3DMTC

Structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma cruzi in complex with the irreversible iodoacetate inhibitor
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
358
Chain Sequence
MPIKVGINGFGRIGRMVFQALCEDGLLGTEIDVVAVVDMNTDAEYFAYQMRYDTVHGKFKYEVTTTKSSPSVAKDDTLVVNGHRILCVKAQRNPADLPWGKLGVEYVIESTGLFTAKAAAEGHLRGGARKVVISAPASGGAKTLVMGVNHHEYNPSEHHVVSNASTTNCLAPIVHVLVKEGFGVQTGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTQGKLTGMSFRVPTPDVSVVDLTFTAARDTSIQEIDAALKRASKTYMKGILGYTDEELVSADFINDNRSSIYDSKATLQNNLPKERRFFKIVSWYDNEWGYSHRVVDLVRHMASKDRSARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Studies on Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi in Complex with Iodoacetate.
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, glycosomal
total genus 120
structure length 358
sequence length 359
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2008-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
C PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3dmtC02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3dmtC01
5DOZA 4OM8A 4Y6PA 3WG9A 2I65A 3RD5A 4XB2A 1WZIA 1YB4A 5F5LA 3ROKA 3SX2A 5JMPA 3LLSA 5C7LO 1K0UA 1WXDA 3KO8A 2AMFA 4L4SA 2NADA 4YAEA 2VYNA 5HRUA 4E2YA 2CMDA 5FWNA 4CM6A 3O4RA 4D44A 3TF5A 3GMSA 2AA3A 3RU9A 2OP0A 2IODA 3PLRA 3H5NA 5CDYA 5JMWA 3DTTA 4YAGA 5JCJA 4WKGA 1GADO 5DF1A 5IZCC 3LT2A 4U7WA 3RIHA 4AICA 3I6QA 1SOVA 5FF9A 1NAHA 1QYVA 3NDIA 3D3EA 5JC8A 4JJGA 1PJQA 3GDFA 1LSUA 3PQEA 1IZ0A 3ETEA 2NNLD 3JYPA 5CP8A 2V6FA 5THQA 4BOYA 4GI2A 4HY3A 2FPGA 2PZKA 4TRRA 5ILGA 3HE3A 1QR6A 4MVJH 1NWHA 3F1KA 3F46A 5B37A 4Y8VA 2Q22A 3RAJA 1HETA 1I8TA 2R6JA 2YFQA 3BZUA 1QORA 1KC3A 3A14A 5KKAA 3RUDA 2YJZA 4ALKA 3RROA 1XGKA 2QYSA 4O63O 3N7UA 5I8ZA 1LLUA 5F1OA 4YJHA 2OORA 2Y67A 1MC5A 4LCEA 5AVOA 2PD3A 4URFA 1OC4A 4PFJA 3WB9A 3GF4A 5ITVA 4RDIA 4OHUA 4CL8A 3QV1A 1B2LA 2PLAA 4ONEA 5DN9A 1WWKA 4FFNA 3DBHA 2Q99A 5JY1A 1LSSA 1TT5B 4YR9A 5CHEA 1PS9A 1DDOA 3COSA 3RBZA 2CDAA 4RQUA 3H9EO 3MJ4A 3F9IA 5CDSA 1T2AA 5G2OA 1HYEA 2FP4A 2Q2QA 3G3EA 3WX0A 3AK4A 4FW8A 3PXXA 4XB1A 3K2BA 4HFJA 1I33A 3ZZNA 5TIIA 1HDYA 2AW5A 4FOSA 5EL0A 3ZCXA 1GQ2A 2YDXA 2I3GA 2RAFA 3SLKA 1N92A 1KVSA 4ALIA 4WK6A 2CVZA 5BNIA 1ZW1A 1DO8A 4A26A 4DPKA 4Q3DA 4BO7A 3U49A 2D2IA 5LCXA 2GSDA 4NPCA 4OKIA 5JDIC 2JJYA 1ONNA 3C1OA 4IBOA 1CF2O 1P1KA 1XA0A 4WCFB 4XA8A 3TZCA 4YACA 5I8WA 1NBOA 3GUYA 1E3JA 2AQIA 3JD1A 1NXQA 1KBZA 1T1RA 1EUDA 1SEVA 3JQDA 3U5TA 3VZRA 2IZ0A 4Z6KA 2Y1EA 1NFFA 3HN2A 4DC0A 3GRPA 3TOZA 1E6WA 2Z1NA 1BW9A 2NM0A 5HWSA 5DCYA 1DAPA 2X1HA 1EDZA 3JQAD 1GYPA 4M86A 1ZJYA 3ZNPA 4CUKA 4D46A 5DP1A 3W6ZA 4LGVA 3QWAA 3NAQA 3QRWA 2ZATA 4J0FA 4WUVA 4BO6A 2XOXA 5HBRA 1PWXA 2Y66A 1LJ8A 1VKOA 4XJSA 2VUUA 3T7EA 4B8WA 4EBFA 2AEJA 4GGPA 3E9NA 1C0PA 1RWBA 3OQ1A 4JK3A 3KHUA 5JDIA 4IS2A 5L7YA 4FCCA 5G0UA 3E8XA 3JTMA 4BNJA 4EITA 2J6IA 1D1TA 1U3WA 3FBGA 3DDNA 4Z0TA 1AUPA 1VE9A 3JQ6A 3GEMA 3D1LA 4CM3A 1FMCA 5G4KA 2JHFA 3KEOA 4G65A 1Y81A 2D59A 1XEAA 4NJMA 1WLYA 3FI9A 1HT0A 2GN8A 4IDAA 3CINA 3I5MA 3RC2A 4PLPA 3K5PA 4LRSB 2GDZA 4ROSA 4Z3KA 1T2EA 1VJTA 2DPHA 2C82A 2W98A 3D4NA 2WE7A 3KZVA 1F12A 2C2YA 5EQDA 4F46A 1B16A 3FRJA 4GMFA 3MJVA 3HB5X 1V8BA 1LDBA 4JGBA 3AUUA 4J9VA 2NU8A 2WEKA 2XXJA 2YW9A 4RDHA 4I5FA 2NSDA 3WYBA 4CQMD 2DU8A 1R16A 2PR2A 3ZHBA 5G4LA 4L73A 4IS3A 2R00A 1XR3A 1LNQA 3OFSA 4E13A 1H6DA 2Q4EA 1N1GA 2DVMA 2W2KA 2X0JA 5A9RA 2BLLA 2Z5LA 3FTNA 2O3RA 5T64A 1PJCA 2OP1A 1VJ0A 2AG8A 2EEZA 4HXYA 1GAEO 1E1KA 2PFGA 4YJFA 4AJ4A 1EVZA 3GAZA 1N2SA 2ZYGA 3DFZA 4UULA 4ZQHA 3LT0A 4NR0A 2BELA 2BF7A 4ITUA 4PGFA 4PLHA 4YBZA 1LQTA 5B4UA 3QWFA 1VSVA 2QQ5A 4YAKA 1SC6A 3LU1A 4XIJA 5IJZA 1GZ3A 2PZMA 2YHIA 1N5DA 1CETA 4A5OA 4TRNA 1CQJA 3RC7A 3C7CB 3OJEA 5JCXA 3QWIA 1E77A 3KETA 3EY4A 3JQCA 1PJ4A 1X1EA 5A1TA 2NWQA 1QRRA 3HG7A 1ZSVA 1I10A 2FSSA 1I30A 3AY6A 2VHZA 1EQUA 3F4LA 2VHWA 4OOEA 2E37A 2YY7A 5TT0A 5H81A 3QVSA 5JE8A 5CFZA 2BI8A 1LI4A 2LDXA 4GKBA 2GRAA 3DFUA 1NR1A 3CPSA 1PEDA 4GAEA 1HLPA 5MGBA 3DQPA 1PS8A 1PGOA 1UUFA 3FNGA 4U6QA 2HJSA 1ADGA 4NFYA 4I08A 3TZ6A 3WBBA 4AJOA 3WWYA 3OETA 4L76A 3ANMA 4IIUA 4NHEA 3X2EA 3TQHA 4IY1A 1LC0A 3H2SA 2DBRA 3MWEB 3D5QA 3ENKA 1E7RA 3ADPA 1MP0A 4F45A 1O8CA 1XSEA 3GZ4A 4J7UA 1YH3A 4PVDA 4OQZA 2CFCA 3GY0A 4EUFA 3PK0A 2X22A 3EVTA 5HM8A 4G81A 3WGGA 2GO1A 1J4AA 4E4YA 3EDMA 3S2EA 3HNPA 2O7QA 4JLWA 2QX7A 4AVYA 1A7AA 2VOEA 1KY5A 5A06A 4BNLA 1X0XA 5IAAA 2W8ZA 1IE3A 2NVUB 2JCXA 2Y0EA 5G0TA 3K92A 4FJ0A 3GG2A 4JP3A 2NTNA 1Y5RA 1UP6A 3LYLA 4GVXA 4GSLA 4IJVA 4BQPA 1JVSA 2RIRA 3ST7A 3CTMA 2O3TA 1TEHA 2DUWA 4OH1A 4ZA2A 1NQTA 2PD4A 1FF9A 2V65A 2CDCA 2Y1DA 2GUGA 3FNEA 1PZHA 5ENDA 3UH1A 5A02A 4E12A 4JX8A 1UZMA 2PGLA 4K1LA 1YOVB 2EWMA 1BW9B 4XR9A 1S7CA 1WZEA 4NBUA 1H0KA 4R5MA 3OJOA 3PFFA 4DLAA 5KVVA 2QZ9A 4DUPA 1GFSA 1U1IA 1IULA 3HB4X 1YQDA 3WJAA 3X2FA 4B4WA 1I3KA 1HEUA 2TMGA 3E9QA 3OJFA 1ISHA 3TZKA 1PJ3A 4GGOA 4R1SA 4YT5A 5A05A 4YRDA 4IJUA 5IXYA 3C85A 1I32A 3PDUA 3PFWO 3N58A 5KOIA 5COQA 4HKTA 2UUOA 3UVEA 4JP2A 4XJTA 4KMSA 1QXSA 3LT4A 1T1SA 2DPGA 3ZWYA 4J6FA 2R2GA 4MINA 2ZK7A 4XCVA 3G49A 3QWBA 4Z9YA 3SXPA 3Q6IA 4H7PA 4BB5A 