3ZWCA

Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa
Total Genus 272
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
272
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Isomerase and Hydratase Reaction Mechanism of the Crotonase Active Site of the Multifunctional Enzyme (Type-1), as Deduced from Structures of Complexes with 3S-Hydroxy- Acyl-Coa.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords PEROXISOMAL BIFUNCTIONAL ENZYME
total genus 272
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3zwcA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zwcA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3zwcA01
1GFSA 3VPSA 5JAIA 4CMAA 5GZ3A 3ZU2A 1HE4A 4I5DA 2JAPA 4JLWA 3NJDA 2J3IA 4O6VA 4GAEA 3D5TA 4JIGA 4ZDDA 2YV3A 3GAZA 3IJPA 4TKLA 3DZKA 3HDHA 1CQJA 5KKCA 2R2GA 1E1LA 2J3JA 4EMMA 5KVCA 4KDEA 1I2CA 3QWBA 5L7WA 3WTCA 1N1GA 3PZKA 4CM4A 1R4NA 2PKRA 1YB4A 2GDZA 1QMGA 1JLLA 4RPLA 4TRMA 5DTPA 1A4IA 2C82A 4O63O 4BKPA 1QG6A 4PLFA 4BQPA 4JBIA 5F1KA 1SEVA 5IDYA 4IBOA 3SXPA 1NWCA 3DO5A 3NRCA 1LI4A 1U5AA 2VWPA 4QQRA 3VZRA 3DOCA 1O8CA 5JC8A 3TVUA 3JQ9A 3N58A 4R3NA 3HDQA 4Z9FA 4OH1A 1IZ0A 3I9OA 4FJWD 1NQ5A 1JAYA 4OG1A 4N54A 1DRUA 4XGNA 4XKJA 5DDIP 5BNTA 2P68A 2O3UA 3UN1A 1B8UA 1PS9A 3TRRA 1LC3A 1H93A 4J4TA 4GX2A 1PTJA 1AN9A 3JQ7B 3M1AA 1NPYA 2FZWA 1KYQA 2V6GA 1QYWA 1ISFA 2X9GA 3GEGA 1TI7A 2OGUA 1A27A 1DIRA 3FF4A 1OOEA 4D46A 4GH5A 2F00A 4QXMA 2QRLA 4NIMA 3OJOA 4UEOA 4G81A 4PLZA 4CODB 2X9NA 3K73O 2Y1DA 1VE9A 2AE1A 3C24A 5KJPA 4FJ2A 4FNDA 2J6IA 1LLCA 1AUPA 3HE3A 4R68A 2NADA 5U1PA 5IG2A 4B4VA 1E5QA 3A14A 4E5MA 2NWQA 2IZ0A 3V2UA 2O2SA 2AEFA 1PJTA 1HDOA 1SPXA 4R01A 3GNTA 5JSFA 4O1MA 5JYDA 3EY4A 1OFGA 4Y8VA 2NACA 3KHUA 1E6EA 2QHXA 4LISA 4MOWA 1DC3A 5CG2A 1XG5A 1VC2A 3HDJA 5KNLA 4KWIA 3ZH2A 4QX6A 3W4KA 4CUKA 1O8UA 4E4YA 2ZB4A 3JD4A 4MKRA 3IP1A 1E6WA 1UIYA 2YFQA 4ZGWA 1IZ9A 3PFFA 3LAOA 3IAVA 3SLGA 4AL4A 4DI1A 4K6CA 1MXHA 4Y6SA 1DIBA 4ALJA 2EW8A 2DFVA 5CDTA 3AY3A 1IULA 3CEAA 1PQPA 2JL1A 3DZGA 4R16A 1FCFA 3FNFA 5LC1A 3DZBA 3U4CA 2V7PA 1BXZA 1ZNQO 2JAHA 5KJ6A 3PRJA 4YQZA 3BIOA 3C8MA 4ROSA 5ITVA 2PBPA 1MG0A 2QQ5A 3RJ9A 4GX0A 3ZHZA 4CL8A 3WG5A 5B37A 3CE6A 4XDZA 4LMRA 4R1UA 3ZCXA 3WX0A 4FBGA 4DMMA 2CDCA 4EW6A 4II3A 1WNTA 2FSVA 2CVQA 3B1FA 3ONDA 4ZN6A 3JQ9C 4CV1A 4BUCA 2W2LD 2P4QA 3OH8A 3EUWA 2EGHA 3DAPA 3GPIA 4PRKA 3RBXA 3KTGA 3AWDA 4UVEA 1OI7A 4D0RA 1XIVA 4BNJA 1F0YA 2X5KO 4JJFA 3PQFA 3M6MA 3R0IA 1FC6A 1Y8QA 2DUUA 3VVCA 1JVBA 4MVJA 1YL5A 4XEHA 4QFCA 4JNKA 3OA2A 1JKFA 3DAFA 1DAPA 3IQDB 1QLJA 3CSDA 4WOKA 1J6UA 1I24A 1ZSNA 4J1SA 5IN5A 1RM4A 3NDJA 5JW6A 1JQBA 1ZJYA 1SB9A 3STAA 3PYLA 5KIAA 2J3KA 2ZCVA 5KJFA 5AXBA 3WGYA 2WE7A 2G5CA 2HMWA 3TFQA 4E30A 4BQRA 4GGPA 2JFFA 2VYVA 4ONEA 2IYOA 1WAMA 1NXQA 1E7SA 5JE8A 4PG8A 1SEPA 3OSUA 5H81A 1Z74A 1NASA 3H9UA 5F5NA 1LBEA 1C1XB 3GN2A 4EEZA 4XQCA 3PDUA 3DB2A 3F46A 1H2BA 4B3JA 2DTEA 3ZWCA 3IKTA 2FR0A 5FWNA 3ZW8A 3ORFA 3K5PA 1NYTA 3PK0A 4PGFA 5IZCA 4WCFB 4FOOA 1ENYA 2A92A 1EBFA 4OHUA 2PPYA 1O94A 4BO3A 3NTOA 4IINA 1E3JA 3H4VA 2BLLA 4TMFA 5F5LA 1RKXA 4MIYA 3GY0A 4P8RA 5EMHA 3ZWMA 2CF5A 1WVGA 1B3BA 1TYFA 1P1IA 5A02A 1IB6A 1K3TA 3EC7A 3LVFO 3HQ4O 1HE5A 3CZRA 4RF4A 4XRGA 2EKQA 2P9GA 4UEJA 1JVSA 2O4UX 1SO8A 3TZCA 1H6CA 1P74A 3KZVA 1CJCA 2NQ8A 4XGKA 4BS9A 1KERA 2ET6A 2J5GA 5FFFA 1MV8A 2AQIA 2HO5A 4KUGA 3NAQA 2UDPA 4DLLA 5EL0A 1LUAA 1K6XA 4TWRA 4A10A 4OSPA 4HP8A 3R3JA 1HWYA 5GZ6A 1T1SA 1Q0HA 1S6YA 3CH6A 1HLPA 3OMEA 5HM8A 3VDRA 2H9IA 5C7OO 1E7MA 4UUNA 1UDAA 3DMTC 3K96A 4U6QA 4G65A 1EMDA 1QR6A 2Q99A 4EBFA 2C7VA 1YH3A 2OORA 2I5PO 3WJAA 5DOVA 3GEDA 3RU7A 4B79A 2GO1A 4PLTA 3Q3CA 2PFGA 4X54A 1LQUA 1TG6A 4CQLB 2O3JA 3SBOA 1U7TA 2C7GA 3GLMA 1P1HA 2JCXA 3ZNPA 1I2ZA 3GN1A 3Q2IA 4JFCA 1I36A 3WMWA 1RYDA 1XCBA 4IZHA 4Q39A 4A2CA 1UXHA 1A7AA 3L3SA 2OP0A 3WOHA 3HSKA 2ZTVA 3JQGB 4I4ZA 4JX8A 3WXBA 4NQZA 4F45A 1E92A 4KQXA 3JQGA 4I42A 4L8VA 1R0KA 1DC4A 4YJGB 3DR3A 2I3AA 4I1IA 3RUEA 3ZU4A 4BNTA 4IQGA 3KBOA 4LK3A 1YONA 1HZJA 4BO5A 5COQA 2I65A 1ONPA 4GSKA 2XOXA 1P77A 4LCEA 3WLEA 1LLUA 3AOGA 1QRRA 5I8ZA 3UFXA 1FJHA 2Q49A 3ZV5A 1P3DA 4U0GA 1BXKA 4CM9D 1GZ6A 3F1LA 5HS4A 3A4VA 3VVBA 4UEKA 5H83A 3PP8A 2IEXA 4RYFA 2O3SA 1T2EA 4BHTA 1TT5B 2BFAA 1NNUA 4PLPA 5AOVA 3AUTA 4EGFA 5JFOA 3JQFA 1W73A 4D3FA 3FD8A 1GYQA 4OOFA 2CMDA 4DMLA 1V3VA 7ADHA 3F6YA 1Y7TA 2AG8A 3RKRA 1C14A 3RC7A 2GF2A 1FC7A 2HMVA 3BXXA 4YJFB 4JQCA 3V1UA 3MJ4A 3LYLA 4ZICA 1SG4A 4UVIA 4CLXA 1YBMA 1ZW1A 2X5OA 1BDBA 3R3SA 2A81A 1NX6A 2X0RA 5KTKA 3H7AA 1DOHA 2VQ3A 5A05A 4E2ZA 1ZMOA 4YAGA 3KV3O 5IJZA 5L4NA 2FY8A 3UH1A 3KETA 1ZMTA 1N8KA 2RHCA 4Y67A 5IDWA 4YLHA 4JCOA 3MJSA 5G2OA 5AXDA 2HJRA 5IAAA 5KOIA 2YQ5A 3W8EA 4WOJA 4IIVA 5TF4A 4DTIA 4FFRA 1NBOA 4BNNA 1PJ3A 2VRCA 4WZ8B 4EYEA 4CM8A 5HWSA 4QECA 4MVJE 4PN3A 1U28A 2EP5A 2V65A 3R1IA 2Y93A 1Q0LA 4XYBA 1ONNA 5IXSA 3JQBA 3PHJA 3TNLA 4CQMD 1HE2A 2EIHA 1U8FO 1DB3A 4HY3A 1MB4A 4Y6PA 2VNSA 3FN4A 3BTSA 3O4RA 3QJ5A 4WCFA 1R4MB 5DCUA 4M55A 3EW7A 2YV2A 4DQVA 4W4TA 4ZD6A 1IYZA 2NLOA 2D3TA 4MI2A 3PWKA 1JW9B 1NPDA 4AJ2A 3M2PA 3H3FA 1ZCJA 3PEFA 3RBVA 2GD1O 