3KTKA

Structure of clpp in complex with adep2 in triclinic crystal form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
174
structure length
174
Chain Sequence
b'DIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDTMQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEALEYGLIDKILTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent Clp protease proteolytic subunit
publication title Structures of ClpP in complex with acyldepsipeptide antibiotics reveal its activation mechanism
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase/antibiotic
total genus 63
structure length 174
sequence length 174
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ktkA00
5E0NX 3IB9A 2VX2A 3BEZA 5DZKH 3QKAA 4ZDDA 1XX4A 2PG8A 1WZ8A 4ELXA 4RYFA 3T3WA 3RSTA 2VSUC 4FZWC 3U9TB 2CBYA 3H0UA 3G64A 3TV5A 2D3TA 2VSUE 1O8UA 4G2RA 1XO6A 3GF3A 3V5EA 1SZOA 1VRGA 1HNOA 2F6QA 3K8XA 1ON9A 3P2LA 3GKBA 3ISAA 4JVTA 5CTBA 3VIVA 4JYLA 3Q7HA 1Q52A 5DU4A 5DTWA 3T8AA 3Q0GA 3HP0A 3RRVA 2W3PA 4I52A 3RSIA 2X24A 2Q2XA 1X0UA 4ELSA 1WDKA 4ZDCA 1YG8A 4I4ZA 3KTKA 3JU1A 2A81A 4FZWA 3SLLA 4FNBA 3ZWBA 2VREA 1TG6A 5DU8A 1NZYA 3T88A 4IZBA 1XNVA 1SG4A 1N6FA 3TVUA 1DCIA 4DI1A 2HW5A 4JOTA 3PGQA 1UYSA 3QMJA 2VSSF 2UZFA 1N6DA 3H0JA 4JCQA 3M6MA 2F9YA 4HC8A 2WTBA 3M6NA 4QFEA 1RJNA 5DUFA 4B3HA 4B3IA 3MOYA 4FB8A 3DORA 1FC7A 1UYVA 4U0HA 3WG5A 4F47A 1OD4A 2FW2A 3TLFA 4EMMA 5E0SA 2ZL0A 3LAOA 1OD2A 1WDLA 3DJAA 4L8KA 1PIXA 2F6IA 5G1SA 5INFA 3NJBA 3QREA 4ZDBA 3T89A 3ST9A 4JJTA 1YG6A 1JXZA 3V5IA 1FCFA 4FN7A 2DEOA 3U9SB 3TT7A 4WZ8B 3ZWCA 2Q35A 3KTJA 4RYFH 3H81A 3QK8A 1FC9A 3HINA 3PEAA 4OMRA 4MI2A 2VSUF 3KTHA 1PJHA 2DUBA 4EMPA 3ZW8A 5G1RA 1TYFA 2A7SA 3MT6A 4B3JA 4OG1A 4QIJA 1EF8A 5DTPA 2J5IB 5FUSA 3FF6A 3TVWA 4ASIA 1XNYA 3QXIA 1MJ3A 3PE8A 4LK5A 4Z0MA 4JFCA 3HLN1 3N6RB 4ZDFA 4KNPA 4JWVA 3QXZA 1HNUA 1N6EA 3R9TA 2PBPA 2F9IA 5MGBA 1K32A 1NZYB 3KTIA 4GHNA 1EF9A 3GLMA 3PZKA 2ZQRA 3QWDA 5FIFA 4K3WA 1EY3A 2J5II 5KJPA 2BZRA 3GMAA 4YLHA 2ZQQA 3STAA 4FJWD 3Q1TA 4QIIA 2F9YB 1ON3A 4KD6A 5JBWA 2CE3A 3R6HA 5KDRA 3IBBA 4MOUA 4Q0GA 4JSBA 4K2NA 3FDUA 5DL1A 2J5GA 3Q0JA 3TT6A 3OC7A 4U0GA 1Q51A 4WYOB 4NNQA 5E0SH 3R0OA 