3KTKA

Structure of clpp in complex with adep2 in triclinic crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
174
structure length
174
Chain Sequence
DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
total genus 63
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktkA00
1PJHA 2J5II 1JXZA 5KDRB 3HLN1 4IZCA 5DUFA 5E0NX 2F6QA 5DL1A 1RJNA 3DORA 2VSUA 1FC6A 3QREA 1XNVA 5DU8A 4HNKA 4JCRA 4OG1A 3TLFA 4ZU2A 3KTIA 1ON3A 1FC7A 4FZWA 4K29A 5DUCA 1NZYA 3R9QA 2F6IA 2X58A 2F9YB 1Q51A 2VREA 2X24A 3TT7A 4JCTA 2PPYA 1EF9A 5JBWA 4JSBA 4WYOB 4FJWD 3GLMA 3M6MA 4FNBA 1XNYA 4JYLA 4JCQA 3Q7HA 2Q35A 3PZKA 2ZQQA 1EF8A 1W2XA 2C8TA 3HINA 3TZ3A 3M6NA 3PGQA 3T3WA 1ON9A 4JJTA 3TRRA 3OMEA 3RRVA 4HC8A 2FBMA 3TVWA 3U9TB 2NP9A 4ZDCA 4U0GH 5INFA 3TT6A 3QXIA 5FIFA 4B3IA 5G1SA 5INIA 2CE3A 2F9IA 3L3SA 3MT6A 2PG8A 3HE2A 3N6RB 2FZSA 1WDKA 3PE8A 1FC9A 3SLLA 3G64A 4U0GA 2ZL3A 3R6HA 3DJAA 4MOUA 2VSSF 3K50A 3GKBA 1WDLA 4Z0MA 5KDRA 4Q1IA 2DUBA 2EJ5A 3ISAA 3HP0A 5DTPA 3VIVA 3H81A 3K8XA 2CBYA 3H0QA 1OD4A 2FW2A 1MJ3A 4FZWC 5IKLB 1TYFA 2DEOA 1DUBA 3KTJA 3IB9A 3H0SA 5G1RA 1UYRA 4MXIA 2W3PA 4GHNA 1Y7OA 1UYTA 2HW5A 4FN8A 2GTRA 4NNQA 3RSIA 1UYSA 4EMPA 3PEAA 3IAVA 2F9YA 4JCSA 1EY3A 1FCFA 3NJDA 4WCZA 4ZDBA 5E0SH 5DU4A 1UIYA 4FB8A 4I42A 4JWVA 2VSSE 4DI1A 1PIXA 5DU6A 3STAA 4I52A 3T8AA 3TDCA 4ASIA 3Q0JA 3KTGA 3I47A 2QQ3A 3FDUA 2Q2XA 3OC7A 3MOYA 5DTWA 4JFCA 5G1QA 5E0SA 4ELSA 1VRGA 3ZWBA 1O8UA 3QYRA 3WG5A 3P2LA 4MI2A 1TG6A 4K3WA 4QFEA 1RJMA 4B3HA 3T88A 5KJPA 5MGBA 4U0HA 3QXZA 5DZKH 4I4ZA 3LKEA 1K39A 1HNOA 4ZDEA 2PBPA 2A7KA 4GM2A 2J5IB 4EMMA 4ELWA 1YG8A 3H0UA 4KNPA 2VSUC 3ZWAA 1WZ8A 3TV5A 1SG4A 2VSSA 3H0JA 2ZL2A 4WZ8B 3KTHA 3OT6A 3QMJA 2VX2A 2VSUF 4QIIA 5DZKA 3SWXA 5JBXA 3IBBA 5DKPA 3BEZA 3ZWCA 4FN7A 4NEKA 3QKAA 3JU1A 1YG6A 4G2RA 2J5SA 1N6DA 1K32A 1HZDA 1NZYB 4RCNA 4KPKA 3R9TA 3ZW9A 2UZFA 1XX4A 4ZDDA 3Q1TA 4QIJA 3T89A 3HRXA 4U18A 3ZW8A 4F47A 2ZQRA 3V5IA 2ZL0A 4RYFH 1WDMA 1X0UA 4LK5A 2J5GD 3V5EA 3MYBA 4OMRA 3NJBA 5CTBA 1DCIA 2VSUE 1UYVA 1XO6A 5CTCA 4JVTA 4K2NA 1J7XA 2IEXA 4L6WA 1XNWA 2A7SA 4Q0GA 5FUSA 3R9SA 5C90A 4RYFA 4B3JA 4U19A 3MFMA 