3IDSA

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetamide inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASCTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
publication title Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in complex with the irreversible iodoacetamide inhibitor
rcsb
source organism Trypanosoma cruzi
total genus 120
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2009-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3idsA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3idsA01
4FJ1A 4P22A 2VOEA 2G76A 3TDKA 4H16A 2HMWA 1EVZA 2RBEA 2DBQA 4CMIA 4IDGA 1P31A 4XZ3A 3W8EA 3IP3A 4PN3A 1ZK1A 1QKIA 3L6EA 1XU7A 1D1SA 4FCCA 3A1NA 4W9NC 4WUVA 5JCJD 4QO8A 1PQWA 3F9IA 3I3OA 4Y6PA 4CQMA 1ZIDA 2P4QA 2RH4A 2PWZA 5BSHA 4LMPA 4BNJA 4RPLA 5ER9A 2YDXA 3DFZA 1DAOA 4II3A 4BNTA 4BNLA 1SPXA 3P2YA 2FPPA 3DQPA 3LDHA 1IY8A 3HE3A 3HADA 3F47A 4YQZA 3Q0EA 1HYHA 3JQ7A 4DWVA 3AI1A 3GPIA 4KP7A 5I8ZA 3U4DA 2BGMA 1PJTA 4OKNA 3JTMA 3MCVA 2J5RA 3LT2A 4UUNA 2QRLA 4JP3A 4BIIA 1P1HA 1KVRA 1MXFA 3HN2A 1T2AA 2Q22A 2PV7A 3OEWA 3EVTA 2PD3A 3HFGA 2HK7A 4FOSA 4RGBA 1DB3A 3L77A 4NPCA 4F45A 4JBIA 5JAIA 2AA3A 3G3EA 3HWRA 3I9NA 3SLGA 5CEJA 5ITVA 1GQYA 2B0JA 3BMNA 1XEAA 1MFZA 1CRWG 4CMKA 1NQ5A 4PG6A 3U3XA 1EEHA 1KC3A 4R9RA 4D3FA 4KDEA 3VDRA 2EKLA 3S1LA 1ZVMA 4YYZA 3GGGA 3JQ8A 2NUAA 3DBHB 1ONPA 2GN8A 3DB2A 1M6HA 1HRDA 1TI7A 1HE3A 2EGHA 3PGXA 4RZIA 4BMSA 2V6BA 4RV9A 1M2WA 1Y6JA 4DYDA 3AY6A 1R16A 4JGBA 4DREA 3BTSA 5JXWA 4XEHA 2X6TA 1OMOA 1T2EA 4WOKA 2DT5A 2GR9A 2JAHA 4E13A 1O6ZA 1W73A 2OUIA 4DBZA 4RLHA 4J1TA 4CJXA 1JWBB 1DFIA 1LDGA 2O3QA 2CVQA 4E31A 5IDQA 5ICMA 3OHSX 4GLLA 1KEWA 2Z5LA 3I4FA 4GVXA 4R69A 2QQ5A 4UVDA 2GN4A 2GD1O 2CD9A 1LQTA 4NK4A 3OSUA 2WWRA 1Q0LA 5EESA 1BVUA 3G1UA 1QYWA 1Q1NA 2QZZA 2H63A 3ZV6A 2O2YA 2Q46A 3ZHZA 1NAHA 1EE9A 2B69A 2VT2A 3E82A 3N58A 5L7TA 3QY9A 1A72A 1UZMA 2X5JO 3C1AA 1HYGA 1M75A 1NHWA 1RM0A 1Q7BA 3KVOA 4K28A 5THQA 4ALLA 2C2YA 4DVJA 1N92A 2X0IA 4FFNA 3WDSA 1YOVB 3HUDA 2EP5A 3LQFA 4IDCA 3AFNA 1CQIA 4BNGA 4YJGB 2PNFA 2PZMA 5IDXA 2J5KA 3RUFA 4I1IA 4JJGA 3OJOA 1EFLA 4IDBA 3ZWWA 2C54A 1DRWA 1T2FA 2OMEA 5CDUA 1GEEA 3RU9A 1GAEO 1T2CA 4WEQA 1K0UA 3OQBA 4EUEA 5ADHA 1PGOA 1I8TA 4WOJA 1OC2A 3FR7A 2P68A 1VLLA 4TRRA 3MJTA 4AJPA 2PKQO 3W4JA 4YQYA 5CEFA 4AICA 3F3SA 1M6WA 4BNUA 4RDIA 1I3KA 1H6DA 1RM4A 2W8ZA 4IJKA 4XIJA 1IUKA 2NTVA 1J5PA 3NEPX 5C7IO 4FFMA 3JV7A 4OQZA 4KUGA 3U0BA 2XOXA 2C07A 3PP8A 4EI2A 4LSMA 4P38A 1YBVA 1K5HA 3KM0A 3MZ0A 1RWBA 3L6DA 3JQAA 4ID9A 1JA9A 1H9BA 3KTDA 3KETA 5FF9A 3BA1A 1PX0A 3TL3A 1UXHA 2VHVA 2VZ8A 3CSDA 3DMTA 2NVWA 3ZWYA 2VT3A 4ALNA 1P77A 3UICA 2NWQA 4FFRA 4W6ZA 5FFFA 2R00A 3VZPA 3VVBA 2W2LA 1SB8A 2PD6A 3NDJA 2W2KA 4RPKA 3PWZA 1DO8A 1NVGA 1NYTA 2JCXA 4PRKA 1GFSA 1IYZA 4XWYA 4HV4A 1YWGO 2Y0EA 1XU9A 1IHXA 2X86A 4GVLA 4JBGA 4WASA 4AJ4A 2D1YA 4BMVA 2A35A 1UDCA 1UXGA 1M67A 3TQHA 5J23A 1JVBA 2QZ9A 5H81A 3ZU4A 2P4HX 3JQEA 1E3WA 1GQQA 4DXHA 3JQGA 5FYDA 5T73A 1JDJA 1HYEA 5JY6A 3LSYA 1JKFA 2FSSA 3JD2A 3B1JA 4E5MA 1MGOA 1ID1A 3KRTA 3C7CB 1EZ4A 3CPSA 1CYDA 5G0WA 3ZWPA 3PPIA 4Z6KA 2OXIA 4IDAA 1TT5B 1H2HA 4R41A 3WMXA 1F14A 3HNPA 3H9EO 1PJ4A 2VHWA 4FS3A 2IE0A 2QHXA 3DHYA 4TZKA 1HZJA 4B79A 1CJCA 4YAIA 1E6EA 1T1SA 3JQ9A 2O23A 3PJFA 2PA3A 2V65A 3EZLA 1N5DA 3IOYA 3NJ8A 3NTQA 3INRA 2QG4A 1AE1A 1A71A 5TJ9A 4J4BA 3PLRA 2FN7A 5A3VA 2EKPA 2VHYA 3H3FA 2PGLA 2EKQA 4LK3A 4NZ9A 2V7PA 4CUKA 3Q1LA 4HBGA 4FOOA 5HBRA 3KEOA 3UN1A 1IL0A 3UOGA 4CQMB 2BFMA 1MB4A 3UUWA 1YVEI 3CKYA 2FR0A 4WNCA 3W6ZA 3E9MA 1P0FA 2O2SA 2FR8A 3RQSA 9LDTA 3VH4A 2AMFA 3C8MA 3MJSA 5F5NA 1TA4A 1YGYA 3SJUA 1H0KA 3V2HA 1FXSA 4J1SA 4KOAA 3WYEA 4F6LA 2POQX 3IMFA 2AG8A 3JQ7B 4N5MA 1G0NA 1T1RA 5C7LO 2EIHA 5B12A 3PHIA 1Y5MA 3GPDG 1LU9A 2HRZA 3F5SA 3FNHA 3FSRA 4IDDA 4L75A 4EZBA 3K31A 1LSUA 4HFMA 1EQUA 2CDCA 3AW9A 4Z9YA 5F1PA 4AJOA 4E5NA 1ML3A 4CL3A 3WGYA 2FRDA 4PG8A 4J4TA 4CM7A 4P4GA 2SCUA 1CIVA 5A3JA 3ABIA 1OOEA 5DNAA 3RJ5A 5T8KA 3ETDA 2GDZA 3RUIA 4E5PA 5A9RA 5GY7A 3B20A 4I9NA 3PTZA 2JJYA 1N1EA 1NXQA 5BQFA 2RHRA 1DHRA 5DBIA 3O9ZA 4R1SA 4TRNA 4YWJA 3X2FA 1H6AA 4PG7A 3JQ8B 1XA0A 2Z95A 1IULA 1QYCA 1DRVA 3I4CA 1DJQA 4W7HA 4RVSA 2A92A 3QVOA 4YAGA 3GZNA 4MVJM 5EQDA 5F1OA 3NTOA 1V6AA 3PIIA 5TLSA 3W8DA 1ISMA 4J7UA 4YT8A 3FTNA 4N7RA 2WEKA 2FR1A 3D3WA 2OGUA 1WLYA 2ILTA 2BD0A 4JX8A 2V6GA 4RVFA 4XGKA 5CDGA 1YJ8A 4ZHSA 1DPGA 1EUDA 1GCUA 4QXMA 1HSZA 2VTEA 3CH6A 3GF4A 3RJ9A 1EK5A 1B8PA 2WYVA 2NQ8A 3RBZA 4YTEA 4WK6A 4YB8A 3WGTA 5ILOA 1GTMA 4CM8B 1UXIA 4L73A 1I32A 4NMHA 4DPMA 5I8WA 2UUPA 3GGOA 3GVHA 3IAHA 2Q3EA 3GEDA 3EYWA 3WGGA 2EJWA 3GG9A 4R4JA 3LC7O 1FJHA 1PJSA 2GRAA 3M2PA 4K26A 2I65A 2Q1TA 3OFSA 2PGJA 4KQXA 4N5NA 1PR9A 2C82A 1NFQA 1YQDA 2R6JA 1ZW1A 4RZHA 5JLAA 4G81A 1J6UA 3RUDA 3TOZA 4XQ9A 3GNQA 1W4ZA 3KO8A 3QLJA 4HXYA 5COAA 4BO8A 3WLEA 2NVBA 4MVJP 1YXMA 4J2HA 2NM0A 4K9DA 1PS9A 1QLJA 4BNVA 3V8BA 3BHMA 4L74A 3E8XA 4NU5A 4PLYA 4AG3A 2GZ1A 3E9NA 4CMEA 4W9NA 4FDAA 1Z73A 4E6PA 2HO5A 5CDYA 4DIFA 1M76A 2O4CA 5H82A 1DIAA 3QA9A 4BO1A 3CXRA 4A26A 1WXDA 2V6FA 3KSUA 4WLFA 