3GLMA

Glutaconyl-coa decarboxylase a subunit from clostridium symbiosum co-crystallized with crotonyl-coa
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
584
structure length
562
Chain Sequence
b'MYSMPGYFQNMPTIGKELVNPNPENEQEIKAVESDIHESIKKALDAGITSEEKLNERGQLSAMQRINALIDPGTWCPLNSLFNPENNKFGTTNIVNGLGRVDGKWVYIVASDNKKMAGAWVPGQAENLIRCSDAAKMMHLPLIYLLNCSGVEFPNQDKVYPNRRGGGTPFFRNSELNQLGIPVIVGIYGTNPAGGGYHSISPTILIAHQDANMAVGGAGAEQIIAAQIENSKLKVPAPGSVPIHYDETGFFREVYQNDLGVIDGIKKYISYLPAYNLEFFRVDTPKAPQLPAEDLYSIIPMNQKRPYDIYEVIARLFDNSEFSEYKKGYGPEMVTGLAKVNGLLVGVIANVQGLLMNYPEYKQNSVGIGGKLYRQGLIKMNEFVTLCARDRIPLIWLQDTTGIDVGDEAEKAELLGLGQSLIYSIENSKLPSLEITIRKASAAAHYVLGGPQGNNTNVFSIGTGACEYYVMPGETAANAMYSRKLVKAQPIIGKMNDMIQMYTDKSRPKYCTEKGMVDEIVDMTEVRPYIQAFTEAAYQNPQSICPMHQMLTPRSTREFETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutaconyl-CoA decarboxylase subunit A
molecule tags Lyase
source organism Clostridium symbiosum
publication title An asymmetric model for Na+-translocating glutaconyl-CoA decarboxylases
pubmed doi rcsb
total genus 207
structure length 562
sequence length 584
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.70: Transferred entry: 7.2.4.5.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.680 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Helix bin 3glmA01
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3glmA03
5INFA 4U0GA 3KTKA 3NJDA 3R9TA 3NJBA 2VSUA 1EF9A 2DEOA 4I42A 4I52A 3ZWCA 3V5IA 3KTIA 3R9SA 3FDUA 1EF8A 3M6MA 4YLHA 4JCSA 3V5EA 1K39A 2IEXA 5C90A 3QK8A 3OT6A 1WZ8A 2CE3A 3MYBA 5FIFA 3L3SA 5DL1A 3Q0JA 4GHNA 4K29A 1UYSA 5INIA 5DUCA 4MI2A 2FW2A 3Q7HA 1XO6A 1EY3A 1YG8A 2UZFA 5E0SA 2J5II 4MOUA 4FNBA 3H0UA 4NNQA 4MXIA 2WTBA 3HLN1 3H0QA 3TVUA 4RYFA 2BZRA 2F9IB 2PPYA 5CTBA 3T3WA 4ZDFA 1UYRA 5G1RA 1J7XA 4ELSA 5DUFA 3RSTA 3T88A 3HP0A 1HNOA 2J5SA 4ELWA 3LKEA 4FN7A 4WCZA 1N6FA 1RJNA 4IZDA 3GKBA 4ZDEA 4B3HA 3QXZA 3ZWBA 3KTHA 2VSSF 3QXIA 2VREA 2QQ3A 2FBMA 3BPPA 1K32A 1TG6A 2A7KA 4DI1A 4QFEA 5DKPA 4L8KA 3Q0GA 4U19A 1UYVA 2DUBA 1FCFA 2FZSA 2J5GD 3ZW9A 5IKLB 4OMRA 2ZL4A 4Z0MA 1SG4A 3RSIA 4JCTA 5DZKA 4HC8A 3U9TB 4ZU2A 2C8TA 3MOYA 2W3PA 5G1SA 4U18A 1UYTA 3K50A 3MFMA 3KTJA 3OMEA 3DJAA 1N6EA 1SZOA 1XNWA 4K3WA 1NZYA 4FJWD 3QREA 3U9RB 3R6HA 4OLQA 1FC9A 3QYRA 3TDCA 3PE8A 4JCRA 1DUBA 5KDRA 5KDRB 1Y7OA 3BF0A 4B3JA 2ZL0A 1XNVA 4JCQA 3TRRA 3G64A 1TYFA 4Q0GA 3GF7A 3TZ3A 2X58A 3I47A 4FZWC 3T8BA 3P2LA 4RYFH 2F6QA 3P85A 3MT6A 3TLFA 3T8AA 4JWVA 1FC7A 1JXZA 1ON9A 3LAOA 4FB8A 4RCNA 3P5MA 4WZ8B 2A81A 3IAVA 3STAA 2F9IA 3PEAA 2CBYA 3R9QA 1PIXA 4IZBA 3GMAA 1FC6A 3GF3A 5DTWA 4LK5A 1WDKA 1OD2A 2ZQQA 4JFCA 1VRGA 3H0JA 2D3TA 4ELXA 4IZCA 2ZL3A 4F47A 4EMPA 3SLLA 3FF6A 5G1QA 2VSSA 5C9GA 3OC7A 5CTCA 2Q34A 2VSUF 2J5IB 4QIJA 3VIVA 4I4ZA 1PJHA 1NZYB 2GTRA 1WDLA 3WG5A 4K2NA 4ZDDA 2F9YA 3Q1TA 1UIYA 1HZDA 2ZQRA 3SWXA 2VX2A 1WDMA 4L6WA 2PG8A 4ZDCA 4KPKA 3R0OA 3T89A 3ST9A 3QWDA 1Q51A 4FN8A 3U9SB 3QKAA 3ISAA 1XNYA 3N6RB 4U0GH 5DZKH 3IB9A 2Q35A 3H81A 4JSBA 2J5GA 2NP9A 3BEZA 4FZWA 4U0HA 5MGBA 3H0SA 4EMMA 3HRXA 2VSUC 5E0SH 3H02A 2F6IA 3PZKA 3JU1A 3KQFA 2PBPA 3QMJA 4G2RA 1DCIA 4JVTA 2Q2XA 1ON3A 3ZW8A 1YG6A 2EJ5A 3DORA 1X0UA 4EMLA 5JBXA 4JYLA 1MJ3A 3KTGA 5DU6A 1W2XA 1Q52A 2A7SA 4KWBA 1HNUA 5DTPA 3TV5A 4QIIA 2X24A 5FUSA 1OD4A 4B3IA 4KNPA 1O8UA 2F9YB 3HINA 2HW5A 3M6NA 5KJPA 4KD6A 5E0NX 1XX4A 4ASIA 4WYOB 5DU8A 4NEKA 4JOTA 1N6DA 1RJMA 4GM2A 3TVWA 2VSUE 2J5IA 5INGA 2ZL2A 3TT7A 4ZDBA 4JJTA 4JYJA 3GLMA 3K8XA 3HE2A 4HNKA 4U1AA 5DU4A 4FNDA 2VSSE 3PGQA 3IBBA 5JBWA 3RRVA 4OG1A 3ZWAA 4Q1IA 3TT6A
chains in the Genus database with same CATH superfamily
2ZVNB 1K9MQ 2IZ0A 3NJDA 3GG2A 1JO5A 2FBWC 2MKVA 4OGQC 3NJBA 2VSUA 1SQVG 2YJGA 4I42A 3PH0A 5CJ0A 4U7JA 3R9SA 3GHGB 4GIFA 4YLHA 3M6MA 4JCSA 4ASVA 1VF5B 1FZEA 2IEXA 1X8YA 4OWFA 3MYBA 2CE3A 4LLHA 4Y99C 3D6YA 1S4XA 3CLQA 2ZYGA 1PGPA 2R3SA 2GUSA 2LXCB 2Y0EA 1UIIA 2FYUG 1UYSA 2OYHC 4GHNA 3FXDA 5DUCA 1SQQK 2D2CD 1RQUA 5B66H 3B71A 4BRYB 1SQBE 1LTSC 1NTKJ 2D2CC 3V6IA 1IFJA 4FNBA 2IBZE 3H32A 3HLN1 3OAKA 3H1JD 4RYFA 2BZRA 2PPYA 4DJGA 3A0HE 1KYOD 1N7LA 1YJNP 3AE8C 2KK7A 2POHA 1LTTC 1NKNA 1G1JA 1AQ5A 3T88A 2JWDA 2PGDA 1HNOA 2R5BA 2J5SA 4YXWH 4WCZA 1KB9H 1ZR4A 1ZR2A 4IZDA 4ZDEA 1NTMD 4U3FG 3KTHA 2R3CA 2VREA 3VP8A 1JMBA 4QFEA 1QLED 4WVZA 3Q0GA 2FYUJ 1VQMP 3AEBC 4IL6H 1KILB 2DUBA 2BCCD 1KC8Q 3ZW9A 4OMRA 3H1LD 2W6BA 4JCTA 1H88A 3CX5E 1JY3N 2YMYA 1S5LX 4HC8A 4KT0J 2OGUA 3MOYA 4WB4A 1M1KQ 2C9NY 1SP4A 2W3PA 1NU1D 2XKMA 3M0DC 2H43A 1DEBA 1SFCA 1U57A 2BCCG 2KUBA 3H1KD 1SLQA 2HR3A 1LWUB 2P7JA 1Z56A 1SQBJ 4YTPC 3Q5SA 1EDKA 1NTKE 1XNWA 1NTZJ 1NZYA 5KJ7C 2JP3A 5H2FE 1P84E 1W2EA 3R6HA 2FFDB 1OW8A 4OLQA 1VQNP 1R8EA 4JBZA 1DUBA 2Z5HA 3D70A 1T2KD 3IFMA 3ITKA 4GKGA 3RGUA 2QRXA 3H1LG 1PGQA 1L2PA 4JCQA 3U1CA 1SQBK 1L0LG 1TYFA 1S5LH 1Q7YQ 2M8RA 1URQC 1WMKA 3KXDA 2XNDH 1OW7A 1Y8AA 3I47A 1R5LA 3GW6A 3T8BA 2D2CB 4RYFH 2E75C 1U7JA 1IFNA 3CC4P 1QEXA 2B88A 3CCLP 2JO1A 1EXIA 1DD3A 3TLFA 3RK3B 2MJZA 4UB8E 4B86A 2QSIA 2HFED 2E76D 1JXZA 1ON9A 1GL2B 4FB8A 1M7LA 3QWOC 1L0LE 1A02F 3PTZA 2A81A 1M57D 1CSBA 1QX8A 2F9IA 1YJWP 3PEAA 2CBYA 3CWBD 1PIXA 2NPSB 2J59M 4PV1D 1FC6A 2AXTH 3L73E 1MFTA 3RK3E 2Q3IA 