1H9BA

Active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 173
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9bA01
3N58A 2XPCA 4HFMA 5ER9A 1YH3A 2B35A 4ZQGA 1PR3A 2XF8A 2EHDA 1YWGO 4OQYA 1EK6A 4RORA 2NV6A 3CZRA 2YY7A 3BTVA 2AE2A 2VNSA 2FZWA 4IZIA 4PG8A 4Y8VA 3GG2A 4CLEA 4IINA 1NQAO 2BGKA 3AY7A 2Z1NA 4HFNA 5F3RA 2YUTA 3M2PA 4OOFA 3GUCA 4CM6A 1R37A 3PEFA 5HS6A 2FWMX 2YHIA 3UGKA 1U28A 2RHRA 3TN7A 5L7WA 1YOVA 4AJNA 2X22A 2G17A 2VZ9A 4GVXA 4NMHA 3M1AA 5BNFA 3MEQA 5CDUA 2NVUA 4CMAA 3BHJA 3ZU2A 4Q3NA 4FS3A 2RH8A 5IF3A 2IE0A 3HQ4O 3DZHA 3JQ7B 5JYAA 4MVJF 4CV1A 2BD0A 4HNHA 1K0UA 4OHUA 4IJVA 2GYYA 1I0ZA 1O5IA 4NH4A 4W9NA 5A9SA 3NEPX 1E6UA 1A4IA 4GVLA 3V1YA 1ZSVA 2NLOA 2Y0EA 4RPJA 3ZV4A 3ZDFA 3AM5A 1EVYA 4A27A 4HNGA 1PSDA 1IL0A 3BTUA 1UAYA 3PHJA 3MJCA 4JLWA 1H6BA 1V9LA 1V3TA 1DJNA 3D5TA 4UVDA 3D3WB 3G3EA 3DBVO 4K6FA 4WK6A 3KUXA 3L6DA 3M6IA 5TGDA 4NBUA 1MC5A 1ZIDA 1P1IA 1FF9A 1RYDA 4YAIA 3L9WA 3Q9UA 5DF1A 2Q2WA 4E5YA 4XRGA 4RQTA 4XR4A 4GL4A 4P4GA 4DXHA 2HLPA 4UVIA 4W7HA 1O95A 2CUKA 5L4NA 5L7YA 4YRAA 3RKRA 4AJHA 1WZIA 5ITVA 1EEHA 3O8QA 3ROKA 3KYDB 3SEFA 1PS0A 1EE9A 1ONPA 5TSDA 1VE9A 2VT2A 3ZWXA 5EINA 3TZ6A 4Y9DA 1P31A 1UXHA 1U3TA 4E13A 4IJUA 2BFMA 3ZV5A 3KYCB 3G1UA 1T2CA 1QSGA 1A71A 2R2GA 3WG9A 3GF4A 4GWKA 3BZUA 3GGGA 3QIVA 1ZK0A 4WCFA 4MVJA 3WTBA 3PYXA 3P19A 1YBAA 2CY0A 3GVHA 1H9AA 4NFHA 2GD1O 3DMYA 4AJOA 1F12A 1U3VA 2H5LA 3DBHB 1ZFNA 4BNXA 1T2EA 4WEOA 4DYVA 4N5LA 3BMQB 1I5RA 4WNCA 3E9NA 5KKAA 3WYBA 1LUAA 2HMSA 5DOVA 4BGEA 5I8WA 5T57A 3NX4A 2VN8A 4BGUA 4TZTA 2DLDA 2YV3A 4YXFA 2NNLD 3GG9A 4RVDA 3DEYX 3Q3CA 1Y5MA 2IRWA 2XOXA 2NACA 3GEGA 1NR1A 4CQLA 3HWRA 3WQSB 4ZRMA 2B4RO 4OXNA 3AU8A 4U5QA 3E18A 4URFA 1LLCA 1ZZEA 4CMHA 2P4HX 3W8DA 4IS2A 3SJUA 1UDCA 2EJWA 4D3SA 4XKJA 4J49A 1ZCJA 2EERA 2VYVA 3ZH2A 1YB5A 1LSUA 4G2NA 4GX5A 5DCYA 5A02A 3WGGA 1YQGA 4UEJA 3QW2A 1N7HA 4Q3AA 5IZCA 3WBFA 3IIEA 3INRA 4I5DA 3HE3A 1K89A 4AJJA 1PR9A 1SC6A 1ISHA 4HUJA 4ND3A 1B8UA 1DC3A 2OFPA 1HL3A 5FWNA 1NP3A 2IYOA 1E1LA 4MVJI 1Q1NA 2CF6A 3H2SA 3IS3A 4UULA 4JN6B 5JS6A 1GQQA 4I9UA 3QA9A 2JD2A 2I76A 2FR1A 2HUNA 4YB8A 1IZ9A 3IKVA 5A03A 4CV0A 4PLCA 2QQ5A 4J1SA 2Y1OA 5L45A 4IJKA 3RUIA 3FTPA 5IN4A 2X9VA 3GGOA 2AEMA 4ZA2A 2HMVA 1ULSA 4RLSA 5BSGA 1Z45A 2UYYA 2OXIA 3GFBA 4FJ2A 4J2HA 1YDEA 2NU9A 2O2SA 2Y1CA 5JXWA 1ULUA 3ADOA 4FDAA 1N5DA 3F4BA 2R00C 5C5IA 4FSHA 3QVXA 1YBVA 1Z82A 1PJCA 4XGIA 3HDYA 5J9GA 1BGVA 2B83A 1GZ4A 1X1TA 1RWBA 2P5YA 4X54A 4MVJD 1LLUA 5L7TA 3E9QA 5KVCA 2DTEA 2Y67A 1I33A 3IAHA 3G49A 4AJPA 2RBEA 2HO5A 3WQRA 3U4HA 3TFOA 1U1IA 3DTYA 3QVOA 5G0VA 4YT4A 1V3UA 1WLYA 1JVSA 4FJ0A 4ALKA 4WGGA 1SPXA 5DBFA 1KEVA 4XZ3A 3UICA 3AM4A 3GRPA 4KUEA 5G4KB 3P2YA 4E32A 3GT0A 1ADCA 2E37A 4RL6A 2WEKA 3KOUA 3KVOA 1GV1A 4G65A 1ZK1A 3WJAA 5A04A 2WE7A 3PFWO 5L51A 4OKNA 3IQDB 2G5CA 1NBOA 1UH5A 3I5MA 3IC5A 2V7PA 4D3FA 3QE3A 1SNYA 4F45A 1N1EA 4M8SA 1OZAA 1A9ZA 2EGGA 2C5EA 2WYUA 1KY5A 4EYEA 2DM6A 1XDWA 3ZNQA 3RKUA 3ZWYA 3VAZA 4I1IA 4XGNA 4L8VA 4I08A 1LTHR 1Z73A 2O23A 1HDZA 4OGWA 1PGOA 3H5NA 1VJ1A 1R0KA 3MCVA 1Y8QB 3PDJA 5CEJA 1J6UA 4XR9A 3X2EA 5BR7A 2GO1A 4TSKA 1G6KA 1DFGA 3LLVA 5IDYA 4B7UA 1XIVA 2E6UX 3SXPA 3K30A 1JVBA 1IHXA 4PLWA 4U7WA 1V35A 3BHIA 4TVOA 2BGMA 4UUOA 4GPD1 4M86A 4RZIA 3BMCA 4A0SA 3UCEA 2OP0A 3OJOA 2Y66A 4RV9A 3BXXA 1ID1A 4GH5A 3H8VA 5ILGA 3RCBA 3K6JA 1WPQA 4DIOA 3ORFA 5CDGA 1WDMA 3BMNA 2HMUA 4FFPA 1DIBA 2ZB4A 4ESOA 1BWSA 2VHVA 5BNIA 1FDUA 3GZ4A 3JQAD 3V5NA 4BOYA 1EVJA 3EW7A 1LLQA 4DWVA 1MX3A 2BHLA 5U1PA 5IJZA 5B4TA 2NVUB 4RDHA 4DIFA 5KJ6A 3W4IA 1PJTA 1C14A 2QRLA 4NFSA 1I3MA 3U09A 1NR7A 2NM0A 4GAEA 3ZI0A 1N9GB 1UDAA 2A94A 2PY6A 1BXKA 1I8TA 3NDIA 4FBGA 4JQCA 3D5QA 2I9PA 4WEQA 1DFHA 4B4WA 4CM1A 1UXGA 4D42A 3ONEA 1P77A 2D3TA 3QWAA 2PKRA 3GVIA 5JDIC 2JCVA 1E0DA 4L0QA 5AXDA 1SO8A 5JDIA 2FRDA 2EKPA 4JJFA 2ZK7A 4FIZA 4C4OA 4C7JA 1U5AA 4YJFB 3HJAA 3M2TA 3S1LA 3VKUA 3LSYA 1E7QA 3EZYA 1W73A 1JKIA 3AW9A 4QSMA 4TRJA 8ADHA 1ARZA 3VH3A 1XSEA 3PHIA 1N1GA 3V2GA 3ROPA 1I10A 2A9FA 3HG7A 1EUDA 1JTVA 3T4EA 1MG5A 3CUKA 2Q2QA 3K2BA 3K73O 4R5HA 1X15A 1Y9AA 4A03A 4Y6RA 3ZU3A 5H83A 3RU9A 3IP3A 2O7SA 3LF2A 3OJFA 3BA1A 3UOGA 3VDRA 2PZKA 3ICPA 3NRCA 1VRWA 4R69A 3WQQA 5AXAA 1DBVO 3ZNPA 3JD0A 3ONDA 1SOVA 1QLJA 4CLOB 1UP7A 2BFPA 4GBJA 3RWBA 3BMQA 4L76A 3ST7A 4R16A 3DBHA 5K0ZA 1NPYA 3MTJA 3RC1A 1N7GA 4MPDA 3RASA 2DC1A 1KBZA 1UR5A 3E5MA 3NUGA 5JAZA 3C24A 5AYVA 2C7GA 3AUAA 4XGKA 7MDHA 5KOIA 4FOOA 4RLHA 4YTEA 2F00A 3FNEA 1YQDA 4MDHA 1KVRA 3NTOA 4J4TA 2Y1EA 1KETA 2YV1A 3RQSA 3RVDA 3WLFA 3A9WA 4KTTE 3DAFA 2DUUA 2WYVA 2H6EA 4OKIA 1ZUD1 3U49A 4DMMA 2HJSA 2WWRA 1R16A 2CDCA 3ZHZA 1MC4A 2AA3A 5I9MA 1U5CA 2AQHA 4XYEA 2CDBA 4II3A 1GFSA 4TVBA 1JQBA 3D3WA 3LZ6A 1Z75A 3NTQA 3H3JA 1DXYA 4NDNE 4R5MA 5KVQA 2NTVA 3S8MA 4QFDA 3T4XA 2W2LA 4A2CA 4CM8B 1C1DB 2F1KA 4Q9NA 1GPDG 2WM3A 5FI5A 4CM9A 5I9NA 2PK3A 4J7XA 4EW6A 5A06A 5JE8A 3K8ZA 5IXSA 1P1JA 1B26A 1E3IA 5DDIP 3STHA 5KJEA 1ZNQO 4BNNA 5COAA 5IG2A 2YDXA 3AY3A 3GUYA 3WIEA 5G0SA 4KQXA 1HDXA 4GI2A 5BSFA 4BKQA 1CETA 