3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
3HB4X 1DSSG 2YYYA 3C1OA 3R0OA 2C2XA 4JIGA 5EL0A 1NQOA 3W4IA 4S3MA 4QT0A 4DI1A 1SPXA 1XR3A 2OBNA 3IS3A 5EQDA 2PZJA 1ISJA 5DU6A 3G0OA 3TRIA 2RIRA 3OJOA 4WE3A 2CDCA 1UJMA 1E7SA 1QORA 1J4AA 3P5MA 1V8BA 1E3LA 1BW9A 2VZ0A 3VPGA 2I3GA 3RROA 4CV3A 5A02A 2EWMA 2VNSA 5DDIP 5G4KB 4RPGA 1Z82A 4ELXA 4WKGA 1LXCA 2C07A 4CLXA 1ZBQA 2VYND 5KKCA 2CVOA 5DN9A 4FS3A 4I1IA 3CXRA 5IN4A 4B3HA 1X7GA 3RQSA 3KHUA 2JKVA 4MIOA 3PYLA 2F9IB 2AEJA 2Z1MA 4G2NA 2B4TO 4XA8A 5L7TA 1C14A 5DZKH 1KEPA 4GX5A 2BD0A 3RBVA 1WLYA 4BO2A 4OKNA 3GF7A 1X0VA 3SC6A 2FOIA 3BXXA 1U2DA 2P9EA 4MXIA 4ITUA 3JCZA 3PWSA 3DL2A 3QWBA 4WEOA 3C8MA 3G79A 4IPTA 5I8WA 2WWRA 2OFPA 3LVFO 5EPOA 2O3JA 1RJNA 5JBIA 1LUAA 1EFLA 3AY3A 3OQBA 3TPCA 2JCYA 1E7MA 3GVXA 1F17A 1Y5MA 4AJ1A 2WTBA 2PH5A 4WNCA 3WDSA 4ZQEA 3QV1A 3WSVA 2VREA 3ENKA 4A7PA 1XNWA 5TJHA 1UYSA 2DPGA 3MJTA 1X7HA 3D1LA 2HQ1A 4WGGA 2HRBA 3RIHA 1DJQA 4JX8A 1FCFA 1YG6A 4JNKA 5ER6A 3DBRA 1IE3A 4CM6A 5F1KA 4BNLA 3PJEA 1Y8RA 3CTMA 5L53A 1EUDA 1DRWA 2F1KA 4FFNA 4FR5A 1UUFA 2V6BA 3INRA 4BNVA 4CM8A 1IY8A 4DLAA 3TZ6A 3HDYA 2PD4A 4JXKA 2OGUA 4J2OA 1AHHA 1M6WA 3DR3A 1WMAA 1I10A 2B35A 4ZVVA 3VPSA 3I83A 1BVUA 3NDRA 5C9GA 3JYLA 3QQPA 4DYDA 5TC4A 5IZCC 3MT6A 1JU9A 3I4CA 4QSMA 4E6PA 3R6HA 1M67A 3V2HA 4PGFA 4B8ZA 3JQCA 3CZMA 3T89A 1SEVA 3F3SA 2B69A 1EBUA 2CFCA 2XAAA 5EESA 5L51A 4UULA 1Y9EA 4FFRA 1U4OA 2GD1O 2FN7A 1N6EA 3V1YA 1UP6A 3GRPA 3FSRA 2D1YA 4XGIA 5JAZA 3QWHA 1VJ0A 5EINA 2DM6A 3NJDA 1QKIA 2FZEA 4GGOA 4IJWA 1PZHA 4UEKA 3NGXA 3F4BA 3STHA 3H9JA 3IAHA 3U3XA 2WYUA 3SWXA 4JP3A 2IYPA 4RPLA 3GN1A 4GX1A 4KPKA 1PJTA 2ZIZA 4J1QA 1FDSA 1PQUA 4MIEA 4JBGA 4OYRA 4ESOA 2RBEA 1YQXA 5C90A 3QE3A 4Y6SA 1LEHA 4O1MA 4GBJA 3H0SA 1AE1A 2AQIA 2X7HA 3PJDA 4Q3AA 3NJBA 5ADHA 4CLDA 3AJRA 4AG3A 4GVLA 1EQUA 2H5LA 3RBXA 5JAMA 1XQ1A 1GV1A 2X23A 4PLFA 5DBGA 4EJMA 1OFGA 3RSIA 3ONDA 4E5PA 1CRWG 2WE8A 3BMNB 3KXDA 1I8TA 3WIDA 3GUCA 5AVOA 2B0JA 2QRLA 1L7EA 1DOHA 1HYGA 2DBZA 4MVJA 5A06A 1C0KA 3VVCA 3E9NA 3HQ4O 4IDEA 5CPFA 1LX6A 1LI4A 4YRAA 1LQUA 2GRAA 3JQFC 3D4PA 3K9QO 3H0QA 1UXKA 2Y93A 1NQTA 4NU6A 4WOKA 4IINA 3F46A 1UP7A 2BFPA 1Y5RA 1Y9AA 1T24A 2DAPA 3DZFA 5FI3A 3ZWMA 4DVJA 1LDGA 4J6FA 4RORA 4AFNA 1LC0A 1M2WA 1YRLA 3Q9UA 2B37A 5G4KA 4GGPA 4JBHA 4WLOA 4JJGA 1QG6A 5B1YA 3HG7A 4JQCA 1BWSA 1VLLA 4JFCA 3Q1LA 3OT6A 3MWDB 3ROKA 3ZGYA 2AW5A 4JJTA 4B79A 3K8ZA 5CAEA 2F9IA 5B4UA 4MJLA 4P4GA 1SO8A 4HC8A 2PKQP 2PV7A 4ZQFA 4WNIA 3ANLA 1H94A 1I24A 4R41A 5DZSA 3GF3A 1HDCA 4FOOA 4LSWA 4WASA 4IGFA 3CUKA 1B14A 2X24A 3PTZA 3OMEA 2O3RA 1PL7A 1RKXA 2PGJA 3NDIA 5T8KA 3D3WA 1V3TA 2I66A 4NDNE 3RUIA 3LKEA 1WDLA 3WXBA 1CDOA 1HETA 1B16A 4HP8A 3GVHA 2ZL0A 3TSCA 2EJVA 4GAEA 5H81A 2P5UA 4W9NC 4ZHSA 5TLSA 3QVXA 2YQ5A 4FSHA 4U18A 1E3EA 5KVQA 5BNFA 3DBHB 1R4NB 2Q49A 3ROQA 4YQYA 2ZL4A 3OJEA 3L9WA 4AJOA 1M75A 1QLHA 1O0SA 2PFGA 4HXYA 2VSSE 4WJZA 3U09A 1Q7CA 4JCOA 4DMLA 3SLKA 2IXBA 1SB8A 3R1IA 1BXGB 1PJLA 1P33A 1QSGA 1VKOA 3IBBA 4DYVA 2W8ZA 2D8AA 1GFSA 4CV1A 3VIVA 1KEUA 3ON5A 1D7OA 2Y1EA 3E9MA 5DNAA 3JQ9C 1XYGA 4L8KA 3UVEA 2CUKA 4NEKA 4GKVA 3WB9A 2PGLA 2YFHA 1DFIA 3LF1A 2HK9A 2EKLA 2D5AA 3HN7A 4YAKA 3FPLA 2Y1DA 4MDHA 4BO3A 4KUEA 4H15A 8ADHA 3CEAA 2C0CA 2EGGA 1IL0A 1K6IA 2FW2A 3UKOA 1GPJA 4LK3A 4WLVA 1NFFA 3QLJA 4IDCA 4N7RA 1DIGA 4OGWA 4ZRNA 1ZJZA 3ZWYA 5DULA 5L45A 4MVJP 2QYSA 4NR0A 2GNAA 5L3ZA 1I3LA 2XXJA 1C3VA 4YT4A 5AQ1A 1GYPA 1HDGO 1NXQA 1R16A 2C5AA 4GLLA 1ZSYA 4NJOA 3VVBA 1U3WA 2VOJA 4X54A 2ZTVA 3PHGA 1T4DA 3H81A 1U5CA 4QQRA 2ZKLA 2ZJ0A 2O4UX 1D3AA 1OAAA 4BQPA 1YBMA 1GD1O 3TOZA 1Y7OA 4WCFB 2FY8A 3QXZA 3OF2A 3U4CA 2P91A 2YY7A 2Z5LA 3WGOA 5G0UA 3A28A 2HK7A 5HWSA 1IOLA 1IUKA 1FJHA 3ZWWA 5DZKA 5INFA 4M55A 2YDXA 2B4QA 2X0IA 2VSUF 4FC7A 2HMWA 5CHEA 4R1UA 3TV5A 3UOGA 4FW8A 3BMNA 4HKTA 4XIJA 1P9LA 3ASVA 3QYRA 5BT9A 2QZ9A 1VC2A 3HJAA 3WIEA 1GU7A 1U3UA 3DZIA 1VI2A 1LC3A 4QFCA 1K89A 1P1IA 3GUYA 4B4VA 2ZTLA 3KTIA 5G1QA 2GPTA 3TFOA 3W4KA 2VN8A 2O7SA 4B3JA 4PFJA 1R0LA 4YT5A 3VDRA 1PL6A 2YHIA 2BMAA 3ENNA 3M1AA 1PR9A 3IUPA 3GZNB 1DUBA 3H2SA 3OSUA 2PPYA 1L7DA 1ZUD1 3DB2A 2BI8A 4M87A 3FF6A 3AOGA 1HL3A 5GMOA 3VPXA 3TRRA 2ZYGA 3ANNA 1DIAA 1MB4A 4TRJA 2PH3A 1JVBA 1N9GB 1KEVA 3KTDA 5K6AA 3FF4A 4II2A 4TZTA 4I9NA 4NHEA 4FD3A 1GQYA 2PG8A 5TNXA 1YL6A 3IP1A 1Z6ZA 4S1VA 4L74A 3NTOA 3JD3A 1GV0A 4R16A 2E48A 1ZK0A 3OETA 4BKUA 2ZQZA 3B70A 1LDBA 1PEDA 2GUGA 3L4SO 4GPD1 3BTVA 4F46A 4LGVA 3EUWA 5F3RA 1DCIA 2RHRA 5JE8A 1O95A 3BA1A 3MTGA 1H6BA 1AN9A 3GNTA 1PJBA 3DHEA 1FK8A 3UFXA 1YBVA 5L95A 2LDXA 1LLQA 4ND3A 4ND4A 1HZZA 1GR0A 1LNQA 1ZW1A 2Y67A 2PKQO 4AJ4A 4L0QA 4KDEA 3WYBA 2G5CA 3CMMA 1PZFA 4OXKA 1ADFA 3KB6A 1NHWA 3WLEA 3W8DA 5BSEA 3DBHA 4BS9A 1LLUA 1R4NA 4D3FA 1J0XO 1GL3A 1MC5A 4OLQA 1JA9A 1PL8A 5AXBA 4JCQA 2C20A 4L8VA 3ONFA 3H02A 4R3NA 3X2FA 2CF5A 2C29D 1NP3A 1FDTA 1D1SA 1Q0HA 2EIHA 1TLTA 4DGSA 1D4FA 2B5WA 2EP5A 2Q2WA 3UW3A 2D4AA 4LK5A 2YV1A 4R54A 3PFWO 3PK0A 5A9RA 4DIOA 2P9GA 2JCVA 3ZWNA 2UZFA 4AL4A 1C1XA 1LSUA 1ML3A 1HE4A 1KOLA 3I47A 