3BPPA 1K39A 4KPKA 4Q1IA 3HE2A 2ZL2A 5DZKA 1UIYA 3ZWAA 1WDMA 2Q34A 4WCZA 3TRRA 2FBMA 3R9QA 3T8BA 5INGA 5C90A 4U1AA 3MFMA 4JYJA 4L6WA 5DUCA 2VSSA 2FZSA 3TZ3A 3H02A 3K50A 2J5SA 2IEXA 4KWBA 3R9SA 2EJ5A 3U9RB 3QYRA 1UYRA 1UYTA 4JCTA 5DU6A 4JCSA 3ZW9A 1RJMA 4JCRA 4RCNA 3SWXA 2PPYA 3OMEA 2GTRA 2X58A 2J5IA 3P5MA 5JBXA 4MXIA 2C8TA 3KQFA 1Y7OA 3P85A 4EMLA 4ZU2A 1J7XA 1FC6A 3KTGA 1XNWA 2ZL3A 2F9IB 3HRXA 5INIA 4ZDEA 2VSUA 4HNKA 3IAVA 3H0SA 4IZCA 3TDCA 2J5GD 4K29A 5CTCA 1DUBA 3BF0A 1HZDA 2QQ3A 4GM2A 2ZL4A 5C9GA 2VSSE 3MYBA 4FNDA 5KDRB 3NJDA 3GF7A 4U18A 4IZDA 4FN8A 4ELWA 3H0QA 3I47A 4I42A 5IKLB 3OT6A 5DKPA 4U0GH 3LKEA 1W2XA 2NP9A 4NEKA 2A7KA 4OLQA 5G1QA 3L3SA 4U19A
chains in the Genus database with same CATH superfamily
5E0NX 3IB9A 2VX2A 3BEZA 5DZKH 3QKAA 4ZDDA 1XX4A 2PG8A 1WZ8A 4ELXA 4RYFA 3T3WA 3RSTA 2VSUC 4FZWC 3U9TB 2CBYA 3H0UA 3G64A 3TV5A 2D3TA 2VSUE 1O8UA 4G2RA 1XO6A 3GF3A 3V5EA 1SZOA 1VRGA 1HNOA 2F6QA 3K8XA 1ON9A 3P2LA 3GKBA 3ISAA 4JVTA 5CTBA 3VIVA 4JYLA 3Q7HA 1Q52A 5DU4A 5DTWA 3T8AA 3Q0GA 3HP0A 3RRVA 2W3PA 4I52A 3RSIA 2X24A 2Q2XA 1X0UA 4ELSA 1WDKA 4ZDCA 1YG8A 4I4ZA 3KTKA 3JU1A 2A81A 4FZWA 3SLLA 4FNBA 4HDTA 3ZWBA 2VREA 1TG6A 5DU8A 1NZYA 3T88A 4IZBA 1XNVA 1SG4A 1N6FA 3TVUA 1DCIA 4DI1A 2HW5A 4JOTA 3PGQA 1UYSA 3QMJA 2VSSF 2UZFA 1N6DA 3H0JA 4JCQA 3M6MA 2F9YA 4HC8A 2WTBA 3M6NA 4QFEA 1RJNA 5DUFA 4B3HA 4B3IA 3MOYA 4FB8A 3DORA 1FC7A 1UYVA 4U0HA 3WG5A 4F47A 1OD4A 2FW2A 3TLFA 4EMMA 5E0SA 2ZL0A 3LAOA 1OD2A 1WDLA 3DJAA 4L8KA 1PIXA 2F6IA 5G1SA 5INFA 3NJBA 3QREA 4ZDBA 3T89A 4J2UA 3ST9A 4JJTA 1YG6A 1JXZA 3V5IA 1FCFA 4FN7A 2DEOA 3U9SB 3TT7A 4WZ8B 3ZWCA 5HUQA 2Q35A 3KTJA 4RYFH 3H81A 3QK8A 1FC9A 3HINA 3PEAA 4OMRA 4MI2A 2VSUF 3KTHA 1PJHA 2DUBA 4EMPA 3ZW8A 5G1RA 1TYFA 2A7SA 3MT6A 4B3JA 4OG1A 4QIJA 1EF8A 5DTPA 2J5IB 5FUSA 3FF6A 3TVWA 4ASIA 1XNYA 3QXIA 1MJ3A 3PE8A 4LK5A 4Z0MA 4JFCA 3HLN1 3N6RB 4ZDFA 4KNPA 4JWVA 3QXZA 4NARA 1HNUA 1N6EA 3R9TA 2PBPA 2F9IA 5MGBA 1K32A 1NZYB 3KTIA 4GHNA 1EF9A 3GLMA 3PZKA 2ZQRA 3QWDA 5FIFA 4K3WA 1EY3A 2J5II 5KJPA 2BZRA 3GMAA 4YLHA 2ZQQA 3STAA 4FJWD 3Q1TA 4QIIA 2F9YB 1ON3A 4KD6A 5JBWA 2CE3A 3R6HA 5KDRA 3IBBA 4MOUA 4Q0GA 4JSBA 4K2NA 3FDUA 