3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
5G1SA 2EJ5A 1XX4A 4KWBA 1UIYA 1K32A 3TRRA 1WZ8A 3NJBA 3R9TA 2PBPA 3BEZA 3GLMA 3KTKA 2J5SA 3P85A 2GTRA 2F6QA 3H0JA 5G1QA 4I4ZA 3H0SA 2C8TA 3WG5A 4U1AA 3SWXA 3VIVA 4JCQA 3IBBA 3V5IA 4QFEA 4ELSA 3ZWAA 4HC8A 5DL1A 4MOUA 4JJTA 3QXIA 3QKAA 1TYFA 3Q1TA 5DTWA 1OD2A 4FJWD 5CTCA 5G1RA 3R9SA 4MI2A 3PE8A 3R9QA 3P5MA 3BF0A 4YLHA 2VSUE 3Q0JA 4HNKA 2FW2A 1OD4A 5DU8A 3HE2A 3U9SB 4LK5A 5JBXA 1WDMA 5FIFA 4EMLA 1XNVA 2FBMA 4QIJA 4ASIA 2IEXA 2F9YB 2A7KA 3RSIA 4JOTA 2J5IA 3TDCA 3TV5A 1Y7OA 2NP9A 3ST9A 4ZDFA 3BPPA 1NZYB 2WTBA 4NNQA 3KTIA 3OC7A 5E0SA 3HRXA 4OG1A 2QQ3A 3GMAA 4JCTA 1ON9A 3U9TB 5E0NX 4FNBA 2X58A 3SLLA 1PJHA 3Q0GA 4I42A 1Q52A 3TVUA 2A81A 3ZWBA 5E0SH 5DKPA 3QWDA 4MXIA 3TT7A 4F47A 1YG6A 1UYVA 3QREA 3M6NA 4KD6A 4JFCA 3K50A 3DORA 3KTGA 2ZL4A 3GF7A 2VSUF 3JU1A 3HINA 1WDLA 2W3PA 3TVWA 1ON3A 3T88A 3MT6A 5JBWA 1FC6A 3G64A 3I47A 3PZKA 3T3WA 2PG8A 3K8XA 3ISAA 3Q7HA 4DI1A 4JYLA 3T8AA 5DUFA 1VRGA 1W2XA 1RJNA 1MJ3A 1Q51A 1UYTA 3IB9A 4KPKA 4RCNA 2PPYA 2F9IB 3H02A 4B3JA 2FZSA 3QYRA 2Q34A 1HZDA 1HNOA 4FN7A 3T8BA 1X0UA 2VREA 4IZDA 4IZBA 1K39A 5KJPA 3MOYA 4FNDA 5INIA 3NJDA 2ZL0A 1PIXA 4U18A 3KQFA 4JSBA 5MGBA 4GHNA 4ZDDA 1EY3A 5DTPA 4ZDCA 2F9YA 4Q1IA 3QXZA 3M6MA 3PGQA 5KDRB 5CTBA 4U0HA 1NZYA 3HLN1 1N6EA 2VSUA 3ZW9A 2Q2XA 2BZRA 5INGA 1FCFA 2VSSF 3T89A 4FB8A 4JWVA 4JVTA 1J7XA 3L3SA 3N6RB 4Q0GA 3RRVA 3U9RB 3IAVA 3KTJA 1O8UA 1EF9A 3ZWCA 3QK8A 1DCIA 2A7SA 3MYBA 5C90A 4FZWA 4I52A 4B3IA 5IKLB 4WCZA 1EF8A 4KNPA 3RSTA 2UZFA 3STAA 2F6IA 2J5GA 2J5GD 3LKEA 1XNWA 3H0UA 1JXZA 4K29A 4B3HA 2X24A 2VSSE 1N6FA 4EMMA 3OT6A 5INFA 5DU6A 1DUBA 4OMRA 2Q35A 4JCSA 1WDKA 4K3WA 3MFMA 2ZL2A 3FF6A 1UYSA 5C9GA 1RJMA 4L6WA 3ZW8A 1YG8A 2CE3A 3TT6A 3DJAA 2ZQRA 2F9IA 4ZDEA 4ELXA 1N6DA 2VX2A 4JCRA 3QMJA 2HW5A 2VSSA 3LAOA 4QIIA 2VSUC 4ZU2A 3TLFA 3GKBA 4L8KA 3PEAA 2ZQQA 3TZ3A 3H81A 1XNYA 4WZ8B 3OMEA 4NEKA 1FC7A 4G2RA 2J5IB 2CBYA 1SG4A 4FN8A 5DU4A 2ZL3A 3R0OA 4WYOB 5KDRA 5DZKA 4FZWC 4IZCA 4K2NA 1UYRA 2J5II 3R6HA 1SZOA 3V5EA 4ELWA 4GM2A 3P2LA 3KTHA 5FUSA 4Z0MA 5DUCA 2DUBA 1FC9A 5DZKH 4U0GA 4RYFA 3HP0A 4ZDBA 1XO6A 2D3TA 3FDUA 4JYJA 4OLQA 3GF3A 1TG6A 3H0QA 1HNUA 4U0GH 4U19A 4RYFH 2DEOA 4EMPA
chains in the Genus database with same CATH superfamily
1M1KQ 2NZ2A 2EJ5A 1UIYA 1T3JA 4WY4D 1K32A 5EFWB 3TRRA 3R9TA 4H13C 1VF5D 2L91A 3VMAA 1L0NJ 2GTRA 2B88A 3KPEA 1EDLA 1H89A 4D6TE 4OGQB 1KZUB 1OW7A 3JSVC 4EIJA 2MKVA 4QFEA 3VTPC 2WPQA 2ZYDA 3V2NA 3CCMP 3H1KE 2QE7H 4JJTA 1NTZK 3CCVP 1MFTA 2CPBA 5GTHH 1KV4A 1TYFA 5B66E 5APWA 3AE8C 4EOTA 4FJWD 2QJKC 2Z5IA 2WQYC 3R9SA 3AEEC 1SQXE 2E76C 3HD7D 3R9QA 5TJHA 1BDCA 1JY3N 5KTBA 3BF0A 2KZJA 3EWKA 1N7SC 4YLHA 3EFGA 1SQVK 1KQGB 2N9YB 5DU8A 4PV1C 4LK5A 3CX5I 4ZKPA 2ZT9D 5FIFA 1RE3A 2KYVA 3L72D 3W68A 1UIXA 2IZ0A 1FDMA 1Y7OA 1NVOA 3L73E 4ZDFA 5CJ4A 3E1IA 3ZDMA 1NZYB 3AE4C 1GL2C 2OYIB 3L71E 4JCTA 2R3SA 1ON9A 1M1JA 2KLUA 2K3RA 5DJTB 4FNBA 5TISE 3L72G 1S3JA 1BSHA 1YI2P 2V4HA 3NFQA 2WTYA 3TVUA 1IC2A 1T2KD 4WBAA 4I7ZB 1PP9J 4MXIA 1YG6A 1JMMA 3D6ZA 1FJPA 3KZIH 3EFFK 3M6NA 2K88A 3SFDC 3HE4B 3EQ2A 4KJMA 3FWLA 1QVFO 3KTGA 2J58A 4IOIH 2W27A 1ZRTE 1NTZE 1WDLA 2W3PA 2QA4P 3TVWA 3D6YA 2FYUD 3TGUJ 1JOCA 3B5NC 5JBWA 1HTLC 3G64A 1URQC 3CX5E 1S9KE 4K3AA 4OVNF 3I47A 3A7OA 3G3ZA 1OVUA 3TF5A 1Z56A 1SQVE 4OGQD 1IZNB 2FYUG 3BASA 3JCUE 1E79H 1W2XA 1RJNA 2WSFH 4ZKUA 1Q51A 4NARA 3KHUA 2QG4A 4ASVA 1UYTA 3HD7A 1NKZB 4RCNA 1Y9BA 2F9IB 3H02A 4B3JA 2OTKE 3S4RA 2Q1KA 3QYRA 2IYOA 3PH0A 5CCGC 1M90Q 3BVHA 3KQGA 5KAIE 2KNCB 1MV8A 1X0UA 2E42A 3VMZA 5CBOA 1AJYA 1D7MA 1VQLP 2ZXXA 1USEA 1KILA 2O01H 3LW5H 3NJDA 2A45I 1PIXA 1NHLA 2O01J 3H25A 2KOGA 1S72P 4D6TJ 4GHNA 3RK2B 1EZVI 3IAOA 3H1LD 5GTIE 3HE5B 3M6MA 2OGUA 5KDRB 3H1KJ 4U3FD 3OW2O 1N6EA 1EDIA 1YQ4C 2Y9ZA 1RF0C 2VSSF 1HGZA 4JVTA 4WWIA 4HDTA 3N6RB 4Q0GA 3CL3D 1T3UA 1FJKA 3H1LG 4H44C 2YXQB 3IAVA 2NPSC 5BU8B 3H1IE 3PTZA 4IL6E 3KTJA 2IFNA 1HVVA 1EF9A 1IFPA 1L0LD 5APXA 4GIFA 1QEXA 4U3FG 1P84I 3SWYA 3MYBA 2P1JA 1L0NK 1VQPP 3GHGA 1CZQA 1EF8A 3GW6A 1W5CE 4KNPA 4W7YA 2UZFA 1L0LG 5KJ7A 2FYUK 2R5DA 4HB1A 3A5TA 1L4AB 5APYA 1RF1A 3CXHD 3H0UA 3Q2YA 1SP4A 3L71J 5TISH 1N6FA 4I1LA 3RL0g 5KLVD 1OXZA 4GOFA 1K73Q 5DU6A 1DUBA 4GT1A 4QMAA 4OMRA 2Q35A 2ZL2A 1YITP 1UYSA 5C9GA 2K9YA 4BRYA 1GU5A 1USDA 2KI7B 1EXIA 2D2CB 3DJAA 3L75E 1YYCA 4AQRD 1H0TA 4ZDEA 3WU2E 1IK9A 5KLVG 1FZCC 1NTZJ 2VX2A 2VSSA 1NTMD 4QIIA 3CX5H 1NO4A 3NMDA 1EQ7A 4L8KA 3VMXA 3OMEA 1JCCA 1KB9D 3P8CE 3RK3B 4OH8B 2M3BA 1BGYD 2POHA 2WPVB 2RKLA 1EXJA 4IFMA 1SQVJ 3RK2D 1N7SA 1SG4A 1L0NE 1NTMG 3JCUH 2ZL3A 2BASA 4IZCA 1M1JB 3R6HA 4DCKA 1BGYG 1OW6A 1J1DC 1L2PA 2FYUE 4N6JA 2Q9IA 3U1CA 5KAIH 2P67A 1L0LK 1YJ9P 1N73C 1U7JA 1AV1A 2Y0CA 4ZDBA 1M57D 1GL2A 2D3TA 3HTKA 3CCEP 4HH2A 2HPCA 2FFDC 3QWOC 3H0QA 3JC22 4PD4D 4H0LC 4U0GH 1E5WA 1GTWA 5AW0B 1LTJB 1NAFA 5GTIH 2QVAA 4R4MA 1DD3A 2Y0EA 4JYCA 3VYIA 3GLMA 1FE6A 3G9RA 4GKGA 3P85A 2F6QA 3H0JA 1N2DC 4I4ZA 3H0SA 3WUUA 4JCQA 1XTCC 4BWNA 1S4XA 3V5IA 5KLVK 2KK7A 3LIDA 4IL6H 3H1IJ 4HC8A 5DL1A 4MOUA 5C39A 