1TLTA

Crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
304
Chain Sequence
KLRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVHSSTASHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLMVGFNRRFAPLYGELKTQLATAASLRMDKHRSNSVGPHDLYFTLLDDYLHVVDTALWLSGGKASLDGGTLLTNDAGEMLFAEHHFSAGPLQITTCMHRRAGSQRETVQAVTDGALIDITDMREWREERGQGVVHKPIPGWQSTLEQRGFVGCARHFIECVQNQTVPQTAGEQAVLAQRIVDKIWRDAMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)
publication title Crystal Structure of a Putative Oxidoreductase (VIRULENCE FACTOR mviM HOMOLOG)
rcsb
source organism Escherichia coli
total genus 86
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1tltA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1tltA01
2OZPA 4ZGWA 3JQAB 1KS9A 4IDDA 4RO0A 4YBZA 3DFZA 5DBIA 2CD9A 3U3XA 4Z0HO 4NFYA 2JCXA 3ZWAA 3CKYA 1KVTA 2HCTA 1VL6A 2CDAA 3QWAA 4BNZA 5I7FA 1Y9AA 1PZGA 2JCYA 2R00C 1DSSG 1HE3A 3OA2A 4EITA 2GDZA 5BSFA 3D64A 3FPCA 1VSUA 1ID1A 1O5IA 4XWYA 4DYDA 3K96A 2E37A 2ZK7A 3C8MA 3LVFO 3AUUA 4FJ1A 3GGOA 4HFMA 5K0ZA 1KYQA 1DLIA 5ES3A 3ITKA 1D1SA 3P7MA 1M2WA 1DAOA 3AUAA 3WGGA 1YB5A 1YB4A 2C2YA 3TZHA 1T2FA 5DP2A 5A3VA 2DBQA 1O95A 2DBZA 3NYWA 4ITUA 4J4HA 4R41A 4JP3A 2EP7A 2BGMA 4CLRB 3IP3A 1DRUA 5JO0A 2PK3A 4MJLA 1SBYA 5JMWA 4Q3CA 1L7EA 3ADOA 2Z1NA 1DIAA 3QJ5A 3RBVA 2H1SA 3BMCA 3LT0A 4U8GA 1NX6A 1WMAA 3H9GA 1E6EA 2IDZA 3KOUA 3CPSA 1BSVA 1QLJA 4EYEA 1DDOA 3Q9UA 3PZRA 3IAHA 4K9DA 2VCYA 4FPXA 1PWXA 3WLFA 1GR0A 3E48A 3HSKA 1NQOA 3AOEC 1N9GA 2FR8A 1HEUA 2HU2A 2YHIA 5CG2A 2OP1A 4MKZA 3HJAA 2PY6A 3S2EA 3CE6A 4U0JA 2NNLD 2NU9A 1P77A 3KLPX 1N5DA 4B7CA 1XA0A 4I5GA 3LT2A 3V5NA 3RFTA 4I5FA 3ONDA 4OYRA 3Q0EA 4BNMA 1NXQA 1T24A 4TROA 3MWEB 3NGLA 3R6DA 3NAQA 1LDNA 1KC3A 4D7AA 4PLZA 2JCVA 4PZCA 4HWKA 4JNKA 3VZPA 3O26A 1GCOA 5K6AA 4PLFA 4GWGA 5KJFA 4YAEA 4H15A 4E2YA 2HO5A 3FWZA 3WYEA 5TT1A 1U3UA 4MKXA 4L0QA 3GDOA 1HYGA 4A5OA 3PYXA 2PGJA 3K2EA 4K26A 5THQA 3WTCA 2FPPA 4I9UA 5COAA 5ENDA 1FDWA 3GMDA 4JIGA 3FCOA 2D1YA 5DF1A 4DPKA 1OOEA 1MC5A 4YAJA 1FF9A 3EY4A 4GX5A 3H5NA 5F1PA 2GCGA 4BNUA 4J2HA 3N58A 3DXFA 1V3UA 4MIYA 1HKUA 1GQ2A 3RUFA 4BGUA 4YT4A 2O48X 1NR7A 4ALIA 3EUWA 4HNHA 3RI3A 1GTMA 1H94A 3E8XA 5I8WA 3JQ9A 3TZ6A 2O2YA 4BO4A 5EIOA 3PP8A 4E33A 4B7UA 2PKQP 4R4JA 2NU7A 1UP4A 3BMOB 4YB8A 1TEHA 1PJTA 5DDIP 4BS9A 4CLEA 2W2KA 7ADHA 4D3FA 3M1LA 5TQVA 2XAAA 1XSEA 4JXKA 4NIMA 4YACA 5G0UA 1AXEA 1UXHA 3DFUA 2Z95A 4IPTA 1XCBA 4AJJA 1UR5A 3RU9A 2ZYGA 3DZJA 4PLWA 1IL0A 4D42A 1F12A 4XDZA 5CDSA 3ZWCA 1WDMA 5MDHA 4OOFA 2I5PO 4R01A 3L9WA 4J90A 1RKXA 4IGFA 2FY8A 1EVJA 4NNJA 2LDBA 3DTTA 4IM7A 2Q45A 4QTZA 4BB6A 2EXXA 4P4NA 3MTGA 2D8AA 5F5NA 1YBAA 1HETA 4IDGA 1QRRA 1H2HA 4BO3A 4DTIA 1Y81A 5ADHA 4A2CA 4LRTB 1C0PA 1T25A 2HJSA 3GMSA 3O03A 3KZVA 4IZHA 3FR7A 2NVUA 4TZKA 3GA0A 3HHPA 1BRMA 1GADO 2P2SA 2IRWA 3NJ4A 3AU9A 3PHIA 2WMDA 3W1VA 3RC9A 5GZ1A 2X1HA 1E3JA 5H81A 5TRTA 1G1AA 4ZQGA 1QSGA 2JAPA 3RC2A 5DCWA 4EJMA 1MFPA 1D3AA 2FPGA 2X7HA 1DIRA 4E5NA 4J91A 5T5QA 4OKNA 3DONA 3ZDFA 5A05A 2VHYA 5U1PA 3WOHA 4GSKA 3K73O 3HDQA 3PHHA 4PZEA 4E30A 3PHLA 2VOEA 3DMTC 1HE4A 2ZQYA 3ZNNA 5I9LA 4PLTA 3EVNA 3W6ZA 1BWSA 1TI7A 4CR7A 5B4VA 1ZKMA 3A9WA 2Q22A 1CQIA 1JDJA 1OAAA 3PYMA 4UVHA 1ISMA 1YB1A 2PLAA 4DBZA 1RM0A 1B16A 2ZATA 5KVQA 4WNCA 1PJCA 2XF8A 2GLXA 2P5UA 3ROPA 3WFJA 2I3AA 1ZIDA 4RZHA 5BSHA 2C2XA 1LSOA 3NJ8A 4Y98A 5BQFA 1F14A 1ULUA 4GX2A 3OH8A 1E77A 1O89A 2GO1A 5KJCA 4ZHSA 1B3RA 2P91A 1SOVA 4ZN6A 5I9MA 4BMVA 1IB6A 4QFCA 1HL3A 1M6HA 3UXYA 4XGIA 5DULA 1Z82A 1RYDA 3GG9A 4B79A 4FFPA 1VPDA 4GAEA 4XQ9A 5I9NA 3R3SA 4CMEC 4XIJA 1PS9A 4E5PA 2BGLA 2NSDA 3WGIA 1DC3A 1YL6A 1U9JA 4CJXA 1ZEJA 3LLVA 4J7XA 4ND1A 5CP8A 3IS3A 4MVJI 1PU2A 4TRMA 3SXPA 3PVZA 4LW8A 4BNTA 3WJ7A 1NHGA 3GAZA 2PD6A 3MEQA 3B70A 2DT5A 2P9GA 1UXIA 1DFGA 4O0LA 2IZ0A 4EI2A 2BRUA 2W90A 1N1EA 2E48A 3PQEA 3WB9A 3TDKA 2HQ1A 3ZI0A 1CETA 1LC3A 3GVPA 4PIVA 5L9AA 3GVHA 3JQGA 1I8TA 2OP0A 3AWDA 4OM8A 5EQFA 2CZCA 3INTA 5IDWA 4RPHA 4CLHA 3K92A 3PFFA 3VPHA 4MP6A 3A1NA 1KY4A 5KKAA 2NU8A 1ZUD1 1HWYA 3I4CA 3WR5A 2WE7A 4CLRA 4IY1A 3UFXA 4NH4A 1F06A 1LLUA 3P2YA 1F17A 3QVWA 3JYOA 1E1NA 4YJGB 4DRYA 3PQDA 3IKTA 4ALLA 4B8ZA 3OQBA 4YXFA 1PS0A 2VZ9A 3DHEA 1IUKA 6LDHA 1A4UA 4AJ4A 3L77A 1ONOA 4BNIA 3WTBA 5IDXA 2GZ3A 3SBOA 2VYVA 4GGPA 1YKFA 4IS3A 4J7UA 3PYLA 2IODA 4Z6KA 1RWBA 1HDXA 3VH1A 3EYWA 1AUPA 3FNHA 3D0OA 3H5RA 3HNPA 1NNUA 3FBGA 3S2GA 5DOVA 3IOYA 5J23A 1LA2A 3ENKA 3GDFA 1EVYA 4P8RA 2AQ8A 4GKBA 4CUJA 2DUUA 2EKPA 4CLXA 3KXDA 4RQTA 4WECA 1NASA 1R4NB 4MP3A 3F5QA 4O5OA 2C82A 4XCVA 4P22A 4U6SA 3QLJA 4PLVA 2FSSA 3AJRA 4J3FA 3CEAA 4B7XA 2DTEA 3UAGA 4QSMA 4OSPA 2WEKA 3ZHZA 5JCJA 5A3JA 5A9TA 5ICSA 3SC6A 1T1RA 2NLOA 1GV1A 4EDFA 5JYDA 4OOEA 1U3WA 4WCFA 4OJNA 1X1EA 3GHYA 2PTGA 1GPJA 4R51A 4U0KA 3LC1O 1DIGA 1RPNA 4YYZA 2ZCVA 4PLGA 4PLYA 2Y1CA 4NBTA 3WNQA 4PRKA 2J6IA 4WLUA 1C0LA 3TWOA 4WPGA 4Z3KA 3PJDA 3PJGA 2IXBA 5T8KA 2YZ7A 1D4FA 3BMNB 3OP4A 3AU8A 1HE2A 1NVTA 3NV9A 3JV7A 2G5CA 4D0RA 3GGPA 1ENYA 1B0AA 4R1UA 2JL1A 2EKLA 3U49A 4JX8A 1ONPA 3JQCA 4R68A 2J3IA 1RM4A 4JBHA 5H83A 4JJGA 3WBBA 4L9RA 3ETGA 3D5TA 3S2IA 4GLLA 