3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
3OC7A 3MFMA 2VSSA 2ZQRA 2J5II 5KJPA 2Q34A 3TRRA 4Q1IA 3GKBA 4KNPA 3TT7A 3QMJA 3T8AA 4GM2A 1XX4A 5G1RA 2C8TA 1HZDA 4I42A 1XNWA 3R9QA 4B3HA 1SZOA 3QK8A 4MI2A 4OMRA 2X58A 2VREA 4ZDBA 3HLN1 5INGA 5KDRA 3L3SA 4ZU2A 5C90A 2ZL4A 3QXZA 3JU1A 1XNYA 3R9TA 3ISAA 3GMAA 2W3PA 5JBXA 4OG1A 3GF3A 3RSIA 2VSUA 5INFA 3QREA 3KTGA 3QWDA 1FCFA 4U0GA 2DUBA 4ELWA 4RYFA 2ZL3A 3PEAA 3ZWBA 3K8XA 3BPPA 1WDMA 1K32A 4JVTA 3U9TB 3V5IA 3LKEA 3SWXA 4JCQA 3TDCA 3H0UA 1SG4A 5DTPA 2A81A 1FC6A 1JXZA 4MXIA 4ZDCA 3MOYA 2D3TA 4LK5A 1J7XA 3TVWA 3RSTA 2DEOA 5E0SA 3IBBA 3T8BA 3TLFA 5DUCA 2VX2A 1UYVA 3HE2A 3GLMA 5DTWA 3KTHA 4FN7A 3MYBA 4L8KA 2FBMA 2ZL0A 4GHNA 1N6DA 3R6HA 4U0HA 3H0SA 4HNKA 4ZDEA 1YG6A 3T89A 2FZSA 5G1QA 5JBWA 2VSUF 1NZYA 4FZWC 4WZ8B 1UYTA 1WDKA 4JCSA 1EY3A 4HC8A 4FZWA 4U18A 3FF6A 1Y7OA 2PBPA 1FC9A 2EJ5A 3Q0GA 4NNQA 3H0JA 4K2NA 1ON9A 3I47A 3Q1TA 1PJHA 3N6RB 1O8UA 4L6WA 4ZDDA 2A7SA 4FNBA 3R9SA 4JSBA 5DZKH 3TV5A 1WDLA 4KPKA 4U19A 1DCIA 1UIYA 3M6MA 3KTJA 4JCTA 5C9GA 4FN8A 4DI1A 2CBYA 3BF0A 1W2XA 1YG8A 4Z0MA 1X0UA 2J5IA 3V5EA 3K50A 3H02A 2F6IA 3MT6A 3GF7A 2F9IA 5DZKA 5DKPA 3QKAA 3FDUA 1PIXA 5E0SH 1OD2A 5E0NX 1N6EA 4IZCA 3VIVA 1N6FA 2BZRA 5G1SA 3M6NA 2J5IB 4NEKA 2PG8A 4JCRA 3TVUA 4B3JA 2ZQQA 5IKLB 4K3WA 4QFEA 3PZKA 3ZW8A 3R0OA 3NJDA 4IZDA 2Q2XA 2GTRA 2J5SA 2VSUE 4I4ZA 4QIIA 1VRGA 3KTIA 4K29A 1K39A 3T3WA 2VSSF 1TG6A 3HINA 3HP0A 3G64A 2ZL2A 3IAVA 4RCNA 3TT6A 5FIFA 4ASIA 2HW5A 2FW2A 4YLHA 1Q51A 2J5GA 1ON3A 2F9IB 4EMLA 2J5GD 3DJAA 1OD4A 2A7KA 5CTCA 2VSSE 4JWVA 3HRXA 5KDRB 4U0GH 4B3IA 2F9YA 4RYFH 4ZDFA 3DORA 4KWBA 4OLQA 4FB8A 4KD6A 3QYRA 3ZWCA 3QXIA 4ELSA 2IEXA 4WCZA 3Q7HA 3OT6A 3T88A 5DUFA 4FNDA 4EMPA 4F47A 3RRVA 3BEZA 1EF9A 5FUSA 1HNUA 1XNVA 3H0QA 3SLLA 3PGQA 1UYRA 1TYFA 4JYJA 1RJMA 3ZWAA 3KTKA 1RJNA 3TZ3A 4JYLA 5INIA 1Q52A 3STAA 2NP9A 2QQ3A 2X24A 3H81A 1UYSA 2UZFA 2PPYA 3NJBA 2VSUC 4JOTA 5DU4A 3WG5A 3P85A 3KQFA 3LAOA 1HNOA 4Q0GA 4WYOB 2F6QA 4FJWD 1WZ8A 1FC7A 2F9YB 2CE3A 3U9RB 4QIJA 2WTBA 3PE8A 1DUBA 3ZW9A 3P5MA 4ELXA 1MJ3A 3IB9A 3Q0JA 4IZBA 3ST9A 4MOUA 5DU8A 4G2RA 1NZYB 3P2LA 4JFCA 1XO6A 4JJTA 4U1AA 5MGBA 3U9SB 2Q35A 3OMEA 4I52A 4EMMA 5DU6A 1EF8A 5DL1A 5CTBA
chains in the Genus database with same CATH superfamily
3OC7A 3MFMA 4JF7A 1WMKA 2WSSH 1MFZA 2H89C 3GKBA 1QVGO 3TT7A 1FOSF 1VQ5P 2ZYGA 3HUSB 4KT0J 2W6BA 3Q5PA 4IOIH 1LGHB 3L73G 5CCHA 1PGOA 4I6MC 5G1RA 3H32A 3MD0A 5AW5B 1FU1A 1IO4A 3CCLP 3VP9A 1KTMA 1SZOA 3AEFC 5KLVD 3QK8A 1JUNA 4R4MA 1BDCA 1VDFA 2Z4EA 4Z1MH 5AVQB 2Q6QA 1K8AQ 1RF0A 4GDOA 2N1TD 4R4LA 3QXZA 3R9TA 3P8CE 5KLIC 3GMAA 1JMMA 3GF3A 2FYNB 5INFA 3SWFA 3QREA 4PJ0E 3QWDA 2ITAA 2J59M 3VMXA 1VF5D 1CI6B 3O6QB 3H1LE 1BGYJ 1EXIA 4RYFA 4OGQD 2R3SA 1SFCC 2AEJA 1DD4A 2KYVA 1JTHB 3M0AA 1NKNA 2O1KA 2OYHB 1K32A 2QE7H 1BE3D 1L0LG 1N2DC 1E79H 3AE5C 3RK3B 3U9TB 2KP8A 4JCQA 2B88A 1YI2P 3H1ID 3E1IA 4M3LA 1LTGC 1W5CE 1GW4A 1NH4A 3L4FA 3BCCJ 2WSFJ 5GTHE 4K3AA 1EDKA 4ZDCA 3A3YB 2QG4A 4AUWA 1GL2B 3GG2A 3V6IA 2HPCB 3TVWA 3V2QA 1L4AA 4L75A 1BCCD 3CC7P 2HPCA 3KHUA 4JBZA 4Y99C 1JY2N 3TLFA 1M1JC 2QSIA 3WU2E 2VX2A 2BCCJ 1FZGA 1UYVA 3RBZA 1AFOA 2YKOA 2Y0EA 1N7SC 5AVSB 1M1KQ 1N6DA 2WSCJ 4PD4E 1MFTA 4U0HA 1KORA 2K3RA 3MUDC 2QRXA 3T89A 1EC5A 2FZSA 1QGKB 5APXA 2VSUF 1NZYA 4WBAA 5B5EH 1UYTA 2FFDB 1NTMD 2W27A 2KOGA 1HGVA 4U18A 3FF6A 2Q1KA 2FYUD 3BATA 2ZJSE 3H0JA 3UIAA 1FZAA 4HJGH 4U3FD 3CXHE 4C46A 2WSFH 2YMYA 3LIEA 2Y0CA 1PJHA 1Q81Q 3M9HA 4WY4A 3NFQA 3R9SA 3KZIE 1SFCA 5AVTB 2WT7B 2GUSA 4J2UA 4ASWA 2ZAEB 3TV5A 3ZDMA 2FYUG 2XDJA 4U19A 1DCIA 2J5UA 2B87A 4WVZA 3H32B 1HUCA 3RK2C 5KLIB 3Q2YA 1S4XA 2ZT9D 1W2XA 1BGYE 4IFDK 2POHA 1YG8A 2IYOA 1X0UA 1N73B 3V5EA 2W83C 5KTBA 2WSEJ 3MT6A 1DH3A 2MKVA 2LKMA 4WY4C 2ZVOB 1S3JA 3QKAA 2WMMA 3HE4A 5E0SH 3KDPB 4BXLA 1OD2A 4HKZH 1N6EA 1RE4C 2WPRA 1SQVE 3VIVA 2YIUC 2KZJA 1JTHA 2XNDH 1BE3G 5APUA 1LJ2A 1LTIC 5CCHD 1LP1B 3RK2D 2E74C 1BSNA 3IN6A 3CWBD 4U3FE 2A06D 1OW6A 5AW8B 1R8EA 3RGUA 3KTIA 1URQA 1K39A 3S1KA 5AVYB 1TG6A 3QWOC 1K9MQ 3HINA 2KNCA 3RBXA 4D6TE 4YXDC 3TT6A 4ASIA 2ZFCA 3HD7C 5AW1B 3CWBG 2J5GA 2A06G 2F9IB 4EMLA 3G9RA 2J5GD 1FDOA 2A7KA 3L37A 4H0LC 3HRXA 2YNYA 3TDKA 1FBMA 1MV8A 2KUBA 1LTJC 4OLQA 4FB8A 2QJPB 3BASA 3QYRA 3K5BA 1IFIA 1LTAC 1NTMG 1L2PA 2IEXA 3VOPA 2ZXEB 2I1KA 1S9KE 2QJKB 3G3ZA 3VN0A 1LTSC 1LTTC 1JM0A 5AW9B 2BCCE 4PV1D 2JJLA 3H1HE 1ZR2A 2KI7B 5GTIH 3AEBC 1KB9I 2E76B 5FUSA 2OTLP 1SQBE 2P58A 3H0QA 4XFJA 1IJDB 5CCHC 1UYRA 3F5HA 1RJMA 2YKQA 3RK3E 1JO5A 3KTKA 2D2CD 3H1LG 1EDIA 1S72P 5KJ7A 3L70G 1Q52A 3HRNA 1JEKA 2AEFA 2XU6A 3MTUE 2X24A 3TYYA 2KXPB 1YQ4C 1J2JB 2NRGA 2WVRA 1RF1C 4WY4D 2H43A 1X79B 1QLED 4I7ZC 2P7JA 3VP8A 2O01J 1WZ8A 1FC7A 1BE3J 4RJTA 1DUBA 3H1JE 3P5MA 5AW0B 4IZBA 2LXCB 3WUTA 1N86A 4AQRD 1ZN5A 2DW3A 3M91A 4U1AA 2AXTE 1GL2D 2IBZG 2Q35A 2R3CA 1NTKK 1OXZA 4EIJA 3AECC 1NTKG 3H1HG 1S2EA 1SQVK 1RF1A 2VSUA 2J5II 2P67A 2Q34A 1YTZI 1FOSE 2P1JA 2XV5A 4KNPA 3HE4B 2AXCA 3QMJA 5CCGC 3BCCE 1KQLA 4N78D 1EDLA 3SFDC 1XX4A 2C9NY 4DZOA 3HD7D 4H0LB 2KS1A 2C8TA 2E75B 