1H9BA

Active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 173
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9bA01
4ILKA 4L75A 2AQHA 2AE2A 3DHNA 3L77A 3FHLA 1E3LA 3E82A 2JD0A 2AXQA 4FGWA 3JCZA 4FJ2A 1PWXA 1N9GA 2VNSA 1NAIA 2VWPA 1GUYA 4NFHA 3UVEA 2BELA 1YL5A 4ESOA 1YVEI 1DSSG 3QVWA 1CQJA 4R1SA 3I9OA 3UFXA 4FCCA 4BNZA 2PR2A 3EC7A 2DQ4A 1SCUA 3GDGA 2Y66A 1Z73A 2P4HX 4ND1A 1PGQA 5KJCA 5GMOA 2X5JO 3MJCA 4L9RA 3PWKA 1A4UA 3QVXA 1NHWA 3ZWVA 5A9SB 5BNTA 3TZHA 4BV9A 2Y05A 1F14A 1FDVA 1SC6A 5HWSA 1I3LA 3JQBA 5JYAA 3RC1A 2ET6A 2XXJA 3GGOA 1D3AA 1V35A 3GG9A 4YRDA 1WWKA 4PN3A 3JQGA 3L6OO 3OICA 1P74A 2Q50A 4YQYA 4EBFA 2PY6A 3L6DA 4O5OA 4NR0A 2VTEA 3CSDA 1N7GA 1O94A 2Q49A 1DIBA 3D3WA 3ICCA 1YL6A 1E3WB 2AHRA 3PQDA 1AXGA 1E3IA 4CLRA 2FHSA 4DRYA 2BF7A 3GFBA 4CM4B 3ZDFA 3T4XA 1A7AA 3UW3A 4CM7A 2ZYDA 4R3WA 1SZJG 2TMGA 4IQ0A 1E3WA 3EGOA 1DAPA 1DIGA 2RHRA 3WYCA 2BLLA 2ZB8A 5I9MA 3D7LA 2UUOA 4EJMA 1XKQA 3RFTA 3DZJA 1C0LA 3EHEA 4GVXA 4RF4A 3KLPX 4Z3DA 2ZKLA 2WD7A 1N7HA 2PFGA 2J3KA 3DOOA 1U5AA 3FNEA 3PLNA 4K6FA 3DFUA 3F4BA 3F47A 5BNFA 3LVFO 2AA3A 4CMBA 1OZAA 1S6YA 5KKAA 4IDGA 3MJ4A 4KTTE 1G6KA 3ST7A 3WOHA 3F1LA 1IL0A 4IZIA 1VPDA 5AVOA 3QA9A 4TRRA 3K5PA 5JC1A 3PDJA 5I7VA 4E13A 5L95A 3Q9NA 4J1NA 4L73A 2QZZA 3PJFA 1EFKA 1LSSA 4AJ2A 2B4TO 4DA9A 2GZ2A 1E3SA 2W2KB 2ZYAA 1YDWA 3K2EA 4OH1A 1P44A 5IN4A 1I10A 1Q1NA 4GX5A 5KTKA 4M1QA 4TSKA 4WUVA 1ULUA 4Y6RA 2GYYA 3CKYA 4FS3A 5KJEA 3W4JA 2X0IA 4Q3EA 4Z3KA 1KEVA 3V2GA 1VRWA 3WIEA 4FFMA 1K6XA 4YR9A 5L7WA 2ZYGA 1ZXLA 5H82A 1E1LA 1C1DA 3CXRA 4YPOA 4GGOA 3COSA 3VAZA 1ZEMA 4UVHA 2H6EA 5T73A 2YQ5A 3AU8A 3D3WB 3ETGA 4RQTA 4RVSA 1O89A 2CVQA 4J0FA 5KCZA 3DO5A 1UZLA 4MP8A 4FJ1A 1ONPA 1ADGA 1PQUA 3E8XA 3LK7A 3DXFA 1A72A 4GL4A 4GLOA 4RL6A 4P38A 5LDHA 1YOVB 1QG6A 2B69A 5F1OA 3UGKA 4DQUA 4H15A 2EGGA 5A3JA 3GZNA 3GVXA 4NMHA 4RDHA 5I9LA 1IZ0A 1PEDA 2XF8A 1A4IA 2GZ3A 3VOSA 5JYFA 3HQ4O 2ZTLA 4O6VA 3IP1A 5B1YA 3O03A 3PHIA 5COQA 5DCYA 1YQGA 4J3FA 1LDGA 3WYEA 3WQRA 4BHTA 2RH4A 4IINA 3TQHA 5KWEA 1XDWA 3SC4A 4BGEA 3F9IA 1P45A 1P31A 4BB6A 1GFSA 4HKTA 2QRLA 3I52A 4U0KA 2F1KA 1T2FA 1HYEA 3SJUA 3JYQA 4BNUA 4AJOA 4A2CA 2Y1GA 1N1EA 2PZJA 4BB5A 4R1UA 2D8AA 4D45A 2VQ3A 1NASA 3G0OA 5TT1A 5I9NA 2D4AA 3W8FA 2Q2VA 1DC6A 1KIFA 4CR7A 5CG2A 3CMCO 4Y9DA 2AG8A 2ZK7A 1B7GO 2VUSA 5K6AC 3QQPA 1QLJA 3O8QA 5LDGA 1E7YA 4JIGA 4DBZA 5TGDA 3CMMA 1H0KA 1U8FO 3OJFA 5EESA 3BMOB 2B37A 4XQCA 4ZU3A 1EEHA 3OA0A 2Q22A 4WLUA 3OH8A 1HDXA 2VHYA 2VWHA 3W6ZA 3UCFA 4BO0A 4CQMD 2WYUA 5B4VA 4IDBA 3U0BA 4UULA 2X58A 2IXBA 2P4QA 3I9KA 3VH4A 4PZDA 2QHXA 2QRKA 4XDZA 3F46A 1UP6A 1T2CA 5T8KA 3VTFA 1XCBA 2JD2A 3GUCA 4CM8B 4BO8A 1YB4A 1KEPA 1R66A 3DBRB 3VTZA 1W8DA 1E5LA 4E5YA 4E33A 2PZMA 5JCJD 3ULKA 1GAEO 1QYDA 1ULSA 3NV9A 4IMRA 4CM6A 5IZ4A 4BQRA 1I3MA 1YBMA 3H3FA 1VJ1A 4XA8A 2G82A 7ADHA 1F8GA 3DZKA 4RJTA 5JXWA 1WPQA 1Z82A 1XGKA 5B4UA 3KYCB 2Y99A 3ZWXA 1I2BA 2C5AA 4E5PA 5JW6A 4ALIA 4TKMA 4EJ0A 4Q39A 3ZV6A 4DYVA 1BDMA 3E9QA 4L74A 1Y7TA 2X0NA 1R16A 5TC4A 3WFJA 4PG4A 3QIVA 2Y67A 1DHTA 2D1YA 1V3VA 1P1JA 4HV4A 4DREA 2DKNA 5COAA 3BXXA 2GRAA 4B3IA 1DEHA 4YEDA 4E4YA 1UXHA 1VM6A 2GERA 1CERA 1YGYA 4YWJA 4JBGA 1B0AA 4QXMA 5FWNA 1T2EA 1QYVA 4RLHA 1EUDA 4OO3A 4AJEA 1D4FA 3W4IA 4YTEA 1X14A 2H1SA 3UN1A 4YAKA 1H6AA 3KV3O 1UDCA 2EF1A 1LRLA 1VSVA 3KLMX 5HA5A 4NK5A 1DLIA 3QSGA 2BGMA 4UEOA 3OQ6A 3IKTA 2GCGA 2AW5A 1F06A 2V6FA 3MWDB 4M89A 3C24A 4R54A 1YOVA 2VHWA 4JQCA 1A9YA 3U5TA 1JDJA 2DPGA 4MVJG 4H7PA 5KOIA 4S3MA 1NNUA 3A9WA 3NDRA 4MO2A 5A1TA 4ALMA 1QV6A 4NFSA 3WGIA 1LRKA 2NADA 4R1NA 4E21A 3IP3A 2HDHA 1LU9A 2DM6A 2B35A 3PXXA 1X1TA 3LT4A 4FJ0A 5L4NA 1X7DA 7MDHA 1NAHA 3ZCXA 4G5HA 5C3MA 2ZB3A 1YWGO 3N74A 4YJGB 5G4KA 1KVUA 3BMNA 2VOEA 1PGOA 3KRTA 4BV8A 2OL4A 4E2XA 1LX6A 5A9RA 4P8RA 1M67A 2ZTMA 4YXFA 5C7OO 4KZPA 1RM3A 3VH3A 3EW7A 4M55A 3LLSA 2RAFA 5CHEA 2G17A 1F8FA 3ZWBA 4O1MA 1Q0LA 1QV7A 1HZZA 3DFZA 2OGUA 1R4MB 2ZCVA 5A9TA 3RU7A 2W8ZA 1IY8A 5ER6A 5DOVA 2YYYA 3L9XA 3JSAA 4CM5A 5CDGA 1SEPA 3QVOA 3MOGA 4X54A 2O4CA 2NSDA 5IXYA 4MJLA 1Q0QA 2Z1MA 3TRIA 2J5RA 4OOEA 1PS9A 1CRWG 3GHYA 5G0VA 3GVCA 4JP2A 3MJTA 5CEFA 3ZNPA 1GQ2A 2EEZA 1DRWA 4HADA 2CF5A 4R9RA 4DL9A 3LDHA 2DBZA 1RWBA 3FCOA 4H16A 1UAYA 4M8SA 4BGUA 4DXHA 1F0YA 2UUPA 3I1JA 4WCFA 4J90A 5AQ1A 4E2ZA 3FWZA 4Y6PA 2JHGA 2OORA 4FQ8A 5ITVA 5JCXA 6ADHA 4IXWA 3L07A 4UEJA 1PGNA 2DU8A 4MP6A 4ND3A 3DBLA 1GQQA 1PS0A 2Z95A 4P4LA 1BDBA 1P1KA 3OETA 5GZ3A 4ID9A 4DPMA 3VZRA 4OOFA 1QYXA 4WLEA 3C8MA 2OBYA 3FTNA 1VC2A 1NTOA 3AY3A 2C2XA 1KEWA 4RPJA 3S2GA 3EVNA 1MA0A 3SJ7A 1RYEA 1YBAA 1Q0HA 3BTVA 4INAA 2HUNA 1EBFA 4R68A 1EVIA 3S55A 3K8ZA 1SBYA 3QWHA 3WMXA 3H9UA 3ZH2A 1QR6A 3PEFA 3MJEA 1I0ZA 4RZHA 5ER9A 1UP4A 4JJIA 5T6BA 2DT5A 3MOIA 4L4RA 3DHEA 4CM1A 1J5PA 3NTOA 3HZZA 2B5VA 1K6IA 3C1TA 3EAGA 3GN2A 1DC3A 1IPFA 2UVDA 2I5PO 2D59A 4WASA 3H2SA 1JAYA 3ONEA 4OL9A 2D3TA 1A5ZA 1PTJA 4B8ZA 2GF2A 4CMJA 1WNTA 4DLBA 3INRA 4XQEA 1YE3A 4BMVA 4DTIA 4Y98A 2WJPA 4WCDA 5L53A 1PGPA 4RO0A 1PJCA 5TNXA 4NBWA 1BXZA 4WEOA 3HJAA 1HLPA 3ZWYA 