2VSUF

A ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
245
structure length
245
Chain Sequence
YEGRWKTVKVEIEDGIAFVILNRPERRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 97
structure length 245
sequence length 245
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vsuF01
1ON9A 5E0SH 2EJ5A 5CTBA 5KDRB 4EMLA 4ZDDA 4OG1A 2DUBA 3V5EA 5JBXA 3ZWAA 1JXZA 3P2LA 4FJWD 1XX4A 4WYOB 5G1QA 4I42A 4NNQA 3HRXA 2VX2A 3U9TB 1XNVA 1Y7OA 4ZDFA 5DTWA 3H0UA 3KTJA 4JJTA 4K29A 4G2RA 2D3TA 3QK8A 4RCNA 2A7KA 4I52A 4ZDCA 3SWXA 2ZL4A 3BF0A 3MOYA 1EF9A 1K32A 5DU6A 1DUBA 2ZL3A 3T8AA 2BZRA 2X24A 1UYVA 2ZL2A 1EF8A 3RSIA 3PEAA 1HNOA 2PPYA 1FCFA 4JFCA 4KPKA 2J5GA 3Q1TA 4B3JA 3OMEA 2PBPA 3LAOA 1WDLA 3NJDA 4FNBA 2W3PA 5DUFA 4WZ8B 1SZOA 3ST9A 3TV5A 5G1RA 3H0SA 3L3SA 1XNYA 3T3WA 3GF7A 3TZ3A 3QREA 2HW5A 4U19A 3ZWBA 2DEOA 3H02A 1XNWA 4ZDEA 1PIXA 1SG4A 1VRGA 3P85A 4JWVA 5CTCA 4RYFH 5DTPA 4OLQA 1NZYB 4RYFA 2UZFA 5MGBA 2VSUF 4U1AA 3MYBA 2A81A 3K50A 2ZQQA 4LK5A 2ZQRA 5INIA 4B3IA 3T89A 1FC6A 2FW2A 3TT7A 3MT6A 4F47A 3HLN1 4ZU2A 4MXIA 4MI2A 3KTIA 1FC7A 4FB8A 3ISAA 3DORA 1UYTA 2VSSF 2NP9A 3IBBA 3RRVA 2VSUE 4FN8A 3KQFA 3GF3A 3QXIA 1DCIA 5DU4A 4ZDBA 4HNKA 5C9GA 2J5IA 1FC9A 3K8XA 3H81A 3QKAA 5DL1A 3PE8A 1YG8A 3QWDA 3FF6A 4OMRA 5FIFA 4EMPA 1Q52A 2CBYA 3FDUA 4U0GH 4YLHA 2FBMA 2VSSE 1EY3A 1OD4A 3VIVA 5KDRA 4Q1IA 1RJMA 4QFEA 3KTGA 5IKLB 1XO6A 4IZBA 3GLMA 1MJ3A 5E0NX 3LKEA 3OT6A 3TVWA 3GMAA 1PJHA 3U9SB 1ON3A 3QXZA 3OC7A 3DJAA 5INFA 1WZ8A 2ZL0A 5JBWA 3M6MA 3HE2A 1K39A 1RJNA 3TT6A 3Q7HA 4U0GA 5KJPA 2F6QA 3TRRA 2VSUC 4L8KA 3Q0GA 2F9YA 3H0JA 4K3WA 3NJBA 3BPPA 4KD6A 4GM2A 4I4ZA 1W2XA 4FNDA 4IZCA 3IAVA 2C8TA 1X0UA 2Q34A 2F9YB 4EMMA 3P5MA 3R9QA 4FZWA 1N6EA 1YG6A 3R9TA 5FUSA 4KWBA 4MOUA 4JVTA 3TDCA 3KTKA 2Q35A 3ZWCA 2F9IB 1TG6A 3HINA 4Q0GA 4JSBA 4JCQA 4JCTA 1UYRA 1HZDA 2PG8A 3G64A 3KTHA 4ELXA 2F6IA 5G1SA 3QYRA 4JCSA 3JU1A 3QMJA 4JYJA 5DKPA 3PZKA 3I47A 1OD2A 3MFMA 3T88A 2F9IA 3STAA 1O8UA 5DZKA 2A7SA 3PGQA 4JYLA 3T8BA 1J7XA 3H0QA 2VSUA 4B3HA 2J5II 4Z0MA 4KNPA 3R9SA 5DUCA 3ZW8A 3ZW9A 3SLLA 3BEZA 4U0HA 2CE3A 2QQ3A 1TYFA 3R6HA 4NEKA 5DU8A 3RSTA 