4GMFA

Apo structure of a thiazolinyl imine reductase from yersinia enterocolitica (irp3)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
351
structure length
335
Chain Sequence
KQRVLIVGAKFGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRVAGGAGTQLARHFLARGVHVIQEHPLHPDDISSLQTLAQEQGCCYWINTFYPHTRAGRTWLRDAQQLRRCLAKTPPVVHATTSRQLLYSTLDLLLLALGVDTAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDDPDMHSLIMHRLLLGWPEGHLSLEASYGPVIWSSSLFVAILRDPPGLTRSAAPLSWRDCCETVGPEGVSWLLHQLRSHLAGEHPPVACQNVHQIALSRLWQQILRKTGNAEIRRLTPPHHDRLAGFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Structures of a Thiazolinyl Imine Reductase from Yersinia enterocolitica Provide Insight into Catalysis and Binding to the Nonribosomal Peptide Synthetase Module of HMWP1.
pubmed doi rcsb
source organism Yersinia enterocolitica subsp. enterocolitica
molecule tags Oxidoreductase
molecule keywords Yersiniabactin biosynthetic protein YbtU
total genus 104
structure length 335
sequence length 351
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4gmfA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4gmfA01
2ZQZA 4WE3A 1ZXLA 1P31A 2OP0A 4CLHA 5I7VA 1H2BA 2VUSA 1GD1O 2PZKA 2P4HX 3ANLA 4P22A 4CLOB 2E49A 3RC9A 2D5AA 1L1FA 5JCJD 3H6KA 3ICCA 1XWFA 2CVZA 1EVYA 2UYYA 3DTTA 1WPQA 4B79A 2V65A 5TSDA 3WWYA 2J3HA 1V3TA 2WM3A 2DKNA 5DULA 3AY3A 2CF5A 3RU7A 1MLDA 2DFDA 2WTBA 2QIOA 2P9CA 1VLLA 3DZHA 3GZNB 4GSKA 3DZIA 1KVQA 4RL6A 1GYQA 2EW8A 1WWKA 2PGDA 4B4OA 2YV2A 2QW8A 1UDBA 5JO0A 1OBFO 2OZPA 5DDIP 2JHGA 3CUKA 4FS3A 4FB5A 1QYVA 4N5LA 1VSUA 5B37A 1M2WA 2G1UA 5CHEA 3GN2A 4YT5A 5CEEA 3PJGA 5L3ZA 1R0SA 2PKQP 3FN4A 3PQDA 4UREA 1DC3A 5EQFA 3DONA 1GUZA 1XU9A 2BH9A 1ZVMA 1Y8RA 3E1KA 4NMHA 5A9RA 3U4CA 2CDCA 2VQ3A 4E12A 4URFA 1V9LA 3GNTA 3TQHA 4FW8A 1Y1PA 1PS0A 2I3AA 1U5CA 3WIEA 4FJ1A 1E92A 3WNQA 1PJ4A 2GZ3A 2BRUA 3GG9A 4UEJA 1T24A 1R0LA 4I9HA 4IIUA 1S6YA 1X0VA 1NNUA 3DZBA 2ZB7A 4BVAA 1PJCA 2QQ5A 1OZAA 4W4TA 4CLXA 1PQWA 3JD2A 4NFYA 1Y6JA 3GUYA 4DYVA 4KTVE 2YQ4A 2ZATA 4NR0A 1HDYA 4FGWA 5TT0A 3RKUA 3ZHBA 1N7HA 3RC2A 4P38A 4PLWA 1Y8QB 4FJ0A 4IDGA 2ZYGA 4FC6A 2YHUA 2VHZA 1XQ6A 1YB4A 2PA3A 1WAMA 1ZFNA 1E77A 3HNPA 1FDUA 3AUUA 3OIFA 1S7CA 1YBAA 3KYCA 4X54A 4UUMA 2BFAA 3ZWVA 4E3ZA 2VYVA 4KWHA 1E6WA 4OO3A 4IQ8A 1MGOA 4NJMA 3HFGA 4R1NA 2VCYA 3CE6A 4IPTA 2GRAA 2Q1SA 3U3XA 4YJGA 4WPGA 5A4DA 4IQ0A 4L74A 3PRJA 4KUHA 1E3IA 4NG5A 4YB8A 1Q0LA 4TKLA 5G4KB 1N92A 5KJCA 2DTXA 5L4NA 3D1LA 1PGQA 1AHIA 4M49A 3RKRA 4CM8A 3FBTA 4XA8A 4LK3A 1OOEA 2PLAA 1LDYA 4I5EA 4YJFB 4QFDA 1PJSA 1HLDA 3ETEA 3ZNOA 3EZYA 3I4CA 3Q2KA 2EIHA 4DLLA 5C7IO 4OJNA 1MUUA 1OC4A 2DUWA 4I5DA 4XRGA 3G79A 2CF6A 3JQ8A 3OIDA 3D5TA 2Q1UA 1DIGA 3HG7A 5KOIA 1N9GB 1HEUA 1LSJA 2QZZA 2VOEA 1LA2A 3VH3A 3HDYA 2FMUA 1A9ZA 3PHHA 5C3MA 5BNIA 2B4QA 5T57A 2B4TO 3SJ7A 4GAEA 3TSCA 1D1SA 1YQGA 3H3FA 1NQOA 2OFPA 5DNAA 4RO0A 5EQDA 2D59A 3OEYA 3AM3A 3ZWNA 1NAHA 2EJVA 1U4SA 3ZWCA 4IZIA 3GGPA 2X5KO 1XLTA 3MJTA 1JA9A 3ZZNA 4MVJA 3RWBA 3WLEA 2YV3A 4ZQHA 3KRTA 4EBFA 3MOGA 1Y9AA 4D3DA 4MP6A 5TLSA 4EJMA 3QP9A 4W99A 3Q9UA 3L6DA 1K6IA 1ZIDA 5ITWA 5F21A 1GZ3A 3HWRA 2OOSA 4JBHA 4RZHA 1KBZA 4CV1A 3H9UA 4YQZA 5JY1A 3AOEA 2QX7A 1X13A 3ZU3A 4E4YA 1YDWA 3AOGA 3JQ9C 4RZIA 4NBUA 4GWKA 4BGIA 1XYGA 1MC4A 4G81A 3IIEA 4R5MA 2NACA 4Q3BA 4RQUA 4JJGA 4O1MA 1B16A 1FK8A 1UXGA 4RVHA 4AJ1A 4I8XA 3CH6A 4J91A 1H2HA 1BXKA 4J4TA 1N1EA 1T26A 5IN5A 1WLYA 1UUFA 4WCFB 1YOVB 3VDRA 1HE4A 1F17A 2BD0A 3MJSA 1EDOA 2DC1A 2C54A 2WE7A 4OKIA 4BIIA 2DM6A 1B15A 4RVFA 2X6TA 2JCVA 5IXYA 5IG2A 4AJJA 3GR6A 4NBRA 4ZVVA 4II3A 5G4KA 1U4OA 2EF1A 3M2TA 4TRJA 1J6UA 4PG7A 4CQMA 2EGHA 1PJBA 3AI3A 4GQAA 2V7PA 4OOEA 1ONPA 2HK8A 4QTZA 4IJKA 1NR7A 2NLOA 4RDIA 4GKBA 3JYQA 3NYWA 4I9NA 1KETA 3JQFA 1ONOA 1HDCA 4K6CA 3H9JA 1E5LA 5F1PA 2HU2A 2FZWA 2ZCVA 3GDGA 2Y1DA 3ETGA 4A26A 1GPJA 1I3NA 3KZVA 4CUZA 2YDXA 1DC6A 3NTOA 2VRCD 1FDWA 3OJLA 4TZTA 5KVVA 1GPDG 3FHLA 2FN7A 2HK7A 1CQIA 1W73A 4CL8A 4YQYA 4NU5A 4NNJA 2HAEA 4UVHA 4DMMA 1UXIA 4D42A 1NWHA 4MIOA 3FBGA 5GZ6A 1PGPA 3TOXA 5KVCA 3IJRA 1EFKA 2NQ8A 2FR8A 1BGVA 4J4HA 4OHUA 3JQAA 2ZB3A 2Y1GA 1HWYA 3S8MA 4B4UA 4IXTA 2NTNA 1QMGA 3B6ZA 4ND1A 3T4EA 5MDHA 3GLQA 2CUKA 2I66A 5JCJA 3D3WA 2C29D 3I6IA 3INTA 4UAGA 4RVGA 1LBEA 3PVZA 4XQGA 2PD6A 3PTZA 4JBIA 1PZHA 2NSDA 1PR3A 4M87A 4EDFA 2GPTA 1DO8A 5COAA 5TQVA 4FOSA 4YRAA 1YL7A 2BF7A 4J2HA 5EERA 2FPIA 2X0RA 1YGYA 1LLDA 3BMCB 1LQUA 3CIFA 3QLJA 3PWZA 4U5QA 1JVBA 3KSDO 4WGGA 4CMGA 2X23A 4RLHA 3ZV5A 1ZK4A 3KBOA 1PJQA 1BVUA 5G0VA 1T2FA 1KVSA 4MVJF 4F45A 1E7MA 4N54A 1DIHA 1VL6A 4JROA 2P5YA 3IQDB 1QV6A 3RUCA 2DPHA 1C1XA 4HNGA 3PYLA 3C7AA 1LRLA 4NIMA 2A35A 3HUDA 2JKVA 4CMEA 2J5KA 2YHIA 1HDRA 4GBJA 2FHSA 2CSUA 3IAHA 3K30A 3LT1A 3VH2A 4INAA 2TMGA 4IDEA 1ZJYA 2X9VA 4OMUA 1TA4A 3FNFA 4L0QA 1ARZA 3PHIA 1ZSNA 5CAEA 4NJOA 4PLHA 5BNFA 3UICA 4MVJI 3KTDA 5CPBA 1I01A 1FF9A 3H3JA 4FD3A 3ITDA 5JAZA 3DZKA 1UZNA 3DZFA 1BXZA 2DUUA 3L07A 2DAPA 3WJ7A 2P9EA 3H2SA 1DFHA 2ET6A 3QW2A 4E13A 3DQPA 3OIGA 1ZW1A 2IEBA 4NK5A 4Y98A 1Z45A 1N2SA 2FR0A 2HLPA 2O7QA 4NQZA 1A72A 2IRWA 4NHEA 5A03A 2Q4BA 3ZWAA 4WLVA 4BO5A 2NNLD 3G1TA 3GRPA 4RF3A 3P2YA 