2VSSF

Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
246
Chain Sequence
TYEGRWKTVKVEIEDGIAFVILNRPERRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 95
structure length 246
sequence length 246
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vssF01
1UYVA 4RYFH 1J7XA 3LKEA 3PEAA 3QKAA 4Q0GA 3BF0A 5KJPA 2VSSE 5INFA 1N6DA 3TT7A 4K2NA 4U0GH 3OT6A 3T88A 2X58A 4ELXA 2VX2A 4QIJA 4FN7A 3TRRA 3V5IA 2C8TA 2ZL4A 4OG1A 4G2RA 4GHNA 4KWBA 4IZBA 3R9QA 1XNWA 4ELWA 1WDKA 4HNKA 4JCSA 4MI2A 4ZDBA 4FZWA 4B3IA 2DEOA 4JVTA 5DUFA 3HLN1 3ZWAA 1DUBA 1XNVA 4U19A 2J5GD 4YLHA 5E0NX 3L3SA 3H02A 3K8XA 2F6QA 3KTJA 1Y7OA 4HC8A 4OMRA 5IKLB 2BZRA 1FC9A 5DTPA 3STAA 3QMJA 3M6MA 3GF7A 3LAOA 3HP0A 4JWVA 5INGA 4EMLA 4EMMA 5DZKH 1O8UA 1MJ3A 3G64A 3SWXA 3RSTA 3DJAA 1RJNA 1XO6A 4Q1IA 3MOYA 3GLMA 3TVWA 5JBXA 1ON3A 4L8KA 1NZYA 3P85A 2ZL2A 4KD6A 1EF8A 3U9TB 3OMEA 4I52A 5CTBA 1HNOA 3QXZA 2GTRA 3JU1A 2WTBA 1X0UA 1N6EA 4IZCA 4ZDCA 4FN8A 3MFMA 3TVUA 4RCNA 2VSUF 4NEKA 1WDLA 4IZDA 2NP9A 3HE2A 2Q34A 2VSUA 1HZDA 2ZQRA 5DU8A 5DKPA 4U0GA 4QFEA 2FZSA 2CBYA 2PG8A 3PE8A 1FCFA 2A7SA 3T3WA 4FJWD 5C9GA 1UYSA 1XX4A 5KDRB 4ZU2A 5DL1A 1PJHA 4JJTA 4KPKA 1OD4A 3DORA 1YG8A 1N6FA 4ZDEA 4K29A 3Q0GA 2J5II 2VSUE 3WG5A 5CTCA 5MGBA 3T8BA 3QK8A 3R0OA 1K32A 4K3WA 4FNBA 3R9SA 2F9YB 2HW5A 4JOTA 1UIYA 4NNQA 2VSSA 1FC7A 3M6NA 5DU4A 3P5MA 3R6HA 2PBPA 4FB8A 3ISAA 1XNYA 1PIXA 1UYTA 5G1SA 4MOUA 3U9SB 3SLLA 4MXIA 3HINA 5KDRA 3TZ3A 4ELSA 2J5GA 2QQ3A 3BEZA 5E0SA 3GKBA 4B3JA 3H0UA 1RJMA 4KNPA 3VIVA 4GM2A 1HNUA 2W3PA 3ZW9A 3H0SA 5JBWA 4B3HA 1EY3A 3KTKA 4JFCA 2F9IB 3ZWBA 5DZKA 4JYLA 2F9YA 3KTIA 3HRXA 1OD2A 4EMPA 2VSSF 3I47A 4F47A 3ST9A 4WYOB 4QIIA 4ASIA 2ZQQA 3K50A 2FBMA 3IBBA 4I42A 2VREA 4JCTA 4WZ8B 1VRGA 3N6RB 2CE3A 4ZDFA 2J5SA 2DUBA 4RYFA 1UYRA 2FW2A 4U0HA 1K39A 3KTHA 4FNDA 1TG6A 3MT6A 3Q7HA 4ZDDA 3TDCA 2ZL0A 2UZFA 1FC6A 4WCZA 4JCQA 1EF9A 3QREA 3QXIA 3FF6A 5DUCA 3QWDA 3V5EA 3OC7A 4L6WA 4JSBA 2VSUC 5INIA 1TYFA 3TT6A 5DU6A 3T8AA 4LK5A 2A7KA 5FUSA 4FZWC 4JYJA 2Q35A 3ZW8A 2F9IA 2ZL3A 3H0JA 1Q52A 5DTWA 3RRVA 1YG6A 2Q2XA 4U1AA 4OLQA 1NZYB 4DI1A 3U9RB 2EJ5A 3T89A 1WDMA 5C90A 4U18A 3ZWCA 2A81A 3QYRA 3H81A 3KTGA 3PGQA 1W2XA 1Q51A 2J5IB 4I4ZA 2X24A 5G1QA 3H0QA 4JCRA 5E0SH 1ON9A 5G1RA 2PPYA 3TV5A 3IB9A 1SG4A 3MYBA 2J5IA 1WZ8A 3P2LA 1DCIA 2D3TA 3GF3A 1JXZA 3FDUA 3PZKA 2IEXA 3RSIA 3Q0JA 2F6IA 3KQFA 4Z0MA 3BPPA 5FIFA 3NJDA 3IAVA 1SZOA 3NJBA 3Q1TA 3GMAA 3R9TA 3TLFA
