1DRUA

Escherichia coli dhpr/nadh complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1druA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1druA01
4I08A 5KVVA 1P1RA 2WJPA 3HDYA 3NDIA 3RSHA 2O4UX 3ZCXA 1H6CA 1ZXBA 1DIHA 2ZYDA 1R4NA 5HA5A 3WIDA 1Z82A 2HMUA 5EERA 4BO4A 4GGPA 4BNGA 1P74A 3D64A 3A06A 2X5JO 4KMSA 1GR0A 4IBOA 4N5LA 3SLGA 3WNVA 2RAFA 2NU9A 3JD1A 4X54A 3P2OA 3OQ6A 4NBVA 5L3ZA 4E5PA 2HK9A 1QYXA 2Q45A 3FSRA 3DBLB 4O63O 2P9GA 3HB5X 1NYTA 3AUUA 1CF2O 4N18A 2ZJ0A 3GEMA 1N1GA 3WJAA 1ZK3A 2PD4A 3MWEB 1GUYA 2EGHA 4CL8A 1Y7TA 3VKVA 1DFGA 2EGGA 2OZPA 4YYZA 1DC4A 3D5QA 3OH8A 4XEHA 4F3YA 5IAAA 2EEZA 4MIEA 1UXHA 3IMFA 1SCUA 1M6WA 1W4ZA 1UZMA 1Z73A 2I99A 1C0KA 1KVRA 4RDHA 3RIHA 4M8SA 2LDBA 3VKUA 1NTOA 2GGSA 1Q0QA 3F3SA 3WTBA 4OXNA 4NR0A 2RHRA 2UV8A 4GPD1 4J7CA 3JQAB 2GO1A 4AJOA 4RCVA 3W8FA 1PJ2A 2GZ3A 2NU7A 2QG4A 3HUDA 2JAPA 5KJFA 3BHMA 1A5ZA 4E13A 1KEVA 1X7GA 3FRJA 1N92A 4IDDA 1MUUA 2B4TO 3FF4A 1E5QA 1PS8A 2PD6A 4W99A 4I9UA 5F1OA 1TT5B 1UDBA 4H7PA 1QYCA 3QVXA 2QRLA 1G0OA 3ANNA 4CQMD 5A4DA 3ZI0A 3ENKA 5JC1A 1PWXA 5CDYA 3PWSA 2J3JA 2FR0A 3G3EA 1HYGA 5L51A 2HLPA 4TSKA 2AG8A 4AJPA 3F1KA 5I7EA 3I3OA 4WLEA 5B4UA 4Z0PA 1YBAA 1HEUA 1DHTA 4GSKA 4XB2A 3UHAA 4BNTA 3VH2A 1TB4A 4CMHA 1PX0A 3WGYA 3L9XA 4KQXA 1PL7A 2WDZA 4R9SA 4AJNA 3PDJA 1P77A 2CFCA 2C20A 3AM3A 4G65A 1QXSA 5CAEA 2AG5A 4NBUA 2C7VA 2WD7B 4GI2A 3OIGA 2HU2A 3K2BA 1LDNA 3OIDA 1F8GA 1VJTA 3NV9A 3GVIA 4NU5A 4RLHA 3BHIA 5BNTA 3FNFA 1WLYA 1RPNA 1Q0HA 3RUAA 4CM4A 4IDEA 3WIEA 1DLJA 3F5SA 2GYYA 3K73O 3BTUA 2Q46A 3H9QA 2NU6A 4PVCA 3Q11A 2X7HA 5JCXA 5KCZA 1ZBQA 4E6PA 3F9IA 3K31A 5CPBA 2X0RA 4YQYA 3IDSA 1U1IA 1U28A 4EYEA 3L9WA 4BNUA 2P4HX 5AOVA 5IDXA 2NU8A 1HLDA 3OEYA 1LU9A 4WLOA 3TFQA 2P2SA 4FIZA 3RJ5A 5JS6A 5B4TA 2VYVD 3VAZA 4ALKA 5KWEA 2DT5A 1NNUA 1H9BA 3PHJA 4FOSA 3JYNA 3JTMA 5AXAA 3RCBA 1M66A 1DOHA 4W9NC 4BO1A 1LC0A 4FB5A 1R37A 2WYVA 4L9RA 3KOUA 4IDBA 1OBFO 1MV8A 3D0OA 2DBVO 3RFTA 1XG5A 2FR8A 1VJ1A 3QE3A 3ZWMA 3TZHA 3UOGA 4QSMA 4MP3A 3BYZA 3WYCA 2ZB4A 1EMDA 2CD9A 3S8MA 1DAPA 1E3EA 1ISIA 4IJUA 3H65A 3O26A 4FOOA 2QW8A 4FS3A 4EDFA 2CZCA 5AQ1A 1MLDA 2DLDA 1WPQA 2X22A 4XCVA 2CSUA 5AXDA 3QWFA 2V65A 4D3FA 4BOYA 3ZDFA 2D3TA 1WW8A 3GVPA 3GT0A 3KEOA 1R0SA 3ZV5A 3DBRA 3EC7A 3AI2A 1V6AA 4UUMA 3DBHA 1XCBA 2POQX 1GZ3A 1MG5A 1UP6A 1WZIA 3KYCA 3KYDA 1EE2A 3ZWNA 1P9LA 1LI4A 2AEMA 2Q1SA 3CUKA 2X8LA 3ADOA 3VPHA 1QG6A 1XR3A 5LDHA 2CF6A 2D0IA 1P1HA 3ABIA 5FEUA 4A26A 2E49A 2Y68A 3HHPA 3TN7A 4J0FA 8LDHA 1BSVA 1R6DA 1W8DA 5G4LA 4YTEA 4CMGA 5I7VA 1PGQA 4IS2A 4YAGA 4J1NA 1IPFA 3PI7A 3WWYA 2PNFA 4IDGA 4YDRA 1B8VA 4W9NA 2P5YA 2X0IA 4CM5A 2CF5A 4MVJH 1KVQA 4E3ZA 4YJDA 1BW9A 4KQWA 1YL6A 4J0EA 3GOHA 3PHIA 4E32A 1V3UA 4OQZA 4TROA 4BNXA 1KY5A 1E7YA 3OMLA 4HXYA 4PLPA 1DIGA 2G17A 1J0XO 5HS4A 4B7XA 4B8ZA 1CIVA 1U4SA 5CEFA 3C8MA 3K8ZA 4RPKA 1Q7GA 5TC4A 3PJEA 2E82A 5T64A 4C7JA 1CWUA 3O38A 2JAHA 3ON5A 3E1KA 3VTZA 1T25A 4TQGA 3V1YA 1IHXA 4MKXA 1R0LA 2IEDA 5EINA 4BNLA 1AXEA 3FR8A 4XB1A 3RFVA 3H5NA 2CVQA 1ORRA 4RPJA 1FJHA 4CV3A 4A27A 1WVGA 3WOHA 3D5TA 4UVGA 3EHEA 2C5EA 4HY3A 1CDOA 4OGWA 4XQGA 1EVYA 4BUCA 2JHGA 5T73A 1NPYA 2Q2VA 3Q2KA 3UH1A 2C2YA 2JCYA 3PQDA 4JNKA 5DP2A 1ISFA 3RBXA 1LSJA 5TJ9A 2EW8A 1J4AA 4JLWA 4KWIA 4CMCA 3HADA 4GL4A 4CQMB 3SEFA 2BHLA 4TMFA 3MJ4A 4N5NA 3GVHA 4HNGA 4L0QA 1GFSA 2D4AA 2CY0A 2NUAA 4FFOA 4HWKA 3ROKA 5FF9A 2R6JA 5TT0A 3G17A 1V8BA 4CMEC 4FJ2A 3P2YA 5KJCA 1P1KA 1ZH8A 1GTMA 2R00C 1V3VA 3U4CA 4I9HA 2DQ4A 2BFAA 5L53A 4WOJA 2NWQA 4Z3KA 4Y6PA 1P0CA 5DOZA 2FSSA 4MVJA 3BAZA 1EBUA 4K6FA 2VTEA 1E3WA 2FN7A 1B14A 2OFPA 1O0SA 3BMCB 2DPGA 4BMNA 1V35A 2C7GA 3ZWWA 4EBFA 4P4GA 4D0RA 3U4DA 1AUPA 1HE5A 1LDMA 1E6EA 3LZ6A 4J3FA 4OO3A 2DUUA 1Y81A 2Z5LA 2HJRA 3PQEA 1QSGA 4RVFA 5TSDA 4GX0A 1VSVA 3CE6A 4OSOA 4XQ9A 4F45A 1W73A 4M1QA 4PG6A 4FCCA 3JD0A 1X1TA 3D3WB 5AVOA 5C3MA 2DFVA 1R15A 4J49A 3OA2A 1ZCJA 5TX7A 2XF8A 4R68A 4O5OA 4MPDA 2BFPA 1E7RA 3ZWBA 1QYVA 2Y1CA 2O23A 4FPXA 2HMTA 3GG9A 3ROQA 3QHAA 2OL4A 2VOJA 1SOVA 4EITA 2YHIB 4C7KA 4A7PA 3FNHA 4DIFA 1NVGA 5JYDA 1U3UA 1MC4A 1SO8A 4UUNA 5TJHA 3SJUA 3V2HA 1XHLA 4UVEA 2JD0A 1BG6A 2D5AA 3PWKA 1GYRA 4FC6A 4PVDA 5CPFA 3JYPA 1YH3A 1K6XA 2QYTA 3W4IA 3M1LA 4CMEA 4PLWA 4UREA 4Q3DA 1KBZA 2GNAA 3ZU2A 2R00A 3CEAA 4AJ4A 1JDJA 2I76A 1K0UA 4EZBA 1IB6A 4HUJA 2WE7A 3BTOA 3WLEA 5K9ZA 2FSVA 4O0LA 5LC1A 3CZRA 2D2IA 3WGZA 3JV7A 4YB8A 4YAKA 1N7GA 4NU6A 1NWCA 1KC3A 5L9AA 2YV1A 1LQTA 2VWPA 3I6QA 4HBGA 1LLUA 2WTBA 2O3JA 4RORA 1LTHR 1PZEA 3I83A 2QZZA 1JAXA 1ZFNA 2HMVA 4TVOA 1OMOA 2OMEA 2VZ9A 3INGA 1HDYA 4CLEA 3MWDB 4FJ0A 1Y5RA 2PGDA 3LVFO 2I65A 4CM1A 1C1DB 1OFGA 1Y8RB 4R1TA 4AJEA 2H63A 2YFQA 4R54A 2NVWA 3OJFA 2OOSA 1HDZA 1D1TA 4QO8A 1QYDA 4JN6B 1X15A 4NQZA 1JQBA 5DCYA 1UAGA 1MA0A 3GQVA 1XGKA 1SNYA 5JPIA 3WFIA 4PRKA 4YT5A 4P8RA 4AJKA 4I8XA 1JKIA 1RYDA 3NTOA 4A10A 1LDEA 4AICA 2O48X 1BW9B 2EJVA 3W8EA 4ZRMA 4QTZA 4UAGA 3M6IA 3FBGA 4ZQBA 5DBFA 5A06A 2NLOA 3PYLA 3DBLA 3OETA 3BHJA 4FFMA 2BRUA 4A0SA 2ZTMA 2VWGA 4LMPA 2WD8A 3K9QO 5JDCC 2HKIA 2EWMA 2UYYA 