1ID1A 4O63O 1DIBA 4BO6A 5BSHA 2YYYA 3A1NA 3FR7A 4E32A 3DXFA 1LRJA 4RF2A 5IZ4A 3JQDA 3D0OA 1U2DA 5COQA 5G0WA 1Q7BA 1P1JA 4E5YA 1XR3A 2GASA 4CV0A 1I3KA 4J1SA 4E2YA 1LC3A 3SC6A 2PV7A 4DLBA 1PS8A 3RU9A 1P0FA 1W8DA 3VPXA 4MOWA 1ENOA 1TT5A 4PLPA 3NTQA 5JPIA 1LRKA 4XCVA 3HE3A 1YKFA 4MO2A 4Q3CA 1X0XA 4WUVA 4PLTA 2O3QA 2G5CA 1M6HA 4ALMA 5I9NA 4HUJA 3O26A 3HQ4O 1GCUA 1YH3A 1ADCA 3JQ7A 1R16A 2RAFA 4FQ8A 4MJLA 1ZMTA 3GFBA 1B7GO 1MA0A 4BKQA 4CV3A 4D7AA 1BXGB 1FDTA 2BGMA 2X0JA 3ZWXA 1DDOA 4G65A 4BO2A 1NPTO 4YJHA 3EDMA 3AUSA 1YXMA 2ILTA 3FNGA 5U1PA 4CMCA 4CMBA 2GNAA 1IL0A 4OM8A 1P1FA 3VAZA 1YQDA 1WVGA 4IJUA 1I30A 3ONEA 1WDLA 3ITKA 1TLTA 1H9BA 2HMTA 2VWPA 2PY6A 4RLSA 1OC2A 2UVDA 3ZGYA 1SCUA 3COSA 5T8KA 2QRJA 4EUEA 1CJCA 2Q46A 2SCUA 3U4DA 1Y9EA 4CLOA 4HKTA 1KEPA 2WJPA 2DBVO 4PVCA 2ZB8A 1GEEA 3DAGA 2NU9A 3WGGA 4GX2A 2Q49A 4BNLA 4RVUA 3STHA 5TC4A 1M66A 3WFIA 4BNHA 4IMPA 4Z0PA 2E82A 4GGPA 1HKUA 5KKCA 1QYCA 3M2PA 5L4LA 4Y9DA 2B35A 4DREA 1SB8A 4ALIA 2FRDA 4RVDA 1XG5A 4EW6A 1IOLA 2AQHA 3D3EA 3L4BA 4FJ2A 3BHIA 1Y5MA 3CKYA 3W8FA 2BFPA 1MX3A 4XYEA 3F9IA 1EQUA 4MINA 3TZQA 4PLYA 1MG5A 5A5EA 1UP6A 1EEHA 1F14A 2RIRA 3TL3A 1DFIA 2VTDA 2AW5A 2VYND 3NDIA 4E5PA 3V8BA 3AI1A 1EUDA 2VNAA 3ZNNA 2LDBA 1I5RA 1UZMA 4D43A 5JAQA 3L6EA 4GWGA 5A02A 5ICMA 5FF9A 5A04A 2P5UA 3UKOA 1F8GA 3G49A 2AQKA 4GSLA 4CMIA 4A2CA 3RJ9A 3Q0EA 5G2OA 3LC2O 5IFLA 2ZTLA 2B5WA 4BNMA 5G0UA 3H9EO 4P4GA 1M75A 1B0AA 2DVMA 2Y0CA 1LX6A 2J3IA 1EMDA 1SEVA 2Q45A 3PHGA 3HDJA 4IINA 3WG9A 1R4MA 3MZ0A 3NJ8A 1I2ZA 3UCXA 3GPIA 1E3WB 3PFWO 1H0KA 2IZZA 2VTEA 3WR5A 3EAGA 3QVTA 3ZU2A 5COBA 5BSFA 2GCGA 4H3VA 1U8FO 1DJNA 1XCBA 3GK3A 1ZBQA 2D0IA 2DU8A 3BMOB 5G0TA 1BW9B 1CRWG 2UV8A 2AEJA 3GVCA 1C0LA 1GADO 3UCEA 3K2BA 4TRMA 1DAPA 4OL9A 1C1DA 1T1SA 3OJ0A 3JQBA 3I3OA 3WX0A 3FD8A 3UGKA 2O2SA 4GVLA 1CDOA 1U3TA 1Y5RA 4XB2A 1GUFA 4ZHSA 2WYUA 1XU7A 3RUHA 4LVCA 3D3WB 3WWZA 4J43A 3JYPA 3H9QA 2RBEA 3BYZA 3WTBA 3FWNA 5LDGA 5M6DA 1HDXA 1OMOA 4XGIA 1PQUA 1EFLA 5JE8A 3P5SA 3OSUA 4KZPA 4QXMA 3JQ6A 3PQFA 2AEFA 1KOLA 3BMCA 3AK4A 3KVOA 3QA9A 4JJFA 4ALLA 3WDSA 4BNNA 4R1TA 1GZ4A 5DP1A 5FYDA 2Y0EA 4HV4A 3E8XA 2IODA 4TVBA 4XX0A 1KEUA 1O5IA 1O8CA 5B4UA 4IQGA 1UH5A 5JMPA 4B8ZA 4B3HA 3DBHA 4ZD6A 4ZRMA 3ZW9A 2CY0A 2W8ZA 4BKRA 4XRRA 1QORA 4XQCA 4LISA 3L6OO 5F3RA 3RBZA 1OI7A 2QHXA 4IMRA 1M67A 1VI2A 5TS3A 2GGSA 5THKA 3QVSA 3EYWA 5BT9A 4CR6A 3QIVA 4PRLA 3IUPA 4JIGA 1T4BA 1K6JA 2DTDA 1E1NA 3W4KA 4U7WA 1FDSA 4S1VA 4ID9A 3UFXA 4PZDA 4MIYA 5EINA 4YPOA 1IZ0A 1V8BA 1X1EA 3DHEA 3QSGA 4NFSA 2E4AA 5DBFA 5JDCA 5TNXA 2IZ1A 1CIVA 1V6AA 3PLNA 1E5QA 1HYHA 4D45A 3ZU4A 3S2GA 4IDBA 1I8TA 2O4CA 3I5MA 4CL3A 4XKJA 1JWBB 2QYSA 2BI7A 1QG6A 4Q3DA 5JMWA 1R4NB 1FMCA 3GVPA 2AE2A 5JCXA 4C7KA 1Q7CA 1PJ2A 5A5FA 1XHLA 2PD3A 4R01A 2C20A 1HT0A 2Q2QA 1EDZA 4Y8VA 3BTOA 3B1JA 1A4UA 4CR7A 2XOXA 1K3TA 4QSMA 3B70A 1WDKA 2XPCA 1SC6A 5IDXA 2VHYA 3DEYX 1NP3A 4RPKA 4UEKA 5MGBA 4L73A 2IXAA 1N7GA 3OEWA 4CM4B 2JAPA 3WGHA 1BDMA 3VKUA 4R4JA 1DB3A 4Q3AA 1EVJA 4Q3EA 4UVDA 2IDZA 1HLPA 2X5OA 4F3YA 1XGKA 3WGYA 2PNFA 4ZGWA 8LDHA 3FF4A 1UDCA 3R6DA 3I83A 4Z3DA 3HB4X 3VVBA 4R54A 5I8WA 4FDAA 2QYTA 1FXSA 4R1SA 4IS3A 5F1KA 1P1KA 3P7MA 3X2FA 3ZNPA 3ADPA 1XSEA 2XXJA 1EZ4A 3G1UA 4WKGA 5U4QA 3KXDA 4BO0A 1NYTA 1RWBA 4WNCA 2YJZA 4R16A 3TZHA 5J23A 3FNEA 1KVUA 2O4UX 3PIIA 3IUSA 3W8DA 4RPHA 2YQ5A 1NFQA 3EVNA 5A1TA 4I5FA 5FWNA 3JQ8B 3QV1A 3U5TA 5C7OO 3FRJA 1G0NA 5KKAA 1JKIA 2EGGA 2FSSA 1RM5A 1NM5A 2UUPA 5DCUA 5KJFA 2ZYAA 4OQZA 4XB1A 3OICA 4P4NA 5DCWA 5DOVA 1VJ0A 1N5DA 1V35A 4R3WA 2B4RO 1C3VA 1PS9A 1H94A 5DOZA 3OA2A 5AVOA 3BHMA 2IYOA 4P8RA 3TFQA 3ICPA 2B37A 1YL6A 1CWUA 2J5RA 5JO9A 4ALJA 3CEAA 3LDHA 4WOJA 3KM0A 1MB4A 4NBWA 4R9RA 1IY8A 4AJKA 5JS6A 3QE3A 2D1YA 2JFFA 4BO1A 3L77A 1P74A 3BXXA 2NADA 2TMDA 4XYMA 1VL0A 1MFZA 4TQGA 1A27A 4U6SA 1CYDA 3VPGA 1WXDA 3DBVO 2VWHA 4LVUA 1WP4A 2GZ1A 4GX1A 3UVEA 4DIFA 3I9MA 3QWIA 4J7XA 3A14A 3RBXA 4CMAA 5JXWA 1SPXA 4IDAA 3F6YA 1ZKMA 4UVEA 4OGWA 4XEHA 2O2YA 5ILGA 1P0CA 3ZW8A 5ITVA 2EG9A 3V5NA 1IZ9A 2O3JA 2HO5A 2Q4EA 1O0SA 3INRA 1E6UA 4CM7A 3PYXA 1GY8A 1HSOA 2DBQA 3U0BA 4CMKA 3GH3A 3PZRA 3NAQA 3DR3A 1Z7BA 3L4BC 2C7VA 3VTFA 1OFGA 2OP1A 1P44A 3O4RA 4F6LA 2Y1OA 3P2OA 4LMPA 4Z0HO 1LDEA 3IKTA 4W9NA 3TOZA 4PRKA 3AY6A 1O89A 4JX8A 1E3SA 1LJ8A 3JD4A 5JAIA 3W4IA 5L7YA 3W6UA 4LRTB 1PL6A 3KEOA 3DOJA 4CM5A 1NQAO 4UVIA 5ER9A 3RI3A 5HRUA 4ND4A 1HZJA 3VZSA 4M86A 1NWCA 2WD7B 3DDNA 4DC0A 4O59O 1HE3A 2FSVA 3RSHA 5LDHA 1WZIA 4FOOA 2NVBA 3C85A 5T64A 3H5AA 1AGNA 4EGFA 4YAKA 4A03A 1Y7TA 3F47A 5ER6A 2O50A 5TJ9A 1AE1A 3F4BA 3RFTA 3D4OA 2YFHA 2YW9A 4QQRA 3WQQA 1KERA 2AEMA 4UEOA 4WNIA 1NFRA 4J1QA 5EJ2A 3QHAA 4TWRA 3DOCA 1XQ1A 1B2LA 4HX5A 1RYDA 4FFOA 1B8PA 3CINA 4F6CA 2IZ0A 1I3MA 3IOYA 4DIOA 3JQBC 3WTCA 4Q39A 3B1FA 5H83A 1IPEA 4KQXA 3EC7A 4GH5A 1XDWA 4KMSA 4YJGB 3AJRA 3EUWA 1HSZA 3GHHA 3NGLA 1LDNA 1NVGA 2V6MA 2EERA 4TMFA 4PCVA 3WYEA 2IXBA 2AG8A 1P1HA 3LT0A 4YCAA 3GN1A 1Q0HA 3GDFA 3TNLA 4CV2A 1B26A 3F4LA 1KIFA 4PN3A 5DT9A 1Z75A 2ZCUA 4E21A 1JTVA 4J1TA 1E3LA 4O6VA 1QYWA 3HADA 1NASA 1ZXBA 5FI3A 2X58A 2UUOA 4LSMA 4L9RA 2C7GA 3TDKA 3E6AA 2V6FA 3ZH2A 4HNHA 4CMIB 3EHEA 1E7QA 3NEPX 3UCFA 