1DRUA

Escherichia coli dhpr/nadh complex
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
270
structure length
270
Chain Sequence
b'ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Interaction of pyridine nucleotide substrates with Escherichia coli dihydrodipicolinate reductase: thermodynamic and structural analysis of binary complexes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 75
structure length 270
sequence length 270
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1druA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1druA01
1VJ0A 3AOGA 4ZRNA 1PQPA 3WDSA 4M1QA 4D3FA 3RBXA 1FK8A 1LRKA 3H5AA 3HUDA 4LISA 1V8BA 3KLPX 1U4SA 2X9NA 3ORFA 5G2OA 2RCYA 1JU9A 4RF2A 5TRTA 2G5CA 1W6UA 2E4AA 3FNFA 1UR5A 3EYWA 2Q99A 5AXCA 4NPCA 3HQ4O 3TRIA 1PJQA 4M86A 3JD3A 4B7UA 1H6BA 4JQCA 3DAFA 3ZV6A 4TRRA 4A2CA 1LC3A 5KIAA 3P19A 3OA2A 3BA1A 4J43A 4NFSA 1E7RA 8ADHA 2Y1GA 4G5HA 3K6JA 2YZ7A 3JTMA 1YB5A 3ZU4A 4NJMB 3DO5A 3JYNA 4IINA 1QYCA 5THKA 4OQZA 4FPXA 4CQMA 3MJEA 1XELA 2X5OA 3KYCB 3BMQA 5K0ZA 2JKVA 3GEMA 1A9ZA 1C0LA 3H4VA 1L7EA 4ZHSA 3LU1A 2UAGA 5KOIA 3MTGA 3QA9A 2YV3A 2I99A 1SO8A 1MA0A 2V65A 1X1EA 2GLXA 1OI7A 3CZMA 3WICA 1H6DA 4BO6A 4BVAA 4XQCA 1GR0A 1KERA 2PZLA 1HYGA 3H8VA 1ISHA 3OIDA 4CLOB 1NBOA 1GY8A 1A72A 1HDRA 2JFFA 1UXHA 2EGGA 4DYVA 5BSGA 3NT2A 1HF3A 1YKFA 2RIRA 2O3JA 4RPGA 5G0WA 2HMSA 3ST7A 3BHMA 4P22A 2QRLA 2EP5A 3GZ4A 2VTDA 3GR6A 4UEJA 4OIMA 2HU2A 5I7EA 2HQ1A 3HADA 3PDUA 4I9UA 4PG4A 2AQKA 4ZVVA 2X58A 4YQYA 3ULKA 4RDHA 5ES3A 4CV1A 1Z75A 3DAPA 5G4LA 2AXQA 4NNJA 5ADHA 2FMUA 3ZWVA 4QFCA 4E30A 3C3XA 3IP1A 3WMWA 2PZJA 3GG2A 4B79A 4MP3A 4HX5A 1TT7A 1M76A 1MV8A 3KEQA 3ZHZA 2ZJ0A 5JYAA 3VZRA 2O3TA 2O3UA 3EK2A 5CG2A 1EVYA 3H2SA 5CDYA 5C7LO 1UXIA 4G65A 2X86A 2EP7A 3LLVA 4W9NA 1NVTA 5U4QA 4BO3A 3BHIA 1O5IA 3DZFA 4NK5A 4PLFA 5IZCC 2B5VA 5AXAA 3LF2A 5IFLA 4IQGA 4C7JA 2IZ1A 4YVFA 3TZ6A 3W6ZA 1KEPA 4LGVA 3QWBA 3D7LA 3ZHYA 3WQQA 4MIEA 3U62A 1VI2A 1N1EA 3LVFO 3JCZA 1ZJYA 4GMGA 2X4GA 2A92A 1L7DA 2QRKA 2IXAA 3GEGA 4TRNA 2NVBA 4BQRA 3JQ7B 3E48A 4HFNA 1DIBA 3UOGA 4XYLA 1NR7A 3GUYA 1IL0A 2H6EA 5U9CA 1CEQA 3KSDO 2X23A 4PG5A 5DNAA 1M66A 3BXXA 4GBJA 3I23A 1PR9A 1J6UA 2XPCA 1R16A 3OEWA 2FSSA 1U5CA 4LMPA 4F46A 3VPHA 1ML3A 5B1YA 3FTNA 4ZQHA 2AW5A 4J1NA 1R66A 2Y1CA 4MVJI 1DIGA 3OF2A 4D3DA 3AUAA 2O3SA 1HZJA 1A7KA 4ALNA 4LVUA 1GV1A 4BNLA 5L9AA 3L9WA 7MDHA 3PXXA 4FB5A 2B4RO 1OMOA 4MVJF 1YQDA 5BQFA 3C1TA 3ZGYA 4NH4A 4XCVA 3W8FA 4WE3A 4BKQA 4IJUA 2GN6A 1Y81A 2I66A 5G0VA 2PTGA 5HBRA 3AFNA 5JDCC 1XKQA 2Q1UA 2YDXA 4CLDA 3GVIA 3D4NA 3DL2A 4CLXA 4WCFB 5KVQA 4PVDA 2Q22A 1J49A 1Z73A 1PQUA 2VWHA 3NV9A 1K3TA 3K92A 3U4IA 5JAZA 3P2YA 1ZSVA 2O7SA 3HSKA 1X7HA 3G17A 4R9RA 1X7DA 4QO7A 3TF5A 4GLOA 3O38A 3PEFA 1LUAA 4BO8A 2J8ZA 3ENKA 1WXDA 2F00A 3EAGA 3OMLA 1K2WA 3UCXA 1Y1PA 4EI2A 3I52A 3KBOA 2PGJA 5COQA 3RFTA 4N18A 4EJMA 2YJZA 5AXBA 3RKUA 1BW9B 1ISFA 1XLTA 3TZHA 4DGSA 2WM3A 2VOEA 5DN9A 4FS3A 3G3EA 3CE6A 1NR1A 3G1UA 5F5NA 4O5OA 5AVOA 1XQ1A 3F4BA 1V35A 1HKUA 4YAGA 1H2HA 4BO0A 1TLTA 2P4QA 4L4RA 3ETEA 4AJNA 2IYOA 5L40A 3EGOA 4J1QA 1Q7BA 1FDWA 4DTIA 1Y9EA 1PQWA 4E3ZA 4BIIA 5JYFA 3SC4A 3Q2IA 2CVQA 3CTMA 1H2BA 3JD0A 2EW8A 1ZK2A 3KXDA 5HS6A 1A9YA 2VOJA 4LMRA 2A35A 1RJWA 1DFHA 1ZXLA 1DC5A 2HK7A 4O63O 3JQ9C 3DHEA 1MG5A 4YEDA 1WZEA 1E3EA 1PX0A 2EXXA 1E3WA 1HL3A 1I3MA 2DUWA 4ZQBA 2C54A 1UXKA 4PVCA 1IE3A 1IZ0A 3UVEA 1V3VA 4YT4A 3GLQA 4MPDA 3CMMA 1ID1A 2CZCA 4EITA 2EV9A 3K30A 1YBVA 2QIOA 5L7YA 1JTVA 3GOHA 1QYVA 4E21A 1E7QA 1K6XA 3Q2KA 1Z82A 4CMKA 4OSOA 3DZJA 4NI5A 4B3IA 4ALJA 5JY1A 1I3LA 1BXZA 2NTJA 4ND2A 3WXBA 5C7IO 2V6GA 2X0NA 3K5PA 3F46A 3KOUA 4ZGWA 2X9VA 1LSSA 5DP2A 5EQFA 1MX3A 3SJUA 2OP0A 2VUTA 2JAPA 1JWAB 4IS3A 1UXJA 3NYWA 3B1KA 3WGGA 1ZK4A 1QORA 2GERA 5TIIA 1JA9A 2J5KA 4BNKA 2JJYA 4CM8B 3E03A 3WJ7A 4BO2A 5I7FA 3HWRA 3MJTA 4TSKA 3FPCA 1KEWA 5ER9A 1DRUA 1YH3A 3LC2O 2O48X 2AQIA 2ZYDA 2Q2QA 4P4LA 4CQLB 3VZQA 3NTQA 3F9IA 4N7RA 4BS9A 4I5GA 4A7PA 4D7AA 2Y0DA 3FWNA 5GMOA 3VZPA 4E2ZA 4E6PA 5IJZA 3PQFA 1AN9A 1H5QA 2C7GA 3MCVA 4NK4A 1UP7A 1TB4A 1I0ZA 2G0TA 3JQAD 4OH1A 1NTOA 2Y68A 2CDBA 2B5WA 2YHUA 4PLGA 3E5RA 1CDOA 2YDYA 1ENOA 1U2DA 2FP4A 4L8VA 1LLQA 3QVXA 3OSUA 5IAAA 1XR3A 5JCXA 2FR8A 1VJTA 5DOZA 3HJAA 5DOVA 3QIVA 3IS3A 3DC2A 3WSVA 3X2FA 4BNIA 3ENNA 1EFLA 3TN7A 2PY6A 1JN0A 3CMCO 3GA0A 4RVUA 3BMOA 4DPKA 4WNIA 4BNZA 5A3VA 4OQYA 1SZJG 1WDKA 2PLAA 2B36A 3OJLA 2OL4A 4AL4A 5BSFA 3VTFA 2JCYA 2EEZA 3GC6A 3JD2A 3VDRA 4IGEA 1U3WA 3EZYA 1DO8A 3FBTA 2GD1O 4YJGA 3WB9A 1YQGA 3H3JA 1U3UA 4GI2A 3S8MA 3HN7A 4D45A 4IZIA 3GHYA 4DRYA 4JN6B 5ILGA 2DLDA 2OBYA 3ICCA 2O2YA 3BMNA 3WTCA 3RC7A 1LRLA 2HMVA 5JC1A 4R68A 2B35A 1GTMA 1LBEA 3NGXA 1EQ2A 4W99A 2BF7A 4BNJA 5CAEA 1NFRA 2Q2WA 2D1YA 3I9LA 3FR7A 2G1UA 2Y0CA 3H7AA 4IDGA 2FR0A 3EMKA 1LA2A 2XXJA 1VSUA 1F06A 2HK8A 3ZWAA 6ADHA 1TXGA 4FQ8A 1B7GO 3QP9A 3Q0EA 3WGZA 4KTVE 2P5YA 2YFHA 1LLDA 5KKCA 2C82A 3B1FA 5CG1A 1ONOA 2G17A 5L45A 1GUZA 4RVFA 3TJRA 4YRAA 4M49A 3GDOA 1T24A 2IEBA 4RF5A 3GGGA 2NQ8A 1VJ1A 4EBFA 5TGDA 4HUJA 1K6JA 4Y67A 3JQGB 2ILTA 5KWEA 3QY9A 4KWIA 