3PZRA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
b'MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural Characterization of Inhibitors with Selectivity against Members of a Homologous Enzyme Family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3pzrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pzrA01
4CMEA 2GDZA 3D3EA 4QQRA 5JDIA 3Q1LA 1Q1NA 4JBGA 4CJXA 3A4VA 1GEEA 1LJ8A 4IXTA 1E1MA 1XA0A 3PQFA 5BSGA 3CEAA 1NM5A 3SXPA 3H9QA 2WWRA 3GDOA 4W7IA 5JYDA 1M2WA 3MJEA 3H3FA 5CG2A 1NFRA 5IF3A 1T24A 4A5OA 2AMFA 4YJHA 4CUJA 3JSAA 2VTEA 3CMMA 1KC1A 3H9GA 3HADA 3MJ4A 4DC0A 4XYBA 1AN9A 4R3WA 1IUKA 1SEPA 3F46A 5JCJD 4E3ZA 3E8XA 2V7PA 4WLOA 3JQAA 3GZNA 1YBAA 4KDFA 2O3JA 4R54A 1NVMB 1ZK1A 1GFSA 2CD9A 2DU8A 4LVUA 5TSDA 3TFOA 3GEDA 4DXHA 1PJSA 4R1TA 4URFA 2X1HA 3Q11A 3H2SA 1TT7A 2DC1A 3S2IA 3IKVA 4RVUA 4RDIA 5K9ZA 4CV0A 4EJ6A 3TQHA 3BMQA 1NR1A 3JQFA 2EKLA 3NDIA 3QSGA 5ENVA 4P4GA 4ZU3A 1U7HA 4UEJA 2VHVA 4CM1A 3AOEA 4GSLA 1BDMA 3ANMA 2R2GA 4OOEA 3FN4A 4J4HA 3WJAA 1P74A 3ZNNA 4TKMA 5A03A 5IDWA 3Q0EA 3RWBA 3PPIA 3NX4A 3S2EA 4ZQEA 3PP8A 3QVOA 4MVJF 1UZNA 2Q2WA 4NZ9A 4KDEA 3ORFA 3U4CA 4FFLA 5KNLA 5JAMA 2Q1SA 4C7JA 1WWKA 4R51A 1G6KA 2VHWA 3PJDA 3W8FA 2AHRA 1VL0A 4OYRA 5KVQA 1E7SA 5T67A 3DZJA 3RJ5A 2WJPA 4CMHA 3NDJA 2O50A 2GN6A 2A9FA 2PY6A 4LMPA 2FZEA 2O3TA 3S2FA 1VLLA 5I7FA 2HO5A 4GLOA 4JJFA 5TJHA 3WB9A 2J3IA 3OP4A 2Y1FA 4RF4A 3GHYA 4WKGA 3ANLA 4W4TA 2EKPA 2GZ1A 1YB4A 3OQ1A 3RU7A 1ZMOA 2JD0A 1X1EA 2GO1A 1HSOA 1ADCA 3DBLB 3I3OA 4CL8A 2D4AA 2Q3EA 3HDQA 3O8QA 1ONNA 1XWFA 4IBOA 1QXSA 1PGJA 2CVQA 3RIHA 2NTJA 4WASA 4JBHA 2Y66A 1H93A 5JAZA 1DAOA 2GNAA 1XQ1A 2HMVA 5A05A 3ZWOA 2JCYA 4AJOA 3V2HA 3R1IA 5L40A 1WMBA 4Q39A 4WLNA 2P5UA 3HWRA 1ZCJA 3UN1A 3RC9A 1K2WA 3VH4A 3WG9A 3BMOA 4UVGA 1Y9AA 4UUPA 4K26A 3O9ZA 3PDJA 1N9GB 2X5JO 1LLQA 5U1PA 2VHXA 2XF8A 1VSUA 2PGJA 4FJ1A 4B7XA 2NUAA 3QHAA 3KRTA 3PK0A 4AJIA 1UXGA 3AM3A 3N7UA 3TL3A 3DHYA 3JQGA 2HMUA 5TLSA 1H2HA 3AY3A 2X9NA 3IL2A 4BGEA 1QYVA 3ASVA 1NASA 3ZNPA 3T7CA 3GMDA 5IJZA 2X8LA 1P44A 4PZCA 4LVCA 4RF3A 5ENDA 3OA0A 3DXFA 3V1YA 2JFHA 1DC5A 4QEDA 2B83A 3TN7A 1R6DA 2ZB8A 2XAAA 1ZNQO 1U4OA 4PVDA 1ZSNA 1Y8QA 1EK5A 2OZPA 5ITVA 3DDNA 3VPFA 1SBYA 3PHJA 4HWKA 4PG7A 4S1VA 3WGZA 1RM3A 4AJEA 1YH3A 1PJ2A 3IKTA 4PFJA 4PLTA 3FCOA 1CJCA 2X5KO 2FPPA 2E6UX 2PGLA 1NYTA 3KYBA 4YJDA 1EBUA 3GAFA 3OIFA 1DLJA 2JFGA 1XLTA 2ET6A 4PLYA 5EQFA 3RKRA 5L4SA 4K1LA 2CVOA 4CUZA 1RPNA 4L74A 3ROMA 3N74A 4IQ0A 2VZ9A 2ZIZA 4DQXA 1E7WA 1Q0HA 3IAHA 4FGSA 2UYYA 1O9BA 3CZMA 3ZNOA 3B20A 3GLQA 1O94A 4OXKA 1LXCA 1E3JA 3KO8A 4MIEA 4NFSA 2PD3A 4GX5A 3GGGA 4F46A 1ENZA 1GV0A 4Z0PA 3I4FA 1BWSA 4GKBA 3PZBA 3NEPX 4B3HA 4BNYA 4JIGA 1U3VA 1WMAA 3QE3A 4GQAA 3MCVA 1NQOA 3WDSA 1A9YA 3WMWA 3ETGA 3C7AA 5JO0A 5EL0A 2R6JA 4KTTE 4E5NA 4CQLB 4R5MA 3NJ4A 3MOGA 1NPYA 4FPXA 1TT5B 1GR0A 3ETEA 4CLXA 3JQDA 3FSRA 2D1YA 4Q3AA 3BA1A 1H2BA 2NM0A 2VRBA 3KSUA 2NVBA 1DJNA 4U7WA 2I65A 4B3JA 4DRYA 1GQYA 1PGOA 2EG9A 1IL0A 2OOSA 1HYEA 4AL4A 1LRLA 1FF9A 2VNAA 3GHHA 4A2CA 2P91A 4GWGA 1BXGA 2QZ9A 3AOGA 2PK3A 1PU2A 1K3TA 3JYPA 1T4DA 5TIIA 1PWXA 2VRCD 5KKCA 5G4KA 1I8TA 3ZHXA 3KTDA 1Y8RB 5KVVA 3UUWA 3FWNA 1FXSA 1B14A 7MDHA 5T6BA 3WYBA 4CM3A 2AW5A 2GPTA 4LMRA 1SZJG 4P4LA 1KOLA 2ZQYA 4LRSB 3B70A 4NK4A 2NNLD 4BKQA 4O63O 3MOIA 4A73A 1MC4A 4D46A 1XR3A 3GZ4A 1T25A 3AUUA 2HKIA 5I9LA 3F4BA 4W82A 1D7OA 3DBRA 1B0AA 1DIRA 1GZ6A 4UVEA 2BHLA 1R0KA 4RPGA 1TI7A 3DZKA 5LCXA 3WQSB 5CEJA 3MTJA 5FWNA 2PH5A 1GV1A 3ZU5A 2VWPA 4IQ8A 3H3JA 1AHHA 1XU9A 2JHGA 5GZ1A 1BTOA 1MFZA 4NBUA 1Y81A 5HRUA 3B1JA 1Z6ZA 3AY7A 5JMWA 4BO2A 5A04A 2C82A 3ZWVA 3NAQA 3QRWA 4XDYA 4Z9FA 2DTXA 1WVGA 3K73O 3K2EA 3TL2A 5AVOA 3D4PA 1LU9A 5DNAA 4KWIA 2X9GA 4OKNA 1OZAA 4NFYA 3PGXA 3QY9A 3JQ7B 4GX0A 5KJEA 4L4RA 1VRWA 2C7VA 3C3XA 5THKA 1LLCA 1C1XA 5KVCA 2O3SA 3OFSA 3FPCA 4CM5A 4A10A 1C3VA 3FR7A 2IXBA 3GVPA 3DO5A 4BB5A 2PNFA 2X7HA 4IGFA 4WCFB 2AE2A 4BV8A 1BMDA 5L7WA 5FI3A 3L77A 3D5QA 4FW8A 1VKNA 4ND5A 2HLPA 1R0LA 1NPTO 2ZJ0A 1QYDA 3V1TC 5DDIP 3RUDA 4QXMA 4IPTA 3IS3A 1MC5A 2ZCUA 4DMLA 5EERA 5ICSA 1LSSA 3H9EO 4WUVA 1YDEA 2PZJA 3FWZA 5KJFA 3ADOA 2EW8A 5A9RA 5BSEA 1IZ9A 2O3QA 2VYNA 3GG2A 1O95A 1QG6A 2VOEA 1CF2O 1PGQA 1KS9A 4TZTA 3U5TA 3ZWPA 3GG9A 3DTYA 1BW9B 3R3JA 3BTVA 3QVXA 3OHSX 2BD0A 1TA4A 4GKVA 4M54A 1U8XX 5G0SA 3TNLA 3WFJA 4OJNA 4BNHA 3QIVA 4N5MA 4OQZA 2D0IA 1NFQA 3OQBA 1GZ3A 1I33A 3M2TA 3OEYA 4OOFA 4A7PA 1X0VA 1LRKA 4JJGA 1AXGA 1CRWG 3WWZA 5EIOA 2Q50A 3ZWWA 3G79A 1MX3A 4JROA 5L4LA 1CETA 1PS8A 1PJLA 4IMPA 3V5NA 4WNIA 3WGOA 3TZKA 4BNFA 4L9RA 3BYZA 3IJPA 3I9KA 3NRCA 4BO1A 5AXDA 4MKXA 3VC7A 2CZCA 3WTBA 1U2DA 3KETA 3QWIA 4MVJD 1W4ZA 1QLHA 4J2OA 2NQTA 4YBZA 4R9SA 3T4EA 4D3DA 1YQXA 1JWBB 1NVGA 5KWEA 4GMFA 3I5MA 1Q0QA 2EJVA 3RU9A 3AI3A 5CPBA 3FTPA 1E92A 1KYQA 2WD7B 5MDHA 2PH3A 1ISGA 1LLDA 3DBLA 4K9DA 4W9NA 5B12A 4IJVA 2OHXA 5U9CA 5JC8A 3HJAA 5BT9A 4E6PA 1X1TA 1KIFA 4R9RA 5JAIA 4XQ9A 5JCJA 3WLFA 3WIDA 1E3WB 1JU9A 2FY8A 3WGQA 3R0IA 3RUAA 3RASA 3TZQA 1UAYA 5BR7A 2DPGA 4GPD1 1O5IA 3UVEA 2Y1GA 4B8WA 2HAEA 