3QW2A

L-myo-inositol 1-phosphate synthase from archaeoglobus mutant n255a
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYAILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
total genus 142
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qw2A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qw2A01
2W2LD 1PL8A 3PQEA 3RC9A 5F1OA 3SX2A 1R0KA 4XDZA 2IYPA 1K6XA 1KEPA 3LDHA 3ZWOA 1WP4A 2FPPA 2HJRA 2NADA 2AEFA 2FZWA 3AJRA 2VHXA 5GMOA 1DRVA 4YJHB 3ZV6A 1N9GA 4R9RA 4J3FA 3S1LA 1WDMA 3SXPA 4D0RA 1AHIA 4XGNA 3H65A 3KYDB 4AJEA 3H5RA 4E4YA 1HDYA 4A03A 4EW6A 4OHUA 3ZW8A 2VN8A 4PIVA 4CJXA 2HMSA 2ZTMA 1R0LA 2WE8A 1JTVA 4WKGA 1C14A 1ZMOA 4RVSA 1MXHA 2NU7A 2P9EA 3EAGA 1Z75A 5A9SB 4GL4A 2CVQA 3D3EA 5C7IO 3A4VA 5IN4A 3BA1A 4IZHA 3NKLA 3HHPA 5EIOA 4WLNA 5L40A 6LDHA 3EW7A 2H5LA 1E5QA 1P31A 4IPTA 3PIDA 1N1EA 1E3LA 4OQYA 2BF7A 1NBOA 3BTSA 1GTMA 4YJGB 2NTJA 4IGEA 2Q4BA 3AY3A 4ND3A 4QSMA 4BNWA 4UUMA 2OL4A 1C1DA 5L95A 1I3MA 3OIDA 4KQWA 4JBIA 3INGA 1UDCA 3GRKA 3W8DA 2Y66A 3HDYA 4BVAA 4WE3A 3WX0A 4DYDA 1O9BA 3PHLA 1GUYA 3GNQA 2I67A 1EBUA 1ISJA 2I66A 3DBRB 4U0JA 2Q99A 4WLUA 1ISFA 1GY8A 5CPBA 2VWPA 5AVOA 4R3WA 4BGIA 2CNBA 4NZ9A 1P44A 2ZCVA 5ES3A 1HL3A 3T7EA 1LQUA 3F5SA 1UXHA 2Y1EA 2EGHA 4FFRA 4CR7A 4CM8B 3R1IA 1QMGA 2X1HA 2IDZA 2OO5A 3WJAA 1CQJA 4YAGA 4YRBA 4K6CA 1TXGA 1P1JA 4AJ1A 3H6KA 3ZWBA 5JCXA 3Q2KA 2NV6A 4CM1A 1VL0A 2QIOA 4BV9A 2UUPA 5TJ9A 4GPD1 2HLPA 1JW9B 2F1KA 4F46A 4F45A 1U28A 5DCYA 3AM4A 2O48X 2NU6A 5CPFA 3E1KA 2FHSA 4E6PA 1JQBA 1E7RA 1HYGA 2BLLA 1PJLA 2GN9A 5CDYA 2YQ4A 1T4DA 3B1JA 3ROPA 1UZNA 2JCYA 1Z7EA 4R01A 5A5FA 4RPKA 4OMUA 1U5CA 4CLOA 2NTNA 2JCVA 1A7KA 5BR7A 3AI1A 3H3JA 4MKXA 3EMKA 4IDEA 1NVGA 4MP6A 1KC3A 5TGDA 4IDCA 1N9GB 1VRWA 4FN4A 1W4ZA 4AFNA 4AJPA 4BO0A 1I2BA 2C82A 1ISHA 3V5NA 3IKVA 1D1TA 1SEVA 1AXEA 1ZEJA 3TQHA 3D3WA 3CEAA 2BFAA 3Q11A 4LGVA 4YAEA 4RLHA 3WGOA 1SOWA 1T4BA 5DF1A 4RPGA 5JDIC 4EI2A 1JKJA 1NM5A 4PZEA 3IUSA 1IHXA 2ZQYA 3BTUA 1B26A 5JLAA 1ISGA 5JAQA 4BO2A 5IAAA 1SEPA 1D8AA 3JQAA 4CMGA 2FOIA 2NWQA 1BVUA 1JAYA 1T26A 1UAGA 4RPLA 3OM9A 3RJ9A 1NHGA 5JAMA 4NFSA 2O3UA 3AM5A 5FI5A 1U5AA 3Q2IA 1P77A 1VL6A 5DZSA 1NX6A 1UUFA 4FJ1A 4KQXA 2HSDA 4ROSA 1DJQA 4Y6PA 1GZ6A 5TT1A 5JAIA 2PH5A 3CSDA 1QYXA 2P5UA 4ILKA 4NBRA 4J49A 1B7GO 4QEDA 3JD2A 1R4NA 2NQ8A 1UDAA 4FJ0A 3FD8A 1DFIA 2WMDA 2VRCD 1V6AA 2C2YA 3COSA 1P1KA 5LC1A 4QFCA 2E48A 3EHEA 2BELA 3IJPA 1M6HA 3PFFA 2YW9A 1H6DA 3E82A 3VAZA 2CMDA 3E5MA 4IJVA 2PK3A 5AQ1A 1PR3A 4WCFC 2PV7A 4OIMA 2EP5A 4R3NA 5JPIA 3SC6A 1A4IA 3C1TA 5ENDA 5EINA 3FCOA 4CM3A 4JBHA 5L3ZA 1B14A 1ENZA 3PTZA 5AXBA 5ENVA 3G17A 4BUCA 4TRRA 1LC3A 4Z0TA 3A9WA 4RQTA 1NQ5A 2PWZA 2IE0A 1F8FA 3KEOA 4UVHA 4ZRMA 4ND2A 2J3JA 4MINA 2GCGA 1E7WA 1KOLA 1BXZA 1N1GA 3PJEA 3EZYA 3CH6A 4DQUA 2F00A 4NIMA 4CQMA 4DIOA 5L53A 5JCJA 4WLOA 4JJFA 3PWKA 4RZHA 4HX5A 1BW9A 4PG5A 3DMTA 1MFPA 3KZVA 4GLOA 5A03A 2YHIA 1LC0A 3GQVA 1N7GA 3ZN2A 4J43A 1PL6A 4RJTA 1MG0A 3NJ8A 3ZV4A 2P2SA 1CWUA 2D5AA 3RD5A 4R54A 2ZTUA 3L07A 3C24A 3WMWA 4YAKA 1HDGO 4XQGA 4MP8A 4QXMA 1DFGA 2R6JA 3V1TC 5ADHA 3D3WB 3HZZA 3IUPA 2FZEA 4YWJA 2JD2A 4OOEA 3DAGA 4RF4A 1OBFO 1W73A 1JWAB 1GUZA 4RZIA 3U0BA 2ZJ1A 3QVTA 4D44A 2Y1OA 2IEBA 4E2WA 2DTDA 5ITWA 4JXKA 3GDOA 2VUSA 3UH1A 1GL3A 1SZJG 1E3SA 4ZQFA 3GFGA 4O0LA 4ZQBA 1VM6A 3CIFA 2AE2A 1ZW1A 3P7MA 3UGKA 1H94A 2O3JA 4BKQA 1BDMA 1YQGA 1LX6A 1NFFA 4IQ8A 4J4HA 3GZNA 1MUUA 1NPDA 3HFSA 4YQZA 4LMPA 4FC7A 2WSBA 4B4WA 5DDIP 5JAZA 2RBEA 4WLVA 3MEQA 4J1NA 2Y99A 3KRTA 3U62A 1EVZA 2HU2A 1B15A 3DZFA 5I9NA 1X13A 4CMAA 4ALLA 3RUDA 3N74A 1YB1A 1XHLA 4YT8A 3OJEA 4CLRA 3DAPA 4CMKA 1ADCA 1SCUA 3P5SA 4R69A 2B5VA 5BT9A 4XGIA 4ALJA 3NRCA 3WBFA 3K73O 1HKUA 5JY1A 5EN4A 4L9RA 1ZBQA 4BO4A 4DLAA 3OF2A 3VPGA 4E2YA 1QYWA 1QXSA 3G3EA 4E32A 3KTDA 2FP4A 4GMFA 4MKZA 2VTEA 1GYQA 3KUXA 3L6EA 1BTOA 2E82A 1V3VA 4J2HA 4YXFA 5JS6A 4MPDA 5T5QA 3DHYA 4BQRA 1PGNA 4CQMB 3LZ6A 1PIWA 3FN4A 5I9LA 5KVQA 1BW9B 2C7GA 4BS9A 3WLFA 4Z3KA 2EW8A 4E5PA 3A06A 4XR9A 4IDBA 5ITVA 4MVJH 1U7HA 2EJWA 4G2NA 3JTMA 4E30A 5K6AC 4EITA 3PRJA 4PGFA 2NNLD 4PZDA 5M6DA 4QQRA 1U3UA 1ULSA 4DRYA 4BKOA 1HSOA 2C7VA 3WIDA 1ZNQO 2E49A 4Z6KA 5B4TA 1NFRA 4D3FA 4MOWA 1FJHA 4B4UA 3ZWXA 4YPOA 3AUAA 2IRWA 5G4KA 3OH8A 4M8SA 4N5LA 3B1KA 1NQTA 3H7AA 4NQZA 4HWKA 1DIGA 3OECA 3OJFA 2YYYA 1T1RA 1JAXA 1OFGA 3PDJA 4BL5A 2I65A 4HFRA 1YDEA 4PFJA 2Q49A 4C4OA 5L7YA 2VHVA 4CMCA 3QWHA 3RC7A 4R41A 1E1MA 4DMMA 1EUZA 2O50A 4GH5A 1EMDA 4LVUA 5I7FA 3KOUA 3MJVA 3WGGA 1CF2O 2X4GA 4GWGA 3EDMA 4XIYA 1LA2A 4MKRA 4FCCA 1P0FA 4GX2A 2WYVA 2OBYA 3NV9A 3ZWVA 3WBBA 3GA0A 5DOVA 3O9ZA 3BXXA 1IE3A 2NACA 4JX8A 4E13A 4E5MA 1VSUA 1SC6A 3FR8A 5C7OO 3BMQA 5JW6A 3UUWA 3RWBA 2HO5A 3ZNOA 4AG3A 4EEZA 3AU8A 1DOHA 3WFJA 4GX1A 4B79A 4CLRB 1DIHA 1NAHA 3GEMA 1U2GA 3MCVA 3QSGA 3FI9A 3QWFA 4MIOA 3QWAA 3UVEA 1YGYA 4F6LA 1KC1A 3D4OA 4WNCA 3IJRA 4RF5A 4EEXA 3ZU5A 1I3LA 4KDFA 4EUHA 5T73A 3WICA 4TRNA 4NFYA 1AE1A 5JO0A 4YQYA 1C1XA 3GG2A 1IPFA 1Y1PA 3I6QA 3PQFA 5G4LA 1OC4A 4BQPA 4BO7A 4YT4A 3OJOA 3ZNPA 3E48A 1PZHA 4MVJE 1PZEA 1YO6A 