1PQPA

Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
357
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNSTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
total genus 118
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pqpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pqpA01
1SMKA 1G0NA 3F1KA 3JQ8B 3R0IA 3QVOA 5EMHA 2C7GA 1DO8A 4FFLA 4NJOA 4XGNA 4Y98A 3OJEA 5JC8A 2EKPA 4J7UA 4CQMA 5KWEA 1U9JA 1AUPA 4R9RA 3OQ1A 2D2IA 4DIBA 1GQ2A 2YHUA 4J1SA 1LXCA 2C7VA 4BGEA 3IOYA 4BGUA 2BI8A 4J9UE 1UDCA 5FWNA 4RQTA 4CODB 5JY6A 1F8FA 1BTOA 5A5FA 3WOHA 4J1QA 4RPLA 4D46A 3PFWO 3MJ4A 2EWMA 5J23A 3F9IA 3OIDA 1YB5A 4CR6A 3HFSA 3SC4A 2VWHA 3B1FA 4CM4B 3VPGA 4N5NA 4ZGWA 3PGXA 1SPXA 4GBJA 4ZVVA 1W8DA 3GDOA 1UZNA 3EAGA 2JHGA 3IIEA 1ZCJA 1GU7A 2B83A 5BSHA 5L7TA 2BI7A 5HRUA 2EJVA 3K9QO 3CIFA 5DBIA 4II2A 5CDTA 3CINA 3FF4A 2OBNA 2OP0A 3AFNA 4IDAA 4ZQBA 2ZCVA 4L9RA 3KYDA 5ILOA 1L7DA 1U2GA 3O8QA 3GAZA 3INGA 1GD1O 3QQPA 2AW5A 5TJ9A 1WVGA 1A27A 2BLLA 3W1VA 1LU9A 1U28A 3LF2A 1YKFA 2DBVO 2HSDA 3N7UA 3ZWMA 3P2YA 2Y0DA 4XQ9A 4AJ1A 2VRBA 4X54A 4R1SA 4DVJA 3BMNB 3WLFA 4WCFB 5TGDA 1CERA 1U3UA 2HAEA 3NRCA 4IXTA 4YEDA 6ADHA 5EPOA 2FR1A 4GMGA 6LDHA 1VL0A 3RUCA 1PGQA 1DFHA 4XGKA 1Y9EA 5DBFA 5ES3A 3S2FA 4OXNA 4EUHA 1PJCA 1Z73A 2Q2QA 1HXHA 4BNXA 1ADFA 4MVJA 4QTZA 2A94A 2AQ8A 1HETA 4YJFB 1M76A 4YCAA 4DQVA 4ROSA 1E7RA 2Y93A 3V2GA 4FC6A 5H81A 2O2SA 4DUPA 4BV9A 5A04A 1QLHA 1ZXLA 1A5ZA 5TJHA 4FR5A 4BO5A 2IXBA 3DMTC 3GVHA 3NJ8A 3RUHA 3ZV6A 1Z82A 4ZA2A 3WB9A 2QRJA 4YJGA 4D3DA 3INRA 2I99A 3VPFA 3UGKA 1DC5A 2POQX 3Q3CA 5B4VA 4XKJA 1M6HA 3Q9NA 2PD6A 2J5QA 2J5RA 3E18A 3EC7A 4F6CA 2FZEA 1PL6A 5ENDA 3G79A 4PLPA 3G3EA 1PJ2A 2WYVA 1E1KA 1EQ2A 5BNFA 5C7LO 4MIOA 5T8KC 3VPHA 2GGSA 2DC1A 3GAFA 4W9NC 1E1LA 4YT5A 3PGJA 5ER6A 2DBRA 5JYFA 4MVJH 3DXFA 1PJBA 5B37A 3RI3A 1AHIA 3JQAB 3NYWA 4BIIA 2YQ4A 2OO5A 4TVBA 3L6EA 4XWYA 3E5MA 4WLFA 1E7YA 1LLQA 1UUFA 4OOFA 2VZ8A 1NWHA 2AQHA 2VNAA 5IDXA 1WNTA 4FCCA 2QZ9A 1ZUD1 2IEDA 4CL3A 3F4BA 2PTGA 3M6IA 4BO1A 1UXJA 5AXAA 3QWAA 1QV6A 4LRSB 5BSFA 1X7DA 1HT0A 1HZZA 2GF2A 1DEHA 3H2ZA 4L4RA 1KY5A 1LQTA 2IXAA 4JCOA 3DBRB 5KKAA 1PR9A 1C1DB 3NX4A 2YZ7A 3GEMA 3EVTA 3LU1A 1F17A 3D64A 2Y1CA 4K28A 2VUSA 5A9RA 4XB1A 3ZGYA 4IIVA 4UVIA 4WGGA 4UAGA 2VUUA 3D3EA 2HMUA 3HSKA 2NACA 3O38A 5JMWA 4GX1A 3B1JA 2V6MA 4GAEA 4UUPA 4NBVA 1GEGA 1O5IA 4HFJA 5A5EA 2X86A 4DA9A 2HKIA 4QSMA 2BGKA 3FBTA 4BMVA 1I36A 3GHYA 4NU6A 3I1JA 2V6GA 3OFSA 4PLWA 4O5OA 4N5LA 4CMBA 3WGTA 5JE8A 2ZTLA 3WGYA 4OH1A 4QFDA 4R4JA 3DAFA 4I5EA 1OC4A 2W90A 4GX0A 4IDEA 1PIWA 3JYOA 1MUUA 4RJTA 1PU2A 4B8WA 4CM6A 4JBIA 3ICCA 4EJ6A 3FR7A 1XR3A 4YRDA 4BNGA 2NU7A 3Q11A 4GKVA 3DHEA 4CM4A 1ENYA 4XRGA 1DIHA 5FI5A 3MTJA 4DMMA 1W6UA 1CQIA 4UUNA 5FEUA 3WR5A 2HK7A 4ALIA 5DT9A 2AG8A 5TF4A 3ZWNA 4B7XA 5L7YA 4CM9A 5KJ6A 5L51A 3WGZA 2BD0A 1TVEA 3FNFA 1Y81A 3I6IA 2WM3A 3DBHB 3VKVA 3JTMA 1RJWA 1KY4A 1GEEA 2IODA 2O3JA 3RQSA 3U9LA 3ROKA 1LUAA 1NHGA 1EEHA 2YFHA 5GMOA 1P1FA 1B3RA 2AA3A 3JCZA 3PHIA 2QRKA 1OMOA 2GN8A 2C2YA 5U9CA 1PGJA 2VUTA 3SLKA 3IKTA 3C1TA 1ZK0A 2ZTMA 3RASA 1V3TA 3C24A 2VT2A 1IULA 1E3LA 1ORRA 1HEUA 2D5CA 4FFRA 4KDEA 3BMNA 3FNHA 4YT8A 2YQ5A 3KSDO 4WCFA 3UICA 3I6QA 4DIFA 1I8TA 4BNJA 1NP3A 2GZ3A 2CMDA 2D59A 4DYVA 2H1SA 4BGIA 4YRAA 2QZZA 3FPCA 2ZB8A 3E82A 1H6AA 4UVDA 1JWAB 4G5HA 1BVRA 1JTVA 4PRLA 1QG6A 1PL8A 4R1UA 1IB6A 4Z6KA 1C0KA 3OECA 3DTTA 1DB3A 3O4RA 3BTOA 4RDHA 2CDBA 1N5DA 1E7QA 5C3MA 1K5HA 3UFXA 7MDHA 1HZJA 5IG2A 1X15A 2HMTA 4GWKA 4J0EA 4E2XA 3BHIA 4XQCA 3PQFA 1G6KA 2X5OA 3KETA 1BSVA 4KTVE 4RORA 5I7EA 1ZKMA 2P9CA 1BW9B 3WGGA 5IZCC 3WGOA 2XPCA 2VWPA 4OHUA 4UEKA 1JVSA 2WTBA 3RBVA 3MWEB 5KVSA 1R37A 3OSUA 4HUJA 2C5EA 1CJCA 4K6CA 2IEBA 2RH8A 3STHA 5B4UA 3BIOA 1GL3A 2P91A 2DVMA 3DQPA 5FFFA 3S8MA 3K8ZA 1P77A 4RZIA 2ZATA 1MXHA 3FTPA 4YDRA 4PLFA 3WTCA 4OKNA 1M66A 1P1RA 1C0IA 1T1RA 1XU7A 3JQAA 3M1LA 1HE4A 1EMDA 2JHFA 3R6DA 4E5MA 1JKFA 2B4RO 2XAAA 3GPDG 3RJ5A 2Q4EA 5DZSA 1LC0A 4YRBA 2DTEA 4O59O 4FBGA 2JD0A 3PI7A 1XKQA 1E5LA 4H7PA 3LT4A 3RROA 1U5CA 2P9GA 3F5SA 4NHEA 4FJ1A 1CF2O 3DBRA 3TQHA 1C1DA 3WYEA 4JP2A 2GYYA 3D4NA 1EQUA 4CPDA 3P2OA 3VTFA 1C14A 4FOSA 4K26A 2AE1A 1ZK4A 1N92A 2EEZA 2RHCA 2AEJA 2HCTA 4Z0TA 4RO0A 2Z95A 1RM3A 3WICA 4FS3A 2O3SA 3ZU2A 2PZJA 2GASA 1U4OA 1P31A 4ALKA 2HMSA 2VYND 3NDRA 1X7HA 4RZHA 3JD4A 4XYEA 2HLPA 4P4GA 4ALJA 3RU9A 2HK9A 1QYWA 5JPIA 3ZWPA 3RCBA 2GRAA 4EUEA 4XJTA 3V5NA 4IJUA 2VRCD 2WEKA 4ZQEA 5DN9A 4A5OA 4WNCA 4J3FA 2NVBA 1MFZA 2BFOA 3JQFC 3GVXA 2HDHA 3IKVA 4ONEA 1PQPA 4R3WA 1YRLA 1YB4A 3EDMA 3X2EA 4NZ9A 3HWRA 4IJVA 3HFGA 1BDBA 2J3HA 2CSUA 4PG6A 1QYVA 3DB2A 4OGWA 3WGQA 2DUUA 2C0CA 3TZQA 1HLPA 3I9JA 3GN1A 2GCGA 4XA8A 4J1TA 3A14A 3DBHA 1TEHA 4TWRA 4Y6RA 4QECA 4QFCA 3QIVA 1F0YA 3GA0A 1I2BA 1RM5A 2FWMX 3CMMA 1B7GO 3PJEA 4BO6A 4BO7A 5EERA 1NASA 4B3JA 4JNKA 3GQVA 1Q7BA 1ZSNA 3E48A 5LC1A 2VTEA 1O6ZA 4XJSA 3FPLA 5A06A 2FRDA 3W4IA 3WYBA 3UCFA 3WLEA 4GQAA 3OA2A 3GDGA 5ITWA 2C20A 5IN5A 3GGOA 4E5PA 4N18A 3WSWA 3OJ0A 4B79A 3OHSX 1HYHA 1TLTA 2NU8A 4OYRA 3N74A 