3A28A 3GDFA 4LVCA 1GDHA 5JYFA 4LRTB 4BHTA 3T7EA 5JMWA 5BNFA 3VDQA 2FPIA 3U9LA 4RDIA 3JQBC 2DC1A 3RC2A 1N1EA 2Q3EA 3ROMA 3GGOA 2PD3A 5THQA 5TF4A 3ZGYA 4EUFA 3ULKA 4Q3BA 3NX4A 4L74A 3HJAA 4FFNA 3WGOA 3JQAA 4DMLA 4YA6A 4ZVVA 5JMPA 3GUCA 4JX8A 3WYEA 3KBOA 5I9LA 4E5KA 3L0DA 4GAEA 3GNTA 1E77A 5I8ZA 3GHHA 3ZHXA 4YT2A 2P9CA 4FD3A 4RVGA 2FZEA 4FFRA 4BO5A 4IIVA 1TT5A 2HDHA 5FFFA 2BH9A 3CMMA 4U0JA 1DPGA 2XAAA 4IXTA 4RZIA 1GY8A 1QMGA 4A5OA 5H82A 4NG5A 1XU7A 2X58A 3IQDB 3KTDA 1U2DA 3PDUA 3IIEA 4PLYA 5DNAA 4BKUA 2ZTUA 3FI9A 1R66A 4WNIA 1KERA 4UUOA 3DZKA 1VSUA 1PL6A 1PSDA 4CR7A 2X5KO 5DF1A 3PHLA 3AFMA 1CEQA 2EXXA 3DOCA 2W4QA 5JW6A 4DIOA 5DZSA 2JFFA 3NYWA 1IUKA 1DO8A 3DFZA 1XSEA 5EMHA 3PGXA 2VZ8A 2VUTA 2AE1A 3ZWVA 2C82A 3C7DB 4E21A 1SB8A 1ISGA 3E8XA 4LISA 3DAFA 3RAJA 1A9YA 1B8PA 1PJSA 1Q7BA 1GZ6A 3MJEA 2WSBA 4BKOA 3S55A 5JDCA 3G1UA 3UCEA 3WNQA 1HRDA 2AEFA 2DFDA 4OHUA 4ZQEA 4KDEA 3JD4A 2WD7A 4J7XA 3IKVA 1FK8A 3LQFA 3NRCA 4O59O 3JQBA 1L7EA 4D0SA 3DAGA 3RBZA 1LSOA 3RJ9A 1V0JA 2G76A 2G0TA 3DTYA 4NZ9A 2W90A 5JE8A 3CTMA 4B7CA 4NBWA 2Q2QA 4J1SA 3A4VA 3HNPA 3FN4A 1SOWA 4YJFB 4Z9YA 4BO3A 3FBTA 1CJCA 1KEWA 5GZ6A 4NDNE 2J5QA 4CV1A 3GRKA 3D3EA 5A9TA 1PS9A 4R1NA 3TZCA 4WE3A 3VTFA 1QLJA 3QSGA 3OFSA 2CDAA 4S1VA 1OC4A 3IKTA 4XIYA 4MIOA 1HETA 3O03A 4F46A 4TZTA 1ZZEA 4IJWA 4Y8VA 1KS9A 5JFOA 2D5CA 2YZ7A 4PZCA 2WWRA 1GD1O 3EYWA 3VH3A 2YDYA 5JYAA 4YPOA 1PGPA 3MJVA 1B7GO 2OGUA 1PZHA 3EGOA 1XIVA 1T2DA 4TKLA 4KUGA 1U3VA 1TI7A 3L6OO 2UUOA 3GFGA 1Q2XA 3IC5A 2OP0A 3I4CA 4B8WA 1ENPA 4B7UA 3DWFA 4Q39A 1RM0A 3D4OA 2JJYA 5A5FA 1FDWA 1PU2A 1TT7A 2OHXA 4NK4A 4G2NA 2IYOA 1EEHA 3I1JA 3FD8A 1VE9A 3NT2A 2PGJA 1YL5A 4N54A 1PZFA 1NXQA 3PK0A 4FN4A 2ZYGA 2FPPA 3UUWA 1WDLA 3H2SA 2X0NA 2CMDA 4PZEA 5CHEA 3ZV3A 4B79A 4BNHA 4RLSA 1E3LA 2ZATA 3E18A 5KVCA 3PZRA 3DZJA 3AW9A 1JWAB 5ICSA 1ZUD1 4R3WA 4GVXA 2D8AA 3LSYA 3JYLA 3L77A 5T5QA 2W2LD 2DKNA 3VH4A 4BO6A 3QVTA 1C0IA 1OAAA 4NJMB 4XD2A 4OKNA 4ZRNA 2X86A 1R0KA 3KB6A 1XDWA 1UR5A 1X1EA 3NKLA 3GN1A 4WUVA 2V7PA 3ONDA 3GVXA 1I0ZA 2TMGA 1Z45A 5A5EA 1DJQA 1VL8A 3I9JA 3DOJA 1XQ1A 8ADHA 1HYHA 3I9LA 1PQWA 1SBYA 5JY6A 2GRAA 1HT0A 1VL6A 4DREA 1ZSNA 4TRJA 3VZRA 3IS3A 5G0VA 1LDYA 3HFGA 4BO8A 4GGOA 2E6UX 4BNYA 1LLQA 2ZCUA 1RM3A 3F1LA 3UVEA 3RWBA 3WXBA 4PG8A 1NASA 2VRBA 5IFLA 2I3AA 1GV0A 3ANMA 4KZPA 2BGKA 5U1PA 1U7TA 4RVDA 4YVFA 3VPXA 2PZKA 3SVTA 2GF2A 1LSUA 4JP2A 3I9MA 1E1NA 1IY8A 2OO5A 2Y0CA 1O9BA 1ZJYA 1YBVA 3TOXA 2VHXA 3Q3CA 2H9IA 3B70A 3PQFA 2FZWA 4U5QA 5A02A 3JD3A 1ML3A 3V5NA 1T1RA 1ZW1A 2VHVA 5LCXA 2PH5A 1VC2A 5L4SA 5IN5A 2B4QA 4BMVA 1AHHA 4AVYA 1H0KA 3NT4A 4BGEA 3INTA 1DRUA 2NTVA 2RCYA 4R41A 3OBBA 4LW8A 4OIMA 3ZNQA 4OQYA 1G0NA 1P3DA 1EK5A 1HE4A 1N2SA 3DFUA 3GY0A 4CM3A 4FBGA 2GLXA 4CQMA 4CM8B 1NAHA 5IJZA 1QYWA 3B20A 3TQHA 2VRCD 1HXHA 3LK7A 4ILKA 4Q9NA 1C3VA 1GUFA 1HDOA 2VHWA 1B3RA 2NTJA 3ETDA 5L95A 4A03A 5I7FA 3MJTA 4R5HA 1QR6A 3GK3A 4I1IA 4LSMA 4UEOA 3UICA 4U8GA 3ASVA 5TNXA 1VL0A 4XR9A 4W4TA 1DJNA 1RWBA 2PY6A 2Q4EA 5TS3A 1YS4A 1H2HA 3NUGA 3WMWA 1CQJA 3WMXA 4ND2A 3GH3A 3JQDA 3BMCA 5GMOA 1GQQA 1Z7BA 4DL9A 5L40A 2WM3A 1JTVA 1AHIA 2B83A 4E33A 2PK3A 5FWNA 2B5WA 2GERA 1YO6A 3OHSX 1A71A 3WFJA 3WYBA 2HUNA 3EW7A 2QQ5A 3KLMX 2HSDA 2OORA 3N7UA 1ARZA 3COSA 4IDCA 1I10A 2Y1GA 1Y9AA 3NDRA 5ADHA 4UVDA 3D3WA 3LC1O 4MINA 4CJXA 3NGLA 2O4CA 4IZHA 5EESA 1LNQA 1GPJA 2VN8A 1QV7A 3GA0A 3QRWA 4II3A 3WGQA 1PGJA 5TLSA 3K5PA 1M76A 4QQRA 3V1UA 2VYVA 1ZMTA 4XKJA 3UKOA 2UAGA 2YHIA 1B16A 2C59A 2UDPA 3G49A 3UF0A 3ZH2A 3WDSA 1NR7A 4IGFA 3AI3A 4B4OA 5JO9A 3JQ8B 4DMMA 1FMCA 2BF7A 3R3SA 3H4VA 1NFQA 4Y67A 2OBNA 3Q0EA 5THKA 4BNFA 2EIHA 1X7DA 2EF1A 4IXWA 3DZBA 4GWGA 2GZ2A 1OOEA 3IJRA 1T2CA 2NACA 3IP1A 2Y1FA 3H9UA 1F06A 3R0IA 2WYUA 1BRMA 3QW2A 3W6UA 3I9NA 3QWIA 1PQUA 4LCJA 1HTBA 3C85A 1ZEMA 2NQTA 2A94A 5DN9A 3RROA 2ZK7A 2E37A 3GGPA 3ZNOA 2I6TA 5KNLA 4I5GA 4XGNA 3QWHA 1XU9A 3BMNB 2E48A 5ER6A 3U0BA 5TGDA 4L4RA 3U62A 4CLOB 3ONEA 1ZK0A 2HCTA 3KZVA 1C0LA 3DZIA 1T4DA 2DM6A 2NV6A 5IXSA 4I5DA 1H9AA 1U8FO 3WGHA 4JQCA 2RH4A 4GSLA 3P19A 1ZNQO 1XKQA 1GCOA 4CUKA 1SZJG 3E5MA 1J5PA 1C1DA 3GN2A 4II2A 1Y8RA 5COBA 3MJSA 2O3RA 2Q1TA 2AQIA 3AY3A 4CQLB 2BI7A 4BV8A 1YB5A 1EUCA 1R12A 1FDVA 2Q99A 4G5HA 4NBTA 2AXQA 2I66A 4RO0A 4W6ZA 5C7OO 3ZHYA 4EW6A 4ALNA 5HBRA 1VPDA 1A72A 1P33A 4CLXA 5EJ2A 2YQ5A 1ZJZA 4QX6A 3Q9NA 2CVZA 4NK5A 3ONFA 4JGBA 3U4HA 2PH3A 4ALJA 5CDUA 3DL2A 3QVOA 1U3TA 4KTTE 1MP0A 3GAZA 4K6CA 4RPGA 3P5SA 1I01A 3QQPA 4IS3A 2PWZA 4HFJA 4M86A 3INRA 3PYMA 1UH5A 5BQFA 5DCUA 1PL8A 3CSDA 4E31A 1YB1A 3R6DA 5EPOA 4DGSA 3UCFA 2GN9A 1E1MA 2O3QA 4CLDA 1GEGA 1P45A 1K6JA 4WPGA 3ROPA 5JAQA 1NQ5A 3SBOA 3I5MA 4H3VA 1YDWA 4KUHA 4NI5A 4Y9DA 2GDZA 4XJSA 5L7YA 1JKFA 5FI5A 4M54A 1IZ9A 1UZLA 4IZIA 1LRKA 3ORFA 1NPDA 4BGIA 3CKYA 3ZV6A 3AJRA 4BNIA 3ZU3A 3O9ZA 1GEEA 4FDAA 1TXGA 1H6AA 2NADA 4RVUA 1YKFA 2P9EA 4XQCA 1I30A 2X1HA 3RU9A 2NM0A 5A9SB 4K28A 3FNGA 1YQGA 4DYVA 2Q49A 4ND3A 3HN2A 1PJLA 4BQRA 4EEZA 2P68A 1K89A 3JSAA 4ESOA 3GEDA 4J2HA 1ZMOA 2CNBA 3OEWA 5J9GA 2J6IA 3FPCA 1JWBB 