1TLTA

Crystal structure of a putative oxidoreductase (virulence factor mvim homolog)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
304
structure length
304
Chain Sequence
KLRIGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADSLSSLAASCDAVFVHSSTASHFDVVSTLLNAGVHVCVDKPLAENLRDAERLVELAARKKLTLMVGFNRRFAPLYGELKTQLATAASLRMDKHRSNSVGPHDLYFTLLDDYLHVVDTALWLSGGKASLDGGTLLTNDAGEMLFAEHHFSAGPLQITTCMHRRAGSQRETVQAVTDGALIDITDMREWREERGQGVVHKPIPGWQSTLEQRGFVGCARHFIECVQNQTVPQTAGEQAVLAQRIVDKIWRDAMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR mviM HOMOLOG)
publication title Crystal Structure of a Putative Oxidoreductase (VIRULENCE FACTOR mviM HOMOLOG)
rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 86
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1tltA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1tltA01
1H0KA 1HT0A 1I2BA 1BXGB 4IJUA 4BO4A 4BNLA 4DQXA 4ZJUA 5JXWA 4EI2A 2I5PO 3WWZA 2D2IA 2JD1A 4J4TA 1PS8A 1I3MA 1WZEA 4KDEA 1B8UA 4Y6PA 3PQFA 4D43A 5U1PA 4ALNA 5JCJD 1LDNA 1QYVA 1P0FA 1BWSA 4QO7A 1H2BA 2IODA 4EEXA 3AFMA 3JD1A 1ISMA 5CDTA 1GQQA 4BIIA 4MVJG 3ETDA 5EJ2A 3WX0A 3PGXA 3A1NA 1YKFA 4BNXA 5H81A 1J4AA 1NPTO 3JQ6A 4CLRB 3E9NA 1LTHR 3KTDA 4WGGA 4IZHA 2EWMA 2X23A 5HWSA 3PHIA 1H6CA 4FFPA 3PYXA 1C0KA 2BFMA 4JIGA 3VTFA 1XEAA 4UAGA 3I1JA 1GV0A 5AXAA 2P4QA 3A06A 5DNAA 4E2YA 4QFDA 5HM8A 4LISA 1CWUA 4CMKA 3DMTA 2WTBA 3GFBA 4ZU3A 5FI3A 2O4CA 4D0SA 4IXWA 2AW5A 3JQEA 1DIAA 3TPCA 1B16A 3I3OA 4OYRA 1UJMA 3KZVA 1KY5A 5HRUA 3ZHYA 3C7CB 3WYCA 4K6FA 5T5QA 4I08A 1QYWA 1PGNA 3DHNA 4BNWA 1ZMOA 4GGOA 3KYDB 2EIHA 2ZYAA 3QVXA 3MEQA 1GQ2A 3DBRA 5LDGA 2W2KA 3MTGA 1IPEA 4GMGA 5T6BA 1CF2O 1Z75A 4KUGA 4RZIA 5CDYA 3AK4A 3WIEA 2YYYA 5A05A 2C82A 4DVJA 5IN5A 1A5ZA 4ND2A 4RF2A 4D44A 4DMMA 3JQCA 2WD7A 3CH6A 5THKA 3WFJA 4E13A 4P4LA 3WMWA 3QLJA 3STHA 1HZJA 1YOVB 2VN8A 1G0NA 1CJCA 1XG5A 3ZU3A 1X13A 2V7PA 3GVIA 5DBIA 2BFAA 3GEMA 3BMCA 1H9AA 1SBYA 3WTBA 4MKRA 3S55A 5L7TA 4TZTA 2OHXA 2NQ8A 4XR9A 2PZJA 1A7KA 1PZGA 1A7AA 1PL6A 1UXKA 1Z74A 4YJDA 3ANLA 3F5QA 3AOGA 2CDBA 1U2GA 1HSZA 4LVUA 3LT2A 4J2HA 2OUIA 1DLJA 1UDCA 2AEJA 2OO5A 4NBRA 1PWXA 1VKNA 2X9NA 4AJLA 5JCXA 2Z1MA 1XU9A 1NFFA 3I52A 3ROKA 2EKPA 4LSMA 3G3EA 1C0PA 2EW8A 4CQLB 2PNFA 2WWRA 3IP3A 2WE7A 1Q0HA 3U4IA 4OHUA 4OQZA 3C1AA 1E7QA 1P33A 3HFGA 1KC1A 2RAFA 1Y9EA 3RBZA 4Y98A 3DZHA 2H1SA 1IL0A 3RD5A 1ZMTA 3GVPA 4BMNA 4EUFA 2PH5A 3H9JA 3WTCA 4UUPA 3W8FA 1FMCA 2DKNA 5DT9A 1AXEA 4F3YA 3DZFA 4NR0A 4YDRA 2UAGA 5G0VA 1EK6A 3FTPA 4Z9FA 4L73A 4CLRA 2Y68A 2VYNA 5CPBA 1XIVA 3OHSX 2O3QA 3PHLA 4Q3NA 1JVBA 5EQDA 1GAEO 1ZK1A 1N7HA 4ND1A 3KRTA 3BTUA 4RVGA 3ZWWA 3T7EA 3D64A 1BXZA 3EGOA 1YO6A 2VNSA 3Q6IA 3ZV3A 1UAGA 2AQ8A 2CZCA 3DBHB 4IUYA 2EEZA 4RQUA 3AFNA 1EE9A 3V8BA 5KVQA 2ZQYA 3F46A 1Y7TA 3KYDA 4J90A 4J2OA 3ZWPA 3R0IA 4E5KA 5JYFA 2R6JA 3L07A 3GVHA 4J7UA 5C37A 3PQDA 4JN6B 1E3IA 4DLAA 1MGOA 4CQMB 3NJ8A 1H6BA 5CPFA 5JDIA 1I33A 3IP1A 1QLHA 4DREA 3QVTA 1FDUA 4A0SA 4XIJA 1N5DA 2PZMA 2G5CA 1Z7EA 3OP4A 4LMRA 1GYQA 5G0UA 5ENDA 1JKJA 1JN0A 5IJZA 4R68A 1YOVA 4PLPA 1HYGA 1KS9A 4UVHA 1ISJA 5DBGA 1YDWA 4TSKA 1HE4A 4ZGWA 2GN6A 1ZBQA 1DC4A 4MVJH 2BLLA 1PR9A 3GZ4A 1NQTA 4ZRMA 3RCBA 2CSUA 3GLQA 2QYTA 4PLFA 1ZKMA 4WPGA 4TRNA 3E03A 1ORRA 4XYBA 1HDRA 3JD0A 5AVOA 4GMFA 3G1UA 3QA9A 5IZ4A 1CDOA 4N5MA 3VDQA 4NPCA 4OH1A 1E7YA 3C7DB 2RBEA 3K96A 3PJGA 3OIDA 3GAZA 4CM4A 2BH9A 3BMNA 2GUGA 5JAZA 3WGYA 2X5OA 3WIDA 5EQFA 2FR8A 1CEQA 4BNHA 2DC1A 4G2NA 5F1PA 4L76A 5F5NA 5I9LA 1PTJA 4IS2A 1T2DA 3HZZA 4NNJA 5A9SB 3Q2IA 1I01A 1E3WB 3WICA 1XHLA 3BXXA 1YXMA 4PZEA 4RPHA 3UVEA 1BRMA 1JQBA 2FHSA 4RV9A 4AJPA 1TT7A 2NVUB 1U5AA 4DIOA 3HB4X 4H16A 4NBWA 5DCUA 3WWYA 1YWGO 1NPYA 4I1IA 1DOHA 1CIVA 5IDQA 2QZ9A 4FJ0A 4NG5A 4NFYA 1HXHA 2DPGA 1SNYA 4U7WA 5A3VA 3QQPA 2V6MA 4LCJA 2OP1A 1HDOA 4ZQFA 2X6TA 3SJUA 1A27A 2O3SA 4IPTA 1ZVMA 1OC4A 1DFGA 1FDSA 1IB6A 3PZBA 4NK5A 3EY4A 3JCZA 3GEGA 4YR9A 1BXKA 1X1TA 5CHEA 2QQ5A 2P5YA 3AUUA 2EP5A 3X2EA 5IDXA 1E7RA 4O0LA 1B14A 1MB4A 3PYLA 1U28A 5A4DA 5IZCC 3B6ZA 1TB4A 5G0TA 1XYGA 1BW9B 5CG1A 3ITKA 1YL6A 1UXIA 1DB3A 1WP4A 1YL5A 2EW2A 3I6QA 1SCUA 4BNJA 2GO1A 3B70A 4XWYA 2I3AA 1J6UA 3VH3A 3KEQA 5J23A 2PZKA 2GRAA 5CEJA 4B3HA 2Q99A 1LRJA 4EW6A 5KVCA 4M49A 1OC2A 4E5YA 3RC9A 3EC7A 3RJ9A 4I5GA 4ZRNA 1YQDA 2JJYA 1PJCA 3EDMA 3S2EA 1H94A 4OAQA 2ZK7A 3ZW9A 4CPDA 5JO0A 3I4FA 2CDCA 1EEHA 4MVJP 4ZVVA 2X0RA 1EFLA 5TF4A 1HF3A 1Y8QB 4HFRA 3PFWO 4B3IA 3RC7A 2Q2QA 1DC6A 3H9QA 1UR5A 4YVFA 1L7DA 1MA0A 4JNKA 3LC7O 1TT5A 3PJDA 1R4NB 1QP8A 4BNFA 3PEFA 5CG2A 2DTDA 2HCTA 3MJ4A 1BHSA 3JD2A 1N9GB 1LLCA 3KO8A 3H8VA 3LF1A 4D79A 2F1KA 4L4XA 5JO9A 4CL3A 1HDXA 1J49A 9LDBA 1VL8A 1WAMA 1YB5A 2P4HX 3EVTA 4ZQGA 1VE9A 5TIIA 4XD2A 2P9EA 2EG9A 3M2PA 4B4WA 2EP7A 2OBYA 3GZNB 4FFLA 3SJ7A 1PJ3A 2X0NA 2VOJA 4FC7A 1GV1A 5JYEA 3C1OA 3D4NA 2VHXA 4IDAA 2IZ0A 2Y1CA 3ZWMA 1UXJA 2LDBA 4CMHA 2BF7A 2FN7A 2IEBA 4NHEA 2O50A 3OBBA 2Y67A 1Y8RB 1E3WA 1R4MA 3GQVA 2J3HA 4MVJM 1W73A 1X7GA 2AE1A 3CZMA 3OIGA 4S1VA 1U4SA 2E49A 1D7OA 4HXYA 4L8VA 2AXQA 1P1JA 2HK7A 3C3XA 3D0OA 1B2LA 3BHIA 3JQBA 3NT5A 3WBBA 4YQZA 4A26A 4HFMA 5FYDA 4A2CA 