1TLTA

Crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
304
Chain Sequence
b'KLRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVHSSTASHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLMVGFNRRFAPLYGELKTQLATAASLRMDKHRSNSVGPHDLYFTLLDDYLHVVDTALWLSGGKASLDGGTLLTNDAGEMLFAEHHFSAGPLQITTCMHRRAGSQRETVQAVTDGALIDITDMREWREERGQGVVHKPIPGWQSTLEQRGFVGCARHFIECVQNQTVPQTAGEQAVLAQRIVDKIWRDAMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystal Structure of a Putative Oxidoreductase (VIRULENCE FACTOR mviM HOMOLOG)
rcsb
total genus 86
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1tltA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1tltA01
3NAQA 2IDZA 2BD0A 1GZ4A 4GWKA 3T4EA 1Y6JA 3I9LA 2FSSA 2P5YA 4J1NA 7MDHA 3OJLA 1MB4A 2FZWA 4LMRA 3FPLA 3VOSA 4OHUA 3O8QB 1AHIA 3PIDA 5JPIA 3PYLA 3RC1A 4D42A 2EKQA 3ZNOA 4WNCA 5EESA 4CM9A 3BXXA 3TOZA 5EJ2A 3JQGA 3QV1A 3D64A 1LRLA 5A9RA 2PA3A 3TJRA 2OO5A 3U3XA 3WX0A 1Z7EA 4IIUA 3S8MA 1EVZA 3NDIA 1WZIA 3B1FA 3F46A 4EW6A 3FBGA 1SAYA 3DONA 4ONEA 4BKQA 5KJEA 4F46A 1PX0A 3R3SA 5JDCC 3ICCA 4XYMA 2EV9A 1O95A 1RM0A 2AEJA 3PQEA 3UFXA 3UICA 3QWHA 3I52A 2X23A 3FPCA 4MP3A 2J3JA 3AOEA 4EJ0A 3JQ7B 1ZCJA 1EQUA 3TZCA 4D0RA 3DBRB 5A3VA 1KC3A 3KYDA 3JQBA 2Z95A 1P1JA 1TEHA 4J91A 1B14A 2PZKA 4DUPA 1BGVA 4CV2A 2VHVA 1E0DA 5TT0A 3QWFA 4D46A 1S7CA 2FR0A 1PGNA 2OL4A 2O3TA 4ALNA 3TZ6A 4GKBA 3U0BA 1NQOA 2G76A 2QQ5A 1JAYA 3P5SA 2WM3A 1DLJA 1HDXA 4MVJM 1MX3A 3I3OA 2O3JA 3R1IA 3LC1O 4E21A 3UH1A 1DIAA 2ZYGA 4L4XA 2GCGA 4E5MA 3JYNA 1HSZA 1PQUA 4HKTA 1NR7A 2D59A 4DTIA 4Y8VA 4Z0TA 5B4TA 1IYZA 5KTKA 2D3TA 3V2GA 1RM4A 3P19A 3ZW8A 4RCVA 4DIOA 2CMDA 3D4NA 5F1OA 4CQMB 3L4BC 3H2SA 2VOEA 3KBOA 3PHHA 3PZRA 4I5EA 2D4AA 5CFZA 1SBYA 2PH3A 4XQEA 1H94A 1ZO8A 5T64A 4DC1A 1JKJA 1EVJA 5K0ZA 3PGJA 2IYOA 1A5ZA 1RJWA 5G2OA 1LTHR 4AICA 4IUYA 4BNYA 3OP4A 5DN9A 3KYDB 1DAOA 2VYNA 3GLQA 3GRKA 3FHLA 5C7IO 1ISGA 1K5HA 1KEUA 2W2KB 4WECA 3PJEA 4RL6A 1ADCA 1U7HA 4FFPA 5KCZA 1ENZA 4B4OA 1MC4A 1K6IA 5T57A 2ZB4A 4NBTA 2A9FA 1BTOA 5TJ9A 2EJWA 1KEWA 1YONA 2NSDA 2IXAA 1JVSA 3HJAA 1NFQA 1QV7A 3CXRA 1LQUA 1N9GA 2AG8A 3ROKA 3G3EA 3B1KA 1Z82A 2ZKLA 4MPDA 2OP1A 2EP5A 2PZMA 3JCZA 5KIAA 4PFJA 1GYPA 4NK5A 1QG6A 3M6IA 2C5AA 1Y9EA 4LVUA 1G0NA 3JQBC 4K9DA 4J1QA 3FD8A 2NWQA 2QIOA 5FYDA 3U5TA 3K9QO 4RZHA 4BNJA 1H6CA 1MFZA 2EIHA 1UAYA 4YAEA 1HRDA 3RBXA 4YAGA 1K89A 4XGKA 2NVWA 3RUDA 3WYBA 4BO5A 4RZIA 4IM7A 4QQRA 3QA9A 3IUSA 3PK0A 4ESOA 2EG9A 3PFFA 4K1LA 2H6EA 2ILTA 3QIVA 3RFTA 4B4WA 4IQ0A 4XJSA 1XELA 4BO4A 1XYGA 4EGFA 4UULA 3WGIA 2Q3EA 4YXFA 3HB4X 3HUDA 3E82A 3F3SA 2G17A 3DDNA 1E7MA 4NDNE 4IQ8A 2CNBA 2BLLA 5A05A 1WWKA 3BTUA 3VHRA 4WCDA 1P1KA 1TVEA 5I8WA 3F1LA 5IZCC 3AU9A 2YW9A 3PYMA 1TB4A 3M2TA 4GSKA 1JWBB 4JCOA 1Q7BA 4LISA 4XIYA 2B0JA 3EC7A 2B5VA 3NTQA 3I6QA 4WPGA 2NQTA 2YV3A 3FI9A 1EE9A 3PJFA 4ND4A 5DF1A 2AEFA 4W99A 3SEFA 4E5NA 4R3WA 5JXWA 4WLUA 3G1TA 3NJ8A 4WJZA 2B4QA 4I5GA 1WDKA 3HN2A 2RH4A 3TFOA 1DB3A 2Y05A 4GGOA 5CDYA 3RC7A 3ZHBA 3G0OA 4PRKA 2OOSA 5JSFA 4I9NA 5JYFA 2AQKA 2PV7A 4TZTA 3NDRA 1I30A 2Y93A 2OGUA 3HWRA 3GGPA 4FGWA 4BUCA 2GN6A 1NVGA 3BHIA 2GD1O 4HNHA 2V6FA 5C7OO 4FSHA 3TL2A 3FSRA 3X2FA 4DVJA 1P0CA 4TKLA 1PZFA 4Y9DA 1PU2A 1BXGA 4CV0A 1F8GA 4OAQA 3ZNQA 2D8AA 4FPXA 4H7PA 1VPDA 3WS7A 1GEGA 1P1FA 1X13A 2AMFA 2EW8A 3IIEA 3K73O 4PG6A 3UW3A 3MJ4A 3CH6A 1B8PA 4OH1A 6ADHA 2FPGA 1XG5A 1EDZA 3RROA 5KVVA 5JDIC 1WZEA 2O23A 5IAAA 4U0KA 3OH8A 1DRWA 2VZ8A 4WGGA 4BOYA 5JYDA 1KVUA 4DQVA 4CMCA 2Y1GA 5U9CA 1PGJA 3ZU3A 4HFJA 3OBBA 1HSOA 1QYWA 2NACA 5EQDA 2BKAA 1PJ2A 1IZ0A 1B16A 4Q39A 3R0IA 3GPDG 3WMWA 3QVXA 1JN0A 1F06A 2I5PO 3P7MA 4J0EA 3G79A 3W4JA 1UUFA 4BB6A 3QRWA 5KJ6A 3MJCA 5JAIA 1M66A 3M1AA 4BKUA 2C29D 4OSOA 2G1UA 2DPGA 1C0IA 2DQ4A 4RDHA 3IAHA 3PTZA 3CPSA 1VJ0A 1DC4A 2CD9A 4CM7A 1Y8RA 4UVIA 4G2NA 3U4HA 1LSOA 5BR7A 3DTTA 1YDWA 4GGPA 2PTGA 3JQDA 2OZPA 4RVSA 4Y6PA 1CRWG 2WD7B 4EDFA 4EEXA 4E0BA 4D43A 2UAGA 1PR3A 1NAHA 2JL1A 1PQPA 4CL8A 3WSVA 4LRTB 3GC6A 1DRVA 4BNZA 5B12A 2Q50A 1ZW1A 1HDCA 5TS3A 4YB8A 2GPTA 2O2SA 1ZEJA 2AA3A 2IRWA 1NNUA 3NRCA 2WE7A 4NK4A 3H3FA 1IPEA 4OOFA 1IUKA 4BKRA 5IN5A 3IJPA 2E48A 5TLSA 3Q2KA 1DO8A 4OKNA 3K96A 4JBGA 3ADOA 5FF9A 5LCXA 1UDCA 1IZ9A 2HMVA 2EHDA 4ND2A 4CM8A 3FCOA 1BSVA 1BXKA 5J23A 4BGIA 3KRTA 5AXDA 1YO6A 3LT1A 1I2ZA 2ZYDA 1QYVA 3HHPA 2NU9A 4PRLA 4NG5A 1Z75A 1XCBA 2C59A 4OMUA 5GY7A 2JFGA 2JCVA 4CR8A 1UDAA 4IDDA 1KIFA 2VHWA 1LNQA 2CSUA 2VUSA 1KVSA 2DUUA 3VC7A 4ZQHA 3SJ7A 1MC5A 5T8KC 3IDSA 1KY5A 1SOWA 1XIVA 3OQBA 4FR5A 1D3AA 5AVOA 3BMNB 1T25A 5G0WA 5K9ZA 2E6UX 5KJFA 3F47A 3VTZA 1I33A 3AOGA 2Q4EA 1WLYA 2PD6A 3F4BA 2VRCD 3E8XA 3MZ0A 1AHHA 3OSUA 4J2OA 3E9MA 1UXJA 2C07A 4MVJF 3BMQB 2NTNA 1GADO 2I99A 4BKPA 1C0PA 1B3RA 2B4TO 1FDVA 1N7GA 4O1MA 4I9HA 3HFSA 9LDTA 1HF3A 3HSKA 3RKUA 4RF2A 4A5OA 2I6TA 1CQJA 1RPNA 2WYWA 1Q0LA 3VPFA 4Y6SA 4E5KA 1MA0A 3FR8A 4GKVA 1YXMA 4OXNA 4CUKA 3DTYA 4NBWA 4GLOA 2Z1NA 5CP8A 3GFBA 4MP8A 4EJMA 3WBFA 1C1XA 3BHJA 1FF9A 1H6BA 5FEUA 4DPKA 3H4VA 1P1HA 3GK3A 5JO9A 1D1TA 1ZMOA 3WBBA 4GLLA 1V0JA 2UUOA 3STHA 4JXKA 1YJQA 4BO3A 1DC3A 3JD4A 3PVZA 