3UAGA 2X8LA 5U9CA 1ZXLA 1NWHA 4LSMA 3GHHA 4CM7A 4PG6A 3K2BA 2VZ8A 3F6YA 1I2CA 4FGWA 5HS6A 2CNBA 2VHYA 4CPDA 1A9YA 4LN1A 3WGGA 4Q3BA 2VOEA 3NX4A 3N74A 2I3AA 4I5EA 2J8ZA 3PZKA 4FJWD 4KNPA 2O3QA 1VSUA 4DIBA 3DZGA 2VYVD 1WAMA 4JWVA 5IDYA 4XCVA 3DAPA 2JD2A 3RSTA 1XSEA 5CFZA 4NI5A 4I9HA 4F47A 4RDIA 4EI2A 2VHXA 4L9RA 2GLXA 5GZ3A 3DO5A 1NQ5A 4Z6KA 4KOAA 1DPGA 4IZBA 3ZHXA 1I2ZA 3EZLA 1GUFA 1U8FO 1EF8A 1QXSA 3FNFA 1I01A 5JCJD 2CVZA 3V5NA 2JFHA 5L4LA 4PRKA 1XIVA 2CD9A 4RF4A 4UVIA 4BO0A 3K6JA 4LMPA 3RJ5A 1UAYA 1P31A 1NM5A 4WCFA 3U4HA 3VTFA 2C82A 1UYRA 1Z45A 1NVGA 2YW9A 2WDZA 3L6EA 4YEDA 3WBBA 1EMDA 3GMSA 4YJDA 4DWVA 1DC6A 1DRUA 1P1HA 4WLNA 4ELWA 4FN4A 3QY9A 3AFNA 1XA0A 1YB4A 3WNQA 5AXCA 4CQMB 1WDMA 3AM3A 3RU7A 4EZBA 3AI2A 2WD7A 3B1FA 3E6AA 3E5RA 3GA0A 4J16A 1KVTA 5TT0A 3PWKA 3RKUA 1JAXA 2EKPA 1YG8A 1V3VA 1ZK4A 4R1TA 4ZQBA 5DKPA 5G0WA 4DQXA 3FWZA 4NBVA 2PR2A 3BMOB 4TKLA 2FP4A 1HE2A 4ZDCA 4RVDA 3ST9A 4EDFA 4BV8A 4GQAA 2OP1A 5BSFA 4KUHA 4IS3A 1D1TA 4IIUA 3LLVA 3AOEC 2VWHA 3LT1A 3GZNA 3JQGB 4FNDA 1PJ4A 3ETEA 2OHXA 4MKXA 4RYFH 2Q2VA 3RC7A 3FTNA 4XQ9A 4JVTA 1DAOA 4Y6RA 3I9LA 4W99A 1LBEA 3GFGA 4LCEA 4E5NA 4JROA 2A35A 1N9GA 3L6OO 4W82A 1O94A 2FR1A 3RC9A 1GUYA 3TNLA 5KJFA 3L07A 5DT9A 3ZV4A 2P2SA 5ICSA 3DFZA 2B83A 5KTKA 1UDAA 4H16A 2CMDA 1LRJA 2JFGA 1YWGO 2FPGA 1NASA 3WGZA 3C1AA 4JLWA 4WLEA 2X5KO 1MX3A 4BNUA 1XNVA 3DMYA 3F1LA 3H9EO 5FFFA 3TVWA 2GSDA 4LVUA 4J4BA 5JC8A 1ADBA 1H2BA 1CWUA 4ELSA 3EC7A 2OMEA 3TDCA 4WLFA 1ZEJA 4OAQA 4EEXA 1WDKA 4II3A 4FB8A 2QQ5A 2RCYA 5JCXA 4N54A 3MJSA 1V6AA 3CE6A 1A27A 4B7CA 4INAA 1YONA 2QX7A 2A9FA 2R2GA 3LSYA 4FGSA 4D45A 1UZMA 1E7WA 2WYVA 3PP8A 3ZV6A 2WYWA 1BG6A 1M66A 5ITWA 2HK8A 2IRWA 3GF4A 4EGFA 4XDYA 5BSHA 4L4RA 5K0ZA 2UUPA 1EUCA 1SBYA 3E5MA 4E2XA 3IKVA 5KJEA 2EXXA 3GN2A 4E3ZA 5G0VA 1SNYA 3D64A 1ZZEA 3G1TA 3PLRA 2VSSF 3WX0A 1K32A 3AM5A 1N7GA 1WVGA 3EVNA 3TL2A 2EJWA 4CLRB 5CDUA 4JYJA 3LAOA 1N1GA 5JC1A 1HF3A 1WZ8A 1YO6A 1UXIA 3BMCB 3CIFA 3GOHA 4CMHA 4D44A 3LYLA 3W4JA 3ITDA 3H3FA 2J3HA 4Q0GA 2ZB4A 3IMFA 3DC2A 4J0EA 4ALKA 5CDGA 1UAGA 1YL5A 5CDYA 3K8XA 2O3UA 4CL8A 1SCUA 3C1TA 3PGXA 5DBIA 3WMXA 2EP7A 1Q51A 4FOSA 1X14A 1PR3A 4QXMA 3M2TA 3ZU5A 2EW2A 2PKRA 5FWNA 4FJ1A 2H9IA 3BHJA 2R6JA 1GZ4A 2Q3EA 3PFFA 1PGNA 2A81A 2Y0DA 2P68A 5TIIA 3A06A 3M1LA 4MVJE 4EUEA 1VL6A 1KS9A 2DUWA 1KVUA 3O26A 5AYVA 1N8KA 3HWRA 3Q0GA 3LF2A 3JD4A 3X2EA 4BNJA 3ETGA 2J3JA 4DPMA 4QIIA 5KJ1A 1G0OA 1DAPA 1LQTA 2A94A 3TN7A 2EW8A 3KVOA 5JW6A 1N6DA 2YDYA 4ZU2A 4XQCA 4U0GH 2ZL3A 3W6ZA 2J5GA 3WQSB 5CEFA 3ZWAA 4A2CA 5AXAA 2NVWA 2W3PA 1E77A 4CQMA 3JQAB 2IODA 3K92A 1K6JA 5A4DA 4KTVE 4XEHA 2HKIA 4HNHA 4M1QA 2X0RA 2Y68A 3O03A 1DFGA 3AUUA 2BFOA 5ENDA 1UZLA 4RVUA 2W2LA 5A05A 3BMOA 5T8KC 5A04A 4HUJA 2BRUA 4R5HA 1RJWA 3HDQA 2OBYA 1GZ3A 4FN7A 2P4HX 1UH5A 3DORA 3FNEA 2DFDA 3HUDA 3JQGA 4R68A 3ZHZA 4EW6A 1TI7A 5FI5A 3P85A 5EN4A 1XDWA 3QKAA 3PE8A 1WZEA 1H0KA 4E13A 1ZNQO 3GFBA 1XU7A 2DVMA 2AE2A 1X7DA 3JQDA 5G0SA 2YV2A 4EITA 3N58A 4OOFA 3RUAA 2Y0CA 4IXWA 1DBVO 3H5RA 2FZWA 3DXFA 3GQVA 3Q3CA 4BHTA 3D3EA 5IN5A 3KEOA 4RZIA 2YHUA 4E5YA 5BNIA 1U1IA 1UZNA 4PZCA 3WGIA 4DPKA 5DUFA 3VKVA 4UVHA 1EF9A 1DIRA 4GMGA 5DUCA 4EMMA 4XKJA 1KEWA 1YVEI 3UUWA 4P22A 4ALIA 3MJ4A 5C3MA 1RPNA 1NAHA 1QYWA 3KTJA 4LRSB 1XGKA 2I76A 4YJFB 1N1EA 3VKUA 3VZQA 5I9NA 1C0LA 1EY3A 1DHRA 1DIHA 3ZNOA 2VT3A 4J0FA 3WFIA 4YACA 1VRGA 1CIVA 2AHRA 4AJIA 3E82A 1Y1PA 2DKNA 3DHNA 4MP8A 3JQ6A 3LU1A 4TVOA 1EDZA 1K3TA 4NZ9A 1GAEO 4LW8A 4JN6B 1YDWA 1O8CA 2B4RO 3HINA 1T26A 5CP8A 3JTMA 3LQFA 1J49A 3KQFA 5L4SA 2OXIA 4ILKA 2POQX 3L4BA 1ZVMA 3NV9A 4YYZA 3EY4A 1K0UA 1CQIA 1DC4A 1E1MA 1YQDA 2J6IA 1MXHA 4OKIA 1I3MA 1PJ2A 5IAAA 4FJ2A 1PGPA 4JOTA 2JD0A 2Q45A 4TRRA 4YRDA 4JSBA 1ARZA 5CEEA 2F6IA 1MA0A 3HN2A 3TJRA 2DPHA 5FYDA 1MJ3A 3MZ0A 4Q3NA 5A5FA 3GGOA 4XX0A 2PZMA 2GGSA 3ZWVA 1UIYA 3TOXA 1WZIA 3U9TB 3SX2A 3BMCA 3QA9A 4FFPA 3EYWA 5IF3A 4TSKA 1CETA 3JQBC 3KTKA 1HDXA 1ULUA 1DLIA 1IPFA 1IZ9A 5IKLB 1Q1NA 2JJYA 5JAIA 1QP8A 3NJ8A 1D8AA 1JKIA 2I65A 5DOZA 3WGQA 5U1PA 3ZHBA 4ZD6A 2DBVO 1CF2O 3KV3O 4B4OA 3AUAA 3ISAA 1LRLA 4JCSA 2J5II 1TT5B 3KSZO 1T1SA 4GSKA 1O89A 2I5PO 3JV7A 4I8XA 5ITVA 3GVIA 4K26A 3H9QA 3RUHA 3M6IA 4RYFA 1PZEA 2CY0A 4BB6A 4YAGA 1DEHA 3IOYA 2Q4EA 3GY0A 3PIIA 3JYQA 3QJ5A 3QWIA 4IUYA 3U9LA 3U9RB 3JU1A 3DZBA 4MOUA 4WCZA 1XQ6A 4KQXA 2GN8A 1BMDA 3WYCA 5G1SA 3Q2KA 4QFEA 3A1NA 3PYXA 4BMSA 5JXWA 1ISMA 4AJPA 2O4CA 2GASA 1T1RA 4E12A 2YFQA 5K6AC 2B5VA 2V7PA 5LDHA 4CMKA 3TQHA 4C4OA 3EK2A 3JQAA 3KYDB 4OL9A 4Y9DA 3S2IA 2G82A 4XB2A 4DREA 3QWDA 3WGYA 1FF9A 1UXJA 1FC9A 1LJ8A 2HLPA 2FSVA 4U0KA 3B1KA 1PIXA 2G17A 4FN8A 1DC5A 3O8QB 4LVCA 1NHGA 3AW9A 4YA6A 2AMFA 3UN1A 1M76A 3LC7O 4CM9A 3T8AA 1B7GO 1QMGA 5DP1A 1PIWA 1ZJYA 4P4NA 4XR4A 3LT0A 3BAZA 2A92A 3H8VA 4K28A 2E49A 2EERA 3OFSA 4K6FA 4CR8A 5JDCA 4XWYA 5F1OA 4YJHB 1A9ZA 2NNLD 3AU8A 4RVFA 1HLDA 1PSDA 3CPSA 4EUFA 5JFOA 1ONNA 1PS8A 1YH3A 1NYTA 3PWZA 4IZIA 1YOVB 2OUIA 5T5QA 2QIOA 3RBZA 2BF7A 1UR5A 4WLUA 5A1TA 5A3JA 4WZ8B 3TVUA 1R15A 2W2KB 4I5DA 