1H9BA

Active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
total genus 173
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9bA01
1PSDA 3G79A 3DDNA 3RIHA 5B4VA 3PXXA 3JSAA 3GUCA 5AOVA 2Q4EA 1SEVA 2F00A 3DZGA 5KJ6A 1GTMA 3V8BA 1YONA 5TF4A 4BB6A 4CODB 5KIAA 1DRVA 1B26A 1O9BA 5G2OA 4CUKA 2Y1DA 3PZRA 1QR6A 4BNYA 5CDSA 5C7LO 2ET6A 2OGUA 1Q2XA 2Y1CA 4YT8A 3O4RA 4TKLA 3FBTA 1HYGA 4J6FA 2GO1A 3V2GA 3JTMA 4PZDA 2WD7B 3L4SO 1ARZA 1MA0A 5IN5A 4I1IA 2UVDA 4NK4A 2EXXA 4E5KA 1C1XA 2Q2WA 3MOGA 1UH5A 4LISA 2ZB3A 1GYQA 5GZ1A 1ISJA 4GGPA 4O5OA 3FHLA 2P5UA 3VH2A 3GDGA 1T2DA 4BNVA 1Y1PA 3PYXA 1AHHA 4J0EA 3HE3A 4IDAA 4CLDA 1P44A 2FRDA 5KJCA 4TSKA 3DAFA 5A3JA 3OF2A 1FJHA 2AQHA 4ZHSA 3F9IA 3OM9A 4LSWA 4M89A 1MFZA 4RQUA 5I7EA 3L77A 3T7EA 2J6IA 3VZSA 9LDBA 3QY9A 2TMDA 1M76A 3LK7A 1YBVA 3ROPA 4AJHA 3RI3A 3A9WA 1E7SA 3ZNPA 3ONEA 1P45A 3MTGA 3PFFA 4M49A 3HNPA 3GZ4A 3GC6A 4CMHA 1A4UA 2O7QA 1PIWA 5H81A 1P0FA 2BH9A 1H6DA 4BO7A 1SC6A 2ZYDA 4MVJH 3TZHA 3IMFA 5A9SA 3L4BA 4W99A 1PJ4A 4CR8A 1DHTA 4TZKA 3JQEA 3BHJA 4I8XA 1ZK1A 5CG2A 1SOWA 2O3QA 5THKA 3JYQA 1CJCA 1E6WA 1SMKA 4MPDA 4TRNA 2PWZA 3KM0A 1F8GA 3F4BA 2B0JA 3LZ6A 4GMFA 1I0ZA 2VWGA 4PLGA 4R41A 1BDMA 1PU2A 3DHYA 3NTOA 5FEUA 4XYEA 3IOYA 2WSBA 3DOJA 2PZJA 2ZK7A 1E7YA 2C7GA 2H6EA 4HNHA 1QMGA 5IAAA 5JO0A 2D5AA 2VWPA 1VC2A 1HDOA 4XQGA 3LYLA 4C7KA 2H1SA 1KYQA 3FPLA 4HADA 4TVOA 2NVWA 3FD8A 4PCVA 5G0SA 4R16A 1BXGB 4BB5A 1PS9A 2EV9A 3C7AA 2Y05A 4RLHA 5JE8A 5JCXA 1YBMA 5DOVA 3PIIA 2J8ZA 4W7HA 1JW9B 2ZJ0A 4OL9A 3RKRA 3NAQA 3ZWOA 4J7XA 4UVIA 1IHYA 3W4IA 5L7TA 4DC1A 4MIEA 2J3HA 3PHJA 3NRCA 3D0OA 3ON5A 3E18A 1JVBA 4JIGA 1OI7A 4Q3CA 3JD3A 4KWHA 1RPNA 2ZATA 4AG3A 2OOSA 5EQDA 3C3XA 4AJLA 1LRLA 2X0JA 1TT7A 1LDMA 1YBAA 3TZKA 5DBFA 3SEFA 4BGVA 3UVEA 4MKXA 1OFGA 2YW9A 3TZCA 5JS6A 1LLDA 4N5NA 1HF3A 1S6YA 3FTNA 3OIGA 4HFNA 2Q4BA 4Q3NA 4CJXA 3DOOA 3ANMA 4JP3A 4ID9A 1SAYA 1VL8A 1XEAA 1E3EA 3GMDA 2IXAA 3JQBA 3KXDA 1I36A 3I9OA 1HTBA 3ZH2A 4U0JA 1K6JA 4YRBA 3HUDA 4NBTA 3U5TA 4WASA 2BHLA 1GEGA 2PV7A 4DIFA 1IB6A 1WWKA 3AI1A 5EMHA 3PJDA 4INAA 1U5AA 1Z6ZA 3ZN2A 4CV3A 1GPJA 2G5CA 3QVSA 1PGNA 2I76A 3VDQA 3JQ8A 4IY1A 3VPGA 1DIGA 1KY4A 2XXJA 2DUUA 1PJTA 3ROQA 1CIVA 4RF3A 4AJ4A 3L6DA 5BNFA 1H2BA 2PFGA 3ETDA 1XWFA 1F12A 4HKTA 3WYBA 2D1YA 4CMIB 1Y6JA 3K31A 2DC1A 2VZ0A 3ADOA 2QRLA 5THQA 3PJGA 3E9NA 5JAMA 4A5OA 4OO3A 4L73A 2FPGA 1Z7EA 3HB4X 1TT5A 4S3MA 4XWYA 4BNHA 2AE2A 3D4NA 3VOSA 2IEBA 1FDVA 4IMRA 5C5IA 2QZ9A 1ZEJA 2Y1FA 3HDQA 3IIEA 2Q45A 3QWBA 2PKRA 3NGXA 1D1SA 3KZVA 4RORA 4R1NA 3Q9UA 4R1TA 4EJ0A 2I99A 3TN7A 4DTIA 4QFDA 4O1MA 1E1KA 5JCJD 3MJEA 3AU8A 2A9FA 1DSSG 1JWAB 1XU9A 4N5LA 2I6TA 5A5EA 5J23A 1SBYA 2VTEA 2NVUB 1Q1NA 5C37A 4NJMA 2P5YA 1YOVB 4R1UA 4IIUA 1E3WA 3CZRA 3VAZA 3C7CB 3AUTA 3MEQA 2EEZA 3T4EA 1Z82A 4NBRA 4J7CA 1LDYA 2ZYGA 1NQAO 1R16A 5EL0A 4BO6A 3PP8A 4UVEA 3O03A 2DBZA 2G76A 3F47A 1GZ4A 3OQ6A 2FR0A 5L3ZA 2YYYA 1ZSYA 4TWRA 3DEYX 3GVHA 2GUGA 4JGBA 3OJEA 4TZTA 2GD1O 4IJUA 3WFJA 1DXYA 4UUOA 3GEGA 1MXHA 4ZJUA 3NKLA 3TNLA 4CLOA 4QECA 5HS6A 5B4UA 2JL1A 1HZJA 1M75A 2Z1NA 3EW7A 1HDYA 1YS4A 1KY5A 1B8UA 4ZVVA 4AFNA 1A72A 1QYVA 5IFLA 2NTNA 1EFKA 4H7PA 3WNQA 2CDAA 1E0DA 4CR7A 4D79A 1ENYA 3DMYA 2WMDA 4CLRA 2DAPA 4JP2A 3CZMA 2VT3A 2PLAA 1DFHA 4UEOA 3VH1A 5EERA 3QIVA 3DOCA 4QXMA 2YFHA 1ENOA 4LK3A 4YR9A 4ND1A 1NX6A 2AEJA 4DIOA 3JQ7B 4A0SA 3ORFA 4L4XA 1VRWA 1F0YA 2BMAA 2OMEA 1X15A 3UOGA 4AICA 3BMQA 4EW6A 5IJZA 1W4ZA 2HLPA 2PTGA 4LRTB 3ZWXA 5JY6A 5ENVA 4ND4A 2X7HA 4FD3A 5JDCC 2A94A 4TROA 2ZTUA 3TQHA 1XQ6A 3KEOA 2EHDA 1HDXA 1QYDA 4BNIA 4EITA 1QP8A 2OL4A 2R6JA 4ZQGA 4JN6B 2BI7A 1PWXA 3T4XA 5EIOA 3X2FA 4BQRA 3AY6A 4TRRA 2PY6A 4AJEA 4Z6KA 1EMDA 1W6UA 2FPPA 1D3AA 1YQXA 3GG9A 4R9SA 4WCFA 5FWNA 3CINA 3QV1A 5J9GA 2IZZA 4IXTA 4I9UA 2CVQA 5IXYA 1BTOA 4GQAA 2Q1TA 4OXYA 4RDIA 2C5EA 3EVTA 5JAIA 5TJ9A 4NFYA 2AXQA 3AWDA 3BMNB 3UAGA 4PGFA 4XRGA 8LDHA 1QLJA 3ZWBA 1LNQA 4CV2A 4YAEA 1AE1A 1ZNQO 1C0LA 3DBLB 4P4NA 3OECA 4W6ZA 1NVGA 4YJHB 1Y5RA 4BOYA 3ZHBA 2FHSA 4XJSA 1K89A 4JXKA 1YDEA 3MOIA 5DP2A 1T2CA 2O3UA 3M1AA 3F5SA 4IDCA 3TL3A 3U4CA 2I66A 1WVGA 4ND2A 1TLTA 2G0TA 2DVMA 4YCAA 3ROMA 4RCVA 3GHYA 4BGUA 3GFBA 2RIRA 1H2HA 2OUIA 4BO4A 4E13A 4BNJA 2I65A 1I3LA 4GX2A 1U2DA 2FR8A 1R6DA 3FRJA 5DZSA 4AJKA 2EGHA 3OIFA 4PLTA 2JCXA 2I3AA 2OBYA 5DP1A 4CQMA 4AL4A 5T64A 3KLPX 4PVDA 4ALMA 4XJTA 1XELA 4BO5A 5JLAA 1N9GA 5L4LA 3OSUA 3CMMA 2Q50A 1GL3A 2Q49A 1QSGA 3CUKA 1H94A 4KP7A 3D4PA 2X0IA 4URFA 4J43A 3T7CA 3NT5A 1LSJA 1QRRA 1SO8A 4QT0A 5CG1A 2B37A 3F3SA 1UJMA 3DBVO 3OJFA 1VSVA 3WIDA 2JFGA 3K73O 2ZYAA 4FFPA 3BA1A 1HE5A 4ALNA 4GX5A 4OSPA 3BMCA 3R0IA 3FNFA 4JJIA 4XDZA 1PS8A 3RFVA 5HS4A 5JC8A 4WE3A 1GYPA 4RDHA 5IDXA 4FFOA 2J3KA 3RBZA 3DXFA 4ESOA 4FW8A 4QTZA 4ZU3A 1GFSA 4NR0A 3VZQA 2O3RA 3FWZA 3DTYA 4MVJG 3WG9A 4NBWA 3D3WA 3DZKA 3WX0A 1K6XA 1DIRA 2X5OA 1B15A 1B14A 2H9IA 4LVCA 1GEEA 1I3NA 4FBGA 1N8KA 3ZWWA 3D5TA 3L9XA 5DDIP 3JYNA 4BGEA 5DBIA 2YY7A 3GRPA 2B35A 2WD7A 3HDHA 1XLTA 1B7GO 3SVTA 3DQPA 5IDYA 3S2IA 1VL0A 1NPYA 1LTHR 2CY0A 