1NX6A 3PHLA 4AJHA 5KJFA 1QG6A 2CVQA 4BNWA 4ALNA 1N7HA 5IF3A 1T2CA 1JKFA 2AE1A 2NTVA 5C7OO 2VHVA 1X7DA 3RUCA 1IZ9A 3ONEA 5HS6A 5KIAA 4WASA 4QFDA 3VOSA 3IAHA 1PR9A 5IG2A 1R66A 2EJWA 2G5CA 3DBRB 4UUOA 4A73A 4J2HA 2DAPA 2DLDA 2V7PA 1QLHA 5ENVA 2Q1SA 1XQ1A 4RVUA 1HDOA 1CJCA 3ON5A 3PJEA 2JD2A 3F3SA 5ITWA 1K2WA 5T73A 1M66A 4R16A 2Y0DA 3OIFA 4A10A 4HNHA 5EMHA 2IRWA 4RCVA 1L7DA 4EDFA 4LCJA 5C5IA 2Q2WA 3KTDA 1R12A 5ER9A 3INGA 2J3KA 4OMUA 3WYEA 1H9BA 1CERA 3C3XA 4CJXA 1PQWA 1NPYA 3ANNA 3BMNB 3JQAA 2E48A 5TX7A 2VN8A 3ZN2A 4CM8B 3CUKA 1QV7A 4O6VA 2FZWA 3M1AA 4ND4A 2HO5A 4GQAA 3OECA 5B12A 1HSOA 4YA6A 4B3HA 2WDZA 4W4TA 1QYWA 4BNUA 4ZGWA 2CVOA 2PK3A 3R3JA 3ZWOA 1PQPA 4J43A 3EHEA 4TMFA 4WECA 3HQ4O 3AM3A 3U62A 4BNFA 3UFXA 1C0IA 1O5IA 5KTKA 3SC4A 4BNKA 2Y0CA 2JAPA 3S8MA 3TSCA 3NV9A 1GPJA 2GZ1A 1K5HA 5C7IO 1CWUA 4R3NA 5AYVA 1JKIA 1R37A 3BYZA 3ZWVA 2IXBA 2ZIZA 1FDTA 4BNXA 4C4OA 3DZHA 4F6LA 3KRTA 5BT9A 1BWSA 1TA4A 1AHHA 4WLNA 2B0JA 1WPQA 3B1JA 1CEQA 1F8GA 4IXWA 2HQ1A 3IQDB 3JYLA 4FOOA 3VKVA 1NWCA 2C29D 4KQWA 5TQVA 1E7MA 4WCDA 4BMSA 3UOGA 3MOIA 1P9LA 4PLCA 4WCFC 1M67A 1GUYA 1PSDA 1YJ8A 1VM6A 2J3HA 1QLJA 3CKYA 3GDGA 2X4GA 4NBWA 3W4JA 1ID1A 5JC1A 4OQYA 2DFDA 4Q39A 1B26A 1G1AA 4IZIA 1EK5A 3DBRA 3WIEA 5BSGA 1LA2A 5A4DA 1I3NA 4IINA 1EEHA 5EIOA 4JXKA 5JDCC 3KVOA 4JBIA 3CMCO 1W73A 3D3WA 4YAIA 3PIDA 4GMGA 1O95A 4YCAA 3GNQA 4J1NA 5AOVA 3RKRA 4ZN6A 5IFLA 4MIEA 3QHAA 3C1TA 2Q2VA 3KOUA 5F1KA 3UCFA 3IKVA 3BTUA 3INRA 4CM5A 5L45A 3IP3A 1GEEA 3JQ8A 4JIGA 2HK8A 2EV9A 4E5PA 1X0VA 4FD3A 4B3JA 1YXMA 2J5KA 4NBRA 4BGIA 3HFGA 4PRLA 4CM8A 4PLZA 4OGWA 1U9JA 4D41A 3Q2KA 1SO8A 2EHDA 1NVGA 1DXYA 3R3SA 1UAGA 4ZQFA 8ADHA 4ND1A 1DRVA 1Y8QA 1UAYA 5G4KB 3TJRA 1LRKA 4HBGA 2C2XA 3T4XA 1LDGA 2O50A 1K89A 4QTZA 2WSBA 5JPIA 2X5OA 4E32A 1IUKA 2PGJA 8LDHA 1J49A 4ND3A 1RM0A 3KB6A 4J3FA 1NM5A 3A28A 3UF0A 5A5FA 1SB8A 1KVUA 3KSDO 4FDAA 5KJ6A 3GLQA 4CLEA 1GZ6A 4RGBA 2C54A 3WTBA 3H4VA 5JW6A 3HDQA 4R1UA 1R15A 2G17A 2H6EA 1T2DA 5JY6A 1O94A 1U2GA 3O8QB 4AJPA 3L6OO 9LDBA 2NTJA 2XXBA 3K9QO 3WBFA 5LDHA 2CUKA 3WNQA 1ZNQO 4BO9A 2GGSA 3L9WA 3R1IA 2BFPA 4CUJA 1UZLA 1ZK4A 3I9NA 5I9LA 1YQGA 2CD9A 2HRZA 3ENNA 1EVYA 4J4BA 1HXHA 4YB8A 3PZBA 1WNTA 3H65A 4GLLA 4BO5A 1PR3A 2JAHA 5CDGA 3QJ5A 4IQ0A 3AU9A 4IMRA 1NPDA 4RF2A 4F3YA 1EUCA 1IPFA 3MTJA 1QSGA 1LQUA 2NVBA 4L4RA 4Z9FA 1FDUA 4IDEA 3V1UA 4CLXA 4H3VA 1Z6ZA 4PN3A 4MIYA 3NT5A 1WP4A 2VRCD 4ZQBA 5K6AC 5JCJD 3ZNQA 2Y1GA 2DC1A 3OA2A 3PGXA 4ALJA 1YO6A 4H15A 3PWSA 4B8ZA 4UEOA 2GCGA 2W2LD 1YGYA 3JQEA 1E7WA 3JQFC 3MZ0A 3VTFA 1M6WA 1NFQA 3EZYA 3UGKA 3E5RA 1SZJG 5I7FA 5JNLA 1NQ5A 4YAJA 3BTOA 4PLWA 2FN7A 4RF5A 2VQ3A 5EQFA 3DR3A 1DEHA 1KEUA 2OUIA 5CEFA 1HDZA 3C7DB 3HADA 2VTEA 4XKJA 4UUPA 2H1SA 3RFVA 3EVNA 1DC5A 4MVJM 1IB6A 2P5UA 3UKOA 2X86A 4WPGA 1ADFA 5T8KA 3JCZA 4JBHA 4WLUA 1K6IA 1WMAA 3V2GA 1DHRA 2O4CA 2OGUA 5JAIA 1EDOA 1E7QA 2FY8A 2X0NA 1ADBA 1ISJA 4AG3A 2BFAA 2GNAA 2EGHA 2G76A 4PRKA 1CQIA 4EEXA 1P31A 2EGGA 4DIBA 2BH9A 1Y5MA 3DZFA 1XU7A 4Y9DA 1U7HA 1CYDA 3IP1A 1DC6A 2OO5A 2PGDA 5JAMA 3FN4A 2ZJ1A 5DNAA 3E82A 1QYCA 3BMQA 5JDCA 4NFHA 4CLDA 2JFGA 5CAEA 4EJMA 1G0OA 1P0FA 3QE3A 1V0JA 1K6JA 3Q9UA 4DQXA 3IJPA 3RC1A 1LSOA 2GN9A 1GQQA 3Q0EA 1IPEA 3TL2A 4A0SA 4BO3A 2EP7A 2VYVD 1HDXA 3WGOA 4DC1A 3BTSA 1R4NA 3G0OA 1ZVMA 3PQFA 2JD0A 1JWAB 1ZSYA 1E92A 4BUCA 1GQYA 4FPXA 1RJWA 3ICPA 3H7AA 1XU9A 4UEKA 2ZB7A 4KQXA 4LN1A 2GERA 4ZD6A 4E2ZA 4CR7A 3KBOA 5LDGA 4GX5A 3VKUA 3IKTA 3ABIA 3NT2A 3PJDA 1ZK0A 1ZMOA 3E48A 4J1TA 4DXHA 4MOWA 5BSFA 2OBNA 4RLHA 1E5LA 4MKRA 1E7YA 2E49A 4J90A 4CM9A 3RU7A 1M75A 2O4UX 4YJGA 3ZU2A 2EP5A 4PZCA 3D7LA 3TZHA 1KC1A 2VNAA 3WSWA 3JD0A 1RPNA 3EC7A 1GR0A 4NIMA 5C37A 1NTOA 3GZNA 3I6IA 4GL4A 4XEHA 4B79A 3WIDA 4FGWA 1E3SA 2C07A 2FPPA 3DL2A 3BA1A 2D5AA 1YB5A 1RM4A 4BV8A 4WNCA 5AXBA 4K6CA 5K6AA 2PTGA 3ZI0A 1PGPA 4BGVA 3EK2A 4CM4B 5L7TA 3W1VA 4Z0HO 2P4QA 3WGIA 3ASVA 3GEGA 3NTQA 4QUKA 4UREA 1I5RA 4S3MA 5K9ZA 4J9UE 3RUHA 1XQ6A 3RC9A 3SEFA 1KEVA 1H6CA 1A4UA 4KTTE 3GPDG 1ISGA 3MTGA 4KZPA 2OL4A 3JYQA 1DHTA 3JD2A 5L3ZA 1GV1A 2VWQA 3PVZA 4O0LA 4LVCA 4JQCA 3TL3A 4KWIA 1JA9A 2EG9A 2FR8A 2I9PA 5AXAA 3OICA 3P2YA 3OQBA 2O3JA 3IUSA 4J1QA 5TJ9A 4W82A 3P19A 3ZU4A 4YWJA 3BHJA 2PY6A 3ICCA 5T8KC 4B4VA 4QFCA 4E5MA 1C1DA 1NAIA 3L77A 4RVSA 2HKIA 2ZJ0A 4M8SA 4MVJP 5I9NA 3FCOA 5BR7A 3UXYA 4CMCA 1PL7A 1GYRA 5L53A 1DBVO 3DZIA 2Q3EA 4CQLA 2HMUA 3BMCB 4LK3A 1E1NA 1YL7A 4FQ8A 4OL9A 1L1FA 3ONDA 2W4QA 1E3IA 1F17A 4I9UA 2D8AA 4XRGA 1GCUA 4IUYA 4LSWA 4DL9A 4KP7A 2YQ4A 3VH1A 1B15A 3ETGA 2ZTVA 4Q3AA 4CMHA 4MP8A 2BKAA 4UAGA 5A9SB 4BGUA 3DAPA 3GZNB 3GVXA 4AJJA 5AXCA 4RPGA 1Z45A 3JQ7B 2PD6A 5TGDA 1A5ZA 2VUTA 3H9JA 2I3AA 2QZZA 4TKMA 4Y6SA 4BKOA 3DHEA 2VRBA 2WD7B 2RHCA 5TT1A 1Q2XA 1PJSA 3WWZA 3RFTA 3QP9A 1YRLA 3PP8A 2WM3A 1ZH8A 4JN6B 3ULKA 4YJDA 1NPTO 5EERA 3NEPX 2DFVA 4QO8A 3ITDA 2BGMA 4YT2A 1QYDA 1KYQA 1LBEA 3JD3A 2JD1A 2HUNA 4QECA 1PX0A 1YWGO 1U28A 4CPDA 3DZBA 3AOGA 3H2ZA 3L6EA 1BSVA 1P3DA 1H94A 3LQFA 3AUAA 4D7AA 3GPIA 3ZWMA 4DYVA 5GZ6A 3DB2A 1KEWA 1YB1A 1Z7BA 4UVDA 2Q1WA 5U4QA 3BIOA 4RZHA 3GK3A 1VKNA 2BI7A 2QW8A 2Q50A 4BNTA 3TNLA 3WLEA 2AQHA 2B36A 4C7KA 3P7MA 3C24A 4Z0PA 