4NMHA 1LC0A 3LC1O 4JJIA 3UGKA 1JA9A 1VL6A 4GKVA 1LRLA 3ISAA 2O3RA 2VWGA 4IPTA 2OMEA 4Q3EA 2WSBA 3ZU3A 1YGYA 3UUWA 1E1MA 4NFYA 3SEFA 4HBGA 2VT2A 4JK3A 2Q2XA 4YT5A 3FBTA 1UAYA 3DOJA 3W4JA 3IKVA 1ZFNA 1ZK2A 4ESOA 4QTZA 4OLQA 5F3RA 4U0GH 3JD2A 3ZNOA 1PR3A 1HNOA 2C2XA 1D3AA 5U4QA 3EDMA 3LF2A 1W8DA 3SC6A 3KEOA 1LLDA 3AJRA 1E3SA 1JDJA 1SOWA 2FMUA 3GVXA 2ZYAA 3JYQA 1BTOA 3R6HA 1M76A 2EGGA 4IDCA 1I0ZA 3WSWA 1IUKA 2VSSA 2Q1WA 2Q4EA 4M1QA 1UDCA 1YB5A 3IC5A 1UYVA 2CSUA 2G1UA 4J0EA 5LCXA 3UCEA 2ZL0A 3K50A 3UHAA 2ZTMA 4ZJUA 2VHXA 2PD4A 3U4IA 1DCIA 1NM5A 2PKQP 3DFUA 1P0FA 4PLHA 4DXHA 3AW9A 5DP1A 3JYOA 3GPDG 4J4BA 4PVCA 4UVHA 3D3WA 4EITA 1EUZA 1KBZA 2VN8A 1FDTA 1I3MA 4CM5A 4F6CA 1HEUA 1YJQA 3BEZA 4GLLA 1HYEA 1WP4A 3TOXA 1RJNA 2H5LA 4BNZA 3P2LA 1MLDA 3FR8A 1XWFA 3EGOA 2B35A 2W8ZA 5JMPA 3WGHA 4Z3KA 1C1DA 2Q2VA 4J1NA 3PGJA 4WE3A 3H02A 3F1KA 2W2LA 4EI2A 4L76A 3WQRA 1VJ0A 1VSVA 4EEXA 3GKBA 1NTOA 2UUOA 3D3WB 4DPKA 3IBBA 3A28A 1GY8A 2C5AA 2CY0A 2VTEA 3LT4A 5BNFA 4BGUA 3UVEA 2X7HA 2D5AA 1B7GO 3QA9A 3WQQA 5I7SA 3O8QA 1WDKA 4N5MA 2G17A 4Z9YA 1Y5RA 2WMDA 3P2OA 3Q2KA 3I9KA 1BWSA 4GMGA 4PLVA 2DPGA 2SCUA 2QZZA 3DBLB 4RGBA 1GD1O 1F06A 1JWAB 1X7DA 3CZMA 2AEMA 3RUIA 2ZL2A 3NT4A 4KWHA 5EINA 4PVDA 2BELA 3GVIA 4ZDBA 3P19A 4FOSA 1PJHA 1U3WA 3L6DA 1T4BA 4IZCA 1P44A 1EQUA 1SMKA 2I6TA 1AHIA 4WPGA 1I3KA 4J16A 1XQ1A 4JGBA 1UXJA 4HADA 3Q9UA 4I5GA 1T25A 4PLCA 3RU9A 1PGJA 1OD4A 5JMWA 3FNEA 3SJ7A 4B7UA 2ZCUA 4RDHA 3SX2A 1BW9B 4L9RA 5CHEA 3WJ7A 2GTRA 3CTMA 4E6PA 3W6UA 1MFPA 4H3VA 4L74A 5JO9A 5C37A 5JS6A 3CKYA 2OBNA 3D5QA 3OJLA 3PEAA 4PRLA 3IB9A 4WLEA 4MVJF 1ARZA 5TX7A 3EVTA 4OOEA 4RF2A 5ER6A 3TZ6A 3RRVA 3OIFA 4CLHA 5TT0A 5L7TA 2A35A 1N6EA 2RH4A 1YS4A 3JD3A 1IPFA 1VRWA 5CTBA 5DU4A 3DBRB 5TGDA 2O3QA 5TNXA 3D1LA 5CEJA 2EKLA 4FR5A 4Z0MA 1LSUA 5CDSA 1UXKA 4R1NA 4I9NA 3ADPA 5A1TA 1H9AA 3FNHA 4R5MA 2FRDA 3OT6A 4Q3BA 4IJVA 4Z3DA 4PZEA 4CM1A 3N7UA 4D3SA 5B4VA 1EQ2A 1ENZA 4YACA 1EVIA 3VPHA 4GVXA 3TFOA 4HFNA 4MP8A 4WCZA 3QQPA 4CM9A 2I3GA 1SZOA 3W8DA 3KTJA 4IDDA 3GVCA 3QVOA 1B8VA 3GGOA 3WMXA 4XGIA 3G3EA 2J5II 4QT0A 1N5DA 4HFJA 3D4PA 3VH3A 4A27A 2ZQRA 1Y9AA 1MXFA 2ZKLA 3NJBA 3BMQA 5IN4A 4N5NA 1E1KA 4J2HA 4ND1A 2PLAA 4D79A 1HDGO 2P9CA 2J5IB 4EMPA 5K6AC 4WECA 1HDCA 5IF3A 2WE8A 3FBGA 1V6AA 1L7EA 2R00A 1DFGA 3IJRA 5JCXA 4EMLA 1LSSA 1Y9EA 4OSOA 2FW2A 3OEWA 3KYBA 4O5OA 3MTJA 3E48A 4R9RA 4YR9A 1SCUA 4S3MA 4IUYA 4DQXA 3JQAD 2BGKA 2GN4A 4YAEA 1B16A 2C20A 4OXYA 1T2DA 4CMHA 4YT8A 3FRJA 3DAGA 5E0SH 1J0XO 4W7HA 3CMMA 1YQXA 1RJMA 1U8XX 3DONA 2DVMA 3Q6IA 5KJCA 1PSDA 4JN6B 2FZEA 4NJMB 2FR8A 3N74A 2POQX 3S2IA 5A4DA 1GV0A 2YUTA 4GLOA 4L0QA 2OHXA 4J3FA 1EVZA 1NZYA 4J9VA 4OGWA 5C5IA 3PHGA 5KDRA 4FJ0A 4XRRA 5G4LA 2B36A 1EK6A 4BIIA 1PGNA 1SB8A 4FCCA 5F1PA 4CR8A 1C3VA 2VSSF 4BO9A 1KEUA 1NFFA 1A5ZA 3D4NA 3WBFA 4TVBA 2G0TA 2Q45A 5T8KA 1UAGA 4B8ZA 3FDUA 3HFSA 5G1RA 1NR7A 1B3RA 1GQ2A 5CEFA 2IXBA 1D1TA 1O6ZA 1I5RA 4H16A 2HW5A 3U4HA 4GX5A 1XNVA 4WCFC 1R15A 4FNBA 4MVJH 2VUSA 3OJ0A 1D4FA 2J5GD 3AU8A 3KVOA 3L77A 4Z0HO 3RI3A 4CQMB 2NVBA 5KJEA 1ZEJA 3PFWO 1PL8A 1KVQA 5COAA 1LDYA 3SWXA 4FPXA 5CDGA 3PLNA 1NVMB 4RORA 4XJTA 3DBHA 3F4BA 4I8XA 2QRJA 1ZIDA 4ALKA 1ZK0A 1VPDA 1ISGA 3RKUA 3UCXA 4LN1A 2EXXA 1R0LA 2HSDA 5HA5A 5L40A 1PL6A 4CLRB 5LDHA 3GAFA 5TJ9A 1SAYA 3P2YA 3DZJA 3GVPA 3WIDA 4JCTA 1GQQA 1XDWA 1YQGA 2HKIA 4CQMA 3L07A 3S2EA 1GYPA 2C2YA 4HFRA 2FZSA 1V3UA 2CFCA 3QHAA 3ZGYA 3WFJA 4HC8A 4EJ0A 4Q3CA 3DBLA 3U62A 1DO8A 2OL4A 4H15A 4RCVA 3BMNA 3ZWBA 4MVJP 4CMKA 3HLN1 4OMRA 3WGOA 3EYWA 3HFGA 3WDSA 3QIVA 1KC1A 4XR9A 5JAMA 5INFA 2Y1FA 2I66A 3DC2A 2PWZA 4GQAA 4NBTA 5BNIA 5JDCA 1R12A 1EFKA 1FXSA 3BHMA 4BGEA 5A9TA 1CYDA 3B6ZA 3X2FA 3FTPA 2DTDA 1UZMA 3AY6A 3WBBA 5KDRB 1WLYA 3GZ4A 1UZLA 3FWZA 3KUXA 3QWAA 2ZQYA 3VZPA 2IE0A 5J23A 1LDMA 3K2BA 3H9JA 4JXKA 3TQHA 4JYLA 3H0JA 4A5OA 3F5QA 4IXWA 4IS3A 4KP7A 3K92A 4J91A 2GASA 4QIIA 4CM4B 4K2NA 3HP0A 3LT2A 1XA0A 3LLSA 5INIA 5JAZA 3WGGA 3Q1LA 3QWDA 1YOVA 3ONFA 4LVUA 3WSVA 5ENDA 4HNHA 1WZIA 4XB1A 4B7XA 4DREA 4RVFA 1XR3A 4RQUA 5JAQA 5DZKH 4RL6A 3D0OA 5G0UA 3BMCB 4JCSA 4J6FA 4R41A 3GC6A 4CMEC 1UJMA 3AI1A 1GAEO 2AQHA 3KXDA 1NVTA 1UP6A 2GLXA 2JD2A 4AJHA 5KJ1A 3T88A 3JTMA 4IDBA 4J7UA 2UAGA 4IGFA 4NNQA 2C59A 1LTHR 1UP7A 2Q2QA 1LXCA 3I9LA 2PGLA 3T89A 3I9MA 4RF3A 3RBZA 3P85A 3TZQA 1W0CA 1ZBQA 2HUNA 3QRWA 3B1KA 3PHLA 8LDHA 4PZCA 3UW3A 2E37A 4MVJG 4OKIA 3I9NA 4FC6A 1YB1A 3B1JA 1A72A 3E9QA 3H81A 3G17A 2YV1A 1U9JA 5T67A 2CUKA 4D3DA 3RQSA 2C54A 2DKNA 5DTWA 2C8TA 2ZTUA 3RIHA 2F9IA 4OM8A 4AJPA 4CR7A 3RAJA 3RSTA 4DL9A 5DU6A 1AGNA 4KOAA 4ZHSA 3ITDA 4RQTA 3MEQA 2GZ3A 3H3JA 2CVZA 2DUWA 3FF6A 3L4BA 4E5NA 1Q2XA 4QFDA 4L4SA 1D7OA 3T4EA 3T4XA 2BF7A 3BAZA 4HXYA 3OA0A 5DT9A 2I67A 2R6JA 1TVEA 3ZZNA 4OQZA 4XIJA 3QKAA 1ZK4A 3H8VA 4J90A 1RYEA 4WLVA 3V2GA 4BKUA 2VX2A 2XF8A 1BG6A 2YHUA 1QYDA 4J2OA 5GY7A 4E12A 1GU7A 1GYRA 4KTVE 1MJ3A 2CE3A 1LDNA 4J1QA 3I6IA 4CMIA 1R0SA 4JCQA 3BHJA 2WD7B 1PZFA 5K9ZA 4E2WA 4Q0GA 4FGWA 5JDCC 3GQVA 3K6JA 1NFQA 3HUDA 2H6EA 3LQFA 5TS3A 4FN7A 3K8ZA 2VHYA 3RUAA 5C7LO 2O48X 3H2SA 3WLFA 4JJTA 4GWGA 3BHIA 3JQ8B 