1PQPA

Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
357
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNSTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Haemophilus influenzae rd
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
total genus 118
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pqpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pqpA01
1HL3A 4RDHA 3CEAA 2Y67A 1YRLA 1ZFNA 4XRRA 4MVJD 3WGIA 2HMVA 2Y1DA 3JD1A 3KRTA 4HV4A 5CDTA 2J5RA 4OMUA 1U3TA 4BB6A 4CQMD 3JQAB 4LK3A 4YB8A 1VL8A 3CMCO 4R41A 5K0ZA 2DTEA 3C3XA 3C7CB 5IFLA 1H9BA 1JWBB 3D0OA 2GZ1A 3N58A 3E9QA 4A5OA 4Z3KA 5AXAA 2EP7A 4FGWA 2GN6A 4Y6RA 1ZEMA 2D4AA 3JQAD 5DCWA 1K2WA 4WCFA 5BNIA 3Q2KA 3I4CA 4ZGWA 4CM1A 3AUTA 4J7CA 4Q3NA 2P2SA 5U4QA 1E92A 2CY0A 4MKZA 3BMQB 2J5KA 1B3RA 3D4PA 4BNLA 1GUYA 1NTOA 3IC5A 4JP3A 3S2EA 1IHXA 1WDKA 1EUDA 2DPHA 3KYBA 1WAMA 3PHGA 3AI1A 1VKOA 3VPXA 4EUHA 1RJWA 3WJAA 1NQTA 1XGKA 4IY1A 3DAPA 3T7CA 3VPGA 3UVEA 3D4OA 4TQGA 4DTIA 2ZB4A 4R1SA 2V6FA 3AI3A 3A14A 3JD0A 1I36A 4E2ZA 2Y68A 3K8ZA 3WIEA 1R0LA 5TQVA 1R4MA 3QA9A 4YPOA 3C1TA 2WJPA 2WTBA 4MVJP 3BXXA 5GZ6A 4J1QA 1EUZA 3KTDA 1E6EA 4R3NA 4IZIA 1BXGB 2FPPA 3DDNA 1P1KA 1KVQA 4PIVA 4WKGA 3VTFA 1BW9B 3QVWA 3UHAA 1KEWA 3OEWA 3F1KA 2HCTA 1OFGA 1C0LA 2VTDA 3QSGA 2Y1EA 5JY6A 1EBUA 2DT5A 4CL3A 1ISIA 4E4YA 1GCUA 4TRMA 4JN6B 4NFYA 2B83A 2PGDA 3RSHA 4B79A 4EEZA 3VZSA 1JWAB 3EC7A 1UZNA 5CG2A 2FR0A 4NG5A 3RC7A 3HUDA 8LDHA 1ULSA 4CQLA 2DUWA 2X0NA 1CERA 4J4TA 2X9VA 1UZLA 5LC1A 1H6AA 3DB2A 5JCXA 4BNTA 1EK6A 3FD8A 2C54A 3W8DA 5A06A 3NT5A 3WGQA 4YT8A 1NFFA 1V0JA 2HQ1A 4YJDA 4EEXA 1BDMA 4AJEA 4GSLA 1Q7GA 3LF2A 4YAGA 4AJ2A 1O6ZA 5B4TA 1PZHA 2Y1OA 4QFCA 3I4FA 3RUAA 3GGGA 3GDGA 1MB4A 4MVJF 2B5WA 3RUHA 3UCFA 1ID1A 4XZ3A 1WZEA 4J49A 3OF2A 1B2LA 3AUSA 3WIDA 5T73A 4FFMA 5JC1A 3VPHA 4EBFA 2JCXA 2BFPA 2H5LA 3H6KA 1X1EA 3JQ7A 2C29D 3WBFA 2PH3A 5EERA 1S7CA 4IJKA 3LC1O 4JJGA 1ISHA 3KBOA 3QIVA 3ZN2A 1RPNA 5HBRA 2DBVO 3KHUA 4JBHA 5CDGA 1ZJYA 2BFAA 3CH6A 2YV2A 3Q3CA 4GLLA 3PHIA 3MTGA 1VRWA 1YB5A 1I2BA 2O50A 3QWBA 1XIVA 3PYXA 1LTHR 2Y0EA 1P74A 1T4DA 3FTPA 4RF5A 3GNTA 3HN7A 3FWZA 4XYEA 1YVEI 3C24A 4NH4A 1C0PA 4RPGA 1EEHA 2RHRA 3NJ4A 1MP0A 3Q2IA 2Z95A 4YJHA 4DC1A 1QP8A 1LC0A 4B3HA 1EK5A 5IZCC 3GAZA 2NTVA 4XYBA 3WLFA 4A73A 3B1JA 1IYZA 3TFQA 1P3DA 2XOXA 3VPSA 3GF4A 2JFFA 3WQRA 5B12A 4W6ZA 1KETA 1C1XA 1SCUA 3P5SA 1U3WA 3GFBA 4NQZA 1U5CA 2FZWA 2OBNA 2G5CA 4J90A 4DYDA 1MFZA 5DNAA 4E5PA 1Q7BA 2GO1A 1C0KA 4BO7A 3P2OA 4GQAA 2ZB7A 4WECA 2SCUA 3H2ZA 4BNIA 2JFHA 3FTNA 1I10A 4MINA 1NXQA 3AW9A 4OQZA 2RBEA 2QZ9A 4U8GA 1R66A 4Z0HO 3PWKA 1WLYA 3KLMX 4FR5A 3GQVA 4WLUA 5I7SA 2X5KO 5ENVA 1EMDA 2OFPA 4RF4A 4P22A 3DBLB 2V65A 4CLXA 3AJRA 1WW8A 2D59A 3RU9A 4B8WA 4HUJA 1I3LA 2GZ3A 3ITKA 4RLHA 4W9NC 4A10A 4YAJA 4DUPA 5A3VA 2FR1A 3QV1A 3BTUA 1E3LA 4UVGA 5IDQA 3FI9A 1LRLA 3TZKA 3IMFA 5KJEA 3PYLA 1DB3A 4E2XA 1E7RA 3JQ8B 5F3RA 3WGGA 5JMWA 3GHHA 4BV9A 5G4KB 1YQXA 1SEPA 4B7UA 2E82A 1X0XA 4OXYA 3LT4A 3S2GA 1N8KA 4IDFA 2NWQA 1XELA 3OIDA 3PLNA 2HK9A 2GSDA 4CLOA 3KSUA 3I9LA 3WMWA 2GYYA 4YEDA 3W6ZA 3GLQA 2Y93A 3EW7A 2NTNA 4K6CA 2EP5A 3GN1A 4KUEA 2WEKA 4RZHA 5AQ1A 5G0TA 3V2UA 4JLWA 5KVCA 1XLTA 3ZU3A 4E5MA 1KIFA 1V8BA 5K6AC 3PLRA 5JFOA 1O89A 1F17A 1P77A 3ZWAA 2DTXA 2G82A 3OIGA 1LDMA 2Z5LA 2ZIZA 4RPHA 1H5QA 2O2YA 4CR6A 4DBZA 3HNPA 3RKRA 3A9WA 4RF2A 1AXEA 1GUFA 1PWZA 3JQDA 3PGJA 4CV0A 5FI5A 1LSJA 4E33A 4J6FA 3NDIA 1EFLA 3H3FA 1EFKA 4JGBA 4PLFA 2I76A 1ENPA 4I9UA 1ISJA 5JLAA 3K9QO 2IEBA 3KYCA 4IQGA 4AJPA 3HB4X 4PG4A 1YJ8A 5EJ2A 1W4ZA 4AVYA 3G1UA 1R37A 4BNVA 4GKVA 1I0ZA 1OI7A 2JHFA 5JCJA 3OQBA 4A0SA 1F8GA 4AJIA 1NP3A 2B5VA 1HRDA 1R0SA 4WLNA 1P0CA 5CPBA 1AUPA 2WMDA 4FFRA 4YQZA 3DONA 1SC6A 1B3BA 3ZWVA 4EJ6A 1PTJA 1JKFA 4JBGA 1JAYA 1ZBQA 2OL4A 3ZV3A 4CMCA 3WTCA 1ONPA 5HTOA 4FCCA 3QVSA 3T7EA 3M2PA 5BSGA 3L6EA 4EJ0A 4W7IA 3IAHA 1VL6A 2UYYA 4XB2A 3OJ0A 1QRRA 3NEPX 3H7AA 1TVEA 4TMFA 4JXKA 3PHJA 4CLOB 1D1SA 2DC1A 3O26A 4QXMA 3CKYA 5A9SA 3AY6A 2ZQZA 5L3ZA 3GVIA 1GQ2A 2VHWA 3B70A 2EIHA 2GLXA 3GEGA 2V6MA 2OUIA 3RAJA 1I2CA 2R00C 1K6JA 3WSVA 3WYEA 4MP6A 4KWHA 2X9GA 4B4WA 1A7AA 3LZ6A 2CDCA 2GPTA 4GLOA 2DTDA 4MPDA 2HAEA 1P31A 1C14A 4DQVA 4UUPA 3IUSA 2ZTMA 3QVOA 1P0FA 4QECA 4ZD6A 3DO5A 1JTVA 4O5OA 4QSMA 1ZXLA 1HZZA 4ILKA 1I32A 1NASA 4M86A 3WJ7A 2EKQA 3TZ6A 1E3WB 4GVXA 1E3JA 1SBYA 2GR9A 2AHRA 4XYLA 2QX7A 1VC2A 1PS8A 4D41A 2HU2A 3BIOA 1VSUA 3GVCA 5CDYA 5CPFA 1ULUA 1WZIA 3RFTA 4CJXA 2O2SA 4R01A 2D2IA 1UJMA 5KJ6A 4ZA2A 1FDSA 3TJRA 2YFQA 3B6ZA 4AL4A 1QR6A 3VVBA 3GG9A 3GG2A 2HK8A 4L8VA 4C7KA 3ANNA 3FHLA 3ZNQA 1GCOA 3DFUA 3DL2A 4IDGA 4R9RA 1PL7A 2R00A 4BGIA 2CF6A 4R4JA 2C82A 1FDWA 1XU7A 2WD7A 5G4KA 3TL3A 3OICA 1M6WA 1I30A 5JYAA 5JAIA 2C0CA 3JD4A 4C4OA 3ZNNA 1UXGA 2NNLD 1X0VA 1X14A 2BI8A 3AM3A 2C2XA 3F47A 1V35A 3PDUA 1P1HA 5C7LO 4IXWA 2NQ8A 2O7SA 1DFGA 1H6CA 1PIWA 2EF1A 1IL0A 4BNFA 2FPIA 2ZB8A 1PR9A 4ND5A 4BNGA 3LQFA 1HSZA 3ZU4A 5JC8A 4CM3A 4CV2A 4W99A 1ISFA 4EYEA 2IXAA 4R69A 4WEQA 3L0DA 3V1TC 4FDAA 3C85A 2BGKA 4C7JA 3FF4A 4FSHA 4CUJA 