4GMFA

Apo structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
335
Chain Sequence
KQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVAILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Yersiniabactin biosynthetic protein YbtU
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
total genus 104
structure length 335
sequence length 351
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmfA01
2BFMA 1QRRA 1M6HA 1GEEA 2P9GA 1YKFA 3ONEA 3GEDA 2NVUB 4YWJA 4NR0A 3U9LA 2DUWA 1ZIDA 3CSDA 3K30A 4E31A 1Q0LA 4QFCA 5BNFA 4E13A 3ZNNA 3L4BA 3DONA 3DZBA 3CUKA 2D8AA 1VKOA 4HP8A 1HLPA 1YO6A 5LDHA 4AFNA 2NQ8A 3QVXA 1ENYA 2ZTMA 4P4GA 3ST7A 4FD3A 3PK0A 2WE7A 3H9QA 4J49A 3OJOA 4O63O 3I6IA 4MPDA 1BTOA 4B4OA 1HYEA 5IN5A 2EGGA 3H2SA 4GVXA 3GEMA 3ITDA 4MKRA 3WMWA 3WGZA 1NX6A 2J3HA 1H94A 1GYQA 4M49A 2FMUA 1MV8A 1DJNA 4AJKA 3JD1A 3L07A 3RD5A 1CYDA 3IP1A 4IQ8A 3PZRA 3O38A 1KOLA 1T2EA 4FOSA 1Q1NA 3AWDA 1ISGA 1PGPA 2OHXA 3H3FA 5TGDA 3W8FA 5BSHA 4J4TA 4MP3A 2OBNA 3WXBA 4YTEA 3TZCA 4RLHA 4WEOA 4K9DA 5BNTA 4GLOA 3W4JA 3K31A 4UEJA 3KO8A 3SLKA 1I8TA 2AW5A 2CDBA 1LDGA 1MG0A 4IIUA 2O3SA 4GL4A 1U2GA 3GHHA 1E1MA 1ONNA 1A71A 1VRWA 3ZHZA 1PL6A 1QYWA 4OXNA 5G4LA 1KEVA 2WSBA 4CMBA 4ZJUA 5CHEA 1E7WA 3GGPA 3F1LA 1PS9A 1PSDA 3DDNA 1BVUA 3KSUA 3LSYA 1U3UA 2E82A 3MWDB 3ICPA 4N5NA 4DTIA 4G2NA 5CEFA 4Y9DA 1A9ZA 1W8DA 2B36A 5FF9A 3E9MA 1F17A 1ZK0A 3TDKA 1X0XA 1VL8A 2HDHA 3L77A 3VZSA 5HBRA 2UUOA 2IEBA 4CR7A 3AY6A 4AJPA 2ZB3A 3VZRA 1EFLA 3INTA 4EJMA 5EMHA 2EW2A 4BNUA 4UUPA 4JX8A 2E4AA 3GNQA 1XEAA 5ICSA 1XG5A 4RQTA 4CMIB 3FNFA 2D2IA 2DQ4A 3OBBA 4F6LA 2QHXA 3C8MA 2W98A 4II2A 1C1DA 1D1TA 3KYDB 4TQGA 3ZV3A 1GADO 2VRBA 2EKQA 1D8AA 3D7LA 1Q7CA 1ZK4A 2PNFA 1KIFA 3C85A 2EJVA 5A9SB 1KVUA 4PLHA 3S2GA 2DFVA 2RBEA 4ILKA 4Z0PA 3AM4A 4BO3A 3BTVA 5JNLA 3HE3A 4J1TA 3KYDA 1ZW1A 1LUAA 2I3GA 4BUCA 1PS8A 4R3WA 1G1AA 4E5MA 2PZMA 3PFWO 4L4SA 1Y8QB 4RPKA 3ZU4A 3PWKA 2X5OA 3HNPA 4MP6A 4BKUA 1O89A 4G5HA 5JLAA 1DIGA 1E3JA 3DWFA 1UAGA 4JLWA 4BO1A 1IPFA 3ADOA 1N1GA 3JD4A 3GMSA 1GZ4A 1TT7A 4RVSA 4N54A 5EERA 2JD0A 2WDZA 3V5NA 1Y8QA 4FFMA 5THQA 1YWGO 1EK6A 3WG9A 5JO9A 4YJHA 2FR0A 1ZSVA 3WTCA 4I9HA 1FDWA 3OHSX 3ZWCA 1HL3A 2EEZA 5TRTA 4IUYA 4NIMA 4DC0A 2VYVA 1R4NA 1WPQA 1EZ4A 5CG2A 1U5CA 2CSUA 3P2OA 4XYBA 1FXSA 4IDBA 1DIBA 2FRDA 4Q3AA 4W7HA 2HAEA 4AVYA 4CV1A 1D4FA 1NAIA 1ENZA 1OOEA 3AU8A 4U0KA 3WICA 3LC7O 1P74A 1EBUA 3I83A 2VTEA 4FGSA 5MGBA 3HWRA 4FGWA 1HDCA 2HK7A 1PJCA 1K6IA 4FQ8A 4R01A 2QIOA 3AM5A 2DLDA 4WLUA 1DFHA 1WP4A 3V1UA 4MVJE 3AUTA 3GT0A 3PQDA 2W2LD 5TS3A 4GLLA 4B7UA 3TOXA 1BWSA 1I01A 3B1KA 1PZHA 1NM5A 2OGUA 5H82A 3JYNA 4FJ2A 3MOGA 3U62A 1R37A 4L75A 2JFFA 2CD9A 2GZ3A 4NPCA 3WNQA 1FF9A 2AMFA 5DBFA 5ENDA 4YRBA 1BXZA 3E8XA 4FJ1A 1FDVA 1LX6A 4BL5A 2FPPA 4L4XA 3PHGA 2ZTVA 3I9MA 1XELA 3ZNPA 2P5UA 1V3UA 4OSOA 5CDSA 1C1XB 2ZTUA 2W8ZA 2NUAA 4E2YA 2POQX 2YHIB 1GAEO 1F8FA 1F06A 1YVEI 4ID9A 4UVHA 5TJHA 4JGBA 4K1LA 3F5QA 1R6DA 1VI2A 4P38A 6ADHA 2BGKA 3FSRA 1RYDA 3PPIA 3HUDA 3GK3A 4RPGA 4M87A 5BQFA 2VYNA 2NACA 3FRJA 3VH2A 1NQOA 5DDIP 1UP7A 1TVEA 4D43A 3RUDA 4ZVVA 1Z75A 1SPXA 4BB6A 3TFQA 4MVJP 3HN2A 3PHHA 1E7RA 4GQAA 2UVDA 1E5LA 4WLNA 1SEVA 2NU9A 4NFYA 4CV2A 5HTOA 4CMAA 2ZB8A 1PZGA 2C2XA 1PR3A 2HUNA 4PG5A 4XJSA 2Q99A 2WD7B 2Y1CA 3PIDA 2VHZA 1FMCA 1I2BA 3FCOA 1YOVA 4G81A 1NTOA 2C2YA 3NGXA 1CIVA 1N2SA 1T2AA 5TNXA 4BO7A 3HB5X 2NWQA 3OF2A 2NTVA 1BG6A 3FI9A 3LF2A 2DAPA 4JQCA 4CMHA 4U6SA 4MKXA 2AEMA 1B3RA 4ALIA 3UF0A 5JYAA 2ZYGA 4L73A 5EL0A 2WYUA 4H15A 3TL3A 4PFJA 4NK5A 1E6UA 5ILGA 3OH8A 2NVWA 2LDBA 2ZB7A 3Q6IA 1YDEA 4RVGA 4L74A 1LLCA 4PLTA 1XGKA 3WSWA 4CM4B 2B35A 4P8RA 3IIEA 3AI1A 2Z5LA 4DMLA 2VZ9A 3GEGA 4QXMA 3TNLA 5L7TA 5LCXA 1NQTA 4QQRA 4ND2A 3ZU3A 5KCZA 4YPOA 2EP7A 1IL0A 1WMAA 3PJEA 3M1AA 1ZXLA 3KOUA 2ZB4A 4BKOA 1E1LA 1CRWG 3FBGA 4MVJG 3AY3A 4RPJA 4H3VA 4CM4A 2IYPA 2D59A 3ENKA 2FWMX 3OP4A 2YUTA 3FD8A 3RU7A 4R16A 4MO2A 3SC4A 2OBYA 4E33A 2JAPA 3I4CA 5COBA 1NQ5A 3JQBC 3R6DA 2WM3A 1A5ZA 1E3IA 4IXWA 4IS2A 2DBVO 1VC2A 3VTFA 1MGOA 2Y1FA 1EVYA 3OSUA 1GPDG 3GZ4A 4Q3BA 5K0ZA 2E49A 1GCUA 3KSZO 4W99A 3AOEC 3DR3A 4M1QA 3RASA 3DBHA 4HBGA 4NBRA 1EE2A 4R51A 5JDIC 3O9ZA 1YDWA 4AJ1A 2I76A 1S7CA 2VRCD 4YYZA 1V6AA 1CERA 1RYEA 3GNSA 4RVFA 5TSDA 2FSVA 2NSDA 2Y99A 4CLRB 4U8GA 4WOJA 1X0VA 4XCVA 5U9CA 1J0XO 1YL6A 1SB9A 1DDOA 3FTPA 3NTRA 4YRAA 1G0NA 1XWFA 4CUZA 3S8MA 3DBRB 4CLRA 1A4IA 2OOSA 3BMQB 3NAQA 4JK3A 1HETA 3M2PA 3AUUA 2PA3A 4XYGA 4K28A 4J4HA 4EYEA 3O8QA 4ALLA 3H9JA 4KQXA 2O2YA 1PR9A 4NNJA 4AJJA 3NJ8A 3EHEA 3NDJA 4BO2A 1LSJA 3BMNB 2ZYAA 4Y8VA 4HX5A 2ZJ0A 1CF2O 4R9RA 4NG5A 1HE3A 1U3WA 3QWFA 4TKLA 1TLTA 3RJ9A 3WR5A 1JTVA 1LC0A 1ZSYA 4E2XA 3DTTA 1E5QA 3B1JA 4B3HA 1E3WA 2HMTA 1I3NA 4YDRA 4IQ0A 1EVZA 3AW9A 3ONFA 1G6KA 1P1JA 4E32A 3JQ8B 1RM3A 1KC3A 3V1YA 3B20A 3E82A 1U7HA 4ZN6A 4LRTB 1JWBB 3JYPA 5JDCC 3PHLA 4J6FA 3DO5A 4U6QA 5B12A 5HRUA 2PH5A 3SX2A 5A3VA 4B79A 5JMWA 1I2ZA 1Q7BA 3PYXA 1CQIA 3JQ8A 1WNTA 3HZZA 4EEZA 3JQDA 4B4VA 4DVJA 1GQQA 3VPHA 1B26A 3RU9A 4BNVA 2P9EA 4PIVA 3INRA 5I9MA 4R41A 3KSDO 3LLVA 1OAAA 