3DMTC

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
358
Chain Sequence
b'MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
molecule tags Oxidoreductase
source organism Trypanosoma cruzi
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
total genus 120
structure length 358
sequence length 359
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
C PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtC02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtC01
4MVJA 3PLRA 2XOXA 3BAZA 4QFDA 1K89A 2VZ0A 7ADHA 4B7CA 2A35A 2NM0A 2X86A 2YQ5A 1JW9B 3WS7A 1O8CA 3DAFA 2R6JA 3E1KA 1TEHA 2EJWA 3D64A 4IS2A 4J7UA 2NADA 1PR3A 1HDXA 2D5CA 1E7YA 1I2CA 1E6UA 4FFNA 2D0IA 4FS3A 3P7MA 1LDEA 1PZFA 3TN7A 5IZ4A 4L74A 4CLOA 1CDOA 5C37A 2LDBA 1HDRA 3ZV5A 4MKRA 5BNIA 1BGVA 4PFJA 1R12A 3O8QA 1ISFA 3E18A 3TOZA 4EYEA 1KOLA 4BMVA 1I33A 3QRWA 4W7HA 4P22A 3BMCA 3KETA 3A14A 3JV7A 3AY7A 1T2AA 3K73O 1C0KA 4NH4A 1DFGA 4AJKA 2O48X 2X4GA 4LCEA 1B8PA 2A4KA 4GSKA 3GT0A 3GVPA 1NP3A 4Z9XA 2WJPA 3SBOA 3RBZA 5L7TA 1PGOA 3OHSX 2X22A 1EK6A 3KLMX 3VKUA 1LXCA 4R54A 4LK3A 5CG2A 5JS6A 4UEKA 1R37A 4KUHA 2ZYAA 1JU9A 3SJUA 1UP6A 2RH4A 1L7DA 2QRJA 1LQTA 1HL3A 3NGXA 3PDUA 5L9AA 4K28A 3AOEA 2I66A 1FDVA 5COAA 3CE6A 2HKIA 4YAIA 5CDTA 2RHRA 5JMWA 3GF4A 3W6UA 2A92A 4IM7A 2BI8A 1SBYA 1T26A 1M6WA 3WR5A 2BLLA 2QQ5A 1LU9A 2HMTA 3ADOA 1XIVA 1K3TA 1Z6ZA 4WUVA 1U4SA 4YT8A 3RUCA 1HDGO 1KYQA 2HUNA 3SLGA 2FN7A 2IODA 5HM8A 2OUIA 4Q3BA 2YYYA 2Y66A 4IJKA 4MIOA 5I7VA 4TZKA 1P1FA 3I6QA 2ZTUA 5JYAA 4ZQHA 1S6YA 1XU9A 2X0NA 2JHFA 3UICA 4FR5A 3VAZA 5JDIA 3LT0A 4DTIA 4DA9A 2DKNA 1YJ8A 2WE7A 3Q9NA 5A9SB 4PLCA 4YACA 2BH9A 1F0YA 1UDBA 3NT2A 5I7FA 4BOYA 4LVUA 3U09A 3BZUA 5KNLA 3BMQA 1WNTA 4M86A 4PZEA 5KVCA 3O38A 3CXRA 4YJHB 2QHXA 2E48A 4OM8A 5BQFA 4D46A 3QSGA 4E32A 2OL4A 1E3WB 5T6BA 1DJQA 5B1YA 2UUOA 3I9KA 1H2BA 3PYLA 4W9NC 4IIVA 2E6UX 3OIDA 1Y1PA 1ZH8A 2ZTMA 3TFQA 4D0SA 5IJZA 4GVXA 4IXTA 2PNFA 5TJ9A 4A03A 1H94A 2NVBA 3I9MA 1GYPA 1G0OA 4DBVO 2H5LA 1OAAA 4UVEA 4J1SA 3VH4A 1U2DA 3H9GA 2V6GA 4UULA 3IKVA 4E0BA 4EEXA 4L4XA 3WGIA 3LU1A 3LC2O 4CR6A 3DB2A 3FCOA 3OP4A 1JN0A 1BW9A 4AJPA 1M75A 4CMIB 1WDMA 3RUFA 3WGOA 5EIOA 2FMUA 4QX6A 1ZEJA 2YFHA 4NZ9A 4DQXA 1LNQA 3JQGA 1RM4A 1PJBA 3IQDB 4PG7A 1V3UA 1A4IA 2HMUA 1ZJYA 1HTBA 4MVJP 1Q0HA 1WPQA 2NU9A 8ADHA 4M87A 3RFTA 1ZSNA 2PKQO 2RIRA 4J9UE 3RUDA 1NPDA 1K0UA 4MPDA 1R4MB 1FDWA 4Q3NA 1DBVO 4KTTE 4NMHA 4YT2A 5L7YA 3DONA 3G49A 4ND2A 3BHIA 4CQLA 1PWXA 4U0JA 5JDIC 4A0SA 1NAHA 2O3UA 1HF3A 1UXGA 1B8UA 3ASVA 4I5DA 1WMBA 4BB5A 1XQ1A 2D59A 1MXHA 4OXNA 4GWGA 3P5SA 1PZGA 3AU8A 1UDCA 4Z0TA 1I5RA 2X8LA 3AOGA 4L8VA 5JAZA 4PZCA 5G4KA 1L1FA 1Q7GA 2D4AA 2FR1A 4UVIA 4D7AA 4CM7A 3IJRA 3Q9UA 4ID9A 1QLJA 1JKJA 2GZ2A 5ILOA 1XYGA 1XGKA 3AWDA 3JYPA 4CV1A 2H1SA 4AJJA 3VZSA 1KS9A 4BNHA 1ZSVA 1TT5A 4I08A 4PCVA 4DYDA 3NEPX 1E7RA 3WOHA 1NWHA 5JAQA 3Q1LA 2WMDA 3LLSA 3ZWCA 3C3XA 1E3JA 2GASA 3LF1A 4BQRA 3INTA 5C3MA 1ZIDA 5KKAA 1NNUA 1PGQA 4IBOA 5THKA 2O7QA 3A9WA 2C2YA 1SB9A 2VT2A 2ZQYA 3KYDB 2JL1A 3S2GA 4BGVA 1Q2XA 4TRRA 2ILTA 1K2WA 2G5CA 5ITWA 2PZMA 4TKLA 2WEKA 1TA4A 5ILGA 3GAZA 3CKYA 5TRTA 1JAYA 1A7AA 1YB5A 2EIHA 2V6FA 3PTZA 1EQ2A 1PJ4A 1LA2A 4CM3A 3F46A 1ZZEA 4E3ZA 5DP2A 1IZ0A 2QZ9A 1GZ3A 1DDOA 1WWKA 1TLTA 1YO6A 4WECA 2VTDA 1LRKA 5FFFA 3GUCA 1CEQA 1XELA 1IZ9A 1ISJA 1EZ4A 2V6MA 1JKFA 1C1XA 3FWZA 4IDDA 4XR9A 3X2FA 4URFA 5IF3A 1HDZA 4HXYA 3GPDG 3LT4A 3CSDA 2VYVD 2YHIA 5KWEA 3ZNPA 3GMSA 5L4NA 3CTMA 4TVOA 2BFMA 3DBVO 4FDAA 4BO1A 2OZPA 5COBA 3GA0A 2JAHA 1GADO 1KY5A 3AY3A 3DHEA 3ZV6A 5IN5A 4WCFC 2WWRA 1D8AA 4KOAA 1I24A 1P33A 4D42A 1FXSA 1J49A 1FF9A 3PFWO 4L9RA 5JSFA 4IY1A 1PR9A 2Q1SA 4HX5A 2B4TO 1PTJA 3H2ZA 4NFYA 4DWVA 3HDHA 2YV3A 4ZN6A 2IZZA 1PQWA 4IJWA 1MC4A 1E1MA 3UGKA 1PL7A 4BV9A 3H9UA 1DC5A 3CEAA 2X58A 4H3VA 3QLJA 1MX3A 3DBRA 1BSVA 2P5YA 5T64A 5TF4A 1OZAA 3JQ7A 3RASA 4MIYA 3ETEA 4FIZA 2BD0A 1GPJA 2Z95A 3GK3A 1R4NB 4XQGA 3S2IA 1P1IA 3E9MA 1L7EA 4YA6A 4B8WA 4EW6A 1UUFA 1UAGA 2I67A 4HUJA 5IZCC 2O2YA 2IEBA 2C7GA 3QHAA 3PGJA 1N5DA 2C82A 5G0VA 4DBZA 5DBFA 3DTYA 4E5YA 4F45A 5A02A 2O4CA 4PLGA 2JHGA 5TT0A 3MJ4A 1PS0A 3SC4A 4DPMA 4CM6A 2PTGA 2QZZA 4ZJUA 1SPXA 4YAGA 2PKRA 4W4TA 4FN4A 2BHLA 5DULA 3OJOA 2JKVA 4BO7A 5CG1A 1A9ZA 1Q0QA 2YZ7A 1PQPA 1BG6A 3GGPA 1NM5A 4RF3A 4R01A 5JCXA 3TQHA 1DB3A 2GLXA 3DQPA 4L4SA 4NHEA 4D0RA 4ZQEA 2O3QA 3HFGA 3F9IA 4WOJA 1DAOA 4YJGA 4H7PA 1PJTA 3F5QA 1PIWA 2W2KA 5F3RA 4BO0A 5JC1A 1U8XX 3ONDA 2GZ1A 2DBQA 1AHHA 1YE3A 2B4QA 2DAPA 3EZYA 3WSWA 1VJTA 4C4OA 4XIJA 2VUSA 1DHRA 1WP4A 2YY7A 2PFGA 4XIYA 3JQ9A 4ZRNA 4CR8A 4U6SA 5KKCA 1X7HA 3WDSA 3CIFA 1IB6A 2XXJA 4JGBA 1Y9EA 5J23A 1F8GA 3RJ9A 2FPGA 3F1LA 4F6LA 4RF5A 2I6TA 5B4UA 3PK0A 5DNAA 5JCJA 2EJVA 2R2GA 5M6DA 1VC2A 3OMLA 2CD9A 1LLUA 1SNYA 5DBGA 5THQA 4JJFA 5KCZA 3LDHA 4QQRA 4WLNA 3K5PA 1KVTA 1P1JA 2YHUA 2ZJ1A 4UVGA 3IUPA 3AM3A 3ROPA 4IINA 3RBXA 2WYVA 3E48A 3OA2A 2GF2A 2HJSA 1OC2A 1VSUA 5CPBA 3DBLB 1ZK0A 3RU7A 4B79A 2VHWA 2E82A 2ZK7A 4NK4A 4YAEA 3IP3A 3ITDA 1HDOA 3GZNB 4YRDA 2PKQP 2ZYDA 2O7SA 2PD6A 2Y05A 1QXSA 3JYLA 1BHSA 