4MVJD 4W4TA 4Z9XA 3AI2A 5DZSA 5H83A 2X86A 1ISMA 1H9AA 1HRDA 3GUYA 1AUPA 1WW8A 5EMHA 1Y8QA 5MDHA 1VSUA 2C5EA 3JYOA 2JJYA 2W98A 3AM5A 4AJLA 2GGSA 2GPTA 4HFMA 1UUFA 3JQDA 3B1KA 1LC3A 2G5CA 1W6UA 4QO8A 1TI7A 4CMGA 1GCOA 2VOJA 4GAEA 3TL2A 3R6DA 4IM7A 4HX5A 2IXAA 2DTXA 5JDCC 1LLCA 3CZMA 5JY1A 2WWRA 3GMDA 1LNQA 1H94A 2X9NA 4ZQBA 3JQ9C 1PL7A 3GZ4A 4II3A 4W82A 4S1VA 1I8TA 1K0UA 2FZEA 4BNLA 4R4JA 2OP1A 4D43A 4EEZA 1P77A 1LXCA 3ASVA 3DTTA 5IZCC 3HN7A 4NBTA 1ZMTA 1K5HA 1RM4A 2VRCD 1LTHR 4Q3BA 3CEAA 1DC5A 2J5QA 1MXHA 3F4LA 3OM9A 5FI5A 4RPGA 3KM0A 3FNGA 4PG6A 1GTMA 2B36A 2J3JA 3BTOA 3GK3A 3LC2O 4XZ3A 2FRDA 4AJPA 2Y1EA 3W1VA 1SB8A 3I9MA 1YB5A 3KZVA 4B4VA 1U4OA 2A92A 1LI4A 4NZ9A 4PVDA 1WLYA 3UKOA 3BMQA 1TT5B 3T4EA 3EZYA 2J5KA 4J9VA 3G1TA 3FBTA 2I99A 4ZQGA 3RWBA 1CIVA 3HADA 4D3DA 4IQ8A 4NJMA 3WS7A 3IIEA 3GEDA 1IZ9A 2QYSA 5IF3A 4NHEA 3HFGA 1OMOA 3WXBA 5G4LA 3PP8A 4N5MA 4CMKA 4Q3CA 3QY9A 3ZWMA 4TRJA 4Q9NA 4OGWA 2JAHA 1GEGA 3ZU4A 2O4UX 3ZWAA 2DLDA 3VHRA 4FIZA 1GZ4A 3PHGA 3ZV5A 4CMHA 1F17A 1RM5A 2DTDA 1O8CA 5TS3A 4JROA 2PA3A 5KKCA 4BKPA 4I5GA 2FPIA 4KP7A 5JO0A 4PIVA 1AN9A 2DBRA 3GGGA 3L0DA 4II2A 5BT9A 4YAIA 4DMLA 3JQ7B 2B4RO 1EVYA 1ADBA 3BTSA 1IULA 3OMLA 1GEEA 1DJQA 3A28A 3ZV4A 4QFDA 3DBVO 1Z74A 2O50A 1KVSA 3ZWWA 4CM9D 4YT4A 2XOXA 4CM4A 3LC7O 1KVQA 5A5EA 3PJGA 2NTNA 3WGYA 3NT5A 4GMGA 1EMDA 3VPHA 4E5NA 2X0RA 3AWDA 1GUZA 3EVTA 3KHUA 4BO2A 4CMIA 5EN4A 2JAPA 2Q1SA 3QRWA 1HDZA 4BKOA 1WZIA 5T57A 4TROA 3IC5A 3E48A 2HMWA 3WWYA 2CD9A 2NLOA 4RVUA 4ZQEA 1ISIA 1CYDA 3RKUA 5EINA 1JA9A 2C59A 3A1NA 4PLHA 5IFLA 4KUGA 5THQA 1ISJA 3DZBA 4URFA 4Z0HO 1YDEA 1YB1A 2D0IA 5AYVA 1CJCA 5T5QA 3EYWA 3RUHA 3JQCA 1HXHA 1PQPA 4BNGA 4BNVA 3DTYA 1E92A 2FZWA 2DUUA 4WOKA 1VL8A 3ASUA 5DDIP 2FR1A 3AFMA 3VKUA 3WLEA 5JYDA 1QLHA 2NVBA 2OBNA 4XJTA 5DCWA 3OIGA 2W4QA 1A27A 2VYNA 3M1LA 1X1EA 4NQZA 1H6BA 1P1RA 3SBOA 4UVGA 3TJRA 3CPSA 1HSOA 1BSVA 1GYQA 4J4BA 3C7AA 1GPJA 1HSZA 4RGBA 5G2OA 3JQ7A 3QWFA 5U4QA 4BVAA 2GO1A 3RBXA 2GR9A 3KETA 2HK7A 4ALNA 4E31A 5L3ZA 5DNAA 6LDHA 1NVMB 4NIMA 1VJ0A 3ONDA 4UUPA 2BRUA 3B70A 4L8VA 4IY1A 1EUCA 5I8WA 2E48A 3PIIA 1TLTA 1A7KA 3DAPA 3JYLA 3PHHA 3GQVA 2RIRA 3MEQA 4OSPA 5DP1A 1UXGA 1EFLA 1VKOA 1ZFNA 3DZHA 3GZNB 2HMSA 2JCYA 2FSVA 1R4MA 3P2OA 1GDHA 2I9PA 4YACA 3AM4A 1B26A 2GSDA 4WLNA 3RFVA 4RVHA 1YL7A 1ENYA 4DQVA 2X0JA 3DMYA 3JD4A 1E6UA 1MG5A 3VPGA 1YS4A 1KC1A 1K89A 3GVPA 2HJSA 4XYLA 3VKVA 2OHXA 3ENKA 1I2ZA 4BGVA 1E7QA 1TT7A 2E4AA 3G79A 2X7HA 5TQVA 3BMQB 2HRZA 4XKJA 2XXBA 2ZQYA 4J1QA 3U4CA 5CDTA 4LISA 5DF1A 4CQMA 2CSUA 2D5CA 3HG7A 3GFGA 1BG6A 3F1KA 1QXSA 2PD4A 1Q2XA 3UF0A 1NP3A 2WM3A 4GX2A 1EQUA 4FB5A 4OKIA 3ZNOA 2AEFA 3O4RA 4MINA 1FK8A 1N9GB 1ISGA 3PRJA 4MVJH 2IEBA 4HY3A 1Q7BA 1CF2O 4ZGWA 1V9LA 1R4NB 1NWCA 4XYBA 3SX2A 2HSDA 3RJ5A 3VPXA 3MTJA 2W2KA 3GR6A 2BFPA 3IAHA 4CL8A 3UH1A 1SPXA 1DO8A 1Q7GA 5JMWA 3INTA 5I7SA 4WEQA 4B7CA 4BNFA 3RC9A 2P91A 4FW8A 2NU9A 1HE3A 1Z6ZA 2CY0A 3WR5A 4DPLA 3CIFA 1Z45A 3PYMA 1SNYA 2DAPA 2C0CA 3RD5A 3PHLA 4B79A 2W2LA 3ANNA 2CDAA 1HWYA 4JJFA 2YW9A 1GL3A 3CH6A 3X2EA 3HB4X 5U9CA 5HS4A 5IDXA 1LDMA 3KO8A 5C5IA 1NVTA 2GD1O 4Z9YA 1Z7BA 5JE8A 1JWAB 1KYQA 4DC0A 2EP7A 4CODB 3ADOA 1PZEA 1Y5RA 3BHIA 2WD7B 3Q6IA 3DZFA 2I66A 2Y1OA 3HDQA 4QUKA 5C37A 2HJRA 4CR8A 3H9QA 3WQQA 1HL3A 1YKFA 4J4HA 4YDRA 5ENVA 5IAAA 1E1NA 1T1SA 1DHRA 2NVUA 2Y1FA 4L4SA 1RM0A 3U4HA 3WSWA 5L4LA 4IJKA 1QORA 4XRRA 1ZKMA 1M76A 1J49A 1HE2A 3TZQA 5MGBA 4G65A 2GN4A 1NBOA 1TXGA 3KYCA 1O9BA 3DMTC 2IZ1A 2WSBA 2NU8A 3U3XA 1F12A 4I9UA 4DVJA 2NQ8A 3I9NA 2A9FA 1OAAA 4J4TA 1HZJA 1LLDA 3LU1A 2QRJA 1DOHA 2IZ0A 5BSEA 4M87A 1P1FA 3RC7A 2UV8A 3PLRA 4CR6A 1YQDA 3JQGB 4R69A 5IZCA 4N7RA 1ZVMA 1EDOA 3FR8A 3AW9A 4FPXA 3OEYA 3NT4A 3TZCA 4BNXA 5AXCA 3ZI0A 3PWSA 3GF4A 4NU5A 3ZW9A 4TZKA 1N5DA 5A5FA 1FDSA 2HK8A 3O8QB 3GPIA 5ILGA 5A4DA 4IDEA 3TWOA 3VZPA 1N8KA 5KJFA 1Y8RA 4NFYA 3DBLB 3Q3CA 3RIHA 4Z6KA 4ZICA 2BFOA 3VH1A 4FSHA 4ZHSA 3WGTA 3ROKA 4O0LA 4U6SA 4AFNA 3GT0A 1JKJA 2QW8A 1Y81A 5TT0A 3GY0A 2GZ1A 3N7UA 1T1RA 2QYTA 4WNIA 2VWQA 2NQTA 4Y67A 2C82A 3NJ8A 2E6UX 5JCJA 4PG7A 2GDZA 1T2AA 3PFFA 1BRMA 3UCEA 4AG3A 2G76A 2FR8A 5EIOA 1C14A 2CFCA 3TFOA 4J49A 4TQGA 2DC1A 1YRLA 4M86A 2YZ7A 3SLKA 2J6IA 1MG0A 1EE2A 4O63O 4DGSA 1MP0A 1NPYA 2YJZA 3GEGA 3ZWNA 2PGLA 5ENDA 3U09A 2X1HA 3LT0A 4FDAA 2FMUA 1O6ZA 3NUGA 4TKLA 3H5RA 4AJIA 2EXXA 1V0JA 4RZIA 1L7DA 4LGVA 2A94A 5KVVA 1LEHA 1W4ZA 2R6JA 3DL2A 4FN4A 4XGNA 3E5MA 4DQXA 4FC7A 3LC1O 1XQ6A 4LK3A 3FWNA 2DTEA 1KS9A 4F3YA 2WE7A 1ZCJA 1NPTO 4RORA 4IDDA 1GYPA 1IUKA 1Y1PA 4CMAA 3GVIA 4HWKA 3DBRA 2FY8A 3K73O 2OFPA 4L4XA 3RFXA 1DFIA 1WMBA 1AE1A 4ZQHA 5AXDA 5IXSA 2PNFA 3TNLA 4EDFA 3VZSA 1B8VA 3PWZA 4WCFC 3ENNA 1U5CA 1PGJA 4U5QA 3U4IA 1T25A 1ONOA 1DRVA 4BNJA 1HTBA 2WYWA 5HRUA 3Q9UA 3O26A 1RKXA 1C0PA 3WGOA 5H81A 2DVMA 2OMEA 2VRBA 4IIUA 3V1YA 3PHJA 4F45A 2O3QA 1B8PA 1X15A 2PV7A 3IS3A 4JP3A 2IYPA 2I3GA 4BKQA 3UXYA 3TOXA 4YT2A 3BAZA 2GN8A 1JN0A 1HDYA 2NUAA 2NWQA 3FI9A 4PLTA 3RKRA 3I23A 4PG8A 3H6KA 4ONEA 3WICA 1DC4A 4J7CA 4MKRA 3S2IA 3D0OA 