chains in the Genus database with same CATH superfamily
1UYVA 4RYFH 1J7XA 3LKEA 3PEAA 3QKAA 4Q0GA 3BF0A 5KJPA 2VSSE 5INFA 1N6DA 3TT7A 4K2NA 4U0GH 3OT6A 3T88A 2X58A 4ELXA 2VX2A 4QIJA 4FN7A 3TRRA 3V5IA 2C8TA 2ZL4A 4OG1A 4G2RA 4GHNA 4KWBA 4IZBA 3R9QA 1XNWA 4ELWA 1WDKA 4HNKA 4JCSA 4MI2A 4ZDBA 4FZWA 4B3IA 2DEOA 4JVTA 5DUFA 3HLN1 3ZWAA 1DUBA 1XNVA 4U19A 2J5GD 4YLHA 5E0NX 3L3SA 3H02A 3K8XA 2F6QA 3KTJA 1Y7OA 4HC8A 3BPTA 4OMRA 5IKLB 2BZRA 1FC9A 5DTPA 3STAA 3QMJA 3M6MA 3GF7A 3LAOA 3HP0A 4JWVA 5INGA 4EMLA 4EMMA 5DZKH 1O8UA 1MJ3A 3G64A 3SWXA 3RSTA 3DJAA 1RJNA 1XO6A 4Q1IA 3MOYA 3GLMA 3TVWA 5JBXA 1ON3A 4L8KA 1NZYA 3P85A 2ZL2A 4KD6A 1EF8A 3U9TB 3OMEA 4I52A 5CTBA 1HNOA 3QXZA 2GTRA 3JU1A 2WTBA 1X0UA 1N6EA 4IZCA 4ZDCA 4FN8A 3MFMA 3TVUA 4RCNA 2VSUF 4NEKA 1WDLA 4IZDA 2NP9A 3HE2A 2Q34A 2VSUA 1HZDA 2ZQRA 5DU8A 5DKPA 4U0GA 4QFEA 2FZSA 2CBYA 2PG8A 3PE8A 1FCFA 2A7SA 3T3WA 4FJWD 5C9GA 1UYSA 1XX4A 5KDRB 4ZU2A 5DL1A 1PJHA 4JJTA 4KPKA 1OD4A 3DORA 1YG8A 1N6FA 4ZDEA 4K29A 3Q0GA 2J5II 2VSUE 3WG5A 5CTCA 5MGBA 3T8BA 3QK8A 3R0OA 1K32A 4K3WA 4FNBA 3R9SA 2F9YB 2HW5A 4JOTA 1UIYA 4NNQA 2VSSA 1FC7A 3M6NA 5DU4A 3P5MA 3R6HA 2PBPA 4FB8A 3ISAA 1XNYA 1PIXA 4J2UA 1UYTA 5G1SA 4MOUA 3U9SB 3SLLA 4MXIA 3HINA 5KDRA 3TZ3A 4ELSA 2J5GA 2QQ3A 3BEZA 5E0SA 3GKBA 4B3JA 3H0UA 1RJMA 4KNPA 3VIVA 5HUQA 4GM2A 1HNUA 2W3PA 3ZW9A 3H0SA 5JBWA 4B3HA 4NARA 1EY3A 3KTKA 4JFCA 2F9IB 3ZWBA 5DZKA 4JYLA 2F9YA 3KTIA 3HRXA 1OD2A 4EMPA 2VSSF 3I47A 4F47A 3ST9A 4WYOB 4QIIA 4ASIA 2ZQQA 3K50A 2FBMA 3IBBA 4I42A 2VREA 4JCTA 4WZ8B 1VRGA 3N6RB 2CE3A 4ZDFA 2J5SA 2DUBA 4RYFA 1UYRA 2FW2A 4U0HA 1K39A 3KTHA 4FNDA 1TG6A 3MT6A 3Q7HA 4ZDDA 3TDCA 2ZL0A 2UZFA 1FC6A 4WCZA 4JCQA 1EF9A 3QREA 3QXIA 3FF6A 5DUCA 3V5EA 3QWDA 3OC7A 2YJGA 4L6WA 4JSBA 2VSUC 5INIA 1TYFA 3TT6A 5DU6A 3T8AA 4LK5A 2A7KA 