3DMTC

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
358
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
total genus 120
structure length 358
sequence length 359
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
C PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtC02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtC01
4FJ0A 3HB5X 3VTFA 2QG4A 4YXFA 3VH1A 1P0CA 3LT1A 2P5UA 3PIIA 4KOAA 1EFLA 2NACA 1K89A 5ILOA 4A2CA 2PFGA 3ZHYA 2GSDA 3OM9A 3TFOA 1E7WA 2EF1A 1HZZA 1OC4A 3PFFA 1AHHA 3U9LA 2F1KA 1Q2XA 2BFPA 4W4TA 4XA8A 2ZB4A 4UVDA 6ADHA 2BF7A 1OC2A 3Q2IA 4ZHSA 4CODB 2V6BA 4RZIA 3ZCXA 3UHAA 4BNJA 1Y5RA 4E30A 4J43A 3KO8A 5IDXA 1P77A 4MIYA 1GQ2A 4DREA 2ZTLA 1SO8A 5JY6A 4E21A 4IS2A 2EW2A 4F3YA 4XQCA 4BNXA 3NYWA 1AUPA 2VYNA 3AW9A 1HKUA 2DFVA 3GEMA 4YYZA 2J3KA 1GQQA 2ZYDA 1YDEA 4AL4A 2P4QA 1MLDA 1O95A 4FR5A 4MKZA 1NP3A 5THKA 4K28A 2NVBA 5JAIA 4W82A 1A7KA 5JW6A 3CKYA 2QZZA 3HDQA 4TROA 3JYLA 3HZZA 5FI3A 5FYDA 3WGHA 4BB5A 4HADA 5JDCA 1X15A 2FOIA 1HYGA 4U6QA 4J2HA 2TMDA 1MG0A 1UAGA 3H8VA 1PJCA 1R66A 5GY7A 1JVSA 5JY1A 3JQEA 3K96A 3D5QA 4YJDA 4TRRA 4IQ8A 1YOVA 2YZ7A 3PLRA 1ZEJA 4ZRMA 1QKIA 5JYAA 2W8ZA 3KYDB 4TMFA 1Y5MA 3BA1A 2F00A 4YRBA 3SBOA 1J6UA 4ONEA 3DHEA 4HV4A 3DTTA 4XB2A 1PR9A 4GWKA 3FR8A 1MFZA 1PJBA 3ZNPA 2YQ5A 5G0WA 2YV2A 1ZSNA 4JJIA 3RC7A 3TZHA 5EMHA 1MX3A 9LDBA 1GU7A 4TWRA 3JYPA 4ND1A 1JAXA 1HE2A 1QYDA 1C1DA 1R0LA 1VE9A 1VM6A 2BRUA 2HMVA 4RLSA 4E31A 1G1AA 1RYEA 3WNVA 2X1HA 5DDIP 4AJ2A 2I99A 1YH3A 2HRZA 4TRMA 4BL5A 4WEQA 2I5PO 3PQFA 4HWKA 2Q2WA 4E12A 5ITVA 1ISGA 3RWBA 1KY5A 4XGIA 4GGPA 3F1KA 4L0QA 4NK4A 4Q3EA 4R68A 3NTRA 3DFZA 4ZU3A 1TA4A 3GMSA 1WP4A 4RLHA 1HDYA 4IJWA 4JCOA 2B4QA 5L7WA 1S7CA 1WZIA 2CD9A 3IL2A 1LU9A 3IQDB 1X1TA 3VC7A 4MIEA 1Z75A 2GNAA 2OFPA 3N74A 1ZVMA 5BQFA 1GV1A 2DBVO 1OZAA 2QRJA 3JYNA 4GBJA 1LLDA 3TN7A 2PH5A 1ISJA 1E77A 4XZ3A 3PDJA 2LDBA 1BMDA 4PLPA 1EK6A 1GUYA 3QLJA 2UVDA 4XR9A 3Q1LA 5A1TA 1FJHA 5CAEA 1LSSA 4DBVO 4BNZA 3WQRA 4WLVA 3K2EA 3KYCB 3TL3A 2Q1SA 2J5RA 1LTHR 3K31A 4WASA 1D1TA 1HRDA 1SBYA 4IQGA 1CRWG 5G0SA 3B1FA 2Y68A 3LVFO 3IAHA 1M6HA 1N1GA 4FFLA 4BHTA 3DOOA 5CEJA 4GX1A 3LT0A 1IULA 1UXIA 3AFNA 4C7KA 1DRVA 1EVJA 5EJ2A 3HJAA 5L7YA 3KM0A 3MWDB 4BO7A 3I1JA 5IJZA 4AJ1A 1CQIA 2NLOA 2H63A 2WSBA 1E1LA 2UDPA 3FNGA 2FPPA 4LMPA 4MVJM 1O0SA 4BO1A 1GZ3A 3GVCA 4BKUA 3E9MA 4PLCA 2YJZA 3GAZA 4BO9A 2BLLA 2AEMA 3KLPX 4B4VA 3HN2A 1YL5A 2IYOA 1AXEA 2FSVA 1U2DA 2E6UX 3G3EA 2H5LA 2X9GA 3NRCA 3H9GA 4KTVE 5ES3A 2QRLA 4UEOA 5FF9A 1CJCA 3ZWXA 4ZQEA 1B8UA 1E0DA 4A7PA 3CE6A 1QYWA 4N54A 4MVJF 4E5MA 2EIHA 1ZNQO 3GN2A 4CQLB 2RH8A 3KBOA 4AG3A 4BNFA 5DCWA 5B1YA 1DC6A 3ZWBA 4OYRA 3K6JA 4IPTA 1LX6A 3QVTA 3MCVA 4D7AA 3P19A 3LQFA 3DZBA 4NDNE 4B79A 1TEHA 1R0KA 1Y8RB 2BI8A 1IHXA 1RM3A 5KVSA 3PQDA 1ENYA 1X14A 2VHWA 5CG1A 1UUFA 3IKTA 3LF2A 2IDZA 1BXKA 1VL8A 2PTGA 2PZMA 4ZA2A 4UEJA 1BVRA 3ETGA 3DAFA 3RUDA 5A5FA 4OQZA 3F46A 3CTMA 2AMFA 3HE3A 3HG7A 4MVJI 5JCJD 1BDMA 4AVYA 1DDOA 3DL2A 4WCFA 1DJQA 2VYND 4QQRA 1LBEA 1QMGA 3KYCA 3AFMA 1RPNA 3AK4A 1LRKA 1UP7A 1H2BA 1ADBA 3FF4A 3JQ6A 1JKFA 5A9TA 5HWSA 5CDUA 5TS3A 1YBMA 3G17A 1PU2A 3DZKA 2Q49A 3D4OA 3NT5A 2Y0DA 3C1OA 3C24A 1I33A 3AY6A 1KOLA 2PKQP 3VAZA 5AXDA 2FPIA 4R5MA 2JFHA 1R16A 4Y67A 5K6AC 2OL4A 1QLHA 1UXKA 2GERA 2V65A 3KETA 3DBRB 5IZCA 3HFSA 4QO7A 5DBGA 4XGKA 4B7UA 3QWHA 4BO8A 1WVGA 1YDWA 3CPSA 4MOWA 1YJ8A 2V6MA 3F47A 3V1TC 4GLOA 5A02A 2Q45A 3BMOA 1NQAO 1B3BA 3ITKA 3B20A 3UGKA 3WIDA 1EE2A 2A92A 3JD0A 4NBUA 4NH4A 4C4OA 1P74A 4D79A 5CHEA 1KC3A 5T8KA 3AOGA 1D8AA 3ZH2A 2HSDA 1V8BA 5DNAA 1PS9A 4WCFB 4I9HA 1YXMA 3H5RA 4UVEA 5MGBA 3H2SA 5B4UA 5AXCA 1GYQA 1LI4A 4GKVA 3ZHZA 3GMDA 4OO3A 5KJ6A 1XR3A 4HFRA 4X54A 4LVUA 3GF4A 4YJGA 3PQEA 4L4RA 1KIFA 1KBZA 3JQGA 5ENDA 2YHIA 4FJ2A 4MJLA 2FR1A 3L77A 5M6DA 1BXGB 1P1RA 1YO6A 1B16A 4YAIA 1ONOA 3OQ6A 2JD2A 2X86A 5U4QA 1XU7A 1B8VA 1LC0A 1XELA 4NNJA 2JKVA 3FNFA 1WDKA 3HDHA 1WXDA 1GV0A 4JP3A 2BKAA 3AWDA 3DZJA 2Q4BA 5EESA 4J1QA 4F6CA 4FIZA 1KEWA 2Y1FA 4P4NA 1PGQA 1WDLA 4KMSA 1U1IA 1K6JA 1YONA 3GHYA 2YV3A 3ZI0A 1NR1A 3WWYA 4Z0TA 1NFQA 1SNYA 4B3JA 1E3IA 4CM9A 4JGBA 3ZWMA 3IC5A 4BNWA 3MTJA 2EWMA 4CL3A 1G0NA 1NAIA 3QE3A 4R1UA 4XIJA 4YT4A 3D7LA 3PXXA 2EGGA 2Y67A 3W4KA 1R37A 5TJHA 1GEEA 2WE7A 3K92A 4XYLA 2FHSA 5KWEA 1ZO8A 4PZDA 4J91A 4LRTB 1B14A 3P7MA 4XR4A 5BT9A 1ENPA 4B4OA 4DC0A 3DMTC 3NAQA 3PVZA 1E7MA 4XYEA 1BWSA 3TQHA 4IXTA 4GVLA 3RBZA 1QYVA 3GUCA 3HHPA 5COQA 8ADHA 1F0YA 1WW8A 2ZQYA 5ER9A 5LDHA 3FTNA 1DB3A 4UULA 1H9BA 3AUSA 2X0RA 2X58A 3P2OA 4DA9A 3KSDO 1E6EA 2G0TA 2Q1UA 1K2WA 4FCCA 1QYXA 1OBFO 3BMCB 4JK3A 3UCFA 4DPKA 2HJRA 1NX6A 4IM7A 2VQ3A 1R12A 4PLYA 2X5JO 3RQSA 2PR2A 4IJKA 4ND3A 5JCJA 5J9GA 1RJWA 5GZ6A 3ASUA 2R00C 3DZIA 3EMKA 5IXYA 1K5HA 4J4TA 1XLTA 1RM4A 1BGVA 1PL8A 3Q9UA 5DP1A 1HE5A 2I76A 3AUUA 4CR6A 4WLFA 4D0RA 3I5MA 1MUUA 2QIOA 1UZNA 4OJNA 3V2UA 1H93A 5DZSA 5HM8A 4R54A 2FMUA 2WJPA 3ICPA 4AJNA 3H4VA 1T1RA 3S2FA 1YL7A 4TQGA 3PDUA 5C5IA 1B15A 1RWBA 4N7RA 4QTZA 1QXSA 5BSHA 2VTEA 4FS3A 4J90A 4ALNA 4IDEA 1NTOA 4WUVA 1E7SA 