3QW2A

L-myo-inositol 1-phosphate synthase from archaeoglobus mutant n255a
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYAILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 142
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qw2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qw2A01
5IDWA 3NRCA 3ZWMA 5CG1A 1H2HA 4R1UA 1OMOA 1BTOA 4WJZA 3RAJA 2FPPA 1XU7A 3RD5A 2VYVD 1F0YA 1R4MB 1YGYA 2PKQO 4YAJA 2B36A 3AUTA 4E5NA 2FWMX 3JQ7A 4EI2A 4J0FA 2JFFA 3OJFA 5L40A 3ANNA 1IOLA 3NDJA 3ADOA 5HM8A 5U4QA 3W8DA 4GVXA 4NK4A 3PHLA 1LQTA 3L77A 1E3IA 3GVPA 3FBTA 1NAHA 2X5OA 3Q1LA 4BQPA 1EBUA 4ZQEA 1DLIA 4UUOA 1F12A 5C5IA 2NU7A 1EUCA 1YB5A 1B16A 1W73A 3OJLA 3VPSA 3WICA 3RUAA 2X86A 4AJPA 3GMSA 4IQ0A 1O95A 3OF2A 4GH5A 4DTIA 3CMMA 8ADHA 3U4DA 4RF5A 4YAGA 3Q11A 3T4XA 4JNKA 3LC7O 1U5AA 4RJTA 2B37A 4UUPA 5ENDA 3ONDA 1B15A 1HE3A 2RIRA 3PWZA 3ZN2A 3PJFA 4OL9A 1LUAA 3GEGA 2CVOA 4XYGA 5G0TA 4GGOA 2J3HA 1Z6ZA 3TQHA 4B8ZA 3WS7A 4WE3A 5DULA 4H15A 1PL8A 4OQZA 4DMLA 5ITWA 3DBHB 4NBRA 3BMOA 4J9UE 2VWQA 3K8ZA 5A02A 3D4OA 2QYTA 3F4BA 1XSEA 3FNGA 4FD3A 4FC7A 5KJ1A 4CM1A 3ROMA 4FOSA 1U7TA 3OFSA 2IZZA 4JLWA 3QVXA 3JQBA 4IXTA 4BV9A 1FF9A 4Z0HO 1XEAA 2EHDA 3FCOA 4H3VA 2G5CA 4IDBA 3WGZA 2YDXA 5KKAA 5F3RA 4XYMA 1X7HA 2O3RA 4L74A 4ALIA 1B3RA 1BWSA 4NI5A 1O6ZA 2Y99A 4BKQA 3ZNOA 2YZ7A 1LQUA 1O8CA 5KVSA 3QWBA 3HE3A 1PWZA 4P4GA 3I9KA 3HADA 4UREA 5LCXA 3GHYA 5JAZA 4YXFA 3H9QA 2W2KB 4IS3A 1M2WA 3ZU5A 4MKZA 2B83A 4WGGA 4B3JA 1ENZA 4O59O 3FWZA 4J3FA 3Q2IA 4TVBA 3WMWA 4IJKA 3H9JA 3STHA 3OQBA 1NBOA 1MG0A 5ILGA 3GAZA 2OBYA 4H7PA 5G4KB 3PQFA 3S55A 2VRCA 1BG6A 1G0NA 3VHRA 1VPDA 3FWNA 3ENNA 4DXHA 4DRYA 3WTBA 1ONOA 5EL0A 3DXFA 5CAEA 1LDNA 2J3IA 3JD2A 4MOWA 2YQ4A 5IXYA 1I2CA 1DIRA 4MDHA 4BMVA 3QHAA 4I1IA 1CRWG 2PR2A 3RUCA 3DR3A 2HRBA 3PI7A 1HDCA 1NQOA 4MIOA 2VHZA 3ADPA 3VPGA 3EW7A 1VJTA 1OBFO 4WNCA 1AXGA 2ZKLA 2GLXA 2FR1A 5KIAA 2CDAA 2P4QA 2CSUA 4ZRMA 4MP3A 1BHSA 2WYUA 3UCXA 4D79A 5BSGA 2ZB7A 3ASUA 1YS4A 3R0IA 3QVSA 2FY8A 3JYPA 2GNAA 4BB5A 1WP4A 4IJVA 2V6BA 4MVJD 1K6IA 1MV8A 3DZKA 5THQA 5L7WA 4IJWA 1I3LA 5DZSA 4PGFA 3PLNA 3S2GA 5COBA 4DBZA 3PWSA 4W9NA 2EW8A 3EZYA 1P74A 3JQBC 4RVHA 3FR7A 4PVCA 1UXGA 4Y6RA 5EJ2A 4NQZA 3E03A 5KJEA 1JW9B 4CM8A 1Q7BA 5DCUA 2B4TO 3DMTA 1O9BA 3HDHA 4AJHA 1LSUA 4L73A 3WJAA 4OSOA 5BT9A 3ZWOA 1P44A 3U9LA 5THKA 5M6DA 2J6IA 1E7MA 3O8QB 3BMNB 2QX7A 3O38A 3LYLA 3OQ6A 3EC7A 2C82A 4RLSA 1RWBA 1PTJA 3IJRA 5A9SB 1PSDA 5JC8A 5T64A 2O7SA 4J4HA 3GPIA 4Z3KA 2EKLA 4NBUA 5FF9A 3QWFA 2C7VA 3JQCA 2X0NA 4NU5A 4HADA 3I9OA 4HUJA 5JCJA 1DOHA 4JBGA 4GI2A 4CLHA 1YBMA 3FN4A 2VOJA 4EYEA 5FEUA 3SJ7A 1GEEA 1UR5A 1FJHA 1ZCJA 2I3AA 4GAEA 4CMJA 4DLBA 5JO9A 3E9QA 3ONFA 1CIVA 3V1UA 3A14A 1RM0A 3RBVA 3WJ7A 1YKFA 1Z73A 1DC4A 1DPGA 1YDWA 1CJCA 5DF1A 3L07A 1GR0A 3E5RA 2LDBA 1ENPA 1CQJA 2C7GA 3QP9A 2W4QA 4JX8A 4FQ8A 3INGA 1L7DA 4R51A 3IP3A 3JQFA 4A03A 2B0JA 1YB4A 1PJTA 2YUTA 2XXBA 3I9JA 3M2PA 3EZLA 4RL6A 2JD2A 3VH3A 4E2XA 3ASVA 4L0QA 2JAHA 4NG5A 4OIMA 4FS3A 5AYVA 1EK6A 3TZQA 4RLHA 4E30A 4EBFA 3C24A 5LC1A 4B4OA 3I6QA 3DHYA 1QYWA 1IZ0A 3WYCA 4XIYA 3W4IA 1A4UA 3O9ZA 1TI7A 4DLLA 4PG4A 2Y1GA 3FBGA 3GC6A 3PVZA 1MC5A 1E3WB 3DEYX 1MLDA 4XYLA 1MB4A 1ZW1A 3PHIA 4GMGA 3KYDA 1IPEA 3QW2A 3G79A 4Z0PA 4WCDA 2ZJ1A 1KVUA 1ZXLA 3HDQA 3L9XA 5HS6A 4N5NA 4CLDA 2PD3A 1A7KA 3VPXA 5G0WA 4CMGA 3F46A 5IDXA 2D0IA 4BMSA 1WXDA 1T2AA 3DMTC 2JCYA 1DRWA 4NR0A 4MVJM 1VKOA 1UAGA 4FBGA 3KBOA 4XCVA 4BNLA 1HDRA 3KYCB 1DIAA 3PIDA 1HLPA 4BNNA 1B14A 1UDAA 2H5LA 1ZXBA 4WUVA 2JCXA 4PN3A 2O2YA 2SCUA 4IBOA 4JCOA 2BFOA 3UN1A 1LNQA 4CV1A 2FHSA 3WBFA 4RDIA 3HZZA 2ZTMA 4OXYA 2PLAA 5CHEA 2I67A 4B79A 4YJFB 5DOZA 3WOHA 1LJ8A 1M66A 1T1RA 1UP7A 2Y1OA 2IDZA 3WFJA 1IZ9A 3LT2A 5EERA 1F17A 2GSDA 3S2EA 1PEDA 1QRRA 4WNIA 1XELA 4O1MA 4BQRA 4TQGA 1E3LA 4XR9A 4FFPA 2D4AA 3BAZA 3NT5A 3BIOA 1N7HA 3CXRA 1XWFA 3K6JA 2O50A 3G3EA 3BMQA 1LDBA 3CTMA 3KRTA 3KO8A 3CMCO 3C1AA 4R41A 5AVOA 4ROSA 3AI1A 2HK8A 1JA9A 4QFCA 2EJWA 3JQFC 4IGEA 4OXNA 1IHYA 4YACA 1WW8A 3JD4A 4IGFA 3R6DA 1ISFA 2EP7A 2BGKA 4KQXA 4J1QA 4YRBA 3ZHBA 4NIMA 1SB9A 3KXDA 5HBRA 4J2HA 4M55A 4JJGA 1RM5A 4XZ3A 1I5RA 4E5MA 2Y1CA 2Q1WA 1JN0A 5IF3A 2FPIA 4AICA 1GPJA 4GLOA 2YHIA 5L7TA 1RM3A 3RC7A 1LLUA 1PGOA 4IDFA 1FDWA 2OGUA 4ITUA 3IDSA 1UUFA 1SCUA 5IXSA 1CYDA 4CMIB 1JWAB 3JQ6A 2QW8A 2E49A 4FC6A 4M87A 3C8MA 2PZMA 1KETA 4J4TA 1E0DA 2P68A 4XIJA 3OICA 3Q0EA 4FFOA 4J4BA 1MX3A 4FJ1A 2BRUA 1HE5A 1VL6A 3RU9A 5I9NA 3G0OA 2VHXA 3PHHA 3COSA 3ITDA 4OAQA 3OEWA 4W7IA 4N18A 3KZVA 4Z0TA 1ADFA 4NPCA 3WX0A 1EFKA 3RQSA 1P1HA 3RUEA 3GEMA 3AOGA 5BNFA 3QVWA 1Y9AA 1PZFA 2CMDA 1Z82A 2Y1DA 2OBNA 1P1IA 2CNBA 4WECA 4RF3A 4CM9A 4EDFA 1FDVA 4RV9A 3NUGA 4RO0A 3PRJA 1EK5A 4BO7A 1QXSA 4EUFA 2OL4A 2WM3A 4FIZA 1JU9A 4LGVA 3NT4A 1DHRA 2ZYGA 4OMUA 3MJ4A 2HKIA 1YXMA 1ZSVA 3I9LA 3K31A 3NJ8A 5B1YA 5JYFA 1I3MA 3JQEA 2JKVA 4QECA 4DPLA 3WIDA 4EEZA 3WQQA 4AVYA 3A4VA 1R0SA 2ZB4A 3H5RA 3U4IA 5JCXA 5G0VA 1GCUA 2HSDA 4CM3A 2FR0A 4XJTA 3RROA 4J0EA 4KTVE 4TSKA 1LDYA 4YJHA 1XU9A 4AJLA 2IRWA 2HQ1A 2PGLA 3JQAD 