3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
1NWHA 3PYLA 4QXMA 4DIBA 4FDAA 4JP3A 2ZQQA 3RFTA 4YJFB 1MP0A 3SC4A 2WWRA 4Y6PA 3ZU5A 1GZ6A 3BTOA 4CODB 2Y05A 2VHYA 1C3VA 4J9UE 5TIIA 1H6AA 2D2IA 3AW9A 2IEDA 4J43A 4NFHA 4NIMA 3E48A 3OQ1A 5FI5A 3BMOB 1CYDA 1NR1A 4K28A 1P1FA 1ENPA 4R9RA 3CTMA 4A73A 1DIGA 1LDNA 4R01A 3VH1A 4ZD6A 1DDOA 4Q9NA 2VNSA 2ZATA 4CR7A 1NPYA 4N18A 4IMRA 4DIOA 3DMTA 2Z5LA 3H5RA 4A0SA 4PIVA 4ND3A 1ZUD1 3DOJA 4N54A 2FRDA 4LSWA 3PLRA 4Q3AA 2IXBA 6LDHA 4GX0A 3DONA 1RM0A 2EJWA 3MOIA 2VZ9A 3BMQB 4E6PA 1JQBA 2X0JA 3SX2A 1GQYA 1KEWA 3U4IA 4RF2A 3O4RA 4CM8B 4QFDA 4EI2A 1MFPA 1DJNA 3ZH2A 3VZQA 5CEFA 2BFAA 4FJ0A 2ZQRA 3IKVA 2TMDA 3E82A 1I0ZA 3GVCA 5TS3A 3BMNA 2Y0CA 4RQTA 5JMPA 2X23A 1K89A 4D42A 5DTPA 2X0RA 4WEOA 4PZDA 1Z7EA 1BMDA 2UYYA 3E6AA 2DLDA 1LTHR 2D8AA 1B8UA 4B3HA 3RBVA 3UKOA 3H0UA 1I3KA 2NWQA 4CM9A 4FZWA 2BH9A 3KQFA 2ZKLA 5DBIA 4WNCA 4WLOA 2VHXA 3OJ0A 1HRDA 1K6IA 4PVCA 3ST7A 5DZKA 2GUGA 1K3TA 2AQHA 2PLAA 2J5IA 1ZKMA 3WTCA 4BL5A 5KDRB 4XYBA 2QG4A 2FZWA 1AHIA 2X9VA 5JCJA 2HAEA 3NEPX 4FBGA 4ZQEA 4RF4A 5HM8A 1DC4A 1Q51A 1TLTA 3B1FA 4LISA 4JFCA 4UVHA 5JDIA 4BO4A 1O8UA 4URFA 4XDYA 4BNVA 1NM5A 4CLHA 3U5TA 3FTNA 4RVFA 2PNFA 3KV3O 3LQFA 4NNJA 5T6BA 1EK6A 3IP3A 4NBVA 5CAEA 2B69A 3RUFA 2PGJA 3C24A 4DMMA 1U2GA 3PYXA 4ID9A 2E49A 3F4LA 1E7MA 4YT5A 2YYYA 3RUEA 2CVOA 4R1TA 1JAYA 1DEHA 4JCOA 4L9RA 4Z3KA 1K6JA 2DEOA 3P85A 3R9TA 4JYLA 4GWKA 1I30A 2I65A 5DNAA 4F3YA 1X0UA 1LU9A 1T2CA 1ISHA 3JD3A 3PJFA 2CF5A 3QVXA 4EEZA 4J4TA 3Q1TA 4UVIA 3I6IA 3DFZA 1IZ0A 4CQMB 3T3WA 3UN1A 1UP7A 3D3WA 3H9UA 2A9FA 3G49A 5JC1A 4M86A 4PG5A 3JYNA 1LRKA 5HA5A 3GFBA 4J4BA 2JCXA 4GLOA 2W2KA 4AJPA 1ZZEA 2JAPA 1X13A 3M2TA 2W90A 5T8KA 2JD2A 3DZBA 5HS6A 3QWDA 4OO3A 1P1JA 2X6TA 3DBVO 3ZN2A 2Q99A 1MGOA 2EEZA 5ES3A 4ROSA 1QMGA 4BGUA 1A4UA 1E1KA 4B4UA 3U62A 3Q9NA 5CFZA 1H6DA 1I3LA 4R5HA 3F46A 3C85A 1P1KA 3FWNA 2FHSA 3H8VA 5G0WA 4ND2A 3DXFA 4NJMA 1HKUA 3AJRA 3UVEA 1YONA 4JJIA 4OMUA 4GX1A 2Q4EA 4J3FA 1ON3A 1VSVA 1Q0LA 3CXRA 4XR9A 2FPIA 1LDEA 2VT3A 1U3TA 3PEAA 1HEUA 1PJ4A 4IDFA 1LDBA 1KVSA 2PKQO 3TDCA 1XGKA 2NQ8A 4NBTA 3ZU3A 5AQ1A 2AHRA 1N9GB 3DC2A 1QRRA 5A3VA 4OXNA 4DUPA 1ZSYA 3QXIA 3EDMA 3B1JA 4GH5A 1LJ8A 1P31A 4L4SA 4OYRA 5JBIA 4L73A 2PA3A 2IZZA 4AJOA 5COAA 2CDCA 3BHIA 5KVCA 1MG5A 4QX6A 1KC3A 1R0SA 2AE2A 2VSUF 2OGUA 2X1HA 1E1NA 1DAPA 3PJDA 3K73O 4YRAA 1JU9A 1G0OA 1HTBA 4NDNE 1YB4A 4RVDA 5A05A 2GRAA 4OKNA 3VZRA 5IDQA 1PZFA 1FC9A 5CP8A 1H9BA 2ZJ0A 4ILKA 4CMKA 3TF5A 2ZYGA 5JAMA 1E3EA 1OD2A 1JAXA 1NFQA 3ZV5A 4F6LA 3U9SB 3GHYA 3SEFA 4MVJH 1E6EA 4P22A 1MC5A 2NSDA 1V3VA 4PLPA 4DPMA 1HDYA 3BIOA 2YY7A 1SB8A 2ZYDA 4BO3A 3DFUA 3H3FA 1CWUA 1OAAA 3FI9A 4W6ZA 4R51A 4DPKA 4EJ6A 4HFJA 3OQBA 3KETA 1QP8A 4LVCA 1BXZA 1G1AA 4OGWA 4XB2A 4UREA 5C7OO 2WD8A 4IZBA 5I8WA 4R16A 3WLFA 1K32A 1RKXA 2DUUA 2HK7A 1T1SA 3QQPA 3ULKA 3BZUA 1LLUA 1SBYA 4BNYA 3H81A 2EGGA 2Y99A 2GZ3A 3SLGA 2VUUA 4YXFA 1E3JA 1TT5A 3BXXA 2PH3A 1IOLA 5H83A 3GLMA 2DBRA 3MCVA 4M1QA 5DCWA 1B3RA 3KYDB 2QQ3A 5INIA 5IXSA 3I1JA 4MVJE 2GLXA 1A4IA 4FFOA 1C14A 3ZWCA 3MZ0A 2ZIZA 3DZKA 4IPTA 5JDCC 1V8BA 5A5FA 3WR5A 5DN9A 4PZCA 4ZQHA 4C7KA 3ZWYA 3VPSA 4U0KA 1JDJA 3R6DA 2P2SA 2CVZA 4DLBA 3H0SA 4R9SA 5A5EA 3AUSA 3M1AA 2OOSA 2AXQA 2RAFA 1CIVA 3VTZA 3OP4A 1H2BA 2OP1A 3U9LA 5A03A 4RVGA 3ZHXA 4YTEA 4RL6A 1MV8A 2I6TA 4LN1A 4XR4A 2H63A 3I83A 4JLWA 3ZWXA 1UYVA 3QWBA 5F1OA 2HRZA 4J1SA 1C1DB 1UXGA 3PDUA 3WSWA 4AJLA 5DTWA 1IUKA 3G1TA 4I5DA 4BVAA 3A06A 4II3A 1J6UA 1XNYA 2PZLA 3OEYA 3QHAA 2HMTA 2YHIA 4LMRA 4A2CA 2JFFA 4R1NA 4CLXA 4BO8A 4XD2A 2H5LA 5K0ZA 3FR8A 3L4SO 1E3WA 3C7AA 4A27A 4BO9A 3JQ6A 5EMHA 4JJFA 1YG8A 2F6IA 4WZ8B 4GMGA 1U8FO 2YFQA 4CM4B 1DLIA 3TQHA 3I9OA 4YAEA 3ZI0A 4Y6RA 5DCUA 3DZJA 3LF2A 4FOOA 2ZB3A 3AOEC 3G79A 4O59O 1F17A 3U4DA 5CDGA 4HC8A 5ITVA 1K0UA 4GVXA 4Q3EA 1I3NA 3JCZA 4ITUA 2XPCA 2AEJA 4UUOA 2GZ2A 3HDHA 4RPHA 1P0FA 4YCAA 4MVJP 3T89A 5F3RA 4RZIA 5B4TA 3ADPA 4D7AA 4ZQBA 3JQBA 1X7GA 4YB8A 4FFRA 2A94A 2J5RA 1XLTA 3QSGA 1AUPA 1GY8A 5ENVA 3S1LA 4B8ZA 4Z0TA 1KEPA 4YPOA 4B3JA 2VTEA 1Q7CA 1MXHA 4YT2A 4INAA 5EESA 3GR6A 1EEHA 1P33A 1YGYA 2Q2XA 3CINA 1RYDA 4YT8A 2GASA 3GVPA 2HMSA 5B4UA 2O50A 2OBNA 2Q46A 2POQX 3FTPA 3QVSA 3SJUA 1UYSA 3RC2A 3VH3A 4GVLA 4Z0HO 4BUCA 1CRWG 1QYCA 1HDCA 2HMVA 2R00A 3E5MA 1Y8RA 1UDAA 2ZJ1A 1YVEI 1GUFA 3EZLA 3PGXA 1ZMTA 1E5QA 1QSGA 4NBUA 5DCYA 4FN4A 3HADA 3ROMA 1U9JA 2NTNA 1GPDG 5KJ6A 3DZGA 1VL6A 2ZTMA 2Q3EA 4W99A 1E6UA 1M6HA 2HQ1A 3L77A 1O89A 3JYLA 4RPJA 3ETEA 2C20A 4RF3A 4GX5A 4TWRA 4ZRMA 3RUCA 4BB6A 5HRUA 2JD0A 4IGEA 4XGKA 4U0HA 1XNWA 3U49A 1DPGA 3OF2A 4JQCA 1JWBB 2YDYA 3OIDA 4XIJA 5I7SA 3TLFA 2EW8A 1NHGA 4ZRNA 4OAQA 5HBRA 5B37A 1N6FA 3TL2A 4C7JA 3NJBA 4DQXA 4PN3A 3DZIA 3CH6A 3OHSX 4OJNA 3RUIA 3V2GA 1V6AA 1Y1PA 2GYYA 3D4OA 4MKXA 5EINA 5CEEA 4ZN6A 1LSSA 4XRRA 4CMIA 1YKFA 4RF5A 2Y67A 3QV1A 3OECA 3P2YA 5EERA 4FN7A 5AYVA 5DP2A 5BSFA 5EPOA 3VC7A 2CY0A 3R9QA 1SOWA 3AFNA 4LMPA 1EVIA 2ZCVA 4FN8A 4JYJA 3AUUA 3JQCA 2ZB7A 3SVTA 5CG1A 1YBVA 2VSUC 3M2PA 2VSSA 