5E0NX

Crystal structure of msmeg_3139, a monofunctional enoyl coa isomerase from m.smegmatis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
236
structure length
209
Chain Sequence
b'TRFVLLDRSRPGVALVTLNRPERMNSMAFDVMVPLLELLGDLRHDNSVRVVILTGAGRGFSSGMEVLDNVILALRRLHQPVIAAVNGAAIGGGLCLALACDVRIAAHNAYFRAAGGLTASELGLSYLLPRAIGTSRAFEIMLTGRDVDAAEAERIGLVSRTVPDDDLLETCFEMAQRMRGFSRPGIELTKRTLWSGLDAASLEGHMQAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase
publication title Unsaturated Lipid Assimilation by Mycobacteria Requires Auxiliary cis-trans Enoyl CoA Isomerase.
pubmed doi rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Isomerase
total genus 83
structure length 209
sequence length 236
ec nomenclature
pdb deposition date 2015-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5e0nX00
1OD2A 2Q2XA 3ISAA 4RYFA 2Q35A 2ZL4A 3P85A 3PE8A 3KTHA 3HLN1 3GMAA 4B3IA 4NNQA 1N6FA 3H0QA 5G1QA 4OG1A 3ZWAA 1Q52A 4U0GH 3HP0A 3V5IA 2UZFA 3T88A 3PGQA 1UYTA 4JSBA 4FZWC 4U19A 5KJPA 3R0OA 2F9YA 1FCFA 5INFA 4G2RA 3TV5A 2VSUF 3IBBA 2F9YB 4U1AA 4KPKA 4FNDA 4ASIA 5KDRA 1HZDA 4JWVA 2W3PA 3ZWBA 1DCIA 3P2LA 1XNWA 5DUCA 4L8KA 4IZBA 3RRVA 4FN7A 3WG5A 4I4ZA 3MT6A 5E0SA 1JXZA 2FZSA 1YG8A 3DORA 3TVUA 1X0UA 3GKBA 1SZOA 4NEKA 5INGA 4ZU2A 1HNOA 3QXZA 3MOYA 4RYFH 3V5EA 3ZWCA 4WYOB 5DUFA 3TRRA 3T8BA 3RSIA 4IZDA 3SWXA 4K3WA 2J5GA 5DTWA 3BEZA 5C90A 2ZL2A 3QREA 1EY3A 4MXIA 5IKLB 3K8XA 5DU6A 4ZDEA 1N6DA 2F9IB 3TLFA 3R6HA 4JCTA 2J5GD 3H81A 1YG6A 1VRGA 3FF6A 3VIVA 4KD6A 3M6MA 2DUBA 3M6NA 1K39A 5MGBA 2GTRA 4ZDCA 4GHNA 5E0SH 4B3JA 4K29A 2A81A 3IAVA 5G1SA 3OC7A 4RCNA 3U9TB 4ELWA 3KTJA 3QKAA 3BPPA 4HNKA 1UYSA 2F6QA 1DUBA 2J5II 3U9RB 4YLHA 3R9TA 5JBWA 1FC7A 3OT6A 2FBMA 2PBPA 3QYRA 2A7KA 4QIJA 4ZDBA 3MFMA 5G1RA 4JCSA 1PJHA 1WDLA 3R9SA 4OLQA 3RSTA 4WCZA 3GLMA 3Q0GA 5KDRB 2CE3A 1FC6A 1MJ3A 4QIIA 2NP9A 2C8TA 3TDCA 4LK5A 4ZDFA 3STAA 1WZ8A 4FNBA 3GF3A 3OMEA 1EF8A 3QWDA 3Q7HA 2VSSE 4L6WA 1XX4A 5DL1A 5JBXA 3K50A 3U9SB 4EMMA 4MI2A 2DEOA 5DKPA 3SLLA 2CBYA 2VREA 1TYFA 2VSUC 3ST9A 4JFCA 4I52A 3ZW8A 4Q1IA 2F6IA 2X24A 3H0SA 3QMJA 4KWBA 4I42A 4K2NA 4U0GA 3T8AA 3KTKA 2QQ3A 2HW5A 5C9GA 1J7XA 1W2XA 2J5IA 2Q34A 1O8UA 