3PZRA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural Characterization of Inhibitors with Selectivity against Members of a Homologous Enzyme Family.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3pzrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pzrA01
4U7WA 1PS8A 1E1NA 2FR1A 4MP6A 3ZNOA 1NHWA 3JD0A 1P77A 3JSAA 2VWGA 4A73A 1KVRA 1LQUA 3I6QA 2OBYA 3HB4X 5I9LA 2O3SA 4M54A 4MDHA 3FHLA 4OH1A 3JQGB 1M6WA 4DMLA 1HDOA 1ZXLA 1PJLA 1UAGA 4NI5A 2XXBA 1ADFA 3QWFA 5KJ6A 1K6IA 4K6FA 1LNQA 3QIVA 3LC7O 1VJ1A 1HTBA 2R00A 1PEDA 2JKVA 3GA0A 4XYBA 3ZWWA 1H6BA 1B15A 5G0SA 3JQ9A 2DC1A 4QO8A 4CLEA 3SVTA 5CEJA 5EN4A 1Z73A 4MVJG 3D4OA 1EBUA 4G65A 3ANMA 1NQOA 2GF2A 5B37A 2WWRA 1TLTA 1K2WA 2DFDA 3ADOA 2BD0A 1ZNQO 4R51A 2A92A 2TMDA 4BNMA 1QV7A 3FNEA 3F9IA 2PR2A 3PDJA 2P2SA 1HDYA 4XZ3A 4WLUA 4IM7A 1MC4A 2W2LA 1U5AA 3VPXA 1EQUA 4JXKA 4J3FA 4WEOA 2J6IA 3FPLA 3WIEA 2ZYAA 2BELA 4UULA 1JVSA 4MP3A 4PRKA 3FNHA 4CV2A 3CKYA 2AEFA 3UHAA 3I52A 1F06A 4YBZA 2GERA 2DBVO 1WP4A 4FOSA 4M89A 3OF2A 1Q0LA 2VQ3A 1HDRA 4YRDA 4QO7A 4TKLA 5CPBA 3Q2KA 1VLLA 3PLNA 4ZU3A 1LXCA 5ICSA 2ZTMA 1NP3A 3GHYA 2GN9A 5JO0A 4GMFA 4XQGA 1ZEJA 3SEFA 1E1KA 5A05A 3V2GA 4Z0HO 2XAAA 3V8BA 1PS9A 2V6GA 4KTVE 3N58A 3HDHA 3VZPA 1IL0A 1T2FA 1I2ZA 1I30A 2ZQZA 1DC6A 1LDBA 2C29D 1GV0A 1P1HA 1DEHA 2Q1UA 2D5CA 3DAGA 3VZSA 2Q49A 2AE2A 2CY0A 3UOGA 2G1UA 4FFMA 3CINA 4GX2A 2ZKLA 3V1UA 3KEOA 2WTBA 1X1TA 4YAGA 4YAIA 5JY1A 5I7FA 1FDVA 5L95A 2X9GA 2EKPA 2Q45A 1F0YA 3LC1O 2PZKA 1VSUA 4PG8A 1PGPA 4BNVA 2EP5A 2VT3A 3DZFA 2O23A 1OZAA 3DZGA 4RVUA 4FFNA 4PRLA 1EVJA 1DRWA 1VKNA 5JYFA 1HKUA 3E5MA 3W1VA 2H63A 3FR7A 2Y1FA 1J4AA 1A27A 4XGIA 1MA0A 4XGKA 2Z95A 4J4BA 4FFRA 2YDXA 4YAJA 3DAFA 1XWFA 2XOXA 3OIGA 4EUFA 3MTJA 2AW5A 3E1KA 2E48A 3DTYA 1X7DA 2PTGA 5IZ4A 5EESA 4AJ4A 2O7SA 3KUXA 4Y6SA 4CJXA 5B4VA 2HMUA 5G0TA 3RUAA 1H2HA 1RYDA 2G5CA 2HMWA 4IPTA 5DOVA 4AJKA 4RPJA 4I5GA 2P68A 4UVGA 1UDAA 4CPDA 4OHUA 3H65A 3WG9A 3ZZNA 3DONA 1EQ2A 1DIHA 4CMGA 2UVDA 5T73A 2VTEA 4CM9D 4D44A 3W6UA 5DOZA 3S2GA 3K92A 3VPGA 4L76A 1SZJG 3NAQA 4D3DA 3QLJA 3GHHA 2CD9A 1VSVA 4FIZA 4XR9A 4AJ2A 4PLTA 4N18A 3SLGA 5JDCC 1NVTA 4ZN6A 5U1PA 3CEAA 4BO4A 3TPCA 3ZH2A 2ZB4A 4U0KA 3WQRA 1I32A 4GVLA 4K9DA 4HBGA 3WIDA 1Y9AA 3FD8A 2IXAA 4NU6A 1VL6A 4BO5A 4LVUA 3Q6IA 3ZHBA 3PZRA 3R3SA 4L4RA 5JNLA 3ZGYA 2QX7A 3JQ8B 1XG5A 1YQGA 4JCOA 3GH3A 4I9NA 5IFLA 4F6LA 3QVWA 1LEHA 5L51A 5C7LO 3PZBA 1YB1A 4FJ2A 4YJGA 1JN0A 3VH4A 3KETA 1QXSA 4P22A 4CMEC 2JL1A 3JQCA 4LGVA 1RM5A 2Y67A 1B14A 4D42A 3ITDA 3H5RA 3KSDO 4GKBA 4J1TA 4CLXA 3PJGA 1OFGA 2Z1MA 1E3WA 4RVFA 5LDGA 4CM3A 3NKLA 4XCVA 1ISJA 2EJWA 2VUUA 1FDWA 2W4QA 2GRAA 2I3AA 4TRRA 3PQEA 5A5EA 2ZB8A 5L4NA 1LDNA 1R12A 1DFHA 4BO8A 3JQAD 3ON5A 3W6ZA 5JYDA 1N7GA 1ISGA 3BMNB 1N92A 4BV9A 5DULA 1FDUA 1E3LA 4WASA 1LI4A 1BRMA 1ZEMA 4PLCA 4UUNA 3ZV5A 1T4BA 3OM9A 1UZNA 3WFIA 4YT8A 5I9NA 4IINA 1W0CA 1VE9A 2XF8A 4I5FA 2NV6A 4D3SA 4R3WA 4GKVA 3HZZA 2WM3A 3K6JA 3I5MA 2PKRA 5L4SA 3RASA 1LDGA 1H9BA 3B1JA 1W4ZA 5CDUA 2GDZA 1V6AA 3UCFA 4WJZA 1ZCJA 2NUAA 2DBRA 4FOOA 4E33A 1V8BA 4AJLA 3I3OA 4RVGA 3Q9UA 3OSUA 3PJDA 3X2FA 1KC1A 4Z9FA 3R6DA 1U5CA 2BF7A 1BGVA 3U4IA 5C37A 3BIOA 1HYGA 4KWIA 4OYRA 3K2BA 2B4QA 1MX3A 4AL4A 3DFUA 2CVZA 2JHGA 4YAEA 4KWHA 4BGUA 3AFNA 3V2HA 4DVJA 5T8KA 5COBA 4P4GA 1HDCA 3RFXA 3F4BA 2VT2A 5K6AC 2P9GA 4PLHA 5KWEA 1U3TA 2PKQP 3JQAA 1K5HA 4A27A 1IPFA 2VNSA 2ZIZA 3HDQA 2WE7A 3ZDFA 4BNHA 3FBTA 2WYUA 4R4JA 1BSVA 1ADGA 1MGOA 4B8WA 4WLVA 3JYPA 5AQ1A 1GUFA 5ER6A 4E13A 2IZ1A 2NVUB 2GN4A 3A1NA 1MFPA 1YBAA 3QVOA 4GLOA 4L8VA 1LLCA 3MWDB 4ALIA 4PZCA 4IBOA 3ETEA 1KVSA 1IYZA 4FPXA 3U4DA 2D2IA 3E6AA 1YB4A 4D45A 2I65A 3AM5A 3UFXA 2UV8A 3QVXA 2X8LA 4RCVA 1LU9A 1ZK2A 3GAZA 3WTCA 5I8ZA 5CG2A 2B69A 1LSUA 5G2OA 3TNLA 2Y05A 3PVZA 3M1AA 3VZRA 1AHHA 5A9SB 3ROQA 1XELA 3GVPA 2ZB7A 3ASVA 1JVBA 3H2SA 4J7CA 1ZSVA 3BMCB 4WK6A 5ER9A 1ML3A 1LRLA 1Q7BA 5AOVA 3W4IA 5IZCC 2DVMA 