1DRUA

Escherichia coli dhpr/nadh complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
b'ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1druA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1druA01
3JQEA 3QWHA 4ESOA 1ULUA 1DAPA 1P33A 3DFUA 3GA0A 1DHTA 3QRWA 4KUGA 1AE1A 4GBJA 1NNUA 1TI7A 3UXYA 5DULA 2QIOA 3HHPA 1X7HA 1LDEA 3PJEA 1UH5A 1O5IA 1X7GA 5C37A 3SJUA 3ETDA 3ON5A 3VKUA 3W1VA 3ANMA 4J43A 2FRDA 3OM9A 1HDGO 1DFHA 5JYEA 2VOEA 1BVUA 4L4RA 2XXBA 2Y1EA 4CR7A 4FC6A 4HFRA 4PCVA 3WGIA 1HLDA 4KDFA 5C5IA 3Q1LA 4F46A 3S2FA 5A9TA 1HSZA 2I67A 2Y67A 2O3JA 3A06A 3VH3A 3Q3CA 3AUSA 3HFGA 5THKA 3MJEA 3I6QA 2CVZA 1DRUA 1MC5A 1JVBA 3JD3A 4CMIA 3PDUA 4CM9D 3ASVA 1E6EA 4D42A 2NQ8A 4M55A 4ZQEA 5JO0A 3ADOA 1MFPA 2B83A 1OAAA 1E5LA 1DEHA 2JKVA 5JCJD 1I8TA 1R16A 2Y68A 2P5UA 4EUEA 2Q45A 3DXFA 4IXWA 1Q1NA 2YV2A 4AFNA 3VHRA 3DHNA 1YJQA 1ZXBA 2P4QA 2X0NA 3I6IA 3SJ7A 3DHEA 3WIEA 3ZV3A 2EKLA 3WQRA 4GX1A 3U4CA 4YT8A 3UAGA 4QUKA 4OOEA 4RVDA 4GX0A 2OL4A 3PQDA 4NFSA 2BGKA 3DZHA 3GVCA 1IHYA 3FWZA 3M1AA 4PIVA 1B15A 3RKUA 1TT5A 2YV3A 2GUGA 4KUHA 3KLPX 3E5RA 3PP8A 3EHEA 1P3DA 5HRUA 4WLVA 5TGDA 3ETGA 2PNFA 3I83A 3DAPA 4K1LA 4AJ4A 5CDSA 2B4TO 2IYPA 3JYQA 1HE5A 4J9UE 3GY0A 4Y8VA 4P4LA 3GR6A 4MINA 1U4SA 2VWPA 5HBRA 3RFTA 3O26A 2EW2A 1K0UA 4CLEA 3RU9A 4NZ9A 4RDHA 1N92A 3AU9A 3OP4A 4OQZA 4BGVA 3Q0EA 1PJQA 3G3EA 3VDQA 3KBOA 2NVUA 1RPNA 3ZW8A 1IY8A 1IE3A 4D3FA 1E7QA 1LI4A 2VT3A 4CQLB 4YT5A 4JP2A 3QY9A 2ZB7A 1KIFA 4A5OA 4A03A 3L77A 1Z74A 4OYRA 3KO8A 1ZIDA 2QHXA 4ND4A 4RPKA 1NHGA 4DGSA 5ILOA 3JQAB 1HEUA 2Y1FA 4LISA 3B1FA 2DPGA 1K6XA 4TROA 1Q0QA 3SLKA 1G0NA 1XYGA 3JYLA 4N5MA 1YB1A 2ZK7A 1B8PA 2CVQA 4DREA 3EDMA 1BG6A 2D5AA 3A9WA 3JYOA 4BGUA 2J8ZA 3TWOA 4DA9A 2B37A 5IDQA 1B8VA 1CJCA 1N2SA 3L0DA 1CIVA 3OJEA 5CG1A 1GZ3A 4Z3DA 3HADA 4CV2A 2P2SA 1E77A 3MTJA 3H2SA 5KJCA 2VT2A 4H7PA 2IEDA 2GYYA 3GDOA 4IS2A 2R00A 1KY5A 3OICA 2O3TA 2OBNA 2NUAA 4RF2A 3ZWAA 1ISIA 5HM8A 2Z5LA 4WLEA 4MVJI 3RIHA 4EBFA 3ZNQA 3PPIA 3HDQA 1WMBA 2D0IA 4TQGA 2X5OA 3RUEA 4YRBA 2CDAA 5DNAA 2ZCVA 3GDGA 5A3VA 4Y6PA 1MGOA 3V1UA 3IIEA 3OJFA 3S2EA 3QW2A 1GL3A 3KEOA 4I5DA 1SOWA 1OBFO 3W4KA 1T2DA 2E82A 3Q11A 4OAQA 3V5NA 1HE3A 1N1GA 1D8AA 4URFA 3SXPA 1CWUA 4DLAA 8ADHA 3JD4A 2X4GA 1IHXA 3IMFA 3RUHA 5BNTA 4HADA 2DC1A 2OP1A 1F0YA 3WSWA 3GGOA 4B4OA 4MDHA 1JA9A 1I2CA 4DYVA 1LRKA 2BFPA 2FR8A 1T4BA 3PJGA 1DFIA 1NQTA 2X5JO 1BWSA 2B69A 1ZJZA 4BNKA 5I7VA 1ORRA 4CLXA 4QQRA 4OXKA 2OOSA 2YFQA 3DBRB 2AQIA 2ZJ0A 3AI2A 2IZ0A 2FPIA 3KXDA 2Q2QA 3IOYA 4Q9NA 1NQAO 2BGMA 3EY4A 4EI2A 5JAZA 4IZHA 1E92A 4DIOA 3DFZA 3UUWA 2DTXA 2GRAA 1YQGA 2VHWA 4EEXA 5TRTA 4JBHA 5JDIA 3I9LA 3L07A 4NU6A 5U4QA 3RC9A 1UZNA 3CZMA 3GT0A 4YRAA 5B4UA 3I1JA 1EE2A 1LDBA 3PGXA 1FDWA 2PD3A 3RKRA 1BGVA 4BMVA 3WS7A 3WYCA 1EUDA 2Y0CA 1UAGA 4OKNA 4BV9A 4B4VA 2Q46A 1H93A 1ZSVA 2CDBA 4EZBA 2EHDA 1JKFA 1NQOA 3AOEC 4WLUA 2XXJA 4RPLA 3WR5A 1MUUA 3LQFA 4MPDA 5EIOA 4OSOA 4IZIA 3KEQA 3ORFA 4ALJA 4TZTA 5L53A 3QVTA 3U9LA 1GCUA 2CUKA 3I9JA 4CL3A 2UAGA 4MP8A 2JHGA 3M1LA 2Q1WA 5BNFA 2VHVA 1K5HA 4FR5A 1PL7A 4YBZA 3L9WA 4XJSA 4YJFB 1ISHA 3ANNA 4N5NA 2Q2WA 1NX6A 1XSEA 3JQ6A 5I8WA 5KNLA 1KETA 4IJVA 3BMOB 2DUWA 2JFFA 3VPGA 1P9LA 3LT2A 1AHHA 1V9LA 2DTDA 4BNGA 5DZSA 5F21A 2WD8A 3FTNA 4UVDA 3BMNA 4XZ3A 4GI2A 4BKPA 1Y8QA 3L6EA 1EDZA 2AHRA 4ND5A 1IPEA 1GYRA 2Q99A 8LDHA 4HFJA 2Q2VA 3E18A 1EFLA 4XCVA 5G0UA 1GTMA 2EIHA 4TMFA 4F6CA 3CMCO 2HMWA 3QP9A 3G1UA 1AGNA 2G17A 2Z1NA 4A73A 6ADHA 3GEDA 5BR7A 4BKUA 1H6BA 4L4SA 3ETEA 5C3MA 4RL6A 1GQQA 3E48A 4IDGA 3P7MA 4CQLA 4M1QA 3WICA 1ML3A 3CZRA 1RM4A 3QSGA 5A02A 4ZD6A 5T5QA 2V65A 2CSUA 1Z82A 3QVXA 4PRLA 3WGOA 3NV9A 4JNKA 1JKIA 3I23A 4QT0A 4R01A 4XYMA 3KHUA 2H1SA 2X6TA 5DDIP 1ENYA 4J4HA 5G0SA 4P38A 1SB9A 4RPGA 1CDOA 1DC4A 3WMWA 1N1EA 1JDJA 1M6HA 3RJ5A 4N5LA 2HMSA 2A4KA 3P2YA 2X9VA 4PLTA 1XHLA 4UAGA 3KM0A 3UGKA 3MEQA 1HZZA 3QWFA 3ICPA 2B35A 1UZMA 4RF4A 3WSVA 3A4VA 3C7CB 4AG3A 5KVQA 3GNTA 3OQBA 4MVJH 2OORA 4IDAA 4BL5A 3QLJA 3U4IA 4IUYA 1BHSA 1Q2XA 1IB6A 5BSHA 4BQRA 3JQ8A 5TT1A 3PLRA 1P45A 5TT0A 4HNGA 4CM7A 3JD1A 4DMLA 1HZJA 4MKXA 4E2YA 3WB9A 3LF2A 3NRCA 4NPCA 4R3NA 4WCDA 5FYDA 3TSCA 2PKRA 5I7EA 1EMDA 3ZHXA 1I0ZA 5DP1A 1ZFNA 2AQ8A 1UZLA 4KMSA 3VZQA 2DTEA 4AJKA 3C8MA 1A71A 1PWZA 2Q1TA 2C0CA 4OMUA 1LLUA 2V6BA 1IPFA 3GNSA 4R54A 2Q49A 2Z1MA 4CLOA 1GR0A 1YE3A 1HF3A 1JQBA 3FRJA 4EW6A 1E3WA 5T8KC 1PJ2A 5A05A 2YDXA 1N5DA 3ZU5A 1BXGB 3VOSA 2V7PA 4DIBA 4J1TA 3ZNOA 2Y1CA 4LGVA 1EZ4A 3U5TA 4J9VA 2FSVA 1A4IA 1N9GB 4KDEA 1R0SA 1E3IA 3KYCB 4TZKA 5JXWA 5DBGA 1Y7TA 1E7WA 4CR6A 4OH1A 4IDCA 1Y8RB 1FDUA 3MZ0A 1DJQA 3WBBA 4PG7A 3WGHA 4XYGA 3ADPA 1GFSA 1T1SA 5U1PA 3SC6A 1E1NA 1PJBA 3GAZA 3INGA 1WW8A 2H6EA 2IDZA 3JQFA 3NTQA 1K3TA 2PH5A 4Y67A 4E2XA 3DBLB 1I3LA 1X0VA 4NQZA 3BZUA 3TOZA 2VTEA 1HDZA 3LT0A 4E31A 4AVYA 2QZ9A 2ZTVA 4Z0TA 4E4YA 2EP5A 4IPTA 1EVIA 3BXXA 1UP7A 3FI9A 2EKPA 1SEVA 1KVRA 2YV1A 1YWGO 5T67A 3AY3A 2O4CA 2R2GA 3ONEA 3NX4A 4EJMA 2C7VA 3ZWYA 3GFGA 1E3SA 2VYND 1ZEMA 4J7XA 3DMYA 3I4FA 4BNYA 5JMWA 4GKBA 4Y6RA 2C7GA 4R41A 