3PHLA 4E32A 1WXDA 4RO0A 2FR8A 3SX2A 3WXBA 4FPXA 1E7QA 2HJSA 2OZPA 1I24A 5ILGA 3UICA 4BKPA 1SZJG 5LDHA 2FOIA 3OETA 3Q9NA 4KUGA 1DLIA 4CM7A 4MO2A 1E7SA 3EVTA 2B37A 2HK7A 2P5YA 1N5DA 5A02A 4FIZA 1UR5A 1A7KA 1ADGA 2PV7A 4JNKA 4WEOA 1NM5A 1SMKA 2FN7A 3RBZA 4L0QA 2X0IA 3O38A 3KUXA 4HFNA 5THQA 4MKXA 2BELA 2J3KA 4OOFA 5A4DA 7MDHA 1OOEA 2X1HA 4DA9A 4I9HA 4BVAA 1T2EA 1ZJZA 1E7YA 1W0CA 2IE0A 3KOUA 2C2YA 4NI5A 3ZWYA 1KVUA 2R2GA 4OSOA 5IZCA 5I7FA 5A05A 1LQTA 1H6DA 2VWQA 5J9GA 3DXFA 5JCJD 2P91A 4DPKA 2OOSA 3HFGA 2WWRA 2VUSA 1O8CA 5MDHA 4BNNA 4E12A 3FPLA 3OQ1A 2FY8A 2UUOA 4LMPA 4D43A 1MV8A 2O3QA 2TMGA 3ENKA 3KB6A 1W73A 3VKVA 3H9UA 5T5QA 5ITVA 4IMRA 3K2BA 3NTQA 3RQSA 3ZWBA 1T4BA 2A35A 3FCOA 4IINA 2HDHA 1LDEA 2Y05A 1HEUA 4XGNA 4OOEA 4YJHB 2YQ4A 1YXMA 3LSYA 2QW8A 4J16A 2X9NA 2FSVA 5A9SB 1DC3A 1T26A 3DZJA 1AHIA 3OSUA 5DULA 1DBVO 5AXDA 4WLVA 2ZJ1A 4JIGA 2AEMA 2OP0A 1YDWA 1JLLA 3ICCA 1IHYA 4UEJA 3DTYA 4W7HA 3ZCXA 3NJ8A 3UH1A 1LLQA 2ZATA 1QG6A 2P9EA 1BXKA 4CMEC 4J0EA 3ZDFA 3QW2A 3IIEA 3RC2A 1XQ6A 1GFSA 4K28A 5EN4A 5JE8A 3M1AA 4N7RA 2BFMA 2J5QA 4OH1A 4PZCA 4P4LA 1R4MB 1WMAA 3UKOA 4YAIA 3NDJA 1I3MA 4B4OA 3BAZA 2EERA 4UVDA 4IZHA 3ZV6A 4AJNA 3JQFA 4BKUA 5BT9A 3LC7O 4RLSA 1CETA 2ZCVA 2Y99A 3JSAA 2ZTLA 2PY6A 4O63O 1MGOA 4M89A 3ZV5A 1J0XO 2O3RA 1E7WA 3PYMA 1A4UA 1ISGA 1MXHA 5KKCA 1Y81A 1HKUA 1GYQA 1EE9A 1L7EA 3RUEA 1NQOA 2Q1UA 5BSEA 2FMUA 3DBRA 3K5PA 4WOJA 2DAPA 4UULA 3ZHBA 2H9IA 5IXYA 3QRWA 4HXYA 4DREA 3VPFA 4NHEA 4Q9NA 4BMVA 4JK3A 1HDCA 3FNFA 1SPXA 4W4TA 5L45A 1O0SA 3JQBA 4HKTA 4BO9A 1HTBA 4BMNA 2D8AA 5ER9A 3DOOA 3INRA 5DZSA 5A9TA 4CMIB 3DQPA 4HWKA 4NBUA 3PJGA 3H8VA 4E5KA 2WE7A 2Y1FA 3RI3A 3QWIA 1TT7A 4R68A 1T2DA 3L77A 1IPFA 1Y5RA 2CF5A 1PEDA 2YV1A 3H3JA 3LDHA 4L76A 1K3TA 4EUFA 3I83A 4BO3A 3K92A 1OC4A 3GC6A 5HA5A 4FW8A 4TSKA 3F5QA 3VH1A 2JHGA 2P9GA 2CDBA 3BTOA 1ZK1A 4TVBA 1A71A 4Z0PA 2R6JA 2WYUA 1Y7TA 2EW8A 4BHTA 4D46A 4ND2A 4BNKA 5I9NA 3QWAA 2VWHA 3WYBA 4PLHA 3GVHA 4LSMA 4BQRA 1V3TA 4DQUA 2ZQYA 3RUDA 3U4CA 2JD1A 3KSZO 3K96A 1N1GA 1FK8A 1B7GO 2DFDA 5TT1A 2NV6A 3GDFA 4Q3DA 4DQXA 3D3WA 2PLAA 2EKPA 4NFHA 1NVTA 1R4NA 1PQWA 4ZICA 1K89A 2C7GA 4AJOA 1SOVA 1OZAA 1GQYA 5KWEA 3DHNA 4RDIA 1H94A 5DCUA 1GY8A 4GPD1 3PQFA 2GERA 3WFJA 3PWSA 1UXJA 4UAGA 3OA2A 5TRTA 1YB1A 1JQBA 1N2SA 3PEFA 3VZQA 4WNCA 3DTTA 1DC4A 1DFIA 4IM7A 2C59A 3SC4A 3WSWA 5JYEA 3T4EA 1DIBA 2AEJA 3QP9A 4K6FA 4NDNE 4CMBA 5C5IA 3TFOA 5IDYA 3GOHA 2E4AA 3EZLA 1YQGA 2O3UA 1QYWA 3ONEA 1BXGA 3UOGA 3EUWA 3ZU2A 4DGSA 3H5RA 1B16A 2DPGA 5JAZA 1EVYA 4MP3A 3W4IA 5L7TA 4RCVA 4J2HA 1QORA 3JQBC 3R1IA 1XYGA 3E9NA 5FF9A 4HFRA 3QHAA 1ZMOA 4KUHA 3C1AA 3PXXA 1A5ZA 1QYDA 3BHJA 3VDRA 2HLPA 3PQEA 4HNHA 3LLSA 3E6AA 3IKTA 3AM5A 3WLEA 4N54A 2JD2A 1J6UA 4Y8VA 1LA2A 4ZN6A 5EPOA 3VDQA 1M6HA 9LDBA 4CQMA 1X15A 3UUWA 4RPJA 1B26A 1Q1NA 3LC2O 4KMSA 4L4SA 5EQDA 1BW9A 3U4DA 1WPQA 2NVUA 5C3MA 5IAAA 3FR7A 1GTMA 4PRLA 1XQ1A 3WWYA 5A3JA 4DLBA 1T25A 1U3VA 3KO8A 5DOVA 2VCYA 4MVJE 2Q4BA 1W6UA 3EYWA 1R4NB 3HG7A 3N7UA 4XGIA 4BQPA 3GAFA 1PU2A 4KTVE 2W98A 1HSOA 4FFPA 4CM4B 1PZFA 5L53A 4W82A 4WOKA 5I9MA 4WCFC 2PNFA 1I01A 4CMKA 2Q2QA 4BGEA 4U7WA 4GX0A 3I6QA 1M76A 5IG2A 5AOVA 4B8ZA 4GBJA 1DRVA 1DOHA 2A94A 3KV3O 4RVGA 4Q3AA 4DIFA 3G49A 1ZKMA 3KETA 4II2A 3TQHA 2H6EA 1KC3A 4OL9A 4CR7A 2X4GA 5DBFA 4J0FA 1C0IA 1MFPA 3CZMA 2VYND 3F4LA 4KQWA 4RORA 2P68A 3ZHZA 1D7OA 3CMMA 5ILOA 3RUCA 4BGVA 4I5FA 3GMSA 4JJFA 1ZCJA 3HB5X 1UXIA 1I3NA 5DOZA 3RFXA 1R6DA 1HF3A 2ZJ0A 4JP2A 4CR8A 1AGNA 3V2HA 5FWNA 1DC6A 1BMDA 2EG9A 3RUFA 3BHIA 4NU5A 3D1LA 3DBHA 5COAA 2Q4EA 2X0RA 1WDLA 3OP4A 4RVFA 4ESOA 5I9LA 3WMXA 3H9QA 3TOXA 1U1IA 3PDJA 4AJHA 3EK2A 2EGHA 2VZ9A 3OIFA 2HSDA 3INTA 4JQCA 1AE1A 2FHSA 5DP1A 2VT2A 1ZZEA 3ORFA 2JJYA 3R3SA 1FDTA 1B8UA 2DBZA 5A5EA 2FSSA 4U5QA 2W2LA 5KCZA 3RD5A 3UAGA 1MUUA 2DBRA 4PLYA 5KJ1A 2GN8A 3INGA 2BRUA 3ADPA 1I5RA 4QX6A 3DAFA 3O4RA 1JU9A 4A27A 1X7DA 2Z1NA 4Z9FA 5G4LA 4L74A 3TZQA 4IPTA 3E18A 2VNSA 4XQ9A 3I1JA 2QHXA 1IE3A 5JPIA 5L7YA 3DHYA 3LU1A 3RJ5A 4DLLA 2Q1WA 2I6TA 2DQ4A 1P9LA 4GKBA 5TJ9A 2YV3A 4TKLA 1U3UA 3GGOA 2AG8A 4K1LA 3U49A 3KM0A 3KXDA 3PI7A 3E5MA 1HYHA 2UV8A 4OKNA 2YYYA 4OAQA 1DIGA 5DDIP 2E37A 1ZXBA 3S2IA 2Q99A 4BNMA 1ZNQO 2B4QA 5GY7A 1ONOA 3VVCA 3DZFA 4TRNA 2VHYA 1SEVA 1LC3A 2BMAA 2Z1MA 3ZZNA 2NVBA 1JN0A 2Q2VA 3JQFC 4BUCA 1PX0A 2CDAA 5T8KA 3PJDA 2Q22A 2VHZA 1BTOA 2D0IA 1B0AA 1DHRA 4DMLA 2AXQA 4ALLA 2XPCA 1IY8A 4CMJA 1C1XB 1WNTA 4OM8A 1IZ0A 3ONFA 4B4UA 5GMOA 1TXGA 1DO8A 3BMNB 2H63A 5F1KA 4II3A 1CEQA 3DAGA 4CV1A 3H4VA 3A28A 3PIIA 4WLEA 3WICA 4KOAA 4A2CA 2Q50A 3DZKA 3PZRA 2NUAA 1NPTO 3WGOA 1ORRA 3IQDB 2UUPA 2WYVA 4NJMB 2BFOA 2BGLA 2DUUA 1B14A 5KVQA 1TA4A 4WGGA 2QRJA 4XR4A 4OO3A 4DL9A 2EEZA 1TT5A 1E3EA 5IDXA 1Z73A 1ZSYA 4U0KA 2D5AA 4CM8A 4IDBA 4MVJH 2W2KB 1DFHA 3D5QA 4J4BA 3R0IA 4LVCA 1X7GA 1PZEA 4PG5A 1Z45A 3QY9A 4BOYA 1LLDA 3JQ9C 3SJ7A 1WP4A 2FP4A 3RBVA 2PH5A 4BO8A 1UXKA 3W8FA 4G2NA 5JO0A 2PFGA 3GY0A 1F14A 4XQEA 2AQKA 2VZ0A 1KY5A 3L6DA 4J1TA 5KNLA 1PZGA 5B1YA 1P45A 2VYVD 4RV9A 1I2ZA 3ICPA 4NFSA 3S8MA 3RROA 4QFDA 4FQ8A 1PQUA 