1DRUA

Escherichia coli dhpr/nadh complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1druA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1druA01
3PHLA 3AI1A 3I9JA 2VHVA 2FPPA 4KTVE 3E6AA 1B26A 3CPSA 3IL2A 1ZO8A 4G5HA 2I9PA 1SB8A 4DA9A 4YT5A 3BA1A 5G0TA 4ZQGA 3QWHA 3AM4A 2VT3A 3LT1A 5L4LA 3S2GA 2EXXA 2NVBA 2D8AA 4PIVA 2E82A 3U4HA 3KXDA 4KOAA 4RVDA 5C5IA 4UUNA 3VHRA 1WMBA 4WEOA 3VH4A 1ISGA 3JQAA 2GERA 3K8ZA 2QYSA 3ANNA 3H3JA 3RUCA 3PFFA 1DIAA 3HG7A 4FGSA 3BMQB 3OBBA 4BO8A 1SEVA 4KDFA 1SC6A 1MG0A 3V1UA 3JSAA 1LNQA 5CDUA 2Q49A 3PQDA 2CF6A 1DIBA 3D5TA 5F21A 5L51A 4CR7A 4LVUA 4D44A 4BGVA 1TEHA 2ZYAA 5DN9A 4I08A 5ER9A 1F0YA 3NDIA 3SLKA 5GZ6A 2NTJA 1U5CA 1X1TA 2AE2A 2EP7A 4BNVA 3OIGA 4H16A 2C07A 1NTOA 4YBZA 3JQEA 5U9CA 1WZEA 3DQPA 1Y7TA 1ZK4A 1ISFA 3IOYA 1R6DA 3ICCA 1E3JA 3BTUA 2FPIA 3O38A 1G6KA 2JJYA 3VTFA 2BFMA 3VDQA 4B3JA 1V9LA 2WWRA 4IQ8A 2X8LA 1T24A 3ITKA 3A4VA 2CD9A 3AOEA 1BTOA 3E82A 4BNTA 4B4WA 1DHTA 2NADA 4C7JA 4JP2A 4QFDA 1C0PA 3ZV5A 4Z0PA 3BMNA 3W1VA 3OQBA 3ZNQA 3UUWA 1NWCA 5L7WA 1MLDA 1SZJG 1P44A 4MOWA 3ZWNA 4AJ4A 2XAAA 5HRUA 3PI7A 2NQTA 4UAGA 2VRCD 1X13A 2DFDA 3BMCB 3C1AA 1XGKA 2VNSA 4U7WA 4YXFA 3PHIA 1U3UA 4R01A 4QXMA 1YONA 4E5NA 4BNIA 2GR9A 4YYZA 5KVQA 3MJSA 4I5DA 1BWSA 4EJ0A 1ZH8A 1PS9A 2PLAA 4I5EA 4JCOA 1NFQA 5BSGA 3PLNA 3AW9A 4JBGA 4KWHA 3O4RA 4KUGA 5J23A 1B2LA 4D3SA 2HLPA 1QG6A 1O9BA 1T2DA 1EVIA 1GD1O 1VSVA 3RUEA 4OIMA 4M87A 3ZHBA 5L53A 3UH1A 3L6OO 3WGZA 1T25A 2UDPA 4UREA 4CMKA 2DUWA 5IDXA 3PFWO 3LF1A 4U0JA 3F1LA 3UVEA 2JFHA 3INTA 4QTZA 3GGGA 5IZ4A 1BXZA 3BIOA 4CQLA 5CEEA 3U3XA 3QY9A 3KYDA 4YRDA 3RD5A 2EGHA 4QO7A 1VKOA 1LSSA 2X4GA 1P1FA 4J2OA 2ZB3A 1PJ3A 1C0LA 3QLJA 4W99A 5A3JA 3DZJA 2Q1SA 2JKVA 3RU7A 3V2HA 4DQUA 3UFXA 3ULKA 3JYPA 4NJOA 4XJSA 4JROA 1NWHA 3GUYA 2XOXA 2YV1A 3AUAA 1V3VA 3ZWYA 3NT5A 2ZTUA 3LC1O 2O4CA 4WLUA 2WM3A 1RKXA 3JQBC 2RIRA 4DQXA 3A1NA 4MO2A 5DOVA 2GPTA 4B7CA 4UULA 3D4OA 4DIFA 4AJEA 4J7CA 4ZRNA 1YBVA 4UVHA 1NM5A 3ITDA 4XRRA 3SJ7A 1I24A 2VWHA 3HSKA 5JDIC 2JL1A 4XD2A 4RF2A 1DC4A 3E9QA 1OMOA 1HETA 2J6IA 1I3LA 3U49A 2CDCA 3IP1A 2UAGA 3NV9A 3VPXA 1A9ZA 3I83A 4FFMA 2FPGA 3CH6A 3L9XA 3TJRA 4NQZA 3JQ8A 4BO2A 4BMNA 3KYCA 3S2IA 2J3IA 2BFPA 4XR9A 1VKNA 3NTQA 2Y0EA 1PGOA 2O7SA 3NKLA 4F46A 1O0SA 3E9NA 3PJGA 1LDMA 4OL9A 1A9YA 2YY7A 4LW8A 4IZHA 1JKIA 3PDJA 3E5MA 3JQAB 4J9VA 1T1SA 3K30A 4S3MA 1UXGA 4Y67A 3ROQA 4A27A 3Q0EA 4BO3A 4EUHA 3UICA 7ADHA 1P1IA 5CHEA 4INAA 5AOVA 5AXAA 2YQ5A 1GEGA 3TSCA 5EIOA 2EERA 4K6CA 5L40A 1I5RA 3LVFO 2CY0A 2X1HA 5EESA 2ET6A 1LX6A 1EUZA 2YHUA 4RVFA 1PL7A 3DOOA 3RAJA 3TN7A 2VOJA 4CMIA 3OEYA 4BNUA 3OICA 1EQ2A 3TZ6A 3QWIA 1LA2A 5T67A 1HDXA 3KTDA 2OBYA 3GFBA 1U5AA 5B12A 4GX0A 4LMPA 1H94A 2HSDA 1ARZA 4Q9NA 3C7AA 3WBBA 3H9UA 4GX1A 3PHJA 2ZJ0A 1LEHA 1ZUD1 3OQ1A 1E5LA 3V1TC 2VYVA 4R54A 1IUKA 2ZB8A 2OBNA 3U62A 1SO8A 3C7CB 3K2BA 1RM5A 2X5OA 3CZRA 1ZK3A 4O0LA 1TT5A 4L73A 4PRLA 3ZU5A 4ALNA 2B83A 4CLOA 1DO8A 2G82A 3BMNB 1ADCA 1CETA 4YQYA 5L9AA 2PH5A 1C14A 4AJIA 1UUFA 2VZ9A 2DTDA 1B8VA 3W8DA 4PZEA 1XU9A 2IEBA 4OH1A 1C1XA 2HMVA 3BTOA 5JYDA 1PJ2A 4BO9A 3LLVA 1EMDA 4BHTA 5BR7A 3G49A 3ST7A 2VHYA 3GHYA 2ILTA 2IZ1A 4FQ8A 3AWDA 3EGOA 3I23A 5T6BA 2WD7A 3ROPA 4TKMA 3GPDG 2OHXA 1JAXA 3TDKA 4HV4A 4J16A 5HA5A 3I6IA 1I2BA 4RF5A 1I2CA 4GKVA 1EE2A 2CFCA 3ETEA 4J6FA 1QR6A 4RPGA 1UDBA 4IM7A 2RCYA 3WQSB 4PLZA 4E2ZA 3KV3O 2J3JA 3EVNA 4QSMA 3WS7A 4LSMA 1VRWA 3UCFA 4BKQA 3M2PA 2X7HA 5IAAA 2GN6A 1ENYA 3LT2A 1P1JA 2W2LA 4E2WA 3KB6A 3L4SO 3FTPA 5DCUA 3DL2A 2NQ8A 3PJDA 2RAFA 3ANMA 4CQLB 4D3FA 4DRYA 1PJSA 3C1TA 4J3FA 4L0QA 4K9DA 3ASVA 4PZCA 1QSGA 2BMAA 3ZU3A 4OHUA 4E0BA 1XQ6A 3PZBA 3ZU4A 3JD1A 4JQCA 3ZHXA 4ZHSA 4RPKA 4XIJA 2AG8A 4CUKA 5IXSA 4IGFA 2GN8A 1N2SA 2PKQP 4B8WA 1G0OA 4XB2A 5CPFA 3A06A 3ADOA 5TT1A 3VKUA 4E5MA 5L4SA 3D5QA 5TIIA 3VPSA 1NYTA 3AI2A 2OL4A 2VZ8A 1Z6ZA 4NR0A 2R6JA 4YT4A 2Y66A 4MIOA 2A9FA 1PZEA 2NTVA 5DCYA 1T26A 1U7TA 3UW3A 1CEQA 4Y8VA 2VWQA 2IYOA 3K31A 1E3WA 3ETDA 1TB4A 1R66A 1J4AA 4A26A 4OQZA 1UP6A 4PLCA 1JW9B 2ZATA 1FDWA 4UEKA 2YYYA 1FF9A 1I01A 3DMTA 2UVDA 3M6IA 4B79A 1PS8A 3TL3A 5KVCA 3GK3A 4FBGA 4FFPA 3T4XA 1E1LA 4GKBA 1IZ9A 2EG9A 4MVJD 4K1LA 1GY8A 3FN4A 4ZQHA 2P9EA 1X7HA 2CVZA 3SJUA 2H63A 4MVJG 1ISJA 1HDCA 1HE2A 2PZJA 5GMOA 3RBVA 1DAOA 2Q3EA 3ZWPA 5ICSA 3GZ4A 1QRRA 1NR1A 1N7GA 2HMWA 3KYCB 3S2EA 3AU8A 2HK9A 2Q1WA 4J4BA 3H7AA 5TNXA 1T2AA 4AJPA 2EW2A 5T73A 1X7GA 3D1LA 3ZI0A 5DCWA 5EQFA 4E31A 3VKVA 4NK5A 3ANLA 3UXYA 4BKOA 4WASA 2AXQA 4Y9DA 2YW9A 4CL8A 1HWYA 4LCEA 4ZU3A 4Z3DA 1B3RA 1AXGA 1BHSA 2Y1OA 5TT0A 1PJBA 3RU9A 2X0IA 4IIUA 2D2IA 1OC2A 4J4TA 3FBTA 1HDYA 3BHIA 3M2TA 3BMOA 2J3KA 2PZMA 1LLCA 2PNFA 4G81A 1J0XO 1QYVA 1RPNA 2FOIA 2UUPA 1KC1A 2YFHA 3ZWVA 4DWVA 3NAQA 2HCTA 2HK8A 4UUMA 3F5QA 4CMIB 4MPDA 3S2FA 2V6GA 2EW8A 4RDHA 2BKAA 3DAGA 3JD2A 5BSHA 3UKOA 1E3IA 4B7XA 1P1HA 1YXMA 4BKPA 2PKRA 3FCOA 3ZW8A 4HFMA 2ZK7A 4QUKA 3GY0A 3CUKA 4IMPA 3KRTA 1NXQA 1XCBA 3PYXA 1GZ6A 2PGLA 2O48X 1LLDA 1LQUA 3JQAD 3PLRA 3WYBA 4NIMA 4II3A 1ZJYA 1T2EA 4EEXA 1TT5B 3IJRA 