2GPTA 3E9QA 2YYYA 4ALLA 3GPIA 2GD1O 2OFPA 2PGJA 3ZWOA 2FN7A 3AOGA 4PFJA 4DIFA 2PZLA 3WQSB 4O59O 4DUPA 3VDRA 1RYEA 1ZMOA 5JDCC 3RUAA 1Y81A 3H5AA 5B37A 5DP2A 3H3FA 4PRKA 2PZMA 3PQFA 5CP8A 3G79A 4KP7A 3F3SA 2BFMA 5LCXA 4Y6SA 4GLLA 4D44A 2ZYAA 2JCYA 2RHRA 3ZWBA 1GY8A 1T1RA 4XGKA 5TJ9A 4OJNA 1E7YA 1I33A 2GO1A 5TNXA 1E3EA 1J6UA 3P5SA 3LC1O 3AI3A 2H5LA 4G81A 5JDIC 4MVJM 3D3WB 4RZIA 2FR1A 3I3OA 1YBAA 3HJAA 2BGLA 5JAQA 3TDKA 4BO6A 2P91A 1Y8RA 1SOVA 3PWKA 2QX7A 3BYZA 3RUCA 4EUHA 2QYTA 1L7DA 4MVJA 1O89A 2DVMA 2OHXA 4U6SA 4MKZA 1NBOA 4HBGA 4J1NA 2HRZA 3EW7A 4BO1A 1ID1A 5L3ZA 4RORA 4JK3A 1B14A 1UXHA 1BXZA 2P5YA 3B6ZA 1VRWA 4LW8A 1I3KA 2DLDA 1VJ0A 3CINA 3FCOA 2Q3EA 4YQZA 4LRSB 4EJ6A 3PI7A 4UVIA 5EPOA 3W8FA 4IIVA 5K6AA 4RQUA 3BIOA 2YDYA 5TQVA 5KJ6A 1C1XB 5B4TA 3HFSA 5IDWA 1DB3A 3PIDA 1NM5A 4NBWA 2NACA 1B2LA 2C20A 2NU8A 3TQHA 1VLLA 2NTVA 4NFYA 1X15A 3MJCA 3RU7A 4J1SA 3H2ZA 1D1TA 1ZW1A 4PLYA 4UVGA 1C14A 5BNIA 1PS0A 5JYAA 1KY4A 3RROA 1E3LA 3E03A 1SNYA 2EJWA 4NI5A 1XEAA 4XGIA 2BFOA 2NADA 1UDBA 3RAJA 5F5NA 3EUWA 3RC2A 3IC5A 1KEVA 1SPXA 3FNEA 1HWYA 1H0KA 5CDUA 2O7SA 2Z95A 1PU2A 4Q3EA 2BFAA 4R1UA 5ICMA 1YONA 2GCGA 5JFOA 1PGQA 2GNAA 4MP6A 4ZRNA 2VWHA 1OZAA 4J3FA 4CMGA 3NDIA 5IZCA 2WD7B 4RVSA 1B26A 5MGBA 2VHXA 1RKXA 4EUFA 1F12A 4GVLA 1C3VA 1C0LA 3QE3A 3C1OA 1O0SA 2X22A 3RVDA 2YUTA 3ROKA 1NVMB 5T73A 5LDGA 3ROMA 4J4TA 1JLLA 1YBMA 2YZ7A 2JCXA 7MDHA 3FNFA 3TPCA 4BGIA 3F1KA 2C5EA 5G2OA 4ALKA 4LMRA 3OQ6A 2FMUA 4AJPA 4CQMD 4DBVO 1SO8A 1WDMA 1P0FA 2Q1SA 4BUCA 4HKTA 3RUFA 1XGKA 3UCXA 4D0SA 2X9NA 3IKTA 2HMUA 1I30A 1OC2A 4P4GA 1W4ZA 2PD6A 4OOFA 4WECA 1KVUA 1D1SA 2HLPA 1JKJA 1LDMA 2CVOA 3GRPA 4E6PA 4TRMA 3PVZA 4CUJA 3GH3A 3ZWNA 3WNQA 1LLCA 4JX8A 3EK2A 3IUSA 4E2WA 3MOIA 1QSGA 1XCBA 3ST7A 2B5VA 5JSFA 2O3QA 2PGDA 4I9HA 3D5QA 2X86A 4XRRA 1Z75A 3AI1A 4U0KA 4WNIA 1WVGA 1T24A 1DC6A 4R3WA 1PJTA 4GKVA 3GHHA 5FEUA 1GEGA 2OMEA 2EW8A 4IMRA 3UW3A 3DOJA 3VZPA 2I3AA 4BNWA 4FFLA 3CIFA 1IULA 2HMVA 4ZQGA 3BMCB 4XRGA 2CMDA 1TEHA 1NFQA 3DZJA 1NWCA 3LK7A 4IINA 3E9NA 2YQ5A 4INAA 3CE6A 3K2EA 4Q3BA 2DAPA 3UVEA 1BVRA 1F8FA 1PL6A 2FY8A 5A5EA 4Z0HO 1W0CA 1EVJA 2J3JA 2E37A 4XA8A 1IOLA 2PWZA 4UEOA 1VI2A 1B3RA 3L6DA 3CMMA 5IG2A 4QEDA 3GMDA 5HS4A 4J1QA 1RYDA 3VPSA 3VPXA 1DIRA 5AVOA 2QW8A 1T2FA 4Z9XA 5JC8A 3RSHA 3WWYA 5G0VA 2OXIA 1K2WA 4FFNA 4YWJA 5COQA 4EEZA 3IJPA 3AUAA 3I5MA 4ND2A 1GEEA 3WWZA 3CUKA 5FF9A 1U5CA 5JCJA 5KKCA 5F1PA 1NYTA 5JY1A 1WDKA 4FB5A 4IJWA 1BXKA 1W73A 1DIGA 1XWFA 2GN8A 3D1LA 3MJ4A 3AY6A 3KYDA 4FOSA 2I9PA 3QVSA 4JGBA 3PHIA 3GLQA 3NGLA 1WZEA 5KJFA 3BTOA 1DLJA 3NEPX 1ZNQO 1OMOA 1T2EA 4H3VA 4YTEA 5TF4A 3C1AA 1T4DA 1TT7A 2WE7A 2QG4A 5EMHA 4GSKA 4YR9A 3LC7O 1ULSA 1Q7GA 4AJ2A 2PZKA 1UAYA 4BNVA 2VRCD 4FJ2A 3OA0A 3DL2A 2EWMA 1PTJA 2YY7A 1ISGA 4CQMB 4YJHB 5JC1A 4DYDA 1ENZA 4ZGWA 1B0AA 3OECA 4WLNA 3PTZA 1HDXA 4MIYA 5IXYA 4BO3A 3GK3A 1JN0A 4J7UA 3G1TA 1W6UA 4XEHA 4ZN6A 4XYBA 3HG7A 1QV7A 3OIFA 4ID9A 1PQPA 3LVFO 3O38A 3DAGA 1E7MA 2R6JA 3TF5A 1VL8A 5ES3A 3RBVA 3F1LA 3GEMA 2C54A 4CUKA 1R0LA 1RM5A 2O3RA 3AU8A 4B3JA 5KCZA 4CMBA 2GZ1A 4RQTA 4MVJE 5J23A 1C0IA 1S7CA 1KEWA 4JJFA 5EESA 3FPCA 3WIDA 1ONNA 5IXSA 3IUPA 3WG9A 3WYEA 4YCAA 4LVUA 4BO0A 2AG8A 3UFXA 3PXXA 2RAFA 3H5NA 2CNBA 4W7HA 4CUZA 5KOIA 4G65A 1R4NB 3KOUA 4FQ8A 2PTGA 2GF2A 1UDAA 5EJ2A 4XKJA 5GMOA 2W98A 4H16A 4XX0A 4NIMA 3SLGA 4IDFA 5I9LA 2VYNA 1VL0A 2PR2A 3INRA 1SZJG 3CSDA 4JBGA 5F3RA 1AXGA 3AY7A 4LN1A 3H9UA 1GQYA 4FDAA 4GX2A 4TKLA 1EQ2A 3H65A 2GGSA 3H8VA 4B4UA 3ZU2A 4E3ZA 3A28A 1ZK3A 4TRNA 4BS9A 1ONPA 2DFVA 5JAMA 5L7WA 2E6UX 2C59A 3VZSA 2NU7A 1UXJA 5JPIA 3UCEA 3ROPA 3BMOA 4E5NA 3E6AA 2DT5A 3TFOA 1LQUA 4YA6A 3PZBA 4UUMA 1M66A 3WFIA 3P19A 2HDHA 2W2KB 3AWDA 1UP4A 4BO2A 1NPTO 4CQMA 4GSLA 1LEHA 3H9GA 4KWIA 1EUZA 2XAAA 1H6DA 1WWKA 4ZICA 1D4FA 4J4BA 4Q3AA 5L4LA 3S8MA 3ROQA 3NJ4A 1WMAA 4BKQA 4BO4A 4W82A 2GZ2A 1DSSG 1YXMA 3NUGA 1YOVB 1BW9A 5C7OO 2VNAA 2X7HA 1MC4A 3F4BA 4IDBA 5JCXA 5JDCA 3KRTA 1HTBA 1L7EA 5DF1A 1JW9B 3IDSA 3HN2A 4BNFA 2J3IA 4Q3CA 1DPGA 1EVYA 4FGSA 2VRCA 1QORA 1ZVMA 4P22A 1OI7A 1VM6A 1ONOA 2O50A 3WMXA 3LLSA 1KVQA 4OQYA 5H83A 2ZCUA 5KTKA 4CLRA 2UV8A 4ALMA 1R4MB 3NTOA 2I99A 4NJMA 3ZZNA 5KWEA 2NVUB 1XLTA 3KSZO 2I76A 3KV3O 4GQAA 2C5AA 2FZWA 4J90A 4IQ8A 4JJIA 4U5QA 2LDBA 3SEFA 3TFQA 1J0XO 3A1NA 3BHMA 1PZFA 2EJVA 4AJ1A 4CMCA 3C7DB 5JW6A 2XOXA 1YGYA 3EZLA 4A26A 3GUYA 2FPGA 4N18A 3UN1A 5LDHA 1ADCA 1LNQA 3V1TC 4JLWA 4MJLA 1R0KA 3R3SA 3QA9A 4E13A 1IYZA 1A27A 1HRDA 3K92A 1LSJA 4B4WA 5JNLA 4XGNA 1UXIA 2V6MA 2VUTA 4TVBA 1KOLA 3V2UA 4DC0A 3WQQA 3WGQA 1Q0LA 4CMHA 9LDTA 3EC7A 1VKNA 1ISFA 4E12A 4A0SA 1M67A 1PJSA 5BSEA 3T7CA 3ITKA 2ZYDA 4WCFB 3JQ7B 1HYHA 3NDJA 1LA2A 4W6ZA 2AE2A 4BNHA 5K0ZA 2YW9A 4NK4A 2WYWA 4GGPA 4XJTA 2YHUA 3WXBA 1DXYA 5CFZA 3AM5A 3RUIA 3RCBA 4ZVVA 3E82A 1KBZA 1XR3A 3ZWPA 1Y1PA 2JJYA 1DIHA 3T7EA 2JD1A 5AQ1A 2VUSA 5FI5A 2ZQZA 4TRJA 1R15A 2VYVA 4AJIA 4DPMA 1AUPA 2YJZA 1JVSA 5ENDA 3NJ8A 1E6UA 2C82A 3W4JA 5HTOA 3GG9A 4RVUA 1DJNA 1Z6ZA 3DO5A 3U4DA 3RWBA 1F06A 1UDCA 2EXXA 4GPD1 4L0QA 5COAA 