3HN2A 3F3SA 3MJEA 5L7WA 5BSFA 4IJVA 3DONA 4PN3A 1KEUA 3EZLA 2R2GA 4I9HA 4JBHA 2WM3A 4AJNA 2X7HA 3L9XA 2RH8A 1VJ1A 3JQFA 4BNKA 3HHPA 3JQDA 1JW9B 1PZFA 3PLNA 1PQWA 3HQ4O 5HTOA 1T24A 4QFCA 1NFQA 2Q4EA 2VYND 1UP4A 2QIOA 2AG5A 2I76A 3UAGA 4AJEA 4XDYA 3ASUA 1LX6A 3AM3A 1LLUA 1K0UA 4IQ8A 2D59A 5HS6A 3DZGA 1LBEA 2OMEA 4O63O 1WZIA 4PG5A 4WNCA 2UUOA 2X22A 1ZO8A 4JP2A 1HLPA 3N58A 2OORA 1ID1A 1GPJA 2OZPA 3GUCA 2YHIB 3DDNA 4BGEA 1ZXBA 3BMQB 5T8KC 1V3TA 3HDQA 2C20A 3VVCA 1LDBA 3LF2A 3TFQA 3DAFA 4CV3A 3T4XA 3L4BA 5FEUA 4Z0TA 3FR7A 4ILKA 4BMVA 2NSDA 3L6EA 4WKGA 3PHHA 1IHXA 4BO6A 2OFPA 2FY8A 3IUPA 1T1SA 2B5VA 1YBAA 3RFXA 1U3WA 1XCBA 3UW3A 4A27A 1F14A 4AJ4A 3KUXA 4GX0A 3LYLA 2EKQA 2ZB8A 1N2SA 5TGDA 1DC3A 4MPDA 3AUAA 4GPD1 5ILGA 1ZJYA 2XOXA 3GG9A 3QVOA 3RUFA 4D0RA 1RPNA 3ONFA 4LMPA 1IOLA 2HJSA 2GN9A 3U4HA 2ZTLA 3ENNA 2GN8A 3K31A 1EBUA 2GNAA 1AGNA 1NHGA 2DTEA 1R37A 1LEHA 1WMAA 2Z95A 3AI3A 1I2ZA 1ZW1A 4Q9NA 1DHRA 1SPXA 4XQGA 4PLCA 3VPHA 3GZNA 1ADCA 2AHRA 5B4TA 4O59O 2VYVD 3OH8A 1KVTA 2O7QA 2VTDA 1GUFA 3F4LA 4YBZA 3RUEA 4QXMA 1SOVA 5KCZA 4WASA 1X14A 2JFHA 4FFMA 5L4NA 5BSEA 2A92A 5C3MA 1F12A 3DBVO 4YJFB 1QORA 3HJAA 2I3GA 1ZEJA 1QV6A 5JAIA 1Y8RA 4TRMA 3WNVA 1EK5A 4JGBA 1LQUA 4IMPA 4II3A 4DPLA 4DBVO 4GKVA 3WGGA 4QQRA 4WUVA 1ZSYA 4XRRA 2PWZA 2X5KO 9LDTA 4I8XA 4OO3A 4RORA 5JC8A 1DDOA 4DYDA 3LQFA 5I7SA 5HA5A 1KVQA 1AHHA 5KKAA 4ZQEA 1NQOA 4CV1A 1GZ6A 3MJSA 3VOSA 5AOVA 2HMUA 4CR7A 1GYPA 4D3DA 1XQ1A 2QZZA 4I5EA 3AY6A 5JDCC 4UUNA 4CLEA 1WVGA 4GSLA 2I9PA 4YAEA 3RASA 2JD2A 4J16A 3ZV6A 3ZWYA 4YJGA 4CJXA 4U8GA 1ZXLA 2Y1FA 1T2AA 1D1SA 1E5QA 3INGA 4P4NA 1XDWA 3IDSA 3P2YA 4UEOA 1YGYA 2P91A 2FSVA 3QWBA 3WJAA 3BAZA 4R4JA 3BA1A 3EAGA 3K2EA 3OA0A 3O4RA 1NR1A 4CM8B 3ETEA 4FJ1A 2Q4BA 3EZYA 1T1RA 3W4KA 3BMQA 4DYVA 4ID9A 3I6IA 3GPIA 3OSUA 5GMOA 2AQKA 2DQ4A 2OL4A 3DZIA 1KERA 1U3UA 2CMDA 5EL0A 4TRRA 3VZPA 2ZJ1A 2Z5LA 2QRLA 3K73O 2BFOA 4I9UA 3O38A 2WE8A 1T2FA 3PRJA 4KQWA 4JP3A 1DSSG 4K1LA 3D5QA 2BGKA 3OJEA 5FI5A 2H5LA 3KOUA 5H83A 4FS3A 5A03A 4E32A 2HMVA 3UICA 4OQYA 4HP8A 1JAXA 1GR0A 2CVOA 4B7CA 5AXCA 4UVIA 4BO7A 2JHFA 3H6KA 3ROQA 3OEWA 5B37A 1K6IA 2YDXA 2J5QA 1VJTA 1LA2A 1ZFNA 3RIHA 5U4QA 1I3KA 1WDMA 4E31A 3WSVA 1Y1PA 4B3JA 3ZHBA 5JNLA 3NX4A 3TJRA 1XELA 3OA2A 2DU8A 1TVEA 1KEVA 2VUUA 3GPDG 3ICCA 1NNUA 4CL8A 1B26A 2Q1WA 3ROPA 2G0TA 1NVMB 3LC1O 3D4PA 2ZJ0A 2P9CA 3R6DA 3VZRA 4J0FA 4FGWA 4WLEA 3A9WA 3I9MA 8ADHA 5KTKA 2EGGA 2YQ5A 4WOKA 3KM0A 1PX0A 1DIHA 1G0OA 4R1NA 3FNHA 4DRYA 4OM8A 4BO5A 1Q7CA 2I65A 1U8FO 4EBFA 2HU2A 3JYLA 3VZSA 4L4RA 4XZ3A 5IDWA 2NNLD 1I0ZA 3P2OA 3Q9NA 4FSHA 4YAGA 3TQHA 5TRTA 1H6AA 3Q0EA 3TZKA 1BVUA 3DAPA 3RSHA 1A4IA 3HWRA 5MDHA 2Q45A 2B5WA 1PJLA 3DTTA 3PK0A 4DMLA 2B35A 4WOJA 1MFZA 4QEDA 5IFLA 3PJEA 4CMIB 4JCOA 1WXDA 4AG3A 4K9DA 3QP9A 1Q7BA 3IAHA 1GL3A 2Y0DA 4NMHA 2R00C 3NDRA 4U5QA 3AM4A 3GUYA 4D3FA 4GKBA 4MVJI 2BRUA 2GLXA 3KLPX 3COSA 4YRBA 2CF6A 1IE3A 4M55A 1Y81A 2UYYA 2PGDA 1CERA 1UH5A 5KNLA 4IM7A 3OF2A 3OECA 4W7IA 3LVFO 2VHWA 3IL2A 1EE2A 4M86A 5GZ3A 1G6KA 3KLMX 1WLYA 4BQRA 2X9GA 1TA4A 2EJVA 4E12A 1PZHA 1MLDA 5ADHA 1GEEA 4G81A 1I24A 1T26A 1RYDA 1U1IA 2QRKA 3PIIA 3WR5A 1P1HA 1VJ0A 5DOVA 1W4ZA 4D42A 1E1NA 1VPDA 4YJHA 1LSOA 3C24A 2VWHA 3GNSA 3TNLA 3WGTA 2C0CA 2X0IA 3PJFA 1MP0A 4CM7A 3CSDA 2HRZA 4DIBA 1QYDA 1FK8A 4TVBA 4Q39A 1TXGA 2V6GA 5ILOA 1I3LA 3RUCA 2FP4A 2HO5A 2DFDA 3RUAA 5K0ZA 2CFCA 1DRWA 4MINA 3GF4A 3RROA 4LRTB 2VNAA 1JWAB 1SEVA 4QTZA 5IXYA 1A9YA 4XX0A 3L77A 3VDRA 2DLDA 4L0QA 6ADHA 1PGQA 3ZNNA 4HV4A 1F8FA 5L4LA 2B0JA 1UP7A 5F3RA 3PHGA 5JMPA 4BB6A 3GHYA 4N18A 2YUTA 3ST7A 4R9RA 4Z3DA 1L7EA 1LSSA 2QHXA 4U0KA 1VC2A 2NWQA 3RUHA 4ALMA 2O2YA 1E1MA 1V3UA 3CZRA 4BO3A 5A02A 1EDOA 3MZ0A 3C7AA 2E6UX 1DAPA 3UF0A 3W1VA 4AFNA 4XIYA 1KIFA 1EMDA 4NH4A 3L4SO 1P74A 2D0IA 4BO2A 3FHLA 4FJ2A 5ICMA 1PQUA 3WGOA 3BTOA 2NM0A 5MGBA 4Y6SA 3VH4A 4JX8A 3KB6A 1V3VA 3NV9A 3C8MA 4IDDA 3ABIA 4JJGA 3UHAA 5BNIA 2ZYGA 1BXGA 1ISFA 1B7GO 3X2FA 3MJVA 2PV7A 2HUNA 1RYEA 2JAPA 4FOOA 4JQCA 1IUKA 1XR3A 3ZV5A 3KXDA 1PJQA 2EXXA 1K5HA 1Y5RA 5B12A 1HDGO 1T2EA 3IC5A 1ONPA 2PH3A 3A14A 2C7GA 1I36A 2V65A 4YYZA 1ENZA 5LC1A 5L3ZA 4UVEA 4CODB 1IZ9A 4EZBA 3DOCA 1PJ2A 3K9QO 4GLOA 5KJ1A 4CMIA 3AY7A 4YQYA 1OOEA 2O2SA 2ZB7A 3TSCA 5CDUA 3TZ6A 1JTVA 1E3EA 2GGSA 4OXYA 2E48A 2BELA 1ONNA 2JL1A 3R3SA 4PG7A 1N8KA 4TKLA 3KSDO 2V6FA 4WK6A 3L6OO 4J9UE 4U0JA 3GA0A 3O03A 4RVUA 1XU7A 1FDTA 2PKRA 3TN7A 4E0BA 2RHCA 5ITWA 1MFPA 1NVGA 1NASA 3PWSA 2C54A 2BKAA 4MVJF 3ZI0A 4D3SA 3JYOA 2O3UA 4CLHA 2C5AA 4JXKA 3DBLB 4BO1A 2QRJA 3F1LA 2O4UX 3M1LA 1T4DA 4Y8VA 3AUSA 5BSHA 2VOEA 2DAPA 1EFKA 2WJPA 4LVCA 5I9NA 3QHAA 4CM9A 4JROA 4HBGA 2Y93A 4BNMA 3HDYA 2G1UA 3D7LA 4L74A 4PZDA 2Q1UA 3RBXA 5JE8A 5IZCA 4W7HA 2B69A 4B8ZA 2YV3A 4W9NC 3F9IA 3PI7A 3QWIA 1ULUA 4PG4A 1WNTA 1XKQA 3C85A 4MP6A 1ZIDA 4CM3A 2NU9A 5BT9A 3RU9A 3GDOA 4R5HA 1HZZA 1SC6A 1IY8A 1YQGA 3H5RA 3FD8A 2E82A 2VRCD 3UH1A 3GN1A 4DTIA 4XEHA 4Z9YA 4FFRA 1DFIA 2VYVA 2JKVA 4KWIA 3CIFA 4CV0A 3CKYA 2ZCVA 4II2A 3H2ZA 2AQHA 4BOYA 1HL3A 1GY8A 4AJ2A 4BMSA 4Z0HO 4IY1A 4Z3KA 1BDMA 1GUZA 1YE3A 4RF4A 4DLBA 4YAKA 4R16A 4PG6A 1M6HA 3MWDB 3F6YA 