3K30A 4IMPA 5G0SA 4XB2A 1ONOA 4ONEA 3MTGA 4OQZA 4MP8A 3VPGA 1EE9A 3ST7A 2P9GA 4IQ8A 3KZVA 2R00A 1X1TA 1N9GB 4L0QA 1QG6A 1PGNA 3DBHA 1JDJA 3GUYA 1AN9A 2JCXA 2EP5A 1AHIA 4H15A 3FN4A 3F3SA 4W6ZA 3GMDA 1X1EA 5ENDA 1A4UA 5TLSA 2CNBA 4AJEA 4KQWA 3UW3A 1BWSA 3HN2A 3Q0EA 3ZWAA 4LN1A 5A9TA 4Y67A 5CDYA 3ICPA 4RVSA 3GZ4A 4ZVVA 4UUNA 3OQBA 1NAIA 1I10A 5F21A 3WLEA 4XR4A 2XAAA 5JYEA 4FBGA 4CM8A 5FWNA 5B12A 4MVJD 4OSOA 5LDHA 2FOIA 4CUJA 1ZUD1 2BELA 3BYZA 4FJ2A 3OFSA 4NU5A 1YQXA 4RL6A 1E0DA 3UUWA 3NT4A 2O23A 1P0CA 5I9MA 3P19A 1D1SA 5TNXA 1IUKA 2QRLA 3FSRA 3HZZA 4JJIA 1I0ZA 4Q9NA 1EFKA 2AG8A 4WASA 4EDFA 2TMDA 2F1KA 2YDYA 3OEWA 2Z1NA 1GCUA 3I23A 3KLPX 1I2BA 1NPTO 1NHWA 1EE2A 3GQVA 2D8AA 1MP0A 1M2WA 4OO3A 1H0KA 5EINA 1GDHA 3WYBA 3GZNA 3IP1A 2EHDA 4RLHA 3KOUA 4JJGA 1E77A 1PJCA 5ES3A 3MWDB 4DXHA 4FPXA 3W6ZA 4QEDA 2VYVA 4DPLA 1AUPA 4PRKA 3ZNNA 4CMBA 3F5SA 4PRLA 3D4NA 2Q22A 3DMTA 4O5OA 1LTHR 2DT5A 4FD3A 4IDBA 1EMDA 5L7WA 5ENVA 4TRMA 1W6UA 1VKOA 1VM6A 4KQXA 3I52A 1DSSG 2BRUA 2X6TA 3B1KA 4Y98A 4AJNA 3CZRA 2YV1A 3VOSA 4KWIA 3G79A 4U6QA 2OOSA 3FHLA 3PJEA 3HSKA 4BKUA 4DQUA 5K6AA 1KETA 3IUSA 2OP0A 4J9VA 1M66A 3PIDA 4MP6A 2DFDA 4PLZA 3GGOA 3B1JA 5IN4A 3R1IA 4JCOA 3VTFA 3ZW8A 4K26A 4BNZA 1H9BA 3ITKA 4NFSA 3AK4A 4X54A 3BMNA 2FZWA 3BA1A 2Q46A 1LDYA 4MIEA 1HYGA 3KHUA 4MINA 1CJCA 3LC1O 3AM4A 3D5QA 3L77A 4YJGB 3DZBA 5JCJD 3M2PA 3WB9A 3V2UA 5TJHA 4WCFB 2HMVA 3OJ0A 3PRJA 2HRBA 3KVOA 4J49A 2Q1UA 2B0JA 3QVOA 4UVDA 4BKQA 4NNJA 5EQFA 1MGOA 2C0CA 1A27A 2P9CA 4B4WA 1W8DA 4O6VA 4MVJE 4WLVA 4WNCA 1R15A 4CMJA 1QYVA 2VWQA 3AI3A 3TZKA 3RJ5A 2PA3A 5DOZA 4DIBA 4HY3A 4HNHA 5IDXA 4WOKA 4JN6B 5K6AC 5I8ZA 3ZN2A 3OECA 4NG5A 2VUTA 3ULKA 1GPDG 1YXMA 3DZKA 4B4OA 2C7VA 4B7XA 5DP1A 3NAQA 2XXBA 2BMAA 3PJGA 1ZKMA 3KYBA 3FNEA 3QP9A 4CM4B 4WLUA 3RUHA 2JJYA 1RWBA 3K8ZA 3PZRA 3DBRB 4P4LA 1IY8A 2ZCVA 1KIFA 1N1GA 3N58A 1T4BA 4GLLA 4XYBA 4Z3DA 1PWZA 3NV9A 4R1SA 3DMTC 2ET6A 4ZQBA 2JD2A 4FW8A 5IZCA 2IYOA 1T1SA 1D1TA 1CQJA 1M67A 1B26A 1B2LA 2GRAA 5T73A 1Q0LA 2GERA 4E12A 1BXGB 1QLHA 3HE3A 5G0TA 4NBTA 3RKRA 3WBFA 4Y6PA 2CVZA 2IDZA 3KXDA 2G76A 2EP7A 4RPGA 3H2SA 3JQAD 3INRA 3RVDA 3QWHA 2X23A 1W4ZA 1LEHA 1HT0A 3JQAB 3P2YA 4II3A 2YHIB 1MLDA 3EK2A 5TSDA 1QV7A 1Q1NA 5JW6A 4EJMA 3WMWA 5ICMA 1DC6A 2W2LD 1NFRA 4BNXA 3RFXA 4IMRA 2AG5A 4BIIA 1SAYA 4WCFA 2EEZA 4M8SA 5C5IA 5EN4A 3ZWYA 1PGJA 4O1MA 2Y1CA 1BMDA 3NTQA 3PHIA 5JAMA 1BVRA 3SVTA 1KERA 1P3DA 3PVZA 4CL8A 5GZ1A 3E5RA 2YDXA 5KJEA 2GD1O 3FTNA 1X0XA 3N74A 2Q1WA 4EITA 1VL0A 2D5AA 1DRUA 2J3KA 1O89A 1WAMA 3NJ4A 4Z3KA 4PG4A 1DRVA 4UVHA 4GPD1 1XLTA 2GN6A 2R00C 2W98A 3QVSA 3LK7A 2OO5A 3NGLA 5CAEA 4JP3A 4PGFA 1ZFNA 3QA9A 3ASUA 5L45A 1AGNA 4MVJH 3T7CA 3AUAA 3BIOA 2JFHA 3M1AA 3VZPA 3NTOA 2E49A 3T4EA 4E6PA 4HFRA 4R51A 3S55A 3EGOA 3AM5A 3MJVA 2VYNA 1DIGA 2FPIA 1TT5B 2IEDA 5H82A 4YRAA 5HWSA 3DFUA 1EUCA 1ZEMA 3ANMA 4YJDA 5A3VA 1B3BA 1ZXBA 2VT3A 4EUHA 3E8XA 4R9RA 5T8KA 4XYLA 2GZ3A 1OOEA 3QVTA 2AQHA 2IZ1A 2ZYGA 2WTBA 1NVMB 1NHGA 3ZH2A 4C7JA 3TPCA 1R66A 4OKIA 4E5MA 4YAKA 2I3AA 1MB4A 3LF2A 2DPGA 3FR7A 3ZWPA 3DL2A 2H6EA 5C7IO 2I76A 3W1VA 1SC6A 4FC6A 4MOWA 3K9QO 5CDUA 2FRDA 3ANLA 2YFQA 1ZMTA 4BNWA 1N7GA 1LRLA 1GEEA 3I3OA 2EG9A 1DIRA 3Q6IA 4XB1A 1KBZA 2VHZA 1HYHA 3OEYA 4RGBA 4GI2A 1BVUA 1MA0A 4D43A 4E30A 2VHXA 1GL3A 4OH1A 1DC4A 3MJSA 3LT2A 1M76A 1HE5A 4ALNA 2J6IA 1IHYA 3JYOA 4YPOA 3JQGB 2W90A 5A5EA 4CM8B 4L4RA 2PH3A 4JXKA 1DJNA 1XKQA 1XU7A 2NTNA 4TKMA 3TZQA 4B8ZA 3WFJA 1HETA 1HYEA 3GG9A 3I9JA 2BFAA 2POQX 3QWAA 5AXDA 1FDUA 4A7PA 3VPFA 1VLLA 3JQAA 3DOCA 3FI9A 3K2EA 4YQYA 3SX2A 4DLAA 1HEUA 3PZBA 2Q2WA 3D3EA 2UDPA 3GY0A 5BR7A 3E03A 1BDBA 2PLAA 1DRWA 4CM9D 3JQEA 3NRCA 4J4BA 4YEDA 1E7MA 2ZATA 2WSBA 3FBTA 3H9JA 1NQ5A 1T2FA 3D4PA 3ZHBA 3DOOA 1SEVA 3ZW9A 5JO0A 5EJ2A 5HRUA 1P74A 4YTEA 3IAHA 3WGHA 2DM6A 4M1QA 3TNLA 1UH5A 3PHLA 2X1HA 1B7GO 4FFPA 1E3IA 4DMMA 2FWMX 5JC8A 1T1RA 4P38A 2J3HA 4YQZA 3OJLA 2PZLA 4DIOA 4YJHA 2YUTA 4E31A 1P44A 1K6JA 4DLLA 4CM1A 1U3UA 4S3MA 4FCCA 1NX6A 3DFZA 3RKUA 4CM4A 1C0IA 3F47A 2CZCA 4LVCA 5GMOA 1ARZA 1NQAO 3Q2KA 2Z1MA 2ZTLA 2V6BA 5A9SA 4DRYA 3PHJA 2WD8A 3IS3A 1VSVA 1H9AA 2GCGA 1NVTA 1PEDA 3WYCA 4E5KA 4N5MA 4R16A 5IDYA 1T2CA 1FDSA 2Y1DA 1LI4A 2GPTA 1I01A 3OQ1A 4B4UA 4R4JA 3OM9A 5CP8A 2W8ZA 4MVJF 4I1IA 2X5JO 3EYWA 1CETA 4AJ2A 2RBEA 3GFGA 3FNFA 4CM5A 1JVBA 2NACA 2Q4BA 1ZXLA 2CF6A 1PJ3A 5TT1A 1V8BA 2CDBA 3UVEA 4JNKA 4YDRA 1UJMA 3PLNA 4XQEA 3QV1A 5JYFA 5DCYA 1E6WA 1CERA 1HXHA 3U4IA 4K6CA 4ALKA 2IZ0A 2VQ3A 3KO8A 3VPSA 4ND1A 4NBWA 2Y93A 1RPNA 3HQ4O 2X0RA 4TWRA 4NU6A 4PLWA 3JCZA 3GLQA 2J3IA 3DR3A 3PYXA 2W2KB 2ZJ0A 1GQ2A 5EQDA 4Z9FA 4HFJA 3FPCA 3BMNB 3VH1A 2UYYA 3SLKA 1B15A 3E9NA 4FFOA 4H16A 5G4LA 2G1UA 4AJOA 5TC4A 4CQMD 1NQOA 2EW2A 1ADFA 1LUAA 2C59A 4BL5A 2RCYA 4YT5A 5DT9A 4OL9A 4YB8A 1GFSA 4KZPA 4J7XA 1IOLA 3HG7A 4K9DA 3VH2A 4JIGA 5T67A 4CV3A 3BTSA 1ADGA 3HN7A 3MOGA 1VJ0A 4XZ3A 1XHLA 1N8KA 3S2EA 2DUWA 3L9XA 4CMGA 2Y1EA 3OH8A 2Y99A 5FYDA 5I7EA 5FEUA 4XD2A 4CMAA 3GVXA 4QFCA 1MFPA 2AMFA 3TOXA 4BNMA 3PQEA 3BTUA 4BNFA 3CZMA 3OJEA 1IPFA 5JBIA 2YJZA 3AW9A 4C7KA 4E5PA 