2Q50A 1QYCA 3PGJA 2G76A 4Q3DA 4B4OA 1CRWG 4ZHSA 3Q9NA 3U3XA 5AQ1A 3ABIA 2Y0CA 4I5GA 4ZD6A 4CJXA 3ETEA 4HKTA 3FBTA 1SBYA 3TWOA 3RUFA 1JN0A 1F0YA 4II2A 4FPXA 1V8BA 3DBRA 3JQGB 3NT5A 1C0PA 2YJZA 1X0XA 4HY3A 4W7IA 4XQ9A 4N5MA 1ZEJA 2QHXA 5TS3A 4DUPA 1JWBB 1YB1A 3ROMA 5I8ZA 3Q2IA 4DVJA 7ADHA 3PWZA 1CWUA 1NAIA 3RFXA 4KOAA 3QWHA 4XYMA 1MLDA 4EI2A 4DMLA 3IP1A 3OF2A 2BFAA 2C59A 1VC2A 2OUIA 4U0JA 2EP5A 1QP8A 2VHWA 1XU9A 3KM0A 2B37A 3CSDA 2CF5A 5G4KA 3WNQA 3NKLA 1DIHA 2VWHA 4JBIA 1H6AA 3OFSA 4BNVA 3ZNOA 2ZATA 4QFCA 4GMFA 3WGZA 4WJZA 4XEHA 1P44A 3JQCA 2EEZA 3NDJA 2JCXA 1WP4A 4NR0A 2UVDA 4XQCA 1BDMA 5K6AA 1ZJZA 3GDOA 4EJ6A 4LN1A 3RC2A 4JJIA 1U3WA 2A4KA 1VKOA 1NFFA 5I7EA 5DCUA 5ENVA 1L1FA 2IXAA 2H1SA 4KDFA 4BGVA 4DREA 4R1UA 3DOOA 5CPFA 5JAMA 4ALJA 1HZJA 1CIVA 1R6DA 4XQGA 4P22A 4B8ZA 1DC4A 2Z1MA 3F46A 3FWNA 3B70A 3EVTA 1BVUA 4J1TA 4KWIA 4KP7A 1LNQA 2PA3A 5C37A 4LVCA 1Q7CA 4RVSA 1G0OA 4DLBA 4J1NA 3W1VA 1D1TA 4IMRA 1ZBQA 4OSOA 4CM3A 4EBFA 4J43A 1J5PA 3IUSA 1JU9A 3QVSA 1CEQA 3NTRA 4J7CA 4Z3DA 1HTBA 3MTGA 4GQAA 4YPOA 4MVJG 4IDGA 2AQKA 5B4UA 3H9JA 1U8FO 3JQBA 3BIOA 5TT0A 4YAGA 1M2WA 3BTOA 2VWGA 3NJ4A 4OQZA 1VKNA 4BKRA 2OBNA 5AOVA 2X0IA 2PKQP 3K92A 2O3RA 2XXBA 4ZGWA 2YQ4A 3ZNNA 5TF4A 1P3DA 2JD0A 4A5OA 3ZWVA 4CMCA 4QQRA 2VHXA 2D8AA 1ZXBA 2DFVA 1D8AA 4IDDA 2Y1GA 3GZNA 1GTMA 4PG7A 3DAPA 1XELA 4M55A 3JQFA 4EEXA 4XIYA 4AJKA 4DPKA 4MIYA 3VHRA 4EUHA 3OBBA 4D79A 2W2LD 4Z6KA 2C82A 3AM3A 3I9NA 5A9TA 2ET6A 4W6ZA 4CLHA 1WWKA 3S55A 4LSMA 5T67A 2LDXA 3GR6A 4HADA 1QYDA 3ANLA 1LXCA 2BI8A 1MP0A 2CVQA 4Z3KA 1XHLA 1UXKA 1SMKA 3ICCA 4L4SA 5HTOA 3WYCA 1Z7EA 1WXDA 3E5RA 2NVBA 5TNXA 1TB4A 2PFGA 4YQYA 1R4MB 1YKFA 1U4OA 3B1JA 3PJDA 1PJBA 4MVJH 4MVJM 2V6GA 4DC1A 1NX6A 1VJ0A 4ILKA 2EV9A 1QORA 3H7AA 3DMTA 2QYTA 4BNMA 2Y1FA 5KKCA 2QZ9A 4DTIA 4GLOA 3UKOA 1LLDA 2GN8A 4NI5A 2H63A 3O8QB 2FOIA 2QYSA 3CINA 5KIAA 4YBZA 1JKFA 2AQIA 5EQDA 1UP4A 3UVEA 3LT2A 3ZHBA 1I32A 1ORRA 1BVRA 4WOKA 2EKQA 1E7WA 1OI7A 2ZYDA 3V8BA 1E3WB 3QVWA 1L7DA 1PEDA 4QT0A 1GCUA 2EG9A 2W2KA 4J90A 2Q45A 3BYZA 2PLAA 3F4LA 3E8XA 3F1LA 1ZMOA 2HK8A 3BTSA 4E30A 3RUHA 5DZSA 1A72A 4BKUA 4JP3A 4CM5A 1Y8RB 5HRUA 2AE1A 4UVGA 1HRDA 3I6IA 2IDZA 3Q0EA 3JQ9A 4XDYA 4LCJA 1UZMA 4L74A 4O0LA 3VZSA 1YO6A 4UEKA 2GZ2A 2CVOA 1PL8A 4OM8A 2UAGA 1N8KA 1RJWA 2VZ8A 4IY1A 3P5SA 3GNTA 4DQXA 4B4VA 4IMPA 2W98A 3AUTA 1U2GA 2DKNA 4FR5A 4H15A 5FF9A 1QYWA 2ZCVA 4D41A 1W6UA 4RO0A 4E5PA 3I83A 3TL3A 1QYXA 2CVZA 1ZH8A 5KVSA 4D45A 2J3KA 2ZQZA 4W4TA 1WMAA 2AG5A 2DUWA 3U4CA 6LDHA 1KY4A 1LDNA 3CMMA 1CYDA 4KUHA 1PJSA 2IXBA 5JBIA 4S1VA 3GZNB 3MOGA 2DPHA 3OECA 4QO7A 2AW5A 3ANNA 4N7RA 4R1TA 4GSKA 3AI1A 4XJTA 3TF5A 4J4HA 3RAJA 3NDRA 2PTGA 3I4CA 4D0SA 3QV1A 1T2AA 1XYGA 3B1FA 3UXYA 2DTDA 4F3YA 4RF2A 3WWZA 1Y6JA 1SCUA 5EL0A 4FGSA 4YCAA 3ZWWA 4PCVA 3JD4A 1A5ZA 2E82A 3A1NA 4PRKA 2QG4A 4MKRA 4XD2A 3WJ7A 3F47A 4CPDA 4YA6A 4CMBA 1R15A 1O8CA 5THQA 2DU8A 2OP1A 4O1MA 1LRJA 3UFXA 4INAA 1XEAA 3HN2A 3IJRA 3KXDA 3KLPX 1ENPA 2X8LA 4NHEA 5FI3A 5IN5A 1WZEA 4IXWA 1Y1PA 4PFJA 4R41A 3VTFA 1ZKMA 1ZSYA 4Y6SA 1KYQA 4E31A 1PZGA 5JPIA 2HKIA 2ZB3A 4DRYA 2X4GA 2PNFA 4BHTA 2PGLA 1F17A 1J49A 2ZIZA 4PG4A 4ZQEA 4IIVA 4YAEA 1PZEA 3GAZA 3WMXA 4BO8A 3AY6A 2QRKA 4GGPA 1VI2A 3I52A 5ENDA 2FPPA 2AQ8A 1IZ0A 2A35A 3KEQA 5JCJD 5JYFA 4MIEA 2HK7A 3LT0A 1KVTA 3RROA 5IAAA 3ZZNA 2XAAA 4E4YA 3OIDA 5BT9A 2J5KA 3C1OA 1O0SA 4ZQBA 9LDBA 2C2YA 4FW8A 2J5QA 4RJTA 4Q3EA 4ZQHA 1Y5RA 4B7XA 2D1YA 3KV3O 1UZLA 3OSUA 1FMCA 4PLGA 5CP8A 3H9GA 4CQMB 5B4VA 2V6MA 3WWYA 3JQDA 4J0FA 4I5EA 4ZU3A 3GLQA 2W2KB 2JHFA 1KS9A 1TEHA 1R4NA 3EAGA 4IZHA 2VYVD 4QX6A 1LRLA 1Y8RA 1ISIA 1RKXA 5A3JA 1XG5A 4NZ9A 1QV6A 1Y9EA 3ASVA 1DC6A 4BNTA 3GEDA 2D59A 5CPBA 3WGYA 4YDRA 3TOZA 1YB4A 3WMWA 1TT5B 4YEDA 1EBFA 3H3FA 3JD1A 1GL3A 2O3UA 3PPIA 4QUKA 4BQRA 3LVFO 4AICA 1PJLA 2CDAA 2HSDA 3HDQA 1Q2XA 5IZCC 4LISA 2ZYAA 5DNAA 3RSHA 4BO7A 2O50A 1NXQA 4HXYA 4KQWA 3G1TA 1N9GA 5HBRA 4Z0PA 5U4QA 1YBMA 2B4TO 3Q6IA 4TMFA 2E4AA 4GKBA 1OFGA 5KJCA 3GC6A 5KNLA 2X0JA 3F6YA 1SOWA 4J91A 5ADHA 1Y81A 5GZ6A 4YQZA 4R51A 5GZ3A 2EGHA 4O6VA 4UUNA 3O9ZA 3WXBA 4BNGA 4HBGA 5CDTA 1QXSA 4TQGA 4RGBA 1K5HA 3L07A 3TRIA 1EFKA 3B6ZA 3U62A 1M6WA 4B79A 5IDXA 3DO5A 3UW3A 1EUZA 3DHYA 1MB4A 3F9IA 3SJ7A 5C7LO 3ZW8A 4BKOA 4DQUA 3W6ZA 1M75A 3JYQA 2YFHA 1YL7A 3JYNA 3SLGA 1VL6A 2OOSA 3N74A 4OYRA 4RF3A 3RU7A 4ZJUA 1LSSA 5LC1A 3QHAA 2VTDA 3OP4A 5G4LA 1DAPA 3W8EA 4BIIA 2WYWA 4BGIA 1NPTO 3GVPA 3MJSA 2RAFA 4IBOA 5T8KC 3GK3A 2VCYA 1E3EA 1HT0A 3WGIA 3JTMA 1LC3A 1DAOA 2NSDA 3L4BC 4ROSA 5LDGA 4PVCA 1R12A 2UDPA 3ITDA 4J2OA 3AOEC 5J23A 1E6EA 1X14A 4AJIA 3ULKA 1DSSG 5CEEA 1LDEA 4GX2A 1DRUA 5F5NA 1QKIA 1NAHA 1O9BA 2EWMA 1PL7A 4NJOA 2HJRA 3CH6A 1NTOA 3RBVA 4N5NA 1XGKA 4PIVA 2Y99A 4J9VA 1T26A 3LT4A 5L3ZA 4CLXA 1PJ4A 4MKZA 2BF7A 3KRTA 3NGLA 5JY6A 5TQVA 1NVTA 3GA0A 3ETGA 4NFYA 3CMCO 1EQ2A 2VHZA 2ZTVA 3HHPA 4RVGA 3HDHA 2BGLA 5CDSA 1LU9A 1X7GA 4DL9A 2PD3A 2ZJ1A 5DP2A 4BO3A 4OMUA 4E6PA 2TMDA 3RC9A 5DT9A 1C0KA 3GPIA 1WAMA 3QWBA 4DYDA 2C07A 1HF3A 2NU8A 3E1KA 1HYEA 