1ZEJA 2GD1O 1F14A 4YJHB 4BNYA 1DOHA 1ORRA 1ZK3A 2NACA 4XGNA 4BIIA 4HFNA 3NJ8A 1DRUA 2AE2A 4DQVA 4NBVA 3SC6A 1VI2A 1T4BA 3MOGA 4GX0A 5DBIA 1BXKA 2DQ4A 5KWEA 1C1XA 4E33A 4YVFA 3DBHB 4ND5A 3Q9NA 3TRIA 1LRJA 3ZWWA 3FNFA 4XRRA 3QSGA 1DJQA 4FFMA 1KVQA 3IOYA 2JHGA 3BMCA 3FR7A 2W2KB 1Y8RB 1UR5A 3GDOA 3JQ9A 3GC6A 4NMHA 4YEDA 3T4EA 3QVWA 5IDQA 4MIOA 4OSPA 2WD7A 3IUPA 3BXXA 3PEFA 4DA9A 1JTVA 4FJ1A 1W8DA 3VAZA 1JAYA 2C5AA 5DCWA 2V6GA 2SCUA 2Z95A 4BO4A 4PG8A 3B1KA 1CRWG 3WGHA 4BO0A 4R4JA 1PL6A 2PH3A 2HMWA 4RZIA 1LSJA 4RF4A 4PZDA 3B6ZA 4J0EA 2Q4BA 1DC4A 2BGKA 1HZZA 3PYMA 3QVXA 1DJNA 1Y9EA 3KSUA 4H16A 4L9RA 1A71A 4XDYA 3ROQA 3ZU3A 1HE4A 5JO9A 3IJRA 2D3TA 1I2CA 1FDWA 3NTOA 1ZFNA 3QIVA 3OM9A 1VL6A 1I2BA 2A9FA 2WYWA 1LC3A 2R00C 3VDQA 5L40A 5DBFA 3WFIA 4R69A 3HHPA 4D45A 1R0KA 2HK7A 1M2WA 5TF4A 5KNLA 4ZICA 5COAA 4WLFA 4NFSA 5JLAA 2J8ZA 2X58A 1IHYA 2VWPA 4FB5A 4CM7A 1WDLA 2C5EA 2RH4A 4ZRNA 3HUDA 4FFLA 1XWFA 3GR6A 3Q11A 4E2WA 3GRKA 1AXGA 1OC2A 4CM1A 2CF6A 2O7SA 2A35A 1EBFA 3PPIA 4OJNA 1YE3A 1QMGA 3SJ7A 4P4GA 4K6FA 2VWHA 4BNHA 4ZU3A 3BMNA 4K9DA 1BXZA 1U5CA 3S2GA 2YFHA 3NRCA 5TC4A 4GBJA 4L75A 4OOFA 4CV3A 3ZW8A 3DBVO 2PH5A 4DMLA 1A9YA 4R68A 1A4IA 3VPGA 3BHMA 4LW8A 1MUUA 2AHRA 4DBZA 3W8FA 3BMOB 4WLEA 4FS3A 1Z75A 4K26A 3ITKA 4HFRA 1K3TA 2YZ7A 1UP7A 1JDJA 3GN1A 3AI3A 1LDNA 3L6DA 2P68A 3AUSA 3GGGA 1E0DA 3AOEC 5BSHA 2Y93A 4IQ8A 2P9CA 2WMDA 4OYRA 4FGSA 1LDMA 2HDHA 4MVJE 1MFZA 2ZQYA 5U1PA 3PZRA 3PIIA 4II2A 3NUGA 4L8VA 4JJIA 1H93A 3L4BC 4I8XA 4TWRA 3BMQB 2NU7A 1MX3A 1O9BA 5F1PA 4D79A 3S2FA 3W6UA 1PWZA 3ZWCA 1DFHA 1EZ4A 4ND2A 1OZAA 3CEAA 2V6BA 3CZMA 1H2HA 2XPCA 4Z3DA 2B69A 2BMAA 2VZ8A 5TJHA 4BNMA 3GT0A 4BO2A 5CDTA 5JO0A 3WDSA 4CLRA 1ADCA 5KJEA 1C14A 1YL6A 3WGYA 4NU6A 1D3AA 3DC2A 5A9SA 1JN0A 3KUXA 1I3MA 3ORFA 3OP4A 1PS0A 3PYXA 2UUPA 5G0SA 4PZEA 1D4FA 4XZ3A 4IDCA 5FEUA 2X5JO 4LISA 1ONOA 4UVIA 4CUZA 3EW7A 1P1JA 4WGGA 2EJVA 3V2HA 1CDOA 2VYND 4NU5A 4EJ6A 4G2NA 2QYTA 2I76A 1EVIA 2I67A 4IGEA 1D8AA 1A72A 4ESOA 1V3UA 3V5NA 5B1YA 2P91A 1LLQA 3GOHA 1I0ZA 1RKXA 4Q3BA 1HZJA 4WLOA 1HE2A 3PHGA 3M6IA 4I5DA 1WW8A 3E03A 3KYDA 3S1LA 2IEBA 2PKRA 2ZB4A 1YQXA 3PI7A 3KLPX 4DGSA 1A27A 1W0CA 3U4CA 4YQYA 2UV8A 3M2PA 4ALLA 4OXYA 4P38A 4DIFA 1JAXA 3UCXA 2WD8A 4FN4A 3RSHA 3BMOA 3QVTA 3LF2A 2I99A 3RUFA 4BKRA 4NQZA 3LC7O 3E6AA 1P0CA 4KDEA 4PG5A 3GHYA 1X14A 3LSYA 4BQRA 3FWZA 1X1TA 1D1SA 1UDCA 4TRJA 3JQBC 1HYGA 2HU2A 1ZMTA 3K96A 4Y67A 1U3UA 3ASUA 4AJEA 4CMJA 4AJ2A 3KSZO 4LMRA 1V3TA 3PJGA 2ZTLA 5GZ3A 4Y98A 2HJRA 5T57A 3NGLA 4MP6A 3DXFA 4P4NA 1E3WA 2GN4A 4YJGB 1LRLA 1PJ2A 3PHJA 4CMGA 1M6HA 3GFGA 4BVAA 4A7PA 4ZRMA 4KOAA 3GVIA 3VPHA 3HSKA 1FDSA 2J5QA 3H5AA 4W6ZA 3D4PA 3DOOA 2X5KO 3F1LA 1ZK1A 1BHSA 4GLOA 5DZSA 1MG5A 3CIFA 4EI2A 2F00A 3DAGA 3E18A 4CLRB 1P1HA 4N5NA 2FSVA 1H2BA 2X7HA 1P1IA 3W8EA 3O03A 1NR7A 1UDAA 5I7VA 1ZBQA 1U2DA 4CQLB 1ISIA 4Q3NA 2ZKLA 4O59O 4RV9A 1ZKMA 2NV6A 1KERA 2GF2A 2QRKA 4Y6RA 2EW2A 4KDFA 4R51A 4HNGA 4AFNA 3Q3CA 4BMVA 5JYEA 3LZ6A 4MO2A 4IGFA 5H83A 3TZQA 1I3LA 2YHUA 3V8BA 3B20A 2H63A 3K2EA 4M49A 2DT5A 4B7CA 1YJQA 2E6UX 3D3WB 1Q0HA 2QIOA 4AJIA 1GEGA 4NNJA 1V35A 5CPFA 3CMMA 4M87A 1BMDA 4DYDA 4DLBA 3AFNA 4IIVA 2VZ9A 1Z74A 3I23A 3PTZA 1ML3A 2EF1A 1P74A 3AUTA 1LDEA 3NDJA 4TRMA 4GWKA 1HWYA 4PLFA 1ISFA 4FC7A 3A9WA 2W2LA 1BTOA 3AU8A 5JBIA 3CXRA 1ZJZA 3N74A 1XCBA 1WDMA 2FWMX 4FFPA 2JFHA 1YOVA 2QRLA 2HMVA 4BNVA 4DIOA 2AG5A 1IHXA 1P77A 4ILKA 3JSAA 3INTA 1HSZA 2RH8A 1BXGA 1X15A 2IE0A 1XKQA 1Q7BA 2CDBA 3I9KA 2EW8A 3R6DA 4J4HA 1UJMA 4PLYA 4XYBA 5FYDA 4WLVA 1XDWA 1G6KA 1E3EA 3H9GA 4N5LA 3KEQA 2OZPA 4RVDA 4CLOB 1W4ZA 3H5RA 5K0ZA 1TB4A 3I83A 1MG0A 3OHSX 1LEHA 4OAQA 3VPSA 1UXJA 5EJ2A 3V1YA 3UUWA 2HLPA 1TI7A 5IN4A 5J23A 1UZNA 3ETDA 5GZ1A 4L0QA 3D5TA 1IY8A 1OFGA 1JKJA 1J6UA 2AEFA 2P9EA 3C7AA 3I4FA 4U5QA 3EYWA 4XDZA 3S55A 3UCEA 1ZIDA 1ENOA 2YV2A 2XAAA 3D64A 4QQRA 2I66A 2NUAA 3WQQA 4B7XA 1ENYA 1ZEMA 3QA9A 3R0IA 3QLJA 4XGKA 4XQCA 1SAYA 4OIMA 2O48X 4MKZA 1VC2A 3H3JA 3M1LA 3FPCA 3TWOA 3ZWPA 3DZGA 3S2IA 1XIVA 3JQGB 5BNFA 3K73O 3STHA 1KOLA 4DPMA 4QEDA 2B83A 1AHIA 2ZTUA 4TROA 2XF8A 3RBVA 4RJTA 2OFPA 4XYMA 4I1IA 4DMMA 4PVCA 3U4HA 3AOEA 2E82A 2J3IA 1GD1O 1T2FA 1PZFA 2P5YA 1C3VA 1H5QA 3FR8A 3VZQA 4AJLA 3I1JA 4YRAA 1LXCA 1YBAA 2CY0A 4CM9D 2NQTA 1BRMA 1YBVA 5A3JA 1B3BA 4PG7A 4BNGA 2B35A 1C1XB 3L9XA 3MJTA 3CE6A 4IPTA 3DMTC 1PZEA 3RVDA 2GYYA 1SEPA 4BMNA 3W4KA 1RYDA 4PLTA 4S1VA 3W8DA 3TPCA 4N54A 4I9NA 2AXQA 2ZQZA 3GAFA 4RPJA 4TSKA 4EGFA 4YT4A 1UDBA 4OSOA 3ZW9A 1P1RA 1Y1PA 5EINA 3NYWA 3JQGA 3OMLA 1JVBA 1R4MB 3MJCA 1NHWA 4FBGA 1U4SA 2Y68A 3H9UA 2A92A 3ZHZA 4YDRA 3AWDA 1EFLA 1AN9A 1KIFA 4DTIA 2UAGA 2NU9A 4IXTA 2J5RA 2O3QA 2B5VA 2NVWA 5CEJA 4GVLA 4IZHA 4QX6A 1B7GO 1W6UA 2YUTA 1IYZA 2WJPA 1ZXLA 2O2SA 4UUNA 2AQKA 5H82A 3JQFA 3ZGYA 1TVEA 2CNBA 1Z73A 2UYYA 5CG2A 4OXNA 5THKA 1B8VA 1PGJA 2EIHA 4XIYA 4GSKA 4FR5A 5A5EA 1YDEA 2VT3A 5IN5A 5L7WA 3DHNA 4XYGA 1PQUA 1PJLA 3L4SO 3F5QA 3SBOA 1KETA 5T67A 5ER6A 5J9GA 4UVHA 3ZV5A 1LDYA 2X9GA 3AY7A 4W9NA 2D0IA 1GPDG 1F06A 4MVJG 1EE9A 5TNXA 4J16A 4PLVA 7ADHA 4PLGA 3KYCA 4G5HA 2D4AA 4R9RA 4DWVA 1NFRA 3DAFA 3H3FA 1V9LA 4I5EA 3O26A 3WSVA 2C20A 1Q7GA 1VL0A 