3A0BH 2ZYDA 2KSJA 4I42A 1SQXE 3HTKB 5CCGA 4B3HA 4OMRA 5APWA 3A0HE 5L8RJ 2Q3IA 1FZCA 2VREA 4ZDBA 2QJPC 5TISH 5INGA 5KJ7C 4A7PA 1NTMJ 3CXHH 2XZRA 1HJBA 2ZL4A 1NTMK 3ISAA 1SP4A 1L0LJ 4GIFA 3H6PA 4XA4A 2E42A 2WZ7A 1FZCC 1YJWP 2R44A 3KTGA 1EZVI 3CL3D 1WT6A 4U0GA 3I55P 3FWNA 2ZL3A 4H13B 1PPJD 3K8XA 2O3JA 1WDMA 3L71E 4JVTA 1YBKA 2OYOA 3SWXA 2O01N 3U1CA 1KMIZ 3W67A 3L73D 3TDCA 3WUUA 2OYIB 3H0UA 4HH2A 3D6ZA 5DTPA 3L70J 5B5EE 3L75E 1AJYA 3V4QA 5KJ7D 3IF4A 1S5LH 3MIWA 4UB6E 4LK5A 3JCUH 2DEOA 3CCRP 4JPZB 1KYOH 3T8BA 5DUCA 1LP1A 3RK3C 3U59A 5DTWA 3AE9C 2KLUA 2E5TA 1WRGA 2OARA 4DJGA 2ZL0A 1P84D 1S5LX 1VQOP 1VQLP 1RH5B 2JWDA 3H0SA 1JB0J 5G1QA 2BEZF 1AA0A 2R32A 4FZWC 5KAIH 2HG5D 1RE3A 2RKLA 1YITP 1KILA 2XNXA 4N3YB 1CZQA 1AVOA 1KB9H 4GOFA 1JY3O 4RKUJ 1Y7OA 1U57A 3BRVB 2PBPA 2PFXA 1EXJA 5APVA 2YO2A 3L75D 1VQ7P 1ON9A 1HVVA 1VQNP 1OFCX 3CCJP 2D2CC 1SQBD 5AW4B 4JSBA 1PP9J 3L71D 1ZR4A 1KILD 3HUSA 5DZKH 1NU1E 4KPKA 2OQQA 3CCVP 1G2CA 3KQGA 4GKGA 2FFDC 1AV1A 1AQTA 3KTJA 4JCTA 4FN8A 1KB9E 2KK7A 3TGUE 1P84H 1T8ZA 3BF0A 1W2EA 2IZ0A 3CPWO 5GTIE 2JO1A 2WPVB 3L72G 5DJUB 3H02A 4H13C 5DZKA 1VPCA 4K35A 5DKPA 1R5LA 5CCGD 3FDUA 5E0NX 3RL0g 2N9YB 1SVFA 4XE5B 1SQXD 2KLVA 2W90A 2ZVNB 3H1KD 1N6FA 3G71P 2J5IB 2M8RA 4BWNA 1X8YA 1GU5A 2PG8A 4B3JA 3AE3C 2ZQQA 5IKLB 3CCUP 3CX5H 1N7LA 3TGUD 2P10A 3OJAB 2G3AA 1EDJA 4H44C 2PGDA 1HTLC 1KN7A 1VQ9P 3CX5D 5BU8B 1KQFB 2Q2XA 2J5SA 2VSUE 4I4ZA 2E76D 1VRGA 1NU1D 3KPEA 2KNCB 4YXWH 3MP7B 3HP0A 2E43A 3H1HJ 1YJ9P 1KILB 2HR3A 4N78E 3BCCD 3I5CA 2HW5A 3TGUG 3AEEC 2H88C 1SQBJ 3L74E 3CXHI 1JY2O 3GHGA 1Q51A 1UIXA 1ON3A 3L71J 2QVAA 3DJAA 3CCEP 3KYQA 5KDRB 4U0GH 3Q5RA 1L0ND 5DJTB 5AVVB 3DORA 1G1IA 4OH8B 5AW3B 2BASA 4KD6A 4BRYB 3ZWCA 2Q9IA 2FXPA 2JR8A 1FE6A 3QXIA 3V2RA 1HWTC 2KIKA 3OT6A 5KLVG 1PPJG 2E75D 3T88A 1P84E 5DUFA 3H1JD 3GW6A 3RK3D 4FNDA 3P7KA 4F47A 3AEAC 2B9BA 2M3EA 1IFMA 2QEXP 4RESB 1N73A 2XKMA 2ZT9C 1QL1A 1HNUA 3Q3DA 2OYIA 3V2PA 3PGQA 4PV1C 4JYBA 2Q5UA 4U3FJ 3CXHD 1RJNA 1CSBA 3JCUE 2BCCD 4JYLA 1KYOI 5INIA 1QVFO 4C7RA 5AW7B 3TNUB 3STAA 1L0LD 3AEDC 3VMAA 3B71A 2UZFA 2NZ2A 1DEEG 1FDIA 4WB4A 1GDTA 4JOTA 5DU4A 3WG5A 1SQPK 1M8OB 3P85A 5BU5A 2HYNA 2VRSA 4FJWD 2YKPA 2RMZA 3U9RB 3H1HD 2WTBA 4Y28J 1G1JA 2C0XA 3ZW9A 1X22A 1KFNA 2G8YA 3IB9A 3Q0JA 3ST9A 4MOUA 3PRJA 5DU8A 1LT9C 1S9KD 3L73J 1NZYB 2E74B 1XO6A 3SWYA 3C9IA 3C1LA 4H44B 3U9SB 1IFJA 3OMEA 4IL6E 4HDTA 4I52A 2QM7A 1BCCE 1OVVA 5DL1A 5KKZC 2A45G 2L91A 4RO0A 2VSSA 5KJPA 2I1JA 3TRRA 1IFDA 1KILC 3EQ2A 4H13D 1SQQD 3PP5A 1GK6A 1Q90D 2V7QJ 3HD7B 1ZV8A 3LW5H 3T8AA 4GM2A 4GOEA 1M7LA 3L72E 3T97A 2M0BA 1P84I 3RL0C 1ZMEC 1SQVD 4KJMA 1XNWA 2V4HA 5CBOA 1Y9BA 1NVOA 2X58A 1VF5C 2R5DA 2M5AB 2BEQD 1NU1K 2C0WA 2CPSA 3HE5A 5GTHH 3CWBE 2PRRA 1NU1G 3L3SA 1N8RQ 4ZU2A 1OIPA 2QA4P 1OWAA 1OZHA 2YXQB 3JU1A 1JY2P 1RF0C 4C7NA 2W3PA 3WMM0 3CC4P 3R2PA 3RSIA 1GK4A 4YTPC 2WPSA 1J1EB 1DX7A 5H2FH 3VYIA 4ELWA 3PEAA 4WWIA 1LT1A 2KZIA 3CX5I 4H44D 3V5IA 3M0DC 2AEMA 1N7SB 1SG4A 2A81A 1MKMA 4TLFA 2K37A 3KZIH 1AQ5A 1JXZA 3H1JG 3MGNA 2D3TA 1VQ6P 4I7ZB 5AVRB 1J7XA 3L74D 3RSTA 2NPSB 1SFCB 3CMEP 3L72D 1FS0E 5E0SA 3V2NA 1SQQJ 3IBBA 3PTZA 1GZLA 1FZEA 3CMAP 3GLMA 3KTHA 3MYBA 2FBMA 2YMKA 3AE8C 3G4SP 4GHNA 4B86A 4UB8H 1SQVJ 3R4YA 1HJ0A 4IFMA 3A0HH 1PGPA 3L75G 4EYYQ 1JCCA 5JBWA 1BCCG 2GA1A 2O1JA 2LR2A 2JP3A 3TGUJ 3VMZA 3EFGA 1PL5A 3KXDA 5APSA 2K1AA 2IFMA 1KC8Q 3D70A 4JCSA 4ASVA 3L71G 4MN4C 1EY3A 1EQ7A 4H0LD 1M1JB 1NU1J 3D6YA 1NKZB 1H89A 1VQ8P 1AVYA 2PP6A 2QJYB 1LWUA 1PGQA 3I47A 2GUVA 3OW2O 3USSA 3Q1TA 3PJSK 2A45H 5BVZA 3CD6P 3N6RB 2IZ1A 4D6TD 2QIWA 3CCSP 4L6WA 2W6JH 1UIIA 2ZXXA 3CCMP 3B5NB 5H2FE 1WDLA 1Z56A 3M6MA 2IYPA 2A06E 2YO3A 3SFEC 5C9GA 1CI6A 4DI1A 1SQXK 1VQKP 3JSVC 1X9VA 1Q82Q 4NPDA 1IFPA 1SLQA 3EFFK 1FZCB 3PLNA 4PD4I 4QMAA 2K88A 4Z0MA 3P8CD 3K50A 3CI9A 4ZKUA 1A02F 1VL2A 1YIJP 3H1JJ 3OAKA 1PIXA 1W2BO 2N1TC 2JWAA 3BPTA 3MHVA 1DEBA 1ZXGA 3O8ZA 3O6QA 3B5NA 2OYIC 3T97B 5AVWB 5M1BA 2BZRA 4GT1A 4UB8E 1NTKE 3FWLA 1JOCA 5G1SA 1MZ9A 3M6NA 1VQPP 2IBZD 1URQC 2OTKE 1L0NE 4OWFA 5KAFH 1FDMA 1BGYD 5CJ4A 1VQMP 4K3WA 2V7QH 3ZW8A 3U1AA 1NTZG 3FGAD 1J1DC 1ZP0C 4ZNCA 4IZDA 1Q86Q 3RL0D 3JC22 5KLVJ 4K29A 4JQ0D 1GD2E 3L74G 2LXBA 2YIUB 3AE6C 3FXEA 4IFFA 3G64A 1GW3A 3IAVA 4RCNA 2W6AA 1M90Q 5FIFA 3TK1A 1RE4A 1OX3A 3H1LJ 2FW2A 4YLHA 2Z5HA 3AE4C 3AEGC 1RQUA 3M0DA 3CC2P 3GHGC 3WU2H 1OD4A 5CTCA 1BCCJ 1LNQA 2FYUE 1LTBC 1KD1Q 1IK7A 1KQGB 4U3FG 2F9YA 4ZDFA 3Q5SA 1LTJA 2IPPA 4NARA 1LWUB 3W68A 4IL6X 1NAYA 4KWBA 3L73E 1CW5A 5AVZB 1H8AA 4GODA 1SQPE 1ZRTD 1DIPA 3FXDA 2YJGA 1G2CB 3IR9A 4EI2A 4ELSA 4WCZA 3Q7HA 2HFED 1L4AB 3H1IJ 5CBNA 1ZW0A 3MUDA 2KB7P 3L70D 1U7MA 5KLVK 1RHZB 2QM8A 4N6JA 2E74D 2SPZA 1RF1B 1SS1A 3RRVA 3N4XA 3BEZA 1EF9A 1N7SA 1NTKD 3SLLA 2RH0A 1TYFA 4HYTB 2J58A 3PH0A 5AW6B 4JYJA 3H25A 4L76A 3ZWAA 1HF9A 2N9BA 2H7HA 2OTJP 3M9QA 1H88A 3S4RA 2NP9A 1S5LE 2P2UA 3C8VA 3EWKA 3AE2C 2PPYA 3NJBA 3H1IE 3L35A 3S9OA 3F89A 2Q3EA 1USEA 3LAOA 1HNOA 2F6QA 2CE3A 1IK9A 4QIJA 4Y99B 1K04A 1R5SA 2RN0A 2JKVA 3PE8A 3H1LD 3HUSC 4W7ZA 1URQB 4LLHA 2FYUJ 