3ICPA 3ZWCA 3LC1O 4GX1A 5TT1A 1F8FA 4GSLA 4BO4A 4YAEA 1R0LA 4KZPA 2WE8A 1YOVA 4K28A 3E1KA 3DQPA 3VZSA 4NJOA 1QYCA 3W6ZA 3L0DA 3DZHA 1X1EA 4JP2A 1SO8A 4BNKA 3FNEA 4R68A 4MKXA 4OHUA 2C54A 3KLPX 1FDTA 2WEKA 1R4MA 1JAYA 2JL1A 3WXBA 2ZK7A 3VZQA 3G1UA 1W6UA 2A35A 3E8XA 1Y5RA 3VAZA 3I83A 4PLGA 1DLJA 1E7SA 4J9VA 4KWHA 1ZZEA 1WZEA 1MXFA 3GH3A 3OM9A 3QE3A 1TT7A 1YBAA 3AI3A 4D44A 1BVUA 5IG2A 1PX0A 5A04A 1GYQA 1S7CA 2WD8A 4HY3A 2P91A 1HKUA 2P9CA 4E21A 4ZN6A 1LDEA 1PJLA 4MPDA 4BNYA 3UW3A 3WBBA 3WLEA 1F8GA 1Q0QA 1LSOA 1PJQA 2Q99A 3WFIA 3GN1A 2I3GA 3JQ8B 1BGVA 4AJ2A 3SC4A 3KB6A 3BZUA 4BO3A 2RAFA 1MUUA 4P38A 4BB6A 2IYOA 5JFOA 3RVDA 2X5JO 3TSCA 2P5UA 4GGPA 1WLYA 2Q2QA 5JBIA 5AOVA 3GEDA 1I33A 4YJGB 2QYSA 3HUDA 2FSSA 4J91A 1X0XA 1B8VA 1ZEJA 2GPTA 1PJSA 1E7RA 3RKUA 3DMYA 3QA9A 3KSZO 2BHLA 4BOYA 2WJPA 3FTPA 3DOCA 4HFRA 3AY3A 3OP4A 1AUPA 3AJRA 4DIFA 3CSDA 4K6CA 4M54A 3DBRB 1I36A 3U3XA 1HZZA 1QR6A 4Y67A 4RZHA 4YVFA 3O4RA 1MA0A 3DBHA 3I9MA 3V1TC 1VRWA 3F5QA 2BF7A 1NQAO 4ZICA 5I8WA 4H16A 1Y5MA 3AW9A 1KYQA 4YCAA 2VRCD 4DMMA 1HDXA 1NASA 1E6EA 4NU6A 1KVRA 4E2WA 3OMLA 2WD7B 3GNQA 4P22A 1E3JA 4RPKA 3DFZA 2R00A 2P5YA 1U4SA 4EJ0A 1XHLA 3ANMA 3SX2A 1W8DA 4FFLA 1BDMA 3WGIA 3TNLA 3A1NA 1HXHA 3WNQA 3UGKA 4PZDA 2VUSA 3QLJA 4IDAA 4MIEA 4HNHA 3ROKA 4GX0A 4KDFA 4E33A 2IZ1A 2BI8A 4P8RA 1HE2A 2VYNA 2VWHA 2Q1UA 2XOXA 4DYVA 4LMRA 1MFPA 2P9GA 2GDZA 3VVCA 3KM0A 1PU2A 3JYQA 2VNSA 3MOIA 3GRKA 1VE9A 1J4AA 1PZHA 2W2KA 1E3SA 2BD0A 1ID1A 4OH1A 4A7PA 3WDSA 3MJEA 1A9ZA 3HFSA 2PH5A 4CLEA 2FR8A 5C3MA 3ZV4A 1DAPA 1V8BA 4DGSA 4FDAA 3TJRA 1AXEA 2EJVA 4AJ4A 3GDGA 4JGBA 5G4KA 3VKUA 4B7XA 4DQVA 1TT5B 3MTGA 1ARZA 1ZK1A 1OFGA 3GVIA 2DQ4A 3JD1A 1DIHA 4Q3CA 1LC3A 4JXKA 4WCFB 1V0JA 2EIHA 4XEHA 5L4SA 4L8VA 4IS2A 4IINA 1EDOA 4CLOB 5L3ZA 4E2YA 3PYMA 1LBEA 4R9RA 4BIIA 2VOEA 4GMFA 5I8ZA 5JYDA 4CJXA 4MVJF 3U0BA 3C7AA 1ULSA 1VJ0A 3HN7A 3RUHA 2XPCA 4AJNA 4YQZA 1ZO8A 2QRLA 3PTZA 4YWJA 1BW9B 4II2A 1T4DA 3M2TA 3EUWA 4MVJP 3DHEA 3ZU3A 4XGKA 3DTYA 1Q7CA 3AOEC 4RQUA 2UUPA 2Z95A 4TRRA 3UAGA 3ZZNA 2EXXA 3PHGA 1U7HA 3V2GA 3ENKA 1SNYA 1SB8A 4Q9NA 5JDCA 1NAIA 4DC0A 3WSWA 2GN4A 3BTSA 3U49A 4CV2A 4BO6A 3GFGA 1QYVA 1AE1A 4RVSA 2Y0EA 2CVQA 5JMPA 3WYBA 3W8EA 4O63O 3AUSA 3JV7A 3V8BA 2NU9A 3H4VA 2VHYA 1ZJZA 3JYNA 2O3TA 2EERA 4AFNA 1V3TA 2R00C 1EVIA 1N5DA 1X1TA 3QWIA 2YYYA 3GA0A 4W4TA 4FFMA 1ISJA 3D4PA 3MJTA 5BSEA 4BO2A 3AY6A 3BMNA 3LF2A 3O8QA 4HFMA 1T2DA 1ZMOA 1GFSA 1NFQA 1AHHA 4XGNA 3JD3A 1CQIA 3QIVA 5A9SA 2AG5A 4XDYA 4LRTB 1ADBA 1OI7A 3IS3A 4RPLA 4MKRA 4WLFA 1R66A 3JSAA 5ICMA 1DJQA 5L95A 1EVYA 2YV1A 4ID9A 4CLRB 4IZIA 3NT2A 4XWYA 4BO5A 1Y8RB 3EYWA 1FDUA 1WMAA 1YJQA 1C1DB 2PD4A 3UF0A 2WTBA 5DBGA 3ZHYA 3OJ0A 4IIVA 5EPOA 2X9VA 5A5FA 4E12A 3H9UA 2X58A 5JXWA 4Y9DA 5CEFA 3D5TA 3AUUA 3CKYA 1HRDA 3HWRA 4NBWA 4BGUA 5LDHA 2VT2A 4CQMD 1PR3A 5KKCA 3PPIA 1T24A 5CDUA 3GT0A 1HYHA 2YFQA 1HZJA 4IPTA 3ONEA 6LDHA 1S6YA 5BNIA 2O3JA 3PHJA 2PNFA 3GAFA 4TZTA 2A4KA 1C0IA 5A06A 2FN7A 5CEEA 3BYZA 1ML3A 1R12A 4NMHA 4PVDA 1W0CA 5L7YA 5EQDA 3GNSA 3AK4A 2I9PA 1YE3A 2DFDA 4J7CA 4IDEA 3M6IA 2OFPA 2ZIZA 4KDEA 2X0RA 1B8PA 5B4VA 1RJWA 3NTQA 3DB2A 1ZVMA 3EGOA 4Q39A 3N58A 1KEPA 3D4NA 5JDCC 5T8KA 1E3WA 3I5MA 3GUCA 3BMCB 5JS6A 3GDOA 3GGPA 1OC2A 4D43A 2NU8A 1KBZA 2IYPA 3VOSA 3NAQA 2GD1O 4DL9A 3DO5A 4L4XA 2GGSA 2FZEA 1Y9EA 1N9GA 1F06A 4U5QA 4XQEA 4EUHA 3KSDO 1UJMA 4NJMB 3I23A 1YH3A 4NFHA 3TN7A 5TJHA 3ZNQA 3EVNA 1WAMA 5ES3A 1N8KA 2ZYDA 1DSSG 1Z75A 3KYCA 2QRKA 4B4WA 4BNVA 1YO6A 2OO5A 3HDJA 1K2WA 3HHPA 4KP7A 2WE7A 1P1KA 4QTZA 4ALKA 2Y67A 3OIDA 1C1XB 2Z1NA 1EDZA 3PZRA 2GN9A 4YQYA 4CM7A 2V7PA 4HBGA 3JYLA 5L4LA 4B3IA 1YL6A 2YY7A 1H6DA 4YJFA 4AJKA 3SXPA 3Q3CA 3P5SA 1NPYA 1DIBA 4DQUA 4UVEA 1JTVA 2VNAA 4BNGA 4J1SA 2H1SA 2VT3A 2VCYA 4RGBA 3AM5A 1ZMTA 5C7OO 2X9NA 3X2FA 2IEDA 3SEFA 3I1JA 1MXHA 4ZHSA 2UUOA 1YVEI 4D3FA 3LSYA 2GF2A 2OP1A 3KLMX 1TB4A 1UZNA 5HS4A 3BHIA 1Y1PA 4O5OA 1JVBA 4BNHA 4RQTA 2OHXA 3RFVA 2V6FA 1M6HA 1BXGB 3E9NA 4E6PA 2Q22A 2EWMA 1PGPA 1A71A 1N1EA 1KY5A 3ANLA 3N7UA 4E5YA 2PK3A 4A5OA 4LCJA 1JAXA 5IDYA 1EVJA 2O3SA 3DTTA 1XG5A 3UCFA 5AXCA 3WGYA 5G0UA 1A9YA 1FXSA 1DRUA 4QSMA 2C59A 5EMHA 4TKLA 5MDHA 2D5AA 3H2SA 3S2FA 3PWKA 3ETEA 4CM9D 4ZVVA 4DVJA 4Q3NA 3WB9A 5KVVA 1KVTA 1JKFA 4U8GA 1P0CA 2AEJA 4IQGA 5T8KC 2O4UX 1R0KA 3U5TA 1QKIA 2O48X 4OOFA 3UCEA 1D1TA 3C85A 2XXJA 3IMFA 3PYXA 4CMIA 1PQWA 2WDZA 3ULKA 4CUJA 1O5IA 1YBVA 4BMNA 4GL4A 2TMGA 3DZGA 3TZ6A 2CFCA 4PCVA 4IDDA 2AQ8A 9LDBA 1O94A 3AM4A 3VH1A 3BHMA 3H5AA 2PGJA 5GZ1A 3JQAB 5ER9A 4XRRA 4DUPA 1R37A 4Q3AA 1U3WA 1EUDA 5A5EA 1IY8A 3K96A 1CF2O 3LK7A 1R6DA 4K1LA 4XD2A 1T4BA 3KHUA 4G5HA 5IN4A 5EESA 3HB4X 4TROA 1XGKA 2NQ8A 3VZRA 2FMUA 4S3MA 2VYVA 1VLLA 3NEPX 4WASA 4FFNA 3PFFA 1WVGA 1WDMA 3INRA 1HLDA 2QZ9A 4XB2A 3V2UA 1GUYA 1PJ3A 4I08A 3TPCA 4ND5A 4WLEA 4NK5A 3UICA 2Q1SA 1GV0A 4HXYA 1N92A 2YDYA 1ORRA 3PXXA 3FF4A 1T26A 1UP4A 4XX0A 2GYYA 1HDOA 2R2GA 2Y1EA 2CZCA 1LTHR 3FSRA 3CPSA 5B37A 4B7CA 1WDLA 2BFPA 1Z7BA 1WNTA 1NR7A 4PLWA 1OOEA 3JD0A 4RPHA 3JYOA 1X7DA 5L45A 4KOAA 3V5NA 1V35A 3TL2A 