2WD8A 4P4LA 3ZV3A 3HUDA 4XEHA 1OBFO 3OJ0A 1Q1NA 2PA3A 4IDCA 4FIZA 3DBLA 2HMWA 1SPXA 1LXCA 1QXSA 1VL0A 3HDJA 4WEQA 4OSOA 3M2TA 4IXWA 5G0VA 4LN1A 1F8FA 1KC1A 1DPGA 1UH5A 1LDBA 3PFWO 1BVUA 4HY3A 3OBBA 4GMFA 2GERA 4BNVA 3MJ4A 2WD7A 3KETA 4KMSA 1E7WA 2A94A 2CDBA 2JD0A 1J4AA 1I33A 2FOIA 4B4VA 3OIDA 1K89A 4AJLA 2P9CA 4LSWA 3PLNA 1NP3A 3JQBC 1T2DA 1NM5A 3KBOA 3OEYA 3MTJA 2P68A 3BMCB 2VYVD 2BGKA 3MJSA 3F5SA 4RV9A 2EGHA 1LEHA 2YDYA 1Q0QA 3I9OA 5CDUA 4OXYA 4TRJA 4G65A 1QYDA 1P1HA 3C7DB 1NPYA 2DFVA 3BHIA 3C7CB 4QT0A 1R16A 3K5PA 4Y9DA 5L3ZA 3RKUA 4A03A 4WLNA 2DKNA 3JD2A 2YHIB 1TT7A 4FFNA 3QE3A 1XR3A 2OBNA 4FGSA 3VVCA 1VSVA 4AICA 3EAGA 1H6DA 2DBVO 1WDKA 1GDHA 3U62A 1A7KA 1MV8A 3AY6A 2NU6A 3I9KA 3IUPA 3NEPX 3VPFA 3F4BA 5I7VA 3OJOA 3I9MA 1Z75A 4DGSA 3SEFA 3GDGA 3F47A 4ND3A 4M1QA 3W8EA 2ZTLA 4DIFA 3JYNA 4I5EA 1T4DA 4GKVA 4RQUA 1R15A 1C1XA 3PLRA 1XU7A 4GBJA 3MZ0A 5L7YA 4BMNA 3DZBA 3NTRA 1PJ2A 1JVBA 5L95A 3Q11A 2O3SA 2ZJ0A 5CDTA 2AEFA 2Q4EA 5GZ6A 2I67A 1Y8QA 3KYBA 3WLEA 4W4TA 2WDZA 3V8BA 3H9QA 1HDYA 2B4RO 2UAGA 4ZD6A 1E7QA 3H9JA 3GVXA 4N5LA 2JFFA 4CPDA 2X5OA 2Y1DA 2NTJA 2I3GA 4NQZA 2CDCA 3KYCA 1XQ1A 1U4SA 5EPOA 1R0SA 1ADGA 3I5MA 2PD3A 3OJEA 2C5AA 4R9RA 5A03A 3BHMA 4W7HA 4Z9FA 3BIOA 1H2BA 2QYTA 4D45A 3GG2A 3PDJA 4EZBA 3RASA 4ZQFA 4IQ0A 3U9LA 3JYQA 4ZU3A 1I32A 1I24A 1E92A 2CY0A 3T4XA 1PJ3A 2X9VA 1S7CA 1SAYA 2GRAA 1BGVA 3VVBA 4CM6A 4J16A 3RU7A 4UUMA 1EBFA 4BV9A 3TFOA 5FFFA 5IZCC 2YJZA 2W2KB 4MVJA 4S3MA 4FBGA 4TQGA 2NWQA 1BMDA 5TNXA 4L73A 4XJTA 4IQ8A 1TLTA 3A4VA 4RVUA 1F0YA 1B8UA 5B12A 5IXSA 1I36A 1IHXA 4GX1A 1FDVA 4FC7A 1ZXLA 1TVEA 5JYEA 2W2LA 1CERA 1LRJA 1U1IA 4UEOA 4E2ZA 1ISFA 3BHJA 4JROA 1PR3A 1R4MA 3DBHA 2DM6A 4XRGA 1B7GO 2C29D 4U6QA 2A4KA 3I6QA 1TT5B 2FP4A 1E1MA 1AN9A 3I9LA 4PLCA 3OIGA 5AVOA 3FI9A 3QVXA 4JK3A 1KBZA 4U7WA 3GEDA 1QKIA 4RL6A 2X5JO 4O6VA 3ZU2A 2J8ZA 4GVXA 2OUIA 1VC2A 4DC0A 2PGDA 3RUCA 3W8DA 3ZV6A 2HMUA 4BB5A 2YV1A 1JKJA 1IPEA 2PZJA 4BNKA 1A9YA 1KVUA 5FYDA 4YEDA 4RF3A 4WGGA 2NVUB 3DZGA 5JDIC 3ZWMA 5KWEA 1R4NA 3OIFA 2YFHA 4ZJUA 2P4QA 3UOGA 5JSFA 4FOOA 1HT0A 1LLDA 1PQWA 4M87A 1OI7A 3DL2A 2DTXA 4R54A 2EERA 1CQJA 2YY7A 1QG6A 4F45A 4CMIA 4Q3DA 2A9FA 3TQHA 2X8LA 1NPDA 3EVTA 1QYXA 4Q9NA 2OMEA 1MX3A 5JXWA 1WAMA 4BNLA 5TSDA 1E3SA 3WS7A 2RHRA 1HYEA 5EL0A 4AJ2A 1YL5A 4IQGA 1EEHA 5C5IA 1E5LA 4RLHA 5IDQA 3RCBA 1XHLA 1IULA 1JWBB 1BHSA 1VJTA 3R3JA 4PRLA 2GN9A 5L40A 2Q2QA 5J9GA 2YUTA 3MCVA 3ZV4A 2JD1A 4CMCA 4QO8A 4D43A 4B8WA 4XYLA 1BVRA 1CJCA 1K6XA 4L75A 1U3TA 3GRKA 1B26A 4YT5A 1PQUA 2OGUA 1PR9A 4FQ8A 1LQUA 1L1FA 5FEUA 1Z7BA 2EF1A 3H6KA 3RUEA 3AM3A 2O3TA 4IJWA 3JYLA 1ML3A 1H93A 4Z3DA 4W82A 4J0EA 4CUKA 3C1TA 4R5MA 3QVSA 3K6JA 3ASUA 3ONFA 3DC2A 3EMKA 3DAPA 2GSDA 3I9NA 1Y6JA 1YRLA 4KUHA 2C59A 4U5QA 4XGNA 1P0FA 5KCZA 1U5AA 4DPMA 1RM3A 2VUTA 3LK7A 1H0KA 2NUAA 1XYGA 4FFLA 2B4TO 5M6DA 3UN1A 4JBGA 4G5HA 4R1TA 1I2BA 4MVJD 4XB1A 3LLSA 3FHLA 1ZJYA 2DUWA 3ZH2A 2HK8A 2Y1FA 1NQTA 5IAAA 3NDRA 3JQGB 1QP8A 3QHAA 2NTNA 1GY8A 2Q49A 1HZZA 1ZK3A 4F3YA 1E3IA 4BKOA 3GEMA 3VDRA 3RAJA 4BQPA 1UAYA 4OKIA 5IJZA 1V9LA 3V1YA 2W2LD 1E6UA 2G76A 3QQPA 1JLLA 3SLKA 3VPSA 2CF6A 5DP1A 3GQVA 3EGOA 4UVEA 5LDGA 3RQSA 4MVJG 1JQBA 2CMDA 3UH1A 1ZMTA 1ADBA 4CL8A 2ZYDA 2JD2A 3CINA 1KEVA 3EW7A 4FD3A 3BXXA 4GVLA 4BL5A 2V6GA 5L7TA 4DLBA 1W73A 1XGKA 1JAXA 4F6CA 5EINA 1SC6A 4JBIA 3ZCXA 4KQWA 1YQGA 3DOCA 1P1RA 2FR0A 4TVBA 5KVCA 4MVJH 4IDFA 1CWUA 4JJIA 4FS3A 2X4GA 3PI7A 3GNSA 3OJFA 3VZSA 1A9ZA 3LSYA 3PHGA 5EJ2A 2IYOA 4YAKA 4MVJP 3G79A 5AYVA 3NUGA 1YL7A 4I1IA 3QVOA 4JCOA 4J4BA 1YVEI 3TL2A 5JAMA 4G2NA 2IEBA 1J6UA 4FFMA 3ZGYA 4ND4A 4Y6SA 2RH8A 1ZJZA 1W4ZA 3QY9A 5L51A 1WLYA 4PG5A 4WEOA 3RROA 1EQUA 2FWMX 2Q46A 3WGQA 4WCFB 1C0IA 2GUGA 3WDSA 4E2WA 1LLCA 2H6EA 3B1FA 4BO9A 1B2LA 4RVDA 1DB3A 4NBRA 3GH3A 4HBGA 5LDHA 2C7GA 2RH4A 3RUAA 1ZMOA 2VHZA 2J3JA 3PIIA 4AJNA 2Z1MA 3GN1A 2PZKA 5COQA 2IE0A 2GGSA 4BIIA 2VWQA 2BF7A 1EK6A 4RVHA 2GN4A 1NYTA 3I4FA 3F3SA 3ZWXA 3PXXA 3NDIA 2BH9A 1Z6ZA 2Q1UA 1U2GA 3DO5A 4QO7A 1I3KA 1ZK2A 3BTOA 5L45A 1GYQA 2NV6A 3NX4A 2YHUA 1MG0A 5KJ1A 4J9UE 2ZYAA 4W9NA 1PJ4A 1BW9A 2H9IA 3D4OA 3KB6A 2X0NA 2HK9A 4JJFA 3WYBA 5CEEA 3WWYA 1ZBQA 4EUHA 4JQCA 1PTJA 2HRBA 5G4KA 2PH3A 1PGOA 3JYPA 3WQRA 4CODB 1UDAA 3DBLB 5CDGA 5KKCA 4E3ZA 3R1IA 1N7GA 1SNYA 3RJ5A 3PWSA 1PJSA 5HA5A 1PQPA 4XYMA 5AXDA 1LNQA 1Q0HA 3FD8A 2X9NA 4TRNA 1PSDA 2HLPA 3WBFA 3RIHA 5JDCA 2WD7B 3KEQA 4GPD1 5A9SA 4CLDA 4E2XA 4UVGA 3UW3A 5DCYA 3E9MA 4FCCA 1TT5A 3U09A 3E5MA 4HADA 1GU7A 2JJYA 1Q2XA 4EUFA 4II2A 2BFMA 4YRBA 4OGWA 5KTKA 1OC4A 4FW8A 1B3BA 3KSDO 1KETA 4RCVA 5JPIA 5IG2A 1P9LA 3PDUA 4DC1A 4LRSB 5JYAA 1GYRA 5TJHA 3UVEA 4WE3A 3G17A 4PVDA 4WLOA 1PEDA 3L6OO 4URFA 4JLWA 4O59O 4BO1A 4BGEA 4NJMA 4OXKA 1T2EA 3U4IA 4ILKA 1V3VA 1SEVA 2PZMA 4IIUA 4J1SA 3L4BC 5JC1A 1T2CA 4CMJA 1NQAO 1I3NA 4LCEA 5DNAA 5T64A 1JA9A 5T6BA 3TF5A 5IN5A 4R3WA 4RDIA 1Q0LA 4BMSA 4RF4A 1BTOA 3JTMA 3TSCA 5BR7A 4CQLB 5G2OA 2VWPA 1C1XB 3PK0A 4JGBA 3BA1A 1FDUA 1FXSA 5HRUA 4QFDA 3M2PA 4CV3A 3RBXA 3VPGA 3WGHA 1WZIA 1OMOA 1YJQA 1DOHA 4O1MA 4NPCA 4BO8A 4CR6A 3V2UA 3GR6A 4LVCA 3C3XA 1P1JA 1SB8A 2GYYA 