1MXFA 2D1YA 5EQFA 3IP3A 3TZKA 3ZGYA 4YPOA 1HDYA 4HFMA 4FCCA 1A7AA 3PK0A 3JQAA 4W4TA 2YHIB 1GYPA 2QQ5A 2RH4A 4CLHA 4CJXA 4K9DA 2UUOA 4YB8A 1ZJYA 4KQWA 4ILKA 4FN4A 1B7GO 1XA0A 4PZCA 1TT5B 5TC4A 3AK4A 4IIUA 4A2CA 4XD2A 1VJ1A 4B7XA 4JN6B 4DTIA 4PZDA 4LRTB 1U7TA 4D3SA 2J6IA 5EINA 3QIVA 4O0LA 4E32A 2O7QA 3G0OA 1WPQA 4YDRA 4JJGA 3ZV5A 4PLHA 4ROSA 4DQVA 2ZQYA 4AJHA 4FOOA 4BVAA 2DUUA 5JS6A 3GGPA 1H5QA 1NASA 3IP1A 5KKAA 4I5FA 4OIMA 1MB4A 4PLFA 1G0OA 4M87A 3BMCA 3Q2IA 4DBZA 3K31A 1U28A 4J0EA 2DBVO 3PYXA 2AW5A 3ENKA 3D7LA 3VVCA 4B7CA 1C1DB 4XQ9A 3FHLA 1H9BA 1MXHA 2GDZA 1EQUA 4Z6KA 3MCVA 1XIVA 2CD9A 4J2OA 1ZBQA 5TS3A 3H5RA 1P1FA 1XQ6A 4FPXA 2E4AA 1ENOA 3PYLA 2DU8A 4LMPA 4IM7A 2UUPA 4Y98A 2BD0A 3ZWWA 5CEEA 2HJSA 4M86A 4ZQHA 4A7PA 3AM3A 4LCEA 4S1VA 1F8GA 4R16A 1N7GA 2E48A 4L9RA 3QQPA 1IZ0A 2AQHA 3PHLA 2BMAA 3P2OA 5C7IO 4OHUA 3V2GA 3K73O 4GVXA 1LC3A 1ADGA 1PSDA 3I52A 5FFFA 1VJTA 2GR9A 2C2YA 4J0FA 1C1XA 1CYDA 2O23A 3MJSA 2Y05A 4S3MA 4FSHA 1EVZA 1R37A 4XIJA 1NFFA 1I10A 4DRYA 2WTBA 4DL9A 2X8LA 1PJCA 1WP4A 1E7RA 1DOHA 1PWXA 2PD4A 3UCFA 2YFHA 4FJ1A 1MV8A 5AXDA 4AJJA 5EN4A 3HDHA 5G4KA 1O94A 1NR7A 2AEFA 5JYFA 1G1AA 4WCFC 5L7TA 2AEJA 1GZ6A 4UVEA 1P0CA 1ARZA 2X23A 4KQXA 2D5CA 3D5TA 3MTGA 4J7CA 5JLAA 3NYWA 4FBGA 3DZBA 2PK3A 3AM4A 4YACA 1XU9A 3RFVA 1WLYA 3OEYA 2HO5A 1DBVO 4LSMA 4I8XA 3HSKA 1YO6A 4NBTA 4II3A 4QX6A 2ZB3A 1LTHR 1P44A 2DM6A 3AFNA 3U62A 2D8AA 5AXCA 3WLEA 5I8ZA 5A3JA 1FMCA 2WYVA 3Q2KA 2GN9A 1IUKA 5L4NA 1U3TA 5DOVA 4YT2A 4I08A 5A1TA 2DFDA 4YRDA 4E2ZA 1PX0A 4YQYA 4R1NA 1ENPA 3ZWXA 4RPJA 4UULA 2GZ3A 1B8UA 5TJHA 5ILGA 3W4IA 2UDPA 4F3YA 4I9UA 1W8DA 1HETA 5A06A 1L1FA 4PG5A 4MVJP 1ZK4A 4U8GA 4DQXA 2BF7A 4OM8A 5CHEA 2O3UA 5CDTA 2F1KA 4JIGA 3C3XA 2FSSA 2IYOA 4GMFA 4NG5A 3M2TA 1K89A 2PV7A 4WLOA 3DZFA 4RCVA 3A14A 4PG4A 5A9SB 1SAYA 3NT2A 3Q6IA 4XDZA 3WBFA 2JAPA 5MDHA 4O63O 4GAEA 2VWGA 1GAEO 4WJZA 1UR5A 3W6UA 3ZV4A 4H15A 2BELA 4Q3NA 1ADFA 1QRRA 3FD8A 5KJEA 1R66A 3UOGA 3WFJA 4ND3A 4GGOA 3PHHA 2A35A 2WDZA 2HK9A 1RM3A 3DAFA 3KLMX 1U5AA 3DEYX 4EGFA 4G5HA 2VRBA 3PHJA 1LLQA 3O03A 3PEFA 3DWFA 3AW9A 3BHJA 4R5MA 1HKUA 2PLAA 3RUDA 2Y0DA 4N54A 1CEQA 1WNTA 1U8XX 5AOVA 2NSDA 1C0PA 1C1DA 3PLNA 3QVOA 2C07A 1DC3A 4CM1A 7ADHA 2BHLA 1I24A 3O9ZA 1V8BA 3KSDO 1U7HA 2W90A 4OXNA 3RI3A 1U2GA 1DIAA 1ZK2A 4B8WA 3VPHA 3L4BA 3LU1A 3NGXA 4J91A 4DPLA 2HK8A 3VZRA 3JQGB 3CEAA 3KYCA 5A4DA 3MJTA 4KOAA 2O2SA 4JBIA 4OO3A 3JQ8B 1GD1O 2OUIA 1SCUA 4E21A 4R1SA 3KZVA 1V3VA 5IN4A 1HDCA 4C4OA 3QV1A 1NVGA 4RF3A 3NKLA 4R9SA 2SCUA 4LSWA 1YQDA 5DT9A 2OO5A 3DZGA 4EDFA 1U1IA 3V2HA 3E9MA 2FR0A 3F46A 3D3WA 3D3EA 4O5OA 2EGGA 4PN3A 2I5PO 3U09A 3MJVA 3WGZA 2NWQA 3B20A 3OH8A 5ENVA 4MO2A 3QVWA 4FS3A 4JP3A 3VC7A 5ER6A 1T2CA 2Q50A 1HE4A 3F9IA 3BTUA 4IJKA 4GMGA 5JY6A 3VH1A 2XPCA 3DZKA 4FGWA 5F1KA 3ZH2A 4F45A 4K6FA 4CR8A 4D43A 2G82A 2RH8A 2NQTA 1PQWA 4E5YA 4YJDA 1VPDA 4NK5A 4XB2A 3OIDA 1J5PA 1DO8A 1GZ4A 3WOHA 3R3JA 3U49A 1YL5A 5JMPA 1MFZA 3EAGA 3KTDA 4CMKA 1PR3A 4E30A 5EQDA 1UJMA 2RBEA 4ND1A 3WLFA 4AJEA 1EUCA 5BSGA 4MVJF 1VKOA 3GVXA 3VTZA 2VZ8A 3JV7A 4LVCA 2ZTLA 4W9NA 4BB6A 1BDMA 3DB2A 2UYYA 3EYWA 3LSYA 4MVJG 5ITVA 5G0WA 5IZCC 2HRBA 1M2WA 4L8VA 3PRJA 1NPDA 3JQFC 3OF2A 2CF5A 1QYXA 3H4VA 3K6JA 4MOWA 3I9MA 1DLIA 4CODB 4KZPA 4FIZA 4WCFA 1PQUA 4IGFA 1AHIA 4BNZA 4NU5A 1ZSYA 1YL7A 1OOEA 1R12A 4LCJA 1I01A 4UUOA 5HWSA 1E7SA 3NDRA 4KWHA 1N8KA 1NFRA 2JFHA 1ZCJA 3GGGA 3B70A 3TJRA 4WK6A 1TXGA 1N7HA 2QRKA 4FFPA 3U4HA 3LT4A 3PYMA 4NDNE 2J5KA 4QFDA 1QYCA 2HK7A 4CM8A 1U8FO 2B4QA 1T25A 1KC3A 2VQ3A 2FWMX 4DXHA 1GPDG 1QLHA 3R6DA 2NNLD 1Z7EA 3KVOA 1JTVA 3Q9NA 4G2NA 1XQ1A 4RDIA 2CY0A 3DTYA 1KERA 5ER9A 4B8ZA 2CZCA 1PS9A 3K5PA 4I1IA 3U0BA 3H9QA 1E5QA 4FJ0A 4D3DA 4MIEA 5IN5A 5KIAA 1YBVA 4E0BA 2NTNA 5U9CA 3B1JA 3JQGA 4PGFA 3ZV6A 5G4KB 4Z3KA 2PZJA 2JD0A 1YH3A 5L4SA 3LYLA 3I4CA 2G0TA 3T4XA 4DLLA 1NPYA 5C7LO 3D4NA 1NHWA 1P1IA 3WTCA 4ZJUA 3SVTA 3DBVO 4XR4A 3EZYA 5ICSA 1M75A 3H7AA 3ZNPA 4W7IA 4QFCA 4E5KA 1PGOA 4QO8A 3OQ1A 4TKMA 2J3KA 4BKRA 3GF4A 3VTFA 3D64A 2VZ9A 3NT5A 1O95A 2B36A 2RIRA 2G1UA 3BA1A 4OL9A 4NHEA 5BT9A 3N58A 1LRJA 2GERA 4FFOA 1OFGA 2TMGA 4NNJA 5EL0A 1LXCA 3GDFA 3OETA 1YJ8A 4WGGA 4X54A 2AXQA 5A03A 3JYNA 2VUUA 4RVHA 4OGWA 3F6YA 3HZZA 3PWSA 3TZ6A 5B4VA 3DOCA 3KETA 3PFFA 5GY7A 1ZH8A 4I5GA 4JCOA 5A9SA 4UUNA 1Q7CA 3ONFA 1TB4A 1YB5A 1BW9B 4XYEA 1WAMA 3O8QB 1PEDA 4PG6A 4BNXA 4U7WA 3ZN2A 4O6VA 4NMHA 5JO9A 1LUAA 4YT4A 2Q1UA 4KTVE 1J49A 5TX7A 1PGPA 2AE1A 3HDYA 3DHYA 3JQ9A 4XIYA 3WX0A 4B3HA 3WDSA 2IZZA 4JROA 4D0RA 2RCYA 1YDWA 2EG9A 1LLDA 1SMKA 4IDDA 4WPGA 3S1LA 3FPLA 1G6KA 3WGYA 2W2KA 2ZB8A 1D7OA 3DZIA 3ENNA 3I9NA 2CDCA 4E33A 5IZ4A 2AEMA 4HUJA 1NAHA 1U2DA 3IL2A 1R4NA 3EVNA 4J49A 2EF1A 4PLPA 1JWAB 3DMTC 3K8ZA 4YVFA 4XB1A 2D4AA 3SC4A 4JXKA 1IL0A 3ZDFA 2B5WA 4EJ0A 3G17A 3JQDA 3VH4A 1XG5A 4II2A 2VTDA 4AJLA 4IQ0A 3W6ZA 4QXMA 3JQCA 2EP7A 1DAOA 1I2BA 3GZ4A 4HX5A 1FF9A 3LZ6A 2CF6A 4FW8A 2D3TA 4RJTA 1GUFA 2BI8A 1KS9A 3U3XA 1DRVA 2F00A 3GVHA 3JQAD 3ZHBA 2VN8A 1K6JA 5DOZA 1P74A 3DR3A 3K9QO 4GH5A 5EERA 5DCUA 