3QW2A

L-myo-inositol 1-phosphate synthase from archaeoglobus mutant n255a
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYAILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 142
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qw2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qw2A01
4GSLA 1DBVO 3I1JA 3PEFA 3G17A 4HFJA 1P0CA 3V1UA 5CDYA 1VL8A 2IEDA 1LQTA 3KB6A 3OJEA 1LDYA 3LC1O 5JDCC 2EW2A 3TZCA 2HLPA 1K2WA 4PLTA 5L51A 5JYDA 1KEVA 4AJPA 1HWYA 4PG6A 5GZ1A 4LMPA 5AXAA 2DC1A 3GLQA 1VLLA 1F17A 1NXQA 3I3OA 4MVJH 2C54A 2I3GA 3ICPA 4TZTA 3NAQA 1DJNA 5JYAA 3QE3A 5CHEA 4BS9A 2NVBA 1U5AA 1YQXA 3UH1A 4O5OA 3E9NA 4UVHA 3MWDB 5L7YA 2C59A 3KV3O 4XEHA 3CMCO 1BXGB 2JCVA 1YONA 2AHRA 3RJ5A 2J3IA 3ZNNA 3A4VA 4BO6A 4BNLA 5MDHA 1NWHA 1HE5A 4YRBA 2J8ZA 3QY9A 2Y1EA 3IDSA 1IZ9A 3AUAA 3C7DB 4D46A 3W8EA 5HM8A 4L4RA 2NLOA 4DA9A 5GZ3A 3Q0EA 4PG8A 5BNIA 4RLHA 1ENOA 4J43A 3ZWYA 3AI1A 4Q3BA 3G49A 2GERA 3L4SO 3GG9A 2Y99A 3BMNA 4YJHB 2VUUA 4LISA 4M89A 3ADOA 5CPBA 5A5FA 4YWJA 2D1YA 2X23A 2Z1NA 1E3WB 2C07A 3C24A 3GEDA 1PZHA 1VPDA 1VKNA 1JKJA 1HDCA 4E6PA 2R00A 4FGWA 1V3TA 1JAYA 1XGKA 4PCVA 3KSZO 5KJFA 1LNQA 4D0RA 3RUHA 2D0IA 5DBGA 3WQQA 4R9SA 3WGQA 1ZH8A 4BO8A 4DPLA 2BGKA 5ITWA 1U3UA 2DTXA 2D4AA 4R54A 1DLJA 4BO0A 1C1XA 3V8BA 3C3XA 2J3KA 1P33A 4QUKA 4UEJA 4A26A 3E8XA 3NDJA 2DTEA 4AICA 2BMAA 2V6FA 4KMSA 1KC1A 3M2PA 4J7XA 2H9IA 1DDOA 3CINA 4S3MA 4GLOA 4M49A 1IYZA 4RPKA 2QHXA 3TFOA 1OBFO 3H9GA 3ZWOA 2D2IA 4CR7A 4WECA 2ZJ0A 1FDSA 2AG5A 1LLDA 3E9MA 1LI4A 3TOXA 1DEHA 2V7PA 4D0SA 3OEYA 4YAJA 4FJ2A 1GYPA 4G5HA 4N7RA 2DM6A 3WGGA 4R1NA 3DZJA 1B14A 4FPXA 1N9GA 3BMCA 5AYVA 2JJYA 2W90A 4CM9D 1N7HA 1WDKA 4B7XA 1EQUA 1CQIA 3O38A 2IZ1A 4IQ0A 2AEJA 4XJTA 3NJ8A 2RAFA 4BNXA 3LVFO 1XHLA 4JJIA 1QYDA 3WMXA 2PZMA 2VWGA 4IINA 1JWBB 4XX0A 2EKQA 4CM4B 3KEOA 3TNLA 1UZMA 4BNUA 2POQX 4F6LA 5F3RA 4HKTA 1QP8A 1YXMA 3QLJA 1JKIA 4MIOA 1LLCA 4RVHA 1LRKA 1ZMTA 2E48A 4P8RA 4DC0A 4NPCA 5JCJD 3TPCA 2B0JA 4A27A 1GCUA 2NVWA 3GDGA 1B8UA 2D5AA 3INGA 2J6IA 1DSSG 1I8TA 2BD0A 3KYCB 1P44A 7MDHA 1FJHA 3RD5A 1VE9A 3RC1A 5A3VA 1ADGA 1XWFA 1HDOA 3OJLA 3DAPA 3PIDA 2H5LA 1TI7A 3ST7A 1ENPA 2Z1MA 3N7UA 3FNGA 2WWRA 3D3EA 1EUDA 3HQ4O 5JBIA 1B15A 1T2DA 1ENZA 2BHLA 1UAYA 4GX2A 3CZMA 4WOJA 1JA9A 1H94A 3DQPA 4ID9A 4O6VA 5CG2A 3BXXA 5EL0A 5F21A 2YQ4A 2Q1TA 3EMKA 3MZ0A 2FR8A 3I6IA 2IDZA 1NPTO 4K6CA 2Y1OA 4I1IA 3V2UA 4R5MA 2YQ5A 3F4LA 4LVCA 5BNFA 2O7SA 4PLZA 4XQEA 4BNZA 4TWRA 4EUEA 4FFLA 2YW9A 2VRCD 3ICCA 5EN4A 4Y6SA 2RIRA 3D4OA 4IXTA 4ZRMA 2E37A 5JE8A 1GV1A 1GZ3A 1LQUA 5L40A 1A27A 2JCYA 2X5OA 1ZBQA 2QRKA 2I76A 4CPDA 1E6EA 3E5RA 3S2GA 2LDBA 1I36A 4GMGA 3DBLB 3RJ9A 3D0OA 1HSZA 2NUAA 1KEUA 1EBFA 1W4ZA 3TF5A 1E5LA 4HNHA 1QKIA 2X58A 2G82A 1LBEA 2UUPA 4FR5A 3NYWA 4OKNA 2PH5A 2OXIA 5K9ZA 1ZO8A 1E7RA 1EDOA 4CMEA 1YRLA 4Z0TA 4CMJA 1R15A 1WDMA 1N1GA 2E49A 1PZGA 4J1TA 4K9DA 4RDHA 2DAPA 1GAEO 4AJEA 4DTIA 1Y81A 2D59A 3E48A 4HFMA 3ETDA 3AM3A 1MXFA 1MV8A 1D3AA 2EG9A 4ZICA 3I9LA 1H6CA 4J0EA 4Q3DA 1H93A 4BNNA 5JNLA 2FN7A 4RPLA 3LT0A 4PG4A 1F06A 3QIVA 4CMIA 3ASUA 1VRWA 3IKTA 4N5NA 1R0KA 4BNHA 4K26A 3NEPX 1X0XA 4N18A 2GCGA 3RUCA 2Y68A 4B8ZA 2O3TA 3JYQA 1TA4A 3AFNA 4P22A 2I99A 2Q4EA 1F14A 2O3QA 4MO2A 5GMOA 2VUSA 1NHWA 3KYDB 4GSKA 3RAJA 4YYZA 1T4BA 3PHHA 3NTOA 4B4OA 2AEMA 1RWBA 2YFHA 2F00A 2PFGA 4PGFA 4RVGA 4XGKA 5BSGA 2AA3A 3D7LA 1MFZA 2B36A 5JO0A 3QWAA 1A7AA 1OOEA 3RC7A 3HHPA 1EMDA 1NM5A 1E1KA 4DLAA 1W8DA 4AJ1A 2PTGA 1UP4A 2D3TA 2AMFA 4D44A 1E3LA 3SVTA 2EGGA 1QYXA 8ADHA 2WD7B 1ZJZA 1UXJA 3WICA 4WLEA 4WKGA 3VDRA 4KZPA 2AW5A 2P4HX 4B3HA 2V6BA 2P2SA 4MVJP 4K1LA 4Y6RA 3FF4A 4BIIA 4DREA 3ZU4A 4XD2A 1V3UA 4KUEA 4EDFA 2OBYA 3AY7A 4KP7A 5TJHA 5CDGA 3FI9A 1CERA 1WLYA 1ZZEA 2J3JA 3UGKA 4BVAA 3DBRB 1NFQA 2CNBA 2CD9A 2X0RA 3ETGA 3HB5X 4KDEA 1SAYA 4DYDA 3RU9A 1ZK1A 1ZVMA 1V6AA 4GGOA 3KOUA 1R0SA 5DT9A 1B2LA 1MP0A 5T8KA 5B12A 3JQ8A 1M6HA 4NJMA 3NDRA 1ZEMA 3UKOA 3LF1A 2VYVA 1SOVA 1TT7A 5CDSA 4RORA 2HMSA 3TZHA 4YA6A 1R6DA 5DULA 4DMMA 3DAGA 4FSHA 5T5QA 5TF4A 1BDBA 1NVTA 2HMTA 5DDIP 4IJKA 2PR2A 4R4JA 1LLQA 1ZSYA 4F3YA 3GRPA 3E1KA 4GX0A 3PDUA 4WCDA 4Q39A 3UXYA 3VH2A 3DZBA 2EJWA 4WASA 5DP1A 3VZQA 5JAQA 3SLKA 4E21A 5CDTA 3ZCXA 4LMRA 1ISHA 3PRJA 3WJ7A 5IDQA 2X5JO 5TS3A 4E0BA 5IXYA 3IP1A 3RROA 2C5AA 3JQ7A 1AXEA 2ZYDA 2QYTA 3JYPA 3PHIA 4PLGA 2HK7A 4BB6A 2PD4A 3GG2A 4FCCA 2QYSA 2OORA 5B1YA 4D45A 4AVYA 3GAZA 4FFRA 3QSGA 1WMBA 5COBA 3F6YA 3DOJA 4B4UA 2GN8A 4YXFA 4XWYA 2I9PA 4GX1A 4CMEC 2YV3A 3WBBA 2Z95A 3LYLA 1FDVA 1DAPA 2PK3A 4UVGA 4E32A 2O7QA 3ZWXA 3I5MA 4EEXA 4OH1A 2ZYAA 1LSOA 3L9XA 2YHIA 2Q2QA 4FJ1A 1ZUD1 1P1FA 1KVSA 5T67A 3V1TC 3AI2A 2EHDA 4RL6A 4HWKA 3VZSA 1CRWG 4MP6A 1U8XX 5EPOA 3OSUA 1I2BA 1XKQA 2X0JA 3MJCA 1I3LA 4G65A 2Y66A 4TRMA 4YJFB 3PJEA 2VWQA 2W8ZA 3QA9A 3BA1A 3H2ZA 3EDMA 4FD3A 4FW8A 3VH4A 4UEOA 1EFKA 2JAHA 1Q0HA 3LF2A 1HDGO 1Y5RA 1K5HA 3U4HA 3KETA 4O59O 3TZQA 2UDPA 4E31A 1XQ6A 3GR6A 3OP4A 4I5DA 1WXDA 3JCZA 2JL1A 2IRWA 4M54A 2TMGA 3I4CA 3K31A 3SJ7A 3M1AA 5B4TA 5KTKA 1B8VA 2CDAA 3OJ0A 1BMDA 4BQRA 3MOGA 