5JDCA 2Q46A 4IJVA 4NMHA 5ES3A 1LRJA 1MXFA 3ANLA 5CG1A 2YZ7A 3IP1A 3V5NA 4PZDA 2EW2A 4PZEA 3ROQA 3V1UA 5EIOA 3WDSA 3AM4A 4Z0TA 4UUOA 3PZBA 1O5IA 1DEHA 4QUKA 1V9LA 1IPEA 1VM6A 2YFHA 4UUNA 3IL2A 5A1TA 5ADHA 1PL6A 3ZHYA 3EDMA 1CQIA 1ENYA 3E8XA 3MWEB 1F0YA 4XQGA 3RJ9A 4LRTB 2X5OA 2RH8A 4UUMA 3SBOA 4MIEA 4N5LA 3JYPA 4DC0A 4ZRNA 4GH5A 2HKIA 1E1MA 4YA6A 3I9OA 3NKLA 2WDZA 3FBTA 2I99A 1YE3A 4O6VA 3RU7A 4PVDA 4YT5A 3KEQA 2C5EA 4CLEA 1UH5A 1YBMA 1QYCA 4NK4A 4NJOA 5EL0A 4BNHA 4WE3A 1HDOA 3PFFA 2EV9A 3QVXA 3GMDA 2YDYA 2X8LA 3GUCA 1BRMA 2VOJA 1PQPA 1DAPA 4YTEA 1G0NA 1LI4A 3ENNA 2ZTUA 3G3EA 2D5CA 1E3WA 1MG0A 3L4BA 4BV8A 3F3SA 3TDKA 1EDOA 1VJ1A 1Z6ZA 3AUAA 5L40A 2JKVA 5GZ1A 2AMFA 3ZU5A 3ZNOA 4NBTA 4E6PA 2QYSA 2YQ5A 3GNSA 3R6DA 3FWNA 1JKJA 4J3FA 4UEOA 1ZSNA 3LF1A 4J91A 5TX7A 1L1FA 4MVJG 2ZB3A 4ZQHA 5G0UA 4AJ4A 4BKOA 3PHHA 3HADA 3DBVO 3M2TA 1KEVA 3P19A 4Y98A 2HMWA 4WNIA 1MA0A 3E9MA 2YHUA 3PPIA 5KKAA 2JL1A 5JY1A 3DWFA 3PVZA 4J1NA 5DT9A 3AFMA 4YJFA 4YCAA 1Z82A 3WTBA 4YT4A 4EZBA 4M55A 1GYPA 5COQA 3DMTC 3VH3A 1Y8QA 3QLJA 1BG6A 3MCVA 4LSWA 4AICA 3PIDA 2I5PO 1LDBA 3SJUA 1Y9EA 1HXHA 1KVSA 1W8DA 3F5SA 3FSRA 4FS3A 4UVHA 3DZIA 2J3IA 1QMGA 1PS9A 4YBZA 5KOIA 2B4TO 1XA0A 3GNQA 1HDYA 1YBVA 3E48A 3OJEA 3GPDG 4RPLA 1DJQA 4XIYA 3S1LA 2D1YA 1EQUA 2VZ8A 5FI3A 1GZ4A 5IDWA 1XWFA 4D45A 4MIOA 3WS7A 4YRAA 1V3UA 4ND4A 5T64A 5TIIA 4MJLA 4ND1A 1DSSG 4J9VA 4LVUA 4H15A 3CE6A 3L6OO 3QWHA 4TRJA 1NNUA 4Y67A 2BD0A 4KP7A 3VZRA 4XGKA 1WDMA 4NJMA 4QO7A 1VLLA 4NZ9A 3WX0A 4NNJA 4OXNA 4WASA 4WCDA 4PCVA 4GL4A 3ZW9A 3O9ZA 1FMCA 3T4XA 4BNYA 3MOIA 1LNQA 4FFNA 2OO5A 1NFQA 1PGNA 1XR3A 3TZHA 2UVDA 4EJMA 1EVZA 4CODB 5JMPA 1G6KA 1VJ0A 3DMYA 3VKUA 5DCYA 3TPCA 1PR3A 2QRLA 4D0RA 4BNZA 2Y0DA 3WGTA 3OEYA 2YUTA 4IGFA 4E3ZA 3U3XA 4GVLA 4CM9D 2CUKA 5EINA 5A9RA 4DBVO 4BL5A 5LDGA 3TRIA 4LCEA 3SC6A 2CZCA 2JAHA 2PGJA 4S3MA 2RAFA 4CLDA 4J4HA 5DBGA 5AYVA 4FJ1A 4YAEA 3LLVA 2YY7A 1VPDA 1PSDA 4M8SA 1NAHA 5I8WA 2ILTA 3SVTA 1KEUA 1QXSA 3FNGA 3BMOB 4E2YA 1PJTA 2JCVA 1QV7A 1KVTA 5TC4A 1HE2A 4U0JA 1QKIA 4L4XA 3RUIA 2LDBA 3KYDA 4U6QA 3HHPA 5IZ4A 3EGOA 2PKRA 3K6JA 1HZJA 3OJLA 2I65A 2NVWA 4HBGA 1EVJA 1YWGO 1PL8A 4Y9DA 4H16A 1R15A 1FF9A 1T24A 1EZ4A 3QE3A 3UCEA 1YH3A 1HE3A 5A04A 4FBGA 3OJOA 2O3SA 5HS4A 4ROSA 3JYNA 3L4SO 3SEFA 4KWIA 1MC5A 3G79A 1LU9A 3DMTA 4FC6A 1ZSVA 3OHSX 4BNUA 3HDQA 4R9SA 1KVRA 4UEKA 2PKQP 3S2FA 3V1YA 3ANMA 3AY7A 1RM0A 2NU6A 3IUPA 3U4IA 2E49A 1NR1A 4GGOA 2X86A 3BZUA 5G0WA 2O7QA 3WYCA 3CINA 2O3JA 5IN5A 4M49A 4ONEA 2IYPA 4Y6PA 4RZIA 1LSSA 1DIHA 4CLRA 4NR0A 2NM0A 7ADHA 4YWJA 1T2AA 5MGBA 3JQCA 3NV9A 4J1SA 5T8KC 4IIVA 3NDRA 3JQ8A 4WLFA 1ZK0A 4D44A 4DRYA 1Q0HA 1PGQA 1NWCA 2O3TA 1QLJA 3IKVA 4MVJI 1J49A 1NYTA 1QYXA 2FPGA 2RCYA 1D3AA 5KVVA 2VHVA 3OFSA 1CRWG 1NFRA 2BHLA 4TRRA 2RH4A 3WB9A 3H9EO 3L4BC 1MX3A 4XB1A 4IBOA 3DZGA 2XXBA 1R12A 3ROPA 3HFSA 5L4SA 3JQEA 1U28A 1NAIA 1PJ4A 4QEDA 4AG3A 5DP2A 1ZEJA 2YHIB 3GH3A 2PWZA 2VN8A 4ZVVA 3F1LA 2GGSA 1VJTA 5AVOA 1C1DA 3AOEA 3BTSA 3LT0A 4CMHA 1M2WA 1LBEA 2EGGA 3LYLA 3PP8A 9LDTA 3OM9A 4IDDA 1ZK2A 1HDGO 1O95A 2X5JO 1YBAA 2WE8A 3ETEA 3PFWO 1NPDA 3L07A 4WUVA 3V2GA 1DRUA 4BB5A 1NX6A 1QLHA 5BR7A 1HWYA 1M66A 3GPIA 1E5LA 1ISMA 2GUGA 1MC4A 4OJNA 4QQRA 2VT3A 1ZW1A 3C8MA 3K31A 3UXYA 4F6LA 4XYGA 1IUKA 1OMOA 5H83A 4CMAA 4YXFA 1LDYA 2C7VA 4A26A 1TB4A 3UN1A 2EKLA 3A1NA 3ABIA 5HS6A 2D3TA 1T1SA 4GAEA 4N18A 2POQX 3EY4A 3RVDA 3MJVA 4HY3A 4H3VA 4P4NA 1Z74A 2VUUA 3R3JA 4URFA 2GD1O 4XX0A 5DN9A 2QG4A 1P1FA 2DKNA 1CQJA 4DLAA 3EAGA 1GL3A 5CEFA 1YOVA 3OH8A 4IMPA 2FZEA 3F6YA 1BDBA 1LJ8A 3H5AA 3DFZA 1NHWA 4BO1A 2IZ1A 3DBRB 3K2EA 4BNWA 1VSVA 1HE5A 1CJCA 1YL7A 3ASUA 4CPDA 1FJHA 2EHDA 4F3YA 1XG5A 1Y9AA 2F00A 3ITDA 5BSFA 4P8RA 4TZKA 2ZCUA 3H9JA 1Q7CA 1YKFA 4OGWA 1Y5MA 1E1KA 1PGPA 4PLTA 4E5NA 5B4VA 4ZQGA 5CP8A 3HSKA 1I8TA 4INAA 3GVXA 1WMBA 3KYDB 4IDCA 2VUTA 1D8AA 3JCZA 4MOWA 3D4NA 3RWBA 4B4VA 4HFMA 4CM5A 3VZPA 4DMMA 3I5MA 1GEEA 1DXYA 3K30A 2HMTA 1NPYA 5L7WA 4H7PA 1KS9A 3RBXA 1RKXA 4ZQBA 3ASVA 5I7VA 1LSUA 3D7LA 1Y8QB 1CIVA 1XEAA 3B1KA 1YGYA 3WGHA 3D3WB 3H5NA 4I5DA 3TNLA 1I3KA 2PD6A 1UDAA 1YDEA 1R0KA 2JD0A 3KYCB 4I5EA 3GFGA 4ALMA 2CVZA 4NU6A 1U8XX 3DOJA 5ICMA 1BWSA 3DR3A 4BS9A 3F46A 2C5AA 5I8ZA 3UCXA 3GZ4A 4MKRA 4AJJA 3L9XA 2WD8A 1E1NA 1UXHA 3AI2A 3PTZA 4UVEA 1XCBA 2RIRA 4B7XA 1LXCA 4E21A 1KC1A 3WQQA 2PD3A 3DZBA 1WVGA 3O8QA 1U4SA 1EBFA 3NX4A 4CLRB 3ON5A 3BTVA 1B8PA 1MG5A 4XQCA 1AXGA 3JQAA 4XD2A 5COBA 5JYFA 2IEDA 1KERA 2HO5A 3DBHB 1UAYA 4IDEA 5KTKA 4J7XA 3KLPX 4KDEA 4R1UA 3RC1A 1E7MA 4Q3BA 3LT2A 4R54A 2PA3A 1FXSA 3F9IA 1HDRA 4YVFA 5TT0A 4IQ0A 1F12A 4BMSA 4L9RA 1UUFA 3SLGA 1BXZA 3PJFA 5FYDA 2HRBA 1O9BA 5LCXA 4OSPA 1H6BA 2J8ZA 1LLUA 3C7DB 4CUZA 2AE2A 3CTMA 3WG9A 5JDIA 3FNHA 1HDXA 3ROMA 1A27A 1JKIA 5TNXA 1NBOA 2JAPA 2QRKA 4RVSA 3P7MA 2NQTA 2Q3EA 3DHEA 1C3VA 3VH2A 5L4NA 1K6XA 1SO8A 1X7HA 1OBFO 4HX5A 3QWFA 3JV7A 1DLJA 4PLGA 2NU9A 3TZCA 3ULKA 5CDUA 1VKNA 1RM3A 2G76A 2QYTA 1PJ2A 2CSUA 2VWPA 3BMCB 4GX2A 4D3DA 3JTMA 5HM8A 3E5RA 3UFXA 2TMDA 3ADOA 4P38A 5H82A 1DIRA 4Q3EA 2OXIA 2GNAA 1IB6A 2C20A 