1P1RA 4A27A 2NTJA 4HWKA 1QYWA 3H6KA 4YXFA 4CM4A 2Y99A 5BQFA 2B4RO 3RJ9A 4YJGA 1I2ZA 1X1TA 2HAEA 3FWNA 4RGBA 3UF0A 1H6CA 1PZGA 3GN2A 1BDBA 1RWBA 4Z9YA 1ZMTA 1PJLA 5FWNA 5F1OA 2AG5A 4BNNA 1JAYA 2NVBA 2DBRA 2WE8A 4P8RA 2Y93A 3D0OA 2JCVA 2Y1DA 3FTPA 2DPHA 4HXYA 4XQCA 1VE9A 3OEWA 4U6QA 2NU9A 5DCYA 3FNGA 4BNUA 1QP8A 2Y66A 2WYUA 3ITDA 1U3VA 3WGGA 3OSUA 2J3HA 4IY1A 4BNIA 3DQPA 1JU9A 3QJ5A 4R69A 1E1KA 4CLOB 2O4UX 1LBEA 5HA5A 3DOOA 5L7YA 4D41A 2WM3A 4Q3DA 3TOXA 4BOYA 5L45A 1A4UA 3OJOA 3WNVA 3RBXA 3HUDA 5DN9A 5GZ6A 2HSDA 1D3AA 3OJLA 4IJUA 2IZ1A 4L4XA 4B3IA 4R1TA 3GRKA 4FD3A 2YHIA 3ONDA 3VPFA 4CM6A 1Y5MA 5KVCA 3FSRA 4XR9A 3UH1A 2J5RA 1A9YA 5AXBA 1LDNA 4BMSA 3ICCA 4J16A 1GYQA 4WOJA 3DBRA 3FR7A 5IF3A 1RJWA 1SB8A 1PJ3A 1U3WA 2BRUA 1PS8A 1Z73A 4R68A 4MIOA 3W8EA 1DRWA 3PJFA 1GDHA 4M49A 4BO5A 1TVEA 4CMJA 1ISJA 2Q22A 3LT1A 1R4MA 3VKVA 4NJOA 3C85A 2X0RA 5G0TA 3E1KA 3GN1A 4XDYA 5AYVA 5KJ1A 4J2HA 3N7UA 4BO7A 4WASA 2O2YA 1H2HA 4AICA 2PKQP 4YAIA 4RZHA 4BO9A 4DQUA 4FC7A 2GASA 3FF4A 1O8CA 3WJ7A 2W4QA 4L74A 1HXHA 2NV6A 4XWYA 1Y9AA 1I3NA 1HYEA 1CRWG 3DTTA 4PG8A 3WTBA 4BHTA 3QWIA 1Y5RA 2G76A 4GLOA 4IGEA 4MKRA 1QV6A 1JAXA 1BRMA 2V6GA 3JSAA 1MA0A 4BNLA 3NAQA 3KSUA 3FNHA 4W9NC 3CTMA 3CXRA 4NH4A 4O1MA 1UP6A 1Y9EA 4PZEA 3PIIA 1HSOA 1AXEA 1V35A 3ULKA 3LLVA 2P9GA 3PZRA 1QR6A 2GSDA 2JFGA 3L9XA 3T4EA 2HQ1A 1SC6A 4QSMA 5L51A 2PKQO 3V1YA 4PLVA 4NBVA 4XYLA 4BIIA 3HB4X 4BO8A 1VC2A 4RF5A 2IRWA 3JYPA 2HMTA 3GVIA 3BTSA 1WZIA 2BKAA 3O4RA 4RLSA 2LDXA 1SEPA 1X13A 3C1TA 4Y9DA 5CPFA 3HE3A 4CMEA 3OIGA 1EBUA 3KYDB 3O8QA 1YVEI 4IXTA 3GC6A 4NJMB 2DBQA 3F5QA 2GN6A 2WWRA 5IDYA 1PR9A 3HQ4O 3M2PA 1EE9A 4HY3A 4CLRB 3MOGA 1YS4A 3OA2A 1B16A 2I6TA 4GX5A 3X2FA 3INTA 3GZNA 1PZEA 2UVDA 3KUXA 4DPKA 1P77A 2AA3A 2VZ0A 3AOEA 4OSPA 1B3BA 2R00C 5CEJA 2ZKLA 3KB6A 2P68A 3RFXA 2DKNA 2IE0A 4DC1A 1PIWA 3AUUA 1E6WA 4TRRA 1FDVA 1VSUA 1DIBA 5BSFA 1CQJA 3OBBA 2CFCA 1MG0A 3VVBA 3NTRA 1EEHA 1V6AA 1HDOA 2Q4EA 2WSBA 1VSVA 2Y1GA 2ZJ1A 1X14A 3GOHA 4E5MA 3L4SO 4RLHA 4R4JA 1ADBA 5F5LA 3RC7A 4OXYA 2GLXA 3KYBA 5TLSA 4XQEA 3UKOA 3N74A 4YJGB 1KVTA 1FK8A 1ZO8A 3PWZA 4YJHA 1DDOA 4CM4B 4BV8A 2XF8A 2PY6A 3RASA 1V3TA 3C7AA 3E8XA 2C29D 3WGTA 1UXKA 4BKOA 4PVCA 3CH6A 1U3UA 1U4OA 1YOVA 3V8BA 3CPSA 3EVTA 4WUVA 3TZQA 4BQPA 4CV0A 2JL1A 1XKQA 3JQBA 4QO7A 5T57A 3GQVA 1FDTA 2HUNA 4ONEA 1A9ZA 1H2BA 3BHIA 4PVDA 2W2LD 2WEKA 3JTMA 2FHSA 1P1JA 1J4AA 1ZZEA 2B0JA 4EYEA 1BSVA 5AXAA 2C2XA 2X5KO 5GZ1A 3MWEB 3ZWMA 2D2IA 1BTOA 5B1YA 3D4OA 4WOKA 3L6OO 4TWRA 4GWKA 3TNLA 3F4LA 1C0KA 4IS3A 1O6ZA 4WKGA 3UICA 4M54A 3WJAA 4ITUA 5THQA 4HNHA 3ABIA 1SBYA 1QLJA 3QHAA 3RQSA 1NTOA 3BMQA 4ALIA 4PLZA 3IS3A 2VHYA 5G4LA 3IJRA 4ZRMA 4CM3A 4M89A 3HN7A 1NVTA 4BGEA 1I36A 1FJHA 5KVSA 1GU7A 3LC2O 3GG2A 1X7DA 2IXAA 2DQ4A 1S6YA 2NU6A 3ZI0A 5JBIA 1YDEA 2P9EA 1ZEJA 4CV3A 3IAHA 1ZK1A 4FFMA 1CETA 3OFSA 2EEZA 1EK5A 3K2BA 4RVGA 4TVOA 3COSA 2V6FA 4YAKA 4LK3A 3LF1A 4CMAA 3DC2A 1LJ8A 3IQDB 4I9NA 2PGLA 3GVPA 1OC4A 3JD0A 5GZ3A 4NBRA 3TZHA 1NXQA 3L4BC 1KYQA 3GEGA 1ZXLA 3B1KA 1V3UA 2Y1OA 3S2IA 4B79A 1F14A 4XQGA 4JQCA 1ZK0A 5CPBA 1DHRA 2EGHA 4Z0PA 4YAGA 2IXBA 4U0JA 1HDRA 1QG6A 3ANLA 3OJ0A 3JQ9C 3DMTA 3JQBC 1KEUA 1R6DA 2A9FA 4YEDA 1LX6A 3RD5A 1P1HA 2Y0EA 3AFMA 4WNCA 3ZW9A 1PGNA 2AMFA 4RV9A 2QYSA 2X9GA 4BNTA 1LQTA 1A7KA 2NLOA 4CLDA 4L73A 4D79A 1EDOA 1DFGA 1TA4A 1KVSA 4ZHSA 1NR1A 3TN7A 2A92A 4OKIA 4C7JA 2ILTA 1EBFA 1E3WB 1ZSNA 2VHZA 2X1HA 5COBA 4YYZA 1GCOA 3DBLA 3S2GA 2AQKA 2QRLA 3K30A 2BLLA 3H9EO 3PQEA 4RPHA 1WXDA 1HL3A 1V0JA 3QWBA 4B7UA 1Y6JA 4C7KA 4PLWA 2X0IA 5ADHA 4BMNA 1QXSA 2JAHA 2I65A 2I3GA 2OP0A 5I9NA 3ZCXA 5IAAA 2G5CA 1X0XA 4GL4A 3MWDB 2VNSA 1QMGA 2ZB4A 4FFRA 2EV9A 2PH3A 2X58A 4QTZA 4ZA2A 4L75A 4A10A 4DLBA 1LSOA 2ZTMA 4BNJA 3F5SA 1HYGA 2X0JA 3M6IA 1ZUD1 4Z9FA 5K9ZA 4NR0A 3EGOA 1Z7BA 1QYVA 3HDJA 4R9RA 2WMDA 4UEKA 1HE2A 1H94A 3HWRA 3W8DA 1GQ2A 1K6IA 4D46A 2QZZA 2HCTA 4AL4A 1GADO 2QRJA 1DC5A 5L40A 4MP3A 6LDHA 1YL6A 1Z45A 9LDBA 2P9CA 3AJRA 4IBOA 3S55A 4ZQFA 5J9GA 1I32A 3DBHB 3DDNA 3JD2A 2W8ZA 4YAEA 1EK6A 3ZHYA 4N7RA 4CM8B 3GPDG 4R51A 2BI7A 3CKYA 3LDHA 2VYVD 2J5QA 1NWHA 2I66A 3E5MA 1HLPA 3D4PA 3R0IA 1GPJA 4CMIB 2PFGA 4DMMA 1M6WA 1MP0A 1E1MA 4EITA 5A5FA 2ZYGA 1NAIA 2YQ4A 4QECA 2E49A 1LC0A 4PLGA 1CERA 1M76A 1PJ4A 5JAIA 3IKVA 3BAZA 1F17A 4HP8A 1GUZA 1YRLA 1PZHA 5CG2A 1CQIA 5A9RA 4R5HA 3VAZA 4L76A 1YKFA 5CAEA 1JWBB 4AJNA 1P1KA 4DVJA 1E1LA 1UUFA 5IFLA 1LDGA 1X1EA 2H63A 3TZCA 5CDGA 3AUTA 5TIIA 1U9JA 4ALNA 3DBHA 3ZU4A 3GFBA 3GMSA 2NVWA 3JCZA 1N9GA 2OBYA 4K28A 3SX2A 2A94A 3TRIA 4DWVA 2OZPA 2EKQA 4BNMA 4WE3A 3C24A 1H6AA 3JQ7A 1TLTA 2ZATA 3BTVA 1P31A 2VCYA 1VL6A 1WDLA 3BMQB 4GWGA 2FOIA 4HFNA 4Q39A 3ZU3A 1O9BA 1QYDA 1Y8QB 2TMDA 5IJZA 4YAJA 4WLFA 4D45A 1ZKMA 2DBZA 5M6DA 1ISMA 1LDYA 3RC1A 1XELA 2WD7A 4IDEA 4NBUA 4I5EA 3HB5X 4CM5A 5I7FA 4D7AA 2RHCA 1E0DA 5IDXA 5DBFA 1LSSA 2HU2A 4IMPA 2JHFA 5JE8A 3GUCA 5JYDA 4E5PA 1HT0A 1I5RA 4K6CA 1NP3A 3F47A 5KVVA 3OHSX 5K6AC 1AN9A 2ZIZA 2HJRA 5H82A 1PL8A 4YJFA 5DBIA 4ZU3A 3TL2A 5T6BA 2POQX 3HNPA 5B12A 3PFWO 3ZWCA 4UREA 