1Y8QB 2PNFA 5GMOA 2DAPA 4LSMA 1I01A 4QEDA 3ZWYA 2WYVA 3VKVA 3KRTA 5AQ1A 5CG1A 3ZWWA 3LT4A 4E31A 2BI8A 2ZTMA 3KYCB 5C7IO 3PEFA 1R6DA 1GUFA 2Y1EA 3AK4A 3DZIA 1GZ6A 3ABIA 5CPFA 2J5KA 5EESA 2HMSA 2Y1OA 1LDMA 3COSA 2YQ4A 1TXGA 4B4WA 1O6ZA 1YGYA 1YONA 2VZ8A 5C7OO 1LRLA 2Y0DA 2ZB8A 4BNNA 4GWKA 4DQVA 2TMGA 3QV1A 3G1TA 5I8ZA 2QG4A 3QSGA 3ANMA 3ETDA 4RVSA 3WGZA 1MB4A 3BMQB 1Y7TA 2UYYA 4N54A 2AE1A 3BZUA 1GQQA 4CV0A 4E12A 1Z74A 1LU9A 4HV4A 1P33A 4H3VA 1DO8A 1DFHA 2GZ2A 3CZMA 3VZQA 3IC5A 3GUYA 1BXKA 3RKRA 4PLPA 1EVIA 5I7EA 1MUUA 4GSLA 1NWCA 3VTZA 3UICA 4PN3A 5C7LO 5CEFA 1SO8A 4BNHA 5G0SA 3GNQA 1GL3A 3M6IA 3V1UA 3V1TC 3ZWOA 1JN0A 1B8PA 1YJ8A 2Q3EA 2VUUA 4YCAA 9LDTA 5B4UA 1P44A 4NR0A 2ZB3A 4YJHA 3WICA 2F1KA 1MXFA 1R4MB 1HDRA 3DBHB 3QWHA 2Y0EA 3WG9A 2D5CA 2UVDA 3LYLA 2EV9A 1R37A 4K6CA 1LLQA 5JDIA 3BTUA 4FSHA 4E21A 4IS2A 3DZKA 2W4QA 2DC1A 2VHXA 5BNFA 1NAIA 4BGIA 1B15A 3A28A 2HDHA 3QP9A 4BNJA 2BMAA 2GZ1A 4ZQHA 5GY7A 2O50A 2PFGA 4DVJA 3MJEA 1HDCA 2QYSA 4DLAA 3DB2A 3RFVA 2VRCA 2D5AA 3TNLA 4LCJA 4CMAA 2VZ0A 1KVQA 1PWZA 3LF1A 4B4OA 4UVDA 4CM5A 1EFKA 3W6UA 3E5RA 3D1LA 3ZNQA 1PZHA 2I66A 4YAIA 1PGQA 1X13A 4WASA 4CMIB 1NAHA 3FN4A 2ZTUA 3L9XA 4J6FA 4XJSA 3I23A 4PGFA 3FTPA 4R69A 2PZLA 4NI5A 4CMBA 3TJRA 4ZQEA 4BKRA 2BLLA 2E4AA 4OXNA 1LI4A 2ZKLA 4YVFA 3LC7O 4OMUA 5C37A 1JKFA 5BNTA 1A71A 1E1KA 3RUIA 4AG3A 1NQ5A 2UDPA 3QVTA 3BTSA 1DXYA 1PL8A 3GVCA 1LUAA 2V65A 5ITWA 4NMHA 2DU8A 1PIWA 2D0IA 5L4SA 1TB4A 2B0JA 2FZWA 4NFHA 2P9EA 1VKOA 1XU9A 3DOOA 2C20A 2O3QA 1DC6A 1ZVMA 4IIVA 3L6EA 4N5NA 4A0SA 4BNYA 4ONEA 4II3A 1U28A 5T67A 5K6AC 2R00A 3F6YA 3W4IA 4WCDA 5CAEA 3IIEA 3ZW8A 3KSZO 1I10A 4IDBA 1A7AA 1YQXA 3JQFC 1YDEA 3HADA 4MO2A 3WIDA 1N2SA 2YFQA 5THKA 3KSUA 1IHYA 1E5QA 1VKNA 1I30A 2BKAA 3JD0A 4XR9A 3L07A 4HX5A 5DOZA 4YJFB 5JY6A 4EEZA 4HFNA 1IZ0A 1K2WA 1EUZA 2WYUA 3IUSA 4XB2A 5TS3A 3ENNA 3DHYA 1BXGA 4WK6A 2E49A 3E03A 3RWBA 1ADCA 4XKJA 3EZYA 3SLGA 1WWKA 2RHCA 3G49A 2FR1A 1VM6A 1EFLA 2G0TA 3OECA 4GI2A 2FPIA 4MVJE 2NM0A 3ANNA 4DWVA 2GASA 2J3HA 3JSAA 4GLOA 4I5DA 2JAHA 4JP2A 1DJQA 3JQ9C 3TZCA 5IF3A 3F9IA 1YBMA 1KVRA 5HTOA 3MOIA 2NVWA 4GMGA 1C14A 1LX6A 3DAFA 4M54A 1KVSA 2QIOA 3LU1A 5IZ4A 4ZRNA 4MPDA 3UUWA 4Z9YA 4P4GA 2BHLA 2H63A 2BELA 3RVDA 3VDQA 3Q1LA 4HNGA 1WW8A 3IL2A 4BKPA 4J0FA 4NHEA 2HMTA 3AOEA 1I0ZA 3K2BA 2UV8A 1NBOA 7MDHA 3ROMA 2X58A 3T7EA 5BT9A 1ZEMA 4OAQA 3QA9A 1NVMB 3H4VA 2WSBA 4IZIA 5JAQA 2EJVA 4UEKA 3WSWA 2DBRA 3Q9NA 5G0TA 4DMMA 2V7PA 3V2GA 1QV6A 2XOXA 4LK3A 1BXZA 4DXHA 3IQDB 2CSUA 4I8XA 2E6UX 5BSGA 2G82A 1H6BA 4BKUA 4Q3NA 4GX0A 4DQXA 3GOHA 2CF5A 1DAPA 2FSVA 3IP1A 5FWNA 4UEJA 1NHWA 2VRCD 4M89A 4TSKA 3DTYA 1E3EA 4C7JA 3FF4A 3W8FA 1E3LA 4L76A 2JHGA 1QYWA 4ALNA 4DYVA 2AQHA 5JBIA 3CSDA 2XXJA 3D3WA 1XG5A 3D4PA 4CQLA 2D4AA 3AUTA 3VTFA 1NFQA 1LTHR 3GGGA 3NRCA 2VTEA 2Y1GA 3MJTA 3FTNA 1DHRA 5CDYA 3STHA 1K6IA 2BD0A 3QIVA 4AL4A 5TJ9A 5FI3A 1HLPA 3ROQA 2OOSA 2P4HX 2CVQA 3ZZNA 2A92A 1U5CA 3AUSA 4KP7A 3UKOA 4J9VA 3TOZA 4OQYA 3T4EA 1DRVA 1GD1O 3MJCA 1FMCA 3UCEA 4AJPA 3I3OA 2DLDA 1YO6A 1C1DA 1UAGA 2O3JA 3VH2A 4XDYA 3JQDA 4RVFA 1HE5A 2IYPA 5KJ6A 3PIDA 1EVZA 4RJTA 2QX7A 4Z0TA 1IYZA 3WGTA 2WWRA 2HK7A 3K31A 1SOWA 4IMRA 1H9BA 2EGGA 3S8MA 1Q7GA 1LSSA 2X5KO 3VOSA 4IINA 4TRRA 1BW9B 4GGOA 3IJRA 3IMFA 3RD5A 1MLDA 4D44A 2BI7A 3PHJA 4OH1A 4FC6A 1CEQA 3BMQA 4GH5A 4QQRA 4HP8A 4H16A 1GEEA 4MDHA 1R0LA 5EQDA 5G4KB 4XGKA 8LDHA 5B1YA 3RFXA 4ESOA 1DHTA 4ZA2A 1RYEA 4K6FA 2RIRA 4R9SA 2I9PA 1V8BA 3A14A 4MINA 4FFRA 4D0SA 1NFRA 2HJRA 1UZLA 1NVGA 1QYVA 5BNIA 1WP4A 1OZAA 3FRJA 5A9SB 1H6CA 1D8AA 3OHSX 4OIMA 2OHXA 2VT2A 1KIFA 3WQQA 3IKVA 1CRWG 3AW9A 4KUEA 2FRDA 4EJ6A 3GEGA 2HAEA 3WNVA 4EUEA 3H3JA 4D3DA 3TZKA 3CMCO 3KYDB 4W99A 3DMYA 1ISJA 2OO5A 4OL9A 4Z0PA 1Y1PA 3B20A 3PWKA 3U5TA 2Y99A 3I9JA 3WSVA 3ZU3A 4N7RA 1N7HA 2AEMA 5T57A 2QRLA 1DIBA 3L4BA 2B37A 3D5QA 3SJ7A 5A04A 3RUHA 3AOGA 1SZJG 5L53A 5JYFA 1NFFA 1Y9EA 3EK2A 4BHTA 4HFRA 4KTVE 4NJMB 1UZMA 1MC4A 1YOVA 4XYGA 3DMTA 2Q2VA 4XR4A 3MWDB 3IJPA 4WLFA 4DA9A 4WOKA 2B35A 3JQ8B 1P3DA 4TWRA 3FWNA 1Y5RA 4YRDA 2QHXA 3DQPA 2DQ4A 1A4IA 3QW2A 2YV2A 3VZRA 3NTOA 2UUPA 1YE3A 3HG7A 3B6ZA 3WWZA 3AY3A 4RPGA 5CFZA 1T4BA 3DR3A 1YDWA 2EP5A 5EN4A 3JD1A 1TA4A 1GFSA 1M67A 3GNTA 2AG8A 3RUDA 5IXYA 1K0UA 5B37A 4CMEA 3AM5A 4IJKA 1GAEO 3AM4A 3HZZA 2QRJA 3D4NA 2VTDA 3KHUA 3WGYA 4NU5A 1I2ZA 4KDEA 3FSRA 4GL4A 1DRWA 1E7RA 5IFLA 5B4TA 4WCFC 5A5EA 4RGBA 1F8GA 4UAGA 4F46A 3C85A 1P0CA 5KOIA 2PKQO 4CLOA 4YJFA 5JC8A 1X1TA 2DFDA 3C24A 5L4LA 3OA0A 1S6YA 3GAFA 3PJFA 5A4DA 3L4SO 5TT0A 4KOAA 4CV2A 3CUKA 4Q39A 4RF2A 3ZHYA 1LQTA 4FN4A 1O8CA 2B36A 2F00A 5T8KC 1CF2O 1M66A 5TGDA 4AJ1A 4I9NA 1RM5A 2Q2WA 1EK5A 5JAZA 1VLLA 1GUZA 2J5QA 1I3LA 3KUXA 4YTEA 4BOYA 4YPOA 1FDTA 3LF2A 2AW5A 1BG6A 1UDCA 5F21A 3W4JA 4RPJA 4ZQBA 3DOJA 1XELA 2VYNA 3ZV5A 1IE3A 3UGKA 4FDAA 1P1FA 1P1IA 2H5LA 1T2AA 3NT4A 4WLEA 5DN9A 1Q7CA 3F1KA 4AJKA 1UP7A 3O38A 4D79A 2VWHA 5TX7A 3VHRA 5JS6A 1T26A 4YJHB 4NDNE 1VJ0A 1HSZA 3QWIA 1ZSNA 4FOSA 3VH3A 1Y8RA 4D3SA 4WKGA 1YBVA 5GZ3A 3H65A 5HS4A 4Q3EA 1K3TA 4J2OA 4YQYA 3P2OA 4CR8A 3DZHA 3NTQA 1X15A 3HFGA 3G3EA 3KM0A 4NFSA 