1PQPA

Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
357
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNSTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
total genus 118
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pqpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pqpA01
3LC2O 1M76A 4I1IA 4B8ZA 2VOJA 4U0KA 1QXSA 1A4IA 4J1NA 1KVUA 2NADA 5IXSA 3ICPA 2EWMA 3PXXA 3ZHBA 2Q46A 1ZNQO 1XR3A 2DTEA 1DHRA 1LDBA 1WVGA 4RCVA 4XYGA 4FCCA 2ZTMA 4RDIA 1EDZA 4OSOA 1I32A 1SOVA 4RLHA 3QJ5A 2PKRA 3WYBA 3AFMA 3H7AA 4MP6A 2J5RA 5LCXA 3INGA 1ISFA 4W9NA 3JQAB 4NU6A 3QRWA 2W2LD 5JS6A 1T24A 4DLBA 4PZDA 5I8ZA 4FB5A 2QZZA 3MEQA 1U9JA 2CDAA 2J5KA 2EKQA 4TRMA 3ZV5A 4KQXA 5IDYA 4ND3A 1JWBB 4CQLA 4FFOA 1U5AA 1PJ3A 3DTTA 4TVOA 4YB8A 4AJNA 3ANMA 4B4UA 1N1EA 2Y1OA 1NHGA 1R16A 1ID1A 5CP8A 4WECA 4IDAA 3GGOA 4Q39A 3FR7A 4KDEA 4TMFA 1K6IA 5KTKA 1H6BA 1E1NA 4EI2A 1I3KA 3TOZA 3QVXA 2UVDA 5JAQA 3DOCA 4N18A 1KOLA 1UZNA 1VL6A 3LSYA 4KUHA 1C0PA 1Q0HA 2PH3A 3MJCA 4PLCA 1B2LA 3JTMA 1LJ8A 1NTOA 3D1LA 4MPDA 1U3TA 4XR4A 1VI2A 1B8UA 5GZ1A 2WSBA 3OBBA 1JDJA 3DAGA 1XIVA 1G1AA 4IY1A 2V7PA 1LSSA 4ALNA 3JQ7B 1K0UA 2YYYA 1PIWA 3GPIA 3RBXA 3GVXA 1VL8A 1Y81A 2X6TA 3I9JA 4X54A 1ISMA 2CDBA 5H82A 5I7SA 1TA4A 1LRJA 3PK0A 3UH1A 4CR8A 1T26A 3ADPA 2YFHA 1CIVA 2P9CA 4BV9A 1KY5A 4PN3A 4FS3A 3JYQA 5LDHA 4O1MA 2X9GA 5L53A 3RUCA 3GFGA 2Q1SA 4QSMA 5CPFA 2TMGA 4GAEA 5AVOA 2H5LA 3QA9A 3R3JA 1E0DA 3FI9A 4RPHA 3IKTA 4XB2A 2V6GA 4IQGA 2I66A 1P0CA 2Z1MA 3TZ6A 3GUYA 1HETA 4EUFA 3FR8A 4CPDA 5CHEA 3PWKA 2X8LA 3O4RA 2NVWA 4G5HA 3OA0A 3ZNQA 2VUUA 4L4SA 5T67A 2OFPA 3JQ8A 4K26A 5EIOA 4E12A 3HZZA 3GDFA 4E31A 4K1LA 4MKXA 2POQX 2YV1A 4HNHA 4ZRMA 1P74A 1G0OA 3R3SA 1PJ2A 2PA3A 3FBTA 2ZYGA 3H8VA 4WOKA 3IQDB 3ZWOA 4B7XA 3PPIA 3TJRA 2HJSA 3WJAA 1KYQA 3PHJA 4JXKA 3AY3A 1M6HA 4DPKA 1N9GB 4D45A 1UH5A 4B79A 2Y1EA 4PZCA 4GX5A 2DM6A 2RHRA 5KJEA 4NFYA 1YL6A 2C0CA 2EG9A 4GQAA 4PG5A 2FN7A 4CMEA 4FC6A 4F6CA 1LU9A 1H93A 1BGVA 3GA0A 3QWBA 4AJHA 5CG2A 1ZEMA 3PQDA 2WE7A 2WYUA 4XEHA 1HDZA 3K9QO 4JN6B 4UUNA 2HMWA 2PLAA 3GNSA 4MDHA 3ZHYA 3DQPA 2IZ1A 2AE1A 3A9WA 1E7WA 2Z1NA 3WIDA 2OP1A 3W8EA 4OM8A 3PHIA 2AHRA 2E48A 4BO1A 3Q2KA 2WD7B 2JAPA 4L73A 3QVWA 3JYOA 1O8CA 5IFLA 2HAEA 3I9OA 5KVCA 2O50A 3GDOA 2AXQA 1XDWA 3FTNA 3U62A 4MKZA 3JQGA 4BKPA 4YRAA 2Y1CA 3FD8A 1I30A 2IZ0A 2QHXA 1UXIA 1B26A 4TVBA 2HU2A 2ZJ0A 4NBWA 3ZV6A 2Q2WA 1O94A 4P8RA 1N7HA 1EEHA 3AY7A 3RBZA 4IJWA 3VPHA 4PLVA 4D42A 1ONNA 1R37A 4DBVO 1GL3A 3SJ7A 4MIEA 3LU1A 4FDAA 4TQGA 3ENKA 3PJGA 4FGWA 3QVOA 5JDIC 1U8FO 3JQ9C 1I3MA 4CUZA 3QWFA 2CMDA 1PR3A 1XSEA 4NJMA 1GYQA 1EVIA 3PI7A 4BNXA 5GZ6A 4U7WA 1DRUA 5CPBA 4BKRA 3LLSA 1YXMA 3FWNA 3ZW8A 4BNWA 2W4QA 4NPCA 4F3YA 4YJGB 3WGIA 4RDHA 2D59A 4YT8A 5GY7A 4YVFA 4XIYA 3WFJA 1R4MB 4AFNA 4R69A 4EDFA 1YQXA 2O48X 3ONEA 3Q2IA 3KUXA 2Q45A 1JWAB 1AE1A 3MJTA 3EGOA 1GAEO 3Q3CA 4JIGA 5IDXA 3WXBA 4CQMA 5DULA 3F5SA 1XQ6A 1HRDA 5KNLA 3VZSA 1J4AA 1V0JA 3P7MA 5DOVA 3WGQA 1U3UA 2Y93A 3RC9A 2OP0A 4XX0A 3KYDA 2QIOA 2AG5A 1BW9B 4HADA 1ZIDA 3RROA 3GY0A 2E37A 2B4QA 4QFDA 2GZ3A 3NRCA 5DDIP 3WLFA 2G5CA 4Z0PA 1HDRA 1E7SA 4JJGA 1WDKA 2E82A 4Y98A 1Y8QA 1KEWA 4DIOA 2VWGA 3ENNA 5JBIA 3WYCA 4XYEA 4BKOA 2DFDA 3AFNA 4ONEA 3M6IA 3ZWYA 5CEJA 3RU7A 3ABIA 3TZQA 1LA2A 2X22A 1LTHR 2IXBA 1DDOA 2C59A 1G0NA 2JD2A 3C1TA 4FGSA 4J9UE 4I5EA 3HB5X 3ZWNA 2I67A 3DZHA 4J90A 3RQSA 1P9LA 4KWIA 3WFIA 2O2YA 2QYSA 3WGGA 4M49A 1DFGA 3DEYX 3AOGA 3GC6A 4XA8A 3D64A 1R15A 3H2SA 1PL7A 3PVZA 5F1OA 3RBVA 4YJDA 4E5MA 3RUIA 4WEOA 1OMOA 2Q4BA 3BMNB 1GQQA 2RCYA 4BO7A 2NUAA 2HUNA 3NX4A 5JMPA 1ENOA 1PGJA 5A04A 3KEQA 4EGFA 3VH3A 4R68A 2AA3A 1KBZA 4L0QA 1DIGA 2J8ZA 3WBBA 2GERA 3ZWXA 4ND4A 1BRMA 1Z73A 1OOEA 2PFGA 3T7CA 1K5HA 3I6IA 1UAYA 4BNKA 2QRLA 4RV9A 4CM4A 1N7GA 4Z6KA 2RAFA 1E6WA 1SO8A 4WK6A 3L4BA 2P9GA 5TNXA 3EVTA 3AK4A 2FSSA 5GMOA 1IHXA 4MVJD 4N54A 3FCOA 3EW7A 1ADFA 3BXXA 3OHSX 1YBMA 5A9SA 5C5IA 4OSPA 1P0FA 2AG8A 3EHEA 3IMFA 2O7SA 4DL9A 1YWGO 1MG5A 1U2GA 5C7LO 1UZLA 1X7DA 3E48A 4IZIA 2GN6A 3STHA 4CR6A 4CMHA 4GGPA 3ASUA 4C7JA 2SCUA 1OC4A 3DBVO 5I8WA 1HDGO 5JO0A 4R3NA 4BKUA 4MVJM 2C29D 4GPD1 4EJMA 1UXKA 1BTOA 3RC1A 1TVEA 2VQ3A 4NG5A 4BQRA 4CV2A 5CG1A 3CZMA 1GDHA 2DAPA 1I2CA 2QW8A 1H2HA 4Y6PA 1ZCJA 4YYZA 4YQYA 4BNUA 2GDZA 3ORFA 1YRLA 4L9RA 5EPOA 4BMVA 2JCVA 3IP3A 5JY1A 4AJ4A 4GLOA 3WJ7A 1GTMA 1NFQA 4YAIA 3F4LA 5JE8A 1ZSNA 1MGOA 4I8XA 3TPCA 1LDEA 2Q2VA 3F9IA 3DMYA 1Z45A 4CMIA 3ADOA 1GYRA 2AQ8A 3PFFA 3W1VA 5G0WA 1RM4A 1BWSA 4ID9A 3SX2A 4UUMA 3V1UA 4J49A 4WCFB 1P3DA 3O9ZA 3RIHA 3PWSA 3WYEA 4OMUA 1JA9A 2Z95A 1HWYA 4H16A 4R1TA 4BUCA 3ITDA 1EDOA 1NPDA 3ZDFA 1GQYA 2C5EA 3ON5A 2I9PA 1I8TA 5T64A 3OF2A 4JROA 4FFLA 3TF5A 1H6CA 1C0IA 3IL2A 3C3XA 3DBLB 2EERA 4PLHA 5HRUA 4WPGA 3X2FA 4HX5A 2GO1A 3I5MA 3S2EA 1HTBA 3ANLA 1O0SA 4XIJA 4J3FA 1PJBA 4DYDA 2EEZA 4OYRA 4J4TA 2NTVA 3S1LA 2NV6A 1X15A 3ETEA 3VKVA 4DC1A 1Q0QA 4R41A 3TZCA 1IUKA 4JLWA 4YRDA 5HA5A 1KC3A 4J6FA 1QYCA 3RASA 3OQBA 4CLHA 1YH3A 1MV8A 4YA6A 4KUGA 1HKUA 1SB9A 2GLXA 1B16A 3OEYA 4DA9A 1U4SA 1PQPA 