5FUSA 4FZWC 4JYJA 2Q35A 3ZW8A 2F9IA 2ZL3A 3H0JA 1Q52A 5DTWA 3RRVA 1YG6A 2Q2XA 4U1AA 4OLQA 1NZYB 4DI1A 3U9RB 2EJ5A 3T89A 1WDMA 5C90A 4U18A 3ZWCA 2A81A 3QYRA 3H81A 3KTGA 3PGQA 1W2XA 1Q51A 2J5IB 4I4ZA 2X24A 5G1QA 3H0QA 4JCRA 5E0SH 1ON9A 5G1RA 2PPYA 3TV5A 3IB9A 1SG4A 3MYBA 2J5IA 1WZ8A 3P2LA 1DCIA 2D3TA 4HDTA 3GF3A 1JXZA 3FDUA 3PZKA 2IEXA 3RSIA 3Q0JA 2F6IA 3KQFA 4Z0MA 3BPPA 5FIFA 3NJDA 3IAVA 1SZOA 3NJBA 3Q1TA 3GMAA 3R9TA 3TLFA
chains in the Genus database with same CATH topology
1UYVA 4RYFH 1J7XA 3LKEA 3PEAA 3QKAA 4Q0GA 3BF0A 5KJPA 2VSSE 5INFA 1N6DA 3TT7A 4K2NA 4U0GH 3OT6A 3T88A 2X58A 4ELXA 2VX2A 4QIJA 4FN7A 3TRRA 3V5IA 2C8TA 2ZL4A 4OG1A 4G2RA 4GHNA 4KWBA 4IZBA 3R9QA 1XNWA 4ELWA 1WDKA 4HNKA 4JCSA 4MI2A 4ZDBA 4FZWA 4B3IA 2DEOA 4JVTA 5DUFA 3HLN1 3ZWAA 1DUBA 1XNVA 4U19A 2J5GD 4YLHA 5E0NX 3L3SA 3H02A 3K8XA 2F6QA 3KTJA 1Y7OA 4HC8A 3BPTA 4OMRA 5IKLB 2BZRA 1FC9A 5DTPA 3STAA 3QMJA 3M6MA 3GF7A 3LAOA 3HP0A 4JWVA 5INGA 4EMLA 4EMMA 5DZKH 1O8UA 1MJ3A 3G64A 3SWXA 3RSTA 3DJAA 1RJNA 1XO6A 4Q1IA 3MOYA 3GLMA 3TVWA 5JBXA 1ON3A 4L8KA 1NZYA 3P85A 2ZL2A 4KD6A 1EF8A 3U9TB 3OMEA 4I52A 5CTBA 1HNOA 3QXZA 2GTRA 3JU1A 2WTBA 1X0UA 1N6EA 4IZCA 4ZDCA 4FN8A 3MFMA 3TVUA 4RCNA 2VSUF 4NEKA 1WDLA 4IZDA 2NP9A 3HE2A 2Q34A 2VSUA 1HZDA 2ZQRA 5DU8A 5DKPA 4U0GA 4QFEA 2FZSA 2CBYA 2PG8A 3PE8A 1FCFA 2A7SA 3T3WA 4FJWD 5C9GA 1UYSA 1XX4A 5KDRB 4ZU2A 5DL1A 1PJHA 4JJTA 4KPKA 1OD4A 3DORA 1YG8A 1N6FA 4ZDEA 4K29A 3Q0GA 2J5II 2VSUE 3WG5A 5CTCA 5MGBA 3T8BA 3QK8A 3R0OA 1K32A 4K3WA 4FNBA 3R9SA 2F9YB 2HW5A 4JOTA 1UIYA 4NNQA 2VSSA 1FC7A 3M6NA 5DU4A 3P5MA 3R6HA 2PBPA 4FB8A 3ISAA 1XNYA 1PIXA 4J2UA 1UYTA 5G1SA 4MOUA 3U9SB 3SLLA 4MXIA 3HINA 5KDRA 3TZ3A 4ELSA 2J5GA 2QQ3A 3BEZA 5E0SA 3GKBA 4B3JA 3H0UA 1RJMA 4KNPA 3VIVA 5HUQA 4GM2A 1HNUA 2W3PA 3ZW9A 3H0SA 5JBWA 4B3HA 4NARA 1EY3A 3KTKA 4JFCA 2F9IB 3ZWBA 5DZKA 4JYLA 2F9YA 3KTIA 3HRXA 1OD2A 4EMPA 2VSSF 3I47A 4F47A 3ST9A 4WYOB 4QIIA 4ASIA 2ZQQA 3K50A 2FBMA 3IBBA 4I42A 2VREA 4JCTA 4WZ8B 1VRGA 3N6RB 2CE3A 4ZDFA 2J5SA 2DUBA 4RYFA 1UYRA 2FW2A 4U0HA 1K39A 3KTHA 4FNDA 1TG6A 3MT6A 3Q7HA 4ZDDA 3TDCA 2ZL0A 2UZFA 1FC6A 4WCZA 