1UDCA 5L4NA 5DUFA 4F47A 4U0GH 3A28A 3I23A 5L7YA 3DBHB 4DBVO 4E12A 4YT4A 2PD4A 4NU6A 4B3IA 2VQ3A 1UP6A 3UUWA 1WZIA 4FC6A 3QVTA 3UCFA 3ZNPA 2FP4A 3PQDA 2QYTA 3QWHA 3RC7A 4BGVA 3RRVA 1WAMA 3UXYA 1Y8QB 4JP2A 4I5FA 4GLLA 5FUSA 2C29D 2EJVA 1QXSA 1VPDA 1OC4A 5JSFA 3K9QO 2HJSA 4M55A 1DBVO 5L53A 1NFRA 2P5YA 3KHUA 3RD5A 1QLHA 3MJCA 2O2SA 3I5MA 3BTUA 3HP0A 3FCOA 1OI7A 1FCFA 4I9HA 3JQ9C 2Y1GA 4MVJD 2DTDA 2YW9A 1X0VA 3MJ4A 1TG6A 2AA3A 2I66A 3M1LA 4AJ4A 4WOJA 3AI3A 3RWBA 2EP5A 4XKJA 2FR0A 4IZCA 4EUHA 1DJQA 4I9UA 3L3SA 3IDSA 3WNVA 3BMCA 4FS3A 2UUPA 4CQLA 1DFIA 1PU2A 1LQTA 2NVUA 4CM7A 4Q0GA 5EIOA 2SCUA 3WOHA 4HX5A 4Y9DA 3GMDA 5AXAA 3RCBA 1KETA 1N2SA 4MKRA 3PYMA 3QJ5A 4AJNA 2R2GA 1ENOA 5ER6A 1BTOA 3V2HA 2J3IA 1ISIA 3W6ZA 3D0OA 4WCDA 2X86A 3BPPA 4PG7A 1E3IA 1JW9B 3I9JA 3NDIA 3P19A 1GCOA 3HSKA 4PLFA 4DREA 4YQYA 5JCJD 5KNLA 2C5AA 4TRJA 3O26A 2PZMA 4KWBA 3LT2A 4FGSA 4YEDA 4ND1A 3S2EA 4ONEA 3ASVA 3RAJA 3SJ7A 1DXYA 3AM5A 4AG3A 4M8SA 1F8GA 3WBFA 2Z95A 4E3ZA 5IDYA 3ETGA 3H02A 4PLWA 1SZOA 4DL9A 3V2UA 1O94A 3HE2A 2OZPA 2Q45A 4E31A 4ALJA 2VN8A 4KTVE 5HS4A 2FR1A 3RI3A 5CDSA 1EE9A 1XWFA 1NVTA 4QFEA 4HXYA 1EE2A 4E5PA 2FPPA 3LZ6A 4ZHSA 5HTOA 2CD9A 2ZCUA 4DWVA 4N5LA 4CMCA 4AJJA 5KKAA 1DC6A 3O9ZA 4ELXA 5T5QA 3ZNOA 4BNJA 4BMVA 5FIFA 5L3ZA 3DBRB 4BNLA 4FFLA 2F9IB 2E48A 1YS4A 4PZEA 5U1PA 4GM2A 4IXTA 2P9CA 4Z3DA 4E5MA 5DT9A 2P68A 1K2WA 1PJCA 1H0KA 1RJWA 2VWPA 2O3JA 3PDJA 4XQCA 4AJKA 1U5AA 1ARZA 1EQ2A 5KJFA 2DAPA 4XGNA 1DSSG 3JQ8A 4ZDEA 3DQPA 3TSCA 1WLYA 4FFPA 3UW3A 1F14A 5K6AC 2FSSA 2H1SA 4HFRA 3GF3A 4IJWA 4TRNA 3VVCA 2VYVD 4J0FA 1GQQA 3OJOA 5KJEA 5JBWA 1EBUA 3I9NA 4H15A 4PCVA 3ICCA 4D41A 2Q49A 3LU1A 4RDIA 2QZ9A 3GEMA 1GUYA 3EVNA 1TI7A 3WB9A 1S7CA 1E3LA 5DF1A 1D7OA 2BGMA 2YV3A 3H9EO 3ZWWA 3K8XA 1NQOA 5A9SA 1NTOA 2Y1FA 4EMPA 4FQ8A 4OSOA 1PR9A 1IYZA 3LYLA 2NU7A 1U7HA 2OHXA 4QIIA 3EVTA 2R6JA 2JAHA 3STAA 1YB1A 5GY7A 3JQGB 4IUYA 1LUAA 1HYHA 2YFHA 3D64A 4QSMA 1U5CA 2P4HX 1T2AA 4AJIA 4WLNA 1FC6A 3WWZA 2VSUE 3RVDA 1V0JA 2IE0A 5JS6A 1GAEO 3C1OA 2VX2A 5ILGA 3GMAA 2VHVA 4OG1A 2VZ0A 5DOZA 3KSDO 4G65A 2W4QA 3BMOA 3LVFO 1T4BA 1XKQA 5B1YA 2Q2WA 2VNAA 3AUAA 4BB5A 2VUTA 5L7TA 2XOXA 4QUKA 3L4BA 3NT2A 3ROPA 4DMLA 3RUHA 2A81A 2UDPA 4II2A 3CEAA 3A1NA 3W8DA 1GEGA 4CM3A 1ADFA 4Z0MA 1K6XA 2G76A 2GD1O 3DAFA 2JCYA 2VTDA 4KP7A 3EW7A 4ALNA 4CV1A 8LDHA 3JQ7A 3TDKA 5IXYA 4CLOA 3PWSA 5I7VA 1NPTO 3O03A 1VL8A 4Y8VA 1R66A 3VPGA 5TF4A 1WW8A 3O8QB 2HO5A 3AI1A 3N6RB 1AGNA 3TNLA 3BMQA 1HF3A 1JKIA 3UAGA 4CM8A 4XYGA 2DVMA 4BGEA 4HNKA 1EDZA 2P9GA 2J3HA 5DBFA 4GBJA 2HW5A 2VOJA 1SB9A 4TQGA 4WCFA 4AFNA 5GMOA 1Z45A 1ORRA 3GGGA 1PL7A 5COBA 4MIEA 2ZL2A 4ELWA 2IRWA 1ZFNA 3GY0A 4O63O 3H0QA 4BS9A 4LRSB 2BGLA 5JY1A 2NACA 2B5WA 1W73A 1J7XA 2IXAA 4E5NA 4KNPA 3JV7A 2E82A 3LLVA 5JBXA 4ESOA 2BI8A 3L6EA 4MOUA 3PZKA 4FJWD 3AWDA 3B1KA 4RJTA 3D5QA 1Y7OA 3OMEA 3E9QA 4CUZA 3S2IA 1PX0A 4ND5A 4L74A 4KD6A 4YAIA 5KDRA 5DULA 5JAZA 4U7WA 5EQFA 1DB3A 1O0SA 3CUKA 3NTRA 4MPDA 1E6WA 4CLRB 4CV2A 4CL8A 2AE1A 4CM5A 1BW9B 3HG7A 2RIRA 3C8MA 1ZEMA 4GMFA 4E32A 4C4OA 4A7PA 4JCSA 5CPFA 4CLDA 2GN4A 1FDUA 3AY7A 2HRBA 5L7WA 3R3SA 5U4QA 4BKQA 2EGHA 3LT1A 1PZGA 1RM4A 4MVJA 4XA8A 4H7PA 3NTQA 3V8BA 3GK3A 5JMWA 1J49A 3U4CA 4RPKA 4P4GA 1O95A 4IQGA 2G5CA 4YJHA 3ZZNA 3MJTA 4WASA 4WECA 1BVUA 3TOXA 3V1TC 3TFQA 1PQUA 1EY3A 2X5OA 3X2EA 4GSLA 3SXPA 5I9NA 5TLSA 2C59A 1U8XX 3NDJA 2DPHA 2PH5A 3L0DA 1LSOA 1ZJYA 3WFIA 3GZNA 1IULA 1H94A 1UXIA 2D59A 1X7DA 5LDGA 2PV7A 2J5QA 1UXJA 1T2DA 4NEKA 4HBGA 3HDJA 2BMAA 3BA1A 4ZDFA 3Q2KA 3I47A 4E2YA 4NHEA 3W1VA 4D3SA 2GSDA 1J0XO 2EKPA 1GFSA 1IY8A 5G1QA 4AVYA 3WGIA 3AK4A 1KIFA 3U3XA 5EN4A 5COQA 1N6EA 2ZB4A 4TVOA 3R3JA 2BD0A 2BI7A 1DUBA 1X7HA 4J91A 5F5NA 1DOHA 1KOLA 2X24A 4UAGA 3JQAB 3FDUA 3V5NA 4B79A 5BNFA 4Q3CA 3DOCA 3WNQA 1LC0A 2AQ8A 3K96A 3KLPX 1GEEA 2CUKA 2VYND 3D5TA 4RLHA 1MG0A 3Q9UA 3NAQA 1AHHA 4HWKA 2VCYA 3JYOA 2AW5A 3GA0A 5CEJA 3OQ6A 4EITA 4TVBA 4IGFA 3EGOA 1BXGA 3UF0A 2YHUA 1V9LA 3PJEA 4MO2A 3ZW9A 4YAGA 3CIFA 1PZEA 5KKCA 2GPTA 4I4ZA 2IYOA 1U1IA 2UVDA 3GNSA 5JDIC 1TA4A 2PWZA 1TB4A 4XWYA 1N9GA 2DQ4A 2VZ8A 4R69A 3QXZA 4IIUA 1E7QA 3IL2A 1ZSVA 3VOSA 3RFVA 2DTXA 1QYVA 1BVRA 1Z6ZA 4QQRA 3K92A 2QX7A 4AL4A 1M75A 2PK3A 4J7CA 3B6ZA 4JBHA 5CHEA 4EMMA 2AG5A 2OBYA 1QYWA 1JTVA 3DDNA 2EF1A 3A14A 3KBOA 3P7MA 1WPQA 3OC7A 3ZWBA 1T2EA 3SLKA 2VYVA 5C7IO 1HT0A 5C37A 2QRLA 1BSVA 5JFOA 2Y1CA 2O4CA 3GC6A 1DFGA 1FJHA 1DC5A 2B4TO 2PR2A 5I8ZA 3JYPA 1YG6A 1ISMA 4B4OA 3WFJA 5FWNA 5ITWA 1XDWA 2DFVA 3DHYA 4ELSA 3DJAA 4O6VA 5C90A 3G1UA 3QWIA 3RJ5A 2HU2A 3K30A 4RGBA 4P4NA 5T8KC 3QY9A 3PHJA 4GHNA 4P4LA 5A06A 1UYTA 3GAFA 5CDYA 2V6GA 2HMUA 3EC7A 5L51A 2D4AA 3FWZA 3KSZO 5TJHA 3PWKA 1DHRA 4IDEA 5A1TA 4FOSA 2Y1EA 3WJ7A 3QWFA 5EJ2A 1E5LA 5TSDA 4AJEA 1CQIA 3VPHA 1TXGA 1ADCA 5DP1A 3WICA 3ZWNA 1UR5A 5AXBA 4ZDDA 2G17A 1NZYB 2I67A 2O48X 4JOTA 3HE3A 1Y9EA 3TFOA 1Z74A 2Q35A 2FMUA 3PGQA 3G0OA 3H6KA 2QZZA 4L76A 2XAAA 1E7RA 1PQPA 2NU6A 4W4TA 2QIOA 2DBZA 2J8ZA 1HE5A 3L6DA 3PFWO 5G0TA 1XQ6A 1HZJA 2I99A 4HV4A 