3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
4OMRA 2VSSF 3P85A 1WDLA 3MFMA 4NNQA 4KPKA 3QYRA 3MOYA 4JOTA 1WZ8A 2VSUE 4FJWD 3RSTA 4YLHA 2ZL3A 1HZDA 1K39A 3TV5A 3R9TA 2D3TA 5C9GA 3DORA 4U19A 5DKPA 4OLQA 3P5MA 2A7SA 5INIA 1WDMA 2F6IA 3QXIA 3ZW8A 3TT6A 2F9YA 1OD2A 3LAOA 1NZYB 4FZWC 5C90A 5FUSA 1RJMA 5G1SA 4JWVA 3R9QA 3PZKA 4JCRA 5KJPA 4NEKA 4JCTA 3KTKA 2HW5A 1FC7A 2VREA 2C8TA 4K2NA 3K8XA 4ELXA 4K29A 2J5GA 3N6RB 4WZ8B 4I52A 4JJTA 2X24A 3T8AA 5KDRB 3SWXA 2EJ5A 3PGQA 4FNBA 3I47A 4Q1IA 4GM2A 4Z0MA 1SG4A 5E0NX 2Q34A 5INGA 3Q0JA 4RYFH 3ZW9A 4B3IA 4ZDFA 1EY3A 2CBYA 2NP9A 3QWDA 3GF3A 3KQFA 2VSUA 2PBPA 2CE3A 3KTHA 1XNWA 3FDUA 1XX4A 1SZOA 1EF8A 3R0OA 4ASIA 4QFEA 2PG8A 2ZL4A 3V5EA 5IKLB 1YG8A 3ZWAA 3R6HA 1FC6A 1W2XA 3HE2A 3TLFA 2QQ3A 3G64A 3T89A 5JBWA 3ISAA 2FZSA 4L8KA 3TT7A 4ZDDA 5INFA 2X58A 3BPPA 3QXZA 2Q35A 3QKAA 5DTPA 1K32A 3Q0GA 3ZWBA 3LKEA 4U0HA 3QMJA 1TYFA 3H0QA 4FN8A 3T3WA 3H0SA 3KTJA 5DU4A 2J5II 3VIVA 1DUBA 3U9RB 5E0SH 1UYSA 4K3WA 5DU8A 2ZL0A 4IZDA 2F6QA 5DUCA 1UYTA 2VSUF 1N6DA 3PE8A 5DU6A 2A81A 2ZQRA 3GF7A 4QIIA 4U0GA 3RRVA 2J5IA 1FC9A 3HINA 4FN7A 2A7KA 1XNYA 3HP0A 4B3JA 1UYRA 4JYJA 1Y7OA 3BF0A 2WTBA 1OD4A 3BEZA 2F9YB 3NJDA 1HNUA 3IBBA 1UYVA 4QIJA 1N6FA 3TZ3A 5DZKA 4JSBA 3P2LA 3OMEA 4FZWA 1JXZA 5CTBA 3OT6A 4EMPA 4MOUA 4WCZA 3WG5A 4MXIA 3H81A 4ELSA 3TDCA 4FNDA 4EMLA 2J5GD 4GHNA 2DUBA 3PEAA 4IZCA 2F9IA 4OG1A 3M6MA 4F47A 1EF9A 3M6NA 4DI1A 3H0UA 4MI2A 2VSSE 2FW2A 4I4ZA 4LK5A 4Q0GA 3U9TB 4HNKA 3TVWA 3IAVA 5G1QA 4ZU2A 3JU1A 4FB8A 4L6WA 1XNVA 1DCIA 3H0JA 3V5IA 2UZFA 3SLLA 3Q1TA 5JBXA 5CTCA 2PPYA 3U9SB 3ZWCA 2IEXA 4KWBA 4U1AA 4U18A 2VX2A 5FIFA 1MJ3A 2GTRA 4B3HA 1WDKA 1J7XA 3STAA 1N6EA 1TG6A 1NZYA 2BZRA 5G1RA 3OC7A 2Q2XA 2DEOA 1XO6A 3R9SA 5DTWA 4EMMA 3L3SA 4JVTA 3H02A 1ON3A 1PJHA 4HC8A 1PIXA 4WYOB 3K50A 3T8BA 1O8UA 2J5SA 3IB9A 4JYLA 2FBMA 4KD6A 5KDRA 4RYFA 3KTGA 3FF6A 3TVUA 2VSSA 1RJNA 2J5IB 2ZQQA 3Q7HA 4KNPA 4JCSA 3GLMA 1VRGA 4JCQA 1ON9A 3ST9A 4IZBA 3MT6A 3DJAA 4U0GH 2VSUC 3QREA 4JFCA 4G2RA 1HNOA 3QK8A 3KTIA 4ZDCA 3HRXA 5DL1A 3MYBA 1Q52A 1UIYA 3NJBA 1X0UA 5DZKH 3T88A 1Q51A 1YG6A 4ZDBA 4ZDEA 2ZL2A 2W3PA 2F9IB 5DUFA 3TRRA 5MGBA 4I42A 4RCNA 1FCFA 4ELWA 3RSIA 5E0SA 3GKBA 3GMAA 3HLN1
chains in the Genus database with same CATH superfamily
2L91A 4OMRA 3CWBJ 4TT3H 3MFMA 2IYPA 4NNQA 3CC7P 1NTKD 3QYRA 3D71A 1HH0A 1AV1A 4JOTA 1FDOA 3H32B 3EQ2A 1K39A 2QJPC 3II6A 3TV5A 3MD0A 1NAYA 3RL0C 3R9TA 5C9GA 1M1JA 1M1KQ 2IBZI 1L0NG 5DKPA 4JQ0D 1NU1G 1P84H 3CCLP 3A0BE 4YXDC 1HWTC 2A7SA 2F6IA 2WWWA 5CCHA 2W8ZA 1NH4A 2WITA 3EFFK 3C9IA 3MZWB 5GTHH 2FYUK 2WPRA 4XA4A 1OD2A 5FUSA 1KQFB 3F5HA 3D6YA 3R9QA 1T2KC 4JCRA 4NEKA 3NFQA 4JCTA 1FC7A 3V2RA 1JOCA 3VTPC 1XTCC 2ZVOB 1YHQP 2WT7B 4K2NA 1LNQA 1PPJE 2Q3EA 3TK1A 1JNMA 5B66E 1SQXE 4WZ8B 1N8RQ 1S2EA 4IFDK 2N1TC 1GZLA 3CWBE 3L75J 3PGQA 3PRJA 1HGVA 1SG4A 3TDKA 1T2KD 3A2AA 2M5AA 3GHGA 1U57A 4RYFH 1OVRA 1YIJP 1BGYE 4ZDFA 2QRXA 1AJYA 3AEGC 3H1LD 3CXHE 5CMZA 3QWDA 3GF3A 3V4QA 3BPTA 1SQQD 2WSSH 2CE3A 5KLVG 2XV5A 1GL2C 3H1IG 4BWNA 4I6MC 2W6AA 1S5LH 4NPDA 2HPCA 1N7SA 2PAJA 4K3AA 4ASIA 2QSIA 4OGQD 4QFEA 1LTSC 4OGQB 1MV8A 1H0TB 3V5EA 2GA1A 5IKLB 1YG8A 3ZWAA 3B71A 4AYCA 3HE2A 1PV3A 3TLFA 1SQXK 1YITP 2FZSA 4L8KA 1SQBJ 4ZDDA 3VMZA 1FDMA 3A5TA 5AVVB 3QXZA 4EIJA 3V5BA 4B86A 3Q0GA 1K9MQ 3LKEA 2XNXA 2PP6A 1LP1B 1U7JA 1YJNP 5HUQA 1Q90D 3N7NA 3H0QA 3KTJA 3HE5B 4PV1B 2LR2A 1GU5A 4K3WA 2L5GB 3L75E 1LT9B 4WVZA 3L35A 1SFCD 4IZDA 1PGPA 4HJGH 1SFCB 4H13C 4Y99C 1NTKG 4EDFA 1ZLLA 1OZHA 2A81A 3Q1MA 3RRVA 3BCCD 3C8VA 3HUSB 1KQLA 3HINA 3SWYA 1ZN5A 3HP0A 4AUWA 1KV4A 1JCDA 1G1IA 2B87B 3BF0A 2NPSD 1VQNP 2WTBA 1PGQA 2W90A 3CLQA 4WY4C 3IAOA 2Z4EA 1AFOA 1GD2E 2RH0A 4QIJA 5DZKA 4JSBA 4GDOA 3OMEA 4EMPA 4MOUA 3CCMP 1NTMJ 4N3YB 2M3EA 3H81A 4ELSA 1M90Q 1JEKA 1SQBE 1JCCA 2V7QH 2KZJA 2Y0CA 3M6MA 1QGKB 5CJ4A 2HG5D 1BDDA 1PP9J 4W7ZA 3H6PA 5K5GB 1FU1A 4Q0GA 2WMMA 2R3SA 3AE8C 3GG2A 2ZFCA 3TGUE 2A06D 1SQPD 2I8DA 3WMM0 5GTIH 2QVAA 1OVUA 5TISH 4L6WA 1RE3C 2K88A 1DCIA 3QH9A 5AVZB 1L0LJ 1BDCA 3AE4C 3T97B 5KJ7D 2N9BA 3Q1TA 3AE9C 2E75D 2FFDC 1Y8AA 1GL2A 3QWOC 5CTCA 2E75B 3U9SB 2QA4P 1BE3D 1SQQG 1NKNA 4H44D 4KHXA 3RK3D 5KKZB 1SQBK 1SS1A 3RK3B 2VX2A 5APYA 3PTZA 5AW5B 1WDKA 4Z1MH 2H7HA 5BU8B 1P84E 5AVUB 1JY3P 5G1RA 1HJ0A 3OC7A 3A0BH 2OGUA 1KB9E 1NTME 5AVQB 1M8OB 1LWUB 3Q5RA 5DTWA 2OYIC 2W6BA 1DEBA 4JYCA 4JVTA 5GTHE 1YJWP 3VN0A 3EFGA 1T6AA 2YMKA 4YXWH 2FYZA 3K50A 2XZRA 2NPSA 3Q3DA 4PD4E 3VOPA 4RJTA 2MJZA 1AVYA 1O8UA 1PP9E 3D70A 1IZNB 1EQ7A 2KYVA 1KYOE 2P2UA 1OMIA 3F89A 2VSSA 1RJNA 2J5IB 2CPBA 3SSUA 5B66H 3ST9A 4IZBA 3MT6A 3S4RA 4RKUJ 2BEZF 2ZXEB 2OQQA 4U0GH 1L0LE 3PH0A 3W67A 3QREA 4JFCA 1BSHA 3L71J 1VF5B 1NTZJ 2HR3A 1HNOA 2QM7A 4WY4A 1NTMK 2YO2A 2WZ7A 3HRXA 1EDLA 2YIUB 1SQXG 3RBXA 1GMJA 1EZVE 2E76D 3AE2C 2E76B 3CWBG 4ZDBA 4ZDEA 2Q5UA 2F9IB 1IFIA 1L0ND 4JYBA 1M56D 3TRRA 1NU1D 3WUUA 3AE3C 1FCFA 5KJ7A 1YTZT 3VYIA 3GMAA 2E5YA 3VMYA 3P85A 2V7QJ 1WDLA 4W80A 2Z5HA 2KS1A 2R5DA 1L0LK 2OYOA 1USEA 4FJWD 1ZRTE 2Y0EA 1RQVA 2QJKC 4XE5B 4D6TJ 3HE4B 