1WDKA 4GHNA 1N6DA 4HC8A 5E0SA 2J5IB 2VSSA 3N6RB 3M6NA 4QIJA 3R0OA 5DZKH 3IB9A 4JOTA 1UYSA 3WG5A 5C90A 4K2NA 4ASIA 4ELSA 3U9RB 2WTBA 1N6FA 4FN7A 4U18A 2J5GD 2VREA 4L6WA 1HNUA 4WCZA 1NZYA 1Q51A 2J5SA 4ELWA 5INGA 1WDMA 3HP0A 2Q2XA 1UIYA 2FZSA 2GTRA 4FZWC 3GKBA 4DI1A 4IZDA 3V5IA 2IEXA 3TVUA 4JCRA 4QIIA 2X58A 3Q0JA 3TLFA
chains in the Genus database with same CATH superfamily
1ON9A 5E0SH 2EJ5A 5CTBA 5KDRB 4EMLA 4ZDDA 4OG1A 2DUBA 3V5EA 5JBXA 3ZWAA 4HDTA 1JXZA 3P2LA 4FJWD 1XX4A 4WYOB 5G1QA 4I42A 4NNQA 3HRXA 2VX2A 3U9TB 1XNVA 1Y7OA 4ZDFA 5DTWA 3H0UA 3KTJA 4JJTA 4K29A 4G2RA 2D3TA 3QK8A 4RCNA 2A7KA 4I52A 4ZDCA 3SWXA 2ZL4A 3BF0A 3MOYA 5HUQA 1EF9A 1K32A 5DU6A 1DUBA 2ZL3A 3T8AA 2BZRA 2X24A 4NARA 1UYVA 2ZL2A 1EF8A 3RSIA 3PEAA 1HNOA 2PPYA 1FCFA 4JFCA 4KPKA 2J5GA 3Q1TA 4B3JA 3OMEA 2PBPA 3LAOA 1WDLA 3NJDA 4FNBA 2W3PA 5DUFA 4WZ8B 1SZOA 3ST9A 3TV5A 5G1RA 3H0SA 3L3SA 1XNYA 3T3WA 3GF7A 3TZ3A 3QREA 2HW5A 4U19A 3ZWBA 2DEOA 3H02A 1XNWA 4ZDEA 1PIXA 1SG4A 1VRGA 3P85A 4JWVA 5CTCA 4RYFH 5DTPA 4OLQA 1NZYB 4RYFA 2UZFA 5MGBA 2VSUF 4U1AA 3MYBA 2A81A 3K50A 2ZQQA 4LK5A 2ZQRA 5INIA 4B3IA 3T89A 1FC6A 2FW2A 3TT7A 3MT6A 4F47A 3HLN1 4ZU2A 4MXIA 4MI2A 3KTIA 1FC7A 4FB8A 3ISAA 3DORA 1UYTA 2VSSF 2NP9A 3IBBA 3RRVA 2VSUE 4FN8A 3KQFA 3GF3A 3QXIA 1DCIA 5DU4A 4ZDBA 4HNKA 5C9GA 2J5IA 1FC9A 3K8XA 3H81A 3QKAA 5DL1A 3PE8A 1YG8A 3QWDA 3FF6A 4OMRA 5FIFA 4EMPA 1Q52A 2CBYA 3FDUA 4U0GH 4YLHA 2FBMA 2VSSE 1EY3A 1OD4A 3VIVA 5KDRA 4Q1IA 1RJMA 4QFEA 3KTGA 5IKLB 1XO6A 4IZBA 3GLMA 1MJ3A 5E0NX 3LKEA 3OT6A 3TVWA 3GMAA 1PJHA 3U9SB 1ON3A 3QXZA 3OC7A 3DJAA 5INFA 1WZ8A 2ZL0A 5JBWA 3M6MA 3HE2A 1K39A 1RJNA 3TT6A 3Q7HA 4U0GA 5KJPA 2F6QA 3TRRA 2VSUC 4L8KA 3Q0GA 2F9YA 3H0JA 4K3WA 3NJBA 3BPPA 4KD6A 4GM2A 3BPTA 4I4ZA 1W2XA 4FNDA 4IZCA 3IAVA 2C8TA 1X0UA 2Q34A 2F9YB 4EMMA 3P5MA 3R9QA 4FZWA 1N6EA 1YG6A 3R9TA 5FUSA 4KWBA 4MOUA 4JVTA 3TDCA 3KTKA 2Q35A 3ZWCA 2F9IB 1TG6A 3HINA 4Q0GA 4JSBA 4JCQA 4JCTA 1UYRA 1HZDA 2PG8A 3G64A 3KTHA 4ELXA 2F6IA 5G1SA 3QYRA 4JCSA 3JU1A 3QMJA 4JYJA 5DKPA 3PZKA 3I47A 1OD2A 3MFMA 3T88A 2F9IA 3STAA 1O8UA 5DZKA 2A7SA 3PGQA 4JYLA 3T8BA 1J7XA 3H0QA 2VSUA 