4PLCA 4XYMA 1U8FO 4B3IA 2W8ZA 3NGLA 4BNXA 4L75A 1LRKA 1A72A 3I9JA 4JX8A 1XHLA 2GASA 2I67A 1U2DA 1ZIDA 1GPDG 1DJNA 4DVJA 4ZQEA 3GVPA 3TWOA 2ZYAA 2IRWA 3WOHA 1PJLA 3Q9UA 2AQ8A 3NYWA 4J9UE 3F4BA 1K0UA 4LCJA 1HETA 2PZLA 1PS0A 5HWSA 1ZO8A 1Z7BA 3W8EA 2WD7B 3ZWOA 3S55A 5AXBA 2AE1A 4ID9A 2F1KA 2AW5A 1WWKA 4RF3A 1YJQA 1IZ9A 2VRCD 4RQUA 4IDAA 1ADCA 1PJCA 3HDHA 4EDFA 1VE9A 3V8BA 4DYVA 4Z6KA 2AEFA 6LDHA 4RVDA 4ND3A 1LQUA 2EJVA 4BKRA 4MP8A 2X22A 4XR9A 3STHA 3B1FA 4E13A 2H1SA 3GEMA 2VYNA 1GQQA 3H9GA 1KEPA 2IZ0A 4NK5A 5IXSA 5TS3A 3ZGYA 3AOEC 5TF4A 3BMNA 4I9NA 3FBGA 1VI2A 3ZH2A 3DC2A 2BKAA 4XJTA 2V6BA 2VTEA 4WPGA 4IS3A 1P1RA 3Q11A 3Q0EA 1VL0A 2QIOA 5F1PA 1ENOA 4K26A 4LISA 4KQXA 3IJRA 1JVSA 3I9NA 1NR7A 2NU8A 4XDYA 1E5QA 2IZZA 4CMEA 4FD3A 4CM8B 1H0KA 1XU9A 4DXHA 1E6UA 1Z7EA 4K9DA 3NRCA 1E0DA 4WK6A 1MLDA 3MJ4A 3Q6IA 1E77A 3WFIA 3U62A 2X6TA 2W2LD 4P4GA 3VH4A 2JCYA 1GUZA 1TLTA 4BO2A 2I3AA 3IS3A 1NVMB 3M6IA 3KEOA 4GWGA 1I33A 1GD1O 2BGMA 2GN4A 4DPLA 4OQYA 1G1AA 3TL2A 2HJRA 4EITA 2PKQO 2J3HA 1LSOA 2VOEA 5ER6A 5J23A 1CF2O 3D3EA 2A92A 4PLWA 4PN3A 1K6IA 4PFJA 1DDOA 5TLSA 5DBIA 1F06A 2CVOA 2IYOA 5ICSA 3MWDB 4YACA 4YQYA 5TJHA 3UF0A 1D4FA 1SAYA 3JQGB 1UP7A 2O4UX 1A9YA 4WJZA 2FRDA 2OHXA 5IF3A 1YONA 3U4HA 3UGKA 1EE2A 1U9JA 1AN9A 1J5PA 2PK3A 1NVGA 4Z3DA 3HDYA 1SOWA 3JQ6A 5U9CA 1PJ3A 3GRKA 4F6CA 1U7TA 4NPCA 2P4QA 4D79A 3GUYA 1HLDA 2P4HX 5CAEA 1HE4A 1OC2A 2I66A 4R5MA 2NADA 2Y1CA 3HZZA 3ZHXA 2XF8A 2CFCA 5G2OA 3ONDA 5KJFA 1UAGA 1EQ2A 5I7EA 5L4LA 4U6SA 4CV3A 4R16A 2OORA 4R3WA 2QZZA 1RWBA 3BYZA 4J43A 2P5UA 3CPSA 3FPCA 1ZK4A 1PWXA 3OA0A 2DLDA 2UAGA 3JD2A 1TT5B 3SXPA 3G17A 4EUEA 1PGOA 2Y1GA 1N7GA 2O48X 2G17A 4OKIA 3JYLA 1RYEA 3H2SA 5U1PA 4DWVA 3PWZA 1LEHA 4LMRA 1N1EA 1XSEA 5F1OA 3E03A 1EDZA 4M87A 3JQ7B 3W1VA 1A9ZA 1BVUA 4JCOA 4GMGA 3KVOA 2Q49A 4PVCA 4Q39A 1GV0A 2P9CA 5CHEA 4IGEA 1P33A 2GF2A 4BO0A 4DIOA 1QYVA 4RL6A 1ZK3A 4HFJA 2G0TA 2NU7A 2B36A 3CSDA 2JFGA 4YJFB 4OXKA 1XDWA 5T57A 5JDCC 4D42A 1M75A 5CEJA 2VQ3A 4CMGA 1ZMTA 1P44A 3ZNPA 2HMUA 3ZWMA 3AY3A 4YR9A 2BF7A 4Z9YA 4ALNA 3GR6A 2OP1A 5JW6A 3W4JA 2AA3A 4I8XA 3X2FA 5B4UA 5C7OO 3MTJA 4FB5A 1HYEA 2BLLA 1E3IA 4MVJA 2NACA 1LDGA 1GYRA 4IS2A 1LX6A 3NT2A 5T67A 2BH9A 1HLPA 2XAAA 5IN4A 1N9GA 3NT4A 4XKJA 3I23A 2VNAA 3MEQA 2O4CA 2VWGA 1ZUD1 2GDZA 3PJEA 5KIAA 3A06A 4N5NA 4BO6A 1S6YA 1X1TA 1N7HA 3JD3A 1RM5A 2B69A 1PJBA 5B37A 3CIFA 1L7DA 1Q2XA 4B7CA 3RC9A 3I9MA 5BNFA 3AK4A 1V3VA 4XDZA 2YDXA 4GMFA 4CQMB 1RYDA 1UDBA 3IP3A 3B20A 2VHXA 1JA9A 3MJCA 1FDVA 3ETGA 4FOSA 3VAZA 1IOLA 3MJEA 3CZRA 4PG8A 4JROA 3NTOA 3KZVA 4XIJA 1ZH8A 3U09A 3K73O 3OBBA 2BI7A 3UW3A 3WR5A 2ZYDA 3EHEA 1YB4A 1GAEO 2Q1TA 4NBVA 4BO5A 3U9LA 1O94A 4L73A 3WNQA 3CXRA 2I3GA 4D7AA 3U5TA 4GGPA 1V6AA 3C1OA 4FJ2A 4S1VA 1GU7A 1ONNA 5BQFA 4TZTA 1YS4A 1GV1A 5IJZA 3GZNA 1E3SA 4BIIA 2DVMA 1JDJA 5BNTA 2NLOA 1NHGA 3LT1A 5CFZA 1KYQA 5CDSA 4E5YA 1Y8RB 3COSA 1ENZA 2XXJA 3W4KA 4W9NA 2CVQA 3FNEA 2PTGA 5EESA 3WBBA 1GZ6A 3PQDA 1M67A 2O23A 4TKMA 3G1TA 2GZ2A 3GEDA 3JYQA 1H93A 4CM6A 5GZ3A 4YJGB 2NVUB 1ADFA 4J2OA 3SLKA 3GT0A 2CNBA 4MIYA 2HRZA 4I08A 2CD9A 4IXTA 4O1MA 3H65A 1JW9B 1TEHA 4F46A 3OQ6A 4PG6A 3O03A 4QO8A 1D1TA 4B3JA 2IXBA 2W90A 3ZV4A 3I52A 4X54A 4CM4A 3HE3A 4ZQFA 1U5AA 4QTZA 1KOLA 4ZU3A 2V7PA 1G0OA 2OBYA 3HDJA 5L95A 1B8VA 3L9WA 4RVUA 2DFVA 5M6DA 3BHMA 4M1QA 4UVIA 4E30A 4R51A 4HNGA 3NTRA 2VRBA 4YRDA 3I9KA 2EXXA 1GR0A 4FJ0A 3VOSA 1J4AA 4OYRA 2FWMX 3I3OA 1F8FA 2CMDA 3M1LA 2DBQA 4DPMA 1PJSA 3X2EA 3NAQA 3ZWXA 4R1NA 3BMQA 3VTZA 4EGFA 3MOGA 3ZWPA 3JQ9A 2DU8A 2PZMA 4RVHA 3QVTA 1PJQA 3TOZA 4FFOA 1T2FA 2G1UA 5F21A 3AUUA 4CL8A 1HYGA 3PRJA 4TROA 1OAAA 1P1IA 5JSFA 4OHUA 3IOYA 4FGSA 3GZNB 4I5GA 3BMOA 4CM9A 6ADHA 3CUKA 4LW8A 5FFFA 3ZI0A 2ZTVA 3ZWNA 1LLCA 3FN4A 1LUAA 4TWRA 5L9AA 2YW9A 5JYDA 2YHIA 5G0VA 3TN7A 4WLOA 4F45A 1T1RA 1H2BA 1Q0LA 1T2CA 1YO6A 2B0JA 4FC7A 4JBIA 1HDZA 4TVOA 3LK7A 2PD4A 1CWUA 3GDOA 4QT0A 4Q3CA 2GCGA 1K5HA 3WGYA 1DHTA 3D64A 3Q1LA 2RHCA 3EVNA 3W6UA 3ZWCA 3ST7A 4OIMA 4ALIA 2A4KA 4G5HA 3HWRA 2EWMA 4KTTE 4IQ8A 2ZKLA 3AU8A 2QQ5A 3WNVA 1GPJA 1BHSA 1R16A 3E82A 3E1KA 2Q45A 3PK0A 4BGUA 1BVRA 3GK3A 4D3SA 2B4RO 2DM6A 2YJZA 5TSDA 5JS6A 3GHYA 4XWYA 4FOOA 5F5LA 5KJCA 1DIAA 2C07A 4HP8A 1Y8RA 2NSDA 2X58A 4XRGA 1B15A 5JAMA 1N92A 3C7AA 4GX5A 1QV6A 3ZW8A 1HT0A 1C1DB 4NBWA 4ITUA 1BSVA 3RIHA 2IDZA 3FR8A 1GZ3A 2Q1SA 2W4QA 3IJPA 1TI7A 5A03A 4EI2A 3HQ4O 1QSGA 2WYWA 4PLPA 3WGZA 1FDUA 3GRPA 4RJTA 2AQIA 3HN2A 5HRUA 1KBZA 3AFNA 2B35A 3MZ0A 4FFLA 3VC7A 3DBLA 4E31A 2I9PA 2Q2WA 4NIMA 3RFVA 4XCVA 5JNLA 2PZKA 5EMHA 2ZYGA 4M54A 5ITWA 4IUYA 2HUNA 1Q0QA 1Y6JA 2ZK7A 3QJ5A 2PGLA 4G81A 3NGXA 4CUKA 2AG5A 1RM4A 3A4VA 5KVSA 1U2GA 3VHRA 1DC5A 1AHHA 1YL6A 2Y66A 1YQDA 3LVFO 4ZJUA 4J7UA 4YYZA 4L4RA 3KSDO 5T6BA 1DAOA 1EVIA 3ETDA 3JQGA 3JYOA 1YOVB 1UP6A 8ADHA 1U4OA 5TGDA 1YL5A 4ZRMA 4AFNA 4PLVA 5K6AA 2EJWA 2GN9A 4Y6SA 4Z9XA 3HJAA 1U7HA 1ML3A 2PR2A 5G0SA 2X0JA 4KDFA 1H2HA 2WSBA 1E1LA 5C37A 1IULA 4D3FA 4GI2A 1JVBA 5JDIC 4XA8A 1SB8A 4XJSA 3RASA 1KY4A 2E48A 3ZWWA 3TF5A 5ENDA 2HMSA 4NBRA 1UZMA 1ARZA 2VYVA 4DIBA 