4ZICA 4CLOB 2BFOA 3PP8A 1JVBA 1GUZA 2AG5A 2Q45A 4R1TA 3ZV3A 4BNJA 4OM8A 1W0CA 4G65A 4Z9FA 1EFLA 2JAPA 5DP2A 2A4KA 1K0UA 4J4HA 4FSHA 4M89A 5KVVA 1RYEA 2FN7A 1V3TA 3JQ6A 3DBVO 5EL0A 1C1XB 1SOWA 2QRLA 1BG6A 1GYPA 3HJAA 1MXFA 3HNPA 2NUAA 4Q3DA 1T2FA 1XKQA 3ZGYA 1YJQA 3RC7A 2WD7B 3PYLA 3NYWA 3OETA 4FC6A 5EN4A 3L6DA 3F9IA 4OO3A 3GEGA 5FI3A 3RBXA 1SNYA 2AQ8A 2OMEA 1CQJA 4J1TA 3U9LA 5IZCA 4NFYA 3QVTA 4FJ0A 3GDFA 4JNKA 3UCEA 1DC6A 1DC5A 3MEQA 5JFOA 1NP3A 2FZEA 4JBHA 1S6YA 2PFGA 3GF4A 4LSWA 4CMEA 1JTVA 3WDSA 3I5MA 3SXPA 2VQ3A 1QYWA 1EK5A 2G5CA 4XB1A 3DBLA 4YTEA 1PWXA 4IDGA 4JXKA 4X54A 1MUUA 3KO8A 5L7YA 1MXHA 1BW9A 1NVTA 3OJFA 1DIRA 4DREA 4Z9YA 5JLAA 2DPHA 1GUYA 1HTBA 2BGMA 5L3ZA 5ER6A 1C0IA 4JK3A 2X5JO 1UDAA 1YL7A 2QRKA 1QV7A 3L9WA 5I7EA 3WXBA 3WFJA 3F3SA 3Q9UA 1I3MA 4BNZA 4NBVA 1ISIA 3GMSA 4ND5A 4CLDA 5G2OA 4DL9A 2GO1A 4XX0A 3L0DA 2GN9A 2X0JA 1GUFA 5JS6A 3PK0A 5AVOA 1HDGO 4BOYA 4WCFB 7MDHA 4ND3A 3NT4A 3GMDA 2JFFA 1FDTA 1E3WB 3WMWA 4N54A 1KIFA 4GSKA 4RZHA 1LI4A 1WP4A 1XELA 4IQ0A 3P7MA 4NBRA 4EJMA 5C37A 4H15A 4WE3A 2CZCA 2FSSA 4XYLA 1DFGA 3FR7A 4NDNE 5F5LA 4GGPA 1DJNA 1U3TA 3UN1A 3S8MA 1SB9A 4CM8A 4HXYA 4ESOA 5JBIA 2O3SA 4HBGA 4NFSA 2PA3A 2HQ1A 5JAQA 4CR6A 2A94A 1ZSYA 3DHNA 5JC1A 1E1KA 3DZIA 3VC7A 4QQRA 4BO5A 1KY4A 3FR8A 6ADHA 3LT4A 3ZNNA 1TI7A 3LF2A 3D4PA 4LN1A 1Y9AA 3WTCA 4PG5A 3EDMA 4WEQA 4BO4A 5IF3A 1P31A 3BTVA 3QP9A 5JW6A 3I9MA 4KQXA 1R37A 4NNJA 5ITVA 4E2XA 5I7SA 2IRWA 3KSUA 1NQOA 4FOSA 5KNLA 3GEMA 4XYMA 3A28A 4DGSA 2CUKA 4QFCA 4RVSA 2X9VA 3GVPA 4CM4A 1J5PA 4FFOA 4YAJA 5H83A 3WLEA 4HX5A 2P4QA 4ZRMA 3STHA 5TQVA 3BMOB 1JU9A 2VCYA 4XYBA 4PG4A 1WNTA 3N58A 1LC0A 3SBOA 1JLLA 1Q7GA 1FDSA 1NR7A 3CSDA 4IDDA 4OOFA 3IJPA 3AK4A 4NG5A 3VH3A 4J0EA 2FWMX 3ORFA 1K6IA 4KTTE 2NNLD 4Q39A 4UVGA 5KJEA 1VPDA 1PR3A 4UVIA 4ALLA 3DXFA 3NDRA 2Q46A 4A5OA 4PFJA 2PWZA 1VJTA 3NTOA 1EUDA 3I9OA 3RUHA 4B4VA 5KVSA 1I8TA 1Y1PA 4B8ZA 5MDHA 3HB4X 2VZ0A 2ZYGA 2DBZA 1GQQA 1RM4A 1XR3A 3DZBA 2Y1GA 4R41A 2LDBA 1IOLA 1P77A 3H5NA 2EKQA 3L07A 4TSKA 4FFNA 1ZIDA 4CJXA 1PSDA 4XA8A 3NUGA 4A10A 2B4RO 1PQPA 4GBJA 1KVTA 4WECA 1F12A 4LCJA 2C7VA 4MKXA 2O7QA 4KWIA 5CAEA 3C24A 3RI3A 5IJZA 3MTJA 5KKCA 1PJTA 4GVLA 3IAHA 4DMLA 2B4TO 3FI9A 2TMDA 2GUGA 3LQFA 5F3RA 1A4UA 3RC1A 2C2YA 1AHHA 4KZPA 5DBIA 2B37A 3GPIA 3RASA 1QLJA 3T7EA 4J7UA 2VYVD 3F47A 3PEFA 2YHIA 3PHHA 1ZBQA 4AJOA 5KJCA 1PZGA 4DIOA 1O8CA 3DBLB 1FDVA 1SPXA 1LSOA 5TX7A 3ZV4A 3JQFA 3G1TA 3PQFA 1EZ4A 4UUOA 5AXDA 4BV8A 1LDBA 1GCOA 1BW9B 3QWFA 1E7MA 3UF0A 5JAIA 1UJMA 4R1NA 4RPHA 1QLHA 5A3VA 1K89A 3IIEA 4IIVA 3IDSA 1GEEA 2HRZA 3HUDA 3NGLA 4TZKA 4J1QA 3AFMA 4ONEA 5CEFA 2JD2A 2PR2A 5HBRA 2CVOA 1A27A 3QV1A 1PGNA 3GLQA 1KVUA 1KVSA 1V8BA 1E7YA 4R5HA 4IXWA 4OQYA 4GQAA 2YQ4A 4D0SA 3VVBA 2JCYA 4BNHA 4BNMA 1KEPA 3LC2O 1D1TA 2Q99A 4AJKA 1JVSA 4RQUA 2W2LD 4YRBA 4HFJA 1PQUA 1CIVA 2ZQYA 3HFGA 4NZ9A 4RVUA 4BMSA 3MCVA 4NBWA 3DONA 1Z7BA 2J8ZA 3CIFA 4CM8B 4NU6A 3C1OA 4OAQA 4XQGA 1T4BA 2YV2A 4I9HA 5ILOA 1BXKA 1ENZA 3T4EA 3AY3A 1DFHA 1IZ0A 5B4TA 1P1KA 4W9NC 4HFRA 1ZSNA 4GAEA 3IP3A 5DBFA 3D4NA 1QKIA 4O5OA 3RC2A 4XCVA 4L4XA 3OA2A 2VHWA 3I9KA 3CZMA 4AG3A 1HZZA 1GYRA 4QX6A 1PGQA 5EERA 3EZLA 4OKIA 5FYDA 5TRTA 3SEFA 2Q2QA 4HNHA 5THKA 5BQFA 4IINA 4OOEA 3PZRA 3HHPA 4CLXA 3RKRA 2ZYDA 4E6PA 5A03A 2DVMA 2DLDA 5JYAA 1U4OA 1V35A 5F1OA 3A9WA 3GAFA 3Q6IA 3OF2A 3GVHA 2P4HX 4RPLA 3F1KA 1DXYA 4YCAA 4DUPA 5ICMA 1LBEA 4FPXA 4JJFA 3TRIA 4CM4B 1M6WA 1PJLA 2Y1CA 1LQTA 2O23A 3GVIA 1WZIA 4XEHA 4PLYA 5G0UA 4JX8A 1A7AA 5I9LA 2JFGA 2ZCUA 5KIAA 2AHRA 3L77A 3U09A 4UEJA 1N9GA 3OA0A 4TRNA 2D1YA 1YL5A 1YQXA 3NT2A 4EEZA 1HYEA 5CDTA 5G4KA 3INRA 1CJCA 1HSZA 4BNGA 4I9UA 1VL8A 4Z6KA 2P5UA 2C54A 1WMAA 1BSVA 2AQIA 2Z1NA 1SOVA 1HE5A 1Z75A 2JCXA 2FZWA 3O8QA 2NWQA 1I3KA 4E5KA 2Y99A 2QZ9A 3GVXA 4OYRA 4N7RA 1YBAA 1TA4A 4XDZA 4YWJA 4XQ9A 1H93A 1ZJZA 2JD1A 4AFNA 1YS4A 1OI7A 1ZNQO 2ZB4A 3H3FA 3U4CA 1E7QA 1E7RA 3G17A 1GPDG 2DC1A 4BO6A 2E37A 1ZXLA 1ZW1A 2GRAA 1YB4A 2H1SA 1VE9A 3H8VA 1GADO 3M1AA 4D45A 4PLPA 3S55A 3GZNA 2EJWA 3FBGA 2D0IA 3FWZA 5EPOA 1PX0A 3DO5A 3O9ZA 1I0ZA 1IYZA 2BI8A 2DQ4A 2EP5A 2IXAA 2P5YA 2V65A 3GNSA 4TRMA 4A03A 5EMHA 5K6AA 1ZK0A 1X14A 1UR5A 1JWAB 1TXGA 1MP0A 4DPLA 1SAYA 4DTIA 3QHAA 1HKUA 1M76A 1BDMA 1C1DA 4P4LA 1MX3A 1Q7CA 4HWKA 5TJ9A 3OIFA 1S7CA 3RCBA 1M2WA 1ZZEA 3JD0A 2YHIB 3FWNA 1R12A 4CPDA 2GDZA 1YH3A 2AEFA 3RFTA 3VPFA 3OH8A 1E92A 3SLGA 4YJFB 4L75A 4NMHA 1ULUA 5B37A 4AJJA 3H6KA 3IS3A 4JLWA 1PZFA 4W82A 3HADA 1A71A 1EDZA 5JE8A 3TOZA 4BNNA 3LK7A 2Y1FA 2R2GA 3OP4A 3K73O 4CLEA 2IODA 1HF3A 1DRUA 1GYQA 1XEAA 1DHRA 2POQX 1DC3A 4MIEA 4HUJA 4KUHA 4ZQFA 2NU7A 2GASA 3B20A 1YB1A 3H65A 2PY6A 1VC2A 2I6TA 2P9CA 3MJCA 1U2GA 1VI2A 3KUXA 3H2SA 3HFSA 1MG5A 3GVCA 3FNFA 4RVGA 5COBA 4JGBA 1K6XA 2CMDA 1UXKA 2SCUA 2A35A 1IULA 3DBHA 3ZHZA 1DSSG 5EINA 4ZD6A 3H9EO 2WE7A 1DJQA 3JQGA 3GQVA 4YJHA 3OM9A 4U0KA 3WLFA 1BMDA 4WLNA 1SEPA 3TFOA 1NQAO 2O4UX 1HE4A 2VUSA 3EMKA 4FCCA 5K9ZA 4Q3BA 4BB5A 4S1VA 1VL0A 4BO0A 2IDZA 3L4BC 5TF4A 4XR4A 9LDTA 1QMGA 1X0XA 3ASUA 5T8KC 