1N6EA 3RSTA 3GF7A 3FF6A 4EMLA 4IZBA 3BF0A 3U9SB 2J5GA 2WTBA 3U9RB 1OD2A 3P5MA 3Q0GA 4KD6A 4OLQA 3R0OA 3GMAA 3KQFA 2BZRA 3P85A 1SZOA 5C9GA 3KTKA 1N6FA 3ST9A 4L8KA 2F9IB 4ZDFA 5INGA 2A81A 3LAOA 2ZL4A 1Q52A 3QWDA 4JYJA 4YLHA 4IZDA 3BPPA 3T8BA 4KWBA 1HNUA 4FNDA 4JOTA 3H02A 2Q34A 3QK8A 3TVUA 2D3TA 4U1AA 2J5IA 4ELXA 3GF3A
chains in the Genus database with same CATH superfamily
1PJHA 2J5II 1JXZA 5KDRB 3HLN1 4IZCA 5DUFA 5E0NX 2F6QA 5DL1A 1RJNA 3DORA 2VSUA 1FC6A 3QREA 3BPTA 1XNVA 5DU8A 4HNKA 4JCRA 4OG1A 3TLFA 4ZU2A 3KTIA 1ON3A 1FC7A 4FZWA 4K29A 5DUCA 1NZYA 3R9QA 2F6IA 2X58A 2F9YB 1Q51A 2VREA 2X24A 3TT7A 4JCTA 2PPYA 1EF9A 5JBWA 4JSBA 4WYOB 4FJWD 3GLMA 3M6MA 4FNBA 1XNYA 4JYLA 4JCQA 3Q7HA 2Q35A 3PZKA 2ZQQA 1EF8A 1W2XA 2C8TA 3HINA 3TZ3A 3M6NA 3PGQA 3T3WA 1ON9A 4JJTA 3TRRA 3OMEA 3RRVA 4HC8A 2FBMA 3TVWA 3U9TB 2NP9A 4ZDCA 4U0GH 5INFA 3TT6A 3QXIA 5FIFA 4B3IA 5G1SA 5INIA 2CE3A 2F9IA 3L3SA 3MT6A 2PG8A 3HE2A 3N6RB 2FZSA 1WDKA 3PE8A 1FC9A 4J2UA 3SLLA 3G64A 4U0GA 2ZL3A 3R6HA 3DJAA 4MOUA 2VSSF 3K50A 3GKBA 1WDLA 4Z0MA 5KDRA 4Q1IA 2DUBA 2EJ5A 3ISAA 3HP0A 5DTPA 3VIVA 3H81A 3K8XA 2CBYA 3H0QA 1OD4A 2FW2A 1MJ3A 4FZWC 5IKLB 1TYFA 2DEOA 1DUBA 3KTJA 3IB9A 3H0SA 5G1RA 1UYRA 2YJGA 4MXIA 2W3PA 4GHNA 1Y7OA 1UYTA 2HW5A 4FN8A 5HUQA 2GTRA 4NNQA 3RSIA 1UYSA 4EMPA 3PEAA 3IAVA 2F9YA 4JCSA 1EY3A 1FCFA 3NJDA 4WCZA 4ZDBA 5E0SH 5DU4A 1UIYA 4FB8A 4I42A 4JWVA 4HDTA 2VSSE 4DI1A 1PIXA 5DU6A 3STAA 4I52A 3T8AA 3TDCA 4ASIA 3Q0JA 3KTGA 3I47A 2QQ3A 3FDUA 2Q2XA 3OC7A 3MOYA 5DTWA 4JFCA 5G1QA 5E0SA 4ELSA 1VRGA 3ZWBA 1O8UA 3QYRA 3WG5A 3P2LA 4MI2A 1TG6A 4K3WA 4QFEA 1RJMA 4NARA 4B3HA 3T88A 5KJPA 5MGBA 4U0HA 3QXZA 5DZKH 4I4ZA 3LKEA 1K39A 1HNOA 4ZDEA 2PBPA 2A7KA 4GM2A 2J5IB 4EMMA 4ELWA 1YG8A 3H0UA 4KNPA 2VSUC 3ZWAA 1WZ8A 3TV5A 1SG4A 2VSSA 3H0JA 2ZL2A 4WZ8B 3KTHA 3OT6A 3QMJA 2VX2A 2VSUF 4QIIA 5DZKA 3SWXA 5JBXA 3IBBA 5DKPA 3BEZA 3ZWCA 4FN7A 4NEKA 3QKAA 3JU1A 1YG6A 4G2RA 2J5SA 1N6DA 1K32A 1HZDA 1NZYB 4RCNA 4KPKA 3R9TA 3ZW9A 2UZFA 1XX4A 4ZDDA 3Q1TA 4QIJA 3T89A 3HRXA 4U18A 3ZW8A 4F47A 2ZQRA 3V5IA 2ZL0A 4RYFH 1WDMA 1X0UA 4LK5A 2J5GD 3V5EA 3MYBA 4OMRA 3NJBA 5CTBA 