3PFWO 1YDWA 1NFFA 3OIFA 2YHIA 3RWBA 5CEFA 4RVHA 4Z9YA 2BMAA 3S2GA 2Q49A 3HDJA 2NWQA 1Z6ZA 4G65A 1JVBA 3JQAD 3OA2A 2YW9A 1ENZA 3K5PA 3MJEA 4S3MA 2NVUB 1E77A 5KVQA 1SCUA 2A94A 1PR9A 2FPGA 1X1EA 3NTRA 4WNIA 3WWZA 5JNLA 1MX3A 4GWGA 5AQ1A 4AJJA 1JTVA 3I9MA 1Z7BA 5KJCA 3PP8A 2DTXA 2OHXA 3G17A 4A73A 2PGLA 3DHYA 1WDMA 3DBRA 3JD1A 4Q3EA 4UVDA 3TZHA 5A5EA 1KVTA 2X0NA 5HWSA 5FWNA 3P2YA 4HFJA 4OIMA 1BDBA 3BTUA 2ZQYA 4UREA 3WSWA 2P2SA 1GPJA 4O6VA 2Y99A 4RZHA 3C7AA 3M2PA 3JD0A 1UDCA 3M2TA 4FOOA 4R1SA 4IXWA 2ZCUA 4MP8A 1YB5A 4GVXA 3AU8A 5CDUA 3HB4X 4J7XA 4OAQA 4XZ3A 5A3VA 2NVBA 1ORRA 3HDYA 5F1KA 5KCZA 3FPCA 1BVRA 1P33A 2WTBA 2Y66A 3RUFA 4A26A 2GF2A 3U9LA 1DRWA 1LLCA 5U9CA 1ENPA 1F06A 3F1KA 2J3IA 3DMTA 2IYOA 1RM5A 5G0VA 2O4UX 3PEFA 3U4DA 3U09A 4RVGA 3BMOB 3PRJA 1UDAA 4TZKA 1T25A 3ICCA 3M1LA 1PTJA 3PQEA 2YQ5A 1EUZA 2BGKA 4KMSA 5JDCA 3IIEA 3DZBA 3P5SA 1EMDA 1GV0A 4P4GA 3C7DB 1MA0A 4IDDA 5AXBA 1G6KA 2E49A 4PLGA 3O26A 4IDGA 4WKGA 5ILOA 3QE3A 1C1DA 2JD0A 5K6AC 1PZGA 4URFA 4R51A 5T8KA 2OZPA 1WMBA 1Q7BA 5TLSA 1QYVA 4IGFA 5G0UA 3AI2A 4II2A 1Y5MA 4M8SA 3KSUA 4FQ8A 3OP4A 5C7IO 4OO3A 5FYDA 2UUPA 4Y6SA 1YB4A 2PZMA 3D0OA 4CM9A 5U4QA 2NTJA 4IIUA 2Y1DA 1P1KA 2HMUA 1WXDA 1HE5A 4RF5A 3WGHA 3WR5A 1PJ4A 2ZTUA 3I83A 4IBOA 4JNKA 4WNCA 4YQZA 2I6TA 3TN7A 4L4XA 2DBVO 2G76A 1M66A 1Z7EA 5IN4A 1Y8RB 1GUFA 2VNAA 5T5QA 1ISHA 3BTOA 2IDZA 1BHSA 3DOJA 4OH1A 3RUHA 3UOGA 2H63A 3EY4A 4RPGA 4XRRA 2PKQP 1T4DA 2VRCA 3I1JA 1ENYA 1I24A 1YS4A 2JFHA 3H5NA 1LDYA 4PG8A 2OO5A 2O23A 1NQTA 2B5VA 3U4HA 2XXBA 1NBOA 1O95A 2VHZA 5AXCA 2X9NA 1VRWA 1CQJA 2JFFA 4YDRA 1JAYA 1E3IA 1UDBA 2HQ1A 3DBHA 2B0JA 3NAQA 5EQDA 1OC2A 2ZTLA 2UYYA 1H0KA 2PK3A 4L4RA 1WWKA 1CYDA 2Q50A 3ASVA 2BLLA 5JYFA 3W4IA 1UAGA 2ZB8A 3KYCA 4RF3A 3ZW9A 3R6DA 1P1FA 4XQGA 1DXYA 1PEDA 4ZVVA 2FMUA 1GZ6A 2VZ0A 3RAJA 1YJQA 1EE2A 1PZHA 5DCUA 3U0BA 4DTIA 1LXCA 5I9MA 5FI5A 5COAA 1EK6A 5COBA 2BGLA 3KETA 4NFHA 2IE0A 3BTSA 3JQBA 3EUWA 5CAEA 1BXGA 4BIIA 4YJHA 3RFXA 1Y7TA 1A4UA 3WGZA 1PJQA 2OORA 3GFBA 4CQLB 5KVVA 1T2AA 2AQIA 3A14A 2PGJA 1RKXA 2HDHA 3DZFA 4QXMA 5KKAA 3WTBA 1ZUD1 2NNLD 3E9MA 1DC5A 1GEEA 3WICA 4EEXA 1I5RA 4XWYA 1JKIA 1DJNA 4I5DA 1WMAA 5EERA 4GX0A 3ZV3A 4J91A 1YQDA 5FF9A 5LC1A 1K6XA 5BT9A 1XELA 1NR1A 5TF4A 4FFPA 2CVQA 3V5NA 5BSHA 3IC5A 1NP3A 1XWFA 4NBRA 1Z74A 1S7CA 3DHEA 1X0XA 1GR0A 4M89A 4LN1A 3IUPA 3NT5A 1DB3A 1VJ1A 4L75A 3GR6A 3INTA 5KIAA 5A9RA 2PZKA 1T2DA 4DREA 4A10A 4NDNE 3DTYA 3UCEA 2E4AA 3K8ZA 3NDJA 9LDTA 1H2BA 3GN1A 3TZKA 4YRBA 1SNYA 1NVGA 5L4SA 3GQVA 1UZMA 4R54A 5EINA 3CIFA 4DQVA 2ZCVA 5IXYA 1V3TA 5IF3A 2A4KA 2Q1TA 2AE2A 3I9NA 3ITKA 3ZV4A 4BNJA 4PRLA 1IHYA 2Q1WA 1GYPA 1FF9A 1E3JA 1K3TA 5JCJD 1UR5A 3UCFA 3SC6A 4IGEA 3EYWA 1H5QA 5HBRA 2EJVA 3JQ8B 4LISA 1XYGA 1D4FA 4IDCA 3ZNOA 3KLMX 1LI4A 4PGFA 3JQDA 4PRKA 1CF2O 1H6AA 1SEPA 3QP9A 4E21A 9LDBA 5J23A 4DIBA 3KLPX 4JK3A 1A9YA 1A7KA 1VSUA 4Z0TA 4CV0A 5B4VA 3FPLA 3JYPA 3VDQA 1I36A 1Q7GA 2V6FA 2VZ8A 3KO8A 4JCOA 5THKA 1DAOA 3WDSA 1P44A 2CNBA 1GUYA 5TGDA 2PV7A 3D3WA 2J5QA 4KTVE 5JC8A 3GN2A 3L6DA 2YV3A 2D5CA 5B37A 2XAAA 3SEFA 5TRTA 1CETA 1C14A 3VKUA 3NTQA 2VHWA 2X58A 3ZH2A 4AG3A 4AJEA 1R4NA 4WJZA 3B1FA 1AHIA 2BI7A 4QTZA 4Z9XA 1PGOA 1E3SA 1QLHA 4FFNA 3GOHA 3F5QA 5DOZA 1IZ0A 3MCVA 1LC3A 4Z9FA 5JDIA 4IZHA 3QLJA 1ZFNA 1DFIA 3N7UA 5BNFA 4KUEA 3GEDA 1SOWA 4ZA2A 1ZSVA 3PQFA 4J2OA 5A02A 3VOSA 5KVSA 5C7OO 3FNFA 5L7YA 4M54A 3X2EA 4R5MA 3DAFA 3JQGB 5IAAA 4RVDA 1L7EA 4M87A 4NMHA 2ZKLA 3SVTA 1Y5RA 4CMGA 3BMCA 2OBYA 1DC6A 4FOSA 1ZEJA 1CDOA 1ARZA 1LSJA 3D4NA 5G2OA 3F4BA 3JQFA 4IJVA 1NAIA 4J16A 4RQUA 5T73A 5TJ9A 4TZTA 1FDWA 4BO8A 2P91A 3FWZA 1J0XO 2OGUA 3IDSA 4NJMB 4CLOB 4ND1A 2CF5A 4E30A 5AOVA 4RLSA 3VC7A 3U3XA 4INAA 4Q3AA 4YACA 1JVSA 3VH2A 2FZWA 3ROQA 1O6ZA 1Q1NA 2Z5LA 2P68A 3K31A 4JBHA 1KETA 5ES3A 3NKLA 2WE8A 3B1JA 1PL6A 5EQFA 5K9ZA 5MDHA 3Q6IA 1YJ8A 5JSFA 2FZEA 4E33A 1NASA 2BFAA 3GEGA 2XXJA 4BQPA 1E5QA 2VT3A 3PLNA 5K0ZA 2ZB4A 4ROSA 4KDFA 1J5PA 5JAIA 5A3JA 1AXEA 1LC0A 5ITWA 4CQMB 5G4KA 1LLQA 2DBZA 3NV9A 1YBVA 1Z82A 1XU7A 3GRKA 4GLLA 3OFSA 3KYDB 3E5RA 3OECA 4B4VA 3PHGA 4O5OA 3B70A 1VC2A 3EZYA 4YAJA 4C4OA 1YBAA 2OXIA 4IDBA 4H7PA 4TRNA 1WDLA 2H1SA 4I5FA 2FWMX 4XCVA 3EC7A 4TKMA 4XGKA 1QV7A 2FP4A 2FSVA 1YKFA 3H9GA 3VTZA 1UXHA 1Y8QB 2PZJA 1X7GA 4XYMA 3GVCA 3OSUA 2I3GA 2VYND 3RC7A 3K92A 3FN4A 3D3EA 1UUFA 1EK5A 3SBOA 4XYBA 1AN9A 2PY6A 1YOVA 4XR9A 1V9LA 4LSMA 5BNTA 1X7HA 4HBGA 2AEMA 1NPTO 2GYYA 1U3WA 3NJ8A 2H6EA 4PLPA 4BKQA 3H4VA 3PWZA 1NVTA 3Q9UA 4J0FA 2DPHA 4PVCA 1PJSA 2LDBA 1RM3A 3HDQA 3UXYA 1P1JA 3OJFA 5H83A 4NNJA 3ZWAA 1KVRA 2HRBA 1PSDA 1YL5A 4KTTE 1JN0A 1LNQA 1NFRA 3FHLA 1Q0LA 3LYLA 4OJNA 4Z3KA 8LDHA 5KJ6A 2GSDA 2O3UA 1LLDA 4I9NA 4WLEA 3GPDG 3VZRA 1FMCA 1PJTA 4ILKA 3WBFA 1E7RA 2V65A 4JGBA 4TKLA 2EP5A 1CEQA 1E1LA 5COQA 2GASA 2I65A 4W99A 5F5NA 4AJLA 3GMSA 1ML3A 4HUJA 4N5MA 3PYXA 3VTFA 2PH5A 1U8XX 4CM4B 3WGTA 4OOFA 2D8AA 3RC2A 1IY8A 1HYHA 2GRAA 2JCXA 3A1NA 4GSLA 3VZQA 1EUDA 4H15A 3E9NA 3PJDA 4YT4A 1SBYA 3K6JA 5FFFA 3TNLA 4K9DA 4YEDA 4DRYA 5THQA 3LC1O 1LDMA 2ZQZA 3RFTA 