1DC4A 3ONEA 4XX0A 1GU7A 1PWXA 4B8WA 2X5KO 4K28A 4L76A 3WGIA 4NBWA 1KOLA 1GQYA 3U0BA 3S1LA 3VKUA 4XYEA 2I5PO 1UP4A 3NTOA 1N5DA 1T2FA 3GH3A 3PIIA 1FDVA 3GQVA 4MVJP 4NJMA 2JD2A 2BKAA 1ENZA 1UAYA 4QT0A 4R1UA 4ZA2A 3NAQA 4XGNA 3GVPA 2DKNA 4NU5A 5A9SA 4DBVO 4Y6PA 3KYCA 3PFWO 4B4UA 2JFHA 4I1IA 4ALKA 1TEHA 4AJ4A 3LT4A 3C7CB 4BKPA 4PZDA 1QYDA 1Z45A 4ONEA 4E0BA 1Y8QB 4PCVA 5F1OA 2IZ0A 3WWYA 4HNHA 4ZQFA 5JE8A 1NQTA 1UXGA 2H5LA 1ZK0A 2VT3A 2GGSA 5TT1A 4CLOA 5FWNA 3JQBA 3LLSA 1ZK1A 3N74A 1R4MB 5EL0A 3TSCA 1C14A 5JW6A 4TMFA 2Z1NA 3RUAA 3M1LA 1VC2A 2OBNA 4LCJA 3H5NA 1MUUA 4YDRA 4II2A 1E5LA 1PGOA 5IG2A 1N1GA 1H6AA 3PQDA 4RF3A 1Q7CA 3W1VA 5IN5A 3OJFA 3JD4A 3CXRA 4YT2A 2FZWA 4NBVA 1BSVA 1PL7A 2VHZA 4JBHA 5K6AA 2WDZA 4H7PA 1WZIA 1M2WA 3E6AA 3V1YA 2DTDA 3T4EA 2W8ZA 4IBOA 5KJFA 3ZH2A 3RI3A 4RPJA 4IDAA 2P9GA 2PZMA 4NR0A 4XDZA 5GY7A 4A73A 5JAQA 3HFGA 1PR3A 4QECA 1YGYA 3MJVA 5TNXA 3V2GA 2IYPA 2R6JA 3I9NA 4OM8A 5CEEA 4YR9A 2E49A 4GX5A 1L1FA 2RAFA 3KVOA 2ZCUA 2DTXA 5T67A 4IMRA 3RUHA 2POQX 4XB1A 3WGQA 1IUKA 1O0SA 3RIHA 1EBFA 2WD7B 4N5LA 5A5EA 3CEAA 1C1XA 1FJHA 1I01A 1PS0A 6LDHA 1IOLA 1VRWA 1DRVA 2XAAA 5COBA 1BMDA 4FFRA 1HDGO 1VE9A 1N7HA 4WNCA 4J9VA 4B4VA 1ZUD1 1HDXA 4A10A 4PG7A 3A14A 4GAEA 3MOIA 3P5SA 4L9RA 1YS4A 2C2XA 2CMDA 3NDIA 4J49A 1KIFA 3EVNA 3B20A 1WW8A 2Y1DA 4RGBA 4P4NA 4L73A 3GY0A 2LDBA 1ZMOA 2D3TA 2EW2A 4I5EA 1PGNA 2CDAA 1EZ4A 3GNSA 1NQAO 3RKRA 4CL3A 1Z7EA 2GN9A 1FDUA 1KS9A 3AM5A 4QSMA 3L6DA 2CF5A 1UJMA 2C07A 1T4BA 4J0FA 5TJHA 1LSJA 4CUZA 3NGLA 2V6BA 2W2LD 3MJSA 4MOWA 2FPGA 3BHJA 2VWQA 3GG9A 2ET6A 5TX7A 4CL8A 3UKOA 4YJDA 1KC3A 1O9BA 2QYSA 3I5MA 4ND3A 3VZSA 1YXMA 2PKRA 5B4VA 4XB2A 2EF1A 4ILKA 2BGMA 4WCFC 3U49A 4MO2A 1UDBA 2J6IA 1HYHA 3AY7A 2PV7A 1HZZA 4NDNE 4UREA 2J3IA 4UVEA 3RU7A 2PGDA 2I6TA 3LT1A 3GVCA 1P77A 1Z74A 3A06A 3KM0A 3DBHB 4BV8A 5JYDA 3U5TA 3FHLA 1SC6A 1B3BA 3AK4A 4TVBA 4WCFA 1HETA 3V2HA 1A5ZA 1YBMA 4AJIA 1ZCJA 1QRRA 2VYND 1VL0A 3CH6A 4FC7A 1GPDG 5EIOA 4JGBA 2PH5A 2VYVA 1LQUA 3PZBA 1F8GA 2YHIB 1U7HA 2VZ9A 2W98A 2HSDA 2NU9A 1M67A 4J4BA 2VWGA 2QHXA 1ZSNA 5HS4A 2ZQZA 1U28A 5JMWA 1DIHA 3GDFA 4HFJA 2W2KB 3JQAB 2EKLA 5BNIA 4BGIA 1P31A 2BFPA 1R4NA 1CQJA 1E6UA 4WLOA 3CSDA 4MVJE 4E12A 2VUSA 3UXYA 2VRBA 2W4QA 5J23A 3O26A 3GNQA 4RL6A 1EVIA 3VVBA 4AVYA 4WASA 3IQDB 4FCCA 3HDQA 4ESOA 3IJRA 3AUTA 1FDTA 2OHXA 5H83A 5F1KA 3KYDB 3TZCA 3JYLA 4HFMA 3PWZA 3L6OO 3SX2A 4BNVA 1BDMA 3K31A 5JSFA 2P4HX 4R01A 3C7DB 1ONPA 1Y8RB 5AOVA 3ZW8A 2IXBA 3SC6A 2YV2A 1RPNA 5LDHA 4QXMA 1DJNA 3RBVA 4NBUA 4WOKA 4LVCA 1RM4A 1ZIDA 5AYVA 3I3OA 4JP3A 4RDIA 1IZ9A 2PD6A 3WNQA 2GN4A 1G6KA 3NT5A 4M55A 2VT2A 3D4PA 1ARZA 1NQ5A 1T2DA 1HXHA 5DDIP 2VUUA 1ENYA 1CYDA 3O8QB 3KB6A 1Y5RA 3PHJA 1X13A 3GEDA 3E82A 3JQEA 2ZATA 4RVHA 9LDBA 1XCBA 1SMKA 4FFPA 5I7SA 1GZ6A 4CM6A 2Q4EA 3AY6A 2VYNA 2X0JA 4XIJA 1K0UA 1Q0HA 1N2SA 1B14A 2ZTUA 4IPTA 3W4JA 1SOWA 4KDEA 1UH5A 1D7OA 2P5UA 4GSKA 3NX4A 1Q0QA 2JCXA 4MVJM 4CMBA 1CIVA 1YL6A 4CM9A 1E92A 3DOCA 1O8CA 3AU9A 3PYXA 4XD2A 5IN4A 2C5EA 2PNFA 4AJKA 3OJOA 1D4FA 2DFDA 1EDOA 2FWMX 2QRJA 3ANNA 3F3SA 3C85A 4E31A 1CJCA 4WJZA 3Q11A 2B83A 2Q1TA 1XU9A 4LW8A 1JAXA 1KETA 3JQ6A 1UAGA 1ZXBA 1J5PA 1Q2XA 5JYEA 4JXKA 4WK6A 1O89A 4N5MA 1W8DA 3SVTA 4CM8A 1C0PA 1Y9AA 1JLLA 1ZKMA 3PGJA 1ZJZA 4TWRA 1DB3A 4CUKA 3PLNA 1BHSA 4MJLA 2VRCD 1GFSA 1YWGO 2C59A 1P0FA 1EVZA 4BGVA 4Z6KA 4CQLA 2ZK7A 4R51A 3QWHA 1MFPA 2EIHA 2NU6A 3F1LA 3KZVA 3NJ4A 3HE3A 4U0KA 1B0AA 3WJAA 3JQ8B 2QZ9A 1GEGA 2GR9A 2EERA 1UZMA 1X0XA 1LU9A 4YRBA 3OHSX 3RVDA 1QXSA 1E7SA 3QQPA 4PIVA 3DEYX 4R1SA 2Y93A 3ZWWA 5IZCA 3F5SA 4FJ0A 2GO1A 3DTTA 4NBTA 1UDAA 2JAHA 4CLRB 3PHIA 1GUYA 1KVQA 4IJKA 1E3SA 3VTZA 3UAGA 2B4TO 4XZ3A 2NWQA 2P68A 2XOXA 4EEXA 4WGGA 5CDGA 1QP8A 2Z1MA 3FNGA 4CMJA 3D4OA 4LSMA 5B4UA 2DPGA 1N7GA 3AWDA 2QYTA 5AQ1A 1T26A 3WMXA 2DC1A 4CM5A 1YO6A 1XHLA 2IDZA 1X1TA 3ZWXA 4J4HA 4BMNA 3ZU5A 1K5HA 1XDWA 5JO0A 3UH1A 4BNNA 4Q3EA 1HLPA 1PGJA 2X1HA 4IDBA 1HSOA 3TPCA 4YAKA 1P9LA 1F17A 2C0CA 3H6KA 5JAMA 3LC7O 1CETA 1HDZA 4BNHA 1EEHA 1W0CA 4O0LA 3ONFA 3H9UA 2CDCA 4S1VA 5CFZA 3DBRB 2VRCA 3NEPX 3RWBA 2O7QA 2OUIA 1VKOA 4ND5A 2RHRA 4J4TA 5DT9A 2V6MA 4L4SA 3W8EA 3W6UA 4PLZA 2ZKLA 4FR5A 1W4ZA 3OFSA 3MJ4A 3WNVA 5L4SA 3U9LA 2AA3A 3WWZA 1WMBA 4HADA 3QWAA 5H82A 2PKQP 1P45A 4IDCA 4WUVA 1U1IA 4FW8A 2JCVA 3Q9UA 3TZKA 1PL6A 4QX6A 1QMGA 2NU8A 4OKIA 4AJPA 5JDCA 2I65A 1P1JA 1E0DA 5DCYA 1JKJA 4E32A 2QZZA 4BO7A 2Q49A 1P33A 3VKVA 4CLHA 1B15A 3HHPA 2SCUA 4I9NA 4IQ0A 1PL8A 1LSUA 1KVRA 4GX2A 4D44A 4BMSA 4KWHA 2NQTA 4DWVA 4F6LA 2HAEA 5JLAA 4DC0A 4BNYA 1YL7A 1J0XO 2Q46A 4M89A 2ZJ1A 1B2LA 5ITVA 3E9NA 1QYWA 3TL2A 5T57A 1PS9A 3IUPA 3GDGA 2Y1EA 4C7KA 4RPLA 3AJRA 1P74A 2AE1A 4WPGA 4OOFA 3RUFA 2DBZA 4K9DA 4MP8A 1DXYA 5CP8A 4A27A 4BKRA 2G82A 1K89A 1PJCA 2OP1A 3BYZA 2FPPA 4GKVA 2JFGA 1OBFO 1GQQA 1WLYA 1W73A 3WGOA 4CV2A 4YYZA 3GMSA 1PTJA 3LSYA 1GQ2A 3LT2A 3MJCA 5TJ9A 2AMFA 2AG8A 4EEZA 1FF9A 1PZFA 4RZHA 5U1PA 3EUWA 2EKQA 1ZFNA 4UAGA 4W7HA 2O2SA 3PYLA 2AQHA 4HXYA 4AJEA 1Y8QA 1N92A 2P9EA 3BIOA 2XXBA 4CMHA 1LQTA 4E13A 1ZH8A 3H9QA 1U4OA 3ZNPA 4YT8A 2UUPA 3OP4A 