2J5IB 4DI1A 1TG6A 3H0JA 4U18A 3PZKA 4FJWD 3Q0JA 2BZRA 3TT7A 2FW2A 4MOUA 1RJNA 1NZYA 2PG8A 3TT6A 2WTBA 1SG4A 3IB9A 3KQFA 3NJDA 3L3SA 1OD4A 1NZYB 4WZ8B 4EMPA 3G64A 2PPYA 4JYLA 2IEXA 3HINA 1N6EA 2VSUE 2ZQRA 3PEAA 1UYVA 3HRXA 2VSSA 3FDUA 5E0NX 3H0UA 5DZKA 1ON3A 3Q1TA 2ZL0A 1UYRA 3GF7A 4Z0MA 1XNYA 1RJMA 3N6RB 1UIYA 2A7SA 3KTIA 5DU4A 2D3TA 3H02A 4B3HA 3DJAA 4QFEA 5CTBA 5FIFA 2ZL3A 3NJBA 5DTPA 4FB8A 2X58A 4EMLA 4FZWA 1FC9A 2VSSF 3BF0A 1EF9A 4F47A 2EJ5A 4U0HA 1WDMA 1HNUA 5DU8A 2J5SA 3P5MA 3JU1A 4Q0GA 1WDKA 5FUSA 1Y7OA 3LKEA 3HE2A 3I47A 3MYBA 4JCQA 1K32A 2F9IA 4HC8A 3TVWA 4KNPA 4JOTA 5DZKH 4JVTA 3QXIA 4FN8A 4GM2A 1PIXA 4ELSA 3T89A 4JJTA 3KTGA 3QK8A 4OMRA 1Q51A 3TZ3A 3T3WA 4ELXA 1XNVA 1ON9A 4ZDDA 3R9QA 5INIA 2VX2A 2ZQQA 5CTCA 4JCRA 3LAOA 2VSUA 3ZW9A 4JYJA 1XO6A 4IZCA
chains in the Genus database with same CATH superfamily
1OD2A 2Q2XA 3ISAA 4RYFA 2Q35A 2ZL4A 3P85A 3PE8A 3KTHA 3HLN1 3GMAA 4B3IA 4NNQA 1N6FA 3H0QA 5G1QA 4OG1A 3ZWAA 1Q52A 4U0GH 3HP0A 3V5IA 2UZFA 3T88A 3PGQA 1UYTA 4JSBA 4FZWC 4U19A 5KJPA 3R0OA 2F9YA 1FCFA 5INFA 4G2RA 3TV5A 2VSUF 4NARA 3IBBA 2F9YB 4U1AA 4KPKA 4FNDA 4ASIA 5KDRA 1HZDA 4JWVA 2W3PA 3ZWBA 1DCIA 3P2LA 1XNWA 5DUCA 4L8KA 4IZBA 3RRVA 4FN7A 3WG5A 4I4ZA 3MT6A 5E0SA 1JXZA 2FZSA 1YG8A 3DORA 3TVUA 1X0UA 3GKBA 1SZOA 4NEKA 5INGA 4ZU2A 1HNOA 3QXZA 3MOYA 4RYFH 3V5EA 3ZWCA 4WYOB 5DUFA 3TRRA 3T8BA 3RSIA 4IZDA 3SWXA 4K3WA 2J5GA 5DTWA 3BEZA 5C90A 2ZL2A 3QREA 1EY3A 4MXIA 5IKLB 3K8XA 5DU6A 4ZDEA 1N6DA 2F9IB 3TLFA 3R6HA 4JCTA 2J5GD 3H81A 1YG6A 1VRGA 3FF6A 3VIVA 4KD6A 3M6MA 2DUBA 3M6NA 1K39A 5MGBA 2GTRA 4ZDCA 4GHNA 5E0SH 4B3JA 4K29A 2A81A 3IAVA 5G1SA 3OC7A 4RCNA 3U9TB 4ELWA 3KTJA 3QKAA 3BPPA 4HNKA 1UYSA 2F6QA 1DUBA 2J5II 4J2UA 3U9RB 4YLHA 3R9TA 5JBWA 1FC7A 3OT6A 2FBMA 2PBPA 3QYRA 2A7KA 4QIJA 4ZDBA 3MFMA 5G1RA 4JCSA 1PJHA 1WDLA 3R9SA 4OLQA 3RSTA 4WCZA 3BPTA 3GLMA 3Q0GA 5KDRB 2CE3A 1FC6A 1MJ3A 4QIIA 2NP9A 2C8TA 3TDCA 4LK5A 4ZDFA 3STAA 1WZ8A 4FNBA 3GF3A 3OMEA 1EF8A 3QWDA 3Q7HA 2VSSE 4L6WA 1XX4A 5DL1A 5JBXA 3K50A 3U9SB 4EMMA 4MI2A 2DEOA 5DKPA 3SLLA 2CBYA 2VREA 1TYFA 2VSUC 3ST9A 4JFCA 4I52A 3ZW8A 4Q1IA 2F6IA 2X24A 3H0SA 3QMJA 4KWBA 4I42A 4K2NA 4U0GA 3T8AA 3KTKA 2QQ3A 