3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
4XEHA 2ZCVA 5IDWA 3PK0A 2W2KB 3Q11A 9LDTA 4C7JA 2YY7A 5EINA 3S2IA 3U9SB 3QWHA 1ON3A 3QK8A 2I6TA 4O1MA 1OAAA 1YJQA 4NPCA 4M87A 3C85A 4LGVA 4U1AA 3TWOA 1TB4A 4IZDA 4U19A 3DHYA 1V3UA 4G65A 1PU2A 4WCFC 1UXIA 3UFXA 1DIRA 1UP7A 5BNIA 4QO7A 4AJPA 4BQRA 2AE2A 1XG5A 2A9FA 4DQXA 1EVJA 4OMUA 4FCCA 1PGJA 4O59O 2CSUA 4NK5A 2I99A 3DMYA 4R5HA 5L4SA 3DBLB 3OQ1A 3T3WA 1R4MA 1VSVA 2C7VA 4B7UA 3VC7A 5ILGA 1X0UA 4E3ZA 4JWVA 1PSDA 2BELA 2FPGA 1P1JA 1E7SA 2VOEA 5A4DA 3E8XA 3M1LA 2BMAA 1BXGB 4CV0A 2Z1NA 1PS0A 2JFHA 3EHEA 3WWYA 2NU7A 2X9VA 4UVHA 4RF4A 4DWVA 3H81A 1PZGA 1A7AA 2Y1GA 1Y5MA 3ENKA 5I9LA 3QYRA 1KVUA 5I8WA 4PLHA 1P1HA 1UP4A 4JJFA 4YT4A 3LLVA 4NFYA 2PKQP 3ZI0A 2F6QA 2P5UA 4F47A 2Z1MA 4Q9NA 1J4AA 3SLKA 1PJ2A 4MP6A 4FZWA 2EKPA 3K96A 4LRSB 4CMEA 4PZEA 4I5EA 3M6MA 1ZW1A 2R00A 4M1QA 1V8BA 5HRUA 3C1AA 3MTGA 1SPXA 5AVOA 4Z3DA 4QIJA 4QSMA 3FD8A 4YJGA 1DCIA 1DO8A 1JAYA 4WECA 4YBZA 4ONEA 6ADHA 3HNPA 2EW8A 1UXKA 4BNNA 1N1GA 4UUOA 1JVSA 5IDXA 3ANLA 4HX5A 1NXQA 1HXHA 2YFQA 1U28A 3ZV3A 2GN4A 5CEJA 4GBJA 1QV6A 2HMVA 2YQ5A 1YDWA 4OKNA 2NNLD 4GMFA 4D0SA 1ENZA 2DPHA 2IE0A 4TMFA 4DBZA 4BNLA 4U5QA 1B8UA 4GKVA 4BGIA 1VKNA 2GSDA 4CQMA 3FNEA 5COBA 3PEAA 2B0JA 3HDHA 5CP8A 4J7XA 5IAAA 1LLUA 3ETEA 4W9NC 2Y1DA 3P7MA 1ZBQA 1X1EA 3L9XA 3T8AA 1NM5A 1A7KA 3G49A 5TGDA 1VRGA 2D5CA 3RKUA 3DBVO 1UXHA 3PGJA 3IDSA 1B14A 3KRTA 1XO6A 5C7IO 2W2KA 3OBBA 5HS6A 4MVJH 4NH4A 2VYVD 4XYMA 4NK4A 1KIFA 3QREA 4WCZA 3T4EA 3C1TA 4Q3CA 2GNAA 5LDHA 3QVOA 1PX0A 3ZHXA 4ZDBA 1E7QA 1B8PA 3RUDA 2B5VA 4XQEA 4R1TA 3BZUA 4R68A 1ID1A 3IJPA 1E6WA 2GD1O 4PLYA 3GEMA 3ROKA 1KOLA 3ITDA 5COAA 3IJRA 1HDZA 4G2NA 2BKAA 1HDGO 3I3OA 1ISMA 5JFOA 4R1UA 2B83A 3FNFA 1YBVA 1XA0A 1NASA 5ILOA 2O3QA 4IIUA 4R01A 3WLEA 1TA4A 3B1FA 2Q3EA 1R0LA 2VWPA 2BI7A 3BHMA 4FS3A 3DBLA 5JC1A 3IBBA 4HNGA 2D5AA 1RJWA 2IZZA 2C0CA 2W8ZA 2HCTA 1BXGA 5J23A 3KQFA 1LDEA 2IEDA 1K0UA 4EJ6A 2I65A 1KBZA 2Q35A 4I52A 4N54A 5A3VA 1QKIA 3DBHB 4PG5A 1DIBA 1YWGO 1ZSNA 4M86A 1OI7A 3GN1A 3H2ZA 3NEPX 3QWFA 3PJEA 4L0QA 1N6FA 1HWYA 3DB2A 3NJDA 2G82A 4IDGA 1N6DA 1GCOA 2O4CA 1PR9A 2X7HA 3VVBA 1HDYA 3GA0A 1NQAO 1EK6A 3VPXA 4DIOA 4TRJA 1ISHA 2J3HA 4YJDA 5B4UA 1N7HA 3KTKA 2H6EA 4BNTA 1DLJA 3GAZA 5CPFA 4MOUA 1UAYA 4Y8VA 3FRJA 3L77A 5JLAA 5CDYA 3T8BA 3V2HA 1GZ6A 3PEFA 1DOHA 4DYVA 4MIEA 4IDFA 1ZVMA 4L76A 1I3LA 2A35A 2AE1A 4A2CA 2JD2A 3DZJA 2FZSA 2EF1A 1WXDA 4BOYA 4WOJA 4EBFA 4XYGA 4RJTA 4M54A 3MZ0A 3QP9A 3R9SA 5FWNA 3GDGA 3CXRA 3RROA 1P33A 4JCTA 4IUYA 3L4SO 4GX0A 1A5ZA 4YEDA 1EQ2A 3HE3A 4DI1A 4IDAA 1KEVA 1XSEA 3PJGA 2DAPA 2FPPA 1I01A 1YQDA 2EGHA 2NADA 4QFCA 3TDKA 1PJSA 4NBVA 4CLXA 1Y8RB 1OFGA 2WD8A 4P8RA 2Q99A 4U0GA 1CERA 4FIZA 2PKQO 3DTYA 1O9BA 3N74A 5T8KC 1NAHA 2D4AA 4Q39A 2O2YA 5AXDA 5BSEA 1A9ZA 4NR0A 3G3EA 1I2ZA 1B26A 1BVUA 7ADHA 4KUEA 5C5IA 4JROA 3B6ZA 1DIHA 2DM6A 2WEKA 3H2SA 3P19A 3C7DB 3DDNA 1E3WB 2GDZA 3RCBA 5A9RA 1IZ9A 3QIVA 5L4NA 3MWDB 2ZTLA 3PHHA 5EPOA 4ELXA 4URFA 1SAYA 2E48A 2BRUA 5T57A 3I9LA 3QV1A 3V8BA 2J5GA 4JJIA 1KVRA 4GHNA 4S3MA 1UYTA 4MP3A 1PZHA 2DC1A 3IP1A 2UUOA 1J5PA 2VUUA 2X9GA 3Q0GA 1PJCA 4FB5A 5GZ3A 1EUCA 4OM8A 4XCVA 4FJ1A 3L6DA 4MJLA 4A03A 1FDSA 1PJTA 2GF2A 5JSFA 5JMWA 2Q2WA 4NBTA 5KJ1A 3DXFA 3EW7A 4WASA 3TSCA 2EJVA 4CM8B 3HP0A 3OA0A 1NVGA 4FC6A 1IB6A 3AM3A 4GPD1 4DPLA 3H9EO 1PEDA 4FBGA 3B1JA 4IDDA 5F5NA 2AA3A 3TZ6A 1ADGA 4BNFA 3EVNA 1A4IA 1XDWA 2DUWA 3A14A 1B3RA 4TKLA 4GQAA 1HZZA 4BNJA 2J5RA 2YFHA 3DBHA 4I8XA 4TZKA 2EIHA 2UVDA 3K5PA 2PLAA 4INAA 1FMCA 4ND2A 4CLOB 3PZRA 1LDBA 2VSUF 2YZ7A 1SEVA 3ZWPA 2PY6A 3HE2A 1EDOA 2IEBA 3WGQA 4BMSA 3IMFA 2IXAA 1CETA 4YXFA 4I4ZA 2UYYA 3P85A 1KS9A 2NLOA 5JY6A 3W8DA 4K1LA 3RRVA 4YB8A 3I83A 4YT2A 2GO1A 5TIIA 3S2FA 2R2GA 3A28A 4RL6A 3AY7A 4OL9A 2QQ5A 2DUUA 3PWKA 5JC8A 3OJOA 3WGOA 3GK3A 1FDWA 4MVJD 1DC3A 3BXXA 2GZ1A 3DL2A 1E3EA 4CM4B 2OUIA 1RYDA 3KBOA 3JQBA 3MJCA 4TSKA 4HFRA 5INGA 2E49A 1TT5B 3NDJA 3GC6A 3ANNA 5G0VA 4I5GA 3SJ7A 3JQGB 5TC4A 3FTPA 4IJKA 1XR3A 1L1FA 3WJ7A 3JYNA 3DQPA 1Y8RA 5C90A 3CIFA 3WGHA 2P91A 4AL4A 2XXBA 1U5CA 5B1YA 3LT2A 4RYFA 1UAGA 1H2HA 4NFHA 2C29D 1KETA 2FSVA 5DU6A 1UJMA 2QRKA 2O4UX 1H6BA 1JQBA 1T2FA 4HNHA 5IFLA 3D0OA 3LK7A 4UREA 1M2WA 2JFGA 2W90A 1ZIDA 1E3WA 4RPJA 3NUGA 1MUUA 1UXJA 1ENOA 3PDUA 3AY3A 4ZU2A 2NU8A 3G1UA 2CDCA 3NAQA 1DEHA 7MDHA 3DOJA 3H5AA 5JO9A 3QQPA 5CPBA 4ZD6A 2BFAA 4RQUA 4YWJA 4ALKA 4GVLA 4LW8A 2ZQYA 3DMTA 5CFZA 5I9NA 2PFGA 3NJBA 3A4VA 4JK3A 4FDAA 4IZIA 3KZVA 3FNGA 5G2OA 1X7HA 2BFOA 2DBRA 2FPIA 4AICA 1ULSA 4MKRA 3WJAA 1I33A 4E2XA 3PDJA 4CM8A 2D1YA 4U8GA 3GUCA 1AUPA 3QE3A 3GEGA 2P68A 3DJAA 2DU8A 1F06A 5T5QA 1YE3A 2BGKA 3O38A 1XU7A 3H0JA 1X0XA 5K0ZA 1T1RA 4BB6A 5I7VA 2WE7A 4NJMB 3DZFA 3ZZNA 3UN1A 1QMGA 1E6UA 5A05A 5G1SA 4K9DA 3IUPA 4WK6A 5CG2A 2NU6A 2Y0DA 4AJKA 3U4IA 4QQRA 1JTVA 4ZQBA 3OICA 1XCBA 3UCFA 2ZCUA 2FZEA 4BUCA 3OSUA 4ZU3A 3RFVA 1PL7A 4CLOA 2PZLA 1YBAA 2V6MA 3A9WA 3ZU2A 1BXKA 1GEGA 3ETDA 4BNMA 3DWFA 2P9EA 4B3HA 4E32A 4FN4A 3DZBA 4PRKA 4C7KA 3CE6A 2DTXA 