1RM0A 3H9QA 1EQUA 2DBRA 2X1HA 2VOEA 5T6BA 1DLIA 3ZN2A 4E0BA 5CG2A 1DEHA 1Q0LA 4IDCA 3WNVA 4NJMB 4PVDA 3NV9A 2P9EA 3RUEA 1YOVB 4D7AA 4I9NA 4RZHA 4FN4A 2OBYA 1D1SA 1I2ZA 1H9BA 1QYVA 4JP2A 2E49A 2DT5A 2IEBA 3AWDA 3BMOA 2POQX 1RM5A 4MKXA 1XLTA 3DHNA 3TPCA 4AL4A 4CMJA 5ICMA 2Z95A 4TRRA 4BNKA 4CV3A 4DLAA 3L4BA 1Z74A 2GGSA 3OJ0A 1U3UA 2EXXA 4B3JA 1K2WA 3F1KA 3DZKA 1R4MA 4R3NA 3ON5A 4QXMA 5JAIA 3WGOA 4PLHA 3HFGA 5TX7A 4LMPA 2X6TA 3OIGA 2P9GA 2RHCA 2CZCA 4R68A 2B69A 1VSVA 2V65A 3UCFA 1HDOA 3FBGA 1YJ8A 3FCOA 1E77A 1PQWA 2WE8A 1PQPA 4GKVA 4D44A 1E3WA 2FN7A 3D3EA 1I2CA 5CEFA 1NVGA 3TL2A 1SB9A 4J16A 1H0KA 4W99A 1SB8A 4L4RA 5I7VA 3GH3A 1BXGA 4CUZA 4MVJE 4CMIB 1NASA 1YE3A 3GGPA 3I1JA 3IOYA 4M89A 3R1IA 1KC1A 5KJFA 3OQ1A 2NWQA 5JO0A 3EUWA 4MINA 1AXEA 1XCBA 3E48A 4EDFA 4XYBA 3AOGA 1EVZA 2E48A 4PLTA 1WNTA 1BHSA 1TA4A 3O38A 2J8ZA 4K28A 1FJHA 3GFGA 2V6BA 3VPSA 5FEUA 1Z7BA 2WDZA 1M66A 1P9LA 1AGNA 5L4SA 3DZFA 4CQMA 4CR7A 4BNZA 1LI4A 3PLNA 4TRNA 4BMNA 4IPTA 1VL0A 3DWFA 3PFFA 4FB5A 4GX1A 5THKA 3LC2O 4EUFA 4BO6A 4E33A 3WFJA 3CE6A 2NU7A 3I6QA 4XJSA 1DHRA 3U4IA 3VPXA 1C1DA 3NT4A 5L53A 5KWEA 3TZHA 1A4UA 3IL2A 1FDSA 2VOJA 1TXGA 3JQBC 4BNFA 1RM4A 3DC2A 1TVEA 4L73A 1PZHA 1Q7GA 1EVIA 3IJPA 3D4OA 4WCFB 4GX0A 3UUWA 2I67A 5A3VA 4CLRB 2PZLA 4G5HA 4TKMA 1VLLA 4YACA 3KYCA 2ZB7A 5C7OO 3JV7A 3RFVA 3O26A 4AJLA 3JQ7A 1GAEO 2QX7A 3FPCA 2JKVA 4TROA 3OICA 3WBBA 1MA0A 5F1OA 3O4RA 3DZGA 2PV7A 1JA9A 5T64A 2FSVA 4JX8A 2OGUA 3WSVA 3WGTA 2WMDA 4FOSA 1E7MA 2IZ1A 5F21A 4BL5A 1Y8QA 2D5AA 3VVCA 4EEZA 4OO3A 4ND1A 4BS9A 2HDHA 2UV8A 1YVEI 2FHSA 3PI7A 4OIMA 1H93A 3P7MA 1MFZA 3H9EO 3GVCA 3DOJA 3GN1A 1D4FA 2WJPA 1W4ZA 3OEYA 1B2LA 2I65A 3ONFA 4LW8A 4YRDA 2OORA 4LK3A 3QY9A 4RVUA 2VYNA 3UHAA 4BO9A 2DFDA 2I3AA 3OA0A 1KEWA 1DDOA 3O03A 1U7TA 2IODA 1NHWA 4XDZA 3PHLA 3TQHA 2PGDA 4WPGA 2P2SA 1O89A 3AK4A 2VWPA 1WDKA 3PLRA 5TJHA 4O5OA 4LGVA 4FC6A 1GZ3A 1ZO8A 2X7HA 4FQ8A 3GNQA 3RJ9A 1RPNA 3H65A 1XQ6A 3PIDA 3JD2A 4I9HA 3ZWMA 4RPHA 2X9GA 1OAAA 4LSWA 3HUDA 4ND2A 3CEAA 4O59O 3MZ0A 1NFQA 3H6KA 4RQUA 4WLOA 4BQPA 1DFIA 2YHIB 4P8RA 2DAPA 3JQ8A 3IKTA 2GF2A 2IEDA 4ALMA 1LQTA 2GNAA 4XA8A 5L9AA 3ASUA 1Q7BA 4CL8A 4OL9A 1C0IA 4ALIA 1GUZA 4E21A 4HV4A 3DDNA 4RPLA 3FRJA 4E2XA 1SEVA 5GMOA 5MGBA 5GZ1A 4WLNA 3CIFA 4WLFA 4E2WA 1DRVA 2DPGA 3EC7A 3QVTA 1KC3A 3QQPA 3RUDA 2FP4A 5LDHA 1F8FA 1UAGA 3C1AA 4FC7A 4YRBA 3RFTA 4R01A 4N54A 2RCYA 4EZBA 2J6IA 3LU1A 1I3LA 4DLLA 3HB5X 3WDSA 4Z9FA 4EITA 4H7PA 3LQFA 4WE3A 1E1NA 2BI7A 5U9CA 4CM9D 3GNSA 2Q99A 3C8MA 1M67A 1M6HA 1ZXLA 5A1TA 2P9CA 3PJEA 2Q4BA 3A4VA 3C7CB 1GU7A 2O3JA 2VUTA 4B8WA 1DB3A 5CG1A 1UDBA 2AMFA 4YJFA 3ZWPA 4H16A 1GD1O 2DQ4A 3PQFA 4RPKA 4CMEC 5BQFA 5EN4A 5EJ2A 4CMEA 2PD6A 2C54A 4F46A 4FJ1A 3QWIA 4DGSA 4UAGA 4R3WA 1E5LA 3D0OA 4U8GA 5LCXA 4MIOA 1C3VA 2P4QA 4BNYA 2GZ3A 4NIMA 3FPLA 1CQJA 1GEEA 2GSDA 2PH3A 5H81A 3VTZA 4A73A 5EQFA 1K6IA 3AI2A 4PG5A 4M1QA 2VWQA 3AOEA 3DONA 1D7OA 3OMLA 4UUMA 5A5FA 2SCUA 4CR8A 1WW8A 1YS4A 1B14A 4PLFA 1PS8A 1NQTA 4O63O 4ALLA 4RF4A 1H6CA 2C20A 4KZPA 4CM8A 5CDYA 4XB2A 3ETDA 1GCOA 3S2EA 3GVXA 1PJ3A 3MJ4A 1IE3A 2B5WA 1PIWA 2NTJA 3R0IA 1BW9A 3BMNB 3GDGA 2B4QA 2VT3A 4E2ZA 1E92A 2VQ3A 1Q0HA 1GEGA 2PZJA 1IB6A 4DBVO 3UF0A 4YYZA 1NWHA 3GPDG 1JDJA 2CD9A 3C1TA 2J5RA 4JROA 2FR8A 4BO2A 2NTNA 5GY7A 1E3SA 1P1HA 1JKJA 2QRJA 4E2YA 3QWFA 5TRTA 3PJFA 1YGYA 3ENNA 2JCYA 3RUAA 5IFLA 3R3JA 2NVWA 2I66A 3FWZA 5B1YA 4I8XA 4WCDA 4CM7A 4IJWA 1BSVA 4JIGA 3B20A 5IDWA 4JCOA 3D64A 5JLAA 3QSGA 4CMKA 4NU6A 2JAHA 3ZWNA 3H5AA 4NBTA 3A14A 3ANMA 1BTOA 4D3DA 3FD8A 4BNHA 1E1KA 2GN6A 1PGQA 3CXRA 2EW2A 3LYLA 1NM5A 3D7LA 4Z0TA 1K6XA 2J3JA 1NQ5A 1HETA 4PLYA 4DIBA 5A05A 3JQFC 1LDBA 4J1QA 1WVGA 2BMAA 2Q1SA 4FGWA 4R1NA 5B12A 5JC8A 3PIIA 3TNLA 1TLTA 3EVNA 1KERA 4MP3A 3E9MA 4YT2A 3PZBA 3ZW9A 1HZZA 2G82A 3E03A 3LLSA 2X9NA 3JQAA 3MWDB 4IIUA 2VYND 3NJ8A 3G0OA 2W4QA 3V1UA 3I23A 1I01A 4HFRA 4IGFA 3E6AA 1DIGA 2CNBA 1B15A 2GR9A 3K2EA 3RIHA 1CJCA 2A92A 4GLLA 3PK0A 4UVEA 5JDCC 3T7EA 1EK5A 3LDHA 4OOEA 3B1KA 3BHMA 3GEMA 3PYLA 2PKQO 1SEPA 1JWAB 1U8XX 5I9LA 3VZQA 4G81A 3VVBA 5HWSA 2ZB8A 1X7DA 4BNWA 3C7DB 3D4PA 2I6TA 4YJHB 2FY8A 1X13A 4CM4B 1PX0A 3DBRB 2TMGA 3JQGA 5JAQA 4A26A 4UREA 3WSWA 4CODB 3JQ8B 4LMRA 5DP1A 5EPOA 2J3IA 3LK7A 1HLDA 1VM6A 4PZDA 4FFOA 5HA5A 1NHGA 2VRCD 1XR3A 1E3LA 4ZQFA 2D2IA 5JY1A 2OMEA 1KVQA 3G79A 4ITUA 2G0TA 3IDSA 2Z5LA 3TFQA 1A9YA 4OXKA 1UJMA 3WGHA 1E7YA 2HCTA 4M87A 3MJTA 5COQA 2VZ0A 3DB2A 1VJTA 1LC0A 2Y93A 2GN4A 4WNIA 2X58A 2WD8A 3UH1A 2EKLA 3GHHA 2I5PO 3DBLB 3PHHA 3U4DA 4PLVA 4JJGA 3RBXA 5ILOA 5JCXA 1HE2A 4JBGA 5ITWA 3OQBA 5BNTA 4PZCA 2X0NA 3NGXA 1F8GA 4NG5A 3R3SA 3TSCA 3L0DA 2GDZA 2GCGA 2D5CA 3IMFA 4E5NA 1PL6A 1A7KA 4BUCA 3OETA 3EGOA 1HKUA 1T2DA 3DHEA 4IQGA 4E5KA 3GY0A 5JMWA 3ZGYA 3L9XA 3JYLA 1GADO 1MUUA 1U4SA 4B3IA 3RI3A 2O2YA 2Q4EA 1XWFA 1FDVA 2ZKLA 2HU2A 5JDCA 1JW9B 3RC7A 1D3AA 3OM9A 4QO8A 3WX0A 5EESA 3ZU5A 4XYLA 4QECA 2GASA 4IDFA 4YWJA 1I30A 3KB6A 2AG8A 4PZEA 4YJGB 3UAGA 3VDQA 1YXMA 2UUPA 3KETA 5A4DA 4D43A 1NVMB 3VH2A 1U9JA 