1LDNA 3AOGA 2IODA 1GADO 4UREA 4A7PA 2NTJA 3BA1A 4IJWA 4CMIA 5JBIA 1CDOA 5A5FA 3QQPA 2J6IA 4E0BA 4MVJM 4CQLB 3DOCA 1GDHA 4AJKA 1PGJA 4IIUA 4LGVA 3ROKA 5H81A 2V6GA 1EUCA 4E2WA 4LRSB 2X23A 2PZJA 3OECA 4R1TA 1X13A 4ALKA 2VRCA 4GSKA 3MJTA 4WCFB 5DF1A 1XKQA 1CYDA 4GWKA 4I1IA 4KZPA 3GN2A 4BKQA 4R5HA 1ZVMA 3AU9A 1SNYA 4O59O 1H9AA 2AQHA 5F5NA 3AWDA 5THKA 1JAXA 4LN1A 1Z75A 1BGVA 1E6WA 4ALJA 5JXWA 3WWZA 2J3JA 2W2KA 4XEHA 2OMEA 3RKUA 1NQ5A 3GA0A 2E6UX 3D5TA 4HADA 1Y1PA 1SB9A 2OGUA 4O0LA 4CLHA 4G65A 4YDRA 3FRJA 5AXCA 5FEUA 2UDPA 1ADBA 5CEEA 2WM3A 3WQSB 3U0BA 4D0SA 4AJLA 1P1JA 2GRAA 2LDXA 3GGPA 3IDSA 2X7HA 4IJUA 1UP4A 2A9FA 4PRKA 4N5MA 1DRWA 3PGXA 4A03A 4EW6A 4PGFA 3OMLA 4RQTA 1NQAO 4FN4A 3G0OA 3OJFA 3DZHA 1UDCA 3MJSA 3EMKA 4YT2A 3BMCA 4ZHSA 2Y0CA 4YRBA 5C7IO 3DEYX 4GX1A 4PLZA 4YJGA 3RCBA 4MDHA 3TSCA 1NWHA 4BNJA 4JJIA 1N9GB 5JAQA 1A4IA 1GEGA 4YAKA 5BSHA 3EZYA 5L51A 4AJ1A 2ET6A 3O8QB 5EQFA 3I6IA 3N74A 3NUGA 4BO4A 4RPKA 4PG7A 5K9ZA 4RGBA 5JO9A 3P2YA 1DPGA
chains in the Genus database with same CATH superfamily
4RDHA 4XRRA 3O73A 5AVVA 3ZY6A 1X80B 4UTZA 3IO3A 2HT6A 1KSJA 1OILA 4I4TF 3JD1A 4MICA 1R6TA 4HEQA 3KFVA 3SZGA 3WGIA 4DMKA 4N6NA 1L7XA 5KINB 4R6WA 2XUAA 2J5RA 2RGGA 4OMUA 2R87A 1Q6ZA 4XPIB 3EWAA 4CQMD 4LK3A 4V0SA 4C1BA 1VL8A 2IU6A 3CMCO 4R41A 1POXA 2DTEA 3DE6X 4DKXA 4HYYA 4C05A 1H9BA 3D0OA 1K6EA 4X41A 1RE0A 2B34A 5K3FA 2BY4A 5AXAA 1R00A 4A9AA 1ZR2A 4M0PA 3F96A 5DCWA 2ZYSA 1JG6A 3T0FA 4KOEC 3Q2KA 1T5IA 2D2FA 2GS9A 4IILA 4ZGWA 1FMLA 4H08A 4AP6A 4HZIA 3COVA 2P2SA 4CI0B 4W63A 4KC0A 1PI3A 4JP3A 1DBRA 1FFWA 1ESMA 1WDKA 5H0IA 4E51A 1EUDA 1S8OA 3HCEA 3THOA 3TXAA 5DPMA 3W5AA 2B4KA 2BUBA 2EFEB 4R1LA 2BM0A 2GXQA 1EJ2A 2HIGA 3WJAA 3O3NB 3J81k 1NBMA 2QX9A 4RNCA 1XGKA 3VPGA 1CFZA 1X87A 4WOPA 4R1SA 2V6FA 1MB0A 2VJMB 2X2EA 4NU0A 3EFOA 4X6UA 4RJJA 1C50A 1WXHA 3DMFA 5EIBC 4ARIA 2P41A 3UUGA 1CR0A 3AV0B 3ENVA 3WIEA 2HL6A 4JNCA 3PUHA 2NU9B 1CZNA 3NC0C 4YLYA 3QA9A 3WB2A 2V98A 4MVJP 1VLMA 2NGRA 3G2JA 3N2GB 5GZ6A 4GKJB 1MHPA 1EUZA 4DV6B 1K7CA 1MJFA 3RIYA 1FTWA 3EX7C 3RDPA 1KVQA 1X7WB 1O77A 1Q6YA 4O3MA 4Z1OA 3DTVB 4EYQA 3S2SA 2UUCB 5CGQB 3OOYA 1FW6A 2I7TA 3HBMA 5BP7A 2X15A 2GNOA 4KX5A 4C2UA 4GZ3A 4DSNA 2GCOB 5IJXA 4S2EA 5KCMA 2NPFA 3U3OA 4UNRA 4UFPA 1XL1A 3WLOA 3CW9A 4TRMA 4JN6B 2ECKA 2B83A 3DTVD 3V4PB 4M53A 3AZQA 4EEZA 3FUUA 3UK0A 1S8AA 2PUCA 1UZNA 2I1WA 1JXOA 1ATIA 2O1EA 1XTKA 1IQRA 3FFAA 4NG5A 1N33B 1NVKA 3QUTA 3VU9A 4M8LA 5HILA 1N5OX 2C2BA 2FQ1A 1CERA 2XMQA 4J4TA 1YRHA 2H1CA 5JCXA 3EXHA 5E6SB 3FD8A 1YCFA 2ZJ3A 3WGQA 3SSNA 4YT8A 3CVUA 1BX3A 4EEXA 4JC0A 5D5QA 1BDMA 2OCDA 2WJ6A 5EZSA 4BE7B 1Q7GA 3LF2A 5FPYA 1EIWA 1PZHA 5DYGA 3NCTA 2VF7A 2J85A 1MB4A 1ID1A 4KHPB 2F59A 4IOMA 1DC8A 1TD9A 3M6FA 3J81A 3M4JA 3OF2A 4ZVMA 1J25A 3WIDA 3W3ZB 3TD9A 5T73A 2AOVA 2HFJA 4Y7CA 1TJ4A 3H75A 3DZ7B 3UQZA 1ZM3A 4FVTA 2REQA 5JC1A 2JCXA 3BDAA 3KOOA 2Q07A 2WM9B 1X1EA 3PQ3A 2O1XA 4DJAA 2UUAB 2C29D 3MAJA 4OL0A 3THXA 2O52A 5CCBA 4CETA 2PH3A 3CF4A 3EBLA 1ECGA 3M3PA 3FPGA 1X1BA 5A5GA 1CNFA 1G21B 1Z68A 1Z2AA 5CB6A 5L3VA 1I7QB 1JENB 3L43A 2MTBA 3MTGA 3PHIA 4U3JA 1CUGA 2DFLA 1SWWA 2WM8A 2O50A 1EHCA 1SUAA 4B3TB 1JIKA 3ZLTA 2ZRCA 3DLTA 1QGDA 1QPBA 1LTHR 2ETXA 2XVMA 1YR8A 4QEZA 4F71A 1KTIA 4W5TA 2ZRAA 3EODA 3FTPA 1TUBA 3GNTA 4RF5A 4TMWA 5E2IA 1JL3A 3FNRA 4C29A 1D0IA 1QHXA 4TTRA 1C0PA 3OFND 1BCRA 1EEHA 2VO1A 3H2JA 3OPMA 4GZMA 2HPAA 3NJ4A 3Q2IA 5DK6A 1HQDA 1FZQA 4LOAA 5GP1A 5JATA 4GC9A 2ZW9A 2FEPA 1ZNYA 3BD7A 4JD5A 4MNTA 2C04A 5IBQA 3STTA 2L18A 1H1DA 1XD9A 3CR7A 1CEXA 4PYOA 3MBOA 4Q9LA 3HI6A 2BFDB 3MGKA 3PDCA 1JT9A 3TW6A 2H1RA 5C4GB 3KP1A 4OHBA 4XYBA 3WLFA 4DW8A 4L95C 1JQAA 2QPLA 2XOXA 1C8VB 3GF4A 2QT0A 4V38A 4W6ZA 5FAKA 2I0FA 2HCRA 3H8JA 3DDCA 4HWOA 5I5GA 3L4KA 1GA1A 1BFDA 2DQSA 2FZWA 3OJWA 3E70C 2ISSD 4J90A 4AWAA 4HDOB 2ZS9A 3C3EA 1Q7BA 1OH7A 1J0BA 4U7JA 1ESEA 1YFJA 2ZB7A 1U0RA 3AF1A 5BQPA 3U44B 3QE2A 2UYQA 3HCOA 4BNIA 2JFHA 3FTNA 1TE2A 4O2AF 4ZWNA 2CV1A 2IOHA 1NXQA 1NW4A 1S2OA 3T1YB 3GEBA 3MCUA 2WT4A 2RBEA 4CKBB 1JMYA 2QZ9A 1NW6A 1R8QA 3PTLA 1GPYA 3G88A 4U8GA 2FPWA 2W6IA 2ZBDA 5FOVA 3KLMX 1Y6QA 2RJ3A 1T3HA 4RZ3A 1XRJA 5K3FB 4CL2A 5ENVA 3TOCA 3HYLA 3I9FA 2OFPA 3U19A 3TTWA 3QOWA 3EB9A 4CLQA 4PC2A 4CLXA 1ZMXA 4JQOA 1TPZA 3WGVA 4RTNA 4N3AA 1VMEA 3L7KA 4E03A 2H65A 3HJGA 2F3PA 4ZVOA 1X1AA 2D59A 4ZGGA 2XTNA 1I3LA 1NW5A 1RLOA 2GZ3A 3ITKA 1YF3A 3HXOA 5FQNA 3DF9A 2AIRA 3E2IA 1OZFA 2XB4A 2XCOA 2GTIA 3LX8A 1DKPA 4M1MA 3NCHA 5DU2A 4YMLA 2IA5A 1ST2A 3E9DA 4EB3A 1JFTA 3FI9A 4NKRA 4X1YB 3TZKA 3RVBA 3OZCA 1QGOA 2WTNA 4QRDA 4E2XA 1E7RA 5E8RA 3NKVA 2MSLA 3GHHA 3FUTA 4B45A 2CLHB 2XMBA 3STWA 5K0EA 2W6NA 5ARCA 1SC3A 4OQLA 3REQB 4UEWA 2IQIA 3D6VA 5T3UA 1WCV1 3B8HA 3T7IA 3JZMA 4TYYA 2VBCA 4OXYA 1ILWA 3LUAA 5CNMA 1Z26A 3OIDA 2GBPA 4MGKR 2A3RA 3BE4A 3BL6A 3MCZA 3TTXA 2M1ZA 4EELA 2GYYA 4AUEA 2Y93A 4RGVA 1NKSA 2FOXA 4KJXA 3BREA 4Y6GB 2X7XA 4FN5A 1LS6A 1YBHA 2CZQA 3GN1A 3SMQA 2CKDA 5GV7A 1G59A 1TYZA 4JIMA 1YD7A 2OFXA 5KVCA 2ZYHA 1DT5A 1JYEA 1VHLA 1XLTA 1OCEA 3BWCA 1Q0RA 5AHKA 4E5MA 1H85A 3DVAB 1V8BA 