3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
source organism Clostridium symbiosum
molecule tags Lyase
molecule keywords Glutaconyl-CoA decarboxylase subunit A
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
5DUFA 3MFMA 1FC7A 2A7SA 5CTBA 4U1AA 2PG8A 4WZ8B 1SG4A 2F9YA 1OD4A 1UYVA 2ZL2A 4K3WA 3MYBA 2ZL0A 4ELXA 4QFEA 3TV5A 3KTHA 3TZ3A 3FF6A 4EMLA 1XNYA 5DU8A 1FC6A 5G1SA 2X24A 5KDRB 1WDLA 4EMMA 2F9IB 4JVTA 2VREA 5E0NX 4K2NA 4RYFH 3ZWCA 5KDRA 4U0GA 3OC7A 2VSUE 2F9IA 2BZRA 2PBPA 3R9QA 5KJPA 2IEXA 4WCZA 2ZL3A 3R6HA 2D3TA 4JOTA 3ST9A 5DL1A 1RJNA 5DTPA 4ELWA 4B3IA 1W2XA 3ZWAA 4Q0GA 1X0UA 3H0QA 4B3HA 1EF9A 5JBXA 1XO6A 5FUSA 2F6QA 2VSSF 3TRRA 4JYJA 2GTRA 3OMEA 4I4ZA 4G2RA 3Q0JA 4JCQA 3GKBA 3KQFA 3HLN1 3TVUA 1UIYA 4FNDA 4ZDBA 3HP0A 4ZU2A 3H0UA 3PGQA 4FZWC 2VSUA 2J5IB 4FN8A 5CTCA 3TLFA 3T88A 3DJAA 3DORA 2J5GA 4FB8A 1MJ3A 4RYFA 4RCNA 3ISAA 3H0SA 1HNOA 2PPYA 3ZW9A 1SZOA 3SWXA 1EY3A 4FZWA 3T8AA 4FNBA 4L6WA 2F6IA 2ZQRA 2F9YB 2VSSA 4GM2A 2X58A 2EJ5A 3NJBA 5DZKH 3QKAA 3JU1A 3OT6A 1JXZA 4GHNA 4DI1A 3IB9A 4ZDDA 2NP9A 3H81A 4K29A 3TDCA 3U9SB 3TT7A 4KWBA 2J5II 1WDMA 4Z0MA 4JCTA 1ON3A 3U9TB 4JCRA 2UZFA 3FDUA 3MOYA 3P2LA 3GLMA 4ELSA 1XX4A 3T8BA 4Q1IA 3R0OA 2FBMA 4U18A 3V5EA 2ZQQA 1Q51A 3K50A 4LK5A 1J7XA 3L3SA 4U19A 4JWVA 5DKPA 1N6DA 2CBYA 2Q2XA 2W3PA 3R9TA 4ZDEA 3KTKA 5INFA 2DEOA 3QREA 3P85A 3I47A 3R9SA 2CE3A 3H0JA 3PEAA 5C9GA 2Q34A 4IZDA 3QK8A 1XNVA 4KPKA 1UYTA 4U0HA 2VSUF 3KTJA 3IBBA 2A7KA 4OG1A 4EMPA 3GF3A 4NNQA 1Q52A 3G64A 5E0SH 2HW5A 1EF8A 3BF0A 3GMAA 4I52A 4NEKA 1FCFA 1YG6A 1N6EA 1TG6A 1NZYA 3ZWBA 3BPPA 3QWDA 4IZCA 5IKLB 1K32A 1DCIA 4ZDCA 4MOUA 3VIVA 4WYOB 5INGA 4HC8A 2VX2A 1NZYB 3T89A 4HNKA 1XNWA 2J5IA 3NJDA 2J5GD 3QXZA 3M6NA 5DZKA 4FN7A 4FJWD 3MT6A 1UYSA 1WZ8A 5DU4A 3H02A 3QMJA 3STAA 1RJMA 3SLLA 3P5MA 1N6FA 5INIA 3U9RB 2WTBA 3QXIA 4F47A 1UYRA 4KD6A 1HNUA 5E0SA 3QYRA 2VSSE 5MGBA 4MXIA 3HE2A 2A81A 3M6MA 3BEZA 1YG8A 1PJHA 4YLHA 2FZSA 4JFCA 3Q0GA 5DU6A 1DUBA 3PZKA 5JBWA 5C90A 2Q35A 4U0GH 3T3WA 4JSBA 1K39A 3RSTA 4MI2A 4OLQA 3IAVA 1Y7OA 3LAOA 1PIXA 3WG5A 4B3JA 4QIIA 2QQ3A 2VSUC 3GF7A 4OMRA 3Q7HA 4KNPA 5G1QA 2C8TA 2J5SA 3HINA 3K8XA 3N6RB 3V5IA 2ZL4A 5G1RA 4QIJA 4I42A 1FC9A 4L8KA 3KTGA 4JJTA 3Q1TA 1WDKA 1ON9A 4JCSA 3TVWA 3RSIA 4IZBA 3LKEA 3RRVA 5FIFA 5DTWA 3PE8A 4ASIA 1O8UA 1VRGA 3KTIA 3ZW8A 2FW2A 1TYFA 5DUCA 2DUBA 1OD2A 4JYLA 3HRXA 1HZDA 3TT6A 4ZDFA
chains in the Genus database with same CATH superfamily
1D7MA 1OVVA 1DIPA 1HTLC 4C7NB 2CPBA 4BWNA 5CTBA 2PGDA 1LTSC 2RMZA 3CCMP 2R3CA 5AW3B 2E42A 3L70D 2YXRB 1GD2E 5CHXA 2FXPA 1Y8AA 5CCGC 2ZL2A 2KP8A 2LR2A 3II6A 1FJPA 3H1HG 4K3WA 2ZL0A 3HE4B 4N6JA 4OGQD 4QFEA 1K73Q 3KTHA 3TZ3A 5KKZB 2W83C 2OTLP 2Q3EA 4LC1A 1HWTC 2FFDA 5G1SA 2X24A 5KDRB 4WY4A 5BVZA 1TU3F 2F9IB 4JVTA 3L72J 3P8CE 1NTZK 2O1KA 3L72G 3L73G 5KDRA 1VQLP 5KTBA 1EDJA 4U0GA 3L72E 3RL0C 2ZJSE 3Q5SA 1BE3E 3M9BA 1NTZE 1XTCC 2P7JA 2ZL3A 1JMMA 2D3TA 5AVVB 2K9YA 3A5TA 1NTZJ 3BRVB 1RJNA 1JTHB 4EDFA 2MKVA 3HD7D 1OZHA 5CJ4A 1PPJE 1ZLLA 3H0QA 4B3HA 4Z1MH 1KILB 2WSEJ 3H25A 1URQD 3B4SA 2IBZE 2F6QA 2KZJA 5L8RJ 1OW8A 3CCRP 1HVVA 3MUDC 4G2RA 1PGPA 5B66E 4JCQA 1LJ2A 1DH3A 5CCGD 3HLN1 1SP4A 2LXCB 1IFIA 2KIKA 2A06E 3TVUA 3AE6C 1LTTC 2W8ZA 1N73B 4ZDBA 4PD4I 3AE3C 1VQPP 5APSA 3HP0A 1BGYG 2CK3H 3H0UA 2OGUA 2B87B 4H44D 4FN8A 1W5CE 2XNXA 5CTCA 3DJAA 2J5GA 5GTIH 2HR3A 2QEXP 3CLQA 2IYOA 2ZVNB 4ZKUA 1YJWP 1SQBE 2LKMA 4U7JA 3RL0D 1OW7A 3VYIA 5AW5B 3CI9A 2F9YB 4GM2A 3B5NC 4PJ0H 5DZKH 1GU5A 3AE4C 3IAOA 5B66H 1JXZA 2YO3A 4YXWH 4DI1A 3CCSP 3OAKA 2NPSA 4K29A 1J1EB 4ASVA 3U9SB 2IZ0A 1QEXA 3A7OA 3A0BH 1WDMA 3WU2E 2QA4P 1LTJA 1KMIZ 1LWUA 1ON3A 2I1KA 5BU5A 2WVRA 3FDUA 3MOYA 3P2LA 3GLMA 3S4RA 5KLVD 5APQA 1XX4A 1Q7YQ 4ZNCA 1NTZG 2FBMA 3P32A 3K50A 1ZRTE 2V7QH 4U19A 1OXZA 1FZFA 1N6DA 2CBYA 1BCCG 5AW8B 2G8YA 3AECC 1HF9A 1AFOA 3KTKA 5B5EH 5INFA 4N3YB 1L4AD 2YXQB 2DEOA 3P85A 3QREA 4JBZA 2P10A 5APVA 1AA0A 4IL6H 3VP9A 1LT9C 3FWNA 5DJUB 3M0DA 5E79E 3JSVC 4C46A 2JDIH 2LXBA 1SQXG 3L74D 3PTZA 4WY4C 1HJ0A 4EMPA 2QJPB 1FC2C 3AE7C 5E0SH 1LNQA 4OVNF 4KHXA 3CMAP 1NTMD 2B9BA 2A06G 2N1TC 1T2KC 3ZWBA 3CMEP 1L4AC 4H0LC 1FJKA 1DCIA 1PP9D 3CCJP 4WYOB 1GW3A 1LP1A 1T6AA 4HC8A 1VQ4P 1GL2A 2WPRA 5AW7B 1NZYB 3H1HJ 3T89A 2J5IA 1PFIA 2E76C 5DZKA 1FZCA 3MT6A 1UYSA 4QMAA 1SQPK 4NPDA 3O8ZA 1ZW0A 2E74C 1KC8Q 2G3AA 4U3FE 3HE4A 1SQQD 1N2DC 4PD4H 1FZCB 2WTBA 4F47A 2E76D 1UYRA 1HBWA 2XNDH 1HNUA 1PGJA 1EDLA 2VSSE 5MGBA 2Y9YA 3EQ2A 3PH0A 3M6MA 3BEZA 2O1JA 1FDMA 1BDDA 2BEZF 1NU1J 3IFMA 5TISH 3H1IJ 3Q0GA 1GU4A 1NU1G 2K1AA 4DOJA 1ZXGA 1N7SD 4GODA 3CCUP 2AXTH 3T3WA 2E74D 1S5LE 2PRRA 1YIJP 4MI2A 2W6JH 1J2JB 1HUCA 4JPZB 1PIXA 2KK7A 2YIUC 3VOPA 4QIIA 2QQ3A 3U59A 3GF7A 3Q7HA 4KNPA 1A02J 2C8TA 1N7SB 1R5SA 3H1KD 3H32B 3CCEP 4MN4C 1YJNP 5CMZA 1FBMA 4XE5B 1CI6A 1X22A 1IFPA 4JJTA 1WDKA 3S9OA 1HH0A 2OQQA 1L0LE 4YTPC 4BXLA 1QX8A 1JO5A 3RRVA 3H1JJ 2BCCE 2YKOA 1S2EA 1VQMP 1NTZD 2KXPB 1N73A 5KAIH 4ASIA 4RO0A 1RE3A 2BASA 1NO4A 3SWFA 3HRXA 1H8AA 1HZDA 4HH2A 3TT6A 4ZDFA 3M06A 2O3JA 1IO4A 3V2QA 5DUFA 5BU8B 2A45I 1GL2B 