4D46A 4Q3BA 3TPCA 3WMWA 1V35A 4BNVA 1SC6A 1LDGA 4JQCA 4OO3A 1J49A 3LYLA 1U7HA 2Y05A 4L4RA 3WTBA 2ZJ1A 2GRAA 4GM2A 5BNFA 3PWZA 1U2DA 4CM4A 4E33A 1LC3A 2ZQQA 2JCXA 3GFBA 1D7OA 4U0JA 3JD1A 2Q45A 3RASA 1TT5A 1X14A 2VN8A 3FPLA 1I3KA 1NR1A 1YL6A 4MOWA 5COQA 1IHXA 3JQGA 3JYOA 1BVRA 1H0KA 1VPDA 3UUWA 2EKQA 3QVTA 5DN9A 2NUAA 5F3RA 3GQVA 1CQJA 1QYCA 3M6NA 1GV1A 3GMDA 2O3JA 1SZOA 2B5WA 1YXMA 4Z0HO 4QFDA 4LSWA 1MFZA 1NBOA 1VL0A 4YDRA 2OFPA 4W7HA 5THKA 3O8QB 1ONOA 1PIWA 1YB4A 1GYPA 3HB4X 1U3WA 1MG5A 1I24A 4OGWA 3INTA 1GD1O 1KEWA 1M76A 2XOXA 3MJEA 3KYBA 1HZDA 4ROSA 4J2HA 3UF0A 1Z75A 2Y67A 2JHFA 4YRDA 1K6IA 4JSBA 3Q1LA 3OP4A 4ITUA 4XIJA 3GVHA 4FZWC 5JY1A 4JP2A 4R16A 5EJ2A 4CMEC 1WZIA 3ZU3A 4FGWA 4MI2A 1MLDA 4QUKA 3W4IA 2ZIZA 4IQ8A 2VUTA 3R0IA 1KC1A 3DAGA 4E6PA 1WDMA 3G1TA 2NV6A 3DZHA 2VWGA 5JAIA 3JU1A 1PZEA 1M75A 2O2SA 2POQX 4JX8A 3WQQA 3W4KA 4AJLA 4BQPA 2GN6A 4IQGA 5AXAA 3WBBA 1K6XA 2J8ZA 5KJFA 4Q0GA 3SWXA 4RF3A 4CL8A 2EJ5A 3JQFA 1H9BA 4ND4A 3NRCA 3OH8A 4GX2A 1Z82A 4NJMA 1E3JA 5AXCA 5TNXA 2AQKA 4J4TA 1WLYA 3QWIA 4RPGA 2PH5A 3L07A 1LXCA 1ZKMA 2GUGA 4L8VA 2WTBA 2FOIA 3HJAA 2VTDA 4ZQFA 1ML3A 2BZRA 3LVFO 2Q50A 3UOGA 4B4VA 3GLQA 2EERA 4YT5A 1LBEA 3GVIA 1K32A 4CM7A 1SG4A 1JW9B 3KYDB 3F46A 3FN4A 5JNLA 4RLSA 4LSMA 1YG6A 2PPYA 4OQZA 3NV9A 2F1KA 5T64A 2B4QA 5JW6A 1E77A 2UDPA 4IY1A 1MJ3A 1N1EA 3GPDG 3ADOA 3PJFA 1R0SA 3G79A 3TZ3A 4FB8A 1GZ4A 1JN0A 1YGYA 4DLAA 5IDQA 1P3DA 2D59A 4PZCA 4W82A 2E37A 3WGGA 3E5MA 4J1SA 5JS6A 1U7TA 2VWQA 1NPYA 4MVJF 1GZ3A 4BL5A 3C1OA 4WKGA 2VSUE 4YAGA 1DC6A 1O95A 1HDRA 4HC8A 2OGUA 4I9HA 1H5QA 3Q2IA 3CPSA 1YB1A 3EDMA 3WNQA 3BIOA 5DF1A 5AQ1A 1NPDA 3LKEA 1PS9A 2QYSA 2UAGA 1U9JA 3AM4A 3C7CB 2QIOA 4OQYA 4XQGA 3E5RA 3RFTA 3QWAA 3Q2KA 4N5NA 4PLGA 4EMMA 3W1VA 5FI3A 3O8QA 5KVCA 4KD6A 5L3ZA 1JDJA 1QRRA 4YQYA 3V5EA 4RVDA 4J6FA 2FR0A 4K2NA 1HZJA 1FC7A 3L6OO 3JV7A 3RJ9A 4EMLA 4XYEA 1U3UA 5L7YA 3MJ4A 4A73A 3GZNB 3NTOA 4JBGA 3Q6IA 4DQVA 1R4NB 3AOGA 3AUAA 5CTBA 1Y9AA 4B7XA 2NTNA 1EE9A 3RI3A 2OO5A 5CDSA 2YV3A 2DT5A 3QW2A 4J43A 3AI3A 4HFMA 4CM9A 4NEKA 4BIIA 3TVUA 3RUAA 3SC4A 4Z9FA 3OA2A 3FR8A 3ZHZA 1P1IA 3GRKA 2QQ3A 1H2BA 4FW8A 4IGEA 2JKVA 2Y1OA 3RC1A 3QVXA 2WDZA 2X0IA 2DTDA 1QG6A 3QVWA 2PZJA 2ZYGA 3GEDA 4OKIA 4OSPA 2GTRA 4QIIA 3KUXA 1EY3A 4KWHA 3SX2A 5K9ZA 3KO8A 4A26A 5INIA 2Y93A 1IZ0A 1YQXA 2NP9A 3BHIA 1A27A 1KYQA 3TNLA 1C0IA 4CUZA 2W2LA 3KXDA 4J90A 4ELSA 2AG5A 3VTZA 1WPQA 3Q9UA 2YYYA 4RDHA 4CM5A 4PFJA 3T7CA 5L53A 2P2SA 4GKBA 5HA5A 3INGA 2P4HX 2Q4BA 1D1SA 3H6KA 4IZCA 3DOCA 3FWZA 3IC5A 1B7GO 3F5QA 4W6ZA 2EG9A 5DOVA 3AJRA 5TX7A 1ZMTA 5BNTA 3S2EA 3WTCA 3UH1A 4ZQHA 3WQSB 3VVCA 4RCVA 3WG9A 4PN3A 2VRBA 3EMKA 3PYXA 4CR6A 1HF3A 1QP8A 3WR5A 1YL5A 4R5MA 1C1DB 2BHLA 2Q1SA 3V1YA 1TEHA 4EW6A 3BMOB 3KYDA 2AMFA 4DUPA 1J6UA 4PG8A 3WQRA 4OH1A 4HADA 4CUKA 8LDHA 2ZB7A 3WIDA 2ZB4A 1ISIA 3D4OA 4OSOA 3QLJA 2C8TA 2ZQZA 1HYGA 4GX1A 4CMJA 1ZK1A 5DBIA 1GV0A 3NYWA 4ZVVA 4A5OA 5GZ6A 4BO3A 1JLLA 1LNQA 4H3VA 1ZUD1 3DBRB 5AOVA 2VSSF 4PLFA 3PI7A 2RHRA 2F6IA 4FSHA 4E13A 2X4GA 2Q1WA 1Q51A 3VKUA 4FN8A 4K26A 4I9NA 3GOHA 5IZCA 1M6WA 1E6EA 5IKLB 3TL2A 4PVDA 4KTVE 2E4AA 3H3JA 4MDHA 4D45A 1ZEJA 1ZK3A 2DEOA 1XU9A 1NP3A 2X5OA 3KYCB 3GN2A 1D1TA 2IDZA 4CUJA 1Y9EA 1Q7GA 3E18A 1WZ8A 3ZHBA 1Z7EA 4B4WA 2J3KA 2NTJA 2J3IA 4R3NA 3GF3A 1TVEA 4BGUA 3H5RA 5L7WA 5DZKA 5DCYA 4OOFA 2J6IA 2PD4A 2QZZA 4UAGA 1N5DA 2B4TO 1MX3A 1TXGA 2EKLA 4JXKA 3KV3O 2JL1A 2VWHA 3GLMA 3GZNA 3L6EA 3M1AA 3PQEA 4NJOA 4AJ1A 5KNLA 1R4NA 1RPNA 5EIOA 3H65A 3PQDA 3RSHA 4EUHA 4IXWA 3I4CA 4XYBA 2G1UA 4XB1A 2CZCA 3ST9A 4ALLA 3WWZA 4WYOB 3CUKA 1B3BA 3UHAA 4MVJM 5I7SA 1XQ6A 1QORA 2Q2VA 3MOYA 3LC7O 3OECA 2J3JA 3OEYA 4A0SA 1LU9A 2VNSA 4ELWA 2CBYA 1KVQA 1EUDA 1WAMA 1GU7A 5DT9A 1SOWA 2AQHA 2GR9A 1Q2XA 1T24A 2VNAA 4NBRA 1XYGA 3AUTA 5TRTA 4H16A 1UR5A 4N18A 2VRCD 4M89A 4YJFB 2DBQA 2P9CA 3IQDB 4IDEA 3GDOA 1GTMA 1I3MA 4DTIA 1ZEMA 4KMSA 3FWNA 4QXMA 2A81A 1BRMA 3F6YA 5DU8A 3ZWVA 3EYWA 2B35A 3FHLA 1JWBB 5G4KB 2Q4EA 4IQ0A 4J0FA 1TI7A 1ZNQO 5EN4A 3T4XA 2X0JA 4TROA 3TVWA 4LK5A 3CH6A 3CZMA 3U9RB 3OM9A 5JCXA 1VC2A 4BNIA 1C1DA 1LI4A 3ZH2A 3BMOA 1DBVO 1LSSA 3JQAB 3VH1A 2ZK7A 3PXXA 4IMPA 1VLLA 2C2YA 3Q0EA 5KJEA 3VPSA 1TLTA 4FR5A 4DC1A 4DREA 1YDEA 5A1TA 3LC1O 5EERA 1JKFA 1C1XB 1PJ4A 5LC1A 3MYBA 4UULA 1N92A 5JDCA 3H8VA 2RIRA 3QY9A 4NU5A 1QV7A 3WGYA 4GGPA 1K89A 1RM3A 4UUMA 3DBRA 2CNBA 3ST7A 4BGVA 3OMEA 4RF2A 1PWZA 4FFRA 5HBRA 4DQUA 1EFLA 4QO8A 4YA6A 3S55A 5KCZA 1BW9B 1UIYA 3E82A 2G0TA 3O03A 1YRLA 3B20A 1DSSG 2B36A 3KLMX 5ES3A 4M8SA 4ILKA 3B1KA 3DMTC 1HE2A 1JU9A 1UH5A 4BO7A 3RQSA 3KYCA 5K6AA 2EWMA 3U5TA 3RJ5A 1NFRA 1JAXA 2IODA 4LISA 4CODB 1UYRA 1XHLA 3PZKA 5KIAA 4KQWA 4BNZA 1XNVA 2Y68A 4Y6PA 1E5LA 4EMPA 4JYLA 1LTHR 3D3WB 3JD4A 1J7XA 3HSKA 4HFJA 1LDNA 2AQIA 3HFGA 2HO5A 1F0YA 5JBXA 4R69A 2H1SA 1HLPA 4Q3DA 5F5LA 4OHUA 3WSWA 4N5MA 1HETA 4IDCA 2CVQA 3FCOA 3VPFA 2JCVA 1E7RA 2PZMA 2A7KA 4XR9A 4CV3A 4AJHA 1HNUA 1X13A 4Q3AA 1EVIA 4FD3A 2Q1UA 3RC9A 4GL4A 2YV1A 4RORA 4GSLA 5JPIA 1GEEA 1YQGA 1I0ZA 1M66A 