1H9BA

Active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
485
structure length
485
Chain Sequence
b'VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
total genus 173
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9bA01
4XB2A 3WG9A 3WYBA 3RBXA 4PG4A 5BT9A 1DFGA 4KOAA 4ALLA 2OHXA 3AWDA 5DF1A 1E3LA 2O50A 3OIFA 4XYLA 2IODA 3U4IA 1EBFA 1DJQA 3PJDA 4B3IA 1QYDA 5BNTA 4OXKA 3HFSA 4TROA 4CMCA 1V9LA 1Q7BA 4N5MA 1PZGA 1JA9A 4WCFC 1G0OA 5T64A 4EW6A 1P0CA 2Y1EA 3U9LA 5I7SA 2Y1CA 3QVOA 3TZKA 1GY8A 5TC4A 4GBJA 1U3TA 4YVFA 5JMPA 1LDYA 1EUZA 2OBNA 1QSGA 3S2EA 3U4DA 4Z0TA 3MWEB 1PQUA 4OKIA 3NGXA 2DUWA 4NFHA 1M66A 4FGWA 1X7HA 2NUAA 2CDCA 5TT0A 3RC9A 2X9GA 3CZRA 1YDEA 1LDMA 4XQGA 4J16A 2NSDA 4JBGA 1CERA 5A3JA 5A4DA 3OF2A 1I2CA 1DXYA 2PNFA 3C7CB 4I08A 1FDVA 4GLOA 5EPOA 3QVTA 1LLQA 3W4JA 2UUPA 2BI8A 1WDMA 4EDFA 1P33A 4ZQEA 4HNHA 1GEEA 4FBGA 3V1UA 1PS0A 1D1SA 3WWYA 4FOOA 2JAHA 1HETA 4NBTA 4FFRA 4B79A 4GX2A 1E6UA 3MOGA 4BMSA 3JQFC 3LF1A 3TDKA 4CR6A 1FDUA 4IIVA 3M2PA 2DLDA 3DTYA 4NH4A 3WTCA 2YQ5A 3LT2A 4L4SA 1LU9A 4NK4A 5BSEA 1ZCJA 2BI7A 2G82A 4MIOA 5C7LO 5C7OO 1KC1A 2E6UX 3GA0A 1E7MA 5EQFA 3P2YA 1F12A 4M86A 4PLFA 4IDGA 3E18A 2Q1SA 1PU2A 2W2LA 1ZSNA 3BMNB 4KWIA 5G0UA 2ZJ0A 5ADHA 1HL3A 5H83A 5JDIC 4R1TA 1NASA 5G4KA 4BKOA 4IM7A 4BNFA 1SNYA 1TI7A 3FNHA 2GUGA 3GNQA 1PEDA 1CRWG 4LSWA 1MFPA 3JQAD 1LBEA 1LNQA 4BNXA 2P4HX 8LDHA 1SO8A 3T4XA 4DQVA 4OXYA 4A26A 2G17A 4AJIA 2PA3A 4RCVA 4HFRA 3MEQA 5L7YA 4MIYA 5JNLA 3ZI0A 2R6JA 4U5QA 3FPCA 4G65A 1B8UA 2WEKA 4JQCA 4CL3A 5CFZA 1JN0A 2X1HA 4QUKA 4PZCA 5A04A 1EE2A 4M54A 3E1KA 1M6HA 1XELA 4BV8A 1UXKA 3IMFA 3A4VA 5KIAA 4D43A 4ONEA 3P2OA 3L0DA 1M67A 2X8LA 2O23A 3N58A 5F1OA 1ULUA 5IN4A 4QXMA 3IUSA 1J6UA 5JXWA 3RFVA 2AMFA 4MPDA 4YRAA 1H2HA 1KY5A 1PJ4A 4YJFB 4HX5A 3A1NA 3AJRA 2Z1MA 4RPKA 1GQ2A 2NTNA 3KEOA 3PJFA 4GH5A 2YZ7A 3WNQA 4PG5A 1S6YA 1LTHR 3FR8A 4HNGA 3VVBA 1SZJG 4C7JA 4PLCA 4J4HA 3Q6IA 3C24A 3LSYA 4TKMA 4CM4B 3LQFA 4TZTA 3H65A 2VNSA 1C1DA 4U0KA 5GMOA 1IHYA 4J4BA 2ZYAA 2EP5A 3UHAA 1ULSA 3ZWWA 4BO1A 3DZGA 2ZKLA 4GGOA 2CNBA 2EHDA 3WQSB 2V6FA 3H4VA 5KJEA 1EK5A 3G3EA 4IS3A 1ZO8A 1OC4A 4D3FA 3JQ9C 5JYFA 3JYLA 4QO7A 3HHPA 4BNNA 1DAOA 1K3TA 1A4IA 4PRKA 4BMNA 3UCEA 3QJ5A 3EC7A 2PFGA 2J8ZA 3JQAA 4NU5A 5L9AA 3SLKA 1CF2O 1UUFA 4OHUA 1R0SA 3I4FA 3L4BA 4FC7A 1PIWA 3QWAA 1DHTA 1J49A 1WLYA 3WGHA 4AG3A 4FJ1A 3PDJA 2O4CA 3KOUA 4Q3EA 1RPNA 1HXHA 4PCVA 3DBHB 4PLZA 1F8FA 2VTEA 2O3QA 2W2KA 5JDCA 3MTJA 4A0SA 3V2UA 1V0JA 1N1GA 1JWAB 3JYQA 3PWKA 3EZYA 4U6SA 4BNLA 1I3LA 1R16A 4BNYA 5MDHA 1I5RA 2C5EA 1M76A 1NFQA 1PZHA 3G1TA 5L51A 5IAAA 5C3MA 2DC1A 2R00C 4Z3KA 4ZICA 3ZHZA 4PGFA 4I5GA 4IJWA 5AXDA 9LDBA 1XHLA 1GFSA 5JLAA 4IMRA 4EJMA 4IMPA 4ZGWA 1KVTA 4F3YA 4E2ZA 1GR0A 2G0TA 4IDCA 3GVIA 4O6VA 2VZ9A 2B4TO 3QWIA 1R66A 4AJKA 4DQUA 3OJOA 1E7QA 4K28A 2W98A 4PZDA 2GYYA 2DFVA 1OFGA 4KTVE 3FPLA 3GQVA 3H9QA 4CPDA 4J7UA 5EIOA 1XQ6A 5HTOA 4CMBA 5ICMA 1B15A 3H9JA 5CDSA 1U28A 3AK4A 1TT5B 4J49A 1I10A 2GF2A 3PYMA 4NI5A 5JW6A 3OJFA 3BMQA 3LYLA 2VRCD 3C85A 3MZ0A 2SCUA 3A28A 1NQAO 1QYVA 1JAXA 4KQXA 1A27A 4MKXA 3D5QA 1ISFA 2O48X 3ASVA 5GZ1A 2O3JA 1D3AA 3U3XA 4R9SA 1F8GA 1NWHA 4DC1A 5B1YA 2D4AA 2J6IA 1PS8A 4CM9D 2YY7A 1GDHA 5I9MA 1J4AA 4R1SA 2X6TA 3PHLA 5IFLA 2GN8A 1ZKMA 3EHEA 4CLEA 4M87A 4K9DA 4OQZA 5U9CA 4AJEA 1N7GA 4Z0HO 3KUXA 2PKRA 3TZ6A 1CWUA 1F14A 1F17A 2Q2VA 2WD8A 2C82A 4Q3CA 4B3JA 3DZJA 4U8GA 5H82A 4CV3A 2HK9A 1LLUA 2EW8A 3WFJA 3RD5A 3N74A 3BMCB 4LVCA 2IYOA 4FJ2A 3LT4A 2C0CA 4CMHA 3G79A 1HYHA 3I9JA 2VHXA 1P74A 3SC4A 4W9NC 5JAQA 4Q9NA 4QECA 3HWRA 1DLIA 1MC4A 1O8CA 1FMCA 2YV3A 2QQ5A 3OJEA 2BGLA 3NT5A 3QRWA 2EKLA 2QX7A 1ZXBA 3I83A 4P4LA 3NYWA 4YT8A 2A35A 2PZMA 4JLWA 2AXQA 3WDSA 2PGDA 4F6LA 2X0RA 3EY4A 1ZK3A 3JYPA 4J91A 5KVQA 1M6WA 4I9HA 3DHYA 3RROA 1Z45A 4WJZA 1PZFA 1W4ZA 5DBFA 2PWZA 3H2SA 4E31A 1P31A 3BTUA 3S2IA 1ONOA 1XCBA 1JVSA 4YYZA 1J0XO 4NHEA 2O3UA 4LISA 1WZIA 4BIIA 2VRCA 2QYTA 4NJMB 4XJTA 1YE3A 4YJFA 5K6AA 4RPJA 1I0ZA 4A10A 4CLRB 5F1KA 4IS2A 4E3ZA 3Q2IA 1T1SA 4ND3A 3B1FA 3I52A 1MP0A 3WS7A 4IZHA 4GSKA 5ICSA 4W6ZA 5L3ZA 4LGVA 1HZJA 1PJSA 4I9NA 4RQTA 1DIGA 4J1TA 1SAYA 3BMOA 3I5MA 1JW9B 3HDHA 4BV9A 4CM7A 2OMEA 3GGGA 2PD4A 1H5QA 3D0OA 1OOEA 3VZPA 4CUZA 2FPIA 5HS4A 1TXGA 2OBYA 2GO1A 3KZVA 2VUTA 3ANLA 2EW2A 3I3OA 4NBUA 3GZ4A 4YXFA 3BTOA 5DCUA 5G2OA 1A7AA 2O7QA 4GVXA 4Z0PA 4DIOA 1P0FA 4R41A 4YTEA 1R4MB 2X0IA 1SC6A 2X7HA 3E9NA 3LC2O 5GZ6A 5JSFA 4KMSA 3OMLA 5J23A 5EINA 1B0AA 1Q0QA 1K6IA 2DPHA 2C2XA 4OIMA 1N2SA 2C29D 3W4IA 2Q46A 5DOZA 2Q4EA 3U09A 2VUUA 3JQGB 4DLLA 1VE9A 5IZCC 3DBHA 1EEHA 4IQ0A 3ITDA 3QVWA 1H6DA 3EVTA 2V65A 3R3SA 2J3JA 4UUPA 4UAGA 3PXXA 1V3VA 2ZQYA 1XDWA 4TRJA 1OMOA 1T26A 3WLEA 3PYLA 2RH8A 4R9RA 1PL6A 2X0NA 2B5VA 4TMFA 3WSWA 2DTXA 4UUOA 3BZUA 4MVJD 1ADGA 1O9BA 2Q22A 3W4KA 3WLFA 1AN9A 4GLLA 4H16A 1H0KA 1GU7A 1C0IA 1Y8RA 4RVFA 5DCWA 5B37A 1U7TA 5ES3A 1E1NA 2O2SA 3O38A 1LC0A 3KM0A 3AY7A 1YL6A 3WGQA 4IBOA 5DULA 3ZW8A 4BKUA 4BNGA 2POQX 4MKRA 2C59A 5J9GA 2QRKA 3OP4A 2ZTVA 1TT5A 4FS3A 4XGIA 3D4OA 