5B5EE 1G2CA 3H1HJ 2D3TA 1RE3A 3DORA 3G6EP 2O1KA 2FFDA 3P5MA 1WDMA 3A3YB 1URQB 3HTKA 1CZQA 3OAKA 1JY2P 3L71E 3L4FA 3TT6A 4U3FJ 1BE3G 2XKMA 2G8YA 2IDBA 1GW3A 2RKLA 2OTJP 4EYYQ 3PLNA 3I56P 5G1SA 2LKMA 4JWVA 1WMKA 3P8MC 2QJYC 4WWIA 3V6IA 2ZT9C 5KJPA 3KHUA 4HB1A 1Y47A 5AVXB 4C7NB 1JMBA 1K05A 2OYIA 1S4XA 1QVGO 2C8TA 3CX5D 1JUNA 1U7MA 3UIAA 3H1ID 2J5GA 3MTUE 1W2BO 4I52A 4JJTA 5APSA 2IFMA 1N73C 3M91A 5KDRB 4O9BA 3CL3D 4LGDE 1WRGA 3SWXA 4FNBA 1CSBA 2ZAEB 4Q1IA 4L73A 4ZKPA 5INGA 2Q3IA 4D6TE 4B3IA 1NTZK 1KTMA 1EY3A 1NKZB 4IL6E 2QM8A 3H1HE 1Q2NA 2LXBA 2PBPA 3KDPB 1SQBG 3KTHA 2P1JA 2HODB 3FDUA 1XX4A 2QIWA 3R0OA 4TLFA 2PG8A 4U3FE 4YTPC 2ZL4A 3JCUE 5H2FH 3H1KD 1W2XA 1CI6A 2RN0A 2QQ3A 2YKPA 1W5CE 2QG4A 1L4AD 5APWA 3U1AA 3H1JJ 1K04A 1L4AB 2Q35A 1BGYJ 1LJ2A 3D6ZA 4YPCA 2ZXXA 4A7PA 1YYCA 2A45H 2P67A 2IPPA 2WTYA 1KILD 3CCEP 3H0SA 1KILB 2J5II 5AW7B 2BCCJ 3U9RB 3G9RA 4IL6X 1KB9H 1E5WA 1MKMA 3ZDMA 1TU3F 3MP7B 4M3LA 2C0XA 2ZL0A 3S9OA 5DUCA 4PJ0E 4AQRD 1X22A 1DH3A 2FBWC 3U1CA 3GF7A 4L74A 3CCSP 1AVOA 5CBOA 2PGDA 4PD4H 2WSEH 3BASA 2Y9YA 1NOHA 2I1KA 4BRYA 3WUTA 2A7KA 1SQVJ 2KK7A 4B3JA 1UYRA 1NTMG 1KYOH 1Y7OA 3RL0g 3CCVP 2N9YB 1OD4A 3BEZA 2Q9IA 2E5TA 4L76A 1CW5A 2F9YB 1GW4A 1OX3A 2OTKE 1JXZA 5CTBA 1M7LA 5TJHA 2AEFA 4OGQC 3L72J 1R5SA 2P58A 4EMLA 3H1JE 1JM0A 4GHNA 4OG1A 3WU2E 3L74J 1J1EB 3M6NA 2R32A 3H0UA 4MI2A 2VSSE 2C9NY 2FYUD 1N73A 1IJDB 1SLQA 4I4ZA 1L0LG 1H8AA 2BCCE 3S1KA 2WSFH 1N86A 3FWNA 1FS0E 1LT9C 3N4XA 3H32A 3TVWA 1RQUA 3IAVA 1SFCC 1N7LA 3O6QB 2KLVA 2YKOA 3JU1A 1VQMP 2ZYAA 3M06A 3H0JA 2N1TB 4OH8B 3HUSC 3OA7A 1SQVE 2RMZA 2K3RA 4U1AA 4U18A 5FIFA 1MJ3A 2NPSC 4PV1D 5B5EH 3M0DA 1RF1B 1W2EA 1J7XA 2G3AA 2Z5IA 3E1IA 3P8CD 3CX5I 3CCJP 3TGUJ 2B88A 2BZRA 1NVOA 3L72E 3H1KG 2Q2XA 1DIPA 2DEOA 4GOFA 2WPQA 2MKVA 3RBZA 3H02A 1BCCJ 3Q5PA 1NGMB 1R5LA 4RO0A 3L74E 1PIXA 2WT7A 1OXZA 3E7KA 1FZCB 3T8BA 3KZIE 1L2PA 3SWFA 2QE7H 2JR8A 4JYLA 3B5ND 1SQXD 1S3JA 4KD6A 1ZXGA 3B5NB 3H25A 1LTJB 3L71G 3RK2D 1NTZG 1SQVK 3CWBD 3RK2B 3FF6A 3CI9A 3Q7HA 4KNPA 1KORA 1VRGA 1ON9A 1T3JA 2ZYDA 1AQ5A 1UIXA 2HLOA 4C46A 1EXJA 3BATA 2IBZE 1S9KE 2VSUC 1BGYD 1FBMA 2AEJA 4I7ZB 3VP9A 2GUSA 1UIIA 2ITAA 3CXHD 4WB4A 3CPWO 1E79H 5AVTB 4H13B 4Y99B 5KJ7C 4Y28J 1IO4A 2E75C 2OYHB 2WSEJ 1NJIQ 1NAFA 3M9HA 4IL6H 5KKZC 1IK7A 1Q52A 4H44C 3RK3C 1NWQA 5DZKH 3L73J 3T88A 1Q51A 1H0TA 1YG6A 4R4LA 3Q2YA 1HVVA 2ZL2A 1ZR2A 2W3PA 1HBWA 2JKVA 4BXLA 4HYTB 1BCCE 1LWUC 5H2FE 4D6TG 1MZ9A 2K9YA 2GM4A 4ELWA 3JCUH 1IFMA 5E0SA 3GKBA 3H1HG 1LP1A 4N78E 2VSSF 2AXCA 2YO3A 1RY3A 2JEEA 2H43A 2FYUG 1J2JB 2FXPA 3MOYA 3HE5A 1FZAA 5EFWB 1WZ8A 3RSTA 1KN7A 4YLHA 5KLVJ 1LT9A 3L75D 2XDJA 1M57D 1SFCA 4U3FG 1OW7A 3LW5H 2WSFJ 1IFDA 2H89C 4U19A 2P7JA 3HUSA 3VMXA 4OLQA 3HD7B 5INIA 3GW6A 1QL1A 3TNUB 2B87A 2C0WA 1EDKA 4PJ0H 3L70J 5AW1B 1VF5C 1BSNA 1JTHB 2D2CD 3LAOA 1NZYB 2D2CB 3IN6A 1FJKA 5APUA 2FY8A 3L73E 1VDFA 3PZKA 1NYHA 3U59A 3KTKA 2E76C 4EOTA 3AE6C 2SPZA 2JP3A 2POHA 1T3UA 1VQ6P 3K8XA 1FZFA 4ELXA 4K29A 1SQBD 3SWKA 2DW3A 3TSIA 1G1JA 1NTKJ 2M8RA 4UB6E 2FYNC 1GU4A 1VF5D 3PJSK 2LXCB 3I47A 1OW8A 1PPJG 3FXDA 4GM2A 2IZ1A 2Q34A 5KLVE 3WU2H 3H1IE 3FGAD 1JY3O 3ZW9A 5AW3B 4GT1A 1VQKP 2K9JB 1MFTA 1QX8A 3B8EB 5AVYB 3CCQP 2W27A 3AEAC 5APQA 2VSUA 2WSCH 4IFMA 3H1JG 1JMMA 2KIKA 3T97A 1BGYG 1RF0C 3L70E 1X79B 1J1DC 2E43A 1EC5A 3MGNA 1FC6A 3IR9A 3G64A 2KZIA 3T89A 5KLIB 5JBWA 3ISAA 1R8EA 3V2NA 3NTNA 1P84D 2X58A 5APTA 4UB8E 5CCGC 3QKAA 5DTPA 1K32A 1JB0J 1LWUA 1NO4A 1KB9D 1NTMD 1S72P 4U0HA 5AVWB 5KLVK 1ZR4A 2H88C 1NTKE 1TYFA 1URQD 2I1JA 5DU4A 4LC1A 3VIVA 1CI6B 1DUBA 2E74D 4HDTA 1UYSA 2E74B 2FXMA 1FE6A 4PD4D 3KPEA 1PP9D 2W83C 2F6QA 2K37A 3H1LJ 2IFNA 1K8AQ 1PL5A 1N6DA 3M9QA 1M1JB 1SQQJ 3PE8A 2R44A 4XFJA 1FZEA 5CBNA 1GK6A 5CCGD 3CXHI 2J5IA 2W6JH 3A0HE 3L75G 5AW0B 5CCHD 3KZIH 4FN7A 1IFNA 3LIEA 3WUVA 3L72G 4JYJA 1YBKA 3AE1C 2J58A 1L0LD 2ZYGA 3LW5J 4ZKUA 3IBBA 1UYVA 1AQTA 1N6FA 1MFZA 3TZ3A 3FWLA 5APXA 3P2LA 3OW2O 2KOGA 2KSEA 2XU6A 2CPSA 2JWAA 4H0LB 3VMAA 1LT1A 1NTKK 3WG5A 4DZOA 5DJTB 4MXIA 1Z56A 5CJ0A 2JWDA 3BRTB 1Q86Q 1LTTC 4JPZB 1YJ9P 1H88A 3VP8A 2F9IA 4IZCA 3L37A 1L4AC 3ABVC 1SVFA 4DI1A 2IBZG 1JY2O 2HYNA 5E79H 3G71P 2OTLP 3ITKA 1KILC 2VRSA 2M5AB 3GHGB 3BCCJ 2AEMA 3M0DC 2B89A 4HNKA 3H1LE 3NXSA 1PGJA 5G1QA 1SQQE 3AEEC 1GK4A 3HE4A 1QVFO 1LTBC 1XNVA 3SLLA 1DEEG 1LTAC 3AECC 3TGUG 4L75A 5JBXA 5BU5A 1N7SD 3P32A 2HPCB 1N7SB 4HH2A 3ZWCA 2IEXA 1RF0A 2XNDH 1BCCG 1URQA 4KWBA 2H8PD 5AW9B 2GTRA 1D7MA 5L8RJ 3L71D 1NTZD 2WVRA 3PP5A 3JC22 4GIFA 4HKZH 4MN4C 2WSCJ 4GKGA 1N6EA 3STAA 2KNCA 2PFXA 2Y0DA 1EDJA 1FOSE 1XO6A 1ZMEC 3R9SA 4EMMA 5CCGA 4OVNF 2A45G 1ON3A 4C7NA 3OJAB 4I2LC 1SP4A 3RGUA 3P8CE 1J1EC 3AE7C 1VQ7P 1SQQK 3R2PA 1SQPJ 1DD3A 3E1RA 1KFNA 5KDRA 1YTZI 4RYFA 2QJPB 3B4SA 1KMIZ 3P7KA 3RL0D 3BCCE 3TVUA 4EI2A 3RL0B 1KC8Q 2AXTH 2ZQQA 4JCSA 1GDTA 2O1JA 1PP9G 4NPFX 1PGOA 1KQSO 1BE3J 1HTLC 4UB6H 3A7OA 3DJAA 3L73G 4D6TD 2R5BA 3KYQA 1JY3N 3PHLA 3H1HD 1IK9A 1Q82Q 2V4HA 3CX5H 1QL2A 3KTIA 2O01J 2A45I 2HODA 3MYBA 1P84I 2OARA 3NJBA 4DJGA 1X0UA 1PZQA 1RF1C 2FKWB 3FX0A 