4A26A 1T1SA 2W2KB 2B69A 4PRLA 1Y8RB 4K28A 5A9TA 1P74A 5CDGA 1E6UA 1W73A 4BVAA 2IYPA 4F46A 4GLOA 4IJVA 5K0ZA 1P1IA 4J91A 4KOAA 1DPGA 1GR0A 3U49A 1Q0QA 1HDZA 1EVZA 1PTJA 1NR7A 1DIBA 3OA0A 3KSUA 3WLEA 3QE3A 5TT1A 3E6AA 2JFFA 3ANNA 2VN8A 3RFTA 2C82A 3L6OO 1B0AA 3Q11A 1ONOA 1XIVA 2AQ8A 4DVJA 5L51A 4WECA 5I7VA 3HDYA 1C0IA 3ICPA 5TRTA 3OA2A 1WDKA 4EUEA 5HA5A 3AJRA 2EIHA 3VPFA 3HN2A 5F1OA 3WMWA 4PG4A 3DHNA 3GZNB 4U6SA 4OH1A 1D7OA 3PI7A 1WMBA 3KO8A 1EDZA 3OICA 1H6BA 1NFRA 1QG6A 3RC2A 4RPHA 2JHGA 3C85A 3JQ6A 3GGPA 2DQ4A 1EVJA 4IIVA 1G0OA 2O48X 2YZ7A 2ZQYA 4Q3AA 5T6BA 4OKNA 4PVCA 3AW9A 3PLNA 3K30A 4ALJA 1C0KA 4IZHA 4Z9FA 3LC2O 1LQTA 3V5NA 2YDXA 4IJWA 1MXFA 2NU7A 2ZB4A 4KWIA 2GR9A 1ZW1A 3E03A 4WLFA 1K3TA 4WNIA 1E3IA 1U8XX 1XQ1A 2X0RA 5TJHA 4IQ0A 5KVSA 5G4KB 1Y5MA 2VZ9A 3KTDA 1EK6A 2X23A 4PLWA 3WMXA 4EGFA 2PZMA 1HDCA 2B36A 4DREA 3DBHB 1GQ2A 4KUHA 4RZHA 2CVZA 1JKFA 1E1MA 4YAKA 5GMOA 1E7QA 2PKQP 5ITVA 4BNXA 3W6ZA 3HZZA 3ANLA 4FC6A 2BFPA 5IF3A 3OQBA 2G1UA 3LLSA 4HX5A 4JX8A 1R15A 3AM3A 1WW8A 2OORA 3C1OA 3ETEA 2PR2A 3ZNNA 1J4AA 5MGBA 1QXSA 3H2ZA 1KBZA 3U3XA 4OYRA 4XGKA 4BS9A 1GCUA 3RCBA 4E0BA 3GGOA 4DLBA 2HMWA 4E12A 2FZWA 4QEDA 5TQVA 4EEZA 4EJMA 3QHAA 1DBVO 1MC4A 3AI3A 4MJLA 4M86A 4FGWA 3RFXA 1ZVMA 4FFLA 2BFAA 4FDAA 3JQDA 4MP3A 1U3WA 4GX1A 3FR8A 1PJCA 1QKIA 1NP3A 2NUAA 4IDBA 4DGSA 3I1JA 3H9EO 2X22A 1JA9A 5JFOA 3I5MA 3L4BC 4II3A 3DZIA 1ISMA 3KB6A 4PIVA 1U7HA 2YV3A 1R4MA 4OQZA 4KQWA 4WLOA 3QWFA 2B5WA 1X0VA 2WDZA 2V6MA 3G1UA 4X54A 4XGNA 1P1HA 3EZLA 4RVHA 4KUGA 2Y1OA 5TIIA 2A35A 4EBFA 4J7UA 2R2GA 3S8MA 2WD8A 1VKNA 4WKGA 1OBFO 2E37A 2WWRA 3CH6A 4CM3A 1QLHA 3PJEA 1YQDA 1T24A 5EN4A 4XD2A 3DFZA 4R3NA 5F3RA 4Y6SA 2QYSA 3OEWA 3JQAD 4R51A 4Z0PA 3TOZA 1DAPA 5F1KA 3JQCA 1EVYA 3BTSA 3S55A 3NDIA 1KEPA 1AN9A 1PR3A 1JWBB 3JQAB 1O89A 1C1DA 2WJPA 1EFLA 4TKMA 5GY7A 3RC7A 2BKAA 2W90A 2I3GA 2WE7A 2YV2A 3P5SA 3I6QA 1BW9A 5EQFA 2GN8A 2J5RA 1I2CA 4YTEA 1ULUA 5A3VA 4J90A 1YB1A 3HHPA 3PYMA 1JDJA 1UDCA 1O0SA 2Q46A 4WNCA 2GSDA 3G1TA 1UXHA 2I67A 4BNTA 3JD1A 2IZ0A 4BNLA 5BSGA 4BKRA 3WWZA 3TFQA 2BI8A 4PLHA 3UFXA 4CUJA 3LT1A 1XA0A 2GRAA 1WNTA 1MX3A 4HY3A 4NDNE 4RLSA 3JD4A 1DDOA 4BNWA 1M66A 3NTQA 2AQKA 3TJRA 3K8ZA 4OGWA 5JCJA 3GUYA 3BMOA 4K9DA 2NVUA 2DUWA 4OSOA 4JLWA 1CF2O 1ZK0A 3AFNA 1DO8A 5A02A 3GPIA 4B3HA 2P9CA 3ZW9A 5L95A 3JQBC 4CM6A 1BG6A 4A73A 1OMOA 2NM0A 2X6TA 3L07A 5AXCA 4CLXA 4ND3A 2CFCA 4JBHA 6ADHA 3RASA 4R4JA 3A14A 2C54A 4C4OA 2NLOA 1BMDA 4PLZA 2HMTA 4PZEA 3ZWMA 4G65A 2Z1MA 1F14A 4I5DA 4J1TA 2JHFA 1PWZA 3A28A 5JAZA 3QVXA 4KUEA 3EVNA 4GWKA 2R00C 3ZZNA 1SPXA 3ZWAA 1WDMA 3NEPX 5ILOA 4WLNA 4E30A 4HFRA 1UAYA 4GPD1 3RSHA 5ITWA 4RGBA 5BNTA 4RZIA 3EYWA 5JPIA 3TL2A 2RBEA 2YHIB 2QG4A 3DBRB 2B4RO 4ZQBA 1H0KA 1Z74A 1EUDA 1PL7A 1YB5A 2UUOA 4S1VA 1D1TA 1I33A 1GD1O 3H5AA 3K2EA 1GUZA 4II2A 3PHIA 3WQQA 3FWNA 1N7HA 2W2LD 2AW5A 5T5QA 6LDHA 3JQ7A 2CDBA 2PKQO 1XCBA 4RPKA 1R0LA 1VI2A 1BSVA 1WAMA 3K6JA 4BNMA 1K5HA 2P4HX 1NVMB 3DR3A 1EUZA 1IE3A 3JQFA 4N5MA 1XR3A 1LQUA 2CD9A 1U3UA 1JN0A 1U28A 2UUPA 2AE1A 5ER9A 2AQIA 2O3SA 1P9LA 3TZQA 2CF5A 2YJZA 3QVOA 4ALKA 5IZCA 2NQ8A 3I9KA 1M6HA 4WPGA 4E31A 4YJFB 3U4DA 2OO5A 4WLVA 2V6GA 4O0LA 5DN9A 3SX2A 1PQPA 2FY8A 1VJ0A 1ZEMA 2X8LA 3VVBA 2O4CA 4DWVA 3MJVA 3W4KA 2WE8A 2GCGA 1X1EA 4WCDA 4I5GA 4KQXA 5G0WA 1C14A 2XPCA 5T8KA 3GG2A 1FXSA 1WLYA 3WIEA 1PJSA 1MG0A 4JROA 4XQCA 4ZRNA 3F46A 3L0DA 4D3FA 4NQZA 2YDYA 3HG7A 3V2HA 3VKUA 2QW8A 4MIYA 4I5EA 5JAQA 4EI2A 3GMSA 5EJ2A 3BMNA 1NBOA 1KEVA 4I08A 1PQWA 3DZJA 4XIYA 4BUCA 1JKIA 2PA3A 2PH5A 2Y68A 5KOIA 4OQYA 4K1LA 1DRWA 4MVJD 3HQ4O 4D45A 1UUFA 1Z75A 3FBGA 4KZPA 4RF2A 4FS3A 1JAYA 1PGPA 3PHLA 2E48A 5HTOA 1WZIA 1ADGA 2X5KO 3LDHA 4PZCA 1G0NA 4B4OA 5TS3A 2VHWA 4D46A 2GZ2A 4M54A 4ZRMA 5IG2A 4P8RA 4Y9DA 3Q2IA 4K26A 2E6UX 4DLLA 1FDWA 4GWGA 2AG8A 4Z9XA 4B4VA 3WR5A 5JNLA 1UXIA 3K9QO 4E2XA 5BSEA 1RM0A 1ZK2A 2PNFA 3PHHA 4FGSA 3GDOA 2R00A 1ZK4A 1DOHA 1PQUA 4O6VA 4YDRA 4XR9A 4B7XA 1UDAA 2F1KA 4GVLA 2NTVA 4RO0A 3BZUA 1LDNA 4MDHA 1ZZEA 2I9PA 5JO9A 3B1KA 1ZFNA 1QYXA 2VWHA 4E5PA 4XYLA 2HRBA 2Q1UA 3EAGA 5EPOA 1EEHA 1L7DA 2OBNA 4R5MA 3I9JA 5JXWA 4MKRA 4GMGA 3IDSA 3VZRA 4WCFC 4ZQHA 2QYTA 4L4RA 5AYVA 1TVEA 4L74A 2X9VA 1HZZA 1KVTA 5BNIA 3B1FA 1GPDG 3VPXA 3MJSA 3AUAA 3TZ6A 2NV6A 4UVDA 4RPLA 1U3TA 3KLMX 2CNBA 2O50A 3CEAA 1CYDA 1I5RA 4NBVA 3WGQA 3GF4A 1KVRA 1U8FO 1Y9EA 1H9BA 3JYOA 1NFQA 4RVGA 4H16A 2ZKLA 1NM5A 4ZQEA 3ZWCA 3ASVA 4XCVA 4XEHA 3S2GA 5C3MA 3BHMA 3BTVA 4B3IA 3PQFA 4CMJA 1WPQA 4YQYA 1XYGA 5HBRA 1E7RA 3KUXA 4DYDA 3FI9A 3GEMA 1E6EA 1H5QA 3VTFA 2UAGA 4UEKA 1YJQA 1E3JA 1LLQA 1I24A 4BO2A 4NZ9A 3U4IA 1ADFA 3GLQA 2O3JA 1GV1A 4MP6A 1K2WA 1RM4A 2DBVO 4TVBA 4LCEA 4BIIA 3PQEA 4J1NA 4YRAA 1DC4A 3RU7A 4FPXA 2ZTMA 3AOEA 1KETA 3PGJA 4IGFA 1ZXBA 5LDGA 3EMKA 2EJWA 3LC1O 5I9LA 5LC1A 3OJ0A 1I01A 1VM6A 2GF2A 1Z73A 4OM8A 2Y67A 3EDMA 1K6IA 3FPCA 3LF1A 1F8FA 4J49A 2YV1A 1KERA 8ADHA 3RUCA 4L76A 3S2FA 4E4YA 3INTA 3WJAA 2EKQA 4AVYA 4R1SA 3F6YA 3GQVA 4CL8A 3SBOA 3AOGA 4DPLA 5DOZA 3VVCA 1ZJYA 3B70A 4UULA 2HSDA 