3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
4NEKA 5DUFA 4FB8A 3M6NA 3RSIA 4KWBA 3IB9A 3LKEA 4OG1A 1J7XA 2PBPA 4ZDEA 4ZDDA 4I42A 3PGQA 4ASIA 4EMMA 1WZ8A 4U19A 1Y7OA 4FN8A 3MOYA 3T88A 4IZBA 3IAVA 3OT6A 5E0SH 4B3IA 1DUBA 4WCZA 5C90A 1W2XA 3QXIA 1ON9A 1XNWA 3ST9A 5G1RA 1XNVA 3SLLA 1PIXA 3RRVA 3TT7A 2J5GA 3R6HA 1O8UA 2UZFA 3ISAA 3GF7A 3H0JA 5JBWA 5DKPA 3K8XA 5DZKA 3QK8A 2FZSA 5FUSA 1SG4A 3HINA 5C9GA 3T8AA 2F9YB 2PPYA 2J5IB 2EJ5A 2FW2A 4U18A 3L3SA 3BEZA 2VREA 2F6QA 4Z0MA 2ZQRA 3SWXA 2HW5A 1PJHA 3H0SA 2ZL4A 1FCFA 1HNUA 3ZWAA 3HE2A 5DU4A 4JVTA 5DTPA 4U0GH 4MI2A 4ELSA 3R0OA 1EY3A 1HNOA 3VIVA 3GKBA 5INGA 3TV5A 1N6DA 3TVWA 3OC7A 4WYOB 3HLN1 1HZDA 3G64A 5E0SA 3FDUA 4JJTA 3TVUA 4F47A 3OMEA 3Q0GA 3R9SA 2X24A 2QQ3A 3JU1A 5KDRA 1XNYA 1WDKA 3KTGA 4KD6A 3TLFA 1NZYA 4JCTA 2IEXA 3Q7HA 4I52A 3IBBA 1EF9A 2C8TA 4JFCA 4JYLA 4GHNA 2VSUF 1ON3A 2NP9A 3STAA 4FNBA 2Q34A 3HRXA 3ZWCA 2ZQQA 2CBYA 3T89A 1MJ3A 3BPPA 1OD4A 2VSSE 4JSBA 2A7KA 1X0UA 1K32A 3QYRA 4FZWA 3QKAA 4MXIA 2GTRA 1N6FA 1XX4A 3R9QA 3ZW9A 4YLHA 2F9YA 2FBMA 4ELWA 5E0NX 3RSTA 2CE3A 1WDMA 3H02A 3WG5A 4IZDA 4OMRA 3H0QA 4Q0GA 4MOUA 2WTBA 4HNKA 5KJPA 1UYVA 5JBXA 3TT6A 3GF3A 4EMLA 2J5II 3R9TA 3KTHA 5DL1A 1YG6A 2F9IA 1FC6A 2VSUA 2F6IA 4HC8A 3H81A 3BF0A 3M6MA 4FN7A 2J5SA 1UYTA 2A81A 4ZDFA 3QXZA 1Q52A 1RJNA 3TRRA 4I4ZA 3KTIA 3P85A 3P2LA 5INFA 4KNPA 1EF8A 3PE8A 4JCQA 4JOTA 3HP0A 1UIYA 2VSUE 4WZ8B 5MGBA 2W3PA 3V5EA 4B3JA 2VSSA 3Q1TA 4ZU2A 3T8BA 2ZL3A 3LAOA 2Q35A 3DJAA 3KTJA 1YG8A 4JWVA 4JCRA 4QIIA 1RJMA 1JXZA 3PEAA 2A7SA 4OLQA 4DI1A 4U1AA 3TZ3A 4LK5A 5DU6A 3GLMA 2VX2A 4K3WA 2VSSF 1OD2A 3Q0JA 1SZOA 3K50A 3U9TB 3I47A 4B3HA 3MT6A 4QIJA 2F9IB 5INIA 4RYFH 2DEOA 1N6EA 4Q1IA 2ZL0A 3QMJA 2J5IA 1TG6A 4RCNA 4U0HA 4U0GA 1NZYB 4G2RA 2BZRA 3MYBA 3PZKA 3MFMA 1TYFA 2DUBA 5KDRB 3FF6A 3N6RB 4L8KA 5DTWA 2X58A 3P5MA 4GM2A 4NNQA 1WDLA 3KTKA 1XO6A 1UYRA 3V5IA 4ELXA 2Q2XA 3QWDA 1FC9A 5G1QA 4FZWC 5DZKH 4IZCA 3H0UA 3ZW8A 3TDCA 5IKLB 4JCSA 4FNDA 3NJBA 1FC7A 4KPKA 4FJWD 3U9SB 4L6WA 1K39A 5FIFA 3U9RB 2VSUC 5G1SA 4QFEA 2ZL2A 2J5GD 5CTBA 4EMPA 4JYJA 1UYSA 4RYFA 4K29A 5CTCA 4ZDCA 5DUCA 5DU8A 4K2NA 3T3WA 1DCIA 3KQFA 3NJDA 3DORA 1Q51A 2PG8A 1VRGA 3GMAA 2D3TA 3ZWBA 4ZDBA 3QREA
chains in the Genus database with same CATH superfamily
2KS1B 3BVHA 5DUFA 1L0LD 3GHGC 1GK6A 1KD1Q 2WPSA 2OYHB 3LW5H 3I55P 4L76A 3LKEA 5H2FE 2GM4A 4HKZH 1IK7A 3E1IA 4C7NB 3PJSK 3EFFK 3T97B 1KYOH 1J7XA 1KQFB 1YYCA 4ZDDA 4ZDEA 4I42A 1FE6A 3CD6P 3M91A 4U3FG 3BCCE 1H0TB 4EMMA 3IFMA 5CCGC 1L4AC 4WBAA 1BDCA 3MOYA 3G71P 1URQB 3D71A 1SQXG 1SFCA 4B86A 1NAYA 3ITKA 3KQGA 5CCHA 1BDDA 5CCHC 1W2XA 2QE7H 2LXBA 3PP5A 3VMYA 2YKOA 1L2PA 1XNWA 3ST9A 5G1RA 2FXPA 1XNVA 3SLLA 2Y0EA 4D6TD 1N7SB 5AVUB 1KC8Q 3R6HA 3BCCD 3CX5E 2G8YA 1O8UA 5AW4B 1T3JA 2N9BA 2JP3A 5GTIH 3H0JA 3BCCJ 2AXCA 2JDIH 5DKPA 1DIPA 3K8XA 2IFMA 4GT1A 1OX3A 2NZ2A 2FZSA 3L70G 3HE4B 4JF7A 2GA1A 5KLVJ 1PFIA 3H1HE 5KTBA 2KLVA 2J5IB 2EJ5A 1IK9A 1LTAC 1OWAA 3BEZA 3L3SA 4K3AA 2CPBA 4Z0MA 3SWXA 3L73D 2P67A 1FS0E 1HGZA 3AE8C 2E76D 2WSEH 5CBOA 1EQ7A 4JVTA 4U0GH 4MI2A 3R0OA 1EY3A 2ZYAA 3TV5A 3H1HG 2O01H 3TVWA 4WYOB 3CMEP 1M57D 3M06A 4YXDC 5E0SA 1S2EA 4CPGA 3CXHD 3SFDC 1SFCC 2Z5IA 1SS1A 4OVNF 1WDKA 2PAJA 1IFIA 2LR2A 3Q3DA 2FBWC 1VQ4P 1VQNP 4PJ0H 3IBBA 1PP9J 3MTUE 3L72E 1EF9A 4XE5B 1SQXK 4GHNA 1ON3A 4RKUJ 2NP9A 2Q34A 2CBYA 3MHVA 3Q2YA 4DZOA 3T89A 1MJ3A 3KDPB 3PRJA 3AEFC 3A0HE 1QL1A 2R5BA 1LTBC 4IL6E 4H13D 4MXIA 3CCMP 1N73C 1SQXE 1M1KQ 4WVZA 1KFNA 3H1KG 4YLHA 1Q81Q 2FYUD 1SQQJ 4ELWA 1WRGA 1HGVA 3VTPC 4N78E 3RSTA 1H89A 3L4FA 2ZT9D 1G1JA 2KB7P 1NTZD 3G4SP 1A02J 2OYHA 2E43A 5C39A 1SQBE 4IZDA 3H0QA 4D6TJ 2I1JA 2P7JA 1QVGO 3A2AA 4HNKA 1M8OB 1UYVA 3HE5A 2E74B 1X0TA 4UB8E 2XNXA 3R9TA 3KTHA 3CX5H 1SQQD 1NTMJ 2A06E 2VSUA 1HH0A 2WSCJ 2A06D 3M6MA 3R2PA 1KZUB 3TK1A 2A81A 3CCJP 5AW3B 1Y9BA 1JY2P 4NARA 1URQD 1L0NE 2Q1KA 1U57A 3B5NB 3A0BH 5KAIH 5KLIB 2CPSA 1S4XA 1PP9G 1LTGC 1K04A 4M3LA 4GOFA 4YPCA 3A0HH 3HP0A 1G2CB 3GW6A 4Y99B 3VMAA 1AJYA 3Q1TA 3AEEC 2ZL3A 3LAOA 2OGUA 1OIPA 3A3YB 4GODA 1S5LX 1JXZA 2E74C 2QJPC 3PEAA 1QVFO 1SQQG 1GK4A 2OYIC 2YMKA 3TZ3A 1BGYD 1LJ2A 1H88A 3CWBE 1HUCA 4PV1C 3WMM0 2VX2A 4U3FE 1SQPD 3AEGC 1OD2A 1KILD 3Q0JA 4D6TG 3L75J 1NOHA 3U9TB 3I47A 3HD7B 1GMJA 2F9IB 2DEOA 1YQ4C 4LC1A 1N6EA 3V2QA 4Q1IA 1MFTA 2ZL0A 2Y0DA 2O1KA 1PV3A 5KLIC 2E5YA 3MIWA 1EDIA 5KKZC 3MYBA 3PTZA 5AVQB 2ITAA 1SQVE 3L71J 5B66H 5CHXA 1LTIC 1N7SA 2O01N 3CWBJ 1PL5A 5DTWA 2X58A 2WPQA 4GM2A 2ZVNB 1L0ND 2IX7C 2KYVA 2H43A 2BASA 3L71D 1S5LH 4N3YB 2O1JA 1N86A 1OVRA 2IBZG 3ZW8A 2C0WA 1LP1A 3TDCA 3Q5PA 4FNDA 2JJLA 3B5NA 5AVTB 1FC7A 1FZBA 4AUWA 2QA4P 1EZVD 3BATA 5KJ7D 1KN7A 1SQVJ 2WSFH 3CLQA 3U9RB 1R5LA 2VSUC 2J5GD 4EMPA 2IBZD 3HE5B 3OAKA 3L72G 3M9BA 1YBKA 5AW8B 2A45I 4HYTB 1KB9D 2PG8A 1VRGA 2D3TA 1FZCB 4H0LC 3P8CE 1VQ8P 2ZQQA 4ZDBA 3AE9C 4NEKA 3HRNA 4FB8A 2E74D 1LNQA 2W6JH 2E76B 5L8RJ 3HD7D 2YO2A 1J2JB 1KYOD 1NTZK 3L71G 3RL0g 3II6A 4HJGH 2I1KA 1Q2NA 2YKPA 4U19A 1FJPA 4RJTA 3CWBG 2JWAA 1NGMB 4FN8A 3SWFA 2P10A 1BCCE 4IZBA 1N2DC 