3A2AA 5KJ7D 2YKQA 4JFCA 3H0JA 5AW4B 1L0LD 1YQ4C 1GU4A 1FDMA 2PAJA 3H32B 2OYIC 4EMPA 3V2QA 1QVGO 4WY4A 1EDJA 1K8AQ 5G1QA 2QJPB 3OC7A 2Q34A 1USEA 1NJIQ 1RY3A 1RF0C 1LWUA 1UIXA 1IK9A 4QIJA 3NTNA 1YYCA 1PJHA 2J58A 1PPJD 3HTKA 2BCCE 2I8DA 1L0NK 1BE3J 1X0TA 2E76B 3SWKA 4H44C 3L70E 2W90A 1M56D 1SQPE 2PG8A 1EDIA 4ZDCA 2C9LY 1RE4A 4GODA 3ST9A 1K73Q 3L72D 1JNMA 3L71E 3CC7P 4ASWA 3U9SB 3N6RB 1L0LJ 5DZKH 3IB9A 4RESB 2OYHA 1LTJC 3M91A 4U0HA 3L73J 1PFIA 1KQGB 1PP9E 3H02A 3B4SA 3PZKA 3JU1A 3KYQA 1RHZB 1L0NG 1L0LK 1DCIA 2ZJSE 3CXHH 3V4WA 1NTZK 2Y9YA 1BE3D 1CI6B 2WITA 4IOIH 2OARA 2EJ5A 3MD0A 1BE3E 2IDBA 1OMIA 1FZCA 4JYLA 3V2NA 2W6JH 2K1AA 2ZVOB 4L75A 3VMZA 2BCCJ 2E74D 1H0TB 3L72G 2WSFH 3TV5A 4QIIA 1OXZA 2X24A 2Q3EA 4H13D 2WTYA 5AW5B 2FXOA 3L70J 1FZAA 4KNPA 5CJ4A 2HW5A 1GW4A 1NOHA 2IFNA 5KJPA 2N9YB 3M0DA 1PPJG 4KD6A 3H1HJ 5AVTB 4XE5B 5AVYB 1JTHB 3KDPB 4I1LA 5CCGD 4JOTA 3M9BA 3TVWA 2J5IA 1L0NE 4Y28J 3H1JE 1SQXJ 5B5EH 3BPTA 2R5DA 1SQBD 1S72P 1FOSF 3CWBJ 2FFDA 3GLMA 2ZT9C 1K04A 5AW8B 2YXQB 1HGZA 3IBBA 3H25A 4OG1A 3B5NB 1SFCB 3CC2P 3N7NA 1FDOA 4U3FE 1HGVA 3KHUA 5GTIE 5APYA 4NPFX 2Q6QA 1ZRTD 4I52A 3V5IA 3NMDA 1G1IA 5AVZB 4I7ZC 3MIWA 4ZKUA 3IAOA 1PP9G 3V5EA 3VMYA 2E5TA 5C90A 3QK8A 3OT6A 3BCCD 1E5WA 1N73C 3L73D 1VQ8P 3JC22 1SQXD 4JYCA 3H1HE 2LKMA 3L35A 1FC2C 5KAIH 5BU5A 4OGQD 4DCKA 4JYBA 1WRGA 3GHGA 1XO6A 5CCGC 1YG8A 1BCCG 2XV5A 2J5II 4MOUA 4XFJA 3H1LE 3RL0C 3IN6A 3TGUJ 4D6TE 3TVUA 4LGDE 1P84H 2Q5UA 3VMAA 2VRSA 3SSUA 1J7XA 2CPSA 3RSTA 1N7SA 2L91A 4ZMDA 1VF5C 3LKEA 4FN7A 1N6FA 1QL1A 4C7NA 1J1DC 5TJHA 4EDFA 3SWFA 1RJNA 4B3HA 3QXZA 4O9BA 1NTKK 4OGQB 1K32A 4OVNF 2A7KA 4L73A 3EFFK 3PHLA 4L8KA 2QM8A 2GM4A 2E75D 3L70G 1UYVA 1ZP0C 1OZHA 2XNXA 3TK1A 1E79H 4I6MC 2ZL4A 4Z0MA 1SG4A 4TLFA 4Y99B 1NU1G 4C7NB 4ZU2A 1FJPA 4BWNA 3TGUD 1H8AA 5AW2B 2AEJA 3A7OA 3KQGA 3BCCE 1EXJA 1HBWA 2K9YA 2K37A 1BGYD 3E1RA 1VQKP 1U7MA 3BASA 2IBZD 2JWAA 3QREA 3U9RB 3TGUE 3L37A 1RE3A 2M5AB 3PE8A 4JCRA 1W5CE 1EZVE 5KDRA 1NHLA 3T97A 3BF0A 4B3JA 1NTMG 4N3YB 2CPBA 2E43A 2JKVA 2WSEH 1LT9C 1AVYA 1JY2O 4H0LC 3GF7A 4HJGH 1YITP 1KILC 5AW7B 2FYNB 3R4YA 3CCUP 3AEDC 2X58A 3K5BA 1R5SA 2WQYC 5B66E 1HF9A 1FBMA 3L71G 1T6AA 2HODB 1NWQA 3P85A 3MT6A 3L75G 1IFIA 2N1TB 3II6A 5APQA 3HE5A 1HJ0A 1OVVA 1LTAC 3S4RA 1N7SC 1VQPP 3AE6C 1SFCC 4YPCA 4DT0A 1YBKA 3M9HA 4OH8B 3RL0B 3IAVA 3V2RA 3BCCJ 2OYIA 3STAA 2M0BA 5APSA 2GUVA 3C1LA 4HDTA 1VPCA 1URQB 1IFPA 4KJMA 2KZIA 5AVQB 5APUA 2B89A 3GF3A 5DTWA 4LK5A 1CZQA 1LNQA 1WDKA 1ZV8A 5AVUB 1SQPK 1MZ9A 2FYZA 1QL2A 3L74J 1YTZI 2YKOA 3FGAD 3WUTA 1D7MA 1X22A 1KMIZ 4EOTA 5C9GA 4M3LA 3Q5PA 3TYYA 3B5NA 5DJTB 4U3FD 4IFFA 2P2UA 4PV1C 3M06A 1HTLC 5GTIH 1PZQA 1XTCC 2J5IB 3CMAP 2IBZI 1A02J 4I4ZA 2WT7B 2GTRA 2BASA 2WSSH 2ZYAA 2M3EA 1WDLA 3WG5A 3MZWB 4K2NA 4N6JA 4JQ0D 2F9YA 3G6EP 1BGYE 1NTZE 2P58A 4H44B 2ZQRA 3O8ZA 3NFQA 4N78D 1S9KE 3R0OA 3RL0D 1SQPD 3QWDA 1Q51A 1NTZD 4WBAA 4FN8A 2H89C 5M1BA 1DD4A 2I1JA 2YNYA 2QE7H 3QKAA 3C8VA 2AXTE 3L75D 1AQTA 1GMJA 2WSEJ 2Q35A 5KKZB 5AVXB 2NP9A 3GHGC 1NAFA 2WSCH 2A06G 2RN0A 3CCEP 2KZJA 2OQQA 3MHVA 1TU3F 2N1TA 1EQ7A 1RH5B 2PBPA 4H13B 1EZVD 3I56P 3WU2H 4G2RA 2QJPC 1NTKD 2RH0A 4JVTA 3AE7C 3ZW8A 1T3UA 3CI9A 1YG6A 3VYIA 2E75B 2A06D 4EMLA 3U1AA 2HPCB 1NU1K 1LJ2A 4R4MA 5B5EE 2FXPA 2WSFJ 1MJ3A 3KTGA 1RF1B 5DU6A 2A7SA 3V4QA 1AFOA 1HNUA 3H1KG 1FE6A 2W83C 4IL6E 3Q3DA 3LIEA 3QH9A 3ZDMA 3Q5RA 4NPEA 4GOFA 3N4XA 2K3RA 1G2CA 5GTHE 3HINA 1DEEG 2RMZA 1JOCA 5E0NX 1DH3A 1BDCA 1CW5A 1N6DA 1RJMA 2FYUE 2Z5IA 2W6AA 3G3ZA 2VSUE 4TT3H 3HE4A 1MFZA 5INGA 2BEQD 2E74C 1YQ3C 2K9JA 2QJKB 3PP5A 2OYIB 2KS1B 3K8XA 1RE3C 2KOGA 5JBWA 1SQQG 2HLOA 3CXHE 1KILA 1AV1A 4LC1A 1YI2P 3KTKA 2P1JA 3Q1MA 1SQBG 2LR2A 1SQPJ 3CCVP 1SQXK 3AE4C 1ZLLA 3CCRP 3L71J 5CCGA 1VDFA 3FDUA 3BCCG 2E76C 1N8RQ 1EF8A 2OTLP 1MKMA 1HWTC 1N2DC 1KB9D 5DL1A 5E79H 3P32A 3Q0JA 3A3YB 3AEGC 4K29A 1S3JA 3UIAA 4MI2A 1ZMEC 4W80A 1SQQJ 2GA1A 2KIKA 5E0SA 1URQD 2NPSD 1OIPA 2WTBA 1USDA 2F9IB 4A7PA 5CTBA 2O01N 3T3WA 1UYRA 3CXHD 4ELSA 5DUFA 1M1JA 3HP0A 2DW3A 4R4LA 2AXCA 5KLIC 3HD7A 1NTME 3HUSB 2JJLA 1P84D 1AA0A 4WY4D 5KLVG 5AW0B 3CL3D 2QG4A 3WUVA 2VSSF 1L0ND 2C0XA 3O6QA 1KN7A 4N78E 2FBMA 3BPPA 3BATA 2JDIH 1TG6A 2FYUK 4DI1A 2A45H 1EZVI 2HG5D 4U19A 5HUQA 2ZFCA 2JEEA 3RK2B 1SQQD 4L74A 4ZKPA 1JMMA 1VF5D 5DZKA 1GTWA 2V7QJ 3RBXA 3H1JJ 2IYPA 1VQ6P 3H1HD 2YO3A 1UYTA 2KSEA 3K50A 3JCUH 1S9KD 3MFMA 1J1DB 3CWBE 3V2PA 2R44A 3KTJA 3AEAC 2PP6A 1SFCD 1HVVA 1N6EA 2JR8A 1JY3P 3P8CD 2WT7A 1NTMJ 4K3WA 1FS0E 4FJWD 1PV3A 1FAVA 2NPSC 2ITAA 3CD6P 3JCUE 1FC9A 3QYRA 3TNUB 2Q1KA 3TGUG 2N1TD 1ZW0A 5KDRB 2HODA 3L72J 3LW5J 1FZGA 5K5GB 1L4AD 2E5YA 3E7KA 3H1IG 2O01J 1ZXGA 2M3BA 1VQ4P 3OW2O 3IF4A 4Q0GA 3G4SP 4UB6E 2V4HA 5AW9B 1RQVA 3AE9C 1X79B 5KAFH 1FZFA 2QEXP 1BCCD 3CCMP 3H1KJ 3BVHA 4W7YA 2YMKA 2G8YA 1Q90D 3NXSA 1M1JC 2WPQA 3T8AA 4JWVA 1GDTA 3HD7C 1J1EC 2L5GB 1FC7A 1YHQP 3LAOA 1WT6A 1NYHA 3RL0g 2XZRA 3B8EB 2W27A 3R9QA 2KI7B 4HKZH 1URQA 4IZBA 2WZ7A 1RF1A 3USSA 2A45I 2BEZF 1LTBC 2ZQQA 3P8CE 3L70D 4AQRD 1IFMA 1VRGA 2D3TA 4ELXA 1LT9B 3L72E 2ZL3A 4F47A 1BCCJ 2V7QH 5BVZA 3SLLA 2XU6A 1M90Q 3FF6A 1SQVK 2VSSA 1IO4A 3CX5H 1PPJE 2HYNA 3RK2C 3C9IA 1BSHA 3VIVA 2ZXXA 1L0NJ 1S2EA 3RK3C 1SQXE 1LT9A 3CWBG 1PGOA 