3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
2JAPA 3BA1A 3UCEA 4D3FA 4OH1A 1ISMA 1XQ1A 1B7GO 2FZEA 2B83A 4A73A 1YXMA 4WOJA 5JLAA 3DBRB 4A26A 2J5RA 5A5EA 2P5YA 4GVXA 1S6YA 3GFBA 4Z6KA 1OOEA 4BNKA 5INFA 3CMMA 2FY8A 5T8KA 1OC4A 3E1KA 4BNWA 3QP9A 3T7EA 3AK4A 5TX7A 4PZEA 2BFMA 1UAGA 1BHSA 4XZ3A 3NJ4A 1C1DB 3AFNA 3RBXA 4UUNA 2VRCA 4O59O 1YONA 4OM8A 1BXGB 1E3SA 1ADCA 1AGNA 3U5TA 5KVQA 3TT6A 1YH3A 4BV8A 4BO7A 4KWBA 2Q1SA 1OFGA 3QRWA 2GGSA 4YB8A 4PG8A 1NNUA 3E8XA 1VL0A 3GAZA 3JYQA 3L9XA 3MCVA 4FJ1A 1V9LA 2C59A 4UUPA 4FD3A 5A9SA 5TJ9A 2PGLA 4OXNA 2I3GA 2AG8A 1SEPA 1YO6A 5ENVA 2YV3A 2F9YA 2WYVA 3LKEA 3QWIA 4J2HA 5DCUA 4GL4A 2EKQA 3AI1A 4ESOA 1B8VA 2IXAA 4AJNA 5JBXA 4PG7A 4KWHA 1DIBA 3JQEA 1HDGO 4J1NA 5G4KA 1ULUA 4AJ4A 4ZQBA 4CM9A 4CMJA 3W6UA 4RF5A 3FDUA 2YHUA 3WYCA 5AXBA 4D42A 3OF2A 2NTVA 3AWDA 4RVSA 1TXGA 5DOZA 2DBRA 1NVTA 3HINA 4BGVA 3T8AA 4CR8A 3QWDA 4I1IA 4INAA 1EFKA 1LBEA 3ZV6A 1EZ4A 3E9NA 2D2IA 4J0EA 4D45A 2ZQZA 2E4AA 2JL1A 4W6ZA 3L6DA 3SWXA 2D3TA 5JO9A 5B12A 4Z9FA 3VVBA 5A02A 3AM3A 5ILOA 3TZQA 5L3ZA 2D5AA 2W3PA 2FHSA 2Y67A 2POQX 4EJMA 1RM3A 5COAA 3HSKA 2ZTUA 4R3WA 2Z5LA 4JJTA 2BGLA 5KOIA 1ONPA 4J1SA 2WEKA 1WDLA 3PJGA 4B4WA 3SVTA 2PZMA 3JU1A 2ZQRA 4ALJA 4NFSA 1MFPA 4M8SA 3OA0A 3ON5A 2I6TA 1ZK2A 4FB5A 1UXHA 3DOOA 4IMPA 1YB5A 4NIMA 3G1TA 4LN1A 4WUVA 5T5QA 3WR5A 1I30A 3OSUA 2F9IB 3T89A 2DFVA 1G6KA 1PZEA 3B1KA 2X86A 3TZCA 3GQVA 4DMMA 2UV8A 5JAMA 1FDVA 4LGVA 4W7IA 4BNNA 4C7KA 2VHYA 1ENZA 5I9LA 1ONNA 1T2AA 3LSYA 1TG6A 4IQ0A 4JCTA 3SEFA 2BKAA 3S2GA 3FF4A 3KYBA 1J49A 3HDJA 4U5QA 2OZPA 2AXQA 2VWQA 2EXXA 1DIHA 2PNFA 4RQUA 4MVJG 3DR3A 2O4UX 4BVAA 4GHNA 2YDXA 3JQ6A 2ZL4A 1KVTA 3PHGA 3WWZA 3RSIA 4H16A 3ZCXA 4IINA 4BNHA 2ZB4A 4B79A 1GCUA 1P1FA 4MJLA 4BNJA 3MWEB 4ZDDA 4ND5A 1BW9B 4U6SA 4GAEA 4DMLA 4YT2A 3I6IA 4CV3A 3WICA 3QXZA 4PLGA 4J16A 2FWMX 1YB1A 3G0OA 4XIYA 3TL3A 1H9BA 5DTPA 3TDCA 5C7LO 4IJKA 4XDYA 4HNHA 1Y8QA 1N9GB 4RZIA 3CSDA 4OLQA 4PIVA 3JQ8B 2X5OA 1PL6A 3U3XA 1E3WA 1HZJA 4QIJA 4MO2A 2GN4A 3BMQA 1ON3A 4IMRA 1PJLA 3AY6A 3A9WA 2GNAA 4CMBA 4IXWA 3IQDB 4ND1A 1YBAA 2E82A 4J0FA 4L9RA 3WQRA 4Q3AA 1G0OA 3BZUA 2QYTA 2PBPA 4LRSB 4TRNA 4Z0TA 5C7OO 1R6DA 4F6LA 1OBFO 1LQUA 3TRRA 1UDBA 5TJHA 4BGEA 3GUCA 2GRAA 3JQDA 4S1VA 4WCFC 4K29A 5AYVA 2I9PA 2BGMA 2ZB3A 2O23A 3WGOA 4P4LA 3DORA 4JP2A 1F8FA 2C20A 3RUAA 2W2KA 4WOKA 3OIDA 1Z74A 3V2GA 2EJVA 3VPXA 4CM9D 5G1SA 1JKFA 3FSRA 4QSMA 3PJFA 4XJTA 4AJOA 4MVJH 2AG5A 3UICA 3KOUA 3FBGA 2CE3A 3TT7A 3GHYA 1U9JA 3K31A 1OI7A 1K6IA 4LRTB 2J5GD 2VUSA 2DVMA 3SXPA 2Q1UA 1QG6A 1T2EA 3T4EA 4UVIA 3B6ZA 5B4VA 4DTIA 2HJRA 1QYDA 1XA0A 2EW8A 1UXJA 2GASA 2XF8A 2Y1GA 5F3RA 2OHXA 5EJ2A 3JQ9A 3PZKA 3GNSA 1CYDA 1ZKMA 4BHTA 4NZ9A 4PVDA 5G2OA 3KEQA 1VJ0A 1VKOA 2V65A 3RQSA 5I8WA 4CMKA 2B4RO 2J6IA 2XXBA 2RH4A 4M55A 2GPTA 2F1KA 4CM8B 3JD2A 3TOZA 5CEJA 4FFLA 2VSUA 3ST9A 2BGKA 2JHGA 4AJJA 1SC6A 1H6DA 2QZZA 3BTOA 4GSLA 2E6UX 2YQ4A 4O5OA 5I7EA 2CZCA 4WYOB 5BSGA 4CQMB 2O2YA 1ORRA 5L7TA 3GRKA 1NYTA 2HDHA 1GV0A 2EP5A 5IJZA 4K3WA 3BMOA 1U2DA 3PDUA 1E3LA 4NFYA 3FTPA 2PGJA 4L75A 4PLHA 2HK9A 3MJCA 1M67A 3P7MA 2QQ3A 3U4HA 2V6FA 4RDIA 2CDCA 2VYVA 4GLOA 3ZWNA 1H6CA 1CETA 1E3WB 4P4NA 3RBVA 2Q1WA 4J1QA 4JJFA 3RJ5A 1EE9A 1HTBA 3VPSA 4K6FA 1HETA 1Q0QA 2B35A 1DB3A 3PI7A 5L7WA 1R4NA 3PEFA 2A7KA 4CMIB 3NJBA 3KSUA 2I3AA 2PR2A 2UDPA 3DXFA 1PR3A 4DQVA 1FC7A 2IZZA 3GVIA 2BF7A 5EESA 1I0ZA 4J4BA 1C3VA 2D8AA 3OEYA 1PIXA 2VSSA 4BNVA 5G1RA 1V3UA 5F1KA 3CUKA 5F1OA 3C1AA 4UREA 4CMCA 3K6JA 4Q3CA 7MDHA 1ZK3A 2DUWA 3JQAD 3UOGA 5INGA 3EAGA 5C3MA 4BNLA 3F6YA 3HWRA 3ADPA 5CDGA 3D1LA 4L74A 3QWHA 5CDUA 4ZRNA 1ZXLA 2HSDA 5CHEA 3RC1A 4BGUA 3ISAA 4CQLA 1O9BA 2X58A 1JA9A 2C5AA 2PZJA 2YUTA 1Q51A 1GCOA 4L0QA 1WP4A 3ZHYA 4FQ8A 1U4OA 3DZHA 5CPBA 4MDHA 4QIIA 3CPSA 3GPIA 4IZIA 3VOSA 1DAOA 3OHSX 4B4UA 1J6UA 4XQEA 3BTSA 2QRLA 1A9ZA 2HU2A 2IRWA 1E3EA 3EK2A 3L6OO 5TGDA 2ZYAA 3X2FA 5DZKA 1T2CA 1Z7EA 3PIDA 4LSWA 4XR4A 4WJZA 1RYEA 4A2CA 4U0GA 3W4KA 2GZ1A 1GUZA 5BR7A 1KS9A 1R16A 2PA3A 2FPPA 3PZRA 2VWPA 1C0IA 2WSBA 4YR9A 5TIIA 1AN9A 3GH3A 4YT5A 1NQTA 1QYCA 4M89A 1X7HA 4Z9YA 3ROKA 2X0IA 4YAEA 3S2EA 2J5KA 4D44A 5H83A 4DGSA 4E4YA 3M6NA 4WLNA 2DQ4A 3MZ0A 4GX0A 4N5LA 3ZWYA 4A5OA 3ZWCA 1SAYA 1UAYA 4BO2A 4MOUA 2SCUA 4RL6A 3KEOA 1VPDA 2IDZA 3RKRA 1ZJZA 4X54A 4Y67A 3RAJA 3ZV5A 4N5NA 1UYRA 3BF0A 1NWCA 1U3UA 1LLDA 3D3EA 3F5QA 4RF2A 3VPHA 4BV9A 4J4TA 5I7SA 5L4LA 4J6FA 4QFCA 1ZK0A 4IY1A 5HTOA 4NH4A 4XWYA 3DDNA 2W2LD 4Y6SA 3R9TA 1B14A 1PS9A 1Y8RB 2Q35A 4NQZA 2FR0A 4E21A 1HZDA 2Y66A 4MOWA 2Y1CA 1OC2A 1QV7A 1YGYA 1VKNA 3CH6A 4E31A 3KBOA 5AXDA 2G0TA 3HP0A 3R9QA 2IZ1A 1YVEI 1H93A 1PTJA 5DULA 4OOEA 4I08A 5GZ6A 3FWNA 3HADA 1Y8RA 3OETA 1FJHA 2J3KA 3GEDA 1X7GA 2J5IA 4DRYA 1DFIA 1T26A 2HQ1A 3FN4A 4DL9A 3EVTA 4NHEA 2VOJA 3H7AA 4DUPA 4G2RA 3I9MA 3GMAA 3I5MA 5JBWA 3GGPA 1GL3A 3BMQB 3DHEA 5JDCC 4ZDEA 1U2GA 3SC6A 2ZKLA 3SLKA 4EUEA 4WLEA 3BAZA 4IDAA 4WLVA 5AXCA 1JWAB 4PRLA 5DBGA 3WIEA 4FZWA 4MPDA 4DIBA 2EGGA 3G49A 1AHHA 2AQKA 2CVZA 3WS7A 4KD6A 3WXBA 3PWSA 