1UXHA 2PD6A 4RVFA 1R37A 1DPGA 1YS4A 3AI3A 4R16A 1I24A 4JJFA 1GL3A 1NWCA 3COSA 4EW6A 4YVFA 2BF7A 3UCFA 1NR7A 3UOGA 1XU7A 1L7EA 4CM8A 4WCFA 5M6DA 2CDBA 4WEQA 2AG8A 3E6AA 4ZN6A 5TRTA 3RASA 2IZ0A 1YOVB 2C5EA 1DFHA 2PWZA 3Q11A 3F46A 1VC2A 5IJZA 1LDEA 4OKIA 3ZW9A 1UDCA 5CFZA 1DIHA 1J0XO 2C29D 4IDEA 4RVSA 4QFCA 1PJLA 4GVLA 2P4QA 5EJ2A 3EK2A 3RIHA 1RM5A 4TVOA 4ALLA 3U9LA 5DF1A 3CKYA 3GHYA 9LDTA 1ULSA 2QW8A 4GVXA 1Y8QA 3DWFA 3OF2A 1ZJYA 3D4PA 1D1SA 3ZHZA 2ZCVA 3I23A 3KXDA 1P45A 1M66A 3KVOA 3U0BA 5T8KC 3KHUA 3U5TA 3PYXA 2GZ1A 1BGVA 4CR6A 4BNIA 5ILGA 3CUKA 4R1UA 1Z82A 4DGSA 2NU7A 1QRRA 5TSDA 5L9AA 1YVEI 3EZYA 3X2EA 4AJNA 2FPGA 4CM6A 2IE0A 1VKOA 4PLPA 4UEKA 1K6XA 1GR0A 3DO5A 2YZ7A 5JC1A 1RM4A 2NSDA 3KTDA 5DOVA 1P1KA 4I5GA 3GHHA 4YT5A 4CL8A 1EVJA 1LC0A 3I9NA 5L4NA 1P3DA 1GZ4A 2WM3A 3B20A 2HK8A 1T26A 3D5QA 4HBGA 4Z6KA 3QJ5A 3PDJA 3FWZA 1L7DA 3CZRA 2QG4A 1ISJA 1PR3A 3JSAA 3DHNA 4ONEA 1HLPA 5BSHA 3ADPA 1D4FA 1JVBA 2FR1A 5L7WA 3KO8A 1ZK4A 2NTJA 5DP2A 4F6CA 4NHEA 4BO7A 4IPTA 1SEVA 4CLOB 2PD3A 4QO7A 2A94A 2Q22A 4R3WA 5JCXA 5JAIA 5K6AA 2UYYA 4HADA 3MWEB 2J5KA 4RV9A 2VYVD 1U7TA 3I52A 4IDFA 1DC6A 3KSUA 2HAEA 2AQIA 3S2IA 1BVRA 2B37A 4I9UA 3H4VA 3WGZA 1NAIA 2GGSA 5THQA 1ADFA 2W2KA 4J1NA 3GPIA 4PRLA 4EGFA 3EHEA 4BMVA 1KERA 4OMUA 3ZV6A 1V35A 4P4GA 3UFXA 5BSEA 3H9UA 4WE3A 2W2LA 3R3JA 1ONOA 4KQXA 4GMFA 1KVUA 2C0CA 3JQBA 4U5QA 4PLHA 2LDXA 1DXYA 3TWOA 1A4UA 3VDQA 1YE3A 4YAGA 1NQOA 4RF3A 1T1RA 4CLRA 1LRLA 3BTUA 2P9CA 3V5NA 3EC7A 4TZKA 2VCYA 3VH3A 3HZZA 3IMFA 1U9JA 1NFFA 3JQAA 4ZD6A 3RUAA 4WK6A 4GKVA 2IYOA 4IZIA 3ZWMA 5B37A 2X4GA 4BO1A 3FN4A 3RUIA 5JDIA 2B4TO 2CFCA 4CMIB 4RPGA 1Q2XA 4PLWA 3PPIA 2OMEA 3ANMA 1TB4A 3C8MA 3PQDA 3PIIA 4WLNA 2P5YA 4CMCA 2ZJ1A 4BMSA 5JY6A 1VJTA 1WAMA 3DFUA 2JD0A 4E30A 3PTZA 2DU8A 3H3JA 1FK8A 1Z7EA 2WD8A 2YDXA 3OJOA 3P5SA 2BELA 5J9GA 3NTRA 3K5PA 3NT4A 4NI5A 4M87A 1H6BA 1YJ8A 2AQKA 1JN0A 1U28A 5I7EA 1DFIA 2A35A 4CV3A 4EUHA 3K30A 2NTNA 5JAMA 4BO4A 3GEGA 1H9AA 1K6JA 3GMDA 1PTJA 1E3EA 2YUTA 4LN1A 2VHXA 4RZIA 4RPHA 4IGEA 4RQTA 5U1PA 4DMLA 1T2AA 3K96A 2H63A 3ITKA 4FFPA 3ZW8A 2ZB8A 5ITVA 3IJRA 3DZKA 4DPKA 1HYEA 2EF1A 3JQ9A 3PHLA 1R4MA 1XQ1A 2RCYA 1AUPA 1GYRA 4WNIA 4AJOA 3ONFA 4GGPA 4OJNA 4GPD1 2HKIA 4OHUA 2GDZA 1AHHA 4Y98A 1I10A 3F5SA 4FFMA 4K28A 4J9VA 1FF9A 2BI7A 4AJIA 1ZXBA 2X0NA 4A0SA 4TQGA 4DQXA 1U1IA 5FWNA 4Z9YA 1DHTA 3JQ8B 3N58A 4ALNA 2NU8A 5EIOA 5TC4A 1KETA 5IG2A 3RBXA 1E6UA 1OC2A 3DTTA 1MGOA 2RH4A 4I5FA 5FI3A 3WXBA 3VZPA 5CEJA 5DBIA 3HADA 3H5RA 5KIAA 5K6AC 4IUYA 4CM3A 1NR1A 3T7EA 3WR5A 3UHAA 1Q7CA 4X54A 1HDXA 4J3FA 1TVEA 3GNQA 4ND5A 3VC7A 4BHTA 4ZQEA 5G0SA 1HTBA 3HG7A 4BUCA 1T2EA 3JQ7B 4Y6PA 1CYDA 5COAA 3JYNA 1S6YA 1U3VA 1GDHA 1HRDA 4WLOA 3WFIA 3LLVA 3SBOA 1N5DA 4OM8A 3JV7A 3ZDFA 5DBFA 4DIFA 1YBAA 4B8WA 1DAOA 2I67A 1AGNA 3GVXA 2NADA 1EUZA 4LRSB 3EYWA 4B3IA 3E82A 4HFRA 2I3AA 1PS0A 2X6TA 3K8ZA 1D7OA 1BW9B 1NAHA 4E2YA 4D3DA 2DKNA 3ORFA 3DMTA 2F1KA 1IOLA 3I9JA 1LDMA 1X14A 4J7UA 4CQLA 2GRAA 2VUTA 4RF4A 2ILTA 5JDIC 2GLXA 1U4SA 3IC5A 1PL6A 3R6DA 3KSDO 3D3WB 4CUKA 4DRYA 1GV0A 3DL2A 4BNVA 1I2CA 4YT4A 1V0JA 1WZIA 4BNGA 4XKJA 5L4SA 3JQFA 4FOOA 4I5EA 4I08A 2XOXA 2QZ9A 2OZPA 2HK9A 2ZK7A 3LLSA 2VHYA 4YR9A 3WMWA 3DEYX 2JFHA 5KVQA 5F1PA 2PH3A 1CJCA 1P74A 1KY4A 1X0VA 3HN7A 3DC2A 4J9UE 1HDRA 1KVQA 5KVVA 2GZ3A 1UUFA 1HEUA 5BSFA 2W2LD 1P9LA 1M6WA 1X7DA 1YB1A 1EE2A 3JYLA 3JTMA 4YRAA 3QWBA 3G1TA 1G0NA 3ULKA 3WJAA 3ZHBA 4BO5A 4U6QA 3RVDA 2QX7A 4JX8A 4MPDA 3Q9NA 3AU8A 3KLPX 5G4KB 2H1SA 3PWZA 2VQ3A 3KZVA 1JAXA 1QG6A 2DVMA 3SJUA 4ZQHA 2BGMA 1YL5A 3NV9A 4CMGA 3VH1A 3JQAD 2BGLA 1LSUA 1HETA 4QQRA 3SXPA 1R4NA 3AWDA 3H5AA 3AK4A 1B3BA 3AY3A 1LXCA 3H6KA 1R66A 1LU9A 2YHUA 3F9IA 3JQ9C 1Y9EA 1MC5A 7ADHA 3HE3A 1K6IA 3O26A 3DOCA 4H15A 2X9GA 3BHJA 5IDWA 3PHGA 1GPJA 3OMLA 1VJ0A 4DVJA 1QXSA 4XB1A 4D43A 3ZH2A 3DZIA 1UDAA 3GGGA 3NJ4A 4D7AA 3F1LA 1NVGA 5IDYA 4E33A 5JYFA 1YDWA 3CSDA 4YJGA 2XPCA 4M86A 1Z74A 1Y9AA 2FPPA 1C1DB 1I3NA 3BMOA 1UP6A 3F47A 6LDHA 3ZNPA 2FWMX 2AQ8A 1RM0A 1R0LA 3VZRA 2DPHA 3K92A 2J5RA 2HRBA 5FI5A 1ISFA 1O89A 1RKXA 1NHGA 4W7IA 1PJ2A 1PJ3A 1PSDA 2UAGA 5A4DA 3PYMA 3ZHYA 2VWHA 4MVJG 4RPJA 2BH9A 2Y0CA 1HF3A 1PJQA 3W4IA 1ZK2A 3TZKA 2DTDA 5A9TA 1VL0A 2DBVO 3ENNA 4TROA 3PFWO 1NQAO 2YDYA 1OFGA 2QRLA 2V6MA 3I9OA 1U3TA 3RBVA 1Y7TA 2HMWA 4B3JA 2XF8A 2ZTUA 5HBRA 5K0ZA 3DZGA 2RBEA 3GFBA 3TN7A 1HZJA 4LRTB 4CMAA 2HMUA 1DRUA 4OXNA 4EITA 1A5ZA 2VHZA 3INRA 4IXWA 4NIMA 3LT4A 1DB3A 1BWSA 2CSUA 2VZ8A 3KRTA 1NYTA 4ALIA 3DZHA 5AVOA 1K3TA 1X7HA 3G0OA 3WFJA 1E0DA 1XSEA 2ZYGA 3KUXA 4JP3A 4E4YA 3EAGA 1N2SA 5GY7A 1XDWA 4PIVA 2R00C 1GQ2A 1O9BA 4Y9DA 3U3XA 1FDUA 3UN1A 5A06A 1GUFA 4G2NA 1V3VA 3AY6A 1DO8A 4NQZA 1PGNA 3DMTC 3OIGA 1HYHA 1KS9A 3WGHA 3BZUA 3RKUA 5CG1A 1PQUA 3OJFA 2YJZA 4GI2A 5A02A 1C0PA 3SX2A 1NVMB 2GASA 5ICSA 6ADHA 4AJ2A 4Y67A 3WGTA 4LK3A 4N54A 3CEAA 4R1TA 1ADCA 2WE7A 4GBJA 5U9CA 2FSVA 4YEDA 3GOHA 4YAEA 1F8GA 2JD2A 4NU6A 2ZTMA 3JQFC 5G4LA 2I5PO 2A4KA 4RO0A 4PFJA 3GPDG 1PL8A 1IE3A 4A10A 3G79A 3K9QO 1YDEA 1CQJA 5KOIA 3NT2A 2DPGA 1ZK3A 1MXHA 