3DO5A 3W6ZA 1ADFA 4CUZA 3I83A 1SB8A 1VKOA 4INAA 4PLVA 1GQYA 1H9BA 2Y1GA 2PFGA 1E77A 3HNPA 3TOZA 4EEZA 2YDYA 2W98A 3B1FA 2FR1A 3V1UA 3DZBA 3HFSA 4CQLA 5JYAA 3LK7A 1B0AA 4AJKA 4F46A 1AE1A 3ROMA 3W4JA 2UUPA 1C1XB 2CUKA 4GSKA 3PGJA 4E6PA 3ZNQA 2X1HA 4L75A 4MOWA 1EUDA 4DPMA 5TT1A 1JU9A 2IRWA 3NGXA 3WLFA 4O1MA 2YHUA 5BR7A 2VWPA 1OFGA 5IG2A 1LRLA 1DAOA 1MXHA 2HMWA 4GQAA 1ZK2A 2HMTA 1Q7GA 3A4VA 3ZWNA 4J6FA 2AA3A 3ZDFA 2IYOA 3EW7A 3T4EA 4IZIA 1ADBA 4M1QA 4J43A 4R1TA 3SVTA 1U7HA 4E2ZA 2VRBA 3GHHA 3FI9A 3JQ7B 2NTVA 4N5LA 3INTA 7ADHA 1PJSA 1XA0A 3ZNOA 3FWZA 1NQ5A 4YT2A 2VUSA 4IDCA 3QY9A 2GR9A 3WB9A 5ITVA 3NT2A 1EBFA 3P7MA 4W6ZA 3NUGA 2PGJA 1P45A 4YRAA 3DBHA 2H9IA 3W8EA 2PLAA 2Y1EA 2G76A 2HJRA 3GVCA 2WEKA 3PWKA 2IEDA 4AL4A 4B8WA 1N1EA 1V0JA 2PKQO 3V2UA 2JCYA 3VHRA 4BGVA 1NQAO 2HQ1A 4BNTA 2Q3EA 2I99A 4AJJA 4MVJE 4PLYA 4EYEA 3DL2A 1P31A 3UOGA 4ITUA 3TF5A 4XJSA 1GDHA 2PD4A 3JYPA 2Q50A 1C0LA 5GY7A 3UCFA 4Y6RA 3M6IA 1LSUA 4YCAA 3L0DA 1U7TA 1X1EA 3H65A 4IJKA 1DBVO 3CPSA 1Y5MA 4E5NA 2NV6A 4Q3CA 4MJLA 3MWEB 2B4QA 1R15A 4O5OA 2H6EA 2AEMA 2OP0A 3FPLA 4XA8A 1ADGA 2QG4A 2BMAA 2X9VA 1PJTA 2EERA 4CM1A 5JBIA 3ICPA 2DM6A 4B7XA 4PVDA 4BNNA 4DA9A 3OEYA 3BYZA 3LDHA 1LUAA 2F00A 1AHIA 2ZB4A 2CNBA 3DOOA 4FC6A 5T8KA 2VHVA 3ADPA 4GBJA 4PVCA 3ZWVA 3GH3A 3C1TA 1O5IA 4JJFA 4BNYA 1MG5A 3PVZA 1E1KA 1KVSA 2GD1O 1IULA 1A71A 1R12A 1V6AA 4OSOA 2EF1A 4BV9A 1ZJZA 4D45A 1IYZA 1HE5A 1UDBA 2O3TA 2C2YA 3G79A 1B3BA 3H2SA 1ZSNA 2VWQA 4YAJA 4CLXA 2GPTA 2P9GA 4GX2A 4BNGA 3PIDA 1PGPA 1W0CA 3IJPA 1GCOA 4ZD6A 2P5UA 5A9SA 1S6YA 4E4YA 3S2IA 1ZK3A 3AOEC 4B4UA 4GLLA 2HK9A 1CQJA 1N7GA 3M1AA 2X0JA 4K28A 2X4GA 3IS3A 2BI8A 1A72A 4I5FA 3VKVA 2NVUA 1CRWG 3V2GA 1HLDA 1ISIA 4IQ0A 5A1TA 3SBOA 1E3JA 3QV1A 4F6CA 4PLHA 3CMCO 1FDVA 3G1TA 4GH5A 4TVOA 5ENVA 3GFGA 4BHTA 3I23A 4H3VA 1BDBA 2DVMA 3JQ7A 1PZEA 1O0SA 4GL4A 2WYUA 3V5NA 1I30A 4H7PA 2A94A 3GK3A 3JQAB 4U6SA 3WDSA 4BO9A 1QG6A 3WNQA 4TRJA 2O48X 4OKIA 3Q11A 5JSFA 3RFVA 2O7SA 4J91A 1K3TA 4K6CA 4EITA 4MO2A 4H15A 1R0LA 1HSOA 4DWVA 1E6WA 1LRKA 1WWKA 1K89A 1KEPA 2FPIA 2OBNA 2FZEA 4QT0A 2NU8A 2B37A 1BW9A 2NUAA 2DT5A 1SB9A 4LSWA 3FPCA 4YB8A 5A3JA 4R5MA 1DO8A 4RZHA 2NU7A 4MIOA 3AUTA 3CE6A 4KZPA 3SX2A 2J3KA 5K6AC 5JDCA 1DIGA 4WLNA 5TC4A 1SO8A 3CINA 5IDYA 1VSVA 1YB4A 3RKUA 5EINA 2HMSA 3DR3A 1HEUA 2OGUA 5GZ1A 1HYHA 2H63A 4AJ1A 4XGNA 2UVDA 4WEQA 4AVYA 4M54A 4EJ0A 2X5JO 5BNFA 1LSJA 2CY0A 1RKXA 3ZU5A 3WYBA 4W4TA 3JQ9C 3SLKA 5JC1A 1Y8QA 2E4AA 3OICA 2I6TA 3JD4A 2B36A 1DHTA 4CM9D 1Q1NA 1BGVA 1R4NA 4FDAA 4I5DA 4UEKA 4TKMA 5DP1A 2EJWA 4EJMA 2TMGA 2QX7A 2W2LA 1P1FA 4ALIA 3PZRA 1N9GA 3I9NA 2EGHA 4DIFA 3GRKA 4IIUA 4Q3EA 4NFHA 1X7HA 4GI2A 4J3FA 4DUPA 4Z9XA 1UXGA 1XQ6A 1DIRA 4IDBA 5AYVA 5G4KB 4OMUA 5G2OA 4PFJA 1ENPA 4WCFC 3KVOA 3QVWA 4HUJA 1EQUA 3WGQA 2J6IA 2HK8A 1U8XX 2DBQA 4DPKA 1UXHA 3KV3O 1PJ4A 4KTTE 2G82A 4C7JA 3UKOA 1ARZA 4ND3A 2JHGA 1DEHA 3EUWA 3ON5A 3MJTA 3U09A 5J9GA 5FF9A 5L45A 3RKRA 3F47A 4RJTA 5L7YA 2ZIZA 4IQGA 3U4DA 4FR5A 5F1KA 1CYDA 2IDZA 2AMFA 1V9LA 4BO8A 4E2WA 3KSUA 4OXKA 4RLHA 4BGUA 5KJCA 4E21A 1NTOA 1GEGA 2YFHA 1EDZA 2YZ7A 3GMSA 4J1QA 5JLAA 1E6UA 4OJNA 3I9LA 4XR4A 1Z7BA 4CR6A 5K9ZA 4NBUA 1V35A 1Y9AA 1E3LA 3ZHXA 3VAZA 2E37A 3U3XA 2CF5A 2Y0CA 4IBOA 4URFA 3JQAA 3GGPA 4EDFA 3IMFA 3PLRA 1PL8A 2RH4A 4XYEA 1O8CA 3H5NA 1QSGA 3H9GA 4IDEA 4Q3BA 4R69A 5I7FA 1QV7A 3JV7A 3OJFA 2NVWA 3IUSA 2VTEA 2X86A 1U3TA 3GEDA 4UEJA 3RBVA 2FRDA 3AWDA 3ZN2A 4WCDA 3INRA 2VCYA 3DHEA 3HDJA 5KJEA 3AI1A 3PDJA 3EYWA 1B15A 4KOAA 4FB5A 1PIWA 3F5SA 1PGJA 2HSDA 3FRJA 3GN2A 4J9VA 2YHIA 3RI3A 3NEPX 4A7PA 2R00A 3LT4A 4RVDA 4DLLA 1R66A 2WMDA 1TEHA 1YQXA 1R6DA 2C59A 1AN9A 3DOJA 4FGSA 2VRCA 3HE3A 1M75A 2VHZA 1KBZA 3ZNPA 2HKIA 1YDEA 1PSDA 3AM5A 1PJBA 4N5NA 4NBVA 4WLOA 3I5MA 4GWKA 3GG2A 4NU6A 1NFRA 5KJFA 4JJIA 3PTZA 2NTJA 1LLDA 4CQMA 3U62A 3IKTA 3V1YA 3ONDA 4NZ9A 3OIFA 5IF3A 2GSDA 4HKTA 1OAAA 3FBGA 4MKZA 1YJQA 2Q2VA 1N1GA 2IXAA 3GRPA 5TJ9A 2C5EA 3DFZA 3DC2A 4HNHA 2JD0A 4P8RA 5A04A 3I4CA 4WE3A 5AXDA 2J3JA 3E82A 3E9MA 3ZW8A 1NAHA 2RIRA 3BMOB 2W8ZA 3ZWAA 2WD7B 3R3JA 4EUEA 1XLTA 1YB1A 4BNIA 4CMEC 1K6JA 3HN7A 2CVZA 4PIVA 3RC2A 4BL5A 4RLSA 1AXGA 5KJ6A 3D3EA 2VHYA 1K2WA 1PEDA 4DL9A 4FBGA 4LCEA 3TL3A 1NYTA 4RCVA 3JQ8B 3R1IA 1YJ8A 2Y05A 4YJFA 4R54A 1M6WA 4NI5A 1HDCA 4OXNA 3U4CA 4A73A 3PHJA 1ZK0A 3LSYA 5C7LO 5JAMA 3K2BA 5I7VA 1YBVA 3PXXA 4RF3A 4XKJA 4J1SA 2HRBA 4YT8A 2BGMA 4ND4A 3ZGYA 4GAEA 5B4VA 1MUUA 3H9UA 1UUFA 5L40A 1JKFA 4FOSA 4DQUA 5DN9A 2PGLA 1FJHA 4IDFA 2V6BA 5C5IA 4J4HA 2BHLA 1Q0LA 4OOFA 1H2HA 3H9EO 4O6VA 1ZNQO 2G17A 5G4LA 3NRCA 3PQEA 3QE3A 3EHEA 4KMSA 1BTOA 1E0DA 4MVJD 3ZU4A 4E5PA 3KEOA 3ZHZA 4ZQHA 4A5OA 1F0YA 3HDHA 4CLOB 1YVEI 4B4VA 5A5EA 3EVNA 2D1YA 1JDJA 2RHRA 3MTJA 4DC0A 3CEAA 2ZQZA 1ZUD1 4NU5A 3B1JA 2Q2WA 4PG8A 3DFUA 3KYCB 3WQSB 2JAHA 3U9LA 3WS7A 1DC5A 2I66A 1QYCA 4WNIA 4XB2A 4ND5A 2EHDA 3ZV4A 3PFFA 2PD3A 4CM8A 3IQDB 3ZU2A 1WDLA 4RDHA 2JCVA 1MXFA 1VI2A 4MDHA 5M6DA 4R41A 2ZTVA 5B1YA 2YY7A 2A9FA 3FF4A 5I8ZA 5ER9A 5BSGA 1N92A 1O95A 1M76A 1NWCA 3W6UA 1NHWA 1SAYA 1P44A 2GZ3A 1VL0A 4ZQBA 3JD3A 4WLVA 1KYQA 1LC3A 1B3RA 1QLJA 1EVIA 1KEWA 4BKOA 