2ZJ1A 3CPSA 4KWHA 4MVJM 4D44A 2UV8A 3JSAA 1PIWA 4JP3A 4FOOA 3VH3A 3ZNQA 3MJ4A 1CJCA 4GH5A 4XGKA 1WDKA 2Y1DA 1MB4A 3JQBA 1E1NA 1NYTA 2BD0A 2GGSA 4MIOA 4YJFB 5L4SA 5KJCA 4XR9A 3F3SA 2V6MA 3NT4A 1QYXA 2WYVA 3DMYA 5IXSA 5M6DA 4OQYA 4IGEA 1NWHA 3AOEA 1N7GA 4CMJA 4LVUA 3S2IA 5ADHA 5A05A 4YJFA 2R00C 3GR6A 5JDIA 4NFHA 5A3JA 2YZ7A 1I0ZA 5J23A 2ZYDA 2GN6A 4WNCA 2V7PA 4ZQGA 5IDYA 4XQCA 4DC1A 1IE3A 1HDYA 4J3FA 1WLYA 3NT5A 2JFGA 5I7EA 2VOEA 4RF2A 3S55A 4BMVA 2JAHA 3K96A 4E2WA 5JFOA 4QECA 2ZKLA 3B1FA 4NQZA 3IKVA 4YB8A 2O7QA 5ITWA 1T1SA 1F14A 1HSOA 5FI3A 1HZZA 4HNGA 3BXXA 5I7VA 3ZCXA 5H83A 4IJUA 2IDZA 4DXHA 3DBLB 2VQ3A 4FSHA 2O3TA 3GN2A 3B70A 2UAGA 3WQRA 3GVHA 4UVIA 4Y6SA 4I5GA 1P3DA 1Y7TA 2Q1WA 3FNHA 1QP8A 4XX0A 1WDMA 3RUAA 4OQZA 3AU9A 5KJFA 2AQHA 1I30A 4EI2A 4YACA 2HJSA 4C7JA 2JFHA 4J16A 3KUXA 3P19A 4BNIA 4OXYA 4J1SA 2EP5A 1NAHA 4OOEA 1VKNA 3RC1A 3QWHA 1Z6ZA 2ZCVA 1J4AA 5AXAA 1KC1A 3DAPA 5EPOA 4BMNA 3UICA 2YW9A 4LMRA 3JQ9C 2CNBA 2IRWA 3ZHXA 4EJ6A 3QLJA 4XQGA 1TB4A 1A27A 3WIEA 2G5CA 1KS9A 4D42A 4WLOA 1DPGA 2PZJA 1ONOA 1LJ8A 2DT5A 2IZZA 4DLLA 1XYGA 2Y93A 3QHAA 2C5AA 7ADHA 5JS6A 4A2CA 3L4SO 1HEUA 4HFRA 3VZQA 3VKUA 4XZ3A 2I5PO 2H6EA 4CMCA 3JTMA 4ZRNA 3ZU2A 5CPFA 3F9IA 1E77A 2J5QA 1O0SA 3A06A 1DAOA 1UP4A 1ISJA 3IDSA 4BGEA 4PLWA 3OQ1A 3RWBA 1UXJA 2JKVA 3VVCA 1UUFA 1VJTA 1XR3A 2X9NA 4LRSB 4J9UE 3S2EA 4PLYA 4UEOA 1T4DA 1ZMOA 4W9NC 4YJGB 1D7OA 5K9ZA 5T8KC 4I1IA 2VOJA 4FFNA 3RCBA 1PJBA 4IQGA 2WTBA 4RCVA 4E5NA 3IAHA 3TSCA 4M54A 3WJAA 4CLHA 4I8XA 3D3WA 1VM6A 4BGUA 1U3VA 1HYHA 1IZ0A 2VT3A 2R00A 2NU6A 4AICA 3INGA 4UUOA 1DFGA 3IOYA 5BSEA 5TIIA 3Q1LA 1W0CA 3I9OA 4WASA 1NFQA 4N5MA 2V6GA 4DREA 5IZCC 3DHYA 4L0QA 5EINA 5T57A 1DC4A 3V8BA 3HDHA 5A4DA 1H2HA 1QKIA 4J7UA 4XJTA 2EF1A 1XDWA 2IEDA 4PRLA 4D0RA 1ZEMA 1T4BA 2GCGA 1UZMA 2HRZA 4IGFA 4JJFA 4OGWA 2PKQP 4J7CA 5B4TA 3VOSA 2RAFA 3A1NA 2D1YA 1LEHA 2JJYA 3I9KA 5F3RA 3ASUA 3F47A 4JBHA 1LQTA 1E7MA 1GYPA 3ANLA 4R3NA 4GWGA 4CQLB 4QO8A 1BHSA 2BGMA 3O4RA 4D41A 1VSUA 1XQ6A 4BNFA 1WMBA 1ZXBA 1SB8A 1VL0A 2B0JA 1C0PA 3EK2A 3JQAA 3AM3A 1ZCJA 3R1IA 4BS9A 4RJTA 1EBFA 3EW7A 4XQ9A 4BO4A 1Y6JA 4KZPA 3L9XA 2HRBA 4UREA 1K89A 3JQCA 4ESOA 4CQLA 1LDYA 3VC7A 4FFPA 3WGOA 3VH4A 2OP1A 4NBTA 4CLEA 4CM8B 2O23A 3ZWWA 1I32A 3WIDA 3MEQA 3HDJA 1QMGA 1W6UA 4G65A 3A28A 1T2FA 3OEWA 4ND3A 4WEQA 1MXHA 2CMDA 2GN9A 2PK3A 3JQ9A 4FN4A 4AJ2A 5DBGA 3WX0A 4K6FA 1P0CA 1AHHA 1M6WA 1P31A 1ZJYA 3C1AA 3TQHA 3TZQA 4AG3A 1NASA 3VTZA 3VPGA 4I08A 3U4CA 3SEFA 2XF8A 4BNJA 1E1KA 1CDOA 3NDIA 1LU9A 1NFRA 4Q39A 1RM0A 4GX2A 3KXDA 3GOHA 3JD3A 2DC1A 2AEJA 2NVUA 1R0LA 1HDRA 2BLLA 2HK8A 1E6EA 2V6FA 3WYCA 4IMPA 3WOHA 4TSKA 2FY8A 2VNSA 1NNUA 5TLSA 3E6AA 2V6BA 3K8ZA 3L9WA 4E5PA 3ZWXA 1Y81A 2Q50A 1ZFNA 1PWXA 5EQDA 2Y0EA 1I10A 4W9NA 5JW6A 4BKPA 3L6EA 4YXFA 5T8KA 1QV7A 1GFSA 5T64A 1GV0A 3GN1A 4J2HA 1P1IA 1J6UA 5DOZA 4BNXA 1HWYA 1UXGA 1LRKA 2RHRA 1LDNA 3AFMA 1ISFA 5AXBA 2CVZA 1CWUA 1Y8RB 3LDHA 1WZIA 1M75A 3OECA 1NHWA 3HDQA 1BXKA 1OZAA 1KY5A 1C14A 2QZ9A 1R66A 4YQYA 4KOAA 5IZCA 1M2WA 1PJ4A 2VUTA 1UXIA 3W4IA 2WD8A 1QYDA 5JYFA 4O59O 4BV9A 1Y8RA 4XD2A 2EWMA 5KVCA 3ZV6A 1DC5A 1U28A 3TJRA 4F45A 2IE0A 4LCEA 1XU7A 5GMOA 5GZ3A 2C5EA 3GLQA 4BMSA 1V0JA 4MJLA 4ZGWA 5I8WA 2DBZA 3QVWA 4GKVA 2EKPA 1HE2A 1R4MB 4IJKA 4NU5A 4I5DA 3DB2A 3WYEA 4CM9D 1PU2A 2O4UX 1PJLA 3KETA 1GTMA 3KLPX 1VLLA 5F5NA 3BIOA 3RFVA 1V9LA 1Q2XA 2P2SA 2BH9A 5EQFA 3ON5A 3Q11A 2CUKA 4WPGA 4XYEA 4DPLA 1PJSA 1X15A 1JVSA 1H6AA 5G0WA 2O3JA 3LK7A 5L4LA 4IJVA 5G4KB 3ROQA 5CEEA 3GMDA 3KBOA 1PGOA 4LW8A 2F00A 3VDQA 4B7XA 3NEPX 5GZ1A 5U1PA 4IY1A 1PGNA 3WYBA 3PGJA 4XQEA 4TVOA 4QEDA 4CMIA 3ZWMA 1SO8A 1I2CA 4RZIA 1YJQA 1LLQA 1TA4A 4J0FA 1DRVA 3FN4A 4ZQEA 2BF7A 5A9SA 1BDMA 5JCXA 3DOCA 4IDFA 2WYWA 4GSLA 1MLDA 1P44A 4CQMD 2PGJA 3PHIA 1PL8A 4GGPA 3WQQA 4BQRA 4ALKA 3K2EA 4J7XA 2YY7A 3N58A 4NI5A 5CP8A 2Q2WA 4UUMA 4Z3DA 3QJ5A 4CUKA 3AK4A 5JAZA 5C37A 5DP2A 3VPFA 1LQUA 4IDDA 3NX4A 3CEAA 1QLJA 4LGVA 2Y05A 3RKUA 4JROA 3N7UA 4ZU3A 1XLTA 2GPTA 4OL9A 4L8VA 4ALMA 1F0YA 1IHXA 2BKAA 1H6DA 2B4TO 1YB4A 4BKQA 1K3TA 2RH8A 4J0EA 4Y98A 1X7GA 4D7AA 4YQZA 5IJZA 5GY7A 4YAGA 1ZUD1 4UVEA 3RVDA 4LVCA 2I66A 4Y6RA 1YS4A 5B4UA 1FDUA 3FWZA 4M55A 2CDCA 2X0RA 5TX7A 4UAGA 5G0SA 3PYMA 2YHUA 4ND5A 2BRUA 3C7DB 4PRKA 4RV9A 1HZJA 2C29D 1P1HA 4KUEA 4EZBA 4FR5A 1D1SA 4J1NA 5CAEA 2BFOA 1TEHA 2R6JA 2YQ4A 3HFGA 3T4XA 1P9LA 5C3MA 2BGLA 1KEWA 1S6YA 3NKLA 1UDBA 2PH3A 4O5OA 4QFDA 1ZK3A 3ULKA 4D46A 4E6PA 3RC7A 2EG9A 3RBVA 1EDOA 2ZK7A 2PV7A 4E3ZA 2YFQA 2GRAA 2A35A 1HYGA 3RUCA 2JHFA 4PG6A 2NADA 3LT1A 1B2LA 2PR2A 3C3XA 3LQFA 3V2UA 3MCVA 4RF5A 4EDFA 3PGXA 4GWKA 4Q3EA 2HCTA 3FHLA 2PGDA 4OYRA 4MVJD 1IYZA 5KVVA 1ULSA 3ADPA 1C1XA 2OORA 6LDHA 5HM8A 1HE5A 2YHIA 1JWAB 4ALJA 1YJ8A 4C4OA 4YAIA 1DOHA 1NWCA 2X8LA 1JW9B 2VT2A 3UCXA 4CM1A 3OJLA 3GUYA 5IFLA 1GZ6A 3O03A 3PQEA 1V8BA 1UJMA 3RSHA 2BHLA 3WTBA 3KZVA 4LISA 1I3MA 2P5YA 2I6TA 4F46A 4ZQFA 3CZRA 4BNMA 4CLOB 1XKQA 3HQ4O 2CY0A 3AJRA 4JJIA 4QT0A 4JCOA 5A5FA 3PDUA 4BO6A 4Q3DA 1DHRA 2DM6A 3QWBA 3R0IA 4ZQBA 2ZATA 1LSOA 4IPTA 1N92A 1ENOA 