3NTQA 1U2GA 3QV1A 2VSUA 4O0LA 2UVDA 1LSJA 1U3VA 2GZ1A 1YO6A 2JD0A 4BO8A 3VZQA 1YDWA 3KYCB 3IS3A 1SZJG 4A26A 2GZ2A 2PKQO 2X24A 3AFNA 2PH3A 1PJ4A 3ONEA 2Y0EA 4CLOB 2XAAA 3O03A 2VT3A 2I99A 1WDLA 1ISJA 4INAA 4R1TA 5CDYA 1XSEA 1ID1A 2HK8A 3GHHA 4CUJA 4E5KA 4WUVA 2CNBA 3U9TB 3DL2A 3GR6A 2A7KA 1I30A 1K6JA 2O23A 4YCAA 3RFTA 3ZHYA 4BOYA 2Q1UA 1NQAO 4CV3A 1M75A 3CINA 3C7DB 3KSUA 4CM3A 1X7GA 5JPIA 4BB6A 4C7JA 4YJFA 4BO0A 1U5CA 1BRMA 4I5EA 1MX3A 3FCOA 2Q1SA 1DHTA 1TEHA 4AG3A 3AI3A 2ZIZA 5JLAA 3WGTA 1DPGA 4ELSA 4YDRA 2RHRA 4DIBA 3ETEA 3PJDA 4HNKA 1WZEA 3DBHB 4E5PA 3HE2A 3GF4A 1KVTA 1HZDA 4Q1IA 5JO0A 3GVHA 3MJEA 2W3PA 3PGXA 1NR1A 4KWBA 1BVRA 1X0XA 2PZKA 2JJYA 2QX7A 5DNAA 2NU6A 1ZK1A 4KMSA 1EVYA 3ZWWA 4K3WA 5KVQA 4BNXA 4NI5A 4FDAA 4M54A 3O8QB 3MJTA 4B3IA 4QO8A 4YXFA 4K1LA 1CERA 1XYGA 1F8GA 3ROPA 4FIZA 3ROMA 4ZDCA 2WYUA 2ZB8A 3EZLA 1PJLA 4DLBA 1TB4A 5C90A 1WW8A 4CMCA 3CXRA 4DWVA 3P5MA 4TZKA 5CTCA 3PZBA 4YWJA 1A7KA 4FFMA 5CP8A 2IYPA 4BNGA 1EY3A 4NPCA 1PJCA 5AYVA 1AXEA 3F3SA 2VYVD 3GG9A 3GLQA 2J5SA 4Z0PA 2HJSA 4BNLA 1ULUA 1RJWA 1B0AA 3ICCA 2F1KA 1VSUA 3JYPA 1ENOA 1CDOA 4KNPA 4RCNA 5DBGA 3QWHA 3I6QA 1EE2A 4NDNE 1HRDA 5FEUA 2C0CA 3VPXA 4TRJA 1Y7OA 1JU9A 3BTOA 2NV6A 5G4KB 5HRUA 1HXHA 1M6HA 3RWBA 2GYYA 1I8TA 3ROKA 3S8MA 3H5RA 3VC7A 2HK7A 3DTYA 5B4TA 2IEDA 4M49A 4AFNA 2Y05A 4XIYA 1VL0A 3E5MA 3ASVA 1QKIA 3DORA 4FB8A 1N1EA 4R5HA 5AVOA 2WD8A 2CBYA 2Q3EA 5EERA 2FSSA 1WPQA 2G82A 3E5RA 4AJEA 3K2EA 3DOOA 4U1AA 5DKPA 1NVGA 3UKOA 2D0IA 2VZ0A 3PGQA 1ISHA 1EE9A 3BMQB 3GK3A 5L53A 1L7DA 5EJ2A 3S2FA 2FPGA 2AE2A 2EEZA 3AM3A 1KVUA 3OMLA 1QYVA 4WASA 4GSLA 2A94A 2ZTLA 1CIVA 2I9PA 5TIIA 3QK8A 4JSBA 3VH1A 2YHIB 4ASIA 4M89A 1GEEA 4IMRA 3NDIA 4BO6A 1ON3A 4K28A 3ZNQA 2QQ3A 3M6NA 2B4RO 1MGOA 3A1NA 4GL4A 3FHLA 3O26A 2VHWA 4WLFA 3DXFA 5KKAA 4CMGA 3H5AA 3TDKA 1XEAA 4CLDA 1YL7A 1A9YA 4YBZA 2JHGA 3ANNA 1BVUA 4K26A 4JVTA 2QYTA 1N92A 3KYDB 4RVHA 4RZIA 4Y6RA 4E5YA 9LDBA 1B26A 4I9UA 2YHIA 2E49A 2FWMX 3AUSA 3ENNA 4ID9A 3RSHA 1G6KA 3UCFA 3PHIA 4F47A 5BSEA 3EK2A 1QYXA 3MJCA 5DCWA 2BFPA 2XXJA 4FZWA 4JOTA 3QMJA 1PZGA 3EVNA 3OIGA 3PJFA 2X1HA 3T7CA 3IP3A 3Q0GA 3BZUA 4OO3A 3AY7A 5CPBA 1AE1A 2GRAA 1U3UA 1BXGA 3D4OA 1FK8A 3Q0EA 1E3WB 2CDAA 4U8GA 1DXYA 3ST9A 3KTIA 1A71A 4KUHA 1DJQA 5FI3A 3CMCO 1MC4A 3UF0A 4U19A 4YJDA 4C7KA 4NNJA 1HETA 5A5FA 5BSHA 3V5NA 1Z7BA 4QFEA 5IDXA 2PTGA 4YAIA 1C0LA 2VSUF 4CMEA 5I9MA 1PGPA 2DBRA 4PLYA 1QYCA 5DP2A 5G0SA 4A7PA 3PJGA 2PD6A 3RJ5A 1G0NA 1IHYA 4IY1A 2JCYA 2UYYA 3RROA 4U0HA 3JYNA 1H2HA 4B4WA 5DL1A 4ZA2A 1M6WA 4WLUA 1Y1PA 1MUUA 3ABIA 3LT1A 4G5HA 4MDHA 1ISIA 1CQIA 2B37A 1N9GA 1E7WA 1V3TA 3MOGA 5JDIC 3H2ZA 1DAOA 2O7SA 4MIOA 3TVWA 2DTXA 2DFDA 1U7HA 2GERA 4IDGA 2LDXA 4PZDA 1LNQA 4NR0A 4DBZA 3LSYA 3LT0A 4RPKA 5TRTA 4OQYA 5BT9A 1EDOA 2WDZA 3C1OA 2VCYA 3TJRA 4GHNA 3RC2A 3S2GA 4W7IA 3N6RB 4FSHA 1N9GB 5IZCC 1PGQA 3D3EA 1ON9A 1Q7CA 2FN7A 3QE3A 1O95A 2FPIA 1HYHA 3TWOA 2AW5A 4YYZA 3TSCA 1P0CA 3ZWAA 4JBGA 4NFHA 1F8FA 5TLSA 3WWYA 1DLJA 1PJSA 1SBYA 4UUOA 2ZQZA 4R4JA 1JXZA 3HN2A 3JD1A 3U9RB 3GDFA 5L4LA 2FHSA 2XXBA 4MKZA 3RUHA 1ZUD1 1VM6A 2O7QA 1MFZA 3I23A 3P7MA 1PWXA 1P33A 1RM5A 4ZQHA 1ENPA 1R6DA 1E1NA 2D4AA 2DT5A 4DUPA 1E3WA 1DFHA 1EUCA 1K32A 1PGOA 3WNQA 4BKOA 4U18A 2HMUA 2PGDA 3QW2A 1Q0QA 3INRA 4L75A 2PH5A 4YQYA 1ZSVA 2QZ9A 4MVJM 3QVXA 1HT0A 3TT6A 1DFIA 1KEPA 1T2CA 5L4SA 4TROA 3ZI0A 3EHEA 5LDGA 1N6FA 3V5IA 5EQDA 3ASUA 3C7CB 1KVRA 2VTDA 3LC7O 1NP3A 2VNAA 3PWSA 1XELA 1XGKA 4B4OA 5JC1A 2WM3A 3U5TA 5A9SB 4JCRA 2IXAA 1DJNA 1M67A 3QWIA 5FYDA 1RWBA 3ITKA 1BXGB 1XU7A 3Q11A 4NBVA 4R51A 2X58A 4ZQFA 2X0IA 4OYRA 2CF6A 3E18A 2OFPA 2YDYA 1E5LA 5DOZA 1GTMA 1YBVA 4UVGA 4H7PA 4BNIA 3ULKA 5ENVA 4EZBA 4EDFA 5JDIA 2OP1A 4XYGA 5AXCA 1ZO8A 1ZXBA 4ND5A 3Q0JA 2JFHA 2VYNA 1E3EA 1HDXA 1U4SA 1C1XA 2PZMA 5JCJD 4QEDA 3C85A 3BF0A 1Z82A 3M6IA 1DC5A 3GMAA 3MWDB 3U49A 5I8WA 2VUTA 1YG8A 1EEHA 1UYSA 1X0UA 1ADFA 2ZB3A 3AM4A 3TF5A 3BA1A 3L6OO 2FP4A 3DFZA 3OEYA 3MT6A 4N5LA 1GCOA 1GPDG 3T7EA 1DBVO 4IXTA 4U0JA 1Z75A 4CPDA 5B4UA 1NAHA 2AQ8A 3KRTA 2RIRA 3E82A 1RPNA 3ZV6A 5I9LA 2X4GA 3HG7A 2A4KA 4ZDEA 4B3HA 1UUFA 4ELWA 4OXKA 2NM0A 1YG6A 1LA2A 3ZWPA 2F6QA 1OC4A 2DU8A 2EKPA 2PZJA 4YAKA 1QXSA 4J1TA 1GUYA 3WYEA 4BL5A 3V1YA 5GMOA 4Q3DA 3ETDA 1Z6ZA 4D41A 4DYDA 2B69A 4PG7A 1O9BA 1LQTA 2VSUE 4BNHA 4NK4A 2WYWA 2P91A 4NFSA 4XD2A 1ZSYA 3NV9A 2GN9A 1S7CA 4ALLA 9LDTA 1P1FA 1U3TA 4CMBA 1B15A 5L9AA 3G49A 3OC7A 3LK7A 4OXNA 2J5IA 3ENKA 1GQYA 1HSOA 4P4GA 4RDIA 3TN7A 4L6WA 1OC2A 1PS0A 4XB2A 2HDHA 5G1QA 4J43A 1VI2A 2P5YA 1HLDA 1PEDA 4QIJA 5AXAA 3AFMA 3INGA 2W4QA 1SC6A 1D1SA 4IDAA 3PYMA 1YDEA 3KTKA 3S1LA 3TDCA 3ZHXA 4EUEA 3H9GA 2Z1MA 3ETGA 4ALNA 4M86A 4EUHA 3TLFA 3IAHA 1Y6JA 1YWGO 1TT7A 4TZTA 1LU9A 1H5QA 3DHNA 2DBZA 4OAQA 1U2DA 4W82A 3G79A 5DN9A 1LDEA 4KQWA 5DULA 4BO4A 4ITUA 4CUZA 3G64A 1WZ8A 3MOIA 3JYLA 1MA0A 4OKNA 4R69A 5EN4A 4EUFA 1LRJA 4FFOA 2GCGA 3KLPX 1K89A 4LK5A 4MVJI 4ZU3A 1U4OA 4E2XA 4U5QA 2X23A 3BMOB 1UP4A 4FN4A 4GMFA 1LX6A 2HCTA 3VPFA 2PK3A 4DRYA 3DBRA 4ZQGA 1I3NA 2Y67A 1T24A 1NHGA 4MP6A 4NK5A 1DRWA 1DEHA 4K6FA 4BO2A 5INGA 2CVOA 2WJPA 4XWYA 