5U9CA 2A4KA 3H9QA 4R9SA 3OEWA 5DDIP 1AE1A 2Y05A 1RM5A 2C7VA 1EE2A 3GVCA 4AJNA 1NQAO 4E2XA 4U0KA 1DFGA 2PKQO 2POQX 4UUMA 4UVEA 2YYYA 1RYEA 2J3JA 3F5SA 4E5KA 1F0YA 4GKVA 2QG4A 2Y99A 3I4CA 4RVGA 1YBMA 4WOJA 3HFSA 5KJ1A 3OF2A 2VRCA 2NLOA 1E6EA 1EQ2A 1YL5A 3GH3A 1I01A 1X7HA 1U3VA 3PDJA 4P8RA 4HFMA 4J7CA 1Q0QA 1VL8A 1GU7A 1KY4A 4FFRA 1OOEA 5I9MA 4P4LA 3U09A 2DBVO 4BV9A 3TFOA 2Q45A 2WTBA 2Q1TA 5IZ4A 4MPDA 3ZDFA 3KYCB 4CV1A 4DLLA 1PGQA 5I7EA 3FSRA 1NP3A 2DKNA 1PZGA 2Y1FA 2B4QA 2FZEA 2ET6A 4J7XA 5BNTA 3WGTA 4E31A 1U8FO 4XWYA 3DMYA 1BVUA 2DTEA 3QQPA 5JS6A 4E3ZA 1HE3A 4NI5A 3VC7A 4ALMA 1B3RA 4J2OA 4QXMA 2PA3A 4DQUA 5IDYA 2ZYAA 3RJ5A 3MCVA 1V3VA 4M1QA 2BFOA 4XQGA 1I2ZA 3DBLA 1WDKA 1C0KA 3A06A 4BNZA 2FR1A 3Q2IA 3F4BA 1YONA 3VH2A 5ADHA 1OI7A 4NDNE 1U8XX 4RPLA 1N8KA 4CODB 5BSEA 4XQ9A 1O89A 4HUJA 2EKQA 4IDDA 1OAAA 4CLOA 4BL5A 2B37A 1K6XA 2BGLA 3G1TA 1ZK2A 3DMTA 4TQGA 4WE3A 4EZBA 4PCVA 4KWHA 2P4HX 3OIGA 2W90A 4HV4A 4N18A 1JWBB 1QYXA 2YDYA 4E30A 3LF1A 3NT4A 1PJBA 3I9OA 3HDJA 3WMXA 4RORA 4ZJUA 3FF4A 1VLLA 5EPOA 1E3WB 2YV3A 3ROMA 1LX6A 2VUSA 1N9GB 3JD4A 4J49A 3LLVA 2ZB8A 4WEOA 4BKQA 5KCZA 1E3LA 3QW2A 2O3SA 4O1MA 3QVOA 5I7SA 4WJZA 4MKXA 1MLDA 2IXAA 2HMSA 3I3OA 1VRWA 4WEQA 4CMBA 4CMIA 1DLJA 5C3MA 5L4SA 1EUZA 4W99A 5FI5A 2VT2A 3ZWAA 4YYZA 3K31A 2DBQA 3OSUA 4IMPA 4YT8A 3GHHA 5L51A 4JCOA 3RFXA 1BDMA 4RVHA 1YS4A 4IJWA 3WQRA 3ZWXA 4NK4A 2PV7A 4OO3A 2NVUA 1X13A 3FTPA 3GVPA 3HWRA 2HMTA 3DOCA 3GVHA 5IDWA 2JKVA 2NQ8A 4R3WA 4BNIA 1B8PA 2PWZA 3JQ8B 3SLGA 3AI2A 1DRWA 4D3FA 2BHLA 1CIVA 3BAZA 2GZ3A 1ZO8A 2JCYA 1N9GA 1GZ4A 3AM5A 3K6JA 1FK8A 2P2SA 3G1UA 3RASA 1IL0A 3MEQA 3CH6A 4MDHA 3SVTA 3EUWA 3U4IA 4R1TA 3ZV4A 4J4TA 1Q7CA 1KEPA 4ZQEA 4CL3A 4DREA 4EJ0A 3OEYA 2BD0A 4E21A 3JQBA 1PGNA 1GTMA 1ENZA 1UP4A 5JYAA 4E5NA 3WLFA 1ARZA 5F3RA 1HLDA 1LLDA 4HP8A 5FI3A 3IDSA 2WYUA 3AJRA 4WOKA 1O0SA 4U8GA 5KJCA 4CQMB 3IIEA 3VZSA 1I36A 1HDGO 2DM6A 4D3SA 4BO1A 1EMDA 2DTDA 4P22A 3JQ9C 3O8QA 4FJ2A 5CPBA 2OMEA 4N7RA 5IZCA 4QO7A 3LC1O 1P44A 4BHTA 3U9LA 3GUCA 4Q3CA 5ES3A 3TN7A 4OKNA 3ZV6A 2X8LA 2YHIB 4WNIA 1AXEA 2IYOA 4XGIA 3VH3A 1H6AA 1MC4A 1UXGA 2EXXA 1BXGB 4GWGA 3VH4A 3UHAA 3ZHXA 4MVJD 2FR0A 3GGOA 1UXIA 4Z9XA 2FRDA 3FWNA 4IDFA 1LTHR 3ZU5A 2I5PO 1GV0A 3OIDA 4FFOA 3WMWA 3KXDA 2ZYDA 1J0XO 3RUEA 1MXHA 2OOSA 2EKPA 4CMIB 1QKIA 1BG6A 1X7GA 4B4UA 4D42A 1Q1NA 4ZHSA 2GPTA 2OHXA 2TMDA 2BRUA 3PRJA 4RQTA 3MJEA 1YDWA 1MFPA 3DZJA 2Q1UA 4RF3A 5JAZA 1NASA 4HWKA 1EK6A 3WICA 3Q1LA 1T24A 2Y1CA 4XD2A 1E6UA 3OH8A 2D5CA 3F6YA 3ONFA 3P2OA 4O5OA 3IMFA 3PGJA 4FSHA 3DO5A 3I52A 3K30A 5A04A 2EERA 3CZRA 3ROPA 2HRBA 2C0CA 2X23A 3PQDA 2X0RA 3I9MA 4F6CA 1EFKA 1HL3A 3DOJA 3EGOA 3QY9A 1ZUD1 3PLNA 3KV3O 3JQAB 5G0WA 1KVRA 3A4VA 3OJLA 1DB3A 2YV1A 3O38A 4RVFA 2JCVA 1FJHA 2AQ8A 2GR9A 4QT0A 4TZTA 1HRDA 1WVGA 2VCYA 4W9NC 1LUAA 3UAGA 2WE8A 3V2UA 3GG9A 4MVJI 4BS9A 4CQMA 1HDRA 1H9AA 2HAEA 1JQBA 1I24A 3ZNNA 2CF5A 2VOJA 3AI1A 3GFBA 5COBA 2FMUA 3VDRA 3WGQA 4XYLA 3M2TA 4EUHA 3P5SA 3RCBA 3UICA 4E5YA 1Y7TA 4L4XA 2FHSA 2VHYA 3L07A 1EBUA 5EESA 3E9MA 3U4DA 1VSUA 3WXBA 2G0TA 4CR8A 1G0NA 1U7TA 1DIBA 3FPLA 3PJFA 1T26A 2HCTA 4NG5A 4IQGA 1DAOA 1Y6JA 3GNSA 1Y8QB 4K28A 5A3VA 5M6DA 1PJTA 2B5WA 1VPDA 2RCYA 4EW6A 1EVJA 1GL3A 2ZB3A 3C8MA 1ENPA 3C1AA 2VWGA 1DLIA 1KS9A 4XR4A 1NVTA 3NJ4A 1UH5A 5A9TA 3LK7A 3JQ7A 4CV0A 1B14A 3WS7A 3IL2A 1R4MA 1UXHA 3HJAA 3TDKA 3E1KA 1R6DA 5L4LA 1KVTA 2IYPA 3GGPA 4D43A 4NJOA 3KLMX 4M54A 3MJSA 3WFJA 5JSFA 3RWBA 4CMAA 3PHIA 3OBBA 1SMKA 4L74A 1TLTA 2CZCA 1P45A 3LT1A 3GN2A 3F47A 3T7CA 1V6AA 3V1TC 1PL8A 4EYEA 2PZJA 4BO8A 3MWDB 4E0BA 3NX4A 4D0SA 6LDHA 3VTZA 5T6BA 3GQVA 3ZH2A 3B1FA 4KTVE 2I6TA 2O3UA 3JYOA 5DCUA 3VPXA 2GZ2A 2LDBA 3VVCA 3KM0A 3D0OA 1SOWA 3DEYX 3WOHA 1ZXBA 4CMEA 2C59A 5JFOA 5L9AA 4I9HA 2PZLA 1DIHA 2E4AA 3ZWBA 3QWHA 1N7GA 3AY3A 2PNFA 5TRTA 3PWZA 4M89A 3O9ZA 1ULSA 4RO0A 3TFQA 1GY8A 4AJKA 1GYQA 2HSDA 1M76A 2ILTA 1SBYA 4UVGA 4YPOA 3H6KA 5MDHA 4CM4A 2WWRA 3LC2O 3LVFO 4NH4A 3RUIA 1P1FA 3WGZA 2QHXA 4YTEA 4E6PA 2VTDA 2A94A 1FXSA 4NK5A 1NQOA 4EUEA 2GN6A 5T5QA 1P33A 4NZ9A 4B4OA 1F8FA 1MB4A 4WCFA 2Y1OA 5FFFA 4D0RA 2NU6A 1BDBA 5L4NA 3CSDA 2IDZA 1SPXA 2CSUA 1B0AA 1NVMB 1A7KA 1PTJA 2QRJA 1FDVA 1GUZA 1QV6A 2WYVA 3DONA 4JJFA 3FHLA 4CMEC 1Y8RA 2F1KA 5B4VA 4YQZA 3TOXA 5DP2A 1AGNA 5LC1A 4LVUA 3ZNOA 2JL1A 4PG4A 4GX1A 1HDCA 1UXKA 1L7EA 2BFMA 2OBYA 1DIGA 4AJ1A 2P9GA 3HN7A 2IZZA 2Z1MA 4M55A 4QSMA 4R41A 4OXKA 5JYFA 5KVSA 1PIWA 3GMDA 4XYEA 2O23A 2GLXA 4RL6A 1U5AA 4XX0A 1VJ1A 3G79A 3L4BA 4IM7A 4EEZA 1D7OA 1MXFA 1DIAA 1R0LA 4YRBA 1ISMA 3W4IA 1SNYA 5KKCA 5DT9A 3GNTA 2V6MA 2O2YA 2YQ5A 2Q49A 1MV8A 3DTYA 4JROA 2PKQP 3ADOA 3VPFA 1R4NB 4II3A 4GPD1 5G0VA 3DZKA 1QP8A 3RBXA 4CV2A 1R0SA 3AW9A 3DWFA 1E1LA 5AQ1A 3EMKA 5HS4A 2ZTMA 3VHRA 4KUHA 4XQEA 3NDRA 6ADHA 2UVDA 1DC3A 5TSDA 3UN1A 2VZ0A 4I5GA 1XYGA 5DOVA 4B3IA 5GMOA 1JLLA 1HKUA 1U3TA 2UDPA 5DBGA 5CDUA 4LSMA 1GDHA 2RBEA 2X9VA 3PHHA 3VVBA 4DRYA 4BGEA 4MVJF 5AXDA 2EKLA 1TT7A 4JNKA 1BGVA 4Q9NA 1TT5A 2G82A 1ULUA 4IJKA 3WNVA 1OMOA 1C0LA 4MVJA 1NHGA 2FOIA 3DHYA 3FBTA 3ZV3A 4BKUA 2Q46A 1DPGA 1WAMA 1XELA 3KYBA 4C7JA 4LMPA 4TZKA 3WR5A 4PIVA 4DBVO 2VYVA 3WJ7A 3WQSB 1DFIA 