1HSOA 5IZ4A 1AHHA 2Q22A 2ILTA 3WR5A 1DHTA 1FXSA 4KTVE 4KDEA 2JFGA 2C2XA 4Z9YA 4S3MA 2QW8A 3WS7A 1DRWA 1HYHA 3VOSA 4MP6A 3VPFA 3TZKA 1H94A 2DTXA 1XA0A 3C85A 1EMDA 3VKVA 2HQ1A 4CLOA 3R6DA 4U6SA 1DIRA 3GMSA 1T25A 4WECA 1FK8A 3KLMX 2Q1TA 3QLJA 4A10A 2J3HA 3I9OA 1ZK4A 2ZCUA 4FCCA 4JNKA 1E5QA 1IOLA 1HE3A 1QRRA 3AJRA 2CSUA 1MXFA 2O3SA 3OJLA 4BMSA 3E82A 2YV2A 4B4UA 1CDOA 5JO9A 3TOXA 3K5PA 3DFZA 1I3NA 5IDQA 1O94A 5G0WA 1ZW1A 3PGXA 4ALNA 3CZMA 1HDCA 4XYGA 2AXQA 4BNIA 1BXGB 1LA2A 1HLPA 3DZIA 2C7VA 3KSUA 1PTJA 4F6LA 4OSPA 1L7EA 4KMSA 3SVTA 3FSRA 1VL8A 4F6CA 4HWKA 1PU2A 5K9ZA 1H6DA 4CUJA 4L4XA 4CMIA 5TJ9A 2NQ8A 3HN7A 1H2HA 2Y0DA 3ZWAA 3DAGA 3EYWA 3F5QA 3PQDA 1J4AA 3U9LA 2O3TA 1JAYA 1O6ZA 1P33A 4WLEA 3WIDA 4BB5A 3Q1LA 8LDHA 4RDIA 1HE5A 2ZTUA 1LEHA 1HDRA 4FFNA 3WYEA 3MWEB 1NQOA 3DTTA 4K26A 2Y1DA 4CQLB 1LQUA 1FDTA 1I2BA 3V1TC 3WLEA 4WLVA 3KO8A 3ZCXA 1ONNA 4KWHA 1PGPA 3X2FA 1B8PA 3ZHYA 1U7HA 4BO0A 5KCZA 4R9RA 3OA2A 4ZRNA 1XKQA 3L6OO 2RIRA 1X1EA 5T5QA 3KEOA 4Z9XA 4ZICA 5G2OA 2W90A 1T1SA 1I36A 3EDMA 5AXCA 4HX5A 4NQZA 1QR6A 4D46A 2JFHA 1F14A 1TI7A 1BRMA 4GSLA 3ZWCA 1M76A 1FDWA 1LRKA 1GY8A 2DBQA 1ADBA 1C0LA 2VTEA 4MVJP 4PN3A 2OO5A 5JYEA 3N7UA 5TC4A 1MV8A 5L40A 3GRKA 1V3VA 1LBEA 1YL6A 3PWKA 3CTMA 1VPDA 1PS9A 1B7GO 1AN9A 3A06A 3EZLA 1GV0A 3CPSA 1KEPA 5CHEA 1BXZA 4BNUA 3AUSA 1B3RA 4IDEA 2Y68A 5JYDA 1NWCA 4Y67A 1PGJA 3MJEA 1KEUA 4AVYA 3JYOA 2BRUA 3H4VA 4Y6PA 4J6FA 3PQEA 5IXYA 2DBVO 3TZCA 1Q0QA 2YHUA 2ZJ0A 4U0KA 2ZTLA 1EDOA 1A27A 1IPFA 4RPGA 4Z0HO 4BO1A 4I5FA 5G0TA 5DBGA 2EF1A 4J7UA 4Q39A 1X0VA 1PGNA 4IDBA 3TDKA 3Q2KA 1ISFA 1ISMA 1GYQA 4MOWA 1B16A 2C29D 2JFFA 2VUUA 4ND4A 5DN9A 3HDJA 3HFSA 3JQ6A 3OQ6A 4XWYA 2LDBA 3GMDA 4CLRA 4YVFA 1DOHA 1LX6A 1Z6ZA 3VZRA 3PRJA 4LCEA 1YL5A 1NNUA 4BO5A 1MGOA 3ZWOA 2FZEA 2ZYGA 3VZPA 1LJ8A 1NFRA 2HRBA 3FN4A 1YQXA 1YRLA 4L75A 5JMPA 3RJ5A 5MDHA 4YAJA 4J3FA 3UCXA 3D1LA 1HSZA 1T1RA 2AHRA 1C1XB 3L6EA 5L4LA 3W8FA 1XQ1A 4M54A 3ADPA 2O48X 2W8ZA 3PWSA 3VPGA 1PWZA 3C7AA 3NT2A 4TRMA 3I9MA 1K6JA 1VSUA 1P1RA 2PWZA 3LC1O 4IS3A 4AJ1A 2B36A 2FPIA 3KZVA 4IQ0A 2VUSA 4P4LA 3SLKA 3QP9A 4WASA 1S7CA 2GLXA 1I24A 1UXJA 2Q1UA 3EHEA 2Q49A 1HXHA 1ISJA 2ZQYA 4IGEA 4D0RA 3OHSX 2GPTA 1P45A 2Q1WA 2YFQA 2VNAA 4QEDA 2O7QA 3G17A 1KVSA 1AHIA 3PDUA 4EUEA 5JNLA 2JAPA 1QMGA 2B0JA 3DFUA 4R4JA 1DIAA 4J9UE 1GYPA 3M1LA 1H2BA 4FFMA 1MG0A 1ZK2A 2X5KO 2D0IA 4XB1A 4IM7A 4JBHA 2EP7A 4LRSB 4E3ZA 4YJHA 2I3GA 3BAZA 4ID9A 4MO2A 2HRZA 1HEUA 1WDLA 4WKGA 2GZ1A 4YT8A 2OHXA 3NYWA 1CQIA 2BELA 1AUPA 1H5QA 3PP8A 5EMHA 5JW6A 2Q2VA 3OEWA 1GYRA 5A9SB 5ICSA 2EJVA 1BW9B 2JL1A 4XQEA 5FFFA 1P1KA 4XCVA 5AXBA 3JQAB 3LC7O 3ENKA 4E12A 3V2UA 4CLDA 2I99A 5HM8A 4AFNA 4ONEA 4BNJA 4JXKA 2PR2A 2B5VA 5DULA 3HNPA 4Q3CA 4W82A 4LRTB 1RM3A 4UUPA 4KUGA 1R0SA 5T73A 2CFCA 2C5AA 3S2FA 2C0CA 3AU9A 5F1PA 3SC4A 1MXHA 1QV7A 4EJ0A 2Y05A 1E7SA 5CAEA 2G1UA 3K9QO 2NUAA 1XU7A 1P74A 3FNGA 5I7SA 4UEOA 1DC5A 3UN1A 4BMVA 4ZN6A 1OBFO 3V2HA 5EERA 2ZTMA 4JK3A 3AFNA 3FHLA 5F1KA 1NYTA 3AI3A 3KSZO 2IZZA 1BMDA 3F3SA 3KYDA 4TZKA 4YR9A 4TKLA 1R66A 3SC6A 3T7CA 5KTKA 1R0LA 3DQPA 2X86A 4EGFA 3GN2A 4BB6A 5TIIA 4K1LA 5COBA 1ML3A 1ENYA 3OJEA 2WTBA 4HP8A 3U5TA 3P2OA 4YJDA 1I3KA 3DR3A 1IULA 1J0XO 4NBWA 4BV8A 1LDMA 1PJQA 3W6UA 4CQMD 3KTDA 1YJQA 4PGFA 2YQ5A 5DCWA 1LSOA 1V0JA 4BNLA 3FR7A 2X5OA 4K9DA 4DPMA 4JGBA 3TZQA 4CR6A 3AUUA 1ZSNA 4NBRA 5DBIA 5FYDA 3DBLA 3ZWBA 1W8DA 5K6AC 4FFRA 1IUKA 4CL3A 1YDWA 3DMTC 3WTCA 3H2ZA 3W4KA 4IXTA 4Q3BA 3HZZA 2BKAA 5TT1A 5G0UA 1PZFA 2H9IA 1K3TA 1UXIA 2O4CA 4RCVA 4CMGA 3COSA 1ADGA 5BSHA 1V6AA 4MJLA 3HB4X 1EBUA 4PG6A 1GZ6A 1HWYA 3PHGA 4RVFA 4YT5A 3ITKA 3DL2A 4YJGA 2Q3EA 3PYMA 3VH4A 4AJEA 5L95A 1UZNA 2BH9A 2VRBA 4B3HA 1HDYA 1HDGO 4GGOA 5JC1A 3QRWA 1ZMTA 4IQ8A 1GPJA 1ENZA 2UUOA 3ZV3A 3PTZA 5ER6A 4EJMA 3LT1A 5DOZA 2JJYA 2PGJA 4UVHA 1QG6A 1RYEA 1B0AA 3H9UA 4P4NA 3FF4A 2JHGA 1LSJA 4BO4A 1EE2A 3ZHXA 1PJ2A 2O4UX 1P0FA 2NQTA 3MJVA 3CKYA 3PXXA 4AJ4A 4DQVA 1HE4A 2VHYA 4CUKA 4HFJA 1GUFA 1AE1A 1N2SA 4NNJA 2HAEA 1SZJG 3RD5A 2QIOA 2AEFA 5JSFA 1B8VA 1X7HA 1JAXA 1DPGA 4W9NC 4QTZA 4PLPA 3INGA 2V6FA 3GQVA 2IYPA 3FR8A 4C7KA 1E6WA 4TWRA 1UUFA 3AFMA 4ND5A 2JD1A 5A5EA 3BMCB 5BSEA 3Q11A 1QLHA 3JQ9C 4NBVA 3IUPA 1DJQA 3FTNA 3K96A 5JCJA 4WOJA 5ES3A 3PJGA 4GWGA 4YAKA 2R6JA 6ADHA 5EIOA 1N92A 1T4BA 3DZBA 3GHYA 4DA9A 3KHUA 2NU6A 4XIJA 1F06A 5B37A 4BVAA 4IUYA 1ISGA 1OC4A 2HMWA 2R00A 2HK9A 1BDBA 4OJNA 3JYPA 4GMGA 3VPHA 1NPDA 1OMOA 2WD7A 1P1FA 5JFOA 2NADA 1GUYA 5H82A 5I7FA 1PWXA 5A9RA 3MOIA 4R54A 1E1MA 2Q46A 4AG3A 4R9SA 4N18A 2EIHA 3EMKA 4BV9A 3BMOB 3SX2A 4PLZA 1KIFA 1MFPA 2P91A 4P38A 1ONOA 4DC0A 1HYGA 3HSKA 1IYZA 4OAQA 4BKPA 1IY8A 2HMTA 4NK5A 4DBZA 1SAYA 2YDYA 4XRRA 5TLSA 3INTA 3SBOA 3JSAA 1C1XA 3I9KA 3JQEA 3I9JA 4U6QA 5C3MA 1ZEMA 3EY4A 3WOHA 3TJRA 4NJMA 3WFIA 3WGQA 4IDAA 2AEJA 1YONA 1DO8A 5KJ1A 1T24A 1JLLA 3I9LA 2RH4A 1GQ2A 4Y98A 2QZZA 1U2DA 5HS4A 1E3JA 5C7IO 1BG6A 3JCZA 5F5LA 1G1AA 2WSBA 5T8KA 3QJ5A 1T4DA 2PH5A 3KYBA 1UP6A 1ADFA 1CERA 4RVHA 3ZU4A 3S2GA 3C3XA 3OH8A 9LDTA 5CFZA 2X5JO 1B3BA 