2YJGA 5HUQA 2HW5A 5C9GA 1J7XA 1W2XA 2J5IA 2Q34A 1O8UA 2J5IB 4DI1A 1TG6A 3H0JA 4U18A 3PZKA 4FJWD 3Q0JA 2BZRA 3TT7A 2FW2A 4MOUA 1RJNA 1NZYA 2PG8A 4HDTA 3TT6A 2WTBA 1SG4A 3IB9A 3KQFA 3NJDA 3L3SA 1OD4A 1NZYB 4WZ8B 4EMPA 3G64A 2PPYA 4JYLA 2IEXA 3HINA 1N6EA 2VSUE 2ZQRA 3PEAA 1UYVA 3HRXA 2VSSA 3FDUA 5E0NX 3H0UA 5DZKA 1ON3A 3Q1TA 2ZL0A 1UYRA 3GF7A 4Z0MA 1XNYA 1RJMA 3N6RB 1UIYA 2A7SA 3KTIA 5DU4A 2D3TA 3H02A 4B3HA 3DJAA 4QFEA 5CTBA 5FIFA 2ZL3A 3NJBA 5DTPA 4FB8A 2X58A 4EMLA 4FZWA 1FC9A 2VSSF 3BF0A 1EF9A 4F47A 2EJ5A 4U0HA 1WDMA 1HNUA 5DU8A 2J5SA 3P5MA 3JU1A 4Q0GA 1WDKA 5FUSA 1Y7OA 3LKEA 3HE2A 3I47A 3MYBA 4JCQA 1K32A 2F9IA 4HC8A 3TVWA 4KNPA 4JOTA 5DZKH 4JVTA 3QXIA 4FN8A 4GM2A 1PIXA 4ELSA 3T89A 4JJTA 3KTGA 3QK8A 4OMRA 1Q51A 3TZ3A 3T3WA 4ELXA 1XNVA 1ON9A 4ZDDA 3R9QA 5INIA 2VX2A 2ZQQA 5CTCA 4JCRA 3LAOA 2VSUA 3ZW9A 4JYJA 1XO6A 4IZCA
chains in the Genus database with same CATH topology
1OD2A 2Q2XA 3ISAA 4RYFA 2Q35A 2ZL4A 3P85A 3PE8A 3KTHA 3HLN1 3GMAA 4B3IA 4NNQA 1N6FA 3H0QA 5G1QA 4OG1A 3ZWAA 1Q52A 4U0GH 3HP0A 3V5IA 2UZFA 3T88A 3PGQA 1UYTA 4JSBA 4FZWC 4U19A 5KJPA 3R0OA 2F9YA 1FCFA 5INFA 4G2RA 3TV5A 2VSUF 4NARA 3IBBA 2F9YB 4U1AA 4KPKA 4FNDA 4ASIA 5KDRA 1HZDA 4JWVA 2W3PA 3ZWBA 1DCIA 3P2LA 1XNWA 5DUCA 4L8KA 4IZBA 3RRVA 4FN7A 3WG5A 4I4ZA 3MT6A 5E0SA 1JXZA 2FZSA 1YG8A 3DORA 3TVUA 1X0UA 3GKBA 1SZOA 4NEKA 5INGA 4ZU2A 1HNOA 3QXZA 3MOYA 4RYFH 3V5EA 3ZWCA 4WYOB 5DUFA 3TRRA 3T8BA 3RSIA 4IZDA 3SWXA 4K3WA 2J5GA 5DTWA 3BEZA 5C90A 2ZL2A 3QREA 1EY3A 4MXIA 5IKLB 3K8XA 5DU6A 4ZDEA 1N6DA 2F9IB 3TLFA 3R6HA 4JCTA 2J5GD 3H81A 1YG6A 1VRGA 3FF6A 3VIVA 4KD6A 3M6MA 2DUBA 3M6NA 1K39A 5MGBA 2GTRA 4ZDCA 4GHNA 5E0SH 4B3JA 4K29A 2A81A 3IAVA 5G1SA 3OC7A 4RCNA 3U9TB 4ELWA 3KTJA 3QKAA 3BPPA 4HNKA 1UYSA 2F6QA 1DUBA 2J5II 4J2UA 3U9RB 4YLHA 3R9TA 5JBWA 1FC7A 3OT6A 2FBMA 2PBPA 3QYRA 2A7KA 4QIJA 4ZDBA 3MFMA 5G1RA 4JCSA 1PJHA 1WDLA 3R9SA 4OLQA 3RSTA 4WCZA 3BPTA 3GLMA 3Q0GA 5KDRB 2CE3A 1FC6A 1MJ3A 4QIIA 2NP9A 2C8TA 3TDCA 4LK5A 4ZDFA 3STAA 1WZ8A 4FNBA 3GF3A 3OMEA 1EF8A 3QWDA 3Q7HA 2VSSE 4L6WA 1XX4A 5DL1A 5JBXA 3K50A 3U9SB 4EMMA 4MI2A 2DEOA 5DKPA 3SLLA 2CBYA 2VREA 1TYFA 2VSUC 3ST9A 4JFCA 4I52A 3ZW8A 4Q1IA 2F6IA 2X24A 