4LVCA 4ZQBA 3I83A 2D0IA 4BO6A 1PJCA 3T4XA 3JYLA 3PYXA 4RVDA 1NHWA 1DIRA 5EPOA 4KDEA 2YYYA 4LSMA 1YE3A 2RCYA 4IDFA 4KMSA 4A03A 3TSCA 2WYUA 1NFRA 4U0JA 4R69A 2Q1TA 3WIEA 2O3QA 1XU7A 2LDXA 4MKRA 1GL3A 3B20A 5DCYA 2PK3A 1U3WA 4ALIA 1J49A 4RVFA 3MOIA 4YPOA 1VLLA 3AM4A 3E6AA 4WNIA 1M6HA 2VWPA 1PS8A 1ZXLA 3ORFA 4M55A 2Y99A 5I9NA 1EDOA 4YT5A 3P2OA 3GZNB 1CJCA 3V8BA 2PKQP 3FR7A 3I23A 5TJHA 2C2YA 4KUHA 5JFOA 5EQFA 1RYDA 2GN4A 4BO8A 3KSZO 4IINA 3QSGA 5I9MA 2W4QA 3NTOA 1D8AA 1HL3A 1S6YA 1ZH8A 1ULUA 4YQYA 1LLUA 3ZGYA 3Q3CA 1E3LA 1E3EA 3VPSA 4B4VA 3ON5A 3COSA 3ZWAA 2JCYA 3WGTA 1Q7GA 2DKNA 2V65A 3QWIA 3GVHA 4Q3AA 3W6ZA 4AG3A 2X9NA 4LW8A 4IZIA 4PLVA 2CY0A 2E37A 3QHAA 3VKVA 4EUEA 2FWMX 4KUGA 3AM3A 5ENDA 1FDTA 1V8BA 5JY1A 1ISFA 2Z5LA 3TRIA 1ZKMA 4BMSA 4L73A 1HE3A 1QV6A 4PZCA 2HRBA 4WEOA 3H9EO 4XRGA 3RAJA 3KYCB 1YOVA 4L75A 4J7XA 3R3JA 1BMDA 1HZZA 1PSDA 1I10A 1KERA 1AUPA 4I9UA 3AUTA 3KYBA 4ZQGA 1ZZEA 1ISJA 2J3HA 5AXBA 4RF5A 4DBVO 2BGMA 3C7AA 1Q0HA 1E1MA 1FXSA 5EN4A 3I4FA 3NTRA 3AJRA 2Q49A 4CV3A 5JE8A 3CUKA 1GYQA 1C14A 1NWCA 1JAXA 5HRUA 4QO8A 3FN4A 5JDIA 2Q1SA 3IMFA 1LC0A 4ALJA 4YYZA 1DOHA 4OQYA 4NJMB 4D7AA 4AJNA 2C5EA 1OOEA 5F1KA 1DIBA 4R3NA 3I4CA 1H9AA 3ASVA 1LUAA 4K6FA 1Q2XA 3DZFA 5CPBA 2QZ9A 2VWHA 3GN2A 4TRNA 5ITWA 1JA9A 4DC0A 2VHXA 2FN7A 2OHXA 4ID9A 4JK3A 3RI3A 3FTNA 4B7UA 1B0AA 3A9WA 1X0VA 1N5DA 2J3KA 3PXXA 1CIVA 3UHAA 4BNGA 4I8XA 2AW5A 2WD8A 1YBMA 4Q9NA 4AJ1A 1Q7CA 1DJNA 1RKXA 2QYSA 1YJ8A 4CM6A 4YT8A 3D3EA 3V1TC 3H9JA 2WMDA 3QP9A 3Q1LA 2UUPA 3MEQA 1IPFA 4WLEA 2YJZA 3DEYX 4Y6RA 3WNQA 1N7HA 5DOVA 3RASA 1H6DA 2GZ2A 4FJ2A 4J1TA 5C7LO 1QSGA 5DP1A 5GZ3A 4DGSA 1M76A 1LX6A 4IQGA 3W8DA 4Z6KA 1UXGA 3BMOA 4GVXA 1HLDA 3LC2O 2BFAA 1H2HA 2BF7A 1IE3A 5C3MA 4L9RA 5JC1A 4WASA 4CM1A 3HG7A 3AY7A 4WKGA 3RUFA 2O48X 4YT4A 3TZQA 1R0SA 1I3LA 1LRJA 1I0ZA 2CF6A 2DTEA 2YDXA 4IMPA 5AOVA 3K8ZA 5CEFA 1E6WA 1R16A 3E9NA 3EZLA 4L0QA 3PQDA 2V6GA 4UVDA 3BTOA 5ER9A 5TGDA 2D5CA 3SC6A 1NP3A 4MINA 3BMCB 1XDWA 1YBVA 4I5DA 3WLFA 2HUNA 3PHJA 4L8VA 2HSDA 2WJPA 3AWDA 4CODB 4KWIA 5I7VA 4BO7A 2VYND 4J4BA 1B15A 5KJ1A 4A2CA 1X7GA 3WGQA 1D1SA 3C24A 1C0KA 5KNLA 3A14A 1I32A 3JQFC 5COAA 2VUUA 3HE3A 4XD2A 1WW8A 4ZICA 1HT0A 1YQGA 2O4UX 1A4IA 1PQWA 4DLBA 3NT2A 1NXQA 4DPMA 3UCFA 3UGKA 4AL4A 4J4TA 3RUCA 4H16A 4TRRA 2XOXA 1NPDA 4IS3A 1Z7BA 1O89A 3BMQA 1ENYA 1U2DA 2I65A 3ZI0A 3JD3A 4R51A 1LDEA 3I9NA 5HTOA 1VJ1A 1I36A 4JP2A 1SO8A 2X9VA 3JSAA 3N7UA 1JKIA 1PIWA 2Q22A 2UV8A 1BG6A 4UUMA 3ADPA 5TX7A 2Q1UA 4RLSA 4BO9A 1DXYA 1U8FO 3HB5X 1I8TA 4D44A 4M8SA 4W82A 1UP4A 1U3UA 1HE2A 3RU9A 2Q99A 1T4DA 3OIGA 4R01A 1P9LA 4I08A 4R1TA 5DULA 1FDWA 3MCVA 2NLOA 4O0LA 1U9JA 2OUIA 4FDAA 1PJSA 2ZB3A 3K31A 4NBRA 1M75A 1EFKA 3LK7A 4ZU3A 1M6WA 4XRRA 1GQ2A 1ZIDA 2LDBA 3H7AA 3WIDA 1V3VA 3AUSA 3WMXA 3WQQA 2GDZA 3KUXA 4P38A 1A27A 3S2GA 1UXHA 4J4HA 5HM8A 4D3FA 3WLEA 4XX0A 4RDIA 1YS4A 1X0XA 2H1SA 2PGDA 3O26A 1E1NA 3TZKA 4EUHA 3WXBA 1V6AA 2AE1A 3RWBA 5IXYA 1UP7A 5DCUA 3CINA 3ENKA 4MVJH 2J8ZA 1WAMA 4DWVA 1J5PA 3RIHA 5IXSA 4G81A 4F45A 5LC1A 3CTMA 5JW6A 3D3WB 5U4QA 2GR9A 5TT1A 4J7CA 4CL3A 1E3SA 1CDOA 1V35A 3DC2A 1PGPA 2H5LA 3OEWA 4RJTA 2X9GA 1MV8A 1NR1A 4CMIB 2R2GA 3HDJA 4WLFA 5I7SA 4KTVE 2X5OA 2IEBA 3MJEA 5THQA 2VRCA 4OXKA 3SLKA 1D7OA 2PGJA 2VRBA 4OM8A 5G4KB 1EUCA 4TQGA 2GN9A 1A9YA 1YKFA 4LCEA 2R00C 2POQX 2ZCUA 5EMHA 3RJ9A 5ADHA 4FOOA 2GLXA 3GNTA 4D0SA 4J9VA 1A7AA 2NQ8A 3IQDB 5L4NA 1BHSA 3ZDFA 3JQFA 4UEOA 3ROMA 1ADBA 4M87A 2ZCVA 3KHUA 3LLSA 2B37A 2NVUA 2PZLA 2FP4A 5L4SA 3KLPX 1FDSA 4CPDA 2FZEA 4DQUA 1DLIA 2Q4BA 1GFSA 3GQVA 1PZHA 4WUVA 2HQ1A 3L4SO 4WK6A 5JDCA 3DBVO 1IY8A 1G6KA 2ZK7A 4GX5A 4WLVA 4PG5A 3HZZA 4YRAA 3SLGA 3GVPA 4E6PA 2G5CA 4FC6A 4E32A 1U3VA 3PLNA 4ZRNA 4B3JA 3OHSX 3NDJA 1QYDA 3IS3A 5IDQA 1WMBA 4M86A 1IHYA 5JLAA 5L45A 4RF3A 1PL7A 1E6UA 4FN4A 4AJOA 5IJZA 5L4LA 2DBQA 4MKZA 3EDMA 5IDWA 4OIMA 2GF2A 2QRKA 1DFHA 2O3SA 2B4RO 3IKVA 1BW9B 3KB6A 3AI1A 3JQ6A 2O3UA 3OQ6A 5I7EA 4FJ1A 3W8EA 5I9LA 5J9GA 3AM5A 4I5FA 3UUWA 1H6AA 5G4LA 3U62A 2X6TA 4BO0A 3H3JA 4BHTA 1H0KA 3MJSA 2DAPA 4DL9A 1QP8A 3K6JA 3V5NA 3HDHA 4AJKA 3PWSA 1NPTO 1ZMTA 2IZZA 4MVJI 4ALMA 1CWUA 3EGOA 2GGSA 3A06A 4QSMA 2B5WA 3Q6IA 4PG8A 4W7HA 1GDHA 1TT5A 1EBUA 4J3FA 4OJNA 3ZU4A 4L4SA 3ROPA 1U5CA 2NVUB 3ZHZA 4D3SA 4D41A 1YQXA 3V1UA 5FFFA 4XYLA 1MLDA 3H5NA 1W4ZA 3JQAB 4A73A 4CMKA 4OGWA 3Q0EA 1BDMA 1DIGA 2XPCA 3RSHA 2GRAA 3DBLB 3RD5A 1KY4A 3W6UA 2W98A 2DFDA 1XR3A 4E33A 4AJHA 2EWMA 3JYPA 1GCOA 2NV6A 4JP3A 4BNFA 2P4HX 4XQCA 4BMNA 5JBIA 2BI7A 4KQWA 1TLTA 3MOGA 3GFGA 9LDBA 2OP0A 5IF3A 2R00A 2PLAA 4FOSA 1AGNA 4M49A 1HDGO 2ZATA 4IZHA 4W9NC 1GQQA 4MVJA 1T2DA 4ZGWA 4IDGA 2QRJA 4P4GA 4NFHA 3PWKA 3PJDA 1I5RA 4PCVA 3ANLA 3E18A 1E3WB 1YVEI 2YQ5A 3PDUA 5FI3A 4CLXA 4RPJA 4DBZA 2VHZA 1N1GA 1B8VA 2BHLA 4IDBA 3L6EA 2QX7A 3DZGA 3JTMA 1LSJA 1VJTA 5KOIA 1X15A 4DLLA 5BQFA 2NADA 4E12A 1PL8A 4R9SA 4P8RA 2B36A 2Y0CA 1Y9AA 2TMGA 4PLYA 3I9JA 3UAGA 5HWSA 2CDBA 3LF1A 5JMPA 2WYVA 2YQ4A 3JD2A 5T5QA 1VSUA 3GAFA 4R1NA 5TC4A 3GVCA 4XDYA 3VZRA 5CPFA 3H65A 3MWEB 3INTA 3HN7A 4IDEA 4AJ4A 1VKOA 4MVJD 3WB9A 1C3VA 4NH4A 4PLZA 1PJQA 