3JQAD 4YXFA 2CNBA 2O3TA 3BAZA 1CETA 4E0BA 1TT5B 3E48A 3V2GA 1YVEI 4H15A 2VZ8A 3KETA 4E2WA 3AU8A 1JVSA 1D1TA 2B69A 1JKJA 4D41A 3AOEC 3ZWYA 4R5HA 1M76A 5IJZA 3F1KA 4XD2A 1BXGA 1GU7A 3NDRA 3X2EA 1ONNA 2PZMA 5CDUA 5HS6A 1MC5A 1Q7GA 1RM4A 4YTEA 4UVGA 4EITA 5KNLA 5K9ZA 4CUJA 9LDBA 4MKZA 4BB6A 2OBNA 1ZMOA 4I9UA 4KUEA 1O9BA 3F5SA 1SZJG 3DOOA 2AXQA 3ZV6A 3OETA 1UR5A 4EJ6A 3WJAA 4Z9XA 3ZWMA 3WBBA 4RPJA 2OUIA 3K73O 5JSFA 1HDGO 4FFMA 4IJVA 5L4SA 1IHXA 2O3RA 1ISGA 4MKXA 4WLUA 4E5MA 5CDGA 5F1OA 3U9LA 2BKAA 4JCOA 1R66A 5EMHA 5ILOA 4YAIA 2D8AA 5BR7A 1BDBA 1M6WA 3EZLA 3DBRB 2A92A 4CM6A 3LC1O 2D4AA 2IYPA 4A0SA 4BO4A 4E30A 5BQFA 1ISHA 1TT7A 2I99A 3MJ4A 3MJEA 5TIIA 3D4NA 2AQIA 3BHJA 4DA9A 5GZ3A 4BO8A 3WGQA 4O0LA 2VT3A 4PZEA 2J3KA 4ALKA 1VRWA 4ZQBA 5CDTA 3JCZA 4YVFA 1WMAA 5T5QA 3W8EA 1P9LA 4CQLA 5B12A 4IDDA 2EW2A 5U9CA 4DWVA 3AUTA 3S2IA 1JW9B 5CG1A 1K89A 3UOGA 1A7KA 1ZK2A 1EE9A 4UUOA 1Z82A 3KYDA 4KP7A 2HMWA 2DT5A 2E48A 3GGOA 3HDQA 4J4BA 2I76A 3PWKA 1U3VA 4H16A 5DN9A 3EMKA 3RUFA 1UXJA 4F46A 3GMSA 3I6QA 5C37A 2Q3EA 1LUAA 1HYEA 1R4NA 4JGBA 3RFXA 1C1DB 4AL4A 4N5NA 2HUNA 4J0EA 3S2FA 4R51A 1PIWA 3E82A 2HJRA 4DBZA 4DL9A 4EI2A 4J0FA 1DHTA 5IDYA 4HADA 5DZSA 1UAYA 3NGXA 2OL4A 3NUGA 2YZ7A 1PTJA 3RROA 1ZO8A 3WXBA 5DP2A 3PPIA 5JW6A 4NPCA 3PXXA 3PJFA 2PKRA 1HDOA 5EN4A 4DQVA 3KYCB 4U8GA 5JBIA 4YACA 1P77A 2OORA 4IY1A 5JC1A 1GL3A 3S55A 3Q9NA 5L7TA 2D3TA 2X7HA 3QWAA 3WGOA 5A05A 2P4QA 1SOWA 4PG5A 5KIAA 1XEAA 3FR8A 3IDSA 4C7JA 1PZEA 2C0CA 2JFHA 2C5EA 4L76A 4A73A 1U9JA 1RM3A 3PDUA 1EVZA 5LC1A 3KEQA 5TF4A 2GDZA 3ZCXA 2HMVA 4M8SA 2DBZA 1H6BA 1YS4A 3DMTA 2I65A 2R6JA 4L4RA 2HRBA 3QVWA 1C14A 1XA0A 5KJEA 3CXRA 4ALNA 4DMLA 1JKFA 3ZWPA 4ILKA 4XYGA 1LI4A 3WGZA 3OH8A 3WGTA 4B3JA 2JCYA 4R1UA 4MVJH 4LSWA 1A7AA 1CQJA 3DBLA 4G5HA 4BGUA 5A9TA 1SNYA 4ZQGA 3ROPA 5K6AA 4FFPA 5JY6A 1E3JA 1CF2O 3H5RA 4PLVA 1C0KA 1U7HA 1I0ZA 3A9WA 3JYNA 5EIOA 1PL8A 5H82A 2PZLA 3RUEA 5K0ZA 2PWZA 5L7WA 1ZK3A 1QRRA 4MVJG 2B0JA 4R41A 4DRYA 4QO8A 1GZ6A 3JQAB 2FY8A 2J5QA 3KYDB 1F06A 3GUCA 4YEDA 1LC0A 4TSKA 3OHSX 3K9QO 3H7AA 1NQTA 3JV7A 1YB1A 1E1LA 1GUYA 2HK9A 3PP8A 1KC1A 1L7EA 5TGDA 3RASA 2EKPA 4EZBA 3K31A 1HE2A 3G0OA 1U3WA 5K6AC 4WK6A 1YO6A 3DWFA 1AUPA 2RH4A 5G4LA 4CLDA 7ADHA 3VC7A 1D3AA 1NPYA 1PSDA 1QP8A 4LRSB 1BVRA 4GLOA 1X15A 2GZ2A 5ES3A 3VH4A 4FN4A 1QLJA 4GI2A 4PZCA 4BKPA 1ENYA 4CQMD 3GHYA 3GA0A 3SJUA 2BGLA 1P3DA 4XYBA 3KUXA 2VWGA 3GOHA 3VPSA 2AG5A 3GY0A 1HF3A 3QWHA 2GF2A 1J4AA 4DXHA 3V2UA 4XJSA 4QEDA 3LT2A 2ZJ0A 3VVCA 1J0XO 4ND3A 1IULA 1YBVA 4HFNA 1ORRA 3I9KA 1EUCA 2NUAA 1NPDA 1ZSVA 3H5NA 1X7GA 1OAAA 1BG6A 3IJPA 3E9QA 4NFHA 4J6FA 1PR9A 3ZWOA 4NK4A 3FTNA 4L75A 1CERA 4OH1A 5JDIC 4DBVO 3BMQB 3QVXA 2I9PA 1BRMA 1NQ5A 1PU2A 1HETA 4RF5A 5I7SA 4BNJA 1XIVA 2V6GA 3ASUA 1NBOA 3PFFA 4LN1A 2P91A 1SEPA 1U3UA 1X1TA 3JQGB 4W7HA 4WLOA 2GYYA 1JU9A 3G17A 3O9ZA 4B4VA 3HHPA 1K6XA 3BMNA 5JYDA 2W2LA 5ICSA 1DLJA 3TFOA 4ITUA 3N74A 1PL7A 4Z9FA 1IB6A 2I3GA 1HL3A 4MVJE 1GCOA 1R0KA 4NJMB 3NJ4A 5I8ZA 4GX0A 2PK3A 4TZKA 5JLAA 3WQSB 5IN4A 3AU9A 3DZGA 3VZQA 1GFSA 3VTZA 5L51A 2NVWA 3LYLA 2EJWA 1X7HA 1KVTA 4EYEA 3DZJA 2BFMA 3PYMA 1QYXA 1YOVA 3O8QB 1ZSYA 5LCXA 2EKQA 1V3VA 2Q99A 4E5NA 2OHXA 4KDFA 4KTTE 2OBYA 3A4VA 3F5QA 4U0KA 4LCJA 2H1SA 1SB9A 2DLDA 3HSKA 4A27A 3RBVA 3FWZA 3N7UA 4CMEC 4TROA 5IAAA 1G0OA 3D5QA 4Z9YA 2BI8A 4CM9D 4HY3A 3GDOA 1K0UA 3AUAA 4HWKA 3BIOA 1VKNA 1CEQA 4PIVA 3PHJA 2X5JO 3WB9A 3ADOA 4WEOA 3GAZA 4P4LA 1VKOA 3VDQA 4A10A 2VZ0A 1ENZA 2FPPA 4YR9A 2B36A 4E6PA 2YY7A 2VYVD 3O8QA 1F12A 1LEHA 4WEQA 1HZZA 2C07A 1B3RA 1A9YA 1DLIA 3RUDA 4BNZA 4BO9A 1B3BA 2NQTA 4CM8B 1XELA 2DTEA 1LNQA 2E37A 1KY4A 4Y6PA 2WSBA 5AXAA 2OXIA 1Q1NA 4J3FA 2EV9A 2BLLA 2Q1WA 2PFGA 5AXBA 1X14A 4IGEA 3WGIA 3PHLA 4PGFA 1F0YA 4CLEA 4K26A 3JD1A 1T25A 4YA6A 3I9LA 4TVOA 3K92A 4ZQEA 2QRKA 2Z1NA 3I4FA 3KB6A 2FOIA 3CMCO 1PEDA 5F5NA 4B4WA 3W4JA 2CDAA 4D0SA 3GVHA 1E7RA 2EEZA 1QYDA 2OGUA 1PWZA 4BNTA 3WYCA 4YJFA 3PDJA 3KLPX 2J3JA 2RCYA 2OO5A 2PZJA 3MJCA 1YQXA 4WCFA 5L95A 1JLLA 3M1AA 4CM3A 3CPSA 1YB5A 4W6ZA 4CJXA 3KLMX 1ZH8A 1EK6A 3H9GA 3LT4A 1W6UA 2EWMA 4NH4A 4AJIA 5TJHA 1DXYA 3O03A 1EK5A 2O7SA 4FCCA 1E3WA 2G82A 5KVQA 2R2GA 3ORFA 2PH5A 4OXNA 1DPGA 4W82A 3AY7A 4AJ2A 4ZICA 4CPDA 2WWRA 3KSUA 3E18A 4XIJA 4Z6KA 5TRTA 2VWQA 2NVUB 3LQFA 2NTJA 4EEXA 3PJDA 4UULA 3PLRA 3KV3O 3DB2A 2EHDA 2CD9A 3GEGA 1WNTA 3NKLA 2HMSA 4KWIA 4K1LA 2FR1A 2YHIB 3ANMA 4FR5A 1T2EA 1UP4A 2GN9A 5F5LA 2EP5A 4D46A 1C1XB 2IE0A 4KOAA 2WE8A 3GEDA 1MV8A 3ON5A 3OJOA 2A9FA 2ZK7A 1KC3A 4Q3NA 3FCOA 2Y0DA 3WIDA 2H6EA 1EQ2A 2O48X 5GY7A 3AM4A 1RM0A 1V0JA 3ST7A 3O38A 2NU6A 1L7DA 3M6IA 4OXYA 2CVOA 1PGNA 2VNSA 4RVSA 4GPD1 7MDHA 4DGSA 1U7TA 3GAFA 5HS4A 3JYOA 2G17A 1UXHA 2B83A 2H5LA 3SBOA 5T8KC 1NFFA 4MVJM 5H81A 3ULKA 1E7YA 4GKVA 2DPGA 4LGVA 2PD4A 4IIVA 1ZZEA 3LLSA 1E1KA 3NT5A 5TT1A 3BTSA 1KEVA 4MIEA 3JD3A 2X9NA 1HYGA 1GV0A 2NVUA 3BMOA 4I1IA 3OBBA 4BNWA 1IYZA 4XZ3A 1DBVO 1NAIA 2Z95A 1B8UA 3VOSA 4M54A 5C7LO 3PEFA 4ZQFA 1I33A 2VT2A 3MWDB 4GVXA 4IM7A 4IGFA 4MP8A 4RCVA 4L4XA 3MEQA 1KEWA 2BELA 4GMGA 2JFGA 2VHWA 3VHRA 4DPMA 2X22A 2W98A 3JQ7B 4AJOA 4K28A 3C3XA 4BMSA 2G76A 3HN7A 4J7CA 3GT0A 5JAMA 2D2IA 