1HL3A 2YY7A 2YYYA 3I23A 1ZMTA 5DCUA 3FD8A 3NKLA 2AEFA 2Y99A 3P5SA 1J49A 4KWHA 1UXKA 4TSKA 4CMHA 3IKTA 2PH3A 1L7DA 4OXYA 7ADHA 4CMJA 3QWFA 3TZHA 3F6YA 3BMOB 3Q3CA 1NPTO 3NTRA 3EK2A 3VH1A 2J5QA 4NK5A 2YUTA 1LC3A 3QE3A 3I52A 5AQ1A 3ROMA 5B4UA 3ROQA 1T24A 1NP3A 1JW9B 3RKRA 5LC1A 4AJIA 3WGIA 2OP1A 1XSEA 1ARZA 2WD7B 5A06A 3AUUA 1ZXBA 1BDBA 3DAPA 3KYDB 4J49A 1YQXA 5DP1A 2EHDA 3FNEA 3OICA 4K6FA 1K6JA 4A03A 3D4OA 4BGVA 4RPJA 2O3RA 1PS0A 3ZCXA 1FF9A 3PZBA 1CEQA 1K89A 1DIRA 1D1TA 2ZQZA 1YB1A 3BTUA 3VTZA 2BI8A 2Q2WA 1ISHA 1E3WB 3JQGB 1H9AA 2FMUA 1WZIA 4XYLA 1SAYA 3N7UA 4HFNA 4XQGA 3DZKA 4WJZA 4BKUA 3K8ZA 3DAFA 4HFRA 3WGQA 4MP3A 2HK9A 3RBVA 3ONDA 1LLDA 1BXKA 2HCTA 3EGOA 3QSGA 2A9FA 5EIOA 1IE3A 4Z0PA 3ZWNA 1O89A 3L0DA 3ZN2A 2IEBA 2VNAA 4CV0A 2PZLA 2W98A 4R5HA 1HE4A 1MLDA 3JD1A 1B3BA 4R1UA 4CR6A 1I01A 4QX6A 1NQOA 4OYRA 4JBHA 3RI3A 3V2GA 4E2WA 3G0OA 3MEQA 3WS7A 1JN0A 4J4HA 1GUYA 4XQCA 2NU9A 1EBUA 4YR9A 1VL6A 4DLLA 5DULA 1JU9A 3OMLA 1B8VA 1J4AA 3EHEA 5DBFA 1SZJG 3VPGA 5KIAA 3T7EA 3PHJA 3VOSA 4QFCA 4UUMA 2Q4EA 2NVUA 4ITUA 3LC1O 2DUUA 1C1XA 3GRKA 5FI3A 3U4HA 1P44A 4DL9A 4IQ0A 5B37A 2GCGA 3AI3A 4KDFA 4CLRA 3HN7A 3WBFA 1D3AA 3QW2A 3PIDA 2AEJA 2VWHA 3DWFA 4W7IA 5A03A 2P5UA 1QR6A 2ZTVA 4DIBA 1ADGA 4YCAA 2QYSA 5FWNA 3WYCA 4BB6A 4QQRA 3ADPA 5KVQA 3X2EA 3CUKA 4E12A 3F1LA 1N1GA 3KYBA 3LF1A 4XYEA 5JE8A 1EE2A 1YBMA 1AXGA 1YQGA 2OO5A 4ZRMA 4YACA 3QVTA 1R4NB 3I9KA 5JDCA 3JSAA 4MIOA 3L9WA 2EERA 1C3VA 3VKVA 3DZBA 4MINA 4A27A 4HADA 1EVJA 4NBWA 1MX3A 1V3UA 1A27A 3TL2A 3E5RA 1Y9EA 2X9NA 2NQTA 5BSGA 2G82A 5JAQA 3FN4A 3OQ1A 2JL1A 4CLOA 4IZHA 4MDHA 5T5QA 2P5YA 1VKOA 3DOJA 4DPKA 3JD4A 2BMAA 3PQFA 4IS3A 3BHJA 3GC6A 3L4SO 1DC6A 1P1RA 3DZFA 3K96A 1N9GA 4B3JA 1KERA 3D3WB 5GZ3A 4BGUA 1Q2XA 2JHGA 3P2OA 2C5AA 2ZB4A 3ON5A 1UUFA 1SB9A 1DLJA 3KHUA 4XA8A 4XDZA 4D42A 3EZYA 4E4YA 5ICSA 4MVJA 4YJHB 4NR0A 1GV1A 1SCUA 2OOSA 3U49A 1O5IA 1U7HA 4RPGA 1E7WA 1VSVA 1ZK0A 1P1KA 3ETEA 1PS8A 4FIZA 3AUTA 1MC4A 4JJIA 2WYUA 5B4TA 4U5QA 3O38A 4BNWA 3AFMA 1WMAA 1BRMA 3E9QA 3OETA 4GLOA 5L45A 2E82A 1NR7A 3OJFA 2WJPA 3ZV3A 3H7AA 1VPDA 3L4BA 1TLTA 4NJOA 3DL2A 3ZWCA 4BUCA 5KJCA 3AU9A 1TB4A 3V1UA 4E2YA 3BZUA 2JCYA 1JVSA 4MVJI 4HWKA 3JYQA 3SXPA 1P45A 1PJCA 5TT1A 4R68A 1WNTA 3ZDFA 4DYVA 3WWYA 5A9TA 1NX6A 1GYRA 3ZNOA 3NYWA 4O6VA 1U3WA 5AYVA 2AQ8A 4HFJA 4RF5A 1H6CA 5TRTA 2ZJ1A 1B16A 1FDUA 3R0IA 1XHLA 3FTPA 1ENZA 3NT4A 3RBXA 1QYVA 3JQFC 3INGA 1V8BA 4XRRA 3H3JA 4QEDA 3GDGA 4NJMA 1E6UA 1Y8QB 2Y1EA 3PXXA 4W82A 1Y9AA 3JQBC 1G1AA 4JQCA 5AVOA 1DC5A 3MOGA 4CV2A 5JPIA 1YKFA 4JCOA 1NPYA 2I6TA 4XX0A 4UVHA 2JFFA 4D46A 3D5TA 3E5MA 1ZMOA 1R15A 5G4LA 4TVBA 1PTJA 1HDGO 1Y7TA 1EK6A 3NV9A 1Z6ZA 4Q3BA 2FZEA 3ANNA 1HDYA 2DFDA 1VRWA 2VYND 1LLQA 2Y0DA 4AJ1A 2A94A 5G0VA 3FBTA 3ANMA 4RO0A 3RCBA 3WJ7A 1ZK2A 3ST7A 1VSUA 2JHFA 4C7JA 1F0YA 4MPDA 5CG2A 3D64A 3OJ0A 4PZCA 3FRJA 2RAFA 3M6IA 4HP8A 2CF6A 3NDRA 3CTMA 1FDTA 4L4XA 2CY0A 1XG5A 2B4QA 1I3LA 4JXKA 4ZVVA 4WNIA 4ALIA 4TMFA 3PFWO 4RF3A 3O26A 4DLAA 4E0BA 3ETGA 3ITDA 2FP4A 4OH1A 1IZ9A 1I24A 2IZ0A 3COSA 4PVDA 1BSVA 1ZSVA 4D3DA 3GNTA 3T4EA 3Q2IA 4QSMA 1IB6A 1R0KA 5IJZA 2UYYA 4IINA 4ND3A 1DSSG 4J7XA 3FNGA 3H9UA 5JDIC 1KEVA 2WTBA 2Y1FA 4EITA 2C2XA 4DQXA 3WBBA 1P3DA 4XR9A 2UDPA 4DTIA 4ND5A 1TVEA 4MP6A 4BKRA 4IUYA 3ICPA 4U0KA 2ZKLA 1XDWA 3PYXA 1LXCA 2J3KA 4PLTA 1CETA 3L6OO 3GAZA 4YRDA 5ER6A 3Q9UA 5G4KA 2VWPA 1ISFA 2DBVO 3LT4A 1T25A 1XKQA 2Y67A 2BF7A 4J0FA 1U9JA 1LA2A 3OF2A 4YT4A 3PI7A 1HF3A 1P74A 3DO5A 3B6ZA 3GMDA 1C1XB 4LGVA 3QV1A 4IMRA 4OSOA 5ILGA 5BT9A 3L9XA 2ZTLA 2DQ4A 3O4RA 3SC4A 3ZU2A 5DF1A 3Q2KA 5A04A 4IM7A 5KOIA 1YL6A 1UZLA 3CZMA 2Y1DA 1D7OA 3VDQA 4GMGA 5L4SA 4B4WA 3KOUA 4D41A 1YBAA 5TSDA 3W4IA 4NQZA 4UAGA 1HDRA 4F46A 3ASVA 1TXGA 5DP2A 4AJLA 3U62A 2GYYA 3KYCA 5KTKA 1U3VA 1T4DA 5K6AC 1U8XX 4NDNE 4FW8A 3UW3A 4TKLA 3D4PA 4U0JA 4DMMA 4CM9D 3ULKA 1XGKA 4WCDA 4EEZA 3OBBA 3QP9A 3ZHYA 3KB6A 3HSKA 3HDJA 4OJNA 5AXDA 1BW9A 4FB5A 4YT2A 3RUAA 4XIYA 4G5HA 1RM3A 1NFFA 4MP8A 4CLOB 1KVUA 1GU7A 4WCFB 4M87A 3QHAA 1QG6A 3GEGA 3AOEC 5J9GA 3WQRA 1NPDA 1T4BA 3ZH2A 2I99A 3JYOA 5KVVA 1QRRA 2OZPA 5DOVA 1UAGA 4BNHA 3IJRA 1W8DA 3QWIA 4ESOA 1F17A 5C7OO 4OQYA 4OL9A 1DDOA 3MJEA 3KV3O 1E5QA 3V5NA 4XJTA 1HE2A 4D43A 3ASUA 3WGOA 3GGPA 4CV1A 5EQFA 2NADA 3BMCA 1R0SA 3TOXA 1ADCA 5T67A 2JKVA 5TF4A 1BXGB 4ROSA 1GYQA 1YJQA 2VRCA 3WTCA 1WDLA 4RQTA 3WNQA 2WE7A 5I7EA 3U5TA 3RUHA 1S7CA 3JYPA 3KEQA 1SNYA 4D0RA 4BO2A 4M54A 2P9CA 2J3HA 3H8VA 2DFVA 3ZNNA 3ZWVA 2ZIZA 1KEUA 4GKVA 4D7AA 1UXJA 4CQMD 2GSDA 2JCVA 1KY4A 3H2SA 2PZJA 3H4VA 4IDEA 1AUPA 2VRBA 4IQ8A 4GMFA 4GX0A 5HS4A 2PKRA 5F1KA 3I6QA 3WMWA 2G5CA 5TX7A 1QSGA 2Q50A 3DBRB 1OC4A 3KSDO 1X1TA 4WGGA 3NDIA 3JQDA 4FD3A 4WLOA 1X7DA 1MC5A 1EDZA 2QRJA 4NJMB 2Y68A 3AUSA 1E7SA 2VUTA 1R12A 4HUJA 1PSDA 1I36A 3O8QB 5MGBA 4R3NA 4WE3A 1GDHA 2ZK7A 3RIHA 4U6SA 1JTVA 4Q3NA 2EG9A 4BKPA 4D45A 5GMOA 4CMAA 5MDHA 1T2DA 3IS3A 2D8AA 1K2WA 1HWYA 1E3JA 1PGPA 4FPXA 4CMIB 3EW7A 5L51A 3TFQA 3SVTA 3GFGA 1B7GO 5IZCC 5K9ZA 3C3XA 3I83A 3NT5A 3T4XA 1QYDA 4NFSA 4I9UA 2GN6A 1ISIA 4KTTE 3VC7A 4DIOA 4DLBA 4Q3EA 