2X23A 4W9NC 1Y7TA 4YB8A 4AJ1A 3U4CA 3RWBA 2D2IA 2VRBA 4WKGA 4CR6A 2NNLD 3FNHA 4QUKA 5I7FA 5A03A 1MP0A 4LVCA 4WOKA 4CR8A 4I5DA 3KVOA 3EVTA 1P1RA 4A27A 4CQLA 1BXZA 1GYPA 1SMKA 2B5WA 3TRIA 3PEFA 2Y66A 1T2CA 1SC6A 1QYDA 2PZJA 3ICCA 2I5PO 1XQ6A 4CODB 2B4RO 5HWSA 4MVJG 4EEXA 3BTUA 2DAPA 2HDHA 4RVUA 3VPHA 3GVHA 3DONA 1LDMA 1OZAA 3K73O 4R54A 1VSVA 3ZDFA 2ZTUA 1QLHA 2GR9A 1EQUA 1B0AA 3RFXA 4DQXA 2CF6A 4ZJUA 4MJLA 4MO2A 1V3VA 1B26A 1E1NA 1QLJA 3UFXA 4XA8A 1ONNA 3JQ8A 5TLSA 2GRAA 4KQWA 4RVGA 3GOHA 4GBJA 2AMFA 4XR4A 3WGQA 2WWRA 4WLNA 4EITA 5DT9A 3I4CA 4KUHA 1L1FA 3D3EA 4BNJA 4QX6A 4YJGA 3L6DA 1P9LA 3W8FA 4ND1A 1CDOA 4GVLA 3CEAA 1SAYA 1UXIA 2BLLA 2VYND 2QRJA 1T2FA 5DNAA 4PG8A 3MJSA 3R3SA 1OAAA 4YEDA 1E7QA 4Z3DA 3U09A 5G0SA 4XYEA 1X7GA 1NX6A 2DM6A 1PIWA 3HQ4O 4HWKA 1ISGA 4ZU3A 1UXJA 5F1OA 4R3NA 3T7CA 2EKQA 4IUYA 1UP6A 1VL0A 3IJPA 1GZ6A 4CMAA 1HDYA 4RPGA 2FP4A 2OXIA 2V6MA 1J0XO 5KNLA 4N7RA 5JW6A 4R1NA 2HUNA 3ZWAA 5F21A 3GR6A 5L4NA 3CINA 4AG3A 1H6CA 1X0VA 3OHSX 5A9TA 4IDGA 3K2EA 1N7GA 4GKBA 4GQAA 2NVUB 2PGDA 2QIOA 1E6UA 4LCEA 2X6TA 5JAIA 2EGGA 3QVOA 2P9EA 1H9BA 2ZTVA 2PA3A 4OJNA 1FMCA 2GERA 1KERA 1HT0A 3WMXA 2OORA 3U62A 5CFZA 3IL2A 1GL3A 4CMCA 4AJIA 3RUFA 1G6KA 1P31A 2HAEA 2WSBA 2ZQYA 4PFJA 4DLAA 3TOXA 4AJOA 2OMEA 5HA5A 3GG2A 2DBVO 3PJGA 4OQYA 4L9RA 3AFNA 4TKMA 4PZEA 2AG8A 4BKRA 1TVEA 1LXCA 3MOGA 2I65A 4IMRA 1NNUA 4GPD1 2PD6A 4L4RA 3ZWPA 4DBVO 3VTFA 3S2IA 3LLSA 3ZHZA 5IZ4A 3GF4A 3D0OA 3T7EA 4LSWA 1MFZA 2R6JA 3PJDA 4S1VA 1PJ2A 1GDHA 5BR7A 4YTEA 3KTDA 2HMVA 1K6XA 5CPFA 4KTTE 2BFAA 4M49A 4I5EA 1WMBA 2CUKA 1UZLA 3JQDA 3NGXA 4PZCA 4GWGA 2DBQA 4QO7A 3DDNA 4WCFA 4BGVA 2BI7A 2E37A 4CMKA 3WQSB 4UAGA 4B7UA 4F6CA 5JYAA 1BMDA 2Q46A 4CLOA 3PFWO 5DBIA 4MIYA 3A06A 1LSSA 2A9FA 4W6ZA 4JN6B 3JTMA 5I7SA 3OA2A 3LT4A 4OYRA 2HK9A 1IB6A 3IAHA 3IOYA 4ILKA 4N5MA 1BW9A 3UOGA 5G2OA 3IQDB 3K5PA 1H2BA 5GZ6A 3TZCA 1U3VA 3PDUA 3BTVA 1E6WA 3MZ0A 3VKVA 1ZBQA 1YQDA 2X22A 5TS3A 4AL4A 3UH1A 3OETA 2WYVA 4F6LA 4BNZA 1XQ1A 3B6ZA 1XA0A 4FJ2A 4BNXA 3RBZA 2I76A 1D7OA 3B1KA 3B1FA 3QJ5A 4QFDA 4N54A 1ZK4A 2PY6A 1PJBA 5JAQA 3LU1A 5H83A 4EGFA 2X9GA 1R16A 4Z9YA 4KUGA 1U28A 4CQMB 3C7CB 1ONPA 4R69A 5CPBA 4Y8VA 3PYLA 3QV1A 4UVGA 3U4HA 2X5KO 3OA0A 5JYEA 3EY4A 4I9NA 1G1AA 5BQFA 5AXBA 1A4IA 5AQ1A 2PV7A 5I9MA 1H0KA 2W98A 1LDGA 3FRJA 4XYBA 3IKVA 3RI3A 1LX6A 3A9WA 1Y6JA 1CETA 3O03A 4TRMA 2Y93A 1GUZA 1B2LA 3UKOA 2UVDA 4HV4A 3MWEB 2Y0CA 2YV3A 1ZIDA 4FJ0A 4F3YA 4B3HA 2I99A 2Q50A 3ZCXA 4CLRA 1PS8A 5KTKA 3RC9A 5B12A 4EJMA 1DIGA 2ZJ0A 2D8AA 4TWRA 4K9DA 1Y8RA 5IJZA 3D1LA 4PLCA 1C1DA 2VTEA 1A27A 5FFFA 3UUWA 4ALLA 4LN1A 1RYDA 2X1HA 5T5QA 3K2BA 3LZ6A 3KETA 2UV8A 4HFJA 4J1TA 2DKNA 5ICSA 3C1TA 2Q2VA 1KS9A 3MTJA 2DVMA 4WLVA 3QQPA 4WK6A 4ZD6A 4FGSA 1U8FO 4FPXA 4WCFC 4B4UA 1YWGO 4ND4A 2O7QA 2AA3A 3GZNB 4QXMA 3F3SA 1VI2A 3ZV6A 2AHRA 1NHGA 3ORFA 2D5CA 1IUKA 2Z5LA 1VSUA 3QRWA 2J3KA 1MG5A 3D3WB 1K89A 4ZQHA 1HWYA 4LMPA 3E82A 3NJ4A 4O0LA 1K5HA 3WQRA 2C29D 4NBTA 4UEOA 3TFQA 3JQGB 1LRLA 3I3OA 1DHTA 1XKQA 1I10A 3IUPA 4URFA 4RZIA 4U6QA 4II3A 4BNTA 1P33A 2D59A 1RYEA 3SLGA 5IDQA 4PRLA 1PL6A 1NP3A 1SOWA 3FPLA 3KEQA 2PZLA 2QHXA 1KC1A 2ZYAA 1A7AA 1ZNQO 1EEHA 1I01A 2F00A 3BMCA 4YBZA 4C7KA 3B20A 1UDBA 2J8ZA 3W4KA 1NVGA 2ZATA 3PZBA 5A4DA 5T6BA 5FWNA 3VDRA 2TMDA 1LLDA 2D1YA 3ZWBA 3HNPA 3AM3A 3WTCA 1PL7A 4D3SA 4R9SA 1C0PA 4DYDA 2VWGA 4NJMA 1DFGA 4MVJI 5TIIA 4OSPA 3HG7A 3VZPA 4IMPA 3D5QA 2O2SA 2RBEA 2G82A 1C14A 7ADHA 2RCYA 1IYZA 1I24A 3EMKA 3ZI0A 3GDFA 1U8XX 5I7VA 4AJJA 2E82A 4PRKA 2PWZA 2DTXA 2NTVA 4UEKA 4EZBA 5L53A 2EF1A 4WOJA 1E7WA 5J23A 3RASA 1KEVA 1XR3A 3DZBA 1R4NB 3P7MA 2DPHA 2AXQA 1EMDA 1P3DA 4D0SA 1NWCA 1I8TA 4ONEA 1J6UA 2IZ0A 3GHHA 3G17A 3MWDB 4G65A 5JCJD 2EV9A 2QZZA 1BVRA 4YYZA 3WLFA 3QWAA 5G4LA 1Q1NA 1XDWA 3L6EA 1H6AA 4R4JA 1V3UA 5TF4A 3H8VA 2C5AA 1JKJA 4UEJA 4KMSA 1TA4A 4YA6A 1UXKA 3ZWYA 1HYEA 1M76A 2W8ZA 4YAKA 5JPIA 3F9IA 3GGGA 2B35A 4YT5A 2HLPA 4XQCA 3RJ5A 5JLAA 3QVTA 1C0LA 1T25A 4GX2A 5A3JA 1B3BA 5IAAA 4G2NA 2EP5A 4R01A 4B8WA 2V65A 2ZCUA 2FZWA 1L7EA 3CZRA 1NVMB 3ZWVA 3F4LA 3DAFA 1EUZA 2VQ3A 4MP8A 2NLOA 4R5HA 3DAPA 1WWKA 2IXBA 3F1LA 1F14A 2JHGA 5DP1A 1NXQA 4XB1A 3ZH2A 5IFLA 3LDHA 2NU6A 3EK2A 4ZQGA 2AE2A 4IQ8A 4J1NA 1KOLA 1PZEA 4JK3A 2Z1MA 3RCBA 2W2LA 1P1FA 3PGJA 4UVDA 1DC3A 4M8SA 3CE6A 3OSUA 4Y6SA 1XCBA 5KJFA 1T1SA 3EDMA 4I5GA 4R16A 3LT0A 3WG9A 1ZJYA 2C07A 4R1TA 3QY9A 4Y6PA 4K6FA 1YRLA 4QQRA 1PGQA 1DEHA 5H81A 3JQAA 5TT0A 2P2SA 2YQ5A 1GQYA 1RKXA 4GSKA 2AEFA 1KY4A 2PH3A 5T67A 3ITKA 3V2HA 3VVBA 4JQCA 1P45A 5IZCA 2NACA 3ETGA 1TXGA 2JCVA 5A3VA 3GG9A 4GKVA 1D1SA 1IHXA 2OP0A 2CF5A 3H65A 1YL5A 5ILOA 1HYGA 4C4OA 2B4QA 3UXYA 3TF5A 2JJYA 1LEHA 5H82A 3RU7A 2XF8A 2NV6A 4BO0A 4OXKA 2IODA 3RJ9A 1E7YA 3PJEA 3BA1A 1U2GA 2OZPA 3DFUA 4BO1A 4BNMA 4W7HA 1EVZA 2DU8A 5F5NA 5ADHA 1GQ2A 3GQVA 4P4NA 5C7IO 1EE9A 1V6AA 1P77A 3F47A 1SPXA 1N2SA 1P1JA 5EIOA 4UUMA 2NWQA 2GZ3A 3B70A 4M86A 4NH4A 3FNFA 4U7WA 3BXXA 2HRZA 3AU9A 3W1VA 4EJ6A 5HTOA 4OM8A 4ALJA 4ALNA 4PG7A 3GLQA 5L51A 1Y8QB 2NTJA 1O0SA 3ROQA 4UUNA 4D0RA 4E5PA 