4Y6PA 2W2KA 3DZIA 5F1KA 3JCZA 4CLDA 2GLXA 2QHXA 5DCWA 1TVEA 2AG8A 3TJRA 1H6DA 3CXRA 1U8XX 2JCXA 2B4RO 1GZ6A 5U4QA 5HS4A 2YQ4A 1UH5A 3ZWVA 3IUPA 1LLDA 3GFGA 3BYZA 3HB5X 3WYCA 3QVSA 1BW9A 3E18A 3NTQA 2O2YA 3HDJA 2NU6A 3OQ1A 5DP2A 4D79A 2O3TA 5KIAA 5DP1A 3PXXA 3D7LA 4JP3A 5T64A 1Y81A 3GRKA 2WEKA 1ZUD1 4PLZA 3AK4A 2AEMA 3DO5A 2EW2A 1Q2XA 4YDRA 4YQZA 5J23A 2HJSA 1ISMA 1MG5A 3TOZA 1DPGA 4M87A 3U4HA 3AU9A 5B1YA 3IAHA 1DB3A 1U3UA 1PZFA 1ULUA 5A04A 2BFOA 3H2ZA 1I5RA 4Z0PA 4Y8VA 4JJFA 1GYRA 1QORA 4Z0TA 4AJHA 5IDQA 5JCJD 1H94A 5DBIA 4CMJA 3ROKA 2XXJA 3RUFA 4XYLA 3V5NA 3LU1A 2WSBA 3OQ6A 2CDCA 4LW8A 4II3A 4E3ZA 3A06A 1VJTA 3LZ6A 5FF9A 2B5WA 4WE3A 3NEPX 4LCEA 3FTNA 4DRYA 1M6HA 1PR3A 3FWZA 2Y1DA 4OSPA 4WKGA 4NJOA 1P44A 4OJNA 1UUFA 2DLDA 2FZWA 4XB2A 2WYVA 4BIIA 2Y93A 4J90A 4GX0A 2B4TO 3AUTA 2LDBA 3AJRA 4DPKA 4HXYA 2R00C 1NXQA 3GZ4A 1KY5A 5IN5A 1RM3A 3PWKA 3Q9NA 4CUJA 1DIRA 3FI9A 1N8KA 3RJ9A 4YRBA 2J3KA 3PIIA 3U62A 4H7PA 3QA9A 2GNAA 2HKIA 1LA2A 4CLOA 4DYVA 3H9UA 1ZBQA 2ZYGA 4E4YA 2YV2A 1VL0A 4JBHA 2P9EA 1D8AA 3IC5A 1WZIA 4B4VA 1HSOA 4AG3A 3QWAA 4L73A 4ILKA 1TEHA 5THKA 2QRJA 5JCJA 1A4UA 2VWQA 4PZDA 3G1TA 4WLNA 1ZJYA 4J2HA 1QLHA 2Q2QA 3PWSA 4H3VA 4JQCA 2FPGA 1SB9A 1Z7BA 4EYEA 3L0DA 2X86A 3CMMA 1R4NB 4TZTA 2DPGA 1XLTA 3PGJA 1C14A 3UN1A 3M6IA 2PK3A 3JD2A 3JQFC 4UUOA 4BKPA 4N54A 3L6DA 2Q2VA 4MIYA 1EMDA 4JIGA 4R69A 1BXGB 4CM8A 4A7PA 2HK7A 5ILGA 3DHEA 1GCOA 4CMHA 5DCYA 4IDGA 1M75A 3K73O 3NT4A 1PWXA 1PX0A 1I2CA 1DRVA 2BGKA 1KVTA 3FR8A 3GEMA 2FN7A 4PLWA 1U7TA 1BDMA 1YJQA 3AM4A 5DF1A 3WR5A 1UJMA 2AHRA 2D1YA 3JD1A 5JBIA 3I9KA 4O5OA 1A71A 1P31A 2O3RA 3TZCA 2WD7A 1P3DA 2JD0A 2QZ9A 5JW6A 1SEVA 5G0WA 5T6BA 1TT5A 4DC1A 2NSDA 4E0BA 1KETA 8ADHA 1EFLA 3WICA 1LDMA 4CV3A 5JCXA 4BNJA 1YQXA 1R4MB 4RLSA 4G81A 3I9MA 3FTPA 1I3LA 3Q3CA 5AXDA 2EV9A 2YQ5A 3GZNA 4OXYA 2NTNA 3DBRB 2AEJA 4MVJF 2HRBA 3PFWO 1LLQA 1CF2O 3TN7A 5C7OO 3TDKA 1Y8QA 4IDFA 2W8ZA 1YXMA 4E5PA 1EVYA 4W7IA 5HWSA 2VRCD 1GCUA 3NDRA 4BHTA 4LCJA 3A14A 3ONFA 3OIDA 5G4LA 3C24A 1YH3A 4ND2A 4UEKA 4U5QA 3SJ7A 1XKQA 1IZ0A 3JD3A 1RPNA 1ENPA 4KUHA 4KQWA 4MVJI 3DHNA 3AY6A 4TRMA 4CV1A 2BGLA 2JD1A 3TZ6A 3C3XA 4HFRA 3F6YA 3JYLA 4TROA 3UH1A 5HM8A 1V3VA 3WBBA 1E6EA 3H3FA 1NPTO 2AG5A 1JKJA 1E3IA 4CMBA 3KYDA 4ZQGA 1ZXBA 2RH4A 4DPLA 2DQ4A 4Y67A 4LMPA 5G0UA 5JMWA 2AXQA 5EIOA 3VDQA 4MVJP 4F3YA 5JE8A 3P7MA 4HADA 4YAKA 3PFFA 1GYQA 2VOJA 4KQXA 3JQ7B 1GPDG 1ZK3A 2RAFA 3C7AA 4E6PA 4RL6A 2GN6A 5TIIA 1YOVA 5HA5A 4B4OA 5A3JA 1KVQA 4ZGWA 1TXGA 1K89A 2BI7A 3FSRA 5A5FA 3F5QA 4JGBA 3GRPA 2Y1CA 2VRCA 3UICA 2EP7A 4JJGA 3EHEA 3QVTA 2OMEA 1Z45A 2IRWA 3BHMA 3AOEC 1CEQA 2PY6A 1SC6A 3PYMA 3CSDA 1JA9A 2ZJ1A 2NM0A 4IGFA 3IOYA 4MINA 3I6IA 3L9XA 4CQMD 4FJ1A 4NFYA 4NPCA 4OL9A 1S6YA 4BKUA 3D5TA 2ZQYA 2H9IA 3WS7A 3L77A 1U8FO 1YL7A 3VPSA 3K8ZA 4BGVA 1EVZA 4M86A 3HFSA 2Q2WA 4R54A 3O8QB 4QFCA 3G1UA 1MXHA 3ZHZA 1P45A 1VI2A 2W2LD 4RZHA 2V6FA 3GR6A 4HKTA 2PH5A 3VPHA 4XJSA 4YT2A 3ZCXA 4W9NA 1PU2A 1FDTA 4OAQA 1KYQA 1XA0A 2WYWA 4DUPA 3BMQB 4AJPA 1XHLA 1RWBA 1OMOA 3KBOA 5DBFA 3HNPA 1DOHA 4RORA 1YDEA 4BKOA 2CNBA 4BS9A 3O03A 1QYWA 1UP7A 2C0CA 4UVDA 4XKJA 1CQIA 3RD5A 3JQEA 3WGYA 2NLOA 3JQ6A 1N9GB 4G5HA 4D46A 1O9BA 4IZHA 4DBZA 1PJQA 2BGMA 2QG4A 4W99A 4RF2A 2X5OA 3T7CA 3L4SO 2ET6A 4GGOA 2Y1OA 4CMCA 2CVOA 1NWCA 3SX2A 1EUZA 4NG5A 1HL3A 2EHDA 4IDAA 4ALMA 1RKXA 4CQMA 2UYYA 3H4VA 4Y9DA 2YV1A 1GEGA 4KMSA 1DBVO 1JKFA 4IDDA 3QWBA 2WDZA 3PRJA 2X4GA 4DL9A 1SB8A 2J3HA 2Q1WA 3ORFA 4QT0A 2VHXA 3NTOA 5ES3A 3JYQA 1SCUA 1G6KA 2FPIA 4G2NA 1CRWG 1MC5A 3CH6A 1J0XO 4ZA2A 2D0IA 1XQ6A 4CLHA 4RVDA 1WWKA 2GPTA 1CJCA 4CM7A 1DDOA 2HCTA 4ZRNA 3WWYA 4A0SA 3WMXA 3ONDA 3IJPA 3QJ5A 3JQBC 4DLLA 4F46A 5CEEA 4N5NA 5GZ6A 3LLSA 2YHIA 3QQPA 1A4IA 4YB8A 1QYCA 1E7RA 3GDFA 4XJTA 1P74A 3HG7A 3CTMA 4NFSA 4A26A 4OQYA 2VTDA 4YJFB 3PHHA 3GC6A 3HHPA 1NTOA 1IULA 3JQGA 2A9FA 4XYMA 3WLFA 4AJJA 4ZQHA 5TLSA 3HWRA 1ZVMA 2ZJ0A 2YFHA 1WMBA 3E48A 