4ZN6A 3DBLB 1ZK2A 3PXXA 2ZYAA 3K6JA 4QTZA 1RKXA 1ZJZA 2Y1GA 2PGDA 3FNEA 1I01A 3K31A 4XYMA 5IDQA 1OMOA 2XXBA 4YAJA 3HADA 2IXBA 3FTNA 5JDCC 3U3XA 3PLNA 4YYZA 5A3JA 1A7AA 2QX7A 1DBVO 5ILOA 1CQIA 1FK8A 2AXQA 1Q2XA 2GERA 3L77A 4J0EA 2I5PO 4FIZA 5A9RA 1NFQA 3LF1A 1XDWA 2RH4A 1VKNA 2DU8A 2PKQP 1GCUA 5CFZA 3G49A 3EUWA 3ETDA 4ZA2A 2R00C 3C1AA 3ZDFA 3INRA 3VDQA 3DO5A 3L0DA 2OMEA 2PD3A 4TRJA 4UEJA 5JXWA 1HETA 3VZQA 1ISMA 3O8QA 3TOZA 1DEHA 4IJKA 1DSSG 2X8LA 1JKIA 3JQGA 5EQDA 5GZ3A 3I5MA 4IY1A 2POQX 3NX4A 1PU2A 3CZMA 3ONFA 4XDYA 4A7PA 3O03A 5JSFA 2QQ5A 4RF3A 1FF9A 4HNGA 2C5EA 3VKVA 3JQFC 1WDKA 3EVNA 5JYEA 2PD4A 4ALKA 5TS3A 3UCEA 4MIYA 3FSRA 4DYVA 2O4CA 3GUCA 4M1QA 3DTYA 1D7OA 3ROMA 3WWZA 5TT0A 1N2SA 1SBYA 2BKAA 1Y81A 2PLAA 4FDAA 2W2KB 3ZH2A 2PD6A 4CUKA 1QSGA 4R16A 4ZQEA 3BMQB 3HJAA 3OMLA 2EXXA 5ER9A 3INTA 3X2EA 5DP2A 2EV9A 1ZXBA 2NU8A 3ZGYA 3DAFA 3GK3A 5B4UA 4HADA 1Z82A 4TMFA 1LRLA 4BGVA 5BSHA 3LLSA 1LDBA 4BGUA 3ANLA 2TMGA 2WEKA 3Q1LA 1LRKA 4JROA 4IM7A 3BMCA 1LSUA 1WDLA 3W4JA 3RUFA 1E7QA 3DWFA 2O2SA 2I76A 3FTPA 1DRUA 1DLIA 3UKOA 4DTIA 2C54A 5DP1A 2YV1A 3WYBA 1MP0A 1H5QA 4RDIA 4YJHA 1IHYA 3TRIA 5A4DA 2B37A 2FPGA 3ZWPA 5KNLA 5G0WA 1I10A 3FNFA 4DQVA 1PGQA 4BNUA 4CMHA 5JC8A 4FOSA 4Q3BA 1X7DA 2P9CA 4CM9A 3V2UA 3DEYX 4S1VA 4ZU3A 5G0TA 4IINA 3GVXA 2BFPA 1JN0A 1KBZA 5L4NA 3MJ4A 1C0LA 5A9TA 5A9SA 3PJFA 4BV8A 4I8XA 4N5NA 4QO8A 2VRBA 4ZJUA 2PGJA 2LDBA 1B3RA 4TZTA 3PP8A 3C8MA 3A14A 5IDWA 4R1UA 1GV0A 3OICA 4K28A 2UUOA 2VHWA 3ZWNA 1T24A 3PHGA 1ADBA 2Q3EA 2I3GA 1B8VA 3PPIA 1E6UA 1GFSA 4CL3A 1DDOA 2HK7A 1ZK4A 2SCUA 3I83A 4YCAA 1XU9A 3ZCXA 5T6BA 1EVIA 1H6CA 5JO9A 2OOSA 2PH3A 3Q6IA 3L9WA 4MVJG 3ETEA 4OKNA 4XKJA 4RVUA 3JQGB 4PLZA 4J4TA 3ZHYA 5KJ6A 2I6TA 3LC2O 2DLDA 1TA4A 3JYLA 3TNLA 3ETGA 3RJ5A 5EQFA 1H6AA 2HRBA 2PZJA 1GUFA 4CR8A 2DPGA 4XRGA 5IDXA 5L7TA 4XJSA 2ILTA 2RHRA 1AXGA 2C29D 4KDEA 3VPFA 2H1SA 2VYND 1D1SA 1E77A 3HG7A 4QFDA 2NUAA 3JD4A 1R66A 3RC2A 2BI7A 3HB4X 1M75A 1J5PA 1X7GA 3AY6A 2HKIA 3H9JA 1WW8A 4PLGA 4A26A 4CM8A 5THKA 3ZWAA 5TLSA 4RPHA 5DNAA 3OBBA 2YV2A 5TF4A 3GMDA 2OHXA 3F1LA 3PJGA 1PJ3A 1I30A 3DDNA 5L7WA 2NVUA 2J8ZA 3JD0A 3MJCA 3IMFA 2HK8A 2QRLA 4OSOA 1XU7A 3M6IA 1E7YA 1E1KA 5A5EA 1E92A 1SMKA 1PX0A 2ZB3A 1LSOA 1Y5RA 1U8FO 4DUPA 3QVOA 4WCDA 3WWYA 4CM6A 3GEGA 3GDFA 4AL4A 3PZBA 1MC4A 2NVWA 1EFLA 4DWVA 4QO7A 3BMCB 1RM3A 2AQHA 2LDXA 2DAPA 3ZW9A 4PLCA 4BNLA 3Q3CA 2A35A 4YEDA 4UVEA 2P91A 3ENNA 1FDTA 1V8BA 3GGOA 1BXGB 1HDRA 1UP6A 4GKVA 1QG6A 2OORA 4DXHA 3AWDA 4TROA 3C3XA 4NBUA 3W4IA 2B0JA 3D7LA 3PLRA 1ONNA 5CHEA 3BMNB 5ER6A 1GDHA 1FDWA 3CE6A 2X0IA 4AJOA 1QYDA 1YBVA 3LVFO 3GVHA 3C7DB 2WDZA 2EKPA 4WEQA 4Q3DA 2G82A 1WXDA 1BSVA 4P8RA 2ET6A 3H9EO 2IODA 1H93A 3ZI0A 1ZEMA 1SO8A 3WGZA 2CUKA 2G1UA 4UUPA 3GRPA 1ZUD1 2QRJA 3I4CA 2Q45A 3KSUA 2DM6A 4F6CA 1DAPA 5K0ZA 2HAEA 2VZ9A 3AUSA 1Q0QA 3JD1A 1LLQA 1DAOA 1LDMA 4WCFA 4L4RA 2AMFA 3TZCA 4E2XA 1DIRA 1MFZA 3ADPA 4JGBA 1E6WA 4D42A 2C2XA 4N5MA 3VH1A 4LSMA 1QYCA 4NFHA 2ZYDA 4YDRA 4HP8A 4XRRA 3TFOA 3F6YA 3DQPA 4KZPA 1E3JA 4FFNA 1YRLA 2VYVD 2UVDA 1NWHA 4I5GA 4Q39A 2OBNA 5KKCA 1MB4A 5LDHA 1NXQA 5T67A 2YFQA 4FS3A 4BB5A 4E21A 5T64A 3LT4A 1LI4A 1H9AA 1HF3A 4RF2A 1FDUA 3FRJA 5KJ1A 3CMCO 3ZU4A 4K6FA 4HBGA 3JSAA 3VH3A 4Q3AA 2JHFA 5JMPA 3W4KA 5IZCC 3GY0A 4DVJA 3ABIA 4IUYA 4JP2A 1ZH8A 3DB2A 1Q0LA 2YV3A 2JHGA 2V6GA 1P1HA 1VSVA 3GGPA 4P4LA 1JA9A 1P9LA 3U5TA 2AW5A 1TT7A 1YH3A 2AA3A 2B4QA 2WYUA 4TVBA 2NVUB 3B1FA 1E7SA 2JJYA 3KSZO 3GAFA 3GR6A 1XYGA 2X5KO 1F17A 1CJCA 4FW8A 4Y9DA 1Y6JA 4IJWA 4CM7A 3GPDG 5CEJA 1G6KA 2Y1DA 4FQ8A 4Z9XA 5BNFA 4JJIA 3RAJA 4PG4A 1FDVA 4YJFB 3TOXA 2ZTLA 3EK2A 4ONEA 1U9JA 2O3QA 5FYDA 2JL1A 3S2FA 4NJMB 2PGLA 3PEFA 3GN2A 3ANNA 4D79A 2YJZA 3PHHA 1HXHA 4JCOA 2ZIZA 1YDWA 3AI2A 3F47A 2FMUA 2E6UX 3QE3A 5AYVA 5EMHA 1CDOA 2X9GA 1PJ2A 1T2DA 1XSEA 1N8KA 1HLPA 4OAQA 2D2IA 4MVJP 4UEOA 2FY8A 4BMSA 1GQ2A 3RU7A 4LCJA 1XWFA 4B7XA 3PGXA 3SLGA 1XIVA 2D8AA 4GX5A 3VKUA 3UOGA 1GADO 3DZGA 5DN9A 3WXBA 4CMIA 3WGYA 3FNGA 4YTEA 1BHSA 1HT0A 1RJWA 5BNTA 2Y93A 2C59A 1PJTA 2XPCA 1U4OA 3RKRA 4NBTA 4URFA 3OQ1A 5BSFA 4I5FA 4IXWA 5TQVA 4P22A 2GF2A 3WSVA 3H2ZA 3IP1A 3K5PA 2X0NA 1SOVA 2PNFA 3GLQA 2C0CA 1T25A 3V1YA 4N18A 3RC1A 3WR5A 1NYTA 1ZMTA 4WCFB 4W9NA 4D7AA 1B2LA 4FD3A 3OQBA 2JD0A 3UCFA 4XJTA 4L75A 1EK5A 1K5HA 2NLOA 4FSHA 4PRKA 3RVDA 2EP7A 5G0SA 3RFVA 1ZCJA 3O38A 4ZRNA 2BH9A 4G65A 3RFTA 1ZO8A 4MJLA 4JQCA 3QVXA 3SLKA 1O94A 2IZ0A 5GZ1A 2OFPA 4B3IA 4K9DA 2BI8A 2IZ1A 1Z74A 2ZJ0A 2O7SA 5KJCA 4Q3NA 5A04A 5J9GA 2A92A 3OHSX 1U2DA 4BKRA 5H83A 1E3IA 2PZLA 1ORRA 2DFDA 4LCEA 4NPCA 4DLBA 5K6AA 3F1KA 4J4BA 4GSLA 5IF3A 2J5RA 1GQQA 1UAYA 4EYEA 5DT9A 1NWCA 2V7PA 4MP3A 4DMLA 4AJJA 5IZ4A 3V8BA 4GWKA 2GLXA 4DBVO 1A71A 1VLLA 1Y5MA 3CMMA 4ALMA 1NQAO 3U4DA 3KM0A 1XG5A 3F4LA 2NSDA 1W0CA 4PLYA 3W8FA 1O6ZA 3AK4A 5FFFA 3V2HA 1B3BA 1HLDA 4IBOA 4LN1A 1KIFA 4IGFA 5JNLA 3K2EA 2GZ1A 3I9KA 5CDSA 3H4VA 4MVJD 2HK9A 3ONEA 4CV3A 4GBJA 2JD1A 4II3A 3LC1O 4ZICA 4TKMA 3N58A 3ZWWA 1A9YA 4FPXA 1GQYA 1HYHA 2J6IA 4PRLA 4WEOA 3ICPA 3ZU2A 4WLEA 1TVEA 1DJNA 5I8WA 