4A7PA 3IKVA 4UEJA 1LDEA 2EXXA 2Y1OA 3AY7A 3VPXA 4OMUA 2IZZA 2Q4BA 3FPLA 2D59A 4ALMA 1B26A 4PZDA 2RIRA 5HWSA 3HHPA 3IQDB 3TZKA 3HQ4O 4BVAA 4YXFA 2DTXA 3ENNA 3KLMX 1P1FA 3DOOA 4JK3A 4BO5A 1N7GA 4AJ2A 4JJFA 1JLLA 4BQPA 1HLPA 4U7WA 4CMBA 4BKQA 1LDMA 1ZKMA 4KUEA 1WAMA 3DBVO 4DUPA 1X1EA 2BGKA 2DBZA 5B1YA 2V6MA 3S55A 3PHHA 5TQVA 1LNQA 4LN1A 1U4OA 4GWGA 3NX4A 1DXYA 3LT1A 4XGIA 1ZFNA 3BMNB 1MV8A 3SX2A 5I9MA 1SMKA 5A5FA 4O1MA 4AL4A 3WB9A 3VVCA 2HMVA 4AJNA 3MOIA 4PLVA 4CL8A 1WDKA 3DDNA 1U2GA 4FR5A 2DLDA 2AXQA 2AQIA 3VPFA 1RYEA 4Y6RA 2OBNA 2X0NA 4HKTA 1HE5A 5A05A 1F8GA 1HKUA 3DZIA 4MO2A 3C1TA 3N74A 4S1VA 4I8XA 2O3UA 2BKAA 4Z9XA 2PH5A 4Q3AA 2AQKA 7MDHA 4KZPA 2X7HA 4B7UA 3E6AA 4IJUA 5HM8A 2BH9A 1R6DA 3PWKA 2Q1UA 1GUZA 3TZQA 1YS4A 4OO3A 3PDJA 4QO7A 3GAFA 3H9QA 4DC0A 4UUPA 4Y67A 5EMHA 3VZRA 1PJLA 4GPD1 1L7EA 3AOGA 3JQFA 8ADHA 5L9AA 3PHGA 5BSFA 2I76A 1YL7A 1VJTA 1QLHA 3F5QA 1HDOA 3RUCA 4RJTA 3EMKA 1RJWA 2ZB7A 3RSHA 3LK7A 2XPCA 3C85A 3KYCB 4JROA 4L0QA 4J43A 1ADFA 3OA2A 1B2LA 3ROKA 4XR4A 3JQAD 4XCVA 1O0SA 4PZEA 3RU7A 1A7AA 3UCFA 5JMPA 4E5YA 3FHLA 1LBEA 3GVCA 5M6DA 2W2LD 4J9UE 4WEOA 4KTVE 2BLLA 5LDHA 4TRJA 1SOVA 3VPHA 2QW8A 5GZ6A 3GG2A 1DFGA 4XB1A 3EY4A 4EBFA 3WSWA 2HMSA 1Z82A 1OFGA 3D0OA 4GQAA 4TWRA 1R4MA 2O50A 2CVZA 4CM3A 1ORRA 1FDSA 2E6UX 3PHLA 2EP7A 3WICA 1E7RA 1YDWA 6ADHA 5T57A 3ZU5A 4M86A 3G79A 4ALJA 1WMBA 3OIGA 2LDBA 3WIEA 3P19A 4TROA 2QRKA 3K73O 3W8FA 1NQAO 2Q49A 2Y1GA 1NVTA 4BNIA 1I5RA 4QECA 4DC1A 4RPHA 4FFLA 4DA9A 2X22A 4YVFA 1AXEA 3JQAB 4K1LA 3C24A 1PZEA 4GGPA 1GR0A 4WPGA 3OEYA 4AVYA 1O95A 2UVDA 4LSWA 4EJMA 2IXBA 3QWAA 1NWCA 5JDIA 1Q0QA 2O4UX 3ZNQA 5KVCA 2YHIA 3HB5X 1A9YA 3BTOA 4IXTA 2W2KB 5TIIA 2JD0A 3BMQA 4DQVA 3NRCA 2A4KA 5K0ZA 1I2ZA 2JFGA 4J1QA 2VTDA 2VUUA 2X58A 3W4KA 4BO9A 4OXNA 3CIFA 2ZB8A 1A5ZA 2RHCA 1BHSA 3UCEA 2GN9A 2RH8A 8LDHA 4BKOA 5L7YA 2G0TA 4IJWA 1JAYA 1ZH8A 1H2BA 3QIVA 4PLFA 3RC9A 3GHHA 5JO0A 3OIDA 2QX7A 2JD1A 5IDYA 1A4IA 4RVUA 5KWEA 4RVGA 4YT5A 1E0DA 3TZCA 2PLAA 4TVOA 2VOJA 1VE9A 1PZFA 1T26A 4PG5A 1UH5A 1W0CA 4FFPA 1CF2O 4IPTA 4Q3CA 2YJZA 1DC3A 1X7GA 4XYBA 4YJFA 2I9PA 3WR5A 2Z1NA 1BXZA 1YO6A 4CLXA 3DMYA 5IDWA 3MJ4A 4ZICA 1QXSA 3AM4A 2OORA 4B7CA 1S6YA 1LLUA 2J8ZA 1AGNA 3RASA 1KVSA 1VC2A 4OKIA 4CM4A 4Z0TA 2DM6A 5ITWA 3SC6A 2GASA 3EAGA 3H5NA 3P7MA 1PGNA 3B1FA 3OIFA 3U4IA 3ZW8A 3K2BA 1JWAB 2W90A 2NSDA 1X13A 1ZXLA 4L76A 2ZCUA 2R00C 3C7AA 2H5LA 4J2OA 5IXSA 3DTTA 4I5EA 4AJEA 4QUKA 5JCJA 1XLTA 4CUZA 4L9RA 2C0CA 3V1YA 4ZQFA 1CERA 1KVQA 3DBHA 1MP0A 3F4BA 4FC6A 4GAEA 2P9GA 3KXDA 3AM5A 1LC0A 2AEMA 4J7CA 3RD5A 3VH2A 1NM5A 2WYWA 5FEUA 3MTJA 5DCWA 2X9GA 4WLEA 4XB2A 4BQRA 4B8ZA 3DHNA 1HT0A 4BO6A 9LDBA 1X0XA 3ORFA 5KKCA 1NVMB 3WWZA 5KCZA 4GWKA 4YBZA 1GQ2A 4E2ZA 3DOCA 1PL8A 5LDGA 1GZ3A 4RLSA 4M1QA 2NU6A 4I5GA 1R66A 1Y5RA 3A14A 4NG5A 4ZN6A 3HFSA 1E3IA 1HEUA 3PK0A 1Y81A 3SEFA 2EGGA 4Z9FA 1G0OA 3PQEA 1R0LA 4P4LA 6LDHA 2OHXA 1K6IA 4WLNA 1GUFA 2YV3A 4CR7A 4IJVA 3KZVA 3H5AA 3OM9A 3GZNB 4DQUA 5G0SA 1EUCA 2HAEA 4OOEA 1Z75A 4NFYA 4IBOA 4K6CA 2FY8A 4PFJA 3FNFA 1PIWA 4L8VA 4WLVA 2DC1A 5JC8A 1Y8RA 3AWDA 4PLCA 5AXBA 5ENDA 5COQA 4PLGA 1TT7A 2GF2A 1PZGA 4TRMA 4W4TA 4MKXA 4AJJA 4FC7A 3TRIA 1YOVA 2D2IA 1PJ3A 1WVGA 4E32A 1NTOA 3K92A 1NHGA 3HDYA 1ZK4A 3UHAA 3GVPA 4PLPA 1E5LA 2AHRA 2I67A 5EN4A 1DHTA 5JY1A 2YFQA 1OZAA 1PWXA 2EEZA 1OAAA 4FGWA 3ZHXA 1LRJA 1ZNQO 1BWSA 4TKMA 1HDXA 3RAJA 3ZI0A 1RKXA 2H6EA 3CMMA 1LEHA 4BNNA 1U8FO 4CMGA 3DEYX 1YONA 2BHLA 4GH5A 4OOFA 4Y8VA 2ET6A 4EJ6A 4U8GA 1IOLA 3GDOA 3TPCA 2OL4A 4AJKA 3Q9NA 2GZ3A 3M2TA 4ZJUA 4J0EA 3NJ4A 4I5DA 4FSHA 3PJEA 1ENPA 1I33A 3WSVA 1PJBA 1K3TA 4OM8A 5ENVA 5DBGA 2B4TO 5LCXA 3ZNPA 4EGFA 1X7HA 2X0RA 3DZHA 5L4LA 1B0AA 2VZ0A 4BO7A 5JBIA 1O94A 1MG0A 3ZU3A 3VTFA 3ZV5A 1IZ0A 5TGDA 1VL8A 3OJEA 1U28A 1H6BA 1V35A 1N8KA 2WM3A 4G2NA 3GOHA 3RC1A 1EVIA 2O7SA 4WLUA 1ULSA 1M66A 2ZQYA 5G0TA 5AOVA 2VHXA 5EJ2A 4E2XA 3ITKA 1ISJA 4J1NA 4NBTA 3HB4X 3TNLA 2CSUA 5F3RA 1GADO 3TZ6A 3WNVA 5I9NA 3GQVA 1BDMA 1ZSNA 3VAZA 4H15A 3DAGA 5BNTA 4XGNA 4RF4A 2D5AA 3GH3A 4B4OA 1AHIA 1E7QA 4XJSA 3W6UA 1TT5A 4W99A 1I10A 2DVMA 3GUYA 4L4SA 4YAKA 2YHIB 2ZYDA 1LDBA 3GA0A 3KSZO 4NIMA 1ONOA 2B4RO 1QV7A 3QWHA 5BNIA 3AM3A 3RVDA 3BMQB 4AFNA 3UCXA 2VQ3A 5BSEA 1F12A 5TNXA 4F3YA 4RL6A 1O9BA 2Y0CA 3NGLA 3HJAA 1H93A 3WLFA 1WW8A 3TFOA 1W6UA 2X9VA 2NV6A 4ALKA 3M1AA 1CDOA 4PRLA 3TF5A 1PGJA 1VI2A 4KUHA 5U4QA 4D44A 4UUOA 5JW6A 3E1KA 2IYOA 2NTNA 4CMEC 4LRTB 5JNLA 1V0JA 3PZRA 5EL0A 5JYDA 1YE3A 3LT0A 4IQGA 1WPQA 3IUSA 1KVTA 3UGKA 2NTJA 4RF2A 1H5QA 1ZJYA 2XXBA 2DPHA 3D5QA 4FQ8A 4MVJH 4ZRNA 4YJFB 2DUWA 1KY5A 4J9VA 1U5AA 4C7KA 2PR2A 1BG6A 1Q0HA 2I3GA 2Q2QA 3AUAA 2IEDA 4H7PA 4YRBA 5ES3A 2GERA 5A9SA 1Z7EA 5F21A 2HMTA 3PLNA 4UULA 4A73A 4ZQHA 1RM5A 4CM4B 4CM6A 2CDBA 1UZNA 5AXAA 2DPGA 1RPNA 1U4SA 3G17A 4MOWA 4XQEA 5L95A 1DIBA 4MVJG 1XIVA 3H2ZA 1VJ0A 3WQQA 2W4QA 4BNXA 4IIVA 5CHEA 5HRUA 1ONNA 2HRBA 5H83A 2DKNA 1HZZA 4MJLA 2IDZA 1J0XO 3I9LA 3CINA 2FHSA 2X1HA 5IXYA 4PG4A 2ZYGA 2NVUB 1E3LA 5DN9A 1V9LA 1LRLA 3FF4A 4CUJA 4CLHA 4ZQEA 5BR7A 3I6IA 3A06A 4PLZA 1R37A 3JQ6A 4BOYA 2FWMX 