4JCQA 1EF9A 3QREA 3QXIA 3FF6A 5DUCA 3V5EA 3QWDA 3OC7A 2YJGA 4L6WA 4JSBA 2VSUC 5INIA 1TYFA 3TT6A 5DU6A 3T8AA 4LK5A 2A7KA 5FUSA 4FZWC 4JYJA 2Q35A 3ZW8A 2F9IA 2ZL3A 3H0JA 1Q52A 5DTWA 3RRVA 1YG6A 2Q2XA 4U1AA 4OLQA 1NZYB 4DI1A 3U9RB 2EJ5A 3T89A 1WDMA 5C90A 4U18A 3ZWCA 2A81A 3QYRA 3H81A 3KTGA 3PGQA 1W2XA 1Q51A 2J5IB 4I4ZA 2X24A 5G1QA 3H0QA 4JCRA 5E0SH 1ON9A 5G1RA 2PPYA 3TV5A 3IB9A 1SG4A 3MYBA 2J5IA 1WZ8A 3P2LA 1DCIA 2D3TA 4HDTA 3GF3A 1JXZA 3FDUA 3PZKA 2IEXA 3RSIA 3Q0JA 2F6IA 3KQFA 4Z0MA 3BPPA 5FIFA 3NJDA 3IAVA 1SZOA 3NJBA 3Q1TA 3GMAA 3R9TA 3TLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYV A;  4RYF H;  1J7X A;  3LKE A;  3PEA A;  3QKA A;  4Q0G A;  3BF0 A;  5KJP A;  2VSS E;  5INF A;  1N6D A;  3TT7 A;  4K2N A;  4U0G H;  3OT6 A;  3T88 A;  2X58 A;  4ELX A;  2VX2 A;  4QIJ A;  4FN7 A;  3TRR A;  3V5I A;  2C8T A;  2ZL4 A;  4OG1 A;  4G2R A;  4GHN A;  4KWB A;  4IZB A;  3R9Q A;  1XNW A;  4ELW A;  1WDK A;  4HNK A;  4JCS A;  4MI2 A;  4ZDB A;  4FZW A;  4B3I A;  2DEO A;  4JVT A;  5DUF A;  3HLN 1;  3ZWA A;  1DUB A;  1XNV A;  4U19 A;  2J5G D;  4YLH A;  5E0N X;  3L3S A;  3H02 A;  3K8X A;  2F6Q A;  3KTJ A;  1Y7O A;  4HC8 A;  4OMR A;  5IKL B;  2BZR A;  1FC9 A;  5DTP A;  3STA A;  3QMJ A;  3M6M A;  3GF7 A;  3LAO A;  3HP0 A;  4JWV A;  5ING A;  4EML A;  4EMM A;  5DZK H;  1O8U A;  1MJ3 A;  3G64 A;  3SWX A;  3RST A;  3DJA A;  1RJN A;  1XO6 A;  4Q1I A;  3MOY A;  3GLM A;  3TVW A;  5JBX A;  1ON3 A;  4L8K A;  1NZY A;  3P85 A;  2ZL2 A;  4KD6 A;  1EF8 A;  3U9T B;  3OME A;  4I52 A;  5CTB A;  1HNO A;  3QXZ A;  2GTR A;  3JU1 A;  2WTB A;  1X0U A;  1N6E A;  4IZC A;  4ZDC A;  4FN8 A;  3MFM A;  3TVU A;  4RCN A;  2VSU F;  4NEK A;  1WDL A;  4IZD A;  2NP9 A;  3HE2 A;  2Q34 A;  2VSU A;  1HZD A;  2ZQR A;  5DU8 A;  5DKP A;  4U0G A;  4QFE A;  2FZS A;  2CBY A;  2PG8 A;  3PE8 A;  1FCF A;  2A7S A;  3T3W A;  4FJW D;  5C9G A;  1UYS A;  1XX4 A;  5KDR B;  4ZU2 A;  5DL1 A;  1PJH A;  4JJT A;  4KPK A;  1OD4 A;  3DOR A;  1YG8 A;  1N6F A;  4ZDE A;  4K29 A;  3Q0G A;  2J5I I;  2VSU E;  3WG5 A;  5CTC A;  5MGB A;  3T8B A;  3QK8 A;  3R0O A;  1K32 A;  