4NH4A 5DZSA 4UVHA 1N1EA 5FI5A 3D4NA 5JDCA 5I7SA 2WD8A 3KSDO 1IHYA 5DULA 3AY6A 3NT4A 1PS9A 1R4NB 3RSHA 1Y1PA 4R69A 3I9NA 3MJVA 4D3SA 1BXZA 4KQWA 1NAHA 4QT0A 5G0WA 2OL4A 3W4KA 1SC6A 3GN1A 3T4XA 1C0KA 1YVEI 3NTRA 4O59O 4WOJA 4Z9YA 1W73A 1B3RA 2XOXA 4EYEA 4BIIA 5L4NA 2VWHA 1H6AA 4UVDA 3ABIA 2BGKA 3DZIA 1T2AA 1KEVA 1ONOA 1E7MA 2ZYAA 1Q7CA 2BI7A 3HB4X 3ZCXA 4IY1A 4Z3KA 2PZMA 4L76A 3JCZA 3TF5A 1WP4A 4II2A 4YT2A 1BG6A 1V3TA 3RFXA 4IM7A 3DB2A 2NVUA 4L8VA 4BQRA 1J0XO 3PIDA 4IQGA 4AJ4A 3GT0A 1RYEA 4CLRA 1BXKA 2QYSA 2UV8A 4GAEA 4W99A 5HM8A 1Y9EA 3WGHA 1A4UA 3AFMA 4CMEC 1I30A 4DIBA 4BNKA 3L6OO 1MG5A 5JDIC 3DOOA 1DJQA 3WR5A 1EVYA 1E1LA 3U09A 2VUSA 5B37A 1PEDA 2DQ4A 3SLGA 3DZGA 1ZK4A 2YHUA 4DIFA 2Y0EA 3JQ8A 5CAEA 3AUAA 1CDOA 1U7TA 1FDTA 2BGMA 1FK8A 2H5LA 3RAJA 1YL6A 1G1AA 1N5DA 4IINA 2X0JA 3WNQA 2R00A 2YYYA 1I3KA 3BTOA 3PVZA 4J1QA 3GVCA 4CM9D 5COAA 2YW9A 4Q3BA 3E5RA 1PZGA 2CSUA 3OMLA 4GLLA 5DOVA 1J6UA 1P1HA 3IDSA 3GN2A 4HUJA 4FS3A 4TVOA 4E13A 1IULA 4CQMB 3QQPA 4MIOA 2EEZA 2AEFA 2C5AA 1R66A 2FRDA 4N54A 1AHIA 3BIOA 1PZEA 2IRWA 5DBIA 3WOHA 3PQEA 4JQCA 3PXXA 1TT5A 1DC4A 4F3YA 4PVCA 1WPQA 3CIFA 1YGYA 4EEZA 3FR8A 2P9CA 5I7EA 3NT2A 1EUZA 2HJSA 3FPLA 3I6IA 4PLWA 1T26A 2QRKA 3JQFC 1Z7EA 3OEWA 3QP9A 3L6EA 5IDYA 3SVTA 5C3MA 4GL4A 3AOEC 5EJ2A 1JKIA 2IYPA 1DIGA 2V6MA 1ULSA 2PKQO 3PJEA 4PRLA 1XU7A 3K6JA 1CQIA 2IEBA 5FYDA 1UJMA 4RVSA 1QV7A 4RPHA 3EHEA 5TT1A 1K89A 4WLFA 3M2PA 1RJWA 1Y8RA 3X2FA 2LDXA 4YRDA 2RAFA 4RQUA 4YYZA 4D3FA 1ML3A 2O23A 4YQZA 2RHCA 3GFGA 1C14A 2GZ3A 2E37A 4HFMA 3LLSA 4GX2A 4JX8A 5DT9A 2GLXA 4Y9DA 3FBTA 3FF4A 4FFPA 5C7OO 4XGKA 4QUKA 1I5RA 3CTMA 4AJ1A 2BMAA 3KOUA 1ENYA 4OSPA 3DEYX 1Z82A 5L9AA 1WDLA 1XCBA 1V3VA 1MUUA 3EDMA 4H15A 4OXNA 4D44A 3HDHA 5K0ZA 1KVTA 1DIBA 3JYQA 3ZHYA 4UEKA 3AI1A 4CMBA 5CPFA 3EVNA 4MVJH 3MWDB 3RQSA 1CERA 8ADHA 4FFNA 1XHLA 4E0BA 2FZWA 1I2ZA 4LISA 1IPEA 4O6VA 1NBOA 5LDGA 1G0NA 2UUOA 4EITA 4MDHA 2D2IA 1LBEA 3JD0A 2JKVA 4MP3A 4BVAA 5F1OA 1NWCA 2WYVA 2XXBA 1P45A 3WQRA 2AE1A 1UP4A 2YDXA 1ZXBA 1RYDA 1E3LA 4FOOA 2F1KA 1NVTA 2Q1TA 4B4WA 1LLUA 1PJBA 1RM0A 5F5NA 2FSSA 3PFWO 1GY8A 2PD4A 1FJHA 4CMIA 3EYWA 5CDUA 2JCVA 4OIMA 2UDPA 3V8BA 5JFOA 1KEPA 4FFOA 5L3ZA 1X15A 4XKJA 2EIHA 3CE6A 1PTJA 1W8DA 2DBQA 2W2LD 2NADA 4FCCA 3HSKA 3ICCA 1ADBA 4J4TA 3L9XA 4IS2A 3M1AA 3LZ6A 2PGDA 5HBRA 1YL7A 3ZGYA 5A3JA 2HJRA 4DUPA 1ZEMA 4BNNA 3GUCA 3NUGA 3F4LA 3OJFA 3KYDA 3RJ9A 1QYXA 1U3WA 3EZLA 3FNHA 5B4VA 2CMDA 4NBVA 1OFGA 4R16A 1NNUA 2C2XA 2VRCA 2ZK7A 3MTGA 2A92A 4NFHA 2EHDA 2ZJ1A 1EDOA 2YJZA 4R1UA 3V1UA 1Y7TA 1PL7A 5GZ3A 1T2DA 1GUZA 4Q3CA 4I9NA 4YR9A 3E03A 2CUKA 3TDKA 3D4OA 3P5SA 3QW2A 1N7GA 4XB2A 1R15A 3K92A 4HKTA 4ROSA 5DOZA 1B3BA 1D1SA 5TS3A 2JD1A 4XGIA 4E32A 1NQTA 2O4CA 4ND3A 3SBOA 5I8ZA 1Y5MA 3HB5X 4W7HA 4Y6SA 4JJIA 3GPDG 3ZV6A 4ALIA 1ADFA 1KC3A 3UCXA 3JD3A 2NWQA 2Q4EA 2ZTMA 3D5TA 4YAGA 4FIZA 4PLGA 4BNJA 2NQ8A 3TWOA 4GH5A 3SJUA 4RL6A 4Y98A 3ZWNA 1HEUA 4RZIA 4N7RA 4YACA 4XDZA 4JCOA 1KVUA 2ZTLA 1LI4A 4NQZA 3F3SA 1UDCA 1N2SA 4F6LA 4UULA 3LU1A 3JQ6A 3W8DA 2C7GA 1OC4A 2RBEA 2X9VA 2Z5LA 4GGPA 3X2EA 2C07A 4YWJA 1LC3A 1ARZA 5G2OA 3HN2A 3WNVA 2OBNA 2P9EA 3UCFA 4GI2A 1EK6A 2WD7A 3U4HA 1XGKA 4J4BA 4QO7A 4J0EA 3TJRA 2NACA 1P1FA 2YDYA 5K6AA 4E31A 2X6TA 4GBJA 5A5EA 4Q3NA 2AQ8A 2Z1NA 2CDAA 4LK3A 3ZU3A 1MV8A 3PI7A 1L7EA 3DHNA 1LTHR 1TEHA 4G5HA 4Y6PA 3MJCA 1ZH8A 5JY6A 1SPXA 1XSEA 1YWGO 4NIMA 4CLOB 1U2GA 4Q3EA 2BGLA 3I9MA 1X7GA 1GDHA 1TVEA 4XIJA 4BNVA 4ITUA 1PX0A 3ROQA 4KWHA 2Z1MA 2J5RA 3WQQA 5DP2A 2EF1A 2FR1A 1JVSA 4DVJA 3DAPA 1T2EA 1PQPA 2GERA 1S7CA 2I3AA 4O1MA 1R4NA 3NGLA 3GPIA 3ZDFA 2ZB4A 3U0BA 2GRAA 1WNTA 4BS9A 5IAAA 4PLHA 4NBWA 4DQVA 4AG3A 3LT0A 4BKRA 2PKRA 1UZMA 1JN0A 2Y1CA 3EVTA 1IE3A 3ZI0A 2UVDA 1LEHA 1DIAA 1JAXA 4DPMA 2Q1UA 4ZQHA 5TF4A 4RGBA 2A4KA 3VPHA 2W2KB 2X58A 1ZO8A 2CDCA 1KBZA 3HG7A 2BI8A 2ZYGA 3P2YA 5JXWA 3EY4A 3V2GA 1PZFA 3FTNA 1GEGA 2HMWA 4CMCA 2NSDA 4D42A 4MO2A 3G0OA 5F1KA 1VM6A 1GCUA 4IDAA 3BTUA 3Q6IA 2BKAA 3QWFA 4MVJA 1QYCA 1HSZA 3D1LA 4FB5A 3GFBA 3OBBA 3OA2A 1PJTA 1SO8A 2BFPA 3I52A 3PQDA 4XJSA 3A28A 1GPDG 4NJOA 4RORA 1R4MA 3GRKA 3R3SA 4KUHA 2OFPA 3B1FA 3CUKA 4CM7A 3SEFA 4AVYA 2EWMA 4U0JA 3F47A 3ASUA 5IZ4A 5JYEA 4RPJA 4OMUA 1LDBA 5JAQA 3MJSA 1NPDA 1QYWA 4YJFA 5CG1A 2HMSA 1A4IA 2OGUA 3E9MA 1VI2A 1O6ZA 2GZ2A 4CR8A 4E21A 4PLVA 4XCVA 1DLIA 3OF2A 4QFDA 5FF9A 3HQ4O 1ID1A 2D3TA 5AXAA 4ID9A 3CKYA 2AQKA 4DBZA 4YAEA 5T64A 5KIAA 3WGIA 4DLBA 2C0CA 2Y67A 4BNIA 5JE8A 1X13A 3ZHZA 3RUHA 2IYOA 3STHA 3LVFO 1HDZA 3E9QA 4AJ2A 3ITDA 1GL3A 2Y99A 3KSZO 4BO6A 3TZ6A 2VCYA 4EUEA 1LNQA 4IDEA 2A35A 4CM6A 3DFZA 5CEEA 2HUNA 4E12A 2IE0A 1YOVA 4B3IA 1LUAA 2O7QA 5HTOA 3NKLA 4RVDA 4XA8A 5L7TA 3ZWBA 2VZ0A 2IDZA 3PYXA 3GUYA 1MB4A 4R4JA 1A72A 1Z74A 2X22A 2EP5A 3NT5A 3V2UA 4BO3A 5I7VA 1HL3A 4WLEA 4BNGA 3HFGA 4R68A 3LK7A 4XR9A 2ZTUA 3AI2A 4K28A 3RUIA 5CFZA 9LDBA 1OOEA 4ZVVA 2W98A 4CLHA 2XXJA 4EUFA 1UAGA 3K5PA 3UHAA 4NDNE 3RUEA 4J7XA 3JQBA 1UUFA 2WM3A 1YB5A 1EQ2A 5G0VA 2D5CA 4R3NA 1YKFA 1ZK0A 4DYVA 4BO5A 1YJ8A 2ZQZA 2AG8A 3GGPA 4YAJA 1NAIA 4I9HA 3K9QO 