3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
b'PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
2FSSA 3BHIA 5JYDA 2RH8A 5TSDA 4JCOA 3DDNA 3GOHA 3JD2A 3H81A 3S8MA 3V1UA 3GK3A 3VPFA 3GNQA 5CTBA 4XQ9A 4MVJG 3WTBA 1EDOA 5HS6A 2ZL2A 5C7IO 3VZSA 2XAAA 4J91A 5G1QA 3VTZA 4J1QA 1IHYA 3DEYX 4GX5A 1XG5A 1GADO 4F46A 2I5PO 3PTZA 4CM3A 1NQTA 3ST9A 3KTGA 4LSMA 4LVCA 3DZBA 3VZPA 1DBVO 2FHSA 4K26A 3KLMX 1CWUA 4W9NC 3T4XA 1CRWG 2P9GA 2HMVA 3BZUA 4JN6B 4FB8A 2DAPA 3QLJA 5FEUA 4HX5A 4JIGA 3GKBA 3ZWWA 4GMGA 4R1UA 1U28A 3GHYA 1L7EA 3DZFA 5KJCA 1T26A 2Q1TA 1I0ZA 3QHAA 1WW8A 3ASUA 3H0UA 3M1LA 4J16A 4FFRA 4ZQHA 4H3VA 3G17A 2BF7A 1XHLA 1I3LA 4YT2A 1R15A 3QVSA 3B6ZA 4OH1A 3OEYA 4FNBA 4KNPA 4W82A 2RBEA 2OP1A 2VHZA 2GSDA 2OMEA 3DZGA 1NXQA 4JLWA 1JA9A 3ONFA 4PLPA 4YPOA 2CZCA 3GZ4A 7ADHA 1CETA 1K2WA 4L6WA 1VJ0A 3AY7A 5LDHA 1LU9A 3TN7A 2ILTA 4AJNA 1SEPA 1MV8A 1ZSNA 3N58A 4CLDA 4RCNA 4U8GA 3L9WA 4E5MA 3BHMA 4PLHA 4AJLA 2P91A 1Z6ZA 4RGBA 5HWSA 5A9SB 4JOTA 1I3KA 1WPQA 3JCZA 1IUKA 3JQGA 3JSAA 4GKBA 5AXAA 3OQBA 3VC7A 2PH5A 5DU8A 1JU9A 3GGGA 5FF9A 3D4NA 1YRLA 4NH4A 1BGVA 3IJRA 1XSEA 1O9BA 2RCYA 4R9SA 1FC9A 2EJ5A 1H0KA 4YJHB 3WLEA 2C7GA 4EUEA 2HMTA 3HP0A 4XYBA 5F3RA 3UOGA 4ALMA 2QZ9A 1G0OA 3LT0A 1TLTA 1WVGA 2BFMA 3OJEA 4NEKA 3VIVA 2G76A 2WYUA 4XX0A 4CM5A 4WLEA 1ULSA 1ZUD1 1PSDA 1N1EA 3ROPA 1O89A 1KVRA 1X7GA 1V3TA 3RC9A 4YWJA 5IF3A 2FP4A 3WGQA 2NU9A 3ZH2A 2ZL3A 4FN4A 3K8XA 4U0JA 3TF5A 1QXSA 2O3UA 3LT4A 2VYVD 3P19A 5TT1A 1MFZA 3P5MA 4UVGA 2IEBA 2Q4BA 1HE2A 4CV2A 4JP3A 1V3UA 2Q45A 1EZ4A 1XR3A 5L9AA 2GZ3A 4B3JA 1MG5A 3B20A 5DZKA 3AU9A 4ILKA 4E2ZA 1GQYA 1KBZA 1PQUA 3H4VA 4BNXA 3G79A 3I47A 4MINA 1NNUA 4ONEA 3SXPA 1A4UA 3FPLA 4QTZA 1DRUA 1N2SA 3W6UA 1MUUA 2EF1A 3HLN1 1LA2A 1E7RA 2I65A 3GN1A 4TZKA 4EBFA 2YHIA 2CSUA 2PG8A 4TKMA 4MOUA 3Q3CA 2CMDA 5K6AA 1DEHA 3IB9A 3PGXA 5G1SA 1LSOA 3QWDA 2CF5A 1A72A 3ETGA 4N7RA 2A7SA 3NYWA 4KPKA 4PRKA 3GVIA 4A03A 4I5EA 5DL1A 1YL6A 4I5GA 4RPKA 4K6FA 4NHEA 4IDAA 1LDBA 3COSA 1V0JA 1VRGA 1HDRA 3PK0A 5ER9A 3X2EA 1E1LA 2I9PA 2NACA 1ZK2A 2G1UA 2X4GA 2VYND 3NAQA 1E3IA 1OMOA 4IJKA 3SX2A 2B83A 5L95A 5A03A 1PJBA 4WLOA 4EMLA 2PZMA 1SEVA 3RFTA 4MIOA 4BVAA 4XYLA 1AXGA 4NBVA 5KVCA 3C8MA 4P4LA 3H3JA 1B14A 4CPDA 1P45A 1GAEO 1LDEA 3FD8A 5LCXA 1G1AA 5KKCA 2BD0A 1RYDA 2BLLA 3T3WA 4TVBA 4BO8A 1QG6A 5A9SA 4PCVA 2NADA 1ZMTA 1I2ZA 1XA0A 3GVXA 4RF3A 1EF9A 1E7WA 1EBUA 4L4RA 5HTOA 2J3HA 3Q1LA 4R51A 1GUYA 4DQUA 1HZDA 2O48X 3I6QA 3WBBA 4LVUA 1K32A 1BW9B 1QORA 4YTEA 4YJHA 3FNHA 4XGIA 4FOOA 1VC2A 3GF4A 3BXXA 3L3SA 1XIVA 1WZ8A 5TT0A 3DOCA 1EBFA 1OFGA 2C59A 3ROKA 4B4VA 3CH6A 1J49A 4NJMB 1J5PA 1E7QA 1RM4A 5I9MA 4PZEA 3D4OA 3ZHYA 3IL2A 2NM0A 3QY9A 3TZCA 3JQBA 4GHNA 1ML3A 1NFFA 3I9JA 4YXFA 5ILGA 3WGTA 4CM4B 3C1TA 2FR1A 4AJHA 2NU8A 1P1FA 2EIHA 2Z5LA 3WSWA 4IBOA 1BDBA 2OBYA 1R6DA 2B5WA 3FHLA 4E30A 4EJMA 4BV9A 4PRLA 1HTBA 5DOVA 3F5QA 3H2ZA 4BO9A 1GD1O 1FF9A 3KEQA 3ICCA 3FWNA 3VPGA 4FJWD 3OP4A 1BHSA 3HSKA 4MVJE 4FD3A 4XRRA 4Z0PA 5KVQA 1LRLA 1U7HA 3GVCA 3HDHA 3RQSA 2Q2XA 3DFZA 3H02A 2XOXA 3PYXA 3I9KA 1F0YA 3AU8A 1X0XA 3P5SA 2EG9A 2F1KA 3DZHA 3PGJA 4BB6A 1IY8A 4J2OA 4DIFA 2AXQA 4A2CA 1IULA 3SLGA 1BSVA 2C8TA 1NVTA 3H7AA 3WQRA 2HKIA 1ENPA 1FDSA 2VWGA 2I76A 4UULA 4L73A 4NIMA 4DUPA 3GGPA 3RBVA 2H6EA 4OSPA 1E6EA 3EYWA 4CR7A 3V8BA 2C5AA 3TOZA 3WGOA 3VPSA 1U5AA 2VRBA 4BKUA 3LZ6A 3CIFA 5HBRA 4IDBA 1R4NB 3PYMA 2BFOA 1WZEA 1E7SA 3GRKA 5T8KC 4ZHSA 1N7HA 4Z0MA 2PD3A 1MG0A 3LYLA 2PNFA 3NJ4A 3O26A 3RUCA 1K5HA 5COQA 4FPXA 1C14A 1YH3A 4IDGA 4NJOA 4NZ9A 2HW5A 3NGLA 4CR8A 4JBIA 5JO0A 3U4IA 2CDBA 2YDXA 3GEMA 1NZYB 1P0FA 2Q4EA 3DTTA 3F1LA 4J6FA 5BSFA 3E1KA 2RHCA 1P1KA 2CVQA 4YA6A 2VSUA 2Z1MA 3GC6A 1M76A 2J5KA 5FIFA 3L4SO 1XGKA 3HQ4O 1D1SA 3PFFA 2CF6A 1ZBQA 1BW9A 1NHWA 5U4QA 3IOYA 4J49A 2ZKLA 4A10A 1ID1A 2GR9A 4AJEA 1FDVA 4XJTA 4BMVA 4UVDA 3UCEA 1KY5A 4FQ8A 1BWSA 1YBMA 3RU7A 2J6IA 3H2SA 3ZNPA 1HDZA 2YY7A 3GDFA 3NTQA 3OECA 4OLQA 2BHLA 4PLCA 4N5LA 4J1TA 1AUPA 2PY6A 2VUSA 1RWBA 3BMCA 1GZ4A 3C1AA 3D1LA 3QRWA 4NJMA 5CTCA 2ZQRA 3DAPA 4GWKA 4EEZA 2JD0A 2ZCUA 5IN4A 1ADGA 3FBGA 3FNFA 1SG4A 1KEPA 4ZGWA 3HHPA 3I9LA 4U0KA 5KJEA 3ULKA 3WGZA 1U2DA 3EVTA 1F8GA 4CV0A 4R1TA 4A73A 4CM4A 2VTDA 4AJ1A 1PJLA 5IZCA 3BMQB 2GLXA 4BL5A 3V5EA 1SOVA 1YDEA 4HBGA 3OIGA 3IKVA 4NFSA 1E3LA 1VM6A 2HJRA 4RVDA 4DBZA 2IEXA 1GFSA 1N6FA 3G3EA 2ZTUA 4RVFA 4WKGA 1P1RA 1HDXA 3LQFA 1QYVA 4ZRNA 4BNFA 2W2LD 2J5GD 2GD1O 2R6JA 1DC3A 4KZPA 4PLVA 4WASA 2AQHA 1V8BA 1X0UA 4MVJF 4HV4A 2NVWA 4U0GH 1P1IA 3CE6A 2ZIZA 3DOOA 4EYEA 1PS0A 5TS3A 4BNGA 4CV3A 3DZKA 3UW3A 4ZQGA 4ZJUA 1SOWA 1YKFA 3P2LA 4Y98A 1ZK3A 2UV8A 2LDBA 3GEGA 5DU6A 3JQCA 4E4YA 3LU1A 4BUCA 5E0NX 4OAQA 2GF2A 3K31A 3QE3A 1SBYA 2NUAA 3NT2A 2O3QA 3WNQA 3WR5A 3S2FA 4U19A 3QWHA 1PJCA 1LJ8A 4ND1A 2P2SA 3DZIA 3WX0A 2EW2A 2EKLA 1R4NA 2UAGA 4E21A 4X54A 1Y6JA 2D8AA 2W4QA 3NT4A 3H0SA 2F9IB 4OXYA 1EVJA 5DCWA 1UXHA 1Q7CA 2C20A 1RPNA 1Y8RB 4U6SA 1IPFA 4FC7A 3AM3A 1EUZA 3L6OO 3O9ZA 3V5IA 4CQLB 3K9QO 3I23A 2FPIA 1HF3A 3Q0GA 3ZW9A 5C7OO 5DNAA 