3LF2A 4JJGA 1Q0HA 1RYDA 1NQ5A 3KYCB 2VHYA 4NBVA 2NADA 3OICA 5IDQA 2AQKA 2FPGA 4LK3A 2Y93A 3RC1A 2E49A 1E5LA 3SJ7A 5IDYA 3DBVO 1VSUA 2AG8A 4E21A 2P4QA 1NFRA 3C1OA 2HK8A 3TSCA 1UZMA 4YJGA 4D0RA 3NJ8A 2O7SA 3PTZA 2ZCUA 4KZPA 1O6ZA 4B7CA 1QLHA 3NDJA 4DPMA 4K6FA 4WEQA 1Y5RA 1ZXLA 4FPXA 1YL5A 2B35A 1NNUA 2DT5A 4E32A 2OL4A 2IZ0A 5BNFA 2BFPA 1BXZA 4RORA 1R4NA 2PD3A 3VZSA 3OM9A 2WD7B 5T8KC 2BMAA 4ID9A 4NK5A 1ZIDA 2X5KO 3R0IA 4RF5A 4NQZA 1VJ1A 3ROPA 3ZWCA 4JP2A 1NR1A 4BKPA 1VKNA 4ZU3A 2IE0A 3WJAA 1AHIA 5JCJD 5F3RA 4MO2A 4MVJA 4BNUA 3TOZA 1LC3A 3ZNOA 1HSZA 2JJYA 1XEAA 1D1TA 3FBGA 4LSMA 5CDTA 4XYBA 5IZ4A 3WWZA 1L7EA 4D79A 2H1SA 3PHIA 1HWYA 3AOGA 3INRA 4FOSA 4NFSA 4LW8A 1MFZA 3HZZA 1R37A 4CR8A 3VHRA 3ZWNA 3ZNPA 1WW8A 4WCDA 3X2FA 2HJRA 4GL4A 1K89A 1UH5A 4ND4A 5A06A 1PJBA 2AG5A 3NT2A 4NJMA 1PL8A 1HDZA 4CUJA 5JYEA 1Y81A 5DP1A 3F46A 5HS6A 1ADBA 2Y0EA 4WPGA 1FK8A 4E2XA 3NTOA 1M2WA 1U3WA 3GNTA 4XGNA 1DOHA 4I8XA 1DRVA 2OGUA 1OAAA 2VWHA 1LEHA 3CEAA 1WXDA 5A9SA 2RIRA 3LLSA 1HKUA 4BGIA 3PK0A 1ZBQA 1LSUA 4IQGA 1EVZA 1DIBA 5I7FA 3ZV3A 4CMAA 5KJFA 3VDRA 1I32A 4OXNA 3CPSA 1NTOA 3ZU4A 5L45A 4IDEA 2RBEA 2Q1TA 3U0BA 3FTNA 3KETA 1AE1A 3JYNA 3DBRA 4DBVO 5T5QA 3DHNA 3ZDFA 4PRLA 4LMPA 5G4LA 5JCJA 5BQFA 1F0YA 3WQRA 1A71A 2HQ1A 3IC5A 3JSAA 4OH1A 3JV7A 4ZA2A 3H3JA 3GFBA 2JFFA 3HB4X 1KVSA 4S3MA 5TJ9A 3QVSA 4BMVA 1EQ2A 4KUHA 3L4SO 3KB6A 4TQGA 1NFFA 4J1QA 3CZMA 1VL0A 4CODB 4W7HA 5DBGA 1YQXA 7MDHA 5DP2A 2JD0A 1KC3A 2ZQZA 2GRAA 1HDCA 1KVUA 3E5RA 1X0XA 3JQ8A 3O8QB 3O03A 3RUIA 3VZRA 4D42A 4UREA 4L73A 4F46A 1MC5A 2BLLA 5THQA 3BHIA 4R01A 3T4EA 3WYCA 5DZSA 3IKVA 4JN6B 4BNTA 3TFOA 2IZ1A 2W8ZA 3GLQA 5TQVA 2NU8A 1CJCA 2Y05A 4IY1A 4Q39A 4BQRA 1QR6A 3RUCA 2Q2QA 1H94A 2HMUA 4PG8A 3MWDB 3HFGA 1YS4A 1PX0A 1SB9A 4RZHA 2NWQA 4RPHA 4MKZA 1C1DB 2TMGA 1NXQA 4YQYA 1NVGA 5KOIA 2CVOA 1Z73A 3E8XA 4WK6A 4N54A 3JD2A 3QV1A 1E77A 1GTMA 1ZVMA 3TZHA 3BHMA 1DRWA 1GCUA 5B12A 3JTMA 3S8MA 4CMKA 2X9NA 2YYYA 3VDQA 5IDWA 5L4SA 1EDOA 2QG4A 3ZWOA 3JQAB 4NIMA 4RF4A 1YB1A 4ZVVA 4E2WA 3QSGA 4WE3A 2PLAA 1DSSG 2Y0DA 1LLDA 4PLGA 1HSOA 3BXXA 1DIRA 1FXSA 1NQTA 3DXFA 1UZLA 1NHWA 3FR7A 1PJ2A 1IYZA 3ASUA 2VYVD 3ENKA 4E6PA 2W2LD 1A72A 4RPGA 5DOVA 2W2KB 3WGZA 1AXEA 3H7AA 1TB4A 2WD7A 1NM5A 3MJTA 4AJ2A 1KEVA 1U4OA 3WFIA 4U7WA 1ZK2A 1DBVO 4DPLA 4QQRA 4MDHA 3FNFA 3JD4A 1SEPA 2FZWA 4RVDA 3FRJA 2CF6A 3AI3A 2FP4A 3O9ZA 1K2WA 1LI4A 1XLTA 3AM4A 1LSOA 2V6GA 4OO3A 5I7VA 4B8ZA 4LRTB 3HE3A 3UF0A 3LVFO 4GPD1 4Q3AA 5IXYA 2EIHA 1WWKA 2PH3A 3DMTA 3PLNA 3VKVA 1FF9A 1EQUA 3I6IA 3KYBA 4DBZA 1H6CA 5L7WA 4K1LA 1XR3A 2AW5A 3D3EA 2FY8A 2NVUA 5CPFA 2RCYA 1BMDA 4NDNE 1T24A 1MV8A 2RAFA 4XD2A 4ZJUA 1E6WA 4XYMA 4MVJE 3ANMA 3BMQB 4J9VA 2HO5A 2D5CA 1P1IA 2G5CA 2I6TA 2NTVA 1C1XB 1QV6A 3LK7A 2V7PA 2EP7A 4UVDA 4F45A 1G0NA 4ROSA 3GHYA 4BUCA 2I5PO 3ZV6A 2OP1A 3HDJA 3P7MA 1VM6A 2YHIA 4DYDA 1HT0A 3HB5X 2Q45A 2C20A 1ZEMA 4NBWA 1C3VA 1B3BA 3U49A 4BO0A 1T4DA 4XA8A 1T1RA 3DWFA 1PSDA 3TL3A 2VYVA 5COAA 2GNAA 5KTKA 1E3WB 4LMRA 3WQQA 1YB4A 5G0VA 3L6EA 4I9UA 4M8SA 4Y67A 1P9LA 1E3JA 4BB5A 5KWEA 4EYEA 1RM0A 1YBVA 1A7KA 4YT2A 2HMWA 2Y67A 5FI5A 5JMWA 3PI7A 1IL0A 4FD3A 4BKQA 1Q1NA 4W7IA 4L75A 4TKLA 3COSA 4PVDA 2FMUA 3B70A 3GZNB 4IUYA 2JFGA 2NACA 4GSLA 4FR5A 4CL8A 4RPLA 3RKUA 3BA1A 4BGEA 4Z9YA 4MVJI 3VH2A 4XRRA 1L7DA 3IIEA 2CVQA 3SLGA 1VC2A 2UYYA 5I8ZA 4YAGA 5BSFA 1IHXA 3UAGA 3PQFA 1UDCA 4JBIA 3QY9A 3O8QA 5FFFA 1IY8A 1PR9A 3EVNA 3NTQA 4UEKA 1EFLA 2GSDA 2ILTA 5TIIA 1W6UA 3A9WA 6ADHA 1LJ8A 3V5NA 4Z3DA 3ZV5A 3V1TC 1PJ3A 2OUIA 3CIFA 2HMSA 1YQGA 1QORA 3AW9A 4J43A 4BNJA 4DMMA 5EJ2A 5C7IO 1WP4A 3W8DA 4XIJA 4R3WA 5M6DA 3VH3A 3F9IA 1BXKA 2IZZA 3GH3A 5DNAA 3PWSA 4TRNA 3BMOB 5JC1A 5DN9A 5JCXA 3H5AA 4WNCA 2FR8A 1DC3A 4DGSA 1ISMA 2FRDA 3LT1A 5THKA 3KVOA 4DC0A 3ADPA 5IXSA 3A14A 3ON5A 1W0CA 1TLTA 4QFCA 4EUFA 2GGSA 4HXYA 4ZHSA 3KO8A 7ADHA 4CV1A 1PGQA 4KDFA 4D7AA 1X7DA 2P91A 4E4YA 4PFJA 4INAA 2NNLD 2H9IA 1QV7A 3I9MA 5JO0A 2A4KA 3PIDA 2OZPA 4NG5A 2EV9A 1JKIA 3LT0A 1ZMTA 4OAQA 5IJZA 2HU2A 3IS3A 4YDRA 5LCXA 3WGYA 3ST7A 2JKVA 2NM0A 3W8FA 2HRZA 2X4GA 4GAEA 4E0BA 1DRUA 1HEUA 1RM5A 1DDOA 1BXGA 1MG5A 3G1UA 3IJRA 4YB8A 4R1NA 1GV0A 2P68A 3PQDA 4DXHA 4TRRA 3L4BC 3I9NA 1SCUA 3OJ0A 1QG6A 1Z7BA 4P8RA 2WYWA 3GAFA 3PWZA 2R00A 3OA2A 5DBIA 3TJRA 1IE3A 1ENOA 4KQWA 1QKIA 4PLVA 3TF5A 4DYVA 1GV1A 4NR0A 3HDYA 1EBUA 1Z75A 2B4RO 4GMGA 1ZMOA 3IQDB 5CG1A 3LU1A 4QT0A 3G49A 4FFOA 3OQ6A 4AL4A 4E13A 1Y8RB 2VWPA 2JCVA 3UVEA 1PGPA 2FN7A 3KTDA 1VJTA 1CIVA 5A03A 1YOVA 2EGGA 1LRKA 1EMDA 5KKAA 5T67A 4BVAA 5FWNA 2QHXA 3I6QA 2YV2A 3CH6A 4MJLA 3L9WA 3KSUA 2HSDA 1NR7A 2NQ8A 5JPIA 5ITVA 3PP8A 3GDGA 1GYRA 1LSJA 2Q50A 4WLFA 1C1XA 3BTVA 1SPXA 3DQPA 3H5RA 3H9GA 1HZZA 3RBZA 4MOWA 3OIDA 3HG7A 4BO8A 5CHEA 2X5JO 2VUSA 1C14A 2C2YA 1QYWA 3K92A 2WTBA 1PZEA 4YJGB 2X22A 2DBZA 5JYDA 1SEVA 3JQBA 2Y1DA 4L9RA 4RL6A 4O63O 1ORRA 5JS6A 1C0LA 4KDEA 1TEHA 3O26A 3TWOA 2H5LA 3I9LA 3GVCA 1K6JA 1V6AA 2WE7A 1U3VA 1JQBA 4CR7A 3ZNNA 1E3WA 4O0LA 4MP3A 4R54A 1MGOA 4MP6A 5TRTA 4HFNA 1DC5A 1FJHA 2JD1A 3VC7A 2BGMA 