2FR0A 2P5UA 1EFLA 5AVOA 4M49A 1ENOA 4AJ2A 2VRCA 3PZRA 1AXGA 4B7CA 1ZK3A 4FD3A 1OC2A 2PZMA 3WB9A 2FPGA 3HADA 3DOCA 1LDYA 2CMDA 3S2IA 3ZV6A 1W0CA 3NAQA 4R1SA 1EZ4A 3FNFA 2D4AA 3OIFA 3VH1A 4K6CA 3D4NA 3L77A 4CV2A 3L4SO 3U0BA 1Y7TA 4H3VA 1GQYA 1EUCA 3K31A 2FMUA 2XXJA 4WLUA 3PVZA 4OH1A 1IPEA 2DVMA 2IZ0A 5KVVA 1WMBA 1TT7A 3GAFA 1KOLA 5M6DA 1IHYA 4WCFC 4RF5A 1ZJYA 3KBOA 3EK2A 4DPLA 2X0RA 1LDGA 2YYYA 3RUCA 3KSDO 1DLJA 2DBZA 3W4JA 1KVUA 2X23A 1A7AA 1T2FA 3RBZA 4NPCA 3FI9A 3GDFA 4WUVA 1G0NA 2EW8A 2P68A 3JD3A 4FFLA 4CM4A 1ZVMA 4ZVVA 3VC7A 2BLLA 2FSSA 2GN9A 4NU5A 1TT5A 3WICA 3H5RA 4PRLA 2O3QA 3I4FA 4LVUA 4NK4A 2BFOA 1OOEA 2YZ7A 1PQUA 3DZJA 3GOHA 2GERA 2YW9A 3A28A 4J0EA 1S6YA 3FNHA 4XX0A 2OZPA 1P0CA 2PD4A 4OXYA 4MP8A 1EDZA 1CF2O 1E7RA 3F5SA 4E5MA 3I3OA 2WD7B 3ROQA 1GR0A 4J4BA 1R4NB 1GDHA 2GUGA 4L9RA 2GRAA 4A7PA 3LF1A 2OL4A 3DXFA
chains in the Genus database with same CATH superfamily
4BMCA 1FW6A 5LNK6 1YH3A 5CFQA 1PR3A 2HGZA 5K05A 1H2WA 5CTAA 3TECE 2GAAA 4WBNF 4RORA 4WIAA 4PGMA 2ODNA 2CLIB 3MT8A 2NV6A 5HQ3A 2YY7A 3BTVA 2AR7A 4Y8VA 3LHDA 5LQDA 3S5JA 4W5RA 1U80A 1YZGA 3IIKA 5AM2A 2OCLA 4JT9A 2Z1NA 1U9ZA 3LOPA 4PYQA 4ER5A 2M32A 2O8BB 4CM6A 3C7KA 4ZEXA 1ZI6A 4JU8A 3BE6A 3M3HA 5BN3A 2H4ZA 1KP2A 2YHIA 3UGKA 5JI2E 3TN7A 1YOVA 3AL0C 1T9DA 1T2VA 1JEAA 2G17A 5CURA 2PYZA 3LUPA 4N1AA 2XRMA 4MI6A 1XRRA 4TXLA 5LZ2A 4B2PA 5DK4A 3BHJA 2D7DA 2F4NA 2RH8A 4LYGA 4AZ3A 3HQ4O 4F5DA 3DZHA 5JYAA 5C4MA 4D9JA 1AB5A 2Q6LA 2Y1WA 5KHOC 3ADDA 1WTAA 4TQUS 4BFUA 1VYVA 5F23A 3NOVA 2GYYA 4HF7A 3QTBA 4NH4A 4W9NA 3UATA 3AHFA 3NEPX 1E6UA 1A4IA 1ZD8A 4TT3D 4BB9A 5EUQB 3DS8A 1KAQA 2O1XA 2Y0EA 1ICEA 4RWZA 5EUMA 2NXNA 1K8ZB 3KOMA 4OHCA 1HRKA 1ZRNA 3BCRA 1EVYA 2ATIA 4JDUA 4PAGA 3UHJA 3WV5A 4A27A 3AVYA 1RKVA 3E0QA 3PHJA 3V7UA 4DLVA 4JUFA 4OJTA 4GS5A 5DYTA 4Q3LA 2B34A 4LHSA 2NPFA 4DR7B 1OASA 3EXHA 1RE0A 4N6OA 4DHEA 2IYTA 5AW7A 3OOEA 3R0JA 4B3XA 3R6LA 1CUAA 2OCBA 5D1HA 4GECA 1U11A 2OXEA 1YMUA 2Z57A 1MC5A 1Y1LA 4WD3A 1V5EA 1XBTA 4L78A 4I3HA 4YAIA 3FG9A 3L9WA 2IY9A 4HO1X 4PNHA 5DF1A 3UT5B 4E5YA 2WB2A 4GL4A 2DLNA 2ODBA 3P9PA 1OFUA 2HLPA 4UVIA 1O95A 2CUKA 2ZWAA 2J9YB 2JS7A 2WIGA 4YRAA 5DNEA 5K03A 4RXMA 3I2GA 4AJHA 4A8JB 3VC3A 2ONYA 3ROKA 3SEFA 3TR5A 2W43A 3SQOA 1XD2B 2PX4A 5EINA 1I13A 1DINA 1ZM9A 2AR9A 2HT6A 1F2UA 1OH7A 1UXHA 1U3TA 4HN9A 4IJUA 2E89A 3ZV5A 5BMOA 4O2BB 2CXRA 1T2CA 1QSGA 3O4FA 4KRYA 2R2GA 3ILXA 4NP6A 3D7KA 4NV1A 4MDEA 3EIWA 3ESXA 4JA2A 2GLUA 2CY0A 2OHJA 3CNBA 1WXFA 4MUHA 3DMYA 3MGAA 1CW2B 1SK9A 1U3VA 2VTVA 1SQFA 1ZFNA 2ZBPA 1T2EA 1WF6A 2KMLA 3EPBB 4N5LA 2GOYA 4DYVA 4HT3B 2AC2A 1I5RA 2XAUA 1G9TA 5JIBA 3E9NA 2M6LA 1UBSB 2ZJAA 1QMPA 1TF5A 3MA0A 4FXOA 3I6MA 3V7WA 5I8WA 2VN8A 4BGUA 4TZTA 1US8B 3JW8A 4QRIA 4FGZA 3W7VA 3A6ZA 3OQVA 1VECA 1V2GA 2F43B 4JJ6A 5AOAA 4G1BA 3LUBA 2RMKA 3T1OA 2D2VA 3HBLA 2G9ZA 2NACA 4WFKA 2GFIA 4DNXA 3ZXYA 1NR1A 3SZUA 4PSDA 4ZMRA 3EP8B 1XKTA 2QW1A 2XYRA 3HWRA 1DL5A 3OLQA 3ZLJA 2WAMA 1A2OA 2IC5A 5E6UA 3E18A 3NS7A 4N12A 4UM8B 5JZVA 2JIZD 4CMHA 1I2AA 2H00A 2WA1A 5CCXA 4KG7A 4QBFA 4TLMB 1X3SA 1GDDA 2EJWA 2HR1A 2EL7A 4XKJA 4C6HA 5KNCH 1G3QA 3ZEIA 4JNCA 4H7JA 4B7AA 4G2NA 4GX5A 1ORDA 2NZ8A 3AR3A 3RRZA 5A4KA 3LPAA 4UEJA 1IZYA 1LI5A 3TQIA 3LPCA 2ZM5A 4Q3AA 5IZCA 1ACLA 2KLBA 5CLGA 2HDWA 3INRA 4IIDA 1MTOA 3HE3A 4WKCA 5C1PA 1NVDA 2XCOA 2WP8J 1LTQA 2XWJI 1SVNA 5M3BA 2OFPA 4JLUA 4AJ9A 4MVJI 1V43A 1Z5UA 1QTQA 2NU9B 3H2SA 4RANA 4Z4EA 1W4RA 1ZLXA 4HAIA 4UULA 5JS6A 3P96A 2G5PA 3KFVA 2QD1A 1DWQA 2W6PA 3HA3A 4XSVA 4YB8A 5DYNA 3DE6X 3TLBA 1BQ4A 3R41A 3ANSA 3PICA 5AESA 3QNUA 4FSXA 4J1SA 1IXKA 1H23A 2WICA 2F9LA 4AI6A 1KU0A 3WBKA 2YWJA 3FTPA 2X9VA 5IN4A 3GGOA 1DKUA 4RBNA 3WP0A 2HYIC 4ZOAA 5CLHA 3V8MA 1Z45A 2XB6A 5LIPA 1TYAE 3GFBA 5HF6A 3TIGA 1BGXT 2NU9A 4C7XA 4N49A 4P4TA 4GHWA 5I51A 4M22A 4OLFA 3ECAA 1ULUA 2ZPAA 1EQAA 4A0GA 3I3SR 3SFTA 4MYDA 4L08A 3QVXA 4LVOA 4XGIA 2DCMA 5LQMA 5BXYA 2BVNA 3M82A 3O1HB 4Y0NA 3GO4A 3JWEA 2WIBA 1QHGA 3K0HA 1M1XB 3QXJA 3E9QA 1T6YA 3OTOB 1OLUB 3ZTWA 4OLBA 4UCXA 3FNIA 3QFCA 4ZO8A 3FTEA 2XXAA 1LNZA 1ZIXA 4RHEA 3ZCQA 3PQ2A 5HTKA 3ZY5A 1D04A 4AU1A 4ZXFA 5FOUA 3DMGA 4KFUA 3WQRA 5M2QA 1J70A 2JB9A 4A6XA 5BVGB 2ZRPA 5G0VA 2IP1A 5CXQA 1XZQA 2P0YA 3CZPA 1MO2A 2HDOA 1WY7A 4TQAA 1OVMA 4TOIA 5IMSA 3DVAB 1H2ZA 2FSIA 1YDFA 1AOXA 4K8RB 4ALKA 2CFSA 1SPXA 3VU8A 1K7EB 3V8VA 3CLRD 3UICA 3AVQA 4ZOBA 1KNXA 1TEVA 3OF5A 5G4KB 3G7SA 1GGMA 4Y2JA 4ZJZA 5IJ0A 4ZVRA 4PS0A 3NGMA 3B7GA 5FUVA 3GT0A 3VHLB 1N5IA 3IAXA 3R0XA 4IH9A 4E09A 4TYMA 3WJAA 5JEDA 4RCYA 1C3XA 4L8YA 2V97A 1UK9A 1UH5A 2WF9A 1WXQA 1T3GA 2V7PA 3IC5A 2YWXA 5BW5A 3NEYA 4F6RA 4CHGA 2WYUA 1NUPA 2C9BA 3UXEA 3EC1A 1Z5WA 221PA 4G8CA 3ZWYA 1PSWA 2VFAA 4MQUA 1Y7IA 3MUEA 4WY5A 5BOVA 3OSZA 5I47A 4UUQA 2FWRA 1Z73A 1Y98A 4UHHA 1PLLA 3DT9A 5FPPA 2O23A 1V26A 4OGWA 4IFBA 4FWTA 4QGAA 2GKOA 4M9XA 4MEJA 1Z25A 3B5IA 4IGAA 4BX0A 4DM3A 3T9FA 3TSWA 2I4TA 3IQWA 3H86A 3F7NA 7REQA 3W77A 4XR9A 2H2WA 4PYKA 1YAJA 5BR7A 1JIUA 2O8DB 1W7AA 4UHBA 3PDIA 5IDYA 1VSTA 5I6DA 1DBRA 2FFQA 3KZCA 5K7SA 