4GMFA

Apo structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
335
Chain Sequence
b'KQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVAILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Yersiniabactin biosynthetic protein YbtU
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
total genus 104
structure length 335
sequence length 351
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmfA01
1WVGA 1PSDA 1J5PA 1PGNA 5FYDA 4YJHB 2AQIA 5DT9A 4DPMA 3M1LA 1Z6ZA 5JCJA 2WJPA 1WLYA 3KVOA 4L75A 4M55A 3OJOA 4S3MA 4UVIA 5JCXA 2DQ4A 5A9TA 5C3MA 3RUFA 4AJ1A 4B7CA 2IRWA 3GDOA 2GYYA 5JXWA 3DQPA 4WLOA 3STHA 1HYEA 4G81A 1LSUA 2NNLD 3RUDA 1XIVA 5IDQA 1M67A 4WCDA 3FTNA 1GYPA 2Y0CA 1LJ8A 4NBRA 3S2GA 1A4UA 4FDAA 3KB6A 3TL2A 1XU9A 1QP8A 1P77A 1B16A 2HO5A 1YH3A 3ZWAA 3GGPA 5CEFA 2HJRA 4BGVA 1DFIA 3GT0A 4M87A 4PG7A 3FPCA 4BS9A 1OAAA 1GADO 3EZYA 1TA4A 4OOFA 4L76A 3ASUA 1E3IA 2GN6A 3C1TA 1UH5A 4WASA 2NWQA 1K6IA 3RI3A 2JAPA 4IDCA 3ROPA 1AE1A 2GZ3A 3VPHA 4JIGA 1HL3A 1DIGA 4OH1A 3JD2A 2AW5A 5F3RA 4ZHSA 3JD3A 5B37A 1B7GO 4U7WA 1EVIA 3WFJA 4BNHA 3IKTA 3W8DA 3GLQA 4TROA 2O2YA 3K30A 4DLAA 3HNPA 4YT2A 1MXHA 4L4XA 4NBVA 4NNJA 3GPIA 5CHEA 5FFFA 3ZU5A 1LU9A 1OZAA 1F12A 2AEJA 3COSA 5DP1A 3WTBA 3WXBA 4MKXA 1GDHA 1GZ3A 2QHXA 4E33A 4RPKA 5KVSA 2VWPA 4XQEA 2Y99A 4DBZA 4U0KA 3JQAB 3HDJA 4UUPA 3ROMA 1X14A 4II3A 4KUEA 2XPCA 5H82A 3DHNA 2I9PA 1TVEA 3PI7A 1QYDA 1QLHA 1EVYA 4M54A 1MX3A 1PR3A 1TT7A 1XA0A 4KDEA 5DCWA 3JQ8B 3O8QB 2GDZA 4NFYA 4YAJA 3GNSA 2POQX 4GBJA 3AOEA 2QW8A 2C29D 4BNWA 4CMBA 1NWCA 1PJ4A 1N7GA 4IIVA 4R01A 3ZH2A 1QLJA 3RU7A 2E82A 3C3XA 1GZ6A 1PWZA 4A26A 1NM5A 2RH4A 2OHXA 3OF2A 3CXRA 4CQLA 1LXCA 3SJUA 4DYDA 2WYUA 1B8UA 4IDEA 3CZRA 3GC6A 5IG2A 2DTDA 3FWZA 4PLZA 4JBGA 4Z3KA 3GHYA 2X9VA 3JQGA 2C54A 3SBOA 4DREA 4J2HA 1AHHA 4W9NA 4XA8A 3IC5A 1I32A 5A4DA 1UXIA 4ALJA 4YDRA 3KTDA 2OP1A 1XWFA 5JYAA 1LA2A 4DIBA 1VL8A 3GMSA 5JO0A 1BXGA 1P33A 4FJ1A 2ZTLA 4CLRA 4GPD1 5F5NA 4CQMA 2IZ0A 5FEUA 1H2BA 2NACA 4WE3A 2P9EA 4Q39A 1RJWA 4XRRA 2RH8A 3GUYA 3ZV3A 4PLTA 1ID1A 4DPKA 4RLSA 4KQWA 3KYCA 3UOGA 4EEXA 2Y1DA 4RZHA 4TRRA 2I3AA 2CMDA 3R1IA 5LC1A 3S55A 2Y1EA 1Z74A 5H81A 3UICA 4AJPA 3I4CA 3PWSA 4PLCA 4RVUA 3WG9A 4ND3A 1PL8A 2NVBA 2YJZA 1UXKA 2YHIB 3C8MA 1BHSA 4R1SA 5T5QA 1GQ2A 4IDGA 2ZB7A 2VOJA 2OFPA 3E9NA 5FI3A 1E3WB 3ZDFA 2JFFA 2HMTA 4MIEA 4RVGA 5CFZA 1NPDA 4LN1A 4XQCA 3W4KA 1ZK2A 4AJ2A 3KOUA 3PZBA 3FWNA 3VPSA 1G1AA 3B1FA 3TOXA 5C5IA 4XQ9A 3DR3A 1GV1A 2YV3A 1HE3A 1DIHA 2IE0A 4F6CA 1DC5A 3M1AA 4EJMA 2A94A 3OJ0A 3UCFA 4UREA 4Y98A 2C0CA 2NM0A 1ENYA 3DMTA 1ONPA 4QTZA 5F21A 2ZTVA 5KJ1A 4GGOA 2VHYA 2R00A 2AQ8A 2C2XA 3OP4A 4WOKA 3DOCA 3O4RA 5AVOA 1B2LA 4WUVA 3ZZNA 3NEPX 3P7MA 1U7HA 5EN4A 2I3GA 2P2SA 4R3WA 2VNAA 2VNSA 5AXCA 1GPJA 1C0KA 4XYEA 5I8ZA 2J3KA 4CLEA 4E6PA 2QYSA 3ZV5A 3K8ZA 2J5RA 3QE3A 4W99A 1E6EA 4MO2A 1OC2A 3AW9A 1BW9A 4PLYA 3ADOA 4WEOA 4XX0A 3FN4A 1UP7A 3LT0A 5IF3A 3U09A 3PYLA 3GVCA 4IDFA 4PCVA 4ZQFA 3DBLB 2NLOA 3ZWBA 3C7DB 4TZKA 4E2YA 4BQRA 4BNVA 1DBVO 1YWGO 4MKRA 1LRKA 3LT2A 3F9IA 4FW8A 3JQEA 3LYLA 4PRLA 3WGOA 4MJLA 4ALIA 1CETA 3B6ZA 4LW8A 3NV9A 3TZCA 3RUHA 3WMXA 3W6UA 3TZ6A 4R16A 4YTEA 2PK3A 2CF5A 1UZNA 4UUOA 1ONNA 3PVZA 2ZJ1A 3OIGA 4JJFA 3OH8A 3WGZA 3TZHA 5F5LA 1T4BA 4AJHA 2ZYAA 2R6JA 3DZBA 3QQPA 1VSVA 2P9CA 4HUJA 4Y6PA 2EGHA 3DZHA 4BNFA 3NT2A 1B3BA 2Q1UA 4WCFA 3ZWWA 3UW3A 3I9MA 3DL2A 3RSHA 3I9LA 4CMJA 5JC8A 3BTOA 5JLAA 1XHLA 3IKVA 4D41A 4MDHA 4RL6A 5ITVA 2I65A 1ZNQO 2YFHA 3QA9A 3FF4A 5L4LA 4NBTA 5U9CA 3OJFA 2HMWA 2PD4A 4Q3NA 4B4UA 1WMAA 3D64A 4JJIA 5THKA 4XDYA 2VHVA 1GV0A 2IZZA 1JVBA 1KY5A 4N5LA 2Q45A 3PHLA 4ONEA 2Y1FA 3E1KA 2CDBA 4YAIA 3SX2A 5BT9A 3JV7A 2HRBA 1H6AA 3N58A 4B8WA 5KTKA 5JAMA 1F8GA 5EPOA 3LLSA 1NQTA 5CDSA 1D7OA 4GX2A 1RYEA 1Q7CA 2DUWA 3I9NA 4BNNA 2O3RA 3FI9A 1R0SA 1P0FA 2HU2A 3FCOA 5CDYA 4CLHA 4GKBA 1JAXA 1NTOA 1WPQA 2V6FA 2C82A 1Y7TA 3D3EA 3CMMA 3E8XA 2JAHA 4AJKA 4B7UA 3L0DA 2WMDA 2BLLA 1MG5A 4NBWA 4L73A 2JCVA 5TC4A 2G1UA 5TSDA 1WDMA 4ND1A 3VZRA 3OHSX 1QV7A 1PGOA 1XU7A 4NQZA 3ADPA 1K6JA 4JBIA 4W4TA 3CEAA 1M66A 1QR6A 1WZEA 1GCOA 1E7YA 3WSWA 1Y8RB 5I9MA 5KVVA 1T1SA 1LSOA 4I5FA 1PJLA 5GZ3A 1BDBA 4D79A 5JAIA 1HE2A 4IZIA 3SC6A 5G2OA 4YRBA 2CDCA 4UEOA 5BSFA 1X7HA 1IHXA 1P45A 1XR3A 1MXFA 3F46A 4OXKA 1HDZA 2B4QA 3PLNA 3Q9UA 4BB6A 3INGA 4FR5A 4JLWA 4FOOA 3ZV6A 3E03A 2EP7A 1CQIA 4RVHA 4YR9A 4LVCA 3IMFA 4TSKA 1E6UA 5A05A 3N74A 1YL5A 3NX4A 3D4OA 3WOHA 4CMGA 2ZCVA 1KS9A 4JJGA 2PLAA 2DM6A 2W8ZA 3ZN2A 4JK3A 1XQ6A 2Y05A 4TRNA 4A2CA 2JFGA 4IIUA 1LBEA 3ONEA 4CM7A 2YYYA 1EUDA 3BMOA 1XSEA 3PQEA 4A5OA 2VYVA 2ZTMA 4LCEA 5L3ZA 4D46A 2V6GA 5IDYA 3MZ0A 4E13A 2ZK7A 1CRWG 1LDNA 2NU9A 4XWYA 4JXKA 3DBRB 4IJVA 4CLOA 1LLDA 4WNCA 1V3TA 1V8BA 4BGIA 4GMGA 2VUTA 3WYEA 5DCUA 1QYVA 4XR4A 1ISHA 3ZI0A 2O7SA 3GVXA 5AXBA 3KETA 1O89A 4XCVA 3TNLA 2JD0A 3Q6IA 3GG9A 1CDOA 5TGDA 4AJOA 1JKFA 3WYCA 1LEHA 1PJBA 3CKYA 3CUKA 4BUCA 4RJTA 3HB4X 1GU7A 2A4KA 2JKVA 1A7AA 3JYOA 3ZU2A 5A02A 1QSGA 4XGNA 5DN9A 4QO8A 4O6VA 1XG5A 1IYZA 3VH1A 1C0IA 4PLFA 2H1SA 4AVYA 1ADBA 5IZCC 