2DTDA 3KYBA 1F17A 1BXKA 1N1GA 1XLTA 4U6SA 5A9SB 5JYAA 4OQYA 1MXFA 5B4TA 3UW3A 5TT0A 4YT5A 2YQ4A 5DP1A 3UFXA 1CQIA 4UVGA 2NM0A 3O8QA 5L4NA 3L0DA 2FR8A 3H9EO 3GUCA 4RVSA 2FY8A 4M55A 4BO4A 1E7QA 4IMRA 4RF2A 1H94A 2FRDA 1UXGA 3G3EA 1BXZA 3JYNA 2X1HA 1E3WA 1AUPA 1NXQA 3KSZO 4D43A 3KOUA 1DJQA 4IJKA 1PGQA 2W2LA 4C7KA 1JW9B 2D5AA 3GAFA 2WM3A 2YZ7A 4ZQEA 1XU9A 2AQKA 5L9AA 4WOJA 1CJCA 1SC6A 4ZJUA 4JP3A 3JD4A 4CMIB 4DPLA 5L4LA 2VYVD 2V6BA 1KEVA 3MWEB 3G0OA 5BSGA 1N2SA 3HFGA 3ZCXA 4XB1A 4BMNA 4R5HA 1PJCA 1LUAA 5IZCC 2P5YA 2UV8A 2Q2QA 1HLDA 1EVYA 3GGPA 5JAZA 3I23A 3DAPA 4WLFA 3CE6A 4CMBA 3H6KA 1C0LA 1MFPA 5JAMA 1GQ2A 3ETGA 1GCOA 2G1UA 5KWEA 1IULA 3VPXA 2CF6A 2VOEA 2ZYAA 2ZIZA 4AJKA 1U2DA 5JXWA 5KJ1A 1T2CA 3GVPA 3K30A 2BFOA 1DPGA 1GU7A 1QSGA 1P1IA 2W98A 2WWRA 3L6EA 8ADHA 1RYEA 1ISGA 2X5OA 4JX8A 4BNLA 4HV4A 4I9HA 2DPGA 1HEUA 3QWAA 1W73A 4YR9A 3VPFA 4MIOA 1D3AA 3OM9A 4HFRA 4NIMA 1NHWA 2IRWA 1EE9A 3AUUA 4ZU3A 5DP2A 2C2YA 3WLEA 2EV9A 1ADCA 2I5PO 4GI2A 2O3QA 3F1LA 3GZ4A 3GHYA 1B8VA 5JCXA 2GUGA 2X0IA 1GY8A 3I3OA 1FDUA 1PS8A 3Q11A 1U3VA 4P4LA 1PX0A 2HCTA 3C1AA 4GMFA 3WGOA 2GZ2A 3OEWA 1F0YA 3TSCA 4J1TA 4YXFA 2QRJA 1V8BA 3L9WA 2AW5A 1A7AA 1I2BA 5DBFA 4OL9A 4M86A 1PGPA 1ONOA 2YHIB 3BHIA 2C54A 3RCBA 4HWKA 5B4UA 4ZHSA 4RVFA 1ZVMA 3NJ4A 5TIIA 4F46A 3L07A 2Y1GA 4B8WA 1MP0A 2B5WA 1QV6A 4XYLA 3NT2A 1SB8A 3H65A 3HADA 3JD2A 5BSFA 2PD3A 1P77A 2QQ5A 5L45A 4MVJG 5TX7A 4XDYA 3NGLA 1GV1A 2AEFA 3S8MA 2HK9A 3DBRB 1DIHA 4UVEA 4YJFA 3CMMA 1EVJA 2IODA 4NK5A 4GL4A 1MFZA 4MP3A 3E9QA 3OJ0A 3PHLA 4XQCA 5EN4A 1NM5A 3RUDA 3GVIA 3GEMA 4PG7A 2VRBA 3MOIA 2ZB7A 3ST7A 2PD4A 3UAGA 4CODB 1W6UA 4J1QA 3OICA 3W8FA 5L51A 1GZ4A 5CDYA 4K28A 3BMQA 3TFQA 3DWFA 1QRRA 4D0SA 1WAMA 3CZRA 3ZI0A 4J4BA 3VVBA 3OETA 1KC1A 4ND2A 3L6OO 1ZK2A 2Y1FA 3ANNA 5K6AA 5L7TA 1CERA 4MOWA 3RJ5A 5HM8A 2Y67A 1C0KA 3CUKA 3V1TC 3BYZA 3OJOA 1JLLA 4J0EA 3PHHA 2P9EA 1OFGA 3HDHA 3GT0A 1HZZA 1VJTA 2J3JA 3E5MA 4FFRA 1RM0A 2VHVA 1ZXBA 1LLUA 4WUVA 3TRIA 1YGYA 4QEDA 4CMJA 1VPDA 5DNAA 1LEHA 3UUWA 4I9UA 1YDEA 3CXRA 4DMLA 2ET6A 2X7HA 4GH5A 3WGYA 2JJYA 3ONDA 3VPGA 7MDHA 3OMLA 1IL0A 1XKQA 1H6DA 2VWHA 1HDYA 5FEUA 3LT4A 3RKRA 1PZEA 3G1TA 3N74A 3COSA 1ZZEA 3RUEA 2RIRA 5HS4A 1IB6A 4AJ2A 1C1DB 4DLAA 2A35A 3AI3A 5JPIA 3ZWPA 1E92A 1D8AA 1I01A 2E6UX 2P5UA 4HP8A 4QO7A 1KVSA 4UVIA 3QVTA 1ZK4A 3VZPA 2J3HA 4DWVA 4WLUA 2PWZA 3WS7A 2D2IA 2YJZA 3JYLA 3NEPX 4FR5A 3T4EA 4E5PA 2IYPA 4G81A 2JHFA 4L74A 3OIGA 4ZD6A 4BNTA 3I6QA 4R9SA 1FK8A 2R00A 4CV1A 1HDOA 3WSVA 1PZFA 4RQTA 3PYMA 2RHCA 4B3HA 3OJEA 3PGJA 1DO8A 3O38A 3IKVA 3WMWA 2BRUA 3WQQA 5JY6A 1FXSA 4A27A 4D3FA 2FOIA 4BO2A 4DUPA 2EGHA 2C5AA 4FJ0A 4YAEA 4TRRA 2HMSA 1ZK1A 1MUUA 2WYWA 3JQEA 2B37A 1OZAA 1XHLA 2HK8A 4FSHA 3VH4A 3GGGA 1AHHA 3GF4A 4G2NA 1VKOA 2JKVA 3UKOA 1Q2XA 4EW6A 5ER6A 2D1YA 1HE3A 1DC4A 1V3UA 3OJLA 2OOSA 1C1XA 3DBHB 2CSUA 3WOHA 4XD2A 3ZU2A 4CMKA 1EUCA 4H3VA 2Y05A 3E18A 2O3JA 4XJTA 2EKPA 2C2XA 2VUSA 5IN5A 4Q3DA 1W8DA 3KYCB 3U4IA 4E32A 4LGVA 4L8VA 3SLKA 4D44A 1D7OA 4FW8A 3OQ1A 4FD3A 4ALMA 4EUHA 3N58A 3PIDA 4WCFC 1T2EA 4GKBA 4IXTA 1K6JA 3BZUA 4B7UA 1E7YA 3ZWVA 4NH4A 4B4WA 4HXYA 3A4VA 5L95A 5A03A 1JQBA 1QYWA 4RPKA 3G79A 4R01A 3PJFA 2EIHA 4CM8A 2D4AA 4MVJH 2J6IA 5F3RA 4AVYA 3AU9A 5DN9A 1BXGB 4RPLA 1CWUA 1BDMA 3NT4A 1TT5A 4YJHB 4J4HA 1JKJA 4E5KA 2HRZA 4Q3CA 4EYEA 5IDQA 3KEOA 4RORA 1B7GO 4BGEA 2W2KA 4CM5A 2UDPA 2VUTA 3QHAA 1VSVA 3W8DA 5IZ4A 4CLRA 2GN4A 3BIOA 5JYDA 4DGSA 1X1TA 1E7MA 3QY9A 1HYGA 1KIFA 2X9VA 4Z3DA 7ADHA 1XG5A 2FHSA 3O03A 1EVZA 4BO3A 1PS0A 5CEEA 3KRTA 2HK7A 2EP7A 1ZMTA 2YUTA 1MLDA 1SZJG 3MJVA 4JJFA 3WQRA 1PJLA 2DUUA 2X86A 3NDIA 2EHDA 4ZQBA 3HN7A 1E5LA 4PLFA 4CQMD 2DBQA 5EL0A 4E5YA 3S2IA 1B15A 2RBEA 1AGNA 3VPSA 1B14A 3DL2A 2BGMA 4DXHA 2QZ9A 1T2FA 4D3DA 5CDTA 4ALIA 4QFCA 4CM3A 1LRLA 4BB5A 4BNFA 2HKIA 4A03A 3KM0A 3GH3A 3SXPA 4JBGA 3PZRA 2Q99A 3JSAA 3WMXA 1R0SA 1EBUA 1YL7A 5JDCC 4MVJA 4TROA 3SC4A 2CVZA 1LSOA 4D41A 1YVEI 4CR7A 4LSWA 1GD1O 3HFSA 5U1PA 3W4KA 4EBFA 4EJ6A 3JQ6A 4TRJA 3RD5A 3RSHA 2X23A 4Q9NA 2D3TA 1DIRA 4IJUA 1DBVO 5DBIA 4N5NA 5CDGA 4YAGA 2Y0CA 1KVQA 2X5KO 4NZ9A 2IEBA 3TDKA 3JQCA 1LRKA 1B8PA 1QLJA 4Q3BA 1L7DA 2JL1A 4MKRA 3HE3A 4YAKA 4TSKA 3PDUA 4RGBA 2VT2A 1M67A 3C1OA 4YCAA 4CLEA 3LC7O 4IQ8A 1TXGA 3GG2A 3QWIA 1I3NA 4BNYA 3WNQA 1I33A 2XOXA 4HFMA 1T4BA 3OIDA 4PLWA 1PQWA 1X0VA 4BB6A 3GZNA 4D7AA 4IDEA 4ALLA 3VAZA 2GCGA 4ZQFA 4FBGA 4XDZA 3D3WB 1AXGA 2YHUA 3B6ZA 1P1RA 4GVLA 1N92A 4U0JA 5DCWA 1OBFO 4BNVA 2FR1A 3LZ6A 1IPEA 1R4NB 3CSDA 5I7FA 4Q3NA 3GVHA 4D0RA 4W4TA 3ZWCA 3Q1LA 3CPSA 4K6CA 3RFVA 4NHEA 3T7EA 5ILGA 2RH4A 1NQ5A 4WE3A 4BO6A 1FDTA 2UAGA 2VNSA 2X0RA 2QRKA 2C07A 5ENVA 1BMDA 5KJFA 1SPXA 1VLLA 1GEGA 4IM7A 4E0BA 4RL6A 4PG4A 3QV1A 1NX6A 1R0KA 4BV8A 1E1KA 5CFZA 2PTGA 2AQHA 1HT0A 3UHAA 2YDYA 3E8XA 1D1TA 4Z0HO 1N8KA 2PD6A 2C20A 2BH9A 3ZWBA 3BMCB 1RWBA 2OMEA 3JQBC 5DZSA 4IPTA 3NDRA 2ZATA 1WW8A 3DC2A 3NYWA 5AXAA 1ZK3A 4WGGA 1ZKMA 1WP4A 2Y0DA 3JQAA 4GX1A 3PTZA 3MJSA 3B20A 1RJWA 2O3RA 4E4YA 4MVJI 1EFKA 4BL5A 3AOEC 1KY4A 3IS3A 1QMGA 2AEJA 5ENDA 1E3LA 