2CY0A 4DC1A 5L51A 4RVFA 4ROSA 3ZV3A 4Q3DA 2IE0A 4E2WA 4PVCA 4RCVA 4XA8A 3PHGA 4UUOA 1C3VA 1C14A 3BXXA 4RPKA 3IDSA 4LCJA 3GN2A 5MDHA 3HWRA 4OYRA 3DTTA 4IDEA 4OOEA 1EVYA 2UVDA 2VTEA 4BNKA 2NTJA 1HDCA 4UUPA 3K2BA 1UP7A 5F5NA 1EDOA 4W99A 4XGNA 2JCVA 3QE3A 2P68A 4L75A 5CEEA 4D44A 1NPYA 3PWZA 4PLHA 1F12A 1YQDA 4J0EA 2AHRA 1ZNQO 1U9JA 2DTXA 2HRZA 3BTOA 3UFXA 3ZWVA 4GLOA 2NLOA 1ONNA 4CV0A 3RBVA 1YQGA 1V6AA 3WTBA 2QG4A 1VPDA 1GY8A 1EFLA 3VVCA 4CM9A 1JA9A 3DZHA 5KJ6A 4FOOA 4BQPA 1GQQA 3ICCA 2J3JA 1WZEA 1UR5A 3WGYA 2FY8A 2O3RA 1UXJA 1LDGA 3I9LA 5C7OO 2JFFA 3V1YA 4GWKA 1R0LA 2B36A 3FR8A 4J1TA 1C1XB 4WLEA 2X0IA 1OI7A 3ZZNA 2AEJA 4GX1A 3JQCA 3V5NA 4P8RA 2O4UX 1Z7EA 3ADPA 4B4VA 3JQBA 3KSDO 4CLEA 2GSDA 3DBHB 3HUDA 4JP2A 1XCBA 1CF2O 3QWIA 2ZB7A 2AQIA 1J0XO 1N92A 4AL4A 2DTEA 3QVWA 1QORA 2X7HA 3U4CA 3ZGYA 1WZIA 2BI7A 5BSGA 5T8KC 4YR9A 4WLFA 2P4HX 1GU7A 3NX4A 3KYDA 4OHUA 1RYEA 1B3RA 1I30A 3JQFA 4RVGA 4CUKA 1GTMA 1ZVMA 2DTDA 2WYUA 1I36A 3NDJA 5A03A 3CPSA 3QVXA 3JD3A 4ZA2A 3PI7A 3D7LA 4IJVA 4RQTA 3RAJA 3WG9A 2IXBA 2VNAA 4O59O 1O0SA 3DBLA 4IDFA 3RC2A 4BHTA 1P9LA 5DOVA 1HLPA 2P9EA 1T4DA 3LVFO 1KEWA 1LSSA 5L4LA 3B70A 1CWUA 2DBVO 3WX0A 3L07A 2IXAA 5GZ6A 3VHRA 2PZKA 5FI5A 1DFHA 3DDNA 3S8MA 1D4FA 4J16A 5JXWA 5L40A 2B69A 2VN8A 4R9SA 5A5FA 4WKGA 4UAGA 1V3VA 1U3VA 1ZK1A 2Q99A 3ZNQA 1X7DA 4R1TA 3COSA 4LSMA 4FQ8A 2AEFA 3DZIA 4DLBA 3OSUA 4PLPA 2Q45A 4U5QA 3MJTA 4MKXA 1U5CA 5A3JA 5TGDA 1O94A 4CMEA 4Q39A 2VOJA 3DXFA 3QY9A 4OJNA 1B0AA 1DXYA 3AY6A 2P91A 3OIGA 3KBOA 1RM5A 2C20A 2JD1A 4KP7A 5TX7A 2HLPA 1ENOA 1E3EA 3O9ZA 4L73A 4PVDA 5A4DA 5FF9A 2DQ4A 4OXKA 4UREA 5COQA 1ENYA 3M1LA 2Y0CA 3AOEC 3GAFA 3I6IA 4PLTA 3WQSB 4HWKA 4MKZA 4R3NA 1PZEA 1H6DA 4RPHA 3WSVA 4AG3A 4G5HA 3VDQA 5DF1A 1E1KA 4A26A 1IPEA 3DOJA 3FNHA 3WWZA 1Z82A 5U4QA 2EV9A 2W2LA 4CL3A 1YBMA 5EPOA 2GUGA 4R5HA 1PQUA 2VRBA 4Y8VA 5LCXA 1CQIA 1FMCA 5L3ZA 2PY6A 1ID1A 4XQ9A 4E2ZA 3GRPA 1T2EA 5A06A 3EDMA 1BDMA 1U2GA 1BXGA 3MEQA 5IDWA 4NPCA 2JD0A 3CMCO 1DLJA 2X9NA 1ENPA 4M54A 3PJDA 3GN1A 4BNTA 4U7WA 4GL4A 2OGUA 3ENKA 1R4NA 2TMGA 3AFNA 1GV1A 4BGUA 4BUCA 1NFFA 4PIVA 1B8VA 1LJ8A 4QT0A 4QXMA 1DIHA 4TQGA 5K0ZA 1TVEA 3H65A 2P5UA 5KTKA 4J3FA 2BGMA 2HQ1A 4HKTA 3L9WA 4J2OA 2DBZA 3BMQB 2D1YA 1C1DA 3OBBA 3A28A 4XEHA 4YWJA 1JAXA 4BKPA 1C0PA 3HB4X 2CDAA 2Y1GA 4I9NA 5BT9A 1UXHA 3V2HA 1N7HA 1VL6A 1QV6A 3INGA 1I8TA 1NYTA 5JDCC 4ZQFA 4Z9YA 2O3JA 1U4OA 3JQ6A 1JTVA 4YBZA 3VTZA 5TIIA 2EKLA 1NWCA 3W4KA 1X14A 1YBAA 5JLAA 4AVYA 1ISMA 2GGSA 4OIMA 4OSPA 5KVVA 1XG5A 3JQ9C 3GC6A 3C1OA 3U4DA 4RVUA 2RAFA 4RZHA 2ZB4A 4E4YA 1E5LA 2YQ4A 1ZCJA 1MFZA 1YWGO 2BFPA 4HBGA 2Y1OA 5KJ1A 4XRRA 1E1NA 2PGDA 3ZHZA 4BGIA 3F4LA 4CUZA 3U62A 1SOVA 3GRKA 3HFSA 2HJRA 2H63A 4HFMA 4J90A 5HBRA 3RI3A 3RSHA 3UAGA 1Y81A 1GCOA 4UEJA 1R16A 5U9CA 1NTOA 2ZKLA 4BKOA 4ZU3A 1EK5A 4NJOA 3LYLA 4WGGA 3VDRA 1HZZA 5F1PA 1HWYA 1XR3A 4NBUA 2JFGA 2V7PA 3RQSA 1U8FO 3EC7A 4XGIA 5MGBA 5TQVA 4D3SA 4JQCA 4FSHA 2OBNA 3OA0A 3NJ8A 1HKUA 5LC1A 1G1AA 2Q1TA 4AJ1A 2CVQA 3KRTA 1F14A 3FWNA 5F1OA 1E5QA 1Q7BA 5EESA 3H6KA 1VJ1A 4FC7A 1HSOA 3KSZO 2C5AA 1W73A 4GKVA 1JQBA 4E21A 1HE4A 4FGWA 3GVHA 2B4RO 4E2XA 2WE8A 4NQZA 4B3JA 3FBGA 2NSDA 4G65A 2GDZA 3PIIA 3S2FA 1P1KA 2NQTA 4BO2A 5CFZA 1PZHA 2YW9A 4KDFA 4N7RA 4IZHA 4E33A 1KVRA 1ISHA 2SCUA 2VHYA 5G4KB 5CEJA 2PD3A 3TWOA 1YJQA 4R3WA 1A7KA 5AXCA 3C7CB 2B37A 1MXFA 4GVLA 4FJ0A 1I32A 3JD0A 4CV2A 4RDIA 1Y8RA 2RHCA 4CMEC 3L6EA 5I9NA 1PJ2A 1BTOA 4IGFA 3WIEA 4BO9A 1E92A 5KOIA 1CYDA 1JLLA 3R3JA 4QECA 5ADHA 3GG2A 2IYPA 4XJTA 1DEHA 3PFFA 3K92A 1QR6A 2ZB3A 4IIUA 3H4VA 1GQYA 1T24A 3GOHA 1YRLA 4QO7A 3ZNOA 4YYZA 2VZ9A 1UP4A 4Y9DA 4R1UA 5BSHA 4A2CA 3ROMA 1Y7TA 4LRTB 1U7TA 2I99A 1OMOA 4HFNA 4OMUA 3VPXA 4BO6A 4OGWA 3IC5A 1BW9B 4CMIA 4TVBA 5KIAA 3W8DA 4JX8A 1OBFO 4CLXA 2EGGA 4D45A 2BF7A 4FGSA 1Y5RA 3PEFA 4TROA 3ON5A 2UAGA 4O0LA 2VOEA 1NVGA 4ZICA 4M55A 2DLDA 2Q2VA 3R0IA 4RVDA 8LDHA 4E13A 4ZHSA 1N9GA 1ZSYA 1SO8A 3G1TA 5HS4A 2DFVA 1DC3A 5L4SA 1LC0A 1A5ZA 1G6KA 3L4SO 3W4IA 1KEVA 1B16A 1E3WA 1Y9AA 3WGGA 1KVSA 1GZ6A 4BNUA 5ICSA 3GNSA 3TRIA 3U5TA 1ZK2A 4KMSA 2HMSA 1P45A 2AA3A 3U3XA 3JTMA 3H8VA 4ALJA 4FOSA 3JYNA 3BHMA 3FTPA 3IJPA 3PJFA 1CIVA 4BGEA 4IJUA 4BV8A 3FD8A 6ADHA 4IDGA 3IOYA 5AOVA 5GZ3A 3ROQA 4IDCA 3AUTA 3PWSA 1C0LA 5C7LO 3KV3O 3A4VA 4IQ0A 4XKJA 3H5AA 3H7AA 3EMKA 4J4TA 1Y6JA 4WEOA 2NV6A 3F1KA 4DREA 5IXYA 4J91A 1LLDA 3WJ7A 4CQMB 3D0OA 3I83A 1NQTA 3GH3A 3RUIA 2Q49A 4LMPA 4NR0A 1YDEA 4J0FA 1QYXA 3AUUA 4Z0PA 4YXFA 3WBBA 4XYGA 4CLRA 2J5RA 7MDHA 1GUZA 3NYWA 1MG0A 2X9VA 2HAEA 2Y67A 3GHYA 1H6BA 4YJFA 1LBEA 3UCFA 1KEUA 4I9UA 2GN9A 4GKBA 2C29D 3R6DA 4I5EA 2B5WA 4I8XA 3S1LA 1X0VA 2OBYA 4OOFA 2B83A 2OXIA 2JAPA 1BRMA 1S7CA 3ZWMA 1O5IA 5H81A 3SJ7A 4IGEA 4WLOA 1J6UA 4HADA 3GFBA 5KVQA 4DPKA 3HDQA 2Q4EA 3RUEA 1HDYA 4IZIA 1DIBA 1I3LA 4KUGA 1XWFA 4BNJA 2O2SA 2QYSA 4NFHA 1E7QA 3UN1A 5JPIA 3JD4A 4GMGA 1XEAA 4GGOA 5EL0A 4AJLA 4WE3A 3EVTA 1LLQA 2FZEA 1P1HA 4I9HA 1XSEA 3QIVA 5G0WA 3GDGA 2PR2A 3G3EA 4IS3A 3C85A 3O8QB 4J43A 3PYMA 4RF2A 3ZWOA 4BVAA 1ZW1A 4LRSB 2I9PA 4CLOB 3C24A 3CUKA 2J5QA 2VRCD 