1DCIA 2VSUE 1UYVA 1XO6A 5CTCA 4JVTA 4K2NA 1J7XA 2IEXA 4L6WA 1XNWA 2A7SA 4Q0GA 5FUSA 3R9SA 5C90A 4RYFA 4B3JA 4U19A 3MFMA 1N6EA 3RSTA 3GF7A 3FF6A 4EMLA 4IZBA 3BF0A 3U9SB 2J5GA 2WTBA 3U9RB 1OD2A 3P5MA 3Q0GA 4KD6A 4OLQA 3R0OA 3GMAA 3KQFA 2BZRA 3P85A 1SZOA 5C9GA 3KTKA 1N6FA 3ST9A 4L8KA 2F9IB 4ZDFA 5INGA 2A81A 3LAOA 2ZL4A 1Q52A 3QWDA 4JYJA 4YLHA 4IZDA 3BPPA 3T8BA 4KWBA 1HNUA 4FNDA 4JOTA 3H02A 2Q34A 3QK8A 3TVUA 2D3TA 4U1AA 2J5IA 4ELXA 3GF3A
chains in the Genus database with same CATH topology
1PJHA 2J5II 1JXZA 5KDRB 3HLN1 4IZCA 5DUFA 5E0NX 2F6QA 5DL1A 1RJNA 3DORA 2VSUA 1FC6A 3QREA 3BPTA 1XNVA 5DU8A 4HNKA 4JCRA 4OG1A 3TLFA 4ZU2A 3KTIA 1ON3A 1FC7A 4FZWA 4K29A 5DUCA 1NZYA 3R9QA 2F6IA 2X58A 2F9YB 1Q51A 2VREA 2X24A 3TT7A 4JCTA 2PPYA 1EF9A 5JBWA 4JSBA 4WYOB 4FJWD 3GLMA 3M6MA 4FNBA 1XNYA 4JYLA 4JCQA 3Q7HA 2Q35A 3PZKA 2ZQQA 1EF8A 1W2XA 2C8TA 3HINA 3TZ3A 3M6NA 3PGQA 3T3WA 1ON9A 4JJTA 3TRRA 3OMEA 3RRVA 4HC8A 2FBMA 3TVWA 3U9TB 2NP9A 4ZDCA 4U0GH 5INFA 3TT6A 3QXIA 5FIFA 4B3IA 5G1SA 5INIA 2CE3A 2F9IA 3L3SA 3MT6A 2PG8A 3HE2A 3N6RB 2FZSA 1WDKA 3PE8A 1FC9A 4J2UA 3SLLA 3G64A 4U0GA 2ZL3A 3R6HA 3DJAA 4MOUA 2VSSF 3K50A 3GKBA 1WDLA 4Z0MA 5KDRA 4Q1IA 2DUBA 2EJ5A 3ISAA 3HP0A 5DTPA 3VIVA 3H81A 3K8XA 2CBYA 3H0QA 1OD4A 2FW2A 1MJ3A 4FZWC 5IKLB 1TYFA 2DEOA 1DUBA 3KTJA 3IB9A 3H0SA 5G1RA 1UYRA 2YJGA 4MXIA 2W3PA 4GHNA 1Y7OA 1UYTA 2HW5A 4FN8A 5HUQA 2GTRA 4NNQA 3RSIA 1UYSA 4EMPA 3PEAA 3IAVA 2F9YA 4JCSA 1EY3A 1FCFA 3NJDA 4WCZA 4ZDBA 5E0SH 5DU4A 1UIYA 4FB8A 4I42A 4JWVA 4HDTA 2VSSE 4DI1A 1PIXA 5DU6A 3STAA 4I52A 3T8AA 3TDCA 4ASIA 3Q0JA 3KTGA 3I47A 2QQ3A 3FDUA 2Q2XA 3OC7A 3MOYA 5DTWA 4JFCA 5G1QA 5E0SA 4ELSA 1VRGA 3ZWBA 1O8UA 3QYRA 3WG5A 3P2LA 4MI2A 1TG6A 4K3WA 4QFEA 1RJMA 4NARA 4B3HA 3T88A 5KJPA 5MGBA 4U0HA 3QXZA 5DZKH 4I4ZA 3LKEA 1K39A 1HNOA 4ZDEA 2PBPA 2A7KA 4GM2A 2J5IB 4EMMA 4ELWA 1YG8A 3H0UA 4KNPA 2VSUC 3ZWAA 1WZ8A 3TV5A 1SG4A 2VSSA 3H0JA 2ZL2A 4WZ8B 3KTHA 3OT6A 3QMJA 2VX2A 2VSUF 4QIIA 5DZKA 3SWXA 5JBXA 3IBBA 5DKPA 3BEZA 3ZWCA 4FN7A 4NEKA 3QKAA 3JU1A 1YG6A 4G2RA 2J5SA 1N6DA 1K32A 1HZDA 1NZYB 4RCNA 4KPKA 3R9TA 3ZW9A 2UZFA 1XX4A 4ZDDA 