1AN9A 1R0LA 4RF3A 1ML3A 2O4CA 3JTMA 3K5PA 1QRRA 4IS2A 4RORA 1H6DA 4E30A 3UGKA 5L7YA 1NR7A 1NQ5A 1OC4A 2CD9A 1PQUA 3ONDA 4PLGA 3T4EA 1X13A 3FSRA 1U28A 1E77A 5A04A 5IAAA 1UXJA 1N5DA 5BNIA 3SJ7A 5KIAA 1DHRA 1VLLA 5AQ1A 4HV4A 3H5NA 5ILOA 1V3UA 3ONFA 4YA6A 1EE2A 4ZA2A 4FC6A 1YONA 2HSDA 3RUAA 3MWEB 4B3IA 1NQOA 1Y9AA 2BFMA 1DFGA 1PQPA 1MFZA 3DZKA 1DPGA 3UUWA 3GAFA 3BHIA 3MTGA 3FHLA 1ENOA 3PJDA 1A7KA 2V6BA 4J1QA 5A3JA 1YBMA 4R5HA 1ENPA 2O3QA 1EFKA 4RVSA 4YBZA 5HWSA 3KM0A 5JFOA 5HM8A 3WGYA 1U5AA 4NK4A 1U8XX 1KEWA 3JQFA 3D5TA 4FQ8A 1I5RA 1HLDA 1N9GA 4P4GA 3IS3A 1DEHA 2J5QA 3F5QA 5IDXA 1ZSYA 2NUAA 4BGUA 1LC3A 2IEBA 4YJHA 3KYDB 3W6ZA 4Y6RA 2IXAA 4FS3A 4I5DA 2C2YA 4W82A 2G82A 1DHTA 5DP2A 3TPCA 3PYMA 3PWKA 1K0UA 1UAGA 4W7IA 2DAPA 3HDHA 2JL1A 1U3WA 1IHYA 3G1UA 4YRDA 4YCAA 2YUTA 2X0IA 5A9RA 3PGXA 1GD1O 4MVJI 4P38A 2PH3A 1ZEJA 3NJ4A 2EJVA 2LDBA 2FR8A 1GEEA 2YV2A 4GH5A 4RQUA 1FDSA 5EL0A 4E5NA 1JWAB 3LF2A 4PRKA 3H8VA 4HKTA 5DF1A 3BMNB 3F5SA 1DLJA 1CJCA 2FPGA 3FNEA 4QFCA 3PTZA 1R12A 3AUTA 1H9AA 2HK7A 2VQ3A 3IAHA 1Y5MA 1N92A 3IP1A 1ZO8A 1I10A 2NU8A 4BVAA 4K26A 1U7TA 1I3NA 3VTFA 5A03A 1OOEA 4AJ4A 3NT5A 2P4HX 3IUPA 5KNLA 1XCBA 4WLFA 4HNHA 4YVFA 3PDJA 3FTPA 1M6HA 3A9WA 1PJQA 4LMPA 4PFJA 4R1NA 3PGJA 4R1TA 3WWYA 2I6TA 3TDKA 4NH4A 2X86A 4BNLA 1VRWA 2B5VA 4EJ6A 1P1RA 3C1OA 1VL0A 4XZ3A 3ZGYA 2O4UX 1E3JA 1UXGA 4EZBA 1U8FO 3QWHA 3BA1A 4MVJE 1PGQA 5BSGA 3TOZA 1VE9A 4YT8A 4MVJF 1VL6A 3KSDO 3WIDA 3VTZA 1DRUA 2PZKA 2PWZA 5ENVA 4CODB 2PZMA 3HN2A 5G0TA 1K2WA 4TRMA 5IDWA 1J49A 2GN9A 2AQHA 2GPTA 2Q50A 4BGEA 1VKOA 4CL8A 4D7AA 4J1SA 4UUNA 3WGTA 3U4HA 4YAKA 5ICSA 3JSAA 3GG2A 4WKGA 4PG5A 3D1LA 3I5MA 2UVDA 1O8CA 4KUGA 4M49A 4JX8A 1ZK3A 4LK3A 3CTMA 4BKOA 2RBEA 3OICA 2VWQA 3GDGA 3VPFA 4KOAA 3KHUA 5JDCC 5T67A 1ULSA 1Y8QB 4E2ZA 3BXXA 1R16A 5CG1A 2EJWA 5L51A 3NDIA 3I4FA 3KRTA 2P5UA 4II2A 4ID9A 3CINA 4PVDA 4IDAA 5JMWA 3M6IA 4EUHA 2VRBA 1SOWA 4ILKA 4ZQBA 1I0ZA 4DRYA 5I9NA 1NVTA 3DZJA 3JQ9A 4RF2A 3DEYX 4DPLA 1I2CA 2PTGA 4DXHA 3GDFA 1VJTA 5K9ZA 4B7XA 3F4LA 1YVEI 2GUGA 2H9IA 2Q2QA 2IODA 2XXBA 3AUSA 1GY8A 2BELA 5COQA 1HEUA 2X9GA 5CDUA 4D0SA 1U3VA 2CVQA 2PY6A 3R3SA 1LRJA 4M1QA 1HE5A 2X0JA 1E3EA 1LLUA 4XB2A 3O9ZA 1JWBB 3H9UA 1M6WA 4UUMA 3HDYA 4IQ0A 5TJ9A 4FFNA 3MJSA 4CLDA 2FY8A 2WWRA 2PGLA 4B4OA 5CEEA 5JDIC 5L40A 2D5AA 3KSZO 1BMDA 1ZJZA 1IZ9A 2FOIA 2NVUA 2PFGA 3RKUA 3E82A 3W8EA 7MDHA 5HS6A 4F6LA 3SEFA 4E2WA 4DGSA 1U9JA 5TS3A 3OA2A 1ZCJA 2YZ7A 3JQ7A 4P22A 2EGGA 3OM9A 3F6YA 1EZ4A 5IXSA 3L4BC 3AY3A 3WGHA 3H65A 1KVQA 2NTNA 1U1IA 3RC2A 1KBZA 4M89A 2AHRA 4RDIA 1GL3A 5F1PA 4Z3DA 3EGOA 4Z0HO 4DMMA 3O03A 2OBNA 2Q3EA 3EK2A 4FFOA 4JP2A 4EEZA 1C3VA 1F0YA 4JP3A 1YBAA 3QWBA 4OXNA 4WLUA 4DA9A 3QIVA 1P9LA 3EUWA 1NPYA 4UEKA 2F00A 3IOYA 3DOJA 2OBYA 4WLEA 2HMVA 1SCUA 4ND5A 1ADFA 2EKLA 3DB2A 4O5OA 3VKUA 1Y5RA 3AUUA 4PZEA 1UAYA 3AU9A 5G0UA 3FPLA 4ZU3A 3PHHA 2Y67A 4MPDA 4BMNA 5IXYA 3KYBA 4D42A 1OBFO 5JSFA 1OMOA 3DBLA 4RPHA 3ZHZA 1PU2A 1K5HA 3QVTA 1ADCA 2VUSA 1A9ZA 3ZWNA 1T2AA 4MVJH 1CWUA 1Y9EA 3E48A 2AMFA 1AXGA 1RM3A 3U4CA 1C1XB 3H9JA 4NG5A 4A03A 4NR0A 3MJCA 4CMAA 1W73A 1ONOA 3PZRA 1QV6A 2YDXA 4YJFB 2O23A 3GEGA 3L9WA 4RLHA 3G0OA 2JD2A 4NJOA 5BR7A 1V6AA 4CM8A 4QXMA 2D59A 1T25A 2WD8A 1X1EA 1YS4A 4BHTA 1YDWA 1YDEA 1YO6A 4Q3DA 2AG5A 4XJSA 5L4SA 4DC1A 4HADA 4IXWA 3F4BA 4IM7A 1V0JA 1YOVB 3H2SA 3FNFA 2YV1A 4ZQHA 3LDHA 1WZIA 2X8LA 4GVLA 2JD1A 4L4RA 4NDNE 4Y8VA 4BNXA 3RFXA 3Q9NA 4E5PA 2VCYA 4O1MA 4XD2A 1WNTA 1LDMA 2W2KB 4BO6A 1YJ8A 4CMCA 3ZWOA 2EERA 4ZJUA 1NHGA 1U2GA 3FNGA 2RIRA 3BMCA 2VTDA 1IB6A 3EY4A 5T8KA 4QO7A 4YRAA 4M8SA 1C14A 1Z7BA 1M75A 1E92A 3PXXA 3WS7A 2D0IA 2HMUA 1P74A 2GN4A 5G0SA 3N7UA 2W98A 3F3SA 3UAGA 4FPXA 3U4IA 3ZHYA 1Q7BA 4ALLA 3JQDA 2D1YA 4MP3A 1D4FA 3E9QA 3VZSA 3IL2A 4KTVE 2FZEA 2WM3A 4E5KA 3UXYA 3TN7A 5EQFA 4Q3AA 2PKRA 1NASA 3TF5A 1E1NA 4KQXA 1R4NA 3GA0A 3VVBA 1E6WA 1NBOA 3A1NA 2E4AA 3JYQA 5HA5A 5JAZA 1K6XA 3GZNA 2DBVO 3K31A 2EV9A 2BGMA 3O38A 1CYDA 3D3WA 5LDGA 1R4MA 2JFHA 4QUKA 5J23A 2OL4A 2BD0A 1EBFA 5KVQA 1Q2XA 1RM0A 1ISGA 1HDXA 3NKLA 2O3TA 2RAFA 4XGIA 1D1TA 1QYWA 2V65A 3H5RA 4FGSA 1BWSA 4PZCA 5I9LA 4OIMA 3ZWCA 1TT5B 4QFDA 4QEDA 4Q3BA 4ALNA 1H94A 1GR0A 2BF7A 3PHIA 3DBVO 3QHAA 3DBHB 3SXPA 2VYVD 4DQUA 4LCJA 4EUFA 1RKXA 1ZKMA 4CMIB 1EEHA 5DCYA 1E7SA 4DYVA 4URFA 3DONA 5ENDA 4P4NA 2J3IA 4BO0A 1GYQA 1GUYA 3GN2A 4A10A 3AOEC 1YE3A 3UHAA 3K9QO 3ETDA 1YQXA 1E5LA 4GWKA 3INTA 1I30A 3WNVA 1UDBA 5B4VA 5C7IO 1GUFA 4CL3A 5G4LA 4CMEA 3WYBA 1UXHA 2FMUA 3K92A 1FDWA 2NVWA 2CSUA 2HK9A 2AA3A 3W4JA 4OXYA 1Z82A 4Z9XA 2H63A 4CMKA 3I3OA 4E5YA 1B0AA 4BNMA 1U3TA 2NQTA 1ZW1A 3H9GA 1V9LA 1CEQA 4A27A 4L8VA 1QORA 3WR5A 4PVCA 3D7LA 4HBGA 3VKVA 1A5ZA 1H6BA 2J8ZA 2EP5A 4LSMA 1T2CA 3V2UA 1KEUA 2QRKA 3KBOA 3RBZA 4OOEA 1DIRA 3I83A 2JCYA 1VJ1A 3WFIA 4NI5A 4KTTE 3WJAA 1H9BA 3KLPX 3PJEA 4BMVA 4IINA 2D5CA 3DC2A 3PIDA 4J0EA 5TT0A 3UH1A 3SLKA 1EK5A 2VYNA 4GX5A 3KSUA 4FSHA 1QYCA 2PKQP 4J7UA 4GMFA 1QXSA 4A7PA 2YHUA 4IZHA 4XEHA 1PTJA 3DFUA 5KJFA 4GVXA 1DJNA 3C24A 4BO4A 3ZV4A 1EE9A 2DTEA 2C5AA 2QYTA 4EJ0A 4IPTA 3OBBA 1W4ZA 