1YQDA 1R0KA 3HRXA 1C0LA 3HFSA 2Z95A 5BNIA 4KDFA 4B4OA 4DVJA 5CEFA 1C1XB 3TSCA 4HC8A 4D7AA 2P5YA 4B3HA 5ENVA 4CLXA 5JSFA 3JD4A 3R9QA 1P1HA 2EERA 5JW6A 2DFVA 4CMHA 2OUIA 4IZDA 3QVOA 4D3FA 1DRWA 5T67A 3U9RB 4DIOA 2AG8A 3PLRA 1WMBA 1ZXLA 3NTRA 1UUFA 1D7OA 3DMTC 4GVLA 1ADBA 1KVUA 4PLGA 2PA3A 5JYEA 1Y8QB 3NJBA 1A5ZA 3CUKA 3EMKA 3OEWA 4WCFC 3A9WA 1FMCA 1UR5A 1ADFA 1E5QA 3V2GA 1PGQA 2J5GA 2Q49A 2Q2WA 3T4EA 5EJ2A 1N6EA 3KYCB 2CE3A 1JKFA 3BTVA 1R0LA 3JYOA 4O1MA 4W99A 2TMGA 4Z9FA 4DLBA 2NQ8A 4CMEC 2YYYA 3VVBA 1O95A 4UUMA 4EMMA 4AJPA 2CBYA 4GX2A 4D3DA 4MKXA 2UUPA 4C7KA 3JQ9A 2PK3A 1TA4A 1MP0A 1IOLA 3BMQA 1T4DA 2G0TA 4XGKA 4I1IA 3NDIA 4MVJH 5EMHA 1JVSA 4KQWA 5FI3A 5JPIA 2O3SA 1DFHA 4J4HA 3WDSA 5ITWA 2VWHA 1EUDA 2VHVA 2C2YA 1I30A 1B8PA 4CUKA 3RSHA 5INGA 2ZTMA 4CMAA 4GPD1 1U3WA 1UYVA 3ITKA 2J3IA 4RVUA 5HA5A 2FWMX 4J3FA 4IJUA 5CG1A 4NNJA 3DB2A 2VUUA 1UDBA 5C37A 5BNTA 2Q50A 4MP3A 5KJ6A 5L40A 1JQBA 2WM3A 3Q7HA 1N6DA 4K1LA 3PRJA 4BO4A 4QIJA 1B3RA 3JD0A 3E48A 3V1TC 1GV1A 1X13A 4II2A 2Q1UA 1NQ5A 3JQBC 4CMBA 5CDSA 1W73A 3F4LA 1LDMA 4Z9XA 4M55A 3DHEA 4J0FA 4FNDA 3PFWO 4E3ZA 3T8AA 2NTVA 3JYLA 4OKNA 2IZ0A 2Y1CA 2ZB4A 3MJVA 1V3VA 3KTKA 1C1DB 1N1GA 2H5LA 2PZJA 2FOIA 5G0UA 4KD6A 1G0NA 1NAIA 4MJLA 5A1TA 2DU8A 3NDJA 4HY3A 1DO8A 4P38A 3GVPA 3K96A 1Y8RA 3OICA 3GY0A 4D0SA 2PFGA 3LC1O 3U3XA 1F14A 1DJQA 3FWZA 4CQLA 3F4BA 2FY8A 1PGJA 3G49A 5I9LA 4CMCA 4RYFH 2EKPA 2NU7A 2E6UX 2JHGA 4WGGA 1HNOA 5C5IA 3A28A 3ANMA 1C1XA 1PR3A 1DB3A 4PG8A 3AK4A 4IQ8A 4J2HA 3AFNA 5CP8A 2DUBA 2JFHA 2JKVA 4RORA 3F9IA 3HB5X 3JQAD 4NK4A 4CMJA 5DTPA 2Y1FA 4Q3EA 1DPGA 3U0BA 4HFJA 1E3WA 4QFCA 2C82A 3DHYA 5DBIA 4CMKA 1SZOA 1ISMA 2HLPA 4WLNA 1Y8QA 2B0JA 1I3MA 2OFPA 3E5RA 1CQJA 4RQTA 3ZWBA 2Y1EA 4LW8A 5KKAA 3UVEA 3IP1A 5KJFA 1EQUA 2CY0A 2WE8A 1KS9A 4WEOA 1U3TA 4Q9NA 5DKPA 1X7HA 3KYCA 5KTKA 4OG1A 3PXXA 3AFMA 3GMSA 1CF2O 3CTMA 4KTVE 2D4AA 3F3SA 3DBVO 4WNCA 1B16A 2ET6A 1UH5A 4JBGA 5HRUA 4RCVA 3RUAA 3JQDA 1LLQA 1ZEJA 7MDHA 2PZKA 3E9NA 4R69A 1AE1A 3H8VA 3AUUA 5IXSA 3NGXA 4P8RA 4B4WA 3UCXA 2CDCA 4TMFA 2P9CA 4URFA 1ZO8A 3HDQA 4Y6PA 1KETA 5DBGA 3VH3A 4D3SA 1U4SA 1Z45A 3BMOB 1PGNA 3V2HA 5DN9A 3ROQA 1OD4A 4N54A 4IPTA 2DM6A 1PJ2A 1PZHA 2IODA 2Y1OA 2RAFA 4A7PA 3OJLA 2Q3EA 3PJEA 3DHNA 2E82A 5KIAA 1DIBA 3L07A 4D41A 1FCFA 2NNLD 5L45A 4LMPA 3ZWYA 1P1JA 2Q1SA 5LC1A 1H6BA 2WWRA 1Y5MA 4C4OA 4XIYA 3K5PA 4IDCA 4GL4A 1H6AA 4E33A 2Q1WA 3WWYA 4AJ2A 4CUZA 1BVRA 4EUHA 4JCTA 5CDUA 4NFHA 3TZQA 3WBFA 3RI3A 3H9UA 1DAPA 1P31A 2NTNA 4N5NA 1BG6A 4D46A 1A9ZA 3INRA 4ALJA 4ZDDA 1PS8A 4LRSB 3EC7A 1HKUA 1LC0A 2YQ5A 1C1DA 1K3TA 3U4HA 3IC5A 1HRDA 1SZJG 2AEFA 3NEPX 1FJHA 2QRLA 4FIZA 1HLPA 2AEMA 2PKRA 3DTYA 3WWZA 1QLJA 2WYVA 4BO5A 5A02A 1TG6A 2YDYA 1IZ0A 3GFBA 3WIDA 3MWDB 3FF4A 2VHXA 2HSDA 4PLYA 4CM6A 4DYVA 4XQCA 4BV8A 3BHJA 1Q0QA 1JKJA 4XWYA 1OC2A 1T2DA 3BTOA 2FR8A 2NSDA 1GY8A 4GSKA 4B8WA 4E5PA 4ZICA 2HK9A 5MDHA 1M66A 3A1NA 3PWSA 4I4ZA 1U2GA 2POQX 1NASA 3AUSA 3TRIA 4XKJA 2D59A 5LDGA 5F5NA 4LCEA 3VTFA 1EE2A 4BGIA 4AJIA 6ADHA 2X22A 4FSHA 3Q9NA 4XGNA 4JP2A 3TZKA 4MIEA 2YV3A 4D79A 4ID9A 3ONDA 3GZNB 3PZBA 1E1NA 3KXDA 1G6KA 2FMUA 1DLIA 3VZRA 3RJ9A 4XD2A 2YHIB 4L75A 1Q0LA 1WLYA 2UZFA 1JXZA 3PIIA 5IFLA 4M89A 3ISAA 4BMSA 2JCXA 3KO8A 3QQPA 4L8VA 4ZA2A 5JLAA 3O4RA 3SWXA 2B35A 1LNQA 2DPHA 1YBAA 4IS2A 1PWZA 5DDIP 4NDNE 4PFJA 2PWZA 3V1YA 3PZKA 1PIWA 3ZV4A 4KUHA 3E5MA 4IIUA 3DL2A 4IJWA 3HWRA 4EGFA 3GUYA 1CJCA 4CM7A 1NQOA 2WSBA 3CEAA 4BNKA 4YT8A 3BMOA 2BZRA 4OJNA 1EE9A 4ZDEA 3TOXA 4IJVA 5CHEA 4J1NA 1HL3A 1SC6A 3S55A 3GH3A 5L51A 4YB8A 2UVDA 3I9NA 1UJMA 1PJTA 1BMDA 3TT7A 1YGYA 4NNQA 1DHTA 2O4CA 1NWCA 1MJ3A 1ZW1A 1JKIA 4XZ3A 3ROMA 3I5MA 8LDHA 4JWVA 3JQEA 4OMRA 5TJ9A 4MVJM 1GTMA 3AI3A 2J8ZA 3NX4A 4DRYA 1HDCA 1CYDA 3QV1A 1IYZA 5G1RA 1ZSYA 4GGOA 4FN7A 2R00C 1R0SA 4DGSA 2GZ2A 4TRNA 2BFAA 3K2EA 4QO8A 2HQ1A 1ENOA 4UVEA 2ZL0A 2EGGA 4XQGA 3H65A 4XB2A 1IZ9A 4TKLA 4RF2A 4YDRA 5DTWA 3U62A 4XYGA 5TX7A 5AYVA 1O94A 3WLFA 1XEAA 5THKA 4BMNA 3T88A 4DXHA 6LDHA 2Q2VA 3FRJA 2D2IA 4U18A 1QMGA 5L4SA 4WCZA 2WD7B 1HNUA 4BNWA 5AQ1A 3GPDG 3KOUA 3MTGA 4YCAA 2P4QA 3TQHA 3HINA 3WJAA 3ICPA 3H6KA 4R16A 3RVDA 3L4BC 4J7XA 5IZ4A 5A05A 2JFFA 4DC0A 1XWFA 5KWEA 4CM1A 3IMFA 1H94A 2LDXA 5L7YA 4TWRA 3VH1A 4EEXA 4BO0A 4BKPA 4GAEA 2VRCA 4KUGA 1O6ZA 1VKNA 3H0JA 4OXNA 2GYYA 3GZNA 4JXKA 3UCFA 1O8UA 3R9SA 3SVTA 3DBHB 5F21A 1ZK4A 3K6JA 1BXGB 4H15A 5BR7A 2PD6A 2Y66A 3QVWA 1TYFA 4U0GA 4L8KA 2VOJA 2ZTVA 3BEZA 1P33A 5JCJD 4G81A 2PZLA 4FFNA 5ER6A 1WP4A 3GRPA 4FOSA 5ES3A 3N7UA 2J5RA 2CD9A 4QX6A 3GN2A 3BAZA 3M1AA 5TGDA 4INAA 4WYOB 1DIHA 1VJ1A 4BNNA 2BI8A 1E77A 1NVMB 1U3UA 2DTDA 4Z6KA 3JD3A 3K30A 3PYLA 5INIA 4MIYA 3C85A 3AUTA 1UYTA 1QYDA 3I6IA 2X9NA 1JWAB 4BNZA 4D43A 3RSIA 2XF8A 3ASVA 1W4ZA 4TQGA 3EGOA 4WUVA 4J7CA 4J0EA 2WDZA 4RDIA 3BF0A 1P3DA 4YVFA 3ZWOA 4DREA 2PBPA 1E6UA 3KETA 1K39A 2XXJA 3AOEA 3BIOA 1FDWA 3D0OA 5EL0A 4MKRA 4GH5A 1WMAA 1Q7GA 4IDFA 1I10A 3PHLA 2ZCVA 2ZB8A 3JQFC 4BO2A 4YRDA 3C3XA 5B4TA 1YB5A 3LF1A 2AEJA 1LLUA 3EUWA 4M49A 5C7LO 3W8EA 