3M2PA 4RJTA 4YPOA 2EV9A 4PLHA 4R9RA 2PTGA 3BHMA 4D43A 1RYEA 2IZ1A 4UUNA 3P2YA 4B4UA 2J5IB 2VCYA 3AWDA 3HFSA 4W7HA 1OBFO 1XHLA 1G1AA 1O9BA 3RFVA 3P2LA 4NK4A 1T2FA 2GZ1A 4U19A 4FFOA 1IULA 1QYDA 3WTBA 1NPDA 2W2LD 4DC1A 4BKRA 2DUUA 4BIIA 4J7UA 5C7IO 2NADA 2FHSA 3OH8A 4LCJA 3GRKA 4WOJA 4EJ0A 4OQZA 1A71A 1NFQA 1SC6A 4HFJA 4WECA 4B7XA 3NKLA 3WGHA 4HBGA 1ISGA 1V0JA 4FCCA 4GL4A 5KVVA 1FMCA 3R6DA 5KJCA 3HE2A 4ZQHA 3ROMA 3V1UA 1BDBA 5BR7A 4NFHA 1YS4A 4BNFA 1LDNA 5I9MA 4YR9A 1C0IA 1P0CA 5DF1A 1ENPA 1I33A 2O23A 1Q0QA 3DAFA 1E3JA 3PPIA 1PJSA 3O38A 1EUZA 4IMPA 4U6QA 4BO9A 3DONA 4D79A 2C8TA 5L4NA 1NR7A 4KTTE 3AI3A 2J5RA 4H3VA 4EEZA 2G76A 1XNYA 2DEOA 2HJRA 5CG2A 3SLLA 5MGBA 3HHPA 4I5GA 4JCRA 1HDYA 4U0GA 2B36A 4GX2A 1JKJA 3RUDA 4TRMA 3JD1A 1NVMB 3EDMA 4WCFC 1W8DA 1QR6A 2CZCA 4CMIB 4JJFA 4XZ3A 1GEGA 1HZJA 4FPXA 1Y8QB 3DMTA 2D5CA 2HAEA 2HMSA 3SVTA 1AUPA 3H7AA 3I6IA 2X5OA 1GTMA 3TZ3A 2D3TA 4BNWA 4PG7A 1H6CA 1YDEA 3I23A 4KUGA 4BQRA 4E2YA 5IG2A 2NVUB 1E1NA 2YZ7A 3SJUA 1TT5A 4GWGA 3V5IA 4GSLA 4WUVA 3INTA 3S2GA 4WEQA 4H7PA 2I99A 4M49A 3E8XA 3K31A 5CTCA 3KETA 1E6WA 1JXZA 1K6XA 5CDSA 4P38A 1CEQA 2ZCVA 3VAZA 4GX0A 3PQFA 2JAPA 1PGOA 2BI7A 1W2XA 1KVSA 2D59A 3TZKA 2CDBA 3GGPA 3KRTA 3Q6IA 1H93A 2GN6A 4IXTA 4ZU3A 3T7EA 2CF6A 1JDJA 5TQVA 1X1TA 3OQ6A 2DTXA 4MVJF 1G0NA 4RF3A 5C7OO 2RH8A 1T4BA 2FMUA 2IZ0A 3GEMA 4YAJA 2Q35A 5KKAA 3KYDA 3OBBA 1RM0A 2ZB3A 1WP4A 4FC6A 3RUFA 2PY6A 5JBXA 3OQ1A 2YUTA 4R51A 2GN9A 1P1JA 2NTJA 5KCZA 4E2ZA 3U49A 3PDUA 3WR5A 3W8EA 2HO5A 4FZWA 2ZATA 4TWRA 2PBPA 3IKTA 3OEYA 1DC3A 3I52A 2ZB8A 4CMEA 5DCWA 3WJ7A 2HCTA 4RQTA 1AGNA 4XGNA 1KERA 3MOGA 4DIFA 1TEHA 2H63A 2GDZA 5B4TA 3ZU2A 3BF0A 4J9VA 1X13A 1EVYA 5I7SA 2AQHA 3FCOA 2I67A 3JYNA 3RCBA 1ZKMA 2C5EA 3HDJA 3UXYA 5JBWA 1TT7A 2NU7A 4O59O 3ZW8A 4R01A 4YJHA 4NH4A 2VUSA 1ZO8A 3M6NA 2Y1OA 4ALLA 2FR8A 1F12A 2BELA 2GTRA 2ZTUA 1SOWA 4XIYA 1YOVA 2GZ2A 1T2DA 3RKRA 4BOYA 1PJQA 4IQGA 3JD2A 3VPFA 4TVBA 3F1KA 1UYTA 1I3NA 3IL2A 4A27A 2GO1A 4RF2A 1WPQA 4BNKA 3OIDA 4D3SA 2J5IA 2X5JO 4RDHA 4ZRMA 4IZDA 2J5KA 4R5MA 1OC2A 4HV4A 3HNPA 4Y67A 5JO9A 4RVHA 1HZDA 1Q52A 5HS4A 5ICMA 4IDFA 4M86A 1HNOA 3GMAA 3RFXA 4J3FA 2JHGA 1DLJA 4MVJD 2Q2XA 3F4LA 2WJPA 4OSOA 1SZJG 2ET6A 3ZWOA 4UEJA 2VRCA 3C7AA 5KJ6A 1JKFA 4J4TA 4C7JA 4Z0PA 1H6DA 1C1DB 4YJGB 1P77A 5IDQA 3F9IA 5A03A 1SEPA 2E37A 3PI7A 3ZU3A 1TG6A 3NT5A 3S1LA 2OZPA 3IJPA 1ONOA 1QYVA 5TS3A 5L7WA 2Y1CA 6ADHA 1BXGA 3VZPA 1B3RA 3QP9A 3WSWA 1VJ1A 2DC1A 4P8RA 3V2UA 4E4YA 1I2BA 1VJTA 1N92A 1YXMA 2Q4BA 3VH2A 4CUKA 2VUUA 1KVRA 2YJZA 4IQ8A 5LC1A 5THQA 1AHIA 1PGQA 2FPPA 3KBOA 5HRUA 1NBOA 1HNUA 2FSSA 2ZQRA 3IIEA 4EJ6A 2Y99A 1PX0A 3L0DA 3A9WA 3OECA 4ZQGA 4RL6A 4GH5A 4CMIA 2DUBA 3G3EA 1JAYA 2X58A 1EDOA 4OXYA 1LTHR 4PLWA 1Y8QA 2W4QA 3OICA 1RWBA 1S6YA 3DZJA 3OIFA 1EQ2A 4TZKA 3BZUA 5ER9A 4GM2A 1KETA 1I0ZA 1K39A 1E3SA 4OHUA 3Q2IA 4ZICA 5IDWA 1UXHA 4QO8A 2Y0EA 4IDBA 5JS6A 3RRVA 2EGHA 1EEHA 4UVGA 5A9TA 4K9DA 3C7DB 3PJFA 2WEKA 1L1FA 3TT7A 4N5NA 4ASIA 3FRJA 5HBRA 1I32A 3I5MA 1W6UA 3HP0A 1Z73A 2UV8A 5ES3A 2NTVA 3EHEA 3GGGA 5DTPA 1IYZA 3VTZA 2W98A 1N2SA 5FUSA 4CMBA 2VTEA 4R1NA 2X86A 3L77A 5KDRB 1ZMTA 5KVCA 4RPJA 4HFNA 4RO0A 4CM1A 4D7AA 1LRKA 5ILOA 5E0NX 1E7QA 2HUNA 4FFLA 4PN3A 5JSFA 4BKPA 3I9MA 2BGLA 4JP2A 3RU9A 3MTJA 2JCXA 4I4ZA 3S8MA 1E1LA 2UUOA 2VNAA 2H6EA 1O5IA 2XF8A 3H9GA 4M89A 1E92A 3ZNQA 3TT6A 3VDQA 3F47A 1DO8A 4NNJA 3G64A 2DLDA 1VM6A 3T4EA 2IEBA 4GMFA 4MIYA 4TROA 4BNIA 3OJLA 3NRCA 4W7IA 2HMVA 4J7XA 1WW8A 3JQ9A 4F45A 2O48X 2CBYA 4CLEA 1EBFA 3V8BA 1VL8A 2AQ8A 3V2GA 2JAHA 1PTJA 1PWZA 2GZ3A 1HDZA 2VYNA 4YWJA 3S2FA 2HW5A 3ICPA 2I6TA 6LDHA 7MDHA 4OSPA 2ZQQA 4BKOA 1KC3A 4QECA 3VH3A 2BGKA 3B6ZA 4BO1A 4KDFA 1A72A 2NV6A 2JD1A 4RCVA 3AY6A 4U1AA 2BKAA 4UAGA 5G0TA 3PIDA 4KWBA 3I3OA 1SOVA 4DL9A 2WMDA 2X1HA 5JPIA 3GEDA 2A7KA 4MVJM 4I9UA 4N5MA 4K1LA 1I5RA 4RPKA 3IB9A 3WQRA 3WNVA 2Q1TA 2HSDA 2X22A 5H83A 2X9VA 5JO0A 3H0UA 4YDRA 4PG8A 4Q9NA 2VWPA 1PWXA 4E5MA 3L3SA 1BW9B 3DAGA 4TKMA 4OO3A 4PCVA 4UUPA 4UVEA 3D4OA 3GDOA 3F5SA 1YJQA 2VWGA 5A3VA 3ZI0A 4F6CA 2FR0A 3W1VA 3WBFA 4EBFA 3LDHA 3KUXA 3PHJA 2YV3A 4HNKA 2DQ4A 1CERA 2NUAA 1Z74A 1I3KA 2PZKA 1EFKA 3NAQA 1YBAA 4DC0A 3U62A 4XGKA 4YJGA 3CINA 1NTOA 1XCBA 4M8SA 2AQKA 2O3TA 1HSOA 3C24A 3WGTA 1PZGA 1AXGA 1W73A 2CVQA 5DU4A 4Y6PA 1YKFA 2F9YB 1SZOA 1ISIA 2WE7A 4ONEA 5DP2A 2E82A 4CUZA 3MFMA 3GVPA 1OD2A 1WNTA 5L9AA 3ZDFA 5CEJA 3VC7A 4CL3A 3ZV5A 4EUHA 4FDAA 1YB5A 2X9NA 3VH4A 4R4JA 4G2RA 3L6DA 1QV7A 4PVDA 1N6FA 3K50A 4KMSA 3TWOA 3TF5A 3EW7A 2NQ8A 3MYBA 5F5LA 4J4HA 4FFMA 5COQA 5DOVA 5I7VA 4QUKA 5C5IA 2GN4A 4Q39A 4RZHA 3DBRB 3BMQB 2FWMX 1ZH8A 3SXPA 3SEFA 2RH4A 3GPIA 4CM3A 1UP4A 4MP6A 4IDGA 4DRYA 4WK6A 3PLNA 3BEZA 4IQ0A 4QTZA 2EG9A 4KP7A 4NBRA 2XPCA 3AUTA 4CR7A 4RCNA 3ICCA 4I08A 3GMDA 1W0CA 1HE3A 4DPLA 4R1SA 4NG5A 1ONPA 1J6UA 2DTEA 4BO6A 2NU8A 4XYLA 1E7YA 1SAYA 1K5HA 4NU5A 5DTWA 3DZHA 4RVSA 4BO7A 2P4QA 3PZBA 4TRNA 5AXDA 5KDRA 5GZ1A 3WOHA 4CM5A 4D3DA 1GYRA 1HDOA 1X1EA 2GERA 4LRTB 4E2WA 4K6CA 3JYPA 3FHLA 1EE2A 1ULSA 3Q0EA 