5FEUA 1U3UA 4IIVA 4LRTB 4RVDA 5KVCA 1GCUA 2NVUB 5TJ9A 3NX4A 2NVWA 3JD3A 1LA2A 2PH5A 2C20A 2X9GA 1NYTA 4BNNA 4NBVA 1R4NA 3DAFA 3KYDB 1FMCA 5K9ZA 2CF6A 4CV0A 4YJFA 5KNLA 1PJ3A 3OSUA 3A4VA 3EMKA 1LDBA 2I67A 2C2YA 1D1TA 1X7GA 1B3RA 1JW9B 2DFVA 3I6IA 4Q3DA 2IZZA 3JQBC 1JVBA 4NU6A 4W7IA 1ZK1A 1KERA 3FTPA 2IDZA 4IGFA 4E6PA 3BYZA 4CLRB 4UREA 3TOZA 3D4NA 2R00C 5F21A 2YUTA 2HAEA 2YHIB 1BW9A 2VRCA 4YT5A 2UAGA 3RU9A 3DHYA 3M6IA 4CM8A 1HF3A 4E3ZA 1VI2A 1I2CA 4OMUA 4YRAA 1H6CA 2IE0A 1QKIA 4XGKA 4JK3A 1V3TA 1PZHA 2EGHA 1EK5A 3NGLA 1NR7A 1G0NA 5HS6A 2V6BA 4C4OA 4DPKA 1C3VA 1E7MA 1PL8A 2IODA 4B4UA 1X13A 2B83A 3GHHA 3JQAD 4R3NA 3FN4A 5A9SA 5DULA 3PYXA 1WDMA 3ETDA 4UVIA 3V1TC 4XD2A 3H5AA 4JCOA 3ZNQA 4B3JA 4CUJA 4KDEA 4WE3A 2GUGA 3HDYA 2VUTA 1GZ6A 1ZZEA 4IJUA 1ONNA 1DIHA 4IXTA 3GRPA 3PYLA 4RVGA 1OC4A 2BKAA 4XYGA 5FFFA 1V8BA 4KUHA 1PQWA 3AUUA 3AOGA 4IUYA 1E7SA 4GH5A 1WP4A 1LLUA 1ZSNA 2Q4BA 4PLPA 1MXFA 4B7XA 2YV2A 1E77A 1PZGA 1ZJYA 1OFGA 2B5WA 2Y0EA 1M6WA 5CAEA 1LUAA 3JQFC 1SOVA 1LLQA 4Y8VA 4CLXA 4FFOA 5JAIA 3W8EA 3OIDA 5LCXA 1EUZA 3KSUA 1PJ4A 3PJEA 1LSOA 8LDHA 4MDHA 4KQXA 3IKVA 3SVTA 2F00A 2X22A 1RYDA 2JCXA 1GYRA 2YFQA 4CL3A 4QX6A 2CDCA 3K6JA 1Y8QB 2NM0A 5F5LA 4BO5A 3QHAA 1WVGA 3IL2A 3WJAA 5L9AA 5DP2A 1UH5A 2QQ5A 3HHPA 2BFAA 3NDJA 3GN1A 4BIIA 4A73A 4WPGA 2C29D 3QV1A 1U8XX 1VE9A 4ND2A 4MVJI 3ADPA 4UUOA 2QIOA 3QLJA 3HDJA 4OAQA 4I5EA 1QMGA 1SO8A 3H5NA 3E9MA 1U28A 3NGXA 4CMCA 4A5OA 5ICSA 1LDYA 1U2GA 1YH3A 3PTZA 5F3RA 1O5IA 2O23A 1XA0A 5IDQA 3OA2A 2GNAA 2I6TA 3CINA 1ISFA 1FDUA 4FFRA 4I5DA 3BHJA 4K9DA 3L9WA 3RC2A 4FFNA 3D4OA 1E6EA 2ZJ0A 3GH3A 3KUXA 2W90A 4RPLA 4YAEA 5T8KC 4GQAA 1V3UA 5ICMA 5CDUA 2P2SA 1KVTA 1J6UA 4LW8A 1FJHA 5T67A 2CVZA 3RUIA 4E5KA 2YFHA 3MZ0A 5DT9A 3S1LA 5BNIA 2O2SA 3OIFA 4GSKA 5AXBA 4PRKA 2OXIA 3S8MA 3WYBA 1GV0A 2B4QA 1ID1A 2VYND 1P0FA 1P3DA 1YBVA 1HDGO 5CP8A 5EQFA 4BNMA 4XR9A 5GZ1A 3H4VA 4MVJF 1ZK3A 1GQYA 3RI3A 4DLLA 4RLSA 4DIFA 3KBOA 4HNGA 4MVJP 1J4AA 2Y68A 4GKVA 4ZD6A 1BXKA 1PJBA 3DDNA 1ZJZA 3JD1A 4B4OA 3EK2A 4FOSA 3UCXA 3JQ9A 1EE9A 1DAOA 3JQ8B 3WB9A 4U0JA 3UAGA 4E0BA 3RBVA 4KOAA 4MVJM 3TPCA 3PGXA 4KWHA 4TWRA 4D7AA 5ES3A 4CMEA 4LCEA 2TMDA 1PR9A 2ZIZA 3PPIA 4E30A 3LYLA 4A03A 4OXYA 1XU9A 3RUFA 4WCFB 4CLHA 2YHIA 4MOWA 2HRBA 4PCVA 3GNSA 1E5QA 1ENPA 3P2YA 9LDTA 4EYEA 4PG5A 4KTVE 3B20A 2BFMA 4PLVA 4RDIA 5ITWA 1EZ4A 5I8ZA 5ADHA 1ENZA 5EQDA 3WTBA 4XIYA 2CVOA 1EDZA 4GWKA 1B16A 4ALJA 1N2SA 4D42A 2EWMA 2QZ9A 3K9QO 3P19A 2BH9A 4RPKA 2JHFA 3WGGA 1QSGA 2I65A 3OF2A 4A0SA 1JTVA 1EQ2A 3FNHA 4PZEA 5IDYA 1JLLA 3IJRA 1R12A 2FN7A 5EL0A 4HNHA 2UDPA 4YBZA 4NH4A 2BGLA 1E6WA 3AI3A 4N5LA 4QTZA 2VTDA 2WTBA 2GN6A 1JKFA 1PS8A 1JWBB 1JU9A 2VUUA 3PVZA 3AI1A 1MUUA 2NV6A 1U3VA 4YAJA 3DOJA 3VDQA 2AQKA 2SCUA 4A10A 1YONA 4XDYA 1Y9EA 1IOLA 4W9NA 4D3FA 4OQYA 3ORFA 1ZK2A 3HWRA 3RUDA 3AM3A 3PFWO 2ZB4A 2PWZA 4DIBA 2B0JA 1ZSYA 4AVYA 1HEUA 2OUIA 3FF4A 2YDYA 5A03A 4HUJA 1XWFA 5KVQA 2AQIA 3D5QA 3OQBA 5CDYA 3AOEC 1H5QA 2PD6A 1IB6A 2OZPA 4AJNA 3JQ8A 4IDCA 3H2ZA 1XYGA 2DUWA 1XU7A 5B37A 1MFPA 2NTJA 1DPGA 4WECA 1FXSA 2Y93A 4XB2A 1ZBQA 4CMEC 2VN8A 2O3RA 4HP8A 1XQ1A 4HFJA 5JO9A 2VT3A 2WYVA 4FOOA 3ABIA 1T24A 3KVOA 1VJTA 3N58A 1AXEA 3S2FA 2WMDA 4I1IA 4GSLA 3F5QA 3VH2A 2VHXA 2WEKA 2O3UA 3BMNB 3ZWOA 3Q2IA 3JQAB 3DR3A 5DCUA 1TA4A 4TZTA 4G81A 3U4DA 1YJ8A 4RV9A 2Y0CA 2P68A 3CUKA 4GWGA 5T64A 2RHCA 1C1XB 1WXDA 3AJRA 4J0EA 4PLZA 3Q11A 4FR5A 4DBVO 4BQPA 1U3WA 3UOGA 1M75A 2PH3A 2PK3A 4I9HA 4JNKA 3RQSA 3O9ZA 3PK0A 2RH8A 4NPCA 3QW2A 2NNLD 3B6ZA 4IMPA 1DIAA 5IN5A 3WBBA 5A3VA 1Y8RB 3WG9A 3W8DA 4PGFA 1C1DB 2P9EA 2PZLA 4IQGA 3GOHA 3I3OA 4HBGA 1E7WA 2X5KO 3PGJA 4DLAA 3EDMA 4BKUA 3GRKA 3ICPA 4GKBA 5L7TA 2VYVA 2JFFA 4BNYA 4D44A 2G1UA 3ONFA 5BSFA 2NTVA 4E2YA 1PJTA 2YY7A 2FPGA 1KC3A 3RAJA 3RROA 3Q0EA 4IGEA 2JFGA 4Q3AA 4XIJA 1DDOA 2DFDA 1IHXA 3NYWA 5KIAA 1H9BA 1PJ2A 4RF5A 3O38A 3V2HA 4K6CA 5TX7A 4ZJUA 3PQEA 1E3EA 1I01A 4MIYA 1BXGB 1LSJA 2IRWA 5CPFA 3NEPX 3WX0A 4B3HA 3KSZO 2PGJA 2C54A 1W73A 4QT0A 4BMNA 1CEQA 2HMUA 3NRCA 1ZO8A 4BNIA 1UDBA 2VHVA 3KB6A 4KUEA 4GLLA 2JCVA 4W7HA 1ZK4A 3E18A 1B8UA 1HYHA 4XQGA 4DC1A 4ZVVA 3IDSA 4JX8A 4Z0TA 2E49A 3HDHA 3R1IA 1A71A 4LSMA 3WJ7A 2WDZA 4R5HA 4WLFA 5B4TA 4CLDA 2O7QA 2W2LD 3GC6A 1T4DA 2X5OA 4FFLA 4J7UA 4NDNE 1LSUA 4P4NA 4R01A 1HYGA 1WDKA 1FF9A 5I7EA 2Q4EA 5C7IO 2P5YA 2ILTA 1GY8A 3WGQA 3VVBA 1AHIA 4QFCA 3FRJA 4E2WA 3IUSA 4LVUA 2BD0A 3BIOA 3GG2A 3WNQA 3Q2KA 3D64A 3ZNNA 1OC2A 1D8AA 3B1JA 4D0RA 1FDTA 2A4KA 1I3NA 1IHYA 3HE3A 3DB2A 3I4CA 4U6QA 2JKVA 3UUWA 1AGNA 1C0IA 2A35A 5FI3A 5JPIA 3LT2A 4HFRA 1OOEA 3WFIA 4YCAA 2Q45A 2O7SA 3MTGA 2Y1DA 4OJNA 3NKLA 3ROMA 3D1LA 4ZRNA 2FOIA 2FP4A 3KTDA 1V6AA 1KY5A 3E5RA 3RCBA 5GZ6A 4EI2A 1HDOA 4NJOA 3F3SA 4L76A 4E32A 5K6AA 5F1PA 1NHGA 3DWFA 2DBVO 2J3IA 1O0SA 5A06A 2Q2WA 1ZNQO 1YXMA 2D5AA 4YJHB 1T2DA 3C1AA 3DAGA 3GAZA 4BMSA 4ZN6A 1LQUA 5G0TA 5ILOA 5A02A 3ZV3A 4CLOB 1O95A 4EW6A 1UZNA 5F5NA 1MLDA 4P22A 3WMWA 1AHHA 8ADHA 2RCYA 2C07A 1HLDA 1DFGA 3L6EA 3P7MA 4BNTA 2EKPA 1B2LA 1ZMOA 3UHAA 1P1IA 