3INGA 4YYZA 3BTUA 4EUHA 3ENNA 5BQFA 3B20A 1R4NB 1MGOA 4YT5A 2ZCVA 4GSKA 4AJNA 4QO7A 4FFMA 1E7MA 3UCEA 1RJWA 1EQUA 5CDYA 5A9SB 1PGQA 1YO6A 3ZU5A 4ZN6A 4L4SA 4DRYA 4QX6A 3UCFA 3GAFA 3WTCA 4B4WA 5DNAA 5BSFA 2P91A 1CWUA 1UAGA 3SLGA 2ZB8A 4ONEA 3RC9A 1DJNA 4DQXA 2DT5A 7MDHA 1KC3A 2VRCD 5A03A 1NFFA 2BFOA 2OHXA 3JQGB 4IS2A 4IMPA 1UXKA 3QWHA 4U8GA 4ALIA 3OJLA 1K0UA 5F21A 1N2SA 1A7KA 3KYDB 1EBFA 5G4KA 1DEHA 1NQ5A 4FCCA 4OXKA 2EF1A 2VTDA 3JYPA 3STHA 1GUYA 2DU8A 4P4GA 4RVDA 3F5QA 1ML3A 1BHSA 3DBHA 1B3RA 2GZ1A 4IPTA 3O9ZA 5L53A 4J1SA 1P31A 1JVSA 2C59A 2PK3A 2UYYA 1DJQA 3O8QA 2EKPA 3WICA 1I2ZA 1V3TA 2ZQZA 2JJYA 2HO5A 4EJ6A 3CKYA 3GR6A 2IXBA 4CM4B 3M6IA 3P7MA 2DTXA 1X13A 3ONDA 1N92A 4LRSB 1YE3A 3OIDA 5TC4A 4CM7A 4YAGA 4CMBA 3RC1A 2POQX 2VWQA 4E6PA 5IXSA 2JCVA 1LU9A 4WLEA 1E3LA 3E9MA 5K9ZA 5LDHA 5CP8A 1DC6A 1T2EA 4Y6RA 3Q9NA 3C1AA 4MOWA 3QLJA 2OXIA 1V0JA 1CDOA 1SNYA 4NFHA 3NDRA 4YB8A 2GERA 3HFSA 1NR1A 3C1TA 2EGGA 1IY8A 5FI3A 3DZFA 5ER6A 4CM8B 1V6AA 5JBIA 4I9HA 2JAHA 4M55A 2VRBA 2WTBA 2ZTLA 3RWBA 5C7OO 3VH4A 3DAGA 3EGOA 3KETA 1VLLA 1E7WA 1PJLA 3OH8A 4PLPA 4OKIA 4DQUA 3WSVA 4ZQFA 4Z0TA 1IHXA 3MWDB 3K96A 3NT2A 1XKQA 5AXDA 4CM9D 1E77A 5TX7A 4UVGA 5DULA 2D3TA 5T73A 3UGKA 3WGYA 3IKTA 3ULKA 3GNQA 3LVFO 1EUCA 3IP1A 3OJOA 4HP8A 3TRIA 4RL6A 1BGVA 2VZ8A 1P1JA 4DIBA 2HMSA 4MVJP 3BIOA 3CXRA 1HYHA 2GPTA 1PS0A 1HL3A 1ZUD1 4CLEA 3G17A 2D8AA 4RF5A 3TPCA 4RVUA 2VT2A 1UXJA 4I5FA 3LT0A 4F3YA 3M2TA 5JSFA 3WGHA 1I2BA 4IZIA 1W8DA 2LDBA 1GZ6A 1LC3A 2VYVA 2X86A 3ASUA 3WXBA 2RHRA 5KNLA 2BF7A 1L7EA 4LMRA 1GU7A 2AMFA 4HFJA 3DMTA 4I9NA 3UICA 4CMCA 4FJ1A 1YWGO 4NBUA 2D0IA 3OP4A 3H5NA 3DL2A 1H6AA 3CE6A 5G0UA 1E92A 1KEWA 1DAOA 1VE9A 4GKVA 5A1TA 2RHCA 3PHGA 3PYLA 1BVRA 3GOHA 2FSVA 3HN7A 1FDSA 1X1TA 2IE0A 3GHHA 4GI2A 3QWAA 1BVUA 3KYBA 2FSSA 4J1QA 5L45A 2QZZA 2P68A 5HWSA 1MUUA 3PK0A 1FDUA 5COAA 1PX0A 4LSMA 2OP0A 2YQ5A 4O59O 1M67A 1MC5A 1PZHA 1DFGA 1ISHA 1SCUA 3DONA 3ITDA 4NJMB 3RKUA 4R3WA 1YL6A 1ZO8A 1U3VA 4O63O 2GYYA 4OXNA 5FFFA 4BNGA 3I3OA 5TT0A 3I52A 2O2SA 1J0XO 4EYEA 1XG5A 3V2UA 2Y99A 3N58A 4J9UE 2JD2A 3D4OA 2GZ3A 3U09A 4FN4A 2D59A 4ITUA 2FR1A 1IPFA 4PRKA 3WGTA 1U4SA 1YB4A 3B1JA 4JBIA 3B6ZA 4IDEA 1VPDA 1XU7A 2VHXA 3DFUA 1ZMTA 3L6EA 3IUSA 3FCOA 4CLOB 1OAAA 1JU9A 2PZKA 4PG5A 3BXXA 2YHIA 3NV9A 4BNZA 4PN3A 3DBRA 2BGKA 2AG5A 2PZLA 3JD2A 3SJ7A 1ISFA 4EEXA 4E3ZA 1N7GA 2CUKA 5KJ1A 2JFHA 3LLVA 1VJTA 2HKIA 3H65A 3AI2A 4BKUA 4XIJA 1XHLA 3V1TC 4IQGA 4LCJA 4BKOA 5G4LA 4BKPA 2DTEA 4EUFA 1SB8A 3KBOA 2BRUA 3A1NA 3UKOA 3ZU3A 3C7DB 5L7WA 1IUKA 1ZMOA 2ZJ1A 1IZ0A 5KVVA 4K6CA 2RAFA 3N74A 2QQ5A 2W2LA 3WWYA 2HK8A 4YA6A 1XGKA 4YT2A 5KWEA 4A27A 2X58A 3ONFA 1T4BA 4PFJA 5C7IO 1AGNA 3W8EA 3H8VA 1MP0A 4DYVA 4RQTA 4N7RA 5EESA 1MG5A 2Y0DA 1GZ3A 3MCVA 3I6IA 1P1KA 5I9MA 2O7SA 4QO8A 3LT2A 4B8ZA 1LDBA 3DTTA 4YJFA 1I32A 1PL6A 4B79A 2HMUA 3R3SA 4RJTA 1NWCA 1A7AA 3OQ1A 2ZIZA 4ZA2A 1LLCA 3MJ4A 5T57A 2VHYA 4E2ZA 2G82A 1MLDA 1BXGA 3H9JA 1TB4A 1HSOA 4AJJA 5BT9A 4BO8A 4J16A 3GNSA 1YGYA 4E33A 4UUPA 5GZ6A 1ZSNA 3CSDA 5FI5A 3ZNQA 1T26A 2JCYA 5B4TA 1BRMA 4H15A 1ADCA 4IUYA 2IODA 1ISIA 4CQLB 2B5VA 2D4AA 4ND5A 2VOEA 4YJGB 4Y8VA 3TOXA 3U9LA 1LI4A 3PWKA 3JV7A 3Q0EA 1T25A 4GKBA 3I23A 4NNJA 3UHAA 2W98A 3WJ7A 4XB1A 1GDHA 1PJBA 1R66A 2I5PO 2WYVA 2DFVA 1P3DA 2NTJA 4LW8A 3E82A 3NX4A 4MVJA 4YACA 5DCUA 4GBJA 5KKAA 3K92A 1L1FA 4RF4A 4YRDA 5DF1A 1FK8A 2GN9A 2BD0A 3JQFC 1A5ZA 4PG6A 4OHUA 2VNSA 1B2LA 4HUJA 1X0XA 4BO1A 2C7VA 4BO3A 2DKNA 1PJQA 4N54A 1QORA 4GL4A 4IJKA 4KTTE 3G49A 2Y0EA 3QP9A 2ZB7A 5CEEA 1U9JA 4CPDA 2NU8A 2XF8A 1GV0A 1ID1A 5IZCC 5F5NA 3ZWYA 4NMHA 1Q7GA 1LRJA 5L7YA 4K6FA 5JMPA 2B83A 5CFZA 5B37A 1LSOA 5KJEA 3BAZA 4FQ8A 2B4TO 4CMIA 1YL5A 2VUTA 1YVEI 3WGGA 4IGEA 2NU9A 2NADA 4ZGWA 5T8KC 3G3EA 3ZNOA 3PGXA 2HDHA 1OZAA 2H63A 4Y98A 3COSA 3ZGYA 1R37A 1LLUA 2DLDA 1AHIA 1ZJZA 1UXGA 4YBZA 4JQCA 3C8MA 1EVIA 2RH4A 3DZHA 5JYAA 3WNVA 3L9WA 2QX7A 1ZCJA 4ROSA 3AM4A 3WLFA 1IULA 4LGVA 1PGJA 2V6FA 3PLRA 2WEKA 1HRDA 4XRRA 3IL2A 3FNHA 3WQSB 1SOVA 5T67A 1KS9A 1LUAA 3HWRA 4J3FA 4U0KA 2PGDA 2O2YA 3V1YA 5KJFA 3D3WB 1YOVA 1NHGA 2FOIA 2QHXA 1RWBA 4XR4A 3PFWO 2FPIA 5JC1A 5CEFA 1Q7CA 2HUNA 1N1EA 3H4VA 2JAPA 4JK3A 4GAEA 1HSZA 2EKLA 2FZEA 4MVJF 3RQSA 3Q1LA 4XQ9A 1ENZA 3GPDG 1D4FA 3OHSX 1NASA 2W8ZA 2HU2A 4CMKA 2PH3A 4L8VA 1P1FA 1P77A 3GDFA 4TQGA 3LSYA 1GCOA 3W6UA 4C7JA 2X0NA 4NIMA 4UAGA 1ONPA 1E5LA 3W8DA 5F1PA 1R0SA 2P9EA 3H6KA 3RUIA 5JDIA 2Y1EA 2DBQA 4IBOA 4OJNA 1NWHA 4DUPA 2HCTA 3UN1A 1HE4A 1Q7BA 3ZWVA 1Y81A 3H3JA 4A10A 1E1LA 1Z7BA 3ENKA 5IDQA 1CQJA 4R54A 4XYMA 4FC7A 1KVSA 1ZXLA 3GAZA 5ADHA 3U4HA 4DL9A 2CZCA 3FNGA 3GRKA 1TEHA 3KHUA 2WM3A 2SCUA 1R4NA 2E82A 1B3BA 4A2CA 4CL3A 4HV4A 1HLDA 4XB2A 1AXEA 1PGOA 5U4QA 3GVPA 3VC7A 3PJFA 4H3VA 3ZCXA 2V7PA 1OC4A 4JNKA 5FF9A 2C20A 1J6UA 1I10A 3N7UA 3NYWA 4ZICA 1O95A 3WDSA 3EHEA 3PIDA 2G17A 4QFCA 2TMGA 3CPSA 3AUSA 4W9NA 4R68A 1H6CA 4OOFA 3NJ4A 5AVOA 2C29D 1V3UA 1UP6A 3JQGA 4BMVA 1ZH8A 4BNNA 1YQGA 2DTDA 3SLKA 3KYDA 4UUNA 2AEMA 5EINA 4HWKA 3DAPA 4GVXA 4TRMA 4UREA 