3Q6IA 3PIDA 1A9ZA 3NUGA 2VOEA 1QP8A 4A0SA 4E4YA 3TNLA 4CM5A 3PZBA 1ENOA 1O9BA 3EY4A 3L4BA 5JMPA 4Y6SA 4ZJUA 3KB6A 3M2PA 3F1LA 4JBHA 2UYYA 1YQXA 5IN4A 1E3JA 4II3A 4J2OA 3T7CA 4DC1A 1V9LA 1ZMOA 3V8BA 1HE3A 1B2LA 2WD7B 2ZJ1A 3HADA 2OHXA 3OIFA 1J49A 3AY7A 2UUPA 4EBFA 5IDQA 2HO5A 3U49A 1Q0QA 2O2YA 5AXCA 2BFAA 5I7FA 3Q1LA 3VHRA 4MIEA 3DR3A 2G76A 4ZQFA 4B3IA 1O0SA 3KYCB 1BW9A 5G2OA 2OOSA 1WDLA 2AMFA 4WKGA 3KUXA 2XXBA 3AFMA 4TVOA 4YAKA 4WE3A 3OQBA 1NPYA 4HX5A 4I5FA 3F46A 4JK3A 3RFTA 1ADGA 3UCXA 5CHEA 4CV3A 2BGLA 3OIGA 1VKNA 1U2DA 1QV7A 3NTQA 1GYPA 5BNTA 2FHSA 2HMWA 1Q1NA 2RHRA 3JD0A 3GEGA 3JYQA 1IHYA 3LT1A 4XB2A 3L07A 1LTHR 3D3WB 4FD3A 4DBVO 4CL8A 3V1YA 4UVEA 4YJFA 1H2BA 3DMYA 1JLLA 5JDCC 2QYTA 3WG9A 3IJRA 5KVCA 4C7JA 1DDOA 2ZYGA 4M8SA 1GAEO 3DOCA 3KLPX 1I2CA 1VRWA 3PJFA 4JXKA 2I66A 3AU8A 3DBVO 3GUCA 4NPCA 1NPDA 2PGLA 1ZFNA 3BHJA 4DGSA 2PH3A 3EK2A 3PFFA 3QWIA 3I9KA 2DTDA 1GYQA 4PLGA 3WFIA 1Z75A 2JKVA 4YYZA 2O7QA 2TMGA 5A02A 4UUOA 2X9VA 5FF9A 4M86A 2YFQA 4E13A 2UAGA 3ANNA 1LNQA 4J16A 4N54A 1ZSYA 1ONNA 2OP1A 1VSUA 4LMRA 3KZVA 3CMCO 3FHLA 3MJSA 2XXJA 1O94A 4R51A 1ZJZA 1GZ3A 3I4FA 3EGOA 4J6FA 5DCUA 1KS9A 3C7DB 5EN4A 1P1HA 3DHNA 2RCYA 4GGPA 3ETDA 4PLZA 5THQA 1WZEA 3AUUA 3H9QA 2IYPA 3H2SA 3IMFA 1E92A 1HDOA 4WEQA 1P0FA 4P8RA 1U5AA 3PJDA 4B3HA 1YB1A 5G4LA 4YT4A 1Q0HA 3AY6A 4S1VA 1B8VA 3UHAA 5AQ1A 5CPBA 1DLJA 1R4MB 3IL2A 4IPTA 4DMLA 2C5AA 3CE6A 3AUAA 3HN7A 5K9ZA 2EF1A 2PFGA 4LK3A 5ITVA 4AICA 2I3GA 3SLGA 2Z5LA 3QWFA 4RQUA 1B16A 4GI2A 4RVSA 4YACA 3V1UA 1EUDA 3OA0A 4QT0A 4YWJA 2GD1O 4CV2A 3AOEC 4ND1A 3COSA 3E1KA 5EESA 2Y1OA 1KVRA 4CUKA 3GG9A 2Q49A 3QV1A 2VHWA 4U6SA 1E6UA 2IZ1A 4MINA 3WQQA 4F3YA 4TKMA 1DLIA 4OSOA 3KYBA 4IIUA 5JSFA 4W99A 3PLRA 1OFGA 5B4TA 5JW6A 4J49A 3ITKA 4DL9A 2CDAA 5JYEA 5HWSA 1LA2A 1WP4A 2E49A 2X58A 3LT2A 2C07A 2B5WA 2H5LA 4YAJA 1OAAA 3PDJA 1Z6ZA 1AXGA 3WBBA 1FK8A 4IGFA 4OAQA 1YS4A 3ZV5A 3ROQA 4Z0HO 3ZZNA 2ZTUA 3D5QA 1JQBA 2WD7A 2X0IA 2I6TA 1VJ1A 3AWDA 3RJ9A 1N8KA 3CUKA 3LLSA 5DCWA 4CR8A 4CV0A 3H6KA 2D4AA 4HKTA 2ZYDA 4BGVA 1W4ZA 3NT2A 3GC6A 2WE7A 3QY9A 4XR9A 3OJOA 3RUDA 2OFPA 3CZRA 4U8GA 2Y1EA 4S3MA 2EW2A 2F1KA 4Y67A 1TT5B 3GH3A 3DOOA 3G49A 5TX7A 2AE2A 2I76A 1SEVA 3W6UA 3W8DA 1NR7A 5KJCA 1E5QA 2WYWA 3GEDA 3AK4A 3GK3A 3V2HA 2DFDA 4IGEA 1A9YA 1GTMA 2VHYA 4AJJA 3G1UA 3U0BA 3KM0A 3DEYX 5KVVA 1JW9B 3GHHA 2YY7A 1I5RA 1T1SA 3C7AA 4O63O 2PY6A 4O1MA 4CMIB 2DKNA 1KIFA 1NAIA 3D3WA 3H3JA 1I3KA 3GZ4A 3CKYA 1SNYA 2DBQA 2FSVA 4L4SA 4JQCA 4W7HA 4CM8B 4B4OA 4AL4A 4RDIA 4QO8A 3KSZO 3WTBA 1N2SA 2C54A 3WDSA 3P7MA 4TRMA 1NQOA 4ZHSA 5THKA 4EEXA 3F47A 1QMGA 4BNHA 2HRBA 1HYEA 3D5TA 3WWYA 2Y05A 3GNTA 1YGYA 3JQ7B 1MG5A 1QYDA 4NI5A 2GLXA 2VYNA 1X7GA 3F3SA 4D43A 3NDIA 2YV2A 2R00A 4FOOA 2E37A 2PGJA 1DHRA 1O89A 3E9NA 3LLVA 3PHJA 4EITA 5HS4A 1ISJA 3NTRA 4RVDA 1YBMA 4UEOA 3BHMA 4D42A 4O0LA 4NQZA 3CEAA 1ML3A 2VRCA 4PIVA 4Q39A 1NFFA 3ETGA 3ZWXA 1HYGA 4J7XA 1E1MA 2Q4BA 3BMQB 5BR7A 4PCVA 4RVUA 1DFIA 1A7AA 4GGOA 1IY8A 2ZCUA 3PEFA 3QA9A 1TA4A 4WLOA 2JFFA 4YPOA 2J3JA 3LC1O 1NXQA 4Y8VA 4CLRA 1WPQA 3IUSA 1GYRA 4BNUA 2DQ4A 4CM1A 2FPGA 3WWZA 3H9GA 4BMSA 3HJAA 4GMFA 3QVWA 1XYGA 1KYQA 4XZ3A 1LSSA 4YAGA 1ARZA 4TRRA 2WJPA 5KOIA 4F6LA 3EMKA 4H3VA 5DP1A 2VHZA 5EL0A 5B12A 1KEVA 5TSDA 2E4AA 4HXYA 3QHAA 5T57A 3Q2KA 2W2LA 4BO9A 2F00A 1MV8A 1LBEA 3IJPA 1JU9A 5EINA 3VVCA 2V6FA 4DLLA 3PK0A 4CMAA 1UP6A 3DO5A 1R0LA 2NTNA 2W98A 3D4PA 4G65A 1ZZEA 4WOKA 1CWUA 2FMUA 4FSHA 1V3VA 2DU8A 4E32A 5MDHA 5BSGA 2ZB4A 5CAEA 4EYEA 3K31A 1YWGO 4R16A 2HU2A 2I67A 3SX2A 3ZNPA 2AXQA 2G1UA 3OJLA 1ZJYA 5BT9A 3RWBA 3ONEA 5JBIA 5I9LA 4CJXA 3GZNB 3L9WA 3VVBA 1T2FA 2FR8A 3PIIA 2AQKA 2VCYA 3CPSA 2FOIA 2P9EA 4NH4A 4DPKA 3VZSA 4D0SA 4TRNA 2PZLA 3W8FA 4Q3NA 1J0XO 2B4QA 2CVQA 4MIYA 2A35A 3U5TA 1T2CA 2WDZA 4MP6A 4Q9NA 1UZMA 1QXSA 1SAYA 4OOEA 3RAJA 5JAMA 1LDEA 5G4KB 3KBOA 4XD2A 1IYZA 2HK8A 1LDNA 3MJCA 2RH4A 1I10A 4FFPA 4CM7A 1LDMA 1XDWA 4L0QA 4BNKA 4TRJA 1ISFA 1D8AA 3AI3A 3PQDA 3JV7A 4MVJM 4IM7A 2BELA 4KTTE 1FJHA 1V35A 2RBEA 1ZK3A 4QEDA 3DZHA 3E03A 4BO3A 5KKCA 1B15A 3JQ8A 2GN4A 1ZXBA 2Y66A 4PZEA 4R1TA 4HFRA 4YQZA 1B26A 1ZK2A 4IQ0A 1I2ZA 5IAAA 3HUDA 3L6DA 3ZHBA 5EJ2A 4I08A 4YXFA 5A9TA 1WWKA 3KSUA 3GMDA 2GO1A 4A26A 5FI3A 3WNQA 5AYVA 1V6AA 4QX6A 3DZIA 5JXWA 7ADHA 5IJZA 5DULA 3ST7A 3LC7O 1I30A 2V65A 4CMIA 1MX3A 4JLWA 2GSDA 2QRLA 3DDNA 2D3TA 5T64A 2V7PA 1M75A 4CM8A 2ZTVA 1PJLA 4BKPA 2YHIB 2RIRA 3BTUA 3X2FA 3A28A 5CDYA 3W4KA 4BB6A 1QORA 4ND4A 2PZMA 3RBXA 2EERA 2NVWA 4DTIA 4E2ZA 5CEEA 2O3RA 3DZJA 1IPEA 1D3AA 3LZ6A 2DBZA 4IJKA 5JO9A 3MCVA 1V3UA 2NTJA 4IZIA 3ULKA 3NKLA 1LLCA 3W6ZA 4CMEA 3LDHA 4GSKA 3OMLA 3TL2A 3ZWAA 1Y8RB 2Q1SA 1YL7A 1DAPA 1LJ8A 3QWBA 4PRKA 1G0OA 1ONPA 4WCFC 4IINA 4WNIA 1G1AA 1U4SA 2QYSA 5LCXA 1MB4A 3PXXA 3C7CB 4U0KA 2JFGA 3WNVA 4YT2A 1LDBA 3AU9A 4EGFA 1PS0A 1YH3A 4DLBA 1IOLA 4GVXA 4GSLA 3PDUA 5G0WA 2UVDA 2PKRA 4TMFA 1R4NB 3CSDA 5CP8A 1P1KA 4RGBA 4FDAA 3C8MA 3FD8A 2Q1WA 3BMQA 1H6BA 2CVZA 4I5GA 4RF2A 4D45A 3O9ZA 1HDRA 2VQ3A 2JL1A 5A1TA 1NX6A 3NAQA 2VWQA 4DPMA 1ISHA 4ND2A 1BMDA 