4QFCA 4WOJA 4YJHA 1P1IA 2PR2A 1XQ6A 4U6QA 1ZK3A 2DFVA 3H9QA 5F5LA 3ANNA 2CZCA 1UH5A 5F5NA 1NPYA 4BS9A 3WSWA 2EP7A 3WGGA 1W73A 4UAGA 2GN8A 3H5RA 5JMWA 5G0VA 1E1LA 4Z0HO 1Z45A 1D4FA 3AUAA 3G1UA 3IUPA 4XCVA 3S2IA 5CDTA 5JCJD 5B1YA 5KKAA 2VWQA 5DBGA 2RIRA 2O7QA 2B69A 5TIIA 3KM0A 3ETDA 1W6UA 3T7EA 3RUEA 3ZV5A 2EKPA 4J1SA 3LT4A 4FC7A 4MDHA 3JQ9C 1M2WA 4MVJP 4OSPA 4K26A 4ZQEA 3W1VA 4LMPA 1E3WA 1R6DA 2X22A 2Y1OA 2YZ7A 4ZVVA 3M1LA 3LYLA 1DC5A 1EMDA 2Y1FA 5F21A 2YV2A 4RPHA 2RH8A 2EKLA 4HP8A 2HK9A 4UEKA 1IL0A 1LSUA 1R37A 1ZSNA 5CHEA 1SOVA 4A10A 3RC9A 2BRUA 4RVUA 3WDSA 1O8CA 3U4IA 4Y67A 1GUFA 2NTVA 4BNTA 2IZ1A 5IZ4A 4R1SA 4IGFA 3AUUA 2DC1A 2RAFA 1N8KA 3WNVA 1E7SA 3WQRA 1QR6A 4W9NA 3S2FA 3LC7O 4RVGA 5A4DA 5COBA 3KV3O 1NTOA 2VZ9A 2DVMA 1W8DA 3JD0A 4CMJA 1GEEA 1CQIA 3Q11A 1ZK2A 1ZSYA 4WOKA 4IJVA 1WNTA 1W0CA 3DOOA 1FMCA 1R12A 3CZMA 4IJUA 2OMEA 1QYXA 5DBIA 3INGA 1C1XB 1KYQA 2D5AA 5JC8A 1U5AA 2FMUA 4OQZA 2ZB7A 1BDBA 1JVBA 5HA5A 4XQGA 4GVLA 4NJOA 1YBAA 1EQ2A 3TNLA 3IP3A 4BV8A 1P74A 4DRYA 1GUZA 4XB2A 1Y5MA 4TSKA 4BO2A 3GMDA 3H8VA 4J49A 1NM5A 4TMFA 3PI7A 1Y8QB 2IYPA 3E5RA 2Y66A 3OJEA 5DBFA 3PJGA 1U4SA 2NUAA 3OQ1A 3QVWA 1VL8A 1QMGA 2EJVA 3DMTC 4XYEA 2JD1A 2DLDA 5BSHA 2FRDA 1SCUA 2EGGA 2P91A 1ZSVA 2J3IA 1YL7A 2PKRA 1I2BA 2UVDA 4GBJA 1QRRA 4L74A 1L7EA 4J7UA 2IODA 2EGHA 4TVOA 2Y0DA 3U4DA 1AN9A 3IL2A 1GQYA 5JYAA 2P68A 3U9LA 4IDAA 4CM5A 2E49A 1KBZA 2AQIA 3BMNA 4FQ8A 4PIVA 5DP2A 4Q3EA 1E5QA 1BWSA 5KKCA 1ZNQO 2GYYA 4Y98A 3H5AA 4PZEA 3ZN2A 1KEVA 3C1AA 4ILKA 4P22A 2QHXA 2DBZA 3LQFA 1EVIA 4K28A 1EUDA 2BFMA 4PVDA 3GNQA 4DXHA 4NIMA 4C4OA 2GO1A 5HBRA 3F6YA 4E13A 1KC1A 1X1EA 3QJ5A 3AW9A 1JWAB 5LDGA 3KZVA 3UCEA 1TT5B 2GSDA 1DHTA 3EVTA 4DLAA 3FTPA 2BGKA 3RC2A 3W8FA 1Y81A 1H9BA 2X1HA 1XKQA 3D4OA 4LN1A 1P0FA 1SEVA 4DPLA 4F3YA 4IGEA 4LSWA 4PLGA 3ST7A 1HEUA 4ZRMA 2Q45A 4CUJA 1TA4A 3DZBA 3AU8A 3UKOA 4E31A 1GAEO 4E3ZA 3VH1A 1TXGA 4J2HA 4CMEA 3AI3A 4GWGA 3LZ6A 1CERA 2GZ3A 2CF5A 4IS2A 3ZH2A 4YAIA 3N58A 3ZCXA 2HKIA 2Y68A 1UXKA 4N54A 4AJIA 3ENNA 1ID1A 4J6FA 3ROQA 1P45A 4R4JA 3GGGA 2HRZA 1F14A 2C82A 3LU1A 2YUTA 4NI5A 3NT5A 1X7DA 3OF2A 1YDEA 1R0LA 3ANMA 3GEGA 1OAAA 4MKXA 2O50A 3C3XA 2A35A 5L95A 4KWHA 4MIEA 1LLQA 4BMVA 3GF4A 3DHYA 4FGSA 1A7KA 2Z1MA 3LDHA 3DAPA 2VOJA 4NNJA 2EF1A 1XU9A 4CQMD 5T8KA 3PRJA 1V9LA 4CJXA 4A27A 1ZJYA 4MIYA 3PP8A 3F5SA 1ISIA 2VNSA 2J5QA 3JQCA 4N5LA 4S3MA 3GUYA 5AXAA 1U3TA 1WVGA 2VTDA 4FIZA 4B7CA 1U4OA 3ZWMA 4DYVA 3KETA 4HNGA 4BGEA 3SC4A 4BO1A 3C85A 3DB2A 3UN1A 2Q2QA 2WSBA 5DCWA 1NHGA 1Y5RA 2HMSA 3WG9A 3FWNA 2G0TA 2GZ1A 5GMOA 3GUCA 4OXYA 5BNTA 2X0JA 1P33A 2ZIZA 3Q9UA 1CF2O 4R41A 3NKLA 5FWNA 4BNLA 1NYTA 3ZV6A 2YY7A 3BTVA 4QXMA 5TNXA 1A9ZA 1Y1PA 3GNSA 3D1LA 2X5JO 1HLPA 3PFWO 3TQHA 1ZEMA 4YVFA 3TZHA 1MUUA 1XEAA 1X14A 2IE0A 3GDOA 3ETEA 1ONNA 2PZJA 3VKUA 1O6ZA 1ZK4A 2FHSA 4ND3A 1ADGA 1T24A 2NNLD 3BTSA 2P9GA 4XDZA 4YBZA 3DO5A 4E5YA 2FPIA 2IEDA 2FR8A 4NBUA 4PLTA 1SNYA 2WD7A 5BNIA 1I3MA 2ZTUA 1PZGA 3NJ4A 4CR7A 4OOEA 3CIFA 4FFOA 3IJRA 4PLWA 4TZKA 5C5IA 3CKYA 4UVGA 4O63O 1JLLA 7ADHA 4WEQA 4Z3DA 2P9EA 3K30A 3D5TA 3T7CA 2HO5A 4GSLA 2HMTA 4R54A 4CMEC 2VHYA 4B4UA 3JQ9A 3GG2A 1PJTA 2YDYA 1MG5A 3H6KA 4JN6B 1OZAA 2TMDA 4XYBA 3L07A 5T6BA 1I01A 3M2PA 1BXZA 4FW8A 1ADFA 3F5QA 4IPTA 1Q1NA 4DQXA 1HYGA 1HYEA 4BNKA 4EBFA 3WOHA 5B4UA 4E2YA 4CUZA 4B8ZA 4Z9XA 1E3JA 2E4AA 4PLHA 1MG0A 1T2CA 5CG1A 5L3ZA 4ZHSA 1OBFO 3V2UA 4CM9D 3CZRA 2Y67A 4CM8B 4IIVA 4DMLA 4UREA 1PJBA 2JAHA 2WTBA 1QLHA 2C20A 3GPIA 3U49A 2VQ3A 5ICMA 4W7IA 3QLJA 4FFNA 3IOYA 8ADHA 4M89A 1MP0A 4CMAA 3TF5A 3WJAA 1EVYA 4DA9A 4HV4A 3JQEA 3RBZA 2V6MA 5G0SA 4D45A 4MIOA 5IG2A 4IXTA 2F00A 4UUOA 4JJGA 1Y7TA 3VH3A 2HAEA 1DRUA 2VWGA 1P44A 1EE2A 4PZDA 4TRMA 4ALKA 3GGOA 5IFLA 2XAAA 4YRDA 1NBOA 4E2XA 4N18A 2IXBA 3SXPA 3ULKA 4F6LA 1EUZA 5AQ1A 3BAZA 4W6ZA 4FFMA 1SB9A 1ENOA 4A26A 1Z6ZA 4KOAA 1LSSA 3VPXA 4BNMA 4RF4A 1C0LA 1O0SA 4YQZA 3VTFA 5MGBA 4CQMA 1LEHA 2HU2A 3AI2A 5DOZA 2I67A 4P4NA 1O5IA 2DPHA 1KVQA 5ILGA 1WDMA 3I6IA 3NYWA 1VSVA 4PVCA 1A71A 3GA0A 3UCXA 4YRBA 2NU8A 1PJ4A 1EK6A 3DMTA 3DR3A 4CM4B 3C7CB 4PG7A 3NX4A 1XSEA 4QFDA 5A5FA 3GAZA 2V6BA 4EI2A 2WEKA 3TDKA 3DAGA 3C1OA 1O9BA 3IC5A 3KTDA 3PHLA 2GUGA 4UUPA 4E2ZA 3OA0A 1XLTA 4YJFA 3ABIA 1KVTA 1PS0A 2Y1EA 4YJGA 3ZHYA 4IY1A 4RGBA 3ZU5A 4A0SA 1PGOA 2A4KA 2NM0A 1JU9A 4B7XA 1ISHA 5G4KA 5KVCA 2GERA 2I66A 2O4CA 5A3JA 2VYVD 1E7RA 2PD3A 1M67A 3D4PA 3D7LA 3O9ZA 2BELA 3MWDB 4L76A 4ZA2A 1RYEA 4GMFA 4FS3A 5JNLA 3AFNA 3AY3A 3QWAA 4FFLA 4XWYA 1AXGA 3ZV4A 1ZXBA 2NU7A 1U7TA 2A94A 4QO7A 4CMGA 4LGVA 2HMUA 1GD1O 1TT7A 1A72A 1WMAA 4WCFA 4FD3A 3B1JA 3GZNA 5TQVA 5HS6A 5ITVA 3NGLA 5L7YA 4DYDA 5JYEA 3R6DA 1SC6A 4X54A 1DHRA 1J0XO 1YRLA 1OI7A 5A9SA 4YDRA 2QRLA 4BNIA 2Y1CA 5GZ6A 1VL6A 3AY6A 3GHYA 3PIIA 3GY0A 3S55A 4JIGA 1GYRA 2I9PA 1N1EA 2CVQA 4JBHA 3FNFA 3KEOA 4XEHA 1VC2A 3QVTA 4CM4A 3UXYA 3C7DB 3RFXA 3O03A 4DIBA 4BL5A 4NHEA 3OEYA 3E1KA 1IHXA 2C2XA 3PHGA 4YACA 4NU5A 3PDJA 2V7PA 4CV1A 3L0DA 4CM3A 5JY6A 1ZK1A 3FBTA 3DZKA 4RPKA 3JQGB 3L4BA 4TRJA 3W4KA 4R5MA 5JO0A 1T2FA 2XXBA 3V2HA 1YOVB 3L77A 1NX6A 1ML3A 2DBRA 2AE2A 4KTTE 1ENPA 5BNFA 