3Q1TA 2KNCA 5KAFE 3H1KE 1UIYA 3PLNA 3L71D 2H7HA 1BGYG 2VX2A 5AW3B 1VQLP 1NTZG 1KFMA 4AUWA 4ZNCA 1VQOP 4L6WA 4KPKA 1JY3O 1YIJP 2YXRB 1VQ7P 1L4AA 2H88C 4HH2A 3I55P 1NU1E 4RO0A 4EIJA 1XNYA 4U0GH 2KYVA 5CBNA 2K88A 3CX5D 3H81A 4JSBA 3BEZA 3AEEC 1VL2A 1LT1A 5MGBA 1LGHB 3H0SA 4JPZB 3G71P 3MP7B 4EMMA 1N7SD 3HRXA 5H2FH 2ZT9D 2VSUC 1VQ5P 5E0SH 3WU2E 5DJUB 2F6IA 1T8ZA 3KQFA 1KYOI 3AECC 1M1JB 1N7SB 1DIPA 3HD7B 1NTMK 3TNUA 1ON3A 3Q2YA 1T3JA 4GDOA 4C46A 3MUDA 4IL6X 1RE4C 1EC5A 1FDIA 1G2CB 5JBXA 1OFCX 1Q81Q 2HPCA 1T2KC 1Y47A 3H1JG 3MGNA 3F89A 1KQFB 3WMM0 2FFDC 1KTMA 3VTPC 1FJKA 1KORA 1Q52A 4KWBA 3HUSA 4Z1MH 5FUSA 1KZUB 5C39A 1KV4A 1Q86Q 3MTUE 3HD7D 3M6NA 5AVVB 3U59A 1LTIC 4DOJA 2ZAEB 1NU1J 2KLUA 2NPSA 2QIWA 1XX4A 2IPPA 1HUCA 4ASIA 4WYOB 5DU8A 4NEKA 5APTA 2KXPB 2QJYC 2FKWB 2ZL2A 3TT7A 4CPGA 1N73A 2OTKE 3P7KA 2Y0CA 1JY2N 1OW6A 4JJTA 4JYJA 4GT1A 3VP9A 3CCQP 2KNCB 2KS1A 3HE2A 3VN0A 4HNKA 4U1AA 4FNDA 2VSSE 1NH4A 3PGQA 4Q1IA 1KYOE 3TT6A 3IR9A 1GL2C 2WWWA 5AW1B 1AJYA 1VQ9P 5CMZA 4U0GA 5INFA 1S5LE 2LXBA 3CPWO 3R9TA 2AEFA 1EF9A 2DEOA 3PJSK 1LTGC 3ZWCA 1K05A 3KTIA 3H6PA 1PP9J 3TDKA 1K39A 3EFGA 1NO4A 4WWIA 1WZ8A 4NARA 5FIFA 3L3SA 1FZCB 3VMXA 2QJKC 1FZBA 1Q2NA 4H0LB 1LP1A 1IK7A 4H13C 2OYHB 5INIA 2KSJA 2FW2A 1ZRTE 1KYOH 5KTBA 2AEMA 3AE1C 3Q7HA 1HH0A 2QA4P 2WSCJ 2M5AA 1EY3A 4PD4H 4PV1B 2UZFA 5AVSB 4NNQA 3H0UA 4MXIA 1S1CX 3H0QA 4H44D 1Q82Q 4ZDFA 3AEFC 5G1RA 4JF7A 5APWA 5CCHC 1RF1C 1GL2D 1LP1B 1MV8A 4ELWA 1BSNA 4GOEA 3WUUA 4UB8H 3HUSC 2H8PD 3GKBA 1SVFA 1QVFO 5GTHH 3ZWBA 3QXIA 2QQ3A 4EYYQ 3M0AA 3SWYA 5DKPA 2FYNC 5KKZC 1FCFA 2FZSA 2J5GD 2P10A 5IKLB 4K35A 5KLVD 2Y0DA 1P84I 2QVAA 2KP8A 3RSIA 3S9OA 4PJ0E 1H0TA 1QGKB 3AE3C 3U9TB 2C8TA 2YKPA 3O6QB 3A0BH 2NRGA 5G1SA 4NPDA 2ZT9B 3L73G 1IFDA 4U18A 4U3FJ 3RK2D 3D71A 1JTHA 4D6TG 1JEKA 1SQVJ 3DJAA 2RKLA 3OMEA 1ZOYC 2WMMA 4YXDC 4PD4D 1JCDA 1SZOA 3CX5I 4K3AA 2E74B 3FXEA 3LW5H 3A0HH 2O1JA 3RK3D 3TDCA 1AVOA 1Y7OA 1IZNB 3OJAB 2J5UA 1PP9D 1BE3G 3H1IE 2ZL0A 2Z4EA 1XNVA 3MUDC 2A06E 3TRRA 1FOSE 3G64A 1KILE 2IFMA 3TZ3A 2IX7C 3L74D 4BRYA 2WPVB 2B9BA 1KILD 4DZOA 4FZWC 2OYOA 2QM7A 3P2LA 2F6QA 2WPSA 2W8ZA 3A0BE 3S1KA 5APXA 2YIUC 4RKUJ 3BRVB 2B87A 3SFEC 3FX0A 5CCHA 1SQVE 2C0WA 2O01H 1IJDB 1PL5A 1YJ9P 1SQPG 3G9RA 2I1KA 3B5NC 5CCHD 5CHXA 3L4FA 5CBOA 4RCNA 2Q9IA 3P5MA 4WZ8B 3FWLA 4QMAA 2ZXEB 2FXMA 1LTJA 3R2PA 2G3AA 3GMAA 3LIDA 3TSIA 3H1IJ 3JSVC 4AYCA 1OD2A 1DX7A 1GZLA 4I2LC 3HE4B 4IFMA 1FZCC 1CI6A 1GL2A 4IZCA 3EQ2A 4KHXA 3M9QA 2PFXA 3L75J 4J2UA 1NTKG 4W7ZA 1OX3A 2OTJP 1LTJB 1IC2A 1OVRA 1NAYA 5CTCA 1KD1Q 4H0LD 3AE2C 1L4AC 5AVWB 5KLVK 5AVRB 3TF5A 2VSUF 1FU1A 3E1IA 1JY2P 1JCCA 2KB7P 5E79E 2QJYB 1OWAA 3H1HG 2N1TC 1NZYB 1EZVG 1GK6A 4HB1A 4ZDDA 4PD4E 1KB9I 1HZDA 4C7RA 3SWXA 1WDMA 4PJ0H 2IZ1A 3SFDC 5KLVJ 2O1KA 3L74G 3KZIE 3T89A 4EI2A 3BRTB 3KPEA 2R32A 5APVA 1RF0A 2O3JA 3RBZA 3ISAA 2Y9ZA 5TISH 3ABVC 1KFNA 4I7ZB 1XTGB 2J5GA 2P67A 3HTKB 3CCJP 2WPRA 1ZN5A 3T97B 4FZWA 3L75E 5BU8B 1SQVD 5KJ7A 3CCSP 3P8MC 1GK4A 2YO2A 2XDJA 5KAIE 1H89A 3HRNA 4BXLA 3CXHI 3QMJA 2E42A 2A45G 5AW6B 1GU5A 2IYOA 2CK3H 3H1LJ 4MN4C 4D6TJ 3L36A 1J2JB 2Q2XA 4HYTB 1M8OB 2ZYDA 1KQSO 3DORA 2PRRA 1X0UA 1N86A 3B5ND 1SQQE 1MUUA 3HE5B 5TISE 2IBZG 2NZ2A 1KQLA 1NVOA 1JB0J 1W2XA 3L74E 3D6ZA 5KLIB 1J1EB 5DTPA 1HJBA 2UWJE 3AE5C 1NGMB 1NKZB 1W2BO 3FWNA 1YTZT 2WVRA 1OVUA 1OD4A 1X9VA 1JUNA 2KLVA 2N9BA 4B3IA 2FYUD 3VOPA 1GD2E 5KLVE 1Y9BA 1O8UA 2F9YB 5L8RJ 1SQXG 4RJTA 1KB9E 1SS1A 1BCCE 4PD4I 4L76A 4XA4A 2Q7CA 4GM2A 1L4AB 3EWKA 3PRJA 4D6TD 2YIUB 2FY8A 1BGYJ 3KZIH 2K9JB 4ZDBA 1N73B 4IFDK 3V5BA 3I5CA 1JM0A 3W68A 3A5TA 1PGJA 2SPZA 1BDDA 3F5HA 3CMEP 4WY4B 4WY4C 5DU4A 1GW3A 3RRVA 3W67A 1EDLA 3ZWAA 5EFWB 3H1ID 3OA7A 2B87B 4UB6H 1LWUC
chains in the Genus database with same CATH topology
5INFA 4U0GA 3KTKA 3Q1MA 3NJDA 2FBWC 2MKVA 3R9TA 4OGQC 3NJBA 2VSUA 1EF9A 3AE4C 2DEOA 2YJGA 4I42A 4I52A 3ZWCA 1K05A 3V5IA 4U7JA 3KTIA 3R9SA 4I7ZC 3FDUA 2E76C 1EF8A 3M6MA 4YLHA 4JCSA 3IAOA 3V5EA 1VF5B 1K39A 2IEXA 1MKMA 5C90A 3QK8A 3OT6A 1WZ8A 2CE3A 3MYBA 4NARA 5FIFA 3D6YA 3L3SA 5DL1A 2QJKC 3Q0JA 4H0LB 1IK7A 4H13C 3AEGC 4GHNA 4K29A 1UYSA 5INIA 5DUCA 4MI2A 1ZMEC 4OGQD 2FW2A 1ZRTE 3Q7HA 3AE1C 2D2CD 1RQUA 2WSCJ 1XO6A 1EY3A 3B71A 1YG8A 4PV1B 2UZFA 5E0SA 2D2CC 2J5II 4MOUA 4FNBA 3H0UA 4NNQA 4XFJA 4MXIA 3IN6A 2WTBA 3HLN1 1S1CX 3H0QA 4H44D 3TVUA 4RYFA 2BZRA 2F9IB 2PPYA 5CTBA 3T3WA 4ZDFA 1UYRA 3AEFC 3AE8C 5G1RA 1J7XA 4ELSA 5DUFA 3RSTA 3T88A 3HP0A 1HNOA 4R4LA 2J5SA 4ELWA 5KLIC 1VF5C 3LKEA 4FN7A 4WCZA 1N6FA 1RJNA 4IZDA 3GKBA 4ZDEA 4B3HA 3QXZA 3ZWBA 3KTHA 2VSSF 3QXIA 2VREA 3O6QA 2QQ3A 4OGQB 2FBMA 3BPPA 1K32A 1TG6A 2A7KA 4DI1A 4QFEA 5DKPA 4L8KA 3Q0GA 3AEBC 2E75D 2FYNC 5KKZC 4U19A 1UYVA 1ZP0C 2DUBA 1FCFA 2FZSA 2J5GD 5HUQA 2P10A 3ZW9A 5IKLB 4OMRA 2ZL4A 4Z0MA 1SG4A 4JCTA 3RSIA 3S9OA 1VF5D 5DZKA 1S5LX 3AE3C 4HC8A 3U9TB 4ZU2A 2V7QJ 2C8TA 4KT0J 3MOYA 2W3PA 5G1SA 2ZT9B 4U18A 1UYTA 3K50A 3D71A 1U57A 3MFMA 1EXJA 3KTJA 3AEAC 3DJAA 3OMEA 1ZOYC 2K9YA 4YXDC 1N6EA 1SZOA 4YTPC 2E74B 3Q5SA 1XNWA 4K3WA 1NZYA 4FJWD 2JP3A 1PV3A 3QREA 3U9RB 3R6HA 1OW8A 4OLQA 1FC9A 3QYRA 3TDCA 1R8EA 3PE8A 4JCRA 1DUBA 5KDRA 5KDRB 3D70A 1Y7OA 3BF0A 4B3JA 3LW5J 2J5UA 2ZL0A 1XNVA 2O01J 4JCQA 4H0LC 3TRRA 