3Q1TA 4QIJA 3T89A 3HRXA 4U18A 3ZW8A 4F47A 2ZQRA 3V5IA 2ZL0A 4RYFH 1WDMA 1X0UA 4LK5A 2J5GD 3V5EA 3MYBA 4OMRA 3NJBA 5CTBA 1DCIA 2VSUE 1UYVA 1XO6A 5CTCA 4JVTA 4K2NA 1J7XA 2IEXA 4L6WA 1XNWA 2A7SA 4Q0GA 5FUSA 3R9SA 5C90A 4RYFA 4B3JA 4U19A 3MFMA 1N6EA 3RSTA 3GF7A 3FF6A 4EMLA 4IZBA 3BF0A 3U9SB 2J5GA 2WTBA 3U9RB 1OD2A 3P5MA 3Q0GA 4KD6A 4OLQA 3R0OA 3GMAA 3KQFA 2BZRA 3P85A 1SZOA 5C9GA 3KTKA 1N6FA 3ST9A 4L8KA 2F9IB 4ZDFA 5INGA 2A81A 3LAOA 2ZL4A 1Q52A 3QWDA 4JYJA 4YLHA 4IZDA 3BPPA 3T8BA 4KWBA 1HNUA 4FNDA 4JOTA 3H02A 2Q34A 3QK8A 3TVUA 2D3TA 4U1AA 2J5IA 4ELXA 3GF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJH A;  2J5I I;  1JXZ A;  5KDR B;  3HLN 1;  4IZC A;  5DUF A;  5E0N X;  2F6Q A;  5DL1 A;  1RJN A;  3DOR A;  2VSU A;  1FC6 A;  3QRE A;  1XNV A;  5DU8 A;  4HNK A;  4JCR A;  4OG1 A;  3TLF A;  4ZU2 A;  3KTI A;  1ON3 A;  1FC7 A;  4FZW A;  4K29 A;  5DUC A;  1NZY A;  3R9Q A;  2F6I A;  2X58 A;  2F9Y B;  1Q51 A;  2VRE A;  2X24 A;  3TT7 A;  4JCT A;  2PPY A;  1EF9 A;  5JBW A;  4JSB A;  4WYO B;  4FJW D;  3GLM A;  3M6M A;  4FNB A;  1XNY A;  4JYL A;  4JCQ A;  3Q7H A;  2Q35 A;  3PZK A;  2ZQQ A;  1EF8 A;  1W2X A;  2C8T A;  3HIN A;  3TZ3 A;  3M6N A;  3PGQ A;  3T3W A;  1ON9 A;  4JJT A;  3TRR A;  3OME A;  3RRV A;  4HC8 A;  2FBM A;  3TVW A;  3U9T B;  2NP9 A;  4ZDC A;  4U0G H;  5INF A;  3TT6 A;  3QXI A;  5FIF A;  4B3I A;  5G1S A;  5INI A;  2CE3 A;  2F9I A;  3L3S A;  3MT6 A;  2PG8 A;  3HE2 A;  3N6R B;  2FZS A;  1WDK A;  3PE8 A;  1FC9 A;  3SLL A;  3G64 A;  4U0G A;  2ZL3 A;  3R6H A;  3DJA A;  4MOU A;  2VSS F;  3K50 A;  3GKB A;  1WDL A;  4Z0M A;  5KDR A;  4Q1I A;  2DUB A;  2EJ5 A;  3ISA A;  3HP0 A;  5DTP A;  3VIV A;  3H81 A;  3K8X A;  2CBY A;  3H0Q A;  1OD4 A;  2FW2 A;  1MJ3 A;  4FZW C;  5IKL B;  1TYF A;  2DEO A;  1DUB A;  3KTJ A;  3IB9 A;  3H0S A;  5G1R A;  1UYR A;  4MXI A;  2W3P A;  4GHN A;  1Y7O A;  1UYT A;  2HW5 A;  4FN8 A;  2GTR A;  4NNQ A;  3RSI A;  1UYS A;  4EMP A;  3PEA A;  3IAV A;  2F9Y A;  4JCS A;  1EY3 A;  1FCF A;  3NJD A;  4WCZ A;  4ZDB A;  5E0S H;  5DU4 A;  1UIY A;  4FB8 A;  4I42 A;  4JWV A;  2VSS E;  4DI1 