1ZK2A 1W4ZA 2WYUA 3QJ5A 2NUAA 3KSUA 5C3MA 1JQBA 3GOHA 1NAHA 1NASA 3BIOA 3OEWA 1PZEA 1T2AA 1Q0HA 2EXXA 3OSUA 5JAQA 5CDYA 1ONPA 3VPFA 2Z1MA 3I6QA 4YTEA 3LLSA 4BO0A 2AQKA 1M2WA 1GPJA 1PJSA 2ZYGA 4K1LA 4WGGA 3W4JA 4D3FA 2QX7A 3NEPX 2O4CA 2HDHA 4ZJUA 1NYTA 5I8ZA 5JE8A 5I7VA 3CSDA 2GN8A 1B7GO 3X2EA 2HQ1A 1N9GA 3INGA 2TMGA 1N9GB 4FB5A 1LRLA 4NBVA 4HY3A 4WLOA 3EGOA 3TZ6A 4GPD1 3JQ8B 1KVRA 4XYMA 5H82A 3KTDA 3W8EA 4D44A 4TRNA 4KTTE 1EQUA 4YRDA 2Q1TA 1VLLA 2VHXA 1H94A 1VL0A 3I52A 4RVGA 4AJPA 4Z3KA 5JYEA 1N92A 4E2XA 1JDJA 3OEYA 1SAYA 3FNEA 5A9SA 5CDTA 3JQAB 1ZKMA 2YDYA 4JNKA 4AJOA 1MC5A 3OFSA 2R00A 3W4IA 1E5QA 4NR0A 5TNXA 2W90A 2R6JA 4I9UA 4EI2A 4EEXA 1CQJA 3IJPA 3KEOA 1MA0A 3D4NA 1Q7BA 1IE3A 5TT0A 3GZ4A 2EG9A 3LU1A 4PG6A 4R9SA 4EZBA 3OBBA 4R01A 5TX7A 2EV9A 1E3EA 4J7XA 4WLEA 4PRKA 5KVQA 4BV8A 1B2LA 5H81A 3DBRA 3E82A 4P8RA 2DVMA 2O2YA 3BHJA 3PZRA 5LC1A 4ZGWA 4D45A 2Q22A 3Q2KA 2JL1A 1TXGA 4ND2A 4JX8A 4YR9A 3HSKA 5AOVA 1I10A 1B8PA 1PTJA 1DC5A 1W8DA 2GRAA 5K9ZA 1U9JA 3FWNA 3NJ8A 5K6AA 4BGVA 5TLSA 1U8XX 1SEVA 4GWGA 4K6CA 1YWGO 4Z9XA 3VPSA 4Z9FA 2PZJA 4EITA 1PJLA 4WLUA 1LDEA 1ID1A 1M76A 4UAGA 2AQIA 4FGSA 4NJOA 3MJ4A 2EJWA 2ET6A 4BKRA 2B0JA 1PWZA 3L6DA 2O4UX 2AG5A 5CG2A 2NU6A 5TQVA 3U4HA 4NBRA 3EZLA 3DZGA 2X9VA 3H5AA 1HE4A 3DZHA 2YHIB 2E49A 1FXSA 3K73O 3GGGA 1BXGA 2CDCA 1Y9AA 4BO2A 1V3VA 3LK7A 3ZU3A 4E32A 3O38A 2FZEA 4Q3AA 1SCUA 2CDAA 5AXAA 2HRBA 4G81A 1UDAA 3WTBA 2GN9A 1PGPA 4S1VA 3F1LA 2GD1O 3TZKA 1WLYA 1DC4A 1GEGA 4ALJA 1L1FA 5C37A 3TF5A 2GDZA 4QEDA 3UOGA 4D42A 4E6PA 1ZSYA 2W4QA 4YEDA 3JQ9A 4BQRA 4BNKA 3MJVA 1P0FA 2C29D 2I65A 3LYLA 4DL9A 3PYXA 3JQFC 3EYWA 4MDHA 1TT5A 2Q46A 2WD7A 3RUIA 4J1NA 4YAGA 3QY9A 4R4JA 9LDTA 3ZV5A 5T64A 1FDTA 4CMHA 4CM8A 3S1LA 1EK5A 2X0IA 4WOKA 3C85A 5COAA 2VUSA 2VYVD 4N5NA 3L07A 4BGIA 5DF1A 4E0BA 4EYEA 5JC8A 4A5OA 4B4UA 3RD5A 3HWRA 1U3WA 1TB4A 1EDZA 4ND5A 1M67A 2JFFA 4HNHA 3SLKA 1TVEA 5G4KA 3HB4X 1QRRA 2H9IA 5CEEA 1NR7A 5T67A 2YQ4A 3L4BC 4LW8A 2D5CA 3L6OO 1CF2O 1DIAA 4YJFA 5TSDA 2Y1DA 2O3JA 1AXGA 2D0IA 4EEZA 4FFOA 2PGJA 4OIMA 4RORA 4RVFA 1E3SA 3RBXA 4BNLA 4EUEA 2B35A 1D4FA 3JSAA 3WB9A 1ZZEA 1IOLA 1U7HA 1RYDA 1UZMA 3AU8A 3PYLA 4XEHA 4RF3A 1KVSA 5ENVA 4GI2A 4ZQFA 1HDOA 4DWVA 4ID9A 2NNLD 1P1JA 1XKQA 4H7PA 2Z5LA 5KCZA 4OOEA 1M66A 4DIBA 2OO5A 1W73A 4OM8A 3ZWNA 1HDRA 2EKQA 2CUKA 2VZ9A 4WJZA 4UEKA 1H6BA 1UJMA 1VKNA 3H5NA 1B0AA 2CVOA 7MDHA 2C7VA 4ZRNA 1O8CA 2BGKA 3UCXA 4QX6A 1F12A 5JCXA 3OIDA 2PK3A 2VNAA 3UFXA 5KKAA 1Y7TA 4U0KA 3E9QA 4IMRA 1XGKA 4TKLA 2Q4EA 1EBFA 1C14A 3Q0EA 3OP4A 4J9UE 2AHRA 3EK2A 1NWHA 1IHYA 2FZWA 1P9LA 1UXHA 5IZ4A 1OOEA 2IE0A 4BB6A 1NVMB 5JS6A 3QVSA 1XIVA 1RM5A 3UN1A 4M89A 2ZCUA 1K0UA 3ICCA 1DAOA 5CP8A 1HEUA 1NQ5A 1YQXA 4IQ0A 5IDWA 2VRCD 1J5PA 4IIUA 4LCEA 1A7AA 1WAMA 4NIMA 3PJEA 1ENOA 3DB2A 2E48A 3GDFA 4Q3DA 4B8ZA 5A9RA 4FW8A 3PGXA 2DTXA 4OXNA 1HWYA 2QHXA 4DTIA 4GX0A 1C3VA 1H9AA 1SOWA 1I30A 3PI7A 4KWHA 4U8GA 1UP4A 3BTSA 2RCYA 3GRPA 4RPGA 4CM4A 2AXQA 2DQ4A 3DDNA 4UUPA 2YW9A 4CL8A 1DIBA 1F8FA 3GGPA 1PQPA 3E48A 3PWSA 3RROA 5G0UA 2YFHA 4O0LA 3WLEA 2NWQA 1U4OA 4GLLA 4J49A 1EMDA 2B5WA 2VUUA 2Y1CA 4BVAA 5JYDA 1HDZA 5DP2A 1KVQA 4DIFA 1Y6JA 3FRJA 2JAHA 4OHUA 3DR3A 5KVVA 1HLDA 3RUFA 1TT5B 4CLHA 1F17A 4YRAA 5KIAA 5EQFA 4NK5A 1DOHA 2CVZA 4E2WA 1H6AA 2J8ZA 1R0SA 4ZVVA 3GK3A 3NDJA 3N58A 2XXJA 5F3RA 1O89A 5C7LO 1JLLA 2CF6A 3W1VA 3V1YA 2P2SA 1R4NA 3CIFA 2D59A 4CLRB 2X5KO 1IYZA 4P4LA 4J2OA 4II3A 2CSUA 4XX0A 1ZXLA 2G1UA 4CQMB 1E1MA 1UP6A 3BMNB 2UYYA 4MKXA 1MG5A 1YKFA 2YFQA 4HFJA 5BSFA 4E5NA 1R15A 4IDFA 2JFGA 1SEPA 2WEKA 2YYYA 1HETA 4NPCA 2ZK7A 4UVIA 2PA3A 1I0ZA 4K26A 4HFMA 3TSCA 1HTBA 4TZKA 5F1PA 4RL6A 4AJIA 4HKTA 1VPDA 1W0CA 3FI9A 4JBGA 4CM8B 5KJFA 2JD1A 3PJDA 4Y98A 1FDUA 1P1HA 4JROA 5HA5A 3GZNB 1PX0A 1CEQA 1PQWA 1QV7A 3LC1O 2RHCA 2NVWA 3E6AA 4E2YA 3ZWAA 1BDBA 3IUPA 4CM1A 3FSRA 1DPGA 3DFUA 7ADHA 1E1NA 2JAPA 5I9LA 5I9MA 3E9NA 1XSEA 1PR3A 3HDJA 3RC1A 1E7QA 1ZJZA 3Q6IA 4ILKA 2AW5A 1T4BA 1BRMA 4FSHA 2HUNA 1I01A 2QZ9A 2DBRA 4A03A 4AJ4A 5DCUA 4OMUA 1T2EA 4PG5A 2ILTA 3QWAA 1GQYA 1VSUA 1N5DA 4R9RA 1EFKA 3WMXA 4R1SA 1ZH8A 3KYBA 4I5FA 5IG2A 4FFRA 4URFA 3JD1A 4D3DA 3WFJA 2O3TA 3WX0A 3GPDG 4HNGA 1LC3A 4RVSA 2FP4A 3ROQA 3MJSA 4WEOA 3I83A 5KKCA 1FDVA 1XCBA 3VDQA 4DGSA 2VHVA 5GZ3A 1M6WA 1YBVA 3ZHXA 3DTYA 1XG5A 4MP3A 2EERA 3ZGYA 5JO9A 2ZB3A 4CM6A 1V9LA 2V6GA 1LNQA 4D41A 3UICA 4QXMA 5DOZA 4CMKA 4CQMA 1GFSA 2GYYA 4ESOA 4W6ZA 2NSDA 5EERA 1T24A 2I66A 3ZWCA 3A1NA 5L4SA 4J4BA 4DQXA 3OQ1A 3C7AA 2DPGA 5L95A 2OP1A 2GPTA 1PL6A 2J6IA 4FPXA 4PLZA 3U4CA 3UUWA 1LDGA 3WGGA 2A9FA 3ANLA 2VN8A 3RFXA 5BNFA 3KHUA 5F1OA 3KSZO 2C07A 3GA0A 5HS4A 1DSSG 4CMIB 1C0LA 3RKRA 3H2ZA 3JQAD 4FOSA 4EUFA 3EHEA 3L6EA 1NXQA 5L3ZA 3JYOA 2VNSA 5AVOA 1DAPA 1YJQA 2BGMA 3QW2A 1BG6A 1WMAA 2NADA 5CFZA 4RGBA 1ONNA 4QSMA 1SZJG 4IMPA 1K6XA 4H15A 2FY8A 2IYPA 1KEPA 3GDOA 2IEDA 2HMSA 3AU9A 2NU8A 1P1FA 1P1IA 5EIOA 5L45A 4RPJA 4O63O 4IXWA 1DFIA 3RCBA 5KJCA 5HTOA 3PHLA 4B7XA 4BS9A 4F6LA 3NKLA 1MC4A 4GX2A 1R4MA 3WGYA 4NJMB 1W6UA 4R41A 1TI7A 2C82A 3PHHA 4PGFA 1C0IA 1ISFA 