4GMFA

Apo structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
335
Chain Sequence
KQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVAILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
molecule keywords Yersiniabactin biosynthetic protein YbtU
total genus 104
structure length 335
sequence length 351
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmfA01
5IDYA 3EK2A 1AE1A 3D0OA 3LQFA 2TMGA 2JCXA 5L40A 3X2EA 4RDIA 2AEFA 1NX6A 4N18A 4IJUA 4MIYA 2OORA 1ZUD1 4XDYA 3ZWNA 5A02A 1G0OA 2JCVA 2FWMX 4YEDA 4RVSA 3A06A 4CUJA 3CINA 1EMDA 3LC7O 4WPGA 2R00C 4WCFB 4WNIA 5ENVA 2NQ8A 1UXIA 1I24A 5EQDA 4BV9A 4EUFA 5JYEA 4PG6A 3PXXA 2BRUA 2PV7A 1TI7A 3E9QA 1LSSA 1Z73A 3QRWA 2QRKA 4FOSA 3AI2A 3GN2A 4J1SA 1DBVO 5ER9A 3EC7A 3HB5X 3JQFC 4J4HA 2HLPA 2GLXA 3INRA 5CG2A 3F5SA 4YJFB 3IUSA 4NU5A 3ZU3A 1C1XA 4EUHA 2FSSA 2HK9A 4GPD1 4HFNA 3O8QA 4Y98A 1F8GA 4J1NA 4IXTA 2NTJA 4XCVA 3GPIA 2VYND 1GY8A 1VL8A 4R41A 2YFHA 4NFYA 4J7UA 4UEKA 2JFHA 1FJHA 5EN4A 1P74A 4B4WA 2X5KO 2NSDA 4CODB 4M49A 4JJFA 1PGQA 4BNNA 2Q1UA 4G5HA 4BNXA 1BXGA 2W98A 4GX2A 4I5GA 3VH3A 2W90A 4OXYA 4I9HA 4CMGA 5AXBA 3JQEA 3ENNA 5U4QA 2EWMA 3DZHA 9LDTA 3CUKA 4E5PA 5I7EA 1JKIA 1SOVA 4AJLA 3DQPA 4JX8A 1UH5A 5A5EA 4J90A 1GCOA 4BMSA 5BSGA 1MA0A 1U3WA 5CPFA 4BOYA 5JDCA 5KTKA 1D4FA 4DPLA 4NBWA 2NU6A 3Q3CA 3VH2A 2WYVA 4A5OA 1YBAA 2P91A 1GR0A 5F5LA 2ZJ1A 2B5VA 3FTPA 3DOCA 3TZKA 4L75A 1PWZA 4O59O 3UH1A 3CPSA 1OC2A 3KYBA 5KVCA 4YJGA 3MEQA 1LJ8A 1TT5B 4GI2A 3T4EA 4AFNA 3PIDA 3D7LA 2DLDA 2BHLA 1NVMB 1Y7TA 1O0SA 2F1KA 1K6XA 2I9PA 2ZTVA 1DIAA 3RKUA 5BNIA 5JAZA 3OM9A 1V3UA 3E5MA 3M1LA 2NU9A 4ZN6A 1YO6A 4EEXA 5L4NA 2Q4EA 1E3SA 2J5QA 2V7PA 2X9NA 1Q2XA 3GT0A 1TB4A 5ILGA 1E6UA 5JDCC 4DLAA 2IXBA 3ZWAA 3SJUA 1AN9A 1C1XB 2I67A 5G2OA 3C1AA 2VOJA 1UAGA 4LRSB 2A94A 4WE3A 1E5LA 1QXSA 4IDEA 5U9CA 2B4QA 3OSUA 2FSVA 4MKZA 4XKJA 3TZQA 1SB8A 4EJ6A 4J91A 1B0AA 5DN9A 4ALKA 3O38A 1HYHA 2D1YA 4BKUA 3TF5A 1QYWA 5FWNA 5DOZA 1YWGO 3HDYA 4KTTE 3QW2A 2PD6A 4D79A 1PJCA 4PVCA 4RQUA 5IZCC 1EUCA 4B7UA 3RU7A 3PJFA 1W4ZA 3ST7A 3AM4A 4IZIA 1SAYA 2UYYA 5T67A 1A72A 3C7DB 4IY1A 2HRBA 1I32A 2BELA 4U5QA 3RUHA 3AOGA 3ONEA 4ZJUA 3E82A 1NFQA 3GC6A 4GVLA 5JPIA 3VKVA 1GL3A 3ASVA 1P0FA 2LDXA 1GYPA 4EI2A 3DZFA 1UDCA 3ZU2A 4BNVA 1JAXA 1GTMA 2PZKA 3SLKA 4J6FA 3KLMX 5TC4A 5TRTA 4B79A 1R66A 4DA9A 1T2AA 1QRRA 2EKQA 3V2HA 4ROSA 4CM4A 2CY0A 2XF8A 1X1EA 2NLOA 1IPEA 1PJ3A 3GNSA 3MJSA 3NT4A 1ZK4A 3H2SA 3FN4A 2QRJA 4WCFC 2ZCUA 5KJCA 2GCGA 1RWBA 4XQEA 1U8FO 2VYVA 3MWEB 4FJ2A 5DT9A 4B4UA 4BV8A 5T5QA 1W8DA 1YE3A 3JV7A 2B69A 2AQHA 1EDOA 3BHMA 4R1NA 7ADHA 3VPFA 3RBVA 4JBGA 1V35A 5BSHA 3WFJA 2X86A 1AHHA 4FB5A 4NR0A 1QKIA 4DLLA 4IZHA 3K96A 4PZCA 2FN7A 5I8WA 4BO1A 3WNQA 2OOSA 4UREA 1ZK3A 2H9IA 1X0XA 4N5MA 4IIUA 3UICA 4BO2A 1N1EA 4WCFA 2DM6A 5DCWA 3LC1O 4EGFA 2YW9A 1YONA 5U1PA 4CMKA 2FOIA 4NI5A 2W2LA 4KTVE 4FC6A 3EZLA 2D59A 3ONFA 1DFGA 4OXNA 1UP6A 5COBA 2UUOA 4CL3A 5JYFA 5ENDA 1XYGA 2RIRA 1LLQA 1RKXA 4BO6A 1JA9A 4AJNA 1ISIA 1GUYA 1K2WA 3DOOA 5THKA 1NVGA 1EFLA 1N7HA 1NFFA 5JAIA 4LISA 5JDIC 3GDFA 2I99A 3WGGA 5GMOA 3Q0EA 1A9YA 4IDDA 4PLFA 3G79A 3GMDA 2VNSA 3ICPA 3GRPA 3QJ5A 5JYAA 3AW9A 3G1UA 4F45A 1UUFA 5A4DA 3UXYA 5CAEA 3GPDG 1YL7A 1LI4A 4CM4B 1O6ZA 4ZQEA 5G4KB 4CUZA 1YQXA 2RBEA 4WECA 2X0RA 1BGVA 5EMHA 5A9TA 3BMOA 3DBLA 4L0QA 1H6BA 3GAZA 3ANNA 4ITUA 1ENOA 1NHGA 4CQMB 1XU7A 5LC1A 3KZVA 3LLSA 3ZW9A 1PTJA 4BIIA 1Z45A 2X9GA 4FD3A 1A5ZA 4FJ1A 3CEAA 4H15A 3PHHA 4EITA 2BD0A 3DMTC 5DBIA 2LDBA 4XB1A 4DPKA 5L7WA 5COAA 1UAYA 3FCOA 4KWHA 5EL0A 5FF9A 4XIYA 2IDZA 4IQGA 4LCJA 4UVDA 4BGUA 4W82A 3DZIA 1Q0QA 3ZV4A 3GRKA 3MJVA 3N74A 3PIIA 4XGNA 3SEFA 1P3DA 4CM8B 4CR8A 1J4AA 5HWSA 3JD2A 3UF0A 2PGLA 2Q1TA 5JMWA 1SC6A 3L07A 1TT5A 1JN0A 1LC3A 1MLDA 3E6AA 3OICA 3R3JA 5JFOA 3LZ6A 1O95A 3ZNOA 3TFOA 1H93A 2GSDA 2NTVA 1VL0A 3OHSX 4LMPA 4QXMA 4CLDA 4RORA 2PWZA 1VRWA 3H9UA 2FPGA 3KETA 5B1YA 2QHXA 1ULSA 3E1KA 4YVFA 1CQJA 3JQ9A 4CM9A 4U0JA 1MG5A 5A9SB 2PNFA 4M55A 4ALNA 1PS0A 3OJLA 4MP8A 2QYTA 3EVTA 1DHRA 4TKLA 3WMWA 2Y1EA 2EKLA 4JIGA 3ZWOA 4OXKA 1PX0A 1YRLA 1EBUA 1GYRA 1PQPA 1YJ8A 3NGLA 1B8PA 1EK6A 3BIOA 2VTDA 1ZSVA 4XB2A 1U7TA 2VHVA 5G4LA 2ZB3A 4NJOA 3MCVA 1VSUA 3DTTA 1R12A 3H6KA 2GNAA 5C7OO 3JYNA 4RVDA 1HE3A 3JQGB 1UZMA 1Z75A 3S1LA 1WP4A 3B70A 2J5RA 3WNVA 4CPDA 2ZCVA 2DT5A 3F6YA 5M6DA 3KVOA 4UUMA 4OYRA 4FC7A 1E6WA 4E21A 2NWQA 4J49A 3F1KA 4J0EA 1R4NA 2VZ8A 4CLHA 4FBGA 4RL6A 4DRYA 1ONOA 1N7GA 3G1TA 2C7VA 3N7UA 1S6YA 4XYBA 4MKRA 3AI1A 1T2CA 1ZK2A 3ZWVA 1FDUA 1ZZEA 3DBRB 3C24A 1W6UA 2ZQZA 2P9GA 4A03A 4BMVA 1I5RA 3K30A 4URFA 2DKNA 1ZFNA 1XHLA 1PS8A 2IYPA 3I6QA 4H7PA 5K6AA 4NBVA 1A7KA 2A4KA 2CD9A 1I2CA 5IN4A 4FFLA 4OKNA 3WLEA 3AUAA 4CLRB 3VC7A 2VQ3A 2J3HA 3ETDA 2O3UA 1R0LA 3ITDA 1YBMA 1JKFA 4PG8A 4GGOA 4TKMA 2ZB8A 3ZW8A 4JQCA 2YDYA 4O1MA 1WAMA 1FDSA 3TZHA 3L6EA 1DO8A 4B3IA 1T24A 2YUTA 4L4XA 5K6AC 1AHIA 3JD4A 4NDNE 4KWIA 1KVTA 3NGXA 2O7QA 3HQ4O 3L9XA 1R4NB 1T1SA 3FTNA 3KOUA 3O8QB 4LVUA 4QEDA 1GUFA 4F3YA 3GA0A 4WGGA 4IDFA 3DZGA 4BNUA 1UP4A 3H65A 4U7WA 1J5PA 2ZKLA 3DMYA 