4O6VA 4OXKA 1SB8A 4Y6RA 2D0IA 4U0GH 4F3YA 3OJFA 2LDBA 3BEZA 1Q0HA 1Y7TA 2ZTVA 1XU9A 2HW5A 3GR6A 5EMHA 5JAZA 2A35A 1Q1NA 3KRTA 3N74A 3S2FA 3R3SA 1WW8A 3D3WA 2NU8A 4J3FA 4UUOA 2OBYA 2IEXA 3VZSA 4I5EA 1PIWA 3UXYA 3KQFA 4RPKA 1KEWA 3QVWA 1EUDA 3I52A 1Y8QB 2B4QA 1E5LA 1YL5A 4FPXA 4M49A 2QRKA 4OQYA 3X2EA 1O95A 2A92A 3INTA 4XB1A 2X24A 5E0SH 3ROMA 1YS4A 4JQCA 4BNYA 1CEQA 1DLJA 1PS0A 2O3UA 3I6QA 3VAZA 3DEYX 5DL1A 4MVJF 3H65A 2G5CA 1FK8A 4M1QA 3B70A 2NU7A 3B20A 3LT2A 2J5II 3BMCA 3ZWVA 1NZYA 3W6ZA 1GPJA 3AI3A 4CR6A 1KY5A 3PEAA 3U9TB 1N5DA 3ONDA 4ND4A 1AUPA 3RFXA 3R0OA 2ZK7A 1MLDA 3DOCA 4DC1A 4JYLA 3NT5A 3WSWA 1RM0A 5C5IA 2GZ2A 1PWZA 4R5HA 1LRLA 3KZVA 1H0KA 3GDOA 3QREA 4MVJA 3DZKA 4PRKA 5DUCA 1UZLA 3ENKA 5B4TA 1V6AA 4OXYA 4GGPA 3TSCA 3VPFA 1P74A 1V35A 3AY3A 5G0SA 4BO3A 3ZWOA 2DFDA 1J4AA 2WD8A 4WEOA 4YBZA 4AJEA 5INIA 4TRMA 4IDDA 5BNTA 1KEPA 3WTCA 4DQUA 2J3HA 4QO8A 5F5LA 1JTVA 3NAQA 1HE2A 4XCVA 2IYOA 4D41A 1ISFA 2Q34A 1H6AA 1PJQA 4FIZA 2H9IA 4XRRA 5JC1A 5KVSA 3L0DA 3FNGA 4R3NA 4R1TA 3Q11A 5HBRA 2ZL0A 3CE6A 3PPIA 1HYEA 3PGXA 1DC4A 2BI8A 4BNZA 1QORA 4HNKA 4KPKA 3QQPA 1XG5A 5JMWA 3P5MA 4RVDA 1K3TA 1M76A 1E3JA 2UUPA 3OECA 1HE3A 4HFNA 2BH9A 3D5QA 2YV2A 1CDOA 4YJFA 5ADHA 4PG4A 4TSKA 4WCFA 4MVJM 3VH3A 4KUHA 2V6GA 4FN4A 3ADOA 2Q2QA 2EF1A 4K28A 5JFOA 4CV0A 2X22A 4XB2A 3ROQA 4KWIA 1NWHA 4EZBA 1UP6A 4U19A 4QECA 4OSPA 3ASVA 2AEFA 2EWMA 2WTBA 2PD4A 3DBLA 2ZB7A 4G5HA 3ASUA 1N8KA 4G65A 4CMAA 5JAIA 1Q52A 1I3LA 4MVJI 3WG5A 4IJVA 2YFQA 2H63A 1IUKA 4MVJD 4UEOA 3H2SA 4PCVA 1EK6A 4BMVA 1WZ8A 4E0BA 4RF4A 3RC9A 2PKRA 3AW9A 2HMVA 3LF1A 3LF2A 4BNFA 4WCDA 5JY1A 4MKZA 4OMUA 4P38A 3ZU5A 4BO1A 2CVOA 1R0SA 4R54A 1JKIA 1N6DA 5G0VA 4NI5A 1TYFA 3LC2O 3QIVA 1T4BA 1YG8A 3I9JA 2CVQA 3C1OA 3GGGA 2EJWA 4ZD6A 3GGOA 2JFFA 2YJZA 1WDKA 4AG3A 1NM5A 2P9GA 5FYDA 5T57A 3WNVA 4IIVA 4JNKA 3C7DB 3WGIA 1EEHA 1EVZA 3HRXA 4RPJA 3H0UA 3NUGA 4XQCA 3UCXA 2OXIA 1ZK1A 4F46A 3MJEA 3HQ4O 3QWAA 1HE4A 3QA9A 4MVJP 1A27A 1LLUA 2UAGA 4RPGA 3GN1A 2RH8A 4RO0A 3PWZA 3IOYA 4YAGA 3EVNA 4JX8A 2X0JA 3RFVA 3NRCA 1LSJA 1XNVA 2FPIA 1ZUD1 2CDBA 1EFLA 2BLLA 2PZLA 3EC7A 4BNTA 1E1LA 1BXKA 1I36A 1GPDG 4ASIA 6ADHA 4IUYA 2Q99A 3W1VA 5I9MA 4DC0A 2PD3A 2NP9A 3PXXA 4J49A 4RORA 4O0LA 4R1NA 1UP7A 4UEJA 3CIFA 3UGKA 3GMSA 1A4UA 1U28A 3TVUA 5G4LA 1VSVA 1LDNA 2NSDA 2VX2A 3D5TA 4II3A 1KVSA 3OJ0A 2FSVA 2YW9A 3PZBA 4XX0A 2J3JA 2C0CA 4GMGA 4YACA 4PGFA 3WX0A 4ZQHA 3H8VA 5IF3A 5IXSA 2WE7A 1FC9A 2J5QA 5HWSA 4AFNA 1P77A 2OOSA 4ELXA 2Q2XA 4J1TA 3FNEA 2OL4A 3F4BA 2VWHA 3MJSA 2ZTLA 1GZ4A 4KQWA 1LA2A 1KEUA 2UZFA 3TF5A 3LQFA 4NNQA 4YRBA 5B4UA 5GZ3A 1JAYA 1E7WA 1JVBA 3DAGA 5ILGA 1UXIA 2HK7A 5L7YA 3IS3A 4FNBA 1E5QA 4ZN6A 1IPFA 4DPMA 3M2TA 2O3TA 2C2XA 2P4QA 4TROA 4U8GA 4J90A 2HO5A 4ZICA 1E7SA 1A7AA 1E0DA 2PLAA 2Y1FA 4UAGA 4YEDA 4YAKA 5FI3A 1YG6A 5GZ1A 3QYRA 4UVHA 3T88A 2CNBA 4IDBA 5DDIP 3IUPA 2F9IA 1YL6A 1GADO 2FP4A 4PG5A 1DPGA 1C0LA 4DI1A 2O7SA 3GLQA 3H4VA 2YYYA 1EF9A 2YZ7A 1ZMTA 3UVEA 2DEOA 4AJ2A 1XDWA 3TZ3A 3GF7A 3JQGA 1W8DA 1R0LA 2PWZA 3NV9A 3RRVA 3TWOA 2RBEA 4EJ6A 1YBVA 4ZVVA 3PJEA 2WYWA 1MFZA 1PS8A 5KJPA 3RU9A 3NEPX 4FDAA 4RDHA 1X1EA 3DBHA 2O3QA 2VHXA 4MVJE 2BFOA 4YWJA 3IKVA 1TT5A 4XYEA 3EUWA 5KWEA 1Z75A 5ITVA 5JCXA 2H1SA 5C37A 1JVSA 3C8MA 1DC3A 4E5MA 2B37A 2EIHA 1H9AA 3ENNA 3K2EA 4EEZA 5KJFA 2CY0A 2BZRA 3EHEA 5CFZA 5U4QA 4GX5A 3GKBA 3STAA 1ULSA 1XELA 5JSFA 4BNIA 4B3JA 3WYEA 4YJGB 4CM7A 3WNQA 4DIFA 1LX6A 1ISGA 5JC8A 2AE2A 2BFAA 3BTVA 4K26A 3RBZA 3U9RB 1P45A 3H0QA 3Q0EA 1DJNA 2VZ8A 3I9LA 1OAAA 2AHRA 1E92A 1PQUA 2DU8A 2CBYA 4XD2A 3T7CA 3L4BA 1NAHA 1WPQA 1PZFA 3RVDA 1B16A 3A14A 4JFCA 3ZZNA 1YRLA 1UIYA 2X23A 3WGTA 1O89A 1Q7GA 5DOVA 1MC5A 3R3JA 1RKXA 4J9UE 4XYMA 3GF3A 2JCVA 1QSGA 3ICCA 4HKTA 3M2PA 1T2FA 4FJ0A 4AVYA 4OKNA 1LC3A 3CINA 4NJMB 3WDSA 4N5MA 3OQBA 4Y8VA 2G76A 1UYVA 4ZHSA 2B69A 1QYWA 3E5MA 5A04A 1IY8A 1HLPA 3DC2A 4ND3A 1RM4A 4OJNA 3WFJA 3ZW8A 1C1DA 1EMDA 3O4RA 1GFSA 4E3ZA 1KC3A 3GVCA 1NZYB 2R00C 3WTBA 4JJIA 3A1NA 3KYCB 4G81A 3DJAA 5KDRA 1BDMA 3ETEA 3D4PA 4YJHB 1MG0A 2FPGA 4I5FA 3D3WB 3PYMA 4BO9A 3K30A 3OM9A 1T25A 2C82A 4MXIA 1JXZA 2I67A 3SJ7A 5A9SB 3PFWO 2PPYA 2WJPA 3AU9A 1ZO8A 4ZQGA 1WVGA 4UUMA 4Z0PA 1XHLA 3IIEA 3AOGA 4HNGA 4TKMA 4BKQA 2V6BA 3HZZA 4II2A 5TLSA 4QFDA 2ET6A 4LSMA 3ORFA 1L1FA 1BVRA 2I99A 3AU8A 2VZ0A 3P5SA 4HFJA 1SOWA 1ENOA 5A9TA 4D46A 1JAXA 3VKUA 4S3MA 1YDWA 4RLSA 2GN9A 4J91A 1NAIA 5DZKH 2RAFA 1DRUA 1I33A 1N1GA 4EUFA 3VH4A 4CM3A 3I23A 1YQXA 5DZSA 4RPHA 4W4TA 1LDGA 1LNQA 2X4GA 5ER9A 2X7HA 1LI4A 3AUAA 4WLOA 4EBFA 2D5CA 3WB9A 5CPFA 2DM6A 5JAQA 1HF3A 1PL8A 2TMGA 4DBVO 4GWGA 4BKRA 1QP8A 1IZ0A 3NDJA 1NFRA 4DYVA 1E6UA 4FFMA 2NVUA 2VQ3A 4E5PA 4WCFB 3W8DA 3SLLA 1LXCA 1Z82A 2HMTA 3UUWA 5IDWA 3C3XA 3JYOA 4N18A 4ROSA 4XDZA 3LT0A 4P4GA 4DXHA 1EY3A 4CUKA 4JYJA 3IUSA 1TA4A 3L3SA 3UH1A 1PGQA 1EK5A 4CM1A 2BI7A 3AY7A 3H5NA 4FOOA 1PEDA 3BYZA 1M66A 4R9SA 3ANLA 4CODB 5JDCA 1U8XX 2QIOA 4ZDCA 2NNLD 1PR9A 2IXBA 3TN7A 1ZH8A 3I9KA 1IPEA 2DC1A 3W8EA 3RFTA 2AE1A 1N92A 1Z7BA 1ZSVA 5IDYA 5CDYA 