3G64A 1TYFA 1KILE 4Q0GA 1WMKA 3GF7A 3TZ3A 3R4YA 1OW7A 2WPVB 3AEDC 2X58A 1RQVA 3AE9C 3I47A 4FZWC 3T8BA 3P2LA 2D2CB 4RYFH 2WQYC 2F6QA 1HF9A 2E75C 2YIUC 4RKUJ 3P85A 3MT6A 3SFEC 2JO1A 1EXIA 2YMKA 1HJ0A 1DD3A 3TLFA 2G8YA 1Q90D 3T8AA 2QSIA 4JWVA 3AE6C 1PL5A 3G9RA 2E76D 1FC7A 1JXZA 1ON9A 3LAOA 4FB8A 4RCNA 1NYHA 3P5MA 4WZ8B 2A81A 3IAVA 3STAA 2F9IA 3RL0g 3PEAA 2CBYA 3R9QA 4HDTA 1PIXA 2G3AA 4IZBA 3GMAA 4PV1D 1FC6A 2BEZF 3GF3A 5DTWA 3RK3E 4LK5A 1WDKA 1OD2A 2ZQQA 4JFCA 3FGAD 1VRGA 3H0JA 2D3TA 4ELXA 1YQ4C 4IZCA 2ZL3A 4F47A 4J2UA 4EMPA 1KMIZ 3SLLA 3FF6A 5G1QA 2VSSA 5C9GA 3OC7A 5CTCA 3Q5PA 4H0LD 3AE2C 2Q34A 4PV1C 2VSUF 2J5IB 1UIXA 4QIJA 3VIVA 4I4ZA 1PJHA 1NZYB 2GTRA 1WDLA 3WG5A 4K2NA 4ZDDA 2F9YA 3Q1TA 1UIYA 1HZDA 2E76B 4H44C 2ZQRA 4H44B 3SWXA 2VX2A 1WDMA 4L6WA 2PG8A 4ZDCA 3SFDC 4KPKA 3R0OA 3T89A 2H88C 3ST9A 3QWDA 1Q51A 4FN8A 2H89C 5M1BA 1DD4A 3U9SB 3QKAA 3C8VA 3ISAA 1XNYA 3N6RB 4U0GH 5DZKH 3IB9A 1GMJA 2WSEJ 3ABVC 2Q35A 3H81A 4JSBA 4I7ZB 2J5GA 2NP9A 3T97B 3BEZA 3AEEC 1VL2A 4FZWA 4U0HA 5MGBA 3H0SA 4EMMA 1KQGB 3HRXA 2OQQA 2ZT9D 1TU3F 2VSUC 5E0SH 3H02A 2F6IA 3PZKA 3JU1A 3KQFA 2PBPA 4H13B 3QMJA 3AECC 4G2RA 1DCIA 2QJPC 1DIPA 4JVTA 2Q2XA 3AE7C 1ON3A 3Q2YA 4GDOA 3ZW8A 4IL6X 1YG6A 2EJ5A 3DORA 1FDIA 2E75B 1X0UA 4EMLA 2IDBA 5JBXA 1OMIA 4R4MA 4JYLA 2FXPA 2WSFJ 1MJ3A 2NZ2A 3KTGA 1KQFB 5DU6A 1JB0J 1KTMA 1W2XA 1KORA 3D6ZA 1Q52A 2A7SA 4KWBA 1HNUA 5DTPA 3AE5C 1NGMB 2E74D 3Q3DA 3TV5A 4QIIA 4Z1MH 2X24A 5FUSA 4H13D 3Q5RA 1OD4A 4B3IA 4KNPA 1Y9BA 1O8UA 2F9YB 3HINA 2HW5A 3M6NA 5L8RJ 5KJPA 4KD6A 2QIWA 5E0NX 1XX4A 4ASIA 4WYOB 5DU8A 4NEKA 4JOTA 1N6DA 1RJMA 4GM2A 3TVWA 2VSUE 3EWKA 4TT3H 2J5IA 4Y28J 2QJYC 5INGA 2BEQD 2E74C 2ZL2A 1YQ3C 3TT7A 3BPTA 4ZDBA 1OW6A 4JJTA 4JYJA 3GLMA 3K8XA 3HE2A 4HNKA 4U1AA 2ZT9C 1K04A 5DU4A 4FNDA 2VSSE 3PGQA 3IBBA 5JBWA 3RRVA 3H25A 4OG1A 3ZWAA 4Q1IA 3TT6A 1FDOA 1AJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INF A;  4U0G A;  3KTK A;  3NJD A;  3R9T A;  3NJB A;  2VSU A;  1EF9 A;  2DEO A;  4I42 A;  4I52 A;  3ZWC A;  3V5I A;  3KTI A;  3R9S A;  3FDU A;  1EF8 A;  3M6M A;  4YLH A;  4JCS A;  3V5E A;  1K39 A;  2IEX A;  5C90 A;  3QK8 A;  3OT6 A;  1WZ8 A;  2CE3 A;  3MYB A;  5FIF A;  3L3S A;  5DL1 A;  3Q0J A;  4GHN A;  4K29 A;  1UYS A;  5INI A;  5DUC A;  4MI2 A;  2FW2 A;  3Q7H A;  1XO6 A;  1EY3 A;  1YG8 A;  2UZF A;  5E0S A;  2J5I I;  4MOU A;  4FNB A;  3H0U A;  4NNQ A;  4MXI A;  2WTB A;  3HLN 1;  3H0Q A;  3TVU A;  4RYF A;  2BZR A;  2F9I B;  2PPY A;  5CTB A;  3T3W A;  4ZDF A;  1UYR A;  5G1R A;  1J7X A;  4ELS A;  5DUF A;  3RST A;  3T88 A;  3HP0 A;  1HNO A;  2J5S A;  4ELW A;  3LKE A;  4FN7 A;  4WCZ A;  1N6F A;  1RJN A;  4IZD A;  3GKB A;  4ZDE A;  4B3H A;  3QXZ A;  3ZWB A;  3KTH A;  2VSS F;  3QXI A;  2VRE A;  2QQ3 A;  2FBM A;  3BPP A;  1K32 A;  1TG6 A;  2A7K A;  4DI1 A;  4QFE A;  5DKP A;  4L8K A;  3Q0G A;  4U19 A;  1UYV A;  2DUB A;  1FCF A;  2FZS A;  2J5G D;  3ZW9 A;  5IKL B;  4OMR A;  2ZL4 A;  4Z0M A;  1SG4 A;  3RSI A;  4JCT A;  5DZK A;  4HC8 A;  3U9T B;  4ZU2 A;  2C8T A;  3MOY A;  2W3P A;  5G1S A;  4U18 A;  1UYT A;  3K50 A;  3MFM A;  3KTJ A;  3OME A;  3DJA A;  1N6E A;  1SZO A;  1XNW A;  4K3W A;  1NZY A;  4FJW D;  3QRE A;  3U9R B;  3R6H A;  4OLQ A;  1FC9 A;  3QYR A;  3TDC A;  3PE8 A;  4JCR A;  1DUB A;  5KDR A;  5KDR B;  1Y7O A;  3BF0 A;  4B3J A;  2ZL0 A;  1XNV A;  4JCQ A;  3TRR A;  3G64 A;  1TYF A;  4Q0G A;  3GF7 A;  3TZ3 A;  2X58 A;  3I47 A;  4FZW C;  3T8B A;  3P2L A;  4RYF H;  2F6Q A;  3P85 A;  3MT6 A;  3TLF A;  3T8A A;  4JWV A;  1FC7 A;  1JXZ A;  1ON9 A;  3LAO A;  4FB8 A;  4RCN A;  3P5M A;  4WZ8 B;  2A81 A;  3IAV A;  3STA A;  2F9I A;  3PEA A;  2CBY A;  3R9Q A;  1PIX A;  4IZB A;  3GMA A;  1FC6 A;  3GF3 A;  5DTW A;  4LK5 A;  1WDK A;  1OD2 A;  2ZQQ A;  4JFC A;  1VRG A;  3H0J A;  2D3T A;  4ELX A;  4IZC A;  2ZL3 A;  4F47 A;  4EMP A;  3SLL A;  3FF6 A;  5G1Q A;  2VSS A;  5C9G A;  3OC7 A;  5CTC A;  2Q34 A;  2VSU F;  2J5I B;  4QIJ A;  3VIV A;  4I4Z A;  1PJH A;  1NZY B;  2GTR A;  1WDL A;  3WG5 A;  4K2N A;  4ZDD A;  2F9Y A;  3Q1T A;  1UIY A;  1HZD A;  2ZQR A;  3SWX A;  2VX2 A;  1WDM A;  4L6W A;  2PG8 A;  4ZDC A;  4KPK A;  3R0O A;  3T89 A;  3ST9 A;  3QWD A;  1Q51 A;  4FN8 A;  3U9S B;  3QKA A;  3ISA A;  1XNY A;  3N6R B;  4U0G H;  5DZK H;  3IB9 A;  2Q35 A;  3H81 A;  4JSB A;  2J5G A;  2NP9 A;  3BEZ A;  4FZW A;  4U0H A;  5MGB A;  3H0S A;  4EMM A;  3HRX A;  2VSU C;  5E0S H;  3H02 A;  2F6I A;  3PZK A;  3JU1 A;  3KQF A;  2PBP A;  3QMJ A;  4G2R A;  1DCI A;  4JVT A;  2Q2X A;  1ON3 A;  3ZW8 A;  1YG6 A;  2EJ5 A;  3DOR A;  1X0U A;  4EML A;  5JBX A;  4JYL A;  1MJ3 A;  3KTG A;  5DU6 A;  1W2X A;  1Q52 A;  2A7S A;  4KWB A;  1HNU A;  5DTP A;  3TV5 A;  4QII A;  2X24 A;  5FUS A;  1OD4 A;  4B3I A;  4KNP A;  1O8U A;  2F9Y B;  3HIN A;  2HW5 A;  3M6N A;  5KJP A;  4KD6 A;  5E0N X;  1XX4 A;  4ASI A;  4WYO B;  5DU8 A;  4NEK A;  4JOT A;  1N6D A;  1RJM A;  4GM2 A;  3TVW A;  2VSU E;  2J5I A;  5ING A;  2ZL2 A;  3TT7 A;  4ZDB A;  4JJT A;  4JYJ A;  3GLM A;  3K8X A;  3HE2 A;  4HNK A;  4U1A A;  5DU4 A;  4FND A;  2VSS E;  3PGQ A;  3IBB A;  5JBW A;  3RRV A;  4OG1 A;  3ZWA A;  4Q1I A;  3TT6 A; 