3WTCA 4LRTB 3ZN2A 3ZWMA 4KOAA 3E03A 3I4CA 3R1IA 4HY3A 5I9LA 3JQ9A 3M1AA 4E6PA 5IG2A 1HDCA 1MB4A 4BNZA 2JAHA 3KXDA 1NVMB 1TB4A 3ROKA 3ROMA 1F8GA 2X5JO 5ICMA 2QX7A 2PKQO 2ZTVA 4GX2A 4A2CA 3U5TA 4MO2A 2OL4A 3PLRA 1XGKA 4J7CA 4R16A 1K89A 3GMDA 3HG7A 3KVOA 5JMWA 1LDNA 5LDGA 1XA0A 3H3FA 5HS6A 4D3SA 3MOGA 4W9NC 3ZU5A 3V8BA 5KKCA 1U1IA 2XF8A 1MG0A 2DFVA 5TC4A 2WYVA 4GSKA 3LF1A 5G4KB 4BNHA 2NTNA 4YTEA 3JQ7A 5L40A 2YV2A 1HE2A 3K73O 5ADHA 2P4HX 1HSZA 4ALKA 4ZRNA 4LMPA 3I4FA 5L7WA 3TL3A 3H9UA 1WLYA 4DPMA 2DUWA 3VVCA 3DZKA 1ZO8A 4CMAA 2NQTA 4WLOA 3PJEA 4MIYA 1A71A 3AUSA 5G0SA 4AICA 3KB6A 3DFUA 4R9RA 3IAHA 3ZHXA 1X14A 2B83A 3H9JA 4BNNA 1UJMA 4AL4A 4FJ2A 2D0IA 2GR9A 4DYVA 2O3TA 1YOVB 2AMFA 5IDWA 3LLVA 1NYTA 3RVDA 1T1SA 2NU6A 3GG9A 4XQEA 5L3ZA 1XEAA 4MVJE 4YWJA 1B3RA 3RKUA 4DBZA 4CLDA 5AXDA 2VTDA 3D5TA 5BSEA 3TFOA 3PIIA 4A0SA 3AUAA 5GZ3A 2GPTA 2B69A 2YDXA 3ZGYA 4QUKA 1ADGA 1NWCA 1V6AA 1U5CA 2HMVA 3TL2A 4BVAA 1V35A 5DF1A 5ICSA 2B35A 3MJ4A 4IINA 2EW8A 4BO0A 5JFOA 2C82A 3UVEA 3AM5A 2C7VA 3AI1A 4E5NA 2CY0A 4LK3A 3OH8A 4WLNA 1J6UA 3QW2A 1DIBA 4UUOA 5JO9A 5T57A 4FFMA 2NU7A 4O59O 1PWZA 1T1RA 4OXNA 4PLTA 3DO5A 2NU9A 1N9GA 4A7PA 1KEPA 2QG4A 4PZEA 2HLPA 4CLXA 4CV3A 4B3JA 3WIEA 3BHJA 6LDHA 3BHMA 5A06A 4KQWA 4J7UA 1GADO 2O3SA 3A28A 2XPCA 1H9AA 2W90A 2DVMA 5CDSA 1I0ZA 3EZLA 4Y9DA 2NLOA 4UAGA 2R2GA 2GNAA 4CLOA 3FNEA 1DC3A 4XGIA 4BGUA 4O63O 3TOXA 2GN9A 6ADHA 5C37A 3HQ4O 5A1TA 4NBTA 1KERA 3SJUA 1IZ9A 2CDCA 3K2BA 2FPPA 3KV3O 1DLIA 3K2EA 3O8QB 3LF2A 3LT0A 4RZIA 2CZCA 4MJLA 2B4TO 1I10A 1I3LA 1HYEA 2WD7A 4NBUA 4CM1A 2C7GA 4GBJA 5IZCA 1I2ZA 2A9FA 3I9LA 4F45A 3AM4A 3AW9A 1NR7A 4ZGWA 4R1NA 4PLZA 4RF4A 5F5LA 3W6UA 4DVJA 4EITA 4OXYA 4NJOA 1A9ZA 1U28A 3JQFC 4WCDA 1PL8A 1F14A 4LVCA 4CMEC 4RJTA 1E3WB 3E82A 3LT1A 4O0LA 1HF3A 4PCVA 3E1KA 1R12A 1QYDA 1ZJYA 1A5ZA 3HN2A 4IDFA 4NR0A 4P4NA 4L76A 5G4LA 2PNFA 1QP8A 1VKNA 1F8FA 4CM9D 2NQ8A 4RPJA 3Q9NA 5TT1A 3HNPA 2EF1A 1DIAA 1ONPA 2WEKA 4HKTA 5DBGA 3Q0EA 2JD1A 1VE9A 4UEKA 2G17A 4ZN6A 2EJWA 3WWYA 3WX0A 4B3IA 3I52A 3K96A 2BHLA 3NTOA 4Y67A 1TI7A 2YY7A 1U4OA 2VRCD 3EDMA 2A92A 5J9GA 4ZQGA 4YJGA 3LT2A 3WQSB 3UF0A 1LQUA 1SMKA 4CM6A 3F3SA 2IXAA 1R4MA 2BF7A 4ZICA 5G0TA 2VWQA 1GCUA 3F47A 4PLYA 5DT9A 3U4CA 2G0TA 4BNMA 3L4SO 1EFLA 3BAZA 4PFJA 1Z75A 1L1FA 3NUGA 3DONA 1PS9A 1FJHA 1LQTA 3JD3A 3PGXA 4A5OA 2JHGA 3A06A 1YB1A 3EAGA 2DKNA 3EMKA 1NAHA 2VN8A 4UULA 2VZ9A 4AJIA 1E6EA 1UXJA 3L77A 1ZH8A 3GDGA 5I9NA 4JP2A 4DQUA 1MC4A 1BW9A 1M6WA 2TMDA 1U7TA 2UUOA 5AYVA 2H9IA 4BHTA 2VWPA 1O89A 3INRA 4DMMA 3ETDA 2WDZA 2BI8A 1QG6A 3ROPA 4ALJA 2NU8A 3QWHA 3JCZA 5JC1A 1JU9A 4YBZA 5EJ2A 1IYZA 1XQ1A 2ZK7A 3FNHA 3AJRA 3MWDB 4U6QA 1HL3A 3H3JA 1NQOA 4W6ZA 2Q1UA 3C8MA 3DB2A 5JCJA 1HXHA 4FN4A 4IS2A 1Q7CA 1DSSG 4IIVA 4YJFB 1VL0A 3KBOA 4UVHA 4OQZA 1IE3A 3TWOA 3S55A 1TT7A 5B1YA 1NWHA 1UP4A 4CJXA 1QORA 1YE3A 5A05A 1OI7A 3AUTA 1ISJA 5H81A 1Y9EA 1FDSA 2CUKA 3BMNA 4YPOA 4FIZA 4D46A 3BMQB 4QQRA 3IJRA 3HSKA 2R6JA 1IOLA 3ZNNA 4M1QA 1RPNA 4IS3A 3QSGA 4LRSB 1MXHA 3FBGA 4KP7A 4BO5A 2Q3EA 2Q4EA 1V3VA 1HDXA 4NBVA 3PDJA 3MZ0A 3QVSA 3H5RA 1KEUA 3WB9A 3CTMA 4IQ0A 4B7CA 4CUKA 4ESOA 3IUSA 5A4DA 3DR3A 1WZEA 4S1VA 1W0CA 4RO0A 4WLVA 4P38A 2HO5A 2BFMA 3GLQA 3D5QA 4R1UA 5DCYA 1EBFA 1DRVA 4HNGA 2OBNA 2IEDA 3GAZA 3WG9A 2FR0A 3R0IA 4QECA 4AJ1A 1LSUA 1TLTA 1M2WA 4OKIA 3FRJA 4N7RA 3UGKA 4DC0A 1NQAO 4XJSA 1DOHA 4XGNA 4Y8VA 2HMTA 4MVJP 1U7HA 3SLGA 3GK3A 4CMCA 1R6DA 1SAYA 3HJAA 1RYDA 4B4OA 4U8GA 1D1SA 5C3MA 2YFQA 2OUIA 4I5GA 4LCJA 4W7HA 3IOYA 4XRGA 1B3BA 3DXFA 3CKYA 2WMDA 5F1PA 5A5FA 1UP6A 3PYLA 1HE4A 3S2FA 4E2ZA 2I76A 2IZZA 1DHTA 1EZ4A 3L4BC 1UP7A 1PWXA 3IJPA 3B1KA 2PZLA 2ZB3A 2B4RO 5TJHA 5I7VA 1R66A 1Y9AA 2O7QA 3DHNA 3MTJA 4GKVA 2WJPA 4NFSA 2I3AA 5F21A 3VHRA 1NPYA 4W7IA 3TQHA 2HJRA 4WCFA 1OAAA 4F6LA 2VHYA 1Y6JA 2BKAA 3KHUA 1WZIA 3NGXA 4XQ9A 3KZVA 4BGVA 3AM3A 3QIVA 5TSDA 1E6UA 1DLJA 4QT0A 5EMHA 2CFCA 3DOOA 4K6FA 1TEHA 3V2HA 3RJ9A 3ZU4A 3RI3A 4E3ZA 3PZBA 1QKIA 1C1XB 2DQ4A 4FJ1A 3EK2A 4LMRA 5BR7A 3ULKA 3U49A 5I7EA 4ITUA 4OXKA 2JFGA 3DBLA 1HSOA 5BNIA 4LW8A 3W6ZA 1VJ0A 3DZIA 3H9QA 4OGWA 2BELA 4NQZA 4OOEA 4J9VA 3VDRA 1YO6A 1ZK0A 1ISIA 5HTOA 1LBEA 2CD9A 4BOYA 1JKFA 2GZ1A 3CMCO 5IJZA 4RVUA 3GHHA 4BNIA 3ZU3A 3L9XA 2F00A 5JW6A 4QX6A 2P4QA 2ZYDA 4GMGA 5TS3A 4DIFA 4BS9A 4EEZA 4EZBA 1BSVA 3UCXA 2JCYA 3QQPA 3MTGA 4DQXA 3KTDA 3UN1A 1WNTA 5M6DA 4EUEA 2LDXA 4BNGA 2GGSA 2X4GA 1PGNA 4E2WA 2WD8A 4IUYA 2VYNA 4CM8B 1E1MA 1W4ZA 5ER9A 4PVDA 1TT5B 2DT5A 3CH6A 1MC5A 2NVUA 4FC7A 4I08A 2Y68A 2EXXA 3HUDA 1B0AA 4OKNA 4EJ0A 3W4JA 4UEJA 2CVOA 3JV7A 1ZW1A 2W2KB 3HWRA 3RU9A 4CLRB 3AY6A 4FPXA 4DLLA 2EW2A 3GNTA 3WNVA 3P19A 1R0LA 4IMPA 4D79A 3D4PA 4YT2A 1ADBA 2F1KA 4JBIA 2EKLA 3ZZNA 3FNGA 2GD1O 2HSDA 2W8ZA 3GNQA 4MINA 2B36A 4OHUA 1GPDG 4KWHA 1K2WA 1ULSA 2DBRA 3GRPA 1ZMOA 4R3WA 3I9KA 5MGBA 1DFHA 4MVJF 4JJIA 1EQ2A 2X0JA 2ZJ1A 3BTVA 4UEOA 1IPFA 1O5IA 2Q22A 1LX6A 4UUPA 3FSRA 3LQFA 1Y1PA 3T4XA 4NI5A 1QYXA 4BMSA 3LVFO 3BMOA 1DEHA 1HLPA 3IP1A 1CRWG 2PR2A 3C85A 4HFNA 1C3VA 4NK4A 3E6AA 1FDVA 1EQUA 3ZWWA 5T6BA 