4B3HA 2J5II 4Z0MA 4KNPA 3R9SA 5DUCA 3ZW8A 3ZW9A 3SLLA 3BEZA 4U0HA 2CE3A 2QQ3A 1TYFA 3R6HA 2YJGA 4NEKA 5DU8A 3RSTA 1WDKA 4GHNA 1N6DA 4HC8A 5E0SA 2J5IB 2VSSA 3N6RB 4J2UA 3M6NA 4QIJA 3R0OA 5DZKH 3IB9A 4JOTA 1UYSA 3WG5A 5C90A 4K2NA 4ASIA 4ELSA 3U9RB 2WTBA 1N6FA 4FN7A 4U18A 2J5GD 2VREA 4L6WA 1HNUA 4WCZA 1NZYA 1Q51A 2J5SA 4ELWA 5INGA 1WDMA 3HP0A 2Q2XA 1UIYA 2FZSA 2GTRA 4FZWC 3GKBA 4DI1A 4IZDA 3V5IA 2IEXA 3TVUA 4JCRA 4QIIA 2X58A 3Q0JA 3TLFA
chains in the Genus database with same CATH topology
1ON9A 5E0SH 2EJ5A 5CTBA 5KDRB 4EMLA 4ZDDA 4OG1A 2DUBA 3V5EA 5JBXA 3ZWAA 4HDTA 1JXZA 3P2LA 4FJWD 1XX4A 4WYOB 5G1QA 4I42A 4NNQA 3HRXA 2VX2A 3U9TB 1XNVA 1Y7OA 4ZDFA 5DTWA 3H0UA 3KTJA 4JJTA 4K29A 4G2RA 2D3TA 3QK8A 4RCNA 2A7KA 4I52A 4ZDCA 3SWXA 2ZL4A 3BF0A 3MOYA 5HUQA 1EF9A 1K32A 5DU6A 1DUBA 2ZL3A 3T8AA 2BZRA 2X24A 4NARA 1UYVA 2ZL2A 1EF8A 3RSIA 3PEAA 1HNOA 2PPYA 1FCFA 4JFCA 4KPKA 2J5GA 3Q1TA 4B3JA 3OMEA 2PBPA 3LAOA 1WDLA 3NJDA 4FNBA 2W3PA 5DUFA 4WZ8B 1SZOA 3ST9A 3TV5A 5G1RA 3H0SA 3L3SA 1XNYA 3T3WA 3GF7A 3TZ3A 3QREA 2HW5A 4U19A 3ZWBA 2DEOA 3H02A 1XNWA 4ZDEA 1PIXA 1SG4A 1VRGA 3P85A 4JWVA 5CTCA 4RYFH 5DTPA 4OLQA 1NZYB 4RYFA 2UZFA 5MGBA 2VSUF 4U1AA 3MYBA 2A81A 3K50A 2ZQQA 4LK5A 2ZQRA 5INIA 4B3IA 3T89A 1FC6A 2FW2A 3TT7A 3MT6A 4F47A 3HLN1 4ZU2A 4MXIA 4MI2A 3KTIA 1FC7A 4FB8A 3ISAA 3DORA 1UYTA 2VSSF 2NP9A 3IBBA 3RRVA 2VSUE 4FN8A 3KQFA 3GF3A 3QXIA 1DCIA 5DU4A 4ZDBA 4HNKA 5C9GA 2J5IA 1FC9A 3K8XA 3H81A 3QKAA 5DL1A 3PE8A 1YG8A 3QWDA 3FF6A 4OMRA 5FIFA 4EMPA 1Q52A 2CBYA 3FDUA 4U0GH 4YLHA 2FBMA 2VSSE 1EY3A 1OD4A 3VIVA 5KDRA 4Q1IA 1RJMA 4QFEA 3KTGA 5IKLB 1XO6A 4IZBA 3GLMA 1MJ3A 5E0NX 3LKEA 3OT6A 3TVWA 3GMAA 1PJHA 3U9SB 1ON3A 3QXZA 3OC7A 3DJAA 5INFA 1WZ8A 2ZL0A 5JBWA 3M6MA 3HE2A 1K39A 1RJNA 3TT6A 3Q7HA 4U0GA 5KJPA 2F6QA 3TRRA 2VSUC 4L8KA 3Q0GA 2F9YA 3H0JA 4K3WA 3NJBA 3BPPA 4KD6A 4GM2A 3BPTA 4I4ZA 1W2XA 4FNDA 4IZCA 3IAVA 2C8TA 1X0UA 2Q34A 2F9YB 4EMMA 3P5MA 3R9QA 4FZWA 1N6EA 1YG6A 3R9TA 5FUSA 4KWBA 4MOUA 4JVTA 3TDCA 3KTKA 2Q35A 3ZWCA 2F9IB 1TG6A 3HINA 4Q0GA 4JSBA 4JCQA 4JCTA 1UYRA 1HZDA 2PG8A 3G64A 3KTHA 4ELXA 2F6IA 5G1SA 3QYRA 4JCSA 