1M75A 3DC2A 5IZCC 1X7DA 5T64A 1SBYA 4RF4A 4U6SA 2X0RA 1OC4A 4HY3A 4IY1A 3VZQA 3JCZA 1V3UA 1ISMA 2ZTMA 4DLAA 5AXBA 2NM0A 3WX0A 4MDHA 1QXSA 5TLSA 3I4FA 5L4NA 4XGIA 3E5RA 1Y8RA 5JNLA 3P19A 3I9LA 3RFXA 4OXKA 3GRKA 4MP3A 4I5GA 4J43A 5JMWA 1N9GB 5DBGA 2UYYA 1B0AA 2E6UX 3JQCA 5A1TA 1KEVA 2PK3A 3R3SA 1ADFA 4CMCA 5JDCC 3E03A 4ZGWA 4IDBA 2X0NA 2VN8A 3PRJA 4P8RA 3QA9A 5FFFA 1VLLA 1W4ZA 5G4KB 1E1NA 1UXIA 4L76A 5I7VA 1Y9EA 5I8ZA 3ZNOA 4XYGA 4GMGA 3FSRA 3N7UA 3O8QB 4Z0HO 3L6EA 1GL3A 3ZU2A 1TT7A 1KC3A 4RO0A 3GNQA 3QVOA 4L4RA 4MP6A 4MVJI 4HFNA 3F46A 4EITA 2WTBA 1Y5MA 3RWBA 2W8ZA 3COSA 4PVCA 4FB5A 1M67A 3PYMA 4TQGA 1PJ4A 4R4JA 3VOSA 1DFIA 4CMJA 1EE9A 3JV7A 3NJ4A 4TVBA 4MVJM 5G0WA 1ISHA 2DUUA 3GZNB 5LDHA 3HDHA 3H2ZA 3EUWA 4TKLA 1CWUA 5BT9A 4M54A 3W8EA 1EK6A 4F6CA 4P22A 2NVWA 2DBRA 2ZB7A 2ZTVA 3P5SA 4II2A 4CM5A 5DNAA 2DAPA 1Z73A 5A05A 4I9NA 3U4IA 2UUOA 1ZSVA 4BNXA 4R9SA 3RROA 1C1DB 1ENPA 4MJLA 3HDJA 4WCFA 4DBVO 4M55A 4UVDA 5JMPA 3ICPA 4D79A 2BFAA 2ZIZA 2GZ2A 4L8VA 3I1JA 3ONEA 4DMMA 3MJ4A 1NQ5A 3F4LA 4EZBA 1GDHA 3RUDA 5JY6A 4FIZA 3JQDA 1NPYA 4U5QA 3MTGA 2QHXA 1YB5A 5KWEA 4R51A 4URFA 1BVUA 2OO5A 3R3JA 4ALKA 5BNTA 4D46A 2D4AA 3AFNA 5FI5A 1H2HA 4O1MA 1NAHA 3AUSA 1MC4A 4P4GA 1JWBB 1T1RA 4YA6A 1EVJA 1CQIA 3FD8A 1IHXA 1HDZA 3ROKA 2XPCA 4YVFA 4XRGA 2E48A 4QEDA 3NX4A 4QECA 1Q0HA 4NK4A 5IXYA 4PLFA 1RM3A 1UXJA 5EQDA 4WLVA 1FXSA 3DFZA 1HSOA 1QYXA 3AI3A 5HWSA 3WGHA 1LDNA 5COQA 4YAGA 2E49A 2PTGA 3RFVA 1XIVA 3DBHB 5JO9A 1SMKA 2CDAA 4CM6A 1WLYA 5TSDA 4GH5A 3DBRB 3JQGB 4YJHB 1LUAA 4Z9XA 3JQBA 4ZVVA 1LSJA 1HZJA 2OFPA 1GV1A 2AMFA 3RIHA 4MVJH 5M6DA 1SCUA 4YJGA 4KQWA 4IDCA 3LT0A 2GGSA 3TWOA 5B1YA 5IFLA 4JJGA 1GU7A 3ABIA 1U2DA 4PRKA 5JC8A 1CRWG 5JYEA 1N5DA 4N18A 4PZDA 3V5NA 3ZCXA 3WOHA 3IUPA 1ZVMA 3B1FA 1OOEA 3QVSA 1I2ZA 4J49A 4RORA 1I3NA 2FR1A 1PJCA 4CODB 4LMRA 5IN5A 3WGQA 4N5NA 5HS4A 3LC7O 3E18A 3D0OA 3D3WA 4D7AA 4I1IA 5JAZA 1H9AA 2O2YA 1N1GA 3PGJA 4E5YA 2RBEA 3MZ0A 1P1RA 3AM3A 4IS3A 2GD1O 1Y8RB 1LDYA 5GZ1A 2P9GA 4LVCA 4ALMA 4D3DA 2HUNA 3JQFC 5IG2A 2NLOA 3DFUA 2PKQO 5KOIA 3WIDA 2VTEA 1Q7BA 1UAGA 1Z82A 3AUUA 1P3DA 3IKVA 2WDZA 4CMAA 2I3AA 4R3NA 1KVRA 3AJRA 3I9NA 2V7PA 4BO1A 3BXXA 2RHRA 4MINA 1LDEA 5ENDA 3OJEA 3EZYA 1ULSA 1UP4A 1NPTO 2O3QA 1A4IA 3PDUA 5MGBA 2IZ0A 5BSEA 3T7CA 2OORA 3O26A 1H6BA 2WD8A 2YJZA 1X0VA 3LU1A 3G1UA 3K5PA 1VJ0A 4CR8A 1IL0A 5BNIA 3V2UA 2B0JA 3VTZA 3OEWA 1NX6A 4FJ1A 1N1EA 4B4OA 3PJEA 3K9QO 3HZZA 4CMBA 4K28A 4AICA 3R6DA 5EJ2A 1XA0A 2NSDA 2I65A 1D4FA 1JQBA 3CXRA 2EKLA 4M1QA 1PGPA 1P74A 3KSDO 5T5QA 3FPCA 2WYUA 3FPLA 1XWFA 3ZWCA 4ALIA 3KM0A 3QVXA 2P68A 2JD0A 3DDNA 4IJWA 2I66A 4D42A 5JXWA 1YQGA 4I8XA 3WR5A 3WTBA 4A73A 4C4OA 3DTYA 1Y6JA 4BUCA 3GG2A 2V6BA 4OKNA 1H6CA 2FHSA 2GCGA 3JYLA 1PL8A 1IY8A 3OMLA 1ONOA 3UCXA 1E7SA 5FEUA 4W6ZA 3TF5A 1PL6A 1B8UA 3FF4A 4E33A 4WJZA 2EIHA 4IJVA 3WGGA 5JCXA 3AOEC 2PH3A 1BGVA 1XHLA 5CDYA 1EVYA 1RYDA 2H5LA 3D64A 3RSHA 1QORA 4RDIA 1IPEA 2WYVA 4EBFA 4C7KA 5JPIA 1GQ2A 2F00A 1E3EA 3OSUA 4DQVA 1B16A 1H2BA 3QSGA 2DFVA 3P2YA 3CTMA 2I3GA 3UOGA 5CDSA 3ZDFA 3LLSA 5IDYA 3DOJA 3UHAA 5ITWA 2R00A 3KSZO 4NHEA 3K6JA 1DRWA 1ONNA 1B3BA 9LDBA 3BYZA 4FFRA 1E6WA 4IDAA 1LXCA 4RV9A 3GEDA 3TOXA 1E6EA 5JSFA 3C85A 4OXYA 4EJ6A 2X22A 2DBQA 5AQ1A 3AM5A 3LDHA 1VM6A 2X9GA 3H9JA 3S1LA 1UZNA 2TMGA 4E5PA 5IDQA 5C7LO 3ZNPA 4EGFA 2HJSA 1A5ZA 1E1MA 3NJ8A 4TROA 5KKAA 1IE3A 1V0JA 3E9MA 2C20A 5ENVA 2VUTA 4RLHA 1CDOA 2BH9A 2QX7A 3MJEA 4HNGA 2AW5A 1WDMA 4YJGB 4PLHA 4IXTA 3WGIA 3RVDA 5B4VA 3FNEA 2X86A 1YRLA 1E77A 1ADGA 1D8AA 4XQCA 4IPTA 5GY7A 1YOVA 1I10A 2C5EA 4J2HA 3OJLA 4PG7A 1GTMA 1E3LA 3BZUA 2VOEA 3VPGA 1CF2O 3OECA 3HN2A 4FGWA 2Y67A 2IE0A 3ZH2A 4BNLA 1L1FA 1AXEA 5TJHA 2YZ7A 3D3WB 3OJOA 1EFKA 1U1IA 4F3YA 1UP7A 1Y81A 1MFPA 4GX5A 1AGNA 2AQKA 4AJHA 1YDEA 1UXHA 4R68A 1JKFA 1U28A 3D7LA 4BKRA 1ZEMA 5A02A 3OFSA 2PGJA 3HDQA 1DDOA 2Q2WA 4J1SA 2Q1TA 4GWKA 2BGLA 2CF5A 4DC1A 3A14A 3IKTA 3NDJA 5FF9A 2IXBA 1E6UA 1P9LA 4MIYA 4IDEA 3Q1LA 1E3SA 5BNFA 1BVRA 3I52A 3H4VA 4FN4A 2D59A 5HS6A 4BNWA 3EK2A 1Q0LA 5G4LA 4ZQEA 3H5RA 4BGUA 3ZWMA 1GV0A 4YJFA 3I4CA 2JHGA 3KETA 3BHMA 2J5QA 2QZZA 1PR9A 2J5RA 1F8FA 3CKYA 3KHUA 4BV9A 1R16A 4JN6B 5LC1A 3PIIA 4F6LA 4ZJUA 4IGEA 3QE3A 4NBUA 4XGKA 1B7GO 1CERA 2OZPA 3CINA 3PIDA 3AOGA 1E5QA 1MB4A 5TC4A 2O3RA 1MFZA 3GUCA 4N5MA 1PQWA 1FDUA 5JAMA 1WAMA 4FOOA 4D41A 2Z95A 5DP1A 3H9GA 4TZTA 4U6QA 4P38A 4UUPA 1T2CA 4WPGA 2WMDA 1U4SA 1C0KA 3PGXA 4GMFA 3Q3CA 3AY6A 4H7PA 4BGEA 5JY1A 2B5VA 3DZGA 3CMMA 1U8FO 1WW8A 5CP8A 5DT9A 4CQMA 4DLBA 5KTKA 4Y6RA 2VUUA 4AJLA 4NBTA 4DVJA 1RWBA 5JCJA 1EEHA 1R4MA 1AN9A 4XWYA 2GF2A 4XIYA 2X5KO 3C7DB 1KERA 5F1KA 4CV1A 4A2CA 4M86A 4J0FA 2AEJA 2HKIA 1ZFNA 2GNAA 3EC7A 3ZWOA 1N7HA 1LLUA 4J9UE 4MVJF 2WJPA 3KLPX 1T4DA 1HLPA 4JBIA 1NASA 1DPGA 4OJNA 4OSOA 1AE1A 1GPJA 3NGXA 4IZIA 3TPCA 4FFLA 5A4DA 3QRWA 2YV3A 4WCDA 1X1EA 2B4QA 3VZSA 4RJTA 1YO6A 4AJ2A 2RHCA 2VTDA 1O89A 1ZMOA 1JKJA 2W4QA 5I8WA 3WYCA 2XF8A 1R0SA 3DMYA 4AJNA 4TVOA 2HRBA 4NJMA 4Q3EA 3GOHA 5G0VA 4BNFA 3NTRA 3W6ZA 2Z1MA 2J3HA 2VHXA 