5DL1A 2J5GA 3Q0JA 3TT6A 3OC7A 4U0GA 1Q51A 4WYOB 4NNQA 5E0SH 3R0OA 3BPPA 1K39A 4KPKA 4Q1IA 3HE2A 2ZL2A 5DZKA 1UIYA 2YJGA 3ZWAA 1WDMA 2Q34A 4WCZA 3TRRA 2FBMA 3R9QA 3T8BA 5INGA 5C90A 4U1AA 3MFMA 4JYJA 4L6WA 5DUCA 2VSSA 2FZSA 3TZ3A 3H02A 3K50A 2J5SA 2IEXA 4KWBA 3R9SA 2EJ5A 3U9RB 3QYRA 1UYRA 1UYTA 4JCTA 5DU6A 4JCSA 3ZW9A 1RJMA 4JCRA 4RCNA 3SWXA 2PPYA 3OMEA 2GTRA 2X58A 2J5IA 3P5MA 5JBXA 4MXIA 2C8TA 3KQFA 1Y7OA 3BPTA 3P85A 4EMLA 4ZU2A 1J7XA 1FC6A 3KTGA 1XNWA 2ZL3A 2F9IB 3HRXA 5INIA 4ZDEA 2VSUA 4HNKA 3IAVA 3H0SA 4IZCA 3TDCA 2J5GD 4K29A 5CTCA 1DUBA 3BF0A 1HZDA 2QQ3A 4GM2A 2ZL4A 5C9GA 2VSSE 3MYBA 4FNDA 5KDRB 3NJDA 3GF7A 4U18A 4IZDA 4FN8A 4ELWA 3H0QA 3I47A 4I42A 5IKLB 3OT6A 5DKPA 4U0GH 3LKEA 1W2XA 2NP9A 4NEKA 2A7KA 4OLQA 5G1QA 3L3SA 4U19A
chains in the Genus database with same CATH topology
5E0NX 3IB9A 2VX2A 3BEZA 5DZKH 3QKAA 4ZDDA 1XX4A 2PG8A 1WZ8A 4ELXA 4RYFA 3T3WA 3RSTA 2VSUC 4FZWC 3U9TB 2CBYA 3H0UA 3G64A 3TV5A 2D3TA 2VSUE 1O8UA 4G2RA 1XO6A 3GF3A 3V5EA 1SZOA 1VRGA 1HNOA 2F6QA 3K8XA 1ON9A 3P2LA 3GKBA 3ISAA 4JVTA 5CTBA 3VIVA 4JYLA 3Q7HA 1Q52A 5DU4A 5DTWA 3T8AA 3Q0GA 3HP0A 3RRVA 2W3PA 4I52A 3RSIA 2X24A 2Q2XA 1X0UA 4ELSA 1WDKA 4ZDCA 1YG8A 4I4ZA 3KTKA 3JU1A 2A81A 4FZWA 3SLLA 4FNBA 4HDTA 3ZWBA 2VREA 1TG6A 5DU8A 1NZYA 3T88A 4IZBA 1XNVA 1SG4A 1N6FA 3TVUA 1DCIA 4DI1A 2HW5A 4JOTA 3PGQA 1UYSA 3QMJA 2VSSF 2UZFA 1N6DA 3H0JA 4JCQA 3M6MA 2F9YA 4HC8A 2WTBA 3M6NA 4QFEA 1RJNA 5DUFA 4B3HA 4B3IA 3MOYA 4FB8A 3DORA 1FC7A 1UYVA 4U0HA 3WG5A 4F47A 1OD4A 2FW2A 3TLFA 4EMMA 5E0SA 2ZL0A 3LAOA 1OD2A 1WDLA 3DJAA 4L8KA 1PIXA 2F6IA 5G1SA 5INFA 3NJBA 3QREA 4ZDBA 3T89A 4J2UA 3ST9A 4JJTA 1YG6A 1JXZA 3V5IA 1FCFA 4FN7A 2DEOA 3U9SB 3TT7A 4WZ8B 3ZWCA 5HUQA 2Q35A 3KTJA 4RYFH 3H81A 3QK8A 1FC9A 3HINA 3PEAA 4OMRA 4MI2A 2VSUF 3KTHA 1PJHA 2DUBA 4EMPA 3ZW8A 5G1RA 1TYFA 2A7SA 3MT6A 4B3JA 4OG1A 4QIJA 1EF8A 5DTPA 2J5IB 5FUSA 3FF6A 3TVWA 4ASIA 1XNYA 3QXIA 1MJ3A 3PE8A 4LK5A 4Z0MA 4JFCA 3HLN1 3N6RB 4ZDFA 4KNPA 4JWVA 3QXZA 4NARA 1HNUA 1N6EA 3R9TA 2PBPA 2F9IA 5MGBA 1K32A 1NZYB 3KTIA 4GHNA 1EF9A 3GLMA 3PZKA 2ZQRA 3QWDA 5FIFA 4K3WA 1EY3A 2J5II 5KJPA 2BZRA 3GMAA 4YLHA 2ZQQA 3STAA 4FJWD 3Q1TA 4QIIA 2F9YB 1ON3A 