3DMTC

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
358
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
source organism Trypanosoma cruzi
total genus 120
structure length 358
sequence length 359
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
C PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtC02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtC01
2A94A 1H6DA 1RM3A 1CERA 2GR9A 4AJIA 2FHSA 4GSLA 2NACA 4J1TA 3PRJA 2I6TA 3IAHA 4J7UA 4E4YA 3V1YA 1AGNA 4ALMA 4MVJI 4J1QA 3SX2A 3DHNA 4NQZA 3PYLA 3F1LA 4CV0A 1SBYA 1QV7A 4R3WA 1NFFA 4MIOA 1EVZA 4NIMA 3QY9A 1SO8A 1GQ2A 3NDIA 5JMWA 1P1HA 5B4TA 4UULA 5LDHA 2A4KA 4F6CA 1VC2A 4WKGA 4IIUA 4I5EA 5G4KA 3WWZA 2QRLA 2VZ8A 1JWAB 3IDSA 1AXEA 3UXYA 3DB2A 4XQ9A 1I3MA 4OQZA 1JKIA 5CPBA 4BO5A 1WZIA 3EZLA 4RVHA 4IIVA 2Y67A 2YQ5A 2J3JA 5IG2A 2BF7A 4CQLA 2P9EA 2J6IA 2X7HA 4IGEA 4J0FA 4TRNA 3UGKA 1QYVA 4JBIA 3T4EA 1ZBQA 3ZZNA 4E6PA 1EVIA 1DAOA 2VNAA 4BNMA 2JCVA 4Q3BA 5EINA 3ZCXA 1B15A 3GT0A 5TRTA 4FFPA 2WD7B 5I7FA 1KVQA 3ZNNA 4AJ1A 4B8ZA 2YHIA 5IF3A 1SOWA 2VHZA 1EUDA 3GN2A 4URFA 1FDSA 3RFVA 1R16A 1PR9A 2EGGA 1E3IA 4IQGA 3OMLA 4KUEA 2FZEA 5JY1A 4PCVA 1T4BA 1Q0LA 1TXGA 4I9HA 3W4IA 3OQ1A 2DVMA 3QWIA 5CP8A 4UVEA 4W9NC 4OKNA 1CWUA 1A5ZA 1OBFO 3R0IA 3I4FA 1TB4A 5T5QA 4YJDA 4JP3A 4ZQGA 3V5NA 3GUCA 4PG4A 1Y81A 5L9AA 2RH8A 4UEOA 2V6GA 1NPTO 3G49A 4OOEA 1AHIA 1PIWA 5IZ4A 1VL6A 1WAMA 3HDJA 4Y98A 3U5TA 4E5NA 2HU2A 1VLLA 2YW9A 4N5NA 1DFHA 1HDRA 4PZDA 4UUPA 1YL5A 3Q1LA 4XQEA 4LRSB 3CXRA 4CM3A 1UUFA 2HKIA 3VOSA 4AG3A 4B8WA 5KIAA 2Q22A 4NPCA 4CM4A 1M66A 3BMCB 4L74A 1P74A 4FW8A 1RYDA 5L4LA 2FSVA 5CFZA 1CJCA 2I76A 4YEDA 4BNLA 1DC5A 2CF6A 4DUPA 3F6YA 5L7TA 4D7AA 4YJHB 6LDHA 2CMDA 5KJCA 3WGIA 2D3TA 5DT9A 4PRLA 5A02A 2I3GA 3ABIA 1YL6A 3HJAA 1SPXA 3A9WA 3QWAA 4OJNA 4CLRB 3E1KA 4J1SA 2HMWA 3DBHB 4JBGA 5COBA 1DIGA 1Z75A 3L4SO 1GEEA 1U3TA 2DPHA 3QLJA 3RASA 4AJLA 3KO8A 2YFQA 3RU9A 2PNFA 4J1NA 2FR0A 2Z95A 3BHIA 3UAGA 5IDWA 5FFFA 3PJGA 3DBLB 2GZ3A 5U9CA 1HYHA 3VPHA 1XR3A 3WFIA 1J5PA 3GUYA 1LXCA 3S8MA 3GAFA 3ZWCA 4FFNA 2EKPA 1YB4A 1EEHA 4YDRA 1PGPA 1YS4A 1MB4A 3KEOA 3PEFA 1LQTA 4PZCA 4ZICA 4ZRNA 3TRIA 4BNTA 4Q3CA 4NJMA 2Q2QA 3GG2A 2J5RA 1N9GB 1VSUA 4UVIA 1JAXA 4KDFA 3PJEA 4YJGA 3INRA 1F12A 1YH3A 3H9GA 3GVXA 1B7GO 1OZAA 2JHFA 3GVCA 1PTJA 5KKCA 1W8DA 3AUTA 4OMUA 3WQRA 1DBVO 2O7QA 1WZEA 3D3WA 1A7KA 1NVTA 4AJ4A 4B4UA 4L75A 5ADHA 4BNJA 4GGPA 3RAJA 3HB4X 3CZRA 1EK6A 1E7YA 1DHRA 3BHJA 2EXXA 4Q3AA 2P5UA 1SOVA 4FFLA 4LCEA 2JFGA 3VZSA 3PVZA 1VM6A 3FWZA 4R1UA 2CY0A 3OICA 3M1LA 1P1IA 2NUAA 4IUYA 4WCFA 2C20A 2WE7A 4BNUA 3VZQA 1WDKA 1T2FA 1LLQA 4NDNE 2UVDA 5JFOA 4II3A 2BI7A 3WMXA 2J8ZA 4CUZA 4J2HA 1MA0A 4U7WA 1ZEJA 3Q2IA 2YV1A 4J2OA 1U9JA 5EIOA 4DIBA 1DSSG 2ZTLA 3GDFA 4ND3A 3VTFA 3QE3A 2VUUA 3OEWA 1K3TA 3BMOA 4Z3KA 3VH2A 3VHRA 2VTDA 3IUSA 4RJTA 4BO9A 1A9YA 4EYEA 1YDWA 4EJ6A 5CG2A 4QO7A 1NTOA 2EF1A 4Z0HO 1LSOA 1WVGA 3TZQA 3UCEA 3GRPA 3ZNOA 4CMAA 4CV3A 4XYBA 1WDLA 2CSUA 4G65A 5L53A 4MVJP 1UDAA 3GRKA 4MVJM 1ZJZA 2J5QA 2Y66A 1HE5A 3KETA 3B1FA 3WIDA 1O6ZA 2PZJA 2DTEA 1E92A 1KEVA 4Y9DA 2B37A 2HK9A 1Y6JA 4IDEA 1VKNA 4M55A 3M6IA 1C14A 5KOIA 3DO5A 1WDMA 3KRTA 1KEWA 3IQDB 5JYEA 1ONOA 1VJTA 3WBBA 3UN1A 1EE2A 2O3QA 4AJ2A 4BNNA 2IYPA 1MG0A 1PSDA 3CEAA 2P9CA 4XYGA 4LISA 3WGTA 4YAGA 3U9LA 5MGBA 4D41A 4DBVO 5THKA 3RBZA 2Q99A 4BMNA 1S7CA 1UXJA 4DPKA 1WMAA 2O23A 5EPOA 4CM6A 4BL5A 3KLMX 2Z5LA 3L6EA 4FFRA 5CEFA 1PJ3A 1UAGA 2PKQO 3W4JA 4RQTA 4D45A 5F5NA 4HFRA 3RUEA 1I3LA 3OJ0A 4AJOA 4BO8A 1H9BA 3PHHA 4UREA 4ALLA 5HBRA 5HRUA 1BGVA 2NVBA 3ZHBA 1QG6A 5ES3A 1R66A 5GMOA 3I9NA 1E1MA 3HG7A 1ZUD1 3I4CA 1IY8A 2EIHA 3ZV4A 2V7PA 3OQBA 3E48A 4EI2A 3NTQA 3M2TA 1CF2O 3L77A 3LSYA 2B4QA 1R15A 2XAAA 5IJZA 4TZKA 2F1KA 5JAZA 2Q45A 3BTVA 3H5RA 1FDUA 4U8GA 3QV1A 3TZKA 2H9IA 2OL4A 2X6TA 4FJ0A 4L4RA 3OH8A 1BVRA 1YQXA 4BGUA 3HNPA 5KJ6A 3C3XA 3JQBA 3MCVA 5IN5A 4WJZA 1JKJA 3WNQA 1H0KA 1QP8A 2ZTUA 2VZ9A 3DMTA 3ENNA 1DOHA 3HE3A 2Q3EA 1LDYA 5MDHA 4BV9A 4JN6B 5CDTA 1AHHA 2GUGA 1D3AA 4B3IA 1V0JA 3HQ4O 3GLQA 4FSHA 5IXSA 3ZWBA 1W0CA 3VPSA 1EBUA 3F46A 3WIEA 1RM4A 1FK8A 2WDZA 3CPSA 4FGWA 1HT0A 2HRBA 3OF2A 4GX0A 4CMJA 1Q7CA 1C0LA 5TSDA 1HLPA 2IZ0A 3GG9A 1LDBA 1RWBA 4ILKA 2D1YA 2B69A 1ISJA 1SEVA 4WGGA 4YPOA 1C1DB 4D3FA 2HO5A 1GL3A 2Q50A 1PJBA 4GL4A 4BGEA 4J7CA 1VPDA 1V8BA 4P38A 4O5OA 3K9QO 3DBRA 3FTNA 3EUWA 3PFWO 1HRDA 2CVZA 3TZ6A 2HJRA 5T6BA 3TPCA 4W82A 2AXQA 1HDYA 2Y0DA 1DIHA 2EJVA 4UAGA 4EEZA 1CDOA 1K6IA 3TSCA 4BHTA 3RJ9A 4ALNA 2X5KO 3NT4A 4RZIA 1GDHA 4BKUA 1ZVMA 2C5EA 2QX7A 4MOWA 3GC6A 4GLOA 5G0SA 3ZWPA 3RCBA 1SCUA 2DKNA 5G0TA 3D5TA 3INTA 3IP1A 4M89A 4ND1A 3JD3A 3JQDA 4M49A 3NUGA 3VVBA 4I9UA 5HS4A 1TA4A 3EZYA 3GGGA 1X1EA 4CM8A 3SJUA 4GWGA 3NT2A 2JHGA 2A92A 1QKIA 1ADBA 3L0DA 5ILGA 2ZCVA 2D5CA 3ZGYA 1LRJA 4FOSA 1GYRA 2H5LA 3JQAB 4WLNA 2VTEA 1DIBA 5H81A 3VZPA 4YB8A 2ZCUA 1HZZA 1H9AA 4Q9NA 3AUSA 1Q7BA 1E6WA 4MIEA 4CPDA 1K5HA 4YXFA 4HUJA 2AQIA 2ILTA 4U6SA 5FWNA 4YJFA 1PGQA 4ZQFA 3A1NA 3QWHA 1S6YA 3DQPA 4XYLA 1DC3A 3JQFC 1F0YA 3EW7A 4IMPA 3GEGA 3B6ZA 