4IQ8A 2YYYA 4Z0PA 3PQEA 1P31A 5T64A 2A9FA 3UICA 1HE2A 1ID1A 3EW7A 1E92A 3JYOA 4XYGA 4EJMA 4GWKA 5A9SA 5KWEA 1TT5A 1QMGA 5IZ4A 1G6KA 3ZU3A 2ZQZA 4CJXA 3I9KA 1AHIA 1C0LA 4XIYA 3ROKA 2ZB7A 3FTNA 4MKXA 3MEQA 1KVRA 1Z73A 3HFGA 3NGLA 3ZZNA 3UCEA 4ROSA 4YBZA 2PKRA 5MGBA 1A4IA 4WOKA 4D79A 2VRBA 3IS3A 1Z7BA 3Q3CA 3WB9A 3AOGA 3QW2A 2YV1A 1ISMA 1PJTA 5DNAA 2GD1O 1UAGA 1IPFA 4E5NA 3DB2A 5L7TA 2A92A 3INTA 1UXIA 1I33A 4YAKA 4DL9A 5T57A 2O2SA 4JROA 3RUDA 1WW8A 3OECA 5TT0A 1A7KA 2SCUA 5TLSA 1DIBA 1EBUA 3ZWBA 3NT5A 2B5WA 2QRJA 3RFXA 4II2A 2NWQA 2OBNA 3L07A 5BNTA 4KTVE 2D8AA 4GWGA 2GSDA 2X1HA 3MTJA 2I65A 4CMBA 1EEHA 2B4QA 3B1FA 4ND2A 3WWZA 4BKOA 3N74A 2IEBA 4II3A 5BR7A 1GQQA 1MX3A 4NK5A 1DC4A 2PY6A 1QLJA 3BAZA 4ZGWA 2B5VA 4W9NA 1LLUA 3AFMA 5L53A 2BFMA 3GVIA 1ZXLA 4J6FA 4J2HA 3B1KA 1E7WA 1K89A 3H9QA 5IFLA 5DCWA 3S2FA 5TNXA 1U8FO 1P77A 1YH3A 3PWKA 1BDMA 4RZHA 3TJRA 1GZ6A 5I9NA 1ZMOA 4AJKA 1J49A 1WP4A 2OGUA 4YTEA 1J4AA 4I9NA 5L3ZA 4IGFA 2BFAA 5KJCA 1ARZA 2P9EA 4A7PA 3FNHA 5CEEA 1EUCA 3PHJA 2BI8A 3LSYA 3ZNQA 1X7GA 3OHSX 3HUDA 4ALKA 1E77A 5I9MA 4L75A 3L4BA 2Q1WA 3DHYA 3B1JA 3RFVA 1UJMA 4GL4A 1U7HA 1SNYA 5GZ6A 5C7OO 2JCXA 5CP8A 1O95A 3GNTA 4OYRA 1GCOA 2CVOA 1MUUA 1I2ZA 3RCBA 1B0AA 3H3FA 1OAAA 4B7CA 2JFGA 3FRJA 1GFSA 5EESA 1UZLA 3AUSA 4NK4A 2B69A 2EW8A 1O0SA 1L1FA 2EV9A 5B4UA 3STHA 1VSUA 3BHMA 4XJSA 3PZBA 3BMNB 4K6FA 4XQCA 1MB4A 3OIFA 4YJHA 2OHXA 4FB5A 5G2OA 1AN9A 1YBVA 4UREA 3MJEA 3VPGA 3R3SA 4PLYA 4KQWA 3QWFA 1QV7A 3OEWA 1E3JA 4Z9XA 1Z75A 1RYDA 4R9RA 4DYVA 1ZKMA 3WLFA 4CQMD 2Y1FA 1WPQA 4WJZA 5G0TA 4CM5A 3QVWA 3HFSA 1C1XB 3PWSA 4JP2A 4JCOA 4FBGA 2X9VA 5IN4A 4L73A 3NX4A 1YBMA 2Y1DA 2ZQYA 2GUGA 4KWHA 2Q49A 1QYWA 2R6JA 4A73A 3NGXA 2E82A 1NFRA 4URFA 3QQPA 2G76A 4L74A 4Q3AA 3RFTA 4YT8A 4RF5A 4CUJA 1SBYA 1IPEA 2DQ4A 3A06A 1QYCA 1SPXA 3C1TA 3FR8A 3VKVA 4EYEA 1PU2A 1DIAA 5JY1A 3FNEA 1SZJG 2QIOA 1ML3A 3IOYA 4BNJA 1DRWA 2V6GA 2HCTA 1N9GB 3BMCB 4PLCA 3AUTA 5L95A 3HDHA 1IY8A 4P38A 2VHWA 4Q9NA 4YT2A 2P68A 3OQ6A 4PN3A 5JYEA 2VHVA 4DUPA 1R4NB 4CMHA 1PGJA 1LRJA 5I7SA 2DT5A 3L0DA 4CM1A 1H5QA 1PR9A 3S2EA 4CM4A 5IXSA 4RGBA 1LDBA 3AOEA 3R1IA 3QVOA 2Y0DA 1HE4A 1O6ZA 4CV2A 5C37A 4CUZA 4XRGA 4N5LA 1ZCJA 1PJBA 2YV2A 2GYYA 5ER9A 1SB8A 5G0WA 1N92A 4DBVO 4W9NC 4XR4A 2R2GA 4E13A 3O4RA 1EE9A 4E3ZA 4YJGB 1XR3A 1YWGO 2IODA 3OM9A 4QTZA 1N7GA 1NPDA 1AXGA 4EZBA 1GPDG 1Z45A 4BNTA 4PG5A 2ZATA 3LZ6A 3D4NA 1IHXA 3WGIA 4RQUA 4GQAA 5TGDA 3O8QA 4WLFA 1YQGA 5LC1A 1HZZA 4NH4A 4ZVVA 4KTTE 5A03A 3OFSA 4O1MA 2JD1A 3JD3A 3GGPA 1RM3A 1E7YA 3KEQA 4E5YA 1EZ4A 1QYVA 3W4JA 1JKFA 4UUPA 4XYLA 3PYLA 5H82A 3NDIA 1KIFA 3MTGA 4Z3KA 3WDSA 1ISIA 3EGOA 1E3SA 2ZB3A 1H6DA 1TLTA 3M2TA 3OQBA 1A71A 1KY5A 1QR6A 1XU9A 4JXKA 2CF6A 4R69A 4UAGA 3Q9UA 5EMHA 3K2BA 1M75A 1O8CA 4FIZA 5TJ9A 1ENYA 4CV1A 5CAEA 3IL2A 1LC3A 1XEAA 3DHEA 2VYNA 3GN2A 1KBZA 2AQHA 3RC9A 3CMMA 1IULA 3GQVA 2EWMA 1D8AA 4IDCA 4KDFA 3H9JA 4UUOA 4HXYA 1C0IA 3PJFA 4W99A 2Q3EA 1ZK0A 2GN9A 4NFHA 4CLDA 3PGJA 5A5EA 1IZ0A 4M8SA 3ZHXA 4INAA 4YJDA 3UF0A 2FSSA 1HXHA 1V9LA 3DBLA 4AG3A 1AE1A 2PA3A 4TRNA 1R16A 3P7MA 3IKVA 4BO3A 3IQDB 3IUPA 5A05A 2G0TA 3NKLA 4CLXA 4E2XA 3CXRA 3GDFA 3GUYA 2IYPA 3PGXA 3WWYA 3L9WA 2NQTA 2GR9A 2BRUA 4PLVA 2O48X 5L4LA 4AJLA 3G3EA 3WTCA 4W7HA 2FMUA 3EY4A 1HT0A 4CODB 3D64A 3GH3A 2PV7A 2NTVA 3CIFA 2JHGA 4IDAA 2UV8A 3WSVA 1LA2A 2OFPA 3MJVA 5KCZA 2PKQP 3VAZA 3L6DA 4WCFC 4XRRA 2EP7A 5JS6A 4CR8A 3DFZA 2GNAA 3ANLA 2B4RO 4AL4A 4RF2A 3ROPA 3RC2A 1X1EA 3T4EA 3U09A 2O3SA 3QV1A 2QZZA 3E9QA 3C85A 2WYVA 2GPTA 2Z5LA 4D41A 3WIEA 5DN9A 1MG0A 1VI2A 2JAPA 5AOVA 2O50A 3PLRA 4RDIA 3GT0A 5JPIA 3A14A 5IZCA 4BNFA 2PNFA 3OETA 1YGYA 4BGIA 4C7KA 4NFYA 3QP9A 4ZHSA 1A9ZA 2EIHA 3PFFA 4IIVA 4J16A 3WLEA 4AJHA 3IIEA 4AJJA 3BMQA 1M76A 2DUWA 1I0ZA 4ZRNA 3HN2A 4H7PA 4OO3A 3E03A 1KVTA 1OC4A 2D5CA 3AOEC 1KEWA 3QWHA 3O9ZA 1LEHA 3ROQA 2WD7A 4OSPA 2PZKA 3BTSA 2Q2VA 1XG5A 4LSMA 4RJTA 3JQGA 3DR3A 3HNPA 4O63O 5TT1A 4BL5A 4QXMA 3S55A 4MJLA 2OP0A 1T2FA 3GNSA 5JAZA 5J23A 3JD2A 1E1LA 4NG5A 3JQDA 1WMAA 1A72A 4Q3NA 3DBRA 4DPMA 4OOEA 2OL4A 1PJSA 2OUIA 4O0LA 1VL6A 1E5QA 1GEEA 1XYGA 3WNVA 3WQRA 3LK7A 1GADO 1B26A 4NJMB 3LC2O 3KYBA 2ZCUA 2FR0A 2V65A 1J6UA 1HE3A 1MLDA 4NJOA 1ORRA 1M2WA 2TMDA 1BG6A 1T2CA 4DC1A 1PS9A 3MJTA 1G0OA 4HNGA 1GEGA 1WWKA 1DJQA 2FOIA 5KKCA 2E4AA 4JIGA 5C7IO 3ON5A 3VKUA 2NVUA 3DBHA 4WUVA 3TDKA 1G1AA 4R41A 2I66A 2PKQO 1JLLA 1LDGA 2EJVA 4XYMA 1E7SA 2PGDA 4C4OA 1MC4A 3W1VA 4PZCA 4HUJA 3B70A 2X9NA 4YRDA 3C1OA 5THKA 5CDUA 4DXHA 4WEOA 3ZWWA 1P1JA 1ONPA 5TIIA 3UW3A 1SCUA 4DQUA 5HS6A 4PG7A 3BYZA 5TQVA 3S1LA 1PIWA 5A1TA 5ICMA 1IB6A 5F1OA 1XLTA 1GUYA 3JQBC 4DIBA 1MA0A 1UH5A 4GH5A 4FDAA 8LDHA 4I9HA 4ND1A 1T25A 4ZU3A 1F8FA 4WPGA 4GX5A 3FNFA 2YHIB 3TL2A 1IL0A 4IM7A 1JTVA 1H6AA 3CPSA 1HKUA 4H3VA 2VT3A 1JU9A 3ENKA 3HJAA 4YQZA 5FFFA 1EK6A 1PGOA 4BNKA 4YJFA 4MVJA 4WNCA 1Q0LA 2VYND 5TX7A 3WOHA 1K0UA 2PZLA 4IMPA 4J7CA 1WNTA 4MINA 4YQYA 4OQYA 3UAGA 2HMVA 1ADBA 1Y1PA 2XXBA 2O2YA 1A9YA 1T24A 3ZWAA 1PX0A 4E5MA 3Q6IA 3TZ6A 4EEZA 1I5RA 3M6IA 4J90A 1UDBA 3ASVA 5T6BA 