1Q7BA 1MG5A 2O48X 1XU7A 3WYBA 3K96A 1A5ZA 3FN4A 3OMLA 3H3JA 4KTTE 5T8KA 1T2AA 1KEPA 2NM0A 3VH2A 5ITWA 1GUYA 4W99A 2IEBA 1Q0HA 3G49A 3QWAA 5FI3A 4CMEC 5L95A 3STHA 1FDSA 3BMNB 4TSKA 3GNQA 1YQXA 3UHAA 1GV0A 1IZ9A 1YB4A 2FPPA 5L9AA 4HV4A 3EMKA 1MX3A 3SBOA 5HS6A 1A72A 4M8SA 2P4HX 1CF2O 2EERA 2IODA 2FZEA 3RBZA 1PGJA 4UUPA 2W2LA 2BH9A 3GHYA 1UXGA 2VOJA 1LU9A 2ET6A 2ZTUA 3FBGA 2HKIA 4MVJD 3TL3A 3I9OA 3X2EA 4P4NA 4WEQA 5A04A 3ASUA 4IQGA 1QKIA 1BMDA 4UVHA 4ZQBA 4F6LA 3FR8A 2OGUA 1GV1A 2GN4A 4CPDA 2WJPA 4PLCA 2PA3A 1EFKA 1RM0A 1BXGA 1FXSA 3FBTA 3ZNNA 5CEFA 4CM9A 4RVFA 2O3SA 4NFHA 1XDWA 1KC1A 1I3MA 3PHGA 4CV1A 2FP4A 5CDYA 3GAFA 2D59A 5I9MA 5T64A 3GZNB 4CL8A 2H9IA 1E3JA 4RO0A 3PJDA 5TSDA 2Q4BA 3NT4A 1LRLA 1NQ5A 3I9KA 4AJOA 5H81A 1H9AA 3PGJA 1T26A 4KUEA 4UEJA 4K26A 1MLDA 3R1IA 2VWQA 4BB5A 1LSUA 3ZHZA 3ZWVA 5I7SA 3H9JA 5LC1A 2JD2A 3DONA 3PDJA 5DCWA 4J6FA 3Q9UA 4WEOA
chains in the Genus database with same CATH superfamily
1CDZA 3NDBB 3A6PC 1KIMA 1WBJB 1KTVA 1ULUA 1VCMA 1Z17A 1DC7A 1E2MA 1JIXA 4FYXA 5J4HA 4BWGA 4EI8A 2IQ5A 3QRWA 1RXCA 3KQKA 3EAQA 1CUAA 1M6VA 2WTEA 3JRXA 1U7ZA 2VXBA 4V2UA 5DULA 3HHPA 3GLHA 3PJEA 4MTCA 2E85A 4UJ3A 1O5IA 3FDXA 1QK5A 3ED1A 1Y7HA 4U9UA 3VKUA 2IHNA 7MHTA 4LJLA 4DJ5X 1P5RA 3SR0A 5JYEA 2ECFA 2QQFA 2Y1EA 3LL7A 2GPWA 1TQHA 1HEIA 4NCXA 4CR7A 1PFQA 1V11A 4DDWA 5FBQB 2DHCA 3WGIA 4KDFA 3LPNA 2YWEA 2IHJA 3OD5A 4Q4LA 4F46A 1LPNA 1A50B 3FGOA 3RU3A 2VQFB 3AVWA 1JIJA 2O8BA 2IDKA 1EVEA 1V1JA 1RBQA 4GM0A 4C1BA 1XAGA 4Q6BA 1QP7A 4PHTA 3VR3A 1EUDB 3DE6X 2BGNA 2CVZA 3DOHA 4NE7A 5K6RA 1XZNA 1EFAA 1MC5A 3OKCA 4XIGS 4CM9D 2W6PA 1E9RA 3C74A 1DQZA 1NKTA 3ZY4A 4D42A 3T1VA 4GFDA 1J8FA 3AHEA 3WWDA 2B8WA 5H8WA 1GTRA 1XRLA 2ZIFA 3NYQA 4O4JF 4WFJA 1OAAA 3H75A 1E5LA 3CLRC 1DEHA 3T9AA 1D1QA 4JLJA 3KQPA 1WTAA 2MWMA 2OFXA 2Y68A 2P5UA 4JI8B 4OV6B 5GADl 4H3KB 3W6NA 2YV2A 3AC0A 4X85A 3VHRA 4EJFA 3COYA 4DCMA 3ZJVA 1NG1A 1R1DA 1RRVA 3AF3A 3I6IA 3WIEA 3BRQA 2W8BA 1SC1A 4CKCA 4F4JA 3ER9A 1HNZB 4G8DA 2WMNB 1U9ZA 3O21A 3UAGA 3ADDA 5CFOA 3E7XA 2BGKA 3E1SA 3FIUA 3ZBUA 5LXTA 2QUKA 4FCTA 3DZHA 4EPXA 4YS6A 5H1YA 4O8ZA 1EDBA 3U7HB 3M1AA 1GZSA 1W47A 4WI1A 1TT5A 4KUHA 1KS2A 1A76A 1GNQA 4FONA 2IU4A 4YDQA 1N4DA 1KI3A 2NXCA 5TGDA 1N2IA 1KEZA 2PNFA 1PR5A 2OO3A 1QC5B 2A5JA 2I6GA 3CIOA 1RYZA 4ZPJA 5DISB 3SR3A 2XQJA 1N75A 5DIFA 4PTLA 2RHMA 1DJOA 3GR6A 1Z4OA 1AK2A 4ZCSA 4MINA 1U4SA 2VWPA 2PUJA 1PRYA 4W5TA 1ZVQA 1N6HA 2CLSA 5FULA 3RU9A 1Q50A 3G2OA 3OPYA 2RK4A 3EY9A 2YINC 4RAQA 1ZOPA 2B3DA 4QVKA 2YS6A 2ZULA 1D5WA 4JENA 2VDWB 4N3NA 1PJQA 2IZOA 2HCRA 2I7TA 1ACMA 3D54D 3KBOA 2NVUA 3BJMA 1CY6A 2PRJA 3KZMA 3PGLA 1EWQA 1UPXA 1XXHA 1FP4B 3PFBA 3TPZA 1K27A 4JV5B 5FJIA 1Y8CA 1PVOA 4YT5A 2A5GA 4U7PB 1H1TA 3QY9A 1MIOB 1KIFA 3CLSD 4A5OA 4DWOA 4P0QB 4IVRA 2H9AA 2RGDA 4OYRA 4RUKA 4HNRA 1ZIDA 4LCBA 4KAJA 1NHGA 1WSAA 2C4HA 2PG3A 4MEBA 3REQB 3JQAB 3U7QB 4E4TA 1U2RA 4M9UA 4URWR 4DSNA 1NLMA 1NJGA 3EQ9A 5IF9A 2XIQA 1G0NA 3KLBA 4FFWA 4UOEA 4QNMA 1XYGA 4LEIA 1N6RA 1YB1A 2B82A 1B8PA 4JI0B 2CVQA 3L7IA 2B6HA 4PRZA 1VG0B 2GPYA 2XVMA 1RIIA 1Z2EA 4M0UA 4LZNA 4UBIA 2I2XB 4C7MA 4BGUA 3WLPA 2V4UA 1WY5A 1YZUA 1D9XA 3HUEA 4JQSA 3TJZA 3MUOA 4GPEA 5K8VA 2BTEA 1AN0A 1Z5PA 4EHNA 2H5EA 5CG1A 4OQDA 5CNIA 2GEBA 3KTFA 5KOHA 4Z3DA 2P2SA 2P9TA 4S0XA 3MTJA 2OZEA 2YJ4A 4RZUA 4XX0B 2VT2A 1JLKA 2WBLC 3EWIA 4HQ6A 2IKQA 3L5OA 1ND5A 5KTMA 4OHBA 2GYYA 3A0RB 5JV5A 1KY5A 3A3NA 4LXHA 2LUOA 2VF5X 4QGGA 4RF2A 4WKBA 3WK7A 3TUTA 2YWDA 3P4XA 2P1RA 3ZWAA 4BJ3A 4EMTA 4FWBA 1H8ED 1N2GA 1VL5A 1HYQA 2FEKA 1WMBA 2D0IA 1E4YA 2H54A 2OOKA 4FYMA 3AJEA 4ILEA 4ZANA 4TS9A 2LWIA 4P3OA 2MR6A 1OA1A 3T41A 3IIEA 1A8QA 1U1DA 3S2EA 3L41A 3QW2A 1ABEA 3N3BC 4MWCA 1PF7E 2Q0SA 1GNTA 2ZAYA 4PINA 1SOWA 2H51A 2ZRNA 2HBQA 3CXUA 4KXVA 5FTKA 4DARA 4ZI7B 1V1MB 1VGRA 3W4KA 1GPYA 2BFFB 2EIXA 3LQKA 3WO1A 1UMCA 2BGRA 2UZ1B 2X7XA 3N8NA 3R3YA 1N3YA 1X6VA 5DTMA 1Z5GA 4JJ6A 2DQSA 2VPQA 3GP5A 1T5LA 2HZ7A 3TLXA 4DLAA 1R3UA 1JSRA 4O8JA 2X4GA 1NN3A 2Z2KA 3IMFA 3RUHA 4A0RA 2DC1A 2BBTA 3EULA 1CUJA 3LY5A 1PFKA 3RYCB 1N2BA 1PG5A 3AB3A 3ESYA 4Y1RB 1KL7A 4B7ZA 2BFPA 5EJEA 1UDWA 1MVNA 1SPBS 4KAFA 4L0DA 1NQTA 4A8JA 1ZJZA 5IAEA 2CL7X 4G0NA 4CLXA 4F4IA 2IC5A 3TPFA 1NW4A 3RWMB 3U13A 3DBRB 2H07A 2J31A 2ZJ0A 3AI2A 2NU9B 2IZ0A 1QVZA 3KXDA 2VDNB 1VMEA 4RK1A 1Q3TA 1NQAO 4RWEA 4BRSA 10MHA 4ERXA 1E92A 4DIOA 4ZAZA 4X97A 3G9QA 3KHKA 3HYTA 4QBKA 3PC6A 5TRTA 1ETHA 3D9QX 5FUYA 4B0PA 5E3HA 3U4AA 3U7FB 3ZIUA 3I9LA 1DDGA 4NU6A 5U4QA 3FYUA 3GT0A 1SXPA 3A6GA 1UFVA 4OJQA 2XA1A 4AUNA 4JMLA 3TW3A 4JAVC 2C3PA 5HQ3A 2I4RA 4H0CA 5D2CA 3TD9A 3K6SB 3WS7A 1Q0SA 4UBOA 5HQ3B 3QHPA 4Q3KA 2FN4A 2Q46A 4ZVKA 1Y34E 2E4WA 2JZOA 4JWKA 4BV9A 4D9IA 4TM8A 1JKFA 1NQOA 2C4VA 2WPDD 4RD0A 1NBME 3WR5A 1K63A 2O1WA 3IV6A 3IIIA 3A3KA 3C4QA 1BROA 4TWBA 1XNHA 1XVTA 4ALJA 1ZGGA 5L53A 3S7TA 4LFCB 5KOJB 2PYZA 3C7KA 1U98A 3AL0C 3DCIA 5HK8A 1GPKA 1UBRS 4CI9A 3IKMB 3W5IA 4L2IB 4ZGBA 4PTYA 1QH8B 4GQBA 1CD5A 1GLNA 2I6UA 4GR4A 1K5HA 2NXEA 1PL7A 3SX0A 5H80A 1Q44A 4ZOLA 4CGYA 1ISHA 3PUIA 2CBXA 3VSEA 