1LC0A 4WEOA 4J7CA 2FWMX 4RVHA 1ML3A 1HDYA 4AJOA 3GVXA 4F6LA 1Z73A 4TMFA 1RJWA 2I67A 5JMWA 2VUTA 2IYPA 3VZQA 1B8VA 1EZ4A 3I9JA 4MP3A 1LJ8A 4AJIA 2PK3A 5JPIA 4FW8A 1B8PA 4HFNA 4K26A 5EPOA 3N74A 1WPQA 5TNXA 3BMOA 4ALLA 1ZSVA 4TWRA 4NFSA 4LW8A 5TT0A 1AUPA 3VVBA 4CMBA 1HDZA 1Z82A 2DPHA 1LQTA 4DC1A 4QX6A 1O6ZA 5TQVA 3WQRA 1GPDG 4R1SA 4W9NA 2W2LD 4RPLA 2Q49A 4BQPA 5I8WA 1SMKA 4YACA 1EVZA 5LDHA 4EUHA 1DRUA 4R3WA 3JQ8A 2PR2A 3WGIA 3OQ1A 4IGEA 3WJ7A 2XPCA 5GZ6A 3VPFA 1CETA 2ET6A 4TQGA 4ZA2A 2A35A 2PZLA 3D3WB 3RC1A 2HDHA 5JW6A 1M67A 1MC5A 4NJOA 1F8GA 4J49A 4E2XA 4JK3A 3GDFA 4JBIA 1FDWA 3OFSA 4UUOA 4RO0A 3I9OA 4S3MA 3E48A 1NWHA 4R01A 4J1NA 4CUJA 1D1TA 3QWAA 3S2GA 4E30A 2BGLA 3CMMA 3JYQA 1NVTA 4CM4B 2CVQA 3BMNB 3K30A 3WLEA 4CV2A 3AU8A 1DXYA 2Y66A 3SLGA 4R3NA 3G0OA 3A28A 3HG7A 1L1FA 1D3AA 4BS9A 1F17A 1H5QA 5A5FA 3BTSA 3RUIA 4BGIA 4XGIA 4AICA 4KDFA 3KBOA 4LN1A 5DCWA 4XB1A 5DOZA 4WLFA 2P68A 1U9JA 5TSDA 3DMYA 4OGWA 4CLOA 3RU7A 1NR7A 1S7CA 3KSZO 1OBFO 5DDIP 1OI7A 2ZYDA 1GZ4A 3GNQA 3GDGA 5TS3A 1DFHA 2YW9A 3U49A 1DJNA 3DHYA 5DP2A 3DAGA 1P1KA 3DMTC 1XGKA 4CR8A 3DQPA 5HBRA 1QMGA 3KYCA 2D3TA 4ALJA 3ANNA 1TLTA 4BKUA 4HWKA 2PTGA 2P2SA 3JQAD 1HE2A 4FIZA 2DBRA 1QYXA 2Y99A 2Y1OA 1JLLA 3CXRA 4BB5A 4PLWA 2X8LA 3OJLA 4KTVE 4NJMB 4YXFA 1GUYA 5CEEA 4LGVA 1GU7A 2FR0A 4PZCA 4YT5A 3SC6A 3S1LA 4Z6KA 5DULA 1I3NA 3ZWXA 4IINA 2D8AA 1XSEA 1KVRA 1P9LA 3H3JA 1P1IA 3MCVA 1ULSA 2NU6A 2GDZA 5LCXA 4RPKA 1F06A 2C29D 2CDAA 2WSBA 4R51A 3WMXA 3I9KA 1LI4A 3AJRA 1RM0A 1UZMA 5FWNA 1E1LA 4OOEA 3E6AA 4E33A 1U4OA 4BKRA 1EUZA 4UVDA 2GERA 2NTNA 2NACA 3FBTA 4CM6A 5U9CA 1OMOA 1YRLA 5G0SA 2VT3A 1LU9A 4QECA 3WG9A 5EERA 3UXYA 4Y67A 5ICSA 3TWOA 2OOSA 2PY6A 3VH1A 2X58A 1QRRA 4WJZA 4R1UA 1W8DA 3HSKA 1H6DA 2UV8A 1TI7A 8LDHA 1LDMA 1KC3A 4GVXA 1JWBB 4KP7A 3DZKA 4MKXA 2D5CA 1EUCA 2JFFA 4P38A 1O9BA 4ZN6A 3UUWA 1IZ0A 4RVFA 1M66A 4CQMD 3RUDA 5TJHA 2RCYA 3LU1A 5DF1A 1LXCA 3O26A 5CDSA 2ZKLA 1LDYA 3E5MA 5FFFA 4CMCA 1WDKA 3RFTA 5B4UA 5EN4A 2AG8A 5T57A 4PRKA 4MIEA 3AW9A 4XDZA 3Q2KA 3VH2A 2YV1A 4AJHA 1NXQA 2NLOA 1O94A 1TT5B 1JAYA 4FPXA 2IE0A 1I8TA 5H82A 3OQ6A 3UCEA 3D3WA 2IZ1A 3G17A 5L95A 2HAEA 1VM6A 3OETA 5JFOA 2DUUA 2PA3A 1ISHA 4W82A 4XCVA 4KUEA 2IXBA 4MP8A 4XJTA 2NVBA 1GD1O 2TMDA 3O9ZA 3E8XA 1HE3A 3MJCA 4PLGA 5JYDA 4HY3A 3ANMA 4OSPA 4EJ6A 1GTMA 4WCFB 1C1DB 4DBZA 2NADA 3FWNA 4ROSA 3ULKA 4BVAA 5KOIA 1E6EA 4Z0PA 3BHJA 2FOIA 3O8QB 2WDZA 3AI2A 4U6QA 1R4MB 2D5AA 1I5RA 2VZ0A 4KUHA 1W6UA 3AOEA 2Q46A 3BTVA 4A10A 1JA9A 3G49A 3PYMA 3PDUA 3S8MA 2DUWA 1MC4A 2WYWA 5ER6A 4BUCA 5F5LA 3V1TC 2B4TO 4PGFA 2ZATA 4G5HA 4IXTA 2Z1NA 4TZKA 3IJRA 5C7OO 4NJMA 4WECA 3WQQA 4OIMA 3LT1A 2ZCUA 4QO8A 2UDPA 3L6DA 1UAYA 5IXSA 4ESOA 1C14A 3QWHA 3TDKA 3TZQA 3DBLA 1SOWA 1MV8A 1ZK4A 5JDIC 4Y9DA 5A9RA 3GOHA 4IS3A 1Z6ZA 2BFPA 1BVRA 1YH3A 3WGHA 4G65A 4J0EA 2ZB3A 1DRVA 4WLUA 4NK4A 4B79A 5CFZA 3N7UA 3FR8A 3P19A 4RVSA 1RM3A 2FPGA 3NYWA 4YTEA 3W4IA 1CQIA 1DIBA 3DEYX 2Q1SA 3ITDA 4CMGA 3M2TA 1ISGA 1GZ3A 1ZH8A 4RPGA 3WYEA 3JSAA 5HS4A 1V8BA 2HLPA 5A06A 5K6AA 1BSVA 1E3SA 4CLDA 2AE2A 2QW8A 4NQZA 5JAQA 5CEFA 1X0XA 5DZSA 4R9SA 1I10A 3OMLA 3ONEA 1JKIA 1EVJA 3OJOA 3ZCXA 1E7WA 1HETA 1YONA 2XAAA 3E1KA 4X54A 4N54A 3CTMA 2GYYA 3AY3A 2DBZA 3ZWCA 1A4UA 2QYSA 1KETA 3GC6A 3JQ9A 3KHUA 4BO0A 1HRDA 1NP3A 1NPDA 1UP6A 3TRIA 4BV8A 4XYMA 1EQ2A 1Y6JA 3DXFA 1GFSA 3HB5X 1C3VA 3EMKA 3TOXA 3KETA 1PQPA 3D1LA 3ETGA 2A4KA 3D4OA 1X0VA 3VKUA 3KYBA 1T4BA 1C1XA 3D5TA 2O3RA 1RM4A 4KQXA 1LDEA 3NDJA 5THQA 3UGKA 4BNZA 6LDHA 2W4QA 4BKPA 4EGFA 3NTOA 4IIVA 4MVJA 1WW8A 1PS0A 5EESA 1LNQA 3TL2A 1FXSA 4ONEA 1P77A 1BG6A 4HADA 4HFJA 5T73A 5T64A 1M2WA 3NGLA 5BQFA 4GGPA 3DB2A 4WCFA 1GCUA 1C1DA 3IKVA 3PP8A 1GYRA 1MG0A 2C7VA 1I2CA 1VSUA 3DZJA 4P22A 5JCJA 1KY4A 2VQ3A 1RWBA 4C7KA 1T2CA 2AEFA 3GY0A 3NJ4A 3O8QA 1FF9A 5T67A 4C4OA 3HUDA 5KVSA 2ZTUA 3PWZA 3FNFA 1G1AA 4JLWA 4B7UA 2ILTA 3BHMA 3PPIA 3LLVA 7MDHA 3W8DA 4MIYA 3K8ZA 1MX3A 3LC2O 4XYGA 1NBOA 1Q2XA 1J0XO 3SC4A 1WMBA 1KOLA 4L9RA 1H93A 3AU9A 3B1KA 1UZLA 1Z45A 2LDXA 4FD3A 1ENYA 3QIVA 4E5MA 3UN1A 4DQVA 2Y1DA 5KIAA 1E7SA 4D46A 1ZCJA 4BKQA 4YPOA 1SEPA 1EVYA 4LRSB 1RM5A 3MOGA 4YJGB 1X7DA 3QW2A 4ZICA 4FFOA 4A03A 2XXJA 1DPGA 3K6JA 4F45A 5TLSA 3NAQA 3E18A 3JQGB 5L4SA 3UCXA 5DBFA 2OXIA 1J5PA 5COBA 4YAIA 4HNGA 2J3IA 2WYVA 4CM5A 4IGFA 1IPFA 1ZEMA 1HKUA 3ENKA 3HADA 5AXBA 3NKLA 3BZUA 1SZJG 4RF5A 1ZZEA 2EV9A 3B20A 2YFQA 3QSGA 3RJ5A 4UREA 4Q3DA 3SXPA 4RL6A 3H7AA 1PGOA 3IIEA 4NDNE 2CD9A 3Q3CA 3VTZA 4XRGA 2Y0EA 3P5SA 4XGKA 5JY6A 1NAIA 4L4SA 3ZWBA 1K6XA 4BNVA 1D4FA 3V2HA 2JFGA 3OM9A 3QVSA 3H3FA 3FTNA 2GASA 2VZ9A 4LK3A 3SEFA 1A9ZA 2IZZA 1R0KA 2EKLA 2POQX 1O89A 2C07A 3F4BA 3GAFA 3FNGA 3WFIA 1UZNA 1JVSA 3NDIA 5AQ1A 1ENOA 4J4BA 2YQ4A 3JQBC 5G0WA 3ZWOA 4CMEA 4RGBA 2GF2A 1YS4A 5CAEA 1NX6A 3JTMA 1ONOA 2VT2A 3FSRA 2FZWA 3TZCA 3GT0A 3ORFA 4HX5A 1KVUA 4XQ9A 3RAJA 5L9AA 2YV2A 1T25A 1P3DA 1DLIA 3JQFC 5L53A 3TFOA 4W99A 5KKCA 1E92A 1GADO 2BI7A 2FPPA 1D8AA 1PL7A 2PD6A 3GGGA 3H5AA 4FFNA 2WD8A 4XYLA 4IJWA 4IMRA 4FCCA 2J8ZA 3QWFA 2O23A 4J1TA 3DWFA 4UULA 4UUMA 4QSMA 3U0BA 5JY1A 3GGOA 2DTXA 3ASVA 3DTYA 5C7IO 5F21A 3F1KA 