1PQPA

Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
371
structure length
357
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNSTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae rd
molecule tags Oxidoreductase
total genus 118
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1pqpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pqpA01
3PJGA 5A9SB 4NU5A 2OHXA 3A1NA 1ISGA 2CZCA 1B26A 3ROPA 2H9IA 1XQ6A 1H94A 1PS0A 4MKRA 1ULSA 3ZHXA 4IMPA 4N54A 3F4BA 1QYVA 2H5LA 2OORA 4BGVA 3JYOA 3W8DA 5JYAA 2DBRA 3EGOA 4H7PA 4JCOA 2FPGA 2BGMA 3X2FA 3MEQA 1ONPA 3M1AA 4ZJUA 1N1GA 2ZTUA 2O4CA 2XAAA 3R3SA 4FBGA 3JQBA 4D42A 1HDXA 2Q49A 1SEPA 3TZ6A 1HEUA 2YYYA 5COBA 4PRKA 1HDCA 3V5NA 3ZCXA 2QYSA 3GN1A 1NPTO 3RJ9A 4MKXA 4ZN6A 2CMDA 2C29D 4WASA 3IIEA 2P91A 3RUEA 2IRWA 1HE3A 3AU8A 4RDHA 4XYGA 2DAPA 3GPDG 2OUIA 3BMOA 4BKOA 4ALKA 1H6BA 1ADCA 1EQUA 1E92A 3PQEA 4N5MA 2EGHA 3ADPA 1LRLA 2VZ8A 3FNFA 2FWMX 2J8ZA 4JX8A 2I5PO 1PR9A 1YJ8A 1WW8A 1YL5A 5JYEA 4R54A 4D0SA 5U1PA 4OMUA 3E9QA 4J6FA 5ILGA 3ITKA 5EINA 3N7UA 2PZMA 1I2ZA 5B12A 1OMOA 4J7XA 1HETA 1UZMA 3PDUA 4XQCA 1ZH8A 4K6FA 5JCJD 8ADHA 2EKQA 2Y1FA 1TA4A 5IF3A 4MP8A 2WYVA 3JQ7A 3K8ZA 3UXYA 2VYVA 2JD1A 3GFBA 3WGQA 4BB6A 2CVOA 3G0OA 4XEHA 1SBYA 2PD6A 1UZNA 2O2YA 3V8BA 3ZV6A 1BDMA 2X9GA 1BXGA 2O3RA 2B83A 1SCUA 3DOJA 3GNTA 1HT0A 3M1LA 3N74A 5TRTA 1PJ3A 4I1IA 2Z1NA 1QORA 2GRAA 1PEDA 5F1PA 2NU6A 1NXQA 2XOXA 1QYXA 3DZBA 4KQXA 4KUEA 1PL6A 1R4MA 3MZ0A 4UREA 3CPSA 1F8GA 4AJ4A 3K9QO 3VOSA 1PZEA 1PGNA 1Y8RB 4PG6A 2HUNA 3F4LA 5TIIA 1GPDG 1NAIA 1P9LA 6ADHA 3ZWPA 2X0JA 1LA2A 3IS3A 4O5OA 4UUOA 5AXBA 4E5KA 3EY4A 3I6IA 5B4VA 3EHEA 1PS8A 1PZGA 2AQHA 1JVBA 4WUVA 1QG6A 1YE3A 2YFHA 4YJHA 3BTSA 1AUPA 1U2GA 1IPEA 3U4IA 3F1LA 4DMMA 3D0OA 5IXSA 3JQ8B 5F1OA 1GQQA 1EUZA 2HMSA 5CP8A 4IXTA 1YB4A 3LC2O 2EW8A 3PFWO 1MX3A 2R6JA 3DFUA 5FYDA 2NVWA 2AQKA 3E48A 4E30A 3EAGA 4XYBA 4UUPA 1P33A 4NR0A 1LU9A 3MJVA 4BIIA 5F5LA 5KKAA 3WLFA 1M76A 1C1XA 3PJEA 5C5IA 2OBNA 3VZPA 3NV9A 4WEQA 3CMMA 4PLGA 1MGOA 1KEWA 2ET6A 4DXHA 2DBVO 1I01A 5HA5A 2BFMA 4RQTA 3BTVA 3D3EA 2NTVA 4HP8A 4KP7A 1DLJA 1Q0LA 4I08A 4Q9NA 5FEUA 2EWMA 4J2OA 1GYPA 4DPKA 2ZB4A 3E6AA 1ZK2A 3OICA 1U9JA 4J49A 3E82A 3RROA 4L8VA 2WSBA 1DC3A 2Q99A 1XCBA 1O9BA 3DZIA 3QWAA 4FFRA 4AFNA 3JQFC 4YPOA 2YV3A 5I9NA 2PD4A 4Y98A 1O6ZA 1U8XX 1HRDA 4D3DA 3WB9A 4YAGA 3QJ5A 5EIOA 3JV7A 1VSUA 3OP4A 4ID9A 5CEEA 4ALMA 2AQIA 2E4AA 3H3JA 4BNTA 4E33A 5IZCC 2JHFA 4R69A 5A5FA 1HF3A 4CM3A 5KJFA 2FPIA 3F3SA 1EUCA 1U5AA 2CDAA 3QWHA 3WNQA 1LX6A 2GO1A 1LBEA 1UDCA 3OEWA 3F1KA 4OKNA 3IC5A 4YQYA 5AYVA 3T4EA 4BO7A 4E31A 5CDUA 4TKMA 2AHRA 4YCAA 2JFGA 4J3FA 2BELA 3COSA 3UGKA 3VPXA 5KNLA 4XIYA 3PP8A 1YKFA 1H6CA 2PGJA 2NTJA 4GSLA 4OHUA 3TZHA 3OQBA 3WNVA 1PR3A 3HG7A 1VI2A 4BO0A 1ONNA 1R12A 5JAMA 1ISHA 1DRUA 3RFTA 4YRBA 5CEFA 3GUYA 5CPFA 1HXHA 1U7TA 3AUAA 3MOIA 3CUKA 1YQGA 5DNAA 1X15A 4CM9D 1ZEMA 1ZJYA 2C54A 1JVSA 5ITVA 2Z5LA 1Y7TA 1U5CA 2FRDA 2FY8A 4GX0A 3B1JA 3PHHA 4CM9A 3I83A 1N9GB 3P5SA 2GLXA 2YHUA 4CQMB 1EDOA 2RH8A 5G0WA 1UUFA 1E3WA 1CQJA 3BMNA 1K6JA 4R01A 3ZU3A 3ZWAA 1PWXA 5FFFA 4MVJD 1RKXA 3WSWA 5C3MA 2AMFA 3UUWA 1IHYA 3UF0A 3H3FA 3PYXA 1ZSNA 2DVMA 3E8XA 3GLQA 3R3JA 1R4NB 1N92A 3KYCA 4BNYA 5I7FA 4FFNA 3OEYA 1DFGA 4FJ0A 5U4QA 4LISA 4YB8A 3H9JA 4N18A 2FR0A 3D5TA 1LNQA 5HBRA 3W6UA 2HJSA 2Q1SA 3I4CA 5GZ3A 3EW7A 2UV8A 1SNYA 5DZSA 3RFVA 2A35A 5HTOA 2Y0CA 1I2BA 5HRUA 2VRCA 2BH9A 4P4NA 3BMQA 4UUMA 4D0RA 1NNUA 5CDSA 1YH3A 1M75A 4YJFB 3CZRA 3B1KA 4JN6B 4P8RA 3DQPA 4YJGB 4B4UA 5IJZA 2H6EA 3AY6A 4XR9A 4IDFA 4E0BA 3RASA 3C8MA 1A27A 4KOAA 3ZWNA 2Q50A 1FXSA 2P9EA 1FMCA 2EEZA 2JKVA 4XX0A 4ALJA 1QR6A 4ONEA 2UVDA 1XU9A 4WNCA 3OJLA 4OOFA 2HK7A 3INGA 2X0IA 2EJVA 3NUGA 4QECA 4CQLA 1IOLA 3WLEA 3U49A 3PHLA 1BGVA 3LF1A 3P2YA 4NFSA 4ALNA 4OL9A 4J9UE 4RVGA 5JC8A 3I4FA 3TNLA 4YBZA 4MPDA 1B8UA 1LC3A 1UXJA 4DIBA 2V6MA 4K6CA 1HLDA 4RVDA 1XU7A 4WLFA 1RJWA 3S2GA 3TJRA 3WICA 5L7WA 5JY1A 3DL2A 3GC6A 2CNBA 4JIGA 3TDKA 1BVRA 4CM8B 3BMCB 4ZA2A 1J4AA 5TNXA 3ETEA 4DQUA 4I5EA 3LT0A 2A4KA 3IMFA 4R3WA 3K73O 3OA0A 2QIOA 5GZ6A 4URFA 2B69A 4BGIA 3NT5A 1JLLA 1B15A 1LSJA 3UW3A 3JQ9A 3WMWA 1M66A 1YXMA 2EW2A 3O8QA 2X58A 5GMOA 3HDHA 1PQWA 5B1YA 3IDSA 1LJ8A 2EXXA 3W4KA 3K31A 4R51A 1LLUA 4L0QA 3B70A 1DSSG 1H6AA 3DBLA 2C5AA 4IDDA 2VWPA 2SCUA 2O7QA 4CL8A 1E7YA 3DR3A 1KY5A 4AJNA 1LDYA 3T7EA 5A05A 2WWRA 5BR7A 4CM4B 1IPFA 4N5NA 2YW9A 1ZSVA 1WAMA 1DO8A 4NFYA 4TRRA 5KJCA 3WFJA 1KVTA 1WWKA 3P19A 4CUKA 1HWYA 2I67A 3PXXA 2IXBA 3DMTC 1J6UA 1GUYA 1OZAA 5G4KA 4CR6A 4MIYA 5IN5A 3F9IA 1Q7GA 4W99A 3WXBA 2FPPA 3HN7A 2AQ8A 3WYEA 2UUOA 4UVDA 3LC1O 2R2GA 4ZQEA 4TRNA 4UULA 3WBBA 1PX0A 4UAGA 3DZKA 1T4DA 2DTDA 3ASVA 3HWRA 3GN2A 2GPTA 1ZJZA 4NBVA 5JDCA 5L53A 3ZWBA 4BL5A 1D1TA 3FR7A 1GZ6A 5I7VA 1CF2O 1JA9A 4Y67A 2NVUB 4WCFA 1E6WA 3TRIA 5L40A 5F21A 1HYHA 4YWJA 1B7GO 4CUJA 2B4TO 4OGWA 5G4LA 3M6IA 4MVJE 5T64A 5BSEA 3WX0A 4Q3NA 4IDBA 4BNZA 3OQ6A 1GYRA 1KVSA 1Y5MA 2EIHA 3WR5A 4XJTA 1YQXA 2PZKA 4IMRA 5DF1A 4IINA 2JD0A 3NTOA 4H16A 5DOVA 4CV1A 4L73A 4AJ2A 3I5MA 