4PV1C 1KB9I 4U3FD 2Y9ZA 1VPCA 2YMYA 1KZUB 2R3CA 3KXDA 4ASVA 2JO1A 1KFMA 2KLUA 1L4AA 2YKQA 3HRNA 1EZVG 2N1TD 3SFDC 1MUUA 1RHZB 1QLED 3RSIA 4PD4I 1FZGA 5KAFE 3HLN1 1Y9BA 3M0AA 1ZV8A 2A06E 1KYOI 1SQPE 1FZCC 1KILA 4KPKA 3USSA 4UB8H 2VSUE 3BRVB 3CC2P 2ZL3A 3IF4A 1HZDA 1FJPA 3L70G 2J5UA 3B5NC 1LTJC 1RE4C 4ZMDA 3RK2C 4GODA 1GL2D 5KAIE 3TYYA 1BE3E 2KP8A 1GL2B 3RK3E 3KQGA 3CMAP 1OIPA 2IZ0A 2NRGA 4U7JA 3QXIA 3ZW8A 1OW6A 4I7ZC 2ZVNB 1ZW0A 2WQYC 4C7RA 2KXPB 1PPJD 1XTGB 5KTBA 2F9YA 1EZVI 2J59M 4FZWC 5C90A 2OYHC 3A0HH 1RJMA 1L0NJ 5AW8B 1NU1J 4RESB 1LGHB 2HW5A 1SQPK 2ZJSE 2VREA 1YQ3C 1FOSF 3K5BA 1YI2P 2NPSB 3H1JD 3N6RB 4WBAA 2X24A 1PFIA 3T8AA 4H13D 1DX7A 2EJ5A 1OWAA 5APVA 1KD1Q 5AW2B 4Z0MA 5E0NX 2BCCD 3Q0JA 1JY2N 2BEQD 2M3BA 4R4MA 5E79E 3BVHA 5DJUB 4ASWA 2CBYA 4GOEA 2NP9A 3O6QA 3CCUP 3KQFA 2FXOA 4WY4D 4WY4B 2N1TA 3V4WA 1XNWA 2UWJE 1FDIA 3HD7C 1SQVD 1SZOA 1EF8A 1A02J 3R6HA 1RF1A 1L0NE 1IFJA 4QMAA 3JSVC 2D2CC 1NU1E 3CMEP 3TT7A 5INFA 3H1IJ 3BPPA 4K35A 3I55P 3L72D 3H1LG 3ZWBA 3L36A 2Q7CA 2BASA 2JDIH 3QMJA 2YXQB 4H44B 3HD7D 4NARA 2KS1B 2C9LY 4FN8A 3T3WA 3MUDC 1X9VA 1X8YA 3L74D 2NZ2A 1FZCA 5E0SH 3EWKA 1HJBA 1JO5A 2IYOA 1VQPP 5DU8A 2KUBA 3C1LA 5C39A 1G2CB 3B5NA 1UYTA 2VSUF 1LTJA 2Q6QA 2WPVB 5DU6A 1RE4A 1EDIA 2YIUC 2ZQRA 4QIIA 4U0GA 3CCRP 4KJMA 1FC9A 2FFDB 3SFEC 1AA0A 3HTKB 1XNYA 3V2PA 1L0NK 2E42A 3W68A 2AXTE 1YQ4C 1NU1K 2IBZD 1S9KD 3H1KJ 3AEDC 3NJDA 1HNUA 4LLHA 3Q5SA 2O3JA 1OFCX 2M0BA 4FZWA 2OYHA 3OT6A 4IFFA 1HF9A 3CD6P 3G4SP 4WCZA 3AEBC 2OYIB 3CX5E 3TDCA 4FNDA 1LTIC 5KLIC 2J5GD 2DUBA 5AVSB 3BCCG 3PEAA 4W7YA 3MIWA 3TGUD 3M9BA 1HUCA 2K1AA 3NMDA 1QEXA 4F47A 1EF9A 4I1LA 2YXRB 2FW2A 1BCCD 2KSJA 1Q81Q 1RH5B 1VQ5P 4LK5A 2KB7P 2IX7C 2P10A 3CXHH 3U9TB 1URQC 4N78D 2JJLA 4DCKA 1LTGC 2E74C 1S5LE 2HFED 5AW4B 1NHLA 1H89A 1VL2A 4ZU2A 2BCCG 5AVRB 5KAFH 4FB8A 1M1JC 2FYNB 3V5IA 2UZFA 5M1BA 1FAVA 4ZNCA 1ZOYC 3AE5C 2PPYA 5CCHC 4KT0J 1VQ4P 3HD7A 3H1KE 3TNUA 2KI7B 4B3HA 1T8ZA 3IFMA 1EXIA 1JTHA 1SQVG 5KAIH 3R4YA 1VQ8P 3AEFC 1GTWA 1TG6A 2A06G 1NZYA 1SQPG 2B9BA 1KYOD 4H0LC 2Q1KA 3L73D 2FYUJ 3L3SA 1KILE 1PJHA 2PRRA 1VQLP 5CHXA 2O01H 4HC8A 3G3ZA 1J1DB 1NTZE 3CC4P 1DD4A 2YNYA 4WYOB 1S1CX 2QEXP 1S5LX 1WT6A 3MUDA 2WPSA 2J5SA 3IB9A 2KNCB 1VQOP 2QJKB 2YJGA 3MHVA 2FBMA 4DT0A 3L74G 1K73Q 4CPGA 4OWFA 3KTGA 2GUVA 3GHGC 4JBZA 3GLMA 4H0LD 4BRYB 4JCQA 1KQGB 1IFPA 5KLVD 2K9JA 3O8ZA 4IOIH 1EZVD 1IC2A 1VQ9P 1FC2C 1OVVA 3FXEA 1USDA 1X0TA 4G2RA 2O01N 3TF5A 4NPEA 3QK8A 1FZBA 1N7SC 4ZDCA 5DL1A 2ZT9D 4J2UA 3LIDA 1HGZA 2QJYB 1UIYA 2ZT9B 4JF7A 3L70D 4N6JA 3I5CA 3V2QA 1N2DC 1A02F 5AW6B 5DUFA 1ZRTD 2FYUE 5GTIE 4DOJA 5MGBA 4I42A 4RCNA 1Q7YQ 1N73B 1SQXJ 1ZP0C 5TISE 2CK3H 5BVZA
chains in the Genus database with same CATH topology
4OMRA 2VSSF 3P85A 2V7QJ 1WDLA 4TT3H 3MFMA 4NNQA 4KPKA 3QYRA 2FXPA 3MOYA 3D71A 4JOTA 1FDOA 1WZ8A 2VSUE 4FJWD 3RSTA 1ZRTE 4YLHA 2ZL3A 1RQVA 2QJKC 1HZDA 1K39A 2J5UA 2QJPC 3TV5A 1OW7A 3R9TA 2D3TA 5C9GA 2WSFJ 3DORA 2H89C 4U19A 5DKPA 3RK3E 4OLQA 4YXDC 3P5MA 2A7SA 5INIA 1WDMA 2F6IA 4U7JA 3QXIA 3ZW8A 1OW6A 4I7ZC 3TT6A 1VF5C 2WQYC 2G8YA 2F9YA 1OD2A 2IDBA 2D2CD 3LAOA 1NZYB 4FZWC 5C90A 5FUSA 2D2CB 3IN6A 1KQFB 3D6YA 1RJMA 5G1SA 4JWVA 1WMKA 2QJYC 3R9QA 3PZKA 2ZT9C 4JCRA 1NYHA 4NEKA 5KJPA 4JCTA 3KTKA 2HW5A 1FC7A 2E76C 1K05A 3AE6C 2VREA 1YQ3C 2JP3A 2C8TA 4K2NA 3K8XA 4ELXA 4K29A 2J5GA 3N6RB 4WZ8B 4I52A 4JJTA 2X24A 2FYNC 1VF5D 3T8AA 4H13D 5KDRB 3SWXA 2EJ5A 3PGQA 4FNBA 3I47A 1OW8A 4Q1IA 4GM2A 4Z0MA 1SG4A 5E0NX 2Q34A 5INGA 3Q0JA 1U57A 3FGAD 4RYFH 3ZW9A 2BEQD 4B3IA 1KTMA 4ZDFA 4R4MA 1EY3A 1AJYA 2CBYA 3AEGC 2NP9A 3O6QA 3QWDA 3GF3A 3KQFA 3AEAC 2VSUA 2PBPA 3BPTA 2CE3A 3KTHA 1XNWA 1FDIA 3FDUA 1XX4A 1SZOA 2QIWA 1EF8A 3R0OA 2QSIA 4OGQD 4QFEA 4ASIA 2PG8A 4YTPC 2ZL4A 4OGQB 3V5EA 5IKLB 1YG8A 3ZWAA 3B71A 3R6HA 1FC6A 1W2XA 3HE2A 1PV3A 3TLFA 2QQ3A 3G64A 3T89A 5JBWA 3ISAA 2D2CC 2FZSA 1R8EA 4L8KA 3TT7A 4ZDDA 5INFA 2X58A 1K04A 3BPPA 3QXZA 2Q35A 3QKAA 5DTPA 1K32A 3Q0GA 1JB0J 3ZWBA 3LKEA 3D6ZA 4U0HA 3QMJA 5HUQA 1Q90D 4H44B 4NARA 2H88C 1TYFA 3H0QA 4FN8A 3T3WA 3H0SA 3KTJA 5DU4A 2J5II 3VIVA 2NZ2A 1DUBA 4PV1B 2E74D 4HDTA 3U9RB 5E0SH 1UYSA 4K3WA 3EWKA 3G9RA 2E74B 4IL6X 1MKMA 1TU3F 5DU8A 2ZL0A 4IZDA 3S9OA 4H13C 2F6QA 5DUCA 1UYTA 2VSUF 1PL5A 1N6DA 3PE8A 2WPVB 5DU6A 2FBWC 2A81A 2YIUC 2ZQRA 4XFJA 3GF7A 3Q1MA 4QIIA 4U0GA 3RRVA 2J5IA 1FC9A 3C8VA 3HINA 3SFEC 4FN7A 2A7KA 1XNYA 3HP0A 4B3JA 1UYRA 4JYJA 1Y7OA 3RL0g 3BF0A 3AE1C 2WTBA 1YQ4C 1OD4A 3BEZA 3IAOA 3LW5J 3AEDC 2F9YB 3NJDA 1HNUA 3IBBA 1UYVA 3Q5SA 4QIJA 1N6FA 3TZ3A 5DZKA 4JSBA 4GDOA 3P2LA 3OMEA 4FZWA 1JXZA 5CTBA 3OT6A 4EMPA 4MOUA 4OGQC 1HF9A 4H0LB 4WCZA 3AEBC 3WG5A 4MXIA 3H81A 4ELSA 3TDCA 4FNDA 4EMLA 5KLIC 2J5GD 4GHNA 2DUBA 3PEAA 4IZCA 2F9IA 4OG1A 3M6MA 3ABVC 4F47A 1EF9A 3M6NA 4DI1A 3H0UA 4MI2A 2VSSE 2FW2A 4I4ZA 4LK5A 2P10A 4Q0GA 3U9TB 3AE8C 2E74C 4HNKA 3TVWA 1RQUA 1VL2A 3IAVA 5G1QA 3AEEC 4ZU2A 3JU1A 4FB8A 4L6WA 1XNVA 1DCIA 3H0JA 3V5IA 2UZFA 3SLLA 3AE4C 5M1BA 3T97B 3AECC 3Q1TA 3AE9C 5JBXA 2E75D 5CTCA 1ZOYC 3AE5C 2PPYA 2E75B 3U9SB 4KT0J 