A;  1PIX A;  5DU6 A;  3STA A;  4I52 A;  3T8A A;  3TDC A;  4ASI A;  3Q0J A;  3KTG A;  3I47 A;  2QQ3 A;  3FDU A;  2Q2X A;  3OC7 A;  3MOY A;  5DTW A;  4JFC A;  5G1Q A;  5E0S A;  4ELS A;  1VRG A;  3ZWB A;  1O8U A;  3QYR A;  3WG5 A;  3P2L A;  4MI2 A;  1TG6 A;  4K3W A;  4QFE A;  1RJM A;  4B3H A;  3T88 A;  5KJP A;  5MGB A;  4U0H A;  3QXZ A;  5DZK H;  4I4Z A;  3LKE A;  1K39 A;  1HNO A;  4ZDE A;  2PBP A;  2A7K A;  4GM2 A;  2J5I B;  4EMM A;  4ELW A;  1YG8 A;  3H0U A;  4KNP A;  2VSU C;  3ZWA A;  1WZ8 A;  3TV5 A;  1SG4 A;  2VSS A;  3H0J A;  2ZL2 A;  4WZ8 B;  3KTH A;  3OT6 A;  3QMJ A;  2VX2 A;  2VSU F;  4QII A;  5DZK A;  3SWX A;  5JBX A;  3IBB A;  5DKP A;  3BEZ A;  3ZWC A;  4FN7 A;  4NEK A;  3QKA A;  3JU1 A;  1YG6 A;  4G2R A;  2J5S A;  1N6D A;  1K32 A;  1HZD A;  1NZY B;  4RCN A;  4KPK A;  3R9T A;  3ZW9 A;  2UZF A;  1XX4 A;  4ZDD A;  3Q1T A;  4QIJ A;  3T89 A;  3HRX A;  4U18 A;  3ZW8 A;  4F47 A;  2ZQR A;  3V5I A;  2ZL0 A;  4RYF H;  1WDM A;  1X0U A;  4LK5 A;  2J5G D;  3V5E A;  3MYB A;  4OMR A;  3NJB A;  5CTB A;  1DCI A;  2VSU E;  1UYV A;  1XO6 A;  5CTC A;  4JVT A;  4K2N A;  1J7X A;  2IEX A;  4L6W A;  1XNW A;  2A7S A;  4Q0G A;  5FUS A;  3R9S A;  5C90 A;  4RYF A;  4B3J A;  4U19 A;  3MFM A;  1N6E A;  3RST A;  3GF7 A;  3FF6 A;  4EML A;  4IZB A;  3BF0 A;  3U9S B;  2J5G A;  2WTB A;  3U9R B;  1OD2 A;  3P5M A;  3Q0G A;  4KD6 A;  4OLQ A;  3R0O A;  3GMA A;  3KQF A;  2BZR A;  3P85 A;  1SZO A;  5C9G A;  3KTK A;  1N6F A;  3ST9 A;  4L8K A;  2F9I B;  4ZDF A;  5ING A;  2A81 A;  3LAO A;  2ZL4 A;  1Q52 A;  3QWD A;  4JYJ A;  4YLH A;  4IZD A;  3BPP A;  3T8B A;  4KWB A;  1HNU A;  4FND A;  4JOT A;  3H02 A;  2Q34 A;  3QK8 A;  3TVU A;  2D3T A;  4U1A A;  2J5I A;  4ELX A;  3GF3 A; 
#chains in the Genus database with same CATH topology
 1PJH A;  2J5I I;  1JXZ A;  5KDR B;  3HLN 1;  4IZC A;  5DUF A;  5E0N X;  2F6Q A;  5DL1 A;  1RJN A;  3DOR A;  2VSU A;  1FC6 A;  3QRE A;  3BPT A;  1XNV A;  5DU8 A;  4HNK A;  4JCR A;  4OG1 A;  3TLF A;  4ZU2 A;  3KTI A;  1ON3 A;  1FC7 A;  4FZW A;  4K29 A;  5DUC A;  1NZY A;  3R9Q A;  2F6I A;  2X58 A;  2F9Y B;  