3ZHYA 3KB6A 2DFVA 3RC1A 2IZ1A 3NTQA 1E7QA 3FBGA 4IJWA 1DIHA 5DNAA 4WLOA 1DB3A 3CE6A 1HE5A 3QE3A 3H3JA 4JGBA 2PFGA 5EIOA 4NK5A 1ZVMA 4BNJA 5I9LA 3G49A 1WMAA 1XSEA 3D4OA 5HM8A 3O9ZA 3B20A 2BLLA 3W4KA 3DR3A 1ENZA 4ALLA 1UXGA 3PEFA 4PLCA 4JP3A 1OC4A 3OH8A 3N58A 4O5OA 3TN7A 4CLEA 4R1TA 4OIMA 3S2FA 1DRVA 1B16A 4E5YA 2EV9A 1JW9B 1ZCJA 2VRCA 4D7AA 4L4SA 1MB4A 1HE2A 4PZEA 3BZUA 4K6CA 2VRBA 4TQGA 2P4QA 4LRTB 1FDTA 3OIDA 4JJGA 5G4KA 3DO5A 1NP3A 2O3SA 3PRJA 4D41A 3L0DA 3D3WB 1HF3A 3RROA 3VPXA 1Y8RA 5L95A 1K6IA 2H63A 3PJDA 5L45A 2D4AA 2Z1MA 3D4NA 5JY6A 2A35A 5DCYA 3U62A 3ZGYA 1NFRA 3S2GA 2G17A 1QYDA 2Q49A 2E48A 3PGXA 5CPBA 2O3RA 4YJHB 2EW2A 2EF1A 4QO8A 1R37A 5B12A 3BA1A 2WYUA 2DBQA 2OBYA 1HE4A 5A04A 2XXBA 5IN5A 1QMGA 3GZNA 3TOZA 2O2YA 5G0SA 5EQFA 1BRMA 2H6EA 1KBZA 1PJQA 3RKRA 4D0RA 1KEVA 3F4LA 4OOFA 1IE3A 3FRJA 3QWFA 4Z9YA 3GK3A 2Q99A 2PKRA 4DQVA 3JTMA 3PWZA 3NT2A 1UJMA 1LLCA 3Q2IA 5DP1A 3PYLA 1HLPA 4NHEA 2YHIB 4FR5A 4XJSA 2GO1A 3AU9A 3A1NA 2Z5LA 3AUSA 2VHWA 4RLSA 4E5KA 1LUAA 2QX7A 4AJOA 2GZ3A 2Y68A 5A9SA 3ETEA 1GQQA 1L1FA 4HP8A 4TWRA 1P1HA 1TEHA 4JLWA 1HWYA 1HDCA 3GGGA 4G2NA 2A9FA 3SJ7A 1DC5A 4IM7A 5JXWA 1B8VA 6LDHA 5CDYA 5T8KA 3ZV6A 3CSDA 1Y8QB 5KKCA 5I7FA 3RC2A 4Q3AA 2I66A 4HBGA 4B3HA 3GF4A 3Q1LA 1ISJA 3Q9UA 5ITVA 4Y6RA 5MGBA 5JAMA 4OKIA 4B8ZA 2YDXA 1HL3A 5CP8A 4I9UA 5I9MA 4OOEA 3SLGA 4TVOA 3TZCA 3VPHA 1PL8A 1H9BA 2X5JO 1WLYA 1NPTO 4E3ZA 5K9ZA 1CQIA 5L51A 1B3BA 3ANMA 2HMUA 3AY3A 3LDHA 5L7TA 1WW8A 4BNWA 3L4BC 3GHYA 2EJWA 1K89A 5EESA 2CF5A 1KIFA 4BB6A 2I65A 3DHYA 1SMKA 3BMNB 2P5UA 3JQ8A 4CR6A 1LC0A 1M76A 4OAQA 2C7GA 4PFJA 4XR4A 3UN1A 1O89A 2WSBA 3DBRA 1JQBA 2NV6A 3I83A 1YL5A 2X0JA 4UEOA 4RPKA 3WB9A 4N5LA 4AJHA 3ZN2A 1ISMA 3HN2A 1X1TA 3QVSA 4EYEA 1E7WA 1Y5RA 2X4GA 3E8XA 4D3DA 4CV3A 5CDGA 3RJ5A 2AQKA 1GCUA 5KIAA 5TX7A 4AJPA 3IUPA 4B3JA 4CJXA 4CM5A 1K0UA 1OOEA 2DUUA 3EUWA 4UEJA 2PD3A 4OL9A 3BMOB 3DBLB 3RUIA 1Y9AA 4CQMA 1YS4A 1RYDA 3D5QA 2VTEA 3UW3A 4MPDA 4AG3A 4LMRA 5BT9A 3U3XA 1Z7EA 1BWSA 2AG8A 3UAGA 3ZHZA 1R0SA 2AG5A 3TL3A 3DZJA 1MV8A 2J6IA 3D4PA 3JQCA 1NWCA 3JQ8B 3MOIA 3T4XA 3AFNA 1GQYA 2X0IA 1JLLA 1XDWA 2GN8A 1UXHA 2G82A 3D1LA 4MIOA 3R3SA 1E3LA 3L4SO 2O2SA 5L3ZA 1YB4A 5MDHA 4ID9A 1GD1O 1TA4A 5FEUA 1U2GA 5KOIA 1I01A 1IHYA 1Q0LA 1YVEI 3DFZA 4PLYA 5FI5A 3NTRA 1EZ4A 3D64A 3GHHA 1HZJA 4RLHA 1TXGA 1LSJA 1HZZA 1NQTA 2Q46A 2RHCA 5JCJA 1O8CA 3PWSA 4PIVA 3PHIA 1XQ1A 2JAHA 1MXFA 1ARZA 3AK4A 4J4TA 4D3SA 3CIFA 2PKQO 4Q39A 5CFZA 2WM3A 4KUEA 1LDBA 2PY6A 3PP8A 4ND2A 4BNMA 2CZCA 2JHFA 3NRCA 4RF2A 2J3IA 3RSHA 3RUCA 2HMTA 3UCFA 5L9AA 2D0IA 2Y0CA 4Q3DA 4JK3A 1SNYA 3K73O 5C7IO 2FR1A 3QVOA 2W4QA 1SPXA 5AXDA 5TF4A 3GUYA 3PQFA 4W4TA 3PGJA 2YZ7A 4QUKA 2FHSA 2Y67A 5ER6A 3KV3O 1J6UA 5I7VA 3SVTA 4WCDA 1N2SA 2RHRA 2DBRA 2GYYA 2JJYA 4NK4A 1JVBA 1FXSA 1JWBB 5BR7A 4NFSA 4A7PA 2IODA 4BKQA 2IYOA 5GY7A 2JAPA 4Z9XA 2YQ4A 4DC1A 3V5NA 3OECA 3DAFA 1DSSG 1LDGA 1N5DA 4I5FA 3ZWBA 1F8FA 4II2A 5TJ9A 1P9LA 1BXGB 4WOKA 3GZNB 1KERA 2H1SA 4E32A 4J7XA 1BMDA 1B8UA 1GEEA 1E3WA 1NQOA 2FZEA 3OEWA 4ONEA 1U3TA 4XIJA 3U09A 4GQAA 2P68A 1KC1A 4KZPA 2FMUA 4DYDA 4LSMA 3GH3A 3OBBA 1B14A 3ICCA 1F0YA 4WKGA 2Y1GA 5JBIA 3ZWMA 2IE0A 5AVOA 2YHIA 2G0TA 3CH6A 2NVUA 4YBZA 1QV7A 1YB1A 5T8KC 1YKFA 4IMRA 6ADHA 1NBOA 3ZWWA 1WDKA 1U5CA 2EERA 3HN7A 1JKJA 4XGKA 3TZ6A 5B37A 4BKRA 3AUTA 1WDMA 3GFBA 1C1DB 4W7HA 1W0CA 1TVEA 3I52A 1E3EA 3DTYA 1EVZA 1LDMA 3WX0A 1VM6A 4DMMA 1XCBA 4UULA 3WIDA 1N1GA 3C1OA 4MKXA 4OJNA 8ADHA 3KRTA 3HSKA 3V1UA 4OSOA 3PYXA 1G0NA 1Y8QA 2Z95A 1EVYA 3E18A 3O4RA 5JAQA 4DVJA 2X23A 4Y6SA 3DOJA 1IULA 3JQDA 1CRWG 4CQMD 3PQDA 1J49A 5BSFA 3VDQA 1V3TA 3HHPA 2GN4A 4O0LA 1O9BA 1GUZA 1ZEMA 3TWOA 1KVRA 1ZSNA 1YJQA 1F06A 3FBTA 1CERA 3MJEA 2DAPA 1E1KA 1P44A 1ENYA 1EUDA 2W2KB 5FI3A 2V6FA 4YA6A 4IPTA 1NPYA 2YHUA 1H2BA 2WD8A 4PG5A 3H4VA 4BNIA 4CLRA 5HA5A 2ZB7A 4UVIA 3GEMA 4HX5A 5ICMA 2O48X 3I9MA 3E03A 3LT2A 3KEQA 1LQUA 2WD7A 1Y5MA 1GEGA 1DLIA 2XAAA 5A03A 3QQPA 3MWDB 3C85A 1LSUA 1WNTA 1I33A 2Y0EA 2VZ9A 1HTBA 3SC4A 3I23A 1T26A 3D5TA 1R4MA 2DTEA 4ZD6A 4GVXA 3GQVA 1V8BA 4NBTA 1HSOA 3EMKA 2OP0A 4M89A 4YWJA 1XKQA 3C7CB 4XJTA 3OEYA 4YRDA 5F21A 2VWPA 5G0WA 2UV8A 5ADHA 1O94A 4J9UE 4RZIA 1DC3A 4WLNA 4OHUA 1G1AA 3PDUA 4QT0A 2NVUB 1I3LA 1VL6A 4JXKA 2PZJA 4R9RA 3Q11A 2ZQYA 1Y8RB 2O4UX 3DONA 4E2WA 3BYZA 1LLDA 4GWGA 3JYQA 1LNQA 4MVJD 3V2GA 3GVXA 5DZSA 1X0VA 2VHYA 2E6UX 1E1LA 5IDQA 3W8EA 1FDVA 5CDUA 1Z7BA 1PQWA 1E92A 3WGYA 2H5LA 2P5YA 2NNLD 3FSRA 1UDBA 3NEPX 1ZO8A 4QO7A 4Y67A 5T64A 2AHRA 1VPDA 1C0IA 2VUSA 2WD7B 4IINA 2DFDA 3UGKA 2BGMA 2X58A 3F46A 3GAFA 2VT3A 2EHDA 1LRKA 4XX0A 1ZK0A 3ZV3A 2Y1DA 2Q4BA 3BMQB 3L6DA 1PJ4A 4GKVA 3HNPA 5BQFA 2I3AA 2OP1A 4YPOA 4YR9A 3BXXA 1E1MA 5CDSA 1NXQA 1A9ZA 2P9EA 4E2XA 2CUKA 4BO5A 4S3MA 1ZJZA 4MVJE 3NJ4A 2Q1SA 5JW6A 2VT2A 3NUGA 3UFXA 4YJHA 5FFFA 4UAGA 3C7AA 1LRLA 2HJSA 2EGHA 5IXYA 2EIHA 3PQEA 3QY9A 2IZ0A 1YOVA 2DUWA 4WASA 5L53A 4Z3DA 4I9NA 4JN6B 3ONDA 2Q22A 1V3VA 4CM6A 1EBFA 3I9JA 3GG9A 4KQWA 3TRIA 3WSVA 5KJEA 5TJHA 3MZ0A 1SEVA 4CM7A 5JS6A 3OETA 4NG5A 3RIHA 1H94A 1XGKA 2GN9A 