1AXEA 1XGKA 4BO5A 4ZGWA 3KEOA 3L77A 2ZYGA 1LLCA 4IQGA 4ROSA 1UP6A 3GGGA 1GPDG 4N54A 1LQTA 2Y68A 5U4QA 3UFXA 3W1VA 4JGBA 1P1IA 3DMTC 1F14A 1KVRA 3UVEA 4DIOA 1MB4A 5JBIA 2Y1OA 4UVDA 2R00C 1PZEA 2ZIZA 3H3FA 4NJMA 3TQHA 5C7OO 2Q99A 1E0DA 3DDNA 2X4GA 4KDFA 1KYQA 2BRUA 1T24A 1EK6A 3EVNA 1YB4A 5T6BA 3KYDA 5IFLA 3RQSA 1JTVA 1M2WA 4GI2A 4FCCA 2B4RO 1T4DA 4HFMA 4FJ2A 4BL5A 3LF1A 3WBFA 4K6CA 3ETGA 1SB9A 4CQLB 1A4IA 1Z73A 5ADHA 2NQ8A 4RGBA 4UVEA 1U2DA 3P5SA 3DO5A 3JQGB 4J4TA 1B8PA 4XYBA 3K2BA 3SC4A 1JDJA 2PZLA 3ITDA 3S1LA 3NTRA 2PD6A 2DUUA 3DWFA 3OA0A 3JQ6A 5KCZA 4J91A 1YXMA 2Q22A 2E6UX 3VHRA 5ICMA 3BTUA 4XRGA 4A73A 1BXGB 1SAYA 4UVGA 1KC1A 2JJYA 3M2TA 4JQCA 4KWHA 3BMQA 4YT5A 4FN4A 1HTBA 1KETA 4HXYA 4CQMB 4E0BA 3OJEA 4Q3CA 3GR6A 5K6AA 3AOGA 3HJAA 4PGFA 1A71A 1HDCA 2WYVA 4WCFC 4MVJG 1QG6A 3RUIA 1ZSNA 3AWDA 3G49A 4ZVVA 5JYDA 1DC4A 1GYRA 1KIFA 2XAAA 3JQCA 1MG0A 1NFRA 2V6MA 2A92A 3LT1A 2X9NA 4D3DA 4NPCA 4IMRA 1ZMOA 3JQAD 3KEQA 4MKZA 2Y66A 4Q9NA 1BVRA 5L9AA 1JA9A 2YY7A 3L4SO 5BQFA 1BXZA 2X58A 3ZNQA 4MP6A 4XKJA 3Q0EA 2UDPA 2Q1WA 3ZWYA 4AJNA 2YQ4A 4EGFA 3HHPA 1PIWA 2EG9A 3JD1A 5FF9A 5G4KB 3RD5A 3ZCXA 3JQBC 4CM4A 4OSPA 3I6IA 2W2LD 4Z9FA 3K2EA 2PGJA 5JMPA 2X7HA 4PN3A 3HE3A 3LQFA 3DZGA 3GHHA 3PFFA 2HJSA 1H0KA 3ZWMA 4F45A 1AUPA 4X54A 1Y81A 3AY7A 1J0XO 4DQXA 3S2IA 5BNTA 3DAPA 2P5YA 2QRLA 2YFQA 3GN1A 3GMDA 3I9KA 1NAHA 2CY0A 2NADA 4BIIA 4LRTB 5CPBA 2OP0A 1B8VA 1GTMA 1FDTA 3CZMA 1DC3A 4UULA 2OMEA 4DWVA 5CEJA 5IN4A 1PZHA 1DJQA 1MP0A 2WD7A 4ZRMA 4EYEA 3OMLA 4YWJA 1JU9A 4ZRNA 4B3HA 3MOGA 3WICA 3AI1A 5CDTA 4EDFA 1C1DB 3GRPA 2RCYA 5FWNA 1DIBA 5ES3A 3WQRA 1EMDA 3VVCA 4ZICA 3AI2A 1VI2A 4RCVA 2BI8A 3LC7O 5JE8A 3LK7A 3ZNNA 4BNYA 4J6FA 2R2GA 2ZB4A 5BNFA 3QY9A 4I9UA 1NQAO 4E5MA 1LI4A 3C7CB 4TVOA 1YL6A 3U0BA 5L7WA 4AG3A 1E1KA 1W8DA 4PLHA 3S2FA 3WX0A 4BMSA 2NU6A 1UP4A 2EWMA 3T4XA 4AJJA 4FC7A 3ROKA 2QZZA 1DOHA 4AJIA 5TQVA 2GZ1A 4IUYA 1JLLA 3BTVA 4GKVA 4GLLA 4WCFB 2BFAA 4BNUA 4KP7A 5KJCA 3OIFA 2B36A 3ETEA 1MGOA 2GO1A 4BNIA 3GRKA 3ZHBA 5EJ2A 1S6YA 4R9RA 1C0PA 2EKPA 2GCGA 3PFWO 1NX6A 3L6DA 1V3VA 1R66A 3WTCA 1LRLA 1PGJA 3NTQA 4TWRA 3AI3A 1VM6A 5T73A 1MC5A 4CUJA 1PQWA 3T7EA 3WDSA 2WE7A 4FIZA 5AYVA 1YRLA 4M86A 3WLFA 5AOVA 5ER6A 3JYLA 3TSCA 2C5EA 4EBFA 5B4UA 4CV0A 2C20A 4WOJA 1FDUA 3NGLA 5I7SA 4ND4A 1PJSA 4KZPA 3TZQA 1I3KA 2H6EA 1X0VA 3GGOA 2B5WA 3QSGA 1I33A 4R1UA 4O63O 1IUKA 4G2NA 3VAZA 4Y6SA 2BGLA 5DOVA 3CE6A 4Y67A 4E32A 3SLGA 1VKNA 2IZ1A 1RM4A 3G79A 3QVSA 5ITWA 3W8FA 3O26A 3SVTA 1Q0LA 4E21A 4CM9D 1JN0A 1KVSA 1P0CA 1MV8A 1ZXBA 1F06A 4QQRA 1XKQA 3ZW8A 1T26A 3UF0A 4H16A 5CAEA 3TJRA 3E9MA 2VT3A 4I8XA 1FJHA 1DO8A 3BHMA 3R3JA 3F1LA 2CUKA 3IDSA 1EVZA 2OO5A 5HTOA 3VDRA 3D4PA 3JYNA 1JQBA 1NR1A 4B4WA 3G17A 4AL4A 4BO8A 4MINA 4BNGA 2EW8A 4D43A 2DU8A 4AJEA 2I5PO 2FR0A 1XQ1A 4H3VA 1O9BA 3FNHA 1IZ0A 3JD4A 4J49A 1PS0A 2DLDA 5DBGA 2AQKA 2X5KO 2QZ9A 3P2OA 1JW9B 5A3VA 3FD8A 2OOSA 4OHUA 4DTIA 1N8KA 5BSHA 1N7HA 3AFNA 2Z1NA 1CERA 3A28A 2EKQA 5KWEA 2BH9A 4QECA 3VH2A 5JS6A 3DHYA 3INRA 2YDYA 3KZVA 4JNKA 3GFBA 3RWBA 1DLIA 1Q0HA 1I24A 4HFJA 4AFNA 1ZZEA 2P9GA 4GSKA 3JQAA 1K3TA 5THQA 4UAGA 1ZFNA 3JQFC 1U4OA 3EC7A 2F1KA 5JDIA 2Q2VA 3VH4A 3R6DA 2QRJA 3WMWA 1NHWA 3OFSA 2PR2A 5EIOA 3WBBA 4XIJA 3VPGA 4YJGB 1IL0A 2B83A 4K1LA 3MTJA 3HQ4O 2WEKA 4J7CA 2P4QA 3JQ8A 3O8QA 4G5HA 1X7DA 3LSYA 1A27A 3BMOB 1WDLA 2J6IA 3ANMA 4BKQA 4J3FA 2W2LA 3OQ1A 3DTYA 1NNUA 2B4TO 2B0JA 3L4BA 2J3JA 3RC1A 4B8ZA 1WWKA 4CLOB 2ZJ0A 3I1JA 2Y1CA 4RPLA 4CPDA 4O59O 2PZJA 1NPTO 4OGWA 4W6ZA 4CR6A 4NMHA 4CMHA 4LRSB 3EAGA 2UUPA 1L1FA 5A06A 2HAEA 4RVDA 1SO8A 1NYTA 4K9DA 3QVOA 3ON5A 2QIOA 5AXAA 3E6AA 3AK4A 1R15A 2HK8A 2HLPA 2I76A 3BHJA 2DC1A 5TJHA 1I36A 2A9FA 2FPPA 4P8RA 1VPDA 4CM5A 2Z1MA 3TWOA 4LMRA 3T7CA 3GOHA 5K0ZA 1FXSA 1D1SA 4DQVA 3WNQA 5DZSA 4R5MA 1AHIA 3NJ8A 1SB8A 3AM3A 3S8MA 4HX5A 1G0NA 4BB5A 4CV3A 2VN8A 2AE1A 3MJVA 3K6JA 4J16A 2WE8A 1PS9A 1ZMTA 4Z0TA 4H15A 3Q11A 4UVHA 5TLSA 1HETA 1PL6A 2CVZA 2VZ0A 4ESOA 8LDHA 3WGIA 2FSVA 3PJFA 2EW2A 1E7MA 2NV6A 1GQYA 2Z5LA 3ZNOA 2DVMA 4GGPA 2YHIA 3TFQA 3VH3A 4N5NA 4XYMA 3WGGA 4ALKA 1LDBA 4FD3A 2EEZA 5B4TA 1SEPA 3ITKA 4D44A 1E3WA 3F47A 1KERA 4NHEA 4TKMA 2PNFA 1B3RA 3PP8A 2VT2A 1NXQA 4IJUA 1R37A 4EUEA 2VHZA 2CF6A 5I7VA 1BSVA 3DBHA 1HYGA 2HQ1A 1N9GB 5TT1A 4PIVA 3HADA 4DLLA 4OJNA 4J1TA 5A9SB 3LC1O 4CMIA 4KMSA 4DUPA 3EDMA 4WPGA 1UDAA 1NP3A 4PLWA 3CMCO 1Y1PA 3HB5X 5C7LO 5TIIA 2HKIA 4IJWA 2VWHA 4CUZA 4N5MA 1EDOA 3EYWA 3I9JA 3ZWPA 3U49A 4RDHA 3ICCA 3PQFA 1VJ0A 5CG2A 2IYOA 4WK6A 4D3SA 4J7XA 3WWZA 4YEDA 4IQ8A 1KVTA 1PZFA 4E3ZA 5CDGA 3ZU3A 3B1KA 6LDHA 1I8TA 2O3UA 4B79A 3RFTA 4C4OA 1ZK4A 2EF1A 2VOEA 3JQ9C 4ZD6A 3ZWXA 1H2HA 3PPIA 3VDQA 3GEMA 1EQ2A 4BNZA 1EUCA 4U6QA 1YL7A 4H7PA 4EITA 2J3HA 4CM9A 4DIFA 1LSSA 3X2FA 3MOIA 2VYND 4RPGA 3IQDB 3V5NA 4EI2A 4GWGA 2VRCA 2E37A 1UDCA 2AXQA 2X0NA 1PJ2A 2CNBA 2GNAA 5TX7A 3F1KA 4MOWA 3DZIA 3HUDA 1I2ZA 3V1UA 2WTBA 2OGUA 3WQQA 3PLRA 1KVUA 2X5OA 1SMKA 3RC7A 3UKOA 4I9NA 4BOYA 4C7KA 3BIOA 4XR9A 4CM3A 1WXDA 3BTSA 4KWIA 2FWMX 1O5IA 2BFPA 2QX7A 2G76A 2GLXA 4FBGA 2XOXA 4QT0A 