4KD6A 5JBWA 2CE3A 3R6HA 5KDRA 3IBBA 4MOUA 4Q0GA 4JSBA 4K2NA 3FDUA 5DL1A 2J5GA 3Q0JA 3TT6A 3OC7A 4U0GA 1Q51A 4WYOB 4NNQA 5E0SH 3R0OA 3BPPA 1K39A 4KPKA 4Q1IA 3HE2A 2ZL2A 5DZKA 1UIYA 2YJGA 3ZWAA 1WDMA 2Q34A 4WCZA 3TRRA 2FBMA 3R9QA 3T8BA 5INGA 5C90A 4U1AA 3MFMA 4JYJA 4L6WA 5DUCA 2VSSA 2FZSA 3TZ3A 3H02A 3K50A 2J5SA 2IEXA 4KWBA 3R9SA 2EJ5A 3U9RB 3QYRA 1UYRA 1UYTA 4JCTA 5DU6A 4JCSA 3ZW9A 1RJMA 4JCRA 4RCNA 3SWXA 2PPYA 3OMEA 2GTRA 2X58A 2J5IA 3P5MA 5JBXA 4MXIA 2C8TA 3KQFA 1Y7OA 3BPTA 3P85A 4EMLA 4ZU2A 1J7XA 1FC6A 3KTGA 1XNWA 2ZL3A 2F9IB 3HRXA 5INIA 4ZDEA 2VSUA 4HNKA 3IAVA 3H0SA 4IZCA 3TDCA 2J5GD 4K29A 5CTCA 1DUBA 3BF0A 1HZDA 2QQ3A 4GM2A 2ZL4A 5C9GA 2VSSE 3MYBA 4FNDA 5KDRB 3NJDA 3GF7A 4U18A 4IZDA 4FN8A 4ELWA 3H0QA 3I47A 4I42A 5IKLB 3OT6A 5DKPA 4U0GH 3LKEA 1W2XA 2NP9A 4NEKA 2A7KA 4OLQA 5G1QA 3L3SA 4U19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E0N X;  3IB9 A;  2VX2 A;  3BEZ A;  5DZK H;  3QKA A;  4ZDD A;  1XX4 A;  2PG8 A;  1WZ8 A;  4ELX A;  4RYF A;  3T3W A;  3RST A;  2VSU C;  4FZW C;  3U9T B;  2CBY A;  3H0U A;  3G64 A;  3TV5 A;  2D3T A;  2VSU E;  1O8U A;  4G2R A;  1XO6 A;  3GF3 A;  3V5E A;  1SZO A;  1VRG A;  1HNO A;  2F6Q A;  3K8X A;  1ON9 A;  3P2L A;  3GKB A;  3ISA A;  4JVT A;  5CTB A;  3VIV A;  4JYL A;  3Q7H A;  1Q52 A;  5DU4 A;  5DTW A;  3T8A A;  3Q0G A;  3HP0 A;  3RRV A;  2W3P A;  4I52 A;  3RSI A;  2X24 A;  2Q2X A;  1X0U A;  4ELS A;  1WDK A;  4ZDC A;  1YG8 A;  4I4Z A;  3KTK A;  3JU1 A;  2A81 A;  4FZW A;  3SLL A;  4FNB A;  3ZWB A;  2VRE A;  1TG6 A;  5DU8 A;  1NZY A;  3T88 A;  4IZB A;  1XNV A;  1SG4 A;  1N6F A;  3TVU A;  1DCI A;  4DI1 A;  2HW5 A;  4JOT A;  3PGQ A;  1UYS A;  3QMJ A;  2VSS F;  2UZF A;  1N6D A;  3H0J A;  4JCQ A;  3M6M A;  2F9Y A;  4HC8 A;  2WTB A;  3M6N A;  4QFE A;  1RJN A;  5DUF A;  4B3H A;  4B3I A;  3MOY A;  4FB8 A;  3DOR A;  1FC7 A;  1UYV A;  4U0H A;  3WG5 A;  4F47 A;  1OD4 A;  2FW2 A;  3TLF A;  4EMM A;  5E0S A;  2ZL0 A;  3LAO A;  1OD2 A;  1WDL A;  3DJA A;  4L8K A;  1PIX A;  2F6I A;  5G1S A;  5INF A;  3NJB A;  3QRE A;  4ZDB A;  3T89 A;  3ST9 A;  4JJT A;  1YG6 A;  1JXZ A;  3V5I A;  1FCF A;  4FN7 A;  2DEO A;  3U9S B;  3TT7 