4RO0A 3OT6A 5E0SH 1IZNB 1OW6A 1SQVK 3V2NA 1CSBA 3QXIA 2FFDB 1YJNP 2IDBA 1BGYG 1KQLA 3O6QA 4W80A 1BE3E 3CC2P 3TT7A 1H8AA 2P58A 2WSEJ 1GDTA 1LT9B 3RK3B 1QX8A 3H1JG 3MP7B 1JEKA 2K9YA 2RMZA 2UZFA 2Q3IA 3CCEP 3RL0B 3ISAA 2PP6A 2ZVOB 5JBWA 1ZXGA 2FFDA 4JPZB 2FFDC 5KJ7C 3CCUP 3U1CA 1SQPG 1AV1A 2RN0A 4U7JA 1BCCJ 3O8ZA 1S3JA 4DOJA 5FUSA 1IFDA 3B71A 1SG4A 5C9GA 3T8AA 2C0XA 1SP4A 1YI2P 3NFQA 2VREA 4BRYB 2H89C 3H0SA 4L75A 3UIAA 3N4XA 1HNUA 3ZWAA 2IPPA 3SWYA 3H1IJ 1LWUB 4WY4A 1JTHA 5GTHH 3PH0A 3VIVA 1OZHA 2ZAEB 3CX5I 1N6DA 4H44D 1BE3G 3OC7A 3CCSP 2NRGA 3HLN1 3TGUD 4JJTA 4F47A 3OMEA 1NTKE 2Z4EA 1Z56A 3V2PA 3R9SA 2RKLA 1YHQP 5APUA 4H44B 1OVUA 3H1LG 1LWUC 5KDRA 3WUVA 5AVRB 5B5EH 2SPZA 3RL0D 4JCTA 3HD7C 3H1ID 1LT9C 3Q7HA 4I52A 2Q9IA 1BGYJ 3H1JD 1RE4A 5B66E 2VSUF 3KPEA 3SWKA 4LLHA 3BPPA 1NTZG 1PP9D 2VSSE 1OFCX 3NMDA 3H25A 1EDJA 1K32A 1N6FA 1NJIQ 1ZR4A 3V6IA 2XV5A 1AFOA 2FYUG 2H88C 3O6QB 2Y0CA 3TNUA 2Q7CA 1FZCA 5E0NX 2HPCA 1GU5A 2IYOA 4RESB 1AQTA 1BGYE 1T2KC 4Y28J 3WG5A 3F5HA 2YXQB 4Q0GA 3CWBD 2O01J 5JBXA 2WPRA 3VP8A 2J59M 3GF3A 3B5NC 2J5II 1K9MQ 5DL1A 2XU6A 1N7LA 1SQPK 2WPVB 1FC6A 2QJPB 4H44C 1EXJA 3V2RA 1Y47A 2UWJE 3AE4C 1X22A 1UYTA 5KJ7A 2R3SA 3CCLP 4ZDFA 1LWUA 3QXZA 3FX0A 1JTHB 4D6TE 3P85A 1ZLLA 1KYOE 1WMKA 5DJTB 5INFA 3VN0A 1SFCD 1JM0A 2BEQD 3H1IE 1L0LJ 3WUUA 4MN4C 2KXPB 1Q90D 5AW6B 1MV8A 4I2LC 2WT7A 2HLOA 1CW5A 2W8ZA 2W3PA 3CXHI 3T8BA 4KJMA 3M0DA 2XDJA 4PD4E 4AQRD 2D2CD 1NTKJ 3H1HD 1FDIA 2QM7A 5AVWB 1FC2C 1RJMA 2M3BA 3L73G 3AE1C 3ZDMA 1OXZA 4U1AA 2P1JA 3OA7A 3P32A 3U59A 5DU6A 3L74D 4WY4B 2LXCB 2IBZE 1KILA 2RH0A 3BASA 1NKZB 2NPSD 1L0LE 4YXWH 2ZXEB 4PD4D 1PPJD 1RY3A 3H6PA 4IL6X 4ZKPA 3L36A 1RE4C 3RGUA 5B5EE 1P84D 2V4HA 1AVYA 4WB4A 1A02F 2KSEA 2HPCB 3U1AA 2FXOA 1KILB 3WU2H 3IN6A 2J58A 3HUSA 4RCNA 3L37A 5TISE 3ABVC 4U0GA 3WU2E 4G2RA 2WSFJ 2OYOA 1DX7A 3MFMA 2WSCH 2DUBA 5KDRB 3V4WA 2OTKE 2ZT9B 2V7QH 4ASWA 1PPJE 5CCHD 4L8KA 2GUSA 1SQBD 1R5SA 2FKWB 1NU1G 3HTKA 5KAFE 3RL0C 1XO6A 1UYRA 2E5TA 2M3EA 1NAFA 1VDFA 3V5IA 3RK3C 2N1TD 1D7MA 4OGQB 1FC9A 5G1QA 4IZCA 4IFMA 1L0LG 3H0UA 3P8MC 1JNMA 1N7SD 2B88A 3FGAD 5BU8B 1MFZA 5IKLB 1IFJA 3CMAP 3NJBA 1BSHA 2YKQA 1RF1C 1JB0J 3U9SB 4R4LA 3A7OA 1ZP0C 5FIFA 1NTKG 1KILE 1LTJC 2ZL2A 1JCCA 1VQOP 5CTBA 5AVXB 4RYFA 4K29A 5CTCA 1JY3O 1PGOA 5DUCA 5AW5B 4L73A 1YIJP 4K2NA 1DCIA 1S9KE 1M1JB 3FXEA 1Q51A 3L72D 2WITA 1FU1A 3ZWBA 1Q86Q 1KB9I 1W5CE 2W27A 1VF5D 2QG4A 1VQLP 1CI6A 2AEFA 3RSIA 2CK3H 4KWBA 1WT6A 5APTA 5AVVB 3C1LA 2GUVA 3CXHE 5TISH 1VF5B 1HBWA 1JY3N 1GL2B 4O9BA 1OMIA 1ZN5A 1T6AA 2JR8A 1CZQA 3G3ZA 1EXIA 3PGQA 5HUQA 1PGJA 3H1JE 2QEXP 3RK3E 4C7RA 1Y7OA 4BRYA 2E75C 3KHUA 1DD3A 2LKMA 5GTIE 1FAVA 2OYIB 4WCZA 5C90A 2B87A 2KSJA 1ON9A 1KB9E 3AE5C 1PIXA 2YIUB 1HWTC 1XTCC 1ZOYC 3RRVA 3RK3D 2J5GA 3E7KA 3VMXA 2AEJA 3F89A 1OW8A 1YJ9P 1L4AB 3R4YA 1X79B 3HUSC 5BU5A 3GF7A 1YJWP 1L0NK 1JUNA 1NHLA 2HODB 2QM8A 2KLUA 2B87B 1IFMA 3H1KJ 2A06G 1EZVI 2ZJSE 5DZKA 1KORA 3CI9A 3KZIH 3D6ZA 2E75B 1JMBA 2HYNA 3PLNA 2F9YB 2NPSC 1IFPA 2NPSA 2WZ7A 4I6MC 2BCCD 4U18A 2HW5A 5TJHA 2WTYA 3H32A 1HVVA 2FYUK 2ZL4A 4GOEA 4ZNCA 4QMAA 5DU4A 5DTPA 3L74J 1Q82Q 2MJZA 2H8PD 1GW4A 2NPSB 3GKBA 2YNYA 5INGA 1SQVD 3G64A 3HTKB 4U3FJ 2JO1A 3AE6C 3FDUA 3TVUA 3CC7P 2B89A 3Q0GA 3AE2C 3RK2D 2WT7B 2IFNA 2X24A 4I7ZC 3VP9A 4JQ0D 3VOPA 1XNYA 3KTGA 4KD6A 3TLFA 1NZYA 1RHZB 2OTLP 3BPTA 2C8TA 1N7SC 3L70E 4JYLA 1EC5A 2R44A 1RH5B 3STAA 1FZAA 3M0AA 3HRXA 4FNBA 2Q3EA 1FZEA 3VYIA 1HJBA 1OD4A 3TSIA 4C46A 2WVRA 3L75E 4EYYQ 2A7KA 1X0UA 4FZWA 3G9RA 3QKAA 1XX4A 3B5ND 3R9QA 2PGDA 3TDKA 2WMMA 1P84H 2FBMA 2OARA 1ZW0A 2FYNB 1GU4A 1H0TA 2KP8A 1BCCD 1NKNA 1HJ0A 3IAOA 2KI7B 2WTBA 3PHLA 3AE3C 1YTZT 2FXMA 1KQGB 4PJ0E 3L74G 1K8AQ 3H1KE 2BEZF 2FYUE 3USSA 3JCUH 5APXA 1NTKD 2IZ1A 3H1HJ 4OGQC 1KQSO 3H81A 3BF0A 5KLVD 4FN7A 2JWDA 2J5SA 2AEMA 4Z1MH 1QLED 2D2CC 1LTTC 1P84I 4WY4C 2QRXA 2M8RA 1SVFA 1NH4A 4I4ZA 1ZRTE 3KTIA 1JY2N 3LIEA 2FYNC 1M7LA 3FWLA 1N8RQ 2KNCA 1EF8A 1VQKP 1MUUA 4JCQA 4JOTA 4PV1D 3L74E 3HUSB 2ZYGA 3CCVP 4WZ8B 4B3JA 3CCRP 1NVOA 4ZU2A 1ZMEC 2Q35A 4HH2A 3DJAA 3CC4P 3S9OA 1YG8A 1SQVG 2L5GB 5M1BA 4DJGA 4ZKUA 4JWVA 1L0NG 4JCRA 2N9YB 1YTZI 2QVAA 4QIIA 1MZ9A 5APQA 1JMMA 1CI6B 2HR3A 1SQXD 2O3JA 4DT0A 3GHGA 2M0BA 4OLQA 3L72J 5KAIE 4LK5A 3E1RA 1J1EB 1BSNA 1LT1A 4KT0J 1LT9A 2ZFCA 3K50A 1GTWA 3FXDA 3B4SA 3W67A 1M56D 4H0LB 4B3HA 3KYQA 4QIJA 3BRTB 3CCQP 4YTPC 2KUBA 5KKZB 2A45G 4EDFA 2OYHC 1RQVA 4U0HA 1NTMG 4BWNA 1NZYB 3TF5A 2BZRA 4OGQD 4KHXA 3OW2O 4N6JA 2HG5D 1KV4A 2WWWA 3KXDA 1U7JA 1AA0A 1AQ5A 2R3CA 4HB1A 3KTKA 3L73E 2B9BA 3G6EP 1VF5C 4ELXA 1JY3P 2Q2XA 3QWDA 2IBZI 2W6AA 1LTJB 3AEAC 1URQA 1NTME 2FY8A 3RK2C 5AVYB 5CBNA 1EDLA 3H1KD 4NPFX 3H1LD 5APWA 1NWQA 1SQBK 5APSA 4KPKA 2OQQA 2DW3A 2YO3A 4WY4D 1K39A 3JSVC 1L0NJ 1LTJA 4H13C 1IO4A 2Y9ZA 5G1SA 3H32B 1SQPJ 3D70A 1J1DC 1UYSA 1K05A 2KK7A 1EZVE 1JOCA 4IOIH 2ZYDA 5DU8A 3T3WA 1GL2D 3DORA 1L4AD 2P2UA 3P7KA 3GMAA 3LIDA 3N7NA 1DD4A 1MKMA 1NTMD 3QREA 5AW2B 3L75G 1ZR2A 1L4AA 4A7PA 2MKVA 3M6NA 2W6BA 3IB9A 5E79H 3RBZA 1XTGB 1ZV8A 2H7HA 3L75D 