1C1XA 4OKIA 1HLDA 3VH2A 2OO5A 3B20A 3GT0A 1UJMA 3IAVA 1L7EA 2O3SA 1AXEA 1VRWA 3H9JA 2DBVO 1VLLA 1PJBA 3ENKA 3DWFA 2X5KO 3EYWA 3WJAA 2FSVA 3U9RB 2WE7A 4D79A 1N1GA 3IOYA 2CBYA 1MLDA 1KEVA 3F5QA 4AICA 5JDCA 2PZJA 1YH3A 3OIFA 3OEWA 3BAZA 3DB2A 3ENNA 2C2XA 1E7SA 4UVGA 1NNUA 4LW8A 3PFFA 4E33A 1UXKA 2HMWA 1SO8A 3RBXA 5CTCA 4FNBA 3HNPA 3HDYA 3IMFA 2G82A 3GN2A 4YRBA 3ST9A 3DMYA 1H2HA 3JTMA 1KVTA 2E4AA 3CKYA 4IDDA 1YQDA 1R16A 2YZ7A 3K6JA 3I9KA 3EY4A 4U0GA 2WYWA 3GOHA 4ASIA 1SNYA 1IHXA 5FF9A 1V3TA 4GAEA 2CDAA 3UICA 2A7SA 4CM4A 2GGSA 1NBOA 3OJEA 2DU8A 1KY4A 1PQWA 5IFLA 4IJUA 1E7YA 1FDVA 4M49A 3D1LA 1LLQA 1WDKA 3KOUA 4FFNA 4B7CA 3JD1A 1BHSA 3KTKA 4OQZA 2ZL4A 2AMFA 1EUCA 2F00A 4U1AA 2O7QA 3LC1O 2HCTA 3WYEA 4BOYA 2X9NA 5L95A 1LSUA 4NBRA 1GR0A 2BGKA 3BHMA 3F9IA 4I5EA 3QIVA 1XSEA 1YBMA 2AQKA 3DTYA 3PHGA 1FC7A 2E37A 3BHJA 3NGLA 3H65A 4NQZA 1F8FA 5TNXA 3ZWOA 3ORFA 3GKBA 3OJLA 3TV5A 3JSAA 4DQVA 4IZHA 1ZK2A 3BTSA 3R6HA 1DO8A 3GH3A 4PRKA 3ZNQA 3PEFA 3T7CA 1Y9AA 3RFXA 1Q0QA 1R12A 3AOEA 1N7HA 3KXDA 2LDBA 2Q1SA 3H9GA 4GI2A 3GAZA 2WYUA 3ROQA 1ZNQO 4BIIA 4RVHA 3Q2IA 1DFHA 2RHCA 1OD4A 1MB4A 4YRDA 3IC5A 3OJFA 4BNKA 4AJ2A 4FJ1A 4CUJA 1XX4A 2ZL3A 2VWHA 3HWRA 3ZHZA 3ON5A 3H7AA 4Q3NA 5G0SA 3FNFA 1N5DA 4CL3A 4XQ9A 1LX6A 5ENDA 5KCZA 4FCCA 2PD6A 3VAZA 5CDTA 4BKUA 3I3OA 4R1UA 3ZWPA 2C8TA 3OIGA 4WGGA 1RJNA 4NR0A 3QMJA 1SC6A 1B15A 1P0CA 4OOFA 3OBBA 1BDMA 2E6UX 3Q0JA 3R0OA 4K26A 3GG2A 4FGWA 4OXYA 4FD3A 1PJTA 1BGVA 1TT7A 1W4ZA 1XHLA 3OMLA 3SC6A 1L1FA 1U2DA 4QT0A 2WD7B 1PJ3A 2EP7A 3EUWA 2PTGA 1U3UA 2VYNA 3GDGA 1A71A 4YVFA 2F9YB 1R4NB 5THQA 1HE2A 1CEQA 1PIWA 2ILTA 3OA0A 3C7CB 4MIOA 3VTFA 4BNHA 4D45A 3LC2O 4KWIA 4BNNA 3HDQA 1EFLA 2NTJA 3ONFA 1XO6A 4K1LA 3A9WA 1BDBA 1VE9A 3DO5A 5IKLB 3HN7A 1XG5A 4BNIA 4R41A 1PIXA 1T25A 3ABIA 4WPGA 4BQPA 4CV3A 3VPFA 3OA2A 1W2XA 2HLPA 2Q1WA 2TMGA 1HDGO 1HZZA 3LLSA 3WIEA 3RSTA 2BELA 4M54A 1UAYA 2DPGA 5J23A 1SG4A 1B16A 1JVSA 3QA9A 4YLHA 2OL4A 4CMEC 4CPDA 3DBHA 2J5GD 3R1IA 2IODA 1K39A 3IP1A 1HLPA 1ZJZA 1JWAB 1A9YA 1B0AA 1BXKA 4OL9A 3E9NA 4K3WA 4CJXA 2C54A 1ZEJA 3KYBA 3OICA 5JE8A 4J7XA 3L07A 1EUDA 3PI7A 4WKGA 2AEMA 4IDGA 3ROKA 3SBOA 1UZMA 2ZQZA 3LSYA 1ULUA 1X0XA 4ZU3A 4Z9FA 3GF7A 2R00C 2VSUA 3GQVA 4TRRA 1KBZA 4L0QA 1HETA 1RPNA 2A4KA 5JAIA 4ZDCA 3MT6A 4FB5A 1XQ1A 3M6MA 7ADHA 2QRKA 1VL0A 1LQUA 5MDHA 5KOIA 4WLFA 4KWHA 4XIYA 3JQFC 2VWGA 1VJTA 2O3RA 1FMCA 1TVEA 4IZIA 2OFPA 4KUGA 5C9GA 1C0LA 3TRRA 4IDAA 2X5JO 3TL3A 3INTA 1NVMB 4E5KA 1HDRA 1R4MA 3LT0A 4CMHA 1Y8RB 1EFKA 3K2EA 3GMSA 5KIAA 4MOWA 1ZBQA 3PZRA 1E1LA 4LK5A 3RSIA 1X15A 3PP8A 3GEGA 2W2LD 3FPCA 4JGBA 5BR7A 3RU9A 4BO0A 3GFGA 4JBIA 1FDTA 4OXKA 1GV0A 1IHYA 1GPJA 4X54A 4Y98A 3BEZA 4RZHA 4Q3DA 4YJGA 4DLLA 4EJMA 3HRXA 1L7DA 2A35A 1RYEA 3KYCA 4QO8A 2I3GA 1HSOA 4A10A 2GTRA 4UUNA 5CPBA 3IJPA 4O1MA 4IDCA 2GDZA 4BKRA 3DBLA 5C3MA 2NVBA 2NU8A 1UXHA 5F21A 4EUEA 1PZHA 4E4YA 3ZWMA 1PJQA 2CE3A 2CDBA 2DT5A 3ZHBA 3IBBA 4J9VA 4UUPA 3JQAD 1NFFA 4JXKA 1X14A 3UOGA 3V1UA 4MXIA 4BV8A 3P5SA 4WEQA 3RKUA 2UZFA 4OHUA 1LDMA 3WBBA 2DM6A 3O38A 1PGNA 3PLNA 4MKZA 1T24A 2W3PA 3FD8A 2QW8A 1YBAA 2NLOA 1KEUA 3VH4A 4B4WA 3W4JA 1DC3A 1LRJA 5FEUA 5BNIA 4KDEA 3ITDA 4F46A 4XJTA 4YAJA 5BSGA 4CQMD 4XX0A 2J3KA 1P74A 2ZTVA 1MC4A 4PVDA 2QYSA 4AJ1A 1I01A 2F9IA 3VDRA 5DBGA 5JXWA 4E13A 2D1YA 2P4QA 2C07A 4GKVA 4NFSA 3RKRA 1SEVA 3FNHA 5JY6A 1FDSA 1Z75A 1KERA 3WLEA 3WWYA 3STHA 1QV7A 1VSUA 2GN9A 3IS3A 1ZK1A 1GZ4A 5JYDA 4NNQA 3GRPA 2CMDA 3NTOA 2YQ4A 1U3WA 4L8VA 4WNIA 4RCNA 2QQ5A 3Q0GA 2VWQA 1CERA 4XYLA 1M76A 4DC0A 5L9AA 1R0LA 3GRKA 1AN9A 3V5EA 4P8RA 2ZL0A 4MDHA 4QIJA 4UEOA 4TZKA 3A4VA 1OC2A 1P77A 1VKOA 2I5PO 4WYOB 4FB8A 1Y81A 4HY3A 1B3BA 3H5NA 4J0EA 4R68A 1E77A 4CM1A 3H2SA 4LCEA 3GGPA 1DIHA 3H2ZA 4R1SA 3BMCB 3MWEB 3Q6IA 1LDYA 2Q4BA 2O4UX 2DFDA 4GGOA 1ZK4A 4IMPA 4DPLA 5K6AA 3JQGA 1NX6A 1DAOA 2O23A 3LC7O 1BRMA 3DEYX 1NQAO 5G4KB 1DIRA 3JQDA 2ZK7A 4W9NA 2RCYA 2PBPA 2DUBA 5GZ6A 4MINA 2W98A 5CDUA 2NQTA 1EF9A 4U19A 1EVJA 4ALIA 3TT7A 3MJEA 3PVZA 1ONOA 1LSJA 4NFYA 4NH4A 4PLHA 3TRIA 4CR6A 3P2LA 3ANMA 4BNGA 4BKOA 1YJQA 1SOVA 4QEDA 2PPYA 3NJ8A 1KVUA 4NPCA 3ZU2A 2FZSA 2YJZA 1M6WA 3FN4A 4PLTA 1PJHA 1HZDA 1PSDA 5JO0A 1HWYA 2OMEA 5G4LA 4BQRA 3PE8A 4R54A 4GL4A 5DU6A 5A02A 3IQDB 2BFMA 3F4BA 3WGYA 2XF8A 3OFSA 5E0SH 4A5OA 5TJ9A 3D3EA 5L40A 3HHPA 4JJTA 4DYVA 1UP4A 4I1IA 5G1RA 4I52A 1NVGA 4NMHA 4RDHA 1E1MA 5JCXA 1QG6A 1PEDA 4MVJM 1ADBA 4E2ZA 3S55A 4FC7A 3O8QA 3UCEA 4W7HA 1DIAA 4EYEA 4NK4A 5A9RA 2BKAA 3INGA 2EG9A 5C5IA 1JXZA 3PQFA 3PHIA 1YOVB 4JIGA 4YJFA 4IQ0A 1QLJA 5FI3A 1PJLA 4YBZA 2WTBA 1EMDA 1W0CA 3ANNA 2X4GA 1HL3A 3PK0A 1PJ2A 1KYQA 4UVDA 1TYFA 2BZRA 3QE3A 3VKVA 4TROA 3S2GA 1AXGA 4FW8A 4ZICA 4XB1A 2X8LA 1P3DA 4FIZA 4L75A 2B0JA 3VIVA 3WX0A 3U9TB 4DLAA 4YYZA 2HK8A 1I24A 1I8TA 1LEHA 3AOGA 5IN5A 4N5MA 2J5GA 3W8EA 1OMOA 4GKBA 5I7EA 3C1AA 3JD2A 2Y93A 4YR9A 1OOEA 1ZW1A 2IEXA 3JQ8B 5F1PA 3GHHA 1VKNA 1EK5A 1HE4A 3PXXA 5IDWA 1XELA 3CSDA 4D0SA 1WVGA 2EIHA 4R3NA 2J5II 3GDFA 5KJ1A 4JJGA 2Z1MA 3CZMA 1ML3A 1BW9A 4I5GA 4A03A 