A;  4WZ8 B;  3ZWC A;  2Q35 A;  3KTJ A;  4RYF H;  3H81 A;  3QK8 A;  1FC9 A;  3HIN A;  3PEA A;  4OMR A;  4MI2 A;  2VSU F;  3KTH A;  1PJH A;  2DUB A;  4EMP A;  3ZW8 A;  5G1R A;  1TYF A;  2A7S A;  3MT6 A;  4B3J A;  4OG1 A;  4QIJ A;  1EF8 A;  5DTP A;  2J5I B;  5FUS A;  3FF6 A;  3TVW A;  4ASI A;  1XNY A;  3QXI A;  1MJ3 A;  3PE8 A;  4LK5 A;  4Z0M A;  4JFC A;  3HLN 1;  3N6R B;  4ZDF A;  4KNP A;  4JWV A;  3QXZ A;  1HNU A;  1N6E A;  3R9T A;  2PBP A;  2F9I A;  5MGB A;  1K32 A;  1NZY B;  3KTI A;  4GHN A;  1EF9 A;  3GLM A;  3PZK A;  2ZQR A;  3QWD A;  5FIF A;  4K3W A;  1EY3 A;  2J5I I;  5KJP A;  2BZR A;  3GMA A;  4YLH A;  2ZQQ A;  3STA A;  4FJW D;  3Q1T A;  4QII A;  2F9Y B;  1ON3 A;  4KD6 A;  5JBW A;  2CE3 A;  3R6H A;  5KDR A;  3IBB A;  4MOU A;  4Q0G A;  4JSB A;  4K2N A;  3FDU A;  5DL1 A;  2J5G A;  3Q0J A;  3TT6 A;  3OC7 A;  4U0G A;  1Q51 A;  4WYO B;  4NNQ A;  5E0S H;  3R0O A;  3BPP A;  1K39 A;  4KPK A;  4Q1I A;  3HE2 A;  2ZL2 A;  5DZK A;  1UIY A;  3ZWA A;  1WDM A;  2Q34 A;  4WCZ A;  3TRR A;  2FBM A;  3R9Q A;  3T8B A;  5ING A;  5C90 A;  4U1A A;  3MFM A;  4JYJ A;  4L6W A;  5DUC A;  2VSS A;  2FZS A;  3TZ3 A;  3H02 A;  3K50 A;  2J5S A;  2IEX A;  4KWB A;  3R9S A;  2EJ5 A;  3U9R B;  3QYR A;  1UYR A;  1UYT A;  4JCT A;  5DU6 A;  4JCS A;  3ZW9 A;  1RJM A;  4JCR A;  4RCN A;  3SWX A;  2PPY A;  3OME A;  2GTR A;  2X58 A;  2J5I A;  3P5M A;  5JBX A;  4MXI A;  2C8T A;  3KQF A;  1Y7O A;  3P85 A;  4EML A;  4ZU2 A;  1J7X A;  1FC6 A;  3KTG A;  1XNW A;  2ZL3 A;  2F9I B;  3HRX A;  5INI A;  4ZDE A;  2VSU A;  4HNK A;  3IAV A;  3H0S A;  4IZC A;  3TDC A;  2J5G D;  4K29 A;  5CTC A;  1DUB A;  3BF0 A;  1HZD A;  2QQ3 A;  4GM2 A;  2ZL4 A;  5C9G A;  2VSS E;  3MYB A;  4FND A;  5KDR B;  3NJD A;  3GF7 A;  4U18 A;  4IZD A;  4FN8 A;  4ELW A;  3H0Q A;  3I47 A;  4I42 A;  5IKL B;  3OT6 A;  5DKP A;  4U0G H;  3LKE A;  1W2X A;  2NP9 A;  4NEK A;  2A7K A;  4OLQ A;  5G1Q A;  3L3S A;  4U19 A; 
#chains in the Genus database with same CATH topology