4G81A 2PLAA 5DP1A 4BVAA 4AJKA 1N7GA 3OHSX 5COQA 2X1HA 2BGKA 3OQ6A 3HUDA 4CMIA 4EEXA 3NJ8A 3AY3A 1VJ1A 2YJZA 1I5RA 1C0PA 4GI2A 3HDQA 3RJ5A 1QYXA 4GKBA 4R41A 2X8LA 3KYDB 4HFNA 2TMDA 4OXYA 1LU9A 5AOVA 3ON5A 3PWZA 4L9RA 4E2WA 2VOJA 1WLYA 1EVYA 5CDGA 4HP8A 1FJHA 3K92A 4RLSA 2YFHA 3KYBA 3VZRA 4BO2A 4BKOA 5DBGA 1HSZA 2E37A 3IIEA 4Y67A 3V2GA 3VPFA 2AA3A 4HNHA 1GY8A 4JQCA 2POQX 2GRAA 4CLOB 3DR3A 3GNQA 1KETA 4NG5A 4JIGA 4TVOA 3EDMA 3U4CA 3O03A 2B5VA 3JQ9A 4ZQBA 5F21A 3U0BA 1QYWA 3V1TC 4RPGA 1J4AA 2HK8A 5JC8A 3JQGB 4WCDA 1QORA 4KP7A 5DDIP 2C59A 2Q4EA 1E7MA 4XR4A 3WQQA 3L6OO 1HSOA 1KVSA 3O26A 1KY5A 2Y1EA 3VPGA 1DC6A 2ZB4A 2GERA 3HADA 4HFJA 4CV1A 4DQVA 2QZZA 5A9SA 1HKUA 5CG1A 1I2BA 2X0IA 2W2LD 4O0LA 3PYMA 1HF3A 4Q3DA 3EK2A 3WG9A 4PLVA 3PK0A 2PTGA 4JX8A 3NGXA 1K89A 4FFOA 3VH1A 1QRRA 4XGKA 1OFGA 2Y1FA 3NDJA 1XSEA 1TT5B 4R3NA 4L8VA 3EC7A 2AE1A 4FJ1A 2RCYA 2QHXA 1MUUA 3S1LA 1I0ZA 1MLDA 1LNQA 3NTRA 1YOVA 4OO3A 2JD1A 1HE4A 4IDCA 3R3JA 5DULA 3LK7A 3RC7A 4MP8A 4TKMA 3ZNQA 3ANLA 1B16A 1DJNA 1UR5A 1WWKA 3JQ7A 4B3HA 1YRLA 4FFMA 1QR6A 1IZ0A 1KS9A 4Z9FA 1E7WA 1IPEA 4J4BA 5T57A 4J7XA 1F8GA 1QYDA 2I67A 2WMDA 3NDRA 2FPIA 2Z1MA 4NMHA 1SNYA 2FR1A 5BSGA 2C07A 4PGFA 1BW9A 4GKVA 3VKVA 2VRBA 3AM5A 3I9LA 3WGGA 1YBVA 4LW8A 4WLVA 3D5QA 1HL3A 4DLBA 4GBJA 3UH1A 3PIIA 4KQWA 5DN9A 4C4OA 1BXKA 3UHAA 1ZCJA 4MVJA 3ONEA 1YVEI 4J3FA 6ADHA 4PFJA 1DFGA 1UP4A 1XU7A 5M6DA 3IJRA 2X4GA 1GPJA 3W8DA 4OYRA 1LLCA 4U5QA 2EWMA 3JQCA 2PGDA 5HA5A 3QP9A 2EG9A 1IHYA 1HE3A 2OORA 2PH3A 4NK5A 5IDYA 3FN4A 3QA9A 2Q1SA 3UF0A 1OOEA 2JL1A 4HX5A 2VWPA 3D4NA 5JBIA 4R9RA 1EDZA 5JMPA 1LQUA 4E2XA 5ICSA 3Q3CA 5F1OA 1NFQA 1UH5A 3O8QB 1GV1A 2GASA 4Q39A 5DZSA 4MP6A 3WJ7A 1N7HA 1QSGA 5BSFA 2EHDA 4KUGA 5JDCA 5LDGA 3LT4A 1BXGA 3GEMA 3GVHA 3JQ8A 5KVCA 4R54A 4N54A 2ZYAA 2VT2A 4XRRA 5G0VA 2CVOA 3Q0EA 1E7RA 4GMGA 4O59O 4OSOA 4A10A 3CIFA 2PV7A 4YAJA 1U3VA 1V9LA 4YAKA 2Y68A 4KMSA 2ZQYA 5TS3A 1PEDA 3KYCA 2D0IA 1B8UA 3DXFA 1MC4A 3BMQB 3VAZA 2RIRA 3A28A 5CAEA 1RM5A 3RUFA 1U8XX 4NZ9A 3LT1A 1IHXA 4R4JA 4NH4A 3H4VA 3DONA 3K2BA 1EE9A 4ND4A 4YWJA 1CIVA 3RWBA 2Q46A 2Y93A 3ZV5A 1T26A 3SLGA 5JO9A 1YONA 1X7DA 5G0UA 3EHEA 3GY0A 4BB6A 3GGPA 3ETDA 4R01A 2HAEA 5JDIA 3MTJA 4O63O 3GEDA 2AW5A 2Y05A 4ND5A 3CSDA 3GPDG 3K96A 5TJHA 4MKRA 4WECA 2HQ1A 2VWHA 3BMNB 1NBOA 3S55A 4B7XA 1Y8QB 1CETA 2UDPA 2OXIA 3K6JA 2BELA 4PG6A 5H82A 2RHCA 3WMWA 2BH9A 4GGOA 5JAQA 2OBNA 3E8XA 3GVPA 4RO0A 3GAZA 3SBOA 5BSEA 2TMGA 1LX6A 4TZTA 4TRJA 2BHLA 1GV0A 1KC3A 3A14A 3GOHA 4CL8A 2O3UA 1ENOA 4J90A 4GX1A 3Q2KA 1NP3A 4RPLA 1ARZA 3PI7A 3F5SA 3PQDA 4GLLA 4R5HA 1PJCA 1U5AA 5DOVA 4F6LA 1P44A 4CM1A 1DPGA 2XF8A 4LRTB 2W2KA 4FS3A 3TQHA 2QYSA 1KY4A 2NTVA 4IDGA 3LC7O 5L45A 1N2SA 1NPDA 3JV7A 4KUHA 3HN2A 3ST7A 3GHHA 4AJPA 1P0CA 2LDBA 3AM3A 4CMCA 2J5KA 4RF3A 3C85A 5L7YA 1JQBA 3K30A 3SVTA 4J49A 2LDXA 3ZWAA 1NWCA 3GZNA 3WGOA 3LU1A 4S1VA 3OIFA 4CMKA 4S3MA 1Q7GA 2NU7A 2VQ3A 1I8TA 3E5MA 3TOZA 4DGSA 4ALIA 3NTOA 4BNYA 5DNAA 4R51A 2Y0CA 5G4KB 5KWEA 4FB5A 3OA0A 5KTKA 4BNWA 3AUUA 4ZGWA 3NT5A 4YAEA 1F06A 4WCFC 1GADO 3KVOA 3Q6IA 3E82A 3P2YA 4CUJA 4RCVA 1P77A 4LCJA 4JJGA 4RVUA 5TF4A 3TL2A 4CQLB 2HLPA 5EESA 3L4BA 3LC2O 2GO1A 5ILOA 2J3KA 1W6UA 4A7PA 2Q49A 4NK4A 2GN6A 3PPIA 4E32A 3S2IA 5CDYA 3V8BA 4UUMA 2AG5A 3SEFA 2QZ9A 2VT3A 1EQ2A 1ONNA 1P1FA 1BHSA 2AEMA 4G2NA 5A9RA 2YHIB 3RU7A 5DBFA 4DXHA 3STHA 3DZGA 3TDKA 4OHUA 3I52A 4BV8A 4XRGA 4X54A 2VCYA 4BKPA 4BOYA 2X58A 2C5AA 1JN0A 4K9DA 1M6HA 1GPDG 2JKVA 4IDBA 4ZVVA 2O3TA 3ROKA 1SB9A 3KB6A 1R0SA 3IC5A 1DLJA 3EVTA 3NV9A 2FR8A 1PZEA 5BR7A 3E9QA 1B8PA 3ANNA 4BUCA 1O94A 1B26A 3KEQA 3OIDA 1YJ8A 2VZ0A 2FZWA 3KZVA 2GNAA 3ZU4A 2Y1OA 2O4CA 4CM5A 8LDHA 2PKRA 4JGBA 1R6DA 4BNKA 3GZ4A 5K6AA 2AEJA 1R0LA 4CM4B 4BO4A 1ZH8A 4DPMA 2R00A 3NRCA 3H9JA 3QRWA 1T2EA 5A5EA 2JAHA 2ZKLA 1H94A 2DQ4A 3L9WA 5DCYA 3DEYX 4BNXA 1A71A 3ANMA 5EJ2A 2WM3A 4WNIA 1BXZA 4U0KA 1XGKA 3H7AA 4RV9A 4Z0PA 3H6KA 4YA6A 3PJDA 1B3BA 2XPCA 1G1AA 1E3WA 4EW6A 2O2SA 3JYOA 3C1AA 4XYMA 8ADHA 4A73A 1YE3A 2J3HA 2NVUA 5TT0A 1H2BA 3A06A 3PXXA 1Y7TA 3WICA 2G17A 4JJIA 4QX6A 4Q3EA 2DUUA 2Q1TA 3O38A 3FR8A 5FEUA 1H93A 2UV8A 2DTXA 3JQBC 3HHPA 4LVUA 2I3AA 3RD5A 2WSBA 3T4XA 4CQMA 4BIIA 1U5CA 2HK7A 3DMTC 1G6KA 1HWYA 1YL7A 2P4QA 2QW8A 3ITKA 2JCXA 1ULUA 4AJJA 3RROA 4RF2A 5DF1A 4E0BA 2YDYA 2CDCA 4FGSA 4RGBA 1EFLA 4LGVA 3D4PA 5EN4A 2B0JA 1Y9AA 3OIGA 4YRDA 3FD8A 1PJ2A 1HDCA 3H65A 4QSMA 3C1TA 1HDGO 3PHGA 1IUKA 5BT9A 5G0WA 1EUCA 3QWFA 2O48X 2FPPA 1R4MA 4YJGB 4CQMD 4EGFA 3N58A 3AY7A 3DAFA 3MWDB 4ID9A 1RPNA 4N18A 4RF5A 4BMVA 9LDTA 1T25A 3JYQA 3D3WB 4BO7A 1IB6A 4YT4A 2VWGA 1DJQA 4Z0TA 1E6UA 2XXBA 2CF5A 2BFPA 1NFRA 3WTBA 2GYYA 4NFSA 1U2GA 4E5KA 1FF9A 4D3SA 4ZJUA 4BKQA 2NSDA 3E5RA 1JDJA 2VHVA 1VE9A 5TC4A 1XKQA 4WCFB 1EK5A 1UZNA 3EVNA 1WPQA 1NQOA 1IE3A 2GN4A 3P19A 5FYDA 3W4KA 1PQPA 4BGVA 3LT2A 2YV2A 3B20A 2P91A 1RYEA 4D43A 4FQ8A 4TROA 4QFCA 1C3VA 1JTVA 4RVSA 2OO5A 1XU9A 5A05A 2HCTA 3BMOB 5JS6A 4ZQHA 4IY1A 3UOGA 4BO6A 4N7RA 4ESOA 1GR0A 2OBYA 1PL6A 4XQCA 3I9OA 4DA9A 1UXIA 4RZHA 1HE2A 4WLUA 3VH3A 5BNFA 4BQRA 