2VSSF

Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
b'TYEGRWKTVKVEIEDGIAFVILNRPERRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 95
structure length 246
sequence length 246
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vssF01
2CBYA 3PE8A 1TG6A 4DI1A 3Q1TA 3RSTA 2Q35A 2VSUC 3N6RB 3P5MA 2VSUE 3JU1A 3OMEA 4K3WA 1YG8A 4EMLA 3T89A 2C8TA 3R9TA 2J5II 3QKAA 4MXIA 4EMPA 3GF3A 4KNPA 4YLHA 3V5IA 3MYBA 5FIFA 4ZU2A 2WTBA 3IAVA 2F9IA 2IEXA 5KDRA 2D3TA 4HNKA 1DUBA 4RCNA 5C9GA 2J5GA 2J5IA 2BZRA 1X0UA 4OLQA 3KTGA 3TV5A 3K8XA 3M6MA 2VSSF 4I4ZA 3IB9A 5MGBA 3BEZA 3HINA 4JJTA 3KTJA 3TLFA 4MI2A 1EF8A 3ST9A 4JSBA 4RYFA 3TDCA 5C90A 3ZWCA 3SWXA 5DU8A 2FZSA 2X58A 4MOUA 4JCQA 1DCIA 2F6IA 1XNYA 2A7SA 4JCRA 4U0GH 3H81A 3HP0A 3PZKA 2A7KA 5JBWA 3ZW8A 3QMJA 2VSSA 4KWBA 3TZ3A 2FBMA 3Q7HA 1UIYA 1N6DA 3WG5A 5FUSA 5IKLB 1HNUA 3DJAA 2Q34A 3TVUA 3P85A 4ZDFA 3OT6A 5DZKH 5JBXA 5INGA 5DKPA 4JWVA 4Q1IA 4L6WA 3VIVA 2PBPA 3GMAA 1NZYB 2VSSE 3FDUA 4ZDCA 5E0SA 4FZWA 5DUFA 3GKBA 2F9YA 3ZW9A 4B3HA 1EY3A 5G1SA 5CTCA 4F47A 4B3IA 3SLLA 2FW2A 1Q52A 4Q0GA 1Y7OA 4U18A 3U9RB 1O8UA 3K50A 3T3WA 3KTHA 3GF7A 3IBBA 1XNVA 3R6HA 3NJDA 3I47A 1ON9A 3Q0GA 5DUCA 3M6NA 4NNQA 4FZWC 3NJBA 4FN8A 3FF6A 4QIIA 2VX2A 1UYTA 1N6FA 3GLMA 4K2NA 1FCFA 1TYFA 3RSIA 4FB8A 2F9IB 3G64A 4I52A 5KDRB 1MJ3A 3Q0JA 4JOTA 4G2RA 2PG8A 4U19A 3TT7A 4WYOB 3QYRA 2J5IB 1WZ8A 3BF0A 3T8AA 3LKEA 3HRXA 1RJNA 1EF9A 4B3JA 4I42A 4JCTA 1WDLA 2ZL0A 2X24A 1PIXA 3U9TB 5G1RA 1JXZA 4JCSA 4U1AA 4OG1A 3QREA 1HNOA 4NEKA 2GTRA 2VREA 2DEOA 3STAA 1N6EA 1FC9A 1HZDA 5DL1A 1UYSA 2PPYA 1WDKA 4FN7A 2ZL3A 1UYVA 4EMMA 1XNWA 1UYRA 5KJPA 3QK8A 4RYFH 5INFA 3OC7A 2EJ5A 2Q2XA 4IZCA 1WDMA 2DUBA 3ISAA 4U0GA 5DTPA 2QQ3A 3R9SA 1FC7A 4HC8A 5CTBA 3DORA 3HE2A 3P2LA 4ASIA 3V5EA 3RRVA 3MOYA 4IZBA 3T8BA 3ZWAA 4KPKA 4WCZA 3MT6A 3QXIA 4JVTA 4KD6A 4FJWD 2A81A 4JYLA 2ZL2A 3R0OA 1K32A 2ZL4A 2J5SA 3H0QA 1XX4A 1XO6A 2F9YB 2W3PA 3BPPA 4ELXA 2VSUF 3HLN1 5DZKA 4ELSA 3H0JA 1ON3A 1OD2A 3L3SA 3PGQA 2UZFA 4ZDBA 4QIJA 5DTWA 4FNDA 3U9SB 1SG4A 4IZDA 3KQFA 5DU4A 5E0SH 2J5GD 2ZQRA 3ZWBA 3TT6A 1SZOA 5DU6A 1OD4A 4FNBA 1J7XA 3KTKA 4ZDDA 3QXZA 4GHNA 4QFEA 1K39A 5INIA 3TVWA 1FC6A 4Z0MA 4WZ8B 3PEAA 1VRGA 1RJMA 3H0SA 4K29A 4GM2A 4U0HA 1PJHA 2VSUA 2CE3A 3QWDA 5G1QA 2HW5A 3R9QA 3MFMA 1NZYA 1YG6A 4JFCA 1Q51A 3H02A 4ZDEA 5E0NX 4L8KA 2NP9A 3LAOA 2F6QA 4JYJA 3H0UA 3T88A 1W2XA 4OMRA 4LK5A 2ZQQA 4ELWA 3TRRA 3KTIA