2JFFA 2X6TA 1E1MA 3LDHA 1XHLA 1SB9A 1XLTA 3PYLA 2FPIA 3K8ZA 4A03A 4DPLA 4YXFA 3GEDA 4UEJA 5B4TA 4AL4A 4IDBA 5A03A 1IOLA 3B70A 5JAQA 1WMBA 1Z82A 2IEDA 1HE5A 4Q3EA 2OXIA 4RPKA 9LDTA 3E5MA 3PWKA 1ZZEA 2C7GA 4A27A 5JXWA 4BB6A 5ICMA 2DTXA 5L95A 5F5NA 3RI3A 4R54A 2H5LA 3RQSA 2ZCVA 4X54A 4FIZA 4J1SA 4MJLA 3RKUA 5CEEA 3G17A 4FC6A 3U0BA 3A1NA 4GX2A 1A9ZA 4D3DA 1LU9A 1HF3A 4HX5A 3I9JA 3ANLA 3D4OA 1YKFA 4HADA 5TS3A 3UW3A 1ONPA 4PG6A 4DVJA 4MP3A 2DUUA 1B8UA 1GCOA 1S6YA 1Q0LA 5DULA 3U3XA 1E7SA 3GA0A 4LRTB 4N5MA 3OA0A 1JW9B 4W7IA 3OJ0A 4ID9A 1MA0A 4R1NA 1JU9A 3IC5A 7MDHA 5HTOA 3JYNA 4INAA 5HA5A 3HDHA 1H6BA 4IDGA 1C1DB 2X9NA 2DBZA 1RM3A 1DIRA 2AEMA 2B4RO 3EZLA 4RLSA 4TVBA 4CR6A 3SJUA 1BVRA 1MGOA 5ILOA 3RJ9A 1HYHA 3HZZA 1TXGA 3BTVA 1T25A 3NTRA 3I9LA 4BNNA 4NJMB 2X0IA 4RPHA 3WYCA 4U0JA 5F21A 2H9IA 1OBFO 3IS3A 5ICSA 3H8VA 1GUFA 3NGXA 1T4DA 2IZ1A 3KYDB 2D1YA 4TVOA 3VZPA 5JYDA 4TKLA 2RHRA 1J5PA 5CG1A 2ZCUA 1NNUA 4JBGA 4CLHA 5KVCA 1U4OA 5IDXA 2GASA 4U6SA 3ZWNA 3AM4A 4W7HA 5GY7A 4J91A 1O6ZA 3WTCA 1Y9AA 3JV7A 1DSSG 3BHIA 5IXSA 3FNHA 1E5QA 1N1EA 1HTBA 4ZVVA 1LLCA 3HDYA 1SCUA 2HK9A 3FD8A 4KUGA 4NBTA 2B4TO 3RUAA 3ZHYA 4A2CA 1NYTA 4R5HA 4ZQGA 1XG5A 4KUEA 3L0DA 3AFMA 4GH5A 4BKPA 2VNSA 1PU2A 2G1UA 3EAGA 1Z7EA 5TLSA 2VHXA 1ZCJA 5KVQA 1YVEI 3NKLA 5EN4A 4CMKA 4R01A 4YJFB 4B7UA 1ZSNA 3DBLB 5BQFA 3OQ6A
chains in the Genus database with same CATH superfamily
1MOQA 3WHLA 3RD5A 3P71T 3NEAA 3ONWA 3HI4A 1W59A 6PFKA 2GKSA 4N0DA 5FIUA 3R7WA 3EVDA 3HCPA 4MQEB 5JMPA 4EMBA 5B3JC 1WXDA 1K0UA 4QSHA 5GVSA 2O19A 2AMFA 4L4SA 1E3TA 3T1QA 1CKEA 1U3DA 2HOQA 1D4OA 2VYNA 1VL1A 3FUTA 3IBYA 2ORVA 3LRPA 3OLWA 1QHEA 3P32A 2ONYA 3A8TA 4G9GA 3VPAA 1GGJA 4LWPA 4N12A 1ICIA 2QYOA 2H2GA 5EVCA 3GGJA 3KQNA 4LVOA 2ZJFA 2WPNA 1Q95A 2ASEA 4GOND 4D44A 1ZUIA 4KR6A 2IK8A 3KL4A 4HVCA 2CLFB 1KHTA 2VTVA 3CNLA 4ZAGA 1QM5A 2HSGA 1LX7A 3AKZA 1NIJA 5LQMA 5JCJA 1K08A 1QCCA 1MH9A 1GADO 5IZCC 1G5HA 3LT2A 2IDKA 3IR5A 1PTJC 1QYVA 2CMGA 4D74A 1G8MA 1CULC 1J1IA 5HQ3B 3TZEA 5JC8A 1JPNA 2R65A 2NNLD 3O90A 2WIDA 4RMHA 3LZCA 1KMQA 5CP8A 3PRHA 5ABPA 3M4ZA 5THQA 1A50B 4HY3A 2RGAA 4MR8A 3RGWS 3VZBA 5ES4B 2PZKA 5TQ0B 2WFZA 5ILGA 1OI2A 2JLQA 4B76A 1R6UA 1JEEA 1XTSA 1NWHA 2C1ZA 2FOLA 3OPYA 4X3PA 2RIPA 1LS1A 1CC1S 2IEGA 3WNZA 4DY6A 2F1IA 1N3IA 3N75A 1OZFA 1HETA 1I8TA 2R6JA 3BZUA 3SHQA 1QORA 3AXSA 3NCTA 2YJZA 3RREA 1N2CA 3RROA 1XGKA 3U0VA 4DM7A 1WUTA 4HDRA 4IX1A 4DXAA 2Y67A 4DUZB 2PUGA 1EFPB 1IXYA 2CCGA 4AK9A 2EL7A 1EFVB 3H11A 1TPZA 3B78A 5TQJA 1OC4A 2NUPA 1Z26A 1T5BA 3GF4A 4BC1A 1T0PA 1H42A 1RAAA 2O0HA 1HMYA 3KPWA 3EODA 1JPUA 3ODPA 1WQ4A 1MJFA 2H4XA 2M98A 2P11A 3QV1A 1C2TA 2VPQA 4JR1A 4MK4A 2HXGA 4ONEA 5ERXA 1KEKA 1E2QA 5JY1A 1QZTA 2GPWA 3BBPA 4YR9A 3EWAA 1PS9A 1Z5GA 2EDCA 3WMGA 1QQAA 2L69A 1AZWA 1EZZA 3H9EO 3A4IA 3FCXA 3QI2A 4TWZA 5G2OA 1ZLXA 4KGVA 2B92A 5FUVA 1GAXA 1L5FA 4NRDA 2Q2QA 3G3EA 1L8QA 4DIUA 3JR7A 2JG3A 4MQEA 1J06A 1EFRA 3RPEA 4RMIA 4BXOB 4CZ2A 2QLJA 5LD2B 2AW5A 1E2MA 3NNSA 5CIWA 1DAFA 3ZCXA 1FSFA 3ER9A 2VQEB 3E7WA 4HAYA 4LE0A 5EMLA 2PUVA 2I3GA 3D3KA 3ZIAA 2ESRA 4QQFA 1BHJA 3E9CA 1KVSA 1YD7A 1U2RA 1F5SA 3QXSA 4WK6A 4GE0A 4ALIA 5BNIA 4DRXA 5E8JA 1KIMA 5CX4A 1CVLA 3MRSA 2OE2A 4AURA 1XCPA 4BO7A 2RI6A 4N49A 3TL6A 4W5RA 4OKIA 2WM2A 3W8RA 1HTWA 1T4GA 2PGIA 1LWNA 3M6UA 4HGZA 2NYVA 3OCJA 4HQLA 1TM1E 4NNOA 2FG5A 2Z43A 3EPRA 4MV0A 4CKCA 3QEAZ 5I8WA 3ND8A 1REQB 3GUYA 1RYBA 3Q7QA 1KBZA 2XE7A 1L1EA 1T1RA 1EUDA 1O58A 1POXA 4UHEA 4UTXA 4RGYA 4Z6KA 5K8VA 3FNQA 3PGKA 4HT3B 4QDJA 5AKEA 4ARZB 1E6WA 4HQNA 2Z1NA 5KS2A 2HWWA 3C45A 4P4TA 1AM4D 4M86A 3FY4A 1A69A 4V38A 3X1ZA 4YRIA 4M9QA 2QPOA 1H4SA 3UFBA 1LLFA 4EUNA 3HCDA 4ARSA 4BO6A 1ZAKA 1ZJ4A 4BFWA 3L6BA 2Z09A 1SY7A 3BFJA 2O54A 4XJSA 1CY1A 1KXZA 3PC4A 3T7EA 1FFCA 2VBGA 2XOKD 5AI9A 3BQ9A 3TQSA 4M88A 3F6EX 1FMJA 1SULA 1NVFA 1JSZA 2SNIE 1C41A 3OQ1A 3TIXB 5JDIA 3CVJA 2RGRA 5L7YA 4AS1A 3JTMA 3NWEA 1UWKA 3GJ8A 3SSMA 4BNJA 2PSJA 4RS4A 2J6IA 4F96A 4G1VA 1C8VB 1AUPA 4FBMA 4R6XA 1VE9A 4ZKDA 2CLOB 2QY9A 2V8BA 3AIKA 1UT6A 1CJKC 4YCDA 7YASA 1UBMS 5K0LA 4S05A 1I1OA 4IKEA 2YWDA 4RS3A 1N2OA 3KT0A 3EVZA 5ECDA 3X43A 3CVYA 3S3TA 3KR2A 3KLOA 1UWLA 3FGNA 2G25A 2I03A 1XDGA 2BN4A 4PYQA 3KKNA 4MO9A 4QHSA 3SCZA 3WK8A 4C08A 2EL9A 5HKBA 5HJEA 4RKEA 2KI5A 2DE0X 1Z5WA 3VNBA 4BRSA 3RSZA 1EGQA 3FWKA 4UAVA 2O52A 3P26A 4C4RA 2J3MA 4ROSA 2BTQB 2DPHA 1VJTA 1IZ8A 3IMEA 3UGQA 3LGXA 4P54A 3D4NA 3EPAB 4W8HA 1GNSA 1TYEB 4LOIA 3EEBA 4GYWA 1F12A 2PVCA 1O96B 4G5RA 4MV4A 1YF3A 2BH2A 2CLHB 5C4GB 1K4YA 5G53C 2A3NA 2JH3A 1V8BA 4ZOEA 1LDBA 2AFHE 1BVHA 5C8YA 2WEKA 5DM1A 2K2QB 4OI4A 4LZAA 4EL0A 3WYBA 5CNKA 4BQNA 4ER5A 3CBQA 1REQA 1EHCA 3PD0A 1Y8AA 4BUJA 2EJCA 3EBPA 3PGA1 2CE7A 1QYIA 1LK0A 1TD9A 3M6VA 1PW7A 4JLKA 3I0ZA 3OFSA 1GDTA 1XZPA 4E13A 1H6DA 1WPGA 5A9RA 3W5HA 2BLLA 1V16B 3OAAA 2NAFA 1Q74A 4L02A 3K8OE 1RXEA 3GCGA 3AKEA 4X1IA 1UWVA 4QRIA 3CCFA 3ZGOA 1BMTA 1X7YB 4EG8A 1I2DA 1EVZA 1D6MA 3FCCA 5A6VA 1N2SA 3CUTA 1Q15A 3WO1A 2ODBA 3LT0A 4GF5A 4AY4A 5CB4B 4RULA 3EZ2A 1NNLA 1JQ3A 3BZWA 4PGFA 1BWQA 4PLHA 1NDQA 1MABB 2ZWVA 3M70A 5JSQA 2KM1A 4UTZA 1GZ3A 3MB5A 2PZMA 2FLWA 4FYXA 3LQQA 4MTLA 5ALDA 3UH0A 