1B3RA 2FHSA 5I9LA 4MIOA 3ZW9A 3GAFA 1Q7GA 1R4MA 1ISMA 4FFLA 2AEJA 3R6DA 4OMUA 4JIGA 1P1RA 3T7EA 1E3LA 5JDIC 3D3WA 1YVEI 2UYYA 2RBEA 1FXSA 1NFQA 1V6AA 4INAA 3JQ9A 4AJHA 4PG6A 2Y0EA 1ADGA 5KJCA 4XA8A 4CV0A 4KTTE 4Q3NA 4GX0A 1E1KA 5FYDA 5JNLA 3QW2A 4R9SA 3M2TA 4HP8A 3EC7A 4OYRA 2PK3A 4WLUA 1C0IA 4HV4A 5DBIA 5L51A 3LYLA 1F0YA 5EMHA 5DP1A 3UHAA 4JJGA 4WLFA 3I9MA 4K6CA 1RM0A 4KMSA 3WIEA 3KTDA 3PHLA 4ZU3A 1YJQA 3AUSA 3BMCB 4YJHB 3FCOA 3ZI0A 3KV3O 3ZWBA 4BNXA 4FJ1A 3ICPA 1VPDA 4NG5A 1MFZA 4MDHA 1LDBA 1YONA 2BI8A 3LQFA 4QQRA 1AE1A 1QLHA 5LC1A 5CEJA 4FJ2A 1PZEA 1E7YA 3EZLA 5G0SA 3ZNOA 2PFGA 2WD7A 1BG6A 2DVMA 5EESA 3PLRA 4OGWA 1NFFA 2CD9A 2DBQA 2VHYA 1BRMA 1TT5A 2IE0A 3TWOA 1A4IA 1NM5A 2JD1A 3RUEA 1BXGB 2GN8A 1KYQA 1MXHA 2YQ5A 3WQSB 1T2EA 1DFIA 1U8FO 3GK3A 2BFAA 4GMFA 1QKIA 2DU8A 1BXKA 1TA4A 1R37A 3U09A 2YFQA 3FR8A 1DLIA 3QWFA 1NVGA 3GGOA 2NTVA 4ROSA 3I1JA 4Q3AA 5C7OO 3OM9A 1KEUA 3L4BC 4E2XA 4HKTA 4R3NA 1C0KA 4CR8A 2ZB7A 3S55A 4I9HA 2ZYGA 5C3MA 4EJ0A 3PZRA 1NPYA 2Q50A 4QTZA 3GZNB 3SEFA 5F1PA 2Y67A 3CPSA 4R5MA 1LDYA 1I10A 4PLPA 1NQOA 4J6FA 4DLAA 2FR1A 1IPFA 2J3JA 2E6UX 4PZCA 1P44A 4XYGA 3X2EA 5IZ4A 1BGVA 3DBHA 2WTBA 1P1IA 1G0NA 4XKJA 3IC5A 4MKRA 2FN7A 3ZWYA 3MOGA 4LRTB 4DUPA 5B37A 3D3EA 1D1SA 3F1KA 5L4NA 3UICA 3ZHXA 2JD0A 3IUSA 1DAPA 4ND1A 5T73A 2O23A 3DFUA 1I33A 1S7CA 4BQPA 2YHIA 1AXGA 4YWJA 2VHWA 3Q9NA 5IDQA 1ZVMA 3H2ZA 3QWIA 5DZSA 3ZWPA 2DPHA 3DONA 1SEVA 1GCUA 5A1TA 1BVRA 2A94A 1PWZA 4RZIA 1SNYA 1ZK3A 3FD8A 1EK6A 5KJ1A 5LCXA 4BOYA 2CY0A 5CEFA 3PWKA 2D8AA 1YOVA 2W2KA 3JQAA 4U0JA 1M6HA 1CF2O 3HFSA 4QEDA 1YB1A 3DZIA 5JPIA 1P1KA 4FN4A 4Z9YA 3FNEA 1UUFA 2AEMA 3C24A 4IQ8A 3NDRA 2R2GA 1U7TA 4BO1A 2NSDA 2QQ5A 2V6FA 1GZ3A 3KYDA 5ENVA 5BNFA 4A0SA 1C1DB 1U5AA 2NADA 3OEYA 1MC4A 3L07A 4B4WA 5TF4A 1DSSG 4R3WA 1Y8RA 3B70A 3C7AA 3FSRA 4GLLA 5EPOA 2PGLA 3B6ZA 1HYEA 4CMEC 2WEKA 3GGPA 3S2GA 1HEUA 1MG0A 3DR3A 2PD4A 5I8ZA 3MWDB 4F3YA 1LJ8A 5L3ZA 5KKAA 4NZ9A 1JKIA 1PU2A 1DRWA 3TQHA 2J3HA 4KUGA 3QVSA 1EFKA 5EINA 2PD3A 3WQRA 4DBZA 3GFGA 3OECA 4IXTA 5CDSA 2C29D 5IDXA 3PGXA 3GFBA 4IDFA 4Z0HO 3V8BA 4PN3A 1O95A 4K1LA 1A27A 1PGPA 3FN4A 1WP4A 3VC7A 4FSHA 3V5NA 4FDAA 5HWSA 2WMDA 2WYUA 5BR7A 1MC5A 3SLKA 4U7WA 3GT0A 3GAZA 1DJQA 3OIGA 1HSZA 2BMAA 3PIDA 4CM4B 4TZTA 2FY8A 4OOEA 4OKNA 1IB6A 2HRZA 3VPXA 4J1SA 1XA0A 1PJBA 2WE8A 1NAIA 3W4KA 4PG8A 4JJFA 1NHWA 5GZ3A 4ITUA 1XU7A 4WLEA 4GVXA 3UCFA 1JVSA 1RWBA 1AHIA 4EW6A 4R5HA 1YDEA 3CKYA 5JS6A 1GEEA 3TNLA 4D43A 1OZAA 1NASA 5MDHA 3JQFC 3RUDA 1PEDA 2Y1OA 1CQIA 3DTYA 3OIFA 3AM4A 5L4LA 2J5RA 4RF4A 4CJXA 2AE2A 4J3FA 3G0OA 1E3WB 2XF8A 4KDFA 4C4OA 3RJ5A 1KVSA 3OA0A 3AOEC 2TMGA 1YL5A 2AHRA 2JHGA 2DQ4A 1EUZA 3JV7A 4HFRA 5EJ2A 1DOHA 2X0RA 1QV6A 3I9JA 3E9MA 4GPD1 4U5QA 2ZIZA 2HCTA 3AOEA 5JCJD 4TKLA 1KVUA 4B8ZA 2HDHA 3OQBA 3NTRA 1HE4A 2VNSA 3UGKA 4HWKA 3PHGA 4A03A 4IJWA 3ONDA 3UN1A 1B8PA 3W4IA 4OJNA 4HNGA 2CF6A 3U4HA 2BH9A 4BKOA 1JVBA 5JXWA 1GYRA 1IHYA 4KZPA 4CLRA 3JQ7A 3M6IA 5ER6A 2D2IA 2LDXA 4LRSB 4BB6A 2VHVA 1E1NA 1SBYA 5DULA 5A4DA 1E77A 1ZEMA 3LF1A 4Z9FA 1GL3A 2BGKA 4F6CA 3WYBA 3ABIA 1HDOA 4FGWA 5DBGA 1Q1NA 2DFVA 3U4CA 4CMCA 3NKLA 4CODB 4MVJD 1AUPA 4OXNA 2BFMA 2HJSA 4GH5A 4G81A 3DOJA 4BV9A 4NJOA 2D59A 4CMGA 4WEOA 2BRUA 3GUCA 4L74A 3LC1O 1SEPA 2UVDA 1PS8A 4W6ZA 1DEHA 3VPSA 1VSVA 2Q3EA 1EBUA 3DHYA 4IGFA 4BO5A 1VL6A 5JFOA 3Q6IA 4YJFB 4BNTA 3IL2A 3PQEA 1P0CA 1ZW1A 1I2CA 1UZNA 4YB8A 3DWFA 4ZQEA 4JLWA 2GZ3A 4NIMA 3GVXA 2YYYA 3PJGA 5EERA 2PZKA 1RKXA 3DOOA 4UVDA 1DIAA 2B4QA 2DAPA 4J90A 1YRLA 3DDNA 3NRCA 4J2HA 4RCVA 5F5LA 4P8RA 3M1AA 3ANMA 2R00C 2Z5LA 3WYEA 3O4RA 1X0VA 3NDJA 2NM0A 3GPIA 4MVJH 3I6IA 4E2YA 3T7CA 3RFVA 3N7UA 3E8XA 4JP2A 2X5JO 3DMTC 3I9KA 5F3RA 5L7TA 3JD1A 4J7UA 4G2NA 5IF3A 4LSWA 4NU6A 3V1UA 3WGHA 3BMOB 1P1FA 1Y7TA 3QE3A 2HJRA 3OICA 1UZLA 4O6VA 4Q39A 2GPTA 2GUGA 5KNLA 5T8KC 5DCWA 4HY3A 4JX8A 4U8GA 4YJGB 4ZN6A 2WSBA 5A06A 1ISGA 2WE7A 1YJ8A 4PRLA 4ND4A 2ZQYA 3SJ7A 4DMMA 1ZSYA 1NYTA 5T8KA 3ZNNA 1IHXA 1LC0A 2PH3A 2HK9A 1GD1O 2YY7A 3RAJA 3BMNB 2W90A 5C37A 4OSPA 4CMAA 1BW9A 1HRDA 4KUHA 1U8XX 3D64A 1EUDA 1WNTA 4GGOA 4PLTA 4Q3CA 4YPOA 1PZHA 3UW3A 3DBVO 3QLJA 3ITDA 3PRJA 1VKNA 4NQZA 1LDEA 2UDPA 2NV6A 4UEOA 4CR7A 3F5QA 4CMIB 1N9GB 5M6DA 2W2LA 3LK7A 4UUNA 5GZ6A 1SOVA 4MKZA 2B0JA 3IP3A 1FDSA 3R0IA 4JNKA 4BO9A 3AI2A 5JC8A 2P91A 2ZB4A 4PLVA 4W4TA 3LDHA 3DXFA 1GAEO 1X7GA 4PRKA 4Y6SA 1F8FA 1VM6A 1JW9B 3KYBA 4FOOA 5H81A 1LEHA 2YV1A 3PJEA 4UEKA 1ZMTA 1ULSA 3E5MA 1X15A 1TVEA 1LLUA 2OFPA 4EZBA 1WVGA 3QJ5A 4XJTA 3B1JA 1YBAA 4D46A 2BLLA 1B26A 3BTUA 4AICA 1O94A 4E4YA 1V9LA 4TKMA 3HNPA 3FTPA 1XEAA 3RSHA 1IYZA 1DFGA 2QW8A 2Y05A 2ZB3A 4BNWA 2P2SA 5KJ6A 4RVSA 2DBVO 3TFQA 5G0UA 2H9IA 3IMFA 3JQDA 2IRWA 1ORRA 3DZBA 1ADFA 1PJSA 2WJPA 5A9SB 1IY8A 5GZ1A 3ROKA 2Y1FA 3INGA 3D5TA 3AUUA 4PLHA 4XQ9A 1GUFA 4BHTA 2E48A 1J4AA 2CSUA 4E5NA 4R16A 1E1MA 5JY6A 3ZNQA 2O4CA 5L53A 3FWZA 3K2EA 4DIFA 1IULA 5IXSA 1PJTA 2O4UX 2HRBA 3AI3A 4IXWA 2DUUA 3RC1A 1NNUA 5F21A 2VZ0A 1T2CA 3L6EA 3ZWCA 4RV9A 1E3JA 3BMCA 4YJHA 4XDYA 4YACA 4ZICA 1T1SA 3KLMX 3R3JA 3RROA 3AI1A 1ZO8A 2EJVA 2C20A 3DAGA 