1DEHA 2OMEA 4J9UE 2VOJA 3DBRA 3DL2A 3LF2A 2Y05A 2Y1EA 5BSGA 3UAGA 1Y81A 5ENVA 1LDGA 5AXCA 3OF2A 3OECA 1PJ3A 2W2KB 3I9NA 1H6AA 1E7WA 1ZK1A 4CR8A 1ZCJA 2WD7A 2X1HA 3DHYA 2BGKA 1JAXA 3ABIA 1T2CA 1B14A 3ROQA 1PJLA 5FFFA 4CM1A 3ZHZA 1O94A 3JQFC 4ND5A 2WDZA 3JQEA 3JD0A 2W2LD 3JSAA 2I67A 1TXGA 2GN4A 1RPNA 3RQSA 4YRBA 3JYLA 2P2SA 4NBVA 1YJQA 4OSOA 4ZJUA 1N1GA 3SEFA 4U0JA 4PVDA 4Q9NA 4RDHA 3DFZA 1D8AA 2F00A 3MTJA 4ZRNA 2XAAA 3I9OA 1U1IA 3VKVA 1LLCA 3A28A 1G1AA 5AYVA 3B20A 3LC7O 3BA1A 3DTYA 1LU9A 2C82A 4OXKA 4O5OA 3D4PA 3ZI0A 5IDWA 4ESOA 4Z3KA 4ROSA 1HDZA 4D79A 1GV1A 1ISMA 2BFOA 3GZNA 4WECA 1NX6A 4PG6A 2PTGA 2Y1FA 1AN9A 1I10A 5C5IA 2WD8A 1TEHA 4W7IA 4Y6SA 1T1RA 1NHWA 3AW9A 3Q1LA 3U49A 4UUPA 1GQ2A 4N18A 1VPDA 3RFVA 2EKLA 1PGJA 4FBGA 4I08A 5JDIA 4S3MA 4IBOA 4IZHA 3TZKA 5GMOA 4K6FA 3L0DA 1PX0A 3N58A 1ML3A 4CM4A 1DAOA 1E3EA 3DHNA 5ENDA 5B4VA 4RF4A 1R15A 4ZA2A 3B1KA 4BV8A 3LLVA 4CMHA 6LDHA 3RAJA 3GVIA 1EUZA 1ADGA 4A5OA 2WYWA 6ADHA 1DC5A 3UXYA 5KJ6A 3DC2A 2JHFA 3RUAA 4XGNA 4YT2A 2GERA 4BUCA 4FFLA 1EVIA 1QR6A 4E5KA 3GVXA 4PFJA 3C1AA 3VZPA 1TVEA 3ENNA 3TZ6A 4AFNA 4OQYA 4D0RA 1ZNQO 1G6KA 4CLRB 3TRIA 4B8WA 1MXFA 4M1QA 4RV9A 1UDAA 3QWFA 1UZLA 4AJ4A 2HJSA 5T67A 4J90A 4WASA 3EGOA 4ZN6A 2BMAA 4DTIA 3A06A 3L4SO 4AJEA 4BNKA 4JK3A 4UUNA 3LVFO 4R69A 4GLLA 4JQCA 1BTOA 3FSRA 4NU6A 4KUGA 3TJRA 1EBUA 4E2ZA 2VYNA 3GNSA 3IL2A 3DFUA 5T73A 2X8LA 3NTRA 3ZHYA 2X86A 3I9JA 1R4MB 4DUPA 1ZEMA 3JTMA 3H8VA 3NX4A 3ZWBA 3K5PA 4AG3A 5J9GA 4BB5A 1BWSA 1LDMA 2GR9A 2Q2WA 3MTGA 1C0IA 3HZZA 3ETDA 1V3UA 4II2A 3SLGA 4AJHA 1UJMA 1VC2A 4BNXA 1WZEA 3IS3A 3TPCA 2AMFA 4OOFA 1ZUD1 1QSGA 3PI7A 3HB5X 3PIDA 2VZ9A 2E6UX 3DBHB 1PQPA 1Z6ZA 1WDMA 4DVJA 1DOHA 1H5QA 2YV1A 3Q3CA 5DBIA 4Z0TA 3CTMA 5IF3A 3ROMA 3I23A 4GMFA 4FPXA 3DO5A 1PGOA 3SC4A 3Q2IA 3GEMA 2GD1O 1NR1A 2ZIZA 3LK7A 2YDYA 3F1LA 1Q0QA 1P33A 1NXQA 4R3NA 3OQBA 3CSDA 5I9MA 2Y1CA 1YL5A 3RUIA 4BS9A 3TL2A 4J16A 4RGBA 4AJLA 4B3IA 5CEJA 1K2WA 3R3JA 1Z7EA 3I1JA 1H9AA 3BMQA 1DSSG 1LQTA 2Q2VA 4BNGA 3K2EA 1ZK0A 5JC8A 3V1TC 1RYEA 3GFGA 1NHGA 2ZB4A 3P19A 3PQEA 3Q11A 3DAFA 1P1RA 4D3SA 4XDZA 4IUYA 5DBGA 2O3UA 5A3JA 5T6BA 4DPLA 1KS9A 4BHTA 4AJPA 5AQ1A 2JD2A 2W2KA 4LCEA 1GYPA 3F46A 4JXKA 1T4DA 4DIBA 1R12A 5JYAA 5G0SA 1U8XX 1I3LA 5A9SB 4B7CA 3GPDG 4BMNA 2A4KA 2NTVA 3E9MA 3UUWA 5HBRA 3VZRA 4N7RA 5IXSA 3NV9A 1PZFA 3GQVA 1P45A 4DPKA 3PWSA 1GEGA 2J8ZA 4DYDA 1QLHA 3ZV4A 3D7LA 3WMWA 1Z74A 2I5PO 2CFCA 3SVTA 4KQWA 4QUKA 2PGLA 3EVTA 4C4OA 3C1TA 1BSVA 1EE2A 3WFJA 3OJFA 2ZYDA 4IDFA 4ZU3A 2A94A 1N8KA 3HN2A 3CZMA 3U09A 5FEUA 4RORA 2AE1A 3ZU5A 3R3SA 3ANNA 3WSWA 4OSPA 4PLFA 3IP1A 3NT4A 2Y99A 3C1OA 1R6DA 1MXHA 2R00C 4YAEA 2CDBA 4XR9A 3LU1A 1DRVA 1BMDA 1SOVA 4JBGA 4QT0A 1PWXA 1IE3A 1LXCA 2O3SA 1DFGA 2J6IA 4CUKA 3WQRA 1DRUA 2JD1A 1VL8A 3BTUA 5CEFA 1RJWA 2HDHA 3S1LA 3T7EA 4BNUA 3LF1A 5B1YA 2EP7A 1GTMA 4PLZA 5HM8A 3GG2A 2ZTVA 3D64A 5KJ1A 3U4IA 3AWDA 1HXHA 2P9GA 4QFCA 5L45A 3DBLB 2F1KA 2AA3A 1F8FA 3QJ5A 1I36A 2ZJ1A 1YRLA 3KSZO 1E0DA 3NDJA 3U4HA 4J2OA 1ULUA 4NZ9A 1B8VA 4BL5A 2VN8A 3TF5A 1H93A 4YAGA 2FWMX 3RC1A 1WW8A 4YDRA 1DIRA 9LDTA 3WMXA 4MPDA 4JNKA 1SBYA 1AXGA 3C7DB 3RD5A 4D3FA 1A5ZA 1NTOA 4YT8A 5JNLA 3NT2A 3S2EA 4E33A 3H65A 3V1YA 3KO8A 4MVJP 2PKQO 2C59A 3MOIA 2NV6A 1LDBA 2AQ8A 5I7EA 2GO1A 3ZHXA 3MCVA 3IMFA 5KVSA 1UP7A 1DC4A 4QECA 1Y8QA 2P68A 4EUFA 4CM9A 5B4TA 2ZTMA 2UAGA 1MP0A 2NU7A 2D5CA 2LDXA 2HQ1A 4GL4A 1LLUA 4WCDA 2JCXA 2RH8A 1DRWA 4WLNA 1YBMA 3UHAA 2Y67A 3GMDA 4QX6A 1O6ZA 5HWSA 4GGOA 4M55A 1KYQA 3GF4A 4DQUA 1Z73A 1J5PA 4DC1A 3OM9A 3ZNQA 2CMDA 4OIMA 3AI2A 5A3VA 2FP4A 1NVTA 1ENPA 5DF1A 3BZUA 2GLXA 2ZQYA 4PG4A 3TWOA 1TB4A 1HTBA 3QVOA 4A7PA 3E03A 4BNIA 2Y93A 3ZV3A 3PJEA 2EXXA 5JFOA 1JQBA 2Q50A 3DMTC 2YUTA 5EL0A 4XIYA 1A4IA 1AHHA 3BMNB 3GZ4A 5AXDA 4JP2A 4CMJA 4JLWA 5HTOA 4J9VA 1U2GA 5CG2A 4JN6B 3OQ1A 3MJVA 1YDEA 4OAQA 5HA5A 3EY4A 1DIAA 2O23A 3ZDFA 3PZBA 1W0CA 3FI9A 4J1NA 3DAPA 3IKVA 3L9XA 4BO3A 1Y8RB 3C8MA 1YWGO 1GQYA 1KY5A 1GYRA 2Q1TA 2WEKA 1FDVA 3FTPA 2RHCA 1X7DA 2Y68A 3T7CA 1IUKA 3R0IA 3I52A 4LW8A 3ONFA 4EUHA 3QY9A 1BW9A 3RC7A 2GSDA 4H7PA 4IJWA 3JQ9A 4BKOA 5IZCA 2B5VA 3CZRA 5A9SA 5CP8A 2R00A 3QWBA 8ADHA 1ADFA 2PGJA 3BTVA 4LMRA 4YJHB 5I7FA 1U28A 3OQ6A 3TZCA 3SX2A 5CDSA 4NDNE 1WMBA 4TRRA 2HCTA 4JJIA 4BNFA 4IXWA 3HDHA 3AFNA 2V6BA 5EESA 3IC5A 4RPLA 3WS7A 3WSVA 4XDYA 3NRCA 4OYRA 2Z1MA 1ZJZA 3FNHA 4U6QA 5IDQA 1VSVA 4B7XA 1GQQA 2POQX 4NI5A 5KTKA 2W90A 1PJTA 1W4ZA 2WYVA 3VPFA 1ADBA 3KYBA 5DCYA 1XKQA 2BHLA 5JYEA 2GN8A 3OMLA 3GGGA 4FGSA 4JP3A 4DQXA 4HP8A 1ULSA 4R68A 3U62A 3PGJA 1IHYA 2NM0A 2X4GA 5KWEA 3CMMA 1LSUA 1D4FA 1RKXA 3R1IA 1JAYA 4FFNA 2DQ4A 2WMDA 3JQGA 2HKIA 3G3EA 2HRZA 1DJQA 1N9GA 5CFZA 1C0PA 5IZCC 1QV7A 4CODB 3WBFA 1DHRA 4XWYA 2JL1A 3W1VA 2DFVA 1TI7A 1ZEJA 1HE5A 4YRDA 2H63A 3T4XA 5L40A 1GAEO 2RHRA 4HFRA 3UF0A 1VJ1A 1R37A 4XQ9A 4BO7A 4BKUA 3HFSA 3OFSA 1GR0A 3OA0A 3RVDA 3EW7A 4HBGA 2UDPA 1QXSA 3E5MA 1NVMB 3ZN2A 1MFPA 4PLGA 4FIZA 4WOKA 4K9DA 1PZGA 2JAHA 3FPCA 4FC7A 4IS2A 1UXKA 4BGEA 1I24A 3H2ZA 4YBZA 2VRCA 4QO7A 4B7UA 1EBFA 1KVRA 1E1MA 2PR2A 4AJNA 2X0NA 2FPGA 2Q22A 1H6CA 2QZ9A 4M89A 2VHXA 5FI5A 4Y6RA 3E9NA 3WLFA 2XF8A 3RIHA 4BQPA 