1FDMA 1NU1D 4OG1A 3CL3D 3TGUE 3M0DC 4WWIA 3SFEC 2C9LY 1NO4A 1G2CA 2PBPA 4I7ZB 2A45H 1RQUA 4ASIA 5AW1B 1WZ8A 2V7QJ 5EFWB 2QJYC 1OVVA 4EOTA 1PGQA 3T88A 3H1LJ 3IR9A 4JYBA 4R4MA 3IAVA 1KTMA 4B3IA 1DUBA 2PFXA 3JCUE 1URQC 2K9JA 1UIXA 1VQMP 1AVOA 5CCGD 3LW5J 1ZRTD 3Q5RA 1PZQA 1SQBJ 1NTZJ 1U7MA 1RE3A 2QJYB 1Q7YQ 4DCKA 1FBMA 3MD0A 1RF0A 1RF0C 3AECC 4NPEA 2BCCE 1FDOA 3AEBC 3QWOC 2FYUJ 2ZT9C 2VRSA 1W2BO 3QK8A 2YJGA 4UB8H 2I8DA 2XKMA 3HINA 5GTHE 3AE7C 1RF1A 2PPYA 4UB6E 3P8CD 5AW0B 1G1IA 2FW2A 4ASVA 2POHA 1S1CX 2F6QA 2ZQRA 2QSIA 1PJHA 3S4RA 1FOSF 1FCFA 1PGPA 1PP9E 4IFFA 3CX5D 3HE2A 1KFMA 4H0LD 2N1TB 3W68A 1X9VA 4Y99C 4ELSA 1VQ7P 1RF1B 1HNOA 1KYOI 3S1KA 4HDTA 1LP1B 3L35A 1DH3A 1FZFA 2K3RA 1HZDA 3NTNA 2OYIA 1W2EA 1P84E 2QQ3A 1R8EA 3JU1A 3SSUA 4L74A 1VQPP 2W90A 2N1TC 2YMYA 1N73A 2D2CB 3OJAB 4LGDE 2Y9YA 3RK2B 3BRVB 1LGHB 3MUDC 2IEXA 3L70D 4PD4H 4JFCA 2HFED 1EZVG 3GHGB 5KAFH 3ZWCA 2Q5UA 2HODA 2L91A 5APYA 1YQ3C 2E76C 1SQBG 3H1JJ 1S5LE 2QIWA 3MZWB 1JCDA 1SFCB 2AXTE 4JSBA 1KILC 1T2KD 3QYRA 1T3UA 3Q1MA 2GTRA 5BVZA 2R32A 3ZW9A 2M5AB 4JBZA 1T8ZA 2F9YA 1K73Q 3L73J 4AYCA 3EWKA 3H1LE 1SQQK 1BCCG 1QGKB 2IYPA 3GG2A 4U3FD 1S9KD 2XNDH 2OTJP 2CE3A 1WDMA 3H02A 3L71E 4OMRA 3TYYA 1PPJG 2M5AA 4MOUA 2YXRB 5KJPA 1FJKA 1VL2A 1VQ6P 5APVA 5H2FH 1GD2E 3EQ2A 3V5BA 3TT6A 3H1IG 1E79H 4EMLA 4XFJA 3HE4A 1UIIA 1BE3D 1KB9H 1YG6A 2F9IA 2BCCJ 3JC22 2JKVA 1LTSC 2K37A 1BE3J 1VPCA 2F6IA 1VQ5P 4HC8A 2QJKC 3CXHH 5AW9B 4GIFA 1E5WA 5DJUB 4ZMDA 3I56P 1M1JA 2FYZA 2E75D 4C7NA 3RBXA 3T97A 1J1EC 2N1TA 1FOSE 4BXLA 2C9NY 3B8EB 1Q52A 1RJNA 1SQPE 4TT3H 5CJ4A 3TRRA 1USEA 1HTLC 1NU1J 2ZXXA 4IFDK 4W7ZA 3P2LA 3NXSA 1JO5A 3KZIE 4KNPA 3IF4A 3PE8A 1IFNA 1DEBA 2KIKA 5KLVE 4I1LA 1GL2A 2QJKB 1UIYA 2VSUE 5MGBA 3EFGA 3V5EA 3AEDC 2VSSA 1IC2A 5CMZA 1NU1K 2W83C 1J1DB 1JY2O 3A0BE 3KTJA 1NTMK 1Y8AA 4XA4A 2K1AA 3TGUJ 5KLVK 1S72P 5CCGA 3C8VA 3WUTA 1GZLA 2A7SA 1QL2A 4DI1A 3M9HA 4TLFA 3GLMA 2R5DA 2G3AA 1YITP 4K3WA 2VSSF 2IZ0A 1NTZE 1NTKK 1SZOA 4UB6H 2WQYC 4GDOA 5AVZB 4OH8B 3MT6A 3A5TA 2Q6QA 4N78D 3CPWO 5INIA 4RYFH 1RE3C 3QMJA 1EDKA 3Q5SA 1QEXA 5AVSB 2J5IA 1TG6A 2XZRA 4JYCA 1FZGA 2BCCG 1USDA 3PZKA 1SQQE 1TYFA 3VMZA 2J5UA 1DEEG 3M9QA 3FF6A 1N73B 1HF9A 1L0LK 2AXTH 3N6RB 1M90Q 1NYHA 1OW7A 2KNCB 3MGNA 1SQXJ 3P5MA 2E42A 4NNQA 1WDLA 2JEEA 1IJDB 1SLQA 2Z5HA 4NPDA 3TNUB 4IL6H 4K35A 4H13B 4EIJA 4FZWC 5DZKH 2K88A 2KZJA 1GL2C 1KMIZ 2KOGA 3FWNA 4PV1B 4EI2A 4JCSA 5CJ0A 1FZCC 3K5BA 3HD7A 5AW7B 3I5CA 5E79E 4FJWD 1X8YA 2PRRA 4L6WA 3BCCG 1GW3A 4OWFA 3TGUG 2KS1A 4QFEA 2KZIA 3C9IA 4GKGA 4JYJA 1VQ9P 1M1JC 1NU1E 2WSSH 5K5GB 4J2UA 4ZDCA 3L70J 2K9JB 5KLVG 3KQFA 3NJDA 3MUDA 4PD4I 3D6YA 4W7YA 2YIUC 3V4QA 1TU3F 3QH9A
chains in the Genus database with same CATH topology
1VF5D 4NEKA 5DUFA 4FB8A 2E74D 2MKVA 3M6NA 3RSIA 4KWBA 3IB9A 3LKEA 2E76B 1VF5B 4OG1A 1IK7A 5L8RJ 3SFEC 3T97B 1J7XA 2PBPA 4I7ZB 1OMIA 1KQFB 4ZDEA 4ZDDA 4I42A 1EXIA 1RQUA 3PGQA 4ASIA 5HUQA 3RL0g 4EMMA 3RK3E 1WZ8A 2V7QJ 4U19A 2QJYC 1Y7OA 2E75C 1NGMB 4FN8A 3MOYA 2P10A 3T88A 3D71A 4IZBA 1DD3A 4R4MA 3IAVA 3OT6A 5E0SH 1KTMA 4B3IA 1DUBA 1OW6A 4WCZA 5C90A 1W2XA 3QXIA 1ON9A 1UIXA 2IDBA 1XNWA 3AE5C 3ST9A 5G1RA 2FXPA 3O6QA 1XNVA 3SLLA 1PIXA 3LW5J 1ZOYC 3RRVA 3TT7A 2J5GA 3R6HA 2WSEJ 3Q5RA 1OW8A 2K9YA 2G8YA 1O8UA 2UZFA 3R4YA 3ISAA 3GF7A 2JP3A 3H0JA 5JBWA 3AECC 3AEBC 1FDOA 5DKPA 2ZT9C 1DIPA 3K8XA 5DZKA 1KORA 4U7JA 3QK8A 2NZ2A 2FZSA 2YJGA 5FUSA 3D6ZA 3B71A 1SG4A 3HINA 3AE7C 5C9GA 2E75B 3T8AA 2F9YB 2PPYA 2J5IB 2EJ5A 2FW2A 4U18A 3L3SA 3BEZA 1S1CX 2VREA 2F6QA 4Z0MA 2ZQRA 3SWXA 2H89C 2HW5A 2QSIA 1PJHA 3H0SA 2ZL4A 1FCFA 1HNUA 3AE8C 3ZWAA 2E76D 3HE2A 4H0LD 5DU4A 4JVTA 5DTPA 4U0GH 4MI2A 4ELSA 3R0OA 1EY3A 1HNOA 3VIVA 3GKBA 4HDTA 5INGA 3TV5A 1N6DA 4H44D 3TVWA 3OC7A 4WYOB 3HLN1 4YXDC 1HZDA 3G64A 5E0SA 2JO1A 3AE6C 3FDUA 4JJTA 3TVUA 4F47A 3OMEA 3Q0GA 3AE2C 3R9SA 3SFDC 2X24A 4H44B 4I7ZC 2QQ3A 1R8EA 3JU1A 5KDRA 1XNYA 1WDKA 2D2CB 3Q3DA 3KTGA 4KD6A 2FBWC 3TLFA 1NZYA 4JCTA 2IEXA 3Q7HA 4I52A 3IBBA 3BPTA 1EF9A 2C8TA 4JFCA 4JYLA 4GHNA 2VSUF 1ON3A 4RKUJ 2NP9A 3STAA 4FNBA 2Q34A 3HRXA 3ZWCA 2CBYA 3Q2YA 3T89A 1YQ3C 1MJ3A 2E76C 3BPPA 2QIWA 3AEFC 1OD4A 2VSSE 4JSBA 3H25A 2A7KA 1X0UA 1K32A 3QYRA 4FZWA 3G9RA 3Q1MA 3QKAA 4H13D 4MXIA 2GTRA 1N6FA 1XX4A 3R9QA 3ZW9A 4YLHA 2F9YA 2H88C 2FBMA 3EWKA 4ELWA 5E0NX 3RSTA 2ZT9D 2CE3A 1WDMA 3H02A 4Y28J 3WG5A 4IZDA 1HJ0A 3IAOA 3H0QA 4OMRA 4Q0GA 4MOUA 2WTBA 3AE3C 2O01J 4HNKA 5KJPA 1VL2A 1UYVA 5JBXA 2E74B 3TT6A 3GF3A 4EMLA 1KQGB 4XFJA 2J5II 3R9TA 3KTHA 5DL1A 2WPVB 1YG6A 2F9IA 1FC6A 2BEZF 2VSUA 2WSCJ 4H44C 1EXJA 2F6IA 4OGQC 4HC8A 2QJKC 3H81A 3BF0A 3M6MA 3AE4C 4FN7A 2J5SA 2E75D 1UYTA 2A81A 1Y9BA 4Z1MH 4ZDFA 2D2CC 4NARA 3QXZA 1Q52A 1RJNA 4TT3H 1U57A 3TRRA 4I4ZA 1ZRTE 3KTIA 3P85A 3P2LA 2FYNC 1WMKA 5INFA 1K04A 4KNPA 2BEQD 1EF8A 3PE8A 4JCQA 4JOTA 4PV1D 1Q90D 4ZDBA 3HP0A 1UIYA 2VSUE 4WZ8B 5MGBA 2W3PA 3V5EA 4B3JA 3AEDC 2VSSA 1AJYA 3Q1TA 4ZU2A 3AEEC 3T8BA 2ZL3A 3LAOA 1ZMEC 2Q35A 3DJAA 3KTJA 3S9OA 1YG8A 5M1BA 4JWVA 2D2CD 4JCRA 1FDIA 1S5LX 4QIIA 1RJMA 1JXZA 2E74C 