1AQ5A 4IL6X 2WSEJ 3B5NA 1NH4A 1URQA 3HD7B 1DEBA 3CCQP 5G1RA 2Y9YA 1NKNA 2ZYAA 4R4LA 1GW3A 4L73A 3Q5RA 3MUDC 1PP9E 3PLNA 1ZN5A 2HODA 1LP1A 2VSUE 3P8MC 2OYHC 3A3YB 4B86A 1NTMK 3CMAP 5KKZC 1OD4A 1NOHA 1RH5B 2QJYB 5KLIC 1KILB 3U9SB 5JBXA 2A45H 3V4QA 5AW6B 2FBMA 2HFED 2IEXA 5AW3B 1L0LE 2ITAA 4YPCA 3D70A 5CCGA 1JTHA 4K35A 3BPPA 3A0BE 4NNQA 1S2EA 1JMBA 4N78E 5E0SA 2QQ3A 3GMAA 1G1JA 1KMIZ 3L72J 2FKWB 1QLED 3R4YA 3Q0GA 1Q52A 3V5BA 3WU2H 2C0XA 1QGKB 2A81A 1FS0E 1LTAC 3L4FA 1KQFB 1LT9C 2K9JA 3TT7A 5HUQA 2YIUB 3TK1A 1J1EB 2XV5A 3GHGB 4KD6A 4XA4A 3K50A 2WZ7A 1RF0A 5KLVE 1NAYA 3M9QA 3JU1A 1SQQD 2NPSA 5AVQB 1RF1B 1PV3A 3MT6A 1BCCD 4Y99C 2PP6A 3PZKA 5CBNA 5AW4B 2ZFCA 1SFCC 3OAKA 1SQQG 1NTME 2YMKA 2FYUJ 3M0DC 5DUFA 1S5LE 1YTZT 1IFJA 1VRGA 2FYNC 1BCCG 2YJGA 4H13B 1MJ3A 2H89C 4WB4A 4BRYB 1YHQP 1HF9A 3AEBC 2E5YA 2IBZD 3O8ZA 3L74D 1FZGA 3UIAA 3L70D 1H0TB 1FOSF 3E1RA 2FZSA 2QJPC 2Q34A 2M8RA 3C1LA 5CCHC 2M3EA 2VREA 1FZAA 3IR9A 3M06A 1K39A 2GA1A 1VQKP 2IBZG 2RH0A 3FX0A 3L74G 3AE7C 2QJKB 5INIA 1KILD 3L70G 2Q3IA 2ZL0A 5E79E 3KQFA 2E76B 5MGBA 5AVXB 3HUSC 1N7SB 1K05A 3P32A 1FZCA 2A06D 1JY2P 2YKQA 3ZW9A 3CLQA 2Q2XA 4PD4E 3VMYA 3G6EP 2BZRA 5INGA 1FCFA 3T89A 3N4XA 4EI2A 1LJ2A 3L3SA 2P7JA 1GW4A 4C7RA 4LLHA 4N3YB 1N86A 1P84D 1MZ9A 4WVZA 3U9RB 2A06G 1JCDA 4U3FJ 3QK8A 2A7SA 5CJ0A 1SQBD 1GL2B 3FXDA 3HTKB 4JBZA 1TU3F 3WUVA 2W8ZA 2JKVA 1Q90D 4LGDE 4GOEA 2I1JA 4AYCA 3TNUA 1SQQK 3RSTA 1L0LJ 3B71A 1H8AA 2R44A 2K37A 3U1AA 5KJ7D 1HGVA 1OW8A 1SQBG 2F6IA 3STAA 1N73A 5APVA 3NTNA 1ZR4A 3A2AA 1JXZA 2WWWA 4B3HA 1Q7YQ 2X24A 2FFDA 3V2PA 1YJWP 3RL0C 3OT6A 5INFA 3BCCD 1T8ZA 3K5BA 2QRXA 3B5NB 4K3WA 1CW5A 1Y8AA 1URQB 4H13D 1RJMA 5AVTB 2J59M 1GU4A 2XZRA 3RK3E 2IZ1A 2M5AA 3BCCG 2HODB 2KS1A 5KLVJ 1LP1B 3CD6P 3H1HD 3Q3DA 1G2CA 4JCRA 5H2FE 3QMJA 2Q7CA 4ZU2A 3TLFA 1R5LA 1IFDA 3PEAA 3TZ3A 1PZQA 4WZ8B 1FC7A 1GD2E 2E76D 3H1HG 3MUDA 2O1JA 3L37A 1FZFA 1JY3O 2MJZA 1JTHB 4ZMDA 2YKPA 3H32B 1FC2C 3CCUP 1KORA 1NTMJ 1S5LH 4UB8E 1N7SD 3NXSA 5B66H 1PGOA 2OYHA 1S5LX 5DZKA 2WVRA 4PV1D 2J5II 4ELWA 1SQQE 4W80A 2H8PD 1JM0A 1R8EA 2IPPA 2QIWA 2B87A 3C9IA 2H7HA 1K8AQ 1HUCA 5DUCA 2DUBA 5AW1B 5AVVB 1SQBK 2K9JB 2OYOA 1S1CX 1GL2D 3CI9A 3MGNA 1AVOA 1TG6A 1L4AC 5E79H 1OMIA 3FGAD 2P2UA 4YXWH 1OFCX 1VQ7P 2E75C 4U19A 4RYFH 2DEOA 3Q5SA 1A02J 2O3JA 4H44B 2NPSB 5G1SA 4RKUJ 4PJ0E 1WZ8A 2ZJSE 3L74E 3NJBA 1LT9A 3L70E 2E74C 2KSJA 5CHXA 2JWAA 1UIIA 2PBPA 3OA7A 4PD4H 3FWNA 2J5SA 1PPJG 2C8TA 2W83C 2JR8A 3WG5A 3VIVA 3B8EB 2D2CC 1LWUC 3IBBA 4ELSA 3ZWAA 2Z5HA 5AW5B 2ZVNB 4GDOA 3L72E 1KILE 3QXIA 3B5ND 2QSIA 5AVYB 1URQD 2CK3H 5DTWA 5CTCA 5APQA 3H1JD 4MI2A 3KDPB 3PE8A 1SFCA 3MP7B 2WMMA 1QL1A 4A7PA 3M0DA 2WT7A 2N1TC 1PL5A 5BVZA 2L5GB 3PP5A 2FY8A 2BEZF 2OTJP 2B89A 3H1JG 4EMLA 4QIJA 1K04A 1PFIA 1T6AA 3H1KD 1WRGA 1JY2N 1SQBE 3RSIA 4JOTA 2E43A 4Z1MH 3TDKA 5CCGD 3TV5A 1FZCB 3TYYA 5CCHA 3ST9A 4DT0A 1SQXD 3KTIA 2G3AA 2QM8A 1M7LA 3VP8A 3H1KG 2X58A 1X9VA 1KYOD 2RN0A 3HUSA 1BE3D 4WY4C 1SQXG 3U59A 3QWDA 1SLQA 2WPRA 1KTMA 1VF5C 3QREA 2H43A 2Q3EA 3BCCE 2Y0DA 4JFCA 3DORA 3L73D 1J1DB 3GF7A 3RGUA 3TNUB 2JP3A 3HINA 1BE3G 3HE4A 4H44D 1N73B 2NPSD 1ON3A 4UB8H 3T88A 1LTBC 3LIEA 1W2BO 2K1AA 2FFDB 2PG8A 3L73G 1DH3A 2ZAEB 4H0LB 3Q7HA 1HH0A 1SQQJ 4DI1A 2YXRB 3CXHI 1OX3A 2WSEH 4JF7A 3G71P 4RO0A 4JYLA 3WUTA 1BCCJ 1JEKA 1N8RQ 1K9MQ 4DOJA 1KD1Q 3H1LE 2ZT9C 2J5UA 1ZRTD 3IB9A 1PGPA 1IJDB 4UB6E 2M5AB 2KS1B 4U3FE 3CX5D 1S9KD 1G2CB 1NGMB 3T8BA 1YBKA 2Q5UA 3BPTA 2OTLP 2PRRA 2WSCJ 2AEFA 4IZDA 3MOYA 3L74J 4FNDA 3D71A 3L70J 2Z4EA 2V7QJ 2JEEA 1DEEG 2ZVOB 1FDOA 2H88C 1ZR2A 2WITA 2HLOA 4ZDCA 1NTKD 2YKOA 2F9YA 4Q1IA 1T2KC 1VQNP 2JDIH 2XKMA 3QXZA 2OYHB 4J2UA 5CTBA 4U0HA 1IO4A 1GK4A 5KKZB 2KXPB 1YIJP 5KLIB 2XNXA 1GK6A 2YO3A 4IFDK 1J2JB 1N7LA 3CCJP 3TSIA 1VQOP 3VN0A 1LNQA 2B87B 2C0WA 3CXHE 5DJUB 3T97A 2FYZA 2R32A 1NTKG 4ZNCA 3RRVA 1O8UA 5AVZB 2KSEA 2BCCD 3CC7P 2WPSA 1ZP0C 5C90A 4B3IA 4YXDC 4WCZA 1ZW0A 2FXMA 3ABVC 2M0BA 4OGQC 5BU5A 1SQBJ 2IFMA 3V4WA 2BCCG 1U57A 1YQ3C 1LT9B 2J5GA 3LKEA 2IX7C 3H1JE 1KQSO 4PD4I 1XNWA 1NU1D 3A0HE 3AEDC 3H1ID 1L4AA 1X0TA 4MN4C 2AXCA 2W6BA 5AVUB 1KC8Q 3HRNA 1VQ5P 1OVVA 4H0LD 1G1IA 3CCRP 1VDFA 3W67A 2HYNA 3CWBD 2R5BA 3I56P 5APSA 5AVRB 1KB9E 1WDKA 3MFMA 2UWJE 3FF6A 1MKMA 1BGYE 4Y99B 1NU1G 4C46A 4L6WA 1Q81Q 3ZW8A 3H1IG 2CE3A 1KN7A 3BCCJ 2ZXEB 1SFCB 3TT6A 1IFMA 1HWTC 5AW2B 1LWUA 2WT7B 3MHVA 4ELXA 3CWBG 1N6DA 2FYNB 2HW5A 1Q82Q 3LAOA 1YJNP 4CPGA 2VSUC 2OYIC 3SSUA 1EZVD 1KYOE 1X79B 1RHZB 1AFOA 3RBXA 1XTGB 1BE3E 4NEKA 2ZYGA 2QJPB 3H1HJ 4NPFX 1PGQA 3MTUE 1NTKK 2A45G 3FXEA 4IFFA 4PV1B 3SFEC 4FN8A 1RQVA 2N1TA 3P7KA 4I7ZC 3R0OA 4WYOB 1SQPD 3L75D 1ZV8A 4FZWC 1EZVG 1H88A 2LKMA 4K2NA 3V5EA 1SZOA 3H1LJ 4UB6H 1Y47A 3S1KA 4GM2A 3F5HA 3KTHA 1EDKA 5FUSA 3HUSB 4Z0MA 4U0GA 3E7KA 2HPCB 1SQPG 3L75G 1AVYA 1XO6A 3P8CD 5B5EE 5APUA 2KB7P 3Q5PA 1LTIC 3N7NA 4OLQA 3Q1MA 3GF3A 3M9BA 3AE2C 3BRVB 1YTZI 1HNUA 1L0ND 1NJIQ 4ASWA 3AE9C 4AUWA 4DJGA 3A0BH 1XX4A 4HKZH 4KWBA 4WY4A 3CC4P 1VL2A 2JJLA 3PHLA 1VPCA 1NU1K 4U7JA 1LTJA 1MFZA 4L76A 2HG5D 1RQUA 3BEZA 