1AUPA 4BNGA 2CFCA 1M2WA 4IPTA 1H6BA 1IULA 4XX0A 5IZCA 4BO1A 1ENPA 4EBFA 3GPIA 4BGIA 1RJWA 3D4OA 4PG5A 3H5NA 2I9PA 7MDHA 2O3SA 3T7EA 3UW3A 4ZA2A 1DIRA 1BTOA 3WGYA 4YBZA 2X5JO 3PHIA 4INAA 2BD0A 4CR8A 1LJ8A 4NI5A 1E3LA 3GHYA 1GU7A 2FP4A 4BNIA 3ZNPA 4H7PA 2BMAA 2IYOA 2D8AA 1H6CA 3H3FA 3AU8A 3ZU5A 3BYZA 2DPGA 1DAPA 2Q1UA 2HSDA 2G5CA 2CNBA 4PVDA 1T24A 2PH5A 2CDBA 3WYEA 2EW2A 3IJPA 4NBWA 3Q9NA 4A0SA 4Z6KA 4EUHA 2FSSA 1MXHA 4UEJA 2ZB7A 2JCYA 4OOFA 5JE8A 5A9TA 2EJWA 3WYBA 1OMOA 5CHEA 4FDAA 1V35A 5I8ZA 3HFGA 3OM9A 4XDZA 4CLXA 3BXXA 1TI7A 1Z73A 3F47A 3EMKA 1UP6A 1GAEO 3B70A 1A4IA 3R6DA 2PZLA 1NHWA 5BNIA 3PGJA 5ITWA 1U3UA 3C24A 1GZ4A 1ZSYA 4EJMA 1GQYA 2E48A 4KDEA 2BI8A 1CQIA 2O4UX 4CODB 2Q1WA 2VUSA 3AW9A 4AFNA 4BNFA 4E13A 5JNLA 3ZW9A 2ET6A 4IQ0A 1IZ9A 1I32A 1Y5RA 2YZ7A 4O1MA 4CUKA 3EGOA 1FDTA 1LRLA 3RUCA 4PN3A 5KJEA 2D2IA 3JQ9C 1PGNA 4F45A 4ZRMA 4Q3NA 1E7SA 1P1JA 2X0JA 5T8KA 3JD2A 2EV9A 2PKQP 4XB1A 3IS3A 4NU5A 2ZB3A 4XA8A 3GNSA 3Q11A 1E5LA 3D64A 4MIYA 3TZCA 1RM0A 1XDWA 1X0XA 3F9IA 2C7GA 1PGJA 4R9SA 1E0DA 1AN9A 4AJEA 3PWKA 4D79A 4CJXA 4YT2A 3LQFA 4U0JA 4HV4A 4ALJA 1ISMA 1OC2A 2ZYGA 2P68A 1R4NA 2C2XA 4FIZA 2G1UA 4FC6A 4PRKA 5JYDA 2V6FA 1MC5A 4I1IA 5ITVA 1XELA 3FCOA 2VYVA 5FI5A 4J9VA 3PDUA 5GY7A 1MFZA 2YQ4A 1Y5MA 3HWRA 4DLLA 1M75A 2FMUA 4YRBA 1U4SA 3D7LA 1E1LA 2CD9A 5A03A 1RKXA 1QLHA 3CH6A 5I7EA 1HXHA 1H6AA 4TVBA 4B4VA 4QUKA 1E1NA 1SEPA 1HEUA 1MG5A 4FC7A 1A9ZA 1AE1A 1NNUA 1LUAA 2VUTA 4JCOA 2IEDA 3R1IA 3TNLA 3DWFA 2X0NA 3BHMA 5DP2A 1XA0A 1DEHA 1YBMA 3DBRB 4IJKA 5JLAA 2IEBA 3UVEA 4CMEA 1H5QA 3FTPA 1B2LA 3ENKA 2RH4A 4M1QA 5KVSA 1BWSA 4XGIA 3JYNA 2VYVD 3I5MA 3FPLA 3M2PA 2NU9A 3K2EA 3MJTA 3T7CA 3X2EA 5HM8A 2FPGA 2QRKA 2IDZA 4LVCA 4XEHA 1M67A 5I7SA 2IXBA 3BIOA 4RPJA 3ZWMA 3OJLA 2VHWA 4IZHA 4LN1A 2NQTA 3KV3O 4WOKA 2EW8A 3WYCA 4DMMA 3JYPA 3AI2A 3LT0A 1R12A 2GDZA 3WWYA 3UCFA 4I9NA 1JVSA 5F1PA 2PD3A 1NAHA 1ZK4A 4Y6RA 1E7QA 4WUVA 2IE0A 5F5LA 5JYAA 4CM8B 3DC2A 3G1UA 2FY8A 1J0XO 3GFGA 2PFGA 2W2LA 4WE3A 4ZQEA 3CZMA 2NNLD 4OXNA 3N74A 2CVQA 5K0ZA 3WBFA 3FNEA 3D3EA 4EDFA 1HDZA 1UZMA 1FDWA 3VVCA 1PWXA 4O6VA 2DFVA 1HZJA 3TZHA 2IXAA 3I9KA 4QFDA 1PZHA 4NBUA 2R2GA 5CDSA 3PQFA 4B4WA 3OETA 3B1KA 3ADOA 3WDSA 3C8MA 4FOOA 3ZU3A 1MV8A 3PHLA 3LF2A 4I5FA 1KERA 4DQUA 2E4AA 1ID1A 4E33A 3VKUA 3RFTA 1V3UA 2YDXA 1UXHA 3I83A 3DOJA 4YJFB 4YR9A 3WLEA 4PLFA 3K31A 2WYVA 5JDCC 1B0AA 2E49A 2EEZA 1W73A 2YY7A 4GAEA 3A4VA 4MVJH 1DO8A 4OKIA 3U4DA 2DM6A 3WFJA 5B4VA 3ASVA 2X9NA 2XXJA 5CEJA 5GZ6A 3OECA 1ISFA 4JJFA 3GVIA 2V65A 1O8CA 3K5PA 2PK3A 3MWEB 4JXKA 3CMCO 2B4TO 3TN7A 4NBRA 1NVMB 3WGQA 1ZSVA 1BRMA 2W4QA 4PLPA 2VWQA 4YTEA 4CMIB 4K6FA 1EFKA 1Z7EA 2HRZA 3NAQA 1LDGA 5KCZA 1E5QA 1PS8A 4TRRA 4E5PA 3GR6A 1C1XA 3WX0A 4R1NA 3MZ0A 1KEUA 3LF1A 2EKLA 2X9GA 4OAQA 5HS6A 3RBVA 1P31A 2Y0EA 4GVLA 4HXYA 4MVJF 1DLIA 1LLDA 3W1VA 1P1KA 4GH5A 2GN9A 3PLNA 4R1TA 3V2UA 1GUFA 4DIOA 2GSDA 4J16A 1B3RA 4BNZA 4DPLA 1ZMOA 1N1EA 1E1KA 3MJEA 1WW8A 3QVWA 4KWHA 3JTMA 3N7UA 3TFQA 3WGZA 2D4AA 4BS9A 1UP7A 4BB5A 4ZHSA 3ZWNA 4XYEA 4HNGA 4OL9A 3S2FA 2E82A 1ZXLA 1ZW1A 5JDIC 1U4OA 2D5AA 1VL8A 2H1SA 4KQXA 3RVDA 2UUPA 4R16A 5A9SB 1R37A 1ML3A 4E2YA 1XEAA 4K1LA 3JQEA 1YDEA 4NFHA 3HFSA 1LEHA 3C7DB 2NTNA 3VH4A 5KJ1A 3MJCA 3G1TA 1JW9B 4DIFA 1KBZA 4G5HA 1Y8RA 4W6ZA 1B14A 4AL4A 4UUOA 1Z6ZA 3PQEA 5U4QA 1FDVA 2EKQA 3DZFA 1U3WA 5TJ9A 4PVCA 5HWSA 5EQDA 4RDIA 2C54A 4XD2A 4XIYA 4DWVA 2VRCA 3GNTA 4B7CA 4LSMA 3G3EA 3QW2A 4FPXA 3B1JA 1KYQA 3BA1A 5U1PA 3I9JA 5I8WA 4AICA 2AHRA 3JQ7B 4AJNA 2OMEA 4PLWA 4MJLA 3KSUA 2V6BA 3DBVO 4H16A 2C2YA 4ITUA 4LMRA 3K73O 3SXPA 4B4OA 4E2ZA 3JCZA 4WOJA 4HADA 4BMSA 1BMDA 3GA0A 4LMPA 2BRUA 1YKFA 2VRCD 1SZJG 5A04A 4IJWA 2CZCA 4MVJE 1TLTA 4E5MA 4BO0A 1NWHA 4EITA 2Y1GA 2FOIA 4J4HA 3WS7A 3E6AA 1L1FA 2BLLA 2F00A 4XIJA 1PR3A 4CMBA 4E5YA 1LC0A 1XYGA 1TVEA 1IL0A 1O0SA 5LCXA 4RVFA 3L4BC 3DDNA 1DRVA 1SC6A 3I3OA 5AXCA 1LI4A 4MPDA 2WD7A 5ENVA 5IN4A 4PG8A 3ORFA 2PA3A 3FNFA 5FF9A 2RBEA 4ND2A 1Q0QA 4C7KA 3ZWWA 1LSUA 3DFUA 5J23A 1GCUA 4DBZA 1M76A 1SMKA 3H5AA 3H9QA 5AXDA 2OOSA 4A26A 1ORRA 2FRDA 4OGWA 3RFXA 3TJRA 1GEGA 5ICMA 1ISIA 1YJQA 3EAGA 2NWQA 4QT0A 4DC0A 1ZXBA 3QVSA 2XOXA 2A35A 1NR1A 3RC2A 3COSA 4RVGA 1I2CA 2DBZA 1XG5A 3AY6A 2I99A 3MOGA 3PTZA 2DC1A 1JLLA 1BXGB 5KJFA 2G82A 3JQ8B 1I24A 3VPXA 4TMFA 1D8AA 4J91A 3WSWA 3FHLA 4NHEA 1PS9A 1E3JA 1YQDA 3I6IA 1UXKA 3SC6A 2WE8A 1ISGA 3ZWXA 4CM9A 1KVUA 3I9MA 3ZN2A 3AI3A 4NBTA 3WXBA 4FJ2A 3AI1A 2PWZA 4CLEA 4UVHA 3BMCA 2AG8A 2HJSA 3UUWA 3MJVA 2BKAA 3KYCB 4BNVA 1D4FA 3DTTA 5K6AC 1IOLA 3QVXA 2BFAA 5JAMA 4JP2A 4QO8A 4RPHA 2R00C 4YJHA 4PG7A 1YB5A 1I3NA 2JJYA 1UJMA 2C82A 4HY3A 1NPYA 1NASA 5AXAA 4MINA 5CPFA 4Z3DA 4ONEA 4CM9D 1LDNA 1J49A 4CLRA 3DBHA 2X23A 2O2YA 3GF4A 1BDMA 2C7VA 3MEQA 5A1TA 1D1SA 2AQKA 4A5OA 1IPFA 4IXTA 2O50A 1N8KA 2J3IA 3KSZO 3GGOA 4UVDA 3ZW8A 3OJEA 4W99A 2EP5A 3C7CB 2PD6A 1SB8A 2IZZA 4L4SA 4WASA 5L7WA 3AOEA 3AUAA 3DBLA 4CV2A 4IDFA 5L3ZA 3ZU2A 1G0OA 1HDOA 1O5IA 1P0FA 1VKOA 1F8FA 5B37A 3UKOA 3V1UA 4RF4A 2CDAA 3MOIA 3DAGA 3MJ4A 2OP1A 1OI7A 4IXWA 2Z1NA 4DLAA 5I9MA 