3H3JA 2GYYA 4YAJA 1VI2A 3NUGA 2PGLA 1YBVA 2D2IA 1E7WA 4PLVA 4EI2A 2DUUA 2HK7A 2G17A 3ZWBA 4WNIA 3ZHXA 2EF1A 1PJLA 4XCVA 5TS3A 3UH1A 3JQ7B 1KEPA 4ND3A 3WIDA 4RJTA 5A9RA 5U1PA 1UZLA 4JROA 2QRKA 4XGKA 2JCYA 4BO4A 2FHSA 1YKFA 3TSCA 3MJCA 5JDCA 4PG5A 2ZCUA 1EVJA 4JLWA 2HSDA 5CPFA 2WD7A 3I5MA 3PDJA 2CDCA 1D7OA 3CH6A 4ZQGA 3RC9A 1AXGA 3L0DA 3MWEB 1I3MA 1PJQA 3ZU5A 2AW5A 4BB6A 5HTOA 1DLIA 3D3WB 2NNLD 3UCXA 2FP4A 3IKTA 3ZU2A 1DPGA 2AE2A 1ZO8A 3QJ5A 1WW8A 4XWYA 2PK3A 4MO2A 2X5OA 4BKRA 5JYDA 1HE2A 1H5QA 1I2ZA 1T2DA 4B3HA 1GD1O 1F8FA 4OXYA 3W4JA 4OKNA 4F6CA 3E6AA 3RFVA 3PP8A 3U4HA 2E37A 3WYEA 1WVGA 1EVIA 3U49A 4FFMA 1RKXA 3WICA 2VUUA 4CR7A 1KC1A 1ISGA 4CJXA 4DMLA 1EUZA 1KVQA 1KY4A 1Z45A 4NK5A 5AQ1A 5I7SA 4YT4A 4IDAA 4GX5A 2XPCA 1O9BA 1PSDA 3RC1A 3O26A 4D41A 1N1EA 2WYWA 3GNTA 4J4HA 4D3DA 1YL7A 1GAEO 1PGPA 1F17A 3H3FA 3L6DA 3VKVA 2GN8A 1LDNA 4A27A 3K6JA 1ISIA 1LSJA 4ILKA 5KJFA 1HSZA 1WDKA 3HHPA 1LSUA 4GSLA 1RJWA 3D4OA 2C54A 4I5GA 3AFMA 4KWHA 1SMKA 1LRJA 4NJMA 1EUDA 4IXWA 4ND5A 2GR9A 4RPJA 2DC1A 3DAPA 1H6CA 3I4CA 1ZK4A 4M49A 3KUXA 3WJAA 4BNYA 5JO9A 4Y6RA 3WNVA 5CDGA 2B5VA 3TF5A 4PZDA 3O4RA 2CF5A 4XDYA 1U1IA 1ENZA 2QX7A 2NWQA 4G2NA 5T5QA 3SXPA 3KEOA 4O63O 3RU9A 4UEOA 2AQKA 3I4FA 3E9QA 4D79A 4PN3A 3G0OA 3Q11A 5IXSA 2W4QA 3MCVA 1ZBQA 4IQGA 5BNTA 5BSEA 2LDXA 1UXKA 5BSFA 3NT5A 9LDTA 2C07A 3A06A 3SEFA 4CLDA 3IL2A 4JBGA 4ALLA 4LW8A 2X9GA 3G1UA 5FI3A 1IYZA 3RUAA 4LSWA 3TJRA 5AVOA 3K31A 3OF2A 3DAGA 3BMOB 1E7SA 2C5EA 3I1JA 3GGGA 4CQLB 1NXQA 1GV0A 1BXZA 1U3TA 3UKOA 5EERA 1GEGA 1IHXA 1LC3A 5L95A 1K6IA 1UDAA 2HCTA 1IE3A 1ORRA 2Q50A 3CMMA 1O95A 3GEDA 4AJHA 3WGQA 4CMKA 3WGZA 1R4MA 1PJSA 3I9NA 4L76A 2WDZA 1H2HA 4FJ1A 4QTZA 1PL8A 3RCBA 3VVBA 4CMCA 1GUYA 3ZI0A 3OICA 3C7DB 1GZ4A 1P1RA 2X5KO 1VRWA 3NKLA 4DUPA 3RD5A 4YJFB 2NU8A 4R1NA 3KYCA 1FDTA 4CODB 5JE8A 3ZWWA 3V1TC 1MUUA 4IPTA 3QWFA 3VZQA 3ANNA 3UOGA 1U3WA 5IFLA 1GUFA 1OC4A 3H9QA 4J6FA 3JQ8A 4N5NA 4WJZA 3AU9A 1Y5MA 4CQMA 1E3LA 3PWKA 2H9IA 1IULA 3ZCXA 3AUSA 1Z73A 4IUYA 2Y68A 2BFOA 4E2YA 1R0KA 3F4BA 4EUFA 1JVSA 4XJSA 3B6ZA 2Z5LA 1JKIA 1DIAA 5IDQA 1DHTA 4BO5A 2IRWA 4U8GA 5DZSA 3N7UA 1RM3A 3FRJA 4Z6KA 3DWFA 3WLFA 3LC7O 1A71A 5DBIA 1NASA 3VH3A 2PZJA 2F00A 1UAYA 4LMRA 3NDRA 4BO8A 4D3FA 1ZJZA 1PX0A 3DZJA 4ZRMA 2HDHA 1BXKA 2NVWA 2A9FA 4U0KA 2FSSA 2QYTA 4LISA 4RQUA 1LX6A 1QSGA 5I9LA 3JD2A 4OAQA 5A05A 1XQ6A 4EBFA 3C8MA 3ZV4A 3DHYA 1YL6A 1QKIA 4KTVE 2P2SA 4HNGA 5KVSA 4RDHA 3WFIA 3EUWA 3JSAA 4CPDA 2D3TA 2EWMA 5JMPA 3I9OA 4EGFA 1WLYA 3AI1A 2Q3EA 3VC7A 1W0CA 3C1AA 4BMSA 1LDMA 2OMEA 4Q3EA 3ABIA 1R6DA 4FB5A 5HS6A 4BO3A 3DZFA 3ZWNA 2VNSA 4BNIA 3QW2A 3FF4A 3V1UA 4WPGA 5JFOA 2G0TA 2NVUA 1EEHA 3H5RA 1KVUA 1NBOA 3DEYX 1SB8A 4ZGWA 2A94A 1DAPA 5LDGA 4JBIA 3TDKA 4BNVA 4NBRA 3NTRA 2AQ8A 2AE1A 4RF4A 4EJ6A 1YS4A 1O6ZA 4PLYA 2UUPA 1JWAB 4B3IA 1RM0A 2ZB8A 3DMYA 2FR0A 3L4BA 1HE3A 1ADCA 2X0JA 4NIMA 1Y8QB 2CFCA 3ROKA 3Q2IA 1P0FA 4N18A 1GYRA 1YOVB 1DFIA 4P4GA 5DCWA 4DIFA 3ETDA 4MVJM 3VZRA 2ZQZA 1V0JA 1SEPA 4RZIA 3FPLA 3KM0A 5CHEA 1GYQA 3BMCB 3KSUA 3TZCA 2Y0DA 3AI2A 4JK3A 3M2TA 3TL2A 3MTJA 3LQFA 4BNLA 3GEGA 2O50A 3OETA 4ZD6A 1H6AA 5GY7A 4YVFA 4R69A 2VWHA 4RPLA 4BMNA 1PL6A 2RH8A 1CRWG 3RIHA 4DGSA 5JNLA 1ADBA 3GVIA 4I5FA 1QYWA 3C1TA 4HP8A 3STHA 3PXXA 3ZHYA 5DDIP 4PG6A 1JWBB 3WWYA 1QYDA 1TI7A 2V65A 3ONFA 3KTDA 4NJMB 2PWZA 5HA5A 4DL9A 3DHNA 4CLHA 2VWPA 1D3AA 1YOVA 2O3TA 2QIOA 5T57A 5JAIA 3C7AA 5AXBA 1Y8QA 3LLVA 1VE9A 3DO5A 2CVOA 2BGKA 3JQDA 1J4AA 5IG2A 3E82A 4RORA 3X2EA 3UHAA 2HO5A 1WMAA 4RVHA 4A5OA 3EVNA 1LQUA 1RYDA 1A9YA 1YDWA 1YL5A 3RC7A 4UUMA 2NU6A 4J1NA 3SC6A 3CINA 3LSYA 2VYND 3WQRA 4BNGA 3FNGA 4R41A 3GVCA 3L6OO 4QUKA 2NVUB 3TFOA 3NDIA 4F3YA 4MP3A 4PLFA 4WCDA 2I3GA 2B35A 4KDEA 1MG5A 2G82A 1X15A 3EHEA 4GX0A 3P2OA 4XQCA 4DVJA 3GNQA 4A73A 4MVJI 2QW8A 3BHJA 3O03A 4BS9A 4DYVA 4YRBA 3HNPA 5A04A 1U28A 3WGTA 1NR1A 4FFLA 5CEFA 4G81A 2VHVA 1GR0A 1FJHA 1QMGA 2WM3A 3LT1A 1WDLA 5G2OA 2DVMA 2PD4A 4Q3CA 1PS8A 2EW8A 3E5MA 3M6IA 1N2SA 5H83A 1VKNA 4JBHA 3D3WA 3EZLA 3PPIA 4INAA 2DPHA 4AJ4A 1V3TA 4J2HA 2P4QA 4P4NA 2EGHA 1PS9A 1Z74A 3WMXA 3ZDFA 3DC2A 5AYVA 1C1DB 4HV4A 3D5TA 5JY1A 1ZK3A 4FFRA 3QWBA 2CUKA 2Q2QA 3DZGA 1P77A 4XDZA 1SCUA 4R5MA 4MVJG 1E3SA 2ZIZA 4K6FA 4TRJA 2O3SA 3WQQA 5CDSA 3W8EA 4XX0A 1YB4A 3RWBA 3R3SA 4XYMA 1A72A 1EQUA 4W82A 1YVEI 4E5NA 4N54A 5JY6A 4EZBA 1SOWA 3PHHA 5J9GA 2XF8A 2VRCA 3PQFA 2GO1A 3UF0A 3U9LA 3WXBA 2FPPA 3ZU3A 3T4XA 4MDHA 5A1TA 5DCUA 1WXDA 1XDWA 4Z0HO 3JQ8B 1R0SA 2Y0EA 3L4BC 3EAGA 6LDHA 4TMFA 1KC3A 1U5AA 3HB5X 4AFNA 4GQAA 1YH3A 4M89A 2I65A 1V9LA 1HLDA 3KYCB 4GH5A 3QQPA 4ALIA 4MJLA 3AJRA 3ZWXA 1ULUA 5B4TA 2BKAA 3GDOA 2EKPA 2PV7A 4NDNE 2VCYA 4DQVA 4A10A 4EEZA 1ONPA 2EKQA 2VWGA 3HJAA 4J1QA 1LSOA 2AEMA 1VL8A 1B14A 2NQ8A 4PG8A 3H5NA 3MJEA 4AJIA 3PQDA 1QRRA 5F1KA 5IAAA 2OFPA 1FK8A 3F6YA 3KB6A 3W8FA 1K5HA 5I8WA 1I3NA 1H93A 4LGVA 2PGJA 3EW7A 5ER9A 3MZ0A 5ER6A 1PU2A 4ND4A 5K9ZA 3BMOA 1AXEA 3ONEA 4CLRB 1UZNA 5AXAA 1YGYA 3HADA 4Y6SA 2OORA 4RV9A 3B1FA 1Z7BA 1TB4A 2HU2A 4N5LA 1HRDA 3GDFA 3TZ6A 1P31A 1EDZA 1DOHA 5B37A 1EVZA 5BNFA 1TXGA 