3JYQA 4W82A 4BNGA 1KBZA 1X14A 3WOHA 1V3TA 1PJ3A 4YAIA 4QO8A 3PDJA 4K6FA 1QG6A 1NP3A 3DBLB 3MWEB 4DQXA 4YAEA 3FBGA 4JBIA 1BTOA 2RH8A 3FNHA 2TMDA 2NVWA 1DC6A 5ITWA 2ZB8A 3PYMA 4I5FA 4OO3A 4W9NC 2WYVA 1NX6A 8LDHA 1BXGA 4NFHA 3RUCA 1R0SA 1PGQA 2NVUB 4KP7A 4BGEA 1E6WA 2GCGA 4J16A 2IODA 3CUKA 1P3DA 3WYCA 4PLWA 4TVOA 4FC6A 1GDHA 1XSEA 1D1TA 4RQUA 3DFZA 3U3XA 4WOJA 4DPMA 4FOSA 2AG5A 3NJ8A 5TS3A 3WS7A 4D3SA 1QSGA 3I83A 5KVSA 2Q1SA 4J91A 1WDLA 1ULUA 4DPLA 3DMYA 2GZ1A 3KRTA 4D41A 3PP8A 5KCZA 1WAMA 3TL3A 1C1XB 3FF4A 4HBGA 2I3GA 1U3TA 2CUKA 3UF0A 1ZEJA 1KY4A 3GZNA 1EMDA 2HLPA 5B12A 1D8AA 4E5PA 3WLEA 1LRJA 4L0QA 3ASVA 1I8TA 1YB4A 3TDKA 3COSA 4AJLA 2Q45A 3GVHA 1SPXA 2X7HA 3JSAA 1XQ6A 4RJTA 4J7CA 3PK0A 4CPDA 3K2BA 5FI3A 3G79A 4E2WA 3ZV3A 4PZEA 3PPIA 3A4VA 4UUPA 4XQEA 4IY1A 4S3MA 2CVOA 3HG7A 4UVHA 5AXDA 2DM6A 4R1NA 2NACA 1WPQA 5G4KB 2EGHA 4DVJA 3RFXA 4R1TA 1EQUA 3VH1A 4BNFA 1DDOA 4IM7A 4JK3A 1EE2A 1DPGA 3RD5A 4AJJA 4L75A 2CFCA 3STHA 1YQXA 1NWCA 3K73O 4CR6A 2PWZA 3LZ6A 2X8LA 4Y9DA 4EUEA 3IAHA 3NT4A 1NVMB 3MZ0A 1ADCA 3A1NA 4XEHA 1I3NA 3WLFA 1AHHA 4DL9A 4B3JA 2UUOA 2OOSA 1XG5A 1PJLA 3WSWA 2J3KA 3BTSA 4GX1A 1BWSA 3ZV4A 3ZU2A 2IEDA 3UCEA 1C1DA 1IPEA 3OH8A 4YA6A 2QG4A 1PIWA 4JBGA 3JQGA 1G0OA 4RLSA 1ONNA 1EE9A 2I9PA 3K9QO 2V7PA 4WEQA 4XYMA 2OZPA 4D79A 1Z7BA 4MP6A 3OBBA 2Q4BA 1ZBQA 1F14A 5A03A 3ZDFA 3AW9A 4O1MA 4TRMA 3KO8A 5CDTA 4WECA 2ZTMA 4CV3A 5TT0A 2YQ4A 3MEQA 4FFOA 1MXFA 3CZRA 1XWFA 4CLEA 4IJVA 5DBFA 2YUTA 5CHEA 1ISIA 2FZEA 5A04A 4Z0TA 1H94A 1R4NB 3CINA 4GQAA 3ETGA 3ON5A 3AY3A 4BB5A 4I8XA 4OXYA 3HB4X 3JYOA 2NTNA 3I4FA 4IS2A 5CPFA 3BAZA 2IZZA 3GMDA 4JJIA 1NWHA 2OORA 3WX0A 1V0JA 4P4GA 2A9FA 4FGSA 1VL8A 1I2BA 1GADO 4RPKA 3SXPA 4CM4A 1NAHA 4QUKA 4ZJUA 5I9NA 3ZWOA 1PZGA 5DF1A 4XR9A 2I67A 1OC2A 4DYDA 2X9GA 2VTEA 4DXHA 2JL1A 3WG9A 3ZCXA 1N8KA 4CM7A 3DB2A 1KEVA 1JKFA 2JHFA 2PA3A 4H15A 3BTOA 4J1TA 3N58A 4PFJA 5TC4A 1NHGA 3S2EA 1RYEA 3VDQA 2B69A 5CDUA 2H1SA 3GPDG 3M2PA 4XIYA 5JDIA 2GNAA 4CQMB 4U6QA 5I8WA 1A4UA 3BMQB 1I24A 1WWKA 4P38A 2Q2VA 3L9XA 2C2YA 4DA9A 4TRJA 4RPHA 1CERA 2VNAA 1I30A 4GVLA 1B16A 2DBRA 4OHUA 5I7VA 4GKBA 1LDMA 3VVCA 4MKXA 3INRA 3VH3A 2BELA 4Z9XA 3QHAA 2PR2A 5G0TA 3H9JA 2VCYA 2X6TA 4TZKA 3BZUA 1H9AA 3RJ9A 2D4AA 5IDWA 4EGFA 2FSVA 3FI9A 3K8ZA 3ZV5A 3I4CA 4M87A 5TQVA 5A02A 3HN2A 1DLJA 4M8SA 4JCOA 1T4DA 4Z0PA 2GF2A 4Q9NA 1ADBA 1DAOA 1GYPA 1H0KA 4FFMA 4AFNA 5A9TA 1HE5A 2P9CA 3A28A 5COAA 1T2AA 3G49A 2AEFA 3RASA 2WD8A 5TSDA 3PTZA 3RBZA 5BSEA 5CPBA 3QV1A 3RUIA 3C1OA 4O59O 1U2GA 3EHEA 1P1HA 3AM3A 2I76A 2QX7A 4XGKA 1KC1A 4R69A 4R41A 3IOYA 4RORA 1T1RA 1ISJA 4YAJA 4YQZA 3H5RA 4F45A 3I6QA 3KSUA 4R4JA 4B7CA 1R15A 1WDMA 3D0OA 5L95A 5T5QA 2I3AA 1DIRA 1LX6A 3RC2A 3KHUA 1F12A 1RM3A 4FFNA 1LDNA 2D5AA 3F6YA 5K9ZA 1EK5A 4YJFA 1PJ4A 3H65A 2NNLD 1LDGA 1QYXA 4NFYA 2ZTVA 3BTVA 2J5QA 4NBRA 1I5RA 1HLDA 2X0IA 3WFJA 3WGTA 2A4KA 2CNBA 1TI7A 4B4OA 3EVTA 2UV8A 3L4SO 3PJDA 3VH2A 3L4BA 1H9BA 1U9JA 3G1TA 4W7IA 3HZZA 1WMAA 2ZYAA 4K26A 2GYYA 1JWBB 3ANLA 2O3RA 1CRWG 1BVUA 3TFOA 1H93A 3UUWA 1CWUA 3QVWA 1DHRA 1JQBA 2WYWA 3GN1A 4J9UE 1UDCA 1JDJA 1R0KA 1LXCA 4EJ6A 2NU7A 4BMVA 1R12A 2AQ8A 1GYQA 3QSGA 2GASA 4BO4A 3DQPA 1AGNA 1OOEA 2X22A 3GNTA 4URFA 1ZNQO 1GV0A 1VLLA 3MTJA 3RC9A 3R1IA 1DHTA 3C8MA 4YT5A 4DLLA 3VPGA 2BGLA 4OAQA 4Y6RA 1LI4A 1HWYA 3GRKA 3INTA 4J0EA 4RLHA 4ALLA 1S6YA 5LDGA 1RYDA 1U3VA 1B8VA 1HE2A 2WWRA 4DLBA 4QFDA 1E6EA 1GCOA 5EQDA 5T64A 4E5KA 4E5YA 1NPDA 3PI7A 4ZD6A 1OAAA 3WR5A 1QR6A 1T25A 4J2OA 2RH4A 4XGIA 1N9GA 3ROQA 4CMIA 5C5IA 3TOXA 2O50A 1O6ZA 3V1TC 1SCUA 1LTHR 1I3KA 4Y98A 4N54A 4IDDA 4UULA 2GSDA 3AFMA 4IIVA 3L77A 3WFIA 2NUAA 4UVIA 3D1LA 4FBGA 1JAYA 5HA5A 5KTKA 1Z6ZA 3HB5X 2D5CA 4XYBA 4YCAA 2Q1WA 3P7MA 1HE3A 5A5FA 3JYPA 5A9RA 4D0RA 4FIZA 5ICMA 3WBBA 4Q3DA 5JMPA 4R54A 3R3SA 2OO5A 4GWKA 5DCUA 3KETA 2EJWA 4XR4A 1ENPA 5THQA 4CMEA 4RO0A 3E18A 3O8QA 1E1LA 3ITKA 1I2ZA 2H63A 1I32A 1PJ2A 3TZQA 1D3AA 3IIEA 3SBOA 4GGPA 3OQ1A 4WLNA 4AG3A 1XYGA 3H9EO 1MP0A 2O3QA 4IUYA 4YBZA 4ALIA 3I9OA 4DMLA 2PKQO 1MB4A 2OXIA 3EDMA 4DREA 3GRPA 4D42A 4XWYA 1YDWA 2OMEA 4U6SA 2F1KA 2GRAA 4A5OA 3SLGA 2BI7A 4II3A 4XJSA 5KVVA 4L4XA 3LT0A 4I08A 4DQVA 3NUGA 3C1AA 4XRGA 5ILOA 4IZHA 4NMHA 3P2OA 3PJFA 1LNQA 3PVZA 4BL5A 1SAYA 4MIYA 4DC1A 1DBVO 2ZTLA 2HUNA 3IJPA 3JQBC 1QV7A 2C5AA 4Q3BA 1MLDA 1E3IA 2EWMA 2Y99A 1BDBA 4Z3DA 4BKUA 2C7VA 3RQSA 2YW9A 1HTBA 1SB8A 3VOSA 4FD3A 3QVOA 4BNMA 4GL4A 1NXQA 5I9MA 1Y5MA 4AJOA 1GPJA 3JQFA 3D3WB 3OJEA 5FF9A 5JBIA 5FFFA 1LSOA 4AJ1A 3S2FA 4XRRA 2BFOA 5IXYA 1GZ4A 5K6AC 3ADPA 1LLCA 1V3UA 3PWSA 4GWGA 4YTEA 5FI5A 1OC4A 4AJ2A 4BNUA 3WBFA 1M75A 4H16A 3PFFA 3ZZNA 4XQGA 4TROA 3JQ8A 2DTEA 2HMUA 3DBLA 3OJ0A 5HTOA 5KVCA 2VHXA 3E9QA 1AXEA 2EKPA 3EY4A 3A9WA 1Q0LA 2VN8A 3OETA 3T4XA 3ZU3A 2HMWA 2FPIA 1XIVA 3L0DA 3KUXA 4OXKA 1EVJA 3PHHA 5T6BA 3VH4A 5ICSA 2NVUA 2E82A 4KQXA 3IKVA 5J9GA 3ROPA 5A05A 1G1AA 2HKIA 3RCBA 4RQTA 4MINA 2ZCVA 3GF4A 4OL9A 3ZWNA 3QVTA 5BNTA 1UP6A 3AU8A 4KUEA 4EUFA 1R0LA 2Z95A 4UUMA 3O9ZA 1K6IA 3ZWMA 3QRWA 4LCEA 3ETDA 3DZHA 3GN2A 4BGUA 4EUHA 4KQWA 3JQCA 2RHCA 2EHDA 5BT9A 1E5QA 