3WOHA 1C0IA 3T7CA 4BNUA 3RWBA 4B4OA 4DGSA 3WXBA 1VL6A 1I32A 1QKIA 1P1RA 2ZTMA 5CP8A 4D7AA 5BNTA 4XQCA 1HTBA 5EMHA 2PKQP 3EK2A 4PLZA 2J5KA 1VLLA 3OJ0A 3ZH2A 1YL7A 3LZ6A 3Q9UA 3LT0A 3VC7A 3GR6A 2GN4A 3VPGA 4IDGA 4I9NA 3RVDA 2AQIA 3S2FA 3FNEA 2GZ1A 2DBVO 3K5PA 1YBMA 3U5TA 3L4BC 4NIMA 3JQGA 3FCOA 4M89A 4XQEA 4UVGA 3L9WA 4Q3AA 2B83A 2Q1TA 5L51A 3BIOA 3NT4A 2BD0A 3MOIA 2XXBA 2J5RA 4GX5A 4GX1A 2VWGA 3WSWA 3GMDA 1R16A 1VRWA 4KWHA 4M8SA 4N7RA 5JS6A 3ADOA 4JBGA 1R0SA 2SCUA 4NBTA 2Q22A 3Q1LA 3DBRB 5CDGA 1PR3A 5EIOA 1PWZA 4GWGA 3WBFA 1NM5A 2GCGA 2W2KB 3NTQA 1HYEA 3QJ5A 3QRWA 3OQBA 4P4GA 3LLSA 4GVLA 5F1OA 1HWYA 2VZ8A 1BMDA 4RDIA 5DCYA 4YJHB 4CMAA 4TROA 3TZHA 2FSSA 3JYNA 1Q0QA 3VPXA 3GNTA 4OL9A 5I7EA 2D4AA 3E9QA 4M87A 2W90A 5G4KA 2NQTA 1OZAA 1LLQA 5A9TA 2XF8A 4FN4A 5COQA 2JCXA 4YRDA 5ES3A 1QR6A 1P0CA 4YEDA 2GZ2A 2O3JA 2YJZA 1U2DA 3K92A 3BMCB 4CMJA 5IAAA 5KWEA 3IOYA 3H4VA 1E7MA 2B4RO 5TX7A 1IHYA 1UDAA 5IN4A 4YWJA 4ALKA 1U5CA 2DFVA 4RPJA 3NTRA 4E3ZA 4DXHA 1U3VA 4RQTA 4J7XA 3E5RA 3RQSA 4ZHSA 5KVVA 4PRLA 5I9MA 2FMUA 4PLTA 4PCVA 3UFXA 3VPSA 1XWFA 3CUKA 3FN4A 4FQ8A 1PS9A 1QXSA 1DJQA 1X15A 4CUKA 4D41A 4YA6A 1LDGA 4QUKA 4YT4A 5COAA 3WGZA 3ZZNA 1PU2A 4OKNA 2C2XA 1E5LA
chains in the Genus database with same CATH superfamily
5JH7B 4YJ3A 4G89A 3H8SA 5FHQA 4ZJUA 4ODIA 1WQ1R 2MOKA 2HV8A 1BCRB 2I5PO 3NYQA 2D2IA 4JKYA 2DP4E 5DLEA 3I09A 3ROGA 3TQCA 4X6YA 1WZEA 1PKXA 4KDEA 4RZ3A 1B8UA 4Y6PA 4D43A 3SYKA 5JCJD 4ALNA 3L1HA 2GM4A 4QO7A 2BM9A 4H60A 1Q3KA 3AFMA 3JD1A 5E7JA 1ISMA 5F98A 3KDPA 1E1CA 2IK8A 2ZJZA 4X1OA 4EPYA 1XDDA 4YMWA 1GUAA 1E2FA 1E0JA 2G9RA 1SKUA 4BNXA 4L5JA 4RXMA 3UWPA 1I2DA 4RTRA 3HGQA 1NE7A 4J29A 5BMVB 5AW6A 3W79A 3ONVA 1TMYA 1KNQA 1N1DA 5DYGA 4CIXA 1KH3A 3PTLA 3PHIA 4LY9A 4GC5A 2XUHA 4TXJA 4FFPA 4KWCA 3W2HA 1TTPB 1N2BA 2C2WA 5I47A 5C8VA 5B1HA 2XUFA 3I1JA 1BE1A 4AC9A 2VDWA 3AEYA 4K9RA 3T9EA 3H9CA 2WTBA 4CMKA 5FI3A 2VUHB 1N3BA 1VHWA 2O5CA 1DIAA 3KVRA 4RKFA 1UJMA 2E2WA 2JF0A 2OKCA 3KZVA 1KY5A 4L5AA 4TTIA 3THSA 5HRUA 5T3YA 1ILEA 3Q9LA 2IPMA 4EYSA 4ARIA 1Z4KA 4LF7B 3GJXC 3DHNA 1JMVA 4GFDA 1QVZA 1ZMOA 3ELBA 2M6SA 4GGOA 1G6OA 2EIHA 4LHSA 3DTVB 4EO4A 3JATB 5JCZA 3QVXA 1Y3DE 1Z5GA 1GQ2A 3LXMA 3OQJA 4L4YA 2JI6A 2GS9A 1Z16A 1UMCA 2WTNA 1DCKA 2Z2IA 4B75A 1E9RA 2QTLA 3RVBA 5BSTA 2YTZA 2V3VA 2PX6A 2QJTA 3OE5A 5E6UA 4BBPA 1T2NA 4IJ6A 4BECA 5A05A 3TINA 3PQ5A 3A0RB 1OAOA 2B7BA 1JS1X 3N86A 4ND2A 4OP3A 5IN5A 5THKA 5LZ5A 1BS2A 3WMWA 3A4YA 5C32A 4LYEA 4DQ0A 1Z18A 4GUDA 1YOVB 4IF4A 4D4GA 4PGAA 2RK6A 1X8LA 3B6EA 1IEVA 4EHDA 2FDCA 3URMA 4DKXA 3WTBA 3W3AD 3P52A 4MKRA 4TZTA 3EWNA 1WE2A 1SIWA 5CXSA 2BEVB 3P0RA 1PZGA 2B21A 1A7AA 1PL6A 2VLBA 3IIJA 4YJDA 3KWMA 5CCBA 3F5QA 5ALPA 4HJXA 3ECSA 2OHVA 3FTCA 4KSYA 1U2GA 1OGIA 3KWJA 4B6FA 3F0TA 4RPCA 3OM1A 1HSZA 1QNLA 2F1HA 4ABYA 2XTJA 2MWMA 2JFWA 2IITA 3EQ2A 1DDIA 4HUQA 3GA7A 4O2BA 3RHSA 1RXWA 4YASA 4UATA 3ZCVA 4TUYF 1VKNA 2X9NA 4P3PA 1J0EA 2FWIA 4WKNA 5HM6A 3VM6A 1HL7A 1JJBA 1O4VA 1WXXA 1XP5A 2JRCA 1T4CB 2JGJA 3R77A 2XCLA 2EKPA 4CWAA 4BAZA 4UTZA 1SBHA 4CQLB 1NQUA 2PNFA 4JWTA 4UPVA 5JH7A 4QHSA 3IP3A 1BCRA 4J0HA 2WE7A 1Q0HA 4EA7A 5FWXB 2BH2A 4LC0A 3C1AA 1P33A 2I1LA 3EEFA 1BMFD 3CVYA 3IERA 4O8CA 2H0RA 2RAFA 3O4GA 4GNRA 2FPXA 3BM5A 1I79B 3RW9A 1QFMA 5CLHA 4KLNA 1EG2A 1S3SA 3DZHA 3GARA 2H1SA 1EUDB 3U19A 2RGEA 4BMNA 2C9MA 2FCAA 4D5EA 3H9JA 2B20A 2D1SA 4KGZA 2NO1A 4RU1A 3RDPA 1NW6A 3WTCA 4E14A 5AVRA 3Q0IA 4RNDB 1JQLB 3DZFA 3CUWA 4RXUA 3I3SR 3TGLA 3FTPA 2V4MA 1JTFA 4AKGA 3KQHA 1XIVA 2H1OA 2C61A 1FJ2A 3A3YA 1FPMA 3EEOA 1KJIA 3OHSX 3TLBA 2AN3A 1E2EA 1PWHA 5IKEA 1ZHOA 1VCOA 4UTVA 5ICFA 2W43A 1N7HA 2AZXA 4GKKB 4L0CA 3H6GA 3EGOA 2BR3A 1E4EB 3FJYA 1L3BA 2BFCB 4HCJA 2VNSA 4TL7A 4ZU6X 3VJKA 4ERNA 5CB4A 3EPAB 4M36A 3U37A 1GA4A 1UAGA 2CZCA 1ZA2A 1E20A 2R96A 3GFFA 4GYJA 1XDGA 4IUYA 4PNHA 3R8XA 3BWYA 5BV2P 4OK5A 2ZQYA 1EE1A 1HYQA 4MI6A 5TE9A 1IG3A 2HL6A 1Y7TA 1XNHA 3R0IA 4E5KA 4QOGA 2GPNA 1JSLA 1DOAA 1GSOA 2HTFA 4J7UA 4M9ZA 3OZUA 3PQDA 4QRDA 1E3IA 1MIOB 1PW7A 3UMYA 3M6WA 3L0PA 5CPFA 4TUYB 5JDIA 2CK3A 1I33A 1R3UA 4Q3KA 1QX4A 2ATEA 4DREA 3JRXA 5KYTA 3SD7A 5LM3A 1GL6A 2E5WA 4XIJA 3U9TA 1L4LA 2ID8A 4LJ8A 1XT6A 3OX2A 3UA4A 4X64B 2G5CA 3OP4A 4RGVA 5EA2A 1PEYA 1YB7A 3P2EA 4QL3A 4KLZA 4RAOA 2IWRA 3DJFA 2UUAB 1GYQA 2ZRMA 4OHBA 1OFIA 4QWMA 5DGCA 4XM2A 4HT3B 1WZ2A 1KXJA 4M7RA 1TIPA 1G21B 2J3LA 2VDRB 3AHFA 5ECGC 1YOVA 4PLPA 1E6KA 3IE2A 4KN8A 4DC0A 3LDAA 1COWA 3T9CA 3EIQA 4Q4AA 1Q19A 13PKA 4UVHA 2ACVA 1UF9A 1PR1A 1QWOA 4JUDX 3HWSA 4TSKA 2QMZA 3MA0A 4LJLA 4O02B 1ZGHA 2NAFA 1PR9A 2BEVA 2ZSIA 1KMMA 3GZ4A 2GPYA 4ILEA 2CSUA 3P0HA 2QYTA 3MJFA 3MNFA 4PLFA 4WPGA 4TRNA 3H83A 4QGGA 4R7GA 2GM9A 3A1DA 5DXAA 3TNFA 3L06A 1YCDA 1HDRA 3F7OA 4PQFA 2ZJ4A 4WESB 4PC2A 3FPJA 3JD0A 3FETA 2QPLA 3CPHA 3PUKA 3Q6MA 4ZWNA 5CYFA 4TTPA 5IZ4A 3IVAA 3U2QA 1CDOA 2IUTA 2PLRA 2V03A 4Q1BA 2PWYA 2OCDA 1HTTA 5SZJA 4B2LA 1WB9A 4E1BA 1D0VA 3C7DB 3IVCA 3JAKB 2RBEA 3STYA 4V03A 1I7NA 1PR5A 1K97A 2WUDA 4CM4A 3KS9A 1IZYA 2BH9A 1E9CA 4LX0A 1T4CA 4M83A 3WYGA 1L5KA 4YYEA 3R3WA 1BHO1 3S27A 3BK2A 3WGYA 1UFKA 2EDAA 2A1UB 3DC7A 3HR7A 3TTSA 5HF6A 1CEQA 