4KRGA 1NX6A 2XJ4A 4Y2UA 2MCFA 3KE8A 4ZYUA 5I8WA 2EZTA 1ZDMA 3LYUA 3DAYA 4UQPA 1BFDA 3TVYA 5JCOC 4TTRA 2WJ6A 3OEHD 1U6JA 1N5MA 2JI8A 3QE4A 1JMKC 1H2RS 1NMSA 4KX5A 1VBNA 4L16A 4QHTA 4RGQA 3QFRA 1CP3A 4HRAA 5BWLA 1AHHA 4E22A 2NZVG 3KFLA 1AZSC 1BWQA 2DTDA 3THRA 2WD8A 4UVDA 2FG7C 3DNFA 4GP6A 4AIRA 4IVQA 2JVJA 1Y8QA 2GJAA 3L6EA 3OKFA 3UFBA 2HI0A 3VI3B 1BFUA 4PXAA 4MAMA 2AHRA 4JHLA 4RK6A 3FXAA 1YIOA 4EARA 5DSXA 4MCHA 5J63A 8LDHA 5JJLA 3HVHA 1QANA 1IWPB 4U7GA 1NA5A 4HFJA 1CE8B 3E18A 1MJNA 2JIZA 3P2MA 3ZKWB 4RY0A 1FFSA 2ZWVA 4QNNA 5I7AA 3N70A 4EG5A 4DNOA 4C3UA 3UV3A 1U0GA 3RG2A 1ESZA 1NR5A 2Z1NA 3AO0B 4UW9A 5C4GB 3ANTA 4BX8A 4HTFA 2GBFA 3QVKA 3A4TA 3SM9A 5DYNA 1H6BA 4Y2YA 2CHUA 3ANSA 3ETEA 4LMAA 1C7JA 4A8JC 3MRXA 3HUUA 5JTUA 3ZGVA 4ZQIA 2IYAA 4IYRA 3MFYA 3B3JA 4C4ZA 1R64A 2J9GA 1ML3A 2EHJA 5A02A 4ZD6A 1DELA 5KYWA 1YS2X 2WQ6A 5EJIA 5T5QA 2CSUA 4UNQA 5ANRB 1YE8A 3QVXA 4LXYA 5ADUS 5FTLA 4JNKA 1NRIA 4N39A 4DNXA 3ZG6A 3ZCUA 4JA0A 2FGJA 4QDKA 3ZH9B 2FDCA 1UT8A 1XZPA 2P69A 5JJBA 3EPPA 2H1SA 3E8SA 1ENYA 2XMRA 2GPNA 3LKVA 5G0SA 5B3KA 5DGTA 3GV0A 5FD8A 1L5FA 3RYIB 1N1EA 1RACA 5FL3A 2OG1A 2FJPA 3IDAA 2P1DA 1XD8A 1XJQA 3R3XA 4OQNA 3RJ5A 4CU2A 4DANA 2VHTA 3V1MA 1C9YA 6Q21A 1XHLA 5JRJA 4KBFA 1NM5C 1LNSA 3KM0A 3N5KA 4OD0A 4U9HS 5KYVA 4RTPA 1C4KA 2HWUA 4C6RA 1U9IA 3QWFA 1EG2A 3AVXA 4JJZA 2B35A 1E79A 2VSQA 4WA8A 2JAXA 3WSVA 3A3OA 3A4VA 3C7CB 1E6MA 2I78A 1REQA 1VECA 5KVQA 2YL2A 3GNTA 2B2XA 2SKEA 3HJNA 3K0AB 3FPBA 2J4CA 2Y0BA 3ZEAA 4TUYF 4F3KA 1E5XA 1GTSA 2I9KA 4RHYA 3IQIX 2HZBA 3AYXB 5FJJA 5H70A 3IRUA 5KDDA 3BIXA 3UA3A 4BQRA 1NXTA 2P6MA 1DXHA 2VYQA 2YXDA 1QX4A 1THZA 3TRDA 3OQNA 2QDKA 4JLSA 1MOZA 1H3EA 1MTOA 2H52A 2CKMA 4RPCA 3EXFB 3ZDRA 4FEYA 3ZGOA 5BN3B 1OHHA 3EBOA 3HACA 3QE2A 2R6R1 3GEHA 4MW2A 1HOTA 4WCDA 1OSNA 2ZR7A 4K6MA 5I7EA 4DDMA 1W4AA 3OI7A 5SYMA 3QOFA 1I0ZA 1ZFNA 2AQ8A 4KMSA 2XUDA 4UTZA 2R1TB 2Q1TA 1VLJA 2C8LA 1LLUA 5EXXA 3D8BA 3X2SA 1VSTA 3ORHA 4WACA 4RDXA 1OBOA 2ANBA 4P5PA 5BYAA 1JQKA 1HF3A 1L4FA 2KE5A 2OSVA 3FOBA 3VBCA 1C4XA 5HFJA 1PJ2A 3CX4A 2YDXA 3I39X 4CIBA 3ZU5A 1ZIPA 2FI1A 3ZNOA 2F9MA 4J1TA 2DR3A 3STXA 4LGVA 2YUIA 5I48A 4J9VA 4B3TB 5EQTA 1WCXA 1N33B 1IY0A 2D1QA 1E3IA 3KYCB 4ZEWA 4BVJA 1U5BA 1CVIA 4CR6A 1OILA 1QKJA 3I09A 2GCOB 4OH1A 2XMZA 5K8JB 2G1AA 2EKBA 2ZSJA 4FHDA 4TS3A 1SCKA 2ZBQA 5D3QA 5B3AA 1IM2A 3TNJA 1JECA 3WGHA 3X1DA 2V0GA 1GFSA 2WOOA 1JRLA 4HX2A 9ATCA 2ZRPA 2ZBFA 5EQJB 2E4ZA 1JYSA 3FYDA 3INGA 1NMYA 3SKVA 1EHIA 4B82A 4LXIA 1RCTE 5JS1A 2ZXUA 1KRXA 3FSGA 1C50A 2PH5A 4Y67A 3DBLB 4F2DA 3U2QA 4TLBA 2P5TB 3IV7A 1EXWA 2FPPB 2VTEA 1HDZA 3INNA 4MR7A 3TOZA 5CIQA 1RPAA 2H5JA 2HA6A 3NEYA 3NTUA 4AVYA 2QPLA 1ADYA 2ZTVA 4BFZA 3GWZA 4WIAA 2AK2A 4DR6B 1ATIA 3BMXA 4MUXA 1UP7A 3I2IA 4C6HA 1I7MB 2EKPA 1SEVA 3HKBB 2AKYA 2PA0A 5CT8A 2J6BA 2A67A 2HRCA 2VR1A 3YASA 2R2GA 3HO8A 4HEHA 4Z0NA 3ZWYA 1JJFA 5HTKA 2ID4A 4RMNA 3W0LB 5KSZA 3TOCA 1PL0A 3WA7A 2Q5CA 3DMYA 2ZUTA 1WX1A 4QAQA 5AH0A 1TTPB 4FDLA 3UJAA 2XMPA 2C7GA 1J07A 1JDTA 4OU4A 3B36A 4E09A 1E2FA 1E4EA 4IXNA 5LPNA 3LCJA 3DAOA 3UK2A 4W5QA 2HQSA 3AFHA 3OIYA 3GPIA 4XW2A 4DLNA 1E8MA 4J0GA 1WNFA 3NJRA 2PGJA 3AIKA 3QK7A 3RS9A 4DTCA 4PFJA 5AJZA 2QSJA 2PZLA 1EFHA 4PN7A 3VX3A 2PMCA 4RY2A 3L4KA 1ZMOA 4HNSA 4QEZA 4DDTA 5JDCC 2ATIA 2HK6A 2ZE5A 3A25A 2C2BA 1P7CA 5IDVA 1N0VC 4EKYA 2Z6AA 5CP8A 3G79A 5KNCD 3T35A 3D5EA 1WXHA 2DUJA 2YMMA 3ETJA 4AQ7A 1ZOOA 4Z4IA 2H06A 2JK1A 3GB9A 2YRXA 3BFJA 2JCYA 2RHRA 2IZ5A 1DOAA 3GJ7A 4Q18A 4XGKA 3G13A 4IEEA 4UHDA 1I33A 1J8YF 3LE8A 5TNXA 4KPFC 4AS2A 2C4NA 2CCJA 3M70A 5E95A 1E3EA 2XNHA 4OQXA 3P5SA 2D2VA 3L8ZA 3F7MA 5JDIC 2OK7A 2ZR9A 3WMGA 3B13B 4MVJM 2ATEA 4LQCA 5EWLA 4DCVA 5TVOB 1YC2A 2BAGA 3HJAA 1CB7A 1G7RA 2JGAA 4Q48A 3EXHB 4G3XA 3TDKA 4BO6A 1SOVA 1VL1A 2WJ3A 3N0WA 3PL1A 3WB2A 1PK7A 3RUCA 2PO5A 2QVBA 3ILXA 4AK9A 5K8TA 2R87A 3ORYA 2G06A 1O89A 1LBTA 4US0R 2PMWB 3VR2A 2NUPA 2HCBA 1V5GA 1E2KA 4HBGA 5LQJA 1DEKA 1SHUX 3FKSA 1U7OA 4EW1A 1RAGA 3EW7A 4M1KA 2RH9B 2XD4A 4DDUA 5L3ZA 3SSMA 4X92A 3B38A 1XTIA 2QMOA 3GEPA 2V9PA 1VRWA 3G85A 4NCHA 1RLJA 5AHWA 4U8HA 1WZ2A 1I3KA 3FCOA 3CINA 1YR2A 4N0PA 4WOCA 3ZZMA 4B34A 5DM4A 5I9TA 4BATA 2R1UA 3MAGA 4YRSA 2J0EA 2OVFA 1KKUA 4UVIA 5EPOA 5ED0A 5K6AA 4MRNA 4Z53A 5AI6A 4RQUA 4WZAE 1UWVA 5TQVA 3E0XA 2AOTB 1S4QA 3L8FA 1Q0PA 3NPMA 4MQ6A 3S40A 1GZDA 2HSJA 3K15A 3OCZA 1G7TA 3HBJA 1NM5A 4JYPA 4DR2B 2PUGA 2C20A 3R8FA 1ACJA 3AESA 1JHDA 1X15A 2VHEA 3MJCA 4MGKR 5CT4A 4J1SA 5F2EA 4R2XA 1NE2A 2OUKA 4YAWA 4L5AA 2BHRA 2EW1A 5DTIA 1KWKA 5LOVF 5TEVA 3HPRA 3HXPA 5BNIA 2O8CA 1OWOA 4M38A 5KNCH 5DM0A 3T3HA 4D8UA 5AKXA 2FMXA 2DQYA 2EJWA 3OZXA 4NI5A 2CYAA 1A8SA 2NADA 1N5OX 2R62A 3EUWA 2I4MA 1KEVA 3FNEA 4YGYA 2HCJB 4LRQA 1I2DA 3OCVA 4Q19A 4CT5A 3ZVMA 3TR5A 2BFNA 4EQ6B 2XGOA 4AO7A 2WM9B 4HGYA 2O7SA 3HRIA 1SVOA 3CWZA 4PPQA 4BXOA 2AN9A 4HLDA 4CKXA 3M9LA 2BFAA 2VTBB 1OV4A 2RDMA 3QBJA 3ABQB 3IQZA 4KACA 5ICMA 3A6DA 4AG5A 4DHWA 4JOSA 1R6TA 1U0RA 2VA9A 3A36A 3DP7A 5JFOA 2VJMB 3QF7A 4MIKA 3ZBPA 1PGQA 3TRJA 121PA 1L5HB 2VWHA 3NDIA 1ORVA 5EXEA 