3KTKA 3C8VA 2SPZA 5AW8B 1QX8A 1L0NG 5G1QA 1EDJA 3CXHH 3II6A 1CI6A 4U1AA 3B4SA 3SWXA 4EYYQ 4EDFA 2CPSA 4XFJA 2GUSA 3QKAA 3Q1TA 1KFMA 1OD2A 1NTKE 2WSFJ 1JNMA 1OZHA 1X8YA 1OIPA 4M3LA 3RL0B 3CMEP 1SFCD 2KUBA 4I2LC 3CPWO 3P5MA 2WSSH 3RK2C 1X22A 2Q6QA 1VQMP 2IBZI 3IFMA 3AE1C 3Q0JA 4HNKA 1RE4C 2FW2A 1Q86Q 3KXDA 3H6PA 1NYHA 3HE2A 2OQQA 3H1JJ 3A0HH 1WDMA 3AEFC 1XNVA 1SS1A 4I6MC 4ASIA 5AW7B 1DD4A 3MIWA 2IYPA 2F9YB 1NWQA 2BCCE 4RESB 2AEJA 3LW5J 2A7KA 2J5IA 3TDCA 5CCHD 4YTPC 2NP9A 3V2QA 2WTBA 1KB9H 1SQPK 3OC7A 3HRXA 5KAFE 1BGYJ 1PP9D 4OG1A 2QEXP 4TT3H 3U9TB 5E0NX 1LT1A 3T97B 1BCCE 3SLLA 4JQ0D 1PJHA 5M1BA 4I42A 1FOSE 5APTA 3ZWBA 1RY3A 4W7ZA 5E0SH 1IFNA 1NU1E 1HJ0A 1JB0J 1SQXJ 5DKPA 1DX7A 3M91A 1ZLLA 1GMJA 1AQTA 3TGUD 1PP9G 4F47A 1UYVA 3AEGC 5K5GB 1PPJD 4XE5B 3VP9A 1KYOH 4C7NA 1ZMEC 2VRSA 3F89A 2ZL4A 2OARA 3CWBE 3MZWB 2VSUF 1BE3J 4N78D 2FXPA 2I8DA 2IBZE 3O6QA 4O9BA 1HJBA 1EC5A 2BEQD 3TGUG 1FC6A 1U7MA 1MUUA 2R3CA 3BRTB 3L73J 1GDTA 3T3WA 3M9HA 4OWFA 3K8XA 2PAJA 3ISAA 3IF4A 2E75B 2B9BA 2N9BA 4KT0J 2GUVA 3BATA 3T8AA 2LXCB 1EZVE 2E74B 2PFXA 2E5TA 2KIKA 5B5EH 4NPDA 3AE6C 3KYQA 4NPEA 2A06E 4KPKA 1RE3C 2PPYA 1VQ4P 3USSA 1VQ9P 3RK3C 3RL0D 1LWUB 1HZDA 1HNOA 1SQPE 4D6TD 4FN7A 2W6JH 5AVSB 1M8OB 3IN6A 1JO5A 4IZBA 5KJPA 1OVRA 1JY3P 1P84E 3QH9A 1M1JC 2XU6A 4L75A 1OWAA 4U18A 4Y28J 2AXTE 4JSBA 2KZIA 3GG2A 1M56D 2W6AA 1EY3A 4ZDDA 1BSNA 5DTPA 4D6TG 3AEAC 2N1TB 3PGQA 3M0AA 5AW9B 3WMM0 1WMKA 5CMZA 1NZYA 3HLN1 2VSUA 2OYIA 2JWDA 2KP8A 2HR3A 3ITKA 1FDIA 1SVFA 1WT6A 2P58A 2C9LY 4JWVA 4FB8A 1FZBA 1NTKJ 2C9NY 4L74A 1J7XA 3R2PA 1HBWA 2LR2A 1QL2A 2G8YA 5H2FH 1LTJC 3I5CA 2KLVA 3ZWCA 2I1KA 1DCIA 5GTHE 3G4SP 3OJAB 4FZWA 4I52A 5IKLB 2W90A 3VOPA 3V2RA 5L8RJ 1W2EA 2FXOA 3AECC 2XNDH 3L71D 3L36A 4GODA 3MD0A 1BDDA 2BCCJ 4WY4B 2AEMA 3CCLP 2J5GD 2PGDA 1VF5B 5KAFH 3H1HE 4K29A 3HD7C 1LTGC 1A02F 1VQ8P 1L4AD 1IFIA 2VSSE 3L71G 1CI6B 4TLFA 1CSBA 4EMMA 2O1KA 2E75D 1JUNA 3PRJA 1ZXGA 4JCSA 1NU1J 3RBZA 1NTZD 2XDJA 2E74D 2QJYC 1KILC 2GM4A 1YG8A 1ZOYC 2LXBA 3S9OA 2ZQRA 2F9IA 4PJ0H 3AE5C 2WSCH 3CWBJ 2D2CD 2NRGA 4BXLA 2DW3A 3PJSK 2KNCA 1SQVD 1LTSC 2V7QH 1NTZG 2YNYA 1DIPA 2QM7A 3KZIE 2ZT9B 3GKBA 3CCSP 2ZQQA 3H81A 1XNYA 3CC2P 4KHXA 1LTTC 4G2RA 2J5IB 1R5SA 2CBYA 1SQXK 3TGUE 2RMZA 1KB9I 4LC1A 4DZOA 1FU1A 1SQVG 1PPJE 5DU4A 3HE5A 3RK3D 1AA0A 2N1TD 4JPZB 5KDRA 1KFNA 1RE4A 1FBMA 1PGJA 3H32A 2YIUC 2YO2A 1VQ6P 1UYRA 1J1EC 4HJGH 1FZEA 3GHGC 3I55P 1GZLA 4RJTA 1IK7A 3P2LA 1JY2O 4JYBA 4HYTB 5KJ7C 1FC9A 5DZKH 1LGHB 1SQPJ 3L35A 4RYFA 3L75J 3HP0A 2O01N 3AE3C 1RF1C 1KYOI 1KQLA 2IDBA 4C7NB 5AVWB 1P84H 3FDUA 2YMYA 2JO1A 1QVGO 4JYJA 1Q2NA 2P10A 1FAVA 2FBWC 2AXTH 3SWFA 3O6QB 3SWKA 4EMPA 3V6IA
chains in the Genus database with same CATH topology
5G1SA 2NZ2A 2EJ5A 4RKUJ 1XX4A 4KWBA 1UIYA 1VL2A 1K32A 3TRRA 1WZ8A 3NJBA 4R4MA 1DD3A 3R9TA 4H13C 2E74C 4U7JA 1VF5D 1RQUA 2PBPA 3BEZA 3GLMA 3KTKA 3G9RA 3C8VA 2J5SA 3P85A 2GTRA 2F6QA 3H0JA 5G1QA 4I4ZA 3H0SA 2C8TA 4OGQB 1OW7A 3WG5A 4U1AA 3SWXA 3VIVA 2D2CC 4JCQA 3IBBA 2MKVA 3V5IA 4QFEA 4ELSA 3ZWAA 4XFJA 4HC8A 5DL1A 4GDOA 4MOUA 1KILE 4JJTA 4IL6X 3QXIA 2WSEJ 3QKAA 2QSIA 1TYFA 3Q1TA 3AE8C 5DTWA 1OD2A 4FJWD 5CTCA 2QJKC 5G1RA 2WQYC 3R9SA 2WSFJ 3AEEC 4MI2A 2E76C 3PE8A 4R4LA 3Q5RA 3R9QA 3P5MA 3BF0A 3EWKA 4YLHA 2VSUE 3AE1C 3Q0JA 4HNKA 1KQGB 1PL5A 2FW2A 5KKZC 1NYHA 1OD4A 5DU8A 4PV1C 3HE2A 2OQQA 5KLIC 2BEZF 3U9SB 4LK5A 5JBXA 1WDMA 3AEFC 2ZT9D 5FIFA 4EMLA 1XNVA 2FBMA 4QIJA 1K04A 4ASIA 2IEXA 1DD4A 2F9YB 2A7KA 1UIXA 3LW5J 4JOTA 3D70A 3RSIA 4Z1MH 2J5IA 3TDCA 3TV5A 1Y7OA 4YTPC 2NP9A 3ST9A 4ZDFA 3BPPA 1NZYB 2WTBA 3AE4C 4NNQA 3KTIA 3OC7A 2G3AA 5E0SA 3HRXA 4OG1A 2QQ3A 3GMAA 4TT3H 4JCTA 1KMIZ 1ON9A 3U9TB 5E0NX 4FNBA 3T97B 2X58A 3R4YA 3SLLA 1PJHA 3Q0GA 5M1BA 4I42A 1Q52A 3TVUA 2A81A 3ZWBA 5E0SH 1HJ0A 1JB0J 1KQFB 5DKPA 4I7ZB 3QWDA 4MXIA 1GMJA 3TT7A 1KTMA 5HUQA 1VF5C 1YG6A 4F47A 1UYVA 3AEGC 3D6ZA 3QREA 3M6NA 1ZMEC 4KD6A 4JFCA 3SFDC 3K50A 3DORA 3KTGA 2ZL4A 3GF7A 2VSUF 2JP3A 2FXPA 3JU1A 3O6QA 3HINA 1WDLA 1ZRTE 2W3PA 3TVWA 4H44D 3D6YA 1ON3A 3T88A 1PV3A 3MT6A 2BEQD 5JBWA 1FC6A 3G64A 3I47A 3PZKA 3T3WA 2PG8A 3K8XA 3ISAA 4H0LB 3Q7HA 2E75B 4DI1A 4KT0J 4OGQD 2YMKA 4JYLA 3T8AA 5DUFA 1VRGA 2FYNC 1W2XA 1RJNA 2YJGA 4H13B 2E74B 1MJ3A 1Q51A 4NARA 2H89C 1HF9A 2ZT9C 3AEBC 2J5UA 3AE6C 1UYTA 3IB9A 4KPKA 4RCNA 2PPYA 1Y9BA 2F9IB 3H02A 4B3JA 2FZSA 3QYRA 2QJPC 2Q34A 1HZDA 1HNOA 1NGMB 4FN7A 3T8BA 1X0UA 3BPTA 3IN6A 2VREA 2WSCJ 4IZDA 4IZBA 1K39A 1AJYA 5KJPA 3MOYA 4FNDA 3D71A 3AE7C 5INIA 2V7QJ 3NJDA 2ZL0A 1PIXA 2O01J 4U18A 1FDOA 2H88C 3KQFA 2E76B 3H25A 4Y28J 4JSBA 5MGBA 4GHNA 4ZDDA 1EY3A 5DTPA 4ZDCA 2F9YA 4Q1IA 3IAOA 3AEAC 1K05A 3QXZA 3M6MA 3PGQA 5KDRB 4J2UA 5CTBA 4U0HA 1WMKA 1NZYA 3HLN1 1N6EA 2VSUA 3ZW9A 2Q2XA 1YQ4C 1FDIA 2BZRA 5INGA 1FCFA 2VSSF 3T89A 4FB8A 4JWVA 4JVTA 4HDTA 1J7XA 3L3SA 3N6RB 4Q0GA 3RRVA 2G8YA 4H44C 3U9RB 3IAVA 3KTJA 1O8UA 1EF9A 3ZWCA 3QK8A 1DCIA 2A7SA 1TU3F 1ZP0C 3MYBA 5C90A 4FZWA 4I52A 4B3IA 5IKLB 4YXDC 4WCZA 3ABVC 1Q90D 5L8RJ 3AECC 4OGQC 1EF8A 4KNPA 3RSTA 3B71A 2UZFA 1OW8A 