2ZJ1A 3PIDA 1K5HA 4TROA 4Z3DA 4K9DA 3S2EA 1GFSA 4W7IA 4E5MA 3CINA 1J0XO 3WQRA 4AVYA 1H0KA 4R68A 1EK5A 2EJWA 2W4QA 2FSVA 1UXGA 2HMWA 4GGOA 3HJAA 2BI7A 1LDBA 3AM4A 2Y99A 4S1VA 4FCCA 1KS9A 4TWRA 5JLAA 4JJIA 3AOEA 5A9TA 3GHHA 3ANMA 2JAPA 3NT4A 1CRWG 2HRBA 3GVXA 2OBYA 3JYLA 1NQTA 1P45A 3EMKA 3ZDFA 1DRVA 2CF6A 5MGBA 2DPGA 3RIHA 1U7HA 4CMEA 3BTUA 3C85A 4GX1A 1EFLA 4OXYA 2DLDA 3WQSB 2NU9A 4BO1A 4G81A 4Y6SA 1F06A 2WYUA 2J3IA 3WGZA 4ESOA 2VHZA 1HSZA 2ZB8A 2ZB3A 4YR9A 5JBIA 3IJRA 3AY3A 1IY8A 1N7HA 1R16A 4ND4A 3S2FA 4LSWA 3PZBA 3H4VA 2GYYA 1XSEA 1E3LA 2X0RA 1W4ZA 1F14A 1KIFA 1U28A 1Y8RA 2BFPA 1V3TA 1G6KA 3TFOA 3FCOA 2I3GA 5FF9A 2E48A 4N5LA 3GDFA 3H9GA 3WIDA 2NM0A 1QSGA 2Y05A 1E3IA 4WNIA 3HFSA 2J5KA 3W1VA 1KOLA 3ZHYA 3BAZA 1BXKA 4MIOA 4IJWA 4FIZA 1AGNA 1YQDA 2EG9A 1UXIA 3AY7A 3K92A 3JQAB 4IQGA 1GYQA 4RO0A 4F6CA 1YVEI 1V0JA 2RCYA 5TSDA 4EUEA 2PWZA 2GN9A 3RJ5A 4XGNA 5I7SA 3MWDB 3F5QA 1HE4A 4BNGA 3DHEA 4R1SA 4AICA 5I7EA 3ROQA 4CM7A 2QG4A 4II3A 4XB2A 2PY6A 5JC1A 3BYZA 3S8MA 4AJOA 5L3ZA 4RGBA 1Q0QA 1X0XA 1HTBA 1EE9A 3NGLA 1BRMA 4QFCA 4BQRA 2XF8A 1LSSA 5JO9A 3VTZA 3RU9A 3FTNA 4NJMA 1PJSA 4BGUA 1PL8A 1Z45A 1JKIA 2DU8A 2AG5A 2BFOA 2UUPA 3AJRA 4CLEA 3JYNA 1P0CA 3O4RA 1NTOA 2EHDA 5DBIA 4HBGA 4PLZA 4K1LA 3H5RA 2RH4A 5JNLA 2NUAA 1DC5A 1HE5A 5ER9A 1WDLA 4ZU3A 3KXDA 3DB2A 5IDWA 3DEYX 4CPDA 1VJ1A 1MB4A 4IS3A 1DHTA 3W4IA 5FWNA 4AJJA 5C7IO 1MLDA 4R3NA 2GERA 1ZO8A 3HFGA 4Z9XA 4MIEA 3E9NA 4PFJA 3I52A 3KYDA 3ONEA 4KTVE 1ORRA 3KETA 4BNVA 3GVIA 2NSDA 2X7HA 1HDGO 4IJVA 3ZWYA 5JSFA 3IL2A 2V6FA 1ZK4A 1NM5A 1O95A 3NT2A 1T26A 2I66A 4I9NA 3C7CB 5F1KA 2P2SA 1W73A 2YHIA 4B4OA 3QLJA 3IJPA 2GNAA 4WOKA 4EI2A 3DBRA 3L4BC 4RPGA 1K6IA 4RVHA 4TZKA 1DEHA 4UVGA 4JJGA 5JPIA 3RBVA 3HDQA 1YBVA 3ZNOA 1GQYA 3QSGA 3WMXA 3Q1LA 4BO3A 1ENPA 2A9FA 1I8TA 4H3VA 4MVJP 1YOVB 4YAEA 3IP3A 3BHMA 1N9GA 1CJCA 4DGSA 5G0VA 1T24A 4EJMA 4K26A 3RKRA 5AXCA 2X9NA 4HFNA 4O6VA 3GOHA 4WLEA 1GR0A 5TC4A 2DKNA 1DFIA 4GMFA 1D8AA 3AFNA 1TLTA 3VDRA 4CR8A 2QZ9A 4XGKA 1Y8QB 2VOEA 3MJ4A 3INRA 5HWSA 1DAPA 4J1TA 5G0UA 1E1KA 4J16A 1C0LA 3FHLA 4ZQHA 5FI3A 3JD0A 2NACA 5L4LA 2IDZA 3KO8A 3FWZA 4R5HA 2O3UA 1KERA 3AUSA 2Q1WA 2Y67A 1I5RA 2TMDA 1E7SA 4OOEA 4YJFA 1RM5A 4MOWA 3DHYA 3FPLA 2VCYA 1LXCA 4YJGA 1ZKMA 4IZIA 3WDSA 3CH6A 4QSMA 3FR8A 2P4QA 4LN1A 2CVZA 1AHIA 4RCVA 4TMFA 4JBIA 1SZJG 2A94A 3NX4A 5JY6A 3ZV3A 1R0LA 1UJMA 5EN4A 3L77A 3OIGA 3QWIA 4KZPA 4GLOA 1EQ2A 4RVSA 4IM7A 1K89A 1I10A 4DC1A 3OIFA 4RF4A 2CF5A 1W6UA 1K6XA 5I8WA 3OETA 3HUDA 3PJFA 1VL8A 1P1IA 1E77A 1E3JA 1EK6A 4YDRA 3PPIA 4NI5A 4UEOA 3VZSA 2ZB7A 5LDGA 4CMAA 2GASA 1B2LA 3FBGA 5DOZA 5A3VA 8LDHA 1GCOA 2B0JA 3G17A 2OO5A 1XWFA 4QTZA 4FDAA 3O03A 4RF5A 4CM8A 3FI9A 1ZW1A 4CMHA 5CDGA 1A7AA 1JWBB 1U2DA 4LCEA 1AN9A 1ISMA 1LRKA 1GEGA 1T2CA 2E37A 4YAJA 4ALLA 1DIRA 2VTDA 5KTKA 4ZRMA 1OI7A 2HLPA 2HK8A 4BNXA 4G2NA 4CM5A 1ONOA 4ROSA 3E5MA 5AXAA 1ID1A 1T2AA 3CTMA 3W8EA 2B4QA 3GR6A 2VYVD 3ONFA 4JP2A 3GNSA 3DBHA 4E12A 4PZDA 4BNFA 1DBVO 3CEAA 3FNHA 2J5RA 1GEEA 3JQCA 3NDJA 1GAEO 3GHYA 3AI3A 4FJ1A 2RIRA 3A28A 4R41A 1LI4A 1PJLA 1GDHA 3PYMA 3WSVA 4Z0TA 1XEAA 1OC4A 2PK3A 5ADHA 3H2ZA 4ZRNA 4A73A 4BMSA 3JQFA 5G0SA 4DBZA 1WDMA 1Y6JA 4PVDA 3DZJA 3TOZA 3C3XA 3ZI0A 4DPLA 1OC2A 3BHIA 3OF2A 1UP7A 4BO5A 4O1MA 2H1SA 1NHWA 3SLGA 4R1TA 4E5NA 1EBUA 4NG5A 3U4CA 3DAGA 4EZBA 5K9ZA 3E18A 2E6UX 3QY9A 1F0YA 1DFHA 1PIWA 4QFDA 4F6LA 3CMCO 5KJ1A 4Q3DA 2X9VA 3ON5A 3JQEA 1D1SA 1GUFA 4D3FA 3KRTA 5TJ9A 4AJLA 2Q3EA 3IKVA 5T8KC 2D8AA 3H65A 2AXQA 2Y0EA 3PK0A 1VM6A 1TB4A 4BV8A 2NVUA 3JSAA 4PZEA 4GQAA 4BNKA 2G17A 1PU2A 4E5PA 1WDKA 2G5CA 3G1UA 2ZQZA 3LK7A 1FJHA 3SBOA 3RUAA 1O89A 4D7AA 1CIVA 3KEOA 3BA1A 3NJ8A 4OIMA 2B5WA 1B0AA 4DC0A 4IDEA 3U5TA 1PJ2A 1DLIA 3JQBC 5KWEA 4TRJA 1R15A 5K6AC 1UXHA 1H6DA 4A27A 1JTVA 1JU9A 3DMYA 4NBTA 4UEJA 1C0KA 5IDQA 2PKQO 2BLLA 1YB1A 3OJ0A 2JFHA 5EMHA 2I9PA 3UCEA 4IDGA 4TRMA 2IYOA 1O0SA 5ENDA 3JD4A 3KSZO 1GUZA 4BB5A 1NQ5A 4CLRB 4W82A 1ENYA 2PH5A 4GKVA 4HY3A 4GLLA 1BMDA 3MOGA 1I0ZA 3L0DA 1MC4A 1PGJA 3NAQA 4NH4A 1IULA 3VDQA 2B35A 4KDFA 5LC1A 1ENZA 1N2SA 1U3TA 2HMTA 3F46A 4B8WA 1QKIA 1R0KA 2NU7A 3A06A 3UVEA 2E49A 2P4HX 1ARZA 1Q2XA 1MXHA 4ND3A 3RAJA 3PHGA 5EESA 1X0VA 2FR8A 3M2PA 5KOIA 5M6DA 4Q3AA 3PQDA 3QVXA 5DULA 4OKIA 4E2XA 1GCUA 4RPJA 2X23A 1IE3A 5I8ZA 4GVXA 4QO7A 1JDJA 1O5IA 2TMGA 2OOSA 2IXAA 3DOCA 1LQTA 4GMGA 2GCGA 3QE3A 4IJUA 1QYDA 4WE3A 3EVTA 4UVHA 3F6YA 5CG1A 3LVFO 4Z9YA 3U0BA 1PQPA 3ADOA 3RI3A 2BMAA 3GY0A 3AUUA 4FQ8A 3UAGA 2Z1MA 1KYQA 2BGLA 3S2IA 3ITDA 1HDZA 3H7AA 1YL7A 3RKUA 4R1NA 1W8DA 2FOIA 2DC1A 1RM0A 1KVUA 1ZFNA 2J3HA 2PFGA 2D1YA 5EERA 3K5PA 3QWBA 4J91A 3ANNA 1Z7BA 2Q4BA 3TF5A 1JAXA 4CMIB 5TGDA 1UZLA 4AJPA 4UVIA 4YVFA 3UOGA 4IJKA 5IN4A 5BNTA 3RUIA 2VRBA 4Z9FA 3JQAA 2UDPA 3LLSA 2J3KA 2GN4A 1XDWA 5DP2A 4QQRA 4IZHA 4R9RA 3KSUA 4BNLA 1NR7A 3GZNA 4XJSA 1XIVA 4MJLA 2W2LA 2VQ3A 2VRCD 2DQ4A 1U4SA 2VWQA 3SX2A 4R4JA 5C7OO 2OL4A 1NR1A 4QT0A 3ZHBA 5J23A 1RYEA 3SJ7A 1UDAA 3MTJA 2GF2A 1J5PA 2CFCA 4M89A 3TSCA 4D43A 1WNTA 4E3ZA 3RC7A 1GQ2A 5TT0A 1LUAA 1HDRA 5L7YA 4MO2A 