1HDCA 2G76A 1YE3A 4YRDA 3HDYA 5EN4A 1A7AA 3F4LA 5FEUA 4ZRMA 1FMCA 4CM1A 1HT0A 2VYVD 4PGFA 3KSZO 9LDTA 4DIBA 3CIFA 2DT5A 3UFXA 3VPFA 1B8UA 1ZZEA 1TT5B 1A71A 1XGKA 4PLYA 5JO9A 3DHNA 2FOIA 3FPLA 3IKTA 3WGYA 4Z3KA 1OFGA 3GHHA 2NLOA 3TOZA 4Y8VA 3DZKA 3WTBA 5HM8A 3ADOA 4A26A 3DBRA 4WCDA 3K96A 3E1KA 2HMTA 3Q1LA 4ZQGA 5JCJA 3U4DA 1I36A 4CUJA 5KJEA 2HO5A 2E37A 2VZ8A 2VWPA 4M54A 4UUOA 1QLJA 5G4KA 5A3JA 4J7XA 1NPTO 5B4TA 5ENDA 3EW7A 1H6CA 4N5NA 5L7WA 4IDEA 2B37A 1KVTA 3H3FA 4H3VA 3Q3CA 4GSLA 3ROMA 2R00A 4YXFA 4EYEA 1C3VA 3RU9A 4B7XA 4IIUA 2CVZA 5TLSA 3DZGA 4EDFA 2BHLA 3O03A 3W8DA 1PSDA 2GDZA 3F47A 1E7MA 3V2UA 5BSHA 3ZN2A 3DMTA 4D0SA 1EDZA 2Y66A 1HDYA 2VQ3A 2EG9A 4LN1A 4ALMA 4E33A 4B3HA 4CQMD 3VHRA 5JAIA 3HDJA 2FRDA 4IMPA 3ASUA 5IDYA 4NHEA 5MGBA 4MVJA 4UVGA 2BD0A 1R6DA 7ADHA 3KEOA 3HDHA 1EUCA 4DIOA 3FRJA 1DC3A 4I5DA 4ID9A 4X54A 4RVDA 4WKGA 1M6WA 3OQ6A 3WIDA 4BUCA 3ZHBA 3S2IA 4LK3A 4JROA 3H9GA 2GZ2A 4PLCA 1SB9A 1E7WA 1Y6JA 4WLVA 4CM3A 4CM9D 4RVGA 4E5MA 2D0IA 3IDSA 4KOAA 5HRUA 1RM5A 1KY5A 1YOVB 1MGOA 4DQUA 3D5QA 4TQGA 3VAZA 2OGUA 4MVJG
chains in the Genus database with same CATH superfamily
4G2TA 2IYLD 1VJ0A 4JJAA 4ZRNA 4EFMA 1Z36A 1PQPA 3RABA 1TCBA 2INGX 3IQXA 5CXSA 3IVMA 1LRKA 3H5AA 3HUDA 5AKHA 5E4YA 1UFOA 1TVCA 2GJ9A 4IVQA 2X9NA 3D4LA 5CW1A 4B3RB 3WYDA 4BFWA 1RLOA 2RCYA 4QBKA 4TTIA 2CCGA 2ZAYA 3HA5A 5GGYA 4EX6A 2Q28A 3EYWA 5EI5A 1R9GA 5AXCA 5SICE 3UV3A 3TRIA 2JFOA 4J6EA 4XX0B 1M6NA 3L5KA 1SU7A 4FX5A 5F78A 4NS4A 4QXPA 4JQCA 2C98A 2FUCA 3DAFA 1FP7A 3HI6A 1MC1A 1VZ2A 3OOJA 4TRRA 3FKJA 1YZTA 4Z4FA 3OPXA 1AOXA 1IATA 3I76A 3R2JA 2QVBA 3H13A 4J43A 8ADHA 1L7AA 1UADA 4IAOA 4BVFA 1V95A 3ZU4A 4CEHA 1DKOA 1N8NA 3DO5A 1C3OB 3AHDA 3PD7A 4NJMB 3DZ4B 3EEQA 2ZJ8A 3GROA 4LYFA 1X74A 4CQMA 5HK8A 1PYOA 3C5WP 3P97A 1XELA 1E59A 3IVAA 5ICFA 4AX4A 1RHQA 3GEMA 3VU9A 3LU1A 3RVKA 1WPXA 1L7EA 2P69A 3A05A 2UAGA 3MTGA 2DPMA 2V4UA 3QA9A 4GVPA 5LZ8A 1X8LA 5DB4A 5AJUA 4DMRA 1SD2A 4M9XA 4ETWA 1X1EA 3K0FB 4NEGA 5B6JA 5GJCA 3CNQS 3TLEA 1GKIA 4DJDC 4ND8A 1FP4A 4DADA 1ESEA 1SKAA 4KBYA 1BE1A 3FSGA 1GR0A 2XRZA 3FCAA 1NBOA 5C3UA 3RTEA 2O1SA 5REQB 5AVZA 2JDID 1PSWA 4P0TA 2ENWA 4NTZA 3SJBA 3WVNA 3C6QA 2WQ7A 4B3BA 3G2IA 3RVPA 1T8WA 2YC2C 3GJ3A 1CLUA 2HMSA 1M8KA 5G0WA 4B4DA 4UATA 2WKQA 1G8HA 1MA3A 3T9CA 2EP5A 3GZ4A 1R0BA 1L7QA 3HVHA 1SD5A 4C22A 3EX7C 4HLDA 4K40A 1JPNA 2ATVA 2HQ1A 3I01M 3OY2A 4HX2A 2C9MA 1ZPDA 1YD7A 5CM2Z 4PG4A 2AQKA 1R27A 2Y0BA 1L1QA 1G98A 1U7WA 4CKBA 1D03A 5KYXA 4ZVPA 2EJCA 4RDHA 5ES3A 1VG0B 4L51A 1ULHA 4CU2A 3FMVA 2AI2A 3D7MA 1T1JA 3T0GA 3QV2A 1OFHA 3K6KA 5JH7B 1PKEA 3QU5A 3ZY2A 4Z4EA 3C3XA 4OI2A 2Q07A 3GG2A 4HRXA 5EQJB 2YN4A 4HX5A 5TF0A 1TT7A 5EFZA 2G77B 1E3DA 1THGA 1MV8A 2MMGA 2QDXA 3KDPA 4UBOA 2NUPB 2Z08A 3ZHZA 3NV7A 3KTAA 2NPFA 5JYAA 1K7XB 1TW2A 1U3FA 3R74A 3LW8A 2IOHA 3LPAA 1QGDA 2GQ0A 1EVYA 2COKA 2OV1A 3D7NA 3IQIX 1QM5A 4YRPA 5B6IA 5U4QA 2X86A 2EP7A 1T0IA 4GWLA 1NVTA 4W9NA 4PQYA 1NF3A 4FEGA 3ZGNA 3HXMA 1WV1A 2EFHB 3BHIA 3GRZA 4LHYA 1EX7A 5BOSA 3PFCA 4NK5A 3UOAB 5DM60 4I55F 3VR4D 3DKIA 3ZE0B 4IDOA 1FXWF 2YXNA 3LDUA 2I03A 1QF6A 4LGVA 3U4AA 4FNAA 4IRUB 2D54A 2O05A 4KR2A 2XCIA 1L4UA 2EHJA 4N9WA 4H9GA 3AEKB 3LVFO 1MAVA 3S5UA 2G8LA 2Q7OE 4JUCA 3A6KA 2X4GA 4PO1A 3I9FA 2ZCJA 4B32A 1SR8A 2IXAA 3EEIA 2JJ1A 3JQ7B 3E48A 5KHLB 4HFNA 4UXIA 3UOGA 3MAJA 4XYLA 4LZLA 1D1QA 1O8BA 3GUYA 3X1MA 4EHLA 1CEQA 3WRYA 2B9EA 4FNMA 1XJWA 4O4LF 1PFYA 3ZXIA 2G1KA 2JGAA 1DQZA 3AFOA 4CFSA 1TEVA 3ZOZA 4RIFA 4LYAA 4PIMA 2XPCA 1YDFA 3TUIC 1XU4A 2CUZA 4Q4JB 1CUJA 2DH6A 2YZGA 3IIKA 3MPOA 3P9SA 4KE8A 2RGEA 4OQMA 4OB6A 1U5CA 3LBFA 2UZ4A 2H00A 5HUQA 4L16A 5AM3A 5B1YA 4E4RA 5K0EA 1CY4A 2GM9A 4ZQHA 2AW5A 3FDZA 2QZ4A 2Y1CA 5JI3E 3CURA 2P6NA 1XEWX 5G53C 5IYZA 2JFBA 3OF2A 2XTJA 3AUAA 1WY7A 3T54A 4LXTA 1IXSB 3FMIA 3SHVA 4ALNA 2ORYA 5ADVA 4LVUA 1GV1A 4BNLA 2IHBA 1E79A 2WVJA 3H5IA 5L9AA 4FB5A 1YQDA 4MVJF 2QD4A 3U3OA 4YMVA 1TEZA 1Z4NA 5K0FA 3MHTA 3ZGYA 4BX0A 4OI0A 4OL0A 5AKLA 4IJUA 1CHDA 5EJEA 1RBMA 3UMSA 4HNAA 1SKYE 4UASA 3QMMA 2Q3HA 4LK2A 4L9AA 2ZWOA 3A58B 2D74A 2E2WA 2QLLA 3AFNA 4FN5A 3D2LA 4BJ1A 1G2IA 2KBEA 2YDXA 5AI0A 3AKCA 5EEGA 3GVIA 4JC8A 2C9DA 3D4NA 1V5WA 1SQ6A 3DL2A 4CLXA 3A4MA 3EIUA 1JMVA 4PVDA 1U1EA 2FU5C 4A9AA 1VE3A 4DDWA 4W63A 1BXRB 1W36B 1TD9A 2IH5A 3OEHA 5ANRB 3ZYCA 3P2YA 1IY2A 1NZFA 1REQA 4KWCA 4HH0A 1TQ8A 3WK6A 5BYBA 2HIMA 2PJZA 1X7ZA 2ZBRA 2FUG6 4BP8A 2NU9B 3IDZA 1MTOA 4QO7A 2RJ3A 2A86A 4ZV4A 6ABPA 3GT3A 1SWVA 4ZP1A 1EVQA 1YCHA 1WXDA 1XDZA 2F00A 3EAGA 3OMLA 4RNDB 1K2WA 3UCXA 5IJAA 1X6VA 3OI7A 5CVDA 5F5XA 4EI2A 5K0GA 4DSUA 2HL6A 3KKOA 2NAPA 2H51A 1WDWB 2P2GA 4P84A 2QLFA 4N18A 4R2XA 4N3NA 1ISFA 1XLTA 4UD6A 1EI9A 2V1UA 3WLNA 2CXSA 2VOEA 4Q4CA 4OB8A 3FUXA 3IWBB 3G1UA 1K8RA 1J0AA 4O5OA 5CX1B 4C30A 4JI3B 5K20A 4ZT3A 1HKUA 2XZTA 4MDEA 3ZVMA 1H2HA 1TLTA 4ZTZB 3KZ1E 1VLMA 4CCYB 1GNRA 1HEIA 1NMEA 4FMDB 1U7OA 3NBMA 4B73A 2G67A 4KYVA 1G42A 2HFJA 1FDWA 2FI1A 4DMKA 1YHYA 1K6EA 1Y9EA 3H7IA 2XUGA 1KFCB 2NX2A 3MD9A 3HXOA 4GPIB 1EG7A 3NBXX 5JYFA 3NOVA 1DAIA 3SC4A 3PE6A 4TMTA 4O89A 2H2DA 1KJWA 3CV3A 4KEAA 