1PZQA 1MJ3A 4ELXA 3M06A 2H8PD 1YYCA 1L0NK 4G2RA 1PP9G 3P2LA 4JFCA 4JJTA 1TU3F 4LGDE 5MGBA 1HGZA 3I56P 1J1DB 1EZVE 4EMMA 3CLQA 4OGQC 2MJZA 1SFCD 2WITA 5DU6A 1EF8A 2B87B 1SQXJ 2A45I 2Y0DA 5CTBA 5KAIE 1SQVG 5B66H 1HBWA 2K9YA 2ZQRA 3L74J 4Q1IA 1NTZE 1U7JA 2K9JB 3L72J 1XTGB 2FYNC 3SSUA 4D6TG 3HD7A 1LT9B 1HZDA 1BSHA 1GMJA 3R9QA 4PD4H 1PV3A 4ZMDA 2HLOA 3IFMA 4MI2A 1NTKJ 2FYUK 1X0TA 5KKZB 3HLN1 5KDRA 1Q7YQ 1KYOD 1ZLLA 5C90A 1L4AC 1XNYA 3RK2B 3B8EB 1FJKA 3H1IG 5CMZA 5JBXA 3QH9A 4OG1A 2Q7CA 4I2LC 1M56D 4OVNF 2WT7A 1KYOE 1D7MA 1Y47A 1YHQP 3AE7C 1N73C 1L0LE 1FCFA 1GL2C 3SWKA 1XTCC 1FC2C 1T2KD 1NAFA 2DUBA 2ZT9B 2WTYA 3FX0A 3ZWBA 3BPPA 1M1JA 3CWBJ 1N7SD 1M57D 1VQ4P 3L36A 3LKEA 1EZVG 3MZWB 4NPFX 1PP9E 2CPBA 1KQSO 1BGYG 1IFNA 4I1LA 1FC6A 1NTZD 4HB1A 4PJ0H 1JY3P 4MXIA 2WPQA 4AYCA 3MOYA 1JNMA 1PGJA 2FBWC 2JEEA 5C39A 4BRYA 4KHXA 5APQA 1KFMA 1JMBA 1L0NJ 5AVXB 2OYHA 3M9BA 2I8DA 3BCCG 3CCQP 3HE2A 4FN7A 1QL2A 4L8KA 3IAOA 1GU4A 2KSEA 3A2AA 2E5YA 3H1KG 4L74A 3R6HA 1NO4A 5TJHA 1SQQK 4OGQB 4HNKA 3A7OA 2O01H 2K9JA 4ZDEA 1YG6A 1A02J 1K73Q 3WUVA 3P32A 5APYA 1DD3A 4WZ8B 1KV4A 1WDKA 3ITKA 1SQQE 1YJNP 4HC8A 2FXMA 4FZWA 1OMIA 2IFNA 1H0TA 1FC9A 1BDDA 3HE5B 2EJ5A 3Q0GA 3A5TA 4NNQA 3VTPC 3CX5E 4K2NA 2CK3H 2QJKC 4WY4B 4EOTA 1Q2NA 1O8UA 4C7NB 4ZDDA 2A7SA 1SQPG 4FNBA 1VF5B 5APTA 1K05A 3TF5A 2FYZA 2E76C 4UB6H 1UIYA 1OVUA 4EDFA 5E79H 3P8MC 1NTZJ 2CBYA 2NPSA 2FFDA 2JDIH 2FKWB 1OW7A 2J5IA 2QJYC 5KAFE 1J1EC 1ZRTE 1QX8A 1SQBG 1FZFA 2F6IA 3GF7A 2F9IA 3LW5J 4W80A 2D2CB 2L5GB 3G6EP 4IZCA 1L0LK 2Z5IA 1KB9D 3B5NC 3II6A 4IL6H 2N1TA 1FZBA 1NHLA 5E79E 1KILE 1NTME 1IZNB 4NEKA 3OA7A 1ZOYC 1T6AA 4JCRA 1RE3C 3TVUA 3E1RA 5AVUB 1GTWA 1QEXA 4QFEA 3PZKA 5CHXA 2NPSC 3R0OA 3NJDA 1NTZK 1OVRA 1NWQA 2GTRA 1L4AD 3NTNA 2ZYAA 1LTJB 4QIIA 2B89A 3T3WA 4DCKA 1NGMB 2WWWA 1URQD 3Q1MA 2VSSF 4L73A 3NMDA 1LT9A 2IBZE 1T2KC 2ZL2A 3BRTB 2KS1B 1JCDA 2HODA 3V5BA 3TNUA 2W8ZA 1JY3N 1E5WA 2VSSE 4DT0A 4JWVA 1RY3A 4B3IA 1USDA 2AXTH 4RYFH 1SQPJ 3AE1C 4O9BA 4ZKPA 5EFWB 2FY8A 4CPGA 5K5GB 1PFIA 1EZVD 5CJ0A 4U7JA 2PAJA 1BE3E 3E7KA 1FAVA 3ABVC 4YPCA 2R5BA 2WSEH 3VMYA 1YTZT 4EMPA 2M5AA 2OGUA 1SQQG 2GM4A 3GHGB 3BVHA 5AW2B 3D71A 2Y9YA 1T3JA 1YQ3C 1XNVA 1LWUC 2OYHC 1KZUB 2UWJE 2WSCH 3N7NA 3H1KE 2M3BA 2WQYC 3L75J 3L70E 4JYCA 3TZ3A 3A0BE 1PPJE 3B4SA 2NPSD 2YXRB 5B66E 4LC1A 5KLVE 1IC2A 2QQ3A 3H81A 1UYSA 3LIDA 1FJPA 1SQBK 1S1CX 1PP9D 1OW8A 2VSUC 5TISE 3TSIA 2N1TB 1NYHA 2HODB 1MUUA 3KQFA 4Q0GA 2Y9ZA 4TT3H 4WYOB 4W7YA 2F9YB 1NOHA 4DOJA 3B5ND 4NPEA 5HUQA 2BCCG 1SQXG 3HTKA 2IX7C 4PV1B 2FXOA 3NXSA 3PHLA 1L0NG 1GL2A 3RL0B 2E75C 2IDBA 1T3UA 1HH0A 1NJIQ 1RQVA 1SQPD 2C9LY 4D6TJ 4PD4D 2IBZI 1Y8AA 1H0TB 3V4WA 3H1KJ
chains in the Genus database with same CATH topology
3OC7A 3MFMA 2K9YA 2VSSA 2ZQRA 2J5II 5KJPA 1WMKA 2Q34A 3TRRA 4Q1IA 2H89C 3GKBA 4KNPA 4H13D 3TT7A 2FYNC 3QMJA 1Q90D 2V7QJ 4KT0J 3T8AA 4GM2A 3Q5PA 3SFDC 1XX4A 4H0LB 5G1RA 2C8TA 2E75B 1ZMEC 1HZDA 4I42A 1GMJA 1XNWA 3R9QA 4B3HA 1PV3A 1KTMA 1SZOA 3AEFC 3QK8A 4MI2A 4OMRA 1Y9BA 4R4MA 5L8RJ 2X58A 1VF5C 2VREA 4ZDBA 2QJPC 2BEQD 3HLN1 5INGA 5KDRA 4Z1MH 3L3SA 4ZU2A 4GDOA 5C90A 4R4LA 2ZL4A 3QXZA 3JU1A 1XNYA 3R9TA 3ISAA 3GMAA 5KLIC 2W3PA 5JBXA 4OG1A 3GF3A 3RSIA 5INFA 3QREA 3KTGA 4YTPC 3QWDA 3AE7C 1FCFA 1VF5D 4U0GA 2DUBA 4ELWA 2ZT9B 1EXIA 2ZL3A 3PEAA 4RYFA 4OGQD 4H13B 3ZWBA 3K8XA 1DD4A 3BPPA 1WDMA 1K32A 4H44D 4JVTA 3AE5C 3U9TB 3V5IA 3LKEA 3SWXA 4JCQA 1KMIZ 3TDCA 3H0UA 3D6ZA 1SG4A 5DTPA 2A81A 1MKMA 1AJYA 1FC6A 2WSFJ 1JXZA 4MXIA 4ZDCA 3MOYA 2D3TA 4LK5A 4I7ZB 2FBWC 1J7XA 3TVWA 3RSTA 2DEOA 5E0SA 3IBBA 3T8BA 3TLFA 5DUCA 2QSIA 2VX2A 1UYVA 3HE2A 3GLMA 5DTWA 3AE9C 3KTHA 4FN7A 3MYBA 4L8KA 2FBMA 3IAOA 2ZL0A 1S5LX 2YMKA 3AE8C 4GHNA 1N6DA 2WSCJ 3R4YA 3R6HA 1HJ0A 4U0HA 4OGQB 3H0SA 4HNKA 1KORA 4ZDEA 1JB0J 1YG6A 3T89A 2FZSA 5G1QA 2BEZF 5JBWA 2VSUF 2JP3A 1NZYA 4FZWC 4WZ8B 1DD3A 1PL5A 1UYTA 1WDKA 3D70A 4JCSA 1EY3A 4HC8A 4FZWA 4U18A 1OMIA 3FF6A 4RKUJ 4H0LD 1Y7OA 1U57A 2PBPA 3D6YA 1FC9A 2EJ5A 3Q0GA 4NNQA 3H0JA 1EXJA 4K2NA 1ON9A 3I47A 2QJKC 3Q1TA 2D2CC 1PJHA 3N6RB 1O8UA 2QIWA 4L6WA 4ZDDA 2A7SA 4FNBA 1VF5B 3R9SA 4JSBA 1K05A 4J2UA 5DZKH 3TV5A 2E76C 1WDLA 4KPKA 2OQQA 4U19A 1DCIA 1UIYA 3M6MA 3SFEC 3KTJA 4JCTA 2J5UA 5C9GA 4FN8A 4DI1A 3Q2YA 2CBYA 3BF0A 2ZT9D 1W2XA 1YG8A 4Z0MA 1OW7A 1X0UA 2J5IA 3V5EA 2QJYC 1ZRTE 3K50A 2JO1A 2WPVB 2WSEJ 3H02A 2F6IA 3MT6A 4H13C 3GF7A 2MKVA 2F9IA 3LW5J 5DZKA 2D2CB 5DKPA 1VL2A 3QKAA 3FDUA 1PIXA 5E0SH 1OD2A 3BPTA 5E0NX 3RL0g 1N6EA 4IZCA 3O6QA 3VIVA 2YIUC 1N6FA 3T97B 5M1BA 2BZRA 1KILE 5G1SA 3M6NA 2J5IB 4NEKA 2PG8A 1ZOYC 4JCRA 3TVUA 4B3JA 3AE3C 2ZQQA 2E74C 5IKLB 4K3WA 4QFEA 2P10A 2G3AA 3PZKA 4H44C 3ZW8A 3IN6A 3R0OA 3NJDA 3FGAD 1ZP0C 1OW6A 1KQFB 4IZDA 2Q2XA 1R8EA 2GTRA 2J5SA 2VSUE 4I4ZA 2E76D 4QIIA 1VRGA 3KTIA 4K29A 1K39A 3T3WA 1NGMB 2VSSF 1TG6A 3Q1MA 3HINA 3AE6C 3HP0A 3G64A 4YXDC 2ZL2A 3IAVA 4RCNA 3TT6A 5FIFA 4ASIA 2HW5A 3AEEC 2H88C 2FW2A 4YLHA 3AE4C 3AEGC 1Q51A 1UIXA 1RQUA 2J5GA 1ON3A 2F9IB 4EMLA 3G9RA 2J5GD 3DJAA 1FDOA 1OD4A 2A7KA 5CTCA 2VSSE 4H0LC 4JWVA 