chains in the Genus database with same CATH superfamily
2CBYA 3PE8A 1TG6A 4DI1A 3Q1TA 3RSTA 2Q35A 2VSUC 3N6RB 3P5MA 2VSUE 3JU1A 3OMEA 4K3WA 1YG8A 4EMLA 3T89A 2C8TA 3R9TA 2J5II 3QKAA 4MXIA 4EMPA 3GF3A 4KNPA 4YLHA 3V5IA 3MYBA 5FIFA 4ZU2A 2WTBA 3IAVA 2F9IA 2IEXA 5KDRA 2D3TA 4HNKA 1DUBA 4RCNA 5C9GA 2J5GA 2J5IA 2BZRA 1X0UA 4OLQA 3KTGA 3TV5A 3K8XA 3M6MA 2VSSF 4I4ZA 3IB9A 5MGBA 3BEZA 3HINA 4JJTA 3KTJA 3TLFA 4MI2A 1EF8A 3ST9A 4JSBA 4RYFA 3TDCA 5C90A 3ZWCA 3SWXA 5DU8A 2FZSA 2X58A 4MOUA 4JCQA 1DCIA 2F6IA 1XNYA 2A7SA 4JCRA 4U0GH 3H81A 3HP0A 3PZKA 2A7KA 5JBWA 3ZW8A 3QMJA 2VSSA 4KWBA 3TZ3A 2FBMA 3Q7HA 1UIYA 1N6DA 3WG5A 5FUSA 5IKLB 1HNUA 3DJAA 2Q34A 3TVUA 3P85A 4ZDFA 3OT6A 5DZKH 5JBXA 5INGA 5DKPA 4JWVA 4Q1IA 4L6WA 3VIVA 2PBPA 3GMAA 1NZYB 2VSSE 3FDUA 4ZDCA 5E0SA 4FZWA 5DUFA 3GKBA 2F9YA 3ZW9A 4B3HA 1EY3A 5G1SA 5CTCA 4F47A 4B3IA 3SLLA 2FW2A 1Q52A 4Q0GA 1Y7OA 4U18A 3U9RB 1O8UA 3K50A 3T3WA 3KTHA 3GF7A 3IBBA 1XNVA 3R6HA 3NJDA 3I47A 1ON9A 3Q0GA 3BPTA 5DUCA 3M6NA 4NNQA 4FZWC 3NJBA 4FN8A 3FF6A 4QIIA 2VX2A 1UYTA 1N6FA 3GLMA 4K2NA 1FCFA 1TYFA 3RSIA 4FB8A 2F9IB 3G64A 4I52A 5KDRB 1MJ3A 3Q0JA 4JOTA 4G2RA 2PG8A 4U19A 3TT7A 4WYOB 3QYRA 2J5IB 1WZ8A 3BF0A 3T8AA 3LKEA 3HRXA 1RJNA 1EF9A 4B3JA 4NARA 4I42A 4JCTA 1WDLA 2ZL0A 2X24A 1PIXA 3U9TB 5G1RA 1JXZA 4JCSA 4U1AA 4OG1A 3QREA 1HNOA 4NEKA 2GTRA 2VREA 2DEOA 3STAA 1N6EA 1FC9A 1HZDA 5DL1A 1UYSA 2PPYA 1WDKA 4FN7A 2ZL3A 1UYVA 4EMMA 1XNWA 1UYRA 5KJPA 3QK8A 4RYFH 5INFA 3OC7A 2EJ5A 2Q2XA 4IZCA 1WDMA 2DUBA 3ISAA 4U0GA 5DTPA 2QQ3A 3R9SA 1FC7A 4HC8A 5CTBA 3DORA 3HE2A 3P2LA 4ASIA 4J2UA 3V5EA 3RRVA 3MOYA 4IZBA 3T8BA 3ZWAA 4KPKA 4WCZA 3MT6A 3QXIA 4JVTA 4KD6A 4FJWD 2YJGA 2A81A 4JYLA 2ZL2A 3R0OA 1K32A 2ZL4A 2J5SA 3H0QA 1XX4A 1XO6A 2F9YB 2W3PA 3BPPA 4ELXA 2VSUF 3HLN1 5DZKA 4ELSA 3H0JA 1ON3A 1OD2A 3L3SA 3PGQA 