2QJPC 3PEAA 3AE1C 3C8VA 2A7SA 4OLQA 4DI1A 2YMKA 4U1AA 3TZ3A 4LK5A 5DU6A 3GLMA 4PV1C 2G3AA 2VX2A 1TU3F 4K3WA 2VSSF 4KT0J 3AEGC 1OD2A 3Q0JA 1SZOA 3K50A 2WQYC 4GDOA 3U9TB 4IL6X 3I47A 4H0LB 4B3HA 3MT6A 4QIJA 1GMJA 2F9IB 5INIA 4RYFH 2DEOA 1YQ4C 1N6EA 4Q1IA 4YTPC 2ZL0A 3QMJA 1PV3A 5KLIC 3Q5SA 2J5IA 3IN6A 1RQVA 1TG6A 4RCNA 4U0HA 3ABVC 4U0GA 1NZYB 4G2RA 5KKZC 2BZRA 3MYBA 3PZKA 2WSFJ 3MFMA 1TYFA 4OGQD 2J5UA 2DUBA 5KDRB 3FF6A 1HF9A 2ZT9B 3N6RB 1NYHA 4L8KA 1PL5A 1OW7A 3QREA 5DTWA 2X58A 3P5MA 4GM2A 4NNQA 1WDLA 3KTKA 1XO6A 1UYRA 3V5IA 1VF5C 4ELXA 2Q2XA 3QWDA 3AEAC 4H13B 4OGQB 1FC9A 5G1QA 4FZWC 5DZKH 4IZCA 3H0UA 1KMIZ 3ZW8A 3FGAD 3TDCA 4PV1B 3Q5PA 5IKLB 4JCSA 4FNDA 3NJBA 1FC7A 4KPKA 2OQQA 4FJWD 1JB0J 3U9SB 4R4LA 4L6WA 1K39A 1ZP0C 5FIFA 1KILE 3U9RB 4H13C 2VSUC 5G1SA 4QFEA 2ZL2A 2J5GD 5CTBA 4EMPA 3D70A 4JYJA 1UYSA 4RYFA 1K05A 4K29A 5CTCA 4J2UA 4ZDCA 5DUCA 5DU8A 4K2NA 3T3WA 1DCIA 3KQFA 3NJDA 3D6YA 3DORA 1Q51A 2PG8A 2YIUC 1VRGA 3GMAA 2D3TA 3ZWBA 4H0LC 1DD4A 1MKMA 2ZQQA 3AE9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEK A;  5DUF A;  4FB8 A;  3M6N A;  3RSI A;  4KWB A;  3IB9 A;  3LKE A;  4OG1 A;  1J7X A;  2PBP A;  4ZDE A;  4ZDD A;  4I42 A;  3PGQ A;  4ASI A;  4EMM A;  1WZ8 A;  4U19 A;  1Y7O A;  4FN8 A;  3MOY A;  3T88 A;  4IZB A;  3IAV A;  3OT6 A;  5E0S H;  4B3I A;  1DUB A;  4WCZ A;  5C90 A;  1W2X A;  3QXI A;  1ON9 A;  1XNW A;  3ST9 A;  5G1R A;  1XNV A;  3SLL A;  1PIX A;  3RRV A;  3TT7 A;  2J5G A;  3R6H A;  1O8U A;  2UZF A;  3ISA A;  3GF7 A;  3H0J A;  5JBW A;  5DKP A;  3K8X A;  5DZK A;  3QK8 A;  2FZS A;  5FUS A;  1SG4 A;  3HIN A;  5C9G A;  3T8A A;  2F9Y B;  2PPY A;  2J5I B;  2EJ5 A;  2FW2 A;  4U18 A;  3L3S A;  3BEZ A;  2VRE A;  2F6Q A;  4Z0M A;  2ZQR A;  3SWX A;  2HW5 A;  1PJH A;  3H0S A;  2ZL4 A;  1FCF A;  1HNU A;  3ZWA A;  3HE2 A;  5DU4 A;  4JVT A;  5DTP A;  4U0G H;  4MI2 A;  4ELS A;  3R0O A;  1EY3 A;  1HNO A;  3VIV A;  3GKB A;  5ING A;  3TV5 A;  1N6D A;  3TVW A;  3OC7 A;  4WYO B;  3HLN 1;  1HZD A;  3G64 A;  5E0S A;  3FDU A;  4JJT A;  3TVU A;  4F47 A;  3OME A;  3Q0G A;  3R9S A;  2X24 A;  2QQ3 A;  3JU1 A;  5KDR A;  1XNY A;  1WDK A;  3KTG A;  4KD6 A;  3TLF A;  1NZY A;  4JCT A;  2IEX A;  3Q7H A;  4I52 A;  3IBB A;  1EF9 A;  2C8T A;  4JFC A;  4JYL A;  4GHN A;  2VSU F;  1ON3 A;  2NP9 A;  3STA A;  4FNB A;  2Q34 A;  3HRX A;  3ZWC A;  2ZQQ A;  2CBY A;  3T89 A;  1MJ3 A;  3BPP A;  1OD4 A;  2VSS E;  4JSB A;  2A7K A;  1X0U A;  1K32 A;  3QYR A;  4FZW A;  3QKA A;  4MXI A;  2GTR A;  1N6F A;  1XX4 A;  3R9Q A;  3ZW9 A;  4YLH A;  2F9Y A;  2FBM A;  4ELW A;  5E0N X;  3RST A;  2CE3 A;  1WDM A;  3H02 A;  3WG5 A;  4IZD A;  4OMR A;  3H0Q A;  4Q0G A;  4MOU A;  2WTB A;  4HNK A;  5KJP A;  1UYV A;  5JBX A;  3TT6 A;  3GF3 A;  4EML A;  2J5I I;  3R9T A;  3KTH A;  5DL1 A;  1YG6 A;  2F9I A;  1FC6 A;  2VSU A;  2F6I A;  4HC8 A;  3H81 A;  3BF0 A;  3M6M A;  4FN7 A;  2J5S A;  1UYT A;  2A81 A;  4ZDF A;  3QXZ A;  1Q52 A;  1RJN A;  3TRR A;  4I4Z A;  3KTI A;  3P85 A;  3P2L A;  5INF A;  4KNP A;  1EF8 A;  3PE8 A;  4JCQ A;  4JOT A;  3HP0 A;  1UIY A;  2VSU E;  4WZ8 B;  5MGB A;  2W3P A;  3V5E A;  4B3J A;  2VSS A;  3Q1T A;  4ZU2 A;  3T8B A;  2ZL3 A;  3LAO A;  2Q35 A;  3DJA A;  3KTJ A;  1YG8 A;  4JWV A;  4JCR A;  4QII A;  1RJM A;  1JXZ A;  3PEA A;  2A7S A;  4OLQ A;  4DI1 A;  4U1A A;  3TZ3 A;  4LK5 A;  5DU6 A;  3GLM A;  2VX2 A;  4K3W A;  2VSS F;  1OD2 A;  3Q0J A;  1SZO A;  3K50 A;  3U9T B;  3I47 A;  4B3H A;  3MT6 A;  4QIJ A;  2F9I B;  5INI A;  4RYF H;  2DEO A;  1N6E A;  4Q1I A;  2ZL0 A;  3QMJ A;  2J5I A;  1TG6 A;  4RCN A;  4U0H A;  4U0G A;  1NZY B;  4G2R A;  2BZR A;  3MYB A;  3PZK A;  3MFM A;  1TYF A;  2DUB A;  5KDR B;  3FF6 A;  3N6R B;  4L8K A;  5DTW A;  2X58 A;  3P5M A;  4GM2 A;  4NNQ A;  1WDL A;  3KTK A;  1XO6 A;  1UYR A;  3V5I A;  4ELX A;  2Q2X A;  3QWD A;  1FC9 A;  5G1Q A;  4FZW C;  5DZK H;  4IZC A;  3H0U A;  3ZW8 A;  3TDC A;  5IKL B;  4JCS A;  4FND A;  3NJB A;  1FC7 A;  4KPK A;  4FJW D;  3U9S B;  4L6W A;  1K39 A;  5FIF A;  3U9R B;  2VSU C;  5G1S A;  4QFE A;  2ZL2 A;  2J5G D;  5CTB A;  4EMP A;  4JYJ A;  1UYS A;  4RYF A;  4K29 A;  5CTC A;  4ZDC A;  5DUC A;  5DU8 A;  4K2N A;  3T3W A;  1DCI A;  3KQF A;  3NJD A;  3DOR A;  1Q51 A;  2PG8 A;  1VRG A;  3GMA A;  2D3T A;  3ZWB A;  4ZDB A;  3QRE A; 
#chains in the Genus database with same CATH topology