4CQLA 8ADHA 4WLOA 5JNLA 2Z5LA 1QORA 2PGJA 3GUYA 3KQFA 5G1SA 2PA3A 4GBJA 3JSAA 1QLHA 3G1TA 4CV2A 1UH5A 1WDMA 1E7RA 1NHWA 3PDJA 1EDZA 3OQ1A 3VH4A 3ZV3A 3VKVA 1PIXA 4CLRA 3MTGA 3GDGA 4C4OA 4YRDA 3D64A 1WXDA 3E9MA 1IL0A 4HKTA 4MIEA 1B2LA 1PU2A 2AA3A 3L9WA 4CLOA 1RM3A 3OQBA 3BTUA 4TRRA 3QVTA 1X14A 2D59A 2OXIA 1HTBA 2G76A 4KZPA 4DC1A 4IQ8A 3OF2A 1V0JA 3FWNA 4LMPA 4TSKA 4UUMA 2Q35A 1C0KA 5FUSA 4WEQA 2NTVA 1X13A 2H1SA 3HNPA 1KS9A 4RV9A 1Z45A 1YQDA 4YJHA 3V8BA 3WFIA 3I47A 1PWZA 4BV9A 4JBHA 3JQBC 4CV0A 4TQGA 3JQAB 4BV8A 5IFLA 2PV7A 2C5EA 3GEMA 1R4NB 5JBXA 4BNWA 4DVJA 3QYRA 2B4QA 3HRXA 5TJHA 4XQ9A 1H0KA 4TRNA 3WS7A 1DIAA 4GKBA 3VTFA 3GZNA 4PIVA 3I52A 3JQCA 4AJKA 3ZNNA 5ER9A 1P31A 1UXGA 1C1DB 4FW8A 1G1AA 1W4ZA 5A5EA 3MZ0A 4OJNA 1P9LA 3OIDA 1C0IA 2QIOA 6LDHA 1I32A 3WYBA 3GFBA 3H65A 4J49A 2Q46A 1GL3A 2EWMA 3G0OA 4XR4A 1PR9A 4E0BA 2D8AA 2HMTA 2ZYGA 5COBA 4FFPA 1NQOA 3GNQA 2XPCA 2DUBA 4RJTA 4YB8A 1Y5MA 4Y9DA 1EK5A 1FDWA 1VJ1A 3M1LA 3WYCA 1N6DA 3HDYA 3H5NA 1EF9A 2P2SA 1B14A 2YFHA 2IZ1A 5MDHA 4UULA 3MYBA 3OJFA 2P4HX 3K31A 5DBFA 3KSZO 5T6BA 4PFJA 5T5QA 2X6TA 4NJMA 2OBYA 3GHYA 4LVCA 5B1YA 5KVVA 3JQFC 4F46A 3GDOA 1LRKA 2RAFA 1OZAA 2O50A 3ZWVA 2YYYA 5BSGA 4G2RA 3NT2A 3R9QA 4ALIA 2ZB7A 4GWKA 1YOVB 3QLJA 4E21A 2ZL3A 3L9XA 1GPJA 3GFGA 4UVDA 5ICMA 1HDZA 2BFMA 2CD9A 2PNFA 3ADOA 5E0SA 4AVYA 4NG5A 5EQFA 1D8AA 2P9EA 3B20A 1GUFA 4DQUA 3BPPA 4LRTB 4LSMA 4HFMA 1VLLA 4IIUA 3NKLA 4D0SA 2ZQQA 1P1JA 2DM6A 1J7XA 1XNWA 3DHYA 3OM9A 3NJ8A 3GF3A 3H0SA 4IZBA 1T26A 3C7AA 3ANLA 1N7HA 2BKAA 3CIFA 3E9NA 3OFSA 1M2WA 3QVWA 4OMUA 3I1JA 3VDQA 3UAGA 2YW9A 4W99A 4BNVA 2X22A 2V6FA 4Q9NA 3V2HA 5BR7A 4WNIA 4D43A 3QSGA 4D42A 4D7AA 2E82A 1F14A 4GM2A 4ZU2A 5C9GA 1AXGA 2Q50A 4LSWA 4J7CA 4FB5A 4FQ8A 1SOVA 1ZJZA 4AJ4A 2C29D 4HWKA 2WWRA 4JJGA 4U6SA 3U0BA 4CJXA 4P22A 2J3HA 1EBUA 2VWHA 1OMOA 3EZYA 4NHEA 5I7FA 4M8SA 1DC6A 4MVJD 4PG6A 1HZZA 4BNYA 2DC1A 2Y1EA 3O38A 4I52A 1O89A 4OL9A 4LGVA 3PVZA 4WLNA 1FDSA 2VWQA 5ILGA 3SLLA 1H94A 4P38A 5C3MA 7MDHA 1NQTA 1XX4A 3H9EO 4JP3A 3ZHBA 2DPHA 3W4IA 5JBIA 1PS8A 4J4HA 1JWBB 4ND2A 3WIEA 2X8LA 4B4UA 5DF1A 4IJKA 4HV4A 3RUFA 3UICA 3AI2A 2EJWA 2YQ4A 1YL6A 3PQEA 4YA6A 3VHRA 4LW8A 2HLPA 5DCYA 3QY9A 2UUPA 2X0NA 2GPTA 3GF7A 1JTVA 2HMSA 2Y0DA 2AEJA 4AJOA 3WGZA 5JYEA 1ZH8A 2HAEA 4IJUA 1CEQA 4IMPA 3S55A 3D7LA 3HINA 3GGPA 4N18A 4R54A 2EF1A 4DIFA 1Q7BA 2FBMA 3UXYA 4L4RA 5ILOA 1N2SA 3JV7A 3LU1A 2Y66A 3W1VA 5CDUA 4ZDFA 2CZCA 4Z0TA 2NU9A 5IKLB 1UYRA 4QO7A 5IDQA 5ES3A 1BSVA 3FPCA 2IODA 3FTNA 3OQ6A 3ST7A 4WKGA 4BGVA 3IIEA 5A3JA 5G0TA 3STHA 2GN8A 3F4LA 3ICPA 4I9HA 4DC0A 4XYLA 3VPGA 5C7IO 3BMOA 4IM7A 4CMIB 2Y99A 3TV5A 1V35A 1QP8A 5B12A 3O9ZA 4URFA 3R9TA 3HB5X 4WCDA 2EJVA 4YVFA 3U9SB 4IDFA 2BGLA 2X86A 1ORRA 1WWKA 1LLQA 2DBQA 2FR1A 1DDOA 1KEWA 1O0SA 2AXQA 3LC2O 2BI8A 3ON5A 1LSOA 4PCVA 4RLHA 2GN6A 4GX1A 4BNMA 5A9RA 1B8PA 3FPLA 3LF1A 1HE3A 5K6AA 1K2WA 2AMFA 3ZU5A 1CETA 2ZJ1A 1GADO 1FF9A 1R37A 5JY6A 4FGSA 2DEOA 5HS6A 3WNVA 1HSZA 2W2KA 1Z7EA 2BGMA 1IE3A 4D45A 2VUUA 3K30A 1JKJA 2Q34A 1KC3A 4ZVVA 5IXYA 4J9UE 3RCBA 3V5EA 4M87A 4PG4A 2BMAA 4RPHA 3GMSA 4KPKA 2JKVA 4F6LA 3Q1TA 3TZKA 3GRPA 4YAJA 3RD5A 3BYZA 4IZIA 4UUPA 3PIIA 4PLGA 3A9WA 4B7CA 3OICA 2DLDA 5L3ZA 1ZXLA 2NTNA 3WR5A 5K0ZA 3T8BA 3DWFA 3U9LA 4NBUA 4RLSA 5DU8A 4R3WA 3BMCA 1E3IA 5KVSA 1ADBA 2BHLA 2NUAA 4YTEA 1DUBA 4BB5A 2YZ7A 2Z1NA 3MWEB 4E32A 3SLKA 3DZIA 2HRBA 2GR9A 4DGSA 2VZ8A 4K9DA 2NU8A 2FOIA 3SVTA 3NT5A 1KETA 1R66A 3RUDA 3PWZA 4FD3A 1YBAA 2GSDA 1VL8A 3T8AA 3QREA 4OIMA 2PD3A 1X7HA 1YRLA 2OZPA 2Y68A 4IQ0A 4TKMA 1MC5A 2A9FA 2HU2A 2VHZA 1J5PA 3HWRA 5FIFA 2J5KA 4XQGA 5G0VA 1H9BA 3TZHA 4A73A 1UYTA 2WEKA 2YDXA 4YRBA 1K6IA 1BW9A 3AU9A 3H6KA 4RVDA 5ICSA 1ZK3A 2VYND 1A9ZA 3PYXA 3BMNB 2GGSA 2P5UA 4BMNA 1H6BA 1QSGA 4CM7A 5I7EA 3F47A 4WNCA 4R9SA 2UZFA 4Z9XA 3ZN2A 2J5QA 2B4TO 4KUEA 1JAXA 2GUGA 1ULSA 4JROA 3E1KA 1ISMA 2X5JO 1GZ3A 5CPFA 4BVAA 1KEVA 3ZW9A 5A9SA 2VZ9A 2EHDA 2H63A 2RCYA 4KTTE 3RSIA 4IDEA 2O3TA 3ZDFA 2BH9A 2BFOA 3IL2A 5A04A 1KVSA 1YVEI 1VKNA 2NU7A 1ZVMA 4BMVA 2IZZA 4J0FA 2EERA 4XA8A 1GDHA 4FN8A 3VZSA 1FMCA 4W9NC 1I2BA 4B8WA 1EUDA 2JCVA 4ZRMA 1M66A 2B83A 2VRCD 4MJLA 4E3ZA 1NPTO 2DAPA 3NUGA 1DIHA 3KLMX 2F9YB 1HF3A 3TL3A 2Y1CA 1J4AA 2ZJ0A 3NGLA 1E77A 1GR0A 1TLTA 1ZZEA 4YJGA 1K0UA 4FC7A 5CFZA 2ZYDA 4E33A 3GA0A 5CAEA 1T1RA 3QXIA 1XHLA 2IDZA 1GZ4A 1IOLA 3SC4A 3RC9A 2E4AA 4AJJA 4EJ6A 5EESA 4K29A 5U9CA 3TRIA 1QV6A 1XLTA 2GNAA 3CPSA 1H6AA 6ADHA 4S1VA 3KM0A 1XQ6A 3IUSA 3JQEA 2X0JA 1HNUA 1XU9A 4NEKA 3I4FA 1FC9A 2Z95A 2JHFA 1TA4A 2B5VA 5JXWA 2DBVO 1NWHA 3GUCA 4CMJA 3TZ3A 1EFLA 4RO0A 4KD6A 3OJEA 2OOSA 4GI2A 4NBWA 5T8KC 1L1FA 4BNKA 1JKIA 4RVSA 3EAGA 1E6UA 1A4UA 5L51A 4BGIA 4BO1A 4UREA 4MPDA 1C0PA 2NVUA 4E31A 3WGIA 3WICA 1KY4A 1Y81A 3E6AA 1X1TA 5T64A 2RH8A 1PJQA 2VSSE 3GT0A 1SNYA 3I5MA 1BDMA 3LLVA 3MOYA 3TOZA 1CF2O 3PI7A 3X2EA 1VRGA 1FDUA 3OHSX 3U4DA 3HN7A 4YT2A 2F9YA 4P4NA 4YEDA 1OD2A 4NZ9A 1Z73A 3MFMA 4HUJA 1LDGA 2R00C 3FSRA 2C07A 4JP2A 5DUFA 4L73A 4L4XA 5KCZA 2B5WA 3A06A 3NEPX 4MKXA 3ZV4A 2QG4A 3P5SA 4NJOA 1P45A 4IGEA 1NFRA 3JQ7A 4WJZA 4WEOA 3NGXA 1Y8RB 