3PZRA 4ALKA 4CV1A 5DBFA 5EPOA 4EUEA 1ADCA 1G1AA 2EIHA 1E1MA 2V7PA 3NDIA 3FR7A 2Y1CA 3DQPA 1JKIA 3G1UA 1CETA 4CQLB 4GMFA 1Y9AA 3KYBA 4AL4A 3I5MA 5L40A 4O59O 3MCVA 2FWMX 1B14A 1PWZA 4JBHA 5B12A 3LQFA 2X23A 2IYOA 2WE8A 3SEFA 2HLPA 1X7HA 3RVDA 3WDSA 4BS9A 1ZXBA 2O3TA 3E9NA 4NG5A 2V65A 3M2TA 1JAXA 2AEMA 4OKNA 4AJHA 3TN7A 4LRSB 2O3JA 1KETA 2O2YA 1Z7EA 1NFRA 4BNKA 4N5NA 5TJHA 3NJ4A 1QYCA 1H2HA 1LDEA 1L7EA 1WDLA 2EJWA 4D46A 2VHZA 4P4GA 3VVCA 4CQMB 4DUPA 2VZ8A 4BO4A 4PVCA 2VZ9A 4RPHA 1HETA 4WJZA 1GV1A 4WLVA 2CZCA 1BHSA 2CDBA 3JV7A 4J2OA 5BSHA 1MC4A 3G3EA 3ZHXA 2FSSA 3C7CB 1U7HA 2FPPA 1UXKA 3DZIA 3LF2A 4IJWA 2ZCUA 4PZCA 4QEDA 4YRBA 3AY7A 5HTOA 5JAQA 5A05A 2D2IA 3KYDA 1G0OA 3GVHA 3KXDA 1KBZA 1ZSVA 1GD1O 1PSDA 3H9EO 4A27A 2POQX 1TEHA 5CPBA 3HUDA 3OBBA 1H93A 4YAGA 2AE1A 1UXJA 1CQIA 5JNLA 3WGZA 4XWYA 1XSEA 4WGGA 3DOCA 4MVJA 1UAGA 4XRGA 3TF5A 3A14A 2ZTVA 4JGBA 2H5LA 4LMPA 4JBIA 4UUNA 4ZQFA 4IDAA 4UEKA 1IPEA 3KEQA 3VPSA 3DEYX 5EJ2A 1ZH8A 4J1SA 2E82A 4PLGA 1GU7A 4OQZA 4RF2A 1U4SA 2EG9A 4JLWA 3LSYA 2J8ZA 2AQ8A 3JD2A 4BL5A 1ZIDA 1GUFA 1NM5A 5AOVA 3WGHA 3FPCA 1LBEA 2HKIA 1I33A 1ARZA 4R1TA 2Q1TA 3K2BA 3AUAA 3WBFA 3EZLA 5TF4A 4XR4A 4ZRMA 2OO5A 3JQ6A 4EUHA 4HFNA 5K0ZA 1XHLA 1YJQA 3ZHYA 1EBUA 1D1SA 1TB4A 3U49A 3ITDA 3AFNA 3R3SA 2J3HA 3HNPA 3H7AA 4LN1A 3K31A 3X2FA 2BGKA 2HCTA 2IEDA 3BHMA 3ROPA 2XAAA 2FR0A 1B3BA 2PLAA 4I5FA 3LZ6A 2WD8A 4XCVA 3ZWCA 5FYDA 3IUPA 1LJ8A 5CDSA 1DIRA 3GPDG 4RVFA 4MP3A 5G4KB 4CM9A 3DMTA 3GLQA 2EV9A 2ZQZA 4W99A 4MKZA 3GA0A 3ZGYA 5J23A 3NT2A 4PLYA 5DBIA 4BUCA 2HU2A 4J16A 5IJZA 1NR1A 4GX0A 3LF1A 5JDIC 5G0UA 1P1HA 5JMPA 4TVBA 5JBIA 3H9GA 2RBEA 3TDKA 4BO6A 2YQ4A 1XIVA 3CZRA 3DONA 3INGA 1BVUA 3L4SO 1DFHA 4CV2A 2PKRA 1UJMA 1KEUA 2AMFA 4C7KA 3FSRA 3TSCA 2CNBA 3DBHB 5KVSA 3M1AA 1WAMA 4TMFA 2EERA 1MX3A 1GR0A 1R0SA 3PDUA 4AICA 4KMSA 3FNFA 4UAGA 2VCYA 4Z9FA 5COBA 3G49A 3E1KA 2Q99A 4NJMB 3T7CA 4OM8A 1NPDA 3WLFA 3BZUA 2BHLA 1ADFA 2VYVD 3DBHA 3MJSA 2Q3EA 3OQ1A 1MC5A 4EJ6A 3WNVA 1JVSA 3HFSA 4XX0A 1VL0A 3RBZA 4UVDA 3GGPA 3ROQA 1N92A 1SMKA 3Q1LA 1RPNA 2X6TA 4OIMA 2EHDA 3ZZNA 1MGOA 4TVOA 3OECA 4DWVA 1DLJA 4IS2A 1OI7A 5FF9A 3GEMA 3OFSA 4W6ZA 1W0CA 2VT2A 3RUCA 2EKQA 2X4GA 4R16A 5EERA 3W4KA 5CFZA 3E6AA 1NFFA 4R41A 3CTMA 4UUMA 1JQBA 3ZW8A 4MKXA 4D41A 1RJWA 4GX1A 3MJVA 5IDWA 4ZA2A 1DBVO 5F1KA 1NFQA 4J1TA 1BW9B 1J0XO 5U1PA 4FFPA 1Z75A 1ZW1A 1IE3A 1R6DA 4G2NA 4NI5A 3H8VA 9LDBA 1PJQA 3I6QA 4PFJA 4BKRA 4FBGA 4YA6A 3H65A 1LDNA 5G0SA 1X0XA 3F5SA 3MWEB 3U62A 2EW2A 3CE6A 5CEJA 5I7FA 3FD8A 1HE5A 2PKQP 5BQFA 4JJGA 4AJ1A 2BI8A 4OHUA 1VLLA 5JYEA 3FBGA 5AXAA 4I08A 1ZEJA 1R15A 3M2PA 4HXYA 4KWIA 3K96A 4XGIA 1I32A 1PL6A 1NQOA 2UYYA 5A04A 4ND4A 4LVCA 1I24A 2OP0A 4FC6A 4EEXA 1UZMA 1QP8A 1SAYA 3TFQA 4XQ9A 4BNHA 1B15A 1HDRA 4TRNA 3F6YA 3AUTA 1NXQA 1UR5A 4MIEA 5JAMA 4LMRA 4YT8A 5JC8A 4YB8A 3V8BA 5TRTA 1NVGA 1PR3A 5JFOA 2JD1A 4WNCA 2H63A 4YQZA 3SLGA 2BI7A 4NK4A 4IDFA 4QO7A 1FDWA 1L1FA 1GZ3A 3H9JA 4EUFA 2VWGA 1YO6A 3E03A 4AJ4A 5THKA 4CLEA 1R0LA 1WMAA 5CEEA 3PIDA 4CJXA 3D3EA 2ZJ1A 4J2HA 1XEAA 2VNAA 1S7CA 4CM3A 1LRJA 4I8XA 2DBQA 1KVRA 4CUZA 2QG4A 2AG5A 4QSMA 3S2EA 3A06A 4J9UE 3PI7A 4E12A 3VC7A 3D4PA 1P33A 4M54A 2R00A 2QX7A 3KOUA 1DXYA 2VZ0A 1H6DA 4N54A 5TIIA 3JQEA 4DMMA 3ZU5A 4BNWA 5L51A 1M66A 4RQUA 3WIDA 3BMCB 3JTMA 4PRLA 1I3KA 5JS6A 3K92A 3OJEA 1NQAO 3JD0A 1H2BA 4XYMA 4MPDA 3OHSX 3EY4A 3ZHBA 1ZK0A 1PZFA 2C7GA 5JSFA 1BXGA 3SXPA 4JN6B 1E3JA 3AY6A 3U9LA 1U1IA 3ANLA 1BWSA 2Q2QA 3W6UA 4BO7A 5M6DA 4CMIB 1PX0A 4CQLA 4EGFA 2O3SA 2X8LA 4YJGA 1P0CA 5DBGA 5L7YA 1MFZA 1E7RA 1ML3A 1XELA 4IZHA 1UP7A 2YDXA 5BSGA 2Y0DA 4H3VA 2Q1UA 2PKQO 1XR3A 4BO3A 1EVJA 4PLWA 3R0IA 3ZWPA 4F46A 3VZQA 2O48X 1SB9A 2NACA 4R51A 3OJOA 2Q1WA 3AUSA 2PGDA 4TRMA 3AU9A 1R37A 2GN9A 1GPDG 3QWAA 2EJVA 4AJKA 3PQFA 4CLOA 2E37A 4CUKA 1Y6JA 1NQTA 4F6LA 4XB1A 4MVJE 2PD3A 4D3SA 3IMFA 3KEOA 4YJDA 1MB4A 3IQDB 3D5TA 3P5SA 1TVEA 2YV1A 4K28A 1HKUA 4YVFA 5DN9A 1YQXA 5TSDA 2ZTUA 2BMAA 2JL1A 3AOEA 3GMSA 4GBJA 1U9JA 3L4BC 3DC2A 4PLFA 4XEHA 2NU6A 1SEVA 1PIWA 4OSOA 4D0SA 1VKNA 4IBOA 1DB3A 4W9NC 4GPD1 3QE3A 3ZHZA 3G17A 3AK4A 3NAQA 2AEJA 1K3TA 1QRRA 3ZU3A 1ISHA 1PU2A 2V6MA 4K1LA 3DZGA 3C7DB 1I36A 1C1XA 1NX6A 2G0TA 3HN2A 1Y5MA 4B4WA 1CDOA 1I5RA 4QQRA 3QP9A 1WZEA 2Z5LA 1U7TA 4J7XA 4Y6SA 3RJ9A 2P5UA 2EP5A 3I4FA 4PLCA 3OP4A 5J9GA 3TZKA 3GAFA 2HMVA 1K6JA 1BGVA 3WSVA 3V5NA 3FPLA 3C3XA 4BGIA 1PJSA 4JXKA 2H9IA 4MIOA 4BOYA 5C7LO 4A26A 1HE4A 1IYZA 3ITKA 3QVTA 4YYZA 4K26A 4BO9A 4IPTA 3HSKA 3WTCA 4OXKA 3VDRA 1D7OA 3LT1A 4M49A 4XJSA 3WWZA 3IOYA 4QECA 1N1GA 5LC1A 3VPFA 2EKLA 1E0DA 4L0QA 1XLTA 2HO5A 3PZBA 1E1KA 1DRUA 3V2UA 1BVRA 3ZN2A 1NWHA 3GDFA 4IS3A 1MV8A 2Z1NA 3BA1A 4EITA 1EK6A 4YJFB 5DOZA 4YJHA 1ORRA 5CG1A 3ANMA 4UVEA 2C7VA 4DIOA 4OYRA 5JDCA 1CWUA 1C0KA 1U2DA 4RCVA 4CPDA 5JAZA 4J43A 1QYWA 1Q7CA 4OXNA 3GNTA 4NBUA 4B8WA 1PJLA 3BMOA 2NU7A 4RF3A 3HB5X 3WQSB 5JY6A 4Z0PA 3QWBA 1P9LA 3OJ0A 2I3AA 3JYPA 5JDIA 4FGSA 2ZATA 5G0WA 2P9GA 3KSDO 4KDFA 3TL3A 1VL6A 1T26A 2GASA 2EW8A 4GVLA 3UICA 4B7UA 2CMDA 4U7WA 