4NU5A 4XYBA 4RPGA 2VRCA 5FYDA 1IL0A 4RVFA 4MVJE 1M2WA 3AOEC 1V8BA 4LMPA 5A5FA 1CRWG 3QSGA 1F06A 1PJ3A 1PZGA 4R69A 1A71A 3VHRA 3ZHYA 3A4VA 3FN4A 1GUFA 1LJ8A 3ZV3A 2VUUA 2X4GA 3PEFA 1LDGA 1P0CA 4CM4A 5DCYA 2CMDA 2BGMA 3DBLA 3QVTA 2IRWA 4DXHA 4DQVA 4YJHA 4G2NA 2PGLA 4FOSA 1DB3A 1DRUA 1UZMA 1G1AA 1WMAA 3D3EA 1HDRA 2VYND 3E48A 2BGLA 3TWOA 2C5AA 4IDGA 3HDJA 3ABIA 3ITKA 1HKUA 3H9UA 5CHEA 3RU9A 3K2BA 3TF5A 5KCZA 1UDBA 3WYEA 1RM5A 3JCZA 1DLIA 4GLLA 5ICSA 4PLCA 2IEDA 4CM8A 2GDZA 4NI5A 1GAEO 2C0CA 3CIFA 3WB9A 2CF6A 4L0QA 1VKOA 1R4MB 3NDJA 5L4NA 3RUAA 1OC2A 2XAAA 3MJCA 1R12A 3ZI0A 1ORRA 2BLLA 3GVIA 1X14A 3H9QA 5A4DA 2Y0CA 5ILGA 2C2YA 2GN4A 3TFOA 2GGSA 3EUWA 4NHEA 3PZBA 1LX6A 3F1LA 4B7CA 1ZIDA 2EG9A 3UUWA 1Y8QB 3ZV6A 1LSSA 1OOEA 4TRJA 2YQ4A 4AJPA 4D0SA 1PR9A 1KIFA 3QA9A 1CETA 4CM9A 2J5KA 2P4QA 3MTJA 3RUHA 5IN4A 1FDTA 1M6WA 1J5PA 3E8XA 4WGGA 1CQIA 3AY3A 4XZ3A 2FN7A 1I8TA 4D7AA 2HJSA 3VZPA 2FWMX 1I30A 3WBBA 2Q1SA 4MINA 1GQYA 2HQ1A 3KEQA 3KYCB 1G6KA 4IXWA 4G5HA 4DBZA 2ZTVA 1C1DB 1KVUA 3IJRA 1B16A 2J3JA 1YJ8A 1RM3A 4MO2A 2Q1WA 1BW9B 4IM7A 1LXCA 3JD0A 1E3SA 5F5LA 3AK4A 1VL6A 3ETGA 1CEQA 4GX0A 3WSWA 1IYZA 3DWFA 2OP1A 4U5QA 4L75A 2Y1GA 4E5YA 1Y7TA 4W7IA 5DCWA 5KKCA 3PRJA 4LVUA 1KOLA 4B7UA 1QYWA 3GVCA 4ZD6A 4HXYA 2JKVA 4BKQA 2CVOA 2VUSA 4D43A 3DC2A 1LEHA 2Q99A 4Q9NA 3SXPA 3I9NA 3OBBA 3WGOA 4DBVO 5CAEA 1E1NA 3DO5A 1FF9A 2J3IA 1U5CA 3U0BA 3ZU2A 1RYDA 2W2KA 4MKZA 1EK5A 1Y8RA 4CMEC 1C1XB 3BMOB 2WYWA 5JY1A 1ZBQA 5CPBA 1KC1A 2GN6A 3H7AA 3W8FA 1EDOA 3CTMA 2QRJA 2EP7A 2VHZA 1NXQA 2RCYA 4J4HA 3H5RA 3UH1A 2DPHA 4CLHA 1MB4A 3WS7A 2AA3A 2J5QA 1Y9AA 1ADBA 1WDLA 4YQZA 3SC6A 5A06A 1HE2A 1WXDA 1NHWA 3QWIA 3VKVA 1W0CA 2HMVA 4KTVE 3DZBA 2NACA 1RKXA 2W4QA 4CMGA 4J2HA 4J4BA 4MP8A 4QQRA 1ZK3A 2BELA 3QRWA 4B3JA 4U7WA 4UUMA 5KVQA 3CMCO 1YXMA 3I83A 4YEDA 4N18A 4EZBA 1LC0A 4DPKA 4W4TA 3GZNA 4YVFA 3HSKA 1AUPA 1NQTA 1UP4A 1QV6A 2NSDA 2XOXA 3GH3A 1VSUA 2GLXA 2IDZA 3ADPA 2PGJA 1N5DA 3AU9A 1HDGO 3DMTC 5L4SA 3WGZA 2A92A 4XA8A 1E5QA 1H9AA 1ZSVA 4J4TA 3RBVA 3DHEA 4Z0HO 3OFSA 4BQPA 2EWMA 4P22A 1BXZA 3P19A 4D42A 5JMWA 3LQFA 3UXYA 3GK3A 3WTBA 4JCOA 1Q0LA 4JJGA 4YPOA 4FFNA 1HXHA 4CMAA 2YFQA 1DLJA 3I4FA 4UEJA 2AHRA 1JAXA 2NU6A 3VH3A 3VTZA 3ZWNA 4DMLA 2FMUA 5CDTA 2JD1A 2Y93A 4JJFA 4XQEA 4E5NA 1A27A 3E9QA 1DC3A 5M6DA 3IUPA 3ZWPA 4YAJA 2LDXA 4Z9YA 3IS3A 4PLYA 1NVTA 1B8VA 4E2WA 3S1LA 3LF2A 3F4LA 2O4UX 3LU1A 3PTZA 5AQ1A 1KEUA 3GN1A 3Q3CA 3X2EA 3PDJA 3ZHZA 4BMNA 2EERA 2AEFA 4D44A 4NH4A 3OMLA 2PD3A 2PD4A 2HK9A 4RVSA 5COQA 1UZNA 4R9RA 4Q39A 4BGIA 5AXAA 2E4AA 2ILTA 3ICCA 4BNFA 1AXGA 2GASA 4Q3DA 3KSZO 4BNKA 3ZDFA 4CQLA 3KSDO 3KVOA 3VPHA 2E49A 1NTOA 3TDKA 3G0OA 1XDWA 4YJGA 2DFDA 1SZJG 3FTPA 4KMSA 2Z5LA 4F45A 4BO0A 4E32A 3NJ8A 4AJ2A 3QQPA 1WP4A 3AY7A 5I8ZA 1JQBA 1DIHA 4CV1A 2CDCA 3GY0A 4YWJA 4TMFA 4KDFA 3ZHXA 1HT0A 2BFMA 4CMEA 4GH5A 4FB5A 1PJ2A 2JD0A 1QYCA 3RVDA 1A4IA 1DIAA 4WJZA 4DA9A 3RD5A 3HB5X 4AJOA 1LBEA 1NAHA 3VPSA 3PWZA 1GYRA 1LDEA 1BDBA 1UP7A 3GNTA 3GEDA 1LA2A 5CEJA 3RAJA 5G0VA 1Z45A 3O38A 5U1PA 5LCXA 1HLPA 2GNAA 5DT9A 4P38A 5KTKA 1HETA 4WEOA 5JW6A 2EP5A 3NT4A 3E5RA 3RUEA 3M2PA 3R1IA 3JQ8B 4FIZA 1YH3A 5TGDA 1B8PA 4QSMA 3NTRA 1T2FA 3MWEB 3JQAA 3GT0A 4XKJA 4A03A 1S7CA 1JLLA 4OOEA 4IINA 5A9RA 3QW2A 4DLAA 2B4QA 3W1VA 2NVBA 4HNGA 4J0FA 4YAIA 4Q3BA 5H83A 4E21A 3LT4A 2Q3EA 1T1RA 3BHIA 3R3JA 4D0RA 3WGIA 3HJAA 1NAIA 5I7FA 1TT5B 1KVQA 1O8CA 3PQDA 4FJ2A 3BTOA 4P4LA 1I3KA 5TLSA 4L9RA 4YT4A 1EZ4A 3TSCA 4A7PA 4NFSA 2VOJA 3IAHA 4PG7A 4R5HA 2Y66A 3PWSA 2P2SA 2VCYA 4QUKA 4DC0A 1NQOA 4G81A 4GGOA 3PPIA 1YL7A 1EE9A 1TI7A 2Q2QA 2VNAA 3EZYA 4PLVA 3EK2A 1T4DA 5K6AC 4XGIA 1NPDA 5CDUA 2A4KA 5ICMA 1C0PA 2O23A 4DPMA 5BR7A 1R0KA 3I4CA 4Q3EA 2PD6A 5U9CA 4OIMA 1O6ZA 2QIOA 5JDCA 3MJTA 5TNXA 1D8AA 2X5JO 3RJ9A 1SB9A 2D2IA 4OMUA 3H2SA 5I9NA 3DB2A 3D7LA 1LSUA 3ZV4A 3H3FA 3JQ9C 1E3WB 2DBRA 3HFGA 2C2XA 2NNLD 1NYTA 4JBGA 4U6QA 4WUVA 4FR5A 1C3VA 1SEPA 4BV9A 4PG8A 3I9MA 4B8WA 9LDTA 1IZ9A 1DFIA 1BWSA 1O94A 4EDFA 3IKVA 3ZV5A 3WQRA 3K5PA 3VDRA 4RPJA 1PZEA 2EW8A 3D1LA 1V35A 1YDWA 3FSRA 1H93A 3JYLA 1X7GA 3V1UA 5JYFA 1BXKA 3GGGA 2X9GA 2V65A 4B4UA 4D3DA 1HWYA 1PZFA 2C07A 4NPCA 3GVXA 3M1LA 1JTVA 4CM5A 4ILKA 4E2YA 4WOJA 4FOOA 4D41A 4IDDA 5HRUA 4CLRB 2O3TA 4D3SA 3NGLA 1V3VA 3FR7A 5CPFA 2RH8A 2UDPA 3PVZA 3D64A 5IZ4A 4MVJI 4AJIA 4R01A 2EJVA 4PLFA 5COBA 2HK7A 1I3MA 1N1GA 3F1KA 5JYEA 3AFMA 2IYOA 1U2GA 2EW2A 1P1RA 3FNEA 4KDEA 4LN1A 3RROA 1YRLA 2D5CA 3D5QA 4FJ0A 4HFMA 1P33A 3BMQB 4FFRA 5A04A 4NK5A 1NPTO 4UVHA 4CUZA 2Q22A 3MZ0A 5B12A 1HEUA 3WBFA 3RUFA 1X7HA 4F6LA 2NQTA 4Y67A 1QV7A 3WOHA 4BMSA 1DHRA 4Z3DA 4BL5A 4XDYA 3P2OA 3AUUA 3UW3A 3IC5A 1GQQA 1X7DA 5G0TA 4FSHA 4M1QA 4WK6A 2X1HA 3UF0A 1HE3A 2QRKA 4CR6A 5KVCA 3C24A 4YJDA 3INRA 3KRTA 3ROKA 1MFPA 4F6CA 3P2YA 3Q6IA 4WCFB 2DM6A 4M8SA 2P9GA 3FF4A 4OAQA 3IJPA 3IQDB 2FP4A 3GFGA 1A9ZA 2WYUA 3OEYA 4XYGA 4WLUA 4AJ1A 4IDFA 3A06A 3BYZA 3O26A 4BHTA 5JDIC 1O5IA 1DC5A 1EBUA 3Q2KA 1Q0HA 1U1IA 1U4OA 3O8QB 3IP3A 3KV3O 4MIOA 5BSHA 2NWQA 3ST7A 3PDUA 1J49A 3EC7A 