4N7RA 3DMTA 3SEFA 2YZ7A 2VWHA 4RJTA 3FNGA 3ENKA 3VH3A 4BVAA 1VJ0A 5IFLA 1HYGA 3SJUA 4B4VA 3JYPA 4XZ3A 2EKPA 1P31A 2EGGA 3NEPX 1K3TA 4RL6A 3WJAA 2Q1UA 4DLAA 4BMVA 4OQZA 5B4TA 4LCJA 1IB6A 1XLTA 4PRLA 1QLJA 4OQYA 4H15A 1E0DA 4Y6RA 5A5EA 2IZZA 4AJHA 1JQBA 4LMRA 1WXDA 3KLPX 4IDAA 4PLPA 3ZNPA 2VYNA 1I32A 3TZKA 1Y5RA 4I9UA 1N7GA 5CHEA 1N1EA 3OJFA 2BRUA 1VLLA 4M54A 2O3QA 4BGEA 4P4GA 1P0FA 3ZWMA 1A9YA 4FFOA 4LRTB 4IUYA 4DBVO 1WP4A 2VNSA 2CUKA 2YDYA 3Q0EA 3A9WA 4FJ2A 4DUPA 3HZZA 4E13A 4ZGWA 2UYYA 1X14A 3G3EA 1ADBA 5H81A 4X54A 1ZMOA 4G5HA 2Y93A 2PKRA 1QV7A 3EC7A 3QIVA 1O94A 1XR3A 4U7WA 4QEDA 1D4FA 3PGJA 4IS2A 5L95A 4NBRA 1ZK1A 2VHWA 1XYGA 3JQDA 4W6ZA 4K28A 2WDZA 3DZFA 3AK4A 1Z73A 2C82A 1QRRA 2X8LA 1B3RA 4W7HA 2F1KA 1JKJA 1A5ZA 3TFQA 2VHYA 1RM3A 3ZWOA 4EW6A 2R00A 3MJEA 4JJFA 1ZBQA 4AJ1A 4AJEA 5T57A 3WOHA 1G0NA 4JBGA 4NJOA 3JQ7B 4EUFA 1IUKA 2J6IA 3LT2A 1GV0A 1MC5A 3AWDA 5ITWA 1DJNA 5L4SA 1SOVA 2A92A 1BW9B 5EQFA 3BZUA 3GDOA 1EUDA 4OSOA 4BO8A 1NWHA 1BXGB 4J1SA 1M67A 3TWOA 4U0JA 1LSOA 2ILTA 1Y1PA 2GDZA 5BNIA 4TVBA 2HO5A 1TT7A 1PJCA 1E1LA 2C7VA 2ZTMA 1GZ4A 3VPGA 1BDBA 1EMDA 3P2OA 2H63A 9LDBA 3ENNA 5KKCA 5A9SA 1UR5A 3TZQA 2P9CA 1H9BA 1JWAB 4HFMA 4BOYA 1ISJA 4GWKA 1EVYA 4I5FA 1IZ0A 2BFAA 4B7CA 2OP1A 2YFQA 4PLHA 3VHRA 1H2HA 1A9ZA 2W2KB 3VH4A 4IQ8A 4NIMA 2Q45A 2O50A 4ZQGA 1YDWA 1X13A 4CMCA 2RHRA 2ZTVA 3C7DB 3UCFA 3GG9A 4ZD6A 4BO2A 4DYDA 3WWYA 3WTCA 1BTOA 3V2GA 1Q7CA 3H2SA 4B3JA 5JMPA 4U5QA 4CMJA 4XCVA 1NFFA 4I9HA 3TL2A 4OYRA 5CG2A 1HKUA 1PTJA 3KBOA 4XYLA 1VRWA 3CKYA 3RBXA 1P77A 2BI8A 4KTTE 1RWBA 2NTNA 4TVOA 4CMKA 3HHPA 1C1XB 1T1RA 3DZHA 2QRJA 3PIIA 3UH1A 1LC0A 4XB1A 6LDHA 5JDIA 2D2IA 2QYTA 3L9XA 1E6EA 3GF4A 4DVJA 4XRRA 4QXMA 4CLDA 5DDIP 1Q7BA 3EK2A 3GGGA 4IPTA 2PZJA 1YJQA 3H5NA 4ZQFA 3BHJA 1M2WA 5JYDA 3E1KA 1C14A 1E7WA 4CODB 2Z95A 3OSUA 4Q3BA 2VT3A 4U6SA 2VUUA 3ST7A 1OFGA 2ZKLA 2OP0A 3GNQA 4ILKA 3WJ7A 2IZ0A 2AEJA 1X1TA 4IY1A 4CLHA 1LQUA 4E5YA 4L75A 3QVTA 4NHEA 4YT4A 3F5SA 4FC6A 3K2EA 3NJ4A 5JW6A 3G1TA 4AJIA 4XRGA 1NASA 1KBZA 4DL9A 5IDYA 4DA9A 2CY0A 4PLCA 4FOSA 2VTEA 3HB5X 1YDEA 3AUTA 2PA3A 3W6ZA 3D64A 4D45A 1KVRA 1Z82A 4WEOA 2WE8A 2X1HA 5JDCC 2WE7A 4W9NC 1L7EA 3RFXA 1NHGA 2YJZA 3I9JA 1NP3A 3OMLA 5G2OA 3OA2A 2EV9A 3INTA 4LSMA 5KJ6A 1A4UA 4FR5A 3GZ4A 4M8SA 4XA8A 2VWGA 1E7RA 4RZHA 3PTZA 2Y1OA 5DCWA 3ZH2A 1FDTA 3ABIA 3TOXA 5DBFA 1EVJA 1ZUD1 1DDOA 3JQ8A 5JXWA 2B36A 3DO5A 3PEFA 1ZSYA 3DAFA 1IHXA 3L4BA 4MVJH 2HAEA 4D46A 5L7TA 4J1NA 3ZW8A 1HYEA 3EDMA 5J9GA 3VPHA 2NLOA 1VE9A 3KZVA 2HU2A 2X4GA 1M6HA 5CDTA 2AW5A 3OQ1A 3QWFA 5JS6A 1E3WB 1H5QA 3BMNB 5TQVA 4B7UA 4B7XA 2PNFA 5DT9A 2Y0DA 1TI7A 4MP3A 3JQ6A 5I9MA 3Q9UA 2W8ZA 3PDJA 1C0IA 4CLRA 1A7KA 1U3WA 1YONA 3LDHA 4M55A 3KYCB 3VVCA 1UDBA 1ZZEA 4FN4A 1CYDA 3ZWXA 4RVFA 4XR4A 3AOEC 4GPD1 2O3SA 1NVMB 2XXBA 4XWYA 3G79A 3T4XA 2HDHA 2JHGA 4FS3A 4MVJM 2C20A 3BMQB 3CZMA 4BKPA 4LRSB 2XXJA 1J49A 1I2CA 3FNEA 3QV1A 4HKTA 4E2ZA 4RORA 4PZCA 4JK3A 3KYBA 1RM4A 2QQ5A 3GMSA 3OJEA 2C2YA 1U3UA 1TT5B 4J4BA 3ASUA 4I8XA 3ZN2A 1V8BA 1BHSA 1YBAA 1UAGA 2HSDA 4J2HA 1YBMA 2I99A 4CLOB 1SAYA 5BSGA 1PJ4A 3FRJA 2C07A 3GVHA 3ZWWA 4EEZA 4XQEA 3RVDA 4DQXA 3TZCA 5BNFA 5KJEA 4GVLA 2X5JO 4NQZA 1F17A 2YV1A 4XKJA 2PZLA 4QUKA 5TT1A 5JCXA 1SB8A 4FC7A 1A4IA 3PLRA 1GU7A 4MP6A 2RHCA 2Y1EA 4J4TA 2B4RO 1LLDA 3AU9A 5EL0A 1T4BA 2ZCUA 2PV7A 3H6KA 3EZLA 3U4DA 1N8KA 2O3TA 3WFIA 5BSHA 1OAAA 2IEBA 4JLWA 4PLFA 2O48X 1JAYA 4DIOA 4WLNA 2NV6A 1JN0A 2IYPA 2WYWA 4CQMA 3O8QB 5KVSA 3ZNNA 2CSUA 2PLAA 1WMBA 4R1UA 4DQVA 1V3VA 2Y68A 4GWGA 4L4RA 4BQPA 3HB4X 1X7HA 3WG9A 3DBLB 1T25A 1ZEJA 1R4NA 3VKVA 2X5KO 2YV2A 1DC6A 1F8FA 4IIVA 3Q11A 4ZVVA 4CV0A 2JAHA 1E3EA 3WS7A 2Q46A 1O8CA 2JJYA 3Q9NA 4L9RA 3GAFA 4Z0PA 2Q22A 4HV4A 4YXFA 2FR1A 2PKQP 4PCVA 1T2FA 3G49A 1ML3A 3D3WB 3UICA 1DXYA 4HNHA 4IDCA 3OBBA 3WGYA 5G4KB 2D0IA 3DFZA 4HX5A 2PR2A 1DHRA 3MJTA 1HZZA 2BGKA 3SLKA 1EVZA 2W98A 3QRWA 1FDSA 3SXPA 5T67A 3FSRA 4W4TA 3X2EA 2GZ3A 5DCUA 2WM3A 1SEVA 2O4UX 2DTXA 4YA6A 4B8ZA 2P9GA 1EVIA 4PLVA 5A1TA 3LYLA 1VL6A 3EUWA 2GZ1A 5T8KA 1VL0A 2WD7B 4XDYA 1P44A 4BMNA 3SC6A 4M87A 3PWZA 1H93A 3E9MA 4RDIA 3JQGB 3DTYA 4UEKA 4XD2A 2RBEA 4DYVA 3BMCA 3WYBA 1EZ4A 3VZRA 1B16A 4FPXA 4WCDA 1MUUA 1A71A 3PJDA 2DUUA 1E6UA 1UXKA 2DT5A 1L1FA 1FK8A 1NVGA 3KV3O 3JD3A 5K6AA 4J9VA 1N5DA 3CE6A 4NK5A 4WPGA 2Q2QA 1WPQA 3NDIA 4YAIA 4BNNA 5A06A 4PLTA 5GY7A 3VVBA 3AM5A 3PWSA 4HADA 4XQGA 3FBTA 3FF4A 3WGTA 4EBFA 4UVEA 3ICCA 4I5GA 1PZFA 4NU6A 1KVQA 1S7CA 2PH3A 2BHLA 5DP1A 4DRYA 3RU7A 2QW8A 3L6DA 4GH5A 3GQVA 3PLNA 3QP9A 2ZATA 3KVOA 3ETDA 3O26A 3S55A 1EE2A 3EZYA 4AJKA 3CXRA 4PN3A 3I9OA 3OIDA 1D3AA 3U3XA 1P1KA 1PGPA 4Q3EA 4B4WA 4CM4A 4E21A 4L4XA 4EYEA 4YYZA 4KMSA 5COAA 3IQDB 3NKLA 5FI5A 5JAIA 2VZ9A 3UKOA 3GMDA 2VT2A 3KSDO 5HM8A 2NQ8A 1XA0A 1CEQA 5U9CA 1IZ9A 4RPKA 4O0LA 4O63O 5IZCA 2FZWA 1ISIA 5TX7A 5LCXA 3R0IA 5BSFA 4OO3A 1ZXBA 1FDWA 3ZWCA 3GVCA 3LQFA 1BW9A 5JCJA 4O59O 3TPCA 5A3JA 1KEVA 1LEHA 2C7GA 3QHAA 4J43A 3JCZA 2QRKA 1UAYA 5IZ4A 5L51A 1PGQA 2I76A 3ZHZA 2VHVA 2D59A 2V65A 4JNKA 5COQA 4P4LA 4Y8VA 4J4HA 4MINA 