5J9GA 1QV6A 3I4FA 3WFIA 1R4MB 5ES3A 4IJKA 1ISGA 3RC9A 4ZQFA 3WGQA 5CG1A 5C37A 1MXHA 2OMEA 4DQUA 1U4OA 2HSDA 5JO0A 4DC0A 5G0UA 1OI7A 2NACA 3EYWA 2NM0A 3KYCB 3WJ7A 1WXDA 2BH9A 5LDHA 3GGOA 5TQVA 1SBYA 2ZTMA 5T57A 2P9CA 4IIVA 3GR6A 4TZKA 1P0CA 1BHSA 1R0KA 1MX3A 4RDHA 1FMCA 3GGPA 4GH5A 3ROPA 4DGSA 2C07A 1YBVA 4RV9A 4NFHA 1LU9A 4YRBA 3WYEA 4GMFA 4J2HA 3FI9A 4HKTA 4UUPA 3PVZA 4ND4A 1IPFA 3FNGA 2CFCA 2Q2WA 3JYPA 3HB4X 4WOJA 3RFXA 4R01A 3JQBA 1AXEA 3KXDA 3M6IA 5DDIP 4TROA 1FDWA 1T2DA 2FPIA 1NASA 1Z82A 3CZMA 2YFQA 4XYGA 3GEDA 4BGIA 1KC3A 1XG5A 4Z6KA 3IP1A 4E4YA 5KVQA 1A4UA 1P1KA 2CVOA 1PZEA 3FHLA 2WJPA 2EW8A 2X5OA 2YV2A 3RAJA 1ZH8A 1EE9A 4MVJI 3AU8A 2PGDA 5F1OA 4XYLA 3ZWXA 2JFGA 4BNFA 5K0ZA 4LW8A 1C1DA 1E6EA 4JCOA 3D3EA 1GPDG 3MJ4A 1E7YA 4HXYA 2J3KA 4AJ4A 1OMOA 4FS3A 4MOWA 4PG4A 4B7CA 4CMEA 3U49A 4P22A 3F9IA 3RU9A 3VKUA 2HJRA 4CM3A 4DIOA 1OBFO 1ZEJA 3KLPX 4B7XA 3U4IA 4TSKA 1PJBA 3AWDA 5JMPA 3PK0A 1NTOA 4KUHA 3VZPA 3RQSA 4HFJA 2PA3A 3H7AA 2CMDA 3QSGA 2P4HX 4NNJA 3PWKA 3D3WA 1QLJA 3I5MA 2HMSA 2JD0A 5H83A 4K1LA 2VNAA 2VUTA 3PDJA 4FDAA 3GOHA 4FQ8A 3EGOA 2RAFA 1F17A 5CDTA 2W2KA 4LSWA 1IY8A 3QHAA 5JCJD 3DC2A 3ZNNA 1EEHA 3JQ9C 4JROA 1YDWA 3RCBA 5TNXA 4NU6A 4MVJP 4YT5A 2VOEA 4ZQBA 3X2FA 4PN3A 3K2BA 3OMLA 3ZU5A 1CETA 4OQZA 3OIFA 1GQ2A 4QECA 5JY1A 1QR6A 1HKUA 4AJJA 1L7EA 1QG6A 4IDGA 3AM5A 3MOGA 4EUEA 3LYLA 4WEQA 4AJ2A 1M6HA 4FPXA 4BKOA 2JFFA 3OQ6A 4IMPA 1A71A 2OBNA 3DEYX 3PYMA 2QIOA 3DZKA 1DHTA 3NDRA 1LDYA 3RASA 1WZEA 5HS6A 3ROKA 2GDZA 4XRGA 2E82A 2JD1A 2WE8A 3GLQA 4FSHA 4BNTA 4X54A 2NUAA 3IMFA 5DBFA 1R15A 4E33A 2EP7A 2BFPA 1X7GA 2UVDA 3KSDO 1GZ6A 2B35A 4IDAA 4HNGA 2I3GA 3TPCA 4YAIA 3WTCA 4HV4A 3FWNA 4L76A 4ZICA 3WQRA 3WR5A 3L6OO 1KVUA 3WDSA 1AGNA 1NVTA 4P4GA 4E5NA 3WGTA 3ZWCA 1X13A 5THQA 5CEFA 1B7GO 1H0KA 3ZNQA 4J3FA 1BDMA 4F6CA 3NJ8A 1JAYA 2EP5A 1Y81A 4YB8A 1PQUA 4NQZA 2V6MA 4XA8A 3KBOA 1D1TA 4XWYA 3QWIA 3U4CA 2B4TO 3JD3A 1PU2A 4GX1A 4H3VA 3ABIA 3SXPA 4BGVA 3FR8A 4AVYA 5I7SA 1NHWA 4YCAA 5ILOA 3OF2A 4IBOA 4KQXA 2WTBA 4K26A 1UXKA 3HUDA 3IC5A 3DXFA 3FD8A 3WG9A 2HUNA 5JCXA 2VWQA 4DLBA 2J3JA 5KJ6A 4IS2A 1LLUA 5IDWA 1XA0A 3MJTA 5CEJA 2GUGA 2HRZA 1XQ6A 3I6IA 4CM1A 1SEPA 4ALIA 5DBGA 1P1FA 2CVQA 1DAOA 2YQ5A 4RPJA 2HQ1A 3RUFA 4P4LA 4I5DA 4TMFA 1IZ0A 2GN6A 4Z0HO 4NH4A 3COSA 5CHEA 5A3VA 3PZRA 3WOHA 4PRLA 1E7MA 4XYMA 1D7OA 2C5EA 3BTOA 5KCZA 1DDOA 2HU2A 4D44A 4TRRA 2XPCA 2C59A 3QLJA 3HADA 4RF5A 3ZHXA 1RM5A 2O3JA 3QWAA 3MJCA 3WSWA 2QRLA 1P33A 1HDXA 2X7HA 3I9LA 3L4BA 4TRNA 2C2YA 4FW8A 3VPGA 1H6AA 4JJIA 1GZ4A 3FWZA 1I30A 2CDCA 4DPMA 3FNHA 1C0KA 4EDFA 1VC2A 2OFPA 2WWRA 2Q1WA 5JE8A 5H82A 1C14A 1U3UA 5JO9A 3ZHBA 4MVJF 1VJ1A 1E3JA 5B4TA 3FF4A 3OA2A 4OO3A 2R2GA 1PL7A 5CEEA 4A27A 4BNGA 4TZTA 4BO3A 3BTUA 1IUKA 3P5SA 3QV1A 4A2CA 4UVHA 2DQ4A 4CLOA 1CWUA 2PD4A 2X9VA 3T7EA 2EGGA 4GWKA 3UCEA 1DAPA 4A26A 1B2LA 2IEBA 3T7CA 4EJ0A 4MVJG 3HDHA 3U5TA 2Y1OA 3QA9A 4DBZA 2C82A 1N9GA 3B6ZA 3QVWA 4PGFA 2OO5A 1PEDA 1YQGA 4ZRNA 3DDNA 5A05A 5TS3A 1HXHA 4I5EA 1GADO 1Y9EA 3TOXA 1SCUA 2B83A 4M86A 4W9NC 2Q3EA 4CMAA 2GGSA 2C54A 1GYQA 2FP4A 3HE3A 2OXIA 4MP6A 2HCTA 5JYDA 3WBFA 3SX2A 1IZ9A 1ZNQO 2I76A 3JD1A 1NQAO 2OL4A 2CSUA 3R0IA 4KDFA 5A06A 4BB5A 5EERA 3LT1A 4BO7A 2D5AA 5LDGA 2Y93A 2CDBA 3DBHA 4NJMB 1IYZA 2Q2QA 3A28A 3JQ7B 4J16A 1KEWA 5HTOA 3JQ6A 1XU9A 3BMCB 4KP7A 4RVGA 4FIZA 1PJTA 3GMSA 4R9SA 4TRMA 2ZIZA 4HADA 4PLHA 4E13A 5TLSA 4FCCA 3ZI0A 2HO5A 4CLOB 5A3JA 4ESOA 3P7MA 4MINA 1ONNA 3K2EA 3SC6A 4P38A 1DIGA 1ZKMA 3AY7A 4BQRA 4BNYA 4CMEC 2BGLA 4R1UA 3NDJA 3JQBC 1I0ZA 4M1QA 2VRCD 4CM9D 3HJAA 3F3SA 3P2YA 2HMVA 3ADPA 1VKNA 3K31A 4J1TA 1P77A 4GLLA 3ETGA 3K5PA 2W2LD 3G17A 3O26A 4A10A 1ADFA 3H5NA 1ZK1A 1U8XX 1UXJA 4OSPA 4AJ1A 4GX0A 5BNFA 5GZ6A 2VYVD 2NVBA 2G1UA 3NTOA 3WYBA 4IDBA 2EXXA 3BMCA 4JBHA 1JVSA 3BMQA 3CMCO 5JC8A 2GF2A 2PH5A 4FGSA 4MDHA 3KM0A 4BNHA 1BXZA 4J1QA 1E7RA 2IRWA 4PVDA 4CMBA 1ZSYA 3QP9A 1PS9A 1UP7A 2ZTLA 4O6VA 1K6JA 3PFFA 3RUDA 1PGPA 4QTZA 3ORFA 3TSCA 4C4OA 5A1TA 1EDZA 4XQGA 3DFUA 3WJAA 2W8ZA 5ICSA 4AJIA 1XEAA 2BF7A 3CXRA 3WWYA 4CMHA 1PL6A 3U9LA 3DBHB 4RPHA 2O3QA 2O4CA 1DLJA 3Q6IA 3W4IA 3I1JA 3VZQA 4IQ8A 2QZ9A 1FK8A 2PLAA 4G81A 4FN4A 5T73A 4B8WA 9LDBA 2Y0DA 3QWHA 3AFMA 5TSDA 3TFQA 2P2SA 2AE2A 1GDHA 4MO2A 4JP2A 4CL8A 1ZXLA 1Q7CA 2JCYA 4RGBA 4D42A 1XELA 1Q0HA 1Z6ZA 3WYCA 2AQIA 1YDEA 1H2HA 1I36A 3PTZA 4R69A 4RPGA 1LSOA 4NPCA 1DJQA 3ROQA 2Z1NA 3LF1A 2FY8A 3FNEA 4Z0PA 3S2EA 2CVZA 2AMFA 2O50A 4WK6A 1DRUA 3M1AA 5TIIA 2WYWA 3GN1A 4W6ZA 2HK7A 1PWXA 5IJZA 1E1NA 2UUPA 4N54A 3EDMA 4I8XA 3I3OA 1RM4A 3VAZA 4ND3A 3RUAA 1NPDA 3E5RA 2AE1A 2ZJ0A 4TRJA 3C1TA 3RD5A 1ULUA 5EPOA 3ZNPA 8LDHA 3H9GA 2ZTUA 2EKPA 3WTBA 5L4SA 4MVJH 4GKBA 4CMJA 1BDBA 2HMWA 1WWKA 4OMUA 4J9VA 2UAGA 1D1SA 1PIWA 2OGUA 4M87A 4EEZA 3AM3A 1T4BA 4XEHA 4DWVA 4ALMA 3H3FA 4Y8VA 3KSZO 1HEUA 3ZWPA 2Q50A 4N7RA 4XZ3A 1BVUA 3WBBA 3C8MA 4HFRA 5I8ZA 5L7YA 3HWRA 1ML3A 2RH4A 4QX6A 1ZMOA 2D5CA 1LXCA 2FR8A 3DAGA 4Q3NA 1E7SA 3U4HA 1WDLA 4GSLA 4G65A 4R3NA 1LEHA 1GAEO 1RYEA 1MFZA 2D8AA 2VWHA 3DZBA 3VVBA 1DIRA 2B37A 4L8VA 4GX5A 3HDJA 