 2KS1 B;  3BVH A;  5DUF A;  1L0L D;  3GHG C;  1GK6 A;  1KD1 Q;  2WPS A;  2OYH B;  3LW5 H;  3I55 P;  4L76 A;  3LKE A;  5H2F E;  2GM4 A;  4HKZ H;  1IK7 A;  3E1I A;  4C7N B;  3PJS K;  3EFF K;  3T97 B;  1KYO H;  1J7X A;  1KQF B;  1YYC A;  4ZDD A;  4ZDE A;  4I42 A;  1FE6 A;  3CD6 P;  3M91 A;  4U3F G;  3BCC E;  1H0T B;  4EMM A;  3IFM A;  5CCG C;  1L4A C;  4WBA A;  1BDC A;  3MOY A;  3G71 P;  1URQ B;  3D71 A;  1SQX G;  1SFC A;  4B86 A;  1NAY A;  3ITK A;  3KQG A;  5CCH A;  1BDD A;  5CCH C;  1W2X A;  2QE7 H;  2LXB A;  3PP5 A;  3VMY A;  2YKO A;  1L2P A;  1XNW A;  3ST9 A;  5G1R A;  2FXP A;  1XNV A;  3SLL A;  2Y0E A;  4D6T D;  1N7S B;  5AVU B;  1KC8 Q;  3R6H A;  3BCC D;  3CX5 E;  2G8Y A;  1O8U A;  5AW4 B;  1T3J A;  2N9B A;  2JP3 A;  5GTI H;  3H0J A;  3BCC J;  2AXC A;  2JDI H;  5DKP A;  1DIP A;  3K8X A;  2IFM A;  4GT1 A;  1OX3 A;  2NZ2 A;  2FZS A;  3L70 G;  3HE4 B;  4JF7 A;  2GA1 A;  5KLV J;  1PFI A;  3H1H E;  5KTB A;  2KLV A;  2J5I B;  2EJ5 A;  1IK9 A;  1LTA C;  1OWA A;  3BEZ A;  3L3S A;  4K3A A;  2CPB A;  4Z0M A;  3SWX A;  3L73 D;  2P67 A;  1FS0 E;  1HGZ A;  3AE8 C;  2E76 D;  2WSE H;  5CBO A;  1EQ7 A;  4JVT A;  4U0G H;  4MI2 A;  3R0O A;  1EY3 A;  2ZYA A;  3TV5 A;  3H1H G;  2O01 H;  3TVW A;  4WYO B;  3CME P;  1M57 D;  3M06 A;  4YXD C;  5E0S A;  1S2E A;  4CPG A;  3CXH D;  3SFD C;  1SFC C;  2Z5I A;  1SS1 A;  4OVN F;  1WDK A;  2PAJ A;  1IFI A;  2LR2 A;  3Q3D A;  2FBW C;  1VQ4 P;  1VQN P;  4PJ0 H;  3IBB A;  1PP9 J;  3MTU E;  3L72 E;  1EF9 A;  4XE5 B;  1SQX K;  4GHN A;  1ON3 A;  4RKU J;  2NP9 A;  2Q34 A;  2CBY A;  3MHV A;  3Q2Y A;  4DZO A;  3T89 A;  1MJ3 A;  3KDP B;  3PRJ A;  3AEF C;  3A0H E;  1QL1 A;  2R5B A;  1LTB C;  4IL6 E;  4H13 D;  4MXI A;  3CCM P;  1N73 C;  1SQX E;  1M1K Q;  4WVZ A;  1KFN A;  3H1K G;  4YLH A;  1Q81 Q;  2FYU D;  1SQQ J;  4ELW A;  1WRG A;  1HGV A;  3VTP C;  4N78 E;  3RST A;  1H89 A;  3L4F A;  2ZT9 D;  1G1J A;  2KB7 P;  1NTZ D;  3G4S P;  1A02 J;  2OYH A;  2E43 A;  5C39 A;  1SQB E;  4IZD A;  3H0Q A;  4D6T J;  2I1J A;  2P7J A;  1QVG O;  3A2A A;  4HNK A;  1M8O B;  1UYV A;  3HE5 A;  2E74 B;  1X0T A;  4UB8 E;  2XNX A;  3R9T A;  3KTH A;  3CX5 H;  1SQQ D;  1NTM J;  2A06 E;  2VSU A;  1HH0 A;  2WSC J;  2A06 D;  3M6M A;  3R2P A;  1KZU B;  3TK1 A;  2A81 A;  3CCJ P;  5AW3 B;  1Y9B A;  1JY2 P;  4NAR A;  1URQ D;  1L0N E;  2Q1K A;  1U57 A;  3B5N B;  3A0B H;  5KAI H;  5KLI B;  2CPS A;  1S4X A;  1PP9 G;  1LTG C;  1K04 A;  4M3L A;  4GOF A;  4YPC A;  3A0H H;  3HP0 A;  1G2C B;  3GW6 A;  4Y99 B;  3VMA A;  1AJY A;  3Q1T A;  3AEE C;  2ZL3 A;  3LAO A;  2OGU A;  1OIP A;  3A3Y B;  4GOD A;  1S5L X;  1JXZ A;  2E74 C;  2QJP C;  3PEA A;  1QVF O;  1SQQ G;  1GK4 A;  2OYI C;  2YMK A;  3TZ3 A;  1BGY D;  1LJ2 A;  1H88 A;  3CWB E;  1HUC A;  4PV1 C;  3WMM 0;  2VX2 A;  4U3F E;  1SQP D;  3AEG C;  1OD2 A;  1KIL D;  3Q0J A;  4D6T G;  3L75 J;  1NOH A;  3U9T B;  3I47 A;  3HD7 B;  1GMJ A;  2F9I B;  2DEO A;  1YQ4 C;  4LC1 A;  1N6E A;  3V2Q A;  4Q1I A;  1MFT A;  2ZL0 A;  2Y0D A;  2O1K A;  1PV3 A;  5KLI C;  2E5Y A;  3MIW A;  1EDI A;  5KKZ C;  3MYB A;  3PTZ A;  5AVQ B;  2ITA A;  1SQV E;  3L71 J;  5B66 H;  5CHX A;  1LTI C;  1N7S A;  2O01 N;  3CWB J;  1PL5 A;  5DTW A;  2X58 A;  2WPQ A;  4GM2 A;  2ZVN B;  1L0N D;  2IX7 C;  2KYV A;  2H43 A;  2BAS A;  3L71 D;  1S5L H;  4N3Y B;  2O1J A;  1N86 A;  1OVR A;  2IBZ G;  3ZW8 A;  2C0W A;  1LP1 A;  3TDC A;  3Q5P A;  4FND A;  2JJL A;  3B5N A;  5AVT B;  1FC7 A;  1FZB A;  4AUW A;  2QA4 P;  1EZV D;  3BAT A;  5KJ7 D;  1KN7 A;  1SQV J;  2WSF H;  3CLQ A;  3U9R B;  1R5L A;  2VSU C;  2J5G D;  4EMP A;  2IBZ D;  3HE5 B;  3OAK A;  3L72 G;  3M9B A;  1YBK A;  5AW8 B;  2A45 I;  4HYT B;  1KB9 D;  2PG8 A;  1VRG A;  2D3T A;  1FZC B;  4H0L C;  3P8C E;  1VQ8 P;  2ZQQ A;  4ZDB A;  3AE9 C;  4NEK A;  3HRN A;  4FB8 A;  2E74 D;  1LNQ A;  2W6J H;  2E76 B;  5L8R J;  3HD7 D;  2YO2 A;  1J2J B;  1KYO D;  1NTZ K;  3L71 G;  3RL0 g;  3II6 A;  4HJG H;  2I1K A;  1Q2N A;  2YKP A;  4U19 A;  1FJP A;  4RJT A;  3CWB G;  2JWA A;  1NGM B;  4FN8 A;  3SWF A;  2P10 A;  1BCC E;  4IZB A;  1N2D C;  4RO0 A;  3OT6 A;  5E0S H;  1IZN B;  1OW6 A;  1SQV K;  3V2N A;  1CSB A;  3QXI A;  2FFD B;  1YJN P;  2IDB A;  1BGY G;  1KQL A;  3O6Q A;  4W80 A;  1BE3 E;  3CC2 P;  3TT7 A;  1H8A A;  2P58 A;  2WSE J;  1GDT A;  1LT9 B;  3RK3 B;  1QX8 A;  3H1J G;  3MP7 B;  1JEK A;  2K9Y A;  2RMZ A;  2UZF A;  2Q3I A;  3CCE P;  3RL0 B;  3ISA A;  2PP6 A;  2ZVO B;  5JBW A;  1ZXG A;  2FFD A;  4JPZ B;  2FFD C;  5KJ7 C;  3CCU P;  3U1C A;  1SQP G;  1AV1 A;  2RN0 A;  4U7J A;  1BCC J;  3O8Z A;  1S3J A;  4DOJ A;  5FUS A;  1IFD A;  3B71 A;  1SG4 A;  5C9G A;  3T8A A;  2C0X A;  1SP4 A;  1YI2 P;  3NFQ A;  2VRE A;  4BRY B;  2H89 C;  3H0S A;  4L75 A;  3UIA A;  3N4X A;  1HNU A;  3ZWA A;  2IPP A;  3SWY A;  3H1I J;  1LWU B;  4WY4 A;  1JTH A;  5GTH H;  3PH0 A;  3VIV A;  1OZH A;  2ZAE B;  3CX5 I;  1N6D A;  4H44 D;  1BE3 G;  3OC7 A;  3CCS P;  2NRG A;  3HLN 1;  3TGU D;  4JJT A;  4F47 A;  3OME A;  1NTK E;  2Z4E A;  1Z56 A;  3V2P A;  3R9S A;  2RKL A;  1YHQ P;  5APU A;  4H44 B;  1OVU A;  3H1L G;  1LWU C;  5KDR A;  3WUV A;  5AVR B;  5B5E H;  2SPZ A;  3RL0 D;  4JCT A;  3HD7 C;  3H1I D;  1LT9 C;  3Q7H A;  4I52 A;  2Q9I A;  1BGY J;  3H1J D;  1RE4 A;  5B66 E;  2VSU F;  3KPE A;  3SWK A;  4LLH A;  3BPP A;  1NTZ G;  1PP9 D;  2VSS E;  1OFC X;  3NMD A;  3H25 A;  1EDJ A;  1K32 A;  1N6F A;  1NJI Q;  1ZR4 A;  3V6I A;  2XV5 A;  1AFO A;  2FYU G;  2H88 C;  3O6Q B;  2Y0C A;  3TNU A;  2Q7C A;  1FZC A;  5E0N X;  2HPC A;  1GU5 A;  2IYO A;  4RES B;  1AQT A;  1BGY E;  1T2K C;  4Y28 J;  3WG5 A;  3F5H A;  2YXQ B;  4Q0G A;  3CWB D;  