3V8BA 3B20A 3A1NA 4B7UA 9LDBA 4NI5A 1ML3A 2VZ8A 4DC0A 2GN4A 1NFQA 2C2XA 4ITUA 3TL3A 1XA0A 4XYEA 1QP8A 4KUEA 3WTCA 5DN9A 3UCEA 4GMFA 3HDYA 4WEQA 3IIEA 4GX2A 4GBJA 2UV8A 3UXYA 4EUEA 1E1LA 2J5KA 1DO8A 3BTVA 3OIFA 2YV2A 4K1LA 3JD1A 2PH5A 1EBUA 1Z75A 2EERA 1LLCA 4W7IA 2GNAA 1MV8A 5F5LA 3OJFA 3EY4A 3WNQA 3KEQA 3U0BA 2OP1A 3GHHA 4GAEA 1X7GA 3GR6A 4NBVA 3D1LA 2NTVA 1K6XA 1UZMA 4F46A 2FR8A 4R68A 2DBRA 4EJ0A 3ZU4A 3H9EO 2ZTVA 3ORFA 3GEMA 3G17A 4ALMA 2AXQA 2E4AA 2DU8A 3HDJA 3JYQA 3JQFC 3T7EA 3V2GA 5B4VA 2HMWA 3IMFA 2HK9A 1MC5A 2NUAA 2FSVA 2J8ZA 2Y1FA 3TZHA 1X13A 1YONA 1SZJG 3OQ6A 1U7HA 3ENNA 5L53A 1F06A 3GPIA 4BNNA 1YB1A 4J7CA 1G0NA 2NU7A 1M6HA 1V35A 4TZTA 4CMHA 4GGPA 4YCAA 4II2A 5G0UA 1T25A 3RROA 5ITVA 1ZMOA 2HK8A 3JQBC 1NR7A 1QYCA 1AE1A 4W9NA 1EBFA 1J5PA 2EXXA 4XRGA 1TT7A 4TSKA 4ESOA 4QO8A 4WK6A 2I5PO 3MOIA 3ETGA 5EMHA 3PGXA 4Q3AA 1IL0A 4TRNA 1ULSA 4QSMA 2BGLA 1E6EA 3LZ6A 4RLSA 4RO0A 3Q3CA 4OQYA 4AICA 4S1VA 1Y8RB 2CMDA 1Q7CA 1UXIA 3VPHA 1OFGA 1HZJA 2CSUA 1LDBA 2OHXA 2WD7B 5KJCA 3K96A 1I3KA
chains in the Genus database with same CATH superfamily
3EFOA 4OJTA 3FDIA 1FFSA 1QIGA 3LTEA 3K0AA 1KJQA 2RCNA 7ADHA 1DAIA 3SDZA 1QHSA 1XZ8A 1OXMA 1D6SA 2NM0A 4B7CA 3NHJA 2X86A 3WS7A 1O97D 2BV3A 5ED4A 3AR4A 4PZZA 3MCZA 2KJQA 4ETMA 3UHJA 1X7YA 4EI7A 2ZS8A 3D64A 3RO7A 3VA7A 5JZMA 1E7YA 3LT5A 16PKA 4FFNA 1GQSA 4HYQA 5BSMA 2C42A 3DTNA 1I4WA 1PWHA 4B7AA 4RD3A 2W5UA 3A05A 1XZFA 1XL1A 1AO0A 4LV6A 5K4GA 3O8QA 3UMRA 2ZRBA 3PKZA 5EHZA 1KOLA 4E22A 5L3SA 4YAUA 1ECCA 1I33A 4B3DA 1ZRSA 3KETA 3BMCA 2ZWPA 3DDZX 1Z6GA 3T6KA 4YCMA 3K73O 1M72A 1UMBA 2R2AA 2HTEA 3LX5A 3R5TA 1Q1QA 4JI6B 4GBMA 4PM4A 3MLBA 5EKXA 3ABOB 4JUCA 3SBOA 2XMZA 3L1JA 2WKQA 4KQIA 1PGOA 4GS5A 5MN5A 3H8WA 1MJHA 3KV1A 3KLMX 6NULA 2WLTA 3FYUB 4IOMA 2XTZA 4BLWA 2X0EA 4R54A 3Q8MA 3C6YA 1BIFA 4X3CA 4QELA 1R37A 3VKFA 3T0FA 2ZYAA 5LKRA 4P32A 2Z08A 3WBKA 1UP6A 2Z98A 2PSDA 3SIPA 2QRJA 5TMEA 1OLXB 2BYTA 2WM9B 4IVRA 3HKCA 2VRWA 2M6KA 1SXIA 5JNSA 4JYAB 2XB6A 4BFUA 2HKIA 2FEPA 3ZD7A 2P5TB 2FK8A 2IWRA 2VK4A 4QUJA 4ERNA 5CM9C 3GF4A 1NUTA 3W6UA 4CU5A 4EGQA 1SBYA 1T26A 4CKCA 5ECDA 3RE1A 4KLCA 3RV4A 2BLLA 2QQ5A 4DWJA 3MD0A 2FWBA 2JANA 1J2UA 1LB1B 4FZJA 4P53A 1TVMA 2QMUA 3DTVA 3GJ6A 5CT5A 5KSZA 1PZXA 2B1QA 2XB4A 2IODA 1SVSA 1V7QA 1NYQA 3EGIA 2IYFA 1G5TA 2YYYA 2FF7A 1EWRA 1UIRA 3AFIA 1J8DA 2P79A 3B53X 1K8ZB 3E4DA 4UDOA 3CZPA 1P1FA 1CD5A 4Q9LA 5HUQA 1A8IA 4MZXA 3HBLA 4JYPA 1IAQA 3PNLA 4OLHA 2IYAA 2CFTA 2QR3A 2VHJA 3LT0A 3M81A 1KMCA 3PX3A 4DTIA 1SXJE 4I4TA 3Q9NA 4YUXA 2PE5A 5ALEA 3RSQA 4ZO4A 2JI9A 1UDBA 4B3FX 1QHYA 3D6NB 2AK3A 3MFQA 4PCAA 3TXXA 3U09A 3BMQA 1D2EA 4BU1A 4PZEA 5SZIA 4MR9B 3O94A 3CXRA 4PNEA 3EIEA 2G6TA 2WRZA 2V7QA 2E48A 2I7VA 4LDQA 2NZXA 4GUDA 3WAKA 10MHA 1P4GA 1BMTA 5HKKD 5HKOA 4WVLA 4D46A 4E32A 3DH0A 2WK1A 4P1ZA 3ZGLA 4JOBA 1FY2A 2JJQA 3CO0S 5DB4A 5KO2A 2R7NA 1RXVA 5MN6A 1FMLA 4BAUA 5IJZA 2GCOA 2WHQA 2IDKA 3G23A 3GIWA 4KPGA 4MV4A 4YDSA 3I3SR 1H94A 4R1MA 3SEAA 4MUMA 3I9MA 4BQFA 2XT6A 1BEEA 5B3LA 5F23A 1D2RA 4J1SA 1Q3KA 1U2DA 2ZOSA 2PWAA 5CH3A 2G9RA 1Q1GA 1UWLA 3RK4A 1NNSA 1MAHA 2PGIA 1G5IA 2JEYA 4E0BA 1EG2A 1ZLYA 4C0QC 3HB1A 4G5XA 3WGOA 5EWMA 1SOMA 1ZEJA 2PT7A 4NXMB 2XBUA 4NZ9A 1W75A 2VHCA 2Y0BA 3G6WA 3HJNA 4HLQB 4Q03A 1AM4D 1PJBA 1BX1A 4BASA 1ZJYA 4TSFA 1HTBA 2Z09A 3IURA 3RUPA 5FOVA 1VMEA 5BYJA 4UXJA 2IHZA 1UBRS 4F2GA 4Z4QA 4FWTA 5KUTA 2PWPA 3ETLA 3GRRA 4MYDA 3S1AA 5IXJA 3BD9A 4DEYA 1Y8CA 2GVNA 2OSBA 1MDFA 1R4MB 2H00A 3CIOA 1Z4QA 5AT1A 3DEIA 5AUNB 5AW4A 3THXB 1CIJA 3W7BA 6ABPA 2W6IA 1QX3A 3CEPB 3WI7A 1Q3TA 4M8NE 4W5NA 4IQ4A 2WIDA 2V55B 1AS0A 2EBWA 4HDKB 4U7GA 3GROA 3EXEB 1XB2A 5FLKA 5CXSA 2PCLA 1AS2A 3DLPX 1O9HA 4QUBA 1XQ1A 3WK7A 4TQUS 5LUAA 4TMVA 1MPTA 3AU8A 4ZAWA 3S8EA 1EJ6A 2L2QA 2X8LA 2YV5A 1VXOA 2Q9UA 5D3KA 3VO9A 3OZBA 3RK1A 3VKWA 1ZOPA 3IJRA 4CM7A 4QJBA 5LZ8A 1QLJA 5ILOA 4A6DA 1T5OA 1RMTA 4DSUA 4PRZA 3ENQA 1Z26A 5AUOB 2PUDA 3VZSA 4BNHA 2J33A 3P9CA 2QB5A 1ZD3A 2GA8A 5EE1A 1QG2A 2IFTA 2ADOA 1SZPA 1EVKA 2VJYA 1GAQA 2P8JA 1BFUA 1NF2A 3C6QA 5D6OA 1FNDA 2FW8A 3UT5B 3HJTA 4ZMBA 1QC5B 2MR5A 2MDTA 4FMDF 3WOHA 3D4LA 3H0KA 8AT1A 4J03A 1YF3A 3L8FA 1PVDA 2GXUA 2PKEA 3ILYA 1US8B 3C3XA 3DCNA 4BQRA 2WWYA 1NIJA 2XYPA 3INTA 3OZEA 2B99A 1HQCA 1DBWA 1PGQA 4IBOA 3PUIA 2IYZA 5L3RA 1EUDB 3CLUC 2VEOA 2ADMA 5LBTA 3EP6B 4Q66C 1JHYA 1X6VA 1HE1C 3GJ7A 3KYDB 6PFKA 1E63A 2OGTA 3M5WA 1XRLA 2ERXA 2ILTA 1JH8A 4LNAA 5ABPA 4RMIA 5IBPA 5I4KA 5D3MB 5IT4A 2F17A 3A6HA 3HACA 1TA4A 5ILGA 2O19A 3OOJA 1V39A 3NHYA 3Q7EA 5TRTA 3REQA 3ZH9B 4C0XA 4C7BA 3ZDQA 3M6XA 4G8CA 5IRCD 3U60B 1H8ED 1JPVA 3VHLB 3QKTA 4MR8B 1UL1X 3PC4A 1QDLB 3EXFB 4EB6A 4IHJF 3FNIA 2NO4A 1RWVA 4MUKA 4DIUA 5DP2A 1IZ0A 1SOAA 1WWKA 4WQMA 5EHGA 4JWKA 1DGQA 1T6BY 1WO8A 1ODKA 4WXMA 4U2GA 1LRKA 3DG9A 1EUYA 3ZHTA 1UOPA 3EGWA 1PFYA 1IZ9A 1KDYA 3RVRA 1EZ4A 2WD9A 3SSNA 2BP7B 4CCAA 4F96A 5REQA 2FLKA 2LKCA 3BXOA 1RD4A 5IF3A 3R9XA 1ES9A 5HMMA 5HTKA 4TWAA 2Q2OA 4AC9A 3Q85A 1PWEA 4Y2TA 5K0EA 4ZHQF 3CSDA 2H16A 4LI3X 2OEPA 1TVKA 3GMSA 1NF3A 2EFEB 2ZYTX 4TVOA 2JAXA 2BFMA 3C98A 3CY6A 3BIXA 