3MQFA 3WJ2A 2WWYA 3O8DA 5KYGA 1T0PA 1ZM9A 2ZRCA 2HA7A 1KK3A 2VHXA 1UIMA 2VJQA 4EUFA 4KQFA 1B0ZA 1CNFA 4QDXA 1E2BA 1U1CA 1PJZA 3COZA 2Q7OE 1QIHA 2HPVA 2YUTA 1MHTA 3GJ3A 4LWPA 3ROKA 1JQDA 4FOPA 4J4TA 1YRQA 1FXUA 4KXLA 1NIJA 3FPFA 2JCXA 3D8RA 2VBGA 1GOTA 3CX7A 3LG2A 4HEA1 3TO5A 3HRKA 4NU0A 2ZBGA 1FVOA 3E7PA 2H4WA 3F1KA 4BGIA 1RZVA 4BTVA 4CEHA 1PQ4A 1QHHB 3CX6A 2PSJA 2FMUA 4C3ZA 4DBVO 1SO8A 4JBWA 4BLTA 3O94A 5TGTA 1T5TA 1DKOA 1F5SA 1WDMA 2JJ8A 2GVNA 1P0FA 1U2ZA 4YCDA 3PE6A 3TSYA 4BUCA 2FA9A 5CDHA 4IXDA 1JHMA 3DZ3B 2PCJA 3SQWA 1DAIA 1Y1SA 5AJWA 4BTEA 3UPTA 1VRCA 1OC2A 1XZKA 1M74A 1FUIA 4EGSA 5AVWA 4OOFA 1R88A 3BXGA 2Y9PB 6ABPA 3GLFE 2CVOA 2D5BA 3NRBA 4OP1A 3HR4A 2B9VA 3H97A 4O4HB 4TRMA 1CCWA 1E4OA 5HKLA 3GA7A 4DSTA 3IJEB 3GH3A 4GBMA 1K88A 3OCCA 4JX8A 4NLLA 5KSPA 3VR6A 5H0IA 1T34A 2C2WA 1QSGA 5JS8A 1Z4KA 4MUEA 5IKPA 2FSUA 2O3QA 2PGDA 2ZGVA 4O08A 4B48A 2QR5A 5JZOA 2EQAA 2NO1A 3PRYA 1G8HA 2J9FB 4U0KA 3WWCA 3EWNA 1Q92A 1IHOA 2PN1A 2RC6A 1GEGA 3GHHA 3NFYA 4ARIA 4CFYA 3UW3A 1BA3A 1MR3F 3VZPA 3OUTA 3E05A 2I3AA 3GH1A 2Z6QA 1RRKA 1VPTA 1H8HD 2YBEA 1CR6A 4P2BA 4ZQGA 4D9MA 3BMCB 1T9ZA 3DZJA 3IKLA 4JYBA 4ECEA 2Z83A 1W49A 3LK7A 5NLLA 2YQ5A 4OX9Y 5GONB 2A1TR 1EFUA 4KDRA 3CE6A 4BWVA 1ZIYA 2I29A 4FLFA 2VP9A 1ZRNA 4IIBA 3ZZ1A 4H3HB 2NMVA 4AKSA 2VEOA 3U4MA 2E37A 4JELA 4UEOA 5JBNA 1AQ6A 1D2NA 5AHXA 4RTKA 4KQGA 3HLTA 3SS9X 1RYDA 2F3PA 3DVAA 3HUTA 5HQTA 2XT6A 4UFPA 2ROQA 1DIRA 4B4DA 3MBIA 1T2FA 4DBLE 2L0XA 3GLGE 3I8OA 3IIKA 2DHQA 1Z6TA 2HD4A 2ZSDA 4HLUA 4Z9XA 3RSHA 2ETXA 4FFNA 5FHRA 4PICA 3SEZA 4EEZA 1YNSA 3ADBA 4N0QA 3AUAA 1E94E 3I5MA 3EYAA 2F9FA 1X1RA 1UC8A 2C4UA 3AR8A 5FF9A 3EMDA 3FF1A 4M3NA 5JCJA 4CFZA 4EFLA 1EG7A 1HM5A 1GZ7A 1IG0A 4PZLA 5KKCA 1Q5PA 5F1PA 5T4EA 3TQTA 4IJWA 1BXKA 1IY1A 3I5AA 4DV5B 3G5TA 5UKDA 4B32A 3NHJA 2CT8A 4ZC1A 4E5VA 1R6UA 2AG0A 2X42A 3KYDA 1LK5A 2Q21A 2I9PA 3PDWA 2V7XA 1SULA 1MDBA 4O25A 5DXFA 1T0JB 1YRAA 2HPZA 1KMHB 1N34B 2FG6C 2VF4X 4NICA 1ZNQO 2C9OA 1T2EA 4LXTA 2H5IA 2JIZD 1V41E 2I33A 1RJGA 3ILSA 4W9MC 1CUVA 4X63A 3QU2A 4CKEA 1GTZA 3P9IA 2Q3BA 4JITA 4R40A 1RHQA 5AKZA 4YR9A 1JFFB 2BP7B 2XNDD 5CLJA 1KZ9A 5KQRA 2R8YA 4ER7A 2PZKA 1UAYA 1Z68A 1MV5A 4RMIA 4J0KA 4B2IA 5DLQC 1PTJA 1XLUA 3ZDZB 4YAFA 2GAJA 4TKVB 2B8JA 1R5JA 2GDJA 1GFZA 1JDUA 2WP8J 4YJHB 2J9RA 2C9BA 2JJQA 3W7BA 4DYDA 1B0AA 4WLNA 5KS2A 1LTKA 4LZPA 5IXYA 5JMTA 3KVRA 4XEHA 3G1TA 3HYNA 4HVCA 2FUG6 2GSWA 2Q6VA 2O0HA 3OIFA 4H27A 1PQPA 4U6NA 3V7FA 2NSYA 3CR3C 3HA3A 2BC9A 2R6JA 5C8YA 4B9EA 1CLEA 1JT2A 3HXOA 3MJHA 4KMRA 3QKIA 4LTDA 4Y2XA 5HX7A 2XZPA 3WP1B 3F1LA 1PG0A 3A11A 3L6RA 4R2IA 3SC2B 1P4AA 3H0CA 3E9YA 3G2NA 1O6BA 1TW3A 4IOMA 4L0CA 3AU8A 4V3BA 4DV3B 1P39A 3VU9B 1CZUA 5CHYA 4JJFA 3BK2A 5EESA 3FPCA 3EGDA 2GBIA 2GNOA 2DJ5A 2LIPA 3VMMA 3DOEA 4BO0A 3LQ2A 1AGPA 3KAPA 3UFXA 5C1OA 1P7ZA 4MEAA 2QLBA 3WRYC 4IIJF 4K9PA 4OQMA 4JI7B 3PQ6A 1E9BA 4G65A 1NMXA 1RDFA 3SQNA 2FNAA 2J32A 2GF2A 2WHEA 2CVHA 5F64A 3EZXA 4HATA 4FNAA 2BCJQ 4UPDA 1DAGA 2F43A 2YHAA 4H16A 4NIMA 2CXNA 5I9LA 1YIAA 4F9GA 1VL0A 4LGMA 3INRA 1HKHA 1BRTA 3TUJC 4UQOA 2NO5A 1G2PA 2FN9A 1XTUA 1SQSA 1VHWA 2XCRB 1E9FA 2QQ0A 4G1VA 3S2SA 2Q62A 4RA9B 1FVHA 5KTNA 3H65A 1PR6A 1JILA 4MJ3A 4B4UA 1EGAA 1IM8A 3A28A 4YMSA 3MJRA 1DBQA 2IITA 1J25A 2DFVA 2B7CA 2WOJA 4MITA 1OX4B 3JR3A 3MUEA 3DDOA 3LUDA 5HK9A 2C59A 4BP9A 2EBUA 2CWDA 3ENZA 3KKNA 1RAIA 2NU7A 1UXJA 3BE5A 3RRZA 5LQAA 3QI2A 2JLVA 4KXXA 3SIRA 1LQUA 1QH0A 1WHSA 2KWIA 2I1LA 1N1MA 1FYWA 3J81A 4HDRB 2DUMA 4KPUB 5CA1F 1MOSA 3IQWA 3WYFA 2OWEA 1GNLA 4IKOA 4O4LA 1P17A 1VG1A 1PTJC 2VKTA 5DWQA 1EUZA 4C07A 5IHPA 4GP7A 4REQB 2JBAB 4URYR 1WWKA 4BU1A 1D4FA 2UZAA 5H02A 2AS0A 1JFFA 2OCXA 2WQZA 4PHCA 5L3RA 3S8MA 4MB2A 3COJA 1FBNA 3A3YA 1WMAA 4CCYA 4IFEA 2M6SA 5EE9A 3SS8A 3ZVNA 1RWWA 3NBFA 1KDOA 1BH6A 2P9QA 3N6VA 4C7OB 4YMUA 3GQBA 3F4BA 1UEJA 2J07A 2WUVA 3BF7A 3Q5EA 1K3UB 2IVFA 3CPEA 3IHWA 1QU2A 1HTBA 3NAMA 3DE7X 5KNBD 5DF1A 4RHUA 4FDMA 3HN2A 1DBPA 1WHTA 2J3IA 2LW7A 2HWKA 4Q3CA 3Q3IA 1SVNA 1KKLA 1DPGA 4QLAA 4EHFA 1UMBB 2VRCA 1QORA 1QO9A 1Y4UA 1ZVMA 4PZ9A 4GT1A 3DLPX 3LLSA 1DWPA 1S89A 1WTCA 4I99A 1Z26A 5FBRB 2ZCUA 5ETJA 4EPTA 5KTKA 5FTNA 3NBXX 4URXR 3NTOA 4GECA 3ZZNA 4G26A 4HOYA 4DA0A 1XA4A 3E3OA 2NVUB 1J42A 2A86A 1UM8A 2C5AA 2FZWA 2VK4A 3EA4A 2P2CA 3QPAA 1NBHA 1QTQA 2R1VB 1K8RA 3SEFA 1R8JA 4BPRA 2Z4SA 2EDCA 4Z54A 3K6RA 1A9XA 2EJVA 4AJ1A 5IXJA 3C7DB 3BT7A 5JW6A 1UPUA 5E6RA 3MERA 4FBMA 5FOWA 1JHZA 3ZBQA 3I42A 2AMJA 2F17A 3AF1A 4HGOA 4RZQA 4B2YA 2Y1WA 1TIPA 2H4JA 3CB4A 2JBWA 2WT4A 2ZVJA 1J5EB 2R44A 1RMQA 3BFPA 1HRDA 3T61A 1UXIA 4F8YA 4NABA 5J2TB 5AUQA 3V2UA 4FD2A 4H7HA 3WQQA 4LVNA 2DULA 2H1WA 4CIWA 1IBLB 1N2JA 3EC7A 1VKNA 4INPA 1U9IC 3FUTA 1Y1KE 4PYMA 4A15A 1NVEA 4F11A 3R40A 1T5OA 3H13A 5EIWA 3KOYA 1GGJA 4WCFB 3ZWDA 1HYHA 3ZGXA 1LA2A 1J9EA 2J67A 4MKHA 3NM4A 3IEVA 3NUQA 2AE2A 2MSNA 4M9QA 4D96A 2ZI5A 4MYSA 3E9RA 2JANA 2WYWA 4X84A 3IBTA 1FQOA 3UAXA 3ZI4A 4UCFA 4EFKA 3QVJA 5BMOA 5IABA 3O75A 4LJ5A 3OFJA 1IWBB 1GTJ1 4UUQA 2ZI3A 1KSHA 3WISA 2QZSA 2XWPA 1AU9A 3F5DA 