2O50A 4UREA 2DQ4A 4DC1A 1HXHA 3WGGA 3UH1A 4J9VA 1WWKA 1T24A 4TSKA 2IYPA 4WOKA 1GDHA 3DBRB 3U4DA 1YXMA 1ZCJA 3O8QB 4RZHA 1KVTA 3SJ7A 2J3JA 3WGYA 3BMCB 4F6CA 5TNXA 1D1TA 4IIVA 2AMFA 4BNIA 4IZIA 2J5SA 4L74A 4M8SA 4QEDA 1OAAA 4IXTA 4CLOA 3LC2O 4RPJA 3ZGYA 2H1SA 2RH4A 4MVJI 5JDCC 5G4KB 3P85A 4GGPA 4ZRMA 2QRJA 1V35A 4OM8A 1EDZA 2BGMA 1LQUA 2WD7A 3OT6A 1CIVA 4ELWA 5C9GA 5JCJA 2Q99A 3U9LA 1Y7OA 2VQ3A 4BO3A 1QRRA 2C07A 4MVJA 2X8LA 5A04A 3PQFA 1HE3A 3DORA 1OI7A 1TT5B 2QYSA 4I8XA 4WJZA 3KTDA 4E13A 5DOZA 3UGKA 4AVYA 3EHEA 1WNTA 4PVDA 3FSRA 1GEGA 1YG8A 4GWGA 4RL6A 3QIVA 3GHHA 3DBHA 4UVIA 3EY4A 3H5AA 4RF4A 2X24A 1BXGA 4U6QA 4S3MA 5MGBA 3M2PA 5IG2A 1PJ4A 1HDOA 3FF6A 4NI5A 1RM3A 4N5MA 2EKQA 4GI2A 3IBBA 2PGJA 4EDFA 3IKTA 4NU5A 4JVTA 2D0IA 1W0CA 4DWVA 5ADHA 1EY3A 4OKIA 3GF7A 3H9EO 3AM5A 1ISIA 3F46A 1NHGA 3BA1A 2YFHA 3I52A 2HRZA 3RUHA 2DTEA 2OL4A 4ALIA 4O5OA 1YQXA 2J3KA 1DIRA 3QXIA 3MJSA 3ZCXA 3FN4A 3CZMA 1EVYA 4ALLA 1FXSA 4DMLA 2HRBA 1H9AA 5CG2A 2AA3A 2X58A 4FFPA 4NBTA 4R1NA 2YW9A 1SB9A 5KVSA 4HUJA 4NMHA 1MC5A 4BNYA 3UAGA 1DOHA 1LUAA 1LI4A 4CLRB 2OBNA 1PGPA 3QXZA 1NTOA 1O0SA 4BHTA 4L4SA 2CVOA 1XCBA 5DUCA 1C0IA 2EJWA 2FR0A 2I99A 3GVHA 3ZV3A 1DAOA 3TDKA 2JJYA 4QSMA 4FN8A 2OGUA 2IRWA 3GFGA 3EZLA 4RYFA 1ARZA 3IIEA 3B1KA 5THQA 2GERA 1ADCA 1NFQA 3SEFA 2JD1A 3IS3A 3VKUA 3L0DA 4DPMA 5T64A 3IJPA 3G1TA 3WS7A 1H6DA 4L4XA 1VSUA 4IZHA 4RPGA 3C1OA 4NG5A 4M86A 3ZV6A 1KIFA 3DBRA 2VSSA 2OZPA 1QV7A 3O8QA 2R2GA 4Q3CA 4FZWA 3LLSA 1T1RA 1GR0A 3SJUA 4JROA 1XNYA 4MI2A 2DBVO 3I1JA 2F00A 3L77A 1K0UA 1I8TA 4HWKA 2A94A 4QO7A 1U7TA 4CMGA 1LLCA 3UICA 2GUGA 5CPBA 3RJ5A 1GEEA 1ULUA 3JYPA 2DLDA 5G4KA 1EVZA 2HMWA 3OJ0A 1GZ3A 2FPGA 1JDJA 1ZNQO 3RAJA 4GX1A 4XR4A 1AGNA 4RJTA 2Q34A 4CL3A 1HDGO 4EMPA 3ZWCA 1LDYA 2Q46A 2D3TA 3R1IA 3GA0A 4JNKA 4AG3A 2DUWA 4JCRA 4B7UA 4OOFA 2IEDA 2DUUA 5JAZA 3OBBA 4DI1A 4R68A 1ZVMA 1TT5A 4FCCA 5IAAA 3M6NA 3DAGA 4IMRA 4OO3A 3R0OA 3HG7A 3NJDA 4BO7A 1I2CA 1XLTA 5GZ6A 3OMEA 1Z74A 2QX7A 3DR3A 1NM5A 4L0QA 2DVMA 3WXBA 2VCYA 3TT6A 1N92A 4YJGB 3IUPA 1T1SA 2NQTA 3MJTA 1ZMOA 2Y67A 4JX8A 2O3JA 1YB4A 1U1IA 3VHRA 4Y9DA 1UAGA 3FPCA 4LGVA 4OOEA 2P5UA 4P4GA 1E7MA 1SNYA 3TPCA 1NX6A 4DQXA 1KYQA 3FI9A 1B8VA 3P2OA 3STHA 2GZ1A 1X1EA 4GSLA 3FNGA 2Y0DA 1LRKA 4TRMA 2EWMA 4RV9A 3IQDB 2IYOA 2OOSA 2WEKA 4CL8A 5L4NA 1UZMA 1VJTA 1L7DA 4CUJA 4PZCA 2Q35A 1LXCA 5CEEA 4WEQA 2E4AA 3S2GA 1PJSA 2HU2A 3PP8A 1EK5A 2AQIA 4BGVA 2IDZA 1FK8A 3SLLA 3TFQA 3GAFA 4HFNA 4PG4A 4CODB 3DAFA 1T2AA 5C3MA 5CFZA 4CLRA 5JBIA 5U9CA 3VOSA 2ZL4A 4MDHA 4WECA 4HNKA 1MX3A 1YE3A 2DKNA 1T2FA 3DC2A 4O63O 4R5HA 3PJDA 4OQYA 4W9NA 3BPPA 2V65A 4TVOA 4RVHA 5JAQA 4ND2A 3JQ8B 1XELA 2O2SA 3PHGA 1XQ6A 2D1YA 5K6AC 3GUCA 1SO8A 4JJFA 3WFJA 4Q3DA 3WICA 3QK8A 3E6AA 1TB4A 4ZU2A 3E03A 2V6MA 1W8DA 3G64A 3RUFA 1E3WB 4BNJA 4EZBA 2UDPA 4U7WA 3D64A 1B7GO 3RFXA 3BTUA 3T89A 1DRVA 4EJ0A 4DLAA 4UEOA 4J7UA 4IM7A 3BTSA 1YOVB 5A5FA 3DBLB 1KERA 2HK8A 1L1FA 1DIGA 4Q39A 5KCZA 2GN4A 3QW2A 3UKOA 3M6MA 2GO1A 2E37A 4PLFA 2VN8A 1I32A 3K50A 1NQAO 1YO6A 1Z75A 3DZJA 5TF4A 5B12A 3EAGA 5BSGA 3MJCA 4UVHA 1H93A 2A4KA 2D5CA 4R54A 3UHAA 5JE8A 2VSUF 3LAOA 5KDRB 4BKQA 1X7DA 4IQ0A 3CXRA 3I83A 4TROA 1N9GB 2YUTA 1FC6A 3I3OA 1E1KA 1B3BA 3MZ0A 1F8FA 3LT2A 3OA2A 1ENYA 4GLOA 1M6WA 3AI2A 4YACA 4B3IA 4A26A 4CM9A 3QKAA 4MP6A 3FDUA 1IL0A 1AXEA 1JN0A 1SB8A 3GLQA 1YL5A 1FDUA 3ZNNA 2BGKA 3ZNQA 4J43A 1GZ6A 3PQDA 1V9LA 1P0CA 4HADA 1I36A 4MO2A 3VPXA 1U8XX 1PIXA 5T6BA 5CEJA 1NPTO 2NLOA 1PJQA 1JWBB 4LK5A 4DA9A 1TI7A 4YJGA 4BGEA 1PU2A 3ZNOA 1RJMA 1YBVA 1HYEA 2E49A 5I8ZA 4BNLA 1CDOA 1DSSG 4LK3A 1UYRA 3Q2KA 4FJ2A 3R9TA 2UYYA 1K6JA 1P74A 1CEQA 4XJSA 1SAYA 4ROSA 4F6LA 5TC4A 4D45A 4JQCA 1NAHA 3PHHA 3ON5A 3QVXA 1XNVA 2A9FA 4MPDA 3R3SA 4M1QA 4ZQBA 3HZZA 5KJ1A 2VNSA 1B26A 4PG7A 4BKRA 3QWFA 3W8FA 3IDSA 4PVCA 5COAA 4R1SA 4ZN6A 5JY1A 3PHIA 1YB1A 3DFUA 3TVWA 1VRWA 5ICSA 3MCVA 3HB4X 5IDXA 5IDQA 4UAGA 2B37A 2W98A 1KEVA 3HJAA 5DCYA 4DQVA 4ESOA 1EQ2A 2VX2A 1DC4A 1ORRA 3D3EA 5TJHA 2C5EA 1J7XA 5GY7A 1S7CA 1YDWA 3INGA 3RUDA 1EEHA 3JQ8A 1B15A 4KMSA 4FFLA 3UN1A 4TRRA 5FUSA 3NJ8A 4RLHA 2BH9A 4LSWA 4PZDA 3HADA 3ZU3A 4IXWA 3F5SA 4NBWA 3VZQA 3UF0A 1CERA 2Q2QA 1X1TA 4ZQEA 3A14A 3DMYA 3JYQA 5GMOA 5I7SA 2GPTA 2JCVA 4A5OA 4JGBA 1LEHA 4AFNA 4RPHA 1ZIDA 4K6CA 3RBXA 4BNVA 1YOVA 4JCQA 1LRJA 3DBLA 4N18A 3ZWNA 4K28A 2OORA 4OMUA 2TMDA 1I2BA 1M6HA 1YQGA 3OFSA 1WDKA 1R66A 4M54A 3VKVA 1BRMA 3O38A 3P7MA 1MFPA 2ZYAA 3AOGA 4A0SA 2PV7A 4J90A 5AXDA 4J4TA 5H81A 2YV1A 2GRAA 1U9JA 4GBJA 3F6YA 5KDRA 2EP5A 4NBUA 5DUFA 4PLTA 4BS9A 1I24A 3IAHA 3ZI0A 4ZVVA 1N9GA 1IHXA 1D8AA 4JSBA 1VL6A 5JMWA 3KLPX 3E9MA 2VSUC 4GLLA 4GM2A 3KYBA 1TXGA 1QYXA 3PWZA 3GAZA 4IS3A 3C7DB 3GNSA 3HDYA 2YHUA 5TLSA 5U1PA 2C0CA 2WJPA 4B7XA 2O2YA 2OXIA 4GMFA 5A4DA 3RBZA 4OXKA 3V2UA 4E6PA 3GG9A 2X0RA 4XR9A 1V6AA 5ILOA 5JDIA 3M2TA 4L9RA 3QJ5A 2X23A 1OOEA 3ZWMA 4UUOA 2FPPA 1PQPA 3KSZO 4R9RA 4BQRA 2QHXA 4NR0A 3HN7A 3WQSB 4QFDA 3OIFA 2EXXA 3FNEA 3RKUA 4J9UE 5INFA 5ITVA 2F9YA 4MKZA 1ZH8A 5IZCC 1RKXA 3F1KA 1RYEA 4BNUA 