3G9ZA 3QPDA 1G21E 1NN0A 1OBOA 2SICE 3VNRA 4B71A 4G2NA 3W2TA 2G08A 3PICA 5FWXA 3IHKA 1OWLA 1PK8A 4L76A 3SCZA 2FSFA 3SZGA 4MDYA 1T2DA 3HZZA 5A9SB 1A4RA 3MVEA 3Q2IA 1O97D 1E3WB 1I4TD 1MTOA 4QTTB 3WICA 2DUNA 5I48A 5F7OA 5EWLB 1UJ6A 1WTCA 4EB6B 4URXR 5DMHA 3E0XA 4FKBA 4RV9A 4AJPA 2ADMA 3G6KA 1TT7A 1IVSA 4DIOA 2VEOA 4H16A 5EMLA 1NPYA 1CIVA 1SRRA 3A6LA 4ZVNA 2XADA 1Z4QA 2XQFA 4NFYA 3SG0A 3ZBPA 2DPGA 2IXGA 2YOGA 4JOSA 3QQPA 4LY6A 1IAVA 1R0YA 2WT9A 2OP1A 3ONNA 5HUHA 2HT6A 4K40A 4HLNA 3IBYA 4LRUA 3RC3A 3RVPA 3PZBA 1UBFA 2FFRA 2EKDA 4F9FA 4ACBA 5DXJA 4AO8A 1OUMA 5LMNB 1DO2A 2BFCA 2EYUA 4MITA 3GEGA 4MW2A 4X8HA 5I7AA 1RVDA 4ARZB 1L6IA 4LWQA 3HVUA 2BDUA 1WW3A 3IP7A 2FPSA 1S01A 4KAAA 1XD2A 1E7RA 3GP3A 2WWFA 1S8AA 4W5NA 1OPRA 3D6JA 4O0LA 1U28A 5A4DA 4DR3B 1S0UA 1VRCA 4UTPA 8MHTA 1WL8A 4M7OA 3ZG6A 1L5MA 2PCLA 3FWKA 4LE1A 1MIOA 4B47A 1N5LA 3T95A 2IXDA 1W8IA 3I6QA 4BFWA 3G2PA 3BH6A 4PGHA 1Y4ZA 1ZIPA 4HDSB 5D2CA 3VH3A 2QTFA 3HXQA 2XNDD 3KEQA 4B87A 3MMXA 1ZGZA 1HX7A 2GZMA 4ZO7A 2GF9A 2HOQA 5FADA 4M49A 5TGZA 3UMFA 5CFQA 1OC2A 4E5YA 3RC9A 3EC7A 2Z4RA 3IVRA 1YQDA 3L0YA 1PJCA 3STXA 2AMJA 4OAQA 3PE3A 4XJXA 1Q84A 3WLRA 5K4GA 2HQSA 3DE3X 3DNMA 5CFLA 3I0ZA 5LJIA 421PA 3I4FA 3MCAA 1L4NA 1TM2A 1EEHA 1ZD2P 2DWPA 3MT9A 2Y1WA 1IXYA 3ZJYA 2G36A 1P5ZB 3GGSA 1HC7A 5HF5A 1Y8QB 1LCIA 3SQMA 1G3QA 3SICE 5C5CA 3TLGB 1VYTA 3FYCA 3H9QA 1UR5A 2IP2A 3ZGNA 2WR8A 5CIYA 2PX2A 2I87A 4JNKA 3LC7O 1TT5A 2P27A 2QRHA 4L28A 4ZVMA 1NNEA 3GFOA 2DTDA 1EWRA 1YJCA 2ENWA 1BHSA 2V7TA 3L46A 3MJ4A 3QPCA 4WZBB 3BA6A 3OKPA 5LQJA 1T9KA 4AMUA 3EP6B 2AMYA 1RAAA 3AF5A 3FPHA 4L4XA 2OQ2A 4IIEA 1U80A 2ZJAA 3KAPA 3E22A 2VDPB 3GRFA 2O2XA 4O5AA 1SHKA 3WK4A 1DUIA 3L01A 3WWPA 3ZHQA 2NXJA 9LDBA 1WAMA 1YB5A 5I4IA 1X7WB 3EVTA 1GRNA 1XXLA 2X9QA 4ZQGA 4BVLA 3JAKA 3LGXA 4JUFA 2UXDB 3UIEA 4DSUA 1DDGA 3CB2A 2BCJQ 1XVUA 2KSQA 2P9EA 3C70A 3M2PA 1VLHA 4FYKA 4HBZA 5TQ2B 4FFLA 1WCWA 1RRCA 2WWIA 2X0NA 2VOJA 1E2KA 3T3PB 2A1UA 4JLMA 1K7CA 2WJ6A 5JYEA 2FETA 1KAEA 3UMRA 3GP8A 4IDAA 3TTVA 2FZ4A 1IN6A 1RQRA 4U39A 1MGPA 2RBGA 5HE8A 1HFJA 1PR0A 1WMFA 2IEBA 4IGIA 4AO7A 5CH5A 4KITB 1E3WA 1P81A 2XAUA 1NDUA 2J3HA 3SFTA 3OIGA 3AP1A 4RHUA 2TYSB 2ZIWB 3NUQA 2E49A 5EWLA 3VDXA 1G63A 3EPJA 4IO0A 1T9CA 4ZANA 2XQKA 3TIXB 2V7QD 3D0OA 1B2LA 2OZVA 2YS7A 3BHIA 4WZBE 1CEEA 3WBBA 1TU3A 4HFMA 4YALA 4JC4A 1L7RA 2HC9A 4KN5A 5KTSA 3HVKA 4EP1A 2C2ZA 5L7WA 2VDUE 3QEBZ 1CJKC 2PPLA 3N3AC 3QU9A 1CIPA 4KXYA 4LXTA 1JL3A 4XJVA 4ZZ1A 3M82A 2ORVA 3MQFA 4NICA 2O8BB 3DONA 3FCAA 3QUSA 2NUBA 3EE6A 4OXXA 2H11A 3M4JA 4P58A 2VDOB 2YVQA 3EZLA 4HMQA 2UU9B 4PYNA 4RK7A 3VO1A 3WE7A 2RH8A 4BP9A 3ITNA 3JQFA 2J48A 2VBFA 4HQ0A 1XNJA 1PCXA 3ZLVA 4RTQA 1TQDA 2A7QA 2GD2A 2MR5A 4H1HA 3IV9A 4U9UA 4ARZA 4Z5XA 2HHCA 3AVVA 2VXYA 2C8JA 1FDOA 3AJEA 3UZUA 1T24A 2JC3A 4QFCA 3L8DA 1TU4A 1UP4A 2ZUBA 3LO8A 2H8KA 2DBYA 3UAGA 1C30B 4RTPA 1GPH1 3KU4A 1JEEA 2XIQA 4EX6A 4A8JC 2JFVA 4KNYA 1OW3B 2R6AA 2B99A 2SKCA 2D59A 1EGMB 2FW8A 2R1TB 5AWFC 1LBEA 2XE4A 2OMEA 3E3NA 4UBIA 4FWTA 5CHYA 4R83A 4WNCA 1QX3A 3H1FA 4I2VA 1ACJA 1AK9A 4Y6GB 4RTNA 1HLPA 3BK7A 1XVLA 3WLLA 4HDSA 1ID1A 3PVCA 1AC5A 5KYVA 1GPJA 3CYFA 5U4XA 4NOKA 3GFTA 2YHIB 3VVLA 3DFIA 5A0VA 1V3TA 1KHHA 2XMRA 3F9CA 4X24A 3U16A 1LDBA 3PQ7A 5EE9A 4W5WA 2R7MA 4YAUA 3EFOB 4NDAA 3L4BA 1K6MA 2DUJA 3D7MA 1TYCA 2CL7X 3FR7A 4Z0TA 3DT9A 3TTWA 4ZJYA 1V16A 5LMCA 1D9ZA 1XLVA 3CNBA 3PHHA 4KPFC 4FMBB 3X1JA 1IXSB 4V3BA 4QSHA 1SURA 2FY8A 3ZE9A 2B5VA 3W8NA 4YRLA 1JLHA 5T6MA 4EG6A 1XCBA 1TZMA 3WVNA 2YXPX 2WINI 4AXXA 1LFDB 3VR5D 1SU4A 4LXUA 1ODTC 4MPDA 5TGDA 4DEYA 1E0KA 3V2IA 3S68A 2QTGA 3JVVA 3BUSA 1NT2A 4GPD1 1A5AB 1I4DD 1NIJA 1ZJYA 4WZBA 4HVCA 4D0RA 4WK4B 4DIEA 4Q7QA 1IOLA 1BROA 4JAVC 2LNDA 3Q87B 1QIGA 1YZ3A 2ZTLA 4ZT6A 3TCNA 4EJSC 4CETA 2GN8A 2GNAA 1AGNA 1RLTA 1T9BA 3BE4A 1D2NA 3G7NA 3ZTWA 3UG6A 4BWVA 1X7WA 3O75A 1WMAA 1VHTA 1SQGA 5KC8A 2Z95A 1VMEA 5TARA 2GI4A 1I2ZA 2O1XA 2Z6AA 2V0GA 1DHRA 5TQ2A 1SPXA 3OO0A 1HYBA 4XQGA 3II6X 4JJZA 3VPHA 3SHVA 2AHRA 1DKLA 1BMFA 4O59O 1RT9A 2AOXA 3B3QA 3G2MA 3QHQA 4BX2A 2Y2VA 3M6UA 3N70A 3IR5A 3BDVA 4QXMA 1SOVA 1OWPA 1T0BA 2QQFA 3FRHA 3Q3IA 3WRYC 3IUYA 4RZUA 1J8DA 5LMUB 5BSEA 3EW9A 3F71A 3HCEA 4IIHA 3CZ4A 4MWZA 4D81A 4YJFB 3HJAA 5JANA 1ORWA 2PJZA 1XI2A 3KJHA 5IVHA 1LQUA 3T7SA 1OWMA 2YVAA 1P73A 3REFA 1Y0BA 2PE5A 4TQUS 3X43A 4LWOA 4J76A 3V8PA 1QZTA 2KYRA 5KBYA 1Q83A 2CNKA 3GDHA 4Z1MA 1ZNYA 1UBOS 3U5ZB 3HKDB 1WOYA 5CB0A 4RORA 5JC8A 4XXHA 4U5XA 1JSXA 2HYIC 3MRXA 1L5HB 3KOXA 1Z0UA 4ZCPA 3GUUA 4QEKA 3FPFA 1WB4A 1NQOA 1T9AA 1PV1A 1NVEA 2ZUDA 2J30A 5LQRA 3VOSA 4NZZA 2HMUA 2ZDHA 4D3DA 3BEOA 1QIEA 1XQ1A 3E9EA 3ABRB 3ETNA 1JNYA 4U4AA 4UUNA 2BHTA 4UHFA 5CT9A 3H18A 2VBCA 1WVGA 4WZAA 4MYRA 4YY3B 2IXFA 2VJMB 1QG0A 1Z5WA 2JD2A 1RRFA 2QRMA 3T38A 2GRJA 2XUDA 1FSSA 3Q6NA 1S2DA 1KZYC 3O7WA 1JALA 2FE1A 3C48A 3ROEA 1C30A 5T41A 5AVZA 4U8GA 1KARA 3TMKA 1FS5A 1T2AA 3AY0A 1P7WA 4V0RA 3IB6A 4NOMA 4ASUD 1D1SA 2R1TA 3HI4A 2R97A 1DZ3A 4LGCA 4NV1A 2Q8PA 2VZEA 3EX7C 3B2QA 5KMGB 1YGYA 3IEMA 3D6HA 3KUKA 5ISMA 4KXNA 4AZ3B 4DDWA 3O0TA 1IU9A 3HEBA 4KQMA 4G25A 3O4RA 5FPYA 2F6RA 1DJLA 5HK8A 5K3CA 