3EK2A 5G4KB 1ISJA 3NDJA 2AEJA 3RUHA 5B12A 5JAIA 3C1TA 4WOKA 3H3JA 3D1LA 4L76A 4GLLA 3QP9A 4Y98A 4BKRA 1ENZA 2GUGA 1PTJA 2XXJA 4P4NA 4UVHA 5G0WA 3L4SO 2B69A 4R1SA 3EZYA 2HRZA 3TWOA 1YONA 2VTDA 4RZHA 4WLNA 4DRYA 1XELA 1NFRA 4A73A 1R4MB 4GLOA 1Z75A 2DU8A 3MCVA 3KXDA 2O7QA 3R3JA 4FGSA 1O5IA 3RBVA 1U4OA 3Q2IA 2Q22A 2C0CA 4L4XA 4RPHA 4DYDA 3GDGA 4J4TA 4WGGA 4Z3DA 2OUIA 3ZWAA 2X23A 4J90A 4CMBA 3ENNA 4DTIA 2X9NA 1BXZA 3GMSA 2W98A 3PPIA 1EFLA 1I3LA 1GCUA 2NNLD 3GF4A 3IUSA 4JROA 4Z9XA 4CV2A 5BSFA 3AFNA 4MVJG 4P4LA 4NFYA 3QV1A 4B4UA 5C7LO 3QY9A 1JVSA 1UXJA 3TF5A 1VJ0A 2WYWA 4E0BA 4S3MA 4NFSA 4J7UA 2B35A 4YJFA 4MVJF 4WCFB 5GZ3A 4R3NA 2NVUB 2IXAA 3FWNA 1IPEA 4J2OA 2IODA 4ZICA 3EVNA 3VC7A 4BNKA 4J4BA 5EIOA 1H5QA 3KEQA 3AWDA 3KO8A 4IY1A 3TSCA 4NBRA 4BNMA 4E4YA 4IDFA 4AJ1A 1VRWA 1R16A 3RC9A 3ZWPA 3DHEA 2I5PO 4GKBA 3D4PA 5CG1A 3OIFA 5HM8A 2IZ1A 3PIDA 2YV2A 1BDBA 1ENOA 4AJJA 4YAIA 3A1NA 3S1LA 2R2GA 3SC6A 3TRIA 2JCVA 1UDAA 3EY4A 2VHYA 2CDBA 3GG2A 2OBYA 2W8ZA 3E9QA 4GX5A 4R01A 5COQA 2QRKA 7ADHA 1ADCA 2BD0A 4RF5A 4AJ2A 5A3JA 4XGKA 4BB6A 4DQVA 4DPMA 2C29D 1DIAA 1DIRA 3PEFA 4ZQGA 4PFJA 4LVUA 4M87A 1KVUA 2PA3A 3MTGA 1EQ2A 3ITKA 4CLHA 1ZO8A 4E30A 3FCOA 2YYYA 2RHCA 3KSDO 3FPLA 4WCDA 3QVSA 3VPSA 3LDHA 3PJGA 1KVTA 3GFBA 1LLDA 1MGOA 2C07A 4XWYA 4L73A 3KYBA 1KEUA 3VZQA 1Q7CA 2PV7A 1B26A 4YJGB 5L7WA 4XJTA 4E2YA 3FR7A 2V6MA 2I9PA 1CERA 4TKMA 1T2EA 5JCJD 1H93A 3DZHA 1W6UA 1NWHA 3OQ1A 3ICPA 2FPGA 4NJMA 3UAGA 3ZZNA 5JCJA 2H6EA 3PRJA 1J49A 4DQXA 1P0FA 1HWYA 2F00A 2VCYA 3HN7A 3ZHZA 3LLVA 1IL0A 2DPHA 4YACA 5JY1A 3DMYA 2VHZA 1E7WA 4GVLA 3PP8A 4R1UA 2EERA 1JW9B 1MC5A 4LN1A 3NTQA 2BLLA 2I67A 2P5UA 3KSUA 3TDKA 5U4QA 4PLHA 4DLLA 3U5TA 5ENDA 3U4IA 2EKLA 5K6AC 1BXGA 5A3VA 1SPXA 4DLBA 5I9MA 3DB2A 2CVOA 1YQDA 3H3FA 3HB4X 4B4WA 3LC2O 3GVCA 2AQHA 3ITDA 3JQEA 4KWHA 4M49A 4NHEA 1RKXA 2JHFA 2JFGA 4OOEA 4J4HA 5CFZA 1LXCA 3SX2A 5JAZA 4OL9A 4IJKA 3WX0A 1WMBA 2DVMA 4CMKA 3NAQA 4IDAA 4OM8A 1HE3A 3AU9A 1LRLA 4PG4A 3Q6IA 4NH4A 2O2YA 5H81A 4BKQA 1DBVO 4HADA 4XYEA 1MFZA 1LJ8A 5CDTA 1MXFA 1CQIA 2P4QA 3RU7A 4E12A 1X13A 3CH6A 4M55A 5B4VA 1XLTA 4WEQA 1I24A 1HSOA 3S2FA 3AUAA 3KSZO 4BNWA 3K2EA 2ZCVA 1Y9EA 1F14A 1LDGA 3UXYA 5FYDA 5M6DA 1PGOA 3V2UA 2DUWA 2X9VA 3FHLA 3GC6A 1CYDA 2FR1A 2GPTA 1I5RA 1LLCA 4CM8A 2G5CA 4N5MA 3NJ8A 5G0SA 4ZU3A 3A14A 3TJRA 3HDQA 3OJEA 4CM9D 1WP4A 5AXCA 4KP7A 3IL2A 4CM9A 5K6AA 4CM7A 1ADBA 5JSFA 3G1TA 4MIYA 5JLAA 3ANLA 1ENYA 1X0VA 4CM6A 3LYLA 4QO7A 1L1FA 4I9NA 4D44A 3W4KA 3ZWCA 1UDCA 4YR9A 3JYOA 3P7MA 4RGBA 3ZWOA 4BO9A 1NQTA 1LSSA 1NAIA 1UAYA 4CMJA 4RQUA 1HZZA 1PJTA 4FFLA 3ZN2A 3FWZA 4D79A 1HDRA 2J8ZA 5L45A 2B5VA 2GCGA 2Q1UA 3DEYX 2XPCA 3LF1A 1ULUA 4PRLA 2Y67A 1SMKA 3AOEC 4L4SA 5K0ZA 4K26A 2VNSA 2VQ3A 1GV1A 3E48A 3NEPX 4MVJE 3PYXA 4O1MA 4XIJA 1PR3A 1E6WA 1DFIA 2YQ4A 4INAA 1UP4A 1A4UA 1XQ6A 2AQ8A 4NFHA 3JQGB 3PJFA 1MG0A 2V6GA 5JNLA 4QFCA 1Z6ZA 1MB4A 2EP5A 3PZBA 1T4BA 4IQGA 2VWQA 4WEOA 4EJ0A 4WKGA 3CZMA 4PZDA 3JQ6A 3FNEA 1T2AA 1D1SA 5G0UA 1LQUA 2HJSA 1F0YA 1DXYA 3GZNB 5BT9A 3JQ8A 2DBRA 3GGGA 3G79A 4JXKA 4ND1A 2ZJ1A 1IYZA 3OA0A 5A04A 4R51A 4L75A 1NQOA 3JYQA 4AJHA 3L4BC 4B3IA 3PGJA 4ZN6A 4R9RA 3BA1A 5DBGA 2RH8A 3GHYA 4EUHA 5EN4A 2PR2A 4HFRA 4J1QA 2V6FA 4OOFA 4DPKA 3JQ7B 1DC3A 3U09A 3ZV4A 2QRJA 3KV3O 4H15A 5U9CA 1EUDA 1ZXLA 3WG9A 2A35A 4GQAA 4MVJM 3TZ6A 1I2CA 2O3UA 3BMNA 1RYEA 3QWAA 4BO7A 4H16A 5B37A 4OKIA 4CLOA 3MZ0A 1FDTA 4OH1A 3DOOA 2Q2WA 1D3AA 1JU9A 3TFOA 4UVIA 5EQFA 1A7AA 3WSVA 4EJMA 5EL0A 4I5FA 3AOEA 1F8FA 3OECA 1K6IA 3H2ZA 4IPTA 3K6JA 2O7SA 2W2LA 3GNSA 4KOAA 1I3KA 1YBMA 1PJBA 1VM6A 1DHRA 3PLRA 3ZU5A 4CQLA 1DB3A 3M2TA 1XYGA 2ZTVA 1PIWA 3MOIA 2FMUA 2W2KB 4MVJP 1OZAA 1O95A 4P38A 1EUZA 1I3NA 3W1VA 1LC3A 1DDOA 3B6ZA 3ZWYA 3AY7A 1NQAO 3WGTA 1M6HA 3W8DA 1GUZA 2HK8A 3CXRA 4RF3A 1BXGB 4TWRA 2ET6A 1DC5A 4NMHA 2C54A 5CDGA 4Q3EA 4PLCA 1NFFA 3PFFA 4U6SA 4XYBA 1VLLA 3DDNA 1EDOA 1P31A 1O94A 4UEKA 5BSHA 3AU8A 4TRRA 4YJHB 1KC1A 1T26A 3MEQA 5HWSA 3STHA 1P44A 2BI8A 2BFMA 3RUCA 4NIMA 4FGWA 4KTVE 1E3IA 1GU7A 1U8XX 4W82A 3WBFA 3G0OA 3E9MA 3L4BA 4CUZA 2B4RO 4G81A 1KEPA 2HO5A 2UUPA 4BGVA 4XZ3A 4D3SA 5IDYA 3OQBA 1A4IA 1BVRA 1HYEA 5BSEA 4GKVA 1YOVA 3WQQA 2E4AA 1BMDA 4P22A 2AW5A 3N74A 2PLAA 2P91A 2VOEA 4A2CA 3WLFA 4ND4A 2ZB3A 4LSWA 5DDIP 4PLVA 4XGIA 3DR3A 1E0DA 2ILTA 3AOGA 5A03A 4IJVA 4D3DA 2PFGA 3X2EA 1KVSA 3IAHA 1LA2A 4Q3AA 4GMFA 1QP8A 5L4NA 1N9GB 2DBQA 5L4LA 5A9SA 1N8KA 3O4RA 2V6BA 4WCFC 2EG9A 4F6CA 1EVZA 4CMAA 3ST7A 1U5CA 1S7CA 2LDXA 3NGXA 3H5AA 3CPSA 3RFXA 3HG7A 1E7QA 1ZK1A 4BV9A 3TNLA 3ETGA 4JJIA 3VPFA 5C7IO 1E7SA 4DWVA 3RASA 4MOWA 1U9JA 2GN4A 1T24A 3H9GA 5EQDA 1B3BA 5G4KA 2HRBA 5F5LA 2VUSA 4GX1A 3L6DA 3VDRA 1Y6JA 2FWMX 4QFDA 4MVJI 2VRCA 3X2FA 1UUFA 3AY6A 4R5MA 5ER9A 5TQVA 6ADHA 2PGLA 1YRLA 5C5IA 5KVSA 5I9NA 4FSHA 3V1TC 2AA3A 1NHWA 1R4MA 3DMTC 4CLRB 4ONEA 4EI2A 1ZVMA 4O6VA 1Z74A 2C2XA 5I8WA 3F4BA 4IINA 1MX3A 1KY4A 2O3SA 2PTGA 4UULA 1VKNA 3U3XA 1C14A 2Q50A 3FTPA 3FTNA 5DCWA 4BGUA 3TL2A 1B15A 1GYPA 2GN8A 1KIFA 4U6QA 5T67A 4YT4A 4GWKA 3BTVA 