4IDCA 4J43A 4L74A 3GDOA 3GNQA 3OJ0A 1DFHA 4R3WA 4P8RA 4HFMA 3HFGA 2FR0A 1N9GB 1C0PA 4DYVA 1X7HA 2ET6A 4R5MA 5L4LA 2WDZA 3GVIA 5HRUA 3EW7A 4FGWA 4UVGA 1PJSA 4J7CA 1EE2A 4K9DA 1PSDA 2A92A 2NVWA 5TT1A 4YT2A 1OFGA 2NTNA 3JSAA 5KVVA 4YRAA 4QQRA 2DTDA 1HLDA 1PJLA 3CZRA 3JYOA 1LRJA 2OUIA 4INAA 2X8LA 4C7JA 3GVHA 4KOAA 3RBXA 2DBVO 1QYVA 3LLVA 1QLHA 3S55A 1LDNA 2FZWA 3GUCA 3NKLA 4ZRMA 4YJGB 4E31A 2G5CA 4II3A 2WMDA 3GZ4A 4IGEA 4BNKA 3OFSA 4NJMA 2VHZA 1I3MA 5LCXA 3RWBA 4YXFA 1HT0A 1A4IA 1KY5A 3FPLA 3VPSA 4ILKA 2RH8A 3E9NA 2GD1O 1NR7A 2HAEA 3B1FA 3UCXA 3CKYA 1QP8A 1CF2O 2J5KA 4JNKA 4BMNA 5FYDA 3LVFO 3KYDA 1X7DA 1DPGA 5GZ1A 1GZ3A 2B5WA 4GSKA 2WE7A 2AXQA 1ID1A 1CJCA 2Y99A 3E9MA 2GASA 4RVHA 4EBFA 2D2IA 4DUPA 1E5QA 4BS9A 2DPGA 1PR9A 2DBZA 1BG6A 3G0OA 5KJFA 5IZ4A 3PHJA 4Q3BA 3H9QA 2HK8A 5AXCA 3PHLA 4BO4A 1E3IA 3FPCA 4PLVA 2J8ZA 4KMSA 2O3TA 4FFPA 5B4UA 1H6CA 1RPNA 4B4OA 2G76A 4XRRA 1JTVA 1GV0A 4UUOA 3IP3A 1HYGA 1H5QA 1VJTA 1LDEA 1DC4A 4R5HA 1CIVA 5KVSA 1MC4A 3GY0A 2F00A 5I9NA 1F12A 4YACA 2XXJA 3IJPA 2GZ1A 3IQDB 1PGOA 1UDAA 4K6FA 4UUNA 2YV3A 1R6DA 3W6ZA 4ZGWA 2YY7A 5IF3A 2X1HA 1CEQA 3STHA 3VZSA 3V2UA 2BFOA 3U0BA 1SO8A 3HZZA 4CV0A 3K92A 2PTGA 1QYCA 1DFIA 4PLZA 1Q1NA 4GAEA 3MTJA 3IOYA 4IGFA 4MVJA 2NADA 4XQ9A 4EJMA 3CTMA 1Y1PA 2O7SA 4DMLA 4YAGA 5G0VA 4YTEA 2I6TA 1YGYA 4FFNA 2VHXA 4L4RA 2ZYGA 5AQ1A 2ZB4A 1WPQA 4WLVA 3H9JA 1KEPA 3OA0A 5BNTA 3W8DA 3DHNA 2NU8A 3KEOA 1BW9A 3RJ9A 2O23A 4Q9NA 1GU7A 1BTOA 4WUVA 3WICA 5TT0A 1KOLA 2GPTA 2R6JA 1ZXBA 1Q7GA 1T25A 4R68A 4I1IA 5AOVA 2C20A 2EJVA 4R51A 3JD0A 3ZH2A 4PLGA 2UDPA 3UVEA 2E4AA 1PGNA 3PFWO 1NR1A 3H2ZA 2VCYA 3VHRA 2Y05A 2QZZA 2B4RO 3VTZA 2AW5A 2C29D 5ITWA 3OIGA 2CNBA 4YAEA 5GZ3A 3OQBA 4MJLA 2E49A 3OJOA 4J2OA 3QVTA 3ROMA 4PG7A 2IZZA 3PLNA 2IXAA 1XR3A 3K9QO 4PLPA 5DOVA 1O5IA 3RFTA 4CMCA 3L9WA 3DL2A 5DULA 2Q45A 3OJFA 4FFOA 3LK7A 4U6SA 3TJRA 1DIBA 4CV2A 3WQQA 1X15A 4IJVA 4NMHA 5F1KA 1EUZA 3M2PA 3RVDA 3VH4A 1LTHR 3PPIA 4K28A 2PZMA 4S1VA 4W9NA 4E2ZA 1PR3A 4BVAA 2SCUA 4IXWA 1ISFA 3JQAD 3NX4A 1I3NA 4B4VA 4YT8A 1E77A 1Y6JA 1I2ZA 4CLXA 2Y1CA 2PKQP 3V8BA 4P4NA 1LX6A 3UKOA 3BHIA 3WS7A 1DOHA 3JQ7A 1PJ2A 3OP4A 2JL1A 1K3TA 4YAJA 5J23A 3PZBA 3BMNA 1AXGA 3WMXA 3RC7A 1KVQA 5AXAA 1PZFA 3DBVO 2QYSA 1HSZA 3SBOA 1MG0A 4U0KA 4M8SA 1EVIA 1XWFA 3W6UA 2X22A 1XIVA 4RQTA 4DIBA 5JSFA 1GFSA 1U28A 5JC1A 1J0XO 1OZAA 4C7KA 2ZYAA 3K6JA 2POQX 1UZNA 1D3AA 4LK3A 2JKVA 5JNLA 1VLLA 2JD2A 4ZA2A 4A0SA 2R00A 3A4VA 1C0LA 1HDYA 4ZQHA 3ANLA 1B26A 3KYDB 4ZU3A 4U6QA 5C7LO 4Y6PA 3IS3A 2PZLA 2DTXA 5HBRA 1IB6A 3NT5A 1TLTA 4MIEA 3DHEA 3H8VA 4GGPA 2VZ0A 4DL9A 1KVSA 1Q7BA 3HFSA 2QQ5A 3I9NA 2VWGA 5H81A 3AI3A 3BHJA 3NV9A 1T4DA 4F46A 4TVBA 3AUUA 3TL2A 7MDHA 5C5IA 3ZU4A 2HKIA 2QW8A 3AOEC 1RM0A 3ZDFA 4NBRA 1GV1A 1YL6A 4XQCA 1NYTA 1ZJYA 2YV1A 4KDEA 1I2BA 3JQGA 4FJ0A 4BUCA 3ZWYA 4WEOA 4R4JA 4U8GA 3LU1A 4Z0TA 5TGDA 3RFVA 1QORA 3IJRA 4PRKA 4CMIB 3ZCXA 4YDRA 1E3WB 1IOLA 1B3RA 4RF3A 4BKPA 3PLRA 1SB9A 4MP3A 1MGOA 1M75A 4DBVO 4AL4A 3QVXA 3I4CA 3F5QA 5KNLA 2V65A 3WXBA 1HDZA 4R1SA 3V1YA 3G3EA 4BO0A 1DEHA 3UUWA 4IUYA 2GR9A 3ADOA 4XYEA 5DF1A 1I3KA 4J4BA 1A7AA 4E2YA 5JDIA 1N92A 3V1TC 4AJEA 1IHXA 1KETA 4OGWA 2B36A 3HG7A 3KUXA 3A14A 3U4DA 3KTDA 4O63O 3Q9NA 1U2DA 3JCZA 4BO8A 4E30A 3P2OA 3ZZNA 3I9KA 4E6PA 4WLUA 2OZPA 3A9WA 3BAZA 5KKAA 4E0BA 4DREA 2AEJA 4Q3EA 1NAIA 1ORRA 2OHXA 2BFAA 3IIEA 1LQTA 5DCUA 5G0TA 1BW9B 1UZLA 4RZHA 1ENPA 1M6WA 4CQLB 1NQ5A 1YXMA 1P1RA 1MC5A 1ADCA 3NDIA 4RVUA 3WQSB 2AA3A 1V0JA 1YB5A 1T2EA 3DWFA 3EZYA 1H6DA 4CMIA 4N5NA 2CDAA 1VSVA 3LT4A 3P19A 1U3VA 1T1RA 2ILTA 4ND1A 1KEUA 3S8MA 3C3XA 2BI8A 4OM8A 4WLEA 4BGEA 3EY4A 4FFMA 3ON5A 2PGJA 3F4BA 3GEGA 3DB2A 5IDXA 3PJGA 4EZBA 3IL2A 4GLOA 2EG9A 3RBZA 1MUUA 2Y66A 1Z74A 2IEDA 2QG4A 5BSEA 4R54A 1ZIDA 4CM8A 2FRDA 4A73A 1DC6A 3EAGA 3INGA 2Y1FA 4ZHSA 2YJZA 3WGIA 1U9JA 3S2IA 4RCVA 5EJ2A 1TT7A 1NAHA 3CMMA 1RJWA 3E48A 1RM3A 4ZVVA 2I5PO 1T2FA 1I10A 4D45A 5IZCA 4EW6A 5IFLA 1HETA 1BXKA 4JBIA 3NAQA 4BHTA 3GFGA 3VH1A 5HS4A 1ZMTA 4YJDA 3GVCA 2BKAA 1U7HA 1VJ0A 3R1IA 1U4SA 1S7CA 4F6LA 4RJTA 3RI3A 4CQLA 4D0SA 1EFKA 2YYYA 1IL0A 1AUPA 3WGZA 1E0DA 4PLWA 2VUUA 4XGIA 4YQYA 4LVCA 4YJFA 4OH1A 3QWBA 4PLTA 3F1LA 2WEKA 1SOWA 4LGVA 4L73A 1H9AA 2VYNA 4Z9FA 3W4JA 4WJZA 1JU9A 4W7IA 1WVGA 3KO8A 1EQUA 1P1IA 1P31A 1PGJA 1VKOA 4IQ0A 4LCEA 4ALJA 5B4VA 2V6BA 4E5MA 3IKTA 3VOSA 4XD2A 1MFPA 2EEZA 3JQFA 4GL4A 4YYZA 5AYVA 1XLTA 2BMAA 1YH3A 3AY6A 3M2TA 3WIEA 2BI7A 5IG2A 2ZK7A 1DJNA 1X14A 5F1PA 4M54A 2CF6A 1VE9A 3GDGA 4GBJA 5T6BA 4GMGA 1L7DA 5A5FA 2PR2A 3I9OA 4W99A 4NZ9A 3WGOA 1B15A 1LA2A 2DPHA 1N8KA 1NNUA 1KS9A 3UOGA 3K8ZA 2DU8A 4AJKA 3F47A 1JWAB 4D46A 4DXHA 4HUJA 1M66A 3ITKA 3NYWA 4Q3CA 1ISHA 5EINA 1NM5A 1HYEA 3VZRA 4HNHA 2RCYA 1MP0A 1NWHA 1P1JA 2AQ8A 4PCVA 4NIMA 2BGKA 1ADGA 2NU7A 4FFRA 4H16A 4RPLA 3OJEA 1EK5A 2JHGA 4XDZA 2DC1A 4Z3KA 2BFMA 1M2WA 4ND5A 2NQTA 4AICA 4I08A 3W8FA 5A9RA 2TMDA 1LBEA 2V6GA 3ENKA 3B1KA 1SZJG 2FPPA 3JQAA 4Y9DA 2X6TA 3GNTA 4IS3A 1HDOA 4RF4A 3RUEA 3TNLA 2DVMA 4DIFA 1D8AA 3UHAA 2GRAA 1EVJA 2C0CA 1C3VA 4CV1A 3IAHA 1DXYA 