5CEEA 4LVCA 3U9LA 1BGVA 3FHLA 4KTTE 1YL6A 2OP0A 4J0FA 3PQDA 3Q0EA 2CD9A 1M66A 1NVTA 4CMIB 2WWRA 4IS2A 4FJ2A 1GZ3A 1KVSA 1H2BA 3TZQA 5FEUA 3PWSA 2O3SA 2JAHA 1DLJA 4B8ZA 2PKQO 1ENYA 4JJGA 5DCUA 1MX3A 1GD1O 4R68A 2YDYA 3ADOA 4FFOA 4HV4A 2A4KA 3WG9A 3HSKA 2NU9A 3WDSA 4J7XA 3DOOA 1VL8A 2J3IA 4S3MA 7MDHA 2X5OA 1N5DA 1F06A 4QT0A 2GUGA 2XAAA 1UJMA 1E6EA 5IFLA 4O6VA 1LTHR 2PY6A 1E1LA 4M89A 3H3FA 4QUKA 4WLFA 1BG6A 1HDOA 1HDCA 2NTVA 4D0SA 2X7HA 5KJEA 4DL9A 2EIHA 3K8ZA 4ND4A 2YFHA 1NR7A 1X1TA 4PLWA 4AJIA 4PVDA 1V3UA 4PZCA 3I9NA 5A02A 1EUCA 3ZZNA 4RCVA 3NJ4A 3IOYA 3KBOA 5JDCA 3RIHA 4BMVA 4L0QA 3ZV3A 1RM0A 2EF1A 5DCWA 3WTCA 1YBMA 4E2ZA 5L45A 1LEHA 1E1NA 2ZK7A 2Q1SA 3M1LA 4IIUA 4IQGA 1PGJA 2QRKA 4HY3A 3IIEA 2QG4A 1YKFA 3OJLA 3QVSA 4AVYA 1PSDA 2W8ZA 2GPTA 5U4QA 1RM4A 1WMBA 2R00A 1IB6A 2VYNA 3GT0A 1TB4A 2GD1O 2AHRA 1UP4A 4J90A 3DZJA 3WQSB 2Q50A 1HTBA 3OEWA 1P1IA 4CMEC 3RFXA 4Y8VA 1U3TA 1OZAA 2BGKA 3RCBA 1P45A 1R12A 5G2OA 3WJ7A 3RASA 4W4TA 1Q0HA 2EKLA 5JYDA 3DBLA 4PLFA 3N7UA 3WGIA 4JIGA 3PFWO 4E5NA 4C7KA 1EFKA 4BO5A 2A9FA 4BOYA 3HWRA 4IMPA 5COBA 1B0AA 3JQFA 4RO0A 2FRDA 5F5LA 3VPXA 4CLHA 1R37A 3K30A 4HXYA 3DONA 1CRWG 5KVSA 3UFXA 1R15A 1ZK0A 3BHJA 3EZLA 4NR0A 2V6MA 1PJ4A 1HWYA 5AXAA 1ONOA 2CF6A 5CEFA 3QVWA 1T2AA 3F46A 2D0IA 2W2LA 2FWMX 1HDXA 1GEGA 2PTGA 4F3YA 1DC5A 3PIIA 1CEQA 3GVPA 2J5KA 1GAEO 1M6WA 1YB4A 3A28A 4J16A 3NT4A 2DKNA 3R6DA 1Y8RB 4WGGA 2H63A 4EBFA 3R3SA 1C0KA 2YQ5A 2X0JA 4E5KA 1Z45A 1ZSNA 4A73A 2G5CA 4L74A 4M49A 2FPIA 4UAGA 5IDYA 4FR5A 3UXYA 1TI7A 2VT2A 3F5QA 5G0UA 4DQXA 4HNHA 2B4TO 2WYWA 1VI2A 3HQ4O 3AOGA 4RLSA 4DLLA 2HJSA 3JYPA 2PKRA 3MTGA 1LDNA 3GN1A 4A10A 2W2KA 3NEPX 1ZK1A 3KLMX 3BHMA 1U1IA 3BTOA 3PYXA 2RCYA 2V6FA 3E9MA 4DPKA 2E4AA 2CVZA 2Y1CA 2HQ1A 1F14A 1YWGO 3FR7A 5DULA 4IZIA 1XQ1A 3RBZA 4JLWA 4XYGA 3LQFA 1PS8A 8ADHA 4XCVA 3D5QA 1IY8A 2DUUA 1IZ0A 3I52A 5HS4A 4EUEA 4WUVA 1NAIA 4B8WA 3DR3A 2J3KA 3RUHA 3GMSA 5U1PA 4CLXA 5I7VA 4HFMA 2VYVA 4KOAA 1AN9A 3ROKA 1DIBA 3TWOA 1Y7TA 3MZ0A 2G17A 3WS7A 3LLVA 3ZHBA 4YVFA 3I9LA 3TDKA 3AFMA 1EBFA 1TLTA 4R5HA 3S2IA 2IXAA 3NTQA 2BFMA 4HFNA 4WNIA 1UXIA 3DZIA 4IDFA 3U4CA 4BNGA 4YT5A 1FMCA 2J3HA 2VNSA 2DQ4A 3UW3A 2AE1A 3U4HA 2B5WA 4OJNA 4GGOA 2PA3A 4A27A 4DIFA 4DA9A 3GH3A 4PLHA 1JDJA 4TZKA 1D3AA 1E5LA 1Z6ZA 3PI7A 3R3JA 4P4GA 4C7JA 4CV0A 4PG7A 4AJ2A 2Y0DA 4BNZA 2ZQZA 5HS6A 4NNJA 3GNSA 3K9QO 3NT5A 1U3VA 2Q2VA 3LU1A 1XEAA 2Q2QA 3DL2A 5JYAA 1O5IA 4J91A 1YE3A 5TNXA 2DBRA 3I9OA 5T8KC 3TZKA 3ZV5A 2DTEA 4CMBA 4NJOA 3GHYA 3I23A 3JQAD 4B7UA 5IXYA 3C85A 1NASA 4XR4A 3LSYA 3IQDB 4UVDA 3VPHA 1QLHA 5F5NA 4DREA 1LRJA 2CVOA 1V9LA 2Z1NA 1DC3A 1P33A 4PLPA 4E5YA 2ZYGA 3RQSA 4XZ3A 3RSHA 1HDZA 4XX0A 4Y67A 2BGLA 3FNHA 3TSCA 2D3TA 2OXIA 3HFGA 4INAA 4KP7A 4ZVVA 3JYQA 1MLDA 3MOGA 1R4MA 5A1TA 1I36A 1AHHA 1PGPA 3JQ7B 4GVXA 2TMDA 2E37A 3OQ6A 3DBHB 3PWZA 4A5OA 4DIBA 5L9AA 1SPXA 2VOJA 5KVVA 1R16A 2JAPA 3HUDA 3EC7A 3QY9A 3NDIA 3TN7A 5IXSA 4J1SA 3IC5A 4YR9A 1C3VA 3S2EA 1NHWA 3WIEA 3CZRA 3VVCA 5CDTA 4ID9A 3C7AA 1Q7BA 3F4BA 2QZZA 4D3DA 3I3OA 4OSPA 3RKUA 3NAQA 3E18A 1QV6A 4GVLA 4M87A 5TIIA 1W8DA 3DFUA 1ONPA 1WVGA 4WOJA 2GR9A 3H2SA 3JQ8A 3L6OO 1PJQA 2YY7A 3PDUA 4G5HA 4OXNA 1R6DA 4MO2A 4MVJI 5THQA 1P1RA 5JCJD 1QR6A 3BTVA 4EGFA 2HUNA 3UAGA 4B7CA 1XGKA 4UEKA 1BXGA 4EJ6A 1E3WA 4H15A 5JMWA 2VRCA 3L9XA 3RUIA 1AUPA 3L6DA 1ADGA 4QX6A 3M2PA 1MXFA 4FGSA 1KEUA 1GR0A 4MVJM 2QYSA 3PHIA 4TWRA 4EDFA 3H9QA 2UAGA 1IOLA 3DZKA 3BMNA 1CETA 2DUWA 1JVBA 3I6IA 2HMTA 4LW8A 2GZ2A 1LJ8A 2Y0CA 2ZTVA 1WZEA 1M67A 3A1NA 5AXCA 2X9NA 3DZBA 1EDOA 4Q3CA 3MTJA 1GV1A 3C7CB 3JQ9C 1ZVMA 3GDGA 2JFGA 4BIIA 4PVCA 3H9GA 2OZPA 3DC2A 5COAA 1LBEA 4D45A 4Y6SA 5I8ZA 3CINA 5C3MA 5IZCA 3FF4A 1N7HA 4PCVA 3KO8A 3IAHA 1P1FA 3EVTA 4MVJA 3W8EA 3QIVA 3G0OA 3GC6A 4Q9NA 2YUTA 2AG8A 1QORA 1E3EA 4I9UA 3UHAA 1KVQA 1XA0A 1C0IA 4D46A 2Y68A 4IDAA 3AM3A 1VE9A 3PYMA 4EZBA 3VC7A 4OM8A 4CMJA 1F0YA 1HSZA 1UXKA 3MJEA 3JYNA 4XD2A 4BHTA 5BNIA 3OJ0A 5TRTA 1ISIA 3BYZA 3TPCA 3WSWA 1OI7A 6ADHA 4XA8A 1R4MB 4A0SA 1XLTA 2CF5A 2A94A 3G1TA 1I5RA 3ITKA 4U7WA 1WZIA 3PYLA 1X1EA 1XR3A 3JCZA 5F21A 4E33A 5MDHA 4CM4A 4ALNA 1HRDA 5COQA 5DBIA 3AI3A 1VJ1A 1GEEA 1PWZA 1Q7CA 2Q46A 1SNYA 1HYEA 5B12A 5TJHA 1MC5A 4UREA 3SC4A 2O3TA 2VWGA 3MWEB 1ID1A 1YBAA 1EE2A 4PN3A 1PJSA 2RH8A 2Y0EA 1NPTO 2AQKA 3EGOA 4YJFA 1M2WA 5HBRA 5JDIA 1OAAA 1GU7A 2VTDA 4NJMA 2BMAA 3JQ8B 5EPOA 1EQ2A 4BNMA 2VZ0A 4II2A 1Q7GA 3W6ZA 4CL8A 4G81A 2B36A 5I9MA 5AOVA 1HZZA 4RPJA 3ZU3A 1RPNA 4ALIA 1KVTA 3OIFA 1E3WB 4R5MA 1UZLA 2P4QA 3D5TA 4JP3A 4ZQHA 4PG8A 4XQEA 4BO9A 1X0VA 2CFCA 2AEMA 2ZB4A 2ZCUA 2QW8A 2OGUA 4B3JA 2DC1A 4RDHA 4GX0A 1T2FA 1LDEA 5KTKA 5EL0A 4D3SA 5EESA 2DFVA 1A9ZA 2DPHA 2DVMA 4RGBA 5C37A 5KCZA 3ZHZA 1VC2A 1IZ9A 3H8VA 1E0DA 3S8MA 2DTXA 4PLTA 1CYDA 2VCYA 4HUJA 2FSVA 4ND5A 1I32A 3NTOA 2GZ3A 1NPYA 3DFZA 3KETA 2B69A 4BNVA 2B4RO 3LYLA 5LCXA 1QYVA 2EW2A 3V2GA 3AY7A 4R51A 4RVGA 1DRWA 4GKBA 2X0RA 3DBVO 1CERA 1YB5A 9LDTA 2NM0A 1S7CA 4I9NA 2CDAA 4U6SA 1UDBA 5HTOA 2QZ9A 1FXSA 2X22A 4CUZA 4IS3A 4WOKA 1WAMA 3QP9A 2JFHA 5F3RA 1MG5A 