5DBFA 3KLMX 2Q1TA 3CSDA 1G0OA 1ORRA 5I8WA 5JNLA 3V8BA 2HDHA 1AGNA 3ORFA 3AU8A 4RO0A 3PK0A 5EINA 4NIMA 1B14A 2WSBA 4JROA 4WECA 5L4NA 3ENKA 3IIEA 2AG8A 3LT4A 4DL9A 4PG6A 1ZJYA 1RYDA 2BFOA 2IYPA 3EVTA 4XDZA 4YPOA 2CFCA 1HKUA 3ZNPA 2X22A 4J4BA 2NTJA 4TQGA 1GAEO 1P1JA 4MVJP 4B4VA 2A35A 2HCTA 4YAEA 3H9EO 4BO2A 5L45A 3RCBA 4IGEA 4ZN6A 3MCVA 3ZW9A 4HFNA 1YQGA 2PD3A 1LSJA 3QVXA 3UN1A 4GSLA 1KOLA 5KVCA 1ZK0A 2HMSA 4BV9A 3ULKA 3OQBA 2O3SA 3V1TC 2YQ5A 5M6DA 4NU6A 3VPXA 1DIAA 1PGPA 2J5KA 2X6TA 2VZ8A 3GUCA 1X15A 4I5EA 6ADHA 4J9UE 3QWFA 1M76A 1B26A 4Z0PA 3NAQA 1SNYA 4YYZA 1ZSVA 2C7GA 1ZVMA 3GVPA 4ZQEA 4ZQGA 1E3SA 1DC6A 2TMGA 1UR5A 3X2EA 1ADGA 4YQYA 3RU9A 7ADHA 2NU7A 5CP8A 3OEWA 3ROQA 3HG7A 2SCUA 4D0RA 1DDOA 3E5RA 4MIYA 3P19A 4UEJA 1XYGA 3RROA 4MVJM 1Y8RA 4S1VA 4GAEA 1DRWA 4CM1A 1JVSA 1ZBQA 3GVIA 4HY3A 3HN7A 4OKNA 3VZPA 1NVGA 2ZQZA 2NTVA 4N18A 1P1HA 2Q1SA 1S7CA 4XQGA 4XGKA 3AM4A 1PL7A 3HZZA 4IGFA 4IY1A 4WGGA 1E5QA 1XDWA 3NRCA 4OMUA 1W0CA 5IJZA 3H9QA 2VTEA 1HDRA 5JO9A 2NVUB 4DMLA 2OORA 5COBA 1T2EA 3DTTA 2ILTA 4L4SA 1UZLA 3I52A 2FSSA 2AEFA 3WJ7A 1Z7EA 2AEMA 4G65A 3PHGA 5A1TA 3RUEA 3U5TA 3JQ7B 4FFLA 2GD1O 3OETA 4NFSA 4GQAA 2BI7A 1ENZA 2UYYA 5ER9A 4CV1A 3DFZA 3FBTA 2BHLA 1BVUA 1W6UA 1DXYA 1HXHA 1JAYA 1XEAA 4YACA 1CQJA 4LSWA 4CR7A 1DAPA 5G4KA 1ARZA 1BXKA 2Q46A 2XXJA 3I6QA 5JY1A 3ENNA 5T8KC 2O2SA 5TRTA 3K73O 3DBRA 4RV9A 4I08A 5GY7A 4W9NC 4MVJD 1O6ZA 2GASA 4TMFA 4MP8A 2GR9A 2YW9A 4D3FA 1Z45A 4J90A 3PRJA 4BNJA 2X0RA 1L7DA 4J4HA 2PKQO 1BTOA 3EZLA 1Q7GA 3LZ6A 5GZ1A 4C7JA 4FOSA 3A06A 3TZKA 2GERA 3V2HA 1PS8A 3RUCA 3E18A 2VHWA 3CIFA 3WLEA 5H83A 1C1DA 1E3LA 4BQPA 2ZKLA 1H6CA 1TB4A 1ISMA 4YJDA 1U3UA 4JCOA 1VSUA 1ISIA 3ICPA 4FJ0A 1P1FA 5EMHA 1RPNA 2ZB3A 4LVUA 2G0TA 3GFGA 4FFPA 2DBQA 2W90A 5L95A 1E7WA 1H5QA 1N2SA 1DFHA 3RFVA 2Q4EA 2PA3A 1JKJA 4E31A 3D5QA 1LUAA 2LDXA 4HP8A 4NBUA 1P1KA 4CM8B 1LLQA 1CF2O 4P4LA 1KEPA 1D3AA 1Y6JA 1EUZA 3PDUA 5DNAA 2G17A 4E4YA 2C59A 3PEFA 1I3MA 2VUUA 1TLTA 2D4AA 2VZ9A 4YAGA 1X7GA 2V7PA 1RM5A 1E1MA 2IEDA 2ZQYA 5JYEA 2O7QA 2DPGA 5KJEA 1TXGA 3RJ5A 2ZYDA 3DOOA 3CH6A 3H2ZA 3NTOA 4GLOA 4CMEC 5HRUA 5TF4A 4N7RA 2OXIA 3TFOA 4IJKA 3GF4A 5IZ4A 4Z9YA 2FRDA 2B35A 2BGKA 1ZUD1 4E12A 3P2YA 3JQBA 2E48A 2G5CA 1GFSA 3U3XA 3BMCB 4TKLA 1DB3A 3ANLA 3PQDA 4J43A 4U0JA 3PWZA 3NT4A 3NUGA 4OQZA 1PX0A 4EW6A 2D2IA 5GZ6A 3QJ5A 3HFSA 5T57A 1IPEA 1U4SA 4E2XA 3K96A 4CLXA 5B12A 1V35A 5L53A 1R0KA 1I2BA 2DFVA 3AFMA 1GEGA 4BO3A 4K28A 9LDBA 3JCZA 4CLRB 1ZIDA 3WGQA 3G3EA 1A72A 5DDIP 3ANNA 1EFLA 4U5QA 3BMNA 3QP9A 3ZHXA 3UCXA 5IZCA 3LVFO 3GPDG 1R4NB 2DFDA 3OIDA 2Q49A 4FFRA 2Q2WA 3B70A 3AY6A 4J1NA 2Y0EA 3EMKA 5COAA 5ILGA 4YXFA 1XELA 3GVHA 1NFQA 1TEHA 3KYCB 2GRAA 4ND2A 2NSDA 3HWRA 2RHRA 1F17A 3GZNB 4GX1A 3HFGA 1MLDA 4J9VA 4XYLA 9LDTA 8ADHA 3KV3O 3D3WB 1ULUA 1YB1A 1R4MB 4QX6A 4R51A 1C0LA 4L0QA 3OSUA 1BRMA 4R69A 2X1HA 4CV2A 1KEVA 2RHCA 1E1LA 2OUIA 4RVFA 4BV8A 4OL9A 3WQSB 3GH3A 4DC0A 1GCUA 1QYXA 4RZIA 3L07A 1EQUA 3L9XA 3R0IA 1B15A 3H6KA 3QLJA 4WNIA 3VC7A 4R68A 4R54A 1O95A 2HUNA 1NWHA 2Q4BA 3GQVA 1OI7A 5EQDA 1ZEMA 4R41A 3ZU4A 5KOIA 4XYGA 1HLPA 3NGXA 4HFRA 1WMBA 2W4QA 4FGWA 3U9LA 2JHGA 2ZATA 4NK5A 4WLVA 4YJGA 2Z95A 5JPIA 4Y9DA 3PHJA 5LCXA 3H7AA 5BSEA 4YQZA 1PR9A 4Z6KA 1KY4A 1IOLA 1WDKA 3QRWA 5A5EA 1HZJA 3GAZA 2E49A 5F1OA 4U8GA 3DXFA 1Y8QA 1X1TA 1BW9B 1MFPA 4MVJA 3IJPA 3KO8A 4ITUA 1YQDA 1K89A 2GN8A 3V1YA 1YKFA 1O0SA 4HWKA 3WIEA 4CQMD 1RWBA 5L7TA 3GZ4A 1NAIA 1GZ4A 4WLNA 3TRIA 3HSKA 5EESA 3DMYA 4RF5A 4DBVO 3LC2O 1UJMA 3Q2IA 4XB1A 5LDHA 1WW8A 1MUUA 3RKRA 3I23A 5K6AC 3JD0A 2CDAA 4OO3A 4XIYA 4MIOA 5GMOA 3QVWA 1FDVA 3EW7A 1CIVA 3HDQA 4F46A 4TRJA 2UUOA 4IS3A 3MEQA 3C7AA 1DAOA 2AE2A 4NFHA 1YBVA 3CPSA 1HT0A 1NFFA 4OSOA 3G1TA 4AJLA 4U6SA 3ZWVA 3MWDB 5U1PA 1SPXA 1IPFA 4O0LA 5HBRA 1PJ3A 4I1IA 1EVJA 3OQ6A 1BDMA 1YJQA 3FBGA 3I9OA 3TL3A 4NZ9A 2GF2A 1X0XA 2OZPA 1Q1NA 3EHEA 4PLPA 5KKCA 1A9YA 3PYXA 4R3NA 2EXXA 1I01A 4J0FA 1EBUA 4BO7A 1DRVA 3C1AA 2B37A 3AUAA 3NDRA 5JCJD 5JYFA 4DVJA 5C37A 1LTHR 4BO9A 3NDJA 5EERA 1U5CA 1SOVA 2WYWA 2GGSA 2X5JO 3IP3A 2JCXA 3FR8A 2PV7A 1SC6A 5A9SA 3H4VA 2GSDA 4NJMB 1ISFA 4JN6B 1P31A 4YB8A 4RF4A 2ZTUA 5HS4A 4IXTA 4BNTA 5FI5A 3OJLA 2CZCA 2DPHA 2Y93A 4BKRA 2H5LA 1HWYA 2FZWA 3KUXA 4LGVA 3C85A 3RJ9A 5DOZA 5JAQA 1NVMB 4Q3EA 1R6DA 1TI7A 4R9SA 2VRCD 2P68A 5JDCA 3Q3CA 1HZZA 5IN5A 2P91A 1P3DA 1T2FA 1HSOA 3LLVA 1YGYA 4J2OA 4B3JA 4PLVA 2DT5A 1N1GA 1P44A 2UV8A 3V2GA 5JW6A 3BAZA 4CR8A 4OAQA 1ZXLA 3VOSA 1H93A 1Q0QA 2GZ2A 1HDYA 1HRDA 2EIHA 3DAGA 3H5AA 3BMQB 2Y1GA 3ASVA 2D3TA 4YT4A 1LQUA 3KXDA 1EDZA 1L7EA 1Z75A 4PZDA 1C1XA 1O94A 4BO1A 1HDGO 3PIIA 4ALMA 2FP4A 2QG4A 3IUSA 3PJGA 3DAFA 2IDZA 4IDDA 4K6FA 1PWXA 3UCEA 4HNGA 3M2PA 4YJFA 2CVOA 1GQQA 3A14A 3BYZA 3U4DA 3GK3A 3GNQA 2IXBA 2X23A 1PZGA 2JHFA 2EHDA 3MJEA 5TNXA 4A0SA 1PJTA 2TMDA 4KUHA 4QSMA 1WAMA 1D8AA 1FMCA 1PJCA 2ET6A 4OKIA 2VWGA 5B1YA 4CUKA 3B1JA 1QKIA 5MGBA 3D0OA 3WB9A 2UAGA 3GY0A 2DBZA 4L9RA 1YOVA 3S2EA 5JC1A 2Y0DA 1G6KA 3W4IA 3MJTA 1E7RA 3LU1A 3JYPA 1FK8A 1FF9A 1PEDA 5DBIA 3RASA 4CM4B 4FB5A 3NYWA 5I7EA 2W2KA 