1GZ4A 5AXCA 4ND5A 2JHFA 3AY7A 1FJHA 5G0WA 5JFOA 1SCUA 4YDRA 4HFJA 4L8VA 3ROKA 3ZWPA 2W8ZA 4LVUA 1IOLA 3F46A 4FJ0A 4IJUA 4YA6A 4CMGA 2Q99A 1UZNA 3LZ6A 1UP6A 3B1KA 3HFSA 2C5EA 3H7AA 2GF2A 3ZNOA 3PQFA 5ILOA 3D3EA 3BTVA 1OFGA 1VRWA 4INAA 1AHHA 1WDLA 4FFOA 1MGOA 3MOGA 3INGA 4O63O 5ILGA 3TPCA 4YRAA 1LDGA 3NT2A 1H6AA 3CH6A 4XD2A 4LGVA 4CM8A 4TKMA 2NQ8A 1I3MA 5JAIA 2ZTVA 1Z73A 3Q2KA 1JW9B 2VOJA 3K30A 4I9HA 4K28A 4L4SA 5IDYA 4YWJA 4XA8A 1C3VA 4B3JA 5I7SA 3ZW9A 2I99A 4M8SA 2X86A 2E82A 3UF0A 8ADHA 2B69A 4UULA 4J4TA 5AXAA 4DREA 3VPXA 4PFJA 2OXIA 1VE9A 1KY5A 4AJOA 4BGVA 3JQFA 4PG6A 5TC4A 1GYPA 3GZNA 1QV7A 3SC4A 1N8KA 1E3WA 3AFNA 4W7IA 3JQ7B 1HXHA 5JLAA 4CMHA 5KNLA 2D59A 1V35A 3WJAA 1AE1A 3WMXA 1ZW1A 1H5QA 3E9QA 4BNFA 4G81A 5KJEA 5HM8A 3ADPA 3WIEA 3WMWA 4WJZA 1SEPA 4EBFA 1E6WA 1HLDA 3RJ9A 4ROSA 4D41A 5JY1A 3A06A 3P19A 4DLLA 4DL9A 4AJEA 5A5FA 4P38A 4BNWA 4BO5A 3GY0A 3PGJA 4PLHA 1BXGB 1DC4A 1ZK1A 5KVVA 2IEDA 3HN7A 3H8VA 2B4QA 2VUSA 2X0RA 4A10A 3H2ZA 1ULSA 3ULKA 1NWHA 2FN7A 2G1UA 3JQBA 4PG7A 4R5HA 4EGFA 3DWFA 3INRA 2AEJA 1PZEA 3VAZA 2VYND 1MG5A 1J0XO 1P1KA 3VKUA 2ZCUA 2BFPA 1AGNA 1QYCA 2C7VA 2JFHA 1AHIA 2Y0CA 2ZQZA 1Z45A 1PL6A 3GT0A 1QORA 1D7OA 3KYDA 1SMKA 4A27A 2B83A 3N7UA 2NTVA 2X22A 4LMRA 4R1SA 4RORA 4XQEA 3IDSA 1DLJA 5A02A 2GPTA 1PGPA 2XXBA 4Z9XA 1XDWA 5DBFA 5U9CA 2VHVA 3UHAA 4E5YA 2X9GA 2CFCA 3LT1A 1ZCJA 3FNGA 4CM4A 4MVJF 3DBVO 3PGXA 2G17A 4AFNA 2EG9A 3R0IA 3P5SA 2AQKA 1BDMA 4QX6A 2DPHA 3K8ZA 1ONNA 4MIOA 3JQ8A 5DCUA 4J7CA 5JMPA 2GNAA 1H9AA 1DIHA 4KZPA 1E0DA 4TKLA 3D3WB 3S55A 2D3TA 1PL7A 1UUFA 1GEGA 1D1TA 9LDBA 2ZB4A 4DPLA 5DT9A 1WVGA 3ICCA 2HSDA 2RBEA 2BFAA 5HS6A 3WQSB 2WE8A 5ENVA 3OMLA 2NADA 4RVGA 1I5RA 3PRJA 4CM9A 3TN7A 1UJMA 1ZFNA 4FB5A 1ZNQO 3WGOA 6ADHA 5F1KA 3I83A 4TZTA 4A26A 2Y05A 1YH3A 2YV3A 3E1KA 1HSOA 4N5MA 2HKIA 2Z5LA 5ITVA 5A1TA 1PJBA 3NDJA 4CQMB 1EDOA 1G6KA 1LBEA 4J1TA 1C1DB 4UUOA 1KEWA 1N92A 2Q50A 3U4HA 3DAGA 2VWGA 4X54A 4Q3AA 1HDZA 4N18A 3TRIA 4ID9A 1R0KA 3O8QA 1LDEA 2HUNA 4J1QA 3GN2A 5IZCA 2WTBA 3I6IA 1UXGA 1MFZA 4DMLA 4PVCA 4UUNA 3KVOA 2I76A 3JQAA 1EUDA 3PZBA 2BFOA 2DPGA 2PGLA 3RC7A 2ZIZA 2QZ9A 3GFBA 2D2IA 4NJOA 4NBVA 4RPLA 3F1LA 1ISHA 1V6AA 3DHNA 4CM3A 4LMPA 1NR1A 2FZEA 3E9NA 1ARZA 2OORA 3LQFA 4TMFA 1ENZA 3QWBA 4KUGA 1HTBA 2O3UA 1DFIA 3GFGA 1YXMA 4RPKA 1PGNA 1U7HA 3HDHA 5JW6A 1B14A 4W6ZA 2ET6A 2OFPA 1GQYA 3JQ6A 4J49A 2TMDA 4Y67A 2CVZA 2X0IA 4UREA 3S2FA 2VNSA 1P31A 3G1UA 4BNGA 5FI5A 1LSJA 3I1JA 1Z7EA 1N1GA 3ST7A 2EW2A 4YR9A 4HUJA 2GN6A 2Y68A 3SVTA 4PZDA 4RLSA 1LJ8A 2GD1O 4R1NA 1UDBA 4BVAA 2O7QA 1O9BA 1W0CA 1VL8A 1M6WA 1XWFA 1A72A 2HMVA 2VRBA 1JWAB 2J5RA 3PPIA 3B1JA 2AMFA 4RDHA 3EHEA 1A27A 1R66A 1CDOA 1QMGA 3CZRA 4XIYA 3F4LA 1WXDA 1GUYA 3DDNA 3RSHA 1EZ4A 2GN8A 4DIBA 2CUKA 3T7CA 3E82A 4FGWA 1VJ1A 3X2FA 5JCXA 4KWHA 1EDZA 3U4CA 5ER6A 1YOVB 4OO3A 3AI1A 3CMMA 3ASVA 1DBVO 2O4UX 3ZN2A 3CIFA 2CNBA 1K6JA 2VN8A 2VHWA 3DBRB 3Q3CA 3SJUA 4J1NA 1XEAA 2EKQA 1PGJA 1X14A 2I6TA 3OQ1A 3ZHBA 3OJLA 4CM9D 2R2GA 5U4QA 3GZ4A 2J3KA 3KLMX 3TOXA 1A5ZA 2IZ1A 1J5PA 2OBYA 1PJQA 1ENPA 2NACA 4E5KA 1MXHA 4EW6A 2OL4A 2RCYA 1E7YA 2R6JA 2PD4A 2DVMA 3EZLA 3JQEA 1EE9A 3Q2IA 2B5WA 4DUPA 4IXTA 2QW8A 1KEUA 1UXKA 3W4KA 1WMBA 2V6MA 1X7HA 2EIHA 4CM7A 5G4LA 4Q3BA 1U7TA 4YQZA 3X2EA 3JQ7A 4IMPA 4L4XA 3OSUA 1YS4A 3AFMA 3I52A 5K9ZA 4KDFA 2YW9A 4K1LA 2I65A 3C7AA 1ORRA 4C4OA 2AHRA 2POQX 3WXBA 5EMHA 3HQ4O 1PS8A 1ZXBA 1IPFA 4KTTE 1WNTA 1ZZEA 1XIVA 3HB4X 3JD4A 4IDEA 4CLOB 4Y8VA 4MP8A 3CTMA 1JAYA 1ISGA 3JQAD 1DC5A 3UCFA 2QZZA 1EUCA 1JKIA 2AQIA 4E32A 3LDHA 3GPIA 3TL3A 1K5HA 2Y67A 4XQCA 4AJIA 3ANLA 4WLVA 2EHDA 3BMOA 4MIEA 4ALJA 4CV1A 4FR5A 4F6LA 1EE2A 3SX2A 3GLQA 2W98A 2AXQA 1U3VA 5BSEA 2XPCA 1ISIA 2WM3A 5IN4A 1WZEA 4IUYA 2V6BA 4W9NC 3ZHXA 3FNEA 1YWGO 3OEWA 1Y5MA 3TFQA 2A35A 3OQ6A 4YT2A 1MP0A 4A7PA 3S1LA 1X0VA 3AI3A 1PX0A 5CHEA 4BO6A 4ZVVA 3QWFA 5TLSA 1QR6A 2EEZA 3OM9A 1EBUA 1Y8RB 4RF5A 1ZH8A 1JVSA 3OETA 1PJLA 3C1AA 3O9ZA 5COBA 1I2CA 2LDXA 5LCXA 1LRKA 3KTDA 4UUPA 1V0JA 2UUOA 3M1AA 4A73A 5JDCC 5KVSA 4KQXA 3ORFA 5A9RA 3ON5A 2NQTA 1MA0A 1FK8A 1XQ6A 2PV7A 1M75A 2FMUA 2YQ5A 5F3RA 1X7DA 2GR9A 4R16A 1HF3A 3NT5A 3TZQA 1O0SA 2Q1SA 4DIOA 3LC2O 1XKQA 3OFSA 3BYZA 4UVIA 4PCVA 2FHSA 1LC0A 1U8FO 1X0XA 1ADFA 2WJPA 4NZ9A 3V2HA 3FPLA 4BO0A 4EJ0A 5ICMA 1GPDG 1V3TA 3N74A 1N9GB 4WNIA 2O2SA 4IGEA 5HWSA 3JD3A 3RC1A 2ZJ1A 4MOWA 4B3HA 3DEYX 1CIVA 3CXRA 4C7KA 2O4CA 2VNAA 1HDOA 1JU9A 4D46A 3KO8A 4IBOA 5CEJA 3OICA 4E4YA 3PWZA 1IZ9A 4CL3A 3GPDG 3ONEA 2O7SA 3U0BA 3HE3A 4CM8B 5CPBA 4XQGA 3AI2A 4B4UA 4S1VA 1PZFA 1LSUA 5ER9A 4E0BA 1XLTA 4CQMA 4NK5A 4BV8A 4YT8A 4MKRA 4AJHA 3EDMA 1JTVA 3H2SA 5JCJD 1IY8A 1GZ3A 3H5AA 4MVJM 4NBUA 5EERA 3C1OA 1HYHA 4E6PA 3FR8A 4B3IA 3GZNB 3E18A 1GV0A 1E3WB 1X7GA 1L7DA 5L7WA 4HXYA 4TVOA 4QUKA 4IDAA 5MGBA 1ZO8A 1P45A 3KV3O 4KWIA 4PG4A 4DBVO 1RJWA 3FBTA 1NPTO 3HB5X 4L74A 5FF9A 3JCZA 2RAFA 3PTZA 5JO9A 3Q6IA 3GK3A 3OF2A 4OQZA 1KERA 1U4OA 2AE2A 2VT3A 1HZJA 4ND2A 1E1LA 3GUCA 2AG5A 2X6TA 4GQAA 3HWRA 2X0JA 3ICPA 4XYEA 5JNLA 3L6DA 4M55A 1ZK0A 2PWZA 5DBGA 3QRWA 2O3RA 1M76A 1O94A 3U4DA 5L4NA 4OHUA 1QLHA 2YYYA 3L0DA 