3KXDA 3MOIA 2GN8A 1HE2A 4FBGA 3L4BC 5JFOA 4NU5A 3DOCA 4GQAA 4R9SA 1EVJA 4WJZA 3U49A 4K26A 5G0VA 5CG2A 1KYQA 1LSSA 1V3TA 1EK6A 2WTBA 1IPEA 4WASA 1LU9A 1TT5B 4CPDA 1PL7A 1YS4A 1I33A 4CM4B 1K3TA 4EJMA 3T7CA 2XXJA 3MJSA 1IULA 4CV2A 2C07A 5IG2A 2AQIA 2O23A 3VDRA 2I9PA 4XB1A 2HDHA 2WD7A 3AUUA 2X9VA 2PZMA 1I0ZA 4RVDA 4YRDA 1VJ0A 3ASUA 3LK7A 3VH2A 3AOEC 1WPQA 4L8VA 1YQDA 4GLLA 5HA5A 2VOEA 4O5OA 3KSDO 3TZ6A 1GYRA 3Q9UA 4YBZA 3TF5A 2UV8A 4H16A 5KJFA 4KWIA 4WK6A 3TFQA 2ZB7A 4Z9FA 1PTJA 2HMVA 1KEWA 4DGSA 2RAFA 1ZZEA 3MWDB 4XYEA 4RV9A 4J9UE 1PWXA 1I8TA 3QW2A 3WLEA 1UXGA 4GGPA 4RVHA 1K2WA 1R0SA 3OA2A 1VKOA 1KY5A 3MJTA 3DZHA 2AG5A 2GN4A 2I99A 4BNIA 2D4AA 2X86A 3JV7A 2O3RA 4KUEA 1DO8A 4BO1A 3PJDA 2Y1FA 2RIRA 1F8GA 4NBVA 3T4EA 3UN1A 1T2EA 1BXKA 4J7UA 1PZGA 4BGEA 4YJDA 4Q3EA 3OA0A 5CG1A 4FC6A 5JC1A 2Q1UA 1QP8A 4OGWA 3JQCA 4P4NA 4M86A 3VTFA 4D43A 1MA0A 1QRRA 3BZUA 1PQUA 1YL5A 4ESOA 2VUTA 4FB5A 1WNTA 3D4PA 3NGXA 4DC1A 5HWSA 1L1FA 4J1QA 5DBGA 3ST7A 4WECA 1K6IA 1ENPA 3BHIA 5J23A 2P5YA 2QYTA 3JQBC 4N7RA 1AGNA 1DHRA 1J49A 4CMEA 1KY4A 2UDPA 2VQ3A 4YAIA 1ADFA 5A3VA 1DHTA 3IP3A 3H9UA 1LXCA 1LNQA 1P3DA 1YONA 4UUNA 1NQOA 3GF4A 3SEFA 2BRUA 5IN5A 1LSJA 1U8XX 4YT2A 4E0BA 1BDBA 1Z73A 5C7LO 3VPSA 2W4QA 4U5QA 4BNNA 4Y98A 4UUOA 1MGOA 3ZWCA 3WNVA 3CPSA 2UYYA 4BNTA 3UF0A 3Q9NA 4B4OA 1LLUA 1BVRA 3F3SA 1C1DB 1BMDA 4E31A 2FSSA 1O0SA 3GZ4A 5H82A 3U4IA 4MVJF 4A2CA 1TEHA 4BKUA 2WD7B 4MDHA 3TL2A 2QHXA 4CR6A 1EDZA 3O26A 3GVIA 1DC4A 4I5DA 4EUFA 2VHYA 1ZXLA 3P19A 5CDUA 2Q1WA 3DTTA 1ZIDA 2GO1A 4R1SA 4K1LA 3DHEA 2YHUA 4YACA 4KMSA 1J4AA 4AJNA 4KTVE 4XYBA 4CM9D 5KWEA 3RU9A 4UVIA 3JQ6A 1H0KA 1MV8A 5EJ2A 1NR1A 2XOXA 5BSGA 4XEHA 3B6ZA 3K2BA 1GPDG 2DT5A 5HM8A 4NHEA 1J6UA 2VZ8A 5EERA 4W7HA 4OQZA 3C1OA 1Y9AA 3TZHA 5FWNA 5ICMA 1J0XO 3JQEA 3VZRA 1T2CA 2V65A 3NUGA 4E3ZA 4OKIA 4LRSB 2Q2WA 1H9BA 5A05A 1XKQA 1RM5A 1NTOA 3AUTA 4ZD6A 4Z3DA 1PQPA 1Z7BA 2Y67A 1VJTA 4CLOB 1Y8RA 1B8UA 3KEQA 3HN7A 2BD0A 1NNUA 4YB8A 3FPCA 1DXYA 3HDQA 2VNAA 4JBGA 4M54A 4GSKA 3RUCA 3GGGA 1DC6A 2PZKA 3ENKA 1PEDA 4LRTB 1HZJA 3E5RA 3HB5X 1A5ZA 4PG6A 2HCTA 4GAEA 3DHNA 4FOOA 1K89A 2C5AA 2VWQA 1DFHA 3R0IA 3LT0A 1XQ6A 2EGGA 1SAYA 2EKQA 3JQAB 3TL3A 2PR2A 1OC2A 4TQGA 1PZFA 1CIVA 2Z95A 1W6UA 3WB9A 2EHDA 4J2OA 5KOIA 5AXDA 1IL0A 1QLJA 2B35A 3GOHA 1IUKA 4P38A 3WNQA 3CXRA 2NQTA 3ULKA 4CLEA 1EE9A 5T8KA 1V35A 4IQ0A 3NDJA 2W90A 1G1AA 1U4SA 1YOVA 3VVBA 1R4NB 1XCBA 2G76A 4BO8A 3GHHA 3IKTA 3PGJA 2Z5LA 3G1UA 5T57A 5MGBA 1UP7A 2FR1A 2ZB8A 4BNKA 1I2CA 2GDZA 2O4UX 2O7QA 3W6UA 2HRZA 2D1YA 3E6AA 5B4VA 4UULA 5L51A 2GRAA 3KVOA 4OYRA 1UH5A 1O95A 2HMWA 1ZSVA 3ANMA 5BQFA 2CSUA 5F1PA 4X54A 4Z0PA 4JN6B 1U7TA 1YQXA 2H9IA 4BNHA 4W9NC 4B3HA 1K0UA 3BIOA 3ONDA 4XIJA 4IIVA 4AJKA 2GNAA 4XQCA 3CUKA 5TX7A 3OEYA 2P9GA 2VHZA 2ZKLA 9LDBA 2VT3A 2CDBA 3VZPA 2GASA 4ZHSA 1P74A 3WYCA 1XELA 2FN7A 4KUHA 4U0KA 3HDHA 4BB6A 1N92A 3L4SO 2Q4EA 3H5NA 3PVZA 3NT2A 4BNXA 4TSKA 3LT2A 4YRAA 1YL7A 2YHIB 1S6YA 1E7MA 4XYLA 3VOSA 3DOJA 2VUUA 3IDSA 1GCOA 2VWHA 4LMRA 1EEHA 1A4UA 1EZ4A 4WPGA 4NBWA 3KYCA 1PJCA 3DXFA 3SJUA 2CY0A 1I3NA 1LUAA 1PS0A 3O4RA 3RUEA 5GZ6A 5U9CA 5B37A 1JWBB 4W82A 4B4VA 3WGHA 5DOZA 1KVUA 3FBTA 2R2GA 1K6JA 2B83A 2P68A 4U6QA 3JQ7A 3ROQA 1JVSA 4W7IA 4R1TA 4W6ZA 5K9ZA 3DBHA 4HKTA 2WM3A 3SJ7A 5TSDA 3I9JA 4FFPA 4IDDA 1BWSA 2HMUA 2Z1MA 3WFIA 2G0TA 3JD3A 3QWIA 2Q1TA 1Y8QA 4NI5A 3ICCA 3B70A 3ZWYA 3QA9A 5IJZA 1ZK3A 2WE7A 2JCXA 2H6EA 4L4SA 1I2ZA 3CTMA 1LQTA 3VH4A 3JYOA 5C5IA 4TRMA 3DMTC 2EJVA 4L73A 4OXKA 2Q22A 1B8PA 1ZFNA 2BFOA 3D64A 3I1JA 4RQUA 3WQRA 1QV7A 4CUJA 3SBOA 3JQDA 3DMYA 3JQ9A 1JLLA 4J7CA 3GFBA 4U8GA 3GZNB 3GUYA 5CDGA 4OXYA 1X14A 1LLDA 4IJUA 4XGKA 4O59O 4ZGWA 1O89A 3GEDA 4RORA 4BNFA 1YOVB 3E9NA 3ZNNA 3NTRA 4J9VA 4OL9A 1FDSA 2GGSA 1HE5A 2CDCA 5TC4A 1ZJYA 2IYOA 1DIAA 1A27A 3BMOA 5FF9A 4IMRA 3GVCA 4TKLA 1VPDA 3T4XA 5ICSA 2OP1A 4FFMA 1PQWA 3ZWMA 1X7HA 2FR8A 3ITDA 3D4NA 2O2YA 4CM5A 2X5JO 4NDNE 1X15A 1U3WA 1YVEI 4ZQGA 4AJLA 1ZKMA 5ILGA 3HNPA 3M2TA 3HN2A 5CAEA 4E12A 3SVTA 3WGQA 1ARZA 3VZSA 2DBZA 4RL6A 3AFNA 1ULUA 2NVBA 5CP8A 3K96A 2XF8A 2IEDA 2JFFA 3E03A 3KB6A 4RVFA 3WQQA 1A72A 2PFGA 5L4SA 4NMHA 5GY7A 1ZSYA 4JNKA 3WMXA 3RBXA 3LC7O 1YJ8A 4BNYA 2BGMA 4CQLA 3RUAA 2D59A 4J1TA 4I08A 4BKPA 1QKIA 4DPLA 4L76A 4D41A 1GPJA 3RI3A 2JKVA 3KYCB 1D4FA 3GG9A 5F1KA 4GMGA 2J5QA 8LDHA 4I5EA 2EERA 3HDJA 7ADHA 4NH4A 4CV1A 1KS9A 3KV3O 1M76A 4NG5A 5KIAA 2P4HX 3GNTA 4HFJA 5G4KB 3NGLA 4Z0HO 4Z9YA 1SB9A 4CLDA 3PZRA 3B20A 1I24A 4NK4A 1UZMA 1JU9A 1I3KA 5HRUA 1Y8QB 3KLPX 3UCXA 1UR5A 4I1IA 3OETA 3AU9A 3STHA 3IS3A 3LT1A 1HE4A 3QRWA 3S55A 1RYDA 3QQPA 3FBGA 4NU6A 2AEJA 3M1AA 3X2FA 2ZATA 1RYEA 1NP3A 3ASVA 4J6FA 4MIEA 5L4LA 3ZHXA 1DB3A 1P0CA 1IYZA 4M55A 3TJRA 2OUIA 4H3VA 3VHRA 2IZZA 3AW9A 4BO3A 4CQMD 3RBVA 5JY6A 2DBVO 1G0NA 2AQ8A 4XQ9A 4KUGA 5I7EA 1LLCA 5A06A 2I3AA 2GN6A 3HE3A 4GI2A 1F12A 3G79A 3KYBA 1KVRA 1RWBA 4NK5A 5FI3A 4XB2A 1NVMB 1G0OA 1KERA 5KVCA 1EQUA 3IL2A 3P2OA 1KEVA 3BMOB 4H7PA 4IXTA 1L7DA 3L4BA 4R1NA 2FR0A 2W98A 1ML3A 2X58A 3WOHA 1ENOA 1O8CA 5BSEA 2D5CA 2EWMA 