4FB5A 2FY8A 5THKA 4EEZA 4MO2A 2AXQA 2DT5A 5JS6A 1L7DA 4FCCA 1RM5A 5CAEA 2VUTA 3JYOA 4WCFB 2W8ZA 1NFFA 1O94A 4HWKA 1C1DB 4RQTA 1AXEA 3BIOA 4F6CA 2VT3A 3JV7A 4TVBA 1NQ5A 1XA0A 2Y0EA 1PEDA 1JKFA 2DUWA 1HDYA 1ZJZA 5A04A 1SPXA 3PQFA 5A1TA 5DT9A 1ISMA 3DBLA 4J9UE 4HUJA 1QYCA 1YB4A 1LI4A 2PH5A 4CLDA 3WJ7A 3DZHA 2JD2A 1QXSA 5A03A 4CMBA 5DNAA 4NPCA 5DDIP 1K6JA 4DIFA 2CDAA 5A06A 4U5QA 3JQAD 3IP1A 4JGBA 5MDHA 3VDQA 4E5PA 3ICPA 2BGLA 3X2EA 2O2YA 1HKUA 3ZWNA 1PTJA 2J6IA 1NASA 1HDOA 1DEHA 4RQUA 1GPJA 2JFHA 4C7KA 1JTVA 4FFRA 4U7WA 2CVZA 3I1JA 5JAQA 3LLVA 1Z74A 4XIJA 2X86A 3S1LA 5K6AA 5KWEA 4B3HA 1HZJA 4JNKA 4JJIA 4HXYA 1VM6A 1LDBA 2OBNA 1KVRA 2HLPA 1DPGA 4JQCA 1LC3A 1PWXA 5U1PA 3VAZA 3JQ8A 1SEPA 3ONFA 1MGOA 1UZLA 3DMYA 4HFRA 2RHRA 4NZ9A 3C1TA 1YH3A 1IB6A 1LU9A 3NV9A 4H3VA 1Z73A 3PPIA 2DTDA 3IKTA 1QKIA 3MTJA 4FJ0A 4NQZA 2NTJA 3OJFA 2VYVA 1I24A 4O6VA 4CLEA 3LSYA 5AYVA 2CDCA 4QT0A 3QQPA 4MOWA 4B79A 1HWYA 5A02A 2AHRA 4J90A 4WE3A 3JQAA 4BNVA 1BVUA 1GCUA 3OIDA 5C37A 2HK7A 1PS9A 2W2KA 1YB1A 1GZ6A 1U1IA 3SX2A 3DWFA 1EEHA 4XKJA 5H82A 3LVFO 3ZWBA 4YA6A 4GMGA 3GH3A 2ZB8A 2WDZA 3UOGA 1FK8A 1VL0A 1AE1A 1BVRA 1OMOA 4HADA 4CLHA 3U4CA 4YJDA 5M6DA 5GZ1A 1T1SA 2X0IA 1HE4A 3GN1A 4GQAA 3K5PA 5KVQA 2UDPA 4KUEA 4CR6A 3WR5A 5A9TA 4UVHA 3LT0A 1P3DA 2RHCA 4XGIA 1WDLA 4PG4A 1ZUD1 2EERA 3KO8A 1F12A 2C7VA 1K6XA 1ZFNA 4RVHA 2HMWA 3SVTA 1NAIA 4N5MA 1F0YA 2QZZA 3E9QA 4ZD6A 3ZWYA 5JCXA 2FR1A 1H93A 2ZQYA 3PLRA 3RCBA 1FJHA 4JROA 4NMHA 3BHMA 3ITDA 4XB1A 2OBYA 3KLMX 3ONDA 1ONPA 3QWBA 2YFHA 1DAPA 1I2CA 1G1AA 1LQTA 3SJUA 5CG2A 3ITKA 4YJGB 2JCXA 4YJFB 1KOLA 1DFGA 4XR9A 4KZPA 1WXDA 2H9IA 5B37A 5EL0A 3GEDA 3KXDA 1ARZA 1R4NA 3DBHA 3G49A 3DZJA 4JJFA 3OIFA 4YJHB 1NVMB 5ILOA 4EJ6A 1CETA 4BGUA 3I5MA 3EAGA 1OFGA 4UEJA 4RPGA 3GVIA 3VH2A 4BIIA 2BFPA 3PZBA 5K6AC 1ORRA 4GI2A 1T26A 3ZWXA 3B70A 4KQXA 1B26A 2FOIA 4BKOA 1T4BA 4FBGA 4N7RA 3JD1A 1E5LA 3DZIA 2NU6A 4M54A 4BGVA 5L7WA 4BQRA 4YT2A 4QX6A 2PGLA 1T2AA 2BMAA 4GPD1 3QW2A 2B83A 3A28A 2JHFA 2X4GA 2BI8A 3TOXA 1Y8QA 3K2EA 3MJVA 3P2YA 3RUAA 3WICA 3OETA 1X1TA 3PHIA 2AG5A 2R6JA 4JX8A 2PKQO 1LXCA 3WGHA 1Q0QA 2F1KA 2Q2VA 2PD4A 4WCFC 1GU7A 4HFNA 1K0UA 1E7YA 3KOUA 4E30A 2VN8A 3NEPX 4YTEA 4GX1A 4MJLA 4AJJA 1CYDA 2A92A 4LRSB 1NVTA 3WGYA 2CVOA 1R4MB 1R0KA 2PY6A 2J5KA 1K2WA 3GEMA 3EZYA 4EYEA 3WYCA 2OORA 1R15A 3ZW9A 3OA2A 1GV1A 1TI7A 2CFCA 4M1QA 1BXGB 2RBEA 1CEQA 4AJ2A 4QUKA 4N5NA 4IMRA 2Q2WA 1DSSG 4NBVA 1HTBA 2JD0A 3ASUA 3ZNPA 1LDMA 1NWHA 2VTEA 3VZSA 5BSFA 4UUNA 1MXFA 3BA1A 3ZWPA 3NT4A 1YGYA 1F17A 3ETGA 5IDYA 4PN3A 4L4RA 4ALLA 2JHGA 2X7HA 2ZYAA 1GR0A 4NU6A 1DFIA 2OFPA 2O3RA 4IJWA 4CMHA 4II2A 4OO3A 4XR4A 3RKRA 4CQLA 3F9IA 1B3BA 4XYGA 4YAJA 1UAGA 3WWZA 1UR5A 1BRMA 2AQ8A 3DHEA 3WYEA 1JW9B 1V3UA 4ZJUA 2HDHA 2Q46A 4R9RA 5EIOA 3BZUA 1LDGA 3B6ZA 1X7HA 3QVOA 1PR9A 4R1UA 4OYRA 3HDQA 2ET6A 3GT0A 4CLOB 3GVXA 3KYCA 1E7WA 3G17A 4TROA 3O38A 2QG4A 4R68A 4BNUA 3EMKA 1OC4A 5H81A 3OJ0A 2JKVA 3ZZNA 4D79A 5CDSA 2B35A 5A5EA 1I3NA 1UZMA 3JYQA 4Q3BA 5A9SB 1SMKA 4QTZA 5BT9A 1RWBA 1U2GA 2VZ0A 3F1KA 4IDCA 3H9GA 3ZHXA 1F8FA 3WFIA 1LBEA 2ZTLA 3RQSA 2BFOA 2I3GA 5BSGA 4QECA 3NUGA 4XA8A 3ZWVA 3EUWA 2W2LA 3EHEA 1WPQA 1LJ8A 1E3IA 3RJ5A 3JQ8B 3GG9A 1MFPA 4Z9FA 3CMCO 3E03A 1H5QA 3ONEA 4G5HA 2ZJ0A 4O5OA 2C0CA 3GZ4A 1YWGO 4DMMA 4YCAA 1P77A 3I9OA 4XJTA 4AJPA 4P4LA 4J0FA 4TWRA 3F4LA 4NJMA 3VPGA 4AJEA 4QEDA 1LLDA 3MTGA 2YFQA 4ITUA 2PFGA 2WE8A 1XQ1A 4NR0A 3H9UA 3WWYA 4URFA 5TF4A 1GV0A 3WQSB 3HDYA 1HXHA 2HCTA 4JLWA 3FWZA 4BNWA 4O59O 3KEQA 2G82A 4CLOA 4JBIA 1RM3A 1E7QA 2VNAA 3E48A 3D5QA 5G0UA 5CDUA 1UJMA 2P2SA 1C1DA 2NVBA 3GOHA 3I9MA 5COQA 1NQTA 1ULSA 1XWFA 3OFSA 3UVEA 1WP4A 1XGKA 3O8QA 1B8UA 2HJSA 1T1RA 2EEZA 4EUFA 3L6OO 2O7SA 2X0NA 2ZTVA 6LDHA 3QY9A 3C8MA 2X58A 5HS4A 3H2ZA 1VE9A 4RLHA 5ES3A 1B7GO 5L7TA 4TKMA 3L9WA 3L9XA 1LRKA 4PGFA 1E77A 4OL9A 3DFZA 1IOLA 4CLRB 3GR6A 4Z3KA 1GPDG 4C7JA 5B4VA 4B8WA 4HBGA 3N74A 1GTMA 5ER6A 4ZN6A 1L1FA 1K3TA 2E82A 4AVYA 1DDOA 3CMMA 3BMOB 3GDGA 4EZBA 4IJKA 3W4IA 1JDJA 4BNHA 2XXJA 3U09A 3DOCA 3KVOA 5F3RA 2GASA 2QYTA 2X5KO 4Z0PA 3RUIA 3VH4A 4YR9A 3DQPA 5L40A 1YL6A 3PGXA 4RPLA 3ZWCA 4GL4A 3GRPA 2IZ0A 1R4NB 2DU8A 2X0RA 3DBHB 4RO0A 1V3TA 3VZPA 3HADA 2FPPA 2CUKA 3TL3A 4XGNA 3JQ7A 3WTBA 1OC2A 3DBRA 5TSDA 2WWRA 4IBOA 1G0OA 3VVCA 2YHIB 3LF2A 3LT2A 3FNHA 1PJLA 3NGXA 1GUYA 4G65A 1DBVO 5T73A 4LCJA 4R16A 4EITA 1I3KA 3ZU2A 2X8LA 3O4RA 1ZK0A 4U8GA 1R66A 1UXIA 4AJLA 3DL2A 1E92A 4GH5A 4U6SA 4ROSA 1N9GB 2AQHA 2I3AA 3CSDA 4LK3A 4BNNA 1PL6A 3DAFA 3VDRA 3OMLA 3EYWA 4NFYA 5ENVA 3TN7A 3PEFA 1LDNA 1PWZA 4CLRA 4UVEA 4H15A 1PGQA 2DBVO 5KJCA 2EXXA 4ZQFA 1DIHA 1ONOA 5KVSA 2UYYA 4NFSA 4GX0A 4YEDA 3EY4A 3HNPA 4J16A 3ZNNA 4S1VA 3L6DA 1LDYA 4ND1A 2JAPA 3PWZA 1LA2A 3WTCA 4YAKA 5I7FA 1FDUA 4II3A 1HYHA 2HJRA 3D0OA 1R4MA 2SCUA 2YHUA 2C7GA 1UZNA 5AXCA 3VZQA 4W4TA 3QE3A 3HQ4O 2C54A 2DTXA 3RBVA 3ZV3A 5CEEA 1VRWA 3VVBA 1YL5A 4GX2A 2VT2A 4BVAA 1SB8A 3WFJA 1LLCA 3OECA 2AEMA 3GHHA 1HDZA 3K92A 2PWZA 4WLNA 4HFMA 2W90A 1IULA 2YHIA 2JFFA 4WLOA 3D3WA 5L51A 1EBFA 3KSUA 5TRTA 5JCJA 4DREA 3WGZA 1PZEA 2XF8A 4GAEA 1GY8A 3RFVA 1J4AA 