3HRXA 5KDRB 4U0GH 1IK7A 1KQGB 4B3IA 2F9YA 4RYFH 4ZDFA 3Q5SA 3Q5RA 3AE1C 4NARA 4IL6X 3DORA 4KWBA 4OLQA 4FB8A 4U7JA 4KD6A 3QYRA 3ZWCA 1DIPA 2YJGA 2FXPA 3QXIA 4ELSA 2IEXA 4WCZA 3Q7HA 3OT6A 4PV1D 2E75D 3T88A 5DUFA 3ABVC 4FNDA 4EMPA 4F47A 2E74D 3AEAC 3RRVA 3BEZA 3AEBC 2E76B 3D71A 1EF9A 2ZT9C 5FUSA 1HNUA 1YQ3C 3Q3DA 1XNVA 3H0QA 4XFJA 3SLLA 3PGQA 1UYRA 1TYFA 4JYJA 1RJMA 3H25A 4PV1C 3RK3E 3ZWAA 1HF9A 2WQYC 3KTKA 2D2CD 1RJNA 3TZ3A 4JYLA 5INIA 1Q52A 3STAA 2NP9A 2QQ3A 3C8VA 3EWKA 2X24A 3H81A 3AEDC 1UYSA 3B71A 2UZFA 2NZ2A 1YQ4C 3AE2C 2PPYA 3NJBA 1FDIA 1S1CX 3S9OA 1OW8A 2VSUC 4JOTA 5DU4A 3WG5A 1NYHA 3P85A 3KQFA 4I7ZC 3LAOA 1HNOA 4Q0GA 4TT3H 4WYOB 2F6QA 2O01J 4FJWD 1WZ8A 1FC7A 2F9YB 2CE3A 3U9RB 4QIJA 2WTBA 4Y28J 1K04A 3PE8A 5HUQA 1DUBA 3ZW9A 2G8YA 3P5MA 4ELXA 4PV1B 1MJ3A 3IB9A 3Q0JA 4IZBA 3ST9A 4MOUA 5DU8A 5CTBA 4G2RA 1NZYB 2E74B 3P2LA 1XO6A 4JFCA 4JJTA 1TU3F 4U1AA 2E75C 2IDBA 4H44B 5MGBA 3U9SB 2Q35A 1RQVA 3OMEA 4HDTA 4I52A 4EMMA 4OGQC 3AECC 5DU6A 1EF8A 5DL1A 5KKZC 2VSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OC7 A;  3MFM A;  2VSS A;  2ZQR A;  2J5I I;  5KJP A;  2Q34 A;  3TRR A;  4Q1I A;  3GKB A;  4KNP A;  3TT7 A;  3QMJ A;  3T8A A;  4GM2 A;  1XX4 A;  5G1R A;  2C8T A;  1HZD A;  4I42 A;  1XNW A;  3R9Q A;  4B3H A;  1SZO A;  3QK8 A;  4MI2 A;  4OMR A;  2X58 A;  2VRE A;  4ZDB A;  3HLN 1;  5ING A;  5KDR A;  3L3S A;  4ZU2 A;  5C90 A;  2ZL4 A;  3QXZ A;  3JU1 A;  1XNY A;  3R9T A;  3ISA A;  3GMA A;  2W3P A;  5JBX A;  4OG1 A;  3GF3 A;  3RSI A;  2VSU A;  5INF A;  3QRE A;  3KTG A;  3QWD A;  1FCF A;  4U0G A;  2DUB A;  4ELW A;  4RYF A;  2ZL3 A;  3PEA A;  3ZWB A;  3K8X A;  3BPP A;  1WDM A;  1K32 A;  4JVT A;  3U9T B;  3V5I A;  3LKE A;  3SWX A;  4JCQ A;  3TDC A;  3H0U A;  1SG4 A;  5DTP A;  2A81 A;  1FC6 A;  1JXZ A;  4MXI A;  4ZDC A;  3MOY A;  2D3T A;  4LK5 A;  1J7X A;  3TVW A;  3RST A;  2DEO A;  5E0S A;  3IBB A;  3T8B A;  3TLF A;  5DUC A;  2VX2 A;  1UYV A;  3HE2 A;  3GLM A;  5DTW A;  3KTH A;  4FN7 A;  3MYB A;  4L8K A;  2FBM A;  2ZL0 A;  4GHN A;  1N6D A;  3R6H A;  4U0H A;  3H0S A;  4HNK A;  4ZDE A;  1YG6 A;  3T89 A;  2FZS A;  5G1Q A;  5JBW A;  2VSU F;  1NZY A;  4FZW C;  4WZ8 B;  1UYT A;  1WDK A;  4JCS A;  1EY3 A;  4HC8 A;  4FZW A;  4U18 A;  3FF6 A;  1Y7O A;  2PBP A;  1FC9 A;  2EJ5 A;  3Q0G A;  4NNQ A;  3H0J A;  4K2N A;  1ON9 A;  3I47 A;  3Q1T A;  1PJH A;  3N6R B;  1O8U A;  4L6W A;  4ZDD A;  2A7S A;  4FNB A;  3R9S A;  4JSB A;  5DZK H;  3TV5 A;  1WDL A;  4KPK A;  4U19 A;  1DCI A;  1UIY A;  3M6M A;  3KTJ A;  4JCT A;  5C9G A;  4FN8 A;  4DI1 A;  2CBY A;  3BF0 A;  1W2X A;  1YG8 A;  4Z0M A;  1X0U A;  2J5I A;  3V5E A;  3K50 A;  3H02 A;  2F6I A;  3MT6 A;  3GF7 A;  2F9I A;  5DZK A;  5DKP A;  3QKA A;  3FDU A;  1PIX A;  5E0S H;  1OD2 A;  5E0N X;  1N6E A;  4IZC A;  3VIV A;  1N6F A;  2BZR A;  5G1S A;  3M6N A;  2J5I B;  4NEK A;  2PG8 A;  4JCR A;  3TVU A;  4B3J A;  2ZQQ A;  5IKL B;  4K3W A;  4QFE A;  3PZK A;  3ZW8 A;  3R0O A;  3NJD A;  4IZD A;  2Q2X A;  2GTR A;  2J5S A;  2VSU E;  4I4Z A;  4QII A;  1VRG A;  3KTI A;  4K29 A;  1K39 A;  3T3W A;  2VSS F;  1TG6 A;  3HIN A;  3HP0 A;  3G64 A;  2ZL2 A;  3IAV A;  4RCN A;  3TT6 A;  5FIF A;  4ASI A;  2HW5 A;  2FW2 A;  4YLH A;  1Q51 A;  2J5G A;  1ON3 A;  2F9I B;  4EML A;  2J5G D;  3DJA A;  1OD4 A;  2A7K A;  5CTC A;  2VSS E;  4JWV A;  3HRX A;  5KDR B;  4U0G H;  4B3I A;  2F9Y A;  4RYF H;  4ZDF A;  3DOR A;  4KWB A;  4OLQ A;  4FB8 A;  4KD6 A;  3QYR A;  3ZWC A;  3QXI A;  4ELS A;  2IEX A;  4WCZ A;  3Q7H A;  3OT6 A;  3T88 A;  5DUF A;  4FND A;  4EMP A;  4F47 A;  3RRV A;  3BEZ A;  1EF9 A;  5FUS A;  1HNU A;  1XNV A;  3H0Q A;  3SLL A;  3PGQ A;  1UYR A;  1TYF A;  4JYJ A;  1RJM A;  3ZWA A;  3KTK A;  1RJN A;  3TZ3 A;  4JYL A;  5INI A;  1Q52 A;  3STA A;  2NP9 A;  2QQ3 A;  2X24 A;  3H81 A;  1UYS A;  2UZF A;  2PPY A;  3NJB A;  2VSU C;  4JOT A;  5DU4 A;  3WG5 A;  3P85 A;  3KQF A;  3LAO A;  1HNO A;  4Q0G A;  4WYO B;  2F6Q A;  4FJW D;  1WZ8 A;  1FC7 A;  2F9Y B;  2CE3 A;  3U9R B;  4QIJ A;  2WTB A;  3PE8 A;  1DUB A;  3ZW9 A;  3P5M A;  4ELX A;  1MJ3 A;  3IB9 A;  3Q0J A;  4IZB A;  3ST9 A;  4MOU A;  5DU8 A;  4G2R A;  1NZY B;  3P2L A;  4JFC A;  1XO6 A;  4JJT A;  4U1A A;  5MGB A;  3U9S B;  2Q35 A;  3OME A;  4I52 A;  4EMM A;  5DU6 A;  1EF8 A;  5DL1 A;  5CTB A; 
#chains in the Genus database with same CATH topology