3FWZA 1WMAA 3D0OA 2GYYA 4ND1A 1C1XB 3NDRA 3D1LA 3BAZA 4BNJA 4AJHA 3PK0A 1GYPA 1Q1NA 3OIGA 1Y9EA 3LF2A 3QWBA 1PS9A 3ORFA 4Y6RA 3KYDA 3KHUA 4XWYA 3NYWA 2CZCA 3VTZA 2RHCA 4L4XA 3CKYA 1PJBA 3F9IA 1L7EA 4ITUA 1SB8A 1LDGA 4CQLB 2X6TA 5B1YA 2DBQA 3QV1A 3ON5A 4LISA 3E9QA 4OH1A 3AOEA 3V1UA 4OO3A 3QJ5A 5DBFA 5JE8A 1HE3A 3I9MA 3QLJA 1PR9A 1OOEA 4PLVA 3OP4A 5I7SA 2C20A 4W99A 5H81A 5LDGA 1EVYA 3QHAA 3K92A 4YJGA 1WLYA 3P2YA 3O8QB 3W1VA 2YZ7A 3PHJA 3OFSA 1LDYA 1TT5A 1BRMA 4O63O 4OOFA 2WJPA 2GSDA 3H5AA 4DBZA 4UVGA 3U09A 4LK3A 2EG9A 3GPIA 4KWHA 1GZ4A 2BHLA 4TVOA 1EUDA 2Y05A 3RROA 3S2GA 3EYWA 3FWNA 4DC0A 2WD8A 3EY4A 4EJ0A 3DBRA 4FGWA 3E8XA 4DPMA 3UICA 4R4JA 3ZNQA 4AJ4A 1H6BA 1H2HA 1V0JA 1PGOA 1X0XA 2V6BA 3GAZA 4I9HA 3WYEA 2X23A 4N54A 1KETA 4CODB 1HEUA 2EEZA 4O1MA 4QECA 4IDGA 3FPLA 3WGTA 4LSWA 4BMNA 1B16A 1YJQA 4AICA 5KKAA 3JQBA 3WTBA 1YXMA 3I4FA 1JKFA 4YA6A 1UXJA 2YDXA 4BO6A 1C0PA 4FFLA 4JK3A 5JBIA 3OSUA 1DPGA 1WWKA 1T1SA 5JYFA
chains in the Genus database with same CATH superfamily
4HNVA 1PL8A 1GPWB 1XZPA 3K0EA 3PQEA 3H5IA 4HEQA 2F43B 3SX2A 1R0KA 4EHDA 3ZGXA 1GGMA 3NTXA 4JU9A 4UE6A 3VAYA 1PVVA 2NADA 5EPEA 3SWWA 4OMFG 4DR4B 4AU1A 2AEFA 4C30A 2WHRA 4NRDA 2VHXA 5MN4A 1DRVA 1UPFA 4YJHB 1N9GA 4D0RA 2AX4A 4EYKA 1WDMA 4DARA 1C7EA 3SC2A 3EP7B 1YZQA 4QJ3A 3ETNA 2O1SA 1A8HA 2IIVA 2XE4A 3BHNA 2GHQA 4PNZA 1E9DA 2ZTMA 4MWOA 1QO0A 3C39A 3IVXA 1QHXA 2CC2A 5JJLA 1Y33E 4RENA 1NW7A 3CNLA 2P9EA 4Q00A 4R2KA 1Z75A 1M1YE 3AR3A 4GL4A 4I1UA 4AP6A 5C7IO 3A4VA 4B6JA 1W29A 4QATA 5IN4A 2LTAA 3LFHA 3EQ2A 3NKLA 4R0NA 1Q74A 4MCJA 1IN7A 1MNQA 3C8HA 1M2NA 1E5QA 5CVVA 3G0GA 3L0SA 1O54A 2G9ZA 4QL3A 3K6RA 4DLTA 5DW0A 2H2WA 2BF7A 1SULA 1QWOA 1XCLA 2FEWB 2QT0A 1JAZA 1H65A 2ZUDA 3EGDA 3IVAA 3KD2A 2OZLA 3L18A 1C3XA 4FYIA 4YJGB 4IGEA 4W5RA 3NEYA 2V7GA 4ND3A 1SQFA 4QSMA 1L7MA 2DT8A 2O1EA 3BH0A 3FCUB 4N7JA 3URKA 4C0JA 2NOAA 3KYJB 4BMPB 1UIRA 3T3PB 2ZVJA 1HT2E 5F2KA 5F4BA 2GF0A 3CSSA 3GCGA 4YRCA 4CG2A 2GAOA 5CBPB 9ATCA 4P0PB 3RJZA 1WW3A 4LJLA 3U16A 3MJHA 4KGVA 2YIMA 5IT5A 1UDCA 1II8A 1ML4A 1N1MA 2W0MA 3W8DA 4BVAA 4KQFA 4WE3A 1FUEA 4P08A 4D57A 3EQ9A 3PHLA 1MAVA 4XIFA 4BJ5A 2QT1A 4TKUB 3PB3A 4WLUA 4EECA 1ISJA 4TSFA 1U0SY 3DBRB 2VKTA 1P4HA 1G42A 5AVOA 4IIBA 4BGIA 4BWGA 2NUAB 3CT4A 3PEEA 2O5CA 3L6CA 3DE7X 1QH8B 3T7EA 3VR5A 2Y0BA 1ONSA 3EOAI 2EOAA 2XQIA 4C88A 1UXHA 3PI6A 1Z8DA 2EGHA 3TXXA 4YP1A 2QVBA 4Q05A 2OO5A 2OZVA 4KHPB 4MKFA 3L8HA 5FIUA 2RGDA 3BRWA 3EZ9A 1AQLA 4TL6A 2V7VA 4GKAA 4U2EA 3AI7A 2PZEA 3Q2KA 1FNNA 1WUKS 4M6WB 4ZT2A 4BQSA 1Y6GA 1M7BA 2NV6A 1IBLB 4INOA 1GDDA 4CM1A 5HQ3A 4S05A 5DK4A 3KUKA 2UUPA 1TDJA 2V7TA 4M8NE 1SG6A 4ZYTA 5CA0F 2J3LA 4X7MA 1U28A 2IYVA 3IB6A 5DCYA 3AM4A 5CPFA 1NQUA 2RK3A 3M5CA 3UJ8A 2YJ4A 4UCFA 3H05A 2BDEA 4LZNA 2BYTA 3B8HA 2BLLA 2VAWA 4OGLA 5EZYA 5CDYA 3P2IA 1DP4A 5HMMA 1T4DA 4A9AA 1DGQA 2Y71A 3PKIA 3LNCA 3MTDA 1UZNA 2JCYA 2QD5A 2Z8ZA 4FLEA 1ZMRA 4UXJA 4EO4A 4PQFA 1U3DA 5EFZA 5DASA 3LFUA 3MYRA 3G5TA 1R6XA 1U5CA 1NUSA 1FFWA 3TTSA 4DT1B 2KMLA 3QMVA 1XXHE 1M34A 4JT8A 4LNHA 1I1QB 3BX1A 3EH1A 1JXMA 2WWHA 4OJQA 4IDEA 3AETB 1OIXA 2GUWA 2H2AA 1U8CB 5TGDA 1NVUQ 1Z2OX 1VRWA 1W4ZA 4AFNA 4AJPA 2C82A 2P62A 2C5GA 4KQ1A 4QAJA 2MT9A 3O1IC 4A36A 1D1TA 2XBLA 1W1IA 2O9JA 4F91B 4TKVA 1SEVA 2PUEA 1AXEA 4F3TA 2B8WA 3KKOA 2V5UA 1XNJA 4HN2A 3ODGA 4MV3A 3Q15C 2R7KA 3H3XA 4DEXA 4LGVA 4ZREA 4HGZA 4RGYA 3AUYA 4UHKA 1VHLA 5IAOA 1JKJA 2DH6A 2XUGA 5HCNA 3FYUC 4EF4A 1CUUA 1Q50A 1T35A 2ZQYA 3C45A 4MKHA 4EGSA 3L0IB 2C7BA 4BVJA 3DD5A 5DW3A 3VR6H 3Q7SA 2GARA 3E27A 3RM3A 1K9SA 2Q5FA 1SEPA 1JG4A 3RS3A 1G19A 4DILA 5IAAA 4AX4A 2FOIA 4RD4A 1WEHA 3K0CA 3VKGA 1K08A 2DGDA 1T26A 4F2HA 4RPLA 1NA5A 3OM9A 3RJ9A 1Y1KE 1X2EA 1HLGA 4HS9A 2NGRA 4MV1A 2UYGA 2OORC 3ZX4A 4AZSA 1M5RA 3COZA 3V8RA 1JHQA 2UVPB 2CMFA 4BVKA 3GOQA 3N0XA 4RU1A 5F9HA 1UUFA 1GOTA 3IEPA 3PNQA 4RGVA 4GNKA 4BC1A 1KSHA 2ZRHA 2G07A 1T1GA 4HB2A 4OHKA 4YFYA 2P5UA 1M1YA 2F1RA 1GG8A 3F9CA 3WAGA 4ZGGA 3E5HA 1NI4B 2A1TS 4M7WA 2JK0A 2NQ8A 3PNLA 1UDAA 3QBJA 3FD8A 4C4SA 3IP9A 4FT4A 2VRCD 3A6JA 1V6AA 2C2YA 3OO1A 3T5GA 4ARCA 5DGTA 3U7IA 2E48A 5HDBB 3TRFA 4YJ3B 3SZMA 3IESA 2BN4A 3GCWA 3E82A 1DKOA 4QE3A 5BYBA 2DLCX 2NPOA 1Q1BA 1WCV1 5DM1A 5AQ1A 1JB1A 1G16A 4QDTA 4YRIA 2R68A 2YHAA 4R3NA 4CIAA 3V80A 3X44A 4KI0A 5LQNA 1V39A 5EINA 2A86A 4CM3A 4G4IA 5L3ZA 1CUHA 4OJKA 1ENZA 2FPWA 3G17A 2HIAA 2QRUA 3WYAA 4DJAA 4JLBA 8ATCA 1AG9A 2PWZA 2XUIA 2PRIA 5EZSA 4PO3X 3LQRA 5DFAA 3MD0A 1DI0A 4ND2A 4DMRA 4F71A 4B17A 1VG8A 3TQQA 4MINA 2COEA 1P2SA 2GCGA 5BN5B 3TTXA 2C4HA 3V8VA 4ZZ0A 1HLFA 1MRZA 1QNLA 5ALWA 4LHZA 2LWIA 3QVJA 4ZOBA 4CQMA 3GYBA 5JCJA 4R71A 4WLOA 3JAMA 3KUDA 2ZUFA 5B53A 1RRFA 1UWCA 5KNDD 3ABRB 3VZDA 2QX8A 4PG5A 4TZ6A 3FJ1A 1OXXK 3CVJA 1MFPA 3KZVA 4GLOA 3WK5A 1VPLA 5F9MA 3OZAA 3PRHA 3GQVA 1N7GA 1PT7A 1V4NA 1XZIA 4J43A 5HZGA 1SC1A 3D8UA 2D1TA 2ZDHA 4Q9LA 2CFIA 4MLDA 5JR3A 1U0TA 3ZHCA 1R0BA 1T5IA 4R54A 2GWRA 3WMWA 4CDRA 4Z3OA 4DJFC 4XQGA 4MP8A 2H1OA 3V1TC 4W5QA 1QIFA 1TTPB 4DLUA 1AF7A 1PSWA 1ZGJA 1G20A 4QPDA 4YWJA 2F3QA 3CF4A 4OOEA 3O31A 5ALEA 