1U57A 1YQ3C 2F6IA 3STAA 2J5GA 2J5GD 3LKEA 1VF5B 1XNWA 3H0UA 3Q2YA 1JXZA 4K29A 3AEDC 4B3HA 2X24A 2VSSE 1N6FA 4EMMA 3OT6A 5INFA 4H0LD 2E75D 3RL0g 5DU6A 1DUBA 4OMRA 2Q35A 4JCSA 1WDKA 4K3WA 3MFMA 2ZL2A 1MKMA 3FF6A 1UYSA 5C9GA 2K9YA 2E74D 4H13D 1RJMA 2QJYC 4L6WA 3ZW8A 1EXIA 1YG8A 2D2CB 1ZOYC 3RK3E 2CE3A 3TT6A 3S9OA 3DJAA 2ZQRA 2F9IA 4ZDEA 3AE5C 2D2CD 3Q3DA 4ELXA 1N6DA 2VX2A 4JCRA 3QMJA 2HW5A 2VSSA 3LAOA 1DIPA 4QIIA 2VSUC 4ZU2A 3TLFA 2ZT9B 3GKBA 4L8KA 3PEAA 2ZQQA 3TZ3A 3H81A 1XNYA 4WZ8B 3OMEA 4NEKA 1FC7A 2E76D 4G2RA 2WPVB 2J5IB 1EXJA 2CBYA 1KORA 4PV1B 3SFEC 1SG4A 4FN8A 5DU4A 1RQVA 4I7ZC 2ZL3A 3R0OA 1S5LX 4WYOB 5KDRA 5DZKA 4FZWC 4IZCA 2YIUC 4K2NA 4PV1D 1UYRA 2J5II 3R6HA 1SZOA 3V5EA 4ELWA 1IK7A 4GM2A 3P2LA 1R8EA 3KTHA 1OW6A 2QIWA 5FUSA 4Z0MA 5DUCA 2DUBA 1FC9A 5DZKH 4U0GA 4RYFA 3HP0A 3AE3C 4ZDBA 1S1CX 1XO6A 2D3TA 2IDBA 3FDUA 2JO1A 3Q5PA 4JYJA 4OLQA 3Q1MA 3GF3A 1TG6A 2P10A 3AE2C 1OMIA 3H0QA 3FGAD 1HNUA 2FBWC 4H0LC 4U0GH 2E75C 3AE9C 4RYFH 2DEOA 4U19A 3Q5SA 4EMPA 4H44B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G1S A;  2EJ5 A;  1XX4 A;  4KWB A;  1UIY A;  1K32 A;  3TRR A;  1WZ8 A;  3NJB A;  3R9T A;  2PBP A;  3BEZ A;  3GLM A;  3KTK A;  2J5S A;  3P85 A;  2GTR A;  2F6Q A;  3H0J A;  5G1Q A;  4I4Z A;  3H0S A;  2C8T A;  3WG5 A;  4U1A A;  3SWX A;  3VIV A;  4JCQ A;  3IBB A;  3V5I A;  4QFE A;  4ELS A;  3ZWA A;  4HC8 A;  5DL1 A;  4MOU A;  4JJT A;  3QXI A;  3QKA A;  1TYF A;  3Q1T A;  5DTW A;  1OD2 A;  4FJW D;  5CTC A;  5G1R A;  3R9S A;  4MI2 A;  3PE8 A;  3R9Q A;  3P5M A;  3BF0 A;  4YLH A;  2VSU E;  3Q0J A;  4HNK A;  2FW2 A;  1OD4 A;  5DU8 A;  3HE2 A;  3U9S B;  4LK5 A;  5JBX A;  1WDM A;  5FIF A;  4EML A;  1XNV A;  2FBM A;  4QIJ A;  4ASI A;  2IEX A;  2F9Y B;  2A7K A;  3RSI A;  4JOT A;  2J5I A;  3TDC A;  3TV5 A;  1Y7O A;  2NP9 A;  3ST9 A;  4ZDF A;  3BPP A;  1NZY B;  2WTB A;  4NNQ A;  3KTI A;  3OC7 A;  5E0S A;  3HRX A;  4OG1 A;  2QQ3 A;  3GMA A;  4JCT A;  1ON9 A;  3U9T B;  5E0N X;  4FNB A;  2X58 A;  3SLL A;  1PJH A;  3Q0G A;  4I42 A;  1Q52 A;  3TVU A;  2A81 A;  3ZWB A;  5E0S H;  5DKP A;  3QWD A;  4MXI A;  3TT7 A;  4F47 A;  1YG6 A;  1UYV A;  3QRE A;  3M6N A;  4KD6 A;  4JFC A;  3K50 A;  3DOR A;  3KTG A;  2ZL4 A;  3GF7 A;  2VSU F;  3JU1 A;  3HIN A;  1WDL A;  2W3P A;  3TVW A;  1ON3 A;  3T88 A;  3MT6 A;  5JBW A;  1FC6 A;  3G64 A;  3I47 A;  3PZK A;  3T3W A;  2PG8 A;  3K8X A;  3ISA A;  3Q7H A;  4DI1 A;  4JYL A;  3T8A A;  5DUF A;  1VRG A;  1W2X A;  1RJN A;  1MJ3 A;  1Q51 A;  1UYT A;  3IB9 A;  4KPK A;  4RCN A;  2PPY A;  2F9I B;  3H02 A;  4B3J A;  2FZS A;  3QYR A;  2Q34 A;  1HZD A;  1HNO A;  4FN7 A;  3T8B A;  1X0U A;  2VRE A;  4IZD A;  4IZB A;  1K39 A;  5KJP A;  3MOY A;  4FND A;  5INI A;  3NJD A;  2ZL0 A;  1PIX A;  4U18 A;  3KQF A;  4JSB A;  5MGB A;  4GHN A;  4ZDD A;  1EY3 A;  5DTP A;  4ZDC A;  2F9Y A;  4Q1I A;  3QXZ A;  3M6M A;  3PGQ A;  5KDR B;  5CTB A;  4U0H A;  1NZY A;  3HLN 1;  1N6E A;  2VSU A;  3ZW9 A;  2Q2X A;  2BZR A;  5ING A;  1FCF A;  2VSS F;  3T89 A;  4FB8 A;  4JWV A;  4JVT A;  1J7X A;  3L3S A;  3N6R B;  4Q0G A;  3RRV A;  3U9R B;  3IAV A;  3KTJ A;  1O8U A;  1EF9 A;  3ZWC A;  3QK8 A;  1DCI A;  2A7S A;  3MYB A;  5C90 A;  4FZW A;  4I52 A;  4B3I A;  5IKL B;  4WCZ A;  1EF8 A;  4KNP A;  3RST A;  2UZF A;  3STA A;  2F6I A;  2J5G A;  2J5G D;  3LKE A;  1XNW A;  3H0U A;  1JXZ A;  4K29 A;  4B3H A;  2X24 A;  2VSS E;  1N6F A;  4EMM A;  3OT6 A;  5INF A;  5DU6 A;  1DUB A;  4OMR A;  2Q35 A;  4JCS A;  1WDK A;  4K3W A;  3MFM A;  2ZL2 A;  3FF6 A;  1UYS A;  5C9G A;  1RJM A;  4L6W A;  3ZW8 A;  1YG8 A;  2CE3 A;  3TT6 A;  3DJA A;  2ZQR A;  2F9I A;  4ZDE A;  4ELX A;  1N6D A;  2VX2 A;  4JCR A;  3QMJ A;  2HW5 A;  2VSS A;  3LAO A;  4QII A;  2VSU C;  4ZU2 A;  3TLF A;  3GKB A;  4L8K A;  3PEA A;  2ZQQ A;  3TZ3 A;  3H81 A;  1XNY A;  4WZ8 B;  3OME A;  4NEK A;  1FC7 A;  4G2R A;  2J5I B;  2CBY A;  1SG4 A;  4FN8 A;  5DU4 A;  2ZL3 A;  3R0O A;  4WYO B;  5KDR A;  5DZK A;  4FZW C;  4IZC A;  4K2N A;  1UYR A;  2J5I I;  3R6H A;  1SZO A;  3V5E A;  4ELW A;  4GM2 A;  3P2L A;  3KTH A;  5FUS A;  4Z0M A;  5DUC A;  2DUB A;  1FC9 A;  5DZK H;  4U0G A;  4RYF A;  3HP0 A;  4ZDB A;  1XO6 A;  2D3T A;  3FDU A;  4JYJ A;  4OLQ A;  3GF3 A;  1TG6 A;  3H0Q A;  1HNU A;  4U0G H;  4U19 A;  4RYF H;  2DEO A;  4EMP A; 
#chains in the Genus database with same CATH topology