1I01A 4QXMA 5JO0A 3I6QA 3RUDA 2NU8A 2GLXA 1DFIA 1N9GA 2ZATA 2QRJA 3DTYA 3IOYA 1GD1O 4E12A 1ISHA 2B83A 2YYYA 1T4DA 3ZHXA 2QQ5A 4JROA 3KLPX 4HWKA 2AE2A 1GYQA 5JY6A 1X0VA 4QEDA 1JA9A 1CRWG 4M8SA 3GQVA 3JD4A 1T2DA 2W2KB 1AXGA 2IODA 3ETGA 1PJTA 3L07A 4GSKA 3ZWOA 5JPIA 1U1IA 4RQUA 3HB5X 2DBQA 1ZO8A 1NVGA 1H2HA 1ADCA 4P22A 5KKAA 4YYZA 1A7AA 3PZRA 3RQSA 1E6EA 3E9MA 3GZNB 2WTBA 4H3VA 4BQPA 7ADHA 4D0RA 4E21A 4CMGA 5TQVA 4DMLA 3H2ZA 3DZIA 2BFMA 3GK3A 4Z9YA 2JAPA 2EP7A 1P33A 2WWRA 5COAA 3WNVA 1I10A 3AM4A 1FXSA 5I7VA 4PLCA 5EQFA 3VDRA 1HETA 1LTHR 2UYYA 4R5MA 3DZHA 2PD4A 4M87A 4RPKA 1NM5A 4XKJA 1XWFA 1P1RA 3LZ6A 4GWKA 1VRWA 3KSDO 1TT7A 4HKTA 4KWIA 4D0SA 4GPD1 2IZ1A 1LSJA 2BGMA 2HMSA 3ZWYA 5H83A 3HDYA 4DQXA 3FI9A 3HSKA 1MGOA 4DRYA 3SJ7A 3MTGA 2CUKA 2HDHA 2X22A 3LLVA 3KM0A 5AXBA 1HDXA 4OQYA 2EERA 4YAIA 1L7DA 1VI2A 2NU6A 2PGJA 2ZTVA 3JQ6A 3WSVA 3PZBA 1Q1NA 3DAPA 1A72A 3GFBA 1C0KA 4N5LA 5TX7A 1D1TA 4W9NA 5IZCC 3WR5A 1ZK3A 2Q2WA 1VSVA 4RLHA 1UZLA 1ZNQO 2WEKA 5B4UA 5JSFA 1IYZA 1LSSA 4PLHA 1ZJYA 1X1TA 4PLYA 1EMDA 4IDDA 1MXFA 4YVFA 4QTZA 5L51A 3E03A 4EUFA 1QXSA 2PY6A 4BNHA 1V3TA 5FI3A 1Q2XA 4C7JA 2ZYDA 3R3SA 4WLFA 3CE6A 4F46A 3D0OA 2GZ1A 4NR0A 3INGA 4B7UA 4IS2A 2PGLA 4XZ3A 3AFNA 4NJMB 3ZHZA 1PU2A 2RHRA 1XHLA 3EYWA 1YXMA 1BVUA 5A06A 4ZU3A 3AFMA 3OA2A 4RVDA 1OC4A 1U7TA 4CMHA 2X5OA 1NQAO 4XB2A 4WEQA 2VNSA 1T1RA 2DT5A 1PQWA 1PS0A 1K6XA 3F4BA 5LC1A 3HZZA 1SAYA 4CR7A 3RC1A 2W98A 2NADA 4WLEA 2NV6A 2SCUA 3IKTA 4I08A 2OFPA 1ZMTA 4II2A 3SC4A 1KIFA 2BFOA 4YT8A 2FWMX 5BQFA 5TGDA 1QMGA 3VC7A 1BG6A 1E3WB 1X15A 4FN4A 5I9LA 2P9GA 4P4NA 1LA2A 4DREA 2X9VA 4NJOA 2ZB8A 3PHJA 1Z7BA 2NVUB 3WQSB 1PJLA 3PIDA 1LC3A 4P4GA 4TQGA 5A4DA 1PX0A 4OXKA 4XQGA 3UFXA 1PJ4A 4AJHA 5L95A 3SLKA 4KTTE 1Z82A 3RKRA 1A27A 5T8KC 3OP4A 1I36A 2AQHA 2YV3A 3PWSA 4KZPA 4CQMB 5L4SA 4GMFA 2GPTA 4K28A 3IKVA 3W8FA 1UXGA 4GQAA 4IQ8A 3ROPA 1GYPA 5L40A 2O3JA 1MP0A 4MKZA 1T2CA 3LYLA 4E3ZA 2WD8A 1JKFA 3QIVA 2X0RA 3U4IA 4FD3A 1I30A 3FBTA 3GMSA 3NGLA 1U2DA 3ONFA 1ULSA 3TWOA 3VTZA 4ALKA 4E31A 3H9UA 3DHEA 1FMCA 3ICCA 4QQRA 5DCWA 1EQUA 3OBBA 1UDBA 5JYFA 5KNLA 4I8XA 1R4MB 4TKLA 3PFFA 4KOAA 1C1DA 1LDEA 3E9NA 3ZV3A 3EY4A 4WEOA 1NX6A 4RDHA 4B3JA 2EGHA 3F3SA 3TL3A 1JAYA 4PIVA 2I66A 3GH3A 4RL6A 1CYDA 3BZUA 5BNTA 1EUZA 3CMMA 2O3RA 2QYTA 4OM8A 4DL9A 3ITDA 4TWRA 1GFSA 2NLOA 4CMEC 5IDXA 4JBHA 3IP3A 5I9NA 3AWDA 4IS3A 1EVJA 5JC1A 5KVVA 2Y99A 5TT1A 1ZIDA 2YUTA 4L4XA 4A2CA 3U4HA 3FNHA 5EERA 5B1YA 3VDQA 1UDCA 3RUAA 3ZDFA 3JD1A 4WLOA 4OIMA 3RBXA 1T2AA 4GVXA 4UVGA 4PLZA 4IDAA 3WGHA 3Q9UA 1YWGO 4A03A 1PL7A 1M6WA 4R69A 2PZMA 3D1LA 4DYDA 4Y6PA 4QECA 2I5PO 3CUKA 1ENZA 3GDOA 3ZH2A 1DIAA 3GDGA 1WP4A 3FSRA 3P7MA 3DMYA 2GD1O 1YQGA 3KBOA 4IM7A 3RKUA 1LDMA 5G4LA 1JVBA 5C37A 2X86A 4DTIA 4XDYA 5ER6A 3NX4A 3JQAA 3OFSA 4I5DA 1NHGA 5CEEA 2B4RO 3OJFA 3OJOA 4NBVA 5HTOA 1GUYA 4IGFA 5DOZA 4N5MA 1NR7A 2BGLA 3DZJA 4GX5A 2VOEA 2DU8A 1K6JA 3HDHA 3ONDA 5JXWA 2VHXA 1NAIA 2DAPA 4Y8VA 3BTUA 4L76A 3RUIA 1B8VA 1Y9EA 2NM0A 1EZ4A 3LVFO 4FBGA 2GN8A 2O7SA 3ZV6A 1XIVA 3K8ZA 3JQAD 5A3VA 1O89A 3HN7A 5A5FA 4WPGA 2IRWA 1DDOA 3O9ZA 2NQ8A 4W4TA 1LRKA 3FPCA 1ENYA 4YQYA 4IJUA 3P5SA 4XJSA 3H9EO 2R6JA 5F3RA 4PZEA 5EL0A 3FRJA 1X7HA 5IDQA 4TSKA 2B5WA 2OUIA 4EUEA 3TOXA 1KVRA 4W7IA 5BSHA 5JAIA 3ASUA 4IZIA 3KYDA 1P9LA 1X14A 2ZJ1A 4UEKA 4MVJG 2WJPA 3L6DA 5C7OO 2HMUA 5C7LO 3P2OA 4OH1A 1ONPA 1F14A 1PQUA 4OSPA 2PR2A 4WK6A 1I2ZA 5TNXA 3O4RA 3QHAA 3ULKA 2UAGA 1EBFA 4I5GA 1KC1A 5ENDA 4H15A 9LDBA 4DC1A 4CLOA 1J6UA 4LSWA 3CKYA 4MP3A 3WTCA 1GCOA 2AEFA 5T64A 1NYTA 3WLFA 3IL2A 1G0NA 5JW6A 1X13A 1PZGA 1O95A 4L0QA 2WYWA 3OSUA 1D7OA 3ZHYA 3JQGA 1N5DA 4GX2A 4J43A 5IAAA 3KOUA 5A3JA 3AU9A 3TFOA 3G0OA 3S2GA 3FR7A 4BKRA 3PLRA 2ZTMA 3NJ4A 3NKLA 1YBAA 4D42A 2JFFA 4IBOA 5K9ZA 4JNKA 1GQQA 2W90A 5AYVA 5TIIA 3H2SA 3U3XA 3X2FA 1HLDA 4P8RA 3F4LA 2PZKA 3QVTA 5JCJA 1V6AA 1NXQA 2P2SA 1DHTA 1ZK2A 2DBRA 1HYGA 3KUXA 3M1AA 4XCVA 4K6CA 1TT5A 5T67A 2GCGA 3L9XA 1KEPA 2FN7A 1R4NB 4D44A 1PL8A 1DRUA 2QIOA 3CTMA 1YB1A 5AVOA 1E77A 2AQ8A 2V6MA 3RUHA 2B36A 1QLJA 5G2OA 3RSHA 1ZK1A 1BDBA 5CDUA 2W8ZA 2HMTA 4XWYA 2WYUA 4Z9XA 4YACA 2E6UX 4LK3A 1JU9A 4YCAA 1C0IA 2DBVO 3G17A 1ZSNA 5JCJD 3AJRA 5KVQA 1QYCA 3IUPA 3H3JA 3RI3A 3C1OA 1HYEA 3E18A 1PZFA 4IJVA 3IMFA 4EZBA 5T73A 5F1KA 2GGSA 2H63A 2B35A 4FCCA 3NYWA 2ZK7A 1CEQA 1R0KA 5EMHA 2VN8A 4R1SA 1XQ6A 4XJTA 1XLTA 3QSGA 1QV6A 4P4LA 2RAFA 2OGUA 3ADPA 2G0TA 4D46A 1GUZA 4ZN6A 2ZJ0A 4HBGA 1WMBA 4HFMA 1DXYA 2H6EA 3PJFA 3AK4A 4YQZA 4CM7A 3U62A 3W6ZA 3F5QA 1BSVA 1DRWA 1T1SA 1E3EA 2ZIZA 1PGOA 5C3MA 1GZ6A 5J9GA 3QJ5A 3UICA 4EJ0A 2ZQZA 3ZI0A 4J6FA 4NU6A 2NVWA 4XR9A 1PJSA 1ZKMA 4MDHA 1TEHA 1UAYA 3UCXA 2JD2A 3I23A 1LBEA 3PDJA 4J9UE 2Q2VA 1K0UA 1Z45A 1WXDA 4K26A 5AQ1A 4W7HA 3LC1O 4WNCA 1PJQA 2DUWA 3DL2A 3LLSA 1N92A 3C7AA 4L73A 4M86A 1VJ0A 4ROSA 2D59A 2Q4BA 1I3KA 3RIHA 2JFHA 3CINA 3DZKA 1ADFA 5JCXA 1DC4A 3DOCA 1E3SA 1YO6A 1Z74A 3BTOA 3O8QA 5B12A 5THQA 4YRAA 1U7HA 1OAAA 3QVOA 3GMDA 1N1GA 3QWBA 3PP8A 1U28A 4JK3A 4U6QA 1Q0HA 4Y6SA 4AVYA 3KXDA 3ROQA 3F1KA 3KTDA 3ZWVA 3JQFA 1P45A 