1ZBQA 5JAMA 5H83A 5CDGA 4BV9A 3Q9NA 2D1YA 3EK2A 1VI2A 1E6EA 1U28A 3HFGA 1KETA 4A7PA 1N2SA 4MP6A 1UDBA 3CEAA 2OXIA 3DFUA 4E2WA 4MVJE 3EW7A 2EW2A 4HX5A 4KDFA 5IN4A 1HETA 4J43A 1U8XX 1YB5A 3AK4A 4CMIA 4R5HA 4I1IA 4AFNA 1ZVMA 5LDHA 3GDFA 3S2EA 3SBOA 2H63A 1P1RA 4INAA 5T67A 3TWOA 4Z9YA 1DJQA 2PNFA 2QW8A 5L53A 3ZWOA 3WGOA 2W2LD 3E5MA 3V1YA 3K2BA 3GMSA 1UP6A 1J6UA 2DM6A 1T2EA 4PLFA 4K6CA 2D2IA 2Y1DA 4XZ3A 2GNAA 5DZSA 1H2BA 3BYZA 1HE5A 1YQDA 1A4UA 2J5RA 4BNXA 3VPHA 2I76A 4B3IA 4RV9A 2JJYA 3TPCA 3A4VA 2P4QA 4PLCA 1SZJG 2P9CA 3QVSA 3RU7A 1P31A 2ZTMA 3DXFA 4Q3DA 4PLPA 3FRJA 2BH9A 1EK5A 3FNGA 1PJ3A 1VKNA 3INRA 4HY3A 1KS9A 1MXHA 5EERA 1NQAO 3AOEC 3TFQA 4YWJA 3ZWWA 1JQBA 4ND5A 3FNEA 3OM9A 4OKIA 5FI5A 2HK8A 4E4YA 4Q3NA 5EINA 4Q3CA 3RUHA 5IZCA 5F1PA 5IDXA 4BB5A 5I8ZA 1KEPA 2Q1WA 4MVJG 1EFLA 1HDRA 1B2LA 8LDHA 3AFMA 4IXWA 2ZJ1A 5G0TA 3A1NA 3KSDO 1BW9A 1EZ4A 5ICSA 2ZQZA 5JAZA 5CEJA 2FSVA 3FF4A 3CE6A 1E1KA 1N92A 1XHLA 4RORA 3Q2IA 2VCYA 4KP7A 1GZ3A 3UF0A 4XQ9A 2YV1A 5L9AA 4BQPA 3MJTA 1QORA 1QLJA 3I9KA 1Y8RB 1DC6A 3EVNA 4D3DA 2P5UA 3RVDA 3DOJA 3BMCA 3DHNA 3OJOA 4CQLB 3OICA 5BSEA
chains in the Genus database with same CATH superfamily
4DSUA 5ELLA 4RHCA 2R6GA 2XWSA 2X19A 2BPOA 2OV3A 4M7WA 1GZ4A 4FMDF 4QQNA 2WTAA 5GWXA 1OROA 4MWOA 4N7MA 2FSSA 4J1NA 3D9QX 2X2OA 3R3VA 1MB4A 3D2AA 4RENA 4LMRA 4CL2A 3PC3A 2WTEA 2ZI7A 4ARZB 1ZJ5A 4DMUB 4KPUA 1QBGA 3PIDA 1SKQA 2JGDA 4OA5A 4UJ5A 4CQNA 2BEVB 2EKQA 4WNCA 4DNOA 1QMIA 2WY2D 3ZLTA 2ZBQA 3IH5A 3E2PA 1JHDA 5DN6D 3MT8A 4U4AA 5EWJA 1E0AA 3TJRA 4WK0B 3LDFA 3VDNB 4QTTB 1X9HA 2BJVA 3A8TA 4EGSA 2GHTA 5C8VA 2OHVA 3LY5A 3QHPA 4GPEA 1DBWA 1UBRS 5C1DA 6PFKA 1EK0A 4V1CI 2V03A 2BOVA 1OFVA 4IIUA 2HPZA 1WZIA 2OXFA 2QE7D 3E3NA 1U0RA 4EW6A 1FSPA 5FI1B 3BH7A 5JJ5A 2CKMA 1VSTA 4ONEA 4BKQA 1F9EA 4NZYA 1RBMA 2E5FA 4ESHA 1N0WA 4DM7A 3CX7A 2CNLA 3ICCA 2FMKA 4RS3A 2BJHA 5DTEA 1ZJJA 3S99A 4PY2A 1AB5A 3KVYA 1O95A 1RM0A 3N5KA 3PQEA 2C3YA 4IJ5A 4LXQA 3UFXA 3ZJ4A 3BWMA 5IC6A 5IS2A 2X23A 3A2NA 5ALPA 5JJKA 4MP3A 3BX1A 1JFFB 1VIMA 3Q8MA 2J3JA 4QDUA 1R00A 1T4MA 7GPBA 4I66A 1SXJE 3DBRB 5A3VA 3QKRA 1XTKA 2B92A 2NSYA 3CUWA 3JQBA 1E3MA 5D3KA 2Z95A 4EM6A 2B7LA 3WXMA 4COKA 4UXIA 1B4DA 4LX8A 4CV2A 3G0HA 3FNBA 4LNAA 1XYYA 1E0DA 1NZJA 2NXCA 3QWFA 2A0FA 3U13A 1ZM4A 5JFTA 1PR1A 3RF7A 4D46A 3G0BA 1BS1A 1VI5A 2WZBA 4Y2PA 1GZUA 4EYKA 5A3RA 2WAXA 3RJTA 1PGNA 4FB4A 4YWHA 4EFKA 1FS5A 4P4SB 1OHHA 3FY4A 3IT2A 4G0YA 4C4YA 3RTAA 1P6XA 4EW1A 1HDXA 1MX3A 1D2NA 3AHFA 5HOEA 1I0IA 2O2IA 2O3JA 4GRAA 3U7IA 3NNDA 2QL5A 4UNNA 3LC1O 3PQCA 1U65A 5DB4A 1E3TA 1TGYA 2EBUA 3P1JA 2ODQA 4Q7MB 4N1AA 1CUFA 1KMMA 1XAIA 3PGKA 4MPTA 2I62A 1K8ZB 3E61A 3QXCA 1ICEA 4E5MA 3DPSA 3JYNA 4GE0A 2DHCA 2V4ZA 4P81A 1PDOA 3VNRA 1DELA 3HP1A 1CNEA 4D8YA 4JT8A 1AH2A 2AOTA 5E1DA 3R9KA 2D3TA 2YL2A 3HCOA 3CFYA 3U3DA 4ER6A 4B2IA 4DIOA 1VB5A 4RCVA 2CMDA 2JCBA 2L19A 5F1OA 4JLJA 3G5MA 5D51S 3AXSA 1U0TA 1YQ9A 2VNIA 3A1VA 4ZC1A 4KJXA 1L8AA 1DEXA 1YKSA 5E6RB 3QXGA 2J4CA 4RXUA 2PH3A 1TLFA 5AVZA 5B1IA 5T64A 4DC1A 3K4HA 3M3HA 1AGYA 1M1UA 4E1BA 5K0ZA 3DT6A 1DT3A 2DF8A 2JJ2D 4WESB 1LTHR 4AICA 3UJ8A 1E6CA 4X20A 3ZEAA 1Q3TA 1DAOA 1QCDA 4FYIA 2CEKA 1CQIB 1R6AA 3GRKA 2FN4A 4GPZA 4P2GA 3ORHA 4Z9BA 4CKWA 3DFKA 5HQTA 1DEAA 5K8IA 3C70A 2Z6QA 2W2KB 3EAFA 4UBOA 3R7LA 3OZGA 3PJEA 4ZZ0A 1X8KA 2G9QA 1DGQA 3QUQA 1U7HA 2W22A 4FFPA 1SKBA 3PS9A 5EXSA 2WWXA 2HWXA 3EF3A 1FQKA 4MWBA 4ZZ1A 1JQAA 1AUOA 2W48A 2X3FA 1II8B 1NXXA 4FHCA 2WQ6A 1BTOA 1DBQA 2NSDA 5FHRA 2XCQA 3E1GA 4OFXA 1K68A 3CR8A 3IERA 1G63A 2I91A 1HM5A 3HJAA 2Q2NA 2ZROA 1NFQA 2KM1A 5K3AA 4X8OA 1IEQA 2AG8A 2REQA 3ROKA 3QPBA 4Z4CA 1LI7A 3B1KA 1Z82A 2ZKLA 5NULA 3EUEA 1KYVA 2OD7A 2ZJ2A 2VKTA 4EY8A 1QWSA 2HSZA 2PZMA 5CNJA 1UDWA 1MX5A 4PFJA 1V45E 2PX8A 2RAUA 5J3JA 1EXWA 1LPOA 1DI0A 2FKNA 2OHFA 3M6IA 4G24A 2G9NA 4OLBA 2W6JD 2G04A 3L0OA 4OV6B 4WDRA 5ALJA 4RTSA 1I5OA 5I9IA 1LH0A 4DMGA 4FXOA 1N2CA 1F4LA 1NVWQ 2EX4A 2XD4A 1XXHA 1L5RA 2GN1A 2QGFA 4FLEA 1SR8A 4BQQA 2EIHA 5GADl 4L51A 4YAEA 1CY0A 1ZMXA 2XOKD 1W581 1Z17A 4PCAA 3VR5A 4OHXA 5FWDA 3B89A 2SCUB 3VKHA 1YB2A 1ZNYA 3L7YA 5A3QA 2JA2A 4BP9A 4ESOA 4ARIA 3R75A 4W5JA 1O54A 3DT9A 3QIVA 4B4WA 5DI9A 1F8XA 1B1AA 5JTTA 4V0QA 1VYVA 1F0KA 1FA9A 1XELA 2YVUA 3MGGA 3R44A 4JLDA 2Q3MA 1XYGA 4JP8A 3A2KA 3GCGA 1FB5A 1K88A 1PT7A 1U6JA 2V0CA 1EP9A 3T9FA 2Q3EA 2EDCA 2I4TA 4LJ5A 5IWAB 3HB4X 1XCJA 1RT9A 5KNCA 3BGDA 1TYZA 3EIFA 2WOJA 4MH0R 4C0LA 3MPOA 4CU2A 3EOAI 3R5FA 2GK6A 3NDPA 5CMLA 4K9MA 4LZPA 3BTUA 3PVSA 4HDMA 5H68A 4KW7A 5I8WA 5IZCC 3F1LA 1WXFA 2XMBA 4GXNA 3QW4B 1Q1AA 2QQEA 2H1RA 4HDNA 5CK5A 4IQFA 5EHNA 5HDQA 3T3EA 2IXTA 3PYMA 1TB4A 2WYHA 3H19A 3AEZA 4ENTA 4JCOA 3RS8A 1JG7A 1CZOA 2UUAB 3I6QA 3EXHA 3HP4A 4OVKA 3PXGA 2RGNC 1C3JA 4QAJA 4WSOA 2QNIA 1XF9A 2O52A 3FI9A 3KZMA 5CAEB 3TTTA 5E38A 3N8DA 2AEFA 1JBQA 3GV0A 4FT2A 4W99A 3EP3B 5FP0A 3RVKA 1W47A 2ZJ6A 3SEFA 1KJJA 1V7CA 1W94A 1U0GA 1IH8A 2R1UA 1D1PA 2X1VA 3NJ8A 5FJIA 5CB6A 3M6VA 3K70D 1WDKA 2ORED 2SHKA 1DAEA 2RH4A 4PS0A 2X4LA 4UHEA 2CSXA 2OC9A 4GGOA 2DFLA 4ZOQI 3ZHBA 5HR5A 2OOSA 2XH8A 3IP8A 3W3AA 1DADA 4I9NA 4Q0MA 