2O2HA 4Q4JB 3WL4A 2L42A 4D56A 4RF4A 2Q5JA 4MYSA 4BBPA 4BTLA 5CK5A 1A5AB 1B2RA 2BR5A 4A6PA 1CE8A 1JWAB 1SUPA 1TTHA 3FPGA 3U0BA 2DULA 2ZJ1A 3QVTA 4HPWA 3VTAA 4D44A 1WXFA 1I5EA 1LJUA 3IKMB 4E2WA 4EVSA 1WHTB 3K5HA 1GLNA 1KSJA 2Y3IA 1TIKA 1F3OA 1XXHA 3RADC 3PFCA 4JXKA 4R7GA 3UH1A 1ZINA 1GL3A 3DYVA 1SZJG 3IA2A 5ALLA 1CUDA 3HKCB 4Z7NB 1E3SA 1GNLA 3UMBA 2HX1A 2WP8J 2BUCA 4Z4CA 3CIFA 1EHCA 5KZMB 3O2QB 5EHZA 1H94A 1O6BA 5I45A 3CF6R 4LMAA 3ESRA 3GZNA 4C20A 1CZKA 1IJEA 1A9QA 1C80A 1K4KA 5JIBA 2XITA 3HFSA 1JEOA 4LMPA 1EGQA 2HM7A 1CIJA 2EFYA 3FY4A 5JAZA 2ZIXB 3UHPA 7ABPA 4J1NA 2Y77A 5D3KA 2Z1DA 3KRTA 1S3GA 3DZFA 1B15A 5B7GA 3UYLA 5HKBA 1ZOOA 4Q1FA 2PV0A 2OCIA 4NYMR 1D9ZA 3NC4A 4EG8A 3WLQA 1XHLA 1XMPA 3SXUB 2UUCB 1BMFD 1TW2A 1ADCA 7MHTA 1UBRS 2PZFA 4IV0A 2PSFA 4A4DA 5I7RA 5EMNA 4M9SA 2DUMA 5EY5B 1SCUA 3P5SA 4R69A 1VHDA 4S1WA 1R8XA 3C3YA 5F51A 4ALJA 3NRCA 3WBFA 3BAFA 3K73O 3W04A 3LYUA 2ZVDA 3FDJA 3M89A 4ZZIA 2A0WA 3HA7A 1EWYA 1AKUA 1HO3A 1I4LD 3QPWA 4AS1A 3PE3A 4L9RA 1B6GA 3VPGA 4DJJA 1WCWA 3E70C 5AVQA 3VYVA 4KWCA 1QXSA 4RTJA 3G1WA 4YUAA 5B3AA 3GEPA 3O75A 1F0KA 1SA0B 4MKZA 1GJRA 1EHYA 4TLDA 2ZJFA 5L3QB 4RKRA 3ZY6A 3MINB 3SSAA 3GT4A 3KUXA 3D2BA 3NU1A 4NX2A 3ZLUA 1MVLA 4ACBA 4BJ3A 1TYBE 2ZWMA 4MPDA 5LQCA 2GEFA 2BRUC 2GJSA 2I4OA 5T5QA 4UD2A 3T0GA 5K3CA 3DHYA 1CF9A 3UATA 3RJMA 1QGYA 3QLEA 4BQRA 3O1LA 3LZ6A 1SHUX 3CRVA 1CUSA 2C2GA 4X93A 2A7QA 5ED0A 4D4JA 3WRXC 1V7ZA 2HA3A 1TF5A 5JHGB 1Z9BA 4Z1MA 1FCJA 2C31A 3PVCA 2NZ2A 4HL6A 2BGNA 1X7YB 1U7HA 3KR9A 4G2NA 4E30A 1GAJA 4WESA 4RS4A 1DBQA 5AK6A 1BCRA 2OTCA 3V33A 3NWEA 3Q98A 4QQRA 4RC9A 4EP1A 4XWOA 4PE5B 8ABPA 4LUCA 3GLKA 1RWXA 2ONZA 2O7RA 1N5JA 1AZTA 3BK7A 1ZNQO 1F6DA 3EF1A 5B4TA 3MHPA 4QNRA 1C2YA 1SIUA 1FJHA 3ZUGA 2XIJA 2ZSEA 2IRWA 1BXRA 4CWAA 5BP7A 2Z8YA 3ZVMA 3NHZA 4M8SA 1WZNA 1CVIA 1JDPA 2WFLA 3BJMA 3H13A 4N5LA 3B1KA 3H7AA 4NQZA 2ZE8A 4BXOB 1YCGA 2GM4A 4HDSA 4BBZA 3VHXB 1Q0TA 1OPXA 2I6QA 3I6BA 3KP1A 1UYJA 3IMEA 4LE0A 2HR1A 1NKTA 2VT7A 4KVZA 4BL5A 4CIYA 2H92A 2Q3CA 1E8DA 3R3VA 1YDEA 4JT2A 4WA7A 4EG4A 4XPZA 1NW6A 3L0BA 5FUWA 3THYB 3QWHA 3RC7A 1ZD5A 4GH5A 1EMDA 2WD9A 4QYSA 1RYBA 3KOUA 4C9BA 4EA7A 5LYJB 2A6PA 3OX4A 3PXUA 3BBLA 5I47A 4GWGA 4X91A 3EDMA 5DGXA 3QXJA 5K45A 3DF7A 4MKRA 1EJBA 1P0FA 5E6RA 1IDOA 2OBYA 3H2GA 1Q11A 3GLHB 1VPVA 3B36A 5E38A 1TM3E 1EB9A 1LNZA 3GD5A 4AQDA 1X7XA 2ZPUA 3KPUA 1RWPA 2CNWA 3ADBA 2PUHA 3WAKA 1IE3A 4JX8A 4E13A 2PUCA 1JDSA 1ECCA 1XVTA 1J99A 4C43A 2AR9A 3RYIA 3FR8A 1TMYA 4S1PA 5KYKA 3TG8A 4EEZA 4IIGA 1EUCB 3AU8A 3D6FA 4JJEA 1DOHA 1G21B 4FBLA 2ZI6A 3IV6A 3TSWA 2XRZA 4GM4A 2R87A 2BFEB 3IQFA 5C81A 1Z0FA 2Y9MB 1IOZA 2DKOA 3TZBA 2HWUA 4R2XA 4RSHA 3RIYA 4R7ZA 4CLRB 5EWJA 3FXAA 1U2GA 1XRMA 1KYZA 3NVDA 2X5NA 1F0PA 2YRFA 1DPFA 3UVEA 3GWZA 4AKSA 3ZGLA 1ZW6A 4QYIA 3S8YA 4OF4A 1UC9A 3OCYA 4L5YA 3URMA 5B64A 1C5KA 3ZD7A 2ZS8A 1QHSA 1U04A 2FP3A 2AI1A 3EIUA 3ZU5A 4ENWA 3MTEA 2EJBA 2VJLA 4NFYA 1C1XA 3GG2A 1M54A 3PQFA 1A3CA 1OC4A 4QU0A 5FBHA 5G4LA 4RTKA 2V9PA 2FP4B 2ICAA 3UHOA 3V4RA 3C3WA 3COWA 3EIEA 1PZHA 1RP7A 2EVWX 3PQ4A 4NOMA 4B48A 3SQOA 3DBLB 4QTZA 5AKIA 4ZEWA 2AK2A 2A9KA 2Y1GA 4NS4A 1M83A 1NX9A 1SIWA 4RVCA 4UAJA 2GHTA 3TL6A 3HXMA 1J09A 3AKCA 4MEAA 3EP9B 3FTNA 4UBIA 4YFVA 5JDCC 5AVRA 5AJVB 4JI0B 4EABA 4C4RA 4EF5A 3FPAA 1EDBA 2PIDA 3DL4A 4RE6A 3R75A 2B25A 1OW3B 1PLLA 2AN3A 2FQYA 2W37A 2C9DA 2YZKA 1RYZA 3UAYA 2NO6A 2QX7A 3IP5A 4D8TA 4RADA 4BFUA 2RSLA 2GERA 1Q2XA 3L77A 4UM7A 5A9RA 1PT6A 2GPJA 3ZI7A 1NFQA 2M1ZA 3LF1A 4JLNA 2I1LA 1RI1A 2XUOA 4HPXB 4LNUB 4RAOA 3SJCA 1I7NA 2O8DB 2PKQP 4MR8A 5CFZA 3ETDA 1QVWA 1ECFA 4N3GA 3PG5A 1VE1A 3VDQA 1SHKA 2OFXA 3EZNA 4UEJA 5BWLA 3IP8A 3T38A 1LW7A 2IJGX 1KYXA 4ZCMA 1ZWKA 3MIZA 3C6XA 4LJ8A 1DEHA 4IJKA 3S6JA 3UJBA 2O2EA 1V8FA 3Q4GA 4JLVA 3B85A 2NAFA 2RHJA 2I7TA 3NG1A 1ODIA 1GSHA 5CW1A 3NEJA 4OHZA 4F3RA 3OT5A 2HRQA 4X0EA 1REQB 2XECA 3DHVA 2IU0A 4LSZA 1NVAA 2FF7A 3PKJA 5GONA 1RXEA 4RF3A 4U7FA 1FF9A 4HWPA 4I2NA 3FNQA 3RAFC 4EWLA 4CF5A 4I46A 3QF4B 2PG3A 2DERA 2YBDA 2WVHA 2DHCA 4M1YA 4HRAA 1L5ZA 5ITZB 3JQFC 4X3PA 2ATEA 4FNAA 4AJ9A 1PK8A 3AVPA 3KJQA 3AW8A 5JYEA 5AQEA 2A9PA 1TOAA 2JIDA 4MIYA 1XZEA 1P9RA 4GPTA 4TLLB 5HKOA 3GUCA 3VR3D 5FPYA 2O54A 3DE1X 3NB0A 4GYKA 2OE2A 1N7IA 2GVZC 2A9VA 2PS0A 2QDKA 2ZJ8A 5LZ4A 1Y81A 2PLAA 2V7WA 4ZOLF 5ALDA 2W2KB 1EFRD 2A8YA 2PQ2A 2A3NA 2XMRA 1X7WA 4RHXA 3C0KA 4R16A 2C3OA 3GNLA 1KSGA 5DYYA 3W5AA 1CHDA 4DIMA 4F93B 3JVDA 2EXXA 3EDYA 1HPLA 4LV5B 2ZE7A 1YFKA 3LBHA 3UMYA 1BROA 2FH5B 3AFGA 2G0NA 2C3UA 1ZM7A 1RWWA 3OPYI 4I4TF 4G0NA 1KYYA 4JJ6A 4M9RA 1WSDA 1GCGA 2O14A 3DAFA 3X1XA 2W48A 3GK3A 4EI7A 4EG5A 2PA0A 5C1OA 1R0WA 1W5FA 3DJFA 4JI4B 3P27A 1LRLA 2G9RA 2Z0MA 2QM8A 3EG9A 3OUUA 2VPPA 5BYKA 1RRKA 2TMGA 2WEKA 3RW9A 3WKDA 2BM8A 4O2AB 4Y2SA 3QM1A 4LRXA 3BMCA 3H0VB 1LSUA 1WDLA 2ZTHA 3IT0A 3W4JA 1E94E 1Z4PX 3FIUA 4YCNA 3ZJTA 4IUCS 3S5JA 1E7QA 4RETA 3U4GA 4WT7A 2ZT8A 3FTPA 2KM1A 2A0YA 1DRUA 2YWFA 1JYEA 3IQWA 4QJBA 4DTIA 5B3LA 3OTWA 3C5EA 3O4GA 2C54A 3THXB 1VPWA 2C9OA 3LH5A 1H5QA 5JSQA 5A4DA 3VUEA 3IIMA 2R1ZA 4LC1A 