1SZJG 1LDYA 1I3LA 1BG6A 4LISA 1QMGA 3ABIA 4OQYA 4RPJA 4AICA 1VC2A 1T2DA 1SBYA 4I9HA 5I7FA 2C7VA 4RQTA 1LC0A 5T64A 4IDBA 3B20A 3A4VA 2QQ5A 2XF8A 3FR7A 1ZH8A 4D45A 1N1EA 4PG8A 2I99A 3RIHA 2FHSA 3E5MA 1HDOA 1LDEA 3GEDA 4CM6A 1HE4A 3QV1A 1UUFA 2VHXA 5MDHA 1J6UA 3RC9A 3MJ4A 4JBHA 5G0WA 2WD7B 5CPFA 2DTXA 1T1RA 2O3JA 1BGVA 2O48X 2PGDA 5KJ6A 2BMAA 2ZB8A 3RVDA 3DZFA 3BZUA 5DULA 4I5GA 1J4AA 4WEQA 3ST7A 4GX0A 2HRZA 1WP4A 4OM8A 4BKUA 3L6OO 4R4JA 1IY8A 2I66A 2WDZA 1ZK1A 3OEYA 3WSVA 5AXDA 1HSZA 2FN7A 1KC3A 2FPIA 5F1KA 4BKPA 4L74A 2DKNA 2BKAA 2B69A 1IULA 3H3JA 3QWAA 3U62A 3Q2KA 4IBOA 1XLTA 3AM5A 1DSSG 2O50A 5J9GA 4W7HA 5A5FA 1YB5A 1LX6A 3FRJA 4F3YA 3IJRA 1HF3A 3VZQA 5KKAA 1LNQA 4OYRA 3QWIA 3AJRA 1UZMA 2ZCUA 5JY6A 4INAA 1GUZA 2DBRA 4NU5A 3RBXA 1SEVA 2C07A 1E7QA 2PH5A 4TZTA 3RAJA 1MC4A 2FR1A 1HYHA 4TVBA 1IE3A 4BNKA 1MA0A 1TT5A 1OFGA 2D8AA 1LDGA 4IMPA 4DLBA 1F8FA 5G0VA 3D4NA 3QW2A 3GNTA 2I67A 3L6EA 4XJTA 4WJZA 4GL4A 4PG4A 3RBVA 1JKIA 3Q1LA 4CJXA 4FFMA 3OECA 1ISJA 3DHEA
chains in the Genus database with same CATH superfamily
4L2IA 1WVGA 5C1DA 5K8IA 1GFZA 3O3NB 3QH4A 2NAFA 3EVDA 1E0JA 2D74A 4PC3A 1B4DA 4ZVPA 4LVOA 1V4NA 3F0TA 5FOTA 4RBNA 5A2GA 4E2FA 5H3LA 2H8KA 2OHHA 1T8PA 2EFGA 3EBOA 4QJ5A 3WK5A 5IC5A 1GPUA 2WUDA 4YP5A 4AJ1A 1S1MA 3GDOA 1XF9A 2YX1A 5JXWA 2XCOA 5AVTA 2DE0X 3GGSA 1HYEA 4IHJF 3DCNA 2ZE7A 4I1RA 1O4VA 3RUDA 1T5DX 1XIVA 4JGIA 2P9TA 2YICA 1RQLA 1SKYE 3OU7A 4RETA 4HUTA 5JVDA 1GYPA 1J00A 5EVJA 1M2JA 4RWEA 1Y3HA 2Y9PB 4B6RA 1A4UA 3B1XA 1KYYA 3C6BA 3G0HA 4NTZA 1AF4A 3ILHA 1YH3A 5LZ7A 1IJEA 3JATB 5DVZA 5AIBA 1MT3A 3FYUB 3IUEA 4CIXA 4M9RA 4NYIQ 1GKUB 4H1TA 4B6GA 2JCGA 2CLDX 3HP4A 3SYRA 4PG7A 3REFA 1JFLA 3FPCA 3RJZA 2H1LA 2C03A 2YOGA 5JTUA 2XMBA 3EZYA 1U31A 4L76A 2PEYA 1YQ9A 1FJXA 1MB3A 2YWEA 3PDWA 1CDZA 1E3DA 1C81A 2GN6A 4MMXB 1YSCA 5ANRB 3B7GA 4O2RA 1WOYA 5J63A 3TLYA 1X9HA 2ZW9A 3OU2A 3RI3A 4F4JA 3EPHA 3L7DA 2JAPA 4Y1GA 3DZ8A 3I2GA 3Q85A 4M1TA 3PNBA 3VPHA 1HK7A 5LKAA 4IO0A 5E3JA 3L18A 5MF6A 3ZX5A 1DIGA 3DKKA 3DP9A 4M98A 2ZJ8A 2AW5A 4H1VA 4IUDS 3JD3A 4JQYA 1B7GO 2D4HA 4U7WA 5F33A 2YASA 4UE3S 2FQQA 1W93A 3UTDA 3UW1A 2XCTB 1KK0A 2ODPA 2VHJA 3W8DA 4TROA 4MRVA 3HNPA 4NYJQ 2JHCA 2XEXA 1ZVQA 4L4XA 2GYUA 3NBFA 4N5HX 4REQA 2DWOA 5DN6A 3UAZA 3ZU5A 4M8KA 2LNDA 4OHWA 3S2SA 4CT4B 3RT7A 4DA6A 1V16A 1F12A 1RI4A 3WXBA 4TSFA 3U19A 3OZUA 2VWPA 1AGPA 4MUHA 2RHJA 3KPWA 2P90A 3TE7A 4C89A 2HZ7A 4EUSA 4AQ7A 1X9GA 1PQ4A 1M6YA 4D9KA 1Z6AA 1P7CA 2HBQA 1Z0SA 3JQAB 1SXPA 3HDJA 4OA8A 2B82A 3DUFB 1X92A 4OHPA 4C5CA 3PQ7A 3ROMA 4WN9B 5LMZA 3G7SA 1B74A 4II3A 4RAQA 3LUFA 2W2XA 2XPCA 1JTFA 3PTAA 1KEKA 1T2VA 1Q77A 3DHNA 2I9PA 3OCCA 5AI6A 5DX8A 1QYDA 3T0IA 3GLFA 1QLHA 2CLOB 1W88B 4O0MA 2BT4A 4M8LA 2VYCA 2ZS9A 4M54A 3ABZA 4ER7A 1MX3A 3FZYA 4MJXA 1QQBA 4KDEA 2VA8A 5DBOA 3GLTA 3JQ8B 4NFYA 4WKBA 4GBJA 3AOEA 3T35A 3IJEB 1M6EX 5AVSA 1U7DA 1CFZA 1PJ4A 2AOTB 2AFIA 1OLXB 1JMYA 3QE2A 5FX2A 4RD6A 2XNDA 3BWDD 3EPLA 3C3XA 3C7KA 1GZ6A 1NM5A 3N75A 2WRZA 2A7QA 2K7ZA 2OHXA 3ZWDA 5KYYA 2BCJQ 3ZR4B 3SJUA 1K8YB 2ZRLA 5D85A 1GAQA 2W6PA 4HDRB 4IDEA 5AW7A 4ZTUB 3G5AA 2PUFA 1Y3AA 3ICVA 3OFND 2YJTD 2QTNA 4DREA 4QLBA 2K7FA 4W9NA 5DNDA 4AT1A 3RGGA 2ZRBA 1B1AA 1UXIA 2OXTA 4DVGA 3HSYA 3I1YA 4EOGA 1NN5A 4DLWA 1FPMA 1A8SA 4QL3A 3DEHA 1VL8A 5JO0A 5JI3E 4LWPA 1FNSA 1L3BA 4CLRA 4HWSA 4CQMA 1UPAA 5KJ6A 4LHZA 5CW2A 4PZPA 5DNVA 1H2BA 2NACA 1P4HA 3HCWA 4EB8A 3RF6A 3U7HB 2WTEA 5JZ9A 4AKTA 1M9NA 1ID1A 1THMA 4PLTA 3O8RA 4D4KA 4DPKA 2H9YA 4OP3A 5EQJB 4OYHA 2CMKA 2JFUA 2HHLA 2FKAA 2PJDA 5D5PA 3UOGA 2B1RA 4R1LA 9MHTA 3S55A 3AR2A 3J81A 4MRNA 2IOFA 2ZIXA 3I4CA 2JGKA 4RVUA 1YZQA 3R0XA 4JD5A 1Q0ZA 1CUGA 1UXKA 4MQLA 4EHDA 1NLFA 1BHSA 1GQ2A 2QR5A 1IJBA 4IDGA 1G21A 4QPNA 2OFPA 3DV2A 3E9NA 5JFGA 4DR1B 1O08A 3H1EA 1JQEA 1ZD1A 4M4SA 4CIWA 1XTVA 2B2NA 2XVMA 4N9QA 1NPDA 4HEHA 4LN1A 3W4KA 4HNVA 1ZK2A 1APBA 2VNHA 5CW1A 2Q07A 3PT5A 3B1WA 2AMYA 1T6NA 3DLAA 3FNIA 3BXHA 1C7IA 4NONA 3VPSA 1Z25A 1FFXB 4KEAA 3TOXA 5F51A 3IMKA 5JH7A 1KAMA 4XQ9A 3DR3A 1PBTA 1T91A 2XMDA 2IE0A 3KQTA 4KLNA 4F6CA 3M1AA 2GAJA 3OJ0A 4M7PA 1RYHA 1Z39A 4UREA 5JNUA 4BCCA 4R71A 2NM0A 3KR9A 4U7FA 1ONPA 4QTZA 3UG6A 5F21A 3R7FA 2ZTVA 3FCUB 2R84A 5KJ1A 2NXWA 2GJSA 1DKPA 2VHYA 2R00A 3I53A 2FSHA 1N8NA 4J6EA 4WOKA 4WUVA 4EPXA 3K0EA 5EEGA 1DAFA 4MWDA 3SQOA 4BJ1A 3NEPX 3P7MA 4L02A 2GCIA 2W37A 1GPAA 2I3GA 3MGBA 4IFIA 1F48A 5KDLA 2V0NA 1Z0FA 4LZAA 4E09A 1G9XA 4XVUA 3K9FC 3ZV5A 3BMXA 5NULA 2J5RA 3N76A 4D9HA 5HKAA 4K9RA 3E81A 1T9CA 4EZIA 2WF5A 2I1QA 1A97A 4MO2A 3E35A 4EJFA 4KKVA 1BW9A 4PLYA 2HPAA 4XX0A 1XD9A 3FN4A 3UGTA 5IF3A 4OAOA 1G3RA 4GKAA 3C4VA 4M2LA 2WAAA 3DBLB 4ZQFA 3ZWBA 3FMPB 2QLMA 1L5OA 4BQRA 1BWRA 5E6SA 2AT1A 4D3DA 5KNCH 1YWGO 1XXHB 2PZAA 3CUWA 4AD8A 2ZQ5A 1LRKA 4FONA 4AIIA 3F9IA 3JW8A 1T9GR 2XUKA 4PRLA 1I9CA 3WGOA 2FQYA 4WKNA 5EZQA 5C3UA 1GA6A 3NVAA 4LW8A 2HA0A 16PKA 1JQLB 4GXQA 1W4AA 3PC7A 4U7PB 2JGRA 3RUHA 4NXMB 2XE8A 4QATA 2F1OA 4ENUA 3N5KA 2CF5A 2WIDA 3JSXA 1P72A 1A88A 1K4KA 1ZGHA 4U2EA 1L4LA 2WWTA 3WGZA 1NW6A 3TZHA 1T4BA 4AJHA 4AN1A 2R6JA 5AKYA 4CDNA 