3DBIA 3DMGA 3E82A 3GPCA 4H6WA 3T5BA 1SKBA 4PAOA 3ZWPA 3UHJA 2JJYA 1JLRA 3L3BA 4NBLA 5I7RA 2JD1A 4BQIA 2UYCA 2VUSA 1G291 5FI5A 2ZQZA 1RP7A 2R79A 3KT6A 2D0OB 3PXBA 4DPMA 1PJRA 3N0VA 2CEAA 3G2HA 4Y6LA 1SWWA 1EGQA 4WXEA 3OOHA 3NJ8A 1YASA 2C82A 3GFOA 4DM7A 2V59A 1RVDA 3SJAA 4WMLA 2FP3A 1CY0A 2YCLA 3EODA 4E14A 3GZTB 4PYRA 3FUCA 4Q37A 3RSOA 1F06A 4IDOA 4ZALA 2KYRA 1M2OA 1SXIA 3VU3A 2EC5A 4WY2A 2YZ2A 4I50A 4I36A 5DTRA 4BY9E 3IP3A 3CVOA 1Z39A 4OFXA 1XA3A 1MO2A 4YPOA 3P9KA 1LGYA 3VNAA 1J0DA 2VJMA 4OYHA 2YHIB 2CCGA 2RH4A 3G2QA 4MV4A 4MRRA 4G1MB 4IG4A 4FDUA 4UDXX 4MW1A 4ZEOA 4CJXA 3WDKA 1ZJYA 1Y7LA 2QLTA 1CSEE 2N47A 3OC0A 4WFQA 4NU8X 4XUEA 2ENWA 2PBRA 3AY0A 3OWHA 2IH4A 1S1CA 1TT5B 3IIJA 5TVKA 4MV6A 1MJHA 3AK4A 4IIUA 4M8IA 4B7XA 2B7BA 3CLTD 4EVRA 4KO3S 4PZDA 2E5WA 4ZZ0A 2XF2A 1GIAA 3IPXA 4OQPA 1E5VA 4OYYA 4PM4A 1FMTA 3FFXA 3MWGA 3P20A 2J6IA 3QFHA 4ZP1A 4D3SA 5JSUA 1EGVB 3MTIA 3QIVA 4N48A 3I37X 1M7BA 4E32A 2EZ4A 3NPAA 3CLHA 1T6ZA 4I66A 4QFMA 3ZV5A 4ROSA 1ZWKA 1SGWA 4DQVA 5JS6A 2DUUA 4B9AA 1NASA 3IP1A 4PU0A 5ESXA 7GPBA 2I4LA 1JFLA 4EUKA 3CEPB 3Q2IA 1PZXA 4MSUA 1U28A 1GDDA 2DBVO 3ENKA 4I4IA 4B7CA 1C1DB 5EUMA 3UK1A 5IT9A 1K7FB 1PTKA 3SZGA 1P9WA 5LYJF 4CEJB 2JGJA 4WZBE 1Y48E 2ZRBA 5EXDA 1OH6A 1PR1A 2QE6A 3P9PA 4PZ0A 3EFHA 1ZBQA 1BEUB 4N8SA 1ISRA 3H5RA 3NHSA 5TS3A 3VAYA 2C7OA 2Q1YA 1JFTA 3KPJA 5KKNB 4LOHA 5DNEA 1L9KA 3ZWWA 5JCZA 4OM7A 2UUPA 4NYMR 5CEEA 1TOAA 3QNUA 4M86A 2JARA 3N1UA 5JNTA 1CK4A 1T4MA 1G8KA 1H0RA 1O9GA 4R16A 3ESAA 3HSYA 4JNCA 1DCKA 4DNFA 2G9RA 5GJCA 1IATA 1UAAA 2BMAA 1X92A 1I7DA 4OHUA 3V2GA 3BOSA 1GNSA 1PSDA 5AVVA 1VJTA 1BS2A 3IO5A 4ARUA 4Q7EA 1UOQA 3FAKA 2FTKE 1Y98A 3MJSA 2YWRA 3LXXA 4FSHA 1V95A 4AI6A 1KNQA 4B45A 1NFFA 1XQ9A 2B98A 4Q3LA 2C99A 3VXKA 3KD3A 1E7RA 1FL9A 1DOHA 1UWCA 3MS7A 2AXEA 1DIOB 3AF4A 4FJ1A 4KHZA 4MYTA 4BBAA 2WY2D 3SQLA 2G63A 4IDHA 1AZLA 3W06A 1M1UA 2BUAA 3GJXC 4Y7CA 5G4KA 1FQWA 1O94A 1NR7A 2AEFA 3HA5A 3K9WA 1SIWA 4FHFA 3LW7A 4IHQA 4UVEA 2IWRA 3MG9A 1K08A 2D5CA 3D5TA 2YHBA 3DVQX 3VHXA 2PGIA 2JGMA 2ZIXB 3F6SA 3PC4A 2QGZA 5JLAA 3W79A 3DZBA 4Y2VA 2WQ7A 3GELA 2UYOA 4G24A 1NI3A 2I4IA 2HO5A 1DBVO 4LSMA 2JGFA 2XCQA 1QO0D 3HSKA 4I8XA 2NPFA 1Q15A 4NBTA 2OO5C 5DN6A 4O4JB 5IUKC 1NXVA 2B1GA 5TQ0A 3TH5A 4AZ0B 3CNBA 3ZZTA 4I1RA 2OZVA 1G21B 4COOA 4HPWA 1TZCA 2ZE8A 4KOEC 4ZTZB 4BQNA 2GN9A 2JEZA 3KQMA 4MWOA 1RPZA 2VSYA 3FFWA 3ICOA 4UBMA 3ZPXA 1GVNB 3NALA 4YRDA 5BRAA 3GUVA 4E2ZA 4KKVA 3GT4A 4ZO7A 4CT0A 4I55F 4YQYA 1DTEA 3WKDA 3N6XA 3X1KA 5IAOA 3ZWXA 1HNXB 3ICEA 2Z08A 4HR7A 2I7XA 2GZ3A 4P3PA 5AOAA 4V0LA 3T3PB 4AS3A 5CA1A 5L6MB 4FHGA 3IE2A 2E89A 3W4IA 5KWSA 2YNMD 3U48A 1W8DA 1BS1A 1THGA 3OO0A 4PG5A 3WK9A 3RVJA 3PC8A 4YPVA 1K4KA 3ONNA 3K9NA 5ELMA 1RQXA 5ICGA 1HE8B 2O3UA 3I4LA 1I6WA 1M8FA 5H3CA 1I4WA 2HF9A 1LY1A 3NANA 4K81B 4DFDA 4R6XA 4LF8B 1OPXA 2FSSA 4WERA 2QXTA 2IYOA 4L9AA 1Z4PX 2NU8B 2G9UA 3M2TA 3DZFA 4EI7A 2XHZA 1SAYA 3NT2A 4BX3A 2XDWA 1FW8A 1S7GA 4Q16A 2F64A 4H0NA 4HLCA 1G21A 3AQIA 3IAM6 5MDHA 4O63O 3JRNA 4MAAA 2X15A 3C3PA 1R9JA 4WJZA 1PK8A 2IWHA 5AVUA 3ZDYB 3WQBA 3W6UA 2EWWA 4YP0A 2BELA 2JFXA 2XE6A 3S27A 1ADFA 4JASB 3TTYA 3ZE0B 1AV6A 4OREX 1Y9DA 5KJEA 5CAEB 3VR4A 1R66A 2VBFA 1JG6A 2ZB2A 1K7CA 3AKCA 1NBIA 2PQMA 3KPWA 4KVFA 2A30A 3PWTA 4UM9D 4XPIA 5AM0A 3X1MA 2WDZA 2HK9A 1RM3A 1DQYA 3FUXA 3PC3A 3U3ZA 5BV2P 2OBMA 1OLXB 3WVNA 4PBTA 4C2AA 5GJBA 2M32A 5KEIA 1Y82A 2G25A 3IAXA 4IRXA 4RIIA 4G5HA 3C3YA 3PHJA 5KHLB 4ZCQA 2J7PA 3DLBA 5JTTA 1QWOA 1KI1A 3BHJA 4GRIA 4N03A 2H8GA 2WSIA 3IB3A 3CT6A 1L1RA 1MB9A 3OE7A 4UDYX 3W2HA 1UJ4A 3R7WA 1QK3A 2CJYA 3N8HA 2NSDA 1LV7A 3NC0C 4H1HA 3T1OA 2C07A 3CONA 1DC3A 1AXRA 3FETA 3MRTA 1NMEA 2JLRA 4ZO6A 3V8VA 2CNWD 3W5BA 2ALJA 2IELA 2FOLA 1HYBA 3R41A 4GLJA 1I24A 1K92A 5I5EA 4AP9A 2I7VA 3O9ZA 3P9XA 5MN5A 1JIIA 1YFKA 3SHFA 2HRRA 3EIQA 3EXIB 1ZK2A 2GYWA 1SELA 5EJ7A 2ONYA 4CEIA 4L72A 4DPLA 3BIFA 3JQGB 4M0CA 4ZARA 4HVTA 3UMSA 4YUAA 4MROA 2X5NA 5JECA 2VH2A 2TS1A 1BZYA 2WZQA 5E4YA 1TD1A 4P7JA 2PRIA 4JBIA 2IYEA 2WF9A 1GD1O 1NW3A 2OUIA 2CFRA 1M7GA 2ZTHA 2PR7A 4HYEA 1UC9A 3BQ9A 1YQ9A 3LOQA 3IQGX 4O2RA 4C76A 3QV1A 1N1DA 1YI1A 2JAWA 2IXEA 2XWSA 2XSZA 4RF3A 4R9SA 2SCUA 2QG6A 3G2PA 5DT9A 2OO5A 1EP1B 3PFKA 3FPHA 3V2HA 1GAXA 1A5BB 3E9MA 1V7QA 5KTOA 3FOCA 2FR0A 1TJPB 3F46A 1Z2CA 4MV0A 5I51A 2P35A 4EA9A 2G04A 1XE3A 3WGZA 2H08A 2O7NA 3AZPA 3QVMA 5TPWA 3TLJA 1DP4A 2FSGA 1K5GA 1A2QA 1U6IA 4AN1A 1W87A 1WQ4A 2FEAA 3NR2A 1FS6A 3NIFB 5CM2Z 5ER6A 3T94A 1W36D 4M0LA 3BTUA 3G59A 1XMXA 3QMMA 4HN9A 4LTMA 4M0MA 1G60A 4QSHA 4Z7NB 1OIWA 3VH1A 4MHTA 1QIJA 1W35A 2XPCA 2NNWB 3HABA 3V4ZA 3B48A 3GLVA 4BMDA 4AW9A 4JYZA 1L5OA 2J6CA 1PQWA 1VPWA 2P6NA 2Z2JA 5U4XA 1VPDA 3MD0A 2Z2XA 1UBMS 5LBTA 4HQFA 4DUGA 5DT2A 4D9KA 2X8WA 1VKZA 3NEJA 5F3DA 2GPSA 3KTDA 4CMKA 1PR3A 4QOIA 3TLZA 5AM2A 4C5CA 4NXMB 1Z2DA 4TLLB 1DG3A 4DAOA 1XMPA 2X1VA 4UHCA 1LPSA 3PUZA 4E5SA 2RBEA 4MLCA 4ND1A 5BSGA 3BPSA 1EUCA 2ZW9A 4MVJF 1JG2A 4IIEA 1VKOA 3KYJB 4M2LA 3EVFA 4URUR 4BB6A 4LVCA 1OHHD 3PXDA 1RMYA 1BOFA 2BBWA 5G0WA 1OCEA 1M2WA 4L8VA 3GJSA