 1M1K Q;  2NZ2 A;  2EJ5 A;  1UIY A;  1T3J A;  4WY4 D;  1K32 A;  5EFW B;  3TRR A;  3R9T A;  4H13 C;  1VF5 D;  2L91 A;  3VMA A;  1L0N J;  2GTR A;  2B88 A;  3KPE A;  1EDL A;  1H89 A;  4D6T E;  4OGQ B;  1KZU B;  1OW7 A;  3JSV C;  4EIJ A;  2MKV A;  4QFE A;  3VTP C;  2WPQ A;  2ZYD A;  3V2N A;  3CCM P;  3H1K E;  2QE7 H;  4JJT A;  1NTZ K;  3CCV P;  1MFT A;  2CPB A;  5GTH H;  1KV4 A;  1TYF A;  5B66 E;  5APW A;  3AE8 C;  4EOT A;  4FJW D;  2QJK C;  2Z5I A;  2WQY C;  3R9S A;  3AEE C;  1SQX E;  2E76 C;  3HD7 D;  3R9Q A;  5TJH A;  1BDC A;  1JY3 N;  5KTB A;  3BF0 A;  2KZJ A;  3EWK A;  1N7S C;  4YLH A;  3EFG A;  1SQV K;  1KQG B;  2N9Y B;  5DU8 A;  4PV1 C;  4LK5 A;  3CX5 I;  4ZKP A;  2ZT9 D;  5FIF A;  1RE3 A;  2KYV A;  3L72 D;  3W68 A;  1UIX A;  2IZ0 A;  1FDM A;  1Y7O A;  1NVO A;  3L73 E;  4ZDF A;  5CJ4 A;  3E1I A;  3ZDM A;  1NZY B;  3AE4 C;  1GL2 C;  2OYI B;  3L71 E;  4JCT A;  2R3S A;  1ON9 A;  1M1J A;  2KLU A;  2K3R A;  5DJT B;  4FNB A;  5TIS E;  3L72 G;  1S3J A;  1BSH A;  1YI2 P;  2V4H A;  3NFQ A;  2WTY A;  3TVU A;  1IC2 A;  1T2K D;  4WBA A;  4I7Z B;  1PP9 J;  4MXI A;  1YG6 A;  1JMM A;  3D6Z A;  1FJP A;  3KZI H;  3EFF K;  3M6N A;  2K88 A;  3SFD C;  3HE4 B;  3EQ2 A;  4KJM A;  3FWL A;  1QVF O;  3KTG A;  2J58 A;  4IOI H;  2W27 A;  1ZRT E;  1NTZ E;  1WDL A;  2W3P A;  2QA4 P;  3TVW A;  3D6Y A;  2FYU D;  3TGU J;  1JOC A;  3B5N C;  5JBW A;  1HTL C;  3G64 A;  1URQ C;  3CX5 E;  1S9K E;  4K3A A;  4OVN F;  3I47 A;  3A7O A;  3G3Z A;  1OVU A;  3TF5 A;  1Z56 A;  1SQV E;  4OGQ D;  1IZN B;  2FYU G;  3BAS A;  3JCU E;  1E79 H;  1W2X A;  1RJN A;  2WSF H;  4ZKU A;  1Q51 A;  4NAR A;  3KHU A;  2QG4 A;  4ASV A;  1UYT A;  3HD7 A;  1NKZ B;  4RCN A;  1Y9B A;  2F9I B;  3H02 A;  4B3J A;  2OTK E;  3S4R A;  2Q1K A;  3QYR A;  2IYO A;  3PH0 A;  5CCG C;  1M90 Q;  3BVH A;  3KQG A;  5KAI E;  2KNC B;  1MV8 A;  1X0U A;  2E42 A;  3VMZ A;  5CBO A;  1AJY A;  1D7M A;  1VQL P;  2ZXX A;  1USE A;  1KIL A;  2O01 H;  3LW5 H;  3NJD A;  2A45 I;  1PIX A;  1NHL A;  2O01 J;  3H25 A;  2KOG A;  1S72 P;  4D6T J;  4GHN A;  3RK2 B;  1EZV I;  3IAO A;  3H1L D;  5GTI E;  3HE5 B;  3M6M A;  2OGU A;  5KDR B;  3H1K J;  4U3F D;  3OW2 O;  1N6E A;  1EDI A;  1YQ4 C;  2Y9Z A;  1RF0 C;  2VSS F;  1HGZ A;  4JVT A;  4WWI A;  4HDT A;  3N6R B;  4Q0G A;  3CL3 D;  1T3U A;  1FJK A;  3H1L G;  4H44 C;  2YXQ B;  3IAV A;  2NPS C;  5BU8 B;  3H1I E;  3PTZ A;  4IL6 E;  3KTJ A;  2IFN A;  1HVV A;  1EF9 A;  1IFP A;  1L0L D;  5APX A;  4GIF A;  1QEX A;  4U3F G;  1P84 I;  3SWY A;  3MYB A;  2P1J A;  1L0N K;  1VQP P;  3GHG A;  1CZQ A;  1EF8 A;  3GW6 A;  1W5C E;  4KNP A;  4W7Y A;  2UZF A;  1L0L G;  5KJ7 A;  2FYU K;  2R5D A;  4HB1 A;  3A5T A;  1L4A B;  5APY A;  1RF1 A;  3CXH D;  3H0U A;  3Q2Y A;  1SP4 A;  3L71 J;  5TIS H;  1N6F A;  4I1L A;  3RL0 g;  5KLV D;  1OXZ A;  4GOF A;  1K73 Q;  5DU6 A;  1DUB A;  4GT1 A;  4QMA A;  4OMR A;  2Q35 A;  2ZL2 A;  1YIT P;  1UYS A;  5C9G A;  2K9Y A;  4BRY A;  1GU5 A;  1USD A;  2KI7 B;  1EXI A;  2D2C B;  3DJA A;  3L75 E;  1YYC A;  4AQR D;  1H0T A;  4ZDE A;  3WU2 E;  1IK9 A;  5KLV G;  1FZC C;  1NTZ J;  2VX2 A;  2VSS A;  1NTM D;  4QII A;  3CX5 H;  1NO4 A;  3NMD A;  1EQ7 A;  4L8K A;  3VMX A;  3OME A;  1JCC A;  1KB9 D;  3P8C E;  3RK3 B;  4OH8 B;  2M3B A;  1BGY D;  2POH A;  2WPV B;  2RKL A;  1EXJ A;  4IFM A;  1SQV J;  3RK2 D;  1N7S A;  1SG4 A;  1L0N E;  1NTM G;  3JCU H;  2ZL3 A;  2BAS A;  4IZC A;  1M1J B;  3R6H A;  4DCK A;  1BGY G;  1OW6 A;  1J1D C;  1L2P A;  2FYU E;  4N6J A;  2Q9I A;  3U1C A;  5KAI H;  2P67 A;  1L0L K;  1YJ9 P;  1N73 C;  1U7J A;  1AV1 A;  2Y0C A;  4ZDB A;  1M57 D;  1GL2 A;  2D3T A;  3HTK A;  3CCE P;  4HH2 A;  2HPC A;  2FFD C;  3QWO C;  3H0Q A;  3JC2 2;  4PD4 D;  4H0L C;  4U0G H;  1E5W A;  1GTW A;  5AW0 B;  1LTJ B;  1NAF A;  5GTI H;  2QVA A;  4R4M A;  1DD3 A;  2Y0E A;  4JYC A;  3VYI A;  3GLM A;  1FE6 A;  3G9R A;  4GKG A;  3P85 A;  2F6Q A;  3H0J A;  1N2D C;  4I4Z A;  3H0S A;  3WUU A;  4JCQ A;  1XTC C;  4BWN A;  1S4X A;  3V5I A;  5KLV K;  2KK7 A;  3LID A;  4IL6 H;  3H1I J;  4HC8 A;  5DL1 A;  4MOU A;  5C39 A;  1AQ5 A;  4IL6 X;  2WSE J;  3B5N A;  1NH4 A;  1URQ A;  3HD7 B;  1DEB A;  3CCQ P;  5G1R A;  2Y9Y A;  1NKN A;  2ZYA A;  4R4L A;  1GW3 A;  4L73 A;  3Q5R A;  3MUD C;  1PP9 E;  3PLN A;  1ZN5 A;  2HOD A;  1LP1 A;  2VSU E;  3P8M C;  2OYH C;  3A3Y B;  4B86 A;  1NTM K;  3CMA P;  5KKZ C;  1OD4 A;  1NOH A;  1RH5 B;  2QJY B;  5KLI C;  1KIL B;  3U9S B;  5JBX A;  2A45 H;  3V4Q A;  5AW6 B;  2FBM A;  2HFE D;  2IEX A;  5AW3 B;  1L0L E;  2ITA A;  4YPC A;  3D70 A;  5CCG A;  1JTH A;  4K35 A;  3BPP A;  3A0B E;  4NNQ A;  1S2E A;  1JMB A;  4N78 E;  5E0S A;  2QQ3 A;  3GMA A;  1G1J A;  1KMI Z;  3L72 J;  2FKW B;  1QLE D;  3R4Y A;  3Q0G A;  1Q52 A;  3V5B A;  3WU2 H;  2C0X A;  1QGK B;  2A81 A;  1FS0 E;  1LTA C;  3L4F A;  1KQF B;  1LT9 C;  2K9J A;  3TT7 A;  5HUQ A;  2YIU B;  3TK1 A;  1J1E B;  2XV5 A;  3GHG B;  4KD6 A;  4XA4 A;  3K50 A;  2WZ7 A;  1RF0 A;  5KLV E;  1NAY A;  3M9Q A;  3JU1 A;  1SQQ D;  2NPS A;  5AVQ B;  1RF1 B;  1PV3 A;  3MT6 A;  1BCC D;  4Y99 C;  2PP6 A;  3PZK A;  5CBN A;  5AW4 B;  2ZFC A;  1SFC C;  3OAK A;  1SQQ G;  1NTM E;  2YMK A;  2FYU J;  3M0D C;  5DUF A;  1S5L E;  1YTZ T;  1IFJ A;  1VRG A;  2FYN C;  1BCC G;  2YJG A;  4H13 B;  1MJ3 A;  2H89 C;  4WB4 A;  4BRY B;  1YHQ P;  1HF9 A;  3AEB C;  2E5Y A;  2IBZ D;  3O8Z A;  3L74 D;  1FZG A;  3UIA A;  3L70 D;  1H0T B;  1FOS F;  3E1R A;  2FZS A;  2QJP C;  2Q34 A;  2M8R A;  3C1L A;  5CCH C;  2M3E A;  2VRE A;  1FZA A;  3IR9 A;  3M06 A;  1K39 A;  2GA1 A;  1VQK P;  2IBZ G;  2RH0 A;  3FX0 A;  3L74 G;  3AE7 C;  2QJK B;  5INI A;  1KIL D;  