2WD7A 2WEKA 3WGIA 1G0OA 1PGJA 1U8XX 3C7AA 1SC6A 3DTYA 2W2LA 3DZJA 3F1KA 3KVOA 5L45A 1KETA 3I5MA 3PZBA 3F4BA 4BKRA 1NPYA 3W8EA 1PQWA 3KB6A 4Z3KA 2ZTLA 3F6YA 1D3AA 3VPSA 1PJQA 1W73A 1AXGA 1X7DA 3G79A 1DLJA 2AEFA 3OJ0A 5A9TA 4DYDA 5JCJD 5AXCA 5THKA 2RHCA 5A06A 1IHYA 5JAMA 3OIFA 1FJHA 3FR7A 4JBGA 4X54A 2NNLD 1X7HA 3LLSA 3UVEA 5IG2A 3GG9A 4XGIA 2AQ8A 1KY4A 3B6ZA 3LVFO 2XXJA 2YV2A 4J2OA 2FHSA 3OJFA 3VVBA 1JN0A 7MDHA 1YE3A 4ZQHA 2D4AA 1U9JA 1YB1A 5CG1A 4C7KA 2BFAA 5I9NA 2EJWA 5G0UA 1Q0QA 3H5RA 5BT9A 2PTGA 1Y5MA 4NU6A 5ENVA 4LSMA 3OQBA 5B37A 5TQVA 4DGSA 2YFHA 1DRUA 1FK8A 1IULA 3RFXA 4RL6A 1X1TA 1L7EA 2DVMA 3ITKA 1MFZA 2Q4BA 2AXQA 2ZQYA 3GA0A 4W82A 1JQBA 1QV6A 1HTBA 3JQ7B 4B8WA 5ILOA 2CVOA 3ETDA 2FZEA 1HXHA 2DTDA 4CMKA 2WMDA 1UP6A 4B8ZA 3LC1O 4MKZA 5AQ1A 3PI7A 5AOVA 3GRKA 3WFIA 2HK9A 2P91A 4PVDA 4FCCA 3KRTA 5COAA 4EUFA 1B8PA 3QV1A 3FWNA 4QTZA 3TRIA 4NZ9A 1DRWA 1HT0A 5F1PA 3WBBA 2O3UA 1XHLA 2JCXA 2HLPA 3LF1A 2HU2A 1PGQA 1OI7A 2W2KB 3GAZA 4F6CA 3DZFA 4XWYA 1ISIA 2QZZA 1DIRA 1Y9AA 3EVNA 5JC1A 1LRLA 4FS3A 2VWPA 4HWKA 2G17A 4Y6PA 1ENPA 3DHNA 3X2FA 1J49A 5L7YA 1YL7A 3DBRA 1LI4A 2QYTA 3BMQA 3OICA 5GZ6A 5ES3A 1MX3A 3OA2A 2W2KA 1LC3A 4KUHA 3KHUA 5A03A 1MUUA 1U2DA 3KLMX 4Z9YA 3GDFA 5KJ6A 4JNKA 3CZMA 1JA9A 4RVDA 5JC8A 4WLEA 3BMNA 2AG5A 5T6BA 5LC1A 4AL4A 4WK6A 2J5KA 1EEHA 5KOIA 1ADGA 1VJ1A 3CMCO 3E5MA 4FFLA 1U7TA 2B37A 4E12A 2PKRA 3PIIA 4E5YA 4I5EA 3RAJA 3FF4A 2Q3EA 1XA0A 4TZKA 1HE4A 2J8ZA 1Z7EA 2W90A 3K9QO 3W1VA 2GF2A 3D5QA 1E6WA 1T25A 2GASA 4RO0A 2Q46A 3G1UA 3P5SA 2I3AA 5DZSA 3U4DA 3U4HA 2GD1O 5HWSA 1AE1A 4E2ZA 3H4VA 3ZWYA 3ZW8A 1K6JA 3KEQA 2OXIA 3EY4A 2P4HX 4MDHA 4FC6A 1HKUA 4TROA 4BNZA 5JYDA 1M76A 1NVTA 1ARZA 1DXYA 4R5MA 5KWEA 3DQPA 5F5LA 5JE8A 3LC2O 4P4LA 4YT8A 2XAAA 3WGQA 2VRCA 8LDHA 1Y9EA 2QW8A 1PZEA 5DBIA 2D0IA 3GC6A 3QSGA 4E21A 2IODA 2CF6A 4A7PA 2BELA 4LCJA 1GPJA 1KEPA 4WCFB 5COQA 4DA9A 1ZZEA 3HB4X 2GNAA 2V65A 4WNIA 1A9YA 1NFFA 3KEOA 3GDOA 2JL1A 4A03A 3PJFA 1R12A 1EE9A 2GZ2A 5JYEA 1W4ZA 4B3JA 3D3EA 3WDSA 4EBFA 3SBOA 1ULUA 4YAEA 4BNHA 1QR6A 2NVBA 5DCUA 5JO0A 1SBYA 1NP3A 3E5RA 4NBUA 3DL2A 3QE3A 1YONA 2JD2A 3T7CA 3QVTA 1KBZA 2PY6A 1AN9A 4Y67A 3ASVA 1ZO8A 3EDMA 2HO5A 3RROA 2YDYA 4L4RA 3LT0A 2P68A 4MINA 1ML3A 3WMXA 1ISHA 1PZFA 3JV7A 3T4EA 4B3IA 5KTKA 4PGFA 1MP0A 1Z73A 1ZH8A 3DZIA 3FBTA 1B3BA 5CPBA 3ZN2A 4BO5A 4WOKA 3GQVA 4MVJI 2J6IA 2O4CA 3JQGB 3PLRA 2ILTA 4ZRMA 1GQYA 1HDZA 5JAQA 3IL2A 3D4OA 3BMCB 4CMGA 3DOJA 1SMKA 3BTUA 1TT5B 4PLFA 1NHGA 3UHAA 3PFFA 5TJ9A 4E4YA 3DBLA 5HS4A 2O7SA 3JQGA 2SCUA 3Q0EA 2HQ1A 2WJPA 3BHJA 4KDFA 3IJRA 3C7CB 2YJZA 1I24A 3WGYA 4O1MA 2OZPA 4XRRA 2VUSA 1QYCA 4DLAA 9LDTA 3PJDA 5ER9A 2B69A 5TT0A 3HJAA 1R15A 3I9NA 5EN4A 4XYMA 4GX0A 3ZWVA 1WDLA 3IKTA 2TMDA 2AE1A 1BW9B 2C82A 4WECA 3V1TC 2CDAA 3A14A 1GV1A 2O50A 2Q49A 3QWIA 3L0DA 3S2FA 1VJ0A 3VAZA 3STHA 1P45A 4CM7A 3ZHBA 4IMRA 2PFGA 3TF5A 1GUYA 2HMVA 3ENNA 4O6VA 2NQTA 4D3FA 3K2BA 4KDEA 1ID1A 4TWRA 3FNEA 4NBWA 3G49A 1ZJZA 2FSSA 3DEYX 2Q4EA 3ZWBA 1K0UA 3SVTA 2OL4A 5K6AC 3H5NA 2JCVA 3E48A 1I36A 2Y68A 3AY7A 3JQAD 1UDAA 2BFPA 3GZNB 4J90A 4NMHA 2QX7A 1YH3A 2X9GA 1IY8A 3NDRA 4MIYA 2X0IA 1IPEA 1LTHR 4IJWA 2NTJA 3WNVA 4QO7A 3KYCB 4BNLA 4I9NA 3WGHA 4B4UA 2OFPA 4NFSA 3UOGA 2E37A 3LU1A 1OBFO 1GQ2A 2B4RO 2GO1A 3GZNA 3LT2A 4XDYA 4GX1A 1AUPA 8ADHA 3SLGA 1E7QA 1F8GA 2G76A 4UVGA 4IIVA 5TC4A 3W6UA 2VUUA 2VHXA 4A26A 3KYBA 4RLSA 4E30A 2HSDA 2YV3A 3NTQA 4YJGA 3VH1A 4CM3A 1T24A 1O94A 3FNGA 4YBZA 4EGFA 5I9LA 3ETGA 2O2SA 3G0OA 2I99A 1HDGO 2C59A 4NHEA 2NM0A 4KTTE 2NU7A 3ANMA 1ZVMA 1E0DA 1WVGA 3GVCA 3L6OO 1EUCA 4AJHA 4HNHA 2FR8A 4BNWA 3GPDG 3PWSA 3IJPA 1IZ9A 1N9GB 2DTXA 3HN7A 3AI3A 4URFA 4UUNA 3OEYA 3RFTA 2NTNA 5A5EA 1UAYA 1XIVA 3GVXA 1DIAA 3P7MA 1XSEA 4DPMA 3RUIA 5ICMA 3OIDA 2Q2QA 5B4VA 2DBRA 1N9GA 4INAA 5CEJA 1B14A 2AE2A 2Y0DA 2G1UA 4KWIA 4PG8A 1EQ2A 5KVSA 4IDEA 4NBVA 2XXBA 2GDZA 4IZIA 2FN7A 4NJOA 4IM7A 1LSUA 3OQ6A 2HMSA 5AYVA 3CH6A 3MTJA 2VWHA 5JY1A 1I33A 3GY0A 3RBXA 2B5WA 1B8UA 1P0FA 4B4WA 1Z45A 5KKCA 2OUIA 3F46A 4B7CA 2EGHA 2OP0A 4BB5A 3RBZA 4K26A 2VZ8A 3HHPA 2J5RA 4CMEC 2E6UX 4CM8A 2BMAA 3ANNA 2NU8A 1QYVA 3EC7A 2X9VA 1IOLA 3TL2A 4DLBA 5AVOA 1EUDA 2YYYA 3IP3A 3GGGA 4IINA 4KTVE 3LZ6A 3E03A 3MJEA 3KV3O 4QX6A 4PLGA 1SOVA 4TRNA 3M6IA 3DAGA 3WFJA 2EKLA 5T67A 5A9RA 1A72A 3HSKA 4R9SA 1JKIA 1K2WA 1QLHA 1QORA 2UYYA 4IS3A 4DYVA 3NYWA 1JAYA 1HDXA 2EIHA 3PTZA 4GX5A 4U0JA 5K6AA 4I5FA 4PLPA 4Q9NA 1RPNA 1UZLA 1UZNA 3O26A 3UGKA 4YR9A 1LA2A 4OOFA 3RKRA 3Q2IA 5G0VA 4UEKA 3HG7A 4RVUA 5ITVA 1C0KA 3OETA 1EMDA 2VCYA 4U7WA 5B1YA 3CE6A 3GDGA 3ORFA 2B4QA 3QY9A 3PJGA 2E48A 3RUEA 3HFSA 2IXAA 2PZLA 3JYLA 3KM0A 4NK4A 3ETEA 1EDZA 3UKOA 1DLIA 1EK5A 1O8CA 1T1RA 2VNAA 4L9RA 1IB6A 4OKIA 1LLDA 5DNAA 4GPD1 4DQVA 2Q1TA 5G2OA 3D4PA 1UH5A 1VPDA 2GUGA 2JCYA 2UUPA 4FW8A 5A02A 4JN6B 1ZK2A 2ZIZA 5KJEA 3IC5A 1JVBA 1R0SA 2ET6A 3K5PA 2I65A 4BNNA 1U8FO 3EUWA 1J5PA 3N74A 4TZTA 5I7SA 4CLDA 1DSSG 3WLEA 2ZCUA 3COSA 4J43A 2PWZA 5IN4A 3GPIA 1H93A 3PP8A 2GLXA 2H9IA 3EYWA 4D3DA 1K5HA 3ZWNA 5JAIA 2X6TA 3AFNA 3E9NA 2XPCA 2VTDA 4Q3NA 4AJLA 