4CI0B 1Y4DE 1Y34E 2VF7A 1LQ2A 3RYHA 1OAKA 4GPTA 3U4GA 3EIOA 2OCXA 3IVXA 4JC4A 2PV7A 3NEAA 4Q48A 4W1QA 3DMPA 3F98A 2R7LA 2GZDA 4V3BA 5J9FA 4HDSA 1UFOA 5G1OA 1EFUA 1K7FB 1PVVA 4R1QA 3CX4A 3BULA 4R2IA 1XZJA 3TL2A 2PJRA 3L7LA 4DVJA 1U81A 3IOMA 4Y9DA 3W9YA 2V7XA 4ARZA 4YUWA 2YY5A 1A97A 3RFCA 3HJRA 4L85A 4AUEA 3FETA 2RARA 4PXYA 3ZNQA 4G67A 1XTPA 2IF2A 3I73A 2QVBA 4F84A 2CHVA 2J9XB 1GEGA 2FMHA 2G36A 3PEWA 2AMFA 3K73O 3UW3A 2ZVPX 5KREA 3CH6A 3U7FB 6ADHA 1F6DA 4AC9A 1N2EA 1GLGA 2WFZA 3OD5A 4UM9B 1EDZA 2FXVA 2CUNA 2Q3FA 4MW9A 1WZEA 3EIWA 4E09A 4EF4A 4U0KA 5MF6A 4WGGA 1UOOA 1FNBA 4BOYA 2C5HA 2IOHA 2J9ZB 1WF3A 2QTVA 4JOCA 1PGJA 4CMCA 5BUCA 2YBEA 4HFJA 5JADA 5KQGA 2B1IA 3M49A 1F48A 2EATA 2QLLA 1QYWA 1P61B 2JGAA 4R9VA 2BKAA 3D8RA 4GFDA 2IPLA 5EQDA 5LQSA 1RW4A 4JFAA 2I8AA 2GEDA 5C5DA 2MTBA 3NHSA 1JDNA 2V8OA 3N2NA 4Q39A 1UIRA 3QVXA 2H52A 2XEXA 3B1XA 4X1KA 3V8PA 3M6LA 1OCEA 5FPSA 5A4JA 3KQHA 4P82A 3NG1A 4JGIA 4OYHA 3MJCA 2J33A 2AFVA 3NORA 3MERA 5IM4F 1XQ9A 3M1AA 4LY3A 1PLKA 4TXNA 3H5TA 3I61A 2AXNA 2W2PA 4IWXA 1UEXC 1C0IA 2FPXA 3D02A 4MRSA 5EMKA 2DERA 2PWBA 4YCCA 3CPSA 2RHGB 2FUKA 4FMPA 2VJKA 5HFNA 2I71A 1FTWA 1DC4A 2G9ZA 3NDBB 3QKRB 2A2ZA 1YBFA 1Y8RA 3W2GA 1MEOA 1S4QA 1Y1KE 3FNQA 4LXGA 3RNOA 2OK8A 3AUYA 1GPUA 4EH1A 5DSTA 2OZPA 4RVSA 3B51X 1XJQA 1CRWG 2QKYA 2WD7B 3DTNA 4FNOA 4R9NA 4EDFA 1I4TD 3O4IA 3WLHA 3Q15C 1YMUA 5IBQA 2A9VA 2JEOA 1CLEA 5FAXA 1C8LA 4IIEA 1PQPA 4B3TB 2AF3C 2OLJA 4LJ7A 4NOJA 1FFCA 1VDZA 4IYJA 4XPIA 3VU3A 1V5EA 1KP3A 5B12A 1HDCA 3N39C 2BFFA 3UEOA 4PYOA 2R6ZA 2GPTA 2WINI 4GKAA 5K3EA 3PU6A 3TW8A 3E0QA 3GBVA 1IBRA 3LWBA 4EOGA 1WQ4A 2WI8A 2IKSA 4MX8A 3OQOA 2JNWA 2NVOA 4UNSA 1F7UA 2WE7A 3PGMA 2ECOA 4NK4A 1VHWA 4IDHA 5EKUA 3H0EA 1VGVA 3EDCA 1TA9A 5CJ2A 3IJPA 2E48A 5TV2A 3RTEA 3HUTA 1EWTA 3DVAB 3MN1A 4G4IA 1A8UA 3GMIA 3LYHA 1UT6A 5GP1A 2O7VA 3ADOA 1I6LA 4MW5A 2PH1A 5B3KA 1AUXA 1UDCA 3VQTA 1H2YA 2W2XA 4MS3B 4LHXA 4M6WA 4RH1A 3BB4A 3UMSA 3FCOA 3D6FA 1UMDA 1TZ2A 1ZGZA 3D7MA 2WHQA 3KRTA 3UMRA 1YO6A 4MUBA 3NBUA 3U3KA 4Y6LA 1UXOA 2ZYDA 3D1JA 3MSCA 4UBJA 3CB4A 1TIKA 3G2MA 4PRLA 4NG5A 2C59A 3BKXA 3FWYA 3I62A 2XB6A 3BEDA 1W4AA 1N57A 3UYKA 1JEQB 1USVA 2DUUA 1RTKA 2D1QA 2DQKA 3CUVA 1Y7IA 2J46A 1MC5A 1QGZA 2BMFA 5T8KC 3OQBA 4PNHA 4HQLA 2OZEA 3QPWA 3LUCA 4X44A 1RC8A 1WZUA 1T25A 1FYXA 1Z6XA 5LNK1 2QM0A 1P5ZB 1M8PA 1I33A 3BIJA 5AM4A 1P17A 4OH7A 3E8XA 3ASZA 3OLXA 4JDUA 1AHHA 4XVRA 3OSUA 1E3QA 3BMQB 3F3MA 4NHOA 3IQFA 3EF1A 2YJ4A 4MVYA 4PW0A 1K7CA 1B3RA 2PUJA 2B4TO 2CDNA 5AKZA 4L95C 4LS3A 1PHPA 4MB0A 5EZSA 2ZRFA 3HFSA 3GRVA 1HF3A 1TEXA 3F6BX 3TZEA 4C4TA 3CJTA 3CO0S 9LDTA 1GFIA 5EIBD 4A5OA 2BY4A 2D1FA 4LE0A 4ROTA 1RPNA 3DKPA 5E3IA 1Q0LA 2V96A 3TI7A 4Y6SA 2ONJA 3VPFA 2BKVA 5DXAA 3FR8A 4E5KA 5MN4A 3I6ZA 4AB1A 3A0UA 5DJ5A 5FLKA 3RIMA 1UWLA 2CGEA 2NU6B 4WVFA 2F3TA 3IUYA 1H6BA 4DC9A 5FEUA 4DPKA 1C3OB 4EHFA 1P1HA 16PKA 2ECQA 5BORA 3T9EA 4HR7A 3LPDA 5FRDA 4ABTA 3SY8A 3FMVA 4BO3A 1RXVA 1N77A 3JD4A 1RXYA 1YMQA 1KSGA 1Z4OA 1NZFA 3G9TA 1DVRA 4HUQB 4IWNA 3RIEA 1J7JA 1NXPA 4BO6A 1X1CA 3SXUB 1XEFA 2E21A 1ZN9A 3PGVA 4M7RA 3T4XA 3CUEF 3PYXA 4OFWA 1DIRA 2XUPA 2AUTA 2Y4NA 1SC3A 2C1ZA 3PUZA 1UFQA 1MVOA 3JVIA 4F7WA 2AH5A 4LSMA 1YE3A 2VYFA 2MJLA 2RCYA 2V1XA 4GM4A 4KMSA 3GXBA 3TSAA 1R9JA 1IRXA 3NHZA 5KOHA 3F90A 1N5OX 2WYUA 4LHWA 5EC8A 3MFQA 3WIEA 1XU7A 2LDXA 1J39A 4LF6B 3B20A 3Q8WA 5DCYA 1J49A 4O8ZA 2VZEA 5FBRB 1VLLA 4DLNA 3E6AA 3W04A 1SVOA 1U3GA 4LRQA 3HMKA 4IZOA 4J3JA 1USKA 2NO5A 4G5GA 4MVWA 2XQGA 5K0NA 4Y2QA 1X1DA 4IX9A 1RPTA 3B5IA 5C0OE 3DVQX 2JRLA 3H1AA 2XTNA 3W5BA 3P2OA 4G4SO 2YS6A 4KQCA 1C9JA 3SDZA 3P9ZA 2B20A 2NUPB 1LTKA 3FR7A 1O8BA 2C5SA 3UBTA 2G5PA 3J80A 2FQ1A 1RYDA 1PRYA 2FDRA 2TMYA 2A33A 3EXHB 3JWGA 1Y98A 3ZXXA 3EJ6A 2H48A 1HL3A 2X15A 1ZH8A 4QGFA 3ZGYA 3T7DA 5J1TB 3GW8A 1E3EA 4D8XA 3VR4D 3TK1A 5FWYB 3EA5A 5BWLA 4JI6B 1WZ2A 5HUQA 4AG3A 2QAIA 1QF9A 3I28A 4YJ3F 5K0GA 2PANA 5A62A 3U1VA 1XAHA 2W0SA 2E37A 5EVJA 5BR4A 1E8NA 2P9BA 2J59A 3B1WA 2A1UA 1SWWA 4JSTA 3QFHA 3IKJA 4RDCA 2XDYA 1N0UA 4JB8A 1E5XA 1V8BA 4EAAA 4JYMA 3LBAA 3IVRA 4HZUB 2CMFA 2EBHX 4UUQA 1UFVA 2QN9A 3JASB 3UJAA 1V5GA 1OYWA 2BBWA 1TJYA 3NM5A 3C4QA 3Q2OA 4M1YA 3RAJA 2POCA 4MWCA 1P8AA 4UQOA 3U39A 1YOVA 5IJ0A 2WDPA 1QNFA 2CL5A 3JAWB 4K3UA 3ZOZA 1CUVA 5DN6A 1VKJA 2JRCA 1Z38A 2ZAMA 3QUTA 3AUTA 3WAKA 3KYBA 3ZWQA 3EGIA 1ZZEA 1ISJA 3I1IA 2C88A 4HATA 4W63A 4UCQA 4Q21A 1FXSA 3C7KA 4B17A 5J47A 2DY1A 2JLVA 3NTRA 3AJRA 4F3NA 2Q49A 2R1ZA 3GUVA 4H17A 4CV3A 3MUFA 3OE7D 4WK2B 3QXJA 1Y33E 1C14A 4H77A 4NZPA 4XJVA 4Y2RA 1K0FA 1CF4A 4KXFB 3H8JA 8ABPA 1ONSA 1EG2A 3A9CA 3OKFA 3HR4A 3BL5A 2OCPA 4RVCA 4C7BA 3OMWA 3HBJA 3FFTA 4BRSA 9ABPA 1Q17A 2BDUA 3IMFA 4EMTA 1OREA 4QA9A 4BDSA 2JFOA 2WWHA 2MSEB 3V1MA 4YI5A 4AJNA 4BJ6A 1NXWA 4G07A 3HXKA 1TQHA 2B1QA 3EC1A 4TUYB 3WKDA 4ATNA 3ZJYA 5F1KA 4N0QA 2HQOA 3I4CA 4K6FA 1LUAA 1SIOA 2P4UA 3F5FA 3GN2A 1OIXA 3BFVA 4J29A 2R6HA 1KO5A 2ZJBA 3OY7A 5SZIA 4C21A 4HZGA 1KI6B 1FP2A 4DC0A 1SHLA 1SXJC 4ID9A 3DW1X 3MD9A 4B7UA 4QPCA 4D0LB 1V6CA 1L4HA 1O58A 1BJTA 2ZR0A 2ZIVB 1N6PA 5F1YA 1BDJA 5IX8A 1QU3A 1Z33A 3L6UA 4CDMA 1AT1A 