3L70 G;  2Q3I A;  2ZL0 A;  5E79 E;  3KQF A;  2E76 B;  5MGB A;  5AVX B;  3HUS C;  1N7S B;  1K05 A;  3P32 A;  1FZC A;  2A06 D;  1JY2 P;  2YKQ A;  3ZW9 A;  3CLQ A;  2Q2X A;  4PD4 E;  3VMY A;  3G6E P;  2BZR A;  5ING A;  1FCF A;  3T89 A;  3N4X A;  4EI2 A;  1LJ2 A;  3L3S A;  2P7J A;  1GW4 A;  4C7R A;  4LLH A;  4N3Y B;  1N86 A;  1P84 D;  1MZ9 A;  4WVZ A;  3U9R B;  2A06 G;  1JCD A;  4U3F J;  3QK8 A;  2A7S A;  5CJ0 A;  1SQB D;  1GL2 B;  3FXD A;  3HTK B;  4JBZ A;  1TU3 F;  3WUV A;  2W8Z A;  2JKV A;  1Q90 D;  4LGD E;  4GOE A;  2I1J A;  4AYC A;  3TNU A;  1SQQ K;  3RST A;  1L0L J;  3B71 A;  1H8A A;  2R44 A;  2K37 A;  3U1A A;  5KJ7 D;  1HGV A;  1OW8 A;  1SQB G;  2F6I A;  3STA A;  1N73 A;  5APV A;  3NTN A;  1ZR4 A;  3A2A A;  1JXZ A;  2WWW A;  4B3H A;  1Q7Y Q;  2X24 A;  2FFD A;  3V2P A;  1YJW P;  3RL0 C;  3OT6 A;  5INF A;  3BCC D;  1T8Z A;  3K5B A;  2QRX A;  3B5N B;  4K3W A;  1CW5 A;  1Y8A A;  1URQ B;  4H13 D;  1RJM A;  5AVT B;  2J59 M;  1GU4 A;  2XZR A;  3RK3 E;  2IZ1 A;  2M5A A;  3BCC G;  2HOD B;  2KS1 A;  5KLV J;  1LP1 B;  3CD6 P;  3H1H D;  3Q3D A;  1G2C A;  4JCR A;  5H2F E;  3QMJ A;  2Q7C A;  4ZU2 A;  3TLF A;  1R5L A;  1IFD A;  3PEA A;  3TZ3 A;  1PZQ A;  4WZ8 B;  1FC7 A;  1GD2 E;  2E76 D;  3H1H G;  3MUD A;  2O1J A;  3L37 A;  1FZF A;  1JY3 O;  2MJZ A;  1JTH B;  4ZMD A;  2YKP A;  3H32 B;  1FC2 C;  3CCU P;  1KOR A;  1NTM J;  1S5L H;  4UB8 E;  1N7S D;  3NXS A;  5B66 H;  1PGO A;  2OYH A;  1S5L X;  5DZK A;  2WVR A;  4PV1 D;  2J5I I;  4ELW A;  1SQQ E;  4W80 A;  2H8P D;  1JM0 A;  1R8E A;  2IPP A;  2QIW A;  2B87 A;  3C9I A;  2H7H A;  1K8A Q;  1HUC A;  5DUC A;  2DUB A;  5AW1 B;  5AVV B;  1SQB K;  2K9J B;  2OYO A;  1S1C X;  1GL2 D;  3CI9 A;  3MGN A;  1AVO A;  1TG6 A;  1L4A C;  5E79 H;  1OMI A;  3FGA D;  2P2U A;  4YXW H;  1OFC X;  1VQ7 P;  2E75 C;  4U19 A;  4RYF H;  2DEO A;  3Q5S A;  1A02 J;  2O3J A;  4H44 B;  2NPS B;  5G1S A;  4RKU J;  4PJ0 E;  1WZ8 A;  2ZJS E;  3L74 E;  3NJB A;  1LT9 A;  3L70 E;  2E74 C;  2KSJ A;  5CHX A;  2JWA A;  1UII A;  2PBP A;  3OA7 A;  4PD4 H;  3FWN A;  2J5S A;  1PPJ G;  2C8T A;  2W83 C;  2JR8 A;  3WG5 A;  3VIV A;  3B8E B;  2D2C C;  1LWU C;  3IBB A;  4ELS A;  3ZWA A;  2Z5H A;  5AW5 B;  2ZVN B;  4GDO A;  3L72 E;  1KIL E;  3QXI A;  3B5N D;  2QSI A;  5AVY B;  1URQ D;  2CK3 H;  5DTW A;  5CTC A;  5APQ A;  3H1J D;  4MI2 A;  3KDP B;  3PE8 A;  1SFC A;  3MP7 B;  2WMM A;  1QL1 A;  4A7P A;  3M0D A;  2WT7 A;  2N1T C;  1PL5 A;  5BVZ A;  2L5G B;  3PP5 A;  2FY8 A;  2BEZ F;  2OTJ P;  2B89 A;  3H1J G;  4EML A;  4QIJ A;  1K04 A;  1PFI A;  1T6A A;  3H1K D;  1WRG A;  1JY2 N;  1SQB E;  3RSI A;  4JOT A;  2E43 A;  4Z1M H;  3TDK A;  5CCG D;  3TV5 A;  1FZC B;  3TYY A;  5CCH A;  3ST9 A;  4DT0 A;  1SQX D;  3KTI A;  2G3A A;  2QM8 A;  1M7L A;  3VP8 A;  3H1K G;  2X58 A;  1X9V A;  1KYO D;  2RN0 A;  3HUS A;  1BE3 D;  4WY4 C;  1SQX G;  3U59 A;  3QWD A;  1SLQ A;  2WPR A;  1KTM A;  1VF5 C;  3QRE A;  2H43 A;  2Q3E A;  3BCC E;  2Y0D A;  4JFC A;  3DOR A;  3L73 D;  1J1D B;  3GF7 A;  3RGU A;  3TNU B;  2JP3 A;  3HIN A;  1BE3 G;  3HE4 A;  4H44 D;  1N73 B;  2NPS D;  1ON3 A;  4UB8 H;  3T88 A;  1LTB C;  3LIE A;  1W2B O;  2K1A A;  2FFD B;  2PG8 A;  3L73 G;  1DH3 A;  2ZAE B;  4H0L B;  3Q7H A;  1HH0 A;  1SQQ J;  4DI1 A;  2YXR B;  3CXH I;  1OX3 A;  2WSE H;  4JF7 A;  3G71 P;  4RO0 A;  4JYL A;  3WUT A;  1BCC J;  1JEK A;  1N8R Q;  1K9M Q;  4DOJ A;  1KD1 Q;  3H1L E;  2ZT9 C;  2J5U A;  1ZRT D;  3IB9 A;  1PGP A;  1IJD B;  4UB6 E;  2M5A B;  2KS1 B;  4U3F E;  3CX5 D;  1S9K D;  1G2C B;  1NGM B;  3T8B A;  1YBK A;  2Q5U A;  3BPT A;  2OTL P;  2PRR A;  2WSC J;  2AEF A;  4IZD A;  3MOY A;  3L74 J;  4FND A;  3D71 A;  3L70 J;  2Z4E A;  2V7Q J;  2JEE A;  1DEE G;  2ZVO B;  1FDO A;  2H88 C;  1ZR2 A;  2WIT A;  2HLO A;  4ZDC A;  1NTK D;  2YKO A;  2F9Y A;  4Q1I A;  1T2K C;  1VQN P;  2JDI H;  2XKM A;  3QXZ A;  2OYH B;  4J2U A;  5CTB A;  4U0H A;  1IO4 A;  1GK4 A;  5KKZ B;  2KXP B;  1YIJ P;  5KLI B;  2XNX A;  1GK6 A;  2YO3 A;  4IFD K;  1J2J B;  1N7L A;  3CCJ P;  3TSI A;  1VQO P;  3VN0 A;  1LNQ A;  2B87 B;  2C0W A;  3CXH E;  5DJU B;  3T97 A;  2FYZ A;  2R32 A;  1NTK G;  4ZNC A;  3RRV A;  1O8U A;  5AVZ B;  2KSE A;  2BCC D;  3CC7 P;  2WPS A;  1ZP0 C;  5C90 A;  4B3I A;  4YXD C;  4WCZ A;  1ZW0 A;  2FXM A;  3ABV C;  2M0B A;  4OGQ C;  5BU5 A;  1SQB J;  2IFM A;  3V4W A;  2BCC G;  1U57 A;  1YQ3 C;  1LT9 B;  2J5G A;  3LKE A;  2IX7 C;  3H1J E;  1KQS O;  4PD4 I;  1XNW A;  1NU1 D;  3A0H E;  3AED C;  3H1I D;  1L4A A;  1X0T A;  4MN4 C;  2AXC A;  2W6B A;  5AVU B;  1KC8 Q;  3HRN A;  1VQ5 P;  1OVV A;  4H0L D;  1G1I A;  3CCR P;  1VDF A;  3W67 A;  2HYN A;  3CWB D;  2R5B A;  3I56 P;  5APS A;  5AVR B;  1KB9 E;  1WDK A;  3MFM A;  2UWJ E;  3FF6 A;  1MKM A;  1BGY E;  4Y99 B;  1NU1 G;  4C46 A;  4L6W A;  1Q81 Q;  3ZW8 A;  3H1I G;  2CE3 A;  1KN7 A;  3BCC J;  2ZXE B;  1SFC B;  3TT6 A;  1IFM A;  1HWT C;  5AW2 B;  1LWU A;  2WT7 B;  3MHV A;  4ELX A;  3CWB G;  1N6D A;  2FYN B;  2HW5 A;  1Q82 Q;  3LAO