5EJGA 2FDCA 1I2MA 4R98A 3DNFA 1JVBA 4U7WA 5KTRA 4EI7A 4R40A 4Q4AA 4KREA 1ECCA 5FADA 1EH5A 3BHIA 2IT1A 4I8IA 4M9SA 5AVYA 5FUBA 5CA1B 4UUOA 1G8MA 4GPD1 4IUCS 2DGDA 2PX0A 3F6BX 4KQIA 1NVKA 3WK8A 2H5IA 4DLYA 2XGOA 2VPTA 4GRDA 2JAQA 3OJOA 2Y66A 1C2YA 5HG0A 2VYFA 5AO9A 3EXHB 4MWBA 1FQOA 1MF7A 4GH5A 5DHQA 4IRXA 5ARCA 5ARDA 3TPFA 5F7OA 4LJAA 3D6MA 2Z1DA 3K6JA 4O2LA 3IBCA 2AC4A 1RRKA 1LFAA 1YUMA 5DHRA 1MV5A 3OCYA 2D54A 1F60A 1K4MA 4MITA 3DKRA 5ILQA 2QVXX 4QQNA 2GN1A 1E9BA 1MDFA 1N2GA 3OO0A 4QYSA 3ZW8A 2YZNA 3VNAA 1J42A 3W06A 4AG6A 1X8XA 3E9DA 1UBGA 3EQ2A 2APJA 2QRPA 3F2VA 5FLXA 1EVJA 4CFYA 1H2EA 3EW7A 3P26A 4YUYA 1TW3A 3RUPA 5IJZA 1H8HD 1E2QA 13PKA 1ND5A 4AMBA 4DIFA 1Q0ZA 2BEVB 4AMVA 3DG9A 1R0BA 2ZE8A 3AXTA 3CBQA 1IIBA 1I3MA 3EDCA 5JZSA 2NM0A 1RPJA 1N9GB 1UDAA 5LP6C 2F3TA 3QLVC 4OGGA 4FBGA 4U9HS 4BVKA 3D5QA 2I9PA 4Q9LA 4O8CA 4B4WA 1L4YA 2IXEA 1UXGA 4FZRA 4YIKA 1Z17A 4CM1A 4LXYA 5IAOA 1GPUA 4D42A 1I3CA 3FGPA 3CZQA 3QWAA 1JLKA 1K7FB 1OX5A 2AJDA 1Z7WA 1VJCA 1IY0A 2E21A 1VLJA 3OIUA 4M7WA 3UMSA 5JDIC 4M1SA 4C07A 4D99A 1CB7A 4DMGA 1N1MA 1RADA 4G0MA 1TUIA 3G13A 2P62A 4QARA 4V1CA 3LSYA 4QSMA 3EZYA 1ZUNA 2OWDA 3NH6A 4JD5A 3ZDEA 1ARZA 3DZDA 1G5QA 2BUBA 1UJ4A 1VHDA 4ETIA 4XGRA 1I10A 3KCQA 4ZCQA 2A9FA 3HG7A 2FRXA 3OHPA 3CUKA 3ORHA 3TH5A 5EIXA 3K2BA 1X15A 3L6BA 2GPBA 4NLLA 3FPEA 4B2LA 5C53B 3IP3A 2POCA 4A6DA 4J0IA 2IH2A 3THYA 1MIHA 5HKBA 2I6UA 4R69A 1TVKB 4K9OA 1W29A 2UYGA 2TRSB 3ZHUA 5CFLA 4R2LA 4HVCA 1UP7A 2OORC 3GXOA 4GBJA 3FLAA 4HQ6A 1VJ5A 1RHQA 4EG0A 1DI0A 3UMYA 4R16A 3MUNA 3LP5A 2OHHA 5K0ZA 1R0YA 1SG6A 1SVMA 1U5BB 2ZRAA 2FUG1 3MTJA 1WZNA 3E5NA 4C3UA 3C3KA 2Q29A 5KREA 1UR5A 4QVKA 3NUGA 1QHYA 1R6AA 1S1CA 2F64A 1GZUA 3PPXA 4F4UA 4DNFA 1IEVA 1L5OA 1XTTA 3V6LA 2VVTA 7MDHA 3MINA 5KOIA 3NWOA 3PNQA 3HCAA 3FNEA 1G7CA 5HZKA 1FQWA 2WLTA 3EVEA 1YQDA 3FKSA 4M6WB 1RWNA 4KHZA 4L6AA 1KVRA 3NTOA 1WEHA 1E62A 3STYA 3W2TA 1BHO1 2MT9A 2YV1A 3VGJA 1VQ1A 5DGHA 4KTTE 5A5GA 4FYPA 1P73A 3IALA 3ZK9A 5IUKC 4Z4QA 3IWDB 1ODIA 1TLLA 4NXNB 2WYVA 2H6EA 4OKIA 1ZUD1 4DC9A 4DMMA 5JBNA 2HJSA 5DNUA 4AULA 4C0SA 2X2EA 2XUDA 4L0DA 1UJCA 2ADMA 2WHRA 3O2NA 3TQQA 3ZE8A 4BKMA 3IAUA 2Q4RA 2A67A 2FTKE 1QWOA 3FUVA 3MRTA 2AQHA 2XUPA 1J09A 4MWZA 2NO5A 2XE8A 2ENWA 1W2HA 2HPHA 2WD9A 3Q3IA 2HGSA 3FUWA 2C9CA 3QELB 3DVLA 3NTQA 3H3JA 3L8HA 5ULLA 3SBXA 5CITA 5LNK1 3QE9Y 4OB6A 5CX4A 3S8MA 5JASA 1UBNA 2AMVA 1SUCA 1DT3A 2QPTA 3BREA 4WCVA 3TIXB 4ASUD 1IN1A 4OFBA 3P0RA 3WKDA 4NBLA 1ULHA 2ZREA 5AK0A 1CE8B 1ZH2A 2ZJ8A 1F6BA 2YYZA 3K8ZA 3A6PC 1DADA 2D8MA 5FBQB 3S70A 3FYCA 4PZ0A 1ZNQO 1OIWA 2YDXA 2I4OA 3GUYA 4AS2A 4EG5A 5G0SA 1O97C 4KQXA 3THXA 1SHUX 4F3KA 3C8DA 1MH9A 3FYTA 5BSFA 4GVPA 1ATIA 4DLXA 1J0AA 3PPYA 3PGJA 4E15A 4XTRA 2H92A 4NAHA 4ZHSA 1FYFA 3A6GA 3Q9NA 3SQDA 4D5EA 4XDHA 4UHJA 5LXTA 3BA6A 3D6FA 3LWZA 4OM7A 4ZD6A 2A9JA 2BM9A 1II8B 3EXAA 3A36A 4CJXA 2BFFA 3OM1A 3QHQA 5C18A 2HLDD 2VJBA 3FBTA 2ZIUB 3P4XA 3QPCA 3R0VA 4FNMA 4GC9A 4YNBA 3TWOA 1F0YA 1CTQA 2IHZA 1V8BA 3DBRA 3JQGB 1C0PA 1NUTA 2P3SA 4NS4A 4HY3A 3NHPA 1JIQA 1I80A 4MYCA 4XQ9A 3EIUA 4UAUA 2CN1A 2VCHA 1RD4A 3K0FA 4GNKA 3A1DA 2XMRA 1YACA 1DWUA 1JWBB 3RB8A 1NULA 3THYB 5I8ZA 4DVJA 4K9RA 5BW8A 5D5HA 3PUZA 3WGMA 3SLRA 1XN1A 2JGMA 3W2GA 2I6QA 1SVLA 1JHMA 2DMRA 3Q6MA 3QWHA 4ZREA 4TXMA 3TS1A 4DMLA 3TJZA 4FQ7A 3IP1A 3OF2A 5D7NA 3GXBA 5GJBA 4NEQA 2BP7B 4URHA 5FL7A 1KJYA 3EW9A 2AMYA 4KU4A 3KM0A 5T4EA 4MHOA 1A76A 2EFDB 3DHVA 3FVRA 3NKLA 2CXNA 2XHEA 4OQFA 5AIBA 1BDJA 5JSUA 3OFSA 4K1XA 2ZSIA 1E5VA 1B42A 4YREA 2B1RA 3K71B 2CMFA 3BFVA 4WBNA 1ZN2A 3ED1A 4H1HA 4ARAA 3GGJA 2SKDA 2JCXA 1TCUA 1WP4A 3O73A 3TE6A 3UFBA 3W5CA 4OJQA 2G9RA 3ICEA 3GDOA 3ZY3A 4EJ6A 2E1PA 3BL8A 4JJIA 4TMKA 3TLYA 3KAQA 1U3WA 4NCHA 3ROEA 2UVPA 3GMTA 4HAUA 1VKOA 2V0NA 3OE7D 1L4FA 4DREA 2YIVX 1N8TA 4R1UA 1K97A 2XUJA 2PX3A 1KSHA 1O9HA 2R8PA 2JGKA 4B43A 5JAMA 1OSNA 3BICA 4LC0A 4FOTA 4XQGA 2DHEA 3KR0A 4LV8B 4C1NA 4LOHA 2Z1MA 3ZDDA 1DTWA 1N0UA 2QD3A 4LS3A 4DLZA 2NP6A 5LA6F 1I14A 1TZBA 1YI1A 1NLMA 3EVTA 3G2LA 2IWHA 5HUHA 1FNCA 4G8DA 3AF5A 3THXB 1V8ZA 2D62A 3KKLA 3I4LA 4LVCA 1Q7CA 1G0OA 1TKBA 1T91A 2WJVA 3M5WA 4K6MA 3W1VA 1AH2A 1L5NA 2MYNA 2OFXA 3NRJA 3OLYA 4OSOA 5HJEA 4X66B 1M6EX 2Z04A 3S2UA 1H4TA 2IUFA 5F2KA 3RRNA 2J45A 3QVSA 5CMLA 5C0OE 3SKYA 3UJBA 3GLHE 4WKNA 5B58T 2IZOA 4KVGA 4OXRA 4EUNA 5CLFA 3SQXA 1HTBA 1VLQA 3MTGA 3PVCA 1JB9A 1WV1A 4MVJG 2CXSA 4IDGA 3V3KA 3ZWKA 2JFPA 2W93A 3EIHA 4BV3A 4ZVMA 1ECLA 4Z53A 1Q6ZA 4U2GA 2EJBA 3RQIA 4AZVA 1M2WA 2DUNA 1YNSA 4HYEA 2VQFB 3N3BC 1FFSA 2UKDA 4TSRA 4GL2A 2B6NA 3D8NA 4EHDA 2OBNA 3FPGA 3T7KA 1BHQ1 5FUQA 2DWOA 3NM5A 3ESQA 4KXWA 3VGPA 5TF4A 1P3DA 1EM8A 4NZPA 1Y3IA 3L8FA 3UOAB 2O59A 1GN8A 4QQRA 2OO3A 1OTHA 2VHXA 4CMCA 1HT2E 2NNWB 2D8AA 3OEHA 1ZXBA 2DFVA 1TZ2A 5A0TA 3GLSA 4IDDA 2C0PA 3KB1A 4DZRA 3GZNA 3UWOA 3DD5A 2AMJA 1JHZA 2PLFA 4INJA 4RV4A 2XQGA 2WM8A 1EG7A 2PL3A 1RWOA 4EEXA 3R3UA 3R5KA 1NBWB 4MQ4A 4JDPA 3WYFA 2X6QA 2CVFA 4R7ZA 4XIYA 3TEMA 3WWOA 1PQ4A 5DMXA 4C29A 3I2JA 5F2NA 3IP5A 4KI0A 3I2HA 5LBTA 2V03A 