4J91A 3PJDA 5HM8A 2JFHA 1NQ5A 4A7PA 3OJLA 3RUEA 5BR7A 5L45A 3BTUA 2PZKA 1K2WA 1SOWA 4DYDA 1KY4A 4EZBA 5TLSA 2LDBA 3QWIA 2I76A 4D79A 4ND5A 3LLVA 3C85A 2DPHA 4IJVA 3GNQA 3OEWA 5GY7A 4XYEA 2P9CA 4CV3A 1ZUD1 4GI2A 1T4BA 3I83A 2V6GA 1UDAA 3TZ6A 3RUAA 4F6CA 1EVZA 4R5MA 2PTGA 1I30A 4C7JA 2Q46A 3JQFA 3QJ5A 4WOJA 2X9VA 4ALLA 4WKGA 4J6FA 3H3JA 1X0VA 2HK9A 5JLAA 3NTQA 2OOSA 4Q3NA 4E5MA 4BO1A 3ON5A 3I9LA 1BTOA 2XPCA 3T7EA 4AJJA 1XG5A 4ITUA 1LQTA 2HQ1A 3JQAA 4N18A 5KJ6A 3EUWA 2CUKA 4NNJA 1HDCA 4NBRA 3SC6A 3K30A 1LC0A 3QVSA 3JYNA 2YHUA 4WLOA 3R3JA 1KOLA 1TT5A 5KJ1A 3I9JA 2GLXA 1A9ZA 3RSHA 3V1UA 2R2GA 3RASA 3IJPA 4LSWA 2LDXA 3B1FA 1UXIA 4KQWA 5L4SA 1OBFO 3NTRA 3STHA 1R0KA 2HMTA 3BMCA 4U8GA 3ZU2A 3GDOA 1DJNA 1M2WA 1U3TA 4GGPA 4FD3A 1ENOA 3C1OA 4LCJA 5HBRA 3ETEA 3L4BA 1GADO 1HT0A 1BMDA 4I9NA 4R9SA 2YV3A 2ZB7A 4WK6A 5IG2A 4ROSA 1M6HA
chains in the Genus database with same CATH superfamily
3OBIA 1KQPA 4L75A 3W0LB 1P39A 2GM9A 4F2GA 4DV0B 3PQCA 5DEOA 3ZY2A 3E82A 1R8YA 2JD0A 4KITB 2AXQA 1SIWA 5C8VA 3R7DA 3OU6A 4FGWA 4P4SB 2BFBB 2ZRPA 2AOWA 2IDKA 1IQ0A 1XA3A 3B51X 2R79A 1WCYA 2VNSA 3IIKA 4Z1MA 1KAQA 4L0CA 2RGNA 2CJPA 5GONF 3AIOA 3EQ7A 4R1SA 3I9OA 3UFXA 1QPBA 4E2FA 1EGHA 4FFBA 4HNSA 3EPHA 1GGVA 1ZRSA 1KAOA 2FEMA 4L7VA 5FWDA 2FSGA 2DQ4A 2QMOA 3F5FA 1NJ2A 2OGTA 1SCUA 3CR7A 1Z73A 3L06A 4ND1A 2NQ2C 4O5AA 1L5YA 3BQNB 3OLQA 5KJCA 2EWWA 4L9RA 1A4UA 3QVXA 2RHLA 2YXNA 5BNTA 2FPGB 1R8SA 3D1JA 1XNQB 1RDFA 1FDVA 5HWSA 1NQVA 3DCIA 3NBFA 5JYAA 3RC1A 1KBOA 1DWOA 5EIHA 3BK1A 2PL1A 4ZVNA 2FZVA 2C7BA 3WGNA 1KYZA 3CRZA 5FR1A 3A4IA 4PN3A 5IH3A 1DEOA 1GNQA 1M8FA 2DPMA 4MJXA 1KORA 4MW9A 2PCLA 5CH5A 2OZVA 2Q50A 4LYDA 4MGKR 3L6DA 1E4EB 1E9CA 2GCIA 4O5OA 4NR0A 1J99A 4NQRA 5D85A 3DAHA 4F3RA 1JYSA 3M3DA 2PFSA 1TYBE 4ZQIA 2G08A 3ZQJA 4FYKA 3K0FB 1JQDA 4KODA 2DR3A 5CTJA 2NT3A 3C3AA 5IAEA 1S8NA 2AHRA 3DE7X 3LWZA 3TO5A 1NMYA 3PQDA 4FOLA 3Q2OA 1RKQA 5KAPA 2FHSA 4BQOA 3GFBA 4PSAA 1JG2A 5DW3A 2OZLB 1CZLA 1J2EA 1NVUQ 4RAQA 1XD9A 4JB3A 4JT8A 3BKXA 1KE2A 4DIEA 4EG0A 2TMGA 4A8JC 1JG4A 3A6LA 2BLLA 2GLTA 1G2OA 2WNHA 3C8DA 3E61A 1IY0A 2CYBA 1MIOB 5SZIA 2XCTB 3PGLA 1JR3A 1DI0A 3VR5A 3DZJA 1C0LA 1JFLA 1EVEA 4MDYA 4W1SA 5AJVB 5EQJB 3ZIUA 4RF4A 3DMNA 4FUQA 2WHEA 4EF4A 4W5QA 3WWCA 3DOOA 4EGCB 8MHTA 5JS2A 1RKVA 4L9SA 3PLNA 3R3UA 3SYNA 4K6FA 4J3JA 2Y9MB 3DFUA 4O25A 4EPVA 1E5DA 2AA3A 4YCBA 1QTIA 2GHTA 3MJHA 5IC5A 3R7NA 4F2PA 1TFUA 4S0ZA 3FROA 3VYTB 4JZKA 1Z2CA 1QONA 5B64A 3WOHA 3CVVA 2OCGA 3AP2A 4NMMA 5YASA 1IL0A 1MEEA 1W36C 1VPDA 5BVHA 3ANYB 5AVOA 1SRQA 1KU6A 3QA9A 1G8PA 2J0UA 3T3IA 3PDJA 4LC1A 3UPDA 5CA1A 1Z29A 4ZZ0A 4J0KA 1SVLA 5L95A 3DVLA 4J1NA 5KYUA 2ZU6A 4F4UA 1SD1A 4YLYA 3NANA 4CKWA 4MGYR 1BJKA 3NG1A 2X9QA 4DA9A 2GZ2A 1RBMA 3FUUA 3K2EA 3O2SB 1C4KA 4OH1A 1I10A 4OPMA 2X0DA 2QX9A 3LSTA 2G4LA 1HE1C 2KSQA 4NAUA 4TSKA 4UUQA 2QSJA 3I0ZA 4MS4A 1L3BA 4PSCA 1ZD9A 2GYYA 1BCSA 2WOJA 4TLLB 1Y98A 4NESA 3KB1A 4R7GA 3S81A 3TVDA 1VRWA 1Y82A 1IIRA 2JLBA 3BH6A 2EL7A 4JMLA 4XVQA 4YO7A 5FOVA 3DW1X 4BVEA 1K6XA 4DLSA 3EEYA 4PC2A 5L7WA 2FN3A 4JXZA 2HSGA 3B12A 3KP1A 5B6IA 1ZXLA 5H82A 5BOSA 2GTHA 4YPOA 2WR8A 3DW3X 4N49A 1AB5A 1YIOA 1ZEMA 2GQ0A 2GPAA 4HLCA 5T73A 4NDZA 1Q15A 3CF4A 3OZCA 5E7QA 2QTVA 3ZK8A 1WOYA 1CNMA 2BFFA 1KE1A 1CY2A 5EXXA 5E6RA 4M88A 2I87A 1E9SA 4MP8A 1B4DA 2W6ID 3DZ7B 1JHUA 3B2EA 2XCUA 2CKMA 4LRYA 4KXFB 2W48A 1J2UA 2B69A 3PXDA 5F1OA 1ZMRA 3IHTA 3VYUB 4C3ZA 5BP7A 4TXNA 4NMHA 4C6HA 3JALB 1IZ0A 3QNWA 3WAKA 4CCYA 5LR6A 4DUYB 5JYFA 3HQ4O 1Q22A 2BSAA 2VHUA 3RJMA 4O6VA 5CNIA 3THXA 1QB8A 3O03A 3PHIA 4KBFA 5DCYA 2FSUA 1YQGA 4J3FA 2GK6A 2WF8A 3FVTA 3WYEA 4DF3A 1IEQA 3LBHA 4PAMA 4DYHA 2XTMA 1KDPA 2O1SA 2EKDA 4JQYA 3DTVD 2FKNA 4IINA 5E9QA 3TQHA 1RXWA 3IKLA 5AHKA 5KWEA 1RHMA 1WHTA 2H4JA 4QEKA 3EXEB 4QBTA 1U99A 5BVHB 1QJCA 3MSXA 3CUEF 3CNBA 1SXJC 1OLSA 3HM2A 4HDOB 4EYOA 3TW8A 3ZYZA 1AGPA 1XLVA 4C5BA 3FMVA 1TQ6A 3PSAA 3RWMB 4BNUA 1FUUA 4KQGA 3GEIA 4OVKA 1N1EA 1HURA 1GT6A 4BB5A 3LUFA 1K6EA 2WKQA 4DEXA 1VE1A 2P3OA 1NASA 5AFSA 3G0OA 2VH1A 5TT1A 4DJDC 5KU7A 1Q19A 1P62B 2F1HA 3P52A 4NCHA 2DY1A 2ZULA 4CR7A 4NXMB 1BKDR 3V6MA 5H3LA 4DM3A 3SIRA 3FCYA 3C3PA 1W7AA 2WSLA 2IXDA 2VUSA 3M6FA 4W8OA 4YWHA 3QQPA 5DWDA 3DWEX 5FLYA 3SHQA 2UZ4A 3A6KA 5FB3A 2PVSA 5GJWC 5DRYA 4N0EA 5IM4A 1YJ5A 1GTRA 4PQYA 3RS0A 1F7UA 3BMOB 2VF8A 1SJ9A 1O95C 1P5JA 1OREA 1BEZA 2OC9A 2J7PA 5BURA 2WU8A 2HRCA 4BB0A 4G1UC 4K9LA 3OH8A 5TDHA 2W8BB 2VWHA 1RMTA 2IOQA 2PT7A 3UCFA 2Y4OA 2JEZA 4ADSG 1VG8A 4I55B 1RZVA 3U0BA 4AZVA 1F7VA 2WD9A 1KJYA 1P91A 2X58A 4HQ6A 4RK4A 4ZAXA 1JDBC 5AJYA 3TQSA 2QRKA 3H0WB 1G55A 1LTKA 1XTSA 2JPDA 1UP6A 2WP8J 3ABRB 3GEHA 4MGEA 2LTAA 4YRRA 3K9CA 3DO6A 1IOZA 2QPLA 4JASB 5DI9A 5TQ0B 4MKFA 4JIMA 3FNRA 1NU6A 1KEPA 1UC9A 1HC7A 2H0RA 1W8DA 3OZSA 3VTZA 3IEVA 4E5YA 4E33A 2PZMA 1Z6XA 3FPBA 1QLWA 5JCJD 3W5CA 1NKSA 2PSEA 3UJ9A 3IAFA 4OBEA 4RD1A 1CF4A 1GAEO 2C5HA 4ZIRB 4P4UA 4G26A 4DRXB 4IMRA 5IZ4A 2IV2X 1I3MA 4XA8A 2G63A 4EKEA 2G82A 3IAAA 2Q3HA 4KGDA 5FTMA 3DZKA 2OK8A 3Q7QA 2OVFA 2B2NA 1ZCAA 