4F6CA 3K2EA 2NQ8A 3F47A 3QRWA 5DZSA 4AJIA 3ZWBA 4E31A 2FHSA 3SJUA 5A04A 3R6DA 1PL6A 1I3NA 1YL7A 1Z6ZA 1CIVA 2D0IA 2ZL2A 4Y6RA 1FJHA 1GDHA 2NQTA 2Y99A 3NTRA 3U49A 3ZWOA 5KJ6A 4YJFA 4HXYA 4ASIA 1X1TA 1XNWA 3ZU4A 1C3VA 3K31A 5DTWA 4QT0A 4ESOA 3WOHA 2HLPA 5CAEA 3PFWO 3V2UA 1UYSA 4AJEA 5TLSA 1PQUA 5G4KA 3IAVA 2V6FA 3WGTA 2BLLA 1WZEA 4FFMA 1NVMB 4I5DA 3E48A 3DORA 3DEYX 4GI2A 5HTOA 3HHPA 2PH3A 3ROMA 4MIYA 3VDRA 4JJTA 4DYDA 3UW3A 1ONPA 5KVSA 1QYXA 2VHWA 3DZKA 3JQAA 3UKOA 5G0WA 1K2WA 1T2CA 3PHLA 4QX6A 2X23A 3RU9A 4NMHA 5DZKH 1NQOA 3P2LA 2A94A 3RC2A 1C1XA 1GAEO 5EMHA 1F8GA 1YVEI 1E0DA 3C24A 3MT6A 4GLLA 3IP3A 4MKXA 3L0DA 1BMDA 4IINA 4FJ0A 1TG6A 3BAZA 1DHRA 1SOVA 1I2BA 5G0TA 5DOZA 5A03A 3NX4A 2YQ4A 3U0BA 3JQEA 1XEAA 3IIEA 1G0OA 3AUUA 1BW9A 3UCXA 5JDIA 5THQA 2SCUA 1PJHA 2QRLA 1PGPA 1P74A 3VHRA 1ADFA 3ZWAA 3PLRA 2XXJA 4UEJA 3LT1A 1SBYA 2ZATA 4R1SA 2PGLA 4WLUA 3SEFA 5DULA 2G76A 4CMCA 2JJYA 1ENPA 2BH9A 4R4JA 1C0KA 2GN8A 3ZWWA 3D3WA 4E0BA 1FCFA 2C82A 4P4GA 5ADHA 1DIAA 5F1PA 4B3IA 1E1NA 3VDQA 2JCYA 3H9JA 4U6QA 3JQFC 1MC5A 1RJMA 1LSJA 3DZIA 3PRJA 1U4OA 2XAAA 1E7MA 4EJMA 4RGBA 3OQ6A 5JAQA 5DBFA 2ZYDA 1N6EA 3GPIA 1YH3A 4BKOA 1X15A 1OMOA 1DRVA 3K73O 3CINA 4PIVA 5LDGA 3HDQA 3ZWCA 1PZFA 2NM0A 1VL6A 3LQFA 1MA0A 4L75A 4LVCA 1IPEA 3TJRA 1XIVA 4NU6A 3H0QA 4ZQGA 2HKIA 3ZDFA 5C37A 1KVTA 3PFFA 4HFNA 1YOVB 1FC9A 1NWHA 4N7RA 4EZBA 4DPMA 4XX0A 4FJ2A 3DAFA 2VTEA 4J91A 3V1UA 5MDHA 1CF2O 3HN2A 4II2A 1VE9A 1NQTA 2LDBA 2VSUA 1CRWG 3D3EA 4B7CA 1NNUA 2PD3A 2WJPA 4N5LA 1IY8A 3ZGYA 1Q7BA 1QLHA 2VYND 1NVTA 3SLLA 3VH2A 3U4HA 1GR0A 4JJGA 4K29A 2PR2A 4NBUA 1YKFA 4L6WA 3D5TA 2HQ1A 3K30A 1BGVA 3P5SA 5JCJA 4KTTE 4E5PA 3N6RB 4OYRA 4P4LA 3E03A 5FYDA 1H93A 4PGFA 4D79A 2VQ3A 3PP8A 3R9TA 4BO6A 2BF7A 1OC2A 1PGNA 3ZV4A 2I3AA 3VIVA 3ZN2A 2C59A 2VREA 2RH4A 1EBUA 3QWBA 1BSVA 3IAHA 1QLJA 3EY4A 2P4QA 5U1PA 1ULUA 4WJZA 2BGLA 1ORRA 2O50A 1E1LA 5JAMA 2Y0CA 4EJ0A 4EI2A 5DP2A 5EESA 2GERA 3HDJA 3I9MA 1O89A 4KP7A 5TF4A 3ETGA 3GRPA 9LDBA 1Y8QB 1P0FA 2B4RO 4XWYA 4LCJA 1ZMOA 3OJEA 4J49A 5LCXA 1A9YA 2DFVA 4HWKA 1E7YA 4YAJA 3N7UA 1W4ZA 3MFMA 1E5QA 4BO8A 4CR7A 1CYDA 2AQ8A 3AK4A 3RBXA 3NTQA 2Q2XA 4Z0TA 3TV5A 4PRLA 4U6SA 2VYVA 1HE3A 3HQ4O 2HW5A 3RU7A 3WG5A 3ITKA 4KNPA 1RWBA 5C9GA 1S6YA 4D42A 3H0UA 1WWKA 1HTBA 2Y0EA 1EK5A 1K3TA 2JAPA 2YHIB 4LMRA 1XQ1A 3FDUA 4E2ZA 1UDCA 3GFGA 2I5PO 1DAPA 1ADBA 2NVUB 5E0SA 1V0JA 2P5YA 1EEHA 4O63O 3JYQA 8ADHA 3WGZA 4Q3NA 4U0GH 1LRLA 2OXIA 2QHXA 3MTJA 3PHIA 2CE3A 1EQUA 4FFOA 3I1JA 3TRRA 4PVCA 4HV4A 4TRRA 4CMIB 2WYWA 2DQ4A 1WW8A 5GZ1A 4PG7A 3A1NA 3NKLA 4OXYA 3WBFA 4NQZA 4RVHA 1EVYA 1ZO8A 2OMEA 3L9WA 3C3XA 1UXGA 4NG5A 5G0UA 1D4FA 1LX6A 1YOVA 1X7GA 3QJ5A 3G17A 1E1KA 4E2WA 2V65A 1HE5A 4ALMA 4MXIA 3H3FA 4J1TA 3HDYA 3BTOA 3MJTA 1O8UA 3HRXA 1QR6A 1U2GA 5BQFA 3UAGA 3GHHA 3I52A 4R3WA 3KLPX 4YRBA 2UV8A 1DLIA 3PQFA 3NGXA 2VX2A 2I3GA 4WOKA 2JD1A 3DFUA 5DU4A 1P77A 5JYEA 4L8KA 4QFEA 2CFCA 1UP6A 4FPXA 1T4BA 2F9IB 5L9AA 3ENNA 5IZCC 4FFPA 2NSDA 2PBPA 2C07A 1E92A 2JD0A 5I7EA 4BS9A 3HLN1 3LAOA 1DC4A 4JGBA 2Z5LA 4JP3A 1Q1NA 4NIMA 3H5NA 4HUJA 4CQLB 4RVUA 5JMPA 2VT3A 4JNKA 4D3DA 1Q0QA 5TJ9A 1EDZA 1ZH8A 4ZRNA 3WYCA 1KEUA 2VUSA 3GZ4A 5B12A 1QSGA 3GF4A 3VTFA 3RSIA 3HADA 4TVBA 4CQMD 5KJPA 3WIEA 4WGGA 4NNQA 2BFMA 2BGMA 3IL2A 1KY5A 2R00C 1Q0LA 5G4LA 3ZV6A 1Y8QA 3LDHA 4L9RA 2WMDA 4WLFA 1HE4A 1O8CA 2D8AA 2JHGA 4WPGA 5F1KA 3KTDA 5BSGA 4BO5A 4I1IA 3PGQA 3WMXA 3KTIA 1R66A 1SEPA 4BO1A 3DOOA 3ZWXA 3BTSA 3I9NA 4D3SA 3JCZA 4BHTA 5ICMA 2QRJA 1PIXA 3NT4A 3AWDA 1T2EA 5A3JA 2J5SA 1HNOA 2AXQA 3I5MA 3VAZA 4CM3A 5B37A 3MOIA 3PYLA 4WZ8B 1Y7TA 3D64A 3TOZA 3F3SA 2ZJ0A 4BO2A 2YHIA 3JYLA 5IF3A 1FC6A 5H83A 3RBVA 2UUPA 1ISJA 2BD0A 2NVUA 4I5FA 3O4RA 2GZ3A 3EC7A 2C20A 3VZPA 3JQ9A 1WMBA 3B70A 4J1NA 4XYLA 1OC4A 1OZAA 1LDMA 5KKAA 2ZQRA 4RYFH 4W7IA 3TFOA 3GG2A 3BHJA 3WDSA 1KERA 3KSDO 1DB3A 3ON5A 4LMPA 3BMQB 4CLRB 4CMIA 5TJHA 4E5YA 4DL9A 2FZWA 3RUHA 4M49A 4UVGA 4E5KA 2CY0A 4KDFA 4BB5A 2EEZA 2Y1EA 1EF8A 3OIDA 3KVOA 5A9SB 1BDBA 3DTTA 5G0SA 1Y7OA 1ZSYA 1N9GB 5CEEA 4O0LA 4IGFA 4J3FA 1EZ4A 2VZ0A 4J9VA 4PLWA 3VPGA 4XJSA 1YONA 2IZ1A 3DFZA 4U7WA 2AG8A 4OIMA 1NQ5A 2AHRA 3IOYA 3WX0A 4ZDFA 4QECA 2NWQA 4BKQA 5JDCC 4IPTA 1C14A 1SCUA 1SZJG 1K5HA 4AJOA 4PLVA 2FSSA 2XPCA 3D4PA 2DBZA 4DVJA 4PG4A 3AU9A 5B4VA 2RCYA 4R41A 3H9QA 4WE3A 1ZCJA 1R12A 1Q7CA 1AN9A 1DDOA 1LJ8A 4JBHA 4ZA2A 4YAIA 3PVZA 2QZ9A 4MPDA 1PR3A 1L7DA 4IM7A 2F9IA 5A5EA 2J5IB 3ICCA 1NX6A 1R15A 3L3SA 4OLQA 4JCSA 1MGOA 3DZGA 5DDIP 4J7UA 2OP0A 4FJWD 1FDUA 2YHUA 1GYQA 3ZNPA 1DAOA 5HWSA 5K6AC 4P4NA 4CQLA 3DHNA 2CUKA 2PTGA 3HN7A 3JQDA 1RJNA 4Z9YA 1H6CA 2PGJA 5E0SH 4EDFA 1U3VA 4JVTA 4CLEA 4MVJA 3KTHA 3QMJA 3W4JA 5I8ZA 5BSFA 1AXGA 2ILTA 1IUKA 3D5QA 3JQCA 2O48X 1BWSA 3U09A 4MINA 4HP8A 1GPDG 3UGKA 4L4SA 5ITVA 2DVMA 1IYZA 4ALNA 4IJUA 4D0RA 3LSYA 3S8MA 3K9QO 4GAEA 4CM1A 3H9UA 3ANMA 5GMOA 4QTZA 3R9QA 2BFPA 2FR1A 5KOIA 1GADO 3EAGA 2RH8A 3EUWA 4LK3A 3WSVA 3P5MA 3AOEA 4JCRA 2W4QA 4ND5A 2GN9A 3DO5A 2QYTA 2BI8A 4MVJI 2D2IA 3HUDA 4RPHA 4YTEA 3KSZO 