4US2R 5KSYA 3TX6A 1NV8A 4HUJA 4TS1A 1Q15A 1MENA 3PC6A 1X7ZB 2Q1UA 1DBSA 1CT9A 4KDRA 1E5VA 4WCFA 3RSHA 5JC8A 5BN5A 4CMJA 1TQ2A 1NBWB 3EIWA 3BGOS 1JDVA 2ZJBA 1VSTA 2WPDA 1XHLA 3IKVA 3JX9A 3HYCA 4B0PA 4FM9A 3MWDA 4RL6A 1XE3A 2ECPA 5ALWA 1XU4A 2I65A 3C8ZA 1P61B 3EISA 1ZNQO 3OEED 2GAIA 3GEIA 3FF4A 1DVRA 4R05A 4UXHA 4JUFA 4NBTA 5JPDA 1KU0A 1Q11A 4MAMA 3BD8A 4KQMA 4F2PA 1SXJD 4QJBA 3OJFA 1Z15A 2PD4A 3O3OB 1I0LA 5KMGB 4I4TB 4FKBA 4RY2A 4JLPA 4CU5A 4G2TA 2QENA 4ZVLA 2R6ZA 4JJIA 2FDXA 4B7AA 2DY0A 4EJSB 2IUYA 3ACDA 4JR2A 3IA7A 2HRCA 3R2JA 1GV0A 1W44A 4XDYA 3KSRA 4FK8A 1TIPA 2CXXA 4V0MA 4K9QA 1XZIA 1I4WA 3L8MA 4YDHB 5IUJC 3KOYA 5JANA 4KQ2A 4M7OA 3E1KA 2CDBA 4MS3B 3CRQA 2FGKA 3HBJA 1H6AA 2BZ0A 3FMIA 4GXTA 4OMCA 1S9HA 4YH1A 3FFTA 1R27A 4NRDA 3EP3B 1OBOA 1WZNA 2E4VA 1F8GA 1JQ3A 1NQTA 3IXMA 3GCDA 5FCDA 4ZOLB 1D7OA 1TVCA 1GZDA 3LFTA 1JI3A 2VSNA 4JI0B 2CXQA 1TYEB 3AZOA 1R0SA 4H6WA 1UPFA 4JJAA 1P0FA 2V7TA 1US8A 2F2TA 3K0KA 1SD1A 1JAXA 2ECQA 1FMLA 3ABRB 1WPQA 2XI4A 2V6FA 2C82A 4I6JA 2HSEA 1IQPA 3ZE8A 3OKAA 4B7UA 1NMZA 2EQBA 4TZ0A 2BLLA 1LPOA 3MTDA 2VF2A 4HDMA 4EYGA 3TL6A 1JPJA 5JD6A 5DHFA 3VM6A 1LJUA 3OZEA 4RJJA 3ND9A 2XVAA 4MV6A 1F4LA 3F6CA 4LWOA 3VZRA 2R751 4PXAA 1U8CB 2NU7B 4O02B 3AHIA 5H02A 4GLFA 1ESZA 1GL7A 2GCOB 2R7AA 3ADPA 3HXQA 3NP9A 4FWTA 4YRGA 1IZZA 1P5RA 4JBIA 2ERXA 4X5OA 3EUAA 3W2EA 4NZZA 1QR6A 1I7NA 1NW3A 2DMRA 4NAVA 3FX2A 4P98A 4XIFA 1GCOA 2QG9A 3GLSA 4JLSA 5EWMA 3WSWA 4AIRA 3EQ2A 3LKVA 4HEA1 5AW4A 4ARUA 2AOUB 4YP7A 3D6VA 1SQ6A 3JAKA 5K8CA 2QPTA 1HUQA 2QI9F 4QFMA 1GOTA 1MC1A 5JAIA 5J2UB 4WFKA 1LPNA 4EB3A 1KAHA 2B21A 2OC9A 5KX5B 3HCRA 4RWZA 2AC2A 2O1EA 4YRBA 3ITNA 4DA4A 4UEOA 2IELA 1JWLA 3REQA 4UNSA 3V1KA 3F46A 3CWZA 4OXKA 1KZ9A 1QF9A 2B4QA 3ZTYA 4H6PA 1NQWA 1QGED 4FR5A 5E1OA 3IJ5A 1Z26A 2PRYA 1CQIA 1OT3A 4IX1A 3V34A 3EZFA 2PG3A 1U94A 2P9JA 4LVCA 4EGQA 3HM2A 4EFMA 5K0LA 2I9KA 3R5FA 1L8QA 3RK1A 4PQYA 4CMGA 1KS9A 1RACA 2XDQB 2RJOA 4MQEB 4ITRC 3R7BA 1TZBA 4OXXA 2UKDA 3NOVA 4LOKA 1CEXA 2QTGA 3JALB 1MORA 1XQ6A 1XZGA 3KHKA 4FKZA 3CWCA 4JK3A 4LZPA 1QRDA 5E8JA 5EZ6B 3EULA 1L5HA 3S0JA 3V7NA 4Y18A 1RHQA 2JFGA 3PXGA 4RL4A 2YYYA 1EUDA 1T4CB 1T8RA 2J45A 2XF2A 4LHXA 4DLNA 3AHCA 4KYUA 2AWOA 1BEEA 2ZTMA 2C58A 2HSJA 2GK6A 2V6GA 5L3ZA 3MZ0A 2FOXA 4WBNB 1FVOA 4HXEB 2LR0A 1CRWG 1Z7WA 4N8EA 5HKOA 4WACA 4CKXA 3CJRA 3G7UA 3LY5A 3MGKA 4ZO6A 4GMGA 421PA 2VUTA 4TGLA 5DCUA 2IUFA 5HIAA 3FOFC 2GQ0A 3PUYA 2FZLA 4LBZA 4AJOA 2ZBPA 1CDOA 1IH8A 3GFPA 3GG9A 3WYCA 3CNBA 4RD4A 5TGDA 2BFDB 4BUCA 4AURA 3HB4X 1GU7A 3HWSA 3LKBA 3N59A 3QBVA 3EDOA 2VDMB 4LYHA 2UYGA 1QBKC 1XG5A 4EKNB 2H1SA 5IZCC 1ADBA 3QOYA 1AN9A 4CCWA 4QGAA 5CT6A 4J76A 4NE9A 1ML3A 1T6YA 2O4CA 3LGAA 4NCNA 4GPTA 3K5PA 1I7PA 1AGYA 1QRRA 4OG2A 1BDJA 4IS2A 4YFVA 1SHLA 3ICEA 1H6DA 1G2IA 3RS8A 1Z12A 4TV8B 3F8WA 4UATA 5P8WA 1Y4ZA 3RSSA 3U31A 1OC4A 1PQUA 3BL6A 1G5IA 2QAIA 3ONDA 4PLGA 4EHBA 3EXFA 4HDSB 3RC8A 3FSRA 1KOJA 1E77A 1U28A 1V5FA 2ORYA 3A05A 3ONNA 4WOCA 1QOPB 2R60A 4EY3A 3CB2A 4AWXA 2PUWA 2NPFA 4BP9A 5DX1A 1YZGA 2ZUWA 4ISBA 3ONFA 4JLNA 4ZA2A 1OTYA 4DNQA 3THWA 4FC6A 1UFOA 4FUTA 3DD5A 1YONA 2HSDA 1JEEA 3TUTA 4LPSA 1CJMA 3P9SA 3RUAA 4DRXB 1OZGA 4NEQA 4R8LA 5FT9A 5I4KA 4N0DA 1N2HA 1PF7E 3DAYA 3D8TA 5F2EA 2B6NA 1Y9AA 4RELA 3T0FA 3FSJX 1DTSA 2C57A 2XCLA 3UY4A 4K2AA 3V8NA 1DFGA 3W8RA 1MFZA 1DPGA 3UUWA 1FP6A 1NXOA 3BHIA 3MTGA 4X93A 1ENOA 3AMVA 3PJDA 4DEXA 1OW3B 2RHTA 1YB2A 1J1UA 1I7DA 1ZH0A 1YBMA 2O3QA 4GFDA 5HWSA 3NAMA 1ZN9A 1II0A 4YMSA 5JFOA 2I91A 4NMWA 1QTQA 3WGYA 1L7NA 2QX4A 5LNK1 1DUIA 3IXLA 4HAXA 2RKOA 3JQFA 3ORSA 3DEAA 2HWUA 2WM8A 4P4GA 3TPFA 3RREA 5AI9A 3KJXA 4U2CA 3CNLA 3H19A 1Y48E 2JLRA 2NUAA 1GQOA 2IEBA 3EZNA 4WIAA 1TVMA 4Q4CA 4I5DA 4LPKA 1T9ZA 2G82A 4R8RA 3PYMA 3AUKA 1M8KA 3CM0A 3H5LA 1BIFA 1EHCA 2DKFA 2DAPA 2O2EA 2PGOA 2R2AA 3E4DA 3NVDA 3OOJA 2JL1A 1U3WA 4LTDA 5EKSA 3SHVA 3WWCA 1I5OA 2M32A 3G1UA 3PA6A 4P3NA 4M38A 1RLTA 3P5BA 4KQHA 4YRDA 1Y6GA 2X0IA 3VBEA 5A9RA 5IFLA 4P38A 1OZ0A 1EM6A 3HO6A 1AZSC 3Q5EA 4D4JA 1I2AA 3NJ4A 3EIHA 3EFOB 4H7HA 5JAOA 1MJGA 1G2QA 2YV2A 1GEEA 3OD1A 1BQ4A 3FTDA 3RS2A 3LP6A 4GH5A 3V4RA 3HK2A 2WHEA 4Q24A 1MVNA 5J4VA 1EXVA 3FYUA 5FOWA 4QT4A 4HKTA 2WI8A 5ECYA 4X65B 1LWNA 5DF1A 1SZCA 5JSKA 3T5BA 3GD7A 3F5SA 4H4CA 5FNVF 1JA1A 1NJ6A 1CJCA 1IY1A 2D1RA 2FPGA 3L0YA 4O25A 1D2EA 3PTZA 3AUTA 1FMJA 2AYXA 3HY3A 3LC0A 3LLMA 4Q1EA 2VQ3A 2H1WA 3IAHA 1KJZA 5FFNA 3IP1A 2NU8A 1ZO8A 4K81B 4P7JA 4BVAA 4HVLA 2OCYC 3GZTB 2DGDA 1L2TA 1E8MA 3EP4B 2ZIEA 4CCSA 5A03A 1OOEA 4LJ9A 4AJ4A 1YOBA 2RB5A 3KKPA 3L41A 3KAQA 1ZP6A 2SNIE 1VMAA 3K20A 4HNHA 2GHQA 1ZRMA 3N87A 4Z3OA 2ZWMA 3AB8A 3NU1A 4YREA 1UC8A 2R6R1 3HCFA 1XA3A 3QKTA 4M36A 5DGCA 3MWGA 1KA9H 4LMPA 4XEUA 4R1NA 2H4HA 2UZIR 5EIFA 3U5ZB 2YXBA 3LLUA 2CXOA 2DH6A 3V2IA 2I6TA 3W1EA 1KI9A 3B9RA 1VRWA 3WYAA 4A6PA 1P9RA 1QYIA 4GPBA 3EQ6A 3ITEA 4ZDJA 3IAS6 3OFVA 4FYMA 3NEJA 2O4UX 1UXGA 1OBHA 4IJMA 1U8FO 3H2JA 4OBEA 4Y2UA 5H16A 3T38A 5LYYA 4MUGA 2IYNA 2O2DA 5WRFA 4GBMA 4MVJF 1Y9JA 4BJHB 3KSDO 4UBNA 2KWIA 1DRUA 2PZKA 4ETIA 2B1IA 1FXWF 4J2TA 5ENVA 1JU3A 