 3OC7 A;  3MFM A;  4JF7 A;  1WMK A;  2WSS H;  1MFZ A;  2H89 C;  3GKB A;  1QVG O;  3TT7 A;  1FOS F;  1VQ5 P;  2ZYG A;  3HUS B;  4KT0 J;  2W6B A;  3Q5P A;  4IOI H;  1LGH B;  3L73 G;  5CCH A;  1PGO A;  4I6M C;  5G1R A;  3H32 A;  3MD0 A;  5AW5 B;  1FU1 A;  1IO4 A;  3CCL P;  3VP9 A;  1KTM A;  1SZO A;  3AEF C;  5KLV D;  3QK8 A;  1JUN A;  4R4M A;  1BDC A;  1VDF A;  2Z4E A;  4Z1M H;  5AVQ B;  2Q6Q A;  1K8A Q;  1RF0 A;  4GDO A;  2N1T D;  4R4L A;  3QXZ A;  3R9T A;  3P8C E;  5KLI C;  3GMA A;  1JMM A;  3GF3 A;  2FYN B;  5INF A;  3SWF A;  3QRE A;  4PJ0 E;  3QWD A;  2ITA A;  2J59 M;  3VMX A;  1VF5 D;  1CI6 B;  3O6Q B;  3H1L E;  1BGY J;  1EXI A;  4RYF A;  4OGQ D;  2R3S A;  1SFC C;  2AEJ A;  1DD4 A;  2KYV A;  1JTH B;  3M0A A;  1NKN A;  2O1K A;  2OYH B;  1K32 A;  2QE7 H;  1BE3 D;  1L0L G;  1N2D C;  1E79 H;  3AE5 C;  3RK3 B;  3U9T B;  2KP8 A;  4JCQ A;  2B88 A;  1YI2 P;  3H1I D;  3E1I A;  4M3L A;  1LTG C;  1W5C E;  1GW4 A;  1NH4 A;  3L4F A;  3BCC J;  2WSF J;  5GTH E;  4K3A A;  1EDK A;  4ZDC A;  3A3Y B;  2QG4 A;  4AUW A;  1GL2 B;  3GG2 A;  3V6I A;  2HPC B;  3TVW A;  3V2Q A;  1L4A A;  4L75 A;  1BCC D;  3CC7 P;  2HPC A;  3KHU A;  4JBZ A;  4Y99 C;  1JY2 N;  3TLF A;  1M1J C;  2QSI A;  3WU2 E;  2VX2 A;  2BCC J;  1FZG A;  1UYV A;  3RBZ A;  1AFO A;  2YKO A;  2Y0E A;  1N7S C;  5AVS B;  1M1K Q;  1N6D A;  2WSC J;  4PD4 E;  1MFT A;  4U0H A;  1KOR A;  2K3R A;  3MUD C;  2QRX A;  3T89 A;  1EC5 A;  2FZS A;  1QGK B;  5APX A;  2VSU F;  1NZY A;  4WBA A;  5B5E H;  1UYT A;  2FFD B;  1NTM D;  2W27 A;  2KOG A;  1HGV A;  4U18 A;  3FF6 A;  2Q1K A;  2FYU D;  3BAT A;  2ZJS E;  3H0J A;  3UIA A;  1FZA A;  4HJG H;  4U3F D;  3CXH E;  4C46 A;  2WSF H;  2YMY A;  3LIE A;  2Y0C A;  1PJH A;  1Q81 Q;  3M9H A;  4WY4 A;  3NFQ A;  3R9S A;  3KZI E;  1SFC A;  5AVT B;  2WT7 B;  2GUS A;  4J2U A;  4ASW A;  2ZAE B;  3TV5 A;  3ZDM A;  2FYU G;  2XDJ A;  4U19 A;  1DCI A;  2J5U A;  2B87 A;  4WVZ A;  3H32 B;  1HUC A;  3RK2 C;  5KLI B;  3Q2Y A;  1S4X A;  2ZT9 D;  1W2X A;  1BGY E;  4IFD K;  2POH A;  1YG8 A;  2IYO A;  1X0U A;  1N73 B;  3V5E A;  2W83 C;  5KTB A;  2WSE J;  3MT6 A;  1DH3 A;  2MKV A;  2LKM A;  4WY4 C;  2ZVO B;  1S3J A;  3QKA A;  2WMM A;  3HE4 A;  5E0S H;  3KDP B;  4BXL A;  1OD2 A;  4HKZ H;  1N6E A;  1RE4 C;  2WPR A;  1SQV E;  3VIV A;  2YIU C;  2KZJ A;  1JTH A;  2XND H;  1BE3 G;  5APU A;  1LJ2 A;  1LTI C;  5CCH D;  1LP1 B;  3RK2 D;  2E74 C;  1BSN A;  3IN6 A;  3CWB D;  4U3F E;  2A06 D;  1OW6 A;  5AW8 B;  1R8E A;  3RGU A;  3KTI A;  1URQ A;  1K39 A;  3S1K A;  5AVY B;  1TG6 A;  3QWO C;  1K9M Q;  3HIN A;  2KNC A;  3RBX A;  4D6T E;  4YXD C;  3TT6 A;  4ASI A;  2ZFC A;  3HD7 C;  5AW1 B;  3CWB G;  2J5G A;  2A06 G;  2F9I B;  4EML A;  3G9R A;  2J5G D;  1FDO A;  2A7K A;  3L37 A;  4H0L C;  3HRX A;  2YNY A;  3TDK A;  1FBM A;  1MV8 A;  2KUB A;  1LTJ C;  4OLQ A;  4FB8 A;  2QJP B;  3BAS A;  3QYR A;  3K5B A;  1IFI A;  1LTA C;  1NTM G;  1L2P A;  2IEX A;  3VOP A;  2ZXE B;  2I1K A;  1S9K E;  2QJK B;  3G3Z A;  3VN0 A;  1LTS C;  1LTT C;  1JM0 A;  5AW9 B;  2BCC E;  4PV1 D;  2JJL A;  3H1H E;  1ZR2 A;  2KI7 B;  5GTI H;  3AEB C;  1KB9 I;  2E76 B;  5FUS A;  2OTL P;  1SQB E;  2P58 A;  3H0Q A;  4XFJ A;  1IJD B;  5CCH C;  1UYR A;  3F5H A;  1RJM A;  2YKQ A;  3RK3 E;  1JO5 A;  3KTK A;  2D2C D;  3H1L G;  1EDI A;  1S72 P;  5KJ7 A;  3L70 G;  1Q52 A;  3HRN A;  1JEK A;  2AEF A;  2XU6 A;  3MTU E;  2X24 A;  3TYY A;  2KXP B;  1YQ4 C;  1J2J B;  2NRG A;  2WVR A;  1RF1 C;  4WY4 D;  2H43 A;  1X79 B;  1QLE D;  4I7Z C;  2P7J A;  3VP8 A;  2O01 J;  1WZ8 A;  1FC7 A;  1BE3 J;  4RJT A;  1DUB A;  3H1J E;  3P5M A;  5AW0 B;  4IZB A;  2LXC B;  3WUT A;  1N86 A;  4AQR D;  1ZN5 A;  2DW3 A;  3M91 A;  4U1A A;  2AXT E;  1GL2 D;  2IBZ G;  2Q35 A;  2R3C A;  1NTK K;  1OXZ A;  4EIJ A;  3AEC C;  1NTK G;  3H1H G;  1S2E A;  1SQV K;  1RF1 A;  2VSU A;  2J5I I;  2P67 A;  2Q34 A;  1YTZ I;  1FOS E;  2P1J A;  2XV5 A;  4KNP A;  3HE4 B;  2AXC A;  3QMJ A;  5CCG C;  3BCC E;  1KQL A;  4N78 D;  1EDL A;  3SFD C;  1XX4 A;  2C9N Y;  4DZO A;  3HD7 D;  4H0L B;  2KS1 A;  2C8T A;  2E75 B;  3A0B H;  2ZYD A;  2KSJ A;  4I42 A;  1SQX E;  3HTK B;  5CCG A;  4B3H A;  4OMR A;  5APW A;  3A0H E;  5L8R J;  2Q3I A;  1FZC A;  2VRE A;  4ZDB A;  2QJP C;  5TIS H;  5ING A;  5KJ7 C;  4A7P A;  1NTM J;  3CXH H;  2XZR A;  1HJB A;  2ZL4 A;  1NTM K;  3ISA A;  1SP4 A;  1L0L J;  4GIF A;  3H6P A;  4XA4 A;  2E42 A;  2WZ7 A;  1FZC C;  1YJW P;  2R44 A;  3KTG A;  1EZV I;  3CL3 D;  1WT6 A;  4U0G A;  3I55 P;  3FWN A;  2ZL3 A;  4H13 B;  1PPJ D;  3K8X A;  2O3J A;  1WDM A;  3L71 E;  4JVT A;  1YBK A;  2OYO A;  3SWX A;  2O01 N;  3U1C A;  1KMI Z;  3W67 A;  3L73 D;  3TDC A;  3WUU A;  2OYI B;  3H0U A;  4HH2 A;  3D6Z A;  5DTP A;  3L70 J;  5B5E E;  3L75 E;  1AJY A;  3V4Q A;  5KJ7 D;  3IF4 A;  1S5L H;  3MIW A;  4UB6 E;  4LK5 A;  3JCU H;  2DEO A;  3CCR P;  4JPZ B;  1KYO H;  3T8B A;  5DUC A;  1LP1 A;  3RK3 C;  3U59 A;  5DTW A;  3AE9 C;  2KLU A;  2E5T A;  1WRG A;  2OAR A;  4DJG A;  2ZL0 A;  1P84 D;  1S5L X;  1VQO P;  1VQL P;  1RH5 B;  2JWD A;  3H0S A;  1JB0 J;  5G1Q A;  2BEZ F;  1AA0 A;  2R32 A;  4FZW C;  5KAI H;  2HG5 D;  1RE3 A;  2RKL A;  1YIT P;  1KIL A;  2XNX A;  4N3Y B;  1CZQ A;  1AVO A;  1KB9 H;  4GOF A;  1JY3 O;  4RKU J;  1Y7O A;  1U57 A;  3BRV B;  2PBP A;  2PFX A;  1EXJ A;  5APV A;  2YO2 A;  3L75 D;  1VQ7 P;  1ON9 A;  1HVV A;  1VQN P;  1OFC X;  3CCJ P;  2D2C C;  1SQB D;  5AW4 B;  4JSB A;  1PP9 J;  3L71 D;  1ZR4 A;  1KIL D;  3HUS A;  5DZK H;  1NU1 E;  4KPK A;  2OQQ A;  3CCV P;  1G2C A;  3KQG A;  4GKG A;  2FFD C;  1AV1 A;  1AQT A;  3KTJ A;  4JCT A;  4FN8 A;  1KB9 E;  2KK7 A;  3TGU E;  