3DO5A 3RWBA 3OJOA 4XQEA 1DC6A 2CDAA 3T7EA 5E0SH 1Y5RA 3ORFA 2P68A 1SMKA 4G5HA 1R37A 4Y6SA 4CQMB 4YBZA 5EQDA 3ZWVA 1X0VA 4FS3A 3GR6A 4C7JA 1O5IA 3OETA 5AXBA 5BNFA 2DBRA 3KYDA 1WZIA 5H83A 1T2EA 3KTIA 4WPGA 2J5IB 1XYGA 2C54A 1WAMA 2HCTA 2FW2A 5IKLB 4BNTA 3TV5A 4UEKA 4ND4A 2EW8A 1U8FO 4XDYA 3LSYA 1A71A 3H9QA 1Y9EA 4E5NA 1W2XA 3TL3A 2VUTA 5JFOA 1HWYA 4ZDBA 4TRJA 3WFIA 1ZFNA 4WLUA 4QUKA 1R12A 5L7WA 1PQWA 3R6DA 2BRUA 3WGHA 1WXDA 2PH3A 3PLNA 4NU6A 4CV1A 5T5QA 3NV9A 4D0RA 4OQZA 5DT9A 4KP7A 3DWFA 3JQ6A 4DPLA 2HDHA 5T8KA 2BGLA 3Q0EA 5FFFA 3EK2A 3TL2A 3KSDO 4BOYA 4BB5A 2GCGA 3LF2A 1WDLA 2QZZA 4DLLA 1NYTA 4CM8B 3ZU5A 2VRCD 3KHUA 3R0IA 3ZN2A 3ADPA 5I9NA 5KVVA 3TLFA 1J4AA 1W6UA 2HMUA 1RM0A 4YT5A 4QXMA 4G2RA 5A3JA 1A4IA 4J4BA 4YQZA 3VVCA 3QVTA 2SCUA 1UXKA 5ENDA 1AHIA 3ANNA 3PEFA 3NT5A 1P9LA 3K73O 1PZEA 4YJFB 5EQFA 4DL9A 4F3YA 1XDWA 2HAEA 3AUAA 5A9RA 5JXWA 4XA8A 1B8UA 4PGFA 1KEWA 3ETEA 3ETDA 3FTPA 4HNHA 4D42A 1ONOA 1LSJA 3CKYA 3L6DA 4OYRA 4LMRA 1DCIA 3L6EA 5T57A 1DUBA 4Z0TA 4WCFB 4I9NA 3OSUA 3LT1A 1H9BA 3WB9A 1KC1A 2V7PA 4YEDA 2A7KA 3TFOA 2WMDA 4BNMA 2E48A 4E0BA 2FBMA 1JTVA 1MXFA 1H6CA 2JHFA 2QRKA 3LVFO 3JQ9C 4D44A 4RLSA 2X5OA 1QLHA 2VT3A 2A92A 3TZHA 5CDGA 3U09A 4Y8VA 2GASA 2GDZA 1J6UA 3EZYA 4R4JA 4F47A 4WK6A 2J5II 1E92A 3CPSA 4YR9A 3CMCO 5JAIA 3QREA 2OP0A 4CQMA 3TRRA 3HNPA 1HEUA 4IINA 4Q0GA 3GG2A 3X2FA 1DXYA 1UXJA 1VSVA 4FJ0A 3SC4A 4BO6A 4CLOB 4B4UA 4XYEA 2HMSA 2HUNA 2AG5A 3WOHA 1I33A 5JBWA 2DPGA 3FBTA 2J5IA 2VT2A 1QYCA 5EESA 1JW9B 1EVIA 5F1PA 4ZDFA 4AL4A 3CINA 4K2NA 1I5RA 2CUKA 2AHRA 2ZB7A 4IUYA 3G1UA 2B4QA 5JAMA 3STAA 1UZNA 2RHRA 4E32A 1KY4A 1E3JA 1M67A 4II3A 4K9DA 1HE5A 1ZKMA 2B4TO 3ZDFA 4A27A 1UXIA 3QWBA 3KSUA 3AWDA 5EN4A 2CFCA 3CZRA 5JC8A 5L3ZA 3DJAA 3PHJA 2FSVA 2ZK7A 4UUPA 4BKOA 4XDZA 5L7TA 1PZGA 5BSEA 2GTRA 4ASIA 2I3GA 3FCOA 4MVJD 2P9EA 1PGOA 4Z9YA 2DTXA 4YJDA 5DBFA 2F6IA 4OHUA 2XPCA 5I7FA 2J5QA 4CM8A 4FB5A 1A7KA 2IXBA 3JV7A 1LBEA 2GN6A 2O3TA 3JTMA 1SPXA 3GQVA 5CDYA 1GYQA 4YT4A 1Z7EA 2AQ8A 2DFDA 2VHWA 1GUZA 5TRTA 1H2BA 3P2YA 3CMMA 4HP8A 3INTA 5CAEA 3KEOA 3GDGA 1C0PA 1NVGA 4ZD6A 4UEJA 4YJFA 2DBQA 2Y1GA 4AICA 2XXBA 5B1YA 2B4RO 3T8BA 3MWEB 1PEDA 4LISA 1HYGA 2X7HA 3V5NA 2O23A 1GQQA 5EPOA 3DMTA 1AN9A 2DBZA 1F06A 3MTJA 2C2XA 4WCFA 5BSHA 1NFRA 3JYNA 1KVSA 1M2WA 3UUWA 3WG9A 4XCVA 3MYBA 2NV6A 2QIOA 1LX6A 4I9UA 1GQ2A 4B8ZA 4WZ8B 1UYSA 3ZWAA 4E12A 1UZLA 1KC3A 2NVBA 3ONEA 4QECA 5J23A 4CMEA 8ADHA 2JCYA 4HXYA 1E6WA 3W4IA 3JD1A 4I08A 1GCOA 1ISFA 2CVZA 2Y99A 3ZHXA 4GQAA 1OC4A 2Y05A 3W6ZA 4IDDA 3WYEA 2A81A 3HFGA 3KB6A 3OMLA 4E5YA 1E3EA 1UAYA 1DC5A 1LQTA 3VDQA 1CQIA 2I6TA 2YFQA 1XNWA 4RQUA 1IPEA 2RIRA 3FTNA 1NP3A 3WGIA 5G0TA 1ZK1A 5G0VA 3PE8A 3NDRA 2O7SA 2PGLA 2QG4A 2PGDA 3R3JA 4FGWA 1A27A 2YQ4A 4W4TA 5DP1A 1UP4A 2NVUB 3VDRA 2YJZA 2X9GA 3VH4A 2VZ0A 2ZQZA 1Y7TA 2VYVA 3EVNA 4Z3KA 2G5CA 2V6BA 3E8XA 4FR5A 1GL3A 4R5MA 3WTCA 1RJWA 1WDMA 4BO1A 3M6IA 4IGFA 3QYRA 2ZB3A 4PIVA 4WCDA 2FN7A 5JDIC 4H7PA 2VOEA 1TVEA 2X5JO 2OHXA 4GX0A 4ND3A 3DXFA 5B4UA 2A35A 1J0XO 1KOLA 4QIIA 1Z82A 5COBA 1GUFA 2O4UX 2Z1NA 4O6VA 3N74A 3KBOA 3E82A 1LLDA 3OHSX 4G65A 2IE0A 1R4MB 1T25A 1OD2A 1D4FA 4FDAA 1VI2A 2V6GA 4E5KA 1DLJA 4PLZA 3KV3O 4YAIA 2VHYA 4XRGA 3T7CA 1GYPA 1X15A 3K8ZA 4RZIA 3RD5A 5TQVA 3AI1A 4DTIA 2CNBA 2PKQP 1SCUA 4IDEA 2DC1A 3FR7A 1NPDA 2EGHA 3ABIA 3H5NA 3O03A 4P4NA 4EI2A 2W3PA 4I9HA 1JAYA 5A5EA 5IDWA 3IAVA 1JLLA 3U4CA 1GU7A 5EIOA 3SLKA 2W8ZA 1ZSVA 1OZAA 3QA9A 2VYNA 4OIMA 1MC4A 3AY6A 2JD2A 5JMPA 1C0KA 1OBFO 5BT9A 1IB6A 3WG5A 1H5QA 4AJ4A 1QP8A 1Q0HA 3W8DA 3RC2A 1ISHA 1KVQA 3D3WB 3NRCA 3RRVA 3PDUA 1YS4A 4O59O 3JQ7B 5FWNA 4M87A 3OJFA 5K0ZA 1NR7A 4FW8A 1UDCA 2C29D 4U1AA 1A7AA 3PJGA 2Y0CA 2BI7A 1I3NA 2X9VA 4FGSA 1S6YA 3FR8A 4IQGA 1PL7A 5K9ZA 5KJPA 1BTOA 3KRTA 5TIIA 4LN1A 1N5DA 3HN2A 3A4VA 4JFCA 4EITA 5JC1A 3S2IA 2X6TA 3G0OA 3ITDA 3LC7O 3KUXA 3Q2IA 1DFIA 4BQPA 3Q0JA 3I4FA 2FZWA 1U3VA 4RVSA 3TZ6A 3ZWXA 4JJGA 4EUFA 3H0QA 4YAEA 3ZW8A 3OQ6A 1ZK0A 2JL1A 2UUOA 5KOIA 1RJNA 4ELSA 1QKIA 1MXHA 3NKLA 3PDJA 4FC6A 4OGWA 1YWGO 2BMAA 2ZQQA 1GPJA 1VL0A 2QW8A 2HJSA 3D7LA 3LDHA 3ZWPA 3R6HA 1ENZA 2NWQA 3Q6IA 4WLFA 3ENKA 1GV0A 1MA0A 5I7VA 3U5TA 4K3WA 1Y81A 2IZ1A 4KDEA 4U5QA 1LSUA 4JBHA 2NVUA 3S1LA 4U0HA 4TZTA 1HSOA 3EW7A 4E2XA 1EF8A 4KWHA 5DULA 2VSUE 3PJFA 4YLHA 2VREA 3U9SB 4LCJA 1PZFA 4JJTA 4R3WA 3GDOA 1X14A 5L53A 2EHDA 5G4LA 3KVOA 2X1HA 3A06A 3I4CA 3MOGA 1YL7A 5G2OA 3PWKA 2GN8A 4YRBA 1K6XA 1Q2XA 1D3AA 2IZZA 2O3RA 3MJ4A 4IGEA 4Q3NA 2VSSE 4MXIA 1Q1NA 4R41A 4YAJA 5FYDA 5JY6A 2PTGA 5I7EA 3WMXA 3LK7A 1E1MA 1EK6A 1R4MA 2NTJA 2D5AA 3GNTA 4Q3AA 2G17A 5G0WA 4FJ1A 5A06A 4IZBA 1YONA 4FFMA 1F12A 3WSVA 2JFGA 3MJEA 4O0LA 2O7QA 3OF2A 5DZKH 1NPYA 1HT0A 2Y68A 1XU7A 4G2NA 4UUNA 1ZEMA 4EW6A 3RU9A 4JJIA 5F1OA 1UIYA 1K89A 2I3AA 2YZ7A 3DONA 3QP9A 4ALNA 3WYCA 4CM9D 4NK5A 2I66A 1LC3A 5EINA 4B79A 5CDTA 1LTHR 3QWIA 4YAGA 3C7CB 1QV6A 1HETA 1B0AA 3RCBA 3GPIA 4RDHA 4DMMA 1Y1PA 2X0IA 1YJQA 1K6IA 1B2LA 4JK3A 1XO6A 3RSTA 2Y1DA 3KTHA 1ON9A 3D3WA 3OIDA 3VPHA 3WNVA 3JQ7A 3RC7A 