4BNTA 2P5YA 1MFPA 3QW2A 5JY1A 4CLDA 1B0AA 1A4UA 3HG7A 4FFOA 2JD2A 5TQVA 1I32A 3ZHYA 3ONFA 5H82A 5JAIA 1K6IA 1CIVA 4MOWA 4FC7A 2BH9A 3I9LA 1PGPA 5C5IA 1GUFA 1YDWA 1I24A 5A3VA 4GPD1 1VL8A 2O7SA 4BKUA 3MTGA 2AEFA 2NU9A 1JVBA 1JWBB 3ZU3A 4NFHA 2DPHA 4AFNA 4U7WA 2X5KO 1PJTA 2YV1A 1NVMB 3H9JA 3OJFA 1HDXA 3C1OA 3GDFA 4YAEA 3IS3A 2GN6A 1JAYA 4OJNA 5F5LA 3ZWWA 3ONDA 4ZRMA 1EK5A 3GT0A 1A7KA 1PZEA 4QUKA 1MXFA 1JA9A 1Y1PA 2CFCA 3IDSA 2DAPA 2BFMA 4BO4A 1P9LA 3PPIA 1E3IA 1GUZA 4A2CA 3R1IA 3WSVA 3K2EA 1SO8A 1WDKA 3CTMA 3GNSA 2NVUB 3L4SO 1IPFA 2B37A 4R5HA 3SJ7A 3GZNA 4BOYA 4JROA 1DIBA 1DRUA 1T24A 3GPIA 2W2KB 3DTYA 4WJZA 4Y9DA 3TL3A 4Z3DA 2O48X 1XELA 5C7OO 1NYTA 4I9NA 4J7CA 3S2GA 4BL5A 4R9SA 3W8EA 4EJMA 4P4LA 1U7HA 2ZQZA 2IE0A 4FPXA 1DRVA 3ROPA 4MVJE 1J5PA 1JKIA 5G4KA 3NGLA 2OZPA 3VH3A 5DF1A 1GY8A 3GGGA 1PS8A 4N5MA 3ZCXA 4CUZA 3DZFA 2QIOA 3FNEA 4WLUA 3W4JA 2VOJA 5T73A 3R3JA 4WCDA 4BUCA 1PGNA 5IXSA 2X22A 4DLAA 1WZIA 4E30A 5TLSA 2E48A 1PJSA 2IZ0A 2X23A 3B6ZA 4XQEA 4INAA 3JQ9A 3UUWA 3GVIA 3VPXA 1DPGA 4HBGA 3LC2O 2VT3A 3A4VA 2EKQA 4U0JA 1EE9A 4MVJP 2EXXA 5ER9A 3F6YA 2ZIZA 4I1IA 1IZ9A 2GN9A 4KWIA 4XYMA 5JC1A 2QW8A 4D7AA 3EZLA 3O03A 1EZ4A 3NTOA 2P4HX 3H3FA 4URFA 1L1FA 1KVTA 2OBYA 5LDGA 1QYCA 3TWOA 4CUJA 4CLOB 3PP8A 1PX0A 3U62A 1ID1A 3PHHA 2YW9A 1HWYA 4WLNA 1NHWA 2NU6A 4QQRA 4XYBA 5TRTA 5EQFA 4PGFA 4CMKA 5J9GA 2JCVA 1Y8QB 1PJ4A 1PQWA 1YOVB 2JCYA 1YBAA 3I52A 3OEYA 2QG4A 1GADO 1EVYA 2UUOA 4M1QA 1NVGA 1PWXA 3JQDA 1R16A 2C59A 2B0JA 2CF6A 4FW8A 4TSKA 3E6AA 1Y8RA 3T4XA 5A03A 4ALLA 2H6EA 3QVSA 1B14A 2YUTA 2Y67A 4Z9FA 2BKAA 4XEHA 3ZN2A 2Z1MA 4PLYA 2GR9A 2A92A 5U1PA 3L4BC 5DNAA 4CMGA 5HBRA 1HF3A 4PLCA 2OMEA 3HQ4O 1U1IA 2D5AA 1C1XB 1C3VA 3ZWOA 1ZH8A 3UAGA 4MKXA 1MC4A 3A1NA 1F8GA 4KP7A 5T6BA 1U3VA 4ZD6A 2ZB3A 5JCJD 4XIJA 1LSUA 4EJ0A 3WQRA 1GZ6A 3WIDA 4MVJD 1O8CA 4GH5A 1QRRA 3TJRA 3JD2A 5AVOA 4NFYA 5DBGA 5CEJA 2D0IA 3U3XA 2B5VA 3DBLB 1LC3A 4DWVA 4HADA 3GG2A 4LCEA 3ZW8A 1YL6A 4B4WA 5JDIA 3K30A 3H8VA 5EIOA 4MVJI 5K6AA 1XCBA 2DUWA 4IJWA 2YDYA 1MG0A 3GF4A 5MGBA 3NV9A 4FJ0A 2NADA 3L9XA 3G0OA 4PG8A 1SEPA 3WMWA 3RKRA 4DIOA 5KJEA 1KVQA 2WYUA 3QP9A 2JAPA 4HWKA 1PZHA 1Y9AA 4NK5A 4MO2A 4GL4A 4NJMB 1J4AA 1EK6A 4J91A 2G0TA 5BSEA 3MOIA 1XLTA 3DZKA 3NDJA 1HL3A 4ND3A 5L53A 1QYXA 1A72A 1M6WA 4I8XA 4PG7A 3RD5A 4BS9A 3N58A 1KC3A 1KETA 2V6BA 1VSVA 3KEQA 4D0RA 1PZFA 1RM4A 1HDZA 2NVUA 2Q1UA 4PVCA 2FR0A 3UCEA 5IZ4A 3JQBA 4BKQA 1KBZA 5JLAA 1JAXA 1BWSA 1EFKA 5I8ZA 2GZ1A 1FF9A 1P44A 2B35A 1E0DA 3E8XA 3DL2A 3SC6A 2W2KA 4RLHA 1L7EA 5HS6A 2Q99A 5I7VA 1MC5A 2QHXA 3MZ0A 1NAHA 1HLDA 3JQCA 1BG6A 1WDMA 4OIMA 3Q9UA 4DRYA 1XGKA 2YJZA 4TQGA 5HA5A 5L40A 1HE5A 3AI2A 4EDFA 1C0LA 3JSAA 2NNLD 1XHLA 1Z7EA 2AHRA 1GQQA 4N7RA 4Z9XA 4D3SA 3WJAA 1ADBA 4KUHA 2OL4A 3GLQA 4Q3AA 4NBUA 3UKOA 5H83A 3VH4A 1LDYA 3DFUA 4E5NA 2D8AA 1R0KA 4HV4A 1JN0A 1DIAA 4WASA 5EQDA 5B1YA 4XQGA 2VN8A 4RLSA 4BB5A 5JNLA 5KJ1A 1R0SA 4GKBA 4CMHA 3IP1A 4CLXA 3WJ7A 1K6JA 4XDZA 2JJYA 1PEDA 3VDRA 2PWZA 3H4VA 5I9NA 1LI4A 4LVCA 1EVZA 2FN7A 4KQXA 2NV6A 4Q3CA 1YDEA 4MVJF 4LRTB 2R2GA 3ROMA 1X0VA 2HQ1A 3HNPA 5GZ3A 4IDDA 4AJNA 1Y7TA 4K1LA 4AJKA 2VZ9A 2Y0CA 2O3UA 3CH6A 3QJ5A 1LRJA 1UAYA 1DIGA 3JYPA 3O8QB 4CLOA 3GVCA 3WS7A 4CM9D 3RUEA 1NQAO 4E3ZA 4ZQHA 1NQTA 1PS9A 3ANLA 1LLDA 3BMCB 3AM4A 2NSDA 4IS2A 4B7CA 1Y8QA 2OUIA 1YOVA 2PZKA 2DFVA 4IZHA 4E6PA 4W6ZA 1UZLA 3NEPX 5IDYA 3BMOB 3D0OA 1KEWA 4YB8A 5BNIA 5KJFA 2ZB7A 3KO8A 4OQYA 3BXXA 3F4LA 1BXGB 1PJQA 3DAGA 3I9OA 2PKQO 3BA1A 1I3MA 4FGWA 3HZZA 1UXGA 1GCOA 3VKUA 5TNXA 1KEUA 3LYLA 4NFSA 3BTSA 5CPFA 4RF4A 4IXWA 1BRMA 4AJPA 4I5DA 4GLOA 4MPDA 1C1XA 3T7EA 4CM3A 4H16A 1DC4A 2EP5A 1N9GB 3H7AA 4E5KA 3QWHA 4F45A 5KVQA 2VHXA 4YJDA 1YO6A 4XDYA 2X6TA 3L77A 1R12A 1ZSVA 3B1KA 1T4DA 2LDXA 4Y6PA 1ZIDA 3U4DA 4UULA 1LLUA 4E2YA 1NNUA 5A3JA 3PWKA 1Q7CA 4RPJA 3WXBA 4J4HA 3DBLA 5C7IO 1GQYA 3I5MA 3ZWBA 3ABIA 5F21A 3B70A 4PFJA 2HJSA 4JP3A 2NLOA 3ITDA 4FJ2A 2CD9A 3JQEA 1NWCA 3GRKA 3VC7A 3I83A 3GVPA 3DC2A 3TRIA 4NNJA 4D44A 4MP8A 4AVYA 4PN3A 4NU5A 1BXZA 5ICSA 3PHLA 5L4NA 4PVDA 1RYEA 3ZNOA 1LX6A 3SJUA 3TF5A 3KYCA 4NJMA 4LSMA 4BNLA 1GFSA 2X0RA 5CEFA 3ZW9A 1E7MA 3UN1A 4M87A 3A9WA 5CFZA 1OBFO 2IYOA 3VPSA 2PD3A 1V8BA 3BYZA 1GV0A 1AN9A 2O3QA 2I65A 1WXDA 2A4KA 1H94A 5KNLA 2A9FA 2EIHA 4WUVA 1QKIA 4OO3A 3AM5A 1T26A 4ZRNA 3AI1A 2P4QA 4IDBA 3ZV3A 2D1YA 1X1EA 2Q2VA 4P4NA 1YL5A 2NTVA 1J6UA 3RFVA 4E21A 1XEAA 5I7SA 4J4BA 4YR9A 4KOAA 2R00C 4DPLA 3FR8A 3PZRA 1RPNA 2PKQP 5G0VA 3U4HA 2ZKLA 4EUFA 1FDWA 1SC6A 3HDHA 1GPJA 2J3KA 1UDAA 1DRWA 2IRWA 4RPGA 5U4QA 3D7LA 3EUWA 3H9UA 3TN7A 4RF3A 1MGOA 2E82A 4MVJG 1IE3A 1XG5A 2P5UA 3WX0A 3Q2IA 4R69A 2E6UX 1ULUA 1DXYA 3ORFA 2EKLA 4H15A 5DCYA 2XOXA 4NG5A 1D4FA 2X0JA 3B20A 3PWZA 4BKOA 1UH5A 3FI9A 1UXIA 1D7OA 2ILTA 4YQYA 4UREA 4CLEA 3EW7A 3PQEA 4IDCA 4Z9YA 4KUGA 3TFQA 9LDTA 3GMSA 1SZJG 1EE2A 3WMXA 3QVXA 3WFJA 2EGHA 3RSHA 4AG3A 3KRTA 3K6JA 1HTBA 3ON5A 4IDFA 1FDUA 3UW3A 3AOGA 4ID9A 4GX5A 4L4XA 4DC0A 2LDBA 5JYDA 4IMPA 4W7IA 1PWZA 4KQWA 2PA3A 2DTXA 4BNNA 5HTOA 3RC7A 1E7WA 2WD8A 4ZN6A 3SEFA 