1P84 H;  1T8Z A;  3BF0 A;  1W2E A;  2IZ0 A;  3CPW O;  5GTI E;  2JO1 A;  2WPV B;  3L72 G;  5DJU B;  3H02 A;  4H13 C;  5DZK A;  1VPC A;  4K35 A;  5DKP A;  1R5L A;  5CCG D;  3FDU A;  5E0N X;  3RL0 g;  2N9Y B;  1SVF A;  4XE5 B;  1SQX D;  2KLV A;  2W90 A;  2ZVN B;  3H1K D;  1N6F A;  3G71 P;  2J5I B;  2M8R A;  4BWN A;  1X8Y A;  1GU5 A;  2PG8 A;  4B3J A;  3AE3 C;  2ZQQ A;  5IKL B;  3CCU P;  3CX5 H;  1N7L A;  3TGU D;  2P10 A;  3OJA B;  2G3A A;  1EDJ A;  4H44 C;  2PGD A;  1HTL C;  1KN7 A;  1VQ9 P;  3CX5 D;  5BU8 B;  1KQF B;  2Q2X A;  2J5S A;  2VSU E;  4I4Z A;  2E76 D;  1VRG A;  1NU1 D;  3KPE A;  2KNC B;  4YXW H;  3MP7 B;  3HP0 A;  2E43 A;  3H1H J;  1YJ9 P;  1KIL B;  2HR3 A;  4N78 E;  3BCC D;  3I5C A;  2HW5 A;  3TGU G;  3AEE C;  2H88 C;  1SQB J;  3L74 E;  3CXH I;  1JY2 O;  3GHG A;  1Q51 A;  1UIX A;  1ON3 A;  3L71 J;  2QVA A;  3DJA A;  3CCE P;  3KYQ A;  5KDR B;  4U0G H;  3Q5R A;  1L0N D;  5DJT B;  5AVV B;  3DOR A;  1G1I A;  4OH8 B;  5AW3 B;  2BAS A;  4KD6 A;  4BRY B;  3ZWC A;  2Q9I A;  2FXP A;  2JR8 A;  1FE6 A;  3QXI A;  3V2R A;  1HWT C;  2KIK A;  3OT6 A;  5KLV G;  1PPJ G;  2E75 D;  3T88 A;  1P84 E;  5DUF A;  3H1J D;  3GW6 A;  3RK3 D;  4FND A;  3P7K A;  4F47 A;  3AEA C;  2B9B A;  2M3E A;  1IFM A;  2QEX P;  4RES B;  1N73 A;  2XKM A;  2ZT9 C;  1QL1 A;  1HNU A;  3Q3D A;  2OYI A;  3V2P A;  3PGQ A;  4PV1 C;  4JYB A;  2Q5U A;  4U3F J;  3CXH D;  1RJN A;  1CSB A;  3JCU E;  2BCC D;  4JYL A;  1KYO I;  5INI A;  1QVF O;  4C7R A;  5AW7 B;  3TNU B;  3STA A;  1L0L D;  3AED C;  3VMA A;  3B71 A;  2UZF A;  2NZ2 A;  1DEE G;  1FDI A;  4WB4 A;  1GDT A;  4JOT A;  5DU4 A;  3WG5 A;  1SQP K;  1M8O B;  3P85 A;  5BU5 A;  2HYN A;  2VRS A;  4FJW D;  2YKP A;  2RMZ A;  3U9R B;  3H1H D;  2WTB A;  4Y28 J;  1G1J A;  2C0X A;  3ZW9 A;  1X22 A;  1KFN A;  2G8Y A;  3IB9 A;  3Q0J A;  3ST9 A;  4MOU A;  3PRJ A;  5DU8 A;  1LT9 C;  1S9K D;  3L73 J;  1NZY B;  2E74 B;  1XO6 A;  3SWY A;  3C9I A;  3C1L A;  4H44 B;  3U9S B;  1IFJ A;  3OME A;  4IL6 E;  4HDT A;  4I52 A;  2QM7 A;  1BCC E;  1OVV A;  5DL1 A;  5KKZ C;  2A45 G;  2L91 A;  4RO0 A;  2VSS A;  5KJP A;  2I1J A;  3TRR A;  1IFD A;  1KIL C;  3EQ2 A;  4H13 D;  1SQQ D;  3PP5 A;  1GK6 A;  1Q90 D;  2V7Q J;  3HD7 B;  1ZV8 A;  3LW5 H;  3T8A A;  4GM2 A;  4GOE A;  1M7L A;  3L72 E;  3T97 A;  2M0B A;  1P84 I;  3RL0 C;  1ZME C;  1SQV D;  4KJM A;  1XNW A;  2V4H A;  5CBO A;  1Y9B A;  1NVO A;  2X58 A;  1VF5 C;  2R5D A;  2M5A B;  2BEQ D;  1NU1 K;  2C0W A;  2CPS A;  3HE5 A;  5GTH H;  3CWB E;  2PRR A;  1NU1 G;  3L3S A;  1N8R Q;  4ZU2 A;  1OIP A;  2QA4 P;  1OWA A;  1OZH A;  2YXQ B;  3JU1 A;  1JY2 P;  1RF0 C;  4C7N A;  2W3P A;  3WMM 0;  3CC4 P;  3R2P A;  3RSI A;  1GK4 A;  4YTP C;  2WPS A;  1J1E B;  1DX7 A;  5H2F H;  3VYI A;  4ELW A;  3PEA A;  4WWI A;  1LT1 A;  2KZI A;  3CX5 I;  4H44 D;  3V5I A;  3M0D C;  2AEM A;  1N7S B;  1SG4 A;  2A81 A;  1MKM A;  4TLF A;  2K37 A;  3KZI H;  1AQ5 A;  1JXZ A;  3H1J G;  3MGN A;  2D3T A;  1VQ6 P;  4I7Z B;  5AVR B;  1J7X A;  3L74 D;  3RST A;  2NPS B;  1SFC B;  3CME P;  3L72 D;  1FS0 E;  5E0S A;  3V2N A;  1SQQ J;  3IBB A;  3PTZ A;  1GZL A;  1FZE A;  3CMA P;  3GLM A;  3KTH A;  3MYB A;  2FBM A;  2YMK A;  3AE8 C;  3G4S P;  4GHN A;  4B86 A;  4UB8 H;  1SQV J;  3R4Y A;  1HJ0 A;  4IFM A;  3A0H H;  1PGP A;  3L75 G;  4EYY Q;  1JCC A;  5JBW A;  1BCC G;  2GA1 A;  2O1J A;  2LR2 A;  2JP3 A;  3TGU J;  3VMZ A;  3EFG A;  1PL5 A;  3KXD A;  5APS A;  2K1A A;  2IFM A;  1KC8 Q;  3D70 A;  4JCS A;  4ASV A;  3L71 G;  4MN4 C;  1EY3 A;  1EQ7 A;  4H0L D;  1M1J B;  1NU1 J;  3D6Y A;  1NKZ B;  1H89 A;  1VQ8 P;  1AVY A;  2PP6 A;  2QJY B;  1LWU A;  1PGQ A;  3I47 A;  2GUV A;  3OW2 O;  3USS A;  3Q1T A;  3PJS K;  2A45 H;  5BVZ A;  3CD6 P;  3N6R B;  2IZ1 A;  4D6T D;  2QIW A;  3CCS P;  4L6W A;  2W6J H;  1UII A;  2ZXX A;  3CCM P;  3B5N B;  5H2F E;  1WDL A;  1Z56 A;  3M6M A;  2IYP A;  2A06 E;  2YO3 A;  3SFE C;  5C9G A;  1CI6 A;  4DI1 A;  1SQX K;  1VQK P;  3JSV C;  1X9V A;  1Q82 Q;  4NPD A;  1IFP A;  1SLQ A;  3EFF K;  1FZC B;  3PLN A;  4PD4 I;  4QMA A;  2K88 A;  4Z0M A;  3P8C D;  3K50 A;  3CI9 A;  4ZKU A;  1A02 F;  1VL2 A;  1YIJ P;  3H1J J;  3OAK A;  1PIX A;  1W2B O;  2N1T C;  2JWA A;  3BPT A;  3MHV A;  1DEB A;  1ZXG A;  3O8Z A;  3O6Q A;  3B5N A;  2OYI C;  3T97 B;  5AVW B;  5M1B A;  2BZR A;  4GT1 A;  4UB8 E;  1NTK E;  3FWL A;  1JOC A;  5G1S A;  1MZ9 A;  3M6N A;  1VQP P;  2IBZ D;  1URQ C;  2OTK E;  1L0N E;  4OWF A;  5KAF H;  1FDM A;  1BGY D;  5CJ4 A;  1VQM P;  4K3W A;  2V7Q H;  3ZW8 A;  3U1A A;  1NTZ G;  3FGA D;  1J1D C;  1ZP0 C;  4ZNC A;  4IZD A;  1Q86 Q;  3RL0 D;  3JC2 2;  5KLV J;  4K29 A;  4JQ0 D;  1GD2 E;  3L74 G;  2LXB A;  2YIU B;  3AE6 C;  3FXE A;  4IFF A;  3G64 A;  1GW3 A;  3IAV A;  4RCN A;  2W6A A;  1M90 Q;  5FIF A;  3TK1 A;  1RE4 A;  1OX3 A;  3H1L J;  2FW2 A;  4YLH A;  2Z5H A;  3AE4 C;  3AEG C;  1RQU A;  3M0D A;  3CC2 P;  3GHG C;  3WU2 H;  1OD4 A;  5CTC A;  1BCC J;  1LNQ A;  2FYU E;  1LTB C;  1KD1 Q;  1IK7 A;  1KQG B;  