3EC7A 1PQPA 1Z7EA 2IDZA 3EYWA 1GQYA 2G0TA 1ZKMA 4I08A 1NAHA 3D5QA 5KVSA 2EGGA 3EMKA 4TVOA 1NFFA 2D4AA 3P2YA 2FR0A 4UVHA 5JAMA 4PG5A 3TZKA 2CMDA 5B4UA 1AXGA 3ZNQA 1N1GA 4IQGA 4RPHA 4PCVA 3NTRA 3TRIA 4D0SA 3LF1A 1M76A 4CR7A 4EEXA 1LSJA 1CQJA 4QTZA 3GGPA 3SC6A 1ENOA 1UR5A 1WZEA 4NMHA 3DBLB 1HLDA 2VRBA 2I6TA 4QEDA 2CZCA 3DBVO 3HSKA 1X13A 4GVXA 1ARZA 4IDEA 3GLQA 1VC2A 3LLVA 3QE3A 3KSZO 5CDGA 3MJEA 4ZICA 3RFTA 1U3VA 4OXKA 5A9TA 3KRTA 4WECA 3LSYA 1CIVA 3ROPA 2NU7A 5AXAA 5KVQA 4B79A 4PG4A 1FK8A 3QY9A 5LC1A 5THQA 2VWPA 4AVYA 4WOJA 4CM1A 1ENYA 3GNTA 2GASA 5FWNA 3G3EA 3OETA 5G4KB 2UAGA 5U9CA 3H6KA 3AU8A 4YT5A 1S7CA 4KUEA 3WDSA 4CUZA 1Y6JA 5JXWA 1AGNA 1D1TA 2HSDA 4HNHA 2AMFA 2X5JO 5HS6A 3L07A 5MDHA 1VL8A 2PLAA 5K0ZA 1GYPA 4XD2A 4GL4A 4J0FA 1GQ2A 3OQBA 5L7TA 3AI3A 1UZMA 1HLPA 1U4OA 4R1NA 2HMVA 4BMNA 4OO3A 1HT0A 2X0IA 3PI7A 1PSDA 3RUDA 3JTMA 3RUEA 3LT0A 4NBWA 5AYVA 5TT0A 1E0DA 1ZZEA 5L40A 2DFVA 3RIHA 1QYVA 4YQYA 3HDYA 4YJHB 1VKOA 3GQVA 3Q11A 3GUYA 4BNUA 1X14A 1J6UA 1DAPA 2PGDA 4E21A 1I3NA 2G76A 2BLLA 1P9LA 3A28A 3C1AA 1XR3A 2GUGA 3ABIA 4OM8A 3IQDB 1Z74A 5JS6A 1LTHR 1EFKA 1ADCA 1HE2A 3D1LA 1DC4A 4GSLA 2PZLA 4XR4A 5CDSA 3NT2A 4IQ8A 3WGOA 1N2SA 3QRWA 1LDYA 1UAYA 3OA2A 3FN4A 2BKAA 3G17A 3OFSA 4GLLA 3TOXA 1HDGO 1KEUA 5KTKA 3E9QA 1ONOA 2YUTA 3RBZA 3W8DA 4BO7A 4RF3A 4BO3A 1YL6A 2TMGA 2CF6A 5KKCA 3IKTA 1QR6A 5JYAA 2D3TA 1G0NA 4R16A 4BB6A 4E5YA 2I9PA 3D64A 2Q22A 1C1DB 2RBEA 3PPIA 1E5QA 5A02A 1GQQA 1NR1A 1OI7A 4FFLA 1X15A 3K5PA 1R0SA 2VYVD 4BNXA 2IEBA 1BVRA 1QMGA 3SBOA 5IG2A 3MJCA 2AQ8A 1K6XA 3RC1A 5KCZA 2R6JA 3VH3A 3VVCA 3WGZA 3KZVA 4FGWA 3ZNPA 5ITWA 2EERA 4GI2A 1YKFA 3WYEA 5A9RA 4CM4B 2H6EA 1ADBA 2O48X 3F3SA 3LQFA 4K26A 3B70A 3KYCB 1H9AA 2EWMA 3I9OA 4YA6A 1NQAO 2VCYA 3KSUA 4NBVA 3GNQA 3ZV4A 4WCFC 4BNKA 3VH1A 4YPOA 4GSKA 1QRRA 4BMVA 1D1SA 3S2FA 4D7AA 5TJHA 5LDHA 2QYSA 2OORA 1T25A 3JQDA 2PZJA 3X2EA 1W6UA 2YHUA 3BHJA 4QXMA 1QV6A 3INGA 2B83A 5TJ9A 4ALLA 4XYGA 3ZV3A 2YFQA 3CZMA 1O8CA 3I9LA 3D3WB 4JN6B 3FNGA 1ISHA 2OP1A 3ICCA 3OP4A 4LVCA 5CP8A 3TSCA 4D43A 3JQ8A 3VAZA 1CERA 1HRDA 2C7VA 2GR9A 2JFGA 2I3GA 3BMOB 4BB5A 4FB5A 1JDJA 3SC4A 1BXKA 1K6JA 2VYVA 2QQ5A 5H82A 4XQEA 1P0FA 1ID1A 2IEDA 4PVDA 3F5SA 5FFFA 3WGIA 2C59A 3GOHA 4I8XA 2IYOA 2C20A 3O4RA 1GUYA 1UXGA 1B7GO 1YS4A 4DQUA 4GX5A 2O4CA 4PN3A 5JSFA 3DXFA 4L0QA 2AQIA 4RO0A 3BMNA 3DBHB 2PA3A 1PGJA 3L4BC 4GWKA 2DBZA 3UVEA 3S55A 4OMUA 5CHEA 3RKRA 4IXTA 4WPGA 4E32A 2O4UX 4JBIA 4FSHA 1C0KA 1MLDA 2HMTA 5L7YA 1V0JA 4IJWA 3OJEA 3PIDA 1OC4A 2RIRA 3FRJA 3F46A 5ITVA 2VOEA 4ALJA 3UCEA 1ZMTA 4L4SA 3RCBA 2FY8A 3OEWA 1DLJA 3P5SA 4E30A 4R68A 1X0XA 3EDMA 1C1XB 4EW6A 1W73A 4DQXA 3GGOA 3OJ0A 2R2GA 4O1MA 3AUUA 3WB9A 4Q3DA 2OZPA 1IPEA 2FSVA 3STHA 3GFBA 4QUKA 5A06A 1I01A 3NJ4A 2FP4A 4ND3A 3SLKA 4CMIB 4EGFA 4KP7A 2B0JA 9LDBA 4IMPA 4BKRA 4XDZA 3ASUA 5TF4A 4DIBA 2UDPA 5DCUA 1MXFA 2OXIA 1SNYA 3VVBA 5JDIA 4YJDA 3DC2A 1G1AA 1HETA 2OBNA 3ETGA 4ID9A 1P1FA 2DTEA 5KJFA 1PJ3A 3NJ8A 3W4KA 1ZH8A 5F5NA 3L6EA 5AVOA 7MDHA 4QQRA 3NX4A 4WNCA 2H1SA 1K3TA 4L74A 3GVXA 1P1JA 1QKIA 5DDIP 2BFPA 3AUAA 3RBXA 1F17A 3LDHA 3DHYA 4MO2A 1T4DA 4EI2A 3D0OA 2W90A 1T2CA 1UP4A 4DWVA 1KEPA 1ZJZA 4UVEA 3G79A 4P8RA 1EZ4A 2J3IA 2V6MA 4B4UA 3EGOA 2BRUA 2NVUA 4PIVA 4R1TA 4LRTB 4XX0A 3BTOA 1VM6A 2GCGA 4BO0A 4M55A 3OJFA 1GADO 3BA1A 2F00A 1NPDA 2FWMX 2GGSA 2HDHA 4FW8A 5B4TA 5I7EA 4XQ9A 2X22A 4FGSA 4Q3BA 4CLRB 5JC8A 1W8DA 2RH8A 3RC7A 4JBGA 1YBVA 1P1KA 5TS3A 1HZZA 2BI8A 4B3JA 4NFHA 3WGTA 1B3BA 4W9NC 4DTIA 2VHZA 3MJSA 4BVAA 2HK8A 4PZEA 1GZ3A 1JU9A 4INAA 4GGPA 5COAA 3RSHA 4I9HA 3HADA 4BQRA 3PJFA 1NQTA 4A10A 3W8FA 5A9SA 1DIAA 3IP3A 1JAXA 1IUKA 3AW9A 3WNQA 4BNWA 4ZVVA 3DWFA 8LDHA 4D3FA 2Y0CA 4A2CA 5K9ZA 4WCDA 1LQTA 2JD2A 1X7HA 3BMCA 3LT1A 1SMKA 4PLGA 5COQA 2A94A 2DUWA 4FCCA 4IY1A 3DOJA 4Z3KA 2YJZA 2AE1A 1ONNA 4WCFB 1YL5A 2E37A 5DT9A 3G49A 3F1KA 3JQ9C 4FR5A 4PGFA 9LDTA 1Y8RB 2I5PO 4Y98A 5JDCA 1NPYA 