3ZWCA 2IEXA 4H44D 4KWBA 4U1AA 4U18A 2VX2A 5FIFA 1MJ3A 2GTRA 4PV1D 4B3HA 1WDKA 5L8RJ 1J7XA 4Z1MH 2G3AA 1EXIA 3STAA 2WSCJ 3R4YA 1N6EA 3AEFC 1TG6A 1NZYA 2BZRA 5G1RA 1HJ0A 3OC7A 2Q2XA 1DIPA 2DEOA 4H0LC 3Q5RA 2MKVA 1ZMEC 1XO6A 5DTWA 3R9SA 4EMMA 3L3SA 4JVTA 3H02A 1KILE 1ON3A 1PJHA 3Q5PA 1NGMB 4HC8A 1PIXA 1DD4A 4WYOB 1S1CX 2YMKA 1S5LX 3K50A 3AE7C 3Q3DA 3T8BA 1O8UA 2J5SA 3IB9A 3D70A 4JYLA 2YJGA 2FBMA 1DD3A 4KD6A 5KDRA 3H25A 4RYFA 1OMIA 1KMIZ 3KTGA 3FF6A 3TVUA 2VSSA 1RJNA 2J5IB 2ZQQA 3Q7HA 4KNPA 4JCSA 3GLMA 1KORA 4H0LD 1VRGA 4JCQA 1KQGB 1ON9A 3ST9A 4IZBA 3MT6A 4RKUJ 1UIXA 2BEZF 3DJAA 2OQQA 1EXJA 4U0GH 2VSUC 4I7ZB 3QREA 4JFCA 4G2RA 1VF5B 1HNOA 3QK8A 4H13B 4Y28J 3KTIA 2O01J 2E75C 2WSEJ 4ZDCA 3HRXA 5DL1A 2ZT9D 3MYBA 4J2UA 5KKZC 1Q52A 1IK7A 1UIYA 2ZT9B 4H44C 1GMJA 3NJBA 2E76D 1X0UA 5DZKH 3T88A 3AE2C 1Q51A 1YG6A 2E76B 4PV1C 4R4LA 3Q2YA 4ZDBA 4ZDEA 2ZL2A 2W3PA 2F9IB 2JO1A 5DUFA 3TRRA 5MGBA 4I42A 4RCNA 2K9YA 3AE3C 1FCFA 3SFDC 1ZP0C 4ELWA 3RSIA 5E0SA 3GKBA 3GMAA 3HLN1 1Y9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMR A;  2VSS F;  3P85 A;  1WDL A;  3MFM A;  4NNQ A;  4KPK A;  3QYR A;  3MOY A;  4JOT A;  1WZ8 A;  2VSU E;  4FJW D;  3RST A;  4YLH A;  2ZL3 A;  1HZD A;  1K39 A;  3TV5 A;  3R9T A;  2D3T A;  5C9G A;  3DOR A;  4U19 A;  5DKP A;  4OLQ A;  3P5M A;  2A7S A;  5INI A;  1WDM A;  2F6I A;  3QXI A;  3ZW8 A;  3TT6 A;  2F9Y A;  1OD2 A;  3LAO A;  1NZY B;  4FZW C;  5C90 A;  5FUS A;  1RJM A;  5G1S A;  4JWV A;  3R9Q A;  3PZK A;  4JCR A;  5KJP A;  4NEK A;  4JCT A;  3KTK A;  2HW5 A;  1FC7 A;  2VRE A;  2C8T A;  4K2N A;  3K8X A;  4ELX A;  4K29 A;  2J5G A;  3N6R B;  4WZ8 B;  4I52 A;  4JJT A;  2X24 A;  3T8A A;  5KDR B;  3SWX A;  2EJ5 A;  3PGQ A;  4FNB A;  3I47 A;  4Q1I A;  4GM2 A;  4Z0M A;  1SG4 A;  5E0N X;  2Q34 A;  5ING A;  3Q0J A;  4RYF H;  3ZW9 A;  4B3I A;  4ZDF A;  1EY3 A;  2CBY A;  2NP9 A;  3QWD A;  3GF3 A;  3KQF A;  2VSU A;  2PBP A;  2CE3 A;  3KTH A;  1XNW A;  3FDU A;  1XX4 A;  1SZO A;  1EF8 A;  3R0O A;  4ASI A;  4QFE A;  2PG8 A;  2ZL4 A;  3V5E A;  5IKL B;  1YG8 A;  3ZWA A;  3R6H A;  1FC6 A;  1W2X A;  3HE2 A;  3TLF A;  2QQ3 A;  3G64 A;  3T89 A;  5JBW A;  3ISA A;  2FZS A;  4L8K A;  3TT7 A;  4ZDD A;  5INF A;  2X58 A;  3BPP A;  3QXZ A;  2Q35 A;  3QKA A;  5DTP A;  1K32 A;  3Q0G A;  3ZWB A;  3LKE A;  4U0H A;  3QMJ A;  1TYF A;  3H0Q A;  4FN8 A;  3T3W A;  3H0S A;  3KTJ A;  5DU4 A;  2J5I I;  3VIV A;  1DUB A;  3U9R B;  5E0S H;  1UYS A;  4K3W A;  5DU8 A;  2ZL0 A;  4IZD A;  2F6Q A;  5DUC A;  1UYT A;  2VSU F;  1N6D A;  3PE8 A;  5DU6 A;  2A81 A;  2ZQR A;  3GF7 A;  4QII A;  4U0G A;  3RRV A;  2J5I A;  1FC9 A;  3HIN A;  4FN7 A;  2A7K A;  1XNY A;  3HP0 A;  4B3J A;  1UYR A;  4JYJ A;  1Y7O A;  3BF0 A;  2WTB A;  1OD4 A;  3BEZ A;  2F9Y B;  3NJD A;  1HNU A;  3IBB A;  1UYV A;  4QIJ A;  1N6F A;  3TZ3 A;  5DZK A;  4JSB A;  3P2L A;  3OME A;  4FZW A;  1JXZ A;  5CTB A;  3OT6 A;  4EMP A;  4MOU A;  4WCZ A;  3WG5 A;  4MXI A;  3H81 A;  4ELS A;  3TDC A;  4FND A;  4EML A;  2J5G D;  4GHN A;  2DUB A;  3PEA A;  4IZC A;  2F9I A;  4OG1 A;  3M6M A;  4F47 A;  1EF9 A;  3M6N A;  4DI1 A;  3H0U A;  4MI2 A;  2VSS E;  2FW2 A;  4I4Z A;  4LK5 A;  4Q0G A;  3U9T B;  4HNK A;  3TVW A;  3IAV A;  5G1Q A;  4ZU2 A;  3JU1 A;  4FB8 A;  4L6W A;  1XNV A;  1DCI A;  3H0J A;  3V5I A;  2UZF A;  3SLL A;  3Q1T A;  5JBX A;  5CTC A;  2PPY A;  3U9S B;  3ZWC A;  2IEX A;  4KWB A;  4U1A A;  4U18 A;  2VX2 A;  5FIF A;  1MJ3 A;  2GTR A;  4B3H A;  1WDK A;  1J7X A;  3STA A;  1N6E A;  1TG6 A;  1NZY A;  2BZR A;  5G1R A;  3OC7 A;  2Q2X A;  2DEO A;  1XO6 A;  3R9S A;  5DTW A;  4EMM A;  3L3S A;  4JVT A;  3H02 A;  1ON3 A;  1PJH A;  4HC8 A;  1PIX A;  4WYO B;  3K50 A;  3T8B A;  1O8U A;  2J5S A;  3IB9 A;  4JYL A;  2FBM A;  4KD6 A;  5KDR A;  4RYF A;  3KTG A;  3FF6 A;  3TVU A;  2VSS A;  1RJN A;  2J5I B;  2ZQQ A;  3Q7H A;  4KNP A;  4JCS A;  3GLM A;  1VRG A;  4JCQ A;  1ON9 A;  3ST9 A;  4IZB A;  3MT6 A;  3DJA A;  4U0G H;  2VSU C;  3QRE A;  4JFC A;  4G2R A;  1HNO A;  3QK8 A;  3KTI A;  4ZDC A;  3HRX A;  5DL1 A;  3MYB A;  1Q52 A;  1UIY A;  3NJB A;  1X0U A;  5DZK H;  3T88 A;  1Q51 A;  1YG6 A;  4ZDB A;  4ZDE A;  2ZL2 A;  2W3P A;  2F9I B;  5DUF A;  3TRR A;  5MGB A;  4I42 A;  4RCN A;  1FCF A;  4ELW A;  3RSI A;  5E0S A;  3GKB A;  3GMA A;  3HLN 1; 
#chains in the Genus database with same CATH topology