2FPPA 1PQWA 2Y0CA 5EIOA 5A06A 2ILTA 3FNGA 3NJ4A 2LDBA 2AHRA 3W8FA 4AJLA 3QP9A 1IPEA 3KYDA 4NU6A 5DBIA 3ZWXA 1E7QA 4YPOA 5CG1A 3R9SA 2VOJA 4KDFA 4W9NA 4N7RA 2Y1OA 3AUAA 1J49A 1PX0A 1R4MA 3VAZA 2QRKA 3KYCA 5F21A 3WG9A 5I7VA 4AJNA 2NP9A 3JQ6A 4DLAA 2PR2A 3AOEC 3HHPA 3VOSA 3PQDA 3AUUA 4NBRA 1EF8A 3C3XA 3U09A 2TMDA 3KB6A 4LRSB 1V8BA 1O5IA 4Q3AA 3TPCA 4WYOB 4CM8B 2NTJA 4IZDA 3GG2A 4CR6A 2Q1TA 3DQPA 5H82A 4DIOA 2PG8A 3NTRA 2AG5A 5HTOA 4HNGA 4CL3A 1EVJA 3TT7A 1DLIA 3UOGA 1I10A 2BD0A 5TT1A 1FDVA 3DEYX 5KWEA 1HDRA 3HADA 3MJVA 3RFXA 3M2TA 4ZRNA 4XCVA 3PIDA 3OECA 4RVUA 5DZSA 3WB9A 2UV8A 5JBWA 5BSFA 3COSA 4QSMA 3I4CA 2EJ5A 1WMBA 1TXGA 5ITWA 2AQKA 3GRKA 4RZHA 4CM6A 3QVSA 3RUCA 1Y8RA 5T57A 3GMDA 5CEEA 4ELXA 3K8XA 3C1TA 5E0NX 1VJTA 1I3LA 1GV1A 3JU1A 3PHHA 2I76A 2ZL4A 3R0OA 3WWZA 4P4LA 4RVGA 3T3WA 1EZ4A 4XDYA 3ZWNA 1ZKMA 3OP4A 3ZWOA 3KTDA 4O59O 4Y98A 3ROQA 1LEHA 2VRBA 3FI9A 4I08A 1DHRA 4U0KA 4HX5A 1WMAA 4JWVA 5EPOA 1ADGA 5DUCA 1GEGA 4BKQA 2WTBA 1BHSA 2IEBA 4RYFH 1OBFO 1UZNA 3QXZA 2VHVA 3GGGA 4RF5A 1X15A 3PTZA 4GVLA 3RFVA 4MXIA 4WK6A 1CRWG 1PZEA 2BI7A 4TVOA 1MG5A 1CWUA 3GH3A 4MINA 2NVUB 1YE3A 1Y8QB 4AICA 1T4DA 2D5CA 3PXXA 1DSSG 3NYWA 5G4KA 4LCJA 5TSDA 3JCZA 4ND3A 2W2KB 4FJ1A 2EP7A 2HQ1A 4MP3A 3I83A 5A03A 1P1KA 1QV7A 1P1RA 4MO2A 1YXMA 5FF9A 4GGOA 2Q4BA 3JQDA 2DQ4A 3PLRA 5TQVA 5I9NA 3NDRA 3QWFA 2NQTA 3C1AA 1E0DA 4IS2A 1PJ2A 5L45A 1Q51A 1LJ8A 4DBVO 3AOEA 2D1YA 3VIVA 1I33A 3GZNB 1HYGA 3PPIA 1PJBA 4DPLA 1XO6A 1YJ8A 4FS3A 4G2NA 4ND4A 2ZK7A 3OETA 2BZRA 4L8KA 1ONOA 1NAIA 4U7WA 4PG5A 4FZWC 4BO7A 2HRZA 3AK4A 4QUKA 3DZHA 4E13A 1E3LA 2PY6A 4JYJA 4CLEA 4DYVA 2VSUC 3L4SO 1HDYA 5JCJA 3JQAA 3RC1A 3KOUA 4Z6KA 3W6ZA 3GNSA 3AM5A 3MCVA 3V1TC 4YJHB 2IRWA 3RASA 1DIGA 1U1IA 3I3OA 3RVDA 3VH2A 3TL2A 1RM0A 1HL3A 2PZLA 3LZ6A 3DHEA 4RPGA 4E2YA 1Q52A 4GPD1 3WTBA 2RBEA 3LKEA 1PQUA 2B0JA 4WGGA 2JFGA 3LDHA 1UDBA 4Q3NA 4R1SA 5THQA 2V6BA 3DZFA 2D2IA 5A3VA 1X0VA 3CUKA 3H9QA 3I9JA 4NH4A 1Q1NA 2EV9A 3F5SA 5MGBA 3E03A 1KY5A 3L4BC 4II2A 3R6DA 3INTA 3JQ8A 2W90A 2YY7A 1HKUA 2EG9A 5ADHA 5BQFA 2W98A 1N7GA 1KIFA 1I01A 2ZATA 1H6DA 4F3YA 5L95A 3VKUA 3PE8A 2O2YA 3IUPA 1XNYA 3EMKA 3L6EA 4BNFA 3HJAA 5THKA 5GZ1A 3GOHA 4XJSA 3DBVO 1BGVA 2YJZA 3E8XA 1F17A 1UXIA 4XX0A 4A03A 2WD7A 3HB4X 4A0SA 1R16A 3HZZA 1W2XA 3DJAA 3KTHA 4AJIA 5F1OA 4I5FA 4RPJA 3ZWYA 2QW8A 3Q7HA 3U3XA 3K9QO 1X1EA 4UAGA 1K5HA 2NNLD 3KO8A 2E6UX 4MOUA 5L7YA 1ZEMA 2F6IA 3G1UA 1NZYB 1GUZA 4NU5A 4D44A 2E48A 5JY1A 1BMDA 2NVWA 4W6ZA 4BMSA 1G0OA 4ZQBA 1MP0A 1PZHA 4BNUA 1OAAA 2OO5A 2F9IB 5G0WA 1F12A 2TMGA 2CDBA 1AHHA 3IOYA 2V6MA 3KEQA 4DA9A 3JD0A 3H0QA 1YKFA 4FFNA 2VOEA 1ADCA 1Q7GA 1PL7A 3NX4A 2J8ZA 1IY8A 3Q9NA 2QYSA 3OBBA 3FR7A 3DMTA 1XKQA 2VREA 4PLWA 4XYEA 3PJEA 1UR5A 4EJMA 4DPMA 1DRVA 3DDNA 3H0UA 5DZKA 4ZQEA 4XZ3A 1LDBA 2OUIA 1JN0A 3F9IA 3DTTA 2X9VA 5HBRA 1K39A 5FI5A 4IJWA 3B70A 1KOLA 1W6UA 1GCUA 3L0DA 3WGQA 2O4CA 2NSDA 5TC4A 3DMYA 3IDSA 2HK9A 4J7XA 4YRAA 2Y1GA 2Q2WA 1TT5A 3KSDO 4BKRA 4XQEA 1T2FA 3IMFA 4ILKA 3WQSB 5IZ4A 3VTZA 2BRUA 3PZRA 4ALMA 3SJUA 5AQ1A 2WYVA 2JD1A 1IHXA 2EW2A 4AJ1A 3ANMA 2A7SA 4XYMA 1V9LA 1T2AA 1ML3A 1E7YA 4YT4A 2J5RA 4FFLA 3BTVA 1VKOA 1PIWA
chains in the Genus database with same CATH superfamily
4U2DA 5FOQA 1Q5PA 3AR6A 4FFDA 1FMTA 4FE4A 4Q00A 3VNSA 3ZU2A 5GZ3A 5BW4A 4OBWA 3VHQA 4I5DA 2JAPA 2ZCJA 3ES9A 2I78A 5JISA 3BJEA 2Y1WA 5EFZA 3IJPA 3T3DA 3VR5H 1J1UA 4IH9A 1ZM2A 3DZKA 3HDHA 1FC0A 4ZANA 4PWZA 1QE3A 1CUDA 1XPUA 1C8LA 2J3JA 3HRIA 3U6KA 5KVCA 2GPWA 4PSVA 2XCQA 4RABA 1N1GA 2XCOA 4XX0B 4YO7A 3WTCA 1E6LA 1R4NA 4AF8A 1WV1A 2I6GA 4BZWA 2BTEA 4F6RB 1YB4A 5EKUA 3JU3A 5FH9A 1FMFA 3KJFA 5DTPA 1II0A 3HYLA 1LNSA 2ZKIA 1IEVA 4L27A 3HCDA 5BYBA 5BOSB 1YZLA 2CXOA 4ECEA 5F12A 2PGIA 3UV7A 4FUQA 3ZIAA 1FFCA 4WADA 2O8VA 4NV3A 3A1VA 2G07A 1GPKA 2VWPA 1U5AA 3TVUA 2HXSA 3EVGA 1O8CA 1NU8A 3AF3A 2PMKA 4QQ8A 4URHA 3IRUA 5I7WA 3JQ9A 5JC8A 3GUUA 4OH1A 4B6OA 3I9OA 4RENA 1TQDA 1QHNA 1XVLA 1T1JA 1XZDA 5M29A 2XRZA 2RGYA 5DDIP 2XWJI 1HFEL 5JAUA 2VK4A 2O3UA 5A5GA 1H3EA 4R9VA 3QXSA 1LC3A 1A9QA 1H93A 2QK4A 1VXRA 3RS0A 2QLTA 3CEPB 5CK5A 3QG1A 1NPYA 2FZWA 3GI1A 1KL7A 4LDZA 3G13A 4MB6A 3OD1A 3T7TA 2OGUA 5D86A 1ZIOA 1RYZA 3S5UA 2ZT6A 1ZINA 4QXMA 1N3YA 1TK9A 3BH0A 1HM5A 1UBCA 4PLZA 4CODB 1QS0B 2BEUA 2AE1A 2Y1DA 5AWFC 3HE3A 2D1RA 2EJTA 3RFFA 3KCNA 3IPRA 1H4VB 1PK9A 1FFSA 3RRBA 1XN1A 1YVDA 3U4MA 3K8OE 2O2SA 4GQBA 3UG7A 4KPEC 2AEFA 3TLGB 2AC2A 3S6JA 2DETA 3GJ5A 3SQNA 3AH8A 5J4YA 2Q8NA 4P92A 4R01A 13PKA 3I2IA 2BC9A 3C8ZA 3QOWA 3OESA 3RRZA 2BRUC 1PE0A 2DSTA 3L7JA 4JJ4A 2OBBA 1PDVA 1OFGA 2NACA 5EIAA 4LISA 3TLCA 1RRGA 3GB9A 4G23A 1EP9A 3RYHB 1V8FA 1ODIA 4HLQB 4QX6A 3W4KA 4Q01A 4QUHA 3RIMA 1Y1LA 1OXSC 3ELUA 4L0DA 5CB6A 4NZPA 1J2JA 5I7AA 3IP1A 5K0GA 4TSFD 5E2IA 1DWQA 4TYYA 4JOBA 3IAVA 1PNVA 2PAAA 3D3QA 3FROA 3JVIA 4DI1A 1QK5A 3OJCA 2YXNA 4WJLA 3R6LA 4B80A 3FDJA 5LWQA 4I5IA 3ME5A 4MWOA 4HWSA 1CBUA 5HP4A 2Z04A 3WISA 3IBFA 1V39A 2CNLA 1B8OA 3KB2A 4PZYA 5C8DA 4C2UA 1XWWA 2ODBA 4BPBA 1A7JA 3RS5A 5DKFA 1U31A 3T5TA 1L4HA 1CLUA 3C8MA 5J4LA 4ROSA 4HDNB 3SWWA 3RW9A 1RWKA 4JXZA 1OZHA 