3MFMA 3HRNA 2A7SA 4U1AA 3MP7B 1FU1A 3QWOC 1SG4A 2KYVA 2KB7P 2ITAA 2JR8A 2M8RA 2OYIB 2WWWA 2GM4A 1RF1A 1NHLA 1R8EA 5CCGA 4KJMA 3MYBA 3V5BA 1LTJC 3A0BE 4EMLA 2NPSB 5DU8A 1EZVI 3H1IG 3MD0A 1RF1B 2Y0DA 3AE5C 3CL3D 1KTMA 1JB0J 2Q3IA 1K8AQ 3H1LG 2R32A 1EZVG 3PJSK 2VREA 5E0NX 2Z4EA 2E43A 4RYFH 4CPGA 3L73D 1NU1E 1Q90D 3TGUD 2FYNC 1VQ6P 1KB9E 5AVZB 1GL2C 3R9QA 2AEMA 5KJ7A 2QM8A 1NYHA 2HFED 3M9HA 3M9QA 2P1JA 2YIUB 3V2NA 2RH0A 1KILA 2IYPA 1IK9A 3MTUE 3A0HH 4ELWA 1FZGA 4B3IA 1W2XA 1BDCA 3ZWAA 1YI2P 3G4SP 1JOCA 1GW4A 3B5ND 1EF9A 5JBXA 3M0AA 1OMIA 3TRRA 3OJAB 4JYJA 4I7ZB 2GTRA 2KS1B 3H1LD 4JYBA 4I4ZA 4HJGH 3Q0JA 1YQ4C 1BGYE 3L74G 3GKBA 1L0LJ 1RQUA 2YMKA 5AW1B 1KILE 2ZAEB 2E75B 1BGYJ 3B5NB 2FYUJ 1UIYA 3SSUA 1VQ5P 5APYA 1VQOP 4JF7A 1PP9E 1ZR2A 2QG4A 1RQVA 2J5IB 1S3JA 3Q5PA 3T88A 1IC2A 1A02F 3GG2A 1MJ3A 1JEKA 3CX5E 3W68A 3HE5A 4H0LD 1OVRA 2L5GB 3T97A 1BE3J 1HNOA 3H0SA 3ZW9A 1NTKK 5AVTB 4AYCA 4PV1B 1EY3A 4FZWA 3T8AA 4L6WA 2F6IA 1IZNB 2YKPA 2X58A 3FXDA 3T97B 1DD4A 5EFWB 3TYYA 1FZEA 2IPPA 3QKAA 3JU1A 1LTJB 3VP8A 3OT6A 2O01N 2JWAA 4ZDDA 3QH9A 1QGKB 3H81A 1GDTA 1NTKJ 3E1IA 5C39A 3TT7A 5M1BA 3IR9A 1EZVE 2N1TD 5GTHE 1G1JA 2R5DA 3U9TB 4JCRA 2Z5IA 4U3FG 1S5LH 1W2BO 3CXHD 1EZVD 1SQXK 2QJPC 4D6TJ 1OFCX 1G2CB 1LWUB 3TDKA 3L75G 3O6QA 5TISE 1E5WA 4UB8E 1MV8A 3PLNA 3H1KJ 1DD3A 2N1TB 3BRTB 5DKPA 5CJ0A 2Q2XA 3SFEC 2W3PA 4Y99B 1FDOA 1L4AB 1Y47A 4W80A 3I47A 1ZRTD 3VMYA 1SQVJ 1OW6A 2QJKB 4IFFA 3CXHH 3F5HA 3H1KE 3PEAA 3D6YA 3WUVA 1RY3A 1VF5C 1FOSE 5C9GA 4M3LA 4DJGA 4IZDA 3QK8A 1S1CX 1SQBJ 2IDBA 3CPWO 1IFDA 2J59M 3HUSB 4U0HA 2YO2A 1P84D 2E5TA 1JY3O 1M57D 1X8YA 3CWBG 4IL6X 4OG1A 3GF3A 3G64A 1P84E 3C8VA 3I5CA 1EF8A 2HW5A 3BF0A 1URQB 3TNUB 3HUSA 4NEKA 1YJ9P 3MZWB 1KQFB 3RK2D 1WMKA 3SWKA 3B5NA 3BPPA 3QWDA 2FYUE 2IFNA 4IZCA 1SQQE 2Q7CA 1X79B 1EXIA 3L71G 1SLQA 2HODB 1SQQJ 3LW5J 1BGYD 3WUTA 3C1LA 2H43A 2H7HA 1L0LD 3M6NA 4FJWD 4JQ0D 1CZQA 5APWA 2IBZD 5DJTB 3H02A 3STAA 3HUSC 1PV3A 3P5MA 5KLVJ 1LTAC 3I55P 4R4MA 1L0NG 5CBNA 5KLVE 4KD6A 2A06D 4H44C 5KLIC 4MXIA 2WSFH 3L70G 3H1JG 2IX7C 3AEBC 4DCKA 1N73C 1YG8A 1PJHA 4YLHA 2FZSA 4O9BA 1SQPE 1USDA 1AQTA 1OVUA 3L71J 5DU6A 2IBZG 1BSHA 2WT7A 3LW5H 5C90A 2Q35A 1UIIA 4U0GH 1KYOD 3L73J 4NARA 1GL2D 3RSTA 1Q82Q 1U57A 5AW0B 4R4LA 3BVHA 3IAVA 2KLUA 1Y7OA 3A0HE 3O6QB 2VSUC 4H13D 2J5SA 2JO1A 3K8XA 1J1DB 3V5IA 1SQVE 1KYOH 1RF0A 2KS1A 3NFQA 2ZXXA 5TJHA 3KTGA 4RKUJ 3H32A 5KAFE 4IZBA 4H0LB 2YKQA 2QJYC 5FIFA 1IFNA 5DTWA 1VQ8P 3MIWA 2OYHC 3ZDMA 4HYTB 3KTIA 3RK3E 3G71P 1S9KE 1P84I 3ZW8A 3BASA 1JNMA 1PGQA 3VMAA 1NTME 2GUVA 3IN6A 1LGHB 3TGUJ 4EI2A 1LP1B 5AVRB 1GMJA 2FKWB 2QM7A 2C9LY 1E79H 2E74B 2Y0CA 2YMYA 4ZKPA 3RK2C 5APTA 1KV4A 1BE3G 1VL2A 4WZ8B 2FYNB 2KNCB 5AVWB 5KKZC 1AVOA 1SFCA 1KQLA 1OD4A 3L74E 2SPZA 3P8CD 5K5GB 1UYVA 2FFDB 4WY4B 3R2PA 3RK2B 3BCCG 3V2PA 3L36A 1SVFA 4ELXA 5AW6B 3TV5A 3L72D 3FF6A 1XNYA 2OYIA 2QVAA 5AW9B 1YYCA 3BCCE 4PD4D 5E79H 1VQ9P 3Q2YA 3CD6P 4EMMA 1M90Q 2R3SA 3BCCJ 3USSA 1KZUB 2Q6QA 1LT1A 5AVUB 1M56D 4K2NA 2IZ1A 3H1JE 1SQPJ 2R44A 3NXSA 3RBXA 2ZFCA 1N86A 2C0WA 2FYUG 3OC7A 1WRGA 2F9IA 2BZRA 2ZT9D 5KJPA 1NU1D 1AVYA 4EYYQ 1KQSO 3FWLA 3R6HA 3EFFK 3AEDC 2W6AA 1PPJG 3Q1MA 3TK1A 5DL1A 5DTPA 1SQXE 1KILD 3KPEA 4Q0GA 4L75A 4DT0A 2M3BA 2BCCG 1LWUC 2KUBA 3LIEA 1XO6A 3NMDA 2I1JA 3LIDA 4NPEA 1NOHA 1URQA 2JWDA 4GIFA 5APXA 3MHVA 1SQQG 3KQFA 1NTKG 2QJKC 2WPSA 3H1HD 1USEA 2OYOA 1NAFA 1NKNA 5KLVK 1HJBA 3HTKB 2QE7H 5KJ7D 2VSUA 3HD7C 3Q3DA 2HODA 2YNYA 4PD4E 1FOSF 3L4FA 1KORA 3TLFA 3EFGA 5GTIE 3DORA 1NTMJ 2R5BA 3TF5A 2K9JB 3FX0A 3ISAA 3HD7A 3B8EB 2PPYA 3TGUG 5KJ7C 1SZOA 1SS1A 1JY2P 3KXDA 1S4XA 2B89A 4FNBA 1VF5D 1L0ND 2P67A 4B86A 1DEEG 2ZQRA 3N7NA 3E7KA 2WPQA 3CCVP 3NJBA 2D2CC 2M5AB 1T8ZA 1MUUA 2NP9A 1CW5A 2VRSA 4EOTA 2A45G 1VF5B 4KWBA 4PV1C 4Z0MA 4JCTA 2JKVA 4EIJA 2UZFA 3SFDC 1EDIA 4L76A 4IFDK 5AVXB 1VQKP 3TSIA 3MUDA 2ZXEB 1N8RQ 1Q2NA 2IFMA 2P58A 2QSIA 2HYNA 4U18A 3V5EA 2ZQQA 1Q51A 4L73A 4LK5A 1RH5B 3M0DC 4GOEA 4JWVA 2Y9ZA 2WSCH 3R9TA 4ZDEA 3V4WA 2Z5HA 2I8DA 1G2CA 4HKZH 2CE3A 3CX5H 2M0BA 2Q34A 3B71A 2W6BA 1KFMA 2N1TA 3VN0A 1XNVA 2ZYDA 1MFTA 4H13B 2XU6A 2FXMA 1UYTA 3IF4A 1S5LX 2VSUF 2KZIA 2ZYAA 1KYOI 2A7KA 3IBBA 4NNQA 1Q52A 1PGOA 2V4HA 4I52A 1FCFA 3CX5I 1TG6A 4W7ZA 4IFMA 1U7MA 5H2FH 1NVOA 3GHGB 3P7KA 1NTKE 1K32A 1L0NK 4LGDE 4ZMDA 4ZDCA 4MOUA 1NAYA 1Y9BA 3ITKA 5INGA 2VX2A 1Z56A 3NJDA 2XZRA 3OA7A 4WY4D 4WB4A 1M1KQ 1SFCB 5AVSB 4HDTA 1EC5A 2OARA 1MKMA 5DU4A 4H13C 1LTGC 3D6ZA 3U9RB 1YTZT 2XDJA 1YBKA 2NPSC 4A7PA 2KSEA 5E0SA 1L0NJ 3KDPB 1RF1C 3RK3B 2WT7B 3HE2A 2A81A 3R4YA 1QL1A 1FZAA 1L0NE 1SQXD 1Q86Q 3AE8C 4N78E 2L91A 3MGNA 1OWAA 2RN0A 4XFJA 3U1CA 4JYCA 1SQPD 2OTJP 1BCCJ 3PRJA 1K39A 3D71A 4I2LC 2FY8A 3V4QA 1NGMB 1SQBD 3BCCD 4OLQA 1KQGB 3RBZA 4TT3H 3LAOA 3WG5A 4B3JA 3UIAA 1M7LA 3KZIE 3M91A 3E1RA 1JY3P 3WMM0 1YHQP 4YPCA 2HLOA 4NPFX 5G1QA 1NKZB 2Q9IA 1IFMA 1FZCC 3CX5D 3HINA 4D6TG 1S72P 1DEBA 1QVFO 1K9MQ 2HPCB 5G1RA 4QIJA 1JY2O 4I42A 4IL6E 2FYUK 1FC9A 1NU1K 4L8KA 1NTMK 3KYQA 3L70J 1WT6A 4DZOA 2FYUD 3Q1TA 5AVQB 4OH8B 1KN7A 4JCSA 2C0XA 1QVGO 2WMMA 