4NJOA 2IE0A 5LDGA 1EVIA 2B36A 1O8CA 3I9KA 1M75A 1C1XB 1HL3A 1YVEI 4PCVA 3UW3A 3KUXA 3DXFA 1DFHA 2PZMA 4BNNA 1PWZA 1KETA 2Y1EA 1ONNA 1WNTA 2DTXA 2AE2A 3T7CA 3MTJA 1EQUA 3PIIA 4EGFA 1P1IA 4WCFA 5IG2A 5F1KA 3S2GA 3KM0A 1G6KA 3WWZA 2C5AA 1E92A 2NVUA 2ZTLA 4J9VA 4YXFA 1EVJA 4YWJA 5CG2A 1ZIDA 3C24A 2DTDA 3ZWXA 3I6IA 4JJFA 3JQ9C 1CRWG 4BB5A 5BNIA 4YAJA 5F3RA 5KVQA 2X9GA 4YBZA 1IZ0A 1U2GA 2XOXA 3LT0A 1F12A 1NR1A 1Z7EA 3GMDA 5KJ6A 4QT0A 3RUDA 4ZQHA 1RM5A 3HWRA 5IZ4A 2GSDA 5BR7A 3E82A 3R1IA 1YJQA 5KKCA 3RKUA 3A9WA 4ALLA 2EJWA 4R4JA 1AXGA 1Y5MA 4BS9A 1PJ4A 3DHYA 3DMTA 1I2ZA 1N5DA 2NTNA 1HLPA 4PIVA 1DAOA 4ITUA 1UXIA 1DIBA 1SB9A 2G82A 3F47A 4Y6SA 4CL3A 1DRVA 2NQ8A 4HX5A 1DRWA 3OP4A 2ZKLA 3BMOB 4MKZA 4CMIB 4OJNA 5JYEA 4JBIA 2WEKA 4HFNA 3TPCA 3W6ZA 4WASA 2H5LA 2OP1A 1D7OA 3GLQA 3HFSA 1AE1A 1OC2A 1QV6A 2B37A 1D8AA 3E5RA 2J3HA 4GH5A 5HTOA 1NPTO 5J23A 3O8QB 9LDTA 4XQEA 4WLUA 2Y05A 1ISHA 4YJGA 3GPIA 5ICMA 3HE3A 4BNJA 2QZ9A 2AQKA 3LC7O 1E5LA 4WLVA 1ID1A 3RQSA 2FOIA 4HNHA 4IIUA 3B1JA 2DTEA 1YQXA 1PJQA 1HDXA 2JL1A 3K30A 4GBJA 4J6FA 2GZ1A 2EHDA 2X6TA 4CR8A 3AI1A 3GZ4A 1B2LA 1PGNA 2BFOA 1YB4A 1ZK2A 2RIRA 3JQ9A 4JP3A 1O6ZA 4J9UE 3GAFA 1EK6A 4YRAA 5T8KC 1YJ8A 4FQ8A 4U0KA 4DXHA 4OXKA 1Y8QB 1PEDA 4DA9A 2IRWA 1LDBA 4D43A 4YT8A 1JVBA 2BKAA 3L6EA 4YRBA 2VWHA 2O50A 1R4NB 4NPCA 3BIOA 7MDHA 1F17A 3SJ7A 2GD1O 4XDYA 3W4JA 2J3KA 1JAYA 2IXBA 3S2EA 2F1KA 1PJ3A 1YOVB 5COAA 1XEAA 3WQSB 1S6YA 2YHUA 3M1AA 4ZJUA 2Y0DA 1SEPA 1X7HA 3GNQA 4ND5A 4AJLA 2BGMA 2HMSA 5B1YA 4TVBA 4I5EA 4Z0TA 4RV9A 5JBIA 3H8VA 3PFWO 4IMPA 4CODB 1O89A 4PN3A 2HAEA 1E3SA 3NTRA 1ZSYA 1IE3A 3B1KA 3GDOA 1JA9A 3U49A 4W7HA 1YDEA 3ASUA 3L07A 3HZZA 2OXIA 1D4FA 3VOSA 4ID9A 1EE9A 5ITWA 2SCUA 3NT5A 4LK3A 4DBZA 3WR5A 3C7AA 2YW9A 1H6BA 3RUFA 4ZGWA 4E5YA 2GN6A 1SEVA 1EBFA 4LRSB 1E1LA 1Y1PA 2X5OA 4J16A 6LDHA 2NSDA 4B4VA 1TA4A 3HSKA 1JN0A 3GR6A 4YAEA 2G1UA 3GPDG 3EDMA 3K92A 3F46A 5TT1A 5F1PA 3DC2A 3PHHA 4Q3NA 5T8KA 3QVWA 2NVBA 4IQ8A 2CUKA 1N7HA 3KVOA 4FC7A 3AM4A 1V9LA 3PTZA 2IYPA 1DSSG 2BGLA 4IQ0A 3PVZA 1BXKA 4LCEA 4PLFA 2ZIZA 4IUYA 2D1YA 1GYQA 4UEJA 3ZNPA 2O2SA 4B3HA 5T57A 1UJMA 3T4EA 4Z6KA 4XDZA 1BTOA 2HMWA 5AYVA 1UXGA 2A92A 2IZ0A 2Z1MA 4Z0HO 1KYQA 4XYGA 3EUWA 1H6DA 3E9NA 4ROSA 4J43A 4MVJD 4PG5A 1BVUA 2YJZA 4TRMA 4EJ6A 1GL3A 1WWKA 2Q4BA 1TVEA 1KOLA 4R16A 1ZSVA 1VKOA 3CMCO 1HE2A 1H2BA 1I2BA 1RM4A 2QX7A 3PWZA 4XYLA 1GZ4A 3OSUA 5IDWA 3SLKA 3TL3A 3WSWA 2XXBA 3VPGA 4CPDA 1UXKA 4DIBA 1NVMB 2EW2A 2VZ0A 3AM5A 3LLSA 2VUUA 3QA9A 4BMSA 1OI7A 4MJLA 4CM4B 1E6UA 4U7WA 3JQGA 2Y1DA 2QHXA 4AFNA 3D4NA 2ZB8A 3DHNA 2Z1NA 3CIFA 3WQRA 1Q0LA 4IM7A 4CUJA 3ICCA 3QIVA 3DAPA 1B8UA 3JQCA 2Y0EA 4JK3A 4BO0A 3AK4A 3LU1A 3RC7A 1BDMA 5ENVA 1WAMA 2AMFA 2IZZA 1MXHA 3UFXA 3PJDA 2IDZA 3WICA 3WJ7A 4RL6A 3BMQA 1FDSA 2QIOA 3BXXA 4BNVA 3WB9A 5HS6A 1L7DA 3ZW8A 3DQPA 3AUTA 3SC4A 3GZNA 4J91A 3M2PA 4MP6A 1PJCA 3H5RA 3GUYA 5IN4A 4DC0A 2AHRA 4JCOA 1ONOA 1SC6A 4QECA 5ILGA 9LDBA 4C4OA 1WDKA 4DUPA 3EMKA 1WXDA 4D7AA 4CR6A 4XRRA 3HDHA 3RUIA 3HDJA 1ZEJA 2Y66A 3DTTA 5A1TA 5IDQA 3SXPA 2WE8A 5F21A 4GX2A 1IOLA 1YGYA 2J3IA 1WDMA 2VT2A 4BQPA 3MOGA 2JD1A 3JQ7A 3UN1A 1TLTA 1BGVA 1HSZA 3C1OA 1K5HA 1EZ4A 1NBOA 4M89A 2YDXA 5IF3A 4WECA 3V8BA 4E5NA 1EFKA 3BZUA 2WMDA 5H83A 4DQUA 1LUAA 1ULSA 1X14A 1JKJA 4MDHA 4K9DA 3WBBA 5ILOA 1PZGA 3OJ0A 3DBRB 3H7AA 5CP8A 4D41A 4PLZA 3DBHB 2JCXA 4WJZA 4N7RA 3GRPA 5CDSA 2ZQYA 4Y6RA 3H9JA 4BIIA 3KYCB 3KYDB 4TZKA 5G0TA 3VHRA 4AJIA 4DVJA 3C7CB 1FF9A 4R69A 3WTCA 5I7SA 3F5QA 2W2KA 1A27A 5IZCC 4DC1A 2PKQO 1BWSA 1H94A 1XA0A 3UCXA 3H6KA 4B3JA 4D45A 1NP3A 2X4GA 3C1AA 5ES3A 4AG3A 1A7KA 4PG7A 5ITVA 4MP8A 4MKRA 3E03A 1M2WA 3D7LA 1AN9A 3WGGA 3I23A 5JDIC 2ZB7A 3GEGA 5C37A 5FI3A 3IUPA 4YJHA 4BKPA 1PS0A 1IULA 4BO2A 1I3MA 2A4KA 3EAGA 3PHGA 2JD2A 3I4FA 1GQYA 2EV9A 1U3WA 3WS7A 4W7IA 2GR9A 4AL4A 3OF2A 2PKQP 1HKUA 1YE3A 3LT4A 4LMRA 5DOVA 1W0CA 2FP4A 2GASA 1QORA 3JCZA 1I36A 1QKIA 4JJGA 5T6BA 3PXXA 4WK6A 1I33A 5KIAA 4WNCA 5TRTA 3VH1A 5IXYA 3VZSA 1E3JA 4XYMA 4IGEA 4RVHA 1EDZA 1NX6A 1T1SA 5AXBA 3WGIA 1A9ZA 1HDGO 1K2WA 1JLLA 1SAYA 4PLGA 4ZQFA 1WMAA 4E2XA 3I9OA 3B1FA 3E6AA 1DEHA 3F4LA 3OM9A 3ZNNA 1K3TA 4JIGA 1PQPA 2UVDA 4E2ZA 1N9GA 5CEEA 1LEHA 2CDCA 2PKRA 1J6UA 2Y99A 3VZPA 4JBGA 2O3TA 2YUTA 5JXWA 4CV0A 2Z95A 4RJTA 1AGNA 1ISMA 3JQAD 5DT9A 3ZHBA 1I8TA 2J5KA 1NVTA 2EP7A 3QLJA 4GMGA 5KKAA 1BHSA 1ADGA 3UGKA 5HRUA 5IZCA 1LRJA 3PLNA 4URFA 4ALIA 1I32A 3Q9UA 3DBVO 4XX0A 1U5AA 4OXYA 5MDHA 4NNJA 2HQ1A 4WLFA 4UUPA 3AUSA 1B0AA 4FW8A 2FHSA 4QXMA 2RBEA 3IJPA 4ZD6A 5JDIA 1V3TA 3KHUA 5GY7A 4CLRA 3CINA 5G2OA 2H1SA 2BMAA 3LF2A 4YQZA 3ZW9A 3S2IA 1HF3A 4EUEA 3K96A 3QJ5A 2Y1OA 3RC1A 2ZYAA 4KDFA 3DZGA 2DAPA 4HKTA 1LBEA 1X0XA 1E3WB 2FY8A 4L8VA 4EEXA 4RPLA 1C1XA 3T4XA 4QEDA 5KJEA 1HDCA 1YXMA 2YFHA 2IEBA 3VVBA 5DBIA 2PZJA 4PLTA 2ZQZA 4BVAA 5DULA 4KUEA 1GPDG 1UZNA 2D59A 1XWFA 1QRRA 3RKRA 5JAMA 4TRNA 1IHYA 1C0PA 1VI2A 4PGFA 3MJCA 4FR5A 4RF2A 5JC8A 1YWGO 1RJWA 3DZFA 4Z9FA 4XR4A 1HZJA 2VNAA 2I3GA 3ADPA 4IMRA 5MGBA 3RVDA 3OJOA 1MFPA 3JQFC 1WZEA 2YY7A 5BSGA 