2ORIA 4RZQA 4DSOA 4RTLA 4B3TB 9MHTA 2PHZA 2A0XA 4I1OA 4CIWA 4LA4A 3OJEA 5JCXA 1E77A 1J25A 1MAHA 4HMPA 2ZUVA 4DWWA 5BQPA 3Q8LA 2QPTA 3K9HA 4D99A 4F92B 5JLJA 1QRRA 2NWQA 3GRZA 3L0OA 4CEJB 4I9GA 1LPNA 3F4LA 2VHWA 3O74A 4DDHA 4ZT2A 4J7AA 5LPNA 4OOEA 2YY7A 4BFUA 2H1LA 3KAKA 5H81A 1OH5A 3LX6A 1ESNA 3QVSA 1UQUA 3NVDA 4QDTA 4V0QA 5JBQA 5B1DA 2LDXA 1CY6A 2WF5A 2FCRA 2KHZA 3DFUA 3R7SA 1FSZA 1Z06A 4DS3A 4S1TA 2F8SA 2B98A 3UQZA 1FYEA 2BFNA 4MQBA 3CPSA 2WWXA 3P9CA 1T3TA 2C4MA 3BIJA 3C3MA 2P9ZA 3WHIA 5MGBA 3PLAE 3I6ZA 1VP3A 1PS8A 3N7AA 3M9WA 3U4GA 3QLVC 3GU3A 3FROA 3L8HA 3G0CA 2VH2A 4JAVC 3WBBA 1Z68A 4AJOA 2HQBA 1ATZA 3OETA 3VO1A 4IIUA 4RTSA 3FDXA 2ZRPA 3CPEA 1TTHA 4GOJA 4MRMA 5DPMA 4QTTB 2XYRA 1LC0A 1QIMA 1UKVY 4AU1A 2A9RA 5FTNA 1MP0A 4B2IA 3HNOA 3IMGA 1O8CA 3C5WP 4D26A 3WLKX 3KKOA 1X19A 3ZR4B 5TARA 3BGDA 3GY0A 5EIBC 4HNAB 1XQYA 2G71A 4B44A 2WAXA 3W0LB 4CF5A 3HA2A 3S8YA 2PXAA 5HM8A 4FHDA 4LOAA 5AKYA 2P4EA 3H5WA 3ZEAA 2GO1A 2OD7A 4TTIA 3P0HA 2YRFA 3VSBA 4E88A 5HF5A 3CVUA 3MMZA 2G6TA 2VOEA 5KU7A 3DE6X 3L43A 2OBFA 4RQBA 4PHGA 1F1BA 3LM8A 5ARCA 1XTUA 5IAAA 4Q4AB 3LDGA 4EO4A 1FUIA 4C7XA 2EDAA 2VKQA 3RH0A 4UBLA 3IEUA 3FDZB 3I45A 5JFTA 1P0PA 1AMUA 4YLGA 1MABA 2HGSA 5G0TA 2UUCB 1QE0A 1RW4A 5BMVA 3OU7A 4FJ0A 3X1DA 1W49A 4JP3A 4UOEA 3T3NA 1JECA 2WMOB 1G60A 4IOLA 4GSLA 2JARA 1KDOA 1O2DA 2ZVPX 1JVSA 2RIRA 13PKA 1JILA 2QA5A 2VPXA 5EIAA 4W5TA 1GFIA 2WHPB 1UBSB 5BRNA 4AS3A 5DNCA 4YJ2B 4JKOA 3OT5A 1L4HA 3NRJA 4OHFA 4QUGA 1O5OA 2PD4A 3L2OB 5EKSA 2FOXA 2R7KA 3EGXB 2ZIXA 3QU5A 4GXTA 5KNDH 2B4AA 4JX8A 3IAEA 3MJDA 2OUKA 4E12A 3EMVA 1UZMA 1B2RA 2PGLA 2ZPUA 5A5VA 1A8SA 3NC4A 4YDSA 2VK1A 1BW9B 1FYDA 1OXMA 4XR9A 1V1JA 3K6SA 2WVHA 4KH1A 4LJKA 3EXEB 3DM9B 3PFFA 3ACDA 4EPWA 1DBPA 4DQDA 1P2FA 1DIOB 2OD2A 2Z58A 4DUPA 5I01A 1R8YA 4K1XA 5DX1A 2O59A 1IULA 3EQ8A 3ZLTA 4L6IA 3DE3X 5K0BA 2GXUA 1FVHA 4K6KA 3L7CA 1HEUA 1TZJA 3OJFA 2VXYA 3HKDB 1XQVA 2A5GA 3JR3A 1KZ6A 4EOGA 2BT4A 4EPXA 1XEFA 4WZAE 1UBLS 2WDPA 4ATNA 1JLLB 2YJ4A 3HLTA 4YRDA 4IJUA 2GHQA 3VSCA 5IXYA 5FHRA 1WUIS 4N82A 4OP1A 3UVEA 4JP2A 4X65B 3VU1A 1T1SA 3ZTTA 4QUEA 3VGPA 1QDEA 1U98A 1ELOA 1WXGA 2FPPB 2XR1A 3D7SA 3EYAA 4W9RA 2AOTA 1U3CA 4J0GA 5FPSA 1KFJB 3G49A 4GBGA 4Z9YA 2WFMA 3LCRA 3Q6IA 1JJ7A 1YR1A 1ULZA 1NX6A 3AKYA 1OD6A 2CVQA 4AWBA 1SCIA 1NJFA 1YB6A 3D8TA 1PK8A 4GWLA 5DLEA 1K7SN 2IY8A 3AW8A 2YZ2A 1YZGA 1T2CA 3OKFA 2QTVA 4ZI7F 1QWOA 4BMXA 2AE1A 3RUCA 2EFJA 5KIAA 2NTEA 2R7AA 1OGIA 1KQGA 4QFDA 1XUOA 2QM8A 4FYMA 3R2JA 3ZOKA 3VOSA 3PVCA 4X84A 1EA5A 1PR9A 5EWMB 2CYCA 2AN4A 2V4MA 3UMCA 2ODEA 2CFSA 1OJ7A 3C41J 1H22A 4NS4A 4QHYA 5AM1A 2BE7A 2NZWA 1BU8A 1G3MA 3UJDA 3PXDA 4DCSA 2YVAA 4NZNA 4ZYVA 1LBIA 3HCEA 4PWYA 1QLHA 1EXWA 2RG1A 4ILEA 4S1PA 1XQ1A 2FCAA 3WMFA 3RB8A 1P19A 4RVUA 1HDOA 3T61A 4NMXB 3P9NA 2JD2A 3F3SA 2PZFA 3FA2A 1SG0A 4LJ5A 4R16A 4A10A 4HNHA 4I6JA 5EMHA 1J5XA 1K5GA 1L7DA 1MORA 2TSYB 1Q57A 1EWVA 3PC8A 4K6MA 2IPAB 5F3WB 2MTBA 3IUYA 5JS7A 1NW7A 5K3EA 4KV7A 3INGA 1D6NA 2EWWA 1H9BA 3V6LA 1FU8A 1XTIA 2PO7A 3C3XA 3ZWDA 4CJXA 4BWFB 4WKPA 621PA 5JCPA 2JH9A 1G9XA 1NN1A 1XVVA 2NZ2A 3BMNB 3F98A 3JQAA 4CM8B 2Y2VA 3CUKA 1QV7A 3LBNA 2QEQA 4O6VA 5EFZA 1JHPA 1FSSA 1AKRA 1ZGHA 4JZYA 4XUEA 2VR1A 2J41A 1P9OA 1QHNA 3LBIA 3OECA 1AS3A 4B3HA 4PYJA 3H87A 1QYWA 4YCSA 3QY0A 4A8HA 2PK3A 3R3JA 3QEMB 5K3DA 1PQPA 4GYKA 3RGGA 3ZE9A 4DLPA 1TJNA 3GRFA 3P94A 1LY1A 3AM3A 3OLQA 4BNFA 2VFAA 1TJYA 3OQIB 4K05A 4OHRA 1IN8A 5B3JA 5ECWA 3V8VA 3GLFA 1AB5A 3SC4A 2RHMA 3DWGA 1WOMA 2FPWA 5KOHB 3IEMA 3VSAA 5AD1A 3FXAA 4L3WA 2YNMD 5EJ4A 1ADYA 1USUA 3IPXA 2Y71A 3OPQA 2OLJA 4JB2A 4NECA 5B57C 3PU6A 1JKIA 4EK9A 4UHDA 3P5BA 2IXBA 4C4OA 4QOHA 1ITZA 2AOTB 3M5CA 2MR6A 5BT9A 1DQRA 2X14A 4NLLA 1BWSA 1TA4A 2VO1A 3BB3A 5KYTA 2B0JA 5AIAA 1DO2A 1VKZA 1WPQA 3QUTA 5CH8A 4J29A 5FOSA 2YHAA 4F0JA 5JXJA 1O57A 2X8JB 1C7EA 3JYLA 4FOOA 2QK4A 3W6NA 1RTKA 3VKVA 2H11A 5TQVA 2HHHB 1C7ZA 3UK1A 1M67A 3NTLA 2ZRGA 3QFTA 2A5DA 1QLJA 3GDGA 4GBED 3W4JA 1ID1A 1QK5A 5DEIA 3T9BA 3VDMA 1XPUA 2IDJA 1N2HA 4EKIA 4NBLA 4R8RA 2CDRA 4ZVRA 3K15A 1ZY2A 4EUSA 4ZO8A 4JXKA 3BFKA 4IIDA 5JDCC 3K1YA 1AUQA 3KVOA 4JBIA 4B9AA 3AERA 1T6YA 5BSTA 1W73A 2AJDA 3PIDA 4GFDA 2CXXA 1T34A 2BHSA 2MYUA 5AOVA 2GAJA 5K8UA 5IFLA 1Q0UA 4GQBA 1IM8A 3TTUA 1A0OA 2Q2VA 3KOUA 3UCFA 2C4KA 5L45A 3U56A 2C2KA 1QQ6A 1THTA 1Q92A 4UNSA 3JQ8A 3SXUB 4G01B 1J7JA 2HIHA 5LQCA 1PLLA 4FD3A 3CA8A 1QRDA 4Z5XA 3HFGA 3OFNA 2VKTA 4CM8A 3C8HA 3LHIA 1U9JA 3QMWA 4D41A 1F60A 1H8EA 1WMDA 2GCOB 5AJYA 1CJBA 1NVGA 3A36A 1QRAA 1JT2A 1O97D 2PSEA 3I05A 3R3SA 4LDPA 1UAGA 4R9UC 3LKDA 4IOJA 5G1OA 8ADHA 3PDCA 4JFAA 4LZNA 5G4KB 4EKNB 1T9GS 2MOKA 1GKKA 4ARZA 2RHJA 3ORQA 3T4XA 2D1TA 4I1VA 4PWZA 5E6UA 1LDGA 3DYBA 3UMRA 1C8BA 1K89A 1EVKA 4QTZA 3WRWA 5JPIA 3V8NA 3KQTA 3QPDA 5EGSA 1IUKA 1YMQA 4BYGA 4E32A 1J49A 4RK4A 1W0JD 3B9QA 1RM0A 5DGHA 4EF6A 2DHDA 5KB3A 3HVHA 1KWKA 4F9GA 1LNSA 4BNDB 1NM5A 3UF0A 1ZI8A 1SB8A 4YC7A 1KVUA 2P3LA 3IERA 1DUIA 4OJKA 5TB5A 2L42A 3DEAA 4CLEA 2J32A 2P3OA 5KSOA 1PE0A 2D1SA 4HNUA 4R1LA 4KACA 1N0WA 1J8DA 1B8NA 5JW6A 1DEKA 1XAHA 2BV3A 2FFBA 3L7AA 3QGMA 4LZWA 2G17A 3IP9A 1U2GA 4AJPA 2P9BA 2BZ0A 2J3LA 2VP3A 1UBKS 