4HNKA 1G0NA 1ZJZA 3QSGA 5L7TA 4QEDA 1HT0A 4RVFA 1HKUA 1I30A 1XGKA 4E21A 5F1OA 1CDOA 2QW8A 3OJLA 3ZU5A 4MVJG 4EGFA 3FBTA 2IEXA 2J5GD 3IB9A 4WLVA 2CVZA 4Y98A 4IS3A 5JYDA 2VHXA 3STHA 1PJ3A 1QYDA 2PA3A 3W8FA 4FN7A 3Q9NA 1HSOA 3GDFA 2AW5A 1H94A 1T4DA 3I6IA 4GX5A 4FNBA 5IDYA 1R0KA 5HM8A 4EUFA 3BMQA 4CLRA 5L95A 1EF9A 1JKJA 4OMRA 4F3YA 4CL3A 5IZ4A 1NFQA 4H15A 3W6ZA 3RSTA 1P9LA 2B69A 3WS7A 1U3TA 4D43A 5A9SA 4ND1A 4NFSA 1N9GA 4R51A 1A72A 2NTVA 3WFJA 2F9YB 4H7PA 1NYTA 3WB9A 2DTEA 3TLFA 2FN7A 1GYRA 2X0RA 3UVEA 3VKVA 2ZTUA 3ONDA 4YR9A 5BSHA 3STAA 3IUSA 1WDKA 1DFIA 5H81A 5CDGA 3R0OA 4J7CA 3M6IA 4TVOA 4Z9XA 3TZCA 2R6JA 3KETA 2D3TA 1A71A 2OL4A 1WNTA 2W98A 4K28A 1K6JA 3CZRA 4UVEA 3MJSA 4K3WA 3RKRA 5TQVA 4DC0A 2VZ8A 1P45A 4RDIA 5JDIC 2J5IA 1D3AA 3HG7A 3A06A 5TSDA 3RUEA 3D7LA 4Q3EA 1U5AA 2RBEA 4PLZA 3WFIA 4NDNE 4D44A 2FBMA 3BA1A 5KVQA 4L74A 2VSSA 1GUZA 3MEQA 1PTJA 3K8ZA 4RLHA 1B15A 3PPIA 3VZRA 3TT7A 1Z7BA 2VHZA 4PG6A 1NZYB 1D8AA 1ZZEA 1QYVA 1AGNA 4BNKA 3L4BA 2DFDA 4DRYA 3JD2A 3SXPA 3GVPA 4XGIA 4CMKA 3TZQA 2YDXA 1OD2A 1IULA 4IZHA 4XD2A 2J5II 1LQTA 5AXBA 3OIGA 3V5IA 1PQWA 3ISAA 5DP1A 3K50A 1YB5A 2EW2A 4ZQEA 3F5SA 2Q46A 3GG9A 4XQCA 3RUIA 3Q0JA 5ER9A 1GUYA 1DC5A 5FF9A 5DTPA 1P1FA 4UUNA 4YVFA 5JCJD 1DXYA 2A4KA 4HY3A 2X9NA 4KQXA 1M6HA 5ENDA 5JO0A 2FR8A 3PYMA 3ZV5A 3LZ6A 5CG1A 2C5EA 2X6TA 5EL0A 4KUHA 3R6HA 2GPTA 1Z45A 1DFGA 3JQBC 5DL1A 2EJWA 4MIOA 4BNYA 1ZK0A 3KSUA 1PJQA 3CTMA 2X24A 3GKBA 4O5OA 4DBVO 2VSUC 3U9TB 2YJZA 3RWBA 1AE1A 1J0XO 4AVYA 4KWIA 3I23A 2OHXA 5L45A 1IL0A 2H9IA 2HUNA 4NHEA 5FFFA 5FIFA 3INRA 2FP4A 3H02A 1B16A 4LN1A 4JOTA 2Y66A 3PHJA 3SBOA 3D1LA 4B8ZA 5IG2A 2HMTA 1SB8A 1Y81A 1KC3A 1VKOA 2CDAA 1HYEA 2OBNA 1DIGA 1XLTA 3K6JA 2EGGA 3BEZA 1H6AA 5IN4A 3E6AA 1JKIA 3GF7A 5DUFA 2VOJA 3PIDA 4GGOA 3GAFA 5I7FA 3AW9A 4WCFB 1YO6A 2VCYA 1Q52A 2F9YA 4ZN6A 1Q0HA 1HSZA 2X86A 4FOOA 4XRGA 1B8VA 4O6VA 2Y1FA 4TRMA 1JXZA 1EBFA 4FGSA 1BXZA 1FK8A 3OF2A 1F12A 4K6FA 3OIFA 1H9AA 1A4UA 3V2GA 4CMAA 4BVAA 5F21A 3ABIA 1MB4A 3QVSA 3JYPA 4YPOA 4KUGA 3PWSA 4YYZA 4BO9A 1U1IA 3GVCA 4WLOA 4WNIA 1VJ0A 2Q34A 3TQHA 3P2OA 3TT6A 3QWDA 3GR6A 1PJBA 4WUVA 3SVTA 4CLDA 4IS2A 2IZ0A 4BNHA 3JQ7B 3U4CA 4D41A 1HL3A 1AHIA 3O9ZA 3KM0A 4J16A 4PZDA 3OMLA 2O3RA 5KKCA 4BKRA 2X22A 1R6DA 4AFNA 5INFA 3RAJA 1E3IA 1LEHA 4J9UE 4JCOA 1G1AA 5HS4A 1R16A 4WLNA 4BNGA 1DRUA 3T89A 4XQ9A 2I67A 1NZYA 4CLHA 4XKJA 1FDTA 3GGOA 3K92A 4UVDA 3F1KA 4WEOA 4ALIA 4MVJE 4BO0A 1E3LA 1ARZA 1F17A 4E5NA 1IOLA 2HJSA 3AFNA 3W6UA 4BV9A 1DRWA 1UDBA 1Z73A 1CWUA 4RV9A 2UZFA 4FC7A 2GLXA 3OETA 1LA2A 1V3VA 2X5JO 3IKVA 5BR7A 3ONEA 3IS3A 4JN6B 4MKZA 5E0NX 3JSAA 3GT0A 4IIVA 2X0NA 2ZL3A 4W4TA 3FTNA 3GHYA 4GWGA 4CV2A 2OORA 3I6QA 1NPTO 5DUCA 4R54A 5T67A 4RO0A 4NZ9A 1Y6JA 3C7AA 3OJ0A 5I9MA 4G2RA 4J4BA 3PJDA 4BNWA 3K8XA 3ASUA 5U9CA 1VM6A 3LU1A 3GH3A 1IHYA 3VPHA 4DA9A 1Y5RA 3OT6A 2PWZA 3R3SA 4AJJA 3GMSA 4IXTA 2A92A 3QXIA 3JQ8B 4KWBA 1N8KA 1KY4A 1XKQA 3WLFA 3E9NA 2E6UX 1XELA 3K2BA 3DONA 1KEPA 1P44A 1W73A 4LCEA 1JVBA 3I9JA 2O7QA 5ER6A 2EP5A 4XR4A 1LC0A 4RCNA 2HAEA 2O3UA 4RQTA 4RZHA 3F9IA 1F14A 3KTGA 1K39A 3AI2A 2ET6A 2DKNA 4LRTB 2AEFA 3TRIA 2PD6A 1RKXA 3JD0A 1U8XX 4PLPA 4HKTA 5IN5A 4ALJA 3T88A 4YJHB 4CR8A 1NR7A 3BPPA 1P1RA 2C54A 3EK2A 1OOEA 3UICA 2WSBA 5JE8A 3U9LA 3GNTA 4TQGA 2VHVA 4Z0PA 1MC4A 3ULKA 4WCFA 5KDRB 1X0VA 1AXEA 5A9TA 2B37A 3FF4A 2VHYA 1QXSA 1OBFO 3C8MA 1LDYA 3OFSA 5G1QA 4CV1A 1T25A 5GY7A 3FR7A 2IYOA 2CMDA 3BMNB 3KOUA 3LC2O 4JBIA 3VZSA 4ZDCA 1FXSA 3G64A 3WGIA 3OQBA 2YV2A 3H0SA 4ZDDA 5JBWA 1DHTA 2OOSA 2X58A 1ISFA 2NU9A 2WWRA 3QHAA 4E2YA 4IZBA 4EEZA 3JQ7A 3ZNNA 4OAQA 4NNJA 4RPLA 5JAZA 3TFQA 1P1KA 4B3JA 4P38A 2HK9A 1W6UA 1HDOA 2CF6A 2HJRA 3RUCA 1GCUA 4IMRA 4XA8A 3BF0A 3MCVA 1U4SA 4P22A 4EITA 2VSSE 4HBGA 1LUAA 3PLNA 1WP4A 5CHEA 3JQ6A 4J4HA 3H7AA 4YAKA 1SNYA 3BYZA 4BNXA 3DAPA 3JQ9C 3ICPA 1ZK4A 1BHSA 2PNFA 3TF5A 3FSRA 2WM3A 2ZTMA 1N2SA 3VZQA 5EQDA 4XRRA 4Z6KA 1TT7A 4YT8A 1CEQA 5AYVA 4BV8A 1UZNA 1LSUA 2HMUA 2W3PA 2CVOA 3RUFA 2PGDA 4X54A 5TS3A 4K6CA 4L4XA 2JAHA 5TT0A 2A7SA 5DKPA 2ZB8A 1RM0A 1AHHA 1JWAB 1Z74A 1LLCA 4ID9A 3M2PA 4G5HA 1P0CA 4IDBA 1MP0A 3KEOA 4UEKA 5L4LA 4I42A 3G0OA 3UXYA 2DLDA 1UZMA 3V1TC 4BMVA 1WDLA 4RVGA 4ZRMA 3JQ8A 4W9NA 4EYEA 3PZBA 2CD9A 3GGPA 4DIBA 1BTOA 1YS4A 3R1IA 3I47A 2C7GA 4YACA 1B2LA 4CM9D 5KTKA 1ENYA 2TMGA 1NTOA 4RZIA 3U62A 4B4OA 4U0KA 5FEUA 4D3FA 1SO8A 4E30A 4XDZA 1N7GA 1HRDA 1FDVA 1O0SA 3BTUA 4A27A 4D7AA 4F45A 4KPKA 4DMLA 3I9OA 4R9SA 4ZHSA 3DR3A 5A06A 1YG8A 1ZSVA 2EP7A 1OD4A 1KVSA 2EXXA 4YJHA 2G5CA 3ROQA 3CSDA 2W2LD 3HB5X 4J2OA 4YLHA 1T1SA 4IBOA 4MP8A 4MVJP 1RM5A 4FFLA 1UDAA 1EUZA 3EVTA 3MJVA 4I9UA 3E9QA 4XGKA 3EZYA 4E4YA 4BMNA 2G17A 2FY8A 1NFFA 5KDRA 2VRCA 4GLOA 4JYJA 1Y1PA 3PGXA 4XGNA 3OEWA 2QG4A 2YUTA 1W8DA 3ZCXA 1M67A 1ZFNA 3BMCB 2OBYA 4B4UA 4F46A 3ZWMA 3X2FA 4U18A 4AJNA 2DBVO 4GVXA 1GL3A 2Y1CA 2PZKA 3AM5A 3BMNA 3LLSA 4JCQA 2WYVA 1PWXA 2WD7B 1X7DA 2ZKLA 3EZLA 3FI9A 4YCAA 4Q1IA 1MXFA 4GSKA 2P9GA 1XWFA 1GQYA 1ZXLA 2VT2A 2H5LA 3NJ4A 3I9KA 4YAEA 1XX4A 