3Q6IA 4J7UA 1YJ8A 3UN1A 4HXYA 4BOYA 1SMKA 3GNQA 4PLCA 2NWQA 2YFQA 2G0TA 4L8VA 3LZ6A 3QQPA 3SLKA 4YYZA 3MWEB 4XYLA 3VPHA 5AOVA 3TN7A 1K5HA 2Z5LA 4MKRA 5I9LA 5JDCC 2CVQA 3WYBA 1LSOA 1VE9A 3SXPA 2Y66A 3JQCA 4CQMB 1ISFA 5CDYA 2X9GA 3ROKA 4XQEA 3IP3A 4MP3A 3K96A 4G2NA 1T2DA 5THQA 3VH1A 2I6TA 4N5MA 4YAJA 4EEZA 3AM5A 4CQLB 4NBTA 1I2CA 1D7OA 4PG8A 5BNTA 4J49A 2IEDA 1ISIA 4BGVA 2DBRA 4ND2A 4EJ0A 1IPFA 4XR4A 1MG0A 1JN0A 3KHUA 1I2BA 4W9NC 5A06A 3C24A 2C5AA 4MVJD 4DLAA 1YONA 3RCBA 2JD0A 2X0IA 3RJ5A 1I32A 1YE3A 3ONDA 4MDHA 3HJAA 3KOUA 4BV9A 4GX5A 5EPOA 4RJTA 3W6ZA 1E7SA 2H9IA 3GRKA 4BQRA 4D44A 2ZTUA 5ADHA 4WLEA 3LSYA 4FSHA 2QG4A 4RQTA 2HMUA 4RPGA 3H4VA 1LSSA 2VUTA 4TRNA 1FJHA 3OP4A 2GN6A 2CZCA 3DMYA 3ENKA 3PK0A 1GDHA 2C2XA 1ISJA 3GC6A 5JYFA 4FFRA 1QKIA 4E2XA 5BSEA 3INGA 3WICA 1Q2XA 4BNVA 3K6JA 2C2YA 2JJYA 5GZ1A 5L9AA 4AICA 2NU8A 4HFJA 2HSDA 4WCFC 2QRLA 4WLFA 4XGKA 1A71A 3V2HA 4YT4A 3WOHA 3EK2A 3F3SA 1AXEA 2GUGA 1LTHR 3ASVA 4Y67A 2XXBA 1UAGA 4YWJA 1VM6A 5TX7A 4L4SA 2ZKLA 1HRDA 4AVYA 4HFMA 1J49A 3E5RA 1O95A 3FPLA 3OJEA 4KDEA 3AFMA 1SO8A 3M1LA 4ONEA 4YJDA 3UH1A 3QRWA 3K8ZA 4TKMA 3ZWWA 3L9WA 4CLRA 4XJTA 5CPFA 1U5AA 3UW3A 4I5GA 2VUUA 1BHSA 1H6DA 2FZEA 4OKNA 3V1UA 1LLQA 5KCZA 1SAYA 1E6EA 1JDJA 4R9SA 4E31A 3C7CB 4BNYA 4IDCA 1JWAB 3WNVA 2VHVA 2PH3A 4WJZA 1T2AA 4BMVA 1P1IA 1VJTA 2VRBA 2W4QA 3PGXA 5L53A 2AHRA
chains in the Genus database with same CATH superfamily
4LF7B 1O94C 3BAFA 4WE3A 5GP1A 1CQZA 1Z4LA 5I7AA 4ZYXA 2L69A 2VPWA 3N3BC 5I7VA 1EJ0A 3DE2X 3FDXA 4K86A 4E1BA 5BV8A 3KQUA 2HN9A 1WTCA 3TCNA 2PZKA 2P4HX 1U7ZA 3FUUA 4N01A 4P22A 4CLOB 2XD4A 3KR1A 3C87A 1WW3A 2E49A 2VCHA 3OZEA 3V6MA 5JCJD 5JJBA 1XWFA 3MD9A 5BW8A 3VYVA 4WMLA 1UADA 4CFYA 2G7ZA 1UC9A 1ZMRA 1EVYA 4JL6A 2UYYA 1VYHA 3A58B 1DEOA 1NF9A 3AEQA 3PDIA 2IUYA 1EDBA 1W4BA 4ITRC 2RAUA 2VDJA 4X1OA 1W44A 3G13A 1V3TA 2WM3A 4K88A 3RLFA 1LPNA 3MA0A 2EJCA 2CF5A 1MLDA 4U39A 5BQPA 3KQLA 2DFDA 1E9BA 2F3RA 2QIOA 4N40A 2P9CA 4UM5A 4KFCA 2XIQA 4JC5A 1GIAA 1DV1A 1L5WA 4TMVA 2Q3BA 2RJ3A 4C06A 4GSKA 5BWNA 3DZIA 5A4KA 3AL0C 3IESA 4RL6A 3RAPR 2VH5R 2VNKA 4RMGA 2PGDA 3EUFA 2OZPA 1N8NA 3VPBA 2QUBA 1QYVA 3PF8A 4I81A 1VSUA 2PN1A 4NJEA 4OQPA 5B37A 4RVOA 5JQGA 3L8EA 2G1UA 1UMBA 5CHEA 1FY2A 2N75A 3AFGA 4WKNA 3T9AA 4EI7A 2BMDA 2YNMC 3ZXUB 1R0SA 5JD3A 2PKQP 1OV6A 3PQDA 1I79B 4NXNB 4V1CI 1DC3A 1MO6A 5EQFA 3R4CA 5K20A 3DONA 5JZVA 1XU9A 4ZREA 5K0BA 1FMFA 3MIZA 2ZI3A 4O2AA 3E1KA 2CHVA 4NMHA 4X0EA 1ETUA 1M8JA 3U4CA 3ZHVA 2CDCA 5AJTA 5GJCA 1UBHS 3IAEA 2X6QA 4HLCA 3NAGA 4URFA 4FW8A 1S1CA 4HUQA 1Y1PA 4AKTA 3WIEA 1BGWA 3A10A 3WNQA 2X5XA 2C2MA 4FMDF 2GZ3A 1HG1A 2BRUA 2Q6VA 3CH4B 3QVGB 5CD9A 2R6GA 1VHDA 1G41A 1DARA 3DZBA 5FAXA 4U7DA 3ZKAA 3HSYA 1N2CB 1TDJA 3EXAA 4BVAA 2G63A 2QQ5A 4W4TA 2C95A 4BX9A 4NFYA 1WPXA 2AJBA 1Y6JA 2D2XA 2V7WA 3JD2A 3QG5A 4LXIA 4TL8A 1P9NA 1EHIA 2I4IA 3HV0A 1HDYA 3RKUA 2NGRA 3FRIA 3GBSA 2X19A 2J87A 2IHTA 2R4TA 3O93A 3RC2A 5C32A 4PLWA 1Y8QB 4FJ0A 4DZTA 1QPBA 3LBAA 2VF8A 3PPWA 4GS5A 2II6A 2PSDA 1EXVA 1CF9A 2GD0A 1WUHS 4FC6A 3CJTA 1J42A 2NZ2A 2PSJA 1OTHA 4D5EA 5F4BA 1NLUA 3EIWA 3MJHA 4U1RA 1SHJA 1IFXA 1JG4A 1XCLA 2VI5A 3MIIA 4FQ5A 3V46A 1YBAA 1CZOA 4G85A 5CM8B 2C0QA 4KWHA 5BSUA 4V1CB 4P5PA 1WSWA 1UKZA 4OO3A 4IQ8A 3FVRA 4KH0A 3E8MA 4F8YA 4NJMA 1K08A 1OXBB 3HFGA 2VCYA 4IPTA 3IQXA 4IV8A 1XXHA 1L2TA 2XD9A 3NDPA 1T9KA 4F5YA 4OHWA 3VSAA 1T0IA 4L74A 3AEXA 4MV5A 3JATA 1UEJA 4WESB 4YB8A 3RYHA 4R0MA 4NS1A 1L7QA 1Z5PA 2DTXA 1RCUA 2VP6A 3SHTA 5L4NA 5EZYA 1O4VA 1VHQA 3DT9A 1CF4A 3FY4A 2EZ4A 4LK3A 1OOEA 3Q72A 4JEMA 1PNTA 4MJ3A 3GA7A 1B6SA 1VI5A 4RIEA 3BFPA 2HFKA 3IAXA 3T1QA 1CBUA 3H16A 2Q5IA 3HCWA 3TLGB 2YWFA 3EGDB 3OIDA 3P4UA 4AECA 1DIGA 5KOIA 2VZEA 3HRIA 3TJZA 1GKLA 1TF2A 1LSJA 2YFYA 3AL2A 3MTDA 1LA2A 1YGPA 2GEKA 3N53A 4D6YA 5IBCA 2J09A 3AJAA 1J8DA 4BTVA 4CBVA 1U2GC 1Z7GA 4G26A 3RFFA 4GAEA 3THYA 2D7DA 4WXHA 6REQB 5GONA 4KG7A 2NXEA 1J1UA 5AUPB 3WGUA 2RSLA 3PNPA 3BH0A 4YMLA 3KDPA 5JNSA 4HGZA 1KI6A 4GZ5A 4IZIA 2RHDA 2X5KO 1KE2A 3U3RA 4C9BA 1CFZA 4EHLA 3SJCA 3WLEA 2WIBA 4ZQHA 4UNRA 3ONNA 1Y9AA 5G3ZA 3MUEA 4R2XA 1B41A 3EWIA 3PV0A 3U3DA 3DV2A 1FCJA 3D02A 5JH7B 2SKCA 2ZJ2A 3GLRA 1ECBA 4WWHA 5TXGA 2XGSA 3TNDA 4EFLA 1QIMA 3L6DA 1OBOA 3KKMA 3DBIA 4NYIQ 2VJLA 2J3MA 3GLVA 1W48A 4RZHA 1JXMA 1KBZA 1YR8A 1M2KA 3S29A 4YQZA 3UT0A 1QLWA 5JY1A 3VISA 3CPHA 3C15C 1RWMA 4NF2A 3O4FA 2IEZA 4QOIA 1X13A 3RF7A 1FP1D 1VZ2A 2NSHA 2ZDQA 2F43A 2PGXA 4NBUA 4OQNA 5EIBD 2YY6A 1J8YF 5HX7A 4GWKA 5C2JB 3T4UA 2OAP1 4JVLA 2FKNA 5KYUB 3EPLA 2J41A 3IIEA 3IBTA 1W9MA 2Q0QA 4O1MA 4OAOA 4UZSA 1H2YA 3U81A 2IY7A 1UBRS 2WUEA 1BYUA 1RCFA 2G36A 1JBKA 4I8XA 4J91A 2ODBA 4QPPA 1O96B 2GF9A 3MINA 2M6SA 4J4TA 5LYJF 5IN5A 5EMMA 3B6KA 5CGZA 1OH6A 1G60A 4LHEA 3VDRA 2ARKA 5DGXA 5FR1A 1F17A 1IAQA 2GFQA 3UWPA 2P0YA 2BD0A 3ZD9A 2WY2D 4LHXA 2RFLA 4BIIA 3COJA 4GLJA 3BSWA 2WFMA 3IOMA 4W6QA 1YA4A 2G04A 3G1WA 9ATCA 5CNMA 2XB6A 1AHNA 5IG2A 5EJ4A 2AFRA 1N36B 4ZVVA 1YK1A 1YAHA 5G4KA 1U4OA 3PRYA 2QQEA 1X2BA 3I9V6 3THXB 1WXQA 5AKIA 3SGLA 2FFAA 3CJQA 3NVDA 4KXXA 4PZUA 3H4IA 1PJBA 3P0IA 4GQAA 4C0HA 2QAIA 4L28A 4QTZA 3R3HA 4IJKA 2BP7A 2NLOA 3BK1A 1IJKA 1DVRA 4RTPA 