5K6AA 3LC7O 4HBGA 3AM5A 1GADO 1LRKA 3KOUA 5HM8A 4NG5A 5JYDA 5ES3A 1GY8A 2YHUA 2ZCUA 5ENDA 3RUDA 4BNUA 4Z3KA 4E5MA 1EE2A 1FMCA 2Q2VA 1PEDA 4GSLA 2HAEA 1V9LA 4BV8A 5B1YA 4XX0A 4YXFA 1EQ2A 3NUGA 2VYNA 1A9YA 3JQ9A 1ENPA 4MVJM 3QJ5A 7ADHA 3S2EA 1ULSA 1MV8A 1HYEA 3H9GA 2VQ3A 2UV8A 5GZ3A 2YUTA 5DBGA 2HRZA 3R6DA 2XXBA 4CM1A 1CERA 1VJ1A 5L9AA 3GN2A 4J9VA 4CQMD 2V6BA 1IPEA 3EY4A 5H82A 1TA4A 2X9NA 5I7SA 1U7TA 4RV9A 3WYCA 2Z95A 4CQMB 4W9NC 1PL8A 1RYEA 5A05A 3UCXA 1T2AA 1YKFA 1Y8QA 2HJRA 3U62A 3WFIA 4IQ8A 1N9GB 2IZ1A 3SJUA 4W82A 4WEQA 4ALLA 1NNUA 2CSUA 5IDWA 2H5LA 3RBXA 3RJ5A 4BO9A 4DMMA 3W4JA 3GA0A 3QVWA 3ZU4A 4NU6A 2OZPA 1UR5A 4Y6PA 1ISGA 2DPGA 3E5MA 5MDHA 1ONNA 5L40A 4CV0A 1XSEA 3HADA 3OETA 1WZEA 3KYCA 3I9LA 5AXBA 3BMCB 4NJOA 3SC4A 1JKJA 2VYVD 4M87A 1UZLA 1ZKMA 4WOKA 3E1KA 1IOLA 1F17A 4J2OA 5I8WA 1TXGA 2OFPA 2VHVA 5TSDA 4IS3A 3ZW8A
chains in the Genus database with same CATH superfamily
1OFHA 2H5JA 4S1NA 5ITSA 3DDNA 1GPNA 3CURA 3RIHA 2J08A 4QUAA 2WVHA 2JGDA 4P08A 3OO0A 2JFZA 4KQ1A 4AUKA 2PO5A 5AOVA 2Q4EA 4ECAA 3UAVA 3ROXA 3AZQA 4MWTA 4ZAVA 1OH5A 3SHFA 1JJBA 4ZANA 2C2WA 1B26A 4ZYTA 4XWGA 3GLSA 3M5CA 4TLEA 3PZRA 4WY5A 4BNYA 4XAQA 5CDSA 4RU1A 5C7LO 2ET6A 2H1FA 2OGUA 1E9BA 2Z2KA 3C97A 3FMGA 3IUQA 3O4RA 3Q5EA 3PDWA 1NLFA 3FBTA 1HYGA 4J6FA 1TKBA 3FPAA 1VRCA 3S3TA 3JTMA 1SIOA 1YR7A 4MO9A 5FAXA 5LM3A 4US1R 3AQIA 2ZRCA 5ALXA 4KIJA 4U7HA 2WZCA 5IN5A 4MAAA 1CB7A 3EOAI 4NK4A 2DR3A 1PNVA 4E5KA 5BW8A 3ME5A 1JXAA 4P3NA 1FVHA 4L9WA 1Z34A 2VJPA 2YVAA 4Q6BA 1QIDA 1SUIA 3W9YA 5PNTA 5L3SB 2A1TS 1PEKE 1QTNA 1QB7A 3AKCA 1M54A 4V1CI 3QU7A 3VYVA 1UWCA 1SXGA 2OHGA 4A4DA 3GT3A 1SBNE 4YAUA 5B6JA 3HE3A 4X8HA 1GDTA 3Q10A 2OGTA 1P44A 3CW8X 4IIBA 5A3JA 3RO7A 4PAQA 2XUKA 2VDRB 4K9LA 8ABPA 1FJHA 1Z37A 4AZTA 4X8MA 2XR1A 4IJ6A 4DLTA 4Q93A 1X42A 3H04A 3DVRX 1MFZA 2HZ7A 1IUNA 1CJTC 4OQFA 3U13A 2ZJAA 3L77A 2J6IA 4YCJA 2JARA 1EP9A 4N01A 3ZS8A 1P2BA 2IH2A 5CR9A 3ET4A 3ZS9A 4UBOA 2YHSA 3LK7A 3ROPA 4WHMA 1GOTA 4KPYA 1H9CA 1F6BA 1FVFA 4PYJA 3A9WA 3I2FA 4PGGA 4UW9A 1UIRA 4GICA 4Y2PA 4B3RB 4M22A 3LBNA 1KP2A 2HUPA 1V39A 1JYSA 2PH1A 3PCRB 2XODA 3PFFA 3GZ4A 4M49A 3DD1A 2TECE 4OJKA 1EUQA 1A69A 1VE7A 1WSDA 2COKA 2O7QA 1PIWA 2BFWA 3CW2A 3G8YA 4OGLA 4X8OA 4XASA 4MV3A 4BO7A 3CUYA 4OKSA 1P19A 4INOA 5K3FA 3FUVA 2NO0A 1UDWA 2BFCA 1JG4A 2AI1A 2NO5A 3EULA 4W99A 4X45A 4X3CA 3P2MA 5ERGB 1CUVA 3TLMA 5KNCA 3WHIA 2DJ5A 3A4IA 2CLOB 3HBAA 4RJLA 5D51S 2O3QA 1DCKA 1E9EA 3AUYA 5B3AA 3T3PB 2ZWVA 1DQZA 2N1BA 3IXQA 1MO3A 1E6WA 2LIPA 4XWTA 1NJ5A 3FUXA 3W2FA 5FT9A 1C4XA 2AFIA 1F8GA 3H1GA 1TO2E 2B0JA 4I19A 3EWSA 2VWGA 5FBVB 4HLCA 2XVXA 4PLGA 5F64A 3RTGA 5I7WA 1BDMA 2VDWA 1Z6TA 3GRVA 4W1SA 2OCIA 1RZUA 4XYEA 1LVUA 2BTQA 2V45A 4CN8A 5CB8A 2VR1A 2WSBA 4ROTA 2P8SA 3L7DA 2J07A 1SVKA 4A3SA 1E7YA 2BMDA 2HY7A 3NIDB 2CBXA 4CDRA 4IV8A 1G8SA 1M8KA 5IAAA 3DDUA 2D5AA 2VWPA 5JO0A 5CX4A 1YNOA 3LYLA 4MAFA 3AX6A 2G4LA 4C7KA 1ZOOA 2PZGA 2R8ZA 1S4QA 1VDMA 2XUGA 2YL2A 2P9TA 4HNQA 2NVWA 3FD8A 1HT2E 2BMFA 2FX3A 1NW4A 5ECDA 4R16A 5G1PA 5K0EA 1BXGB 2PXXA 5BQ5A 4BB5A 1KK2A 2EV9A 2Y05A 1MOQA 4IJMA 4RLHA 4LJ6A 4RJKA 4U2DA 1QZ3A 2HA5A 3U4AA 2PGIA 3QF4B 2J8ZA 5IBCA 2IS6A 4WGGA 4HYTA 4Y2UA 2ZJ0A 2X0KA 4Q9JA 3RKRA 3BWCA 3C8DA 3ZVRA 2H5IA 3W4IA 5BR1A 1RYZA 5KEIA 5GM2A 2HFJA 2J3HA 1KQNA 3LG2A 3R0QA 1Z2DA 1R0ZA 3ON5A 4P7GA 5KMGB 4JIGA 3JD3A 4UOQA 1KDYA 3BILA 5FX2A 3C4JA 4WZBE 4AJLA 4UTPA 3VKWA 1WQ1R 2WMOB 1G98A 1H4QA 4MKXA 4KB5A 3KIPA 4AWXA 1LLDA 3HEBA 4Q19A 5BYBA 2CXPA 1QQBA 3FTNA 3TIVA 3VZDA 4B1FA 2ZGVA 3AESA 1KYTA 4G1VA 4HFNA 4YXWA 1U2ZA 2Q4BA 4Q3NA 4CJXA 4NZOA 1MPTA 3I1YA 4JP3A 1Q50A 1VL8A 3H4TA 4UPDA 2YOGA 3W3AA 3GMDA 3ZK9A 1KK3A 3ZH2A 4CCAA 4NZNA 4O33A 5ALIA 1YJXA 3HUDA 4MUBA 4NWIA 3J80A 2BHLA 1CQPA 1KH2A 1JF8A 3CONA 1K7CA 5JBNA 5KUTA 4INAA 3KUCA 4II7A 4D02A 2XA9A 1LJUA 2RJ3A 3VDQA 3FVQA 1QOZA 1Z5UA 3A2MA 5KHLB 2WB2A 3ZGXA 3ZE7A 2HU7A 1C1YA 2DUUA 1FS4A 1K3UB 3O8DA 4NESA 4OHPA 1T1JA 1CIVA 4JT8A 1BE6A 4YRNA 1K0FA 3RSOA 1H2BA 2PFGA 2VS1A 1H2EA 5BV0A 3WYBA 1KJNA 2XSZA 3HNOA 1LBHA 4I1OA 4ID3A 3QKUA 3R7WA 4H6WA 2DC1A 1CUHA 1SZPA 1U8CB 2VZ0A 3B36A 2QRLA 4MRMA 1WB5A 2I2FA 3QOFA 5CMLA 5THQA 4O4LB 5BSMA 2ONYA 3DZ5B 5EXEA 2YFKA 3B6EA 3HB4X 2XEDA 1E2MA 3ICVA 1NT4A 1ZJ5A 3M1YA 4FP9A 4O3FA 4QOGA 4S3MA 4RYLA 4RESA 3TPZA 2IEBA 5ARCA 1FDVA 4D4IA 1KORA 1ZEJA 1T3LA 3HDQA 4IOMA 2PIAA 3EOBI 1DBWA 1EH5A 2ZFUA 3KZVA 4RD2A 5K4GA 2IWHA 2Z2XA 4UU8A 4RORA 2W6ID 3Q9UA 2R11A 1W5SA 3PC2A 4HS9A 3ZYCA 4UZEA 5KNDA 2Q0SA 3H0CA 1KEEB 3E22A 3VC1A 4KN9S 3H2YA 4IZ6A 3LGXA 3QOWA 4DV7B 1XEWY 4N5LA 5LZ7A 3C16C 2I6TA 5A5EA 4FYYA 2VTEA 2AN4A 3G7UA 3T35A 4B3FX 2NVUB 4QPNA 1DV1A 4HF7A 5CYOA 2FW8A 3OWXA 4LQLA 4MI6A 4JI7B 2GQ0A 3ESCA 4J0KA 3RTBA 3SHWA 4H4EA 2XUPA 1UFQA 1X94A 4PSUA 3C7CB 1YF3A 3HA3A 3W6PA 2EEZA 4ZDWA 2W48A 4FXOA 5TQ2B 3T4EA 5EIXA 4NBRA 5AKHA 1AKYA 1LDYA 1Y9JA 2ZYGA 2WQZA 5IW8A 2W70A 1OT5A 2DR2A 1RI4A 3W5VA 2R1VA 5C8VA 3QKRB 3IQIX 4NCKA 2F3QA 4EG6A 2C8LA 3NCTA 5JPDA 4HAVA 3MCUA 2PZBA 2YYYA 3OPXA 1E1RA 4I55A 1ZH2A 