4Q6BA 1RI5A 2A0FA 2PWPA 2UZ0A 3ETEA 5JZVA 4XSGA 5K03A 1KWGA 2Q4BA 2H7VA 3O8DA 4DSOA 4LMAA 3W4KA 3I6IA 3GPIA 3DKIA 2A5FA 1J5XA 4E6EA 1A9RA 4CIAA 4ZQIA 1RYMA 4KFRA 2EOAA 3R5FA 3USCS 4M21A 2C4UA 2YWXA 2C95A 4FYPA 4P7FA 4RD0A 4TRRA 3WKBA 1P4HA 2X77A 2OHOA 1AOXA 4DQLA 1NMYA 2H2HA 3IUNA 1U0EA 4MRMB 4DCOA 2BTQB 4GI7A 4EELA 3AL3A 2IYVA 4QAJA 1Y5IA 2I6QA 1YVUA 2WA2A 1F0NA 4LQCA 4OI2A 3EF1A 5ECYA 3I62A 1PDVA 3A6GA 4K1LA 2BGKA 3I5UA 1AT1A 2LBPA 4FWIB 2X9LA 2X19A 3CLUD 4NAUA 5EJIA 5A03A 2AD1A 1TE2A 1Q22A 3UW1A 1U0LA 2ZRQA 3UICA 4MQEA 4HP8A 3FCXA 2C5SA 3KKLA 4YRQA 2PUFA 4BO7A 3H1TA 1TM3E 3VGJA 1RZUA 2JHFA 3C5EA 2FN4A 4G2TA 3TW6A 4KYUA 1ZICA 3R76A 4QYXA 4JT8A 3AKCA 3RIHA 5BVHA 4DJJA 1J5EB 1Z39A 1UC8A 1X2EA 3P9SA 4E31A 1TFRA 2FUG1 2WT4A 1Y1PA 2ZBDA 1E2LA 4OGLA 2E4UA 5IXJA 2QOEA 3KOYA 4JGGA 3OUUA 4U3JB 4L07A 5FOQA 5I7UA 1RMYA 1KEVA 3GPDG 1KIAA 1FE8A 3M5CA 4CL8A 3ZHUA 5HXAA 2DFLA 2Q1WA 4ZVRA 3E7PA 4FT4A 4DLYA 2VSXA 3R6DA 1T0JB 4RW0A 3A9WA 3I9MA 2WG1A 2EGGA 1YE8A 2NMVA 2RH5A 1DL5A 3BWDD 3LI2A 1JG3A 1Y6RA 4DRYA 4ZIRA 4Y2XA 4BO5A 4DMCA 3QYPA 3WFZA 3HJNA 3FKQA 1VXRA 4LJSA 1B0PA 2OV2A 4KKXB 4B6PA 2ZSJA 2ZBUA 3CNLA 3B5EA 2P6UA 1RC0A 3EH1A 3HH8A 2OO3A 3HKDA 4X91A 3VZSA 3AHHA 4B5KA 4ZI7B 2PZ8A 1VE6A 2R65A 2FRDC 2FFJA 3OX3A 3P2OA 4YAGA 5TRTA 1L5HA 3B3AA 4LE0A 3NWEA 3CQ9A 1CUFA 3RSHA 1A4IA 2BOVA 5LZ8A 1WV1A 3OF5A 1CY8A 3HUEA 3PK0A 2HWWA 1AUVA 2DECA 4HEA1 4QEDA 3ABOB 5IFLA 5KQPA 4CMIB 4NCKA 4NCIA 4AG3A 3OTOB 4RXTA 2CB9A 3OSZA 1ZWKA 2VJMA 3VR4D 1GL3A 2GKSA 1Q1BA 1KS2A 1UMDB 1Y82A 2Y0DA 4GIBA 4IJMA 4OHMA 4UOZA 4BFYA 1BE8A 5KSOA 4DKJA 1KF0A 2IIVA 2WZQA 4X90A 1T9DA 3AZQA 4YMIA 2GLXA 4IRUB 4JI1B 3V8RA 3LWZA 1KQFA 1W4AA 2I54A 3COSA 5EIAA 4YRBA 2CF6A 5A3VA 3PNYA 4XGRA 4FCVA 1QK3A 1CERA 3FDXA 3ODPA 3B1VA 2IHVA 3MFYA 4JJ4A 1CVIA 1R10A 2ZJ3A 4U2KA 5DWQA 4AZ3A 4LC1A 5I9SA 3LVFO 1JLLB 3TM5A 1H5UA 3DE6X 4HDQB 3CG0A 2I1WA 1G6KA 3K9NA 1YFZA 2RGBA 5CTAA 5LBUA 1J8YF 2W6CX 2BKLA 3WHLA 3K15A 2FMXA 4G81A 3CWQA 3ZZTA 3M9WA 1WULS 3WR5A 1VJ0A 4D99A 4D42A 4N6OA 5CVCA 2GKGA 3NBZC 5C31A 1LF5A 3GNSA 3KU1A 3WGTA 3EHDA 1V8PA 3PJFA 1QYDA 4Q39A 2JCGA 4MRMA 1BYIA 1UK8A 2BTQA 2H07A 4R2KA 3LX6A 1I3LA 1JG6A 1XLTC 2J4FA 3SLRA 5FBKA 2GXSA 2DFDA 3TOCA 4P83A 3ACCA 3DZ8A 4G0XA 1IQRA 3I01A 3RUAA 2CFCA 1JR2A 4ZAGA 4LRTB 3EEYA 3MIZA 1G5TA 1LH0A 2F90A 1A9YA 2NUTB 4IIGA 1SFRA 3L77A 5BO5A 1B6GA 4OHRA 2EX1A 1AURA 3PGKA 4PHFA 2IKSA 4IEIA 2QLNA 3GFVA 1H2EA 3ZNNA 3AHEA 4MI3A 4DMHA 2B0JA 2E89A 1XZAA 1UP7A 1CJTC 1VG8A 4OUKX 2J3DA 2ZJ6A 4X92A 4ZAWA 3RFCA 5JMPA 3EOAI 4CLQA 4RHYA 5IBPA 4JZKA 4U7GA 3ST7A 1MQAA 2H51A 1L7EA 1N8NA 1LSSA 3E0QA 1P4AA 2CNLA 1XDSA 1VC2A 2AN4A 1A8QA 1XBTA 2NWQA 3FFTA 1AUXA 3CFYA 3DPUA 1KZ9A 5B1SA 4JI6B 1IXZA 2O2YA 3RUHA 1IQUA 4DMGA 2BWJA 4DJAA 2DHQA 3MZ0A 4P3OA 2BGJA 3Q3VA 1T2UA 4UU0A 3UF0A 5D3KA 3WK7A 3WRXA 1KIFA 1JBQA 2HUPA 3B1XA 4U3JA 4AFNA 5JS7A 1Q17A 2BV3A 3FHLA 2D0IA 2OOKA 5HGJA 3F8SA 2VP9A 1BWPA 4N41A 3BG5A 2L19A 3E4DA 4QODA 2PSFA 5FFNA 2AF3C 3ZW7A 3UHAA 1BXGA 4BDTA 3GLGB 2EDCA 2X2OA 2II6A 1B7GO 4RD4A 2W83A 3X2FA 4ZCMA 1HY3A 1H85A 3KQVA 5HMMA 5EAIA 1RYEA 4FOOA 4JQCA 3QOYA 3UKJA 1XR3A 4D8WA 5JV5A 1D2AA 4EB8A 1PJQA 1GZSA 2EXXA 3RFUA 1OJLA 5HIKA 1Y5RA 4QOIA 4ZI7A 2ACWA 2PRYA 1K8XB 5JI3E 1FFDA 2C7GA 3F4KA 5JZSA 1NMXA 3DOFA 1SC3A 2V65A 2Z8YA 1RWWA 4JOCA 4QBHA 4DQDA 2Q9CA 3GJ0A 2AK3A 1HDIA 4IVPA 3AJDA 4UBLA 5L3ZA 1YULA 4EHBA 4GLOA 4YMGA 2WFAA 4CMIA 1RRGA 3EC1A 1SHZA 2V8BA 1JILA 3EXHB 3A6FA 4DAEA 1OOEA 2ZB7A 3TSCA 1T4GA 5CDUA 3TZ6A 4K0KB 1P29A 2GGSA 2IUSA 3HO8A 2CXSA 3DA8A 4OXYA 3VOBA 2YICA 4M1OA 4BFLA 3B48A 4KFCA 3D2CA 1CNEA 4HD8A 1LPSA 1YS7A 3RYTC 4R2WA 1CK4A 2JL1A 1BVYF 3AB7A 2HWXA 5MF6A 3KSDO 3BXFA 3ER8A 4Z1OA 2QAGB 3EIUA 5JCPA 3WL4A 3GA0A 4KIGA 1YRQA 4RA6A 3GLGE 2H57A 3EVGA 5TEWA 5EIEA 3BH7A 3LMKA 2F67A 2GEKA 3K0AB 3V80A 3EN0A 3U56A 4QNNA 2J9RA 1SXQA 4ES6A 1PD1A 1RVV1 1NVGA 4QGHA 3AXSA 3PWSA 5JEEA 1N3YA 1N6NA 1SUEA 1WBDA 4HQRA 1MPTA 3ZI0A 4CHGA 3HB1A 3T5CA 2B30A 5DM4A 4IOMA 2QVGA 2JHAA 3ZE2B 3AKDA 2ZI9A 4MR9A 2QRJA 1Z5UA 3L43A 1AHPA 3M1LA 5LL6P 5FRDA 3RTAA 4UTNA 4GP7A 3N8KA 2DAPA 5A5DA 1GKIA 2AOTB 4CIWA 2CE2X 1RXVA 2IPLA 1W96A 1ORTA 3MUNA 2P75A 1P3JA 3GD5A 1S2MA 4ER7A 3NHKA 4RTMA 2I7DA 4LQDA 1BX0A 4X8OA 5KYUA 1L5SA 3WDMA 4B8ZA 2PANA 1FYXA 3F9IA 3FI0A 3H5LA 4G09A 3SQLA 4WA7A 2PSSA 4OCZA 3OLXA 1VIMA 1ZIDA 3MB8A 2HK6A 3KZMA 5AKHA 4C29A 4EMSA 1HZZA 1RHKA 2JLQA 1IY8A 4JI3B 1Y3IA 3TJMA 2VRCD 1EGQA 1IY1A 2E82A 4RWEA 4WERA 3SF0A 3UJ3X 1QGDA 4DTIA 1BKDR 4XEHA 4Z9YA 4JXZA 1DFIA 2P4EA 2R62A 3CIFA 5TVGA 2XMSA 4CV0A 5AW5A 3DLPX 1OVMA 4CYMA 2FP3A 2XB9A 4X1IB 4BMSA 4Z0HO 1TO1E 3O94A 1RIFA 1GUZA 1GKYA 1YE3A 2KBEA 2WKSA 1Z4JA 4J6EA 4DLBA 4PG6A 2PS9A 4A8TA 3F6YA 3DO5A 1KO5A 3PXBA 4YUVA 2UZ4A 2FUCA 2C4TA 2WILA 1SB8A 1GQYA 1A98A 1HK7A 1VPEA 4UHJA 1HNNA 2FFAA 3V7UA 2Y1GA 1A9PA 3DDHA 2BEWB 1MO4A 3WZLA 1BRTA 3ZDYB 10MHA 3NHMA 1O9GA 3FAKA 4TL9A 3JR3A 3KEMA 5CLFA 4DG5A 1EB8A 2FR1A 2H8GA 3HS3A 2ISSD 5BUQA 3FGNA 2AJDA 3RO7A 1HV8A 3LK7A 1LNZA 2CJYA 3SS8A 3TLEA 3SR3A 1DBIA 2PGXA 3VPCA 1Z7YA 2JI8A 3DP9A 4Q9LA 2RAUA 2UUPA 2B3TA 4GR4A 4IV8A 4U1RA 