4OXIA 4ISCA 3DF9A 3I3SR 4I9NA 5ALZA 1SVUA 3GUVA 1PT9A 2WM9B 4YN3A 5PGMA 3UA3A 2PUAA 1E5LA 1SCBA 2P0EA 1O0CA 1GPH1 1UMCB 4UTXA 4ZJZA 2ZCVA 4Z4QA 3GDGA 1I9CA 4A92A 2GXUA 3IURA 1N4DA 3HYLA 3PSHA 2E1PA 3LKDA 5DJ5A 1G66A 2DH6A 4JBXA 4O25A 3KXKA 1VGRA 2VRCD 1WCIB 1TQ8A 1NP6A 4KO4S 5C4MA 4UEWA 4CDGA 5IPFA 3LUPA 3A6LA 1W73A 4CL8A 2SECE 4AQYB 2HJHA 1BGXT 3I6MA 4C7OB 2RGGA 3JASB 5BWMA 3CT4A 2VXYA 2B92A 3OIUA 4UVHA 4HDKA 5EZ6B 2TYSB 1LV7A 1T36B 1UXIA 1T6YA 2H57A 4NHOA 4Q1VA 1XYVA 3HY3A 4DXDA 2NAPA 3ZK8A 3TNYA 3HDGA 3K53A 4QEZA 2NQ8A 1XDGA 5EMKA 3RF6A 3CVXA 1QHHB 5IKXA 1BGVA 2ECKA 3I39X 3K1AB 1Z6QA 4DEVA 1DRJA 4C2TA 1HNXB 3DV9A 2XNSA 4L0DA 4RKQA 1NUTA 4IIYA 3UOWA 3P1JA 1OFVA 1IBCA 3FROA 3OFJA 2GAAA 5ESWA 5GV7A 1JR2A 2C29D 3I6IA 3QU9A 5AMXA 4RVGA 3EP4B 2GJSA 4WXYB 2ERCA 3BJZA 4XQGA 3FYSA 2AVNA 2PD6A 3KUKA 4JBIA 3ZDEA 2NSDA 1PR3A 2ZIXA 5LQUA 3H6GA 1L5RA 2WZQA 3A3NA 3K0AB 4RGQA 1XTUA 2ZYWX 1SWWA 3NTLA 3ZU6A 2WP8J 2E9SA 2BF7A 2QRVB 3AVQA 3E3AA 2C4VA 3OBIA 4J2HA 4EFDA 2FPIA 1M1YB 1P19A 2I2XB 3I04A 3NWPA 1KI1A 1LQUA 1QK4A 2QL5A 3DOEA 3O1HB 4DMHA 1OLSA 3G6KA 4YCLA 2X23A 3CLSD 3E9DA 2JGFA 5I9SA 2JIPA 2QVLA 4DR2B 4CEIB 4BQQA 2QRMA 1T2FA 4UM9D 3TDMA 2QVYX 2QR5A 4HGOA 2IH2A 5ECWA 4F45A 1XPUA 1VL6A 4JROA 3FUWA 2P5YA 1QV6A 4JUAA 2DPHA 1JKXA 4OVKA 4HNGA 1Q74A 2VTBB 3C7AA 1LRLA 2XCSB 5IHXA 3B12A 2A35A 2HHJA 3HUDA 2KI5A 1EFRD 2XODA 3BIXA 1REQB 1ZUIA 3VO9A 4CMEA 4FI3F 2YHIA 2C7RA 3F5DA 1HYQA 1U0RA 2CSUA 4B3CA 4GMKA 5TB5A 2IUUA 1YQTA 1DS6A 3K30A 3LT1A 4HZUB 4JBNA 4OMUA 5LLDA 1ZJYA 2IU3A 2R8RA 3R41A 4JY7A 4MYHA 1FRQA 1NC1A 2WPNA 4UDYX 1I6LA 3CB2A 3O8OB 5DKFA 5CAEA 4NJOA 4D6PA 2GI4A 1Q15A 5K3FA 5IX8A 1XDSA 4LQDA 3IAM1 4PYKA 3ITDA 4ZZIA 3H6HA 3SS9X 1YCDA 3SHWA 3A1TA 1BXZA 1SURA 2F67A 2JEZA 2KQUA 3TRHA 1L8LA 4RHUA 4B80A 3L07A 2DAPA 3H11B 3H2SA 2H4XA 2BFDA 2WUDA 3K05A 4R8RA 3ET5A 3UMJA 3UWDA 3ZHTA 4BRUA 3NHPA 3EODA 3VPCA 5BN3A 3QW2A 4C08A 1RLUA 3JYHA 2AHOA 2ZXUA 4ZQIA 4JQSA 1GPBA 4DMMA 3GLFE 1E63A 3U37A 4RTRA 2HA7A 3GFFA 2XRMA 2O7QA 3K4HA 4N7MA 3WL7A 4C4SA 4NQZA 1A72A 2WINI 4YRKA 2Q4BA 3VJMA 2PKWA 4FGLA 1V95A 5LQJA 3NHSA 1SU6A 2RIPA 3G1TA 2AC2A 3GFSA 8ATCA 5KREA 1DIBA 4DV4B 2VL7A 4B75A 2DEUA 1YZVA 3I2YX 2WUWE 4P98A 3BUSA 4MGEA 5HF6A 3FFAA 2CK3D 2FW6A 1U2DA 3K94A 3TECE 4EHNA 4YCSA 2AW3A 3QE4A 5J2UA 1VIDA 3AXSA 1I3KA 4GR5A 2PV7A 1UPAA 1YR2A 4WD3A 1Y8CA 3MSXA 3S5UA 4Z8XA 4BYMA 4DLBA 4YMGA 2EJBA 4A23A 5HKBA 1FYVA 4R6WA 3X1ZA 2Q21A 3ZCUA 1RYZA 2WZBA 3VPXA 3R7WA 2ZRIA 2VSQA 1CFJA 2HNAA 4H35A 2DR2A 2XVMA 3S40A 2WF8A 4WUVA 4ARBA 5JXJA 2JI6A 3H17A 5EXXA 1ZN8A 5EJAA 3KZ1E 1M6HA 5I9NA 3T3DA 3PPYA 3LHKA 2VG8A 5F77A 1QF9A 1KYXA 3IOBA 1YH3A 3KKLA 4CGYA 5ISMA 1ADCA 3O94A 1R16A 2RAFA 3ZZNA 3ID6C 4TKZA 3SSOA 1CDEA 4BKQA 3RAEC 4BLRA 2H4HA 1FDTA 1SHKA 2ID7A 5JMTA 1XJ0A 3AG6A 2GAOA 2OHJA 1KI2A 3KJIA 3A1FA 2W0MA 4HLQB 5JJIA 3ZDYB 1ESNA 1Y5LA 3ZCVA 1D7AA 1QAOA 3EDMA 3ZVKA 3GLIB 4JUCA 1NR5A 1PR5A 4O4LB 3W7AA 2XUJA 1IJFA 2AFHB 3HCFA 4OM8A 3LQRA 1KDTA 3VAZA 2H8GA 2ZYSA 4ZK2A 1YNOA 4PCAA 3ONEA 3CW2A 1QH0A 4BEVA 4KACA 2VWPA 2PY6A 4RLSA 2RARA 3ZJTA 2XT6A 3OY7A 5A6SA 5E6RA 4MUNA 3COSA 5AHWA 4YH1A 5T8KA 5A7HA 4G0UA 4IG9A 1FX0B 1R50A 1R8JA 3QHPA 2SCUA 3QSYA 1PTJC 2COUA 4EJSB 2D62A 1Y9EA 1N2OA 3TVTA 3DM9B 1PF7E 1UBEA 4KDCA 3GJ8A 3SIPA 3I5XA 3WWPA 1UAAA 3RVPA 2WSYB 4GKAA 4KWTA 2F48A 2PFKA 3O92A 4LE0A 1L5LA 2PSFA 3VMFA 1NYLA 4C05A 1H4VB 3SBXA 1V6CA 2OOKA 3FOBA 4HQ0A 5CH8A 2VRNA 4OHZA 5TC4A 3W90A 3A2NA 2FCAA 3NIBA 4X7BA 3LO5A 4HH3C 5EJMA 4PYQA 1QC5A 1QFJA 3CG0A 5KOJA 1ZP6A 2Q5HA 1UBGA 1BKSB 1G8FA 2GM5A 3RHFA 2OHFA 2G71A 1MENA 1V8DA 2DMRA 4UBJA 4Y0NA 3UBTA 1HKUA 5ALJA 2BT4A 3M2PA 5KKCA 1HR0B 4PIPA 1XNQB 3VVMA 3ASYA 4RM3A 1Z7WA 3EP9B 3ONWA 4I9FA 2VNIA 3EP8B 1Y5MA 2QD4A 3FM9A 2OV2A 2XCLA 3SEZA 5DFAA 1VMKA 3N86A 2R8EA 4MS1B 3I4LA 2QE7D 1MX3A 4UUQA 5CLQA 5A5EA 1UP6A 1EEHA 2W5UA 3TL3A 2P3QA 1WB5A 2WICA 4NY1A 3L5KA 3GRYA 1Y4DE 3PPVA 4RV5A 4MPRA 4ND6A 1RNLA 4H4DA 2J6CA 2PRZA 4HLDA 5IS2A 5ILQA 4URUR 3RK1A 1WF6A 2Y3IA 3PXCX 3L7LA 5AJUA 2ZUVA 5JAQA 4GWGA 5I5EA 3F6PA 5A04A 1KFBB 2P5UA 2Q3DA 3UKOA 4QRHA 3GJSA 4GSLA 4W5WA 4CMIA 1P2FA 1RI1A 3RJ9A 5IFLA 1NBWB 2QV0A 1XZNA 3U1TA 3KPUA 4OLFA 2LV8A 5IUNC 3BE5A 4DEXA 2ZJ4A 4JYMA 1M75A 2N3ZA 2DVMA 2FZKA 2QMEA 2R4UA 4BLSA 1L5FA 1Y7IA 2QBYA 2FPNA 2R86A 3N6VA 3HDJA 4IINA 1R4MA 2NUPB 2I7XA 4KR9A 4ZHQF 3I6BA 5BMOA 4KJZA 1GITA 4OLBA 2GCOB 1W2HA 3ORQA 3GPIA 3AYZB 2IZZA 3WR5A 5KDLA 2X2PA 4TT3A 3JW8A 4FXPA 2JFBA 3MQFA 4PQRA 3QBDA 4R8SA 4XH9B 5G41A 3O90A 1XL1A 1N8SA 5G0TA 2A7XA 1PG5A 2LKDA 2PQMA 3IEUA 1CUYA 1OASA 2AEJA 2ZT5A 3GVCA 1C0LA 5SYAA 3L0ZA 4IDOA 5E9AA 1C4XA 3PGA1 3UCEA 2RKWA 1I5EA 1RHJA 2O2CA 4MB2A 3RQIA 2VHQA 4LWPA 2MYNA 4GVLA 3CLVA 1CDOA 1YUBA 2IYWA 2WYUA 5GM2A 3UB3A 5LU9A 3LCVB 3N2KA 2AZXA 3JAWA 6GPBA 4L0MA 4LVCA 4C0JA 2M6KA 4FWIB 2SKDA 2BSXA 1P5RA 2D4HA 3H9QA 4ZZ2A 4MRRA 3QFRA 3Q5EA 5M34A 1AH2A 5M6DA 3W3AA 4PAQA 1OLUB 2DE0X 1OMOA 2OK8A 2CJWA 3KWFA 3SZRA 3OSUA 2WVJA 1IUOA 1X19A 4PY2A 1BX0A 2Z56A 3PA6A 4JJFA 4X95A 4R1TA 4C03A 2H4ZA 1ONSA 3GT3A 3Q2OA 4QULA 4CG0A 1WVIA 4HLUA 3QEKA 4MUAA 5FYDA 3S8YA 1I7MB 1XZHA 2GNOA 3E8XA 1O8CA 3AF5A 