A;  1YJN P;  4CPG A;  2VSU C;  2OYI C;  3SSU A;  1EZV D;  1KYO E;  1X79 B;  1RHZ B;  1AFO A;  3RBX A;  1XTG B;  1BE3 E;  4NEK A;  2ZYG A;  2QJP B;  3H1H J;  4NPF X;  1PGQ A;  3MTU E;  1NTK K;  2A45 G;  3FXE A;  4IFF A;  4PV1 B;  3SFE C;  4FN8 A;  1RQV A;  2N1T A;  3P7K A;  4I7Z C;  3R0O A;  4WYO B;  1SQP D;  3L75 D;  1ZV8 A;  4FZW C;  1EZV G;  1H88 A;  2LKM A;  4K2N A;  3V5E A;  1SZO A;  3H1L J;  4UB6 H;  1Y47 A;  3S1K A;  4GM2 A;  3F5H A;  3KTH A;  1EDK A;  5FUS A;  3HUS B;  4Z0M A;  4U0G A;  3E7K A;  2HPC B;  1SQP G;  3L75 G;  1AVY A;  1XO6 A;  3P8C D;  5B5E E;  5APU A;  2KB7 P;  3Q5P A;  1LTI C;  3N7N A;  4OLQ A;  3Q1M A;  3GF3 A;  3M9B A;  3AE2 C;  3BRV B;  1YTZ I;  1HNU A;  1L0N D;  1NJI Q;  4ASW A;  3AE9 C;  4AUW A;  4DJG A;  3A0B H;  1XX4 A;  4HKZ H;  4KWB A;  4WY4 A;  3CC4 P;  1VL2 A;  2JJL A;  3PHL A;  1VPC A;  1NU1 K;  4U7J A;  1LTJ A;  1MFZ A;  4L76 A;  2HG5 D;  1RQU A;  3BEZ A;  3KTK A;  3C8V A;  2SPZ A;  5AW8 B;  1QX8 A;  1L0N G;  5G1Q A;  1EDJ A;  3CXH H;  3II6 A;  1CI6 A;  4U1A A;  3B4S A;  3SWX A;  4EYY Q;  4EDF A;  2CPS A;  4XFJ A;  2GUS A;  3QKA A;  3Q1T A;  1KFM A;  1OD2 A;  1NTK E;  2WSF J;  1JNM A;  1OZH A;  1X8Y A;  1OIP A;  4M3L A;  3RL0 B;  3CME P;  1SFC D;  2KUB A;  4I2L C;  3CPW O;  3P5M A;  2WSS H;  3RK2 C;  1X22 A;  2Q6Q A;  1VQM P;  2IBZ I;  3IFM A;  3AE1 C;  3Q0J A;  4HNK A;  1RE4 C;  2FW2 A;  1Q86 Q;  3KXD A;  3H6P A;  1NYH A;  3HE2 A;  2OQQ A;  3H1J J;  3A0H H;  1WDM A;  3AEF C;  1XNV A;  1SS1 A;  4I6M C;  4ASI A;  5AW7 B;  1DD4 A;  3MIW A;  2IYP A;  2F9Y B;  1NWQ A;  2BCC E;  4RES B;  2AEJ A;  3LW5 J;  2A7K A;  2J5I A;  3TDC A;  5CCH D;  4YTP C;  2NP9 A;  3V2Q A;  2WTB A;  1KB9 H;  1SQP K;  3OC7 A;  3HRX A;  5KAF E;  1BGY J;  1PP9 D;  4OG1 A;  2QEX P;  4TT3 H;  3U9T B;  5E0N X;  1LT1 A;  3T97 B;  1BCC E;  3SLL A;  4JQ0 D;  1PJH A;  5M1B A;  4I42 A;  1FOS E;  5APT A;  3ZWB A;  1RY3 A;  4W7Z A;  5E0S H;  1IFN A;  1NU1 E;  1HJ0 A;  1JB0 J;  1SQX J;  5DKP A;  1DX7 A;  3M91 A;  1ZLL A;  1GMJ A;  1AQT A;  3TGU D;  1PP9 G;  4F47 A;  1UYV A;  3AEG C;  5K5G B;  1PPJ D;  4XE5 B;  3VP9 A;  1KYO H;  4C7N A;  1ZME C;  2VRS A;  3F89 A;  2ZL4 A;  2OAR A;  3CWB E;  3MZW B;  2VSU F;  1BE3 J;  4N78 D;  2FXP A;  2I8D A;  2IBZ E;  3O6Q A;  4O9B A;  1HJB A;  1EC5 A;  2BEQ D;  3TGU G;  1FC6 A;  1U7M A;  1MUU A;  2R3C A;  3BRT B;  3L73 J;  1GDT A;  3T3W A;  3M9H A;  4OWF A;  3K8X A;  2PAJ A;  3ISA A;  3IF4 A;  2E75 B;  2B9B A;  2N9B A;  4KT0 J;  2GUV A;  3BAT A;  3T8A A;  2LXC B;  1EZV E;  2E74 B;  2PFX A;  2E5T A;  2KIK A;  5B5E H;  4NPD A;  3AE6 C;  3KYQ A;  4NPE A;  2A06 E;  4KPK A;  1RE3 C;  2PPY A;  1VQ4 P;  3USS A;  1VQ9 P;  3RK3 C;  3RL0 D;  1LWU B;  1HZD A;  1HNO A;  1SQP E;  4D6T D;  4FN7 A;  2W6J H;  5AVS B;  1M8O B;  3IN6 A;  1JO5 A;  4IZB A;  5KJP A;  1OVR A;  1JY3 P;  1P84 E;  3QH9 A;  1M1J C;  2XU6 A;  4L75 A;  1OWA A;  4U18 A;  4Y28 J;  2AXT E;  4JSB A;  2KZI A;  3GG2 A;  1M56 D;  2W6A A;  1EY3 A;  4ZDD A;  1BSN A;  5DTP A;  4D6T G;  3AEA C;  2N1T B;  3PGQ A;  3M0A A;  5AW9 B;  3WMM 0;  1WMK A;  5CMZ A;  1NZY A;  3HLN 1;  2VSU A;  2OYI A;  2JWD A;  2KP8 A;  2HR3 A;  3ITK A;  1FDI A;  1SVF A;  1WT6 A;  2P58 A;  2C9L Y;  4JWV A;  4FB8 A;  1FZB A;  1NTK J;  2C9N Y;  4L74 A;  1J7X A;  3R2P A;  1HBW A;  2LR2 A;  1QL2 A;  2G8Y A;  5H2F H;  1LTJ C;  3I5C A;  2KLV A;  3ZWC A;  2I1K A;  1DCI A;  5GTH E;  3G4S P;  3OJA B;  4FZW A;  4I52 A;  5IKL B;  2W90 A;  3VOP A;  3V2R A;  5L8R J;  1W2E A;  2FXO A;  3AEC C;  2XND H;  3L71 D;  3L36 A;  4GOD A;  3MD0 A;  1BDD A;  2BCC J;  4WY4 B;  2AEM A;  3CCL P;  2J5G D;  2PGD A;  1VF5 B;  5KAF H;  3H1H E;  4K29 A;  3HD7 C;  1LTG C;  1A02 F;  1VQ8 P;  1L4A D;  1IFI A;  2VSS E;  3L71 G;  1CI6 B;  4TLF A;  1CSB A;  4EMM A;  2O1K A;  2E75 D;  1JUN A;  3PRJ A;  1ZXG A;  4JCS A;  1NU1 J;  3RBZ A;  1NTZ D;  2XDJ A;  2E74 D;  2QJY C;  1KIL C;  2GM4 A;  1YG8 A;  1ZOY C;  2LXB A;  3S9O A;  2ZQR A;  2F9I A;  4PJ0 H;  3AE5 C;  2WSC H;  3CWB J;  2D2C D;  2NRG A;  4BXL A;  2DW3 A;  3PJS K;  2KNC A;  1SQV D;  1LTS C;  2V7Q H;  1NTZ G;  2YNY A;  1DIP A;  2QM7 A;  3KZI E;  2ZT9 B;  3GKB A;  3CCS P;  2ZQQ A;  3H81 A;  1XNY A;  3CC2 P;  4KHX A;  1LTT C;  4G2R A;  2J5I B;  1R5S A;  2CBY A;  1SQX K;  3TGU E;  2RMZ A;  1KB9 I;  4LC1 A;  4DZO A;  1FU1 A;  1SQV G;  1PPJ E;  5DU4 A;  3HE5 A;  3RK3 D;  1AA0 A;  2N1T D;  4JPZ B;  5KDR A;  1KFN A;  1RE4 A;  1FBM A;  1PGJ A;  3H32 A;  2YIU C;  2YO2 A;  1VQ6 P;  1UYR A;  1J1E C;  4HJG H;  1FZE A;  3GHG C;  3I55 P;  1GZL A;  4RJT A;  1IK7 A;  3P2L A;  1JY2 O;  4JYB A;  4HYT B;  5KJ7 C;  1FC9 A;  5DZK H;  1LGH B;  1SQP J;  3L35 A;  4RYF A;  3L75 J;  3HP0 A;  2O01 N;  3AE3 C;  1RF1 C;  1KYO I;  1KQL A;  2IDB A;  4C7N B;  5AVW B;  1P84 H;  3FDU A;  2YMY A;  2JO1 A;  1QVG O;  4JYJ A;  1Q2N A;  2P10 A;  1FAV A;  2FBW C;  2AXT H;  3SWF A;  3O6Q B;  3SWK A;  4EMP A;  3V6I A; 
#chains in the Genus database with same CATH homology