4K3W A;  4FNB A;  3R9S A;  2F9Y B;  2HW5 A;  4JOT A;  1UIY A;  4NNQ A;  2VSS A;  1FC7 A;  3M6N A;  5DU4 A;  3P5M A;  3R6H A;  2PBP A;  4FB8 A;  3ISA A;  1XNY A;  1PIX A;  1UYT A;  5G1S A;  4MOU A;  3U9S B;  3SLL A;  4MXI A;  3HIN A;  5KDR A;  3TZ3 A;  4ELS A;  2J5G A;  2QQ3 A;  3BEZ A;  5E0S A;  3GKB A;  4B3J A;  3H0U A;  1RJM A;  4KNP A;  3VIV A;  4GM2 A;  1HNU A;  2W3P A;  3ZW9 A;  3H0S A;  5JBW A;  4B3H A;  1EY3 A;  3KTK A;  4JFC A;  2F9I B;  3ZWB A;  5DZK A;  4JYL A;  2F9Y A;  3KTI A;  3HRX A;  1OD2 A;  4EMP A;  2VSS F;  3I47 A;  4F47 A;  3ST9 A;  4WYO B;  4QII A;  4ASI A;  2ZQQ A;  3K50 A;  2FBM A;  3IBB A;  4I42 A;  2VRE A;  4JCT A;  4WZ8 B;  1VRG A;  3N6R B;  2CE3 A;  4ZDF A;  2J5S A;  2DUB A;  4RYF A;  1UYR A;  2FW2 A;  4U0H A;  1K39 A;  3KTH A;  4FND A;  1TG6 A;  3MT6 A;  3Q7H A;  4ZDD A;  3TDC A;  2ZL0 A;  2UZF A;  1FC6 A;  4WCZ A;  4JCQ A;  1EF9 A;  3QRE A;  3QXI A;  3FF6 A;  5DUC A;  3QWD A;  3V5E A;  3OC7 A;  4L6W A;  4JSB A;  2VSU C;  5INI A;  1TYF A;  3TT6 A;  5DU6 A;  3T8A A;  4LK5 A;  2A7K A;  5FUS A;  4FZW C;  4JYJ A;  2Q35 A;  3ZW8 A;  2F9I A;  2ZL3 A;  3H0J A;  1Q52 A;  5DTW A;  3RRV A;  1YG6 A;  2Q2X A;  4U1A A;  4OLQ A;  1NZY B;  4DI1 A;  3U9R B;  2EJ5 A;  3T89 A;  1WDM A;  5C90 A;  4U18 A;  3ZWC A;  2A81 A;  3QYR A;  3H81 A;  3KTG A;  3PGQ A;  1W2X A;  1Q51 A;  2J5I B;  4I4Z A;  2X24 A;  5G1Q A;  3H0Q A;  4JCR A;  5E0S H;  1ON9 A;  5G1R A;  2PPY A;  3TV5 A;  3IB9 A;  1SG4 A;  3MYB A;  2J5I A;  1WZ8 A;  3P2L A;  1DCI A;  2D3T A;  3GF3 A;  1JXZ A;  3FDU A;  3PZK A;  2IEX A;  3RSI A;  3Q0J A;  2F6I A;  3KQF A;  4Z0M A;  3BPP A;  5FIF A;  3NJD A;  3IAV A;  1SZO A;  3NJB A;  3Q1T A;  3GMA A;  3R9T A;  3TLF A; 
#chains in the Genus database with same CATH topology
 1UYV A;  4RYF H;  1J7X A;  3LKE A;  3PEA A;  3QKA A;  4Q0G A;  3BF0 A;  5KJP A;  2VSS E;  5INF A;  1N6D A;  3TT7 A;  4K2N A;  4U0G H;  3OT6 A;  3T88 A;  2X58 A;  4ELX A;  2VX2 A;  4QIJ A;  4FN7 A;  3TRR A;  3V5I A;  2C8T A;  2ZL4 A;  4OG1 A;  4G2R A;  4GHN A;  4KWB A;  4IZB A;  3R9Q A;  1XNW A;  4ELW A;  1WDK