4EEXA 1XQ1A 1QYXA 2HMUA 3GN1A 4CLRB 4DPLA 5DDIP 5L40A 4LVCA 3BIOA 1V3VA 4ND4A 3WGZA 1LQUA 4YDRA 5KKAA 5CFZA 5KNLA 4BMNA 5JYFA 2GUGA 2F00A 2X5KO 4MVJD 1LTHR 2CMDA 3GVXA 3OA0A 3I1JA 3LU1A 5TT0A 3FWZA 5CEEA 2PTGA 4IXWA 4BNMA 4BO0A 3MJVA 3DTYA 1O8CA 4BGEA 5HA5A 4NBVA 5JYAA 4J90A 4UVEA 5CP8A 2I66A 2PKQP 3IP1A 2B35A 4Q39A 4GI2A 3S2EA 4IGFA 3I5MA 3UXYA 4N18A 3WX0A 4R16A 4CM8A 2PZKA 2CNBA 1N7HA 4EUFA 2IRWA 3IJPA 4LRSB 4R51A 4ZU3A 3KUXA 4FN4A 4GX1A 1ZCJA 4IDFA 1JQBA 1NR1A 3NUGA 4JN6B 2E49A 1PU2A 1G6KA 3QVWA 3RKUA 1C1DA 1Y8RB 3DZJA 1DBVO 1N9GB 3O03A 4BV9A 5FI5A 1A9ZA 3R3SA 2C7GA 2C5EA 2YV2A 5TJHA 5KJ1A 5JAMA 3SBOA 5A4DA 3OQ6A 2B5VA 2HUNA 4ZQBA 3DZGA 3DR3A 3R1IA 3B70A 4CQLA 4EJ0A 4GSKA 1ZK3A 1GL3A 4YA6A 2BGLA 1Q7GA 4I08A 4HY3A 1NFRA 2QIOA 1PWZA 2DBRA 4J91A 1GEGA 3R3JA 2UUOA 3BHIA 2X23A 2B37A 4OSPA 1VJ1A 1XR3A 2GZ2A 5BNFA 3JD0A 2ZJ0A 4D0SA 5U9CA 1PL6A 2P2SA 4ILKA 4LCEA 2WSBA 3EC7A 3OECA 4BL5A 3M1LA 4R3WA 1OI7A 4PVCA 5CG1A 2D5CA 4Z3KA 2YFHA 4CLDA 4FGSA 1UJMA 2EWMA 3UF0A 1EMDA 5DZSA 5JDCC 4GX5A 3BMOA 3K5PA 4HNHA 1N2SA 3ZWOA 3IDSA 3IC5A 1HDCA 4Z0HO 3GK3A 5C3MA 4R5MA 3JYLA 1PQUA 1BTOA 2IYPA 3QVXA 1XQ6A 2OFPA 3BXXA 2X5OA 3A28A 1D8AA 1C0IA 4O0LA 5G0UA 2VUSA 4MKZA 2FSVA 1LJ8A 1LDYA 2WD7A 4E3ZA 1QV6A 3KYDA 4WCFC 3HZZA 1LI4A 4EDFA 4E5KA 3RFTA 3JYNA 1Z7BA 2NACA 2O3TA 4DGSA 2FPIA 3GLQA 2Z1MA 2PFGA 3D1LA 2DTEA 3ONEA 1JAXA 3G49A 4LCJA 2BFAA 1KBZA 4E21A 3Q6IA 3RC7A 1BVRA 3A4VA 1BMDA 1GZ6A 2Y66A 1Q7CA 5EINA 5DT9A 2NNLD 4XYGA 5L7WA 3FWNA 2UAGA 1IHYA 3BTVA 1B14A 3D3EA 4IMPA 4WKGA 4J3FA 3RFXA 2X0JA 3D4NA 4L4RA 4B3IA 1I3MA 1KIFA 1U3TA 3DXFA 2GPTA 2YZ7A 4ND2A 3PVZA 3IL2A 2G17A 4RVDA 2BI7A 4P4NA 1NASA 1SEPA 3GEMA 3L4BC 3ZGYA 3LC2O 3RUEA 1H94A 1Y1PA 2WMDA 1MFPA 1I2BA 4RCVA 2JD2A 2LDXA 3QRWA 4YAJA 3C7DB 2B36A 3C1OA 5A5EA 1DJNA 4UVGA 1ZJZA 1B3RA 1XCBA 4ZA2A 4B4VA 2AE2A 4GGOA 1SC6A 2YW9A 1YB4A 2CZCA 5KVSA 5B4VA 2AW5A 2BFOA 3UH1A 3ZHBA 4R54A 5A02A 4BS9A 2ZCVA 4KMSA 1E1NA 1VM6A 2H1SA 2YDYA 3GFBA 2VYVA 5L3ZA 3CE6A 4UEOA 2DU8A 1UP6A 5CDTA 4A5OA 5CAEA 3ICCA 3TWOA 5I7FA 4R1NA 1YB5A 4RQUA 1VL0A 3LLSA 4X54A 4CV3A 3DBLA 3VZQA 4U6QA 1BGVA 4YRAA 5DOZA 5JS6A 4GKBA 5A9SB 3Q11A 5IFLA 4YPOA 3K9QO 3DHEA 5EPOA 4YAEA 3GNSA 4EUHA 5JFOA 5JSFA 1ZUD1 2Q1WA 2E4AA 3CZRA 3AY3A 1LDNA 1LSSA 2CUKA 4LISA 3D7LA 4DBVO 1GY8A 2VHZA 4O63O 4IY1A 5G4KB 3H65A 4GL4A 1DIHA 1P0CA 3S2IA 1DEHA 3WFIA 5GZ1A 1R4NA 3I9OA 3PFFA 5DCYA 1FK8A 3FBGA 4INAA 4BHTA 4CMCA 2GGSA 5U1PA 2AG5A 1HETA 3UVEA 3I9MA 1A4UA 4I9HA 2XAAA 4NHEA 2E37A 1MG5A 4B8WA 5AXCA 3R6DA 1SOWA 1ENYA 3GY0A 3LYLA 4LVUA 2NLOA 2OP0A 1U2DA 4B3HA 1E7MA 1QMGA 1ZSYA 1WDMA 2EV9A 3RFVA 4HX5A 3GDFA 1U7TA 4CPDA 3HDQA 4NNJA 1DOHA 2YV1A 4E33A 1U1IA 4IS2A 4M49A 3STHA 4CODB 2EW8A 1GYPA 3S8MA 3DC2A 1C0LA 3PJDA 3JQBA 1ISGA 2F1KA 5T64A 2VWQA 4YJHA 5KJ6A 4NU6A 3PYMA 1I2CA 1NQTA 3S2FA 2IODA 2WE8A 1GPJA 2VRCD 2NU8A 3ADOA 1WWKA 1BW9B 2ZTMA 3K2EA 4BNZA 3ZWAA 3GR6A 3PYLA 1E77A 4BNKA 3ZV4A 3QVSA 2J6IA 4FJ0A 1E3SA 3DFUA 1FMCA 4EYEA 1DRUA 4PCVA 4GSLA 3S2GA 4BO4A 5IF3A 3E03A 5KJEA 4WECA 1KYQA 1C1DB 4XD2A 4OIMA 3ZZNA 4FBGA 3RROA 1IPFA 4HNGA 4LMRA 4DRYA 5I7SA 2FZWA 2B83A 1QORA 4JLWA 1HLDA 4NH4A 1D4FA 2P9EA 4E30A 2Y93A 1C0KA 1ZBQA 3U4CA 4KWIA 4Y6SA 3ONFA 4CQLB 1VKNA 1EUZA 2HK8A 4O5OA 3QWBA 1EDOA 3VKUA 1DIGA 1LLCA 3E18A 3BMCB 3IIEA 1HDZA 2C29D 2HSDA 2I3AA 1LUAA 3AJRA 2TMDA 3QQPA 1HTBA 4RVHA 2R2GA 1FDWA 5A1TA 1F8FA 1Y8QA 3CEAA 2OBYA 1LRKA 3IUPA 1K6XA 2PY6A 2YQ5A 4BV8A 5I9LA 5KJFA 2EF1A 3WGHA 3WQSB 1KC1A 5HTOA 1DLIA 3PQDA 2O48X 5IZ4A 3BAZA 4RORA 3ZWBA 4MIEA 1A7KA 3MWEB 4GX2A 2C59A 1PJQA 1PQPA 4F6CA 3PEFA 2UV8A 3UFXA 1PZHA 4QT0A 2Q45A 5JMWA 5JAZA 1ADBA 1JKJA 4EW6A 5IN5A 4CM5A 4LW8A 1PEDA 2DAPA 1ULUA 4YJDA 4B4UA 1NBOA 4RDHA 1UR5A 5JC1A 1MXHA 2G1UA 1E6WA 3U09A 4N54A 2Q99A 1P33A 2D3TA 4IZIA 2J3JA 2O7QA 4TZTA 4J16A 3KBOA 5EERA 3PGJA 4BB5A 4UREA 3QJ5A 5JO9A 4Y9DA 1GZ4A 2NU7A 4JP2A 3UAGA 2XF8A 1LSOA 1TEHA 2VYVD 2VNSA 4MKRA 3VH3A 4Q9NA 1NAIA 5C5IA 5IG2A 1HSOA 2DTDA 1X0VA 3OJLA 3MTGA 4BGIA 4GBJA 3INTA 5L53A 1DAPA 2GO1A 2BRUA 3E48A 3PWSA 1U5CA 3F1KA 3RWBA 3NT2A 4CM1A 3UKOA 2VWGA 1I3NA 3DONA 3DMTC 2RCYA 5K6AA 3H9JA 1PGQA 4PLWA 3T7CA 3SJ7A 4FJ2A 1E1KA 4YEDA 2B5WA 5IN4A 3KLPX 1LSJA 4ZGWA 3TN7A 1P1IA 2VYNA 1UP7A 3F46A 4I5FA 1KS9A 2X4GA 1SBYA 3GN2A 3WYBA 4AJHA 2WDZA 1MA0A 2E48A 4TQGA 1E7YA 3ZWMA 1KETA 3AOEA 2YHUA 3GRPA 2HQ1A 4M89A 4NI5A 1ENOA 2Y1CA 3LF2A 1GV0A 3FI9A 3ANLA 3G1TA 2CDAA 3GVIA 2CVOA 3OP4A 1WP4A 2D4AA 4H3VA 2C20A 4A10A 2HU2A 2PK3A 2IXAA 3H9GA 3ZW9A 4B7XA 1DC4A 1EQ2A 3V2UA 3NGXA 4CLEA 4NFHA 4D79A 2PD4A 3HG7A 3WIDA 4ONEA 1NNUA 4ZQGA 2ZTUA 3DBLB 4XYMA 2P91A 3JQCA 1I0ZA 2HKIA 3SLKA 4UEKA 4CR8A 2ZB3A 3JQ9C 4N5LA 1EVYA 1KEPA 4R1TA 4MVJE 3EDMA 5C37A 4NBUA 1Z74A 3JCZA 1EBFA 1YRLA 1X14A 3ROPA 3BYZA 2QYTA 3TJRA 5L4NA 1ZO8A 3GZ4A 4J6FA 3H6KA 3EUWA 5JCXA 3CMCO 3GMSA 3RC2A 1AHHA 5CPFA 4O59O 2BELA 1KOLA 4IGEA 2EJVA 2VZ9A 2YQ4A 3ZWXA 2D0IA 4XDYA 1WZEA 1DFHA 3JD3A 4BNYA 4MVJF 1E3EA 5COBA 3PRJA 1E1LA 4FFOA 1V3TA 1B8UA 1X15A 2ZYAA 3PJGA 4NBRA 3FR8A 4YJGA 2FPGA 4OAQA 4UVIA 3W1VA 4R01A 3GUCA 3NAQA 