5IDXA 4NK4A 3RC2A 1PS9A 4B3HA 1FDVA 3R1IA 4IGFA 3GFGA 3PYLA 5ER6A 1Q0HA 1BWSA 4RPLA 1QYCA 4C7JA 2VZ0A 3TN7A 3U9LA 1PJTA 1SMKA 3PGXA 3GVPA 3E03A 2FN7A 3Q2KA 1YGYA 4KUHA 3ZZNA 4BV9A 4CM1A 2OMEA 1U8FO 1VKOA 3C7AA 3GAZA 2JCXA 1Y9AA 1OBFO 2W2KA 2XPCA 2EP5A 2X0NA 4GX2A 5JFOA 4JBHA 4NBUA 2DFDA 4M1QA 3H9EO 3B1FA 3LSYA 4JROA 3IUSA 2ZYAA 3HN2A 1SOWA 3ETGA 2VHXA 2ZCVA 1ZVMA 2WJPA 1S6YA 3DAPA 3CSDA 4JXKA 4IBOA 1KC1A 3IAHA 3DDNA 2DFVA 4MKZA 5KVQA 4FSHA 2PGDA 5MDHA 3NDRA 2OXIA 3BIOA 3AI2A 2UAGA 4RLSA 1VC2A 2DTEA 1QV6A 3AW9A 3QQPA 1V9LA 4BKRA 4PG5A 1V35A 4BHTA 1QYWA 3I9MA 3HDYA 4J7CA 3FPCA 4U0KA 3B20A 3AM3A 2Y1CA 3PI7A 2BF7A 2Q1TA 1K2WA 3QA9A 5EPOA 3E5RA 1PZHA 3KB6A 3D5QA 3O9ZA 2C0CA 4NJMB 1AXGA 3D4NA 3ZV5A 1EFKA 3OJOA 4DMLA 1I3MA 4YQZA 1CERA 2WTBA 1B3BA 2FZEA 3Q6IA 1V3UA 3ZV4A 1MFZA 3DC2A 2DBQA 1B8PA 2X22A 1UP4A 3IOYA 3RSHA 4WOJA 1MP0A 2YUTA 3LC7O 5EQDA 3L6OO 5ICSA 3ZU2A 4PG7A 3U4HA 2WD8A 1AHHA 1YL6A 3ONDA 4PVCA 5F3RA 5AXDA 3TQHA 4F3YA 2BKAA 1ZK0A 4GAEA 1E5QA 4R9SA 1P1FA 1F12A 4CL3A 5THQA 1RPNA 2NNLD 4PG4A 1Z7EA 3H9UA 1CDOA 2O23A 3KYDB 1NPDA 3K96A 3VKUA 1I30A 2GN6A 2I65A 4KUGA 1NX6A 1Q1NA 3F47A 3JQAD 2OGUA 5TF4A 2HMVA 4BNIA 1D7OA 2HCTA 4ND1A 4Y6PA 4E4YA 5L4NA 4A5OA 3W8FA 4TQGA 1VSVA 1C1DB 5GZ1A 1MG0A 3KEQA 3U09A 5CFZA 1G0OA 3LLVA 1WZEA 2GSDA 1QXSA 2X86A 2YHIB 3PHIA 3PFFA 4I5DA 4DLBA 4D41A 1BSVA 2W2LD 3DBRB 4OXKA 2HRZA 2FHSA 2QHXA 5ILOA 4M49A 4CLXA 3FWNA 2IZ1A 2Q2WA 4RF3A 2OFPA 3VPFA 1IL0A 3VZQA 3GRPA 2JCVA 4OM8A 3L07A 1E7MA 2AE1A 1E3SA 3WGOA 4RLHA 4WK6A 4GI2A 3WYCA 1I3LA 5BT9A 4F45A 2DUWA 5DBGA 5H83A 4A0SA 1WLYA 4YT2A 2AEFA 4FB5A 2D5AA 3W4JA 4FOOA 4E32A 5T6BA 5IG2A 1DJQA 1SPXA 4EJ6A 5K0ZA 2AEMA 1YRLA 3UCXA 1U1IA 2YY7A 4Y9DA 4XIJA 4L4SA 5IXYA 5LDHA 3BXXA 3V1UA 1LLQA 4NZ9A 4MVJA 1Y81A 1FDUA 1SB9A 5B37A 3PWKA 2Y1GA 1I24A 2FMUA 4ND2A 2EF1A 1YO6A 1SO8A 1DIHA 1ULUA 4PIVA 7ADHA 2O7SA 1H2BA 4FW8A 2C5EA 5AQ1A 4YRAA 2VYND 5ENVA 2C2XA 1XG5A 3ZNQA 3DTTA 3DONA 2ZYDA 3WQQA 5CAEA 1LRJA 1DIAA 4WLUA 4WGGA 4DIFA 4OSPA 1YWGO 4GKBA 4XQ9A 5TJHA 4CUZA 3CIFA 4R5MA 4HWKA 3KUXA 1TT5A 4HNGA 3RQSA 1TXGA 1TEHA 2ZJ0A 3EYWA 1DC4A 1R66A 4BNMA 2HQ1A 4CLOA 1MG5A 5CPBA 1CQIA 3B6ZA 5H82A 1GL3A 2PTGA 4MVJI 2BD0A 2GZ2A 2V6BA 3I6QA 3FN4A 4CV3A 2D4AA 3ANLA 4YEDA 3ULKA 4CM6A 1Y9EA 2EP7A 2CDCA 4UUNA 2WEKA 4PG8A 3RCBA 2V7PA 4E2WA 1NAHA 2AA3A 2AE2A 4ZICA 3JTMA 4BKQA 4BO6A 1K0UA 2ZK7A 4J0FA 3K6JA 4AG3A 3HSKA 2EKLA 4J90A 1I36A 1PJQA 4WJZA 1ISFA 3BMOB 2J5QA 5TS3A 4FFPA 1E7QA 4EEXA 4BO4A 4NNJA 1GY8A 1HL3A 1NYTA 1PSDA 1U3VA 4YACA 1YOVA 4LVCA 4Q39A 9LDTA 2VNAA 2X5OA 2EERA 4TKLA 4GGPA 1BG6A 5DCYA 3V2HA 4WECA 1R37A 1ADGA 5AOVA 3OFSA 3DBHB 4KWIA 4P22A 4IIUA 1P1JA 4DPMA 3RC9A 1JKFA 3AI1A 2QX7A 1Y8QA 3I3OA 3P7MA 3UN1A 2NQTA 3A4VA 1PJBA 3KTDA 3L6EA 3D4OA 5A9RA 1LDEA 4ITUA 4LMPA 2NU8A 2GUGA 2G82A 1W0CA 4D79A 4ALIA 3PVZA 4IQ0A 3ZU5A 4D3SA 2NWQA 3V2UA 4CV2A 1HE2A 1DOHA 3LZ6A 3WTBA 1PWZA 4E6PA 3L4SO 1HDYA 1AXEA 3D3WA 2JD2A 1KEUA 1HLPA 1X1EA 2G1UA 1R4MB 1IYZA 4JQCA 2Q4EA 5CDYA 3AFMA 4LK3A 4QX6A 1KETA 3GA0A 3FD8A 4NMHA 3NRCA 4A03A 1GV1A 1HSOA 4GSKA 2O2SA 2E82A 2Y66A 3GUCA 1A72A 1G1AA 2WMDA 3WWZA 3NTQA 4INAA 3UHAA 5C7LO 4M86A 2YDXA 1JW9B 4W9NA 4ZHSA 2GR9A 1LDMA 4XGIA 2JL1A 4TZTA 3U62A 2NVBA 1CWUA 2P5UA 4YJHB 3GGPA 3IP1A 3OHSX 1YS4A 4FGSA 2IEDA 1FF9A 2WD7A 4GL4A 1PL7A 5L45A 3RUFA 1X7DA 1L7DA 2VOJA 4WLVA 3MTGA 4A2CA 3JQGA 3LT4A 3I9NA 2LDXA 2CD9A 4WCFB 1KEPA 5JYFA 5T73A 2X6TA 2DBZA 2QRLA 4OJNA 3O38A 2POQX 3JQ9C 3Q3CA 4NDNE 1ADFA 4QO8A 3HNPA 3WIEA 3R6DA 3EVNA 1NQAO 3ICPA 4OXNA 3VTFA 2VUSA 1Z75A 3S1LA 1RYDA 1VPDA 4CR7A 1MFPA 4BO9A 5JMWA 4HUJA 2VN8A 3HE3A 1XELA 2AG8A 2PD3A 1PQUA 1E1MA 1ENOA 4RQUA 1YB5A 4KDEA 3GK3A 3ORFA 1I3NA 1EDZA 3I23A 2W90A 3JD1A 3K2BA 4ND5A 5KCZA 4OH1A 5A04A 1T1SA 4RV9A 1NBOA 1DIBA 3I9KA 3C24A 3I1JA 3GGOA 1NPYA 3PHJA 1NFQA 2JFFA 3PQFA 4Z6KA 5JE8A 3ROKA 3RUCA 2R00C 3HADA 2DPHA 5ES3A 3H5AA 1VJTA 3K30A 1I33A 1P3DA 4J7UA 3QVSA 4MVJG 4YAKA 4YTEA 2IODA 3BTOA 3H9QA 1MA0A 1Z74A 3A14A 4D44A 5TLSA 1KY4A 4Z3KA 3LT1A 3NTRA 1NVTA 4NFHA 4E2YA 3KLMX 3GEMA 2GGSA 5B4UA 4LW8A 4HFJA 1B8VA 3DXFA 4F46A 4WCFC 4LVUA 4WKGA 2F00A 3IUPA 1R0SA 4C7KA 4IXWA 3C1TA 3VAZA 3SC4A 5A02A 1TVEA 2OZPA 2FSSA 4L74A 2Q2VA 5T5QA 3AOGA 3D1LA 1LSUA 4L76A 1HZJA 1P74A 3WGIA 3KM0A 4ZQBA 1XKQA 4GX5A 3ROMA 3RD5A 3VH2A 1M6WA 3ZWVA 2C59A 3RUDA 3RUHA 5C37A 1BVUA 2Y1DA 3FTPA 4YRDA 2RAFA 4DLLA 3QW2A 3JYQA 4B79A 2ZYGA 5JAZA 2FP4A 5CEJA 1SC6A 2NADA 3Q2IA 2GD1O 4BNWA 5KVVA 4EITA 1R6DA 2J3JA 4CMGA 3MCVA 3GZNB 3GG2A 1P1RA 2HKIA 4BUCA 5JO0A 5JDIC 3GRKA 1QLHA 2YQ5A 1NFRA 1LTHR 4MDHA 2ZTLA 2B37A 4YJDA 3GDGA 1MXFA 4A10A 4BKUA 4DTIA 4Z0HO 3GEGA 4FFMA 4PLWA 4Q3CA 3WGGA 1LLCA 1QP8A 3DWFA 5F5NA 3IKTA 1H9AA 5KIAA 3DHNA 4JGBA 1ZCJA 4CMBA 3ZGYA 2HMUA 1DB3A 4IGEA 3RWBA 1LDNA 3MJCA 3VPSA 3NYWA 4TSKA 4CMEC 4DREA 1XQ1A 1ZMTA 3TL3A 1EEHA 3GT0A 5G0TA 1VKNA 4NPCA 3OM9A 4EUHA 4BNUA 4XYEA 1WMAA 3V1YA 2LDBA 4OAQA 1T2EA 4YT8A 1HDOA 3JD2A 4CQLB 5A03A 2D3TA 4J0EA 5AVOA 2PGLA 1B14A 4RVUA 1MV8A 1ZNQO 3LF2A 3C1AA 3H8VA 4YT5A 3D4PA 4A7PA 4U8GA 5JAQA 