1P0FA 3CE6A 3Q11A 3H9QA 4BMVA 2VYNA 1F8GA 4E2YA 1FK8A 4K26A 5T57A 2GN4A 3AY7A 2Y1EA 3HB5X 3E1KA 4XZ3A 4CUZA 4D0RA 1Y8QA 1N8KA 1KOLA 2BD0A 3MWDB 2Y93A 1K2WA 3C8MA 1XSEA 2GYYA 3WWYA 1YOVB 2VRBA 2G0TA 1MC5A 5COAA 1BXGA 1U3WA 1YBMA 4KP7A 3U4DA 3W6UA 2CDBA 1NFFA 5DULA 1ZEJA 3MWEB 2AA3A 1O6ZA 1M66A 2IEDA 4NU5A 4WCFC 1HT0A 6LDHA 3OHSX 4W7IA 5AYVA 4DPMA 1OBFO 1EQUA 1NHWA 3DAPA 2HAEA 3RJ9A 4B7UA 4YRAA 2I5PO 3RUAA 4GLOA 1NVGA 2Y1DA 1PGJA 1E0DA 4IQGA 5KCZA 3JYOA 4I5FA 2RH8A 4E21A 2X6TA 3DMTC 4W4TA 3JTMA 3KEOA 4CLRA 1P0CA 3DB2A 3JQ9A 3O03A 4J91A 4WLFA 4CM3A 2RH4A 4EDFA 2I99A 3JQ7A 1QYDA 2EHDA 5CG2A 2J5KA 3SC6A 1JAYA 2WSBA 1H5QA 4ITUA 4MP8A 5L45A 3V2GA 4BGIA 4Y6SA 2WE8A 1EUCA 4JP3A 4ROSA 3WNVA 2GZ1A 3IC5A 2JCVA 3DOCA 3RQSA 4LISA 5CFZA 1O95A 2ZKLA 1JDJA 4QT0A 4MVJP 1ML3A 1OAAA 2P91A 2FY8A 1XQ1A 4YJDA 1WDKA 1H9BA 2O50A 3GNTA 4FD3A 3WICA 4EW6A 3X2EA 1KEUA 1LRLA 2HDHA 4M49A 1I36A 2BGKA 2C5AA 3HE3A 4ILKA 1HYGA 2NV6A 2BF7A 5CPBA 3V8BA 5CG1A 4FS3A 3Q9NA 1K3TA 4DPKA 4RPJA 4EUFA 2F1KA 3W8FA 3EHEA 1IB6A 3ENNA 8LDHA 4R16A 1J6UA 3WNQA 4FW8A 1ZK1A 3VZPA 3LYLA 5H82A 3GH3A 3LSYA 1BRMA 3WG9A 1XYGA 2Q4BA 1I32A 4CV3A 2W2KA 3ZWXA 2OGUA 4YB8A 3PXXA 4CM9A 4CV2A 1U7HA 1YGYA 4CLHA 2DTEA 2XXJA 2G1UA 3GN2A 1LSUA 1PS0A 1PEDA 3ZW9A 3EAGA 3WIEA 5JO0A 4ZQBA 1KBZA 4CQMB 3FNHA 4WLEA 2DKNA 4BB6A 3DBRA 1O5IA 1R4MB 3TZKA 1GCUA 2VNAA 3JYNA 2D5CA 1EVZA 4XYEA 4GI2A 3RJ5A 3W4IA 4TRJA 1AUPA 4FDAA 5KJ6A 2EGGA 3FTNA 5A04A 5CDGA 1F17A 5JYFA 1IHYA 3WSVA 4LGVA 3GRPA 5A9RA 1RJWA 4Q3CA 4PLGA 1PWZA 2GSDA 3K2EA 4Q3NA 3AU9A 3WQQA 2A92A 1GZ4A 3HWRA 3ZN2A 3G79A 3F5SA 2DPGA 4RLSA 2NU6A 1PJQA 2UV8A 4GX2A 5J9GA 4IUYA 3U0BA 3U5TA 4TMFA 3WYEA 2QW8A 3KEQA 2OOSA 3JYQA 4CMEC 4OXNA 1JN0A 4NJMB 3HN7A 1O94A 3ZV6A 1LJ8A 1J49A 1QV6A 1R4NA 4BO7A 3CMCO 1NVMB 3UAGA 5BSFA 3I3OA 3AUTA 4YAEA 2NU9A 5HM8A 4KMSA 1YKFA 3PWKA 3QJ5A 3HDYA 4FR5A 4Y6PA 1ADBA 1MV8A 3UGKA 1Y8QB 4PLTA 4O6VA 2HMUA 3DR3A 2B35A 2JAHA 1HYHA 3W4JA 3WJAA 8ADHA 1B14A 1W73A 1ZKMA 1XDWA 1ZMTA 1BXGB 4R1UA 4XQEA 3PPIA 3BHJA 3MOGA 4WOKA 2GLXA 4W9NA 1KVQA 1LC3A 1ZCJA 2Q2VA 3MOIA 3KVOA 4IBOA 4U8GA 4E3ZA 4WGGA 3ZWWA 2B36A 4Z3KA 1NNUA 2HK7A 3KBOA 1DLJA 4WNIA 1QP8A 1UZLA 1YL6A 1YWGO 1YVEI 3TL2A 1B15A 4O59O 1A72A 3KYBA 5ILGA 4GL4A 4B4UA 1HDOA 2Q22A 1R0KA 5DZSA 3TZQA 4CLRB 4O63O 2X9NA 3ONFA 1EDOA 3PTZA 1YDWA 1W6UA 3DTTA 4RQTA 1MA0A 1Z45A 2AEMA 4YPOA 3JQ7B 3TZCA 1M6HA 3B6ZA 2R00C 4WKGA 1LDGA 2NACA 4IMRA 1DIHA 5THQA 4BNYA 5DOZA 2EJVA 1MGOA 1WPQA 2FSVA 5KJ1A 3RC9A 1AHIA 2PD3A 3G0OA 3KYDB 2CNBA 4A7PA 4EYEA 2JHFA 2NTNA 1KY5A 4AJ1A 5G0SA 3I6QA 1RM0A 1K5HA 3DZKA 4NH4A 3H5AA 4PG8A 1L7DA 4TWRA 1GR0A 2V6MA 2NU8A 2EV9A 3ONDA 2AQHA 4FC7A 2DU8A 3NRCA 2FRDA 4Y98A 5A9SA 1EBUA 5A5FA 4YDRA 4LRSB 2G76A 1G0NA 1HXHA 2Q4EA 4PVDA 4IJKA 3PJFA 4PCVA 2I67A 1D7OA 5C7IO 5U4QA 3B1KA 1ORRA 2YFQA 2X58A 1QYCA 1PTJA 1ZXBA 3EY4A 3C3XA 1GQYA 2C0CA 1FJHA 2CVQA 4R9RA 3VH2A 2YUTA 5IDWA 3QWBA 2OP1A 3LZ6A 1VL6A 2QQ5A 2W2KB 4P4NA 2YDXA 4EUEA 2BI7A 2VRCA 4YR9A 3ENKA 3QWAA 3GA0A 4MKRA 1H6AA 4HKTA 3E48A 3TZHA 4WK6A 1NAIA 2O3JA 4TRRA 3JQ8B 2OXIA 4WNCA 1XLTA 5HTOA 1DLIA 3FHLA 2FMUA 4HP8A 4OGWA 3BAZA 4YACA 5K0ZA 1C3VA 3EVTA 4A0SA 4W7HA 4RGBA 5H81A 1K6JA 4RVHA 3PQEA 4GSLA 1PZHA 3K92A 4QO8A 5IN4A 2CSUA 1GAEO 1UH5A 3SX2A 1NBOA 4XDYA 3IUSA 1HL3A 2X23A 5JDIA 2PZKA 3IQDB 5TGDA 1ID1A 2Y0CA 2C2XA 1TVEA 2O2SA 1D1SA 5TS3A 4D43A 1VSUA 3WJ7A 1DOHA 5L95A 2WEKA 2GZ3A 4M8SA 4IJUA 4J7XA 2ZQZA 2HJRA 3OJ0A 4CQMD 1NHGA 4RZIA 4ALJA 1HE3A 3WGTA 2HO5A 2BHLA 2B69A 5JCJD 4HADA 1R4NB 2Q1UA 1WDLA 3WGYA 2Y68A 3MJVA 3P2OA 1F06A 1LTHR 4PN3A 3GDOA 1JA9A 2I76A 2O3UA 2HMSA 1Y5RA 2FR0A 4YAKA 3ROMA 4XJTA 2DT5A 3SC4A 4H3VA 3GT0A 3QVWA 1OFGA 3DHYA 1LRKA 3R1IA 4BNKA 5A9TA 1WXDA 5AXCA 4L74A 3TNLA 1U9JA 3IMFA 3B1JA 3GN1A 4NPCA 2FR8A 4DYDA 3GDGA 5U1PA 4WUVA 3OIDA 3PVZA 4GPD1 2DTXA 2WYWA 2QRJA 5DF1A 1KYQA 1UDCA 3VZRA 2Y0DA 5LCXA 4GGOA 2D3TA 3V1YA 4MVJE 4UVEA 3ZHYA 5KJFA 3B70A 1ENOA 2EEZA 3JD4A 3L4BA 3VVCA 4BS9A 1PIWA 3E8XA 1WWKA 3G3EA 5T8KA 1W8DA 3GR6A 2EKPA 2VYND 2B5WA 3ETGA 3F6YA 5CEJA 4R3WA 2AE1A 1I30A 3VAZA 4FJ2A 1H0KA 1N92A 3NEPX 3Q2IA 4R69A 4BIIA 4DLLA 3W4KA 2BLLA 2W90A 4IDFA 2E4AA 1Z74A 4LRTB 2NVUA 3GFGA 4PG6A 1I33A 1XG5A 3ON5A 3ADPA 3DWFA 3KZVA 1Q2XA 4YT2A 3Q2KA 1Z7EA 3RUFA 4CUJA 5JDCA 2VWPA 4OSPA 3DEYX 4KDEA 4YEDA 3GHHA 1P45A 5B4UA 4RCVA 4IS2A 3TQHA 1U8XX 3EYWA 3FRJA 4LK3A 4YQZA 5ADHA 3KOUA 1DIGA 3VH1A 1OZAA 5A9SB 1YQDA 1L7EA 1KETA 1YJ8A 1DBVO 4ND1A 4ZN6A 3QW2A 1BDBA 2O3TA 4XGNA 1YE3A 1XU7A 3R0IA 4DBZA 3WQRA 5C7OO 3F4BA 3HQ4O 2C59A 4E13A 1A7KA 2IYPA 3FNGA 1P33A 2OUIA 1U3VA 1GZ3A 1H6DA 1TLTA 4JJIA 1F14A 1Q1NA 2P2SA 3OQ6A 1D3AA 1E7WA 3BMQA 3WWZA 5LDGA 2ZCVA 5ES3A 4DYVA 4NI5A 3WGOA 2V6FA 2LDXA 1NQTA 3D3EA 4GLLA 5A06A 5I9MA 5A5EA 1IPFA 4J1NA 4YT8A 1WVGA 2YDYA 4N5LA 4WLOA 2PZLA 4B3IA 2D5AA 4MKZA 4CL3A 2C29D 2PD6A 4Z0TA 4K6FA 2QG4A 4BQRA 3SVTA 5DDIP 3WSWA 3QQPA 3WBFA 3KLMX 4PLWA 3ZZNA 1R15A 4CM1A 5C3MA 2G17A 3JQ9C 2HU2A 1B8PA 1DEHA 4B3HA 4DC0A 3GGOA 3PWZA 5K6AC 2HMTA 5I9NA 2QIOA 3JD3A 