3ZHZA 5IN5A 5E0SA 1ISJA 3IP3A 1QYWA 1EMDA 4BIIA 3IUSA 1UP6A 1U4OA 1GYRA 4WE3A 4HNGA 4XYMA 2QQ5A 2WTBA 4GKVA 5JO9A 1GCUA 1E5LA 3ZHBA 3RKRA 2ZJ0A 4KTTE 5AOVA 5IXYA 4KWBA 3QSGA 3NUGA 1DJNA 3ZZNA 1E7YA 1P77A 4Q3BA 4YYZA 4I52A 2G82A 1PL6A 3PI7A 1VL8A 3KQFA 4L76A 3HUDA 1ISGA 4CMIB 4ELXA 1IE3A 5HM8A 4KQXA 4CLEA 2ZQYA 1T2CA 3TWOA 1GPDG 1JVBA 4FBGA 1HE4A 2EP7A 1XQ1A 1UXGA 4ZU3A 1NZYA 3W4JA 3RC1A 3K2BA 3ADOA 1ONNA 2NU6A 5KNLA 3TJRA 4QFEA 3OM9A 2W2KB 1DIAA 3AY3A 1BDMA 3W4KA 3H3FA 2B36A 1YG6A 1ZJYA 2WE7A 3ENNA 5HS4A 4W6ZA 4P22A 3E18A 2HO5A 2VTEA 5DP2A 4AJJA 2H63A 5C90A 3L9XA 3PGQA 5F1KA 1DFGA 1PX0A 3AJRA 3E9QA 3ZU4A 4EJ6A 1PR9A 3W1VA 4I5FA 2C7VA 3AOEC 2Y0EA 3RFVA 1PS9A 1U5CA 1XX4A 1VKOA 3SC6A 4JYLA 2VZ9A 4QT0A 1BXKA 5ICMA 1A9YA 1ON3A 1Q7BA 1C3VA 3D5TA 2BFPA 2X5KO 3CSDA 3H5RA 4LRTB 5A3VA 2NP9A 3H9JA 4AJOA 4FFOA 4BNHA 2PLAA 2EJVA 3DOJA 2W2LA 1DHRA 4MVJP 4R3NA 2DT5A 1UP7A 4E2YA 1BXZA 1Q52A 3OH8A 2VSSF 5AXCA 3HE2A 2AE2A 1ZZEA 3OA0A 3TDCA 1R16A 1P44A 2B69A 5JCXA 4XB1A 2DEOA 4K29A 1AHHA 2X86A 4J1SA 2R00A 1H2HA 4RPLA 3ST7A 3GGOA 4AJKA 2ZJ1A 2VWQA 3KZVA 4GVXA 4E31A 5AVOA 4RVGA 3UFXA 3D4PA 1PTJA 4MP8A 1HSZA 4NQZA 4PN3A 5G0SA 3HDJA 4PG6A 9LDBA 4I5DA 3PVZA 3MOIA 1HZJA 3BMNB 3VAZA 2PKQO 3Q11A 4HKTA 4OSOA 2HK7A 4Z3DA 1DDOA 3GMAA 1PJ3A 2F9YB 4IZCA 1HYHA 1VLLA 4KUEA 4YQYA 3MT6A 4W7HA 1BVUA 1TEHA 1LDNA 3KM0A 3RASA 4CLHA 3GEDA 3Q1TA 2BELA 1MLDA 3L4BA 1O8CA 4HFRA 5GZ1A 3I9OA 4DPKA 5JBXA 4Z0HO 1ONPA 2ZYDA 3Q9UA 4RF5A 5B37A 3TVUA 3U9TB 2GNAA 3C7AA 3LLVA 3KTJA 3KYDB 1VPDA 5L4LA 5IDYA 1Q51A 1HDYA 4ZQFA 2PD4A 4WOJA 3RROA 5BQFA 3HE3A 4QQRA 2ZTLA 4KWIA 1FDTA 4W7IA 2BKAA 1EUCA 2AW5A 4NBRA 4JCSA 1RM5A 4NFYA 4S1VA 2X0JA 4CR6A 1PJHA 3JQAB 4CMIA 4YRAA 5H82A 2GN9A 4DIBA 1QR6A 5JNLA 3EDMA 2F9IA 3PEAA 3K92A 2FZEA 1E3SA 4RO0A 1Y9AA 3JU1A 1LSSA 3ANLA 2W90A 3WIEA 3QMJA 1Z7BA 1FC7A 1ZJZA 2FZSA 4JYJA 1PL8A 4XEHA 2Y93A 3GT0A 2H9IA 1MB4A 2AE1A 2V6FA 4DBVO 3WMWA 4XIJA 1HZZA 4KOAA 2W2KA 3H9GA 3NTOA 4BGUA 4I42A 3F47A 1KEUA 1T4BA 2VNAA 2WD8A 5I8WA 2VWPA 1XU9A 1F17A 4ND5A 3B1FA 2EEZA 1I01A 2WYWA 3MOYA 1EFLA 1E0DA 3WYBA 1TT7A 2QQ3A 1N8KA 4PLWA 3B1JA 4R01A 2AQKA 3JQFA 4ALKA 3BYZA 3WQQA 1MGOA 1NWHA 1Z73A 4B7CA 3ZU2A 2F6QA 3QWAA 1UDAA 3MFMA 9LDTA 5A9TA 5B4VA 2X0NA 3GMDA 5CPFA 5DU4A 3WJ7A 3N6RB 4ITUA 3PPIA 5IJZA 4Y6RA 3VH2A 3RUIA 2PPYA 4FZWC 4WNIA 1M75A 1QSGA 2B5VA 4MOWA 1PWXA 4HFMA 4WLVA 4ZDCA 1YJ8A 3AW9A 2JAHA 5EERA 4PG5A 3TNLA 3RUEA 3UXYA 1HLDA 2JAPA 4Y67A 3BMNA 3TZ3A 5JS6A 3GLMA 5JDCA 5GZ3A 3LKEA 2I67A 2FRDA 1ZXBA 1NR1A 3OQ1A 1EFKA 4YAKA 3PIDA 5FI5A 3B70A 2P4HX 2QYTA 3SBOA 2YV2A 3AM4A 1VE9A 3RIHA 3ZV5A 2PR2A 3U49A 3JQGB 2OO5A 4F45A 5DF1A 4IY1A 4E2WA 3MEQA 3DQPA 1NBOA 4H16A 3S2EA 1XKQA 2ZYGA 2GGSA 1YVEI 5DZSA 5F5LA 2VZ8A 3PZRA 3C24A 1JAXA 4DYDA 2IXAA 3D5QA 2EV9A 4Q1IA 2ZATA 1N7GA 3I9MA 3PQEA 3GF3A 1LDGA 4IMPA 3JQAA 3OC7A 4NPCA 4CJXA 4OL9A 4CQMD 5DCUA
chains in the Genus database with same CATH superfamily
4GFDA 3OBIA 1LVGA 1BMQA 3QE4A 2FSSA 1SBHA 3N5CA 5AJUA 3U7EB 4Z86A 3GOHA 2W00A 4M98A 5TMDA 3V1UA 5CTBA 4PR3A 2JIBA 4DCUA 1FFXA 4PNPA 5AKIA 4B9AA 3G0HA 3NVDA 2GZAA 1EDOA 4FE4A 1ZJ5A 3DFKA 5HS6A 1APBA 4KGDA 1KQ3A 2FRXA 3DLPX 1DKQA 4KXVA 3FVVA 2AZTA 5KS2A 5DNDA 3T9BA 1QK5A 2XCUA 4J1QA 2JBAA 3GCGA 4GX5A 4JUDX 4LRXA 4ZPJA 5EXSA 5K3AA 3AFOA 3KTOA 2P0AA 2MWMA 1FA9A 2WTEA 3PTZA 1DEOA 4F5EA 2MMGA 3PQ6A 3V4OA 4KSYA 4LSMA 4DLNA 1KKMA 4LVCA 3MWJA 4ZCQA 2FHSA 4K26A 3S0JA 1R8JA 3R7LA 3KLMX 3IOEA 4QOIA 1KJQA 2OLKA 1CRWG 2YMMA 1SRQA 2A0XA 2P9GA 3W2HA 2H48A 2NOGA 5KSYA 5FEUA 4V0NA 3W79A 5AR1A 4BBZA 4G24A 4BLRA 4LHEA 4MW1A 1ZGBA 2FX5A 1XHFA 4AZ0A 5CA0F 3ZWWA 4GMGA 3GHYA 1N0HA 3G0BA 5FO1A 3K71B 5GJWC 3Q40A 2Q1TA 4WOCA 4TWJA 1NBHA 3OWHA 1WW8A 4JUBA 4ZQCB 1Z5VA 2OGWA 4CG1A 5LFAA 4RWEA 1A8UA 2FKAA 3N8NA 4E07A 1XRJA 3N6RA 2PKCA 4D6XA 1M6VB 3B6ZA 2ATIA 4RFSB 2PX8A 2Q0SA 4EB3A 2FTKE 4GLFA 2ZB2A 1Z4LA 3ANSA 2NO5A 3R3VA 1UQTA 2DZDA 2VHZA 4N9QA 1NXQA 1BO6A 1D07A 1JA9A 4PLPA 2CZCA 1VJDA 1CETA 1GKKA 2H1RA 5J43A 1EE1A 2OCPA 1H2YA 1TM3E 4QNNA 1FU8A 4GDMA 4XIFA 3W05A 1LU9A 3TN7A 4N39A 4CKBA 2Z58A 2B34A 4HN9A 4ZZ2A 1OVGA 1QS0A 4L5JA 1DQSA 1XC7A 4M1ZA 4OCZA 3L9WA 4Y1RB 4FQ7A 4HO1X 3H11B 5KOJB 4AJLA 3MAJA 3WWOA 3GJYA 4BQOA 4P31A 4YHBA 5F12A 3WK7A 1YACA 1EVKA 5ALFA 1OXSC 4JOTA 1X74A 4GKBA 2DF8A 1IUKA 1U81A 5KB3A 5DU8A 1SUCA 2F1IA 3N9IA 2GZDA 2IW3A 3JVVA 1BGVA 5JS8A 2RCYA 4R9SA 2EJ5A 1T3ZA 4Q4AB 4YJHB 2B25A 3TVDA 4ZYUA 1UBUS 2HMTA 4WXEA 4AMBA 1WMFA 3FA2A 3HP0A 1K97A 5EJ4A 4XYBA 5F3RA 3T9EA 4UAUA 2H4WA 5K0FA 3AFHA 2C4WA 2IHKA 2Y6UA 2CNWA 8ATCA 2DFTA 2DUMA 3LDFA 4H2DA 5D3MB 1D6MA 3WA6A 3BJMA 3F49S 2QWXA 2WJGA 3DMGA 3GRVA 4CM5A 2QQFA 1GNVA 5CB8A 2JDID 3VI4B 3MHTA 1N1EA 2BHSA 2PRZA 4PFSA 4QA9A 1RZRA 1KVRA 3AF5A 1RP7A 1V3TA 1V48A 3RC9A 3T7TA 5EKTA 2FP4A 5A6VA 4ENVA 3WY9A 2HWUA 1A9XA 1A9TA 1AY0A 1CVIA 2X42A 2OB2A 2X9LA 2C58A 4M8IA 3ZCPA 2CJYA 4OTZA 1PFGA 4V0RA 3SYNA 1C9KA 1KMQA 3EZGA 1P9NA 1CBUA 2ZYIA 5TT1A 3P5MA 3KQVA 3KSMA 2IEBA 3ONWA 1RXSA 4GPBA 4E70A 1G19A 1A82A 2Q45A 