3GN2A 4JGBA 2A4KA 1H6BA 1LDMA 3DQPA 5A05A 1YJ8A 1NTOA 4JXKA 5JMPA 4DBZA 5L51A 2BELA 3VKVA 2WE8A 3KVOA 5A3VA 5JXWA 1MJ3A 5FF9A 4PLCA 3RC2A 4PLVA 4RYFA 2FMUA 2Q1TA 3MFMA 4WPGA 3WGQA 1ENPA 3PHIA 1ADFA 2VTDA 3DZBA 3JQCA 3AUSA 3KYCA 3Q6IA 4KOAA 1O6ZA 4RCVA 4YCAA 5T64A 1N2SA 3L77A 3QW2A 3Q9UA 1ZCJA 4PLYA 4B7UA 4YPOA 1B3RA 1DRWA 1NR7A 3MWDB 4B7CA 3QE3A 4HP8A 4MI2A 2O2SA 3F9IA 1QMGA 1SCUA 1CWUA 3HJAA 6LDHA 2Z95A 1SB9A 5TS3A 4FGWA 1LJ8A 4XKJA 2DTXA 4ZGWA 1ZXBA 1D1TA 4WECA 3H81A 1W73A 1VRWA 1W2XA 3PRJA 1JN0A 4JBGA 5KJ1A 4TVOA 1X1TA 3I4FA 4JCQA 3I1JA 2DBVO 5AOVA 4ALIA 1R0KA 4K2NA 1PJSA 2Y0CA 1SEVA 4EJ0A 5LDHA 3IAVA 2AQHA 4A27A 5K0ZA 1ARZA 3BHJA 1NPDA 2HLPA 2O50A 2O4CA 1H2HA 1JW9B 4QX6A 4BKOA 4EEXA 2RHCA 3OT6A 4KNPA 4ALMA 1J5PA 3H9QA 3L07A 2PG8A 2GO1A 3GRPA 2BHLA 3S8MA 3F4LA 1PJ2A 4CM6A 3HN7A 4N7RA 2GR9A 4IBOA 4BNMA 4UULA 1LRKA 2Y0EA 4HY3A 4BO6A 1XEAA 4R69A 1GQ2A 1G0NA 3NTRA 4FBGA 1Y6JA 5U9CA 1E1NA 3JSAA 1JWBB 1Y7OA 5JDIA 4OG1A 4WASA 2FOIA 5TT0A 3ZU2A 1CRWG 4BB5A 1Z45A 3CMCO 4IDGA 2EJ5A 2B5WA 1E6EA 1T4DA 2EKPA 4TVBA 1P1IA 3C85A 3GFGA 3FPLA 3L4BC 5I9NA 1K0UA 3GUYA 4KMSA 1KBZA 2RHRA 2W8ZA 3H9EO 3ZWBA 1QR6A 3VDQA 4ALKA 1F06A 2JD0A 4IM7A 4YA6A 1O94A 1G1AA 1X7DA 1YB4A 1X14A 5F1PA 1HYHA 4YAJA 3TV5A 2ZQQA 4PLWA 2JFGA 3BXXA 3KXDA 4KDEA 2GDZA 3U09A 3OJOA 5C9GA 1QYXA 5B1YA 4EUHA 1EDOA 2VYNA 3PIIA 4XYGA 3TL2A 3DAPA 3DBHB 4CMGA 4YJDA 3D4NA 4ZDFA 3V1UA 3BPPA 1YWGO 1O8CA 4L73A 2FN7A 2FR1A 1M2WA 3D0OA 3VTZA 5TRTA 4L4SA 1QYVA 1R15A 3KYDB 1A9YA 3PGJA 4OOFA 3ITDA 4N54A 3PK0A 1WZIA 1ZJYA 5BNFA 3NJ8A 5DCWA 4PFJA 1MP0A 5THKA 2CMDA 1MA0A 4GI2A 4XGIA 5L4NA 2H5LA 3QK8A 3U62A 3VH2A 1YQDA 3KM0A 5DNAA 3V2HA 4D0RA 3IAHA 5DF1A 3OQ6A 2ZYGA 3VHRA 5G4KB 2JD1A 2X9GA 1VRGA 2PGDA 2O7QA 1BTOA 3HNPA 2DUBA 1HT0A 3ABIA 5IG2A 1AHIA 1PZGA 1LDBA 1D3AA 3VZRA 1I2CA 1M6HA 1BVUA 1JLLA 4GVLA 3GK3A 1IHYA 3G3EA 5EQDA 3RSHA 1EVIA 1GEGA 4P8RA 1U3VA 4ALNA 4BUCA 3JD1A 1ZW1A 5JCJA 4E32A 4WGGA 3FI9A 2FW2A 4AICA 1NFQA 3TVWA 1DHTA 3OH8A 2Z1MA 1XKQA 4URFA 1ZEJA 4Q3DA 4RF3A 1DLIA 4NEKA 4I9HA 2Y0DA 1XNYA 5DU6A 3V5NA 1N6EA 4OMRA 2IZ0A 4YJFB 4IZHA 5A3JA 3ST7A 4OKIA 4PZDA 1GR0A 4B3IA 2JCYA 3BMNB 3IC5A 5A5FA 1H94A 8LDHA 3HFSA 4AJ1A 3TFQA 5ICMA 1SBYA 4NBUA 1CQJA 2FR8A 1Y5MA 3RC7A 4P22A 3PVZA 2EP7A 3DBLB 5HM8A 4JLWA 4RQTA 1HSOA 3NGLA 5EQFA 4L6WA 2DUUA 4EW6A 3ZU3A 1DDOA 3P85A 5EIOA 1EQUA 4IGFA 1E7YA 3DOJA 1U4SA 3OIFA 3U4CA 9LDTA 5DU4A 1EVJA 1FDTA 1ISJA 3WBBA 5DT9A 2PKQO 2A81A 3GPDG 1GYRA 4GX1A 3JQ7A 3KO8A 4IGEA 3PQEA 1VLLA 1XR3A 1YQGA 3F1KA 1FMCA 5LDGA 1A72A 2FZWA 4PG6A 2ZL3A 4J43A 1LTHR 4MP8A 4DLLA 1C0PA 2HMWA 1BMDA 4IDEA 5MGBA 1I10A 3E18A 4GKVA 1E1MA 2CFCA 1PJBA 1WWKA 1MG5A 3RUEA 3UKOA 1LU9A 3KSZO 5EPOA 1ONOA 1PQPA 3H2ZA 1JDJA 4K1LA 1PJCA 4XR9A 2Q2WA 5CAEA 5DUFA 3BTUA 4IZCA 2ZQYA 2HJSA 4JSBA 1S7CA 3DMTC 5A4DA 4JWVA 1VE9A 5BNIA 4FFRA 2C07A 4D0SA 1FF9A 2W2LA 3OJEA 4ZA2A 1XLTA 3U4DA 2YHIB 3MOGA 1GV1A 4CM8A 3NTOA 4JVTA 1TI7A 2V6MA 5COQA 1X13A 2Q46A 3ITKA 3HDYA 2PKQP 3MJTA 3VDRA 3ZNOA 1YDEA 4L4XA 2W98A 4TKLA 2AMFA 1VSUA 2F00A 4A0SA 1UYTA 1BRMA 4Q3EA 1HDZA 1P1KA 2GUGA 3CTMA 4W9NA 3VH1A 2BMAA 3WGZA 4GX2A 1ZSYA 3ZN2A 3IBBA 4CM4A 1MC4A 1HDOA 5G0UA 4I5DA 3AUTA 4Z3DA 3Q0GA 3M1AA 3LAOA 1P31A 1Q7BA 2QQ5A 4JIGA 1OD4A 1IL0A 1T1SA 4IS3A 1ML3A 3ETDA 4MIYA 5EERA 5IN5A 5L53A 1NPTO 3EMKA 4XQ9A 3TZ6A 1UP4A 4OL9A 2JKVA 3JTMA 4IDCA 4ZU2A 5T67A 3WQSB 1NASA 3OMEA 2NLOA 3K9QO 5DTWA 4Z0MA 3VZPA 5L95A 1AXEA 3E6AA 3HLN1 1DXYA 1U7HA 3ZNPA 1C14A 4AJHA 4E30A 1KY4A 3K73O 3WMXA 1N9GA 3DAFA 5H81A 1R4MB 1I8TA 4WNIA 3S55A 3MYBA 3P2YA 3BMNA 5GMOA 5I7FA 2DTEA 3IDSA 4RGBA 1J0XO 3DHYA 3DMTA 3V5IA 4JK3A 1FC6A 3NT4A 4NBVA 1LSUA 1EBUA 3HFGA 3RUHA 1XO6A 1PGOA 3GNQA 1K6JA 4GH5A 3ZHZA 1PGJA 2J5IB 3AI2A 1QRRA 4FC7A 5L9AA 1P0FA 1X15A 1AXGA 3ZU4A 1GEEA 5AVOA 1WZEA 1QXSA 3HUDA 5U1PA 1SZOA 3K8XA 4E5KA 1R12A 4I9UA 5BSEA 3EGOA 1IHXA 1LC0A 1B15A 4WKGA 3SC4A 4YRAA 2JJYA 4FFNA 4Q39A 4Q1IA 3HB5X 3D4OA 3QLJA 7ADHA 4MP6A 4NR0A 1ZNQO 3TOXA 3O03A 4M87A 4Z3KA 3OC7A 1I2BA 1CF2O 2WD7A 4FCCA 2R00A 2FZSA 2VHVA 4IIUA 3BMCB 4NPCA 4QQRA 2VUTA 4E6PA 5AQ1A 1OD2A 3VC7A 4ELSA 3FCOA 4ILKA 2VUUA 4NU6A 4R41A 1O5IA 3GDGA 3ZDFA 3DFZA 4UVGA 4UEKA 2HRBA 1ISHA 5G1QA 3H02A 4KDFA 2IEDA 4CM5A 4PN3A 3UAGA 1UJMA 4DLAA 3KUXA 2O3SA 5J23A 2CF6A 4WCZA 1RJWA 2TMDA 4YTEA 4FZWC 3KV3O 2F9YB 4CLEA 4GLLA 5JPIA 3AOEC 5ER6A 3ZHXA 2RCYA 4FC6A 4OQZA 4UVDA 4WLUA 2JHFA 4LISA 3HE2A 2NU6A 3S2IA 3WMWA 3PJDA 4R5MA 5C90A 2PY6A 2WWRA 1I5RA 1MUUA 1U5AA 2EW2A 3INGA 1YOVB 2F6IA 1DFGA 1DAPA 4CM4B 3GLMA 2P68A 2X0RA 1PGPA 4CLOA 4F6CA 2VHWA 3QVSA 1Z73A 1ADBA 4R1SA 1Q0LA 1K32A 4MKXA 1O8UA 2BFPA 4NNJA 5IDQA 1GU7A 5CP8A 3RSTA 1SO8A 3ZW9A 5DKPA 4DVJA 1QV6A 3JCZA 4JJGA 2Z1NA 3I3OA 5KJEA 3RKUA 3IKTA 1A5ZA 4CL8A 3OA2A 5EN4A 1DUBA 4FN8A 4LVCA 2Q4EA 2I66A 1DRVA 3AM5A 1RYDA 3GF4A 3O9ZA 1CJCA 4H15A 4TZTA 4EMMA 4KUGA 3TNLA 1ZFNA 3U9SB 4BL5A 4BKPA 4GSKA 3BHIA 4WE3A 4JCOA 3GZ4A 3I4CA 3MJVA 1HLDA 4J7UA 1U3WA 2ZATA 1N1EA 1Y1PA 3GDFA 4CJXA 3QWBA 4GM2A 4CUZA 3NDIA 3H5RA 