2I65A 1JWBB 2OZPA 4M54A 5IFLA 4TRMA 4CL3A 3WB9A 3DFZA 4DYVA 4E30A 1XQ1A 2GZ2A 3ICPA 1W4ZA 1KVTA 1Y1PA 1XCBA 2OHXA 2VYNA 2A9FA 3DZBA 4D3DA 3U09A 5C7IO 2HUNA 1L7EA 1O9BA 4JLWA 1YGYA 2C29D 3I1JA 4J0EA 4ZD6A 3W8EA 4MKXA 4NFYA 3DHYA 4CR6A 4DVJA 3BMQA 3FBGA 3JSAA 3TF5A 1MX3A 1WNTA 3QQPA 5GZ1A 4RORA 1EDOA 1F17A 2Y1DA 5L4NA 2DTDA 1YOVB 2GF2A 3PYXA 4J4TA 5IXYA 3FF4A 3S2EA 3JD0A 2G76A 4FR5A 4YT5A 3BAZA 5C5IA 3LDHA 1C1XB 2NTJA 2VYND 3NEPX 5DBIA 4MO2A 4XGNA 1GZ3A 2Y1CA 3WJAA 3G79A 1ZK0A 4R68A 1HTBA 2P5YA 3W6UA 1P3DA 4IINA 4PLTA 1CQJA 4B79A 3V2HA 5TLSA 1V3VA 4CLDA 3FWNA 2AMFA 3BTSA 4UUNA 4IMRA 4MVJD 2YHUA 4A27A 5ER9A 1MFPA 3PGXA 3ROMA 3U49A 4F3YA 3JYLA 2UUOA 1A4UA 1BW9B 1DB3A 1ZFNA 1NQ5A 1NQTA 2JD0A 3RC9A 3AOEC 1LLUA 1U8FO 2HMVA 1ZZEA 3BMNA 3ETEA 3MJSA 1Y8QA 3KHUA 3DOOA 2VHYA 1GTMA 3FNGA 4KTVE 4NNJA 5DCUA 4CLHA 1K2WA 3H8VA 1VL0A 2P4HX 4BO3A 3AOGA 2OP0A 2QG4A 3GN1A 5GZ3A 1ADGA 1X7GA 1PWZA 1I33A 1ZEMA 2DLDA 4PLGA 3OEYA 3WOHA 1KOLA 2DFDA 1Y8RB 2C0CA
chains in the Genus database with same CATH superfamily
1H6DA 1OX4B 1EK1A 2APJA 2AJLI 3EBOA 3RT7A 2NZXA 3SQWA 4TUYA 3B52X 3VXKA 1ZCBA 1KK0A 4GSLA 1ATIA 2WLTA 2QTFA 5D6OA 1HTTA 5D6NA 5DB4A 3A1CA 2AOTB 4J0GA 1Z33A 4J7UA 3V1YA 3FCXA 3AFIA 4ALMA 4E4YA 4MVJI 1RAHA 3BGSA 1QCZA 4NQZA 3PYLA 3N59A 2IYNA 4JSYA 1Q77A 1WPRA 5KOHA 1YCFA 3QELA 1XC7A 1W48A 3QF4B 3DOFA 1SBYA 1VTKA 4B35A 4BDTA 4R3WA 2VLIA 3A2LA 3G7SA 2H7XA 1SO8A 1E0AA 3NDIA 4PZLA 1Y82A 2PR7A 2QB5A 4PY2A 1P1HA 5B4TA 5IFKA 2D1TA 2VJOA 1VC2A 4IIUA 3IKJA 1HFKA 1D0IA 1DAIA 2ZJ2A 4JMLA 3GUVA 4A36A 1C9EA 3DNFA 1AXEA 1IHUA 3DB2A 3QVUA 4JZYA 4OF4A 5EGSA 4DMUB 5IWCA 1N5IA 1KDPA 4V0NA 1JKIA 1I72B 1JGTA 5HIIA 5B1SA 4IVQA 3GUZA 2AWNA 5KYVA 3AHIA 1TM5E 3PFIA 5DK4A 1ECLA 1JRLA 1YQTA 3LCVB 2GLUA 3CV3A 3NEJA 5KQRA 5CXSA 1QNLA 2BF7A 3MS2A 3S70A 2P9EA 2C8JA 2Q5OA 1RI1A 4J0IA 4JBIA 5EP2A 3ZZNA 4KQHA 1DAOA 4CCSA 5DHAA 1S2MA 3G5AA 3M5WA 4F72A 1NM5C 5KNCD 2VNAA 3DF9A 4Q3BA 1LGYA 1PN3A 2CFTA 2Q8PA 2VLBA 3BWEA 2W2NA 2GEVA 2QN8A 3W05A 4QHSA 1RJFA 3U17A 2WD7B 3B48A 3ZNNA 4ZO6A 1T1IA 2OG2A 4B6JA 4B8ZA 2YHIA 2ZRNA 2F1JA 3CNNA 2OLEA 4FWIB 3REOA 5IF3A 1MO6A 1SOWA 1C7QA 3V8PA 4HEA6 2AJTA 2RG7A 4GPIB 3RFVA 3VI4B 1NW7A 3LW7A 4QQFA 1FP6A 1XCLA 2BE9A 1E3IA 2HWUA 2FZEA 5JY1A 2AC2A 2IE8A 1Q0LA 1TXGA 1KPGA 2EJBA 3AHFA 3H7IA 1PJZA 3JVDA 4BIMA 1BE6A 2AKEA 3VOAA 2YHSA 3BGWA 3QWIA 3G9UA 3LX6A 1OTYA 1CWUA 1VMKA 1ZP6A 3ANTA 3FROA 4HGYA 4I1UA 1IUOA 1G17A 1YNOA 1TB4A 2IV7A 3VC2A 3CLRD 5KO2A 4ZQGA 3GUCA 2WYIA 3FCAA 4MRPA 1G38A 2KS6A 2RH8A 2XDAA 2V6GA 1ZM2A 2B7LA 2H7CA 4Q9IA 3W8NA 1TADA 2NUPA 3LDGA 4CKWB 2ESRA 3Q3EA 1AHIA 2Q3JA 1B1CA 2V8BA 3ND8A 4FFWA 4RHYA 2FLVA 3KD2A 1H9CA 1VLLA 2YW9A 4ZI3A 3N0TA 5JH7F 1HDRA 1N3BA 5AKJA 1H66A 1DELA 1RRVA 3CXRA 4QFBA 2VK2A 3B5JA 1QRSA 3P9IA 1DCFA 1LNZA 1USWA 1J0AA 1TQ8A 3AJ9A 3GPCA 2PDAA 4B8WA 2JH9A 2XKBA 3H04A 4L74A 1KMHB 4Y9TA 5FQNA 3ZHSA 3D54D 1RYDA 2HPAA 3WAJA 2RK6A 4R2LA 4QDOA 5CDHA 1CJUC 1DC5A 4HNSA 4BNLA 3F6YA 3NNSA 4COKA 3BF8A 3TH5A 1WETA 3DE4X 4YJHB 6LDHA 2ID7A 3EWSA 2YL2A 5EI5A 1Y48E 4LKRA 3H5IA 5KJCA 1TCVA 2D3TA 5DT9A 5KYYB 5A02A 3FPBA 2B8EA 3KHKA 3PT5A 2ZJAA 1N4AA 3EDOA 2UUBB 1SPXA 3A9WA 3DW1X 3VR5H 2EX1A 2PKWA 4JXZA 2A9KA 2HMWA 5HQJA 1LV7A 1J99A 4A8JC 5TMPA 1DIGA 1XUOA 2EWVA 3K53A 3L0ZA 1GEEA 2XY4A 2NZ2A 4I6GA 5HIKA 3KO8A 2J9FB 5AVZA 4ZVOA 1R6TA 3RU9A 1F38A 1N3IA 1FW6A 4OK6A 3T3HA 3R24A 2BGTA 4JGIA 5DTEA 3AVVA 4IIGA 4DA7A 2FR0A 2WWIA 3EFBA 1JDUA 5IDWA 1LI7A 3PJGA 5EEHA 1SBTA 1QH8B 5U9CA 4DLTA 4LF5B 3SF0A 1E3QA 5CA0A 3MIZA 3MWGA 3T9EA 1HYHA 5CGQB 1SVLA 3WFIA 4P86A 5B3AA 4N8DA 3WLTA 1N0HA 1U1CA 1ZM4A 2D0OB 2V7WA 4KH1A 3GAFA 1K5GA 2HA6A 4OQNA 1YS4A 3KEOA 2X19A 4B82A 3RIYA 2MSLA 4ZRNA 4J03A 1UQRA 1YC2A 3EODA 1AKWA 4Q3CA 2ZT6A 4BNTA 2PUTA 2XCRB 2Q2QA 5FUMA 3PBKA 2W6IA 1JHUA 1O8BA 4Q4AA 3WAKA 3O6VA 3BQMB 4O4JF 2MOKA 4ZP1A 3WC4A 3PEEA 3BIFA 3F74A 3T9FA 3L7YA 2YTZA 3GI1A 3NORA 1G21B 4O25A 3WRYA 2HLDD 5AM5A 4KDFA 3OUZA 4KIFA 2V7QD 1KOGA 2HY7A 1UFRA 3H9GA 3GVXA 2VRWA 1S9HA 4AXBA 1OZAA 2JHFA 1W8DA 3AUTA 4RA9A 3UUEA 3WQRA 5CT6A 1F7VA 5TR9A 1KYVA 2WQ7A 2QRUA 4Z5XA 3ZD7A 2O8FA 3HA2A 1WZEA 1M8GA 5DNEA 2QUHA 1V5EA 4CT5A 4R8LA 1I4EB 4LQ4A 1JDBB 2KPOA 1Z4MA 2NUBA 1SHKA 4E51A 3K0CC 2ZUTA 2WFZA 5JH7B 3GAMA 2ZRQA 2ZXFA 1YR2A 4LTMA 3EAQA 4B47A 4CKBB 5ED4A 3PXCX 4MB0A 1SOVA 1U9CA 5E1BA 1V3QE 3L05A 4RK7A 3PVZA 3FWZA 4R1UA 2CY0A 1JDZA 3VVLA 5DHSA 2A0UA 3FVVA 3M1LA 3RYHA 4DILA 1ZVVA 1P1IA 2A7XA 4IUYA 4WCFA 2O59A 2WE7A 4JHLA 3V42A 4JVSB 4BNUA 1M1YA 5DFAA 5J3JA 1T2FA 5DU2A 1NT4A 2MSNA 4KFRA 3UXHA 2BI7A 1SQ0A 4KR9A 4LC0A 2J8ZA 2WOJA 1E63A 2E4WA 4U7WA 5DEIA 1ZEJA 1RMQA 2OKGA 1U9JA 1XJ0A 1BS1A 1DSSG 2YS7A 5LB2A 5KOYA 1SBZA 1IQUA 4MCIA 3K70B 1JKXA 3E4DA 5DCLA 5ALUA 1A2BA 3VH2A 1BXRA 3BBPA 3ENQA 3BL8A 2OFFA 2DFKB 3TAHA 3A9UA 4X7RA 1YI1A 4BO9A 1R18A 3VZCA 4EYEA 1YDWA 5HKKA 3QUTA 2FMXA 6NULA 3IB3A 1HBJA 1I80A 2TMYA 1JMVA 1QRDA 4MS1B 3BORA 3TW8B 1US8B 3TZQA 3R3HA 3UCEA 3GRPA 4PNEA 4OXIA 2OHGA 1U2ZA 1PVDA 2CSUA 3I8OA 1JMYA 4MVJP 3Q88A 3TBHA 4I3GA 3ZBPA 5L53A 1ZJZA 