3O03A 2GZ2A 1EQ2A 4YT4A 4BNZA 1CYDA 2AEMA 4BNLA 1UR5A 4WLFA 4D43A 3DAPA 3ULKA 3BTSA 4RVFA 3VVCA 1HDGO 4WNCA 3VDRA 1PZGA 1M67A 4PZDA 2E37A 2HDHA 2C5AA 5KJ1A 1BVRA 3TDKA 1ZW1A 3IKVA 5F5NA 3LSYA 3Q2KA 3LT0A 3KYCA 2PK3A 4R16A 2ZYDA 1U5AA 4DQXA 3DMTA 3LC2O 4RO0A 3JYLA 3VTFA 3H5AA 3WLFA 2VN8A 1K5HA 2D3TA 5JLAA 1DRWA 4QFCA 3OQ1A 1OAAA 1ONPA 4KUGA 2B0JA 1JDJA 1V9LA 4HWKA 3BTVA 2C2XA 3HDQA 3R6DA 5IXSA 5IAAA 3H9EO 4YAKA 1BSVA 3PI7A 3PJEA 3PHGA 4HY3A 4BQPA 3FR7A 1YOVB 1F14A 1WMBA 3B1JA 2XOXA 4DTIA 3JQAB 4FOOA 3KHUA 3H5RA 4BL5A 2Q2VA 3TQHA 3ASUA 1GPJA 1P45A 4LN1A 3KSUA 4NBUA 3FNFA 3INTA 3EVNA 3MTGA 3WWZA 1KYQA 2X0NA 4CUKA 4QSMA 4CR7A 5F3RA 1WZIA 4D3FA 3WGHA 1FF9A 2ZATA 3LF2A 4E12A 1A27A 1HDRA 3QIVA 1YQDA 1I8TA 2GERA 4ZQGA 4UVEA 3GG2A 1QSGA 3IDSA 1R16A 3L77A 5COQA 1KY4A 4MVJM 1PZHA 1VI2A 2PH3A 5C3MA 3GVPA 1CDOA 4OQYA 3W1VA 5KWEA 3AOEA 4L9RA 1ZBQA 4XR9A 1V6AA 4BO9A 1ADBA 1QYXA 3AJRA 4YQZA 3ZV5A 1W73A 1U1IA 4QFDA 5DP2A 1G6KA 4J0FA 3EHEA 1HRDA
chains in the Genus database with same CATH superfamily
4ND6A 4B3SB 1SUWA 3G0IA 4KZKA 3IP7A 2AFHA 5JI2E 1LPAB 1A2BA 3OCCA 1L7PA 4D6XA 2PR7A 3BRWD 3D6NB 3OBIA 4JAVC 4D9IA 2JCXA 2PQ2A 1Q0SA 3L79A 1XFDA 4IIHA 1SUCA 2WYOA 4N18A 4P36A 4HVLA 5C46F 1T5SA 4RFSB 5IAGA 3N6RA 2GAFA 4YRNA 1CCWA 4ESHA 1LLFA 3N2GA 1Z5OA 4WY5A 4D96A 1NMXA 1TMKA 1LQ2A 3HYRA 4CKCA 4WCFB 5AM3A 1W7AA 4WNIA 2KYRA 4RZSA 3TIFA 2QTHA 2OA0A 1NL3A 5EHIA 4C2TA 4CFSA 4OATA 3FZEA 2FYTA 3HB1A 4EUFA 2B34A 5HJ2A 3JZAA 4PG6A 1X19A 4RTQA 4C14A 1QP7A 2PV7A 5BV1A 3UUFA 4YK7A 2MYNA 3E9QA 5CCXA 1Z73A 3RR2A 5A7FA 3R9XA 4C20A 1C9JA 4L0MA 4FOSA 5EJ6A 3ZXUB 4B82A 3DM9B 3T3GA 4QXOA 4R81A 3PPYA 2W9XA 2JLVA 4BJHB 1N0WA 1WMDA 2QUHA 5EP1A 3A05A 2GLXA 3OPYI 4MA4A 5ALNA 5HEKA 3PEYA 2YVUA 1FNBA 2PRJA 2FSSA 1I0IA 3NHJA 1LPBB 4GPD1 4IH1A 5CA1F 3OX2A 3L2OB 3O8QA 5CDHA 4HAUA 2W2VA 1F8GA 4KB5A 1FFHA 1PG0A 1M6EX 2NTJA 5T41A 3NC0C 4MW4A 3SYRA 1RE1A 2BOVA 1PVDA 2Z83A 5DGXA 4BMOB 1B0PA 2XDAA 4QICA 4EPVA 3TQOA 5CAEB 1Y3FE 4WIAA 1MOSA 2JFHA 3WP0A 1R8QA 3EAFA 1P74A 3GGSA 2NU9B 2O5VA 3HEMA 2C95A 3S68A 2HF8A 2G9RA 5DI3B 3P1JA 2GQ0A 3LX8A 5SICE 3B78A 4D0GA 4F1KA 2E55A 4G5HA 3Q8WA 5IUKC 3EXHA 4H18A 1JR3E 4OXYA 3CWZA 1E96A 1A96A 1GU0A 1VDMA 2I80A 3KKQA 1F2VA 1FUEA 3DF7A 1H3NA 3JAWB 4U7FA 2Q4TA 3BF7A 2ZFUA 5AXBA 1YS1X 3CKMA 3I34X 4EB0A 1GQOA 1URPA 2PIAA 3ESQA 1MX1A 5I7EA 1GVNB 3I1FA 3EZGA 3DQPA 1OBVA 2XTNA 4JX8A 3M9LA 4G0XA 1NIPA 2W42A 2C2GA 4BOYA 4XIIA 1QOPB 1ZH0A 5LB2A 3ILSA 5KTKA 2BF4A 1LK0A 4DJFC 2WYVA 3WIUA 1IG3A 4QUEA 1YBAA 4QUHA 2OXTA 2IGBA 1GR0A 2F4NA 1N0UA 2ZJ1A 2QV7A 3EVFA 1MW9X 2XEXA 4EG1A 5K3OA 2Q0HA 2ZVDA 1MQ8B 4C06A 1ORVA 2JIOA 3PEWA 5HOEA 1P2SA 2V0GA 1BE1A 1JAZA 1OC2A 1W0KA 3KYBA 2PAFA 2BMEA 5KVCA 4AFNA 3ZIDA 3PIDA 5E2AA 2DLDA 5DNWA 5G1OA 3LUBA 1P8JA 3F6SA 1IBMB 3RHZA 1VE3A 1O0SA 2VK1A 3RK1A 4G0ZA 4ZCPA 1DO2A 3ZE8A 3G13A 1V3UA 2H8KA 2PH7A 2F59A 2NO4A 2W48A 2Z8YA 4EY3A 1J99A 1YO6A 4HWTA 3KKEA 2ZCJA 3V7NA 1L5YA 4AY3A 5F9MA 4Y9RA 2XUGA 5K8TA 4C04A 5E1OA 2I2AA 1DKRA 2IV7A 2BM1A 2Y27A 3ZWAA 4RGVA 2I67A 3Q8KA 3C1AA 3EPRA 1AGRA 4WZBB 1VSBA 2JJMA 3HR4A 2V7XA 2H1OA 3F7OA 3A2MA 2WUGA 3KJEA 2GEVA 1Q50A 3EFEA 3G9XA 4LMBA 3KR1A 4IDEA 3OE5A 2B4QA 2HLDD 2FSVA 3TPFA 5D51S 1RQ7A 5U9CA 3U09A 4HXFB 1TADA 3DXXA 2JLZA 4IIBA 3BXEA 4ALKA 4CVNA 3Q3EA 4PPQA 4Q24A 5FWNA 3WAJA 1G8KA 3DKVA 3TS1A 1YWGO 3QW2A 1SCJA 1MEJA 1MT0A 2PD6A 3VHXA 5IZCC 3ANSA 3OZRA 1QLWA 4W5HA 3UJ7A 1K8RA 4FK8A 1XKXA 3AM4A 4IZIA 4RYLA 4U2KA 4K0RA 4RKFA 3W5IA 5FOWA 1JEJA 2ZT5A 5T67A 3MWDA 4JKOA 3SS9X 1NC3A 1SC1A 1Q14A 1VHTA 2HRBA 2O8FA 3NPAA 4CTJA 4Q4JB 4ZCIA 3AOGA 4ZJUA 5JFTA 1NFQA 3TCNA 1T9AA 5JPIA 1GL3A 1CUWA 1P0FA 3ASVA 4CKBA 2OQVA 5JH7A 4ZYYA 3VR1A 2GVNA 2SBTA 3ZU2A 3EPBB 2PZKA 3O74A 3KLMX 4GZ6A 5TR9A 2JLWA 1YS7A 2I7XA 2IHVA 2QW1A 5DCLA 5EG5A 4CM4A 2OHJA 2ZJ4A 5KNCH 2XH8A 1PJ3A 4HDCA 5A1JA 1RNLA 2FG6C 3KUUA 1ZK4A 3MUFA 4AU1A 1NLYA 2M6LA 4AN0A 4R7TA 3N7TA 1L7OA 1NIJA 1PEYA 1QNLA 5JHHB 1QO7A 1LBQA 3L1KA 2F9MA 3DE7X 2QL7A 4NFLA 4NZNA 3RIYA 2VYVA 4R98A 5INTA 3O3OB 2E6KA 5CRIA 1W8DA 2B1GA 1US8A 3EPPA 3HVIA 2AQHA 2R8XA 4CDNA 4E70A 1SG0A 1YZQA 2PGOA 5BSHA 4NR0A 4BUZA 5KBYA 4NXNB 4PZUA 1QKIA 4Z1OA 1M1YB 3UMFA 9ABPA 1VIYA 4UOZA 3H2GA 1RXEA 1NW4A 1RYHA 2A9JA 3DE3X 4LWPA 4EA9A 5KDOA 3RM3A 2X41A 3VC1A 3LP6A 3WNQA 4BO1A 4IWNA 2C31A 3ZE1B 2PJDA 1OLXA 2ATXA 1KDRA 4HZIA 3M82A 3ABOB 4IIUA 1V95A 4BO2A 5AO9A 3ID6C 4EF6A 5JZ9A 1ESEA 5DCWA 4EGFA 5U1PA 1GL6A 3ITEA 4CMKA 1KH1A 2XUJA 4MMXB 4X63A 1MBZA 4KN6A 5TB5A 1OI3A 4NE9A 2W2LA 1T0HB 2VQ6A 4KTVE 2HV8A 3EZLA 4QFMA 4BVKA 3REOA 5JZOA 5KYXB 3BREA 1SCNE 2GB4A 3GEPA 2XADA 4CL3A 1V5IA 3OPVA 5JYFA 4EOGA 3FLEA 4HC4A 1LWOA 4YMTA 1IM5A 3I5AA 5KYUA 3LV8A 3PITA 4R05A 2MJLA 2Z9BA 1ISIA 1GUYA 4ZVMA 4F6RB 1AK2A 3F96A 3HO1A 3DOOA 1QZUA 4QBIA 1L8OA 5AKZA 3WA7A 4DDUA 2QTFA 1TJ3A 1N7HA 1C1HA 1RPTA 4NV0A 5DX8A 3WWDA 5HXAA 1RAHA 2VPWA 3GXBA 4UZEA 4P81A 3CLRC 4KEAA 1OV4A 3WGGA 5JDIC 4E08A 3KG2A 1HL7A 3R4VA 1HOTA 3C3KA 5GMOA 3PXBA 4PLFA 4Q0MA 3ZGZA 3G79A 1U7UA 1ZMXA 4GXQA 2X8JA 2QPOA 4HDAA 