4U3F G;  2F9Y A;  4ZDF A;  3Q5S A;  1LTJ A;  2IPP A;  4NAR A;  1LWU B;  3W68 A;  4IL6 X;  1NAY A;  4KWB A;  3L73 E;  1CW5 A;  5AVZ B;  1H8A A;  4GOD A;  1SQP E;  1ZRT D;  1DIP A;  3FXD A;  2YJG A;  1G2C B;  3IR9 A;  4EI2 A;  4ELS A;  4WCZ A;  3Q7H A;  2HFE D;  1L4A B;  3H1I J;  5CBN A;  1ZW0 A;  3MUD A;  2KB7 P;  3L70 D;  1U7M A;  5KLV K;  1RHZ B;  2QM8 A;  4N6J A;  2E74 D;  2SPZ A;  1RF1 B;  1SS1 A;  3RRV A;  3N4X A;  3BEZ A;  1EF9 A;  1N7S A;  1NTK D;  3SLL A;  2RH0 A;  1TYF A;  4HYT B;  2J58 A;  3PH0 A;  5AW6 B;  4JYJ A;  3H25 A;  4L76 A;  3ZWA A;  1HF9 A;  2N9B A;  2H7H A;  2OTJ P;  3M9Q A;  1H88 A;  3S4R A;  2NP9 A;  1S5L E;  2P2U A;  3C8V A;  3EWK A;  3AE2 C;  2PPY A;  3NJB A;  3H1I E;  3L35 A;  3S9O A;  3F89 A;  2Q3E A;  1USE A;  3LAO A;  1HNO A;  2F6Q A;  2CE3 A;  1IK9 A;  4QIJ A;  4Y99 B;  1K04 A;  1R5S A;  2RN0 A;  2JKV A;  3PE8 A;  3H1L D;  3HUS C;  4W7Z A;  1URQ B;  4LLH A;  2FYU J;  1PZQ A;  1MJ3 A;  4ELX A;  3M06 A;  2H8P D;  1YYC A;  1L0N K;  4G2R A;  1PP9 G;  3P2L A;  4JFC A;  4JJT A;  1TU3 F;  4LGD E;  5MGB A;  1HGZ A;  3I56 P;  1J1D B;  1EZV E;  4EMM A;  3CLQ A;  4OGQ C;  2MJZ A;  1SFC D;  2WIT A;  5DU6 A;  1EF8 A;  2B87 B;  1SQX J;  2A45 I;  2Y0D A;  5CTB A;  5KAI E;  1SQV G;  5B66 H;  1HBW A;  2K9Y A;  2ZQR A;  3L74 J;  4Q1I A;  1NTZ E;  1U7J A;  2K9J B;  3L72 J;  1XTG B;  2FYN C;  3SSU A;  4D6T G;  3HD7 A;  1LT9 B;  1HZD A;  1BSH A;  1GMJ A;  3R9Q A;  4PD4 H;  1PV3 A;  4ZMD A;  2HLO A;  3IFM A;  4MI2 A;  1NTK J;  2FYU K;  1X0T A;  5KKZ B;  3HLN 1;  5KDR A;  1Q7Y Q;  1KYO D;  1ZLL A;  5C90 A;  1L4A C;  1XNY A;  3RK2 B;  3B8E B;  1FJK A;  3H1I G;  5CMZ A;  5JBX A;  3QH9 A;  4OG1 A;  2Q7C A;  4I2L C;  1M56 D;  4OVN F;  2WT7 A;  1KYO E;  1D7M A;  1Y47 A;  1YHQ P;  3AE7 C;  1N73 C;  1L0L E;  1FCF A;  1GL2 C;  3SWK A;  1XTC C;  1FC2 C;  1T2K D;  1NAF A;  2DUB A;  2ZT9 B;  2WTY A;  3FX0 A;  3ZWB A;  3BPP A;  1M1J A;  3CWB J;  1N7S D;  1M57 D;  1VQ4 P;  3L36 A;  3LKE A;  1EZV G;  3MZW B;  4NPF X;  1PP9 E;  2CPB A;  1KQS O;  1BGY G;  1IFN A;  4I1L A;  1FC6 A;  1NTZ D;  4HB1 A;  4PJ0 H;  1JY3 P;  4MXI A;  2WPQ A;  4AYC A;  3MOY A;  1JNM A;  1PGJ A;  2FBW C;  2JEE A;  5C39 A;  4BRY A;  4KHX A;  5APQ A;  1KFM A;  1JMB A;  1L0N J;  5AVX B;  2OYH A;  3M9B A;  2I8D A;  3BCC G;  3CCQ P;  3HE2 A;  4FN7 A;  1QL2 A;  4L8K A;  3IAO A;  1GU4 A;  2KSE A;  3A2A A;  2E5Y A;  3H1K G;  4L74 A;  3R6H A;  1NO4 A;  5TJH A;  1SQQ K;  4OGQ B;  4HNK A;  3A7O A;  2O01 H;  2K9J A;  4ZDE A;  1YG6 A;  1A02 J;  1K73 Q;  3WUV A;  3P32 A;  5APY A;  1DD3 A;  4WZ8 B;  1KV4 A;  1WDK A;  3ITK A;  1SQQ E;  1YJN P;  4HC8 A;  2FXM A;  4FZW A;  1OMI A;  2IFN A;  1H0T A;  1FC9 A;  1BDD A;  3HE5 B;  2EJ5 A;  3Q0G A;  3A5T A;  4NNQ A;  3VTP C;  3CX5 E;  4K2N A;  2CK3 H;  2QJK C;  4WY4 B;  4EOT A;  1Q2N A;  1O8U A;  4C7N B;  4ZDD A;  2A7S A;  1SQP G;  4FNB A;  1VF5 B;  5APT A;  1K05 A;  3TF5 A;  2FYZ A;  2E76 C;  4UB6 H;  1UIY A;  1OVU A;  4EDF A;  5E79 H;  3P8M C;  1NTZ J;  2CBY A;  2NPS A;  2FFD A;  2JDI H;  2FKW B;  1OW7 A;  2J5I A;  2QJY C;  5KAF E;  1J1E C;  1ZRT E;  1QX8 A;  1SQB G;  1FZF A;  2F6I A;  3GF7 A;  2F9I A;  3LW5 J;  4W80 A;  2D2C B;  2L5G B;  3G6E P;  4IZC A;  1L0L K;  2Z5I A;  1KB9 D;  3B5N C;  3II6 A;  4IL6 H;  2N1T A;  1FZB A;  1NHL A;  5E79 E;  1KIL E;  1NTM E;  1IZN B;  4NEK A;  3OA7 A;  1ZOY C;  1T6A A;  4JCR A;  1RE3 C;  3TVU A;  3E1R A;  5AVU B;  1GTW A;  1QEX A;  4QFE A;  3PZK A;  5CHX A;  2NPS C;  3R0O A;  3NJD A;  1NTZ K;  1OVR A;  1NWQ A;  2GTR A;  1L4A D;  3NTN A;  2ZYA A;  1LTJ B;  4QII A;  2B89 A;  3T3W A;  4DCK A;  1NGM B;  2WWW A;  1URQ D;  3Q1M A;  2VSS F;  4L73 A;  3NMD A;  1LT9 A;  2IBZ E;  1T2K C;  2ZL2 A;  3BRT B;  2KS1 B;  1JCD A;  2HOD A;  3V5B A;  3TNU A;  2W8Z A;  1JY3 N;  1E5W A;  2VSS E;  4DT0 A;  4JWV A;  1RY3 A;  4B3I A;  1USD A;  2AXT H;  4RYF H;  1SQP J;  3AE1 C;  4O9B A;  4ZKP A;  5EFW B;  2FY8 A;  4CPG A;  5K5G B;  1PFI A;  1EZV D;  5CJ0 A;  4U7J A;  2PAJ A;  1BE3 E;  3E7K A;  1FAV A;  3ABV C;  4YPC A;  2R5B A;  2WSE H;  3VMY A;  1YTZ T;  4EMP A;  2M5A A;  2OGU A;  1SQQ G;  2GM4 A;  3GHG B;  3BVH A;  5AW2 B;  3D71 A;  2Y9Y A;  1T3J A;  1YQ3 C;  1XNV A;  1LWU C;  2OYH C;  1KZU B;  2UWJ E;  2WSC H;  3N7N A;  3H1K E;  2M3B A;  2WQY C;  3L75 J;  3L70 E;  4JYC A;  3TZ3 A;  3A0B E;  1PPJ E;  3B4S A;  2NPS D;  2YXR B;  5B66 E;  4LC1 A;  5KLV E;  1IC2 A;  2QQ3 A;  3H81 A;  1UYS A;  3LID A;  1FJP A;  1SQB K;  1S1C X;  1PP9 D;  1OW8 A;  2VSU C;  5TIS E;  3TSI A;  2N1T B;  1NYH A;  2HOD B;  1MUU A;  3KQF A;  4Q0G A;  2Y9Z A;  4TT3 H;  4WYO B;  4W7Y A;  2F9Y B;  1NOH A;  4DOJ A;  3B5N D;  4NPE A;  5HUQ A;  2BCC G;  1SQX G;  3HTK A;  2IX7 C;  4PV1 B;  2FXO A;  3NXS A;  3PHL A;  1L0N G;  1GL2 A;  3RL0 B;  2E75 C;  2IDB A;  1T3U A;  1HH0 A;  1NJI Q;  1RQV A;  1SQP D;  2C9L Y;  4D6T J;  4PD4 D;  2IBZ I;  1Y8A A;  1H0T B;  3V4W A;  3H1K J; 
#chains in the Genus database with same CATH homology