2F17A 3L82B 5CFMA 1FVXA 1GKYA 3DDWA 4G0PA 4ZT7A 1O89A 1UWLA 1P77A 4HRAA 5ICGA 2HADA 4WFIA 1LDMA 2WICA 2Z5LA 4IIGA 3OZEA 2ZIZA 4FZRA 5DN6A 3KAQA 5G0SA 2ATVA 4YH1A 1JPVA 3RKRA 1SKBA 2CV0A 3PGJA 1N34B 4KVGA 3LYUA 2OV4A 3NAZA 3KB8A 2AL7A 1N5IA 2PUVA 4F6RB 1TKBA 4MV4A 5LBTA 2I76A 1CBUA 4YREA 1XDGA 3MQ2A 4UMEA 5CUQA 5LL6P 1ZVJA 1Q17A 4IMJB 4JGIA 5JLAA 5F9HA 2WU0A 4ZP1A 4PG4A 3TKAA 4AVYA 1W4ZA 1AKNA 1JHAA 1UADA 2BUCA 4JSTA 4QICA 4XIFA 3R4CA 4ZVSA 1JF8A 3UW1A 2R7AA 2AJTA 3FA2A 3HL0A 5JCJA 1V16B 2OUKA 2XUHA 1MNQA 1Y37A 1IG0A 1NMYA 3I92A 5KTTA 1B00A 4BZXA 3R7SA 9MHTA 2CMHA 2V9ZA 1MT0A 2EG5A 1NY5A 3U7JA 1HR0B 1G9SA 1WQ3A 4YQZA 3L8CA 1YRYE 4CKWA 2D5IA 3DONA 2NMVA 2HBQA 4UZFA 1XMOB 4HL6A 2IW3A 1RRFA 3ZCUA 3W5BA 1JAYA 2HCJB 2OL4A 3LQYA 3U7FB 1V5WA 2PZGA 2Z8YA 3EDYA 4FFBB 4QPZA 1WV1A 1BD3A 1SFRA 4JOSA 4UDXX 5BW4A 2C03A 3LYAA 1BZYA 4WBSA 3V3TA 1N2GA 1VL6A 3ED5A 4ZU1X 2RI6A 2UYYA 4OA5A 4OLJA 1TZBA 4DUGA 1PT5A 3PNMA 4UPDA 1QRRA 1GNSA 3G89A 2EZ9A 3O5AA 4H59A 6Q21A 2BCGY 5FWYA 4TMFA 4JXKA 4GYJA 2A6PA 2DR0A 2WKRA 3EQ6A 3K8OE 3LUJA 3PHJA 5EYPB 5KYUA 1ID8A 3EGEA 1LW6E 1D1SA 2RGNA 2DC1A 4ZAGA 4DMFA 2EP8A 1BHJA 3QFSA 3KXLA 2WP8J 1F0NA 3PUVA 4IIJF 4XWOA 1TJNA 4FLMA 4MUIA 1R5BA 4KVAA 4OK6A 4HRYA 4QBFA 4BX3A 1GLGA 1RRVA 4K9NA 4E14A 1N5KA 2XCTB 3R3HA 1OYOA 2R8YA 3C7KA 3IERA 1I2CA 2R00C 1L4HA 3NHBA 4MS3A 4CU2A 4MP6A 2BSQA 2X9GA 1QFYA 1RI4A 4RFVA 4YDSA 5JHGB 4NC9A 1Z2OX 4FEGA 1DARA 1MENA 4GLOA 4XH9B 2PVSA 3G13A 2OCKA 4MPDA 3IEVA 4DQVA 5M34A 1QOZA 2XKJE 5F7OA 1PEKE 1SXQA 3L7CA 4N6OA 2G8NA 3IUNA 4DIUA 4O5OA 4ILKA 3KQNA 3GGJA 2HA7A 4HBZA 4DVGA 1IOVA 1SY7A 3B6KA 4M86A 2OCAA 2H18A 3AFHA 1FJGB 3TZ6A 1E89A 3REFA 1JBQA 4HJXA 1E3WB 2E55A 4OHCA 3T1QA 4GVXA 1M1YA 1E3JA 2GR9A 2KMLA 1OYYA 1PS8A 2NXEA 2VP9A 3PITA 4A0GA 4V03A 3RVJA 3RW9A 5HZHA 1ULUA 1OTHA 2WTXA 1Z0UA 3O74A 4PIMA 1TTPB 3RFTA 4R01A 2D2IA 3W0LB 4E46A 1FRQA 1I5OA 1GRQA 3N8IA 4PPGA 4N5IX 5F12A 3WWPA 1IJBA 1XQWA 4LJKA 4ZA2A 3TJRA 1GL6A 2Z2JA 2YFQA 3B6ZA 4G4IA 4UOZA 2Q0HA 1OWLA 2J6BA 3HV2A 4K9PA 3GG2A 2QM0A 3UA3A 1F51E 1GHTA 4C7KA 2TYSB 1L4LA 3ANNA 3WQHA 1AC5A 3FHLA 1UMCA 3E4CA 2IIQA 2JBAB 1RJGA 1ZW6A 4Q7JB 3SJBA 1L4NA 3IPXA 3ZIDA 3FTFA 5JQGB 3DL2A 3HBFA 2C78A 1S96A 1YT5A 4R9RA 5JU6A 1V11A 5HVNA 2W48A 1O57A 4MS4A 3C3MA 1HYQA 4DZTA 2GZRA 4UBIA 3OICA 1M6WA 3OLZA 4M0EA 4ZTBA 1I30A 2HBZA 1XVIA 4K86A 3U4AA 3BE8A 5D86A 1A8UA 3V97A 4TKZA 2NNLD 2ZSFA 3O2NA 4J2TA 1X0VA 4F1KA 3C3DA 2GAFA 1J2UA 1JIUA 1A9SA 1N1MA 2IF2A 3G8CA 3HNOA 1P1HA 3PDUA 2BEWB 4G8JA 7ABPA 5JAPA 1Q16A 1H6CA 2EF1A 2YNMA 1IL0A 2NAPA 4Q0MA 5HKLA 2FPPB 2P2CA 5F4BA 4XASA 5HJEA 5LMCA 5AUNB 3FKSD 3I1FA 3AT1A 4CM3A 1T6ZA 1JMKC 3FPBA 2IXAA 1OH8A 1DAEA 3N2NA 3FPSA 4QLBA 1TKAA 2P27A 4FDAA 1LV7A 4LF7B 2ZDQA 4RVOA 4E32A 5H9WA 3PHLA 2I4MA 1XLUA 4QGHA 1C4XA 1KK0A 4S1NA 3UWDA 3WRVA 2NZ8A 1BS1A 4KVFA 2B1RA 2V5VA 1E7QA 2GAJA 4AMVA 1RZVA 1QV9A 1VHQA 1JDPA 4G1FA 4F6RA 1N3IA 1GZVA 3N53A 3ROTA 4AMUA 2FSFA 3KOWA 5AW1A 3RRJA 4UTPA 3O8RA 4HDRB 4XOIA 3KAPA 1J70A 2P5YA 5AR1A 2HU5A 2JGNA 2ZGVA 3LIIA 4FIZA 1UR5A 1X42A 2PWBA 4JDPA 1ADGA 1BC5A 2FJ0A 2PV7A 1FFAA 4MGHA 1PJAA 3CJRA 4DBLE 2FN7A 4M1TA 4OJYA 5AVQA 4L0QA 2XW6A 4G0ZA 1OX6A 4EDHA 3H16A 3EVAA 3GRUA 3KL2A 3O38A 3P97A 4MHSA 5A4DA 2BELA 3CN9A 4FFWA 3NVAA 4HNAA 1VGVA 1X7ZA 4OOFA 4CDGA 1OOEA 1E9SA 4HTFA 3WKDA 2ZVPX 3ZD6A 4HAYA 4Q15A 3VR3D 1T2EA 3JVEA 4BMXA 2ISQA 2IU4A 2IE0A 2RHBA 3H99A 3SQOA 1V16A 1Y98A 4JFRA 1KVUA 2BEUA 2JDIA 2R2GA 4OSOA 5I7FA 3T1OA 5A05A 2UYCA 3LZCA 5DX1A 1X80A 1EXVA 1D1PA 1N9ZA 4K2HA 5MN5A 4N65A 3DXFA 4GWLA 4KMOA 5J9FA 1RHUA 2OOSA 1YULA 1FVOA 1VKHA 1Z2DA 3FDIA 1YRAA 3OTIA 3FE2A 2JIZD 2VP0A 2WWRA 3HFGA 3LUHA 2VUSA 3DCNA 1ZCFA 2VA8A 3EWIA 3NONA 4L5JA 2B2CA 3OQ1A 4PBRA 2O2JA 1P91A 2PBFA 2Z4TA 1Q3TA 1XMQB 2QJRA 1PWHA 1XTZA 2A5FA 3KB6A 2YY6A 1QIIA 2OILA 1PVVA 3K2BA 3NTQA 4IMRA 3VKVA 4DIEA 3OLCX 2A35A 4GBGA 3QKTA 3B48A 4C6HA 1E8NA 1E32A 1EVQA 1ZWKA 2B6HA 2HDHA 5EIBD 5BWNA 2Y05A 3S27A 3PXCX 2H3EA 1XD2A 3GXBA 3R5SA 1QHNA 1OZ0A 1VDZA 3D6FA 3LSYA 4YJHB 4IAOA 1IN4A 2X9NA 3W3AA 5A9SB 3EZNA 1Z4OA 4Y2TA 3OJXA 3DJFA 3ACCA 4LY0A 5DULA 5EY5B 4E22A 3IP9A 5LQAA 1DBVO 4YXWD 2PS0A 1EM6A 4LSZA 4JIGA 2KYRA 4MUAA 4LC9A 4EMUA 1YDWA 1RXCA 4RXMA 4UEJA 3DTYA 3O4FA 1AQNA 1ESDA 3NJ8A 3OFJA 4NBLA 1M2NA 5HHTA 1ZU5A 2XVAA 3HJRA 3T1NA 4J0EA 3LD9A 1SUCA 3VZBA 4ZMBA 1F2DA 2JIPA 3QW2A 2YIJA 1XQ6A 4CE6A 5JNUA 5JXIA 3TRHA 3Q7QA 1NSTA 2A5GA 4RIIA 5HKKA 2GD6A 3CG0A 3KR2A 2Q5LA 3OCWA 4PZCA 2Q7OE 3UKOA 1JEJA 3D54D 5EIAA 4X5OA 4PQEA 1SBIA 1QVWA 3GA5A 4QRHA 1ZHFA 4ENWA 2ENWA 4RZXA 4AF8A 4Z2AA 3VJRA 4BKUA 1YRBA 5JNSA 3N5KA 4B2LA 2VG8A 1CETA 4DG8A 3L1UA 2Y99A 1AMNA 5BN4A 1SUEA 2BGIA 1NP7A 2XWSA 3MT0A 2OG1A 4AMZA 1S0UA 3U7HB 1PT7A 4Q9IA 1IHUA 4GHWA 1NUUA 2G9UA 4AO6A 5JQGA 5EKTA 1A4UA 1MXHA 2QZPA 2L42A 1GYQA 3AJ8A 5DBEX 4TT3A 1JHRA 4PGMA 2FWIA 3VDMA 3LHDA 2HXYA 3IHLA 4WOJA 4HXYA 1NLMA 1AK1A 2ODTX 1RI5A 1KJNA 1OLXB 3JU3A 4NHEA 3PXUA 4QDTA 3VPFA 1HDCA 2J3MA 3M9XA 4HDNA 2I4IA 5L45A 1L4GA 2JEZA 3TS1A 4QSHA 2DUNA 4HKTA 3IWCB 2CN1A 4LDZA 2AOTB 