3H0SA 3QMJA 4KWBA 4I42A 4K2NA 4U0GA 3T8AA 3KTKA 2QQ3A 2YJGA 5HUQA 2HW5A 5C9GA 1J7XA 1W2XA 2J5IA 2Q34A 1O8UA 2J5IB 4DI1A 1TG6A 3H0JA 4U18A 3PZKA 4FJWD 3Q0JA 2BZRA 3TT7A 2FW2A 4MOUA 1RJNA 1NZYA 2PG8A 4HDTA 3TT6A 2WTBA 1SG4A 3IB9A 3KQFA 3NJDA 3L3SA 1OD4A 1NZYB 4WZ8B 4EMPA 3G64A 2PPYA 4JYLA 2IEXA 3HINA 1N6EA 2VSUE 2ZQRA 3PEAA 1UYVA 3HRXA 2VSSA 3FDUA 5E0NX 3H0UA 5DZKA 1ON3A 3Q1TA 2ZL0A 1UYRA 3GF7A 4Z0MA 1XNYA 1RJMA 3N6RB 1UIYA 2A7SA 3KTIA 5DU4A 2D3TA 3H02A 4B3HA 3DJAA 4QFEA 5CTBA 5FIFA 2ZL3A 3NJBA 5DTPA 4FB8A 2X58A 4EMLA 4FZWA 1FC9A 2VSSF 3BF0A 1EF9A 4F47A 2EJ5A 4U0HA 1WDMA 1HNUA 5DU8A 2J5SA 3P5MA 3JU1A 4Q0GA 1WDKA 5FUSA 1Y7OA 3LKEA 3HE2A 3I47A 3MYBA 4JCQA 1K32A 2F9IA 4HC8A 3TVWA 4KNPA 4JOTA 5DZKH 4JVTA 3QXIA 4FN8A 4GM2A 1PIXA 4ELSA 3T89A 4JJTA 3KTGA 3QK8A 4OMRA 1Q51A 3TZ3A 3T3WA 4ELXA 1XNVA 1ON9A 4ZDDA 3R9QA 5INIA 2VX2A 2ZQQA 5CTCA 4JCRA 3LAOA 2VSUA 3ZW9A 4JYJA 1XO6A 4IZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OD2 A;  2Q2X A;  3ISA A;  4RYF A;  2Q35 A;  2ZL4 A;  3P85 A;  3PE8 A;  3KTH A;  3HLN 1;  3GMA A;  4B3I A;  4NNQ A;  1N6F A;  3H0Q A;  5G1Q A;  4OG1 A;  3ZWA A;  1Q52 A;  4U0G H;  3HP0 A;  3V5I A;  2UZF A;  3T88 A;  3PGQ A;  1UYT A;  4JSB A;  4FZW C;  4U19 A;  5KJP A;  3R0O A;  2F9Y A;  1FCF A;  5INF A;  4G2R A;  3TV5 A;  2VSU F;  3IBB A;  2F9Y B;  4U1A A;  4KPK A;  4FND A;  4ASI A;  5KDR A;  1HZD A;  4JWV A;  2W3P A;  3ZWB A;  1DCI A;  3P2L A;  1XNW A;  5DUC A;  4L8K A;  4IZB A;  3RRV A;  4FN7 A;  3WG5 A;  4I4Z A;  3MT6 A;  5E0S A;  1JXZ A;  2FZS A;  1YG8 A;  3DOR A;  3TVU A;  1X0U A;  3GKB A;  1SZO A;  4NEK A;  5ING A;  4ZU2 A;  1HNO A;  3QXZ A;  3MOY A;  4RYF H;  3V5E A;  3ZWC A;  4WYO B;  5DUF A;  3TRR A;  3T8B A;  3RSI A;  4IZD A;  3SWX A;  4K3W A;  2J5G A;  5DTW A;  3BEZ A;  5C90 A;  2ZL2 A;  3QRE A;  1EY3 A;  4MXI A;  5IKL B;  3K8X A;  5DU6 A;  4ZDE A;  1N6D A;  2F9I B;  3TLF A;  3R6H A;  4JCT A;  2J5G D;  3H81 A;  1YG6 A;  1VRG A;  3FF6 A;  3VIV A;  4KD6 A;  3M6M A;  2DUB A;  3M6N A;  1K39 A;  5MGB A;  2GTR A;  4ZDC A;  4GHN A;  5E0S H;  4B3J A;  4K29 A;  2A81 A;  3IAV A;  5G1S A;  3OC7 A;  4RCN A;  3U9T B;  4ELW A;  3KTJ A;  3QKA A;  