1JE1A 3GUZA 3LKVA 1WCIA 4Q9NA 1Q7CA 4CNBA 5EJEA 2QYSA 1QZTA 4CM6A 3RQIA 1X9GA 2D7CA 2YUIA 3DM5A 3H9JA 2XZOA 2AFIE 3BXEA 1U2PA 4K9SA 2UUPA 3AV3A 3MEQA 1IPFA 1Q5PA 4XOUA 4EW3A 5B6PA 1EUYA 4DJ5X 1DU4A 2VJMB 2QSUA 1H6DA 1S8NA 4YCNA 4FFBA 5GZ3A 3ROXA 4RSGA 4B5KA 2WHXA 5U4XA 4AQ7A 2VDMB 5I7UA 3C8HA 1NDQA 4E15A 4IMIB 4Z6KA 4BY9E 4EA7A 2FETA 4C7OB 2B61A 1MT0A 1Z4PX 5HBGA 1DT5A 3T7AA 5C7YA 3DE2X 4NF2A 1YJCA 3V4FA 3EIUA 4WASA 3USCS 3HK2A 3ZHSA 3AY7A 1GL6A 4IJQA 3ZE7A 1QIEA 3TJZA 4TXLA 1X3SA 1QK5A 1XRJA 3CC8A 2QLNA 1I3LA 4KXMA 3U7QA 3H18A 4YT4A 2YDXA 4IMPA 3H6HA 2BFNA 2WLSA 3WYDA 3DVAA 2OVBA 5CEFA 4Z4FA 3DYBA 2V6GA 1Q91A 2V3CC 2YZ2A 2AN4A 2Q29A 3KFLA 3UMJA 1KPIA 4PYLA 1KDRA 1DOAA 3O95A 3OEEA 1IC6A 5A3SA 2V9CA 4R8MA 3NEJA 4L8VA 2ZU0C 4EY7A 3BWEA 4OHRA 4L3OA 4LSGA 1U8TA 2CJFA 2WU0A 4EG5A 1M6YA 1QGOA 2PH7A 3E35A 4DM4A 4BO7A 5BV0A 1VP9A 3PNSA 1A8QA 4Q12A 1N9KA 2GD2A 2XGGA 3L06A 1X39A 2X6QA 2G6TA 2JAUA 3HPRA 3IHKA 3S44A 1EESA 1D1SA 5ERYA 1C0KA 1KMHA 3O2SB 1OY1A 1JHXA 2FVYA 5COAA 1MOPA 3HE3A 1JB1A 2F90A 3NIDB 1AS0A 3OZCA 4TKZA 4XD2A 2XVAA 4UBLA 2FOXA 1Z5NA 1EGHA 1PQWA 3DO8A 1ORDA 4DPMA 1Z0ZA 2HC9A 1C9KA 4CEHB 1JR3D 1MQ8B 2C9ZA 2ZAGA 1OA0A 3FF1A 4H16A 1FFXB 2VRWA 4TRRA 1NPDA 1SOMA 3CLKA 4RD6A 3WYFA 4B74A 1Z7BA 1XZ8A 2PXCA 1G8JA 4RC9A 3OUUA 1O89A 1YR2A 3AFIA 3BMQA 1E9CA 2DJIA 3LD9A 3V8NA 4R51A 1ZVKA 1JXOA 2JLSA 3FROA 1WV0A 1FC0A 3LHFA 4JP2A 4LYGA 3UWMA 3N7UA 3ADBA 5IUNC 1SHTX 1PIWA 2Q22A 1Z4NA 2A0WA 3UWDA 4UUMA 3M6WA 5ALVA 1AN0A 5TX7A 4RLSA 1Z5ZA 1E4EA 4G97A 1YDHA 4V2UA 1QVRA 5B36A 4KOEC 1ND5A 2Q99A 1Z0DA 4R2MA 3MCVA 4L22A 2IC5A 4LHSA 3U0VA 1L7PA 1HLGA 1N4DA 2H07A 2WJHA 4PYRA 2C7OA 4RHEA 2O8CA 1PR2A 3EWIA 2DUNA 4EHJA 4F5EA 1PJRA 2GEUA 1GQ2A 1P7WA 1Y1QA 1C9EA 2G25A 2LDBA 2VPXA 1QGED 3A6FA 3AUSA 1BKYA 1G5PA 1Y1RA 3HWX1 3LK6A 4P38A 5FTWA 3S2GA 2PT6A 4HVTA 5C18A 1YS4A 1X0XA 3V34A 2HXYA 4FLMA 4ETIA 5HKOA 3H2KA 2BEKA 3ZE8A 3TX2A 2HSGA 1S2OA 3PEYA 2GAAA 5FL7D 3NHJA 4E3WA 5AVYA 5KOHB 4OK5A 3RIHA 4BP3A 1ETUA 2PO5A 1SG9A 1QUEA 4G81A 4GEGA 5LC1A 1U90A 5JW6A 4F45A 5IXSA 2IK8A 2WJVA 5EUBA 4V0RA 1IBCA 1FL9A 2GR9A 3OKCA 4Q15A 4O8CA 3BGIA 2WR8A 3F97A 3MWFA 2P2CA 4E70A 1DO2A 5F76A 4O89A 4RJTA 2BUCA 2R7AA 4NMXB 3ZQKA 4BP8A 1MV8A 4CMIB 3HDJA 4DJFC 1AQNA 3EEIA 1AKYA 3F9CA 3MJEA 2H2HA 4GYJA 4N0DA 4MW6A 3RIGA 3SLKA 3T7JA 2PGJA 3T3IA 4OBEA 2TRSB 3QLEA 4QDXA 4ISBA 2R00C 2XWJI 1P2VA 3I04A 5JBNA 3MBKA 1RWMA 2YMPA 4G1EB 5EMHA 5BMVF 2GLXA 1NZDA 1C30A 3ZGVA 1A7AA 2NQ8A 1CHDA 2JDID 3IQDB 2HRDA 3NC1C 1YV9A 1VG0B 2YFKA 3WLIA 2YNMC 2YZMA 3QA3E 5FOXA 2CYBA 4MKIA 4Q7JB 1KZ6A 4Y2XA 2Y8EA 1ESDA 5FBQB 4QU0A 2C2OA 4TLDA 1NYLA 2VAMA 4TV8A 2B37A 3ZCPA 5L4SA 3KLPX 2OA0A 1T5OA 4KGZA 1B23P 3H5IA 4DQUA 1G5FA 1GFSA 4M21A 1M1NA 4WUVA 2P2DA 3GRRA 3QPDA 4WI1A 3BSWA 3L4SO 4WK6A 3OLQA 1IY8A 2ZK7A 1L6IA 1FXUA 1MVLA 1XQYA 5JVDB 2HBQA 1DJMA 1S89A 5ALUA 3MHTA 3B1YA 3K8YA 1T0JB 1EP2B 3ESAA 3O75A 4DR5B 1AGPA 4DRXB 3BC1A 4X6XA 4LXYA 1BWQA 5IDQA 3KTAA 1RTTA 3MMNA 2ECFA 5JLAA 5EIEA 3AR3A 1PL7A 2YHAA 4AF7A 3KKZA 1PR0A 4B2YA 1GA4A 2PAFA 3A2MA 4TQAA 4FNAA 4CYMA 3JZFA 2YWRA 2DBQA 3H16A 1MKYA 3KXIA 4MCJA 2FW6A 1VECA 2GF2A 3KT8A 3Q3JB 4I4LA 1OXBB 3M9LA 2OGSA 3TTXA 4DCGA 5K0FA 4QDJA 5H8WA 2O3SA 3VTAA 3FUWA 1FSZA 1TJ5A 3LPLA 4FJ1A 4AZVA 4UTXA 2W2TA 3LM8A 3AM5A 1S2DA 2XUKA 1S1CA 3THWB 4KYVA 4TVKA 3TR5A 3MMZA 5E3HA 5HZKA 5ADWA 4KREA 1KMQA 3AFOA 5HFJA 3H3JA 2JBHA 2DAPA 1I4WA 1N2JA 4DL9A 3G8AA 3CLTC 3FOZA 1QP8A 2VTKA 3UG6A 2W4MA 1GA1A 3K6JA 5K8VA 5K8TA 2O8DA 1UJ4A 2P9HA 2QD1A 4YBRA 3LUFA 5LQNA 5DWDA 5KBYA 5I5EA 1KTVA 1ZMTA 2IYYA 3FCUB 4ARCA 2ZUUA 1R0ZA 2QTAA 4ZGWA 4QSMA 2PUFA 3RFUA 4W7HA 5CA1B 4MUEA 4BB9A 4J3FA 4R8KA 2DQZA 5IKPA 4L4SA 2Q3LA 2XF2A 3FYUC 3O74A 2JEZA 4QELA 5I47A 1ZGHA 3OIYA 2BP7A 4Q37A 5YASA 3ZY3A 4A8TA 4D3SA 1QVAA 1MLDA 3JQAB 1XALA 4LDJA 1KIAA 2HJHA 2XPCA 3ZHCA 1D7AA 3KAPA 4KPUB 5CITA 4C6HA 4ZZ3A 1GNLA 2DFDA 2W98A 4C6RA 4AJHA 4E33A 4X7MA 4HN2A 2ABWA 4BNFA 3VMMA 2KQUA 4PSUA 2BI7A 4RJIA 2FSUA 3CX3A 4N3GA 1TM4E 2A30A 1ZVJA 9LDBA 3FX2A 3MOGA 3P0HA 1LY1A 1ZD1A 4CF6A 2FEMA 1L8XA 2GCIA 5CGZA 1HG0A 1OI2A 3O1JC 3EP8B 1LFDB 2PLAA 4FOSA 4QBKA 1HDGO 4ZAXA 1VG9B 2OWEA 2WKQA 5H1YA 1N7IA 4MVJA 3PT9A 3VR0A 1NU8A 3B3QA 3OT5A 5SYNA 3WRXC 4C1NA 5GIOE 4MQFB 1V43A 3IHWA 2IQ5A 4RNDB 3PJDA 1I5RA 1EFCA 1EFVB 1UPUA 3ANLA 5EMJA 3Q10A 3VBCA 1SK8A 2HQBA 4MUJA 4RPJA 1USIA 3I34X 4GUAA 4S1WA 1TGVA 1UOQA 2ATXA 2QX7A 1BQEA 1DKRA 1VJTA 1XZQA 2OORC 2BCGY 2Q3BA 1M54A 1E8DA 2R11A 3PFBA 4GR9A 4LG1A 3SDSA 1FSSA 3JAKB 5C34B 3UNXA 3UV3A 4A8JB 4DLLA 2I4NA 2JGKA 3BXHA 5FOWA 5ARCA 1ABFA 3L46A 2B36A 2Y0CA 2ZKIA 3PFHA 4JBXA 4DIMA 2JC3A 5HWSA 4MHOA 3C97A 1TM7E 5JMPA 2A7XA 1V4NA 3X1ZA 3THRA 4R1NA 3OX1A 1UINA 3PNBA 3WO0A 3KSMA 2BGIA 1ZJ6A 5CPFA 1L7QA 1T91A 1X80B 3VYRB 3VZRA 2AOVA 2LKCA 3ECAA 1RZVA 3PUVA 4IXMA 3HN7A 3WB9A 2FVXA 2GKOA 4NH4A 4QFCA 1S2NA 3NVKI 2OB2A 4HTFB 2PR2A 1MB0A 3NP9A 3TOVA 2HU5A 4HMOA 3HDGA 3TIXB 5K3OA 2MSLA 5BW8A 2V0GA 3D4BA 5KHLB 4BMPB 3WGGA 4JJZA 2IELA 3H5RA 5G0VA 3L0PA 1Z45A 2W6OA 2V98A 3G1UA 2HA6A 3MCAA 4XCVA 3WK6A 3NTLA 5B58C 3S2IA 4CRWB 