5EN4A 3KEOA 5FYDA 1JVSA 1NPTO 4X54A 3RBXA 1H6BA 4BNIA 2FPGA 4GX5A 3DL2A 1DFIA 2IEBA 4YPOA 1GZ4A 2O23A 4RDHA 1PZGA 5T73A 2YJZA 3F1KA 3GN2A 2UDPA 2P4HX 4C7JA 3ZWXA 1LLQA 2NTNA 4WLUA 1U1IA 1Z74A 2Q2WA 5EINA 3HFGA 5CDSA 3TZKA 4IIUA 5F1KA 3E5MA 4L4SA 4HP8A 3D64A 4Q3BA 4BHTA 4BKUA 2B5VA 3PGXA 4JBIA 1UAYA 3EAGA 2FRDA 3DZFA 2GASA 3E18A 2O4CA 4YR9A 2J3JA 3ZV3A 5DP2A 3RUDA 3UHAA 4RF2A 2DPGA 3R1IA 2VTDA 4ZQBA 2E48A 4BKOA 1YL7A 5DCYA 5TQVA 3WGTA 1AHIA 4Q3DA 3H2ZA 3WGHA 3BHJA 3OECA 5DBFA 3TOZA 4NZ9A 4PLHA 5KCZA 4J7XA 2A94A 3AWDA 5JDIA 5GY7A 4HFNA 2EGHA 4MVJE 3P2YA 1JKIA 4PLPA 2AQHA 3WGGA 3M1AA 3QSGA 3DBLB 4FCCA 5K0ZA 4UVIA 3WR5A 2AEMA 4ND2A 4LRSB 2BKAA 5FI3A 1GUFA 2C2XA 2H9IA 3PQDA 3N74A 2JD0A 2NSDA 1IL0A 2AE1A 3D7LA 3OEYA 3ZU2A 5BSHA 4A10A 2DUUA 1DXYA 2CY0A 4Z9FA 4BO9A 2YW9A 1UXHA 1FDSA 1ULUA 5B4TA 3DZIA 3OBBA 1DO8A 1QV7A 3I4FA 4CM4B 1PQPA 3TFOA 3C1OA 1NWHA 2RH8A 3PIIA 4DA9A 3IP1A 4I9UA 3VDQA 3ON5A 4MINA 2VZ0A 4GWKA 1OC4A 1LI4A 1DDOA 1W4ZA 2Y68A 3IC5A 3JCZA 3JQ7B 4D7AA 3I9NA 1K3TA 2ZTLA 3DWFA 3RFTA 1U5CA 3F6YA 4YRDA 1QV6A 4D46A 1VC2A 4IY1A 4INAA 4XQ9A 4KWIA 6ADHA 3VTZA 5JC1A 5C7LO 1NQTA 4B4VA 4BGIA 3RC1A 2Q4EA 3FTNA 3G49A 3L9WA 3GFBA 3GK3A 2CDBA 2HJSA 3I52A 4QT0A 2LDXA 2C20A 5FI5A 2NVUA 3K92A 4PLVA 2G17A 1KIFA 4CL8A 3VPFA 4XRGA 4CMEA 1VKNA 2Q3EA 3H3JA 3C3XA 3IKTA 2NVWA 1NR1A 1O89A 4I8XA 3GY0A 3T4EA 3H5NA 1NTOA 1ZK2A 5GMOA 4D45A 3G1TA 3FHLA 1WDKA 2DC1A 5TC4A 8LDHA 2NQTA 3ROPA 4FR5A 3ZW8A 2EG9A 3L4SO 4WPGA 3A28A 5KJCA 1SOVA 1BXKA 3KOUA 2PKRA 2ET6A 4PLFA 4E31A 5BNTA 2HMSA 3UVEA 1X13A 3CUKA 3X2EA 1H9AA 1E92A 2X0IA 3QWHA 1DC5A 4FGWA 3BMOB 5JNLA 2JHFA 1KC3A 5KJ6A 1U2DA 2J5QA 3DOOA 3GVXA 1QYXA 5DDIP 4IZHA 4IXWA 2IE0A 3Q2KA 5JDIC 5DN9A 2DFVA 4DPMA 3ZW9A 2YFHA 3ZV5A 2HMUA 4NDNE 5C37A 1QORA 2GN8A 2F1KA 2VZ9A 1MC4A 3ABIA 1UH5A 3O26A 4ZGWA 3RUIA 3ZWWA 1IE3A 1K0UA 3V1YA 3E9MA 4XDZA 1HE4A 2VHVA 1YQXA 4D42A 1TEHA 2DTEA 1HTBA 1E3EA 1WPQA 1H93A 1IULA 3GRPA 2VUUA 1HDGO 3DAGA 3RC2A 5CDTA 1MGOA 1I2ZA 4JJFA 4NNJA 3MEQA 4TZKA 3MJVA 4R5MA 1V9LA 2DUWA 3K30A 1KVQA 3TDKA 4J43A 1N1GA 1QP8A 3ZWNA 5TX7A 1DRVA 3SBOA 4DIBA 1JLLA 1ISMA 3L4BA 4PLZA 3WWYA 4PLYA 2HO5A 4CR7A 2C0CA 1N9GB 1PJ4A 4OGWA 1GCOA 5KVCA 1X14A 3EHEA 4A2CA 2PFGA 5TGDA 1HSOA 2XAAA 4CQMA 5JO0A 5AXDA 2POQX 3NTOA 3W6UA 3WYEA 4CLXA 5JY1A 4CMEC 3VC7A 1GY8A 2Q1TA 2RHCA 3NGLA 2UAGA 5BSFA 4I5FA 1IPFA 1U4OA 2BELA 3NDIA 5KWEA 4NBVA 5JE8A 3OH8A 4ALMA 3IIEA 4JJIA 4CV0A 5F1PA 5IZCC 2ZCVA 4OOEA 3RIHA 4OKIA 4E3ZA 1ENYA 1M67A 2C5EA 3BTOA 5I9LA 1Z45A 1JDJA 1ZKMA 1R15A 2VN8A 1QMGA 2VWPA 1NPDA 2DBRA 4YT4A 4CMHA 3DZJA 3K9QO 4TRNA 4XGIA 4J6FA 1KEWA 4Y98A 4CMBA 5TSDA 5U9CA 3AY7A 1LRJA 2VZ8A 3S8MA 5GZ3A 1HDZA 3H7AA 4K26A 2E6UX 1G0OA 4LVUA 4FB5A 4MP6A 4FSHA 3PK0A 2J5KA 4IM7A 1GPDG 1HSZA 5K6AA 5A05A 4JBHA 3DBRA 3SLKA 1HL3A 5TRTA 5COAA 3AUAA 4U6SA 5LDGA 2CVZA 4ZRNA 3WNVA 2NUAA 3HJAA 1GU7A 1VJ1A 2ILTA 2DBZA 3C7DB 1ZUD1 3GZNA 1YJ8A 1M75A 2WD7A 4MVJH 3AFMA 4GLLA 3TZHA 9LDTA 2GUGA 1VM6A 3HDYA 3D3WA 4CM8B 5A9RA 3GNTA 4G81A 1PGNA 2FSVA 4J2OA 1UDCA 5CEJA 1P0FA 1DB3A 2DLDA 4W82A 1B7GO 4DPKA 1DJNA 4XQGA 1CEQA 3JQGA 5EQFA 4TVOA 4CUZA 4NHEA 4BNUA 3DBVO 5DCWA 3HB5X 4FW8A 1CWUA 4CM5A 1GV1A 4RCVA 2EW2A 3H9GA 1ISIA 1ZSNA 4IDCA 3KV3O 1NHWA 4IJUA 1EZ4A 3LLVA 3GZ4A 3PLRA 2V6GA 1J5PA 3MJCA 3WSVA 3PQEA 2BH9A 1JQBA 3L4BC 3DOJA 5ER6A 4JROA 4A73A 2O3UA 4YT2A 2NM0A 2FOIA 5ENVA 3JQ9A 4MVJA 3ZNNA 1U3UA 3OIGA 4RORA 4CV3A 2W90A 4BNFA 2WYWA 3NX4A 1AN9A 5KOIA 5DOVA 4BS9A 1XIVA 2GCGA 1PJCA 1Q0HA 1D3AA 1NM5A 3F5SA 3M1LA 2YHUA 4Z9XA 1TT5A 3Q9UA 4J49A 1NVTA 2O3QA 5A1TA 2Y1FA 5J9GA 3DC2A 1UZMA 1I3NA 4E0BA 4A26A 2IXAA 1ADGA 1PR9A 1XLTA 2CDCA 2G0TA 1U3TA 2Q45A 2NVBA 4BV8A 3NTRA 2PTGA 4W99A 4DIOA 1ADCA 2Y05A 1R4NA 4R3WA 3ZGYA 5IN5A 4YJDA 1BRMA 2AQIA 4YDRA 1ZK3A 4KUEA 4L76A 1Q7GA 3WGOA 2W2LD 5I7EA 1SZJG 1NQ5A 1H5QA 4D3DA 5K6AC 1E77A 2WMDA 4QO8A 3WWZA 3H6KA 1EE2A 2HCTA 1LU9A 2RHRA 4WEQA 1GEGA 3KYDB 2BFMA 4QEDA 4LK3A 1YQGA 3CH6A 3Q9NA 2E4AA 1GZ3A 2JFHA 2RH4A 2GN6A 3AU8A 3NV9A 1GQQA 1I2BA 3OQ1A 2H63A 1ZFNA 3OIFA 3AI2A 1LC0A 1E1MA 4RVDA 5JY6A 5CP8A 1CERA 1SEPA 3MCVA 4TMFA 2Y0DA 3KUXA 1NFRA 2A92A 2ZQZA 3NYWA 1A5ZA 4J7UA 4D41A 4EW6A 4CQLB 3E6AA 1Q0LA 1DC6A 4Q3EA 4E32A 2X0JA 5HRUA 1XYGA 1PS9A 4BVAA 4XKJA 3OJOA 4JP3A 3FPCA 1E5LA 4HKTA 1LLCA 1T2EA 4CL3A 1B8UA 3HSKA 4BL5A 3Q6IA 2Q49A 2HMTA 3FI9A 5K9ZA 4RF4A 3GVCA 1BSVA 4WLOA 4ND3A 2X4GA 4JIGA 2BGLA 1D4FA 1DAOA 3LT1A 5AXAA 3JQ9C 4O6VA 3VH2A 2HK7A 2OUIA 4CPDA 3WIEA 5L9AA 4BGEA 4N5LA 1JWBB 4AJEA 3LF1A 4ESOA 3L6OO 4FOOA 5MGBA 4PG6A 1ZEMA 3R3JA 3ZNPA 5ITVA 2CD9A 4CUKA 4EUEA 1C0KA 2HJRA 2Q4BA 3LC2O 2DTDA 4A0SA 3RKRA 5JSFA 4OKNA 1YDEA 1DBVO 3PP8A 3BMQB 3ZHXA 1U9JA 5CDYA 1SBYA 4DC1A 4E13A 4HX5A 3ZU4A 1GAEO 1AGNA 3GMDA 2G1UA 2J5RA 3DHNA 1Q2XA 2X7HA 1A72A 1DFHA 4YRAA 3AOEA 3CZMA 3HN2A 7MDHA 1GD1O 2QQ5A 3ETDA 2AW5A 2EEZA 2PZKA 4L75A 1PQUA 4F46A 2B69A 1I32A 1M6WA 4ZQFA 1NYTA 2YHIB 1HEUA 4UULA 2ZB8A 5B4UA 1GYRA 4LW8A 1K6JA 5T57A 3LVFO 1ISHA 1PS0A 1VL8A 5TNXA 5CDGA 1LA2A 1YB1A 4U0JA 2EKPA 5JAMA 3CIFA 1GTMA 1RPNA 