3D70A 4L74A 1CI6B 1JMBA 3CWBD 1W2EA 1HGZA 2J5UA 3PE8A 1X0TA 3TNUA 3L75D 3AEGC 1NTKD 2W90A 1O8UA 2AEFA 2JP3A 1NJIQ 4I1LA 3I56P 2DUBA 1VQ7P 3CC2P 1J1DC 4JYLA 3L71E 1PL5A 2KNCA 2O01H 4PV1D 1FC7A 1NH4A 3CCLP 3AE1C 1JUNA 1SFCC 2PG8A 1BE3D 3AE9C 2F9YA 3AEAC 4U3FD 4H44B 5KLIB 4D6TE 1OX3A 4BRYB 2FYZA 3BATA 3RL0B 4GT1A 5CCHA 2POHA 1FC6A 1DX7A 1ZMEC 5CCHC 1AQ5A 3L37A 4BRYA 1WDLA 1KD1Q 1T3UA 2WPVB 4HB1A 3V6IA 2D2CD 1KB9I 3ZWCA 1FE6A 1L0LG 3GHGC 4U3FJ 4WBAA 2WITA 1M1JC 2VSUE 2E75D 1SQVK 2H88C 2CPSA 2PBPA 3L71D 4UB8H 1BCCE 1JY3N 5AW4B 2UWJE 2IEXA 4WCZA 2OYHA 2Y0EA 3RGUA 4J2UA 3N4XA 3ABVC 2H89C 1L4AA 4GOFA 2J58A 4K3AA 1VDFA 4Y99C 4JOTA 3ST9A 3CC4P 1N7SC 3BPTA 3EWKA 1BSNA 2OYHB 1X0UA 2BCCD 3G6EP 3H1IE 3GW6A 1FDIA 2QJYB 5FUSA 2VSSF 2M3EA 2XV5A 4UB6E 2WQYC 2WSEH 1UIXA 2GUSA 1H89A 3OMEA 4GDOA 2OTKE 1RE3C 2KOGA 3CWBJ 3A3YB 3L70E 3HTKA 3AEEC 4IOIH 5H2FE 4I7ZC 3W67A 3VTPC 4FNDA 4OWFA 1T2KD 1RE4C 4W7YA 1H88A 4ZU2A 4FZWC 3PGQA 1XTGB 2PAJA 2KSJA 2YJGA 2PFXA 1LTIC 3JCUH 2O01J 5AVYB 3K5BA 4FB8A 1GZLA 1K05A 2XKMA 4RYFA 1L0LK 2NRGA 5KAIE 2JEEA 1OIPA 1KFNA 4WVZA 4RCNA 1X9VA 4C7RA 4AQRD 3JCUE 1M8OB 2V7QJ 2ZVOB 3SWXA 4RJTA 1BCCD 1JCDA 2VSSA 1YTZI 3HD7B 3L73E 2EJ5A 1IFJA 4K35A 3JC22 1SQXJ 3Q5RA 1FAVA 1SQVD 4GHNA 3IB9A 2ZYGA 3U1AA 4PJ0E 1AJYA 2BEQD 4UB6H 5KLVG 2WZ7A 5APUA 3TDCA 3L75J 3V2RA 2FBWC 2J5II 1P84H 4OGQB 1JY2N 3H1JD 2HG5D 3H1HE 4GKGA 4D6TD 4YXDC 4ELSA 1LT9A 1K04A 3T8BA 1M1JB 5CCHD 4Q1IA 2WSSH 1KILC 3R0OA 3RK3C 2QRXA 1J7XA 3L3SA 1EQ7A 1KB9H 1MZ9A 1M1JA 4WWIA 4AUWA 2W27A 3R9SA 2K37A 3H0JA 3FXEA 2HPCA 1JTHA 4KT0J 1SQVG 1L2PA 2NZ2A 1KYOE 1YITP 1URQC 3H6PA 4N78D 4KPKA 3WUUA 2QIWA 3KTJA 2FXOA 3TGUE 2NPSD 1QL2A 3G3ZA 1SFCD 1KB9D 5AW2B 1FS0E 1IJDB 3H1ID 1SQQK 2C9NY 2P2UA 2IBZI 3GMAA 1ZV8A 2RKLA 3CWBE 1YG6A 1N6EA 2Q1KA 3FGAD 4XA4A 3L74J 1NZYA 1AV1A 1S9KD 1RF0C 2KLVA 5IKLB 1PPJD 3H1KG 1R5LA 2PP6A 3VIVA 3AEFC 1GTWA 1NTMG 4HNKA 1XNWA 1U7JA 1N7LA 2J5GD 2E5YA 3QXZA 4FN7A 4RESB 3CC7P 1GK6A 2AEJA 1QLED 3HE5B 4Y28J 1H0TA 1WZ8A 2D2CB 2WSFJ 3QMJA 1EXJA 1YQ3C 1IK7A 3L35A 1RJMA 3SLLA 2FFDC 1N6FA 1J1EC 5INIA 1MFZA 1ZP0C 3C9IA 3QXIA 2BCCJ 1H0TB 1PP9J 1VPCA 3AE2C 2MJZA 3CCQP 2ZT9C 2DW3A 2M5AA 4ASWA 3QYRA 1T3JA 5B5EE 1SQPG 1RE4A 4TLFA 1JCCA 3L75E 2E76B 1HGVA 4JFCA 3G9RA 1ZR4A 1VQNP 2WSCJ 1DUBA 5CBOA 3PZKA 5JBWA 3KZIH 2KI7B 1LT9B 4JSBA 2N9YB 2A45H 4I6MC 1PZQA 4LLHA 3RL0g 1LTBC 3WU2H 3NTNA 2B88A 1ZN5A 2AXTE 4OMRA 3PHLA 2N9BA 1PP9G 2H8PD 3N6RB 1CSBA 2ZL4A 1FZBA 3RK3D 3P8MC 3H1LJ 5HUQA 2ZT9B 3CXHE 1Q81Q 3S1KA 1JM0A 1N7SA 1EDKA 3A2AA 1ON9A 1SQBG 3H1LE 3TVWA 3CXHI 2JJLA 3RSIA 3LKEA 3SWYA 1RHZB 3KQGA 1NWQA 3KHUA 2OYIC 1SQBK 3OW2O 3VMXA 3VMZA 2WTYA 1G1IA 2K88A 1ZOYC 1VRGA 3F89A 2FW2A 1TYFA 2Q5UA 5DUCA 4C7NA 5KAFH 2B87A 3GHGA 4OGQC 2GA1A 3PP5A 1GK4A 2AXCA 2E75C 2K3RA 1OD2A 5GTHH 2K9JA
chains in the Genus database with same CATH topology
5DUFA 1DIPA 1GMJA 4PV1D 3MFMA 2E74B 1FC7A 3AE1C 2A7SA 5CTBA 4U1AA 1VL2A 2PG8A 4WZ8B 3AE9C 1SG4A 5KKZC 2F9YA 2FXPA 1OD4A 3AEAC 1UYVA 4H44B 2ZL2A 1R8EA 4K3WA 3MYBA 2ZL0A 4ELXA 4OGQD 4QFEA 3TV5A 3KTHA 5DU8A 3FF6A 3TZ3A 1XNYA 4EMLA 1FC6A 1ZMEC 5G1SA 2X24A 5KDRB 3AE5C 1KTMA 1JB0J 1WDLA 3Q2YA 4EMMA 1TU3F 2F9IB 4JVTA 2WPVB 2VREA 5E0NX 2D2CD 4K2NA 4RYFH 3ZWCA 5KDRA 1Q90D 2FYNC 4U0GA 3OC7A 2VSUE 2F9IA 2BZRA 2E75D 3Q5SA 2ZT9D 2H88C 2PBPA 3R9QA 5KJPA 1NYHA 2IEXA 4WCZA 2ZL3A 4J2UA 3ABVC 2H89C 3R6HA 2D3TA 2K9YA 3AEDC 3Q1MA 4JOTA 3ST9A 5DL1A 1RJNA 5DTPA 4ELWA 2MKVA 4B3IA 3BPTA 1W2XA 3ZWAA 3EWKA 4Q0GA 1X0UA 3H0QA 4B3HA 4Z1MH 1EF9A 2WSEJ 5JBXA 1FDIA 1XO6A 3H25A 1OMIA 5FUSA 2F6QA 5L8RJ 2VSSF 3TRRA 4JYJA 1OW8A 4I7ZB 2GTRA 2WQYC 1UIXA 3OMEA 4GDOA 4G2RA 4I4ZA 3Q0JA 1YQ4C 4JCQA 3GKBA 3AEEC 3KQFA 2QJKC 1RQUA 2YMKA 3HLN1 1KILE 2E75B 4I7ZC 3TVUA 1UIYA 3AE6C 4FNDA 4ZDBA 3AE3C 3HP0A 4ZU2A 3H0UA 3PGQA 4FZWC 2VSUA 2YJGA 3Q3DA 4H44D 2O01J 2J5IB 1RQVA 4FN8A 5CTCA 3Q5PA 1KORA 3TLFA 3T88A 3DJAA 3DORA 2J5GA 4FB8A 1K05A 1MJ3A 4RYFA 4RCNA 3ISAA 4H0LD 3H0SA 1HNOA 2V7QJ 2PPYA 3ZW9A 4U7JA 1SZOA 3SWXA 4PV1B 1EY3A 4FZWA 3T8AA 4FNBA 4L6WA 1VF5D 2F6IA 1OW7A 2ZQRA 2F9YB 2VSSA 4GM2A 2X58A 2EJ5A 3NJBA 5DZKH 3T97B 1DD4A 3AE4C 3QKAA 3JU1A 3IAOA 3Q5RA 2D2CC 3OT6A 1JXZA 4GHNA 3IB9A 4DI1A 4ZDDA 2NP9A 1AJYA 2BEQD 3H81A 4K29A 3TDCA 3U9SB 3TT7A 1VF5B 4KWBA 2FBWC 5M1BA 2J5II 1WDMA 1KMIZ 4PV1C 4Z0MA 4JCTA 4OGQB 1ON3A 3U9TB 4JCRA 2UZFA 3FDUA 3SFDC 3MOYA 3P2LA 3GLMA 4YXDC 4ELSA 2QJPC 1XX4A 1K04A 3T8BA 4Q1IA 2QSIA 3R0OA 2FBMA 4U18A 3V5EA 2ZQQA 1Q51A 3O6QA 3K50A 4LK5A 1ZRTE 1J7XA 3L3SA 4U19A 4JWVA 1DD3A 5DKPA 1N6DA 2CBYA 2G8YA 3AECC 3SFEC 1HF9A 2Q2XA 2W3PA 3R9TA 4ZDEA 3KTKA 1FDOA 5INFA 2DEOA 3QREA 3P85A 3I47A 3R9SA 2P10A 1OW6A 2CE3A 3H0JA 3PEAA 3D6YA 1VF5C 5C9GA 4KT0J 2Q34A 3B71A 4IZDA 3QK8A 2NZ2A 1S1CX 1XNVA 2IDBA 4H13B 4KPKA 1UYTA 1S5LX 2VSUF 2QIWA 3KTJA 4U0HA 4IL6X 3IBBA 2A7KA 4OG1A 1HJ0A 4EMPA 3GF3A 4NNQA 1Q52A 3AE7C 3G64A 5E0SH 3C8VA 2HW5A 1EF8A 3BF0A 3GMAA 4I52A 4NEKA 1FCFA 1YG6A 1KQFB 1N6EA 1TG6A 1WMKA 3FGAD 1NZYA 3ZWBA 3BPPA 3QWDA 4IZCA 4H0LC 5IKLB 1K32A 1DCIA 4ZDCA 4MOUA 3AEFC 3VIVA 