3BPP A;  4HNK A;  1UYS A;  2F6Q A;  1DUB A;  2J5I I;  3U9R B;  4YLH A;  3R9T A;  5JBW A;  1FC7 A;  3OT6 A;  2FBM A;  2PBP A;  3QYR A;  2A7K A;  4QIJ A;  4ZDB A;  3MFM A;  5G1R A;  4JCS A;  1PJH A;  1WDL A;  3R9S A;  4OLQ A;  3RST A;  4WCZ A;  3GLM A;  3Q0G A;  5KDR B;  2CE3 A;  1FC6 A;  1MJ3 A;  4QII A;  2NP9 A;  2C8T A;  3TDC A;  4LK5 A;  4ZDF A;  3STA A;  1WZ8 A;  4FNB A;  3GF3 A;  3OME A;  1EF8 A;  3QWD A;  3Q7H A;  2VSS E;  4L6W A;  1XX4 A;  5DL1 A;  5JBX A;  3K50 A;  3U9S B;  4EMM A;  4MI2 A;  2DEO A;  5DKP A;  3SLL A;  2CBY A;  2VRE A;  1TYF A;  2VSU C;  3ST9 A;  4JFC A;  4I52 A;  3ZW8 A;  4Q1I A;  2F6I A;  2X24 A;  3H0S A;  3QMJ A;  4KWB A;  4I42 A;  4K2N A;  4U0G A;  3T8A A;  3KTK A;  2QQ3 A;  2HW5 A;  5C9G A;  1J7X A;  1W2X A;  2J5I A;  2Q34 A;  1O8U A;  2J5I B;  4DI1 A;  1TG6 A;  3H0J A;  4U18 A;  3PZK A;  4FJW D;  3Q0J A;  2BZR A;  3TT7 A;  2FW2 A;  4MOU A;  1RJN A;  1NZY A;  2PG8 A;  3TT6 A;  2WTB A;  1SG4 A;  3IB9 A;  3KQF A;  3NJD A;  3L3S A;  1OD4 A;  1NZY B;  4WZ8 B;  4EMP A;  3G64 A;  2PPY A;  4JYL A;  2IEX A;  3HIN A;  1N6E A;  2VSU E;  2ZQR A;  3PEA A;  1UYV A;  3HRX A;  2VSS A;  3FDU A;  5E0N X;  3H0U A;  5DZK A;  1ON3 A;  3Q1T A;  2ZL0 A;  1UYR A;  3GF7 A;  4Z0M A;  1XNY A;  1RJM A;  3N6R B;  1UIY A;  2A7S A;  3KTI A;  5DU4 A;  2D3T A;  3H02 A;  4B3H A;  3DJA A;  4QFE A;  5CTB A;  5FIF A;  2ZL3 A;  3NJB A;  5DTP A;  4FB8 A;  2X58 A;  4EML A;  4FZW A;  1FC9 A;  2VSS F;  3BF0 A;  1EF9 A;  4F47 A;  2EJ5 A;  4U0H A;  1WDM A;  1HNU A;  5DU8 A;  2J5S A;  3P5M A;  3JU1 A;  4Q0G A;  1WDK A;  5FUS A;  1Y7O A;  3LKE A;  3HE2 A;  3I47 A;  3MYB A;  4JCQ A;  1K32 A;  2F9I A;  4HC8 A;  3TVW A;  4KNP A;  4JOT A;  5DZK H;  4JVT A;  3QXI A;  4FN8 A;  4GM2 A;  1PIX A;  4ELS A;  3T89 A;  4JJT A;  3KTG A;  3QK8 A;  4OMR A;  1Q51 A;  3TZ3 A;  3T3W A;  4ELX A;  1XNV A;  1ON9 A;  4ZDD A;  3R9Q A;  5INI A;  2VX2 A;  2ZQQ A;  5CTC A;  4JCR A;  3LAO A;  2VSU A;  3ZW9 A;  4JYJ A;  1XO6 A;  4IZC A; 
#chains in the Genus database with same CATH topology