3U49A 5G0VA 1GY8A 4L9RA 3T7CA 2OP1A 4EUFA 5IZCC 4BKPA 1Z6ZA 4NU5A 1EQ2A 1FMCA 1DC5A 3ZWNA 3X2FA 4NDNE 4CM8B 2UUOA 1PQWA 3ONEA 4BV9A 4JQCA 4DBZA 4WCFB 4CMKA 1I3KA 1WVGA 4WLVA 4DQVA 4HP8A 4J1QA 5IDXA 1BHSA 4ZQFA 4IJVA 3HWRA 3RUFA 3V2HA 1SEPA 1HDZA 2WMDA 3WYBA 1V8BA 1YOVA 2P5UA 5I8WA 3M1LA 4TRRA 2FY8A 1XCBA 2NU6A 5BT9A 1DIRA 1VSVA 3U62A 4XGNA 5H81A 5EINA 1SMKA 3ZNOA 5H83A 2ET6A 2Q46A 1J5PA 3W8FA 2B35A 2PLAA 3FHLA 1Y8QB 4NBUA 4IDBA 4NFSA 3AM5A 4PVDA 3A9WA 4UVIA 3OA2A 4QO8A 3ZWVA 3GZNA 3AM4A 4Z9FA 1JVSA 4QECA 4JN6B 1B16A 3D5TA 5JO9A 3Q2IA 1EVZA 2YY7A 1Q7GA 1KEPA 3KM0A 3F4BA 1SC6A 3LU1A 5C3MA 4MDHA 4D3FA 1DOHA 5JC8A 4OXYA 2DUUA 2Y0EA 4FN4A 2C2XA 1I32A 1NASA 1P1HA 4FJ0A 4F45A 3KLMX 3I9MA 4HV4A 3T4XA 4C7JA 5KKAA 5LDHA 2HJRA 2X86A 3AJRA 3GVHA 3PJDA 4N5MA 4QSMA 4XDZA 3EZLA 4XQ9A 1E6WA 3O8QB 1QSGA 3GVPA 1DC3A 4FOSA 4I8XA 4NBTA 3B6ZA 2BFOA 3QRWA 4IJWA 4XYBA 2GF2A 1ZEJA 4NBWA 1GUZA 3FTPA 5HTOA 4FS3A 2G17A 5FYDA 3H8VA 5JLAA 1RJWA 4CLOA 3GFGA 2W98A 3ZU5A 3LDHA 2HRZA 1DIGA 2RH8A 4CQMA 1Y8RA 2EXXA 1E7MA 4L0QA 1LTHR 2VTDA 4PLFA 3D1LA 1GYQA 4J49A 2JFFA 2BKAA 1EDZA 4Y8VA 4E5KA 2BLLA 1H2HA 4D3SA 1B7GO 3C7AA 4Q3CA 1NTOA 1U2DA 2B83A 3WG9A 4H16A 2W2KB 2FZWA 3JQCA 3L6OO 3U4IA 4ZQBA 3SC6A 1NQ5A 2EKPA 4EJ0A 3GEMA 3EUWA 3I6QA 4JBIA 3DTYA 3UUWA 5KNLA 5JMPA 1WZEA 4BQPA 3FD8A 3JQEA 4IY1A 5F5NA 1QLHA 3H5NA 3PK0A 4GLLA 4R5HA 4BNWA 3FSRA 4CLRB 2HU2A 3BHIA 3OICA 1LSSA 2VZ0A 3AUUA 4E2WA 3DXFA 3JQAB 4XB2A 3ANNA 3ITDA 4BKUA 4KWIA 4JK3A 1H9BA 5A04A 1P0FA 4IDDA 4MKRA 2J3HA 2VN8A 4R01A 1ZIDA 4E12A 2RHRA 2WEKA 1QV6A 2HSDA 4XDYA 5JXWA 3F1KA 2WJPA 3ZI0A 1N1EA 3FCOA 3ETEA 5LCXA 1FDTA 4FFNA 4XZ3A 1NX6A 1E1MA 2AE2A 3HSKA 5ENDA 2VOEA 4TKLA 4RVDA 3GRKA 2DBQA 4HX5A 1PGPA 1NP3A 4L4SA 5AXDA 1PL7A 5G0UA 4L8VA 4MVJD 2W4QA 5CEFA 1HL3A 4BKQA 3BTVA 3GZ4A 1CETA 3GK3A 3QHAA 5ADHA 3ONDA 4FQ8A 4YACA 3DOOA 2VNAA 4JJGA 2WDZA 3JD0A 1F12A 4EJ6A 4P4LA 1KOLA 4QT0A 1DHRA 2GN6A 3I83A 4E2ZA 4CLHA 3GA0A 2EERA 2FZEA 4FC7A 3GVCA 3BMQB 2C2YA 3GAFA 2X7HA 4YCAA 1OZAA 4BO9A 4UVDA 1S7CA 4OOFA 3WSWA 4W4TA 4IBOA 4HY3A 3NTQA 3SC4A 3ZN2A 3W4KA 3S8MA 2X22A 2XXJA 4YB8A 3MJ4A 4MVJI 1U5CA 2Q50A 1CEQA 1R4MB 1PJCA 3WS7A 3JQGB 2HQ1A 3EVTA 1X1TA 3WIDA 4MVJM 3DONA 3ROMA 3OQ1A 5AQ1A 5I8ZA 4JNKA 4TRJA 3ZV5A 4BGVA 4YPOA 3Q2KA 1T4DA 5C7LO 1N8KA 3V1YA 1KC3A 1Y6JA 3H2SA 4WGGA 1D1TA 4OQZA 3VPSA 3LQFA 3H65A 4M1QA 3PLNA 1GD1O 3RSHA 4EBFA 1JDJA 3FR7A 2NACA 4OIMA 3VHRA 1LX6A 2O3RA 4NNJA 4Q3EA 3NUGA 5B4VA 2GO1A 1E3IA 4LGVA 4XCVA 4BGEA 1H0KA 3ZGYA 2UVDA 2X0IA 1YL6A 1TXGA 3Q1LA 4J4BA 3HB4X 5IN5A 4HFNA 4J2OA 5EQFA 2Q2WA 4JLWA 3V2GA 2Q1UA 3TRIA 1Q7BA 2FRDA 4U8GA 3WYEA 2P91A 5HRUA 4MIYA 1YQDA 4QEDA 3L77A 2NVUB 3DBHB 4BNYA 1QORA 3CH6A 4QX6A 5JMWA 1EVYA 1BXGA 3ZWCA 1Q0QA 2Y1GA 4P4NA 2O3UA 3WX0A 2AEFA 3U4DA 3IAHA 1SO8A 2FP4A 1LSJA 1R12A 4JBHA 2HUNA 5F1KA 1NPYA 3HDYA 4UUNA 4XYEA 4BNMA 2YFQA 1UP7A 2XAAA 3FPLA 4XGIA 5I7FA 1GTMA 5I7VA 1UZNA 3QVXA 1NBOA 3IP3A 1E1NA 4J1SA 3QVSA 2ZTLA 4AJ4A 2HDHA 2WTBA 4MKZA 3FWNA 3VOSA 2ZB4A 4TVBA 4DWVA 1KYQA 3BIOA 2VNSA 3P2OA 4Z0HO 1E3WA 2C7VA 5AXBA 1PS8A 4A03A 3C7CB 2G1UA 4J0FA 3PI7A 1PZEA 4DIOA 4U0KA 2VZ9A 5HA5A 2WSBA 4JBGA 4ZQGA 1BW9A 3PQFA 2CVZA 3IUSA 4KUGA 2Y67A 3FBTA 4IJUA 4OGWA 4CQLB 3EVNA 2ZIZA 4B4VA 5A3JA 4PRKA 1O5IA 2C20A 4BOYA 1PQPA 3D3WA 1W73A 4XIJA 4NR0A 5KJEA 3K6JA 1MFPA 4BKRA 4ZA2A 3MOIA 1BXKA 3MCVA 3PVZA 4UULA 3H9EO 3RBZA 1OMOA 3VPXA 3W8DA 4ESOA 3A28A 1ZNQO 3KBOA 5FF9A 4PVCA 2X8LA 4RLSA 1ISGA 1MG5A 4FGSA 1PGQA 2AE1A 2C82A 4U6SA 3UVEA 2OO5A 4R51A 2C7GA 4IS3A 4RVUA 3RUEA 4S1VA 4B79A 4NBVA 5IAAA 5EQDA 4ALMA 1H2BA 2I6TA 2PZJA 5G4KA 5HS4A 2DFVA 2EGHA 1VJ1A 1P1RA 1IHYA 1PWXA 5DCYA 5C5IA 1HSOA 2Y1CA 2AXQA 3JQ6A 3VVCA 5COQA 5FEUA 3AW9A 2FPIA 4L4XA 3CE6A 4Z3DA 4LCJA 2CMDA 4YDRA 1I30A 2Y93A 3ZV4A 1ZFNA 4AFNA 4BV8A 1HYGA 3WQSB 1B3RA 3G1UA 4ZJUA 2O4CA 1PEDA 5JSFA 3TSCA 3ZV3A 2VTEA 3UCXA 2PGLA 3WBFA 3IJPA 1VM6A 3WTBA 1W0CA 1YJQA 1C3VA 3LT2A 4UVEA 4IDGA 2O23A 3PXXA 3WNQA 3FPCA 1SOWA 1FXSA 3GZNB 2WYWA 3BMOB 1C1DA 1RYEA 2X5KO 1OI7A 3OIDA 3OH8A 3GF4A 3GGOA 3KYCA 4TSKA 1CDOA 1HLDA 3E18A 3P19A 3WGYA 2EP5A 1GQYA 4A5OA 4ILKA 4WLUA 4XR9A 3K2EA 3F3SA 4IIUA 3VPHA 4G81A 1UR5A 2NV6A 3CTMA 2JKVA 4CLEA 5CPFA 3GN1A 4MP3A 4IZHA 4OSOA 3L4BC 4R1SA 2Q4BA 1Y5MA 5F5LA 5BQFA 2BFPA 1U2GA 2DLDA 3VTFA 1XA0A 2NQ8A 2VT2A 1P1IA 5JW6A 1RPNA 3ZWPA 4ALJA 1ZSNA 1JQBA 2DBRA 2PGJA 2CDCA 3VVBA 3AU9A 5JDCA 1BVUA 1HDYA 2VOJA 3A1NA 1W6UA 2CY0A 3VPFA 5DCUA 3SEFA 4YAIA 4TMFA 1XIVA 2NU9A 3WGOA 3DMYA 4W82A 1LDNA 1BTOA 1UXKA 1I3MA 2WYUA 3GUCA 3HDQA 1FDWA 4LW8A 4MVJF 4CQMB 1Y8RB 5LDGA 3JD1A 3QWIA 1ONNA 4A2CA 2IZZA 4XQGA 3TOZA 1EFLA 3ZU2A 2CZCA 1JW9B 5JFOA 5EERA 1CIVA 2DFDA 3LT1A 3NRCA 4LCEA 4M55A 4QFDA 4W6ZA 4XA8A 3VTZA 4CM7A 2EKLA 1DLIA 3C1AA 4B4WA 3FBGA 2GN4A 5I9LA 3PP8A 3DDNA 4BO2A 2Y05A 2O4UX 4D42A 1NQTA 4UUMA 2ZTVA 3U4CA 1TEHA 4BB5A 4OAQA 5A9RA 4NZ9A 4MVJE 3F5QA 1SB9A 3OBBA 5ER6A 4GKBA 5KJ6A 5T73A 1M67A 2P9GA 2RHCA 1YKFA 2CVQA 3RKRA 2NNLD 3I4FA 4MOWA 5KVCA 3RU7A 2ZKLA 1E7QA 1T1SA 4PZEA 3PZRA 1U4OA 5HWSA 2E6UX 5DOZA 