1DUVG 2HJVA 4HQLA 5D6NA 4B8ZA 3UJDA 1DKUA 4B6GA 2Y92A 3H1GA 4TWIA 1AN0A 2QSYA 4TLMB 5K45A 4XRRA 4Q1DA 4XQCA 4ARUA 2PS3A 4LISA 4RH3A 3L6OO 1FNBA 5F3RA 3RBZA 2QHXA 1E1CA 1VG0B 1BROA 1IBRA 2ID8A 5E1OA 3TLYA 3UQZA 4ENSA 5TS3A 2XNJA 2FPGB 2N1MA 4K8OA 3RSCA 1RIIA 1C8BA 3DE7X 1RYFA 4HEHA 4H1WA 4MK4A 1PDVA 1J7KA 1ZINA 2FHPA 2XMZA 2GHIA 3D4BA 4MRPA 4RK6A 5BT9A 3FOFC 3I8OA 4PRLA 1E4EB 1C80A 1G2OA 1JE1A 1K6JA 4RHYA 5KHLB 4KPYA 2PEYA 1OUMA 4U7WA 1KQNA 3OQJA 3S6JA 2GZDA 3R6LA 1X7XB 3SE0A 3V42A 4F5EA 2O8CA 5EINA 1NVVQ 1QZZA 2IHYA 1I4WA 1IZ0A 4KVFA 4JI4B 3PENA 2H11A 2E4AA 5C34B 2Y27A 4CFSA 4HLNA 3EZ7A 4PE5B 3F6RA 4HZGA 3RJMA 4DZZA 1U8EA 4RMJA 4F84A 1CIVA 1V6AA 1XU4A 3NRBA 4P9NA 5E2AA 1GKIA 3JWHA 3A9UA 5KYYB 3D6AA 2ILVA 3DXXA 4DEYA 1EWRA 3N0TA 2XYVA 3PF9A 1I8TA 4IDBA 2BDEA 4LZZA 4XD7D 5JRJA 1VCHA 4F4FA 1LX7A 4CL3A 3QLUC 1WKVA 3IQWA 2JGNA 2QYSA 2BI7A 4JT9A 3G2JA 3TX2A 2WV7A 1X77A 2UXBB 2MSNA 2AH5A 2CBGA 2R1VA 4KSYA 3R9IA 3H87A 2XTMA 1YJAA 2H1RA 1SG6A 2B1JA 1PUIA 1Z4MA 2EZUA 3GCXA 1F8UA 1CC1S 1Q7CA 1PJ2A 1J0AA 1IY0A 2HA0A 3AY0A 1BC5A 3QBEA 1QMHA 4R01A 5A5GA 4Y8VA 3V8NA 1FUEA 3IRUA 2WKQA 2XB4A 4A6EA 4CR7A 1DOZA 4YS6A 3RB8A 2BKUA 4TT3D 2UUCB 1Z2DA 5IDXA 1SIBE 1X1BA 3TLBA 3IIMA 4YRMA 4CETA 5JAUA 4DKJA 2K5UA 3C3JA 4RPKA 3F90A 4L73A 1M2VA 1HQKA 1IHOA 3AHIA 1JFRA 3PNKA 4LHSA 3KR2A 5HHTA 3SQMA 1M34E 2GPWA 4Q3AA 3STUA 4UVDA 4F9FA 5AW9A 1L5NA 5GJBA 3G23A 3DNFA 2BM8A 3GGCA 4FFVA 2ZRHA 3UK6A 3THXA 2BZ0A 4RULA 5C1IA 2ZVDA 1XGKA 2ZDHA 4V2UA 2PNFA 4F2WA 1VCMA 2ZJYA 3G9XA 3MM4A 3R6DA 3I83A 5CVCA 1KK0A 2B3TA 1P2TA 1VOTA 1WPRA 4Z3DA 3T1OA 3UY4A 5ADVA 2HDWA 4U2CA 1O03A 4V03A 2C61A 4R54A 2LVBA 3LG2A 3LPMA 3O82A 3QBJA 4MUGA 3UJCA 4B44A 5J1SB 2CJXA 3LPNA 2XT0A 4M98A 4IS3A 3HVKA 3RVQA 3SF0A 1WDTA 1X1AA 1P1KA 3L04A 4BDTA 3ADPA 1XSEA 4HYYA 2IYFA 2Q3LA 4QG3A 2B8NA 5CX1B 3LBHA 5AOBA 1FVFA 2VDLB 4FWBA 4MNTA 3U7GA 3KTFA 3KXDA 2QUJA 2WU8A 4R16A 2H48A 5BVHA 2GJ9A 3GD5A 4J0DA 3FNEA 2CFIA 4RZ3A 3LBNA 3PIIA 4JBLA 3ZY5A 2JGJA 5D51S 4TSFA 1G21B 1NFQA 4QRIA 1TRKA 3RVSA 5CBKA 3MAJA 1RQ2A 2F7SA 3DO6A 4I5FA 3SAJA 5FWNA 4KPEC 5CUQA 4CG3A 5JD4A 3TRKA 2HQBA 2WTAA 1GT6A 1DINA 3I53A 3Q87B 4UTNA 4AI6A 4N3AA 1NM5A 1Y1QA 5DTIA 3R7AA 3TDNA 5KJFA 3CGWA 2ZYAA 1ZA2A 4OQZA 1BQ3A 1C30B 1JJBA 1MVNA 3RABA 3VSCA 3OICA 4CU2A 4YPVA 1VJ0A 3JX9A 1V35A 2C9BA 2C4KA 2KHZA 4KNWA 3BCUA 4TQAA 4ZO8A 4AW9A 3GLFB 1TYEB 3AONB 2ZM5A 4FM9A 3EZFA 1F2DA 3C6YA 1H94A 4LF8B 1GKUB 2Z3VA 4IEFB 4NV3A 4WINA 3BHMA 2A30A 3EPBB 1ZGCA 2CLEB 1CY6A 1CULC 3OIYA 1X70A 2FFHA 4FYIA 3ICPA 4MQBA 3E61A 1YL6A 1I1HA 1CWUA 5JO9A 3JAKB 1K92A 4ALJA 3AHJA 4WOJA 3DDOA 1MB4A 2GCOA 3REGA 1E2MA 1YCHA 1COWD 2D1YA 2HHCA 2JFFA 3QE3A 1P74A 1BE8A 4EB6B 1FSZA 1O97C 2NADA 3TD9A 1SQ5A 4HYQA 2R1TA 4BX3A 4GEGA 4OY3A 4R8LA 1A27A 2HBYA 2ZDGA 4KQFA 4M6WA 4EW2A 1P0MA 3AB8A 3IEMA 3VPGA 4LV8B 4CTOA 2QTWB 2XBMA 1CY7A 2OHIA 1JDVA 5DX1A 3WGNA 4R2JA 4UNIA 4C3UA 4DA4A 3LCUA 3AJDA 3A14A 4TTVA 2RGDA 1GPWB 2H1OA 1QO0A 3SSNA 1SD5A 2PBRA 3AR8A 4IWYA 5JXWA 4IDAA 1ZKMA 2UZ1A 5JNUA 1O5OA 4OGWA 4XEHA 1IONA 2O2YA 1ABFA 1T4CB 2QN7A 3EZXA 3ZLTA 5ITVA 2ZBUA 1IZ9A 1RVDA 5FT9A 2O8DB 4GHWA 4EIWA 1UMDA 1WQ3A 3TW0A 5TQJA 5FUMA 2H2AA 2IF2A 3PYXA 5FAKA 1GPLA 1H2ZA 1J2TA 2JHAA 4ZVNA 5JG7A 1HSOA 2DBQA 4XWGA 4JI5B 3LPCA 2AS0A 3A9CA 1Y3IA 4ZCRA 5JJCA 4JS0A 3DR3A 1AA9A 3VDMA 2QBYB 2CKDA 4ZEWA 1J25A 3B6IA 1SUPA 1JIQA 1CEEA 3CRW1 1IQUA 3SZ3A 1QVAA 1TAGA 1XAIA 3AY6A 3I1YA 1E9DA 2ZSFA 2E0IA 2SHKA 3UJ8A 4ECAA 2QENA 1NT2A 3BSYA 3OO0A 1HK7A 2JC3A 3NC0C 4DUYB 1JG7A 3KEOA 3A1EA 5EP4A 3OWHA 5ER9A 3RI3A 2JFXA 1PNOA 4G1EB 1HZJA 2CXNA 3BXHA 4ND4A 3E7DA 3HFRA 4M86A 4AG5A 5AW7A 4DC0A 1X86B 4O59O 2FSVA 1JFLA 2ZREA 3R24A 4JASB 3Q7EA 2C88A 2IHUA 3S99A 2FZCA 4P93A 4TL7A 4F4IA 3OE4A 4UATA 3GLGB 4WKPA 1AZLA 1WMEA 4KQJA 5DISB 1D4ZA 4A5SA 4ZOQI 5TJ9A 2OO5C 3EUAA 3AEZA 3BDAA 1VB5A 1MA3A 2YFHA 5K0FA 4FYXA 3HYTA 3HDTA 4RKEA 3WQQA 1AOXA 1Q1BA 1TCVA 3C8HA 4MO9A 3NWBA 4IIHA 3OCVA 4M1EA 5EKXA 3GPBA 5GGXA 1KDPA 1RYDA 3CRRA 4FFOA 4QXQA 1DKLA 1EXDA 1ULHA 4CKCB 4PWZA 5KYVA 1KAGA 2IZ0A 2IGTA 3O2NA 1XDDA 3WTCA 4DIOA 2C7OA 3U5ZB 1IPEA 4Q01A 4JYZA 3EC7A 1YA8A 1XDWA 3PUXA 4ZDWA 2CCJA 1BH6A 1LDNA 1XD9A 2A6PA 1ODSA 2YW2A 1BH2A 3ZCSA 4Y2HA 4CTNA 2XMQA 1AQ6A 1JSCA 2XUOA 4H60A 2WOJA 1PHPA 1DKPA 1P1HA 3AP2A 2IHKA 3WA6A 4ZI7F 4MQUA 2XVZA 2G0NA 5KDOA 821PA 1B26A 1DDGA 3SOZA 3LWNA 1ZI9A 2ZCUA 4E21A 3IOEA 3VJRA 1GSIA 2AYZA 4MAMA 4G84A 1TTTA 1T9GR 3LDUA 1MQ9A 4O6VA 5FPTA 4XIGS 1G8MA 3COYA 3ZXXA 3CLSC 4IDQA 2A3NA 4ILEA 4AF7A 3QMVA 2V6FA 4KN8A 4OHFA 3ZH2A 3WL6A 5DI9A 1G9SA 3EHEA 1L7PA 2UZ0A 1TKCA 4YXFA 2O3TA 3D1VA 4KQGA 2DKFA 3ANXA 2YIDA 4QUGA 3PQ6A 4G9EA 5KX5B 1YI8A 4E2WA 5FDFA 4X60A 1JVSA 2B69A 2GJKA 2C8KA 3NHZA 2WNHA 1S8FA 1ZESA 4RFSA 4HAIA 4IJQA 3ZWYA 2GBGA 4HNVA 4B6QA 3UJ6A 3SQWA 2P4SA 4XD2A 5KDDA 1BXGA 1GU7A 1D2AA 3X2EA 3WL8A 2OLKA 2Q5OA 1UJ2A 2PZMA 4IH4A 2IS1A 5HS6A 3HB0A 1NKVA 1OSNA 2R8BA 2W7TA 2Z30A 5GM1A 4YTEA 4J07A 4UTZA 4H1HA 2ODQA 4W1PA 2P6OA 5JCZA 9LDBA 4QOGA 3STVA 1I7QB 3W4KA 4HVLA 5B55A 4J29A 4KUEA 3VNSA 2BE7A 2O0LA 7GPBA 3DKPA 3BC1A 3OETA 1K5PA 1UR5A 3WBBA 2HHLA 3K73O 3NC1C 1PYGA 3F3KA 4FT2A 