1XGKA 1TVCA 2H54A 5B4UA 1PWYE 1TTHA 1FBNA 2AC2A 3EWNA 3RLFA 3LUPA 3ZWXA 3EA5A 4ARCA 4K6KA 1I2BA 3AEKB 2Y1KA 4H59A 4E5PA 2OXTA 2PSDA 3MOSA 3TE6A 1QQ7A 4ALIA 1A5TA 4Q0MA 1PFVA 3BORA 1M2OA 3O8OA 1KR2A 4BE4A 2V6IA 1CD5A 1AF7A 3RF6A 1TZJA 4ML3A 1VMDA 2PPVA 4L5YA 1ZN9A 4LUCA 1US8A 3EEBA 3HSYA 5IX8A 4QELA 1WM1A 1WS6A 1P1JA 4P86A 4HV4A 3FDFA 3AC0A 4TS3A 2DCUA 4X3CA 5COAA 4KI0A 1N2EA 2M1ZA 1E66A 2O2DA 3LC0A 3TKYA 5KYTA 2V5AA 4E4YA 3M34A 2RJNA 2G9ZA 1Q7TA 2J6HA 3O4JA 1NW8A 1YNOA 4KO3S 1W59A 1T29A 3DKKA 5K0BA 1YE8A 1EWQA 4ZOLB 1F51E 1CY0A 1VYHA 5FWNA 4RTMA 2FR8C 5A4KA 1PTJC 3PUVA 2RGDA 2DOKA 3CW9A 3K09C 3QW4B 4KMRA 5LA6B 1PVOA 2OCKA 2RSLA 1WEKA 5JBQA 3HHEA 1W581 1DX9A 3KLMX 2VUIB 5HA5A 3RYIB 1E8DA 1KSFX 1HPLA 4BUJA 1WCWA 3OKPA 2FCAA 3IKTA 2VBIA 1S3IA 1QMIA 2CNLA 3QE4A 1WMFA 3U5TA 2QUBA 2DPGA 4MVJG 1Q0PA 2OORC 4H7PA 1Z62A 4QPCA 4S3MA 2HXYA 2ONKA 3C7KA 3D8NA 3NDRA 5K0JA 4Q48A 2BONA 5ES4B 4GU5A 3FUXA 3I64A 3ECCA 4YRNA 3CNOA 4LOHA 2A8YA 5I5EA 4OHYA 4E21A 5ILQA 3KAKA 2HDHA 4B87A 1QE0A 2X41A 4D9HA 2ZIWB 2B35A 2EF0A 3FB4A 3EVGA 3RVBA 1MTOA 3PKJA 4HH3C 1CJTC 1EIZA 2CXPA 2HDOA 3ONWA 4KWEA 4UTRA 1NAHA 2GCPA 1J7JA 2HU7A 7MDHA 4MR9A 4C7OB 2F4VB 1YR7A 4R1QA 1R6VA 3OZUA 3VDMA 4JJ6A 5J5AA 4UPVA 2GVZC 3N74A 1PV1A 1E64A 2YMPA 1D8TA 3KRTA 1NVBA 221PA 1LX6A 2A84A 1B6GA 1GTL1 2Z3VA 1M67A 4KZPA 4HAWA 4IMJB 3COYA 3TOSA 3UWSA 4N65A 2OHGA 2RI0A 4LOAA 3RRFA 4COKA 1P6XA 3ITEA 3TSYA 2O5CA 2JCGA 1R4MB 2OGUA 3DFZA 1JSLA 2CYAA 1KU0A 3W8NA 4B6FA 3L9XA 1XVUA 3QVOA 2FWPA 3VR6D 1XZMA 2NSDA 4ZVRA 1O54A 2GLUA 4YROA 4FFDA 1M2NA 2J5RA 3I6YA 4WT7A 1CRWG 3GHYA 3UMSA 1BS1A 1PJRA 3C5EA 2EEZA 5CFMA 4RY8A 4CCYB 2CFRA 4ZJYA 5DMXA 4HADA 2GHIA 3LQ2A 4R9RA 1TK2A 3I73A 1RWBA 2X7JA 1YE5A 3DDCA 2M98A 1RI4A 4NMXB 1M72A 2P2CA 3GEBA 3I1JA 4LXHA 1ZM3A 3SQMA 4IIJA 5AQ1A 3P0IA 5LA6A 1FU7A 4Y6PA 1JQ5A 2JHGA 4OJQA 4I4CA 3E53A 1Z2OX 4GECA 1VFPA 4IXWA 5FV4A 3U2QA 6ADHA 4IFBA 2D06A 4LZLA 5AMXA 2PRJA 2GNOA 4M7WA 3EDYA 4OATA 1PS0A 2Z95A 3G13A 4YXWA 3W5BA 3G2MA 4ID9A 4OOFA 1JYEA 3M6UA 4Q4HA 3CT4A 3WMFA 2VBCA 3AVWA 4PZPA 3B5EA 5DYIA 3WO0A 4RPJA 1MU0A 1ZOPA 3AHDA 4X6LA 3EF0A 2MHCA 2C3MA 2HV9A 2PTHA 1RYEA 1YBAA 3IKJA 3P9XA 3N6XA 3BTVA 3LPLA 3F8SA 2FA9A 3K5IA 4K9PA 4R68A 1XZKA 1Z5GA 2VDWB 5LLSA 1SBYA 3QWHA 4UBNA 3H9UA 4WZBE 5C4GB 2DWUA 4EF5A 1I0ZA 1EUQA 5T6BA 1E6LA 1J5PA 2AUTA 1JQEA 5GJCA 1TJNA 3HXKA 3MIIA 5D8DA 2DGDA 2UVDA 1G8YA 5FV7A 2VXCA 2GT1A 4OLFA 3ONEA 4X7MA 2Q5EA 5KHOC 2D1RA 3NHFA 1C80A 3WRYA 2H2GA 4ARZA 5JCOC 3FOAA 3QSYA 1UMDA 3WLKX 4DLBA 1Z5WA 3Q1KA 3INRA 3GFVA 1YE3A 4M98A 2OT3B 4DTIA 2BKVA 1B1CA 1P2TA 1JR3E 3IR7A 2WJPA 3O8NA 5EGNA 4CF6A 5CITA 4YX9A 4AQ7A 1MX9A 2FQWA 1CR6A 2F9LA 1L7BA 3BZWA 3H0EA 2R1VA 4RO0A 3EXHB 4REMA 2GVNA 3PFBA 2Z9BA 4NMWA 2KBEA 4JWKA 3ZWYA 4E22A 4Z9XA 4EELA 3KPYA 1OR8A 1U7WA 1BN7A 1HA3A 3R0VA 2B1QA 2QN2A 3KT3A 1WW8A 4TZ0A 3LZDA 1GA6A 4HJXA 4BLTA 5ALJA 3CPEA 1REQA 3A0UA 3CNLA 3AM5A 4ZYTA 1GZSA 3LUAA 4YCSA 1U63A 3FG9A 2HF8A 5AQEA 3B1KA 4HLUA 5FA5A 2QG9A 2FXVA 1U80A 1BXRB 1QRUA 1M2EA 1E69A 1EH5A 1TI7A 2ZJ4A 3R6DA 4O2AA 3JSXA 2HHAA 3R5FA 4HX5A 2IXAA 3AKCA 4GC9A 2XLBA 1CVIA 3B3AA 2XT0A 3DH0A 1C8LA 3QYFA 3R5JA 5JDCC 4ENPA 5I4BA 1JB9A 3WIUA 3CVXA 3EGDB 5JY1A 1YK0A 5FPQA 1OIVA 1UWLA 2JK0A 4O2BF 3P0HA 4XGRA 1FQWA 1VGQA 1TAUA 4HGZA 3HS3A 4LRXA 4RJJA 2WWTA 3GZ4A 3JQ9C 1QH1B 3JXEA 3NB0A 3FHOA 4YN3A 3RM3A 2F3QA 4E09A 5SYMA 3ASVA 3DTTA 4BNDA 2O8BA 3FJ1A 1EDBA 2Z6VA 4RJKA 1OYVA 2C8JA 4E03A 2ZI6A 1TADA 1RM4A 3KPUA 4YHBA 4KE9A 4JU9A 3A1VA 1TYCA 2XRYA 2QUKA 4N3AA 3I04M 2IXTA 3LWNA 3UATA 4N0QA 4C7OA 3CEAA 3IH5A 4UCXA 2C95A 5AJHA 4B6QA 1MXHA 3FYUB 1WXEA 3JRWA 3QKTA 4XD7A 3F4LA 1GPMA 1V8ZA 4GMHA 4PG6A 1GTMA 5DK4A 4O8CA 5LSAA 3MWKA 4RV4A 3BTOA 3L1HA 2LCFA 2P79A 1EJ2A 3IOCA 2PEZA 3GA7A 2E4UA 4RGQA 5FHRA 4PYRA 4C03A 4N40A 1UANA 2Y1EA 1KZGB 3R0ZA 3W1VA 4A3SA 3KZVA 4B4VA 1YAHA 4F84A 1U4OA 1VKRA 4MI3A 2Q0QA 3LFTA 4P2BA 3NIBA 5E7IA 2AUNA 3D7NA 3CEHA 3JALA 1I3OA 2AMYA 4J9VA 2I99A 1CUJA 3H0CA 1XVIA 2RGXA 4RA6A 1RRVA 3BILA 4X1IA 4YYEA 1JKMA 3HYSA 3B2NA 5E95A 3WS7A 1UKYA 2HSZA 3IIEA 2MYPA 2ZE7A 5T4BA 3OLYA 1G6HA 1CUHA 3HFGA 5AVQA 1FZTA 2CJWA 3AUJB 4XSVA 5M04A 3V7YA 2XZOA 4TXMA 1VJRA 3BCSA 1U8AA 1DBRA 1GPUA 1IN5A 2WNIA 2B92A 2XQKA 3J81A 4FUTA 4CMKA 1QGOA 3ODPA 4KXQA 1TLFA 4AS3A 3PQVA 5BWCA 4MUMA 2J31A 5JNRA 2VRNA 3OLZA 1FMFA 2CJWB 3ZWAA 4FIZA 1ACJA 3SFZA 3ETNA 2VAXA 3CVWA 3AUXA 4LPSA 4BVHA 3NIGB 2DTDA 1GILA 3KGDA 2HF9A 2IPAB 2YOGA 1P4JA 5KMGB 4JROA 2ZBVA 2IDMA 2ZJZA 2C5LA 3F3MA 4M0MA 4N9QA 5JO0A 1KO1A 3HFRA 5EJGA 3FUCA 5CXXA 4CIYA 2WT9A 5TQ2B 1VLVA 1B76A 2FWIA 1XTTA 5E6UA 4XUEA 5JOQA 3CUWA 3IUYA 1RABA 1X87A 2DE0X 2B4RO 2UYOA 1ADBA 3BTSA 4M37A 3GFFA 2HQOA 2XAUA 2C97A 2YMQA 3G5UA 5KNCH 3GLGA 1M5RA 1DWUA 4QFDA 4C08A 2NTYC 4X90A 1Z74A 5AHOA 3WO1A 1I6KA 1NIJA 4G01B 2IH5A 1E5VA 3N0VA 4CL2A 5J4KA 3DZCA 3ETCA 2XOXA 3P2JA 1U6KA 4CM4A 3LC7O 2HA4A 3PJGA 1WXHA 4DSTA 2NTNA 2JLAA 4ZVSA 10MHA 1EMDA 4MRPA 4KR6A 4C7XA 4Y2JA 4HLQB 2RHWA 2XMQA 3EH1A 3P9CA 5KNDA 1OB2A 