3I9NA 1Q2XA 1T25A 4D79A 3I23A 5KCZA 4AJIA 3BMCA 5KTKA 2GPTA 1R4MA 2O23A 4NK4A 1S7CA 4TKLA 2O3TA 4WLVA 2PK3A 4MKRA 5AXBA 4UUMA 1C0PA 3PRJA 4A03A 2FPPA 3ETEA 1BGVA 3BMOA 5M6DA 1VLLA 2X7HA 1P33A 4R54A 3KV3O 3EZYA 1LQUA 1MP0A 3AW9A 4Z3KA 3U4IA 4CV1A 1BXGA 2PNFA 4PZDA 1R6DA 2FY8A 3R3SA 4AJHA 5KIAA 1ISMA 4RF5A 4L73A 3EVNA 1K89A 1H9AA 5JCJA 1M67A 3MJTA 1WMBA 3GN2A 3IQDB 1DSSG 2FP4A 2JFHA 1K2WA 3LK7A 4G2NA 1BHSA 1OC2A 5G0UA 4RVGA 5DOZA 4P38A 5CDGA 5I9MA 2BMAA 4JGBA 4IY1A 3VH2A 3NGXA 1VKOA 3RBZA 3P5SA 2WMDA 1TXGA 3TOZA 2G17A 4L74A 4YTEA 1N9GA 4XGIA 1P0CA 4J43A 1Q0LA 1ISIA 1K6XA 4J0FA 1EVIA 1UJMA 2J5KA 5JCXA 3IC5A 2EG9A 2C29D 4WLEA 4EI2A 4GLLA 4BNVA 5COAA 3T4EA 3PYLA 3UF0A 4BV8A 2I9PA 4CR7A 2VHVA 4B7UA 2FZWA 3U4CA 3HDYA 1U8XX 3JQ6A 4BNYA 5ILGA 2NM0A 2X9GA 2Y99A 3JQGB 4O6VA 3AY3A 4B4VA 4JN6B 3RU7A 3DMTA 4BNIA 3GR6A 1ZVMA 1I3LA 3ICPA 4TROA 4CQLB 3QRWA 1CETA 3BZUA 2GERA 3M1AA 4OL9A 3SVTA 4NIMA 5JO0A 4UVGA 3MEQA 4XIYA 3QE3A 2UDPA 5GZ1A 4RV9A 4AJEA 1B3BA 4RPKA 2GUGA 1CEQA 2GNAA 2W4QA 4B8ZA 5L95A 1E3SA 1TT5A 3E9QA 2BF7A 4YJHB 4E31A 4R5MA 3GNQA 3HN2A 1NTOA 1W73A 1OOEA 4PLVA 2EP7A 2PH5A 1XWFA 3H5AA 4IQGA 3OQ6A 5T8KA 9LDBA 3LF1A 5GZ6A 1YBVA 4I9UA 4W9NA 4BMNA 1XA0A 4G81A 1T2EA 2VZ0A 3I9MA 3K2BA 3DOJA 4JJGA 2B4TO 4OMUA 3LT0A 4DQXA 5A9SB 3P19A 3IUPA 2B36A 3QSGA 1VC2A 1LDGA 4CMEC 5COBA 3OP4A 3IAHA 4XRRA 1KVSA 3TPCA 1S6YA 1NQ5A 5F1KA 5L4LA 5AOVA 4C7KA 4JBGA 3UOGA 2NQTA 3RC9A 3FSRA 2NUAA 1VPDA 1HRDA 5JAQA 1H2HA 2CUKA 5ADHA 2R6JA 5L9AA 4R3NA 2H9IA 1NFRA 3ZWYA 4KZPA 3TOXA 1RYDA 3JQ7A 2CVOA 4WOJA 3S55A 4W4TA 2G5CA 4RVHA 1ULSA 4MDHA 3V1TC 1P45A 1GR0A 3DAPA 2IDZA 2X0NA 1KOLA 3KVOA 3OF2A 1AGNA 4XYGA 2PLAA 3DHYA 1IHXA 3KTDA 2CZCA 1AXEA 3RVDA 2HJRA 1Z74A 2Y68A 1DFGA 1PSDA 1E1NA 4RVFA 5TT0A 4K9DA 2Y1FA 3TSCA 4ZU3A 3S2IA 5CG1A 4BNWA 1UAGA 3DFZA 5TC4A 5CDSA 1N7HA 4HFMA 4E5YA 2P2SA 1HSZA 1HDYA 5IF3A 3PJGA 2Q22A 1XQ1A 4L76A 4A27A 1OZAA 3PLNA 2PGDA 3ADPA 1ZNQO 5TS3A 1QLJA 1VL6A 3ZNNA 1Z7BA 1W0CA 3RKUA 3ZV4A 3VZPA 2WE8A 2C82A 3ZHZA 1ZO8A 5HM8A 4OM8A 1BDMA 2WSBA 5C37A 4J90A 1F06A 4PG4A 5G0TA 5DP2A 1KERA 4BQRA 4J1NA 1BVUA 1E7SA 1YQDA 3RFXA 1I3NA 4XX0A 4RPHA 3HHPA 4BNFA 1AHHA 3K73O 1WMAA 3AJRA 4NBWA 4RL6A 4KDFA 3BTVA 3WYCA 4FIZA 4J4TA 1NM5A 1KVUA 4Q3BA 3Q0EA 3OICA 3K92A 3ASUA 2Q1TA 2DT5A 4NR0A 3ZH2A 3VZQA 5DDIP 1WW8A 1EBUA 1HDGO 1O95A 1VJ0A 2VYVD 3LVFO 2WWRA 2VTDA 5K0ZA 1YVEI 4WECA 3H65A 4J9VA 4BO0A 3ZWVA 3QLJA 1LSJA 1IL0A 4U5QA 1SBYA 1YJ8A 4W82A 1EUZA 1SB9A 1TT7A 1XSEA 4EZBA 1VE9A 1DIRA 3NJ4A 2I5PO 1Y6JA 4IDGA 4E0BA 3TZHA 4ITUA 4HP8A 3JQ9C 3DONA 2HUNA 1ZW1A 1DOHA 4BVAA 2O4CA 5JAZA 2HMVA 3FWNA 3TFOA 3JQGA 2AEMA 4IMRA 4ESOA 4DREA 4ND5A 5L7WA 2Y1DA 2UV8A 4UVHA 1YQGA 2EHDA 4CQMD 1A4IA 2X4GA 1H6DA 4CQLA 4D3FA 4XCVA 4ZICA 3KEOA 1D1TA 2FSSA 3ENKA 5IZCA 2GZ2A 1LRKA 1LSOA 3GRPA 3H5RA 4R01A 1PJ3A 2B69A 2OORA 1U3WA 1DJNA 2P68A 3GY0A 3WGIA 1F12A 1NVTA 3O26A 4OXYA 4M49A 4YJHA 1XU9A 2YV3A 1ZEMA 1PGOA 1E77A 4FFNA 4LSWA 4DBZA 1KEPA 2G82A 2CDCA 1DBVO 3SXPA 3D4OA 5IXYA 1EDZA 1AE1A 3PYMA 1X0XA 2VNSA 4JIGA 3RUAA 4EW6A 1HKUA 1HSOA 4FFMA 5A9SA 2QX7A 1E6WA 1PR3A 4PG5A 2JAHA 1U3TA 3EYWA 3GOHA 3I3OA 3OM9A 1P1IA 1EUCA 3JD1A 3WBFA 4AJOA 2X9NA 4HNGA 1UDBA 3JD3A 3HE3A 3RIHA 1DAOA 2YHIA 3VTZA 3BAZA 1EBFA 2Q46A 2NQ8A 3RUFA 1UXKA 3UVEA 1YONA 1B8UA 3HDQA 2CNBA 1X1TA 1GUYA 4GWGA 3ZU4A 1QR6A 1N7GA 2O50A 3ANMA 1HE2A 5L3ZA 1SOVA 4OSPA 3H5NA 4MKZA 1QSGA 2RAFA 1T4BA 2NWQA 3ZU5A 5IFLA 4EEZA 1YE3A 3WIEA 3TDKA 4BO2A 3KOUA 2W8ZA 2C2XA 4UEJA 1ZK1A 3OH8A 1SOWA 1JDJA 3EHEA 4LGVA 1GPDG 3L6OO 2PR2A 3INTA 4LISA 4LMPA 3KLMX 1M2WA 1GV1A 1R66A 1ZBQA 3UXYA 2J3IA 4XYLA 3FBGA 3MJEA 5AXDA 3ZDFA 1EDOA 4JJFA 1R4NA 1PL7A 1RKXA 2AG5A 4BQPA 1D1SA 3RUIA 5A4DA 2PD4A 3ZWCA 4HFNA 5JS6A 5JDIC 1ENPA 4A73A 1RM0A 1MA0A 4AJ4A 4DYDA 5K6AC 4AJLA 3FN4A 3VAZA 1VM6A 3JQFA 3WQSB 1V0JA 1PZGA 1P1JA 3TZKA 5ICMA 4FB5A 4RCVA 2YYYA 4D41A 4P22A 2Y0EA 3HB4X 4IS3A 4JX8A 4L8VA 4LVUA 5JFOA 1SCUA 1R15A 3C3XA 3OBBA 4YVFA 5I8WA 2W2LD 1E3WB 5F5NA 1ISGA 4PZCA 4QO7A 1UP4A 1CQJA 3MJVA 4BKRA 3AUTA 4A7PA 3NT5A 4DQUA 1U7TA 1SB8A 3OEWA 5TT1A 1P74A 1EVJA 2Z1NA 4FGSA 1YXMA 3JQBC 4QXMA 3GGPA 1X14A 8LDHA 2YDXA 1NBOA 3GFGA 2FPIA 4M55A 1E3EA 1RWBA 4MP3A 3FTNA 4CLHA 1FDTA 4M54A 3E5RA 5L4SA 1NPTO 4Q3DA 1B8PA 1GCUA 2IZZA 2CF5A 3MOGA 4E33A 3S2EA 1H5QA 1YJQA 1MLDA 1ZEJA 3AUSA 1NFQA 4ALNA 3ENNA 3H9EO 3IP3A 5CG2A 2OGUA 1K3TA 4IBOA 3CXRA 1PQUA 4GX2A 4LN1A 4CQMB 2BGMA 4TZKA 1A71A 3LSYA 4YAIA 4LCJA 1XIVA 3KHUA 3PHGA 5F1PA 3VOSA 4HY3A 5L45A 4WPGA 3QVTA 3G1TA 3ZHXA 3E9MA 5F3RA 5T67A 3FWZA 1Q7GA 3OETA 5JYAA 4ALMA 4YBZA 3PWSA 2BRUA 3ASVA 4PLTA 1FDVA 2DM6A 1DHTA 3RC1A 3V2UA 4BNZA 1WAMA 4PLHA 4KUEA 4C4OA 1H6CA 4IQ8A 3HDJA 2XF8A 1I0ZA 2AQIA 1ZMTA 3WGHA 5TIIA 2OXIA 1KC1A 3HB5X 4LW8A 3ZNQA 4B4UA 2J8ZA 1DC6A 4WEOA 2DPGA 1ADCA 2QQ5A 3DZBA 3GFBA 2ET6A 4TZTA 3FRJA 1PTJA 4OQZA 3PTZA 4YA6A 4NBTA 1FXSA 3D1LA 2O4UX 5T5QA 3TZCA 2JD1A 1T2AA 1JKJA 1Z45A 4NMHA 4E2WA 1EFLA 1DJQA 3KYDB 3VZRA 5JDCA 1ONOA 3PVZA 5DOVA 4MJLA 1F14A 1N1GA 2EV9A 4NBRA 1H93A 3AM3A 2JCXA 2ZJ0A 