4EFMA 7AT1A 5ER9A 4KGXA 3GEEA 3A25A 5DZSA 1DEOA 1FJ2A 2WJAA 4HWKA 4FR0A 4NBUA 4YPVA 3H8VA 1YSCA 1XEXA 3I01A 5JG7A 5A0FA 4YCCA 1G8HA 3T0GA 2WE7A 3D3QA 3ZGXA 2FFBA 3ZTTA 3GX1A 2W22A 5K0BA 1W2WB 4OATA 1T2DA 3L77A 1IPFA 4PIPA 2CF5A 3P71T 4OJMX 4R68A 3SYKA 2CSXA 4TS3A 4KIUA 4JYAB 4EGQA 5CA1B 1V9CA 4R81A 3F5QA 4YMUA 4YXWA 2OO7A 4MVXA 1X8JA 5A0VA 1ML4A 1XOIA 3CB2A 4KODA 4Z0PA 2R6JA 2WYUA 2VTBA 2H5EA 1Y7TA 3CEMA 1B6TA 1HORA 3LWNA 4JUDX 2Q0SA 1W9HA 4UNPA 1G18A 1KZ7B 2VWHA 1WVIA 3IB6A 4RK7A 3SZUA 5I9NA 1JPJA 4A82A 5KSWB 4LSMA 3ID6C 1O4VA 5HKKD 1I2DA 1RHKA 2DQZA 2CHQA 2OZLB 3B1WA 5B3JA 3K96A 5TT1A 4KRFA 1PX2A 4H77A 1BD4A 4DQXA 2PLAA 3JASB 1QAOA 5EMKA 4NFHA 4PXYA 3FHCB 3LOPA 4EFNA 1R4NA 4B6QA 2YR0A 4DG9A 2WFZA 2Z83A 2C7GA 2IHKA 1CR1A 4L4YA 1OZAA 1IHOA 1QF6A 4AURA 1J20A 1YZUA 3VMMA 1A0OA 1H94A 4BP9A 3FWPA 1KXZA 1J7JA 3PQFA 5DGHA 3AERA 3WFJA 1I14A 4ID3A 3RADC 3GCXA 3PT9A 2DHCA 4HGRA 2QN9A 1E1DA 3USES 1DC4A 1DFIA 1L0BA 4DILA 1JHDA 3SQWA 5JYEA 3GLGB 3T4EA 5ES4B 1DIBA 2AEJA 2WR8A 4EF5A 2V1UA 1B0PA 1XN4A 2XUPA 1YQGA 2OAGA 4GP7A 2YJ4A 2RHOA 1QYWA 1V1MA 1R9GA 1XQXA 2GYVA 2RH5A 5EZQA 3CEPB 4QGFA 1SQ5A 2VH1A 3F71A 4IRMA 3TNDA 4X8LA 3QHQA 1TM4E 1TU0A 4RGYA 2EJUA 2LXNA 3AMVA 5JCZA 1HNZB 2ZTSA 5JAUA 5JSZA 1KI6B 1XKXA 2GK3A 3OE1A 3M6VA 4WJLA 5KBYA 1Z13A 2XT0A 2TS1A 4J2HA 1BQEA 1SRQA 4NS4A 1Z0DA 1V6CA 1QQ5A 4HFRA 4YJ2F 4MPJA 1SHUX 2H1LA 1D6JA 3AW8A 1A5ZA 1JHMA 1QYDA 1DJMA 1YHZA 2C5LA 3PFGA 4K8OA 3BOSA 3C4VA 3HBLA 3AM5A 4LWZA 2C2WA 3BQNB 3MLBA 1L4YA 3Q7IA 2GA9A 2PSHA 2FZVA 4E5DA 5DNUA 2WP0A 2X7JA 4Y8VA 4XD7A 5BSVA 3NB0A 1J33A 1U2TA 4UMVA 4TLAA 1CQPA 4JAVC 2UVQA 9GPBA 4IHQA 2JLSA 1Q1NA 4I0WB 1GUBA 3A1FA 4LOIA 1C8LA 1ZN7A 1M2VB 4MWEA 4AIIA 3IDOA 1PFKA 1HT3A 3EXIA 4CNQA 3QOXA 2GFIA 1GTMA 3O94A 4ENQA 3HFRA 1XQVA 3I9V6 3MT9A 4JEUA 4O25A 4BEVA 4ZO9A 3LS2A 1GL9B 5INTA 3R8CA 3NGMA 5D8DA 5DASA 4DLBA 4YCNA 3L46A 1NQXA 4OG2A 2Q4BA 1C3LA 2FVXA 1W6UA 2CNWD 2YMLA 2JIRA 1V9SA 3IBCA 4GI3A 4QBIA 1OIVA 3RC8A 1R4NB 1X77A 3DOEA 3C14C 1Z18A 4XGIA 1EM8B 1FLNA 3C5EA 3S8EA 4BQPA 2Q6OA 2QSZA 4KTVE 1BE0A 4G5GA 1MF7A 4LDRA 1BOFA 1C9DB 1HSOA 1ZJJA 1PZFA 2IYLD 1PNOA 1TAQA 1I01A 1S3IA 1X3SA 2GK4A 3BFVA 3H1GA 4HZUB 3WK6A 2WKQA 2P0YA 4GX0A 5CIQA 4B8ZA 3C16C 1LVUA 2VDKB 4M8IA 4EUNA 2A94A 2VDWA 4ZVLA 2JH8A 4BVLA 4OYYA 4FS8A 4QARA 4A0FA 4RTOA 2E4UA 5HZGA 1KC3A 1BS9A 2H51A 2OHIA 2WJVA 2XZDA 1O5TA 1IK6A 3FPKA 4L3VA 4OPMA 1PD1A 1AJEA 1C0IA 1ZH6A 2GAOA 3KUUA 2VYND 2P6MA 4ODIA 1W76A 3F4LA 1JFFB 2R751 4KQWA 5KB3A 1KJZA 4RORA 3ZHZA 3CMMA 1U6JA 3GRVA 1L6IA 3LO8A 4LCBA 3RUCA 3VC3A 2QGNA 1RHJA 4JJFA 3HB5X 2FYTA 1ZVVA 2RH9B 3QIAA 4GYYA 1FNCA 3G02A 4RTMA 1XJ0A 3MUFA 2VJDA 2CEKA 5DN6D 1BMDA 1YNSA 4GBED 1NRXA 3BHIA 3DV0B 3RUFA 3IQGX 2PKEA 2QNIA 3N0RA 3TQQA 5EIEA 4XTCS 2X0RA 4GNRA 1WDLA 2F3QA 2HIAA 5KPDA 4G84A 2AZ4A 1MAAA 3F97A 4YJ2B 3W34A 3U44A 5ESDA 3WMXA 4ER7A 5M29A 3PDJA 3AESB 3T3OA 2WB4A 3EK2A 2FAXA 2OQIA 2VZ9A 4URHA 2HSDA 4E2FA 1AE1A 4FWBA 1DX6A 2J5XA 3QX3A 1ZZEA 1OR8A 2O8FA 2QXYA 4DRXB 3VKGA 2QJWA 3PX2A 1A2QA 4U5QA 3GD5A 5BYBA 1OPRA 2RAUA 3M5DA 4MROA 3TTTA 1RRCA 1NV9A 1IY1A 1JSLA 5E6RA 3IMKA 3W5IA 4WSOA 2GA8A 2Q21A 3CNQS 4N03A 2HI0A 2IGTA 4RSRA 3DAFA 4QX6A 3O4RA 3QU9A 5AI6A 1F8YA 2YVUA 5JXJA 3SFZA 3S5UA 2CFIA 4L74A 3SBXA 4F5WA 1JP7A 3E18A 2BFWA 4G5OA 1NW7A 2J0VA 2AZDA 3I1JA 3K1AA 4ARUA 5EXSA 3ZVMA 2D2XA 1U0HC 3LU1A 4DLLA 1ZOSA 5A7GA 2BL4A 3RE1A 1VKZA 2DQ4A 2I6TA 1HX7A 1FUKA 4DA0A 1Z4MA 2B3TA 2XOKD 4UEQA 4MCHA 4DUGD 3PI7A 3E5MA 4WDQA 2YIMA 3RAFC 1HYHA 1ZL2A 4G6ZA 2UV8A 1EX1A 2YYYA 4GC5A 4HAZA 3HJFA 4OAQA 1IB0A 2PJUA 2P69A 5DDIP 3KQSA 1H05A 3O75A 4UDYX 3S2IA 1ZNQO 4RIHA 1RYMA 2IUTA 5FLKA 5HE9A 2AJLI 4QKQA 3DZFA 1BE6A 2V8BA 4TRNA 2VHYA 3M82A 3QKUA 1FS4A 1AV7A 5K8VA 4LZNA 2GM9A 4CF6A 3BRCA 3ZDAA 5KUTA 5T8KA 3KVVA 5AI9A 4RULA 5FJJA 3BCUA 3WLAA 2D0IA 3DEAA 3QQ5A 1DHRA 3ASZA 4B80A 2V5UA 5JHHB 1IY8A 2AN4A 2G88A 1QO9A 4HXFB 1C1XB 4LBVA 3KJGA 1IZ0A 4EYKA 3AL3A 4JI8B 2FMHA 1TXGA 1OFTA 1OX4B 1UBOS 4LXUA 4R2JA 5SV2A 4II3A 3T54A 1VE1A 1X2BA 1Z07A 2Y1KA 1FFYA 4KOAA 3DZKA 3PZRA 2B99A 2QJTA 3WGOA 2EWVA 5REQA 4LXQA 2HWWA 3IQDB 4NJMB 4ZEWA 5A71A 5C53B 3KUDA 4JV5B 1Z88A 2DUUA 1B14A 3G8BA 1XFAA 4BLUA 5I4CA 3MMSA 4OO3A 5J58A 4UM9B 3MS2A 5A4FS 3RFFA 4HZGA 2IV7A 4X44A 1BE1A 1GTJ1 3L2OB 4U0KA 1ZSYA 2HA0A 2EJTA 4F5YA 4YJ3B 4IDBA 1HGXA 3PD7A 1CQXA 5JWHA 1WULS 3NI2A 4WA7A 1AQJA 4EY3A 2WUGA 3SIRA 1LKZA 2XB9A 3MC1A 3TLGB 5H9VA 2BTQB 1PZEA 1M2OB 3TINA 1Z45A 1QHHA 4BOYA 3ETNA 4GQIA 4BO8A 2FP4A 3BBPA 1RZUA 4H0NA 4J94A 1UPBA 4QUBA 4NBKA 1WW2A 3LECA 3O3MB 2FUEA 2ZWIA 1OYWA 4CKZA 2GRJA 1KYYA 3L6DA 2PPVA 1GCIA 3AEQA 4BDTA 5D3MA 5B1YA 2J9XB 2FQWA 1JLSA 1I2ZA 2FE1A 1UCFA 2HHAA 1FPMA 4QFDA 4X00A 1KI2A 1W5BA 2NO5A 3ACBA 4F4IA 5JDCA 1P72A 2Q46A 3FFBA 4W8GA 4BLSA 2H57A 3Q3IA 1E2UA 3T3HA 3LA6A 5A3SA 2VJMA 3RKSA 2ZAMA 5CG1A 4DB2A 4FHGA 5LZ8A 4TLEA 5ECWA 3Q7TA 4HLUA 3KR1A 4HGOA 2QRNA 5E0OA 4UUOA 3KR0A 2GYWA 2J3QA 1DEHA 4QPJC 4QUKA 3A04A 1IPEA 1VM6A 2WIKA 4UUNA 5E95A 3RK0A 5LIPA 3IL2A 1WU8A 2WFLA 3E5NA 4P3YA 3E8XA 1T0PA 