4AJPA 4QO8A 5JYEA 1BG6A 1GZ3A 1PU2A 1DAPA 2G82A 1F12A 3D4OA 4LCEA 1NNUA 4BGIA 1ZSYA 4PIVA 3RUAA 4LVUA 4CM7A 3AWDA 4W82A 3C7CB 1O9BA 2I99A 2ILTA 3V2GA 3F46A 4KZPA 1ZJZA 2O4CA 1J49A 4Y6RA 4TWRA 1N5DA 1A72A 2R00C 3F6YA 1M75A 2RH8A 1X13A 2DC1A 4E13A 4ND5A 3DMTC 3DDNA 4P22A 3BA1A 4JQCA 4ZQHA 3ONFA 5A9TA 1A27A 2DU8A 4GWKA 4CL3A 1S6YA 3C24A 3UICA 1P1HA 2Y0EA 5KOIA 1XCBA 2J3KA 2VYVA 3OQ6A 3P2OA 4J1SA 1JAXA 4PG6A 3GZNB 3CINA 1YONA 5JLAA 2QYTA 5EESA 2V6MA 1Y8RA 3DFZA 2O2SA 1BVUA 4CUJA 3VH1A 3V2UA 2GN8A 4R4JA 4BO9A 2VHXA 2VCYA 3G49A 4E2XA 4J2HA 4XKJA 1LDGA 2NACA 3LDHA 3DZGA 3ZHZA 3V1YA 5T8KC 4GGOA 2PGDA 1QR6A 4E2YA 5ITVA 1P31A 1KS9A 4N5LA 4CL8A 3ZNPA 3H5AA 4II3A 1ZBQA 3EVNA 1VM6A 2BD0A 1P45A 4J43A 4U5QA 3H2ZA 4WEQA 3D7LA 1E3EA 4WASA 1ZXLA 1WPQA 2EGGA 3AOEA 1HZJA 2BFPA 2FPIA 2NSDA 2VTEA 1H9BA 3FF4A 1PQUA 1SEVA 3DZJA 1ULUA 2DLDA 3FTPA 3CEAA 1YQGA 3LK7A 5FI3A 3G1UA 4AJOA 1GUZA 5TQVA 5B12A 1GFSA 3HHPA 5BQFA 4NU5A 3KSDO
chains in the Genus database with same CATH superfamily
1HEYA 5LQSA 3HK2A 1LVUA 1IJBA 1T9KA 3AVQA 3DTVD 4I1IA 4JJZA 4BRSA 2GHIA 4EW3A 2VOJA 2QN3A 3QPCA 4U0KA 2HF8A 1QXSA 1CJMA 4J1NA 4MA0A 1PF7E 1U0HC 3HM2A 4DRZA 5CM2Z 5C8ZA 5LOVF 1OB5A 3OLVA 3C3PA 1ZNQO 3HKDA 1FTNA 5AHRA 3G9XA 4GO1A 1RE1A 1TRKA 3U40A 2OO5C 1WVGA 4H0CA 1KP3A 4OSOA 4OBEA 4MWGA 5CNMA 1SOVA 2GPAA 4AY3A 2PKRA 2H1LA 1OX5A 5JXGA 2J5RA 2B2NA 5LOVB 1UC5B 3AEZA 3JQAB 2JZNA 2BZSA 4ABTA 1RYBA 1PHPA 1W29A 4B3CA 3P26A 1U9JA 2QVGA 2JIRA 2VNKA 1HG1A 2EKQA 2QAJA 4TRMA 2JIMA 5IDYA 4CQLA 2MINA 3OUTA 3CNEA 1T36A 1MT3A 1QZTA 3S1AA 2UVPB 1KBQA 3PB3A 4X20A 4CIAA 3GCGA 2UYGA 3W9BA 1PG0A 3QEKA 2HTFA 5CP8A 5TVGA 4ZOLF 2OPBA 3WLNA 4LWZA 2JZCA 4MO9A 2W0MA 1N6KA 1E1NA 1QWSA 2JLSA 4EFLA 2AG0A 1KXZA 3GJ5A 1XJWA 2F9MA 3JZAA 3LUPA 4OFZA 5IWAB 2BFEA 2WHEA 4BWYA 5KHLB 1A2OA 4C2AA 1X42A 1Z7YA 1G3RA 2G80A 1MX9A 4ZO4A 1ISSA 4CF4A 4GKKB 4KUHA 1XKTA 1N0HA 4MJ3A 4ZOLB 3MJCA 3JTMA 1LJ8A 3HR4A 1NTOA 1ZJ5A 1T5IA 5AI4A 4TSFA 1SD2A 1SELA 4EB0A 3P32A 1MTZA 5EJ6A 1B8UA 2DUNA 1RQXA 3OBBA 8ATCA 4AAYA 4MV7A 4D25A 1XIVA 2NUBA 5AUQA 1J9ZA 1M5TA 1LSSA 1TAHA 2VNIA 1K0UA 2QR3A 3DG9A 1KJWA 1LY1A 3LKDA 5JQWA 2ZWOA 4ISCA 4CTKA 3GVXA 1M2KA 4JUDX 3MCAA 3DT9A 5H82A 4H9GA 1LRJA 2PKCA 2FPUA 2VJQA 5LJIA 3BSFA 2OQVA 1TM7E 3PK0A 3S29A 5JPDA 2IWHA 5K6TA 1DG9A 4WVLA 2UXDB 1UKCA 4MDFA 3AR9A 3L7YA 2BMVA 5AJVB 2WWHA 1EP3B 2AI3A 4H4DA 3RUCA 5B3JC 3Q1KA 2Q1SA 2GJAA 3UATA 5AVOA 1CJUC 5EUBA 4BVEA 3FI9A 4RPHA 3LO8A 2Z1DA 1UJ6A 2UYQA 3K8OE 3OEED 2L82A 3SHFA 2WILA 1FSSA 2OCXA 1HETA 2Z9DA 1EIWA 4WY5A 3I64A 4YLYA 2QJFA 3OZTA 3QF7A 3VR6A 4CPDA 2BI4A 2XBLA 1E4EB 1I4DD 3G0CA 4RK1A 2UKDA 2BVNA 2NSJA 1TK2A 4B47A 1FS4A 5FP0A 2OFPA 3JWGA 5FA6A 1AD2A 1QX4A 3LLMA 2JEOA 3H6GA 1FYFA 3T7IA 3WLTA 4BIMA 4UD6A 4E31A 4WKCA 4MKXA 1RKQA 1RT9A 5HJEA 4JUBA 2ZRDA 1HTTA 4DKJA 1P74A 3OKFA 3R3SA 2PDAA 5TPWA 1CNEA 1NKSA 1T8PA 1H1LA 1PJ2A 4JT9A 4IRXA 5AW5A 1QH8A 4B7XA 3PPIA 3TJRA 3CVVA 1EJBA 1NW7A 4FHCA 2C61A 4I0WB 4YP6A 5HIAA 3QX7A 4ZVRA 3KSBC 3U4QA 4JJ8A 1OWNA 4JXKA 1JQKA 3VMFA 3QE0A 3KQTA 4KPFC 2OSVA 1N9GB 1IJFA 1VI5A 2DR0A 1EHCA 2ADMA 5UKDA 2BMJA 3GPCA 3UK0A 2ZSBA 2DM6A 1NF8A 2G88A 2H1FA 4NFYA 2GK3A 1CR6A 4F6CA 2FN7A 4GQAA 3CZAA 5JCOC 3MQFA 1DVRA 2JFYA 4HNAB 1H93A 1R10A 1AQYA 4XEUA 3NTUA 1TYZA 2GD6A 3PQDA 4WZZA 4B87A 1CX9B 2WE7A 2WYUA 4XEHA 1HDZA 2B21A 5CW2A 1S3SA 1IQ0A 2YWEA 3UT5A 2E5LB 3MHTA 4CG2A 1WU8A 4GI1A 3FTFA 2G06A 2NPIA 1KJZA 1E7WA 3ILVA 4TQUS 1L5YA 4QDKA 1GGVA 4TTAA 5ALXA 1K88A 4UPEA 4EHJA 4LDAA 4NZYA 4TXJA 3ZDCA 1UM8A 3CF6R 5J5CA 4DXAA 3RTGA 4RMJA 2OUKA 5EJFA 1MC1A 4HRYA 3QVWA 3NHZA 1N3BA 2NYRA 2ZYTX 5IFLA 3JVDA 4R98A 5KVCA 5IJ0B 4WNYA 2CJYA 2AXQA 1OPXA 3FTNA 3U62A 3HABA 3JQGA 4IIGA 4YNBA 5ED4A 1Z38A 3O4FA 1M2OA 4YRAA 1V16B 3P0HA 1LTQA 4NCNA 2X6RA 3K70D 1FL9A 4PO8A 1B26A 4MYDA 1BE1A 1SVNA 2R7KA 2Q2WA 2F2TA 3PQ4A 1E98A 2AJBA 3LX6A 2P2GA 4D9FA 1GPAA 1EEHA 3LA6A 3OM8A 4K9SA 4HNVA 3DFFA 2NP6A 5CCEA 4UC0A 1OZ0A 2VK2A 4WRRA 1NZDA 1YB2A 3UWDA 2O5RA 5C8YF 5KVAA 1GWNA 1W96A 3DCYA 2RGUA 4P6VF 3O92A 4TQGA 2JBAB 3STWA 5K3SA 3EC1A 1Y98A 4H6XA 2B0CA 4FGWA 1Z39A 5ALIA 1EUDB 5FOUA 5JSYA 5JD6A 4L27A 2BFBB 2J30A 1THTA 1W4AA 3DMDA 3QVOA 2DWPA 3JQ9C 3PFKA 4U3JB 4ZVQA 3G9ZA 4CUZA 4HNTA 1VHTA 1VSTA 3NANA 3A6DA 4QBKA 4RMGA 4S24A 3LX5A 5C8YB 3PI7A 3CY6A 4B2PA 4CI9A 4LY3A 5E4JA 4BKMA 4Z2AA 5BUQA 4CEIB 4FFVA 2WWYA 2A58A 2FWNA 3FDXA 2UXBB 2HSZA 5BT8A 3B53X 3EEFA 4QQFA 3ZW8A 4NPCA 4F3YA 1O57A 4Q21A 2LW7A 3HXQA 3OQPA 2D59A 3ZHUA 4G84A 1CUIA 2YVLA 1W8IA 2IHVA 3KSMA 3HO1A 3WFJA 4WAUA 3UJ8A 1JHRA 1EAYA 4QWWA 3Q5EA 5CNKA 4YONB 5KYKA 1PR6A 2D00A 1UOOA 5K51A 1LPNA 2OCAA 3JARB 3R0JA 1JWAB 3ESDA 3MJTA 3OVMA 4J16C 3TE6A 5JFGA 3OF3A 1U7WA 3HJUA 2Q6IA 5FUVA 3OZ7A 3WXBA 5C81A 1N2OA 5DULA 1KMMA 2PYZA 3AR6A 3C8UA 3AFHA 3EXG2 5KAMA 2ZUWA 1NF9A 1T9DA 3G8CA 3GV0A 4JI1B 4EMSA 5BYKA 2Y93A 1J1UA 3RC9A 2PUDA 3FLAA 5DYYA 5F35A 5JIBA 2UUCB 1M6YA 3SY8A 3B5JA 3VFDA 3K94A 1SG0A 4OP3A 4ZC1A 1ZH0A 1G8MA 4OHRA 3CWCA 3N2LA 5LNK6 1T3LA 5DI3B 1E3DA 1GU1A 4HRXA 2ENWA 2AIRA 2XB2A 