1UP6A 5A4DA 2JCYA 3RC1A 2VUTA 2QZZA 4DWVA 4A26A 3RBZA 3QVOA 2IE0A 1NWCA 2CDBA 1LDGA 4EJ0A 4HFRA 4XYMA 1E1NA 1E5LA 1X7GA 2P5YA 1C3VA 3V1TC 5BQFA 2I6TA 4CQMD 4NBWA 3WGHA 3DZGA 4RPHA 4FD3A 5IAAA 2P68A 4GBJA 4PLYA 3I9LA 4KWHA 3PRJA 2O3JA 3T7CA 3MWEB 4CMIA 2G0TA 1T2DA 4AL4A 3PZRA 3MJSA 1PGOA 3UFXA 4BNJA 1U4OA 2G76A 3HDJA 4B3IA 4LGVA 3WBFA 1C1DA 1EBFA 2ZQYA 2HJRA 5HS6A 4RZIA 2YQ4A 2I3AA 1ZIDA 5L9AA 5EJ2A 3LU1A 5ICMA 1GADO 3ZU4A 4XDZA 4JP3A 1GZ3A 3VC7A 1I3KA 1CETA 1DAOA 3C1OA 3GH3A 3KOUA 4II2A 2DM6A 2GN8A 4MVJF 3VH1A 3ZW9A 1AE1A 1DIGA 4P38A 3QVWA 1UH5A 4C4OA 1NQOA 4KQWA 3SVTA 1DRWA 4S3MA 4PGFA 1KC3A 2V6GA 3GEDA 4WLOA 3OECA 5I9LA 1C0PA 4U6QA 1WZIA 1V6AA 4FGWA 4HXYA 3GPIA 3DBVO 4CJXA 7MDHA 2HK9A 4J1QA 1QMGA 1Z6ZA 3HQ4O 3STHA 1OOEA 4EGFA 5THKA 1ZK3A 1XGKA 2ZIZA 3L9WA 5HS4A 1BXZA 2D5CA 3D7LA 1WVGA 4BNHA 4EDFA 4FFLA 1GTMA 3M2TA 5KVCA 3N58A 1DPGA 2CVQA 4BS9A 1GPJA 4G65A 2B5VA 5DN9A 1ZXLA 3NGXA 4R16A 4RF2A 3OH8A 1GD1O 1XHLA 1P1HA 3KHUA 3DOOA
chains in the Genus database with same CATH superfamily
1T15A 3OPYI 4BWYA 1V95A 4HNTA 3I9V1 5CNIA 4MWTA 2MIIA 4W8HA 3OZGA 2XYRA 3ROPA 1JALA 5K03A 5ISMA 1XQ6A 5JARA 2PDAA 4DADA 4MKRA 3EUEA 1TVCA 1ZC4A 3ZHXA 3IIMA 3OG9A 4IMPA 2XNHA 2QV7A 2H5LA 2AFHA 4F3NA 4KKVA 5JYAA 2GLTA 2IYSA 3EGOA 4JCOA 4MRNA 2CKMA 1L5QA 3KAQA 4H59A 1KK0A 2JLSA 2IXGA 3M1AA 3PXAA 1LV8A 4E5SA 2ZTUA 3ZCQA 2O4CA 1NM5C 3K6SA 2IZ6A 2GEBA 2R97A 4JA2A 4FBGA 4L02A 4QUGA 5B57C 5C31A 3JQBA 3WLKX 4URWR 2Q49A 2AZMA 5BSRA 3WLJA 2LGJA 2QYSA 3AIIA 3SY8A 3IH5A 3LZCA 1NMQA 1F6WA 3Q0IA 4WSOA 1ZQ9A 4OBEA 4Q7JB 1IBCA 3B5JA 1HE3A 3AU8A 1TQHA 1XZMA 3QVLA 4JKYA 2DAPA 3N8NA 3GPDG 4M9UA 1FXUA 2WWFA 4QU9A 2ZBQA 2W6IA 1K27A 2OC9A 3BMOA 4ALKA 1AD2A 2I4RA 1ADCA 1KAHA 1E92A 3AL3A 2QLMA 4GI1A 4TMVA 3TE7A 3PQEA 5KTRA 2EGHA 1NGSA 3FNFA 2FWMX 1UIMA 2HPHA 3I6BA 2QSUA 5FTLA 4Y2UA 1RLIA 4ERXA 1QMIA 3WWCA 2OQ2A 5C8ZA 4PYJA 4AF6A 2HSEA 1XF9A 1X7YB 1EFCA 1T9ZA 3E9QA 5CX1A 5KDOA 1GL9B 2BBWA 2BOVA 2WJAA 3ITKA 3N7UA 4IFEA 1KKUA 2VAXA 4F7WA 1E3QA 1PNVA 3RH0A 1HETA 4DWWA 2IIQA 5DBHX 1Z06A 4K6FA 3KOYA 3MA0A 1DTWB 8ADHA 4P0QB 2OV4A 1TA4A 1MENA 5EOVA 3W2FA 4MP8A 3BRSA 2GCIA 4LXIA 3KR2A 3LVQE 3JQ7A 3K8ZA 4M37A 4MK4A 3FZYA 4B3TB 3L6CA 2YIMA 4J0DA 3TPZA 4BVGA 3GFBA 4D42A 4BB6A 4BMPB 3D2LA 3UUFA 1W5BA 4FB4A 2C4MA 4E11A 4XEHA 4JT4A 2PD6A 2O2YA 3DE6X 3DDHA 2XRMA 3FFTA 4G89A 5ELLA 4OGKA 4BTLA 1H22A 1LY1A 2O3RA 2HXYA 1U65A 3M8KA 2HQRA 2HU8A 4Z0NA 5TRTA 4D74A 4W5HA 5EZYF 4C4SA 4I1IA 2XNCA 2Z1NA 4EI9A 4PPNA 2V97A 3H0VB 1Q0UA 1O4VA 2NU6A 2Q5CA 1QYXA 2XOXA 3E3OA 3HLTA 4LDAA 2CHVA 1IFXA 2PRYA 4FZRA 4ZTUB 2AG1A 1L7AA 2OVBA 1J2UA 3CPSA 1Y34E 4LZOA 5JNSA 3J81A 2DR2A 3K9QO 3VOSA 1PZEA 2N46A 1CVLA 3DO8A 4GHWA 4MS3A 4UHFA 2QAGA 4ZVPA 1DEOA 2WQZA 1FFBA 4OJMX 4YGYA 4DNOA 2P6RA 2H1LA 2VBFA 3L0OA 1CUXA 1XCOA 2WSSD 4ZARA 3ZWPA 1EX9A 1IQUA 4O5OA 5K0EA 4E5KA 1PJZA 5AXBA 3EY4A 3TRDA 4JSRA 1PS8A 1GNSA 1PZGA 5A4JA 3MMXA 2AQHA 3EXHB 3R7WB 3RHSA 3JVIA 4H7EA 1NU8A 4Q3OA 4WUVA 3RK4A 2PSJA 2EKBA 3BC1A 5DM4A 2O8FB 3IVXA 2XWPA 4MJ7A 3U4IA 4I14A 5GJVC 1LBTA 1QO9A 3WK7A 1GOTA 4Y6GB 3BXGA 5CLLA 2XNJA 4HVLA 3PUKA 4L3WA 4D4HA 1EUZA 3L5KA 4IXTA 1WB5A 3IA2A 3ICVA 1YB4A 3LC2O 4R1QA 1MX3A 4IH1A 1FS6A 4ZPXA 1FFXB 5ALEA 1E4OA 5FYDA 3U0VA 2NVWA 5E9AA 5FTWA 4E94A 3IWCB 3DOIA 4EW3A 3F3KA 4LJ7A 1P33A 4HYEA 4WXEA 4NR0A 4BIIA 5KKAA 2J0SA 2HTFA 3FM9A 4RH1A 3VZPA 4HB2A 1H3FA 2IBSA 2HCRA 3ILHA 1QBGA 4P1ZA 5F4ZA 2PAFA 1MGOA 1KEWA 1W93A 2G04A 4HF7A 4LF6B 4JVSB 3V8PA 3LQ1A 2ET6A 1J2TA 3PD0A 3STTA 1U2PA 5HA5A 4X5OA 1U90A 2AFIB 1S8OA 1FBTA 2NTVA 4KP7A 1OIXA 1EXNA 1OLOA 2O5VA 1R0CA 2ZBEA 3EFOB 2BM0A 1KFEB 3KJHA 4PPGA 3RT9A 4DPKA 3VISA 2VSFA 3E6AA 4CHTA 3P2EA 5JRJA 2AI3A 1E1CA 2ACEA 3QYAA 2R6ZA 4KE9A 3UXHA 4B48A 1RT9A 1C30A 3QXGA 1RIIA 2PEYA 1UEJA 4OA5A 4EB3A 4V1CI 3DZIA 2R5FA 3PITA 3LRXA 3QWAA 2WIJA 2XNSA 3M6FA 1VYUA 2FMKA 3BDVA 3TNJA 5CR9A 3I05A 1O6ZA 3H84A 1TTQB 3KEMA 5LP6C 4CGZA 1KH2A 4LWQA 4TN5A 4D3DA 4JU8A 2QWXA 3FETA 3QJ5A 1B41A 1Z4MA 1VIVA 2X6RA 5EKDA 3WK6A 2YVUA 2IZ7A 2VZEA 3GV0A 1VSUA 3OP4A 1A76A 3QENA 4HEQA 4ID9A 5F33A 3H3JA 4RIIA 4BNTA 4E33A 2B3TA 1VE3A 4Y7DA 4OJYA 4B2LA 3P1JA 5A5FA 1HF3A 2QV0A 4HGZA 1COWD 4MGZR 3WE7A 5BYKA 3QWHA 1NX9A 2IYQA 4GD3Q 1LX6A 5BRNA 1P2TA 4RM3A 1CEYA 1YVDA 2A0FA 1L4BA 1UDCA 4MKGA 4YQYA 4PANA 5LBIA 1GCIA 2EWWA 1BYUA 1W2GA 4Q37A 1NYRA 4YCAA 3H1FA 1LS6A 3KOXA 5K3DA 3RAGA 2ZWIA 5J5AA 3USZA 4ENQA 1CHDA 1AF4A 4D9EA 3NXSA 4XIYA 4KRFA 2OAGA 3FHOA 2Y4OA 1K5GA 4D8UA 2PGJA 4KXWA 3ICWA 1VMEA 4YMHA 3WNVA 1CYEA 4TXMA 1TTPB 5JAMA 4LDNA 1ISHA 3FSGA 4OH7A 4YRBA 3GUYA 3CNHA 3JZIA 4TUYB 1V16A 1YQGA 4IGKA 5DNAA 2BUAA 2EFHB 1XYVA 3U6KA 4CM9D 1Z9BA 4KVAA 4RTMA 1CB7A 5BSVA 3R0VA 2X1MA 5INTA 2R1VB 3NC4A 1XP5A 2IOQA 2PWAA 4KAJA 1K75A 1MT3A 4N8DA 4LGYA 1K92A 2A0YA 1VMKA 2NO1A 3LXUX 3DOHA 3I83A 4H31A 3P0FA 1N9GB 3NH6A 1JWLA 4PTYA 2GLXA 1JR3D 5FT9A 3R8FA 1AHNA 4CQMB 1UBOS 5DGXA 1IK6A 1PO7A 4IKEA 5G0WA 3TS1A 2ODQA 1C4WA 3OHMA 1SKYE 1E3WA 2F43B 3ZQJA 5IKXA 2HLNA 3KTOA 1PWXA 4MVJD 1RKXA 3I58A 4O1IA 2X19A 2I62A 