4OSOA 1LDNA 3PGJA 1R4NB 3DONA 3MCVA 2PGJA 2UVDA 4J7XA 1JTVA 2GZ2A 1GPJA 4OSPA 3E6AA 1E92A 3AM5A 2CY0A 3UGKA 5ILGA 4EBFA 3ICPA 1VI2A 2E37A 4I5FA 5GY7A 1AUPA 2NVBA 3QWFA 4EEXA 4YAIA 4KTTE 1XGKA 4CMEA 3GZNA 5JC8A 5JBIA 4EITA 1HTBA 2Q3EA 1LSSA 3DOOA 1MA0A 2X0JA 3I1JA 4YRBA 1BG6A 4CJXA 4I1IA 2AE1A 3QP9A 3R3JA 4RVUA 3ZU5A 5DDIP 3NJ4A 4ND5A 3INGA 5COBA 5FI3A 3AU8A 4NFYA 3PZRA 5TX7A 1ZFNA 3I23A 3KYDB 1RKXA 2HMVA 2WSBA 4E5PA 3EDMA 3EYWA 4CM6A 1I24A 4PG7A 5CP8A 4BL5A 1HDRA 4JP3A 1GQYA 2VT3A 3NT4A 4JJFA 2ZTUA 3K6JA 2ZB8A 1VL8A 3NX4A 2YFHA 4IDAA 1E7RA 1UXJA 2F00A 1KOLA 3ZW9A 2AQIA 1Y9AA 4LRSB 1DLJA 1KEWA 1WAMA 1BVRA 3LC1O 1E3IA 2I65A 3GGPA 4IDFA 2QZ9A 3IOYA 3WBFA 2O4UX 3TN7A 4DUPA 3S55A 1K5HA 4J2OA 1U5AA 2PZJA 2I3AA 2EG9A 3ROMA 5A9SB 2Z95A 1IB6A 4MVJF 5TGDA 4HBGA 3QVXA 1AXGA 1B3RA 1B8VA 2H63A 1PJTA 5IN5A 3TQHA 1NVTA 3PJGA 1CETA 4MVJH 4MVJM 3X2EA 3BIOA 2QYSA 2DPGA 1PGNA 2IDZA 3WIDA 1VL6A 3PGXA 3OEWA 3AU9A 5TT1A 3ZCXA 4RZIA 4D41A 4WEOA 3IP1A 4UUMA 4B4UA 1G6KA 2PV7A 3DBRB 1R0KA 3B20A 3VPXA 4MIEA 5BSHA 2V6MA 2EWMA 1UXHA 1P45A 3W1VA 3AOEA 3FWNA 5I9NA 1A5ZA 3ZU2A 1S7CA 2AEMA 4UVHA 2BELA 4YJHA 3EZLA 3WSVA 4UULA 2I99A 4AJLA 1J5PA 3DEYX 1YL7A 1VKOA 3H3FA 3ZWPA 2GDZA 1W73A 4TVBA 1GYQA 4BS9A 1I36A 1JAYA 3NTRA 5A05A 2VCYA 4JXKA 1YDWA 4A73A 2XXJA 4OJNA 3JQ8B 4JNKA 3ONDA 4C7KA 1H6AA 4XQ9A 1T2AA 5LDHA 4W4TA 1I3MA 1WNTA 3F5QA 2VHWA 4CLHA 4EI2A 1X13A 2VWQA 2IXAA 1ENPA 1HDGO 2Q1UA 4PVCA 2ZCVA 4XR4A 1ZNQO 2AEFA 3JQCA 3SEFA 3FHLA 4OGWA 3O4RA 4J0FA 6LDHA 3ZHBA 1AHHA 4UVEA 4CLXA 4IPTA 4DQXA 1HLPA 3HQ4O 1PQPA 1PL7A 1Z82A 1JKJA 4FJ0A 1V35A 3TZQA 2E82A 4WASA 3ZWMA 2CDAA 2O3TA 4WLUA 3ZWBA 2HUNA 5I7EA 4MVJP 2NU7A 3E9QA 4FDAA 3E03A 1SB8A 4R5MA 2I76A 2O2YA 3ENNA 3KBOA 2NQTA 4R4JA 2P5YA 4WLVA 3FTPA 2YV1A 4LCJA 2JD2A 1LXCA 4Z9XA 3GHHA 1HDXA 3INTA 3GVPA 1GPDG 5COQA 5KJ6A 2HJSA 4MINA 1U2DA 1UR5A 1LRJA 4EZBA 3AUUA 5KVCA 2C7GA 2BKAA 1RYEA 3RASA 5AQ1A 3PQEA 5JYAA 1CEQA 3QWHA 4RDHA 4RJTA 4B4OA 3H6KA 1V3UA 3GK3A 4BNKA 3DOJA 1NPDA 4ALMA 4IJVA 3D3WA 4WGGA 1H2BA 4IGFA 4L74A 1CDOA 2A92A 2VHZA 2ZIZA 3WYEA 4M89A 1EUCA 3VH1A 1Q0LA 1ADFA 4L0QA 4YJDA 3H9UA 4CMIA 3Q1LA 4J2HA 5HA5A 4PLWA 1YBMA 3W6UA 1GZ4A 1N7HA 2X9VA 3DZBA 3DR3A 3IP3A 4RQUA 4DLBA 2Y1GA 3AY3A 4GGPA 1ARZA 2BFMA 3OQ1A 4HY3A 4Q3DA 1W8DA 3PRJA 3GFGA 3KYDA 3QLJA 4J1SA 4CM5A 2DBVO 3C1AA 5U4QA 1O95A 2P9GA 2FWMX 1WPQA 2G76A 2CDBA 1P1KA 3ZWXA 1DB3A 3N7UA 4ZRNA 2HRBA 4BNIA 3STHA 4XGKA 5DCYA 3RUFA 4IDDA 2NVUB 3WGOA 5I8WA 4XDZA 3HSKA 1LQTA 4XRGA 3C8MA 1PS9A 2Y99A 1PJCA 3SX2A 4M49A 4A2CA 4WLEA 1WDKA 3AUSA 4LN1A 4PZEA 4Y6SA 1EFKA 1OC2A 3HDQA 4GX5A 4HADA 4GVLA 1DIHA 4II2A 4GKBA 4GWKA 4NBRA 4ESOA 4XKJA 2YHIB 3WMXA 5ER6A 3KV3O 1GZ6A 2NVWA 1R12A 1PJLA 3DAFA 3GMSA 4D44A 2DFDA 2NTJA 4E12A 4DMLA 4JGBA 3HADA 4ITUA 4FSHA 4PLTA 1NYTA 1NBOA 3DO5A 1EE9A 3ANNA 1BDMA 1UJMA 3OA0A 2CZCA 1JLLA 3FF4A 5JFOA 2OORA 1XWFA 5TS3A 2ET6A 3VAZA 2J5RA 4ALNA 1BW9A 3DZHA 1HYGA 1QP8A 4JROA 3RU7A 4GWGA 4E2YA 2YW9A 3DTTA 1HDOA 1YQDA 2B37A 4BO4A 1DC6A 3L6OO 1YO6A 2B36A 2QRJA 1E1LA 4J3FA 5KJCA 3ETGA 3GVXA 3SJUA 2PGLA 3ZNQA 3UN1A 1ZK0A 2X58A 1XSEA 3RFTA 3D4PA 4WLOA 5F21A 3ADOA 4B7XA 3K30A 2PR2A 3F4LA 2BFOA 2LDXA 3RBVA 4J0EA 5CDGA 5AXAA 4AJHA 3PHJA 2NLOA 1UP6A 1IZ0A 3ITKA 1OBFO 1YKFA 4LVUA 3HJAA 1E7WA 4DWVA 3DBLA 3GEGA 1M75A 4JCOA 4FIZA 3GOHA 4LCEA 1NAHA 2WYVA 1KS9A 4Y6RA 4CM8A 4EUHA 1LUAA 1Y8QA 2VT2A 4QEDA 1MB4A 5AXBA 4E5NA 2DTDA 3JQEA 3EGOA 1Z74A 2Q99A 3RC7A 5L4NA 3RUDA 4L4XA 5B4UA 3QWBA 1O89A 4AICA 3M6IA 1KVRA 1PGJA 2OP0A 3GN1A 1LX6A 2F1KA 1BRMA 2GASA 4P4GA 4IJUA 4OOEA 4XYGA 3ORFA 1ZJZA 4XJSA 1Q7CA 3CXRA 2FR1A 1JU9A 4BNVA 1HYEA 1QYXA 3L9XA 1E0DA 3WNVA 4BHTA 2CFCA 1Q7GA 2JCYA 1YJQA 3NGLA 3UICA 4AJOA 5H81A 3U62A 3UCFA 5A9RA 4BNZA 4FFNA 4E33A 3UFXA 1GAEO 2PTGA 5CAEA 5TLSA 2FR0A 4D3SA 3Q9NA 3Q11A 1DHRA 2JHGA 4WCFA 4DIFA 1I33A 2VN8A 5F5LA 5A02A 4AJPA 4GMFA 4P38A 3HN7A 4CV0A 3WB9A 3RUAA 2J3IA 3TOXA 1BXGB 1NAIA 3RWBA 3JYOA 4PN3A 1HRDA 1DEHA 4ZQGA 3UKOA 4RO0A 3WMWA 1VRWA 4NJOA 2NU9A 3OHSX 4H15A 2O3SA 3SXPA 4M55A 1UXGA 1U5CA 3PDUA 3CTMA 5JAZA 1EUDA 2G1UA 2W90A 3TFQA 4AJ4A 3C7AA 3B6ZA 5AXCA 4PG6A 3I9OA 4BO3A 2VWGA 3WBBA 3RUHA 2YHUA 1EVJA 5HWSA 1KBZA 3VVCA 3E9MA 1DO8A 1B8PA 2ZTLA 3EAGA 5EESA 4L4RA 2I66A 3CE6A 4W82A 2X5OA 4K6CA 3TNLA 1E1KA 1ZK1A 4A03A 4CQMD 3M2TA 5CEJA 1GUFA 1YOVB 4J1NA 1XQ1A 1QLJA 5MGBA 4FCCA 1K6XA 3OEYA 1KEPA 5CPBA 5F1PA 3WXBA 2Q2WA 4G5HA 1NWCA 3DOCA 1LLCA 3F47A 3JQFA 4OL9A 4CMGA 2HDHA 4DPKA 5CEFA 2BFAA 2BRUA 2C54A 2EXXA 2H6EA 2VTDA 3DMTC 5TNXA 1UZNA 3AI1A 1MXFA 2J5KA 3UXYA 2I67A 4D0SA 1EZ4A 1X1EA 1B7GO 1KYQA 4JJIA 3CKYA 4ZQFA 1HE4A 2JL1A 4ND1A 1GQQA 2CMDA 2NV6A 1DFHA 5U1PA 1DAPA 3T7CA 4A27A 2OOSA 1B26A 2FSSA 3D5TA 3SBOA 1XU9A 4Z6KA 5EQDA 5G0TA 1BWSA 1ZW1A 1I3NA 3QQPA 3BYZA 2GD1O 1N8KA 1U3UA 2IEDA 1E5QA 4AFNA 4BNMA 4CUKA 5JDIA 2ZK7A 1HF3A 3VKUA 4YEDA 1SBYA 1SOVA 3F1LA 3K9QO 3LZ6A 3RSHA 1IPFA 4DTIA 3K73O 4BGUA 3Q9UA 4NPCA 3FNGA 1GUZA 1D7OA 1KETA 3DC2A 4XIYA 1VPDA 2YJZA 3C3XA 3UW3A 2A9FA 1H9AA 2AHRA 3GN2A 3K96A 1TA4A 2HK7A 