#chains in the Genus database with same CATH topology
 2ZVN B;  1K9M Q;  2IZ0 A;  3NJD A;  3GG2 A;  1JO5 A;  2FBW C;  2MKV A;  4OGQ C;  3NJB A;  2VSU A;  1SQV G;  2YJG A;  4I42 A;  3PH0 A;  5CJ0 A;  4U7J A;  3R9S A;  3GHG B;  4GIF A;  4YLH A;  3M6M A;  4JCS A;  4ASV A;  1VF5 B;  1FZE A;  2IEX A;  1X8Y A;  4OWF A;  3MYB A;  2CE3 A;  4LLH A;  4Y99 C;  3D6Y A;  1S4X A;  3CLQ A;  2ZYG A;  1PGP A;  2R3S A;  2GUS A;  2LXC B;  2Y0E A;  1UII A;  2FYU G;  1UYS A;  2OYH C;  4GHN A;  3FXD A;  5DUC A;  1SQQ K;  2D2C D;  1RQU A;  5B66 H;  3B71 A;  4BRY B;  1SQB E;  1LTS C;  1NTK J;  2D2C C;  3V6I A;  1IFJ A;  4FNB A;  2IBZ E;  3H32 A;  3HLN 1;  3OAK A;  3H1J D;  4RYF A;  2BZR A;  2PPY A;  4DJG A;  3A0H E;  1KYO D;  1N7L A;  1YJN P;  3AE8 C;  2KK7 A;  2POH A;  1LTT C;  1NKN A;  1G1J A;  1AQ5 A;  3T88 A;  2JWD A;  2PGD A;  1HNO A;  2R5B A;  2J5S A;  4YXW H;  4WCZ A;  1KB9 H;  1ZR4 A;  1ZR2 A;  4IZD A;  4ZDE A;  1NTM D;  4U3F G;  3KTH A;  2R3C A;  2VRE A;  3VP8 A;  1JMB A;  4QFE A;  1QLE D;  4WVZ A;  3Q0G A;  2FYU J;  1VQM P;  3AEB C;  4IL6 H;  1KIL B;  2DUB A;  2BCC D;  1KC8 Q;  3ZW9 A;  4OMR A;  3H1L D;  2W6B A;  4JCT A;  1H88 A;  3CX5 E;  1JY3 N;  2YMY A;  1S5L X;  4HC8 A;  4KT0 J;  2OGU A;  3MOY A;  4WB4 A;  1M1K Q;  2C9N Y;  1SP4 A;  2W3P A;  1NU1 D;  2XKM A;  3M0D C;  2H43 A;  1DEB A;  1SFC A;  1U57 A;  2BCC G;  2KUB A;  3H1K D;  1SLQ A;  2HR3 A;  1LWU B;  2P7J A;  1Z56 A;  1SQB J;  4YTP C;  3Q5S A;  1EDK A;  1NTK E;  1XNW A;  1NTZ J;  1NZY A;  5KJ7 C;  2JP3 A;  5H2F E;  1P84 E;  1W2E A;  3R6H A;  2FFD B;  1OW8 A;  4OLQ A;  1VQN P;  1R8E A;  4JBZ A;  1DUB A;  2Z5H A;  3D70 A;  1T2K D;  3IFM A;  3ITK A;  4GKG A;  3RGU A;  2QRX A;  3H1L G;  1PGQ A;  1L2P A;  4JCQ A;  3U1C A;  1SQB K;  1L0L G;  1TYF A;  1S5L H;  1Q7Y Q;  2M8R A;  1URQ C;  1WMK A;  3KXD A;  2XND H;  1OW7 A;  1Y8A A;  3I47 A;  1R5L A;  3GW6 A;  3T8B A;  2D2C B;  4RYF H;  2E75 C;  1U7J A;  1IFN A;  3CC4 P;  1QEX A;  2B88 A;  3CCL P;  2JO1 A;  1EXI A;  1DD3 A;  3TLF A;  3RK3 B;  2MJZ A;  4UB8 E;  4B86 A;  2QSI A;  2HFE D;  2E76 D;  1JXZ A;  1ON9 A;  1GL2 B;  4FB8 A;  1M7L A;  3QWO C;  1L0L E;  1A02 F;  3PTZ A;  2A81 A;  1M57 D;  1CSB A;  1QX8 A;  2F9I A;  1YJW P;  3PEA A;  2CBY A;  3CWB D;  1PIX A;  2NPS B;  2J59 M;  4PV1 D;  1FC6 A;  2AXT H;  3L73 E;  1MFT A;  3RK3 E;  2Q3I A;  3A2A A;  5KJ7 D;  2YKQ A;  4JFC A;  3H0J A;  5AW4 B;  1L0L D;  1YQ4 C;  1GU4 A;  1FDM A;  2PAJ A;  3H32 B;  2OYI C;  4EMP A;  3V2Q A;  1QVG O;  4WY4 A;  1EDJ A;  1K8A Q;  5G1Q A;  2QJP B;  3OC7 A;  2Q34 A;  1USE A;  1NJI Q;  1RY3 A;  1RF0 C;  1LWU A;  1UIX A;  1IK9 A;  4QIJ A;  3NTN A;  1YYC A;  1PJH A;  2J58 A;  1PPJ D;  3HTK A;  2BCC E;  2I8D A;  1L0N K;  1BE3 J;  1X0T A;  2E76 B;  3SWK A;  4H44 C;  3L70 E;  2W90 A;  1M56 D;  1SQP E;  2PG8 A;  1EDI A;  4ZDC A;  2C9L Y;  1RE4 A;  4GOD A;  3ST9 A;  1K73 Q;  3L72 D;  1JNM A;  3L71 E;  3CC7 P;  4ASW A;  3U9S B;  3N6R B;  1L0L J;  5DZK H;  3IB9 A;  4RES B;  2OYH A;  1LTJ C;  3M91 A;  4U0H A;  3L73 J;  1PFI A;  1KQG B;  1PP9 E;  3H02 A;  3B4S A;  3PZK A;  3JU1 A;  3KYQ A;  1RHZ B;  1L0N G;  1L0L K;  1DCI A;  2ZJS E;  3CXH H;  3V4W A;  1NTZ K;  2Y9Y A;  1BE3 D;  1CI6 B;  2WIT A;  4IOI H;  2OAR A;  2EJ5 A;  3MD0 A;  1BE3 E;  2IDB A;  1OMI A;  1FZC A;  4JYL A;  3V2N A;  2W6J H;  2K1A A;  2ZVO B;  4L75 A;  3VMZ A;  2BCC J;  2E74 D;  1H0T B;  3L72 G;  2WSF H;  3TV5 A;  4QII A;  1OXZ A;  2X24 A;  2Q3E A;  4H13 D;  2WTY A;  5AW5 B;  2FXO A;  3L70 J;  1FZA A;  4KNP A;  5CJ4 A;  2HW5 A;  1GW4 A;  1NOH A;  2IFN A;  5KJP A;  2N9Y B;  3M0D A;  1PPJ G;  4KD6 A;  3H1H J;  5AVT B;  4XE5 B;  5AVY B;  1JTH B;  3KDP B;  4I1L A;  5CCG D;  4JOT A;  3M9B A;  3TVW A;  2J5I A;  1L0N E;  4Y28 J;  3H1J E;  1SQX J;  5B5E H;  3BPT A;  2R5D A;  1SQB D;  1S72 P;  1FOS F;  3CWB J;  2FFD A;  3GLM A;  2ZT9 C;  1K04 A;  5AW8 B;  2YXQ B;  1HGZ A;  3IBB A;  3H25 A;  4OG1 A;  3B5N B;  1SFC B;  3CC2 P;  3N7N A;  1FDO A;  4U3F E;  1HGV A;  3KHU A;  5GTI E;  5APY A;  4NPF X;  2Q6Q A;  1ZRT D;  4I52 A;  3V5I A;  3NMD A;  1G1I A;  5AVZ B;  4I7Z C;  3MIW A;  4ZKU A;  3IAO A;  1PP9 G;  3V5E A;  3VMY A;  2E5T A;  5C90 A;  3QK8 A;  3OT6 A;  3BCC D;  1E5W A;  1N73 C;  3L73 D;  1VQ8 P;  3JC2 2;  1SQX D;  4JYC A;  3H1H E;  2LKM A;  3L35 A;  1FC2 C;  5KAI H;  5BU5 A;  4OGQ D;  4DCK A;  4JYB A;  1WRG A;  3GHG A;  1XO6 A;  5CCG C;  1YG8 A;  1BCC G;  2XV5 A;  2J5I I;  4MOU A;  4XFJ A;  3H1L E;  3RL0 C;  3IN6 A;  3TGU J;  4D6T E;  3TVU A;  4LGD E;  1P84 H;  2Q5U A;  3VMA A;  2VRS A;  3SSU A;  1J7X A;  2CPS A;  3RST A;  1N7S A;  2L91 A;  4ZMD A;  1VF5 C;  3LKE A;  4FN7 A;  1N6F A;  1QL1 A;  4C7N A;  1J1D C;  5TJH A;  4EDF A;  3SWF A;  1RJN A;  4B3H A;  3QXZ A;  4O9B A;  1NTK K;  4OGQ B;  1K32 A;  4OVN F;  2A7K A;  4L73 A;  3EFF K;  3PHL A;  4L8K A;  2QM8 A;  2GM4 A;  2E75 D;  3L70 G;  1UYV A;  1ZP0 C;  1OZH A;  2XNX A;  3TK1 A;  1E79 H;  4I6M C;  2ZL4 A;  4Z0M A;  1SG4 A;  4TLF A;  4Y99 B;  1NU1 G;  4C7N B;  4ZU2 A;  1FJP A;  4BWN A;  3TGU D;  1H8A A;  5AW2 B;  2AEJ A;  3A7O A;  3KQG A;  3BCC E;  1EXJ A;  1HBW A;  2K9Y A;  2K37 A;  1BGY D;  3E1R A;  1VQK P;  