3TZ6A 5LDHA 1LEHA 3ZI0A 4R68A 1E6EA 4IUYA 5COQA 3ADOA 4U6QA 2X1HA 4NDNE 1DC3A 3NT4A 2GDZA 1N1EA 4I9HA 4M89A 1OI7A 3PYXA 2Q2WA 1K0UA 4Z0PA 2VWGA 4WK6A 2ZK7A 1H9BA 4CLRB 4F46A 5GY7A 3U09A 2EW8A 3VDQA 1GZ4A 3RC2A 3DZGA 3FCOA 3SBOA 1TI7A 5F1OA 5ENVA 1TB4A 1VI2A 3K96A 4OKIA 4BNMA 1T2DA 2Y1GA 4FN4A 4L75A 1ENZA 3FNGA 2Q50A 1UR5A 3UH1A 4CMCA 3GUYA 3KXDA 1X13A 2SCUA 1Y5MA 1Y5RA 3LQFA 2HRZA 4HNHA 4DXHA 3G17A 1I01A 2J6IA 1UP7A 3DWFA 4JJIA 4YJGB 3F5QA 1IZ0A 4CMJA 2PV7A 1U8FO 1FMCA 3L0DA 4K6FA 3CZMA 4OXKA 5FYDA 1E3WA 8ADHA 2BHLA 1FDSA 2BFPA 3MWDB 4ZQGA 2Q45A 1WLYA 2I3AA 1P3DA 2ZYAA 1IUKA 3JYNA 2TMDA 2EGGA 5CDUA 2ZQYA 4XR4A 4R41A 1LRLA 4KMSA 3C85A 3VH1A 2Q3EA 3AOEA 4J2HA 1BXKA 1H0KA 2X5JO 1CYDA 4KWHA 5G0SA 4R1NA 3M2TA 3S1LA 5BQFA 1XQ6A 1VJTA 2VYVA 1GDHA 4BHTA 1CRWG 1NR1A 2EJWA 4Q3EA 3JYLA 1HDCA 5A05A 3A06A 4E12A 1I33A 4A10A 4FQ8A 4GVLA 3C1AA 4AJ2A 2H63A 3JQAD 2CY0A 1CDOA 2DLDA 2X8LA 3K5PA 1UXHA 4BO8A 5IDWA 4ILKA 3I4CA
chains in the Genus database with same CATH superfamily
4DS3A 3FIUA 4BMOB 5F9HA 1R9JA 2NO9A 3RRZA 2JJ2D 4BEJA 1DO8A 4EP1A 4QRIA 4FFLA 4AZWA 4EOGA 4Y98A 4JYZA 1I7CB 1Q0TA 3HKCB 4J7UA 4LRQA 3O0TA 3TXXA 3OQ1A 2D2IA 1KHTA 1GQ2A 2WWWA 1E0JA 3Q8XB 1SFRA 2C7VA 2F3SA 3H0KA 3I12A 4X1YB 3RS2A 3IOYA 5EXSA 2ZI7A 1L0BA 1VQ1A 1FYWA 3C3PA 1A9QA 2BI8A 3HCNA 1E6KA 1V43A 4RXMA 3RHTA 1UDCA 4ZYLA 3LIPA 2JRLA 2N9UA 3D8BA 4YUWA 2BFCA 2EU8A 1T5OA 3R5JA 4LX0A 4OP2A 2P4SA 4Y2HA 4DT1B 7ABPA 3OE1A 1JL3A 2I2WA 5CFRA 4RELA 2HADA 1Q15A 2Z2JA 2E55A 2A0WA 3F9IA 3TLMA 4QXOA 4N0PA 1SG9A 3CVUA 3HFSA 2FEOA 2FPKA 5SY4A 3UM9A 3BK1A 2KI5A 2LV8A 2NU7B 2VWHA 3R7BA 3SC4A 4N5NA 5AKYA 1DJMA 1U1GA 1P4GA 5A7HA 5HGJA 4ZVVA 4HGRA 1M54A 4EATA 2RGRA 1W8DA 1JG6A 4HWTA 4FYPA 3EAGA 6REQA 1M1XB 3GRAA 1ZCZA 4N6GA 4P82A 3WAKA 2VDOB 5L7TA 2QUZA 3C3BA 1G6HA 1IHPA 2YICA 1IY9A 5A6SA 4WZBB 3CIFA 5DBIA 2JVIA 3PB3A 1N6LA 1RFGE 1YBFA 2QR5A 3COYA 4HZIA 4EHJA 3GRCA 2UXBB 3CINA 2OBNA 3AFNA 1Q21A 1MABA 3KYDA 4L78A 5IRCD 4RHTA 4Y7DA 1FXUA 2ZRQA 1TMGE 1UBTS 2CL5A 1GD1O 5E8JA 5IAKA 2AW5A 2SHKA 5TJ9A 2G8NA 1WVGA 4R9UC 3IQXA 4OB7A 1R7RA 3OCJA 2DBVO 4IOKA 2HSDA 3ZIAA 5BSKA 3AH8A 4IJ6A 3TUJC 1Y4UA 2Y0DA 4UAVA 1DO2A 3WRVA 3OFNA 1WQ4A 4R6XA 4X54A 1HI9A 4QUAA 4DVJA 2IYWA 2UYQA 2OXEA 3CH5A 3EIFA 5MHTA 4CKXA 4PS0A 2QPOA 4X3PA 5TGDA 1U3UA 2HAEA 4KKVA 4DVGA 4IXTA 3X1MA 2PVPA 4UHBA 1YI1A 2XE8A 1Q14A 2FR1A 2VC2B 2I4LA 4MUIA 3ISJA 1VL0A 1PYOA 3NP9A 2W93A 2O2ZA 1UWVA 2DWCA 2Q28A 3T5DA 1K5DA 1DFHA 1M1NA 3E53A 5ARCA 3ADCA 4U7FA 2HWYA 3PL1A 1UBOS 4LYAA 1TZCA 3TLBA 4BECA 4PYOA 5CFMA 4OXNA 1PJCA 1Z73A 1TM3E 2CLLB 5EMJA 2B92A 4A2QA 3ERCA 1RRFA 5C35A 3I39X 1X1AA 1YU6A 2CKMA 4IKOA 4BNXA 3T99A 4OMDA 3RAFC 1QAOA 1HETA 1JQKA 1YASA 5IJAA 4UBNA 4NMXB 3V32A 4DQVA 1DKRA 2PO5A 3TM5A 3FUWA 4ROSA 3QEMB 4DUPA 4FC6A 1CKEA 4LHXA 5H81A 4EYSA 3LHIA 3BB1A 4HVAA 1WKBA 1QLHA 4XSGA 2VDWA 1O0CA 3L7KA 1V71A 2GPJA 1LW6E 1CJTC 3D02A 1CYEA 3R6TA 4IHAA 3WGKA 2XDAA 4YJGA 1CJVC 2GKGA 2I99A 2QJOA 1Y3CE 1RPTA 4WUTA 5CYGA 2PU5A 1DC5A 3N8GA 3I64A 2BISA 4G9BA 1RJGA 1M6HA 3Q9NA 2PD6A 4NYMQ 4XASA 1SBIA 5AUQA 4MQEB 1TCVA 1XNRB 4Y1RB 3EC7A 3JVVA 5LIPA 2HLHA 2E4WA 5DGXA 3K09C 1WBDA 3G79A 2A78A 3ZGVA 4Y2TA 1GL6A 4PO8A 5LP6F 4X20A 2PX8A 1OFHA 2XCRB 2WYVA 4WINA 1E1KA 5BNFA 4MIOA 3VPHA 2GGSA 3DLIA 4MDYA 5H16A 1I6WA 4LQ4A 3DMPA 4YT5A 3W9SA 5ER6A 4DIUA 1DDIA 2X2OA 3SIXA 5DV9A 1O57A 4EPVA 3EWSA 5HKKD 1AHIA 4OAOA 2Q5FA 1M6VB 2QM7A 3IRVA 3G2JA 2QE7D 2GI4A 2OO5A 3OHMA 3L6EA 4F2WA 1Y34E 5I4BA 2QGFA 3FMVA 4I19A 5J4YA 4HT3B 1LLQA 4RMGA 1B6RA 1QX4A 1NLMA 4ZMSA 3ICVA 4RHFA 2BDUA 3BEDA 2IEDA 1XRLA 2ZANA 2W2MA 1B76A 5JMOA 2O5CA 4CG0A 4QYIA 1Q2UA 2CJFA 3NHWA 3QHQA 2RKOA 1X7DA 2ICAA 1W0JA 1Z0IA 2NO4A 2GF2A 2XCUA 3DYIA 5KEIA 2VH1A 1QF6A 3PDIB 1B0UA 1FVHA 1F4LA 1GKYA 2BKVA 3LU1A 4GPAA 4OHVA 3D64A 2DXIA 4IIVA 1IJEA 3JATB 4JLNA 3GH1A 5M3BA 5TMDA 1W93A 5KMGA 5JMWA 4TMYA 3OBIA 1AK9A 1LBIA 3MS2A 2NSLA 5T4BA 4B3BA 2IHNA 2X86A 1GNPA 4YP5A 2C7BA 3FBTA 4DDUA 3GHYA 4UTZA 2V6JA 3KUCA 2WWTA 3QZUA 4CMBA 3WGTA 5JE8A 3WGYA 3OIYA 3VR1A 1OB2A 3DAFA 3UY4A 3CKLA 4AZVA 1V6SA 1NU8A 4B87A 5JI3E 1BGWA 1XKLA 4IDEA 3I42A 1PU2A 3PENA 3ZGOA 3ICCA 1EJ6A 4L57A 4EJ6A 5K7SA 4NECA 1B74A 3HSSA 4QOEA 2QORA 3GWGA 3Q11A 4CM4A 3DHEA 2NU6B 2ZOSA 4XRGA 3E5NA 4UD6A 4ENWA 5IMSA 2O8EA 5T7BA 1RAGA 1PEKE 4HLNA 3SC2B 3M6AA 1W6UA 1CQIA 1E9DA 4MQ4A 3C1UA 3RJMA 5SZKB 1SRRA 1D0IA 3WR5A 4H1TA 2QR3A 3ZCSA 4E1VA 4ALIA 4LYYA 1DGQA 4HNRA 1GPKA 3O73A 4AUEA 4MMXB 1PI3A 3IAS1 2G7MC 2IOFK 1SN7A 4R71A 2QTZA 1Y81A 2J0UA 3I6IA 3CX6A 4GUAA 1JIXA 4KXLA 3HBJA 2FPRA 1DQRA 1VKJA 4QICA 4DSAA 4ZYVA 1NMQA 2IODA 2R84A 3JXEA 5E9AA 4F12A 2ERCA 2W2NA 3VMFA 3S6JA 4RULA 3W2GA 3EHDA 1E1CA 1EEHA 2YFHA 4FK8A 5GMOA 1P1FA 3VYTB 5K3EA 1MO2A 4FHZA 4W5TA 5KYYA 2Q6OA 2VQEB 1PGJA 3BVPA 2VUTA 4QYMA 4KXNA 1FDIA 1OX4B 3KALA 4L1KA 3CRNA 3ZXXA 1V3TA 3FHJA 4KFCA 2VT2A 2WHEA 2LVBA 1QQ7A 2FN4A 1BD3A 1B0ZA 1NM5C 4J03A 2DETA 4P0PB 3K1ZA 1RD4A 2D5CA 1MOQA 3FNHA 1FSZA 3IEVA 2GZHA 2YQ5A 3ZVKA 2R25B 2ZJ7A 4MWZA 4YAOA 2F1HA 4DIFA 2F8TA 3CUEF 