2GO1A 3BTOA 1VJTA 3BMOB 4RF4A 4XJTA 1T25A 3OA2A 1HYHA 2RH4A 4Q3NA 5KJEA 3E1KA 5JAMA 2BFAA 4D0SA 5F5LA 5CPFA 3LDHA 4DYDA 5JBIA 4B8WA 4UVHA 4NG5A 3C7DB 1OMOA 1UH5A 4WNCA 4RDIA 2GR9A 4RPKA 3FBGA 3ROKA 1XA0A 4OKNA 3WS7A 4A10A 1KS9A 2NU7A 3WYCA 1LSJA 4J7UA 2OZPA 2WWRA 4W99A 3VVCA 4A27A 2GZ3A 3ST7A 1KVTA 2X5OA 3JQBA 4M86A 2FN7A 1GUZA 5GMOA 2HCTA 3CUKA 5DBIA 5EQDA 2HK8A 3OA0A 2D4AA 3UW3A 4IY1A 4J3FA 4CM4B 3BXXA 2FPGA 2P5YA 3STHA 4QO8A 3SC4A 1A27A 4FOOA 2DAPA 1ZK3A 2ZIZA 4I1IA 3WWZA 1OFGA 1JKJA 4FC7A 4Z6KA 3PTZA 2O2SA 1Q1NA 2JCVA 3ZN2A 2AEJA 2EGHA 4MVJD 2D2IA 2GN4A 4Y8VA 1D3AA 3DHYA 3E5RA 3RUHA 3VZQA 1YE3A 3F5QA 3JD4A 3GZNA 2Y93A 3A06A 4BKQA 4EGFA 5A5EA 5LDGA 2D8AA 4WCDA 2AE1A 3G79A 3HNPA 4DYVA 1Y9EA 5G0TA 5AYVA 1EVYA 5BSGA 3V2GA 4R1TA 1HDGO 1SOVA 1PZHA 3MJTA 3C1TA 4CQLA 3KOUA 5U9CA 1Q0QA 3D1LA 3DEYX 3FTPA 5T57A 1D1SA 3ZV4A 3EY4A 3GNTA 2OHXA 4GMFA 2AQHA 5F1KA 3CZMA 3RASA 1ZIDA 4FN4A 3DQPA 3R6DA 1A71A 2GLXA 5DCYA 2CZCA 4KP7A 5MDHA 1ZSVA 3D5TA 1R4MB 1PJ3A 1ENZA 3FCOA 3O26A 3LZ6A 4IBOA 4ZQHA 3QVOA 3GG9A 4HUJA 4FFNA 4OKIA 4PZEA 2Q2QA 2IRWA 3PWZA 3DBVO 4PVCA 3PHIA 2XF8A 1H0KA 2NV6A 1NWCA 2VZ0A 1H6DA 2EHDA 3VVBA 1DLIA 3MJCA 3W6ZA 5H83A 3ZWWA 3I4CA 4LVCA 1NFRA 3GGOA 3GC6A 2NTNA 2CY0A 4ROSA 1A9ZA 3DXFA 2O50A 5BNIA 3U4IA 3BTUA 1DLJA 1TLTA 3K30A 4ND4A 5JPIA 1X13A 3OQBA 1KETA 4YDRA 1JN0A 2P4HX 4N5LA 3LF1A 1NPTO 3IUSA 3JQGB 3N7UA 3MOIA 2HAEA 4CM3A 3AOEA 3KUXA 3ZW9A 2BI7A 3ABIA 4R51A 5DULA 4YCAA 3PIDA 4RO0A 1T26A 3KZVA 3G49A 3OF2A 3AM5A 2PZKA 2O48X 1FF9A 4QFDA 4KUGA 1PSDA 4J1TA 2DU8A 2IZZA 3JQFA 4J1SA 2VZ8A 4PLTA 5I7FA 5ICMA 1MXHA 2PD6A 3U09A 2B4RO 2PWZA 3RU7A 1DIHA 4M1QA 4R1NA 3JV7A 3WGOA 3VKVA 1NHWA 1VRWA 3ITDA 2W2LD 3VPHA 3W8FA 4MVJP 3NV9A 3AJRA 1JA9A 3FR7A 2BFMA 4DMMA 3QSGA 5AXBA 1JVBA 3ZHBA 1PJTA 3VTZA 3ZU5A 5A03A 3F9IA 5T5QA 4P4GA 3C3XA 5ADHA 1PWXA 5KVCA 3IDSA 3GLQA 3GAFA 2J3IA 3D64A 2O3QA 3BHMA 4PLVA 2A35A 4YPOA 3OECA 3GVIA 2G76A 3I23A 3NTQA 4B3HA 2OUIA 3TOXA 5BR7A 3H6KA 1DRUA 4RF5A 1Y8RA 2FR8A 3VOSA 2JCXA 1DEHA 4Z0HO 2H6EA 2JHGA 2W2KA 4BQPA 5U1PA 3QV1A 4CLXA 4DMLA 3ZW8A 2Z1NA 2Y66A 4HX5A 4ZQBA 4WPGA 5KOIA 3WGTA 4E2ZA 3AUTA 3HUDA 4NBWA 4U6SA 5L51A 1KY4A 2FRDA 3RC9A 1QYCA 1XU9A 4GSKA 4II2A 2G82A 2G17A 3I3OA 4NU6A 1QR6A 4FFPA 2IZ0A 5L7TA 5DOVA 4IDAA 1V0JA 5C7OO 5LCXA 4GQAA 1JTVA 2I3GA 2Z95A 1DIRA 1IL0A 3WYBA 3T7CA 5B4VA 3O03A 2NM0A 1I3LA 3GNSA 1Z45A 4IZHA 3T7EA 3UKOA 4DC1A 2X23A 4EJMA 1LLQA 4BUCA 4BMSA 2WDZA 4QUKA 1GCUA 4CUJA 2UAGA 4UUMA 4DRYA 2B5VA 3QWIA 1V6AA 1NFFA 3JQ9C 4E5YA 3WIEA 1VSVA 4MVJA 5I7SA 4PN3A 1ZBQA 3LSYA 4QFCA 4BNUA 3ENNA 3H9UA 1CDOA 4B7CA 1YGYA 4DUPA 3RIHA 4C7JA 1HSZA 3OMLA 3PHGA 2X0NA 2QQ5A 2C7GA 3ETEA 1A4UA 3LT4A 1DFHA 1X7DA 2RIRA 4IGFA 3QIVA 4JJFA 2VWGA 5TF4A 3NGLA 4L9RA 4E3ZA 2HU2A 1WDMA 3ORFA 2BFOA 5JYFA 2O3UA 5IFLA 4WKGA 6LDHA 3GY0A 4CV3A 3KLMX 8LDHA 5L53A 1CWUA 2XPCA 1A9YA 3TOZA 4XCVA 1DBVO 5I9NA 1I24A 1TT7A 3E03A 2AEFA 3F6YA 3VH2A 2IXAA 2W2KB 1YB1A 4ZQGA 4BNNA 3WJAA 3GH3A 1EZ4A 2ZYAA 3OH8A 3FWZA 1EEHA 4Y6PA 1GD1O 1N2SA 5F21A 3H3JA 4OXKA 2OXIA 4Q9NA 3WSWA 3VDRA 1ULSA 3IS3A 1N7GA 3BHIA 3U0BA 1O94A 3PK0A 3VZRA 4CQMD 1QSGA 2EKLA 4LRSB 2XAAA 1E3LA 2PGLA 4Q3BA 4Y6SA 5KTKA 2CNBA 2NTJA 3I9MA 3WFIA 4CM7A 1E92A 3WXBA 2I6TA 4CLOA 3TRIA 3HN7A 2WE8A 2GUGA 3IOYA 1U4SA 2CDBA 3UAGA 2ZB7A 3KYDA 4FJ1A 2NU9A 5L4LA 4KUEA 5B12A 1EUCA 3C7CB 3PHJA 3RU9A 2PNFA 3ZU2A 5DBFA 1UZLA 4W7IA 3ONFA 1BHSA 2NVUA 2PY6A 4PIVA 4H16A 4CUZA 1EDOA 3M6IA 2I3AA 1NVTA 3GT0A 3OETA 4M49A 3T4EA 3I9NA 4EUHA 2A94A 4I08A 2O3SA 3BTVA 4TRJA 1JWAB 1M75A 3ANMA 3JYQA 2VWHA 1N1EA 3I9JA 2EEZA 2NQ8A 2RAFA 3M2TA 2GN6A 3NJ4A 1LDMA 1V3UA 3JTMA 2E4AA 3D3WB 3EW7A 4MKRA 4N5MA 3WLFA 3RKUA 2IXBA 4BNYA 5JFOA 2D3TA 3F5SA 4FBGA 4JIGA 3WGZA 2HLPA 5A04A 4BNMA 1U8FO 2GZ1A 4OOFA 1E6UA 2DFDA 2OORA 2Q99A 3R3SA 4U0JA 1GCOA 4Q39A 3ROMA 1HT0A 1NPDA 5CPBA 3WGQA 3MTGA 4AFNA 3GPIA 3CZRA 2HJSA 3SLGA 1FMCA 3F4LA 1Z82A 4HP8A 3P2YA 4XJSA 4RF2A 3NT2A 2CMDA 2C20A 4BO6A 4ALLA 4O6VA 4J0EA 4R5HA 4YJGB 5IF3A 3QWFA 4MPDA 3EVNA 2AA3A 2GZ2A 5JDIC 1H2HA 1YRLA 5CDSA 1U3TA 4YACA 4KZPA 4YAKA 3TDKA 5B37A 3JD3A 1YB5A 4OH1A 4KQWA 1VL6A 4AJEA 3I9KA 3GRKA 3PP8A 5ER6A 3JQBC 5JNLA 1F8GA 2VUTA 1PZGA 4K6FA 1B26A 3D3WA 3B70A 4QECA 1KEUA 1EVIA 5A3JA 1T2DA 2Q3EA 4LMRA 4OGWA 4QT0A 4YA6A 4DIOA 1QP8A 5T6BA 2VOEA 1PIWA 1UAYA 1SB9A 3RI3A 3QVXA 1Z74A 1UXJA 4UUNA 3A14A 2PLAA 5ILGA 2C5EA 4ZD6A 3ROPA 1LQUA 3S2EA 1EUZA 3Q11A 5GZ1A 3WICA 5TGDA 1NQOA 4RQUA 4MVJG 2YV1A 2ZTVA 5L9AA 3NT4A 1CIVA 5JXWA 2OP0A 2VT3A 2GF2A 1HLPA 1Z73A 3H3FA 1H6CA 1XWFA 3LT2A 3ZWOA 1I2CA 1GTMA 2C54A 4FD3A 3CMMA 4CMAA 3AI1A 4DLAA 4OAQA 3K9QO 2EP7A 3PZBA 1ZUD1 3I9OA 3VHRA 3OIGA 3UVEA 5BSEA 1K3TA 1PJ4A 4PLFA 4L76A 3WBBA 5THQA 2X7HA 5FWNA 4J4HA 4PLWA 3MOGA 3RAJA 3OICA 3ADPA 3ULKA 2EKPA 4TVBA 1GADO 4N18A 1C1XB 1YOVB 2B83A 1C0KA 3GDGA 2OOSA 2WMDA 1ISHA 3C1AA 4RZHA 3PRJA 4LCJA 2IEBA 4BO4A 4BNGA 1ULUA 2W98A 1LSOA 3S55A 4PFJA 4CMEA 2I67A 3SEFA 2FWMX 4I8XA 1G0OA 4NI5A 3B6ZA 1Y1PA 1DJNA 1WZEA 2J5KA 1IB6A 4FQ8A 4LSMA 5EPOA 3LC7O 5A05A 2QYSA 2ZJ1A 