3RI3A 1NNUA 1PJ4A 2HJSA 3GMSA 4CM9A 2VWPA 5ILOA 3DBVO 2EEZA 1XELA 2JHFA 2GZ2A 3K73O 4BGUA 2O3JA 1EK5A 3O03A 4IQGA 4B7UA 4FFOA 4RCVA 3DAFA 4KUHA 1BSVA 1WDLA 4CL3A 4LSWA 4ND4A 5A9SB 1TT5B 3HDJA 4J91A 5KJ1A 1BXZA 1YB5A 2QQ5A 3PJGA 2CF5A 3KYDA 1YO6A 3H7AA 2NM0A 3RWBA 5ES3A 1O94A 1PZFA 1Q1NA 3GC6A 3W6ZA 4OL9A 4TKMA 3GDOA 1PWZA 1ULUA 4L76A 4U0JA 3TQHA 4J4HA 4F46A 9LDBA 3GY0A 1ZSVA 3MJSA 1ZW1A 4GAEA 4DLLA 1LJ8A 4ITUA 1GU7A 2OOSA 5JCJA 4E5PA 2IXBA 1BRMA 1LUAA 3TL3A 3BTOA 1F0YA 3ABIA 1CWUA 1I01A 4PZDA 1DRVA 5AXCA 1JWAB 5U4QA 3WYCA 3L6EA 2Q1SA 3RQSA 4U7WA 4MIEA 5ENVA 3QVTA 3SLGA 2G5CA 2J5QA 3JD4A 4OXKA 2WE8A 4NMHA 4NBRA 5L45A 1X13A 1EVIA 2CUKA 4FC6A 2H6EA 3OA0A 1YL7A 1YB4A 2Q45A 4KOAA 4EI2A 1C0KA 4LVUA 1C14A 4JGBA 1B8PA 1X15A 5IF3A 1IUKA 4R68A 2HO5A 3W6UA 4MP8A 4ND3A 1DFGA 1UXGA 3TFQA 3P2YA 1U3WA 2FHSA 3R0IA 2Q99A 3DZFA 5KVSA 2DBZA 5DZSA 3E5MA 4DLBA 1CF2O 4R3NA 2VRCA 4IMRA 4CV0A 3LC7O 2IXAA 4BMNA 4J4TA 4IS2A
chains in the Genus database with same CATH superfamily
2IIQA 2PEYA 1DBVO 1QK3A 4GSLA 2ADOA 4NE9A 4TGLA 3HKCA 4F2GA 2FMHA 4ZT6A 5CDYA 4I9GA 4WBNB 2PT7A 3KOYA 1THTA 3DE1X 1KI3A 2FFRA 1XZMA 2IEDA 3KR9A 3Q72A 1LQTA 2G6BA 1KXJA 4IJMA 4WZZA 4X1IA 5EYPA 4Z4HA 3OJEA 3LC1O 1NATA 2EW2A 5L51A 1K2WA 5JYDA 1RRPA 5A5DA 2DOKA 1VIMA 5CMLA 1S2GA 2F59A 4GM4A 4PG6A 5GZ1A 4PRZA 2GTPA 4H4DA 1BFUA 2EQBA 4LMPA 5AXAA 4ZYXA 4GYWA 3ESCA 1OB5A 4GZ6A 1VLLA 4I0WB 4UASA 1P8JA 4P32A 5IC4A 3R77A 4WI1A 4LYJA 2YN4A 4C6TA 3TCXB 1WR8A 4FMBB 1T3SA 1ZD1A 5DBEX 4BMZA 1J97A 3COZA 3UATA 3A1CA 3LFHA 2IF2A 3L7KA 1WXEA 3UH1A 4KXQA 3KHKA 2NZVG 5AICA 3WWOA 5L4NA 3IUNA 3CRW1 1D5CA 1A1SA 4KN6A 2AHRA 1R6BX 2G0AA 5DHQA 3A4VA 3A6FA 1AX9A 1IBSA 3H04A 4Y2JA 4YH1A 3TQTA 3H86A 2Y1EA 2A5JA 1V3QE 2BFDA 3A26A 5A4IS 3F71A 3IT2A 3C7DB 1AV7A 3DVQX 1SWWA 3SKVA 1RLOA 2Y8EA 3U81A 1EJ6A 5JS8A 3DZ6B 1HT2E 4X90A 3Q0EA 3NPAA 3U7RA 2JBWA 2ZUUA 4J43A 4TUYA 1G4UR 1KZ7B 1A8HA 4Q3BA 2X0FA 5MF6A 2V54A 4RH0A 1V5IA 4M53A 2GERA 5FUBA 2QL6A 3GG9A 1MQ9A 2Y99A 2ONKA 5T4BA 3W3AH 1P9NA 4GMXA 4BYGA 1TO6A 4MWGA 4C7XA 2O8FB 2Z1NA 4KGVA 1E3WB 1KAEA 1GA1A 3C24A 3UG6A 4F0JA 1JNYA 1VPDA 2IF0A 3MAGA 1JKJA 1HDCA 2IDMA 3ZK8A 4JB8A 3SEQA 2R00A 4FGWA 1NC1A 1LPBB 2VEDA 5KJFA 2PLNA 1RXEA 3BZWA 4MIKA 4GZ5A 2ZXUA 2LR0A 4G0MA 1ZA2A 2D0IA 4FP9A 4Y2UA 1L5RA 4O25A 1QQBA 1Z63A 1ZH8A 4F9EA 2QW0X 4DPLA 3WRWA 5C2JB 2XXAA 3PGLA 1YNOA 2DTXA 5AVQA 4R54A 3UXEA 2WJJA 3TIXB 2XJ9A 3ASZA 4IFTA 1WM1A 2X15A 4BO0A 2UVPB 2ECFA 2ATVA 4C3ZA 5DYGA 3R41A 1IWBB 4ERNA 4F7WA 1AURA 1P33A 1MX9A 4UOQA 3TK1A 2I4OA 4TV8B 1UFQA 2V6IA 4U4AA 2ZE8A 1IRXA 3BJIC 3QF7A 3ZHRA 5EHZA 2V6FA 2GA9A 1JL3A 3CONA 3EAFA 3O31A 3HJFA 1KJJA 4Y6OA 2WSIA 3LIIA 2O8DB 1JDBC 3CINA 2ZR7A 4MYTA 4S3MA 1RZVA 3W3AA 4M49A 1IYZA 4OLAA 2PMCA 4R7GA 2R85A 1E96A 3G13A 4KFRA 4PHHA 1QHEA 5EXTA 3A9TA 2D2IA 4MRVA 2GJSA 2YH2A 4N9QA 4NPHA 5J4KA 1XTRA 4HQ6A 3CSUA 4GOKA 3TOXA 1NRJB 1MR3F 4D0SA 3STWA 4YAJA 4EMSA 2NPOA 2IEAA 2BPOA 3T1TA 2MU1A 4FJ2A 3U4MA 4R1NA 1JVNA 5LXTA 2AJTA 5AYVA 2H4FA 1NU6A 4B7XA 3MWLA 1TU4A 4QIHA 4L07A 3R3WA 2ZUBA 5CLJA 4XJTA 3IE1A 3RANA 4EQ6B 2ZBUA 2OKGA 3M6LA 5IABA 5LP1A 1SCNE 1QHHA 2FOXA 3HUTA 3WMXA 2JGMA 2PZMA 1C3JA 2IHBA 3VTKA 1ZDMA 4OBEA 3MRVA 5B7GA 5BQ3A 1K08A 1DDGA 1XUOA 3O4JA 3AV3A 3OPQA 2ZSKA 1U3DA 1TCBA 1UZMA 4HZUA 1O94D 3HSSA 1KYTA 5F3RA 3KTOA 3DFMA 1CU1A 3N2EA 4YP0A 1JHVA 2NXEA 2ZRHA 5DKFA 3E58A 2ODQA 4NARA 1UJ2A 4F4UA 1KO7A 1D6MA 4DC0A 1O03A 4NPCA 2J0QA 5EP3A 1GUAA 3QX8A 2DRIA 2QR2A 3TPCA 3R5JA 4AXBA 1APBA 3GDGA 3TB6A 3R8CA 4LZJA 3INGA 2YJ5A 3IVGA 4LY3A 1M8FA 1I8TA 2IZ7A 4G36A 5TVOB 3KYCB 3WHIA 1NVDA 7MDHA 1AK9A 2Q8QA 2AWOA 5ERGB 4AUKA 2WTUA 1ZIXA 4D99A 5C35A 2VTBB 2TMYA 4CU2A 3B5JA 2WWIA 3BKWA 3TLGA 1HDOA 2ACEA 3LNCA 3OEED 1ZNWA 1I4EB 2IA5A 5IUKC 3ST7A 3OTIA 1UMBA 4JI6B 3WKAA 1WU8A 3N7UA 4DDVA 3FNGA 5JHGB 2WWRA 3NGMA 2PJUA 3BGOS 2M98A 3EVGA 4H59A 5JBIA 2HSZA 1XCOA 4DN6A 1T2DA 4UOEA 4P2GA 1PZMA 1ENZA 2OAQ1 1UAYA 2DHEA 4TYYA 1JA9A 3DQPA 1GWNA 1Z5UA 2F3UA 2JJ8A 3IMKA 3NAGA 3PC4A 1QB8A 5EL0A 4DS3A 2TMKA 1I79B 4C0WA 1CQWA 3MZ0A 1CJKC 1FYFA 4K6CA 2IDZA 4KK3A 1F5NA 5IEBA 2Y1OA 3V2UA 2BONA 2VQ6A 1FB5A 1G8MA 4BNZA 3S28A 5HIAA 4GXNA 2P79A 1SXJA 4IGKA 5EN4A 3DOUA 5JCOC 4OGGA 2E37A 2CNWD 1GV1A 2GZHA 4YCJA 2C2WA 4MVXA 4V02A 4JEMA 3CWZA 4EJ2A 1A27A 3ORYA 3V6MA 3Q40A 2QRKA 4CPDA 1OB2A 2P30A 1GDTA 2QNRA 1SN7A 4Q9JA 4EFKA 1GZSA 1NVBA 1D4OA 2DFNA 1LBIA 1RI4A 4TWBA 1I36A 9ATCA 1T8WA 1C9EA 4D9KA 2GJ9A 3LKDA 4LKOA 3UJ8A 1KEUA 1SQ5A 1KOJA 1W87A 1W4ZA 2BCGY 1N2CA 2QN1A 3OTHA 1QKIA 3LLCA 4FE3A 4ETNA 2UUPA 2WUDA 2YXNA 3ZZ1A 3KC2A 4OKNA 3PFKA 5AKJA 4JEUA 4C08A 5EZSA 2BP7B 4G0PA 4I66A 4WFJA 4IVRA 5EIXA 4L72A 4MITA 3USCS 4Z0TA 5J59A 1X7WB 4CMJA 2HLDD 1G8JA 1PWYE 1ST2A 3N0WA 4L16A 3VBEA 4BTEA 3RG8A 3ILHA 5AKXA 3CX7A 3TJZA 3ZU6A 4RDHA 4F6RA 4L4YA 1XMIA 3L7DA 3FJOA 4AJEA 2PGNA 5F78A 1HV8A 1L4EA 1SJ9A 1L7AA 4X60A 2FWAA 3I8XA 3TVDA 1Y81A 4PX2A 3T9FA 5TQ2B 3E48A 3AM3A 3H9CA 2JLSA 1P4SA 5KAPA 4TV9A 1B42A 4ZICA 1IOWA 4V0NA 3DEZA 1G6OA 2RGDA 4J0EA 3M6UA 2L42A 1GU0A 