 1OD2 A;  2Q2X A;  3ISA A;  4RYF A;  2Q35 A;  2ZL4 A;  3P85 A;  3PE8 A;  3KTH A;  3HLN 1;  3GMA A;  4B3I A;  4NNQ A;  1N6F A;  3H0Q A;  5G1Q A;  4OG1 A;  3ZWA A;  1Q52 A;  4U0G H;  3HP0 A;  3V5I A;  2UZF A;  3T88 A;  3PGQ A;  1UYT A;  4JSB A;  4FZW C;  4U19 A;  5KJP A;  3R0O A;  2F9Y A;  1FCF A;  5INF A;  4G2R A;  3TV5 A;  2VSU F;  4NAR A;  3IBB A;  2F9Y B;  4U1A A;  4KPK A;  4FND A;  4ASI A;  5KDR A;  1HZD A;  4JWV A;  2W3P A;  3ZWB A;  1DCI A;  3P2L A;  1XNW A;  5DUC A;  4L8K A;  4IZB A;  3RRV A;  4FN7 A;  3WG5 A;  4I4Z A;  3MT6 A;  5E0S A;  1JXZ A;  2FZS A;  1YG8 A;  3DOR A;  3TVU A;  1X0U A;  3GKB A;  1SZO A;  4NEK A;  5ING A;  4ZU2 A;  1HNO A;  3QXZ A;  3MOY A;  4RYF H;  3V5E A;  3ZWC A;  4WYO B;  5DUF A;  3TRR A;  3T8B A;  3RSI A;  4IZD A;  3SWX A;  4K3W A;  2J5G A;  5DTW A;  3BEZ A;  5C90 A;  2ZL2 A;  3QRE A;  1EY3 A;  4MXI A;  5IKL B;  3K8X A;  5DU6 A;  4ZDE A;  1N6D A;  2F9I B;  3TLF A;  3R6H A;  4JCT A;  2J5G D;  3H81 A;  1YG6 A;  1VRG A;  3FF6 A;  3VIV A;  4KD6 A;  3M6M A;  2DUB A;  3M6N A;  1K39 A;  5MGB A;  2GTR A;  4ZDC A;  4GHN A;  5E0S H;  4B3J A;  4K29 A;  2A81 A;  3IAV A;  5G1S A;  3OC7 A;  4RCN A;  3U9T B;  4ELW A;  3KTJ A;  3QKA A;  3BPP A;  4HNK A;  1UYS A;  2F6Q A;  1DUB A;  2J5I I;  4J2U A;  3U9R B;  4YLH A;  3R9T A;  5JBW A;  1FC7 A;  3OT6 A;  2FBM A;  2PBP A;  3QYR A;  2A7K A;  4QIJ A;  4ZDB A;  3MFM A;  5G1R A;  4JCS A;  1PJH A;  1WDL A;  3R9S A;  4OLQ A;  3RST A;  4WCZ A;  3BPT A;  3GLM A;  3Q0G A;  5KDR B;  2CE3 A;  1FC6 A;  1MJ3 A;  4QII A;  2NP9 A;  2C8T A;  3TDC A;  4LK5 A;  4ZDF A;  3STA A;  1WZ8 A;  4FNB A;  3GF3 A;  3OME A;  1EF8 A;  3QWD A;  3Q7H A;  2VSS E;  4L6W A;  1XX4 A;  5DL1 A;  5JBX A;  3K50 A;  3U9S B;  4EMM A;  4MI2 A;  2DEO A;  5DKP A;  3SLL A;  2CBY A;  2VRE A;  1TYF A;  2VSU C;  3ST9 A;  4JFC A;  4I52 A;  3ZW8 A;  4Q1I A;  2F6I A;  2X24 A;  3H0S A;  3QMJ A;  4KWB A;  4I42 A;  4K2N A;  4U0G A;  3T8A A;  3KTK A;  2QQ3 A;  2YJG A;  5HUQ A;  2HW5 A;  5C9G A;  1J7X A;  1W2X A;  2J5I A;  2Q34 A;  1O8U A;  2J5I B;  4DI1 A;  1TG6 A;  3H0J A;  4U18 A;  3PZK A;  4FJW D;  3Q0J A;  2BZR A;  3TT7 A;  2FW2 A;  4MOU A;  1RJN A;  1NZY A;  2PG8 A;  4HDT A;  3TT6 A;  2WTB A;  1SG4 A;  3IB9 A;  3KQF A;  3NJD A;  3L3S A;  1OD4 A;  1NZY B;  