1Y9BA 4WYOB 5INGA 1EXIA 4HC8A 2VX2A 3LW5J 1NZYB 3T89A 4HNKA 1XNWA 2J5IA 3NJDA 2J5GD 3QXZA 2E76C 3M6NA 5DZKA 4FN7A 4FJWD 3MT6A 4HDTA 1MKMA 4Y28J 1UYSA 1WZ8A 5DU4A 4H13C 2D2CB 2WSFJ 3H02A 3QMJA 3STAA 1EXJA 1YQ3C 1IK7A 1PV3A 1RJMA 3SLLA 2E74C 2G3AA 3P5MA 1N6FA 5INIA 3D6ZA 3U9RB 4R4MA 1ZP0C 2WTBA 3QXIA 4F47A 2E76D 1UYRA 3AE2C 4KD6A 1HNUA 2ZT9C 5E0SA 4H44C 5KLIC 3QYRA 2VSSE 5MGBA 4MXIA 3HE2A 3AEBC 2A81A 3R4YA 3M6MA 3BEZA 1YG8A 1PJHA 4YLHA 2FZSA 2BEZF 2E76B 4JFCA 3G9RA 3Q0GA 5DU6A 3AE8C 2WSCJ 1DUBA 3PZKA 5JBWA 4XFJA 5C90A 2Q35A 4U0GH 3T3WA 4NARA 4JSBA 1K39A 2E74D 3D71A 3RSTA 4MI2A 1U57A 1NGMB 4R4LA 1KQGB 4OLQA 3IAVA 1Y7OA 4TT3H 3RL0g 3LAOA 1PIXA 3WG5A 4B3JA 2YIUC 4QIIA 2QQ3A 2VSUC 3GF7A 4OMRA 3Q7HA 4KNPA 5G1QA 2C8TA 4H13D 2J5SA 2JO1A 3HINA 3K8XA 3N6RB 3V5IA 2ZL4A 5G1RA 4QIJA 5HUQA 4I42A 2ZT9B 1FC9A 4L8KA 3KTGA 4RKUJ 4JJTA 3Q1TA 1WDKA 3S9OA 1ON9A 2OQQA 4JCSA 4YTPC 3TVWA 3RSIA 4IZBA 4H0LB 3D70A 3LKEA 3RRVA 2QJYC 5FIFA 5DTWA 2J5UA 3PE8A 1ZOYC 3AEGC 4ASIA 1O8UA 1VRGA 3KTIA 2JP3A 3RK3E 3ZW8A 2FW2A 1TYFA 5DUCA 4OGQC 2DUBA 2E75C 1OD2A 4JYLA 3IN6A 3HRXA 1PL5A 1HZDA 3TT6A 4ZDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUF A;  3MFM A;  1FC7 A;  2A7S A;  5CTB A;  4U1A A;  2PG8 A;  4WZ8 B;  1SG4 A;  2F9Y A;  1OD4 A;  1UYV A;  2ZL2 A;  4K3W A;  3MYB A;  2ZL0 A;  4ELX A;  4QFE A;  3TV5 A;  3KTH A;  3TZ3 A;  3FF6 A;  4EML A;  1XNY A;  5DU8 A;  1FC6 A;  5G1S A;  2X24 A;  5KDR B;  1WDL A;  4EMM A;  2F9I B;  4JVT A;  2VRE A;  5E0N X;  4K2N A;  4RYF H;  3ZWC A;  5KDR A;  4U0G A;  3OC7 A;  2VSU E;  2F9I A;  2BZR A;  2PBP A;  3R9Q A;  5KJP A;  2IEX A;  4WCZ A;  2ZL3 A;  3R6H A;  2D3T A;  4JOT A;  3ST9 A;  5DL1 A;  1RJN A;  5DTP A;  4ELW A;  4B3I A;  1W2X A;  3ZWA A;  4Q0G A;  1X0U A;  3H0Q A;  4B3H A;  1EF9 A;  5JBX A;  1XO6 A;  5FUS A;  2F6Q A;  2VSS F;  3TRR A;  4JYJ A;  2GTR A;  3OME A;  4I4Z A;  4G2R A;  3Q0J A;  4JCQ A;  3GKB A;  3KQF A;  3HLN 1;  3TVU A;  1UIY A;  4FND A;  4ZDB A;  3HP0 A;  4ZU2 A;  3H0U A;  3PGQ A;  4FZW C;  2VSU A;  2J5I B;  4FN8 A;  5CTC A;  3TLF A;  3T88 A;  3DJA A;  3DOR A;  2J5G A;  4FB8 A;  1MJ3 A;  4RYF A;  4RCN A;  3ISA A;  3H0S A;  1HNO A;  2PPY A;  3ZW9 A;  1SZO A;  3SWX A;  1EY3 A;  4FZW A;  3T8A A;  4FNB A;  4L6W A;  2F6I A;  2ZQR A;  2F9Y B;  2VSS A;  4GM2 A;  2X58 A;  2EJ5 A;  3NJB A;  5DZK H;  3QKA A;  3JU1 A;  3OT6 A;  1JXZ A;  4GHN A;  4DI1 A;  3IB9 A;  4ZDD A;  2NP9 A;  3H81 A;  4K29 A;  3TDC A;  3U9S B;  3TT7 A;  4KWB A;  2J5I I;  1WDM A;  4Z0M A;  4JCT A;  1ON3 A;  3U9T B;  4JCR A;  2UZF A;  3FDU A;  3MOY A;  3P2L A;  3GLM A;  4ELS A;  1XX4 A;  3T8B A;  4Q1I A;  3R0O A;  2FBM A;  4U18 A;  3V5E A;  2ZQQ A;  1Q51 A;  3K50 A;  4LK5 A;  1J7X A;  3L3S A;  4U19 A;  4JWV A;  5DKP A;  1N6D A;  2CBY A;  2Q2X A;  2W3P A;  3R9T A;  4ZDE A;  3KTK A;  5INF A;  2DEO A;  3QRE A;  3P85 A;  3I47 A;  3R9S A;  2CE3 A;  3H0J A;  3PEA A;  5C9G A;  2Q34 A;  4IZD A;  3QK8 A;  1XNV A;  4KPK A;  1UYT A;  4U0H A;  2VSU F;  3KTJ A;  3IBB A;  2A7K A;  4OG1 A;  4EMP A;  3GF3 A;  4NNQ A;  1Q52 A;  3G64 A;  5E0S H;  2HW5 A;  1EF8 A;  3BF0 A;  3GMA A;  4I52 A;  4NEK A;  1FCF A;  1YG6 A;  1N6E A;  1TG6 A;  1NZY A;  3ZWB A;  3BPP A;  3QWD A;  4IZC A;  5IKL B;  1K32 A;  1DCI A;  4ZDC A;  4MOU A;  3VIV A;  4WYO B;  5ING A;  4HC8 A;  2VX2 A;  1NZY B;  3T89 A;  4HNK A;  1XNW A;  2J5I A;  3NJD A;  2J5G D;  3QXZ A;  3M6N A;  5DZK A;  4FN7 A;  4FJW D;  3MT6 A;  1UYS A;  1WZ8 A;  5DU4 A;  3H02 A;  3QMJ A;  3STA A;  1RJM A;  3SLL A;  3P5M A;  1N6F A;  5INI A;  3U9R B;  2WTB A;  3QXI A;  4F47 A;  1UYR A;  4KD6 A;  1HNU A;  5E0S A;  3QYR A;  2VSS E;  5MGB A;  4MXI A;  3HE2 A;  2A81 A;  3M6M A;  3BEZ A;  1YG8 A;  1PJH A;  4YLH A;  2FZS A;  4JFC A;  3Q0G A;  5DU6 A;  1DUB A;  3PZK A;  5JBW A;  5C90 A;  2Q35 A;  4U0G H;  3T3W A;  4JSB A;  1K39 A;  3RST A;  4MI2 A;  4OLQ A;  3IAV A;  1Y7O A;  3LAO A;  1PIX A;  3WG5 A;  4B3J A;  4QII A;  2QQ3 A;  2VSU C;  3GF7 A;  4OMR A;  3Q7H A;  4KNP A;  5G1Q A;  2C8T A;  2J5S A;  3HIN A;  3K8X A;  3N6R B;  3V5I A;  2ZL4 A;  5G1R A;  4QIJ A;  4I42 A;  1FC9 A;  4L8K A;  3KTG A;  4JJT A;  3Q1T A;  1WDK A;  1ON9 A;  4JCS A;  3TVW A;  3RSI A;  4IZB A;  3LKE A;  3RRV A;  5FIF A;  5DTW A;  3PE8 A;  4ASI A;  1O8U A;  1VRG A;  3KTI A;  3ZW8 A;  2FW2 A;  1TYF A;  5DUC A;  2DUB A;  1OD2 A;  4JYL A;  3HRX A;  1HZD A;  3TT6 A;  4ZDF A; 
#chains in the Genus database with same CATH topology