5TQVA 3K30A 2OMEA 3GNQA 5IN5A 4A0SA 2H63A 4DA9A 4YPOA 4PRKA 3ROKA 3PWSA 3TSCA 4JK3A 1KEUA 4UEOA 1C0IA 2Q99A 1U5AA 4TVBA 4JBIA 4CM9A 3AM5A 4W9NC 4RF2A 2VTDA 3D3WA 1D4FA 2J8ZA 5ER9A 1QR6A 1YS4A 3RCBA 3A14A 3NGXA 4R01A 1HDYA 4AJHA 2YQ4A 1VC2A 4L75A 1A7AA 2B36A 1UDBA 4YEDA 1ISFA 3ICPA 3G1UA 4BGVA 3VDRA 3QWHA 2QZZA 4ND2A 2FPGA 4MPDA 1EEHA 4IMRA 4IZIA 1HXHA 4DMMA 2Y05A 5JDCC 1PWZA 4JLWA 2DBVO 2RIRA 3OJ0A 5COQA 5H81A 4OQYA 5IDQA 3AFNA 3ZWCA 1KEWA 3I4CA 4DPKA 5F3RA 1EZ4A 3TRIA 2QIOA 1B2LA 4JNKA 2WEKA 2EW2A 3BZUA 2VQ3A 4FFMA 2J6IA 4BNXA 2YHIB 3H2ZA 3GGOA 3FRJA 5TT0A 4WLVA 3H9UA 1LDGA 5U4QA 3WGGA 4IJKA 1TB4A 1Z7BA 3O26A 4M86A 4I5EA 2AEJA 1E5LA 3L4SO 3VAZA 2OORA 4OKIA 4II3A 3U4DA 4OO3A 4RCVA 1R0SA 2Y68A 2HK7A 5GMOA 5A3VA 1DPGA 4YJGB 5THQA 3P2OA 3TPCA 1P1RA 3UICA 4YRBA 2C59A 1PQUA 3RFVA 3IUSA 1GYRA 2O3RA 2V6FA 1HWYA 4ILKA 3F5QA 3IC5A 4H16A 2VYVD 4ONEA 3QVWA 1Z45A 3WFIA 5A5FA 4ZA2A 1PJ4A 1X0XA 4UREA 4YT4A 2X5OA 2JD2A 3RVDA 1UXIA 2OP0A 3GNTA 3AJRA 2DTEA 3DZHA 1T4BA 2PV7A 4TKLA 2YV3A 1U8FO 4YXFA 5FFFA 4HADA 1KY4A 3FD8A 2WTBA 1MXHA 4CMJA 1P0CA 4CM4B 5JW6A 5A9SB 5KJ6A 3VDQA 4YJHB 1IHXA 3DZBA 1DO8A 4HY3A 4BNZA 5BNIA 4RVHA 2R00C 1VE9A 4IIUA 1VJTA 3SLKA 1MA0A 3ONDA 3WMXA 1DDOA 2FSVA 4AFNA 3C24A 1JLLA 1HLDA 3JQAB 4WK6A 4BO8A 1OC2A 4NK5A 3C7DB 3TOXA 3PJGA 1ZXLA 1QP8A 3I6QA 2W2LA 3CMCO 4HNHA 2PKQP 3KUXA 3BMQB 3QV1A 1B8VA 2ILTA 1JAYA 3L4BA 3BHJA 2B5WA 1UP6A 2Z95A 4ZQGA 3ZWAA 4F45A 4DGSA 5DBFA 3BMNB 1E1NA 4B4OA 3JTMA 4EJ0A 5L45A 1AXEA 3RC1A 2VOJA 4FFRA 3GH3A 2BFAA 3OIDA 1PSDA 4TWRA 4XB1A 3DOCA 1PL8A 4BMNA 4E2WA 2WSBA 2Q46A 3UAGA 3DBVO 4F6CA 4PCVA 3AUSA 1C0LA 2RHRA 4IJWA 5J23A 2NU9A 4N5LA 1HE3A 4CQMD 4J1TA 1D1TA 3UF0A 1LDMA 3EW7A 4FJ2A 3EK2A 3RC2A 3AUTA 1I24A 4DREA 1J49A 4DL9A 4DBVO 3IJRA 4R5HA 1N9GA 1A9ZA 4CLEA 3IUPA 3LYLA 5FEUA 3SC6A 3IP3A 4PLZA 1UXKA 4S3MA 3JD2A 1E6WA 4IGEA 1Q0LA 4W6ZA 3SX2A 1V6AA 4J9VA 3H65A 4EW6A 4KMSA 1PZHA 1T2FA 3PTZA 1C1DB 3AM4A 3H5NA 4IJUA 4OSOA 1I2BA 5JNLA 1ENOA 5TX7A 4QECA 3IQDB 3K31A 3PDUA 1DOHA 4ZGWA 2PTGA 2PWZA 2PFGA 3E82A 4J1SA 3ST7A 1MGOA 4ZICA 2VHYA 2QQ5A 1U1IA 1LDNA 4INAA 1JQBA 3I83A 4DLAA 3LC1O 1JDJA 2V65A 3C1TA 3FI9A 3JYNA 4FR5A 3DTTA 3PHLA 2BF7A 4PG8A 1M6HA 5F5LA 4Y8VA 2FR0A 3ETDA 1SB8A 5IG2A 4DTIA 4XYEA 5B4TA 2E48A 3A1NA 5H83A 1EE2A 1JKFA 3IMFA 4PZEA 4I5FA 2DAPA 4U5QA 4EZBA 3KYCB 2EERA 3H9JA 3JQGB 3WSVA 1UDAA 4CPDA 2VN8A 2EV9A 4AJKA 2DPHA 1SNYA 2GASA 4XWYA 3W6ZA 3OJOA 2DKNA 3QVTA 4BKPA 1SAYA 4RPLA 1UH5A 5ILOA 2PZLA 2D5AA 4DQUA 1FDVA 1AE1A 3DC2A 3L07A 1PQWA 2TMDA 1B26A 1OI7A 4LGVA 3MEQA 2GCGA 2DLDA 3NTOA 1Y8QB 3DFUA 1HDCA 4BNUA 4CMGA 2GD1O 3ZW8A 4HBGA 3H7AA 3QLJA 2BH9A 1ZSYA 3M6IA 2X86A 3MWEB 3QWBA 1T2CA 4Z0TA 4CQLA 4PN3A 4J90A 4MVJE 1K5HA 1NQAO 2NTNA 4YQYA 4YAKA 4MP8A 1TXGA 2XPCA 3L9WA 1XIVA 2OP1A 4E5KA 4BGIA 5GZ6A 3RD5A 2FR8A 4XEHA 1GU7A 4AICA 3PJFA 2J3HA 1JVBA 3CH6A 4N5NA 1RKXA 3DR3A 1YXMA 3NYWA 2NU8A 5J9GA 2SCUA 4CV1A 2YV1A 3GQVA 3L0DA 3IOYA 2O3UA 1PJ3A 4D45A 4HV4A 4EUHA 4ALMA 1HE5A 2LDBA 3OJLA 3HNPA 3ZWMA 4FOSA 2Y1EA 1OBFO 2ZATA 3B1KA 1XKQA 4ZN6A 4M1QA 5A02A 2NVWA 5MGBA 3GVHA 1WXDA 4ZQFA 1HTBA 5K6AC 3GOHA 4ND4A 1KVSA 1NHGA 3O03A 1BHSA 4OH1A 4E2YA 1XEAA 1LQTA 2B5VA 2WDZA 4AJPA 4IDGA 2WYWA 5DCUA 3LSYA 5JO9A 4OM8A 3ONFA 5C7LO 3C7CB 2B4RO 4LRTB 4MINA 1KVQA 1BVUA 1H6CA 1E7RA 1HETA 3K8ZA 5CHEA 3K96A 2VT2A 5BNFA 5JC1A 2Y1OA 4NU6A 3S1LA 2JAHA 1M66A 2I76A 1H94A 3F1KA 4RO0A 2CDBA 4JGBA 3CSDA 1WAMA 3OIGA 5F21A 2Y93A 1M75A 2J5KA 5T8KA 4J91A 3UOGA 2YQ5A 2E49A 4XR4A 5BNTA 4DWVA 2BLLA 1Q7BA 2C29D 2QG4A 1DXYA 2AQHA 5G4KB 1ZEJA 2DT5A 1SMKA 1BGVA 3JQ7A 1Y6JA 4H3VA 9LDTA 3VZPA 1ZFNA 2Y1DA 5TGDA 3WIEA 4MVJP 3OQ6A 2NU6A 3E9NA 4LSWA 4IDCA 3PLRA 1Q7GA 4P22A 2DBZA 1QRRA 4J3FA 3VVCA 4GWKA 4BO0A 2QX7A 3I1JA 4WCFA 2EP7A 4ALJA 2JFFA 3VPXA 4KZPA 1HKUA 1P0FA 1DRWA 2YY7A 3ZWYA 5ADHA 2CNBA 4NJMB 1QMGA 1KERA 2B0JA 3GVXA 5H82A 2FN7A 3RC7A 4U8GA 5IZCA 3DBRB 1ISIA 1DC3A 1ZUD1 1PL6A 4WEQA 5ILGA 4KQXA 4WJZA 2X0NA 5ES3A 3DMTA 1A7KA 4FC7A 3RBXA 1YDWA 2G0TA 4RVGA 3RUCA 4AJLA 3H5AA 5JYFA 3HHPA 4UUNA 5B4UA 1WDKA 2RH8A 3WICA 1YBMA 4N18A 1AUPA 4CV3A 1BW9A 1ZSVA 5BQFA 1E7YA 1GADO 1XDWA 3EGOA 3I9LA 1NWHA 2GF2A 1GZ4A 5JYAA 1MXFA 4J0FA 3T7EA 1C1XB 2H6EA 1WDMA 3VHRA 4CM4A 4E33A 5A9SA 1QSGA 4WLUA 5ER6A 3N58A 4O0LA 1U3UA 2HQ1A 4ZQBA 2YFHA 2YFQA 3PGJA 5C5IA 5IXYA 3VZSA 5HA5A 2C54A 2DUUA 2P4HX 4KP7A 1T1RA 5IN4A 3H6KA 4EBFA 2NTVA 4G65A 3GVIA 3W1VA 2ZTVA 2P68A 4ZRMA 2CF5A 3EZYA 5A06A 1XELA 1GPJA 5G4LA 4PG4A 3ULKA 4MKRA 1DC6A 1GQQA 4J6FA 1P1JA 1GYPA 4WECA 5AQ1A 3Q9UA 3BMCB 1NHWA 1LSUA 1U5CA 4NMHA 4PLFA 3DAGA 4GVXA 4BV9A 4YTEA 5AXCA 1UXJA 3OETA 4G81A 4ALKA 4CM8B 3BMNA 3HN7A 1J5PA 3TFQA 5B1YA 5CDTA 2HCTA 3RBVA 1LDEA 2E82A 4IIVA 4KUEA 3PIIA 3U3XA 4NU5A 4BHTA 1N8KA 1GUFA 2YUTA 3OM9A 3QVSA 2G76A 3GF4A 5JLAA 1P31A 1EE9A 3CZRA 3PHGA 4LSMA 1EQUA 4L4SA 4NG5A 2HK8A 5CP8A 1SEVA 1E3WA 1HE2A 2GR9A 4WEOA 3F1LA 1IZ0A 2H1SA 1YB1A 3VPGA 3U62A 3KV3O 1XYGA 1P77A 4PG5A 2TMGA 2X0RA 3ADPA 3WXBA 3ZU2A 2AG5A 4FJ0A 4ALNA 1C0PA 2J5QA 1NFFA 4J1NA 3G49A 1E3IA 