2EWMA 4GWGA 3WFIA 5F5NA 4CM9D 1HEUA 4L4SA 3ZWAA 1CYDA 3BMCA 2BRUA 4ND2A 3BTSA 1HLDA 2Q50A 5FWNA 4RL6A 3VPHA 4WOJA 1NFRA 4UEOA 2H9IA 3GAZA 4NFHA 4AL4A 4KUEA 1EBFA 1V6AA 3N74A 2Y05A 2EF1A 4R5MA 4J90A 3GC6A 4BKUA 2VT2A 4ND4A 3EW7A 2BELA 4DXHA 5L7TA 4E32A 3GGPA 1UZMA 2FP4A 4OMUA 2C7GA 3DHEA 1LU9A 1NPDA 2H6EA 4GVXA 4JIGA 1LRJA 3PWSA 4F45A 4CV0A 4YAIA 3RBZA 1ZK2A 2VHZA 5I7FA 4E30A 2VWGA 3PHGA 3M1LA 3WMXA 4CMGA 2W98A 4BQPA 4EI2A 2DBVO 2DM6A 2PV7A 2IZZA 3X2FA 4MVJA 4AVYA 3MJTA 2QYTA 4L9RA 3DAFA 1KEWA 2C82A 3K96A 5F1PA 1Q0QA 2PD4A 4Q3AA 1LLQA 4ZA2A 3VDRA 3ZWBA 1GFSA 1DRVA 1ONPA 2Z5LA 3RUIA 4BVAA 3DZHA 2OP0A 1DAPA 1KS9A 4E4YA 2ZJ1A 1X15A 1DB3A 1VJ1A 3CEAA 1FMCA 3RKUA 4PGFA 3WB9A 4RF3A 4XKJA 4BL5A 1G1AA 3QIVA 1HDRA 1PU2A 5GZ3A 2ZTLA 3INGA 2XXBA 1HRDA 3TFQA 4G2NA 2PGDA 1UAYA 3GG9A 4ID9A 2NVUB 4E12A 4CMHA 4CM7A 3DZFA 4R1SA 4DIBA 4PLVA 1R0LA
chains in the Genus database with same CATH superfamily
5ALYA 4RH0A 4AF8A 3AI1A 3I9JA 2VHVA 4XWOA 1BXRB 2G06A 5GVSA 5DRTA 1FSFA 1KZHA 5KQPA 1ZO8A 3PFNA 3QUAA 2Q2NA 1H2XA 4PAMA 4ZQGA 3BWYA 2A9KA 2FLWA 1W4RA 3H5WA 5L4LA 5J2UA 2VVTA 3R7FA 1GU0A 3WLIA 4MQFA 3NM6B 1FFSA 2BWJA 1MAUA 2COKA 3U81A 2C0QA 2Y2VA 3Q41A 5JR3A 4FZ5A 2Z4RA 4U3JA 4A26A 2WOJA 2VT7A 2OO3A 4RVDA 4AK9A 4DCUA 2ZLBA 4UUNA 2F1HA 5C5IA 1GN9A 4JI0B 2Z4TA 3LUJA 4M1YA 3D8HA 1EM6A 3R3ZA 1PR1A 1Z15A 2WT9A 2XDQA 4P3NA 2B1GA 4TM7A 2QDXA 4TSFA 5I4KA 3ANNA 1IOWA 1MHPA 3AXSA 3HB0A 2FEMA 2PLRA 2C8JA 2H18A 3BWMA 1LK0A 3EIQA 3ETJA 3H4TA 4R1QA 5LZ9A 1A9SA 1QO0A 3G5LA 4UARA 3OBBA 2QGFA 1SEVA 4HVTA 1SC6A 3QLUC 1MG0A 1RAFA 1XDDA 2A14A 4TX1A 3VO9A 5CDUA 4TUYF 2CF6A 3D5TA 1L5OA 2AS0A 1Z0ZA 2ZE6A 4KIUA 4CR7A 1ZVQA 4XVCA 2FMIA 4CTJA 5BMOA 4XIIA 3LS2A 5DYNA 1PNVA 3PNQA 1GTSA 4I08A 3NDIA 4INPA 4TTRA 2BFCA 3SLKA 3LPCA 3TLAA 2X19A 1ODIA 5GZ6A 1U5CA 3FTCA 4OB7A 4TTTS 4BNVA 4MUKA 1HNZB 1YS2X 2C07A 1NTOA 4H16A 4Y2GA 5JJIA 1QMIA 1OZHA 1ZK4A 3G5AA 1ISFA 3SYRA 3VYVA 1O2DA 2DWQA 2C8KA 3ICCA 3BTUA 2WAMA 3LWZA 4QTUB 3FWHA 2FPWA 1G6KA 5BUCA 1Z4QA 4JIMA 3R5SA 2AJBA 2H5EA 3ITKA 1FZQA 1VFNA 3FPJA 2CD9A 2OCLA 2QU7A 3THYB 1G9SA 4XUGB 2XAUA 1R10A 1OTXA 2NADA 4CDRA 4YRCA 3ANTA 3BMNA 1J06A 5K0BA 2WG1A 1P44A 2ZJBA 4QPDA 2BTQA 4DV6B 2XAAA 1W9MA 1U0LA 1LW6E 5C31A 4QDOA 1MR3F 4LG1A 1N9ZA 4JI1B 2ZUSA 2FSVC 3GJ6A 1XZKA 3I04A 3U7JA 3C1AA 1ESDA 4DDHA 1NJ6A 3PHIA 2B3TA 4NEQA 4DCSA 3C3AA 3P4XA 4QXMA 4INZA 4COOA 1XP5A 2EWWA 2GYWA 2WG2A 1SXJA 3AJEA 4MR7B 4G1UC 4I5DA 5EXXA 4HNTA 1ZH8A 1DUIA 1PS9A 1RWQA 2PLAA 2RB4A 4W5QA 1SOAA 3RS7A 3DBIA 1NBIA 1KSFX 1UMDA 1W85B 3QFHA 3ZCSA 2C1EA 2OCGA 4HLNA 4KUGA 1CBUA 1XROA 1DMSA 2OZVA 1QRTA 4WCVA 4EVRA 2VJCA 3IUNA 1L8AA 2HLPA 1GT91 1NBEA 1V4VA 3CGWA 1TJYA 3N2IA 5K05A 1T4CA 4FMCF 4GHWA 3RUEA 3ZHBA 1RYYA 2WC1A 1RBYA 1U1EA 3A31A 3FNIA 3SAJA 1OFTA 2AIRA 4UREA 2AKYA 2DUWA 4NE7A 4RKEA 5FPSA 2IPNA 4U00A 2ZXEA 4YUXA 3LF1A 4U0JA 4N39A 2QN6A 1M2HA 3GBSA 3UVEA 2WZDA 3CVOA 4LJ7A 4KO2S 3L1HA 3KQSA 3EP4B 1MA3A 1P9OA 2R1VB 5DNDA 3QLVC 3ESQA 2FFHA 5I5EA 2CE2X 4RVOA 5DHFA 1TF7A 4GZ3A 1ODKA 1XKTA 2J3QA 4WOCA 4UUBA 2C5LA 2EZTA 1S01A 1ZWKA 2ZB3A 4RY0A 4PX2A 4X1KA 3TE6A 2REQA 4W99A 1GUBA 3DZJA 2Q1SA 3TZEA 3AEQB 1DBRA 3JYPA 4Q01A 4FQ7A 4G84A 3WFZA 1JR3A 4JROA 1XYVA 1A9RA 2PSHA 3D2LA 3NM5A 3NWBA 5FTKA 2QLJA 3UUFA 2YV1A 2V7WA 2WWXA 3RTAA 3JPWA 2WM3A 2H7YA 5IMSA 3RSGA 2JFVA 2RIRA 1JPVA 3A1NA 2XB6A 4HNVA 1DO2A 3DFMA 5JAPA 4MO2A 1YAHA 3I28A 5BYJA 1JZSA 4DIFA 3OWOA 5C8DA 2HN9A 4ZRNA 1FQOA 3ASYA 3N2ZB 4MV4A 3T7SA 5TS2A 1H8HD 2VK8A 3HSKA 1P6QA 3DKVA 5ESDA 4CWAA 3WKAA 1RWVA 2OAQ1 2RH5A 1DC4A 1WUIS 1OMOA 1IJBA 2GBPA 2G1PA 3A6LA 4X97A 5E2IA 1T43A 3BK1A 1YZKA 4LE0A 4JYMA 2AI2A 3IP1A 2FPPB 3LUBA 3KXIA 3E5NA 5C8YB 2JZNA 2EAUA 1QAOA 3HKCA 1TVKA 1ZUHA 5GQSA 3CWCA 3A3NA 3O8BA 3TXAA 1A9ZA 1I7BB 3ZI4A 3L9XA 4YCJA 5KTSA 4NQZA 1Q15A 1N6LA 4FIDA 3KYCA 4LXUA 4NCXA 5FPQA 2J3IA 1E2DA 1DP4A 2ZROA 4QFMA 1VKNA 3DL0A 1K3UB 4XR9A 1FUIA 1AUOA 2BDUA 2QTWB 2YN2A 3PIRA 1TM3E 3PJGA 3BPSA 3L79A 2Z43A 5GOZA 6GPBA 1A9YA 2YY7A 3BWCA 2II6A 3EIOA 4RBNA 1J22A 4HTAA 4GZ5A 4PGAA 1ZL0A 2OV6A 4J2TA 3OQVA 3FYUA 2VPTA 4O4LF 2WT8A 4J9VA 4S3MA 3ROQA 4DYHA 1UXGA 4A27A 2NZXA 1B73A 1MO4A 4EGSA 5JCOC 7ADHA 2EF0A 4IFBA 4XD7D 5CHEA 3BT7A 5HPYB 2F1JA 4AZ0B 1UZAA 3ITNA 4F91B 1IBMB 5AOVA 2VSNA 4G4JA 5AXAA 4MGYR 3R3HA 1JI3A 2AKAB 2FPKA 4E5SA 3TSCA 4DUYB 5EIOA 3B9RA 4GQIA 1TOAA 4EDHA 4ZAGA 3QJGA 1E69A 1FOEB 3VMMA 1QG2A 1OR8A 2YHUA 4QTXA 5FORA 4MJ3A 1XTRA 2VOJA 4CMIA 4W5OA 1L7MA 2HK6A 5A7GA 3OKPA 1S7GA 4C6RA 5AI0A 3UJBA 2OLKA 2CLEB 4ZPXA 3SZUA 3LKVA 4UQLA 4AY6A 3ELWA 3C5VA 3GFBA 1T8TA 2Q5LA 2ZS7A 1ZD5A 4GX0A 2WNHA 4LMPA 4Y2XA 2CL7X 4DE5A 1FPQA 2IK8A 4OHOA 2HSDA 5E8JA 4BLVA 4A8PA 3HB9A 1PK7A 2FPIB 1U3FA 3H9UA 3PHJA 2ZJ0A 1LEHA 2PYDA 3IBYA 1RLOA 2YYSA 1SVOA 3DYBA 5BSKA 4R54A 3IPLA 1M2OA 1BE6A 3U62A 1SO8A 4Q66C 1RM5A 3ZU5A 3EPJA 4N41A 3CBQA 4XCXA 2QLNA 4JI2B 2ZDQA 3SN6A 2DFTA 5CM9C 2G82A 5KDLA 1WZ2A 1ADCA 2CZGA 2PH5A 2PUVA 4QXRA 5DK6A 3BCUA 1UUFA 1Z2DA 2VZ9A 3OWXA 1BU8A 2I1VB 1XU9A 1PNTA 4DLSA 1OASA 