3IP9A 4UHFA 5CNKA 1GPH1 5C4GB 1DKLA 3WK4A 4B3JA 1A0OA 3B7WA 4WESB 5F7JA 4XPIB 3W7VA 3UMCA 4ILKA 4KQGA 4MYDA 1TVKB 1G55A 2B1JA 4YJ3F 3R5TA 3BWEA 4ZU1X 1GQYA 1KBZA 3H4VA 1UC4B 5KI6A 2XSZD 4LHYA 3UT0A 4AM8A 1B2RA 1P4SA 1MB9A 3UWOA 4KPGA 1VLVA 5FNVB 5G3YA 1XTRA 2BYTA 3I47A 2GEKA 2E5WA 3I1FA 2PWPA 3FPLA 1OI2A 3GFSA 1N2SA 1JHZA 2EF1A 1L7VC 1DAKA 2WZQA 3ZCRA 2SKDA 1E3QA 2J07A 1L1RA 1CF9A 2YHIA 3VRHA 2JFVA 4IOKA 4FNGA 4OATA 4B46A 1OI3A 2BJVA 2CMDA 3L0OA 4YUYA 1QKKA 2XEDA 5FP0A 4DUGA 5K6AA 4CF3A 1VLJA 4C7VA 2XQFA 4QTYA 2ZJFA 5KHAA 2GVDC 1KR2A 1P72A 2QM7A 4IV0A 4I5EA 4TTTS 1YL6A 2YHAA 4RPKA 2CL7X 1QF7A 3ZY3A 5DL1A 4IDAA 4LI3X 1FCJA 1W76A 1FXWA 2IHYA 3COSA 1V0JA 3K0CA 4ECEA 1ESNA 5KINB 3PK0A 3EDRA 2C31A 4OBWA 3PXBA 2AG1A 1KAHA 2NACA 3B7PA 2G1UA 3Q7PA 5AVZA 2VYND 3TVYA 4DARA 5H8WA 7MHTA 1E3IA 1OMOA 4IJKA 4NMXB 3SX2A 1AKYA 5HJEA 3HKBB 4XB6B 1WY7A 4CQNA 3TUIC 1VCIA 1W1UA 2GZHA 2IC5A 4O25A 4D3YA 4F1KA 1C8LA 1XZPA 3K1AA 4ZZ0A 4EMLA 2AFHE 4H6VA 2Q8NA 1IEVA 3OKAA 4O4JA 1RXWA 1YV9A 1FJ2A 2MSEB 3FLBA 4IW3B 3HJHA 3RAPR 1TE2A 2FFJA 3A8TA 4AZ3A 4BVAA 4NBVA 4ZAVA 5A6SA 3QX9A 4UBKA 1GAEO 3FD8A 3EZ6A 4XIGS 2X6RA 2BLLA 1ZONA 5CDFA 1GNRA 3K9BA 4KGXA 1TQ8A 2HXGA 4G09A 2NADA 2XDQA 1YS7A 4HWRA 4RHUA 4EYSA 3QLUC 4O2BA 5EIBC 1I14A 3WBBA 2PRJA 2JFPA 3IJEB 4JDUA 4FX5A 5EWMB 1K32A 3P9ZA 5MN6A 4RDXA 3ILSA 4Q03A 2DPMA 3ORQA 4KYTA 4KR7A 3BXPA 1PFUA 1VC2A 3GF4A 1IG3A 5C8YA 1KI3A 1GGEA 1XIVA 4DDWA 1VJ5A 5AW2A 3EEOA 3LPLA 1SJ9A 4JLUA 3KFXA 3H1EA 4H31A 2OO3A 3DOCA 4J2TA 4LQLA 4Q3LA 1EBFA 1GKLA 4D82A 4EEKA 4RC9A 3ROKA 3CH6A 1VOTA 5KNCA 1J49A 1GZ7A 4NJMB 3BEDA 2ZIXB 3K0HA 4L27A 5I9MA 4OK3A 2EWVA 3RC3A 2NM0A 3A3YA 2FOLA 3N2LA 5H5JA 4GHNA 4X65B 2V9CA 1RVV1 4YV2A 1NFFA 3NOOA 3HXQA 1ZUWA 2XA9A 2XTMA 3UTCA 5ILGA 4LC9A 3JQQA 1WV1A 3GLRA 3P8ZA 1YQQA 2FR1A 3SZRA 2NU8A 4AJHA 2EIHA 2Z5LA 3KG2A 1ZC4A 4BWGA 4ED9A 4ZCTA 2R6HA 3NNSA 3QLEA 3ZHQA 2OBYA 3M5DA 4E30A 4RJ2A 4JUIA 1RHUA 2PMFA 3N28A 4BV9A 4EJMA 4F3CA 1GT6A 2WA2A 1M8JA 1X38A 1V3QE 3KOMA 3PCTA 3PUVA 2AN1A 4PAWA 1BQEA 3FWNA 2GBIA 2V0CA 3VPGA 4KFRA 1ST3A 4G3XA 1NVDA 4FJWD 1BHSA 1L7OA 1J56A 1G5RA 2B78A 2E0IA 4FD3A 4MVJE 1KE1A 2Q2XA 5LP6F 2CLFB 3H02A 2HREA 2XOXA 1H8HD 4KAFA 4EG7A 2IYYA 3IDZA 2XCOA 4ENTA 2ZBVA 2ZE8A 3KEGA 4KRGA 4EJSB 2Z6QA 4DZZA 4RK1A 3SLGA 9MHTA 1L4GA 1UMDB 1NVTA 1XVLA 4BC1A 1NX9A 4EHJA 1PNRA 4F5DA 1OLSA 5JS1A 4NOKA 2EFEB 3ZBUA 3LHIA 3WLOA 2DWOA 3IMKA 5EUMA 4DTCA 1E6EA 1A1SA 2D1SA 5TIIA 5EIXA 3ET4A 4I1SA 3WLAA 4IRUB 2C5AA 4RAOA 2AR7A 1ODIA 3ZIDA 3FPKA 1Z7YA 5HFNA 3PC7A 5IAJA 5JPCA 4RZ2A 3WYNA 1LTKA 1H22A 2P0EA 4IDBA 4ISBA 5HBRA 1FUIA 5TQ2B 4G41A 4ZCMA 5B1HA 4FDVA 1ZCBA 1WRBA 4KO2S 5D6NA 4UHKA 1N7HA 4Z0MA 1DWQA 1P4GA 1MG0A 3DOFA 3MCUA 3SVZA 3O26A 1Z2PX 3JVEA 3OUZA 3RUCA 1EX1A 3NRJA 2ZBGA 2BGIA 4FPXA 4QOFA 1YH3A 4NJOA 1M9NA 1Z8FA 1LPBB 4U63A 1Q16A 2C3UA 1SOAA 2MINA 3IBBA 5FPPA 5TQJA 2YDXA 1UBGA 1YA6A 2Q4EA 2FXIA 1YK1A 3RRJA 4WD3A 4HLQB 2UZ1B 1V5GA 5BSFA 1KK1A 2R8RA 2V7TA 1L5SA 1U7UA 3COWA 1U7WA 3E1KA 3IUJA 4RH0A 4YA6A 1O6FA 5AKLA 1U8YA 4EWLA 1MEOA 4CDNA 4DG5A 4GQBA 4WZBA 5JSQA 5JJKA 2ONCA 2X4IA 3PEUA 1IVSA 2PRIA 4XFKA 3EOBI 3OTWA 4UTRA 1ZBQA 4DB4A 4LBVA 1NHWA 3EDQA 1ID1A 4AJEA 3GV0A 2R85A 4BMVA 4JYCA 3SDBA 2EG5A 4IXNA 1BE8A 3PGVA 3G68A 4FQ8A 4YRIA 2GF9A 4LBZA 5BUSA 3TQCA 3O1HB 4C6TB 1SUEA 4PYJA 2W4MA 5AM5A 4R8RA 2A6PA 2D7DA 2PUHA 3BMCA 1W46A 3FJYA 5AMXA 3EGWA 1AKQA 3HZOA 4EAAA 4QHSA 1YVPA 3M83A 3MJFA 1PE0A 4JQSA 4D6PA 1DJMA 2H7YA 2EZ4A 3DF7A 1JG4A 3K5IA 4JB2A 3R0JA 2C8KA 3C98A 4F21A 4U0KA 3ULKA 2YJ3A 3IHTA 3EVTA 4TV8A 4CEJA 4R1TA 4A73A 2OQ2A 1X2BA 2ZI6A 3L6UA 4CM4A 3KPVA 1MJNA 4JJKA 4BL5A 5IZCA 3ZJTA 3ZQ6A 1DXOA 2C4MA 2IH2A 1NF9A 3G6KA 2HQOA 3AYXB 4FEEA 4E5VA 3N05A 3K3PA 1SXJB 5CT4A 1J7JA 2G0NA 4HX9A 1P1RA 4WKGA 1HDXA 2XT6A 5HUJA 4DV4B 3GJRA 3ZE7A 4N12A 1AQJA 1Q5PA 2H0QA 5EWJA 2ZGVA 4UDNA 1DC3A 2CC2A 4KZPA 3B5JA 3D1VA 4MDFA 1U1CA 1V8BA 1D4ZA 3AZOA 3OY7A 4KX5A 2OAGA 4YROA 1PNQA 3K8OE 4OI1A 4HV4A 4RTMA 3AEQB 1BDHA 2QVGA 1JHVA 5KWIA 4KPEC 5GIPE 1WQ3A 4F9EA 1U3CA 3M3PA 4EYEA 1M34E 3K09A 4FZVA 3W1WA 4BNGA 3IBFA 4CV3A 1QVAA 2Z9DA 1EFDN 5BPFA 1YKFA 2XDAA 5ETJA 5EXDA 4WQMA 3PNYA 2CXOA 2NO1A 5EMKA 5DU6A 1F8YA 2JRLA 5JJ5A 3K6SA 4D5EA 5JSKA 3W9UA 5E0NX 1ZAKA 4KIUA 1CY8A 4EKGA 3WR5A 2PR7A 1JLSA 4LY3A 3RVOA 1W36D 2AJTA 1RFGE 1MB0A 1VG9B 1EU1A 1LJ8A 4ND1A 2QRMA 2FPWA 3DZIA 3WX0A 3RT9A 4MKHA 3KXKA 1RXYA 2BFWA 4E21A 2UAGA 4LWOA 4V0ME 2FSVC 2PFKA 3ZHVA 1Y6JA 4L15A 5G1PA 3ZJVA 1TMOA 2XNDA 3L1VA 2D8AA 3FGOA 3I09A 1YZ3A 2QMUA 2W4QA 1GRNA 5J63A 5DYGA 5IHPA 2F9IB 1XZHA 1EVJA 4MV3A 1QHIA 3DA8A 3A6HA 3AIKA 2C20A 1SZDA 3DF9A 1Y8RB 2JJ1D 4U6SA 1Y6ZA 4FYWA 4GMDA 1WKVA 3AM3A 3V5IA 3L49A 1XZBA 2A5YB 2AD5A 3I23A 1HF3A 4GBMA 4D8VA 1OZGA 4B35A 5JVDB 2AFRA 5DNAA 4GXQA 3W78A 4ZVMA 1ODSA 5C7OO 5HZMA 3TLEA 2Z95A 3N2KA 2QVBA 4DVJA 3P0EA 2WT9A 4NXNB 1DX4A 2LGJA 3JU3A 5JSFA 3UT5B 3R9QA 5ULLA 3OZTA 3VOBA 2QBYA 1VIYA 2OUIA 4IZDA 1TDJA 2W6PA 3EGVA 4GXNA 5FOTA 3VYUB 4DLTA 4XLTA 1YUMA 5AQEA 1RT9A 1W1WA 3ZQ4A 