1F12A 2FR1A 4WUVA 4L76A 5KKAA 3GH3A 3NRCA 2PLAA 5BNIA 2A92A 3BAZA 3ABIA 3TWOA 3GVIA 2VYVD 1XU9A 4YT4A 3MOIA 3HADA 4OKNA 1VSVA 4GI2A 1IUKA 1SCUA 2Q45A 4OAQA 3D64A 3I9JA 1O95A 2QRKA 1DJQA 4IZHA 1NR7A 3WB9A 2GN4A 3FPLA 4TRRA 1HF3A 1R4MA 4CODB 3CXRA 3CIFA 4HFMA 4KUGA 3QWAA 4FJ0A 3H7AA 5TF4A 1NQAO 3ZDFA 4OM8A 4FC7A 4AJ4A 1WZEA 1MG5A 4PLCA 4AJEA 1V3TA 5A1TA 4BNYA 5L40A 3NT2A 3D1LA 1EUZA 2TMGA 5A04A 1LDMA 1WXDA 1C1DB 4PLZA 1YBAA 4RGBA 4WKGA 4A73A 3BMOB 4CMEA 1B16A 1Q0HA 1OC4A 5G4KA 4ZD6A 3UN1A 3ZH2A 1UR5A 3GF4A 4GAEA 4XRGA 3OMLA 1YQGA 1JDJA 4YEDA 3BMOA 2C07A 3UFXA 1WW8A 3H2ZA 1ZKMA 1T26A 4OH1A 1PL7A 4CL3A 3VZPA 1ZBQA 1JLLA 1MA0A 1KVSA 2RIRA 3GAFA 5JXWA 2JHGA 4R1SA 4FBGA 1MC4A 1XCBA 4ROSA 1JKFA 1NXQA 4GVLA 4IDCA 5G0TA 5LDGA 4UVDA 1NVGA 1LBEA 3MJCA 3DHEA 4RF3A 3LYLA 1X13A 2PZKA 5U4QA 2G0TA 3FR8A 4YVFA 3GFBA 1FDTA 2I9PA 2G82A 4YJHB 4PN3A 2VYND 3JYQA 1KVTA 2Q1SA 3BTSA 4OSPA 3C24A 1R4NB 1P1FA 2NV6A 2Z1NA 4TVBA 3CINA 4DIFA 1GYRA 1PEDA 2AQIA 2F1KA 2XOXA 4FDAA 2EW8A 1YL5A 4YRDA 4BO9A 2DTEA 4A27A 3H5AA 3JD0A 1BRMA 5BSGA 3U4IA 4RPLA 1HSZA 2O3QA 4YAJA 2RCYA 4CM9A 5KJ1A 1X1EA 3F5SA 3D4NA 4BNTA 1H9AA 4BQPA 4DBZA 4EJ0A 2A9FA 5JMPA 1HRDA 2X22A 5DF1A 4WLFA 3Q9UA 1UXHA 2FP4A 2IXBA 2BI8A 3JQFC 2VWGA 1RM5A 3K92A 3BHIA 2EV9A 5TT1A 4GBJA 2EERA 3RQSA 2GZ1A 1ZK1A 3K6JA 4R1UA 3DC2A 5DP1A 3UAGA 3OFSA 2IZ1A 3GHYA 1GUZA 3JQ6A 4AJOA 2X4GA 3TPCA 1RJWA 1E3LA 4BGVA 3IMFA 4FPXA 4CQMB 4R4JA 4CL8A 2X86A 3DFUA 1C3VA 3AUSA 3FPCA 3TFOA 3A9WA 4LMPA 4S3MA 3UW3A 1OC2A 1CQJA 4CV0A 2X58A 3D5TA 4OJNA 5IAAA 4DBVO 1AGNA 1ADFA 5DOVA 4CQMA 2Y66A 1E7YA 4OO3A 3ZI0A 1KVQA 1YB5A 3PDJA 1NPTO 3U3XA 3ROKA 5HS6A 2C7GA 1U4OA 2PD3A 4N5LA 1DBVO 3DAFA 3TZHA 2C20A 2FPIA 3UCEA 1GD1O 1YQXA 4Z0HO 4RPHA 4CJXA 3DOOA 4EUEA 4ZHSA 1YQDA 5IDWA 1U5AA 1NPDA 2B83A 1U3TA 3PWZA 4Z9XA 4CM5A 1YRLA 5I8ZA 1I3LA 1N1EA 1C0IA 1HLDA 2EXXA 3U49A 3E9QA 3IUPA 1I5RA 4DUPA 2QG4A 4PVCA 1T2DA 3MJSA 3ZWOA 3BZUA 3WJ7A 3OM9A 3D0OA 3GRPA 3WS7A 5C7OO 1FDSA 3KTDA 4GGOA 4D79A 2VN8A 2NLOA 1YOVB 3DZGA 3ICCA 3RJ5A 3ZZNA 4Z6KA 4CLOA 1VE9A 3PRJA 2A94A 4AJNA 5EESA 3NUGA 5T73A 4BHTA 4N7RA 4WJZA 3M2TA 4HKTA 5IDQA 1O9BA 1AHIA 3TOZA 1L1FA 4HADA 1L7DA 3DZHA 1ZSNA 1LDBA 3W6ZA 4MIEA 4YAKA 2DUUA 3T7EA 3WGGA 2X5KO 2X5JO 2GYYA 1MC5A 2X1HA 3TN7A 3K73O 1DC6A 4GMFA 2HKIA 5L3ZA 2AHRA 3H8VA 1DIHA 3JD2A 3PQFA 4RF4A 3U0BA 3BTOA 1CETA 2B5VA 3SC6A 4CUJA 1M66A 4IBOA 5JBIA 2EHDA 3H65A 5F1OA 2UDPA 2CF5A 1UDCA 2VZ0A 1JU9A 4R5HA 3MWEB 1GEGA 1EVIA 1SAYA 3H3JA 3PVZA 4IDAA 1PQUA 4LK3A 4MVJA 1P1KA 1LDEA 4H7PA 1VL6A 4JP2A 1P77A 3TZKA 3GUCA 3JQFA 2CFCA 1M67A 4WCFC 1WWKA 1P1RA 3I9LA 1QG6A 4HFJA 5DT9A 3L6DA 2Q1UA 1ORRA 3ZV5A 1GUFA 3MTGA 1SNYA 2DPGA 2BI7A 2VWQA 4OIMA 4A10A 4YT5A 3DBHB 5T5QA 3ZGYA 1E92A 4O0LA 1B0AA 5I7FA 5L9AA 2AA3A 4WCDA 3LT4A 1UXKA 3SJUA 3MJVA 5IZ4A 3AUAA 2D3TA 3ROPA 4DL9A 2VHWA 5C7LO 3OA0A 4XIYA 3U09A 5C5IA 3JQ7A 3HDYA 2YDXA 2OMEA 3I1JA 5L51A 3VKVA 1SOWA 4CV3A 2QYSA 4GMGA 2H63A 4JIGA 3QA9A 3ZV4A 4YCAA 2Z95A 4KMSA 3WQSB 3H9EO 1PJ2A 2I67A 2R2GA 5DN9A 3H9UA 1GU7A 3G1TA 3E18A 3RUFA 3S1LA 1JKJA 5ER6A 1U1IA 4DMMA 3UUWA 1GZ3A 3I4FA 2A4KA 2J3JA 3QQPA 4U5QA 4LN1A 1LLUA 3O8QB 3AI2A 2Y1GA 3PLNA 5L7WA 1Z74A 4J9VA 1V3VA 3R3SA 4J1QA 4ZA2A 5FI5A 2H5LA 4DPKA 1EQUA 1R16A 4Z9FA 4PG4A 3VPXA 1KEUA 4JXKA 1NBOA 3WBFA 1QXSA 5JCJA 5IXYA 3QIVA 4F3YA 4R1NA 4S1VA 2Y1EA 1RM4A 5CDTA 3OJEA 3DMTC 3NV9A 4HUJA 3JCZA 4P4NA 4PZCA 2GSDA 3ONDA 5FEUA 4ITUA 1E3WB 2C54A 4WLVA 4HFNA 4H16A 5CDGA 2YQ5A 5DULA 1GY8A 3IUSA 4FB5A 3G17A 2J3IA 3GVPA 1CEQA 2H1SA 3ZHYA 4AJIA 1BXGB 2GR9A 2DFDA 1XQ1A 3ZWAA 1QSGA 1YBMA 4I9UA 2X0NA 1A4UA 3PEFA 3EMKA 3WGTA 4PZDA 5JY6A 1X14A 4BVAA 2CZCA 5C7IO 4XB1A 3F4LA 1OFGA 1BXGA 1BVRA 1O6ZA 4QUKA 3BHMA 3W4KA 1EVJA 4WE3A 1B7GO 1H0KA 4Q3CA 5CDYA 4CLXA 1O5IA 4XA8A 1PQPA 2PD4A 4TRJA 1ZNQO 3QVOA 5FYDA 5BR7A 4II3A 4Z0TA 2J3KA 3WSVA 4M86A 1P33A 3H9GA 2Y0CA 3ZW9A 3CKYA 3I6QA 3Q2KA 3G3EA 4BO0A 4WCFA 4NDNE 4RQUA 1KERA 4OMUA 1I3KA 2D5CA 1KYQA 3ZNOA 2Y67A 3I3OA 1ZEJA 4FFRA 3EGOA 3GGOA 3UCFA 3Q3CA 5F1KA 3RI3A 4W4TA 4XEHA 1MXFA 5DCYA 4W6ZA 1BMDA 4XIJA 5FWNA 3DBVO 5IF3A 4R54A 2QRLA 2FOIA 2GN8A 3UH1A 4YT2A 4KP7A 1ISMA 1EFKA 3AOGA 3JYOA 3NGLA 1ADCA 4RDHA 5KIAA 3BA1A 5L4NA 5DCWA 4EITA 1T2CA 1RKXA 1RWBA 4J4BA 2W4QA 4BOYA 4CM6A 2DU8A 4RDIA 3E1KA 1N5DA 2DPHA 1YGYA 4RVHA 5JSFA 4XGNA 2HJRA 4N18A 4PZEA 4UULA 4TKMA 1R0KA 1JAXA 2QQ5A 1GR0A 4RORA 1DO8A 4JJGA 4A0SA 4ONEA 1Q7GA 4DIOA 2PKQO 5JPIA 4TRMA 2O3RA 4CR6A 1LRJA 2RH4A 4XB2A 1LSSA 3BMCA 3C1TA 3RUHA 3RC9A 3NJ4A 3SJ7A 2ZQZA 4GKBA 1ADBA 1TT5A 3SXPA 1DC3A 1H2BA 4XDZA 4GSKA 1B8VA 3DMTA 4BNKA 4DIBA 1AXEA 4W7IA 2Z1MA 3W8DA 1H9BA 3CMMA 5H81A 3MJTA 4EEXA 4P22A 5CDUA 1K6XA 1DAPA 2AG8A 1PTJA 4WGGA 3VDRA 1A7AA 3ROMA 1PX0A 4CPDA 4A5OA 3V2HA 2PD6A 1BW9A 3ZWPA 2Q2VA 3WWYA 4IXTA 3VHRA 1HDOA 2DKNA 3DFZA 4XYLA 5F21A 4DRYA 2C0CA 1E3EA 3C1OA 4R69A 2AQKA 2X23A 5CFZA 3PXXA 4DQUA 2DBQA 1SEPA 4M89A 4M8SA 4PLVA 2FZWA 3DXFA 1PJTA 5JDCA 5AXDA 3IQDB 2C7VA 4BO8A 3U5TA 3X2EA 1C0LA 3NTOA 2LDXA 4EW6A 2IYOA 4HXYA 1DHTA 1PS0A 2VHVA 2P9CA 4ALNA 1Y5RA 5MDHA 