3LHIA 4GKKB 1IHYA 4R1OA 4E22A 2Q5OA 3R77A 5DHUA 4BNYA 1N92A 3KYCA 1L5HA 2OV6A 4B4KA 1DFGA 4JFAA 1I13A 1SCAA 2C3MA 4FJ0A 5ENZA 1BU5A 1Z07A 4LISA 4YB8A 3STWA 1MABB 3AESA 4HYYA 2XQJA 1AU9A 2Q1SA 3EW7A 2WAOA 5EG5A 5DZSA 3UY4A 3UV6A 3IKJA 5HTOA 3HN6A 3IEPA 1Q0RA 2RH5A 3JPWA 4AZ0A 2Y76A 2BH9A 3IGFA 1BWRA 4MKHA 5HRUA 5DWDA 1JDBC 1QQTA 2FFBA 1V96A 3ONVA 4D0RA 1G4HA 4ZOEA 5CDSA 4MZXA 3RREA 4RHUA 5IT4A 4OX9B 4JN6B 4P8RA 4B4UA 5LOVF 4XR9A 5C8YB 3P0IA 4JJ8A 4IUBS 5FWXB 4XQ0A 2YWJA 3W6OA 1AS0A 4J0HA 4I4LA 1S02A 4IUCS 2P9EA 3AHHA 3PCTA 3ROZA 3TCXB 3WLOA 1F8XA 4F6RA 3ZDCA 1QGUB 2UVDA 4D9NA 2OV1A 4I8IA 1TU0A 4TLAA 4ZGBA 3LQYA 3S7ZA 5KTOA 1TQ4A 1WVIA 3HCRA 1QX3A 1RYNA 4D4LA 4QECA 3V4OA 4Z1OA 1IOLA 4BLWA 4M6WA 3E15A 3PHLA 4CI9A 1FFYA 4DSAA 4V0SA 4ALNA 4R9NA 5A5DA 2B2XA 1C9MA 4LTDA 4RVGA 4OEHA 2I2AA 4QOEA 3OQJA 5H1YA 2QMYA 5IMBA 3I5YA 4AP9A 4D82A 4JXZA 4FDTA 3TDMA 2YZKA 2LUOA 3WA6A 4K6CA 3ZIDA 3Q3IA 4RVDA 4FFWA 1UJ5A 1L5LA 4C6HA 2XOKD 5JI3E 1FTYA 5JY1A 3GC6A 3Q8MA 4JIGA 2WJ3A 2NXJA 3HUUA 3TDKA 5KWIA 4QC2A 5TPZD 1J2RA 1J4AA 1CY1A 1K2VN 3ETEA 3IBGA 4I5EA 1YE8A 2A4KA 1PEKE 2I1VB 1MX9A 2INGX 3FZQA 5J4LA 3K73O 1AMOA 4X64B 3HBMA 2PGAA 3M4NA 1SA0A 4URFA 3UJNA 4AXXA 1PR4A 3UG7A 3OEED 4BGIA 3B1YA 1JLLA 1T2NA 3UW3A 1KSFX 4IH4A 4KO4S 4WXPA 3L4JA 4H18A 3ZDBA 3A3YA 3IRVA 3L8FA 2FFHA 2D74A 2BMWA 3G9ZA 3HDHA 3O1JC 4C88A 2OR3A 4CE6A 2Z0MA 4F4IA 2HDNB 4QJBA 3IDSA 1UC5B 2EXXA 3PFIA 5B1YA 1U9CA 2P0EA 4MRPA 4PBTA 1W88B 5D3MB 2XMGA 4R51A 1LLUA 3K31A 3FUXA 4LG1A 4ZQIA 5J1SB 3ZGZA 1DSSG 1X39A 4BV3A 2C5AA 2SCUA 4CL8A 1E9AA 2BIFA 3OFJA 3HPQA 2BGGA 1ZD5A 1YDGA 3IHKA 1LDYA 3LHKA 5IKOA 3BQNB 5BR7A 2PQ6A 4CM4B 4N5NA 2JRLA 4G5QA 4A6XA 5LYJB 3DQQA 2GM4A 4O1HA 2ZZMA 3WKEA 1WAMA 5KJCA 4JDPA 4E3WA 3ZVNA 3Q3GE 1KVTA 1WWKA 1X8LA 2G1JA 5K0FA 4OCZA 4HDQB 1VMDA 3FPHA 1Z3IX 1J6UA 1BYIA 5G4KA 2ZDQA 2CNWD 1G9SA 1W4BA 3OOSA 4M1EA 1RABA 3QHQA 4UMFA 4B2YA 2JLAA 3F9IA 3WXBA 4AX4A 4JX9A 4BE4A 3HN7A 2GXAA 2VI5A 2A9RA 3WYEA 5BVHA 1FTNA 5T7BA 4UVDA 1IBMB 3LC1O 1SHZA 2C0PA 4ZQEA 3BWBA 3P8ZA 1M83A 4I5IA 5EKUA 5K0NA 2F7SA 3WBBA 2Z2ZA 3EVAA 3HWRA 2DPXA 4MW5A 2ZE8A 2GPTA 1MB9A 3SZ3A 2QN7A 1CK4A 3C5WP 4BN4A 4NBVA 5B3KA 7REQB 1A97A 4XM1A 4YUVA 5I7VA 4OQPA 4DRXB 3D81A 2H18A 3NNNA 2NVUB 4DSTA 2TMYA 3GEIA 4RACA 4WCFA 4EKGA 5L40A 1U2TA 2X40A 1MO6A 4ZCLA 3IWBB 3TX6A 3T5AA 3HV2A 1UL1X 2O05A 4OGWA 4L5YA 3IDOA 1KXJA 3ND7A 1FW6A 3MHTA 1ONSA 2CFRA 1L5SA 2GEUA 1ZAKA 4IDBA 4KN5A 3TRKA 3USES 4A0QA 4BNZA 2F4VB 5JCOC 1M1ZA 1JQKA 2HT6A 3HCCA 5DF1A 1UQRA 3WRXA 3E1SA 1J0EA 5SICE 4AZ3B 3NTOA 1OZFA 3BXPA 2WAMA 4ISCA 4WERA 5JWRA 3GGCA 1W5AA 4FI3F 4IVNA 1WQ3A 1HV8A 3OD5A 3T0GA 2G72A 1JIQA 2ZJ1A 2ZRMA 4JT9A 1RS0A 2W6ZA 4H1HA 3TQQA 1K5HA 2C7RA 4UATA 4Z3DA 3MRVA 2BONA 4E6EA 3HJRA 3MXOA 1QH0A 5LVAA 4R2LA 3IEMA 4QGBA 1ZD2P 5FP0A 1UFRA 4P84A 2EX4A 1N6LA 3BCUA 4Q7KA 2VNJA 4GGOA 2W4QA 1N78A 2VJLA 3CKKA 4ZI7A 1YR8A 1LDBA 3AM4A 1KE2A 2B3DA 1SOMA 1KXZA 2Y99A 3K6RA 3E2MA 3MPUA 4M0FA 4S1VA 3SWWA 4ARUA 2AJCA 3UZUA 1XTBA 2JJ2A 3G9TA 3RFFA 3LM8A 1B0PA 4BJ1A 1KYZA 2BLNA 1A9XB 2PKCA 5A9TA 2JRCA 3GHHA 1X7YA 3AUKA 1J0AA 1VKRA 2ID9A 3V6LA 2ERYA 3NT4A 2L69A 4DSOA 1JG7A 2HRBA 1LX7A 3E61A 3G2QA 1MEEA 3S7TA 3UJBA 2D2EA 3JYLA 4P9NA 5JJKA 1U0SY 2CK3A 2HJWA 4KVGA 5GM2A 5CA1A 1DTWA 1DZ3A 2P40A 4RM2A 3W06A 4C4ZA 3ZDFA 1O9GA 1UFOA 2G71A 4IGIA 4L6AA 2CF6A 2PCLA 4QQNA 4CU5A 4X65B 1YS2X 1ZONA 3ZGVA 4EYGA 2Y0BA 3D6VA 4DQLA 2E1RA 3AQIA 4IF6A 3RIHA 4HGPA 1U7HA 1QCYA 3RK0A 4CMEA 3BTUA 4MI1A 1Z5ZA 1B1AA 2PZAA 1MNAA 4WN9B 4X20A 1Y3DE 1NVVR 2Z9BA 4OD0A 5AP9A 3SXJA 3QX9A 5FX2A 1N5MA 1HEIA 2EBFX 3ETCA 3VU3A 1WHSB 3LPAA 3HXQA 1HGXA 5DJ5A 3OVMA 1VECA 5JRDS 4YHHB 2J85A 2J3IA 3WGZA 3BGSA 4YMWA 5B53A 3DV9A 3CNBA 1CS0B 4Q9KA 5F2EA 4YR9A 5ES4B 1SBCA 2JI6A 3T7RA 3K71B 2VCEA 3GFFA 3MQ2A 3ET4A 3VVMA 3H8JA 2YFYA 3PZBA 3H4VA 2YN4A 2GYYA 1HO3A 1SVWA 3ITEA 5D7BA 2PUVA 3KDAA 2MMGA 2QLLA 3QXHA 4PAMA 4C0HA 2L82A 5IT9A 2P30A 2H31A 3HJUA 3TFOA 3FCOA 3RW9A 2I3GA 4AMYA 1LKZA 3AETB 3B85A 2IUTA 3TD9A 2FDCA 1GWNA 3WYFA 4OX9Y 4N5LA 3TGPA 2XTJA 2NM0A 2P7IA 2V1XA 2Y05A 4H7KA 2QK4A 2XBUA 1E3IA 3CGWA 4WNIA 3K9HA 2BE9A 3EXHA 4O5AA 4ZYUA 2QTNA 1DCFA 4FONA 1C7ZA 4HLDA 1PVDA 3W1VA 2WWXA 4IJWA 1BXKA 2IXDA 2JEOA 1JLRA 3AY7A 3K92A 3R2JA 4HR7A 3JQAB 2O8FA 1VFPA 4Y2PA 1EFVB 2V7GA 4KNVA 4RO0A 3ICQB 1JDSA 1R0BA 2PLFA 4HN9A 4V38A 5JQGF 1GG2A 2RCYA 2VT7A 5AKEA 2WV9A 2Q5IA 5TSDA 2PWZA 3IEIA 4CQNA 1IG0A 3CO5A 1N2OA 4G1EB 3TW8A 4CF6A 3C3PA 1ISSA 1W35A 3MWDB 4UNSA 5FLKA 1CLEA 1A50B 4ZZIA 2ZVPX 1QNFA 3E81A 3F90A 2A33A 2GPWA 2QI9C 4PC2A 5FV7A 3IALA 3UQYS 4LJ8A 1FUIA 2PY6A 2R6HA 1D1QA 3GJTA 4P3PA 5JMOA 4AJOA 4NBLA 5L3ZA 4D9IA 1Q0QA 2PJUA 1IUPA 1DBWA 1QIMA 4P4SA 5ALIA 2UXBB 2HLDD 1I6WA 2WA1A 3I5AA 4L9WA 4B81A 4D8WA 4DG9A 1T6YA 4BQRA 1RLTA 5JO9A 3LD9A 3RJMA 3D2BA 1PWEA 5JBNA 5K3SA 1FUKA 2JLYA 1LPSA 3TV1A 1E2KA 1O1YA 1XVIA 1Z45A 4XUCA 1D6NA 1O77A 2BE7A 3ECSA 3ETJA 3JWGA 1M2FA 4FKBA 4C0LA 4RA6B 1JA0A 4EO9A 2G08A 2WF6A 1YRQA 4LQDA 1H2WA 4TS9A 3NKVA 4HRAA 5FKJA 3AVQA 3T9DA 1U3GA 4CVNA 1N2IA 