2UZFA 4ZDBA 4QIJA 5DTWA 4FNDA 3U9SB 1SG4A 4IZDA 3KQFA 5DU4A 5E0SH 2J5GD 2ZQRA 3ZWBA 3TT6A 5HUQA 1SZOA 5DU6A 1OD4A 4FNBA 1J7XA 3KTKA 4ZDDA 3QXZA 4GHNA 4QFEA 1K39A 5INIA 3TVWA 1FC6A 4Z0MA 4WZ8B 3PEAA 1VRGA 1RJMA 3H0SA 4K29A 4GM2A 4U0HA 1PJHA 2VSUA 2CE3A 3QWDA 5G1QA 2HW5A 3R9QA 3MFMA 1NZYA 1YG6A 4JFCA 1Q51A 3H02A 4ZDEA 5E0NX 4L8KA 2NP9A 3LAOA 2F6QA 4JYJA 3H0UA 3T88A 1W2XA 4OMRA 4LK5A 4HDTA 2ZQQA 4ELWA 3TRRA 3KTIA
chains in the Genus database with same CATH topology
2CBYA 3PE8A 1TG6A 4DI1A 3Q1TA 3RSTA 2Q35A 2VSUC 3N6RB 3P5MA 2VSUE 3JU1A 3OMEA 4K3WA 1YG8A 4EMLA 3T89A 2C8TA 3R9TA 2J5II 3QKAA 4MXIA 4EMPA 3GF3A 4KNPA 4YLHA 3V5IA 3MYBA 5FIFA 4ZU2A 2WTBA 3IAVA 2F9IA 2IEXA 5KDRA 2D3TA 4HNKA 1DUBA 4RCNA 5C9GA 2J5GA 2J5IA 2BZRA 1X0UA 4OLQA 3KTGA 3TV5A 3K8XA 3M6MA 2VSSF 4I4ZA 3IB9A 5MGBA 3BEZA 3HINA 4JJTA 3KTJA 3TLFA 4MI2A 1EF8A 3ST9A 4JSBA 4RYFA 3TDCA 5C90A 3ZWCA 3SWXA 5DU8A 2FZSA 2X58A 4MOUA 4JCQA 1DCIA 2F6IA 1XNYA 2A7SA 4JCRA 4U0GH 3H81A 3HP0A 3PZKA 2A7KA 5JBWA 3ZW8A 3QMJA 2VSSA 4KWBA 3TZ3A 2FBMA 3Q7HA 1UIYA 1N6DA 3WG5A 5FUSA 5IKLB 1HNUA 3DJAA 2Q34A 3TVUA 3P85A 4ZDFA 3OT6A 5DZKH 5JBXA 5INGA 5DKPA 4JWVA 4Q1IA 4L6WA 3VIVA 2PBPA 3GMAA 1NZYB 2VSSE 3FDUA 4ZDCA 5E0SA 4FZWA 5DUFA 3GKBA 2F9YA 3ZW9A 4B3HA 1EY3A 5G1SA 5CTCA 4F47A 4B3IA 3SLLA 2FW2A 1Q52A 4Q0GA 1Y7OA 4U18A 3U9RB 1O8UA 3K50A 3T3WA 3KTHA 3GF7A 3IBBA 1XNVA 3R6HA 3NJDA 3I47A 1ON9A 3Q0GA 3BPTA 5DUCA 3M6NA 4NNQA 4FZWC 3NJBA 4FN8A 3FF6A 4QIIA 2VX2A 1UYTA 1N6FA 3GLMA 4K2NA 1FCFA 1TYFA 3RSIA 4FB8A 2F9IB 3G64A 4I52A 5KDRB 1MJ3A 3Q0JA 4JOTA 4G2RA 2PG8A 4U19A 3TT7A 4WYOB 3QYRA 2J5IB 1WZ8A 3BF0A 3T8AA 3LKEA 3HRXA 1RJNA 1EF9A 4B3JA 4NARA 4I42A 4JCTA 1WDLA 2ZL0A 2X24A 1PIXA 3U9TB 5G1RA 1JXZA 4JCSA 4U1AA 4OG1A 3QREA 1HNOA 4NEKA 2GTRA 2VREA 2DEOA 3STAA 1N6EA 1FC9A 1HZDA 5DL1A 1UYSA 2PPYA 1WDKA 4FN7A 2ZL3A 1UYVA 4EMMA 1XNWA 1UYRA 5KJPA 3QK8A 4RYFH 5INFA 3OC7A 2EJ5A 2Q2XA 4IZCA 1WDMA 2DUBA 3ISAA 4U0GA 5DTPA 2QQ3A 3R9SA 1FC7A 4HC8A 5CTBA 3DORA 3HE2A 3P2LA 4ASIA 4J2UA 3V5EA 3RRVA 3MOYA 4IZBA 3T8BA 3ZWAA 4KPKA 4WCZA 3MT6A 3QXIA 4JVTA 4KD6A 4FJWD 2YJGA 2A81A 4JYLA 2ZL2A 