3WQRA 1NAIA 3VKUA 5ILOA 1CF2O 4E30A 5JYEA 4L8KA 1HDXA 4Y6SA 2V65A 2VSSE 4NI5A 5INFA 1Q1NA 1EVYA 5I7FA 5A9SB 3BTVA 4R4JA 1RM3A 4PLGA 1PGQA 2BF7A 3MFMA 4LGVA 3M6NA 4NU5A 4FNDA 3GG9A 4NZ9A 1PWXA 3FPLA 3E03A 4D44A 2GF2A 1ZVMA 4IJKA 4I8XA 5T64A 1Y6JA 3UGKA 1Q2XA 2GO1A 4CM6A 4DRYA 1H6BA 2VRCD 4OSPA 2XXJA 4QO7A 3RIHA 2JCVA 4YA6A 4BKPA 4CMGA 4ZGWA 1O8CA 2BLLA 2W2LA 2ZB8A 5IZCC 1OBFO 5KJCA 6ADHA 4E2XA 3DZHA 2NUAA 4TRMA 2YV1A 5G1SA 1NR7A 3E5RA 3M6IA 1UIYA 1SAYA 1SEPA 4DI1A 2O3QA 1N6DA 4WCFC 2O3UA 3QKAA 1H6CA 4MJLA 4RLSA 4OLQA 3G3EA 1MXFA 4TZTA 3TVWA 1F12A 1N8KA 2C7GA 3KO8A 4ALKA 1GDHA 3JQ7B 3MOYA 2H9IA 3F3SA 4OQYA 2VRBA 1JLLA 3ZV6A 3ZU4A 3JQAA 4CLOB 4RPLA 4DVJA 3PIDA 2VOEA 3WGTA 1YXMA 2JJYA 5E0NX 2PZKA 2HK9A 4J7UA 4IZDA 2JKVA 2J5SA 1T26A 3WGOA 1PS8A 3AI2A 1XU7A 3DMTC 2WM3A 4NJOA 5TX7A 3E1KA 4K6FA 1NQ5A 5AVOA 1MFZA 1PGOA 2RHRA 3ADOA 4WCFB 1QYXA 2I76A 5T67A 1WDLA 2EWMA 4IINA 4CQMA 2PGLA 1A7AA 5I9LA 1CQJA 1HXHA 2JHGA 3ZGYA 2EKLA 2HJRA 2Y0EA 1OZAA 1H93A 4RYFH 1P1IA 1YL5A 3OM9A 3R0IA 1H5QA 2VREA 1YQXA 1QKIA 2WSBA 3P2OA 3JQEA 2IDZA 4P38A 1YO6A 2F6QA 1RWBA 3PRJA 2J3JA 4DC1A 1M66A 1YRLA 2V6MA 3KVOA 4ZU2A 1KY5A 3QREA 4ZQFA 2VHZA 3CMMA 1ENYA 4XGIA 2B35A 3GNQA 4RQUA 2CF6A 2PKQP 4PG8A 4FZWC 1JN0A 2VT2A 4IS2A 5BQFA 5B4VA 4R5MA 3WMWA 4MI2A 1IPEA 1K5HA 4J1NA 5THKA 4HADA 4M89A 1EDOA 2BHLA 1IE3A 4EZBA 3RUDA 1C0KA 1SCUA 1GADO 1M67A 3BMNB 4MIYA 3EZYA 4KQXA 4E21A 3I52A 3AM3A 3WSVA 1NHWA 2ZYAA 4YQZA 5AXDA 1YWGO 2PY6A 3LAOA 4YJHB 2V7PA 3JD0A 3EAGA 1GYPA 3NX4A 3NKLA 5TT0A 3ZNNA 2NV6A 4KDFA 3ZV4A 3QW2A 5H81A 4J1TA 1LA2A 3GUCA 3L9XA 4RV9A 3WMXA 4LK3A 1YB5A 2ET6A 2Y0DA 3GZNB 2BRUA 2J6IA 2FWMX 4L6WA 3BF0A 3TT6A 5INGA 2J5IB 1Z7BA 2EV9A 2FN7A 4D0RA 3LKEA 2OUIA 3OT6A 1NYTA 4D3FA 2YDXA 3FNEA 3TWOA 1HSZA 4YWJA 3T4EA 1RM5A 1XCBA 5A3JA 2ZQYA 1I33A 3VDQA 3GUYA 4KUEA 1VJ0A 4K6CA 4Z0PA 4PLYA 3NDRA 1PGJA 4OM8A 5L4LA 1DIBA 4BGIA 4KOAA 3QRWA 2VUSA 2FZEA 3MTJA 1PS0A 1ENZA 1ON9A 1A9ZA 4IDBA 3ZHYA 3WGHA 2NP9A 4PG4A 1XYGA 4N7RA 3ONEA 4LVUA 3MJSA 4DBZA 2EXXA 4J49A 3U4HA 4CLEA 2PFGA 3RJ9A 1EBFA 1Q7BA 3N74A 1NZYA 5BNTA 5JNLA 2H6EA 4G2RA 2IYPA 2NADA 4KZPA 3DL2A 1UUFA 1GL3A 1NAHA 4JCTA 2YUTA 2GN8A 4PG6A 4BNFA 1HNUA 2LDXA 3I4CA 2UV8A 4DA9A 3IB9A 4Q39A 3WYCA 3WIDA 3NYWA 3ZWAA 2P91A 1ZO8A 2XXBA 1N92A 3GGOA 4JNKA 3TZHA 3VZSA 1E92A 3HN2A 2C5EA 1BXGB 3OH8A 3K8ZA 3D3WB 2Q2QA 4LRTB 4IS3A 4PLVA 1Y7TA 5JPIA 3KYDA 4MP8A 4NBWA 1I3MA 1MA0A 3G17A 2W2KB 1KC1A 2AEFA 5HWSA 1ZMOA 5ER9A 3KB6A 1PJSA 5DU4A 3ONDA 3RSHA 2RH8A 2EW2A 4EBFA 5CTBA 1O5IA 3HLN1 4K29A 4EGFA 3NV9A 5KVVA 2FW2A 1A5ZA 2JL1A 1AE1A 4BO6A 1R37A 2Y68A 3S8MA 2AG8A 4WUVA 3RC9A 3GNTA 5ICMA 1D8AA 4WCZA 1SZJG 4YJDA 5IZ4A 3V5IA 3NRCA 1F0YA 4WE3A 3F1LA 4HP8A 1LLCA 5AXCA 3CE6A 5H82A 2IZ0A 2PKRA 4GSKA 4Q3BA 5T57A 4B7UA 3RQSA 3PJGA 1IPFA 5KWEA 1G6KA 4NJMB 1B26A 3PHLA 1GQ2A 1EUZA 3N7UA 1DRVA 4RPGA 3INRA 4XRGA 1ZK3A 4PGFA 4F45A 2VSSF 2NNLD 4GQAA 4XZ3A 1R15A 5DOVA 1DRUA 4Z6KA 4S1VA 1C1DA 4W82A 2IZ1A 4UEJA 5IN4A 1I5RA 3K50A 3GN1A 2VHWA 3PIIA 3QLJA 4BO2A 2RH4A 2B4QA 3NJDA 3EK2A 4JVTA 1V35A 1H9AA 4XEHA 1Z73A 5TQVA 1W8DA 1ZSNA 2VRCA 4J2HA 3U09A 1T4DA 4ND4A 1GV1A 4KQWA 5A9TA 5DZKH 5LDHA 1VM6A 4BO1A 5IDXA 4XDZA 3WGQA 4JX8A 4BNXA 1MUUA 4HKTA 3FRJA 2JFHA 4XYEA 4KPKA 2QRJA 2X9GA 5L45A 1YJ8A 3BYZA 1O6ZA 3PPIA 3MYBA 3TN7A 2B5VA 3QVOA 1MX3A 3H0JA 5GZ3A 1LXCA 3C1TA 3WXBA 2X7HA 2QHXA 4EW6A 2DBQA 3D4NA 3N58A 1I2CA 1E3SA 1CETA 1C1XB 4XQGA 3JD4A 8ADHA 9LDTA 2NM0A 4GX2A 2EKQA 3GVHA 3HJAA 4A26A 4L4RA 4NK5A 5A04A 1YL6A 4TKLA 4J2OA 1Q0HA 3MEQA 5IAAA 4RVSA 3L9WA 1M2WA 2WD7A 1ISFA 4BO7A 2OXIA 5JLAA 4BMSA 1R4NA 3AY3A 5B12A 2F9YA 3KTGA 4I08A 3FF4A 1TT5B 4UULA 4D46A 1N7GA 3GEDA 3E8XA 4GGPA 2X0NA 1UYRA 4TKMA 2Q1UA 3CMCO 3KEQA 4KUHA 1BWSA 1P9LA 3KTDA 3MWDB 4Z9YA 5JAQA 5LC1A 4CMAA 4RO0A 2B4RO 1N1EA 2B37A 2J5KA 3DHEA 2V6BA 5G0VA 1WXDA 3H9QA 1ZH8A 4MP6A 4ZDBA 1CDOA 3AU8A 1UH5A 3AY6A 2FY8A 2RBEA 1WWKA 1ZCJA 1B8PA 3NT5A 2GNAA 3FNGA 1WMAA 4Z9XA 3VZPA 2B36A 4YACA 3JU1A 3TZ3A 3GVIA 3RROA 1I32A 4O5OA 5DU8A 2Q34A 5F1KA 4PRLA 4DTIA 4OH1A 5U9CA 2F1KA 3S2FA 3EHEA 1FF9A 1WMBA 1D1SA 4IQ8A 4DGSA 4FPXA 4WJZA 4J1QA 3RBZA 3GLQA 3K5PA 3MTGA 4O0LA 4PLZA 4B4VA 3ETDA 1UDBA 3F1KA 4G81A 4U5QA 1ZXBA 1DCIA 3E9MA 4B7XA 4AJHA 1PL6A 4QECA 3DAGA 5KVQA 1XNVA 3HINA 4PFJA 5C7LO 2FBMA 3IUSA 4PLCA 4J16A 1KVRA 5CG2A 2OP0A 3F47A 1LC3A 1P1RA 4ZA2A 2DTEA 4XYMA 4CMEA 1EF8A 2YHIB 4UUMA 4JWVA 1GYQA 1QV6A 1GTMA 4UVEA 1O9BA 1E3WB 5FFFA 4U8GA 3JQBC 3PHHA 4CR8A 1LDGA 1LLDA 4U6SA 1WZ8A 2X0IA 2DUWA 2HDHA 3AFMA 3UHAA 3KZVA 1GUZA 2FPGA 2GZ1A 1IZ9A 5DZSA 4HNGA 4U18A 1YDWA 4GWGA 4TSKA 1NPDA 5BT9A 1P1HA 4H3VA 2NU9A 4YAKA 1X1TA 3GVXA 4M87A 1PGPA 1Q52A 1Y8QA 1X1EA 3SWXA 1G0NA 1ISJA 2HUNA 1YE3A 2C82A 1KVQA 3JQFA 4MVJG 4FSHA 1FK8A 3IUPA 3NT4A 4BO5A 2EHDA 1U7TA 5E0SA 4JROA 2Z1NA 3Q0EA 3PZBA 3Q7HA 1JA9A 3T8BA 3VPXA 3HQ4O 3UFXA 3KEOA 4J4HA 3K31A 3WG5A 2OORA 1ID1A 1FXSA 1Y5MA 3WG9A 4K2NA 5MGBA 1J4AA 3DR3A 3T8AA 4JCRA 1ZIDA 1QORA 1ZXLA 1TEHA 2X22A 1S6YA 2C2YA 1U3VA 3OSUA 1LNQA 