4D25A 4DNFA 4ZZ2A 2GA8A 2PMKA 3HDTA 1CR2A 1SC9A 2QE7A 2QTLA 1HE5A 2IPOA 1IOWA 4TTAA 1IWOA 2BKEA 1IVSA 2Y2VA 4ZU3A 3DB2A 3CW8X 2JEZA 3DEYX 1VJ1A 5JRZA 1M2VB 4A82A 4AJJA 3G9QA 2CLFB 2WMNB 2DLCX 1MLDA 1ISRA 4R3NA 2ZIUB 3DF9A 1ULBA 2A9OA 2DHRA 2J3LA 2JC3A 3GYBA 2PMWB 4MGYR 3E9NA 2QDXA 2BCGY 5UKDA 4F5DA 3GVIA 2UUAB 2KMLA 3QUTA 2FPSA 3A36A 4YECA 3B1VA 1JIIA 1BN7A 3Q3EA 3ZY2A 1P75A 2OAEA 1O95A 2VDJA 3IE0A 1T26A 1WOYA 2I66A 4I9NA 5SYAA 3L6RA 2O0HA 1WV0A 5K8VA 4TUYA 1TYEB 2MINB 1GCGA 2H5JA 3SN6A 1IC6A 1XQWA 1K6IA 3D6TB 2XE4A 4CL0A 2BM9A 3MGCA 1WG8A 4HNAB 3S2YA 4CI0B 4QA9A 4F0JA 1XN1A 3HDQA 3ZNOA 2R1VA 4D8VA 3C6XA 1K98A 1DTSA 1IJEA 1MEJA 2A9FA 2REXB 3GBPA 4PM4A 2BTQB 4H3VA 4MVJP 1FA9A 3N2NA 5EKTA 3CGGA 3UHPA 4GNRA 2X3YA 3NB0A 1J70A 1N9GA 1CJCA 3BHMA 4YUYA 2BFDB 1WO8A 4KQKA 3IBCA 2IC5A 3DZ4B 2O2JA 4BECA 4WLEA 1DADA 3GOHA 2F43A 1GR0A 2VP3A 2XA2A 1QTIA 3GLHB 4ZQCB 3DFMA 4UAJA 4B09A 1D8AA 4AW9A 4D3XA 4LF5B 1TLTA 4OB6A 1BEUB 3QKRB 3AX6A 2IYZA 3IIIA 2R7AA 2Q9UA 1U3FA 2D1SA 4XGKA 4BQFA 4DLVA 3VR6A 4LBYA 1PF7E 5G0UA 4J1TA 4ZO9A 2Q3JA 3NG1A 5A3RA 1E1KA 1E64A 2PV0A 3DV0B 1RAGA 3DG9A 4EB8A 2I54A 1YFKA 1UPAA 2H08A 3A9VA 5FI3A 3UWMA 4XWWA 4ER5A 1K86A 1OILA 2M1ZA 1R8JA 2F3RA 2IDZA 1VTKA 2QAJA 1Z6QA 2RHDA 3K9GA 2PRSA 2VK4A 3VHXB 5AK4A 2Q1WA 2GAOA 3ISVA 2Y67A 1I5RA 3LXMA 2QVZX 3NHSA 4L8LA 4ZHQA 3EMDA 2MYPA 4TS1A 2VCYA 1YDHA 5M2QA 2P6PA 5B6IA 3CH6A 2WM9B 3FR8A 4RENA 2VL7A 4LN1A 5C8YA 2XCSB 4S2UA 3ZLVA 2RGBA 2ORED 4LNAA 4P98A 1SZJG 5CFOA 4GYKA 1Z37A 4NECA 4PX9A 5JY6A 2GNOA 4MRRA 5E9WA 621PA 5KSOA 5JG7A 1OT5A 1QGUA 1DUIA 1TF5A 4EABA 2JFZA 3QWIA 4BNDA 3C4JA 3DYIA 2ZUCA 3DC7A 3UQZA 3WAKA 4RVSA 4IM7A 3U1BA 4QJ4A 5G40A 2IPAB 2GS9A 4YMTA 5B7QA 5LPNA 4DC1A 1SIBE 4OB8A 4RF4A 3OWXA 5EYPB 4RBNA 3OZAA 1KA9H 4J7AA 1E77A 3OI7A 4FBLA 5JJBA 4NMXB 1DZIA 3G82C 3KOMA 1VSBA 4CMAA 3HXPA 2FUG1 2OXRA 5DOZA 1RBZA 4INOA 2W6ID 3C4VA 2FQWA 1VLMA 2CJPA 3CNLA 4NSNA 1GCOA 2A0WA 8LDHA 3EZ6A 4FU0A 2YMMA 3UMBA 4FDAA 2UXCB 4K9NA 1RD4A 1M1YA 4MAAA 4RJIA 5KQRA 4UDNA 2ZQ5A 1A7AA 3H04A 1JWBB 4DLNA 2RGAA 4LCEA 4MWCA 2WKWA 1AUQA 2QL9A 1GEGA 1NIJA 2CHFA 2W2MA 3DEIA 3EWIA 2C2OA 2GB4A 3IAFA 4PYOA 3LO5A 5FPSA 1OJ7A 4MUHA 1H2RS 3WHPA 5I9TA 4DB2A 3UHFA 2HK8A 3QKTA 4I55B 3L8YA 1P4SA 5E3IA 1E20A 5MF6A 1XZIA 4ZYVA 4Y0AA 3GR6A 1HQDA 4LA4A 3I76A 1T3HA 3ED5A 1RQLA 1YZQA 5D3MA 1TMGE 1W88A 5CB0A 1GEEA 4N4AA 3MT0A 1FMTA 2QRQA 1OCEA 1GAEO 3GHYA 4AUMA 5LP1A 5KYYA 1YI1A 2AR7A 5ALVA 4ZTZB 2QBYB 2WSYB 5AM2A 1SXJE 3WYAA 3OUUA 1XEAA 2FUCA 3H2ZA 1HM5A 2QX4A 4YMIA 4ZRNA 3LBFA 4PVDA 1LS1A 3C3XA 3DKRA 2CV2A 1U7DA 1KO8A 4W5QA 1OC2A 3IPCA 2A9VA 4BO5A 4E1VA 2QW0X 1BH2A 1IWPB 1DV2A 1Q6YA 4NG5A 5AI9A 5K45A 2G7MC 3FE2A 3UT5B 5K9ZA 2UUBB 3E18A 3QI7A 2Q1XA 3B9BA 3C3DA 1NDQA 4YCSA 1KL7A 1XLUA 1MTZA 4J07A 4RELA 1SVNA 1MGPA 1Z8NA 1E79A 2G28A 2GRJA 4QFDA 4TQ9A 3G89A 2IV3A 1XZLA 2VRWA 5HUHA 1D1SA 4GEGA 1GUFA 3FMGA 4A6DA 3QEJA 3M3DA 2XDAA 2XMQA 7REQA 5GV8A 4E03A 3IKVA 3KXKA 2D8AA 2O5EA 1QHFA 4HGQA 5IU6A 4D9BA 1C7EA 2Y0EA 3V46A 4OREX 4DRXA 3PK0A 4GBMA 2NVUA 4PZEA 4TXLA 4GQAA 3ILSA 4BNKA 4EL0A 2P8JA 3D6HA 4CWAA 1A2OA 2HBRA 2IHZA 1I7LA 3CH7A 2OORC 2CXPA 1NF3A 3FF1A 3JWPA 4R8MA 3LK7A 5JYCA 1T9CA 3H97A 3L04A 3SBOA 1XTIA 4D7AA 2AG6A 1II0A 3KEOA 1GCAA 5IC4A 3TR6A 3BA1A 2PZFA 3V55A 1EG7A 1QGAA 4IDEA 1Q2UA 1PJ2A 1Q57A 1KDTA 4HNQA 4IJ5A 4ZJYA 2Z4SA 4AZ3A 3S27A 5IAGA 5K6AC 5KYTA 3WFZA 1L5FA 4UEJA 3V34A 5CURA 2PKQO 4GNKA 3IAS1 5EMHA 3OJ0A 5JSKA 3HXLA 1FUYB 2Z4RA 4PCLA 1UC4B 1X9GA 4LVOA 4MV3A 1T5SA 4QFMA 1PFKA 2BSQA 1F3LA 2XIJA 2FEXA 4K9PA 3KSZO 1B0UA 1GUZA 4H3SA 1ZA1A 4LY9A 5AHXA 4BB5A 5DWVA 3ZS9A 4EVRA 1IATA 4HUTA 4EFMA 5BW6B 2XMSA 3EPRA 1BMFA 3SFTA 2P9TA 2PH5A 3W7AA 3W2TA 5ELXA 1EESA 4YX9A 4FHEA 2QPOA 4GLLA 3MOGA 3D2CA 3THRA 2NO5A 1MC4A 1PGJA 2PS9A 1KWGA 3OKCA 3MMSA 3VDQA 4BPRA 4GOND 4KDFA 1A77A 1ENZA 2HMTA 3F46A 1TM5E 2BTEA 4OLHA 4UFNA 2BZ0A 1N1MA 5IUNC 1QYRA 3EEOA 3DGFC 2E49A 5KOJA 1A9XA 3R20A 3F6CA 4LBVA 1Y4AE 4QXOA 2JFPA 2YL2A 3M2PA 1QBKC 3B9QA 4NICA 5M6DA 1PFWA 1M3SA 1X74A 4V0KA 1E6MA 1HNNA 3PQDA 3QVXA 1KAGA 2VF5X 5CXQA 5EZSA 2H85A 1IQRA 3MXTA 2PT9A 3IUNA 4RPJA 2PYZA 1IE3A 3SFZA 1DS6A 3BFJA 5LZ7A 1QGYA 4QDKA 1G8YA 1WMSA 3DLIA 2NT3A 1PJRA 3C3YA 4L4ZA 4GMGA 3PA8A 3PFKA 4JBWA 1EKXA 3J81k 3GCZA 3QE3A 1M2OB 1YJXA 3MC1A 1WHSA 3ZCRA 3LVFO 3QEMB 4G5YA 4OQMA 3FSGD 2HU7A 1PQPA 3GP3A 1DG1G 3RI3A 4MYCA 1YQTA 1NJ2A 2BMJA 1CS0A 1AF7A 3F2VA 4B45A 4W5TA 3KQSA 1XYYA 3QUBA 5GGYA 1EXWA 1UOQA 2BZSA 1SQFA 4RHYA 3S2IA 3OZFA 2FEMA 2ZSAA 3MWLA 1KNXA 4GZ5A 1XZDA 4TQUS 4WWHA 1JIJA 5CHYA 3RKUA 2FOIA 4XVHA 3SG0A 4K88A 5B3AA 5IM4A 4F3TA 3AETA 1MW9X 3IV7A 5EERA 3K5PA 2XEDA 3L01A 4FEEA 1NY5A 3AF1A 2HDWA 1PD1A 3SR0A 4EMSA 3CJRA 4BZZA 1BKDR 3D8UA 1UZLA 3QPVA 3UK7A 4R81A 3VPBA 2K7ZA 1GXSB 2QN6A 5DHAA 5KNBH 3H4TA 5IN4A 4CEJB 3RUIA 3CLHA 1NW4A 1RYHA 2FETA 2UDPA 3JQAA 5E2IA 4C3ZA 3K32A 1EFVA 3LLSA 3UC9A 3PUYA 2WSIA 2AEEA 4B85A 4FSXA 3D54D 1MPTA 2ODAA 3L82B 3HU5A 1SZCA 3I72A 3X1JA 2ZI6A 4IZHA 3QJYA 4R9RA 2YMLA 1NR7A 3GZNA 4XJSA 3ZY5A 1G21E 4MJLA 