2O01 J;  5JBX A;  2WPR A;  3VP8 A;  2J59 M;  3GF3 A;  3B5N C;  2J5I I;  1K9M Q;  5DL1 A;  2XU6 A;  1N7L A;  1SQP K;  2WPV B;  1FC6 A;  2QJP B;  4H44 C;  1EXJ A;  3V2R A;  1Y47 A;  2UWJ E;  3AE4 C;  1X22 A;  1UYT A;  5KJ7 A;  2R3S A;  3CCL P;  4ZDF A;  1LWU A;  3QXZ A;  3FX0 A;  1JTH B;  4D6T E;  3P85 A;  1ZLL A;  1KYO E;  1WMK A;  5DJT B;  5INF A;  3VN0 A;  1SFC D;  1JM0 A;  2BEQ D;  3H1I E;  1L0L J;  3WUU A;  4MN4 C;  2KXP B;  1Q90 D;  5AW6 B;  1MV8 A;  4I2L C;  2WT7 A;  2HLO A;  1CW5 A;  2W8Z A;  2W3P A;  3CXH I;  3T8B A;  4KJM A;  3M0D A;  2XDJ A;  4PD4 E;  4AQR D;  2D2C D;  1NTK J;  3H1H D;  1FDI A;  2QM7 A;  5AVW B;  1FC2 C;  1RJM A;  2M3B A;  3L73 G;  3AE1 C;  3ZDM A;  1OXZ A;  4U1A A;  2P1J A;  3OA7 A;  3P32 A;  3U59 A;  5DU6 A;  3L74 D;  4WY4 B;  2LXC B;  2IBZ E;  1KIL A;  2RH0 A;  3BAS A;  1NKZ B;  2NPS D;  1L0L E;  4YXW H;  2ZXE B;  4PD4 D;  1PPJ D;  1RY3 A;  3H6P A;  4IL6 X;  4ZKP A;  3L36 A;  1RE4 C;  3RGU A;  5B5E E;  1P84 D;  2V4H A;  1AVY A;  4WB4 A;  1A02 F;  2KSE A;  2HPC B;  3U1A A;  2FXO A;  1KIL B;  3WU2 H;  3IN6 A;  2J58 A;  3HUS A;  4RCN A;  3L37 A;  5TIS E;  3ABV C;  4U0G A;  3WU2 E;  4G2R A;  2WSF J;  2OYO A;  1DX7 A;  3MFM A;  2WSC H;  2DUB A;  5KDR B;  3V4W A;  2OTK E;  2ZT9 B;  2V7Q H;  4ASW A;  1PPJ E;  5CCH D;  4L8K A;  2GUS A;  1SQB D;  1R5S A;  2FKW B;  1NU1 G;  3HTK A;  5KAF E;  3RL0 C;  1XO6 A;  1UYR A;  2E5T A;  2M3E A;  1NAF A;  1VDF A;  3V5I A;  3RK3 C;  2N1T D;  1D7M A;  4OGQ B;  1FC9 A;  5G1Q A;  4IZC A;  4IFM A;  1L0L G;  3H0U A;  3P8M C;  1JNM A;  1N7S D;  2B88 A;  3FGA D;  5BU8 B;  1MFZ A;  5IKL B;  1IFJ A;  3CMA P;  3NJB A;  1BSH A;  2YKQ A;  1RF1 C;  1JB0 J;  3U9S B;  4R4L A;  3A7O A;  1ZP0 C;  5FIF A;  1NTK G;  1KIL E;  1LTJ C;  2ZL2 A;  1JCC A;  1VQO P;  5CTB A;  5AVX B;  4RYF A;  4K29 A;  5CTC A;  1JY3 O;  1PGO A;  5DUC A;  5AW5 B;  4L73 A;  1YIJ P;  4K2N A;  1DCI A;  1S9K E;  1M1J B;  3FXE A;  1Q51 A;  3L72 D;  2WIT A;  1FU1 A;  3ZWB A;  1Q86 Q;  1KB9 I;  1W5C E;  2W27 A;  1VF5 D;  2QG4 A;  1VQL P;  1CI6 A;  2AEF A;  3RSI A;  2CK3 H;  4KWB A;  1WT6 A;  5APT A;  5AVV B;  3C1L A;  2GUV A;  3CXH E;  5TIS H;  1VF5 B;  1HBW A;  1JY3 N;  1GL2 B;  4O9B A;  1OMI A;  1ZN5 A;  1T6A A;  2JR8 A;  1CZQ A;  3G3Z A;  1EXI A;  3PGQ A;  5HUQ A;  1PGJ A;  3H1J E;  2QEX P;  3RK3 E;  4C7R A;  1Y7O A;  4BRY A;  2E75 C;  3KHU A;  1DD3 A;  2LKM A;  5GTI E;  1FAV A;  2OYI B;  4WCZ A;  5C90 A;  2B87 A;  2KSJ A;  1ON9 A;  1KB9 E;  3AE5 C;  1PIX A;  2YIU B;  1HWT C;  1XTC C;  1ZOY C;  3RRV A;  3RK3 D;  2J5G A;  3E7K A;  3VMX A;  2AEJ A;  3F89 A;  1OW8 A;  1YJ9 P;  1L4A B;  3R4Y A;  1X79 B;  3HUS C;  5BU5 A;  3GF7 A;  1YJW P;  1L0N K;  1JUN A;  1NHL A;  2HOD B;  2QM8 A;  2KLU A;  2B87 B;  1IFM A;  3H1K J;  2A06 G;  1EZV I;  2ZJS E;  5DZK A;  1KOR A;  3CI9 A;  3KZI H;  3D6Z A;  2E75 B;  1JMB A;  2HYN A;  3PLN A;  2F9Y B;  2NPS C;  1IFP A;  2NPS A;  2WZ7 A;  4I6M C;  2BCC D;  4U18 A;  2HW5 A;  5TJH A;  2WTY A;  3H32 A;  1HVV A;  2FYU K;  2ZL4 A;  4GOE A;  4ZNC A;  4QMA A;  5DU4 A;  5DTP A;  3L74 J;  1Q82 Q;  2MJZ A;  2H8P D;  1GW4 A;  2NPS B;  3GKB A;  2YNY A;  5ING A;  1SQV D;  3G64 A;  3HTK B;  4U3F J;  2JO1 A;  3AE6 C;  3FDU A;  3TVU A;  3CC7 P;  2B89 A;  3Q0G A;  3AE2 C;  3RK2 D;  2WT7 B;  2IFN A;  2X24 A;  4I7Z C;  3VP9 A;  4JQ0 D;  3VOP A;  1XNY A;  3KTG A;  4KD6 A;  3TLF A;  1NZY A;  1RHZ B;  2OTL P;  3BPT A;  2C8T A;  1N7S C;  3L70 E;  4JYL A;  1EC5 A;  2R44 A;  1RH5 B;  3STA A;  1FZA A;  3M0A A;  3HRX A;  4FNB A;  2Q3E A;  1FZE A;  3VYI A;  1HJB A;  1OD4 A;  3TSI A;  4C46 A;  2WVR A;  3L75 E;  4EYY Q;  2A7K A;  1X0U A;  4FZW A;  3G9R A;  3QKA A;  1XX4 A;  3B5N D;  3R9Q A;  2PGD A;  3TDK A;  2WMM A;  1P84 H;  2FBM A;  2OAR A;  1ZW0 A;  2FYN B;  1GU4 A;  1H0T A;  2KP8 A;  1BCC D;  1NKN A;  1HJ0 A;  3IAO A;  2KI7 B;  2WTB A;  3PHL A;  3AE3 C;  1YTZ T;  2FXM A;  1KQG B;  4PJ0 E;  3L74 G;  1K8A Q;  3H1K E;  2BEZ F;  2FYU E;  3USS A;  3JCU H;  5APX A;  1NTK D;  2IZ1 A;  3H1H J;  4OGQ C;  1KQS O;  3H81 A;  3BF0 A;  5KLV D;  4FN7 A;  2JWD A;  2J5S A;  2AEM A;  4Z1M H;  1QLE D;  2D2C C;  1LTT C;  1P84 I;  4WY4 C;  2QRX A;  2M8R A;  1SVF A;  1NH4 A;  4I4Z A;  1ZRT E;  3KTI A;  1JY2 N;  3LIE A;  2FYN C;  1M7L A;  3FWL A;  1N8R Q;  2KNC A;  1EF8 A;  1VQK P;  1MUU A;  4JCQ A;  4JOT A;  4PV1 D;  3L74 E;  3HUS B;  2ZYG A;  3CCV P;  4WZ8 B;  4B3J A;  3CCR P;  1NVO A;  4ZU2 A;  1ZME C;  2Q35 A;  4HH2 A;  3DJA A;  3CC4 P;  3S9O A;  1YG8 A;  1SQV G;  2L5G B;  5M1B A;  4DJG A;  4ZKU A;  4JWV A;  1L0N G;  4JCR A;  2N9Y B;  1YTZ I;  2QVA A;  4QII A;  1MZ9 A;  5APQ A;  1JMM A;  1CI6 B;  2HR3 A;  1SQX D;  2O3J A;  4DT0 A;  3GHG A;  2M0B A;  4OLQ A;  3L72 J;  5KAI E;  4LK5 A;  3E1R A;  1J1E B;  1BSN A;  1LT1 A;  4KT0 J;  1LT9 A;  2ZFC A;  3K50 A;  1GTW A;  3FXD A;  3B4S A;  3W67 A;  1M56 D;  4H0L B;  4B3H A;  3KYQ A;  4QIJ A;  3BRT B;  3CCQ P;  4YTP C;  2KUB A;  5KKZ B;  2A45 G;  4EDF A;  2OYH