3R0OA 1K32A 2ZL4A 2J5SA 3H0QA 1XX4A 1XO6A 2F9YB 2W3PA 3BPPA 4ELXA 2VSUF 3HLN1 5DZKA 4ELSA 3H0JA 1ON3A 1OD2A 3L3SA 3PGQA 2UZFA 4ZDBA 4QIJA 5DTWA 4FNDA 3U9SB 1SG4A 4IZDA 3KQFA 5DU4A 5E0SH 2J5GD 2ZQRA 3ZWBA 3TT6A 5HUQA 1SZOA 5DU6A 1OD4A 4FNBA 1J7XA 3KTKA 4ZDDA 3QXZA 4GHNA 4QFEA 1K39A 5INIA 3TVWA 1FC6A 4Z0MA 4WZ8B 3PEAA 1VRGA 1RJMA 3H0SA 4K29A 4GM2A 4U0HA 1PJHA 2VSUA 2CE3A 3QWDA 5G1QA 2HW5A 3R9QA 3MFMA 1NZYA 1YG6A 4JFCA 1Q51A 3H02A 4ZDEA 5E0NX 4L8KA 2NP9A 3LAOA 2F6QA 4JYJA 3H0UA 3T88A 1W2XA 4OMRA 4LK5A 4HDTA 2ZQQA 4ELWA 3TRRA 3KTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBY A;  3PE8 A;  1TG6 A;  4DI1 A;  3Q1T A;  3RST A;  2Q35 A;  2VSU C;  3N6R B;  3P5M A;  2VSU E;  3JU1 A;  3OME A;  4K3W A;  1YG8 A;  4EML A;  3T89 A;  2C8T A;  3R9T A;  2J5I I;  3QKA A;  4MXI A;  4EMP A;  3GF3 A;  4KNP A;  4YLH A;  3V5I A;  3MYB A;  5FIF A;  4ZU2 A;  2WTB A;  3IAV A;  2F9I A;  2IEX A;  5KDR A;  2D3T A;  4HNK A;  1DUB A;  4RCN A;  5C9G A;  2J5G A;  2J5I A;  2BZR A;  1X0U A;  4OLQ A;  3KTG A;  3TV5 A;  3K8X A;  3M6M A;  2VSS F;  4I4Z A;  3IB9 A;  5MGB A;  3BEZ A;  3HIN A;  4JJT A;  3KTJ A;  3TLF A;  4MI2 A;  1EF8 A;  3ST9 A;  4JSB A;  4RYF A;  3TDC A;  5C90 A;  3ZWC A;  3SWX A;  5DU8 A;  2FZS A;  2X58 A;  4MOU A;  4JCQ A;  1DCI A;  2F6I A;  1XNY A;  2A7S A;  4JCR A;  4U0G H;  3H81 A;  3HP0 A;  3PZK A;  2A7K A;  5JBW A;  3ZW8 A;  3QMJ A;  2VSS A;  4KWB A;  3TZ3 A;  2FBM A;  3Q7H A;  1UIY A;  1N6D A;  3WG5 A;  5FUS A;  5IKL B;  1HNU A;  3DJA A;  2Q34 A;  3TVU A;  3P85 A;  4ZDF A;  3OT6 A;  5DZK H;  5JBX A;  5ING A;  5DKP A;  4JWV A;  4Q1I A;  4L6W A;  3VIV A;  2PBP A;  3GMA A;  1NZY B;  2VSS E;  3FDU A;  4ZDC A;  5E0S A;  4FZW A;  5DUF A;  3GKB A;  2F9Y A;  3ZW9 A;  4B3H A;  1EY3 A;  5G1S A;  5CTC A;  4F47 A;  4B3I A;  3SLL A;  2FW2 A;  1Q52 A;  4Q0G A;  1Y7O A;  4U18 A;  3U9R B;  1O8U A;  3K50 A;  3T3W A;  3KTH A;  3GF7 A;  3IBB A;  1XNV A;  3R6H A;  3NJD A;  3I47 A;  1ON9 A;  3Q0G A;  5DUC A;  3M6N A;  4NNQ A;  4FZW C;  3NJB A;  4FN8 A;  3FF6 A;  4QII A;  2VX2 A;  1UYT A;  1N6F A;  3GLM A;  4K2N A;  