1IB6A 4XD2A 2ILTA 2J5QA 4L4SA 3UH1A 2IZZA 4U7WA 4DA9A 1QRRA 2ZL2A 2C2YA 3UF0A 5IXYA 1P0FA 2ZK7A 4DBZA 3C7CB 2H1SA 1JVSA 1Q7BA 4BGVA 4DMMA 1H2HA 1W4ZA 2VSUE 1QYCA 3K2EA 4NBWA 4IZCA 2O7QA 1GQQA 2Y1FA 3AM4A 3QSGA 1B8VA 4XJSA 3HADA 4G5HA 3ONEA 4A03A 4NBTA 1V3UA 2NU9A 3ASUA 4GLOA 4E31A 5BQFA 4JCTA 4NPCA 3PZRA 3RD5A 1S7CA 4A0SA 1PJHA 1E1KA 4RV9A 1GCOA 3WQQA 2X0JA 4YCAA 4D0RA 4MVJG 3RUCA 1NWCA 3UHAA 2EEZA 1E5LA 3G1UA 4BNGA 3NYWA 1VL0A 1LLCA 1RM3A 4IY1A 1XLTA 3WG9A 1EVJA 3JYOA 4BNZA 1Y81A 4D42A 2Z1NA 2VQ3A 4A73A 1ZFNA 5LCXA 3VZSA 1UYVA 3OP4A 3TLFA 1JLLA 2DBRA 4IJVA 3I9JA 4XB1A 4C7KA 2QQ3A 1GPDG 3RASA 2NU6A 1ADCA 2QYTA 5IXSA 3H9UA 3OHSX 5GZ6A 4JJIA 1U9JA 4N18A 3V5EA 3FN4A 3ZW9A 4E5KA 5IZ4A 3QRWA 5JDIA 1ZSVA 2C7VA 5FIFA 3NDJA 1UXGA 3HLN1 5T57A 3FNHA 2NM0A 3LK7A 1VRWA 3D5TA 5JY6A 4PZEA 3I9KA 5JYDA 5F21A 1NNUA 3FWNA 1XWFA 3JQEA 1P1RA 2HJSA 2QHXA 3CSDA 3F5QA 1ZK1A 4G81A 5TT1A 4YVFA 4LISA 5ILGA 5T64A 3H0JA 3GG2A 4Z0HO 3PGQA 2NTNA 2PZLA 3DMTC 4IM7A 4PLZA 5HA5A 4ALJA 2V6FA 5AOVA 3DOCA 1ID1A 5H82A 4K29A 3KTGA 2EHDA 4ALMA 1NAIA 2DBQA 1Z75A 4AJLA 1HE5A 3ADPA 1E0DA 3UGKA 1ISFA 3G49A 2F9YA 1HT0A 4CMJA 4HX5A 3D3WB 5G1RA 2X4GA 5J23A 2X9GA 1FC6A 5DU8A 4EYEA 4AJNA 4MI2A 5BSGA 3KSDO 4WCDA 3AOEA 3OA0A 4JGBA 3T3WA 1ON3A 2QRKA 4WYOB 3U9SB 3NTRA 4IJKA 4BNHA 2Q1SA 3H5AA 4CLRA 3BPPA 4BGUA 1U5AA 4BO8A 2GR9A 1KIFA 1FC7A 2Z95A 2QZZA 3S2EA 8LDHA 4Y98A 1EK6A 3PEFA 1HXHA 1F8FA 1ENYA 1R12A 3FR7A 1J7XA 3JQ7B 5EERA 2VRBA 1DXYA 3GVCA 3LZ6A 4CM4B 3BMQA 2G1UA 4OXNA 3AFMA 3E03A 3I1JA 2DT5A 4AJ2A 3ADOA 2Q1UA 4J9UE 5JMPA 2GYYA 5FF9A 1F06A 3BTSA 3OMLA 1AXEA 3VH1A 1MFPA 1GDHA 3JD0A 4J90A 1MUUA 4GHNA 1ZXBA 1IHXA 1ZEMA 3BTUA 1RJMA 1CJCA 1RYDA 4QEDA 4YQZA 1E3WB 2P5YA 4ND5A 3ZWBA 3ZHYA 4FZWC 1KC1A 2EF1A 5G4LA 4M54A 1R37A 2NACA 3ZWPA 4CMEC 3QVWA 3B1JA 4NIMA 1NQAO 4U6SA 2J3IA 3GG9A 4L4XA 4QIJA 3FNGA 2NSDA 3UCEA 4AJHA 1K2WA 4B3IA 4K2NA 1MG5A 3RAJA 1SB9A 4Z3DA 2O2YA 2RHCA 3PXXA 3IQDB 5KVSA 1BTOA 1ZCJA 2VWQA 3FI9A 3FD8A 4NJMB 2PD3A 4D0SA 1I36A 4HADA 3BIOA 2C54A 4PLYA 3Q0JA 3QW2A 5FEUA 1JWAB 5B12A 3DZKA 5KOIA 4OG1A 1KYQA 1ENZA 5JLAA 4O5OA 1A4UA 1JN0A 3DBVO 3EGOA 4ZDFA 1E7RA 3EAGA 4BNXA 2X0NA 4Z3KA 3PQDA 4IDAA 5KJPA 1P74A 3GNQA 3BYZA 1E6EA 3ST7A 1XX4A 2O2SA 3KZVA 2A4KA 5IJZA 1QLJA 3N6RB 4E32A 3DEYX 2DTDA 3CZRA 3LC2O 3H65A 4JYLA 3RJ9A 1BDMA 4W6ZA 4D46A 5T6BA 3GDGA 1IHYA 1DRVA 2BLLA 3IJRA 4J43A 3Q1TA 3DBLB 3IC5A 1OOEA 1HYEA 2LDBA 4RQUA 1Y7TA 5C7LO 3W6UA 5INIA 1DDOA 4B7UA 5A9SB 1ZK3A 5EQFA 4I5FA 3RWBA 1YB1A 1GEEA 3T88A 1CYDA 3AU9A 4J1NA 2VSUA 1U8XX 1B15A 3COSA 4BV9A 1ZMOA 1H5QA 3ULKA 2J5GD 3QVSA 4AICA 2VTDA 4ALNA 2IYOA 1XEAA 2YHIB 4CQMD 1WXDA 2F6QA 3EZYA 4J1SA 1YL7A 4BO4A 3FDUA 3OC7A 5L40A 3HSKA 1LDMA 4YRBA 3DOJA 3WYEA 1YGYA 1TXGA 4Z9YA 4YJFA 1QYXA 2JL1A 4YT8A 1X0UA 2R00A 3WMWA 1ZIDA 3QVTA 4CLOB 1ENOA 3OA2A 3TZHA 1T2CA 1M6HA 4N5LA 2OOSA 2IEXA 2ZCUA 1YQGA 5JNLA 1GUZA 4OJNA 1VE9A 1PU2A 2PNFA 3JSAA 4QFDA 4CMAA 3GDFA 1EK5A 1HDRA 2E6UX 3D0OA 4PG5A 4PLVA 4RLSA 4CQLB 3DQPA 1LSSA 3FR8A 4Q1IA 1GADO 1LA2A 1J5PA 4Q3EA 3KLPX 4BNTA 3Q7HA 4YLHA 1FXSA 4ZJUA 4ZGWA 4GI2A 2VYVA 1Q0LA 1JQBA 3ZWCA 3P7MA 4PVCA 4ZDBA 2WD8A 1GCUA 4FB5A 1NPTO 4O6VA 2BGMA 2EJ5A 1U7HA 1A5ZA 4XDZA 2D2IA 1B3BA 1Q7GA 3JQ7A 4YB8A 4W4TA 3G17A 4CM4A 2UDPA 5JCJA 4DLBA 5TSDA 3HZZA 1C1XB 3FBTA 3H4VA 3SBOA 2FBMA 4CUJA 1P3DA 4YT2A 1EVIA 2V6GA 1DFHA 2J3KA 9LDBA 5KWEA 3GHYA 4FQ8A 1E3WA 1BXKA 1QV6A 2V6MA 3EVTA 3GAFA 1X0XA 4URFA 2BFAA 3ZNPA 4CR6A 2BZRA 2BH9A 4GVXA 3ZV3A 1FDVA 1U3VA 2PD6A 3TZQA 4NBUA 3QREA 4NFSA 4CODB 3ZNNA 1T2EA 1XU9A 2I9PA 1TA4A 3BTOA 5DL1A 2BFMA 4HY3A 4XQEA 1HTBA 4IZHA 2UYYA 1HKUA 3A14A 4NJMA 1RM5A 1SMKA 3B20A 5I8ZA 4DBVO 1OI7A 2W90A 1PJ3A 4XR9A 4Z9XA 4HFRA 1DHTA 4MO2A 1U2GA 3VPHA 4OOEA 1VSVA 1OD4A 1OZAA 4NK5A 3SJ7A 4A5OA 1IZ0A 4U0JA 3STAA 3GLMA 3QVOA 3R3JA 2Q99A 4JK3A 5HM8A 4XQGA 3WLFA 4A26A 1ZK2A 3HRXA 1PJCA 3O8QA 3MJEA 2TMDA 3O9ZA 5A5EA 2HRZA 3OEWA 4HNGA 5MDHA 3NGLA 3PYMA 1DB3A 3JQBA 3S55A 5IZCA 3DHYA 1N7HA 1NR1A 1MV8A 3M6MA 2NLOA 1R66A 5TGDA 2NVBA 2AA3A 4MPDA 5COAA 2TMGA 4UUOA 4EMPA 4PZDA 4O0LA 4U5QA 3WWYA 3DBLA 4TMFA 2Q46A 2WD7B 3H2ZA 3C85A 4BMNA 3FBGA 1Z7EA 4PG4A 3VOSA 4RF5A 5A9SA 5INGA 4FNBA 5CDTA 3KYCB 4PLCA 3R9SA 3UICA 4BKQA 2Y05A 2NWQA 2ZJ1A 4KWIA 2W2KA 3U0BA 1KY4A 3GPDG 1MP0A 3KOUA 4L75A 4NQZA 3JQAD 5B37A 4AVYA 3C3XA 1HEUA 4OMRA 1TVEA 1SG4A 1A4IA 3T8BA 4DTIA 2Q1WA 3HE3A 1MLDA 1H9AA 2XXBA 3LT2A 4EMLA 4DQUA 4GWKA 5CG1A 4ND2A 1KBZA 3GZ4A 3NUGA 3GK3A 1TB4A 4UUMA 1OC4A 4ROSA 1YE3A 3RSHA 1NFRA 4CLOA 2FPIA 2F00A 4CM9D 1F8GA 1R0SA 3WG5A 1Q2XA 1LU9A 4BNYA 4BO5A 4IGEA 2WSBA 2C59A 1R4MB 1XG5A 1PS0A 1JW9B 3MWEB 1B0AA 2OL4A 2PLAA 2JFFA 4DLLA 4CQLA 4E0BA 3ZN2A 1T25A 3MEQA 3DTTA 4PLTA 4YTEA 3SC4A 3I6QA 3JQFA 4E33A 3NT2A 4RGBA 3CKYA 2AEMA 3SLGA 5E0SH 2ZQYA 2PK3A 3TZCA 3I4FA 3IAVA 3ROPA 4J1TA 4XRGA 4RLHA 3HFGA 5I9LA 1Y6JA 1EZ4A 1B2LA 1PGJA 1WWKA 3KO8A 4XYBA 2IXAA 1GYQA 9LDTA 3L9XA 3NEPX 3GC6A 2VZ9A 4HFMA 3I9OA 4FJ0A 4PLPA 4R69A 4ZDEA 3ITKA 4GKBA 3U4DA 4J2HA 3AY7A 2XOXA 