1D4FA 2ZATA 3K5PA 4FC6A 3RCBA 1N92A 1KIFA 3NDIA 4RVHA 1TVEA 1PGOA 4XX0A 4EJ0A 2GR9A 1HDYA 1B2LA 5IDXA 4KP7A 2PKQP 3V8BA 3U4HA 1K0UA 4BO5A 3ABIA 5DT9A 1UAYA 3DZIA 4CQMA 1H6BA 4KUEA 3TZCA 3H8VA 1ZK4A 4FFLA 4UUNA 3GDFA 2B0JA 4IDBA 3AUAA 2LDBA 3RU9A 4CQLA 3NKLA 3JD3A 5JO9A 4Q3BA 4CLOB 5AOVA 2XAAA 3VH4A 1ZUD1 2B5WA 3QE3A 5IF3A 3AFMA 1BVUA 1LDBA 2EGHA 2I9PA 3V2GA 4J90A 4JK3A 1U4SA 2DBRA 3DAGA 4IXTA 3RVDA 3GT0A 1A9YA 3RJ5A 1UP7A 4ALIA 3D4NA 5FF9A 1BSVA 2PH5A 4QSMA 2VNAA 1T2EA 1D8AA 2QZZA 2C07A 4BOYA 5K9ZA 1NX6A 2AQHA 4B8WA 3GDOA 1Y7TA 3OQBA 4OM8A 5A1TA 3JCZA 3UH1A 2A94A 1FDWA 3PYXA 1B16A 1XKQA 3PLRA 4RF2A 1CQJA 4Y8VA 3MOIA 4ZQHA 3JQ9A 4GX0A 5A5EA 3DL2A 1UDBA 4L8VA 1XYGA 2RH4A 2FHSA 3BHJA 5T57A 3H9EO 1U2GA 5C5IA 1E3EA 3MJ4A 5G0SA 1MXHA 4KUGA 3ULKA 1I8TA 3AUTA 9LDTA 3DB2A 2ZB3A 4WNIA 2AA3A 5JY6A 1ISHA 1GEGA 2DTEA 3QHAA 1RJWA 4ZQBA 1U9JA 3M1LA 2P5UA 4MVJG 5EL0A 3EW7A 3GPIA 4DIBA 4I5DA 3WGTA 1NVMB 3TPCA 3RKRA 3VTZA 3JQ6A 4YJHB 4EGFA 3WJ7A 3L6DA 3FI9A 3QIVA 1CYDA 1YJ8A 3ZHYA 1U8XX 3FBTA 4EUEA 4BO6A 1P1JA 1MX3A 2UDPA 1DJNA 3GG9A 2ZTMA 3OSUA 1V3TA 3K2BA 1QYCA 4N7RA 4GKVA 1BDBA 1SOWA 3GEDA 4ALJA 2EERA 2IYPA 3OH8A 2Q1WA 2JFHA 3IAHA 4DA9A 1A4UA 5KJ1A 3ICCA 5JE8A 4D45A 4CM3A 4RF3A 3IL2A 5JDCC 4D3DA 1MLDA 4TWRA 3E5MA 4ALKA 1I30A 4XYEA 2O3RA 1E6EA 2HLPA 4XEHA 2WWRA 3WIEA 3Q0EA 1IULA 4FFPA 2FSVA 4UEJA 1I01A 3ZWYA 1PTJA 1ZSVA 3FD8A 4WECA 1DPGA 2OXIA 2GCGA 3M1AA 1R15A 3ROKA 1Q2XA 2ZYGA 2D3TA 1KY4A 4XWYA 1ISIA 3PVZA 1OZAA 4R1UA 1N9GB 5CDUA 1LDEA 2D5AA 4HFMA 3WTBA 3GR6A 4WOJA 2DVMA 5JY1A 4XB1A 2R2GA 4FFMA 4ND2A 2YDXA 3VPHA 3W6ZA 2B69A 4GQAA 1N1EA 4O59O 1A9ZA 1C0PA 2EEZA 2PK3A 3L07A 3T7EA 3DMYA 4ZN6A 2CVZA 2VZ0A 1UAGA 1GUYA 1YRLA 5K0ZA 2D59A 2CSUA 1P1HA 2PZLA 4RVSA 4IZIA 3PIIA 2VOEA 2Q4BA 4X54A 5F5NA 1KERA 4DRYA 3NAQA 5GZ3A 3GPDG 1ZEJA 5TF4A 1U7HA 4TSKA 1ADCA 2IRWA 4YAEA 1ENYA 3AM3A 3UUWA 1UP4A 2DBQA 2Y1OA 3LDHA 3RIHA 4E30A 2BD0A 3JQBC 3GEMA 5L4LA 3WGGA 2TMDA 3D3WB 3RJ9A 1WMAA 2CD9A 2W4QA 2UUOA 1NPYA 3GNSA 4OYRA 4W9NA 4TZKA 4FW8A 3PJEA 4FB5A 3NUGA 1H93A 2IXBA 4Q3NA 4YACA 5KVVA 1NPTO 1X1TA 3BMNA 2J5QA 4U0JA 3W8EA 2BHLA 3UOGA 4CMIB 5ENDA 4E5YA 2HAEA 5AVOA 2PD6A 1P77A 3OECA 1JDJA 2YDYA 5IG2A 3NRCA 1C0KA 5HRUA 4RGBA 4E5KA 4TRMA 2HMTA 3CSDA 1QRRA 4YA6A 3KEQA 3RI3A 4PIVA 3RFXA 4A7PA 3NEPX 1I3KA 3ZWAA 4CMJA 4C4OA 1P1FA 1X0VA 5CG2A 4CMEC 3DZFA 1JKFA 1LDGA 2Z5LA 1Y5MA 4Y9DA 3GY0A 4BNHA 1MUUA 4CLOA 1SMKA 5BNIA 1E7SA 3MJSA 4J6FA 4WUVA 3DAPA 2Y0CA 1O0SA 2P9EA 3OBBA 1Y1PA 2GERA 3DDNA 1ISGA 5A3VA 4JBHA 4II3A 4HFJA 1GCOA 2JAPA 2VYND 4AVYA 3EMKA 2VQ3A 3FCOA 1P1RA 4CM1A 1I2ZA 4HUJA 1T4BA 3TRIA 4YRDA 5TJHA 1EDZA 5K6AC 4NMHA 1JVBA 3KHUA 4AJJA 1Z7EA 5CEEA 4FGSA 1QMGA 2AEJA 5C37A 3C1TA 3JD0A 3G0OA 5ILOA 2D0IA 4N5NA 3HUDA 3QW2A 3GUCA 2Y1FA 3S2FA 3MJCA 4CM4A 1YH3A 1BW9B 2CF5A 4CM9A 4IJKA 3GF4A 2PZKA 2JCXA 2UV8A 4BGVA 1H9BA 1PR3A 4RDIA 1E1MA 1XIVA 2Y68A 2DU8A 4D46A 5EMHA 5CDYA 1R0LA 1UXIA 4P22A 4PLHA 5IZCA 1IOLA 4HP8A 5KKCA 4MP8A 4R16A 4DLAA 1HLDA 2QIOA 8ADHA 3AFNA 3VPGA 1KEUA 1DIAA 2GPTA 1E7YA 2DM6A 1BGVA 4RVGA 4R5HA 1P3DA 2GLXA 3ZN2A 3B1JA 4YBZA 3GC6A 3AOEC 4J4TA 5JAMA 3MTGA 1P44A 3LC7O 1BHSA 1WDLA 1RM4A 4ZRMA 3DBLB 2C5AA 1WMBA 3IDSA 4F6CA 3Q3CA 4ZD6A 2XPCA 1F06A 2E4AA 4XQEA 3RUEA 5KNLA 1DC4A 2EKPA 1ZSYA 3U4CA 3AI2A 3ZHXA 5EERA 3E48A 5B4TA 1XA0A 4CM8B 1X14A 2B4QA 3SVTA 3U5TA 3CMMA 4DL9A 1Y8QB 4BNWA 5HBRA 2VYNA 1EVYA 1TT7A 3E82A 4FN4A 4DVJA 3PFFA 3GAZA 4O5OA 1GZ3A 4RV9A 1LQUA 1YVEI 2GN6A 3JQ7B 1ML3A 1L1FA 4YAKA 2P9CA 1PJQA 3R1IA 3F4BA 3JQDA 5ER9A 1Y6JA 5L7TA 3KSDO 3WICA 3GRPA 4EJ6A 1N9GA 1U8FO 1V8BA 2GZ3A 4OMUA 3I4CA 4YR9A 4YQZA 3KSZO 2AE2A 1UDAA 3F1KA 2EF1A 2ZYDA 3FNEA 4WLNA 5BR7A 4R68A 4M1QA 3ZZNA 3PHGA 1JWBB 2EJWA 1ZZEA 3R6DA 5ITWA 3F3SA 1T2DA 4JIGA 3A06A 3MJEA 3P5SA 2RHCA 3DFUA 4G81A 4HWKA 5EN4A 4UVGA 3TL2A 3ZU3A 4PLPA 2QW8A 4J7CA 3V1YA 3ETDA 4JX8A 1AGNA 1T2CA 3D1LA 3OJLA 4IIUA 4J9UE 3GMDA 1VSVA 2XF8A 1B14A 2C7VA 2Q49A 2J3HA 1ISJA 3G17A 4WCFB 4HKTA 1RM3A 4BO7A 3L77A 4XQCA 4ILKA 2WJPA 2HCTA 3RQSA 3GG2A 1IUKA 1YXMA 2D8AA 2CUKA 1ONNA 3H2ZA 4CV2A 2VZ8A 1PQWA 4BO9A 2ZB7A 1QXSA 3NV9A 4YT5A 5T8KA 3V2HA 1EK6A 1PWZA 4XCVA 1GYPA 1VLLA 4Y6PA 3FWZA 4YPOA 2D2IA 3ZWVA 4YT4A 4YWJA 1HE2A 4GI2A 4IXWA 4N5LA 4B4WA 1O5IA 4URFA 2WE8A 3CMCO 5AYVA 4R69A 4IQ8A 4BQPA 1X15A 3GVHA 1FDSA 3DHEA 4P4NA 1YWGO 4OOFA 1ENZA 4TVOA 1ID1A 3OFSA 3Q2KA 4DREA 4HV4A 3BMCA 4XDYA 4NNJA 2NU6A 3VTFA 4N18A 2JHFA 2RHRA 4FQ8A 3P19A 2IEBA 3OIGA 3DZKA 4K26A 5LC1A 3PPIA 3JD1A 5LDGA 4OQYA 2DAPA 2AQ8A 2EKQA 2Y66A 4IGEA 4UVIA 3WOHA 2ZJ1A 5FEUA 1ZH8A 1EVIA 2X23A 4RLHA 1YB5A 5A5FA 4YCAA 1WVGA 2XXBA 5KCZA 2HKIA 3S2GA 3C7DB 1XG5A 3GUYA 3DFZA 5FYDA 2B83A 2XOXA 4S1VA 1MG0A 5TSDA 1HE3A 2OO5A 3F6YA 3K8ZA 2OFPA 3ROQA 3SC6A 4QFDA 2J3KA 5ENVA 3VZQA 4BB6A 2BF7A 2E48A 5L40A 2YFQA 4NU6A 2PY6A 3OETA 1DFIA 4CLRA 5JAIA 5T73A 3RAJA 5G0WA 4W99A 5HM8A 4IINA 2DKNA 2BH9A 3ZH2A 1ONPA 3KXDA 4EEZA 2ZB4A 3D7LA 4O1MA 1I2BA 2VHVA 3IJPA 3D64A 1GD1O 3MJVA 2GN9A 4H7PA 3HN2A 4A5OA 4AJNA 2EJVA 1KVQA 3IKTA 1Z6ZA 5I9LA 