A;  4HNK A;  4JCS A;  4MI2 A;  4ZDB A;  4FZW A;  4B3I A;  2DEO A;  4JVT A;  5DUF A;  3HLN 1;  3ZWA A;  1DUB A;  1XNV A;  4U19 A;  2J5G D;  4YLH A;  5E0N X;  3L3S A;  3H02 A;  3K8X A;  2F6Q A;  3KTJ A;  1Y7O A;  4HC8 A;  3BPT A;  4OMR A;  5IKL B;  2BZR A;  1FC9 A;  5DTP A;  3STA A;  3QMJ A;  3M6M A;  3GF7 A;  3LAO A;  3HP0 A;  4JWV A;  5ING A;  4EML A;  4EMM A;  5DZK H;  1O8U A;  1MJ3 A;  3G64 A;  3SWX A;  3RST A;  3DJA A;  1RJN A;  1XO6 A;  4Q1I A;  3MOY A;  3GLM A;  3TVW A;  5JBX A;  1ON3 A;  4L8K A;  1NZY A;  3P85 A;  2ZL2 A;  4KD6 A;  1EF8 A;  3U9T B;  3OME A;  4I52 A;  5CTB A;  1HNO A;  3QXZ A;  2GTR A;  3JU1 A;  2WTB A;  1X0U A;  1N6E A;  4IZC A;  4ZDC A;  4FN8 A;  3MFM A;  3TVU A;  4RCN A;  2VSU F;  4NEK A;  1WDL A;  4IZD A;  2NP9 A;  3HE2 A;  2Q34 A;  2VSU A;  1HZD A;  2ZQR A;  5DU8 A;  5DKP A;  4U0G A;  4QFE A;  2FZS A;  2CBY A;  2PG8 A;  3PE8 A;  1FCF A;  2A7S A;  3T3W A;  4FJW D;  5C9G A;  1UYS A;  1XX4 A;  5KDR B;  4ZU2 A;  5DL1 A;  1PJH A;  4JJT A;  4KPK A;  1OD4 A;  3DOR A;  1YG8 A;  1N6F A;  4ZDE A;  4K29 A;  3Q0G A;  2J5I I;  2VSU E;  3WG5 A;  5CTC A;  5MGB A;  3T8B A;  3QK8 A;  3R0O A;  1K32 A;  4K3W A;  4FNB A;  3R9S A;  2F9Y B;  2HW5 A;  4JOT A;  1UIY A;  4NNQ A;  2VSS A;  1FC7 A;  3M6N A;  5DU4 A;  3P5M A;  3R6H A;  2PBP A;  4FB8 A;  3ISA A;  1XNY A;  1PIX A;  4J2U A;  1UYT A;  5G1S A;  4MOU A;  3U9S B;  3SLL A;  4MXI A;  3HIN A;  5KDR A;  3TZ3 A;  4ELS A;  2J5G A;  2QQ3 A;  3BEZ A;  5E0S A;  3GKB A;  4B3J A;  3H0U A;  1RJM A;  4KNP A;  3VIV A;  5HUQ A;  4GM2 A;  1HNU A;  2W3P A;  3ZW9 A;  3H0S A;  5JBW A;  4B3H A;  4NAR A;  1EY3 A;  3KTK A;  4JFC A;  2F9I B;  3ZWB A;  5DZK A;  4JYL A;  2F9Y A;  3KTI A;  3HRX A;  1OD2 A;  4EMP A;  2VSS F;  3I47 A;  4F47 A;  3ST9 A;  4WYO B;  4QII A;  4ASI A;  2ZQQ A;  3K50 A;  2FBM A;  3IBB A;  4I42 A;  2VRE A;  4JCT A;  4WZ8 B;  1VRG A;  3N6R B;  2CE3 A;  4ZDF A;  2J5S A;  2DUB A;  4RYF A;  1UYR A;  2FW2 A;  4U0H A;  1K39 A;  3KTH A;  4FND A;  1TG6 A;  3MT6 A;  3Q7H A;  4ZDD A;  3TDC A;  2ZL0 A;  2UZF A;  1FC6 A;  4WCZ A;  4JCQ A;  1EF9 