3RS0A 1YZUA 4NEGA 2N42A 2QN9A 4KFSA 3VGJA 2LNDA 1EWTA 3ORQA 4DNPA 2H1SA 1D2HA 3R0QA 1H6AA 2A5JA 4XWGA 3TZBA 2DEUA 4UM9D 1BVRA 1GL9B 4PRLA 4N41A 4ZMRA 3Q4GA 2FZVA 1LK5A 5I9SA 3CLHA 1C0KA 1F0NA 4M0MA 2IBMA 3NHJA 2QPLA 2B2CA 3HJNA 4FR2A 1TDJA 3C6KA 4HQFA 3VV2A 1P80A 2OR3A 1JTEA 2ZSUA 2QQ0A 2CDBA 3BULA 4M2LA 1E7QA 1X7WB 5C3MA 3PRHA 3AF6A 1OWPA 3DVQX 1M74A 1OSNA 1ZICA 2PSHA 4L5JA 1BS2A 4OP1A 1HRKA 3LQ4A 5IG2A 3U7GA 4XPIB 4GMHA 4NJEB 3QNWA 4ZANA 1G6KA 4ZODA 2DGDA 5ESXA 4RORA 2XY4A 4Q7EA 4YMTA 2P9CA 3WGGA 5BVGB 4BP8A 4CKZA 5IZCC 4PICA 3A9VA 4C0LA 5EPUA 2VWPA 3O1IC 3MWEB 3RBVA 4HUJA 2WIGA 3Q7SA 5EVCA 2IPXA 2ZRPA 4M7OA 3VV3A 1H8HD 1XCJA 3TR6A 4DXDA 4BQQA 3BT7A 1FBNA 2P8SA 5ANRB 3KKOA 3G5LA 5BURA 5BWBA 3PNQA 3JRWA 3PIRA 5F98A 1M7GA 2CK3D 5C1DA 1ULHA 1T10A 3DLHA 1A2BA 1L8XA 5HIAA 3AR7A 4YDRA 1FLAA 2CLMB 2R11A 4GZLA 1XU7A 1C0IA 4HLDA 3WTCA 1WZ2A 1NT2A 1KZ6A 2X5XA 5MFZA 2JHFA 1GTJ1 5H0IA 2B4RO 2XQVA 3R0XA 4KXUA 5HFNA 5ARBA 3CQ9A 4YUYA 1JEYB 1I7MB 1XDUA 3HACA 3NAZA 4KN6A 3DQQA 5DBHX 3VNUA 4YRBA 1DJPA 3EFHA 3EZGA 2GVNA 4Z8XA 5IVDA 4O59O 4FBGA 3RYCA 2OYCA 3E2MA 3JVDA 3G82C 3ER6A 3SU8A 4K7JA 5F7ZA 3U60B 1QYIA 4AW9A 2QQFA 5LYJF 1XKQA 1E5LA 4RK4A 4V0NA 5K3AA 4EM6A 3DCIA 2E2WA 3F5SA 1VL1A 1E5DA 3DBRA 2O1SA 4L0CA 3F71A 1A9XB 1YZKA 2GYYA 4OD0A 5IT9A 1PRYA 2IXFA 4N5HX 2OFWA 4MMZB 5F33A 3NTVA 4TLCA 3DJFA 4CPDA 5ERGB 4MLPA 4YRRA 4LXTA 1G7TA 1ZK4A 2QTHA 2IIPA 4RACA 5FH9A 3ND9A 1T1EA 2WIDA 1EWVA 1FUIA 4DUGD 4ZDJA 3M81A 3ZU2A 4KQ6A 1XTQA 4MYDA 4UXIA 4EO7A 2CXNA 5IYZB 1U81A 4XVQA 4TKUA 2QVXX 3LCMA 5BN3A 4Y2XA 5KYWA 4XYEA 2NSJA 4F8YA 1XTBA 3KKPA 4O4HA 5TQ0A 1FUYB 3QLVC 1WSWA 3HUFA 5A1TA 4IV0A 1GRVA 5C8VA 5GVSA 1GAXA 3DCNA 3L18A 4RTSA 4Z7JA 3UAYA 1D2RA 3DDCA 1W85A 2QTVB 3JWIA 1I7BB 4LXHA 5D5PA 3UAVA 2F1RA 4WBNF 2ZUWA 5SY9A 3IVXA 4CLQA 4ONEA 1KJYA 2IGBA 4KH1A 3N07A 4XIGS 3ZDAA 1T0PA 4JU9A 3H1GA 4F4FA 5CJPA 4B3SB 5DYYA 1YZHA 4IJVA 5HOQA 3NBXX 3NIBA 4KNYA 3EAQA 1OI3A 4Q19A 1JQ5A 3QYPA 3STWA 4MYSA 4OCZA 4IOLA 1J24A 4UOEA 3WGQA 1KJ8A 2Q2OA 2DUUA 3VSAA 5IT5A 4WBSA 5FBRB 3SVLA 1RJFA 1M83A 3TZQA 3W2IA 3WL6A 4NZZA 3GN1A 4BRZA 3HO1A 4DSOA 3L40A 3WHIA 5D00A 3A14A 5HIKA 4Y1FA 5K0GA 4QECA 4QFCA 4CEJB 1P6UA 3GA0A 4GQBA 4ID3A 4Q48A 4BO6A 3N2IA 3SVZA 5EERA 1EUDB 2OBFA 4BBZA 3CO5A 1Q7BA 4TT8A 3OQHA 5LC1A 1AOXA 4ISCA 4Y2GA 5CXXA 4IFEA 3FPLA 3P9XA 4HOYA 1NDQA 1SUBA 2C4VA 4MCIA 3W4IA 1JIIA 2RHLA 3AHFA 1FNBA 3BXPA 3GOQA 3ILXA 2C42A 3GDGA 3KE8A 4Y3UA 1ZM4A 4OLJA 3SXJA 3GGOA 4JU8A 3PX7A 2IVZA 3UOWA 1XYVA 5L3RA 5AW1A 3EVGA 2F2TA 4HDSA 2I8CA 3OHSX 4MR9A 4HRAA 1HYHA 2C5HA 2Q3FA 4Q9KA 1KQGA 2GPWA 2JIQA 1EM6A 2WNIA 2XUGA 3IEKA 3KJZA 4C22A 5JNUA 4QBKA 4DAEA 1N2ZA 1XC7A 3Q6IA 2QD1A 2CKDA 2ZI5A 3NUGA 1QP8A 1NXVA 3B38A 1XMPA 3EIWA 3PFBA 4G63A 3TNLA 4EF5A 1O9BA 3IKJA 1JEJA 4TKVA 5LQSA 4TTIA 3PFNA 1QIEA 3VR2D 3W5AA 3OZTA 3AEUA 5J4VA 3TSAA 4JBHA 4UPDA 4MV8A 1XD2B 5A5GA 4S04A 3C97A 3QJYA 2OQ2A 5ALEA 3RODA 3PPVA 1SUIA 1X7YA 1KGSA 2JS7A 4JWKA 3BXGA 1J49A 3L0PA 3BPSA 2HO5A 2Y6VA 2NIPA 5AXCA 4J0QA 4O3MA 3Q1LA 1V5FA 1M3SA 1NNI1 1ZUWA 3ZK7A 4JA0A 4MIEA 4YONB 2RKWA 2VEOA 1QQ6A 5REQA 4MUFA 3ES9A 4FE4A 5ITZB 3HHEA 2ALJA 3D6UA 4TKZA 3WLJA 4D3ZA 3WB2A 4YPVA 4QYTA 3CNOA 5G2OA 2OOSA 1EK2A 3R5TA 4KC0A 3C8ZA 3LNTA 3ORHA 3RKSA 1M33A 4WKGA 1NVDA 1JZTA 4YAKA 1AS3A 1RACA 9ATCA 1NPYA 2VLIA 3CLKA 5GADl 1E9VA 1QBGA 4ZI7B 4CHGA 2ODEA 2BGLA 3NEAA 4Q18A 2V4ZA 1VKNA 1U2DA 1GTZA 1QV7A 5EP3A 1BMTA 5BNTA 1VHWA 2HMWA 3F78A 3MMPA 1CU1A 1T5TA 4H7FA 1FYVA 5J4KA 3AEQB 4G56A 2IS2A 3L07A 2I2BA 2DH6A 4DBVO 5DWVA 2Z2KA 3HDGA 5U4XA 4B0PA 4UVEA 5KNCH 3NIDB 5IUJC 3OT1B 2XVYA 3DKRA 4KGVA 5ALUA 5FI1B 1XP8A 4EAAA 2Q7OE 5BOSA 5JXIA 5KVCA 1LPSA 5LFAA 3ESRA 4LFBB 4U3JA 3FCXA 3PTLA 4C06A 4C7JA 1DDOA 4DDWA 1I0IA 2ZYGA 5FR1A 2VF8A 1KP2A 5FTJA 4UE2A 1AMUA 3T7RA 2IH2A 3LTNC 3PJFA 4Q02A 3AU8A 2D1RA 1N5KA 3KHSA 4L07A 2IIVA 1YAHA 3AG5A 1HBJA 4M7PA 1YHZA 4NPCA 2PGLA 1GITA 2D1SA 3HCCA 1ZFNA 3BHJA 5C5DA 2LKCA 4BX3A 4A8HA 3Q5DA 2ZI6A 3CUVA 1C0EA 4DGSA 1FTGA 1STOA 1W5EA 3NZEA 2UVPA 3VNSA 3I9KA 2GHRA 1GYQA 1M0WA 4YO7A 2A5FA 4UNPA 4YRTA 3RIEA 5JJCA 1KJ9A 1W7AA 2TMGA 5A02A 3FGPA 3PNOA 3ZJ5A 1ZJWA 5F7JA 2ZRLA 2OV4A 1KDOA 1BMFA 3PNPA 4DAOA 4E13A 3NUQA 4ZXFA 1CG6A 5E9JA 5FTLA 1JEOA 1KMIY 2I54A 4ZOAA 1NE2A 1I6KA 1G8HA 3CMCO 3FHLA 1N5OX 1FU4A 2CZGA 1IDOA 1O94A 1VA5A 1GZ3A 1ZC4A 2IXTA 2Q5LA 2XUHA 3EGOA 3I4FA 4JC4A 4PCAA 3VR6A 5DISB 2CLIB 1P1HA 5EN4A 1A8HA 1DBRA 1SUPA 2RCYA 4GGPA 4JHXA 2ZRIA 2ZRMA 1WZEA 4YCSA 3H0CA 1M2JA 1OLSB 1X80B 2IYPA 1UDRA 3JTEA 3FHTA 1J9GA 1GQOA 2Q5HA 3V8NA 2P67A 4KVAA 3WLRA 4GQIA 3RUPA 4WHMA 4Y2RA 3FCSB 4KMMA 4B3HA 1NE7A 3BN3A 3MMZA 5L3QB 2A1TS 4YT4A 1Q0HA 4J2TA 1XALA 1QBKC 3PKZA 1MO4A 3UHAA 1CZRA 1O54A 3TIXB 4GYYA 1DLJA 3MBKA 2COUA 1L3BA 2JAXA 2K6GA 4WL0A 3L92A 3KU4A 3G9XA 4PRYA 2Z98A 3CE6A 5K4HA 1NQUA 4MB6A 3P96A 1I94B 2AB0A 1NUSA 3HN7A 2EF1A 2PFGA 4LK3A 4HDMA 2GEFA 4HWSA 4GKJB 4AICA 5MN5A 2I3GA 1SHLA 1TJ3A 4E6EA 2FWRA 3P8ZA 1VSBA 1QHHB 2Z5LA 4FEEA 4GI2A 3A6FA 4KW7A 4QNNA 1RDFA 2FCRA 3ESBA 3LGXA 4TWZA 