C;  1RQV A;  4U0H A;  1NTM G;  4BWN A;  1NZY B;  3TF5 A;  2BZR A;  4OGQ D;  4KHX A;  3OW2 O;  4N6J A;  2HG5 D;  1KV4 A;  2WWW A;  3KXD A;  1U7J A;  1AA0 A;  1AQ5 A;  2R3C A;  4HB1 A;  3KTK A;  3L73 E;  2B9B A;  3G6E P;  1VF5 C;  4ELX A;  1JY3 P;  2Q2X A;  3QWD A;  2IBZ I;  2W6A A;  1LTJ B;  3AEA C;  1URQ A;  1NTM E;  2FY8 A;  3RK2 C;  5AVY B;  5CBN A;  1EDL A;  3H1K D;  4NPF X;  3H1L D;  5APW A;  1NWQ A;  1SQB K;  5APS A;  4KPK A;  2OQQ A;  2DW3 A;  2YO3 A;  4WY4 D;  1K39 A;  3JSV C;  1L0N J;  1LTJ A;  4H13 C;  1IO4 A;  2Y9Z A;  5G1S A;  3H32 B;  1SQP J;  3D70 A;  1J1D C;  1UYS A;  1K05 A;  2KK7 A;  1EZV E;  1JOC A;  4IOI H;  2ZYD A;  5DU8 A;  3T3W A;  1GL2 D;  3DOR A;  1L4A D;  2P2U A;  3P7K A;  3GMA A;  3LID A;  3N7N A;  1DD4 A;  1MKM A;  1NTM D;  3QRE A;  5AW2 B;  3L75 G;  1ZR2 A;  1L4A A;  4A7P A;  2MKV A;  3M6N A;  2W6B A;  3IB9 A;  5E79 H;  3RBZ A;  1XTG B;  1ZV8 A;  2H7H A;  3L75 D;  1FDM A;  1NU1 D;  4OG1 A;  3CL3 D;  3TGU E;  3M0D C;  4WWI A;  3SFE C;  2C9L Y;  1NO4 A;  1G2C A;  2PBP A;  4I7Z B;  2A45 H;  1RQU A;  4ASI A;  5AW1 B;  1WZ8 A;  2V7Q J;  5EFW B;  2QJY C;  1OVV A;  4EOT A;  1PGQ A;  3T88 A;  3H1L J;  3IR9 A;  4JYB A;  4R4M A;  3IAV A;  1KTM A;  4B3I A;  1DUB A;  2PFX A;  3JCU E;  1URQ C;  2K9J A;  1UIX A;  1VQM P;  1AVO A;  5CCG D;  3LW5 J;  1ZRT D;  3Q5R A;  1PZQ A;  1SQB J;  1NTZ J;  1U7M A;  1RE3 A;  2QJY B;  1Q7Y Q;  4DCK A;  1FBM A;  3MD0 A;  1RF0 A;  1RF0 C;  3AEC C;  4NPE A;  2BCC E;  1FDO A;  3AEB C;  3QWO C;  2FYU J;  2ZT9 C;  2VRS A;  1W2B O;  3QK8 A;  2YJG A;  4UB8 H;  2I8D A;  2XKM A;  3HIN A;  5GTH E;  3AE7 C;  1RF1 A;  2PPY A;  4UB6 E;  3P8C D;  5AW0 B;  1G1I A;  2FW2 A;  4ASV A;  2POH A;  1S1C X;  2F6Q A;  2ZQR A;  2QSI A;  1PJH A;  3S4R A;  1FOS F;  1FCF A;  1PGP A;  1PP9 E;  4IFF A;  3CX5 D;  3HE2 A;  1KFM A;  4H0L D;  2N1T B;  3W68 A;  1X9V A;  4Y99 C;  4ELS A;  1VQ7 P;  1RF1 B;  1HNO A;  1KYO I;  3S1K A;  4HDT A;  1LP1 B;  3L35 A;  1DH3 A;  1FZF A;  2K3R A;  1HZD A;  3NTN A;  2OYI A;  1W2E A;  1P84 E;  2QQ3 A;  1R8E A;  3JU1 A;  3SSU A;  4L74 A;  1VQP P;  2W90 A;  2N1T C;  2YMY A;  1N73 A;  2D2C B;  3OJA B;  4LGD E;  2Y9Y A;  3RK2 B;  3BRV B;  1LGH B;  3MUD C;  2IEX A;  3L70 D;  4PD4 H;  4JFC A;  2HFE D;  1EZV G;  3GHG B;  5KAF H;  3ZWC A;  2Q5U A;  2HOD A;  2L91 A;  5APY A;  1YQ3 C;  2E76 C;  1SQB G;  3H1J J;  1S5L E;  2QIW A;  3MZW B;  1JCD A;  1SFC B;  2AXT E;  4JSB A;  1KIL C;  1T2K D;  3QYR A;  1T3U A;  3Q1M A;  2GTR A;  5BVZ A;  2R32 A;  3ZW9 A;  2M5A B;  4JBZ A;  1T8Z A;  2F9Y A;  1K73 Q;  3L73 J;  4AYC A;  3EWK A;  3H1L E;  1SQQ K;  1BCC G;  1QGK B;  2IYP A;  3GG2 A;  4U3F D;  1S9K D;  2XND H;  2OTJ P;  2CE3 A;  1WDM A;  3H02 A;  3L71 E;  4OMR A;  3TYY A;  1PPJ G;  2M5A A;  4MOU A;  2YXR B;  5KJP A;  1FJK A;  1VL2 A;  1VQ6 P;  5APV A;  5H2F H;  1GD2 E;  3EQ2 A;  3V5B A;  3TT6 A;  3H1I G;  1E79 H;  4EML A;  4XFJ A;  3HE4 A;  1UII A;  1BE3 D;  1KB9 H;  1YG6 A;  2F9I A;  2BCC J;  3JC2 2;  2JKV A;  1LTS C;  2K37 A;  1BE3 J;  1VPC A;  2F6I A;  1VQ5 P;  4HC8 A;  2QJK C;  3CXH H;  5AW9 B;  4GIF A;  1E5W A;  5DJU B;  4ZMD A;  3I56 P;  1M1J A;  2FYZ A;  2E75 D;  4C7N A;  3RBX A;  3T97 A;  1J1E C;  2N1T A;  1FOS E;  4BXL A;  2C9N Y;  3B8E B;  1Q52 A;  1RJN A;  1SQP E;  4TT3 H;  5CJ4 A;  3TRR A;  1USE A;  1HTL C;  1NU1 J;  2ZXX A;  4IFD K;  4W7Z A;  3P2L A;  3NXS A;  1JO5 A;  3KZI E;  4KNP A;  3IF4 A;  3PE8 A;  1IFN A;  1DEB A;  2KIK A;  5KLV E;  4I1L A;  1GL2 A;  2QJK B;  1UIY A;  2VSU E;  5MGB A;  3EFG A;  3V5E A;  3AED C;  2VSS A;  1IC2 A;  5CMZ A;  1NU1 K;  2W83 C;  1J1D B;  1JY2 O;  3A0B E;  3KTJ A;  1NTM K;  1Y8A A;  4XA4 A;  2K1A A;  3TGU J;  5KLV K;  1S72 P;  5CCG A;  3C8V A;  3WUT A;  1GZL A;  2A7S A;  1QL2 A;  4DI1 A;  3M9H A;  4TLF A;  3GLM A;  2R5D A;  2G3A A;  1YIT P;  4K3W A;  2VSS F;  2IZ0 A;  1NTZ E;  1NTK K;  1SZO A;  4UB6 H;  2WQY C;  4GDO A;  5AVZ B;  4OH8 B;  3MT6 A;  3A5T A;  2Q6Q A;  4N78 D;  3CPW O;  5INI A;  4RYF H;  1RE3 C;  3QMJ A;  1EDK A;  3Q5S A;  1QEX A;  5AVS B;  2J5I A;  1TG6 A;  2XZR A;  4JYC A;  1FZG A;  2BCC G;  1USD A;  3PZK A;  1SQQ E;  1TYF A;  3VMZ A;  2J5U A;  1DEE G;  3M9Q A;  3FF6 A;  1N73 B;  1HF9 A;  1L0L K;  2AXT H;  3N6R B;  1M90 Q;  1NYH A;  1OW7 A;  2KNC B;  3MGN A;  1SQX J;  3P5M A;  2E42 A;  4NNQ A;  1WDL A;  2JEE A;  1IJD B;  1SLQ A;  2Z5H A;  4NPD A;  3TNU B;  4IL6 H;  4K35 A;  4H13 B;  4EIJ A;  4FZW C;  5DZK H;  2K88 A;  2KZJ A;  1GL2 C;  1KMI Z;  2KOG A;  3FWN A;  4PV1 B;  4EI2 A;  4JCS A;  5CJ0 A;  1FZC C;  3K5B A;  3HD7 A;  5AW7 B;  3I5C A;  5E79 E;  4FJW D;  1X8Y A;  2PRR A;  4L6W A;  3BCC G;  1GW3 A;  4OWF A;  3TGU G;  2KS1 A;  4QFE A;  2KZI A;  3C9I A;  4GKG A;  4JYJ A;  1VQ9 P;  1M1J C;  1NU1 E;  2WSS H;  5K5G B;  4J2U A;  4ZDC A;  3L70 J;  2K9J B;  5KLV G;  3KQF A;  3NJD A;  3MUD A;  4PD4 I;  3D6Y A;  4W7Y A;  2YIU C;  3V4Q A;  1TU3 F;  3QH9 A; 
#chains in the Genus database with same CATH homology