1ON9A 3VOSA 3GGGA 3AOEC 2OP1A 1DJQA 4DLBA 1E7WA 3GY0A 3FF6A 2IYPA 2HK7A 3NJ8A 3NGLA 3MWEB 1IPFA 1MV8A 4UEOA 3WYBA 1LRKA 5DNAA 1ZK2A 1QYWA 1T26A 3U4DA 4II3A 3TZHA 1EE2A 1VSUA 3COSA 4ND3A 1H6DA 3V5NA 3NT2A 3LT4A 4ZDEA 4IJWA 3I4FA 4WNCA 4XZ3A 4WLEA 5IXSA 4TWRA 2O23A 4OJNA 3QA9A 3HWRA 1PGOA 1WVGA 3NT5A 5C7LO 5IJZA 2IRWA 2V6GA 4BGEA 2GZ2A 4TKMA 3DHEA 1WMAA 3EGOA 4R1NA 2NACA 3SC6A 4RVSA 3AI1A 2V6BA 3Q3CA 4J0EA 4M55A 4FFNA 4Y9DA 3ROPA 2YDYA 1LLQA 1PGQA 1LLDA 1HDCA 4CMBA 1T2AA 5DBGA 2HMSA 3TDCA 5ENVA 4AJ4A 5ICSA 5ITWA 4C4OA 2Z95A 3AUSA 2OZPA 2X1HA 3D4NA 4B8WA 3W8EA 1MXHA 2PV7A 2ZB3A 3CMMA 5H82A 3TN7A 4JIGA 2FMUA 5A02A 1P31A 4BKUA 4PCVA 3Q7HA 1DPGA 1C0PA 4Y67A 3S2GA 1L7EA 3E9MA 5T8KA 2HSDA 2EHDA 1IE3A 3RIHA 5C3MA 2C2XA 4FQ8A 3ZNOA 2RHCA 3F4BA 5CDUA 3RD5A 2J5KA 4OG1A 1ADCA 3SLGA 3ZHYA 1W0CA 1HDXA 4PLCA 1E3SA 4YRAA 4FNDA 2ZL0A 2VZ9A 1NWCA 1VI2A 4IJVA 3GUYA 5TT1A 2LDXA 2ZYAA 1T2DA 3X2EA 1MG0A 4UUPA 2EV9A 4CM6A 3R3JA 2I66A 4J1QA 4W99A 3BTVA 3KB6A 1NAIA 2Q1TA 1EFKA 5U4QA 3H9GA 1I10A 2X8LA 1CQIA 2O3SA 3PTZA 2ZL4A 1V9LA 3N58A 5A5FA 3BMCA 1PJLA 3L4BC 1GQ2A 3LF2A 4WEQA 4GH5A 1I36A 4YQZA 3ZWNA 2FW2A 3PHGA 4Z3KA 4KOAA 3TOXA 1RYEA 3WXBA 4JFCA 2I9PA 4U0HA 3F4LA 5JXWA 3PE8A 1BG6A 3ZW8A 2WD7A 4NI5A 4CPDA 1LQUA 3FBGA 4TZTA 4XDYA 3T7EA 4OXKA 3OHSX 1DUBA 3O26A 4R9RA 3ZWYA 3RBZA 3DC2A 4OXNA 3CMCO 5DCUA 4DGSA 4XJTA 2AEJA 3S1LA 4BKPA 3OC7A 2GASA 1V6AA 5KVVA 1UYVA 1BDMA 2HRZA 1SMKA 3WNVA 4G81A 1O6ZA 2CF5A 3AFMA 2F00A 3LT0A 4A10A 4E12A 3GNQA 2HRBA 3F1LA 1ZXBA 2ZTVA 1JA9A 1F8FA 1ONNA 3E1KA 5BT9A 3MOGA 4WCDA 2GYYA 3Q1TA 3RVDA 4CMGA 5JBIA 4UVIA 3FNHA 4LVUA 4AJ2A 2RAFA 2GCGA 5C7OO 4RPKA 1R37A 2NVWA 2AEMA 4B79A 4NBWA 2O7SA 5FI5A 1VJTA 4ZGWA 1GQQA 3KTJA 1ZJYA 3ASVA 1DFHA 1S7CA 3ZW9A 2PG8A 2TMDA 1GY8A 3LF1A 3NDIA 4EUEA 4AG3A 4ZICA 1VJ1A 5CDTA 5FUSA 3OJFA 3GVXA 3WICA 3CKYA 5EQFA 3KEQA 3JTMA 1VRWA 3QXZA 1O5IA 1UUFA 2J5QA 4OOEA 1XNYA 1W2XA 3WYEA 1LSOA 4DXHA 1PL8A 1FF9A 4L73A 5CEFA 1EMDA 1I5RA 2C5AA 1GFSA 3P2YA 3GNSA 1ISGA 4I08A 3ZNQA 1R4MB 4DMMA 3GMAA 2PKRA 3CEAA 4A7PA 5L51A 4BO4A 5MGBA 1E1MA 1DJNA 4JLWA 5G1RA 3NDRA 1I2CA 2DPGA 3FPCA 2GGSA 4E5MA 3KHUA 5KWEA 5CTCA 2JFFA 1I32A 2WYUA 4TRNA 5T6BA 3UCEA 2FWMX 1MFPA 2NVBA 4S1VA 1GPJA 1NHWA 2O3TA 5L40A 4DLLA 4BNUA 1LRJA 2E82A 4EEXA 2IXBA 3HINA 2HK8A 1NHGA 1PQPA 4ZJUA 1SB9A 4GWKA 1B0AA 3HFSA 1U8FO 1C0LA 1CJCA 2HMWA 2I76A 6LDHA 2XF8A 4FOSA 4CMHA 1TYFA 1HYHA 2CDBA 1I8TA 2VYNA 2PK3A 4KZPA 3TL3A 2HU2A 2FRDA 4YJGB 3QKAA 3HZZA 2QX7A 3AY6A 1O94A 3VH3A 4KDEA 1GUFA 4GMGA 4XIYA 3TZKA 2Q2QA 3RC7A 3U3XA 5B4TA 3AU8A 2DUBA 1HLDA 2YW9A 2Q49A 4PLTA 3M2TA 3JQAD 4DPKA 1EVZA 1PS8A 4XB2A 1RM4A 2V7PA 5IXYA 4CJXA 3ONFA 1G6KA 3PIIA 5KJCA 1YJ8A 1VL8A 3H4VA 4CQMB 3RFXA 4Z0MA 4F6LA 1V3TA 4MO2A 3IKTA 2HDHA 4Y6SA 3ORFA 4RF5A 5DCWA 4DIFA 2WE8A 3JD3A 3ADPA 3VH4A 1HEUA 1YBMA 2H63A 1UZLA 2X5KO
chains in the Genus database with same CATH superfamily
3C6BA 4XEHA 4IVNA 5J2UF 5IDWA 1KOGA 4TL8A 4IXNA 4CETA 4M3NA 2BGRA 2YY7A 1WV0A 5EINA 3UT5A 5EJEA 3I9FA 3EQ6A 2QVZX 4UAVA 4KVFA 2XMRA 2I6GA 1ON3A 3H6HA 3BRCA 3L8EA 2PQ0A 2RIPA 1TAGA 1TKCA 3IOCA 3MUNA 1XV5A 3Q8XB 4O2BA 3OCXA 4NPCA 4O1MA 4DMUB 1PFVA 2DHDA 3ZK7A 3EZ6A 3C85A 1RYZA 1ZS9A 4GVPA 1T2NA 3TWOA 1JPNA 3GLFB 4QOFA 1A3CA 3A6FA 1P61B 3FMVA 3BICA 1N75A 1UZUA 1PU2A 2GKOA 1ZNXA 1FEZA 3UFXA 1R3DA 1C9DB 2VJDA 1UP7A 2WJVA 3IV9A 3LHSA 4RJ2A 4BQRA 5BNIA 1URPA 2BGGA 1XG5A 4DQXA 3UY4A 4FCCA 5HDQA 2ADFA 2Z8YM 1H23A 4FYJA 3PL5A 5L4SA 4R5HA 1SH7A 5ALFA 3DM9B 4K9QA 3CUEF 3DBLB 1R4MA 1S2DA 1VSVA 1YR1A 4B7UA 1GL6A 2G0NA 4G07A 3M5DA 3UMYA 1MQSA 1H4SA 3EMVA 3M3HA 2D1TA 3QEMB 4BRSA 1KYXA 4XE5A 4M1TA 1U0EA 2B3TA 4N6NA 2AUTA 2BMAA 1BXGB 3M1LA 2Z1NA 5HTKA 4CKXA 4CV0A 4DMRA 4LE0A 1AZLA 3DE1X 2X9VA 4RF4A 1ZUNA 1Y8AA 2XUDA 1XCJA 1PZGA 2XVAA 2V0GA 1EGAA 1KXZA 2Y1GA 5I9LA 1RVV1 1YTLA 5T41A 1BU5A 4C5BA 4JJFA 4RK4A 1ZIYA 5J9FA 2F6QA 2PKQP 1OAKA 2OCXA 2P5UA 4Q9NA 1AHNA 4F47A 3I53A 2ATVA 4MP6A 5C18A 3P52A 5B2ZA 3D7KA 4V2UA 5JZ9A 1V41E 1G3UA 5LJIA 1R1DA 3C6XA 1VCHA 3QPVA 4H3HB 3FFWA 3EZXA 1SPXA 1PAUA 4QVKA 2QE6A 1QGUA 2V7WA 4QSMA 4RGYA 1EUQA 3CH4B 4YJGA 3ZKWA 5CLJA 4CEIB 4C4XA 1N3LA 1Z13A 2QQEA 4WVFA 1VMKA 3SOZA 1P4GA 2O0HA 5LDDC 4ONEA 6ADHA 2AF3C 5C9GA 2FSUA 4REQB 2IVZA 4NICA 3UAOA 5ARBA 1LZLA 4D9GA 3DDWA 2H1FA 1G5HA 4MWCA 2XKJE 3ANLA 4HX5A 1KAOA 1OZFA 5F7XA 4P5EA 3EFOB 3H4TA 2PXHA 1U28A 4ZZ1A 1NT2A 5JPCA 3ROEA 5KHOC 3V46A 3LSTA 1Y7LA 4ZCQA 1PR2A 2YQ5A 3OZCA 1L4BA 1YDWA 2NNLD 1MO3A 3NBXX 2DPHA 2V7XA 4MK4A 4DBZA 2AKAB 4BNLA 5LWHA 4GKVA 5CCEA 4QSHA 1GXSA 1ZH2A 3D3QA 4CQMA 5DW0A 2VQFB 3UB2A 1C4WA 4RY2A 1ML4A 2QLMA 1KR2A 1UK8A 3CVUA 2B0JA 5IMBA 3UK7A 2DG2A 2BL4A 4TV9A 5YASA 1U0JA 4GOKA 1EGMB 1LBQA 1YU9A 3RVPA 3WNBA 4CKEA 2ES4A 2QRNA 3B9BA 4IOKA 5IJ9B 2JKYA 4MUHA 1JR2A 5H5JA 1IOZA 3T8AA 2Y9ZA 3QTBA 5ALRA 4W6QA 3RE1A 4D2IA 5KNBD 2AC7A 2D5CA 4D3XA 3KXKA 1UXHA 3AIIA 4N0DA 5BNWA 4Z4EA 3UXEA 3TBKA 1GRCA 4DQKA 1GVHA 2BISA 3OZDA 5C7IO 4CGZA 4PWYA 2C42A 3OBBA 2VJQA 1E9RA 1OSNA 2Q5OA 2W2KA 3I5UA 