1Q51 A;  2VRE A;  2X24 A;  3TT7 A;  4JCT A;  2PPY A;  1EF9 A;  5JBW A;  4JSB A;  4WYO B;  4FJW D;  3GLM A;  3M6M A;  4FNB A;  1XNY A;  4JYL A;  4JCQ A;  3Q7H A;  2Q35 A;  3PZK A;  2ZQQ A;  1EF8 A;  1W2X A;  2C8T A;  3HIN A;  3TZ3 A;  3M6N A;  3PGQ A;  3T3W A;  1ON9 A;  4JJT A;  3TRR A;  3OME A;  3RRV A;  4HC8 A;  2FBM A;  3TVW A;  3U9T B;  2NP9 A;  4ZDC A;  4U0G H;  5INF A;  3TT6 A;  3QXI A;  5FIF A;  4B3I A;  5G1S A;  5INI A;  2CE3 A;  2F9I A;  3L3S A;  3MT6 A;  2PG8 A;  3HE2 A;  3N6R B;  2FZS A;  1WDK A;  3PE8 A;  1FC9 A;  4J2U A;  3SLL A;  3G64 A;  4U0G A;  2ZL3 A;  3R6H A;  3DJA A;  4MOU A;  2VSS F;  3K50 A;  3GKB A;  1WDL A;  4Z0M A;  5KDR A;  4Q1I A;  2DUB A;  2EJ5 A;  3ISA A;  3HP0 A;  5DTP A;  3VIV A;  3H81 A;  3K8X A;  2CBY A;  3H0Q A;  1OD4 A;  2FW2 A;  1MJ3 A;  4FZW C;  5IKL B;  1TYF A;  2DEO A;  1DUB A;  3KTJ A;  3IB9 A;  3H0S A;  5G1R A;  1UYR A;  2YJG A;  4MXI A;  2W3P A;  4GHN A;  1Y7O A;  1UYT A;  2HW5 A;  4FN8 A;  5HUQ A;  2GTR A;  4NNQ A;  3RSI A;  1UYS A;  4EMP A;  3PEA A;  3IAV A;  2F9Y A;  4JCS A;  1EY3 A;  1FCF A;  3NJD A;  4WCZ A;  4ZDB A;  5E0S H;  5DU4 A;  1UIY A;  4FB8 A;  4I42 A;  4JWV A;  4HDT A;  2VSS E;  4DI1 A;  1PIX A;  5DU6 A;  3STA A;  4I52 A;  3T8A A;  3TDC A;  4ASI A;  3Q0J A;  3KTG A;  3I47 A;  2QQ3 A;  3FDU A;  2Q2X A;  3OC7 A;  3MOY A;  5DTW A;  4JFC A;  5G1Q A;  5E0S A;  4ELS A;  1VRG A;  3ZWB A;  1O8U A;  3QYR A;  3WG5 A;  3P2L A;  4MI2 A;  1TG6 A;  4K3W A;  4QFE A;  1RJM A;  4NAR A;  4B3H A;  3T88 A;  5KJP A;  5MGB A;  4U0H A;  3QXZ A;  5DZK H;  4I4Z A;  3LKE A;  1K39 A;  1HNO A;  4ZDE A;  2PBP A;  2A7K A;  4GM2 A;  2J5I B;  4EMM A;  4ELW A;  1YG8 A;  3H0U A;  4KNP A;  2VSU C;  3ZWA A;  1WZ8 A;  3TV5 A;  1SG4 A;  2VSS A;  3H0J A;  2ZL2 A;  4WZ8 B;  3KTH A;  3OT6 A;  3QMJ A;  2VX2 A;  2VSU F;  4QII A;  5DZK A;  3SWX A;  5JBX A;  3IBB A;  5DKP A;  3BEZ A;  3ZWC A;  4FN7 A;  4NEK A;  3QKA A;  3JU1 A;  1YG6 A;  4G2R A;  2J5S A;  1N6D A;  1K32 A;  1HZD A;  1NZY B;  4RCN A;  4KPK A;  3R9T A;  3ZW9 A;  2UZF A;  1XX4 A;  4ZDD A;  3Q1T A;  4QIJ A;  3T89 A;  