4UVDA 4UEOA 3MJCA 5DBFA 4CMGA 1NZYB 3E48A 1GQ2A 1BSVA 2AG5A 2O3SA 2Q50A 5HTOA 1VKNA 2IDZA 1P1FA 4OQYA 2HMUA 1LLDA 5B4VA 4I42A 1ADGA 3DTYA 1NX6A 5ENVA 5TX7A 2AXQA 2NVUA 1HSZA 5CPBA 3QIVA 4PIVA 1ZSNA 4R9SA 2C7GA 2VHZA 3DJAA 5JAQA 4Z0MA 3IUSA 3INGA 4CJXA 4L76A 4MKRA 1NVTA 2SCUA 3E18A 1EE9A 3GNSA 3KYBA 4BNNA 4FBGA 4MP3A 1CQJA 3E1KA 2BHLA 3DWFA 4IIVA 4B8WA 2VX2A 4W9NA 5EMHA 3ZU4A 3OJFA 2VSSA 3WTCA 1I30A 3AI1A 3PEAA 5TJ9A 2OO5A 3EMKA 2VUTA 4IJUA 4MKZA 2IE0A 3U5TA 4QO7A 3D5QA 1OMOA 4O63O 3PQEA 4PLGA 3QWFA 3WS7A 2VHVA 4BL5A 4I52A 2OORA 3K96A 3OJ0A 3CMCO 1V9LA 4IDDA 4IS2A 3JQ8B 3CH6A 4KQWA 1C0PA 2FRDA 3P19A 3ZH2A 3BHIA 1LDYA 2HDHA 3WICA 2UAGA 1B26A 1BGVA 4E30A 3NTQA 2NQTA 3KTHA 3R9QA 1FDUA 3W8FA 3MOYA 1XELA 3FPCA 5T67A 2GCGA 2YQ4A 1E5QA 3A4VA 1U4SA 5JDIC 4YAEA 4R3WA 4CLHA 4NMHA 4KD6A 5KNLA 3N7UA 3PDJA 4ZN6A 3KEQA 3ETDA 3GEGA 1H6AA 3H6KA 1B8PA 3HDHA 2CE3A 3DOOA 3KM0A 1IPEA 3ANMA 4L6WA 1KVQA 3AK4A 5K9ZA 1BVRA 3PHIA 5F1PA 2Q2QA 2EKQA 1MC4A 2CSUA 1MG0A 5COBA 3NT4A 3KYCA 4AJJA 4BVAA 2QRJA 4QX6A 3L4BC 4AJKA 3QK8A 2ZB7A 3QMJA 2ZYAA 2NP9A 4OH1A 1O8UA 2OP0A 4CV0A 2A7SA 3PHHA 4BMVA 3P2OA 3ZWXA 2DFVA 5I7FA 1XO6A 1T2AA 5DCUA 1PQWA 5TF4A 4AJEA 4BGEA 4J91A 3WWZA 5BNTA 5KIAA 5F5NA 2QW8A 1E6UA 3OM9A 1PQPA 5I7EA 5LDGA 2ZYDA 4ND1A 4CMCA 5JYEA 3DDNA 2G0TA 4LMRA 1HYHA 1Z7BA 4D41A 1N5DA 2AEFA 4F6LA 1MXFA 3D7LA 3R3SA 5TRTA 4KWHA 4ZA2A 1U28A 1ISHA 1VPDA 3GH3A 1R4MA 2AG8A 1EVZA 3QWAA 3ZZNA 4FIZA 4JBIA 5JY1A 2PGDA 1C1DA 3ABIA 4BNMA 3PVZA 1V35A 2O50A 4MINA 3LC1O 2VT2A 3TFQA 3K73O 4HWKA 1BXZA 1DJNA 3ORFA 4XRRA 2Q34A 2UVDA 4YAIA 1TYFA 5L7YA 1LSJA 3UCXA 5EJ2A 3FTPA 2HU2A 3IP3A 4MVJH 3Q11A 5G2OA 1LDEA 2CDAA 4OIMA 3T7CA 5C37A 3K30A 1PS9A 1P44A 3O4RA 4XYEA 5THKA 2D0IA 4L73A 1DIBA 4Z9FA 2FZSA 1U3TA 3RC1A 1HRDA 4XYGA 3RUEA 3P5SA 1JTVA 1F14A 4IBOA 4YBZA 2E4AA 1JWBB 1A7KA 1YJ8A 3Q9NA 4P4LA 1NZYA 5CTBA 1XKQA 1NPYA 1B8UA 1A7AA 2HMTA 4MVJI 4Q3CA 3ZCXA 5JMWA 3T4XA 5EIOA 2J5SA 2WM3A 1GZ6A 4DXHA 4IMRA 3TL3A 3MCVA 3U4IA 3RVDA 2VRCD 1Y8RB 1F0YA 3GKBA 2V65A 3GLQA 3PRJA 4XYMA 4CM8B 4NNQA 1RM4A 2PA3A 1WMBA 2Y66A 1ON9A 4TQGA 1FDWA 1ORRA 3TDKA 1LSOA 1O6ZA 1R0KA 3K5PA 3PGJA 3MJVA 4WPGA 3QXIA 4ZDDA 1H9BA 3V1TC 3VZRA 4MOWA 1R6DA 1HWYA 3GT0A 5IDXA 4Z0TA 1UDBA 7ADHA 3H5NA 2PWZA 2X6TA 2RAFA 1GY8A 3HB5X 4OM8A 4PRLA 1UDCA 4KZPA 3MOIA 2Y1GA 1KY5A 3OIGA 5JDCC 3RC2A 2JHFA 3RFTA 3RI3A 4U0HA 4DUPA 3DFUA 5U4QA 4E21A 3GR6A 1P1KA 3H3JA 3QHAA 3E9QA 4RVGA 3R9TA 5DCYA 4BB5A 4BGIA 1MFZA 5IFLA 4OMUA 3NJ4A 3JQ8A 2VHWA 2VSUC 3D4NA 1MGOA 3WFJA 1BRMA 1X15A 1HLPA 4J7CA 4U8GA 4A10A 3IDSA 4DQVA 1U7TA 3UCFA 4CV2A 4F3YA 3LT4A 1G6KA 4G65A 2QG4A 3GAZA 4NFYA 4J49A 2DU8A 1E3IA 1P45A 3AUSA 5GY7A 2ZTMA 4K3WA 4RPHA 4BUCA 4UREA 3KLMX 4Q3DA 3R0IA 2IEDA 2R00C 3WJAA 4B4WA 3PHLA 4XJTA 4Y8VA 4ID9A 3KSUA 3LLSA 2AE1A 3VHRA 4YXFA 3I9NA 2GF2A 1BHSA 5E0SA 3PJGA 2P9CA
chains in the Genus database with same CATH superfamily
4TLMB 1XCGB 3FY4A 3HB4X 1DSSG 3ODGA 4KFCA 2FUCA 4CETA 3V6MA 1CP2A 2NUTB 4IOKA 4WESB 3W4IA 2EGUA 1KZ6A 1WUJS 2VK8A 2C42A 2RB4A 3EBPA 4QT0A 4XIIA 1U8UA 1TZ2A 4A5SA 1CUIA 1L1RA 5JHHB 3TRIA 4EA7A 1TYCA 4WN9A 1FFAA 1J4AA 2AWNA 4XH9B 3U7FB 3U0VA 1V8BA 1MIOA 4COKA 1E3LA 2ETVA 1E61A 1BW9A 2ZOSA 3GO4A 3PE3A 4HJXA 2XRZA 5DHSA 2EWMA 1S7GA 4RPGA 4OP1A 1Z82A 2CDNA 3Q7IA 3BWDD 3LC0A 2C07A 1L4GA 1ZBQA 3L0CA 3VR6A 2CVOA 4KXNA 4F4IA 5KKCA 4I1IA 1JQ5A 1KI3A 1AD2A 1T0JB 3CXRA 4P3XA 2LWIA 4INJA 5BWLA 1A76A 3AXSA 3PFBA 4MIOA 2H8KA 3K4QA 3AV3A 2PUBA 1UKCA 3PF9A 4G2NA 1AKWA 3NV7A 3PDCA 1GP2A 4C4PA 1XCPA 4QQFA 2OZVA 1K5PA 5DZKH 4Q19A 4KE7A 1KEPA 2VTBA 1EJBA 2BD0A 1ZZGA 1IEWA 4NF2A 4BO2A 4R0MA 1WHSA 1UBOS 2XYVA 1LBSA 5SY9A 1OGYA 3ZK7A 1QTRA 3GF7A 1N5MA 3ONVA 3EGVA 5JSUA 3AHGA 3TUIC 4HEA6 3SQXA 2XWSA 4JSTA 1Z5ZA 1Y4DE 3NBQA 4ITUA 1ZA1A 2LR0A 1GGJA 1E1QD 2WUWE 3C8MA 3AKEA 4IPTA 5I8WA 1SIUA 2P6MA 1ODJA 2OHIA 1E2JA 3LVFO 4QGHA 1G6HA 3I6YA 5TQ2A 5JBIA 3I37X 1EFLA 3H75A 3KOYA 2JCYA 5IUKC 4AJ1A 4BLUA 2RGGA 5K0GA 2FWJA 4ZQEA 3ENKA 2NYRA 1IM5A 2QXUA 3A0RB 1IRIA 3I12A 5EWMA 3UJ9A 2X14A 2RE8A 3B3AA 5E6UA 3MJTA 3G7UA 3D1LA 1JI3A 3Q98A 3PI6A 1FCFA 1Y3AA 5I4CA 5DM70 2YOFA 3JWHA 2VUHB 4XVCA 4BNLA 4CKZA 4LVNA 3KTAB 4FFNA 3MMNA 5EWLA 4FWTA 3LVRE 4ZMRA 1USVA 4YRSA 3OZEA 2DT8A 3NOVA 4G41A 3ZIUA 4F5WA 4JXKA 2OCIA 4XUCA 1ZJ4A 2V8OA 2ODWA 4FMCF 3Q15C 4RTLA 3O7MA 1JJFA 1T5IA 1M6WA 4MYUA 2IWHA 3SIWA 4OJKA 4ZVVA 3VPSA 2ORWA 4UFPA 4X90A 1BMFA 1SOUA 3QQPA 4C6TA 2XV1A 2AFVA 3ZDYB 5KYYA 3CIOA 3LV8A 5HFAA 2E5LB 4Q82A 3UUEA 4I4CA 1HEIA 3WB2A 3UIEA 3M5PA 3OPXA 3I1YA 5G3ZA 1ZN7A 4Y6QA 1NJ1A 2OB1A 4A6DA 2R1UA 3EGDB 1XLWA 1LQ2A 2XAAA 5EESA 1Y3CE 2ZIFA 4UULA 3CLUC 5JUWA 1XQYA 2FN7A 4B40A 1N6EA 3V1YA 1UFVA 1JXMA 4XWTA 3R3YA 3HKCB 3L8ZA 4OA8A 5J5AA 1X70A 4HAZA 4I55A 5EINA 2DM6A 2BV3A 1DEAA 3O3MB 4OLHA 1QKIA 3T95A 2FZEA 4AW9A 3NJDA 4QJ3A 1N3IA 3HH8A 1NQWA 4FEAA 1ODFA 1R00A 3IAHA 3U3XA 2IHBA 2WYUA 3I0MA 1Y4UA 3JAWA 1OB5A 3SWXA 3GLMA 3ETLA 3GN1A 3P0EA 1VCIA 1O03A 1PJTA 2YMQA 1T3LA 3HXLA 4LXGA 4YREA 3VGPA 3TDMA 3M6WA 