4DBLC 2B1GA 2F9LA 4EY7A 3IBGA 1J33A 4ZOAA 1PYOA 4I6JA 4XCQA 3ZNQA 3N87A 4Q1AA 3T06B 1BGXT 1MW9X 2YN4A 5TT1A 2BGNA 1JU9A 2IRWA 2RKWA 3NGXA 1MZVA 1T5IA 2P5TB 4NE2A 1PDWA 2W11A 4HX2A 2VWPA 3G9UA 5FX2A 4M8IA 2ZWIA 1OTYA 1Q57A 2XQJA 3F7MA 1MXHA 3B9PA 2HMWA 1ZK2A 1Q7GA 4BZPA 2AA3A 3EW7A 4LYGA 3I37X 3USES 4G5YA 1KK3A 2PYIA 5F77A 3SS7X 3AZPA 2B8EA 3R6TA 4PPFA 1U7HA 3FW1A 4QGFA 2C96A 2MR6A 4CCYB 3JQ7B 2NTVA 1E5XA 2L69A 1TIBA 3L0IB 3KQOA 2WVJA 4P3XA 3QKRB 1PJSA 2YZKA 3FWZA 1ITZA 2GR9A 3IH5A 3WB9A 3EP8B 1II0A 2QAGA 3P7MA 2GF0A 1N6OA 3AEXA 4K9KA 1FNMA 3DBHA 1L2TA 1N9ZA 2G76A 2HJRA 1VJRA 2PLAA 2PL1A 1QUEA 2Z98A 2YIDA 1K3UB 1I4WA 1HT3A 1W85B 1WMDA 2OK7A 3GVCA 3HA5A 4IVQA 4C5AA 5BYAA 3SK0A 3X1KA 4KQ1A 1N5KA 2FPIB 2ECFA 2I99A 3I4LA 1Q6ZA 5IP5A 4AJJA 3N2KB 2O14A 1XF9A 4EYEA 4TTAA 1RWPA 3H7IA 4BLPA 1YASA 2OESA 4GR5A 1DQYA 1DC8A 1K6EA 2H4ZA 5FH9A 2IYEA 2BGGA 3OPXA 2PD4A 1VHLA 2BJVA 1QYRA 2Q50A 3NTUA 1C0LA 3T0FA 2R11A 1MHTA 4IQ4A 4EGSA 2GD0A 2AOTA 3NP7A 3L0DA 1U7TA 3RVOA 2VDMB 1UANA 5F7XA 4LSGA 3H5OA 5HGXA 2OTCA 3CLKA 1DBVO 3M3HA 4IJKA 3FG9A 4MWOA 3TRFA 5HOQA 4RQBA 3ENWA 2H9YA 2RI0A 2PVPA 2R84A 3BGVA 5JD4A 1P7PA 3U6KA 3IPLA 1XZDA 4O5OA 2OHHA 2OP0A 2ZSAA 1LBTA 1N0WA 1TJYA 3BWMA 4FFWA 2C3OA 2A59A 2QG4A 2W93A 1QK5A 4IDQA 3JARA 5EVCA 5JBIA 3EG9A 2AN1A 3B5IA 3VR6D 2Y6UA 1EWYA 3HGTA 2FGJA 4LJKA 2IIBA 2YOFA 3FUVA 3LDHA 4LZZA 5EUMA 2P2NA 1CZOA 1CJVC 3DOOA 5T8KA 4X1IA 2VHVA 4GBJA 3BL8A 5LYJF 2R6DA 4LFBB 1JSZA 2IUUA 5A6VA 3B2EA 3EWAA 2PZGA 1BS1A 1QE0A 4X6UA 1KVSA 3GT7A 4GR9A 1IULA 4RJKA 3RVKA 1V6AA 2PX8A 2D1FA 3U39A 5I5GA 2D54A 1B0ZA 3K0FB 3KB1A 5I9TA 1TU0A 3D7KA 3D1VA 4KR9A 2BEWA 4DV2B 4IHKA 4U2DA 3ZD6A 1EBBA 3WNZA 4MWTA 2OUKA 1S2OA 2IPNA 1D2RA 2O3TA 4H6XA 4HAYA 1NA5A 2B61A 1EJ2A 1C7ZA 3CPJB 4YAJA 1FQOA 5HYVA 1RLOA 1LWNA 2AUNA 3JSXA 4GKAA 2P9GA 4BNGA 1WSWA 2JI4A 1W0CA 1GCOA 2HLDD 4Y2PA 5JNUA 3QGMA 3SBDA 4QYSA 1OXKB 3VNQA 1S6YA 3A1TA 5CRIA 3TVDA 5A62A 3ZJ5A 4HDNB 1EU1A 2FVXA 2G3YA 1XEWY 4HYTA 4B4UA 5HJ7A 2OV3A 2REXB 3K9CA 1W34A 1WUIS 2ES4A 3C8HA 1GFWA 5HVNA 1ZR2A 3EZ2A 4DV5B 2X0JA 4AMVA 2OV8A 3IRUA 1PFVA 2CNNA 1QDUA 2NVUA 1TCUA 3D3KA 2HNAA 1E2GA 3IQGX 1RTKA 1F0PA 3QHPA 5J2TF 3PA8A 4IQ0A 1VPTA 1A76A 3H0WB 4PLHA 4NZNA 2B9VA 1FDVA 3G1TA 1SKQA 4TVOA 4XUDA 5ENVA 3WQHA 1TKAA 3TCXB 3GFGA 3MGBA 3FPBA 2CXTA 3G2HA 4CCYA 2VDVE 3JQ7A 4R8MA 1O0SA 2WYUA 1UDXA 1AKVA 4L2IA 5J47A 4JVSB 3MJHA 2XE8A 2ECPA 1I30A 4H7PA 3JQAB 1QCZA 1PV2A 5ABPA 1LGYA 1HPLA 5DE3A 1LBIA 2B1QA 5AVTA 1IK4A 3DLIA 2XKKA 2P40A 1EZZA 4OKIA 3O8OB 1U5BA 2QMHA 3Q11A 1POWA 3PNQA 3HBAA 3TBHA 2JG3A 1BFDA 2O7SA 4D4LA 1RR6A 5BN1A 1S5PA 4MS3A 3SAJA 1SUSA 1AXRA 1R0LA 1LB1B 4KLCA 1YS1X 2W6ID 2FPIA 2J33A 3EEBA 3QA3E 2H54A 2WV7A 3O3NB 3ZDZB 5CURA 4E4RA 5LYJB 1Z12A 4IV5A 3I0MA 2O52A 4QYWA 5LUAA 2O2ZA 3FPCA 5JJKA 3DE7X 4X20B 2IP4A 1PLKA 5A3JA 1THZA 3DCIA 4MIOA 1R0WA 3LQ1A 4KZPA 1CFZA 3IP6A 1EVEA 1SCIA 5FWAA 1BE6A 3GEPA 4JHXA 1KE2A 2VJOA 4DLRA 3FOAA 1G7SA 1MH9A 5CD1A 4JI8B 2H0AA 1A04A 3AEZA 4AT1A 1DP4A 4MHTA 3C6YA 3CF0A 4PR3A 4XGNA 4FXPA 1OE0A 2UVDA 4WEQA 3I42A 3Q8MA 1JLSA 3NH6A 4BRWA 2D7CA 1NJGA 3EVZA 1E61A 1FFCA 3LTEA 5FBLB 1OR8A 2IYNA 2CB0A 2VTBB 1QFSA 5K05A 2KPOA 1YI1A 1DKNA 5ED0A 4W4TA 3KJGA 4B6GA 5HKOA 3DPIA 5JC1A 2F3QA 4KKVA 3IMCA 4KX5A 4Z7JA 3MXOA 4URHA 2OA0A 2I6TA 3JD4A 4FMPA 2QLLA 2YVUA 5LQKA 2B36A 2PS1A 2Z83A 2ETXA 3LBIA 3PF9A 4OJKA 4OYHA 4I5DA 3PD0A 5AIBA 2NYUA 1H0RA 4NDZA 1ZJ4A 3JWPA 3LUPA 3TRHA 4ZI3A 2W5UA 2HWKA 3LV8A 2K5UA 2M1XA 5J2TB 1SOUA 4NS1A 2WWXA 4K8OA 4IIUA 4K9PA 3V1KA 2A0WA 3TVYA 5C3UA 3W7VA 3SQWA 1X1CA 2QDXA 5B2ZA 5K8IA 1MDBA 1WUYA 2QTHA 3K0FA 3QE0A 5AYVA 4HZIA 3EZXA 3EJWA 1GQFA 4MUXA 3ICVA 4Q7LA 3MIIA 3NBQA 5G4KB 4ZYYA 5G2OA 1CRPA 2PDAA 3S7ZA 1ENPA 1N2JA 2J6HA 3A6KA 3KVOA 4EUKA 1R5NA 5GOTA 2ZBQA 5CIWA 4F5DA 1BKYA 1UKZA 3VKGA 3WGQA 3GAMA 2HK8A 2WWTA 1WUTA 2H1LA 1U8XX 2QD5A 1C9MA 1Z06A 3S81A 3Q8XB 3P9YA 2OWEA 3NWOA 4M3NA 1L4YA 3KV3O 1PJ4A 2CZQA 1EESA 4C7JA 5ALIA 1ARZA 1DBQA 4HPXB 4HDNA 4N0QA 5B4UA 3U09A 4BQNA 5ALVA 4G0WA 4I1RA 5FF9A 2Q6VA 3RKRA 1JI3A 3IDAA 4P4UA 2R1ZA 2O8FA 1KTVA 3ZD9A 1ULTA 5BSMA 4AO6A 5FULA 3N05A 4F3CA 5M7EA 3RJMA 2KQUA 4BO8A 1XWIA 4WKPA 1FX0B 4G5QA 3VU3A 4E2WA 3QXXA 4E21A 2G1JA 1NTOA 4JEIA 2JLYA 3JZMA 1ND5A 3N0WA 2JLAA 4A2PA 4OJNA 2ZUEA 3ZE1B 3CX4A 5HJ2A 4PHGA 3HDVA 1O57A 2CLMB 1Y9AA 2QT1A 2IC5A 3EP3B 1QVWA 3VAZA 2CZGA 3U3XA 2DQKA 4G5SA 2AJLI 4REMA 3JQAA 1IC6A 4P3NA 3GGPA 1R00A 1TK2A 1ECGA 1ZM4A 4C5BA 1XUOA 1WCV1 2ANBA 3DE0X 3EGEA 3BXOA 2FJ0A 3FYUB 4J03A 4RE5A 5FLYA 2XZLA 4ZI2A 3AV3A 3O8OA 4R69A 3TR6A 3W6PA 2BJHA 1I9CA 3TI7A 4LXQA 4DR7B 2GRUA 1VZ2A 3OJFA 4QARA 3ZYCA 1GCGA 3GRYA 4HNRA 4QDJA 1IDN1 1EB9A 2X86A 3NC0C 1EIZA 4P0PB 1U04A 4KJZA 2LCFA 4B32A 3NBXX 3M4ZA 5LYJA 1K4KA 3S3TA 3FNRA 4M7WA 5HP4A 1TKBA 3HDJA 3VU0A 4KFUA 4X20A 2J9ZB 2JLVA 1ZONA 3REOA 2J0QA 2D0DA 4Z51A 3WO1A 1A8SA 1GRQA 1CUUA 2P79A 4FB5A 1MTZA 2IW1A 1PIWA 3A26A 4HMOA 1U8CB 1FS6A 1R9MA 2IYAA 3GFPA 3DO6A 4J9VA 3GN2A 4V3CA 2IEZA 5E2BA 5JHGB 3GMIA 4A7PA 5C52B 2XZOA 2CMHA 4XGQA 3W9UA 2ATVA 3BRSA 1JFFB 5KQRA 1BJTA 2G9ZA 1R66A 1TZ2A 2X14A 3ACDA 1YGPA 3PUJA