1MG0A 2G06A 3SF8A 4GX0A 3KTAB 2MTBA 4CL8A 4AN0A 3WG5A 1OI4A 3ID6C 2JLVA 2Z43A 1J8QA 2X41A 2FSVA 1WNTA 1D1QA 3VYSB 5JRZA 4N40A 3B1FA 1QH8A 2PX2A 4CV1A 3KBBA 2ZSUA 2PQ0A 1YCHA 2KBEA 4WQMA 2C2WA 3P2MA 1Z5VA 1CY2A 1UFQA 3PIRA 1WV0A 4OU4A 4AZTA 1CE8B 1OI7A 4J8PA 4NKRA 1XIVA 1F0YA 1E99A 1PYGA 4OLHA 3IE0A 3R0IA 1Q1AA 3CH4B 4DRXB 1YL5A 2Q9UA 1P4RA 3H5OA 3WYAA 4JNKA 4IX9A 4M0EA 1M34B 3OA2A 2W6JD 2J3DA 4BP9A 1FJGB 1DAPA 2B8JA 2GZMA 4WOKA 1AGYA 1M8KA 2O2CA 3SCZA 3DLBA 1ZSNA 5IN5A 1ZWKA 2EARA 2A0UA 5JW6A 4TMVA 1QH1A 4GU5A 3PYLA 4BQEA 3U7RA 4XXHA 5K6TA 3WQBA 1YI1A 1GA6A 1T13A 4AKEA 2UYHA 2ZS9A 3A2MA 5WRFA 1S5PA 2GPAA 2NO4A 5CCXA 1FBNA 2YJ5A 1RWXA 3JZFA 3WV5A 2GN2A 1NXQA 1CP3A 4AMVA 4JQYA 1O8BA 1NZYB 2AIRA 2F59A 3U3RA 5LA6F 3PC8C 1JMYA 1CUHA 2EDAA 4MV7A 2ZXUA 1NMQA 4EEZA 4JHXA 3Q1KA 4TTTS 4U2CA 1Z37A 4RWZA 2LCQA 4CN9A 5BO5A 1OFTA 2BFFA 1XMIA 3ZW8A 2FR0A 4L5YA 4NV1A 3WAGA 1NYTA 3HNRA 1NBEA 1NVVQ 3PK0A 2JFWA 4WCFB 4AYTA 4FOOA 1ENYA 3DEFA 1EBFA 2C2OA 2NPOA 2X7XA 3FSEA 3T06B 4UTVA 4KQ2A 5LP1A 2XCSB 5FXMA 3ED1A 2FP4B 1O94A 1YE5A 3AKCA 2RBGA 2Z56A 4ID3A 1A04A 1E3JA 2EWVA 2Z8ZA 3O1JC 2HNBA 1JIKA 1RKXA 2WTNA 4MIYA 2QJWA 5EXXA 4P8RA 5EMNA 1TRHA 4N76A 2JCGA 1E9DA 1WVGA 2REQB 2GRUA 3D1JA 3F3KA 1XDGA 1EEXB 2X8BA 4KYVA 4REQB 4ME6A 3EXG1 5C5EA 1IB6A 3EC7A 3LVFO 5I4BA 3OQIB 1HE5A 2J7KA 1ETUA 2EKQA 3CUSA 2XDWA 1MAHA 3P0IA 1XOIA 2XBMA 2RHHA 1HY3A 2O4UX 2XMGA 3PVSA 4JT9A 1SO8A 1JQ5A 1ZW6A 2YC2C 4KNVA 3DYIA 2NQ8A 2R6DA 5SZJA 1WCV1 4F2PA 2GM4A 2Z09A 3T4UA 1Z6AA 2UZAA 5FFFA 3EXIB 1MV8A 5K3BA 1TZMA 2UDPA 3WKAA 4AMUA 5EL0A 3UIEA 4KGVA 1C8VB 1I1QB 3CPEA 3LHKA 1FTWA 2QUBA 3L79A 4A10A 5JCZA 4FLMA 5GZ6A 1YRYE 1T1SA 5CJ2A 2UUAB 2NQ2C 3CH6A 3EWAA 3PCTA 2YN2A 1HT3A 1UC4B 5EVJA 2H9IA 1ZN7A 2Q6LA 1IIRA 5E6UB 1F8XA 4IF4A 3RAPR 3OLXA 5EUQB 1T3TA 4M0LA 5BN3B 1TM5E 1TW2A 4G65A 1EMDA 2IEAA 1RMTA 1QR6A 4EBFA 3WLQA 3TQCA 2C7VA 1YH3A 1KMNA 1OGJA 2OORA 4UTZA 4R2KA 2EYQA 2V1UA 4NPAA 3D6MA 2HRQA 3P2KA 3RU7A 2G5GX 2DWPA 4PLTA 1VIAA 3Q3CA 2R4UA 1LQUA 3F98A 4PY2A 2QNIA 3L6BA 3PT5A 3UMCA 1JFTA 1TG6A 2VKTA 4RKRA 3QVGB 1OX4B 2FPIB 1U7TA 1AMNA 4P0TA 4EB6B 1T2VA 2ZIEA 3GLUA 1EVQA 3M5WA 1E2KA 4TUYA 3Q2IA 1ZPDA 5JT1A 3LPMA 1FSZA 1KYZA 3X1WA 4C7OA 4Y18A 2IYRA 2VDRB 5L3SB 1OJ7A 4KPGA 1UXHA 3L3SA 1NSTA 1D2EA 1U7OA 2OP0A 3KDSE 3HSKA 4OI1A 3RVJA 2VUHB 2ZTVA 4EHAA 4M4SA 3LVBA 3I09A 4NQZA 5KTPA 2XMCA 3A6JA 4FMBB 3I34X 4EJSA 1JILA 4W63A 1P7CA 1RSZA 4EG7A 5DNYB 3DYVA 2YS6A 5CB4F 3BERA 2H29A 4UHHA 2VCHA 4GSKA 4LY3A 1P77A 2V4UA 1LLUA 2ASVA 2APJA 2Z8YA 5I8ZA 3UFXA 4ZO8A 3HTXA 1H9CA 1FJHA 3SY8A 4U0GA 1P3DA 5TF0A 3RV4A 1I7QB 1BXKA 1H2EA 3RVKA 4CM9D 4I55F 3TVDA 1T5IA 3A4VA 4LF8B 5H83A 5DV9A 1FTYA 3B6KA 2O3SA 2HJGA 4G3XA 2PUBA 1JG6A 1TT5B 2PCLA 3EEBA 2HCBA 2HFJA 2X6QA 3UJ3X 3ELYA 4HDMB 4EGFA 1W96A 3JQFA 4D3FA 1W73A 2VHJA 3JQPA 5H5JA 4EG5A 3ZS9A 4I4IA 4OOFA 1Y7LA 3U4QB 3R40A 4AX4A 3A25A 4PHCA 3W5DA 1V3VA 2Q2NA 1N6OA 2QPAA 2E4YA 1RAHA 4G9EA 3BX1A 4KQMA 2QYOA 3TSWA 4C4PA 2Q6VA 1C14A 4ER6A 4UKDA 2HMVA 4YGXB 3BJRA 4JQCA 1NJ1A 4NF2A 1IZYA 4PEVA 4WT7A 4TYMA 5HZMA 2XKAA 4Z7OB 3CYFA 4W5HA 3A4MA 4ZOLA 4XH9B 3WDMA 4EFKA 4MW4A 1ZMRA 4UQLA 5A05A 5L4NA 1ZMOA 4G25A 6REQA 4P34A 2W6CX 3OE7A 1H0HA 5TQ0A 1R1DA 3S0JA 1RAFA 4A2QA 1ZMTA 3SK0A 5IDWA 3LTNC 1XZCA 4JSRA 4UHJA 3VKWA 1PJ8A 4BLPA 4C43A 4YLHA 1Z8NA 2J0EA 2AF4C 5KOIA 1S3SA 4LXHA 3BVPA 1W93A 2BVNA 4IIVA 4DWOA 3FCCA 4F5EA 1NBOA 1RLJA 3CLTC 4QA9A 4RSMA 4WZ8B 1QTIA 1W1UA 3NBXX 3ACBA 4LTDA 3DV0B 1Q74A 1MDFA 7MHTA 3K0SA 4MW0A 1ULAA 5GIOE 3R1IA 2Y93A 1Q0LA 1ONNA 2ZJFA 4Z4GA 3RVLA 4WNYA 5JLJA 2A86A 4CKWA 1MB4A 1XVTA 3BGIA 3FN4A 3KALA 3BTSA 4M0PA 4F4UA 1L5OA 1RI4A 2OENG 4FNOA 4QPZA 4D4IA 2I3BA 1VJDA 2XE8A 5D84A 4DQVA 3C4JA 4QVGA 1MOSA 2F62A 3FPFA 3GCXA 3RNOA 1NPDA 3BFKA 2ETVA 4WAUA 2XB9A 5AIBA 1ZCJA 2RB5A 1NE2A 2GD1O 4GMXA 5CURA 3Q8XB 4D8WA 5HHTA 3RNLA 3L0OA 3DOFA 1K3FA 4JJIA 2WNSA 3MT0A 5EYPA 3AFHA 1JA9A 3LDAA 1MEEA 3LWNA 2HQBA 1TYEB 3Q5GA 3FUUA 1LPOA 4H7JA 1G41A 1Y4ZA 2WSBA 4IPTA 4NYMR 4Q34A 2CZGA 4Y2HA 3WWEA 3I6MA 4H35A 1GIAA 2FQYA 1BCRA 4NFYA 1SUIA 4FYKA 2VT2A 4JK3A 2ZT5A 3FNRA 4PYIA 1RJEA 3SSAA 4YT5A 3SEQA 1ZAYA 2IJGX 3N59A 1RAIA 4WXEA 3MK31 5AI9A 4EL0A 4JLMA 1KMQA 4B17A 1ZFNA 3IEIA 4AZ0A 3SC2A 1ZK2A 1NL3A 2WA1A 4JLUA 1IIBA 2GETA 4YY3B 2Y8EA 4U0GH 3PDHA 3QF4A 2FZLA 3U4QA 1HNOA 3AJ8A 4S12A 1P4JA 4HL6A 1PZXA 1W8DA 2ATVA 2AN1A 2ODEA 2ZBGA 3IQWA 2FMUA 3AJRA 3IT2A 1JDJA 3MYRA 4HDMA 4QBGB 5ED0A 1DUSA 4ELXA 5AI4A 1M76A 3R6HA 2WJ4A 2R7LA 3D2AA 3N9IA 4QXOA 5AKLA 3G0BA 5E7MA 2VTBA 1IUKA 5I3ZA 1EJ0A 1DG1G 4PXYA 2VSSA 3IP5A 4M1QA 2Q4EA 5F7ZA 1F1JA 5EP3A 4ZTZB 2AJDA 1XEXA 1Q77A 1UYVA 2B1RA 2ZUSA 1ZCBA 4Q18A 2A59A 3A1TA 3CX3A 3T41A 1F2DA 3GT7A 3ZCRA 3FJ1A 2NO5A 2PKQP 4IEIA 3TEJA 4BXOB 4X61A 1YULA 3PX7A 1P0FA 1UBJS 3D0QA 4DXHA 4N0EA 5AKGA 1XCPA 3GFTA 1EGVB 3GPDG 3RLIA 4UVHA 5C18A 5LZ2A 1RIIA 4JITA 3AO0B 2OZKA 4LQCA 5A2GA 1HEUA 1M6VB 4J3JA 3CCFA 3C87A 5FBKA 1ZCFA 2HK6A 3T0FA 4EGAA 1JFVA 5K99A 3PFGA 3FR8A 1GG8A 2AT1A 4ZZ1A 5H1YA 4IO1A 4AQ7A 4YMUA 2XUFA 3VR4H 2WPDA 2ECFA 4GXNA 2PSDA 4H7FA 3C3EA 3PGJA 2QTTA 