3OA0A 3HBFA 4YWJA 1BMQA 1KZGB 4QT0A 5DEOA 3M5WA 5FBKA 2GTPA 2WF6A 2X76A 3E81A 2ZWPA 3D6VA 2HHJA 4LXIA 5EESA 1J97A 1THTA 4EL0A 5JAPA 2AS0A 5KBYA 4M1EA 1QRSA 3M1YA 4YREA 2PL3A 2VDQB 3QVUA 3H11A 3FKSD 2XUPA 4MUNA 4F3YA 4TTTS 4WN9A 4OSOA 3NVAA 1NJ6A 3VVMA 3OPVA 3MOSA 2EYUA 2P77A 1C1HA 3LOPA 3RSQA 1OFGA 4MV9A 1G7SA 5AOBA 5JW6A 2D5BA 3DUFA 3P9PA 4HNAA 4J49A 4XM0A 5B7NA 3DWEX 1SBHA 3WYNA 2H4FA 2LE0A 2M1XA 4BJ1A 3Q7TA 1R1DA 1H3NA 5T6MA 3K1JA 2H5LA 2O0HA 3GZJA 2QQEA 3RS5A 1OAAA 2F55A 3PDJA 1Y33E 2Z5VA 1XDGA 3A1TA 1XPOA 1CTQA 1VZ3A 1Y3BE 2G25A 2ZS8A 4JLBA 1YS4A 4QPDA 2XITA 2IUSA 1DV1A 2ZS9A 3N8DA 1GGHA 5HFJA 3ROQA 4UM8B 4IWYA 4KVFA 3WA6A 2PLWA 4CIVA 2WD7A 5K5EA 4JS0A 3ICQB 4DV1B 3AWDA 5FR2A 3CUKA 3LLSA 5FI0B 4CV0A 1EWQA 4WESB 3OP1A 4FYKA 3GFQA 3NNNA 2V3CC 3GC6A 3NT2A 1MX5A 1OUMA 2WE7A 1KE1A 3I28A 1O77A 3P4XA 4E94A 1FL9A 2OFPA 2XWJI 3CZRA 1NBWB 1ZD4A 2F1KA 2PMKA 4Y67A 4C03A 3IBTA 1TT5B 3GH3A 3RTEA 3GJ3A 4Y2UA 4Y2JA 3T1OA 3FOBA 1SEVA 2YOHA 3W8DA 5J2UA 2RK3A 4EKYA 2PMBA 1E5QA 2WLSA 3A32A 3IJEB 3OQIA 5E3HA 3GJ7A 4D9HA 3GEDA 2WUFA 3QPVA 3EP5B 1M7BA 1F6BA 1A9YA 3FX2A 2VHYA 3R3UA 4U2KA 3V2HA 3ZQUA 1JH9A 2W2XA 3RYIB 3TZEA 3SLRA 1RP1A 3C4JA 3DZCA 4LCBA 2WJVA 1RRVA 2HUPA 1HL7A 3PCXA 3DWGA 1CR4A 1KMHB 4OH7A 1ZH2A 3GHHA 4P36A 4CTKA 5KVVA 4Q9AA 1B6GA 4BASA 5LQKA 1QIGA 5JCOA 4CW7A 3D3WA 3P9ZA 4CKEB 1VIAA 3CLRC 1I3KA 3B3GA 4OL0A 2B82A 4DC9A 2BMJA 5PGMA 2CFRA 3CKYA 4G4IA 2DBQA 1XEWY 4L4SA 4CM8B 1S2OA 1OHHD 3LE8A 1FFBA 2FFAA 1REQA 3I2KA 3NC0C 1BQ4A 3YASA 4FS8A 1P3Y1 3KSZO 4E7OA 1N2SA 1Y0BA 4RJJA 2C54A 2OO7A 4YV1A 4U7GA 1NQOA 4JY7A 5AW6A 3EP9B 3O8RA 2XMSA 4DIEA 4EEXA 3Q5GA 3VU9A 1VL5A 2FG7C 1KOFA 1FCJA 2NAPA 3FFTA 3O7WA 1RPZA 3E0QA 3WV5A 4K3UA 2VDMB 3GCGA 1Y4AE 1CSEE 1JZSA 5FTNA 4HSEA 1UPCA 1W46A 2PJDA 2M98A 3JQ7B 1YGYA 3NNDA 3COPA 3R75A 3S27A 3MBOA 2VYNA 1X7GA 4JASB 2D2FA 3T3IA 3VU0A 5IJ9B 5IF9A 2UUAB 2IYYA 3OTQA 1IDN1 3NDIA 1WUHS 4D98A 3FYUC 4OLAA 2E37A 1R8YA 3SS7X 1L4BA 1DHRA 2B4AA 2F59A 5JAHA 4M0DA 2QMQA 1IN8A 1RQ2A 4JSTA 1YBMA 5BR4A 3BHMA 3PXDA 1KYTA 4EMUA 3ZX4A 1EHIA 4BFVA 5GJBA 3SQWA 1QHFA 2AN4A 2QX6A 1I1QB 1PUXA 3BGIA 2YVAA 5BYJA 5BR7A 1W36D 4R8MA 1C9DB 3AUKA 3BRWA 3HNRA 2R1UA 5LMZA 4O33A 1DTEA 3PFKA 1JYSA 1P7YA 2GAOA 2YFKA 5M2QA 4UEWA 4OREX 3TLEA 1NXQA 1CIJA 1JHOA 2SECE 3QBVA 3FPSA 1MIOA 2Q4OA 1SBTA 1QQTA 2P2CA 2RMKA 2FPGA 3E05A 3MYRA 3T95A 3WWZA 2GD0A 3EXHB 3PDCA 3T7TA 4MQMA 2XKJE 2D5IA 2OWEA 1KYQA 2Q0XA 2VH2A 2HZBA 2Z2IA 3OUUA 4IKPA 1KKMA 3L0ZA 4LOLA 1SUDA 4JLOA 1BX1A 5DWQA 1OA1A 4INJA 4TSFA 3V8EA 4CCYA 2VP6A 5J5VA 3PT5A 4HRYA 3UK2A 4ZTZB 4IGIA 2AD1A 5DP1A 3BHNA 5DRYA 5LP1A 5ECGC 4LVNA 1KEVA 1O9HA 1E0KA 3X0DA 3A4TA 4Z4FA 2E4AA 5IK2A 2DKFA 4WBXC 1E5XA 2ZRCA 1ZVJA 3Q2KA 2W2LA 3KVYA 3QHAA 4HXYA 1MV8A 4QASA 4AG6A 1LBEA 3BM5A 5EINA 2DMRA 5KNBH 5KDDA 5CYPA 2VNIA 4LQDA 4BVJA 3EMVA 1Q17A 1J20A 3PK0A 3WYDA 3DO5A 1J0CA 1Q7EA 1R0LA 1RWMA 2AJCA 2O14A 1P5HA 2XCIA 3AP3A 3D4PA 3DEZA 3DDUA 3LWDA 1ZY2A 5L3SA 4CKBB 5E6SB 5AVZA 3FVWA 4BTVA 4AIRA 1V3VA 2DU8A 3OIVA 4M0LA 5C80A 2BH2A 2C4HA 2BR3A 1P4SA 5BSGA 2ZB4A 1G8MA 2BGRA 2VAXA 5EGSA 2NO7A 4EYEA 4YRGA 3EVEA 2WICA 3CLSD 2D7CA 2QUIA 2YOGA 5AIAA 1AKRA 4P3KA 1AGXA 3VPBA 3OJLA 3NTLA 4D99A 1X77A 1JBQA 1JSXA 3I73A 1RVDA 4PNPA 5K3FB 1SQ5A 3ONEA 2YJ4A 4UAJA 5I9LA 3C4VA 1J1UA 4RKEA 5DTEA 2HX1A 2NQ2C 1FIUA 1G1MA 1DL5A 1OAOC 2YRFA 2P9EA 4NH4A 4DPKA 1F2UA 2YNMC 1ZOPA 5FUBA 4Q3NA 2PKYX 4PSCA 3SF0A 3W8FA 1ZH6A 2VBCA 4OQMA 3P9CA 4LY3A 5C9ZA 1P4JA 1M5UA 1UFKA 1QXSA 3ESXA 4QPJC 4RXUA 5ALYA 1LDEA 3GELA 4ENPA 1IYZA 2ZI4A 1DTSA 3MJCA 4LNUB 1I10A 1QB7A 2NZYA 4YROA 3NHYA 4YMHA 2AOXA 1C3OB 1IONA 4JLAA 3TLJA 2ZUBA 3PQDA 4LZLA 2JFPA 3GFVA 3ZEIA 1XCOA 4IM7A 2BELA 1K3FA 1MEEA 2RBEA 2ZU6A 3MT7A 2ZUTA 3KSBC 4QEDA 4WNYA 4INOA 1II8B 5DXFA 1IN6A 1JECA 1O6CA 2FZGA 5LQDA 3RG2A 4DFDA 4GEGA 2AG1A 4LBVA 3K0CC 1ZXBA 3LWBA 1X9IA 3HKBA 4EY7A 4R1TA 3QKTA 3T52A 4CTMA 1Q1EA 3LYAA 1B26A 1ZK2A 4HCJA 2W8BA 5B36A 3DZDA 1MVOA 2D2EA 1G8YA 4YXFA 2IHZA 3LJKA 3QE4A 1Y9DA 2A9OA 1M2OB 5LP6B 1NW3A 1T4CA 3TUXA 3CSUA 1OZGA 4E11A 4MR8A 1BKDR 1VHLA 1JHYA 2QN1A 3QOFA 1LBSA 5FI3A 5AYVA 5K8IA 3OZFA 4HEHA 5DULA 2DPYA 3AEKB 3LC7O 4C05A 2WJHA 4CMIA 2R2AA 3KEMA 1MX3A 5HR5A 4JLWA 4DMKA 1F2VA 2AJLI 3L02A 1FYFA 2QRLA 2QY9A 5T64A 1XVIA 1YRWA 2VDKB 3CV3A 3KVNA 1M75A 1XAHA 2CXUA 2EFDB 3RWMB 2PRSA 1HTWA 2HRDA 1VKZA 5I9BA 3X2FA 1O3YA 3PE4A 1P6XA 3E35A 4ND4A 5E7IA 1QFYA 1TA0A 2PZMA 2NVWA 1NVEA 5HJ7A 1M1YA 3CSSA 3WB1A 1X1QA 2G8LA 4A6DA 1VJRA 1N0WA 4KPUA 1WXEA 3L1VA 4OI2A 4IJKA 1ODSA 1JJIA 1Q7TA 4IXDA 5I6DA 4L2IB 8OHMA 1LLCA 4B82A 2ROQA 3LA6A 3LDHA 3OC0A 1F5SA 3N70A 3OMLA 5FOUA 3WDMA 1Y8RB 3GJTA 3UANA 1YL7A 1LJ8A 2VAMA 1G0OA 1O6BA 2IEGA 3L82B 4WCFC 5G3YA 5AVWA 1JIQA 4YR7A 1MB4A 1A5SB 2QTBA 3WGVA 1Y6RA 4D9CA 3ND5A 1LDBA 4TQAA 4YT2A 2WK1A 2O8CB 3DMNA 4IIEA 3L8GA 5AP9A 1O96A 1OLOA 3FE2A 4TV8F 3TLKA 3RIYA 1YJBA 4PE5B 2A57A 3C8MA 2HRCA 1VKHA 3NRBA 4M0PA 4D9JA 2XA2A 1VTKA 1KO5A 1V9CA 2PZ8A 3CRVA 4G0NA 3O9ZA 2VQ3A 4TLLB 4X64B 2MINB 2OO3A 1NX6A 1K7EB 3NAQA 3QU2A 4OQNA 