1LRLA 3WGIA 4QO8A 2WYUA 2D1YA 3S1LA 5B4VA 1IPEA 3LLVA 3CINA 1T25A 3FSRA 1CQIA 3KLMX 4U6QA 1NQOA 1GL3A 3K2EA 4WOKA 4B3HA 2VRBA 2Z1NA 5KVSA 3NDRA 4KWHA 1FDTA 1HE5A 1O94A 1R4MA 3EUWA 3I9KA 3K31A 5G4KB 3ZGYA 4RLSA 2GN4A 4YAJA 3WX0A 2PKQO 4XR9A 3F5SA 5L95A 4H3VA 4NZ9A 4CQMB 1YGYA 4L76A 3JQGA 1XU7A 2P2SA 4B4VA 2YQ4A 3WR5A 4CLDA 2YUTA 3IUPA 3KLPX 3GRKA 1RWBA 4CQLB 5L53A 3KRTA 1G1AA 4PLYA 1YONA 4R3NA 2UAGA 4QX6A 3HNPA 4G2NA 4UEOA 4Z9FA 2I3GA 3RC2A 3GGOA 1NP3A 2DUUA 4BKRA 2BGKA 3UCXA 4I5EA 3JQ7A 3BAZA 4XZ3A 4AJ1A 3PEFA 5A9TA 1VJ0A 3EK2A 3QA9A 4GX1A 1YBAA 2FPPA 3VOSA 2QRLA 4BO2A 3FN4A 3H5NA 1LA2A 2VOJA 5T6BA 2GZ1A 1Y9EA 3PFWO 2FZEA 3VPFA 3ZV4A 3ONEA 3AY6A 3ETEA 1NHGA 5BSGA 1R6DA 3VPSA 3BTSA 2DQ4A 3PZBA 2WDZA 4OKNA 1PWXA 4Y98A 3CUKA 3PHHA 1BTOA 1T2FA 1X7GA 2X86A 1N5DA 2FOIA 3ONFA 4QTZA 1GADO 1ZJYA 1U1IA 4B7UA 4R51A 3KYCA 2WMDA 4WKGA 1E3SA 2V6BA 1WZEA 1IZ9A 4E5MA 1OI7A 2WM3A 3B1KA
chains in the Genus database with same CATH superfamily
4MLDA 3WYBA 1Y1TA 2XNHA 5HMMA 2EDCA 3VJKA 1THMA 3NW9A 1JMKC 2IODA 3U4IA 2PGXA 3L8YA 3Q5EA 4KMMA 2DJIA 3KPVA 3IVXA 3LVQE 1DJQA 1U0RA 3PJDA 3ABZA 2A5FA 4RTSA 1KMIY 4DM7A 1P7CA 5FBZA 5TS2A 1T9GR 1FFXA 2AR0A 4JOSA 1YQEA 3A1CA 2DMRA 4J94A 2ZI9A 1CUDA 1TAHA 1Q14A 4WCFC 5F3WB 2ES4A 4EW6A 2E4UA 3U9LA 4JZKA 3FRIA 5JCOC 1M2NA 4A0RA 3IUBA 4M8IA 4DGQA 1NVWQ 2F1IA 5E6UB 3AL2A 1U3TA 4YVFA 1WHSB 3SYTA 3EVEA 3LH5A 1E3QA 1QSGA 2QT0A 3DEAA 4YN3A 3S2EA 3U4DA 4YUZA 3PSHA 2YXLA 3HYLA 2P2YA 1IUPA 4NFHA 4JVNA 2YJ4A 4ZMBA 3M70A 2PH1A 5C4IA 1OXXK 1M34A 1K7CA 2FB9A 2C3MA 1P2SA 2X8JA 2XUHA 4ZT3A 4LQLA 2ZJAA 3HBMA 3NWOA 3S70A 3SNHA 4GBMA 2FU5C 3LDAA 5HQJA 3ETNA 3R5SA 3CZRA 4J16A 3A8TA 4JBGA 2P7IA 2O59A 1X7ZA 3BIWA 1I2CA 1XZAA 2R85A 5G53C 1R6BX 3ME5A 5BQPA 2I3BA 1EI9A 4C7MA 4EVIA 3MGCA 5LXTF 4EMBA 4OIFA 4PINA 1YZVA 1YE5A 1HQDA 2JASA 1LLQA 3M4JA 3W4JA 1PFQA 5JWHA 1WDMA 1X7WB 1M7BA 3VBCA 5JALA 3T7JA 1XCOA 3UH0A 4EDFA 2XB2A 4RACA 5BXYA 1YZHA 5BUCA 3UAWA 4FFDA 3WWYA 3CUSA 4FOOA 4RYLA 2JAHA 2QTGA 4I4TF 4NYJQ 4FFRA 4UTOA 4WZAA 5HR5A 1SK9A 1FRQA 2OBLA 2ZT7A 3FAKA 1RFGE 3MOGA 3TCNA 2EKZA 3I8OA 1Y8CA 3JQFC 3B85A 4JBLA 3TDKA 1RWKA 3SEQA 3CT6A 1VYTA 1UFOA 2VUHB 3RVKA 4NH0A 1RRCA 5EXEA 2DLDA 3H84A 2NZUG 5LWQA 4U9UA 3M5WA 1WPXA 4JR0A 2C1ZA 3RS4A 3LT2A 4B48A 3VAYA 3OU6A 1UKCA 2CLIB 2J5XA 4HQKA 4B1FA 3IEIA 5BSEA 3O2JA 3OMXA 4MIOA 4NMLA 5C7OO 2E6UX 1P1CA 4I6GA 4Q34A 3OPVA 5LBTA 4U2EA 3ZYZA 4TS1A 1YJCA 3P2YA 1A9OA 2CBZA 2VK2A 4PLFA 4S1OA 4H0NA 3NFYA 3HNRA 3DDUA 3LPAA 4ARCA 2W2LA 1JFVA 1ZSNA 3PDIB 1AHPA 1JSRA 4CKEA 1MX9A 4J0DA 3QYAA 2GN0A 3OOSA 5EKXA 1TVMA 2PSSA 1G8PA 2WHXA 3MWLA 4BNFA 4R98A 3FNHA 2GUGA 1G98A 4RCYA 1PEDA 1QWSA 1CRWG 3F8WA 3JQAD 2AG6A 4DQVA 4OXYA 4A26A 1P7PA 5E6SA 1I7SB 5DLQC 4RCVA 3W8NA 5IKEA 4OBXA 3FUTA 3K9CA 3D0QA 2AGVA 1FDOA 3HH8A 3MEQA 5LZ9A 3HXPA 5JNLA 3ZI0A 5DTQA 4U5QA 2WTXA 4ZV7A 4Z99A 4P31A 1FXUA 4G1EB 2H7VA 1TZJA 4EVQA 3EPLA 1JN0A 1Y89A 2X1HA 4QUKA 2YWEA 2NG1A 1ULHA 3H75A 3HB7A 4CXMA 2CGEA 2IY9A 1UFRA 1XELA 2HV9A 4ZCSA 1UXKA 5CITA 4J07A 5DNEA 1GAJA 3FOZA 3DLBA 3G23A 4KR7A 3P2OA 1GTJ1 2XE4A 4U63A 2FSFA 4EFNA 4QNMA 1R0CA 4Y1FA 2P77A 4XB6B 5IN4A 3WO0A 3H83A 1EQAA 4RGYA 2JGKA 5IAKA 5JXWA 2WG2A 5B58C 2G80A 4R0NA 4R8MA 3MWGA 4YRAA 5TVOB 1IH8A 1FFGA 4YJFB 2CD7A 3A1NA 4HX5A 2ZJYA 1ESDA 3KEOA 3QOXA 4LQ4A 4YMTA 3D1JA 5JG7A 4B47A 1J23A 1DI0A 1OY1A 2QN3A 4PQYA 3VVBA 5JZVA 1SZJG 1NONA 2P9HA 3Q6IA 4Q01A 2WV7A 3MWDA 3GCXA 4KR6A 2GEFA 2HIMA 5CA0A 4P7GA 4CM4B 3QVUA 4UEWA 1CIPA 4V0MA 4ZI7F 1QTRA 2AN3A 2B34A 2RI0A 1LBQA 1WUKS 2C2KA 3G8YA 1FLDA 3OLZA 4KE9A 5TGTA 3KR1A 4P3PA 3QPBA 1U7XA 2FWAA 3N70A 5LZ2A 2XH8A 2WIAA 4BWVA 5JI2E 2G1KA 3E7XA 3CUWA 3ZKWB 2FFBA 3QXHA 5KJEA 1EK5A 3G3EA 1ODSA 1ZO8A 1REQA 3GB9A 1Y3DE 3O7WA 3PEEA 5ALGA 1SC4A 1SRRA 2ZBVA 1WY5A 3JYLA 4QO7A 2GZRA 4NYMQ 2PE5A 1DAOA 4RKWA 4FR0A 1A4IA 3BL8A 5FHRA 3IR7A 4C88A 3A6FA 3QJ5A 4AURA 1S2LA 1WB6A 2J8ZA 2RG7A 2P65A 4R2KA 4ZAVA 5I8PA 1AF7A 2Q3MA 2FH5B 2XWPA 3L4EA 3I4FA 4NYIQ 3PTAA 4HDOB 1KHTA 3KQWA 2QT9A 3TLXA 1ABFA 3QELA 1J49A 3M4YA 2XJ9A 2CWDA 1U11A 4AG3A 4QQFA 7ABPA 2QM8A 1Y5LA 1O5OA 2P9TA 4DCTA 3ADKA 1J99A 4I1VA 2PBRA 4TMTA 3SAJA 3D6NB 5CLFA 5EIXA 2X0KA 4FSXA 3DBHB 2QGNA 5K1ZA 3AONB 3IUYA 2HYIC 4MUHA 4Q4AB 3UG7A 3MMNA 2BM8A 3V2UA 3FPHA 3MRVA 4XIIA 3UUGA 2OYSA 3ITNA 3H2IA 4Q5IA 1R0ZA 3LS2A 4BNYA 3NHSA 4Q7EA 1Z28A 5CT8A 1ZR4A 5CNIA 1CJUC 1M76A 1D5WA 2XD9A 3RTGA 5IK2D 3G1TA 3R4VA 3AR3A 2PUFA 3O91A 2RHMA 3SYRA 5TR9A 2OHIA 1NVDA 5KI6A 1JBKA 4PGFA 4TTPA 3GH1A 3ZUPA 5JR3A 4H0FA 4BX8A 1HDIA 4IMPA 4TWBA 4AIIA 4EJMA 1IEXA 2CFSA 4ZGWA 4HO1X 4F3YA 1Y4SA 5BW6B 2OQVA 6PFKA 1A9SA 1JJVA 1T2NA 3ICWA 3ZCVA 1K4KA 2VZ9A 4KO1S 2OCYC 3OJOA 5KHLB 1E4YA 1OSNA 1Z5UA 4C6HA 2GYYA 1SHJA 2F3SA 2VHQA 4I4NA 1EAMA 1L8AA 2P75A 1XQ6A 2F1JA 1DWPA 4JD5A 2GD0A 1B15A 2C5FA 2QXTA 3DPIA 3H9JA 1PQ4A 16PKA 3ZV7A 5HFNA 1FW6A 3LUGA 1BWQA 1I10A 1A8QA 3PYMA 2GF2A 3KZ1E 3OJFA 4LDNA 1KO1A 3LYLA 4MB0A 4W5TA 2WTUA 2XEDA 1UWVA 3RHZA 4V1CB 1USUA 4BAZA 4RY8A 1NQAO 1QYVA 4U9IS 3CO5A 2HCRA 2R86A 