3ONEA 1E7QA 1KEVA 4BO4A 1K6XA 5T6BA 1H2BA 3V1TC 3P19A 4I9NA 4FW8A 1TB4A 1ZVMA 4TRRA 3Q9NA 2LDXA 3QWFA 3MOIA 4R68A 2GTRA 3ETGA 2GCGA 4PLTA 3V5EA 3DL2A 4EGFA 2I65A 4NBWA 1V8BA 3ROPA 1KVRA 9LDBA 4B3HA 3K92A 2Q50A 3LYLA 4WLFA 3KTDA 4PLPA 1CIVA 3MTGA 3JYPA 2EGHA 4HWKA 3KHUA 1UDCA 3DBRA 1LRJA 1D8AA 3WSVA 2E37A 4JP3A 1B8UA 2I76A 5TT1A 4CR7A 2Y1DA 3GZNA 3TZKA 2NQ8A 5CDSA 4FSHA 1W6UA 3G17A 4U1AA 5ITWA 2PZKA 3GOHA 5T8KC 3ZH2A 1VI2A 3H0SA 1HRDA 1QLJA 2H6EA 3GAFA 1I2ZA 4OO3A 1ZZEA 2PD6A 2GZ3A 1A71A 3TRIA 3K96A 3PE8A 3WFIA 3F47A 1UXGA 3IMFA 2OP1A 4B4VA 1DEHA 4KTVE 1GY8A 2EERA 2X9VA 1XU7A 5HS4A 3JD3A 4JCSA 5ENDA 1DIRA 2C2YA 3FPCA 4EI2A 2YY7A 1HE5A 1YBMA 4Q9NA 4RJTA 5CG1A 5BSHA 3JD0A 3PLRA 1QLHA 2QHXA 4NFHA 4I8XA 2WMDA 3Q2IA 4IXTA 2IYPA 1RM5A 4D3SA 1P9LA 3RUIA 5KCZA 2NTNA 3JQGB 3EY4A 1NVMB 2NWQA 4B4OA 1E3IA 4GWKA 4NMHA 1LSOA 3QVTA 2A9FA 2X5KO 5JY6A 2PV7A 2XOXA 3R0IA 1Z6ZA 3SJUA 4HX5A 5COBA 1GZ6A 4E2ZA 3K50A 4H7PA 1UXKA 1K89A 1DBVO 3CXRA 4FFOA 1GQYA 4LCEA 3WYBA 2VREA 3EDMA 1UYSA 3W4IA 4YQYA 4Q3NA 4CLDA 3C7AA 3AJRA 4OIMA 4R01A 4BIIA 1P3DA 2O3RA 5ICSA 2YQ5A 1YL7A 3P2LA 4RYFH 4LMPA 3O26A 3NJDA 2V7PA 2B5VA 3EZLA 1GUYA 4NJMA 4ZDBA 1NPYA 1OMOA 4IJWA 3U0BA 4ID9A 4YXFA 4GMFA 2D1YA 2XXJA 3L4SO 5A03A 2HAEA 1VJ1A 5CTCA 2DT5A 5HRUA 4CQMD 2W4QA 4CLRA 5IXYA 1DIGA 4BNUA 8ADHA 4CLHA 5E0NX 1PL7A 4FR5A 1PU2A 1ENYA 4WNCA 3QXIA 4RCNA 3DFUA 5IZ4A 4LMRA 4XGKA 2VTEA 1KC1A 4ZQFA 4G2NA 3UCFA 1F0YA 4QTZA 4JROA 3B1JA 4EITA 1I01A 1BSVA 4Y98A 5LC1A 3PP8A 4TZKA 1NXQA 3R6DA 4OSOA 3QSGA 1KETA 3T8BA 5IN4A 2OGUA 2J5GA 1X0VA 1T1RA 2G1UA 5DCYA 3ONFA 1GUFA 4E12A 4ITUA 4XA8A 5KJCA 2OBNA 5DU8A 1DIAA 1VL8A 3G79A 4OGWA 4W82A 3RUFA 3W4JA 2OO5A 2OORA 4YRDA 1TLTA 3RJ9A 1KYQA 4DLBA 4J2OA 3ZV3A 3HB4X 1R66A 1WAMA 2WYUA 3FR7A 3HG7A 4XYBA 4MP3A 4BKUA 4CV2A 4DPLA 4E5YA 4JOTA 1E77A 3PYXA 3WLFA 1PZHA 3OBBA 1KOLA 1XIVA 3TJRA 2F6QA 3ZNQA 1ON9A 2OP0A 1P33A 4AL4A 1RWBA 1WMAA 1NQ5A 4GPD1 4RVHA 4WK6A 1O0SA 4YJGA 1BW9A 1YJQA 2DPHA 2QRJA 1K2WA 1VM6A 5KKAA 5JBIA 4CMEC 4U0KA 1B8PA 5MDHA 3MTJA 5B37A 2B0JA 4NK5A 3E9QA 4R1UA 5KNLA 3DZIA 1HNOA 4J7XA 4GBJA 2OUIA 1DHRA 5G0WA 3IJPA 1RJNA 1Y9AA 4TQGA 2IODA 4FFPA 1Q2XA 1XWFA 4M86A 2NVWA 2J3IA 2OFPA 1IE3A 3GEMA 1LEHA 3CZMA 2ZJ1A 2R2GA 3QV1A 4Q3BA 1HKUA 3LLVA 3Q7HA 1ADGA 4CPDA 1WDMA 2C29D 1SZJG 3TLFA 4LK5A 1I3NA 3U4IA 4Z0HO 2C7VA 3Q2KA 1EUZA 3O8QB 4CLOB 2FRDA 2UYYA 3HDQA 4YLHA 2VSSF 1E7MA 4NBRA 5F21A 5IZCC 3PLNA 1CQIA 4IDFA 4F45A 3PTZA 2CD9A 2ZIZA 3ANMA 4H3VA 4FB8A 3CZRA 1B26A 3OMLA 3R1IA 1CERA 1EDZA 3C7CB 4DWVA 4BNGA 2O3JA 4JBHA 4O63O 1EE2A 3DWFA 5I8ZA 5JNLA 3FF6A 2GLXA 2X8LA 4GGOA 1JQBA 1V3VA 4YT4A 2JAHA 3OICA 2DKNA 1R37A 3MEQA 2VWGA 1WNTA 3F46A 3SLGA 1MGOA 4TWRA 4RVUA 2CDAA 5HA5A 4CLXA 5JCJD 2P2SA 2HMSA 1VJTA 1F12A 5HS6A 2ZTMA 5IDXA 3RI3A 3DHNA 2EV9A 3NGXA 3WJAA 5KIAA 4E5NA 1DJQA 3WLEA 3QJ5A 1SMKA 3DZFA 1EQ2A 3FHLA 3FD8A 4CV1A 4QUKA 3PDJA 4JBIA 1RJMA 5KJ6A 3FBTA 1DSSG 1YOVA 4U0HA 4BO5A 1HEUA 3GNTA 1Y9EA 1ZBQA 3AFMA 3OEWA 1HZZA 4HBGA 3UFXA 3A4VA 4OYRA 2ILTA 3UW3A 2D59A 1I3KA 5ES3A 3LC1O 4AJIA 4ELWA 1DC6A 1HDYA 5FUSA 3VPGA 1Q7CA 2PTGA 4CUJA 4AJKA 4HADA 3ULKA 4RV9A 2VSUE 2ZCUA 4RZHA 1JU9A 1HNUA 4A10A 3A28A 4EYEA 1PX0A 4QO7A 3R6HA 2A7SA 1R4NB 1Y5RA 1ZEMA 3GHHA 5BQFA 5L45A 3JQBC 3Q0JA 5F5NA 2AEJA 1ZIDA 3LC7O 1HSZA 1V3TA 2VN8A 4YDRA 4C7JA 5A06A 1FCFA 4QFEA 3E9MA 4BQPA 5CEFA 1KVUA 2VSUC 1SG4A 2JFHA 3VZQA 3LK7A 4GQAA 4YQZA 4HFRA 1N7GA 4WZ8B 4E13A 3MJ4A 5FI5A 2VYVD 1F8GA 2NVBA 3GMDA 1TT7A 2AQ8A 2GYYA 3SX2A 4YYZA 2PH5A 2I5PO 2BD0A 1UH5A 1IYZA 1KIFA 4WEQA 3N6RB 4L8KA 1X0XA 4CMHA 3JQBA 3N7UA 3VTFA 3LU1A 3RASA 3WG9A 4AJPA 1NP3A 5TSDA 4FOSA 1BG6A 4XQGA 1EF8A 3DBVO 2Q49A 1GYQA 3IP3A 1XGKA 2C54A 1NVGA 3RUDA 3VVCA 2AW5A 1NQAO 1I32A 4IPTA 4BNXA 1LDYA 4OAQA 3DTTA 2P5UA 1K39A 3H3FA 1UZNA 3TQHA 1XYGA 1M75A 2VNSA 2PH3A 4HV4A 4HC8A 4I42A 2VSSE 3KTIA 1RPNA 1PJ3A 1K5HA 2NADA 4MKRA 2R6JA 1C1XA 3JQAA 3JYNA 3O38A 2PFGA 3AM4A 4MIOA 3QKAA 5L40A 2Y68A 2QW8A 3GZNB 4LW8A 2X1HA 2E49A 1BWSA 4Z9XA 3ZHBA 4D79A 1L7DA 2GF2A 4U18A 3KTGA 4IQ8A 3AUUA 4UVEA 3H0JA 3BHMA 4FS3A 3ZI0A 2YHIA 3WGYA 4QXMA 4J4HA 2Y93A 1GZ3A 4BO0A 2HK8A 1EVYA 2XPCA 3K5PA 1PGNA 2EKLA 4LK3A 5IFLA 4NDNE 1C1XB 2YV1A 3Q1LA 2HMUA 1HXHA 5I7VA 5KVCA 2VYND 3H9JA 4I52A 4YJHA 2ZYDA 4ZQEA 5JW6A 2VT3A 1P44A 3WQQA 1N6FA 2P91A 1Y81A 2VHZA 3OFSA 3GEGA 5BSFA 2J5SA 1B3BA 3DO5A 3I9OA 3F5SA 1J7XA 2DLDA 3SBOA 4HUJA 4KTTE 3LT4A 3HE3A 4IS2A 4YT8A 4EMPA 4JN6B 1IOLA 3W8FA 5K6AC 1EUCA 4AJLA 4CQMA 2HRZA 3U49A 4A03A 5TQVA 3E03A 1MB4A 1E6WA 2IEBA 2NQTA 3CEAA 3JV7A 3LVFO 4YVFA 4DYDA 2C8TA 2W90A 3STHA 3TFOA 1DFHA 2GN6A 1MXHA 3RIHA 2WD7B 1NQOA 3GVPA 2FSSA 3E5RA 1NBOA 3N58A 1GQQA 3GVXA 4B8ZA 4FNDA 1UZMA 3GT0A 4MINA 4FN7A 2Q2VA 2VCYA 4B8WA 1PJTA 2WDZA 1V0JA 1OZAA 3T3WA 3FNHA 2O48X 1BXZA 1U1IA 2EG9A 3NT2A 1H5QA 1F14A 4R4JA 5CG2A 3QMJA 1HDXA 3KTKA 4O1MA 5L4SA 4J9VA 2XAAA 2UUOA 2CSUA 3KSDO 3C24A 1LUAA 3KB6A 4U7WA 4E2XA 3QVOA 1D1SA 1LLCA 3DMYA 1P1HA 1NHGA 3BIOA 1T2DA 1SPXA 3EW7A 4BO8A 4CLRB 2B36A 2JCXA 