4GFDA 2W2LA 4HQRA 5EZQA 3WOVA 1FRZA 3HZOA 3MWDA 4Z7JA 1I14A 1OXSC 3EH1A 5DNUA 3SKXA 4CXMA 3E7FA 4IZOA 2CXTA 2WHXA 1WTCA 1E6CA 2NQ2C 4WKOA 4A2WA 2VBGA 5BT8A 3NBXX 3ZHBA 3W2IA 1S8FA 3MTJA 1OLUA 2Z04A 1RWQA 4QGGA 1J5PA 2CFCA 3TSCA 4D43A 3PDHA 3QPCA 1GGJA 1OY1A 1OLSB 2B0CA 2EP8A 3RC7A 1R8YA 3KVYA 1E61A 1D4OA 1HDRA 1SBQA 1CF9A 2XQFA 3D8NA 5I8PA 3NPAA 1W59A 2WYOA 5FQNA 2GH1A 3GW8A 3RJZA 3DB1A 4WVFA 2IOHA 3FNGA 4URHA 4BVAA 1EJ2A 1V4VA 2O8DA 4QU5A 3CTPA 1CB0A 4RA6A 5EFOA 4DLSA 1ZD8A 3S5UA 1P31A 5K5EA 1K3TA 3ELYA 1ESMA 1T1EA 3A6ZA 5FWYB 4AK9A 1IUOA 3B1ZA 4FCVA 3GH1A 1R1DA 2WTAA 2HBZA 4KWEA 2IY9A 4EHBA 3HYNA 3P0RA 4U1RA 5A5EA 3QBDA 1JQBA 1U2RA 4EO7A 2F1HA 4LYYA 5FBQB 4IXDA 4FNMA 3FG9A 1E63A 1QIHA 1VRVA 4HYQA 4UD2A 1A9SA 4O2LA 4PV7A 1IVNA 1MJNA 1M2VA 1Y5RA 4I9UA 4UCFA 5CHEA 1DI0A 3TZKA 4DJEC 1WPGA 5IVKA 1FLNA 1D2HA 4COKA 2W6QA 2C0QA 3TGLA 2MSDB 2O3QA 4C5AA 3A6PC 1URPA 2GHIA 2VS1A 4QXAA 3DZDA 3W3AA 4DLRA 3DCJA 3TTVA 1G41A 3HB1A 3GLGE 5AUNB 2CUKA 3KZCA 2JH9A 3DZ8A 4BVEA 4E13A 3R9XA 2VYCA 2UYYA 3FCSB 4YAUA 3HCFA 2FX5A 2G9RA 3WWOA 2YOFA 3NOOA 4G5HA 1NJFA 2Y93A 3C3BA 1QV7A 4HMOA 1L4MA 2OGSA 4OQXA 2HM7A 2MINA 1E5VA 4U7WA 2NN3C 4QEDA 3KZOA 4HNAA 5ICGA 1R5NA 3BWEA 1TIBA 2M6RA 1G3QA 3CVYA 2VDWB 1QFMA 3A2MA 4ZT6A 4JODA 2BTQA 1YI0A 4NAUA 4IYJA 2G3YA 2UZ1B 5AKZA 3M1IA 1SCNE 4TM7A 2JDIA 4N6OA 2IKQA 2BFDA 5ETJA 3NAZA 4NYJQ 9GPBA 4E15A 2G09A 4EG4A 2Z83A 4GP7A 3EYAA 1A5ZA 3TFQA 3PUZA 4HAVA 3GLHA 3VJRA 1A8PA 2R00A 1U8UA 1ZBQA 3QKRA 1YJCA 4EUFA 4LQ4A 3QNMA 3V8QA 1WCXA 1IUKA 2WWHA 2ZIFA 3LT2A 4R2MA 2A1UB 2ID8A 4AY3A 3G2JA 4XAQA 1WB9A 3NNSA 1YFZA 4UUQA 1BW9B 3LUGA 5EQFA 1U0NA 2WVJA 3NM6B 1AO0A 4WFQA 1EUDA 4OSOA 4M0EA 1T5DX 4B6PA 2R6GA 3EBOA 2V0NA 4K2HA 4LY3A 5DHPA 2F8LA 2FFRA 2V7TA 4U0JA 3X1XA 1BGWA 3T3EA 1HQKA 4HB3A 2GDZA 4EKEA 4LPSA 3HKEA 2FLKA 4RE5A 1PJCA 3AKYA 1GPAA 4OHRA 3T1OA 4U2FA 3VAYA 1R27A 1P5ZB 3ENNA 3MSXA 2DJ5A 1H2AS 3NTLA 1P5FA 1NXOA 2A1IA 1KPHA 1H9BA 1XZEA 4K8OA 3FH0A 5EKSA 1EVYA 1RR6A 3OE4A 1VXRA 4MA4A 5LQAA 5LQCA 1PR0A 2C4TA 3LWZA 5LB4A 5BW4A 2AZXA 2H1VA 1EGAA 2JI8A 2OP1A 4EG5A 3ZDZB 1H2HA 3VH4A 3LFTA 3L02A 2OCKA 1Z35A 1LGYA 4HRXA 3WNZA 1ZDMA 2XHZA 4UHBA 5AJXA 4DDVA 1BS1A 3GG9A 4DYDA 3REOA 3WTCA 1BTOA 2W6MA 4NU8X 1JSCA 4H08A 1DIOB 3L92A 4YMVA 1DWUA 4BJ3A 1Q12A 1WXFA 2XBLA 4QUDA 4XCVA 1R0XA 3N0VA 4YNBA 1VGQA 2ZI4A 3O94A 5F64A 3VAAA 5BVGB 2BR3A 1D2AA 1PTJA 1O0CA 2VUHB 4XYLA 4NXNB 3RANA 3M82A 2CYCA 4KTTE 4IVPA 1RWBA 2CHUA 4POAA 2NTNA 4G85A 1R3UA 4N7MA 3PE4A 4KO2S 3PNKA 4RK4A 4YYEA 1HI9A 4WXHA 2AI2A 4QZVA 6LDHA 5THXA 2CK3D 1Q3TA 1NRXA 1P2GA 3GF4A 4I55A 3TR5A 5KQPA 2XRZA 4JYZA 2UU9B 1CR6A 1V37A 3V8EA 3AVVA 3EK2A 2CXNA 2ZRGA 3T1HB 1YJQA 2WDPA 3IIJA 2YXNA 4CF7A 5KINB 1K5DA 2PLWA 1EG2A 3CLUC 4ZTBA 1FP4A 5C46F 1C14A 3D8TA 3I42A 5JCPA 2YC2C 3DE1X 3OSUA 5JD5A 4GVPA 4XLZA 3JAMA 1L7QA 1C29B 2I55A 2JZCA 1M6VA 2VUUA 4ZVTA 4KIUA 2ZKLA 2DQKA 2JIPA 2QBYA 3GNQA 3MWKA 3WJ7A 2G80A 4WZ6A 2AEJA 2XUGA 3PWTA 1X1TA 2MHCA 3NATA 1LQUA 1ZH4A 5E2BA 1JLHA 5LA6A 1EFDN 2F8MA 1YI8A 3O74A 4JH0A 3QVTA 4ZMSA 5MFZA 4XH9B 4BMDA 1GL6A 3SLRA 4YCLA 2P3OA 1Q19A 3G5UA 5JW6A 3K09C 4M8LA 4BUZA 3H87A 4DL9A 1I0LA 1DAGA 4UNRA 1QOPB 3R6WA 4RXUA 1WW3A 1HE8B 3ZTYA 1GT6A 3UT5A 2C1EA 3OJXA 2VTEA 1S2OA 3D64A 4L8YA 1EXVA 1KVRA 1KYYA 1OIVA 3V48A 3M6MD 4JC8A 1G64A 2I22A 1KGDA 1NHGA 2DPLA 5LBUA 3QF4B 4MQMA 1LBQA 1NP3A 2JEYA 3MHPA 3Q8WA 5E7QA 4JXJA 1RAIA 1EEXB 3RG8A 4LSMA 1AGPA 3AIKA 2X77A 4RD2A 5DIFA 5K4AA 3SX4A 1A4UA 1F0PA 1F48A 1E4YA 3A05A 3GZ4A 3JVVA 3OLYA 3PD1A 2E4YA 4FR5A 4M8SA 4RAQA 4S04A 2JVJA 4C6TB 4QQKA 3CLRC 3PTZA 4X92A 5KS2A 3UJ7A 1SUIA 2FWIA 2I4TA 2ZI5A 3DDWA 1AY0A 2MSEB 3IBFA 4AT1A 5DBFA 2HWXA 1Z18A 1ZUD1 2HGZA 1DDOA 3JQ8A 4NZZA 2ZJ3A 4OLAA 2P67A 1YR2A 3E7XA 2B36A 3DO5A 3NASA 4MITA 3NDBB 1IIRA 3R7LA 4G23A 3L4BA 4X41A 1IZZA 2C5HA 3VM6A 1XMOB 3VOAA 1IEWA 4CIWA 1KI4A 3G23A 3EDMA 4J1NA 4NCAA 3CWCA 5I4CA 1E94E 1N0WA 2F1RA 2X4GA 5TMDA 3UATA 1Z39A 3V7NA 4EMBA 4DMRA 5EJ5A 3OQ1A 1E9DA 5DGIA 4YY3B 1H5QA 3SZMA 1BVYF 3MIZA 3LPDA 2B8EA 4BFVA 3DOFA 3NWEA 4CZ2A 3BE5A 3RVNA 1DBRA 5I9MA 2XHEA 3HCPA 4K40A 2ZJ6A 4K9KA 1E4VA 3PDJA 3TIIA 3CS3A 1MC1A 4PICA 1U3WA 1CTQA 1TF7A 3LDHA 3CRNA 1PK8A 3OC0A 4C07A 2Q2NA 3KQVA 1Y5NA 2HQSA 4NLLA 4HGOA 1OH8A 1QRTA 2QD5A 4BTEA 4MRMB 1RZRA 2IH5A 2ZJ4A 3T34A 4A16A 3TG8A 4GPD1 2O2EA 4NP6A 2CLLB 2XXBA 2FPLA 3G79A 3PL5A 2HDHA 2XSZA 2QE7D 1DOZA 1CU1A 2X2FA 1PQYA 3UGTA 2I4LA 2GF9A 3DEZA 2QG9A 3BMQB 1KZ1A 4D9CA 5CBKA 4M76B 4X71A 5SYMA 4IX1A 5A6VA 3K5HA 1W9HA 1IM5A 4F85A 5DO9A 3FNEA 3QV1A 5CVTA 5FFMA 3DGEC 4RK7A 3TLAA 1QH1B 1G42A 2IYLD 2HPVA 1YDMA 3GJ6A 1BJKA 1TT5B 1C3LA 1GTJ1 4MEAA 3ZN2A 1V8BA 1BHSA 1U0JA 1YBAA 2HSDA 4XX0B 5PGMA 3GLIE 4HWOA 4XPIB 1T9GR 3GLUA 2EHJA 3LX5A 1AMNA 1H69A 2P2ZA 2XCTB 1M7HA 2YIJA 1HA3A 1ZGBA 1CQIB 4CLOB 2DWUA 2BEVB 1BQ4A 1UBSB 5FFNA 1M2OA 2IYNA 1O95D 1K6EA 4LDRA 3RVDA 1X1RA 3ZLTA 4LF8B 3T9AA 3KHTA 3TZCA 2X5JO 1JHPA 4EIWA 2WUWE 4QUKA 1GFIA 2W2TA 5JCXA 4QL3A 1XAGA 3DLAA 4WK0B 2PXCA 1YQWA 3KZKA 4UE6A 1R6TA 3IAXA 1M2GA 5CFQA 1KF0A 4I50A