1A27A 2ZANA 3CG4A 5KQGA 1YRBA 3IOCA 1RBYA 1RMTA 5ALYA 5FL3A 2O48X 5KWSA 2HSWA 4MW7A 1YZKA 2AYYA 3FNQA 4KQMA 5C8XA 2C00A 4LVOA 1PS8A 2GM3A 2X8BA 2B5OA 3DL4A 2X6TA 2K4MA 1PF7E 2NXCA 3T8YA 1AA6A 2BFBA 3L7IA 1QGUB 2OZKA 4TL9A 5JBQA 5U9CA 3AEUA 3CNNA 3GL9A 3OUUA 3TZ6A 1F14A 3F7OA 1F17A 4MHTA 2AFHE 5J1SB 4KYTA 4OHBA 4AY2A 2HCJB 4B3JA 4U8GA 2OYCA 3KFVA 5JASA 1A98A 1LLUA 4OMFG 5ALXA 3DHVA 2RHBA 3BF7A 3RD5A 2J09A 4BZWA 4LVCA 2IYOA 5BSUA 2D74A 1P17A 1FMJA 5IABA 2Z6UA 2XXAB 3I9JA 3BKWA 4MUAA 4FZVA 3OHPA 5BN3A 1DLIA 1N2EA 4MV3A 4CQJA 1QHHB 1FMCA 1K0FA 2QQ5A 1S01A 3QRWA 4FYPA 1KQNA 1Y3IA 2EKLA 5DSXA 1E66A 4Y9TA 2ZPAA 1PV1A 4ZI2A 4JA0A 2H1FA 3ELDA 3GUZA 5FT9A 3ZCUA 4GRIA 1PBTA 4F6LA 1K1EA 2PGDA 3MIZA 1JG7A 1X80B 2B8NA 3BJRA 3AR5A 1EINA 3IULA 4DV1B 1ZK3A 3GLGA 3HKDA 3KVRA 3OZUA 3A4LA 4J91A 4W5HA 7AT1A 5JSZA 5ADUS 4N7BA 1ZN9A 2YMLA 1KFJB 4IMIB 1Z45A 3UAOA 5H3HA 1GIAA 1P31A 4IEEA 2ODAA 1ZNXA 1ONOA 4GU5A 1XCBA 4REOA 4B3DA 4KYIB 4NHEA 2FDRA 1Z5PA 3WDLA 4TQUS 4EF5A 2R87A 4BIIA 2VRCA 4ZMRA 4FFVA 4NAUA 1G8GA 2BEVB 3K09C 4Q1VA 5BWLA 1XCPA 4GXRA 5K6AA 4JJ7A 5EJMA 3PCRB 3ND7A 1QG0A 3L40A 4CLRB 1L5MA 3INYA 5CFOA 1T1SA 1SBHA 1YVUA 3KELA 1IXKA 5I3CA 3O3CA 4MW6A 2PIAA 3KPJA 3A2MA 3B7GA 4EHIA 4QKQA 2XA1A 4LGVA 4DBLE 3NH9A 1DIGA 2VP4A 3BMOA 3LPMA 4O1IA 3B52X 3KUKA 5EE3A 1XQVA 3D02A 4JENA 2XUQA 1TF7A 2OMEA 4LSZA 3FVWA 3TE7A 4BEBA 1XT6A 3D9QX 4WZBA 2QD3A 3PD0A 4OHZA 4KCGA 1U02A 1X9GA 3H11B 1CQIB 4GGMX 5HW0A 3I3OA 4Q37A 1RVV1 3GZ4A 3OLVA 4EG0A 4H27A 1XJ5A 3BC1A 3SC2B 1JQDA 1SBIA 1SC6A 2X0IA 2O5VA 3P9IA 3DPUA 4HX2A 1KMQA 4KMSA 2GNPA 2V96A 4XVRA 2H8KA 1WUTA 4ZPXA 2I55A 4OQ4A 1PHRA 4QOGA 1FFHA 3VTAA 2C29D 2QMUA 1TZ2A 4C1NA 2ZCJA 1U0SY 1B6GA 3JQGB 4DLLA 1V7CA 3LLUA 4KWTA 4YH1A 4PC3A 3B1WA 4QU0A 3WLPA 2A67A 5IZCC 4EMSA 1S96A 2G36A 4PRYA 3ZDAA 5AKEA 3QVWA 1X1DA 4AQDA 1OXBB 4CTJA 4CT0A 3WA7A 1SZPA 2IUYA 3M9WA 3DTVD 3FNBA 4OLBA 2QK4A 3TR5A 5ADVA 3I2FA 2V7TA 3QBDA 3CVJA 4QWMA 4UAGA 1Z6QA 3PXXA 3HB9A 5HF5A 4DR5B 5FH9A 2GSWA 1JKXA 4ARVA 4RFVA 1KZGB 2X8AA 3HB0A 2JA1A 2XMQA 3MBIA 3B5JA 1J2UA 2YRFA 2WUFA 5A4AA 1P81A 1WIWA 4RX1A 8ABPA 2JHCA 3TOVA 3WSWA 1WDWB 4LYHA 3BZUA 3ZDCA 2ICAA 4MVJD 1BVHA 2D62A 1P4SA 3ET4A 3PDWA 7REQA 1V26A 5AW2A 1OKKA 1O9BA 2FLVA 2QTWB 3K8QA 4QGBA 1FSPA 4DCGA 2HX1A 4TTVA 1AN9A 1N7JA 1KRWA 2GF0A 4GUDA 4LF5B 5GADl 1L1EA 3WVNA 4CEJA 4H6XA 5DCWA 1B6RA 5AW1A 2QE7D 1OX4B 1WUHS 2V59A 5ES3A 3QMVA 5FNVA 4BU0A 2ZE8A 3BORA 2OENG 3BK2A 3H1GA 4Y2GA 4C4YA 3ML1A 4DNXA 2J45A 3ORRA 3PEUA 4JB3A 4BKUA 1UKAA 3MC1A 3ZW8A 3IDZA 3IIKA 3VGPA 2P3LA 4MKRA 3U3JA 3OP4A 2CJWA 4IFEA 1TT5A 4KXWA 3LF2A 4JJGA 5DTEA 3SJCA 3PGKA 3GJ7A 3TQTA 3AF4A 4F71A 2I22A 1P7ZA 3ZLTA 2WP8J 3ESQA 5AI8A 2FEMA 1E79D 3UBMA 4B6JA 2FPGA 5KCMA 7GPBA 1JXAA 2C1EA 2Y93A 1CT9A 2TRSB 5SZKB 2E49A 4EFMA 1E5LA 1PT6A 1LV8A 4C5BA 4E08A 4E21A 5LP1A 2Q5EA 3TW0A 1FSGA 2HIGA 1PYGA 2VKQA 5ALQA 4HDMA 4MA5A 4QPCA 1ND5A 3TSCA 3G9ZA 1LV7A 3Q41A 4D0RA 4PFKA 1VZ2A 3NJ8A 2ANBA 4IXMA 5DT2A 2ZXEA 3CRMA 3P8ZA 3S2SA 1S3IA 2RB4A 1ZXLA 3IEPA 4TWZA 2UXCB 1FFXB 3Q40A 4UM8B 3ANXA 4EPVA 2A84A 1OT5A 5KTYA 2APJA 2YXEA 1L1QA 1J8MF 3EAFA 2OL4A 4OI2A 3I76A 2JFZA 2HA6A 3LVRE 3R24A 5KO2A 4JC5A 5BNFA 4LSGA 4KPFC 1KYYA 3AR2A 4DIDA 4RORA 1D0IA 3T38A 2NV0A 1L4KA 5IAEA 5GONF 4LZJA 2HR1A 2QT1A 2ZIWB 5T8KC 1F6DA 3MERA 4ID9A 3REQA 3V7UA 5JDIC 3R0IA 3OZEA 4NQZA 1EP9A 2VA8A 3LY9A 4ZU3A 5FI0B 2IE0A 3ED5A 2QN6A 4X7BA 5ES4B 2BKLA 2B30A 4MO2A 5F3RA 5ALUA 3TOZA 4Q66C 2YYAA 1M34B 1ZJ5A 3GELA 3HB1A 1OLOA 2FP4B 1DT3A 4IG9A 4PZZA 4A16A 4BJ5A 1MW8X 3GYBA 4LSMA 2CW5A 4OJMX 4XYBA 1X7ZB 4KE8A 3OBIA 1LB1B 1H22A 2GM4A 1L7EA 3OKCA 4D79A 3K3PA 5C18A 3PHIA 1HWYA 1BHJA 1HNXB 3SJBA 4KK3A 2W6NA 4YRKA 2QSZA 3OZFA 4HAVA 4XOUA 4NICA 1PUXA 1GQFA 2JB9A 3W5VA 1WW8A 2KYRA 1WU7A 2JJ8A 4EECA 3X2FA 2M98A 4GL4A 1G3RA 1K89A 2JLRA 1UH5A 1EWRA 2AG5A 2EBFX 1XRSB 3M34A 4HSEA 5EJ5A 5L3VA 1XXHE 2PG3A 4HX9A 1JG2A 4JC0A 4ZCQA 2I54A 2YH2A 5DM70 3Q3GE 1MNQA 3EDRA 2E0IA 1FK8A 3REFA 4H1VA 2E21A 4YUWA 4Z54A 3NB0A 3IR5A 3ADCA 5LYJA 3UAVA 1ODIA 2C3UA 2OHJA 4C1BA 5D5QA 4YRCA 1OU0A 1TEXA 4AY4A 2BBSA 3EP9B 1OX5A 2OO5C 4PBSA 3JWEA 2I4MA 2IEAA 2RIRA 3PXDA 1OV4A 2Q4RA 3NC4A 5DHUA 1SD2A 1GRCA 3NEJA 3PK0A 4BGIA 1ZBQA 1LSUA 3PICA 4RE6A 3GFFA 5I7FA 3VHXA 1BS9A 4U2CA 2IA5A 1O54A 4LX8A 3GLHE 3RSCA 1OBOA 3DKVA 3CPSA 1NTOA 2WSSA 4RA6A 3QOWA 2P6NA 4HN4B 1MAAA 3WZMA 4CKEB 2GZSA 3FTNA 2GRJA 3JYNA 3D7SA 4EHJA 3GLIA 4ZO4A 4DBVO 1Z4NA 3DHNA 4CF3A 2HWKA 3TM4A 2G7MC 2V74B 3F5MA 4PNHA 4PRLA 4CTMA 5BQFA 4LF6B 1FVOA 2N47A 3DDSA 3SD7A 3WBJA 3WQRA 3M4NA 1RPZA 4XI9A 1V8OA 3AF6A 2HHLA 3JSAA 4OH1A 4HATA 3ZYCA 4R8LA 1J42A 2GFHA 4NE9A 3GFBA 4BXOA 4G5GA 2GD2A 1JU3A 1TM3E 4S3MA 3QPVA 1QE0A 2OQIA 3H2YA 1FP1D 3RAGA 1O94C 4KUHA 4EZIA 5GVSA 5KX5F 1WL8A 2R3SA 3ZXSA 3L4SO 1A76A 1JIVA 3PRKE 5CCDA 3S1AA 4ZZ1A 3AL0C 3NETA 1QE3A 3UWPA 5KWIA 4J1QA 1WSBA 2YVKA 3L46A 4OAPA 2G1JA 4W7HA 5DBGA 3FPBA 2QAGC 4JP8A 1NMXA 2CJXA 1P0QA 5DP2A 5EMJA 4O1HA 2ZQZA 1KDRA 1JPJA 2GRAA 2IEZA 2J9ZB 2AF3C 1KVUA 1U1CA 3E5RA 3JQ8A 