4DIKA 2OHHA 2V1UA 2A5JA 2I2BA 3ICEA 1UUFA 4YCSA 3F98A 1S1MA 1NVEA 4CM4B 4WESA 5DIZA 1ZONA 2YJ5A 4NEGA 4CUZA 1NQUA 4NYMQ 2RBEA 2BKVA 4KK3A 3WV5A 4D9KA 3DBLA 1LPNA 4L0QA 1R0ZA 3AINA 4M9UA 3R20A 3THSA 2X0DA 4WXEA 1GUDA 3VSCA 4BJ3A 2OHOA 3BWMA 3DXYA 1JDSA 1XU7A 2WJJA 1EI9A 5LC1A 2FFQA 3I3SR 2P9BA 2EZTA 1WZUA 4BRUA 4BP8A 1UADA 3DZ6B 4R7ZA 4FJ1A 1A5ZA 3CEAA 1RI2A 3ZGNA 1V1RB 1EFRA 3BSWA 1N2XA 2EATA 5JHGB 4PAOA 3MTDA 3QW4B 1UAYA 1F2DA 2WHQA 2IQ5A 4YCCA 5EE3A 2YZNA 4KI0A 4XTRA 1KI1A 1KHHA 4MA0A 4MWEA 4LCJA 4KACA 4BGUA 2P7IA 3FMOB 1OLSB 3X1MA 5TEVA 2QTAA 1KKMA 1NJ1A 2GKSA 2Y2UA 1G9SA 2XVXA 3ZV4A 2A86A 4IV8A 1E9RA 2CYAA 3MJVA 3PIIA 5CDFE 2GTIA 4QUAA 1WVMA 4P3OA 1JWLA 5HWSA 3HRHA 3P9ZA 3HA3A 1Y34E 3JD2A 3QG1A 3STVA 1ZI8A 5ERGB 1OTXA 5A3RA 2IOYA 2Q1TA 4FHDA 3V8RA 1H9CA 3THYA 1FTQA 3L07A 3MWFA 4Q9AA 2NV2B 3E6AA 4S1OA 3TFOA 4DRZA 3LZ6A 4ZTUB 4MRPA 3FFXA 4C3OB 1A8QA 5JD6A 1IM2A 1TM7E 5A0TA 1VL0A 1BDIA 1TFUA 3I62A 1D0VA 4TSRA 1RXIA 5KYGA 2XWJI 4QXMA 3NXKA 1MTOA 4RORA 5DN6D 2BTEA 1D4ZA 3F8WA 3VKHA 1VA5A 3QLVA 3T9BA 1OVGA 3FDZB 3ZQ6A 1ULSA 5KNCA 1SVKA 2P5SA 2QRPA 1OYWA 4YVFA 3KEFA 2J32A 1SJ9A 1F8XA 4U0JA 5AVQA 2ACVA 2W58A 3KPJA 4WFJA 1X80A 3C6BA 4KIUA 4PQFA 4NZMA 2LNDA 4MP8A 4PQRA 1ZOOA 1V1RA 2OCBA 4TKLA 1HH4A 1VI5A 5HJEA 3RABA 3M5PA 4F5ZA 3WMWA 3RYFB 1QZXA 2W0SA 1M54A 4JBXA 2N75A 3TB6A 3WKBA 1KP3A 2RI1A 2Y1EA 3N2KA 2HHLA 3BGIA 2BGTA 3V7UA 3ZK9A 5J1SB 2Z2XA 3BL5A 2HA3A 4OXKA 4MQ4A 1EBUA 3ZYCA 5B1EA 3K0FB 2H1CA 1VHWA 4C07A 3NGLA 2GK7A 5F78A 4TM8A 1CZOA 3CZ5A 2VTDA 5JQGB 4HNSA 4DLWA 4N40A 3DT9A 1NVWQ 4Z4IA 3ERCA 4XB2A 2O57A 1QHNA 1A82A 1S96A 3DTTA 4RVDA 1P1BA 4IJ5A 5D5HA 1HE3A 4WNYA 3S1LA 3B70A 4CPDA 4B8YA 5M6DA 1PV4A 2HDWA 1U0EA 4R0NA 4FC7A 4FT2A 5AWFC 3OUTA 4ZXFA 2OK7A 4J49A 4E21A 4F4UA 5TS2A 4MAFA 1EFDN 1U99A 1YASA 1AX9A 3F1KA 4V1CA 4JODA 4CLHA 2NZJA 4RL6A 3HCDA 1SC3A 4U3JA 1ONOA 4RAQA 5E7IA 1N7GA 3G1TA 3U4MA 2J0EA 2C9OA 5AHXA 4XYBA 4MKRA 3WRYA 3IIJA 1T2CA 4C87A 4DV3B 4TLLB 2VPXA 3ASYA 1VL5A 4RS4A 1ZZEA 5GONB 2HGZA 2JB9A 4UBIA 3U9TA 2PKEA 4AP6A 3GEBA 4BMVA 2I87A 2DKNA 2CNLA 1J9GA 1EP9A 2QQEA 2VSXA 4JUAA 1J2TA 1X9GA 1PS8A 2IYPA 5K0SA 5JJIA 3HGQA 2GO7A 2ZRKA 3KKPA 4BZPA 1VG8A 2ILVA 2RGBA 3HO8A 3DMDA 4LPKA 5DSTA 3FZGA 4K87A 2A4KA 2CD9A 2EQ5A 5SY6A 2IEGA 3REQA 1J39A 3T5AA 3THYB 1UDXA 3MFQA 1N32B 4M98A 4LUCA 4N0PA 4LC0A 4MGKR 1AKRA 3SYLA 3DNFA 5ALPA 1XTRA 2IHJA 2P35A 3WLJA 1M8PA 2CK3D 4HEQA 3UMMA 4HGPA 3RBAA 3QKSA 4FFBB 4UDXX 1SHKA 3LGXA 1PT9A 1NF2A 3PPVA 1TU4A 1H8EA 4B35A 1YBMA 2C7BA 2PWYA 1L5QA 3UY4A 3W2HA 3ZW8A 1NV8A 4DLZA 4ZDWA 2VLIA 4OX9B 2P0EA 2YYAA 3UO8B 2WQ7A 4KRYA 2PBZA 2W93A 1DO8A 4B3IA 5CB6A 1T24A 4A8JA 4A23A 1AHIA 4QLBA 3BH7A 1EA7A 4NDNE 3DUWA 1GKUB 2GXUA 2YWRA 3NGXA 1NXOA 2L42A 2W2NA 3BGOS 3HGMA 3KQVA 3QF4A 2GWRA 2P4SA 1AKTA 4WXRA 5J5AA 4EVRA 4LVUA 4QEDA 1UFRA 4JS0A 4F3YA 4HAYA 4WGGA 4AKEA 3V4SA 3EHDA 3DZGA 4IDFA 2PUDA 4QM6A 1WZCA 3H65A 1J5PA 2ZKLA 1NBMA 3EVDA 3ZHYA 4ZI7A 2CNOA 1AC5A 1G8GA 1ZXXA 4P92A 4HB2A 4A8HA 1V16A 3NVDA 4HEA6 3U7IA 1G8HA 3FBGA 3O8OA 1UPXA 5ALXA 1DIHA 2WFLB 3LMKA 1DB3A 2X2FA 3CE6A 2GFIA 3QEBZ 1V43A 2J9XB 4L8WB 3S2SA 3AM1A 1S3IA 4GI7A 1VE5A 3D4OA 3Q3GE 3L0BA 4O2LA 5F7OA 5HM8A 3B20A 1HYBA 1JDPA 3O3CA 4J0QA 5HF8A 3WLRA 1UXGA 2W0MA 2HT6A 3URKA 4BQOA 2Y2VA 4PLCA 3TN7A 1OC4A 2C3PA 5LLTA 1NY5A 5BXQC 4EP1A 3MXOA 3QKSB 1DRVA 4G1FA 4GDMA 2P1DA 2EV9A 3EEOA 2YN4A 5DNYB 3BGVA 3MBOA 1S2LA 5LB4A 1MB4A 4PZEA 3E3LA 3BZUA 1HG0A 2VRBA 4TQGA 1S01A 4IH4A 2D8MA 2IDMA 3D3KA 4JQSA 5EXSA 1A5BB 4M0LA 4EG3A 3TG2A 1O08A 1JYEA 1KDTA 2BT4A 2NU6B 3GV0A 3KQOA 5JJ5A 1NUTA 3MSXA 1HMPA 4CM8A 4YREA 4OX9Y 1R3UA 1TD9A 2R66A 1Y8RA 3FOBA 4LXYA 5BQ3A 2JLRA 2H63A 2B1RA 5JARA 3ZQ4A 3PUYA 3EPHA 5L45A 3O8DA 2D4AA 5DCYA 3UT0A 2A9PA 4I19A 4UDYX 3ZZMA 3CVYA 3ZGYA 2VP9A 2WWIA 3LA6A 2F2TA 1EG2A 1M1XB 1BHQ1 4ZV7A 5CPBA 5KOHA 4YJHB 3GPLA 2QORA 2ZRGA 1CE8A 2H4WA 1LI5A 4LXUA 3VI3B 3X43A 3ZCUA 5BWCA 5ALWA 2ZS7A 1V4BA 2P9HA 2QTMA 2CHUA 3CLUC 3GWGA 1PTKA 5HMLA 4BFXA 2CD7A 1HE4A 5A04A 1JX6A 4YHHB 4JI4B 1Q6ZA 4ED9A 3IAXA 1MHPA 1CUHA 3O92A 1Y4DE 2PHZA 1OYYA 2TECE 2H6EA 4MB2A 5EQFA 4KNWA 1VE6A 4ZT2A 3RKRA 4ZHQA 1WIWA 2ZUVA 2YTZA 3CSSA 3LWDA 2VP2A 3D0QA 3GK3A 2PKRA 1OQAA 2CXNA 1VYUA 1DELA 4U7PB 3PWZA 2JPDA 4M60A 4ZT5A 4LF8B 1KI8A 4C0WA 1NI3A 1SD5A 1D6SA 4TTJA 3AHCA 1RVDA 3Q2IA 5I45A 2YNMA 1RWNA 4XJSA 2GO1A 4MQMA 2HYIC 5K6RA 3AUSA 4RLSA 4E5KA 3UW1A 3I05A 4AJOA 5JAHA 5JROA 3O73A 3BDAA 2Y68A 1GL9B 1GA1A 1PUXA 1T5LA 3WLKX 1GQQA 1L1FA 3GRRA 3FZYA 4F56A 2IZ6A 4CEIB 1HDCA 1TK9A 5C8YF 3PGA1 2A9FA 2P6NA 3SJ7A 4EJSA 3VYRB 1ZZGA 5AW1A 3FHJA 1DQYA 2HF7A 2P9YA 4IM7A 2I6FA 3LIPA 1B8VA 6LDHA 5CDYA 1CG6A 2RONA 4Z3OA 3HY3A 4JT9A 1GTSA 1KGSA 3GDWA 3NFYA 3H2KA 1I7PA 3RC2A 3OZGA 2VT6A 1PSZA 1ZNXA 2BGRA 4HBGA 4A0FA 5B7GA 1T0PA 2VHCA 1K98A 3K0SA 3PGLA 3N8HA 5LQSA 2DHEA 3E35A 5DSZA 1K7SN 1I9GA 3M34A 4M0PA 2PJUA 3A4NA 3SLGA 3OT5A 1XRLA 1CS0B 2KSQA 4TVOA 5JPCA 3R74A 2OD9A 2CXHA 3G7SA 3H9BA 3GJ3A 3JAKA 1Q91A 4G01B 1PL8A 1H9BA 2X5JO 1GKYA 1NPTO 1R4ZA 1WLYA 4M0CA 2D7DA 1J21A 1CQIA 