4BUCA 2GZ1A 1I30A 2UYYA 3RSHA 3W4JA 3IUSA 5COQA 5KVQA 2I66A 1Y8QA 2OOSA 2PKQP 3SJUA 1SEVA 2D3TA 3SVTA 2NADA 1X15A 4E2ZA 3GPDG 4E4YA 1EQ2A 2GZ2A 2H6EA 5TJ9A 2JFGA 1KVSA 4LISA 2GO1A 5JMWA 1PGJA 2G76A 1Z7EA 3SC6A 4PG5A 1LSJA 3NDRA 5F5LA 2BMAA 3KYBA 2JD1A 1C3VA 2HU2A 1GADO 3E48A 3KSUA 4YAIA 2VUTA 1ENOA 4WEOA 2JAPA 3I6IA 4PIVA 3PDJA 5CG2A 1NFFA 3H9EO 3B1JA 3GGOA 4YT8A 2BGMA 2ZB3A 1Y81A 1I0ZA 1C1XA 3NKLA 4DREA 4OO3A 1D8AA 1E1KA 1E5QA 4J16A 4M89A 4NFSA 1LRKA 4UVHA 3S1LA 1H94A 1HETA 1I3KA 3FR8A 4RVFA 4DWVA 1RM4A 3P19A 3H3FA 3TL3A 1QSGA 1BDBA 4P4LA 3VH4A 1ZSYA 3GUYA 2I6TA 2AQKA 4R1SA 2C2YA 2DT5A 4HNGA 1EBFA 1ZH8A 2YV2A 3LQFA 4ZA2A 4Z6KA 1KEUA 4BO8A 4RPJA 4E5KA 2X8LA 4TRJA 4FN4A 1HF3A 4LSMA 1PWXA 1EFLA 2HMWA 3INTA 4YJHB 4PLTA 3DBLA 4BKPA 1FK8A 4FFRA 4I9HA 4XJSA 1YONA 3ST7A 2VHWA 3P2OA 4M1QA 4BNWA 1WZIA 1YOVB 4J90A 1ZK0A 4F45A 1BXGA 3FD8A 1E1LA 1J49A 5U1PA 3TWOA 4CM6A 3OJEA 4CM4A 2QG4A 4NFYA 1TLTA 1QG6A 4U0KA
chains in the Genus database with same CATH superfamily
2BDUA 2WFMA 3T9AA 2CVHA 5CG1A 5K0GA 1Z0AA 4WJZA 3X1MA 3RRJA 1JSXA 2WUVA 4G4SP 5DU2A 1SKUA 1RACA 3JQ7A 4EI2A 4HDKB 2BFCB 3RS0A 3UH0A 1YZYA 3QFCA 4FGJA 3P4UA 4D80A 1VGQA 1IOLA 3LJKA 2H8GA 3NDJA 2E18A 1MHMB 5HM8A 2C84A 2BFEB 2D5BA 2Q9CA 4Q7MB 4MS4B 4U7TB 5IHXA 3L77A 4RV5A 4YLEA 2Q62A 3P9YA 3GVPA 3AJDA 3REOA 1XN4A 5EXTA 4EY3A 4ZYYA 1WRBA 2CC2A 2YXDA 4MUKA 3CE9A 4PS0A 1TK3A 3I5YA 5C5IA 3CG0A 1EUCA 3DKKA 5I7UA 1L5YA 2X86A 1J8FA 2RHGB 5TPZA 1SU8A 4AJPA 4KITB 3VA7A 4DMUB 5JJCA 3MRXA 4MR8A 3CMMA 3U4DA 1MEJA 1AU9A 3I6BA 1X7ZB 4YAGA 3E9ZA 3C43A 5IARA 1RNLA 2C7BA 4ZO8A 5AW4A 1QTRA 2D3WA 1NKTA 4GKAA 3SQMA 3ZJTA 1KK3A 4RJTA 2AYXA 2V9ZA 3V2IA 1R27A 4UUPA 5AM1A 5DEOA 2WNHA 2VP9A 3ONDA 3HGMA 1B15A 1HE3A 2RIRA 3PWZA 4LYEA 1XLUA 1Y9ZA 3PJFA 5D7BA 4JBXA 3E4CA 2CVOA 1N7IA 2DHQA 3KZOA 2L69A 1JEOA 2YIJA 4HPXB 2JW5A 2GCNA 1K5DA 1Z6ZA 2XT0A 3OU7A 1XTQA 4DV5B 4BRUA 3ZCTA 3D4BA 2WT8A 3H2YA 3OOWA 4PS1A 2BKEA 4WE3A 4DIUA 1CUVA 3DZDA 3K5WA 5EKXA 3DBHB 2CKMA 2VR1A 1TVKB 1OH7A 2BN4A 2QYTA 3F4BA 3TUXA 2UZ0A 3F3YA 3FNGA 4PQRA 1R4ZA 4WVLA 5EKDA 4FD3A 2Z3ZA 1GTSA 2NP7A 4RCYA 5E2BA 3TLBA 1YQTA 4LX0A 2B61A 3ROMA 3VNSA 1V8FA 3JQBA 3LUHA 2FSGA 4Y2PA 4YPVA 3CKLA 1D5WA 1J0AA 2A5GA 3DWGA 1FF9A 4GQIA 4IF4A 4ZI7F 5F3DA 3HHEA 4US1R 4HQ0A 1U0HC 2HRQA 3TQFA 3ZDZB 2G5CA 4QSHA 3E7WA 4ZU6X 5JNVA 5AVQA 4CGZA 2HMYB 1M8GA 2WJGA 3EEQA 3GT4A 4YMGA 1L5LA 4MS3A 2BZ0A 1VXRA 2AVNA 5DTQA 1HDIA 4B7AA 4NI5A 2Y6UA 3EN0A 1EIWA 4HDQB 3RIGA 3RYIA 1QDLB 2ZREA 1UT6A 2Z2JA 3D0RA 1LQUA 4GI1A 2XGOA 4FU0A 4INJA 2VNKA 3OZEA 3QWBA 4AY2A 3UWDA 3WBKA 1UKZA 3LP5A 1B76A 4I4TF 3ZE8A 4UREA 1HC7A 1ZN8A 3THWB 1R74A 5JAZA 3EP5B 5T4FA 5F9MA 1N0IA 2G7ZA 3MMXA 4RM3A 1S0UA 3B5JA 5E1DA 2Y76A 2FXIA 3PSHA 2PG3A 4F8YA 2B83A 1WR8A 3VU8A 3AC0A 4O59O 1UM9A 3FWZA 3QYAA 2JGDA 2Q21A 3L6BA 3R3YA 3WMWA 2GVZC 2R2AA 3H9JA 1ZD1A 3OQBA 1X3SA 2QQFA 3VSBA 1I7LA 4ECAA 1MG0A 4MWOA 4BN0A 3JVEA 2WVJA 4FZJA 3PQFA 2WJ6A 1QVZA 3V8QA 4A9AA 2CT8A 2E5WA 2HCFA 4R8RA 3LTEA 5DJ5A 3ZLVA 4B6PA 3ER9A 2ZS9A 1JENB 3DXFA 5HG0A 2NUTB 4ANFA 5JUWA 2DFKB 2J3IA 3JD2A 1J21A 3MT9A 4FDLA 1FTYA 4LHSA 4TL7A 2M32A 1I2CA 1DIRA 4Z0NA 5H9VA 1T5OA 2G0AA 3DP7A 4AO6A 5A3QA 5HJ5A 1CRWG 4L15A 3STXA 1NQOA 1F51E 4JLNA 1M7GA 1G3UA 4AMBA 5HKLA 1RXSA 4WXHA 1Z2CA 5CX1B 4WJKB 4UEWA 3UV6A 4ZDKA 4WNCA 2XBMA 3FHCB 1I13A 2FR1A 1NUHA 5KIAA 2P4QA 2WU8A 2I2BA 4ZRMA 3H75A 4OQLA 1BHSA 2WYUA 3UCXA 1XAHA 2QGFA 4IMIB 2R60A 4DLSA 3AR5A 3EPBB 2DY1A 4ENTA 2FCAA 3JYPA 3Q8LA 5IAJA 1A5TA 2OECA 4YREA 4DCPA 4IJVA 1RI4A 3EP6B 1M0SA 4MVJD 1VHJA 2LCFA 5IS2A 1GQRA 1EFVB 4QGFA 5FV4A 1BU8A 2OHGA 2XTMA 3L7KA 4D4MA 4HI0E 3FMFA 1F6BA 2WC1A 4TN5A 3ND8A 1XDDA 3PWSA 2Q3CA 4W9NA 4LOKA 4C07A 1LWNA 1CEXA 5EIWA 3UAZA 1ECGA 1PFWA 2EWWA 2IY7A 4EPRA 2QRNA 1HI9A 4G3XA 5EJ2A 3T3DA 4H27A 4NQZA 1SOMA 3W3ZB 2EFGA 1Q7BA 4WA8A 1FPMA 4AJHA 3WJAA 1CDZA 4OSOA 4DANA 2W43A 4L22A 4UBIA 3U9LA 2J6IA 3MS4A 3KKQA 5DYWA 1W4AA 4JLJA 1Q1EA 3BMNB 3OQ6A 3EC7A 1TUBB 2GH1A 3OFNA 3PGA1 5FBZA 5IUKC 4N3GA 1RWBA 4RLSA 4RDCA 1SG6A 1V39A 3EZXA 2CJPA 2H2IA 2O7SA 5BQOA 5HK9A 2WB2A 5FF9A 3QWFA 2C7VA 4NMWA 2YTZA 3DEFA 4NU5A 4DIMA 3TZBA 2O05A 1TFRA 3HJTA 1N8SA 4JBGA 1KTIA 4DV6B 1VKRA 4UC0A 3FN4A 2VOJA 4FZ5A 4KGXA 4UASA 4V2IA 1GEEA 4A16A 1OTXA 3EBPA 3JS5A 4AKSA 3G0DA 4QU8A 4CMJA 5CA0A 1H5UA 3S1SA 4L2IA 2BR4A 4DLBA 3E9QA 3D6MA 3NVDA 2WU1A 1WXQA 3A7EA 4A91A 1T9DA 3QLVA 1E4YA 3C8UA 4W1RA 3T12A 1YKFA 4GG1A 2FOLA 4Y1RB 1DC4A 1DPGA 3P94A 4DCMA 4CIYA 5JMTA 1E6LA 1G55A 2BM0A 1X9GA 2V9PA 4UDXX 3IUJA 1Q19A 1N4DA 1QM5A 5ESXA 2WZDA 1OI2A 4H7HA 1CQJA 1QUFA 1QK4A 1J5EB 1QK3A 3BIXA 3WGMA 2W4QA 1JALA 1GN8A 4PTLA 1SKBA 4LA4A 2WRZA 1CUUA 3B78A 3SBDA 4R51A 3VKFA 3NNSA 1ZOLA 2IHZA 3KL2A 1V47A 4A03A 3EYAA 1PW7A 2RARA 3LA6A 4MAFA 1YB4A 1PJTA 2YUTA 4XEUA 3I9JA 3R3UA 1WZ2A 4RL6A 3QEAZ 1E6CA 4B7ZA 4JC8A 1BH2A 1F9EA 1FX0A 3O3NB 4I5IA 4UBOA 5BN5A 2FEWB 2DKFA 3HXTA 4DIEA 4NBLA 4ITRC 1Z0JA 4E30A 4FQ7A 5ES4B 2BKLA 3P2KA 3E61A 3VKHA 1D04A 1Q7EA 2Z8XA 4FFSA 3GPLA 1G7SA 4V3BA 5IASA 1QYWA 4F9TA 