3JU1A 3QMJA 4JYJA 5DKPA 3PZKA 3I47A 1OD2A 3MFMA 3T88A 2F9IA 3STAA 1O8UA 5DZKA 2A7SA 3PGQA 4JYLA 3T8BA 1J7XA 3H0QA 2VSUA 4B3HA 2J5II 4Z0MA 4KNPA 3R9SA 5DUCA 3ZW8A 3ZW9A 3SLLA 3BEZA 4U0HA 2CE3A 2QQ3A 1TYFA 3R6HA 2YJGA 4NEKA 5DU8A 3RSTA 1WDKA 4GHNA 1N6DA 4HC8A 5E0SA 2J5IB 2VSSA 3N6RB 4J2UA 3M6NA 4QIJA 3R0OA 5DZKH 3IB9A 4JOTA 1UYSA 3WG5A 5C90A 4K2NA 4ASIA 4ELSA 3U9RB 2WTBA 1N6FA 4FN7A 4U18A 2J5GD 2VREA 4L6WA 1HNUA 4WCZA 1NZYA 1Q51A 2J5SA 4ELWA 5INGA 1WDMA 3HP0A 2Q2XA 1UIYA 2FZSA 2GTRA 4FZWC 3GKBA 4DI1A 4IZDA 3V5IA 2IEXA 3TVUA 4JCRA 4QIIA 2X58A 3Q0JA 3TLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ON9 A;  5E0S H;  2EJ5 A;  5CTB A;  5KDR B;  4EML A;  4ZDD A;  4OG1 A;  2DUB A;  3V5E A;  5JBX A;  3ZWA A;  1JXZ A;  3P2L A;  4FJW D;  1XX4 A;  4WYO B;  5G1Q A;  4I42 A;  4NNQ A;  3HRX A;  2VX2 A;  3U9T B;  1XNV A;  1Y7O A;  4ZDF A;  5DTW A;  3H0U A;  3KTJ A;  4JJT A;  4K29 A;  4G2R A;  2D3T A;  3QK8 A;  4RCN A;  2A7K A;  4I52 A;  4ZDC A;  3SWX A;  2ZL4 A;  3BF0 A;  3MOY A;  1EF9 A;  1K32 A;  5DU6 A;  1DUB A;  2ZL3 A;  3T8A A;  2BZR A;  2X24 A;  1UYV A;  2ZL2 A;  1EF8 A;  3RSI A;  3PEA A;  1HNO A;  2PPY A;  1FCF A;  4JFC A;  4KPK A;  2J5G A;  3Q1T A;  4B3J A;  3OME A;  2PBP A;  3LAO A;  1WDL A;  3NJD A;  4FNB A;  2W3P A;  5DUF A;  4WZ8 B;  1SZO A;  3ST9 A;  3TV5 A;  5G1R A;  3H0S A;  3L3S A;  1XNY A;  3T3W A;  3GF7 A;  3TZ3 A;  3QRE A;  2HW5 A;  4U19 A;  3ZWB A;  2DEO A;  3H02 A;  1XNW A;  4ZDE A;  1PIX A;  1SG4 A;  1VRG A;  3P85 A;  4JWV A;  5CTC A;  4RYF H;  5DTP A;  4OLQ A;  1NZY B;  4RYF A;  2UZF A;  5MGB A;  2VSU F;  4U1A A;  3MYB A;  2A81 A;  3K50 A;  2ZQQ A;  4LK5 A;  2ZQR A;  5INI A;  4B3I A;  3T89 A;  1FC6 A;  2FW2 A;  3TT7 A;  3MT6 A;  4F47 A;  3HLN 1;  4ZU2 A;  4MXI A;  4MI2 A;  3KTI A;  1FC7 A;  4FB8 A;  3ISA A;  3DOR A;  1UYT A;  2VSS F;  2NP9 A;  3IBB A;  3RRV A;  2VSU E;  4FN8 A;  3KQF A;  3GF3 A;  3QXI A;  1DCI A;  5DU4 A;  4ZDB A;  4HNK A;  5C9G A;  2J5I A;  1FC9 A;  3K8X A;  3H81 A;  3QKA A;  5DL1 A;  3PE8 A;  1YG8 A;  3QWD A;  3FF6 A;  4OMR A;  5FIF A;  4EMP A;  1Q52 A;  2CBY