2PKYX 4EI2A 2D7DA 3AZQA 3WQRA 3NCHA 1AZLA 4GR4A 4EEXA 3GWGA 5FIUA 5BUQA 3R7WB 1K98A 2L42A 3LT4A 1C3JA 3K9CA 3HVJA 3IAUA 5AKXA 1VP3A 3UC5A 4BMPB 1Q0SA 3WQQA 5I7SA 4Z9YA 3OCYA 1Y5RA 2AFIB 2H8KA 3ANYB 4P3PA 3KAPA 4AIRA 2BGUA 1DWPA 3ABSB 4QXRA 3ZCUA 1Q84A 4LK2A 1N0VC 3ZLJA 4ETNA 4RGBA 2Q6IA 3QUBA 1U6KA 4HJRA 3K0AB 4O8ZA 1X7DA 3EXIA 5GJWC 1Q15A 5I7UA 4XM0A 3JQQA 2DZDA 2K2WA 2WV7A 4I8DA 4DDVA 1YC5A 4GMKA 4OJKA 3WK6A 8MHTA 4ZDBA 3LRXA 3P19A 4TGLA 5M04A 4BMXA 1T4BA 2JAXA 3CN7A 1XRPA 1WZ2A 4FSDA 1PFYA 3RF6A 3DL0A 1P44A 1EQUA 1SMKA 1KFKB 1M0SA 1JHZA 2CFOA 4HSEA 3A4LA 3PGMA 5AUNB 3GLVA 3Q9UA 4I5GA 3JAKA 1LFAA 1XZNA 3CZAA 3W9YA 3RRMA 4ZIRB 3KE8A 3M5CA 4KR6A 4YRMA 5CHEA 5IBQA 4L8YA 4XJXA 3CTMA 3O4JA 1NF8A 4E6PA 1MFPA 4LSGA 2QTMA 5JO9A 1E8DA 2QR5A 3D5QA 4JB0A 5AM1A 1YTUA 4PRLA 4FYXA 4DA7A 4AF6A 4BE7B 3KJEA 3DOHA 4OOEA 5IWCA 3V1NA 2WZQA 2ZUBA 3FCUB 3HNOA 4YP6A 5LQRA 4LXTA 1W5BA 5L7TA 1PRYA 5I45A 2A35A 1IHDA 1ML4A 1U8UA 5LXTA 2O59A 5B4UA 1Q1BA 4TWJA 1VRWA 2H54A 2JFZA 3ZDXB 3UK2A 1QKJA 3ZI7A 3BSFA 1XVIA 3DBRB 2GX6A 2H1IA 2H1HA 4TQ9A 5HJEA 2EKLA 4Z0MA 3QTBA 1I4LD 4R1NA 4U63A 2YV4A 5TQ2B 4KK3A 1VQ1A 3GJSA 3HVUA 3W7BA 3OT6A 1KARA 5KC8A 2C99A 1I7DA 4WBNA 3OO0A 1S2NA 2C9MA 3N8KA 4YACA 1SIBE 5KWIA 3MN1A 4GVXA 4NATA 5DLEA 3W0LB 2GHTA 1EXNA 1PJAA 3A6GA 5CTAA 1C3LA 1XQVA 4CM9A 5D6OA 1NMYA 1NZJA 1Y9DA 2AZDA 4IDDA 2CNWA 3M3HA 3COVA 3A37A 3EPRA 1SVKA 3ND8A 1E3QA 1KKMA 1B8VA 1XRRA 3LQ2A 2VP6A 3MW8A 2XX3A 3WMXA 4DNFA 5BMOA 1GRVA 2JJ2D 2J5II 4R8KA 3CF2A 4FGLA 1F2VA 1EX1A 1N5DA 1YI0A 3EF3A 4HFJA 1NV9A 3D4PA 3F7MA 3SIXA 2YZGA 2C5FA 2Z5FA 3K0BA 3LX8A 4ND6A 3VNRA 4CKCA 1MXFA 2YWDA 4YWHA 2C7PA 1S89A 2V0NA 1N7JA 3BMQA 5E8JA 1YS1X 2OZEA 2PLAA 2P0EA 2IXDA 2LIPA 1HDGO 2QJFA 4JIMA 3LFTA 5SYNA 3RVMA 4Q47A 3W5VA 3MSCA 721PA 5IF3A 2Z2YA 1IHPA 4DCMA 1BOOA 1TYZA 3FBGA 3T1TA 1XKTA 2ZANA 2R00A 1GTZA 1XZKA 1ZGJA 2BM8A 3BCUA 4K81B 4XUGB 3TI9A 4M38A 4OSOA 1IH8A 2XWSA 4PQFA 1WJGA 5EKTA 2XQKA 3W5SA 4JUCA 3SF8B 1ESEA 2QMQA 3I9FA 4O5OA 4ZYVA 4KITB 3MTJA 4S04A 3GLIB 4QG7A 4I1SA 1OTXA 1CY6A 4ZDIA 1OAOC 5I9SA 1B16A 4I6EA 4BMCA 3ZBPA 1U5BA 2WB4A 4M76B 3L5OA 2FZ4A 2P0YA 2QRPA 4P58A 4YJ3F 1PJZA 4CMHA 4B84A 5E0SH 1J0XO 1J39A 1Z8FA 4JB2A 1Q3TA 5M2QA 1YE8A 4EYQA 5IKPA 2C2BA 2POQX 2WAOA 2NZ2A 2YRFA 2FVXA 3N74A 5IFKA 3JWGA 1GG5A 4NFLA 2O8CB 4RCZA 3EQ6A 1FX0A 4KV9A 3E7PA 4EI7A 1DTWA 5C5IA 3MS7A 2R60A 3BZWA 2IA5A 1K6MA 2XNJA 5G4LA 4LF4B 1E79D 1EK6A 1VFNA 1XL0A 1SB8A 4RK7A 1ZR2A 1OWMA 2BDUA 2QOEA 4W7SA 2VSSF 1CC1S 2FDXA 4TTRA 4BQQA 5EZ5A 2COEA 2OD7A 3R5TA 4YCSA 3BREA 4I9FA 4LJ4A 3TR0A 3FFWA 1XXHB 4B46A 3C8HA 2I7XA 1G63A 5CYFA 2M1XA 4F12A 2OCPA 2ISSD 2XGOA 1B3RA 1QB8A 2WVHA 3KUUA 4DFDA 3T5PA 2FSHA 1BQ3A 3AR5A 3CN9A 3E27A 2OVBA 5B53A 1KGSA 1SWVA 3KZKA 4GDMA 1R15A 2GCPA 3R0JA 5LBTA 1AF4A 1DBQA 1FFHA 3FPGA 4MVJH 4NONA 4Q1EA 1E2EA 4KFSA 1GAJA 1K8ZB 3V48A 2Z58A 2HI0A 2J5GD 2NVBA 3EPHA 4ZVRA 4RH1A 1LDYA 1CFZA 3ZJYA 4URYR 5B7PA 3SWXA 5CFMA 3FUCA 2ZRHA 3MCWA 4G9GA 1CYEA 1H2ZA 1Q57A 3GJ8A 1GG2A 4JUFA 2WSYB 2YWGA 3CVOA 1L4NA 1XV5A 1ZK0A 2Q21A 2X1MA 1ISGA 1EI9A 3CE9A 5A3RA 3AFGA 1EFUA 2P6MA 2HSDA 1R0LA 2QZSA 3IV7A 4GOND 2VNIA 4LN1A 2A5LA 4ZVSA 5K20A 3RS2A 4B3SB 1OBOA 2F3UA 2NZVG 5LDHA 4Q19A 4MV8A 4NBNA 1SAYA 3M6XA 1FL9A 3DZJA 3GVPA 3MAGA 4Q5IA 4JCTA 1LF0A 2FMXA 5EIBD 4ZC8A 1G8GA 4CQMA 3P52A 3QI2A 3AVOA 3NHFA 1KP3A 2CNWD 2C2YA 3PHCA 2J67A 4HFRA 4LSZA 4MTCA 2FZSA 5KOHA 4OP3A 2BMDA 1YZHA 4KO2S 4F1JA 4DV5B 4FFBB 1L5RA 3FMOB 2DR0A 4HC8A 2CLMB 4ASUD 3FWKA 2BONA 4JBNA 4Q3CA 3DBLA 1B6RA 4KPFC 3KQQA 1DO8A 4ZYUA 2C94A 2OL4A 3ZWBA 2JPDA 3EVFA 3HLN1 2XY4A 2I2WA 2RGAA 5EJMA 3WO0A 1H2FA 2O2DA 5IM4F 3WDSA 3WWDA 2G7ZA 3QIVA 3O93A 4HTFA 4JB8A 1T1EA 4HDCA 2PWZA 5BNIA 1LWNA 2YWCA 2R79A 5FR1A 1BS1A 1MPXA 2PRJA 1SKYE 3BHMA 4D9IA 1GN8A 4TT8A 4GKJB 1WXGA 4FE7A 2I4OA 4MHTA 1CYDA 2HH9A 2AN9A 1K7FB 5CM8B 2Z8XA 2DTDA 2WTUA 1EXMA 3GZ4A 1PCXA 1UZLA 3KUXA 4JLDA 4KYUA 4WWHA 4J29A 2QUJA 3ZJVA 4IL5A 1HQYE 3ZYZA 3BCSA 1AH2A 2Z83A 1C9MA 1P4GA 4V2UA 3MRXA 4Y3UA 4IXWA 5F4ZA 4A5OA 4A5SA 3H0JA 3H5TA 2PUEA 4ARZA 4QIIA 1LLFA 1MO5A 1GNTA 1SHJA 4MQBA 1M8GA 3P32A 3LT2A 4ZC1A 1WXHA 4K2NA 1USGA 3L3BA 3LLSA 5JAZA 2P9HA 3WGGA 5IJ9A 4FX5A 1G8PA 4AKIA 1WZIA 1ZRHA 1TUBB 2BFEB 1OXBB 4CGZA 4M1ZA 1PHPA 4MQEA 3D0OA 1C50A 1P8AA 3KJQA 5B6IA 1BZYA 1YB7A 3NHYA 5FPSA 1UC5B 2ZRPA 1GPH1 5F98A 4BECA 1TJ4A 3ML1A 3PGKA 2UAGA 4J7UA 4NNQA 1GJRA 3IBGA 1UP7A 2OV2A 1TM2A 1XD2B 3T89A 3I9MA 2G1AA 1NC3A 3QVMA 1ZI8A 3RBZA 2A33A 3VSEA 1NOJA 1RC0A 2Q8QA 2Y27A 4M1KA 1ZBQA 4P4SB 5EQTA 5BV7A 3QRWA 2GKOA 3HBJA 4QZVA 3AV0B 1N3IA 3UW3A 4MVJG 4RKQA 2ZJZA 1W581 2DUMA 3I9NA 3KR1A 1TZKA 4IIDA 4RLQA 1QE5A 4S1NA 3ZGVA 3N05A 2X15A 5KDDA 3GX1A 1QO0D 3E9QA 4O2AA 4W9MC 2AMLA 4HR7A 3WHIA 2CUKA 1OWLA 4EY5A 1ZJJA 1FBTA 2JI8A 1MD9A 3AUKA 3KXLA 2CVHA 4OD0A 4FM9A 2F9IA 3PXBA 5DLQC 3HC7A 2BL4A 4JKYA 4EA9A 2IX9A 4WFIA 2DPYA 4PSCA 4HUQA 2QBYA 3SX4A 3H3JA 2DUWA 4F3CA 4P3NA 4H4EA 1VMDA 5JPCA 4MV9A 2IIVA 3GJ0A 4L4SA 1D7OA 3SP1A 5DT9A 1IXYA 3BH7A 1AVTA 1V8DA 2R6JA 3QOXA 4MITA 3L1KA 4XDHA 1O9GA 4BKUA 2GUWA 4PYRA 4WLVA 4EBBA 