4CODB 2PZMA 5G0TA 5HIKA 1K2WA 2FZ4A 5IS2A 1O9GA 2B1JA 2OGZA 1LW7A 3ZJUA 4LTNA 2GPTA 1ZUNB 5FOUA 2X1LA 1W0KD 1X74A 1CRQA 4OYLA 5KSPA 3RVPA 4EFLA 4YAKA 3PUJA 4IEFB 4KDCA 2RB4A 4TTAA 3MMNA 1RYFA 2BZSA 2VHTA 4WKGA 5F9MA 4PG5A 3DD1A 4KUGA 2VT7A 4M49A 4LK3A 3KPYA 1NDQA 2H07A 3BB3A 4MICA 3M89A 3GDGA 1F2UA 4KOAA 3U3ZA 2WWGA 4LZJA 3OUZA 5T67A 1CIJA 3L8GA 4HUQB 4LY3A 3B9QA 3BXXA 5CG1A 4MUFA 2UUAB 4X1KB 2WWHA 4KXWA 3Q8KA 4N76A 2XB2A 2Q2OA 1UBNA 1VKRA 1ANKA 1HDEA 1SOWA 4ZQBA 2CNOA 3KK0A 3MS7A 2XWQA 3SZ3A 4YCSA 3Q7IA 1VG0B 3GUVA 3QVJA 3ZI4A 3ODPA 4HRYA 5BR4A 1H85A 1IMJA 4GOKA 2NAPA 3KB8A 1NIJA 3BSYA 3ZJ4A 4UM7A 4G01B 1QH1B 3DWEX 1YVEI 1YZHA 4MQ4A 4BBJA 1Q5PA 2H11A 3K9HA 3PA8A 5COQA 1HEUA 4FKMA 2HI0A 5TGZA 1KK1A 4W9MC 3R3SA 3NOXA 1HE5A 4QDTA 2C3MA 2OYSA 3HXMA 5IM5A 3SDSA 1XRJA 5JBQA 1JDUA 1U7WA 4IFTA 3HDYA 3PQ5A 1VFNA 4WUTA 4FFNA 3MJSA 4CLDA 2FY8A 5HMMA 2WWRA 1CU1A 4HRVA 4O4IA 2FWNA 4YROA 5EZYB 1L5FA 2B4KA 4QUHA 5HCIA 121PA 2XCIA 4NYIR 5EWJB 2XVZA 3UJ7A 4BC1A 2JLBA 4R8MA 3RKUA 2DULA 3E82A 2AHOA 3W8EA 4GQBA 5HS6A 3CLTD 2QM7A 4XJVA 4HR7A 3Q9SA 4LJAA 5KYUB 2FLKA 3SEFA 4E2WA 4N3NA 1UODA 2VQDA 3MTIA 1N2JA 2UYQA 3CISA 4B8YA 2Y0BA 1TZMA 2AJTA 4MR7A 2FYTA 3OA2A 3P27A 3EFHA 3KLBA 3ZH9B 4OPMA 4ZEWA 2OA0A 2ODEA 4XLLA 2Q3BA 3LA8A 4WXYB 4E5DA 3P9IA 1N6LA 5IXSA 1UKEA 2I78A 2WVAA 3L4BC 3D31A 5JNWA 1JDNA 2FZCA 4DR6B 2XGSA 4XW2A 4PIPA 3LD9A 1YUMA 3H65A 2CLKB 3ZHTA 1U1IA 1Z6GA 4JJZA 1JJ7A 2IXTA 5E4YA 1IBMB 1TD1A 3PNYA 4KIWA 4RDIA 4AI6A 4J0CA 3IGFA 1T2NA 2SICE 4I2NA 2ODQA 5AI5A 5F9FA 2QN2A 4IFBA 2Q3EA 4Y7CA 4EGAA 2OECA 2LIPA 4R98A 3CX6A 3VR4D 3RHTA 4MHSA 5HQTA 1F0YA 1Q0RA 1JYFA 4JP3A 2LCFA 1YACA 3E9CA 3LRPA 2CN1A 1PHPA 4HTFB 1SCIA 2YMLA 2IXFA 1YMVA 2F00A 1YT5A 2G6TA 3ND7A 4NJEB 5KSWB 3O93A 5CAEB 5AVWA 1ADFA 2CUZA 1PNVA 2BKXA 3VKUA 2YJ4A 1EFUA 4AP5A 1QANA 4E4TA 3VSEA 5JNRA 3AU9A 5G0UA 2Q8NA 2UZ4A 3EJWA 4XGQA 2HN9A 2D2VA 2PWAA 4MPDA 4DR3B 3T41A 3OX1A 2B30A 3KYBA 5IXYA 1XLTC 4A91A 3F5FA 4UFPA 1ZJ5A 3ZK7A 5JSFA 3DBLA 2UYHA 2LP4Y 5BMVA 3D1VA 4PGHA 1A9SA 2YYAA 3V4PB 3KOXA 2FPKA 4G5GA 1CUAA 1A9ZA 1M54A 4LI3X 3ZWNA 2EBWA 3WLPA 2PS0A 1KZHA 1AXGA 5ESWA 4YJKA 1S8NA 2OZVA 1TZJA 3U4CA 4W5TA 4DSOA 1ESDA 1C1XB 1YRAA 3W04A 3H9JA 4M9ZA 2FP4B 1XZHA 2P7IA 3CNNA 4LMBA 4M1KA 1FS4A 4MV0A 5HPYB 1YV9A 1G59A 2JBAB 2GNPA 3CCBA 4YJFB 3W5VA 3GEGA 5DLYA 5IJ9A 3L9WA 3EP6B 3CF0A 3O74A 2M6SA 4RLHA 3T1VA 5TDHA 3UAYA 3FLEA 2G77B 4CM8A 3C74A 2D59A 2W0MA 3GFSA 2W93A 1RXIA 1YS4A 2Q4OA 2R6GA 3GXOA 4GRIA 4Y2GA 1M2FA 3TLBA 3VKFA 2FZGA 4OVKA 1CF4A 3FSEA 4FR0A 3G2KA 5FIUA 2BPOA 3U39A 1F7UA 1LX7A 2Y4OA 4IXWA 3F4BA 3KKNA 4IM7A 4DHEA 1YOVB 4EYOA 1I94B 3FNFA 2YV1A 4CEHA 4OX9B 4ODIA 1WTAA 1SIOA 1Y63A 2HV9A 2G3YA 4ZQHA 4BECA 4EMTA 1G38A 1PKXA 3ZCRA 2X8LA 4GVLA 4NDNE 4L4RA 2P65A 1ILEA 3O83A 3BERA 4NPHA 3BWXA 3L8FA 3RFXA 3ZPXA 3PRYA 2EQAA 4O1MA 2FUCA 4G86A 4ARZA 4EJSA 1LDMA 4KG7A 4BO6A 3KTAB 3W5SA 2AUTA 1JR6A 3NALA 2PVSA 2YOFA 3KNZA 1GWNA 4II7A 1NHGA 1MOSA 2EL9A 2WYIA 4MS4B 2R44A 1T0HB 4QOSA 1HBJA 4JDUA 3TLCA 1CFJA 3J7TA 3BMCA 2YN0A 5E0KB 3TQOA 1KDRA 1FPQA 2CDNA 1P19A 2V98A 2K4MA 2VTDA 4QO7A 4YRAA 2JIQA 1UBKS 1PI3A 1Z7BA 1M75A 4KZKA 4M8SA 2FSPA 1MTOA 2P6OA 4V1CB 4I5IA 3WS7A 4ZOLA 4KJXA 1T3LA 2WPNA 2D0IA 1IOWA 1T8WA 4TS9A 3Q1KA 3LXUX 1PUJA 1IQUA 3UAGA 3ZHYA 2GESA 3GA7A 4RK1A 4A36A 1VPLA 2A0FA 4ALLA 1BWQA 4MVXA 3BH0A 1N1MA 3LUCA 1D4FA 3F8TA 1C9JA 1KI3A 5IKPA 2NUBA 5D87A 3CQ9A 1PKEA 3NNSA 1T15A 1BMTA 1G16A 2P5TB 4Q3AA 5EQFA 1NASA 1OB2A 1JSCA 4YMVA 2W6CX 3ESAA 4G1UC 4KQXA 1NBOA 4BVFA 2Z0MA 3EXHB 1Z5NA 2GCOA 2BN4A 1N5RA 3OT4A 4M1YA 3OZFA 4YS6A 2OHIA 4R2JA 4G0QA 1T0PA 1WMDA 2F64A 5JAZA 1K6XA 4WAUA 4G4JA 3PC3A 3K31A 3PRHA 3FB4A 1NOIA 1W76A 4ZI3A 2WNHA 2BGMA 3B5EA 1CYDA 4ATNA 4LXTA 1LPMA 4B4KA 5LDGA 3HVIA 1U90A 3HXTA 2G1KA 2BD0A 1EBFA 4HDQB 3ZZMA 4ZEMA 1EGAA 3NKLA 3SC2B 2RG7A 1DKQA 3OPMA 3QXJA 1K7SN 1Y33E 3H5RA 4FGSA 5I9LA 3EZGA 5KX5A 5DHPA 2OR3A 5KAMA 3CR3C 1H94A 1MIOB 2ZTSA 2DQSA 4O4LF 3UUFA 1TA9A 3W3AD 2ACEA 3DBHB 4F6RA 3LHDA 3PB3A 2QNRA 3DDHA 4LCJA 4UQOA 5REQB 1GNQA 1FUEA 1ZKMA 4CMIB 1E7SA 2Q9BA 4DYVA 3E3MA 3AGPA 4XWGA 4B2PA 4UFOA 1SU6A 2XNJA 1N6HA 3O8BA 1FNNA 4L6CA 4P4NA 1E63A 1N8TA 3GN2A 3HEMA 4A10A 3U6KA 2GBLC 4FE7A 2V1XA 3BIXA 4HK4A 3SF8A 5A1JA 5KYKA 1YS6A 1ZVVA 4TMTA 3K9QO 1BCRA 1EJ2A 2JLVA 4L57A 3I0NA 4GWKA 3JALA 2NGRA 5YASA 4DE5A 3QYPA 1YBHA 5ERXA 3WNVA 3RDPA 1UDBA 5DT2A 2QNIA 1NDHA 1HT1E 1ZNZA 3ZDYB 2ZBEA 5BPFA 2CSXA 3D7RA 1T4CA 3TYXA 4LMAA 4XVCA 2ZYSA 1FYFA 4DMUB 2CSUA 1XALA 2AA3A 2OO7A 1S3IA 3DOHA 4WBNA 4Z9XA 4H35A 4D5EA 4AUMA 1DC8A 2WHRA 2XZPA 3FNQA 2GF9A 4YUXA 1V9LA 4R7TA 2NXJA 1UFRA 4HEJA 1KR2A 4Z51A 1PEKE 1PSWA 1DS6A 2E4WA 1NVVQ 3N39C 3OTGA 2IOHA 2ZRHA 4NVRA 4G24A 3WR5A 2IUSA 4HBGA 1EWVA 1J20A 4G8BA 4AMBA 2V5AA 2VBGA 1A5ZA 1H6BA 4JS0A 2VPPA 1XZPA 4MA5A 3V2UA 2QAGA 5FO0A 4HYQA 1W0JA 2J3EA 1E2JA 1KEUA 2PLRA 2VL7A 5FWXB 2GXQA 2XMQA 3LQKA 2BWJA 4QPDA 3RC3A 4F91B 3MT9A 3I83A 4JIMA 1VPTA 3W9BA 4A8TA 3A36A 4KTTE 3WJAA 3L1VA 4IIJF 4CKBB 6ADHA 3GLFE 1H9BA 1RYZA 3KLPX 1FP2A 4Q3LA 1MCZA 5GOTA 