3VH2A 4A03A 4BO9A 2IZ0A 3KB6A 3HFSA 2VYVA 3VVBA 4RZHA 4IDBA 5BSFA 2C2YA 3UCEA 3UH1A 1ISJA 3F5SA 4M55A 3CINA 4Y6RA 1AGNA 2ZB7A 3SC4A 3IP1A 2G17A 3JQBC 2V6BA 2EXXA 3K2BA 5DP1A 4RJTA 1V8BA 5T73A 2O7SA 2EKQA 1K0UA 3Q3CA 4YDRA 1WLYA 1RWBA 4B79A 4JN6B 1E6EA 1YO6A 2P5YA 3VTZA 3SJ7A 3UGKA 1C1DA 1BDBA 3GAZA 3JQ9A 3C8MA 2EGHA 1LSOA 1I36A 1RM5A 5ITWA 1J4AA 4J9UE 1GD1O 3PRJA 4M49A 5C37A 4FD3A 1LQUA 4I8XA 4R1NA 2GN9A 3WLEA 1V3UA 2EJWA 4BO4A 1HDOA 4TRNA 4LN1A 2DVMA 3ZHBA 4BGUA 2NU7A 2JHFA 3ZH2A 2P4QA 1N1GA 1EFLA 2PLAA 1EDZA 3JQCA 1CWUA 4UVIA 2OO5A 4MVJG 1U28A 1DEHA 3GR6A 1YONA 1IPFA 4C7KA 1SOVA 4BUCA 2QRJA 3PHHA 3LLVA 5IFLA 2O2SA 4D79A 5JBIA 5TRTA 4EI2A 3WSWA 1HF3A 3O38A 1IY8A 3KYCA 1MFPA 4CR6A 2P2SA 2ZB3A 1EVZA 2HDHA 3U49A 4CLDA 1H0KA 1DHTA 1IYZA 4BMSA 4I1IA 1V35A 2D8AA 1MP0A 2J3JA 1VJ0A 1JKJA 3U9LA 2GSDA 1UZLA 1YQGA 4XD2A 2HSDA 3DBHB 2AA3A 4P4NA 3QA9A 1YL5A 2W8ZA 1YRLA 1B15A 4YT5A 5JCXA 4CQMA 3JYLA 5DF1A 5EINA 4HFJA 1OAAA 5LDHA 4M8SA 2I3GA 4EDFA 3Q9NA 3KBOA 3DQPA 4CUKA 1GQ2A 2IZZA 5I8WA 4H7PA 1I3LA 5CDGA 2NVUB 3RFTA 3VOSA 3PYLA 4XRRA 1M67A 3A06A 4Q9NA 2CFCA 5T57A 4CLRB 4JXKA 1Q2XA 1SB9A 4FC6A 2VT3A 1H6DA 4OAQA 1DFHA 3I9JA 3DZFA 2GUGA 1PR3A 1DIHA 1F8GA 3G1TA 3IIEA 3JD4A 4J2HA 4PLCA 5CDSA 4Z6KA 1I2CA 3HZZA 3PLNA 4P38A 1NP3A 3GEMA 3INTA 2CY0A 3ZV4A 4RVFA 4BL5A 5KOIA 1EFKA 4K6CA 3ZWXA 2GYYA 1I0ZA 1F0YA 4D43A 4ZHSA 1PGPA 2I99A 3JQ8B 5BSHA 1Z73A 5I9MA 5A9TA 1JWAB 1YJQA 1ORRA 3RI3A 1HDXA 3VKVA 2AEMA 2X23A 2IEDA 5KCZA 4QO8A 4U0KA 3W4JA 1NX6A 5JSFA 1V9LA 3H8VA 4TROA 4TQGA 4ND1A 2Y0CA 5JS6A 3KM0A 1LC0A 4IUYA 3TZCA 3HUDA 2H9IA 1D3AA 4GVLA 4FQ8A 3ITKA 2PA3A 5L7YA 3VZQA 1HRDA 1H5QA 1KY5A 4XX0A 4XQCA 4B4UA 2IODA 4GSKA 1M76A 2WE8A 3UKOA 3Q2IA 3DOJA 4D41A 4XIYA 3LC2O 3G17A 3LF2A 2GN8A 4QTZA 3KVOA 3L4BC 3OICA 2JL1A 1ZBQA 3FNEA 1P1KA 4TRJA 5GY7A 1YE3A 4OXYA 1P9LA 4QFCA 3OECA 3VTFA 5CDYA 1M6WA 1V0JA 5TC4A 3KEOA 4KUGA 4YAIA 3C1OA 3NJ8A 2A94A 4IXWA 3C1AA 5AYVA 3VH3A 2BELA 5KVSA 4WE3A 3M1LA 1ISHA 1F17A 4DPLA 3GA0A 4UUOA 4E5MA 3BAZA 1FDSA 2B37A 3WS7A 1DRVA 4FSHA 3JQAD 4D7AA 4XZ3A 1HE4A 1HT0A 5JMPA 2OUIA 4BNTA 1NTOA 3WYEA 4DC1A 4Z3DA 4I5GA 4NJMA 2OBYA 4WPGA 2VNSA 2FP4A 5DN9A 1ULUA 2I6TA 5TNXA 4FBGA 3VH1A 4E2ZA 2IZ1A 4CV2A 3EUWA 3PYMA 1UXHA 1E77A 2X4GA 3PHIA 5TJ9A 4E2XA 1E6UA 3NV9A 1GTMA 2J3KA 3NTQA 2FMUA 2I67A 1Y5RA 1E5QA 2BFOA 3I9OA 5I9NA 1SOWA 4J49A 2V6GA 3O4RA 4A26A 3QWAA 3HE3A 4K6FA 5T5QA 4BB6A 5IDXA 2NLOA 3JD1A 5COBA 2BFMA 3WX0A 3JQEA 1OMOA 1I3MA 2AQIA 2Y0DA 1L1FA 2ZKLA 1HYGA 2B4QA 3WWYA 5EQDA 1ZK3A 2Q2VA 4CMIB 1H9AA 1CEQA 1CIVA 2E4AA 3INRA 1GAEO 5L95A 4BQPA 3ENKA 3BTSA 3C85A 1LRJA 1EBFA 2JAPA 1TLTA 3RUFA 2I9PA 1DB3A 2UAGA 1P3DA 1QV6A 5IXSA 2B4TO 1U9JA 4I5DA 1NR7A 4HXYA 4J7CA 5EESA 1F12A 3LF1A 4BOYA 1U3TA 2PZKA 4B7CA 3MJTA 1VL8A 3KYDB 4L0QA 2HMTA 4YCAA 1GYQA 3BMCA 3TZHA 4A27A 2UUPA 5DCWA 4PZDA 2G82A 1K6IA 2I66A 2F00A 3AK4A 4OL9A 2CVZA 4CR7A 5ICMA 4CM8A 4WOKA 1YBVA 4YT8A 4E4YA 4ZJUA 4RLHA 3RBZA 4NBTA 2YV2A 1Z75A 4XYGA 3EAGA 1A71A 3GZNB 1P1IA 1P33A 1CYDA 1ZVMA 3S55A 2DUWA 1MLDA 5C7IO 3ZN2A 2B35A 3GNSA 4PGFA 6ADHA 1E3EA 3E48A 5KKAA 4CLOA 2FOIA 4NHEA 1E1KA 3S2GA 1S6YA 5AXBA 5HWSA 2GN4A 3KLMX 4HP8A 4UAGA 4IDFA 3HDJA 1DFGA 1I32A 1ZJYA 2QYTA 3DMYA 3PEFA 3WBFA 4WCDA 5G0UA 2DFDA 3LT4A 1PGNA 4RQTA 2VWGA 3JV7A 3WGYA 3PFFA 2JJYA 1E3SA 4MP6A 1MG0A 3ON5A 1HDRA 2P9GA 4BKUA 5JPIA 4LCJA 2AXQA 4E5PA 4GMGA 1WZEA 4ALLA 2G1UA 1F8FA 4PG6A 4Q3DA 2G5CA 4XRGA 4MVJM 1HZZA 1NXQA 3D7LA 4MJLA 4Z9XA 2X0IA 3DL2A 3H5RA 3PZRA 2QW8A 3Q2KA 1WZIA 2POQX 4IZHA 4RPKA 1DBVO 4B8ZA 4CL3A 2W2KA 3WTCA 3F6YA 3E18A 3GRPA 1A5ZA 4YA6A 1I3NA 2DFVA 4WNCA 4NI5A 4IDDA 3JYOA 1ISMA 2PR2A 2PD6A 8LDHA 3W4IA 4XQEA 3R6DA 3GK3A 4J43A 4JP2A 1FDUA 1VSVA 5HS6A 5A1TA 3A9WA 4J7UA 1DFIA 1E7QA 3BHMA 1EVIA 4MOWA 4D0SA 2W90A 1DRUA 3ENNA 2VWQA 3CPSA 1HYHA 3VKUA 3O8QB 4TRRA 3LC7O 2VUUA 4AJNA 4PLPA 3ZW9A 3ZV3A 1K6JA 4BNLA 1E0DA 1A27A 3BHIA 2HRBA 1ZW1A 4GX1A 1LDYA 1BVRA 4NNJA 1R37A 2I5PO 1IB6A 1PIWA 5T8KC 4AJJA 4C4OA 3INGA 5HS4A 1YQDA 4XJTA 3PWKA 1GCOA 1HDGO 3AU8A 3WGTA 4MIYA 2DM6A 1KVRA 3AW9A 4IS3A 1ONPA 2Q45A 7ADHA 1VJ1A 4R41A 1XG5A 4ZRNA 1FDWA 3BMOB 3DBHA 4ZD6A 3KZVA 1FMCA 1X7HA 2Q22A 4WCFC 4UUMA 5L51A 2ZCVA 4XQGA 1U4SA 1ZK2A 1BRMA 4L4XA 1EUDA 2Q4BA 4WGGA 3P19A 1GUYA 3PWZA 3ROPA 4LW8A 4JP3A 5IZCC 4KOAA 1B16A 1HLPA 1W6UA 2VHZA 1ENPA 1F14A 2C5EA 2RH4A 4HFNA 3AWDA 4RF5A 3DMTC 1SCUA 2B69A 4DIOA 4B7UA 3ONEA 5L53A 1DHRA 3FBGA 4NBRA 1I01A 5AOVA 3ZU4A 3ZZNA 1R4MB 4RV9A 5EMHA 4Z0HO 2Q1WA 2O4UX 1XQ6A 3OSUA 4LCEA 4PIVA 1CQJA 3KEQA 4RDHA 3B6ZA 4ESOA 4YVFA 1N7HA 1VKOA 4P8RA 4FDAA 3VPSA 4NR0A 5DBGA 5LC1A 4YJFB 4HNGA 2OXIA 4MKZA 4I08A 3WJ7A 3GC6A 4U6QA 4D0RA 4BMVA 1RM4A 1ADGA 3KXDA 2IXAA 1DAPA 1LA2A 4OGWA 1O89A 1ZJZA 2NV6A 5A4DA 4YB8A 3GMSA 3S8MA 1LSJA 4TMFA 5M6DA 5EPOA 3QJ5A 3WYCA 1L7DA 2HRZA 2Q49A 3HDYA 1NQ5A 4GGOA 4TSKA 3RKUA 1T1SA 4B4VA 1H6BA 3L6DA 3BXXA 4EGFA 3ANNA 3CXRA 3D64A 3OH8A 5KJ1A 3EMKA 1VL6A 4EJMA 3G3EA 3MZ0A 4BNMA 2O48X 2CF6A 3W8EA 3GY0A 1N92A 1PS0A 4FGWA 1UP7A 3OJEA 1QORA 4M87A 4EEXA 4I9UA 