 5E0N X;  3IB9 A;  2VX2 A;  3BEZ A;  5DZK H;  3QKA A;  4ZDD A;  1XX4 A;  2PG8 A;  1WZ8 A;  4ELX A;  4RYF A;  3T3W A;  3RST A;  2VSU C;  4FZW C;  3U9T B;  2CBY A;  3H0U A;  3G64 A;  3TV5 A;  2D3T A;  2VSU E;  1O8U A;  4G2R A;  1XO6 A;  3GF3 A;  3V5E A;  1SZO A;  1VRG A;  1HNO A;  2F6Q A;  3K8X A;  1ON9 A;  3P2L A;  3GKB A;  3ISA A;  4JVT A;  5CTB A;  3VIV A;  4JYL A;  3Q7H A;  1Q52 A;  5DU4 A;  5DTW A;  3T8A A;  3Q0G A;  3HP0 A;  3RRV A;  2W3P A;  4I52 A;  3RSI A;  2X24 A;  2Q2X A;  1X0U A;  4ELS A;  1WDK A;  4ZDC A;  1YG8 A;  4I4Z A;  3KTK A;  3JU1 A;  2A81 A;  4FZW A;  3SLL A;  4FNB A;  4HDT A;  3ZWB A;  2VRE A;  1TG6 A;  5DU8 A;  1NZY A;  3T88 A;  4IZB A;  1XNV A;  1SG4 A;  1N6F A;  3TVU A;  1DCI A;  4DI1 A;  2HW5 A;  4JOT A;  3PGQ A;  1UYS A;  3QMJ A;  2VSS F;  2UZF A;  1N6D A;  3H0J A;  4JCQ A;  3M6M A;  2F9Y A;  4HC8 A;  2WTB A;  3M6N A;  4QFE A;  1RJN A;  5DUF A;  4B3H A;  4B3I A;  3MOY A;  4FB8 A;  3DOR A;  1FC7 A;  1UYV A;  4U0H A;  3WG5 A;  4F47 A;  1OD4 A;  2FW2 A;  3TLF A;  4EMM A;  5E0S A;  2ZL0 A;  3LAO A;  1OD2 A;  1WDL A;  3DJA A;  4L8K A;  1PIX A;  2F6I A;  5G1S A;  5INF A;  3NJB A;  3QRE A;  4ZDB A;  3T89 A;  4J2U A;  3ST9 A;  4JJT A;  1YG6 A;  1JXZ A;  3V5I A;  1FCF A;  4FN7 A;  2DEO A;  3U9S B;  3TT7 A;  4WZ8 B;  3ZWC A;  5HUQ A;  2Q35 A;  3KTJ A;  4RYF H;  3H81 A;  3QK8 A;  1FC9 A;  3HIN A;  3PEA A;  4OMR A;  4MI2 A;  2VSU F;  3KTH A;  1PJH A;  2DUB A;  4EMP A;  3ZW8 A;  5G1R A;  1TYF A;  2A7S A;  3MT6 A;  4B3J A;  4OG1 A;  4QIJ A;  1EF8 A;  5DTP A;  2J5I B;  5FUS A;  3FF6 A;  3TVW A;  4ASI A;  1XNY A;  3QXI A;  1MJ3 A;  3PE8 A;  4LK5 A;  4Z0M A;  4JFC A;  3HLN 1;  3N6R B;  4ZDF A;  4KNP A;  4JWV A;  3QXZ A;  4NAR A;  1HNU A;  1N6E A;  3R9T A;  2PBP A;  2F9I A;  5MGB A;  1K32 A;  1NZY B;  3KTI A;  4GHN A;  1EF9 A;  3GLM A;  3PZK A;  2ZQR A;  3QWD A;  5FIF A;  4K3W A;  1EY3 A;  2J5I I;  5KJP A;  2BZR A;  3GMA A;  4YLH A;  2ZQQ A;  3STA A;  4FJW D;  3Q1T A;  4QII A;  2F9Y B;  1ON3 A;  4KD6 A;  5JBW A;  2CE3 A;  3R6H A;  5KDR A;  3IBB A;  4MOU A;  4Q0G A;  4JSB A;  4K2N A;  3FDU A;  5DL1 A;  2J5G A;  3Q0J A;  3TT6 A;  3OC7 A;  4U0G A;  1Q51 A;  4WYO B;  4NNQ A;  5E0S H;  3R0O A;  3BPP A;  1K39 A;  4KPK A;  4Q1I A;  3HE2 A;  2ZL2 A;  5DZK A;  1UIY A;  2YJG A;  3ZWA A;  1WDM A;  