A;  3FDU A;  4U0G H;  4YLH A;  2FBM A;  2VSS E;  1EY3 A;  1OD4 A;  3VIV A;  5KDR A;  4Q1I A;  1RJM A;  4QFE A;  3KTG A;  5IKL B;  1XO6 A;  4IZB A;  3GLM A;  1MJ3 A;  5E0N X;  3LKE A;  3OT6 A;  3TVW A;  3GMA A;  1PJH A;  3U9S B;  1ON3 A;  3QXZ A;  3OC7 A;  3DJA A;  5INF A;  1WZ8 A;  2ZL0 A;  5JBW A;  3M6M A;  3HE2 A;  1K39 A;  1RJN A;  3TT6 A;  3Q7H A;  4U0G A;  5KJP A;  2F6Q A;  3TRR A;  2VSU C;  4L8K A;  3Q0G A;  2F9Y A;  3H0J A;  4K3W A;  3NJB A;  3BPP A;  4KD6 A;  4GM2 A;  4I4Z A;  1W2X A;  4FND A;  4IZC A;  3IAV A;  2C8T A;  1X0U A;  2Q34 A;  2F9Y B;  4EMM A;  3P5M A;  3R9Q A;  4FZW A;  1N6E A;  1YG6 A;  3R9T A;  5FUS A;  4KWB A;  4MOU A;  4JVT A;  3TDC A;  3KTK A;  2Q35 A;  3ZWC A;  2F9I B;  1TG6 A;  3HIN A;  4Q0G A;  4JSB A;  4JCQ A;  4JCT A;  1UYR A;  1HZD A;  2PG8 A;  3G64 A;  3KTH A;  4ELX A;  2F6I A;  5G1S A;  3QYR A;  4JCS A;  3JU1 A;  3QMJ A;  4JYJ A;  5DKP A;  3PZK A;  3I47 A;  1OD2 A;  3MFM A;  3T88 A;  2F9I A;  3STA A;  1O8U A;  5DZK A;  2A7S A;  3PGQ A;  4JYL A;  3T8B A;  1J7X A;  3H0Q A;  2VSU A;  4B3H A;  2J5I I;  4Z0M A;  4KNP A;  3R9S A;  5DUC A;  3ZW8 A;  3ZW9 A;  3SLL A;  3BEZ A;  4U0H A;  2CE3 A;  2QQ3 A;  1TYF A;  3R6H A;  4NEK A;  5DU8 A;  3RST A;  1WDK A;  4GHN A;  1N6D A;  4HC8 A;  5E0S A;  2J5I B;  2VSS A;  3N6R B;  3M6N A;  4QIJ A;  3R0O A;  5DZK H;  3IB9 A;  4JOT A;  1UYS A;  3WG5 A;  5C90 A;  4K2N A;  4ASI A;  4ELS A;  3U9R B;  2WTB A;  1N6F A;  4FN7 A;  4U18 A;  2J5G D;  2VRE A;  4L6W A;  1HNU A;  4WCZ A;  1NZY A;  1Q51 A;  2J5S A;  4ELW A;  5ING A;  1WDM A;  3HP0 A;  2Q2X A;  1UIY A;  2FZS A;  2GTR A;  4FZW C;  3GKB A;  4DI1 A;  4IZD A;  3V5I A;  2IEX A;  3TVU A;  4JCR A;  4QII A;  2X58 A;  3Q0J A;  3TLF A; 
#chains in the Genus database with same CATH topology
 1ON9 A;  5E0S H;  2EJ5 A;  5CTB A;  5KDR B;  4EML A;  4ZDD A;  4OG1 A;  2DUB A;  3V5E A;  5JBX A;  3ZWA A;  4HDT A;  1JXZ A;  3P2L A;  4FJW D;  1XX4 A;  4WYO B;  5G1Q A;  4I42 A;  4NNQ A;  3HRX A;  2VX2 A;  3U9T B;  1XNV A;  1Y7O A;  4ZDF A;  5DTW A;  3H0U A;  3KTJ A;  4JJT A;  4K29 A;  4G2R A;  2D3T A;  