2PGLA 4CR8A 4E5KA 2QRJA 1ZMTA 2GERA 3L4BC 3EZLA 4D45A 1DFIA 3I52A 4D0SA 2YV1A 1BDBA 2JD1A 4D3SA 1GCOA 4MVJF 3FTNA 1Z7BA 2IZ0A 3KYCA 3WWZA 5L95A 2D5AA 1H6CA 3WLFA 1NVMB 2O48X 1BGVA 3R3JA 1N8KA 5L53A 1B15A 1U4SA 3MZ0A 3D3WB 4LSWA 5FFFA 2OO5A 3EAGA 4K6CA 3PYLA 3P2YA 4DWVA 5KNLA 4DQXA 1Y1PA 2P4QA 3CTMA 4OHUA 1GDHA 4BGIA 3M1LA 4BIIA 5BSFA 2X0JA 4J91A 4YJDA 2WE8A 1YBVA 2CVQA 4FFOA 4JBIA 1BSVA 3A4VA 3RC2A 4R1TA 3QVSA 4KQWA 3EVTA 3UXYA 1E3SA 4ND4A 4PCVA 3V2GA 9LDBA 3QRWA 1H5QA 4OXKA 1GL3A 5EIOA 3JQAB 5KVQA 4BNGA 2Q22A 4R68A 3GNTA 2Y1OA 1PJ3A 3TZ6A 5J9GA 2VHYA 4FIZA 4RZHA 5IDXA 4NH4A 3BYZA 3GG2A 4PG7A 2HMWA 4E0BA 1TI7A 4MVJH 3ZU5A 4XR4A 4QSMA 1DEHA 1LNQA 1DB3A 2FPGA 1SZJG 1KVRA 1LXCA 2HMUA 1YXMA 4MOWA 1A7KA 1NR1A 4IDGA 4MP8A 4XKJA 3EZYA 1H6BA 1OMOA 5EJ2A 4EUHA 1MFPA 3RIHA 1PWZA 1V35A 5HA5A 2X7HA 4HV4A 3JQEA 4NJMB 3QW2A 1TXGA 4YA6A 3OIGA 3H6KA 3I23A 3IS3A 4BV8A 4TMFA 1N7HA 3PHJA 1Z82A 2WWRA 4ND1A 3Q9NA 1WAMA 3GFGA 4HY3A 3QP9A 4NJMA 1ONPA 4ZICA 1E7SA 3DZKA
chains in the Genus database with same CATH superfamily
4OHMA 2BFMA 1QRRA 4BPBA 1NT2A 1J33A 1F1BA 1GEEA 4Z3OA 2PHZA 4H6PA 4NHOA 3PSHA 3GEDA 4JX9A 4W9RA 4YWJA 3UGTA 4JI8B 3PXBA 4RCZA 3LXRA 2XEXA 1D4ZA 3K30A 1EFPA 5GONF 2R60A 4ENPA 4XW2A 4PRYA 5KPDA 3D3QA 2WKRA 4Q93A 3I6YA 1FZQA 5T7BA 3SR3A 3DONA 5IYZF 1BE8A 3LX5A 3M6UA 1R0WA 3JWJA 5CT4A 3KJNA 3QVXA 5ESWA 5C35A 4ZPXA 3A9RA 2VSFA 4LJAA 3PQ5A 1NKVA 2QN3A 5ILQA 1CVIA 1RABA 3OJOA 2WHXA 3T5DA 3OPVA 3AKZA 1ORTA 2FGKA 2X3FA 3NG1A 2C2MA 2F2TA 3JVDA 5TQ2A 1HYEA 4NFLA 4DEXA 3PPWA 5FWXA 2MYNA 4C08A 2X2EA 3WMWA 3DO6A 1D2RA 3FH0A 4WK0B 1K3UB 4MSUA 1H94A 1POXA 1MV8A 3KOWA 4B2IA 3HXOA 1XZPA 2UVPA 3K5HA 4DGQA 1KEKA 3JD1A 1WNFA 3L07A 5A3SA 1EWYA 2O2JA 3RD5A 3SG0A 4TT3D 4Z1MA 3RDPA 3PZRA 4MUBA 1KAOA 1KOLA 2OWDA 1L5HA 5AFSA 3ZHRA 4I8IA 2ODTX 3AWDA 2BHTA 4LMBA 3FETA 1X87A 3B38A 4MGYR 2BEKA 1E2LA 4MP3A 1JE0A 3JAWB 3VO2A 4B87A 2XX3A 3NH9A 3L7AA 3TZCA 5JH7F 2FEOA 1MIOA 3K09A 3K31A 4UEJA 3KO8A 4CKCA 5IC6A 4LZWA 4BFLA 1C4KA 1QZZA 1I8TA 2AW5A 4G9GA 1HBJA 1LDGA 4P93A 5H4HA 1YR3A 1CKEA 1U2GA 3GXBA 3GHHA 5ALWA 3OO1A 4ZVSA 5K0BA 3OD5A 3EPBB 3PDIB 4FXPA 1Z6AA 1VRWA 4K8RB 4X7MA 3T3HA 5BVGA 1PL6A 2ZBQA 3NOQA 5C1IA 4D3XA 2OC9A 3IMCA 2REBA 4CW7A 4ZJUA 3HUUA 5EZSA 4N5NA 3KSUA 1ADYA 1U3UA 4OXQA 3VR5D 2WHPB 4GECA 4Y9DA 5LWQA 2JFXA 2BKVA 3ZD6A 2R6FA 3TDKA 3QKRB 3VZSA 1X0XA 3IEPA 4XGQA 5HBRA 2ZRDA 3HA7A 2WOJA 4B4KA 3M89A 5CU7A 4IRUB 1ZNXA 4LWPA 5K1ZA 4ZZ0A 4EJMA 1P6XA 2PRJA 3WL6A 3TB6A 1XXHE 2I4IA 3A6GA 4JX8A 3KLOA 2NP6A 1IVSA 4L22A 3FNFA 4MV0A 3HYRA 3K9WA 2MOKA 5EWLB 3DQZA 4MUJA 3OBBA 5KBYA 4DRXB 3RYCB 3C8MA 4L15A 4II2A 1C1DA 3KYDB 5BYJA 5EIBD 2C84A 1GADO 1P7WA 2VRBA 3F5MA 3HWWA 3REGA 1D8AA 4BEWA 3BULA 4M3NA 3RVSA 4OG2A 3B5JA 3UWOA 4DLZA 3ESXA 1YB2A 3HJGA 4ZVQA 3S1AB 3WLNA 1OASA 2EZ9A 3ENWA 1OD6A 2RBEA 4G26A 4ILKA 3EXIA 4DV3B 2XB2A 3QXCA 4QHYA 4OYYA 1WV0A 2NZ8A 4X00A 5KNBA 2XT9A 1QG0A 4J1TA 4FGUA 5CB0A 4R3WA 1VCIA 2PZMA 3PVSA 4L4SA 3V3TA 3KK0A 5EUCA 3S2ZA 4EKGA 3ZU4A 3PWKA 5CA0A 1U7WA 1X3SA 4MP6A 1O89A 2XGOA 2JGFA 3GLVA 4G5HA 1AGPA 5JLAA 1DIGA 2H59A 2P6UA 3SKVA 1UAGA 4UPVA 3ADBA 5HKLA 3I09A 2ZJFA 1PF7E 3JD4A 4RVSA 4QAQA 4R2KA 1J06A 2JLWA 4GPBA 4N54A 4X8OA 3IP9A 4OJKA 2JD0A 2QRGA 1YR7A 5T4HA 4IZ6A 2X7JA 1GAQA 3E58A 3FCAA 3N8HA 4PIPA 2CCJA 5FOXA 1VLVA 4V3CA 2O59A 2O07A 4JAVC 5GVSA 4D97A 5J2TF 3EXEA 3KUDA 4FBLA 2CEAA 1ES9A 3ZWCA 1HL3A 2AB0A 1P0IA 4DC0A 2VYVA 1H65A 4C20A 4ER3A 1Z29A 3DB1A 5HKOA 1U2PA 4HMOA 3EP5B 1XZCA 2DLNA 5CVVA 3NASA 3O83A 4IDBA 3AHGA 1M8FA 2NO7A 1K9VF 3B9BA 3PDCA 4W7HA 4AVYA 3ZQJA 4CV1A 1ENZA 1C9YA 3CCCA 4Q82A 3EUEA 5K4AA 3LC7O 1P74A 3ZW7A 2Q3DA 5IJ0A 2O20A 4FGSA 2Q4TA 2VA9A 2QV7A 2OYCA 4Z4HA 5EMKA 3T3OA 5KSPA 3IP8A 4UCWA 3LECA 2BKUA 4UAUA 2A78A 4W7SA 2Q7XA 1DIOB 1TUGA 3R3XA 5I4CA 3RAEC 4MVJE 2C4HA 3AUTA 2AJDA 3DOIA 2JKZA 3PQDA 3COYA 4Q66C 1W88B 4U5XA 4KQFA 3OZIA 1BWSA 4YHHB 3M8KA 4DY4A 3GT3A 5TDHA 2QTFA 2WAAA 2VHJA 3MOGA 1DQRA 1SU4A 2IS6A 2WKSA 3LY9A 2Q6TA 2VTBB 3QLEA 1BHJA 2Q5LA 3FTFA 3H1EA 2FGJA 3QMMA 1NLUA 1R0YA 3BH7A 3TLBA 3E61A 3FCCA 3FMVA 4NPCA 3WNQA 5DBFA 5AUOB 1I7PA 2XE8A 5DHFA 1E4VA 2COEA 1B23P 4FMDB 4ZQCB 4KWCA 2QV0A 3SIRA 4Z1OA 1OLUA 2HPHA 1WBBA 4DKXA 7REQA 3ZHCA 3ZNPA 4D9EA 1TRKA 1Y5LA 5LB4A 1C1XB 2ZTUA 3OX2A 4WOPA 3OX3A 3ICWA 1HT2E 2WFLB 3DT8A 2YHIB 3AW8A 1HQKA 1YVEI 2I6SA 4NU8X 3DHWC 4RPIA 4X93A 4D56A 3ILVA 4K1LA 4ZO4A 1VI2A 4DJAA 2VJYA 2H51A 3RABA 1RYDA 4EYGA 1OZFA 3QBJA 2XCTB 1M1NA 3VH2A 4RKYA 2PWBA 4D43A 1A2BA 3F90A 3BWDD 1P0QA 3RUDA 4DDWA 3U6BA 1WDWB 1Z75A 1E9BA 1SPXA 4WT7A 1QG4A 4BB6A 4U8HA 3BXFA 5TEWA 3V8NA 2J7PD 4JI2B 1T3GA 3ACBA 1UK6A 2VPPA 5IH3A 3RHZA 4G0WA 1YA6A 2OHHA 3E0QA 3EQ2A 1SG0A 4CV2A 3JZDA 4K2HA 3TV1A 4GWLA 5HR5A 5L3VA 1YE8A 2PH1A 3L41A 5HTOA 2IYFA 4H4EA 2GTIA 2HUNA 4PG5A 4NOKA 4XJSA 2Y1CA 4HD8A 3PIDA 1P7YA 2VHZA 4L28A 3IE0A 3P2IA 2HIMA 5HVNA 1W1UA 4FB4A 2OCDA 1NTOA 1QJ4A 2C2YA 2BFCA 2BR5A 1CIVA 4BVBA 4POOA 1M6YA 3D2AA 5JJKA 3OF2A 2NTVA 1BG6A 2CMFA 4JQCA 2PUEA 4CMHA 1B3RA 3GUHA 4Q4HA 3OE5A 5DBOA 4JDPA 2ZYGA 