4OYRA 4ESOA 4EL0A 4S05A 2RBEA 4IVPA 4DDUA 5BQXA 4KDRA 5FHQA 5AW3A 2AI1A 5C90A 1AK1A 3HKDA 3T06B 3IUBA 1K3FA 1PR0A 1N2EA 1MQAA 2JHCA 4O1MA 9MHTA 4D9EA 2V4MA 3BD9A 4Y1RB 3N2EA 4P5PA 5HJEA 2PUAA 1GTZA 4IIJF 3WISA 2OSVA 4PRZA 4ZVRA 3VKHA 2H5LA 3VDNB 1QF7A 3RBXA 1PEAA 2ROQA 4H7DA 4OUDA 1F7VA 5BSUA 4PLFA 1P0IA 3FX2A 2QLBA 4ENVA 1IH8A 4TWJA 4DJAA 1W0JD 2QM7A 2WE8A 3PG5A 3WJ2A 3ZGXA 1I8TA 5DNYB 4ZEOA 3WIDA 4MVJA 3UW1A 4PU0A 4W5WA 1MVNA 4N6NA 2XQIA 3FUXA 2Y4OA 2VQDA 2V54A 4IDEA 4R8KA 1CUXA 5KYUA 5LUBA 1CUGA 5EFZA 2GRAA 1MAWA 2QS9A 4DBLE 2QZPA 2Y93A 2ZULA 4GKAA 3WGNA 4BLRA 4FE3A 3PDIA 4WOKA 1G2PA 4IINA 4EJSC 5IJ0A 4J8PA 1JSXA 4NULA 1UP7A 4FMPA 1RYMA 1TUIA 1Y5RA 1AKRA 3EXG2 5B57C 5IJ9B 5K8CA 3ZWMA 4DVJA 1W36C 1QE0A 1VIYA 3U3MA 4C4YA 5CR9A 5AJHA 4KODA 1IG3A 5H16A 4JI8B 4AFNA 1X8XA 1YRLA 3Q9UA 4PHTA 1GPAA 4X66B 2V58A 2FG6C 1GLGA 2PQ0A 3G8AA 4WTOA 1N0UA 2J59A 2FX3A 2OBMA 2ZBRA 4FNAA 4JFCA 3NTVA 3Q1LA 1NW9B 4JYCA 4NZZA 2JGKA 2VQSA 2WTXA 1F5SA 1CR6A 4BBAA 3CW2A 5LM3A 4KR7A 3H5OA 4B79A 2X4IA 3MTIA 5CAEA 1ZD2P 5B4UA 4MJLA 4P4GA 1SO8A 1T2NA 2WWFA 3G2OA 4YYEA 3VR2A 4YP1A 2ATXA 4S35A 2G6TA 3GLSA 5FOQA 4OATA 5J2UA 4R41A 1KWGA 3NZEA 3LFUA 4FOOA 1VLQA 4LSWA 3Q3GE 3HY6A 5BW6B 4WASA 3D7MA 1WCV1 2NPIA 3L1KA 3WL6A 1QTQA 1OILA 2OHFA 3LPMA 1BE6A 4A16A 1RKXA 3NATA 3NDIA 3ZDBA 1TEXA 2OLKA 2REQA 3F3YA 3GJYA 4WFKA 1V3TA 5CNKA 2BISA 1DUIA 5CCDA 4CIXA 1E0JA 2HPZA 1OYYA 1YI8A 1XT6A 4ARZA 3UFXB 1QIJA 2XYRA 3WXBA 1CDOA 2PSJA 2YWDA 3NAGA 3RIMA 1B16A 2I3BA 4HP8A 2KWIA 2IX9A 2VSNA 3S29A 2P5UA 4UARA 4ZHSA 2YQ5A 2ONZA 1SY7A 1XZCA 1JPVA 3CX8A 3DOUA 5BNFA 4FM9A 1NXPA 3DZDA 3K0KA 1X8JA 2AI2A 1O8BA 3LBHA 2C8KA 3OJEA 4JGGA 1BFKA 2JCSA 4ACBA 2PGXA 1GSOA 1JJIA 3I5UA 1RPAA 3NCTA 4HXYA 4P7BA 5DX0A 3B85A 4IKEA 4PX2A 3HZRA 5A6SB 5EGSA 4DQ0A 4E11A 2J1LA 1E8MA 1PR6A 1PJLA 4QBGB 3OX4A 4P86A 5EIFA 1R6VA 5DW0A 1VE5A 3EVAA 1ODTC 2XUIA 2D8AA 2C1EA 2HDOA 3WNDA 3IE1A 1E18A 2XUJA 3HO8A 3ON5A 4JB8A 4BFCA 4GKJB 4L9SA 4P1ZA 4BQQA 4U7GA 4GFDA 2HIHA 3MAJA 3UVEA 2CUKA 4X41A 4O2AA 5BORA 3TVYA 3IELA 3PR1A 3JW8A 2PGLA 1Z28A 3PHBE 4WZBB 1EFDN 1GU1A 3KPVA 3HXTA 1QKKA 4PC6A 2C97A 1GPKA 2Y1DA 2CNDA 8ADHA 4H15A 3CEAA 4D9KA 1VKJA 3UKOA 2PX2A 5LXTA 5B58C 3G2PA 4KK4A 1EM8A 3IV6A 2PHZA 1PZMA 2QRVB 4IDCA 3HC7A 4ZRNA 3I5YA 4O1IA 3UWOA 2A30A 1TYDE 1QAQA 4G0ZA 4MRVA 4M1MA 2WT4A 3ZWYA 4CKEB 4CIAA 4DR3B 4EKYA 1J9ZA 4HB2A 4Q21A 3ILHA 1I3LA 4R83A 3MSXA 3H17A 3FTEA 1YUMA 1YNSA 2AN3A 3DAHA 3H83A 3KQSA 2WHPA 3ZZTA 2C5AA 4MV4A 1ZSYA 1XVVA 5ALTA 2JANA 3REQB 2EVWX 4U7TB 5BRNA 3VVBA 3O5AA 3IAEA 4M9QA 1RDFA 4HNRA 3JR3A 4X54A 4IVQA 4X7PA 2WVAA 3PHGA 4GBGA 3ZCSA 3RNLA 3H81A 1JNXX 1DQPA 2O4UX 3WK6A 1HOTA 1Q74A 4DWOA 5KB3A 3I64A 4IIXA 5EIBC 1MDFA 2JI9A 3ZKAA 3HVKA 5CIYA 3QXZA 2L69A 1JIUA 2B94A 1OTHA 3QU4A 2P91A 3WHIA 3WGOA 2GZSA 1TKBA 3GFFA 4RZ3A 2QV0A 4YIKA 3N6RA 4UFOA 3AVQA 1M2OA 1QIHA 2X0IA 5KYXA 4YJ2F 4QGGA 1KI6B 1HNNA 5EZYF 5FHRA 4AG6A 2KMLA 3MRXA 1GNSA 3LQQA 4QAQA 1ACMA 221PA 4N5DA 5CDFA 3BMNA 2EDAA 4H27A 4ZCQA 1JKXA 2J41A 3OD1A 1YK0A 3W3AD 1GU7A 1K89A 4BMXA 2XMZA 3GUYA 3A04A 2Z3VA 1KZ4A 2CHEA 4LXTA 3DF7A 2MCFA 2FP4B 4Y9UA 4J07A 3W4KA 3WRXA 1ZPDA 1QH8B 4I1VA 3N39C 1NOJA 1GL6A 3FWKA 2B8WA 4PFJA 4YT5A 1IU9A 3H5WA 1LPNA 2I2CA 2ZPUA 3O95A 4IYRA 4U9IS 3T94A 2FMTA 2EFGA 5C34B 1DUBA 2MSNA 4BVKA 3UO8B 4WJKB 5LA6B 5HUHA 1GPYA 4HDMA 5K45A 4YASA 3DPSA 1VP9A 5F9MA 1OYVA 2WJ4A 4RGVA 3BWVA 4UXIA 1MB4A 2WJWA 2VF7A 3E3MA 3B9QA 1M73E 2XAUA 2QMZA 3KLBA 2H92A 3KTDA 3MWDA 3BE5A 4I9NA 4NHEA 2RKWA 1W19A 3EVZA 4WXMA 5HEKA 3SU8A 3K1AB 3KYJB 3NNSA 1GV0A 2DQSA 3RK1A 4V2IA 1RQGA 4JSYA 4X61A 2B0CA 2R8RA 4BKUA 2J0VA 1BWPA 2O0LA 5JSHA 2GUGA 4I4NA 1VE6A 5DX1A 1DCIA 2OCKA 3HCDA 3KXKA 3HDVA 1V5EA 4YMSA 1Z0AA 1SVMA 1TK3A 2RHRA 5BPFA 2ZIEA 5HGXA 2ZUFA 2BYTA 2GBIA 3ZE9A 3RIGA 1H6BA 4JLUA 4MKFA 2IZ6A 3M4NA 2I55A 1FK8A 2FSFA 3L4JA 1AS0A 2BVNA 1LLQA 3CZPA 1US8A 5AIAA 2BWJA 2FJUA 2Y67A 4DXAA 1KU6A 2I7VA 2R4QA 4OMFG 2G5CA 1EFCA 1CK4A 1PZFA 1ADFA 3KB6A 3PC6A 4CBVA 2B5OA 3GEPA 1GL3A 1QRTA 4U2EA 3N3BC 1WV0A 1JA9A 5FO0A 2C84A 4JCQA 2C20A 1Q22A 2B9VA 3ABSB 3DF9A 3AH8A 4L8VA 1OLXA 2P30A 3SYRA 3C5VA 1Q0HA 2DFPA 2QN6A 3GGCA 2GMWA 3TCNA 2B5WA 2R8OA 3D2BA 1RYYA 2KHZA 1X1AA 3E61A 2X4DA 2LZ0A 2RHTA 4JLSA 4NENA 4R54A 2JAOA 3PK0A 4R0NA 4ZRDA 2JCVA 4KQ9A 3ZCQA 2ATVA 1C1XA 1ML3A 3G2MA 1QGUA 1KOLA 1V8PA 2QRHA 1XTRA 1CRLA 3FMGA 1ZXLA 3E84A 4UJ5A 4DLRA 2Z8ZA 3GHHA 1YU6A 3HWX1 2CC2A 4PG6A 2FJPA 4CCSA 4WAUA 5H8WA 1OLUB 3C16C 2VZ8A 3JVVA 3WADA 2A78A 3G23A 4OFZA 1E9FA 4JB2A 3UAOA 5EE1A 3WWOA 1OAKA 4C4AA 3QLVA 4KXUA 5M29A 1PEKE 2G83A 1D1QA 3NKVA 1A8QA 1RQ2A 4QNNA 4F21A 4UNNA 2J30A 3NX4A 1L4KA 4JELA 3N74A 1HK7A 2JFBA 2F3UA 4FJWD 3WK8A 1B0PA 3SOPA 2HW8A 1VSUA 3KKNA 2ZYIA 1SCUB 1P17A 1F9EA 1VSBA 1WAMA 3D4IA 3HGTA 2FQYA 1ST3A 3FSGD 3NHWA 3VSDA 4EWLA 1H5NA 2ZI7A 3DAPA 4ZIRA 5C4IA 3RSTA 3SAJA 1KFEB 4F47A 5UKDA 2GLXA 4XLZA 5DLDA 2H1VA 2RGYA 3E58A 4DR1B 4C2AA 2ZJ3A 1NQ5A 1K7XB 1GKIA 3VR3D 3WLJA 1X1BA 4IZBA 1RAFA 2RMKA 5HW0A 1Z15A 