3O1HB 3N0VA 3O03A 5DK4A 1EP1B 3HYCA 4JASB 4NL4H 5IBPA 2WTNA 3ZU6A 3KT3A 2HLDD 2QUHA 3CSUA 2IKQA 4HNUA 3ZVNA 2I7DA 5DZSA 4CKYA 3J7AC 3L06A 3EOBI 5HRAA 2G70A 3I6YA 2H57A 4MROA 3GLQA 5TQVA 1DEAA 3LUFA 2Y05A 3NHKA 4BFZA 1USIA 5FA6A 3LCVB 2Q2QA 5EXDA 1O0BA 2R60A 2HMUA 2MSCB 2Y6VA 3EPPA 3MWDB 4UZFA 3AVWA 1YS4A 1PX0A 3HACA 4X71A 3SHOA 3DLTA 5CA0B 3AVUA 1W1UA 2MR5A 2NWQA 3PQ3A 4MKZA 3NBAA 1RLOA 1GNQA 3BDVA 3PEYA 1OFVA 4LJRA 4P08A 2B1GA 3MAJA 2CVOA 1NNI1 3NPMA 5EXXA 1HDEA 2O2XA 3E8XA 4WK6A 3NOVA 1VIDA 3QKWA 2EEPA 2O0JA 5E95A 2A0YA 1Z2PX 2B6HA 2HQOA 3IQEA 1REQB 5IC6A 3TZHA 3URKA 4F93B 3JTMA 4NSNA 2VDKB 5KYGA 1EDDA 1F9AA 1FFAA 1NLFA 3FOWA 4LJSA 4NAHA 1JZSA 3TXAA 4ZIRA 5IDWA 4Z7NB 4QYMA 1Y48E 3PRHA 1MJGM 4NIMA 2EBHX 1T8YA 1ORTA 1XN1A 4BQQA 1OLUA 5CJ2A 2G6BA 3QEJA 1FYVA 4F5ZA 4AXXA 2HM7A 4DLYA 1JJAA 2QD5A 3QELB 3S2ZA 4D8TA 4LFAB 3OURA 1H42A 1FXSA 1NQTA 3DXFA 3DWEX 5EE1A 1PJ2A 4H6VA 3RTAA 4I9GA 2JFPA 4IIBA 3SZUA 2YBDA 5AVSA 4GO1A 2HT6A 3ENKA 4P5PA 4AYTA 5C32A 4RPGA 5DOVA 1YJBA 3WGZA 1BE6A 3MCWA 3NHUA 3L04A 1HL7A 2YXDA 4PPNA 4AJ2A 3QLUA 4KBYA 1CEEA 4IICA 1G8YA 1KU0A 1CU1A 1L9XA 1RACA 2O8BA 4RVDA 2NSJA 1JR2A 4MHSA 1ZM2A 2ZWPA 1KH3A 5JVDF 4DCNA 1R0BA 2CXPA 4WOPA 4ZAXA 4MQMA 3PXEA 3AM4A 3ZGZA 3I1IA 2XECA 1XNGA 2OILA 4B3FX 2V6IA 1GGHA 3UF0A 1RXVA 1EFUA 2D1SA 1CZKA 3BGOS 2QMOA 4LWOA 2EIHA 3VKFA 2A7XA 2FMHA 4OUDA 5LJIA 1MJHA 3PLNA 4LXHA 4DLPA 3I6IA 1N78A 2CK3D 1ESNA 4G26A 1ISSA 1FL9A 1V2GA 1T36A 5E7QA 4F6RA 4H1TA 1FY2A 2ZE5A 4PQGA 4Z86A 3WRYC 4ZHQB 3EG5A 2AXPA 2ZP1A 3OESA 1YS1X 2OAQ1 1ESZA 1HY3A 3DZ3B 3VR6H 3X1KA 3ZS8A 3MINA 4LNHA 4XYMA 4MVJE 4J9VA 2JS7A 1TJ3A 2QRNA 2G5CA 2I6TA 1DJLA 1S8FA 3KQQA 3K70C 3IVRA 1NYRA 4Q9KA 10MHA 2DECA 1OHHD 2WWGA 4OYYA 1UBKS 3FZNA 3NAMA 1JPVA 4DEVA 2HA4A 5ITZB 4P54A 3ZV6A 4OJKA 4AUMA 3HDJA 1SJ9A 1A97A 1N36B 4XWTA 4DYDA 5EQJB 1AKNA 3RSSA 5G1PA 4JJ6A 3GROA 4G8CA 1HT2E 3HR4A 2V8OA 3U49A 3K2QA 4HNTA 4XA8A 4BN4A 3EC1A 3EEQA 2BFBB 4RGVA 4KGVA 1Q5PA 1KYXA 3ZHUA 3AEUB 4P5EA 3TL3A 5JQWA 1VBFA 1Z4JA 1WUYA 2XNJA 3WQQA 4K03A 2J31A 1P9LA 4C0SA 4F8EA 1WY7A 4EYEA 2VP6A 4BEVA 4F11A 2HMWA 2M6LA 4YT2A 3TMAA 4L8GA 5FI5A 5JMWA 4P3NA 1EA5A 1U0GA 1J8VA 4KPUA 3LUPA 4BKQA 4E51A 3WYGA 4FFWA 2P3QA 3VR6D 2VDQB 4TKLA 2HO4A 1W44A 2CCGA 4IUYA 3JWPA 3T06B 1YB2A 3AUJB 3SDSA 3WK4A 5AVZA 1NMZA 4CL8A 4BGEA 2ATXA 4Q12A 1LVGA 3FCSB 2ONKA 3O4IA 3VH2A 3UGJA 2IBTA 4WNAA 1J2YA 2ZUVA 2PXAA 3AB3A 3SLGA 2A7QA 5HK9A 5I8ZA 5LKAA 4YAGA 1GZSA 3O4FA 5JSZB 1BS1A 1CPYA 2A0KA 1KF0A 1EU1A 2I87A 2QZ4A 5KYVA 3UAGA 4C4SA 2HT1A 1UDCA 2HW8A 3O8QA 5C52B 4YI5A 1PR9A 3KOZA 5SY9A 4UEKA 1EH5A 1PLLA 2Q3LA 2XQFA 4V0SA 4X8HA 4BFYA 3DL7A 5HP4A 3V80A 2WKRA 1SXQA 4MJXA 6ADHA 4KI0A 4MQ6A 2V5VA 3V1TC 2OUIA 2Y2UA 1UBGA 3TCXB 3KD2A 2HMSA 4C0KA 1YQGA 1Q0TA 3BJIC 1CNMA 2H0AA 3ZDDA 3QA3E 1EGMB 4CKWB 1UEJA 4BNJA 4F9EA 5EJ2A 5C7IO 1BHQ1 3VU3A 3W8DA 3FZQA 3P32A 1WMEA 3TI7A 4B09A 2FWJA 3MJRA 2K7FA 5BSMA 2VL7A 1XZCA 5ANRB 4ZDJA 3UHFA 2O1WA 3BMOB 5JC1A 5FBVB 2ZKIA 3BL6A 3H5AA 4WNCA 5SY4A 1QTQA 4LJ4A 3WLQA 1DC3A 4DGSA 3INNA 2Z0MA 3Q87B 1KAGA 3I04A 5CB6A 4Z2AA 4MXDA 4PYKA 4WZBB 1IRXA 1IAQA 3BRQA 3L92A 4P4TA 3UWSA 1DXQA 2WM2A 3PWTA 5CVEA 4ETIA 4M0MA 3EXIA 3BE6A 3IEXA 4FZ3A 2GGSA 4HXYA 4KHZA 3AI7A 5ECDA 3BK1A 3KO8A 3TW4A 4DAEA 1ONSA 2PRYA 1PGQA 4HH3C 4BP3A 3ZJYA 2BISA 1RAEA 4D7AA 3Q9LA 1W76A 2XQJA 1XZIA 1TQ6A 3DZDA 5ALTA 1ESEA 1QV7A 3I9MA 5JO0A 5FOTA 1E0KA 3O2QB 4DWWA 5LMZA 4YV0A 2FGJA 4NZZA 2R6R1 3BL5A 3OLYA 3C3EA 1ECBA 2DFLA 3CLRD 3LUKA 1EZ1A 4FGUA 4MMYB 1VPEA 4OAQA 5CFNA 4YDRA 2R8ZA 1WQ3A 2H08A 1OTYA 5CTAA 3AGPA 3L7YA 2FCRA 1I2MA 1KFKB 2B8JA 1QF9A 2H65A 1NKSA 2QXYA 3EBOA 5AOCA 4L85A 3W8FA 4PAWA 3WISA 3AR4A 4P58A 4E0BA 5JEDA 2XVXA 1S0UA 4BY9E 1BXGA 3CF6R 4DNPA 2DWOA 4Q7MB 4K0KB 2P68A 3TH5A 4QODA 1GNPA 3NC1C 4TRRA 2GARA 1XDUA 4D5EA 3WLHA 1SCUA 2JI8A 3HJTA 4P8RA 2WYWA 4QPDA 2HGSA 5JZSA 3PWZA 2BMEA 5CGZA 4DKJA 5CD9A 1WVIA 1HUQA 3CNOA 4DYVA 1UPCA 2XQGA 4M7WA 3I53A 4UM5A 2YIJA 1Y34E 1E3MA 5ICFA 3HC7A 3FDFA 4QU5A 1JHRA 5CG1A 2CXXA 7REQB 4P0PB 4V38A 1AB5A 2XODA 3N3BC 5K3AA 1SXJA 5K4GA 4XEUA 1Z6AA 4GXNA 4NDZA 4AL4A 3G49A 4P32A 4ZTUB 2HLNA 4CEJB 1UIRA 5HCNA 1QU3A 4MGEA 3A37A 4WKBA 5KMGA 3N2YA 4RSRA 4YXWA 2YWGA 5I5EA 2A5LA 1R9MA 2O2HA 3AVQA 5FNVB 5A03A 3FGPA 2D1FA 3WNDA 4D74A 1RRMA 2EGGA 5C51B 3MN1A 1C3JA 1EMDA 2SKEA 5D6NA 1FFBA 2BJVA 1ZESA 2I78A 1VCNA 2P0AA 2YV2A 3CH6A 4BE9A 5EJ9A 2CJWB 1TFRA 4MJLA 3OUZA 5JIBA 4NNPA 5M2QA 3JRNA 3KSUA 3U13A 5JPIA 3KBBA 5ITVA 4GM4A 1CR2A 3PP8A 4EB6B 5IRCD 1T8UA 1TPZA 3GDGA 2Q50A 2PSEA 3AEYA 2ISSD 2AHOA 4FCVA 2JCBA 1GQSA 2YV4A 4ENTA 5FX2A 1U0BB 3B1VA 4X3OA 1COZA 4UU1A 2O2EA 5CHEA 1OE0A 1F9EA 2YIVX 1CVLA 4AKHA 2VUSA 4HDMB 1G5RA 5JATA 3DM5A 1XVLA 2AOVA 3K92A 5GAJA 3RKSA 2DBZA 2QEQA 3GW8A 3AEKA 4MR9A 2WWFA 2Y1DA 4ZTBA 3O92A 5LQRA 4WN9B 4O63O 3L3BA 2Q0HA 1ORRA 4QPNA 3U26A 4E1AA 3FTCA 2L69A 3TWOA 1AT1A 4JBXA 3IT2A 5IS2A 4V03A 4Y6LA 3FG9A 3OQPA 3AKZA 1JQBA 5KREA 3VBEA 1YZQA 4ZDWA 4DN6A 5HM8A 3ROFA 4O0LA 3IUQA 3PF8A 1MGOA 4HFNA 1DC5A 4KAFA 