5SZHB 2VF7A 1SUIA 3B1FA 3TI7A 1XXHB 3R6GA 3OKFA 3FOZA 3BULA 4FDUA 1RD4A 3CLSD 1XF1A 5FUQA 2NU6B 2V0GA 2HK9A 2UXBB 4IDEA 3P4UA 1U0NA 2YN4A 3M6IA 5EHGA 2HZBA 1MF7A 2C9DA 3F4KA 4RL4A 1H8HD 1LI5A 3IQDB 1VZ3A 1V6SA 5JYEA 1Y5IA 3WWPA 5AIBA 1VJTA 2BFFA 3QVLA 4BBZA 1ZJ4A 2P6PA 5T7BA 2IYPA 2IUSA 3TXYA 5C7YA 2EQBA 4Q05A 3WL5A 4LNUA 1JIVA 3O1LA 4OHMA 4LISA 4XYGA 3T5MA 4OGKA 1A5SB 4NCJA 5C31A 2ABWA 3ENWA 5JHGB 5BWCA 2Q99A 3AJ8A 1RQLA 4BMNA 4Z2AA 1Z0JA 2II6A 1WMAA 5EPOA 2B1GA 3HFJA 2DCMA 1PK9A 4TMTA 5MFPA 1Z25A 2QVZX 1UAGA 5FPYA 4KXFB 2VR1A 3D7RA 2GJSA 3DV2A 4HFRA 4UNSA 3W3AA 5E2IA 2I71A 1JFRA 2WP8J 1H9BA 3RUEA 3TCXB 2NN3C 3TD9A 4M0UA 2CN1A 5HRUA 1NG1A 1BGVA 2NVBA 4KJZA 1KYWA 3T4PA 4WNYA 3P0RA 3CPHA 2BSXA 3DQQA 4FLFA 3IQIX 4W6QA 3OQIB 3X43A 5HKAA 2EIHA 1Y80A 3K1YA 3R9XA 3VNVA 1PR5A 2AUMA 3ZK8A 4D4MA 1EGVB 1P60A 3ZS8A 5KQPA 3ZG6A 3A7DA 3AVXA 1D0SA 2PZGA 3TEFA 1CF2O 4F4DA 1XLUA 2FE1A 4ZAYA 2WICA 1Y8ZA 4LF9B 1SXHA 5LBTA 2QK4A 1EIZA 4NNOA 2F1KA 1F51E 2ZR7A 1F2VA 5JAZA 3BTVA 1FDUA 2G1JA 4U8GA 3ICEA 4U2BA 3OESA 1QX4A 1JEQA 4PR0A 4QDXA 3DE0X 2WAAA 3TZKA 3SHTA 3LUCA 4LDPA 3TW6A 2OL4A 1S01A 4UE6A 4YY3B 3OH8A 3EIUA 4G25A 3HEBA 4HD8A 4B3CA 5K5EA 3HNPA 1O95C 4N7MA 4NMWA 2YXNA 2I55A 3EZ7A 3TQOA 4ENVA 2FUEA 4WOPA 5CLQA 2FX3A 2E0IA 3LPLA 2J33A 2BTQB 3F5FA 1DOHA 3GU3A 2HT6A 2N3ZA 5IVHA 1EUYA 1LDYA 3QBDA 4YRQA 1OFIA 4JN6B 1XD2B 2TECE 3HP1A 4RACA 2QTAA 2R6FA 1AHHA 1PW5A 3W34A 4EZIA 4ZCTA 4ZGBA 3O7WA 4KR7A 3GLQA 4QHYA 1G2PA 5F52A 2C2KA 3ZWBA 5JHHB 1W0CA 4C89A 5GVSA 3F46A 3AFOA 1N5LA 1HORA 2RGCA 2AF4C 3AG5A 2X8JA 3NWJA 3WIEA 2ZM6B 1QAQA 3HS3A 4BFSA 4FGWA 1HT0A 1RYZA 2HRBA 2PL5A 4HNQA 4FMPA 4KL8S 3HJBA 4ML3A 1L3BA 1SULA 1YQUA 3MLBA 1HT3A 1FNSA 2W8BA 2J45A 3HBMA 1LDBA 4AQDA 5ALZA 1HE1C 1PLKA 2VPXA 3MGBA 3SVLA 3TRDA 1W2GA 4ILKA 3MUFA 2PAFA 4JASB 4JLDA 4OB7A 4WGGA 3VO1A 2AYXA 2J85A 4P81A 4AJ9A 4YPOA 2I62A 1PE0A 1IPHA 2OQVA 1PJBA 4BGEA 3BMXA 1SU6A 3JQQA 2R9VA 2EKBA 4KYTA 4HXFB 3THYA 1RADA 3FPHA 3LUJA 1A96A 4ATNA 3AUYA 1Y9DA 3J7TA 1KAQA 1ZHHA 3KL4A 2HJRA 4EB0A 3V55A 2B6NA 2QQ0A 5LQCA 2Y0DA 4C6TA 4XDHA 3WK7A 1W5EA 3PUKA 3GLIA 4LMAA 1KHHA 4HH1A 3JAWA 1CDOA 3LVBA 5F2EA 3K6SB 1K6IA 2QPTA 3TSCA 2VNKA 3RJ9A 2X5KO 4F1KA 2QX4A 4JC8A 4AKTA 2C92A 1G9TA 3IV6A 3PDHA 4RV5A 5E8RA 3V46A 4F8EA 1EQAA 3G02A 4GLOA 5J5VA 3RCBA 5G0TA 3IP1A 3A3KA 1NI4A 1QIKA 4YJ2B 2PS0A 3FRIA 4M49A 3VVBA 1DOZA 4I9UA 2PUCA 2MDTA 1WXQA 3EZFA 2GAFA 1TA4A 3EZYA 2BUAA 2G0AA 2JGRA 3PQ6A 2UYHA 1Y1TA 2UZAA 2IYYA 4EHBA 5JAPA 1OU0A 1F2TA 4MRVA 5ALHA 2EFGA 4C4YA 3B89A 4C0XA 3QMWA 1P5JA 3PIRA 4J75A 1Q17A 3S81A 4KE7A 1NNSA 3TW3A 1W1WA 3ZCVA 1CR1A 4D3XA 2A0FA 2D5CA 1K7YA 1GYRA 1QDUA 1TEVA 2DWPA 3JQAB 3AF2A 2BBOA 4I36A 5DYNA 4WBXC 5FKJA 4O2AB 4YRZA 2FXVA 2H1CA 4P3XA 2V1XA 2GXAA 1GGMA 1W44A 5H3HA 1Z39A 1YRQA 2R84A 4G1EB 4P7GA 3V8EA 1DDIA 3DHVA 1EAMA 1Q7BA 2OC9A 4F4UA 4UBKA 3B8EA 4CPDA 1U7DA 3MINB 4KREA 5KC9A 3BN3A 2ILTA 1TIPA 4Y1EA 4U6SA 2Y9PB 4DNPA 3LKDA 1PGQA 3SG0A 3MMNA 4DIUA 3IOBA 2OSBA 1S6YA 1X1DA 3HACA 2ZBPA 4XYLA 2QY6A 3HBJA 5B6PA 1OWPA 1C1HA 1F0YA 1AUQA 3NVMB 1C9NA 2JIRA 2B7BA 3B6ZA 1ZD4A 4I81A 4PW0A 3UG6A 2E9SA 1EU1A 4BVAA 2J3LA 1L5HA 3A6FA 1QAMA 1ZM7A 2Y27A 3TM4A 2RHGB 1GAQA 1YD7A 3K6KA 4ZI7F 5K0TA 1Q91A 4LZPA 1C7EA 2ZFUA 1IHOA 4E22A 3OHSX 1MH9A 2AZMA 2X1HA 1YASA 3OUUA 3ACCA 3PFCA 2ZBRA 3NI2A 4CMIA 4D9HA 4EEXA 4H1WA 4YCMA 5I45A 1I5RA 1C0PA 2FUNB 3HDQA 2VNJA 1C3OA 1QYXA 4NEGA 4B9EA 4O2RA 5AOVA 2A5YB 3Q7RA 3P97A 1QH1A 4L9RA 1EB8A 5F4BA 1MX5A 4LWQA 2O6LA 4Y1RA 3NHFA 5CDGA 4BWGA 3N05A 1WM1A 1FJHA 2WJGA 3VZRA 1WCIB 4BO2A 3OI7A 1DNPA 1UBCA 4Y67A 2B1IA 2F9LA 4BN0A 4ID3A 5F4ZA 2OG1A 2PRZA 3GJ8A 4N9WA 3V80A 3S6JA 4QEKA 3DLPX 2AN9A 2KI5A 4XSHA 4CLOB 1ZRMA 2ZSKA 2MIIA 1KETA 2JGJA 1BEUB 2Z5FA 3BJIC 1N6OA 4DCMA 4FGZA 1JTFA 3O03A 2B5VA 1HKHA 2F1OA 3U0BA 1QYWA 4H3KB 3UV6A 1AQUA 4RPGA 3VDMA 1AS3A 3L41A 1OHHA 4JBNA 4V0RA 3TYXA 4XSGA 2B3DA 4E1AA 5DDIP 2C59A 4FEYA 2JVIA 3HVUA 5FOUA 3U7HB 3WQQA 3O26A 1KY5A 1QJCA 1UODA 2ZB4A 4HFJA 4QVGA 3PGKA 4US2R 2P78A 4HYYA 1GGHA 2VAXA 3K9CA 1JECA 5CG1A 1GXSA 2VT6A 2AFHE 1J8VA 2W2LD 3V7UA 5LJLA 3QVGA 3GFOA 5HGJA 3ONWA 1Q2UA 1XWIA 3AG6A 4NICA 4PLVA 4EUKA 2BEVB 2HBRA 1NKVA 3QEKA 4JX8A 3K0EA 4N03A 4LQCA 2XTAA 4OBXA 1QRRA 4XGKA 3UYLA 2RK3A 3VH1A 5A4AA 1MB3A 3IILA 4R31A 3ZWQA 4G84A 3TZEA 4DF3A 5KNDA 1A5BB 3SXUB 1D6MA 4K7JA 2VP2A 4ZHQA 5CB8A 1QUEA 1R2QA 2R1VB 1UWCA 4ZOLF 1I0ZA 5T4HA 3E9CA 1KH2A 1YA8A 1GKKA 1NQUA 3FYUC 4KHPB 2L69A 4FFSA 2QOEA 1XAHA 5JJKA 2A1TR 4P3OA 4LC9A 4IDCA 4ZAFA 3ZE6A 2WSIA 1M2EA 2IX9A 3ZDBA 3S40A 1GA1A 3EF0A 5CRIA 4X92A 5K3SA 2ZKIA 4CI0B 1KU0A 2ODQA 3W5DA 1S0UA 1RQ2A 3IP8A 1OXKB 2Z5VA 4XCXA 3C8ZA 3WL4A 4B3HA 1T9KA 1WWKA 4M1YA 4ECEA 3IEPA 3RIGA 3BAFA 2YVUA 3F7TA 4C21A 1WXIA 4J4BA 2OVBA 2QUZA 3C7TA 1QYDA 1FLAA 2WMDA 4MZXA 4QOSA 1KMMA 4F71A 3AO0B 5FTJA 4R0VA 1A9SA 1WMFA 2OVFA 3F3MA 3AM5A 4E15A 1U8YA 4I9GA 1YBVA 4LW8A 4P34A 4WLVA 5FV7A 2IV2X 3E3AA 4PYOA 3LFUA 3VR6H 2JLXA 3O9MA 4BWVA 4CKCA 3ASYA 3KE8A 4GBJA 5A0TA 2MSDB 4DDMA 4DJFC 2FUG1 4KQWA 5AM1A 3T8YA 2IP2A 