4I2NA 3OJXA 4EJFA 2QG9A 1L5NA 1PKEA 2EZ9A 1Z5WA 5I7WA 2PMWB 4FZ5A 4YP9A 2RJNA 4PLGA 4PGMA 2FPXA 3D43A 4E5UA 1ZINA 1FRNA 1UR5A 4FDTA 2O7NA 4PQEA 5BWOA 2ZKIA 1WA5A 2PX4A 1N5OX 1V16A 2O1EA 2Q49A 5FKJA 2IS2A 3I58A 1N6EA 1O4VA 2CE3A 1RJGA 1UKYA 3ELUA 3JYOA 4W99A 1K63A 2TMGA 1GAWA 3LGXA 1RQGA 4REMA 3PF9A 5DSXA 4DDHA 1O95A 4AJPA 1SKUA 3BJEA 3I32A 2CBYA 2YIJA 3EZ9A 4D3DA 2IYXA 1HDEA 1UJNA 2I7XA 1RWMA 2QLLA 2E85A 3DAHA 4OD0A 4XGKA 3UUGA 2O59A 4P93A 3QJGA 3FUXA 2J0SA 2GNOA 3Q3GE 4I1IA 2E4ZA 1N6HA 1EK0A 1DAMA 1JEAA 1RHRA 1ZGZA 4HTFB 4FE3A 4KBGA 5ITWA 1UINA 2EJBA 4J4HA 1DBPA 1N5KA 3AI7A 3OFJA 4JVMA 2HRRA 2VWHA 4HS4A 1JI3A 1E8DA 2QGNA 5GV7A 2C2YA 2XI4A 1J0DA 1B8PA 3IQXA 1AGXA 2WB4A 3LUCA 3Q9SA 5K99A 5GM1A 3OFNA 4EYKA 3HEBA 3JWHA 4JVOA 2H2FA 4BX2A 1G38A 3HRHA 5IM5A 2ZTMA 2WMYA 3ITKA 3UAZA 1QO9A 3V1KA 2IYTA 1XQXA 4HGYA 2FWMX 1OREA 3CRQA 3E7XA 4NNJA 1I3OA 5LB2A 4LVNA 1RKQA 2RBGA 4UU8A 1MW8X 1ZAYA 5LQSA 2X77A 1UDBA 5F23A 3FLAA 5C37A 1DZIA 2F3SA 3EVAA 5LOVA 3D7SA 1S3SA 3Q7HA 2CKMA 3RO7A 3GXOA 1SBCA 1FUKA 2IGBA 3IUYA 3O8OA 1B3RA 2PU5A 3QVGB 1Z18A 3E48A 3V1TC 1GV1A 2Y0BA 2Q1UA 3K6KA 1KR5A 4Z9XA 2JK0A 1NZDA 3DHEA 3PDIB 5LZ5A 1DZ3A 2P1DA 5C1PA 1GSIA 4G2TA 2IZ0A 3B3GA 2VA8A 4DSAA 2AXPA 2NO4A 2JJ2A 3GLKA 3IB3A 1XLVA 4JL6A 5H70A 4F5WA 2P8JA 3VDNB 4C2AA 1E9EA 4G37A 5ALEA 4DM4A 4L6AA 1G0NA 2QPTA 4LS3A 4LYDA 4UBLA 1XMOB 1FIUA 3BAFA 5BQ5A 3NDJA 4BLOA 3GLTA 4P38A 5A71A 5JWOA 3G5UA 3GY0A 1JQLB 4QWMA 2HDNB 3I4LA 2QLNA 3FWZA 1DJQA 2B8EA 2QR3A 3LXMA 3F4BA 4Q4LA 4UZSA 4ZOQI 3FSEA 3P9YA 3C8DA 4Q4JB 2E6UX 1AF4A 1TK3A 4TXHA 3AKDA 3C5CA 1T1GA 2PEZA 1HNOA 5EAIA 3A3OA 1C1XA 2YWFA 4X3CA 3KAKA 1ABEA 4HNAB 1KJIA 1Q11A 1V4VA 1XTSA 4TQAA 4KNWA 5LA6B 5FUMA 3BEOA 4GXRA 3GLIE 2JKVA 2DUBA 2I4RA 3F9IA 3IP5A 3VHXB 2XYPA 4MR7B 3ESQA 4Q1AA 3NBMA 1NRWA 1R5JA 1DPGA 3CFYA 4K9RA 3IALA 3U0BA 5AKJA 1RWKA 2PVSA 4QFCA 2C82A 5DBIA 4EGSA 1KQGA 4MPPA 1ISMA 4OX9Y 2WNHA 1KH2A 3S2YA 2HT6A 3OX3A 3ABRB 4UUQA 1Y8QA 4FXOA 5FFNA 3T3EA 3ECAA 1OHHA 3ZWBA 3IHKA 5KJFA 2Z4RA 1EQUA 2NPIA 1ODKA 2PWAA 4MUFA 1CP2A 4Q9NA 3C4VA 4K6KA 1QVWA 1X7HA 4DMRA 1IZZA 1JR3E 1IIBA 1TKCA 3NORA 1OFVA 2E18A 5CLGA 3F3SA 4K0RA 4R98A 1B16A 2IPOA 4YMVA 2D74A 4QUEA 4ARZB 2F62A 1CIPA 1UEJA 4JP8A 5TARA 4BFYA 4CG2A 5HRUA 4RCVA 4KX3A 1SU4A 7MDHA 4P58A 3TXAA 1MAVA 4R69A 2G9ZA 3EVDA 1AE1A 3H2JA 4LJSA 5HF8A 4EARA 4KMRA 3FX2A 4FYIA 1KZHA 4P8RA 3N8DA 2Y76A 1UEXC 2VNJA 1QGYA 5E4FA 3W8NA 1QONA 4URFA 1F6BA 1C4XA 2PBZA 4D3SA 2AHOA 4BIMA 2OR3A 1IU9A 1U4SA 1PGNA 1WF3A 4N47A 2C96A 1WEHA 1Z35A 1PJ2A 2DM6A 2RAFA 1TGYA 4ACBA 3OZDA 3PJEA 5KVAA 1TM1E 3DHNA 1JIIA 2E82A 5KIAA 1DIBA 1MH1A 4P4SA 1KTVA 1RLJA 4CDMA 1KO8A 3O9MA 1PI3A 4LMPA 4AWXA 4HD8A 1GPLA 1ZU4A 3NDPA 1G8MA 2WWRA 4KPFC 4AKTA 4C4OA 2GEDA 4WADA 4IDCA 5DHUA 5HZHA 4YLGA 5CBPA 4E33A 2C9DA 3WWYA 4LF8B 2I3ZA 5CFOA 2P2YA 4TLLB 4JCTA 5CDUA 3TZQA 3ZKAA 3ESAA 2D8MA 1DAPA 2RSLA 4JC5A 2EFGA 3FG9A 4G25A 4MA0A 3AL0C 3ZDDA 3KDSE 1TCVA 4PCUA 1N25A 3EXIB 3QPWA 1QFZA 4UHDA 3EYAA 1YA4A 2DHEA 1LC0A 4M7PA 2YOGA 3TG2A 1RRKA 2JJMA 3DM9B 3VYVA 2O8BB 3NEPX 4FIZA 4R71A 2VIIA 4UJ5A 3HBJA 4PC1A 2AEMA 4QUBA 3W77A 4BJ1A 2AFIA 1EGVB 1IUOA 4Z7NB 4RQAA 1QLJA 4BO5A 2B8NA 1EGHA 4F96A 5DXFA 3WIDA 4NBNA 1DKOA 2OZLB 2P75A 1QZ3A 1SQ5A 4FSXA 3I92A 4L85A 4YJ3A 4BV8A 3GWZA 4DLZA 3ZE8A 1MOPA 4KQJA 2FPMA 1T2DA 2JAUA 1AUQA 5KCMA 7AT1A 3EQ8A 1M66A 1JXAA 3PWSA 5KKNB 3RVRA 4I4ZA 2I62A 1LK5A 1U2GA 3TRIA 3STWA 2XGOA 2PQ6A 4Y6LA 4FGJA 3VTFA 6ADHA 4AJIA 2X22A 4X91A 3OQHA 3GLIB 1VKHA 4XGNA 4P53A 1QCYA 5LQCA 1C0EA 1JDNA 1SCKA 3IV9A 1GXSA 1UPFA 1J8QA 2EBUA 5D3KA 3T12A 1G63A 1LBIA 3BRSA 3UK7A 3PZBA 2DWUA 1E1NA 4YCMA 3CUWA 1G6KA 2FMUA 2HF2A 2XMBA 3D6NB 4YDHB 5EZYA 3RJ9A 3VZRA 1I4WA 5GONB 3IA7A 2A9VA 1QZZA 2JJ8A 1TQHA 4HAYA 4MMYB 2P9QA 3WLMA 1T0UA 1I2MA 4C87A 3UYKA 5TMEA 3EPPA 3AJ9A 1GP2A 2ZJ4A 3RS9A 4HDSA 1T8SA 3ZEAA 4JI5B 3ISAA 4BMSA 5CVVA 1HRKA 2VPQA 2IH5A 4NV0A 3KO8A 5U4XA 3QQPA 3H4TA 1CXZA 2H4XA 3CLSD 3B13B 1B1CA 1IJKA 2FYTA 2G06A 2B35A 1LNQA 2DPHA 3JASA 4XUCA 2IV2X 1PWZA 3SWXA 1G20B 2JGEA 2QDKA 4NDNE 3ZLTA 4W5JA 3VAYA 1KYXA 2YINC 2ZBQA 3P9NA 1RAEA 1TA0A 4BEWA 3HWRA 3LUDA 2XECA 5DNEA 4EGFA 1PFVA 2M2IA 1CJCA 5FD8A 1PTKA 5KNDD 4LAFA 1N0IA 1NQOA 2WSBA 3QBEA 1PFYA 3TB6A 4BNKA 3OQJA 3R7AA 3TS1A 2BZRA 1ZISA 1G17A 4HDNA 4ZDEA 3GEHA 4IJVA 1Q0ZA 3DTVA 4REQB 2PJZA 2ZYHA 1SC6A 3S55A 4V0LA 4YV0A 4H4EA 4C89A 1DT3A 1C1YA 3ASZA 4RCZA 5DRTA 2J31A 5IJ9B 1E1QD 2ZIFA 4Q4DA 3H8SA 2GJ9A 1AS3A 2CL5A 3RYFA 1JKIA 4DKJA 8LDHA 5H16A 4IIHA 1EM6A 1A7UA 2JC3A 1JLHA 4TLMB 1G8JA 4US2R 1ULHA 3THWA 3KBBA 5LZ9A 1IYZA 4GE3A 2X1LA 3PICA 3F8SA 4ZTUB 4GGOA 1JS1X 4GO1A 1DV2A 5DH9A 5JZ9A 4JI8B 2GJKA 5ALTA 2GILA 3KQOA 2CXRA 4M1EA 2MSCB 4I4IA 3CM0A 4B75A 2BFAA 4QO8A 1DELA 4EMBA 4RY2A 2ZE7A 3H65A 4XQGA 1PTJC 4ZDKA 5LQJA 2WABA 3QKRB 4TKLA 4RF2A 5ALKA 1WQ1R 2WTUA 3CBGA 3GYBA 5H3LA 5THKA 4AURA 3ANTA 4DXHA 4JJAA 3T88A 1JB9A 4OAOA 3B3FA 2DFPA 5SZIA 1P7WA 3ABOB 2IYUA 2FPKA 4NP6A 2O05A 5L4SA 2FGKA 2O8CB 4WCZA 1J07A 4QUAA 3IUNA 3FPGA 