2ZB8A 1QORA 4W7HA 4UREA 2ZJ0A 4M54A 4E5KA 1A5ZA 3H9QA 1Y81A 4YQZA 3A28A 1P44A 4XQGA 4YAJA 4CMCA 2J3JA 2VOJA 4BGUA 1EUDA 4YWJA 1P45A 3WQSB 4BNTA 2VTDA 2AG8A 3DOJA 1LXCA 1LLCA 1GPDG 3DBHA 3ZWPA 3KV3O 5IDYA 4KUHA 4L75A 3OHSX 3PPIA 3CXRA 1PQUA 4GSLA 4Y9DA 4M8SA 3SXPA 1YB4A 2CFCA 4RVUA 2P68A 1ARZA 2AQ8A 2X8LA 1E3WB 2UUPA 2WYVA 2BHLA 2BMAA 4ZICA 2QYTA 3U49A 1FDWA 4YT8A 2ZCVA 5EINA 1Z7BA 3JQ7B 4KDFA 4ITUA 5B4TA 3CH6A 3Q3CA 3LLVA 1E1KA 2EJVA 4CV2A 4D46A 3EAGA 2J3HA 1DO8A 1MV8A 3TZQA 4F46A 2HMUA 1GYPA 1U3UA 3D4PA 4OL9A 4IDGA 4NFHA 3GFBA 2AE2A 4XD2A 4I9NA 1MXFA 4P38A 3AY3A 4UVGA 5G2OA 4WK6A 4NHEA 2ZTUA 3HADA 2YDXA 2C2YA 1J49A 3IJRA 1V3TA 1BVUA 4FFMA 3ANNA 1C1XA 1UXGA 4RQTA 2O7SA 2PKQO 1SMKA 4PZCA 1MGOA 4JJGA 3AUAA 1J0XO 3T4XA 4CLEA 1YS4A 2DPHA 2OGUA 4KDEA 3BAZA 4BO5A 1EBUA 4RV9A 3EDMA 4YAEA 3ONEA 4B4WA 4GH5A 2DUUA 4XQEA 3U62A 3I6IA 4A26A 1CETA 2NVUB 3SX2A 3ZU4A 1NHGA 4FDAA 1MFPA 1R6DA 4J16A 2HMTA 4BV9A 3RUAA 4NZ9A 2J5QA 1NVGA 4XWYA 3NGXA 1X7HA 3H65A 4PVDA 3WTCA 4O5OA 3TPCA 4NU5A 4DXHA 2ZATA 1R4NB 3PLNA 4XGNA 2WTBA 4YVFA 4DPMA 4LK3A 2VHZA 4YQYA 2B36A 2GCGA 3VH3A 3ZV3A 4G65A 3V1UA 3GQVA 1ISMA 3NTOA 1DHTA 3K5PA 1GY8A 3WNQA 1I36A 3ZV6A 3FD8A 3DZFA 3PGJA 4BKOA 4NFYA 2WYWA 4Z3DA 2PV7A 5HS6A 2DUWA 1Y8QB 3FN4A 3QRWA 5HBRA 3DMTA 3INTA 5IDQA 4EJ0A 1PL7A 3FPCA 4I5GA 4YJHA 3ZNQA 4IZIA 2Y99A 3WMWA 2X22A 2VWPA 4CJXA 2OMEA 3VZSA 3DAGA 4CMIA 5CDGA 2Q2VA 3EVTA 3A4VA 3KRTA 3SVTA 4U7WA 5FFFA 4YT5A 4AJHA 3E5MA 4ALKA 3WOHA 5I7EA 1NNUA 2BGLA 2X4GA 3OJFA 4IINA 4TSKA 1G6KA 3MWEB 4Y6RA 3RC2A 3JCZA 1VC2A 3AI3A 3ASVA 5TJ9A 3ZZNA 3RUCA 1GYRA 4M55A 4E5PA 1P33A 5ICSA 1ZK1A 4B3IA 3DMYA 2C0CA 4GL4A 4CMBA 3AOEC 3AM3A 1VJ1A 1ZMOA 4RPHA 2OBNA 3ZWYA 1FDSA 4CR8A 5A9SB 3TL2A 1YVEI 3W6UA 3ZNOA 4R3NA 3RJ5A 4XKJA 3TFQA 1Z6ZA 2DLDA 4W9NC 2HMWA 4J9VA 3DBHB 3UH1A 5FEUA 4BO3A 3IMFA 4XRGA 1X0XA 4WOJA 4INAA 1CERA 3FHLA 2YHUA 4IGEA 4PRLA 5IZCC 1WMBA 4O1MA 3GR6A 3GEGA 5ITWA 3WR5A 1OAAA 3COSA 4S3MA 1QV6A 1ML3A 2UUOA 3VZPA 2C2XA 2A4KA 5IN5A 4MP8A 5FI5A 3R1IA 1X1EA 2PGDA 4XQ9A 2Q50A 2GGSA 1MB4A 4XDZA 5T8KC 2X6TA 2XXBA 4CPDA 1AE1A 2VHYA 3GUYA 4JN6B 3CMCO 4MO2A 4RVHA 5TT1A 3LC2O 1OI7A 3WG9A 4BKPA 4L73A 2YY7A 3JD2A 2FR0A 1PEDA 4NMHA 5A3VA 1DC3A 1I8TA 4L4XA 1E7YA 2B4TO 1U28A 1A4IA 4YJHB 1BSVA 3ENKA 3UXYA 3VKUA 4BIIA 3ONDA 2DBQA 2OBYA 1LSUA 1U7TA 1GUFA 1HYEA 1PZFA 1Z7EA 3DBLB 4J6FA 4TKMA 5HRUA 2HO5A 2P91A 3DBLA 1D7OA 1DIGA 1ADCA 5K0ZA 1PGNA 4YB8A 2IZ1A 1I2ZA 1PS0A 4TZTA 4JLWA 4LGVA 3QVWA 2UV8A 4XIYA 5G0VA 2HKIA 1JKIA 4JBHA 1C0PA 1PJQA 1KVUA 3QA9A 2WD8A 1X7GA 2P9CA 5EL0A 4K9DA 1A72A 1GDHA 3FPLA 3V8BA 3TWOA 2DTEA 3OJLA 4E33A 3WDSA 3RVDA 2Y1OA 1RM0A 2Q1WA 2PH3A 5JDCC 4YT2A 3TZCA 1I3NA 4CLRA 4OQYA 2Y1GA 2VYVA 4JP2A 1BTOA 1HE3A 2P9GA 2DM6A 3WSVA 4XDYA 3CEAA 3U4DA 1BW9A 3CINA 4BOYA 1BW9B 1GZ6A 5DT9A 2V7PA 1P1KA 3UF0A 1XQ1A 4LISA 1UDBA 3PEFA 4HXYA 2C59A 4JXKA 4KQXA 4OSOA 4PCVA 4EBFA 3EC7A 2VWQA 5JLAA 4CV1A 3QQPA 5TRTA 2BELA 4J7CA 1O9BA 4I5DA 4R3WA 2DC1A 3GEDA 3WJ7A 3OIFA 1ADFA 3R3JA 4G2NA 4LSWA 4IDCA 3SJUA 4L74A 1L7DA 1YL6A 3WGIA 1U3VA 4BMNA 4CUKA 4CM5A 3DOCA 1DFGA 1LQTA 1NM5A 1E5LA 4XB1A 3OJEA 1WWKA 5JSFA 4CLDA 3ZNNA 3GVXA 5L40A 2D5AA 4YJFB 2JCYA 4JBIA 1YQDA 4MP6A 1LUAA 2DBZA 1ZMTA 3BMQA 3L4SO 4Z0PA 1T4DA 2SCUA 2DT5A 1QLJA 3VPGA 3BMCA 1P31A 4ZN6A 1T2FA 3QHAA 4WNIA 1UDCA 3GHHA 4NJMA 5KNLA 2B37A 1K6IA 3O9ZA 1YBAA 3ADOA 3FNHA 1PS8A 4RCVA 4R69A 1ZW1A 3H9JA 3PJGA 3QWBA 4EDFA 2Y1EA 3L9XA 4PLGA 1XEAA 3RUEA 1AGNA 4CM9D 4PG4A 1LDNA 1E3JA 2DKNA 2HK9A 3UCEA 4IJUA 1XQ6A 1JU9A 2BH9A 2GASA 3G1UA 5IN4A 4GGOA 4OXYA 2POQX 5EN4A 3L0DA 2QW8A 3VPXA 5KJ1A 5G4LA 3KEQA 4EJ6A 1X0VA 2CVQA 5A06A 2VRCA 4ALIA 3BYZA 3GNQA 3WBFA 1B3RA 2O3RA 4R16A 1ORRA 3MZ0A 4AJKA 1Q7GA 4CV0A 3PYMA 4NFSA 3D3EA 3DWFA 3KVOA 4M87A 3VH4A 5G4KB 1FK8A 2C5AA 2E82A 3NDIA 3AY7A 1KC1A 1DRWA 1LLUA 2WM3A 4Z9YA 4AICA 1Y8QA 3WQQA 1I3MA 3EUWA 3U3XA 1E3WA 1KEVA 5I8WA 3RFVA 3I4FA 1DXYA 2Y05A 1Q7CA 1XDWA 3F4BA 2JJYA 3G0OA 4G5HA 3JQ7A 4MVJH 3SJ7A 3I9LA 2RHRA 5JAZA 4D3SA 5IAAA 3IP3A 4NQZA 4CMJA 1LDYA 4BNVA 3JQDA 1ZK4A 3IIEA 2PD4A 3E8XA 2X9NA 3GFGA 2HK7A 1E6WA 3S8MA 1VKOA 1LEHA 3O4RA 2Y0EA 3E18A 4BNIA 3ETDA 1GAEO 3JQ8A 3HQ4O 4FGWA 1ZFNA 1HSOA 1WNTA 3DO5A 3NDRA 1VI2A 2RBEA 3U5TA 1NBOA 4IDDA 4GMGA 4KWIA 2PD3A 4XYBA 1F06A 3S2IA 4YBZA 4A0SA 3DHNA 4GAEA 1JWBB 2NQTA 4MVJE 5BNTA 1EE9A 3BMQB 1IZ9A 4DQUA 1VJ0A 4PG7A 3PFWO 4E4YA 4DPLA 1C1DB 1H5QA 3ON5A 1NPYA 3JQAA 4AJLA 1GR0A 3H9EO 3X2FA 1HXHA 2BD0A 3O8QB 3FBTA 1HL3A 3Q9NA 3IP1A 3O8QA 4GVXA 4I5EA 3MEQA 4IDBA 3RSHA 3TJRA 2VT2A 4WE3A 5JMPA 3WYEA 4RDHA 1EQ2A 1JW9B 1L7EA 1PGOA 2WD7B 4RVDA 5C7IO 1HZJA 1ADGA 5TIIA 2PKRA 1CYDA 1SB8A 1I32A 3GN1A 3ZDFA 5JO0A 1LDBA 4GX5A 4OSPA 3RFTA 4AJJA 3H7AA 3V5NA 4IIVA 4W9NA 4HBGA 4WECA 3DAPA 3GVHA 3D0OA 4MINA 4L4SA 1ISIA 5T73A 1PJ2A 3GG2A 4XYGA 1MP0A 4LN1A 4FC6A 3M2PA 1HDCA 2XOXA 3ZWVA 5JMWA 3BMNA 3A9WA 1LA2A 3KXDA 4WCFC 2QRKA 4J0FA 4WLNA 4D43A 3B1JA 2B69A 1J4AA 4PLHA 2O23A 1V35A 3F3SA 1IZ0A 3PJFA 3OJOA 1IPEA 2O7QA 3P5SA 3BZUA 1XHLA 4U5QA 1ZJYA 1DHRA 5J23A 4EW6A 1O6ZA 