1I7LA 4L73A 1Q20A 1L7NA 3TL3A 2HF9A 3AVXA 1YR9A 3AR5A 4PPNA 2ZB7A 4ZANA 3HL4A 4RVGA 1YDEA 1FUYB 4R2MA 1LLCA 1P39A 2HSWA 4UU0A 5C8XA 2GK3A 2HGSA 3OUTA 4IRMA 3AI1A 5AESA 1H3EA 1AKYA 3GEGA 5F78A 2RARA 1DAKA 1VJ5A 4O4HF 4GXNA 3SNKA 3T3IA 4O8JA 2XMCA 5DGXA 3RVLA 5KOYA 1G18A 3R7AA 2QVZX 1NMEA 4NE2A 4KPUA 3ZKWB 2JH3A 4YPOA 2H7XA 4X3PA 1AXRA 2WJVA 1SRRA 5JAOA 1U2RA 4MVJG 1O6FA 3AY3A 4RPJA 3HUEA 3L0BA 3ENKA 2FWMX 3OP4A 2J6HA 3FD8A 1RJEA 2H2DA 5IWAB 2GF9A 1J0CA 4LOAA 2MSEB 2VDLB 1DG3A 2FQYA 3J81k 2GXSA 2GXQA 5EZ5A 3TG2A 2H5IA 5CA1B 4AS3A 3C70A 4G5QA 2H4XA 1MEJA 2RAVA 1NQ5A 1NE2A 4NAHA 4UE3S 2ETVA 3R6DA 2WM3A 3LE8A 4IXWA 4ZHQA 2AJ8A 1M6VB 4IS2A 2V7QD 1FJ2A 4TXNA 1CR1A 1LK5A 3OSUA 2Y1FA 3VTFA 5ALHA 4P7GA 2WV9A 4F1WA 2F17A 4XWTA 1IHOA 3U39A 3SBEA 2VJLA 3OOEA 5ALUA 2E49A 4AY5A 1GCUA 1UKBA 2A14A 3CB2A 4B6EA 5BVHB 2BVNA 1MDBA 3RASA 4NBRA 4KXLA 2W0SA 1Z07A 3JPYA 3F6SA 1YDWA 1Y1TA 4AJ1A 1G41A 4RVNA 2I76A 4B3DA 4E5VA 3S2UA 2NW6A 3UC9A 1RYEA 1VMAA 4F9EA 5D00A 4GPAA 2PKEA 5LP1A 4RVFA 4KPFC 3SKXA 1T8UA 5C1BA 2J85A 1JENB 1Y6FA 1BS9A 4OB6A 4UU7A 4YRSA 4QOGA 3N2YA 1UIRA 3AONB 4ZAWA 5FBLB 4URYR 2FZCA 1UBHS 2YVUA 1MVOA 3DLAA 1E3QA 2FZVA 3KFLA 2JLVA 5E0OA 3A26A 1PJAA 1SB9A 3N2LA 4S12A 5EUMA 1A2KC 5AK0A 5GV8A 2JNWA 3G5MA 3LPNA 4A0FA 2O7RA 3QVJA 4CUZA 4YRAA 2I1LA 3LUAA 1VLJA 3BRWA 1HZZC 2OOSA 3BMQB 4JK3A 5SY6A 1HETA 2IDMA 2QRNA 2PA3A 3HBLA 1IY1A 3M2PA 3M4ZA 3NS7A 3PX7A 3NWOA 1J8DA 3AHIA 5F64A 4AK1A 3H9JA 1SBZA 1W52X 5KYXB 5DGTA 4NNJA 1DEOA 1UEJA 5CJPA 2BIFA 4AJJA 2QSJA 3EHEA 2XDAA 4TV9B 1JIVA 2ZYAA 2ZJ0A 4TSFA 3I5AA 4K7JA 4GVPA 5GAJA 2FOXA 2ZR8A 2GT1A 1HE3A 1U3WA 1XRSB 2NPIA 1ZUNA 2VZEA 4L5AA 4RU1A 4JI0B 4N6OA 1TLTA 1RPAA 1TYEB 4IW3B 4LJLA 5JTUA 3THYB 1ZSYA 1V96A 1DWPA 4PX9A 2WZBA 5H59A 4CBVA 2FMTA 4XE5A 1E5QA 5EKXA 2CCGA 1I3NA 4NESA 4AS2A 1ZICA 5AICA 3AW9A 3ABRB 2AV6A 3RAGA 1P1JA 3QV2A 4XAQA 4LE0A 5TQ0A 3HDVA 3R24A 4CCWA 2DY0A 3SICE 2MWMA 5AKEA 3ER9A 2C5BA 3E82A 2RC5A 4ZN6A 1VSTA 3JYPA 2M6SA 2ABWA 3QX9A 3PHLA 4Q9HA 1T3LA 3FOCA 3H0CA 3TIXB 4B2YA 3QF4B 4LTNA 1GA4A 1QE3A 2R4QA 2PH5A 1CG6A 2RHBA 3IURA 5A3VA 1WL8A 3SJAA 4C6SA 3JQ8A 4QRDA 3ZCSA 2XNDA 2O0LA 3V4OA 1ESDA 1XD9A 5HF5A 1G8HA 2R7LA 3MPOA 4B4VA 4GG1A 3ORSA 4B6JA 4EEZA 2ZE5A 5CBPB 5KYWA 4FFBB 2D06A 1FQJA 2G3YA 3JSXA 3VPHA 1JEYB 4OXIA 2OV3A 1FUKA 4R41A 2Q5OA 3RV4A 1JI3A 3U26A 4OP3A 3AF4A 2IYRA 2P69A 2CK3A 1LZLA 2QNIA 3QELA 4G5FA 4EFNA 4MVJM 1THMA 4L02A 4D44A 4DJFC 1UBRS 1G55A 4N49A 3M1YA 4R81A 3EP4B 2G4VA 1EINA 4JOSA 5HF9A 1T9ZA 2R1UA 3TAUA 3MJ4A 2Y0BA 1CJCA 3B9QA 1AUQA 3O21A 1KMQA 1TK2A 3EQ9A 2NV2B 3JQBA 2BD0A 1ZRHA 2HIAA 3TEJA 1Q19A 2QDKA 3OAAA 2OWEA 4QBGB 3VHQA 2K7FA 4DKJA 2PGOA 3F3SA 3G2PA 4IRXA 4AZSA 2VH2A 1HFEL 3QVVA 1GL7A 3GROA 3HBAA 4M1WA 4RKWA 5KX5B 2B61A 3DMYA 3DV9A 4NONA 4OK5A 3EF1A 3L7KA 1NWHA 2GS9A 4OQYA 1SFRA 2OHFA 3PXGA 3SPXA 4ZT3A 3TL2A 3N6VA 4V0KA 1K8ZB 3NOXA 4CMJA 5ALQA 3HDGA 2VQ6A 4O2BA 3S2IA 4YJFA 4ZOLA 5LQDA 3GR6A 4RD4A 1RAGA 4RGYA 2VPZA 5AKGA 4H0CA 2J48A 5JBNA 1E2UA 3ND6A 1TK9A 5HHTA 3D81A 5J23A 2GN6A 3IAEA 2YNMA 2VCHA 4Y1RB 4PCAA 4A9AA 4UNIA 2IYSA 4MYRA 2W6MA 4WZAE 4ID3A 4EEKA 1Y8ZA 2BJWA 2H07A 4MDFA 1RD4A 1Y9ZA 4DC1A 2F4NA 3Q7SA 1GNSA 2OYRA 4E5SA 1HDYA 3A3NA 2WVAA 3OZXA 4J3FA 5FOVA 3GJ5A 4IH1A 3HI6A 2XZLA 2G5PA 4QHTA 4RF2A 1L7PA 3G9UA 3K96A 3STVA 1D4OA 4KDRA 3CPEA 4UNNA 5ERXA 3T9EA 1E2FA 2O7QA 4B43A 1ID8A 1N8SA 1WZUA 4MQ6A 5DM2A 3AJ9A 3UUEA 1HI9A 3EA0A 2WYOA 1W87A 4HNGA 2W4IA 3BXXA 2FPNA 2NO5A 3ZBUA 3D7NA 5H83A 1WUIS 2AN5A 4QJ3A 4CEIB 2Y71A 1DRJA 3DBLB 3L4EA 2VQ3A 4L4YA 1AGRA 3R5FA 2B6HA 1Y4ZA 3DBOB 4E11A 5ALGA 2VJNA 2IV3A 1QP8A 4XX0A 1WDMA 4K8OA 1Z33A 2W2OA 1KSJA 2CXXA 3AU9A 1OY1A 3C3MA 3RUAA 4RTPA 2AQHA 2JIRA 4JENA 4LQCA 1L5WA 2GHRA 2GLTA 3CQ9A 4LXYA 3R09A 3B36A 1TMYA 4BNDB 1T1IA 4OQ4A 3EF0A 3F2IA 4X7PA 3M3HA 1GAXA 2UZ3A 3PR1A 4G8JA 1C7EA 3P19A 4OXYA 3STUA 4L5JA 4OOEA 1QP4A 1O7JA 4GO1A 3QWHA 2X0DA 1H8HA 1NG1A 1RI1A 1U65A 2WJIA 1SUWA 4MI9A 3P97A 1J4AA 4X90A 3RT1A 5DLPA 1KK0A 1W2WB 1TGVA 3UICA 4BMNA 2YW9A 4LMRA 4AN4A 1LVUA 4Z4GA 2IOFK 2XUDA 3BJRA 5CITA 5K8UA 2BFEA 3QLJA 2XVAA 4XQGA 1X1AA 4Y2GA 1F6DA 1M2VA 2FDRA 5BYBA 3WIEA 3HJHA 3QBTA 3RYIA 2BGUA 2BZ0A 4AXBA 1V2HE 5HILA 1DPGA 4ZK2A 3S44A 3D8RA 2XCUA 2IZZA 2LGJA 5HIMA 3Q8XB 4DLLA 3ZZ1A 5BUSA 1MAUA 2OXFA 3PUHA 4WXHA 1CZUA 4A2CA 3L4SO 2F3UA 3RTCA 2K6GA 4RIFA 2WG2A 2Q28A 3FFTA 1ZGGA 3LI2A 5K3FB 2H6EA 5IF9A 1MU0A 2QYHA 4BAZA 2C99A 2HHJA 4LXIA 2XMPA 4M6WB 3H1TA 2ARKA 3LPCA 5TGTA 4CTKA 1IJKA 4I14A 3CRNA 2PS1A 1DAOA 4F96A 4EOGA 1QCDA 3ILSA 4BGEA 3N0XA 4ZK6A 2JVJA 3CVOA 1UXJA 1GR1A 2EEPA 2P6PA 4LJ9A 4QXRA 1G2QA 1IK4A 2JBAB 4BB9A 4KGZA 4C3UA 1VJTA 4YMGA 2FCRA 4LRSB 1KEEB 2JIOA 3HGTA 2FMHA 3BXEA 1Z6PA 4J9UE 4PLYA 5AW5A 4YJGB 1QANA 3TW4A 1D7OA 1GJRA 1UOEA 5K9ZA 2O2EA 3NBFA 4AMUA 3ZCUA 3TJZA 5JRZA 4LYJA 4FKBA 5JWHA 4OLAA 4IQGA 4RCVA 2FWNA 3IAHA 4TVSA 1AH2A 1NMQA 3C8UA 5AOAA 3U0VA 2B2NA 2XXAB 5FA5A 4M53A 2NU7B 1RAAA 2Z8YA 2L17A 3IQGX 2ZYTX 3RHSA 4RFSB 4XPIA 4AICA 3WGUA 3E0XA 5FPSA 5DHQA 5BSEA 4DANA 5TIIA 2JG3A 1NFQA 3IO3A 5CYOA 