1W29A 3EASA 2UXDB 2WTXA 3LT0A 5ALMA 4W5WA 3QIVA 2PXCA 3OWXA 1A5SB 4P9NA 2OHOA 3T54A 3IKTA 2FPMA 2ZSHA 2NZXA 3FKSA 1K66A 5J5VA 4DWWA 2BFCB 2EFYA 5I9BA 1PR0A 4N18A 1SBTA 1NUTA 1ORHA 2GCGA 2A78A 2ODBA 1NXTA 2QOEA 2VH1A 3BREA 1RI5A 4KWTA 5AW8A 1ZNZA 3JYQA 4UBNA 1TA4A 4UUAA 2I99A 4LUCA 4BCCA 2Q4EA 2O3QA 3RK4A 2VUSA 4GSKA 4JFRA 2C7RA 2Z9BA 4B4OA 5LQSA 1NZFA 4AT1A 3LPAA 2OPHA 2AA3A 4ZPJA 3EIWA 4PHGA 5D87A 2G9QA 5F76A 1X39A 2C3MA 1OOEA 3AUJB 3NYRA 1L4MA 2Z2JA 1LQ2A 3D6TB 5DGXA 4NCAA 4FR2A 4OD0A 4R2KA 1Q44A 4MS4B 1W8DA 1GPH1 2QDXA 2OESA 4N7MA 1RJEA 1RQLA 4RXMA 2R62A 4F8EA 1YK0A 3RGGA 2GNPA 4MCHA 3WLOA 4R98A 1SQFA 2Z8XA 1JLMA 3OJXA 2EGGA 1CS0B 1QYXA 3ZKWB 2XTMA 2CNNA 3VTAA 4RE6A 1U5BB 1T5HX 4WKGA 4DAEA 1AGRA 4KZPA 2P4HX 1A9OA 1IRIA 4PCLA 3GPLA 3RNOA 3KE8A 2XE7A 2X8BA 3LG2A 1T9CA 2R7NA 4K1LA 5DMXA 3N3BC 5FO0A 5BO5A 4H3HB 5U4XA 3ZU4A 4BIIA 4DREA 1QFZA 4EDFA 2QRPA 3AY7A 3V4LA 3LY5A 4CF7A 1N6PA 1XDUA 2C98A 2PKYX 2WR8A 5FULA 3RVRA 1XTPA 4JMPA 3UGKA 4BVAA 2CD9A 4URXR 1S8AA 3FZNA 2NO1A 3FUUA 3HB5X 1KH1A 5FXMA 2Z2KA 4JOQA 2O5RA 1TCCA 5D86A 4TN5A 5JCZA 4ZC8A 4GGOA 1RXUA 2VK4A 4MV9A 1W5TA 2ZIGA 3CX4A 3BJMA 3G2KA 5CLQA 1NBIA 2EFJA 3CZ4A 5B12A 1ZUHA 4DKJA 1O5TA 4GO1A 3E23A 3UQYS 5J1TB 1FMLA 4ZVQA 5FTLA 2OXRA 2IH5A 3E35A 5CDSA 2WJ3A 2A1TR 2ZJZA 4BJ6A 1FTNA 4YA6A 4FLMA 3SVLA 4MNTA 3SHWA 2DCUA 4FVTA 1JS1X 4FSHA 2Q6KA 4US1R 5ICFA 4YUXA 5KNBD 3UJ7A 4F2PA 1G3UA 2PXAA 1NVTA 5DYWA 2FK7A 2HMTA 4I50F 1NBHA 3DE2X 4XTRA 4KLRA 3R5TA 2CE7A 4NCNA 4X71A 1WEHA 1E32A 2YY6A 2A9KA 4LAFA 3UXYA 5H4GA 2XW6A 4GHWA 1Q95A 3K15A 4ICIA 2ZYTX 4Q39A 1KWKA 5DP1A 5ITZB 3VZQA 3KKOA 4IOKA 2QE7D 4HGZA 2MR5A 5DHPA 5FV7A 4TWZA 1Z83A 3A36A 1MORA 3KUCA 3VR4D 1JDPA 3BCHA 4PZPA 5F7JA 2QAIA 1NUHA 2PVSA 5B1HA 2C5AA 2XCQA 5JHHB 1H1TA 1G7SA 2CYCA 4RHXA 5E7JA 2ZYDA 2HXSA 2ORYA 4URWR 1SCUB 3FDFA 5AUQA 4DA6A 4GBMA 3KVVA 1W47A 2FN9A 4BB6A 3C3KA 1G8FA 2VDUE 2BL4A 1UJ4A 3CW9A 4D45A 3EFHA 5TPZA 2DR2A 3SJBA 1KPGA 4FFRA 4C01A 3ZIAD 2CNDA 1KQNA 1P62B 2JGRA 2WAYA 3DOJA 3MM4A 2GN8A 2N46A 4AY2A 3S44A 4LZNA 3RVOA 4V0QA 1KI6B 2WPNA 4IZ6A 1DAPA 1L5FA 3IR5A 3QX9A 4WXEA 4ZO7A 3RGWS 4CNBA 3WK7A 3I5MA 5IYZB 1XLVA 4J1TC 2PWBA 5EVJA 2ZYAA 1JI3A 1W1IA 3GLGA 5DGIA 1DE0A 2VDPB 3K0AB 3DDWA 4XLTA 1DOZA 5T67A 3V1TC 4ETIA 2RGNC 4M4SA 1NW8A 5AOCA 2RGRA 1NVAA 3OX2A 3VZSA 5G3ZA 1SUIA 1U8XX 3AG6A 1I2BA 2X0JA 3MJCA 4LXUA 2HWUA 3ZNQA 3FMIA 1CK4A 4FGUA 3H2ZA 3VV2A 4E2FA 1GCAA 1SCDA 2JAHA 4G5FA 1RDFA 3G7UA 3OT4A 1RKVA 4C3OB 4EELA 3IV9A 3Q6NA 4D82A 1EX9A 2GN2A 4LDJA 3BS4A 2UDPA 3DTVA 4E31A 1XQ6A 3GR6A 4HDKA 3GCGA 4H7HA 1CD5A 1SZDA 3JCZA 4I5DA 4N0MA 3IP8A 1GILA 2JL1A 1S96A 2IRWA 3TXAA 1ZN2A 2AB0A 1C3OA 3OKPA 2QN2A 4X0EA 3SJ7A 5KTKA 1JHAA 2P69A 4MKGA 1B8VA 5FNVF 1PR1A 3UJ6A 4MV6A 4IHJF 3MOGA 4A8HA 2PD6A 3QG5A 1ZGCA 1PAUA 3ETCA 5YASA 3TMYA 1KO4A 3VQTA 1TCUA 1DPGA 4R16A 2XE8A 1QX4A 1NRIA 2QLTA 2C8LA 3COSA 2AK2A 5AH0A 4CKXA 5JI3E 3JAMA 1XU7A 2GPWA 1NM5C 1U8AA 2AJBA 1XTBA 2HHJA 2HWXA 5ALOA 1L7EA 1JLKA 1L5WA 3ESQA 1AZLA 4YMIA 3IV6A 3KXIA 4WCFA 2B34A 4N1AA 1C41A 2CDBA 4WEQA 4E88A 1PSWA 1B93A 1PO7A 1XTSA 3OU7A 1PJAA 2WWXA 3AIIA 5TRTA 3RASA 3ZY2A 1YOVB 3AKYA 1SC4A 4M22A 1QO7A 1BCSA 3OE7D 2ES4A 1FUYB 2C29D 1BH2A 1S8NA 1W5AA 3KAPA 3OZCA 4Y2XA 4ENVA 2RONA 5I4KA 4UHFA 5L3VA 5LYJB 3ESRA 5EP4A 4GVLA 4HBZA 1ITZA 3EK2A 4AULA 3CVXA 1RM5A 4ALLA 3KR2A 3U9LA 1WULS 5DF1A 2H48A 1W35A 1T0PA 3CKYA 4US2R 1ULSA 2J6HA 2QW8A 5TS2A 4EGAA 3DWFA 2I6XA 3OF2A 2DQKA 1G3QA 2OSBA 3D4PA 4V03A 4DIUA 2HW8A 5FKJA 3I23A 4MUXA 5DVZA 4E4RA 1M66A 1NV9A 1Q7RA 4RXTA 3ZG6A 4AO6A 4URVR 5DN6D 4HK4A 6NULA 3PB3A 2GZ1A 3R9WA 2J59A 4OEHA 4YAWA 5ILGA 2R8XA 3SR0A 4HMPA 3K8YA 4BE4A 1U99A 3KJEA 1OGYA 3CW2A 1OASA 2W6JD 3D3JA 2VAPA 1C30B 1VKOA 2W2NA 2LCFA 2F55A 2VBGA 3OZIA 3EFEA 3AEXA 2NSLA 2Q0QA 1YDHA 1G18A 1JXOA 2FN4A 2IITA 4J76A 4P7FA 1QPGA 3R5FA 4QOHA 3ET4A 4HSEA 4CI0B 5LQUA 1LC0A 3I9NA 2RK4A 3MGBA 3D5QA 1DOAA 2WM3A 3B20A 4O3FA 4PYMA 3WIOA 4Z6KA 3V4RA 2W6IA 5C4MA 1VFNA 8MHTA 4WN9B 2ZRLA 4RJ2A 4DDKA 3KB8A 1EGAA 1W581 4AU1A 1I0IA 4ZP1A 3CZRA 5CVTA 1ISJA 1PR3A 1TU0A 1QB7A 5A1JA 1JIVA 2AWNA 2RB5A 4D9JA 1ZGBA 1RHKA 3UUEA 2CXSA 4ZK6A 1EFCA 2C94A 1EHCA 3LHIA 4L2IA 1UL1X 1JEAA 1RQNA 1T8PA 1F6BA 4EUNA 4F6CA 2HMYB 1G20B 4NHEA 1LTQA 3WV4A 1KQGA 4BO7A 2PRYA 1L1EA 5CT9A 2RHDA 4CKEA 3E61A 3FTQA 5H3LA 2JIZA 1BA3A 2VPXA 2YBEA 1ODCA 1S3FA 3K1TA 5IBQA 1KI4A 2IS1A 3FPHA 1NW7A 2DSNA 4R3WA 4NDAA 4Q4JA 1GGMA 3PNSA 1KARA 5KOJB 1B74A 1Q21A 5DX1A 1ST3A 2BR3A 4RV9A 2X2OA 1R2QA 3O8LA 3I52A 3QK7A 2ATCA 5EWMA 3SHVA 4P3PA 3WVNA 4LBVA 1DC6A 3TV1A 1XHFA 2HAEA 2OECA 3L7OA 1TQ6A 4UHEA 5E1DA 1ZOPA 4QXQA 3RLIA 3S2IA 3D2LA 3VXKA 2OV3A 4YRRA 4DLZA 4I9UA 1WETA 1DQRA 2OPBA 3GIWA 3JALA 3DMPA 3V7WA 2O8BB 2W2KA 2EBFX 3CVJA 2XECA 3NV7A 4KV9A 2D8MA 4PRLA 2PLRA 4EGFA 5EWJA 4HNTA 1GG5A 1J21A 2P6MA 1KERA 5DYNA 2HM7A 1A69A 4OMUA 4EM6A 1V35A 1TMYA 3CVUA 2RJOA 2FJ0A 3UUFA 4WE3A 4L8LA 1AMNA 1F2UB 1N33B 3VM6A 4KQXA 4N0QA 2ZJ4A 3I92A 3T94A 4GMFA 1KVUA 2GLUA 4TT8A 3TWOA 1JLSA 4MLDA 5EXEA 3OQIA 1SQ6A 1YE3A 2BFBB 