2VYVD 4NH4A 3VR4H 3SCZA 1QE0A 1QP7A 1Z56C 1W0KD 1ZITA 5CFQA 4D3ZA 3U9SA 3PQ2A 2GNAA 4Q3CA 1TYZA 2FFJA 3QPBA 3KLBA 1DQZA 1PX0A 2QTZA 1CFJA 2B5VA 2QL7A 4NZPA 4TYMA 4XQEA 1YS7A 4UCQA 2J09A 3SIWA 3BZUA 5I9IA 1ID1A 3N8IA 3PGA1 4FEYA 2ZAGA 3AV3A 1WUJS 3OTOB 3GEMA 2AGVA 4ZOEA 2VATA 4HSEA 2YWDA 4Q02A 4LFCB 3ROKA 2QJWA 3WWOA 1J97A 3ITDA 2BN4A 1EHCA 2P77A 4Q93A 5FV4A 4I4TA 1N2BA 2JRLA 1G20E 3CNLA 3I3OA 1HDGO 2AKYA 4LXTA 3WLSA 1S2OA 4R1UA 5CVUA 2B83A 1G3IA 4ER5A 1C5KA 1WXXA 3D1JA 3VPDA 2WUEA 3WDKA 2O3QA 4R01A 3WLEA 1NG1A 4ND6A 2UZ0A 3JU1A 1R0LA 1UK9A 1HQCA 2BI7A 2RGYA 3BHMA 4MUFA 3KR9A 4LI3X 3MK31 3NWJA 3BAFA 1UMDA 2GNOA 5FHQA 2IEGA 4LECA 2NP7A 4HNGA 2IZZA 4RULA 1RWQA 3QVVA 3PT9A 1AUVA 1NV9A 2HCTA 4YAIA 2VSNA 1HOTA 1HUQA 1F0PA 1T3LA 1U6KA 2AR0A 2C5SA 3LO8A 3ZHSA 5J4LA 4EYGA 4EJ6A 3VO1A 2I65A 4JLOA 2Q35A 4UPDA 1W5SA 5FPQA 1U2PA 2HIAA 3CS3A 4IG4A 2PE5A 3ZHUA 4YRQA 4N54A 1VL2A 1EE1A 3FCYA 1N6FA 4H0CA 4DDMA 2CBGA 1E3QA 4IDGA 1GCOA 5ALTA 2O4CA 1PR9A 2CCGA 4ZHQB 2JJ2D 1J8FA 2MHCA 5HVNA 3G2NA 4K8OA 1HRKA 1ISHA 4Q5IA 4KQIA 2VPWA 5DO9A 5BR4A 3P9XA 2HQOA 4OQEA 1S3FA 1LCIA 1UAYA 1ZGHA 3CNOA 4J3NA 3TRJA 2BEVB 2PSJA 3BX1A 4N65A 3V9AA 4U0GH 1KK2A 3G0BA 3F98A 3KQPA 3T8BA 2Z0MA 3LHFA 1HA3A 3SYRA 5B55A 1JT2A 1NIJA 1CY7A 2QR5A 1MW8X 4RIFA 3K70B 1PJAA 1X1SA 4OX9B 5DMHA 5EZYB 3QPDA 1AKTA 2AJBA 2BAGA 4LGMA 1T6ZA 1Z4OA 4QDKA 4CKCB 4N5IX 1MV5A 2WMOB 2I6UA 3FCUB 5EE9A 1DAKA 2FFBA 2OBFA 1XJ0A 3MZ0A 3N0RA 3QP9A 5DNVA 4QICA 5F7JA 5E6RA 4H3KB 3AMVA 5I9SA 1P33A 4JCTA 1YVUA 4IUYA 1LNSA 1X3LA 3GGDA 1MZPA 3WV5A 13PKA 3BJIC 2CFTA 4KI0A 2V3VA 1UQTA 3ZTWA 1XSEA 1ZM2A 3G2JA 2OYRA 1M0WA 1NXWA 3W3AD 4WOCA 1RQXA 4KE6A 4NBVA 3L5KA 1Y8RB 4X85A 3G2QA 4AG6A 1CERA 1CY1A 2FUEA 2PKQO 2R1VA 4GPZA 1CTQA 5ALUA 1N1DA 1M2OA 2AJDA 4GU5A 1G63A 2BW0A 4LC9A 4ZOBA 2D4AA 2QL9A 3EAQA 2BKEA 3Q40A 3CUTA 5T8KC 5AXDA 3G6KA 1A9ZA 4JYMA 3OM8A 4URZR 1B26A 1ECGA 4NNPA 1DEXA 1TKAA 1Z18A 2D1QA 1YS6A 2EL7A 5C5IA 5JHHB 2BEWA 1NUTA 2RSLA 4MPTA 2QPTA 4PEVA 3A1CA 3K0AA 3AO0B 1E3WB 3V9PA 3ANTA 3MWDB 3RIMA 5C51B 4B3XA 4XTCS 5DNEA 4ZOLB 2P62A 2E48A 1OHHA 3GXOA 1V4VA 3I9LA 3NVAA 4V0NA 4ZKEA 2NU8B 2J5GA 1EFVB 4GD3Q 2FQYA 4XPIB 1UYTA 2DC1A 3ITNA 2YJ5A 3LTEA 4MLPA 1IDOA 3U31A 5I6DA 1SFRA 2JJMA 4X6YA 2WHRA 2B4AA 4FB5A 3FPFA 4JLVA 4X7RA 1V71A 2VAVA 1UKZA 1RADA 3L6DA 3MGAA 2VNKA 2GF2A 3FJ1A 3OIWA 2OILA 5DHTA 5BQXA 5JSFA 4UNPA 2Q2WA 2P6MA 4P7BA 4Q00A 4IRMA 4YCSA 3JPYA 2QTRA 3PCXA 2EJVA 3TSCA 3TGPA 2C4NA 2H9AA 1EESA 2AFVA 3K1AA 4QU5A 4B6SA 1NVGA 1IB6A 2XZTA 2VHCA 4FBGA 4IDDA 4J3JA 4KDRA 4AWBA 4RMNA 4JVMA 4II7A 2V4UA 4MPRA 3IXLA 1A4IA 3L8FA 5D1HA 4XWOA 2DUWA 4IDOA 1V8ZA 3FDIA 4K0RA 4JJ4A 1B3RA 4ZRDA 1RPAA 4TKLA 4GQAA 1HZZA 2WIBA 4DSTA 3FFTA 3GD5A 3K05A 2X8JA 3GFSA 2HPZA 3TQIA 4B6FA 2Q21A 2J0SA 2UVDA 3FYDA 2VZLA 3K5PA 2PLAA 1KY3A 1YD7A 1JQEA 1FMCA 3LHIA 1KJQA 4INAA 4IIFA 4OYYA 5JECA 3TLCA 5EE3A 5DX1A 4DM4A 2PY6A 4U7TB 5BVHB 3HE2A 5IH3A 3EXHA 1EDOA 1GKYA 5FBVB 1N6HA 1G8HA 2D7JA 2IEBA 3L43A 3OZBA 4M83A 4MJ7A 2QGZA 4Q6BA 3RS2A 3WGQA 3ZE7A 3IXQA 4EECA 4GC5A 2UYYA 1T8SA 4YXFA 4HHEA 2ZJ2A 3P85A 5C4MA 5JY6A 3ICVA 3BBLA 4PV7A 1MJGA 3NRBA 4YUYA 4AO6A 4JP8A 4W5NA 2XB8A 1RQ2A 3S2FA 3WA7A 1Q0SA 2IT1A 4ZARA 3AY7A 1SG6A 2XTMA 3FAZA 3OJOA 4KWTA 1FDWA 3O73A 2XMQA 3DL2A 4GEGA 3PU6A 1E3EA 2P90A 5G41A 2OUIA 3GRAA 3UUGA 2W2XA 1RYDA 4WDQA 3ZLBA 3JQBA 4UTPA 5LQJA 3CSUA 4C2UA 4HFRA 1E2BA 3NAMA 2H00A 4I5GA 4KLCA 1BWRA 3JQGB 1TK9A 3OCJA 3DZDA 3QXHA 5DM60 4BCDA 2D06A 1Z4NA 3BN3A 1I7LA 1VCNA 1UJCA 1YHZA 4FONA 3WJ7A 5EEHA 5C90A 3ISJA 5KYUA 4EAAA 3KK0A 1FRVA 4C7OB 4ARAA 1THMA 2CJWB 5BN4B 4NZYA 1XYVA 1V1MA 2JIPA 3EGDA 2ZIAA 2C29D 1E94E 1E20A 2BUAA 2FEWB 2FSVA 4PGMA 1UJMA 1FFHA 2OFXA 3SNKA 3ZDXB 1H6BA 1AS3A 1NL3A 1T2FA 2P1DA 3BIJA 4HNHA 4ZI2A 3D0OA 2VTVA 3PVCA 1LF5A 4U7PB 4G85A 2W6CX 4AG5A 1NRXA 1AX9A 3R3XA 3PC8C 4DKJA 3NHJA 2G8LA 2QY6A 1Z34A 4D8VA 2O1SA 4R2MA 3PDUA 3KJZA 4MYSA 3LTNC 1J22A 2RARA 3GGCA 3CNEA 1OLSB 3T15A 3GLFE 1DEHA 7MDHA 3O94A 3TI9A 4IO1A 3EPRA 5AJWA 5EXTA 4BX9A 1NI4A 2G28A 3DM5A 5CPBA 2MYNA 4ZD6A 2DFPA 2V7GA 5TEVA 4ALKA 1WY7A 1KAQA 2ZQYA 4TWJA 5CFZA 4FSDA 3A4VA 3LVQE 3CTVA 3A0RB 2PUHA 1ODSA 3IX7A 3RYIA 1HR0B 2K7FA 3I2HA 1B0UA 1R18A 2E1RA 1X7HA 2BFOA 2DBRA 1MU0A 2Q1XA 4AICA 2ZIXB 4MKRA 4X1KA 4ETWA 1QIKA 4IWXA 5A5DA 2AMJA 4CM8A 3GFOA 5DBEX 5KNCD 1YULA 3DP7A 3E9CA 5F3WB 2DU8A 1EXNA 1F06A 2VFAA 2Y2UA 1YE3A 3T06B 1KRXA 1XU7A 1SQSA 4Q4HA 1H1TA 1T1RA 2IYSA 5K0ZA 2WE7A 4H7HA 4HLQB 3HO1A 1XVAA 2IPAB 3DZFA 2H2HA 4MH0R 1QMGA 3A9CA 2QLTA 3N59A 5A05A 3UN1A 4DCOA 4WK6A 1USWA 4CRWB 1P91A 2GK6A 4KQGA 1RWMA 3VC2A 1XF1A 2ZCUA 3TVDA 2FZEA 4BUCA 1XMJA 2ODTX 2OUKA 3OSUA 4EKGA 1QIFA 3A2MA 3LH5A 3RFVA 3ZGXA 3ESDA 1RP1A 1A2QA 1BHQ1 1NN5A 1W76A 3MUEA 5DRYA 1RQRA 2QNRA 4L07A 1MJ5A 1P3Y1 1XN4A 4BNMA 3EEFA 2WFLA 5MN6A 1Y6FA 4FN4A 3DZBA 4B5LA 4ON9A 4EM6A 2XYGA 4BGDA 1G7SA 2GCNA 3PL1A 3GLIA 4FIDA 1ZM3A 2Q4DA 1QQ5A 5DTEA 2OCYC 2Z58A 4BNVA 3NRJA 4JQCA 3G5UA 3CZ9A 4OO3A 3W7VA 1CZUA 5LP6F 2YN2A 5ARDA 5LQUA 