5GIPE 1FNNA 3HUTA 3PLAE 1F0YA 3VHLB 3CVVA 1KH2A 1ZOLA 2ZZNA 3ZZ1A 3E5HA 3RJ9A 4LRTB 2X5OA 3SBOA 4DNFA 1SVLA 4MIEA 4MIKA 2GHTA 3JYPA 3LUGA 4DC0A 3EPLA 2JVKA 3I9OA 3NKLA 2WDZA 4ZJZA 2I99A 3CLTC 1AK2A 4ZO7A 1XPJA 3TVYA 3IUYA 3SYTA 2GVZC 2PV0A 1FDRA 1W4RA 4R0NA 5KTPA 3MG9A 3NHJA 2IITA 4HJRA 4KLRA 3V46A 1MOSA 2HF8A 1PFVA 3PE4A 4NK4A 1OGIA 2GYUA 2CLMB 2I6UA 1C3OB 2OC4A 2ZUUA 1HDOA 4WE3A 1KMHA 2FK8A 2JLAA 4B3MB 3GMDA 4BWGA 2DX7A 1YKGA 4RESA 3RTCA 3JRXA 1FLVA 1TUEA 2LD4A 3L7MA 4MPRA 1PQPA 2EFDB 3ODGA 2YV4A 2XUDA 1RWKA 2F90A 2GCNA 4MK4A 5DV9A 3SJZA 4ETIA 2SNIE 3ENNA 1YNOA 4NESA 4GSYA 1VMAA 2EQ5A 4Z9BA 4XJVA 2P3SA 1N3BA 3FLBA 1Z3CA 2QX8A 1R3UA 1QNLA 2PX8A 3RT7A 4BV8A 1AMOA 3R9KA 5M7EA 4MUGA 1RCFA 1U2SA 4N40A 2R6R1 2EKZA 4GOND 4LNAA 2YJ3A 4C4ZA 3K70B 3AETB 4ZANA 2KI5A 2AMFA 1TU4A 4M99A 2Z30A 3K6RA 5AK3A 2F4VB 1QYIA 1AA9A 3RVOA 4NBTA 4WADA 3GNSA 1JKJA 1L1FA 4HD8A 5E3IA 1CHDA 4Q1AA 1A50B 1PFUA 3SC2B 3A4MA 3HADA 1KEVA 2R84A 4H7EA 4RCZA 4ZYWA 2W9XA 5EAIA 2R6HA 3WHLA 4WNIA 4DLNA 2YHUA 3E9MA 2QAJA 3PPIA 4ZAZA 4DDKA 5KKAA 2JIZA 3HMKA 4LQ4A 5JY1A 3OCUA 3DWFA 2PT9A 5B30A 4MDEA 1KI3A 1EA7A 1RAGA 1SXGA 3PTAA 3RRNA 3V1NA 1XTTA 1DXHA 1W5TA 1NNEA 4IIYA 5LMUB 1EXWA 3KKQA 4NQRA 4D9FA 1G3IA 1JV2B 2EU8A 5DX8A 3OZUA 4ZYVA 1M33A 4XSVA 3ELWA 4QBTA 4P3NA 3SJUA 4GXTA 2NXCA 4HEA6 3F5SA 3E9YA 2QWXA 4UVHA 4BWVA 4EVQA 1UBGA 2C3MA 2XMGA 1MEOA 2ZBRA 4EHLA 1JBEA 1CEYA 3IAXA 2QUAA 4ZDIA 2PJDA 4YBZA 5L3QA 4FYKA 5K6TA 2B4TO 3E48A 3OJEA 5KOIA 1KGDA 3GPDG 1W6RA 3MT8A 4TMTA 3KT8A 1TO1E 4KNVA 2YBEA 4RPLA 3VFDA 1DJQA 4F4JA 3S1LA 2OV3A 1MC8A 1GZ4A 4MUYA 1TD1A 2P90A 1JEQA 7MHTA 2JZCA 4G09A 1L5SA 1V3UA 4ND4A 2BCJQ 4MJLA 3DKPA 4QG3A 4K40A 4FE7A 4B3RB 1C9JA 1UEJA 4FNMA 4ARSA 3KKZA 3PC2A 3WKCA 4FFVA 3CH4B 2YFKA 2Q2OA 4LHXA 3R75A 3AUXA 3PGLA 4G07A 1LK0A 1ZKDA 3GJSA 4EJFA 3WI7A 4UKDA 3QPAA 3R5KA 4Y67A 3VZRA 1TNDA 2W6QA 5BSUA 3ZR4B 1UC8A 3NRJA 1ZRHA 3DLCA 4HQFA 4NNJA 4A5SA 4WASA 5JJLA 2XEDA 3UQYS 2Z2YA 1OXXK 1XC7A 3HB0A 4KMMA 4PCVA 1GFZA 1UC9A 1M8JA 4GL4A 4WCDA 1A9RA 4Q9JA 1Y5NA 3TM4A 2H0QA 1FMCA 4RTSA 4NDZA 1T4CB 4J07A 4FFNA 1R5NA 2OO5A 5LZ7A 2FOLA 3TZHA 2R4UA 4XM0A 4EJMA 4CODB 3MOSA 2IEYA 1SQ6A 2FG7C 3OEEA 4QBKA 1VJ0A 4YRJA 3R9XA 4MLZA 3VJKA 1TK9A 2QRLA 1PR4A 1FQOA 3AXTA 1LI7A 3LWZA 3VR0A 3WGTA 2K5UA 4Y9RA 2QZSA 2IBTA 4D9NA 3LSTA 1P4RA 3T8YA 3KXKA 1XEXB 4FDVA 5A1JA 3LP5A 3QELB 3TRIA 2ORWA 4NCIA 4JCCA 4DN6A 2EWWA 3V55A 4X1YA 3E22A 4CLDA 2V3CC 1IXSB 1IZ8A 1BYUA 5AYVA 2BFEA 3TGPA 5GVSA 1CP3A 4U2GA 1KU6A 2NZXA 1A96A 5DT2A 1JAHA 5T4BA 4M8SA 4DRZA 2AX3A 4O8ZA 4U2BA 4RTLA 1NJ5A 3AVPA 4YO7A 1NAHA 2B6NA 1SXHA 3MWEA 1L5FA 3C97A 3ZDDA 1RKQA 4II7A 3SVTA 3R6LA 2Q3CA 1KEUA 1XZMA 3FNGA 1LBSA 4Y0VA 3RK1A 5LYJF 5EXDA 4G0YA 1KPHA 1KVTA 2C4KA 2E1PA 2EDCA 1GQFA 5I5EA 2PRKA 3LXRA 1QKIA 2AKAB 2CZGA 4L4XA 2WHQA 3P1JA 3RUIA 4ZODA 2HRCA 1KBQA 4YI3A 3EGOA 2PKRA 3AH8A 2GK6A 2I65A 1GPMA 4J0QA 5ESXA 4JC8A 5AKGA 1WZNA 3U7IA 1FF9A 2X2FA 4PQGA 5FNVA 4MRMA 4D56A 1T24A 1EZ4A 2WJHA 4UU8A 2IIBA 4XWGA 4M4SA 3UCEA 4EHJA 4DDMA 5KNDD 1QJ4A 5D00A 1BE8A 3OJOA 5AHOA 3LWBA 4EMBA 2PL3A 2O3SA 4B6SA 4ROSA 5IM5A 1I7NA 1Q50A 3ZVRA 3F6SA 1OREA 3PUXA 4KQGA 5BW8A 3G79A 1K8YB 3D6NB 3HO8A 1DXQA 5HKAA 4JFAA 1JKXA 4FC6A 1XJQA 1QZZA 2QTZA 3BWYA 5JWOA 2YXLA 4R9SA 4MW6A 3S2FA 3U4IA 3ANMA 5JE8A 1RM0A 2X76A 4AKSA 2QG6A 1WBJB 2AFIE 1JE0A 6ABPA 5IN5A 3VJMA 1NVBA 1PT6A 5GONF 2IYPA 4AG6A 4EHKA 1CY1A 4RZIA 1LSSA 3OCJA 1FYDA 4QYIA 4NR0A 4CLRA 2FPNA 4YWJA 1SG6A 5AJXA 1CP2A 3NV9A 4J1SA 5ED0A 3CH7A 4IIVA 3JQ8A 3ND6A 1ZK0A 1XRSB 4HNSA 4WLFA 4DRYA 1PGQA 2O3TA 4BAUA 2MOKA 4L9WA 1KHTA 2V74B 2RCYA 3G23A 1D3AA 1SVMA 1BJTA 1Y4SA 1GU0A 4ZCQA 1GGHA 1CRWG 3LP6A 1OB2A 1ZD5A 3NEYA 1CTQA 3EWNA 5YASA 1UC5B 4EBBA 5IT0A 4XB1A 2IYTA 3R3VA 4REQA 2XZLA 3M0EA 1USWA 3HFSA 2VHJA 2KBFA 3JQEA 2R68A 3R5HA 4FFBA 1U28A 4JOCA 3F3YA 3HU1A 3AL2A 3ZXIA 2HCBA 4C0XA 2VN8A 1TQDA 2QJFA 3QOYA 4E09A 2WVAA 3E7WA 3AOEA 4CMHA 1M2WA 1E1QD 4BU1A 1C30B 5CX1A 4YMGA 2VNKA 1ZU4A 2YHSA 2ZROA 1G20E 2LWIA 1HYBA 2WE8A 1TLFA 2IU0A 3LV8A 3ETEA 3PFWO 1WHTB 2ERCA 4OU5A 3W1EA 3AVOA 3DUFA 5AK0A 1IDN1 2AXEA 2K7ZA 4HR7A 1ETHA 1DOZA 1TEVA 2ZRNA 3FYUB 3UUEA 4MDYA 2ZR0A 5ALDA 1M6VB 1VKRA 3KZ1E 5J5VA 2PLNA 4CG0A 1M66A 1NYLA 2QXUA 4WKPA 5H3CA 3WLQA 1CRQA 2BIFA 3H2KA 1A9XA 2JLCA 1ZM7A 3FROA 3K31A 3O1LA 4M9RA 1GGFA 1TCUA 3NIWA 1I94B 4QAQA 1NX9A 3CZQA 4RM3A 3Q8LA 2ZU6A 1QBKC 2PQMA 2JH9A 2V9CA 3P9ZA 1RAHA 3VKWA 2FETA 2YYAA 1DG3A 1FU4A 4M3NA 5DFAA 3UN1A 3R7DA 4CI9A 4F8JA 1U1FA 4HNVA 5HS6A 1PDWA 5CM8B 3TW3A 4EY4A 2C58A 3EY4A 4JP5A 4NYMR 1RWVA 3MJVA 2JNWA 1WB5A 1PK9A 3E35A 2Y2VA 3GIWA 4B6GA 3LPNA 2OCYC 1AIPA 1YDMA 2JBWA 3AQ4A 1FQWA 3EAGA 4IH9A 5KAPA 1VHTA 1FYEA 3TUJC 1YJ5A 3HI4A 1G9TA 3QPUA 2A9VA 2FZEA 3F6YA 3FPJA 4IMPA 4JLAA 1L5LA 1Y4AE 2PSDA 1A9QA 1LJ8A 3H5AA 3R24A 3BL5A 4BP8A 4UTNA 1EFRA 1RXWA 3HXMA 1TVMA 1C29B 2ZSJA 5HMLA 2IZ1A 1TVKB 1WXGA 3R4VA 4US0R 1Z62A 3TQTA 1EP2B 4CIVA 4W5OA 5IP5A 1M8FA 1FJHA 1FYFA 2EHDA 1XG5A 1Y9AA 1XQ9A 4J29A 4ZAWA 3ZV7A 1C9YA 1NVXQ 4P8RA 2E9SA 3T7AA 4GKKB 3OZDA 1Y5MA