A;  3QRE A;  3QXI A;  3FF6 A;  5DUC A;  3V5E A;  3QWD A;  3OC7 A;  2YJG A;  4L6W A;  4JSB A;  2VSU C;  5INI A;  1TYF A;  3TT6 A;  5DU6 A;  3T8A A;  4LK5 A;  2A7K A;  5FUS A;  4FZW C;  4JYJ A;  2Q35 A;  3ZW8 A;  2F9I A;  2ZL3 A;  3H0J A;  1Q52 A;  5DTW A;  3RRV A;  1YG6 A;  2Q2X A;  4U1A A;  4OLQ A;  1NZY B;  4DI1 A;  3U9R B;  2EJ5 A;  3T89 A;  1WDM A;  5C90 A;  4U18 A;  3ZWC A;  2A81 A;  3QYR A;  3H81 A;  3KTG A;  3PGQ A;  1W2X A;  1Q51 A;  2J5I B;  4I4Z A;  2X24 A;  5G1Q A;  3H0Q A;  4JCR A;  5E0S H;  1ON9 A;  5G1R A;  2PPY A;  3TV5 A;  3IB9 A;  1SG4 A;  3MYB A;  2J5I A;  1WZ8 A;  3P2L A;  1DCI A;  2D3T A;  4HDT A;  3GF3 A;  1JXZ A;  3FDU A;  3PZK A;  2IEX A;  3RSI A;  3Q0J A;  2F6I A;  3KQF A;  4Z0M A;  3BPP A;  5FIF A;  3NJD A;  3IAV A;  1SZO A;  3NJB A;  3Q1T A;  3GMA A;  3R9T A;  3TLF A; 
#chains in the Genus database with same CATH homology
 1UYV A;  4RYF H;  1J7X A;  3LKE A;  3PEA A;  3QKA A;  4Q0G A;  3BF0 A;  5KJP A;  2VSS E;  5INF A;  1N6D A;  3TT7 A;  4K2N A;  4U0G H;  3OT6 A;  3T88 A;  2X58 A;  4ELX A;  2VX2 A;  4QIJ A;  4FN7 A;  3TRR A;  3V5I A;  2C8T A;  2ZL4 A;  4OG1 A;  4G2R A;  4GHN A;  4KWB A;  4IZB A;  3R9Q A;  1XNW A;  4ELW A;  1WDK A;  4HNK A;  4JCS A;  4MI2 A;  4ZDB A;  4FZW A;  4B3I A;  2DEO A;  4JVT A;  5DUF A;  3HLN 1;  3ZWA A;  1DUB A;  1XNV A;  4U19 A;  2J5G D;  4YLH A;  5E0N X;  3L3S A;  3H02 A;  3K8X A;  2F6Q A;  3KTJ A;  1Y7O A;  4HC8 A;  3BPT A;  4OMR A;  5IKL B;  2BZR A;  1FC9 A;  5DTP A;  3STA A;  3QMJ A;  3M6M A;  3GF7 A;  3LAO A;  3HP0 A;  4JWV A;  5ING A;  4EML A;  4EMM A;  5DZK H;  1O8U A;  1MJ3 A;  3G64 A;  3SWX A;  3RST A;  3DJA A;  1RJN A;  1XO6 A;  4Q1I A;  3MOY A;  3GLM A;  3TVW A;  5JBX A;  1ON3 A;  4L8K A;  1NZY A;  3P85 A;  2ZL2 A;  4KD6 A;  1EF8 A;  3U9T B;  3OME A;  4I52 A;  5CTB A;  1HNO A;  3QXZ A;  2GTR A;  3JU1 A;  2WTB A;  1X0U A;  1N6E A;  4IZC A;  4ZDC A;  4FN8 A;  3MFM A;  3TVU A;  4RCN A;  2VSU F;  4NEK A;  1WDL A;  4IZD A;  2NP9 A;  3HE2 A;  2Q34 A;  2VSU A;  1HZD A;  2ZQR A;  5DU8 A;  5DKP A;  4U0G A;  4QFE A;  2FZS A;  2CBY A;  2PG8 