4EY3A 2PX2A 4MW6A 2IK8A 5HOQA 5K6TA 5AQ1A 2N47A 2B7LA 4ZTBA 2JGKA 4F93B 3ICPA 3RVDA 5LP6A 6AT1A 3WSTA 3FSJX 5IZ4A 1J2YA 2JFFA 4DC0A 4P2BA 5JD6A 5L7YA 4BO0A 3NBKA 5EJ8A 4BKPA 3QOYA 1UWCA 1FNBA 3O3CA 1I1OA 1TCBA 1KK2A 1O6ZA 2BONA 2TMYA 2QRZA 2GNPA 4TLCA 5FUYA 3H0JA 1NBIA 3DBHB 5F21A 1T5BA 3USES 2ZRPA 3K6JA 3LCJA 5BR7A 3CUTA 1BOOA 2MHCA 3QVWA 2XY4A 1AGPA 3SIPA 4U0GA 2ZTVA 1BQ4A 3N0WA 4G81A 2D3WA 1WP4A 3PX2A 3U4QA 4QX6A 1NE2A 4DIMA 4TXJA 4AY3A 3QVKA 5KYWB 1KFKB 1GGMA 2W6ZA 1DIHA 1FFSA 2G1AA 1PFKA 2X4DA 4E1BA 1NVMB 4L9AA 2G36A 1U3UA 2DTDA 4FGKA 4Z6KA 3MUFA 4ZT3A 2V58A 5LD2C 4Q9KA 5K8UA 5INIA 3FAKA 2QX9A 3CUVA 2EGUA 1UYTA 5IAGA 2A5JA 2P0YA 1CW2B 3BIWA 4DLYA 4BNZA 1VE6A 1D5WA 1VJRA 2XF8A 3D3KA 4KREA 4JITA 3DT6A 1E98A 4RA6A 2J6HA 4BBPA 5E2IA 1AZWA 4HDMA 4N3BA 3OU7A 4TTQA 3ZWOA 3V4FA 3OC0A 4MS1B 2WZDA 2XZLA 3KETA 4LTDA 3O7WA 5GPBA 3C3YA 2XXJA 4UNIA 2C92A 2IX9A 3JAKB 3DE0X 2NTYC 4UTVA 2I33A 5ES4B 1L2TA 2HNAA 8ABPA 4DY4A 1PO7A 2OZVA 2P30A 5B4TA 2JI4A 3IKMB 2B4KA 2H3EA 1RZUA 1UKAA 1LLUA 1NVBA 2GAAA 3FVTA 3W8EA 1IBSA 2WSYB 4DA6A 4IHJA 4MVXA 3DLTA 4OSEA 1PFQA 3WGGA 1U2TA 2PCJA 4JOSA 3E61A 8MHTA 3MWGA 1DCTA 1RQNA 2XMCA 3STYA 4HWPA 1GDHA 3EQ7A 3VNSA 4F8YA 4PHGA 2AV6A 4LOJA 3TJMA 1W0JD 3BWCA 4MB6A 3SJ7A 2CVHA 2BEJA 3ODGA 1QOQB 1L4BA 3FYUB 2BTQA 4BNDA 4BJHB 2CLMB 2E9SA 5CDFE 2JI8A 4GX2A 3HDVA 2J5SA 3IAEA 4L74A 1C30B 1H2XA 1ZCZA 2NYRA 4AYTA 3OEED 1BYIA 1NDQA 4MVJI 3DMHA 3P85A 4MWOA 4AMVA 2FPGB 5CURA 4FDMA 2QRJA 1V35A 4H3SA 1M2VB 2WF9A 4OHBA 1QM5A 2BGMA 2O2ZA 4G5GA 5KNBH 4G0PA 4O1HA 2ONJA 1CIVA 1WCIB 1ZUHA 3CEPB 3PFBA 3QELA 1OB5A 4D9BA 4ZK2A 3K4HA 2XYVA 3A4TA 4D74A 2C3YA 1YNOA 4MWDA 2VQ3A 3CLRD 2ZRJA 4EL0A 1TYCA 4E13A 2EX0A 3IV7A 1W2HA 3OSZA 3HR4A 1QX3A 4DSTA 5BV2P 3HLTA 3UGKA 5KYYA 3EHEA 1P9RA 4PVDA 4NENB 3W06A 4DRZA 1GEGA 1YG8A 5FWXB 4XPZA 4I50A 3OKCA 2F7SA 4UVIA 2P11A 3EY4A 3H5AA 4RF4A 3T7AA 1BXGA 3TLKA 3VNBA 1ZN8A 5BMVB 5MGBA 2X24A 3IMEA 5UKDA 1HDOA 1UFVA 1GA4A 1ZCAA 2IHZA 3NANA 1XZGA 4N5MA 3A4YA 2TRSB 4RA9B 4EVIA 1JL3A 1WVIA 2B94A 4KAXA 3BL8A 2R48A 2D0IA 3DUWA 1R18A 5ADHA 1PLKA 1XNHA 5FORA 1XEFA 2H07A 4OKIA 1R27A 3U7IA 1E4YA 4KPUA 2GXQA 1BYUA 3BA1A 1H4VB 2J5BA 3Q98A 4URVR 1U8UA 3HY4A 3EY9A 3ERCA 1C29B 3W7BA 3EPRA 3TTUA 1J70A 3G7NA 2MR5A 1RQRA 3NJRA 1L7AA 1HE8B 3MW8A 2OHIA 1TW2A 1SUIA 2FLKA 2HRBA 3B3JA 3KVNA 3LX4A 5K3EA 4TVKA 3O3NB 2X58A 4YRMA 4JQOA 4YJKA 4YP1A 1FTWA 2Q41A 2RG7A 4NMHA 4ETMA 4RJIA 3YASA 3GZJA 4MCJA 1THMA 1USKA 4UASA 2E1RA 2WFLB 1NTOA 2XTNA 4TMKA 3A7DA 1O0SA 3U44B 2WMNB 1DT5A 3FMGA 4I6EA 3RGWS 1C0IA 2FR0A 2I99A 3GVHA 4MQFA 4QXOA 2V0NA 1DAOA 3TDKA 4GOKA 2OGUA 4P81A 1TM5E 2PYZA 4QVGA 1OY1A 3UUEA 2V8BA 3EIEA 5E3JA 2XWQA 2EYQA 1N1MA 3O2JA 4JR2A 4P32A 1VA5A 5G3ZA 3BORA 1NFQA 3ELWA 1DAGA 4NYJQ 1R0CA 2YIDA 4YCLA 2JD1A 4LNAA 5F2NA 3IS3A 4HDAA 4BPBA 4DPMA 2OD9A 5T64A 1G5IA 4MYRA 4CFSA 2YC4C 1X7ZB 5J4LA 4L4XA 4BEBA 1EWVA 4CWAA 4Z9BA 1VSUA 4RTNA 4HNQA 3C1OA 3OJWA 4KRFA 3BX1A 4D8WA 4FILA 1O0CA 1NNLA 2I2XB 2VSSA 4NYJR 3LUGA 4Q3CA 3O8QA 2R2GA 3P0FA 5ALOA 5E9JA 4PTYA 3W9YA 1P73A 5EJ9A 1GR0A 1NRJB 2QSZA 1YZKA 2DBVO 1JALA 2JHCA 3A4NA 2F00A 3L77A 4QBKA 1I8TA 5FOSA 2YH2A 5M34A 3MK31 3MJDA 4B3TB 4DR1B 4XUDA 3AERB 4CMGA 5DLEA 4CTMA 3UICA 1DX9A 3RJ5A 3B9QA 3SHTA 3JYPA 2IPMA 1CSEE 2XUKA 1JDJA 1ZNQO 2VH1A 1HQDA 1Q44A 2Y1WA 4GX1A 3WWEA 5D5HA 4MVCA 4EMPA 4WZBE 4HAUA 3VFDA 2QTVB 3GA0A 2WKWA 1ZITA 4RGVA 5DN6A 3FZYA 2H57A 4B7UA 3IUMA 4QXPA 2JFBA 4MR9B 3S1SA 1ND6A 4Y2HA 4MRSA 2OSVA 1RKBA 1ZVMA 2HJHA 2WZCA 3V7FA 2HUPA 3U13A 1QGUB 3DHVA 3HG7A 3R0OA 4B0PA 3NJDA 1I2CA 2JFZA 2WIDA 2QM0A 1EM8A 2XYHA 3CNEA 1SCJA 2K87A 1NBWB 4IZ6A 621PA 4BXOB 3OMEA 3A6LA 4LZPA 5IT9A 1NM5A 1ODJA 4L0QA 2IFTA 5D7NA 4O8CA 1J0CA 3STTA 2WJWA 4F2WA 1A88A 4JB3A 4IOMA 4YJGB 4P86A 1ZG3A 3A04A 4HQOA 3CYFA 3R7NA 4BMDA 1YJAA 5AHOA 2J30A 3VHRA 2CT8A 1CZLA 3NALA 4Y9DA 1EESA 1QPZA 3FPCA 3FVRA 2YJ4A 4LGVA 1S02A 2BMVA 4G1BA 3UB3A 4Y2VA 4KRXA 3ER8A 3O4JA 1EX6A 4BMCA 4INZA 1ZJWA 3JAWB 1ACLA 2L18A 1F0KA 3D6HA 1JLRA 1X1EA 3P9XA 4MARA 3FNGA 2Y0DA 3LUKA 1LRKA 2G1PA 4MV7A 3IQDB 2WEKA 4OBEA 1U63A 2BE9A 1WG8A 5HFJA 3AJDA 2C4TA 2IEZA 1FVHA 3A6PC 3D59A 1JDVA 3EGIA 1OAKA 3G7SA 1Y37A 3WLIA 5IRCD 3VHLB 2HU2A 5J3JA 5KTTA 2VSFA 2AQIA 3A6GA 3KSBC 2QUKA 1NN5A 4FQ5A 1N2OA 2BEKA 4PG4A 2O5CA 2R751 1M7BA 1Y82A 5U9CA 2HBRA 3VOSA 3QUCA 5E1OA 1A5AB 1NW5A 5IP5A 1XAJA 1JQEA 1MX3A 1KAMA 2B2CA 3ZK7A 2G77B 1DOZA 3PJDA 1GPUA 1Z5ZA 4AUKA 5HKKA 3GJ3A 4RVHA 2LW7A 2WNSA 3DLCA 4L3VA 9GPBA 4UNSA 2H1CA 4ANFA 4MUJA 1XQ6A 2HCBA 3ND7A 1SVUA 4B5KA 1AU9A 5K6AC 4TXLA 2GZRA 2JGDB 1PDVA 1XF1A 1YAHA 2R5FA 1KMMA 2ZJZA 1T9KA 4RHCA 5T41A 1TW3A 4ZJZA 4OLAA 1Y0BA 3E6AA 2JZCA 1TUBB 1QFSA 1VDZA 2BR3A 2J59A 2REBA 2V6MA 4ZVNA 4RKYA 1IFXA 1NY6A 1YR9A 5A4IS 4Q9DA 4MWSA 1AURA 1XVVA 4EZBA 1Z29A 1V37A 2KSQA 2R86A 4Y9UA 4A91A 1X1SA 1AK2A 3CV3A 3VKGA 4DLAA 1IXRC 4UEOA 1QDLB 4XD7D 5YASA 1MKYA 2YC2C 2CLOB 1Q15A 1RJ9B 2SKCA 4P92A 2J9XB 5BUZA 4LJ4A 1R9NA 1FP1D 4MW4A 3VR5A 4Z4GA 5ERXA 3ZBPA 2IF0A 5ALIA 1DIGA 4BAZA