2WSMA 1NJ2A 3PNKA 3KJXA 4RF3A 4QG7A 3W04A 3TYXA 4DLNA 3KKPA 4N48A 3DXYA 2P9CA 4G0WA 1ESZA 5JQWA 1QK5A 4I2VA 3LI2A 3IMFA 5AM3A 1U2RA 4HQOA 3BB3A 1TMKA 2VDJA 1KK1A 3KV1A 4N7BA 3RSZA 3NWBA 2H5EA 1KO8A 2XVYA 3NAMA 1XTZA 4GKVA 1XAGA 3G2LA 1PK7A 4A8TA 3PD0A 1O95D 2RGUA 3LM8A 3R75A 1Z4MA 2X4GA 3LDGA 2R87A 3KFVA 4A26A 3WYDA 1TZCA 3KS9A 2K87A 4D9NA 5JDIA 1VLHA 1GZUA 2AVNA 3PPIA 2W6CX 2IV2X 4PANA 2W43A 1PVVA 2HA2A 3PQDA 3PIIA 2OYCA 4QG3A 2WB2A 4MWOA 4FXOA 1WAMA 2G09A 3I45A 2JD0A 4UHDA 1R3UA 1X1QA 4TMYA 5AWFC 1ZCZA 3H3JA 3PICA 5IF9A 3C5WP 3OC6A 2OV8A 2PGIA 2RHLA 2XNCA 4R8RA 1E4YA 2WD8A 3OX4A 4TMKA 5B58T 3KD2A 3P5SA 4Y1FA 3J7AC 3NTRA 2QI9C 1QDEA 1TZJA 1JAZA 2OCYC 3NT4A 4M87A 3NHWA 3Q85A 1YJ8A 2TSYB 5ALHA 2IW3A 1JN0A 4PFKA 3ZJ4A 4XUEA 5DT2A 2QX8A 2ZKIA 5I7EA 3ZLBA 3H0KA 1DQYA 4CV3A 4EUHA 5LQNA 3BRWA 1KI9A 3CFYA 4IRXA 4EHJA 2UYCA 9GPBA 5JAMA 1E9VA 3OEEA 1J9EA 2EKDA 3NALA 3UK1A 4ENPA 3I28A 4FYVA 4I1OA 4PRYA 3H1PA 4HQRA 5IMBA 2YUTA 2FW0A 2DB3A 5K01A 4XSHA 2QLBA 3L1UA 1O54A 5U1PA 5T7BA 1LW6E 3L8HA 4Y18A 2D06A 5BSUA 4F3CA 3WLJA 4FFPA 3ZW8A 2ID9A 2P35A 3TD6A 2X4IA 3IJRA 3PE4A 4HDOB 2R25B 3KOOA 3DZKA 1YB7A 4JQZA 3ROFA 2BIFA 2J87A 4KLNA 4ZMRA 2VJNA 2RH5A 5IJ0A 3HB1A 1XQ1A 2XMBA 4MYRA 2UZ3A 2AYZA 4HX9A 4F21A 3RG2A 1V4BA 1VYHA 3LWBA 3VAAA 4RIFA 5AVZA 3MUNA 3H3XA 4M88A 4GPD1 2ZAIA 3KVYA 3LOPA 1RWVA 2GDZA 5CNIA 1VJCA 3C98A 4FFMA 3LDFA 1N4DA 1E9BA 2GTHA 1ZXBA 2X0NA 1UFRA 4TQGA 1JEQA 1U1IA 2CJWA 2HMAA 5FWNA 2BZ0A 1DHTA 4YJ2F 4YGYA 3OCCA 2QSYA 4QZVA 5EIOA 3SFVA 3EIFA 3E3OA 4GI5A 5TC4A 4ZKEA 4I55F 1TTHA 1JB9A 4MKIA 3X1WA 1E5XA 1SU4A 2DJIA 1MGOA 3VR3D 3FHJA 1VL2A 4RL4A 5FI3A 5CEJA 5DBIA 2JLBA 2MR6A 5L8VA 3H5RA 3KSBC 2C5HA 4IUYA 3LKZA 4IOMA 4L5CA 2VAXA 1NMQA 2OCDA 1HURA 2W6MA 1VIAA 1F9EA 1Q7CA 3RC3A 1Y48E 4RVCA 4PAGA 2QVXX 3LY7A 3GNQA 4MRPA 3KEMA 2M6KA 1Z06A 5IULC 4YCDA 3AX6A 1W52X 1YUBA 3RJ5A 3UT5A 1OUMA 5IH7A 2GMWA 1M7HA 1A8PA 2LVBA 2VXOA 3HG7A 1QGZA 5GADl 5BVHA 4PYNA 2OLEA 4OI4A 4ZREA 1V8DA 2HF9A 3MTEA 4C4SA 1QQ6A 1SG9A 3F9CA 1YFLA 4OHBA 2L0XA 3CX6A 4MWBA 3T8YA 4KRFA 4GC9A 3DYIA 4WLOA 4DXAA 3RSCA 1EFAA 1U1DA 3CX3A 2QQ0A 5F35A 1IM2A 2IEIA 2BT4A 3ENVA 1XRNA 1TTTA 2HI0A 4OFXA 1KP9A 4BFUA 3PQ7A 2WG0A 2BBWA 4KKXB 3AL3A 4EKDA 2L69A 3RRMA 1YBAA 3GRAA 3BDIA 5DHRA 3N5CA 1DAOA 1E2HA 4JBNA 5AVKA 4BVJA 1AGNA 3OM0A 3GVXA 3ORRA 1IJKA 3EYWA 4LQCA 4RLQA 3SZUA 3E82A 2R47A 5JATA 2I3AA 1IQ0A 4JITA 2C31A 4M3NA 4FX5A 1BKSB 1NAHA 3B1VA 3FDJA 5DTIA 2MYPA 3I04A 1JE0A 1PX2A 3QBJA 3ORFA 2C83A 2JI6A 1YE5A 3N07A 4PYJA 3D8TA 4BY9E 1JILA 3AONB 2HA7A 3H2IA 1TADA 4QOIA 4DW8A 5KYGA 5MGNA 4IF4A 4XWWA 3SM9A 1HFKA 2GLXA 3IC5A 1WDWB 3LY8A 4OLHA 4UQPA 3R6DA 3KSDO 4WBSA 4U39A 3Q7QA 3VR6D 4BQNA 2I1LA 1XBTA 5JSZA 4YT4A 4BNGA 3G0IA 3JQFA 3GLVA 4I5EA 3T1VA 4I08A 4AMZA 2ZK7A 5F9FA 1FNBA 1ODFA 1P5RA 1Y34E 2MYUA 2VHYA 4H3SA 3WMWA 2P27A 3DEYX 3NHMA 5JZSA 3LCVB 4WZAB 2PRJA 1CJCA 1PFKA 4U9IS 4ER6A 1NVFA 2VPTA 1U0EA 3Q3EA 4LBWA 5C0OE 1D5WA 2KLBA 2WSSD 3QF4B 3VR4H 2QUJA 4Q47A 2Q7DA 3UW1A 1M6WA 3H6GA 2ZEJA 1DAGA 3WK9A 4C0KA 5JSKA 4YRAA 1F2DA 3QWBA 3WJAA 2ABWA 3KJZA 2WD9A 1PHPA 3SBXA 3L6RA 2W2VA 3LKVA 4M0DA 1ORIA 3KLPX 1PT9A 4PC1A 4DV4B 1V41E 4AMGA 1PFGA 3KZVA 3QKIA 1LZKA 3SJUA 4DV6B 2BGMA 3R20A 1OXVA 3U31A 3P97A 4A9AA 5LN1A 1I6LA 1MGPA 1E4OA 1LSUA 2IU6A 2LTAA 1HETA 1K4MA 2QN6A 1JR3D 1ISSA 5JWHA 3AWDA 3SXPA 6AT1A 4QRHA 4RQBA 3AK4A 1R8YA 3D0QA 1D6JA 3KWMA 1LXCA 1REQA 2YHUA 3TW4A 5CLFA 1T2NA 1YZLA 3JQ9C 4MWCA 5ELLA 4BLRA 1Y9EA 1MC5A 4E1BA 3ZLTA 3NR2A 7ADHA 3HE3A 4DR2B 3QVUA 1V48A 2SNIE 3MTIA 1IVNA 1R0XA 3FDXA 3PHGA 4GPBA 1GPJA 1GPNA 5AI6A 1GPLA 1X2EA 4FNOA 2ISSD 4HYEA 3D7NA 1VJ0A 3P9KA 2O57A 4XB1A 3VR4A 4TL8A 4D9CA 3LH5A 1JT9A 2HF2A 2VJBA 2JFPA 3NJ4A 5GJBA 2NZ8A 2ZLBA 1QIHA 3G9XA 2W9XA 3JQRA 1N0WA 4XDGA 1C1DB 4PZ9A 3SLRA 3F47A 3NMUF 3ZQKA 2E3JA 1E1YA 2O6HA 5CU7A 2AQ8A 2BVNA 1O97D 1T0UA 1JYSA 3MQ4A 5F52A 2AG6A 2VCHA 5AW6A 3GJYA 4M1EA 2RKOA 2FPGB 1O89A 1RKXA 3O74A 4QD3A 5H4HA 3HBAA 2EZ8A 1PSDA 1YCGA 2F1JA 4EF6A 2E4ZA 1Y4ZA 1R88A 2GZMA 3EXHC 2VWHA 2BH9A 2I3BA 1HF3A 1PJQA 3O6VA 4OFWA 5CVJA 1Y1TA 4GBGA 1T5IA 4OFZA 4KQJA 1ZK2A 1WX1A 1YCHA 3TZKA 3KQOA 4CEIB 2QV7A 1PR4A 3D6AA 2JH9A 1YR2A 1W25A 4Z9AA 1Y3AA 3DWIA 2XB9A 1T15A 2YDYA 4EF5A 1OFGA 1TVKB 4DMRA 3HCAA 4NYJQ 3RAGA 2P9TA 2QRLA 2YMQA 3OKFA 2V6MA 4G0XA 3II6X 3RBVA 2XODA 4U6NA 1RIIA 3NWEA 4QA9A 4B3JA 2JKZA 2RBEA 4RANA 5F4BA 4N76A 2VJOA 1V71A 5H70A 1HZJA 5B58C 1EHYA 2EWWA 3U7QA 4CMAA 3BKXA 4ZMSA 5LZ9A 4CIXA 1ZH6A 3CZ5A 4I55A 3LT4A 4A6DA 1YE8A 3I2FA 3UKDA 1H1DA 1BWSA 1R74A 1Q16A 4AN0A 3UTCA 2VZ8A 4RV5A 1NYTA 1RTTA 1PFUA 1ZM9A 4FMDF 1NMXA 1SCBA 2H1WA 1DKPA 4WX2B 2FWJA 1PVDA 4CDNA 1GLVA 1XFAA 5LOVF 1JFLA 1GNPA 1WXXA 3KUXA 1OHHD 5ICGA 4G1EB 2Q3FA 3HCFA 1N2SA 4LRWA 4TTAA 3RIMA 1K6MA 1FPMA 1UK6A 1NF8A 2BFEA 3U3XA 2GA8A 3A9RA 3MCAA 4M9CA 4Y9DA 1TRKA 4OI1A 3UN1A 4EL0A 1FUIA 3AY6A 3ZGXA 3IWDB 2VDVE 3BDVA 3HB9A 1YBHA 3HBJA 1KS9A 5AHXA 3BZUA 4FUQA 3RKUA 3ADBA 3DZ2B 3OJFA 3N0VA 3PC8A 4X41A 3W2EA 4G4JA 4DLXA 5IT0A 1DCFA 3QU5A 5KYVA 4IFBA 3GJTA 