4LRWA 4D79A 4OX9Y 3NNNA 4I1OA 3O3NB 1G6OA 3AM3A 2UYCA 3BRSA 3G2NA 1CBUA 1JEQB 2J87A 4QDTA 5LMZA 5LOVF 4W6ZA 1XLWA 2OHVA 3S55A 1FU4A 3H1EA 4OGLA 1QYDA 1JJFA 3S44A 4WZBB 5EZYB 4CXMA 1X77A 4Z3KA 3V4FA 1JDBC 4Y2QA 2ZRHA 5LSAA 3C3BA 2ZRLA 4HQLA 3WYCA 3Q3GE 1VA4A 3F97A 4P54A 4AUNA 3ODPA 2NVBA 5DW3A 3FPKA 4HD8A 4YQYA 2QK4A 3V1KA 3LBIA 1RIIA 4N0EA 4PXSA 4MVJM 1VBFA 1OWNA 4DC1A 1VJ0A 4ILKA 2EV9A 1QORA 5EMKA 3STVA 3DMTA 3SXJA 2QYTA 5ENZA 1EFRA 3GCDA 4B7ZA 3V8PA 4EWLA 1L8XA 2BSXA 3O6VA 3EVFA 4LE1A 4QPZA 1D0SA 3UKOA 3T3HA 1LLDA 1K0FA 4L27A 3O8QB 2QYSA 3E8MA 4RIFA 4HOYA 5LLTA 1SVSA 3EEBA 1JKFA 2WT8A 2R7AA 3DXXA 2ZR7A 3K72B 4LC9A 5CJPA 3LT2A 5EQDA 5IW8A 5CK5A 4ZVNA 1I32A 3PQVA 1ZH6A 4WOKA 1CR0A 3VJLA 1QFXA 1E7WA 1JP7A 2DPYA 5I48A 4NYJQ 2A1UB 3V8BA 3PEWA 2Q9UA 1W49A 5DM60 2I7XA 3QUTA 1XI2A 2FB9A 4TTAA 2G1KA 2W2KA 4J90A 2MSKA 1T43A 3HYNA 4UCFA 4E30A 1RCFA 1AHPA 3BTSA 1TU4A 1Q5PA 3EGCA 5E6SB 1A72A 3CLHA 3EPRA 1HK7A 3VVLA 4BKUA 1A4XA 1LPMA 1MAUA 1O4WA 1WB9A 1DQNA 4N8SA 1M7GA 2I71A 5KSYA 3BORA 1W47A 3A1EA 3JQ9A 5FOTA 4ZI3A 2DHQA 2ZWMA 4LCJA 4L74A 5SZIA 3VZSA 3ADBA 2VK4A 4I4CA 2MTBA 4UEKA 4KQMA 1K66A 2CVOA 3C3YA 3VR6A 1F2TA 2PS1A 3NTLA 2G5GX 3AESB 4U2FA 1VI6A 4IY1A 4W7SA 4DJJA 5ABPA 4HMOA 2G4VA 1NJ5A 4OIFA 5DYYA 4OI1A 1KY2A 4IMPA 1R6VA 1YC2A 4FR5A 5DHFA 1TD1A 1G20A 1OQAA 5JAUA 5JZMA 1J9GA 4HGZA 1TGYA 3VSAA 3NWBA 2J3KA 4W4TA 4ACAA 1BE8A 1THMA 1Z88A 4K46A 4Z2YA 1OFVA 2OC4A 1JDUA 4EW3A 2I7VA 6LDHA 3FB4A 3IV7A 4BTEA 4FM9A 3ZX5A 2CMGA 2JFNA 2IXBA 1QGOA 3CKKA 1TX4B 2ATXA 3HY3A 3OECA 3DJFA 3BEOA 3TO5A 1KRXA 2Q3HA 4GSKA 2PA0A 3V1LA 2QD2A 2M98A 2Z2XA 3PUVA 5LZ4A 4J4HA 3RAJA 1DDIA 3I4CA 3VX3A 4YYEA 4V39A 1MEEA 4D0SA 3AR8A 3QVJA 2GZHA 2DHDA 3PDIB 5FULA 3B1YA 2X3FA 2WWHA 4HQRA 1JA1A 3RRBA 3U6KA 1Y6JA 4G5YA 3S81A 3UFXB 2DHCA 4PYRA 3K0BA 1L7BA 4EB3A 3KR2A 3IA7A 3OY7A 5CH3A 1A5ZA 1ZZGA 3OPYB 1Z47A 4AN0A 1X80B 2NVOA 4Y1RA 1KHTA 2PSEA 1XE3A 1JKJB 3D8TA 3SNHA 4EG6A 1K8XB 2XB2A 3UEOA 3RANA 5J2UF 3I5UA 2DWPA 5MFPA 2H31A 2QVLA 5E7IA 3HUUA 4UARA 3CUWA 3LKZA 3OTGA 3DKIA 4KKVA 1PVDA 1ENPA 1QHXA 2JJQA 4NHEA 1DDGA 1CZOA 2D3WA 3GCZA 2BJHA 1WZEA 4I9FA 1ZNWA 2KPOA 4IXWA 4KFSA 4PFJA 1A8HA 3TCXB 4EVSA 2DR2A 2IHJA 3SJBA 2Y6UA 1ZKMA 4WMLA 3NP9A 3TZEA 5AUOB 1KYQA 1K5PA 3IUNA 1PZGA 2QS9A 2Z4SA 4K05A 4DCGA 3T3GA 3GQBA 2PNFA 4BHTA 4LHEA 1CUVA 3IB6A 4NPAA 1N2CB 1IFXA 1N7IA 3U56A 1F17A 5UKDA 1P1CA 1IQUA 1VMAA 3TW8B 3D1JA 2NO9A 1QPBA 2AWNA 2P77A 3GAZA 2B99A 1FP6A 3EQ6A 3DZCA 2IPXA 3N87A 3ENWA 3PFBA 1MENA 5KMGB 1ZH4A 1XRSB 1UOOA 3WMXA 2BFBA 3DMFA 2VPXA 4LOKA 4HSGA 4N82A 3BG5A 3FKQA 4X65B 1X6VA 2ZIVB 4BVJA 1IUPA 1IZ0A 2IEAA 4RA6B 3ZY4A 2HK7A 4XB6B 4BC1A 3MCAA 3UTCA 3LT0A 1X19A 3O8NA 1BZYA 1HFEL 4K9QA 2H1RA 1M54A 2ZUBA 3R0QA 4EL0A 4MQMA 2IYVA 4DADA 1O0SA 1VBNA 1VMKA 3IDAA 3RSQA 5M5BA 3RRXA 5CIQA 5DTJA 3TSAA 2C2YA 2ASEA 2R4UA 4FW8A 2N0SA 3BFPA 4B7XA 4ZQHA 2VSYA 4TLBA 2PMDA 1U8AA 2JVKA 1Z0ZA 3AY0A 5FQNA 1JJVA 4KWCA 4OGFA 1F2TB 4RTPA 4OFWA 2QTGA 1ZJWA 2HRQA 1XRNA 2OQIA 2XSZA 4UOEA 1KJNA 3H42B 4MQ5A 4E5UA 1HNNA 1TEHA 2GJAA 5BV0A 3ZR4B 2GXUA 4GP6A 1N2EA 1DVRA 1Q95A 2ICAA 2OVFA 2R47A 3KSMA 5CCDA 1AO0A 2VSQA 3N2YA 1ISIA 3PQ6A 1D4ZA 1XG5A 1QOZA 2DULA 2IYNA 3IAEA 2JH9A 1Y9EA 3NM6B 4EF5A 4X91A 2OG2A 5CDFE 5KTPA 4BNTA 2NTEA 4HB0A 4DMFA 5HE9A 4MQEB 1E1DA 1YJBA 1MJ5A 3MM4A 4BQEA 4YLGA 5IBCA 3B3FA 2GILA 2IYUA 4H60A 5C52B 1D1QA 3TLKA 3H3FA 5CYFA 3GARA 1AUXA 1OWOA 3PPIA 1JR2A 5D85A 1PI3A 1AUQA 3HCNA 1GKIA 2JI4A 4JAVC 3W6NA 3LVFO 1KXJA 4AICA 2XODA 2CLKB 1R0XA 4QUAA 4UKDA 4ZKEA 1W52X 2EYUA 1K3UB 2Q3LA 5DNAA 4BO7A 2HLNA 4D8YA 2HF7A 4B3TB 4NICA 1G17A 2O50A 2YINC 3KFXA 4HXYA 4UTOA 4HX9A 3UJ3X 4QXRA 2IP4A 1YBMA 1CEEA 3GIDA 5E1OA 3U7IA 1CEXA 3Q6IA 4TMFA 1WQ4A 4UCQA 2E4AA 1OFGA 3NHUA 3AV0B 1P0PA 5A3QA 2X0JA 3ZTTA 1N5MA 1R5OA 1SOWA 3IUQA 3UOWA 1IJKA 2J32A 1Q1AA 3U1TA 2QJWA 1SFRA 1H2RS 2AFHB 4YQZA 4A36A 4R51A 5GZ3A 1QO9A 2EGHA 1LK5A 1WXWA 4BRWA 1D2GA 3O9ZA 1ZC3A 3L8DA 4D02A 4HWGA 4HAZA 3JVUA 1JG6A 1K5HA 4D96A 3TRIA 4UEQA 1X39A 4FLMA 4ZO9A 1M6WA 4B79A 3DO5A 1IEQA 1UEXC 3S0JA 1MB4A 3SYTA 5C7LO 1TM5E 3BIXA 1J56A 1J2EA 2OCDA 4MLZA 2Q2OA 4N9QA 2YFHA 2IXGA 3DA8A 3QVMA 4G41A 3SLGA 3I73A 3U1VA 4W63A 2P3QA 3M3PA 1CNEA 3HB1A 3W3ZB 1X1AA 2RONA 3O94A 2H2FA 3OP4A 5G4LA 1XEXB 1E64A 4H7IA 3W1WA 5H80A 3A3NA 2ZSEA 4NBNA 3COPA 5KB3A 2IGTA 1IM5A 1EIZA 1TW2A 1BE0A 1FLNA 3OZIA 3GVPA 1G3RA 1R4ZA 2RAFA 4GPEA 2F2TA 4IBOA 3VKFA 5KYWA 2VG8A 3S8YA 4YMHA 4DY4A 5FOXA 2HIHA 3PTLA 1XZPA 2JW5A 4RESA 5LDGA 5AW0A 1Q77A 2O7RA 1H0SA 3AOEC 5J23A 1T34A 3EJ6A 3GD7A 1DWOA 4JT8A 4M9CA 4NENA 1PLJA 3ULKA 3ZG6A 2D06A 4JJZA 5CEEA 1EA5A 4GX2A 2EF0A 4DIKA 4Y2PA 2VAXA 3KTOA 1JECA 5KOHB 1OFUX 2C1ZA 4C7VA 5JV5A 3NHZA 4L4UA 3D8SA 1XLVA 2WTNA 4LX0A 1BX1A 3OC0A 2Y99A 4J9VA 4WZBA 2BL4A 1RHRA 4GM0A 5DO9A 3NGLA 4F06A 3HYLA 3GA0A 3GRAA 4NFYA 2A58A 3RKSA 3CMCO 4OJMX 3E8SA 1RABA 4RVGA 3HDHA 3DE0X 1UAAA 3GB9A 2VAPA 4DCMA 3GJXC 1E2LA 1PR2A 3DMHA 2PD3A 2Q8NA 1M2OB 5FNZA 4BNDA 1SK8A 5H3HA 2QPAA 4ZV9A 1X74A 1U2SA 2TMDA 