4HD8A 3TAUA 4RFVA 4BX2A 4W5RA 1BMDA 1TE2A 2F6RA 2XUOA 4R7GA 4BNTA 2AVDA 4G5SA 4HB0A 1UBHS 4MIKA 3LPCA 4W8GA 2ATEA 2CXRA 5KOYA 1UKZA 2B9VA 4QKQA 2UZ0A 1ACLA 1L5SA 1PV1A 4UDYX 4NEQA 2JD2A 3FRIA 5AIBA 3D6TB 2A0KA 1PZMA 2W7TA 1MT0A 1U2PA 2D06A 4ZPJA 3ZHYA 1T2NA 1T35A 1Z0UA 3QX8A 2ASEA 4Q4DA 5HQ3B 1CIVA 5IS2A 1GPBA 3PFHA 3AEXA 2NXJA 5DWDA 5EEHA 3KTAA 5HILA 1UOQA 5GAJA 4X6UA 5KOJA 4IG9A 3L8CA 1JDTA 2O7SA 3JYHA 2P9ZA 2CN1A 1U7DA 2W22A 2NU9A 2O6LA 4GOKA 3EGEA 3TR5A 4BLWA 2BBSA 2GYUA 4AFNA 5IC4A 3U6KA 4U7WA 5KSYA 1KFKB 2YV1A 3EOAI 3H1BA 1HDXA 3L0CA 1QHSA 3M4YA 4U7HA 1L5KA 1FUUA 1NBEA 2AI2A 2DPMA 4ZZ1A 2BVNA 3E3LA 2XCOA 1T34A 4IDHA 2FG6C 4ZRMA 1MC1A 3GT0A 3K94A 1T43A 3KHTA 4BWVA 3GFSA 4OUDA 4QUKA 2G63A 2WZCA 3PFGA 1N6OA 4AM8A 2ZSHA 1MB9A 3M89A 4XDGA 4TV9F 4Y1EA 3IPAA 5AK6A 3PPIA 5FXMA 1E3IA 4B85A 4BO4A 3OO1A 1VLVA 4ZVMA 4FFBB 2QNIA 5EWMB 3U44B 2ZWAA 4QOJA 4CIXA 2G67A 2ZYTX 3A31A 3GZNA 4BOYA 3REQB 1KY2A 1W19A 2CJPA 2V6IA 4JROA 5T4HA 3ETNA 1X1RA 1O0BA 1NVBA 1O1YA 2EL7A 1VIDA 5HP4A 2XHZA 3LDAA 4MTCA 3IWDB 1CEEA 1ZNWA 4X8LA 1VIYA 3W6OA 3ZPXA 4DA7A 1IM2A 1NYTA 1SVSA 3PEUA 4EJMA 4R9SA 4E4RA 5KTNA 1TKAA 1FNNA 1J5PA 3FMOB 2CE2X 1E9AA 3N2GA 3OFKA 4QYWA 5G4KA 5I4IA 4KRXA 1ZH4A 3LBHA 4I14A 1PS8A 1N2HA 4JA2A 5B3JC 5B6PA 5K8JB 3KXIA 1ABFA 2RCNA 1JEAA 2QIOA 1Z3CA 3K3PA 4JELA 4NXNB 5T73A 1HOXA 2VK1A 4WCDA 4EX7A 3EA4A 5IXSA 3R7NA 1KYXA 2J9RA 5E1DA 4TLDA 4X6YA 3WLLA 2HW8A 4DLAA 1FDRA 2RK6A 4I1PA 4HGNA 2IYZA 1K86A 2DSTA 2E48A 2GEUA 3ORYA 1V6CA 4O4JB 3EGXA 3UXMA 1PR0A 3T12A 4EKNB 3NLLA 4XQEA 3MTBA 4A8JB 1GTG1 3UUWA 3P0RA 3MMSA 2J4CA 1TM7E 1R6VA 1YB6A 1I1NA 4H9GA 1L4LA 3FGNA 2EKQA 1Y3HA 5FUMA 1U6IA 2VNHA 5KAPA 4F4JA 3AFIA 2ZIZA 4KH0A 4W8HA 1EA7A 3KQTA 1IZ9A 3OUTA 2BSXA 3H84A 5FKJA 3WQQA 1ODIA 2CFTA 4QODA 5A7FA 4RQAA 4I50F 2AJBA 3LH5A 5HIMA 1V1RB 3M3PA 2P4HX 1RI1A 2P2YA 2ATVA 1G2QA 3KUDA 1QYCA 5BMOA 4OP3A 2RH5A 5FUVA 1NF3A 2B1IA 4J1TC 2WG1A 3TEMA 4Q4HB 4UU1A 2C78A 4M53A 2GCOA 5ADVA 7YASA 1VYHA 4EW3A 5T3UA 5EQFA 4OHYA 3E84A 4L5YA 4X92A 1A5AB 2FRDC 3S2SA 4DN6A 2FV8A 2GESA 3G8YA 2JCVA 4Q1EA 5ABPA 3CU5A 1YBAA 4GXRA 4O2BB 1GADO 1EVYA 5K0SA 3DEJA 2R6R1 1PWXA 4RC9A 3NANA 3LOUA 1FMJA 1KK1A 4EYQA 3ILYA 2CHQA 2B6HA 3EZ9A 5KU7A 3TGLA 4LJ9A 4PO1A 1G6OA 3QVSA 3IV6A 2I4IA 2Y67A 4K9KA 4F6RA 1OYYA 2BKAA 4ZOLA 3WLQA 3G2QA 3EVAA 5AJTA 1L5FA 3GLHE 2GR9A 2F90A 4IZOA 4PLYA 5U1PA 4B9EA 5DNAA 3TSYA 4UKDA 4CMGA 4YRKA 3P97A 1HF3A 4MGIR 1SVNA 4RKFA 4EHAA 4QXRA 1L2TA 1E5TA 4UCFA 1GRRA 1EFCA 2Q6KA 3I76A 4PONA 3MPOA 1C3VA 4XSVA 4RW0A 5LB4A 3RU2A 3ZWOA 4UM9B 4D4KA 4ZEWA 1F8GA 1JLRA 4KP7A 2W6NA 1U8TA 2ZB3A 1EFAA 4DDHA 1LSUA 3LDFA 4EJ0A 3DJYA 3WQRA 4MRPA 3FOZA 4F21A 5E8RA 1SKYB 4UHKA 3U7JA 3SDZA 3AR9A 3Q3GE 3H04A 4GH5A 4HXFB 3TJRA 3NC1C 4BC1A 4XEUA 4NFYA 3CR7A 2LRHA 2REQB 2QYOA 2Y1XA 3O8CA 3W3AD 5C8ZA 5DBGA 5BNWA 5CEJA 3EP7B 1JDVA 1LC3A 3BICA 4HADA 5FLEX 5A4JA 5BN1A 1S9DA 1Z28A 5L6MB 4LWZA 3GG2A 4LCEA 2XGJA 3LTEA 1YL6A 2NX2A 4HGPA 4OFXA 5EUCA 3N7AA 1NI4A 4B4WA 5EIOA 4MVJI 4XD7D 2AFIA 2DUWA 2ZE8A 2YDYA 5B2FA 1MG0A 3NDPA 4QDJA 4MI3A 4RTJA 4ZCTA 4GXTA 5F2KA 4ARUA 2VJMB 2NADA 3B2NA 4PS1A 3G0OA 1UFQA 5DHSA 4X00A 4F1JA 5HZGA 5HEKA 3DTVB 4RD1A 1DBQA 3HNOA 2C2HA 1Y48E 1KK3A 2HRQA 3FNBA 3ITNA 1UC4B 3PVCA 3KOZA 4RPCA 3V4SA 2QN2A 2WYUA 4B09A 1IVYA 3CRW1 4OK6A 5SZHB 5LSAA 4LY6A 4DZTA 4HWKA 3EFOA 1Y9AA 2Q4TA 2HBYA 3E70C 2KLHA 3FETA 4M6WA 4NK5A 3O1LA 3O4HA 3OIUA 1J4AA 2C57A 2H59A 3KT0A 4I2VA 4NJMB 3P0FA 4DNXA 2H17A 2OK7A 4PXSA 2MDTA 4O29A 1FP4B 1VLZA 3NDJA 1PT9A 2GARA 4OYLA 1WQ3A 3C45A 1S8AA 4YRMA 4I8XA 1YU9A 2PEYA 4R2HA 3FCEA 1XK6A 3BWBA 3E27A 4KYIB 3RD5A 2RGGA 2YFYA 4UZSA 1PZFA 1RM4A 2Q1UA 1GVHA 5IZ4A 2FR0A 3UCEA 2PR7A 4O8JA 4UDNA 3RK4A 3LVBA 1EFKA 2ZJOA 4AY6A 2IS1A 4EPTA 1GFWA 2CMFA 3FYTA 1XLUA 3QLTA 3FGZA 4L9SA 3X44A 4DQDA 4X94A 2XMBA 4Z2AA 2CHFA 2JLXA 3OFJA 2J5BA 1NYQA 2YKGA 1GZ7A 1ZX1A 3B3JA 2JI9A 2QHXA 4GW3A 4KZKA 4L6CA 3BH7A 2ZUSA 2SICE 3Q9UA 1S5PA 3A9TA 2YHBA 3DE0X 1TVKA 3RHFA 2BFBA 1ZWKA 3QFCA 1U9IC 1YVRA 3AI2A 4K88A 3JSAA 1Z7EA 4N7RA 2FMHA 4KUHA 3JQRA 4NDAA 1SH7A 3NVDA 3UKOA 1H85A 2ACVA 3ZBUA 2BTOA 4YP0A 1D1PA 3LBAA 3RADC 3ZJXA 4E5NA 1JKMA 2WILA 2JGFA 1D04A 2PZEA 4WASA 2XUFA 3H42B 4G5FA 4C01A 4Z5XA 3SQNA 1PVVA 3IPXA 4RH3A 2VN8A 4Q5IA 1M34E 4WWHA 5EKXA 3OKCA 2V7EA 1AKYA 3OY7A 3IP1A 4HQNA 4CLXA 3BGVA 5ELLA 4UTOA 4XDZA 4IJQA 2V4MA 4REQB 5FEMA 2JJYA 1VGRA 1PEDA 2YMQA 2OC4A 3VDRA 5FOWA 4LVCA 2J0QA 4Q3CA 2B98A 2NV6A 5BXYA 2XZOA 2EWWA 5KC8A 5AHRA 1FFSA 4RM3A 4LRTB 1QKKA 2R2GA 4HYYA 1SZPA 3HNPA 3AP1A 4YRLA 2OGSA 3R74A 1RJ9A 2C4NA 4LOIA 3O4IA 4UATA 3ANXA 5IUNC 4K1LA 3RVBA 3QLUC 2BJWA 4P34A 4BIMA 2Y0CA 3CH6A 1U0BB 2BFEB 5CVTA 1JLMA 2XNHA 4PAMA 1XMSA 3AILA 1E2KA 4TMWA 4G5RA 1DIGA 1OT5A 2B7CA 2VF7A 1Z63A 4CLOA 1QCZA 4LRUA 3LY5A 3W0LB 3DS8A 4AY5A 2PVCA 3WS7A 5EJ7A 3RUEA 2H2GA 3O9MA 4FX5A 1DWPA 2GEDA 1D2MA 4X1KB 3FIJA 1ISRA 1OWOA 3LRPA 5IKMA 5DM0A 1PS9A 4KN8A 4Z4QA 1PG2A 5LZ7A 1LLDA 4QRHA 3PEYA 3EBLA 4B7CA 1RLIA 1YOVA 3D0RA 1CUXA 4KEAA 4NE7A 3U37A 3A6LA 1CK4A 4EPWA 5CGZA