 2L91 A;  4OMR A;  3CWB J;  4TT3 H;  3MFM A;  2IYP A;  4NNQ A;  3CC7 P;  1NTK D;  3QYR A;  3D71 A;  1HH0 A;  1AV1 A;  4JOT A;  1FDO A;  3H32 B;  3EQ2 A;  1K39 A;  2QJP C;  3II6 A;  3TV5 A;  3MD0 A;  1NAY A;  3RL0 C;  3R9T A;  5C9G A;  1M1J A;  1M1K Q;  2IBZ I;  1L0N G;  5DKP A;  4JQ0 D;  1NU1 G;  1P84 H;  3CCL P;  3A0B E;  4YXD C;  1HWT C;  2A7S A;  2F6I A;  2WWW A;  5CCH A;  2W8Z A;  1NH4 A;  2WIT A;  3EFF K;  3C9I A;  3MZW B;  5GTH H;  2FYU K;  2WPR A;  4XA4 A;  1OD2 A;  5FUS A;  1KQF B;  3F5H A;  3D6Y A;  3R9Q A;  1T2K C;  4JCR A;  4NEK A;  3NFQ A;  4JCT A;  1FC7 A;  3V2R A;  1JOC A;  3VTP C;  1XTC C;  2ZVO B;  1YHQ P;  2WT7 B;  4K2N A;  1LNQ A;  1PPJ E;  2Q3E A;  3TK1 A;  1JNM A;  5B66 E;  1SQX E;  4WZ8 B;  1N8R Q;  1S2E A;  4IFD K;  2N1T C;  1GZL A;  3CWB E;  3L75 J;  3PGQ A;  3PRJ A;  1HGV A;  1SG4 A;  3TDK A;  1T2K D;  3A2A A;  2M5A A;  3GHG A;  1U57 A;  4RYF H;  1OVR A;  1YIJ P;  1BGY E;  4ZDF A;  2QRX A;  1AJY A;  3AEG C;  3H1L D;  3CXH E;  5CMZ A;  3QWD A;  3GF3 A;  3V4Q A;  3BPT A;  1SQQ D;  2WSS H;  2CE3 A;  5KLV G;  2XV5 A;  1GL2 C;  3H1I G;  4BWN A;  4I6M C;  2W6A A;  1S5L H;  4NPD A;  2HPC A;  1N7S A;  2PAJ A;  4K3A A;  4ASI A;  2QSI A;  4OGQ D;  4QFE A;  1LTS C;  4OGQ B;  1MV8 A;  1H0T B;  3V5E A;  2GA1 A;  5IKL B;  1YG8 A;  3ZWA A;  3B71 A;  4AYC A;  3HE2 A;  1PV3 A;  3TLF A;  1SQX K;  1YIT P;  2FZS A;  4L8K A;  1SQB J;  4ZDD A;  3VMZ A;  1FDM A;  3A5T A;  5AVV B;  3QXZ A;  4EIJ A;  3V5B A;  4B86 A;  3Q0G A;  1K9M Q;  3LKE A;  2XNX A;  2PP6 A;  1LP1 B;  1U7J A;  1YJN P;  5HUQ A;  1Q90 D;  3N7N A;  3H0Q A;  3KTJ A;  3HE5 B;  4PV1 B;  2LR2 A;  1GU5 A;  4K3W A;  2L5G B;  3L75 E;  1LT9 B;  4WVZ A;  3L35 A;  1SFC D;  4IZD A;  1PGP A;  4HJG H;  1SFC B;  4H13 C;  4Y99 C;  1NTK G;  4EDF A;  1ZLL A;  1OZH A;  2A81 A;  3Q1M A;  3RRV A;  3BCC D;  3C8V A;  3HUS B;  1KQL A;  3HIN A;  3SWY A;  1ZN5 A;  3HP0 A;  4AUW A;  1KV4 A;  1JCD A;  1G1I A;  2B87 B;  3BF0 A;  2NPS D;  1VQN P;  2WTB A;  1PGQ A;  2W90 A;  3CLQ A;  4WY4 C;  3IAO A;  2Z4E A;  1AFO A;  1GD2 E;  2RH0 A;  4QIJ A;  5DZK A;  4JSB A;  4GDO A;  3OME A;  4EMP A;  4MOU A;  3CCM P;  1NTM J;  4N3Y B;  2M3E A;  3H81 A;  4ELS A;  1M90 Q;  1JEK A;  1SQB E;  1JCC A;  2V7Q H;  2KZJ A;  2Y0C A;  3M6M A;  1QGK B;  5CJ4 A;  2HG5 D;  1BDD A;  1PP9 J;  4W7Z A;  3H6P A;  5K5G B;  1FU1 A;  4Q0G A;  2WMM A;  2R3S A;  3AE8 C;  3GG2 A;  2ZFC A;  3TGU E;  2A06 D;  1SQP D;  2I8D A;  3WMM 0;  5GTI H;  2QVA A;  1OVU A;  5TIS H;  4L6W A;  1RE3 C;  2K88 A;  1DCI A;  3QH9 A;  5AVZ B;  1L0L J;  1BDC A;  3AE4 C;  3T97 B;  5KJ7 D;  2N9B A;  3Q1T A;  3AE9 C;  2E75 D;  2FFD C;  1Y8A A;  1GL2 A;  3QWO C;  5CTC A;  2E75 B;  3U9S B;  2QA4 P;  1BE3 D;  1SQQ G;  1NKN A;  4H44 D;  4KHX A;  3RK3 D;  5KKZ B;  1SQB K;  1SS1 A;  3RK3 B;  2VX2 A;  5APY A;  3PTZ A;  5AW5 B;  1WDK A;  4Z1M H;  2H7H A;  5BU8 B;  1P84 E;  5AVU B;  1JY3 P;  5G1R A;  1HJ0 A;  3OC7 A;  3A0B H;  2OGU A;  1KB9 E;  1NTM E;  5AVQ B;  1M8O B;  1LWU B;  3Q5R A;  5DTW A;  2OYI C;  2W6B A;  1DEB A;  4JYC A;  4JVT A;  5GTH E;  1YJW P;  3VN0 A;  3EFG A;  1T6A A;  2YMK A;  4YXW H;  2FYZ A;  3K50 A;  2XZR A;  2NPS A;  3Q3D A;  4PD4 E;  3VOP A;  4RJT A;  2MJZ A;  1AVY A;  1O8U A;  1PP9 E;  3D70 A;  1IZN B;  1EQ7 A;  2KYV A;  1KYO E;  2P2U A;  1OMI A;  3F89 A;  2VSS A;  1RJN A;  2J5I B;  2CPB A;  3SSU A;  5B66 H;  3ST9 A;  4IZB A;  3MT6 A;  3S4R A;  4RKU J;  2BEZ F;  2ZXE B;  2OQQ A;  4U0G H;  1L0L E;  3PH0 A;  3W67 A;  3QRE A;  4JFC A;  1BSH A;  3L71 J;  1VF5 B;  1NTZ J;  2HR3 A;  1HNO A;  2QM7 A;  4WY4 A;  1NTM K;  2YO2 A;  2WZ7 A;  3HRX A;  1EDL A;  2YIU B;  1SQX G;  3RBX A;  1GMJ A;  1EZV E;  2E76 D;  3AE2 C;  2E76 B;  3CWB G;  4ZDB A;  4ZDE A;  2Q5U A;  2F9I B;  1IFI A;  1L0N D;  4JYB A;  1M56 D;  3TRR A;  1NU1 D;  3WUU A;  3AE3 C;  1FCF A;  5KJ7 A;  1YTZ T;  3VYI A;  3GMA A;  2E5Y A;  3VMY A;  3P85 A;  2V7Q J;  1WDL A;  4W80 A;  2Z5H A;  2KS1 A;  2R5D A;  1L0L K;  2OYO A;  1USE A;  4FJW D;  1ZRT E;  2Y0E A;  1RQV A;  2QJK C;  4XE5 B;  4D6T J;  3HE4 B;  5B5E E;  1G2C A;  3H1H J;  2D3T A;  1RE3 A;  3DOR A;  3G6E P;  2O1K A;  2FFD A;  3P5M A;  1WDM A;  3A3Y B;  1URQ B;  3HTK A;  1CZQ A;  3OAK A;  1JY2 P;  3L71 E;  3L4F A;  3TT6 A;  4U3F J;  1BE3 G;  2XKM A;  2G8Y A;  2IDB A;  1GW3 A;  2RKL A;  2OTJ P;  4EYY Q;  3PLN A;  3I56 P;  5G1S A;  2LKM A;  4JWV A;  1WMK A;  3P8M C;  2QJY C;  4WWI A;  3V6I A;  2ZT9 C;  5KJP A;  3KHU A;  4HB1 A;  1Y47 A;  5AVX B;  4C7N B;  1JMB A;  1K05 A;  2OYI A;  1S4X A;  1QVG O;  2C8T A;  3CX5 D;  1JUN A;  1U7M A;  3UIA A;  3H1I D;  2J5G A;  3MTU E;  1W2B O;  4I52 A;  4JJT A;  5APS A;  2IFM A;  1N73 C;  3M91 A;  5KDR B;  4O9B A;  3CL3 D;  4LGD E;  1WRG A;  3SWX A;  4FNB A;  1CSB A;  2ZAE B;  4Q1I A;  4L73 A;  4ZKP A;  5ING A;  2Q3I A;  4D6T E;  4B3I A;  1NTZ K;  1KTM A;  1EY3 A;  1NKZ B;  4IL6 E;  2QM8 A;  3H1H E;  1Q2N A;  2LXB A;  2PBP A;  3KDP B;  1SQB G;  3KTH A;  2P1J A;  2HOD B;  3FDU A;  1XX4 A;  2QIW A;  3R0O A;  4TLF A;  2PG8 A;  4U3F E;  4YTP C;  2ZL4 A;  3JCU E;  5H2F H;  3H1K D;  1W2X A;  1CI6 A;  2RN0 A;  2QQ3 A;  2YKP A;  1W5C E;  2QG4 A;  1L4A D;  5APW A;  3U1A A;  3H1J J;  1K04 A;  1L4A B;  2Q35 A;  1BGY J;  1LJ2 A;  3D6Z A;  4YPC A;  2ZXX A;  4A7P A;  1YYC A;  2A45 H;  2P67 A;  2IPP A;  2WTY A;  1KIL D;  3CCE P;  3H0S A;  1KIL B;  2J5I I;  5AW7 B;  2BCC J;  3U9R B;  3G9R A;  4IL6 X;  1KB9 H;  1E5W A;  1MKM A;  3ZDM A;  1TU3 F;  3MP7 B;  4M3L A;  2C0X A;  2ZL0 A;  3S9O A;  5DUC A;  4PJ0 E;  4AQR D;  1X22 A;  1DH3 A;  2FBW C;  3U1C A;  3GF7 A;  4L74 A;  3CCS P;  1AVO A;  