3M1LA 3DTYA 5DP2A 3TPCA 3DB2A 1XSEA 4PLZA 3RUCA 1PQWA 3IJRA 3ZGYA 3K8ZA 5THQA 4QT0A 5IZCA 2QZ9A 1ISIA 1ZK4A 2C5EA 3GC6A 1W4ZA 3QHAA 4KP7A 4B7XA 5JYEA 5BT9A 3PHJA 3GY0A 3PQDA 3OJLA 1XX4A 1EBFA 4K6CA 3WOHA 1UDAA 3JQAB 2PK3A 5EINA 5FEUA 2FBMA 1E1KA 2ZCVA 3QVXA 1NX6A 5CDTA 4DA9A 2AQIA 1U8FO 2NM0A 5DBIA 3KTJA 5FIFA 1I3MA 4BOYA 4BB6A 3IL2A 1P1JA 5K9ZA 4ZU3A 4IQGA 3ANNA 3H3JA 2CUKA 3HDHA 3H9GA 4Y6PA 4IJUA 3FR8A 2A94A 5A9RA 1I24A 1D4FA 2Q45A 3PGQA 3QY9A 3UF0A 5FWNA 1BXGA 2AA3A 3JQ9C 1LQTA 1PJ4A 1HL3A 2HUNA 2VRBA 2Q3EA 1FDSA 5DBFA 3ZV4A 4ONEA 1WXDA 1UR5A 3BMOB 1KVQA 1LSSA 3PQFA 2Q4BA 3G64A 1GD1O 2J8ZA 3JQ7B 2ZB8A 3PHLA 4MIEA 4U0JA 4CQLB 3ZNNA 4CL3A 5JYDA 3NX4A 1XNWA 4ZRMA 3DZJA 3UN1A 5H82A 5KKCA 3HN2A 4KZPA 5JO0A 4Q0GA 2DTDA 1U3TA 1YKFA 3LDHA 5KTKA 2QG4A 3KYDA 5TF4A 1DOHA 3NYWA 1P0CA 4K9DA 4BGIA 1ZMOA 2GN8A 1VL6A 4KQXA 4ALLA 4D43A 3UHAA 1HDRA 2DAPA 1WMBA 2OMEA 4BS9A 3IB9A 3F1LA 3COSA 1YE3A 2VNAA 3JQFC 3Q1TA 4L8VA 3WWYA 3ZWWA 2NTJA 1GAEO 1IZ9A 2B4TO 3GA0A 4DIOA 1IULA 3ICPA 3KETA 3OQ1A 1C0KA 2ZJ0A 2JD2A 4FJWD 3RCBA 1JKJA 3FNFA 3GVHA 1B0AA 1BGVA 3EZYA 2YDYA 4L76A 2HCTA 3WBFA 2BRUA 5JE8A 4IZDA 4XRGA 1MXFA 3FWZA 3KLPX 5IAAA 1UUFA 1TEHA 4GKBA 3A06A 3U9LA 3VIVA 3LT1A 1R4MA 3RWBA 2YFHA 2Y99A 5E0SA 3TDKA 3MOYA 2Y1OA 3L6EA 4ZJUA 3ZWMA 2VOEA 1DC5A 3E82A 5CEEA 3AOEA 3B1FA 1E7RA 2P9EA 3FTNA 2Y05A 2WM3A 4BMNA 4CMIA 4W7HA 2VRCD 2NVUB 3WGHA 3WIDA 1NHWA 2X6TA 4DREA 4PVCA 1FXSA 1FDUA 1PWXA 5KVVA 2DBZA 4M54A 1L7EA 2G82A 5DP1A 1MV8A 4W99A 2G17A 4XJSA 5CTBA 4Y9DA 3E48A 2CF5A 2HKIA 3PFFA 1WLYA 4BMSA 4I5GA 5TC4A 3I9NA 2NU9A 3I47A 3H9UA 3D7LA 5G0TA 4NK4A 4EDFA 1KERA 2X5JO 1GTMA 4D7AA 4NBTA 5JS6A 4LCJA 5K6AA 1A4IA 2DPGA 2VT2A 4QEDA 4R16A 4IZBA 3JQFA 4CMEA 4ND2A 3ZWXA 4FJ2A 4E2YA 4F47A 1LDEA 3INRA 4E33A 3NDRA 3KTHA 4HFMA 5KDRB 2EHDA 4NJOA 1ID1A 3RU7A 4RLHA 3M6IA 4LVUA 4L4RA 3PWKA 4XEHA 1U5CA 3K2BA 3H5AA 1F17A 3LZ6A 3T4XA 5EL0A 3TZHA 4PLFA 2X9NA 3FRJA 1DCIA 1N7HA 3G1UA 2GERA 1A7KA 2X0NA 3F3SA 1FDWA 4DPKA 3HHPA 1TT5B 3I83A 4RVGA 1U7TA 3V1YA 5A1TA 4EMLA 2E48A 3KLMX 2D4AA 3RROA 2AEMA 3JYLA 3MT6A 5C7IO 1P1RA 3P2OA 4W9NC 2Y1EA 4R51A 3GG2A 1XCBA 3R9SA 5TNXA 3RD5A 3Q3CA 2GD1O 4E2WA 3IP1A 1GDHA 3ZWPA 1W0CA 2QYSA 2UVDA 4XGNA 1QKIA 1SOVA 5GY7A 1HDCA 5JDIC 1TVEA 2NUAA 1NR1A 3JD4A 3OP4A 3PHHA 1X0UA 3M6MA 4TMFA 3PYLA 2VZ9A 4YAIA 3WGGA 3EYWA 3GG9A 4J7CA 3DZGA 4TRJA 1LLQA 3CKYA 5FFFA 4HXYA 1IB6A 2W2KB 2DBQA 1MX3A 1T24A 2P9CA 3NTQA 4I4ZA 3ZWAA 4R9RA 4DQXA 1ZSNA 2C7GA 1BDBA 3JQ8A 3NKLA 4FGSA 2NV6A 3V2UA 3C1TA 3D64A 4PZCA 1DO8A 4XYLA 1GYPA 1M6WA 3WJ7A 1PSDA 2NACA 4XIJA 2VSUF 3LLSA 4RPLA 3S1LA 2QX7A 4U6QA 2IE0A 4C4OA 4NU5A 1HYGA 2ZL2A 1VC2A 5IKLB 2RIRA 4NG5A 1PJHA 4JCRA 3DONA 1SNYA 3V8BA 4BQRA 1D7OA 1XQ6A 2EEZA 4OHUA 3H6KA 5LCXA 1AE1A 1NFFA 1B2LA 4KUEA 4RVFA 5DN9A 4D3DA 5AXAA 3O8QA 2GSDA 2P4HX 3OIGA 1HWYA 4A7PA 3L9WA
chains in the Genus database with same CATH superfamily
4DYHA 4EI7A 1DAFA 4OL0A 4KHPB 3HYTA 2ECKA 3BSYA 4OH1A 2FWIA 1T15A 4QYTA 1B7GO 2FZEA 2ERYA 1I1HA 1WKCA 4INZA 3TECE 3HM9A 1DMRA 5DO9A 2V4MA 5JLAA 4M38A 4LKOA 2J5RA 4E7PA 3BXPA 5A5EA 2ZBPA 1IPHA 4Z6KA 3TM4A 1Z4OA 2AYXA 4ZI2A 1JR3D 4OXRA 4C0SA 2PRIA 4TTVA 1OC4A 3E1KA 4BNWA 2XYHA 3T7EA 3V7YA 3ABQB 5HR5A 2RHLA 2VNJA 1XDSA 2GHRA 4QYWA 4J0JA 1CUDA 2JGJA 4DCMA 1Z6AA 3EXAA 1T0IA 4UUNA 2BZ0A 3G0DA 2W83A 1V1RB 2O7RA 4EPWA 4LMBA 1P91A 1SUAA 1YONA 2PMCA 3B5JA 3DTVB 1E3SA 3EEFA 3FPHA 1AGNA 1E6LA 2XCIA 4WXMA 3QK7A 3X1YA 1QKKA 3M83A 4IIGA 1TO2E 1UJ5A 4C87A 4BO7A 5B36A 2Q1SA 1BOOA 3I76A 4DAEA 5FLKA 3CLSC 3B6EA 4ZAZA 3TOSA 1TX4B 1VL0A 2RHTA 3GAZA 3N28A 3OZWA 1KMHB 4FJ1A 2JFOA 1RMTA 1V9LA 3IMKA 1V1MA 3AR5A 5EYPA 4O8CA 3TXYA 2YR0A 4QDTA 4OXNA 4PGHA 3TL6A 4IVQA 4HEA1 1RQ2A 1T35A 4TUYF 3FWPA 4DG8A 3LY9A 3PE3A 4PQEA 2WYVA 4H7JA 5IRCD 5DCUA 3VR3A 4GL4A 1K75A 3HEMA 4H60A 4FFBA 1Y6FA 2LCFA 3DPIA 2E5LB 3X1JA 4ESOA 4L9WA 3OZAA 4HPXB 2WT4A 2VVTA 4DV4B 5J43A 2IXAA 4OQ4A 1GOTA 4HQNA 1RYHA 1HDGO 4WJLA 4Q9JA 5K20A 2YJ6A 1TTQB 3W6UA 1SBNE 3BN3A 1J21A 4EM6A 2NG1A 2D2EA 5AXBA 3OF2A 3WQHA 3FOFC 3HINA 2DBRA 1NVTA 3T8AA 1AU9A 3IEVA 4CR8A 3QE9Y 1PT7A 1X8LA 4ZV9A 5TQ0A 4I1IA 3RSZA 1P72A 2AN9A 5H59A 2ZJ7A 5CH3A 1RKVA 2AN3A 2QUJA 3PPWA 3ZV6A 4D45A 3UO8B 5FUQA 4JHLA 4TV9F 2ZQZA 3IPYA 4G63A 4OJKA 2XADA 3B7PA 3EDCA 1V7ZA 4C4XA 2PIAA 4H1UA 4JT8A 5B12A 1O08A 4FMCF 2QVYX 3E7PA 3HBJA 4C4ZA 3AW8A 1N3YA 3AXTA 4K6GA 5A02A 3BE8A 2Y67A 1AKEA 4ZAGA 4BEBA 4EJMA 1H0SA 1Z2PX 3HY6A 1UK7A 4QTTB 5JD5A 5AKYA 2D5IA 1UOEA 1ISSA 1OHHA 2WOOA 3QENA 3W6NA 5JROA 4MYDA 3VR4D 2KMLA 5KOIA 1V5EA 1ONPA 1Z2CA 1MIOB 2XYQA 4YONB 4B4WA 3H8JA 4NFLA 4DIKA 2PZMA 3ZD6A 2VSQA 2PMBA 4Z54A 2C94A 2V97A 2L2QA 3WE7A 2BTQB 1UDXA 2WJYA 4CIXA 3N86A 4DDUA 2BTOA 2GZDA 2WOJA 3CVVA 2I6TA 2J6HA 3UAVA 4FB5A 1UXHA 4PAWA 3N0XA 8GPBA 3I8OA 5T5QA 3JWIA 2BN4A 1Q11A 1Y82A 4UTPA 5K0FA 3G0BA 3A36A 2DFVA 2WAOA 4KYIB 1Y7OA 4X61A 1O6GA 1ICIA 4DMMA 1ZGJA 2FG7C 3FPBA 3ZLTA 2R7MA 3CZ4A 4MW5A 4YS6A 5BUSA 2I29A 2VHYA 5CIYA 5I9LA 4DR2B 1OZHA 5FAXA 1TG6A 4IQ0A 3Q3EA 3SEFA 