4DPLA 3OJLA 4Q3CA 1G1AA 3BMQB 3V2GA 1FDUA 1FXSA 4BNZA 3RUEA 3RI3A 1CETA 3RD5A 1ZKMA 2BELA 1ZK4A 3KRTA 3VVCA 3IP3A 3TOZA 4ZA2A 3KETA 2B0JA 4E2WA 4RF4A 3EVTA 5A9RA 1E1KA 2FRDA 3ETEA 1TEHA 1E7MA 4MO2A 4QUKA 4RQTA 2EKQA 4D42A 3LT1A 1NM5A 1U7HA 5CEJA 1P1JA 4HP8A 3QWBA 4FJ1A 4J1TA 4BL5A 1NHGA 1YL7A 4D46A 1P1FA 3BTSA 2EKPA 2VT3A 5GZ1A 3TZQA 3BMOA 2PZLA 4CMIA 3N58A 3Q1LA 1DC6A 4K1LA 1GADO 3DONA 4YCAA 2TMDA 5F5NA 4DLAA 1UP7A 1T2FA 5KOIA 2Y93A 3H9EO 4HFMA 5DP1A 4XRGA 3HQ4O 1DLIA 4RVSA 4F6LA 2VYND 3F6YA 5L7TA 3ZU4A 1M67A 2J5RA 2JKVA 4DBVO 5A05A 3O8QA 2JFHA 4OYRA 4FFPA 4YEDA 2VYNA 1QLHA 4ZHSA 2Q1WA 3JD2A 3TZKA 5KTKA 3IOYA 3DO5A 5JO0A 3KLPX 4JBHA 4OAQA 3I52A 4XA8A 1LX6A 4E5MA 3LT2A 3EZLA 2YV3A 5KJ1A 3C3XA 4HV4A 4OMUA 3NJ4A 5TIIA 1PR9A 2X0JA 4LGVA 4OSPA 3JQFA 1Q1NA 2QYSA 1ONPA 2DBZA 3OICA 1ADFA 1GQ2A 4YRDA 4ALMA 1Y8QA 2A9FA 2HK7A 1GAEO
chains in the Genus database with same CATH superfamily
2J46A 4O4JB 1Z08A 3RUPA 2ZRAA 1QBKC 3QXJA 5KVVA 4PICA 3HDYA 4QGAA 2O4UX 1C3JA 5LZ4A 3ZCXA 1VKHA 1H6CA 4KGDA 1E0AA 2XMDA 4TWBA 3T95A 1IATA 3CR8A 5HA5A 3FCCA 1Z82A 4QM7A 3DTNA 2C5BA 4Q24A 2HD4A 3P4XA 4BNGA 3B9BA 4GGPA 2F67A 5LN1A 2X5JO 1TU3A 1JXMA 2Q6IA 3MJRA 4N5LA 4IBOA 4KPUA 4XFJA 5D86A 5ALSA 3UQZA 3ZCTA 4DNOA 3WL6A 3B12A 1NMZA 3P2OA 4NMLA 1NF9A 4PS1A 3A37A 5FCDA 3RJMA 3FSRA 1NYTA 2GSWA 1SN7A 2XCQA 4N18A 3TTUA 5BUCA 5IJ0B 1V4BA 2YZMA 2A0WA 4XM1A 1ABBA 1PLJA 3MWEB 2XYHA 1SQGA 2YBDA 4RD0A 5CW1A 3NXSA 2KS6A 4EA8A 3BBLA 5K0SA 2JLWA 3PEYA 1PEYA 3G9XA 3U7GA 1DFGA 1JLRA 4AD8A 4MXDA 2CDRA 3OHMA 1WXQA 3OH8A 2YXEA 3R4VA 3UB2A 4F3KA 4LRWA 1UXHA 4OY3A 1QANA 3CW8X 1QCZA 3E84A 4UDXX 2I99A 1OLOA 5ALQA 2LPMA 3KE8A 1MJNA 4DQDA 3DCJA 5C4GB 4MV8A 3VNRA 3MWFA 1MORA 2QM7A 4IRUB 2LDBA 2B4AA 3VKUA 2GGSA 1Q0QA 3F3SA 1V5EA 4RJLA 5M3BA 3NANA 2HJWA 4L9SA 4OI4A 2IT1A 3G2PA 3G8DA 4D57A 1VB5A 5AFSA 5H3HA 3E35A 3HUDA 4NAHA 4CEIB 1L8LA 2G80A 2UYHA 3MCAA 4NPAA 1YDMA 3H3XA 1FMTA 4FWIB 1FLNA 3CPJB 3SHTA 3IPCA 1AZLA 1MUUA 2B4TO 3FF4A 3O73A 4M9ZA 4L3OA 2CK3D 2PD6A 3G13A 5F1OA 1UDBA 2CFIA 2FDCA 4G1UC 1T9ZA 3ZI0A 3ENKA 4RHTA 5JC1A 4QYIA 5CDYA 2JATA 5JS8A 4I81A 2J3JA 2HXSA 3DD1A 2FR0A 5E4YA 4EW3A 1V9SA 3CEHA 2C8KA 1LK0A 1J8MF 4HYQA 3F1KA 4AJPA 5JHHB 5B4UA 4B3CA 1QF7A 1NIPA 4BY9E 1TYAE 1X1DA 1KOFA 1PBTA 2OBXA 4GSKA 1O03A 4MWTA 2WHPA 4P5DA 5BXQC 3LO5A 3UHAA 3M9LA 3BIWA 2XB2A 3R09A 4G3XA 1MEJA 1X7ZA 1TB4A 2LKDA 4H6PA 4BNTA 1PX0A 3WGYA 1CTQA 1JHXA 1R5OA 1UPBA 5BW5A 1M0SA 3LPNA 3DXYA 4HNTA 4LWZA 1JIIA 2FX5A 4K8RB 2GVDC 1Z6YA 2I6SA 2IEAA 3OMXA 3BRWD 4UMDA 3WLPA 1V96A 2CFCA 3AM3A 4MZXA 1QXSA 2UXCB 2BZ0A 4GI2A 2CMHA 1MAWA 3SX0A 3OIDA 4JLBA 1F8GA 1VJTA 3GVIA 2QU7A 2VO1A 3EXIB 2R86A 3VR2D 5AVTA 2JBHA 2R3SA 5BNTA 1G291 3FNFA 3Q3JB 4DV5B 4AQYB 1K7YA 5JROA 4IDEA 1Z6XA 1JF8A 3T52A 1DLJA 1JFSA 1OAOC 1LBQA 4MLZA 5JXGA 1IBKB 3BTUA 4YCDA 4QTYA 3EQ9A 1TUEA 3M33A 2X7HA 1ZBQA 3OKAA 5JOQA 1M1NA 5F7JA 3PPYA 3N0TA 4YQYA 2RHHA 3IDSA 4Q4AB 1U28A 4ZAXA 5JS7A 5E2AA 5KUTA 1PG0A 3UJ7A 3O3OB 4DSAA 2ZU6A 4HO1X 1O0CA 5AOVA 1LV7A 3K0SA 4PFQA 4R40A 2JAUA 4IR7A 4W5WA 1UODA 1LU9A 4KIJA 5J2UB 1CZOA 4AMGA 1WU7A 2RGBA 3PHJA 3WK9A 1OJ7A 4EW2A 5F3WB 5DBEX 3JTMA 4Z8XA 1TF2A 1ADYA 3BB4A 4DG8A 2RIPA 4WW0A 1S9HA 2H06A 3U7FB 3M5DA 3PT9A 3L0SA 1G9TA 2QTGA 2QX9A 2WYVA 5EKXA 1W4BA 2ORVA 5ULLA 3WADA 1UT8A 4OK6A 4JB2A 5C80A 1Y3IA 1X7YB 4B6FA 4KVFA 3D0OA 4C87A 4DQLA 1V8ZA 1L5MA 1XG5A 2FR8A 3JARA 3JWGA 3QE3A 1L5VA 4HX2A 4NMWA 4O1IA 3TZHA 1SC3A 3UOGA 3O9MA 1A5TA 3PTLA 4MP3A 4QSMA 3RTBA 1CY0A 3WYCA 1PN3A 1DAPA 1QQ7A 4JUAA 1T15A 2HWKA 4E94A 4IJUA 1R6XA 4Z4CA 1Y63A 3H65A 3O26A 4UM5A 3NDBB 3TX2A 2FWRA 4M1SA 2CZCA 2DLDA 3EAQA 4Y0NA 3T12A 2XWPA 1F6DA 1GAWA 2Y77A 1VKRA 3OE7A 4ZT5A 5FLEX 4A5SA 4D3FA 4ERXA 5K3CA 2PFKA 5I8PA 3IR5A 3A6EA 1WW8A 4L5IA 3U39A 4UOZA 3EXHA 1PK8A 4V1CA 2ZTHA 3OLWA 3ZV5A 5FPPA 4DXDA 3BH0A 3KFLA 5I5GA 4TYWA 1XCBA 3TB4A 5AVRA 1GZ3A 3HXPA 1MG5A 3Q8LA 4A92A 3KYCA 3KYDA 2O2IA 1EE2A 1AQUA 2RB4A 4ZDJA 3AF1A 4R7ZA 1INLA 1Z0IA 1N77A 1W36C 1JG3A 5J4LA 1JPVA 1IBSA 5LDHA 1GGMA 3M6FA 4TWJA 4XVHA 4ZV7A 5JVDB 1F7VA 1UM9A 4CFSA 3ABIA 4GS5A 2Q3HA 3HA2A 2E49A 1W4LA 2Y68A 2UZ3A 3C48A 3HHPA 3O6VA 4J0FA 4Y6OA 2AKEA 5G4LA 4CMGA 1IH8A 1C9NA 1PGQA 5F3DA 2O1SA 2I0FA 2DJ5A 4J1NA 1OTYA 1UMCA 5CM9C 4EL0A 4IDGA 1L1RA 2W9XA 3BWDD 1B8VA 4F4FA 2GYUA 1AKRA 1B43A 1ZMRA 2J41A 1RAFA 2M1ZA 2YRXA 3GCZA 1NBEA 3S28A 4QOHA 5D51S 4BAZA 2WJIA 2OKGA 3SS9X 1B23P 3QSYA 2OO3A 1Z16A 4PZYA 3V7FA 3PHIA 4HHEA 4DOMA 3HI6A 4OQZA 2QAJA 4BNXA 2RGWA 4HXYA 5JYCA 1CF9A 1HFWA 2CL5A 3O8OB 3ZE7A 2SBTA 1J0XO 4EKGA 4DUYB 3CW2A 1CSEE 1FRFS 2EKDA 1JXOA 2EZ8A 4B8ZA 1RC8A 3C8MA 3I76A 1PR5A 3C8ZA 1UMDA 5DH9A 2W43A 5KC9A 1T9KA 2P8JA 3O38A 4JKOA 1ND6A 2JAHA 1WZCA 3ON5A 4UAJA 3VTZA 1T25A 4RJJA 2PLRA 2WKWA 3R0VA 2XITA 1IHXA 2JJMA 1SC1A 4OATA 3G2KA 5D3ZA 2IEDA 1C80A 2OCBA 2OO7A 3QUCA 4AX8A 3H5NA 3CEJA 4N82A 1P17A 1FP4B 4A27A 3FSEA 2ZI3A 4WBXC 5C0OE 3T5DA 4ZYZA 3U4AA 1HMYA 2PS0A 3HJRA 2C5EA 2OTCA 3H83A 2HXGA 4HY3A 2M6SA 3JASB 4XIGS 4BUCA 1FFHA 1NPYA 