2XGGA 1OTHA 1PJ2A 4GR4A 5D3MB 2C3OA 2BBTA 4BO9A 3LLVA 1EMDA 1E6LA 3FCCA 3CUUA 3F5FA 3G49A 2IZ1A 3PQ3A 4AUEA 4KAAA 3AWDA 1GKIA 5ERGB 4YR7A 1M1NB 3AF5A 2TYSB 3KZ1E 3B38A 3UB3A 3UWDA 4ZI7F 3HVIA 2R97A 7AT1A 3UB4A 5FBZA 3ZQ4A 2K5UA 5AKXA 4HV4A 5HA5A 1KEEA 1I2BA 1I2CA 4WA7A 3IB3A 4KIJA 1IN7A 3GFTA 4RTMA 5EZYF 2I0FA 3WMFA 4J6FA 5IPFA 1QDUA 2XEDA 5ELLA 5DJ5A 1U65A 1UDBA 4IM7A 3WHIA 2RCYA 1ILEA 3T3GA 4ARUA 3KV3O 1MO5A 2ERCA 4O02B 3FJYA 5EHIA 1E9VA 4F9TA 1ZH2A 1XNJA 3DVRX 4JC4A 3KKPA 2OBXA 4NE9A 3LT2A 2B8NA 5HQ3A 2NV0A 2IY9A 3O8CA 3NVKI 3B53X 3FTPA 2ZJ7A 3ZQUA 1SD5A 4B83A 2MIIA 2VPXA 4FU0A 3DOFA 4BMOB 2OYCA 5FPKA 5L3SA 2VDWA 3ANMA 1BHJA 4DRYA 1PJSA 2C8LA 3ASVA 3KTFA 5A0TA 1RXSA 1J0BA 1XQ6A 2CLIB 2VSYA 2WKSA 4RCYA 3ZU4A 4BATA 3K9CA 3PNMA 1X7WB 1R0XA 4CUKA 1N2SA 2C58A 4B8WA 4Z4GA 3VKUA 1P5JA 4E5MA 1CUCA 1NVKA 3K15A 3MN1A 4M46A 4Y6QA 3NBAA 2XUAA 5HTKA 3WL8A 2WM8A 3ZC3A 3RC8A 2AEEA 2OL4A 1KF0A 2PIAA 3HKEB 4RXUA 1TW3A 3L7YA 3DDSA 5SYAA 3N2KA 3RK1A 2R6JA 4YT4A 3R3VA 3ZHCA 5J4YA 2RHHA 3P9XA 4KCGA 4K8OA 2P1RA 1KSHA 3JQPA 3MT0A 2ZFUA 3UW3A 1CEQA 3QBVA 2VWQA 3TLGA 3MT7A 2V5AA 1KFEB 5HM6A 1P7VA 2DXIA 5BN3B 1J4AA 1R9NA 1R8SA 3NVMB 4ODIA 3IXMA 1FFXB 2AG1A 2YYYA 3T4UA 4IH1A 5DYGA 1I01A 1V5WA 3VU1A 5AW8A 3U7GA 2OCAA 4G5XA 1FW8A 4LRXA 2DY1A 3B5EA 3G9QA 4FN5A 5E9JA 1N6OA 5AW1A 4FBGA 3T3IA 4EM6A 1E1LA 2X6QA 3A4TA 4ZQHA 1CUEA 2XEXA 2P9EA 1X7HA 2A0YA 3SJUA 4BEVA 4YLYA 1G4UR 1F7UA 4E22A 1SKBA 2N75A 3DCJA 4M0FA 3VX4A 4C7BA 3ZWPA 2R79A 5IHPA 1PNQA 1Z4PX 2VAXA 2PIDA 4EI7A 1QRRA 4HDOB 1FBTA 3CT4A 3D7MA 2CV1A 4HN9A 1IM2A 5DMXA 2HK9A 4GR5A 4KITB 4F72A 1UIRA 2CKDA 3MPUA 4HNSA 1L4UA 1S9HA 4J4BA 4L9WA 4QLBA 1T2AA 2QAGA 4AJPA 3LUDA 3G2JA 1JHDA 2BF4A 3IBSA 1U0BB 1OVGA 1O96A 4AKSA 1WV0A 3M9WA 4CIBA 4G5RA 5F98A 3A7DA 4E7PA 1HWYA 4LCEA 4ZU3A 1F48A 5ESWA 4Z3DA 2W8BA 3HR4A 1THZA 1AXGA 3VVMA 1MJGM 1U0HC 3BVPA 3RU9A 4B87A 2CXUA 5JXJA 1A2QA 4JBNA 1CW2B 3M49A 5GGXA 4J4TA 4B7AA 1RXIA 3FPKA 1N2IA 1VPEA 2P7IA 2OFXA 4J3JA 4ISCA 2PZMA 1LLCA 1V5FA 4ZZ1A 4DDVA 2QLBA 3A9UA 2G0NA 2FOIA 3IVRA 2YFHA 5CJJA 4AY4A 3ZXXA 4DWVA 3CVJA 2PQ0A 3TH5A 2HK8A 4TL9A 1AIPA 4UUMA 4CT0A 2ZVPX 4WKCA 4X66B 4B17A 2EW8A 1KFCB 3I76A 3LT5A 3DAGA 3I39X 1XJ5A 2AK3A 4OM7A 5DIZA 3UKOA 1E3IA 3ZTWA 3PEYA 1REQB 1P1HA 5EY5B 3FCOA 1LI7A 1VYVA 4GYJA 5A4MS 1T9HA 1PBTA 3SHQA 4QUKA 3IQXA 3TUIC 2MU1A 3HPQA 3ZVRA 4UASA 1ZW6A 2KYRA 3K72B 3HVUA 1A50B 1XCBA 2IUTA 4ZKEA 3PLRA 4TSFD 3WHKA 1UWCA 3C3BA 3MPOA 2VH2A 2H1LA 1T2EA 2NP7A 1RIFA 2AC7A 2BEWA 2VDRB 2F17A 4CN9A 1ZN8A 3UK7A 1UK6A 4Z9FA 1XJQA 4LTDA 5I48A 3VTAA 2YXDA 4GNRA 4C7OB 1EFLA 3KZNA 4F4DA 3QITA 4D9JA 2FDXA 3FCAA 3FYTA 3IFSA 4MVYA 1PFWA 2JJQA 1RYEA 3JQ6A 4O3FA 4WGFA 4GDFA 4PSUA 1UK9A 3E05A 4U5XA 3URKA 4DQDA 4Y2HA 5LU8A 3IOMA 2NUAA 1MXFA 2UVQA 5DHQA 2VR1A 3I58A 5FBQB 1T2FA 3L8YA 2CZQA 4PS0A 2X0FA 4PS1A 1DG3A 3K4HA 3SDBA 2RK4A 4FC6A 1UDWA 4OO3A 1YKSA 3F96A 5FI3A 4ERNA 4KQGA 1NJSA 4I4TB 2UUCB 4L3VA 4QJIA 1NP7A 3QZUA 3TIGA 1ODSA 2RH9B 3KFVA 2JIRA 5IZCA 2B6NA 4FJ0A 2EQ5A 4JNKA 5ETJA 1F9EA 3ZBPA 4BWVA 3W6NA 1DC5A 5KYXB 1WPXA 2GAJA 3MEQA 4N8SA 2F67A 4U63A 4JBHA 3UJ3X 1V7PC 4PV7A 1S6YA 4CMEA 3GMTA 5AO9A 1JG3A 1POXA 4U4AA 1SCJA 3Q7EA 3I5MA 1WEHA 4X41A 4K9LA 1EI9A 1KI4A 4PSVA 3TEJA 1M6EX 2NYRA 2P4UA 4WDQA 1VYUA 5LP6A 3HL0A 4CKWA 1PWXA 4IDGA 4JUAA 3TG2A 2XVXA 4QYMA 4X54A 1MUUA 3KO8A 2PKEA 3FHOA 4K9NA 4RFLA 5L7YA 4AYXA 1UKEA 3OJFA 5F76A 2C78A 4POOA 1ZRNA 3M70A 3LDGA 3UEOA 5UKDA 4Z9YA 1V11A 2DPHA 2XYGA 1KRHA 4B3RB 1EG7A 2ZYRA 1GUYA 3OZTA 3NPMA 1XDSA 4HN4B 3NGMA 4JK3A 3GLFB 3OUTA 3FDIA 3PEVA 4ZIRA 5J2TA 3L9WA 1SXJD 2HTEA 3UGTA 2ZSAA 2UXDB 3TBHA 3TBKA 3TINA 5EG5A 4ZQIA 2CHGA 4QT4A 4BNZA 1C4OA 1MOPA 2XE8A 5KOJB 1KS2A 3DDUA 3S29A 4XM0A 1RJFA 1N2CA 1ISIA 2GJKA 2XYHA 3GMSA 4NBVA 3ER9A 3QEAZ 1DCTA 3CF4G 3L0DA 2GN9A 1KTVA 4G9BA 1HDGO 1LZLA 4WCFB 1SK9A 2H31A 4ND3A 3LUAA 4H6WA 3HNRA 3FZEA 3FTDA 4GOMD 4X91A 2Y1XA 1TVMA 4OIFA 1FDTA 1E3WB 5H70A 3WMWA 3WWOA 1KIFA 4RZHA 3P7MA 1WXXA 1O54A 1CDEA 4YP1A 4NBRA 4AZ3B 1JGTA 4WE3A 2FSSA 4IUCS 1DFGA 1Z68A 1KU6A 1VE3A 5JECA 5KSYA 3UN1A 1SB9A 1KH2A 2WR8A 4MQ6A 3FZQA 4H9GA 2VC2B 2O3SA 4U7FA 1UEIA 4WZBE 2WFZA 3WLAA 3DHNA 3UHOA 5LD2C 3EIWA 2VSOA 1ORTA 3G2IA 3NG1A 3PGA1 5J58A 4AB1A 4MYHA 2FGKA 4HOYA 2Y6VA 1Z6AA 4XLTA 1PVOA 2G9UA 3V1KA 3JW8A 4D9HA 1U3GA 4ETIA 1B6GA 1P8AA 2NGRA 5LYJA 1JR3D 1WB9A 5JALA 4LN1A 1C8LA 1Y9AA 4PG5A 1GZDA 1WU8A 2VF5X 3KXPA 4P31A 3EDMA 1IXSB 1P31A 1T5SA 3PHCA 4M0CA 5EE1A 1J0AA 3T3HA 4HH1A 5JW6A 1YULA 2AN9A 4KQXA 2JDID 4C0AC 1QONA 1QLWA 4KKVA 2EDCA 1YACA 3HCOA 3WK4A 3KC2A 4DANA 3UNXA 2ERYA 2IRWA 5I7SA 4DGSA 4HRVA 2OHJA 1LJUA 4HUQB 1YR2A 1SBTA 1ECPA 1RC0A 3OZWA 1J5PA 3FX2A 3SKYA 1TK3A 4HB0A 4ZRMA 2P4QA 3ZGLA 4LE1A 2VCYA 1CUJA 5H59A 3N58A 4KE6A 5D5HA 3LM8A 2NV2B 1J0CA 4JYCA 2HWKA 1L4HA 3GAMA 3INNA 2I6GA 4EG4A 1NR7A 4XWKA 1UANA 3TW3A 1OW3B 2VSXA 4MJXA 4XVRA 2OVBA 2YJ3A 3R3XA 1U2EA 4KIWA 4KNVA 1RADA 2ZJFA 4KO3S 4NG5A 4R40A 4Q39A 3OTOB 1G6HA 3DTNA 1FFGA 3IQWA 1P73A 1PR3A 1Z3IX 2VJQA 2FPXA 3OT5A 