 1D7M A;  1OVV A;  1DIP A;  1HTL C;  4C7N B;  2CPB A;  4BWN A;  5CTB A;  2PGD A;  1LTS C;  2RMZ A;  3CCM P;  2R3C A;  5AW3 B;  2E42 A;  3L70 D;  2YXR B;  1GD2 E;  5CHX A;  2FXP A;  1Y8A A;  5CCG C;  2ZL2 A;  2KP8 A;  2LR2 A;  3II6 A;  1FJP A;  3H1H G;  4K3W A;  2ZL0 A;  3HE4 B;  4N6J A;  4OGQ D;  4QFE A;  1K73 Q;  3KTH A;  3TZ3 A;  5KKZ B;  2W83 C;  2OTL P;  2Q3E A;  4LC1 A;  1HWT C;  2FFD A;  5G1S A;  2X24 A;  5KDR B;  4WY4 A;  5BVZ A;  1TU3 F;  2F9I B;  4JVT A;  3L72 J;  3P8C E;  1NTZ K;  2O1K A;  3L72 G;  3L73 G;  5KDR A;  1VQL P;  5KTB A;  1EDJ A;  4U0G A;  3L72 E;  3RL0 C;  2ZJS E;  3Q5S A;  1BE3 E;  3M9B A;  1NTZ E;  1XTC C;  2P7J A;  2ZL3 A;  1JMM A;  2D3T A;  5AVV B;  2K9Y A;  3A5T A;  1NTZ J;  3BRV B;  1RJN A;  1JTH B;  4EDF A;  2MKV A;  3HD7 D;  1OZH A;  5CJ4 A;  1PPJ E;  1ZLL A;  3H0Q A;  4B3H A;  4Z1M H;  1KIL B;  2WSE J;  3H25 A;  1URQ D;  3B4S A;  2IBZ E;  2F6Q A;  2KZJ A;  5L8R J;  1OW8 A;  3CCR P;  1HVV A;  3MUD C;  4G2R A;  1PGP A;  5B66 E;  4JCQ A;  1LJ2 A;  1DH3 A;  5CCG D;  3HLN 1;  1SP4 A;  2LXC B;  1IFI A;  2KIK A;  2A06 E;  3TVU A;  3AE6 C;  1LTT C;  2W8Z A;  1N73 B;  4ZDB A;  4PD4 I;  3AE3 C;  1VQP P;  5APS A;  3HP0 A;  1BGY G;  2CK3 H;  3H0U A;  2OGU A;  2B87 B;  4H44 D;  4FN8 A;  1W5C E;  2XNX A;  5CTC A;  3DJA A;  2J5G A;  5GTI H;  2HR3 A;  2QEX P;  3CLQ A;  2IYO A;  2ZVN B;  4ZKU A;  1YJW P;  1SQB E;  2LKM A;  4U7J A;  3RL0 D;  1OW7 A;  3VYI A;  5AW5 B;  3CI9 A;  2F9Y B;  4GM2 A;  3B5N C;  4PJ0 H;  5DZK H;  1GU5 A;  3AE4 C;  3IAO A;  5B66 H;  1JXZ A;  2YO3 A;  4YXW H;  4DI1 A;  3CCS P;  3OAK A;  2NPS A;  4K29 A;  1J1E B;  4ASV A;  3U9S B;  2IZ0 A;  1QEX A;  3A7O A;  3A0B H;  1WDM A;  3WU2 E;  2QA4 P;  1LTJ A;  1KMI Z;  1LWU A;  1ON3 A;  2I1K A;  5BU5 A;  2WVR A;  3FDU A;  3MOY A;  3P2L A;  3GLM A;  3S4R A;  5KLV D;  5APQ A;  1XX4 A;  1Q7Y Q;  4ZNC A;  1NTZ G;  2FBM A;  3P32 A;  3K50 A;  1ZRT E;  2V7Q H;  4U19 A;  1OXZ A;  1FZF A;  1N6D A;  2CBY A;  1BCC G;  5AW8 B;  2G8Y A;  3AEC C;  1HF9 A;  1AFO A;  3KTK A;  5B5E H;  5INF A;  4N3Y B;  1L4A D;  2YXQ B;  2DEO A;  3P85 A;  3QRE A;  4JBZ A;  2P10 A;  5APV A;  1AA0 A;  4IL6 H;  3VP9 A;  1LT9 C;  3FWN A;  5DJU B;  3M0D A;  5E79 E;  3JSV C;  4C46 A;  2JDI H;  2LXB A;  1SQX G;  3L74 D;  3PTZ A;  4WY4 C;  1HJ0 A;  4EMP A;  2QJP B;  1FC2 C;  3AE7 C;  5E0S H;  1LNQ A;  4OVN F;  4KHX A;  3CMA P;  1NTM D;  2B9B A;  2A06 G;  2N1T C;  1T2K C;  3ZWB A;  3CME P;  1L4A C;  4H0L C;  1FJK A;  1DCI A;  1PP9 D;  3CCJ P;  4WYO B;  1GW3 A;  1LP1 A;  1T6A A;  4HC8 A;  1VQ4 P;  1GL2 A;  2WPR A;  5AW7 B;  1NZY B;  3H1H J;  3T89 A;  2J5I A;  1PFI A;  2E76 C;  5DZK A;  1FZC A;  3MT6 A;  1UYS A;  4QMA A;  1SQP K;  4NPD A;  3O8Z A;  1ZW0 A;  2E74 C;  1KC8 Q;  2G3A A;  4U3F E;  3HE4 A;  1SQQ D;  1N2D C;  4PD4 H;  1FZC B;  2WTB A;  4F47 A;  2E76 D;  1UYR A;  1HBW A;  2XND H;  1HNU A;  1PGJ A;  1EDL A;  2VSS E;  5MGB A;  2Y9Y A;  3EQ2 A;  3PH0 A;  3M6M A;  3BEZ A;  2O1J A;  1FDM A;  1BDD A;  2BEZ F;  1NU1 J;  3IFM A;  5TIS H;  3H1I J;  3Q0G A;  1GU4 A;  1NU1 G;  2K1A A;  4DOJ A;  1ZXG A;  1N7S D;  4GOD A;  3CCU P;  2AXT H;  3T3W A;  2E74 D;  1S5L E;  2PRR A;  1YIJ P;  4MI2 A;  2W6J H;  1J2J B;  1HUC A;  4JPZ B;  1PIX A;  2KK7 A;  2YIU C;  3VOP A;  4QII A;  2QQ3 A;  3U59 A;  3GF7 A;  3Q7H A;  4KNP A;  1A02 J;  2C8T A;  1N7S B;  1R5S A;  3H1K D;  3H32 B;  3CCE P;  4MN4 C;  1YJN P;  5CMZ A;  1FBM A;  4XE5 B;  1CI6 A;  1X22 A;  1IFP A;  4JJT A;  1WDK A;  3S9O A;  1HH0 A;  2OQQ A;  1L0L E;  4YTP C;  4BXL A;  1QX8 A;  1JO5 A;  3RRV A;  3H1J J;  2BCC E;  2YKO A;  1S2E A;  1VQM P;  1NTZ D;  2KXP B;  1N73 A;  5KAI H;  4ASI A;  4RO0 A;  1RE3 A;  2BAS A;  1NO4 A;  3SWF A;  3HRX A;  1H8A A;  1HZD A;  4HH2 A;  3TT6 A;  4ZDF A;  3M06 A;  2O3J A;  1IO4 A;  3V2Q A;  5DUF A;  5BU8 B;  2A45 I;  1GL2 B;  3MFM A;  3HRN A;  2A7S A;  4U1A A;  3MP7 B;  1FU1 A;  3QWO C;  1SG4 A;  2KYV A;  2KB7 P;  2ITA A;  2JR8 A;  2M8R A;  2OYI B;  2WWW A;  2GM4 A;  1RF1 A;  1NHL A;  1R8E A;  5CCG A;  4KJM A;  3MYB A;  3V5B A;  1LTJ C;  3A0B E;  4EML A;  2NPS B;  5DU8 A;  1EZV I;  3H1I G;  3MD0 A;  1RF1 B;  2Y0D A;  3AE5 C;  3CL3 D;  1KTM A;  1JB0 J;  2Q3I A;  1K8A Q;  3H1L G;  2R32 A;  1EZV G;  3PJS K;  2VRE A;  5E0N X;  2Z4E A;  2E43 A;  4RYF H;  4CPG A;  3L73 D;  1NU1 E;  1Q90 D;  3TGU D;  2FYN C;  1VQ6 P;  1KB9 E;  5AVZ B;  1GL2 C;  3R9Q A;  2AEM A;  5KJ7 A;  2QM8 A;  1NYH A;  2HFE D;  3M9H A;  3M9Q A;  2P1J A;  2YIU B;  3V2N A;  2RH0 A;  1KIL A;  2IYP A;  1IK9 A;  3MTU E;  3A0H H;  4ELW A;  1FZG A;  4B3I A;  1W2X A;  1BDC A;  3ZWA A;  1YI2 P;  3G4S P;  1JOC A;  1GW4 A;  3B5N D;  1EF9 A;  5JBX A;  3M0A A;  1OMI A;  3TRR A;  3OJA B;  4JYJ A;  4I7Z B;  2GTR A;  2KS1 B;  3H1L D;  4JYB A;  4I4Z A;  4HJG H;  3Q0J A;  1YQ4 C;  1BGY E;  3L74 G;  3GKB A;  1L0L J;  1RQU A;  2YMK A;  5AW1 B;  1KIL E;  2ZAE B;  2E75 B;  1BGY J;  3B5N B;  2FYU J;  1UIY A;  3SSU A;  1VQ5 P;  5APY A;  1VQO P;  4JF7 A;  1PP9 E;  1ZR2 A;  2QG4 A;  1RQV A;  2J5I B;  1S3J A;  3Q5P A;  3T88 A;  1IC2 A;  1A02 F;  3GG2 A;  1MJ3 A;  1JEK A;  3CX5 E;  3W68 A;  3HE5 A;  4H0L D;  1OVR A;  2L5G B;  3T97 A;  1BE3 J;  1HNO A;  3H0S A;  3ZW9 A;  1NTK K;  5AVT B;  4AYC A;  4PV1 B;  1EY3 A;  4FZW A;  3T8A A;  4L6W A;  2F6I A;  1IZN B;  2YKP A;  2X58 A;  3FXD A;  3T97 B;  1DD4 A;  5EFW B;  3TYY A;  1FZE A;  2IPP A;  3QKA A;  3JU1 A;  1LTJ B;  3VP8 A;  3OT6 A;  2O01 N;  2JWA A;  4ZDD A;  3QH9 A;  1QGK B;  3H81 A;  1GDT A;  1NTK J;  3E1I A;  5C39 A;  3TT7 A;  5M1B A;  3IR9 A;  