 1VF5 D;  4NEK A;  5DUF A;  4FB8 A;  2E74 D;  2MKV A;  3M6N A;  3RSI A;  4KWB A;  3IB9 A;  3LKE A;  2E76 B;  1VF5 B;  4OG1 A;  1IK7 A;  5L8R J;  3SFE C;  3T97 B;  1J7X A;  2PBP A;  4I7Z B;  1OMI A;  1KQF B;  4ZDE A;  4ZDD A;  4I42 A;  1EXI A;  1RQU A;  3PGQ A;  4ASI A;  5HUQ A;  3RL0 g;  4EMM A;  3RK3 E;  1WZ8 A;  2V7Q J;  4U19 A;  2QJY C;  1Y7O A;  2E75 C;  1NGM B;  4FN8 A;  3MOY A;  2P10 A;  3T88 A;  3D71 A;  4IZB A;  1DD3 A;  4R4M A;  3IAV A;  3OT6 A;  5E0S H;  1KTM A;  4B3I A;  1DUB A;  1OW6 A;  4WCZ A;  5C90 A;  1W2X A;  3QXI A;  1ON9 A;  1UIX A;  2IDB A;  1XNW A;  3AE5 C;  3ST9 A;  5G1R A;  2FXP A;  3O6Q A;  1XNV A;  3SLL A;  1PIX A;  3LW5 J;  1ZOY C;  3RRV A;  3TT7 A;  2J5G A;  3R6H A;  2WSE J;  3Q5R A;  1OW8 A;  2K9Y A;  2G8Y A;  1O8U A;  2UZF A;  3R4Y A;  3ISA A;  3GF7 A;  2JP3 A;  3H0J A;  5JBW A;  3AEC C;  3AEB C;  1FDO A;  5DKP A;  2ZT9 C;  1DIP A;  3K8X A;  5DZK A;  1KOR A;  4U7J A;  3QK8 A;  2NZ2 A;  2FZS A;  2YJG A;  5FUS A;  3D6Z A;  3B71 A;  1SG4 A;  3HIN A;  3AE7 C;  5C9G A;  2E75 B;  3T8A A;  2F9Y B;  2PPY A;  2J5I B;  2EJ5 A;  2FW2 A;  4U18 A;  3L3S A;  3BEZ A;  1S1C X;  2VRE A;  2F6Q A;  4Z0M A;  2ZQR A;  3SWX A;  2H89 C;  2HW5 A;  2QSI A;  1PJH A;  3H0S A;  2ZL4 A;  1FCF A;  1HNU A;  3AE8 C;  3ZWA A;  2E76 D;  3HE2 A;  4H0L D;  5DU4 A;  4JVT A;  5DTP A;  4U0G H;  4MI2 A;  4ELS A;  3R0O A;  1EY3 A;  1HNO A;  3VIV A;  3GKB A;  4HDT A;  5ING A;  3TV5 A;  1N6D A;  4H44 D;  3TVW A;  3OC7 A;  4WYO B;  3HLN 1;  4YXD C;  1HZD A;  3G64 A;  5E0S A;  2JO1 A;  3AE6 C;  3FDU A;  4JJT A;  3TVU A;  4F47 A;  3OME A;  3Q0G A;  3AE2 C;  3R9S A;  3SFD C;  2X24 A;  4H44 B;  4I7Z C;  2QQ3 A;  1R8E A;  3JU1 A;  5KDR A;  1XNY A;  1WDK A;  2D2C B;  3Q3D A;  3KTG A;  4KD6 A;  2FBW C;  3TLF A;  1NZY A;  4JCT A;  2IEX A;  3Q7H A;  4I52 A;  3IBB A;  3BPT A;  1EF9 A;  2C8T A;  4JFC A;  4JYL A;  4GHN A;  2VSU F;  1ON3 A;  4RKU J;  2NP9 A;  3STA A;  4FNB A;  2Q34 A;  3HRX A;  3ZWC A;  2CBY A;  3Q2Y A;  3T89 A;  1YQ3 C;  1MJ3 A;  2E76 C;  3BPP A;  2QIW A;  3AEF C;  1OD4 A;  2VSS E;  4JSB A;  3H25 A;  2A7K A;  1X0U A;  1K32 A;  3QYR A;  4FZW A;  3G9R A;  3Q1M A;  3QKA A;  4H13 D;  4MXI A;  2GTR A;  1N6F A;  1XX4 A;  3R9Q A;  3ZW9 A;  4YLH A;  2F9Y A;  2H88 C;  2FBM A;  3EWK A;  4ELW A;  5E0N X;  3RST A;  2ZT9 D;  2CE3 A;  1WDM A;  3H02 A;  4Y28 J;  3WG5 A;  4IZD A;  1HJ0 A;  3IAO A;  3H0Q A;  4OMR A;  4Q0G A;  4MOU A;  2WTB A;  3AE3 C;  2O01 J;  4HNK A;  5KJP A;  1VL2 A;  1UYV A;  5JBX A;  2E74 B;  3TT6 A;  3GF3 A;  4EML A;  1KQG B;  4XFJ A;  2J5I I;  3R9T A;  3KTH A;  5DL1 A;  2WPV B;  1YG6 A;  2F9I A;  1FC6 A;  2BEZ F;  2VSU A;  2WSC J;  4H44 C;  1EXJ A;  2F6I A;  4OGQ C;  4HC8 A;  2QJK C;  3H81 A;  3BF0 A;  3M6M A;  3AE4 C;  4FN7 A;  2J5S A;  2E75 D;  1UYT A;  2A81 A;  1Y9B A;  4Z1M H;  4ZDF A;  2D2C C;  4NAR A;  3QXZ A;  1Q52 A;  1RJN A;  4TT3 H;  1U57 A;  3TRR A;  4I4Z A;  1ZRT E;  3KTI A;  3P85 A;  3P2L A;  2FYN C;  1WMK A;  5INF A;  1K04 A;  4KNP A;  2BEQ D;  1EF8 A;  3PE8 A;  4JCQ A;  4JOT A;  4PV1 D;  1Q90 D;  4ZDB A;  3HP0 A;  1UIY A;  2VSU E;  4WZ8 B;  5MGB A;  2W3P A;  3V5E A;  4B3J A;  3AED C;  2VSS A;  1AJY A;  3Q1T A;  4ZU2 A;  3AEE C;  3T8B A;  2ZL3 A;  3LAO A;  1ZME C;  2Q35 A;  3DJA A;  3KTJ A;  3S9O A;  1YG8 A;  5M1B A;  4JWV A;  2D2C D;  4JCR A;  1FDI A;  1S5L X;  4QII A;  1RJM A;  1JXZ A;  2E74 C;  2QJP C;  3PEA A;  3AE1 C;  3C8V A;  2A7S A;  4OLQ A;  4DI1 A;  2YMK A;  4U1A A;  3TZ3 A;  4LK5 A;  5DU6 A;  3GLM A;  4PV1 C;  2G3A A;  2VX2 A;  1TU3 F;  4K3W A;  2VSS F;  4KT0 J;  3AEG C;  1OD2 A;  3Q0J A;  1SZO A;  3K50 A;  2WQY C;  4GDO A;  3U9T B;  4IL6 X;  3I47 A;  4H0L B;  4B3H A;  3MT6 A;  4QIJ A;  1GMJ A;  2F9I B;  5INI A;  4RYF H;  2DEO A;  1YQ4 C;  1N6E A;  4Q1I A;  4YTP C;  2ZL0 A;  3QMJ A;  1PV3 A;  5KLI C;  3Q5S A;  2J5I A;  3IN6 A;  1RQV A;  1TG6 A;  4RCN A;  4U0H A;  3ABV C;  4U0G A;  1NZY B;  4G2R A;  5KKZ C;  2BZR A;  3MYB A;  3PZK A;  2WSF J;  3MFM A;  1TYF A;  4OGQ D;  2J5U A;  2DUB A;  5KDR B;  3FF6 A;  1HF9 A;  2ZT9 B;  3N6R B;  1NYH A;  4L8K A;  1PL5 A;  1OW7 A;  3QRE A;  5DTW A;  2X58 A;  3P5M A;  4GM2 A;  4NNQ A;  1WDL A;  3KTK A;  1XO6 A;  1UYR A;  3V5I A;  1VF5 C;  4ELX A;  2Q2X A;  3QWD A;  3AEA C;  4H13 B;  4OGQ B;  1FC9 A;  5G1Q A;  4FZW C;  5DZK H;  4IZC A;  3H0U A;  1KMI Z;  3ZW8 A;  3FGA D;  3TDC A;  4PV1 B;  3Q5P A;  5IKL B;  4JCS A;  4FND A;  3NJB A;  1FC7 A;  4KPK A;  2OQQ A;  4FJW D;  1JB0 J;  3U9S B;  4R4L A;  4L6W A;  1K39 A;  1ZP0 C;  5FIF A;  1KIL E;  3U9R B;  4H13 C;  2VSU C;  5G1S A;  4QFE A;  2ZL2 A;  2J5G D;  5CTB A;  4EMP A;  3D70 A;  4JYJ A;  1UYS A;  4RYF A;  1K05 A;  4K29 A;  5CTC A;  4J2U A;  4ZDC A;  5DUC A;  5DU8 A;  4K2N A;  3T3W A;  1DCI A;  3KQF A;  3NJD A;  3D6Y A;  3DOR A;  1Q51 A;  2PG8 A;  2YIU C;  1VRG A;  3GMA A;  2D3T A;  3ZWB A;  4H0L C;  1DD4 A;  1MKM A;  2ZQQ A;  3AE9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...