3HRX A;  4U18 A;  3ZW8 A;  4F47 A;  2ZQR A;  3V5I A;  2ZL0 A;  4RYF H;  1WDM A;  1X0U A;  4LK5 A;  2J5G D;  3V5E A;  3MYB A;  4OMR A;  3NJB A;  5CTB A;  1DCI A;  2VSU E;  1UYV A;  1XO6 A;  5CTC A;  4JVT A;  4K2N A;  1J7X A;  2IEX A;  4L6W A;  1XNW A;  2A7S A;  4Q0G A;  5FUS A;  3R9S A;  5C90 A;  4RYF A;  4B3J A;  4U19 A;  3MFM A;  1N6E A;  3RST A;  3GF7 A;  3FF6 A;  4EML A;  4IZB A;  3BF0 A;  3U9S B;  2J5G A;  2WTB A;  3U9R B;  1OD2 A;  3P5M A;  3Q0G A;  4KD6 A;  4OLQ A;  3R0O A;  3GMA A;  3KQF A;  2BZR A;  3P85 A;  1SZO A;  5C9G A;  3KTK A;  1N6F A;  3ST9 A;  4L8K A;  2F9I B;  4ZDF A;  5ING A;  2A81 A;  3LAO A;  2ZL4 A;  1Q52 A;  3QWD A;  4JYJ A;  4YLH A;  4IZD A;  3BPP A;  3T8B A;  4KWB A;  1HNU A;  4FND A;  4JOT A;  3H02 A;  2Q34 A;  3QK8 A;  3TVU A;  2D3T A;  4U1A A;  2J5I A;  4ELX A;  3GF3 A; 
#chains in the Genus database with same CATH homology
 1PJH A;  2J5I I;  1JXZ A;  5KDR B;  3HLN 1;  4IZC A;  5DUF A;  5E0N X;  2F6Q A;  5DL1 A;  1RJN A;  3DOR A;  2VSU A;  1FC6 A;  3QRE A;  3BPT A;  1XNV A;  5DU8 A;  4HNK A;  4JCR A;  4OG1 A;  3TLF A;  4ZU2 A;  3KTI A;  1ON3 A;  1FC7 A;  4FZW A;  4K29 A;  5DUC A;  1NZY A;  3R9Q A;  2F6I A;  2X58 A;  2F9Y B;  1Q51 A;  2VRE A;  2X24 A;  3TT7 A;  4JCT A;  2PPY A;  1EF9 A;  5JBW A;  4JSB A;  4WYO B;  4FJW D;  3GLM A;  3M6M A;  4FNB A;  1XNY A;  4JYL A;  4JCQ A;  3Q7H A;  2Q35 A;  3PZK A;  2ZQQ A;  1EF8 A;  1W2X A;  2C8T A;  3HIN A;  3TZ3 A;  3M6N A;  3PGQ A;  3T3W A;  1ON9 A;  4JJT A;  3TRR A;  3OME A;  3RRV A;  4HC8 A;  2FBM A;  3TVW A;  3U9T B;  2NP9 A;  4ZDC A;  4U0G H;  5INF A;  3TT6 A;  3QXI A;  5FIF A;  4B3I A;  5G1S A;  5INI A;  2CE3 A;  2F9I A;  3L3S A;  3MT6 A;  2PG8 A;  3HE2 A;  3N6R B;  2FZS A;  1WDK A;  3PE8 A;  1FC9 A;  4J2U A;  3SLL A;  3G64 A;  4U0G A;  2ZL3 A;  3R6H A;  3DJA A;  4MOU A;  2VSS F;  3K50 A;  3GKB A;  1WDL A;  4Z0M A;  5KDR A;  4Q1I A;  2DUB A;  2EJ5 A;  3ISA A;  3HP0 A;  5DTP A;  3VIV A;  3H81 A;  3K8X A;  2CBY A;  3H0Q A;  1OD4 A;  2FW2 A;  1MJ3 A;  4FZW C;  5IKL B;  1TYF A;  2DEO A;  1DUB A;  3KTJ A;  3IB9 A;  3H0S A;  5G1R