3QK8 A;  4RCN A;  2A7K A;  4I52 A;  4ZDC A;  3SWX A;  2ZL4 A;  3BF0 A;  3MOY A;  5HUQ A;  1EF9 A;  1K32 A;  5DU6 A;  1DUB A;  2ZL3 A;  3T8A A;  2BZR A;  2X24 A;  4NAR A;  1UYV A;  2ZL2 A;  1EF8 A;  3RSI A;  3PEA A;  1HNO A;  2PPY A;  1FCF A;  4JFC A;  4KPK A;  2J5G A;  3Q1T A;  4B3J A;  3OME A;  2PBP A;  3LAO A;  1WDL A;  3NJD A;  4FNB A;  2W3P A;  5DUF A;  4WZ8 B;  1SZO A;  3ST9 A;  3TV5 A;  5G1R A;  3H0S A;  3L3S A;  1XNY A;  3T3W A;  3GF7 A;  3TZ3 A;  3QRE A;  2HW5 A;  4U19 A;  3ZWB A;  2DEO A;  3H02 A;  1XNW A;  4ZDE A;  1PIX A;  1SG4 A;  1VRG A;  3P85 A;  4JWV A;  5CTC A;  4RYF H;  5DTP A;  4OLQ A;  1NZY B;  4RYF A;  2UZF A;  5MGB A;  2VSU F;  4U1A A;  3MYB A;  2A81 A;  3K50 A;  2ZQQ A;  4LK5 A;  2ZQR A;  5INI A;  4B3I A;  3T89 A;  1FC6 A;  2FW2 A;  3TT7 A;  3MT6 A;  4F47 A;  3HLN 1;  4ZU2 A;  4MXI A;  4MI2 A;  3KTI A;  1FC7 A;  4FB8 A;  3ISA A;  3DOR A;  1UYT A;  2VSS F;  2NP9 A;  3IBB A;  3RRV A;  2VSU E;  4FN8 A;  3KQF A;  3GF3 A;  3QXI A;  1DCI A;  5DU4 A;  4ZDB A;  4HNK A;  5C9G A;  2J5I A;  1FC9 A;  3K8X A;  3H81 A;  3QKA A;  5DL1 A;  3PE8 A;  1YG8 A;  3QWD A;  3FF6 A;  4OMR A;  5FIF A;  4EMP A;  1Q52 A;  2CBY A;  3FDU A;  4U0G H;  4YLH A;  2FBM A;  2VSS E;  1EY3 A;  1OD4 A;  3VIV A;  5KDR A;  4Q1I A;  1RJM A;  4QFE A;  3KTG A;  5IKL B;  1XO6 A;  4IZB A;  3GLM A;  1MJ3 A;  5E0N X;  3LKE A;  3OT6 A;  3TVW A;  3GMA A;  1PJH A;  3U9S B;  1ON3 A;  3QXZ A;  3OC7 A;  3DJA A;  5INF A;  1WZ8 A;  2ZL0 A;  5JBW A;  3M6M A;  3HE2 A;  1K39 A;  1RJN A;  3TT6 A;  3Q7H A;  4U0G A;  5KJP A;  2F6Q A;  3TRR A;  2VSU C;  4L8K A;  3Q0G A;  2F9Y A;  3H0J A;  4K3W A;  3NJB A;  3BPP A;  4KD6 A;  4GM2 A;  3BPT A;  4I4Z A;  1W2X A;  4FND A;  4IZC A;  3IAV A;  2C8T A;  1X0U A;  2Q34 A;  2F9Y B;  4EMM A;  3P5M A;  3R9Q A;  4FZW A;  1N6E A;  1YG6 A;  3R9T A;  5FUS A;  4KWB A;  4MOU A;  4JVT A;  3TDC A;  3KTK A;  2Q35 A;  3ZWC A;  2F9I B;  1TG6 A;  3HIN A;  4Q0G A;  4JSB A;  4JCQ A;  4JCT A;  1UYR A;  1HZD A;  2PG8 A;  3G64 A;  3KTH A;  4ELX A;  2F6I A;  5G1S A;  3QYR A;  4JCS A;  3JU1 A;  3QMJ A;  4JYJ A;  