3VC7A 2DHEA 3W78A 2BGMA 2WSMA 1T8RA 1LDNA 4X8OA 3WRVA 4KHPB 3LQ2A 3P9ZA 4LRQA 4L4ZA 4Q7QA 4EI9A 1Z4LA 5A1JA 3M0EA 2R8XA 3E6AA 2AN5A 2WICA 3REQB 3AM5A 2VRNA 4WQMA 3ACBA 4EBFA 1R0WA 1YS9A 5K0FA 4JUIA 4RXMA 2ZDGA 2BFDB 2E37A 1UOEA 2H2AA 1AUPA 1F2UA 3QWFA 4LJ9A 3MB5A 4KTTE 1XGKA 2J48A 4EEXA 3WAJA 3BX1A 5AJZA 3HO8A 3LIPA 3PT9A 3A9CA 3LHDA 2H5EA 4K40A 4PRZA 1HTBA 2Q3EA 1BGXT 1LSSA 3OCWA 2O8DA 3OVMA 3DOOA 2HHJA 2VSOA 1C4OA 1MU0A 1MA0A 5CLGA 1PFUA 2Q7XA 3I1JA 1OAKA 2GJSA 2ZYTX 4JC4A 3LW7A 4OI4A 5CGQB 2FPNA 1OFHA 4G2TA 3ZU5A 2EQBA 2H1IA 3FSJX 3INGA 1UJNA 3Q8XB 5A6SA 4TN5A 5TX7A 5I4BA 3CLUD 4PU0A 4GWLA 3A27A 1RKXA 4LE2A 4XTCS 2IIVA 2MCFA 4S1WA 1AV7A 1G5PA 5C8VA 4BL5A 4UNNA 3P20A 3E27A 4GI3A 4D4GA 5CLLA 2NYVA 4MRRA 4A6XA 4I2VA 2ZTUA 3KAJA 2TS1A 1M1YB 2ZB8A 1FFEA 5CA1F 1KEKA 1UKVY 1XZQA 2YFHA 3NBKA 3O1JC 3ZHVA 2G4LA 5HFJA 1RRKA 2H16A 4RELA 4PYQA 1YVPA 2AQIA 2OCKA 2KBEA 2W2PA 2HJHA 5LYJB 1KQFA 4MV7A 2HA0A 3CNEA 3E3LA 3WBFA 1LH0A 3BIFA 3GCDA 4DUPA 5JYBA 1KIMA 3AHGA 2I3AA 2EG9A 3ROMA 1IPHA 1ELOA 3VXKA 1FU8A 1IB6A 2WZCA 5FWXA 5HJEA 5JZ9A 1H85A 1QIJA 3BXEA 1JR4A 3DGEC 3DXXA 3G88A 4HBGA 1QU2A 4G0OA 5FBWB 3TQHA 1NVTA 4CTNA 3PJGA 2NZ2A 821PA 3IMKA 3VHXB 1CETA 4MR7A 5K51A 1NN0A 2NV2B 3WLLA 3X2EA 3PUHA 3JXEA 3E2PA 1N2CA 2IDZA 1VLZA 5FOUA 2Y76A 1LZLA 3OEED 4RA6B 1LY1A 2CLOB 1O03A 3IPYA 3OIYA 4D82A 1W19A 2QLNA 3DE0X 4U5XA 3LQKA 3VDMA 4D41A 1A2BA 2PUDA 1XZHA 3EMVA 3VISA 3FPSA 3TV1A 3GLIB 3T15A 2V6MA 4CEIA 3K0CC 4ZAGA 4QJIA 1VI6A 3NIGB 1P45A 1RQLA 1Z13A 3AOEA 5I9NA 4ZAZA 1RE1A 4BZPA 1S7CA 1MAUA 3VAAA 4F04A 4DV0B 3ZZ0A 3M1YA 4WWHA 2RGWA 4YJHA 3EZLA 4JKOA 4AJLA 1VDZA 2I99A 3U7HB 1WXWA 2V9PA 3QXCA 2BZ0A 3LLCA 4OBBA 3T1YB 1ZC4A 1KDZA 1FFDA 4I81A 1QPBA 1BDHA 3FLMA 3JW8A 5FPPA 1UPXA 2I7CA 1W73A 4ODIA 3Q3IA 4REMA 1N2JA 1U7OA 2D54A 4MQUA 3S1AB 2CV1A 4DMFA 4URYR 2VHEA 5IUKC 2NZWA 3C14C 4B6GA 1IMOA 3TW6A 4LGCA 3G5AA 4W8GA 3ZZTA 1GWNA 5J59A 1AS2A 2GK3A 4OQMA 1Q3TA 3SI7A 2O8CB 1ODKA 4ZALA 3JQ8B 5EC8A 5DJ5A 3CCBA 2PZEA 5BUZA 2WVJA 1YTLA 2GXUA 1L8QA 1AZSC 3NVMB 4N47A 3RNOA 4DQLA 3F5QA 3AF1A 4PYRA 4YJ3F 4CLHA 1ISRA 1DTSA 1BOOA 2TECE 2Q1UA 1PD0A 5F35A 4O0MA 4XR4A 1JG3A 2IYYA 2ZCVA 3SEFA 1K6MA 3VNUA 5CYOA 1RXIA 1X74A 1DARA 3PQ8A 5EJIA 2WU1A 4LV5B 4MPTA 3HXTA 6LDHA 1PSWA 2QMQA 2XT6A 4UVEA 5SICE 3EOAI 4Q7JB 4DQXA 4F1JA 4GS5A 4CQNA 1PQPA 1Z82A 3A3PA 3TZQA 4H08A 3KTFA 2DEUA 2GLTA 3IE0A 4H0CA 2YZGA 4MICA 3V8RA 1E89A 3C70A 4GYJA 4A1OA 4GC9A 1TYCA 1YS2X 2NU7A 2ECQA 1V47A 4EUNA 1Z63A 1OWOA 2JRLA 2ZDQA 4FDAA 3DOHA 4HGRA 4Q7LA 7YASA 4R5MA 1ES9A 2C9MA 2PT6A 3AV0B 3OCYA 2P5YA 4KAJA 3QU2A 2R96A 3EDCA 1K4MA 3JYHA 4F2GA 1QWOA 1LD3A 3HWWA 3HI6A 3AUYA 5COQA 3QPCA 5DNVA 2Q8PA 1UR5A 1U2DA 2ZUUA 2AUTA 3E2MA 1IB0A 4MW1A 4AO7A 4PQEA 1Z29A 3AUUA 4UBJA 1A9RA 2PO7A 2C7GA 2BKAA 1RYEA 4ML3A 3RASA 1U9IC 2C58A 3K1AA 3ILHA 5AQ1A 4F8JA 5JYAA 2B99A 2PUVA 3E0XA 4MR8A 4RDHA 3H13A 2AN4A 3OT1A 1FW8A 1E6LA 2PSFA 3ZVMA 4N48A 1TCBA 3FNRA 1WZCA 3DOJA 1PYDA 1YZLA 3B48A 4DARA 3C0KA 3JRWA 3L0BA 4CCYA 3UXMA 4FBMA 3Q8LA 5JAUA 3AXTA 2ST1A 1N77A 5M34A 3D3WA 1IOVA 1O57A 4IJ5A 2PMEA 2ZJ7A 3HCPA 3S29A 5J47A 2C7RA 4E03A 2CUZA 3WYEA 2WYHA 1C1YA 1QBKC 1HM5A 3HGMA 3VH1A 3BFVA 2QTMA 2ZVPX 4MITA 5K8LA 1IRIA 3O83A 5HA5A 1GNSA 1GZ4A 2GCOA 3DZBA 3CU5A 4RQUA 1PKXA 3KQSA 2K87A 2OE2A 2A86A 4N6OA 3VSAA 2UXDB 3RSZA 2BGUA 1OD6A 4I8DA 3OQ1A 3EP8B 3U7JA 4ZO9A 4F72A 5EP3A 3W90A 2JAOA 4OUDB 3A1VA 4EJ2A 3QLJA 2ZTSA 1ZRNA 5REQA 5H8WA 4B17A 5JAOA 2D3WA 3K05A 1P0PA 4I1PA 4O29A 4XLZA 4I66A 3UMMA 4RANA 3T41A 2CFOA 1AGYA 2FWMX 3IQZA 5FJIA 2VCEA 3IXQA 1DB3A 2EYQA 3A31A 5AHOA 5BN4B 5JHGB 3STHA 3OPMA 3OX3A 2IPXA 3B6IA 5ARDA 1C2YA 2YCLA 4XDZA 2IOYA 1ZD3A 3MINB 3REOA 4XRGA 3P71T 5BVHA 1BWPA 2B4AA 3C7KA 4L4YA 1BRTA 2Y99A 3HCCA 4YC7A 1US8A 4KGZA 4EAQA 4IHKA 4F4IA 3B12A 1NG1A 1R8YA 5EVJA 4IHJF 5EY5B 4FUTA 1XRPA 2GKOA 4DWJA 5B1IA 1G19A 1OC2A 3KHTA 3P2MA 3KUDA 4II2A 1YC2A 3HVKA 4OAOA 5KUTA 3RJMA 1P8AA 4NBRA 4FFBA 4NULA 4O4IA 1C8VB 4ESOA 4DEYA 3BIXA 2A9QA 2NVWA 1WTCA 1PJLA 3DAFA 4TYNA 2DFDA 2V54A 1LI5A 3EVAA 2GI4A 2V5UA 2DR3A 4KQHA 2J3QA 4PM4A 4EO9A 3E5HA 1NI3A 5JWOA 4DMLA 3KR9A 3EGIA 3HADA 4EB3A 3FVRA 4MIKA 1NYTA 3ANNA 3DO5A 2Q3CA 3OA0A 3BM5A 1WCWA 2OORA 2R5WA 5EQTA 5I4IA 3ELWA 5ALFA 1YCGA 3VAZA 2PVSA 2ZWVA 4L8FA 2A1TS 2DR2A 1N6NA 1A82A 2IW3A 5DNWA 5LQDA 4JROA 4N5HX 3OQVA 3NP7A 4HYEA 2ZSUA 4KPUB 1YQDA 2Q3DA 2R6HA 3JY6A 3P0EA 4GZ6A 1NN5A 4MWEA 4MLZA 3AKDA 3HJBA 4MUGA 1RVDA 3ROTA 3SHFA 4MRPA 3V1MA 5KJCA 1IUNA 1NU6A 2YINC 3GVXA 3MWJA 4HEQA 4NC9A 1ZK0A 5D84A 2OXTA 3SJUA 3UN1A 4E6EA 4YRSA 5I7OA 6ABPA 1XSEA 3ESDA 3RFTA 3K0KA 2XKKA 4ITRC 4FYMA 4WNAB 4XX0B 2R6DA 3KJZA 1T8WA 2ADMA 4ZK6A 2XZLA 5KU1A 1R5OA 4QVKA 4WMLA 4WXHA 1UP6A 3P9YA 3QW4B 1E2QA 1SKYE 2LIPA 2NUPB 2QUAA 3GEGA 1M75A 2I8LA 2JAXA 2QKYA 3CEPB 3GOHA 4FIZA 2DKFA 4UM7A 3FGOA 4C5AA 4ZKDA 4Y6RA 5AJHA 2ADOA 1VGRA 4EUHA 1R5BA 4IH4A 4BASA 1M6VA 3PDHA 4MV8A 4XFKA 1Y8QA 1B6TA 1MB4A 2RKOA 3DNFA 1N75A 2C2WA 2DHQA 3JQEA 4JHLA 4GSYA 1R3DA 1AMUA 3EGOA 3KQKA 3E05A 1Z74A 2C61A