1YOVB 3I23A 4U6SA 4DLLA 5KTKA 1ZKMA 4MVJI 5CEFA 4M89A 1QKIA 6LDHA 2FWMX 4E30A 2FPIA 5F1PA 4KTVE 3GDFA 4E5YA 4DYDA 1KETA 2ZYDA 4QX6A 3DAFA 4RLSA 1B7GO 1JTVA 3FHLA 3D0OA 3VZRA 1ZMTA 5KJCA 1IOLA 3DONA 4TRMA 3DHEA 2WE7A 1K6XA 3E6AA 3UFXA 1HZJA 1PJCA 2Q2QA 2GGSA 3EC7A 1WW8A 4OHUA 3KLPX 4HFRA 4NPCA 2HU2A 5DCYA 4YRAA 2W4QA 4L73A 1BXGB 4BKOA 3UW3A 1O0SA 3FNFA 2C20A 2JCXA 1H9BA 1F06A 2D59A 2YZ7A 4R1SA 1W0CA 2VYND 1B8UA 3E5MA 2VUTA 1VPDA 2WYUA 3F9IA 3UXYA 4CMKA 1X7DA 3RROA 3ZV5A 3U4IA 1EMDA 4O5OA 4FN4A 3LT1A 3TOZA 1B8PA 1EUCA 3AU9A 4HX5A 3DWFA 4CMAA 1LX6A 2VZ8A 5JY1A 2YHIA 4QSMA 5G0TA 3ZNQA 2EGGA 1EVJA 3E1KA 3GDGA 3LT2A 4J16A 1DSSG 2HK9A 3H4VA 3LDHA 3JQ9C 2O2YA 1JW9B 3D3WB 4Y67A 2DBRA 4XYMA 4G2NA 2DTDA 1R12A 5EN4A 3COSA 1D8AA 4XYLA 1G0OA 1BSVA 1ZZEA 4BNWA 1JA9A 1O8CA 1UR5A 4YJGA 3FNGA 3W6UA 4CODB 2QHXA 1X14A 4TZKA 2QRLA 3LQFA 2FHSA 1PR9A 3NDRA 4XGNA 1I10A 1ZIDA 1R16A 2BRUA 1PJQA 2WMDA 1QLJA 4BO7A 3WBBA 3KHUA 4X54A 3P7MA 3GEGA 2RCYA
chains in the Genus database with same CATH superfamily
2GDZA 1FP7A 3UC5A 2OO5C 1N25A 1WXIA 4JBGA 3LUGA 4NMMA 4N8DA 5AM4A 4BAGA 3CEMA 4CJXA 4EEKA 3HVUA 1IXYA 5D3ZA 1U0EA 1D2AA 3O5AA 1NM5A 4LEIA 4QDUA 4OH7A 1ZITA 4BCDA 1TTTA 2I6XA 4W7IA 1ZMRA 1BC5A 2VNJA 4ZHQB 3AKCA 3ROTA 1MJFA 1NJ6A 1U1FA 2JGKA 3H3FA 1D2HA 4A5OA 3NHMA 4MS3A 6Q21A 1OBOA 3DDSA 2HWWA 1FXWA 3RS8A 1Y5IA 4CE6A 1QHSA 1TUBB 4LDZA 4YJHA 5ALRA 1R0YA 2O1EA 3H9GA 5EEHA 3U2QA 3RC8A 1CUBA 4R3WA 2VPXA 3ME5A 2JDIA 3SSNA 5EIEA 3QMVA 3A25A 3Q1KA 3UK1A 1Z0DA 4E3ZA 1AKUA 2V7PA 4P83A 2ZIVB 2QE6A 2PMWB 2Y3IA 3ISJA 4ZT3A 4L78A 5AVVA 3JQAA 3P0RA 1ML4A 2O3JA 3TTXA 3ZDEA 1GFSA 5FWDA 1ZU4A 4YRTA 2W6MA 1N36B 1UFQA 2QKYA 4ZOCA 2X1HA 1TT7A 1A9OA 1YT5A 2OGSA 3FTQA 1OA0A 3S2IA 1WE2A 3IKVA 1ZVKA 3PD7A 4RVUA 4Q9KA 1AQLA 5KKNB 3Q7SA 5EUQB 4EJ6A 1NGSA 4L2IA 1T9ZA 2D3WA 3I6BA 2GBIA 3MSCA 2KLBA 3W7VA 1KEEB 4IUBS 3LPCA 4CF6A 2I7XA 3TL6A 3B2EA 5AM5A 3ANMA 3K0AB 2HJHA 1F5SA 2YXPX 3CISA 3FN4A 5A03A 3EWAA 9GPBA 1NOJA 3RWBA 3TB6A 3PPIA 2C3UA 1IDOA 3NM6B 3PP8A 3GU3A 3QVOA 2DPMA 4L95C 4B9AA 5AUNB 4L4YA 3F6SA 1OAKA 4KDEA 4G5YA 1ZCFA 4FLMA 1R27A 2IHBA 5AOCA 5JAMA 1I7BB 3IVMA 5A5VA 1QHEA 2F1JA 4IH1A 4INPA 1VJ5A 5FA8A 4EG0A 4DSOA 2B78A 1W0KA 3PJDA 3P4XA 4R1OA 2OT3B 4HZGA 1J8VA 1N2CE 3NRJA 3BKXA 3WRYA 1QIEA 2BSAA 1E7SA 1KJ8A 3WIOA 1D0SA 3WYDA 1QHHA 2GHIA 3EIOA 2PUCA 4TMVA 3ESAA 3KR9A 3GFQA 2BBSA 1EIWA 3BBLA 5FFNA 3RJ5A 4BFSA 1MDFA 4L7VA 4CMHA 5JD5A 2VA8A 1P91A 1PT6A 2GN6A 3MINB 2V45A 4ESVA 3TUTA 3MS2A 4P3PA 4PPYA 2Q6KA 4NOLA 4L72A 1VLLA 3FCEA 1SXJC 5TJHA 5JJ5A 1KI6A 1L7QA 3KB2A 3QPUA 2J3IA 3CLUD 4YV0A 3NIGB 4WKGA 4JA2A 2JGJA 2ZUSA 3K7EA 3SXUA 5M04A 1P3Y1 1VMIA 2IIBA 4B33A 4JWTA 1YHZA 4MDEA 4HGOA 2POCA 3RHZA 3W8NA 3PL5A 1HSOA 3NBFA 4IIHA 3WAKA 2Q3EA 4CL8A 3T9DA 4ZJZA 1OYYA 1DX6A 1II0A 1RVDA 4JOBA 1C7FA 4BEVA 1AQ6A 2FFAA 1PBTA 4NE2A 4B8YA 1TX4B 3HVIA 2H1FA 3RIHA 2NTJA 4C5AA 4EGSA 4UDOA 5JAZA 1ACLA 2F3PA 1XD2A 4WN9A 3ICQB 4RXTA 4EELA 1Y42X 2ZSAA 4OKSA 2QLNA 1Q1ZA 5L40A 3FMFA 1XROA 4Q39A 4M6WB 3UN1A 4BASA 1OREA 4UFPA 4QJBA 2XBUA 1UJ2A 2P6OA 2PV0A 2W6IA 4O4IB 4O1IA 1IN6A 3OX1A 2OZKA 3HNRA 4K26A 5ALUA 2WF5A 4YLYA 4YXWD 1U0FA 1MQSA 1S3SA 2JAXA 4Q3OA 3IEMA 1SBQA 4FEGA 5U1PA 4RD1A 1U0JA 4FIDA 1JIQA 1DINA 1N8TA 1QG0A 2AVDA 2FF7A 3IXQA 4L8GA 3WQHA 4AJIA 3A6HA 1QU3A 2Q28A 3SICE 2I4MA 1RAEA 3I5UA 3N7UA 3S29A 3TL3A 8AT1A 1Z6PA 3KZXA 1JHXA 4R83A 4RV5A 2D1SA 3QVJA 4M7WA 5AHRA 3PXAA 1BVHA 5CT9A 1QZTA 3RW9A 1PR1A 13PKA 2QUHA 1KDVA 4K7JA 1R18A 2BKLA 3GMDA 2B8NA 1R0CA 2X8LA 1B00A 4KN5A 5ENDA 3U1TA 4OXIA 3VQTA 3ET5A 4K81B 4DSNA 4E5VA 3J81k 1J7JA 3KQNA 2AK2A 3L0IB 4QEDA 1ZD2P 1BH6A 4RDCA 2HIGA 1X7XB 2XAAA 4WOCA 1Y8QA 3T7DA 3LQ1A 2NTYC 3CLRD 3OZTA 4QNRA 2LD4A 3DA8A 4EZEA 1ORHA 4KXLA 1JFLA 3VPFA 4Q7QA 3MGBA 5TMDA 4G5FA 3SIWA 1Q20A 4MPJA 4AJEA 1YH3A 3F3MA 3IKLA 2HA3A 4QRDA 1UBGA 2WJYA 5JALA 3Q8KA 1ZHOA 3G6WA 1WSAA 2VJMA 2X5KO 5HJEA 3DV9A 1RJFA 1NYTA 1Z06A 3KYBA 3ZE2B 2MR5A 1EBUA 4BYGA 4WACA 3QF7A 2DFTA 2JFGA 5L4SA 3RKRA 3WZMA 5J4LA 3NTXA 3DTNA 4RIIA 4LXQA 4TXNA 4HG2A 2WD9A 4KE9A 3AQIA 5ECDA 5CLFA 2IY7A 2P2ZA 5A5DA 1C8LA 2AUNA 2VK2A 2VZ9A 4F8JA 3U39A 3CJQA 3IAHA 3QE9Y 1G19A 1O9BA 3CZMA 4CCSA 1SA0B 1VJRA 1P2BA 4AY4A 4EHNA 4OXKA 3VSAA 1X8KA 4CF4A 4J07A 1P39A 1G3RA 1XRMA 3KO8A 2PD3A 4GX5A 5L8VA 3ONNA 3E22A 4Z0PA 4DG9A 3IOMA 4EKYA 1DTSA 1I6LA 4EI7A 4BNYA 4YWHA 2ZAIA 1U3VA 4NWIA 1EA7A 3HYLA 4KFSA 3MCVA 2D5LA 4MPPA 4XGQA 4JNCA 4YNBA 3BZWA 4JT2A 1N1MA 1Z38A 4UNPA 1P0MA 4D9NA 4H0FA 1DWUA 4KGZA 3PXDA 2PU5A 2OXTA 2G08A 1UJNA 3KOZA 3W7AA 3QFFA 1NYRA 1IK6A 1YR6A 2UYQA 1G8GA 1XMIA 1SHLA 3D8HA 4G9GA 4HNAB 4I3HA 4CLXA 3T1TA 1SK9A 3TBKA 2WQ6A 1NKSA 3O8LA 2VRBA 3P5BA 1DARA 2R85A 3CLTC 5JG7A 3TQQA 1HKHA 4U7WA 3OZIA 2A58A 4P36A 2EG9A 4CTOA 5JISA 4AWXA 4TUYA 3EF1A 1IL0A 2OOSA 1E5VA 4QU0A 5BV8A 3SQMA 1K7CA 3TSAA 3LTEA 4QBKA 4AL4A 3AGPA 4XLZA 2R4UA 5ALMA 1HT1E 4JP1A 1HOXA 4WADA 4TYNA 2P91A 4D4KA 1XYYA 3HEMA 4BFTA 1T6NA 2XLBA 4I55B 2FETA 1BMFD 4NABA 4ZU6X 5TIIA 1SXPA 5G4KA 1I8TA 3B6EA 1L7MA 3RSFA 2VTKA 3AEUB 