1SC6A 4HFNA 4XRRA 4CMEC 3INRA 1I2BA 1T1SA 2R2GA 3AM4A 4Q3CA 5DN9A 4A73A 2IODA 5TC4A 4GKBA 4JQCA 4MIOA 1E7RA 5JC1A 3AI2A 4CLOB 1AHIA 1EVZA 1U2GA 1I3KA 1KYQA 3B1KA 5COBA 2FSSA 1T2CA 1QG6A 2I9PA 2D1YA 1AN9A 4DBZA 3K2BA 5CEFA 3JQCA 3M1LA 2VCYA 2CF5A 4BGEA 1U5AA 1JAYA 3NUGA 4DQVA 3DONA 2G5CA 2P9EA 3IKVA 4RJTA 1PGJA 2PZLA 2X0JA 4O59O 4CR7A 3G1TA 2DTDA 2NTVA 5AQ1A 1GZ4A 3OJ0A 1F14A 2ZQZA 4DLBA 4H3VA 4PG8A 3DC2A 3C8MA 1ZEMA 4IS3A 5A4DA 1S6YA 1I5RA 4P22A 3HFGA 2Y0CA 4BNHA 1NQTA 1GL3A 3PWKA 1N7HA 1O5IA 2H1SA 3SC6A 3HDYA 3S2GA 1KERA 1SPXA 4L8VA 4ALMA 3K8ZA 2YUTA 1U5CA 3W8DA 4IUYA 5F5NA 2E37A 1HF3A 1WPQA 1UR5A 4DVJA 1HDXA 1ZK0A 3V2HA 5JDIA 4NBTA 1IY8A 1ZXBA 2EP5A 1RKXA 4RPLA 2EW8A 2LDXA 3TNLA 4E13A 2W2LA 4DLLA 1BXZA 2V6FA 3RJ9A 3L9WA 5IXSA 3RBVA 2ZKLA 1P3DA 1Q0LA 1LJ8A 1YQGA 3R0IA 3L4BA 3M1AA 2JD0A 3QP9A 3GVPA 4UUOA 3EZYA 3MJEA 3KB6A 1IUKA 1N8KA 2JHFA 1LRJA 4IJVA 4CMGA 1IPFA 5L4NA 1XYGA 2VRBA 4TVOA 4F45A 1ZCJA 3NX4A 4BMVA 2ZTMA
chains in the Genus database with same CATH superfamily
1ZD4A 3HB5X 2QG4A 3QTLA 4NYMQ 1OWNA 1P0CA 2P5UA 3LT1A 2GI4A 4TN1A 5AI9A 5CFOA 2DFTA 4L3WA 4HWGA 4M6WA 4BASA 1EFLA 2W43A 3GJ0A 5ILOA 4N3NA 4CRWB 3RRJA 2AR9A 3LUPA 2CV1A 1CCWA 4S1WA 4UAUA 4UFNA 3IAM1 1HZZA 4TUYF 3U9LA 3KFLA 1RWPA 4WADA 4KFTA 3O0DA 4F4CA 3TOCA 4F3TA 4ZFNA 1P2VA 4LTMA 2FJUA 3E0XA 3N8KA 2I2WA 3N8IA 2R8OA 1OC2A 3RIMA 3Q2IA 1Q12A 4CODB 3UHAA 4RZIA 2WF5A 1IVNA 1RPAA 2ONZA 4DG8A 2JGNA 3GJ4A 1L8AA 3KO8A 2H5JA 1P77A 2FSVC 1MOZA 5IDXA 3QUCA 2WUDA 4YDSA 4LKOA 1J24A 2CE7A 2MSLA 1KZ4A 1QOZA 2EW2A 3EDCA 1CQIB 3H9BA 4RSHA 4E03A 1P1CA 4C0XA 5KYYB 3THWB 3NYWA 1IC6A 4JLMA 3NATA 2VYNA 5EZYA 3JATA 1HFEL 5SZIA 3GEMA 2XZPA 3IOEA 3K1ZA 4H6VA 5A71A 4YYZA 2ZT7A 1MAAA 2BEWB 2ADMA 4JI1B 4B35A 4FR5A 2BKLA 1H4TA 4KO3S 1W87A 2WT4A 4AULA 4HAIA 5JAIA 4W82A 1PCXA 4MV5A 3BREA 5GONA 1A8IA 3S7TA 5LSAA 1AKTA 4BE7B 2JRCA 2AJ8A 1Z0FA 2ZTSA 1EFVA 1W47A 1THZA 1WDTA 1PW5A 2B34A 3BGOS 4QBFA 4BB5A 4R8MA 4F9GA 5C32A 2KQUA 2LGJA 3DDSA 5AKIA 3DT6A 4YP7A 1O6CA 1HYGA 3NHUA 1K3UB 3CRRA 4J2HA 4E94A 2XNDA 1S8FA 1JVSA 4OYYA 2IXTA 1ZM9A 3D6MA 3NH6A 2AB0A 1OIXA 2F8LA 3K96A 4EEKA 4TMKA 4TRRA 2XNCA 4EB6B 1K8ZB 5AK0A 3N75A 2BDUA 3FFTA 4ZRMA 4O4HA 2W8ZA 3SSNA 4BECA 3TUIC 3ZE8A 4RCZA 3ZOZA 1OE0A 8ABPA 3UMBA 2QORA 3MFQA 1JEQA 3BA1A 5AVXA 1N6KA 1U2QA 3Q3GE 2DR0A 4JEIA 1BE1A 4Q4JA 3ABQB 4RELA 3ROTA 5FTMA 4ZJZA 5HF6A 1XDZA 2YQ5A 1G21E 2VA9A 2YV2A 3EXAA 1BQEA 1NW8A 1ZSNA 4JJIA 3RC7A 3X1XA 5DWVA 4BRSA 2ONKA 5CUQA 3TLYA 2JLVA 5B3AA 4AUKA 4IVRA 2Q3LA 2XUPA 2ERYA 4ZT2A 3V4RA 1CY4A 5LU9A 3CCBA 5FUQA 3N2ZB 2V7TA 3AMVA 1JAXA 1HE2A 1QYDA 4RWEA 3DZ7B 2BEWA 3P9KA 4INPA 3L49A 3B3JA 1VBFA 4ZOBA 3EP8B 1Q74A 1FDOA 5AVJA 2RGUA 4B84A 1YH3A 4FKMA 2K6GA 4DCVA 1S8AA 1SXPA 3UMRA 4A3SA 3PQFA 3FETA 4NCBA 5C8YB 3SOPA 1AUXA 4JENA 2G4CA 3DPUA 3BL5A 3F1KA 3GRVA 3TRJA 1F0NA 4LWZA 3OQMA 2NO5A 2XWSA 2XYHA 4Y0NA 5KTOA 2W6PA 1TA4A 3VX3A 1WP4A 4RLHA 2C5LA 1YRWA 2V5AA 3HGQA 2RKWA 4KIGA 4AY4A 5GVSA 2GZRA 2VDWB 5E7QA 1KEKA 2I6XA 2MINA 4CCSA 1X1TA 2COKA 2H18A 4MIEA 5K7SA 3IAFA 2QRJA 2ACVA 4GYWA 3LT5A 1LLDA 3B6EA 2PH5A 3HLYA 4LDQA 1K7YA 1LFDB 2WJWA 4MTLA 5EP2A 1E77A 1CZNA 1E2HA 1R9JA 2JI8A 1T8SA 2UZ1B 2ZU6A 3ABOB 3M9LA 3PDJA 3T9FA 3C6KA 3QLJA 1L5HB 1P7CA 2C7BA 4IYJA 4XR9A 1M34E 3IAEA 3GGCA 3Q1LA 3P9RA 4XW2A 4ZT6A 1B23P 5H7XA 2YVQA 3BIJA 2WVGA 4RD1A 2IF2A 1G3QA 2Q1SA 2J5RA 3CWCA 1BQ4A 4WASA 3P2KA 2GM4A 1M5UA 3M4XA 1D1TA 1XLTC 3GW8A 1P2SA 1XNGA 3PUYA 3KYJB 3B1FA 2Y68A 4MW6A 1N1GA 2J3LA 5IASA 1T9DA 4GX1A 1T8WA 2PL5A 5CCBA 4C14A 1F6WA 3GP3A 4M0PA 4IH9A 1Y48E 5B30A 1EVJA 3W5SA 3AHEA 5EJ2A 3HJAA 2UU9B 4EI7A 2X9QA 1J7JA 4KCGA 3I1JA 4BO7A 2E87A 3IEPA 1WQ4A 1PKEA 5ULLA 5BVGA 5T7BA 5I48A 4H6WA 3USES 4BJ6A 4ENVA 1QRSA 2AZXA 1E1LA 2OV1A 3FNGA 3L4JA 4MVJM 3GVCA 5DXFA 4G1MB 1F2DA 1XMSA 3LWNA 4HX2A 5DLPA 1G21B 2VK4A 4BKUA 1F2UB 2I4TA 3IPRA 3IPLA 3L8FA 4Z4QA 4L8FA 5JYCA 4JC5A 1XVAA 3CF2A 2YWCA 1NNSA 1SZDA 2IYOA 3INNA 4PZYA 5ALHA 1TEZA 2P9HA 3HJBA 3NHPA 4JQSA 1CE8B 5FDFA 1U2DA 3A6EA 3AUXA 2FEAA 2H5LA 1T8PA 4ZGBA 5F2KA 3DOEA 4XH9B 5JEEA 3B9QA 2WFZA 2XR1A 5DGTA 1D0VA 2I34A 3HA7A 3BRCA 4MRPA 4YAOA 1BS1A 2V6JA 2FCRA 2W4MA 3CE6A 1QYWA 3EXG2 5LZ8A 2PLFA 1V2HE 2W2VA 2RD2A 5LD2B 4U2GA 1QQ7A 2EIHA 1QVWA 1ZNQO 1T36B 2PLRA 1U8TA 3K9WA 2R1VA 4NS1A 1F3LA 1N2CA 3KBOA 4MEBA 1CZLA 1A2BA 3LX5A 3O3NB 2IXGA 3Q12A 4IPTA 3LP8A 3RM3A 3WGMA 4OU5A 5FNVF 3P9XA 1EIZA 1P8AA 2W2NA 1QB7A 4IRUB 1P19A 3DHVA 2LIVA 4WBNA 4G1CA 4NDNE 2RGDA 2XZDA 3L82B 4I0WB 1JAIA 1WMFA 1SD1A 2J32A 3QKUA 1BFUA 1EGVB 3E7FA 2XHZA 4FX2A 1QHYA 2VHWA 1UUFA 2ZBFA 3BORA 3BWVA 4QG3A 3NGMA 3CH5A 3T54A 5HJEA 1BXKA 1E9RA 1Q57A 5AKGA 4YQEA 1WETA 4DV5B 1BVRA 5A5FA 1SXJC 5IEJA 4G9GA 1U80A 3HE3A 5JCJD 4MVJI 1XEXA 4OQNA 4AKTA 2ZRMA 4X6YA 4D9IA 3KJXA 1Z3IX 3DL2A 1DJQA 3PICA 3IBSA 4F4FA 2C2BA 1QCCA 2ZZKA 3I8XA 3UXEA 3AUJB 4JI4B 2IYAA 2XWJI 1IBKB 3AFMA 3AK4A 3KTFA 4C0BA 4ZZ1A 5FQOA 5LQNA 3KSBC 4I4IA 1ADBA 3FF4A 5DGHA 1JKFA 1NURA 4AO7A 3L7YA 1HT3A 3EWSA 4D9HA 1I1HA 4DMKA 1YBMA 2B99A 3LWDA 4HSGA 3ECAA 2DE0X 