4TMWA 5CJPA 3QUQA 2XXBA 3K9QO 1JG7A 2EJUA 4I19A 5LDHA 2OCIA 4HWGA 4I3FA 2FUG1 3WNQA 2AXNA 2QXTA 2BFPA 4EYGA 2FE1A 3I9NA 3ZI4A 5I9LA 2HRZA 3T35A 2E5LB 4J4BA 1HXHA 1ACMA 4U2EA 1JG6A 4WZBA 5CM2Z 5DH9A 2P2GA 4F9FA 3H65A 1WNTA 2GJ8A 4ZU1X 1PR3A 1Z6QA 1I1NA 5JASA 3OIUA 4PFKA 2JLVA 4IQ0A 5KTTA 1USKA 1NPDA 2QJOA 4IMRA 4XVRA 5FP0A 1EUCA 1IPFA 4L4RA 5CX1B 4Z9FA 5M5BA 1FDUA 1N1DA 1T36B 2FNAA 1I13A 4H3VA 1Z6ZA 3ABSB 3OJWA 3V1UA 3EPLA 1DKMA 4KB5A 4MWEA 4ARAA 4TGLA 1OXKB 2ORYA 1I7BB 1DOAA 3OA2A 1QCDA 1XLVA 2C03A 2MYTA 1YO6A 2PV0A 4HAVA 1GZDA 3FOAA 4I50A 4B8ZA 4BUZA 1G2QA 1KAEA 3FMVA 2EGUA 2I6QA 3JQFC 3IHLA 1GKYA 2P8JA 1JHZA 2C8JA 1DKPA 3AJEA 4MPJA 1VECA 1NFQA 2JZOA 5KHOC 3UGKA 1SZJG 4KAJA 2CNWD 3SM3A 4ME6A 1G9SA 1NQ5A 3O3MB 2ATVA 1RWVA 3JWHA 2PGOA 2HDNB 3ENVA 2BHNA 4I1SA 2XBLA 3HKCA 3PUWA 2LCQA 1KEUA 4RFVA 3C7DB 4C7BA 3OOHA 2J4DA 3WBKA 2VJMB 4JLOA 1N25A 4U3JB 1IB6A 2Q3DA 3NBKA 4KYTA 3RYIA 1W94A 3F9CA 3FTCA 5A62A 3HVRA 5T8KA 4CGZA 1XO1A 3HCWA 4WLUA 4R2IA 4K9MA 1M2OB 1S2MA 1V11B 1E2FA 1WMAA 3LWBA 3V2GA 4M21A 4BE9A 4GLBA 1E7QA 4I1YA 4UMDA 2C31A 2YJTD 4AG3A 5HF8A 4YMGA 4JV5B 2EGHA 4B3RB 3ZLUA 1D5CA 4PRKA 3RS3A 3LCUA 1H3EA 1RU3A 4U1RA 3SKYA 2EGGA 1SKBA 2GCIA 5A3RA 4UCQA 1SKYE 3OOWA 1ESMA 4TN1A 2OO5A 3P52A 3GB9A 3O7MA 2ZJ1A 1PRYA 3ADDA 4CCYA 5GQSA 3LFUA 4JI2B 1PJZA 4YMLA 1P7ZA 2EX4A 2V7EA 3G5MA 4G0ZA 2WWVD 5A4KA 1AKVA 5JZSA 1GGVA 4CDMA 4CLDA 2JFGA 4F72A 1PR5A 1JLMA 3O95A 1G0OA 1XRLA 2GEUA 2XMSA 1E1DA 1V0JA 3A11A 2VCEA 3N8DA 1XZCA 4MGEA 1GRQA 1YHYA 4UDYX 3RC1A 1LSOA 1CZLA 3KUDA 3MW8A 4RVCA 1KZ9A 5T4HA 3VDXA 3IFSA 5HW0A 3I62A 4YJ2F 5HFNA 1YZFA 5I9TA 1W35A 5EZ5A 5LOVB 2DY0A 3DVAB 1VBFA 4QRHA 5BWCA 4NE7A 4EEKA 2HEIA 2HRDA 4NMWA 3RM3A 3UJPA 5HJ7A 4LC1A 1YVPA 1P2BA 2WP8J 4I0WB 3DM5A 2EP7A 4KQFA 1V26A 4PSUA 5JZ9A 1IWOA 4DA6A 4DC1A 1W4CA 3G0OA 2FWPA 2W2MA 2X7XA 2FZ4A 3M5DA 2CYAA 3JATB 4HI0E 4EGSA 4ZVOA 2IYVA 1ZSYA 1SD5A 2OCPA 5LA6B 1WKBA 5AUQA 1KJIA 1YR9A 2IXEA 3DS8A 3KG2A 2R7MA 3KPUA 5LZ4A 2UU9B 4PYLA 1JFFA 2A58A 4DCMA 4NU8X 2LRHA 3ABIA 4C3ZA 1UK8A 4RTOA 1JLSA 1U7XA 1M72A 3CX4A 3TSOA 4BLOA 1JWLA 4KKVA 2JFOA 1ZVVA 4G1BA 2VDQB 1OFTA 2X4DA 3F8SA 1L7VC 2OBNA 4RLHA 5F1YA 4MKRA 2ATXA 2GH1A 3WL3A 1EK1A 4BVJA 5ERGB 4CM9A 4L27A 2H1VA 4OJYA 4PQYA 4TMZA 4YJGA 3RU7A 4WVLA 2W2OA 4NKRA 3JVUA 3LFHA 1DGQA 2PKCA 5AJWA 4K9SA 4QU9A 4ZMBA 1ANKA 3JQRA 4L2IA 1HDIA 4ZTUB 3A4LA 1R27A 4NIMA 4D25A 5AVXA 3GZNA 1Q20A 2GPBA 3CLKA 3DVLA 1GL6A 4WZAA 4TLAA 4B8YA 5LUAA 2XCTB 3E7PA 4NONA 3SYMA 4B3BA 1BIFA 2QUHA 2QX4A 1GZHB 4B79A 5HTKA 4Y2YA 5IEJA 2P9HA 3CH5A 3HLYA 4GI1A 1E3SA 4Z53A 1QJ4A 4GR5A 3ROXA 4IIEA 5KQGA 3RT1A 1JDBB 2D5AA 4JYMA 1RM4A 1L5RA 1XMVA 1KJNA 5LBUA 3KVNA 2V4ZA 4EHLA 5K6AA 2VC2B 3H1GA 3TW3A 2F9LA 4KAAA 4YJ2A 2FGKA 2YN0A 3GLKA 1MAWA 1GT91 3W1VA 4Z0HO 3ETNA 4FFSA 4RHUA 4C07A 4C01A 1EGAA 2AFHB 3MUOA 2E4UA 2H4WA 3NUZA 5DI9A 4BLQA 4NYIR 3WGIA 3DCYA 1Z2EA 4GP6A 3TLMA 3NH9A 1VHDA 4S3MA 1PEKE 1H4VB 1AVTA 1PDVA 4EABA 3RUHA 4DEYA 1K7XB 3RC9A 3DHWC 2WY2D 1GKLA 1KEVA 3SEFA 1A4UA 4U39A 1P1BA 5GADl 1OR8A 4FLMA 2QZPA 3T41A 4K46A 1OIXA 2JFUA 2HJGA 3WLHA 2GCOA 3WLTA 1LPOA 4BB0A 1TAQA 4E14A 5BN3B 2Z6QA 1XZ8A 3HBJA 3R3UA 4TT3A 1QG4A 4KWIA 4OJTA 1GNVA 5L3SB 1TYZA 2EG9A 4RZ3A 4UXHA 2AT1A 3T0GA 4KPYA 4RD2A 3U16A 1K66A 3LUJA 5KNCH 3BK1A 3OICA 4JYAB 3L0BA 1JVNA 2GM4A 1WB4A 1OU0A 2RFLA 4RXMA 4FNOA 4EGQA 3ZGXA 2WF6A 3PEUA 3ZHUA 1E2EA 3UK0A 1OBOA 1RC1A 2JW5A 5T8KC 4EVIA 4RA9A 5LQSA 2BGUA 3H0EA 1C1DA 3QXGA 3WJ2A 1C3EA 1PYGA 3E9YA 4RVSA 4BDSA 3L46A 3PICA 2RC5A 1H3FA 1U2EA 1L3CA 4CMCA 1GYRA 1SXPA 1OYYA 4RA9B 1U7WA 4UBOA 2K6GA 3BH7A 3OG9A 1RZUA 2XMDA 2Y1LA 4FQ8A 1L1FA 1PI3A 3V97A 3ONDA 5DN6D 5MN4A 1RJFA 4ND8A 5KDDA 2BEWB 2B94A 4NTZA 4ZQCB 4XRGA 1GCUA 1N2JA 2WTNA 2WU0A 1RS0A 3GLUA 1W8IA 2YQ4A 1GZVA 2JGFA 4W5JA 4DN6A 4DL9A 4ENPA 5EJ5A 2BKAA 3AUKA 2WMNB 3EP3B 1KPHA 3DAPA 3F8WA 3GZNB 1N8SA 3BPSA 1PAUA 2FG6C 3ECSA 3JALA 4F8EA 3JQ7B 4OJQA 1A5ZA 3PPVA 1CDDA 2VNHA 4UBNA 2RAUA 1XNHA 3WXMA 4BKOA 1NY5A 5DSTA 1X1QA 3ITEA 1UZAA 3A3KA 3IEXA 4Y3UA 1TRKA 4WAUA 3WWZA 2D5IA 1DBIA 2SCUB 4UUAA 3UMVA 3PP8A 2WM3A 1U2GC 2FX2A 4S1OA 4ZDKA 5F7ZA 3UPDA 1U0GA 1E8NA 4BVGA 1ORTA 4YJDA 2W6ZA 2Y1WA 1IQPA 4F9EA 4QATA 5EERA 2D2FA 3NEPX 4MS1A 2DFVA 4IQFA 3TLGB 3GCZA 5K3BA 2BGMA 2ZVJA 5KWIA 3LCJA 3PG5A 3HYLA 2ZITA 2XUOA 1U28A 4CPDA 1IU9A 1FS6A 3DZBA 1Z38A 2B9EA 2V5AA 3AOGA 3G1WA 4DANA 2HV9A 1BSVA 5K8TA 2ANCA 2NZVG 2OG1A 1PHPA 3B7GA 1FXUA 3ZWMA 2IGBA 5DXAA 3DB2A 4RW0A 1ZQ1A 2FPOA 5EE9A 1DQNA 3FYUC 2JLWA 1KEWA 1A8IA 2J1LA 3CRZA 1JHMA 2Q1WA 1LJLA 2DWCA 1R3DA 2PVSA 1OSNA 2ETXA 2P6OA 3CPHA 1G5FA 3EGDA 1XZQA 2G7ZA 3FMFA 2AOVA 4NHOA 1XC7A 3PFIA 5AVKA 5JI2E 1OZ0A 1CEXA 2PT9A 2Q50A 1BC5A 1IY1A 2QW8A 3ANTA 1NUPA 3HPRA 4QPCA 4ZXPA 3ZPXA 3MMNA 1KAHA 3L7OA 1W7AA 3P7MA 3WWDA 4EGJA 3V4RA 4A8TA 2COEA 3KOXA 4BP8A 1JU4A 4L7QA 2JDIA 1V5FA 1J8QA 3GH1A 4XGNA 5DSZA 3SQOA 1T6NA 4YQFA 3O8CA 1DRUA 2IZOA 3PFGA 2HWYA 2REOA 4NBVA 3OD5A 4QT4A 3CX7A 1KZHA 2RH9B 3MOGA 3TXYA 5LBTA 4GX0A 1WB5A 4IWNA 3ZE7A 3BCRA 1FVXA 5I7AA 4CCYB 1C1XA 1R0XA 1E99A 4E33A 1E9SA 2J9YB 1IHOA 3L05A 3QYAA 4LXYA 4CIAA 2G88A 4P0QB 1GTL1 3EG9B 3ZWWA 4YRNA 2FPUA 