4K9RA 3SYNA 4UHJA 4JDUA 5E6SB 2J87A 2KE5A 3QEOA 4KRGA 4F3CA 4MYHA 1O96B 2C2YA 2JCYA 2NZYA 4GECA 5DP2A 1ISFA 3NH6A 3K9NA 2L42A 3U3OA 5I7HA 1C2TA 1GZUA 4KV7A 4R0NA 1H1DA 2EX1A 4TPKA 5KNCA 2C9OA 4JLWA 4KWIA 1OX6A 3WK7A 2COUA 3I1YA 3LPMA 3Q7RA 2QTVA 4FQ5A 1AUVA 3MJ4A 4N5NA 4TMFA 1BO6A 3OQOA 4F5WA 2HF9A 2D4AA 1Q1GA 2CY0A 1KO1A 2FZ4A 4EPYA 4WA7A 4HWKA 2QT9A 3CLUD 2G8LA 3TSAA 3VI4B 5TT0A 4F86A 3S2ZA 2VHCA 3VKHA 5TPZA 3ZHOA 1RPZA 5KJCA 3KR1A 2VF8A 4AXBA 1T6NA 2O5VA 2FQYA 4S05A 4K9MA 5TVGA 3LWDA 1M3SA 4DV4B 4FM9A 1TF5A 4HN2A 2P3SA 4I9HA 2XSZD 4B6EA 4CEJB 4WOJA 1CW2B 3DS8A 2Y76A 3CUSA 3I2HA 3PFNA 5GONB 3BIFA 4JL6A 3IT1A 2FSSA 3KAKA 4BVGA 4DJAA 3U9SA 4MTCA 1G8AA 1YUBA 3DJYA 5LOVA 1M34B 3EWNA 2XZLA 3R3UA 1E3WA 4LE2A 2XXAB 3IE1A 3FGZA 4J0IA 3COYA 1V35A 2W2VA 3KXLA 3FZEA 4P4GA 1TCUA 3U4DA 3BQMB 1VG0B 1JXAA 1MF7A 4OO3A 1QVVA 1Y81A 1VGVA 2GRJA 3F5DA 3PQ2A 5EP4A 4YUWA 5JD3A 1W29A 4GX0A 2WHXA 3CE6A 4YK7A 3OI7A 3KQVA 4XQ9A 1YJBA 2HCRA 2QD5A 1QG2A 2GESA 3P0RA 4U63A 2HB6A 1MO3A 3VZCA 2VBCA 3QU4A 5IDWA 3D3WB 3EQ6A 4YCBA 1R15A 3AERB 4J49A 3OA2A 1UPXA 3QOFA 2X0FA 1ZCJA 3DKPA 3UT0A 1GAQA 3HVRA 4BAUA 3PGVA 2RCNA 3OOJA 2CFTA 2BFPA 1E7RA 3LY8A 1FTNA 3ICOA 3KTOA 3ZWBA 5JRDS 2Y1CA 4R2MA 1CJTC 3H1FA 1RHRA 1MC8A 4CHTA 4L22A 1QCYA 3K94A 2ORIA 4HGOA 1PR4A 2OL4A 5KWSA 2VOJA 1RWQA 1DBRA 1KHTA 3AHJA 3N0XA 5KTNA 2UXBB 4LDNA 3KJXA 4ZHQB 4C7OA 3FNHA 4AWAA 5JYDA 3JZDA 2A9KA 3R24A 1SO8A 3QLEA 4UUNA 4GDMA 1V8OA 3BFKA 3UK1A 4YNBA 2J9ZB 2OQRA 3VYWA 1BG6A 1O5TA 3R40A 4KYUA 2D5AA 5ITZA 1GYRA 4FC6A 4BLUA 4PVDA 4NCKA 5LMCA 2OHOA 5AHXA 3PUZA 1GQRA 1CY4A 3OMWA 4N3BA 1YH3A 4EA6A 3LRPA 2QYTA 3UXMA 3M1LA 4HPXB 1N2EA 2AJLI 3W4IA 2V7QA 4CMEA 2Y1LA 1KBZA 3ZU2A 1JILA 1DXOA 3OTGA 1GA6A 3CEAA 4Z1MD 2I76A 4O8JA 1K0UA 2C7QA 2DR2A 2F1HA 1IB6A 1RJ9A 3EEFA 1PT8A 1Y3FE 4OHVA 2C9BA 2MSNA 3BH6A 3NWBA 3RYFA 3GL9A 3DE6X 1AKNA 1D4AA 2PSJA 3OF3A 1SURA 4IOKA 4IIHA 3WKAA 4C0XA 1ZN9A 4DHWA 2D1QA 2OLJA 3PUIA 3ANXA 4YAKA 1IM2A 1ZGHA 2R79A 4R2LA 5IARA 3OT1B 1FX0A 3NLLA 1F4VA 3NRJA 1QG0A 5BVHB 1LQTA 2VZLA 4D9KA 4HBGA 3B9PA 2P1RA 1LLUA 3TD6A 2HSEA 1WOYA 1V95A 1DTWB 2WTBA 2JPDA 3H19A 3SQMA 4TKUB 1PZEA 2OG2A 5TVOB 3I9FA 4PYJA 1EWKA 1REQB 5IKPA 2H0AA 5AT1A 2NPOA 1D0VA 4B6OA 2XUHA 4HD8A 2IPOA 2QGZA 4HSGA 4F3RA 1Z33A 4NONA 1P75A 3F6CA 3TS1A 1L7BA 4FJ0A 1Y5RA 1J42A 1YAHA 2PGDA 3OY7A 2QSJA 1TTHA 3VGJA 2XVYA 1Q95A 4TXHA 4D8TA 2NVWA 3VHXA 1CBUA 5CXQA 1EUCB 1QYDA 3I32A 1TE2A 2FJPA 3OU2A 3EWIA 4NQZA 4IMJB 1UAGA 1NUUA 3B1YA 3HKEB 5ALDA 2QM0A 2C4NA 4EY5A 1L5OA 1VG8A 1MIHA 4FYPA 4EY6A 2RGYA 2XUQA 3CNQS 4BMOB 4H4EA 2Q5OA 3GRYA 1RLMA 4HDSB 4NAUA 4DA0A 1KAEA 2AYZA 1ECBA 4PZZA 2ZZMA 1PV1A 2FUG1 4QUDA 1M8JA 3W3AA 4DZZA 1RYDA 4KMOA 5GOZA 2H1VA 3CF0A 3QVKA 5BO5A 2YXDA 1SVOA 2O48X 4R6WA 2J9YB 1WBBA 1GXSA 1ZQ9A 3CONA 3JWHA 3PENA 2HHJA 4RS4A 4ZRMA 3WL4A 1N25A 4X8LA 4E09A 5DBFA 5A06A 2DPXA 3VNVA 1RACA 3T7DA 1GNTA 1OW3B 1G20E 1BFUA 4NEHB 4EHNA 4QRDA 3GLGE 3RT1A 3GIDA 2BRUA 2G4VA 4LXTA 1XL1A 2ZTMA 4RGYA 1ZOOA 2P6OA 4LMPA 1EDDA 2H3EA 1RMQA 5KHLB 2I7XA 2EWMA 3A28A 4DV0B 5BWMA 4M1ZA 1GDHA 5JYFA 4LRTB 3OQVA 1EUYA 4M46A 3T7EA 3LDFA 3D43A 3WHLA 3DLPX 5EA2A 5BNFA 3VDQA 2HLDD 1C0EA 3HPRA 3U9LA 3AKCA 2XUGA 3MPOA 4BBZA 3SR0A 3KSMA 4YAUA 2ZJYA 5EXTA 3T7IA 2W6NA 5EHQA 3R9WA 1UPCA 4FQ7A 3EXAA 1Y89A 4JLOA 2QRVB 4JB3A 5TF4A 1QOPB 1CJBA 1EHIA 4DLNA 4LBYA 5DLYA 1ZM2A 2BEJA 3K0HA 1E2LA 1NG9A 3JQAA 4DMLA 5AK3A 4JEUA 2WRZA 5GGXA 3OPMA 5HG0A 1FL9A 3UK0A 1IXKA 3KBOA 3E7PA 4LVNA 3AEQA 4WBSA 1P2VA 1WXEA 2I22A 5PNTA 3W5SA 1P7YA 5E3HA 4JJEA 1XZAA 2VH1A 2P9CA 3CSUA 1KK3A 5KYTA 4R1QA 4CCYB 1GT91 1O2DA 2CE2X 5AHRA 5GVSA 2EBUA 1NSTA 1U2PA 2CLHB 3K9LA 1SBZA 1TT5A 1XCGB 1Y5LA 2HDHA 1TYCA 2JFNA 4FS8A 4HNSA 4JA0A 4S1TA 3S2SA 4D97A 5BV8A 4G5YA 1QMGA 2M32A 1IM8A 4F2GA 3KKZA 4UD6A 3KLNA 1HMPA 1W48A 3N8IA 1HA3A 4PXSA 1U2DA 4XD7D 2QJOA 4HPWA 4L5CA 5FUWA 1KE2A 4HLUC 3S68A 4AYTA 4QG3A 4L6IA 2AC2A 3FI9A 3K8QA 4Q9HA 1WQ1R 2E4WA 4Y2XA 1D2EA 2FN4A 1IFXA 1PL6A 3GGCA 4Q1VA 1X9GA 4AUNA 1CEQA 2RBGA 2H2WA 2HIGA 2JFFA 4M9QA 1DO8A 4MS3A 1UFKA 4UHDA 1R0BA 1XSEA 4M0MA 4TL7A 5EMHA 1R4ZA 1NQVA 221PA 3H86A 4C2AA 2CLCX 2P77A 3L7DA 3NAGA 4DUGA 2F9MA 4AG6A 4E21A 4YMSA 1ISGA 5AW8A 4JXZA 3E8XA 1UZUA 5TQ2B 4LISA 3X1MA 1T36A 3F71A 5JDCA 1KJ9A 4EI7A 2D06A 2ZBFA 1EM8B 3PKZA 3JY6A 1JQAA 3G1UA 1SVMA 4RJ2A 3WNQA 2Z5GA 3VR4H 3MC1A 2ADFA 4DCPA 2QL5A 5EIEA 2WD7A 1KH2A 1C9EA 2XMCA 3IKVA 4J7XA 1GPBA 4ZODA 3ZXSA 4A1OA 1SZCA 4P31A 4PC2A 4YFYA 1WB4A 3ID6C 3OO0A 1W85B 3NRCA 3FLBA 3I2IA 1L7EA 1XTVA 4D0SA 1PJRA 2Y27A 4F8EA 1OXXK 5JISA 1WZ2A 2Z6UA 3DTYA 4NZ9A 4ZZ3A 1G21A 5K4HA 3F7NA 3M5WA 4LDJA 4B7CA 1S2GA 2Q2QA 3KAQA 2H3HA 4GOMD 4J1SA 1QZZA 1JJIA 4V03A 1D09A 4KMRA 3WLSA 5AJHA 2OKCA 4N47A 4BO3A 4F96A 3FBTA 4A8HA 2O1WA 2V9ZA 1QH9A 3Q7QA 4B2YA 3ZE6A 3GLIA 3HCPA 3I2YX 4PGHA 5A9TA 1XTPA 1VOTA 1J99A 2V59A 3BWXA 3VTFA 2HSJA 4RFSB 4YC7A 2CDAA 4ESEA 2RGXA 4FYXA 2IPNA 4AP9A 3LLCA 4KFUA 4XIYA 1GPH1 4X85A 3Q0IA 4Q19A 2ZR7A 3DE7X 2IPMA 4KQFA 3FDZB 4YJKA 1W75A 5KYWA 3WRYA 3QXSA 