4WZ8 B;  4EMP A;  3G64 A;  2PPY A;  4JYL A;  2IEX A;  3HIN A;  1N6E A;  2VSU E;  2ZQR A;  3PEA A;  1UYV A;  3HRX A;  2VSS A;  3FDU A;  5E0N X;  3H0U A;  5DZK A;  1ON3 A;  3Q1T A;  2ZL0 A;  1UYR A;  3GF7 A;  4Z0M A;  1XNY A;  1RJM A;  3N6R B;  1UIY A;  2A7S A;  3KTI A;  5DU4 A;  2D3T A;  3H02 A;  4B3H A;  3DJA A;  4QFE A;  5CTB A;  5FIF A;  2ZL3 A;  3NJB A;  5DTP A;  4FB8 A;  2X58 A;  4EML A;  4FZW A;  1FC9 A;  2VSS F;  3BF0 A;  1EF9 A;  4F47 A;  2EJ5 A;  4U0H A;  1WDM A;  1HNU A;  5DU8 A;  2J5S A;  3P5M A;  3JU1 A;  4Q0G A;  1WDK A;  5FUS A;  1Y7O A;  3LKE A;  3HE2 A;  3I47 A;  3MYB A;  4JCQ A;  1K32 A;  2F9I A;  4HC8 A;  3TVW A;  4KNP A;  4JOT A;  5DZK H;  4JVT A;  3QXI A;  4FN8 A;  4GM2 A;  1PIX A;  4ELS A;  3T89 A;  4JJT A;  3KTG A;  3QK8 A;  4OMR A;  1Q51 A;  3TZ3 A;  3T3W A;  4ELX A;  1XNV A;  1ON9 A;  4ZDD A;  3R9Q A;  5INI A;  2VX2 A;  2ZQQ A;  5CTC A;  4JCR A;  3LAO A;  2VSU A;  3ZW9 A;  4JYJ A;  1XO6 A;  4IZC A; 
#chains in the Genus database with same CATH homology
 1OD2 A;  2Q2X A;  3ISA A;  4RYF A;  2Q35 A;  2ZL4 A;  3P85 A;  3PE8 A;  3KTH A;  3HLN 1;  3GMA A;  4B3I A;  4NNQ A;  1N6F A;  3H0Q A;  5G1Q A;  4OG1 A;  3ZWA A;  1Q52 A;  4U0G H;  3HP0 A;  3V5I A;  2UZF A;  3T88 A;  3PGQ A;  1UYT A;  4JSB A;  4FZW C;  4U19 A;  5KJP A;  3R0O A;  2F9Y A;  1FCF A;  5INF A;  4G2R A;  3TV5 A;  2VSU F;  4NAR A;  3IBB A;  2F9Y B;  4U1A A;  4KPK A;  4FND A;  4ASI A;  5KDR A;  1HZD A;  4JWV A;  2W3P A;  3ZWB A;  1DCI A;  3P2L A;  1XNW A;  5DUC A;  4L8K A;  4IZB A;  3RRV A;  4FN7 A;  3WG5 A;  4I4Z A;  3MT6 A;  5E0S A;  1JXZ A;  2FZS A;  1YG8 A;  3DOR A;  3TVU A;  1X0U A;  3GKB A;  1SZO A;  4NEK A;  5ING A;  4ZU2 A;  1HNO A;  3QXZ A;  3MOY A;  4RYF H;  3V5E A;  3ZWC A;  4WYO B;  5DUF A;  3TRR A;  3T8B A;  3RSI A;  4IZD A;  3SWX A;  4K3W A;  2J5G A;  5DTW A;  3BEZ A;  5C90 A;  2ZL2 A;  3QRE A;  1EY3 A;  4MXI A;  5IKL B;  3K8X A;  5DU6 A;  4ZDE A;  1N6D A;  2F9I B;  3TLF A;  3R6H A;  4JCT A;  2J5G D;  3H81 A;  1YG6 A;  1VRG A;  3FF6 A;  3VIV A;  4KD6 A;  3M6M A;  2DUB A;  3M6N A;  1K39 A;  5MGB A;  2GTR A;  4ZDC A;  4GHN A;  5E0S H;  4B3J A;  4K29 A;  2A81 A;  