3ZNPA 3GVIA 2QRKA 2JFGA 3D7LA 1P74A 1R12A 4WUVA 2C07A 2Y93A 1E7SA 4LISA 5F1OA 3RBZA 2QQ5A 3ZWNA 1G0NA 3O4RA 4I08A 4H7PA 3VH4A 2EWMA 2Q4BA 3PJEA 1ENOA 2V6FA 2O23A 5H82A 4BUCA 4CMKA 1EQ2A 5LC1A 1OC2A 5T73A 2EW8A 4YJDA 2HRZA 4HKTA 1KOLA 2NVBA 4YJGA 4WOJA 3NGXA 2EJWA 5DZSA 1NTOA 4L4RA 4ZICA 5C3MA 2C0CA 2AA3A 1LDYA 1DEHA 3ZU5A 4XYBA 4NU6A 5AOVA 4NBWA 1C0KA 2SCUA 5KIAA 1AXGA 4CM4B 3H9EO 2PKRA 1EMDA 2Y66A 1ZSYA 3HDYA 3GF4A 4PG8A 3GRPA 1U2DA 1UXJA 3VC7A 1GCUA 2ILTA 4Y6RA 4CUZA 2ZB7A 2X23A 4ALMA 3DBRA 5F5LA 4M86A 5TF4A 4BNXA 1BDBA 4JN6B 1E7MA 5A06A 3EC7A 3ETEA 4J43A 3MJVA 4NK4A 3GC6A 3K9QO 1T1SA 4IJVA 2P5YA 1YQDA 3HN2A 2Q1WA 1U8XX 3WYCA 1J49A 4BO7A 1ZK4A 2CVOA 2IXAA 2PH5A 3ZWBA 3ITDA 3G0OA 2YDXA 4BKQA 4FJ2A 4NG5A 4M49A 4ZRMA 3BAZA 1VI2A 1ZSVA 2PR2A 1Q7BA 4XZ3A 4XRRA 5JE8A 4ALKA 1SB9A 4CQMD 3UCXA 4Y6PA 4EEXA 4E13A 3NKLA 3ZU4A 4DQUA 1W6UA 1G0OA 1CYDA 4XX0A 3WFIA 4R3NA 1HRDA 2B5VA 1KEPA 2IZZA 2Q1TA 3H9UA 4YAGA 4QXMA 1FDSA 4CM1A 1HDGO 3GHHA 1WPQA 3FNFA 4BQRA 5HBRA 3O8QB 2DTDA 4RZIA 4BO2A 3E6AA 5TIIA 1W8DA 3DZFA 1B8VA 4E5MA 1DJNA 3BMNA 3WX0A 3H3FA 4QECA 5AXBA 2C54A 3KEOA 3ZWVA 4AVYA 2WYWA 2JKVA 2VQ3A
chains in the Genus database with same CATH superfamily
2A33A 4P6VF 2ZRKA 5DBIA 3K70D 2CD9A 3O0TA 5KVAA 4NFYA 1Y6FA 3T1VA 1KVTA 3HEBA 1FFSA 3EDQA 4KAXA 4ML3A 5EJGA 1NW7A 2CDAA 2IDMA 3QWAA 1T8TA 5I7FA 4KNYA 3OQOA 2R00C 2PGIA 3OA2A 1CNFA 1TC2A 3F6RA 3U40A 4WZAE 3AT1A 3O3NB 3KR2A 4GXNA 5EKTA 3BFVA 4XJXA 4IIFA 3TCXB 4IFEA 3FWKA 3EH1A 4CKBB 4F3NA 4N5IX 4GOKA 4QATA 1P2SA 1KMCA 2M9MA 4FJ1A 3K9LA 4NZMA 3CB2A 2I4LA 1XTKA 5IP5A 1ABBA 3IT2A 2XB2A 1DLIA 1OFIA 4F6RA 1Z8NA 1M2WA 2JJQA 4B3FX 2JGDB 4A0QA 3AUAA 3WGGA 1YB5A 4DLVA 1YB4A 3DLBA 3KZCA 1AQIA 2J9ZB 4Q9DA 3SR3A 3TZHA 5A3VA 3G0GA 1HTWA 2DBZA 4D9NA 1NW6A 2UYCA 1USGA 1QIMA 2J46A 3IODA 1VHJA 3O21A 4ITUA 4Y0NA 3U1TA 1MIHA 4K03A 3PA8A 1JUDA 3VU1A 3CPHA 3MWLA 4NBSA 4U9HS 1RBMA 4U63A 5JO0A 5JMWA 2G7MC 2R87A 1JFRA 3LKBA 4KK3A 4CI0B 3RBVA 2PBLA 3DLIA 4R8MA 3BMCA 3VR4H 4BAUA 1MU0A 4LQ4A 1WMAA 2VRNA 3BQMB 4KXMA 2H7CA 3KOUA 2CUTA 1DDOA 4BTLA 4OHYA 1PEYA 4LMBA 3NASA 3PZRA 4JI3B 3T5TA 4C0WA 2VI5A 3OWXA 4L72A 4FB4A 2PDAA 2C78A 5BRAA 1GR0A 3HSKA 3WQBA 1N3LA 2P1ZA 1HEUA 1C29B 4L6IA 4C9BA 5BVGA 3ZHUA 2OP1A 3BRQA 5F9FA 4ZOAA 2BUCA 2FZLA 2IXFA 1VP3A 1IBMB 1FX1A 2R4UA 2YWBA 3PFNA 1V1RA 2NU9A 1EGHA 3SQDA 2HA5A 4B7CA 3GUUA 3LT2A 3WBJA 1LF0A 3RFTA 2P77A 4I5FA 4JJAA 4MQFA 5FBVB 2OFXA 1L5HA 5LQUA 1VCMA 3FROA 4FMDF 3I37X 3NGLA 3RKSA 3V00A 3NAQA 1TYEB 4RS4A 5JMTA 3SQWA 4PZCA 4PNEA 1EJ2A 4LOLA 1L5OA 2ATVA 3O26A 4D98A 5K6AA 4PLFA 3ITEA 1ZR2A 2YY5A 5KJFA 3B12A 1M34A 5FADA 4ZMSA 1NDQA 2AOUB 4E70A 3GLIA 4ZO4A 4A5OA 1AGXA 5M29A 1U3UA 1HYGA 5IARA 4PO8A 4S2UA 2YJ6A 3E7XA 3O4VA 2QUIA 4ZO8A 1JFFA 3T5BA 3H2HA 4I9UA 5EPEA 2W6QA 3A9SA 4URYR 1FDWA 1L4MA 4U2GA 5ENDA 5K03A 2OCYC 4ZANA 1GQFA 4DPKA 3EG9B 1MC5A 3LBIA 2XZTA 2Z6UA 3R40A 1GL9B 3CR3C 1R5JA 3MWYW 4U7GA 2HFJA 3SS8A 1OZ0A 3H5NA 1JPNA 2QR2A 4KXUA 4D9IA 4J2HA 1LX7A 3BWYA 3DXFA 1V3UA 6GPBA 5CYFA 2I4RA 4BGUA 5EHIA 5H5JA 3V1LA 4YT4A 4X84A 4DADA 3EUWA 3PNSA 2YWHA 4IF6A 3C8HA 4EQ6B 5B36A 5LZ7A 1KRXA 3E8XA 3STXA 5I8WA 3TZ6A 3F5DA 2FNAA 2YFYA 1J7JA 3QLEA 1VE3A 3UXEA 4E33A 2QUHA 4R4JA 1PN3A 4DQDA 2NU7A 1UP4A 4YCCA 5I51A 4YB8A 4GKJB 3BA6A 4LOAA 1OYYA 4P7JA 2V5UA 2REQB 1EIWA 2BUBA 5SICE 3SHQA 1OLUA 3BILA 1FSZA 1TAGA 2W2KA 4QXQA 1QP7A 4FFWA 4Q6WA 5TQVA 1Y3CE 1YS6A 5DN6A 1OAKA 3SKYA 3UPTA 4Q7MB 5B2ZA 3NR2A 3A4TA 3VHXA 4J16C 5LNK6 1E66A 2I7XA 2GXQA 5G0UA 3AHHA 1V5EA 4MIKA 2HRDA 2JBHA 3IUQA 4AJJA 4E51A 4UBOA 3CRW1 2PTHA 2Z5FA 3RU9A 4QD3A 3RYFA 3V6LA 2VDQB 1GTG1 1VHLA 1WB5A 4F2HA 2HIHA 4YHBA 3H1TA 3KJZA 4E5UA 3ZWCA 4D8YA 2YC2C 4LA4A 4YPFA 4ARVA 3U60B 3ADDA 4NS4A 4LJKA 4ZCRA 3K9HA 3FA2A 5C1BA 3GWGA 4UEQA 2WKPA 4O4HF 2I5PO 2G1AA 3LUKA 4R01A 4DJ5X 3T0GA 4IGFA 1U8AA 1O3YA 2FY8A 3DDHA 4UZSA 4KPGA 1MT3A 3CUTA 2EXXA 4QEZA 1VG9B 2QRQA 3NHKA 5JBNA 3MTGA 2D8AA 1B6SA 3DLAA 3FYCA 3CRZA 1HETA 3R24A 4KN8A 4UU8A 1RBQA 3EP3B 4UDYX 4YJKA 2EJBA 1C0PA 1R27A 3GMTA 2HLNA 3L3BA 3GLTA 5BYJA 3RSSA 2BV3A 2PT6A 3SDSA 3UG7A 2FOLA 4HYQA 1J2YA 1ICEA 3K8OE 3O03A 1RAFA 1DBQA 1QHHA 1XTUA 2G5TA 2QA5A 2ATEA 2BCGY 5EJAA 1VPEA 3KT6A 4EATA 5JQGF 5JJKA 1UIRA 2PR7A 1BRMA 2OECA 3PXUA 1Z6PA 3PHIA 4CTJA 4UNQA 3W1VA 2NP6A 3LMKA 3TNFA 5TRTA 3R23A 1MJGA 3VJRA 2PAFA 4M9CA 3UJNA 2JAPA 1YE8A 2OZEA 1TW2A 2NU6B 3BGWA 3DYVA 2QRPA 4J0IA 2P9BA 3ROEA 4RTMA 1NN0A 4B0OA 3L6CA 3VYVA 1T36B 2LRHA 3ZDFA 5A05A 5U1PA 1Q19A 2RHWA 5AR1A 4D9CA 2J9RA 4GSKA 3PHHA 4UCFA 4ZXFA 2VQ6A 3JVUA 1QK5A 4JMPA 3ENQA 2Z08A 1L7PA 1UFRA 1NRIA 2VOEA 3T38A 1QHIA 1JRLA 1SHUX 3EVNA 1U94A 1TI7A 3U4QA 2Q22A 1JDJA 4UVHA 1OAAA 1OZGA 1YB1A 2PLAA 2WWFA 3CRMA 4IMJB 4JVOA 4QC2A 2WHEA 2E89A 1IDOA 4DBZA 1M8FA 2XF8A 2QPLA 2VF7A 3ZQUA 4G09A 4RZHA 2DLCX 2VH5R 4YLEA 4LJ9A 3LBFA 1F14A 1E77A 1UBLS 3QG5A 1HFWA 1KRHA 4ZHSA 2P91A 4TLMB 1SOVA 1VPVA 3OPMA 5ALHA 5I9MA 4BMVA 1HL3A 2BVNA 4C5BA 1A2QA 1QE3A 1OYWA 3TR5A 4G4SP 3JZIA 3R75A 1YFJA 1ZNYA 1WSBA 1W35A 2BFCA 2AYYA 1VPDA 3A27A 1SHKA 3HYNA 2O9JA 1Z9BA 3TSAA 5I9NA 1VLMA 1YASA 2BGLA 