2QPOA 3QFHA 2Z58A 5P8WA 3SX2A 1NVMB 4C22A 3DKVA 3TNYA 6ADHA 4P33A 5LZ7A 3UFXB 2R6FA 4N54A 2C2KA 2C3PA 2JBHA 1G5TA 2NP7A 1TVCA 3NONA 2VSOA 5EMJA 1QRDA 1HDEA 2I5PO 2A4KA 3LVBA 3P1JA 1P7YA 1PW5A 3S3TA 4OXIA 4Q4LA 1MC8A 1YDEA 1CQJA 1R5NA 1FNDA 1LI5A 1T0HB 2FKAA 1S9DA 3F2VA 5D84A 3OM1A 3T9BA 5C4IA 3CLHA 4BUZA 4JLDA 1V6SA 2G4LA 3PQEA 1YA4A 4FYIA 2FG5A 1E5TA 1E92A 5JS2A 1Z0SA 1AS0A 3VGJA 1TT5A 1NQVA 1QMGA 5LR6A 4V0KA 4XEUA 3ZU3A 3B2NA 4GP7A 4C3UA 2IOFA 1KS2A 2PX8A 3IYLW 2JIMA 4P7BA 13PKA 3S40A 1Y1KE 1K9VF 2W6JA 4EF4A 4KMOA 4MKXA 1QVAA 1Z73A 1US8A 1M2OA 2HK6A 2YFYA 3HFGA 2RGEA 3MEQA 4NCIA 3ZZNA 4ACBA 3V4PB 4DCOA 2WNSA 2Q9AA 2W8BB 5MGBA 1A4IA 3CLTC 2H1HA 3MJHA 4D79A 2ZS7A 3IS3A 4EPXA 4MS1B 2GJ4A 3N2ZB 1F4PA 3M6MD 4IZOA 1P2SA 2YV1A 3HYTA 1ISMA 1PJTA 3ZI7A 2UYQA 1GXSA 1UAGA 2R5FA 5DNAA 1DT5A 1TZ2A 4E1AA 5L7TA 4XUGB 4WFIA 2J4FA 3INTA 1DCKA 4YAKA 1I33A 5AVUA 4DL9A 2C04A 4IDNA 3ZDAA 4RPIA 4GKJB 4JROA 3PG5A 4F93B 1ONSA 3FTCA 1NE7A 3JQQA 1OREA 1WSWA 3VHQA 1WCWA 4C5BA 1X7YB 3U7HB 1EBUA 2GARA 1C9DB 1Z5GA 2B5WA 3O9MA 1ULTA 4DIEA 1H42A 2OBNA 4M1ZA 4Y9RA 4ZEXA 4BXOA 1NP7A 2ACVA 2WIFA 2A59A 3NYIA 4O5AA 1SOUA 4PQRA 2YJ3A 1Z2DA 2D8AA 3GLUA 2XBUA 4KTVE 5CNMA 1EJ0A 4CFYA 2B4QA 2JJ2D 4OAPA 3WWZA 1CJTC 2Q9CA 4BKOA 4X65B 1Q17A 4LZLA 1XAHA 1QGUB 3HDTA 4HAVA 3T1QA 4AD8A 1GQQA 1X9HA 4D9MA 1N6HA 1QLJA 1VBMA 5SV2A 4W9NA 5HKKD 3IPCA 2BFMA 2Q1XA 2IIPA 4J6FA 4DBLE 1S01A 2XKJE 1K89A 3VO8A 4ZVTA 2WWVD 3P0JA 2EBHX 1C4OA 5TNXA 3S5JA 1KMHB 4Y1GA 3W06A 1P77A 3P2MA 5T41A 1OQAA 3I64A 3PWKA 3BRCA 4J3JA 5TGZA 4ECAA 1PNTA 2V98A 4IUDS 3A6JA 1IATA 1WP4A 2B6HA 2OGUA 2JRLA 3EBLA 2DH5A 5JYBA 5L3ZA 3ZY6A 2ZT5A 4IGFA 1A88A 1FU7A 1YB6A 2BFAA 3RJMA 4A7PA 3SJZA 2BI8A 3LSYA 1M6VB 2G88A 3JARB 2ATEA 3FCCA 2EZTA 3DJFA 3N2LA 3H0VB 3GGJA 1RQPA 2VJDA 2XMRA 3IEPA 3KQPA 2Q1WA 3DHYA 1EA7A 1Y89A 5JD6A 1R5JA 3CHYA 2F4NA 3C8DA 3BJEA 3EDQA 3HYNA 3A04A 3Q3GE 1HLGA 2BOVA 2JCXA 1U8CB 1O95A 4OYRA 1DBPA 1GCOA 3JWPA 2JVKA 4X9XA 3SX4A 5KSPA 4CF5A 5EJ4A 1GG9A 3KYJB 5DMHA 3H3FA 3SE7A 5EWLB 4B7CA 2XWBF 4GL2A 3WLTA 3GJ4A 1JTFA 1UZLA 4WZBA 4XWTA 5B2EA 1YMVA 1JQKA 1OTYA 4JKYA 1O0SA 3IILA 2J3DA 3GCWA 4XFKA 2WT8A 2JCSA 2QMUA 1N8SA 2FSVC 2Z2XA 1D09A 2R7AA 1VSUA 1DEXA 4XQCA 2LGJA 5EI5A 1YJAA 4QT4A 3TTTA 4IKPA 3OIFA 2OHXA 1AN9A 2H2AA 3FMOB 3P9YA 4AYWA 5ECGC 2I7CA 3UB4A 2B5OA 2IHNA 4N8DA 4ZU6X 4JSYA 3FCSB 3AV0B 4A8JC 3HZRA 4ZVUA 5EJEA 4MH0R 2Q9UA 3DV0B 3PSAA 4R0MA 3L1IA 1SUCA 1E3JA 5F33A 1RYDA 1P3Y1 1IOVA 4AWXA 1ZKMA 2OGTA 1XX6A 2C1EA 2Y1FA 4OXXA 1EM8B 5A4KA 2V7QD 5J58A 3BULA 4B75A 4CNQA 3HFSA 2F9MA 4XI9A 4CLQA 1BZYA 1A82A 1ECBA 3RRXA 1ICEA 2OK8A 2X9VA 4FBGA 2ZBEA 5J5CA 1R0CA 2UVPA 2VHJA 4XPIB 1XN4A 1UQUA 3NX4A 4R05A 4F3RA 2ZQYA 3QU7A 2GUGA 4QVIA 2P1DA 3MFQA 1IWOA 1HM5A 2XDQB 4FUTA 4IUBS 4UARA 3G82C 1EDDA 1OFVA 4YJ3B 3BWCA 3I76A 1I7DA 1KORA 3NH6A 3VDXA 2O8DA 1E5VA 1ZD3A 1GQFA 3ANXA 4I5IA 2G76A 3RFTA 3K70D 1R5OA 5ERYA 3KQNA 1X8LA 4MUBA 1SBYA 1T1IA 2GPBA 1OGJA 3C1TA 3FR8A 1N78A 2IXFA 1DIAA 2LWIA 2XDAA 4JUIA 4OGLA 3FNEA 4XWKA 5IJAA 1JEDA 3G68A 4FMCF 2CLDX 4JGGA 2F8TA 1ML3A 3IOYA 4BNJA 4R1LA 1PT6A 1DRWA 3ANTA 3D4BA 4Q19A 1N34B 2V6GA 4AN1A 4ZJYA 3BMCB 2V3WA 4EABA 1XZEA 5BORA 2FQYA 8AT1A 5E8JA 1IY8A 4CYMA 1OYWA 4G1BA 1DWPA 1OFIA 2WIGA 5HJ2A 4WK0B 2IIBA 4RYDA 4EQ6A 4XOUA 4EG8A 4DANA 3PUKA 3HMQA 5JYEA 4PQGA 3JTEA 1A8IA 1V1MA 1MO6A 1TUGA 1Q92A 1E3DA 1P5HA 3EP7B 1YR6A 2VHVA 3AP3A 1PGJA 3VZCA 1QAQA 3GLHA 1XVTA 1FUEA 1ZU4A 4YRTA 4JP1A 3UBMA 1UC5B 2JLYA 3G0BA 1VLJA 2XGJA 3QELB 5IXSA 5C8VA 1NZJA 5C37A 4COKA 4XRGA 4CT5A 3OCYA 2W2OA 2HQRA 2CL5A 3BE5A 2GAAA 5ER9A 1FFBA 3ZX5A 3BFJA 4JVSB 2XTJA 4OLBA 2XMQA 3RRZA 4RTRA 4XR4A 1RQ7A 4E13A 2HTEA 3O4RA 4WNAA 1J00A 5EKSA 2L2QA 1PNRA 1TKCA 4MW0A 5EHQA 1XR3A 2PS1A 1YWGO 2IODA 3OM9A 4QTZA 3T1HB 3QOYA 4MARA 3DE6X 4QM6A 2B8NA 2IELA 4PTLA 1JJIA 2IUTA 3CNQS 5A7GA 3X1JA 4EZBA 6YASA 1L3IA 3LZ6A 2YIDA 2N3ZA 1YFZA 3L05A 4RS3A 3WGIA 3BIWA 5LZ2A 4RQUA 2DHRA 3MA0A 3KZMA 4ZHQB 5LC1A 1HZZA 1Y3BE 4N3GA 4NH4A 2AUMA 1YR8A 4Y2SA 1J0DA 3TPZA 3V7YA 4DNQA 1D07A 3AXSA 3CY6A 3H7IA 3ZD9A 1TC2A 3NUZA 3OFND 4O1MA 4Q7MB 3JD3A 5CM8B 3OM8A 4E5YA 3U26A 4OI0A 3DMGA 1NJ8A 1JKFA 4XYLA 2ZAMA 3PF9A 2VSFA 1X1DA 2PO5A 2JLUA 4LJ6A 3MTGA 5L3RA 4Z3KA 2A3RA 3WDSA 2WHYA 2QKYA 3EGOA 5KYYB 1A98A 3C3PA 1H6DA 1TLTA 3M2TA 1QR6A 4Q9AA 4KSYA 1PQYA 4R1UA 4ZALA 4UAGA 3OCUA 3K9NA 4BZZA 1KSHA 5EMHA 1M75A 1JQEA 1O8CA 2FW7A 3T3OA 2BUCA 5TJ9A 4CV1A 2OFFA 4EZIA 3ZNNA 4UM7A 1LC3A 3U1VA 4M0MA 5FP0A 5CCEA 4DLUA 3V4ZA 1DJPA 1M73E 1AA9A 4G4SP 3PUYA 2HT1A 1IB0A 4TVSA 3W5CA 5BSWA 2QTVA 4WAUA 2EWMA 1D8AA 4IP0A 2BY4A 1KJWA 3A3YA 4AWAA 5BNZA 3DPUA 2J6CA 4HXYA 3D3KA 4HF7A 5BN3B 1DAHA 4PYLA 4CUKA 1UKYA 1Z5WA 3B3FA 3VJLA 4KQIA 4M8SA 1MJFA 4PX9A 1N2EA 2OR3A 4INAA 5TPWB 3A3PA 5DGTA 3UF0A 2W6ZA 2ZJ8A 1HXHA 3G88A 3EGXB 2AI3A 4HAOA 2WSSA 2XX3A 4RDCA 3DE4X 1SC3A 4A2WA 1EFUA 2XDYA 3IO5A 3IKVA 4BO3A 1IUPA 2C42A 4JL6A 4OBXA 4G1MB 2P4EA 1JG7A 2OOKA 1JLRA 4OP2A 3AXTA 2E4XA 3ONNA 4W8OA 1PR6A 1ZVQA 3OUZA 4U7PB 5EVCA 4CLXA 3M89A 5DLEA 3WWYA