1HDGO 1MQAA 4MWTA 3C8ZA 4FFMA 4K87A 2YS6A 2JLZA 3B2NA 1MZPA 3RS7A 1ISGA 4MYDA 3QEMA 1QYRA 1RJFA 4I6JA 3N07A 1D0SA 4RFSB 1FQWA 2QT0A 1UKEA 2QTAA 3NUQA 1HT3A 1R5NA 2FQYA 4NESA 5F1OA 4PN7A 2G67A 4AUNA 1V5FA 1S2OA 1KA9H 4JCOA 5TQ2B 2CMHA 3U40A 3BCRA 5ILOA 3UV6A 5BR7A 2CNOA 1BDBA 2QNRA 1Z13A 2MTBA 2A92A 2WC1A 3LC1O 4L95C 1M8KA 2D4AA 2IYPA 2PSSA 4LZNA 4NE9A 4YP0A 4ROTA 3WHPA 3A9SA 3ZQ4A 5JNWA 3PD7A 1TT7A 2A58A 3QMWA 4JSRA 2BM9A 3D2AA 2H16A 2E5LB 1BS1A 1K06A 5GZ3A 3A9TA 2ZJ5A 4O0LA 1NSYA 3RG8A 4KITB 2VT3A 3FRHA 3BRSA 3UWOA 1HG0A 2ZRJA 1F2UA 3NHYA 2B7CA 3JCZA 1SGWA 3S3TA 3F7NA 3W8EA 5B12A 1MW9X 5BW5A 1GHTA 2EW2A 4FUQA 3H97A 3BB4A 3SX4A 4UFPA 2TS1A 3AUTA 2UZ4A 4QDKA 1ACMA 2VJMA 1JW9B 3W04A 1QHSA 3UOGA 3O8LA 4I4TB 2CFOA 4HB4A 1EE9A 3IB6A 3H5IA 4HD8A 4X6XA 4DR1B 3K16A 1CHNA 4BBJA 4WV3A 3U2QA 3A6KA 3HDQA 3P96A 2I76A 1P2GA 2VA9A 4J4BA 2XOKD 4OCZA 1FP4A 5JECA 2YZ2A 3NM4A 2XR1A 3ZQJA 2P7HA 1MQ8B 1LLFA 2P2YA 3QNMA 1N5LA 3KT6A 3BGDA 2UVQA 1GL9B 3KQSA 5GOZA 5C37A 1SZDA 2OCIA 1A5BB 1HYEA 4IGKA 1R4NA 2PUVA 2GEFA 4QVIA 1N2JA 2DHDA 1BXRB 3FCAA 4DIDA 1IJEA 1SUFA 1UFVA 1VCNA 1XEWX 4G0PA 4U2EA 1QO9A 4MWEA 4AL4A 1H5NA 4BYGA 1ULTA 1ATIA 3S2FA 3V1LA 2Z6VA 4PSKA 3VQTA 4UMDA 3C74A 5M2QA 4OMFG 4XGQA 5IDYA 4MWDA 4HADA 3RRBA 2A1TR 1P6UA 2HGZA 5DZSA 3LO8A 3NAMA 5K0NA 3WJ1A 3CR3C 1B93A 2OL4A 2GS9A 2NUTB 3WKBA 4DV5B 1VBFA 5KS2A 3RROA 1SXGA 2O5VA 3AHDA 3HU3A 1ZO8A 3QQ5A 2YHBA 4M7OA 3ZV7A 4F2PA 3EEIA 2JGKA 4OJKA 3WAKA 3GLUA 3SZOA 4XCQA 5IJWA 4Q1AA 2HQSA 3LA6A 4CF3A 4NPCA 4UJ3A 5B7NA 2MSCB 1WCXA 1ZIXA 1B0ZA 3PJFA 3RYCA 3H5LA 1ZH2A 3ZS8A 1ZM3A 4I1OA 2YXLA 5JBIA 4P0PB 1KQOA 1P77A 2C1EA 2G80A 2OORA 3NNNA 3O47A 4IY1A 5JC1A 3SVZA 3HJHA 3QLTA 2XVXA 2D3TA 2X7HA 1CZKA 4UAVA 1TK3A 2X2EA 4AYXA 2WMOB 3IGFA 4N6NA 2P4QA 1SOWA 4E4TA 1NG1A 4PG5A 3KL2A 1EZZA 1XEAA 1N5JA 2E85A 1YDGA 2ZUUA 1X7YB 3PICA 4C7JA 5HFJA 1PDOA 5CLIA 5JJKA 4QTTB 3EA5A 1L5GB 1DX6A 3FXAA 3O74A 1JBEA 5HCUA 4A1OA 5IBPA 1D2EA 2AJCA 2Z2ZA 4RVCA 4W5QA 4CKWB 4DMLA 1WU7A 1DAHA 1LI4A 3OH8A 2PZGA 2ADMA 4LV6A 4D81A 1KJQA 3H1BA 3PNBA 3SYTA 2RGUA 4MVJH 3KZOA 4LSWA 4D99A 5LA6B 4UM7A 4PM4A 5A9TA 4NOKA 3CU5A 3ZKWB 2IYVA 4ZHQB 1UYJA 5JY6A 3N2KB 4GSYA 1SXJB 5BRNA 1NKTA 4YCBA 1QNFA 5A1JA 3A9WA 3ABZA 3JYNA 3SSMA 5IVHA 1KTIA 1FZTA 1P4JA 2NYAA 5K0ZA 2PWZA 3QYPA 1W88B 5B58T 1JIJA 3J7AC 1C8LA 3KBBA 5REQA 4DRYA 4QO8A 1TM3E 2A86A 2YN4A 4R6XA 4ZCSA 2J5QA 1U7DA 3I2HA 3ITNA 5DBHX 3NWEA 1F06A 3GUCA 4GZMA 4LHZA 4KGZA 4RMHA 4TSKA 2GVDC 1LFDB 3H7AA 2CMGA 1OGJA 1Y42X 3TW8B 4KXQA 4EQ6A 5AICA 3PC2A 4EVQA 2JAWA 2DULA 3PP8A 3TXXA 1RACA 5LR6A 5TGDA 3R6TA 2EKPA 2H2DA 3EXEB 3KD3A 3K31A 2AMVA 3COZA 3L8DA 1T9GS 4QGGA 1HE2A 2M6LA 4QGSA 1MW8X 2VS1A 1Q3KA 1L6RA 4P83A 1XZGA 4QLOA 3DDSA 3VAYA 3GJTA 1AUPA 1U2TA 4Q9DA 2Q4RA 4OYLA 2YMPA 5F73A 5JROA 5SY9A 3B5EA 3AR3A 3IVXA 2HSJA 2NIPA 3K0KA 4I6EA 4WN9B 5F98A 1PSDA 3N0XA 1GGFA 4LRSB 1WO8A 4R1MA 4HAWA 3VOTA 2R7KA 2GZ2A 2QG6A 1O9GA 2XBUA 3QKIA 2PKEA 4GI2A 1OZ0A 1C8KA 3WLQA 2J5BA 3A6JA 3SJUA 3KD2A 5CJJA 4KX3A 2AG5A 4ZVQA 3HR7A 5AVVA 4JKIA 1AQNA 1Q20A 4AZ3A 4MI6A 2GF2A 2JLRA 2IP2A 2UZ1B 3A36A 3OCJA 4BVFA 5E4YA 1ZJJA 3EPPA 4OBXA 4YMWA 2ZJ0A 4BX0A 5D1HA 4ND3A 1EFTA 1C5KA 1YBVA 4OP1A 2HWWA 2XRFA 3T5GA 4PR3A 4BMYA 3I2GA 4YQFA 3I9KA 4QBFA 2WIDA 4D3XA 3P32A 3H5NA 2PT9A 3T1HB 4MUJA 4CIYA 3IJPA 1JSLA 2AOWA 4HTFA 4NFHA 4FE4A 2QAGA 3FTNA 4BCBA 5GIOE 2YWGA 3NCTA 4OH1A 4PINA 3VHXB 2IY8A 3QVXA 3OX3A 1FRVA 4H17A 2B20A 3O21A 3E9CA 4CKZA 1I4EB 5K4AA 1OVGA 5DO9A 4GGMX 1A77A 4MROA 2ZYTX 4HG2A 3JQGB 5HZGA 1W49A 3G17A 1TAHA 3FVVA 1LF0A 1SVWA 1YACA 2C2KA 3EEYA 3HHPA 5CFOA 1GTRA 2GN1A 2GZSA 1DLJA 4Q1FA 3RS0A 3AF6A 3N74A 5DHRA 3F5MA 3LQ1A 4KODA 4EHJA 1PUXA 1GCOA 4NJMB 4YC7A 3HUTA 3QXJA 2AX4A 2BFNA 3DLTA 3EGIA 3EGWA 5I8ZA 2YHSA 3WQSB 5JNVA 1NULA 4YRJA 5IN4A 1G2QA 3OWOA 3T5DA 3R9WA 1EINA 2NVWA 4YASA 5LDDC 1VHJA 4DCPA 1YZ3A 1Z29A 1VE6A 3DZJA 4K9PA 5DHAA 1YOVA 1RXWA 1E8DA 3DEJA 4TX1A 2MHCA 5J4LA 3TAHA 2W6PA 5H83A 3I12A 1K27A 2Q99A 2XWQA 2ZULA 4KDFA 4U4AA 1EGAA 2OBYA 1WVMA 1L5OA 1SB9A 1YR9A 4LRXA 3OM1A 5MF6A 4F72A 3ERCA 2DUJA 3UT5B 1V4NA 2VK2A 2WABA 3FWZA 3LY5A 4TROA 5IAAA 4IIJB 1ORWA 4V02A 3K9FC 4M99A 2HQRA 5AK5A 2C97A 4EX7A 1KZHA 1GA4A 2UVPB 1V11A 3BIOA 1VKNA 2VT7A 3IXQA 4UZEA 5BQOA 4DCCA 2O5CA 2X5JO 3V3TA 4C3VA 4D56A 2V3WA 3GAZA 4P4LA 3SHOA 1JI0A 1VKOA 2EARA 2G06A 4ZOBA 8OHMA 1KQPA 3S1SA 3K71B 1ESMA 1U7UA 4JC4A 4E6PA 5LL6P 1FQJA 1DTWB 1QONA 3VU3A 2ZSBA 4HDCA 1LPBB 4P58A 2BCGY 1G1MA 2C07A 1B3RA 1RJ9A 3D1JA 4DCTA 1QWOA 2RC5A 3UZUA 3SKYA 5GQSA 3VYWA 1XELA 1LNQA 4UNSA 1Z2OX 1E61A 1KY4A 4GYYA 1JA1A 2WSBA 4LS3A 4URHA 3SR3A 4DNPA 3T5BA 2BLLA 3RVKA 2PFGA 3EEFA 2QMUA 1F6WA 3WGIA 4PGFA 1OYWA 4MEJA 4GF5A 1Z6XA 1YB6A 1TVMA 1T25A 5K0GA 2FP3A 3IAUA 3EGXB 1XK7A 3K92A 1E9VA 3NALA 3L4KA 4V3BA 3UK2A 5IJAA 5ED4A 3E3NA 5SZKB 4N0MA 2FOIA 5L8VA 5FPQA 3ABOB 1JE0A 2H5JA 3L6RA 3MWFA 5ESDA 2A2ZA 4B4WA 9MHTA 2CDAA 1AMNA 4D0SA 2H51A 3GVHA 3I5AA 4NCBA 4P3PA 1JS1X 1A9XB 4PAMA 3NHWA 5D2CA 2Q7OE 4HB2A 3U3MA 2J3JA 2RCYA 4XGRA 2PZJA 4WCFA 1YQXA 3OM8A 2QYOA 1B6RA 3NHKA 4AF6A 3K1TA 3P9RA 5LMCA 5I5GA 3M1AA 4GNRA 3CPSA 4GG1A 4CM3A 5MN4A 5HOEA