3DBVO 1E1CA 1V8DA 2R0QC 5COBA 2A9VA 1OIVA 4H08A 2ONJA 5GOZA 1OJ7A 3AY3A 1A8PA 3CVJA 3ZV6A 4YASA 5C2JB 4KFRA 1P7CA 2QGNA 4ZO9A 2YWFA 4XWWA 1G66A 1J49A 1FF9A 3WWEA 1PR1A 3DFMA 1O77A 2AZTA 2WT8A 4WD3A 5JSFA 2Q1SA 2CUNA 4F91B 4LI0A 3EZGA 3ODPA 4W6QA 4DWVA 2ZYSA 2YV3A 3IWBB 1T3SA 4NTZA 3UPUA 2IZZA 1KZHA 3DD5A 3FOZA 4FIDA 4IJWA 1GPLA 2P69A 4WN3A 2RAVA 3TRJA 5GVSA 5JV5A 3B48A 1Y1SA 1YDHA 4XVQA 4QXPA 3VPDA 3CVXA 1BCSB 2P5YA 2XDYA 1OZAA 3JQ7A 5TF4A 4DLSA 2AEEA 2BD0A 4HGNA 3TD6A 3WLTA 1EXDA 3ENZA 1R4NB 1M1YB 1Z5PA 3HP7A 3MILA 3T34A 1P1IA 3E9MA 1KAGA 4K46A 5CA1F 3CLUD 1G8JA 1QZTA 1U1CA 4JXZA 4EVRA 2C2WA 5JVDB 2I67A 1CB0A 4JI7B 4KH1A 3U13A 2C9BA 1IZ7A 1ZI8A 5G0VA 1BXRB 3DTYA 2FFBA 2JNWA 1H2ZA 3BD6A 2Z1DA 2IKQA 2O4CA 3MUNA 4JGGA 5DPMA 3WK6A 4GEGA 3MJ4A 2ORED 4DPMA 3VDXA 1DCKA 4CM6A 4IOLA 3TSZA 4ZJUA 1BCRB 1SPXA 1I1OA 2ZITA 1UBHS 4W4TA 4HWOA 4FN4A 2BHLA 1P2UA 4M0CA 1JFLA 4NMWA 2NPFA 3WGLA 4WJLA 1ZHOA 4ASUD 1TUBB 3TE6A 1K0FA 1S4MA 2Q6LA 2WUVA 2YZ7A 3L0IB 4LC1A 4BB9A 2G36A 1QONA 4BZQA 1O7JA 3RS3A 5LOVF 3TQHA 1P6UA 5LQMA 3UK6A 1DB3A 4WCVA 2GLXA 4JJ4A 1LBIA 1MF7A 1IEWA 2JJ1D 1UAAA 1FOEB 1PE0A 3G6KA 3IPAA 4Y1EA 4NHEA 4X64B 1RPZA 4P3XA 4ZQEA 1IRXA 1KNXA 3V8NA 1KK0A 1E1RA 4ZALA 3F5QA 1GNTA 1PIWA 4NNPA 4FD2A 1ZUWA 1EIWA 5JC1A 3A9VA 4P7KA 5I4BA 5K0TA 3F9CA 3FW1A 3IIJA 1SC1A 3WHKA 1I94B 4RZSA 1DMRA 1JKMA 2EJTA 3G5UA 4HQRA 1YE3A 3V4RA 1W30A 4TUYF 3DF7A 3EZYA 4K9LA 3WSWA 1LPBB 1I6LA 5DRTA 4ITRC 4EMUA 5KDDA 2Q27A 2OO3A 5BWOA 3KPYA 2YY7A 4OQ4A 1A5BB 5TMBA 1XD9A 4XIYA 2NUPA 3V4VB 5HOQA 5J47A 3CIFA 5LXTA 4F4UA 3TI9A 5JS8A 1DWOA 4MK4A 1Z8DA 2Y6UA 1F8GA 3D8SA 5J23A 1SHTX 3W3ZB 2H48A 2JFVA 3F1LA 2Q5OA 3JR7A 4F6LA 5K4HA 2IEAA 2O20A 4R2KA 3KQSA 5EVCA 3LIIA 1TM1E 1ISSA 2EJVA 1NUAA 1U3GA 5M6DA 3K53A 4FGJA 1JYFA 4KW7A 4Q37A 3CNBA 3A6EA 3TOVA 1LLUA 1F8YA 2WU3A 5DBGA 3TPFA 1EFUA 1MT3A 3K0SA 2QD3A 4G3XA 2JGDB 4H60A 2ZJ3A 4JJFA 4OYHA 4RYDA 5CYFA 3R7DA 5KCZA 1TO2E 3K5PA 1KVTA 1K86A 1QIIA 1Y9DA 2IHBA 3NHFA 3P0JA 4LYDA 2YNMC 4UVGA 4ZOAA 1F2DA 5TGTA 3NTXA 3RBXA 3LY5A 3ROPA 2GF2A 2VPWA 4WEOA 1JUDA 1VSUA 1SG0A 1Z39A 1SIUA 3DBLB 2BRUC 3EIFA 2RKOA 2ZK7A 3CEHA 4NK4A 3PX7A 4HVLA 1M2HA 1R6UA 5EGSA 2XT0A 3IP3A 1SXJA 5IW8A 2UYQA 3BF7A 2ZYDA 5AUQA 3GMTA 3OU7A 4GBGA 2IW1A 2Y05A 3G0CA 1H3EA 2FQ1A 1BHSA 2HMYB 2IU4A 1ONOA 4ONEA 4YREA 4EJSA 2BJHA 1S3GA 5FPKA 3COJA 2XITA 1IONA 3ST7A 3II6X 4TTQA 4MWTA 3K94A 1YS1X 4IQ8A 4F3NA 1TQ2A 1X1TA 1N9GB 1YI1A 2AS0A 3HL4A 4OUDB 1QG6A 2WIJA 3DT8A 3WGJA 1R27A 3TGPA 3GPLA 1XZCA 3GUYA 4M1YA 2GPAA 1KP2A 2EP5A 2JCXA 2P2GA 5E1OA 4HGRA 1X87A 3F3SA 1GFWA 1CTQA 3RRYA 5ENDA 3W4JA 5TLSA 3G7NA 2QR5A 4HXFB 5DSXA 2F59A 2F3PA 1U0SY 1WUTA 5F5XA 1UJ2A 5BSTA 4KQWA 3SZMA 4C87A 5JNVA 3HN2A 2FV8A 3FLBA 1HNZB 3ZWAA 3C5HA 3PSHA 3ICPA 4Y67A 1OU0A 4UUNA 2XVMA 4YMUA 1I10A 2B9VA 5JYEA 4XD7D 2ZDHA 1QKJA 3BILA 2G6BA 4YRQA 4G4GA 4I46A 4OSOA 5EJGA 3RGWS 5LDHA 3UV7A 1AQ6A 5D5PA 4YJ2F 2BR4A 4D8VA 4C4YA 4NU5A 1RE1A 5D1HA 4LY6A 2FSUA 3WWOA 4QDZA 4DNPA 1E0DA 3GD5A 3UUWA 2J3LA 4MDFA 4LF9B 1ZH4A 4Q15A 2F55A 3IUEA 3P19A 4MRRA 3OBIA 3M4XA 1IUKA 2WHEA 3O8RA 3KKLA 3F6EX 4B6EA 4NICA 4KN8A 4WASA 1FVOA 2H1VA 3ABZA 3Q7TA 1LF5A 1WKVA 1FEZA 3N2GA 1NY6A 4N40A 2CLOB 5I7HA 2QORA 1LWOA 4DT1B 2R1UA 3FMGA 4ILEA 3EFBA 3GQVA 2D8AA 3PHBE 3I05A 2C4UA 5FBQB 3TB4A 1HQKA 3T1QA 2VSQA 3OCCA 1H0KA 1SUPA 1VHJA 1T3GA 1KSJA 2C3OA 3C3BA 3P0RA 5DBHX 2HPAA 3SYLA 2JBAA 4JJGA 1E77A 4PV7A 1PJCA 2AZXA 5J43A 4K03A 4FPXA 4UHEA 2IBMA 4F3CA 4PRKA 4DPLA 1Z62A 3M6MD 3ZNNA 5E3HA 3F5SA 4PRLA 3C7TA 2Q22A 3DQQA 1JEJA 2VP6A 4ER6A 3RC8A 4PICA 4IDBA 1L8LA 1YAHA 3GJSA 4RV4A 5BSWA 2FSPA 3UHPA 1W6UA 1ZHHA 4AZ3A 2ZSDA 3WLIA 3PE3A 1FUEA 2GEBA 2C96A 4MWCA 1TLLA 2ZUBA 4NP6A 2IV7A 2X6TA 4OHYA 4Y98A 3C39A 3VOSA 1UPTA 3MINB 4M9UA 1KZ4A 5IAGA 4PQEA 4ZO8A 3EGEA 3HSKA 1XP8A 3PJEA 4DQUA 3L8ZA 4PTLA 3Q7PA 4GOLD 1H69A 1QG0A 2J9YB 1DJOA 3HEBA 1WSWA 1NVKA 4GZLA 4R9VA 2NX2A 3QVMA 4B2LA 5DGIA 1H2AS 1W44A 4IXMA 4OQXA 4C3VA 5JSKA 3T35A 4F8JA 3RYCA 2VAVA 4NFSA 3OPYI 2E87A 1AD2A 2OHFA 3FZYA 4IOJA 4OJQA 4OYLA 3JZIA 4HC4A 1T9BA 2Q46A 3QGMA 4MIEA 4KIGA 1JXQA 4KMOA 1X77A 4RFSB 5F7ZA 3D5QA 2ZJBA 4KI0A 4YJGB 3EXHB 5JCJD 1XAGA 2OQIA 3M2PA 4LNHA 5FWXB 1N57A 2IQIA 2HRBA 3C41J 2P67A 5FIUA 2BFWA 4J49A 4E4RA 1IIRA 1OTHA 1PKEA 3ZCPA 1MGOA 3G9XA 5TPZD 1X92A 3EC1A 1A27A 2P9CA 1KQFA 2OYSA 3LUPA 1S2NA 1D6NA 4Y2YA 4LZPA 3A1UA 1HLFA 3CRQA 4WLVA 5C1IA 3E61A 2NO6A 3ZDDA 3ZLJA 1NI5A 4CMJA 3G8AA 2QMHA 1TW3A 1BX0A 2ZIGA 1K63A 4KFTA 4PXSA 4JKYA 3CG0A 4DIBA 4N5IX 2M6SA 1R8JA 5IDXA 3O8BA 2OZLA 3TTUA 3FGPA 2PLRA 3ULKA 2VUTA 2FPNA 3LQYA 1YXMA 2XODA 4B7XA 4ZOEA 1V7ZA 1W6RA 2BMAA 3PJGA 5KJCA 1RC8A 3QP9A 1YCFA 1YQEA 4WLUA 3RUHA 2JJYA 3V4SA 3K8ZA 5CK5A 1N6PA 4XXHA 4XFJA 5J9FA 4XYBA 1KIFA 2PAFA 4GLLA 1T4BA 1OT3A 1Q91A 5FL7A 2X76A 3NV9A 1Q0SA 4KQJA 2PX4A 2OWEA 2PMFA 3R24A 4KRGA 3TB6A 4ZQBA 3Q7QA 4QBFA 4JYMA 2WHPB 1U7PA 2IYOA 5EVJA 1EGVB 4ZC1A 3WL4A 2XDQA 3CPEA 3LDUA 4PAWA 1M67A 3PDCA 1UFKA 4LXXA 2X4DA 3AR3A 2GRAA 3THYB 5A7HA 3SQLA 4BWFB 3E8SA 2PBRA 4B85A 1JQEA 1LCIA 1CY6A 4Q1CA 3HE3A 