1GZ3A 3B70A 1ISGA 1J5PA 2EERA 3VVBA 4ALLA 3WS7A 1MJ3A 1Y5RA 3LF1A 3CZRA 4KTTE 2FR8A 4DQUA 4K9DA 1T1RA 3FF6A 1EVZA 4EUFA 1EZ4A 3JQ9A 3IKTA 2YV2A 4WLEA 1WZEA 4S3MA 1U4SA 1BG6A 2Y66A 3H4VA 3D4PA 1JKJA 1PS9A 1HYGA 3WQSB 3W8FA 4RCVA 3WYBA 3QYRA 3DTTA 2CVQA 3KLMX 5EQDA 3UCXA 5TRTA 2WE8A 2D0IA 1YQGA 4J90A 3QK8A 2V6FA 1T2FA 2W8ZA 2I3AA 4JK3A 3KSUA 3LDHA 4G2NA 3K2BA 3JYQA 3W4KA 4Y67A 1GYRA 4BNMA 3MJVA 4LCJA 5BSEA 1F06A 3I9LA 7MDHA 1SMKA 3ISAA 2BFOA 4BHTA 3LT4A 1VC2A 5DDIP 4CMIB 3HB5X 1NXQA 3PQEA 4IXWA 3RU7A 4XJSA 2WYVA 3TOZA 4EDFA 4DIFA 3P5MA 5DUCA 5ICSA 2P5UA 3VHRA 2PD3A 1I10A 2AQIA 4W7IA 3WQQA 4E5YA 5BSHA 1HYEA 1NASA 2P9EA 4BNZA 4MP3A 1XA0A 3HB4X 2Y1OA 3ZW8A 3QWAA 3WDSA 5TT1A 1P44A 3T7EA 2Y1DA 4UEKA 1VJ1A 4DYDA 5AOVA 9LDBA 4Q1IA 3DBRA 1IL0A 3NGXA 4JBGA 1GCUA 1PR3A 4F6CA 2G0TA 1XEAA 4CM9D 1OFGA 2JHFA 3RUAA 5ADHA 2D3TA 4H16A 4JSBA 3AUTA 3DORA 3UH1A 1R4MB 1WNTA 5GZ1A 4XQEA 3W4IA 5G4KA 4G5HA 4IM7A 3NJ4A 4MVJF 3RASA 4EEXA 4L4XA 1U28A 2C7VA 1PL8A 3COSA 4LSMA 5IF3A 2WDZA 3DAPA 3WTBA 3X2FA 1D4FA 3PGJA 4YJGB 1SPXA 1UAGA 3WGZA 3KTIA 3CPSA 3KYCB 1UZLA 3MOGA 2GN6A 1ULSA 4OOEA 3V1YA 1P45A 3QVWA 5IJZA 3ASUA 3FBTA 5KJPA 1B7GO 1JVBA 4HFMA 2HSDA 3DBLB 4OMRA 4NG5A 2IEBA 5TGDA 3RC1A 2ZTLA 2FOIA 3HZZA 1A27A 4CMJA 1WP4A 1I36A 3KTHA 3C7DB 1R6DA 1UZNA 2A92A 1CJCA 3IJRA 1ZK0A 4I9NA 2Q1TA 1C0IA 4YDRA 4CQLB 1E7WA 5DKPA 3ICPA 3KUXA 2NVUB 1HNOA 1NQTA 1LRLA 4FFMA 3KTJA 1I2BA 1U4OA 3FHLA 1XR3A 1YOVA 1JKFA 2O7SA 3AU9A 2D5CA 1VRGA 2GR9A 3T88A 4KMSA 4U0JA 3U0BA 2EJ5A 2UUOA 3R9SA 1ONPA 2Q2VA 4BNUA 5K9ZA 4RYFA 5JW6A 2I9PA 3EMKA 2JD1A 1A7KA 4TMFA 5JC8A 3E18A 5G2OA 1RJMA 3F5SA 2NVWA 1GU7A 3DZFA 2D5AA 3WGGA 4JN6B 4GPD1 1WDMA 3DHNA 4N5NA 1EQUA 3FR7A 3Q1LA 3TZKA 1QR6A 2DKNA 1W6UA 2ZTUA 1VI2A 1D3AA 4HNHA 1B14A 4E0BA 4ALMA 1NWCA 1B2LA 3DOOA 4E2WA 3I9MA 3GZ4A 4CMBA 4FJ2A 4CUKA 5FYDA 4ZVVA 1HE3A 3ZV3A 2WMDA 5DL1A 1XU9A 5I9MA 3IIEA 4HUJA 4I42A 4OIMA 3ZDFA 4BMNA 1I2ZA 5G0UA 3ITKA 3ZWVA 2WJPA 3W6UA 3TJRA 4IBOA 3KRTA 3NUGA 4W9NC 3TZCA 3GPDG 1HDZA 4BNWA 1D1TA 1ONNA 1Q7GA 2C0CA 3H5AA 4WLUA 3FBGA 2GERA 4EMLA 4FR5A 5F5LA 4BNTA 3TVUA 3GPIA 2PG8A 1PWZA 2NTVA 2B83A 1PTJA 1R0KA 3PTZA 4IIVA 3T4XA 4JCQA 3HFGA 3LK7A 4MVJI 1YL7A 3AM4A 3F6YA 3OETA 4J6FA 1YDEA 2GCGA 3L6OO 4ZQGA 2CSUA 5LCXA 2O3TA 2HKIA 1QYDA 2O2YA 2PGDA 2Q50A 3IAHA 4XCVA 2CZCA 3TPCA 4WOKA 5KTKA 1B8VA 4IJVA 2X58A 4HFNA 2JFGA 4EJ0A 4WK6A 5A4DA 3TZQA 1LBEA 2A7KA 5TC4A 4RVUA 2CFCA 5L4SA 3D7LA 4D43A 3TZ6A 1XIVA 1A72A 3ZCXA 1ADGA 1V3UA 4RORA 2YQ5A 5JO9A 3Q11A 1DLJA 1C0PA 3I6QA 3FSRA 5IG2A 4CLRA 3HUDA 2DC1A 1GD1O 3G64A 2CNBA 3KM0A 3C3XA 4DXHA 2WEKA 3Q3CA 3GF4A 3GDOA 4IY1A 1IB6A 4R3WA 4BV9A 4D3DA 2G1UA 3HFSA 3QP9A 5EL0A 4ZJUA 1DRWA 1NP3A 3ANLA 1E0DA 4B8WA 4QTZA 3PWZA 1FDWA 1DHTA 1KS9A 3L4BC 4WLVA 5KVSA 3I4FA 1LI4A 2BFPA 1HDOA 4QFCA 3H3JA 5IZCA 4CV0A 2UAGA 1Z82A 3SLLA 4U6QA
chains in the Genus database with same CATH superfamily
1EDBA 5F73A 3ZWKA 4JP3A 3GD5A 4JBLA 2GYWA 4FEAA 1NQXA 4PYRA 2OESA 2F4NA 4I6GA 1Q12A 5I45A 3K70D 4I1RA 2Y05A 3R5FA 1N3IA 1ZGZA 4E09A 1U0JA 2D2IA 2VUIB 4OHBA 2JDID 2IEDA 3HMQA 1A9TA 1IN5A 3AF4A 4LSZA 4D8XA 4R1QA 3A3NA 3M9XA 3NWEA 3RYIA 1N3BA 5LM3A 4NE7A 3OTIA 3QBVA 1NR1A 2WHYA 3LXRA 1P1FA 1ENPA 4IUCS 3OG9A 2F9FA 4IXDA 3B7WA 4K28A 3CTMA 3WWCA 4MDEA 4KR9A 3U17A 4KPUA 4O4JA 1Q84A 4H08A 3UGJA 1XD8A 4EMUA 1MX9A 1XQYA 3CRW1 4O02B 3V8QA 4Q24A 3BQNB 2NV2B 1CR0A 2ZJOA 3FGOA 4LY6A 1O97C 2Z5LA 3OLCX 4TL6A 5E4YA 3R7FA 4PIVA 1EYZA 5ERXA 4A0SA 4ND3A 1GZUA 4RK7A 2Y0PA 1GRCA 3PRKE 1ZUD1 3LA6A 4FGKA 3KYJB 1G2IA 4G24A 2FRDA 4GI7A 3PLRA 2ZT7A 2IXBA 1UEJA 2C3YA 6LDHA 2L69A 4E11A 3H17A 2QUZA 4TTJA 3QQ5A 2CB9A 3BMQB 5H70A 1BKSB 1I4DD 1QIFA 3SX2A 3UMCA 1X1AA 1FLAA 3OTWA 3H04A 3O4RA 4RF2A 5LIPA 3AEQA 1KZ6A 3OZWA 3ZH2A 1DWPA 4O2BA 4BGDA 3MUEA 2BFAA 1BROA 3FSGA 3IKVA 5EQTA 5K0LA 1Q11A 4EL0A 1JG1A 3GVCA 3BMNA 4B3TB 4ZOBA 3VR4H 1R6XA 2ZRDA 1IHPA 4GZMA 1EGQA 2JJ8A 1DPFA 1MB3A 1T6XA 2XNHA 2IEAA 4TTVA 4JI1B 1BMDA 1UJ4A 4OX9B 1JB9A 1PNTA 2DLDA 2PM8A 3NHBA 4GECA 3ZLBA 2G1JA 1QKJA 2VBFA 4B3HA 2NTYC 3Q40A 3UKOA 1T10A 1WBBA 3FNRA 2BFDA 2NWQA 4TZ6A 4KHZA 4CKZA 1XN1A 1RRVA 1ZRHA 5CX1A 4FFDA 1GNQA 2C5HA 4WLOA 2VHXA 3RJZA 5L6LB 3EXAA 3BKWA 4D4IA 1U02A 1HRDA 3PQCA 1MOQA 2ZR0A 2HRRA 1FJXA 2Q29A 1I13A 1QHSA 1KJIA 5AW9A 1Q16A 3LFTA 4BL5A 5KDRB 4O4IA 3J80A 4YMTA 2FZWA 2QRVB 5JCJA 3NEPX 1Z17A 3OKCA 4FBGA 1GSIA 2QMEA 3CUUA 4RF4A 3BL6A 1DC4A 5D3MA 1PT5A 2RONA 1DQRA 1H5NA 4FKZA 4KAJA 2JGDA 3G8AA 3O8CA 1Q51A 4PYLA 4WKOA 5D1HA 1L5SA 3V2IA 1EVQA 5HUQA 4NYJQ 1D04A 2Z83A 3IOMA 4BO4A 5MF6A 1IN4A 1ORIA 4DHWA 1NM5A 3FTNA 5A6SB 4NV0A 1N78A 1RADA 2H17A 3LQFA 5T6BA 1B93A 2OV1A 1T9HA 1TC1A 4NBVA 1WUHS 1E2PA 4B2LA 3GJSA 1E0JA 3RUFA 4BCCA 1FP2A 2PGJA 2FPOA 3RS3A 2FMIA 3NO4A 2JK1A 4D8UA 4EYSA 1V7QA 4ZI7F 3PYXA 1V5WA 2E49A 2Q8PA 2GZAA 2R6R1 2YYYA 2GJ4A 2CVOA 4IRMA 3VTAA 5I51A 4UBIA 2J1LA 1HDIA 3ESCA 4MV6A 4XWWA 1NZFA 1U3FA 1X1BA 1NV8A 2WKWA 2J7PA 1T9ZA 3O3NB 2I6XA 4Q1VA 1I30A 1ZVQA 1SG0A 2FWRA 1T2CA 4L4YA 4EEZA 1F2VA 