1QH9A 1GUFA 1U8FO 4ND7A 3NB0A 3FNFA 1Q17A 1KQGA 1PFUA 1QP4A 1S2GA 5ALIA 2P2YA 4AYXA 1RQNA 2QTMA 3USZA 1DMRA 1KYXA 2B92A 5EVCA 3ZCTA 1WSWA 3B52X 1UAYA 3TLBA 1P31A 2J85A 4W9MC 2YW9A 1NVGA 2M6LA 1JEOA 3L6EA 4GIBA 3WBBA 1EI9A 3WMRA 1EMDA 2Q3FA 1JEYA 4LOIA 5JFTA 1Y7PA 2PX4A 3Q3IA 4WLNA 4ZHQF 3AF0A 4ELWA 1T1EA 2Q9AA 4R9NA 4EP1A 2CL5A 1Q95A 2YXNA 1RXUA 3ML1A 3A26A 5BWMA 4AJ9A 3ZU6A 2HHLA 4R2IA 4L5YA 2P27A 4N41A 4C0WA 3QVGB 5HKKA 1WDMA 2C0QA 3AI2A 1E94E 2Y0BA 2WD7A 4F2HA 3E6AA 2WFZA 4FZ5A 3HU5A 5KTSA 3C98A 2BJHA 2R1TB 3QXHA 4MJ3A 2I54A 5IAKA 3HVRA 1N4AA 3RIXA 1P2SA 2J48A 5JWHA 1EX1A 1Q44A 3BMOB 1L5VA 4ZDCA 4RVDA 3OTOB 3ND6A 1GNRA 1KMHA 2YJ6A 2DZDA 4EDFA 4KQ6A 4DCNA 2OP1A 2P2NA 3LHFA 4TTIA 4UBNA 1D1TA 4JI6B 3NHUA 1JU4A 2WUVA 3LT1A 3GZNA 4LY3A 1N6OA 3STYA 5KWSA 3ETEA 4BVBA 4FLEA 3QTLA 2OHXA 3RC3A 1FFYA 3VKWA 2Q2VA 1SOMA 2ADOA 2AT1A 4AQYB 2GM5A 4RYFH 1ONBA 4CVNA 1W9MA 3CH7A 1PYDA 3J7TA 3NHPA 4M7OA 4A23A 4KPEC 2IPNA 1LBEA 1YOBA 3HB9A 4FZ3A 5H7XA 4FZRA 1N5RA 3L6OO 3O91A 4W82A 1GAXA 1HQCA 1TNDA 5EJ4A 1XWWA 4ZV9A 4IIJB 3ZJTA 3EFOB 3L07A 1DARA 1YJBA 3EXHA 5EPUA 2ECQA 2F8MA 3P9KA 2CYBA 4B6PA 1TJNA 5ICSA 3DFZA 5IT4A 3THYA 2WP0A 2RI1A 2AYXA 3CJTA 4BUCA 2EFCB 2C7QA 1A9QA 1M2JA 3B6JA 3ASZA 2CMDA 2CLCX 1FP1D 3AERA 3UXEA 1G19A 2JFGA 1YWGO 5B7NA 2PRZA 3KUCA 2CCGA 3MJHA 3QVMA 2VVTA 4IL5A 2QN9A 4ID3A 1MX3A 4JLWA 4MQ4A 3DMYA 5IW8A 3WL4A 4A4DA 1NSTA 2GSDA 3MNFA 4P81A 1JR4A 5JC8A 1H2BA 2ZTHA 2HF7A 4JITA 4LY6A 4ZV7A 3DE4X 3HU3A 4RHEA 4BP3A 3DTVB 4F38A 1ZEJA 2IDKA 3VHLB 1TF5A 4II3A 1JNYA 4PAMA 2BTQA 3V1NA 3X44A 1U2QA 3OC6A 4MR9A 2QQ5A 4MAMA 4FB8A 1J33A 4UMFA 3WC4A 5JCXA 1U80A 2PMKA 5ALUA 2GJKA 2N46A 2R2GA 3WK5A 2A9FA 3LSYA 3A36A 1T4CA 3OPYI 4B7CA 3KJNA 1E7WA 1H8HA 1CJTC 1NY6A 3TI7A 1EZZA 3GPBA 1CQXA 2FMHA 3STWA 121PA 2FZVA 5BN4B 4XDYA 5BSHA 2XCSB 2PEYA 3WAJA 2IU0A 1G21E 2DMRA 4DAOA 2PTHA 3TSCA 1KOJA 1Q21A 4OI0A 1ESCA 2HCBA 3KL4A 2XWJI 5G0VA 3WLTA 3G1TA 4RSHA 1JYFA 3SS9X 5FUQA 3W7VA 2ZUEA 3GCDA 3KJEA 1K32A 4YC7A 5FT9A 1ZOSA 1W7AA 3ZLJA 1CVRA 3LAOA 1N1GA 3KZXA 1Y3BE 1HF3A 2WFAA 2D0DA 4PZ9A 4XFDA 5GV7A 4F56A 4QGSA 1CRPA 1HORA 1NI4B 2OQVA 3D2AA 1Z5OA 3O21A 1KYIA 2JBAB 2M32A 3ITDA 2JLAA 2AZDA 4QRIA 1TFUA 4BAZA 3IMFA 1N6HA 3NR2A 3LX6A 5IULC 3CRRA 2WWGA 2D00A 5CDGA 1E98A 3K8XA 5ADUS 2HQOA 2O3UA 2NN3C 1V1JA 3L8GA 1X3LA 4AY4A 3LOUA 3L79A 2OXRA 3TI9A 2A2ZA 4NBLA 4F9FA 1U0TA 4ETMA 2EATA 4G24A 5EKTA 4B31A 1GJRA 4MLZA 4UATA 5I9TA 3R7WB 1P2BA 4FJ1A 5FUWA 3BHJA 1QP7A 1OIXA 2R6JA 3BPSA 2ZRCA 1IAVA 3A1WA 1I3CA 1PGNA 2F1OA 1BCSB 1QX4A 4H7EA 2A81A 4PICA 2XVXA 3HBLA 3OAAD 4IWNA 3ND8A 5E2AA 2P68A 4F5YA 2P41A 2PL3A 3U7IA 1KI2A 3UMYA 1PT8A 1K98A 1ONSA 1SOAA 2PMBA 4NV3A 2IUSA 1ZM2A 3ERCA 1KVUA 5D3MA 5AYVA 1CY7A 2QVBA 2VDRB 3EF0A 2RK4A 3FRIA 4EW3A 4DCTA 1FX0A 1F8YA 3I09A 4A8PA 4KAXA 4J2TA 5KJ1A 3KQLA 4EFMA 4WK2B 2A94A 4AY5A 2YJGA 2XOEA 4YAFA 2Q5QA 1JBEA 3DG9A 4M9CA 5D00A 3UG6A 1KRWA 4BJHB 1GZ5A 3TOCA 3OO1A 3RSFA 1ULAA 5CEFA 2A3NA 2BFDB 1OJ7A 2NVWA 1TPZA 2W3PA 3CJRA 4CQMA 2GNOA 2VJQA 1AKMA 4QG3A 1HBJA 2JJ2A 5A4DA 5DCLA 3HXOA 3CEMA 3O03A 4ZCLA 3RHSA 2YBDA 3TKLA 1L5ZA 4PS0A 1ESMA 4KK3A 2W2LA 5K3AA 1BU8A 1DELA 4QYIA 4JOQA 1PVDA 2PX6A 1MF7A 2BSAA 3CCBA 3EQ6A 5IAJA 1GZ3A 2ZIGA 1SHJA 4JIMA 1PK7A 2V3WA 3R9WA 2QZ4A 4R68A 3RVOA 1SQSA 1F51E 1MJGA 1NLFA 2G67A 3V7NA 4EW6A 4RL4A 5FI5A 5EN4A 3QKAA 4ASUD 4LHVA 5EIWA 1WNFA 3L84A 4M9ZA 3GFBA 4PFKA 2J31A 4B17A 1XPOA 1I7SB 3UHFA 2AE2A 2PJRA 5GJWC 3HP4A 1HG0A 1FTWA 1VBFA 1ZGJA 2WD9A 3RUAA 2FFQA 3LVQE 4HAYA 2Y0CA 5BSVA 1NF2A 3Q3CA 3DXFA 3GQVA 4EB8A 4E5YA 3NM5A 3QMMA 4YJ2B 4ZVNA 3N75A 4JLBA 1U1IA 5EZYB 3WGIA 5DUFA 4TXNA 2Z6VA 4Q9JA 1XO1A 4K6OA 3TEJA 2V7TA 1D1PA 1QGAA 1DIRA 3E5NA 4LXXA 1U0HC 5LUAA 5DWQA 2YRFA 3X1KA 1RKVA 3IAUA 3LOPA 4XKJA 1KEWA 3KJQA 3AVXA 1IVYA 4P22A 4R40A 5JARA 4OU5A 3AHDA 3IUNA 2IA5A 1TTTA 4H7IA 4G1EB 1N1EA 1M34A 3VZQA 3ZY4A 2CXXA 1EY3A 3F97A 3CRNA 1PNTA 1FU4A 3CSSA 1NXWA 1ZXXA 3GJXC 2YICA 3MT9A 3WFIA 2G06A 3BPTA 1CIVA 1XTSA 3I42A 3E82A 1AXRA 4DMCA 3A6ZA 3PA8A 3UBTA 5DI3B 3QLUC 4W5OA 2F90A 1M1ZA 4I1PA 1LW6E 1GAEO 3WQHA 4JN6B 3HINA 3QH4A 5A4MS 3EYAA 1KI8A 4IUCS 1J49A 1K8YB 2Q3LA 3SQOA 3UKJA 3PR2B 4HRVA 2VDOB 4ILKA 4KN8A 3AL3A 3TLAA 4TKZA 4DA6A 4UE6A 4F4CA 1K8RA 1K0UA 3MMZA 4DM7A 4EYOA 1GNVA 5I7WA 3TBFA 1C7FA 3ENVA 3UPUA 4TS3A 4FJ2A 4YX9A 3P97A 5E38A 3CQ9A 2F6IA 1W2HA 2C2GA 3HN2A 2WSYB 3OX2A 4IV5A 4RZUA 4I4TA 5AJVB 5FYDA 1MJ3A 3KUDA 1R6TA 2O7VA 3GGOA 4LDRA 4LYFA 2GGSA 4O4IF 4ZOBA 3RHZA 3VSAA 2R1VA 1WZIA 1FQKA 3U60B 3SX2A 4FFPA 1S01A 2YWGA 3EYWA 3FVQA 1Z0UA 2BUCA 2ZUBA 3MS4A 4HS9A 1L5HB 5AJYA 3ZV7A 2MTBA 4BC0A 5DSXA 3WK7A 3WKDA 4GGMX 1HA3A 1UDWA 1IPFA 1ZC4A 2G71A 2XADA 4KO2S 1U1GA 1VJCA 3BE4A 1Q1NA 5IKLB 4DLWA 4DUGD 1U8ZA 2K6GA 1JKIA 3QUCA 3KVRA 2DBVO 4ZD6A 5IC5A 2IYRA 5BSKA 2DP4E 5KSZA 3OF3A 2Y9ZA 4XEUA 2OOKA 4YRLA 1MAVA 3AUAA 4B4OA 3I45A 3BN3A 1TT5B 3KSZO 1VE1A 1O89A 1TRKA 4HDTA 3FUCA 1G5PA 1XRPA 3QXGA 2Q7DA 2JJMA 5HX7A 5EZSA 3M6IA 1VBNA 3AIIA 3RUHA 3WL5A 3UEOA 4L3VA 1P8JA 3U9LA 