3WYCA 2MCFA 1ICEA 3P20A 1A4UA 2QTZA 1PK8A 5FO0A 2R11A 1TI7A 3FSGD 4PR3A 4BJHB 6YASA 2Y1GA 4B48A 1ST3A 4XYLA 1E3WB 3W3AH 5B30A 1OV6A 1ZW1A 2D2VA 4GMGA 1S8OA 3KYDA 3LQ1A 2WFAA 1IPEA 3GRZA 1F6WA 4EECA 4ZJYA 4S1PA 2EZ4A 3DO8A 2HCRA 4EKIA 3T5GA 3BEDA 1YBFA 3SQDA 3HDQA 1KEKA 4CLDA 3ED5A 4RDXA 4L3WA 1XO1A 3DL7A 4EUSA 1LTQA 5B6JA 2GWHA 3F46A 4W8HA 4BMSA 4NPHA 1WXDA 1ESEA 3BJZA 3ZIAD 1T2AA 2X1MA 3LGAA 3TRHA 2JCYA 1C7QA 2WFLB 1CFZA 3N3AC 3BXFA 3NLLA 1XMJA 5J58A 3PI6A 1DQPA 4MEAA 4BPRA 3D3NA 4JOQA 4XCVA 2I2AA 2I6QA 1DIAA 3MF4A 3PIDA 4BNLA 4P58A 3ABRB 1UDAA 1V41E 2H5LA 3K0AB 2YFKA 5HKOA 4RTOA 4QPZA 3F5FA 5K6RA 1BHJA 2O2YA 2SCUA 2UVPA 2VDLB 3ELBA 3B6JA 1QOPB 5CTAA 1LNQA 1RVDA 3SICE 4CV1A 2DSNA 4D5GA 1E98A 5CFLA 3I3SR 3RT9A 3VR5D 3L8GA 1K4KA 2P3SA 5F52A 3U7JA 4RTPA 2R97A 2DYKA 4W9MC 1X86B 3CVUA 2PLAA 5CHEA 3RRZA 1DAFA 1W96A 5FUQA 4YJFB 1IJFA 4Q19A 4B6QA 3WOHA 3L7NA 1M66A 1V5GA 1T1RA 2ZAYA 4BMOB 2IDZA 5JRDS 5JZ9A 1YCFA 3UMVA 1XN1A 3EZ6A 5EERA 3INNA 4ZYVA 3SI7A 2DF8A 1EFCA 1PEDA 4WNIA 3RK4A 5FWXB 5BR1A 1E3LA 2P9QA 1WTAA 4FFPA 2O2EA 1IMOA 1ZS9A 4LX8A 4CFZA 5I5EA 1NXPA 2OCDA 4XLZA 4TT3A 1MD9A 4WKPA 3J80A 4F5WA 1Q1QA 3CXRA 4QD3A 2JARA 1ZA1A 4Q5IA 2E4ZA 3HXPA 4P7JA 3KRTA 3QG5A 3CMCO 3ZWKA 2Y9MB 3E2IA 4EZIA 5DM2A 5LVAA 2OCYC 5AVOA 3CT6A 1WB4A 2GD6A 2J9FA 3HJGA 3NHKA 4ROSA 5AKIA 3LECA 4EVSA 4QFCA 3QVKA 2EJWA 4IGEA 5C4IA 2ODTX 5K0FA 4IOMA 3MGKA 3M4JA 4YACA 4CTNA 3LH5A 5ECGC 3R6DA 2ZBPA 2Z2YA 5AW7A 3HEBA 4OQEA 3P2IA 1IOVA 4KQXA 3EIHA 3LPMA 1G5HA 5F1YA 1HV8A 3NCHA 3O90A 4HLQB 5IXJA 2P6UA 2YFYA 1L4YA 4NIMA 4UDOA 4J0HA 3EAFA 3ROGA 5IJ0B 4JJGA 1ORTA 1I5RA 1T15A 4QBTA 4XZ3A 4E5MA 5IF3A 2PZFA 3LOUA 2VHEA 1K06A 3CF4G 7MHTA 1U80A 3N39C 4EJSB 4HDMA 1URPA 5JOQA 5L7TA 1LLUA 1RZVA 1RP7A 3T54A 4EKGA 1FJ2A 2O8DA 4I55B 1EWVA 2RI1A 3BWBA 1UUFA 1H2AS 5PGMA 2IIBA 1JSCA 2VJNA 4G37A 1H4QA 3QHPA 3V97A 2C9CA 5CJJA 1JWAB 3ZH9B 1QRAA 4CGYA 5D3MB 4YV1A 4K9PA 4L4ZA 1OI4A 4K7JA 2P68A 4KN9S 6AT1A 2VAVA 3U37A 2VBFA 4WINA 4ARUA 1KSGA 2C5BA 3A9RA 4C4TA 1GSHA 1NTRA 5LU9A 1HE5A 3HA7A 4UQOA 1MA3A 4QQNA 1I5EA 1VE6A 1WMSA 2OQIA 4WN9A 5LA6F 4A8HA 2JLWA 1NXVA 2I4TA 2PVCA 3NBAA 4D9FA 3C97A 2ZAIA 3COSA 1BFUA 4UKDA 5JSYA 4HGZA 4XWAA 2EFDB 1XZGA 2JIZD 1BROA 3L8EA 1PT5A 3O74A 2RHJA 4QOFA 1SVMA 2GM5A 3FZEA 1G3IA 3WX0A 4YAUA 4NF2A 4FK8A 1TM2A 1TF5A 4G8CA 4U1RA 5CW2A 4BQQA 3P4YA 1EFUA 2OLKA 5JMOA 3A6PC 2SICE 3QVWA 1PR5A 1PZFA 1JHPA 1TMKA 1Z82A 2CLEB 2Y1DA 3LY8A 2N46A 3HJBA 4PXYA 2V3CC 1BKYA 4RV9A 4ZAGA 2AOTA 2IXTA 3EF1A 1UM8A 3QOFA 1L7AA 1W87A 1EK5A 2LCQA 4EUFA 4FOLA 3CEJA 2YWDA 1LPAB 4PC6A 3C2QA 4LK2A 4HEA6 2PZGA 3TFWA 1MT0A 1RWWA 2RHMA 4LGVA 3NT4A 1QP0A 1NP7A 3I42A 3AMVA 5KU1A 3RVKA 3I9LA 4QXQA 4XX0B 4FEEA 5B1YA 3LPDA 5JYFA 4GM4A 2IIQA 4REQA 4QECA 3BC1A 1FS5A 2YWGA 3WQQA 4EEZA 2OZLA 1Q7RA 3DGEC 4ZVNA 1JKMA 3SQWA 3OEEA 1GCUA 4I8DA 1MR3F 1QCYA 2FR0A 2HSDA 4XJTA 4KTVE 1J9GA 1CUSA 3AHDA 5AJTA 3R7LA 3RROA 5KHLB 1A98A 1F1JA 3D8SA 3F6RA 4F97A 1ECLA 5CFQA 4RA6B 1R4AA 4Y0NA 1N34B 3B6IA 4GI7A 5TT1A 3ZWCA 5L3RA 4QHYA 3Q5DA 4YAEA 3WWDA 2Q9BA 1OXBB 2RB5A 2ZI6A 3QVGA 2WE8A 4IFEA 4KZPA 2B1QA 5KQSA 4PAWA 2YXPX 2ZI9A 1IBLB 2R7AA 2P3LA 4B6RA 4P4TA 5I5GA 1QYCA 2Z83A 4LRXA 4MPRA 3W6ZA 3L0DA 2REOA 4GUDA 4JT2A 5JZSA 3HCCA 1X1EA 4PSDA 5HZGA 3OIUA 2OSVA 4UAUA 3NEAA 2XE4A 1ILEA 4OHUA 3ET4A 3IPAA 3GUHA 5IJWA 2ODBA 2AMLA 3IWCB 3P4XA 4DEXA 4QA9A 4X3CA 3H2BA 2ZK7A 3QNUA 4JT4A 1W6UA 1RQGA 2C8KA 4ASUA 4PLGA 2X19A 4LNAA 4FQ5A 1KQGA 3EIXA 2HYDA 1ZZEA 3STWA 3OM9A 1P9OA 4N40A 2ZW9A 4D44A 3VO2A 2BFEA 2WSLA 4G84A 1PX0A 4L57A 4MS4A 3UAXA 1S7CA 1QHFA 4HY3A 3GZJA 4E21A 3O7WA 4BNYA 2H54A 4P3OA 3NFRA 4KYTA 1SUAA 4DE5A 3WBBA 3PT9A 3T94A 2J41A 2OFFA 3WLEA 1MO5A 1PJQA 4WTOA 3BGSA 1UK6A 1T8YA 2AS0A 3KLNA 2V7XA 1AQUA 4P4UA 5EKTA 1L7OA 5FAKA 3LTNC 1E64A 3KB6A 3ZX5A 3EH1A 1NI4B 1MUUA 2RAFA 2QRVB 4BO3A 4BB6A 5ELXA 2XXAA 2BRUC 3QBEA 4KKVA 1KFEB 3TSCA 1N2OA 3MQ2A 1HG1A 1EP3B 5KNBA 1X70A 5DPMA 4O8JA 1OWNA 1X7ZA 2OD9A 1C7IA 1MHPA 2QYSA 3CX6A 1Z4LA 2FSSA 3GT7A 2P3OA 3FCCA 3LP8A 5AO9A 1E2BA 1T8PA 1B8VA 5EEHA 1DEOA 2O0HA 3B1ZA 4RK5A 3TQTA 3QA9A 4M1OA 3TQQA 2YC4C 1YA4A 2BHLA 3KFVA 5E1MA 4YRJA 4FGZA 4ACAA 4M6WA 4HFRA 2IW1A 4UZSA 3SSNA 5FHQA 2EZUA 3IV9A 3P1JA 4YAOA 4DIFA 1TOAA 3HFJA 1WG8A 1L0BA 3DBRB 4JL8A 4KI7A 4Q3OA 1QR6A 4Y67A 1M2NA 4RZHA 4YVFA 2EATA 3O4RA 2UYGA 5CXXA 3DBHA 5EQTA 1YD7A 1DIOB 3M8KA 3OC6A 3HN6A 4BATA 1JX6A 1YZGA 2BF7A 3F5QA 1Q6YA 5I8WA 4B3SB 4ZAZA 4H16A 2O6HA 1GFIA 3AEYA 3AW9A 3VR1A 3H5WA 2DCMA 3O84A 2VRCD 4FW9A 4NH0A 2FP4B 4XM2A 1J39A 4R40A 4F0JA 1XDUA 1PYDA 2UYCA 3NG1A 4F96A 5HFAA 4C14A 3ZLJA 3GNQA 2O5VA 2YIDA 2AI3A 4KIUA 4RPKA 5E9AA 4S0XA 1VIDA 1GTL1 1UFOA 3C3YA 3IEPA 5DHRA 2PX4A 1BX0A 3SX2A 2HA7A 2A33A 3PENA 4H3HB 2DERA 1B1AA 2JA1A 1J2TA 2BUCA 5CYOA 3VI3B 3TVDA 4RLFA 4HPWA 1ZY2A 4PZDA 3UGKA 1ZX1A 4IDAA 1WUHS 3D6NB 3PNQA 4P98A 4QDKA 1JG2A 4QJIA 4QU5A 5HMLA 2CXQA 4PC7A 3IWDB 4IEEA 1G63A 2GMWA 4O0MA 3NM4A 1SWVA 2VWHA 2XOXA 4Q7JB 5ALKA 2PRZA 4LMRA 2XD4A 3GARA 4QEZA 3UK7A 4DEVA 4QT4A 1N1DA 2VNSA 3E27A 1TCBA 