1U7UA 2IUSA 4IJWA 5IK2A 2BVNA 4G56A 5IT5A 2HA3A 2GK3A 3JZMA 2YZ7A 3E1GA 1QU2A 2WWRA 1Z0KA 1GD1O 4X92A 4ZPXA 1MTOA 1VMAA 4YPOA 2Q2NA 3MTEA 3ZGXA 3K70B 3SI7A 3IIJA 3M3PA 4RY2A 4TKLA 1ZRNA 3O2JA 4BRZA 2OP0A 4YUAA 4LY9A 4L6AA 2JGJA 2JHCA 5K45A 4X8MA 3RYFB 3DWFA 3G9QA 1HORA 5DNVA 4DLWA 1FDWA 2VYFA 2FUEA 1PU2A 1FX0B 3ACBA 1E4VA 2OHXA 3JPYA 4G2NA 4U7HA 4JGGA 1MC1A 2JA1A 3FRHA 2IYOA 3I8XA 5JD6A 4LJ7A 4ZMSA 5I9BA 3FD8A 2D8MA 1IVSA 4NCBA 1BXRA 3N39C 1HRKA 1CG6A 3BORA 3K6SB 2PGJA 4KYIB 1PZFA 3IPYA 3PK0A 2YWJA 4IZOA 5FUVA 2SHKA 1WDLA 3H2SA 4WESB 2X0NA 3ZV3A 4B79A 5CHEA 2FX2A 3VMMA 4CZ2A 3N2LA 1Z0SA 4QKQA 2ZATA 3PZRA 3PNBA 3HTXA 2Q6TA 3ZDQA 3AW9A 4WVLA 1JWAB 4LYJA 3SDBA 4QSHA 3AG6A 1U2SA 1C7QA 3CISA 5ICSA 1V11A 1V8FA 4GVXA 4WXMA 3JYLA 1GNPA 4WBNB 1MIOB 2DKNA 4GI1A 6REQA 2AYXA 4C76A 3LPCA 2F7SA 4BO6A 3QVTA 1OAAA 1TRHA 2FPGB 2PGNA 3AGPA 4GYWA 1DV2A 3CH7A 2FSFA 3DPUA 3I04A 1TAQA 4IV0A 2A14A 3IWBB 1R0KA 4I4TF 5JPCA 3KB6A 3NVKI 1XTTA 4FFDA 2TYSB 1XDWA 3M49A 2TMKA 4BYMA 1LFAA 1KBOA 1F3LA 3EQ7A 4LKOA 1CEXA 3EA0A 5ALNA 1T5IA 2TMGA 3OUZA 1FDRA 1T9BA 2WIFA 3ZY2A 4AZTA 1XQ1A 2WC1A 2YR0A 4KITB 1Y8ZA 3KXIA 1HURA 3EIUA 1DZ3A 1B1CA 1U0HC 1PQWA 3I9LA 1SBYA 2Q0HA 3L7BA 3CLHA 4G5OA 4EKYA 3A3NA 4TRJA 1OKKA 3MLBA 5KYYA 1G5FA 2AMVA 2H1WA 5AIBA 1RHKA 4BNYA 3FZQA 3GLKA 5JXJA 2AJTA 1RM3A 4TT3A 3U17A 2ZSAA 3RWBA 4FHFA 1N1DA 3RR2A 2R4TA 3N7TA 1NASA 2IDJA 5CIWA 2LCFA 1ZRHA 3AUFA 3L46A 3IULA 1K08A 4KGXA 2BFFB 2L69A 1DP4A 4YI3A 3VR6H 4RVDA 1E61A 2MSCB 4BFUA 2PZKA 2PE5A 3O8CA 4V0SA 4U7JA 1E6LA 3MTBA 4HZIA 3VNQA 4G8JA 3GBSA 4YS6A 1PL0A 2GRUA 3BFXA 1BFKA 5E9QA 3NEYA 1OLUA 1YBVA 1YC5A 3OM0A 4FNOA 2M6LA 1CJMA 4Z2AA 5B36A 2VDVE 1Z8FA 1K8YB 1C30A 2OORC 2OFWA 1KK2A 2H9IA 2QMEA 4HB2A 1SCAA 1XTBA 1U2RA 5JARA 4U5QA 5A4KA 1KY2A 5IEBA 2IV3A 5TS2A 3JD3A 1VCIA 3FDIA 4YAWA 3V5NA 1CQXA 6NULA 2QTLA 2AX3A 2D13A 2VHVA 5LCXA 3ZEAA 4BQEA 3BBPA 1ZWKA 1HL7A 4X91A 1VC2A 2OA0A 3W8RA 4MR9B 2IHYA 3SZGA 5FA8A 4D25A 1QFJA 4YO8A 1ID8A 3INTA 3H4TA 1DRUA 2RCYA 3OBBA 4R41A 1JTEA 4LW8A 4MTLA 2F3SA 4WNAB 2CZGA 1P3DA 3A2MA 1KDRA 3RRFA 1N2SA 1P72A 1W0JD 3DFUA 3GY0A 4ZT6A 1S2DA 1RDFA 2PU7A 2C4KA 3Q5DA 1M2JA 1N1MA 4FBGA 4WKOA 4CQMA 4HXEB 4AWXA 2OVFA 2ZYHA 3SS7X 4LI0A 1NN5A 2J08A 3ZY5A 4WGFA 1XF1A 1PT7A 4DJDC 4ILKA 1NOKA 3AEZA 1OWPA 4Q9NA 1GUFA 4ER7A 5BW8A 1HDOA 3TAHA 1GIAA 1B3RA 1TMOA 2H5IA 2RGAA 4P7BA 4BV2A 1G2PA 1YZNA 4A03A 3BD8A 1ZD9A 3KZNA 4BDSA 1LTQA 1JI0A 2ZDGA 3C98A 1JDBB 2A9VA 3IQIX 3KYJB 3GK3A 3UB4A 3S44A 3UICA 1DV1A 2VXOA 1RJGA 1TTQB 2AHOA 2O6HA 2BFCA 4UPDA 3IR6A 1ZGGA 4NYMQ 4L95C 4AP6A 2LIVA 1AQJA 1YS4A 4PZ9A 1HPLA 2IXTA 5CDHA 3ACCA 4E51A 1P19A 3WMWA 5LYJB 1SU4A 1SCJA 3BMCA 4AZ0B 1MRNA 2B25A 5BW4A 3L4KA 3W0LB 3VR3D 2ZUCA 4E33A 4RTRA 3GCWA 2B6HA 3FETA 1G8SA 3I8OA 4HAVA 3TXAA 4E46A 2AW3A 2IS6A 2BT4A 2ZT5A 3T7AA 4IOMA 8ATCA 2HUNA 1ONSA 3DT6A 2KBFA 3GXBA 4IIDA 4YMUA 4IDCA 1IMOA 1DAMA 4NULA 4CT4B 2WZBA 3NDRA 3TOSA 1CD5A 4UVDA 3HXLA 1RRPA 4RTLA 5G02A 1XK7A 2FSHA 3M34A 3DLHA 1U3GA 4NE7A 1P4SA 2F1RA 5EESA 1LNQA 1Y1RA 1E8DA 1XNRB 4OA5A 5JCPA 3WGQA 1PGJA 2B78A 3UC5A 3ZKWA 1JHZA 2X6QA 2YHBA 1KYIA 4ACBA 2H48A 2VYVA 5HFJA 3B48A 3EZGA 4BL5A 1C1HA 1K8XB 2BTQA 1JHAA 3VRHA 2PPLA 3Q3GE 1NXSA 2Q0SA 5IS2A 1AB6A 2YHIA 4XVRA 2J3QA 2C59A 5JTTA 2MINB 2L18A 2CUNA 1MT3A 1FIUA 3STTA 3D7KA 3TQCA 3IE0A 3TIVA 3M4ZA 1O8BA 2G9RA 3SKVA 2N1MA 1NR7A 1DZIA 1W0KA 3AI3A 4HAWA 4US0R 3JQ8B 3I01M 3AJDA 3ABZA 4CIXA 5KSOA 3MLEA 4FYHA 1Y9ZA 3IAXA 1UKVY 3KD2A 4GWGA 4FWTA 3AP3A 1OOEA 1T2CA 5JBNA 3IP1A 3CTPA 1VPVA 1BRMA 1EJ2A 2WYUA 1NJSA 1W52X 3CRVA 4G26A 3QWIA 4I4CA 4KH0A 3ORHA 4ZANA 3EX7C 2F8LA 3F6SA 1AGRA 3U3MA 3U2QA 2NQTA 5J4VA 3NUQA 4YRPA 3FIJA 3SLRA 1EUDB 2XNHA 5CD9A 3ZNOA 1IXYA 2D54A 2YHSA 1ESZA 3QWHA 3C6YA 1XU9A 4U2GA 2XB9A 3UAZA 4ARZA 2WVJA 2X42A 3U0BA 4O2BF 1KAMA 2W83A 3BJMA 4R1PA 1NLYA 2HCTA 3NTUA 1HT1E 2OZLA 4WXPA 2KBEA 4J0DA 3WJ2A 4CF7A 3CRRA 1U8UA 4FZ5A 5AVKA 1SCDA 2FN3A 1U8AA 3WGHA 2BF4A 3NHFA 1OGJA 2EZ9A 2ID8A 5B6PA 1KJQA 1G6OA 3P19A 1ZOIA 2PZAA 2RSLA 3WLIA 3KB8A 1GCOA 3QNWA 4F4UA 3Q6MA 3E4DA 3FLMA 3GN2A 2ZWPA 4II2A 3VR5A 3MJSA 3AY3A 2Q1TA 2AQIA 4CQLB 2V7WA 3V34A 1GG8A 1OSNA 2BI7A 4JKIA 1ISRA 5DYGA 4XWGA 2DH6A 1KRHA 3W9BA 5J9FA 2I66A 1EXWA 3C41J 4JUIA 4Q4JA 4EW6A 4QQNA 3IEVA 3WYDA 1VPDA 1A72A 1P33A 2WHQA 4RC9A 1ZJZA 2DWPA 4D9EA 5EQTA 4KBFA 5CDUA 5AO9A 3AESB 4UM7A 5CX1B 4ZGGA 2V0CA 4H1HA 1T8YA 4M6WA 1ECCA 3RLIA 3RNOA 4BFWA 1MP0A 3CLUC 3UEOA 1PTJC 4WFIA 3IAUA 3E7DA 3ZWQA 4E1VA 3PYMA 1G42A 2JLAA 3O95A 3O47A 4KLCA 1V1RA 3CX4A 4HWSA 4QUHA 4EHAA 1YRYE 2QT1A 1P2BA 1YB1A 3D5EA 5EPOA 3EMBA 2WFAA 3MYYA 4EABA 1M7BA 2I2CA 1L4EA 2GZRA 4L5BA 1UEJA 3NHYA 7ABPA 4N3CA 2A5GA 4G63A 1K6JA 1U80A 1NQ5A 4MQEB 5FWDA 4BMYA 2YIMA 1TQHA 4HNUA 1YDWA 1X1RA 1OIXA 4EYGA 1ADJA 3SIPA 4ZVPA 1X74A 5LM3A 1OLUB 2PUGA 2CXXA 2CMFA 3ZY6A 1MJGA 2DXIA 4BC1A 2RONA 2X8BA 4M7OA 2Q7XA 3DOIA 1F20A 5HQ3B 2GHTA 4ZOCA 3W2HA 4BE9A 1YE8A 3ZV6A 1AUOA 1ZGZA 4Y1EA 3AB3A 1JHMA 1BCRA 3W6NA 1Y7PA 4FDAA 5ALEA 4XQCA 3UATA 1YKFA 1VXRA 