3ENWA 3MGAA 1W5SA 4LV5B 1S96A 4FYKA 2I8LA 3FPHA 1IRXA 3TW4A 3IT3A 3UN1A 1UP7A 1PLLA 2P0YA 3D3WA 4Q4CA 5AW8A 1MKYA 3G49A 4M86A 5FQOA 1LRKA 1QIEA 2ZIAA 1DDIA 5CNKA 4UMVA 3R7DA 3GMIA 2AUMA 1UM9A 2Q9AA 1ZZEA 4XI9A 2J3QA 1CUBA 3TCKA 1DC8A 2QXUA 5AVTA 4QU5A 3RVPA 5KO2A 4TYQA 3QWDA 4ND7A 3U6KA 1NUAA 1M8JA 1N8SA 1P1JA 3QPBA 3ZN2A 3LQYA 2QPOA 2I3DA 3KG2A 1MGOA 4U3JA 5ES3A 1A8UA 1QMGA 2HGSA 1A4UA 1M5TA 4P98A 4ROSA 4BGUA 3I0NA 4XOIA 1XTPA 5HCIA 3OPNA 5B1HA 1XQ9A 4M7RA 1WXGA 4UTNA 5ARDA 4C30A 1ZH0A 5KREA 1H6DA 2VYFA 1PFQA 1P62B 2DSNA 4R5HA 3T9FA 1V37A 1N2GA 3VJLA 4KCGA 4IILA 1CUJA 1H1DA 2CFSA 4JKOA 4D5EA 2VDWA 1FYVA 4QGAA 1MMFB 3ZXSA 1JJAA 4NJMA 1Y3FE 1YE8A 2JFPA 1W9HA 2WKRA 1RLMA 2LXNA 4V38A 3AJAA 3UVEA 4OMUA 4CF6A 1R0WA 2Q4EA 4QOFA 4KXUA 1ON3A 4TX1A 1Q0LA 3EXG2 1TDJA 4QVKA 4HVLA 2RGDA 4W1PA 2X1VA 4DW8A 4TL9A 4TWBA 1Y6FA 2XSZD 1DUVG 2UU9B 2OKGA 2QEQA 2JJ1D 1HEUA 3L0BA 2A9OA 3LCUA 3QIAA 1VHQA 2O2IA 4W8HA 1KVSA 4CVNA 4HH1A 4HRVA 4XPZA 5SY4A 5CLLA 3ZU3A 4JWKA 3O8OA 1N9GB 2GPAA 3VU9A 4QASA 3VYWA 4DUPA 3ZVMA 3QXIA 1NDHA 2JA1A 1MPTA 1WZUA 3EDMA 3I09A 4HWTA 2YHSA 4EHLA 3FTEA 1P31A 1WRBA 3M3PA 2VAXA 3IUQA 2IZZA 5B3JA 1WV0A 1QAMA 2CDCA 3FTDA 4KAXA 4EUNA 1MG5A 5EJ6A 4J07A 2QR3A 3H1EA 4PC2A 4PR0A 3RVOA 4C3OB 2AE2A 4RTSA 3WIVA 1F6WA 1DAPA 1ZA2A 1G8PA 3JAWB 3PJDA 3K73O 2ZAIA 1JU9A 5CCEA 3IURA 2WFMA 4NONA 4CYMA 5A05A 2GRAA 1MNQA 2J6CA 4UOZA 3BCSA 1Z2PX 4OKNA 5JEEA 1N7JA 4D8WA 2E21A 4RY9A 3OPXA 2VHCA 3G9UA 2ZJ0A 2GRJA 4NMXB 1SG6A 2ZYGA 1OBCA 1E3EA 1OD2A 2QROA 2QVBA 2W7TA 1YA4A 1NFQA 1YMQA 4BYGA 4CCYA 5LQUA 2QYOA 2OWDA 4MVJH 4TM8A 1AHNA 2WTNA 1QTNA 2NSDA 4V3BA 4KPEC 1HDYA 3PR2B 1GPNA 2YY7A 2AN4A 1HBJA 4JR1A 3DFUA 4EJ6A 4XLZA 1OAAA 5EZYB 3TR5A 3CNQS 3NEAA 4AQDA 5GIOE 3LTNC 2Q5IA 1JDZA 1L6IA 3GYBA 1BXZA 2NAFA 3ILVA 4LVCA 4OGWA 4XB2A 3UEOA 5CA0B 4IZBA 5I9TA 4PNHA 1RPAA 1PAUA 1Z8FA 1K32A 2HK7A 4N6OA 1LLUA 2FSPA 3BXHA 1SBYA 3IQFA 5LJIA 3H81A 2EGGA 2XDYA 3F96A 5C5DA 4YXFA 2FF7A 1CJBA 5C1IA 1FTGA 3I6MA 5K09A 4WK2B 3QENA 3UXMA 3FVQA 2DBRA 3LUDA 3MCVA 4M1QA 4PAQA 4DMGA 5CW1A 1XWWA 4EW2A 4N5HX 5IXSA 1A8PA 1XNHA 2ZSBA 4ZAYA 1UBNA 2R751 3KS9A 1BDIA 2GVDC 1GNLA 4YAOA 2ZIZA 1PW7A 1EI9A 3WNDA 3C45A 1GQOA 5D2CA 2G63A 4XW2A 5KWVA 4UMDA 4X66B 3AEYA 3MB8A 4U0KA 4YJ2F 1W4CA 2GAFA 2G71A 2ECFA 2XH8A 5AW7A 1JDJA 3R6DA 1XDZA 4Y6QA 4INJA 3RRZA 4DLBA 2IPMA 3OQJA 4D0NA 5A5EA 2VF2A 2JLQA 4IF6A 1ECJA 2R4QA 2KLBA 2JFBA 2ZYWX 1OPRA 3OP4A 3FTFA 4TWZA 5HP4A 2XQJA 3Q41A 5A03A 2LZ0A 3A7DA 1LTKA 2B9VA 4RVGA 4ZO9A 1O94D 2NOAA 1PFGA 3OIUA 4R98A 4JXXA 2O2EA 4KG7A 2I6TA 4YY3B 4AMVA 3TLKA 2XKKA 2JGIA 3CJTA 3TG8A 5F1OA 4J1SA 3RKSA 4R2MA 3ZDZB 3HJCA 3A58B 3N53A 1CS4C 1EINA 4N82A 2WSIA 3G1TA 2Z2KA 4ANFA 4BVAA 3TBKA 1RIFA 1R00A 2RB4A 4EATA 2XMZA 2V7WA 4A8JA 1SZDA 3NDBB 4ESVA 1ZHFA 1E8MA 2DUJA 2HMTA 1HT1E 1D2CA 4K9RA 2B8EA 6YASA 3S2ZA 2ONCA 4BO8A 2H5LA 2OG2A 2WFLA 3I2FA 3L4SO 3THSA 5SZJA 4YMHA 2P2ZA 3C7AA 4BO9A 3JQ6A 3TMYA 2PFSA 4JBYA 5EMHA 1M6NA 1U2QA 2EJBA 5HILA 1S7GA 3AYXB 4MQLA 4AKSA 5DI3A 4WZ8B 4PY2A 3O3OB 3H9CA 4CM4B 1ZRSA 3X1DA 5CH3A 3TQHA 1IQRA 2R60A 1AUQA 2VJYA 3C87A 1K7SN 2EVWX 3GP3A 1QUEA 5K0ZA 1HE1C 3OAAA 3DZJA 4RKWA 3PFNA 1JFSA 3G79A 2H1HA 2PL3A 5CDGA 4HC8A 4KWCA 2V8BA 2OAEA 2ZS7A 4KIFA 4GVXA 4N5DA 4RMIA 4Q3EA 3RU3A 3AT1A 3OFND 3KFLA 4JUCA 4UUOA 3TAHA 3HDHA 2RH9B 1Z5PA 5GOTA 4Z2YA 3E2MA 3VAYA 4EA7A 1F0NA 4K3VA 5HKKD 1D03A 5CDFA 3RSCA 2DQKA 1R3DA 2A86A 2LD4A 4CI0B 3JQBA 2J5RA 4QXPA 4EAQA 3EQ8A 3RSQA 4YALA 4LOKA 3S1LA 4B8ZA 4Z0TA 4C07A 1PV2A 2VK8A 4TLAA 4YPOA 2VTEA 1KQGA 1Q7CA 2QJWA 3EGXB 4YT2A 1I4WA 2QTHA 4INAA 3DDOA 1I9GA 4PZUA 3GARA 2FPRA 3SYTA 3V8EA 1YGYA 2Q6OA 3B6EA 3DV0B 3SM3A 4CFZA 1AHPA 2IYLD 2GASA 9ABPA 4LJYA 4ARCA 2HMSA 5B4UA 4ER7A 3TQSA 1UBFA 1QJ4A 2CE2X 2FQWA 1U6IA 3DTVB 3E27A 3GGCA 1MO4A 4ZJYA 4RWZA 4JMPA 2C1EA 3QHQA 4RU1A 4EMSA 1L7OA 3C4VA 3PX2A 5D7NA 5EMJA 2QL7A 3ZYZA 4MR8B 4AZTA 5LQRA 1U2DC 2P11A 2D62A 3DNPA 4F5EA 3E5MA 2P2YA 1IBCA 3QUCA 5E6UB 2VREA 1L0BA 1E5QA 1QSGA 3EGIA 3ROMA 3OQIA 1LF0A 2JFZA 4CCSA 2C2ZA 2NTNA 1XPUA 1GPDG 5KJ6A 3TZLA 1EP3B 3AF6A 1ZOOA 2GK4A 2QLTA 3EUEA 1NLFA 2NO1A 2BL4A 1M6HA 1F60A 2AVDA 2HQ1A 2NZWA 4JB8A 3K4QA 2QT9A 3DCJA 4IH1A 4MQFA 1E6KA 4BNDA 1UKEA 2LCIA 2BUAA 3ETEA 3PNMA 4RF3A 4BX3A 4EFNA 1GUDA 4ZRMA 1BQ4A 1IBSA 1CZOA 1V26A 3H8WA 2ZZMA 2CV0A 3GRAA 2YRWA 5K3DA 2Q6KA 2GHTA 2QF7A 3FKJA 3NP9A 1Q7TA 5EXSA 5KQMA 4U0HA 3U49A 4I1PA 4JQCA 1VCNA 1JWBB 3OO1A 4OM7A 5GOZA 2J5XA 2BMEA 3UKDA 3TLFA 1EIWA 2CUNA 1NHGA 4YRNA 3SFTA 1N6FA 4FMCB 3SQNA 1VGQA 3M3DA 4G3XA 1VJ5A 2HWKA 3QOFA 3ZXXA 5ALFA 1P73A 1XALA 2PVCA 2QD4A 5EYPB 1V6AA 3NH6A 2W2OA 4J8PA 1Y1PA 2GYYA 3HUTA 5D7BA 5EINA 5C9ZA 2E4WA 4FILA 1L4EA 3DT8A 1TYAE 3IBYA 1W36B 1BKDR 4JSRA 2EEPA 1T36B 3P2YA 3QE9Y 1IH8A 5AYVA 3L0OA 3Q0TA 5DP2A 4AYTA 1GFWA 2QNBA 4JENA 3R74A 3R9QA 2W6PA 1SOWA 4KGZA 3TTVA 2PYZA 1RWKA 2J3DA 2ZCVA 2D2EA 2XKJE 4BCBA 4HGOA 4U2FA 3ZKWA 1T2NA 3AUUA 4JYJA 3INNA 1V4VA 5CFRA 1RWPA 3T1VA 3U3OA 4F91B 5GP1A 1V3QE 1O97D 1TYBE 2XE7A 3QVJA 