1FDVA 3MJCA 2Q1SA 1JKIA 2GNAA 4WCFA 3A9WA 3U9LA 5THKA 3K30A 2HDHA 1L1FA 1PJ2A 4KQWA 4BNFA 2CF5A 3VZSA 5G2OA 3TSCA 2GLXA 3PDUA 5CPBA 1XWFA 1P9LA 2TMGA 2PGDA 2VN8A 4G65A 5TS3A 1NWHA 2O3SA 4ZD6A 1YH3A 2WD8A 1CQJA 3AU8A 3FCOA 5IAAA 1LX6A 4OXKA 4A0SA 4PLHA 4QFDA 2JFHA 3VHRA 5T8KC 3I9JA 2JAPA 3WOHA 1I30A 4XRGA 1UDAA 3ENKA 4MIYA 1OBFO 3EVNA 2AQHA 4Y98A 2C7VA 4CM9A 3F4LA 5JYEA 2H9IA 2X8LA 1BXGA 2FOIA 3LVFO 4DMLA 1UDBA 5IZCA 4S3MA 3HDHA 1AN9A 2CFCA 1UAYA 3V1TC 4D3SA 5TC4A 1HXHA 1R4MB 4II2A 4QTZA 3LZ6A 3FPCA 1SEVA 1GD1O 1F06A 1C0PA 2Y05A 2IZ1A 4P8RA 1IPEA 4OGWA 3K6JA 4Z3DA 4OHUA 4ND1A 1MUUA 2Q2VA 4JNKA 3WTBA 1E92A 4XKJA 1EFKA 2J3IA 3LLVA 5HS6A 3VPSA 1YDEA 4PGFA 3WXBA 4Q3DA 5T6BA 3H5RA 3GT0A 2HLPA 2XXJA 4M8SA 4R9SA 3WJAA 3MWDB 3AI2A 1PL7A 1GPDG 4URFA 1SO8A 1U3UA 1ZEMA 3WFJA 1UP4A 4IIUA 1RYDA 3DBRA 4C4OA 1PR3A 1B15A 2VCYA 3OH8A 3L07A 1YL5A 1Z45A 2O3JA 5F5LA 2AE1A 1GCOA 2BFPA 1C14A 2HJSA 3B1KA 1XYGA 2HJRA 3O8QA 1E1MA 5I7VA 1ZEJA 1QP8A 1P1JA 3AK4A 3WG9A 4A2CA 1CWUA 1ZZEA 2I5PO 2ZATA 3GHYA 4JIGA 4M55A 4BO3A 5CDSA 1XELA 4PIVA 2EW2A
chains in the Genus database with same CATH superfamily
1L1RA 2QY9A 4J0IA 1UKEA 3X0DA 4LV6A 3TDKA 3EVAA 2R8PA 2XHEA 5BVHB 2P2NA 1JQEA 4LHXA 3VU0A 5KAPA 4OQNA 4TM7A 2YV5A 5AO9A 4CMIA 3QEBZ 4O1HA 3UFXB 3FIJA 2ODWA 2ZJ8A 4XZ3A 3IP3A 1Y0BA 1YV9A 4PN3A 1ZK1A 1AKNA 1BZYA 1XU7A 4PGHA 4WUVA 4W9NC 5ELMA 3RVRA 4XPZA 3I3OA 4Y6PA 3V6MA 4CQMA 1A50B 1I9GA 2RGCA 2PWZA 2FUEA 4LMPA 1N2XA 3WO1A 4DUZB 3U6KA 2FE1A 3WISA 2IIQA 5JXHA 4QUEA 3PENA 4H7JA 3QX3A 4BNTA 3M82A 1U6IA 3DQPA 3JRWA 3M6UA 5HDQA 5C46F 5K4HA 2X5NA 3FPAA 5DJ5A 3KQYA 3JSXA 3CZPA 2UYCA 1W1WA 3MUEA 3Q0EA 1HYHA 1K4MA 4HDNB 3SE0A 3AI1A 3H19A 4GI3A 4DWVA 4EHDA 1E9DA 1EX1A 2ZJBA 4JKIA 4N5HX 1W36B 3DZDA 2HSGA 2Q8NA 2CLEB 1O2DA 2HWXA 1KEZA 1MJNA 4UKDA 4I3HA 5EIHA 3LT2A 2VDQB 5A0TA 1DPFA 2W2QA 3WL5A 1P1HA 4BIIA 4F84A 3HN2A 4TTRA 4ES6A 1PD0A 4IRXA 1F3LA 2B9EA 1F51E 3HFGA 2HK7A 2XLCA 3G7NA 3IHLA 3PBKA 1DB3A 1JPVA 1SXJC 3H3XA 3LHFA 3L77A 4TXMA 1S7GA 4NU0A 3PXAA 1LJLA 4F45A 3L1VA 4DV6B 2AA3A 5CEJA 1BKDR 1EJ0A 5D1HA 3SLGA 4IFEA 5ITVA 5KQPA 2P65A 3H5VA 3K9HA 3BMNA 1ZA2A 3A2MA 4HXEB 5L3SB 4CMKA 1NQ5A 3U3XA 2XXAA 1QP4A 1EFHA 2Y4NA 4KDEA 4Z9BA 4F8JA 2EKLA 3TVDA 3S1LA 2NUAA 4G0MA 1TTPB 1FFGA 1ONPA 1BCSA 4DE5A 4CQNA 1N8SA 1HRDA 4AMUA 1GSIA 1OX6A 3HB0A 4O3MA 3HL4A 3CX4A 2ZAMA 3TQSA 2IXTA 3FZNA 1A8IA 4M1KA 1NBHA 1NU6A 2XOEA 5FL7A 3E7WA 3BQNB 1DKQA 1IXYA 1CU1A 1KOFA 3PA8A 4C2AA 4AP6A 4ZAYA 4A2QA 3DV9A 1KAEA 3DE4X 4XEHA 4Y0AA 2A84A 2OCBA 2IS1A 4Q4DA 2DT5A 5JSHA 4G09A 3O4FA 1ZMRA 1W73A 1QPBA 3ORYA 1BWPA 3VJRA 4ZPJA 2BY4A 2MR6A 1GO2A 4LI3X 2OCGA 2GPJA 3RRXA 5EJ7A 1JWBB 1LDGA 3E8MA 4M7OA 5IDQA 1W85B 1SUBA 4E31A 3OHSX 2IHKA 5TPZA 3UAOA 2AZDA 4R69A 1UT5A 2YFKA 4L7VA 5A5DA 3QQ5A 2PYZA 4UVDA 4JYCA 2Y71A 3KWLA 2E4WA 2IITA 1Y3DE 3EIXA 1DBSA 1REQB 4F11A 3CG0A 3QX8A 2Q5IA 2NZ8A 4KAFA 5AP9A 2B7BA 1DJOA 1HPLA 4TV8B 2AC4A 1JEDA 1WUYA 3PR2B 4ZCLA 2H63A 2QM0A 2Q46A 1TUBB 1WKCA 3U3KA 4AU1A 2B69A 5CA1A 3KNZA 5HIAA 4LNUA 2YIMA 4M8NE 3WQHA 4G0UA 5DGIA 3QY9A 2HCFA 2C04A 1RCTE 2PHZA 2I2DA 1A7JA 4HQNA 2VRWA 1UZMA 2O07A 4JT9A 3C1AA 1HYGA 3KVOA 1Q7BA 1ZR4A 5LP6A 1H66A 1P60A 1Z25A 1N92A 2X0IA 1Z47A 3ILHA 2ZE6A 4FFNA 1YRWA 5DX1A 3HUDA 1OGJA 4NYJR 2IDKA 2W2XA 3ZE2B 4DSTA 3AFNA 1CQIA 3A6JA 3DGEC 3F90A 2O8NA 3ZE8A 4IVPA 1PZNA 4EY3A 5HQ3A 4X1YA 1I94B 3HKDB 3U5ZB 5AUQA 3MELA 1EZ1A 4ENVA 2PZGA 1T2UA 1A8UA 2HQRA 4RZSA 2ONYA 1T2CA 2F4VB 4C06A 1PEAA 2CDNA 4EUEA 1A5AB 1I8TA 1PGOA 4BVLA 1E63A 4O8JA 4O4JF 1X2EA 1VLLA 4TRRA 4N49A 3IQWA 1O7JA 3A6DA 3MJTA 6YASA 4C4TA 3LUHA 1EB8A 5CEFA 2QGZA 4YQYA 1S3FA 3QBTA 3UC5A 2E4ZA 4AICA 2ZU0C 4ESVA 3OWHA 2ZR8A 2I4IA 2EJBA 1WV0A 4I6EA 5BRAA 5C7IO 2XOKA 3JV7A 3WL3A 5BR1A 4OQZA 4Y6GB 3RLFA 2HBYA 1N8NA 3U0BA 3ZIUA 5C52B 2IUTA 4EI2A 2BTOA 1Y33E 1XHEA 4RE5A 2GYUA 3VSAA 1K5HA 2BKXA 4QM7A 2I7VA 3GELA 721PA 2DPYA 2IZ6A 1JA9A 1YVDA 4KJXA 1H9BA 5JS2A 3OEHD 2UZ0A 3BA1A 4JB0A 5FF9A 4E15A 3ZKWB 1GA4A 3DMTA 4ZGBA 3BD7A 1PQYA 3PPWA 1QGED 1HT3A 3ZWYA 2IWRA 4IIEA 4ALNA 3IERA 4QDJA 5FFFA 4EELA 5B5SA 2F9FA 2ZRGA 3L8GA 3NB0A 3VKWA 3VVBA 3WWCA 3HYCA 1A9PA 2M6RA 4QVKA 5F7JA 1CVRA 2PD6A 3B6KA 4RPKA 1Z22A 4CFYA 1NYTA 2J0UB 1GSAA 2A5JA 4PRKA 4WBNA 5CFMA 3C8ZA 4OLFA 3KS9A 1SOUA 2OCAA 1M6VA 2VYCA 5DO9A 4GC5A 3IILA 4BRUA 2R7MA 1P3JA 3AYXB 2X86A 4GVLA 4BBJA 4BMVA 2D1YA 3ZCSA 1M67A 2YASA 4DXHA 3AKEA 4C4RA 4ER6A 4BV3A 3OC0A 4PPYA 2VK8A 1JPJA 5ABPA 2D1SA 2FSSA 3EDRA 1A88A 4ZO4A 2DH6A 3ABZA 3S2ZA 2WIFA 1UF9A 4M98A 3KRTA 4C3OB 2WFZA 4K8OA 4OAOA 5K0BA 3CPSA 1CRZA 3TMAA 4LDRA 3G2IA 4P4UA 4QRIA 4HR7A 4R1MA 1XX6A 2PS3A 4IDAA 3QBEA 1L8OA 2ZBVA 3NFRA 3RYHA 3HK2A 3WMXA 3OLZA 3H9EO 2VHWA 3AUXA 3WRVA 5JCZA 2IE0A 2QHXA 1V8DA 2H9YA 2JHCA 2QUJA 2V96A 2PZAA 1HZJA 3UHJA 5AVQA 2DEUA 1TADA 3RK0A 5CB0A 3IDOA 2AFIB 1YZKA 2JF0A 1AS0A 2F43B 2PA3A 2Y92A 3CVYA 4GO1A 2C2MA 4QRDA 2GARA 1NP7A 1AE1A 3CY6A 4TYQA 2QRGA 5AM1A 4J4BA 3K0SA 1L5WA 2OSVA 2EKPA 3Q3HA 2PIDA 2OBMA 1VJCA 2EKQA 3DTVD 5JTTA 5GONF 4NZ9A 3Q8MA 2VS1A 3R0ZA 3Q1LA 2IWHA 3SIPA 2QX9A 