2XHEA 3ANMA 5K3BA 3WLAA 1MPXA 4A8JC 4ZCTA 4ZYZA 4IWXA 4M1EA 4RD6A 4BNWA 1NBMD 1PR4A 3GHYA 3HCBA 1X94A 2CF5A 5TQ0B 3DWIA 4QTYA 1SWWA 4BB6A 2I65A 4JUBA 3I64A 4S1WA 4EW1A 1I79B 4R6WA 1NF8A 3NALA 5ALKA 4KN8A 4MRMA 5FO1A 4CR6A 3HCAA 1YDHA 1AF4A 1EJ6A 4B81A 2EX0A 4OK5A 3A04A 3KWLA 2VZEA 5J2TF 1GKLA 4X6LA 4RK7A 2NV6A 2ZYSA 2X0JA 2BGIA 4C6TA 3CT4A 4QEKA 4AJHA 3UHOA 3THRA 2H57A 3AONB 3B85A 4DMRA 1XD8A 5LIPA 3QVSA 5AHKA 5TVKA 5DNVA 1NJ6A 4DAOA 1U9YA 4FNGA 4CV3A 2A33A 4D3DA 5CDGA 1EDDA 2HJVA 4NYJQ 5FUXA 3ROXA 5TX7A 2ZRJA 3QHQA 4KQ9A 3EG9B 1YDMA 4O2BA 1JHUA 4CM5A 2SKDA 4CF4A 2GM3A 3LTEA 1MOPA 1JHQA 2HJWA 3PXCX 2VJPA 1RJDA 5JNWA 3BMOB 4G0WA 1INLA 1BROA 2CLEB 2OO5C 3H4MA 1Y9AA 4JHXA 3LC0A 5AHWA 2HNKA 4FHEA 1OU0A 1CV2A 2H4HA 4CQMA 1KI9A 4Y9UA 4MPDA 4AG3A 4LMRA 1BJTA 1EJ2A 2GUWA 2PMCA 4C5BA 1GTRA 5LA6B 4CEIA 3SYMA 3R23A 5HE9A 1THZA 1L5HA 5IBRA 1SBIA 1F4PA 2AWNA 2OY0A 3ZHZA 5LZ5A 3SKXA 4CBVA 2CWWA 3AF0A 1C2YA 2BZ1A 2FKNA 1PR5A 5IWAB 3D4PA 1GQRA 3JQ8B 4JLUA 4PZ0A 2V3VA 1UPTA 4Q9HA 1X1QA 1XDWA 3PNBA 4D8TA 1FJXA 3EX7C 2AXNA 2G71A 3R3SA 1FOEB 3L4SO 2BEVA 2O2SA 3K9GA 1KP9A 1YB4A 4HDNB 5MDHA 3O4HA 4R2MA 1OIVA 2R7LA 1L4GA 1U2GA 2O0LA 1VG9B 4GRIA 1CJUC 1CNMA 2O0HA 2WIJA 3DFZA 3EVCA 3LQ1A 4BTLA 1YR8A 3JVIA 2HF2A 1NQTA 2Q46A 2EGUA 5JCJA 4B71A 3IBGA 5J3JA 1OX6A 3GJ6A 1VKJA 4DR5B 2ID8A 4O4LB 4TT8A 2OT3B 3QU7A 4HVAA 3AK4A 3CKKA 2PKQO 5CFZA 2VDOB 4IMJB 3U6BA 2OFWA 4KUEA 4TTVA 2PY6A 1M0EA 5JQWA 1YZGA 1GFZA 1L4LA 2JHFA 4GD3Q 2J3IA 3N76A 3RUCA 3TLBA 2HMTA 4GWLA 2G0AA 2XCIA 2YWCA 4JBLA 2BN4A 4QPZA 2Y0CA 1PX2A 4B6JA 3LSTA 1AO0A 2HBRA 1SPXA 4KRFA 1N2BA 3GUYA 3PQFA 5F7ZA 3IDOA 3KQPA 3PGJA 1F2UA 2YZ7A 4QUKA 2FHSA 4B7AA 2B94A 3SVTA 1T6XA 3C3BA 3R0JA 5AM4A 3V9AA 3X1JA 4D4HA 3BFVA 3ECSA 2JJYA 2WHEA 4O2AF 1JWBB 1SG9A 3MCZA 4PBTA 5CHYA 5BR7A 5HZHA 3R24A 1O97D 5FNVF 2EJCA 5KSOA 2PUAA 2JAPA 2AD5A 2DQYA 1XQVA 3OD5A 1RWOA 3KLNA 4P3KA 5KTOA 3VMFA 1YR7A 1E8MA 2OCDA 3CKLA 1YVUA 1WNFA 1DSSG 1LDGA 1N5DA 1XRPA 4ZKEA 4IIEA 2ZI4A 2PT9A 1NQXA 1P9LA 5JXGA 1SRRA 3AZQA 4WOKA 1T9ZA 1ISPA 5AI0A 4ACBA 1U2GC 1DUSA 3ZE9A 4KODA 3K8QA 2QMUA 2Q1XA 2MDTA 1ZD3A 2ISCA 3RANA 1RADA 2ZIAA 3C8ZA 4OL0A 2FQQA 4GQAA 2P68A 3ILVA 3CJQA 1EKXA 3GA7A 2FMUA 3AXTA 3T0GA 3VKFA 3CZ9A 3HV0A 1J0EA 1FTYA 2W2OA 3KD3A 1F0YA 4LCBA 4ASUA 5K0LA 2Y1GA 1CZUA 4TLMB 4K9KA 1EX1A 4U8HA 3ZVKA 1X38A 1N3BA 2DR2A 1N0HA 2YHIA 1GSHA 4PSVA 3CH6A 1ACMA 3UG7A 1J07A 4ABTA 2NVUA 2WABA 4B34A 3TFWA 3SQDA 4C29A 3MGCA 4QEZA 4IHAA 5BR1A 2B2CA 3LBHA 1UQUA 1Q0UA 1R27A 4IMRA 2R6ZA 1NBOA 3LHFA 1OXBB 1CUUA 1F2UB 1T35A 1TCCA 4YXWA 4MV3A 2XZLA 3IEMA 4JOSA 2VVTA 3E7PA 4XGKA 1N2JA 3QVMA 2E4VA 2OAEA 5B37A 3WDKA 4ZYVA 2YIDA 1QONA 1RWMA 1WDMA 4NHOA 3ICOA 5F7XA 2L19A 1GTG1 5KYWA 3WX0A 3FJOA 2XB2A 2YQZA 1CZHA 3CT6A 1XCBA 3LL4A 3B7PA 3TK1A 3TCKA 4RK4A 5IVKA 3V4FA 5JU6A 5AVKA 2R6R1 2VXCA 1YQUA 1VXOA 3MF4A 1Y8QA 4PV7A 4YC7A 1O6GA 4UXJA 4DVJA 2GOYA 4FCVA 3Q5EA 4YRGA 3P8ZA 2CLDX 2QVZX 2I4TA 5D87A 4KKVA 3T9DA 4KE7A 2QD1A 4CQMD 3PQDA 5BSFA 1WXQA 2MWMA 3O95A 3HHPA 2BW0A 4MV9A 1JI0A 4TLAA 1O9BA 4WH0A 2FEKA 5A4JA 4L28A 5L8VA 1KJ8A 1XJ5A 1ZSNA 3FBTA 5GQSA 3GP8A 3CU5A 1RXYA 2GHRA 1F60A 2BWJA 4JLJA 4K81B 2H07A 4YAOA 3RNOA 5K6TA 2V6FA 5EIWA 4GS5A 4YA6A 1JNXX 1MU0A 2XE8A 4XJVA 4F4FA 4PG5A 5HA5A 4JXZA 4UVIA 1V9CA 3GEMA 1NKSA 3D6FA 4ZAZA 4BB9A 5ICMA 2O48X 2NPIA 2MIIA 3I9MA 4L3OA 3LW8A 4TYQA 3KEQA 4IDNA 2HRQA 1Y3CE 2OCXA 2ODQA 4AM8A 2G1PA 3UPDA 3JY6A 1DLIA 4Q5IA 2IE8A 5A03A 4IVQA 4MYSA 4YX9A 3MWDB 3B60A 1YB6A 2JDID 5TVGA 1WNTA 4QJ4A 5DLQC 3WIVA 1IRXA 4O8ZA 2WFAA 2X0FA 4ESVA 1HQKA 3KQQA 3GLSA 3B9RA 4EENA 3N2IA 1JALA 2QD4A 3LDUA 3EVGA 1NP7A 1VRCA 3GQVA 4BFUA 3D1JA 2YS6A 3LNCA 4QZVA 2R5WA 4ZQIA 1QVAA 4YWJA 1R9MA 5GADl 3PPWA 1CVRA 3F3MA 5GVRA 2V7GA 2ZW9A 3C6QA 3OEYA 1IRIA 5ADHA 1DG3A 1NJGA 1JU4A 3NTXA 2OCYC 3MMSA 4J9UE 1N2CB 1DC3A 3OM0A 3R3JA 3AVWA 1TZKA 1G1AA 2G1AA 3WLIA 5CB4A 3ZY2A 3WRWA 1Q83A 1MJHA 1AV7A 4HRAA 4KBGA 4QTTB 3ZUGA 3FTEA 4G0YA 3ZQUA 4I50B 3G8AA 1MEOA 5HJ5A 3UWKA 4HRXA 4BCDA 2VSYA 4D82A 2WF6A 3LXXA 1LNQA 4H31A 1PFWA 1NUAA 4FHGA 4QDOA 3GVXA 4R1OA 1JT2A 3IPCA 2E6UX 4KQHA 1OA0A 4NMLA 3W8EA 3HXPA 1JB9A 2AUNA 1E92A 3WGYA 3I8SA 3RPEA 3HKDB 5KYWB 4ESEA 3R2JA 1SVWA 2YY6A 4UD2A 4NCHA 4UU1A 5FBQB 4NARA 3FSRA 3ZJ5A 3CVUA 3HLKA 1QVRA 3I73A 3KWMA 1ZO8A 3NEPX 3QE0A 1XWWA 4MW2A 1VPDA 4Y67A 1C0IA 2VUSA 3GFRA 1PAUA 5BVGA 1CUVA 4ER5A 3UGKA 1GITA 3C5WP 4O25A 4KJZA 1JIXA 1WS6A 2E87A 2LP4Y 2X58A 2ASVA 1XMXA 1XL1A 2R6CA 2I7CA 2VT3A 2EHDA 3AETA 3KUCA 3EODA 3TLJA 3CZ4A 4UDNA 4YGYA 1ZK0A 4OB8A 5AI9A 5ALRA 2Q4BA 4IKEA 2QQGA 1M8GA 1PJ4A 1ABEA 3I2YX 3RJMA 3T5DA 2BONA 2OP1A 4OF4A 3N2YA 1MC8A 2O0MA 2OK8A 4QDTA 4EI7A 3COWA 1N5IA 3M4XA 5EMLA 2BEWB 2A5LA 4LZNA 5CDSA 2UYQA 2GJ9A 1NXQA 3CISA 3W5JA 2OFXA 5IF9A 2CUKA 2AFIA 3BH0A 4KE9A 5FR2A 5CVEA 3ROGA 2Q1SA 3K0AA 2NO7A 1XZKA 2VT2A 1ES9A 1IN6A 1ECPA 2P2CA 1NE2A 3E9DA 3EASA 4U3JB 2YYZA 5FFFA 2BTOA 1XP5A 4XWKA 1LRLA 5I7UA 2FDCA 2QM3A 5BO5A 5IXYA 5C1OA 4F96A 3BXFA 5C7YA 2BUCA 2VCHA 3VZCA 4WASA 4B7ZA 1QIIA 4Z3DA 5L53A 1TFRA 1PDOA 