1FCF A;  1TYF A;  3RSI A;  4FB8 A;  2F9I B;  3G64 A;  4I52 A;  5KDR B;  1MJ3 A;  3Q0J A;  4JOT A;  4G2R A;  2PG8 A;  4U19 A;  3TT7 A;  4WYO B;  3QYR A;  2J5I B;  1WZ8 A;  3BF0 A;  3T8A A;  3LKE A;  3HRX A;  1RJN A;  1EF9 A;  4B3J A;  4I42 A;  4JCT A;  1WDL A;  2ZL0 A;  2X24 A;  1PIX A;  3U9T B;  5G1R A;  1JXZ A;  4JCS A;  4U1A A;  4OG1 A;  3QRE A;  1HNO A;  4NEK A;  2GTR A;  2VRE A;  2DEO A;  3STA A;  1N6E A;  1FC9 A;  1HZD A;  5DL1 A;  1UYS A;  2PPY A;  1WDK A;  4FN7 A;  2ZL3 A;  1UYV A;  4EMM A;  1XNW A;  1UYR A;  5KJP A;  3QK8 A;  4RYF H;  5INF A;  3OC7 A;  2EJ5 A;  2Q2X A;  4IZC A;  1WDM A;  2DUB A;  3ISA A;  4U0G A;  5DTP A;  2QQ3 A;  3R9S A;  1FC7 A;  4HC8 A;  5CTB A;  3DOR A;  3HE2 A;  3P2L A;  4ASI A;  3V5E A;  3RRV A;  3MOY A;  4IZB A;  3T8B A;  3ZWA A;  4KPK A;  4WCZ A;  3MT6 A;  3QXI A;  4JVT A;  4KD6 A;  4FJW D;  2A81 A;  4JYL A;  2ZL2 A;  3R0O A;  1K32 A;  2ZL4 A;  2J5S A;  3H0Q A;  1XX4 A;  1XO6 A;  2F9Y B;  2W3P A;  3BPP A;  4ELX A;  2VSU F;  3HLN 1;  5DZK A;  4ELS A;  3H0J A;  1ON3 A;  1OD2 A;  3L3S A;  3PGQ A;  2UZF A;  4ZDB A;  4QIJ A;  5DTW A;  4FND A;  3U9S B;  1SG4 A;  4IZD A;  3KQF A;  5DU4 A;  5E0S H;  2J5G D;  2ZQR A;  3ZWB A;  3TT6 A;  1SZO A;  5DU6 A;  1OD4 A;  4FNB A;  1J7X A;  3KTK A;  4ZDD A;  3QXZ A;  4GHN A;  4QFE A;  1K39 A;  5INI A;  3TVW A;  1FC6 A;  4Z0M A;  4WZ8 B;  3PEA A;  1VRG A;  1RJM A;  3H0S A;  4K29 A;  4GM2 A;  4U0H A;  1PJH A;  2VSU A;  2CE3 A;  3QWD A;  5G1Q A;  2HW5 A;  3R9Q A;  3MFM A;  1NZY A;  1YG6 A;  4JFC A;  1Q51 A;  3H02 A;  4ZDE A;  5E0N X;  4L8K A;  2NP9 A;  3LAO A;  2F6Q A;  4JYJ A;  3H0U A;  3T88 A;  1W2X A;  4OMR A;  4LK5 A;  2ZQQ A;  4ELW A;  3TRR A;  3KTI A; 
#chains in the Genus database with same CATH topology
 2CBY A;  3PE8 A;  1TG6 A;  4DI1 A;  3Q1T A;  3RST A;  2Q35 A;  2VSU C;  3N6R B;  3P5M A;  2VSU E;  3JU1 A;  3OME A;  4K3W A;  1YG8 A;  4EML A;  3T89 A;  2C8T A;  3R9T A;  2J5I I;  3QKA A;  4MXI A;  4EMP A;  3GF3 A;  4KNP A;  4YLH A;  3V5I A;  3MYB A;  5FIF A;  4ZU2 A;  2WTB A;  3IAV A;  2F9I A;  2IEX A;  5KDR A;  2D3T