4B7XA 1H6CA 4J7UA 5HTOA 1RM4A 4J6FA 3VHRA 4CR6A 2PKQO 1AUPA 1Q1NA 1LRJA 4FN4A 2JFHA 1Y5MA 3DZBA 4TMFA 4B4WA 2I99A 2D59A 2BMAA 1DFIA 4CQLB 4YWJA 3IUSA 4GQAA 3DL2A 4NBRA 5T57A 1J5PA 3NGLA 2B36A 2VUTA 3PYLA 1AN9A 3KYBA 1NASA 2X23A 2FRDA 3OECA 3RUHA 4KUGA 3PGXA 4BNLA 4CMEA 2P9CA 4NJMB 4Y6RA 1YQDA 2J5RA 4E5KA 1DXYA 1ORRA 3AM3A 3D3EA 3F47A 4LRSB 4RF5A 3E5RA 5JC1A 4FFOA 4BNGA 4BO1A 1ZSNA 1NX6A 3WX0A 1DIBA 1PL8A 3U0BA 1DSSG 5TX7A 4R5HA 4R1UA 4J2OA 3H9JA 2DPHA 4OKIA 1V9LA 4GBJA 1SOVA 4TKMA 5IDXA 4IIUA 3DMTA 4MKZA 2PD3A 4GX1A 1EK5A 3I4FA 1U7HA 1N7HA 3ICPA 3WMWA 3WYBA 2OHXA 4U6QA 4BNZA 1WNTA 4J91A 3Q1LA 5CDTA 3LYLA 4B3HA 4N5LA 1ZK0A 1K0UA 1HWYA 2UUPA 4NH4A 3UUWA 3WTBA 5I8WA 1F8FA 4RF4A 3K31A 5GZ1A 1BDBA 4E2XA 5BNIA 2VWHA 3UGKA 5C5IA 1IY8A 2HK9A 2HUNA 4XA8A 1M66A 3ITKA 1BG6A 1PQWA 3H3JA 4B8ZA 1OOEA 3PHJA 1NBOA 2X6TA 2VHVA 5BNTA 1B8UA 2Q3EA 3MTGA 1UP6A 4Q3AA 3PHIA 4EJ0A 4MKRA 2RCYA 3RC2A 4S1VA 1E7QA 2P5UA 1E6WA 4M49A 3UXYA 5K6AA 3K30A 2BFAA 1JKIA 1GTMA 3WXBA 3ULKA 4K28A 1ZSYA 4C7JA 5IAAA 2E49A 3OA0A 2X1HA 4B3IA 2QRLA 3A9WA 2Z1NA 1L7EA 1R4NA 1GZ4A 1QYDA 4BL5A 5BSFA 1LJ8A 1LDEA 4J1QA 3ZU4A 1F12A 1BXGA 4MOWA 1LBEA 3DZJA 4MVJH 2HU2A 4OOEA 1P1IA 4E31A 4R3NA 2FPPA 4J0EA 3O26A 3VTZA 3RAJA 4DYDA 2X9NA 2EEZA 1E7WA 3ZU2A 4Z6KA 2NVWA 4R9RA 2J5QA 5IN4A 2EKLA 4X54A 5L53A 2PFGA 1YO6A 2DU8A 1XU9A 2IXBA 4E5NA 3JYNA 1TT7A 4RVHA 2ZCVA 2BFMA 4E5MA 1PS0A 5DZSA 3FBGA 4Q3CA 4YVFA 3TQHA 1E77A 2V6BA 1E92A 1R4MA 1HE5A 4RV9A 1N5DA 4XIYA 2C7GA 1HEUA 3PQFA 1HDXA 3ZV6A 4HV4A 4XDYA 5L45A 1Q7CA 1DFGA 3DBRA 2O3JA 3MJTA 5IZCA 4TZKA 4S3MA 5EINA 4ND4A 1ENZA 3EVNA 3GMDA 2J8ZA 3U9LA 1L7DA 3AY3A 4IJUA 2GD1O 4M8SA 4HFJA 1CETA 2HRZA 4HNGA 4NR0A 1JWAB 3L6OO 2YY7A 4FC6A 5F1OA 2V7PA 3U3XA 3VKUA 1TI7A 1SO8A 5M6DA 1Y5RA 1Q0HA 5DBGA 1HE4A 3C85A 4P38A 3IJRA 3ZWYA 4F45A 3VH2A 3O38A 1R0LA 3ANLA 1LUAA 5IJZA 3C7CB 1Y1PA 2IE0A 2YDYA 3WJ7A 1WW8A 2C5EA 2FHSA 4I9UA 1SOWA 1ZK1A 2X9VA 5LCXA 3I9NA 2EIHA 4RPGA 2BH9A 1GY8A 5GY7A 4AJNA 4ZQEA 3E03A 1YB5A 2EJVA 1DRUA 1U2DA 4Q9NA 1DJQA 5BSHA 2GN8A 1PJ2A 4ZQFA 3OBBA 1OC2A 2POQX 1WLYA 1NVMB 1NAIA 5ENVA 2J3JA 1PJSA 1I0ZA 2JHFA 4C4OA 3KLPX 3JQ7A 3HN2A 1I33A 4BO9A 4NIMA 3JD4A 4PLVA 2CDBA 4AJOA 4BKQA 4LSMA 1GFSA 3GY0A 5KJ1A 2EF1A 3KVOA 1DIGA 1NHGA 3OJLA 1YJ8A 3NUGA 5L3ZA 5IF3A 2DUUA 2Y0DA 1DC5A 3DR3A 3ANNA 5T8KC 2HQ1A 5CAEA 2SCUA 3S2IA 1ISFA 4BOYA 1A9YA 1E3JA 3V1TC 3EZYA 5TNXA 3RU7A 3M2TA 4Z9YA 1I8TA 2PD6A 2LDXA 3GN2A 1CYDA 2RHCA 4UEOA 2B37A 3BZUA 3OHSX 1PL6A 1A5ZA 4GH5A 4K1LA 2VYNA 4Q3EA 1QSGA 3RC9A 1HZJA 1KEWA 3QHAA 3U4CA 4IZIA 4RZIA 3M1LA 1PQUA 3ZWAA 1XYGA 2Q1SA 5BNFA 2YYYA 4NHEA 5J9GA 4ROSA 3UAGA 1Q7GA 1WVGA 5FI5A 3QP9A 3MWEB 4IMRA 4Z3DA 6ADHA 4U8GA 3T7EA 1C0IA 3UF0A 1N1EA 3O8QA 1LX6A 1GAEO 1YRLA 3I23A 4D0RA 3QW2A 1E7SA 1GV1A 1PJBA 3IMFA 4BV8A 5TC4A 1C3VA 3ZWNA 1EUCA 1EE9A 1QP8A 4YXFA 1KVUA 4XIJA 4RLHA 3TFOA 3EZLA 1NWHA 2GZ2A 1PZHA 3BMQA 4PLYA 1PR9A 4DLBA 2OUIA 4CL8A 4FD3A 3PTZA 4FJ0A 2JCVA 3HFGA 2CVQA 4XQCA 5HBRA 5F21A 2G17A 1XIVA 1HSZA 4XRGA 3I1JA 3JQFA 1UXKA 5CEFA 1N9GA 4H16A 3KHUA 4FC7A 3QV1A 4W7HA 3MJVA 4L4XA 3BAZA 4IS3A 2X0JA 1SPXA 3QWHA 5EJ2A 5FI3A 1T26A 1P0CA 4NU5A 5GMOA 5C7IO 1Y9EA 2ZCUA 3HJAA 2VNAA 3GAFA 4H15A 5KVCA 4P4NA 3RQSA 1WPQA 4KOAA 2B35A 3FNFA 5CFZA 5JLAA 2PH3A 1X0VA 4BQPA 5JDIC 2Q4BA 2YW9A 2ILTA 4WLOA 3R0IA 5ENDA 1E5LA 3W8EA 3ZHXA 1X7GA 5MGBA 2NACA 4WEQA 4LK3A 3NV9A 1PL7A 3FF4A 4OGWA 1J49A 3KOUA 4WOKA 1FDSA 1JWBB 2ZATA 1UXIA 4MVJD 3HN7A 4NNJA 3UCXA 2IYPA 4BNFA 1KY4A 4J9UE 4FQ8A 1WXDA 3BTSA 4TWRA 5EQDA 5JPIA 2Y99A 1IOLA 1IHXA 2PWZA 1ISIA 3MCVA 4DREA 5AXCA 4MIEA 5I7VA 1WDMA 1I3KA 1PTJA 2EXXA 1HXHA 4UAGA 4RPKA 4YJGB 2AA3A 1E1MA 3H9QA 6LDHA 2HAEA 5IXSA 3GN1A 1U3WA 3KLMX 4HY3A 2WJPA 4BNNA 2DT5A 2I76A 4ALKA 4BO6A 1O5IA 3ZWCA 1H5QA 4CMKA 1E3WB 1B8PA 1UZLA 4NBTA 3TZHA 4FDAA 3GNSA 4BUCA 5I7SA 4DIFA 3HQ4O 5L7WA 4OIMA 2Q4EA 1R15A 5FEUA 4LSWA 4YJFA 1U2GA 2DAPA 4A03A 3MEQA 