A;  1UYR A;  2YJG A;  4MXI A;  2W3P A;  4GHN A;  1Y7O A;  1UYT A;  2HW5 A;  4FN8 A;  5HUQ A;  2GTR A;  4NNQ A;  3RSI A;  1UYS A;  4EMP A;  3PEA A;  3IAV A;  2F9Y A;  4JCS A;  1EY3 A;  1FCF A;  3NJD A;  4WCZ A;  4ZDB A;  5E0S H;  5DU4 A;  1UIY A;  4FB8 A;  4I42 A;  4JWV A;  4HDT A;  2VSS E;  4DI1 A;  1PIX A;  5DU6 A;  3STA A;  4I52 A;  3T8A A;  3TDC A;  4ASI A;  3Q0J A;  3KTG A;  3I47 A;  2QQ3 A;  3FDU A;  2Q2X A;  3OC7 A;  3MOY A;  5DTW A;  4JFC A;  5G1Q A;  5E0S A;  4ELS A;  1VRG A;  3ZWB A;  1O8U A;  3QYR A;  3WG5 A;  3P2L A;  4MI2 A;  1TG6 A;  4K3W A;  4QFE A;  1RJM A;  4NAR A;  4B3H A;  3T88 A;  5KJP A;  5MGB A;  4U0H A;  3QXZ A;  5DZK H;  4I4Z A;  3LKE A;  1K39 A;  1HNO A;  4ZDE A;  2PBP A;  2A7K A;  4GM2 A;  2J5I B;  4EMM A;  4ELW A;  1YG8 A;  3H0U A;  4KNP A;  2VSU C;  3ZWA A;  1WZ8 A;  3TV5 A;  1SG4 A;  2VSS A;  3H0J A;  2ZL2 A;  4WZ8 B;  3KTH A;  3OT6 A;  3QMJ A;  2VX2 A;  2VSU F;  4QII A;  5DZK A;  3SWX A;  5JBX A;  3IBB A;  5DKP A;  3BEZ A;  3ZWC A;  4FN7 A;  4NEK A;  3QKA A;  3JU1 A;  1YG6 A;  4G2R A;  2J5S A;  1N6D A;  1K32 A;  1HZD A;  1NZY B;  4RCN A;  4KPK A;  3R9T A;  3ZW9 A;  2UZF A;  1XX4 A;  4ZDD A;  3Q1T A;  4QIJ A;  3T89 A;  3HRX A;  4U18 A;  3ZW8 A;  4F47 A;  2ZQR A;  3V5I A;  2ZL0 A;  4RYF H;  1WDM A;  1X0U A;  4LK5 A;  2J5G D;  3V5E A;  3MYB A;  4OMR A;  3NJB A;  5CTB A;  1DCI A;  2VSU E;  1UYV A;  1XO6 A;  5CTC A;  4JVT A;  4K2N A;  1J7X A;  2IEX A;  4L6W A;  1XNW A;  2A7S A;  4Q0G A;  5FUS A;  3R9S A;  5C90 A;  4RYF A;  4B3J A;  4U19 A;  3MFM A;  1N6E A;  3RST A;  3GF7 A;  3FF6 A;  4EML A;  4IZB A;  3BF0 A;  3U9S B;  2J5G A;  2WTB A;  3U9R B;  1OD2 A;  3P5M A;  3Q0G A;  4KD6 A;  4OLQ A;  3R0O A;  3GMA A;  3KQF A;  2BZR A;  3P85 A;  1SZO A;  5C9G A;  3KTK A;  1N6F A;  3ST9 A;  4L8K A;  2F9I B;  4ZDF A;  5ING A;  2A81 A;  3LAO A;  2ZL4 A;  1Q52 A;  3QWD A;  4JYJ A;  4YLH A;  4IZD A;  3BPP A;  3T8B A;  4KWB A;  1HNU A;  4FND A;  4JOT A;  3H02 A;  2Q34 A;  3QK8 A;  3TVU A;  2D3T A;  4U1A A;  2J5I A;  4ELX A;  3GF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...