1U7M A;  3BAS A;  2IBZ D;  2JWA A;  3QRE A;  3U9R B;  3TGU E;  3L37 A;  1RE3 A;  2M5A B;  3PE8 A;  4JCR A;  1W5C E;  1EZV E;  5KDR A;  1NHL A;  3T97 A;  3BF0 A;  4B3J A;  1NTM G;  4N3Y B;  2CPB A;  2E43 A;  2JKV A;  2WSE H;  1LT9 C;  1AVY A;  1JY2 O;  4H0L C;  3GF7 A;  4HJG H;  1YIT P;  1KIL C;  5AW7 B;  2FYN B;  3R4Y A;  3CCU P;  3AED C;  2X58 A;  3K5B A;  1R5S A;  2WQY C;  5B66 E;  1HF9 A;  1FBM A;  3L71 G;  1T6A A;  2HOD B;  1NWQ A;  3P85 A;  3MT6 A;  3L75 G;  1IFI A;  2N1T B;  3II6 A;  5APQ A;  3HE5 A;  1HJ0 A;  1OVV A;  1LTA C;  3S4R A;  1N7S C;  1VQP P;  3AE6 C;  1SFC C;  4YPC A;  4DT0 A;  1YBK A;  3M9H A;  4OH8 B;  3RL0 B;  3IAV A;  3V2R A;  3BCC J;  2OYI A;  3STA A;  2M0B A;  5APS A;  2GUV A;  3C1L A;  4HDT A;  1VPC A;  1URQ B;  1IFP A;  4KJM A;  2KZI A;  5AVQ B;  5APU A;  2B89 A;  3GF3 A;  5DTW A;  4LK5 A;  1CZQ A;  1LNQ A;  1WDK A;  1ZV8 A;  5AVU B;  1SQP K;  1MZ9 A;  2FYZ A;  1QL2 A;  3L74 J;  1YTZ I;  2YKO A;  3FGA D;  3WUT A;  1D7M A;  1X22 A;  1KMI Z;  4EOT A;  5C9G A;  4M3L A;  3Q5P A;  3TYY A;  3B5N A;  5DJT B;  4U3F D;  4IFF A;  2P2U A;  4PV1 C;  3M06 A;  1HTL C;  5GTI H;  1PZQ A;  1XTC C;  2J5I B;  3CMA P;  2IBZ I;  1A02 J;  4I4Z A;  2WT7 B;  2GTR A;  2BAS A;  2WSS H;  2ZYA A;  2M3E A;  1WDL A;  3WG5 A;  3MZW B;  4K2N A;  4N6J A;  4JQ0 D;  2F9Y A;  3G6E P;  1BGY E;  1NTZ E;  2P58 A;  4H44 B;  2ZQR A;  3O8Z A;  3NFQ A;  4N78 D;  1S9K E;  3R0O A;  3RL0 D;  1SQP D;  3QWD A;  1Q51 A;  1NTZ D;  4WBA A;  4FN8 A;  2H89 C;  5M1B A;  1DD4 A;  2I1J A;  2YNY A;  2QE7 H;  3QKA A;  3C8V A;  2AXT E;  3L75 D;  1AQT A;  1GMJ A;  2WSE J;  2Q35 A;  5KKZ B;  5AVX B;  2NP9 A;  3GHG C;  1NAF A;  2WSC H;  2A06 G;  2RN0 A;  3CCE P;  2KZJ A;  2OQQ A;  3MHV A;  1TU3 F;  2N1T A;  1EQ7 A;  1RH5 B;  2PBP A;  4H13 B;  1EZV D;  3I56 P;  3WU2 H;  4G2R A;  2QJP C;  1NTK D;  2RH0 A;  4JVT A;  3AE7 C;  3ZW8 A;  1T3U A;  3CI9 A;  1YG6 A;  3VYI A;  2E75 B;  2A06 D;  4EML A;  3U1A A;  2HPC B;  1NU1 K;  1LJ2 A;  4R4M A;  5B5E E;  2FXP A;  2WSF J;  1MJ3 A;  3KTG A;  1RF1 B;  5DU6 A;  2A7S A;  3V4Q A;  1AFO A;  1HNU A;  3H1K G;  1FE6 A;  2W83 C;  4IL6 E;  3Q3D A;  3LIE A;  3QH9 A;  3ZDM A;  3Q5R A;  4NPE A;  4GOF A;  3N4X A;  2K3R A;  1G2C A;  5GTH E;  3HIN A;  1DEE G;  2RMZ A;  1JOC A;  5E0N X;  1DH3 A;  1BDC A;  1CW5 A;  1N6D A;  1RJM A;  2FYU E;  2Z5I A;  2W6A A;  3G3Z A;  2VSU E;  4TT3 H;  3HE4 A;  1MFZ A;  5ING A;  2BEQ D;  2E74 C;  1YQ3 C;  2K9J A;  2QJK B;  3PP5 A;  2OYI B;  2KS1 B;  3K8X A;  1RE3 C;  2KOG A;  5JBW A;  1SQQ G;  2HLO A;  3CXH E;  1KIL A;  1AV1 A;  4LC1 A;  1YI2 P;  3KTK A;  2P1J A;  3Q1M A;  1SQB G;  2LR2 A;  1SQP J;  3CCV P;  1SQX K;  3AE4 C;  1ZLL A;  3CCR P;  3L71 J;  5CCG A;  1VDF A;  3FDU A;  3BCC G;  2E76 C;  1N8R Q;  1EF8 A;  2OTL P;  1MKM A;  1HWT C;  1N2D C;  1KB9 D;  5DL1 A;  5E79 H;  3P32 A;  3Q0J A;  3A3Y B;  3AEG C;  4K29 A;  1S3J A;  3UIA A;  4MI2 A;  1ZME C;  4W80 A;  1SQQ J;  2GA1 A;  2KIK A;  5E0S A;  1URQ D;  2NPS D;  1OIP A;  2WTB A;  1USD A;  2F9I B;  4A7P A;  5CTB A;  2O01 N;  3T3W A;  1UYR A;  3CXH D;  4ELS A;  5DUF A;  1M1J A;  3HP0 A;  2DW3 A;  4R4L A;  2AXC A;  5KLI C;  3HD7 A;  1NTM E;  3HUS B;  2JJL A;  1P84 D;  1AA0 A;  4WY4 D;  5KLV G;  5AW0 B;  3CL3 D;  2QG4 A;  3WUV A;  2VSS F;  1L0N D;  2C0X A;  3O6Q A;  1KN7 A;  4N78 E;  2FBM A;  3BPP A;  3BAT A;  2JDI H;  1TG6 A;  2FYU K;  4DI1 A;  2A45 H;  1EZV I;  2HG5 D;  4U19 A;  5HUQ A;  2ZFC A;  2JEE A;  3RK2 B;  1SQQ D;  4L74 A;  4ZKP A;  1JMM A;  1VF5 D;  5DZK A;  1GTW A;  2V7Q J;  3RBX A;  3H1J J;  2IYP A;  1VQ6 P;  3H1H D;  2YO3 A;  1UYT A;  2KSE A;  3K50 A;  3JCU H;  1S9K D;  3MFM A;  1J1D B;  3CWB E;  3V2P A;  2R44 A;  3KTJ A;  3AEA C;  2PP6 A;  1SFC D;  1HVV A;  1N6E A;  2JR8 A;  1JY3 P;  3P8C D;  2WT7 A;  1NTM J;  4K3W A;  1FS0 E;  4FJW D;  1PV3 A;  1FAV A;  2NPS C;  2ITA A;  3CD6 P;  3JCU E;  1FC9 A;  3QYR A;  3TNU B;  2Q1K A;  3TGU G;  2N1T D;  1ZW0 A;  5KDR B;  2HOD A;  3L72 J;  3LW5 J;  1FZG A;  5K5G B;  1L4A D;  2E5Y A;  3E7K A;  3H1I G;  2O01 J;  1ZXG A;  2M3B A;  1VQ4 P;  3OW2 O;  3IF4 A;  4Q0G A;  3G4S P;  4UB6 E;  2V4H A;  5AW9 B;  1RQV A;  3AE9 C;  1X79 B;  5KAF H;  1FZF A;  2QEX P;  1BCC D;  3CCM P;  3H1K J;  3BVH A;  4W7Y A;  2YMK A;  2G8Y A;  1Q90 D;  3NXS A;  1M1J C;  2WPQ A;  3T8A A;  4JWV A;  1GDT A;  3HD7 C;  1J1E C;  2L5G B;  1FC7 A;  1YHQ P;  3LAO A;  1WT6 A;  1NYH A;  3RL0 g;  2XZR A;  3B8E B;  2W27 A;  3R9Q A;  2KI7 B;  4HKZ H;  1URQ A;  4IZB A;  2WZ7 A;  1RF1 A;  3USS A;  2A45 I;  2BEZ F;  1LTB C;  2ZQQ A;  3P8C E;  3L70 D;  4AQR D;  1IFM A;  1VRG A;  2D3T A;  4ELX A;  1LT9 B;  3L72 E;  2ZL3 A;  4F47 A;  1BCC J;  2V7Q H;  5BVZ A;  3SLL A;  2XU6 A;  1M90 Q;  3FF6 A;  1SQV K;  2VSS A;  1IO4 A;  3CX5 H;  1PPJ E;  2HYN A;  3RK2 C;  3C9I A;  1BSH A;  3VIV A;  2ZXX A;  1L0N J;  1S2E A;  3RK3 C;  1SQX E;  1LT9 A;  3CWB G;  1PGO A;  3Q1T A;  2KNC A;  5KAF E;  3H1K E;  1UIY A;  3PLN A;  3L71 D;  2H7H A;  1BGY G;  2VX2 A;  5AW3 B;  1VQL P;  1NTZ G;  1KFM A;  4AUW A;  4ZNC A;  1VQO P;  4L6W A;  4KPK A;  1JY3 O;  1YIJ P;  2YXR B;  1VQ7 P;  1L4A A;  2H88 C;  