3T3NA 5J2TF 1X39A 3QMPA 4YJ2F 3KQNA 3GJSA 4XE5A 5FI0B 3SLKA 1EK5A 3IHTA 3KSUA 3A0RB 2AR7A 3R7LA 3KR2A 1QO0D 3QGMA 1QQ5A 4J7UA 4KIFA 1YS9A 4CHTA 1Z88A 3AEKB 2AFIE 3DFUA 2JLUA 2QVXX 621PA 1QK5A 4U2KA 2AR0A 2B7LA 3G2LA 2ZKIA 2PIDA 3A27A 3TFQA 3ZV4A 2C96A 4BO4A 1MR3F 4PSCA 4DJJA 3P1JA 1SCQA 4GE0A 2AN4A 2PAFA 4IPTA 3FDJA 1AXEA 2GEUA 1WCIB 1XGKA 3UK2A 2QB5A 3OTOB 4BO5A 4ZGWA 2I8AA 1NUUA 1R3UA 2G5GX 1DCKA 3EQZA 3G9UA 1LLCA 2H4YA 3ABOB 3O8OA 4IQGA 4QUBA 3T61A 2ALJA 5GM1A 1X1BA 3TLJA 1QU2A 4N54A 1LQTA 2J33A 2Y68A 2VJOA 4V0QA 4MYSA 4KR7A 2JARA 3EGVA 2H8GA 1KVRA 1N57A 4MHTA 2XGJA 4WZAB 1X77A 1IHOA 1P7PA 3F7TA 3EEOA 4Q03A 1RI1A 4YCBA 4CHGA 4D82A 2ZIZA 4OL0A 1N6RA 4NJMA 1P0PA 1JSLA 2BM0A 2JW5A 2Q99A 3DDNA 1KTIA 4M6WA 4WOBA 5T6BA 3EVNA 3EEQA 3F6SA 1VA4A 4O4HF 5JZSA 1M2WA 1L1QA 2JANA 3V8QA 4FCCA 2B4RO 4X6LA 3S4YA 1MAAA 4FYJA 4K6CA 1CNEA 4GYWA 4QXPA 4G8DA 1TK9A 3K9BA 4J0IA 4WK2B 1BROA 2H1RA 3G5UA 4D2IA 2PA0A 1ISSA 1Z73A 3BGWA 3TEMA 1NZDA 2CZQA 1QMPA 3KKKA 3OQIA 5IVPA 1U2DA 3SC4A 3S8EA 2PN1A 1G8FA 4J4TA 3SQMA 1IXZA 2D2XA 4ETMA 1CCWA 2XUZA 3ITDA 2PD6A 3OKCA 4MITA 3JQ6A 2OD7A 3URMA 3QLVC 4KSYA 1FFYA 4WZBA 1G21E 3LX4A 1KSFX 5GVSA 4F60A 5EYPB 3R3ZA 5ICMA 2ZSBA 1IMOA 3GLGB 4XRGA 1SU7A 1FOEB 1BXGB 2K2QB 1VECA 2YH2A 4UVGA 5AKXA 3ZIUA 1H4VB 3BMQA 4YT5A 1FMTA 3D1JA 2XBUA 4TLEA 5EXPA 3WAKA 1ORIA 1I7MB 1NMXA 3OJEA 1OBVA 1T43A 2D1TA 4DCPA 2IU4A 2KX7A 2ZSFA 3HJAA 3MT8A 1FMFA 3KZCA 1HDCA 4MO9A 4ZCSA 4TLDA 3O7MA 3ROFA 5CXQA 4BX3A 4MVCA 1QG6A 1N0UA 2ORWA 4TYWA 3D02A 1R5OA 3HO8A 3RUIA 2KBEA 2VAWA 1PR1A 2VJAA 3G49A 4JUCA 2G8NA 3A04A 4FHFA 2XAAA 1KIFA 2PU5A 3NGMA 4LX0A 3KJQA 2IEIA 1ODCA 1TEVA 4ZOAA 1IY9A 3SIWA 2FW0A 4Q1DA 1ODFA 4A2PA 3KEQA 4MKZA 3KSBC 1QAQA 2Y66A 3WMEA 2J9XB 1FRQA 1OR8A 3GEPA 1RRCA 5ECWA 2RJNA 1ZHFA 2B98A 2YY7A 5K8TA 3QG5A 2ONYA 5BQFA 1BXZA 3K1AA 3RVRA 3KUDA 4MP6A 4XKJA 4FFVA 1P4AA 3HNOA 4O2BA 2UDPA 1CC1S 3EARA 5FWYB 4NU8X 5BQ3A 2R6CA 3DVLA 1YR6A 3E27A 2H4XA 2IYLD 1BQ3A 3W3AA 1HQCA 2E5WA 1HQDA 2VG8A 3RD5A 2Z8YM 1Q0UA 1JIVA 3CS3A 3V00A 4HVCA 1TW2A 1XD2B 4KV7A 3VI4B 1XZ8A 5AKEA 5LU8A 1Y0BA 3K2EA 4Z9FA 2V3WA 3QU2A 3NHLA 3LQFA 2IXEA 3RG8A 2J4DA 3PFFA 5JXGA 2HJSA 1EIZA 1H0KA 1L5MA 1ZRNA 2DECA 2ZVJA 4A0HA 2YJ3A 2UYCA 1AUPA 5JD4A 1Y81A 2BFNA 1MH9A 2RGXA 3QZUA 4QVKA 4US1R 1J0XO 3S2IA 2P5YA 1XZEA 1TX4B 3GN1A 5BXYA 2CLMB 2CY0A 2NADA 3IE0A 5EIXA 2C77A 1L5ZA 1GTMA 4PF1A 4R7ZA 1NG1A 4JOQA 4AF8A 3BQMB 1MAVA 2I4OA 3CZMA 3AKDA 1RJGA 2ID9A 1WQ3A 2OMEA 2O2GA 3DEKA 4WVFA 2L0XA 3V3KA 1DJQA 3MHPA 4EYEA 1SXIA 2OXRA 5A6SB 5FRDA 2A0WA 4W8GA 4HQLA 3A10A 1FYDA 1JHOA 1W75A 3AI1A 4LDAA 4R2KA 1ACMA 1C1DB 1E4EB 3AR8A 3OE7A 5CDTA 3WC4A 4HOYA 2AG6A 3EP8B 4X1KA 1U0NA 3LPLA 3PX2A 3WQRA 2JLQA 2Y76A 2OAQ1 1Z5UA 2VCHA 3LXRA 3NBZC 2ODWA 1E3TA 3ESYA 4OFXA 4J0JA 4BLUA 4RCVA 2BI8A 4R0VA 1KZ7B 5EC8A 4C0JA 1M0TA 1C8LA 3L7LA 3LPAA 3SNHA 4J29A 2C5HA 3ZNNA 3U7GA 1JDSA 1X7WB 1M7GA 1MVLA 2V7GA 3LZCA 3ZS8A 1D0SA 3PFHA 1TQ8A 1YL6A 1J22A 3L7BA 3Q4GA 4TVOA 4ETWA 4V0ME 5L7WA 4LY9A 2QJTA 1AHNA 2FMHA 4Z7NB 5K6TA 1NF8A 4IKPA 4FGLA 5FJIA 4X7PA 4FC7A 2QZZA 4MUKA 1RQPA 3IPAA 1B8OA 1V5WA 2PXCA 2P0AA 3BGDA 4KSCA 3SJBA 5DWVA 2XXAA 4GVPA 3BTVA 3K70C 2BFAA 2JBWA 2ZVDA 2VS1A 1F4PA 5DYNA 2GN0A 5HF6A 4Z1MA 2B36A 3ZWQA 1MGOA 1DAKA 5H4HA 3GRKA 4Q7LA 4BYGA 4GECA 1QO0A 1ECPA 4F84A 1XKTA 3UB4A 4KQ1A 3KOOA 2M9MA 3NHYA 1NYLA 4LTMA 3L6DA 2J5XA 1KI2A 1IEVA 2XWBF 4U4AA 4TWRA 3O8CA 2HQRA 3SR4A 4ZCIA 4R9VA 1R2QA 1L5RA 1Z5WA 4YLGA 5KYUA 1RQGA 1FS6A 1LCIA 4OHMA 3OKPA 1C3JA 4ZOBA 1P17A 2VF7A 2WE7A 1K8QA 4TLAA 3KJIA 2RAVA 2ZPTX 4EBFA 3FIUA 3M9XA 4BWFB 4EFKA 1FDUA 4JVNA 1PVDA 1RXYA 3C5VA 4IYJA 4ND4A 1PJSA 1VHJA 4KZPA 3ZGVA 5BSVA 5HZGA 1P0IA 1ZN8A 2JJ1D 2RGNA 1LZLA 1X0VA 3GGOA 1KNXA 4MDEA 4R1UA 5BQPA 5SYMA 3S28A 3PLAE 3B9PA 3IDQA 4H59A 3T12A 3M0EA 4Y6SA 5DOVA 4WSOA 3WY9A 1ZI8A 4Y67A 4BN5A 4E32A 4RTOA 4RW0A 4HI0E 5DIFA 4DMFA 5CFPA 2DERA 2BGJA 1RCTE 1UMBB 1VKNA 4IIHA 1EFPA 1YTUA 3QVSA 4KQ6A 1QP4A 1L7XA 4FXOA 4NZMA 1PFYA 5ITWA 3O2NA 4BVGA 2FXVA 4OHKA 6REQA 5K51A 4E21A 2EL7A 2XZLA 1JN0A 2FPSA 1RLMA 1X80A 4C21A 1F06A 2CJWB 2QR2A 2HW8A 3K9NA 2ZS8A 3OZ7A 1T26A 4P83A 3HCBA 5HP4A 2C7OA 5CAEA 4K8RB 1PZNA 4QZVA 4I8XA 2O7VA 1FJHA 2KQUA 4LJ6A 3IDSA 1U0JA 4PR3A 3DDUA 2OO5A 1JG7A 4URYR 3TJZA 4PNZA 3VDRA 3C3MA 3JYNA 1JQBA 5BO5A 4MRSA 3VJMA 1USKA 3W5UA 4BBAA 3RM3A 2A1IA 3G17A 4IHJA 4MINA 1N5OX 3N05A 2I7DA 4B74A 3SAJA 2FR0A 2HMAA 3IOEA 4H3VA 1JHMA 4KQJA 4HS9A 2YWRA 3UUEA 3ZDRA 4F2WA 2AQKA 4LXXA 2DHCA 4C3OB 3TQTA 5CFNA 5FUMA 4X1IB 1ZR2A 4K9SA 3IEKA 3T7KA 3PUKA 1VPWA 2H16A 1ODSA 3IT3A 3M6FA 2XQKA 4IIFA 3TQFA 1MO5A 2OOSA 3QITA 4OHUA 5E0OA 3U3RA 3ZVLA 1AMUA 3AT1A 4TTQA 1N8KA 4CF3A 5BSHA 2QXUA 3O8NA 2OCPA 4JU9A 4N39A 2ZSKA 2YWGA 1N25A 2NPOA 1TAUA 2FN3A 1SULA 2N0SA 4RXMA 1E96A 1EFAA 3EPJA 3LBIA 3Q10A 1KZ1A 3IDAA 4NESA 5EXDA 1ZZEA 2P9GA 4GSKA 7YASA 5H0IA 1T4GA 2P27A 4UAGA 1CJBA 1GAWA 2QQFA 3JZAA 3NIBA 1V96A 2WTMA 3VH4A 4KBGA 2IDKA 4EF5A 4JODA 3ER9A 1A5TA 2PR2A 4XIJA 4UZEA 5ELXA 3BSWA 2GEVA 4UTRA 4YJGB 3C3KA 3RAPR 2IXGA 3WK9A 2MCFA 4BXO