1VFNA 4JU8A 4CEHB 3M2PA 1K9VF 4H7IA 2VSSA 1TC2A 1X80B 1HLFA 4RW0A 5F3DA 4D2IA 3DE3X 3GJZA 4AUKA 1RXIA 1WMEA 1QIDA 2R62A 3B3QA 4NZZA 1QGUA 3DBHB 5AFSA 3WE7A 1JSZA 4UTRA 2C31A 2VQ3A 3OEED 3DAHA 4QXRA 1JBEA 4OXQA 5E9QA 4YRMA 3BEOA 5CB4B 1Q95A 5KTSA 4OMFG 4DNFA 4EHDA 3U0VA 3O8RA 3OX4A 2GCEA 4W1QA 4WXRA 3GLKA 2QYTA 3QWHA 4AMBA 3C39A 4ZVTA 1EUDB 1Y8QB 1YBHA 3EVFA 2BKEA 2C29D 2H4HA 4GLLA 5FUSA 3IGFA 2AUTA 1II0A 3KJEA 3OMXA 3WL4A 3JTEA 4BLQA 4OFZA 3EX7C 3CRRA 3FUUA 2PRYA 1FXWA 4HSEA 2IYWA 3ILHA 4M1KA 5H1YA 1T8TA 1ZNYA 3RD5A 1EWQA 3SZLA 3SE7A 3FCOA 1AZWA 3G2LA 3H0CA 5ALTA 4PTYA 4M0PA 5B6PA 2BGTA 4OJYA 1X0VA 2V5UA 5ED0A 1UMDB 6GPBA 1VYUA 2JARA 4PSDA 3VPAA 5FTKA 3RWBA 3RVRA 1JTFA 1FDIA 1O95D 4EUHA 1ML4A 3MN1A 1G8SA 3AONB 2R8RA 2G9RA 1ZCZA 4CQLA 2VSXA 5ALGA 2IXGA 1WB9A 2XZLA 1HKHA 3SAJA 3WOHA 3PNBA 3UWSA 3V4SA 4Y9DA 3KWMA 2NAPA 4WBXC 4FMBB 3MQFA 1JILA 5DHRA 1MV5A 1WQ4A 3PC7A 4FUQA 3OUTA 4Q4JA 3RGGA 2KBEA 2EYQA 5I9IA 2J3IA 1D09A 2AFHB 1N0HA 4LKRA 4PCAA 1QGED 2FUG1 3W6ZA 3D0OA 4DDTA 2XDAA 1R3UA 4PG7A 4ZVSA 3I9JA 4FOLA 3NDIA 4KBFA 4OHZA 1W5EA 3AVWA 3QEAZ 3HFRA 2C5AA 1ZP6A 2LP4Y 5AOCA 4BFCA 4ZVQA 4FTWA 4H18A 5E9JA 2HQSA 1AKWA 4YEDA 1VTKA 3GLIA 5CMLA 2X7XA 1SPBS 5C5EA 5B2EA 3H5TA 2VKQA 5AWFC 3TW6A 1Y4SA 2R8EA 1F8GA 1ZESA 3VO2A 1YU6A 4HDOB 4D9NA 2LKDA 5H0IA 4X64B 1Y8AA 3D2AA 1WU8A 3RGWS 3UK7A 4G5XA 1M73E 1XLUA 3E05A 4RX1A 1OGJA 4HL6A 5DWDA 5EJ8A 2XXAA 2NP6A 2YVAA 5H80A 4KTVE 2F8TA 1EE9A 3ROGA 2VNJA 4PPQA 3KPYA 4IHAA 4RVCA 4DAOA 8AT1A 3NVAA 2QTCA 5F7ZA 1I1OA 2SECE 3RNLA 1J1UA 4B83A 2ZROA 4EO9A 4YECA 1NXWA 3VPCA 2ZCUA 1MHTA 4B3MB 3UT5A 1UQUA 4C0SA 1XDSA 4IUBS 1YZHA 2FGKA 3EQ9A 1PNQA 3URKA 2Q4RA 2VP0A 3UJ9A 4BNJA 3ZV7A 5FIFA 4P58A 2GF9A 2IQ5A 4L28A 2BH2A 5DNYB 3AP1A 2VPTA 4LGCA 3D54D 1RLJA 3ZIAA 5U1PA 2P9CA 4Z3DA 1TCAA 3EEQA 4LKOA 3B78A 4K40A 4QELA 1CQXA 2YJ4A 2R5NA 2HT6A 1PJCA 2OHOA 4XQCA 1I7PA 2O3JA 3T5BA 2RGNA 1AO0A 4BZXA 2WINI 8ATCA 1CUIA 3CRQA 3QJGA 4JEIA 2B99A 1US8B 4O33A 1Z25A 4WIAA 3ZCVA 1W0JA 2EATA 3O2JA 3MAJA 4I8DA 1O03A 4UW9A 5B5SA 2Y6UA 3U7HB 3UW3A 5K6AC 5IMBA 1I7LA 3KOZA 5TQ0A 4F7WA 3OCJA 2YNMD 3LBYA 3TW0A 3BREA 4IJWA 4TRNA 2A9VA 2VYVD 3BFVA 4J0FA 3OJOA 5KJEA 3N8DA 1APBA 4X1YA 4LY3A 4Y7CA 1K86A 1FSGA 2W6JA 1TK2A 2A9RA 5SYAA 4D41A 3LU1A 4IUDS 4BTVA 4U9HS 5C8VA 4D26A 3EVNA 3WB9A 3FYTA 4ZJZA 1S7CA 3HWX1 3D6HA 4BTLA 2B98A 3H9EO 3BXOA 1PYDA 3K9FC 1NTOA 4FQ8A 5DMXA 1UAAA 2RHMA 5I7OA 3HCRA 1GZ5A 2NU7A 2XI4A 2OHXA 1J0DA 2YIDA 1T29A 2NYVA 1VYVA 3KQYA 2DX7A 2FWIA 3DV2A 1YB1A 3E2PA 2OAQ1 3GUVA 3NCHA 4CIDA 1QKKA 4ZDJA 4U1RA 1QVAA 2X4DA 5K51A 4B9AA 5C35A 1LUAA 4LJAA 3L7KA 2P4HX 3CO5A 2JC3A 4BQNA 1KYIA 2IS6A 3TTWA 1C4WA 3H6GA 3LUBA 1KDZA 3RVDA 1U0NA 1GAEO 5EA2A 2V74B 5ILGA 3KSDO 4G65A 4ECEA 3BMOA 3B2EA 1T4BA 1RHJA 4IFTA 3RYFA 2VUTA 4M37A 1WHSA 3EIUA 1PJ8A 2JI8A 2WF6A 4QUKA 4DMLA 5B6JA 4G9EA 1FMFA 3NC0C 4II2A 4ZYXA 4XIFA 4CM3A 1ADFA 3NWJA 5EFZA 2A5LA 3QLVC 1JZTA 1U0FA 2ZU0C 2ZVQX 1K6XA 1EGHA 2BZSA 2GD1O 2H2AA 2JCYA 1GHTA 3EW7A 4FR2A 4KP7A 1XRPA 5AJYA 8LDHA 3IVRA 2R8PA 1GGHA 2WKQA 3PWSA 5DN6A 3TRDA 5I7VA 1UWKA 3BILA 3DULA 1R66A 2D1TA 2AOWA 2E89A 5LQCA 4YHHB 4FU0A 3MD9A 3UC5A 2WUVA 1THGA 2AKYA 3EIFA 3UAGA 3F3KA 1XQWA 3FIUA 4XYGA 5ALEA 2AFHE 1XJ0A 4BGEA 2WIFA 1ESZA 4IHJB 1WEHA 4GBJA 2OM2A 3QKSB 4L0MA 4Q7QA 2VOJA 1SB9A 3EXG1 4TQGA 4WCFA 1Z45A 3GGGA 2ZL2A 3T9DA 5DM4A 1GTSA 1GXSB 4Z7NB 4U2BA 5FOWA 2V7QD 1OX4A 3VI3B 3C3DA 4KR7A 1SVIA 2P1ZA 2PUJA 3T7JA 5AUOB 4F4FA 1JZQA 2R6GA 2Y27A 4OUKX 1BEZA 1D9XA 4BJ3A 3IEKA 1BCRB 1F3LA 3EWAA 4V0ME 4WHMA 3Q4GA 3UWPA 4BXOB 4E5NA 1AT1A 2JLSA 4IIJB 1EFVA 2ZYSA 3FY4A 5F33A 1MEEA 1T3GA 4NAHA 4ESOA 2R6HA 3DNFA 4CFYA 4D9KA 4MI1A 3PZKA 1ILWA 3MJRA 4U9IS 3F6CA 4MV1A 4R1OA 3U40A 4RJTA 5LWQA 2V98A 1DXOA 1PQ4A 3E9QA 3F8WA 5T7BA 1PX0A 1KDTA 4UJ5A 3UKJA 3U7RA 5J40A 2IPAB 4ZI5A 5TMBA 2B8JA 3B8HA 5EQFA 4JI5B 3NTRA 1MOZA 4R2WA 3LMKA 3W1WA 5JXIA 4MPDA 4CG3A 2BCEA 4ME6A 4CT0A 4CV2A 4CL8A 1TFUA 1MGPA 2R0QC 3TQCA 5SV2A 1Z6YA 2PN1A 4R1MA 3SNKA 5F98A 4GT1A 3NOOA 3K09A 5CPFA 4MKIA 9GPBA 2IVFA 2IP1A 4CLDA 5L7WA 2FDCA 4L2IA 1MRZA 3ZJYA 4BKQA 1PZGA 1RM4A 2BUBA 3KZCA 4H7PA 2FEOA 2YMMA 3MRVA 4DLVA 4GS5A 3OT4A 3WL5A 1R1DA 3GEPA 2ZJ4A 4MV4A 4JT8A 2ZRLA 4P4GA 1FSSA 4IQGA 4YJHA 4PM4A 5TMDA 2I4IA 3TFQA 5K05A 4RXMA 3T3PB 2PR7A 3X2EA 5JJKA 4D99A 2C0PA 4OFWA 5FNZA 3DBOB 2C3MA 4HTFB 4N01A 4Y9RA 3GEHA 4PC7A 3IX7A 3DWEX 1CIPA 3WFIA 4CI9A 1ODSA 2C9DA 1H94A 1UXIA 3NHRA 4BMDA 4DR3B 1C41A 4PFKA 3BFJA 3DTVD 4Q9IA 2R8ZA 1B43A 4EW1A 4NU0A 3TSAA 1UXJA 4A91A 1NBWB 2D3WA 4ZFNA 5KNBD 3L4JA 1GIAA 4LBYA 3HDJA 3BOSA 4K5QA 3HC7A 1X39A 1FS4A 1GGNA 3W5DA 5EC8A 4HDAA 3BEDA 3Q2KA 1DCFA 1L7MA 3CJRA 3KZXA 3MMZA 2Z30A 4G8DA 3LY8A 4NHEA 4TTAA 3W1VA 3HXTA 4E2YA 2GK3A 2B34A 4ZEVA 5CT8A 4AVYA 1JR4A 5FWYB 5COQA 1EB9A 3K0HA 5BRNA 4IIHA 3PC8A 4KITB 4GEGA 4KFSA 2NYAA 4EDHA 1K68A 1QDLB 1T9CA 4Y2UA 6REQA 1G18A 2H06A 2XHEA 3USZA 2HJVA 2AMJA 4UASA 5F5NA 1KOLA 3IBFA 1QBGA 4KC0A 2HSGA 3ROTA 4P4SB 1LVUA 1SBTA 3DFMA 2NTEA 1N0VC 3GNLA 4GR5A 