3M6UA 3RKRA 5I7OA 2CVZA 1JPJA 4CQJA 4DMUB 2PBLA 1NI4B 5CNIA 4Q7EA 1E0AA 2J09A 1C29B 3INRA 3ZE8A 3ZY2A 4OB7A 1SCDA 1GZ7A 1W4ZA 2IP2A 3G5MA 2B9EA 3KU4A 4IFEA 5E95A 5IK2D 3P2YA 2GK3A 3I6BA 2ZBQA 1KHHA 1TYCA 1N5OX 2DOKA 5ELLA 3W9SA 3VR4A 3AVWA 2FCRA 4IMRA 4AULA 3CNQS 4CKBB 4JZYA 5JWRA 4AF8A 4Q0MA 5C5IA 3QX3A 5LMZA 1IHPA 3KD3A 4ZODA 3PE4A 4A15A 1GUDA 4HAOA 3NNNA 4O1MA 1GWNA 2D1FA 3OCJA 3OEHD 1KERA 2WAYA 1P3DA 1XEFA 3BH7A 4MRSA 5KX5B 4M1WA 4CL8A 2I2FA 3SYRA 1TUGA 4QATA 3T95A 2MINB 4PCLA 3TXAA 2Q1WA 1T5HX 3OM8A 2QPLA 2J3KA 2V8OA 3DLIA 5TVGA 4QM6A 4P5DA 4NYIQ 3ESDA 1XMOB 1WHSA 3NPMA 3WA7A 1C0EA 4L5IA 2PS9A 4PG4A 3G8CA 1DRVA 1BROA 5JT1A 3PFIA 3B36A 4GPD1 3QVSA 4GT1A 3BCHA 3OOWA 4WXEA 2RGAA 4C6TB 1Z36A 4KI7A 3Q0IA 4LJAA 4JP3A 3ZV7A 2OV4A 5CAEA 2JFZA 3DDCA 3FOAA 1W34A 1ZESA 3G2OA 4YWHA 2DBYA 3AUAA 1YTUA 2WJ6A 3M1AA 4KXQA 3NTOA 2E49A 5BWCA 4KE6A 3T4EA 5B5SA 2TYSB 3EZFA 4R51A 3Q41A 3MJVA 4ZKEA 3RNLA 1DIGA 4YRAA 4C3UA 4JB2A 2GH1A 4YJ3B 3U44B 2GRUA 4YJ3A 1LI5A 1FP1D 4YV2A 4MYRA 5K4AA 2O06A 4EUHA 1ZC4A 5AKXA 2IEZA 2ZR0A 3P9ZA 4OAPA 4DJJA 4XYLA 4BJHB 1DQSA 2GZ3A 1MKYA 2WWGA 2K6GA 4G5GA 4YGYA 2ZIXB 3QVTA 4WIAA 1CY1A 2ZYGA 3EWAA 1P6XA 4QHYA 1G98A 2WTBA 2AIRA 1NVMB 1NHGA 2C8KA 2OCLA 4QBGB 3U40A 4YO7A 4QNNA 1HL7A 1W5AA 3W2EA 4C4XA 4E5MA 2PU5A 2Y92A 2WKPA 3FR7A 3WVNA 4B0PA 5C7IO 1H22A 4JJ8A 1SC6A 4MOWA 4TV8F 3COZA 3K9FC 4EX6A 3M9WA 3NAGA 4EMSA 4YRLA 1VBMA 1UPAA 2YFQA 3O21A 1ZIYA 5E7JA 4A36A 1RIIA 3W06A 3AHDA 4JDUA 5LZ9A 1FFAA 1INLA 1HK7A 2UZAA 3RHZA 4ZI3A 4MQ4A 5J3JA 3L5OA 4XB1A 1KBZA 1YQUA 2VHZA 4M7PA 5DHQA 3WLLA 3SYNA 2IH5A 2ETXA 4GI2A 1BVUA 4X7MA 4E30A 1M2EA 1GL3A 3JPWA 1DC4A 1S4QA 4X62B 3FTDA 3DAHA 3RVSA 1M76A 1PEYA 4CL2A 1HE5A 4ALNA 3IP7A 2QUBA 4HDMA 2FSFA 2J6IA 2WSIA 2ZREA 1IHYA 3CLSC 4KYVA 4L8LA 2W90A 2Y4NA 4CM8B 4UTRA 3EP4B 4Y2XA 4JXKA 2NTNA 1H9CA 1V25A 1EJ0A 2JFQA 3NXKA 3QITA 4JLBA 1HETA 2C3PA 3EVFA 5F2EA 2C2HA 3ICEA 1YZTA 4A7PA 1JWLA 1VI5A 2PZBA 1VLLA 3TV1A 1BD4A 1ZCBA 1DTEA 3FDFA 3OUUA 4GR9A 4A3SA 2IYNA 3PUXA 1EFVB 2PUEA 1ZX1A 4RK1A 3PZBA 3NNDA 2Q2WA 1BS9A 1U5BB 5FOQA 1ICEA 3D3EA 1RHQA 2R3SA 3GY0A 4GM1A 2OCIA 4YDHB 2B5OA 2Z2YA 2PRYA 4CM9D 1DRWA 2CBGA 3NRCA 3GQBB 2ZATA 1C7RA 1JG3A 2PTHA 2N75A 1T2FA 5D86A 3C3CA 1Z0FA 1NVUQ 1NV9A 1QB7A 2OHIA 3EP7B 3T5CA 4KIJA 3W5SA 1Z2NX 1IXZA 3OY2A 1DCMA 1LS6A 3PFNA 1QGDA 1UH5A 2OXCA 4FYWA 2X1HA 3C3MA 1RLUA 4FFPA 4AYXA 2H65A 2Q3JA 2G70A 4IFIA 2GAIA 1OZHA 3K9CA 2LPMA 2Z8YA 5JC8A 3AILA 4DR1B 1YHZA 2GN2A 3ZLBA 3H2JA 1LK7A 1WDTA 1MQ9A 1GPUA 1NW6A 3L8CA 3OJLA 4H17A 4QTTB 4QYIB 1Z4OA 1D9ZA 1P5ZB 5CFMA 1JIJA 1IQUA 2QN2A 4YCDA 5EJ7A 4FCCA 1NX6A 1OI3A 2ZPTX 1U8UA 1NUPA 2Q3DA 3P2MA 4UNPA 3TE7A 3LBFA 1J23A 2CJWA 4DJFC 2OILA 1Y3IA 2YICA 2EU8A 3A4LA 1ARZA 1NQAO 3JWJA 2V6BA 3DV9A 3PHJA 4M37A 4HWTA 1VSVA 4LFCB 3EGXB 3UJ3X 5ALNA 4E5KA 5AVJA 2L82A 4MW5A 4P58A 2GF0A 4MGEA 4B4UA 4K88A 4H3SA 1E89A 5CP8A 1BFDA 5CGZA 3QUSA 4F4CA 5K2OA 1EHIA 4FHZA 4TS1A 2ROQA 3VOTA 2JIZA 3FNFA 4KB5A 1RI4A 4M9CA 4DY6A 4Q48A 2QMEA 4CG1A 3P1JA 3LPLA 2QW1A 5JFTA 5TT1A 1AVTA 1D2MA 1KHTA 5KYYA 2ZIFA 3HKDB 3RJTA 2CDBA 4JASB 3UVEA 3R3VA 1I4EB 4PTYA 3S3TA 4D9EA 4RWZA 4OP3A 4D4JA 2Z4SA 4FVTA 5T6MA 4ZV4A 3CHYA 3EEYA 5JCZA 1MO5A 3E7WA 1ZIXA 3QOFA 1KS2A 5BRJA 4IIEA 2R6CA 2O2ZA 1U8TA 3NDPA 4OQDA 4LV5B 4QREA 4ZEVA 3D2AA 3KO8A 1CBUA 5FFMA 3IAS6 4Q9DA 2FN4A 2HWUA 1BWQA 3KDPA 3EA5A 3DKIA 3KKOA 2JDID 1E61A 2MT9A 3HQ4O 3P2KA 4ENTA 1Y4AE 2JRCA 1CR6A 1ZHFA 4FEYA 4GNKA 4R8VA 2B7CA 4ABTA 5JPCA 3PYXA 1YOBA 2ID7A 3SJAA 4IIBA 1U2PA 1VHQA 1YFLA 4HFJA 1GXSA 3QE9Y 2C4NA 3LK6A 2JGLA 3CN9A 4NS4A 1B15A 3KQOA 3LKVA 3SLKA 3DDSA 4Z7NB 2FUG6 1JDBB 2YY5A 1Z4KA 3NETA 4CQMD 4NYJR 1NQOA 1G7RA 1ZH6A 2EW2A 4KDRA 4S35A 4YQFA 5YASA 1J07A 3ZJVA 1T5TA 4BL5A 2ZDQA 1R5BA 5DT9A 2WY2D 4KZPA 4J0GA 4QTUB 2ZE8A 1T0JB 3CPHA 4LY9A 3SDSA 3E22A 2C92A 4EHKA 2YOGA 4JFRA 1JI3A 4JIGA 2OR3A 4IZ6A 3MOGA 2D0DA 4XZ3A 3GFQA 4DADA 3MINA 4Q1EA 3WIOA 3L9XA 2HXGA 1Z6XA 2JHCA 2NO5A 1JDBC 2AFIE 4G67A 1QH0A 4X20B 1JHPA 5FEUA 2XGOA 2EZ8A 2RMKA 2W8BA 4QWWA 4CMAA 4Q4HB 1G60A 1P5HA 1S8NA 4IFTA 3TOXA 3PQEA 4MI6A 1V96A 1EXWA 3BTUA 4BNFA 4FW9A 1TMKA 4BVJA 1J90A 1JXOA 1OFUX 3AW9A 4E5PA 4F85A 5B6JA 5LWHA 5LLTA 4L0MA 2H8KA 1DQNA 3DKPA 4DC1A 5LQCA 4RVFA 3T4UA 4WT7A 4UBNA 1FNNA 1F51E 1DARA 4O4LA 1DWUA 3PHGA 2OCYC 3TSAA 5ITZA 1XNRB 2P6MA 4KXVA 1KO7A 1C14A 3BXXA 3REGA 3QE4A 2W93A 1WPRA 2WNSA 4X41A 5MDHA 5L6LB 3HWRA 1NBWB 3DTTA 3FFBA 4OOEA 2QLLA 3ZI7A 4ENSA 4KBFA 4V24A 1FW6A 2NTJA 3QLVA 1AQNA 1R8XA 1EDOA 1QVVA 4OGKA 3TTVA 3W5AA 4CEJA 3OJWA 4P80A 5CEEA 2Z3ZA 3A6LA 3PWZA 4PLHA 5E4FA 1QANA 2R96A 2I7XA 3M8KA 4D8UA 1ZNQO 1U9JA 3IO3A 1RE0A 5ICCA 4F5ZA 2RAUA 2G3YA 4B81A 4GLOA 2NLOA 4ZYTA 4HRVA 4Y2UA 2OPHA 4AT1A 5A4IS 3I2FA 4LYEA 5L3QB 1LZLA 3C14C 5HG0A 2QE7D 1L0BA 4PSUA 5BORA 1KDOA 1GY8A 4QBTA 4N7BA 4TKVB 4DQKA 4O4JB 1P2FA 1NXTA 2ZRFA 2Z04A 1F3LA 3QFRA 5AW8A 5AI9A 5C8YF 2QN6A 4LJRA 3CUTA 1F1JA 2WT9A 1E6LA 5I9BA 5C7OO 3I6ZA 4ESHA 3O8OB 4D9CA 2I6GA 1R8YA 1UOEA 1TGYA 3V1YA 2Q9BA 2Z8ZA 3KYJB 4CF3A 2XTNA 1JYSA 1R0LA 4IHJA 2B36A 4WLEA 