3IAV A;  5G1S A;  3OC7 A;  4RCN A;  3U9T B;  4ELW A;  3KTJ A;  3QKA A;  3BPP A;  4HNK A;  1UYS A;  2F6Q A;  1DUB A;  2J5I I;  4J2U A;  3U9R B;  4YLH A;  3R9T A;  5JBW A;  1FC7 A;  3OT6 A;  2FBM A;  2PBP A;  3QYR A;  2A7K A;  4QIJ A;  4ZDB A;  3MFM A;  5G1R A;  4JCS A;  1PJH A;  1WDL A;  3R9S A;  4OLQ A;  3RST A;  4WCZ A;  3BPT A;  3GLM A;  3Q0G A;  5KDR B;  2CE3 A;  1FC6 A;  1MJ3 A;  4QII A;  2NP9 A;  2C8T A;  3TDC A;  4LK5 A;  4ZDF A;  3STA A;  1WZ8 A;  4FNB A;  3GF3 A;  3OME A;  1EF8 A;  3QWD A;  3Q7H A;  2VSS E;  4L6W A;  1XX4 A;  5DL1 A;  5JBX A;  3K50 A;  3U9S B;  4EMM A;  4MI2 A;  2DEO A;  5DKP A;  3SLL A;  2CBY A;  2VRE A;  1TYF A;  2VSU C;  3ST9 A;  4JFC A;  4I52 A;  3ZW8 A;  4Q1I A;  2F6I A;  2X24 A;  3H0S A;  3QMJ A;  4KWB A;  4I42 A;  4K2N A;  4U0G A;  3T8A A;  3KTK A;  2QQ3 A;  2YJG A;  5HUQ A;  2HW5 A;  5C9G A;  1J7X A;  1W2X A;  2J5I A;  2Q34 A;  1O8U A;  2J5I B;  4DI1 A;  1TG6 A;  3H0J A;  4U18 A;  3PZK A;  4FJW D;  3Q0J A;  2BZR A;  3TT7 A;  2FW2 A;  4MOU A;  1RJN A;  1NZY A;  2PG8 A;  4HDT A;  3TT6 A;  2WTB A;  1SG4 A;  3IB9 A;  3KQF A;  3NJD A;  3L3S A;  1OD4 A;  1NZY B;  4WZ8 B;  4EMP A;  3G64 A;  2PPY A;  4JYL A;  2IEX A;  3HIN A;  1N6E A;  2VSU E;  2ZQR A;  3PEA A;  1UYV A;  3HRX A;  2VSS A;  3FDU A;  5E0N X;  3H0U A;  5DZK A;  1ON3 A;  3Q1T A;  2ZL0 A;  1UYR A;  3GF7 A;  4Z0M A;  1XNY A;  1RJM A;  3N6R B;  1UIY A;  2A7S A;  3KTI A;  5DU4 A;  2D3T A;  3H02 A;  4B3H A;  3DJA A;  4QFE A;  5CTB A;  5FIF A;  2ZL3 A;  3NJB A;  5DTP A;  4FB8 A;  2X58 A;  4EML A;  4FZW A;  1FC9 A;  2VSS F;  3BF0 A;  1EF9 A;  4F47 A;  2EJ5 A;  4U0H A;  1WDM A;  1HNU A;  5DU8 A;  2J5S A;  3P5M A;  3JU1 A;  4Q0G A;  1WDK A;  5FUS A;  1Y7O A;  3LKE A;  3HE2 A;  3I47 A;  3MYB A;  4JCQ A;  1K32 A;  2F9I A;  4HC8 A;  3TVW A;  4KNP A;  4JOT A;  5DZK H;  4JVT A;  3QXI A;  4FN8 A;  4GM2 A;  1PIX A;  4ELS A;  3T89 A;  4JJT A;  3KTG A;  3QK8 A;  4OMR A;  1Q51 A;  3TZ3 A;  3T3W A;  4ELX A;  1XNV A;  1ON9 A;  4ZDD A;  3R9Q A;  5INI A;  2VX2 A;  2ZQQ A;  5CTC A;  4JCR A;  3LAO A;  2VSU A;  3ZW9 A;  4JYJ A;  1XO6 A;  4IZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...