1U8UA 2PBFA 3DEAA 3CCBA 1KQOA 5EN4A 1U0EA 2GYVA 4R2WA 2Q1SA 3KDAA 2QQGA 3QRWA 4NZZA 3RJTA 4DY6A 2G28A 4M38A 4CEJB 2GEVA 2MIIA 4HWSA 1WZIA 2VDVE 5I7OA 1X9IA 1NURA 2FHPA 3FIJA 1LNZA 5CR9A 3E48A 1KSJA 5ALLA 1KWGA 2ZVPX 5BSRA 3HR4A 4RCYA 4QGFA 3RKUA 5EINA 3AF4A 5IFLA 1JEYA 2YC4C 1E62A 5LP6B 4GPBA 2PQ2A 9MHTA 5DW0A 3QHQA 1PG0A 1PNQA 1R9GA 1YB1A 4BFXA 4ZYVA 5BN1A 2IJGX 2CNWD 1DV2A 1HXHA 2C4VA 1YASA 4MUYA 3MSCA 3QLUC 3RUHA 5CA1F 5BOVA 5BVGB 4CKCB 1G291 1NOJA 4BX9A 1RHJA 2YIDA 1J8QA 3L0IB 2FR1A 4O4HA 3BX1A 1Y89A 5JYDA 2OBNA 1ZIOA 1LX7A 4UDXX 1QNFA 4CTKA 3SWWA 1UPUA 4P82A 4H6VA 4HMQA 4ZOAA 2W4QA 2E2WA 1C4OA 2VYNA 4BRZA 4D99A 1ESMA 4G1BA 5K8LA 1H6BA 3SBOA 1ULZA 4UVGA 5B1DA 3CPSA 1VLJA 1D2RA 4A8JB 1TEZA 4PGAA 2P9HA 4EMUA 5EMMA 1BSVA 1WLSA 4C1BA 4WESB 3T5DA 1FW8A 3QXXA 1O4WA 3RJZA 1L7OA 5AW6A 5F7OA 3IMEA 2JI8A 5INTA 1XI2A 3H9BA 4TZ6A 3M5CA 3CFYA 2NO4A 5GVSA 5G2OA 3JQ7A 4M8NE 3KQLA 1ZL2A 3RBXA 4DHWA 1JAIA 4QGSA 4E31A 4KYUA 2CD7A 2HWYA 2V03A 1I6WA 5A3RA 2ZSBA 1UEIA 5KDOA 1QS0A 3CLUD 4MYUA 2FDCA 2RKBA 4D6YA 4I5IA 3OOJA 2B8WA 3WFIA 2CMHA 3C4VA 4E12A 1GPH1 3ED1A 1MF7A 4FYWA 3MEQA 1M1YA 3STVA 4DC9A 2AW3A 4M1ZA 3N8KA 3E2IA 5CRIA 3KK0A 1ZFNA 3GZNB 4JVMA 3WK8A 1Z4MA 2Y71A 2H7VA 1GDHA 3AHFA 3RQIA 3RFVA 1B26A 5DBOA 4LHWA 4RVHA 1YZFA 1XRPA 2RK6A 4KXLA 2A0KA 1WF3A 4DQVA 5JSHA 3MRVA 4EDHA 2X0JA 4WVFA 3JD4A 1E6UA 3AJAA 3H84A 4KRYA 5B53A 4F9FA 4JITA 5A7FA 1K89A 3QU2A 4KIFA 5TPZA 1CTQA 1LFAA 2OHXA 4M9CA 1PNTA 2IGTA 1K68A 3ZDXB 3RK0A 1TT7A 2E4AA 2Q4OA 3GDWA 4UU1A 3BMQB 2HRZA 1WKCA 4HB2A 3H17A 4PANA 4XKJA 5T3YA 1SKAA 3HXOA 5CDTA 2GBLA 3GT3A 1LI7A 2P62A 2V7XA 2WZBA 3SHOA 4RZXA 3EC2A 5AT1A 2PYZA 3F1KA 3O92A 2PD4A 5KSYA 1Q2XA 2A57A 4NZYA 1I94B 1EQUA 4FB5A 1L4MA 3H1AA 3N86A 2BGWA 1U7PA 3GLVA 1YIDA 4KQ1A 4F5WA 1P5HA 3FXAA 3WK6A 4YCLA 4MVJH 1U7UA 2PGNA 3GZJA 4HY3A 1TZKA 5KNBH 2PCJA 1Q7BA 4OLJA 1V9LA 1QBGA 2A30A 4AX4A 3N2YA 4R8SA 3T3HA 2CYCA 3AGPA 1E2JA 3MCTA 5EE5B 1XC7A 3IAHA 3S99A 3LPCA 4CKWB 4I6GA 2G1AA 4Y1EA 3T7AA 3LCUA 4B7CA 4BNFA 2I29A 1I1QB 5IBPA 4M7RA 1E9FA 1FVXA 1SM4A 1Z6ZA 2EP8A 4PPQA 1W1UA 2GTIA 3LX4A 4DPLA 1U5BA 3PYMA 3UXEA 2C0CA 1MPXA 1V6CA 2J9FB 2G09A 4UAVA 2ZZMA 1HWYA 1K9SA 1IZ7A 1SHTX 2QT1A 4KLZA 4W1QA 2Z6UA 3LK6A 2YW9A 2B1JA 3X2EA 3GLGB 3ZEIA 2ONCA 5U9CA 2HA2A 1LDMA 2JGFA 3MGAA 5AWFC 1USKA 1T4MA 5JTTA 3OIVA 4QDOA 3RSLA 1RRFA 1Y4DE 3PCRB 1CE8A 1G4HA 4IQFA 5HCNA 4CODB 1KH1A 3C3EA 1M33A 2JIPA 3ADOA 3RG8A 3RO7A 4A5SA 4TYMA 4O1IA 3CNQS 5D86A 2I66A 1OGYA 4QDUA 3HDQA 3A2LA 3S5JA 2GF9A 3EVZA 4FNAA 3WQQA 1HL3A 3I0NA 4BRSA 4F86A 3M5PA 2FP4B 1DHRA 4L4SA 1RM0A 2BR4A 2VFAA 4AO6A 5L4LA 4R0NA 3A6ZA 4KSBA 4IGKA 4IH1A 2R7LA 3VR5H 1M76A 1TCAA 3FWKA 3I28A 3LXXA 4KIGA 1XL1A 3LTEA 4RTQA 1NBOA 3FSGA 3KYCA 4RY9A 3QZUA 1L7NA 2AZTA 2HN9A 2VJLA 1O9BA 1JECA 2FE4A 4YONB 1XN4A 4AZ3A 5A4JA 1O97D 4OF4A 2WSBA 1QDUA 3MRXA 3U3XA 4IWYA 4C4ZA 5MF6A 2V97A 4OU4A 1EB9A 1Y4UA 2Z4RA 3M70A 4MW1A 5MHTA 5JJKA 3I9NA 3KR9A 1QFXA 3GCWA 2XHEA 4ZDIA 4QUJA 1OAAA 4J4TA 1LLDA 3LU1A 5KC9A 5JV5A 1DOHA 3G2PA 3PXBA 2CJXA 1P1FA 2UV8A 2RB5A 3PLRA 4Y9TA 2C0PA 3U7IA 1F2DA 4AM8A 4N7RA 4RQBA 2GPJA 3OTWA 1ZWKA 1B8NA 1ZVMA 2FF5A 4P98A 3BFVA 4WZ6A 2PUAA 2GVDC 3MMSA 4H9GA 4J75A 3L8HA 5AXCA 3PWSA 3GF4A 3NORA 1VCHA 1OX5A 3DOFA 3KIPA 2H3HA 3A7DA 3C8HA 5C8YF 3O8QB 2ZRKA 5ILGA 1TVKA 3G9XA 1WUTA 3OVMA 3BB1A 3IGFA 2Z58A 1YF3A 5BN3B 3VKHA 1W47A 4Z6KA 2D4HA 4Z7OB 3N2IA 4ZO8A 4OXRA 2NZYA 3DF9A 1RBYA 3NM6B 4RA9A 4YIKA 2BFBA 3X3HA 2WLSA 1OWOA 5IH7A 2OXRA 4RE5A 1ODTC 1LPPA 3T61A 3HJGA 3JWIA 5M2QA 3HR7A 3E8MA 3K1YA 4MMYB 4O0LA 4RIEA 3VFDA 3AV0B 1A04A 4AFNA 3NP9A 3GT0A 1JKJA 1G5QA 2QW8A 1LBHA 3W3AA 1NF8A 3GY0A 4N7JA 4UBMA 2QVXX 2J3EA 3LGAA 1FCJA 2A9JA 1K75A 2QYTA 2ZJ2A 1VE5A 3WWDA 5AM2A 3KQQA 2C3PA 3G2NA 3NJ8A 3WYGA 2AJLI 4BVJA 2N75A 3VPAA 4JJ4A 1C41A 1T2AA 2OR3A 3NTLA 3KQUA 2G76A 1WABA 3CVYA 4B6OA 1USVA 1NZFA 3MUFA 2PWPA 5AM0A 2J6IA 2L2QA 1TMYA 3UEOA 1EE2A 4AKHA 4O63O 1D9ZA 4CKEA 5KVAA 1KP9A 1NPYA 3DDZX 3ZWNA 2PGLA 3D8RA 1O6ZA 1U7ZA 4TMTA 4TKLA 1ESEA 5HNKA 3M6XA 4R2LA 2P35A 1V0JA 6REQA 3KOMA 4HAIA 5EI5A 1QU3A 1DDIA 4PYJA 4RJ2A 4B75A 1LEHA 1JIKA 1OAOA 2O1WA 2HQBA 4CCWA 3PEVA 2WPDD 3QX7A 1IAQA 4FN4A 2JGRA 3LC1O 1Y1TA 2HGZA 2X5XA 3LE8A 2D7JA 2QRVB 3ENWA 2I2FA 1XQ6A 2ZSKA 3AFIA 4L8YA 2J4CA 4M0FA 5AK6A 4DR3B 4TYYA 4I55A 1VHDA 1ZH6A 3CUYA 1HG0A 3ZLBA 1AQLA 1NUQA 2QQEA 5LJLA 5A0VA 3L84A 1N3LA 3QNUA 1OX6A 1IUPA 1P72A 3DQZA 1D5CA 4MZXA 4RORA 4Q7LA 1UBSB 4HNAB 3VZBA 1CUCA 1SFRA 2PX5A 4EI8A 3AQ4A 1V2GA 3L79A 1NYQA 3K20A 1Q0ZA 1XMOB 3VHLB 5LBIA 3I1FA 3W1EA 3O6VA 1DXQA 3MCWA 4HDNA 3OOWA 4WSOA 4E70A 4CGZA 2IZOA 2CV1A 1OJ7A 3FKSA 4AULA 3L0CA 1ZIXA 4MCHA 3UCXA 1TF2A 1IN1A 3DS8A 1ZY2A 3OKCA 3VZSA 1B8VA 3PWZA 3JVEA 2D3WA 2W2VA 1ICEA 1PFKA 1T8RA 3ONNA 3HKDA 1T25A 4U5QA 4BNJA 2LUOA 5IHPA 4PXYA 2A5YB 4H7EA 2D0PB 4LE2A 4NICA 4DNPA 2DVMA 4IIUA 1JU4A 2D0OB 3AZPA 3VU9B 2UYHA 2O3QA 4C9BA 3CY6A 3P9ZA 5E3HA 3PNOA 4KLAA 1J9EA 3G9UA 4BKQA 4KQFA 1PRYA 4OA8A 3PB3A 2LV8A 4YP5A 2PSHA 1JN0A 3ZDRA 1HDYA 