1FL9A 2OFOA 3LRXA 2ZR0A 3R8FA 2PKQP 2XI4A 1P4RA 4YO8A 3VAZA 3UT5B 1OF1A 4EMBA 1KJZA 3TSAA 3OCUA 3NCHA 3UJ8A 5CBPB 3COVA 2EFDB 1R16A 1WB4A 4Y67A 2O0KA 5BN3B 2OL4A 3I09A 4UM9B 5K6AC 4RDXA 2VDWA 4UC0A 4MAAA 1C3EA 2WINI 4N65A 2QE6A 4EGAA 1YFJA 2J41A 3ZDRA 3DOUA 5GINE 1IQUA 1YUNA 4HQRA 4BO8A 1XKTA 3QFFA 4WXEA 2CCJA 4Y2TA 3SXJA 1F8UA 3F47A 5J63A 4GLOA 2Q45A 5ELXA 1JHDA 3ITKA 2RHLA 2B7BA 1KTVA 3PUVA 4M9UA 4NBUA 4N48A 2V98A 3CXUA 3K0KA 1XF9A 4YGXB 1W9MA 2AYXA 3KLOA 4HAVA 2PS1A 1JENB 3ZH2A 2HSDA 4RL4A 1YXMA 2X8AA 3H5RA 1JZQA 3TYXA 1FC0A 3H2SA 1OY1A 2E18A 3LRPA 4W6QA 1GYQA 4M9SA 4QOJA 5AXCA 4GKVA 3HJGA 1VA4A 1XR3A 4HFRA 4NVRA 4UZFA 3GF4A 4YJGA 3DF7A 1QQ5A 1FLVA 1KIFA 4G41A 2JFUA 3QFRA 4U2DA 4BMZA 1JEQB 3LY9A 1MOSA 1A96A 4K5QA 2ZT5A 1OILA 1E4OA 2XD4A 3E15A 1SG9A 4ZOCA 2XX3A 5E7JA 3J7TA 3ML1A 1HO3A 3B5EA 2AJTA 1E6MA 1ONOA 1TRKA 2P6NA 1X7WA 2X86A 4C2TA 2WKSA 2HGSA 4KXLA 1GPKA 3C6MA 1XELA 2ENUA 2YINC 4X44A 3NHSA 4Y2YA 3DO6A 2GDJA 2VF7A 1MF7A 1K6MA 2ZUTA 3NH9A 2WPDA 3VR1A 3PX3A 3Q4GA 3AWDA 3UMYA 1FIUA 2BL4A 1H65A 3A11A 4F6CA 4FIZA 1M2OA 1OXMA 3RTEA 4IJ5A 4BN5A 2WFAA 3H2HA 5FI0B 3ABZA 2IF0A 3GHYA 1Z0IA 3ZI0A 1D4AA 2V03A 4JU8A 2JFPA 3VDNB 1E3DA 4YRLA 4X7MA 2F6RA 3GMIA 1KFEB 4MK4A 4CKBB 4CVNA 5BOSA 1AS0A 1RXUA 4JGBA 3ZWMA 2IYNA 4B0OA 4YMTA 1VPLA 1FBNA 1NAIA 4BFVA 1Z5PA 1I7CB 5DWDA 3IP9A 2EGGA 3IH5A 1TAUA 1KO8A 4ZP1A 3OF3A 2WKPA 2PJZA 1E2QA 2OZLA 4XYLA 5KYXA 3ZJTA 3S1AB 4PZDA 2IE8A 5AKLA 1OX5A 4HYEA 4J91A 3HR4A 2Z04A 3HY6A 4D3XA 5A4AA 3P7MA 4XR4A 1TF7A 2PLNA 3D3KA 1ZIYA 5BT9A 4DC0A 1Y7HA 2ZRHA 3PVZA 5IDVA 4FILA 1Q1BA 2FMFA 3H2KA 3IUYA 1P4JA 1S9DA 5H5JA 1BWSA 4LF6B 3A3OA 1G8HA 2PU7A 1EB9A 3MJFA 4FUTA 4WXMA 3TQHA 4IXTA 3RBZA 3OQIA 2Y3IA 4XD7D 4TN5A 1K8YB 1OXTA 4E1VA 4B3BA 4F93B 3EP6B 4NABA 2F9FA 1DB3A 4DIEA 2FUCA 1VCHA 1H9BA 2H07A 4G0QA 3AUSA 2X0RA 3IMGA 5IBQA 2X58A 421PA 1XZJA 3ZJVA 2H0QA 2G0TA 3UJNA 1MMFB 3VR4A 1K2WA 4C3OB 5HIIA 2P40A 3DHWC 1M8JA 3UCFA 1T4CB 2MJLA 1Q1ZA 3EPPA 4DPKA 3FLAA 1NX6A 1LVGA 2YJ6A 4Z53A 2HTEA 4MW9A 1VL1A 4TTAA 3REQB 4NBLA 4PLYA 1E20A 5K0SA 1JDTA 2WWFA 2H3EA 2ZBEA 3LSTA 4FMCB 4ND3A 5IAOA 1RLIA 3R4CA 4QYMA 3WNDA 3M1YA 4X6UA 3DZIA 3G5MA 1K5HA 3I53A 4J4TA 4RVNA 3WO0A 1BC5A 1JBEA 4C1BA 2A0XA 1HE5A 1OPXA 4ND6A 2A9VA 4BRWA 4CR6A 2WPDD 4DG5A 3EF1A 3TI7A 1AZLA 1UZNA 4OJNA 1JLLB 2WJ4A 4XM1A 2FLWA 1H93A 5DZSA 4S24A 5HM8A 2PUWA 2AX4A 5AJHA 3E2PA 3ENVA 1Z35A 3IQWA 4K05A 2R85A 3R0ZA 5EJ7A 1YL7A 2OBFA 1LZKA 4RESA 4N7RA 4MYTA 5A4KA 4TTIA 3HBFA 4NHOA 4YJ2A 2IXEA 2Q3BA 4JI0B 3DE3X 4MA4A 5DYGA 1XD2A 1ICIA 2AN5A 3A05A 1SQSA 1XD2B 4AY6A 2G0NA 2WYUA 2OUKA 1M1ZA 5I45A 3CZPA 2CXUA 3KD2A 2R1VB 2WG1A 4KR9A 4AB1A 1P17A 3OOHA 5GIOE 1ESMA 1PZEA 1XJCA 1T2AA 2HHJA 5D3MB 3NKFA 4Q93A 1P81A 5JAQA 3WRXA 5CDYA 1SZPA 2F3RA 4R31A 1VB5A 2JVKA 2P2YA 4CKXA 2ANCA 4H18A 4HDQB 1B1AA 4C7MA 1PJSA 2ZYGA 3SI7A 4WGGA 2MYUA 3LPMA 3AYXB 1DX6A 1X1CA 2JGKA 3TCXB 3NEPX 5INTA 2A9PA 5I8ZA 5JE8A 1QCYA 1P8JA 1W8IA 3B12A 3QLUA 2ZSAA 1EGHA 3CX7A 2HQ1A 4IXMA 4KXYA 3X2EA 2O8EB 2FG5A 2ZRJA 3UK7A 4JGGA 4NDAA 1ZITA 1LRLA 4DUGD 4UOEA 1X1AA 5ES4B 3I05A 4A0GA 2WTXA 2NTEA 3N7TA 4MRNA 1T0BA 4MQEA 4V02A 3W8EA 5JXHA 1VI5A 2DFPA 2JK0A 4OLHA 1EQUA 4YRDA 2XDYA 2Q1TA 1JFFA 1JSXA 2V74B 2XMPA 3GMTA 2VHXA 3PQ3A 3LUCA 4NH0A 4RVGA 3ENWA 4QBHA 2KYRA 3H6GA 1Z28A 3I01A 4LNAA 3VU9A 3DDOA 3AKZA 1E3MA 2PX3A 4E2XA 4KQMA 4KXXA 2BM8A 1JDJA 3OEYA 4JOQA 1AC5A 4OFXA 2IFTA 1SAYA 2Q3DA 1TO6A 4P54A 1D2NA 4ECAA 3KAKA 4JNKA 3MTIA 3AKDA 1FYEA 2X6RA 3AFIA 5EWLB 3UK1A 3W4IA 2UYOA 1WXXA 1YZVA 2QMUA 3BPSA 1F4LA 1OI4A 3IDQA 4G5YA 4F7WA 2GK3A 2R6JA 4RMJA 4W5RA 4I9UA 3S68A 4YJ2B 1UAAA 4TKZA 4O2BA 4DR1B 1MA0A 3ICOA 4PW0A 1HYQA 1Q7BA 2FX2A 2PWAA 4OIFA 1XZQA 3WKEA 4URXR 3RJZA 4MUBA 4JI8B 4R2XA 5CX1B 4R9SA 4EZBA 5CXXA 5YASA 2VJAA 2E7ZA 3FMGA 4FYMA 3AZPA 1ZOIA 5DHPA 2IPNA 3CY6A 2HA5A 4TYQA 1D9ZA 1V4NA 3KAPA 3CJQA 1B2LA 4J0KA 1NVWQ 3S1AA 1RAGA 2BEKA 3J80A 2RGNA 3H4IA 3IVMA 3KJIA 3BHJA 3LD9A 3SX0A 3T7IA 3TPZA 4BFLA 5JAUA 1Z36A 1QIIA 4B1FA 3Q2KA 4Z8XA 3M83A 5KX5A 4PBTA 3KR0A 1TXGA 4ND2A 4JX8A 2VEOA 4YR9A 5ALJA 3TEFA 5BW5A 2GRAA 1DC5A 1W8DA 3AX6A 3DKPA 4LXQA 5K6AA 2F4NA 2XV1A 5C34B 3GJQA 4OQ4A 1U8XX 3ZY5A 4GWGA 3ZE7A 5TLSA 4Z9XA 1BEZA 3THXB 4Z9FA 4XE5A 2PZJA 4BWVA 5J4KA 2HV8A 1GSHA 4UTOA 4WLUA 3R7WB 2WU8A 4UAGA 4NJOA 1Z0JA 1K88A 4Y2RA 4U2FA 4BKRA 2LP4Y 1F2VA 3K0EA 3ROXA 4ZC1A 1PWZA 3JY6A 1A97A 3VTAA 2HOQA 3LGAA 4GOLD 5DB4A 1CBUA 1RRGA 1VXOA 2XA2A 3GBSA 4U2BA 5DO9A 4MDEA 1B6RA 2X9VA 3PA8A 5HE8A 3ZD6A 2JLWA 4XIGS 3AEUB 5LKRA 3DZHA 4W1QA 2YHIB 2E49A 1SBTA 4HDKB 1CUXA 3QX9A 4IUCS 1KQGA 2ZDHA 4M9XA 3JVDA 2JGEA 5GQSA 1GPNA 2JGFA 3GGGA 1BXGA 1SCAA 2Q1XA 3QVMA 2DSNA 1U02A 1V3VA 2VDPB 3LVRE 2ZYTX 3OQIB 2CHQA 1J70A 3OAAA 2FZEA 3OOJA 4S35A 2VF8A 4E32A 3IT3A 2HT1A 4DSOA 3UO8B 4D97A 2UUAB 4G23A 2FKAA 5JCZA 5IYZF 2CEKA 2FPXA 1I14A 4Y1RA 3A70A 4S1VA 1JJIA 2YXEA 4RZ2A 3HP7A 1WB6A 1WLYA 2J9FA 3PPVA 4GQBA 4LJ4A 5TV2A 1JHXA 1DC4A 5C37A 5C4GB 4GPIB 1EXWA 3RIGA 3RC3A 1CSEE 4D42A 1KK1A 1SC4A 3LPAA 5JFGA 3H9CA 2IEYA 2C29D 2EJBA 