5DKP A;  3PZK A;  3I47 A;  1OD2 A;  3MFM A;  3T88 A;  2F9I A;  3STA A;  1O8U A;  5DZK A;  2A7S A;  3PGQ A;  4JYL A;  3T8B A;  1J7X A;  3H0Q A;  2VSU A;  4B3H A;  2J5I I;  4Z0M A;  4KNP A;  3R9S A;  5DUC A;  3ZW8 A;  3ZW9 A;  3SLL A;  3BEZ A;  4U0H A;  2CE3 A;  2QQ3 A;  1TYF A;  3R6H A;  2YJG A;  4NEK A;  5DU8 A;  3RST A;  1WDK A;  4GHN A;  1N6D A;  4HC8 A;  5E0S A;  2J5I B;  2VSS A;  3N6R B;  4J2U A;  3M6N A;  4QIJ A;  3R0O A;  5DZK H;  3IB9 A;  4JOT A;  1UYS A;  3WG5 A;  5C90 A;  4K2N A;  4ASI A;  4ELS A;  3U9R B;  2WTB A;  1N6F A;  4FN7 A;  4U18 A;  2J5G D;  2VRE A;  4L6W A;  1HNU A;  4WCZ A;  1NZY A;  1Q51 A;  2J5S A;  4ELW A;  5ING A;  1WDM A;  3HP0 A;  2Q2X A;  1UIY A;  2FZS A;  2GTR A;  4FZW C;  3GKB A;  4DI1 A;  4IZD A;  3V5I A;  2IEX A;  3TVU A;  4JCR A;  4QII A;  2X58 A;  3Q0J A;  3TLF A; 
#chains in the Genus database with same CATH homology
 1ON9 A;  5E0S H;  2EJ5 A;  5CTB A;  5KDR B;  4EML A;  4ZDD A;  4OG1 A;  2DUB A;  3V5E A;  5JBX A;  3ZWA A;  4HDT A;  1JXZ A;  3P2L A;  4FJW D;  1XX4 A;  4WYO B;  5G1Q A;  4I42 A;  4NNQ A;  3HRX A;  2VX2 A;  3U9T B;  1XNV A;  1Y7O A;  4ZDF A;  5DTW A;  3H0U A;  3KTJ A;  4JJT A;  4K29 A;  4G2R A;  2D3T A;  3QK8 A;  4RCN A;  2A7K A;  4I52 A;  4ZDC A;  3SWX A;  2ZL4 A;  3BF0 A;  3MOY A;  5HUQ A;  1EF9 A;  1K32 A;  5DU6 A;  1DUB A;  2ZL3 A;  3T8A A;  2BZR A;  2X24 A;  4NAR A;  1UYV A;  2ZL2 A;  1EF8 A;  3RSI A;  3PEA A;  1HNO A;  2PPY A;  1FCF A;  4JFC A;  4KPK A;  2J5G A;  3Q1T A;  4B3J A;  3OME A;  2PBP A;  3LAO A;  1WDL A;  3NJD A;  4FNB A;  2W3P A;  5DUF A;  4WZ8 B;  1SZO A;  3ST9 A;  3TV5 A;  5G1R A;  3H0S A;  3L3S A;  1XNY A;  3T3W A;  3GF7 A;  3TZ3 A;  3QRE A;  2HW5 A;  4U19 A;  3ZWB A;  2DEO A;  3H02 A;  1XNW A;  4ZDE A;  1PIX A;  1SG4 A;  1VRG A;  3P85 A;  4JWV A;  5CTC A;  4RYF H;  5DTP A;  4OLQ A;  1NZY B;  4RYF A;  2UZF A;  5MGB A;  2VSU F;  4U1A A;  3MYB A;  2A81 A;  3K50 A;  2ZQQ A;  4LK5 A;  2ZQR A;  5INI A;  4B3I A;  3T89 A;  1FC6 A;  2FW2 A;  3TT7 A;  3MT6 A;  4F47 A;  3HLN 1;  4ZU2 A;  4MXI A;  4MI2 A;  3KTI A;  1FC7 A;  4FB8 A;  