4TWRA 2G1JA 1KJJA 2A2ZA 3DEYX 1G19A 4F9EA 5AVYA 5JNVA 4Z1MD 4TMVA 3A2KA 1J1IA 6Q21A 4UBKA 3DH0A 1MXHA 3QE4A 3NKLA 5EXDA 4QECA 1CUZA 4NV3A 2Q3DA 2F43B 4XWKA 1S1MA 1KYXA 1LS1A 2AFIE 3B9RA 3KHKA 1HZJA 3D6NB 2Z1NA 1HEIA 3UXEA 4HEA1 3W9UA 1YS4A 1EVKA 1B8UA 4Y9TA 4CIWA 4YDQA 4O2BB 5AW9A 3RVBA 4LJYA 1N5RA 3UOAB 5IFLA 2NTNA 2NAPA 3L1JA 1LWOA 3R4CA 5FA5A 3WNQA 2J9FB 4DR1B 4TMTA 3WGNA 3K09C 1S5PA 4CLRA 5FEMA 3EVEA 2V5VA 2WFZA 4KXMA 3ZJYA 1L5NA 3B9BA 3NUQA 1HH4A 1PSWA 4X94A 3SNHA 4N65A 4XX1A 5BOSA 5P8WA 3DOCA 2PYIA 2YFHA 1B8NA 1RCFA 3ZZMA 2PSEA 4YR9A 4KE8A 5CTAA 2AEJA 4LTNA 2I6QA 1EK2A 2AXPA 2OKGA 3JQ7B 4K2AA 4MS1A 5LMNB 1X15A 3SBXA 3UOGA 2UZ1A 4AMYA 4EG8A 1RLTA 4TKZA 1ADYA 3TVTA 3WB0A 5KQMA 1T34A 3AHEA 4OJTA 4R1OA 1W4ZA 5JSZA 3UJAA 3ZWXA 4FYKA 1VG8A 3DF9A 4M88A 2X7HA 1JU3A 4GMDA 1UPTA 5LFAA 2H9YA 1OA0A 2I2DA 2YVLA 4TROA 2ZTUA 2IP4A 4PGAA 2IHNA 1PYOA 1K9SA 2X8WA 2COEA 4X62B 3ZXSA 5DTJA 1P5FA 2EHDA 3KEOA 3QFHA 1E2PA 2R6JA 2OL4A 5GWXA 5JD4A 4N3CA 3TSZA 4MYTA 1LBIA 4AKSA 1BDIA 2BI7A 4QVGA 2FX5A 1P2VA 1PWXA 2D0OB 2YIMA 3T12A 4A8JB 4BQRA 4C0KA 4PICA 4TRRA 4U2FA 3UV7A 4N82A 4AJEA 4Z6KA 3IERA 2Q2OA 2Z58A 1C3OA 3VX3A 3PFNA 1D3AA 4R9SA 4RGQA 4WCFA 4ZK6A 3CINA 1U0NA 1UC8A 2PCJA 4DDTA 5CB4B 2IZZA 2OYSA 2PSSA 2UVQA 3QEKA 3LLCA 4I9UA 4QICA 1YIAA 4ZVRA 1BTOA 4OXYA 1NYLA 2E5WA 4KXVA 1ZM9A 4U2KA 3F2VA 1CP3A 1U0LA 3K3PA 3G0GA 1QONA 3SFVA 4G0QA 2ZUUA 1KJ9A 3PQ7A 2NPFA 5JAIA 3OF3A 4IDNA 3AVTA 3AWDA 2IK8A 3THWA 3BJEA 5HQJA 1VHDA 4R1QA 3UAGA 1R5NA 4FMCF 3HLKA 1QLJA 2JIZD 1LNQA 3GUZA 1S2GA 1AE1A 1ZNQO 3BEDA 4BVKA 4HDRB 1G8HA 2IZ5A 3KSAC 1J8QA 2JCBA 3C7TA 1NLZA 3ZHBA 4YAOA 1BA3A 2XUFA 4PHTA 3ZHCA 3PR1A 4WNAA 3H75A 5E2BA 1C3EA 1YDEA 1RC8A 3GCDA 1IAVA 1L7NA 1JZTA 5DP2A 2O3UA 3QUBA 3F5SA 1JBEA 3S7TA 3TL3A 3UY4A 3IBYA 1TE2A 5FQNA 2ZRJA 3SFZA 3LUHA 2BV3A 2G0TA 2OG1A 3HO6A 1OAOC 2XCRB 3BD8A 3ROMA 1G7RA 5EKTA 7GPBA 3GFBA 5EXSA 2CXXA 4YMLA 4BXOB 1H2HA 4RAOA 4KR9A 3E8MA 5LD2C 4G37A 2FNAA 1WOMA 2FN4A 4BNJA 1I3LA 2HNKA 4FYWA 2FR8A 1R6DA 2OBBA 4RKWA 5BN4B 3PC8C 1YZKA 3CIOA 4LECA 1PK9A 3BFKA 4OQDA 4QYMA 1WUYA 4CF7A 1IZZA 2WHXA 1XXLA 2CMGA 4Y2JA 1UFRA 2OBYA 2BEJA 2Q9AA 4HI0E 4QHTA 4G36A 1A5BB 4AL4A 3KLPX 4ARBA 2DHRA 2ACWA 2J5XA 2BE9A 1TU4A 4OLFA 3ABOB 4XJTA 1XELA 3C5VA 1PYGA 3DLPX 4JJ7A 1N9GA 2FW6A 1LB1B 2Q50A 3G2KA 4B48A 3CUKA 4V0KA 4EECA 4KP7A 2HBZA 1ID8A 4K8OA 1FEZA 2X0IA 4UHFA 5J2TF 4L07A 1KU6A 3NT5A 3PXCX 1M2VB 4H2DA 5KSOA 5ALWA 3T0IA 3RVQA 1UJMA 2CV1A 1ECFA 1RZRD 5IWCA 1CEYA 2CLIB 3OTWA 3CR7A 4ITVA 1CY2A 1FFEA 2JFGA 3WIDA 3A4TA 4RK6A 2GUWA 4FFPA 3CCCA 4XJVA 3NALA 1I79B 3BMCA 1SXPA 1M1YB 4XDZA 3RYIB 2FPOA 2JLCA 3OZAA 3L0SA 4K1XA 4ZAGA 3H0EA 3RBZA 3M6XA 4OBEA 3R5JA 3KQNA 1YVRA 4KR6A 2VPTA 2XYQA 1UJCA 3OCZA 3NAMA 1JKXA 2P2NA 1U0BB 2JJ8A 2VJBA 1WNFA 3GLVA 3KLOA 3VZQA 2I03A 2ZPTX 2CKMA 1M5UA 5EXPA 1I4DD 3HSSA 3WG9A 1U1CA 2VDNB 3D3WA 1XTIA 1DIRA 2X5OA 3H1TA 1GQRA 1PWHA 4PC1A 1T3SA 1YSCA 2G06A 3PUWA 4QGAA 2PT9A 2VBGA 4KH0A 1L5VA 4FBGA 5G1NA 3TI9A 5BP7A 4L7QA 5DDIP 2ZWMA 4D9EA 4EHKA 3WLSA 1URPA 3DUFB 3L6UA 1DKUA 2WJGA 1W76A 5DBIA 5DGIA 3GRPA 1EFVB 3PT9A 3HDHA 4N8SA 1I4OA 2WJVA 3KT8A 2IZ6A 4B5LA 1DQSA 5I3ZA 1BWQA 2ZI4A 1XD9A 3L0IB 4V0SA 3LBAA 5BV1A 4A26A 1VP9A 4PRLA 3HXPA 4K28A 1PDOA 3QVGB 1FXWA 5L3SA 3G68A 2XNCA 3OOJA 1HE8B 3QVLA 5E4YA 1AKQA 2AN9A 3KOOA 2HD4A 4TMYA 5K0ZA 2RI0A 1QS0B 4J91A 3SF8B 4JNCA 4NU0A 4HVAA 3DVAB 3KHSA 4QYTA 5B7NA 1U8ZA 1XNJA 2N47A 3ZG6A 5BSWA 4ZOLF 1WULS 1P7PA 3U49A 1Q0QA 2NT4A 1EVZA 1R6AA 1T3TA 3FE2A 4A16A 2F9LA 3K70D 2W2XA 1O08A 2FWPA 2ZYWX 1R9JA 1QRSA 1E6MA 1YRBA 2JW5A 1I3OA 2GNOA 3ANNA 3DMPA 3WV5A 3MD0A 3V1KA 2AQ8A 1NR5A 2ZRPA 4JI2B 3BGSA 2RGRA 5H0IA 5TPZA 3EGWA 3DJFA 2IOFA 1E60A 5I7VA 1RPTA 3B6IA 1KBQA 1AOXA 3PFKA 5TRTA 1WDKA 2JLQA 3DV9A 4L51A 5DNEA 3SSAA 3THSA 4DLWA 3HRHA 1N2HA 2FSUA 5FFMA 5IJXA 2QXUA 5HA5A 2O0MA 3KXKA 2ZTHA 4DCUA 2EIHA 3HN2A 3HJRA 4QTTB 3GZNB 4U6SA 4AO6A 3EXHC 3M4NA 4HAOA 4MQ5A 3VNBA 4AKTA 4YR7A 5AM0A 4CIAA 1V9SA 3KO8A 3N53A 2AD5A 2CVPA 2C4MA 3TDMA 2HWXA 4RPHA 3B7WA 3H2GA 3CEPB 1RQRA 4DW8A 5CT4A 3KAPA 4LHVA 5EUMA 3L5KA 4Q3AA 1DNPA 5ERXA 3OEEA 5F12A 2C3PA 3RS8A 4EGAA 3SWWA 3K30A 2K2WA 4ALJA 2B4KA 3W5HA 5ALRA 1BKYA 4GP6A 3LC2O 1V25A 4CRWB 1RJGA 1ZC4A 2AWNA 3ZU6A 1N0UA 3IB6A 3UA3A 2UYCA 3OX2A 3BS4A 3K9GA 4KWIA 3E03A 5FOSA 4ZREA 1K3TA 1U8XX 3Q7TA 4GG1A 4PSDA 4FKZA 2ZPAA 1H2XA 3KZ1E 3OU6A 1Y5MA 4EGFA 2X23A 4KPEC 1TYDE 4FYXA 4MNTA 1HDCA 2BZ0A 1L3CA 4DREA 3GX1A 2IH5A 1IJBA 2RH9B 2X2PA 3KJIA 2PX5A 1BROA 2PQ6A 1CJVC 5GMOA 1L7BA 1WV0A 2PKQP 2D4HA 3IWBB 3W6ZA 2ZYIA 3HZZA 1RXWA 3PICA 1CQZA 1UKZA 5CURA 1YC5A 2ZXFA 3GARA 3N6VA 821PA 4I8IA 4HX5A 5BUSA 2O7VA 4W7SA 1R15A 3AM3A 1H1DA 2OORA 3I8XA 3UQYS 1YI8A 5CDHA 3FGNA 1QFXA 3LQYA 2IXTA 1QXSA 4OD0A 2YUIA 1FUUA 2PBRA 1KBZA 1OYWA 3IUBA 1XI2A 4NG4A 1T2VA 4J29A 4K2HA 3PQVA 2PLWA 4JASB 2WU1A 3N3AC 1QOQB 4LXHA 2F1RA 1YB2A 4QU9A 4DLBA 3QUTA 4EJMA 5TQVA 2H08A 4EEZA 1WLSA 1YASA 4EO7A 2FPLA 4OI0A 4MJLA 3MJHA 2KI5A 3PXUA 1Y6QA 4MLPA 5E1MA 4M86A 1H0HA 3TAXA 