4HH3C 4JAVC 3FB1A 3F2IA 4JB3A 3JQFC 4DL9A 2QRNA 2XITA 3EYWA 3G23A 5LA6A 3TLEA 1VYHA 1I72B 1TT5A 5JLJA 1F60A 2WJZB 4ZVPA 4B6OA 7REQB 1ZLXA 1QO0A 2XNDD 3NHFA 2Q46A 5BOSB 1I1OA 2ZWOA 4UTPA 3ASYA 3I1IA 4JFRA 3ZK7A 4CT0A 3TLXA 3QY9A 4D57A 1UMKA 2J33A 1K06A 4PM4A 4R3UC 4XDGA 1FDTA 5AICA 3WKDA 4CMHA 2QVGA 4G0WA 5HCUA 1BJRE 1U7DA 5E6SA 3S1LA 1FJXA 1E69A 3TJZA 4M22A 2QZSA 4IMIB 4WERA 2QOEA 3NYQA 1DEXA 4WOKA 3C85A 5BYJA 3RJMA 4UNRA 2H1IA 4B83A 2G88A 4C08A 2ATCA 1CIJA 1ZGGA 3R6LA 4E0BA 1GKYA 3PNPA 3RYTC 4CCYA 5AM0A 4Z4HA 3QEBZ 2IGTA 3SVZA 3HWRA 5TMPA 1SQFA 1T3ZA 2NUTB 3G7UA 3ME5A 3PCRB 5LOVB 2JFFA 2QRUA 1E4EB 3G9QA 3L1UA 3HB4X 1K5DA 1G8AA 1QQBA 4LRYA 2H9IA 3QU5A 3SZOA 5CEEA 1L8XA 3TXAA 3O21A 3NG1A 4MDYA 1PT6A 3L6OO 1CF2O 3KL2A 4YJFA 4L6AA 4BJ1A 1C2YA 1IY0A 2Y1DA 1TTHA 4KFSA 4K1XA 4HC4A 3RRXA 5LQCA 5JANA 3CX6A 4UUQA 4EEZA 5JS7A 2ZBVA 4FFOA 4LOAA 2HT6A 1E3SA 3RBXA 4EUEA 4Y1GA 1V1RA 2HMAA 5KC9A 1WLSA 3QHPA 1YZFA 1ZZEA 1U7HA 3BFVA 2VNKA 3N6XA 4X1OA 2XNHA 1BKDR 4ZCSA 1JIUA 2BFBA 4OQLA 3L8YA 1ZI8A 5DSTA 2RGGA 5IVDA 2NNLD 1P1JA 2VFAA 4NCIA 1OI3A 5A7HA 2HIMA 2Z5LA 3ETLA 4DXAA 3IWBB 1LZLA 1NOKA 1DPFA 2A0UA 4KX5A 1G291 4MJXA 5IDQA 1HDRA 3ONWA 2V0CA 3EIOA 3CNEA 3KU4A 4J0CA 3HNOA 5FPHA 4LOHA 3H5NA 4CN8A 3QE2A 1KZ6A 4HDNA 3IXQA 1O8CA 3OMWA 4EB8A 1IXYA 4CN9A 1QX4A 3QEOA 4QX6A 3AR3A 3IOBA 1NBME 1U6JA 2GZDA 4JLNA 4OGFA 1OLXB 4LF5B 1S02A 2WA2A 3SKVA 4Z86A 4IMRA 4UQPA 5DSXA 3QBVA 5DIFA 1GG5A 3OEEA 2I8AA 4WNAB 3O47A 5JVDF 2J5BA 1EBFA 3RYHA 3Q0EA 4BPBA 1XF1A 2AHRA 3EK2A 1NWHA 4EZIA 2QZPA 5AVYA 1P9LA 3OU2A 1JB1A 3QVVA 5IZ4A 1OOEA 3M1IA 1AGPA 5HIMA 4KJZA 5AJZA 3TRHA 5B2ZA 4BX3A 1NVMB 5JS2A 4JUAA 4JUBA 1C3OB 3QVSA 1XIVA 3O9MA 4U3JA 1AU9A 4GD3Q 5HK8A 1VLMA 4OSEA 3VU1A 3DLBA 2FRXA 1DAOA 5CP8A 1HEUA 3HO8A 1NE7A 2O5CA 2VRCD 1A7AA 3BRWA 4HTFB 4JJ7A 4NIMA 3NHAA 1ENOA 5A9RA 4Q3DA 1R6UA 4YJ2F 4G0UA 1XTJA 4KK3A 1TLLA 2G63A 3KQSA 2CNOA 1LPPA 2DTXA 2A1UB 3MGAA 4GZLA 2Q3HA 5BYBA 3WIUA 2XADA 5CB4F 4GOMD 3HYCA 4GX0A 2PH1A 3DLHA 1I30A 1KYVA 2O1WA 1DU4A 2OXCA 1WQ1R 4IGIA 5HQ3A 1UP4A 4PC2A 1XA3A 3GRPA 1DELA 3IEKA 1PQYA 4CM4A 2QTGA 4I6EA 3DDNA 3LCUA 1WKBA 4KKXB 5FUXA 1JJAA 4BQFA 2ZJ4A 3TLJA 3BKXA 1OFUA 4F5YA 1TZJA 3HVIA 2IYRA 1OXUA 2IIVA 1P75A 2B8WA 2RBGA 3WLEA 3PX2A 3DXZA 3N28A 4AX8A 2Y1CA 4HN4B 3S5UA 4CFYA 5JYDA 4IXNA 4JBWA 1OZGA 2LXNA 2OO5C 3GJSA 3MTAA 3FRJA 5K3BA 4DLTA 4OHUA 3DR3A 4L78A 1JKXA 4DMCA 3AH8A 3RUFA 4OXRA 4CLHA 1NATA 1ND6A 4K8OA 2QJOA 1DOHA 1YCFA 2BWJA 2CVZA 5LLSA 2H2HA 1T5BA 3F3KA 3A2LA 3UWKA 2WUWE 1GLVA 3H2IA 3EWAA 2AFHA 4L4ZA 5J2UB 4PONA 1P9RA 5JZOA 3N58A 1O89A 4C89A 2H16A 3FNQA 3DDWA 4L6IA 1JLLA 3QPCA 4RTOA 5K0EA 4PXAA 2CF6A 3NXSA 5CYPA 1F2TA 1R4NA 1GVHA 1OAOC 1P5RA 1SK8A 2A78A 3BCRA 3C70A 3O4HA 4JCCA 4OXQA 5EP1A 3ZJ4A 4JI7B 1ZXLA 2G1UA 3QX8A 3L6BA 1YVUA 1E1MA 3AG6A 3OOYA 3AVWA 2UYYA 1MG5A 3CLRD 3KZCA 3O1JC 3FNRA 1T3TA 1XZCA 2WNHA 4FHEA 2JH3A 3KKQA 4PTLA 2YVAA 3RG8A 3DE1X 2G4VA 4OYHA 2OAGA 1T9CA 2WNSA 2WEKA 1XZGA 2ZK7A 5KWIA 1TYZA 4K26A 5JNSA 3X0DA 2DFNA 3D59A 2XJ4A 1J8FA 3M7IA 2JGRA 3Q0IA 4ZPJA 5ALNA 5F12A 3GLUA 3SFVA 3ZI7A 4RL6A 4AJIA 3FI9A 1VPDA 3EZXA 3ZGNA 5KJFA 4TKVB 3HI6A 3HDVA 2DJ5A 1VE7A 3U40A 3MHTA 1AD2A 5HOQA 2YC4C 1RWQA 3MWJA 3NIBA 1K75A 4IDOA 5F23A 2C3YA 1S2NA 3FFAA 3LP5A 3QXSA 4HTFA 3RTDA 4PXYA 5BV8A 4UE6A 4M0DA 4OQDA 3EPLA 4K9RA 5K03A 2C4UA 1V7CA 3LC1O 2I8CA 2XXAA 3A27A 2RHCA 4GF5A 5IKOA 3E6AA 3A2MA 4TMYA 2JS7A 3EZ2A 3NALA 3V7YA 1G20B 3BD7A 4CM1A 3FSRA 2TECE 3DFUA 1E1NA 1E2LA 4JC8A 5I9LA 2YWEA 4IH1A 2QLJA 1ZS9A 3GCGA 2VF2A 2OZKA 1YS1X 2OQRA 1WB9A 2CUTA 3Q6IA 2CMGA 2AW5A 4I1RA 1Z8NA 3MMNA 1BRMA 4FSHA 4UHKA 5H68A 2OYSA 2IITA 2XMSA 4IGKA 1M9NA 5D3QA 5FHRA 4A03A 4BFUA 3CVOA 4U5XA 4X8HA 2FGJA 2VA8A 1VOTA 1Z4OA 5JQGB 2BCEA 3UT6A 5B58C 5KWJA 1JHPA 3HA3A 4IUDS 4B45A 4H17A 1GQYA 4URZR 4JT8A 3MXTA 3R0QA 1EFKA 3IQEA 2EWWA 1YA4A 4I5FA 3HB0A 3QNMA 2WLTA 3D54D 4MV0A 4J0JA 3IEIA 4DLPA 3DAHA 4D3DA 2QDXA 2O3TA 3I32A 4KPUA 4E4RA 3R5SA 5EOVA 4B48A 1O57A 3GNLA 3H86A 4RVSA 1TVCA 2EFGA 1ZJ6A 1QCDA 1S3FA 4ON9A 3WZMA 1UPBA 4C5CA 3C98A 1XCBA 3U3DA 4O2AF 4JI5B 4DGSA 1M6WA 1VECA 4GMDA 1N78A 3IHTA 4CM6A 3MAAC 2AKAB 1WXHA 4H3HB 1I94B 1NG1A 1LNQA 3FMIA 3UICA 1OREA 3DL0A 2DF8A 3KR1A 3MUFA 4XX0B 4CMKA 4EGSA 1II8A 1SR8A 1GFSA 2B0CA 2RSLA 5L4SA 2WWHA 2X3FA 4TYYA 5TARA 3OQ1A 1MQAA 3SAJA 5LP6F 2HF2A 4L0CA 2OP1A 1PL6A 2DRIA 1U0RA 3B53X 3I2JA 1Q14A 3CUTA 3FOAA 5D01A 4K0RA 1IBLB 3M33A 2OT3B 3RVSA 1KGDA 5E2IA 3RNLA 2GEUA 5HBGA 2A9FA 3ANLA 1CY7A 4DZZA 3T1YB 3HABA 2P75A 3IXLA 3QXGA 1JH8A 3KSZO 4D99A 4EH1A 2WMOB 2A8YA 3IQIX 3K20A 4CMIB 4BX8A 4DZTA 4ZV4A 1Z8DA 3GUUA 3JQAD 4ZEXA 2Z2JA 4M98A 4U4AA 4XIFA 1ODCA 5A5GA 3DBIA 1T6YA 4Q37A 2IZOA 4GL2A 4Y2PA 1SCBA 3A1UA 3QKSB 4PCLA 2AZDA 2VQDA 3ZXYA 1EFRD 1DEAA 4KK4A 2CWWA 4PHGA 3TVYA 1BG6A 1KJNA 3QLVC 1WMAA 2NADA 2XQVA 1TAHA 5CFZA 3EF0A 1UJ5A 4IMPA 2O0MA 4HS9A 3H75A 1KEPA 2HMSA 2OCXA 2FXIA 4KXMA 4Q82A 1P1FA 3H8VA 1O6BA 4U9HS 5EZYB 1V11A 4O2BF 1W34A 4MWGA 5LD2C 4GPBA 2NIPA 4YROA 2HDNB 4PZPA 2O7NA 1L1RA 2Q8QA 1NUHA 2OC4A 1NSTA 