1E1QD 5JCJD 2ISSD 3JATA 1E18A 2I7XA 3PITA 4HLCA 5EUCA 5KKAA 4AX4A 5GQSA 2Z57A 3L49A 2O7QA 4F91B 2B69A 5H7XA 3N2YA 1M8KA 5CNMA 3REQB 5ALSA 3LX4A 4WBNA 3ZV5A 1T0UA 3CBGA 4UMEA 4X41A 4A92A 1ZIYA 2RMKA 1WW3A 4WBNF 4NICA 4WOCA 4OSPA 2AOTB 1ZOOA 2XRMA 2E4ZA 2H2GA 3A6DA 2YZ7A 2PT7A 1G16A 1G2PA 1X8JA 2O1WA 3KB1A 3UJPA 1DAGA 3DV2A 4B5LA 1DC5A 2VDJA 2ZVQX 3F6RA 1UT5A 4OHMA 3H17A 2J6BA 2NZXA 3CB2A 4F2GA 2QS9A 1UF9A 1C8KA 1OA1A 2XV1A 3W3AH 3AB3A 3N1UA 2NO7A 1SOVA 4KMMA 4LXXA 5CHEA 4NCJA 3RC9A 1P72A 4RJ2A 1K3FA 1FY2A 2ZYWX 3MRVA 3EXHC 2NTVA 1XEWY 3K1AB 3U4IA 1FP7A 1OPXA 3HHEA 1DQRA 4KGVA 4R1SA 1RRPA 4EGQA 2F59A 4FGJA 3AUUA 3VRHA 1KFBB 2ODBA 4LBYA 4F0JA 3SKXA 1U8CB 2MSDB 4M8IA 3WQRA 3MINA 2IW3A 4W9NA 1L8QA 4MV7A 2BGRA 2RK3A 3LC7O 5D7BA 1Q50A 3B13B 2GX6A 3EGVA 4RVGA 2GJSA 4V0SA 4Q9JA 2VNHA 3HDTA 1NTOA 4GOOD 3TMYA 1EZ1A 2L42A 1R3UA 1W8DA 3E4DA 3JD0A 3R3YA 2IPAB 2QPTA 3KHKA 1H42A 4XDGA 3X1JA 4QU8A 2D5LA 4N7BA 1GEEA 4AXBA 1ZSYA 4WOKA 4Y6GB 3DB1A 5D6NA 1VLQA 3EQZA 3TSWA 3W3AD 3AIOA 4PHHA 5F2EA 5KDOA 3ZXYA 3T5MA 1R12A 3RJMA 4IJUA 3EPHA 1KKUA 1QYXA 4ZDIA 2CV0A 3F3KA 3RRNA 4O3MA 3EEYA 4B33A 3GRZA 2LXNA 2PFKA 1DTWB 2J08A 4IW3B 3H8WA 4GVLA 3MJHA 4IFIA 2FN8A 5BOSA 1NN1A 3OU2A 4KWEA 5AVWA 3CX8A 3TNLA 1ECFA 2FP4B 4MIKA 2H4WA 1P74A 4US1R 5SY6A 1NJ8A 3BMXA 1N0VC 4J49A 1NM5A 3ND6A 2XVMA 1VLJA 2D62A 1YFZA 3E5RA 2ZYHA 3N0WA 4YFVA 3AR2A 1MRSA 4YJ2B 4QOFA 3GLIA 2IHBA 2NUAA 3OQ1A 3QVWA 4LOIA 5EZYF 5KU7A 2EJVA 3LC0A 3NWBA 3AJAA 4XYEA 5DK4A 3UATA 2ZRCA 2DLDA 2O1XA 2PNJA 2RKWA 5BSHA 1H0SA 4ZOEA 5I9SA 4HB4A 4MB6A 2J3IA 2BR3A 1IOVA 4OATA 2UVDA 5JXIA 5LZ8A 3GEEA 4J7UA 3IT3A 1ECCA 2IODA 2EGHA 3VGPA 4X64B 3H2HA 1V48A 3WLAA 2NUBA 1JQKA 3VR5H 3O83A 4P31A 3P32A 5ALGA 1MJHA 2REOA 1VYHA 3UM9A 1KBZA 1YZLA 4MQEB 4PIVA 1XTRA 5DP2A 3D6JA 2CK3A 2Z5GA 1E5QA 1OYVA 1Y42X 4MV5A 4CGZA 1ZNQO 1E4VA 3KTAB 4Y98A 3EC2A 4HN9A 1ZOIA 5IT9A 2B7CA 2V97A 1GNPA 3LQFA 4WERA 4AWXA 1YFLA 1EVIA 2XYGA 2Z6VA 4K28A 1MB9A 1EUDA 3SF8B 3VNVA 3IRUA 3B85A 2OQ2A 4Z8XA 3GNQA 1Z0KA 5G1NA 2HV9A 2HHAA 4MI1A 3C8ZA 1KR5A 3SZGA 4DXHA 2R48A 2WIFA 4ZK2A 4AK1A 3WA7A 4KIWA 2NYAA 1KC1A 4BVJA 4YCLA 1Q92A 1DKMA 2NO4A 3AW9A 5LDGA 2GSDA 2JARA 4DLAA 4QZVA 2BGKA 3TCKA 3H2BA 1T6BY 2A84A 2X1HA 2A9KA 2YXNA 4XTCS 1TUIA 2FE4A 1NVBA 4GP7A 4IFBA 4ZVLA 4C04A 1EJBA 4OHPA 2DETA 1VLHA 1N5IA 3ST7A 4G01B 1P0PA 3OEED 2Q45A 3FVVA 4URHA 3UANA 2FSPA 3AU8A 3R4CA 1RJFA 1TTPB 3DP7A 3K9FC 2P2NA 4KXVA 3EXIA 3EZ9A 4PZYA 4WA7A 1A95A 5ALRA 2F9MA 4C30A 3VH1A 4CMEA 3TG8A 4LNUA 1QP7A 3FYUB 4GWGA 1BX1A 3SQOA 1GU0A 4C4RA 1S5PA 2CF5A 4D56A 1QIHA 1NF9A 2VF8A 4Z99A 1BFDA 1MEEA 1IK6A 2XMZA 3ZCXA 3RYFB 5FNVB 1P9OA 3KAJA 4RHYA 4MGEA 5KUTA 2CHGA 3X1XA 5ALDA 3SSOA 1ID1A 4MCAA 4J6FA 5CCDA 3AKEA 4R4JA 2UYQA 5GV8A 2HRZA 3T95A 1HURA 3LU1A 2HD4A 2G1KA 1Y0BA 1P7YA 3EZFA 4PBTA 1YQWA 4ML3A 4N49A 2I4RA 3PJRA 2QW0X 4KDCA 4L8WB 2PX6A 4HLDA 4LEIA 4M9SA 3CW9A 3R3UA 2A35A 1WHSB 4QOIA 3UGTA 4WUTA 4MIEA 3OCUA 3DOUA 3OHMA 2JFPA 1A7KA 4ER7A 1I4DD 3OD1A 3DAPA 4MR7B 4N8SA 1LPSA 1EJ2A 2C92A 3A6JA 3QM1A 4CQMD 5JH7F 4WDQA 1IBKB 2IS4A 1BN6A 3LUPA 4YREA 3RYTC 3BBPA 1S8OA 1V9LA 4A27A 3TLCA 3TTWA 1M5RA 3HY4A 4B3XA 1XHEA 1UPAA 3CUYA 3JQCA 4N5LA 3TNFA 5A1JA 4DIKA 1NYRA 3C3WA 2FRDC 4FIZA 3RRBA 4C4XA 1T9KA 1VMKA 4EHIA 3O4FA 1LJUA 3SKYA 4BO1A 5FOQA 1KR2A 3UN1A 4FZ5A 3W9UA 2WSBA 2YJ6A 2HMSA 4N5DA 1A2KC 1CB7A 1I4LD 5ECWA 1LPNA 4P92A 5ESXA 4B83A 3VR4H 1CF2O 2BFCA 1T1JA 1CHNA 4LMAA 3VU9B 3EP6B 3TTSA 2D06A 3ZV6A 4GC5A 2VCEA 4G8JA 1A77A 1P7PA 4D0GA 4M0PA 3RU2A 1U04A 1Y1SA 5JPCA 2DP4E 1S2GA 1V7ZA 1HLPA 1X80A 3AR8A 1J20A 3THYB 4TYWA 4OA8A 4X6UA 1Y1LA 1GARA 3CF2A 5AMXA 4GUDA 1MUUA 1T15A 1X14A 2XHEA 2IE0A 3H2JA 3QYFA 1BEZA 5AVQA 5JSQA 3GDOA 4L08A 5AD1A 3S2UA 4YUAA 3HJCA 2YZGA 4R1LA 4HXEB 4HNAB 2GNPA 4UXJA 1O6ZA 1E2KA 1YU9A 1QYRA 2XZDA 2RFLA 5CT9A 4AJLA 5CLJA 1T24A 4PIPA 2QI9C 2SNIE 1I79B 3BTSA 4O2AB 4Q16A 2XA2A 3FUCA 3C87A 1JIUA 2H9AA 2X0DA 1HI9A 2FPIA 4J0CA 2FR8A 5LOVB 3EP4B 3DKRA 4B9EA 1SNYA 4XIFA 1PVOA 2YJNA 2HIAA 4NAHA 1PZGA 2E5WA 3TUTA 2I7TA 4FX5A 4K9NA 4RDXA 2F3QA 1W59A 2R85A 4PLWA 4TZKA 3EGCA 3PDIB 1ZL2A 2XODA 4K9PA 4UVGA 5E9AA 1ZVQA 2XNJA 1F3OA 1HOXA 2MSNA 4L0MA 4OMCA 1SRQA 3PX7A 2IPNA 3NB0A 1NKVA 1FP4B 2AW3A 3A10A 4C0AC 4Y0VA 1CUXA 4MUFA 2Q07A 1PJTA 2BHSA 2QVZX 1MG5A 2YDYA 3NALA 1XX6A 4X91A 4C6SA 4RIIA 2TMDA 3K20A 3L07A 3M6UA 4XYBA 3A7DA 1XTIA 1BXZA 3M2PA 4I4TF 4L15A 2GZSA 4EKNB 3BT7A 2PVCA 5BVHB 5GAJA 4DQXA 2A5FA 1SJ9A 2E1RA 2NO9A 2BR4A 4HQFA 1UMDB 2QJTA 3I3SR 3HP7A 4RY0A 5HILA 2WIJA 1FYWA 2YC4C 2A5DA 4PLHA 2A67A 2V8BA 5K2MA 2WPDA 1HO3A 1OX5A 2XB4A 1CR4A 3K0EA 5L3ZA 4ZHSA 1XEXB 1OBFO 5B1EA 2JFYA 1TCUA 3B53X 2MR5A 1W0KA 3GLTA 1Z4IA 4LI0A 5EJMA 2OYCA 4IIVA 2A5LA 4I36A 1YR9A 1K5PA 4RZUA 4DMLA 2JAHA 3ZJ5A 3GPIA 1O96A 1QZXA 2FFBA 2VQ3A 1CRQA 1XDUA 1XJ5A 3MINB 4GYWA 4LRUA 1GZ5A 4NULA 2ZETA 4BX9A 5EXXA 3TGWA 3R3HA 4DNFA 1KQGA 1QIFA 3EZ2A 1ND6A 1IJKA 4HI0E 3WJAA 3RBZA 1I9CA 1SUIA 5G0SA 1WBJB 1UBOS 4IF6A 4JUDX 4MIOA 4XD7D 1NC1A 2Q28A 1GGVA 4I2VA 1V16A 4UUOA 3S6JA 1G5RA 3M4ZA 3I30X 3MWDA 1O9HA 5JV5A 4PZDA 2AOUA 3IP6A