3NRCA 4F2GA 5JD5A 4HQ6A 3CXUA 3L6BA 4Y98A 4JJGA 1FX0B 1WDKA 1XRQA 4BNDB 5KZMB 2P3QA 2WHPB 3NW9A 1Y8QA 4KPUA 4RIFA 1AXRA 1PI3A 1X7ZB 3VTKA 4DIOA 4H08A 2ETXA 5FL7D 5JJLA 4EG1A 1CF4A 1XEWY 4MR8A 2GYWA 3Q98A 3JVUA 1BE8A 3AFNA 3LA8A 3ZWYA 1A7UA 1OQAA 4TKVB 4QDOA 4PO3X 4PGMA 2DQSA 2X22A 3DE0X 3TZQA 4L4YA 1FTWA 2SNIE 3IBCA 5CVVA 1TZBA 2JD2A 4J9UE 4L57A 5FIUA 3SJAA 1Z68A 1AUOA 2ZI4A 1KSJA 3BERA 3ER6A 4KKXB 4FMPA 4UHFA 2F59A 3ZWNA 3U7FB 1Q20A 1GRQA 3ACDA 5EAIA 4OHYA 2O2YA 1U99A 3KC2A 4XTRA 1DFGA 3AOGA 4JCCA 3OQJA 4XA8A 1R15A 4D8XA 2RHMA 4RTQA 4L0MA 1RC1A 4B73A 3AKZA 2ATEA 2B1JA 3PVZA 4OG2A 1TLFA 4WEOA 5DXAA 5CB6A 2ZIFA 4IUCS 4URVR 2ZVJA 1JILA 5CYOA 3SQNA 1FFXB 4BBAA 3FROA 2Z30A 4R2WA 2M6LA 3LUCA 3AERA 5L8VA 5JMPA 1ZX1A 3M3DA 3HEBA 5A04A 2AR7A 1NBMD 3VH3A 3FGPA 1L6RA 1K7SN 2AA3A 3AV3A 3O4IA 3R6WA 4M0FA 1JTEA 3PUJA 2LR0A 3WBBA 2JAWA 3ZWXA 5DYWA 3BVPA 4N3BA 1AVTA 3G2QA 2ZBQA 3PEEA 1L5KA 5AW2A 4UOQA 2E4ZA 2XCLA 2Q9CA 4B4KA 2A2ZA 5AW4A 4XXHA 3I6IA 2Z8YM 3TTVA 1GKLA 1ZC4A 3MPUA 4RV9A 2FW0A 4BNKA 5GV7A 3EQ9A 3ZZTA 3MW8A 4JJKA 4Z6KA 5B7GA 3AEQB 2WIAA 1NJ6A 4WK6A 2GUWA 4HSEA 5TNXA 3T9DA 1NNLA 3P5BA 1QIGA 2R1VA 3QXJA 1AZWA 3SKYA 4N54A 4MVJD 4O1HA 5E1OA 5DXFA 1QO0D 4FEYA 1X7WA 4Q1FA 5C1OA 2VTBA 3OSZA 1P8AA 3X1XA 2CBXA 4DMKA 1DBSA 5CB0A 4CF7A 2BY4A 3TI9A 1XLUA 1YC5A 3EHEA 4JLNA 5FBVB 5I7WA 1MG5A 3OZEA 2ASVA 3OJWA 5C7LO 3HL0A 1UZLA 4BWFB 2XCOA 4LC1A 1MQAA 1NVVR 2GN6A 3S3TA 4CR6A 4EA9A 4GGPA 1WZUA 1ULBA 1VL1A 3S7ZA 2WWFA 3PENA 1Y6QA 3AEUA 3L7AA 4PSUA 3BQ9A 4BKUA 2C29D 1FFHA 4G8JA 2IF0A 3WFZA 1BN7A 1NBHA 2ORIA 2FWIA 4OH7A 4BQRA 4NG5A 2AS0A 5CG1A 1J9GA 1JDZA 3GBVA 1GTZA 3EMDA 3S5JA 2QW8A 4MS4B 2CV2A 2QRZA 1P5FA 2OYRA 4Y6PA 4GBGA 3ZI7A 2ZI6A 4YQYA 5HG0A 1KZGB 1VHLA 1CY1A 1MF7A 1Z33A 3H19A 5JALA 1ORIA 3BK1A 2YBDA 4DV2B 5BW5A 3FWKA 4FNOA 5JY1A 4DR1B 3WJ7A 5JAHA 3AVVA 1MJHA 3B1YA 2PZAA 4ZXFA 4YAIA 5JE8A 4H7HA 1ZSNA 2V7EA 1XLTC 4ZVTA 4UEWA 4N7JA 3S99A 4D0GA 4DSZA 2LIVA 1BD3A 1QBKC 4CMIA 1Z45A 4QFBA 1NQVA 3KUCA 2KS6A 1HK7A 1CZKA 1ZY2A 4U39A 4LFCB 1L9KA 1O1YA 1SH7A 4AXXA 3BIFA 1Q2UA 2AFHB 2R11A 3PNOA 2YZMA 3PE4A 1F1BA 2C2KA 4HYYA 4J49A 1ABEA 1NBEA 2RB5A 1P3DA 2WU1A 4EY3A 3RIHA 4TTSA 3TEMA 3GEHA 1FFCA 2IKQA 4OMUA 4EARA 1SY7A 1ONSA 2OV6A 2VK1A 3GJZA 1TZKA 1RZRD 2BJVA 5KAPA 3EBOA 1RACA 2JASA 1E2DA 2GJ9A 3NVDA 2C5EA 2ZBUA 4HX9A 4AN4A 2I9PA 3OF2A 2HH9A 1CUVA 1L8AA 2ILVA 1AMUA 3QNWA 3W6PA 1ECGA 4AI6A 3QKSA 1WABA 1A77A 4CG3A 2Q4TA 1RZVA 2QMOA 3C3XA 3IXLA 2ZIAA 1MJGA 4BXOA 3EXG1 1AZLA 2FEKA 2Q0HA 5TGTA 1JEJA 3DV0A 3T9AA 1W0KD 5HRUA 5A4MS 2PANA 3ZLVA 4URHA 4CT5A 1IZZA 2GNPA 1BU8A 2MSKA 3SZ3A 1ODTC 4X0EA 1M1YA 1HTBA 4QU8A 1EWRA 1K4MA 3WK4A 2I4IA 4J3FA 1RQLA 4KFRA 1MO5A 1VE3A 4MAFA 4DYDA 2ZT6A 4W5OA 5LSAA 2WSYB 4RA9B 3ETEA 3UJNA 4R41A 3WLIA 1RTTA 2J3QA 1NXPA 1UANA 3TD2A 4N3CA 4JLWA 1RKVA 2VAPA 3RASA 3BUSA 1Q77A 5LN1A 2HDOA 4IKOA 1MV8A 4HZGA 4KXQA 1UWVA 4MQMA 5EMMA 4EQ6B 5B57C 3FOFC 5ALGA 3HA7A 4PTYA 1U4SA 3RRXA 3BWEA 3OCJA 4C4YA 1SK8A 3AVOA 1NFFA 3OIFA 2YHIA 1TUBA 3KP1A 5ELMA 3LPMA 2P3LA 2Q49A 1KYXA 1Z3IX 3AONB 2OZLA 2ZR8A 4BTLA 5DNWA 2GKSA 2YW9A 3ETNA 5B1IA 1CB7A 3UHFA 1D2GA 3KJGA 1P5JA 1JIQA 4RJLA 2I1VB 4HR7A 2ZXUA 1E77A 5KVQA 2C98A 2A94A 3WWZA 5JNLA 1MX3A 2V55B 3IQZA 3WK7A 4GWGA 5AQ1A 1GNPA 2ZDHA 5GOZA 1K6EA 5F2EA 3G0GA 1JEAA 1EGQA 1Z7BA 4BC1A 2XMDA 5KJCA 3R7BA 3DXYA 2DTXA 1S4MA 3ABRB 3G17A 2B4YA 3DHYA 4UVDA 1OYOA 2X0NA 4PHFA 1AGRA 5EIFA 3SM3A 3W8NA 1LNSA 2VRNA 2EX1A 3D6JA 4AD8A 1IY2A 2V59A 3G89A 4OIMA 1AQIA 3MWKA 5TPZA 1DT5A 1VCMA 1YR9A 4HS4A 2F90A 1I3CA 3VGPA 2SHKA 1Z5ZA 5LJLA 3ZZMA 3JD0A 1UDCA 5D7BA 1E9CA 2HRRA 3E4CA 3OG9A 1BMFD 1FTGA 1H65A 4TGLA 4EGAA 2PUEA 1V1MA 3UKJA 2IY9A 3AU8A 1G2OA 3I2FA 3BWXA 3FYUB 2HF9A 3M6VA 4XZ3A 3VYSB 2DQKA 4CRWB 2X19A 3WWDA 5BY2A 4B34A 1F20A 1IK4A 5LXTF 3ZWDA 4EG5A 1P33A 4GVPA 2D5BA 1VYTA 2HHAA 4RNDB 3RS0A 1RNLA 3GP8A 2D7JA 3HCWA 3TUTA 1ENPA 5IKEA 1RWWA 4Y18A 5DM70 1L3BA 5G0VA 1O0CA 3DEAA 1S01A 3DFKA 3U4DA 1WMDA 2JIDA 5GONF 3UB3A 4BUJA 2P11A 2C3OA 3N8IA 4TZKA 3V7FA 5LXTB 5AOCA 4ILEA 1EB9A 1FEZA 1JIUA 3LW8A 4NYMQ 3OJXA 2H92A 1GLGA 2KJQA 3P5SA 1EMDA 3UB4A 5A6SB 2UZ0A 3KQHA 1YC2A 3E1SA 3HP4A 5GAJA 5T4HA 4CKZA 2ORYA 4IOLA 4NONA 4D9NA 5GONB 3WAKA 3C7DB 4I3GA 4R2MA 1QH1B 4B4DA 5AXBA 4AKIA 3FKJA 5KB3A 1IMOA 2E49A 2NYAA 3I28A 3OLCX 3B3JA 1EA7A 4I9FA 4PLGA 3UJ6A 2QTWB 3QE3A 5B3AA 2E89A 2I22A 2JD0A 3IRUA 1JG6A 2VPWA 3R9IA 3S5UA 4B81A 4URFA 1RRCA 4DDKA 5T8KA 1D2HA 5IUNC 2I3BA 1WMBA 1XTJA 3P20A 5FO1A 3L06A 4IGFA 4G0OA 1T5SA 4M8SA 3PPXA 1KO8A 3KSUA 2EJBA 4XUDA 3R5JA 3EH1A 1JQJC 4PR3A 2PZMA 2A3RA 3D0OA 4MUKA 3NIGB 4IIUA 2Y1DA 3SYRA 5FFFA 4NXMB 4O08A 3I83A 3I8OA 4G85A 4WNCA 1I5EA 2P7HA 4JL8A 5KOHA 3I01A 2DBVO 4BVHA 4BLQA 4DJAA 4DLYA 5GINE 1X8XA 4X6XA 2CUZA 4ER5A 1HYQA 1L7MA 1TO6A 5A3RA 1CY6A 1GUFA 2QL5A 1VKHA 4LJYA 4BVFA 3BTOA 5LWQA 4OH1A 4RC9A 3QIAA 3UOGA 2H63A 2PKQP 5AVJA 5AVKA 1A9RA 3OMXA 2XVYA 5CCBA 1J23A 2WQ7A 1I24A 1P7PA 4JBWA 3K70C 1RI3A 1SBIA 4DLNA 4PG8A 4ED9A 2ATCA 1ECCA 2WSMA 5HF6A 2HM7A 4MX8A 3KBBA 1WPRA 