4YRSA 3L8HA 1Z6GA 3CJQA 3RFXA 1G3RA 4N5HX 1ZVMA 2BFAA 5EPEA 3JQDA 4MP3A 5DLPA 1ZJ4A 2WJ3A 4GX1A 4ND7A 1HI9A 1QKIA 5FQOA 1BU5A 3QI7A 3ZGLA 3H9EO 2X2EA 4GUDA 5JFOA 4D26A 1KGSA 1HG1A 3DZIA 3KB6A 4HAWA 4WKPA 3B82A 5CNMA 4DCCA 4DQDA 4CXMA 1FMTA 3KPUA 3C15C 3UMGA 2QJTA 2R66A 1BN6A 1TF2A 2WDZA 4B3GA 4AKHA 2FW1A 3G1UA 2OV6A 3K71B 3N07A 4WBSA 5F78A 1P1HA 2XTNA 3LQQA 3LWNA 2FETA 3EZLA 3ZIAA 3NV7A 2HV8A 2A9KA 2N0SA 3HCNA 4RVHA 1PW7A 4U7FA 1WXGA 1X87A 3AR9A 2FFHA 3BD6A 5C9ZA 4EBFA 5DFAA 4E14A 1MNQA 4IJQA 2ADFA 2WD8A 1UWVA 2XNSA 5HHTA 1VKNA 3AIIA 4NS1A 4WKGA 1OBFO 2E37A 2JLUA 4NARA 1MT3A 1QLHA 3H3XA 3PJEA 1PG5A 5THXA 3MN1A 3A10A 3G5TA 3WKEA 3TSYA 5D1NA 3VR4H 1GNTA 3TOZA 4YRCA 2E5FA 4KZKA 1O9HA 4H9GA 3N1UA 4OTZA 1J0AA 5CIQA 3RR2A 3BTSA 4QPPA 2VXCA 3NDIA 3S55A 1MOSA 4PPGA 1MHPA 3JQAB 4YRIA 1XOIA 2AGVA 2OM6A 2XT0A 1I3CA 4PHHA 1JLLB 5JNTA 1MEJA 2W90A 3VU1A 1TZMA 4ZMRA 5EQFA 2CN1A 4NTZA 3LY9A 4O4LA 1FVOA 3AF4A 3DEIA 3OQNA 2JIOA 4J90A 4LF5B 3WQBA 4JFRA 4JR1A 1JDJA 1CUWA 2EGUA 1J8VA 1O0SA 1NRXA 2IYAA 5K0NA 2DJIA 4QPCA 4KQIA 2FZ5A 3STXA 5A5GA 1WW2A 2I67A 2J0VA 4BNTA 3RHSA 2IZ0A 5BSGA 4B3XA 2FEWB 2HPZA 3LYAA 3WWZA 3IAM6 1KZ9A 3KU4A 1E94E 2QTNA 4NZYA 3KR0A 5EIHA 1BX0A 5JSHA 1U0SY 1XA0A 2MWMA 2XD9A 3QE0A 3E05A 1MX3A 2ODTX 3ED5A 3JD4A 1X1SA 3WIUA 3OPYB 1DDOA 2WKQA 5K99A 2JAUA 4K40A 3NTQA 3MWJA 1T6NA 1I7NA 3ADCA 1G5PA 4WESA 3VI4B 4EVSA 4K9DA 2CLDX 1Q95A 1L5ZA 2NVUA 2RGWA 4OXRA 3RSSA 2D0PB 3QUCA 3C1UA 1JLSA 2VUHB 3WMRA 3DZ6B 1DKOA 1E20A 1DO8A 5A02A 4QGHA 3T3GA 5DLEA 2JFPA 2ZR0A 4YJ3F 4B9AA 3SGLA 2IYNA 4V02A 4UM9B 3HCOA 1L5SA 2ZI3A 1OMOA 1VMEA 2ZIXB 1PSZA 3L07A 4HWTA 2CV2A 1E3DA 1W1WA 1R10A 2AT1A 2GWHA 2OV4A 3Q3HA 4GPIB 4ND3A 1XRQA 1WQ3A 3REOA 3RASA 4AY2A 2FV8A 4HPJB 2IPLA 4J1TA 2X8JA 3VV3A 4BJ1A 4EY3A 5KOJB 2PWPA 2A9VA 2JHFA 1PWZA 2WIBA 4PN7A 2V7TA 4XEUA 3VR4D 5HRAA 2E4ZA 4I3GA 2OT3B 4BY9E 2Q41A 3OCCA 3T7KA 4HFRA 4E30A 1YFJA 3FUTA 4IKEA 1Q57A 3GWZA 2F43A 1T6ZA 1BWRA 3ZOKA 2IUEA 2R3SA 5HJ5A 5ITWA 2WJWA 1JQLB 1RAHA 5BNTA 4GUAA 4RGBA 5ADUS 2O8BB 3STVA 4F9TA 4A2QA 3CO5A 4O2BA 1R7RA 2G88A 4G4IA 1D9XA 4ZQBA 3MG9A 1A3CA 1Z74A 5AH0A 1EUDA 1PL7A 1XCOA 1YB5A 4BC0A 4EHIA 3HYLA 2E4UA 4S1VA 1I33A 2Q5OA 5FP0A 1AK2A 1XZJA 3DT9A 1CS0B 1QFZA 4II2A 4L5BA 3A1TA 3UV6A 3RK4A 4US0R 1RRKA 3OT1B 3JVEA 3WWEA 4V03A 1YCDA 4DMKA 5FNVB 4HWRA 3MPOA 4UTZA 4LVNA 2ODWA 5JMOA 5T5QA 2P2YA 4LFAB 1M10A 5IEJA 4ZCIA 1A97A 3JQ7A 1WX1A 1XCBA 3AZPA 3PGMA 3UANA 2R4QA 4M98A 3RFFA 5IK2A 1EUZA 3EQ2A 2D0DA 3JQFA 4NLLA 3TQIA 1FTYA 1Y3CE 1U3UA 4AX4A 3HBMA 4E08A 2XYVA 1D8TA 2AJLI 3DC7A 3GA7A 3KPVA 1OHHD 4WBNF 5ADVA 1TYEB 2BGNA 4CIDA 2MCFA 1WMSA 5ER9A 3TPFA 4AKEA 1CY4A 2O3SA 2D1SA 3QVOA 4TT8A 5IZCA 2ERXA 2NQ8A 4WPGA 3NYRA 4E31A 1NL3A 4PC3A 1AQ6A 2R48A 4O0LA 1U7XA 4RY9A 1PQPA 4LF4B 2O5RA 2B0CA 5A0TA 1I5OA 1KI7A 1ZBDA 5JECA 1RRCA 2O05A 4BJHB 1GZVA 2GCGA 2ARKA 2Y0BA 1ZH4A 1SBQA 3X3HA 4MUHA 1T36B 3PTAA 2P9YA 3LUDA 5G0WA 1GPBA 5FL3A 3RARA 3A6GA 2XCUA 3P9XA 3PHCA 4HH0A 4LV6A 4LWOA 2IY9A 3WIEA 5ALVA 1Y1LA 1W46A 1IXRC 2X4DA 4O4IF 2HW8A 4X8LA 4DWJA 4NQZA 1OWNA 2VHEA 3KXLA 4I0WB 2QN2A 3GFQA 2OCDA 3V2HA 1XMOB 2CFOA 2QW8A 3QITA 4KN6A 4L4ZA 3GGCA 4MWEA 3GMSA 4PO8A 4JFAA 1XT6A 2QLFA 1EBBA 4QLBA 1PQWA 2ATVA 4O1HA 4XIYA 4AY3A 5A5VA 3STUA 2PA3A 4O2AF 2R1ZA 4QQFA 1D2CA 1IN8A 3PDIB 5T7BA 4HDRA 5KOIA 3EDYA 4FCTA 3CRRA 2VVTA 2Q3LA 2Y92A 3ANYB 5IPFA 1U04A 1Z75A 4YRPA 1RQGA 1S89A 4U9IS 2O0KA 4W1PA 1PGPA 3P9RA 5FOVA 2E48A 3V8VA 3KZKA 5DM2A 2VZEA 2W2PA 4KL8S 1CUSA 1DUSA 1Y37A 2XECA 4RWEA 4LZWA 3IXLA 4PAOA 4B4OA 5TS3A 4ZDJA 3HJHA 4M54A 3H1BA 2H4FA 4BXOA 4P8RA 3QX7A 1WMDA 4D81A 4K26A 4DLLA 4YCCA 1G5QA 5A2QA 1GG9A 1TPZA 4GWLA 1ZL0A 2F3PA 3B5JA 3K9QO 2QMUA 3D8NA 5HZMA 5JHGB 5BSEA 4HYQA 3ZIUA 2PNFA 2YICA 5B6PA 3GDOA 1L5HB 1DOHA 5HBGA 4GPTA 4JSTA 3ES9A 5EE3A 2C3YA 2CHQA 4DCMA 1LDNA 2A14A 3F9CA 3G8DA 3H84A 2I9PA 4MVXA 2AJTA 3QXHA 1HKHA 3B1KA 1TL7C 1YCHA 3GLHB 4HTFB 3JU3A 2VWHA 4ENUA 4E5PA 4XYLA 3AR6A 3MFYA 1Z4LA 4RGVA 1AD2A 2HRBA 4XJXA 1OZHA 1EEHA 5EPOA 2H7YA 1OWMA 1W96A 3I9JA 4XWAA 4GMGA 4AN4A 4W5TA 5JJKA 3L7JA 2QYTA 2XDYA 4L74A 2X9VA 1HZZA 4I36A 1KVTA 5BNIA 3OESA 3VPXA 2WTNA 3AUAA 5IKEA 1C7FA 4Q02A 2CNBA 3IVCA 2OCKA 5K3AA 2PG3A 1RE1A 1M1YA 5LPNA 4WXMA 3ENVA 3HVHA 2O59A 4DDMA 1MA3A 1SCDA 3WGQA 2Q3BA 1DWPA 2ADOA 1FRVA 3G2OA 7MHTA 1KVRA 1TDJA 1O96B 1Y9EA 1SC3A 3H6HA 4RVGA 1OLSB 4TTVA 3MWFA 5B1HA 4A0GA 3HM2A 3JRNA 4JYMA 1B42A 5EJEA 5BXYA 1NM5A 4N3GA 5AUOB 5FR1A 4XEHA 2OCAA 1KO1A 3EXHB 5I4KA 4C2UA 2DG2A 1CR2A 1Y8AA 3N2YA 3DTNA 3RG2A 2G77B 3UH0A 4EPTA 1OUMA 2QR3A 3S1AB 2PX6A 1XYGA 4RLFA 3PR3A 1ODJA 4PXSA 1G59A 4LAFA 3AF0A 2VHJA 3FI9A 2VJYA 2OD9A 2NO4A 2I62A 2RGDA 3O21A 4V24A 1M1UA 1H5QA 4UAVA 2WIKA 1YJQA 1EFVA 3FVWA 2WNIA 4H0CA 1I24A 3NZEA 4RSRA 4NZ9A 3M34A 3TTWA 3VSCA 1ADFA 3DV2A 3GLQA 3R20A 4PC6A 5NLLA 3FPFA 4TTRA 3R7DA 3SSMA 3VHQA 4B81A 1K2WA 4D9JA 4TVBA 4H77A 4LCEA 2H4JA 4TV9B 4J1NA 1C9KA 4IIEA 4ZOEA 3HA5A 1SUAA 1UJ6A 3JVIA 2J9RA 3CC8A 3KQYA 1SHZA 3AR7A 3DXXA 4GLFA 4WTOA 4B0PA 