3QMVA 3I5XA 1UM8A 3LDFA 4GR9A 3QU4A 4F2DA 3A0RB 3TINA 2EZ9A 4JBNA 1TM2A 2OBMA 1WAMA 2W9XA 2C07A 2H1CA 1IHPA 1DU4A 1YB6A 2FSFA 2ZB2A 1A8SA 1O57A 2AG0A 4P0TA 2D0PB 1N2HA 3VR2D 1ZJJA 2I1WA 4RETA 1LW7A 5DBOA 2O2CA 2X1HA 2VOEA 4FEGA 4EDHA 2QG9A 2HBYA 1O95D 1DLIA 3ZN2A 4E0BA 2RI0A 1P9OA 1Q0LA 3DLAA 4LECA 3MT7A 3VBEA 3CNEA 1J8MF 3HCBA 1VHJA 4HI0E 1JDTA 2PL9A 2ZI9A 1YOVB 3RUEA 4B45A 3UKJA 3KHKA 4JGIA 3VU1A 8ADHA 4I9NA 4RZHA 2FSGA 4EJSC 3E81A 5K0LA 2VT6A 4HWTA 4ZOLB 4JXXA 5C81A 5BSVA 2E49A 1J2YA 3ZOKA 1WXXA 1Z5GA 3CX8A 1CSEE 2BLNA 2FCAA 3PC7A 4LTDA 3VR0A 1U1CA 2XMPA 3DUFB 5IBPA 4CMJA 1XPRA 5IARA 2ZR8A 4EMTA 2F3SA 2PSSA 4TRRA 1T9ZA 4XFDA 4FNGA 4D4HA 1E4OA 4CV3A 2WJIA 1ACJA 1Z74A 2HSZA 1PHPA 4DQLA 3F1KA 1OYVA 3L04A 3LQQA 1R4MA 4BMOB 3ON5A 5JQWA 4YCSA 2X6TA 4ZI7B 3KQVA 2V65A 3UCFA 2VJDA 2FHPA 4K3VA 3QE2A 4I8DA 3PHCA 1E77A 1DG3A 2JLAA 2QGNA 1TA0A 4RHYA 4D44A 3TGLA 1I2CA 1Z6AA 3D81A 1P7ZA 2AUTA 1P5RA 2P35A 4P7KA 4RPIA 1GNSA 3ZE7A 3A6KA 3U3RA 1IMOA 4FHGA 1N0HA 1Q19A 1SB9A 2O1WA 3D59A 3EBLA 2JCGA 2C97A 4FZJA 4V3CA 1W5SA 2MR5A 4W99A 4B34A 4BLOA 3T41A 4MB2A 4M1OA 1YE3A 1QFJA 1O5OA 4ZT3A 1SCIA 3FPJA 2X4IA 4GXQA 1L7NA 1NJ8A 3RV3A 3E0XA 1AXEA 2XJ4A 2UZIR 1AUVA 2BFFB 3H8JA 3IO5A 2QTHA 4J03A 4O29A 2R65A 1TJNA 4EDFA 3T0FA 5MN6A 1BHSA 1F4VA 1EHCA 1R8SA 1PQYA 1ONBA 1TCBA 4GP9A 3JS5A 2R48A 2GEVA 4I46A 2WDPA 1JEJA 3ND9A 1SD5A 4IXDA 2HRDA 4QDXA 4CQMA 2ZOSA 3A2NA 2WFAA 2PQMA 1N25A 4M0UA 1K8QA 4F4IA 1OX6A 3N0XA 3PFFA 3R5JA 4FB5A 4GX1A 2PPLA 2FZKA 1G18A 4E33A 3I6QA 2NU7A 3L4KA 1JU3A 4RIGA 4H31A 3VPXA 4ID3A 3I5AA 4CKCB 4NMWA 5C1OA 1A4UA 1TAQA 4UAVA 2V7GA 4MUNA 1TXGA 1PVVA 1AMNA 1PEAA 2VYCA 1N5RA 4C03A 3A2MA 3HEBA 2JJ2D 1EVIA 3IJPA 3NG1A 2PUEA 4PYOA 4WCFB 5D01A 4GX0A 1A5AB 3UUWA 1T2NA 4NL4H 4ITVA 4CLRB 4L57A 4DV1B 1VLLA 3WYGA 2JLBA 3KYCA 4LZOA 4CIAA 1V47A 1QQ5A 3JV7A 3RFVA 4A8TA 4AJLA 4ZCIA 4L6CA 1R7RA 1I4TD 5LMNB 2F7SA 1F2DA 5LQUA 1J9ZA 4BFWA 1XDGA 3OICA 5F1OA 2B4AA 2L82A 1Z07A 2YJ4A 3IH5A 1NOIA 2AUMA 3KDPA 1S7GA 3O4RA 4L8LA 5T64A 3FE2A 3WI7A 1ZGJA 1V25A 4ZYVA 1E2BA 2I4NA 1QRDA 2EX0A 4YHHB 5FP0A 3IVGA 4N6GA 3R8CA 2HX1A 1QNLA 3ZV7A 1ZGGA 2Y71A 1LBTA 1QV9A 4FCWA 2AN5A 4OIMA 1H93A 3BWBA 3I12A 3LUGA 3P7MA 3OQOA 3QPAA 4MZDA 5ERGB 4QRDA 1DV2A 3TZBA 1W4ZA 2A5FA 4NAVA 1YI0A 2UZ3A 2YUIA 4LW8A 2OORA 4OP2A 1RQNA 3RYHA 4Z7OB 1XK6A 10MHA 5B7QA 1XZCA 3KS9A 4C4PA 3N39C 3FZYA 2DFDA 2I3AA 1KEWA 3IQIX 5CW2A 1G7SA 2FSUA 4FZ3A 1QHSA 3AEXA 5JNUA 1DT5A 3O82A 4AQ7A 2AW3A 3PLRA 4TWIA 3MPUA 5TJHA 4P5PA 1W9MA 4RTJA 3SI7A 1G21E 2PUJA 1X3LA 2Z2KA 3QKRA 5MN4A 2X7HA 3QG1A 1RXEA 2H4HA 3UV6A 4BJ5A 3KWJA 3RG2A 1EI9A 1NXSA 1ZOSA 4JODA 4LKOA 2YY5A 1NMSA 2PWPA 4RXTA 3CUUA 3OZCA 3F9CA 4V1CB 3E1GA 4AM8A 3JZFA 4KO4S 4S2UA 4TTRA 1WMSA 5E4JA 2P41A 2AIRA 5ALYA 1AZSC 2DAPA 5FV4A 2WYOA 3W78A 4JSYA 4EY4A 1NE7A 2BHNA 3TB6A 3QEBZ 2GF2A 2I9KA 1C80A 4JI2B 1POXA 2YOHA 4XA8A 1N4AA 4KMOA 1WDWB 1GUZA 1ODJA 4E21A 3DDNA 3I04A 1SEVA 5BUZA 2ZDQA 4NV0A 1SUAA 5EYPB 1YVDA 2VJAA 3VAAA 4WLFA 3IILA 4E2WA 3U4AA 4AROA 5HNKA 1BYUA 3FJYA 3RUDA 5JWHA 1F8FA 2OEPA 3NHYA 4FC7A 1L7PA 1S2GA 3RFTA 2VTBB 3SHFA 2A59A 2J6IA 5FOWA 1I3LA 1AQIA 1KR2A 5FNVA 2M6KA 5AD1A 2GZMA 3HHEA 5KQMA 3EX7C 2D74A 4H7PA 3S1AB 4WE3A 1E1NA 2ZJ3A 2BI7A 2XNDA 3K2IA 5F4ZA 1U3GA 4CM9D 3IAM6 2Q99A 2AYYA 3K4QA 4QGGA 3RT9A 2P9TA 2OB1A 1BYIA 3RTBA 1G5HA 2BKUA 3C7CB 3Q40A 5K3FB 4RSHA 4I0WB 1UDBA 2AMFA 2BONA 3AEUB 4H16A 3NYIA 1GD1O 4RPKA 1CVIA 5EN4A 5EJ2A 2PD6A 1COZA 1BKSB 2J9GA 1ZH0A 4DARA 3EIFA 2J07A 3QWIA 4HEJA 4UAGA 2WKQA 2EQAA 2W6QA 1NY6A 3HFRA 4JX9A 4U8GA 5AKZA 1XTJA 5LCXA 2P4QA 3T5AA 3ZIAD 1QIFA 1G2PA 1U7OA 1WCYA 5GIPE 2P1RA 4DV2B 4ASUA 4IIJF 5A7GA 4QNNA 4L16A 1Y3CE 2GSDA 5H81A 4CEIB 3F67A 4A73A 3PFHA 2REXB 1KIAA 4HG2A 4JHXA 4M1QA 4C08A 5E4FA 3OOHA 4GOJA 1D7OA 3OMLA 1X1DA 5HIMA 4WDQA 5LMCA 3N2GA 3L0CA 421PA 2J3EA 4PQGA 4O63O 4ALLA 3AHJA 4BLVA 1TQ8A 4CM8A 2C20A 5CDYA 3G89A 4BNDB 4XB2A 3BCHA 5T4FA 3K1AA 3ER6A 3S2EA 3TLJA 3GVXA 3NTVA 2D5LA 3UWPA 5GONF 3GH1A 5ITSA 1G8AA 1IE3A 4H0CA 4LBVA 2B5WA 2WHPB 3K1TA 1JFSA 1KI6B 5TEVA 3CX3A 2PZFA 3EWAA 3H0CA 3OCJA 3U44B 3PGA1 2F4VB 4WK2B 3GDGA 3BDIA 3I1YA 1P1BA 1X1RA 1M2OA 1SCAA 1WCIA 2VHCA 4MGZR 4CL0A 4MS1B 1VLVA 3OHMA 4H7KA 1YIOA 3HABA 2CXUA 2DYKA 4DBVO 1XLTC 5DCLA 1M1NA 1XXHE 3WNCA 3X1ZA 4EL5A 1JDJA 3C1TA 2B0CA 4QPDA 2ZXUA 2NTNA 5GY7A 1E3SA 2Q3CA 4YR7A 1YRHA 3T9DA 4Q4AB 1I7DA 1OHHA 3I0ZA 3PJFA 4FGUA 1UK7A 4Q00A 2XD9A 1MBZA 4PZLA 3LGXA 2EFCB 2HIAA 3M7IA 4RHTA 5DM0A 4KJXA 1ODCA 2NVWA 1ZRSA 2BHSA 2I66A 2Z08A 3H9BA 2UYHA 1V5FA 5B1YA 1PT9A 3K8YA 3P45A 4CM7A 3B20A 1OJLA 2IU6A 2X3YA 3D6AA 5JLAA 4MQ6A 5BSRA 3O90A 2QQ0A 4H1UA 3LX4A 4TL8A 4S05A 1XMQB 3P9SA 3DVSX 3H5AA 5EIBC 2Q6TA 2F1IA 1CPYA 1N57A 1C3LA 3PBKA 1ECJA 3DF7A 1A69A 2DOKA 1EFCA 2C2BA 2EW2A 3LYLA 1XTSA 4Z5XA 2H52A 3D7LA 3OCUA 3L0SA 1BH6A 2FWBA 4FYWA 1U0OC 5FLKA 5A6SB 3RVQA 3W8RA 4ZZ0A 4PLYA 1VG1A 4V0SA 1XNJA 1TVCA 3DZ6B 5JHGB 4I1RA 1H85A 4J1QA 3BFJA 3GJRA 2IUUA 2MSLA 3DKKA 4R1NA 4BP9A 4D6PA 1T3SA 5B12A 2J3MA 3B6MA 3OLCX