4YR9A 3O9ZA 3VOSA 2FZEA 1M2WA 1AHIA 2RHRA 4Q3NA 1NR7A 4RDHA 1E6UA 4YTEA 2NNLD 3M2PA 4O63O 1O94A 3NDJA 1LLUA 3RKUA 4I5DA 1YVEI 2I66A 2DM6A 3C1OA 3LT2A 1A7KA 4XGNA 1GL3A 1MP0A 4WUVA 3RBVA 1EK6A 3DMYA 1Q0QA 1IHYA 3MJ4A 1JW9B 2C2YA 5KJEA 4U6SA 3EAGA 4DQVA 1H93A 4MVJA 4TRNA 4YEDA 2NQTA 4PG6A 4LMRA 1SAYA 4KDEA 4UUPA 3RROA 1KC3A 3VC7A 3RUCA 2GSDA 2GO1A 4HP8A 5KKAA 3PK0A 2ZB3A 3I9JA 5EPOA 3LF2A 4UEJA 1KBZA 3WWZA 3DBLA 1HYEA 5BQFA 4HWKA 2ZTVA 5KVVA 3GK3A 1QG6A 1YWGO 1O6ZA 1ULSA 3FWNA 2VHWA 1DLIA 4JLWA 1M67A 1NM5A 3KB6A 1U9JA 3OH8A 1A9ZA 4U0JA 3AI2A 2PD4A 4MP8A 3V2UA 1H0KA 2CSUA 1MV8A 1VRWA 2FSSA 1I3MA 4J1NA 3B20A 1CWUA 3RUIA 1O89A 3E9MA 3JQAB 3GT0A 1XQ1A 2GZ3A 3AOEA 3I83A 3TL3A 1B0AA 3OEYA 5CDYA 2DTDA 1ZK4A 5G4KA 4AJ1A 3DOOA 4RQUA 3W4JA 2O3UA 4D41A 3GEDA 4JP2A 1DAOA 3MOIA 2Y1EA 4W6ZA 5EL0A 3LVFO 3PJEA 4EJMA 1L1FA 1MG0A 4ND5A 4WLFA 4EITA 4CM9A 3CPSA 5HRUA 1E3EA 1PZEA 3OJOA 2EG9A 4TSKA 4C7KA 4J7XA 5F3RA 5JAQA 2Q1TA 3H5AA 1AE1A 1IZ9A 1D4FA 4CM6A 3KEQA 2QZZA 4EUHA 2DBQA 3WFJA 4IXWA 1U4SA 4R1SA 4XRRA 2CFCA 4NDNE 3GG9A 3ZWXA 3DMTC 3B1KA 1DHRA 4DXHA 4W4TA 4M1QA 4OQZA 4MJLA 5DN9A 1GR0A 2EKQA 3ZN2A 5CG1A 2Y1GA 2V65A 2VUSA 2DKNA 2WD8A 4YJHA 2G82A 4N7RA 2EW8A 1E7YA 4BO2A 4IGEA 3DB2A 1Z75A 2ZTLA 1SEPA 1LSSA 1PIWA 1AXEA 2JJYA 4BNIA 2P4HX 1I24A 3JYOA 4ZJUA 4IS2A 3WJAA 1DJNA 2FOIA 3WSVA 1A7AA 3EUWA 3TF5A 4CM5A 1UXHA 1T24A 1ZIDA 3ZWBA 4DPMA 2W2KB 2OL4A 3GG2A 2Y66A 2Q99A 1V3TA 4B7UA 4QFDA 2YV3A 1Y7TA 3AUSA 4PVCA 1SBYA 3H8VA 4EZBA 3VPFA 1C1DA 4PLFA 4B7CA 1YDWA 4BNTA 3NDIA 3WOHA 4IIVA 2CDAA 5T67A 5JYEA 2D8AA 1LRKA 3ZW9A 4AFNA 4TVBA 4F6CA 1BW9B 5FYDA 1B16A 3ZWOA 4OOFA 3WSWA 1LSOA 1TB4A 3CMCO 3Q2IA 1YBMA 1GPJA 2VZ8A 5CPFA 4CR8A 4EUEA 3GVCA 4CM4A 4J1SA 2P4QA 1YE3A 3WGHA 4QECA 1OBFO 1CDOA 1NVGA 4K6CA 4YCAA 3JQBA 4AICA 2C82A 3KYCA 1I2BA 3T4EA 3BXXA 1U28A 5JAIA 4DIOA 4DC0A 1B26A 2PGJA 3LC2O 2C5AA 3WQQA 4YT4A 4O6VA 2XPCA 1FF9A 4LISA 4DA9A 2ZYDA 3ZNNA 2X5KO 2J5KA 3GUCA 3ADPA 4TQGA 4YYZA 3KM0A 1DHTA 1X1EA 1PJ4A 3D3WA 2UUOA 4JROA 1NFRA 1BXZA 5H81A 1O0SA 2X7HA 5BR7A 1FJHA 2JAPA 5KOIA 1KOLA 2NWQA 3GPIA 3Q0EA 3BMOA 2HO5A 3NT5A 3ENKA 1UDCA 2HMSA 2QYTA 4EJ6A 3WQSB 3K96A 2C07A 1I36A 1LC3A 1MUUA 2C2XA 1OAAA 3IKVA 2AQKA 4BGEA 3VDRA 1WMAA 5TRTA 2Z5LA 1O95A 4HUJA 4RJTA 4GPD1 4J43A 1R0KA 4WNIA 5L4LA 3CZRA 1BVUA 2FR8A 5IXYA 3AOGA 4LN1A 1HDZA 5A1TA 4PG7A 4CLOB 4MPDA 3DBHA 2H5LA 3B6ZA 3DTTA 5F1PA 3C8MA 4J4HA 4ZRMA 4IUYA 2PV7A 4XEHA 5F5LA 3RJ5A 1RM0A 3GPDG 3WLEA 4E12A 1KIFA 4KDFA 5JMPA 3E9NA 1NNUA 2Y68A 4DLAA 3F4LA 4QX6A 3KO8A 5H83A 2C54A 3T4XA 1LC0A 3MZ0A 1QLJA 1T1RA 4CMAA 3E82A 1ZFNA 3AY7A 3ZHYA 1KEVA 1ZMOA 5I9MA 2I67A 7ADHA 5ILOA 5TQVA 1C0LA 3GGGA 1C1XA 4II2A 4EDFA 2O50A 1F8GA 3IS3A 3JV7A 2OO5A 4BMSA 3R3JA 3GVIA 4UUMA 5L9AA 3IDSA 4BNYA 3K2EA 4Z9XA 1XEAA 1RJWA 3ZI0A 3P19A 1R16A 5ICMA 3WGQA 3N74A 4Q39A 4CMIA 2NU9A 3RWBA 4DBVO 4CM8B 2CF5A 4PLPA 4RQTA 4DGSA 3BTVA 3ROMA 3CIFA 4GMGA 4A5OA 4E2ZA 4J4TA 1P1RA 3S2EA 3L9WA 2P5YA 4RGBA 1EDZA 4ZD6A 4ITUA 3RU9A 5BT9A 1GU7A 3P2OA 5ADHA 2NVBA 2BHLA 2NU8A 3G0OA 3DEYX 4NK5A 4CV0A 4ZHSA 3IIEA 1V35A 3NRCA 5IDWA 4RPLA 4OSOA 3OMLA 4E2YA 5G0VA 1DO8A 2JAHA 4BGIA 4XB1A 1WDLA 2PGLA 4ZQBA 3HE3A 4JNKA 2WD7B 2D5AA 5BSGA 3V1YA 1NFQA 1VJ0A 4O59O 3PEFA 5EMHA 1TT5B 1A72A 4KZPA 3WGGA 4MVJE 4R9SA 3TL2A 3FPCA 4J9VA 2OGUA 4GAEA 1HF3A 1HE3A 2VHYA 3SJUA 2E6UX 2X0RA 4JX8A 4YACA 3C7DB 3GZNB 3PP8A 5JY6A 1E7MA 4IDBA 4QSMA 2VZ9A 2ZK7A 2P91A 4GWGA 1GD1O 5TSDA 1EUDA 1JAYA 3K9QO 4CLRA 1Y8QB 1TA4A 3H7AA 1Z6ZA 5DNAA 4WLEA 1E3SA 3A4VA 3EVTA 2W98A 3GDGA 4KTTE 4WGGA 1ZW1A 1ONPA 5TT1A 1EVIA 1D3AA 1JQBA 1WAMA 3PHGA 1WDKA 1GUZA 1HYHA 3U5TA 3C1TA 2ZTUA 3DZHA 2JCYA 3ETDA 4EBFA 3VTFA 4XYEA 3B1FA 1NQ5A 4P4LA 1YONA 2FMUA 3E8XA 2NTVA 1PJTA 1KS9A 3VZQA 4OKNA 1V3UA 3INTA 1I10A 3NYWA 4I5EA 1PJCA 3FCOA 5KJCA 2WE8A 1EBFA 1DC3A 3KYDB 3DDNA 3NGXA 4IJVA 4WCFA 3VKVA 5GZ3A 2O3QA 5KNLA 3DQPA 2NQ8A 3DFZA 4I1IA 1EDOA 