3ISA A;  3DOR A;  1UYT A;  2VSS F;  2NP9 A;  3IBB A;  3RRV A;  2VSU E;  4FN8 A;  3KQF A;  3GF3 A;  3QXI A;  1DCI A;  5DU4 A;  4ZDB A;  4HNK A;  5C9G A;  2J5I A;  1FC9 A;  3K8X A;  3H81 A;  3QKA A;  5DL1 A;  3PE8 A;  1YG8 A;  3QWD A;  3FF6 A;  4OMR A;  5FIF A;  4EMP A;  1Q52 A;  2CBY A;  3FDU A;  4U0G H;  4YLH A;  2FBM A;  2VSS E;  1EY3 A;  1OD4 A;  3VIV A;  5KDR A;  4Q1I A;  1RJM A;  4QFE A;  3KTG A;  5IKL B;  1XO6 A;  4IZB A;  3GLM A;  1MJ3 A;  5E0N X;  3LKE A;  3OT6 A;  3TVW A;  3GMA A;  1PJH A;  3U9S B;  1ON3 A;  3QXZ A;  3OC7 A;  3DJA A;  5INF A;  1WZ8 A;  2ZL0 A;  5JBW A;  3M6M A;  3HE2 A;  1K39 A;  1RJN A;  3TT6 A;  3Q7H A;  4U0G A;  5KJP A;  2F6Q A;  3TRR A;  2VSU C;  4L8K A;  3Q0G A;  2F9Y A;  3H0J A;  4K3W A;  3NJB A;  3BPP A;  4KD6 A;  4GM2 A;  3BPT A;  4I4Z A;  1W2X A;  4FND A;  4IZC A;  3IAV A;  2C8T A;  1X0U A;  2Q34 A;  2F9Y B;  4EMM A;  3P5M A;  3R9Q A;  4FZW A;  1N6E A;  1YG6 A;  3R9T A;  5FUS A;  4KWB A;  4MOU A;  4JVT A;  3TDC A;  3KTK A;  2Q35 A;  3ZWC A;  2F9I B;  1TG6 A;  3HIN A;  4Q0G A;  4JSB A;  4JCQ A;  4JCT A;  1UYR A;  1HZD A;  2PG8 A;  3G64 A;  3KTH A;  4ELX A;  2F6I A;  5G1S A;  3QYR A;  4JCS A;  3JU1 A;  3QMJ A;  4JYJ A;  5DKP A;  3PZK A;  3I47 A;  1OD2 A;  3MFM A;  3T88 A;  2F9I A;  3STA A;  1O8U A;  5DZK A;  2A7S A;  3PGQ A;  4JYL A;  3T8B A;  1J7X A;  3H0Q A;  2VSU A;  4B3H A;  2J5I I;  4Z0M A;  4KNP A;  3R9S A;  5DUC A;  3ZW8 A;  3ZW9 A;  3SLL A;  3BEZ A;  4U0H A;  2CE3 A;  2QQ3 A;  1TYF A;  3R6H A;  2YJG A;  4NEK A;  5DU8 A;  3RST A;  1WDK A;  4GHN A;  1N6D A;  4HC8 A;  5E0S A;  2J5I B;  2VSS A;  3N6R B;  4J2U A;  3M6N A;  4QIJ A;  3R0O A;  5DZK H;  3IB9 A;  4JOT A;  1UYS A;  3WG5 A;  5C90 A;  4K2N A;  4ASI A;  4ELS A;  3U9R B;  2WTB A;  1N6F A;  4FN7 A;  4U18 A;  2J5G D;  2VRE A;  4L6W A;  1HNU A;  4WCZ A;  1NZY A;  1Q51 A;  2J5S A;  4ELW A;  5ING A;  1WDM A;  3HP0 A;  2Q2X A;  1UIY A;  2FZS A;  2GTR A;  4FZW C;  3GKB A;  4DI1 A;  4IZD A;  3V5I A;  2IEX A;  3TVU A;  4JCR A;  4QII A;  2X58 A;  3Q0J A;  3TLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...