1OWMA 4MUFA 1UIRA 3BE4A 3AUFA 4JB3A 4DEYA 3SMQA 1UMBB 2A8YA 4DMCA 3C14C 121PA 1DWOA 4A7PA 1WXXA 4EG0A 2PH5A 4CLEA 3GFOA 5EJ4A 1GT91 2CGEA 4C0WA 1IC6A 4FDAA 3ZTWA 2C5GA 1QPZA 3L7JA 1AXEA 1OT5A 3ZYZA 4AJ4A 1QU3A 1MCZA 5EAIA 1E3QA 1GSIA 5H0IA 4WY8A 5I7AA 2F9FA 1PSZA 5A2QA 1VQ1A 3ZU6A 1SIBE 4DQVA 3FYTA 4AZ0B 1BX1A 3LZCA 5D6NA 3MTGA 1ARZA 1WCIB 1FFAA 2O57A 3GVIA 4TXHA 1EM6A 2DQ4A 2JLZA 5ALSA 5ICCA 1LC3A 1I4TD 1EG2A 2EIHA 4D9KA 3RJZA 4E7PA 2OCAA 2JJMA 4G0OA 2AIRA 3DC7A 4EVIA 3BERA 5L3ZA 3OESA 3UJ3X 4E2YA 1U6JA 1SPBS 3DXZA 1OPRA 1D6SA 3Q3EA 4ZREA 2VOEA 5BVHB 4GMFA 5CX1A 1HUQA 3BBPA 5IULC 4CJXA 1CJTC 1DBPA 2AFRA 3CUVA 3C7AA 1QE5A 3U0BA 1M2EA 4MW4A 1ULSA 3HN7A 4AJNA 4DY6A 1Z4QA 1FJGB 3PTZA 1XLVA 4Y6LA 3L4EA 2IOFA 4II2A 1T4DA 4MVJP 1LPNA 1U0NA 3RRYA 4EL5A 4XGKA 4NV0A 2ONCA 4HAXA 3D1VA 3A6LA 4YUVA 3WIVA 1EWYA 2TMYA 1BO6A 1BRTA 1U7HA 3T5BA 3ENKA 4ITVA 1HZZC 3N7TA 1SB8A 3GCDA 3AL0C 3KIPA 4IOJA 4BNDB 4DC0A 3GRUA 2CL7X 2GN4A 2ZJBA 4OHXA 1EFVA 4BO6A 4CV2A 3TR0A 1ZUIA 2EKZA 5CW1A 1TQHA 5G1PA 3RIEA 1QYVA 1KH1A 3H0EA 1DTEA 3EXAA 3PQ3A 5JMPA 4AO7A 5THXA 3W8EA 1Q50A 2K87A 3BXPA 4HXEB 3I04A 4N3CA 4X1IA 3HXLA 2BTQB 3R9KA 4ZV4A 2WABA 4DR3B 2QVYX 1JBEA 4RQAA 1ZJZA 3JYNA 3Q7EA 2IX3A 1V3TA 4KEAA 3F3KA 5K3EA 1X1TA 2JIOA 3IAXA 4DLYA 1Z2DA 3FNBA 3KUDA 1G2QA 2YYYA 3QWIA 4NWIA 5DW3A 3T0GA 4F2PA 4D9BA 4FILA 4G4GA 5F5XA 1PL0A 1NW3A 5BSEA 8OHMA 4BLVA 2NTYC 4WFKA 3GRFA 3BMNA 1FYEA 1I1NA 1U90A 1QHSA 3A6HA 4J75A 1T2DA 3GT3A 4QOSA 4II7A 2B9VA 2GJSA 1NFQA 2LTAA 3V4PB 5LBIA 1SCAA 2J59A 1EWRA 4GNRA 3TZEA 5EHIA 3FMGA 4OREX 4XDYA 2A14A 2ISCA 3TMYA 4LRTB 5C1IA 3EZ2A 1J8QA 4NATA 2G1AA 2E7ZA 4LXIA 1R66A 2BEVB 4H6WA 4C43A 2VF7A 3I61A 1APBA 4CLRB 3K1JA 3KD2A 3L3BA 1R0XA 2ZIWB 3AHEA 1XUOA 1CDEA 1Y8RB 1FDUA 1T2UA 1J42A 1JA1A 1GQSA 1IDN1 1WMAA 3EQ8A 4XSGA 5DGHA 2D13A 3RVJA 4CKYA 3KQKA 5KS2A 1Q1GA 2FFRA 1BS1A 3QPDA 1RMYA 4J16C 5EHQA 3V33A 4OA5A 2ETVA 2HA6A 2Q3MA 4IHAA 3TB4A 5JXWA 4Y1RA 5LXTB 3HWRA 3EZNA 4F1WA 1FPQA 2CLOB 4I4TB 4BVBA 1GU0A 4BWYA 5KKCA 1KSHA 1QG4A 2AFVA 5CDUA 3KJHA 1IQPA 3F3MA 2V74B 3OPQA 3DVLA 3IUMA 6LDHA 2RGBA 5CURA 2WFZA 3STYA 3CZAA 3IPYA 5AI6A 2QW1A 2EFEB 4Z9AA 1CJMA 2NO1A 2WAMA 3K2QA 4DFDA 4FX2A 3BYZA 1UWKA 1MT3A 1JS1X 1MX9A 3X0DA 3JYHA 5EVJA 4D8VA 2NMVA 2B1RA 4XCQA 1YE3A 4J7CA 4NAHA 3UTCA 1KZGB 1D6MA 5A7HA 4NTZA 4DV4B 5TVGA 5CB6A 5LYJF 2O2ZA 3FUUA 5KWJA 1JQDA 1RC8A 2XQKA 3NTQA 3I1IA 1TDJA 1YVUA 1ZVMA 4QKQA 5DTIA 4ZT4A 2FZ4A 1E1RD 1YT5A 3GGSA 2K2QB 2C1EA 1SQFA 3HWX1 3EZ7A 3FXAA 3QUCA 1ZD3A 4KMRA 4MW7A 1BE6A 3VPBA 1E3WA 4E14A 5ALHA 2NO9A 1DL5A 3GUCA 4KI0A 3GDOA 3GGPA 1RCUA 2UUAB 4K88A 3C6ZA 5F4BA 1KBZA 2IYPA 4D43A 5JXIA 3V48A 2YJ4A 4TWIA 5EIAA 1ZC3A 1KK2A 2GGSA 3RHTA 3OZVA 4QOIA 5M3BA 3HR4A 2JFOA 4RH1A 4AZTA 4EUHA 1FRVA 3W5HA 1ZGBA 3URMA 3H1TA 1UJMA 3LQ2A 3ISTA 3OPNA 2PL1A 5AKXA 4W5HA 1DG9A 1RE1A 3B48A 4NFHA 3TN7A 3LLMA 3OZCA 5TJHA 3TLXA 1X39A 3KXIA 4XGRA 2IV7A 1Z5WA 4GP6A 2O54A 1DE0A 2Q6LA 2GNOA 2WFLA 5ES3A 2H1LA 3QXGA 1A9SA 1N8KA 5HF8A 3H16A 2ZYDA 2DQSA 4HDRA 4ZT2A 3U4QB 3GIDA 1Z75A 4LY6A 2QRKA 4YMLA 1CHDA 4RD3A 3K0AA 3A3NA 2VG8A 1TPZA 1WTCA 4MX8A 4CETA 4DLXA 1OFUA 1P1KA 4ALKA 3LHFA 2Y67A 1C1XB 2Z1NA 1EDZA 1OROA 4TKZA 2GN9A 4ICIA 3ENVA 5IUJC 1ZD2P 3JYLA 1GDTA 2INGX 5F35A 4ZVTA 4OGGA 3TLMA 4IHJF 1UADA 4YJFA 4NENB 3SXPA 1T4CB 5HR5A 1OHHD 1Y1LA 1YNSA 4DQUA 3AONB 3C0KA 1ZISA 3AUJB 2WPDD 3KSMA 2OZKA 3AFHA 1FOEB 1LV8A 2I87A 1N0HA 3FCXA 3VMMA 4WFQA 5DEIA 4OB8A 5FWXA 2HF2A 5KU7A 1OH5A 3I2KA 4QYSA 4JI4B 5C7OO 3PDWA 2X9NA 4RENA 3X2FA 1JKJB 5LUBA 3I1JA 4IXMA 3RTDA 1YVEI 4HNQA 4OB6A 4QM6A 5GOTA 4PAOA 3KLMX 1UZNA 3DOHA 1EGVB 1YTUA 1U1EA 1Z4MA 3QW4B 3U40A 3VSDA 1JVBA 4OGKA 4YXWD 2FMHA 2OHXA 3OO0A 4RQTA 1YVRA 4KAJA 2WJHA 3FRIA 2V7QD 3E9NA 4NJEB 1FNMA 3DJFA 3TAUA 1PGPA 1N1EA 2P77A 2WSYB 3ANLA 4KE8A 3AB3A 4LCJA 4P35A 3HEMA 4E1BA 1EVJA 2O3SA 1QFYA 3B13B 4QBIA 1AUVA 2Z58A 3NAMA 4H60A 4EVQA 3EA5A 5G0UA 2NSYA 1FXSA 4JUIA 5DVZA 2FPPB 3TSWA 4H2DA 2B5OA 2CFRA 3HBLA 1PFGA 2AYYA 3KFXA 2YOFA 4TKLA 2D5AA 3PXUA 4ZV7A 4C6HA 4BQIA 5MDHA 3QE9Y 1JG4A 4TSFD 1LWOA 1U7UA 3BIFA 5IJ0A 2VDVE 1W7AA 4CM9D 3CLTD 5B64A 4FHDA 1RQNA 1D5CA 2QQGA 3UAOA 3ZXIA 4EJSA 5KYYB 1KVTA 4U8GA 3R4CA 5T8KC 5AD1A 4F84A 1ZJ6A 2BZGA 2AMVA 5LJIA 1CJUC 5DMXA 4I55A 2XLBA 5C8YA 2PQ6A 2B78A 1QHGA 4OOFA 2HEGA 1Q84A 4HAUA 3UCEA 4OI2A 4UJ3A 1V7QA 1XFDA 3KT8A 4UHKA 2IXEA 3MB5A 1PQWA 3Q0TA 4NULA 1XVLA 5IBRA 1UC9A 1GCIA 5TF0A 1SELA 2TMGA 1GXSB 2IZ5A 2CFCA 4OAPA 5D3MA 1U04A 3K0EA 3NJRA 3RYTC 2AQ8A 2NU7B 3QE0A 4QWWA 3CLVA 2C5FA 1O94A 4ZVQA 4ETNA 9LDBA 4RELA 1JWLA 2WP0A 1XYVA 2H07A 4M0FA 4REOA 1EG7A 1SXHA 1H5NA 2LVBA 4DUPA 1R37A 1NE7A 2C3PA 5KNDH 3FOBA 2I1QA 4L6IA 4K8RB 3LUFA 2CMFA 2XTNA 3AR8A 1U0LA 2A9QA 2YJGA 3BSWA 1MQSA 3DWEX 3K96A 4LXTA 4N12A 4WXRA 5AJHA 3ZJYA 3B38A 1P39A 3LK7A 2IKQA 4GP7A 2OO5C 4OYLA 1PWYE 4ZO9A 5E2AA 4DUGA 3DZ4B 4TLCA 4PGGA 4RANA 4Y18A 2ZYUX 3VJKA 3HO1A 1LVUA 4TROA 2NQ8A 3VZRA 4KZKA 3Q4GA 2IEYA 4E7OA 3PFFA 4BYMA 5ECYA 5HOEA 2OC9A 5E3JA 4LJ8A 4BMXA 2GPBA 1GIAA 1IWBB 3OZBA 1F9AA 