2NZVG 1I30A 3LL4A 2ONCA 4I8IA 4PINA 3PXGA 2PWYA 1AMNA 2IS2A 3V8EA 1ESCA 1LPOA 1LNSA 1YDGA 3ENVA 4E7PA 4W9RA 5A9SB 4URXR 4HEA1 1HFJA 1EWYA 1OF1A 3DLBA 2VUHB 3NONA 4MUEA 4EM6A 3OTHA 4LA4A 2GD2A 4EEZA 1XDZA 3EZ2A 4KEAA 3ZD8A 4DCCA 1RZ3A 4C3ZA 1X3LA 1AA9A 3RH0A 4J2HA 4Q7LA 3DP9A 1K2VN 4DHEA 1ZMOA 2CNBA 3RFCA 1H8ED 2H0RA 1AV7A 4B82A 2F90A 2AGVA 5J9GA 4GFDA 1QYIA 2JI6A 4CGYA 2YWXA 1KXZA 5IKXA 1YUNA 1ZDMA 3S3TA 3NDJA 4D4LA 4WWHA 1DEKA 3RUHA 2A0FA 5B12A 1A88A 3OUUA 4G1MB 1XAGA 3H3JA 5J2TF 4Y98A 5B7NA 1QO0D 3T3IA 4I55A 2AOVA 4ZI7B 2VEDA 4K88A 2O2CA 1GU0A 3R0ZA 5B7PA 3WHIA 3TWOA 1G2OA 2VTDA 3CE9A 1ICEA 4DRYA 2XH8A 3H2GA 4MGKR 3TJMA 3N1UA 1XVUA 3T0IA 1R4MB 1UWLA 2R6CA 4GLOA 4Q05A 1Z75A 4A73A 5MN4A 3N87A 3NHSA 1LPAB 2A58A 2A9QA 2P5TB 4FGSA 1IONA 2VTKA 3CZ5A 1TDJA 3P9KA 5IHPA 1RAHA 4J4TA 1QAOA 4P4TA 1YFZA 4UNSA 3CB4A 1JFFB 2QXUA 1B8NA 4MCHA 4R83A 4X00A 3ZS8A 3EP8B 2H11A 1KJWA 3PFIA 1V48A 3TOCA 2CSXA 2SNIE 3AZPA 4KPFC 4BTVA 3T35A 1QTQA 1WHTB 3MT9A 2CL6X 5KB3A 1BXZA 2MYPA 1CUJA 1AJEA 4Z9XA 3HLYA 3PPIA 3IUSA 5I48A 2OYSA 3AFNA 3A1TA 1AKWA 3G2IA 5FBRB 5M29A 4KX5A 4AIRA 1O6BA 1GVHA 1COWD 1JVSA 5JJ5A 3KQUA 4FFBB 3TF5A 3RVOA 1JDVA 1W96A 4V3BA 3USZA 4E0BA 1F9AA 4S3MA 1I7CB 4NFSA 2R5WA 4GHWA 3OZEA 2ZYWX 3L6UA 1AK2A 1ZBDA 5GZ3A 2JFXA 4U3JA 2Q1YA 2D0PB 5EE3A 2IXAA 1IPEA 1ZHOA 3VC7A 2FOXA 4OQLA 5ALYA 4CKCB 1KI1A 2IP2A 4QDUA 4ZEWA 5HGXA 1L7XA 2CBZA 3D54D 4L0DA 4IY1A 3EY9A 4NBRA 2FX3A 4E4YA 4AQ7A 2QA5A 1OH7A 2GZSA 2VP9A 3QF4A 1GT6A 5TR9A 1H9CA 2IL1A 1XDBA 2CHFA 3PA6A 1NVAA 3UKJA 1OFUA 3TTXA 1L8AA 3KQNA 3J80A 4NSNA 1J1ZA 4BNDB 3RYIA 1ENOA 3A1NA 4FD2A 3S1LA 3SC6A 1X1BA 2P6PA 1BOFA 3TRIA 1NW3A 1JJFA 1H2RS 1H3NA 4F4JA 3QPWA 3C4QA 1VFNA 3DEIA 5HK8A 4AG5A 1D2GA 1FCJA 3FMFA 3R4CA 2OBYA 3E9QA 4JGIA 3PR3A 4OVKA 2CCGA 4PLCA 4R01A 3S5UA 1XNQB 2W8BB 1ZI8A 3U6BA 1KP3A 3KR0A 5IBQA 1T4MA 4RAQA 2RGUA 4DR1B 2CYBA 2WNIA 2YKGA 3LCMA 4DPMA 1NSYA 2DG2A 1DIAA 2BAGA 3KQWA 4ZQGA 4PFJA 4WQMA 4H17A 2B8WA 3AP1A 3F3MA 3M5PA 3LCCA 4LVUA 4MUJA 4PHTA 4FMCF 5EJIA 4ZVLA 1KAGA 4KI7A 4QPJC 3FCOA 2MSLA 1CXZA 4H0CA 3KSDO 1DX6A 2C2GA 1K6EA 2CFRA 3RBAA 3EPAB 2V74B 1JX6A 2IKSA 3EAFA 2JNWA 4XWYA 3PS9A 3ODGA 1XBTA 3IBGA 5AESA 1UPUA 3VZQA 1B93A 3RSCA 1JV2B 1T91A 1Q7CA 3HKBA 4YJGB 2W70A 3RVRA 1B76A 2W6JA 4O2RA 1JR3D 1ZOSA 4GG1A 3KSRA 2I9PA 1CERA 2NO0A 4Y18A 2ZRGA 4CT0A 3OQMA 3ZBTA 1NWHA 1RHQA 4KO3S 1U5BA 1NMQA 3UAGA 1QHFA 3IJ5A 4Q3LA 1HNZB 1J49A 1R3UA 1W93A 2AZXA 2HPZA 2C9YA 1LK7A 1GGJA 2C04A 1PW7A 4OI2A 3M7IA 1WG8A 1RFGE 2Z04A 4GDFA 4L8LA 4LOIA 5KEIA 5K20A 3DNFA 4FUTA 1HYBA 1U0OC 2EERA 4LN1A 1MC5A 1PDVA 2YIVX 3ZHUA 4DR7B 5LVAA 2I67A 3TLKA 5FNVF 5AW5A 3KSUA 4TS9A 1AO3A 2YTZA 5U4QA 1YIOA 4JLPA 4BLWA 2QW0X 5K6AC 1DE0A 1S3GA 1WZNA 3AR9A 1JEYA 4GQBA 1SIOA 3FPFA 2CVOA 3GBVA 3DVLA 3H3FA 3HB4X 4PX2A 5CVEA 1IN5A 3ITDA 3TE6A 3NBYC 3UBTA 4F5EA 2X14A 2MIIA 1QIMA 5I4IA 1GQFA 2E5WA 4U2FA 1M2KA 4F93B 3QPAA 1Z39A 1Z8DA 4O02B 4DSTA 4J4HA 3RAEC 2GCNA 3VV2A 4XWOA 1FC0A 1O3YA 2R85A 5FI1B 1UAAA 3JVDA 3H84A 5LJLA 1YNSA 4P54A 3WNDA 2DVMA 4DF3A 4TMVA 2P6RA 3B3QA 4IDAA 2VXYA 3BXPA 4OM8A 4X84A 3AU9A 1YHNA 5DW0A 3WL8A 4DDMA 4QOEA 5CLFA 4C4YA 2BKLA 4NHOA 3WK4A 4NH4A 1GGFA 1P2GA 2W5UA 2O2YA 2Z4SA 3GLHE 5CH8A 4BKQA 3GP3A 1OH5A 1U7DA 4JAVC 3WK6A 1LJ8A 1DI0A 2MSWA 2YC4C 4LHZA 4MULA 4DW8A 3COJA 2MMCA 5E2BA 2ZGVA 4Z86A 4Q93A 4JLDA 5E9JA 3RKSA 2VL7A 3B6MA 5CCDA 2DFKB 4AROA 2AC4A 3DF9A 2ZBRA 3AV3A 4M55A 4WEQA 1R8SA 1VYVA 4DTCA 4C2UA 1USUA 3E2MA 1J9ZA 5DYYA 3FX2A 3W2TA 4C5AA 4I14A 2AJ8A 4OB8A 1QHIA 3OE4A 2XBUA 2ZCVA 4V0OA 1SWVA 4QGSA 1U6KA 1Y9EA 5AVXA 4K7JA 3M6VA 3C5HA 2DUWA 4JH0A 4N0DA 3U80A 1SXHA 3GC6A 1CYDA 2E4VA 2FR1A 1LLCA 2C2KA 4HTFB 4WN3A 4BWVA 2G5CA 2QMQA 4H0NA 4JI4B 5HW0A 9GPBA 1XDDA 1BN7A 2CVFA 2IV2X 3T9DA 1A8IA 1MAHA 2M2IA 2W71A 5IAEA 1WCYA 2BZ1A 3IUNA 2QYHA 3HDVA 2C2OA 4ZO8A 5DI3B 1GDTA 1VMKA 4Z49A 2V4MA 4CM7A 1XMVA 2QS9A 4UAUA 1XWIA 4A16A 5FX2A 5JSYA 3AEKB 2Z2YA 1WPRA 4ZOLB 1ECGA 1U0JA 3I45A 3GJTA 3NP7A 5KHAA 1X94A 3WK8A 2A8YA 3LT5A 4QO7A 5CDFE 4QLAA 2QAGC 1W49A 3DXZA 4FLEA 3HCBA 1KMCA 4OQDA 1JR4A 3ZPXA 2P78A 3FFBA 1BWQA 4DLXA 5LSAA 3ZWOA 4BO9A 3FXAA 4UM9D 1CC1S 1L5RA 3QKRA 5AUQA 3ZN2A 4UFOA 1UBRS 1RKVA 2F59A 2ODTX 3FMIA 4H08A 4MV4A 4QOSA 4EB3A 4DG5A 3ORRA 1VE3A 4FLFA 2GCGA 3LOQA 4DV6B 2Q1UA 3DEYX 1SU7A 1JNXX 3BXEA 1T5SA 4IZ6A 5KSYA 1ULHA 2XTMA 3X44A 2Q3FA 3SN6A 2VG8A 4Y9TA 3AOEC 4L4SA 3BJEA 3GAAA 2RHLA 2VNSA 2IZ5A 2PT9A 3K1AA 4RFLA 3WL3A 4YQFA 4U3JB 4GR9A 4O1MA 4JT9A 4XIJA 3KUCA 1SVSA 1NKSA 1DFIA 1V5WA 2D2VA 2YQ4A 3DQZA 3QW4B 3UY4A 1XQ6A 4CCSA 3HO8A 5AR1A 4IHJB 3PJFA 2FEKA 2P3QA 4EFNA 2PJUA 2JH9A 7REQB 5EWJA 4QFCA 1O95C 3II6X 1FRNA 4B3RB 2EP5A 3PZBA 1CZUA 2NXNA 5TARA 5KINB 1LF0A 1XT6A 4DY4A 1ZAKA 1XHFA 3CT4A 1RI3A 3CZMA 3N2GB 3WA6A 2Q6KA 2WAXA 2ZYTX 1C41A 3E2IA 3ICVA 5JH7F 4HQ0A 2J0UB 2V7EA 1T2AA 2XGSA 2ZBGA 2X5NA 5G0UA 1MU0A 1LQUA 1L5WA 3JSXA 4PYMA 4G1FA 1VCNA 1T43A 2ZWOA 2ID9A 5BT9A 2OLKA 5CCBA 2XCSB 3PT5A 3W8NA 2PSHA 2CW5A 1G8HA 4WKCA 4QUEA 5KDLA 3L1JA 1UMBA 4V1CI <