2CL0X 3HXMA 2NSDA 3QMMA 3N8IA 4KIGA 1DMSA 2F90A 3PG5A 4OUDA 1IUNA 1OR8A 4JBXA 4PGHA 5LUAA 1QGUA 2H4JA 2IYNA 4ND1A 3GJZA 1TQ2A 4TRMA 4BNTA 4LW8A 3O8OA 2ZE6A 3MWGA 2RKOA 3GAZA 1EYZA 3CLVA 2OD7A 3LX5A 4F3KA 1UXIA 2V7WA 1HURA 4M1TA 1U7XA 2IZ0A 4TYYA 4RA6A 4C88A 1N1EA 4YX9A 2LP4Y 4DLZA 1B00A 3FHTA 3W06A 4KCGA 2IX3A 4G2TA 4M8KA 3ZI0A 2DE0X 2PVPA 4TTIA 5L9AA 2O19A 3GVHA 3M70A 2UZ0A 1S2GA 4HNQA 3RS5A 1M72A 2B4KA 1JZQA 1J8DA 1FPMA 1J09A 1TQHA 4RMGA 4RPHA 2G28A 5IDWA 1TMKA 2W2PA 1L5KA 5KKAA 2NU8A 4OATA 1ZUD1 1HWYA 2ZIEA 3WR5A 2WE7A 3IIIA 5LQCA 1D9XA 4B3GA 4NH4A 1F06A 1F0KA 1XD2A 1F17A 3KTOA 3Q6NA 1E1NA 1LS6A 4AS1A 3PQDA 3WDKA 4ALLA 2C4TA 5GINE 2QU8A 4PC2A 4YXFA 1FLVA 4C5AA 3ROGA 2VZ9A 4B2PA 3OPYB 1GT91 1XLVA 4BNIA 3SBOA 3DMNA 3UY4A 2FP4B 2HR1A 1RWBA 4P7KA 4WRRA 5KYYB 1TPYA 2O05A 3LX4A 2OILA 4MI9A 5E6UB 1J33A 4LNUB 5F7ZA 4BMXA 3ETLA 4I50B 5DOVA 3S2GA 1P3JA 5HF5A 4P8RA 1Q11A 3CJRA 2BGIA 2DUUA 1ILWA 1PW5A 2B8JA 4HATA 3E84A 2JGLA 2C7BA 2JATA 4Q12A 5ELMA 3HYRA 1RVV1 3OJXA 4GNRA 4PPFA 1L1RA 1D4AA 3F5QA 2I4OA 2JLXA 4CZ2A 3JVVA 3S3TA 4XCVA 1II8A 2NX2A 4P22A 1J97A 3U9TA 1J7KA 4OHMA 4R8VA 2CNKA 4U6SA 4UHHA 3MWEA 4PLVA 2NXCA 1VGVA 1Z12A 3IXLA 2CC2A 3AJRA 4J3FA 2YIVX 3FZYA 2DTEA 4B31A 4DIKA 4DUYB 1FMTA 5A3JA 4FYVA 4YO8A 2YWFA 4NX2A 1TYZA 5JATA 2LCFA 4DE5A 5JYDA 3LA6A 3MYYA 4OOEA 1U3WA 3DXYA 4WCFA 1C7JA 4GOXA 4OJNA 1D4ZA 2IPAB 1P60A 2XDQA 1X1EA 5CXXA 2GEDA 4E22A 4BBAA 1A88A 3K1ZA 4YRNA 3QNWA 1HX7A 4YQEA 4K81B 3BOSA 3P0EA 3ZJUA 4PRKA 2ID7A 3IDOA 3MLEA 4WPGA 3PQCA 4FWTA 5BPHA 2IT1A 1ZHFA 4O89A 3MCWA 1IIRA 2YZ7A 4LZZA 3BMNB 3TX2A 1VKHA 3SZUA 1IEVA 1NVTA 4R9NA 1OY1A 2H92A 1AO0A 3NV9A 1U4NA 3R5XA 4D0RA 1G4HA 3QEBZ 1X42A 2JFNA 3EMVA 3NONA 4YJ3B 4M1MA 5FWXA 3UWDA 4L1KA 1H5UA 1MIOB 1ULAA 1FCJA 3AO0B 4D9KA 1S3FA 5C53B 3U81A 2JAOA 3KL4A 2I2CA 4M0PA 4RMNA 1ATZA 2C96A 4JEMA 5H83A 4Y2PA 3WBBA 2QP3A 4UTXA 4AZVA 2AN9A 4GLLA 4X7MA 1KQ3A 3FFXA 1SG9A 1XWIA 2GEUA 1C7ZA 3ZV3A 3HUDA 4DJTA 1Z5WA 3A1DA 1JDSA 5AI8A 3R0ZA 3PGKA 4OIFA 4Z4HA 5JEDA 2RGYA 1I2DA 1Z08A 2GNOA 1SD1A 4TYQA 2WYHA 4LGYA 4WBSA 3SEZA 1QXSA 4RZSA 3ZHRA 3A1EA 3C45A 1ZONA 1P2GA 2EX4A 5G0VA 4LN1A 1F8FA 5JSQA 2QLBA 5EVCA 1DPGA 3QJGA 1YHNA 4EO4A 3ZPXA 3E0XA 1SXQA 3LTEA 5BN4B 4ZVOA 1C30B 3MJ4A 2GTHA 2JH9A 5ALZA 4X8LA 1FU4A 3UKJA 1GGNA 4FNOA 3EWIA 2DERA 1FXUA 1J4AA 2R96A 1P8JA 3KDAA 4B4VA 1T8PA 3IO3A 4G1FA 4MW1A 4G26A 4TSRA 4RD3A 5ANRB 3IIKA 1ZBDA 3KR9A 3KBBA 3UZUA 4J2TA 2X6RA 4C4PA 3PLNA 4DM3A 5KX5F 2V7GA 1JLLB 1NLUA 1Z15A 2NTEA 3KBOA 3OPQA 3EZFA 3I39X 3OEYA 4X91A 4TYNA 4QUGA 1REQA 2P68A 5CYGA 2EC5A 2BGKA 3I2IA 1L8XA 1BQ4A 1FTQA 1FRFS 1TCCA 2J9GA 4M2LA 3HL4A 3A26A 2IUUA 3Q85A 2BBWA 5EMMA 3SCZA 4TRJA 2HPZA 3DT9A 4BB0A 1NIPA 4ETMA 5J1SB 1GP2A 2ODAA 4NONA 5AHKA 1KO7A 1KAMA 1W0JD 2VFAA 4ABTA 1NPYA 2APJA 2OMKA 3C7CB 1XL1A 4Y9DA 4CLDA 1YQ9A 3RKUA 2YRFA 2PUFA 1DOZA 1S0UA 3KD2A 2QPOA 5IBPA 5LZ8A 2YHIB 4YLGA 1XR3A 3OQPA 3QF4B 1SCNE 3VYUB 1WDTA 2DRIA 1H6DA 1WDKA 2OXCA 1ULZA 3D54D 3V2GA 4BX8A 3AY6A 4CIXA 5K4HA 1QB7A 1RZRA 4HPWA 2AFHE 3F4BA 5A1JA 1C7EA 3D3NA 4NYJQ 4UMDA 5I7VA 3B3QA 4IWYA 3I9MA 4DGSA 3SEQA 4MH0R 2C57A 1JU4A 1YMQA 5B7PA 4UM9D 4X8MA 5D3KA 4V0QA 2R11A 4LKOA 2A9VA 2EFGA 2QD1A 3W8EA 3O75A 3HJFA 4DIFA 4YP5A 4GKVA 3G0CA 3DMFA 2PLFA 2BM0A 1Z0ZA 2XCUA 5LOVB 3J7AC 4NDZA 4OHXA 4GBJA 4ZK6A 3NTRA 4JI1B 3A3PA 3AONB 2W5UA 3Q11A 2ZJ0A 3FYUA 5CDTA 3RV4A 3DYIA 1ULHA 2Q4EA 3Q9LA 4CWAA 2D2XA 1SGWA 2YUIA 4JYMA 4OY3A 3WLEA 1FFAA 3H1FA 4D4MA 2O5EA 2WDZA 5KTRA 3O9VA 4NNOA 3UA4A 3MN1A 2UAGA 2B4RO 4ZD6A 2JFQA 5F7JA 3CISA 4DLXA 2Z6AA 4B3MB 2ZJFA 2FPPB 3MW8A 2X5OA 4HQ0A 5ISMA 2QRVB 2GYWA 1F0NA 4G0UA 1Z07A 3N75A 2DR3A 2F8LA 3AF3A 1FYVA 1GU0A 4FZJA 6REQB 1N2EA 2JLQA 2GA8A 1R0SA 1ADGA 2Q9UA 3GH1A 1I1OA 2PJDA 4ZOCA 2RIPA 2H1VA 1RLOA 2E5FA 3JARA 1Y98A 4DLUA 2IPNA 2FTKE 1IWBB 3BHMA 2A57A 4WESA 1PVDA 3E22B 1UWLA 3JRNA 4LJ8A 4W7HA 3BIOA 1E2PA 2C5GA 3EGXA 1WV1A 4Z9FA 4LTMA 5ALXA 2CEAA 3RAPR 3OLQA 3V4PB 4D45A 1M5RA 2JIOA 4H0NA 4EZBA 3RASA 3L7DA 2BFFB 1JDBC 3IRVA 4ZU3A 1Y8ZA 1L7QA 2PFKA 2CY0A 4QYIA 5E2AA 1QKJA 1JIJA 1Y5LA 3DGFC 3F3YA 4IFBA 4IG9A 4PCAA 2AOTB 1JJBA 5A2GA 4OD0A 3OZCA 1JA1A 2P62A 4CM6A 4EYOA 3RU7A 2JFYA 3GUZA 3TM5A 4UNSA 1NVBA 2C84A 4BV9A 2G07A 4MCIA 2L18A 2V0NA 1FY2A 5JJCA 2YJZA 13PKA 1Y3DE 4QPCA 3GGDA 3F9CA 4MVJA 4S3MA 5F7OA 2ZBDA 4GOOD 3LFTA 5K8TA 3HKCA 2NWQA 5FT9A 4PTLA 4R8RA 4DIEA 1BMDA 1NVAA 5KQSA 2B34A 1ZRHA 1PFYA 2BFDA 2JGEA 2Z9DA 4XM1A 4XFDA 1F0YA 4XTCS 1UBGA 2X40A 4CF5A 3BB3A 1SVIA 2OQRA 2DR0A 3PRKE 5CURA 3HR7A 5IXSA 3I53A 3NVMB 2VDKB 1KZ1A 3DDZX 1E0JA 5CA0A 2EKDA 1ZXLA 4XARA 4DLSA 1ST2A 1EVQA 1OJLA 1YDGA 3NAMA 1J00A 4OB8A 2FZ5A 4WXYB 4YALA 1KL7A 5FEMA 2CZGA 3KDSE 5A4AA 3ZDCA 3HXPA 4QVIA 5H70A 4GS5A 1KYTA 4RYDA 4ZHQA 1FNDA 2JEZA 2A4KA 3H6GA 3I6QA 3LQ1A 5EEHA 3I9LA 3NBYC 3NYQA 1WP9A 3OIGA 2JI6A 4PLCA 1N8NA 3N39C 2ZS8A 3TQOA 5AUOB 3UT6A 1P2BA 4JK3A 3TLGB 3U7IA 4ETWA 1TQ6A 3AX6A 1QKIA 3LX8A 3K0SA 1H9CA 4LOKA 4EG6A 6CHYA 4JQYA 1N0VC 2A1IA 2OUIA 3WKAA 2PGDA 2B1JA 1UJ2A 3W8DA 3SDZA 1NMXA 4PQFA 5AKEA 3E81A 4BB5A 2PZBA 1E60A 2ZRFA 2YV1A 2H07A 4FXPA 1A2KC 