1DJQA 1EX1A 2OZVA 2EKZA 3KJHA 4FFMA 3HCBA 1Y8RB 1UR5A 2PANA 2JAUA 2PTHA 3GC6A 1I4EB 2LIPA 5KO2A 1SVUA 3PEFA 4G56A 2PQ2A 4BWVA 4DA9A 1JTVA 3AEKA 1R0ZA 3W5JA 5AKZA 5K09A 4QL3A 4F5DA 3VX3A 4W1QA 5IBCA 2SKCA 2ZS8A 4BO4A 2FWRA 1G5QA 4PG8A 1OAOC 2OAP1 3G2JA 3R7DA 4ZGGA 2A9PA 3T7SA 1X2EA 1ZVKA 3QEJA 4PZDA 4ENVA 5JROA 1YRHA 1NJ8A 1XRJA 5KOJB 3AF3A 1GN8A 1HZZA 5H68A 1KDYA 3QVXA 1QAQA 2FDXA 5EHGA 3EXG1 4DLXA 4XDYA 3OURA 3QLVA 4XPZA 4L9RA 3ET4A 4FE3A 4H6XA 1U1CA 3DHVA 4OAPA 3E2IA 1LF5A 4MI9A 2HF8A 2XGSA 2QLBA 3IJRA 1QFSA 1SUFA 1XVAA 4D9CA 1H5NA 1MOSA 4GO1A 2YHBA 4ERNA 2R6ZA 1T2NA 1ZFNA 4JS0A 1VL6A 3A1FA 2R00C 3ZE6A 4EJSB 4Q66C 4DCCA 3THSA 4U2FA 5IVDA 2ZETA 3L7JA 3RNOA 2QE7A 3EIEA 3O0DA 3OM1A 5TF4A 5KNLA 1PBNA 2E18A 4YMVA 1OIWA 1BZYA 1LI5A 2X58A 2EYQA 1I6KA 2QL9A 3CX3A 2FK8A 2RH4A 1T0HB 3Q8XB 3K05A 1YS6A 4WVFA 4B2PA 2P2NA 1XWFA 3ESCA 4IV5A 1YE5A 4Q12A 5I5EA 1ZRHA 1ZISA 1FZTA 4PS0A 1BCRB 3TV1A 1YBFA 1UKAA 4CM1A 1E4VA 3AHIA 2F1OA 2YR0A 4ZO6A 5KYXB 1UJ6A 5LWHA 1ABBA 5HCIA 3NV7A 2YV5A 3OIWA 3OM0A 2QQFA 3PPIA 4OJNA 1ZDMA 2HT6A 2HJ9A 1QMGA 3P2JA 5CXQA 4TLCA 4C0LA 4LBWA 4LDJA 4ZU3A 4BNHA 4OKSA 3R76A 4DEVA 2OLEA 1FP1D 4R2WA 3T3IA 1V2HE 4JB8A 2YFHA 4WXMA 5FBVB 1L5YA 1Z8DA 1VDZA 1Z4OA 3VO8A 3DL4A 3ZW8A 2GTHA 5ITZA 5AI8A 2CKMA 4E22A 4KPEC 4DA4A 3Q8MA 4FDMA 1Z13A 4QJ5A 1EHIA 3ZLBA 1A9YA 4XVHA 1RZRA 4R68A 4U9UA 3D6UA 1RQ2A 3VPGA 4EYSA 2YWEA 2PAFA 2PJUA 3BHMA 1MUUA 1Y89A 3W8FA 2Q3JA 3F6PA 1JAZA 3GRVA 3HBAA 1JXQA 3P0RA 4WLEA 3TZBA 1Z75A 3EFHA 4NSNA 3UMJA 1EHYA 1WHTA 1QAOA 2C3YA 2Q5JA 2Y27A 2NYRA 2YZ7A 4HQ0A 3OCYA 3LDFA 2A0WA 3EF1A 4QOGA 1OBVA 3AI3A 4LGYA 1E69A 4YAFA 3AUJB 2EKDA 4I4TA 1TOAA 3AOEC 4PHFA 3K4QA 4GXQA 1ZM9A 2H59A 3NYRA 3VPBA 4FGSA 1YZHA 1SGWA 4A6PA 1NBME 1UANA 3QKUA 3EGEA 5HIJA 4EG6A 3LUFA 4KVAA 1MFZA 2Q3LA 4G63A 5U1PA 3EOBI 4C04A 3DNMA 4II2A 1L5HB 4I8XA 4TV8A 3DCNA 2MSDB 4WY8A 4Z4FA 3BMQB 1NUUA 1V7ZA 1K8XB 1VRVA 1DAMA 2I1VB 3NHLA 3PR2B 4HVAA 2PZAA 5ALPA 5T3YA 5JV5A 2FW7A 3W6UA 1ZUHA 2OHFA 3NH6A 2XT9A 3RS7A 2R25B 4HN4B 2YKGA 2JIQA 3DE4X 1H2HA 3IAXA 1L5KA 3MVEA 1E66A 3CR3C 4JB0A 4M0LA 1JSRA 4H59A 5FKJA 3DFKA 5JO0A 5KQPA 4QGHA 2OHVA 1YL6A 2C4WA 3C3DA 2NXEA 3DC2A 2A86A 1FTQA 3SHVA 1GGNA 2CUNA 1Z2NX 4J0DA 2ZI6A 3QU9A 2AF3C 3BZBA 2G7MC 2HRRA 5FEUA 4FFBB 1WCWA 2BEUB 4CUZA 1QP0A 5A4FS 5HIIA 3OOYA 1U11A 2EJVA 1M8GA 4EJ6A 2IT1A 3O2NA 4C0AC 3ADBA 3M3HA 2I76A 3ASZA 4M53A 3X0DA 5LD2C 4IGEA 2Y76A 3CZCA 1Q21A 5B1YA 5EEGA 3NMUF 3ZX5A 3OPNA 2WYIA 2P91A 2YFYA 2A0FA 3GOHA 2XY4A 2OPHA 1I0ZA 2C7RA 5FXMA 3SXUA 3PQ4A 3LXXA 3ZWQA 4ZYUA 3RWMB 2VHCA 5FFMA 2AYYA 1WW8A 3U4MA 1D07A 1ZH2A 2QTWB 4IJQA 2VP9A 1PVDA 4BQSA 5JHHB 2WJ6A 2O8CA 1N7IA 3ES9A 1LVUA 3PXAA 4YV0A 1W0CA 3L7LA 4D81A 1U2QA 2FW0A 2UV8A 3A9UA 5I7RA 1B23P 4FZ5A 2BZ1A 4B9EA 2FEMA 4M8LA 3EPJA 1V16A 1ZBDA 1F8XA 3TRHA 1JAXA 3UCXA 1TEXA 4KDRA 3RSHA 4J16C 3E27A 3R4CA 3RUFA 2RGUA 1KSHA 4NQZA 3VTKA 4EVQA 1VLQA 3FKSA 3EIQA 3QKWA 1JHYA 2AW3A 4JVLA 3DH0A 2J08A 3W1EA 3K53A 2D1FA 1IH8A 1TVKA 4TRJA 2FW9A 1G1MA 1U3UA 3QHQA 1T3GA 4R8VA 5GOZA 1BDHA 1JEAA 2QKYA 3SK0A 4LMRA 5AVJA 4TS3A 1SCUB 3SQNA 5BN5A 4MP6A 3DXFA 4AIRA 2PN1A 1Q1EA 3FOFC 1EUDB 2XZDA 2GN4A 2GZMA 1NL3A 1GRVA 1TC2A 3EGIA 4EA6A 4XIIA 3O73A 3UA3A 5CFQA 3S7ZA 2G9QA 1LGYA 2X1MA 1OV6A 1LRLA 4OHMA 4OSEA 3A6PC 1PJ2A 3PHJA 4HBZA 1M6HA 3RRMA 2FEXA 3L41A 4A7PA 4BKPA 5BW8A 5K0GA 2OYSA 3NRBA 3GVIA 3VPHA 4MWSA 1FDSA 4N9WA 1R6BX 1FXWF 1IEVA 3T1OA 1APBA 1E18A 2K7ZA 3D4PA 2UVPA 5A6SB 4A82A 1GTSA 2X5KO 1G6OA 3FDIA 2AWOA 1BHSA 3C6ZA 4GLOA 4UCWA 3I2IA 3ICQB 1HR0B 3C6QA 4EI2A 1XT6A 3NAMA 3E18A 2O7NA 1P1HA 1OASA 5FEMA 4ASUD 4UMVA 2XUJA 1B0UA 4KQGA 4U6NA 2FSVA 3THXA 2AK3A 2EFGA 4O0MA 4X7BA 4B3MB 1E1QD 1NR7A 4FX5A 5I7VA 2BJWA 3K1AB 3C6MA 2ZKLA 1O87A 3IOMA 3DD1A 4HB2A 2DPMA 2PLRA 4RV9A 1KI3A 3SFZA 4F2HA 1KERA 2XCOA 1FTSA 4RSMA 2EW2A 3UJ8A 4FE4A 1YFJA 3OQPA 5IWAB 3KZXA 1TECE 2ZI5A 1UJ4A 3KFLA 5ALLA 4RDCA 4QWWA 2E55A 3PL5A 3CWQA 4LYEA 5EE0A 4AO8A 5H83A 1G38A 5JRZA 1ZAYA 2AG6A 2CV0A 5IM4F 2AMLA 2H63A 1WHSB 3K2EA 3ZC3A 3GEIA 2L2QA 4JT9A 1YZYA 2BBSA 1ZJWA 5IUKC 2ZUSA 1NR5A 5AP9A 2FQXA 4P5PA 3ZVLA 5B6JA 4ABTA 1MVLA 1ZMXA 3FVVA 5F9FA 4IDPA 4TTTS 3D3WB 3NJRA 3TVDA 2QIOA 4W1SA 2H0QA 4ER7A 4MUFA 1XHFA 1MPTA 5G02A 1NVWQ 4DMMA 5BR4A 3QXXA 2QVLA 3R5XA 4DYDA 2H92A 4DLBA 3HZRA 3AFNA 4IIVA 5K4HA 3ZI7A 1FQJA 4MV7A 2GZHA 1SK8A 3RE1A 4DE5A 2F8MA 4MWOA 1GSAA 4MV5A 4MPPA 4PYNA 2GKOA 5GONB 4EG3A 2EF1A 1LDEA 3NDJA 4K5QA 1RPJA 1SXJC 1SZPA 1TTQB 1SN7A 1XMJA 3IQHX 3A9WA 3FVRA 3FRHA 4U7TB 2XJ4A 1QGYA 1CF9A 3AU8A 3QKRA 4OA8A 1I1HA 5FPYA 1AUOA 1N5OX 1ZJZA 4K9OA 1BE8A 4KR2A 2H4HA 3N74A 2FWMX 1WDMA 2WHPA 4FFPA 3OLYA 3TOVA 2QRLA 1FRNA 1V3QE 3GO4A 1BWPA 2HMVA 1NE2A 4BNVA 1QPBA 1P77A 1ORWA 1EP3B 4JLPA 3IQFA 4N0PA 3V3TA 2ZCJA 4HUQB 4R98A 3N1UA 5K1ZA 4EF4A 1WQ1R 1FTNA 2NXNA 5EMJA 2ERXA 5F51A 2KPOA 4KQJA 1XKQA 4AKSA 4KLRA 2FTKE 4MVYA 1O08A 3I9KA 3R6DA 4PLYA 4UKDA 5TXGA 1A8QA 1ZGJA 3SIXA 5G1NA 2HH9A 3M1YA 3R0XA 4WLVA 3NPMA 3DE0X 2JGMA 3H9GA 3UKDA 5BVGA 3KEQA 4JLUA 3V1KA 1CB0A 4ZOAA 3HH8A 4ADSG 5C3UA 3T99A 1JIJA 1W4ZA 2XYHA 3QA3E 3TNJA 3I83A 5TVKA 3RODA 4XEUA 2IJGX 3OHSX 4LHYA 2HA6A