4QFBA 1MGPA 4KAJA 4AB1A 4LSGA 4L7QA 3AR6A 1C50A 1D4ZA 1KR2A 2X0IA 3FIUA 2EWVA 2C2OA 5L40A 3PQ7A 3IE2A 5FUMA 3CW2A 1FMFA 3KSDO 1L4MA 3G9QA 3TRDA 3L7OA 4HXGA 3S4YA 1M6VA 3TSWA 3QKRB 3EB9A 4GPBA 1XCBA 5AVZA 1RHUA 2I7TA 4DDUA 2AQIA 3M3DA 3O90A 4BFYA 1YZQA 3JWHA 4OGLA 3TVYA 2EZ4A 3PVCA 4NMLA 2YMLA 4U2KA 1KGDA 4EJSB 3ZGYA 3QVWA 3OQHA 2BI7A 2GNPA 5T8KC 5BQPA 2P4HX 4OHUA 4RVGA 5G40A 1RYEA 3ZGXA 2GX6A 1Z08A 2UKDA 2DFKB 5EMLA 3FKSD 1MMFB 3QVXA 1I9CA 2A5DA 3G59A 1K8QA 2C1EA 3OY7A 3RAJA 2VNAA 4E7PA 3K0CA 4O59O 1O0SA 1YIAA 3DBLA 4P33A 2WOOA 4RKEA 1SCAA 4AMUA 1GNPA 3R3ZA 3ZCUA 2PUCA 5GGYA 4I3FA 1L8OA 2P9EA 4J0CA 5L4LA 4N12A 1WZ2A 5H59A 1Y7PA 1X1BA 4D6PA 4GRDA 2P3LA 3B70A 4XLZA 1VGVA 1CWUA 3H1AA 5ECWA 3UUEA 3L07A 3WX0A 3OQPA 3FPSA 2FLWA 3D8TA 2QV0A 3B1XA 1NJ5A 1NF8A 3B38A 2QT9A 3CCCA 4GNRA 1VQ1A 4KGZA 1ZKDA 3GJYA 3FRHA 3U3RA 4BY9E 3O4JA 1KGSA 4WKGA 3ET4A 4R6XA 5DVZA 2W42A 1V3VA 1YRHA 1XTRA 3PT5A 1ZK1A 2Q99A 2ZUUA 4LBZA 3ZNQA 5HIAA 1EXMA 2AX4A 4R1TA 2X1MA 4DJ5X 4KXUA 4M9ZA 4WOBA 2ZSUA 4K0RA 3JAKB 5EUMA 1DRKA 1E9AA 3RK0A 3RREA 1SXHA 2RHJA 1H1LA 3OT1A 4FYIA 1IG0A 4KVFA 4QUHA 4ZGGA 4YUAA 1MJGA 4QXQA 5CFOA 1Q57A 1JPNA 1U5CA 3EIXA 5A4JA 5LXTB 1QRSA 3IXLA 2Q1XA 3Q8WA 2AI2A 4RBNA 4X8OA 4ZDIA 3C43A 1B8NA 3X1DA 1O94A 3SS8A 2XXAA 4CMEA 1J09A 4GMKA 1ATIA 3EBLA 3E1SA 3L93A 2JW5A 3DVAB 4Y1RB 2XRMA 4PFKA 1U8YA 3EULA 1RM5A 2B2CA 2C20A 3HYLA 3ISVA 5JTTA 2V03A 3FHOA 1VMKA 4KNYA 4PVDA 5A4DA 1RWQA 3IUQA 1NUQA 4OJMX 2C9CA 2UXDB 4JQOA 4ZDWA 1JBEA 2FOLA 3LJKA 2MSCB 4OXKA 5HR5A 3M1LA 4JYBA 5DNDA 2I4IA 1CF4A 4ZU6X 2DY1A 3IESA 4V03A 1BU5A 1VECA 2OGWA 4K6HA 3WQSB 1J0AA 4EQ6B 3LC0A 3DBIA 4HWKA 3WSVA 3AKDA 4JEIA 5JAHA 5LPNA 3HRIA 3U37A 2CCKA 3P71T 5BW4A 7REQA 4AKEA 1FPQA 4DLRA 4A26A 2ZWAA 1I7LA 1GN8A 3B5IA 3R6GA 4JB0A 5D01A 1Z82A 5U4QA 2EV9A 4DQDA 2DFTA 3OPYA 2I34A 4R5HA 4IIJB 5E9JA 2QRVA 2VCHA 3L8EA 4MUBA 1UM9B 4NWIA 5C8YB 1KYXA 2X1LA 2PXCA 4RKYA 4OHFA 4QNRA 3MBIA 3RARA 3O95A 3B6EA 4X91A 3MAJA 1XC7A 1CJMA 4D81A 1WETA 3IUYA 5IMBA 3T1NA 5AKLA 4ZMRA 3INYA 3MEQA 4MDYA 4WK0B 4MGIR 4JC0A 2WB2A 2X9NA 4LQ4A 1QJ4A 4Y9TA 4RVCA 3GN1A 4MLZA 4BNTA 4U7WA 4GL4A 1T1GA 4NSNA 1R4NA 1CQXA 2X5NA 2OV8A 3TIFA 1NFFA 5KOYA 3GLGA 4CCSA 1Z5NA 2V7TA 4M9XA 3QF4A 1DIHA 1JGTA 1PYDA 2B2NA 3C3WA 4Q3OA 4TQGA 3W90A 5K0ZA 1MR3F 3H65A 5B3AA 1MJFA 4J3FA 4B40A 1NVBA 3IEUA 2HQ1A 1CZOA 2E6KA 4DBLC 3L9WA 4R1PA 2DBZA 4OQPA 1C1DA 2Q3FA 4J76A 4LAFA 5JMTA 3T54A 1JAXA 3C5EA 1C0PA 3EWNA 1E9DA 2CLDX 3L40A 1N7HA 1BDJA 1OI4A 1VL6A 2GOYA 2Q8NA 1EM6A 3INGA 2ZYRA 3O74A 4L15A 1L7VC 1G63A 4JLOA 1U4OA 1IHUA 1JTVA 2CWWA 4INPA 4LRQA 4C5CA 2EKLA 1NWCA 3BWYA 3KWFA 2GJ9A 4H18A 5H16A 5JLAA 2RHHA 3O0TA 4RM3A 2HA5A 2WKWA 2WU4A 1ZM3A 3MGCA 2DCUA 3KEFA 3RPEA 1RR6A 3C1OA 1E1CB 4RVUA 4TYMA 2W58A 3QLUA 2HGSA 4LHXA 4E4YA 1E5LA 5DHTA 4WBNF 2OENG 4G0QA 1HMPA 2BR3A 1NE7A 3IT0A 3N6XA 5K0JA 3BL8A 3V8PA 4PSVA 2HLNA 1W49A 2HWYA 2L17A 4B33A 2HO4A 3KZCA 2FUKA 2PGDA 1U3CA 1THZA 1KAOA 2H5IA 3U62A 2V97A 3GRKA 2HJRA 2H63A 3RSHA 2P35A 5HBRA 3RI3A 4KJZA 3V7YA 3D7KA 2YXEA 1JILA 1CB7A 4Y2VA 5M29A 2QMYA 2PM8A 3RVMA 2ZP1A 4DCCA 3MGGA 3EC2A 4B1FA 3K09A 3EXFA 4M8KA 4DUGA 4WGGA 4EB6B 4ND6A 4ETNA 1XPRA 4PX9A 3VDRA 1ECFA 3F8SA 3LPNA 3OHPA 1EJBA 1SBQA 1WJGA 2RG7A 4NBUA 2JFGA 3M83A 4R40A 3LHKA 3FF1A 1MVLA 1WNFA 2O6LA 1NMXA 1G4UR 2M1ZA 2R44A 3FTQA 4K8OA 4LGMA 5D3MA 3WNDA 5MGBA 4S04A 5HHTA 2V1UA 4JQCA 1II9A 5K0CA 4JNCA 4RE5A 3OA0A 1RRMA 1SU7A 2WAXA 5LC1A 4D9GA 1CUZA 2CVQA 4D9KA 1F14A 3LKBA 2VJCA 4X45A 4H7FA 2F9FA 3ND8A 4WX2B 3WL6A 3H6KA 3F6PA 2BVNA 5KDLA 4N03A 3RNOA 3TRHA 2AFHA 1WHTA 4JVLA 1I7DA 4P36A 2PIAA 4HYTA 3KSZO 2C5AA 3E3OA 1US8A 1W73A 4Q4AA 2JCBA 4YPVA 1WUYA 3G7UA 3DTVD 1SUCA 1XN1A 4FGWA 3TNJA 1KYWA 1UINA 3GVHA 1RXSA 3OLCX 2WE8A 3T8YA 3UV6A 1U04A 3WDMA 2QTBA 2RGCA 3G5LA 3GCWA 4Q9JA 3FBGA 5D00A 3UJ7A 4B3JA 4Z1MD 4IV5A 2O8CB 1T0UA 1CUUA 3NU1A 4OMFG 4H7JA 3EVBA 1OLUB 3C8HA 5MFZA 1GRRA 5ELMA 4N7RA 4P2BA 4P5EA 3KUUA 2AOTA 1KVRA 2P7HA 5JSZB 3JRNA 3QLUC 2XIJA 5IKMA 2VHYA 5DM1A 5B3KA 1J8MF 3JAMA 1ESMA 4GPEA 4MW7A 4ZI7B 1CY0A 4ARCA 3IBCA 3OPXA 4X8MA 3TWOA 1YR8A 3ICQB 2B61A 4CIDA 4R3WA 2D4HA 1FP4B 1A7KA 3E70C 1ZI6A 3MRSA 4RCYA 3UK0A 4J2TA 2B37A 1K66A 4MGKR 4L4UA 1FU7A 3PCRB 5K3OA 1ZMRA 2CNKA 1SVMA 1NQVA 3JD0A 4YLYA 4HDKA 1QR2A 1Y8RA 2RHCA 4DDVA 5JJBA 1L8QA 4PY2A 2YZMA 1BTOA 1Z47A 2WVJA 4WFKA 5LMCA 4HSEA 2QD4A 3ETJA 5G1OA 4K05A 4BO9A 1ODJA 3F5FA 4R7GA 2R4UA 1CJKC 3CRNA 4NBSA 4Y2SA 4A6PA 4ME6A 3V42A 4A8TA 5KOIA 3KDSE 2ZQ5A 2GBIA 3EFHA 4MMZB 4UMFA 4LX8A 2R8BA 3ZBUA 3VR0A 1MIOB 2K7ZA 5ADHA 2R6HA 3SHVA 3T9DA 1LVUA 5I9TA 3IYLW 4L3OA 1QP4A 2BR5A 4L1KA 1QR6A 1U11A 2AJ8A 2P7IA 3GELA 3QKUA 4IIUA 3STWA 1T24A 4UASA 3GOHA 4QO7A 8ABPA 2AFRA 2BLNA 2H17A 3L7IA 3ZNOA 4YYZA 3AL2A 1MPXA 4LVNA 4KACA 3GLHE 4ESEA 1XQYA 1SU8A 1GPKA 2GXQA 1U7TA 4HFNA 3ZTYA 4B2IA 1R3DA 1O4VA 1S3FA 4OGWA 3KXLA 5FD8A 3PNBA 2GYVA 1ZMBA 3W8DA 4PSAA 1SVUA 1OH6A 2A6PA 1V2GA 3PEFA 3DD1A 1WD7A 1YR3A 1ZJ4A 1V1RA 2EATA 3O1LA 2UAGA 1CUVA 4IW3B 4Y0AA 4ZO6A 4EMBA 2VOEA 2MSEB 1KRXA 1YRQA 1NW7A 1U7ZA 1ZCFA 4JOSA