4HH2 A;  3I55 P;  1NU1 E;  4RO0 A;  4EIJ A;  1XNY A;  4U0G H;  2KYV A;  5CBN A;  2K88 A;  3CX5 D;  3H81 A;  4JSB A;  3BEZ A;  3AEE C;  1VL2 A;  1LT1 A;  5MGB A;  1LGH B;  3H0S A;  4JPZ B;  3G71 P;  3MP7 B;  4EMM A;  1N7S D;  3HRX A;  5H2F H;  2ZT9 D;  2VSU C;  1VQ5 P;  5E0S H;  3WU2 E;  5DJU B;  2F6I A;  1T8Z A;  3KQF A;  1KYO I;  3AEC C;  1M1J B;  1N7S B;  1DIP A;  3HD7 B;  1NTM K;  3TNU A;  1ON3 A;  3Q2Y A;  1T3J A;  4GDO A;  4C46 A;  3MUD A;  4IL6 X;  1RE4 C;  1EC5 A;  1FDI A;  1G2C B;  5JBX A;  1OFC X;  1Q81 Q;  2HPC A;  1T2K C;  1Y47 A;  3H1J G;  3MGN A;  3F89 A;  1KQF B;  3WMM 0;  2FFD C;  1KTM A;  3VTP C;  1FJK A;  1KOR A;  1Q52 A;  4KWB A;  3HUS A;  4Z1M H;  5FUS A;  1KZU B;  5C39 A;  1KV4 A;  1Q86 Q;  3MTU E;  3HD7 D;  3M6N A;  5AVV B;  3U59 A;  1LTI C;  4DOJ A;  2ZAE B;  1NU1 J;  2KLU A;  2NPS A;  2QIW A;  1XX4 A;  2IPP A;  1HUC A;  4ASI A;  4WYO B;  5DU8 A;  4NEK A;  5APT A;  2KXP B;  2QJY C;  2FKW B;  2ZL2 A;  3TT7 A;  4CPG A;  1N73 A;  2OTK E;  3P7K A;  2Y0C A;  1JY2 N;  1OW6 A;  4JJT A;  4JYJ A;  4GT1 A;  3VP9 A;  3CCQ P;  2KNC B;  2KS1 A;  3HE2 A;  3VN0 A;  4HNK A;  4U1A A;  4FND A;  2VSS E;  1NH4 A;  3PGQ A;  4Q1I A;  1KYO E;  3TT6 A;  3IR9 A;  1GL2 C;  2WWW A;  5AW1 B;  1AJY A;  1VQ9 P;  5CMZ A;  4U0G A;  5INF A;  1S5L E;  2LXB A;  3CPW O;  3R9T A;  2AEF A;  1EF9 A;  2DEO A;  3PJS K;  1LTG C;  3ZWC A;  1K05 A;  3KTI A;  3H6P A;  1PP9 J;  3TDK A;  1K39 A;  3EFG A;  1NO4 A;  4WWI A;  1WZ8 A;  4NAR A;  5FIF A;  3L3S A;  1FZC B;  3VMX A;  2QJK C;  1FZB A;  1Q2N A;  4H0L B;  1LP1 A;  1IK7 A;  4H13 C;  2OYH B;  5INI A;  2KSJ A;  2FW2 A;  1ZRT E;  1KYO H;  5KTB A;  2AEM A;  3AE1 C;  3Q7H A;  1HH0 A;  2QA4 P;  2WSC J;  2M5A A;  1EY3 A;  4PD4 H;  4PV1 B;  2UZF A;  5AVS B;  4NNQ A;  3H0U A;  4MXI A;  1S1C X;  3H0Q A;  4H44 D;  1Q82 Q;  4ZDF A;  3AEF C;  5G1R A;  4JF7 A;  5APW A;  5CCH C;  1RF1 C;  1GL2 D;  1LP1 B;  1MV8 A;  4ELW A;  1BSN A;  4GOE A;  3WUU A;  4UB8 H;  3HUS C;  2H8P D;  3GKB A;  1SVF A;  1QVF O;  5GTH H;  3ZWB A;  3QXI A;  2QQ3 A;  4EYY Q;  3M0A A;  3SWY A;  5DKP A;  2FYN C;  5KKZ C;  1FCF A;  2FZS A;  2J5G D;  2P10 A;  5IKL B;  4K35 A;  5KLV D;  2Y0D A;  1P84 I;  2QVA A;  2KP8 A;  3RSI A;  3S9O A;  4PJ0 E;  1H0T A;  1QGK B;  3AE3 C;  3U9T B;  2C8T A;  2YKP A;  3O6Q B;  3A0B H;  2NRG A;  5G1S A;  4NPD A;  2ZT9 B;  3L73 G;  1IFD A;  4U18 A;  4U3F J;  3RK2 D;  3D71 A;  1JTH A;  4D6T G;  1JEK A;  1SQV J;  3DJA A;  2RKL A;  3OME A;  1ZOY C;  2WMM A;  4YXD C;  4PD4 D;  1JCD A;  1SZO A;  3CX5 I;  4K3A A;  2E74 B;  3FXE A;  3LW5 H;  3A0H H;  2O1J A;  3RK3 D;  3TDC A;  1AVO A;  1Y7O A;  1IZN B;  3OJA B;  2J5U A;  1PP9 D;  1BE3 G;  3H1I E;  2ZL0 A;  2Z4E A;  1XNV A;  3MUD C;  2A06 E;  3TRR A;  1FOS E;  3G64 A;  1KIL E;  2IFM A;  3TZ3 A;  2IX7 C;  3L74 D;  4BRY A;  2WPV B;  2B9B A;  1KIL D;  4DZO A;  4FZW C;  2OYO A;  2QM7 A;  3P2L A;  2F6Q A;  2WPS A;  2W8Z A;  3A0B E;  3S1K A;  5APX A;  2YIU C;  4RKU J;  3BRV B;  2B87 A;  3SFE C;  3FX0 A;  5CCH A;  1SQV E;  2C0W A;  2O01 H;  1IJD B;  1PL5 A;  1YJ9 P;  1SQP G;  3G9R A;  2I1K A;  3B5N C;  5CCH D;  5CHX A;  3L4F A;  5CBO A;  4RCN A;  2Q9I A;  3P5M A;  4WZ8 B;  3FWL A;  4QMA A;  2ZXE B;  2FXM A;  1LTJ A;  3R2P A;  2G3A A;  3GMA A;  3LID A;  3TSI A;  3H1I J;  3JSV C;  4AYC A;  1OD2 A;  1DX7 A;  1GZL A;  4I2L C;  3HE4 B;  4IFM A;  1FZC C;  1CI6 A;  1GL2 A;  4IZC A;  3EQ2 A;  4KHX A;  3M9Q A;  2PFX A;  3L75 J;  4J2U A;  1NTK G;  4W7Z A;  1OX3 A;  2OTJ P;  1LTJ B;  1IC2 A;  1OVR A;  1NAY A;  5CTC A;  1KD1 Q;  4H0L D;  3AE2 C;  1L4A C;  5AVW B;  5KLV K;  5AVR B;  3TF5 A;  2VSU F;  1FU1 A;  3E1I A;  1JY2 P;  1JCC A;  2KB7 P;  5E79 E;  2QJY B;  1OWA A;  3H1H G;  2N1T C;  1NZY B;  1EZV G;  1GK6 A;  4HB1 A;  4ZDD A;  4PD4 E;  1KB9 I;  1HZD A;  4C7R A;  3SWX A;  1WDM A;  4PJ0 H;  2IZ1 A;  3SFD C;  5KLV J;  2O1K A;  3L74 G;  3KZI E;  3T89 A;  4EI2 A;  3BRT B;  3KPE A;  2R32 A;  5APV A;  1RF0 A;  2O3J A;  3RBZ A;  3ISA A;  2Y9Z A;  5TIS H;  3ABV C;  1KFN A;  4I7Z B;  1XTG B;  2J5G A;  2P67 A;  3HTK B;  3CCJ P;  2WPR A;  1ZN5 A;  3T97 B;  4FZW A;  3L75 E;  5BU8 B;  1SQV D;  5KJ7 A;  3CCS P;  3P8M C;  1GK4 A;  2YO2 A;  2XDJ A;  5KAI E;  1H89 A;  3HRN A;  4BXL A;  3CXH I;  3QMJ A;  2E42 A;  2A45 G;  5AW6 B;  1GU5 A;  2IYO A;  2CK3 H;  3H1L J;  4MN4 C;  4D6T J;  3L36 A;  1J2J B;  2Q2X A;  4HYT B;  1M8O B;  2ZYD A;  1KQS O;  3DOR A;  2PRR A;  1X0U A;  1N86 A;  3B5N D;  1SQQ E;  1MUU A;  3HE5 B;  5TIS E;  2IBZ G;  2NZ2 A;  1KQL A;  1NVO A;  1JB0 J;  1W2X A;  3L74 E;  3D6Z A;  5KLI B;  1J1E B;  5DTP A;  1HJB A;  2UWJ E;  3AE5 C;  1NGM B;  1NKZ B;  1W2B O;  3FWN A;  1YTZ T;  2WVR A;  1OVU A;  1OD4 A;  1X9V A;  1JUN A;  2KLV A;  2N9B A;  4B3I A;  2FYU D;  3VOP A;  1GD2 E;  5KLV E;  1Y9B A;  1O8U A;  2F9Y B;  5L8R J;  1SQX G;  4RJT A;  1KB9 E;  1SS1 A;  1BCC E;  4PD4 I;  4L76 A;  4XA4 A;  2Q7C A;  4GM2 A;  1L4A B;  3EWK A;  3PRJ A;  4D6T D;  2YIU B;  2FY8 A;  1BGY J;  3KZI H;  2K9J B;  4ZDB A;  1N73 B;  4IFD K;  3V5B A;  3I5C A;  1JM0 A;  3W68 A;  3A5T A;  1PGJ A;  2SPZ A;  1BDD A;  3F5H A;  3CME P;  4WY4 B;  4WY4 C;  5DU4 A;  1GW3 A;  3RRV A;  3W67 A;  1EDL A;  3ZWA A;  5EFW B;  3H1I D;  3OA7 A;  2B87 B;  4UB6 H;  1LWU C; 