A;  4HNK A;  1DUB A;  4RCN A;  5C9G A;  2J5G A;  2J5I A;  2BZR A;  1X0U A;  4OLQ A;  3KTG A;  3TV5 A;  3K8X A;  3M6M A;  2VSS F;  4I4Z A;  3IB9 A;  5MGB A;  3BEZ A;  3HIN A;  4JJT A;  3KTJ A;  3TLF A;  4MI2 A;  1EF8 A;  3ST9 A;  4JSB A;  4RYF A;  3TDC A;  5C90 A;  3ZWC A;  3SWX A;  5DU8 A;  2FZS A;  2X58 A;  4MOU A;  4JCQ A;  1DCI A;  2F6I A;  1XNY A;  2A7S A;  4JCR A;  4U0G H;  3H81 A;  3HP0 A;  3PZK A;  2A7K A;  5JBW A;  3ZW8 A;  3QMJ A;  2VSS A;  4KWB A;  3TZ3 A;  2FBM A;  3Q7H A;  1UIY A;  1N6D A;  3WG5 A;  5FUS A;  5IKL B;  1HNU A;  3DJA A;  2Q34 A;  3TVU A;  3P85 A;  4ZDF A;  3OT6 A;  5DZK H;  5JBX A;  5ING A;  5DKP A;  4JWV A;  4Q1I A;  4L6W A;  3VIV A;  2PBP A;  3GMA A;  1NZY B;  2VSS E;  3FDU A;  4ZDC A;  5E0S A;  4FZW A;  5DUF A;  3GKB A;  2F9Y A;  3ZW9 A;  4B3H A;  1EY3 A;  5G1S A;  5CTC A;  4F47 A;  4B3I A;  3SLL A;  2FW2 A;  1Q52 A;  4Q0G A;  1Y7O A;  4U18 A;  3U9R B;  1O8U A;  3K50 A;  3T3W A;  3KTH A;  3GF7 A;  3IBB A;  1XNV A;  3R6H A;  3NJD A;  3I47 A;  1ON9 A;  3Q0G A;  3BPT A;  5DUC A;  3M6N A;  4NNQ A;  4FZW C;  3NJB A;  4FN8 A;  3FF6 A;  4QII A;  2VX2 A;  1UYT A;  1N6F A;  3GLM A;  4K2N A;  1FCF A;  1TYF A;  3RSI A;  4FB8 A;  2F9I B;  3G64 A;  4I52 A;  5KDR B;  1MJ3 A;  3Q0J A;  4JOT A;  4G2R A;  2PG8 A;  4U19 A;  3TT7 A;  4WYO B;  3QYR A;  2J5I B;  1WZ8 A;  3BF0 A;  3T8A A;  3LKE A;  3HRX A;  1RJN A;  1EF9 A;  4B3J A;  4NAR A;  4I42 A;  4JCT A;  1WDL A;  2ZL0 A;  2X24 A;  1PIX A;  3U9T B;  5G1R A;  1JXZ A;  4JCS A;  4U1A A;  4OG1 A;  3QRE A;  1HNO A;  4NEK A;  2GTR A;  2VRE A;  2DEO A;  3STA A;  1N6E A;  1FC9 A;  1HZD A;  5DL1 A;  1UYS A;  2PPY A;  1WDK A;  4FN7 A;  2ZL3 A;  1UYV A;  4EMM A;  1XNW A;  1UYR A;  5KJP A;  3QK8 A;  4RYF H;  5INF A;  3OC7 A;  2EJ5 A;  2Q2X A;  4IZC A;  1WDM A;  2DUB A;  3ISA A;  4U0G A;  5DTP A;  2QQ3 A;  3R9S A;  1FC7 A;  4HC8 A;  5CTB A;  3DOR A;  3HE2 A;  3P2L A;  4ASI A;  4J2U A;  3V5E A;  3RRV A;  3MOY A;  4IZB A;  3T8B A;  3ZWA A;  4KPK A;  4WCZ A;  3MT6 A;  3QXI A;  4JVT A;  4KD6 A;  4FJW D;  2YJG A;  2A81 A;  4JYL A;  2ZL2 A;  