 5G1S A;  2NZ2 A;  2EJ5 A;  4RKU J;  1XX4 A;  4KWB A;  1UIY A;  1VL2 A;  1K32 A;  3TRR A;  1WZ8 A;  3NJB A;  4R4M A;  1DD3 A;  3R9T A;  4H13 C;  2E74 C;  4U7J A;  1VF5 D;  1RQU A;  2PBP A;  3BEZ A;  3GLM A;  3KTK A;  3G9R A;  3C8V A;  2J5S A;  3P85 A;  2GTR A;  2F6Q A;  3H0J A;  5G1Q A;  4I4Z A;  3H0S A;  2C8T A;  4OGQ B;  1OW7 A;  3WG5 A;  4U1A A;  3SWX A;  3VIV A;  2D2C C;  4JCQ A;  3IBB A;  2MKV A;  3V5I A;  4QFE A;  4ELS A;  3ZWA A;  4XFJ A;  4HC8 A;  5DL1 A;  4GDO A;  4MOU A;  1KIL E;  4JJT A;  4IL6 X;  3QXI A;  2WSE J;  3QKA A;  2QSI A;  1TYF A;  3Q1T A;  3AE8 C;  5DTW A;  1OD2 A;  4FJW D;  5CTC A;  2QJK C;  5G1R A;  2WQY C;  3R9S A;  2WSF J;  3AEE C;  4MI2 A;  2E76 C;  3PE8 A;  4R4L A;  3Q5R A;  3R9Q A;  3P5M A;  3BF0 A;  3EWK A;  4YLH A;  2VSU E;  3AE1 C;  3Q0J A;  4HNK A;  1KQG B;  1PL5 A;  2FW2 A;  5KKZ C;  1NYH A;  1OD4 A;  5DU8 A;  4PV1 C;  3HE2 A;  2OQQ A;  5KLI C;  2BEZ F;  3U9S B;  4LK5 A;  5JBX A;  1WDM A;  3AEF C;  2ZT9 D;  5FIF A;  4EML A;  1XNV A;  2FBM A;  4QIJ A;  1K04 A;  4ASI A;  2IEX A;  1DD4 A;  2F9Y B;  2A7K A;  1UIX A;  3LW5 J;  4JOT A;  3D70 A;  3RSI A;  4Z1M H;  2J5I A;  3TDC A;  3TV5 A;  1Y7O A;  4YTP C;  2NP9 A;  3ST9 A;  4ZDF A;  3BPP A;  1NZY B;  2WTB A;  3AE4 C;  4NNQ A;  3KTI A;  3OC7 A;  2G3A A;  5E0S A;  3HRX A;  4OG1 A;  2QQ3 A;  3GMA A;  4TT3 H;  4JCT A;  1KMI Z;  1ON9 A;  3U9T B;  5E0N X;  4FNB A;  3T97 B;  2X58 A;  3R4Y A;  3SLL A;  1PJH A;  3Q0G A;  5M1B A;  4I42 A;  1Q52 A;  3TVU A;  2A81 A;  3ZWB A;  5E0S H;  1HJ0 A;  1JB0 J;  1KQF B;  5DKP A;  4I7Z B;  3QWD A;  4MXI A;  1GMJ A;  3TT7 A;  1KTM A;  5HUQ A;  1VF5 C;  1YG6 A;  4F47 A;  1UYV A;  3AEG C;  3D6Z A;  3QRE A;  3M6N A;  1ZME C;  4KD6 A;  4JFC A;  3SFD C;  3K50 A;  3DOR A;  3KTG A;  2ZL4 A;  3GF7 A;  2VSU F;  2JP3 A;  2FXP A;  3JU1 A;  3O6Q A;  3HIN A;  1WDL A;  1ZRT E;  2W3P A;  3TVW A;  4H44 D;  3D6Y A;  1ON3 A;  3T88 A;  1PV3 A;  3MT6 A;  2BEQ D;  5JBW A;  1FC6 A;  3G64 A;  3I47 A;  3PZK A;  3T3W A;  2PG8 A;  3K8X A;  3ISA A;  4H0L B;  3Q7H A;  2E75 B;  4DI1 A;  4KT0 J;  4OGQ D;  2YMK A;  4JYL A;  3T8A A;  5DUF A;  1VRG A;  2FYN C;  1W2X A;  1RJN A;  2YJG A;  4H13 B;  2E74 B;  1MJ3 A;  1Q51 A;  4NAR A;  2H89 C;  1HF9 A;  2ZT9 C;  3AEB C;  2J5U A;  3AE6 C;  1UYT A;  3IB9 A;  4KPK A;  4RCN A;  2PPY A;  1Y9B A;  2F9I B;  3H02 A;  4B3J A;  2FZS A;  3QYR A;  2QJP C;  2Q34 A;  1HZD A;  1HNO A;  1NGM B;  4FN7 A;  3T8B A;  1X0U A;  3BPT A;  3IN6 A;  2VRE A;  2WSC J;  4IZD A;  4IZB A;  1K39 A;  1AJY A;  5KJP A;  3MOY A;  4FND A;  3D71 A;  3AE7 C;  5INI A;  2V7Q J;  3NJD A;  2ZL0 A;  1PIX A;  2O01 J;  4U18 A;  1FDO A;  2H88 C;  3KQF A;  2E76 B;  3H25 A;  4Y28 J;  4JSB A;  5MGB A;  4GHN A;  4ZDD A;  1EY3 A;  5DTP A;  4ZDC A;  2F9Y A;  4Q1I A;  3IAO A;  3AEA C;  1K05 A;  3QXZ A;  3M6M A;  3PGQ A;  5KDR B;  4J2U A;  5CTB A;  4U0H A;  1WMK A;  1NZY A;  3HLN 1;  1N6E A;  2VSU A;  3ZW9 A;  2Q2X A;  1YQ4 C;  1FDI A;  2BZR A;  5ING A;  1FCF A;  2VSS F;  3T89 A;  4FB8 A;  4JWV A;  4JVT A;  4HDT A;  1J7X A;  3L3S A;  3N6R B;  4Q0G A;  3RRV A;  2G8Y A;  4H44 C;  3U9R B;  3IAV A;  3KTJ A;  1O8U A;  1EF9 A;  3ZWC A;  3QK8 A;  1DCI A;  2A7S A;  1TU3 F;  1ZP0 C;  3MYB A;  5C90 A;  4FZW A;  4I52 A;  4B3I A;  5IKL B;  4YXD C;  4WCZ A;  3ABV C;  1Q90 D;  5L8R J;  3AEC C;  4OGQ C;  1EF8 A;  4KNP A;  3RST A;  3B71 A;  2UZF A;  1OW8 A;  1U57 A;  1YQ3 C;  2F6I A;  3STA A;  2J5G A;  2J5G D;  3LKE A;  1VF5 B;  1XNW A;  3H0U A;  3Q2Y A;  1JXZ A;  4K29 A;  3AED C;  4B3H A;  2X24 A;  2VSS E;  1N6F A;  4EMM A;  3OT6 A;  5INF A;  4H0L D;  2E75 D;  3RL0 g;  5DU6 A;  1DUB A;  4OMR A;  2Q35 A;  4JCS A;  1WDK A;  4K3W A;  3MFM A;  2ZL2 A;  1MKM A;  3FF6 A;  1UYS A;  5C9G A;  2K9Y A;  2E74 D;  4H13 D;  1RJM A;  2QJY C;  4L6W A;  3ZW8 A;  1EXI A;  1YG8 A;  2D2C B;  1ZOY C;  3RK3 E;  2CE3 A;  3TT6 A;  3S9O A;  3DJA A;  2ZQR A;  2F9I A;  4ZDE A;  3AE5 C;  2D2C D;  3Q3D A;  4ELX A;  1N6D A;  2VX2 A;  4JCR A;  3QMJ A;  2HW5 A;  2VSS A;  3LAO A;  1DIP A;  4QII A;  2VSU C;  4ZU2 A;  3TLF A;  2ZT9 B;  3GKB A;  4L8K A;  3PEA A;  2ZQQ A;  3TZ3 A;  3H81 A;  1XNY A;  4WZ8 B;  3OME A;  4NEK A;  1FC7 A;  2E76 D;  4G2R A;  2WPV B;  2J5I B;  1EXJ A;  2CBY A;  1KOR A;  4PV1 B;  3SFE C;  1SG4 A;  4FN8 A;  5DU4 A;  1RQV A;  4I7Z C;  2ZL3 A;  3R0O A;  1S5L X;  4WYO B;  5KDR A;  5DZK A;  4FZW C;  4IZC A;  2YIU C;  4K2N A;  4PV1 D;  1UYR A;  2J5I I;  3R6H A;  1SZO A;  3V5E A;  4ELW A;  1IK7 A;  4GM2 A;  3P2L A;  1R8E A;  3KTH A;  1OW6 A;  2QIW A;  5FUS A;  4Z0M A;  5DUC A;  2DUB A;  1FC9 A;  5DZK H;  4U0G A;  4RYF A;  3HP0 A;  3AE3 C;  4ZDB A;  1S1C X;  1XO6 A;  2D3T A;  2IDB A;  3FDU A;  2JO1 A;  3Q5P A;  4JYJ A;  4OLQ A;  3Q1M A;  3GF3 A;  1TG6 A;  2P10 A;  3AE2 C;  1OMI A;  3H0Q A;  3FGA D;  1HNU A;  2FBW C;  4H0L C;  4U0G H;  2E75 C;  3AE9 C;  4RYF H;  2DEO A;  4U19 A;  3Q5S A;  4EMP A;  4H44 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...