2CLCX 3L92A 4PHFA 4GDFA 4IGFA 1QS0A 4N9QA 1O97C 4B17A 1E98A 3KT3A 3LC1O 2A59A 1XX6A 3IAUA 5ALOA 3RYHB 3SF8A 3R41A 1NXOA 4KI7A 4TQUS 2O5EA 1ZUWA 1VCNA 4BLOA 1XD2B 1ZM4A 1GITA 2QDXA 4OM8A 3NU1A 3RJTA 5MN5A 3U60B 1X19A 2QZ4A 2XQVA 4MW1A 1AKEA 3LE8A 3PX3A 1S3IA 3ZXUB 3DCNA 2VSYA 4CMEC 4F3NA 2OFWA 3V4FA 3F7TA 4BMYA 4PS0A 4FMDF 1FC0A 4L76A 1V8PA 3INTA 1NF3A 4N8EA 4QBHA 2NSLA 2G40A 2C8VA 3ZD8A 3GQVA 3Q72A 1NXSA 4U2CA 2JCGA 2FSIA 3AOGA 4NKRA 3RM3A 3VVCA 1VIVA 1W6RA 1TKAA 1YNSA 3K1TA 3KWJA 4C0HA 1MAAA 3K5IA 3R7NA 3BTUA 2IYUA 3I05A 2R7KA 5BQFA 3IHLA 4MPJA 1MGOA 1KEKA 4PNPA 1N36B 2PR7A 2NZXA 1H2RS 1KMMA 3CLVA 3UCEA 1E6KA 1XMSA 5CYPA 3SJAA 3UHOA 3GBSA 5DTMA 5LQMA 1V7PC 1V7ZA 4OF4A 1O95D 1AA9A 1PGQA 1IG3A 1NZFA 3FHCB 1C9MA 1A95A 3GXOA 4EM6A 2OC9A 4QX6A 3MRXA 2EQBA 3KJHA 3PFIA 4HDQB 5AJZA 4LRQA 3VSAA 4B4WA 4EG3A 3T1NA 4YMTA 5BSFA 2FSVC 1I1QB 1AN0A 2A5FA 1YAJA 4ONEA 3HCDA 2QORA 3OTIA 3G2PA 2JB9A 3PC3A 1YKGA 1SVLA 1XLTC 2BONA 2O0JA 2REXB 4HCJA 4M7PA 4DQXA 2J48A 2WM2A 2VRCD 2ZJYA 3NHZA 1NFFA 3JVUA 2BFOA 4D4KA 1JQJC 1FSZA 3JQGB 4FCVA 4U8GA 1YRHA 5I3CA 3OJLA 4L5YA 4EHFA 1EBFA 1M73E 3WIOA 1NQ5A 4FCCA 1CR0A 4PONA 2MYTA 3F6PA 2DFNA 2VTDA 1GUYA 4UBJA 2FWIA 2VDKB 3OZWA 3F5QA 3FFTA 4DIUA 2G0AA 1QTIA 1FCJA 2XXAA 1D6SA 2GZ1A 2P79A 5TEVA 3EXFB 1QNFA 2PUJA 2EDAA 3FCAA 4IPTA 2R87A 1JVSA 3NWJA 2PK3A 3KR2A 5ECWA 4B46A 5A0FA 1TJ4A 1H1TA 2JJYA 1EJ2A 3I12A 4EJ6A 8MHTA 2IXBA 2IEYA 4RIIA 1QP7A 3OHPA 2IOFK 3M70A 3EWAA 3R4VA 2WDPA 4LC0A 1K9VF 1KMCA 1Q7EA 1THMA 3U7JA 4LRSB 2I2AA 1QK4A 3RC1A 2C5LA 3DOIA 5IXSA 2H7CA 3HKBB 5K6RA 4TYYA 5DLYA 4WLEA 4FHZA 2PCLA 1GN8A 2P5SA 5CP8A 3AKYA 3DTVD 1T2EA 2QA5A 1P81A 4MOWA 2AV6A 3HCAA 1W0JD 2FQYA 1PJRA 2A5JA 2QY6A 3PNPA 4YB8A 1E8MA 1U9YA 4KVZA 3TQFA 4MW9A 5IAGA 5IKOA 4DXAA 1NR1A 3P9YA 3DZ4B 2ZM5A 1AUVA 3ZHTA 4NAVA 3MTDA 5ER6A 1KNXA 1U02A 4LJRA 2DT8A 3ROEA 2FUG1 5M5BA 3W77A 2JAHA 2PL9A 2VRBA 5FL7A 1BEUB 2ZTLA 5HIAA 3AHCA 3DAGA 2RARA 5A5FA 3EGOA 2NYAA 3B3QA 2XIJA 1C29B 1M1YE 4PLPA 1O6FA 1PJLA 3MGCA 2BIFA 3UMYA 4YP5A 3EVBA 4IHJF 3SC2B 4ZQFA 1FMJA 4C07A 4HNUA 3NT2A 4OMCA 4CKEB 1WG8A 5C3UA 1X8LA 1XQWA 4KIWA 2D3TA 3OD5A 4IIXA 3LZDA 4UVGA 2EJTA 1FYXA 3DW1X 3PUXA 3EGCA 4OB8A 3ECSA 3LY5A 3LVFO 1R18A 3IP1A 4EFMA 1D09A 4RL6A 1Z2AA 5DSTA 1P1JA 3RT1A 1T43A 2AMVA 2HMSA 4U2BA 2ZYTX 3VZCA 4O0MA 1GG2A 1PS0A 4D4LA 1XHFA 5JJBA 3QEBZ 4EQZA 4QHSA 1ZUD1 3SXJA 4RTOA 3RRZA 4RF5A 4INZA 1AH2A 3PFCA 4U6NA 4I5FA 3AONB 2B1RA 1ECBA 1A8QA 5DIZA 2ZAOA 5JSFA 4HAXA 4IZIA 3K8QA 1BCSB 5AHWA 3HP4A 3NANA 1I72B 2C4HA 4FLFA 1GM5A 1QQ5A 2I7DA 4JBLA 5E1OA 4Y2YA 2ZIVB 3ZW7A 5F7ZA 5IM4A 4QDXA 2KS6A 2I6XA 1X39A 4GVPA 3W05A 3WXBA 2QUJA 1CF9A 1AS2A 4BQSA 2AOUB 5SYAA 4M36A 1GU7A 4KO1S 3UICA 3DMTA 2YWBA 4CMCA 4FJ1A 5KNBA 1KAMA 3BIFA 1YWGO 3TLGB 4TQAA 5FD8A 3S0JA 2W93A 3DKIA 5DYTA 3TX6A 5HGXA 5LJIA 2OZKA 3RIXA 1XRJA 3F6BX 1A9SA 2EATA 5EFZA 1E92A 1KEWA 5G0UA 5CXUA 1VE9A 1DG1G 2G6TA 2ZULA 3OZVA 1MB0A 1XMXA 3CVWA 1BVRA 3GOHA 4RPIA 1CUBA 1G9XA 1OW3B 1FDSA 3HN7A 1ETHA 3IV7A 1JIIA 3KCQA 1GPLA 3QWAA 2H7XA 2QPOA 4GFDA 4GI2A 2F9FA 1TF7A 2GPJA 1BVUA 3GLUA 4JLDA 5BWCA 2W6JD 4FK8A 2FG6C 4ZC1A 3UT0A 4FWTA 2HSWA 2I7CA 3WNDA 1W581 5HWSA 1KDOA 4GKJB 2HX1A 1NVVQ 1DKMA 5GINE 5COAA 1PX0A 1ZMRA 4LPKA 1OYVA 4V2IA 5J40A 5B3KA 2DE0X 1M67A 5G3YA 4EX6A 1Y48E 4RXMA 4I4IA 2XDQB 1DFGA 1ISHA 1SCUA 3DONA 5H7XA 3M3DA 3ITDA 3DZDA 1HDEA 4KN5A 3BK2A 1L8XA 3EF0A 4UM5A 1JDNA 2JJQA 5D3ZA 4R3WA 4ED9A 4P5DA 1H66A 2HJHA 1FJ2A 1KYWA 2ESRA 2NV2B 4UUBA 5FFFA 3FOWA 1U3GA 4DJFC 3RYCB 1Q1GA 3I52A 3PPXA 4BPRA 5KOJA 1J0XO 1I51A 2G7ZA 2Y99A 3V2UA 5TVKA 4I46A 4PWYA 2NYUA 1T4GA 2ODEA 4RZXA 4PCUA 4CTOA 1ULZA 2IOQA 4D0LB 3DMNA 3DP7A 4N49A 3RHFA 5B30A 1Q14A 1IPFA 2FR1A 1EVLA 4L4UA 1Q0TA 4JUBA 1GKYA 2I3DA 2VRNA 3CX7A 4JBIA 4BCBA 4U1RA 1W85B 3DFUA 1R6TA 2NPOA 3CRW1 4MHTA 2O8BA 1QHXA 4PFKA 2W0MA 2XE4A 1JU9A 3NV9A 4K81B 3A3PA 4G1FA 3ENZA 1LNZA 3A1DA 1R8SA 5DX1A 2AG5A 1A7JA 4HQ6A 1PR4A 2C2ZA 3JD2A 1ISFA 1B0PA 3R3XA 1N7GA 4JLOA 2CUKA 1L5LA 1CS0A 1Z35A 1T2NA 1VJTA 3EVAA 4ZDKA 2PKXA 4GO1A 3H65A 3OT1A 3LUCA 2FMTA 1XA3A 3ZTWA 4NS4A 1QCYA 2UYGA 3B6MA 3NIBA 1JHPA 4XIJA 5FNVA 3V1TC 3QVJA 1CG6A 4TM7A 1FA9A 4EUFA 1A1SA 2GX6A 4ZU6X 1Z2OX 2YW2A 5CNKA 5KVVA 2AZDA 4K6CA 2G3YA 3WNCA 3AF2A 2W2LA 4YT2A 2HK8A 3DGEC 1XGKA 5J4VA 5JS1A 4A27A 2F1HA 1TLLA 3QIAA 1NW5A 4QUEA 3L2OB 1BS9A 4RJIA 2C4TA 2FB9A 1Z08A 2O9JA 1GGEA 4PPQA 1HNNA 4RQTA 2FLKA 2QAGB 4Z4GA 4RXTA 3HRIA 2YJGA 1NVEA 3COWA 5BPHA 3I6IA 1L5QA 1P1KA 3ZPXA 4B8ZA 2GBLA 1DADA 1I32A 4AP5A 2WZQA 2Z4TA 1C9JA 4XLTA 4ZCMA 3N59A 2D54A 1XTKA 2E3JA 3NUZA 1NWCA 2GCEA 3R3SA 3S4YA 2H1CA 5C8YB 2J0SA 1AU9A 5AI5A 1LLCA 3LKBA 2VHYA 3KJZA 4E2ZA 4MGEA 2RG1A 1MLDA 5HX7A 3H9JA 4N48A 1JTFA 3ZLVA 1T36A 1Z39A 1G2PA 3JATB 2FEAA 4CN9A 4DA8A 5K8TA 5MHTA 1YOBA 3AEYA 1TKRA 1YGYA 2QSUA 2V1XA 3THXB 4GRIA 1KL7A 5BSTA 4LDQA 3WLOA 1PWEA 1Y6GA 2PS1A 1JLRA 1SCKA 1T8UA 1V43A 4BQIA 1T26A 3BSSA 4H27A 1YBFA 2JCYA 4PYQA 2WHEA 3TW8B 3ZE8A 3ZY3A 5B4TA 3OX3A 4N0PA 1ADCA 1NJ6A 3DKVA 3PKZA 5KYWB