3R0O A;  1K32 A;  2ZL4 A;  2J5S A;  3H0Q A;  1XX4 A;  1XO6 A;  2F9Y B;  2W3P A;  3BPP A;  4ELX A;  2VSU F;  3HLN 1;  5DZK A;  4ELS A;  3H0J A;  1ON3 A;  1OD2 A;  3L3S A;  3PGQ A;  2UZF A;  4ZDB A;  4QIJ A;  5DTW A;  4FND A;  3U9S B;  1SG4 A;  4IZD A;  3KQF A;  5DU4 A;  5E0S H;  2J5G D;  2ZQR A;  3ZWB A;  3TT6 A;  5HUQ A;  1SZO A;  5DU6 A;  1OD4 A;  4FNB A;  1J7X A;  3KTK A;  4ZDD A;  3QXZ A;  4GHN A;  4QFE A;  1K39 A;  5INI A;  3TVW A;  1FC6 A;  4Z0M A;  4WZ8 B;  3PEA A;  1VRG A;  1RJM A;  3H0S A;  4K29 A;  4GM2 A;  4U0H A;  1PJH A;  2VSU A;  2CE3 A;  3QWD A;  5G1Q A;  2HW5 A;  3R9Q A;  3MFM A;  1NZY A;  1YG6 A;  4JFC A;  1Q51 A;  3H02 A;  4ZDE A;  5E0N X;  4L8K A;  2NP9 A;  3LAO A;  2F6Q A;  4JYJ A;  3H0U A;  3T88 A;  1W2X A;  4OMR A;  4LK5 A;  4HDT A;  2ZQQ A;  4ELW A;  3TRR A;  3KTI A; 
#chains in the Genus database with same CATH homology
 2CBY A;  3PE8 A;  1TG6 A;  4DI1 A;  3Q1T A;  3RST A;  2Q35 A;  2VSU C;  3N6R B;  3P5M A;  2VSU E;  3JU1 A;  3OME A;  4K3W A;  1YG8 A;  4EML A;  3T89 A;  2C8T A;  3R9T A;  2J5I I;  3QKA A;  4MXI A;  4EMP A;  3GF3 A;  4KNP A;  4YLH A;  3V5I A;  3MYB A;  5FIF A;  4ZU2 A;  2WTB A;  3IAV A;  2F9I A;  2IEX A;  5KDR A;  2D3T A;  4HNK A;  1DUB A;  4RCN A;  5C9G A;  2J5G A;  2J5I A;  2BZR A;  1X0U A;  4OLQ A;  3KTG A;  3TV5 A;  3K8X A;  3M6M A;  2VSS F;  4I4Z A;  3IB9 A;  5MGB A;  3BEZ A;  3HIN A;  4JJT A;  3KTJ A;  3TLF A;  4MI2 A;  1EF8 A;  3ST9 A;  4JSB A;  4RYF A;  3TDC A;  5C90 A;  3ZWC A;  3SWX A;  5DU8 A;  2FZS A;  2X58 A;  4MOU A;  4JCQ A;  1DCI A;  2F6I A;  1XNY A;  2A7S A;  4JCR A;  4U0G H;  3H81 A;  3HP0 A;  3PZK A;  2A7K A;  5JBW A;  3ZW8 A;  3QMJ A;  2VSS A;  4KWB A;  3TZ3 A;  2FBM A;  3Q7H A;  1UIY A;  1N6D A;  3WG5 A;  5FUS A;  5IKL B;  1HNU A;  3DJA A;  2Q34 A;  3TVU A;  3P85 A;  4ZDF A;  3OT6 A;  5DZK H;  5JBX A;  5ING A;  5DKP A;  4JWV A;  4Q1I A;  4L6W A;  3VIV A;  2PBP A;  3GMA A;  1NZY B;  2VSS E;  3FDU A;  4ZDC A;  5E0S A;  4FZW A;  5DUF A;  3GKB A;  2F9Y A;  3ZW9 A;  4B3H A;  1EY3 A;  5G1S A;  5CTC A;  4F47 A;  4B3I A;  3SLL A;  2FW2 A;  