4KFRA 2NUBA 2ZRMA 4IV0A 1FUEA 1U0SY 2ECKA 4DIEA 1A5SB 2X4IA 1OX6A 2FHPA 2Y1LA 5BNFA 1OIXA 3RRZA 5KX5A 3U1TA 3WAKA 2EDCA 3S29A 5LVAA 2V74B 4CM4A 2DPYA 2G83A 2GM9A 4Z49A 2JCXA 3PPXA 1NVXQ 4U0JA 4C2AA 2Q45A 1II9A 4AO8A 1NT4A 1TT5A 1X14A 5J4HA 1YL6A 2CMKA 2NAFA 3GA5A 3QEOA 2J0QA 1H0KA 4QBIA 1NYLA 2O2XA 4XARA 3UUWA 1XNRB 1M83A 2NUAA 2W2VA 1CQJA 1QYCA 2Q0XA 3GQVA 5J2TF 3AL0C 3GCDA 4G1BA 3U3JA 1G98A 5JSQA 4XDGA 4IEEA 5TQ0B 3V4PB 4OJMX 1S89A 2QRZA 4UMEA 3RLIA 4QTXA 4GQBA 5EXDA 2QUHA 3B36A 1ZC4A 4W7HA 5THKA 1Y89A 3BM5A 3DGFC 2AWNA 1HM5A 1FS5A 1GL7A 1T15A 3HB4X 4HNAA 4O4LA 1MG5A 4OGWA 2ZS9A 4M99A 3FETA 2D00A 4P93A 3R9XB 2W0SA 10MHA 4F21A 1H8HD 4GKKB 2Z4TA 1Q20A 3IEUA 4MWOA 4C6RA 3UF0A 3EQZA 2UVQA 3NCTA 1ECJA 1OLUB 3H1GA 4TSFD 1TMGE 3ENQA 2JIQA 4U39A 4CU2A 1VSBA 3N6VA 4JSBA 3G5MA 3KZMA 4XIJA 3SQLA 5HBGA 2I7VA 3GVHA 5I3ZA 2R6ZA 3TEMA 4JP2A 1RHUA 5EXPA 2P6OA 1Z5PA 2XE8A 3DBIA 1MLDA 4E5VA 3W4IA 4Q9KA 1CQWA 2DWPA 2ZIZA 1R0XA 1K7CA 3R0IA 5CW2A 1RIIA 2Q8PA 4M1SA 3SF8A 5ALMA 2WWYA 3UATA 3G1TA 3O1IC 2YBEA 2VWGA 4GZ6A 1PD0A 2O2SA 2POQX 3AR9A 4AJLA 4HC8A 2CLFB 1U3CA 3UUFA 3ZIDA 1K63A 4BQPA 4L9WA 1JKXA 4IQGA 3E7PA 2ZRIA 3E2PA 4ZU1X 3WBBA 2AW3A 4GMKA 2FWPA 5BN1A 1Q0UA 2J8ZA 1TZMA 1XRMA 2ZYUX 1XXHA 3OIYA 5KJFA 4Q0GA 2AXPA 2EJ5A 5KU7A 1H9BA 1DT3A 1Y7HA 2EJBA 3NBZC 1Z37A 4ND4A 4RJLA 2IYWA 5FQNA 1ZC3A 3QMVA 3OH8A 2DUNA 4RA9A 1Z82A 3NM5A 1TKRA 4NJMA 1JR3D 2Q6TA 1GN8A 4LV5B 5IAOA 1FP4B 5AXCA 4J4TA 2IP4A 1WLYA 4RPGA 3S2YA 2E21A 4DLZA 5K05A 3BZBA 5JS8A 4RH3A 3G59A 4NONA 4JI0B 1I80A 2XEXA 4DR6B 1VYVA 4L8VA 4KRYA 2DMRA 4TZ6A 2VTDA 2EL9A 2XMZA 1BE0A 3OZWA 2BEKA 4ZQFA 1RKQA 2HF7A 3LVFO 1H0RA 3UOGA 2SKDA 5DSZA 2IL1A 1N3BA 1DQPA 4C0KA 1Z4PX 3KYDB 3OM1A 2I8LA 4NP6A 1ZHFA 1TNDA 3TZBA 1XCLA 4O8CA 2OD9A 4OPMA 1YG6A 1F2DA 3NS7A 1UWVA 2H8GA 4HZUB 2PPYA 2AK3A 1HBJA 3NV9A 4ZVOA 3K3PA 3TTTA 2WF5A 2FQXA 1D0IA 1RI2A 1MJ3A 4EW1A 1JWLA 4ND8B 4D81A 3P5BA 4N8SA 4PC3A 4FB8A 1GZ4A 2HMAA 3KWFA 5JHGB 1C30A 4OLHA 1N0VC 4AY2A 1A76A 3H2GA 4ZCSA 4MDEA 1IJBA 4R83A 3K9HA 2D59A 4AMBA 1TGYA 3GEBA 1K7XB 3N1UA 2CKMA 1NU6A 4KIUA 3NHAA 1GM5A 1GPAA 2CMFA 2WKWA 1P75A 1NE7A 3INYA 1G42A 2HA0A 2VWQA 1NPYA 2ZSUA 3OEHD 4HQRA 4UQPA 5GPBA 3S68A 5CB4B 1PRYA 2LV8A 1JYEA 3CLRD 1YAJA 2FSFA 3IT0A 5JVDB 3B3AA 4WL0A 3V7YA 3D6TB 1DC6A 2I71A 2DFTA 3AEKA 1DWOA 3Q2IA 1YB1A 2Q3MA 3QELA 5K8UA 3EZ2A 5AQ1A 5E9QA 1NPDA 1PS9A 2QAGA 3LO5A 3IKTA 5LP1A 2HOQA 2QIOA 4XQGA 2D7DA 1YS2X 3O8LA 4LOAA 4F3RA 5A4FS 2DBYA 2Z98A 4EMMA 2E4UA 5FI3A 5LZ8A 3O8QA 3DUWA 3VR6D 2IGBA 5L3ZA 2Y1WA 1Z8DA 2NO5A 2X3FA 3AHGA 3FIUA 4X45A 5CITA 4JOSA 1AY0A 4DCNA 4JGIA 1ESCA 4KH0A 3CPJB 1BH2A 4GM0A 4A8JA 3OOWA 2O7NA 2PX6A 1U3UA 4MWSA 4UFNA 4XYEA 5CVCA 4ENRA 4RKWA 2G4VA 3NTOA 4N40A 4AX8A 4DQVA 1PDOA 3AOGA 3AUAA 1FCJA 1VCOA 5GWXA 1Y9AA 3X1XA 1TZ2A 2YV3A 2DT5A 5CDSA 4HFMA 4NEKA 4QJ3A 3RUAA 2ZJ5A 4O25A 4UZFA 3SC4A 5J59A 1U94A 1P1IA 2GAOA 3RANA 4IGEA 1QTRA 2O5CA 4HGZA 3VPCA 2MMGA 1LW7A 2WDZA 2X0IA 3DTVD 4PPQA 1IU9A 3HCAA 1XD9A 4OSPA 3D8NA 1FSPA 4NECA 1R5NA 3GROA 2FA9A 2CXRA 3B6IA 3KUXA 1EY3A 3PB3A 2Y93A 2PS1A 3P71T 4UMFA 3ZOKA 2Z5VA 1A27A 4KACA 3TNLA 4FCTA 3A36A 1C0IA 2UKDA 4A15A 4ELSA 5EJ5A 2ZT6A 4RDHA 2YYYA 5HEKA 5L53A 3LWDA 5IPFA 5HA5A 1QZ3A 5DM0A 1LS6A 1HG1A 3UQZA 5JBQA 5EIWA 3ZEAA 3FLMA 1D1SA 1YZVA 3H6KA 3VU0A 2FMXA 3WDLA 3B1WA 1PV1A 1W6RA 3E0QA 3F5QA 3RGGA 4DLTA 2FDCA 1G5QA 3RVKA 3S2EA 3UH1A 4KXNA 3VR5H 3WQSB 1ZA1A 2HD4A 3O3CA 3NR2A 4O2BF 4PN3A 4AXBA 2IE8A 2VRBA 5KSWB 5A71A 4CR6A 1HF3A 1R8XA 3T8YA 3TMYA 1UQUA 3IHWA 4R5MA 2Q1SA 3V1YA 1TEHA 4OB6A 5FPTA 1R74A 2RHTA 3Q5EA 1J6UA 1JHVA 4DCJA 3HVHA 3ZY5A 3PIRA 1GPUA 4Z4HA 3PLAE 4PBRA 1XDUA 3ABQB 4LQLA 2ZB4A 1Z2CA 1Y3AA 1XDBA 2C8TA 3ZIAD 4Y0NA 3OTHA 1HYGA 1ULBA 4GX1A 1ZK1A 3HV2A 1JUDA 1VE1A 4QOSA 2XZOA 5AW9A 5CVJA 4YCBA 1HFEL 3L1KA 1JLLA 4OB7A 3LCUA 2Q1YA 3Q7QA 1Z3IX 1ZUD1 2IJGX 3JPWA 4XFDA 5AOVA 4E70A 4BKMA 1ZMXA 4G8JA 1QH8A 3HH8A 3BERA 4RHCA 3HPQA 5CDFA 1S3IA 1XMOB 2HLDD 2GLTA 4RSGA 2HK6A 2O0LA 1N2CB 2BRUC 2XRYA 4M7PA 2WPDD 1JALA 4ZT7A 4I9NA 3ZY4A 4X1YA 1I4OA 3K15A 1CE8A 5IZCA 5HQ3B 1V5EA 4R40A 3DV0B 2KE5A 4PVDA 4KTVE 2E4AA 2P4EA 4KAFA 3T94A 3R5HA 1XU9A 1NP3A 2X5OA 3GMIA 3A1FA 5CT9A 2P7IA 1Y9EA 1Q7GA 4G8DA 4PBSA 2QDKA 3OCVA 3C8HA 4W8OA 5AKXA 2P3SA 3ZHBA 1RHMA 1Z7EA 4EMSA 4BB9A 4F5YA 3GF3A 3QUTA 5L7WA 4W5WA 4TMYA 1AS2A 3CKMA 1XZGA 3RS4A 1PDVA 4QAJA 5DZKA 4JUDX 4EZEA 5KTSA 5FTWA 1B93A 2PD4A 2QZZA 4LHWA 4EB8A 3EQ2A 2GZAA 2M2IA 2YJNA 5SY6A 1XEFA 4EA9A 4JXKA 3VC1A 2VZEA 4R7ZA 3GLMA 3GZNA 3L6EA 3PQEA 1E66A 1UPTA 2OK8A 4S2UA 5EG5A 4AJ1A 2ZPTX 4NMMA 5EIOA 2P6UA 3H65A 3PQDA 1P7YA 4EUHA 3KUUA 4IXWA 5DH9A 4EPRA 4XB1A 1A96A 1EZZA 2CZCA 2PXAA 3IQGX 4ALLA 1PF7E 2DQZA 1B00A 4WYOB 1CS0B 5CGQB 4DA6A 4MVJM 3UMRA 5HUHA 2NTYC 1KI6B 1XQ6A 4MW2A 1HPLA 4QOHA 4KRXA 4MLZA 5FPHA 2ZJ7A 3LC7O 4KN8A 3WWEA 3OEYA 1E1QD 3EB9A 3KFXA 3CRNA 4UBLA 5HZMA 3FDXA 4TV9F 2CBYA 3UAVA 1EUDA 2RJ3A 1CCWA 2GTIA 1CUHA 1SOWA 4KHZA 1WJGA 2RMKA 3KKOA 3LDAA 3LRTA 4G1EB 3T1NA 1F48A 1T24A 3INNA 4NBRA 