4UVIA 3SIXA 4ALLA 2PPLA 4JB0A 4ZU1X 1ZM4A 4PNEA 4A5OA 5FKJA 3TX2A 2Z04A 3QBEA 1Z63A 3IAM6 2O59A 3NTOA 1WBJB 2RG1A 2E5FA 5KSPA 1TMKA 4B4VA 4DFDA 1I8TA 5MDHA 1NYRA 4EY5A 3HB4X 2IS6A 1Q1EA 4FNOA 3TECE 1RYBA 2OD9A 4EHHA 4H77A 3LX8A 5A62A 4EUKA 4C0HA 4V0LA 3ANSA 4Q15A 2JVKA 4O2AB 3DXXA 1SUSA 3VR2A 4C4TA 1Z62A 2V7GA 4J0DA 3MW8A 4TSKA 4D2IA 4CJXA 4B32A 1C3OA 2AYZA 4XA8A 2K6GA 2WQZA 2ZP1A 3DFFA 3O1IC 3PKZA 3QEOA 4QPPA 4LGYA 1P29A 4A0GA 1RNLA 5A0FA 5BWMA 4F9GA 1FDOA 3Q5EA 5C2JB 5CAEA 2V9ZA 1M0SA 3Q8LA 1L9KA 5JXGA 1H4QA 5HKLA 3K8OE 3RTGA 1VJGA 2CFOA 1TFRA 5KKCA 4O8JA 3FLMA 3U7EB 3RANA 3O93A 3OF3A 3DBOB 5ILQA 3ZKWA 2B4TO 2PCJA 5EKUA 2CXXA 4LY9A 3SC3A 4A0QA 3RYCA 3EZNA 4XPZA 2OK7A 2VUHB 2YBDA 3PC2A 4B46A 2HV9A 3OWHA 3SE0A 2ZBQA 4RD4A 4CIYA 1QLJA 2WA2A 4HB4A 2JFNA 1YJCA 3IAM1 2B7LA 2Q7OE 2C31A 2ZT6A 4AJOA 2PWPA 3IODA 4YRGA 5I4CA 4KPYA 3KKQA 1GPMA 1Q1AA 1K06A 1FDVA 3GRVA 1G1MA 4G5FA 2V0GA 3JQFA 1KGDA 4UUOA 5AXDA 4BV8A 2QTVA 2J41A 3ADKA 3EXEB 4KOEC 1GCOA 2IBTA 3VFDA 5JAIA 4RPHA 4D98A 4GBMA 4RSHA 3J80A 3IDSA 3THRA 3GFFA 3ZVNA 3PEWA 4HUTA 2HWXA 4DBLC 2WWVD 5CEFA 1JFLA 2DFLA 2W2TA 3ZLJA 4TVKA 1MC8A 1QHHA 1GCAA 2Q4OA 1U2SA 2XRMA 3GXBA 4LI3X 4QOSA 4CQJA 3EG9A 3KT6A 2CVOA 2DT8A 4LZNA 1II8B 1V1RB 1PGNA 2W6OA 4DJ5X 1KVSA 2PS3A 2ZBPA 4F3NA 1IEXA 1LFDB 3QIAA 1V8BA 4NPHA 4R5HA 4IXWA 2DUNA 1QFYA 4GQAA 1KO7A 1ZIYA 2DFKB 2FZ4A 2JIZD 3KWLA 3NVAA 4X44A 3TW6A 1MORA 1AZSC 5HBGA 3VVBA 4TYYA 3GWGA 2JCYA 3ISJA 3MGGA 4ZVRA 1Q2UA 1U9IA 3LC2O 1QGED 1M8FA 3C70A 1G8YA 1L5MA 3IT2A 2JBHA 4AJKA 4CI0B 4ZOAA 1G16A 3ZXIA 2NO5A 4P7KA 1IFXA 1JALA 1QF9A 2ZQYA 1GZ5A 1FP1D 3MINA 4E2FA 1Y89A 3HFGA 1OBCA 3O2SB 4QOIA 4BMSA 1JHVA 1GL9B 4IRMA 1Z7BA 3JVVA 4S1TA 2ZUDA 2C1ZA 3W5VA 2IBSA 4NU6A 2ZS9A 3C16C 4ICIA 1T4BA 2WWTA 3EXFB 1Y34E 2YV2A 1P61B 1FMLA 2JFPA 2X3YA 2YOFA 1BXKA 1ENZA 1BCRB 3I1IA 1OYVA 4HEHA 4PF1A 5FPTA 3T4EA 4CT4B 2YZMA 3TQTA 3EXG1 4CHGA 1JDTA 3I6BA 4EHKA 2WHYA 1QKIA 5EJMA 4X62B 2W9XA 3PFCA 1N8SA 2VHWA 5E3HA 2L82A 2FQYA 1HZZA 2LNDA 1NURA 1DINA 5EERA 4OKIA 4ZCMA 1WHSA 2E2WA 4J16C 1TU4A 5CIQA 5IC6A 1QK4A 1U5BA 2NXNA 4Y0NA 4CLXA 4P1ZA 3EJWA 4Y9SA 4YP9A 4E6PA 5IKOA 2GM9A 1V35A 2QTRA 3IHLA 4X64B 4PYKA 5AQEA 2EC5A 9ATCA 1XTQA 3GVHA 4RPLA 3GCDA 4YCAA 4CCYB 1E89A 4FPXA 2WSMA 2Y2UA 3GLHB 4CM4B 1LQTA 1WZIA 4XEHA 4PLYA 2OZLB 4MUMA 5G0UA 2O8DA 4AMUA 3ELYA 3F4KA 4I7EA 5KIAA 1BEZA 1NUAA 4TMTA 4YMHA 1N9GA 4DT1A 3EUEA 1X8XA 1CFJA 2JCGA 1YQXA 4PCAA 1KDVA 3PI6A 4JJAA 1HYEA 4PM4A 4TT8A 5G4KA 1BS1A 1KI9A 1XLUA 4KQ6A 4PAQA 4GRIA 1NT4A 1MZVA 2CFTA 1ZUNA 4DLUA 5CA1F 3SF0A 2Z1NA 3DKKA 3U37A 4H1VA 5J2UF 2AK2A 1HEIA 1Q0TA 1Z75A 5D5QA 4QGSA 3DZDA 2BW0A 2OFWA 4RD6A 1EUDB 2GRUA 4N7RA 3U56A 4XDZA 4RELA 3KB2A 4IDNA 4MS3B 1A96A 4YGXB 1WU7A 2QY9A 1ZJZA 1PN3A 2CUZA 3ZR4B 4PYJA 2RGUA 5C18A 2ZSKA 3K4QA 2FKNA 1Y1LA 5DGXA 3GEHA 1V8PA 3T35A 1ZD2P 1W36C 4LWOA 4MWDA 1ZXLA 3D6HA 3EQ6A 3IOCA 4QGAA 3U4AA 3TLYA 4BO6A 1M2VB 4HYQA 1YB4A 3VI4B 4RWEA 4DR3B 1F2TA 3H8VA 4KHPB 1RPTA 4NICA 5EIWA 3BJRA 2ZWMA 3N75A 1XJWA 1YHZA 3RG8A 3RRZA 5JD5A 1SCQA 2ORYA 3FBGA 2J6HA 1S5PA 4BTLA 1XQWA 3FWZA 3ZIDA 4L5IA 3E3MA 3DO5A 3IGFA 1I0ZA 3QKRB 1SRQA 2P5YA 1OH8A 3GNSA 5ALXA 4M2LA 5EMHA 1CRZA 4RY8A 4C4XA 5IVHA 1UR5A 2QN8A 1TXGA 4XPIA 4M8KA 4O4HB 1HKUA 1AX9A 4TUYB 2ZZKA 1RHJA 4D8WA 4B0OA 4C4SA 1MTOA 5BSRA 5BQPA 4XX1A 2A3RA 4MV9A 1Q7CA 1SKYE 2ROQA 2W4MA 4IOJA 3VSEA 3C3KA 4NV0A 3LCCA 1VHWA 4EENA 4Z4HA 4K9OA 2RAPA 3W5JA 1M2WA 2VAWA 3FVQA 3H04A 1EP3B 3FOZA 4C3ZA 2AEFA 3VPFA 2WUEA 5C1PA 4NMHA 2EJCA 5B37A 1BS9A 3Q9SA 6NULA 1PZFA 4M9SA 3HO6A 4KXQA 2HRRA 4W82A 4YAOA 5AJZA 3Q7SA 2J0VA 1WL8A 2R84A 3HADA 5L3QB 5JH7A 4J7AA 1SQ5A 3HO1A 3TD2A 3K73O 2Z3ZA 2ZRMA 3P96A 3A2NA 3ZJ5A 2XMBA 1GYQA 1KFKB 1H5NA 4HUJA 1INLA 4MLCA 4DSUA 5BMVB 1YB1A 2GZSA 2FN8A 1VC2A 1ZH4A 3OE5A 3SQOA 5DIFA 2P9CA 3CLTD 5LOVA 1VI2A 3CLKA 3MJFA 2JJ2A 3DDOA 3UKJA 3HFSA 3IB6A 1Z38A 5DW0A 4DAEA 3ET5A 3QFRA 3TVYA 1U6JA 3PQ8A 1XD2A 3BCHA 5EMNA 1XQXA 3K70B 1GRRA 2G8NA 5J5CA 1QP7A 4E2WA 4ZVPA 4EW3A 5BVHA 1IULA 4MV5A 2FVXA 3E27A 4BZWA 1KOFA 4F8EA 3ZHZA 1DSSG 5EINA 2H2WA 3ZD8A 2W93A 4XUDA 5IJ9B 1SKMA 1QFZA 3LUGA 2P0YA 1Q14A 3JQGA 4YJHA 3W5CA 3ME5A 3OM9A 1W4BA 4ZO7A 1Q44A 1TF2A 1JG7A 1QUFA 5LUBA 3TXXA 3WZ2A 5KX5B 4B2IA 4BB9A 4PZZA 1NQAO 3UMBA 2BI4A 3BJEA 1NUPA 2E5WA 2FF7A 1V2HE 3CURA 3L05A 4L4YA 3R7NA 2HYIC 5C5DA 2GBLA 1DAIA 5K9ZA 1Y5IA 4DMHA 3UJCA 3QU7A 3HGTA 5CK4A 1Z08A 4BB5A 1T3GA 4BASA 1V8OA 1G20E 1SN7A 2VQFB 2F43A 5TF4A 1CF9A 1E5XA 1VMEA 3CW9A 3V7YA 2JLYA 1NUSA 2OB2A 1OV6A 3AUYA 4LYFA 3ASUA 4TMZA 5CW2A 3DC2A 1E32A 5EE0A 5T64A 4EPTA 1SBYA 4N0MA 2B8WA 2EBHX 2FK8A 3TUTA 1SVIA 4JI8B 1G9XA 1U99A 1WXEA 2C2GA 3OPYA 5DLQC 1S1MA 3JCZA 1NLUA 1CJSA 2NM0A 5EYPA 1SXHA 2O2ZA 2NAPA 1AU9A 3I4FA 3LYUA 3OEEA 4FKMA 1Y8RA 3CPHA 4L8GA 4PICA 4XGIA 3ZK8A 4DY6A 6YASA 1Z6QA 2ZAYA 2JCSA 3KHTA 4A5SA 4V2IA 3O4IA 4IXMA 5JMWA 2X7JA 2E6UX 1R4AA 3PXCX 3D0QA 2PK3A 1E9CA 1BJRE 2HA2A 3R3SA 2XGMA 2QMUA 3R44A 3E03A 4G9GA 4PQGA 3WO1A 1J00A 2X0NA 2X8BA 3HU5A 5T3UA 1LFAA 3PRJA 2RI6A 