1Q52 A;  4Q0G A;  1Y7O A;  4U18 A;  3U9R B;  1O8U A;  3K50 A;  3T3W A;  3KTH A;  3GF7 A;  3IBB A;  1XNV A;  3R6H A;  3NJD A;  3I47 A;  1ON9 A;  3Q0G A;  3BPT A;  5DUC A;  3M6N A;  4NNQ A;  4FZW C;  3NJB A;  4FN8 A;  3FF6 A;  4QII A;  2VX2 A;  1UYT A;  1N6F A;  3GLM A;  4K2N A;  1FCF A;  1TYF A;  3RSI A;  4FB8 A;  2F9I B;  3G64 A;  4I52 A;  5KDR B;  1MJ3 A;  3Q0J A;  4JOT A;  4G2R A;  2PG8 A;  4U19 A;  3TT7 A;  4WYO B;  3QYR A;  2J5I B;  1WZ8 A;  3BF0 A;  3T8A A;  3LKE A;  3HRX A;  1RJN A;  1EF9 A;  4B3J A;  4NAR A;  4I42 A;  4JCT A;  1WDL A;  2ZL0 A;  2X24 A;  1PIX A;  3U9T B;  5G1R A;  1JXZ A;  4JCS A;  4U1A A;  4OG1 A;  3QRE A;  1HNO A;  4NEK A;  2GTR A;  2VRE A;  2DEO A;  3STA A;  1N6E A;  1FC9 A;  1HZD A;  5DL1 A;  1UYS A;  2PPY A;  1WDK A;  4FN7 A;  2ZL3 A;  1UYV A;  4EMM A;  1XNW A;  1UYR A;  5KJP A;  3QK8 A;  4RYF H;  5INF A;  3OC7 A;  2EJ5 A;  2Q2X A;  4IZC A;  1WDM A;  2DUB A;  3ISA A;  4U0G A;  5DTP A;  2QQ3 A;  3R9S A;  1FC7 A;  4HC8 A;  5CTB A;  3DOR A;  3HE2 A;  3P2L A;  4ASI A;  4J2U A;  3V5E A;  3RRV A;  3MOY A;  4IZB A;  3T8B A;  3ZWA A;  4KPK A;  4WCZ A;  3MT6 A;  3QXI A;  4JVT A;  4KD6 A;  4FJW D;  2YJG A;  2A81 A;  4JYL A;  2ZL2 A;  3R0O A;  1K32 A;  2ZL4 A;  2J5S A;  3H0Q A;  1XX4 A;  1XO6 A;  2F9Y B;  2W3P A;  3BPP A;  4ELX A;  2VSU F;  3HLN 1;  5DZK A;  4ELS A;  3H0J A;  1ON3 A;  1OD2 A;  3L3S A;  3PGQ A;  2UZF A;  4ZDB A;  4QIJ A;  5DTW A;  4FND A;  3U9S B;  1SG4 A;  4IZD A;  3KQF A;  5DU4 A;  5E0S H;  2J5G D;  2ZQR A;  3ZWB A;  3TT6 A;  5HUQ A;  1SZO A;  5DU6 A;  1OD4 A;  4FNB A;  1J7X A;  3KTK A;  4ZDD A;  3QXZ A;  4GHN A;  4QFE A;  1K39 A;  5INI A;  3TVW A;  1FC6 A;  4Z0M A;  4WZ8 B;  3PEA A;  1VRG A;  1RJM A;  3H0S A;  4K29 A;  4GM2 A;  4U0H A;  1PJH A;  2VSU A;  2CE3 A;  3QWD A;  5G1Q A;  2HW5 A;  3R9Q A;  3MFM A;  1NZY A;  1YG6 A;  4JFC A;  1Q51 A;  3H02 A;  4ZDE A;  5E0N X;  4L8K A;  2NP9 A;  3LAO A;  2F6Q A;  4JYJ A;  3H0U A;  3T88 A;  1W2X A;  4OMR A;  4LK5 A;  4HDT A;  2ZQQ A;  4ELW A;  3TRR A;  3KTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...