1NYTA 1EEHA 3UW3A 5A03A 1Y8RA 3QWIA 4RVSA 5IDYA 3RFVA 3ZWMA 2GYYA 1G0OA 2VN8A 3ZW8A 4DMMA 4YRAA 3SXPA 2PZMA 1T2AA 4XWYA 1MFZA 1YOVB 4NZ9A 4NBUA 1T2DA 4NK4A 3ZU3A 3EW7A 1PGOA 5AXBA 1U1IA 4PFJA 1QYXA 4CQLA 2JFFA 4HFNA 1EE2A 1XCBA 5BSEA 5JFOA 2NTJA 3GDOA 4L9RA 1UDBA 2HLPA 3DAPA 2Q50A 5A3VA 4NQZA 4R41A 2QRKA 4NJMA 3INRA 3KTDA 4RDIA 5TGDA 3D4PA 1XGKA 1UXJA 2E4AA 1F14A 1XSEA 3PYXA 3U09A 2DTXA 3GMSA 1RYEA 1YGYA 3AI1A 1T2EA 3KV3O 3TFQA 1T1SA 4L75A 1BMDA 3PQDA 1GEEA 2CUKA 3QSGA 4ND1A 3S1LA 4FBGA 3L4BA 3AFMA 4CUKA 2NADA 3TWOA 4EEZA 1R37A 3LK7A 1PWZA 2IODA 5EERA 4JJIA 2AQHA 1BHSA 1GDHA 1PGQA 3DZKA 2VZ0A 5JAZA 3BTUA 1XU7A 4MKXA 1JLLA 5C3MA 1P33A 1KERA 3WNVA 3I4CA 4AJIA 1IB6A 1MB4A 3OIFA 2O2SA 1B3RA 3CUKA 3IL2A 2OP0A 3EK2A 3IP1A 3R1IA 2B5VA 3CE6A 2OOSA 2O7QA 2QIOA 3F1LA 4TRJA 2A4KA 1VPDA 2IZZA 3AWDA 3UKOA 3PHLA 3H9GA 3HUDA 1PGNA 3RI3A 4ALNA 3OICA 1IE3A 2E82A 4FS3A 3H5NA 1FXSA 5A4DA 4CL3A 3ZWPA 4UREA 4E2WA 3GEGA 4MVJM 3DOCA 1H6AA 1JTVA 2YZ7A 3ZU5A 2IZ0A 4CQMB 3ONEA 1R6DA 1BWSA 1B8VA 3H9EO 3BHIA 2Y0EA 3ST7A 1XDWA 2X0NA 3EY4A 4R5MA 3PLRA 1FMCA 3U49A 4MIOA 2Q46A 3KXDA 4W82A 3N7UA 3S8MA 3TZQA 2WMDA 2OFPA 3RVDA 2GZ1A 3COSA 4N5MA 1E1LA 5T5QA 2VYND 1Z82A 1B2LA 4ONEA 4OXNA 4URFA 1ZO8A 1H2BA 4FFPA 3WBFA 5B12A 2HJRA 2A35A 4ESOA 4J49A 3PWZA 1R66A 4CODB 3GF4A 2F1KA 2PNFA 1BTOA 3D4NA 1C0PA 4HX5A 3LT4A 4AJEA 5EQFA 3ENNA 4IQ0A 3PDUA 2X58A 2YHIB 4UVIA 3GVHA 3MOGA 4IJKA 4IDCA 4O0LA 4R01A 1D7OA 4JK3A 5JO9A 1PZGA 2QW8A 4HFMA 4J16A 2EGHA
chains in the Genus database with same CATH superfamily
1SQGA 4GO1A 4TMVA 4MP6A 3GZTB 3DDCA 3ZNOA 1L7VC 3R6LA 3O5AA 1GT91 2N1MA 1DUIA 1JDBB 1K63A 3DPIA 1SIBE 4QDUA 1KVRA 4LWPA 2OBYA 4J0GA 2B2XA 3E0XA 3LFHA 4MDHA 3FHLA 4A92A 1UYJA 3MCZA 3PFKA 1P18A 4OH1A 5CLQA 4NCNA 3GCGA 5KEIA 2F55A 2QNIA 1ZXLA 1UAGA 2FSIA 3N28A 5J4LA 1T1JA 2I2BA 2RGNC 1ADFA 3HZHA 2P1RA 2ZJBA 5HDQA 5B7GA 2Z0MA 1W1IA 1G2QA 3R5XA 4Q03A 4KDRA 4XH9B 1LNQA 3LG2A 2XEDA 5AI4A 1VJ1A 2WSMA 4IO0A 1T1IA 1KQ3A 1WUHS 1P39A 3QMMA 1T0JB 1U2SA 4W7SA 5K20A 3W2FA 2P67A 3K71B 1RZVA 4CIAA 2OBMA 5IDVA 3AP3A 4V0NA 1VG8A 3CF4A 5CEJA 1YASA 2G5GX 1MOQA 1OXBB 2H31A 2O7VA 2NT4A 3BWVA 2IYXA 5C8XA 1NBWB 3E84A 3ANMA 1SXIA 1NQOA 4K0KB 3L1KA 1L8AA 4WN9A 2DFDA 1CUWA 2YWXA 2A92A 2TMDA 4CEJA 4BNMA 3LIIA 4ZDIA 3R6GA 1XPJA 3JPYA 4D3ZA 2VG8A 5A6VA 2FB9A 2UXDB 2YNMC 4M4SA 4PHGA 3CLRD 4WLUA 3PQ6A 3MD9A 4B80A 4YQFA 2DWUA 2ADMA 1E9CA 4MW5A 2J6IA 3X3HA 3FPLA 2C9ZA 3H5TA 3GRVA 4O4HB 4TV9F 3CF2A 5AM5A 3H97A 3O73A 4QAJA 3NW9A 5DHUA 2ST1A 3CKYA 3E2IA 3FWKA 3THSA 4YBZA 1F06A 1ZYUA 2V3WA 3MGCA 3EFBA 3IT1A 1WP4A 3QFCA 3BG5A 5CVVA 2YFYA 1WHSA 2PLFA 3OF2A 5IC6A 1WCXA 3TTYA 3CUEF 4HWSA 3WLSA 2CHFA 3BF7A 1DWUA 2IHYA 4RZ2A 5D86A 3PXCX 2VXOA 3C6YA 2XYVA 3PLNA 1PWYE 5DISB 1LXCA 4Z54A 3SHQA 1VYUA 2ZTMA 4BXOB 1OLXA 1QCDA 1W19A 4GMFA 1A9TA 1OX6A 1XCMA 2GN9A 3Q7IA 5FBWB 1ZEJA 1H8ED 1JIQA 1R4AA 5A05A 5GJCA 5FULA 2H54A 1QQAA 2R44A 1SVMA 2YY6A 2Y9PB 4Q9IA 3TUIC 3DO8A 2PMWB 3BF8A 4KVAA 1QVZA 4FHZA 4Q4LA 4PO8A 1SUAA 5NLLA 3RYIB 1FNBA 5I4CA 3ZS8A 1T2FA 5KWJA 2ZQZA 5LMNB 4FUQA 2C29D 5EP4A 1P1HA 1ZVKA 2Q3HA 2XVYA 2D5CA 3DAGA 1RWVA 4WFIA 1VXOA 5SZHB 2I34A 1Y4DE 2HT1A 3C3BA 3MRTA 1H0RA 3ZHSA 4DV1B 4AUEA 2O8EB 3K16A 4ZQIA 2WWHA 3V1UA 3IQGX 4GKAA 1Y6GA 3O8OA 1RLJA 3ND8A 5JY1A 5I7FA 3V4LA 3TVTA 1T0PA 3VOBA 4FMDF 1G20E 2Q5IA 4K2AA 3TRDA 4CIYA 2PBZA 1DOZA 3VR5H 4BWYA 2PDAA 2WUEA 1V41E 1OYVA 2PZKA 2BRUC 1IEVA 4K46A 4NZNA 4C29A 2ZRHA 1PGPA 2BMVA 4NV0A 2EP5A 4BNVA 1UQRA 5J40A 2AR9A 1OZAA 4EY8A 1YC5A 1JJVA 4RVUA 2Q0SA 4C0BA 1EVJA 5CU7A 1DRWA 1MMFB 3ILHA 3QUTA 4L2IA 4QRIA 3SM3A 3WSTA 2K7FA 2C7RA 1OYWA 3W1VA 1ZQ1A 1A27A 2R6HA 3P0HA 1PLJA 2DSTA 4RSRA 4TMTA 2L19A 1E61A 5BV2P 1P5HA 3ZD7A 1T5TA 4FFRA 5H02A 3NWEA 3DAFA 3W79A 1GL6A 5EXXA 1QQ6A 3DZDA 4B6JA 1Y5LA 1NNSA 3NRJA 1HZZC 1DINA 2P41A 3MYYA 5DGXA 5JAOA 5FLEX 3ORRA 1SGWA 1IC6A 1X7DA 4L8LA 1XQXA 3MCWA 3GEIA 5EESA 4RFSA 