1KDZA 4C0QC 2X8BA 3GGSA 2YS6A 3AHGA 3MTBA 2JEZA 5SY6A 4YRKA 3R5TA 4YJKA 3GGCA 3IOEA 5E4YA 1CS0A 4C87A 5THXA 4A2PA 2VQDA 1MOPA 2C42A 2XA1A 4ZEXA 1E2MA 4RMJA 1XU7A 3IJRA 4FMCF 2CLIB 3K8YA 4DCUA 3U7EB 1XMPA 3H87A 4PCUA 3OMWA 4XLTA 3W8DA 1SC1A 4L16A 4WN3A 2EWMA 2XUKA 3IEIA 3ZK7A 2CLKB 1P0IA 1T8YA 5HA5A 3QP9A 4JLAA 2FEAA 5DM60 3FLMA 1OA1A 1BC5A 4K05A 3NIDB 1OOEA 5DTQA 1F2DA 1K06A 3EVAA 2VWPA 2ZJBA 3KV1A 1D2RA 5BSTA 3M4YA 1UMDB 3ZXIA 5JBIA 1EDZA 1UPBA 3L43A 3SQMA 1FUUA 1G8MA 2QMYA 4C22A 4KXYA 3QI7A 3SF8B 3L02A 4E2XA 1NFQA 3L49A 1N2CB 5DZSA 5IAJA 4UZEA 4X9XA 3IQWA 1QSGA 2IL1A 2EKDA 2PH1A 1OA0A 2WINI 3HH8A 5ICGA 2YKGA 1AUOA 1QDLB 3NHYA 1I9GA 3ZDEA 2G3YA 2ZE7A 2CHGA 5LDGA 4RVOA 2FEPA 3EB9A 1ZRSA 5J58A 3HCFA 3JQ8A 3EPHA 1RBQA 4RZ2A 3T1YB 1AK9A 2CUZA 4G1BA 2ECPA 3UENA 4ZOLB 1XJQA 4LZLA 5G0VA 1T9CA 2XQJA 3T5PA 3WMGA 1YAHA 4GMGA 3JSXA 3O83A 3PGVA 5HKLA 4ETWA 4X1YA 4QT4A 1CY2A 1ZGHA 3H84A 4KDCA 4B3DA 2PPVA 4L15A 2O8VA 3CEMA 3I12A 2F3SA 1JHYA 5FWYB 4ND8A 4G8DA 4JZKA 2OXTA 4C1NA 1Q0TA 2D0IA 2G9NA 4MV9A 2UZ4A 3DXFA 3RHTA 4PHFA 1JEDA 1IN1A 4QC2A 2G08A 5CAEA 1CSEE 4MW2A 5EE1A 4P0PB 2NXEA 1QFMA 4IQ4A 3RVRA 4OHWA 2L42A 1T5BA 1V71A 3LT1A 4NZ9A 2WIGA 3ED1A 3UK0A 3X2SA 4C3OB 4R4JA 1RDFA 3HUFA 2G09A 3MBOA 1GG9A 4AY2A 2PIAA 1JQJC 3AEUB 1TYCA 2QZJA 1AA6A 2NW6A 1EE9A 4ND4A 3N8NA 4QLBA 1CIVA 2GKGA 1RJEA 2Q46A 2Y93A 5D00A 3RAFC 1AC5A 1GCGA 3NHLA 2TYSB 3R74A 2GJKA 3SLGA 1N25A 4UASA 1KEEA 4CT0A 1Y3BE 4HGRA 2F2TA 3EHEA 3GY0A 4F84A 5M5BA 3SR0A 4Q82A 3T1QA 4JT2A 3I1IA 1DBRA 1YK1A 2HAEA 4CEHB 1CHNA 2CLCX 5C80A 3E8MA 2Y05A 4FMCB 2QL7A 5J2UF 4MKRA 4WECA 4LHVA 2MR6A 5IKMA 2NV2B 4NPHA 4F2DA 3TLBA 4EB3A 1JT2A 1IK4A 1W29A 1RI2A 1XU4A 1VE5A 2FWRA 4P35A 1AZTA 2ZXEA 3DMRA 4OMCA 3ROQA 2XB9A 4F97A 3EAFA 4GGOA 2MINA 2VQEB 3GAZA 4U63A 1LX6A 1M0SA 3NANA 5H9WA 9GPBA 4MYTA 1JSXA 4X63A 1CB7A 2RJNA 3A14A 4QATA 3KR9A 2D2XA 1KJWA 2G9ZA 4I1RA 1DBPA 3TSWA 4G4IA 2C7PA 4F8JA 2OXCA 1J97A 4OYYA 1BX0A 1CRZA 5BQ5A 3OKAA 3LGXA 1RZRD 1V6CA 4IDPA 2RGWA 4NCIA 3KVNA 1PJCA 3WRYC 2ZR0A 4F6LA 4CM1A 4DA4A 3F8SA 2BFEA 4N7JA 1DPGA 4LRTB 3ASZA 4FS3A 4P1ZA 2ZTHA 5D86A 4NSNA 4BRZA 5A2GA 4KMOA 2QL6A 3JV7A 3HN2A 3B1ZA 3G8YA 4QDJA 2LDBA 1TM1E 4RY9A 1DUIA 2FEWB 1JQBA 4J49A 2EVWX 1T6YA 2R2AA 4XQ0A 5JPDA 4MWBA 1NWCA 3LU1A 3QYJA 2YXBA 4CMKA 1MV5A 1DMSA 5KCMA 1Q7GA 3T3PB 4DGSA 1I8TA 1YZFA 5B7PA 1G7TA 1XDUA 4BNYA 4POOA 5DNAA 5KWEA 1Q22A 5JT1A 5ULLA 1LFDB 4N5HX 1ORTA 2ZUCA 1G20B 4HOYA 1E2JA 3SICE 1KZ6A 4QAJA 5J59A 5TY0A 4F11A 3NT5A 2JJ1D 1F06A 4OQFA 4PPGA 4WCFC 1T43A 3KVOA 1P0MA 5BN1A 6CHYA 1NLMA 1VBKA 4G41A 4WH0A 4DA0A 1R6UA 3ORYA 4JI1B 2QMQA 5FNVA 5C8YA 4L9AA 2UZ1B 3JALA 1OVGA 5JNUA 3SNKA 3WLPA 3TL2A 1NUUA 1HMPA 1PWYE 3JZDA 4D3YA 4NYIR 5ILOA 3ZLBA 5DVZA 4OJYA 1RBYA 4A7PA 2Q49A 3PPIA 3SR3A 4E32A 5JPCA 3K94A 3V8BA 1VMIA 3HJHA 4JOCA 4RJ2A 5AVSA 1EXDA 3BSWA 2XQIA 2JGLA 1JYEA 3DGFC 3ME5A 2J5BA 4MWOA 4RZUA 5J2UB 3RU7A 5DBFA 2XV1A 4DXHA 3OWOA 2Z5GA 3I6YA 1OAOA 2AKYA 4O4HA 4OHUA 3N39C 3ZX4A 3KCNA 1O57A 4HNVA 3FTDA 4BV8A 3V4ZA 4GYYA 3TEMA 5KMGA 4XRGA 4D6XA 4DDHA 2JS7A 3WLMA 1G8KA 1VQ1A 2WF6A 4AUMA 1N6NA 3AM1A 2HN9A 4WHMA 3IP6A 1BQEA 1IIRA 1M6HA 4IDBA 3VV3A 4Q48A 1T1JA 3N6RA 5IAGA 2O3TA 3BSFA 2PQ0A 3FGPA 4QNMA 3EY9A 4QG7A 5KSOA 2QSZA 7REQB 1H0RA 1HFWA 3EGIA 3TMKA 3BVPA 2VJKA 3D6AA 3K2IA 4INOA 5IBRA 2GWHA 2JLUA 5CUQA 3ANNA 2LCIA 2P8JA 5T4BA 1B26A 3ET5A 5L3QB 3KEQA 3OIDA 4LPKA 2E1PA 2FZWA 2WK1A 4P7FA 3WBJA 3M4JA 4V02A 3PFHA 2VTBA 3LLMA 4ADSG 4CM5A 1PVOA 2PKRA 2H29A 1R6DA 1NU6A 1I7BB 2FG5A 1SOMA 3AESA 4PHCA 4BNKA 3PPVA 2AEJA 1R0LA 4CM4B 1ZH8A 3D0RA 2R00A 2LZ0A 2C2OA 3NRCA 3F8WA 3A27A 5G3YA 4JUAA 5BSVA 2DQ4A 4GYJA 1ODSA 3L9WA 1Z5VA 2B4YA 1R9JA 1XTPA 2BHSA 1A71A 3OZAA 4BNXA 2WM3A 4WY2A 1BXZA 4U0KA 4AZ0B 1DG9A 1O94D 2WJ4A 2G5GX 4DJTA 1DV2A 4TTQA 4MIKA 4Z0PA 5CYGA 2WT9A 1SG9A 3UQYS 4EI8A 1B3BA 4TV8A 3AF1A 1G1AA 3QM1A 4AF6A 4DDKA 2R96A 1UOOA 2G83A 2O2SA 1Z4QA 4S2UA 4MQ5A 5E9QA 2NXNA 3M4NA 3JYOA 1EXVA 4OQLA 4XYMA 2GEBA 3DTVB 3QE9Y 5JBNA 1W4AA 2P1RA 1BE1A 5J2TA 1H2BA 2H59A 1XMIA 1UM9A 1EFPA 3PXXA 5DXJA 3WWDA 2ZYRA 2AMLA 4NHOA 3E27A 1JV2B 4L1KA 3L7OA 3O38A 5FEUA 3FR8A 1U7PA 5BR1A 2Q6KA 3JWHA 2W58A 1EP3B 2OHVA 3IMGA 3N8HA 3HHPA 3KVRA 5JEDA 3RD5A 1R8YA 1NBMA 3T4XA 3IAM6 4GPTA 3ZGLA 2D1FA 4WXMA 3FSJX 3W3AH 1RPZA 4UZSA 4D0NA 4YV0A 4RKWA 3C41J 2FFRA 4IIYA 1USGA 2FPWA 2GF9A 2NSJA 1UZUA 2YUIA 4IMIB 1ULUA 4IWNA 4PO3X 2IYXA 2F48A 3O47A 5DF1A 3LCJA 3SLRA 3BF7A 3DM9B 2YDYA 5I48A 1FU8A 4RGBA 3PCXA 2RGEA 4Q15A 1RRCA 1M34B 1Z47A 3L8CA 3JXEA 4O2BB 1F1BA 4TMWA 1OTXA 3FD8A 1RTTA 4TKZA 3GLTA 1GN9A 4C2TA 3LUKA 4QSMA 3C5WP 3YASA 3LWZA 3BS4A 2N1MA 4HGOA 4P80A 3OMXA 5JSZB 1R4MA 2P9ZA 1K3FA 1XEWX 3AY7A 4DMFA 1GFWA 3PNLA 2P77A 2X4IA 4RF5A 2E18A 3P0JA 2F43A 1CE8A 2UVPB 3I0ZA 1MC8A 2ZT8A 1DX6A 4Q02A 5EZQA 3UJAA 1Z6YA 3R3YA 5DM70 1O0BA 4C7OB 1C3XA 1R00A 1I2MA 3DO6A 2JK1A 1UCFA 5IJ9A 1ND5A 2ZLBA 1Q57A 3IE0A 2OM6A 3LXMA 4H0CA 2XXBA 2XYHA 1JHMA 1JX6A 3FYTA 4LDNA 3ILXA 3LNTA 4ZAWA 5KREA 4G56A 3UPDA 4ZCPA 4OSEA 1P19A 3R5KA 3PG5A 3GMIA 4D3SA 