1EZV E;  2N1T D;  5GTH E;  1G1J A;  2R5D A;  3U9T B;  4JCR A;  2Z5I A;  4U3F G;  1S5L H;  1W2B O;  3CXH D;  1EZV D;  1SQX K;  2QJP C;  4D6T J;  1OFC X;  1G2C B;  1LWU B;  3TDK A;  3L75 G;  3O6Q A;  5TIS E;  1E5W A;  4UB8 E;  1MV8 A;  3PLN A;  3H1K J;  1DD3 A;  2N1T B;  3BRT B;  5DKP A;  5CJ0 A;  2Q2X A;  3SFE C;  2W3P A;  4Y99 B;  1FDO A;  1L4A B;  1Y47 A;  4W80 A;  3I47 A;  1ZRT D;  3VMY A;  1SQV J;  1OW6 A;  2QJK B;  4IFF A;  3CXH H;  3F5H A;  3H1K E;  3PEA A;  3D6Y A;  3WUV A;  1RY3 A;  1VF5 C;  1FOS E;  5C9G A;  4M3L A;  4DJG A;  4IZD A;  3QK8 A;  1S1C X;  1SQB J;  2IDB A;  3CPW O;  1IFD A;  2J59 M;  3HUS B;  4U0H A;  2YO2 A;  1P84 D;  2E5T A;  1JY3 O;  1M57 D;  1X8Y A;  3CWB G;  4IL6 X;  4OG1 A;  3GF3 A;  3G64 A;  1P84 E;  3C8V A;  3I5C A;  1EF8 A;  2HW5 A;  3BF0 A;  1URQ B;  3TNU B;  3HUS A;  4NEK A;  1YJ9 P;  3MZW B;  1KQF B;  3RK2 D;  1WMK A;  3SWK A;  3B5N A;  3BPP A;  3QWD A;  2FYU E;  2IFN A;  4IZC A;  1SQQ E;  2Q7C A;  1X79 B;  1EXI A;  3L71 G;  1SLQ A;  2HOD B;  1SQQ J;  3LW5 J;  1BGY D;  3WUT A;  3C1L A;  2H43 A;  2H7H A;  1L0L D;  3M6N A;  4FJW D;  4JQ0 D;  1CZQ A;  5APW A;  2IBZ D;  5DJT B;  3H02 A;  3STA A;  3HUS C;  1PV3 A;  3P5M A;  5KLV J;  1LTA C;  3I55 P;  4R4M A;  1L0N G;  5CBN A;  5KLV E;  4KD6 A;  2A06 D;  4H44 C;  5KLI C;  4MXI A;  2WSF H;  3L70 G;  3H1J G;  2IX7 C;  3AEB C;  4DCK A;  1N73 C;  1YG8 A;  1PJH A;  4YLH A;  2FZS A;  4O9B A;  1SQP E;  1USD A;  1AQT A;  1OVU A;  3L71 J;  5DU6 A;  2IBZ G;  1BSH A;  2WT7 A;  3LW5 H;  5C90 A;  2Q35 A;  1UII A;  4U0G H;  1KYO D;  3L73 J;  4NAR A;  1GL2 D;  3RST A;  1Q82 Q;  1U57 A;  5AW0 B;  4R4L A;  3BVH A;  3IAV A;  2KLU A;  1Y7O A;  3A0H E;  3O6Q B;  2VSU C;  4H13 D;  2J5S A;  2JO1 A;  3K8X A;  1J1D B;  3V5I A;  1SQV E;  1KYO H;  1RF0 A;  2KS1 A;  3NFQ A;  2ZXX A;  5TJH A;  3KTG A;  4RKU J;  3H32 A;  5KAF E;  4IZB A;  4H0L B;  2YKQ A;  2QJY C;  5FIF A;  1IFN A;  5DTW A;  1VQ8 P;  3MIW A;  2OYH C;  3ZDM A;  4HYT B;  3KTI A;  3RK3 E;  3G71 P;  1S9K E;  1P84 I;  3ZW8 A;  3BAS A;  1JNM A;  1PGQ A;  3VMA A;  1NTM E;  2GUV A;  3IN6 A;  1LGH B;  3TGU J;  4EI2 A;  1LP1 B;  5AVR B;  1GMJ A;  2FKW B;  2QM7 A;  2C9L Y;  1E79 H;  2E74 B;  2Y0C A;  2YMY A;  4ZKP A;  3RK2 C;  5APT A;  1KV4 A;  1BE3 G;  1VL2 A;  4WZ8 B;  2FYN B;  2KNC B;  5AVW B;  5KKZ C;  1AVO A;  1SFC A;  1KQL A;  1OD4 A;  3L74 E;  2SPZ A;  3P8C D;  5K5G B;  1UYV A;  2FFD B;  4WY4 B;  3R2P A;  3RK2 B;  3BCC G;  3V2P A;  3L36 A;  1SVF A;  4ELX A;  5AW6 B;  3TV5 A;  3L72 D;  3FF6 A;  1XNY A;  2OYI A;  2QVA A;  5AW9 B;  1YYC A;  3BCC E;  4PD4 D;  5E79 H;  1VQ9 P;  3Q2Y A;  3CD6 P;  4EMM A;  1M90 Q;  2R3S A;  3BCC J;  3USS A;  1KZU B;  2Q6Q A;  1LT1 A;  5AVU B;  1M56 D;  4K2N A;  2IZ1 A;  3H1J E;  1SQP J;  2R44 A;  3NXS A;  3RBX A;  2ZFC A;  1N86 A;  2C0W A;  2FYU G;  3OC7 A;  1WRG A;  2F9I A;  2BZR A;  2ZT9 D;  5KJP A;  1NU1 D;  1AVY A;  4EYY Q;  1KQS O;  3FWL A;  3R6H A;  3EFF K;  3AED C;  2W6A A;  1PPJ G;  3Q1M A;  3TK1 A;  5DL1 A;  5DTP A;  1SQX E;  1KIL D;  3KPE A;  4Q0G A;  4L75 A;  4DT0 A;  2M3B A;  2BCC G;  1LWU C;  2KUB A;  3LIE A;  1XO6 A;  3NMD A;  2I1J A;  3LID A;  4NPE A;  1NOH A;  1URQ A;  2JWD A;  4GIF A;  5APX A;  3MHV A;  1SQQ G;  3KQF A;  1NTK G;  2QJK C;  2WPS A;  3H1H D;  1USE A;  2OYO A;  1NAF A;  1NKN A;  5KLV K;  1HJB A;  3HTK B;  2QE7 H;  5KJ7 D;  2VSU A;  3HD7 C;  3Q3D A;  2HOD A;  2YNY A;  4PD4 E;  1FOS F;  3L4F A;  1KOR A;  3TLF A;  3EFG A;  5GTI E;  3DOR A;  1NTM J;  2R5B A;  3TF5 A;  2K9J B;  3FX0 A;  3ISA A;  3HD7 A;  3B8E B;  2PPY A;  3TGU G;  5KJ7 C;  1SZO A;  1SS1 A;  1JY2 P;  3KXD A;  1S4X A;  2B89 A;  4FNB A;  1VF5 D;  1L0N D;  2P67 A;  4B86 A;  1DEE G;  2ZQR A;  3N7N A;  3E7K A;  2WPQ A;  3CCV P;  3NJB A;  2D2C C;  2M5A B;  1T8Z A;  1MUU A;  2NP9 A;  1CW5 A;  2VRS A;  4EOT A;  2A45 G;  1VF5 B;  4KWB A;  4PV1 C;  4Z0M A;  4JCT A;  2JKV A;  4EIJ A;  2UZF A;  3SFD C;  1EDI A;  4L76 A;  4IFD K;  5AVX B;  1VQK P;  3TSI A;  3MUD A;  2ZXE B;  1N8R Q;  1Q2N A;  2IFM A;  2P58 A;  2QSI A;  2HYN A;  4U18 A;  3V5E A;  2ZQQ A;  1Q51 A;  4L73 A;  4LK5 A;  1RH5 B;  3M0D C;  4GOE A;  4JWV A;  2Y9Z A;  2WSC H;  3R9T A;  4ZDE A;  3V4W A;  2Z5H A;  2I8D A;  1G2C A;  4HKZ H;  2CE3 A;  3CX5 H;  2M0B A;  2Q34 A;  3B71 A;  2W6B A;  1KFM A;  2N1T A;  3VN0 A;  1XNV A;  2ZYD A;  1MFT A;  4H13 B;  2XU6 A;  2FXM A;  1UYT A;  3IF4 A;  1S5L X;  2VSU F;  2KZI A;  2ZYA A;  1KYO I;  2A7K A;  3IBB A;  4NNQ A;  1Q52 A;  1PGO A;  2V4H A;  4I52 A;  1FCF A;  3CX5 I;  1TG6 A;  4W7Z A;  4IFM A;  1U7M A;  5H2F H;  1NVO A;  3GHG B;  3P7K A;  1NTK E;  1K32 A;  1L0N K;  4LGD E;  4ZMD A;  4ZDC A;  4MOU A;  1NAY A;  1Y9B A;  3ITK A;  5ING A;  2VX2 A;  1Z56 A;  3NJD A;  2XZR A;  3OA7 A;  4WY4 D;  4WB4 A;  1M1K Q;  1SFC B;  5AVS B;  4HDT A;  1EC5 A;  2OAR A;  1MKM A;  5DU4 A;  4H13 C;  1LTG C;  3D6Z A;  3U9R B;  1YTZ T;  2XDJ A;  1YBK A;  2NPS C;  4A7P A;  2KSE A;  5E0S A;  1L0N J;  3KDP B;  1RF1 C;  3RK3 