5CBO A;  2PGD A;  4PD4 H;  2WSE H;  3BAS A;  2Y9Y A;  1NOH A;  2I1K A;  4BRY A;  3WUT A;  2A7K A;  1SQV J;  2KK7 A;  4B3J A;  1UYR A;  1NTM G;  1KYO H;  1Y7O A;  3RL0 g;  3CCV P;  2N9Y B;  1OD4 A;  3BEZ A;  2Q9I A;  2E5T A;  4L76 A;  1CW5 A;  2F9Y B;  1GW4 A;  1OX3 A;  2OTK E;  1JXZ A;  5CTB A;  1M7L A;  5TJH A;  2AEF A;  4OGQ C;  3L72 J;  1R5S A;  2P58 A;  4EML A;  3H1J E;  1JM0 A;  4GHN A;  4OG1 A;  3WU2 E;  3L74 J;  1J1E B;  3M6N A;  2R32 A;  3H0U A;  4MI2 A;  2VSS E;  2C9N Y;  2FYU D;  1N73 A;  1IJD B;  1SLQ A;  4I4Z A;  1L0L G;  1H8A A;  2BCC E;  3S1K A;  2WSF H;  1N86 A;  3FWN A;  1FS0 E;  1LT9 C;  3N4X A;  3H32 A;  3TVW A;  1RQU A;  3IAV A;  1SFC C;  1N7L A;  3O6Q B;  2KLV A;  2YKO A;  3JU1 A;  1VQM P;  2ZYA A;  3M06 A;  3H0J A;  2N1T B;  4OH8 B;  3HUS C;  3OA7 A;  1SQV E;  2RMZ A;  2K3R A;  4U1A A;  4U18 A;  5FIF A;  1MJ3 A;  2NPS C;  4PV1 D;  5B5E H;  3M0D A;  1RF1 B;  1W2E A;  1J7X A;  2G3A A;  2Z5I A;  3E1I A;  3P8C D;  3CX5 I;  3CCJ P;  3TGU J;  2B88 A;  2BZR A;  1NVO A;  3L72 E;  3H1K G;  2Q2X A;  1DIP A;  2DEO A;  4GOF A;  2WPQ A;  2MKV A;  3RBZ A;  3H02 A;  1BCC J;  3Q5P A;  1NGM B;  1R5L A;  4RO0 A;  3L74 E;  1PIX A;  2WT7 A;  1OXZ A;  3E7K A;  1FZC B;  3T8B A;  3KZI E;  1L2P A;  3SWF A;  2QE7 H;  2JR8 A;  4JYL A;  3B5N D;  1SQX D;  1S3J A;  4KD6 A;  1ZXG A;  3B5N B;  3H25 A;  1LTJ B;  3L71 G;  3RK2 D;  1NTZ G;  1SQV K;  3CWB D;  3RK2 B;  3FF6 A;  3CI9 A;  3Q7H A;  4KNP A;  1KOR A;  1VRG A;  1ON9 A;  1T3J A;  2ZYD A;  1AQ5 A;  1UIX A;  2HLO A;  4C46 A;  1EXJ A;  3BAT A;  2IBZ E;  1S9K E;  2VSU C;  1BGY D;  1FBM A;  2AEJ A;  4I7Z B;  3VP9 A;  2GUS A;  1UII A;  2ITA A;  3CXH D;  4WB4 A;  3CPW O;  1E79 H;  5AVT B;  4H13 B;  4Y99 B;  5KJ7 C;  4Y28 J;  1IO4 A;  2E75 C;  2OYH B;  2WSE J;  1NJI Q;  1NAF A;  3M9H A;  4IL6 H;  5KKZ C;  1IK7 A;  1Q52 A;  4H44 C;  3RK3 C;  1NWQ A;  5DZK H;  3L73 J;  3T88 A;  1Q51 A;  1H0T A;  1YG6 A;  4R4L A;  3Q2Y A;  1HVV A;  2ZL2 A;  1ZR2 A;  2W3P A;  1HBW A;  2JKV A;  4BXL A;  4HYT B;  1BCC E;  1LWU C;  5H2F E;  4D6T G;  1MZ9 A;  2K9Y A;  2GM4 A;  4ELW A;  3JCU H;  1IFM A;  5E0S A;  3GKB A;  3H1H G;  1LP1 A;  4N78 E;  2VSS F;  2AXC A;  2YO3 A;  1RY3 A;  2JEE A;  2H43 A;  2FYU G;  1J2J B;  2FXP A;  3MOY A;  3HE5 A;  1FZA A;  5EFW B;  1WZ8 A;  3RST A;  1KN7 A;  4YLH A;  5KLV J;  1LT9 A;  3L75 D;  2XDJ A;  1M57 D;  1SFC A;  4U3F G;  1OW7 A;  3LW5 H;  2WSF J;  1IFD A;  2H89 C;  4U19 A;  2P7J A;  3HUS A;  3VMX A;  4OLQ A;  3HD7 B;  5INI A;  3GW6 A;  1QL1 A;  3TNU B;  2B87 A;  2C0W A;  1EDK A;  4PJ0 H;  3L70 J;  5AW1 B;  1VF5 C;  1BSN A;  1JTH B;  2D2C D;  3LAO A;  1NZY B;  2D2C B;  3IN6 A;  1FJK A;  5APU A;  2FY8 A;  3L73 E;  1VDF A;  3PZK A;  1NYH A;  3U59 A;  3KTK A;  2E76 C;  4EOT A;  3AE6 C;  2SPZ A;  2JP3 A;  2POH A;  1T3U A;  1VQ6 P;  3K8X A;  1FZF A;  4ELX A;  4K29 A;  1SQB D;  3SWK A;  2DW3 A;  3TSI A;  1G1J A;  1NTK J;  2M8R A;  4UB6 E;  2FYN C;  1GU4 A;  1VF5 D;  3PJS K;  2LXC B;  3I47 A;  1OW8 A;  1PPJ G;  3FXD A;  4GM2 A;  2IZ1 A;  2Q34 A;  5KLV E;  3WU2 H;  3H1I E;  3FGA D;  1JY3 O;  3ZW9 A;  5AW3 B;  4GT1 A;  1VQK P;  2K9J B;  1MFT A;  1QX8 A;  3B8E B;  5AVY B;  3CCQ P;  2W27 A;  3AEA C;  5APQ A;  2VSU A;  2WSC H;  4IFM A;  3H1J G;  1JMM A;  2KIK A;  3T97 A;  1BGY G;  1RF0 C;  3L70 E;  1X79 B;  1J1D C;  2E43 A;  1EC5 A;  3MGN A;  1FC6 A;  3IR9 A;  3G64 A;  2KZI A;  3T89 A;  5KLI B;  5JBW A;  3ISA A;  1R8E A;  3V2N A;  3NTN A;  1P84 D;  2X58 A;  5APT A;  4UB8 E;  5CCG C;  3QKA A;  5DTP A;  1K32 A;  1JB0 J;  1LWU A;  1NO4 A;  1KB9 D;  1NTM D;  1S72 P;  4U0H A;  5AVW B;  5KLV K;  1ZR4 A;  2H88 C;  1NTK E;  1TYF A;  1URQ D;  2I1J A;  5DU4 A;  4LC1 A;  3VIV A;  1CI6 B;  1DUB A;  2E74 D;  4HDT A;  1UYS A;  2E74 B;  2FXM A;  1FE6 A;  4PD4 D;  3KPE A;  1PP9 D;  2W83 C;  2F6Q A;  2K37 A;  3H1L J;  2IFN A;  1K8A Q;  1PL5 A;  1N6D A;  3M9Q A;  1M1J B;  1SQQ J;  3PE8 A;  2R44 A;  4XFJ A;  1FZE A;  5CBN A;  1GK6 A;  5CCG D;  3CXH I;  2J5I A;  2W6J H;  3A0H E;  3L75 G;  5AW0 B;  5CCH D;  3KZI H;  4FN7 A;  1IFN A;  3LIE A;  3WUV A;  3L72 G;  4JYJ A;  1YBK A;  3AE1 C;  2J58 A;  1L0L D;  2ZYG A;  3LW5 J;  4ZKU A;  3IBB A;  1UYV A;  1AQT A;  1N6F A;  1MFZ A;  3TZ3 A;  3FWL A;  5APX A;  3P2L A;  3OW2 O;  2KOG A;  2KSE A;  2XU6 A;  2CPS A;  2JWA A;  4H0L B;  3VMA A;  1LT1 A;  1NTK K;  3WG5 A;  4DZO A;  5DJT B;  4MXI A;  1Z56 A;  5CJ0 A;  2JWD A;  3BRT B;  1Q86 Q;  1LTT C;  4JPZ B;  1YJ9 P;  1H88 A;  3VP8 A;  2F9I A;  4IZC A;  3L37 A;  1L4A C;  3ABV C;  1SVF A;  4DI1 A;  2IBZ G;  1JY2 O;  2HYN A;  5E79 H;  3G71 P;  2OTL P;  3ITK A;  1KIL C;  2VRS A;  2M5A B;  3GHG B;  3BCC J;  2AEM A;  3M0D C;  2B89 A;  4HNK A;  3H1L E;  3NXS A;  1PGJ A;  5G1Q A;  1SQQ E;  3AEE C;  1GK4 A;  3HE4 A;  1QVF O;  1LTB C;  1XNV A;  3SLL A;  1DEE G;  1LTA C;  3AEC C;  3TGU G;  4L75 A;  5JBX A;  5BU5 A;  1N7S D;  3P32 A;  2HPC B;  1N7S B;  4HH2 A;  3ZWC A;  2IEX A;  1RF0 A;  2XND H;  