2WSIA 5HCIA 2PZAA 5SV2A 1JHMA 4GO1A 1XTJA 1J8MF 5ELMA 5LP6F 1KEEA 2TYSB 1CU1A 4KQXA 3WYCA 3UY4A 5G1SA 4MLPA 4O5AA 4CHGA 2R47A 2Y8EA 5E95A 4TS1A 4IIYA 4KQFA 1OD4A 2P2CA 3VV3A 3UMCA 2H4FA 2XXAA 1T1RA 4E12A 3A2KA 1SHZA 2YFQA 4RANA 3I04A 5AUPB 1J0AA 4BMOB 3A32A 5LDHA 4CMKA 4KIFA 4P58A 3DPIA 1E59A 4C4OA 3V5IA 2E87A 2CLSA 4Y9DA 1XJQA 4GI7A 1E6MA 2HX1A 2NO9A 1FFSA 4KLAA 3UM9A 1UXJA 4B35A 3THXB 2OC9A 3BGVA 3OPYA 4UQOA 3ZY3A 4Q3OA 4U0KA 3HNOA 5BSRA 3ZDXB 5KU7A 1JSCA 4MPTA 2B21A 5HG0A 1E6LA 4Z2YA 4DBLC 2DXIA 2V5VA 4UASA 1CZUA 4YA6A 3ICQB 4QAJA 2XZOA 1TM3E 1E6KA 1M76A 1CIJA 1E0KA 4X71A 4Y2YA 5HKLA 3UN1A 3T8AA 4KIGA 1ODKA 1B7GO 3WJ1A 4Q01A 5JH7A 4ZC8A 2G4VA 2VYQA 4JBNA 2IS6A 5ICEA 1GCIA 3LT0A 3BAZA 4B3DA 7AT1A 3W06A 4CR8A 1J2YA 2EERA 3OFSA 3L7NA 4K6FA 5EC8A 1IY1A 3A1VA 1AA6A 1VGQA 1A9ZA 1X86B 3OTHA 2B99A 3MINA 2NYVA 4MQFB 5DE3A 5FPSA 1PSDA 1TQHA 1OFUX 2OK7A 4J6EA 4LYHA 4RMIA 5CM2Z 5FV4A 1PS8A 1YCGA 3CT4A 4PSUA 2QYOA 4AKSA 3HSYA 1LPPA 2J3MA 4ZHQB 3PWZA 2OWEA 2XMDA 1OIWA 1YOVB 2QW0X 3BGWA 4P3KA 3AVYA 4RDXA 2OUIA 2QIOA 1UWLA 4FHZA 4QUEA 1ZNWA 2QMUA 3TQRA 5A1TA 3IKJA 3SX4A 2W2KB 3E23A 4WZ8B 3TVUA 3W9SA 1QANA 1D07A 3C43A 1RXCA 2C95A 2ETXA 2VS1A 2JAUA 4B4UA 2VCYA 3AWDA 1EAMA 2BFCB 3HFSA 2NXNA 1OBFO 1XHLA 3GDHA 1G1AA 1NUSA 3V46A 4I3HA 3RFVA 4C2BA 3U13A 1NXVA 3HO1A 1FQOA 4FFOA 2CFIA 2CXUA 3EG9A 5BQ3A 1GPUA 3HVJA 1NPDA 1V26A 1Q7TA 1UBNA 3FLMA 4IH9A 2DUUA 1YCFA 1U1FA 4L51A 3ZGNA 4MUIA 5C7IO 3GLTA 4LCJA 3GRKA 3FG9A 3F2IA 1L0BA 3SF8B 4HFJA 3EQ9A 4Q1VA 4WECA 4Q9KA 4C6HA 5DM0A 5DKFA 3IALA 1G2IA 4W5QA 4RD2A 3VR5H 4HBGA 4RSGA 1YS1X 2CL6X 3OP1A 2JA1A 4FCCA 4PGAA 1CVLA 2AX4A 2C1ZA 4GL4A 5CYFA 3RSZA 4ZQHA 5BR7A 2FQQA 3DXXA 4DYHA 3BAFA 4EI9A 1AQLA 5KNDH 1C0IA 1P0CA 1SQ6A 4BTEA 1KAQA 2DUMA 1QHYA 1JX6A 4B2PA 1JEEA 5C1BA 3O38A 4IMPA 1EUZA 1YGPA 2J6BA 3MOYA 2XMQA 2WY2D 5L4NA 1KPIA 1Y6RA 2C8JA 3FZEA 1XKXA 4OQMA 1XFAA 4JCRA 3Q8WA 2CLHB 5CVJA 4DZRA 1HPLA 1R5NA 1WXIA 3LMKA 3VV2A 2OCGA 5KDLA 1JKJA 3VM6A 3OCUA 1F3LA 1G8PA 3IQFA 1VSQA 2I6XA 5A3RA 1QR6A 2J9GA 1T0HB 3BH7A 4V0KA 4JJFA 5AKKA 1E6CA 1G3MA 3NHKA 5J59A 2HAEA 4MYRA 1C2TA 5JXIA 4N40A 2O8BB 4LYGA 4EQ6B 2ZEJA 2HXSA 4FE4A 5CA0F 4Z4EA 2X5OA 3PX7A 1XHEA 3NH6A 4MUFA 2PM8A 1S96A 1E9RA 4LF5B 5C4GB 1YDEA 4ZZ2A 5CLJA 1KE2A 3RS4A 3HO6A 1BN7A 1E1NA 3FOEC 1OH5A 3MBOA 4GBMA 2V9PA 1YC2A 1VCNA 2O0JA 4JYBA 3IEXA 4PPFA 4WUVA 1KQNA 4CYMA 3Q8MA 1POXA 2CMGA 4H7PA 4L3WA 4WEQA 2SCUB 1T5LA 5ECWA 3KETA 1AQIA 2XOKD 4P38A 2VTVA 1XRNA 1O58A 2D1TA 3VAZA 4CCAA 4GX0A 2W2VA 4NEGA 2FPUA 4AZ3A 4CHTA 3FNRA 5TS2A 2GWRA 2VDNB 5CTJA 1QIIA 2BI7A 4XSHA 4D74A 4QM6A 1NBME 4C0AC 2NX2A 4HNAB 5J4KA 2XYPA 3Q6IA 2EZ8A 1H93A 3T7EA 3WYGA 1UDXA 5IUNC 2CF6A 4QZVA 1PNQA 1FLVA 2P65A 4Q03A 3AIMA 1JIXA 2DTXA 1YULA 3T7TA 1A5SB 2Q62A 4QUHA 5D7BA 4B7AA 4D82A 4NAHA 1CQPA 1V37A 1U2ZA 1N2BA 2QTWB 2TS1A 2FMUA 3BH6A 4LQCA 3A2NA 3TR0A 1UBFA 5K3DA 5FAKA 5MHTA 3LXMA 1O57A 2XZTA 2YUTA 5IBRA 1QF6A 2XIJA 4HMPA 4JMLA 4MWSA 4FB4A 1DQYA 1G20A 5L6MB 4E7OA 5JJCA 4ZTUB 2D54A 2YIMA 4L72A 1EHIA 2FNAA 2BMEA 2WAAA 3NBMA 5FWAA 1RAGA 1W4BA 4TWRA 3SYKA 1XP8A 2P9HA 3O83A 4K0RA 4M98A 5FPQA 2ZS8A 2OD7A 2QP3A 2W2XA 1D4AA 2HCTA 4RQTA 5T41A 3WJ7A 2P4SA 4EDHA 1PK9A 1DAKA 1LVGA 1BMTA 1TEHA 2GDZA 2O2IA 3QE2A 3U39A 1FMLA 1EVYA 2R79A 2H7YA 1GITA 2WZBA 4AMYA 5JQGF 3BGIA 4POAA 1DJMA 2R84A 5JBWA 1TT7A 2QGNA 4R2HA 2WJHA 3ZW8A 4R01A 4YJHA 1Q3KA 3PUJA 4HHEA 5EMMA 3DQQA 1YB7A 3SM3A 4B5KA 3C70A 4RV5A 1F12A 3I1FA 3FCEA 1JSLA 2GTRA 4OBBA 1SOWA 3B1ZA 3E7DA 1GG8A 4AKTA 3SR3A 1PJQA 5KNBH 2C3MA 3FZNA 1U8YA 4DSTA 2XUOA 4P5DA 3WLSA 3EEYA 3UC5A 4BNKA 4EZIA 3G1WA 2WKWA 4D3SA 3K53A 4KDCA 2X5JO 4G4GA 2W43A 1NNSA 4HV4A 1CBUA 2F8TA 1JS1X 1NXOA 3GMAA 3PT5A 1Q52A 1DQZA 3AETA 3BK1A 4I4IA 4PINA 1HNOA 2GN2A 2I6UA 4ETNA 2JHGA 3A9CA 1GUAA 1CIPA 2WJPA 4OSOA 4UU1A 4ZVUA 1BX1A 3GBPA 2R8EA 1OX4B 2ET6A 3BRCA 1R8XA 1W5SA 1E20A 3L0BA 2RC5A 1XTKA 3FKSD 3DVQX 1CJVC 3UYKA 5KJ6A 4RWEA 1SVOA 1NVVQ 3AF5A 5AVZA 1HEYA 4S1TA 4WNAB 1C1DB 3WRWA 1F4VA 3F9IA 3KXPA 2AJDA 4QRDA 3BA6A 1NW7A 4ZO6A 4D8XA 1TG6A 2WHQA 1IIRA 2OZPA 3S1LA 3SBXA 1IM2A 4F2GA 4TXLA 1ONOA 1QYVA 1UQUA 5L7WA 1JECA 2Y1CA 1Q3HA 1RHJA 1BXGA 4UFNA 3VZPA 3VU9A 1J1ZA 3WSWA 1FSPA 4P8RA 3V2UA 5J5VA 4E4YA 1I2BA 1RP1A 2O8EA 1NV8A 3J7AC 2CBGA 1FU7A 1ES9A 2OV8A 2P7HA 3BX1A 2VUUA 1KVRA 2B30A 3CXUA 3Q4GA 1L8OA 5LC1A 5THQA 1G8HA 3OOEA 3W5HA 1NBOA 3L3BA 1U3FA 2FSSA 3OESA 1HNUA 3GAAA 3AY0A 3BZBA 3GLHE 5LLSA 4EJ6A 1PX0A 3OG9A 4IIHA 2JLVA 3IAM1 2DCMA 2W6IA 1GQFA 3L0ZA 3SF0A 2YKGA 3Q7SA 2HBYA 3ICVA 4CMIA 1IBKB 3G3EA 5BT8A 3LX4A 4DCGA 3EEOA 3RSCA 1EDOA 1G6OA 2JLRA 4L0QA 1J00A 4OXYA 1U0RA 3SGLA 4E7PA 1RWBA 3OIFA 2EL7A 2F6RA 1EQ2A 3IRVA 4GMDA 4L15A 4TZKA 4B6EA 2G4LA 3H16A 3V4OA 1M0SA 1E3SA 1PJAA 3WMEA 2Z2IA 3TJZA 3QGMA 1KAGA 5JS6A 5BV2P 4ZCTA 1TC1A 1DAHA 2IKQA 5CCBA 4S12A 5LZ9A 1YFLA 3PJFA 1RAHA 2WEKA 5FBQB 4N5NA 4ASIA 3UT5A 8MHTA 1JQLB 4DEXA 1UODA 4U39A 3KL2A 3GLUA 2IL1A 3HP0A 2UV8A 3TB6A 4OJMX 3EHEA 1KE1A 2F9FA 2FEOA 3ZKWA 4DA0A 3GP8A 5DTPA