4I9NA 2Q22A 2BHTA 2Z2KA 3CJTA 1EBFA 5TMPA 1PRYA 1EP1B 2DWOA 3TRIA 3HKDA 2YUIA 3DMRA 5GGYA 5TJHA 1RPJA 5JS6A 2Z98A 3OETA 4NG5A 2OD2A 3I4FA 1XGKA 4BLRA 5C52B 3FCCA 1Z4OA 1UT6A 3K9FC 1LVHA 3ONVA 2QD3A 4ZQFA 3NTVA 2G88A 1D2EA 5CG1A 4FSDA 1MXHA 3U7QA 2P1ZA 2NO6A 2V45A 4Z2AA 5HQTA 1NUSA 2ZBQA 5JO0A 3A4TA 5DVZA 3VBCA 1EIWA 2XE7A 1OI7A 1P4AA 2F8MA 2I7TA 2NM0A 2XECA 2F3TA 3RF7A 2IYEA 1DV2A 4F7DA 1CD5A 4YUXA 1J25A 1T9HA 3AJDA 4CL2A 2UUBB 1F20A 3I8OA 5TQVA 5KQGA 3F6BX 5K0JA 4H1UA 3UB2A 2HSEA 5T57A 1RMQA 3ST7A 4ETNA 5BV7A 1RTKA 3CURA 1MX3A 1UBRS 2FN4A 2D54A 2XQJA 3MAJA 4UM8B 4D6YA 3N6XA 4P35A 1J8FA 4D02A 5CA1B 1MT3A 3FI9A 4IFEA 2EFYA 3PVZA 4LHZA 1IPFA 3FNGA 3IOBA 2O8CB 3D8SA 3OM1A 2I1WA 2C2BA 2HWKA 4D26A 4DDTA 3A6HA 3TKAA 4S12A 5CH5A 3TNFA 2B9EA 4NOMA 4K2HA 4XIGS 1WPRA 1UFVA 2FPIA 2UZAA 3JRWA 1EFAA 2YFQA 1ILEA 3GEDA 1F1BA 2B61A 1XG5A 4P98A 4E4YA 3ESXA 1SFRA 3HKBB 1EX6A 1NDHA 3FHLA 1PZEA 1USUA 2WJPA 3DPIA 2W2QA 4FHFA 2OGSA 5HIKA 5I3ZA 1QWSA 2RAVA 3ISVA 3RLIA 3ESYA 1U8TA 2JFGA 4LW8A 4JCOA 1QCYA 2BEWA 4DRXB 1GPDG 2A8YA 2SKCA 4AJ4A 4FS3A 1Y8CA 4J0IA 4E07A 3OCVA 4O0MA 1HFWA 3G0DA 2XVAA 3TUZC 2JARA 5CA1A 2AZXA 3O8LA 1PWEA 4ZTBA 3HTXA 3SKVA 1BHO1 3ZZ0A 3VKUA 3FOWA 4H77A 2HU5A 3UJ8A 2YCBA 3K1YA 3RG2A 1A5TA 1N25A 4DIOA 1QO0D 4N47A 3T61A 1YRAA 3IQZA 3KLPX 4RVNA 2AHOA 2IYXA 4TSKA 1DAFA 3AWDA 4ZQCB 3B6KA 5DTEA 4L4YA 4KUHA 5JMPA 3ACCA 1JJFA 1VYVA 3H7AA 4GF5A 3DUFB 1AGPA 4MS4A 3WYFA 3CPEA 2QTVA 3PWKA 3F7NA 4IL5A 3WO0A 5HF5A 4DT1A 4JYAB 5H83A 3AKEA 4EPWA 2VNAA 2AZDA 2VUTA 1YBFA 4FNOA 3PDJA 3H04A 4FQ8A 4IHQA 4QOJA 2VA9A 3DLCA 2CXXA 2W2KA 1UINA 3E2IA 4DLRA 1NG9A 4CDMA 1EEHA 2CLHB 1E2BA 1FFXA 4CW7A 3ODGA 3QVGB 5LQDA 3N2GB 3QBEA 5KYVA 3AEXA 4KQCA 4U9HS 3R7BA 2KWIA 1IFXA 1XMOB 4HLUC 4PN3A 4C0SA 3ZU5A 1PE0A 3VYVA 4HLCA 3OIFA 1XNJA 3P2IA 3ZTTA 4QOIA 3B6IA 4UHKA 3T5MA 2ON6A 4QQNA 4UPVA 3V9PA 3MD9A 1G5IA 3L40A 4IEIA 4MPJA 1L7EA 4IDGA 1XTUA 3MOGA 4JB3A 1CB0A 1QRDA 3FM9A 4XPIB 4BFYA 2GPAA 3HCRA 3LYLA 4WEQA 4E14A 4EUEA 1YI1A 3OQ6A 3OFNA 1A71A 2OBNA 4EMTA 5IHPA 3PYMA 3DZKA 1DHTA 3KSMA 2WLTA 3AR2A 4BX9A 5TPWA 4C05A 1WZEA 5HS6A 3ROKA 3EDOA 2ZZKA 1VMEA 1UDRA 4I1UA 4PSUA 2FFAA 1SC9A 4X54A 3QV2A 5IBPA 3T1OA 5CFRA 5KZMB 2NUAA 2R96A 2OBLA 4QBKA 4E33A 3K7EA 4KVAA 2ISQA 3EZ6A 3TH5A 3MELA 2BFPA 1N6OA 4BMDA 1GZ6A 1MX9A 3LE8A 3UQZA 4G9EA 4L8GA 4UAJA 4HV4A 3GIDA 3WMGA 3WQRA 3L6OO 1KVUA 4X64B 3BSYA 5F4ZA 4FMPA 4KR3A 2P77A 2ZTSA 4EVIA 3WGTA 3VJRA 2VZLA 1Y98A 3KDPA 4TVKA 1Y5IA 3GGJA 2X1MA 4KXWA 1Z28A 5KDLA 4F6CA 2XD9A 2X76A 4YCJA 3L06A 3S81A 3ITNA 1K97A 5J4HA 5EGSA 3NVMB 3ZDQA 1CY2A 1ESZA 1F9AA 1MZVA 1T3LA 1Z56C 4KQIA 1QR2A 3T5TA 1G6HA 1BEEA 1UPAA 4GM0A 4M0KA 2OYSA 1H4QA 2B4TO 4US0R 4B9EA 3JD3A 1PU2A 1CQWA 2G9ZA 2VDNB 4BGVA 3W6NA 3FR8A 3O5AA 3UC5A 4DR1B 2G36A 4GOJA 4QOHA 2B4KA 1YZFA 3CNLA 3OX4A 4QXRA 3TW0A 4JVOA 4LOHA 1LW6E 3HUDA 2F8SA 3JAKB 1N6LA 3EZNA 3EP9B 2VWQA 2B9VA 1OV6A 3QNMA 4JJKA 5DEOA 1LLUA 1SXHA 1XRQA 1SCUB 4ZMRA 4QJ3A 3BE5A 2R47A 1KAEA 1I2DA 2NXCA 3MJTA 4XSGA 3U7FB 3MAAC 3Q8MA 5EIBD 2RKBA 3P71T 2HRZA 2IEZA 1ITZA 2WMOB 3EP8B 4ZVNA 3AGPA 5EXPA 2J07A 4Z4QA 2BBWA 2YQ5A 4RA9A 1P7CA 4XEUA 3KL2A 2HQ1A 3IEVA 1YJXA 3P9NA 4TMFA 4M36A 1GSIA 2KX7A 2VRWA 5CHEA 4OV6B 5A3VA 4Z4HA 3PZRA 2YXEA 4PRLA 3SM9A 4X8OA 4XYMA 4AZ3A 4IOKA 4TZ0A 3GFPA 3E15A 1WHSA 4PO9A 4EA7A 3ZVRA 4KE6A 4UUBA 5KCZA 1G20A 1DDOA 1DADA 1JI3A 1DXQA 4TRRA 1UZAA 1VRVA 1YJ5A 1EJBA 2XPCA 3ELYA 1KQ3A 5AVUA 4BAUA 1WD5A 2RHMA 3HADA 4RF5A 1JV2B 1K8YB 4DLXA 3GMTA 1RM5A 2Q41A 3ZHXA 1NYRA 2JLUA 3MJCA 4FLMA 2O2ZA 4K9SA 5FOUA 3Q85A 1JZSA 3GAMA 2X7HA 4TRNA 5I4CA 2HRRA 1ANKA 1ZP6A 1GZ4A 1XV5A 3H5TA 3FWZA 1IY2A 2F48A 5E8RA 5T3YA 2BAGA 5KNBD 4EDFA 1QB8A 2OFPA 1RWXA 4JB0A 5LQJA 3W05A 1U3UA 2R8ZA 3E4CA 4XQ0A 5B6PA 4BWYA 4A36A 1Z68A 2XMPA 1T0IA 4OO3A 1CY0A 1CY7A 1ZGHA 5JTUA 3PX7A 3F73A 1PR2A 5J5VA 5GV7A 4WZAE 1RRFA 3B51X 1B93A 5KS2A 1KWGA 3BTUA 2CLKB 3H8JA 5ULLA 2ZJBA 5EKUA 1M7HA 4KV9A 1VQ1A 3QV1A 1HMYA 4UVHA 3PI6A 3OZWA 1CWUA 2PD4A 2DJIA 2X9VA 1Y5NA 2I8CA 4UCWA 3T7CA 4EJ0A 4MVJG 5C2JB 3MXTA 2BEVB 1RW4A 2PSFA 3P5BA 2C82A 3QA9A 2VP3A 4TTSA 4EAAA 3GFVA 2FUEA 3QVWA 3BEDA 2ZBDA 3DKRA 2OO5A 5GP1A 2FW9A 1PEDA 1YQGA 2CGEA 2G1KA 2YVLA 3BFKA 4ZRNA 1ICIA 3QENA 2BM9A 5TS3A 1RLMA 1HXHA 1VKRA 3NTLA 1XTTA 5C1BA 1ZR2A 5G3YA 1GADO 4YP7A 3ZDRA 5FLYA 2N1BA 1SCUA 1YB2A 3KOXA 5FORA 4W9NC 3ZXIA 2E4ZA 4EG4A 4FWTA 2PPVA 2GZHA 2N46A 3FSGD 2GGSA 3HYCA 4PGMA 1A8HA 1Q57A 2C54A 7ABPA 4NE2A 2F9LA 4EABA 3CV3A 2HCTA 2N42A 3FUVA 5ES4B 4DJAA 2JI7A 4HNTA 2Q2OA 1O9GA 1QCCA 4GPTA 4EYGA 1C80A 1IZ9A 3HVUA 4N6NA 2CSUA 1XHEA 2OL4A 2P3LA 3MS7A 5A06A 4EGQA 5EERA 3L7JA 5LDGA 2NGRA 3DBHA 4UU8A 4BX2A 4URXR 1IYZA 3A28A 4NV3A 4W8OA 5DHAA 4YI3A 3FTQA 3JQ7B 3ZI7A 1QAMA 1XTPA 4E1VA 1JHRA 3AZOA 3EQZA 3MJHA 4TUYB 4RVGA 5FL3A 3EDQA 3H75A 3GFTA 3GMSA 2NSLA 3E7FA 2ZIZA 4XWWA 2QTTA 3RQIA 3O8RA 3U3ZA 1F51E 1UC8A 4IX1A 2A1IA 1MJ5A 3CF2A 4I7EA 4X44A 2HO5A 4HN9A 3NNDA 4MYUA 4PPFA 4CLOB 5A3JA 5JWOA 3VNVA 2GBPA 2P3OA 3GA5A 2D1RA 2P9JA 1XTIA 1ZY2A 3P7MA 3TTUA 5IU6A 5ELXA 1YTUA