3O92A 2OV3A 3U9SA 4BKQA 1OREA 2RGYA 3PXGA 1JDJA 2VHVA 4H4EA 3STYA 4GUDA 1VE9A 5TC4A 3I01A 2PX5A 2C8LA 4X66B 4OXQA 4KVZA 1VB5A 1GIAA 1IDOA 2QPLA 3C7KA 3RAGA 3NHUA 4ZHQF 3EVNA 1NI3A 1WPQA 4R2KA 1IE3A 1GZ7A 1Y1QA 3HO8A 1XNHA 4RVCA 4W1QA 1T10A 3WO1A 4NBKA 3L82B 3NJRA 2P91A 3JVUA 3Q8MA 1XNRB 2SECE 4FQ8A 1EFTA 4TROA 1KKMA 2Y4OA 2GJ9A 1BQ3A 1NYLA 1RXWA 4EGCB 3C6YA 3OZVA 1J90A 4P08A 4KPYA 1QGAA 4RIFA 4DUZB 1KBOA 3UOGA 3W5HA 3D6VA 3PFKA 5DRTA 4UU7A 2QUKA 4JIMA 3AQIA 2AXEA 3ESAA 4L8FA 4OFBA 1PT8A 3I9OA 4BLWA 1IXYA 1M2NA 1QQ5A 2J87A 5FORA 2ZRJA 3OY2A 2JC3A 3ESXA 2IYWA 2W6PA 3L3BA 4JVOA 4LBVA 4RZHA 2XE8A 4DBLC 1HE2A 3VH3A 1SD2A 3UEOA 1N6IA 3MILA 4PQYA 3TBFA 2QQGA 1LW6E 3UT5B 3RJMA 4AMBA 1Z6AA 4B3XA 4IPTA 5EHIA 1H6BA 5H3CA 1MDBA 2ZG6A 2ZJ7A 3H5VA 2XW6A 4WWHA 1AQYA 1ONSA 3LCMA 3H4TA 1RVDA 3QNMA 4PPNA 4BO1A 4YUXA 1R6BX 5A5VA 1TZ2A 5BN4A 4EBFA 4YROA 3M5PA 1JQ5A 3D4OA 1JNYA 1KQNA 5CBKA 3H5NA 4C6SA 2O3SA 3T7EA 3OOHA 1NYQA 4G9EA 4JBLA 2JFYA 4ZA2A 3WISA 1JEJA 4YBZA 2X5JO 1JXAA 5JOQA 4INAA 1U31A 1WJGA 2DULA 4CR8A 3ZQUA 4D9MA 1AOXA 2MYNA 4KNVA 2LGJA 1GU7A 2B1RA 2FP4A 4CW7A 1YUNA 2O54A 5DEOA 2H2AA 4JB2A 2IYOA 4GR9A 3H3FA 1K4KA 2J0EA 3MTDA 3VR4A 1FEZA 3QQ5A 5KYWB 3AYZB 2Q1UA 1ZESA 3E84A 2VJNA 1T24A 4II7A 4PVDA 3SOZA 2QW1A 2O0HA 5D3MA 3KQOA 4A0SA 1V43A 3PSHA 2FSSA 4EA6A 1IN7A 4RCYA 2YWGA 2JCYA 5JE8A 5A9TA 4ZIRA 2EJWA 3WYBA 1GSHA 1OMOA 2B4AA 5CHEA 4V39A 2PNJA 4FDAA 2GVZC 1GITA 3KQVA 1NRXA 1R3DA 3OM9A 4IRXA 5I8ZA 1TI7A 1NVFA 4RHUA 2DMRA 4IVRA 3UOAB 3WY9A 4DW8A 4IGAA 4Y30A 1HK7A 3ILVA 5P8WA 1VCOA 1H5UA 4F38A 1NHWA 3M6LA 4FGLA 4MS4B 3MS7A 2YFKA 4U39A 3NAZA 1U3UA 3Q41A 3PCTA 4D4HA 4GXQA 4TYQA 1VBFA 2NPIA 2F8TA 1CUHA 3CVJA 4HWOA 5HVNA 3QTBA 1DTWB 4KDEA 4KGXA 3KZ1E 1CQIA 1R4ZA 1TM7E 2Q1WA 5G1NA 2QJOA 2GPSA 5HE8A 3TBKA 3CKKA 1NMXA 1GZHB 2ET6A 4UOEA 2A14A 3FBWA 2JJ2D 1FDTA 1LRLA 1QONA 2BZSA 5F76A 3O8RA 1RNLA 2D2IA 5BV1A 4D99A 2O8BA 1SJ9A 3QZUA 4F45A 4ZRMA 2O14A 2CJPA 2H54A 1P1JA 3IDFA 1K3UB 2X0JA 3O2JA 2JIDA 1JKJB 1N6LA 4M88A 5HIMA 2Q4OA 5K01A 2EV9A 4MV5A 2V6JA 4OQEA 2PKQP 3R7SA 3ZKAA 3ZY6A 3IS3A 4NBNA 1T8SA 3Q11A 3D64A 1ODKA 1V95A 4I0WB 4A0QA 4L78A 1X0XA 1O3YA 3F9IA 3PDWA 2QQFA 1PGJA 4PFQA 1E0DA 1SUSA 5K3FB 4HNUA 5FT9A 4CJXA 3KQQA 3C70A 2XNDA 1ACLA 2YCLA 1ISMA 1OC2A 2GD6A 2F1RA 3HVJA 1R4NA 1K63A 4O4IA 4TOIA 3BWYA 4K9PA 1DBSA 4FC6A 4EYOA 4PRKA 4AK1A 2OCBA 5JYDA 1NY6A 1MC5A 2WPDA 4I1IA 4LSGA 1XELA 1L3CA 4GRIA 4IRMA 3OZ7A 5DO9A 2HCBA 1WMEA 5C34B 3I6ZA 4R1MA 5AVUA 1IEXA 1J23A 1E2QA 1UWLA 2Q5IA 2I87A 4J07A 1U4SA 1FNDA 1E1LA 3FPSA 3I05A 2CD9A 1ODJA 2P2NA 4ENWA 4TVBA 2VXYA 5CJJA 4B4VA 1HEUA 4JR0A 2QRHA 3TNLA 1XRMA 2X0NA 5DP2A 4X64B 1SOUA 1XA0A 4CMEA 3AHJA 3DBRB 3MERA 1SC9A 1KIMA 3LOQA 3GEIA 1RMTA 1H5QA 2I54A 3K5IA 3IT0A 4MJ3A 3ENKA 1TF7A 5JVDA 3D6UA 1WRBA 2W11A 3PUZA 1BWSA 3OZXA 2VYVD 3M1IA 3FPLA 2YNMD 4YR7A 3QA3E 4R81A 4AB1A 3K2EA 3MJTA 1LPAB 3MBIA 5TMEA 3MC1A 4NCAA 4QUHA 3AX6A 1F60A 1YQ9A 2WUGA 3FUVA 1H2WA 1JPJA 3GQBA 3EP4B 4X1KA 4XEHA 2IXBA 3R0ZA 4TV9A 5EWJB 1N36B 5A3QA 2VAWA 5KNDH 4C06A 5LZ9A 2OV8A 3FZQA 4LN1A 3QNWA 4H9GA 4YJ3F 4FMBB 3KV3O 1SCUB 1UEJA 4AMUA 4MGZR 1OX6A 1L7AA 1TNDA 1U3GA 2FK8A 1IIBA 2B61A 1X7ZA 2JHPA 3JYPA 3WYFA 3KZMA 1U0GA 3WWYA 2AZXA 4X91A 2BR4A 1T36B 4HAOA 4Y7CA 1UOEA 1P2VA 1PLLA 2PJZA 1NMEA 1JVSA 1JG2A 2ZBQA 3A04A 3PTLA 1NAHA 3E2IA 1ZK4A 3EARA 2IBSA 2WWHA 3U5ZB 5BMOA 4CM8B 5JYAA 3DC2A 5J9FA 4PNZA 1MT3A 3KVYA 4PC7A 1KFEB 2E4XA 4WE3A 1CVRA 4EW3A 3HWWA 3I04A 5KYTA 4FBMA 1UJ2A 3WBFA 3FNEA 3HU1A 1QR2A 4AT1A 1HDZA 3B6MA 3VUEA 1FDWA 5F51A 1VKRA 4QWMA 1UEXC 1HZJA 4DTCA 3GW8A 3SSAA 2X9QA 1Z6PA 2YV5A 3PEUA 2WJAA 2F3PA 3PQFA 3O84A 5EPEA 4AW9A 3R0JA 3ADOA 4FUTA 1UJ4A 2C58A 3EZXA 4NBLA 4EF5A 3LF2A 2E4AA 1F3LA 1VGQA 3VKUA 3U2QA 3NLLA 3RFTA 1UXHA 3I83A 3OT1B 3P5BA 1B2RA 3WLEA 3W7VA 2I6QA 1NDQA 3T94A 1QFZA 1W73A 4OKIA 4QDZA 3U4DA 1NNLA 3VHXB 3RNOA 1KI3A 4Z2YA 4FX5A 1MJ5A 5FYQA 2E7ZA 3UWMA 2B2XA 3FOFC 1TVKA 2DWOA 3EISA 4OQMA 1XNQB 2EFCB 2V65A 3DPIA 1GKUB 2XYGA 4MQUA 4MW9A 4RS3A 5HRCA 1O8CA 2FCRA 1BYIA 3MWEB 4GRDA 3TM5A 3CMCO 4EY8A 1Q74A 1NVMB 3OZIA 4JC4A 1BRMA 3A3YA 2YVKA 3U80A 4ZANA 4BXOB 4E7OA 4PQEA 2YOHA 4K6FA 4X85A 5JWHA 4DM7A 1WD7A 4F9TA 5CVEA 1E5QA 1TTHA 4MYSA 5G1PA 4L2IB 3ZVKA 4YASA 2C5HA 3H5LA 3WIVA 4E03A 3RSCA 5HUQA 1JJVA 5A4FS 4L6AA 4MPRA 3O4VA 1LCIA 4Q9LA 1OWNA 4N47A 1KFBB 5AW7A 2X9GA 5HS6A 4FNAA 3P9QA 3IEVA 1L7XA 4M99A 1JZSA 4I55F 4U9IS 2AFVA 3AVQA 4G07A 4HQFA 2NYUA 3U3ZA 3PC3A 3F2IA 4GH5A 4Q3KA 4G85A 1XPOA 2VNHA 1GUFA 2OCPA 1SOAA 2GBCA 2GSDA 1GPH1 3GYBA 1B3RA 4J16A 4QTYA 4YJ3B 3N8GA 4DCJA 1IQRA 1ZMOA 3KPJA 3FDZA 2IU0A 4AO7A 3OF5A 1WCV1 4KWHA 1A4XA 4NP6A 1DJMA 3P0FA 4HNGA 3RYCA 1ZS9A 2RD2A 4R40A 4JQSA 1U4OA 5F23A 1TDJA 4L5BA 1CIJA 4RY8A 5LLTA 2L0XA 2UUPA 4WOCA 3KVVA 2XTJA 4YAFA 4B3GA 3F78A 4OGLA 1E9CA 4K1LA 3ZTWA 3FOBA 5I9BA 3TW4A 1PHPA 2PS9A 2V7BA 2V0CA 1NQWA 2Z6VA 4Z7NB 5LPNA 1LEHA 2DHDA 1EHYA 2XRFA 1U63A 5AK6A 4ZGGA 4YPVA 3HRHA 5FLEX 4IICA 4EIWA 1JW9B 4C07A 4S1PA 4MVYA 5CNIA 1DBWA 4UUOA 4WK0B 5ARCA 4L07A 2F8SA 1BE0A 5TJ9A