2PFKA 4N5MA 1H4QA 4M1EA 4CT5A 4L0QA 5DGDA 5EINA 2WW8A 5J1SB 1A8SA 1OTXA 3V8BA 3AHCA 3HDHA 1H2HA 4J7UA 2JRLA 2AOUB 5AVQA 2EF1A 1D0IA 3FMOB 2VO1A 4OA5A 1KDTA 2GZDA 4JP5A 3WXMA 2HNKA 1XZNA 2VP5A 4IGFA 4HO1X 4OQQA 1EVEA 5B4TA 3SNHA 1F1JA 5ALEA 1VMIA 3A1NA 5JAHA 2D1YA 3DEAA 1RQNA 3LBHA 1ZCFA 3Q12A 4YPFA 1GYPA 5D5PA 1G3MA 1Q77A 4R3NA 4GWGA 1T9DA 1BHSA 1XX6A 3KKMA 1VSUA 1L2TA 1WMBA 2B0JA 5ALDA 2XMSA 4KHZA 4HAUA 4MCAA 3AM3A 4P3OA 1ZCJA 3R1IA 2PXHA 2W48A 4RJTA 1TZ2A 4IEFB 2CT8A 4UNQA 1VKHA 1R9NA 2ZBVA 2HRBA 4AC9A 5IEJA 1MO6A 3JQCA 3MYRA 4ESOA 2DPMA 3AT1A 3MGGA 1LDYA 1Z6QA 3FOBA 1MEOA 2AFRA 4FFPA 1M34E 4BZQA 1PDWA 4D8WA 3ZVRA 3VH4A 4QGSA 4M1YA 1FYWA 4G36A 1O6CA 3HCFA 4RA9B 3EVGA 3U17A 2O23A 4V1CA 3P20A 2NU8B 3CBGA 3H7IA 2PS3A 1TADA 3GJYA 3WIDA 4B6RA 1BXRA 2F3QA 3HPQA 1EUDB 2PUWA 4ZYTA 5KSYA 4OMDA 2X9LA 2K5UA 4G65A 3SC3A 1D7AA 2YIJA 3WLRA 5FFNA 1IY9A 3B1YA 4FHFA 2FH5B 1W94A 1MXHA 3RF7A 3LQQA 4JLKA 2PK3A 3TAHA 3JQ9A 3H5LA 3FDXA 4FN4A 1JEJA 5DBGA 5F51A 1OJ7A 1P0CA 4K6FA 5EGSA 5B7QA 1KOGA 3GCXA 3C1AA 3GLHB 4MKGA 4XH9B 3VNAA 4BCCA 2OCXA 3NPMA 4AG3A 1UANA 3VTZA 3QFCA 3DM5A 2XF8A 2O8VA 2JRCA 2KM1A 1IWBB 1E1KA 1CDOA 5IRCD 3GZTB 1SCIA 2QTWB 4HS4A 4X6UA 3HYTA 1SWVA 4E4TA 4OI0A 1VIYA 1PLLA 1U02A 4GX2A 2BGIA 3CX8A 1J8MF 3OTGA 4F5DA 3GOHA 2DC1A 2PMCA 3WLIA 2RG1A 3EZ9A 4HB4A 1HDEA 3PF9A 5HUQA 3IBSA 4EA7A 5HZMA 4NV1A 4LYYA 3PKJA 3ZE1B 3X1MA 4G41A 3WYCA 2H2FA 4NWIA 2BKEA 3WOHA 3H1FA 3WLSA 2WWGA 4TSKA 2QPTA 5LUBA 1FLDA 4A8JC 4HDSB 4I3FA 1YFKA 2VNSA 4C0JA 4OGLA 1G21A 1U3FA 1Y81A 5SV2A 3CU5A 2Q50A 2WPDD 1TYZA 3LWZA 4ZCRA 1U8TA 1I10A 2Y0EA 1RYBA 5JW6A 4RUKA 5T8KA 4U00A 1MOQA 1QAQA 2HI0A 3E9DA 3SP1A 1P1IA 5LZ9A 3K2IA 3TXXA 5EJIA 4FOPA 2OE2A 4CFZA 1LRKA 3TOSA 1QIEA 1LDNA 2AZDA 3O82A 3OE1A 3EP8B 1LWNA 3OX1A 4LDQA 3DE7X 1GZVA 1OPRA 2J5XA 1FNDA 2O1SA 3K0FB 3RIEA 3UXMA 3OLQA 3UATA 5L7TA 4F9TA 5D51S 1WZIA 2GCPA 3R7WA 5JMTA 2XEDA 4CL2A 4G5XA 1OZAA 1ND5A 2CJWB 3KLBA 5EE3A 3SS9X 4D8TA 4F4DA 2QZ9A 1E0AA 5KX5F 4YQYA 1J00A 4KOAA 5IZCA 1M2WA 1YZYA 3H75A 2I33A 3IIJA 3V8QA 1J2JA 2BRUC 1QYDA 3IAS6 1UYJA 4O59O 4BV9A 1E98A 5CFRA 3KU1A 4DHEA 5TVGA 1Y8RA 1IZ7A 3AKDA 3HU5A 3KJXA 1ZRMA 1S96A 1I7SB 4MRNA 3FJYA 5LKAA 4HUQB 3R9XB 4ZEOA 3R3UA 2I2XB 1HRKA 2W5UA 3WRYC 2IE0A 4LCEA 2QD5A 2CB0A 3FBWA 4JLMA 3IAM1 4X44A 1SCUB 1MO4A 4RD0A 1G8YA 1V0JA 3G8AA 3IV7A 3FMIA 1P5FA 3LUGA 4NG4A 5AVUA 1KAGA 2JGDB 3KDPA 2P1RA 2J87A 5CURA 5GJVC 3PDIA 3ZD7A 4PHTA 4UBNA 5B1SA 4EHAA 4CM9D 3WNCA 1UMKA 1PJLA 2QGZA 1PDOA 3KLPX 1VLLA 4OLJA 1EFHA 5F5NA 2BJVA 3OEHA 4C9BA 3U7FB 2UXCB 2J3LA 4GZ5A 4DCCA 2P2SA 2WHPA 5LA6A 4MYSA 2BH9A 1I6KA 2ZFUA 3EMVA 2OCLA 3QKRA 1FYVA 2RBGA 2HJGA 4QXAA 1JVSA 2O3JA 1JDBC 1WU8A 3F0TA 1QHNA 4OQFA 1RYZA 4TS3A 3ROQA 2FAXA 2IYEA 1TCBA 2QPOA 1CHDA 2O57A 1P4GA 2FMKA 2ZYWX 3GMDA 3B13B 3BBPA 3KBOA 1PGOA 2GBCA 2PYZA 1LF0A 3A2MA 1YZLA 1Z15A 3MINA 3R4VA 4GKAA 3R74A 4B7XA 4HVCA 821PA 4IY1A 2XUIA 1W5SA 2BEWB 1NYRA 1HE1C 2GK4A 3PGJA 2FEKA 3P4UA 5EWLA 1Q5PA 1XN1A 4KIFA 5BRNA 2C4KA 2CLKB 2QK4A 3UFXB 4DRXA 3RYCA 3HCWA 4Y2VA 2VDVE 5BMVB 1SO8A 5JXHA 5EIFA 2O2HA 5ANRB 1SXJB 4E15A 4YV2A 1TA4A 4KFUA 1DRVA 4R8LA 2F59A 2YMLA 1NNI1 3S1AA 3L7IA 3HVJA 3DOCA 4AYWA 1PWEA 1W36B 1OJLA 2Q8NA 3TKYA 4R2IA 1P44A 4CQMD 1VQ1A 5B57C 1NXXA 3N8NA 5C18A 1PL8A 4QJ5A 4B3FX 1A3CA 4XWKA 2B9EA 1M5UA 2BC9A 1OFTA 4J7XA 1RE1A 2H4FA 2X77A 4CUKA 3QJ5A 4PAMA 4TL6A 1TA0A 2VYQA 4PXAA 2CKDA 3C5CA 3NHJA 1JPVA 3MTBA 1QLJA 1Z5WA 3LXXA 3NX4A 4GMDA 3I37X 2DG2A 3RKSA 1RTTA 2AUNA 2DCMA 4LBVA 3RS3A 3ZGOA 4JJKA 1CY1A 4OQNA 1AV6A 1EM8B 3K15A 4C06A 3V4LA 4Q1BA 2XB9A 4N0DA 4F3RA 1T6BY 4L8VA 1E4EB 5FCDA 3STYA 1F0YA 1VKRA 2ZPUA 4N8SA 4CCSA 2BKAA 3PXEA 5LIRA 1Q3HA 2F8MA 2IYUA 3R7FA 1K3TA 3MT0A 2PA0A 4J0EA 4Y98A 1M0WA 4PONA 2CW5A 3IHKA 4W5WA 4V0RA 4PR0A 3UB2A 5EJ8A 5F23A 3H0EA 3PEWA 5IJZA 4JI4B 5MF6A 4HLQB 3EBOA 4UVEA 2P4SA 3E81A 3CPJB 4FZJA 4IWNA 1U0EA 2WHYA 4UJ5A 5DM70 2HWKA 3FWZA 2FQQA 2ZT7A 3SHWA 1QH0A 1A9QA 2WC1A 3SEAA 2AL7A 1PFVA 2D1TA 3QXSA 2EP8A 1QHHB 2WUDA 2XGGA 3GLUA 4ND5A 4Y0NA 3LPDA 4PRKA 3IDOA 2B4YA 2ZYUX 2C29D 1L1QA 1NY5A 2C92A 2A0XA 4KO4S 2PVSA 4J1NA 1TEHA 2YQ4A 4RZ3A 2RGCA 2I91A 5CCDA 4NYMQ 4B75A 4JC4A 1RCFA 4GOKA 4PHCA 5LQMA 1W88A 3HLYA 4AG6A 3EP9B 2CZQA 1F0PA 1TQ2A 3E3MA 3NKLA 4AO6A 2FKNA 1QE0A 1XO1A 2ODQA 4GF5A 3RC7A 1RPJA 1S1CA 1OIXA 1Z7WA 2XTZA 2Z3VA 4HH0A 3BGWA 4DLUA 4HDMB 2VTBA 1XNRB 1OBHA 1VKJA 4RWEA 4P3NA 2GRAA 2A35A 4C4AA 1DTWB 3EFBA 4I1RA 3C3XA 5HPYB 3LQFA 3UK7A 3H5WA 3L8EA 3LX8A 4WA8A 1SC3A 1UBTS 3HCDA 3V2UA 2GKGA 3P4YA 5AM3A 4GWKA 4XD7A 1T5SA 4FEEA 4OYRA 2PGDA 3L1KA 2VDKB 1IYZA 4JLUA 2HJHA 5C5CA 3TKLA 3F6RA 2B7CA 2MSDB 1KYZA 1C1XA 4BMPB 2O8EB 5LXTF 2Z2YA 2WFLA 2YHIA 1JWAB 1S3SA 5J4KA 2XDQB 3K6KA 1Z6TA 1NWCA 2YXNA 4HL6A 2BBOA 1W30A 3M6VA 3D7RA 3C3YA 3UCXA 3SQXA 1GZ6A 1OLSB 5DTQA 4GP6A 5KTOA 1UJMA 1QIMA 4QVGA 4GT1A 1QB8A 2VAVA 1V71A 3KZVA 1XK7A 3W8RA 1KK1A 1OT3A 3CVJA 1B6SA 2H1CA 5LQKA 2L69A 1UFRA 3VO1A 4F46A 1F6BA 1R1DA 4A3SA 1QFXA 2RONA 3CRZA 3EQZA 1EHYA 4L5IA 4A92A 4BNMA 4LZPA 4UBKA 4WGFA 2N1BA 5FKJA 