1BCC G;  1URQ A;  4KWB A;  2H8P D;  5AW9 B;  2GTR A;  1D7M A;  5L8R J;  3L71 D;  1NTZ D;  2WVR A;  3PP5 A;  3JC2 2;  4GIF A;  4HKZ H;  4MN4 C;  2WSC J;  4GKG A;  1N6E A;  3STA A;  2KNC A;  2PFX A;  2Y0D A;  1EDJ A;  1FOS E;  1XO6 A;  1ZME C;  3R9S A;  4EMM A;  5CCG A;  4OVN F;  2A45 G;  1ON3 A;  4C7N A;  3OJA B;  4I2L C;  1SP4 A;  3RGU A;  3P8C E;  1J1E C;  3AE7 C;  1VQ7 P;  1SQQ K;  3R2P A;  1SQP J;  1DD3 A;  3E1R A;  1KFN A;  5KDR A;  1YTZ I;  4RYF A;  2QJP B;  3B4S A;  1KMI Z;  3P7K A;  3RL0 D;  3BCC E;  3TVU A;  4EI2 A;  3RL0 B;  1KC8 Q;  2AXT H;  2ZQQ A;  4JCS A;  1GDT A;  2O1J A;  1PP9 G;  4NPF X;  1PGO A;  1KQS O;  1BE3 J;  1HTL C;  4UB6 H;  3A7O A;  3DJA A;  3L73 G;  4D6T D;  2R5B A;  3KYQ A;  1JY3 N;  3PHL A;  3H1H D;  1IK9 A;  1Q82 Q;  2V4H A;  3CX5 H;  1QL2 A;  3KTI A;  2O01 J;  2A45 I;  2HOD A;  3MYB A;  1P84 I;  2OAR A;  3NJB A;  4DJG A;  1X0U A;  1PZQ A;  1RF1 C;  2FKW B;  3FX0 A;  4PV1 C;  1KB9 I;  4U3F D;  2Y9Z A;  1VPC A;  2YMY A;  1KZU B;  2R3C A;  3KXD A;  4ASV A;  2JO1 A;  1KFM A;  2KLU A;  1L4A A;  2YKQ A;  3HRN A;  1EZV G;  2N1T D;  3SFD C;  1MUU A;  1RHZ B;  1QLE D;  3RSI A;  4PD4 I;  1FZG A;  5KAF E;  3HLN 1;  1Y9B A;  3M0A A;  1ZV8 A;  2A06 E;  1KYO I;  1SQP E;  1FZC C;  1KIL A;  4KPK A;  3USS A;  4UB8 H;  2VSU E;  3BRV B;  3CC2 P;  2ZL3 A;  3IF4 A;  1HZD A;  1FJP A;  3L70 G;  2J5U A;  3B5N C;  1LTJ C;  1RE4 C;  4ZMD A;  3RK2 C;  4GOD A;  1GL2 D;  5KAI E;  3TYY A;  1BE3 E;  2KP8 A;  1GL2 B;  3RK3 E;  3KQG A;  3CMA P;  1OIP A;  2IZ0 A;  2NRG A;  4U7J A;  3QXI A;  3ZW8 A;  1OW6 A;  4I7Z C;  2ZVN B;  1ZW0 A;  2WQY C;  4C7R A;  2KXP B;  1PPJ D;  1XTG B;  5KTB A;  2F9Y A;  1EZV I;  2J59 M;  4FZW C;  5C90 A;  2OYH C;  3A0H H;  1RJM A;  1L0N J;  5AW8 B;  1NU1 J;  4RES B;  1LGH B;  2HW5 A;  1SQP K;  2ZJS E;  2VRE A;  1YQ3 C;  1FOS F;  3K5B A;  1YI2 P;  2NPS B;  3H1J D;  3N6R B;  4WBA A;  2X24 A;  1PFI A;  3T8A A;  4H13 D;  1DX7 A;  2EJ5 A;  1OWA A;  5APV A;  1KD1 Q;  5AW2 B;  4Z0M A;  5E0N X;  2BCC D;  3Q0J A;  1JY2 N;  2BEQ D;  2M3B A;  4R4M A;  5E79 E;  3BVH A;  5DJU B;  4ASW A;  2CBY A;  4GOE A;  2NP9 A;  3O6Q A;  3CCU P;  3KQF A;  2FXO A;  4WY4 D;  4WY4 B;  2N1T A;  3V4W A;  1XNW A;  2UWJ E;  1FDI A;  3HD7 C;  1SQV D;  1SZO A;  1EF8 A;  1A02 J;  3R6H A;  1RF1 A;  1L0N E;  1IFJ A;  4QMA A;  3JSV C;  2D2C C;  1NU1 E;  3CME P;  3TT7 A;  5INF A;  3H1I J;  3BPP A;  4K35 A;  3I55 P;  3L72 D;  3H1L G;  3ZWB A;  3L36 A;  2Q7C A;  2BAS A;  2JDI H;  3QMJ A;  2YXQ B;  4H44 B;  3HD7 D;  4NAR A;  2KS1 B;  2C9L Y;  4FN8 A;  3T3W A;  3MUD C;  1X9V A;  1X8Y A;  3L74 D;  2NZ2 A;  1FZC A;  5E0S H;  3EWK A;  1HJB A;  1JO5 A;  2IYO A;  1VQP P;  5DU8 A;  2KUB A;  3C1L A;  5C39 A;  1G2C B;  3B5N A;  1UYT A;  2VSU F;  1LTJ A;  2Q6Q A;  2WPV B;  5DU6 A;  1RE4 A;  1EDI A;  2YIU C;  2ZQR A;  4QII A;  4U0G A;  3CCR P;  4KJM A;  1FC9 A;  2FFD B;  3SFE C;  1AA0 A;  3HTK B;  1XNY A;  3V2P A;  1L0N K;  2E42 A;  3W68 A;  2AXT E;  1YQ4 C;  1NU1 K;  2IBZ D;  1S9K D;  3H1K J;  3AED C;  3NJD A;  1HNU A;  4LLH A;  3Q5S A;  2O3J A;  1OFC X;  2M0B A;  4FZW A;  2OYH A;  3OT6 A;  4IFF A;  1HF9 A;  3CD6 P;  3G4S P;  4WCZ A;  3AEB C;  2OYI B;  3CX5 E;  3TDC A;  4FND A;  1LTI C;  5KLI C;  2J5G D;  2DUB A;  5AVS B;  3BCC G;  3PEA A;  4W7Y A;  3MIW A;  3TGU D;  3M9B A;  1HUC A;  2K1A A;  3NMD A;  1QEX A;  4F47 A;  1EF9 A;  4I1L A;  2YXR B;  2FW2 A;  1BCC D;  2KSJ A;  1Q81 Q;  1RH5 B;  1VQ5 P;  4LK5 A;  2KB7 P;  2IX7 C;  2P10 A;  3CXH H;  3U9T B;  1URQ C;  4N78 D;  2JJL A;  4DCK A;  1LTG C;  2E74 C;  1S5L E;  2HFE D;  5AW4 B;  1NHL A;  1H89 A;  1VL2 A;  4ZU2 A;  2BCC G;  5AVR B;  5KAF H;  4FB8 A;  1M1J C;  2FYN B;  3V5I A;  2UZF A;  5M1B A;  1FAV A;  4ZNC A;  1ZOY C;  3AE5 C;  2PPY A;  5CCH C;  4KT0 J;  1VQ4 P;  3HD7 A;  3H1K E;  3TNU A;  2KI7 B;  4B3H A;  1T8Z A;  3IFM A;  1EXI A;  1JTH A;  1SQV G;  5KAI H;  3R4Y A;  1VQ8 P;  3AEF C;  1GTW A;  1TG6 A;  2A06 G;  1NZY A;  1SQP G;  2B9B A;  1KYO D;  4H0L C;  2Q1K A;  3L73 D;  2FYU J;  3L3S A;  1KIL E;  1PJH A;  2PRR A;  1VQL P;  5CHX A;  2O01 H;  4HC8 A;  3G3Z A;  1J1D B;  1NTZ E;  3CC4 P;  1DD4 A;  2YNY A;  4WYO B;  1S1C X;  2QEX P;  1S5L X;  1WT6 A;  3MUD A;  2WPS A;  2J5S A;  3IB9 A;  2KNC B;  1VQO P;  2QJK B;  2YJG A;  3MHV A;  2FBM A;  4DT0 A;  3L74 G;  1K73 Q;  4CPG A;  4OWF A;  3KTG A;  2GUV A;  3GHG C;  4JBZ A;  3GLM A;  4H0L D;  4BRY B;  4JCQ A;  1KQG B;  1IFP A;  5KLV D;  2K9J A;  3O8Z A;  4IOI H;  1EZV D;  1IC2 A;  1VQ9 P;  1FC2 C;  1OVV A;  3FXE A;  1USD A;  1X0T A;  4G2R A;  2O01 N;  3TF5 A;  4NPE A;  3QK8 A;  1FZB A;  1N7S C;  4ZDC A;  5DL1 A;  2ZT9 D;  4J2U A;  3LID A;  1HGZ A;  2QJY B;  1UIY A;  2ZT9 B;  4JF7 A;  3L70 D;  4N6J A;  3I5C A;  3V2Q A;  1N2D C;  1A02 F;  5AW6 B;  5DUF A;  1ZRT D;  2FYU E;  5GTI E;  4DOJ A;  5MGB A;  4I42 A;  4RCN A;  1Q7Y Q;  1N73 B;  1SQX J;  1ZP0 C;  5TIS E;  2CK3 H;  5BVZ A; 
#chains in the Genus database with same CATH homology