2Q34 A;  4WCZ A;  3TRR A;  2FBM A;  3R9Q A;  3T8B A;  5ING A;  5C90 A;  4U1A A;  3MFM A;  4JYJ A;  4L6W A;  5DUC A;  2VSS A;  2FZS A;  3TZ3 A;  3H02 A;  3K50 A;  2J5S A;  2IEX A;  4KWB A;  3R9S A;  2EJ5 A;  3U9R B;  3QYR A;  1UYR A;  1UYT A;  4JCT A;  5DU6 A;  4JCS A;  3ZW9 A;  1RJM A;  4JCR A;  4RCN A;  3SWX A;  2PPY A;  3OME A;  2GTR A;  2X58 A;  2J5I A;  3P5M A;  5JBX A;  4MXI A;  2C8T A;  3KQF A;  1Y7O A;  3BPT A;  3P85 A;  4EML A;  4ZU2 A;  1J7X A;  1FC6 A;  3KTG A;  1XNW A;  2ZL3 A;  2F9I B;  3HRX A;  5INI A;  4ZDE A;  2VSU A;  4HNK A;  3IAV A;  3H0S A;  4IZC A;  3TDC A;  2J5G D;  4K29 A;  5CTC A;  1DUB A;  3BF0 A;  1HZD A;  2QQ3 A;  4GM2 A;  2ZL4 A;  5C9G A;  2VSS E;  3MYB A;  4FND A;  5KDR B;  3NJD A;  3GF7 A;  4U18 A;  4IZD A;  4FN8 A;  4ELW A;  3H0Q A;  3I47 A;  4I42 A;  5IKL B;  3OT6 A;  5DKP A;  4U0G H;  3LKE A;  1W2X A;  2NP9 A;  4NEK A;  2A7K A;  4OLQ A;  5G1Q A;  3L3S A;  4U19 A; 
#chains in the Genus database with same CATH homology
 5E0N X;  3IB9 A;  2VX2 A;  3BEZ A;  5DZK H;  3QKA A;  4ZDD A;  1XX4 A;  2PG8 A;  1WZ8 A;  4ELX A;  4RYF A;  3T3W A;  3RST A;  2VSU C;  4FZW C;  3U9T B;  2CBY A;  3H0U A;  3G64 A;  3TV5 A;  2D3T A;  2VSU E;  1O8U A;  4G2R A;  1XO6 A;  3GF3 A;  3V5E A;  1SZO A;  1VRG A;  1HNO A;  2F6Q A;  3K8X A;  1ON9 A;  3P2L A;  3GKB A;  3ISA A;  4JVT A;  5CTB A;  3VIV A;  4JYL A;  3Q7H A;  1Q52 A;  5DU4 A;  5DTW A;  3T8A A;  3Q0G A;  3HP0 A;  3RRV A;  2W3P A;  4I52 A;  3RSI A;  2X24 A;  2Q2X A;  1X0U A;  4ELS A;  1WDK A;  4ZDC A;  1YG8 A;  4I4Z A;  3KTK A;  3JU1 A;  2A81 A;  4FZW A;  3SLL A;  4FNB A;  4HDT A;  3ZWB A;  2VRE A;  1TG6 A;  5DU8 A;  1NZY A;  3T88 A;  4IZB A;  1XNV A;  1SG4 A;  1N6F A;  3TVU A;  1DCI A;  4DI1 A;  2HW5 A;  4JOT A;  3PGQ A;  1UYS A;  3QMJ A;  2VSS F;  2UZF A;  1N6D A;  3H0J A;  4JCQ A;  3M6M A;  2F9Y A;  4HC8 A;  2WTB A;  3M6N A;  4QFE A;  1RJN A;  5DUF A;  4B3H A;  4B3I A;  3MOY A;  4FB8 A;  3DOR A;  1FC7 A;  1UYV A;  4U0H A;  3WG5 A;  4F47 A;  1OD4 A;  2FW2 A;  3TLF A;  4EMM A;  5E0S A;  2ZL0 A;  3LAO A;  1OD2 A;  1WDL A;  3DJA A;  4L8K A;  1PIX A;  2F6I A;  5G1S A;  5INF A;  3NJB A;  