1VLLA 1RRGA 1Y9EA 5FL7A 5KYYA 3MJDA 3NDPA 4EFNA 4GMGA 3QLUA 1YAJA 2FSFA 4HH4A 1UMCB 2VDPB 1T34A 2RGBA 3QXXA 4MHTA 1MO3A 3QKUA 3P1JA 2C4HA 3DFIA 3ZU2A 1IUNA 4QASA 2QTFA 4DR2B 1AB6A 3L6RA 3FOCA 2ZRPA 4FYJA 1CRQA 2OQ2A 5JD3A 4BAGA 1RPZA 4EO9A 4HB3A 2WTBA 4EKEA 1XTSA 1CDZA 1Y5MA 2CXPA 2A33A 3DDCA 4LRWA 4QBKA 5CBKA 3COSA 2ECKA 2DHDA 3Q7IA 4MCAA 3ZJYA 3WGLA 3DA8A 4L6IA 5BN5A 1I94B 1EGMB 1T6XA 4G2TA 3HRKA 3UHFA 2O8BA 1DFIA 4LEIA 3WQBA 3ZJUA 1EE9A 3NJ4A 4HNAA 4M6WB 3RGGA 5GJVC 2A5DA 3W5BA 4O4LB 2DUUA 3GZNB 4MS4B 4K5QA 2ZI5A 3EUWA 3NHJA 4C20A 2QVZX 1D2MA 3HTXA 5BV1A 1I9GA 3NS7A 1E60A 3COZA 1CLEA 1I1HA 1ODFA 3P5SA 5DNEA 3ZBQA 2HU8A 1NVBA 2GAIA 5DNAA 2DAPA 3RDPA 2HT6A 5A05A 5EGNA 5DU2A 3U7HB 3E1GA 4RHCA 3TIVA 1YFJA 4YQEA 4R9SA 1UJ2A 2H8KA 2BSAA 3QYFA 3AVWA 1EHCA 3PQ6A 3VR0A 2W6NA 1IK4A 2J4DA 1JQDA 3MMZA 4U2EA 3EEFA 4UVDA 5CIWA 3WZLA 3H99A 3OCVA 2H9YA 4EAAA 5C8VA 4D79A 1SD1A 5H5JA 5K09A 5KS2A 2ZIZA 2OSVA 3F7OA 5CTAA 3PUXA 3DZ6B 3AXTA 4OMCA 4PYMA 1GDHA 4UFOA 2I6SA 1W47A 2ID4A 5JY6A 2UVPB 4UBIA 3JQDA 5AJXA 1NPYA 2ODNA 4M83A 3D6JA 3VR2D 3LTNC 4ZI5A 2J59A 1LKZA 1US8A 2FK7A 4R51A 3A58B 3BXHA 1BVUA 1OLXB 3LA6A 1KWGA 4ER0A 4QYTA 4ALKA 4MQEA 4A6PA 3OTGA 4D46A 2D4AA 5FI5A 1WCV1 2XNSA 3SEZA 3JARB 2FDCA 1H2HA 3M0EA 4NPAA 1G5HA 2MSCB 3URMA 4WFIA 2ZVDA 3N7AA 4RJLA 1JWBB 1EFVB 1T1RA 3RSCA 4NE2A 2Q6TA 2A6PA 2PMEA 3K0SA 4PNZA 1HDZA 2HBYA 5E6RB 3QLVA 4DRZA 3NX4A 1KGSA 4QECA 4EFLA 1D09A 1D1QA 1LB1B 2RJNA 1VRVA 4PLFA 3M3PA 4L57A 1W5AA 4E03A 1OZ0A 3S6JA 3QXJA 1FPMA 1HSOA 4BJ6A 1NF8A 4TTIA 3WGHA 4JLOA 1UOPA 3AHJA 4LBWA 4QRHA 2PTGA 2C0PA 3VNAA 3NBMA 4XTRA 4ZOEA 1DELA 3AF0A 4UMDA 5JO9A 4FGUA 4WN9A 2HF7A 4OI1A 4CM6A 2FX2A 5EJAA 1Z2EA 4GH5A 3ZHVA 2C88A 5BVGB 1QMHA 5BV7A 1SVNA 3STYA 5HZHA 1CDDA 1LUAA 2F1OA 4FNMA 4I8DA 4ZT7A 4GKAA 1LSJA 1QE3A 2A9JA 2JGKA 1HZJA 2OFPA 3AG6A 3VR4H 4B74A 1ZI8A 3QBJA 2OV2A 4BRSA 1TMYA 4JBXA 3OZBA 1L5LA 1EDEA 1AK9A 1WXHA 4IDCA 1GG9A 3RS0A 1C1HA 3TWOA 3TTWA 4YUAA 4C06A 1NV9A 3A2LA 4RH3A 2NO0A 2JVIA 2VG8A 2R8PA 3SXUB 5B7GA 1D6MA 5JC8A 5JYEA 1JJBA 1JHZA 3V5NA 1KI3A 2Q2OA 4NAHA 1WZUA 4A8JB 4IIHA 3IUPA 5FLXA 5JSQA 5A1JA 4LK2A 4YRSA 2RGDA 3ELUA 3QVSA 4ARVA 5B2EA 4MX8A 2FR1A 3NC0C 2VBCA 1K6MA 1FUEA 2FQQA 2OPHA 1H2ZA 5IN5A 2QI9F 2V7QD 4GPBA 1K5DA 3DP9A 3LL7A 4D7AA 1MNQA 4UOZA 3FOBA 4I1IA 3VR5H 1OKKA 5AUQA 1H9AA 1MVLA 4M36A 2O2YA 1QFXA 3PGJA 3A27A 4FFBA 4TWJA 3AM3A 1LPPA 5AI9A 2XTMA 2PBZA 2RC5A 4E5YA 4EVSA 2YHAA 5IG2A 2OAGA 4DA6A 3HBLA 3LP5A 3I04M 3T6KA 5KOIA 2C3PA 2VTEA 4HRAA 4J76A 5BV2P 3W90A 5CB4B 2JB9A 3JVEA 1Q7BA 4LKRA 1RP1A 3RFFA 1EYZA 3CX7A 3YASA 3R0JA 2VNKA 3GROA 5JCOA 1KFBB 1Y3DE 4V39A 2OCDA 2FP3A 3AJRA 3AWIA 3HY3A 3I9NA 3QPDA 2V7PA 3GQBA 1UPCA 3AKDA 2YBEA 4F12A 3IHTA 1QH0A 4II7A 3M6FA 1EEXB 3A3PA 4X3PA 1ZCZA 2XWBF 4QQ8A 1R1DA 3CLSC 3T3DA 3TRJA 4Y2QA 2UZ1A 4TMWA 1A4IA 4WVFA 1G4HA 1NVVQ 4IV5A 3T7CA 2IOYA 3WYDA 1UBUS 4MGKR 4BE7B 1SOUA 4DLYA 1DJOA 5FYQA 2QIPA 4OVKA 3HKDB 2IX9A 1UBEA 1WX1A 2GZAA 1DTWB 5E0OA 3ZJVA 4B48A 2CXRA 1UDXA 2QN9A 3AUJB 1XTJA 1GVNB 3V2UA 2Y1WA 4IKPA 4CF5A 3RU2A 4HATA 1NX6A 3LBAA 4R6WA 3B7PA 3ZKAA 5IANA 4UMFA 2UZ0A 3TUXA 3MGKA 5IX8A 2KX7A 4Y9RA 4AICA 5EJ2A 3RADC 1A9TA 4PQFA 1WLSA 2RGYA 2VQSA 1D4FA 1ZGCA 5K3CA 5LMUB 1IEWA 1HQCA 1PGPA 3GFSA 1P74A 3KSDO 1M2NA 3EUFA 3L6UA 4BVBA 3FPLA 2ZBRA 3QVXA 2JD0A 3H1TA 5AHXA 3CVXA 3ZDZB 4IJWA 2JG3A 2ONYA 3H5IA 4C4OA 4EKDA 3DTYA 3HV0A 2XODA 3PSHA 1WCWA 4BUCA 4CKCB 1H6CA 3EMDA 3X1DA 1CUFA 1Z88A 3C6KA 1FX1A 1XZLA 2CXNA 2GHIA 4Z4FA 1ONOA 1EJ0A 1Z0SA 4X20B 4H7DA 3SJBA 1PL6A 3G02A 2EIHA 4RC9A 1FL9A 1YRBA 5C1OA 1CY0A 1J70A 3FOFC 5JCXA 1IHUA 1IWBB 1KJZA 4O4JA 1BGVA 1GNLA 1RYDA 3TLKA 4ZCQA 4CIDA 3D64A 3RSHA 4KJXA 3N0VA 1X7YA 2CCKA 2I7XA 3QFSA 2H2HA 2F00A 3FWPA 1E3EA 2IP2A 2ZBVA 3QSGA 4JLAA 5DHUA 5JPIA 2IH5A 1YUNA 3CTMA 5ALRA 4RK0A 3SYMA 3UOGA 1N5RA 2G09A 3H2IA 4AY3A 5A7FA 3KPUA 2VXBA 5TQ0A 4GXQA 1DEAA 4W5JA 2QLFA 2R00A 3KSZO 1ULTA 2HM7A 2QPAA 1CQIB 3MQ4A 5GTDA 1DRWA 1J5EB 3FMFA 4D97A 1T8WA 1TEVA 4S24A 3QELB 1VLHA 3BYZA 3W78A 3FVVA 1E6WA 4IDAA 1VJCA 5AI6A 4PPFA 1E6EA 3C6MA 2JVJA 2QRQA 3L49A 1FLNA 2NOAA 1W5TA 1QU2A 4BZZA 1QFJA 2ISCA 2XTJA 4Q1FA 1VM6A 2IEZA 3S1LA 5J63A 4LHYA 1EFUA 4PC1A 1KJJA 4DIKA 3GA7A 3WNBA 1IVYA 5JBNA 3RRMA 4EWLA 4X45A 3NJ8A 4TROA 4DAOA 1I7MB 3M6UA 2OGTA 4MRSA 4IHKA 3QUQA 3ZZTA 4D9CA 5KC9A 1OH7A 3QKSB 2VUTA 3H87A 3MRVA 4RLHA 1GSOA 1CDOA 1ZYUA 2QX7A 5ALDA 1TYAE 2I91A 5LP6F 2OWDA 1P5RA 3O8OB 2I4MA 5ESRA 4EPWA 1TLLA 3NI2A 4HNGA 1I2MA 3EPPA 1JBKA 3KQWA 4H7FA 4IOKA 4D0NA 3ZQJA 4YJGB 4YV1A 2JEOA 3X0DA 2FN4A 4UUQA 5CJ2A 3UXMA 1QZUA 3FNEA 2X86A 3OOHA 4JUIA 5CDFE 2WNSA 5IH7A 3U44A 2HRDA 3EC2A 4XQCA 1H2RS 1TJ3A 2MYNA 3GT7A 4HLUC 1Y4ZA 3LMKA 2WAXA 1AMOA 1B23P 2QWXA 1SRRA 3CZAA 2JJ2D 4GYWA 4J2HA 1B42A 3OJLA 3RC3A 1GTMA 2OHFA 5LA6A 3BZUA 4PYLA 2N1BA 3GBVA 2WF7A 1AQ6A 4MLZA 3HN2A 4FGWA 1L5HB 1R8QA 2VJMB 3DLCA 1YCDA 5HCUA 3VYUB 4G0OA 4BNLA 1L1FA 3W3ZB 4GOOD 4ARCA 2UZIR 1G8MA 2R8EA 1A4RA 2OILA 2YZ7A 1UC9A 1R0CA 3OJOA 3DV0A 4JP1A 1Z5ZA 4F3YA