1ZK2A 2LCFA 4I4TB 5HS6A 5FBVB 3VDMA 5M7EA 3U7HB 4PO3X 1LNSA 2A35A 3SSMA 4NCBA 2RGBA 3P2EA 4EG6A 3QLEA 3DHEA 4YEDA 1JE0A 5IUKC 1DOAA 2ONKA 1HL3A 2XVYA 2V7GA 4JI4B 4YY3B 3UVEA 2FSPA 2V6IA 2CFTA 2CVFA 2R7NA 4ZT6A 3CMMA 2VAMA 4UMFA 1IU9A 2QAGC 1JHOA 2CZCA 1ID1A 2Z98A 4JLDA 4EITA 5L7YA 5HOQA 2I3ZA 2I7XA 1A5TA 2ZR0A 5G40A 4HX9A 1YGPA 4MS1A 1S7GA 2XCLA 4MDYA 1QHNA 3Q2KA 4H1UA 2HQRA 4L78A 5EIHA 1N78A 4URXR 3DZJA 1N9ZA 4ALJA 4ETNA 3H87A 1JFRA 2COEA 2L69A 1EUYA 3EJ6A 1LFAA 2D62A 4ND2A 3OMWA 5C18A 1WTCA 1OH5A 1FPMA 2G0AA 3H2GA 5BY2A 3K5PA 3QHPA 4KYTA 1KE1A 5FOVA 3E84A 4R7ZA 4ZGWA 1RMTA 4ARUA 1QFZA 5E3JA 3KKEA 3AEQB 1JWAB 5ALQA 5IXJA 1UXJA 3QI7A 1PWEA 2I87A 1T5TA 5FHRA 1SUEA 2GERA 1VCIA 1S8OA 2NYUA 2GZSA 3N8NA 4EHBA 2X76A 4WAUA 2CHUA 3ROXA 2JJYA 4MUHA 2AR0A 4DAOA 3I73A 5I7FA 4Q4AA 4I46A 3HWRA 1FBNA 4XSVA 4TSKA 3MMXA 4CDNA 2QPTA 4LRWA 4ZZ2A 2XHZA 2O48X 3HHEA 1YZFA 1M1UA 1Q12A 3BGVA 3N0XA 4B9AA 5I8PA 2FSFA 4ECEA 2I91A 2W43A 3VR0A 2QPOA 2C8LA 1KARA 3NTQA 3F74A 3KX2A 2X6RA 1AKNA 1Q77A 2HGZA 2Q62A 2QMZA 3DB1A 3GLKA 4AF6A 1T9ZA 1UKCA 2DSNA 4N03A 1H23A 1F7UA 4E6PA 1KQFA 2XVXA 3SVTA 1EXVA 4P7BA 1QP0A 1TZJA 2X6QA 3MCVA 4GZ5A 4NK4A 4OHKA 3VNRA 4BC1A 5BQ5A 4O02B 1P4AA 2G0TA 4O3FA 1O77A 2Q5HA 3OLCX 5AM5A 4ZYZA 2FVYA 1E2GA 2F6RA 3A6FA 1VIAA 1OX4A 2YDYA 1U2DA 2FP4A 2HJ9A 1R9NA 1JQJC 2I7VA 2VJAA 3I64A 5JCXA 1X1CA 3CLUC 2FR8A 3TLYA 5DLQC 2EATA 3DT8A 4YJ2F 1H8ED 3B89A 1A0OA 4TTSA 4JYZA 1HA3A 3DC2A 4IL5A 4YRQA 4EWLA 3ENNA 4KK4A 3LE8A 3TN7A 4C1NA 2C7PA 5D1NA 5DSTA 4QVGA 4TUYB 4RVUA 5KS2A 2PXHA 4DV0B 4DPKA 4H7EA 1EBBA 3RRBA 4X60A 1SZJG 4L6CA 3V33A 2W2MA 4P93A 1HDEA 2XKKA 3OJLA 1AV7A 2OL4A 3W78A 1IY1A 2XSZD 1S2IA 4PHTA 4AL4A 4MYHA 1KH1A 2EEZA 2Z2ZA 3VDRA 3WADA 4BJ6A 1Q0TA 4P0QB 2FRVA 3DZ6B 3EZYA 2JGKA 3QFCA 3UMJA 1KF0A 1NUHA 3H3JA 4AY5A 1U3UA 2CYBA 3ZE9A 4IIJA 4FKBA 1II8B 3W7VA 1FX1A 1T9CA 1T8PA 3CX7A 3QUQA 3MINA 3MVEA 2DT8A 2H08A 2O2YA 2QTTA 3K35A 3N2YA 3QVUA 4I7EA 4JVLA 3UHJA 1C9EA 3RC7A 2HMVA 2DWUA 3CBGA 4R05A 1GTMA 2PEYA 1B0PA 2JAOA 1LBEA 2WIBA 3HVRA 1RBYA 4I50F 5EKSA 1ZLXA 3I9LA 3QUCA 2BSQA 4IDGA 2P4EA 3TLGA 3AVPA 3L0BA 4EVQA 2REBA 1U8UA 4BFVA 3MMSA 4HDMB 3CE9A 1TXGA 4UXHA 1FL9A 4FQ8A 5FPHA 4N49A 3TGWA 2RD2A 1B7GO 2UVQA 2ZIGA 3GFRA 1IN5A 4CYMA 1RKUA 1Y6FA 4KQEA 2H2AA 4BTVA 3WGZA 5AR1A 1QZTA 5KKCA 3B1FA 1EHIA 1VFNA 4TT3D 5I48A 4PO9A 1GUZA 2SCUB 4RVFA 5JAOA 2LV8A 1UBSB 2W6OA 2QR5A 4KXVA 1ZOOA 1WMSA 3NGMA 1NG1A 2ZT7A 4RGVA 2NQ8A 4POOA 4V0SA 2WTUA 2MINA 3FE2A 4AS1A 1K6JA 3HV2A 4AIIA 2ILTA 1WW2A 4IFEA 2Y0PA 1OX5A 1QTIA 2C9BA 3LX6A 3RYIA 3E7DA 5KWEA 1D0IA 4QM7A 3WV5A 1DWQA 3DCJA 3RW9A 2QY9A 4OXQA 4F4HA 4K28A 4C0JA 2IL1A 4NBWA 2XF2A 1GQYA 3RLIA 3U0BA 2H9YA 3S1LA 2VF4X 4MQFA 3HMQA 2MSNA 3T5GA 3ZGLA 1N5DA 1T2FA 3KPJA 4JAVC 5EWLA 4TMWA 1VJGA 3CNEA 5AVKA 3D8BA 3TQTA 2QP3A 1ENZA 1XDGA 4QT0A 4ZA2A 2R6GA 5D6NA 5DI3A 1XTKA 4BRZA 2ISQA 1FFDA 4B4UA 7REQA 1YMQA 4MUFA 2NP6A 8AT1A 3C7CB 3IJ5A 4B84A 1CE8A 2H0RA 1UM9A 2IXGA 2YKGA 3U19A 4A0QA 5K99A 3CW9A 4ONEA 1QGAA 4GC5A 3ZDCA 1SC9A 4P53A 2Q7DA 2FFJA 3ROGA 3WWYA 3GLFE 4KDCA 1CJVC 1NQTA 1J56A 5TT1A 4EY3A 1TQ6A 2XNDA 4FZVA 3OT5A 4LV8B 3ETNA 4L8YA 2G7MC 2IYUA 1ZK1A 1R4MB 3EVDA 3PEWA 3L7MA 2A1IA 2JIDA 3PDWA 2AJBA 4KIFA 4MUBA 4TMFA 4YP1A 4H0FA 5B7PA 3M4YA 4G0MA 5BRNA 4LDNA 3Q6MA 5HQ3B 1VC2A 4JV5B 2BI4A 4Q00A 5AVWA 1J0BA 3S6JA 1VMDA 1PGOA 5GONA 4BVHA 5IG2A 4M0MA 1H6AA 1TYZA 3PQDA 5DM70 1ZA2A 3RVBA 1HOTA 1KR5A 1LBIA 1XRLA 1Z88A 3MWKA 3W1VA 3EP6B 5IN5A 2BTQA 2HCRA 3NHMA 5A7HA 1WG8A 4QU5A 3EP7B 4J03A 1X7XA 2W2VA 2RG1A 2FZWA 3C45A 3JZFA 4NBVA 4X6YA 3SKXA 1P7YA 5EJ7A 1ZN7A 3OT4A 3TVDA 1MQSA 4CKWB 1SCDA 3JR3A 1VPLA 1WZIA 2QR3A 1C2YA 2ZJ5A 3V1YA 5I3CA 1VOTA 4Q3OA 4TL7A 3ZPXA 1T6BY 1QTNA 1RAGA 1G5HA 3KFXA 5D5PA 3RI3A 2FZ4A 4CG2A 4L07A 1DGQA 4RPJA 1FRFS 2P9GA 3RWOA 1A2QA 2D1QA 1SD1A 4IX9A 4XDZA 3VFDA 3QFTA 3GGCA 3HH8A 3PQ8A 4Q4HB 4A73A 4A15A 3HFGA 2O19A 1ST3A 3B1YA 4IO1A 5A6SB 4JB2A 4JB3A 1TUBB 3V2GA 4EJSC 1W0KD 4BBPA 2LTAA 4GX5A 2J0UB 3A3OA 2DTXA 1P8AA 4IMRA 4MLPA 3RUHA 2R7LA 2JH8A 1OLXA 1WVIA 5CVUA 4RZXA 3C16C 2PRJA 2WYHA 3CEAA 1FJHA 1I01A 2NG1A 5CIYA 2IDMA 1W5BA 4R84A 1O2DA 4B6OA 3BCHA 1VRWA 5ALHA 4W5NA 3ZHSA 1HDGO 2WT4A 4EKYA 3D2BA 4URVR 1LS1A 4J9VA 4R0MA 4NONA 1XNJA 1SXGA 3RGWS 4B4VA 3ESXA 1CY0A 4G0VA 5LZ5A 2E18A 2GK3A 3MOIA 2NPOA 1BN7A 2CMDA 2ETVA 3NDIA 4JEUA 4RTSA 1FMJA 1YAJA 3KFVA 4M8KA 2Y1DA 2ODAA 2PMBA 4P4NA 3GY0A 1ZMOA 2EW2A 4I5EA 3S29A 3TW8A 1AA9A 1NQAO 4HQRA 1YZNA 2G1PA 2J45A 3DDSA 5CD1A 3V4PB 2WNHA 1TPYA 2ZWAA 2H11A 3K4PA 3L7OA 3OZRA 1UJMA 1X7YA 2CE2X 1ANKA 3DTVB 1TF2A 4J0FA 2C1XA 4DWWA 2BC9A 2IIQA 4CUZA 4OQQA 4MJ7A 4N5IX 4ON9A 1UM8A 2WAMA 1U0NA 1OJ7A 5IAEA 2VWQA 2FYTA 4B6JA 5JAPA 2J9YB 2P9JA 1L7NA 5TX7A 1F0NA 4QXAA 3KEGA 4ZI7F 1SH7A 1WHSA 3V2IA 1QANA 3G23A 4FGJA 2FJPA 5K0TA 2QYSA 3I5MA 5LLSA 5KKNB 4JC4A 2O54A 4Q66C 4BMPB 3HP1A 4BUJA 3ED5A 5K3AA 3U49A 3EIHA 3IKLA 2X40A 1I7SB 3AY7A 3A4YA 1HYHA 2EZ4A 3K8OE 1W49A 1ZD8A 1CX9B 2J3IA 4RY0A 4UREA 3RU7A 3THYA 1DAEA 2I6TA 3SAJA 1JIUA 3LT1A 5KNBH 3GVCA 4RTNA 1P77A 4Q5IA 4UQLA 1D2NA 3U5TA 