4HBGA 2O5CA 5HBRA 1USUA 3QW4B 1MENA 4FYIA 1U0LA 3UJ7A 1LI5A 3FTDA 2WVHA 3T95A 4QQFA 2Q3LA 1MB4A 2V4ZA 3LK6A 3ONWA 1U9ZA 3R3YA 3DKPA 4OBEA 4MQEB 4WNCA 4ZKDA 3TB4A 4P9NA 3E9MA 5IXJA 4EKNB 9LDTA 3MJSA 2FPPB 3RS2A 2AOXA 1M1NB 1QVZA 1NYQA 3JRXA 1GFZA 4JB2A 4LS3A 1FXSA 3K0FA 4JBLA 2Q6VA 2RSLA 3IMFA 3EDQA 2AG8A 4TLAA 3WYEA 3ZHTA 3RC8A 1G0NA 4G1EB 1P29A 2DQYA 3ZHOA 4LDJA 3F5SA 4YJ3B 2DUJA 3K31A 3TMYA 1EJ6A 1K7XB 3LA8A 5KOIA 1DARA 3QV2A 2MSEB 4QUDA 4Z9YA 4C07A 5SYAA 2PS9A 3GOQA 4W6QA 3TW4A 1YC2A 1YIOA 3FOCA 1GN9A 3AG6A 4J4TA 4QGHA 4P4GA 5FXMA 4PR3A 3MJDA 2PLFA 2SCUA 3CW2A 5DNAA 5C8VA 3RUIA 1RE0A 4JEMA 3DTVB 3B20A 2JGDB 3CF2A 3G9TA 3OD1A 3PTZA 1NXQA 4C5BA 4EPXA 4OQ4A 4ZV4A 1V9CA 1QH9A 4YWJA 4HS4A 3ND8A 1JDZA 2RH9B 3HDTA 3JQ8B 4WJLA 2AVDA 2Z95A 1GQRA 1QYCA 1DRVA 3I4CA 4RPCA 4RVSA 2CLFB 5MFPA 1SHLA 1XD9A 3ET5A 4FLEA 4ARSA 5F1OA 4YQFA 1G59A 4EY7A 4HEJA 4JYBA 3PIIA 5TLSA 3W8DA 2WZQA 4RELA 1WRBA 1KZ9A 5JWRA 2ST1A 2VDRB 3FTNA 3AVVA 4ZVTA 3PQ5A 5AT1A 1KSGA 1WLYA 1UBLS 4TTIA 4JX8A 4KWCA 4PO3X 4XGKA 3O1LA 1YJ8A 2JIQA 3M6WA 3NONA 5AESA 1GCUA 2HLDA 1LNZA 2VJMB 4O4HB 5EP1A 1HSZA 1RACA 3VYUB 3U19A 3SFVA 1K5DA 3BRSA 3W1WA 2QTTA 4BWYA 2WJAA 4ASUD 3IE2A 3ZCPA 2FETA 2KHZA 3EF1A 3GBVA 3EZ6A 3DLIA 2H59A 2X2OA 3G9UA 4DR7B 1QZUA 3E53A 5CA0A 3IDFA 4JI5B 5J2TA 1XQVA 4H35A 4OHMA 2I1LA 3CXUA 4RJKA 3WGTA 4G07A 2D8MA 4LZWA 3GRCA 4KJZA 4NMHA 3FCCA 2XIQA 4QJIA 5I9TA 4MGIR 1RQRA 1KPGA 3V4OA 2VQEB 4JI4B 3WGGA 1ETUA 2BE9A 2WSYB 3UCXA 3KGDA 1VP9A 3NV7A 5JD6A 1QIFA 4LJYA 2Q1TA 4CIWA 3OFSA 1E2UA 4DWOA 2XSZD 3A3NA 1GKKA 1YQDA 2B1QA 5LSAA 2GTIA 3D3JA 2KYRA 2YMPA 2BEKA 2IKQA 5JLAA 1CKEA 1F4PA 1X70A 4Z99A 4AZSA 1SVWA 3CQ9A 4J0HA 3V4SA 1ODJA 2F90A 4EX6A 4HXYA 3NEAA 4EAQA 4MVJP 5DIFA 1ZRNA 4J2HA 4GEKA 4G0YA 2OV8A 5JJLA 1RJGA 3BEDA 2NXJA 5CIQA 4UU8A 3L04A 5FNVA 4L74A 3V8BA 4RFLA 4DN6A 3ZJ5A 4ED9A 3IEKA 4TN1A 3R5SA 4FW9A 4W9NA 4BC0A 1Z73A 1N7IA 1YJBA 3C3YA 1M76A 4M6WA 1Z9BA 1Z26A 2UKDA 1T3GA 1NMYA 3EGCA 2VEOA 3RWMB 4JL6A 4C01A 4MV3A 4EVQA 1PWHA 2G67A 2B3DA 2V6FA 4U7DA 3I6MA 1HL3A 4NYMQ 3BL5A 2YY7A 2YYYA 3EIWA 2WWGA 3QOYA 4V2IA 5F9MA 5BV0A 5KB3A 3TRKA 3QYAA 1XPJA 3NKLA 1PNTA 1PR0A 5SZKB 1SQGA 1QVWA 1E2KA 1B00A 1KI4A 1GL7A 1KIMA 1ND6A 1O96A 1UXKA 2VBFA 2WG0A 4KWHA 1BH6A 2O8EB 2H31A 1OX5A 5INTA 3IKTA 1M3SA 1ZBDA 1QH8B 3DEJA 1PT9A 4HATA 2ZS7A 7ADHA 1LPPA 4CMJA 3TZHA 3D7MA 2QUZA 3K6SA 1QHFA 2AOTA 2F1IA 2R1ZA 1NPTO 3NTRA 4GM0A 4OJQA 4RS4A 1IH8A 4C4PA 4EF4A 5D8DA 3EK2A 1FNCA 4WD3A 1D09A 2HIGA 2J0EA 2JNWA 2UZ3A 5THXA 5ESDA 3QE3A 3ZUPA 1J24A 3I52A 2BKEA 5K3OA 5BY2A 3C39A 1NSYA 2Q3CA 3OT1B 3TVYA 2FSUA 1XSEA 3D6AA 5EE9A 3UK7A 5DN6A 5DP1A 1YQXA 4A03A 2EHDA 3FNEA 4K6FA 3ZQ4A 1K6JA 1JWLA 1N2BA 3A4YA 2QJTA 3COPA 3LUCA 1A04A 3OPVA 2L82A 5DGDA 4RPJA 5HXAA 5KSWB 2O3RA 1PS0A 4KV9A 4N41A 1Y1QA 3PZBA 621PA 3JRNA 2VJLA 1MD9A 2ZSAA 4I55A 4MGYR 4WKCA 5A7GA 5IKMA 2ZQZA 1Z2EA 2ODTX 1PVDA 1LTKA 3Q12A 3T94A 3V4LA 1YB1A 4I50A 2Q2WA 4MLPA 1ISHA 1L3CA 4HNQA 3JQGB 2E21A 1N4AA 3FFBA 1OILA 4JH0A 1W5TA 2IYUA 5KOHB 4PFQA 4WSOA 3SBEA 3CLTD 3IP7A 1I3CA 1TJPB 3PHCA 3JXEA 3LGAA 4Y2GA 4HFRA 4B76A 2GNOA 4NE9A 3S8YA 1OYOA 5KX5A 3PSAA 1SCBA 2WPNA 3HU1A 2EF0A 4DA8A 1LLDA 3SOPA 3QSGA 2VQFB 3Q72A 2VUHB 1IE3A 1BGWA 2CJWB 1O89A 1HRKA 4R2JA 1NDQA 4LJ7A 1DO2A 2W98A 1T9CA 4PBSA 1THZA 4E3WA 2ZULA 4J6EA 1I7QB 4NMWA 3ZU6A 5AJYA 4JC0A 4ZCIA 2V3CC 1I01A 2RGWA 4IG9A 4TL8A 4LEIA 2PL1A 4PO9A 3K16A 3V2GA 5JJKA 3ETJA 1FVXA 1V1JA 3MEQA 3WGLA 1P2GA 4KO2S 2ZUDA 4UJ5A 4O2BB 4IRMA 5DI3B 1GUYA 3WS7A 5CBPA 1EBUA 3K32A 1P75A 3DC7A 4M9QA 3NBYC 1BS1A 1ACLA 4P7KA 1GRCA 1E2FA 1NLMA 4AXBA 5CM8B 3P5BA 3OZTA 5FI1B 3RGWS 5CGQB 5FR1A 4C22A 3OMLA 4DXDA 4UUQA 1J4AA 3WDMA 1E61A 3EUFA 2J6CA 3EPRA 3ND5A 2AOWA 3PHJA 4KQIA 4C3UA 3LDGA 4XCXA 2WILA 2FGJA 4QFCA 4HDOB 1WZ2A 4CI0B 4DDMA 4PSKA 2IOYA 2JARA 3VSDA 3LC1O 3QTLA 4ZI7A 2IIPA 2NO6A 4Q4HA 3L0IB 3EVEA 3V8QA 1YDGA 2OB2A 3IE1A 5E8RA 5EYPB 3HUEA 5M29A 1GNRA 3IKLA 4M36A 4DBLC 1ZNYA 4JI8B 1B8OA 3WBFA 1D3AA 1GARA 2JZCA 3GV0A 5CLLA 4TV8F 4AG5A 4BUZA 4FGLA 3X1YA 4W7IA 4PRYA 1X1CA 3BWYA 2P5UA 3KELA 4POOA 4Z1OA 2QRVA 3DOUA 2WTNA 1K6EA 2OZLB 3OLQA 3LPAA 4FUQA 5FWNA 4HH1A 1ZI6A 2AR9A 4QJ3A 3M1YA 4QQRA 2L69A 4FMCB 3U3RA 3LF1A 3LYAA 2UXDB 1V5GA 1EE2A 3KT6A 2NUPB 2CKDA 3OG9A 5DBEX 5IFKA 4OL0A 2VDPB 5K6TA 4KFRA 3ZHCA 4MIOA 2QN2A 2WNIA 3KT8A 4JSYA 4N6NA 4D0GA 5IJ9A 1EVJA 3DB1A 1WOMA 2QLJA 1L7MA 2QLNA 3KQMA 5F2KA 1V3UA 1A27A 3MWLA 3E5RA 1F8XA 2X9NA 1SVUA 1SUCA 2XLBA 1IN7A 3TR0A 4AY4A 4H60A 4B81A 2I6SA 4DCJA 2XNCA 5BSGA 4KITB 5T4EA 2G82A 1X80A 2QRZA 2ZI7A 3FN4A 3WHLA 2BH2A 4PTYA 2ESRA 5AVUA 4H3HB 1HNZB 2XTZA 2DWQA 2NVOA 3BHJA 1M1YB 1Z06A 3BZWA 3L4SO 1VL5A 1P1RA 2C9YA 3FPBA 1O77A 4L5BA 3L1HA 3FCXA 4TKVB 1KHHA 4B3JA 1KERA 2WMOB 3D3WB 4BWFB 1KFEB 4Q7KA 1OJ7A 2V5VA 4OHVA 4BGUA 1QS0B 3P2OA 3LQQA 4I14A 3M6LA 1TA0A 4BLRA 2R60A 4XA8A 1SB9A 2E4YA 5AM0A 3DQZA 3IP5A 4H7KA 4R05A 3PL1A 4JI6B 1N2CA 1YZGA 2JGLA 4MVJA 2IOQA 3OLYA 4MUAA 4UTXA 2RAUA 3CSSA 4AZ0B 1O4WA 4BFUA 5KSZA 4DAOA 2WQ6A 1VSVA 2OZEA 1ZK0A 1M0EA 1P1KA 3B6JA 1E9RA 4ZTBA 1H4QA 