1ISPA 1KVUA 1XEWY 5I8PA 3PC8A 3E1GA 3OIFA 3D59A 3ESBA 1RRVA 2JAQA 4HGQA 4XI9A 3A25A 3ECSA 1CVIA 3HVKA 3UOGA 1L8OA 4LF6B 3LL4A 3TAXA 3VOTA 3GRVA 2IDKA 3O93A 3ZBQA 1PQWA 1W5AA 1YC5A 4G5FA 1NBME 1PEAA 1OI7A 3DL2A 2DFPA 4KOEC 4Q4JB 3R3ZA 4UPEA 3U13A 4ZI2A 3E15A 1ICIA 1LH0A 3Q7RA 3QF7A 2JEOA 2VDUE 3JW8A 5C32A 2OCXA 1QG6A 5KSOA 5DKFA 4I1UA 4CMIA 3WMRA 3CLSD 1SWVA 3BBLA 4HH4A 5DVZA 5EE5B 3EVTA 3WNZA 1XKXA 3JZDA 2QNRA 2FF5A 1BFUA 1JG2A 3CZCA 3S0JA 1A8UA 4KVFA 2C5FA 5TSDA 1OAOA 1RXEA 1HYEA 2XY4A 2HBRA 1EEHA 3KV1A 3O1JC 4RLHA 1GDDA 4X9XA 5KYKA 2WPDA 1G8SA 3MINB 4JITA 3FF1A 5JFTA 1VJTA 4PRLA 3A0UA 4QDKA 3MUFA 4O1HA 5L40A 2YUTA 3HI6A 4GM0A 4QO8A 2VJMA 4RY2A 3TNDA 4B8WA 4YP0A 2L82A 1N5KA 4F85A 1WXQA 4P08A 2G06A 1BVHA 2XCQA 2YWXA 3L5OA 3Q10A 1LQUA 4FQ8A 1L1FA 2G8LA 4S1TA 4I19A 5IJ0B 1X8XA 4RKYA 3MWKA 3RFUA 4FI3F 2EF1A 3H6KA 7YASA 4C2BA 2QD5A 3M5DA 1T8UA 4DIMA 3CF4G 3TQSA 4RV5A 2PKEA 3MMSA 1H4QA 1ML3A 1PD0A 2Y1XA 3N07A 4Z3DA 4G1EB 4IYJA 2B20A 4J0EA 1T6BY 1DX6A 4ZYUA 1UC8A 3WC4A 4R5MA 3UPDA 1YRHA 1RXCA 2FMKA 3SJCA 3EMKA 4OA5A 1ANKA 2W2NA 4KUHA 1YRLA 1OLSA 3VYWA 4EA8A 1VIVA 4TUYA 1OVGA 1Z2AA 3A2NA 4BN4A 2AI1A 5KCZA 1Y34E 1JQEA 1G6OA 4DPMA 3DLTA 3V8NA 2VUTA 2XA1A 3LK7A 5JJ5A 1PNTA 3X1KA 2B4TO 5H68A 2DWQA 3UN1A 1PHPA 4EVIA 3B6EA 5A3SA 1JG4A 1ZDMA 5JS7A 4JB2A 1N6KA 2GK6A 4XB1A 3C7KA 3FHLA 1ZWLA 2DUWA 1R7RA 2WF6A 3A6PC 1Y4DE 2AV6A 4CTNA 3HI4A 3EHDA 3RC3A 3L06A 4DLNA 1J5EB 2Z83A 5FPYA 4H1UA 4A8JB 3GLUA 1HZZA 2WTXA 3O4IA 4OGKA 1OLXB 4F3YA 1QTNA 4BKOA 2GETA 4JI8B 1MO2A 5LFAA 3BN3A 3LOQA 1Z3IX 3ZXXA 5IJZA 3UFXB 3ND9A 2ENWA 1DXOA 4IW3B 3EVZA 2W2LD 1G17A 2HRQA 1KWGA 2H29A 4I3FA 3VPSA 2CF6A 1KJIA 1O5OA 3NWBA 3X1XA 3TOSA 1XNHA 4UVEA 3DMRA 4XH9B 4BLOA 1N2CE 3C5VA 1SJ9A 1JQBA 4ZC1A 3TLJA 4QU0A 4ZARA 4CL8A 1MAAA 2HA3A 4DVGA 2KW5A 2EJTA 2NSHA 2ZYDA 1V95A 1EFAA 1EWKA 1SVKA 4X1IB 4Y6QA 2M32A 5HTKA 3TLYA 5L7TA 2I54A 1L9KA 4DLBA 3P4XA 1QDUA 1EJBA 3G7NA 5EINA 4PN7A 1SG6A 3H84A 4TMTA 1WSWA 3ZCXA 1P7PA 4JR1A 3RT9A 3ZHSA 1P1RA 2FGKA 3VTKA 4NCNA 2OLKA 4MVJH 1CB0A 1IEWA 2G08A 4D5GA 1L4HA 3GNSA 2JIPA 1QRDA 1A9ZA 3LSYA 1X1DA 1YJ5A 2HBQA 3PHGA 5EJ2A 4L8WB 5FTNA 3G79A 1QC5B 5IH3A 4G5GA 3RYHA 4HWOA 3RBAA 3FDZA 3NTUA 4EGSA 5K01A 1I5EA 3DCIA 4IQ4A 4LXUA 5GV8A 4AS2A 2JBAA 2RC5A 1YVEI 3P9QA 1FFEA 1AV7A 4G2NA 1TMOA 2MU1A 4M1OA 4EZEA 1G60A 1J6UA 4FFMA 3I73A 3ILVA 4ND4A 3ZGYA 4CTKA 6PFKA 3NH9A 4RKWA 4NL4H 1NL3A 1I4LD 3BEDA 1QQ5A 1YZTA 2C3PA 5D5HA 2OHJA 5L51A 4WEOA 2ERCA 2FWMX 4HB0A 5CYOA 3WL3A 3H2IA 4JLKA 3WGQA 1IB0A 5C35A 1CUIA 2GUGA 5EZYB 3HXLA 4RVOA 2Q0SA 3B1FA 4FEGA 3GX1A 3V1KA 2Y1KA 3LLMA 4A0HA 4KE7A 5F4BA 4IV8A 4F1KA 3GH3A 1V2GA 4MRNA 3AF0A 1RQRA 4LHEA 5ESWA 3RUAA 2J3JA 1S9HA 2J07A 3TIFA 2Z1MA 3M3HA 1LWOA 2PZKA 2YWEA 2GGSA 2HPHA 5LUBA 3WLNA 3SY8A 4BIIA 1OXMA 4L85A 3ZWXA 3MYRA 4Q15A 4Z4EA 1YIDA 4IV0A 1J0DA 3TK1A 4HZGA 2Q1UA 1U2GA 2W7TA 4QO7A 3EGCA 5KYUB 1XDGA 3EY9A 2BSQA 5JZVA 4FN5A 2HLDD 3BTOA 5CNKA 1KJJA 3BIFA 4I4TF 1ESNA 1PBTA 4X85A 1PJ4A 2Q2OA 3D4OA 3HDGA 3KB6A 1E1YA 4YC7A 1NG9A 3WYBA 3D8UA 3FVTA 5TGZA 4KDRA 1L4LA 1WKCA 2D5LA 2P2CA 3WWYA 1SKUA 3EFOA 3LBHA 3NRJA 3R6LA 4U2EA 4P3NA 1SIUA 4Y1RA 1W87A 5DNCA 1E98A 3DBLB 1JILA 3OU7A 1EFTA 1VTKA 5KKCA 4E3ZA 2WJYA 1N7GA 2ZZMA 5AUNB 3RJ5A 2FUNB 4G3XA 2XQKA 1P91A 3ESXA 5DYGA 1TOAA 4B47A 4OVKA 1LPMA 4AUMA 1JKXA 5DHUA 2P0AA 4TRNA 3FAZA 3RIHA 1YRYE 3ZXYA 1FFWA 2DX7A 1W7AA 4N4AA 2OCGA 2A9JA 2YNMA 1SU8A 4L08A 3EZNA 1YI0A 4E2XA 4XAQA 3DO6A 3M4ZA 5ALTA 5DCYA 4CKCA 6AT1A 1E2LA 1F2TA 2BY4A 2VDWA 2OOKA 4FCCA 5ALNA 3U09A 1S02A 4HADA 1GU7A 5C8YA 1QWOA 2XYHA 1HG1A 2N0SA 4QKQA 4YRBA 1RRMA 2OR3A 5J59A 2O0LA 1C9NA 3HSYA 1ACLA 1OGJA 2QTGA 3P97A 3TL6A 4B17A 1UOPA 2BT4A 5IG2A 2Z8XA 3J81A 3WLJA 1CB7A 1L4EA 3IBFA 3PWTA 2C61A 1FDOA 3QSYA 2J41A 4FNGA 2K2WA 4G9BA 4JP1A 3IP8A 2UZAA 1GRNA 1IK6A 2B3TA 2K7FA 1RSZA 3G17A 4PVDA 1CQPA 3QQ5A 4D5EA 2FVXA 1OH6A 1SIBE 5HX7A 1K88A 1PYGA 4URFA 1WEKA 4BGEA 4NJMA 1NURA 2JW5A 3H5WA 4NF2A 2P11A 1N4AA 3T3NA 2Z2KA 3KGDA 4HH3C 2QBYB 2E4WA 1V3VA 2PZMA 2KHZA 4FCVA 2C9YA 1A98A 1T2CA 4CMJA 1TTTA 4TV9A 1JQDA 1V16A 3UAVA 4DCCA 4DG8A 4LCEA 3R7BA 5ES4B 2GYVA 3EVCA 4QEKA 5T64A 8OHMA 4QYSA 2Y71A 5AW7A 3HB9A 3OC0A 2XZLA 1JA9A 3OJWA 3TF5A 2F62A 4RELA 4K9LA 5I4BA 4EF6A 1ZM4A 2W6ZA 5KUTA 1BTOA 3JTMA 1Y37A 2AMYA 3UK2A 3JS5A 2FPKA 1IFXA 2WU8A 3O4HA 2I7TA 3CW2A 2WFMA 4AC9A 4EB8A 1FB5A 2PX4A 4BWYA 4CV3A 1IATA 4BJHB 2P5SA 3VPGA 3QFTA 5MGNA 1OMOA 1CR1A 2G9VA 4NPCA 4G8CA 3C3XA 1EG7A 2CZQA 1YFKA 1SB8A 1AKRA 1Y8QB 2H3EA 4MA5A 3EVAA 3EBPA 3NC0C 5JVDF 5EE3A 5C1OA 2R7AA 1Z38A 2PX3A 3HU2A 4NQRA 4QEDA 1BXRA 1DCMA 1R0XA 4X6YA 2CT8A 1KDVA 1JB1A 3H2KA 3KRTA 4WKCA 1KH2A 1G5QA 3LT4A 3H05A 4E31A 3I32A 1H2EA 4TXHA 2ZTMA 5B6PA 3GT4A 4ZT6A 2N46A 3AINA 4OFZA 3B6JA 4F3TA 3LJKA 2JCBA 3R41A 1YZFA 4AY2A 2A5FA 1NULA 3OOYA 3HEAA 1W1IA 2CNOA 4N40A 3SJZA 4ZCTA 1TFRA 2NPOA 4WZZA 1GZ6A 3TZLA 3ABIA 2J5KA 4FTWA 4V0MA 2EDCA 2VHTA 5EESA 2X3FA 1LDMA 2Y1OA 4TKZA 1EFPA 1M1ZA 1TXGA 1XAGA 3EA4A 5EE0A 3RVPA 4DLPA 2ZSHA 3D6VA 1O6ZA 1OIXA 2DKFA 3NHMA 3OE5A 4OK5A 4ARCA 1U8YA 3ZXSA 5IM4A 2ZB8A 1U0GA 4PYOA 