3UWDA 4CT4B 4E22A 1I10A 3ED5A 4DQVA 5H9WA 2NYRA 4XVUA 2J5XA 2RI6A 2I1QA 1NJFA 4UBLA 2GKOA 2I2AA 2IX9A 4PIPA 4S1VA 1CZRA 2VSXA 3G9UA 1EFUA 3HJBA 4G24A 3GVXA 1XALA 1F48A 4LK2A 4ZU3A 4B47A 1JN0A 3IPLA 5L4NA 4KFTA 1C0LA 1FBTA 3EASA 1P0QA 4MWBA 1KAMA 2XUJA 4I8XA 2V9ZA 3OZUA 4N5NA 4R6WA 4KNWA 1CY8A 2YZ2A 2VJDA 3OZSA 4YI5A 1X92A 5KHAA 3K70D 2X8WA 1I6KA 3A14A 1CQIB 1WU8A 1JDNA 5IDWA 4RKQA 4K28A 4FYYA 1VDZA 3EGXA 3SHQA 3JARB 2X8JB 1BX1A 4FONA 3T7SA 2HNBA 2ESRA 1QFMA 3PHGA 1MJGM 2I3GA 2Q3EA 4G5OA 2YZMA 3DA8A 3DV2A 1GFSA 4HH4A 4I8IA 3K4HA 4UMEA 3RJTA 1DDOA 4MQMA 4NE7A 5KNCD 3ZCXA 4QUJA 4X1YA 5EJGA 3Q6IA 5JO9A 1AUVA 3L9WA 3TW8A 4OX9B 3ETEA 4OKNA 3F8SA 3JQGB 3TR0A 1RQNA 1Z0AA 4PV7A 5BOSB 4ZT6A 2IYSA 2QDXA 3J81A 1E1QA 3JYLA 1NR5A 4Y30A 1ZHOA 1Q1AA 3CH7A 3ETGA 3RJ5A 3STWA 4DDHA 5EQFA 2Q9AA 3PD1A 1UMDA 2BTQA 4CNBA 1B76A 3D2LA 5DVZA 3SOPA 3UZUA 3TVDA 2Z83A 1CSEE 3RTCA 4WY2A 1PUIA 5IAEA 3A6FA 3ZXUB 5BV2P 1TUBB 3CLUD 1K1EA 2L18A 3BJZA 1E77A 2IFTA 5IYZA 1QF7A 1SVMA 2GEDA 2CL6X 3RC2A 2FWNA 4BN4A 1YBHA 2C98A 3BFPA 2BI7A 3HB4X 3PC8A 2BTEA 4I14A 1X7GA 1HRKA 3MMPA 2B98A 1EINA 3LDGA 4RSGA 5CLLA 3IDOA 1G59A 1WW8A 4CM8A 4NDAA 2BCGY 1INLA 1SVSA 1YGPA 3A4IA 5THKA 3MJDA 2Q3FA 4RPHA 5C1IA 3RU3A 3MAGA 3WXMA 4B6FA 5KYGA 4RD1A 3AEYA 2KPOA 4KB5A 4MGEA 3ZWDA 1NE2A 2DFPA 4JFRA 2OHXA 4POOA 4BAGA 1JIXA 5L7WA 3CV3A 2BFCB 2J8ZA 4TN1A 1GQOA 1M74A 3MJCA 4V1CA 3TRKA 4ENQA 1JEJA 3QBVA 4AKGA 2BBWA 2J3DA 4OSOA 1A69A 4LRWA 1E7YA 4CKZA 3JQPA 1AV6A 1OF1A 1HNNA 2P8JA 1SELA 1NSTA 2WG0A 3ZOZA 1TAQA 2XODA 3QVOA 1RQ2A 3DT8A 2WVAA 5FUXA 3WWYA 2WFMA 3UOAB 1FP2A 4CM6A 1X2BA 3IUMA 5C8YB 4MUFA 2AOVA 1W76A 3RYCA 1KKUA 3ICWA 1RM3A 1RAIA 1VHQA 3QYJA 4QO7A 5BR4A 7AT1A 1XTKA 3N53A 3VZBA 3ZW9A 2FFBA 1Y8ZA 3Q3CA 4YIKA 3QW4B 1VPEA 4UVEA 3GGOA 1PZNA 3EP4B 1BXGB 5P21A 3U1VA 1R6VA 4B81A 1FTNA 1H8EA 1UP6A 4L02A 5LZ2A 1DBSA 2GEUA 4B3RB 2AFHE 3O8OB 2V4UA 4WFJA 1YE5A 4KWEA 2J0UA 3DLBA 1OR8A 1ZMXA 5A2QA 3DWIA 4WI1A 3RTBA 2I34A 3LL7A 1ZS9A 4ZEXA 3FA2A 2EAUA 3AJ9A 3NOVA 5EJMA 4HH1A 5EG5A 5I7AA 1I79B 3LVFO 3GVHA 1SBNE 2G40A 1Z56C 1K6MA 5CHYA 3AF1A 2B1JA 2OGSA 3AP3A 4RTMA 1WBBA 4BZZA 4Q66C 1B8NA 1WXDA 2FW6A 2QVXX 3CBQA 3GELA 1BSVA 3SCZA 3LGSA 5AUPB 2DMRA 1NKSA 1ODSA 3R41A 3ZI0A 4F4HA 3C14C 5A3SA 3KTAB 1JILA 1V1JA 4JENA 2YV4A 3LUAA 3I2JA 3ODPA 2Q45A 4YP5A 1ZH2A 2AXNA 3PT9A 5K0ZA 3H99A 4PC2A 4ZI2A 4O1IA 4KO2S 5CLJA 5CCDA 2H4JA 2SCUB 1HFEL 1Z2EA 5AKXA 3TM5A 5JISA 1GZUA 3O4HA 1DAEA 1XTJA 1Z15A 3MXOA 4E2XA 1DIRA 1MFZA 4W8OA 5DHUA 3ADPA 3KKMA 4YCMA 2G63A 4D42A 2C2XA 3L04A 3L0YA 5JAPA 1QYCA 2ZYDA 1JEYB 4HP8A 3T15A 2DFTA 3GBVA 3I72A 3DQPA 1T5BA 1YRLA 3KXPA 3KDPA 2N75A 2UVDA 3IILA 4M0KA 1L5HA 3ZKAA 4AK9A 2BE9A 4NZOA 3K6KA 3AF5A 1FS6A 4Y2XA 5KKCA 3MQ2A 4I6EA 1HE1C 5LQJA 5T67A 2F62A 4TMKA 2ZEJA 3HBLA 4H27A 2UXCB 5FV4A 1H9AA 1VJRA 4XPIB 1IZ8A 1PG5A 1WHSB 3W6OA 4FNGA 3FTFA 1E1CB 1NSYA 2Z3ZA 3ZU4A 4K6FA 1USUA 1GNVA 2WKSA 5AM5A 2YNMC 3JSAA 2QAGC 5JECA 2C78A 5JMPA 3VNVA 3IBTA 4DIDA 4LOIA 2CN1A 3ABIA 2QPAA 3ZVRA 1ZH8A 2YV3A 4LCBA 1QTNA 1P1HA 3GGPA 3O90A 4EDHA 1C7FA 4AY6A 1IPHA 3OE7D 4YRKA 4M7OA 3M5PA 2AA3A 2WYUA 3KOOA 3LNTA 4RA9A 1E7SA 4ENTA 1QANA 5FKJA 4BMDA 3A4NA 2W43A 5LPNA 1CJCA 2VRWA 4CM7A 1T10A 3GPDG 1CYEA 5BNFA 2P6PA 3GO4A 2J9FB 4XGQA 1CZNA 2XHZA 5SICE 1N3BA 1SUWA 1WY5A 2ZTLA 3QKSB 1QIKA 4URHA 4ZDWA 4V24A 2P5SA 3AHDA 3JATB 3S2FA 2QZ4A 3GBPA 4NJMB 3UY4A 3GN2A 1SXHA 4ZEVA 1E1RD 1JQ3A 3T1HB 2VT6A 1QG4A 1JPVA 2QTFA 3B1XA 4R9NA 1HXHA 1XLTC 4IKEA 3EA4A 1YNOA 2QRPA 4CKCB 2VBIA 3AI2A 5JH7B 2FMUA 1TQDA 2IYTA 2R6AA 3RTAA 3REQB 3QE3A 3W5VA 2W2PA 2ZBPA 1SCIA 3AT1A 1K8ZB 4TTJA 4WFIA 3L1HA 4I50B 2ECQA 1U99A 2GPNA 1QHIA 1B23P 2D2IA 4MVJP 2WIKA 3E3MA 3K7EA 5CLGA 1NLUA 5FA6A 4MUYA 2GJ8A 1S7GA 1G6OA 1T5TA 2GJAA 1JHRA 3EXHB 2YH2A 3L7MA 1XE3A 4IRUB 1MV5A 2WNHA 4LCJA 3RU7A 4O4IB 2YWJA 3SLGA 1XIVA 4ECAA 3WK6A 4WADA 4YCJA 2VDWB 4R2MA 5DN9A 3IEVA 3ACBA 3EXAA 3IBYA 5AR1A 4ZWNA 2XPCA 2Z6UA 3BD7A 3RKRA 3L7OA 1BA3A 1ESZA 4K8OA 4URFA 1RRCA 1P5FA 1M0WA 5BSFA 1PFYA 3AGPA 5EWLB 2QD1A 3P9QA 1RHKA 4ARSA 3K5PA 2PNFA 3UJ6A 5THXA 5CXUA 3GLQA 1SXPA 1WPXA 4V0SA 3V1YA 3QU5A 5BSMA 6ABPA 3ABOB 5TVGA 1I1NA 3PQCA 4WCFB 1WTCA 5BUSA 5KNBD 4OA8A 2AFHA 4KBGA 2B78A 1QIGA 1B2LA 3C8DA 4GU5A 1W88B 4L08A 4LTNA 4DR3B 1PQYA 1SOMA 1J22A 4XJTA 5FA5A 4HK4A 5IS2A 4FB4A 3BREA 2FSGA 3FAKA 3GJRA 1C3JA 4FUTA 3KQQA 2F8MA 4MJLA 1AQNA 2LD4A 4LRQA 1CY1A 3Q7QA 1NJ8A 3ERCA 3N1UA 3R3YA 2P40A 4K9DA 2NUTB 4UBJA 2IZ1A 1RACA 1Z74A 3AR6A 3IFSA 4NEGA 1C30A 1IM8A 5FNVB 4A6EA 5CITA 4Q18A 1NVFA 5A04A 5J9GA 2A92A 2VHTA 3BB4A 3MUFA 4YJ2B 4P3OA 4BRSA 1QK3A 4RTQA 3TTWA 5H83A 4X85A 3GI1A 1JJIA 5IM4A 4KV9A 1FFAA 2PYZA 4ZVPA 1ZD2P 5HW0A 3EGWA 1WMDA 4MPTA 3P9KA 1JSZA 2R6CA 2FPRA 5CVEA 2IHVA 1GQQA 1UAYA 3Q9LA 3W2HA 1F5SA 3W34A 1NWCA 3CEJA 1G3UA 2V7PA 4C6TA 5J2UA 1OH5A 4JJAA 1EVKA 5IZ4A 4O1HA 1GN8A 5KINB 3V8BA 1ACLA 1T2VA 4UM8B 4H7FA 3KNZA 4K40A 1VJCA 4O5AA 1VLLA 3FPKA 4JQSA 1NQAO 1YSCA 1FUUA 2IE8A 3KM0A 1XG5A 3F4LA 1UEJA 4N6GA 4PLYA 4WZ6A 3W8FA 3Q8KA 5FH9A 1QQAA 1B3BA 