4BAUA 4EL5A 1XYGA 4DIUA 3AQ4A 4LJYA 1AKRA 3SEAA 3AUTA 5TRTA 5JUWA 4N18A 5DEOA 4YJFB 3GLVA 1JBEA 2O1XA 3GDOA 4EWLA 5AR1A 1S96A 1ZEMA 3FWNA 2MR5A 4HB4A 3MS2A 4JUFA 4V1CA 2CMGA 3WSTA 3N2ZB 3ZWVA 2O8EA 1JWBB 5ISMA 3U56A 1XNQB 1TI7A 3T4XA 3I12A 2IU3A 3CH6A 2GCOB 1LI5A 1JFFB 3FDJA 3MCAA 4HYTA 4MS1A 5HKBA 2XKAA 3RAPR 2ECQA 5ALKA 1DBVO 3BIFA 4IMPA 3PC4A 3K5HA 4POAA 3ED5A 3VPSA 4DC1A 2ZWAA 3H1FA 3OC6A 4LI0A 1L3IA 1YDEA 1CUAA 5EERA 3LPNA 3M1YA 2WABA 1PO7A 1Z6XA 3PICA 3MYBA 4UULA 1M2HA 1N92A 1TAHA 2D6FA 5C4GB 5JDCA 2K87A 1V16A 5AI8A 1PVVA 1Z6TA 2RIRA 3QY9A 2SKCA 4NU5A 2D2XA 4GGPA 3DPIA 4CKYA 4F2PA 3BQNB 1I0IA 2RAPA 3JAWB 4UUMA 5D3ZA 2Q7DA 7GPBA 3O3MB 3ST7A 4D9FA 5B1EA 5HBRA 2EBHX 2PHZA 1EFLA 3WXMA 1CEXA 1DWPA 1NQUA 2XNDA 4YASA 4HDNA 3TRKA 4ZTUB 4FDLA 2G0TA 5FRDA 2BTQA 2QUIA 2O06A 1VXRA 2RGAA 1USIA 3NBAA 3QK7A 5CM8B 5ES3A 1H2WA 2ONCA 3EX7C 1QHHA 3IKJA 1GNRA 1HK7A 2C4WA 4ILKA 4UNIA 3UK1A 1X19A 2FI1A 1HE2A 2VJNA 5ANRB 2WP8J 4C2BA 3SWWA 1SD5A 2BMVA 3HA2A 1NFRA 4LISA 4U1RA 1TVCA 3H11A 4CW7A 4K0KB 2DPLA 1E5LA 1YC5A 1P2DA 3D3WB 3HWX1 2ZJ8A 1MO4A 2IZ6A 1PFGA 3OO1A 4Z2YA 4Y9RA 2Q9CA 4D8YA 2LPMA 1A9XB 3DMRA 3R9WA 4CFZA 2RHOA 3QEAZ 2Q9BA 3U7QB 3WSWA 4M4SA 1A1SA 3N5CA 1XTSA 2CVQA 2JFVA 4IDCA 4QPNA 4Q9JA 2PZMA 5EJIA 3PPVA 4BLQA 4XR9A 4C6TA 4AJHA 5AK4A 1MDFA 3C5VA 5HSGA 2QTVB 1X13A 2CK3A 3TKAA 5FL3A 2FWBA 2CN1A 4RIIA 2Q1UA 1II8B 2BSQA 3E15A 3EWAA 2C5FA 3FHOA 4K03A 2PPLA 2H0RA 3HLTA 1FXUA 1QONA 2Y77A 3K2EA 3F47A 5DZSA 2YASA 4AJIA 1OYYA 1C41A 4O02B 4KYTA 3JRXA 4AULA 5JJLA 3SJUA 1EWYA 3NCHA 4JR1A 3AUJB 5A04A 3AVQA 3WHPA 3T3MB 3SC2A 1R5JA 4MWZA 1CIVA 3SSNA 2GF0A 2RB4A 3BWMA 5EHNA 3IEMA 4Y6RA 2C8LA 2O8BB 1QZTA 1FJHA 3NXKA 3R3ZA 1Z08A 3TLXA 2DETA 3UTCA 4AF6A 2P3OA 4K86A 1EGVB 2AMLA 4Q7QA 2XQGA 3Q87B 1GPWB 5CAEA 3OFKA 5CCDA 2H0QA 3OPNA 4UDXX 3O31A 2R8OA 4M7OA 4G4JA 4UCFA 5AVRA 3IAVA 2IP2A 2V6FA 3GJTA 2BLLA 1WZEA 1KHTA 4Q9AA 3O6VA 4RJJA 4Z99A 4I5DA 1D5CA 4HGNA 1G2IA 4O2AF 3PEWA 1W49A 3WJ2A 3DORA 5HTOA 1SULA 4GXQA 3UC9A 2ERYA 3JQAA 5B6JA 5IT5A 2I7DA 3TLGA 5AVVA 3HJGA 3ZUPA 4NMHA 5DZKH 4IKPA 3VV3A 4QXAA 3HDTA 2WWVD 3T38A 1SVIA 4N7JA 2C2GA 1KZ4A 2X1MA 3PPYA 1YVEI 1E0DA 1JLRA 1I14A 2GWRA 1AQYA 3H3XA 4GLLA 4V0RA 4YO7A 3NYIA 4FJ0A 4M7RA 5FAXA 4I9GA 4UU0A 5G0TA 2KI5A 4L6IA 5DOZA 4XIGS 1ATIA 4F5EA 3CE9A 1SBZA 4DBLC 2PJZA 3JQEA 4RZSA 3RO7A 4G25A 1XEAA 1NQVA 4TZ0A 2C9YA 4MV0A 5JDIA 3R6WA 2CFOA 1XLUA 2SCUA 3AF6A 1CF9A 2O19A 2JGNA 3V8VA 2J9FB 1KQFA 1MQ8B 3PPWA 1D1PA 3ZWAA 3PLRA 2HCFA 2CSXA 3L0BA 2PUJA 3LT1A 1SBYA 2VNIA 4BNDB 1W47A 3VU9B 4X8LA 5T7BA 3C16C 4CI9A 2G76A 3MMZA 4V39A 5LSAA 1MRSA 1QO0D 2R5NA 3JZAA 3WP0A 2BH9A 1TADA 2GN8A 2GPAA 2AF4C 1EWRA 2P5TB 3QXJA 4PSDA 4R6WA 4ZOCA 1DP4A 1ZA2A 1Z4JA 1SUPA 1OXUA 1VDZA 2C82A 2GOYA 2Y4NA 2YS6A 4GBMA 4P4GA 4PR3A 5F1PA 2EJUA 2GHTA 3NVMB 3OLYA 4I4IA 1YJ5A 1HV8A 3H9JA 3I45A 5EIHA 3OZUA 3ER9A 3GJ5A 3DZIA 1ZVVA 5JAQA 3LHDA 2ZYWX 4L6CA 2OVFA 2WFLB 3L3BA 4WXYB 3DMHA 1N6EA 1YH3A 1E0JA 4HAZA 3OE4A 3OZAA 1X15A 1UMKA 4PZYA 1OMOA 1WB9A 2NX2A 1G59A 4CIDA 3DLIA 2CZQA 3HDQA 1JU4A 4IFTA 3ID6C 1M5RA 4C9BA 2NM0A 3IPYA 1MA0A 2JEYA 5LIRA 3CHYA 4FINA 1JXAA 3IJ5A 4IR7A 1W1IA 1XIVA 3OLWA 1Z4MA 3FVVA 4PQEA 4DG9A 1L4NA 3H0QA 3BGWA 4ZQGA 2V6JA 5HF5A 5C37A 4HFNA 1LBTA 5IVHA 3OE5A 4EZBA 4DPMA 4XX0A 3PVSA 2PKYX 5AVJA 5TGZA 2HBZA 3N3BC 1W75A 5KTNA 3G23A 1EDDA 2BDTA 2SNIE 3EDCA 4XWKA 2W6QA 3X2SA 1CT9A 4PRZA 3WLNA 1P7ZA 3WFZA 3CO0S 4G9GA 2R85A 4NPAA 2HCJB 1JBKA 3HSYA 3PNSA 3ZGYA 2GBLC 1QLHA 2ZRPA 2ZPAA 4X5OA 3I04M 2G1PA 2PUBA 3SLLA 2IBMA 1SD1A 3MAAC 4P0TA 5FOUA 1M1NB 4GYKA 1SUIA 2PR2A 4NBUA 3TECE 2HQ1A 2GJ4A 3CUYA 2JH8A 1IBRA 4MRVA 3THXB 3T9EA 4LYAA 4KTTE 3VYVA 5ABPA 1TO1E 3W5SA 3N6RB 3M9XA 3E03A 5IM4A 1Z0SA 4OX9Y 1PKEA 1O95C 2F6RA 4D79A 4EPVA 5TMDA 5AUOB 5T3UA 1PGNA 2XNSA 2ZRCA 3A26A 3KJFA 3M6FA 4UM9D 3ZN2A 5T3YA 3VIVA 2WAXA 3PQ4A 3OG9A 4WXPA 2VREA 1EBUA 3K0CA 1QH1A 1VCIA 2VF7A 2ZBRA 3LFTA 3MUOA 3PQ8A 3SXUA 1TUBB 3WK4A 1ORRA 1VRCA 5JAMA 3HYRA 2Y0CA 3IVGA 4FDUA 4P08A 2Q07A 2PUGA 3FDUA 2W4IA 2PSSA 2NO6A 5TF4A 4KP7A 2II6A 2IHYA 4LZZA 3ETGA 1RBQA 3VDXA 5K4GA 1GG2A 2WU0A 2XD4A 1JDSA 4PSAA 1RLOA 2VHJA 5LMZA 2GESA 4BATA 1ZY2A 5IX8A 3TNDA 3EA5A 5K7SA 4LCJA 1Z47A 2VVTA 1XTBA 1J20A 3K9BA 1N2CE 2GBCA 4EG3A 5F52A 3RPEA 1W4ZA 1XC7A 1FTQA 3NO4A 1E5QA 4BO8A 4CR7A 5KOHA 3MFMA 1WZUA 3RBXA 2DR3A 4Z0TA 3QE9Y 2GEBA 4U6SA 3C7TA 3QF4B 5TMPA 3PFIA 1ZOIA 4EA6A 3OMWA 4ARIA 2OQVA 1QQAA 3RU7A 1KFEB 1XVTA 4RA9B 3WG5A 5K5EA 4DLKA 2B78A 1M2VA 5JV5A 1XTRA 2I62A 2LE0A 2OHGA 3PXAA 3H0UA 3DEKA 1K3TA 2K7ZA 2CWDA 1EX6A 2YHIB 3GBSA 3PKJA 1ZCAA 2VG8A 4PIPA 1AKUA 3ZCSA 3CU5A 2NVUB 2I5PO 3EVEA 3F96A 4PN7A 2R751 1V0JA 5E0SA 1EEHA 8ADHA 4Q9DA 1R27A 3BCSA 2I34A 4JR2A 1CUIA 1LRLA 1OX4B 4HQFA 2CHGA 4L3WA 3CZ5A 1FW6A 2QHXA 5GV8A 3E7FA 4GRDA 1AHPA 2B82A 3DKPA 2G77B 5KTOA 3I1JA 3CBGA 3CVJA 1TM1E 2J3DA 1M0SA 2XDQB 3FTDA 4FMCB 2IHKA 4OGGA 4Q3KA 4PX2A 2OCAA 2FE1A 4ZEWA 3U7RA 2DULA 3E9EA 2C7OA 3GFPA 4EZIA 2ZT5A 1D4AA 4UKDA 2WJAA 4UXJA 2GKGA 4L8GA