3DSRA 2EZUA 2FP3A 4P53A 4D80A 4FFVA 5A5FA 2H92A 4LXUA 4QZVA 3TIVA 4UPEA 3O31A 5CBKA 2F1RA 1Q14A 5JAPA 4ZFNA 4ZQBA 2ZATA 1E6KA 5TMEA 1LSOA 4IPTA 5TMBA 1ENOA 3QFTA 1UKAA 1G0OA 2WKQA 4Y2XA 1PGJA 1R5OA 2IL1A 3G2LA 3T15A 3C7AA 1HFWA 1W35A 2W2LA 3DZJA 4CKZA 3AUYA 3AQIA 2OKGA 2VCEA 3GO4A 5EJEA 2ID8A 4CQJA 1ELOA 4FR2A 1CUSA 2R0QC 5A7FA 2C5SA 1WB4A 3BRWD 1D3AA 3PXCX 3ZVKA 1P6QA 1PJQA 1HM5A 1UT6A 1W73A 1WXHA 2BUBA 1DLJA 3I6BA 3KWJA 2JFBA 1N3LA 3GCZA 1RXSA 3MUFA 5THKA 3GRUA 1C29B 1XA4A 3CZCA 4NCJA 5FX2A 2RHCA 4AF6A 2WIFA 5MGNA 2XWQA 2ZI3A 3HRKA 1N5RA 3LKBA 4IDQA 2IWHA 3FR7A 1IXKA 4X54A 1M10A 2CWDA 4O2AA 1J23A 1GZDA 1V6SA 4WZ6A 3AF5A 5DYIA 3LVFO 1EXVA 5D6OA 1FIUA 3ZKWA 2J46A 1YE3A 1C7IA 3VZCA 5IKEA 3RGGA 3NBZC 4FI3F 1YB1A 3KQMA 1MB9A 2X13A 1QHYA 4TTSA 1KI2A 2BFAA 4C7KA 4DXDA 1KA9H 4EW3A 4F2PA 2O54A 1OZHA 3VX3A 1JWLA 4QM6A 5BT9A 2PTGA 1Y5MA 2OCBA 2O14A 1I1HA 3TCNA 2QZ4A 1CR2A 1JZSA 3C6QA 1Y3HA 1AB5A 1ZUWA 3IO5A 4LSMA 1ZJ4A 2H4JA 4Y3UA 5TQVA 2YFHA 1DRUA 1FK8A 1IULA 3RFXA 1GLNA 1IN4A 4UBLA 5FOUA 5TARA 1YDGA 4HRAA 1M6VA 1MFZA 4B5LA 4D0GA 1L7BA 4Q16A 2ZQYA 3GA0A 3T5GA 1HTBA 3JQ7B 3A9UA 2GVDC 2HREA 4LYAA 4DA8A 5ILOA 2IUYA 2DTDA 2PXAA 1EFVB 2WMDA 5EY5B 3PFHA 3LXUX 3RANA 4B8ZA 2Z3WA 2XNDD 1EAMA 3A6EA 1GZUA 3WFIA 1IZZA 3GRKA 3HCEA 1PT5A 1PWYE 3JZIA 3D43A 4K6HA 4NZOA 1UFVA 5AHOA 1S8OA 2UUCB 1E3MA 1YRYE 1J0DA 1RBYA 2OHIA 4DIMA 2IZ6A 4X8MA 2WHEA 3EGWA 3TRIA 3CKKA 3MTQA 3W34A 3QW4B 2O3UA 2JANA 1E2JA 2HLPA 2JCXA 2HU2A 3B60A 4KKXB 1PGQA 4R9VA 1OI7A 1MZPA 4OQPA 4KXMA 1KMNA 1ISIA 2FFJA 2QZZA 3I34X 1L7XA 1X1DA 5DN9A 1HC7A 1WSDA 1Y9AA 3EVNA 2RHMA 2WWXA 1LRLA 4L6IA 2BP7A 1A9PA 2ZRNA 1CUGA 1ENPA 3B7PA 3DHNA 2ORVA 5L7YA 3T5MA 3X2FA 3VOBA 1O0BA 3BMQA 3OAAD 4X1YB 3RYFB 1MX3A 3FVQA 3TQRA 3ZGVA 5I7EA 3IBYA 4H7EA 5EMMA 3R7SA 1IN1A 5A03A 1MUUA 1YCFA 4Q1DA 3LUHA 1HURA 4MUIA 4MR9B 3BJZA 4OA8A 1PW5A 4ZI5A 4Z9YA 2GOYA 4ER5A 2FPMA 5KJ6A 5KYXA 2IHBA 3R77A 4TV9A 2TMKA 1I2DA 2AG5A 5LC1A 2JGKA 4WK6A 2J5KA 2BV3A 4AMVA 2Y6VA 2Z4RA 4I4CA 3IAUA 1VJ1A 5TPWB 2JHCA 4FFLA 4RJKA 4Z4IA 1U7TA 1II0A 3S5UA 3THYA 2YNMD 5AH0A 1QVRA 3RAJA 2XNJA 4H27A 1P19A 1XA0A 2BGNA 5IMSA 3K4PA 4LKRA 5B64A 3G5AA 1CV2A 1RXYA 1E6WA 4RO0A 2YQZA 3PCXA 2VJMA 3JU3A 1T6YA 4TWJA 3UXHA 5FOQA 5M5BA 3FOFC 2BDEA 3ZJYA 1FTNA 1WLSA 2YWJA 1GGFA 1AE1A 2W2VA 3CIOA 3NWJA 4JUIA 3KEQA 1ZD3A 4DJTA 4MDHA 4EKYA 4JI7B 3TCXB 1KY2A 1ZGBA 1GSIA 2DCUA 4LC1A 2CYBA 1CUEA 1G291 2AG0A 4MWBA 1N0IA 5EUQB 5F5LA 4FHZA 5KWEA 1ETUA 5JE8A 3WGQA 2OV6A 1Y9EA 3OPNA 1PZEA 5ERGB 3PQ3A 4EP1A 2B2XA 4FFBA 3GC6A 3QSGA 5JHHB 1JEYA 2BE7A 3KC2A 2NPFA 3VTKA 1NUUA 2CF6A 1C9EA 1NKSA 3SQWA 4LCJA 1HYQA 2GUWA 3GFTA 4L6AA 5K20A 2W2TA 5IASA 3AJEA 2HU8A 4WCFB 1TMOA 3HA3A 4X60A 1ZZEA 3WK5A 2V65A 3N2GB 4WNIA 4PQGA 3NBMA 4PXSA 4A6EA 3KEOA 4AY2A 1CK4A 1XAHA 3EP7B 2HA7A 3TRDA 3V4ZA 1JXAA 2CXPA 4WXPA 2JL1A 1SVIA 1EE9A 4FINA 1H8HD 5K99A 5JYEA 4KI7A 2BTQB 5LZ4A 4DV7B 2DY1A 3EGDB 3WDSA 4GQBA 1ZVKA 4EBFA 1XZJA 3KG2A 1RCUA 5LU8A 1BAPA 4W1PA 1QMPA 1ZP6A 5F9FA 1JF8A 2RAUA 2MT9A 3FCEA 3K6RA 1W5EA 5DCUA 5JO0A 5K8CA 3E5RA 1ULTA 3NM5A 3DL2A 1ZDMA 3IPXA 1P62B 5I51A 2IHKA 3RGWS 1RJ9B 2JD2A 1G8JA 3T7CA 5BXYA 3KSMA 1OGJA 4N12A 1HG1A 1AN9A 1RIFA 4Y67A 1ZO8A 3B1VA 3EDMA 4GP9A 3R7NA 1L7AA 4Y1RA 3CZQA 1UODA 4QC2A 3WMXA 1ISHA 1MN6A 1KO1A 3DT9A 3KU4A 1ECPA 1U90A 2QI9F 2ZE6A 1ZH8A 1B3BA 3SJZA 1XE3A 3RRYA 4BO5A 5ICCA 2Q0XA 4KFSA 1F2TA 5CJ2A 4YFVA 1EH5A 5JAQA 2BHNA 1Z5PA 3D4OA 1C7FA 1IC6A 3BMCB 3DULA 4G97A 4CMGA 1SMKA 3ECAA 2B34A 5CW2A 1YULA 1AKMA 2IXTA 4PLFA 4BJ5A 1NHGA 3QBDA 1BMTA 4JI3B 4Z49A 3UMYA 4CEIA 1ZESA 5KYVA 3AR8A 5TJ9A 1JVNA 3DBLA 4DLRA 1U8YA 3ZY6A 4WH0A 1CS4C 1SGWA 3Q0EA 2W2MA 1N9ZA 4DW8A 4KQJA 1CJVC 2GXUA 3C7CB 4H4DA 5H3LA 3W9YA 4HNSA 3UGJA 2OZPA 1ZD8A 2VUSA 1DAGA 4NV3A 4QD3A 1NF8A 3K9HA 4MA5A 5TT0A 1UC9A 3WMRA 3NAZA 4XYMA 3ZWVA 4EY4A 1KDZA 3X0DA 4AURA 2X2PA 5SYMA 1RFLA 1WUJS 2TMDA 4BLVA 2AE1A 1BW9B 4FGLA 3OPXA 5K0EA 1V8DA 2CDAA 3C97A 3W06A 4BQIA 3AP3A 4X97A 1NN1A 3S2FA 3VAZA 2RGGA 2OC4A 1KU6A 3IMEA 2ODWA 4XX1A 1MKYA 4EI7A 1GUYA 1OWMA 5BO5A 2PWYA 1JHRA 3K2BA 3SFZA 3IE1A 5P21A 1N5IA 1WCWA 3LM8A 3Q7TA 3G49A 4KR9A 1MTOA 2A88A 2Q4EA 1VI6A 3H87A 3WWPA 3ACCA 3QYAA 4JR1A 1K0UA 5DNVA 3ZWBA 5I47A 2ORYA 3EIFA 2XCSB 2ZYIA 3DBIA 2PSJA 3KAQA 3W3ZB 2FVXA 1F0NA 3LRPA 2FXVA 4GZLA 2H1VA 1UDAA 4NMHA 3GZNB 4YRIA 2MYUA 2C2WA 5C8ZA 1T36A 1KWKA 3NDRA 3OIUA 4JASB 4IJWA 2AFHE 4L3VA 4XLLA 2GEFA 5GOTA 1UPXA 4X1OA 5HEKA 4QO7A 4X65B 2BJHA 1IRIA 1UBOS 4I9NA 1IWOA 2YOGA 3Q85A 3WGHA 4H1HA 4LYGA 2BI4A 4M6WA 3LU1A 4PYOA 3RNOA 1MNQA 1FQOA 3LT2A 1NURA 4LWOA 4TTTS 4XDYA 5G40A 3SLGA 2X3YA 4JLVA 4ER6A 5GGYA 3HLKA 2G76A 4IIVA 5TC4A 3W6UA 2AZXA 3KR1A 5CVUA 1E9SA 1E2MA 3VAYA 2B7LA 1UK8A 1A69A 5CK5A 4YJGA 3VH1A 1EK0A 1T24A 1ZWLA 2A5JA 4MYTA 4OKSA 1JHPA 4TXLA 1U7DA 4QUJA 2CDNA 1EIZA 4S1OA 5DTMA 2O1XA 2OPHA 4OATA 1Y5NA 3A2NA 4DDMA 4FLMA 1R7RA 4F2WA 1BO6A 3KVVA 2YRXA 4NHEA 2XXAA 2NM0A 3UHFA 4A82A 2Z2XA 2NU7A 1LNSA 4LE2A 3ANMA 2OCYC 2I2AA 4BFYA 3GVCA 1PFWA 1C2YA 2OENG 1Z4JA 4N7MA 4WKNA 1U28C 1MMFB 3OM0A 4XVRA