B;  2WT7 B;  3HE2 A;  2A81 A;  3R4Y A;  1QL1 A;  1FZA A;  1L0N E;  1SQX D;  1Q86 Q;  3AE8 C;  4N78 E;  2L91 A;  3MGN A;  1OWA A;  2RN0 A;  4XFJ A;  3U1C A;  4JYC A;  1SQP D;  2OTJ P;  1BCC J;  3PRJ A;  1K39 A;  3D71 A;  4I2L C;  2FY8 A;  3V4Q A;  1NGM B;  1SQB D;  3BCC D;  4OLQ A;  1KQG B;  3RBZ A;  4TT3 H;  3LAO A;  3WG5 A;  4B3J A;  3UIA A;  1M7L A;  3KZI E;  3M91 A;  3E1R A;  1JY3 P;  3WMM 0;  1YHQ P;  4YPC A;  2HLO A;  4NPF X;  5G1Q A;  1NKZ B;  2Q9I A;  1IFM A;  1FZC C;  3CX5 D;  3HIN A;  4D6T G;  1S72 P;  1DEB A;  1QVF O;  1K9M Q;  2HPC B;  5G1R A;  4QIJ A;  1JY2 O;  4I42 A;  4IL6 E;  2FYU K;  1FC9 A;  1NU1 K;  4L8K A;  1NTM K;  3KYQ A;  3L70 J;  1WT6 A;  4DZO A;  2FYU D;  3Q1T A;  5AVQ B;  4OH8 B;  1KN7 A;  4JCS A;  2C0X A;  1QVG O;  2WMM A;  3D70 A;  4L74 A;  1CI6 B;  1JMB A;  3CWB D;  1W2E A;  1HGZ A;  2J5U A;  3PE8 A;  1X0T A;  3TNU A;  3L75 D;  3AEG C;  1NTK D;  2W90 A;  1O8U A;  2AEF A;  2JP3 A;  1NJI Q;  4I1L A;  3I56 P;  2DUB A;  1VQ7 P;  3CC2 P;  1J1D C;  4JYL A;  3L71 E;  1PL5 A;  2KNC A;  2O01 H;  4PV1 D;  1FC7 A;  1NH4 A;  3CCL P;  3AE1 C;  1JUN A;  1SFC C;  2PG8 A;  1BE3 D;  3AE9 C;  2F9Y A;  3AEA C;  4U3F D;  4H44 B;  5KLI B;  4D6T E;  1OX3 A;  4BRY B;  2FYZ A;  3BAT A;  3RL0 B;  4GT1 A;  5CCH A;  2POH A;  1FC6 A;  1DX7 A;  1ZME C;  5CCH C;  1AQ5 A;  3L37 A;  4BRY A;  1WDL A;  1KD1 Q;  1T3U A;  2WPV B;  4HB1 A;  3V6I A;  2D2C D;  1KB9 I;  3ZWC A;  1FE6 A;  1L0L G;  3GHG C;  4U3F J;  4WBA A;  2WIT A;  1M1J C;  2VSU E;  2E75 D;  1SQV K;  2H88 C;  2CPS A;  2PBP A;  3L71 D;  4UB8 H;  1BCC E;  1JY3 N;  5AW4 B;  2UWJ E;  2IEX A;  4WCZ A;  2OYH A;  2Y0E A;  3RGU A;  4J2U A;  3N4X A;  3ABV C;  2H89 C;  1L4A A;  4GOF A;  2J58 A;  4K3A A;  1VDF A;  4Y99 C;  4JOT A;  3ST9 A;  3CC4 P;  1N7S C;  3BPT A;  3EWK A;  1BSN A;  2OYH B;  1X0U A;  2BCC D;  3G6E P;  3H1I E;  3GW6 A;  1FDI A;  2QJY B;  5FUS A;  2VSS F;  2M3E A;  2XV5 A;  4UB6 E;  2WQY C;  2WSE H;  1UIX A;  2GUS A;  1H89 A;  3OME A;  4GDO A;  2OTK E;  1RE3 C;  2KOG A;  3CWB J;  3A3Y B;  3L70 E;  3HTK A;  3AEE C;  4IOI H;  5H2F E;  4I7Z C;  3W67 A;  3VTP C;  4FND A;  4OWF A;  1T2K D;  1RE4 C;  4W7Y A;  1H88 A;  4ZU2 A;  4FZW C;  3PGQ A;  1XTG B;  2PAJ A;  2KSJ A;  2YJG A;  2PFX A;  1LTI C;  3JCU H;  2O01 J;  5AVY B;  3K5B A;  4FB8 A;  1GZL A;  1K05 A;  2XKM A;  4RYF A;  1L0L K;  2NRG A;  5KAI E;  2JEE A;  1OIP A;  1KFN A;  4WVZ A;  4RCN A;  1X9V A;  4C7R A;  4AQR D;  3JCU E;  1M8O B;  2V7Q J;  2ZVO B;  3SWX A;  4RJT A;  1BCC D;  1JCD A;  2VSS A;  1YTZ I;  3HD7 B;  3L73 E;  2EJ5 A;  1IFJ A;  4K35 A;  3JC2 2;  1SQX J;  3Q5R A;  1FAV A;  1SQV D;  4GHN A;  3IB9 A;  2ZYG A;  3U1A A;  4PJ0 E;  1AJY A;  2BEQ D;  4UB6 H;  5KLV G;  2WZ7 A;  5APU A;  3TDC A;  3L75 J;  3V2R A;  2FBW C;  2J5I I;  1P84 H;  4OGQ B;  1JY2 N;  3H1J D;  2HG5 D;  3H1H E;  4GKG A;  4D6T D;  4YXD C;  4ELS A;  1LT9 A;  1K04 A;  3T8B A;  1M1J B;  5CCH D;  4Q1I A;  2WSS H;  1KIL C;  3R0O A;  3RK3 C;  2QRX A;  1J7X A;  3L3S A;  1EQ7 A;  1KB9 H;  1MZ9 A;  1M1J A;  4WWI A;  4AUW A;  2W27 A;  3R9S A;  2K37 A;  3H0J A;  3FXE A;  2HPC A;  1JTH A;  4KT0 J;  1SQV G;  1L2P A;  2NZ2 A;  1KYO E;  1YIT P;  1URQ C;  3H6P A;  4N78 D;  4KPK A;  3WUU A;  2QIW A;  3KTJ A;  2FXO A;  3TGU E;  2NPS D;  1QL2 A;  3G3Z A;  1SFC D;  1KB9 D;  5AW2 B;  1FS0 E;  1IJD B;  3H1I D;  1SQQ K;  2C9N Y;  2P2U A;  2IBZ I;  3GMA A;  1ZV8 A;  2RKL A;  3CWB E;  1YG6 A;  1N6E A;  2Q1K A;  3FGA D;  4XA4 A;  3L74 J;  1NZY A;  1AV1 A;  1S9K D;  1RF0 C;  2KLV A;  5IKL B;  1PPJ D;  3H1K G;  1R5L A;  2PP6 A;  3VIV A;  3AEF C;  1GTW A;  1NTM G;  4HNK A;  1XNW A;  1U7J A;  1N7L A;  2J5G D;  2E5Y A;  3QXZ A;  4FN7 A;  4RES B;  3CC7 P;  1GK6 A;  2AEJ A;  1QLE D;  3HE5 B;  4Y28 J;  1H0T A;  1WZ8 A;  2D2C B;  2WSF J;  3QMJ A;  1EXJ A;  1YQ3 C;  1IK7 A;  3L35 A;  1RJM A;  3SLL A;  2FFD C;  1N6F A;  1J1E C;  5INI A;  1MFZ A;  1ZP0 C;  3C9I A;  3QXI A;  2BCC J;  1H0T B;  1PP9 J;  1VPC A;  3AE2 C;  2MJZ A;  3CCQ P;  2ZT9 C;  2DW3 A;  2M5A A;  4ASW A;  3QYR A;  1T3J A;  5B5E E;  1SQP G;  1RE4 A;  4TLF A;  1JCC A;  3L75 E;  2E76 B;  1HGV A;  4JFC A;  3G9R A;  1ZR4 A;  1VQN P;  2WSC J;  1DUB A;  5CBO A;  3PZK A;  5JBW A;  3KZI H;  2KI7 B;  1LT9 B;  4JSB A;  2N9Y B;  2A45 H;  4I6M C;  1PZQ A;  4LLH A;  3RL0 g;  1LTB C;  3WU2 H;  3NTN A;  2B88 A;  1ZN5 A;  2AXT E;  4OMR A;  3PHL A;  2N9B A;  1PP9 G;  2H8P D;  3N6R B;  1CSB A;  2ZL4 A;  1FZB A;  3RK3 D;  3P8M C;  3H1L J;  5HUQ A;  2ZT9 B;  3CXH E;  1Q81 Q;  3S1K A;  1JM0 A;  1N7S A;  1EDK A;  3A2A A;  1ON9 A;  1SQB G;  3H1L E;  3TVW A;  3CXH I;  2JJL A;  3RSI A;  3LKE A;  3SWY A;  1RHZ B;  3KQG A;  1NWQ A;  3KHU A;  2OYI C;  1SQB K;  3OW2 O;  3VMX A;  3VMZ A;  2WTY A;  1G1I A;  2K88 A;  1ZOY C;  1VRG A;  3F89 A;  2FW2 A;  1TYF A;  2Q5U A;  5DUC A;  4C7N A;  5KAF H;  2B87 A;  3GHG A;  4OGQ C;  2GA1 A;  3PP5 A;  1GK4 A;  2AXC A;  2E75 C;  2K3R A;  1OD2 A;  5GTH H;  2K9J A; 
#chains in the Genus database with same CATH homology