5ALOA 5HCIA 1W44A 3HUFA 2P7IA 1ZI8A 1WVMA 4CCYA 3OWXA 4LXXA 3SX0A 2AK3A 3RUAA 4IPTA 4P3KA 4RPJA 1R9GA 3EP7B 4RTMA 2FQWA 3K5HA 2P68A 1JECA 1UDAA 4YGXB 1FE8A 3ZPXA 3ZZNA 1EQ2A 1UL1X 4CMGA 4F3CA 4HNUA 5T73A 2F48A 3V33A 4CEIB 4MARA 3S2GA 1IMOA 2HF2A 3IQZA 4H17A 3D8UA 1FQOA 4GF5A 3NAQA 4D3DA 4N7BA 4D82A 3SN6A 4KJXA 4Y2QA 4KXLA 2Y1WA 4A82A 5KUTA 2JG3A 4KYTA 4XR9A 1G9SA 4J76A 4KIWA 2HWYA 3OESA 3U44B 2PLNA 2BI4A 3K32A 5CDFE 1OYOA 1QKJA 4BO4A 3EXEA 1F2UB 3T5GA 1ISSA 4F38A 1XXHA 3WQRA 3VYRB 1LNSA 2FPRA 4PN7A 4GVLA 1NVKA 4RKEA 4INZA 1TQ4A 2JKZA 4MV1A 4KFSA 4NU6A 5EIWA 3ZI7A 2BBSA 5KDDA 1VL6A 4RM2A 4AUKA 1IFXA 4LE0A 1W47A 3Q6IA 4NBKA 3WYGA 1WY7A 1ZA1A 3W2TA 3H2BA 4P2GA 3U1BA 1CE8A 3SBXA 1XG5A 2HA6A 1YQGA 1J1ZA 2J0UA 3B53X 3GH3A 4JCOA 4KXUA 4FFDA 2Q2NA 4G2TA 4DCMA 1BRTA 4F6LA 5L51A 1HRKA 3UFBA 1CZNA 1EFRD 4YJGA 2ATIA 1JN0A 1W5EA 2A5DA 5HQJA 3HO6A 3LP6A 2VA8A 3VH4A 3JQCA 4BUJA 2CHUA 4M3NA 1RM5A 2D5LA 1Q7EA 1B14A 2ZIWB 3PC3A 1G21B 2IBSA 4GKBA 4CKYA 2XLBA 3QPWA 2A0XA 4CLXA 2Z1MA 1LWNA 1GIAA 1E3WA 2HN9A 1SBIA 1P7YA 3IIIA 4PSDA 4WBXC 1OJ7A 3HGTA 5LDGA 3NKLA 4L02A 3UQYS 3IQXA 1PT8A 2P30A 3IAXA 2VUUA 1FDWA 3C6BA 3ISTA 2I3AA 4I36A 3PQEA 4TRRA 3E9YA 3TQSA 3UJ3X 4CU2A 4WBNF 3M5DA 2RJ3A 2VSYA 3NUZA 1TQ8A 5JCOC 2COUA 2Q9CA 4EAQA 4IOJA 3WLRA 2AN3A 1TKCA 3EPHA 4H9GA 2Z4SA 4ND8A 1B23P 4EMTA 4WASA 1LI4A 1ZEMA 4UUNA 4HHEA 3BEOA 3L0SA 4RNCA 5ALKA 1ZM7A 3KWLA 3OM9A 1VPEA 2XV1A 4YBRA 3UAWA 2JFXA 3GJXC 4MNTA 4IGIA 2ORYA 1YU9A 3OE5A 1LCIA 1TKBA 2LCIA 4LRYA 2H4ZA 3HZZA 3AJ8A 3IO5A 1Y1QA 2XOKD 4Y7CA 3QM1A 1DC8A 4U02A 2X0EA 2FEOA 1W4ZA 1YD7A 3TLBA 1SOAA 2G09A 1V6AA 4AY6A 3QENA 4WJZA 3T1NA 4BX0A 1JH9A 2DBRA 3B13B 4E33A 1DXOA 3CRVA 1DNPA 3I3OA 3HBNA 3O31A 3GLFB 3AVUA 4BWVA 3UMVA 2DULA 5HJ5A 2JIRA 3AUXA 4Z9FA 3SE7A 5B1SA 1E6CA 5LPNA 3SYRA 4PSAA 3EDYA 4ZEVA 1U5CA 4JDPA 1EFRA 4KWIA 1KU0A 2AWOA 1YCHA 3KU1A 2YWGA 1TM3E 3IA7A 5CVDA 1DO2A 2ZJ2A 2C84A 4D92A 4CZ2A 3DFUA 5K3OA 2CVZA 4M22A 2B7LA 2QTAA 4YAEA 5CT5A 1TTTA 4QOGA 5IVKA 2DUJA 1M5RA 3AFNA 4P33A 3OM8A 2J59A 5T8KA 3QEOA 4JJ8A 1HDCA 2ZBEA 2R48A 4P4GA 4WWHA 4J75A 1XPOA 2XHZA 1VZ3A 2QS9A 5A7HA 1U3TA 2AK2A 3UEOA 1NBHA 1P7PA 3OHMA 4AO8A 2G04A 5IT0A 2PXHA 4E1AA 2HBQA 3PC8C 3TS1A 1G66A 3B38A 1FYEA 4PX5A 4MRMA 4R4JA 1GPYA 2BHRA 5CGZA 3NBAA 1ADGA 3EEBA 4X92A 5JECA 4B8WA 1GA4A 5AH0A 1RPJA 3ZVRA 1FBNA 4WLVA 4CF7A 2OKCA 1I72B 4KHZA 3EMDA 3DVSX 5ER6A 2BKEA 2FFHA 2IZ1A 2Q4OA 4JC8A 2RHDA 2GN4A 4JYMA 2WLTA 4M2LA 4UNNA 5CURA 4BVGA 4DLRA 4D26A 3P20A 4UQPA 1YZLA 4JB0A 2CL5A 1WO8A 3IVAA 4NQRA 3PUIA 4JI3B 3B7WA 2JBAB 5C3UA 2HZBA 2XKBA 2AR7A 1GQRA 5I7HA 2ZYUX 3VA7A 1XRSB 3IA2A 5I4BA 5E7MA 4U63A 5T3YA 2GTIA 3JVDA 2Q9AA 2J4CA 4UQLA 4D45A 3LDAA 5M7EA 5E1OA 3A1CA 4I4CA 3W77A 2HLDD 1VB5A 1WP9A 1C3LA 3N0WA 1OYYA 3OPYA 1XD2B 4O29A 2X8LA 4BIMA 2Z2YA 4EFMA 2HHJA 1RRKA 2ZFUA 3GFVA 2RG1A 3CEPB 5CNJA 3KALA 1WOMA 1C29B 3A4YA 1GSHA 1ZK2A 3IPCA 3MHPA 5CFQA 1FOEB 5A4AA 4Q7EA 3LQKA 4I99A 4OLFA 4HI0E 4YJ3F 1WB6A 5I8ZA 3TM5A 3DB1A 3AVOA 2B69A 4QPNA 1LSUA 2BEUA 3PVZA 1JDUA 4K6OA 1AHHA 2WOOA 2ORIA 5AP9A 5ECGC 3I61A 1UBUS 2LZ0A 2G1AA 3GVPA 1L3BA 2IVZA 2WC1A 1NLYA 3ASVA 4C6SA 1Z0FA 5ALTA 1ZSVA 1BVHA 1ZITA 5IM4F 4HDSB 3DMDA 4CQNA 1M6VA 1UBOS 4P7GA 5AW7A 1LRLA 3E1GA 5IVPA 4LZAA 2B1RA 4RGVA 4EI7A 1CY1A 3FCCA 4QRDA 5IZCC 4Y6PA 5F1KA 1QE5A 3KELA 1WSWA 1GU1A 1AQNA 2GLXA 1QKKA 3ZJUA 1GTG1 2VK1A 4LJ4A 1JR2A 1T8PA 5DCWA 3ACDA 1WDTA 3TEFA 4ZYYA 1H6DA 2GQ0A 3CXRA 1GDDA 3IVMA 4PU0A 4L16A 4MQLA 3TR0A 5IWCA 2B4RO 5HS4A 1FSSA 3KR0A 5U4QA 4BFZA 1Z6TA 3KWJA 4TUYB 3KEGA 5H5JA 3H8JA 3WNCA 2V4MA 1PEYA 1YZKA 1Z6XA 4DCUA 3CXUA 5TS2A 5IUKC 3QX9A 1B2RA 3V34A 1ZN2A 2HLDA 2O3TA 3DR5A 4ZAZA 5HP4A 2AN5A 1JE0A 1C41A 3K1AB 2GBGA 3JQRA 4QATA 3S4YA 4UXJA 2O2HA 3GJZA 3OWOA 5SZIA 1ZUD1 4NEQA 5K3AA 1EINA 1GVHA 4HN9A 3VRHA 3B2NA 2DJIA 4YQZA 5LZ5A 4YDRA 2HJSA 1MG5A 2XQKA 3EUFA 3N05A 2HF8A 4QT4A 3T54A 1P7ZA 3IAHA 5B1YA 