3MBOA 1VBFA 2OD7A 1JR3D 2A9JA 4FIZA 3AUTA 1CUWA 3E27A 3QU5A 4OHZA 3G7SA 4LZOA 4ND8A 4NEHB 1IRIA 1MO3A 4NG4A 3O38A 3CWZA 4BNWA 5KUTA 5C32A 5L45A 1JI0A 2R7KA 1QP7A 2EFGA 4P32A 4PINA 2XHZA 1JR6A 1F2TA 3L8DA 2XTNA 1JG4A 2PV0A 2R8XA 5EZYF 1JEQB 3KCNA 2DXIA 4RHYA 4PSDA 3T9DA 1V1MB 3DL2A 1TB4A 1UCFA 3K0CA 2JCYA 2DY0A 3EEFA 1RQXA 3IJEB 3KQSA 3NWBA 1OB5A 1TK3A 4HWKA 1GTSA 2I54A 3CS3A 1NQUA 4JLMA 3SXPA 5TT1A 3LFHA 4HLQB 4RDCA 2ZG6A 1FFCA 4QWMA 3DVLA 1AZLA 3EVGA 1H1TA 2AFIE 4MJ3A 4U7PB 1GYRA 1F20A 3PL5A 4HMOA 4ZAFA 2G9ZA 5FQNA 5FJIA 5PGMA 5FLYA 1U0EA 5TRTA 3N07A 4FU0A 2C92A 4LF4B 1J0CA 1YCDA 1XHLA 4NOJA 5KYXA 2HL6A 2ZJ5A 3FTPA 4F8EA 2O54A 3NT4A 4NCAA 1PK9A 2JEYA 4WERA 1V8BA 2J33A 4Z9AA 3ZLJA 1FJGB 1DKLA 2CFOA 4NJMA 4TKZA 1P9WA 1Z4PX 2VP3A 5JJIA 1Y8QB 3PC6A 2OGSA 1N6PA 1TM7E 1XJCA 3HLYA 3PXXA 1VJRA 2BZGA 1QU2A 2P90A 2GBPA 3ISJA 4ZCMA 4BMOB 2VAWA 3LXUX 3BWDD 1MHMB 1X1SA 5KHLB 1HNXB 4H1VA 1JL3A 1X7ZA 2I6TA 2DQZA 4OU4A 2JFFA 4FFBA 2J41A 4KBGA 1RQPA 1D7AA 1ZMOA 4BY9E 1OXBB 3T4PA 3O9VA 2QX4A 5LWQA 1II9A 4Q3BA 5I6DA 1U0HC 3H2JA 4RETA 1JJAA 3OIYA 1HDYA 2OXCA 2WIDA 3KR1A 1SC9A 1XZJA 3AQIA 1TQ8A 2AOUB 4QNMA 4Y2XA 4MUXA 5AI6A 3QLEA 3AUFA 3S44A 5GADl 2VYND 1YAHA 1DJPA 4RA9B 1BWQA 4ZO9A 3FBTA 3KQUA 1FJ2A 3ANMA 5IYZB 4UCWA 3RCBA 1KR5A 1BA3A 5KTOA 4TYWA 3ST7A 4INZA 5I5GA 2LR0A 4MPDA 3HBJA 1TRHA 1Q0SA 2AN4A 1IEXA 1X3LA 3DHVA 3HV0A 3QFFA 4TWIA 4Q24A 3V4PB 1NRIA 3M34A 3ZDEA 4CIBA 5K01A 1S2DA 2QXUA 3NDRA 4N03A 3AL0C 4QKQA 1ZLYA 3L02A 1FDTA 2A1TR 4EJFA 2CY0A 5I4KA 2CNDA 3WLNA 1AO0A 4JXKA 4ZVVA 1P4RA 4D4JA 5K9ZA 4KC0A 4WNIA 3GEPA 3TUTA 5JNRA 3KCQA 4YJ3F 5LU8A 10MHA 3PFWO 2PE5A 1NULA 3L7YA 4F3TA 2FP4A 3UYKA 3U61B 4YRPA 5DK6A 3QKWA 1RC1A 2J5BA 1BHO1 3RTGA 3G2PA 4JJEA 1T5HX 4FNMA 4F5DA 2XJ9A 3T4EA 1HR0B 4K9PA 4MMXB 4Z4FA 4ZPXA 5ESXA 1UKYA 3TUJC 4DEYA 1MEEA 4ND3A 1G42A 1DSSG 2VNJA 3GCGA 3PD1A 4J7XA 4L28A 4PIMA 3FNGA 4X1KB 4P3OA 5J9FA 3SGLA 1FQJA 3GLGE 3L0CA 1NKVA 3T34A 4G5GA 1H69A 4UASA 4DLPA 1XNQB 1ZIPA 4ZYUA 4DMGA 3DMFA 4IZOA 4EITA 4EVRA 2Z5GA 2BTQB 4NBLA 4HTFA 1Y89A 2BHRA 1P3DA 3SFTA 3WYDA 1Z6AA 4YUWA 1PSZA 4RFSB 5KYNA 2UDPA 3A3KA 4P5DA 5H68A 3H2GA 4WADA 2QR2A 1RIIA 1ECLA 2ZKLA 1XDWA 4TGLA 2H1RA 5AIAA 3VDXA 5A6VA 3PYXA 4MW0A 4REMA 4G0VA 4BLOA 4PICA 1CETA 3L6OO 3HGQA 4FLMA 2WUWE 4OFWA 3CLRD 3OTIA 4U9UA 3W2EA 5CLJA 1RZRA 1KZGB 4KRYA 2NOAA 3FH0A 3NNDA 4MTCA 1JJ7A 1XKQA 3JWJA 4J0FA 4NS4A 4O4HF 2VSOA 4B0PA 1YCFA 1GXSA 1HF3A 1P74A 1L5FA 2PX2A 3AR5A 4H59A 1C1XB 1KDYA 1JNXX 3HU3A 1I6LA 3GLFA 3F6SA 1J2YA 4IMRA 2IV7A 2AJCA 2OZVA 3B6MA 5FWAA 1P4AA 1W4RA 4D6PA 4WZBA 3SC4A 2CE7A 2ORVA 2YYAA 4XXHA 5DF1A 3EFEA 1S2NA 3CN9A 4R2LA 1ISRA 1GG8A 4Q12A 4IM7A 1YI1A 5KYWB 4C7BA 5LP1A 2HFJA 3TH5A 1UZLA 1S3GA 2X9LA 2CC2A 3PI6A 3DFFA 4GYWA 1RMQA 5FD8A 2P2GA 2PMKA 2BFFB 2V9CA 3K20A 1TM3E 3GWZA 2ZRPA 3KOUA 1YBAA 3ODPA 5ALIA 4D41A 4DVGA 4NQZA 3VO8A 4B6FA 2ZT7A 3ASVA 1TXGA 2PXCA 5BMVA 5IEBA 1WHSB 3DWGA 1OKKD 1U3VA 2VIIA 1DG3A 5KMGA 3A26A 4QOJA 4ANFA 5K6AC 4TKLA 4DMMA 4FW8A 3UW3A 5K03A 3ULKA 4MS4A 4WNYA 2V1XA 3R40A 3CH4B 1QO0D 1ZDMA 2YJ3A 3QP9A 3HSKA 3HR8A 4R3UC 2JLWA 2O06A 1LH0A 3WYAA 4C0LA 4QFMA 4CR7A 3WWOA 3M5WA 4JY7A 4XIYA 3GRYA 2JIDA 3OCYA 5G3YA 3V33A 4G5HA 1RM3A 1FFSA 5ED0A 3A1CA 3BSYA 3QH4A 2WJ4A 5AVVA 2ZBPA 4Q5IA 4CLOB 1KVUA 4KRFA 1GU7A 2JFYA 3RF6A 1H2EA 2BEJA 1XZFA 2O0JA 4WCFB 1L5HA 1HFWA 3EZ7A 5IASA 1UM9A 3RAGA 1CBUA 1Z13A 5J9GA 3EWIA 4HDAA 5TMEA 2Q4RA 4B17A 4B3SB 2NPFA 1LKZA 2OZPA 3S1AA 5HR5A 1KJZA 3V2IA 5K3EA 4U5XA 4CL0A 2YJ5A 3MMNA 1W8DA 5JAOA 3ZWKA 3LO5A 3VC2A 4QFBA 3MERA 4WNAB 2EJTA 2HWKA 4UBMA 2WYHA 4ZT7A 5C7OO 1MJHA 3FDZB 4OL9A 3VX3A 1DDOA 2RKBA 3AZPA 4BZWA 2XAUA 1VIVA 3GBPA 1E5QA 5GVSA 1CFZA 1J8DA 1HE2A 2VDLB 3ASUA 3GGPA 2GEBA 4UCXA 5EQFA 3W7VA 4UOQA 3R3UA 2WIAA 2Q4DA 3D4BA 1KIAA 1KZ4A 1Z88A 2JKVA 2E3JA 5MN5A 4FGJA 1CS4C 2ZBQA 2I1WA 2QB5A 4GOXA 5I01A 4X92A 4BQQA 1WDLA 4X5OA 3WNQA 4ENWA 5LJIA 2HF7A 4L8GA 4Z4CA 1U7PA 1G3MA 1LPNA 3FKSD 4MB0A 4YDHB 3OHMA 4DJDC 4D96A 1XHFA 3B82A 4IW3B 1NJFA 4NPHA 4EA9A 1MPXA 1OXTA 3WDLA 4BBZA 3ZWVA 3JWGA 2BISA 3OTGA 2CLLB 5DLYA 2GT1A 1GFWA 2A1UA 2GSDA 2JCVA 3H2SA 4G0WA 1J39A 3V7FA 4IDEA 3DL4A 2PX0A 3BIJA 3I1YA 5L3QA 4IQ8A 4P3KA 4EK9A 521PA 2Z2IA 1DVRA 2WV9A 1MVOA 3BZBA 4Q7QA 4EJ2A 3QBVA 3GEEA 3JWEA 1A77A 1X1TA 3NDIA 4FD3A 1IY2A 4WGGA 4NEGA 2Q6OA 1X42A 4V0NA 5TMPA 1CF4A 1EDZA 3ELUA 5CH3A 2GXAA 2TSYB 4JMLA 3AUSA 1X87A 2RB4A 3O8QB 5JZSA 2VO1A 2YZ2A 2QN7A 2ZRIA 4JT8A 1QCDA 3DV0B 1H2WA 4FX5A 4MR8A 3RIHA 2IBMA 1RWVA 2PRKA 1JTVA 5K5EA 1MEOA 4D45A 2ODBA 1FQKA 1U0BB 3UANA 2N42A 5CIWA 5GMOA 3F6CA 4XX0B 4ZI5A 1E5XA 4CMAA 5JZVA 4O2BF 3O7MA 4O02B 3L0OA 3TJMA 4F4FA 5CCDA 2YXNA 5L51A 3EW7A 3ODGA 2W48A 4MRSA 3IE0A 2UVPB 3LLUA 1G5PA 3TFQA 3C4JA 2QD1A 3CKMA 1ID8A 1D0SA 4PBRA 1C9DB 4PQEA 3V8EA 3AJAA 3FYDA 1TC1A 2OAP1 1OJLA 3C3XA 1FTGA 4QXAA 5IWAB 3EQZA 3IRUA 4ETNA 1QYDA 5FI0B 4HK4A 1H5NA 4DLBA 1ISIA 1YI0A 2B7LA 3I09A 3LOUA 1MC8A 4A7PA 4UEJA 2GN0A 4B9EA 2Y1OA 3OQOA 3DW1X 1M2GA 4OMUA 2D59A 2ZCJA 5CK4A 5DHSA 3W5SA 2RIRA 2W42A 5HWSA 3RKSA 1UBUS 2FW1A 3HQ4O 3K35A 