2PUAA 1BG6A 2PUCA 2QPLA 1KXZA 3LLMA 2R84A 4J2OA 3LIIA 1GU7A 4KTVE 3V8RA 2P9YA 4EKGA 1MJ3A 4DMRA 3HJNA 3THXA 3FJOA 1UKZA 4JCQA 3LD9A 2Z2IA 5A1JA 2QRGA 3FWYA 1JXMA 1E5XA 2VAVA 1AF7A 1NFQA 3GQVA 4XEUA 1AS0A 3C4VA 1NRJB 3OPNA 3IERA 4L8LA 2WUGA 2CFIA 3K8ZA 2I1QA 3D2LA 4N03A 4S24A 3RUAA 5LDDC 3HJUA 4GWGA 5AW9A 1OIWA 4ASUA 2Y4NA 3BHIA 3IH5A 2H59A 1TYDE 5FOWA 2EW1A 2YJ6A 5KX5A 5BSRA 4GR9A 1FJXA 2VSUA 4LDPA 5JWHA 1G4UR 1TA9A 5B1IA 3H87A 1Z4NA 4JBXA 5A6VA 3TT6A 2RK6A 3MTIA 1W0KA 3IS3A 4DLYA 3MFYA 4HAYA 2CD7A 1FU8A 2PKQO 2X24A 2JIZD 1WBDA 3ONEA 1NN5A 1PJ4A 3PLAE 3OOWA 4J0DA 2XLBA 3IXQA 2C8JA 1JPVA 1NBMA 2CDRA 2PXAA 4CLOB 3ANSA 5DGTA 4ML3A 2PV0A 1CF4A 1ISJA 5C32A 1NW8A 3IT0A 3ZCPA 1ID1A 2HK8A 3TD9A 5E6SB 4CUJA 3U9TB 1LY1A 5DSZA 1O5OA 1A97A 2DH5A 2RJNA 3BE6A 3GR6A 5DHRA 5J1TB 2WLTA 1K6JA 4UAJA 4EY4A 4DV4B 3RFTA 1TGVA 3PX2A 4MW6A 4YRQA 2LPMA 4I1UA 2Q1UA 2IV2X 4BOYA 3B9RA 3VKGA 3EISA 5CA1A 1KQ3A 3AL3A 3HGQA 1MW9X 4MCAA 2QV0A 4MS1B 4NZMA 4PNZA 4ZCQA 3KSUA 3ZDYB 4WY2A 1IXRC 2P65A 4MQFB 2EFCB 1E9RA 3P20A 4P5DA 2ICAA 5JPIA 1WQ1R 4ZZ0A 1K7CA 1BRMA 2ATEA 2QQFA 3PG5A 1RPJA 2SCUB 4E07A 1GTRA 3T54A 2N42A 1Y3BE 1RZ3A 1CDZA 1DHTA 1TEHA 3EFOA 2ZROA 4JDUA 4WHMA 5JLAA 3LUDA 2NSJA 2RHRA 2JZOA 1RWPA 1YU6A 4YECA 1OA1A 2VSQA 3PXUA 5FOUA 2IT1A 5JHHB 3GF4A 3HE2A 2MSNA 3TS1A 2DHCA 2LWIA 1G7CA 5BYJA 4MRPA 2XNCA 2G9ZA 3BKWA 4XB6B 4KWBA 1WW2A 1I1HA 1VBNA 2PZKA 2QD2A 2VJDA 3CW9A 2GZHA 2YR0A 1BMTA 3K53A 3N07A 5DN6A 1UWVA 4KLNA 1WB6A 5REQB 3L8MA 2QSYA 5GWXA 1XDBA 4D3XA 4CKZA 3ZWWA 4K3WA 1D2MA 5D87A 2HSGA 1ZN9A 4UMVA 4BNXA 1N57A 2XZTA 2R8EA 1V1MB 2PQ2A 4NI5A 2W2MA 1JAHA 2AD5A 1T4CB 4AJ4A 2F2TA 4FDAA 2ZBEA 3BMXA 4TXNA 1E61A 4Q4HB 5K0JA 5H9VA 4B3IA 4NDZA 4UHDA 1CERA 1L9KA 1XYGA 3EXG2 3HY3A 4FIZA 3ROPA 1KAHA 4ZDCA 2FPWA 5LLDA 4GUDA 4MAFA 1ZVQA 1WW8A 4JX9A 4Q7JB 3R7WA 4AUKA 3P5MA 1XAGA 4TZKA 2O06A 3PNQA 1TF7A 4EJFA 3K70C 3O2QB 4YWJA 1A7KA 5IPFA 1RXWA 3W06A 1J9EA 3R9QA 1KWKA 5J47A 5AYVA 4OF4A 3TM4A 1AXEA 1Z2DA 2NSLA 4UMDA 1YKSA 2WIKA 3ESXA 1ZGHA 2VYVD 3M4XA 4YQEA 1WM1A 3NXKA 2QRVB 4Z0PA 4EZIA 4H59A 2O8DA 3EY9A 4AN4A 1FXWF 1ULUA 2DT8A 1F3OA 4JJKA 3AVVA 2ODPA 4OB6A 4RA6A 1W9HA 3JYPA 1JIUA 5EXSA 4TM7A 4KNPA 2HCFA 4B71A 5CVDA 1EE2A 2XUKA 4NDNE 3H2YA 4HJXA 4L50A 5FYQA 3DKRA 3D3NA 3VPXA 3ZG6A 4C05A 1U0JA 2IU4A 5C4IA 3IGFA 4GOKA 5G4KB 3UH0A 1M6HA 5HRUA 1QONA 1N8SA 3S8MA 1CT9A 5DGDA 3H5RA 4IKOA 2BKLA 1BHQ1 3CZPA 3DTYA 3QQ5A 3GJZA 4IXMA 3SNKA 4M49A 2UU9B 2GVNA 3CBGA 2I2FA 3FMVA 2BISA 1NUTA 5DIFA 3ASVA 4FB8A 4ZGBA 1N1EA 4Q9IA 2CBYA 5EJ4A 3LY7A 3AR9A 1NVBA 2FSSA 2YYAA 1YOBA 2YZKA 5DKPA 3OX2A 3O4VA 4ZI5A 1OPRA 3T7SA 1NUHA 3JRWA 1M54A 4L1KA 4ZJZA 1OH5A 2OAQ1 2ZYTX 2DJIA 2W93A 4NOJA 1BEZA 4FQ5A 4P82A 3MQ4A 3AM3A 1SC1A 1W29A 1QYVA 1U2DC 3UGTA 4CG3A 4I14A 2A94A 1F2TA 4RZSA 3EXEA 3K1AA 3QF4B 4LE2A 4L5JA 4DJ5X 1E0AA 2QTLA 4CTMA 1BCSB 3KHSA 1RYFA 3DEAA 2ZPTX 1GEEA 1YB6A 5ESXA 4UFOA 5E9WA 2A14A 4V1CB 3TVYA 1S2MA 3V4SA 1B42A 2ACWA 1IWBB 4KL8S 5CFQA 2QQ3A 1I4OA 3R4VA 3M6NA 3Q2OA 2JIZA 4FYJA 4JJAA 2JEOA 3FHLA 3HEMA 4G26A 5ICGA 3DVAA 1TAQA 2H5EA 3I5UA 4WLFA 5KKAA 1E1CB 5LYJB 4Q4AA 4YBZA 1A9YA 2JHGA 3ANNA 3WADA 2R65A 1SBQA 2V9ZA 3HPQA 3DEKA 2ERXA 1N0HA 5JVDF 3KYDB 3K7EA 1KZ6A 2D2FA 1HNXB 1B26A 2X1VA 4I9UA 4C4XA 1FFYA 2PN1A 3RSHA 1J7KA 2WAXA 3D8TA 2OXFA 2AWOA 1DRJA 1SU4A 2ERCA 1U0LA 5DCWA 2IY7A 1L7QA 4U2FA 4FZWA 3RHZA 5A7GA 2WILA 1A96A 3EVNA 4FMCF 5CXQA 2X1HA 4YDQA 1TLFA 3IKLA 1NLFA 2J6HA 2N1MA 4IHAA 1CJSA 2BKXA 4QTUB 5BQPA 4DMFA 1V8ZA 5C7YA 2QZJA 5HFJA 5EJEA 4G0WA 2BKVA 2F43A 1ZVJA 3CWZA 3KC2A 1UL1X 1VPLA 1IOZA 2IY9A 2PXXA 2YWBA 3AY7A 1AE1A 3NEYA 3TLZA 4E09A 3QX7A 4M9QA 1DXYA 2F3PA 2IYSA 3KTIA 3ST9A 3QFTA 2FMFA 5FI3A 3BWDD 1E1RA 4OHMA 4B31A 3CMCO 4IOJA 2YYZA 5EC8A 4YJDA 3UF0A 4NNJA 1DOZA 1HETA 1Z5WA 3LBFA 3Q8MA 4RIIA 1Z7BA 3KX2A 3TQRA 1QQ6A 2J87A 2PTGA 3A04A 1SUPA 1C0LA 2XIQA 3N0TA 4YHBA 5I9MA 1SC9A 4HZUA 4DARA 1CUZA 2XHEA 3E0QA 3KKLA 3IJEB 1TD9A 4PS1A 3QBDA 4EA8A 1IHYA 2D00A 4IY1A 4IJ5A 1XTVA 4U0HA 4RMGA 4WA8A 3VDXA 4B4WA 2Q9BA 1SK8A 4HZIA 4PX9A 1M6WA 1W5SA 3OHPA 1FX1A 1W48A 4C0QC 1MUUA 3ABIA 4RJJA 5HUQA 3F97A 4ZMSA 4MDHA 3CO5A 2VPXA 2B37A 1FE8A 1V11A 5HGJA 4UMEA 3RTAA 5HF5A 3U7QA 5JROA 3H2ZA 1DAOA 2O7SA 4R83A 1FIUA 1TAUA 2DFDA 4MUJA 3OOYA 4Q1VA 3SYRA 4F9FA 1U90A 4POOA 1F5NA 2GERA 4B2PA 1JQ3A 3ONNA 3PNKA 3CGGA 1LNQA 1WUIS 2PS9A 3CUYA 4IHKA 3A0UA 3LT0A 4DBZA 5TRTA 4K3UA 4OQYA 4Y2PA 1UM8A 4A6XA 1LJUA 1ORVA 1UODA 5BT9A 5KHAA 4C3ZA 1JHUA 1QJCA 2VCYA 3TJRA 2I03A 3AP1A 3AV3A 3RC2A 3U7IA 3VO9A 5DM70 3RVQA 1DAIA 1C8BA 4FSHA 4XFJA 1N9GB 2W37A 5IZCC 1PGQA 3D3EA 1CQIB 3KR0A 3DCNA 3JS5A 1Q7CA 1T0IA 4OHVA 3HXMA 1S2IA 1EGMB 1ON9A 4M6WB 4HWRA 4MGYR 1LZKA 2AW5A 3TWOA 1XD8A 4YYZA 1P0CA 4MGHA 4MDYA 4JUBA 4P4TA 3NPMA 4DDUA 3GARA 4LQLA 2H4HA 2ETXA 2YN0A 4Y2GA 3PHBE 5A0TA 1DLJA 3MT8A 5CDHA 2NUPB 1JA1A 2OA0A 2XF2A 2ZQZA 2PX3A 3HN2A 3W7VA 3E9EA 2CJWA 4QTTB 1S3IA 2FV8A 4A4DA 3GEPA 5L4LA 1ZUD1 1HKHA 3V42A 4WKPA 4S2UA 3PC4A 1C7QA 3AR8A 4HT3B 2X9LA 1PNTA 1P33A 1PWXA 1AUOA 1RM5A 2F1IA 1T1GA 5BWMA 3K6SB 2A57A 3JVDA 2CNDA 3V5EA 3NNDA 3IQIX