1KFCB 1L8XA 2EZ4A 1KO7A 1DUSA 4ONEA 1PJAA 1DC4A 3CCCA 2QSYA 3JAKB 3D0OA 4MKRA 2VP0A 3ID6C 3QBTA 4Y0NA 5ERYA 4XUCA 5CVTA 5FEUA 2XZLA 4H7KA 2P3QA 1F0NA 3PUIA 3R40A 3B5JA 4DLTA 2GKSA 1C9DB 3R7WB 1NIPA 3NX4A 4QRIA 4CIWA 2X9GA 5KQMA 3EHDA 4I1VA 1RQPA 3UFBA 5IVHA 4NBVA 4XM0A 4P3OA 4JI6B 3T9BA 1LV7A 3KYDB 1FMCA 3CKMA 1H2ZA 4QTYA 2ZDGA 4ANFA 4B32A 1L7AA 4PZYA 1AUOA 4EB3A 1RHRA 1Y1SA 2C2YA 5D5HA 3T95A 2HWWA 4YMWA 3I6IA 2DFVA 1J5EB 3QI2A 3RYCB 3LVBA 3A3YA 4W7IA 5D6OA 3QKRA 1ZK1A 3LX6A 3C6ZA 4Y1RA 1M2HA 1OHHD 3FTPA 3RT9A 3MUNA 2ZJ8A 1P75A 1WD5A 2AI1A 3ZTWA 4CLRB 1CRQA 4HRXA 2GRUA 4Y9SA 5CM2Z 1V7CA 3E7XA 1Z12A 3PA8A 4QVKA 2YUTA 1JSRA 1NF9A 5FL7A 5I51A 1MDFA 3BB4A 3AV3A 3OEHD 3QKUA 3WGKA 3TDNA 2UAGA 4LTDA 3RU9A 3VDXA 3DHYA 5CBKA 1V26A 1Z16A 1GFZA 1L6RA 1HF3A 1XXHA 2A0FA 4E3ZA 1M8GA 1VI2A 1I2CA 2DRIA 3AEQB 1Z5UA 4OMUA 2YIVX 4E94A 5L3QA 3I6BA 2PQMA 1XPUA 1PZHA 1WL8A 2A3NA 1M0EA 4BN0A 4KJZA 1D2EA 1NDUA 3W2EA 5HS6A 1MOQA 1JJVA 1LI5A 5CBPA 1BMFD 5HX7A 1PL8A 1A9XA 3AVVA 3EGCA 4LWZA 1C7QA 4WOCA 2E5LB 2ZI4A 2B83A 3RYFA 3CEJA 3L93A 3Q41A 3ZD6A 4RTPA 5AVZA 5DULA 3PYXA 4UVIA 1BFUA 1RFGE 3AB3A 1XTJA 1FSPA 3V1TC 3H5AA 5SZHB 2NSHA 4MB6A 2FMIA 4HZUA 4O4LB 2CE2X 2IQ5A 4KB5A 4B3JA 1C9NA 4JUIA 4CUJA 4EMTA 1OWPA 1PN3A 2GUGA 3KQYA 1ZZEA 1B6TA 4IJUA 4QPZA 3P20A 1G8SA 3A2NA 2XTJA 1ZU4A 2DKOA 1YZYA 1L3IA 1XF1A 3F78A 3GRPA 4RVGA 1JNXX 4XYGA 1V8BA 1L5LA 1SU6A 3L5OA 1S2MA 3AUUA 4WKBA 4C6TB 1CP3A 1Z4PX 4IUYA 1QIJA 3IE0A 1MJGM 2BP7A 2HI0A 4QJIA 3IWBB 1JU3A 1WPRA 3O95A 4NV3A 5LKAA 4GH5A 3JASB 3CF2A 3I3SR 1WP4A 3NTXA 4X8OA 6REQB 1A98A 4JYCA 2VA8A 3W6NA 3STUA 3RKSA 3K3PA 2O8EB 4ZAWA 3R20A 1NT4A 1JJIA 1HNNA 1QZXA 4WHMA 5BXYA 4JVNA 2YV2A 4ZMBA 1Z5NA 3WA6A 1ZJYA 1OFGA 2B5WA 5EMKA 2FPRA 4KJXA 3HSSA 4GBED 4HDQB 1SOVA 3LCMA 2YTZA 3R24A 2G9NA 2BGGA 3O75A 1SBCA 3ZE7A 3A6HA 1ZHFA 1II0A 2GM3A 4L3WA 1QTRA 2GEDA 1Q74A 2VQDA 1E6KA 4LJLA 4NJEB 4P7FA 2QV7A 1EUZA 1UBGA 3AF1A 3DPSA 3R6TA 2AFIE 5DYTA 4QNRA 3MLBA 4MDHA 3ORRA 1IBKB 3UK7A 8OHMA 4U63A 4MHOA 1B43A 4WBNF 1GGHA 4M1KA 4B80A 1YZTA 1PD0A 1RYDA 2R8BA 1G3QA 1GYRA 5LZ2A 4QX6A 1IAVA 3M5DA 4BO5A 4CF7A 3AZQA 5L9AA 1JNYA 1ZI8A 2IU0A 2FSPA 1L4HA 1T5LA 2PJZA 5F64A 4AG6A 1VYVA 1VJCA 1KJWA 3GJ0A 3BBPA 4AKGA 3IYLW 1F5SA 3ZOZA 4A73A 5CURA 4WPGA 2FSHA 4B35A 3QV1A 1U8XX 1L2TA 1BDJA 1P7PA 4GOOD 2PQ0A 4FFBB 4BUZA 4EYQA 4JFRA 4LFBB 1S0UA 4HMOA 4NX2A 4QTUB 1Q1AA 3PICA 2PJDA 3ZTYA 3S8EA 3QUBA 1N2BA 4CETA 1U2GA 1YH3A 3NU1A 1XA0A 2ZVJA 3KOOA 4ZI7B 1L5VA 3WZ2A 4FFRA 1HL7A 4KHZA 2VP6A 4BBPA 1N33B 2JW5A 4K9DA 2WWIA 3L6RA 1SZPA 1R1DA 1KPIA 2OHOA 5ICMA 3WLRA 3KL4A 5I45A 4GQAA 1RAIA 1V3UA 2W11A 3DAOA 1ZOSA 3H11B 1KDOA 5CDUA 1T91A 2WM2A 1KVTA 4B6PA 5IC4A 4BN5A 2BZ1A 1XZHA 3D2LA 4NU0A 4PYKA 1SR8A 5BNIA 2VJAA 2Q9BA 4GSKA 3OIFA 5AXBA 2OXIA 1ZOOA 3GLUA 3ILSA 1A88A 2WJ6A 4K3VA 4Q1DA 1YBVA 3EPPA 3E70C 3ICEA 1ZI9A 1ZA1A 1XLTC 1MB2A 4P7JA 3RI3A 3RK4A 2IUUA 3CEPB 4XTRA 5DXJA 3U4AA 1AUVA 3KBOA 3TTUA 4DLLA 2XCOA 2R1TA 1GGKA 3U7FB 4DFDA 3GPLA 2BLNA 5KDDA 3GLGE 2N47A 4FDLA 5BWMA 3SZMA 4DGQA 2R96A 4FOSA 3NIDB 3TLYA 2B1IA 1Y4ZA 2FYTA 3JQ8B 1DAOA 4FWBA 4DLZA 3ZX4A 5EIXA 1GA1A 3RBVA 3AYZB 1DVRA 3TPCA 1DAMA 4LDZA 5G1PA 4TWRA 3NTUA 1U4NA 1MO2A 4CMEA 1FFXA 4F96A 3KWFA 1SQ5A 3LYLA 4LCBA 5BMVF 3PVSA 5K3AA 3REFA 2AMJA 2V4ZA 3RUFA 4PCVA 3K8QA 3CLKA 1E5QA 1ENPA 1QCYA 5KX5B 5ALPA 9LDTA 2BM8A 4PSUA 3RRJA 4EYEA 4NS1A 3B20A 4M36A 2BFMA 4PLVA 4DRXA 1XZDA 2W58A 1ZJ4A 4DEYA 1UMKA 5T4FA 3TM5A 5HKKA 3BVPA 3WTBA 3J80A 3IQXA 3CUVA 1N2SA 2O5RA 5EHIA 1YRWA 2EWMA 1A5BB 3I34X 2OSVA 5EKXA 2JZNA 3CBGA 4RPKA 2E0IA 4Q1EA 1KFBB 1JQ3A 2I65A 2YHBA 4AYTA 3QKIA 3M1IA 1JTVA 1EQ2A 3MQ4A 4HRVA 4A0SA 3UAZA 1HT1E 3VTAA 4D8YA 3IJRA 4R2IA 5EJ5A 3JPYA 2MINA 4N9WA 1R12A 2GK7A 2COUA 5DN6D 5REQA 4NH4A 5LPNA 1SXPA 3AI3A 1CBUA 3OX3A 4N5LA 2JLXA 2O20A 2ZXFA 1KI7A 2GN6A 3EPRA 1PS8A 1JWBB 3B13B 3ZDQA 2ZE8A 3IBTA 2AFHE 2P65A 3O4HA 3ZY6A 3E9YA 2XUHA 1MUUA 2NV6A 4G0XA 2VAPA 2VTVA 3I2FA 2AQKA 3P9KA 2JF0A 3BSYA 5DV9A 4YJ3F 3DE4X 4GLJA 2H2AA 3ZH9B 4A10A 1R5JA 1XCOA 3KVNA 1IOLA 4OQYA 2BAGA 2WABA 3TUXA 3RUDA 3PFWO 3CH4B 1ZOIA 3HA5A 1FXWF 3ZK9A 2ERYA 1SZDA 2OUIA 4KR3A 2W83A 1NDQA 1RYBA 1KNQA 1EEXB 2YDYA 1TW3A 5KVQA 2VXYA 3KQWA 2IF0A 3QQ5A 4HUJA 1U2ZA 4DLUA 4US0R 1S2GA 4EG3A 3N8GA 4K9OA 4AJNA 4LTMA 3NNDA 3SHTA 4CTOA 3AESA 1ZU5A 2F4NA 3H2ZA 1T10A 4KQ6A 2SBTA 1XU7A 2FSIA 2XUQA 4L28A 3U7RA 4BBAA 2QM0A 4KXXA 1TMKA 4UASA 5A1JA 3LCVB 5D87A 3SKVA 4BYMA 2RGCA 1C9KA 2Y93A 2TMKA 1ZBQA 3G8YA 3ND7A 5DEIA 5FTLA 5CLIA 4ZCTA 1K8ZB 4HFJA 4TQAA 2EYUA 3MA0A 2WYVA 3FY4A 3BWBA 1QG4A 2I3BA 1RLMA 1VXRA 3FDJA 3CZCA 3KVOA 3ME5A 2QXUA 1RIFA 3GXOA 3EXFA 1S9HA 3N58A 3NNSA 4HB3A 3NCHA 4HNUA 1RIIA 2DR0A 3ZZTA 5AVSA 1L1EA 4N48A 4EYKA 4V02A 2FG5A 3KUCA 4EY6A 5C5CA 1T8PA 1N6OA 4XIIA 2OO3A 8GPBA 2ZXEA 1B41A 4M0LA 3JAWA 2YN4A 1SUAA 4YHHB 3ZWOA 1NMQA 1SXIA 3ISTA 1R88A 3WLHA 1Z6QA 3LFUA 1H2YA 1IXRC 4OQ4A 4ARAA 5I48A 3DR3A 2WVAA 3KKKA 1TA4A 5DCUA 4TZTA 3T9AA 4Z4EA 3DCNA 2ZBEA 1HO3A 3D0RA 3KJQA 4HDKA 2P68A 3CO0S 2FU5C