1OI3A 3KLMX 3S2YA 3JW8A 4JJFA 3ECCA 3LVRE 4E09A 2QOEA 3OKFA 2K2QB 3BJMA 2OCLA 3HY6A 3K9BA 4FMCF 4HYYA 4REQA 3Q7EA 4U7WA 3ZQKA 4C4YA 4CMBA 3N05A 5B57C 3DUFB 5JVDA 1ZKMA 1N9KA 2JZNA 3IUJA 4J0JA 4DUPA 3DPSA 4ZIRB 1AOXA 3T1QA 4EFMA 1M1YE 1I4EB 5KKNB 1NZJA 3PHHA 5ANRB 5TQVA 4QXPA 3ZYZA 1QPZA 4QVIA 3OZXA 2C78A 3Q3IA 2FJUA 4NDZA 1STOA 2I2FA 2MSNA 1KI9A 4GWGA 1DXYA 3ZE9A 4F1WA 5C53B 4XGIA 3OWXA 3CYFA 1KXJA 3AZOA 4PX9A 1U0SY 1ZOLA 1KF0A 1LFAA 3WB9A 2CYAA 1R6TA 4RY9A 4RIHA 2Q3HA 3KUDA 3E35A 3EGWA 3UPTA 2ZAOA 2WM8A 5KNDD 3ZZUA 3SIWA 4Y0NA 4HO1X 3VQTA 3OLCX 1SBIA 5A62A 1GKIA 1ZMBA 3WLJA 1L8LA 2AL7A 2ES4A 4PCAA 3VKGA 1VLMA 3B85A 2AQIA 5CXUA 4Y6RA 3KJZA 3LY8A 1HE5A 4KFTA 2XW6A 3DZIA 1IB0A 2TMYA 3L0PA 3FTCA 4J7AA 3C1TA 3N74A 4PU0A 5MN6A 2QUBA 3MNFA 4I8XA 2HLHA 5LKAA 2WR8A 1XLWA 5E6SA 2O3UA 2CB9A 2V7TA 1XROA 4L4ZA 1FCJA 3FF1A 4N0MA 3WB0A 2PFKA 1EGQA 4IJUA 3T12A 1KKMA 4B7UA 1U8EA 1ZJ6A 2BH9A 2ON6A 1R6DA 4FSXA 2F1RA 3PWKA 1NQVA 3UBMA 1GUZA 1C3JA 2GCPA 2FQYA 1JTEA 2I78A 2QTVB 5TQ0A 2QJWA 1W44A 3RYFB 5IF9A 2A7XA 4QUBA 4DC0A 3V00A 2PWPA 1BCRA 4Q18A 4UUPA 1Z6QA 4IH1A 3NBAA 3VV2A 1ISSA 2PYDA 4ARVA 4JDPA 1YL7A 1VJTA 2H54A 3AHCA 3DMGA 2QRNA 1X7WB 3RS8A 2ZB7A 3RH0A 4P3YA 4PZZA 5HYVA 1NVEA 2QVCA 3C85A 3KYCB 2A78A 3NZEA 4RJJA 1EP2B 5DCLA 1JDBB 1ZY2A 3PR3A 4BPBA 3UJ8A 1ZL0A 5IM4A 2FXVA 3AHFA 3H16A 3JQAD 1U2ZA 4WK4B 3C3MA 4Y9UA 2O2CA 4B6RA 4TXHA 4G5OA 2H2WA 1J20A 1O0SA 1PWYE 2R85A 3VSEA 4DAEA 5KCMA 5AOCA 3UCFA 4E5YA 5J4HA 4URHA 5KREA 3PQ6A 5M6DA 4B3RB 4ARAA 3ZVMA 4R71A 4Q47A 4RESA 4RIEA 1IG0A 3OPYB 4TRJA 1DWPA 3FMPB 5JYBA 4BVHA 3VPHA 1A8HA 1HDIA 1B42A 4EBFA 2AC7A 1GPKA 2WZBA 3C70A 1Z82A 3L0YA 1R4AA 1OFGA 1RD4A 4MS3B 3ROZA 2VQ6A 1R6XA 5EGNA 1MGPA 1R4MA 2TMKA 5EFOA 4TQUS 3ZD6A 2GETA 4EA8A 3ZXSA 3LTNC 3U44B 1YB2A 5JWHA 3W04A 2Y3IA 3TI7A 1MVNA 2J32A 1KP2A 2VQDA 3C43A 1QX4A 1XQWA 2EWVA 3N8IA 4K87A 4M86A 5AJXA 1G19A 1I72B 4QUHA 1EZZA 1WMBA 1QE5A 2LDBA 2Z5FA 3OIGA 1QQ7A 1IY0A 5GJBA 4TROA 2WTUA 3K73O 1C4XA 2IYSA 3CBQA 3IAXA 2XH8A 3W8FA 1OTYA 1S96A 2HW8A 4GIBA 3PGVA 5IJXA 2Q9UA 3LUPA 1NVTA 3MWDA 1KOJA 4GPTA 4BVJA 2IHBA 2EFCB 1PK7A 9ATCA 3GFQA 2WB2A 2G1KA 4HB4A 3WRXC 4DA9A 4YVFA 4ZC8A 2WG1A 3OQHA 4TXJA 3UMMA 3JQAB 4K1LA 3STYA 1RBZA 3C24A 4MAFA 1GU0A 4GGPA 4WPGA 3OEYA 1JR2A 4JGGA 3K70C 1J33A 1V6CA 2Z58A 4JLSA 1H0HA 3TBFA 2IXBA 1T13A 1NWCA 2E4UA 3QWAA 1JLKA 2O4UX 3AIOA 4MA4A 4TKUA 5IYZF 3B3JA 3PQ2A 3O8LA 2YJGA 3HB5X 2CYBA 1A9YA 3LG2A 4IXTA 5B3AA 2ZE8A 3BKWA 4HWGA 4B2LA 4HPXB 2JD0A 3X1DA 1HM5A 4AN0A 2OCYC 4DQVA 1V41E 5A4AA 2WIGA 4B34A 1ZP6A 5K0ZA 2WSSA 4RIGA 1I2ZA 5BSTA 5FR2A 1RKQA 2H9AA 1C29B 2GXSA 3SKYA 4CN8A 5AH0A 3W4KA 3E4CA 3O9MA 1MDBA 3EARA 3EP5B 4LRQA 4Q4AA 4KOEC 1Q7TA 1QAQA 4G63A 3O0DA 3ZGVA 5ALTA 3UCEA 1FPQA 8LDHA 4BKOA 2YXPX 1T1GA 1ZH8A 2IEIA 2LBPA 1H2BA 2H1WA 2O2GA 2PT5A 3VR4A 4PLFA 3V1KA 3RC9A 2HCJB 3GHHA 2H1HA 3BXFA 3ZI4A 1THTA 3CW8X 2EQ5A 2WOJA 2QX7A 2XJ4A 2JD1A 5DLQC 3IMCA 3JARA 5KWEA 5IW8A 3TZCA 3AEYA 4LZAA 1S2OA 2JBAB 1PZFA 3HNRA 2RKOA 4A6DA 5E6UB 1CF2O 1LB1B 1IDN1 2VC2B 1AH2A 1E98A 1TJ5A 4Z7JA 1FYWA 4ZVRA 5JV5A 5IAJA 2Z1NA 4GKAA 1UIRA 2FXIA 4HAYA 4RL4A 2AI3A 4OI4A 1BKSB 3GARA 5B1HA 2OV6A 1T15A 3PC8C 2BGRA 3MJ4A 2G6BA 1R0YA 3AM4A 3PKJA 2UXBB 2QE7A 2QF7A 1JHAA 1UJNA 3EQ7A 2YS7A 1E8DA 2XTMA 2PX6A 5K0CA 1O0CA 4CM4A 4KAAA 4Z0TA 1SHUX 4MWCA 3GGJA 2IXDA 2GASA 1PW7A 3EAGA 3EGDA 1MMFB 4X3PA 2Z3WA 1JTFA 3CLUD 3T3EA 3EPBB 3V8NA 5BVGB 3G6KA 3U4IA 4TN5A 3ZW8A 1JWAB 4D9FA 2O59A 4BU1A 2YS6A 2JLSA 1ZXLA 1MA3A 3NEYA 3CNHA 2XUKA 2JVJA 3LGXA 2R00C 1NP6A 5C4GB 1TE2A 1BHJA 1G5QA 1Z2CA 4PEVA 4V0LA 3CGGA 4Y2SA 3ASZA 4C6TA 4CT0A 3MQ4A 3PDIA 1PD1A 2XEXA 2ZW9A 4XOIA 4I5EA 2CHEA 4QXQA 4QUKA 2D1FA 2ZKIA 3FG9A 5EMLA 4L9RA 4HNAA 3V1YA 4OATA 1ZVKA 3THYA 1QMPA 5KYKA 2H1VA 1QH1B 1KVQA 5K99A 4OQFA 2ZT6A 3VNVA 3M7IA 5FBQB 1JVNA 1MP0A 2A30A 3F4BA 1H2YA 1VMIA 2P9GA 1PN3A 4OJYA 2PUEA 3KXDA 3AM5A 2AEMA 5ALWA 2RK3A 3DJYA 3OZRA 2N0SA 3DE5X 3V48A 2WYWA 3N8HA 3MTJA 4AIIA 1U9YA 3LBHA 1LBIA 3EBOA 1JDNA 3KTOA 3KVYA 3OCXA 1AHPA 2QAJA 4LTMA 1KRWA 4WWHA 1HT0A 4JOQA 1FP4A 3VHLB 2OYCA 1E8NA 1X0XA 2YUIA 3F74A 3C16C 2XMZA 2GDJA 5KCZA 1L8XA 3MG9A 1P18A 4W1RA 4AD8A 1GQ2A 1CJUC 1DKMA 4V24A 2OESA 1Y82A 5LQMA 4RLSA 3P97A 1NXXA 4M1QA 3QFCA 3VR5D 3IPCA 2QP9X 4ZN6A 2LKCA 1E3IA 1QHSA 3HFSA 1XP8A 3DZ8A 2XUHA 4M0KA 3UT6A 2EGGA 3GJYA 3PQEA 4GPEA 4MPPA 4II7A 3JAWA 3MTAA 4YQEA 6LDHA 4DR2B 1COWA 4Q02A 2I0FA 1ZM9A 3RVLA 1HL7A 3W5CA 2VBGA 3HABA 3SJCA 1GZ7A 2GXUA 1PNQA 2LCIA 2WWXA 3KEFA 4Q00A 1IHUA 2GBFA 4RTLA 3ETNA 2C2KA 3EGIA 4ZHQA 3TKAA 3GD7A 1EUCA 2HAEA 3LYUA 1K92A 1SIBE 1JPUA 5G0SA 4G8CA 1QCZA 2FY8A 2WJZB 3FNFA 3LQ4A 4PFJA 4QYIB 1P72A 4WLVA 3TE6A 5IJWA 1DOZA 3KJNA 2GVDC 3DE3X 3RAFC 3INNA 1QB8A 3VPAA 1TW3A 3HU5A 1NOKA 1M34B 3D6UA 3IQXA 1Z2DA 2GLUA 4XLTA 4MKXA 1EXMA 1ZIYA 4AJJA 1B76A 1KGSA 4A0HA 4KXLA 4EENA 4XOUA 2D2IA 2XYRA 1NJ1A 1YB7A 2FUCA 3KUUA 4GP6A 4U7TB 1JHMA 2QI9C 4JBYA 1DKUA 1MJFA 1VGVA 2NZUG 3T7SA 4LFAB 1NHGA 4YIHA 7REQA 3NHSA 1G8JA 1U7DA 2RI1A 3NATA 2QVBA 8OHMA 3I4LA 3GVPA 4KAXA 4BFCA 1E5LA 4AECA 1BFDA