3ZHXA 1Y8RB 5KVVA 4QJ4A 3UUWA 4HDNB 1CS4C 1H4TA 4M53A 5DBEX 7MDHA 3G88A 4LTMA 3QXGA 1JMKC 5J1TB 4X65B 1XVUA 4V39A 1SZJG 4EAQA 1L6RA 1BD3A 1HZZC 2BDEA 4HRXA 2DGDA 1HQYE 1SULA 3B70A 4MROA 3SHFA 2NNLD 5IM4F 2VP3A 3BRQA 1NLUA 3OHMA 4HAZA 2AFIE 4DM7A 2ERCA 3ENWA 3MOIA 2FFBA 4HZIA 1MC4A 1SC4A 4NU8X 5TMEA 1FFXB 4OMFG 2ZROA 1XR3A 3B5IA 1T25A 3AUUA 3BSWA 1NY6A 1R8XA 3F4BA 3GZ4A 2I9KA 1D7OA 3FOCA 2JAUA 4EKGA 2Q9CA 2Q5QA 2FGJA 3EGCA 3T0IA 2BHLA 1IXZA 3WQSB 4E1BA 5CEJA 2DH6A 4JLPA 3MCWA 1GV1A 4HX9A 3B9PA 2BEKA 2VWPA 5JR3A 2BMVA 4IQ8A 3QV2A 2F9FA 4EG4A 5AK5A 2J9RA 3E3OA 5KQLA 4LE1A 4OYHA 1MFZA 5IVKA 4CIVA 4MJ3A 2ZM6B 1YR2A 2QVBA 4MV8A 5KNDA 4M1EA 4BVFA 4MTLA 4CTMA 2C9YA 4F5WA 1RXCA 4RYLA 3QRWA 5LMUB 4Z9FA 2UVPB 2VSYA 3CJRA 1SWWA 4MR8B 1N2GA 1L4KA 1V26A 2B5OA 3OZDA 2NYUA 1V1JA 3G5UA 3IEKA 4ZO9A 3NAGA 3RRMA 2HA5A 5JEDA 1W9HA 3R0XA 2X9GA 4OKNA 3KKZA 1J97A 3EXHC 3SHVA 1E4YA 2DYKA 1PWEA 3PGXA 5IARA 2G71A 2ONZA 3OC6A 4JLMA 1Y98A 1LLCA 1C1XA 1W4AA 1GA4A 2B1GA 3ABQB 4TL8A 1CUWA 1NRWA 3OFSA 3A1EA 4DEVA 1PT8A 4BLVA 2ZI6A 2HHHB 2PNFA 1FP1D 1Z16A 1IEWA 1Z25A 3DE2X 1QIGA 4ZARA 1L8XA 1BMDA 3VU0A 1E2JA 1HORA 1MIOA 1TPYA 1U2ZA 5L7WA 3OJXA 4FW8A 3EEBA 4UBIA 4D96A 1IY0A 1T5DX 3N6VA 3QTBA 3NXKA 2GEBA 1T35A 4WXHA 4DEYA 3KJGA 3MMZA 2IV2X 4QXMA 4IPTA 3AH8A 1ZM4A 1YDFA 1HBJA 1N6NA 1IJBA 1MC5A 2Q3BA 2Z6VA 5CT5A 3X1DA 5ICSA 221PA 1OFTA 1U2TA 2QX4A 2PZJA 4AB1A 2BGGA 3RT7A 1LVUA 1G4AE 3ADOA 3UJ9A 3ZKAA 3A70A 3W78A 1ILEA 1IZ9A 4C0HA 1L5RA 3GG2A 1QMIA 3NM4A 2R11A 1N5OX 1L4HA 4CEIA 1E1CB 3WKDA 2E4ZA 3MTIA 3G0DA 1CF2O 1CR1A 1U0LA 5DYGA 1KS9A 3V48A 2J3MA 3SDSA 3U5TA 4GKKB 3GG9A 1GNVA 3DTYA 2CXXA 3BTVA 3QVXA 3OHSX 1DTWB 1TA4A 3BH6A 3KS9A 1FVXA 3BUSA 4M54A 4M8NE 2M6LA 4BNHA 1PKXA 2PTHA 3LJKA 4R3UC 4I1YA 3LHKA 4N5MA 3ZOZA 1L5OA 3PD1A 5MHTA 2BEWB 1HNNA 1GZ3A 2R1TB 2ZWPA 1GDDA 1HC7A 3M83A 3PI6A 3ZE6A 3M2TA 3IEXA 4OOFA 2BL4A 3L7CA 4FKZA 5CCEA 4A7PA 4FHGA 4ETMA 4ARCA 3GFOA 3HLTA 3K3PA 2V9PA 3EGDA 3QEKA 1JR2A 3TVTA 3KKQA 2Q50A 4KK3A 4JROA 3LMKA 5LP6C 1C4XA 1CETA 2HNBA 3AKYA 2WIFA 1AQUA 1Y6RA 3C3CA 4BU0A 4BNFA 4HH3C 3BPSA 1USGA 5KYUB 1A2QA 1UQRA 3AP2A 4Z8XA 3BG5A 4KYIB 3R6GA 1XAIA 1AGYA 3G1WA 1XE3A 2WA2A 2ZCJA 5KMGB 3KETA 1TC1A 4LFBB 1ISRA 1XKLA 3O90A 4JMLA 3RU3A 2A2ZA 2PXXA 2QV7A 2BKVA 4J6EA 3ZXUB 1MBZA 3PR1A 2HPHA 1JWBB 2ECFA 5EKSA 4QYSA 5IBQA 4GMFA 4NY1A 3WNZA 3SDBA 1YZ3A 2QL5A 3DOFA 3IQWA 3AI3A 3IJ5A 1T6XA 1Z0FA 2ENUA 3RRZA 1GO2A 3FTPA 2OCDA 1RQPA 3OP1A 5AVXA 4IYJA 5FI0B 5DCLA 5EUCA 2O6LA 1GILA 3F74A 1ISGA 4HDKA 1RPZA 2ZBDA 3NIFB 2CBZA 5E7MA 1YJAA 2JHAA 2VQ6A 1YQ9A 3BBPA 2C0PA 4HSEA 3QOXA 1TF7A 3PEVA 2CHGA 5K3EA 3RAEC 1CF4A 3C74A 3RTAA 4A36A 4R1PA 2B98A 1X1TA 2QX8A 4XSHA 5HSGA 3VU9A 3CBQA 4YV1A 3CX6A 3ZE7A 2MYUA 4FS8A 3TBHA 4XQ9A 4ER7A 2N3ZA 5JCJA 3EXFA 1E3WB 3EVZA 2QP4A 2OKCA 3CPJB 5ETJA 3TZQA 2CC2A 5BR7A 3PQVA 4GPD1 1O5IA 5BOVA 2XKKA 2YY6A 1J9GA 1MT3A 5LNK6 3PXBA 1QUFA 2P4SA 4FMDF 4GPTA 5FTWA 1OLSA 4IUCS 3GROA 1T5TA 2OENG 1YIDA 3CRNA 3H1AA 4BPBA 3FDJA 3KD3A 1SBZA 1ZD4A 3KKLA 2IP4A 5KSWB 1R4NB 2P41A 1EFTA 2WWFA 1NDHA 1UQTA 1ZN2A 2WZCA 3OG9A 3MJVA 4D3SA 5C8XA 1BXZA 2H2FA 4UHDA 1PKEA 2PS9A 3H0CA 4RGQA 2X6QA 2WFAA 2Z3VA 4JUAA 1S8NA 1FYEA 3I01M 5FUMA 5EZ5A 1KMMA 3ZK8A 4YRMA 5G0WA 1S8OA 3W4KA 3C43A 3GN1A 6PFKA 1RYYA 1W88B 1AUXA 4E70A 3MQFA 5EE1A 1ZXXA 4WOJA 2R4QA 4HOYA 1I6WA 4RK4A 3BXEA 3RYHB 1E2KA 2XOXA 5FT9A 2XOKA 4LNAA 1ECFA 3OUTA 4DLWA 1S89A 2RONA 2ZRGA 1BE8A 1H6AA 4P4SB 3ABIA 3EE6A 3D8RA 3UPDA 5ICEA 2BGKA 2C4TA 3DZIA 4I55F 1T2AA 4J16C 4GIBA 3F5DA 1Q7CA 4FI3C 3HB4X 3ZCXA 4IY1A 2HV9A 2H3HA 2JCGA 2PZMA 4R81A 1HT3A 3JCZA 2IUEA 3TF5A 5L3QB 1PG2A 5JSQA 4Q66C 2Q62A 4HDMB 2HUPA 1DX4A 4IM7A 2KW5A 3EJWA 1SIBE 1QB7A 2HB6A 2PHZA 2ZJBA 4YCNA 2HTEA 2VEOA 3GEBA 1GPAA 4AJ4A 1C29B 2WDPA 3K94A 1MORA 5JBQA 4MGHA 1L9XA 1RKQA 4WOPA 3AIKA 5F4BA 5AVJA 5K3SA 1X1DA 2C83A 1A4UA 2J32A 2LVBA 3AFMA 4OA5A 3SK0A 3WGHA 4DMGA 3L6OO 1XKXA 2HBQA 5M2QA 3C3PA 3IELA 3EQZA 4P3YA 3GFSA 3GP8A 3QI7A 4MICA 5SY6A 2WP8J 1MKYA 1NM5C 4OM7A 1EWKA 4LJ4A 3SLGA 2VAVA 3DZGA 3HCBA 4DIFA 2C99A 3VKFA 1XP8A 2TMKA 3PWTA 3WJ2A 4Y6OA 1FDTA 2Y0BA 3O1JC 2GZAA 2PWPA 3OPMA 4Z4EA 3FYTA 2X0JA 1Z6GA 3LRTA 3GVCA 5COAA 1QWOA 5ALQA 3QGMA 1Q1QA 2BOVA 2P9QA 1PZGA 4GLLA 1WUKS 1T9GS 2IOQA 1VE6A 2R3SA 4OB6A 3R8XA 5JATA 1J9EA 3A6PC 1E63A 4TVOA 2REQA 4FS3A 4FFDA 4CETA 2BP7A 1IULA 3JYHA 4PIMA 2GAOA 1M2NA 1MX1A 2H1HA 1OZGA 2EEZA 3GLSA 2C5AA 2NSJA 2P69A 1R66A 3IGFA 2FRDA 5EIHA 3RG8A 4N54A 3QX3A 2C96A 1DQYA 1NXWA 3GELA 3MAAC 3LQQA 3R9XA 3TH5A 3PQEA 4JQCA 3W2GA 1TT5A 1C81A 3FFXA 3SHOA 2PSDA 4U3JB 4BV2A 4JC0A 3ADDA 2AJCA 3P2KA 3GRCA 4X84A 2GI4A 5I7EA 3KR1A 3OPXA 3ILHA 1ZCBA 3O8OA 5J5VA 4CG0A 4EWLA 2DQKA 2AC4A 1YBHA 2BMDA 2PSJA 3OEWA 4FYHA 5IDYA 4FVTA 5C3MA 3VKGA 3I32A 4IIJA 3QEBZ 1EFPA 2PFSA 3MAJA 2CL7X 4C22A 2V6MA 4RTLA 2PL5A 2PKQO 4DE5A 2VYCA 4OX9B 1EWYA 3K6JA 4HI0E 5IANA 1MO4A 3IULA 4MW4A 1BN7A 5MF6A 1GPMA 1G8MA 5FL3A 4DLVA 2QPLA 3KKKA 4WVLA 3K6SB 4AF6A 1WKBA 1JEJA 3R2JA 4IV5A 1U8YA 3Q3IA 4TS1A 5DYYA 2LDXA 4RQUA 4YYZA 