1SC6A 1BFUA 4TVBA 3AK4A 2V98A 1NJ5A 1VRCA 2PTHA 1I4LD 3G59A 1HETA 4ACAA 4NJEB 3V2HA 2HWUA 4BWVA 4ZALA 5B1IA 1JEEA 1BQEA 1CUAA 4AJIA 4BECA 2VYND 1EFPA 2AZTA 2OXEA 4IXMA 4FC7A 5B1EA 5EIOA 1SKQA 2ASEA 4JGBA 4EFKA 5E6SA 3K9NA 3ZJVA 1ZIOA 1A5SB 5DLEA 3PZBA 1BOFA 2VK4A 1ML4A 2JFYA 2BE9A 3KKZA 2QW1A 1N5JA 4L0MA 2R7AA 1KI1A 1FFXA 1M67A 4NBLA 1NLMA 2IP4A 5DH9A 3BSYA 2Y4NA 3JWEA 1KAHA 5HS4A 1U28A 4ASUD 4B74A 4IGKA 4HFJA 1LBHA 3I2JA 2JBHA 2EKLA 5F1YA 5AW3A 3GLRA 5BNIA 4BGIA 5F23A 1P31A 4BMDA 1E6UA 1NOKA 1Z5UA 2WTAA 1QU3A 3E4DA 2OE2A 2W4QA 2JLUA 3KKMA 1SVNA 4UW9A 4KVAA 4XPIB 2Z1DA 3O26A 3GNQA 4DR7B 1KDRA 1EVIA 1VI6A 2WF7A 3K0CA 5DGXA 4EA6A 4F2DA 4Q9AA 3IJRA 3IAM6 3AUTA 4ZOBA 1QK5A 4LQDA 4WK4B 5H83A 3LV8A 5BV0A 3FB1A 3ICWA 1RRKA 3NOQA 3L6OO 2OZEA 4QREA 5BO5A 4DSOA 3K31A 5JSFA 1EZZA 3G5TA 3JZAA 2ZRAA 1G8JA 3GDHA 4ZTBA 1Y8RB 4GKKB 3Q5DA 3ESBA 2IXBA 1HQDA 1P4GA 1TEXA 2D2EA 3TZBA 5K7SA 3CONA 4YRSA 2B3DA 3L0ZA 4QXMA 5K0ZA 2XMDA 2YZMA 3OM8A 4LVCA 4O2AB 1ZIDA 5AYVA 4X93A 4RDIA 3VSAA 5SYAA 2JIPA 4M1OA 4EYKA 4XWWA 1CS0B 1NSYA 1PFKA 2GN4A 3OPMA 1D1PA 4WXYB 5KHOC 1P39A 2VT2A 3G8BA 1ARZA 1NQ5A 1JG7A 1WY5A 1PR0A 3O8QB 1R74A 2GI4A 2VAXA 1R3DA 2WUVA 4H77A 4IHAA 5DNVA 2EKBA 5DV9A 3GEDA 4ZARA 5C9ZA 9LDBA 5KNCH 2ERXA 3O9VA 2ZYWX 3OJCA 4IYJA 3TOSA 4V0ME 4WTOA 1JXOA 3W2TA 3OZXA 1BMQA 1GZ6A 2ZJ2A 5H1YA 4CM6A 4PNEA 5I7SA 3DWGA 4XIJA 3PGLA 1CEEA 1K0UA 1WA5A 3W2IA 5EUMA 1VSBA 4U2BA 5A5DA 5CH8A 1DJPA 1SOWA 2ONJA 4OGKA 3Q1KA 1UH5A 4QUJA 2X9LA 1BH2A 1L5NA 3NDBB 2JFWA 2VT7A 4UJ5A 5K0CA 4DUZB 1ZGJA 3SYKA 2LR0A 1Q0QA 2EIXA 2X3YA 1KYZA 3A9TA 3WKEA 1CIVA 4EHHA 4CM9A 3ANSA 3MB8A 1I7CB 2XWSA 3A9UA 1IK6A 5DISB 1BHQ1 4JC0A 4YK7A 3AZQA 2BIFA 1MB9A 2C5EA 3D2AA 4A0RA 4G5RA 2IBTA 3LUAA 3P20A 1TQ4A 3F3SA 2DPLA 2IY8A 2QRJA 3ANNA 5ES4B 1OLUA 1V9SA 1EK0A 2R86A 2HIGA 1W4LA 2FMFA 2MT9A 1DO0A 4CG1A 3H9BA 3JQ6A 3TTWA 3U60B 2B21A 1J5PA 1Q2XA 2PYIA 2IH4A 3LI2A 2PRSA 1NW6A 2VP6A 5FR2A 5JYEA 3BN3A 3N75A 1U0OC 4H7IA 3W5SA 5IM5A 3RYFA 3DOFA 3WHKA 3SP1A 4NXMB 4HQFA 3H99A 3ZE8A 3A26A 1V26A 4CCWA 5GVRA 2CK3D 4JJ6A 4FMCF 1D2AA 1W85A 4MYDA 3A36A 4RW0A 2Z6VA 1BHSA 4ZOLB 1U6KA 1BEEA 2VRCD 2E4XA 4MS3A 1XBTA 3U3ZA 4BGVA 4Z6KA 1GXSA 2GPSA 2HDOA 3ECAA 3SFZA 3QWHA 3IOMA 2FN9A 4HZUB 1RQ7A 4PFSA 5JSHA 1IBSA 3HE3A 1B0AA 3FH0A 2ZE7A 1XYVA 3JQ8B 4DLPA 1J2YA 3ZDBA 4MR8A 2QXUA 1X0XA 1QIMA 2FN4A 2YWEA 3EW9A 2J30A 4RSHA 1IJKA 4UHEA 1WCIA 4EQZA 4YRBA 1F7VA 1Q0SA 2YIDA 2XKAA 3QQPA 3RVMA 1XZFA 1UBLS 2Y93A 3CZ5A 5IZCA 4F06A 3F5SA 5BQXA 3UAOA 3DTTA 4NBTA 3Q40A 5FNVF 3O8NA 2WNIA 1BGWA 1CC1S 1BN6A 3PUVA 4D57A 1GZUA 1UXOA 3WXMA 4BTEA 1GUYA 1Y0BA 2K4MA 2WHQA 4HEQA 3GLGB 4FOPA 3JRXA 2EBHX 1QR2A 1RC8A 3ZLVA 4XZ3A 4MVYA 4N5HX 2P68A 3VKGA 4L0DA 1B43A 3KFLA 1AKUA 5CDGA 2XX3A 2PFKA 1V8ZA 2PGIA 3TBHA 3UYKA 4HUTA 3TXXA 4Q4LA 3D4OA 4K9OA 3QMWA 2GBIA 4MEBA 4UBKA 2J9FB 2WTEA 1LV7A 1N7GA 3HKCA 4IQFA 2QYTA 5AQ1A 1L4YA 4LDJA 4D81A 1S8AA 2YZ2A 2BM0A 1YO6A 2ZSKA 3ZWXA 4EB0A 5KWIA 4F6RB 1VYVA 4A6DA 3P5BA 4M7RA 4I66A 3UH1A 1ZMXA 1LW7A 2A67A 1G60A 3C6ZA 2PO7A 1KSJA 4IDBA 1LTQA 2GKGA 5HRCA 2ZAMA 2IS2A 1HSOA 5F9FA 3TPCA 1DKUA 3TSAA 1JSCA 2FSHA 1ADYA 3RARA 3V8MA 1KIAA 2HA4A 4DR4B 1Z6PA 1YT5A 4LY6A 1FTSA 4OHXA 3NHPA 1HDZA 1W0CA 2H0QA 3AJ8A 1GDDA 3TAXA 1NR5A 4C3ZA 4KB5A 4R2MA 2JEOA 1WUJS 1ZAYA 3DCNA 3QOXA 5CFZA 3MWYW 1HV8A 2GJ4A 3P71T 3PUXA 3KJIA 1E18A 3NEPX 3OD5A 4NU0A 2JNWA 2OY0A 4QFBA 2OUIA 5LP6B 5DT9A 5HFNA 1Z8HA 3L6BA 2OV8A 1G3QA 2QLMA 3EAQA 1O6CA 1KK3A 2CHFA 3PUYA 1X9HA 1U0HC 1GGVA 2O7VA 3E9ZA 4PX2A 4HEJA 4RK4A 3U80A 2PX4A 3DEZA 3GZJA 3AEUB 4PSCA 4I1YA 3U9LA 5L4SA 4B3SB 4OVKA 2CB0A 4HADA 1IMOA 2QROA 3K09A 2UZIR 3QWAA 4PQGA 1AF4A 4WUVA 2JCVA 4YLEA 3TZKA 3VU8A 3AHIA 1FFWA 3AHCA 3IMKA 2I65A 3LOUA 2FFHA 2ZRBA 1JKJA 4FXOA 1YFLA 3D54D 2Z4TA 3NRBA 2GA9A 1Y3BE 3CISA 5C4MA 3AJEA 5C8YF 2DETA 3QE0A 3ABRB 4CKYA 4OHOA 1KS2A 5KMGB 3NZEA 4R1PA 2QM3A 1PL8A 4D44A 3JAMA 1CEYA 3WLMA 4REOA 4JT4A 1QGED 4DWVA 1FLDA 2E4WA 4IHJB 2HJVA 2QTVA 3BJIC 4DCTA 2DCMA 2Q46A 4J7AA 4QTUB 1LX7A 4M89A 1IIBA 4QUGA 1MB3A 2ZJ1A 3TQFA 1GGEA 3DGEC 3E9NA 4WXPA 1CQPA 1TK3A 4JLJA 4GKJB 3WMFA 3KT3A 1PS9A 1EK2A 1EUDB 1AKWA 3CX8A 3EAFA 2B82A 5K51A 4PYQA 4D99A 3AJRA 1P74A 2AE1A 2A6PA 3MCAA 1W4CA 4OOFA 3MS2A 4WPGA 3PFIA 4A8JB 3NOOA 3ZDAA 4DQ0A 5KBYA 3MN1A 2QIPA 1XMSA 4K9DA 4EW1A 4MP8A 5CP8A 2NT3A 4B47A 5K45A 1K89A 1EK1A 1JHDA 4E2YA 2FPPA 5BORA 2JFGA 1WW3A 1AK9A 2XCSB 2VQSA 1XQXA 4RZSA 4CV2A 4HH3C 3GMSA 2QENA 2YJ5A 1ZR2A 1GQ2A 2WAXA 4LJ9A 1VJ5A 5TJ9A 3AVYA 4LHZA 2UZ0A 3SXUB 2XNJA 3EF0A 2P9TA 3ES9A 2EKQA 3OX4A 1R7RA 4V1CB 1PR1A 2W6JA 4NH0A 4W7HA 2B2CA 1JR6A 3PYLA 2AQHA 4HXYA 4AJEA 1IAVA 5KTOA 1Y8QA 1N92A 2P9EA 3BIOA 2XXBA 3F6PA 2ACWA 5KO2A 1J7JA 1XEWY 3H9QA 4IH4A 2P9YA 5CMLA 5HIMA 4H1TA 3PNMA 3ZNPA 4ZYVA 1I94B 4JNCA 3V7UA 3V8NA 4LJKA 1D4AA 4RKYA 2DHCA 5B2EA 1NX9A 1TM2A 2ZYVX 2FZGA 3PSHA 5FL7A 2BGNA 2BFCB 3T7EA 3I12A 4AWAA 2QVGA 5CFRA 5L6LB 1IHPA 5KTTA 1IXKA 2B8NA 1JS1X 3GGJA 3M6MD 4JQOA 4MARA 2BBTA 4ODIA 2XUFA 2MYTA 1MTZA 2Y0EA 1V11B 3EXFB 2MTBA 4AY4A 5KJCA 4CV0A 4MHTA 4KTTE 2ZRLA 1XTRA 