3PHLA 2A6PA 1X87A 3VNSA 3QPDA 4BS9A 1MC4A 4XWTA 1A1VA 1R4MA 1LPBB 1M72A 4NJMB 1JXMA 3D7SA 5JROA 1C0IA 1EP2B 1QDLB 4BQEA 1O96B 4MR8B 2VDMB 2H1OA 1VJTA 5G1OA 5AJWA 3IWCB 3BMOB 3OQJA 5IMBA 4LY6A 3OA2A 1DTEA 1FRNA 4ZC8A 1DIOB 4AN4A 5KJEA 4WBNF 2FSUA 3QPUA 4BEBA 3QZUA 4ZJPA 3MHPA 2N1MA 4EATA 1HR0B 1TJPB 1C2TA 2YASA 3ND6A 1L6IA 3A32A 3PQ7A 5CPFA 1UF9A 4D4JA 5AVUA 5KHAA 5JPCA 3EGXA 4M1TA 4NG5A 3W3AA 1O97D 2CHGA 3FMFA 3NW9A 3C7DB 1UH5A 3KPUA 4JU9A 4ZCIA 3KK0A 2W2OA 4RPKA 3ROKA 1YFLA 2R8PA 3WS7A 4A10A 1KS9A 2QD5A 1E94E 4FMPA 3H5VA 3SE0A 2OZPA 5C8VA 4W99A 3ERCA 3ST7A 5HFNA 2UUBB 2X5OA 1DX9A 3JQBA 5BYAA 2A4MA 2FGKA 2JAUA 1A5BB 2HCTA 4HDRA 1SHUX 3VU8A 4MCJA 3CUKA 4BX0A 4Z4IA 1OFTA 1GITA 3HKCA 3EPKA 1CLUA 4N4AA 4AMZA 2Y1LA 4NONA 4RD6A 4ER6A 2P5YA 4JODA 4MMZB 2ZIZA 4QTUB 4P7BA 1OFGA 1J39A 1JKJA 3DKRA 2Q8PA 1Q44A 4AZTA 4US1R 3JASB 2EBHX 5BN5A 4MVJD 5BRNA 2D2IA 1WXEA 5KYVA 3QVLA 3TB6A 2HA6A 2DB3A 3U2QA 3F5QA 4XUGB 3PEVA 2Y93A 3KOZA 4Y2XA 3A06A 1N2ZA 2A5YB 2ZE6A 2ZRNA 4YMIA 5FWAA 4EGFA 5AUOB 3JZFA 4FXOA 4WCDA 5DMHA 4AS1A 1MJ5A 3ZWQA 3QELB 1UQUA 4DYVA 3ZV7A 1WSDA 3AHJA 2XRFA 2HF7A 3KT0A 2WB2A 1LBIA 1QS0B 1H1LA 1U2RA 4BAZA 4R1TA 3E61A 4Q18A 1KFKB 1PZHA 1QV9A 4LJRA 1R6BX 2G5TA 1Q0QA 2ZBRA 4MUIA 2B98A 1FRVA 1D1SA 1YNOA 3IAUA 3EY4A 4ZVLA 3ZV4A 3RS2A 1EFUA 5ENZA 2ZG6A 4GMFA 5F1KA 3RASA 4AW9A 3LY8A 4EI9A 1V8OA 3D5EA 4KX3A 3DQPA 1CVLA 3R6DA 3SPXA 1ULHA 3C39A 3PB3A 1J0CA 4EFDA 1ESZA 2PX2A 5SZJA 3TW3A 1TIPA 4R83A 3FCOA 2QV7A 5IAGA 1FU8A 1ENZA 3O26A 3LCVB 4GP7A 5BSMA 3B6IA 4OKIA 3D2BA 4QBGB 3VV3A 3MBOA 4I5IA 3DBVO 5MGNA 5TE9A 4K6OA 3PHIA 3KJZA 1KYWA 1NWCA 1H6DA 4L3VA 1NZJA 1XP8A 1PI3A 2RC6A 4OATA 1PR6A 2EHDA 1QUEA 2IEZA 2ZIXA 3CIOA 5AT1A 1AHNA 4HN2A 1YZYA 2AWNA 2BISA 3CLTD 4A9AA 1C3OA 3DE2X 1CUWA 1JKJB 2PGXA 3SHQA 3S3TA 3V00A 1A9ZA 1Y33E 1FCJA 2GJ9A 1ONSA 4DSUA 3U4IA 2BFDB 3LBNA 4Q00A 1R8QA 4C4AA 5HKOA 3AJEA 2LWIA 2A57A 2J6HA 3K30A 4EECA 4D4IA 4AJ9A 4OHXA 1KETA 1S5PA 4I3HA 3QBJA 4D82A 2R5NA 3A2KA 3VVMA 3AFGA 2UYHA 1VBMA 3MOIA 5IVIA 2E4YA 3KUXA 3AW8A 1V5WA 3D2LA 4WOBA 2EZ4A 2DZDA 1T6BY 5IC4A 1ABBA 3HU3A 5FOSA 2HBQA 1GPH1 4YCAA 4DAOA 1EWQA 4JMLA 4RXMA 1NG9A 1T26A 3G49A 3OF2A 2WICA 1T9KA 4ZI7A 4WW0A 4TT3A 1X8JA 1FF9A 5CBPA 3M5WA 1PSDA 3P0IA 2DU8A 4J1TA 3JQFA 3HVKA 4AY2A 2PGNA 1QB8A 2PD6A 3U09A 2DXIA 1CEEA 4QXPA 1N3IA 2EGUA 3HDGA 3PVCA 1JFSA 3IIMA 5LIRA 3MUOA 3AJAA 4KEAA 2PG3A 1BYUA 1NHWA 3OFNA 2XQJA 1QO0D 5ALKA 3ITDA 1Y1QA 4ZTBA 1ILEA 1YRBA 2NU9B 4LRQA 3AJRA 1O96A 4MR8A 1K1EA 3P94A 5M7EA 2QT1A 3E5HA 4DMMA 2TMKA 5AXBA 3PXBA 1W581 4D9JA 3E1GA 3OX4A 4N0QA 1XA4A 5JNRA 2HHCA 3N3AC 4YRIA 5A1JA 2RHOA 5ADHA 1K7EB 1PWXA 3FSJX 3RADC 4MXDA 4BQNA 3DDCA 2BFFB 1DC8A 3LJKA 4MW1A 3GLQA 3H1TA 1XLVA 1QAMA 2QSZA 3GAFA 2BMWA 4NYIR 4R84A 3WNZA 1GJRA 1XDGA 4XM0A 3R9IA 3QU4A 1HA3A 4PLVA 4YPOA 5L3SA 3RS0A 3ZGXA 3D8SA 2DFKB 4B3HA 4CKWA 4GEKA 4X7PA 3MT0A 2IYVA 1DRUA 3EVZA 3O3MB 4KLCA 1NU8A 3AKYA 4CG0A 2V0GA 1TCVA 4DV6B 2GFQA 3OPQA 2L2QA 3H05A 5U1PA 5JNVA 2C5GA 2NXEA 2SHKA 4JFAA 1Y7IA 2Y66A 2Q4TA 1OBCA 2FPMA 4RXTA 3RFCA 3WXMA 2X0FA 4AK9A 4EG7A 2PA0A 5IF9A 1SRQA 2Q62A 2Y8EA 5BQPA 1NUUA 2OVFA 4WESB 1QDEA 2GEDA 4XASA 3ED1A 4HI0E 1A9RA 3AUTA 1P7VA 3QLTA 3LKBA 2C8JA 1I6WA 3SIRA 3WIVA 2GCOA 1T36A 2Q3FA 4HMOA 2NP7A 5FTLA 4GSKA 2EU8A 3JZIA 2CJXA 2FZLA 3I3OA 1ZGCA 3MSCA 3HO1A 5LZ5A 4GRIA 5KPJA 1F5NA 3VTKA 3O8CA 2VDNB 1RWWA 3W5BA 2CXSA 4UUBA 4GQAA 5HFJA 1TJNA 1HTWA 4PGAA 4KV9A 5JSQA 2NGRA 2NM0A 4D4MA 4IZHA 3MAJA 4DC1A 1G9SA 3CZCA 1ZA1A 1RZVA 4JQYA 2X23A 4F4DA 4EJMA 2H7CA 2XGGA 2ZJ3A 2ZYRA 4UCWA 4AWAA 3G1WA 1XTUA 4W9RA 3QWIA 3RRNA 1V6AA 2J1LA 3RRZA 3WK4A 1GCIA 1ISPA 2X0KA 4I50F 2XYVA 1VCOA 3IIIA 2R1TB 4B0PA 1G7CA 1NBIA 1YJAA 2Z0MA 4Q16A 1ZBQA 3D6HA 3K1TA 4MQFB 3FCSB 4CF6A 4F11A 4MWTA 2V7BA 4QFCA 4BNUA 1QH9A 3H9UA 1M2HA 4S1OA 4CIVA 3P0FA 4DUPA 1YR3A 4HB3A 1ZCFA 1YS2X 1EJ2A 5HM6A 2HLNA 3N8GA 3E3MA 4J8PA 1ZU4A 2X0NA 1MEOA 3ZCQA 4E7PA 1A4UA 2VPIA 2W93A 4FNGA 2IUYA 4O2RA 5C1BA 3UC9A 2PHZA 3SJAA 2RIRA 4R2WA 5ALWA 3CB4A 3RYFA 3VV2A 1YVPA 4R9NA 2MSCB 2VBCA 2R4UA 2VWGA 4R1MA 4F6RB 5C7YA 1RSZA 2C8KA 1WDMA 4HEJA 1QE5A 5A4IS 5JYFA 3FMVA 3LUJA 4TLCA 2XVMA 4M8IA 1ZR4A 3GY0A 2VQ6A 4CIBA 2OWDA 3GB9A 3ZDYB 3KLMX 5L53A 1CWUA 1KRHA 1JL3A 1SIOA 3TOZA 4CKWB 1CP2A 4XCVA 3SCZA 2IV7A 1GUBA 2Q5QA 1ZN9A 3KHKA 1I24A 1R0YA 3E03A 4RYDA 5G53C 4KQ2A 2Q8NA 3QKIA 2W2KB 5E1MA 3COZA 5DRYA 1EZ4A 4HAYA 2ZYAA 3GROA 3P5BA 4Y6PA 5P21A 3KYIB 4K8RB 2WSSD 4IJ6A 2GJ8A 2QY6A 2OXIA 4V2UA 1N25A 4HR7A 1SCQA 2B20A 4G5OA 2P9BA 2VH5R 4G9EA 4WL0A 4DE5A 3NBAA 3U0BA 3VZRA 1XXHA 1NYRA 3TTTA 3Q5GA 4LRSB 3C3JA 2HDWA 4NE9A 4HN9A 2G6BA 4PC3A 4Q3BA 1RWKA 2NTJA 3CR7A 1KO4A 3I9MA 5AJYA 1E92A 2Q9CA 3SJBA 2AJCA 3DGEC 5GVRA 1N34B 2FCAA 2I6TA 4ZCPA 1VPEA 4CLOA 3KUUA 1OW3B 5BUCA 2HU8A 1E61A 2GUGA 8GPBA 2X8BA 1G3RA 1TK2A 2GXUA 3VO2A 1ABFA 4RLFA 2CDBA 3QBEA 1E1RA 3BSFA 4JLAA 5LZ2A 3V4PB 4DDHA 4JUDX 5CT8A 3PHJA 4DIUA 5TXGA 2OO3A 4YYEA 5BR1A 5DBFA 1UZLA 1E89A 4YJ3A 1ZX1A 5ESDA 3GAAA 1QGYA 3GUVA 4L57A 4UBMA 1U4NA 1SUDA 4A6XA 4F8JA 3I9NA