#chains in the Genus database with same CATH homology
 5INF A;  4U0G A;  3KTK A;  3Q1M A;  3NJD A;  2FBW C;  2MKV A;  3R9T A;  4OGQ C;  3NJB A;  2VSU A;  1EF9 A;  3AE4 C;  2DEO A;  2YJG A;  4I42 A;  4I52 A;  3ZWC A;  1K05 A;  3V5I A;  4U7J A;  3KTI A;  3R9S A;  4I7Z C;  3FDU A;  2E76 C;  1EF8 A;  3M6M A;  4YLH A;  4JCS A;  3IAO A;  3V5E A;  1VF5 B;  1K39 A;  2IEX A;  1MKM A;  5C90 A;  3QK8 A;  3OT6 A;  1WZ8 A;  2CE3 A;  3MYB A;  4NAR A;  5FIF A;  3D6Y A;  3L3S A;  5DL1 A;  2QJK C;  3Q0J A;  4H0L B;  1IK7 A;  4H13 C;  3AEG C;  4GHN A;  4K29 A;  1UYS A;  5INI A;  5DUC A;  4MI2 A;  1ZME C;  4OGQ D;  2FW2 A;  1ZRT E;  3Q7H A;  3AE1 C;  2D2C D;  1RQU A;  2WSC J;  1XO6 A;  1EY3 A;  3B71 A;  1YG8 A;  4PV1 B;  2UZF A;  5E0S A;  2D2C C;  2J5I I;  4MOU A;  4FNB A;  3H0U A;  4NNQ A;  4XFJ A;  4MXI A;  3IN6 A;  2WTB A;  3HLN 1;  1S1C X;  3H0Q A;  4H44 D;  3TVU A;  4RYF A;  2BZR A;  2F9I B;  2PPY A;  5CTB A;  3T3W A;  4ZDF A;  1UYR A;  3AEF C;  3AE8 C;  5G1R A;  1J7X A;  4ELS A;  5DUF A;  3RST A;  3T88 A;  3HP0 A;  1HNO A;  4R4L A;  2J5S A;  4ELW A;  5KLI C;  1VF5 C;  3LKE A;  4FN7 A;  4WCZ A;  1N6F A;  1RJN A;  4IZD A;  3GKB A;  4ZDE A;  4B3H A;  3QXZ A;  3ZWB A;  3KTH A;  2VSS F;  3QXI A;  2VRE A;  3O6Q A;  2QQ3 A;  4OGQ B;  2FBM A;  3BPP A;  1K32 A;  1TG6 A;  2A7K A;  4DI1 A;  4QFE A;  5DKP A;  4L8K A;  3Q0G A;  3AEB C;  2E75 D;  2FYN C;  5KKZ C;  4U19 A;  1UYV A;  1ZP0 C;  2DUB A;  1FCF A;  2FZS A;  2J5G D;  5HUQ A;  2P10 A;  3ZW9 A;  5IKL B;  4OMR A;  2ZL4 A;  4Z0M A;  1SG4 A;  4JCT A;  3RSI A;  3S9O A;  1VF5 D;  5DZK A;  1S5L X;  3AE3 C;  4HC8 A;  3U9T B;  4ZU2 A;  2V7Q J;  2C8T A;  4KT0 J;  3MOY A;  2W3P A;  5G1S A;  2ZT9 B;  4U18 A;  1UYT A;  3K50 A;  3D71 A;  1U57 A;  3MFM A;  1EXJ A;  3KTJ A;  3AEA C;  3DJA A;  3OME A;  1ZOY C;  2K9Y A;  4YXD C;  1N6E A;  1SZO A;  4YTP C;  2E74 B;  3Q5S A;  1XNW A;  4K3W A;  1NZY A;  4FJW D;  2JP3 A;  1PV3 A;  3QRE A;  3U9R B;  3R6H A;  1OW8 A;  4OLQ A;  1FC9 A;  3QYR A;  3TDC A;  1R8E A;  3PE8 A;  4JCR A;  1DUB A;  5KDR A;  5KDR B;  3D70 A;  1Y7O A;  3BF0 A;  4B3J A;  3LW5 J;  2J5U A;  2ZL0 A;  1XNV A;  2O01 J;  4JCQ A;  4H0L C;  3TRR A;  3G64 A;  1TYF A;  1KIL E;  4Q0G A;  1WMK A;  3GF7 A;  3TZ3 A;  3R4Y A;  1OW7 A;  2WPV B;  3AED C;  2X58 A;  1RQV A;  3AE9 C;  3I47 A;  4FZW C;  3T8B A;  3P2L A;  2D2C B;  4RYF H;  2WQY C;  2F6Q A;  1HF9 A;  2E75 C;  2YIU C;  4RKU J;  3P85 A;  3MT6 A;  3SFE C;  2JO1 A;  1EXI A;  2YMK A;  1HJ0 A;  1DD3 A;  3TLF A;  2G8Y A;  1Q90 D;  3T8A A;  2QSI A;  4JWV A;  3AE6 C;  1PL5 A;  3G9R A;  2E76 D;  1FC7 A;  1JXZ A;  1ON9 A;  3LAO A;  4FB8 A;  4RCN A;  1NYH A;  3P5M A;  4WZ8 B;  2A81 A;  3IAV A;  3STA A;  2F9I A;  3RL0 g;  3PEA A;  2CBY A;  3R9Q A;  4HDT A;  1PIX A;  2G3A A;  4IZB A;  3GMA A;  4PV1 D;  1FC6 A;  2BEZ F;  3GF3 A;  5DTW A;  3RK3 E;  4LK5 A;  1WDK A;  1OD2 A;  2ZQQ A;  4JFC A;  3FGA D;  1VRG A;  3H0J A;  2D3T A;  4ELX A;  1YQ4 C;  4IZC A;  2ZL3 A;  4F47 A;  4J2U A;  4EMP A;  1KMI Z;  3SLL A;  3FF6 A;  5G1Q A;  2VSS A;  5C9G A;  3OC7 A;  5CTC A;  3Q5P A;  4H0L D;  3AE2 C;  2Q34 A;  4PV1 C;  2VSU F;  2J5I B;  1UIX A;  4QIJ A;  3VIV A;  4I4Z A;  1PJH A;  1NZY B;  2GTR A;  1WDL A;  3WG5 A;  4K2N A;  4ZDD A;  2F9Y A;  3Q1T A;  1UIY A;  1HZD A;  2E76 B;  4H44 C;  2ZQR A;  4H44 B;  3SWX A;  2VX2 A;  1WDM A;  4L6W A;  2PG8 A;  4ZDC A;  3SFD C;  4KPK A;  3R0O A;  3T89 A;  2H88 C;  3ST9 A;  3QWD A;  1Q51 A;  4FN8 A;  2H89 C;  5M1B A;  1DD4 A;  3U9S B;  3QKA A;  3C8V A;  3ISA A;  1XNY A;  3N6R B;  4U0G H;  5DZK H;  3IB9 A;  1GMJ A;  2WSE J;  3ABV C;  2Q35 A;  3H81 A;  4JSB A;  4I7Z B;  2J5G A;  2NP9 A;  3T97 B;  3BEZ A;  3AEE C;  1VL2 A;  4FZW A;  4U0H A;  5MGB A;  3H0S A;  4EMM A;  1KQG B;  3HRX A;  2OQQ A;  2ZT9 D;  1TU3 F;  2VSU C;  5E0S H;  3H02 A;  2F6I A;  3PZK A;  3JU1 A;  3KQF A;  2PBP A;  4H13 B;  3QMJ A;  3AEC C;  4G2R A;  1DCI A;  2QJP C;  1DIP A;  4JVT A;  2Q2X A;  3AE7 C;  1ON3 A;  3Q2Y A;  4GDO A;  3ZW8 A;  4IL6 X;  1YG6 A;  2EJ5 A;  3DOR A;  1FDI A;  2E75 B;  1X0U A;  4EML A;  2IDB A;  5JBX A;  1OMI A;  4R4M A;  4JYL A;  2FXP A;  2WSF J;  1MJ3 A;  2NZ2 A;  3KTG A;  1KQF B;  5DU6 A;  1JB0 J;  1KTM A;  1W2X A;  1KOR A;  3D6Z A;  1Q52 A;  2A7S A;  4KWB A;  1HNU A;  5DTP A;  3AE5 C;  1NGM B;  2E74 D;  3Q3D A;  3TV5 A;  4QII A;  4Z1M H;  2X24 A;  5FUS A;  4H13 D;  3Q5R A;  1OD4 A;  4B3I A;  4KNP A;  1Y9B A;  1O8U A;  2F9Y B;  3HIN A;  2HW5 A;  3M6N A;  5L8R J;  5KJP A;  4KD6 A;  2QIW A;  5E0N X;  1XX4 A;  4ASI A;  4WYO B;  5DU8 A;  4NEK A;  4JOT A;  1N6D A;  1RJM A;  4GM2 A;  3TVW A;  2VSU E;  3EWK A;  4TT3 H;  2J5I A;  4Y28 J;  2QJY C;  5ING A;  2BEQ D;  2E74 C;  2ZL2 A;  1YQ3 C;  3TT7 A;  3BPT A;  4ZDB A;  1OW6 A;  4JJT A;  4JYJ A;  3GLM A;  3K8X A;  3HE2 A;  4HNK A;  4U1A A;  2ZT9 C;  1K04 A;  5DU4 A;  4FND A;  2VSS E;  3PGQ A;  3IBB A;  5JBW A;  3RRV A;  3H25 A;  4OG1 A;  3ZWA A;  4Q1I A;  3TT6 A;  1FDO A;  1AJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...