2P3LA 1BYUA 3A3YA 4RFSA 4YQZA 2V5UA 1Y7LA 2B1QA 4N82A 1TW3A 2M1ZA 1RXEA 3KUKA 3WRYC 4D99A 1J8YF 2JS7A 3FPHA 4XGKA 3TTSA 2FZVA 4DT1A 4LC0A 2D5IA 2G09A 5H8WA 1AGXA 4O33A 4B6SA 3SHTA 1HQKA 4OSPA 1KH2A 4YRRA 3ZKWB 4BUJA 1JFFB 4D8VA 3U44B 3T3NA 2VDVE 1M5TA 1V3VA 3EDMA 4H15A 3PQ7A 1UBFA 1KVTA 1DIBA 3EMBA 3F78A 3DAOA 4ZXPA 3ZHYA 4TTPA 3AI1A 1S1CA 3V8EA 4FILA 1G6HA 2XZPA 4CMBA 3EVNA 4MVJH 1ONSA 4MLPA 1B74A 2AZTA 3VO2A 2AN4A 1TJ4A 5FX2A 1IJKA 5LU8A 1FSFA 1T8WA 2QTLA 3LS2A 1Q1BA 4IO0A 4TLMB 2HL6A 4P35A 1OVGA 2HYDA 4XQ0A 4UJ5A 2YIDA 1NSFA 2UUOA 4D4IA 2HTFA 1W5TA 5EKDA 2IBTA 1LBEA 2FE1A 2G25A 2XMQA 3JD0A 4RTQA 3DT6A 2WYVA 1K4KA 4RW0A 5DHRA 5LQSA 3ZK7A 3GPLA 2AE1A 5EUBA 1G3UA 1JSZA 1WXHA 3IDOA 4C4AA 3H0EA 1RYDA 1E3LA 4CCYA 4F3NA 3A37A 2PAAA 1DBQA 1LLUA 1YMQA 1IH8A 1PJBA 3BGIA 1Y37A 2RMKA 4ZV7A 3EFHA 4LJ5A 3PFWO 2WWVD 3N3BC 3MGCA 3V4OA 2PD4A 3UHFA 3CO0S 4E7PA 1FJHA 4Y9UA 4CMIA 2Y76A 3EYWA 4PC1A 5LMCA 1GGEA 4HEJA 5DHTA 2CLCX 1U2PA 4JDUA 1YFKA 2WIBA 2WIKA 2OBLA 4FFOA 4RA6B 4Z54A 1O0BA 1GCGA 2AN9A 4H6PA 3L1JA 4GT1A 1NNEA 4FK8A 4XKJA 1IUNA 3CE6A 5EMNA 5IW8A 4TKVA 3GBPA 4LDQA 2I4OA 1W8DA 2DBQA 2QORA 3AUXA 1KY3A 2FUG1 1BMTA 1DBIA 3HPQA 4FCCA 4RJLA 4WKCA 3O8DA 1ADBA 2ZIAA 3X1XA 4HWTA 2H0RA 4UAJA 2PGDA 1IBCA 3LKVA 5F33A 5DSXA 5HBRA 3S5UA 1KZHA 4X7MA 5FL7D 1BU5A 3ZGYA 2HEGA 2GF0A 2HJRA 4DUPA 4ARVA 5A3JA 4S1PA 3GUCA 3PUVA 3F4LA 2Y9MB 3KYDA 2APJA 3OJFA 4MWTA 3RJ9A 3ZIAA 1ZIPA 3FNHA 5BWMA 4PYOA 1O9HA 5ALNA 1TJPB 1COZA 1MTOA 2WHEA 4NBVA 1QP0A 1HT2E 1X8LA 1NNUA 2ZK7A 4A23A 2RGUA 1I0LA 4NFHA 4OU5A 4CLQA 2ZJ1A 2JZNA 4RXUA 4ARBA 5CD9A 5IKMA 1MOSA 1XVLA 1PL7A 5B55A 1DQNA 2IYWA 4EY5A 3QXXA 4M4SA 2OK8A 1KYVA 1WJGA 4I9NA 3SYLA 2CUKA 3DLCA 3E27A 3QEMA 4X6YA 4YBRA 5J63A 4JITA 5FO0A 4F1WA 3TQTA 1PUXA 3RFCA 2A30A 3P5SA 4G5SA 3P9PA 4XWOA 3UXHA 2D00A 3JWEA 2QTMA 2A7QA 3ECAA 3M6VA 3MS7A 4C76A 4A15A 2EDAA 2JD1A 1AO3A 2ZRNA 3LY7A 1C3LA 1GZSA 2GPSA 5I8ZA 4DJTA 1TA9A 3IQIX 4DCSA 2PL3A 2IHNA 1UBNA 3A2NA 3NWEA 3GCGA 2W2QA 2CYCA 3IAUA 3NOQA 4JJIA 3ZV6A 4ALIA 1AKYA 1FFGA 1KC3A 1N2CB 4XCQA 4YX9A 1KP9A 4GUDA 3LBAA 1VHJA 4QDKA 2E6KA 3ZXSA 4C7OA 4L5YA 4JQYA 3AJ9A 1CZRA 1DMSA 4RL6A 3EBLA 3LHIA 1HEUA 4U6NA 3ZZMA 4BRWA 1JL3A 4JCOA 3BIXA 1DE0A 3LUDA 3F3SA 1UDCA 3O1HB 4RVOA 1N2SA 2X3YA 3O3CA 1ZVVA 3DZ6B 2BCGY 4I3FA 4F6LA 1B1CA 2NUPB 1K7FB 2HIAA 1RWVA 2ZRIA 3IAAA 3JQ6A 3P9NA 2C7GA 2DF8A 3W2EA 2WAAA 4GL2A 5MFPA 4QOFA 2I1QA 4YWJA 1ARZA 3AV0B 2OBNA 3DWEX 4MARA 1C5KA 4QDTA 2P9EA 4KLRA 2NO9A 1YAHA 4NENB 5GADl 2AN1A 4J4BA 4Q05A 4J0EA 4LXGA 5J5CA 2NACA 4WK4B 1ZM9A 4UE3S 3RJZA 4E31A 5K6AA 5A5EA 4Q3NA 2AQ8A 3FNRA 3T5AA 2H2AA 1KAHA 2XDQB 3L7NA 3PLAE 1NIJA 3O2QB 4F8EA 2BMJA 4ZT5A 2AR7A 2YMMA 2IDKA 1LTHR 1KY2A 1O6BA 1TEHA 3DHNA 3DDUA 1ZH8A 3L0OA 3MJCA 3ZQJA 2IF2A 3B6MA 1X3LA 1YWGO 1EWTA 3B7WA 4B76A 1P1BA 2CL0X 2JB9A 3FZYA 1T1IA 5EUMA 4ZEVA 1GDHA 1TVEA 1YE8A 4KRFA 4QGHA 1I4OA 4QVGA 4C3VA 4IVPA 1NLMA 4EQ6A 5E3JA 1ZR2A 4DNOA 3KYJB 5TGTA 1I7DA 1B23P 1UMBB 5DP2A 5TY0A 3ZXYA 4DVJA 3HN6A 4U7HA 2OM6A 4N48A 3A1SA 1H4SA 1N7IA 3D1JA 1RWPA 3OQOA 2GRAA 3WYAA 2UUBB 1D6JA 1WNTA 1OGIA 2SNIE 2WIJA 4QLOA 5A4JA 4QPJC 3DOUA 4PLHA 1DXOA 1ORVA 1M6VA 2BHNA 4NBWA 2B2CA 1T9HA 2NGRA 1QTQA 3K5HA 2PKRA 4HXFB 4HAIA 1JN0A 2Y1CA 4KR9A 4EY6A 4JXZA 1Q5PA 2UVDA 3VI4B 5IKXA 3E9YA 3QYJA 1XZDA 4DPMA 3QUSA 3R4CA 4Z4HA 5LR6A 2JLZA 4YMWA 3W1EA 5DSZA 1TECE 1U8AA 1ZISA 2DZDA 4TLAA 1VMKA 4V0RA 2IIPA 1HA3A 1ZZGA 1FLVA 4L5AA 4LZAA 4I66A 3SS7X 4NL4H 5KAPA 1R3UA 1FU8A 3P2YA 3TNYA 1SQ6A 2F17A 4YDQA 4IWXA 2YL2A 4G9EA 4P4UA 1A8UA 3NBMA 1JAHA 2YMQA 4PSUA 5ERYA 5FUYA 2HMWA 2X1VA 5CH8A 4CMCA 2JLUA 3CUSA 3U40A 2AZXA 4I9GA 4MO2A 3CN7A 3BERA 3G0OA 5KC9A 4IDAA 4P0QB 1Y4ZA 2ZRPA 5BN4B 4D92A 3QWFA 3R7WB 1QYCA 2AI1A 1PHRA 3GFBA 4DA6A 2ZWVA 5DRYA 5C1IA 1NVWQ 3R9KA 4MWGA 1L0BA 1PJTA 1SO8A 5JNWA 1OFUX 4H2DA 3PQDA 1DG1G 1Y33E 1GPDG 2OOKA 4XJSA 2GXSA 5LUAA 3GLGE 4KUHA 2H17A 4S1TA 3X1JA 1NF9A 3E23A 3L8DA 4AVYA 1C7QA 4QJ5A 3QVVA 4U0JA 4PO1A 4U7PB 1EGMB 4A6XA 4OMUA 4H7KA 5JHHB 1ZMXA 1GGFA 1LDBA 1AC5A 2CNLA 2DG2A 1NPDA 2A5JA 3FOBA 3LA8A 4TUYF 4YJFA 2HMSA 2X3UA 3T7TA 3SP1A 3BHNA 3C97A 2HGZA 4P7BA 4LUCA 1R8SA 3LBNA 1E1QD 4OQEA 2GZ2A 3RIGA 3G0HA 2CNOA 1YHNA 1SKMA 2WF7A 4PLVA 2DSNA 4XCVA 1P2FA 3IP6A 3LNTA 3TUJC 3OF2A 2WY2D 1LTQA 3V9AA 1K7YA 5JPCA 3E9EA 3GO4A 3SZMA 3EPJA 1EDEA 1SHJA 3B5EA 4YAEA 2PUDA 4K6KA 3CUYA 4CCAA 3DMRA 1E9AA 3NHBA 4DCOA 2YRWA 4PWYA 2UUCB 3ELBA 3ISVA 3GWZA 1U94A 3L7BA 4B34A 1FY2A 1J25A 1SCUB 4BNIA 1X13A 5B2EA 1I2AA 2IYOA 3DT9A 1HDZA 2EKBA 4CHTA 3BSFA 2XTJA 1GL3A 4RM3A 1RAIA 2JATA 3E61A 3TZ6A 3OZUA 5CLLA 2BT4A 2VCYA 4E07A 3QU9A 2YH2A 5C2JB 1XRPA 2PKXA 2HUNA 4Y2VA 5ICCA 4PPQA 2J41A 3ZDXB 4DXAA 1TM3E 3EQ8A 1NIPA 2O7QA 4ESEA 3BICA 5HTOA 3H4MA 1G5TA 3HJRA 1DUSA 3EPAB 1L8AA 1QJCA 1P6XA 5CFLA 2IDZA 1ZI9A 3R3YA 1MB4A 1A72A 1P2UA 4QE3A 2EP5A 1UEJA 1HO3A 4KQHA 1JG3A 3SF8A 1NF3A 3DJYA 5I7VA 3G2KA 1HL3A 4JI4B 3M6AA 2GN0A 4TV9A 2FG7C 3RUIA 1U8UA 3HA5A 9LDBA 3G7UA 5GV7A 1OOEA 3IPRA 4K3UA 1S4QA 4ZYXA 3URMA 1J0BA 5FHQA 3KK0A 2ZVPX 1F3OA 