1AHNA 5IVDA 5DVZA 2XXBA 1NBOA 1A88A 1O95A 4JYBA 2X9NA 4NVRA 3U4HA 3W2FA 1E6MA 1MAUA 4XFKA 3EPKA 2VP2A 1T3TA 4PINA 2J59A 1JAYA 2YMLA 3GL9A 1NYRA 1UBMS 2MHCA 3P9RA 3PEUA 3ZLJA 1WPXA 4RTLA 2FFJA 3NAQA 1MOPA 5EQDA 2IUEA 1GPBA 2O0LA 2WUDA 3T1VA 3UT6A 2C58A 2PK3A 4LF5B 2ZZMA 2VPPA 1CYDA 4U7HA 4JGGA 2CJPA 2BLLA 1W88B 4BMOB 3KHKA 1UAGA 4I6GA 2D13A 2ZB8A 1E0JA 2HI0A 4W5WA 5TR9A 3PGLA 3H4IA 3IAS1 1Z26A 1T0IA 1PEDA 4ZVVA 4HB0A 4XIFA 1UFOA 1RLJA 2FMUA 4WZAE 4DT1B 1PW7A 3GYBA 3ZE6A 1RI5A 5IVHA 1COWA 2HBQA 3C6ZA 2WI8A 4J7AA 1DUVG 1KK1A 1PZHA 2VDVE 5SICE 4IYRA 3U0BA 4BN4A 1WTCA 5K0GA 3LIIA 4H4EA 5C8VA 4DE5A 5MN6A 1EK6A 1R9GA 2BGLA 1VI6A 4PC2A 3UQYS 5BN3B 3D7MA 2IE0A 1DE0A 3SN6A 4UTVA 5DSZA 2V7GA 1M74A 2FX5A 3OCCA 4ARAA 5LMUB 4PX9A 2CFIA 4RIIA 4WUTA 1T2AA 4Y0VA 4CTOA 5EIEA 2DY0A 4NZMA 2IYXA 3NYQA 3BA6A 1V96A 2AQIA 2YWJA 1KZ6A 3IUYA 5H0IA 3WHPA 5B6JA 1Z15A 4M83A 3DZFA 5D3MB 4QVIA 3G6KA 1ZUD1 4CDGA 2PRKA 3QFCA 5ALEA 1ZN7A 2IOFA 3WK6A 4C0JA 4CZ2A 5EI5A 3WICA 1I5RA 3F3MA 5GVRA 2LVBA 1S2MA 5BW4A 1W6RA 3CW9A 4EY4A 2QMQA 3OUUA 4KQEA 3T95A 1SKYE 3DPSA 4BLVA 3OURA 4UATA 1JZSA 2VCEA 4KO8A 4M60A 3CUUA 3VI3B 4O2AF 5TF4A 2CVQA 1T9AA 2G7ZA 1ZA2A 5AW9A 3IC5A 5M34A 1XEFA 3O8LA 3FOAA 3TUZC 5FPHA 3UJ9A 1V11B 1Z74A 1JDVA 2V7QD 2CNDA 1X0XA 3Q40A 4M2LA 3LPCA 1UJBA 3FM9A 4LN1A 2ONCA 4M89A 4TWIA 1Y0BA 3TLBA 3NVMB 1T1JA 4O2AB 3INTA 2Z2IA 2OG2A 1IN7A 3W5SA 1MVOA 2WP0A 4A10A 1XZKA 3MSXA 3BKWA 3AB7A 3DNMA 3Q5GA 4C3ZA 5JANA 3ET5A 2E4AA 3K8ZA 1KFEB 3IKJA 3LZCA 3NDJA 3QTBA 4NCJA 2X0KA 1CKEA 1KFJB 5CVDA 1NVGA 2BPOA 4JJ6A 1JIXA 3OKAA 1NXSA 3GQVA 2WFMA 3TVDA 2LWIA 3D4BA 3MGKA 1IHPA 4RQAA 4BE7B 5EINA 1N6PA 3VR6H 2VJOA 4DQVA 2ZCVA 1Y4ZA 3GRYA 3VDXA 1L4BA 2IEGA 1V3TA 5BUSA 5IF3A 1P7CA 2IY8A 2AE2A 2Q1TA 2VJPA 3I9NA 3OQIA 3I0ZA 2Q1WA 4U2KA 4D4JA 1TTTA 1FF9A 1NU6A 4ZIRA 1K66A 3RV3A 4RXUA 3O1IC 5HF9A 2OKCA 1WL8A 3EYWA 1H5QA 3GO4A 3KJQA 2FEMA 4BJ3A 3KKKA 3DZ5B 2EJVA 3AIIA 2ZBGA 2Z5GA 1RRKA 3JQ8B 4M4SA 3ZNOA 1LI4A 1XNJA 1GNVA 2BFWA 3WQBA 2Q4DA 1SK9A 2Q5OA 3PX7A 2XNHA 1PSZA 3MIZA 4TV9F 1CZUA 1G2IA 3RSZA 1R6UA 1W1WA 1ZGJA 4HZIA 4M6WB 4BVKA 4E21A 1IH8A 1UBNA 5LLDA 5J23A 1GCIA 2F8SA 3VO1A 1A7KA 1N6IA 2VBIA 3EYAA 3GMIA 1EXNA 2H5IA 1WUTA 2KLBA 2QPLA 4GRIA 5FUYA 5B4VA 1R8JA 5BR1A 3CLRC 2H00A 3UA3A 3KO8A 2O8VA 2VZ8A 2PMFA 3L7KA 3O3OB 4JSYA 4QYTA 1EM8A 1BDJA 1JMVA 1QQ7A 5BYBA 1JE1A 4LHYA 3V00A 3C3WA 3D3WA 4L7QA 4W6QA 3LDFA 3E0XA 1T4MA 5EIAA 2XQIA 3MG9A 3TINA 5A4AA 1N4DA 5JC8A 2MMGA 1JG2A 2YV3A 2D5CA 3GN2A 3SEFA 3I58A 4DJTA 1Z6AA 2Q27A 4G56A 4MUMA 3NIWA 2X58A 4AG3A 1ZRMA 3ADKA 2NU6B 1SULA 2ZRLA 4YRMA 4D74A 4KG7A 2G04A 1P0MA 2GMWA 4B5LA 4D8YA 4Z9FA 1IZ0A 4DRXB 2IP4A 3HBFA 4F4HA 1Z5VA 3O0TA 4QUIA 3SE0A 5A0VA 2I2XB 3AB8A 5JDIA 4IZHA 4ND7A 1XCOA 1ZFNA 3N7UA 2YCBA 3R5XA 4KUEA 1LWNA 2A9KA 1SOWA 4G63A 4RKYA 1ZSVA 5DWDA 4ZA2A 3LVBA 1J5EB 5A02A 2GFIA 3HO8A 3UMVA 4RAQA 4C4RA 1ODLA 4L78A 4M54A 1JEOA 5FPSA 1C29B 5EWJA 4QRIA 2C3PA 4H7IA 1RAHA 1GA4A 3O74A 4AQ7A 2PSFA 1NRJB 1UXOA 4K9RA 4RVDA 5C4GB 4OGKA 3CPJB 4NCIA 1ZIXA 4NRDA 4KLRA 4BX8A 4LYYA 2ZKLA 2RJ3A 3OZWA 4R1PA 3UV7A 3SVTA 4EABA 1RHUA 2QS9A 1DTEA 1QPZA 1ZEJA 5AKLA 3IEXA 1KMHA 3OOSA 3D31A 4K9LA 4OFXA 3U56A 1C4XA 2PGIA 4P3KA 1JLMA 1M72A 4GXRA 1XCJA 5T73A 4GC5A 1UDWA 5FBHA 4M7PA 1FDWA 3RNOA 1T15A 4BQOA 2E5FA 2J87A 4CKWB 1IBSA 3TX2A 1EFCA 2EQ5A 3WNBA 4NJMB 4IG9A 4AWBA 4FQ7A 4ND1A 2C3UA 4E30A 4DDUA 4UNRA 1N57A 3AWIA 3E4DA 4KAXA 2WTNA 3IA2A 4NOKA 2PRZA 3T0FA 4F04A 1H85A 2JCSA 4UMEA 2A1TR 1JVSA 3H5LA 5C80A 1QG0A 2Z9BA 3VH2A 1ZKDA 1QVRA 1KSFX 1XVLA 2GJ8A 3BH7A 3ROQA 5DWQA 1Q1NA 2P68A 1P62B 4HVAA 3NKLA 2WE8A 1PL6A 2GPJA 3D54D 4KI7A 2YHBA 4QUJA 5K9ZA 1ORDA 1OV4A 3Q6IA 1YJ8A 1UPXA 4ZMSA 2ZRKA 3OCYA 3AR4A 4G0QA 3HP1A 4HDKB 4KMRA 4ZJPA 4DUZB 3H18A 3SSMA 2XXJA 2Z2JA 4GNRA 2OILA 4P53A 3J81A 4ROSA 4KDFA 4OGGA 3N7TA 2WKWA 1QCDA 4LVNA 5ITWA 4CQMB 3DPUA 1OA0A 1RWVA 3R6TA 2DBZA 5DM1A 3EXHC 1OREA 4CYMA 1FFSA 3GH1A 4F3NA 2BFNA 1XU7A 3LCMA 1GNQA 4GLLA 1QHXA 2YJGA 4YJ2A 3U48A 1BC5A 3GJTA 4LF4B 3EZYA 4YAJA 4C4OA 2PXHA 1YBAA 1V37A 3CRNA 3WDKA 2CHFA 4H7PA 3FJ1A 1WDLA 2HMYB 4OI4A 2QJOA 1R9MA 1CP2A 2FWMX 2XWQA 4XCVA 3H1GA 2CXTA 1QV7A 4Q0MA 1YKFA 4IW3B 1Y6FA 3N5KA 3P4UA 4MV6A 2AT1A 4XYMA 3GVCA 2NMVA 2LGJA 4QGAA 2VYND 3N6RA 3COWA 4TV9A 4LOJA 4GPIB 3M6LA 2D8MA 4DQDA 1EK5A 4W1SA 3TQQA 3E2IA 4RK4A 1AN9A 4AW9A 5KX5F 2PY6A 1Z2OX 1P2TA 1YOVA 4XR9A 3WYFA 2VEDA 4F12A 1V9LA 4JP5A 2H4JA 3CZ5A 1X7HA 2Z6VA 2P27A 4HBGA 5JXIA 4ER3A 3HJHA 1U3WA 5AVWA 4PLPA 3Q0IA 3I76A 1SC3A 1HBJA 3U3ZA 3DLTA 1NVTA 3IAM1 3OPMA 3G8DA 3DT6A 3ENZA 4WH0A 4TUYF 1CEXA 2DPHA 4HEJA 4PVCA 4F2HA 2MR6A 5J4VA 3HDQA 3IB6A 4CEJA 3BE5A 3OJFA 2PXAA 2HB6A 1KVRA 3FVVA 5JVDA 2REQA 4LI3X 2RHJA 2PBRA 5CMLA 4KTTE 5F64A 1JN0A 2CXXA 1G60A 2CXOA 4ARBA 2I91A 3CLUD 2HLDD 1N5IA 4WA8A 4UXIA 1VFNA 1EFTA 4OATA 2C4KA 4TUYB 3QMPA 5EIWA 2NUAB 3I5YA 4RWEA 3VZRA 4G25A 3E0QA 2ZWPA 4CCSA 4HGNA 2PYDA 4RUKA 1Y33E 2LD4A 5FPPA 1JDPA 4BVBA 3NOVA 5F5XA 5COQA 3WDMA 5F9FA 4B32A 4B6FA 3F8SA 2B2CA 4D9KA 3EZ7A 1U8AA 2QDKA 2ZSKA 3IAXA 