3REQA 4C4RA 2BYTA 1EFVA 3THSA 5FYDA 4M98A 3HXQA 3KT6A 3QW2A 1UBHS 3EZNA 5CXXA 4ZRDA 3RREA 4P4UA 3EC7A 1TKBA 4OYRA 4GOXA 1OLSB 3ZHRA 1J24A 3U26A 4E7PA 5DBIA 1KSGA 2G4LA 5L51A 2DH5A 1OWNA 3JAWA 3LYLA 2IA5A 3PEEA 3FWHA 3TECE 4GM4A 2XZLA 1NF8A 4NYIQ 1H85A 3UHAA 4JJGA 4QOEA 1FA9A 2H85A 4KMSA 4UU7A 3SXJA 1KI8A 3E5NA 3PHLA 1L4KA 4H3HB 4ZU3A 4IRXA 5FP0A 1IPHA 1T9BA 4C0QC 5BYKA 1JDBC 2LE0A 1C7RA 4YJHB 2F48A 4OTZA 3RRZA 3WHPA 5CB6A 3G2KA 3JZIA 3KV3O 3DOIA 4EA7A 3IBYA 1LDBA 2WJGA 3G2LA 1T5BA 2CV2A 1XZGA 4A0GA 1WXXA 4RJIA 3V1MA 3CNOA 4TLAA 1Z6GA 4UTXA 2VDMB 1ZUNB 5H16A 1YZQA 3EZLA 3VGJA 1QO9A 3ZLTA 1MJFA 1NIPA 1NNEA 4XM2A 5ALOA 3RDPA 4NWIA 2ERYA 1KGDA 2R1ZA 3HY4A 2EYQA 2OXRA 2PKYX 3HYNA 4OGWA 5HPYB 1QWOA 2XY4A 5J2TB 3GDWA 1KYWA 1NVVR 1E1RA 1BRMA 3DYBA 1S5PA 3GI1A 4D9KA 2IE0A 3CHYA 3TWOA 4WBSA 5KX5F 3JW8A 3GAAA 1NULA 4RSGA 3SZ3A 4UNRA 1D6JA 1GQRA 2G5PA 2VYCA 4F7WA 1OREA 2JVIA 5KYUA 5AVRA 1NXWA 4DA0A 5B53A 2PUFA 5LJIA 1ZMRA 1ORIA 4BLWA 4G84A 3AT1A 4D4IA 4MYTA 4ZEWA 5C32A 2DJ5A 4KRGA 4MHOA 1BXKA 4FS8A 1TA4A 3R6WA 4CHTA 1O96B 2P2LA 2DR3A 2JIMA 2VPXA 1ONSA 1NVGA 2UKDA 5EMMA 5KYWB 2A4MA 4B17A 5JR3A 4JEMA 4MGHA 4QEZA 1AQIA 1K2VN 1X1BA 1T3TA 3IEUA 5EE1A 4TZ0A 2RH9B 3PRYA 5DYNA 5HIJA 1W7AA 4BBJA 3S55A 4HWSA 3QXXA 3NW9A 4FHFA 4QUBA 3EWSA 3LMKA 5DJ5A 3D8TA 5TPWA 2Q50A 2XB6A 5ICEA 3SEFA 1IUNA 3EZXA 5F1PA 5DIZA 5AKEA 5JMTA 3OZFA 4YRMA 4R5MA 1AKEA 2WKSA 2G9VA 5CW2A 1P2FA 2ZRKA 1W2GA 3NVMB 5GJBA 2G4CA 3SG0A 3OHPA 1E8MA 2WAAA 2HPZA 2J3JA 2ZU6A 4PZCA 4TVSA 4DRXA 3VC2A 1JXQA 1XJQA 3PFBA 5JG7A 1P1IA 1G0NA 3AF6A 5HKOA 2VDWA 1IWBB 5AW2A 2FN7A 3ZWYA 2QVZX 3QLTA 1UPCA 3MOGA 1KZ6A 1Z0FA 4AYXA 5KOJA 3D3EA 4YROA 5AJXA 4MQEA 5L4NA 2PVPA 1M5TA 2JD0A 3IUSA 4G6ZA 4ND1A 2B1GA 4J94A 3BWXA 3T7KA 1GGJA 3VYVA 1I33A 1S7CA 1JR3D 4IV5A 2XB9A 4B3XA 2YHIA 2BMVA 2I8LA 2VHWA 3JARA 1MJ5A 4DFDA 4YQFA 5IDQA 5J2UB 2H7XA 2DPHA 1B6GA 4HB2A 3PBKA 3ZIDA 5HIAA 1BVRA 2FXVA 3IXMA 1NKTA 5E8JA 1COWA 4V2IA 4KXUA 4KAAA 3PWKA 2JGEA 2OR3A 4IXDA 2W2KA 1BRTA 4RA9A 2ZI4A 4KSCA 1A9QA 1CF2O 1P0QA 4PYIA 3ZBTA 5JPIA 4MUMA 4BQFA 3FOWA 3FNEA 1QDUA 2AEMA 3W5HA 4F2HA 5G1PA 2QGZA 3E15A 5F9HA 2ZSDA 3C0KA 1A4RA 4GYWA 1KKMA 3TYXA 1U7TA 4B83A 1NBME 4BO1A 5CVTA 1YZGA 1MPTA 2EDAA 3HBJA 3KYDA 5BNFA 1XQWA 4D9FA 1P2GA 2G8NA 3BXPA 4UCWA 5DHQA 4WBNB 1Y9JA 3U16A 4B4WA 2FK7A 1G8AA 1BKDR 1JE1A 4U02A 4G9GA 3LZDA 5FCDA 5B3JC 4NXNB 4ANFA 4B81A 1RWVA 4R3WA 2OO5C 3L0PA 1RHUA 2ZBDA 2QVYX 5EZQA 3NUZA 4NCNA 1F4LA 2D0DA 2JZNA 4FYPA 3ZX4A 1AZTA 4LXIA 5EIXA 3QEBZ 3K1AB 2BR3A 2WYOA 1JKIA 3MXTA 1YJBA 3P0HA 4AY3A 2KPOA 1BJRE 1RLMA 4S2EA 4YJ3A 2F3RA 2OCXA 5A2GA 1SELA 5B7QA 2A9OA 2YQZA 1H2AS 3S28A 4IV0A 3G02A 3CN7A 1CRPA 1NE7A 1ZR4A 1Z12A 4NZOA 1KO4A 3JASB 4UUAA 4PN3A 1O95A 3JQRA 3ZCPA 3H1AA 1PGPA 3VC7A 4FSHA 1Z47A 2WA2A 4FGKA 2MSDB 2WYUA 4GICA 4M9QA 5HDBB 3PEYA 1MC5A 4B45A 4CL2A 4KGVA 4JS0A 2M6LA 3B9QA 4QD3A 3PIDA 4K8OA 4WZBB 3TTVA 3DAYA 1CVLA 2K87A 1TUGA 2QJWA 4MQ5A 4XFKA 1D2CA 5TY0A 5HJEA 2Q4OA 1AGPA 1XA0A 5I7RA 2ZYTX 4TMYA 1XEFA 3FYUA 3IFSA 2K2QB 2V5UA 5SZHB 4RUKA 2R7MA 4TXJA 2CFOA 2VQDA 3P9CA 2HLNA 4NE9A 3DLBA 3B8EA 3OIUA 3UENA 2CSXA 1W8IA 5H8WA 1RWBA 1T4MA 1LH0A 2OHIA 4EW6A 1S1CA 4R5HA 2XZDA 1M0WA 5FFNA 5SYMA 3VOBA 1GEEA 1WHTB 5AVTA 4UBIA 3BWMA 2FUEA 3CR7A 4WZAA 2XT9A 2IQ5A 3AW8A 3W7AA 4AYWA 3R20A 3WK9A 1HYBA 4TYQA 4X94A 2WLTA 1AQNA 2Y1OA 3OIFA 3DDZX 3DFFA 5L4LA 4NU8X 3OPQA 1XCGB 1G9XA 4OXXA 2XF8A 1B76A 4KDFA 2XDAA 5TARA 3PENA 5G1NA 3REOA 4F4CA 2TMGA 1FJGB 1TJ3A 2YWDA 3KU1A 1KEKA 3SF8A 1TAGA 3H1BA 4Z49A 1PBTA 3JV7A 4HFRA 3BC1A 1DOHA 1KO1A 3VOTA 1F5NA 4FTWA 1C7IA 4BWYA 2MSWA 1QP4A 4CN8A 4JB8A 4N8DA 1EWRA 3KELA 5ECYA 5IJ9B 2I6SA 3U17A 2RGNA 5BURA 3B38A 4TKLA 1F6DA 5ARDA 2C94A 3KS9A 4NENB 3ZCRA 2DBYA 4ZCIA 2C2BA 2C5FA 5ED4A 1HE4A 3JQPA 4QWMA 1ZN8A 3KL4A 3PHGA 3B6IA 4A03A 4IJWA 1J99A 3DAHA 4KXXA 1MW9X 4HAVA 3SS9X 4HDKA 4Y9UA 4PO8A 1B8PA 3C70A 4OUKX 4QU8A 3D31A 3W4IA 4OJNA 1FYXA 3O74A 2IHZA 4M0UA 4BKOA 5K0JA 4JQYA 1GYRA 2AOVA 3GPBA 1IHYA 4DIKA 5ER6A 3M6IA 3RSZA 1GRQA 3KVYA 4P3NA 2TECE 4L5JA 1I7DA 3I42A 3JSXA 1OH7A 1OX6A 2BGGA 2XA2A 4K0KB 1GL3A 2G9ZA 5CVCA 1L5HA 1BS2A 4EYSA 3ZIUA 1R9MA 2DFPA 1MABA 3CZAA 1S3GA 1V96A 3ZVNA 1SQSA 3U4CA 4U63A 3L4JA 3UMMA 4FI3C 1EA7A 2YFYA 4NAVA 1W5AA 4CODB 3Q3GE 4GH5A 2HJSA 2XMZA 3T95A 1CPYA 1Z0DA 3EXEB 2PGOA 3E9EA 1CJBA 2HPHA 2BRUA 2OAGA 4GQBA 2JFPA 2FOLA 3K9FC 1PS8A 1WEHA 4W6ZA 1XXLA 3DHYA 5FTWA 3ET4A 2FSIA 4OI1A 3VR5H 3SDZA 3SIXA 1JKMA 2VYFA 3Q6IA 3PQ7A 4I55A 4J0QA 2WF8A 3IMCA 1Q2UA 3OSZA 3PQEA 3WRWA 1I2CA 2PGNA 1EM8B 1XWWA 1N2EA 1Q5PA 16PKA 3DTNA 4NIMA 5U4XA 5P8WA 3GLIB 2TSYB 1Z22A 2C2MA 4L2IA 3LDAA 3QLVC 1ND6A 1RKXA 2PZKA 3DOOA 3LGAA 3TLXA 1G5FA 1DIAA 2YRXA 1XJ0A 1I72B 2DG2A 1SQGA 2E1PA 1RW4A 4WXEA 2ZRHA 3LJKA 4KIWA 1C4XA 1NUUA 4RD2A 3VHXB 3QX3A 3ANMA 4ETMA 2R00C 1Z83A 5FUQA 1FFEA 2ZBQA 3LCMA 2CHGA 4JEIA 3AKZA 4O4LA 3K4HA 2NM0A 1USUA 3UO8B 3RFVA 2D00A 3I34X 4KPYA 3BD7A 4JLMA 4JSRA 4JZKA 4RXMA 3NIFB 2ENUA 3FCEA 4NYMR 1XWIA 1IZYA 3TQQA 5IUJC 1JFTA 1WXHA 2BJWA 4XVRA 1QS0A 3RSQA 4JT9A 5IF3A 3L1UA 2IPMA 3BMOB