 3OC7 A;  3MFM A;  2K9Y A;  2VSS A;  2ZQR A;  2J5I I;  5KJP A;  1WMK A;  2Q34 A;  3TRR A;  4Q1I A;  2H89 C;  3GKB A;  4KNP A;  4H13 D;  3TT7 A;  2FYN C;  3QMJ A;  1Q90 D;  2V7Q J;  4KT0 J;  3T8A A;  4GM2 A;  3Q5P A;  3SFD C;  1XX4 A;  4H0L B;  5G1R A;  2C8T A;  2E75 B;  1ZME C;  1HZD A;  4I42 A;  1GMJ A;  1XNW A;  3R9Q A;  4B3H A;  1PV3 A;  1KTM A;  1SZO A;  3AEF C;  3QK8 A;  4MI2 A;  4OMR A;  1Y9B A;  4R4M A;  5L8R J;  2X58 A;  1VF5 C;  2VRE A;  4ZDB A;  2QJP C;  2BEQ D;  3HLN 1;  5ING A;  5KDR A;  4Z1M H;  3L3S A;  4ZU2 A;  4GDO A;  5C90 A;  4R4L A;  2ZL4 A;  3QXZ A;  3JU1 A;  1XNY A;  3R9T A;  3ISA A;  3GMA A;  5KLI C;  2W3P A;  5JBX A;  4OG1 A;  3GF3 A;  3RSI A;  5INF A;  3QRE A;  3KTG A;  4YTP C;  3QWD A;  3AE7 C;  1FCF A;  1VF5 D;  4U0G A;  2DUB A;  4ELW A;  2ZT9 B;  1EXI A;  2ZL3 A;  3PEA A;  4RYF A;  4OGQ D;  4H13 B;  3ZWB A;  3K8X A;  1DD4 A;  3BPP A;  1WDM A;  1K32 A;  4H44 D;  4JVT A;  3AE5 C;  3U9T B;  3V5I A;  3LKE A;  3SWX A;  4JCQ A;  1KMI Z;  3TDC A;  3H0U A;  3D6Z A;  1SG4 A;  5DTP A;  2A81 A;  1MKM A;  1AJY A;  1FC6 A;  2WSF J;  1JXZ A;  4MXI A;  4ZDC A;  3MOY A;  2D3T A;  4LK5 A;  4I7Z B;  2FBW C;  1J7X A;  3TVW A;  3RST A;  2DEO A;  5E0S A;  3IBB A;  3T8B A;  3TLF A;  5DUC A;  2QSI A;  2VX2 A;  1UYV A;  3HE2 A;  3GLM A;  5DTW A;  3AE9 C;  3KTH A;  4FN7 A;  3MYB A;  4L8K A;  2FBM A;  3IAO A;  2ZL0 A;  1S5L X;  2YMK A;  3AE8 C;  4GHN A;  1N6D A;  2WSC J;  3R4Y A;  3R6H A;  1HJ0 A;  4U0H A;  4OGQ B;  3H0S A;  4HNK A;  1KOR A;  4ZDE A;  1JB0 J;  1YG6 A;  3T89 A;  2FZS A;  5G1Q A;  2BEZ F;  5JBW A;  2VSU F;  2JP3 A;  1NZY A;  4FZW C;  4WZ8 B;  1DD3 A;  1PL5 A;  1UYT A;  1WDK A;  3D70 A;  4JCS A;  1EY3 A;  4HC8 A;  4FZW A;  4U18 A;  1OMI A;  3FF6 A;  4RKU J;  4H0L D;  1Y7O A;  1U57 A;  2PBP A;  3D6Y A;  1FC9 A;  2EJ5 A;  3Q0G A;  4NNQ A;  3H0J A;  1EXJ A;  4K2N A;  1ON9 A;  3I47 A;  2QJK C;  3Q1T A;  2D2C C;  1PJH A;  3N6R B;  1O8U A;  2QIW A;  4L6W A;  4ZDD A;  2A7S A;  4FNB A;  1VF5 B;  3R9S A;  4JSB A;  1K05 A;  4J2U A;  5DZK H;  3TV5 A;  2E76 C;  1WDL A;  4KPK A;  2OQQ A;  4U19 A;  1DCI A;  1UIY A;  3M6M A;  3SFE C;  3KTJ A;  4JCT A;  2J5U A;  5C9G A;  4FN8 A;  4DI1 A;  3Q2Y A;  2CBY A;  3BF0 A;  2ZT9 D;  1W2X A;  1YG8 A;  4Z0M A;  1OW7 A;  1X0U A;  2J5I A;  3V5E A;  2QJY C;  1ZRT E;  3K50 A;  2JO1 A;  2WPV B;  2WSE J;  3H02 A;  2F6I A;  3MT6 A;  4H13 C;  3GF7 A;  2MKV A;  2F9I A;  3LW5 J;  5DZK A;  2D2C B;  5DKP A;  1VL2 A;  3QKA A;  3FDU A;  1PIX A;  5E0S H;  1OD2 A;  3BPT A;  5E0N X;  3RL0 g;  1N6E A;  4IZC A;  3O6Q A;  3VIV A;  2YIU C;  1N6F A;  3T97 B;  5M1B A;  2BZR A;  1KIL E;  5G1S A;  3M6N A;  2J5I B;  4NEK A;  2PG8 A;  1ZOY C;  4JCR A;  3TVU A;  4B3J A;  3AE3 C;  2ZQQ A;  2E74 C;  5IKL B;  4K3W A;  4QFE A;  2P10 A;  2G3A A;  3PZK A;  4H44 C;  3ZW8 A;  3IN6 A;  3R0O A;  3NJD A;  3FGA D;  1ZP0 C;  1OW6 A;  1KQF B;  4IZD A;  2Q2X A;  1R8E A;  2GTR A;  2J5S A;  2VSU E;  4I4Z A;  2E76 D;  4QII A;  1VRG A;  3KTI A;  4K29 A;  1K39 A;  3T3W A;  1NGM B;  2VSS F;  1TG6 A;  3Q1M A;  3HIN A;  3AE6 C;  3HP0 A;  3G64 A;  4YXD C;  2ZL2 A;  3IAV A;  4RCN A;  3TT6 A;  5FIF A;  4ASI A;  2HW5 A;  3AEE C;  2H88 C;  2FW2 A;  4YLH A;  3AE4 C;  3AEG C;  1Q51 A;  1UIX A;  1RQU A;  2J5G A;  1ON3 A;  2F9I B;  4EML A;  3G9R A;  2J5G D;  3DJA A;  1FDO A;  1OD4 A;  2A7K A;  5CTC A;  2VSS E;  4H0L C;  4JWV A;  3HRX A;  5KDR B;  4U0G H;  1IK7 A;  1KQG B;  4B3I A;  2F9Y A;  4RYF H;  4ZDF A;  3Q5S A;  3Q5R A;  3AE1 C;  4NAR A;  4IL6 X;  3DOR A;  4KWB A;  4OLQ A;  4FB8 A;  4U7J A;  4KD6 A;  3QYR A;  3ZWC A;  1DIP A;  2YJG A;  2FXP A;  3QXI A;  4ELS A;  2IEX A;  4WCZ A;  3Q7H A;  3OT6 A;  4PV1 D;  2E75 D;  3T88 A;  5DUF A;  3ABV C;  4FND A;  4EMP A;  4F47 A;  2E74 D;  3AEA C;  3RRV A;  3BEZ A;  3AEB C;  2E76 B;  3D71 A;  1EF9 A;  2ZT9 C;  5FUS A;  1HNU A;  1YQ3 C;  3Q3D A;  1XNV A;  3H0Q A;  4XFJ A;  3SLL A;  3PGQ A;  1UYR A;  1TYF A;  4JYJ A;  1RJM A;  3H25 A;  4PV1 C;  3RK3 E;  3ZWA A;  1HF9 A;  2WQY C;  3KTK A;  2D2C D;  1RJN A;  3TZ3 A;  4JYL A;  5INI A;  1Q52 A;  3STA A;  2NP9 A;  2QQ3 A;  3C8V A;  3EWK A;  2X24 A;  3H81 A;  3AED C;  1UYS A;  3B71 A;  2UZF A;  2NZ2 A;  1YQ4 C;  3AE2 C;  2PPY A;  3NJB A;  1FDI A;  1S1C X;  3S9O A;  1OW8 A;  2VSU C;  4JOT A;  5DU4 A;  3WG5 A;  1NYH A;  3P85 A;  3KQF A;  4I7Z C;  3LAO A;  1HNO A;  4Q0G A;  4TT3 H;  4WYO B;  2F6Q A;  2O01 J;  4FJW D;  1WZ8 A;  1FC7 A;  2F9Y B;  2CE3 A;  3U9R B;  4QIJ A;  2WTB A;  4Y28 J;  1K04 A;  3PE8 A;  5HUQ A;  1DUB A;  3ZW9 A;  2G8Y A;  3P5M A;  4ELX A;  4PV1 B;  1MJ3 A;  3IB9 A;  3Q0J A;  4IZB A;  3ST9 A;  4MOU A;  5DU8 A;  5CTB A;  4G2R A;  1NZY B;  2E74 B;  3P2L A;  1XO6 A;  4JFC A;  4JJT A;  1TU3 F;  4U1A A;  2E75 C;  2IDB A;  4H44 B;  5MGB A;  3U9S B;  2Q35 A;  1RQV A;  3OME A;  4HDT A;  4I52 A;  4EMM A;  4OGQ C;  3AEC C;  5DU6 A;  1EF8 A;  5DL1 A;  5KKZ C;  2VSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...