A;  3PE8 A;  1FCF A;  2A7S A;  3T3W A;  4FJW D;  5C9G A;  1UYS A;  1XX4 A;  5KDR B;  4ZU2 A;  5DL1 A;  1PJH A;  4JJT A;  4KPK A;  1OD4 A;  3DOR A;  1YG8 A;  1N6F A;  4ZDE A;  4K29 A;  3Q0G A;  2J5I I;  2VSU E;  3WG5 A;  5CTC A;  5MGB A;  3T8B A;  3QK8 A;  3R0O A;  1K32 A;  4K3W A;  4FNB A;  3R9S A;  2F9Y B;  2HW5 A;  4JOT A;  1UIY A;  4NNQ A;  2VSS A;  1FC7 A;  3M6N A;  5DU4 A;  3P5M A;  3R6H A;  2PBP A;  4FB8 A;  3ISA A;  1XNY A;  1PIX A;  4J2U A;  1UYT A;  5G1S A;  4MOU A;  3U9S B;  3SLL A;  4MXI A;  3HIN A;  5KDR A;  3TZ3 A;  4ELS A;  2J5G A;  2QQ3 A;  3BEZ A;  5E0S A;  3GKB A;  4B3J A;  3H0U A;  1RJM A;  4KNP A;  3VIV A;  5HUQ A;  4GM2 A;  1HNU A;  2W3P A;  3ZW9 A;  3H0S A;  5JBW A;  4B3H A;  4NAR A;  1EY3 A;  3KTK A;  4JFC A;  2F9I B;  3ZWB A;  5DZK A;  4JYL A;  2F9Y A;  3KTI A;  3HRX A;  1OD2 A;  4EMP A;  2VSS F;  3I47 A;  4F47 A;  3ST9 A;  4WYO B;  4QII A;  4ASI A;  2ZQQ A;  3K50 A;  2FBM A;  3IBB A;  4I42 A;  2VRE A;  4JCT A;  4WZ8 B;  1VRG A;  3N6R B;  2CE3 A;  4ZDF A;  2J5S A;  2DUB A;  4RYF A;  1UYR A;  2FW2 A;  4U0H A;  1K39 A;  3KTH A;  4FND A;  1TG6 A;  3MT6 A;  3Q7H A;  4ZDD A;  3TDC A;  2ZL0 A;  2UZF A;  1FC6 A;  4WCZ A;  4JCQ A;  1EF9 A;  3QRE A;  3QXI A;  3FF6 A;  5DUC A;  3V5E A;  3QWD A;  3OC7 A;  2YJG A;  4L6W A;  4JSB A;  2VSU C;  5INI A;  1TYF A;  3TT6 A;  5DU6 A;  3T8A A;  4LK5 A;  2A7K A;  5FUS A;  4FZW C;  4JYJ A;  2Q35 A;  3ZW8 A;  2F9I A;  2ZL3 A;  3H0J A;  1Q52 A;  5DTW A;  3RRV A;  1YG6 A;  2Q2X A;  4U1A A;  4OLQ A;  1NZY B;  4DI1 A;  3U9R B;  2EJ5 A;  3T89 A;  1WDM A;  5C90 A;  4U18 A;  3ZWC A;  2A81 A;  3QYR A;  3H81 A;  3KTG A;  3PGQ A;  1W2X A;  1Q51 A;  2J5I B;  4I4Z A;  2X24 A;  5G1Q A;  3H0Q A;  4JCR A;  5E0S H;  1ON9 A;  5G1R A;  2PPY A;  3TV5 A;  3IB9 A;  1SG4 A;  3MYB A;  2J5I A;  1WZ8 A;  3P2L A;  1DCI A;  2D3T A;  4HDT A;  3GF3 A;  1JXZ A;  3FDU A;  3PZK A;  2IEX A;  3RSI A;  3Q0J A;  2F6I A;  3KQF A;  4Z0M A;  3BPP A;  5FIF A;  3NJD A;  3IAV A;  1SZO A;  3NJB A;  3Q1T A;  3GMA A;  3R9T A;  3TLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...