 5DUF A;  1DIP A;  1GMJ A;  4PV1 D;  3MFM A;  2E74 B;  1FC7 A;  3AE1 C;  2A7S A;  5CTB A;  4U1A A;  1VL2 A;  2PG8 A;  4WZ8 B;  3AE9 C;  1SG4 A;  5KKZ C;  2F9Y A;  2FXP A;  1OD4 A;  3AEA C;  1UYV A;  4H44 B;  2ZL2 A;  1R8E A;  4K3W A;  3MYB A;  2ZL0 A;  4ELX A;  4OGQ D;  4QFE A;  3TV5 A;  3KTH A;  5DU8 A;  3FF6 A;  3TZ3 A;  1XNY A;  4EML A;  1FC6 A;  1ZME C;  5G1S A;  2X24 A;  5KDR B;  3AE5 C;  1KTM A;  1JB0 J;  1WDL A;  3Q2Y A;  4EMM A;  1TU3 F;  2F9I B;  4JVT A;  2WPV B;  2VRE A;  5E0N X;  2D2C D;  4K2N A;  4RYF H;  3ZWC A;  5KDR A;  1Q90 D;  2FYN C;  4U0G A;  3OC7 A;  2VSU E;  2F9I A;  2BZR A;  2E75 D;  3Q5S A;  2ZT9 D;  2H88 C;  2PBP A;  3R9Q A;  5KJP A;  1NYH A;  2IEX A;  4WCZ A;  2ZL3 A;  4J2U A;  3ABV C;  2H89 C;  3R6H A;  2D3T A;  2K9Y A;  3AED C;  3Q1M A;  4JOT A;  3ST9 A;  5DL1 A;  1RJN A;  5DTP A;  4ELW A;  2MKV A;  4B3I A;  3BPT A;  1W2X A;  3ZWA A;  3EWK A;  4Q0G A;  1X0U A;  3H0Q A;  4B3H A;  4Z1M H;  1EF9 A;  2WSE J;  5JBX A;  1FDI A;  1XO6 A;  3H25 A;  1OMI A;  5FUS A;  2F6Q A;  5L8R J;  2VSS F;  3TRR A;  4JYJ A;  1OW8 A;  4I7Z B;  2GTR A;  2WQY C;  1UIX A;  3OME A;  4GDO A;  4G2R A;  4I4Z A;  3Q0J A;  1YQ4 C;  4JCQ A;  3GKB A;  3AEE C;  3KQF A;  2QJK C;  1RQU A;  2YMK A;  3HLN 1;  1KIL E;  2E75 B;  4I7Z C;  3TVU A;  1UIY A;  3AE6 C;  4FND A;  4ZDB A;  3AE3 C;  3HP0 A;  4ZU2 A;  3H0U A;  3PGQ A;  4FZW C;  2VSU A;  2YJG A;  3Q3D A;  4H44 D;  2O01 J;  2J5I B;  1RQV A;  4FN8 A;  5CTC A;  3Q5P A;  1KOR A;  3TLF A;  3T88 A;  3DJA A;  3DOR A;  2J5G A;  4FB8 A;  1K05 A;  1MJ3 A;  4RYF A;  4RCN A;  3ISA A;  4H0L D;  3H0S A;  1HNO A;  2V7Q J;  2PPY A;  3ZW9 A;  4U7J A;  1SZO A;  3SWX A;  4PV1 B;  1EY3 A;  4FZW A;  3T8A A;  4FNB A;  4L6W A;  1VF5 D;  2F6I A;  1OW7 A;  2ZQR A;  2F9Y B;  2VSS A;  4GM2 A;  2X58 A;  2EJ5 A;  3NJB A;  5DZK H;  3T97 B;  1DD4 A;  3AE4 C;  3QKA A;  3JU1 A;  3IAO A;  3Q5R A;  2D2C C;  3OT6 A;  1JXZ A;  4GHN A;  3IB9 A;  4DI1 A;  4ZDD A;  2NP9 A;  1AJY A;  2BEQ D;  3H81 A;  4K29 A;  3TDC A;  3U9S B;  3TT7 A;  1VF5 B;  4KWB A;  2FBW C;  5M1B A;  2J5I I;  1WDM A;  1KMI Z;  4PV1 C;  4Z0M A;  4JCT A;  4OGQ B;  1ON3 A;  3U9T B;  4JCR A;  2UZF A;  3FDU A;  3SFD C;  3MOY A;  3P2L A;  3GLM A;  4YXD C;  4ELS A;  2QJP C;  1XX4 A;  1K04 A;  3T8B A;  4Q1I A;  2QSI A;  3R0O A;  2FBM A;  4U18 A;  3V5E A;  2ZQQ A;  1Q51 A;  3O6Q A;  3K50 A;  4LK5 A;  1ZRT E;  1J7X A;  3L3S A;  4U19 A;  4JWV A;  1DD3 A;  5DKP A;  1N6D A;  2CBY A;  2G8Y A;  3AEC C;  3SFE C;  1HF9 A;  2Q2X A;  2W3P A;  3R9T A;  4ZDE A;  3KTK A;  1FDO A;  5INF A;  2DEO A;  3QRE A;  3P85 A;  3I47 A;  3R9S A;  2P10 A;  1OW6 A;  2CE3 A;  3H0J A;  3PEA A;  3D6Y A;  1VF5 C;  5C9G A;  4KT0 J;  2Q34 A;  3B71 A;  4IZD A;  3QK8 A;  2NZ2 A;  1S1C X;  1XNV A;  2IDB A;  4H13 B;  4KPK A;  1UYT A;  1S5L X;  2VSU F;  2QIW A;  3KTJ A;  4U0H A;  4IL6 X;  3IBB A;  2A7K A;  4OG1 A;  1HJ0 A;  4EMP A;  3GF3 A;  4NNQ A;  1Q52 A;  3AE7 C;  3G64 A;  5E0S H;  3C8V A;  2HW5 A;  1EF8 A;  3BF0 A;  3GMA A;  4I52 A;  4NEK A;  1FCF A;  1YG6 A;  1KQF B;  1N6E A;  1TG6 A;  1WMK A;  3FGA D;  1NZY A;  3ZWB A;  3BPP A;  3QWD A;  4IZC A;  4H0L C;  5IKL B;  1K32 A;  1DCI A;  4ZDC A;  4MOU A;  3AEF C;  3VIV A;  1Y9B A;  4WYO B;  5ING A;  1EXI A;  4HC8 A;  2VX2 A;  3LW5 J;  1NZY B;  3T89 A;  4HNK A;  1XNW A;  2J5I A;  3NJD A;  2J5G D;  3QXZ A;  2E76 C;  3M6N A;  5DZK A;  4FN7 A;  4FJW D;  3MT6 A;  4HDT A;  1MKM A;  4Y28 J;  1UYS A;  1WZ8 A;  5DU4 A;  4H13 C;  2D2C B;  2WSF J;  3H02 A;  3QMJ A;  3STA A;  1EXJ A;  1YQ3 C;  1IK7 A;  1PV3 A;  1RJM A;  3SLL A;  2E74 C;  2G3A A;  3P5M A;  1N6F A;  5INI A;  3D6Z A;  3U9R B;  4R4M A;  1ZP0 C;  2WTB A;  3QXI A;  4F47 A;  2E76 D;  1UYR A;  3AE2 C;  4KD6 A;  1HNU A;  2ZT9 C;  5E0S A;  4H44 C;  5KLI C;  3QYR A;  2VSS E;  5MGB A;  4MXI A;  3HE2 A;  3AEB C;  2A81 A;  3R4Y A;  3M6M A;  3BEZ A;  1YG8 A;  1PJH A;  4YLH A;  2FZS A;  2BEZ F;  2E76 B;  4JFC A;  3G9R A;  3Q0G A;  5DU6 A;  3AE8 C;  2WSC J;  1DUB A;  3PZK A;  5JBW A;  4XFJ A;  5C90 A;  2Q35 A;  4U0G H;  3T3W A;  4NAR A;  4JSB A;  1K39 A;  2E74 D;  3D71 A;  3RST A;  4MI2 A;  1U57 A;  1NGM B;  4R4L A;  1KQG B;  4OLQ A;  3IAV A;  1Y7O A;  4TT3 H;  3RL0 g;  3LAO A;  1PIX A;  3WG5 A;  4B3J A;  2YIU C;  4QII A;  2QQ3 A;  2VSU C;  3GF7 A;  4OMR A;  3Q7H A;  4KNP A;  5G1Q A;  2C8T A;  4H13 D;  2J5S A;  2JO1 A;  3HIN A;  3K8X A;  3N6R B;  3V5I A;  2ZL4 A;  5G1R A;  4QIJ A;  5HUQ A;  4I42 A;  2ZT9 B;  1FC9 A;  4L8K A;  3KTG A;  4RKU J;  4JJT A;  3Q1T A;  1WDK A;  3S9O A;  1ON9 A;  2OQQ A;  4JCS A;  4YTP C;  3TVW A;  3RSI A;  4IZB A;  4H0L B;  3D70 A;  3LKE A;  3RRV A;  2QJY C;  5FIF A;  5DTW A;  2J5U A;  3PE8 A;  1ZOY C;  3AEG C;  4ASI A;  1O8U A;  1VRG A;  3KTI A;  2JP3 A;  3RK3 E;  3ZW8 A;  2FW2 A;  1TYF A;  5DUC A;  4OGQ C;  2DUB A;  2E75 C;  1OD2 A;  4JYL A;  3IN6 A;  3HRX A;  1PL5 A;  1HZD A;  3TT6 A;  4ZDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...