4RHEA 5LP6F 4NMLA 1J0CA 5EXEA 4ZCSA 4OOFA 2D8AA 2X77A 2GRAA 2JCXA 2WVHA 3A1NA 1B1AA 2GPWA 4O25A 2QVBA 5KWIA 1EUDA 1Q0ZA 1XRLA 4RIEA 4TTVA 5EXPA 4N40A 1SBYA 3U0VA 3O8OB 4DRYA 1DS6A 2WAMA 5THQA 3LC1O 1LDMA 2ZPTX 3RFTA 3W7VA 5LP6B 1AM4D 1XZ8A 1F17A 4QT4A 2YXBA 2ZRNA 1QHHA 3OLXA 5I9IA 2GYUA 4GRAA 2H4XA 3IP9A 3TLAA 1E1RA 2YR0A 3EZ2A 5A7HA 4P31A 5FWYB 4YT5A 2YQ4A 3VAYA 3FVTA 4EFMA 1HL7A 4QC2A 1QTNA 1RQ7A 3ZIAD 4D92A 3B3GA 4R8RA 2FR8A 5K8LA 3GUCA 3KG2A 3K9WA 3P9IA 4XDGA 2Q0QA 1O94C 1V1RA 3ILHA 3ME5A 3SX0A 1J97A 4BO4A 4RM2A 1AQLA 3B5IA 1EUQA 5D6OA 1PQYA 2FRDA 3WV4A 5EUQB 4RTMA 3CPEA 2YRWA 3OOJA 4I46A 3IALA 1UXGA 4QEKA 3QU5A 3OZDA 1VL2A 3JYNA 5FTKA 3EC2A 4MR7B 4R0MA 1OD6A 3CIOA 3N86A 2B1IA 3ZDXB 4PCUA 2IZ6A 4D43A 3HKCB 1WX1A 1TFUA 4FCVA 1PLKA 3VYUB 2WAYA 1XZDA 1SVKA 2AJTA 4IJKA 3BS4A 2I4TA 3DCNA 2ZQ5A 1JW9B 4C7KA 3GAFA 5IJXA 4CFSA 5L9AA 4DV0B 3QXHA 4MR9A 1Y8AA 4DUYB 1OX4B 2WMNB 2AL7A 1SC6A 2FPNA 3A27A 3MUNA 3RYCB 2WMOB 1G8YA 2R1TB 3IULA 3K15A 3C3AA 3MWEB 2KSQA 5BSGA 1EP1B 3HFGA 2B1GA 4KGXA 3ZCXA 4XB1A 2CXNA 1SRRA 2I1WA 4NJEA 3TYXA 4BMNA 5C2JB 1PJCA 2CV1A 3HY6A 1R6BX 3FLEA 5D51S 2QLNA 2ZYVX 3RIYA 2P5YA 2JIBA 4HGRA 4R31A 5EWLB 3AFGA 4E70A 3GD5A 4H6PA 3CQ9A 3DAPA 2WF8A 3TLGA 5HEKA 1LB1B 3H6KA 1C0LA 3TIVA 1YJXA 3ETGA 5ITZA 3QGMA 1GCOA 5FTLA 5B3LA 1IULA 1U28C 2BGNA 5EJ9A 4QG3A 1G9XA 5CDFA 1KH1A 5KI6A 1L5SA 1YCHA 2VOEA 2ZYAA 1E2IA 4WESB 5DM60 5JXWA 1KPHA 1GFZA 4RY8A 5GJBA 2BFOA 3L6EA 1GU7A 2W98A 1XTUA 1U7XA 1RXWA 2QE6A 1DG1G 1GN9A 1NUTA 2GN0A 3VU9A 4J0IA 3VX4A 1J0DA 5LUBA 4BNLA 1USGA 4EOGA 2DPGA 3QWAA 1NDQA 1PEKE 3CX3A 3CN7A 1IMJA 1NHWA 2W6JA 3PUKA 3NDBB 5E3JA 2ZAYA 4UUBA 2BFFA 1DOZA 4LBZA 2R66A 4GI2A 3F1LA 3TNYA 1TZCA 3QXGA 1NN5A 5AUNB 1HDEA 3AVXA 1GY8A 3I3OA 1X74A 5FCDA 3FDZB 1U3VA 1PX0A 4JMPA 4MKGA 4XB6B 2HCTA 3SC2A 1DINA 1AK2A 3KOZA 3TSCA 2ACWA 4GLFA 1CRLA 3HCEA 4OHPA 1QZUA 2GEJA 2Y1XA 2H1HA 4EF5A 1NT4A 3GOQA 3KPUA 4OL9A 4PQYA 1PGPA 3SI7A 3AHGA 4DQKA 3BHIA 2OXRA 1KAGA 4LE2A 2GEDA 3CEHA 4RVFA 5TIIA 4F46A 1GZVA 4HN4B 1DO2A 4ZHQF 4B8WA 2HU7A 3C97A 4KWTA 2DSNA 5EZYF 4BY9E 5B2EA 2RK3A 1T5TA 3R44A 4XYLA 3RADC 2F9LA 3IEKA 1SB8A 3H65A 2FPGB 3AG5A 3HADA 3JD2A 3N2EA 3PRKE 4Q05A 4GM0A 1P77A 1CZHA 3GLVA 5L45A 5KOJA 4XDYA 1R18A 1RKUA 2PZBA 5BWCA 1TUEA 4ZHQB 4IFIA 3S8MA 5EZYB 1CG6A 3DBRB 4UVEA 3H0WB 3KWLA 4YJFA 3CMMA 1ISPA 1I4EB 3WP1B 2W2XA 2ZSJA 3HDTA 4MP3A 2I2DA 4QDTA 4XQCA 3KQPA 1JP7A 3OJ0A 3PHLA 3KQSA 1KDPA 1RXEA 1KGDA 3AP3A 3ABZA 4KYUA 3IOMA 5FLEX 2VRBA 4RE5A 2C31A 3WVNA 4JI5B 4DWJA 3T0IA 2YYSA 1W6UA 5EEGA 4DR2B 2GSWA 4MV8A 4WK0B 3AUJB 1D6JA 1IOVA 4FE4A 1GZ4A 3D59A 4RY2A 4TSFD 3BMQA 1QRRA 4QU0A 4Z7NB 1X77A 1ZPDA 3K6SA 3MSCA 3FVQA 4X8LA 1EDEA 2ID7A 1PW5A 3BAFA 3VVBA 4ZVNA 4BGDA 4L8FA 4ND2A 3LUGA 1ZK2A 2V7UA 3EGDA 3ANNA 4ARCA 3FCYA 2DUMA 1QNLA 5L7TA 4RACA 1G7TA 2WM2A 4MOWA 4LQCA 3AVWA 3PUZA 3LGXA 1C0KA 3RK4A 4EX7A 3WY9A 5JT1A 3RVNA 1OROA 5CVCA 4AMBA 3Q7PA 5ELXA 3TQIA 1A5TA 2V9PA 3HVKA 4C4SA 2WIKA 3GT0A 4XFJA 5HKLA 2J3JA 2K5UA 1ETHA 4Y2GA 3UNXA 2VHVA 2IU6A 1YUMA 1ZM2A 3D3NA 4RH0A 1E2NA 1DX4A 5CGZA 4YIKA 1YGYA 4QEDA 3TSAA 3AHIA 5JSZB 1QO9A 1WD5A 1LEHA 3UUWA 3CXRA 4J07A 5FKJA 3VNSA 4GH5A 3ONDA 4RABA 7MDHA 1NSFA 1L0BA 1QHEA 1STOA 1TUIA 4L9SA 3STVA 1XKQA 5FV4A 4BZPA 4EY6A 3LT4A 3RKRA 3ZHRA 1T9CA 1MU0A 1RJDA 4P3PA 4C22A 4H1VA 1ZZEA 4K3VA 3RUEA 4EJSC 1IB6A 1RE0A 5HS4A 2GPYA 4UNSA 4KYVA 2A35A 3JZMA 4ZZ2A 5ALPA 5JPIA 3VR6D 1ZHHA 1ZM9A 5F78A 5LP6A 1D8AA 2E6UX 3VZPA 4YLGA 1KVSA 1RYYA 3QVTA 2O07A 2ZSFA 2J3HA 3K4HA 4MZXA 4O4HA 4QOSA 4D97A 2XUQA 5C1DA 4WLUA 2Q6VA 5IJ9B 3KOYA 4FR5A 3T4EA 4ZXPA 4G81A 4QRDA 3ZGNA 1EZ1A 1RI1A 4EVRA 1ZRHA 2GZRA 4K86A 5E7QA 4KQCA 2R00A 2O2IA 2WA2A 4CV1A 5JAUA 1LFAA 2AUMA 2PWYA 4RQTA 3K5HA 4HQRA 1CVLA 2HQSA 1SIWA 2BRUA 3WQQA 2VXBA 1FXSA 4D82A 1NY5A 4D3FA 4E07A 2PNJA 1IWBB 4XDHA 2H3EA 2HY7A 2Z56A 3GCDA 4YLEA 2C00A 2AJ8A 5A0TA 5CD1A 2ZZNA 1CY7A 2W00A 1VKZA 2J85A 2A59A 1N3IA 2HMSA 3T1OA 3U3MA 3F5FA 1SZCA 1E5XA 2W6NA 1E1DA 4CKEA 2E4WA 3QLVC 3GF4A 1WD7A 4G2NA 4L95C 4TXMA 4TM8A 1F2TB 1OZFA 1YR2A 2PQ6A 2EOAA 1Q2XA 2ZSHA 3QV2A 3UKOA 1HE3A 1PR2A 1YI1A 4P7GA 5HJ5A 2IIBA 4A1OA 1GAWA 3DBHB 3JYHA 2Q0SA 2HWUA 3LKBA 2TMKA 2YXNA 3WOHA 3TJZA 1H0SA 1N6OA 2VCHA 4CMKA 2HSJA 2FFBA 3NQ41 2CLHB 4HH3C 4LJAA 2UZ4A 3E18A 1RWQA 4XJTA 2ZUFA 2EKPA 2C2XA 2VUSA 5B2ZA 2ZBRA 3T9EA 4HDNA 5DTMA 4OJMX 4D44A 4FW8A 4NSNA 3OQ1A 3CVUA 4FD3A 1A5SB 1T1GA 2AKYA 3VV2A 3VTAA 3ZJVA 3N58A 3WO1A 1IOWA 3AR2A 3KFXA 2Q5LA 1UBJS 4WCFC 2Z4SA 1DZ3A 1NJGA 1QTQA 2PSEA 4XIIA 3W7BA 1VMIA 4PC6A 4H77A 3BZUA 4GPZA 4TYQA 2VJMB 4MQEA 2P9HA 4UAVA 5CX1A 5JCZA 3QKUA 5BOVA 5L95A 5FULA 3EGWA 1UBRS 2B1RA 5FR2A 3ELYA 3GT3A 4Q9DA 3TDMA 3IA7A 4R01A 2J0UB 3ACCA 4FYIA 3HC7A 5SYNA 2J6IA 4CM8A 3R4CA 2P1ZA 2P2NA 5DN9A 1BXGB 5DEOA 1S8AA 2IEAA 1TT5A 1J8VA 3FUXA 3LHKA 2FZKA 4LBWA 4RZ2A 1VKRA 1JKJA 1QIJA 1H2AS 4JVSB 4D26A 5IM4F 3ZXIA 1YK0A 1H5UA 1W2HA 2HBZA 3OY2A 1DBWA 1MRSA 2VH5R 2W2KA 4I1VA 1SM4A 4F4JA 1L5FA 3W8DA 1Z4PX 5E1BA 4X1YB 5B55A 1WOMA 5AMXA 1WXEA 3BGVA 4OFWA 5JYDA 4DGSA