 4OMR A;  2VSS F;  3P85 A;  2V7Q J;  1WDL A;  4TT3 H;  3MFM A;  4NNQ A;  4KPK A;  3QYR A;  2FXP A;  3MOY A;  3D71 A;  4JOT A;  1FDO A;  1WZ8 A;  2VSU E;  4FJW D;  3RST A;  1ZRT E;  4YLH A;  2ZL3 A;  1RQV A;  2QJK C;  1HZD A;  1K39 A;  2J5U A;  2QJP C;  3TV5 A;  1OW7 A;  3R9T A;  2D3T A;  5C9G A;  2WSF J;  3DOR A;  2H89 C;  4U19 A;  5DKP A;  3RK3 E;  4OLQ A;  4YXD C;  3P5M A;  2A7S A;  5INI A;  1WDM A;  2F6I A;  4U7J A;  3QXI A;  3ZW8 A;  1OW6 A;  4I7Z C;  3TT6 A;  1VF5 C;  2WQY C;  2G8Y A;  2F9Y A;  1OD2 A;  2IDB A;  2D2C D;  3LAO A;  1NZY B;  4FZW C;  5C90 A;  5FUS A;  2D2C B;  3IN6 A;  1KQF B;  3D6Y A;  1RJM A;  5G1S A;  4JWV A;  1WMK A;  2QJY C;  3R9Q A;  3PZK A;  2ZT9 C;  4JCR A;  1NYH A;  4NEK A;  5KJP A;  4JCT A;  3KTK A;  2HW5 A;  1FC7 A;  2E76 C;  1K05 A;  3AE6 C;  2VRE A;  1YQ3 C;  2JP3 A;  2C8T A;  4K2N A;  3K8X A;  4ELX A;  4K29 A;  2J5G A;  3N6R B;  4WZ8 B;  4I52 A;  4JJT A;  2X24 A;  2FYN C;  1VF5 D;  3T8A A;  4H13 D;  5KDR B;  3SWX A;  2EJ5 A;  3PGQ A;  4FNB A;  3I47 A;  1OW8 A;  4Q1I A;  4GM2 A;  4Z0M A;  1SG4 A;  5E0N X;  2Q34 A;  5ING A;  3Q0J A;  1U57 A;  3FGA D;  4RYF H;  3ZW9 A;  2BEQ D;  4B3I A;  1KTM A;  4ZDF A;  4R4M A;  1EY3 A;  1AJY A;  2CBY A;  3AEG C;  2NP9 A;  3O6Q A;  3QWD A;  3GF3 A;  3KQF A;  3AEA C;  2VSU A;  2PBP A;  3BPT A;  2CE3 A;  3KTH A;  1XNW A;  1FDI A;  3FDU A;  1XX4 A;  1SZO A;  2QIW A;  1EF8 A;  3R0O A;  2QSI A;  4OGQ D;  4QFE A;  4ASI A;  2PG8 A;  4YTP C;  2ZL4 A;  4OGQ B;  3V5E A;  5IKL B;  1YG8 A;  3ZWA A;  3B71 A;  3R6H A;  1FC6 A;  1W2X A;  3HE2 A;  1PV3 A;  3TLF A;  2QQ3 A;  3G64 A;  3T89 A;  5JBW A;  3ISA A;  2D2C C;  2FZS A;  1R8E A;  4L8K A;  3TT7 A;  4ZDD A;  5INF A;  2X58 A;  1K04 A;  3BPP A;  3QXZ A;  2Q35 A;  3QKA A;  5DTP A;  1K32 A;  3Q0G A;  1JB0 J;  3ZWB A;  3LKE A;  3D6Z A;  4U0H A;  3QMJ A;  5HUQ A;  1Q90 D;  4H44 B;  4NAR A;  2H88 C;  1TYF A;  3H0Q A;  4FN8 A;  3T3W A;  3H0S A;  3KTJ A;  5DU4 A;  2J5I I;  3VIV A;  2NZ2 A;  1DUB A;  4PV1 B;  2E74 D;  4HDT A;  3U9R B;  5E0S H;  1UYS A;  4K3W A;  3EWK A;  3G9R A;  2E74 B;  4IL6 X;  1MKM A;  1TU3 F;  5DU8 A;  2ZL0 A;  4IZD A;  3S9O A;  4H13 C;  2F6Q A;  5DUC A;  1UYT A;  2VSU F;  1PL5 A;  1N6D A;  3PE8 A;  2WPV B;  5DU6 A;  2FBW C;  2A81 A;  2YIU C;  2ZQR A;  4XFJ A;  3GF7 A;  3Q1M A;  4QII A;  4U0G A;  3RRV A;  2J5I A;  1FC9 A;  3C8V A;  3HIN A;  3SFE C;  4FN7 A;  2A7K A;  1XNY A;  3HP0 A;  4B3J A;  1UYR A;  4JYJ A;  1Y7O A;  3RL0 g;  3BF0 A;  3AE1 C;  2WTB A;  1YQ4 C;  1OD4 A;  3BEZ A;  3IAO A;  3LW5 J;  3AED C;  2F9Y B;  3NJD A;  1HNU A;  3IBB A;  1UYV A;  3Q5S A;  4QIJ A;  1N6F A;  3TZ3 A;  5DZK A;  4JSB A;  4GDO A;  3P2L A;  3OME A;  4FZW A;  1JXZ A;  5CTB A;  3OT6 A;  4EMP A;  4MOU A;  4OGQ C;  1HF9 A;  4H0L B;  4WCZ A;  3AEB C;  3WG5 A;  4MXI A;  3H81 A;  4ELS A;  3TDC A;  4FND A;  4EML A;  5KLI C;  2J5G D;  4GHN A;  2DUB A;  3PEA A;  4IZC A;  2F9I A;  4OG1 A;  3M6M A;  3ABV C;  4F47 A;  1EF9 A;  3M6N A;  4DI1 A;  3H0U A;  4MI2 A;  2VSS E;  2FW2 A;  4I4Z A;  4LK5 A;  2P10 A;  4Q0G A;  3U9T B;  3AE8 C;  2E74 C;  4HNK A;  3TVW A;  1RQU A;  1VL2 A;  3IAV A;  5G1Q A;  3AEE C;  4ZU2 A;  3JU1 A;  4FB8 A;  4L6W A;  1XNV A;  1DCI A;  3H0J A;  3V5I A;  2UZF A;  3SLL A;  3AE4 C;  5M1B A;  3T97 B;  3AEC C;  3Q1T A;  3AE9 C;  5JBX A;  2E75 D;  5CTC A;  1ZOY C;  3AE5 C;  2PPY A;  2E75 B;  3U9S B;  4KT0 J;  3ZWC A;  2IEX A;  4H44 D;  4KWB A;  4U1A A;  4U18 A;  2VX2 A;  5FIF A;  1MJ3 A;  2GTR A;  4PV1 D;  4B3H A;  1WDK A;  5L8R J;  1J7X A;  4Z1M H;  2G3A A;  1EXI A;  3STA A;  2WSC J;  3R4Y A;  1N6E A;  3AEF C;  1TG6 A;  1NZY A;  2BZR A;  5G1R A;  1HJ0 A;  3OC7 A;  2Q2X A;  1DIP A;  2DEO A;  4H0L C;  3Q5R A;  2MKV A;  1ZME C;  1XO6 A;  5DTW A;  3R9S A;  4EMM A;  3L3S A;  4JVT A;  3H02 A;  1KIL E;  1ON3 A;  1PJH A;  3Q5P A;  1NGM B;  4HC8 A;  1PIX A;  1DD4 A;  4WYO B;  1S1C X;  2YMK A;  1S5L X;  3K50 A;  3AE7 C;  3Q3D A;  3T8B A;  1O8U A;  2J5S A;  3IB9 A;  3D70 A;  4JYL A;  2YJG A;  2FBM A;  1DD3 A;  4KD6 A;  5KDR A;  3H25 A;  4RYF A;  1OMI A;  1KMI Z;  3KTG A;  3FF6 A;  3TVU A;  2VSS A;  1RJN A;  2J5I B;  2ZQQ A;  3Q7H A;  4KNP A;  4JCS A;  3GLM A;  1KOR A;  4H0L D;  1VRG A;  4JCQ A;  1KQG B;  1ON9 A;  3ST9 A;  4IZB A;  3MT6 A;  4RKU J;  1UIX A;  2BEZ F;  3DJA A;  2OQQ A;  1EXJ A;  4U0G H;  2VSU C;  4I7Z B;  3QRE A;  4JFC A;  4G2R A;  1VF5 B;  1HNO A;  3QK8 A;  4H13 B;  4Y28 J;  3KTI A;  2O01 J;  2E75 C;  2WSE J;  4ZDC A;  3HRX A;  5DL1 A;  2ZT9 D;  3MYB A;  4J2U A;  5KKZ C;  1Q52 A;  1IK7 A;  1UIY A;  2ZT9 B;  4H44 C;  1GMJ A;  3NJB A;  2E76 D;  1X0U A;  5DZK H;  3T88 A;  3AE2 C;  1Q51 A;  1YG6 A;  2E76 B;  4PV1 C;  4R4L A;  3Q2Y A;  4ZDB A;  4ZDE A;  2ZL2 A;  2W3P A;  2F9I B;  2JO1 A;  5DUF A;  3TRR A;  5MGB A;  4I42 A;  4RCN A;  2K9Y A;  3AE3 C;  1FCF A;  3SFD C;  1ZP0 C;  4ELW A;  3RSI A;  5E0S A;  3GKB A;  3GMA A;  3HLN 1;  1Y9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...