3HU3A 3NHKA 4M1WA 4M1TA 3SE7A 3AKEA 3A9RA 2VXOA 3AF2A 4NDNE 4PSAA 3UAYA 1D04A 5HG0A 4L8WB 1VLVA 2C78A 1DWPA 2QTVA 4ND8B 3D3JA 3VNSA 1HUQA 3DV0A 3E7PA 3AHIA 4O8CA 5G0VA 5JQGB 4IZOA 1RI2A 3G2QA 4XUEA 3VJRA 1KJWA 2SCUB 4P93A 1H2AS 1YJ8A 3VJKA 1Q1EA 2ZQZA 4LS3A 1YRHA 5GV8A 3WSTA 5AM3A 1RVV1 2G63A 3JARA 1IN1A 1EGVB 2VTBA 5TQVA 3MWDA 3EUAA 4URVR 5IN5A 3WHPA 1CE8A 4TWJA 1AVTA 4PRKA 5LYJA 4PNEA 4TMTA 4G07A 1ZRNA 3LZCA 4X6XA 5TPWB 4HPXB 1OA1A 1U5AA 1UWKA 2XRFA 1CZUA 3TR6A 6REQA 3GJSA 2O07A 2FDCA 4JBIA 4A0GA 2VHQA 4IF4A 4N0EA 3WLHA 1ZUWA 2WYIA 3OD1A 1Z2CA 3N2GA 3Q0IA 3VPDA 4C0XA 4UOQA 4XUGB 3IQGX 1AIPA 5BT8A 2P3SA 5AK6A 4R01A 1Y3BE 1Q0TA 2ZZKA 2FLVA 4WY5A 2WHPA 1W44A 2J5XA 1UDBA 1O54A 1M1ZA 2ORYA 2JIRA 2BN4A 3G1UA 2PBLA 2JK0A 3QWHA 4U2KA 1LGYA 1DAIA 3PT5A 1EEHA 2RHLA 3FVWA 1L5HA 5EMMA 3OCJA 3ZYCA 3ROGA 3PGVA 1PWZA 5JIBA 2HC9A 2G9QA 3B7PA 5H81A 4LWZA 2N46A 4OQYA 4P2GA 2QXYA 2F6RA 1GTL1 3ZWCA 3QLTA 3D8UA 4BRSA 3HHEA 4DPKA 2XUPA 2GZDA 1EZ4A 1TYBE 1YI1A 4REOA 1GGHA 1UOQA 2DHCA 3GPCA 4OL0A 1IVYA 2QLTA 3VC3A 4JNKA 2FPNA 2FLKA 2WEKA 2EW2A 1TVCA 3H84A 5IFKA 1EUCB 4QBFA 3BJEA 4P0PB 5JAOA 2J6IA 3VUEA 5JWHA 2YHIB 1I6KA 3GGOA 3FRJA 2OBBA 2XMDA 4DQKA 4AURA 1OROA 2EFGA 5J9FA 2PZEA 4IJKA 3FSGA 5LXTA 5JASA 2GLUA 2VTVA 4LXHA 4XFDA 5KOJA 2AEJA 4ZV9A 4MS1B 4WESB 4XE5A 5ALEA 2QK4A 1F4VA 1OTXA 3CF4G 4KOEC 1QGZA 5BUSA 2H1IA 4ZVUA 4B6JA 4D4LA 5KOYA 1UFOA 5GMOA 4HRVA 3DR5A 2VHEA 3P2OA 3UICA 5LQCA 1TZMA 2Z4RA 2ZJ3A 3MYYA 3QU7A 1BDJA 3IUSA 1GYRA 3DMPA 3DOIA 4IGAA 3TE7A 4ILKA 1JG1A 4H16A 2RAVA 3Q3GE 5K4AA 2XSZA 3IX7A 2Q0XA 3RRXA 1Q7EA 3LX8A 3ONVA 1XZAA 1NBEA 1NN5A 1PJ4A 3S6JA 3QEAZ 3TTYA 1X0XA 3AXSA 1SVKA 5D8DA 1R4AA 1L1RA 2G77B 2OP0A 3AJRA 3OTQA 5CX4A 2DTEA 2FEKA 2VAXA 3N8DA 3MNFA 1DG9A 2PV7A 4HWSA 4MV6A 3GJ5A 5H3LA 3T9FA 3ICEA 1I4WA 4B6OA 2CLIB 4YXFA 4PBTA 3E84A 3UOAB 1DOZA 4EPYA 1U2RA 4RPIA 3K8OE 1CXZA 1G20E 3M6WA 1OLXB 3MFQA 4KIFA 4I1VA 5LU9A 1A8IA 3BZBA 3NBZC 3WLNA 1IHXA 1L8OA 1DO8A 4HY3A 2V7QD 1Z7YA 4LJAA 5KDDA 4AZ0A 3KNZA 1UADA 2LP4Y 3CLSD 3SLKA 2LUOA 1MA0A 3ONDA 3LL7A 5LOVA 4DGQA 3P4UA 2AI2A 2FSVA 5FPQA 3LXUX 1ZONA 3UWSA 1JLLA 3R5XA 2QRMA 1RMQA 1N5RA 5I3ZA 3ET4A 1NBMA 1TMOA 3HV2A 4DCJA 4R8KA 2VXCA 4F7WA 4Y2GA 5LA6A 1H8HA 2Q8NA 1U8ZA 4NQRA 3H0VB 5DTIA 3TOXA 1DRJA 2YASA 4Z4QA 4CXMA 3RJMA 3K1YA 1QP8A 3V8PA 5JS7A 3I6QA 1GL7A 2PRJA 3CMCO 1SM4A 1RBZA 3KUXA 3FKSD 1B8VA 2M32A 2DQZA 1JAYA 1NDUA 3BHJA 4WGFA 4X8HA 1SURA 2O8BA 1EUYA 3BMNB 4DMUB 3NONA 1E1NA 3WWEA 3ZCVA 2QBYA 3T3DA 3RVOA 2Y4OA 1AXEA 2FR8C 3NNDA 3TMYA 3BSYA 1JTFA 3GH3A 3L5OA 3FBWA 2BFAA 1E59A 3QFTA 2BZGA 3NHRA 1M6YA 4CT5A 3OIDA 2WUEA 1PSDA 3L7AA 3GFTA 3PC2A 4MI3A 2PH1A 3DOCA 3EXAA 3DBVO 1KO5A 1A2OA 5BSTA 3GLKA 2LNDA 2NXCA 1NLYA 4IJMA 4MVCA 5K3AA 4ZOEA 5B30A 2EFEB 1RI4A 3KHSA 4RX1A 1RCTE 3G8BA 4HQRA 3X1KA 4A0QA 2NO0A 5ALIA 5BVGA 2XRZA 3HJUA 4WTOA 1UKEA 2P5TB 1RQLA 1TM2A 2O2XA 2WUGA 3K1AA 2I3DA 3IESA 3IJRA 4DL9A 2EFYA 4BATA 3LLCA 3IUPA 3DTVA 4UNRA 2FUG6 4YMGA 5FEUA 5JVDB 4NF2A 3M9WA 4I50B 1SFRA 1V8OA 2FPMA 2IYZA 3R3ZA 5A5GA 1E6WA 1EP2B 2MSWA 1ZGAA 2QMOA 2XGSA 2KMLA 2I3ZA 1V6AA 3C45A 3CR8A 3F7MA 1E60A 2A33A 3G2HA 2O2EA 4EW6A 4JYCA 1RIIA 1E9BA 3OX3A 5ECYA 2W6ZA 2WRZA 2IOYA 5K05A 2IEAA 1XMQB 4RD3A 3K15A 4RSGA 4IEFB 1IONA 3HA7A 3K09A 1IOVA 2IF0A 2XI4A 4JBYA 4PAMA 3NXSA 1GPUA 3DGEC 1C9NA 4EG6A 1DAHA 1Q57A 1Z7GA 1I2BA 2XUQA 4JD5A 4LOHA 1ENOA 5TX7A 1N6OA 5CURA 1DOHA 1G18A 1Y8AA 2B61A 5IUJC 4MR9A 2PMCA 1JRLA 4FD2A 2PWZA 3ZEIA 1PK8A 1SIUA 3ST7A 4BTEA 2FSHA 4ZICA 2ORVA 2OCBA 2AT1A 2X7XA 1LDNA 2OZEA 1JQBA 4LE0A 4IX1A 4J94A 1MX9A 2P79A 1JDJA 3JYNA 3C1TA 2FW7A 2W37A 4BX9A 2CYAA 2FW9A 1M6HA 3GUUA 5FADA 1NBWB 1JH8A 4IIJF 2WAXA 5T6MA 5CH3A 5A4KA 3K4QA 5IWAB 1CLUA 5IG2A 4DTIA 2Y1LA 2YX1A 2NO4A 3ZE0B 4X62B 4G0PA 4FXPA 4XYEA 1GAJA 2WT4A 1XVIA 4MV1A 3P2MA 2O0MA 3CF2A 5HZHA 3A1NA 4M46A 3A05A 4PZLA 3R3VA 3GCZA 3WMGA 2V0CA 1HL7A 3WK5A 1PD0A 1Z12A 3HY3A 4G1CA 4AZ3B 5F5XA 3QYAA 4BNDA 1E2GA 1FP4A 2EERA 4TLLB 4CPDA 4QOEA 2VN8A 1CRQA 2EV9A 4AJKA 2DPHA 3E7WA 3GEHA 721PA 1FFWA 4JU9A 1M34A 5F2OA 4A0HA 4BKPA 1M0EA 1SAYA 1SXHA 4RPLA 2PZLA 2D5AA 1YJXA 2CGEA 3DB1A 4M0FA 5IKOA 1WXFA 2GWRA 3DC2A 4L9WA 3D54D 2J87A 3B3JA 2PR7A 1IRXA 3GT7A 1S8FA 3J81A 3N0VA 2GCGA 4LBWA 1C8VB 2UZ1B 1YQEA 4ID3A 3DFUA 1HDCA 3O4JA 1ZNYA 4QJIA 1XWWA 3SN6A 1ULHA 5H3CA 1RXUA 1D6SA 1BKYA 1G2QA 3ZCPA 2ZIFA 1ZSYA 2BH9A 1JXQA 1K8YB 1S3GA 3SNHA 1T2CA 4LGCA 3M5PA 1AMOA 2ZBPA 3V3KA 1PV4A 4PO9A 4J90A 1T4GA 1VP9A 1KXJA 1GRNA 3JVDA 2PU7A 1E9VA 1FLDA 4MVJE 2ZAMA 3EB9A 4NVRA 2XECA 3PDIB 1ULBA 3DO8A 1HG1A 3X3HA 3A1UA 3AVVA 2HO4A 1V16B 4RTRA 2R1VA 2X8JB 3MJRA 3QOYA 1XIVA 4HDSB 1RXIA 4YGXB 4L6AA 1FQWA 4PPNA 1GU7A 1Z0IA 4NNOA 1PNRA 5AM1A 4AICA 3PJFA 5IAJA 2PMDA 4YREA 3RTCA 3CH6A 1V45E 4BZPA 1OU0A 3WBJA 2XADA 5HKAA 2IYQA 1N0IA 4JBXA 3ND6A 4MS4A 4H6WA 4MRVA 5J9GA 1A9SA 1GPLA 1WMEA 4OHFA 3KHTA 1J9ZA 2WC1A 1PJRA 4OIFA 1ZD1A 4D45A 3K0FB 2BKXA 2K87A 1G8AA 2II6A 3TCXB 2YV5A 3B1KA 4R31A 3SFTA 4DNFA 5FTLA 3EFOB 3K70B 1G98A 1TVMA 2JLAA 3LP6A 3C4QA 2OCPA 5DW3A