3HMKA 4FEGA 4WNAA 4LN1A 3EDQA 1AK2A 3N2GB 1G6HA 4IGFA 4V02A 5IK2D 1V9CA 1QRUA 3IQEA 1UM9B 3O3CA 4LG1A 5IJAA 3T3MB 3DUWA 4GT1A 4YONB 3TKLA 2UUBB 2JD1A 3NHSA 5CT8A 3KALA 3PNOA 4ZICA 4M9CA 3A3NA 4TKMA 1Y8AA 4Q1CA 2G80A 2GVNA 1A9YA 3NW9A 4FPXA 5DM4A 1GQYA 4C4YA 1SHJA 1KYTA 2VHQA 3K0FA 1KSFX 4R83A 4WLEA 4YHBA 4LVCA 4JI7B 2CFTA 1GUAA 4TTQA 1BGVA 2HD4A 2QR3A 4JUBA 2BI4A 5CB4B 4TXNA 3FHLA 1NNI1 3P52A 1VDMA 2JARA 3OZIA 4J0FA 1W1WA 4JYZA 4EIWA 1N2CB 4OQ4A 4RFSA 3RIEA 1JRLA 4F9FA 2X2OA 4G5XA 2WWRA 3E23A 2DQSA 1JMVA 1GZ3A 2VDPB 4HYYA 4JELA 1IN1A 2YYZA 1H2BA 3NBYC 3NATA 3ND7A 3OMWA 3PFIA 1IH8A 3UT0A 4C01A 1CJKC 1SXQA 1BRTA 1IBMB 4B8ZA 1E2QA 2I7XA 2PKQO 5IXJA 4YLYA 4NV3A 1R9GA 1NSFA 1PTJC 2YDYA 2OCAA 4FFOA 4WA8A 2A4KA 1TEVA 2NU9A 4X1KA 1NRJB 4BCCA 3THOA 2XCSB 2J67A 7MDHA 1V6SA 3GJ3A 5BWBA 5E7JA 5KOJA 3HKEB 2XAAA 3W8NA 2QP3A 5JNSA 1EM6A 3K6SA 4HVAA 3IOEA 2VNIA 1M7GA 1R27A 3MCWA 4RGQA 4BFTA 1LTHR 1O8BA 2W83A 1E1LA 3OE4A 3R2JA 1M10A 4Y0AA 4WLFA 1M0SA 2CMHA 1KPGA 3O1JC 4D0SA 2YWDA 4LRYA 2EZ8A 5K99A 2DQYA 1D6SA 5A2GA 2ZIAA 2MMCA 3S2UA 2EIHA 2WAYA 3A3KA 1RRVA 4OLFA 5AI6A 1BAPA 1OX5A 3E15A 2FFHA 2VCHA 3K32A 4PLWA 2YFKA 3PNKA 2FMXA 1V3UA 3VC1A 4OJYA 2JLXA 4HUQB 3AB3A 2H17A 3HFJA 5EKDA 4K88A 3QUBA 2OT3B 3M4YA 4GD3Q 3N8NA 4DV0B 4BMVA 1IZYA 5AM4A 3LY5A 5EIAA 4KQIA 3DEAA 3ORHA 1GA1A 1KJQA 2F8SA 3EXG1 3K0AB 3KQPA 3VU0A 3WTCA 5A4KA 1Y3IA 2VXOA 1SUFA 1U9YA 1E1NA 2BMVA 2ZK7A 1OAKA 3UMJA 1ZQ9A 3EWAA 2ISQA 3GW8A 3DEJA 3U9TA 3L1IA 3RVRA 2QG4A 4C4XA 1J1UA 3AR9A 3OJLA 2W8ZA 3ZH9B 3RVPA 5A6SB 1WMBA 2VYNA 3GT0A 1DOAA 2P2YA 4HYTA 4CMEC 4LZAA 1YOBA 1HTBA 2Q50A 5AK0A 3OOEA 3UJ7A 4Y8VA 4E07A 1JDBC 1Y3CE 3HA5A 2FKNA 2XJ4A 2I8CA 5JD4A 2EKLA 3S1AB 1EHIA 1CRQA 3LHIA 4PLFA 2IQ5A 2R48A 2HNAA 4I1VA 3VQTA 4EKEA 2HJWA 3GFSA 4E5NA 4C7KA 2B2NA 1HH4A 4HDMB 2ES4A 4IMPA 1QO0D 1RCTE 3F6PA 3FFAA 5B3JC 5FOUA 1I7BB 1MAHA 1Q1ZA 1HOXA 4KPUA 5E9JA 3D6MA 2FRDA 4DMCA 1E8MA 1NW5A 1KOGA 4WXYB 5PNTA 4AKIA 1OXBB 3FFTA 1OU4A 4UU1A 5ABPA 4HXYA 3WDKA 4PAOA 1KEEB 2AEEA 4U2GA 5KVSA 1U2QA 4K81B 2ZWPA 1ZK0A 2JDID 1PJ4A 1HWYA 4Q7KA 5CEFA 3CJRA 3U44A 3FWYA 4PXAA 5ALUA 5AM3A 3UV6A 1GKKA 1RAHA 2W2LA 3F4KA 1GR1A 1VE3A 4MR7B 3GIWA 1JMYA 3W5JA 3L0ZA 3IR7A 2JFQA 1WXWA 4H31A 5GM1A 4EZIA 3OFND 2CHFA 2MIIA 4J16A 3V8QA 5HGXA 3OCVA 2B7BA 1JSRA 2DKNA 3R6DA 2INGX 5KYUA 3S2ZA 1BDHA 2QTNA 1FBNA 3M6LA 3QFTA 4U5XA 5JATA 4CEJB 4G85A 2QUAA 4OMCA 3DGFC 3IELA 2X0JA 1RPZA 4HNAB 5IX8A 5L3RA 3FKJA 1BVYF 3ML1A 4DFDA 5IC4A 4G0UA 1AKTA 3PNYA 4H4EA 5AVSA 4FXOA 3HN6A 3G9QA 5DTMA 1FP4B 2FU5C 2FPIA 2VT2A 4DKXA 1S5PA 2QNBA 4DG9A 1BU5A 4FFSA 3VR5D 4UNRA 1VI2A 1ZI8A 4PY2A 4LYYA 2PKRA 4AO8A 3FOZA 1YQTA 4FT2A 4EHHA 1HNZB 5JNUA 2CJXA 1UIMA 2DPXA 2BMDA 3GN1A 3IV9A 4A10A 4WZAA 2J41A 1PYGA 1U1IA 3VO1A 4MNTA 4TYWA 1SKBA 1YRYE 2JHCA 1FFXA 3NJRA 3CVYA 1G5IA 3IKLA 5D3QA 1YWGO 2Z58A 1DC7A 1M2VA 4K6HA 4L78A 5DULA 2XY4A 2Q62A 4C14A 4XYGA 3HCPA 1PS8A 4R1OA 2YOFA 8ADHA 1YHZA 1KH1A 2ZITA 3QOFA 3D5QA 4XCVA 4B3CA 2XNHA 3RUHA 1KMMA 1UWKA 2OVFA 3PC4A 4MRMA 5BW4A 1IATA 4I6GA 2VYVA 5ALJA 3G5UA 4B75A 1AN9A 1JR6A 4Y1RB 2G9QA 4DB4A 2G17A 4ZV9A 3JU3A 3KDAA 1S02A 3AR8A 2PKXA 5JNWA 1ODJA 1S3SA 1G3QA 4QDOA 3I9LA 5LA6A 3TDKA 3AFMA 3IHKA 2BFWA 5DK6A 1KRXA 1TLTA 4HGNA 2P27A 3S2IA 5C51B 2IXAA 5CLFA 3W6PA 3WYGA 3EFBA 2R8PA 4PZ9A 4QPCA 3DZIA 3RS5A 3RE1A 2PCJA 4BNGA 1CZOA 4JSRA 2B8JA 1V5EA 1RQ7A 3SMQA 2E5WA 3LJKA 1RLUA 1X87A 3SBEA 5F7OA 3CX3A 4M21A 3DV0B 4G9EA 4D4IA 1WXEA 1XV5A 2JFZA 1UBUS 2B6NA 4WBSA 4PLHA 5IC6A 5T3YA 3PVSA 3TJZA 4CV0A 1Z6ZA 2A7XA 5JPDA 4OATA 3SYMA 5HS6A 4EKGA 1U3VA 2Q2VA 1NW4A 2QR5A 1XEAA 2QTVA 3ZG6A 3WK4A 3VR4D 5CIQA 3UFXB 5EE5B 2IEZA 3I9OA 3KPWA 5C18A 1S01A 1Y6QA 1L5KA 4CMBA 1VSBA 5F2OA 5FOTA 4NJOA 3B53X 4BCBA 3I23A 2V7XA 2QS9A 1Z5PA 3B51X 3EEQA 3CGWA 3ZBPA 5IXYA 3RHZA 3C85A 4KKVA 3TFWA 5JMTA 4XR4A 1G17A 1AF4A 3LSYA 5CX1B 1QLHA 1YVRA 3VPHA 1LRJA 1R1DA 4DREA 5C8VA 1V11B 1Z26A 3UMVA 3ABQB 2BF4A 1DC3A 2Z1NA 5DYNA 4G4SO 3RS9A 2YIVX 2DFLA 4A0RA 4PLPA 3F2VA 4E5YA 4EHFA 5K8CA 4M98A 3U61B 1IWOA 1R6UA 3TXAA 4DM7A 4KN8A 1BDJA 3UBTA 2UXDB 1UPUA 2FNAA 4MAMA 3AIOA 3CVOA 3RQSA 2D2FA 4BBAA 3RSHA 1HDZA 3WDMA 5AHKA 5K0FA 3T6KA 1AKQA 3EP6B 4MYHA 1TMKA 3EFOB 4KJZA 4F6RB 3DZ6B 3TPZA 3HWSA 1E4OA 1PYOA 3TSCA 4PX2A 4D3YA 3SQLA 1YZTA 1NN0A 3SC3A 4INAA 4YRGA 4KP7A 2WM2A 2XOKA 4N7MA 1MLDA 4EYQA 3WP1B 3TIGA 2IUEA 4GVXA 1W0KA 2E37A 3GB9A 2JIZD 5DI3B 5CXSA 1JG6A 4G25A 1CIPA 1ZRMA 2BGUA 3WLMA 4UBOA 3UJNA 2JGDB 3W79A 2IOYA 3LIIA 2ZJBA 3NDIA 2VLBA 3E2MA 5EE9A 4C0BA 3CT6A 1OVGA 3OCZA 4B9AA 2VDVE 4ZYUA 2PUGA 1VZ3A 4KOEC 3EARA 5TQ2B 3NRJA 3EVBA 5EC8A 5CDTA 1TD9A 4QNMA 3QPBA 5BSUA 3C7AA 4QOGA 2QTBA 1GFZA 3OLWA 3WA7A 1H2AS 2QZZA 5ECWA 3MWEA 4DZTA 2GEJA 2A30A 1NOKA 1NN3A 3I3OA 1ND5A 2P3SA 3WGUA 1PNVA 3E18A 4AZVA 1X8LA 4P84A 5KTRA 1E60A 1OWOA 4M87A 1U65A 3U17A 2EFHB 3HDTA 2P3QA 4KO3S 2R8BA 4ZDIA 3FNIA 1V43A 1E2EA 1G8KA 1SCJA 4OXNA 5LYJF 4QG7A 3MYYA 1R6DA 3KYIB 2LIVA 4I9FA 4D5EA 3TRDA 1QR6A 2R44A 3BTVA 5F7XA 5JCJD 1J2TA 3AMVA 1DV2A 3UAGA 2FFAA 1XGKA 3H6GA 4UEKA