4DG9A 2BMDA 1O4VA 1DQZA 3IDOA 1A9PA 1J49A 1YRYE 2VXYA 3EZGA 2D5BA 3HDJA 3PD1A 4HLCA 5EIWA 3RHZA 2AXQA 4O3MA 1M74A 2EXXA 4MVJG 1Z7GA 1IFXA 3EODA 4XASA 1RI3A 2O4UX 4AY4A 4BMZA 2RGGA 2R68A 5CURA 4QJ5A 5EMMA 1PF7E 5E9JA 2P2NA 4BV2A 4UDXX 4IINA 4D4MA 2ZB4A 4B79A 1GCUA 3X1ZA 2WICA 5JFTA 5CFQA 1CCWA 5DM70 2R0QC 4ZDDA 2QJOA 1EVLA 1X2BA 1CS0B 1XKTA 3OAAA 1YTUA 1TCVA 5AM5A 4N82A 2W5UA 2IBTA 4JQSA 3G0OA 1P73A 1JAIA 1UBUS 1PKXA 1AK9A 4XIYA 2QLNA 1V1JA 2OAP1 3JVUA 4XDYA 3DJAA 4JOCA 3TSAA 2VCHA 4M7PA 1SXJC 1GL7A 4IRUB 1C9MA 4WI1A 1PL6A 1RHQA 2ZULA 4RFSA 1VMIA 4MO2A 4TYQA 1G8GA 1ON3A 4B6SA 1NC3A 2Q0QA 1VBFA 4MW6A 5AIBA 4RMJA 3FBWA 1YBAA 3M34A 4J16C 5DIFA 3IERA 3MN1A 4FDTA 4L9RA 5AI5A 1HURA 4R8SA 3SS7X 1ABBA 4IUBS 4G0VA 3L7CA 4D5EA 4TRNA 2C5BA 2RH5A 5AIAA 4Z0TA 3SYNA 1XYVA 1R6DA 1E58A 1OBFO 3ZDXB 2ZITA 2I3BA 4AROA 5HIMA 1N0WA 4S1VA 5LBIA 3A7EA 2V7QD 3L79A 5AWFC 4BGEA 4F2PA 4Z99A 4DDWA 2FTKE 2I9PA 2JHCA 3GMTA 4BAZA 5KMGA 1PR6A 2O23A 4PZ0A 3G68A 1S9HA 4JP2A 4GXRA 4P4LA 1EDDA 1F8FA 4YREA 4EMBA 4HMQA 3NBAA 3NHUA 4LV6A 3OIDA 4C89A 4I3HA 3V2GA 4I36A 4YALA 1JG7A 1NJSA 2FK7A 3P20A 5G1SA 4QSMA 5I9BA 1BGWA 5IYZF 4XJTA 3VNRA 5ALUA 4QHYA 1MCZA 2OZKA 3S4YA 3V8NA 3GCZA 1GPNA 4RA9B 4P5EA 4RGQA 1JHYA 4E11A 3UICA 1AMUA 3QVGB 1ZU4A 1M54A 2CE3A 3L7KA 3VR3D 3S5UA 3B60A 4GR9A 4NCKA 2CJXA 4Q1BA 2UZ3A 3EB9A 3F2IA 4H3SA 4AN0A 3BUSA 1ZJ4A 1NNEA 1NV9A 3UT5B 3P8ZA 1G3UA 4B87A 5B4VA 4DTIA 4FGZA 2Q5IA 1XZIA 5BYKA 1XMQB 3JQ9A 5H80A 1TIPA 3A6GA 3C3YA 4Q4HA 4K9LA 3MQFA 1T4MA 4F92B 1ADYA 1A0OA 4WKCA 3HHEA 2JIOA 2DH5A 4BHTA 1QGOA 1VJ0A 4JBNA 1TUEA 4YCNA 3PNOA 1DBWA 1G6HA 3QUAA 2J6IA 2XXBA 1AZWA 1RCUA 1WCXA 4RGYA 4OGLA 3R7WB 3U4MA 4LQLA 2NUBA 3JD2A 1XLWA 2PPVA 3B2NA 3GRVA 5FOWA 4FFLA 2VSUA 4ZXPA 4J07A 3ST9A 1EGMB 3P2KA 4N0EA 1H6DA 2QZZA 2O06A 2YL2A 3BTOA 2ALJA 3DFMA 4NG4A 4O5OA 2DWUA 2BW0A 5I7EA 4PSAA 5IT4A 1OYOA 4DWJA 3SZGA 1E9DA 4OHKA 1XCMA 2ZRAA 4K3WA 1CJBA 3N9IA 4GOXA 4HVTA 1N57A 2QSZA 1EFVA 3LT5A 5EY5B 3PKIA 4LZNA 5EHGA 1U2DA 2K87A 2GDJA 4H77A 4IOMA 5HHTA 3B6KA 5SY9A 2VDPB 4XQ0A 5DB4A 1S02A 3IE2A 1Z83A 3IH5A 4GBGA 4WT7A 3TI7A 5MN4A 5CH5A 3VTAA 3MPOA 4WWHA 3S7TA 3E7DA 4RY2A 2CDCA 2OC9A 2FOXA 4DS3A 3FHCB 1DUSA 1RIFA 3H0CA 4KIWA 4OI0A 2IYFA 2OCBA 4HATA 4Q34A 3R9XB 3D2BA 4FS8A 1E9FA 3MUNA 5D51S 1LTKA 3GJ0A 4A0QA 5M29A 1NSTA 1Z37A 1P0IA 3T52A 3NG1A 4UNPA 1TU3A 3O21A 5CD9A 1H2EA 2PUGA 5L7WA 4MCJA 1M34E 1R4NA 4B4DA 5EJ5A 5E9QA 1THZA 2ZJFA 4A9AA 3NJBA 1O9HA 4URUR 4Z9BA 3GLHE 4P82A 3EEBA 1M34B 2YMPA 3KZOA 1TEVA 3S99A 3ZWXA 1E4VA 5CLJA 4RTJA 3ETCA 3ZVRA 1JHUA 2YNMC 3D31A 1TL7C 1H3NA 5GONF 1JTEA 2CXNA 4POAA 5B3AA 3UZUA 1PIXA 2VSSA 3TTTA 4CIYA 1K68A 2PX8A 4HPJB 1V3UA 5KSOA 4CMCA 1T91A 2IEGA 3K6JA 3OFVA 5E95A 2DUWA 2H3EA 3LD9A 5A2QA 1E9RA 1FRQA 4QQ8A 3B36A 3DE1X 3TLCA 3OESA 5TQ0B 4LNHA 2EFJA 4YY3B 4TL8A 2I62A 5B7QA 3BKXA 2FRDC 1XPJA 3QG1A 4M36A 1ZXLA 4BGUA 2AYZA 4WAUA 2QTWB 3W1WA 3H1TA 3O8BA 4LEIA 5E7JA 4CQLA 5JQGB 1JA9A 4RZXA 2ZJBA 4PHGA 2X8JB 4P9NA 3VR6D 3A8TA 1FFBA 1U4OA 3DZHA 2MT9A 4V39A 2R7LA 1E32A 2J09A 2J9ZB 2NO1A 2ECFA 1SC3A 1DAOA 4B4UA 4DUGD 5DLPA 1EXNA 1QNLA 4XQEA 2HQOA 3PQCA 1SUBA 2QRLA 3FB4A 2IRWA 3USZA 3X2FA 3KPYA 5DZKA 2ZYAA 3PFGA 3F0TA 1DBRA 2CDNA 4Y2VA 4XR4A 1RYEA 2WC1A 2FEAA 2GZ1A 4IDNA 5BR7A 4C0KA 2QTZA 3V4FA 1R4AA 4I2NA 4KH0A 2PA3A 4MLPA 2ZRLA 4YAWA 2YWBA 1CRPA 1LY1A 3PZRA 2WMNB 2VWPA 4AT1A 4NENA 2WSBA 1D2MA 4GBED 5AW2A 5BQOA 4MYUA 2QPLA 1FOEB 1T5SA 1VGRA 1RT9A 1SOUA 4FOLA 4ZHQF 1Y1SA 4YAEA 1NW3A 1Q50A 1FVOA 3HI4A 4V0RA 3TB6A 4D44A 4O02B 3OQIB 4LXTA 4OGFA 1Q21A 3IXMA 1OASA 2O2IA 4GX0A 5F7ZA 4A5OA 1DMSA 5SZJA 2R1TB 4DRZA 1UAYA 4BO2A 2IWRA 2SCUA 4OHCA 4A23A 2IDZA 3RKRA 3BWVA 4X54A 3ZV5A 4F3NA 1UYRA 1ML4A 3SGLA 1X2EA 1LLDA 3U3MA 1VE6A 5JNSA 1UOPA 4RF2A 4EAQA 3LTEA 5L4LA 4J4TA 4DA6A 1CV2A 1Q57A 2XQFA 4J6FA 4XGQA 1WXHA 1Z18A 1M2GA 5LYJA 4NH4A 1OLUA 4Z51A 1FRVA 1G98A 4FHGA 3CF0A 5BRNA 4FNGA 4AK9A 1B14A 2VBFA 4L22A 1E5XA 4E21A 2Y66A 1ZBDA 4MOWA 4MQUA 4RJKA 4TLCA 3ZWQA 3U7GA 2Y1CA 4C3ZA 1R5NA 5ALFA 5CCXA 1VKNA 3SN6A 4X90A 5AXDA 3VGJA 3R9QA 4DLRA 1YVEI 1L7MA 1N75A 2QR2A 4CN8A 4D3ZA 4ZO8A 2X2EA 5CYPA 4OAOA 4QL3A 4OXQA 3J7TA 2JGAA 3TD6A 4IXMA 1Y8RA 3OETA 4BFYA 1FJHA 1ZGHA 4EUNA 1RHMA 3ZY3A 2Z6VA 4EDHA 2R4TA 4N6OA 3AIOA 1NRIA 1TCBA 1SU4A 4DUPA 2VOJA 3JAMA 4ZVMA 1JE1A 1II8B 1T0UA 1GL3A 3DHEA 5DK6A 1CFJA 1HGXA 3N53A 3VKGA 1KRHA 1AQNA 5IUNC 3UJ3X 1DVRA 2VXOA 2WJIA 1JB1A 4YGXB 1PZMA 4YRBA 1NJ8A 3V4VB 1DBIA 3EOAI 4G26A 3WIEA 4MPDA 1PAUA 2GRJA 4Z4HA 1OFCX 1VKRA 3B8EA 5FP0A 1AHHA 1QB7A 4DZRA 2EFHB 2CVZA 2CE2X 3Q41A 5IS2A 4KD6A 3ECSA 1D9ZA 1DO2A 3BD6A 3SNKA 4O6VA 1SB8A 2J9FA 2O2HA 2XDQA 2D0IA 2H59A 3RM3A 2C0QA 4Y2HA 3HK2A 2GESA 5EE0A 3KEGA 4YK7A 1Y7TA 1QGZA 2B92A 1Y9DA 2DGDA 1KSHA 2XGMA 2A35A 3GDHA 4FZ3A 4P4SB 4Q7KA 3KRTA 5EMHA 4DMKA 1UBGA 3N74A 5DTMA 3R3SA 2GFQA 3D3WA 3KAQA 3MOSA 1JLHA 4UUOA 3O8CA 1SA0B 1FNBA 1J0EA 3MQ4A 3UXYA 4EQ6A 3KQFA 2EX4A 1KKLA 4YP6A 3OX1A 3QVWA 3Q7SA 4HF7A 3Q3JB 1U8ZA 2PL5A 4KXQA 4FPXA 4BUZA 3L1HA 