3BWYA 4Q3CA 5EHGA 2GKGA 3FVTA 4GZ5A 3I62A 4KRFA 1USUA 4PANA 1BXRB 2AQ8A 2FPWA 3FPKA 1YVRA 2OHGA 2PGAA 2ZYTX 3R77A 2CUKA 1OB2A 2XTJA 1A2QA 4KAFA 2F6RA 3NAQA 4FN5A 1XJWA 3WGLA 2VCYA 4BQOA 1NSYA 1KBQA 3TZBA 3LDGA 2DOKA 3HCAA 3LX5A 5JXHA 1OZGA 3O95A 2CHGA 4K87A 4TVBA 3RSOA 1W36D 3EGOA 4ZU6X 4GPAA 5ALMA 2C58A 1NOJA 2F9LA 3PJEA 3ZW9A 1Y34E 2DECA 1GTVA 1PZEA 3CIFA 1XMIA 3HZOA 3MILA 2IYOA 2VH5R 2UVDA 3RRYA 4I4ZA 5E7JA 1WMDA 2ZB2A 3WKEA 1ONSA 4LZWA 1WP9A 1JAHA 5I7RA 4R69A 1VPWA 2ADOA 1QZ3A 3RVQA 3FNIA 3BBLA 5G3ZA 4C5CA 4DJAA 1BVRA 1XCPA 1AUXA 3K92A 2JEOA 1D2EA 1M75A 4GW3A 5AM2A 4MHTA 5BOSA 4P7FA 5KNCA 3EVCA 3B6ZA 5CD1A 4JYAB 4EMMA 1WQ1R 5LMUB 4D0GA 1L5KA 1U2RA 5D01A 4NYJR 3GLIB 4EJSA 3T9CA 1C9DB 1WPQA 2G4CA 2XTAA 3QF7A 1JXOA 2I54A 4QOJA 2BLNA 1HT0A 3H5VA 3OTGA 2QRLA 3LPLA 1V1RB 4JLPA 4PICA 4DARA 3RDPA 3N0XA 1DC5A 3HDTA 1O54A 4WY2A 3WSTA 4X60A 3JYPA 2AZDA 1P0MA 3MQ4A 1Z2AA 3TD2A 4B4OA 3K72B 5FWNA 4JQYA 4JLNA 4DANA 5ITWA 3DJAA 3KOOA 5YASA 3V4OA 3A6GA 1A8SA 3DOHA 3JZMA 1CCWA 3A9RA 3CSSA 3WZ2A 2ZPUA 3K30A 1NW6A 3R0ZA 4ER5A 4HDSB 5ADVA 3CUTA 4P4NA 5T8KC 2QBYA 4DLSA 2N0SA 3H1PA 5CB4F 3CSUA 5IX8A 5J2UB 4GHNA 2ZAOA 1LPSA 1J07A 3LPMA 2V6GA 4N12A 5CLQA 3Q1KA 1E9FA 2D4AA 3FWZA 5L51A 4RHFA 3KSZO 5TJHA 3PWKA 2QU7A 1BMFA 2FFAA 2RCNA 5ALJA 1G3RA 1DHRA 3W5AA 4BP9A 3FW1A 4L3OA 3FDIA 2B2CA 2Y1EA 2WWFA 4E15A 3FUVA 5TSDA 4AJEA 5HZHA 2IEYA 4AIIA 2IS2A 2G28A 2RGEA 4UCFA 4KFCA 5LQNA 4HB0A 2H85A 3IHLA 5F51A 3ZD8A 3K0CA 1OZFA 4LPKA 1TXGA 4R9UC 4FWTA 1PFVA 3ZWNA 2G17A 5D3ZA 2B78A 2I67A 4JOTA 2VP9A 3HE3A 3UBMA 3ZHUA 3OCZA 2I2DA 4NARA 5F35A 2Q35A 1LH0A 4E03A 4YMVA 6AT1A 3E4DA 2YFKA 1TIKA 3R9WA 5LNK1 2X9LA 4W4TA 5DLEA 2J8ZA 4DSOA 5G0TA 3OEHA 1XQ6A 5H8WA 2FPXA 1HZJA 3TT7A 3KCNA 3J81k 4RK4A 4ZVPA 3B20A 4EPTA 1RLTA 3GT0A 4XFDA 1NVVQ 2O3SA 3FB4A 1VRWA 2O07A 1VHWA 3H11A 3H9JA 5HBGA 5F78A 1I2DA 3AJ9A 3HA3A 5AD1A 5KQGA 2X0EA 1QHHA 3CXUA 3R5SA 3R76A 4BEWA 5JROA 1NP6A 2ALJA 3MWFA 2WE7A 5FXMA 2C5FA 2DFLA 1KAHA 3BSFA 1MLDA 3ISJA 2AXPA 1JFRA 2OM6A 1TK3A 3ESBA 3NBMA 3B38A 2ONJA 3RAPR 1Z5NA 2V6IA 3OEWA 4CHTA 3BAZA 3DB2A 3ONWA 1BOFA 1WXFA 2JFNA 3FM9A 2V0CA 3FZEA 5CXSA 3CR3C 1JEOA 2HMWA 1SO8A 3QMVA 3DE4X 5IC6A 4DUZB 1H2EA 1YC5A 2IHJA 2GM9A 2CNWD 4EY6A 3FUWA 1I7DA 2G82A 1IJBA 1JJFA 3GN2A 4LXHA 5EMMA 5I9MA 2PRJA 3REQA 4I42A 3FYUC 3JTMA 2XCRB 1NI3A 1CNFA 3MYRA 1VKJA 3EDCA 2FRVA 3E9YA 5B3LA 4AG6A 4DMFA 1KZ4A 2AOUA 2PLNA 3K6JA 2Z8XA 5IT5A 3IAFA 4K9OA 5JIBA 4U0GA 3GOHA 1KFCB 2XNSA 1I4EB 2C03A 4ASIA 1SNYA 1V3TA 4GAEA 3IUEA 2CDAA 2FEXA 3UJNA 3RSLA 2IHUA 2GGSA 3GV0A 4G5RA 1FUKA 4B17A 1NBOA 3E1GA 2NXEA 4X1KA 4BMOB 2JBWA 1DMSA 1JG2A 1KY4A 4H60A 1GPKA 4IJUA 3ZZMA 3FHCB 2R11A 3NUZA 1POXA 3D1LA 2RAPA 4WFQA 1AU9A 1LLQA 3KOUA 4LRQA 4FFNA 1BHSA 4OQZA 2ZL4A 3SQOA 2FB9A 3OWHA 3FYUB 4RHXA 4TKZA 4RMNA 2O7QA 5EJAA 1RHQA 2HCTA 3AFHA 3CLVA 4GG1A 5AHRA 3WYEA 2X9NA 5L95A 1LSUA 4NBRA 4KNYA 2RHDA 1GR0A 2BGKA 3TTSA 5A2GA 3HCFA 1SD1A 5TGTA 3R9KA 5AOAA 1YBMA 2BISA 3PHGA 1T4GA 2LIVA 2E37A 2P9TA 2VDJA 3BHJA 4HGYA 4LGMA 4WESA 4G4IA 3ZWOA 4UPEA 2JH9A 2PZ8A 1RACA 1T9AA 3RTBA 1OH5A 4OGLA 5IPFA 4IZHA 5T4EA 1QCDA 4H1HA 1L8QA 3HBMA 4QWWA 1SCJA 5DK6A 5AI5A 4QG3A 4J29A 4PRKA 4WVLA 3T7CA 4D4JA 1Y9AA 3DLAA 4QDZA 1IY9A 1R12A 2A84A 1GPLA 4HAIA 3KXDA 2VCHA 4YYEA 3ZK9A 5FPKA 5A4MS 2LDBA 1X6VA 4FUTA 2Q1SA 1I6WA 3H9GA 1YDGA 4DABA 2QGZA 3G2MA 5ESWA 4R1LA 4CEJB 4KK3A 3KQTA 2FV8A 3ROQA 4UE3S 5KTYA 2PJZA 3CUWA 3QX7A 4P92A 3LH5A 3ELWA 2YIJA 2YJ3A 3DDCA 3OI7A 4UE6A 1Z8NA 1RJ9B 3OJFA 5EMNA 3V3TA 4AJ2A 1II8B 3DZ8A 2R8YA 1O58A 3ON5A 2HGZA 3H7AA 4LHSA 5G0SA 1NUUA 4MVXA 4S35A 3HXMA 1NLMA 4V02A 2XUOA 1N5DA 2UYHA 1KAQA 4UOEA 1TZ2A 1ADYA 2FSFA 1O08A 5ENDA 3OD5A 4FCCA 5EPUA 2PD6A 4DJEC 4P7KA 4UDXX 1PEKE 3I3OA 3T94A 3ZWPA 4RHUA 1T0BA 5KWIA 2IU0A 2QQEA 4MUYA 1B8OA 5K2OA 2V1UA 4AN0A 3QEBZ 4KQIA 4TWAA 4RMHA 1SC6A 1B15A 1P0CA 3BEZA 4ZGBA 1BDMA 3DVLA 4K26A 3GG2A 3B1XA 4OXYA 4ML3A 3GFQA 1PJTA 1TT7A 3WRYC 2CJYA 2WAMA 3QU4A 1XFDA 1QH1B 4QT0A 4YN3A 1IRIA 3GDGA 3EUWA 1XAHA 2VYNA 5HIAA 3QPWA 4LF5B 4LYYA 1R4NB 1ZZGA 4HEJA 1HEYA 4EARA 2GAIA 2QZ4A 3EBOA 4HQFA 4MIOA 4BN0A 1UQTA 1X7WA 2YIVX 2HTFA 1M7GA 3AUXA 3E5HA 4RD0A 5CVVA 3SYMA 1EFLA 1G3QA 3L3BA 4ZYUA 3LYAA 1BDBA 1LPMA 2A4MA 3CF0A 3HN7A 5T3UA 4BNIA 3FMVA 4WPGA 3R9XB 1E63A 2IW3A 1E5XA 2XVMA 3MLBA 1BWRA 5EXDA 2UVPA 4B3XA 3UJHA 1V71A 4LHWA 1YK1A 5D6OA 1U90A 3K9BA 2WZDA 4ZC1A 1JVSA 4BRWA 3WLKX 4Q7LA 4L7VA 1G21A 1Z07A 2OL4A 5AKYA 4CMEC 2HL6A 2R1UA 9MHTA 2FPUA 5SY9A 4ZCPA 3DVQX 2GZMA 3IP1A 1HLPA 4IHJF 1MAUA 3TPZA 3W3AH 2ENWA 1M6VB 5JSZB 1B0AA 1PKEA 1KEEA 1ZEJA 1WHTB 3OLXA 4E07A 1JLRA 3P8ZA 1NF8A 2BBTA 3FCEA 3OD1A 4J7XA 3SDZA 4IDGA 4K9NA 3CCCA 1UZMA 2ZQZA 3LSYA 4LXGA 4OHXA 5SICE 4DV1B 4M1TA 2R84A 2BY4A 1X0XA 5DVZA 4L4ZA 1HGXA 2WHRA 1EFRD 3GUZA 2ZWOA 3L7JA 4HNTA 2EARA 4XTCS 3QF4A 1KBZA 1W29A 4RADA 4B73A 1NN1A 4V2IA 3MT6A 2BE7A 3VFDA 2G9ZA 3L0YA 2Q6VA 4M9ZA 2QNIA 2XDWA 4WI1A 4A8PA 1NKTA 3PC6A 3DUWA 5MDHA 1GRNA 3BGIA 4UU0A 4NAUA 1ECPA 3ZI7A 5B58T 3WLQA