1KJ9A 3WI7A 3QV1A 4ME6A 1RPTA 3ITNA 2W6JD 5I8ZA 2J08A 2QG4A 5DHTA 1F8UA 2ZT7A 4C78A 1OILA 2F43B 1OD6A 3BMQB 5MFZA 2AE1A 1YCDA 1P7CA 1Q92A 2VP0A 3C4QA 3QFCA 4CV0A 4E12A 1Z74A 3PR3A 4TS4A 1YDMA 4HV4A 4CDNA 4S0XA 4MV6A 4LPKA 4DFDA 4ZTZB 1DFHA 3W5UA 2QU7A 3GUYA 2W6MA 4CU5A 2FFBA 1VP9A 2OG2A 4ILEA 1FP4A 2HSEA 1EVIA 3DLCA 1DL5A 1T35A 4FP9A 4OBXA 1J0CA 1QONA 2YXDA 1J8YF 5I7EA 1I13A 3PFGA 1SO8A 4Y2QA 2ES4A 4EW2A 2PN1A 1D2EA 2ZI6A 5UKDA 3ZWOA 3HRIA 2OO3A 4YCAA 4MHTA 3E0QA 2JVJA 3NHSA 5AK4A 1QPBA 3LLCA 3OURA 5B4UA 3WICA 4LXYA 4QHTA 2F1KA 3ACBA 3SR0A 1JSXA 3L7LA 2FPWA 1L4UA 5DLDA 5A62A 3ZCUA 5C9ZA 1Z5NA 2VCEA 4PSUA 2LIPA 1Y5IA 1Z37A 4YCJA 2WIAA 2UVDA 3LYLA 3HCDA 1AQ6A 2BPOA 1R37A 2RHMA 3MGKA 1FTYA 3N2YA 4GNKA 4BFYA 1TZCA 4C30A 2JLAA 4N76A 3PDIA 2XUKA 3ANXA 4RFSA 2H54A 3N86A 4NVRA 3QBJA 3HVRA 2Q3JA 4G5YA 1RPZA 2QMEA 4UXJA 1G20A 1QK3A 3PGMA 1DAKA 2CLSA 1HFJA 1DQZA 1JKJB 1SKQA 3A28A 3QP9A 1J07A 3M5CA 2RDMA 2DFNA 4HDSA 3MJEA 1QIFA 1XA4A 3UXMA 3OUUA 5EIHA 3CZPA 4HAUA 5HEKA 5HGJA 4JYAB 2PGNA 2O7RA 3P0JA 2G1KA 2OWEA 3BXZA 2VRWA 1RRFA 1UFQA 3H5TA 1TKBA 1PWZA 3LF1A 1O97C 1HH4A 1PR4A 2PKCA 3KJGA 4UVDA 5T41A 2LZ0A 4KU4A 1CE8A 3W6UA 3AMVA 3WWEA 1N0IA 2ZB2A 3ZNQA 3AEQA 5TS2A 4EVSA 4ZMBA 5CDFE 5DNWA 4I55F 2QG6A 3HCWA 3WLSA 4J6FA 4XJSA 1XNQB 3I23A 5KWVA 1H3EA 4DIDA 4NI5A 1VL5A 1KHHA 4P84A 4ZQEA 5I7HA 2E4AA 4GP7A 4EVRA 1LI4A 1QO0A 1R0BA 2ZKLA 4PAMA 4YVFA 1JKFA 5BN3B 1HNZB 4RMJA 3THXB 1M54A 4AG3A 4C21A 2UDPA 2YKGA 4LZJA 3QVTA 5AH0A 1DXYA 2FRVA 1M74A 1YUMA 4I1PA 2OK7A 4GLBA 1RZVA 1PIWA 3DDCA 3S29A 4XM2A 5JASA 1TB4A 2Z98A 3BF8A 2Q0XA 4RMIA 4O08A 2GD2A 1KZ6A 1VKOA 3D2AA 1YK1A 3LFHA 4PZPA 1O5TA 4H59A 1ZVMA 1QF7A 1SBTA 5FR1A 3GJ4A 3DDWA 2V7EA 1GOTA 3F6SA 4N5NA 2YFKA 3N2NA 4TX1A 4II3A 3K7EA 3UV6A 1U28A 2PMCA 5K6AC 4LE1A 2IWHA 1AM4D 4WCDA 3ZW8A 3GUHA 1AQJA 3RFFA 5HW0A 3JQFC 3HADA 3LI2A 3KEMA 3SYNA 4YUXA 1P80A 5NULA 3EOBI 3HO6A 3RSOA 4NPAA 4ZEWA 2PWBA 5EWMB 1XRSB 1EB9A 1IHYA 1A3CA 1FTNA 1I30A 1P6QA 2PANA 1KPIA 3G13A 2JI9A 4BZXA 2XR1A 1KAGA 2C2OA 3NHWA 2A86A 2VJLA 4PV7A 1ZN8A 1WR8A 3EOAI 4EHDA 3NPMA 2WSYB 1DKMA 4Z51A 1EUZA 2HI0A 5TS3A 2NUAB 1QANA 1RMQA 4KIUA 4Z9AA 5BMVF 5CMLA 3SSOA 3E70C 3PI6A 2E49A 3E03A 3RWBA 1O6FA 1RRCA 2CXXA 2BTOA 2WMOB 1I7CB 1GPKA 4LXHA 4MWTA 4ZT3A 3SLGA 3LCUA 3HUEA 5CFQA 1R88A 2FR1A 4NCBA 3TW3A 1EFLA 2XNJA 1YC2A 1U7DA 2FPIA 3R5HA 4GI2A 4GOJA 4UD2A 5GAJA 2QP4A 1DCFA 3U39A 5ALSA 2GJAA 1KVRA 1VXOA 4QXAA 5LP6F 1C14A 4GMGA 2JCGA 1QQ7A 2WTNA 3RHTA 5IZ4A 1CUAA 4ZRNA 4Z9YA 1ZJ4A 1BN7A 5BOSB 4RADA 1UJ4A 1Q1BA 3KKPA 2AHOA 3RVDA 2KYRA 3KZOA 3P52A 1KJQA 5EY5B 5F77A 1E2GA 4BKPA 1M33A 4IHQA 1Q7TA 4NHEA 1YZLA 1GZSA 2X41A 3AOEA 3LGSA 4J0FA 3K2BA 4M21A 3IEKA 3ROMA 2QTWB 3T7EA 5HUJA 1ZEMA 1P4RA 3QA9A 4Z7QB 1NVMB 1M3SA 1ZD5A 3EQ9A 3WSWA 4LWOA 1E2DA 2AN3A 2OM2A 2A9OA 4JLPA 4N01A 3W04A 4LY9A 5JV5A 1QV6A 4LK3A 1K9SA 5DHRA 2HWWA 2VXOA 2XYRA 1XEXB 1Z47A 3WWPA 2G82A 2PGXA 4KQ9A 3VR1A 4NFLA 2C9CA 2PBFA 3N7TA 1K7SN 3UEOA 4H7EA 3OTHA 2JGAA 5FHQA 2ZP1A 5TMEA 1US8B 5BWMA 4L51A 4EY4A 1UM8A 3GLFA 2LUOA 1IG3A 5JS8A 2VRCD 1Q57A 1STOA 1TD1A 3KR1A 1PKEA 1T13A 3FF4A 1E3LA 1RHMA 5LNK1 3ZCSA 5HK9A 1QYWA 4GKAA 2DETA 1VMEA 3CSDA 4WK4B 4N6NA 4JI2B 4IR7A 4DT1B 1Y7LA 2K7ZA 4B5KA 4IWNA 4ZT5A 1K98A 3IUMA 4WKOA 2I7DA 3NRCA 4UOQA 2VTEA 3WOVA 2DB3A 4MWEA 4W5QA 1WXGA 2FZVA 5K20A 1YZGA 4A91A 3ZI4A 1DG9A 5TJ9A 1JLMA 3ODPA 1DJOA 4G0XA 3G6KA 2CVQA 4DV0B 5C4GB 4I8IA 3C6ZA 5CFPA 3EPJA 2WJWA 3GCXA 3QUTA 3RSCA 1R8JA 4KP7A 3PC6A 3EVEA 1CIPA 3DFIA 4J9VA 2QS9A 3TOZA 4RTKA 2IGBA 3M3DA 3MJCA 4JVMA 3GLGA 3I3OA 1JENB 2DLDA 4C0JA 1YO6A 4Z99A 1W29A 1L4KA 4C2UA 2WPNA 5ECYA 3EDRA 1WUIS 4RVFA 4QUAA 1RBZA 2IYPA 1RWPA 2VVTA 1OX5A 3PIDA 4Y2HA 5CNMA 5ALOA 5KJ6A 4KR3A 3N6VA 5JD5A 1TAQA 1N33B 2BR4A 3SSNA 1IYZA 2ACEA 1Y42X 1SOWA 4MB2A 5CITA 3CEPB 3VSDA 3ZK8A 3HFJA 1W93A 1D5WA 5CX1B 4Z3OA 2EGGA 3D8SA 2HNKA 3UC9A 1LSSA 2QM8A 3K2IA 4O4IB 2LCQA 2H4HA 4GGOA 3BREA 3IJRA 5CIWA 4QUIA 4D44A 1MLDA 2ZGVA 5KCMA 1CFJA 4HP8A 5I9LA 2AJTA 2B78A 3KQNA 4HDOB 4FS8A 1N57A 2Z4TA 3ESCA 1E0AA 3E53A 4UM5A 5B1YA 2Z2YA 1BDJA 1NU8A 4DZRA 1E89A 3R3XA 3CNEA 2FZ4A 3C3CA 3ISVA 4K6FA 5C18A 4KXNA 4R9SA 4V2IA 4UFPA 4PYIA 1RYMA 1FVOA 2H5EA 1G2IA 1BYIA 3AL2A 4MINA 3MJRA 2WAMA 4MCJA 1A2OA 5K3FB 3I01M 3WLTA 2C5BA 4D0SA 4AZ3A 5K09A 1K3UB 1CF9A 5CH3A 5REQA 1Q12A 4WL0A 3FRJA 1D8AA 3OHSX 1U2EA 5JOQA 4US0R 1JEYB 3DT8A 3WQQA 3AESA 1JL3A 1NSFA 2CXRA 3DTNA 3GEIA 3UHJA 3IKVA 1HO3A 2FRDA 2CB9A 4HX2A 4MRMB 2B25A 2V7TA 3KG2A 3R7SA 4CKWB 1W59A 3PQ7A 4CF3A 5C34B 3MFQA 3H3JA 4D3DA 3C3JA 3CMCO 2B8TA 4EUEA 5JJIA 2CJYA 4ED9A 1RAIA 4AMBA 2JLRA 5EE1A 4XSVA 1W76A 2YJ4A 3DEZA 1TK2A 3NBAA 5KWIA 2HSGA 2HU8A 3HGMA 4WXEA 1HOXA 3PWKA 3U5TA 2Y99A 3WSVA 3ZU3A 3HP4A 2QRLA 3OX2A 3PVCA 1C3LA 3BL5A 3EZXA 4PSCA 3RUHA 3SJ7A 4KO2S 3Q8MA 2OAQ1 3VYRB 1XTZA 5HM6A 1Y9EA 3HA7A 3K8YA 3EK2A 3TSZA 4HFRA 4F21A 5KPJA 4KTVE 1UZMA 1DV2A 1IJFA 3DMTA 2Q2VA 2VF2A 2ZIVB 3DEAA 1FNBA 1CULC 5JR3A 4XFKA 4WLFA 5ENZA 4WOKA 2B35A 3DUWA 2OCKA 1P3DA 3FWNA 1QZ3A 3H04A 2B8WA 4FKBA 4ARAA 3OF3A 1FNSA 3KKLA 1SUCA 2XUIA 2X2PA 3SXUA 2QW1A <