1LW7A 2VBCA 4MAFA 5E0SH 3INTA 2X24A 4PONA 3EIEA 1KQNA 1V7PC 2YHSA 1PS0A 1SKYB 2GCOA 3I6QA 4H0FA 4NTZA 5DL1A 2C84A 2P2YA 3NXKA 2JIDA 3H65A 2WHPB 3R7SA 3S2YA 3UJAA 4MDFA 4KG7A 1P9RA 2NU7A 3B20A 2GJ9A 3P9IA 3QNUA 3BMCA 3THWA 3AP3A 1VDZA 2JK0A 3W6ZA 2C5HA 2FR8C 1P29A 3OOJA 3PEAA 2JJMA 4EX7A 3U9TB 2NSHA 3W3AH 1ZH2A 4F3KA 3RFXA 5E7MA 4JC8A 4W5OA 3SC2B 2OD2A 1JILA 3TW8B 1QQTA 4JYLA 3WSWA 2PBLA 2GZ2A 4R5HA 1LRLA 2GNPA 1BXRB 1MPTA 1YBFA 2WFZA 4Q12A 1H0KA 3OM8A 4ZREA 2ONYA 3OZUA 3ICEA 3QREA 1GTZA 4LQCA 3QBJA 5B4TA 3T5DA 1QAMA 4HRVA 1FFDA 2ZZNA 3CZPA 1ZA2A 3TSCA 3P9YA 1P3JA 2WRZA 3NATA 2QX6A 3L2OB 3AB3A 3NOXA 1P7WA 3AY3A 2R62A 3ZCSA 3BRWA 4GL2A 3IAXA 4HB0A 1ATZA 1J4AA 4YBZA 3C70A 3DE0X 4IDDA 8ATCA 1S96A 1RWMA 3WTCA 5C52B 1W52X 1QFZA 3D4LA 4UCXA 4EIWA 3NKVA 4XCVA 5CA0F 5TEVA 2OVFA 5J1TB 4PO1A 1H6AA 1PJQA 4EGCB 5JC1A 1ACLA 3E15A 4TL6A 5HE8A 3FNGA 4NECA 1SBTA 1P2TA 1RYZA 2IUYA 4PQRA 2JJ1D 1NMSA 2X4IA 3CE6A 4N40A 3M6LA 4DR5B 1DC4A 1QORA 3UG6A 4BVKA 1TCCA 1UC9A 1WSAA 4JKOA 1XG5A 3HWX1 3VSBA 2VDWA 5CVTA 4JDUA 4RVDA 1P39A 4JD5A 2UUPA 2YV5A 4ENPA 1M0SA 3RIGA 1PSZA 1IBRA 3OECA 4TOIA 2BH9A 2G71A 1L7BA 2YV2A 3D5QA 4REQA 2WT9A 1OV6A 2JAQA 3WGLA 4BQIA 4MVJM 5CBKA 4M0KA 2JASA 2ZJ8A 3ADOA 2FN8A 1A96A 2QPAA 4WXRA 1JYEA 1P9NA 1CT9A 3UMJA 3UKJA 3ROQA 4JGIA 4YMGA 5CITA 5IWCA 4A0FA 3LSTA 1UP6A 3N07A 5ARDA 5JWRA 3PPVA 4N1AA 1P5JA 2XMDA 2JIZD 2WHEA 2EWMA 3PPXA 2WTBA 3IXLA 4G5HA 5JALA 2ZB7A 3ASUA 3FWKA 5KNDA 3TSZA 1DCMA 3B3JA 1I3LA 2ZVQX 1EK0A 2C58A 2PFSA 1Q0ZA 1G9TA 1UBFA 2H63A 3DUWA 3IP8A 3B53X 3H2SA 4HEJA 4PCVA 4UEOA 4BMVA 1WZ8A 1E2BA 5B55A 3L02A 3RC9A 3QNMA 2QLTA 2HMVA 4S05A 4WZAB 3OG9A 3MCZA 4R8KA 1UFOA 3HJGA 5HK8A 2Y71A 5JY1A 4OP2A 4TXLA 3QVLA 3R24A 3U7JA 3OUTA 1Y63A 3MW8A 4OMUA 4C4AA 4TYYA 4QDKA 4B47A 2EYQA 1QF7A 3OO1A 1R0SA 4BO1A 4LF8B 1N6DA 5G0VA 4EHDA 4DT1A 5ECWA 4ILEA 1YG8A 2IA5A 4MV7A 3BFPA 3R9WA 1ZD1A 3GGGA 3AKCA 1QHGA 3GGOA 4XJVA 2P4EA 2JFFA 4AKHA 2BDEA 2DG2A 3DGFC 3WNVA 1MQ8B 4S1PA 3A4NA 1QBKC 5JVDF 5AKGA 2GARA 1I7DA 3SFZA 3H0UA 4XQCA 5FTJA 3T1YB 1K27A 2DHQA 2VPYA 5PNTA 4BE9A 4D8YA 3QWAA 4RXTA 1Y3HA 4MW1A 4QASA 2VNKA 1LLUA 1JLRA 5FPYA 1ODIA 1U98A 4JX8A 1XTQA 4ZVOA 1A3CA 2OXTA 3RFVA 4ZVVA 1XNVA 1FS5A 2CDBA 2M1ZA 4CTJA 1Y9ZA 2VJAA 5JASA 2ZYHA 4Q9HA 1FIUA 1E1LA 4MV0A 3PNYA 4XPIB 3KHKA 1KRXA 4I81A 4KFTA 1BXKA 1TVCA 1E64A 1TF5A 1GPDG 1IUPA 1XYYA 2KBEA 2SCUB 3DDUA 2NUTA 2ANCA 3QX3A 1L4HA 2C31A 2PD3A 1FQJA 2XUIA 1Z7WA 3Q5GA 1LJLA 1BEEA 1DKMA 4JJZA 3DT6A 4TUYB 2OUKA 1KSGA 3BJZA 2QN7A 3QU5A 3UGKA 3UMSA 2UKDA 5EVJA 3BDVA 1M5UA 2HFKA 2NSDA 3G0CA 4II3A 2CUTA 3ZGOA 3GLFE 1A9TA 3ZXSA 1LV8A 3OJ0A 3PZBA 4XX0A 1RKQA 3SF8A 4B71A 3ZD9A 4Y1EA 2J3JA 3KZ1E 1QZXA 4S2UA 1ORHA 3FYSA 1NG9A 5C7IO 5H3CA 2FE1A 5IF3A 2VQSA 3WMGA 1TPZA 3K4PA 4BZXA 3ZUPA 1IXRC 3RNOA 4GRDA 3QYPA 4JLMA 3AF6A 4KJXA 5DSZA 4YBRA 4AFNA 5EMJA 4J1TA 4C4YA 3O2QB 1AA9A 1M9NA 1YI1A 2FPKA 3F4BA 2WTXA 2ZTLA 5BW5A 1GZ4A 2GAFA 2B1GA 2JRCA 1KEUA 3I73A 4ZPXA 3HA7A 4I4TF 5AHXA 4FYYA 1D2EA 5B4UA 1KWGA 1JAYA 2FFHA 4ES6A 3MNFA 1RACA 2XWJI 3P9KA 3PKZA 4QHTA 1OI2A 1UXIA 3NVMB 4QFMA 2D0DA 2VAPA 3IS3A 2H0QA 4FNBA 3UATA 2CC2A 4YP7A 4G07A 1IAVA 3R8FA 3GUHA 4NLLA 5J5VA 1QBGA 3LBYA 4M0DA 1ES9A 3IT2A 4PTZA 3VBCA 3REGA 4WXEA 1A7AA 1E0DA 2Y1FA 1YG6A 4YEDA 1G8MA 2A88A 3GFOA 3M4YA 4MYCA 2XNSA 5HKAA 1Q83A 3MMXA 4KO3S 1BS9A 3H4VA 2VHEA 4KXNA 2YYYA 1T0BA 3BCSA 3OOHA 2YZ7A 3IAAA 5HFAA 4NCAA 1ZMTA 2DB3A 2ISQA 1E3QA 4ZODA 3LS2A 4PWZA 1HDIA 1VHJA 3W79A 4ETMA 3ZDDA 4DB4A 1GGMA 1NJGA 1UT6A 1XDWA 2IU3A 1PFGA 1E18A 1M83A 2AFIB 3EXFA 3HNRA 2JRLA 2HCJB 2HB6A 3DOIA 3KT8A 4GT1A 5ALKA 3TIVA 1R0LA 1AMOA 3NV9A 3MJHA 2J41A 3RRVA 1XAJA 4NAUA 5H4GA 4HWRA 2WYWA 1MFZA 2ACWA 1U8YA 4FDAA 3T3DA 3IV9A 4RDHA 1PV4A 4RTQA 3K5IA 2WF7A 2VHXA 3OO0A 4MVJE 2BFOA 2R6GA 4YWJA 2AZDA 3A1FA 1ZX1A 4IFTA 4ZT4A 1C81A 3AJEA 4IJQA 4BVLA 1XO1A 1Z75A 3G2JA 3RS5A 2ZR0A 4QYIA 1JFSA 2H1SA 5C37A 4BE4A 1VLQA 4F04A 2B37A 1C9NA 3HLYA 4TSFD 3FSGA 1L5HA 2FN9A 4EEZA 1NVAA 2W58A 3OKCA 5KJFA 3BWXA 2B3DA 3EHEA 3EQ7A 1GT6A 2A7XA 4AO6A 5DTIA 2BZRA 3AFIA 2HPZA 4FFVA 4WDQA 5CFZA 1W46A 1X7WA 2WU1A 5DE3A 4DIUA 1E2UA 1U81A 4MQEA 3STAA 5JSFA 5J2UA 1UBMS 2YC4C 4GPTA 4B3JA 2VLBA 1N5LA 4W5HA 4YJGB 3V1MA 3BZBA 2WIFA 4YAFA 1NUTA 1ILEA 1SUFA 2VC2B 3U1BA 1ISGA 2E4ZA 2HFJA 5ITZA 4K26A 4TKUB 3NGMA 3H0QA 5JR3A 2XE6A 2JLQA 3OHMA 3Q0EA 2VZ8A 3I9LA 3DE3X 4FLEA 5HZKA 3PGMA 1R4ZA 5LL6P 4BDTA 1RRVA 4FE4A 4HRXA 1HR0B 2OWEA 4ZAFA 4JOQA 2IFTA 2BEKA 3HN6A 1DE0A 4B9AA 1PZFA 2ZROA 4F60A 3A14A 4Z9AA 3ZZNA 3BL6A 2YWGA 3DEJA 5DOVA 4AWBA 3TLBA 1MC5A 4JJ7A 1RKXA 2B9EA 2JCVA 5LYYA 3ORSA 1FSFA 2L42A 3GARA 2ETVA 5FFMA 4HDSB 4I6JA 3KQPA 4BVFA 3EF1A 3QVKA 1P0QA 4BFVA 3W34A 5JI3E 1JFTA 4IX9A 4NBSA 1DEOA 1HZZC 2P6MA 2ZE6A 3K35A 3ZTYA 4BP9A 4ZYZA 2IYVA 1G3MA 2B69A 5LU8A 1HT3A 1QYWA 4I6GA 4GVPA 2CHVA 3A3YA 5IH7A 1RM4A 5FA8A 1EMDA 5JZ9A 4H3HB 4DJ5X 2FP3A 4Y7CA 1CVRA 1KC3A 1Z6GA 3AR4A 1QQ7A 3GVCA 3QH4A 1YUBA 4FVTA 4CCAA 4M0LA 4CU5A 1LF5A 1QO9A 4JJIA 3GGJA 4F84A 2IS2A 