3QRE A;  4ZDB A;  3T89 A;  4J2U A;  3ST9 A;  4JJT A;  1YG6 A;  1JXZ A;  3V5I A;  1FCF A;  4FN7 A;  2DEO A;  3U9S B;  3TT7 A;  4WZ8 B;  3ZWC A;  5HUQ A;  2Q35 A;  3KTJ A;  4RYF H;  3H81 A;  3QK8 A;  1FC9 A;  3HIN A;  3PEA A;  4OMR A;  4MI2 A;  2VSU F;  3KTH A;  1PJH A;  2DUB A;  4EMP A;  3ZW8 A;  5G1R A;  1TYF A;  2A7S A;  3MT6 A;  4B3J A;  4OG1 A;  4QIJ A;  1EF8 A;  5DTP A;  2J5I B;  5FUS A;  3FF6 A;  3TVW A;  4ASI A;  1XNY A;  3QXI A;  1MJ3 A;  3PE8 A;  4LK5 A;  4Z0M A;  4JFC A;  3HLN 1;  3N6R B;  4ZDF A;  4KNP A;  4JWV A;  3QXZ A;  4NAR A;  1HNU A;  1N6E A;  3R9T A;  2PBP A;  2F9I A;  5MGB A;  1K32 A;  1NZY B;  3KTI A;  4GHN A;  1EF9 A;  3GLM A;  3PZK A;  2ZQR A;  3QWD A;  5FIF A;  4K3W A;  1EY3 A;  2J5I I;  5KJP A;  2BZR A;  3GMA A;  4YLH A;  2ZQQ A;  3STA A;  4FJW D;  3Q1T A;  4QII A;  2F9Y B;  1ON3 A;  4KD6 A;  5JBW A;  2CE3 A;  3R6H A;  5KDR A;  3IBB A;  4MOU A;  4Q0G A;  4JSB A;  4K2N A;  3FDU A;  5DL1 A;  2J5G A;  3Q0J A;  3TT6 A;  3OC7 A;  4U0G A;  1Q51 A;  4WYO B;  4NNQ A;  5E0S H;  3R0O A;  3BPP A;  1K39 A;  4KPK A;  4Q1I A;  3HE2 A;  2ZL2 A;  5DZK A;  1UIY A;  2YJG A;  3ZWA A;  1WDM A;  2Q34 A;  4WCZ A;  3TRR A;  2FBM A;  3R9Q A;  3T8B A;  5ING A;  5C90 A;  4U1A A;  3MFM A;  4JYJ A;  4L6W A;  5DUC A;  2VSS A;  2FZS A;  3TZ3 A;  3H02 A;  3K50 A;  2J5S A;  2IEX A;  4KWB A;  3R9S A;  2EJ5 A;  3U9R B;  3QYR A;  1UYR A;  1UYT A;  4JCT A;  5DU6 A;  4JCS A;  3ZW9 A;  1RJM A;  4JCR A;  4RCN A;  3SWX A;  2PPY A;  3OME A;  2GTR A;  2X58 A;  2J5I A;  3P5M A;  5JBX A;  4MXI A;  2C8T A;  3KQF A;  1Y7O A;  3BPT A;  3P85 A;  4EML A;  4ZU2 A;  1J7X A;  1FC6 A;  3KTG A;  1XNW A;  2ZL3 A;  2F9I B;  3HRX A;  5INI A;  4ZDE A;  2VSU A;  4HNK A;  3IAV A;  3H0S A;  4IZC A;  3TDC A;  2J5G D;  4K29 A;  5CTC A;  1DUB A;  3BF0 A;  1HZD A;  2QQ3 A;  4GM2 A;  2ZL4 A;  5C9G A;  2VSS E;  3MYB A;  4FND A;  5KDR B;  3NJD A;  3GF7 A;  4U18 A;  4IZD A;  4FN8 A;  4ELW A;  3H0Q A;  3I47 A;  4I42 A;  5IKL B;  3OT6 A;  5DKP A;  4U0G H;  3LKE A;  1W2X A;  2NP9 A;  4NEK A;  2A7K A;  4OLQ A;  5G1Q A;  3L3S A;  4U19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...