3KXKA 2Z2KA 2CLKB 1VZ3A 4BTVA 3UICA 1CU1A 4ER5A 1GV0A 2YDYA 2HWUA 2DCUA 3PXXA 4BX2A 3FF4A 1T26A 4XX0A 1PE0A 4ZCSA 2YN4A 1QV9A 5I7HA 1L5RA 3FOZA 4P2BA 3W5AA 2CZCA 2BFDB 3CPSA 3FSRA 4RMJA 2HT6A 3ESDA 3V1NA 1WBDA 1NF2A 4G97A 2PPVA 4RD1A 1NR7A 1RHQA 4S1OA 1OOEA 2IZ7A 4I99A 1KZ7B 3KZ1E 3O8RA 4RA6A 3JYOA 1X7DA 3AKDA 1OIVA 3G7NA 1XL0A 3L0YA 1THGA 3BL5A 3N59A 4KOAA 3V5NA 1DTSA 4J0QA 4MUMA 5DN6A 2QB5A 1A69A 3MGCA 4AJ1A 4N0MA 5C8DA 2E1PA 1EB8A 2P6RA 5ALRA 1EFRD 4JP5A 3QFSA 2I8AA 5IFKA 3TLYA 4WKGA 4LDRA 2NNLD 4JMPA 3OQPA 5A03A 2C97A 1Q95A 3NHLA 3SYMA 4JHXA 4RSHA 3ABSB 1GITA 1O5TA 3FWHA 3KVOA 4XASA 3EVTA 4YGXB 2EX4A 1P1RA 2XJ9A 3BS4A 5SZKB 1A1SA 1KDRA 1TJPB 4Q16A 3FLEA 2P9HA 2FYTA 4NDZA 2XI4A 2Y66A 1C3JA 2OK8A 1SC6A 2FAXA 1S8FA 1ADYA 1LPSA 2F3RA 1J0EA 1Z8HA 3OOEA 2DAPA 1AK1A 1J90A 1U8AA 2XUGA 4DJEC 3WMGA 1KQ3A 16PKA 3GVHA 3DONA 5CCBA 5C5EA 4OU5A 3NYQA 3PL1A 1VSVA 4YP6A 2HXYA 1QLHA 3AVUA 5HUHA 1PLJA 1EQUA 1MQAA 1QMPA 1C30B 3IKMB 3TTWA 5KQRA 1B0AA 4ZCLA 3ZHSA 4MJLA 1DWQA 1OXVA 1I4OA 4B4DA 2Y2VA 5GM2A 2H5JA 2JBWA 1QLJA 3UFXA 2FJ0A 1ONNA 2RMKA 3O2JA 1FUIA 1Z08A 1G5TA 4MV8A 5ALXA 1NI4A 3AVWA 2QRVA 4CDGA 2X0FA 3UAWA 1Z7GA 3W8RA 2Q5JA 2EHJA 2DHEA 3BL6A 4EITA 1XT6A 1OJ7A 1L1FA 4FE4A 3T3PB 3VQTA 1X2BA 3EXG2 4BNJA 1CQZA 3CURA 3L6DA 5I9IA 2XYQA 3EPAB 2RE8A 3CVWA 4FX5A 1H69A 4K05A 3ZJVA 1EWQA 4I2NA 2QRJA 3Q8WA 2ZWIA 4ZHQB 3N07A 1L7RA 3UV7A 5KZMB 3ASYA 2JEZA 1A3CA 5IKPA 2RHWA 1DADA 3G23A 2ROQA 4X44A 3WY9A 3PFHA 2QRMA 4OHYA 3P9XA 4HB4A 1WHTB 4YEDA 2FDCA 2UXDB 1Z4NA 3EGIA 3PXDA 1RWNA 4HX2A 1IQUA 5G0SA 3A6FA 3MFQA 5H4HA 1XD2B 4MPJA 4ZMRA 1ZI8A 3T7CA 4G26A 4B3RB 3HNRA 2R6FA 4B6SA 3C3JA 1VL0A 3KJEA 2KW5A 3ER6A 4CMAA 1VG1A 3NATA 3D8NA 5KNCA 2IF2A 4RPGA 1MIOB 2FP4A 3SBXA 3ZY3A 1J0XO 2FH5B 4N7RA 1H8EA 2WINI 2WYHA 5C3UA 3OLZA 2HUNA 1XJQA 5L4NA 2XA9A 5DLQC 1X0VA 3ZJ5A 3NBQA 3KEFA 3HTXA 1PV1A 4IDGA 1N7GA 5KSOA 3KHTA 4IIEA 4A8JC 1BHQ1 1T5TA 3E3MA 3HZOA 3REQB 2GF9A 3ILYA 4AF6A 2PRYA 2PT5A 3QVUA 5EXSA 2PA3A 1CRPA 2C3UA 2FFAA 1AMUA 3UPUA 2GERA 2QMOA 3KJQA 3CF0A 1MKYA 3F7MA 1DVRA 1O97C 3GQBB 4EFKA 1N6IA 5LZ2A 5CFZA 1E9FA 4YJKA 4TTAA 1MH1A 4P08A 2L18A 1P31A 2PE5A 2WSBA 3PGMA 4F9FA 4N7BA 3QQ5A 3VSAA 3WGUA 4EY5A 4ZFNA 2RSLA 4PNZA 1SCDA 3BBLA 4FOTA 2QAGA 2OENG 4Q7EA 1OXMA 1QH1B 4OQYA 3ORSA 4DY4A 4L9RA 3HJUA 2P4EA 2IOYA 3SX4A 1X87A 4P6VF 5DGTA 3MOGA 3EP3B 2I65A 4ZCMA 1NNUA 3EIWA 4GPD1 1Y6ZA 4L4RA 3QKIA 4LZJA 4DBVO 2HJ9A 5IZ4A 3LLSA 1UWLA 5J4LA 2JEYA 3FSJX 1M9NA 1A95A 1SRQA 3T7EA 2QUHA 4KR6A 5F98A 4DABA 3VR3D 2VXYA 3BCSA 3VRHA 3KTDA 4HJXA 4NLLA 4AZ0A 1AS3A 3FW1A 5CPFA 1WCIA 3T5CA 3QJGA 4XOUA 5FNVF 1F8YA 4G56A 1G6OA 2H85A 4QO7A 4FYWA 1LPBB 2DBQA 1JHMA 3KJIA 4ZEOA 4GR4A 3WQSB 1RYZA 1XRLA 3BFPA 1OXSC 1NLYA 4DM3A 3C45A 4HS4A 1SQSA 2PLFA 3A06A 1K8RA 3A4NA 5KQLA 3JRXA 5GVSA 1NYRA 2PR7A 3GLUA 5DGXA 2A9FA 3KU4A 4W6ZA 2KLBA 2X41A 3OTWA 4X94A 4MYUA 3M6AA 3Q7RA 5I7SA 1TVMA 2FEMA 4FI3C 5ILQA 2HK9A 1R7RA 1VKHA 3IAHA 4ILKA 4YRMA 3SZ3A 4BCCA 3O8CA 5G2OA 3IQDB 4IG9A 2H1RA 3VBCA 2XECA 4KQMA 2EW1A 2R751 5J4KA 1U3VA 1V9SA 3BTVA 4FDMA 2ZXEA 1IM8A 5E4TA 3VKVA 1ZBQA 1AUOA 1P7VA 5TS3A 2ID7A 3ROZA 1GTJ1 4RBNA 3G85A 4BNDA 2J32A 4WXEA 4RZXA 1XAGA 1NT2A 2RGYA 5DTMA 2QZPA 2B82A 2XSZD 4OHRA 1Y0BA 2XQIA 1R18A 1F5NA 1ZK4A 1JEQA 2X13A 1XTUA 3DFIA 5EWJA 3T9FA 4HGPA 4R1QA 5JNSA 3CH7A 3VPDA 1R16A 3P0RA 3R5TA 2HC9A 4Q9LA 2V98A 1GL9B 2HWYA 3E9YA 4D0LB 2Q8NA 5J4YA 1E2PA 4Y8VA 2HA3A 3PYLA 1XNQB 2I7CA 2FMFA 3CR3C 3R09A 4NEHB 3EY4A 4XGQA 2C2GA 1G1AA 5BQFA 2ZJOA 4MQFA 4P32A 4G5RA 1A4IA 3W6PA 3GIWA 3HY6A 1VHWA 1T36A 4FYJA 4A0GA 2WWVD 2LXNA 4LTNA 4MRRA 4TLBA 1C9NA 1U2QA 1VJGA 1N2IA 5EMLA 4OHZA 3ZXUB 4XYBA 3KDPA 5C46F 2ZZKA 4G1EB 1Y6JA 1ZCZA 3O03A 3WJ1A 2Y93A 1GUZA 3B3JA 3NC4A 4RGYA 2KE5A 3HY4A 3ODPA 3UKOA 4HV4A 3FZYA 2VPWA 2YV3A 4B3TB 5FA6A 2BEVA 2E4UA 3D9QX 3E81A 1ULAA 3GLVA 4P92A 4R8LA 1A77A 2C4NA 4L9AA 4YN3A 3ZCXA 1ZNYA 4ZI7A 4CLRA 2ZAGA 2CFIA 1BWRA 1XP8A 1HQDA 2CXRA 2FOXA 2VUHB 2VT7A 4H31A 1DIGA 2QLTA 5C4GB 3LP6A 2D8AA 3OT1B 4GEKA 4PYKA 1TM7E 1Y8RA 4TWRA 3A3KA 4HLUC 2BEKA 2VTEA 1P1CA 2XGGA 1XCOA 3OCZA 1JVNA 2PBZA 4ALLA 3ZQ6A 2C3MA 2YRFA 2X1HA 4LXHA 4N9QA 4JI7B 1E2HA 4BZXA 4C1BA 4KXFB 2G5TA 3ZUGA 3WGLA 1QKKA 4ILEA 4WKNA 3O1HB 3MINB 2Z43A 1GA4A 4J1TA 1QOQB 3S29A 4G5YA 1HH4A 2CL5A 4G5XA 2Q2VA 2QTCA 1XZNA 3EVCA 1NOKA 4I4TA 4KJXA 3E8MA 4L5JA 4Z4HA 2AZXA 1VG8A 4JB8A 3ZIAA 1FSZA 3TX6A 4BP1A 2EDCA 1IVNA 1MORA 5C8VA 1Z07A 2AHRA 3ORFA 4BDTA 2JK0A 1IUKA 3RGWS 2J3KA 3CO0S 4XUGB 1HE1C 3K4QA 2QAIA 3CC8A 1I4WA 2H9AA 3A36A 3AHHA 3FPKA 1CNFA 1XU4A 2BFNA 2IFTA 2JGRA 4ZQHA 3B1YA 1N2BA 1K5HA 5B55A 3WRVA 2NO5A 4KO4S 4NBTA 2QMYA 3N8DA 4YRPA 1LRLA 1XWIA 1XKQA 1Z15A 4CI0B 3R0XA 4RZIA 3F6CA 4F3CA 4CKWB 4K9NA 1P33A 3GLFE 2ORVA 1TLFA 1PJ8A 3DLBA 2BHTA 2ZIEA 1PL6A 3KK0A 4QNRA 2WSIA 1JJBA 3QKUA 3VO1A 5GV7A 3KEQA 4H08A 4FFVA 4LSGA 1FRFS 2FDXA 1T3TA 1A7AA 1I01A 1QIDA 1YUNA 2F00A 1D2GA 3O75A 1W5FA 3UMBA 4C7KA 3TUZC 3IQIX 3KT3A 4WT7A 2O59A 3T41A 1UKVY 5T6BA 4DM7A 5A4DA 3WRYA 2TMDA 3NBUA 3RHFA 5K05A 1UCFA 4Z5XA