2Q5CA 4G81A 2QAGC 3DZCA 5KDRA 3PGA1 4N9WA 4ERXA 3D4PA 4YJHB 1QGAA 3BE4A 2VZLA 3FDJA 3IHWA 4MW2A 5G53C 3D3WB 1Q3HA 1YRWA 3K30A 4R8RA 4O2AA 4CFSA 3G5TA 2I67A 1PEYA 3SJ7A 4MXIA 1DBSA 2ZS8A 1Y1LA 1R9MA 5CFOA 1JI3A 1C9KA 2I6XA 5JBNA 1FDIA 1ZO8A 1WVGA 4NEQA 5LMUB 1XHLA 1FZQA 1VL5A 5TV2A 5JARA 5IM4A 4BKQA 3SSNA 3LGSA 5FWDA 4MUGA 4ND8B 4QFDA 4LSMA 2Z5FA 1KYYA 2JFUA 5SZIA 3P5SA 5HQJA 3WLIA 2B82A 4EKNB 1ENOA 5SYNA 3EY9A 3U0VA 3AESB 4D46A 3VKUA 5F2OA 4S3MA 3AG5A 1VP9A 2MIIA 3KZCA 3FZNA 4G67A 4J91A 1NAIA 3HUTA 2O8BB 3HSSA 3ABRB 1I33A 3QVVA 4EUFA 2XITA 3KPUA 3R5KA 1YR8A 2GK6A 3RHFA 3STVA 3I23A 3U9TA 1YQXA 1ZD9A 4N49A 1LDGA 3E35A 5ER9A 1LI4A 1ZRHA 3AUAA 3KKPA 5DIZA 5C8DA 3GJSA 1WZNA 3C6ZA 2DM6A 2DJ5A 1E4YA 2VDWB 3DLCA 3GIWA 4FONA 4G8DA 4OHYA 3NCHA 3FOZA 1IZ0A 2R8YA 2B8TA 4H7IA 3U7IA 5ESWA 1NFRA 3SQNA 3HP7A 2WUEA 2R44A 4FFMA 3OT1B 4E5PA 2IX3A 3O4FA 3N7TA 5DX0A 1U1FA 1QS0A 1LXCA 2X0FA 1MGPA 2JIRA 1WSWA 3KKZA 3C16C 1CQXA 4V38A 4X6XA 3UK2A 1TU4A 1YQ9A 4KPFC 1YMVA 3C3XA 4EFKA 2JARA 2XZOA 1RQ7A 1UFVA 2XF2A 1CD5A 2GM3A 3ESAA 4TTJA 2IJGX 1G8YA 5FLYA 3SMQA 1VE1A 3HCPA 1Z3IX 4ZI7F 1EK5A 2RGNA 4RA6A 3VUFA 3JARA 1XHEA 2FSVC 5LVAA 4R9SA 3RV4A 2K7FA 2CFTA 4ZDCA 4V3BA 1B8OA 1PR9A 5KOHA 1D4OA 1KZYC 2WW8A 1IPEA 2DC1A 3PCTA 2IEAA 5AK4A 5EIBD 1X9GA 2ZRJA 1CS4C 1G55A 2ASEA 2ZI4A 3LIIA 4JGBA 1AG9A 5IDYA 3WP0A 2RHGB 4X3OA 1LDMA 3DQPA 2XZDA 3I6MA 3I9V6 5JMPA 5L51A 2BELA 4O8ZA 1ORDA 2WE8A 3AHJA 4RWEA 3AL3A 1H1DA 3BG5A 3S70A 4QREA 1FFHA 3D4BA 2ES4A 4PLCA 3RC2A 3FNIA 5K51A 2FMUA 2G6BA 2PKEA 3L8FA 4I1RA 4YRIA 4QTUB 3MQ2A 1R0RE 1ENPA 1CF4A 1Z0DA 4QJ3A 2I54A 3FE2A 2VTDA 3S6JA 1U2EA 3DZBA 4QZVA 4HL6A 2QGZA 2ZZKA 2I6QA 2NO5A 4YCAA 3R7BA 5IAEA 1NJFA 3L77A 3QW2A 1JIQA 3Q9UA 4RY8A 2P3SA 3BGWA 3SKYA 3CA8A 3FAZA 5SY6A 1DRWA 4B7CA 1UPBA 1U0SY 1JX6A 3D59A 4DMRA 3F9IA 1X7ZB 3L18A 1XP8A 3HJAA 2FX2A 2PGNA 3HZOA 1KAGA 3PT5A 1XZQA 4H7DA 2RCNA 1QH8B 1KQOA 2OO7A 3KX2A 5K3OA 2V3VA 4DLSA 4UHCA 4XKJA 1WW2A 4OQQA 4ZI5A 4BLQA 1D1TA 4JH0A 2PSFA 3ZQJA 3IT0A 3W5UA 1XQXA 1A8PA 1JN0A 1Z2NX 2ZP1A 5KJ1A 3VISA 3ESCA 2IYSA 2EL7A 4HWTA 2JK1A 5DBEX 4JCQA 2GM5A 1Y1KE 1YK0A 2JLZA 3LHIA 4IX1A 1XBTA 4M21A 2IY8A 1UBRS 3RADC 4TV9A 1BHO1 3EZ7A 3HMQA 4JJ6A 4KNYA 3OU7A 5LDHA 4URZR 2ZJ3A 4A27A 3HCCA 4B43A 4EG8A 3M9WA 4BZPA 1N5MA 3T5TA 3KAJA 1WPXA 3QJGA 5C1OA 4BBJA 4WIAA 3FJOA 4XWKA 2HLPA 3IQZA 3M8KA 1TM3E 4AQYB 2G07A 2QVCA 3TDNA 1N3LA 2O4CA 3QLUC 4BKOA 1WU8A 3PWTA 3OZTA 4HTFA 3CR7A 2J08A 3OT6A 4KNPA 4Q24A 1I80A 2PG8A 4C76A 2PLNA 2ZJZA 3E81A 1OFUX 3FOWA 3F4LA 4BX8A 4F7DA 3PB3A 1VPTA 3HN7A 1NI4B 4IBOA 4W1PA 1JNYA 2OD9A 1W47A 3SFVA 1USGA 4OH7A 4BO6A 1XEAA 5FBWB 2D1RA 1TFRA 2D06A 2XGOA 3NTRA 4HWPA 5EWMA 5LR6A 4GPAA 3LYAA 1E1NA 3JSAA 1NR5A 5HYVA 1ODTC 3ILYA 4GG1A 5U9CA 2DMRA 1J5EB 1SKBA 1VHTA 2RE8A 3UAXA 2ICAA 5FDFA 2IYYA 1B1AA 4NV0A 2X3FA 4O1IA 1P17A 4BB5A 2FZKA 5FV4A 5F77A 1RAAA 1T4DA 3FSJX 1RXVA 4TVBA 2BFEB 5I9NA 3L4BC 4RX1A 1F6WA 2A78A 5AKEA 3REOA 1Z4MA 5LQRA 1K0UA 3BWBA 4OBXA 2P5SA 1IHDA 3GUYA 4LHXA 1N7JA 3W04A 2IIPA 1GNTA 2FZVA 3ET5A 4UMEA 1P1BA 4EZIA 4C2BA 4X1IB 2IUTA 3V7UA 3FHJA 3OUUA 1JMYA 1PE0A 3VDQA 1K2VN 1L7QA 4O3FA 3RANA 1DG1G 4IM7A 1UEJA 2WQZA 1O94A 1YB4A 1G1AA 1DUVG 2DHEA 2LW7A 4DLPA 1NMXA 4YAJA 2P3OA 5K3CA 3F7MA 5HM6A 2QNIA 4TYMA 3A1TA 3CNLA 1A82A 3EA0A 1BZYA 1EX6A 5B1YA 1JWLA 3SSAA 4EUHA 2C9CA 3B1ZA 5C1IA 3TL2A 3K0EA 1ECPA 1WUYA 3BWMA 3HYLA 2TS1A 3D4NA 2AOTA 4ZDFA 4NDZA 1A2BA 3V1UA 2GK4A 4PZZA 4BLVA 1LGYA 3PUXA 1G8AA 1ISRA 3H4TA 2Q7OE 4GZ3A 3U4QA 1OTXA 3OE5A 1M2WA 3EIXA 3A6ZA 1DO0A 4C7OB 1E1QA 3ROTA 1A9YA 3PGJA 3TPZA 1CUGA 1PW7A 3C87A 4JR2A 3KD3A 4EA7A 2F8MA 1WZIA 1ZJYA 2PT5A 4QBGB 4XVUA 1IY0A 1FTYA 3NJ8A 4MQBA 5EQJB 5K6RA 1L4YA 3EULA 3R3HA 2VS1A 4MRRA 2Q1YA 4X62B 1MP0A 2CMDA 3MJRA 4CFZA 1P7PA 1G5TA 2WHXA 5LOVB 3KC2A 3VKHA 3PL5A 4WY5A 3OPYA 3RU3A 3KM0A 3DV9A 3I30X 3IAHA 2BHRA 3DNFA 4DY6A 3K1AA 5KNCH 5IWAB 2A9KA 3PXBA 2HT1A 2JD1A 3G02A 5MF6A 3AL0C 1HT0A 1NRWA 1QCDA 1YVPA 2EQ5A 3RG2A 3BICA 1D3AA 3EFHA 2J9YB 1I2CA 3E1SA 3ELYA 3QXGA 4PFSA 4YJ3A 3C3JA 3ZKWA 4QBIA 1IHYA 4A6DA 5K8TA 3NR2A 3NAMA 4HYYA 4P5DA 4ALNA 1L4UA 1QPGA 3QFFA 1T3HA 6GPBA 2EZ8A 1WPGA 1LPPA 1XZFA 2QPOA 2WBLC 1OCEA 2KBFA 4WGGA 4B6EA 4PGAA 3KKLA 3OH8A 4GI7A 1MABA 4DDTA 2G0NA 4URFA 2X41A 3KOXA 1A50B 4F5EA 1JXOA 4NAVA 3SHFA 3X1MA 2Y0DA 2WZBA 1Q1QA 3ZR4B 2QP9X 4OXXA 2VSOA 1DJPA 3ZDAA 2ORVA 5T41A 1PDOA 3WIUA 3FYHA 2FJUA 4B3IA 3HZHA 5D2CA 1OBCA 4LMAA 3BMNB 5K0EA 4QVIA 4MQFA 2QLLA 1ZJWA 3NFRA 5D3MA 1U28C 5TVKA 2FU5C 4FHEA 4P3NA 2BI4A 3EVGA 3SM3A 3T5GA 3TFQA 1LV7A 1U7ZA 1BH6A 1U9ZA 4JJFA 4V0NA 5F12A 5GM2A 1SBYA 3T9DA 1JS1X 1GHTA 4X20B 2I7DA 1IM2A 3NORA 3RWMB 1DWUA 2GKGA 2ZUWA 3QPWA 1Z4PX 3NGLA 1TLFA 4JLWA 1LK0A 2FDRA 4P36A 4EW6A 2EBHX 1H2AS 3AR6A 2I3ZA 1BMQA 1E7YA 3DOJA 4IGFA 3OIFA 4OFWA 5JHGB 2IS1A 4O2AB 1N2CB 2B61A 4WA7A 1ISJA 3PR2B 2VPWA 3SYMA 5DU4A 1LK7A 2CLOB 3LC0A 3B3GA 4RA9A 4ZOEA 3JQ7A 1XR3A 4LCBA 1RWKA 3N3AC 1FMCA 4Q4AA 5LDGA 4PG6A 3W9UA 1LTHR 5HFNA 1T0HB 4IWNA 4MP8A 4KIJA 3CBQA