4ZALA 4W5QA 3JY6A 1A9SA 4P5PA 1U3UA 1PZFA 4HNRA 4YDSA 2XODA 1AMOA 1I5RA 3WMEA 4HATA 3C3KA 3FOBA 5CXUA 2Z04A 4LXIA 3MCUA 4AJHA 3U7HB 5J63A 5JQWA 3TB6A 1UBTS 4OSEA 3ROKA 1Y1SA 2XGSA 4JLSA 2H1RA 2XXAA 4WAUA 2CDCA 3VO2A 3JWPA 4II3A 4EDHA 4Q15A 1JE1A 3DOIA 4N65A 4E3ZA 2QTFA 3LZ6A 2AKEA 1KYZA 5HF6A 2H18A 4B5KA 1PR3A 3FWZA 1P2FA 4QAQA 4OSPA 5AK6A 4WKGA 2P40A 1V4BA 2H1FA 4MV4A 1ZAYA 4DDKA 4B3FX 1KBOA 2DLDA 2FZWA 3M0EA 5E7IA 1IJEA 1XTPA 3Q1KA 3OZIA 4EA6A 3LX8A 2XQVA 3FYDA 3OCZA 4ME6A 1AQIA 4LNHA 1XT6A 4KFTA 3FUVA 3IR7A 421PA 4K1XA 4JQOA 3Q12A 5DCLA 1VLQA 1WXEA 1NXQA 3C1UA 5GONB 2ORVA 5CLIA 1Y7HA 4KH0A 5FQNA 3WI7A 1Y82A 1MN6A 1UBGA 1ZONA 1BD3A 2OAEA 3OBIA 3W34A 5JXJA 1TQ2A 3KJHA 2J3KA 3U62A 2O5CA 3QPBA 4YECA 5H70A 4N0PA 3MOSA 5D5HA 1W4LA 1O6GA 3TCXB 4HZIA 4EG6A 1BAPA 2BFFA 2ZYGA 2Z3ZA 3D8HA 3KVNA 521PA 4E4YA 4JBHA 3VR0A 4CGZA 3ZDQA 1DBRA 4DSAA 3JATA 5KSOA 2DERA 2VDVE 4YRTA 4LZLA 1TFUA 3SQXA 1X38A 3BE4A 1UEXC 4JQSA 4HGPA 5LB4A 4D81A 4TSFD 5KTNA 1M2OB 4WLNA 2LKDA 1TD9A 2Q2QA 3PWSA 2NTYC 5JWRA 1O6FA 5AKHA 3ZY5A 3GCDA 5DFAA 1JPVA 3D81A 2WOJA 3KK0A 1JEOA 3RTBA 4GOXA 4GYWA 2DPGA 1W4AA 3PGJA 4NAHA 1DMSA 1WU7A 4MW4A 5J5CA 4PGHA 2BFCA 2H57A 4M37A 5GM2A 1NKSA 5E6RB 3UN1A 5CD1A 2DHCA 1EG2A 1RRFA 4MIYA 3I9V1 4MW6A 1Z3IX 1EMDA 4P80A 1BXGB 1DO0A 3TLJA 5AM3A 2HK7A 2I78A 1GCOA 5ALZA 3QFHA 4P5DA 1OIVA 2FPPB 1UPXA 1BCSA 1L7NA 1M75A 1ZOOA 2ZIUB 4AZTA 3UHPA 3B5EA 3MAGA 4J7AA 3NT4A 1PWXA 1PX0A 2G9RA 3OKPA 1DRVA 3FR8A 3ZLUA 1ADYA 1JSCA 4N3BA 1V7ZA 1L5GB 2FN7A 1CQPA 5C53B 4M7OA 2PT5A 1KYXA 2YOFA 5DF1A 2DLNA 4MW1A 2O0KA 3A58B 4UFPA 1UBNA 3WWEA 3I9KA 2O3RA 1VTKA 2R1VB 4PNEA 2WD7A 4MGIR 2IEAA 3A7EA 2JD0A 4PX2A 1CZLA 3TTTA 4IO1A 1U8TA 4XGQA 4O08A 4AMYA 5T6BA 1RBYA 5BN5A 1QOZA 1CUVA 3R7BA 3R8CA 1TO1E 1LDMA 2XTJA 3QH4A 2O7NA 1YQXA 4NNOA 4CV3A 4D1YA 5JAUA 1P4AA 4G81A 2XZDA 3AQIA 1I3LA 1DRJA 3MSCA 4DQ0A 2XGOA 4MW9A 3S7TA 2JC3A 4C76A 3KCQA 4Q34A 2XDWA 1GZSA 4TLAA 1L5HA 1XMOB 4OXYA 2XTNA 3N8GA 1CR0A 1UK8A 3LQ2A 4C0LA 1G7RA 2O06A 3PFWO 4RELA 4V0SA 1VDZA 2N3ZA 4OQPA 3DV0A 1N2BA 2V9CA 1G64A 2XWPA 3HJHA 3PUZA 4YREA 3TQQA 4DRXB 4RV4A 4XPZA 1X1DA 4K40A 3HKBB 5ALPA 5EP2A 2ERXA 3HDVA 2V5VA 4LCJA 3T41A 4JYAB 3KHSA 3BWYA 3OIDA 3ONFA 5G4LA 5J2UB 4CF3A 4OMDA 4ZOLF 1YH3A 2W6JD 3T3OA 2OQ2A 4GPZA 4WESB 1BYUA 3CF4G 4WUTA 2YMMA 4DGQA 1A2OA 3LY5A 5E4JA 4KUHA 1O87A 3AY6A 4HAZA 4D6XA 2ZRAA 4TRMA 1O94C 2IXGA 2BGLA 1IAVA 3VOTA 1JU3A 3F6YA 3EIFA 3WBBA 5HVNA 1G18A 2BDUA 1JJBA 5I51A 4EPXA 2PLWA 3TVYA 1E3IA 4HEHA 4Q7LA 3D7KA 3OVMA 5JNVA 4ZQGA 2J87A 1Y8AA 1BJKA 1ZXBA 4NPAA 2WIDA 4UCFA 4Y67A 5G0UA 2DETA 4MYUA 3VDQA 1QWSA 4UHFA 1W34A 2OCLA 4B5LA 4ZYZA 3VSAA 4F3YA 2P8JA 3SS8A 1XMSA 1Q1AA 3PFGA 4JXJA 4V0RA 4KQXA 3L04A 5FBKA 2QP3A 1MVOA 2RAFA 3FOZA 1QO0D 3IAEA 4E6PA 3H2HA 2IYRA 3QF4B 5HA5A 2CXOA 3KU4A 1USIA 1MC1A 3VPAA 2OV8A 4Q1DA 3W3AH 4DG9A 5BNWA 5B53A 3OX4A 2C7PA 3RRXA 3GRPA 1U1DA 3UICA 1E3DA 2EP7A 1JAHA 3LXUX 4QE3A 4AQ7A 1BNCA 2ZQ5A 2W22A 3RLFA 2PUDA 2RHMA 2FZ5A 1Z45A 3CRMA 4Q7KA 4HQOA 3QELA 1KJIA 2JARA 4FKZA 4PPGA 1EM6A 5D6OA 1RKBA 4D9FA 5EP3A 3BGVA 1GZ5A 1SC6A 1Z36A 3CSDA 4ZO7A 2NM0A 3V8PA 2CNWD 4MINA 3A2LA 1PBTA 1QIFA 4C6RA 3IAAA 3A9VA 5C8DA 4FCWA 1D2CA 3LBHA 5ALLA 2W6OA 1CUSA 4IXDA 4A3SA 3CZ5A 3RGWS 2H9IA 3L77A 3U31A 1M8FA 1V6CA 4KQKA 1KI8A 4CIDA 1KY3A 1LVHA 1VLZA 2CUTA 3K8ZA 1CVIA 5IKMA 2B99A 1OH6A 4BGVA 3TGPA 1NU6A 1JIIA 1UJ6A 1JT2A 1RRMA 1T36A 2CJYA 2QQFA 4ZTBA 2BY4A 1AC5A 1M34E 4HN4B 4R54A 3O8QB 3PV0A 3FCXA 3SXUA 621PA 3C16C 5JJKA 3UGJA 1MXHA 3ZHZA 4HVLA 3L0YA 2E7ZA 3VPHA 3C3MA 3GZJA 4YT2A 1EUCB 4IUDS 1QO0A 3NBKA 4OAQA 4FNAA 1QR2A 1ZLXA 3TW6A 1TYDE 2PKYX 1K7CA 2RB4A 3FE2A 1E6MA 3BSFA 2VJDA 5DBFA 2HBYA 3HNPA 1NBAA 1OA1A 1P4JA 1VGVA 3DCJA 2B7BA 3WL4A 4RORA 1ODFA 4BKOA 2JCSA 2D6FA 1TM4E 4BS9A 1IQRA 3LHDA 1IUOA 1CQIA 3E3AA 2ZIXB 3WGYA 2NLOA 3K4QA 3DL0A 5K99A 1SQ6A 3M70A 4DBZA 1PJQA 2VTKA 4U3JB 2QG4A 1HUQA 4GD3Q 3KQKA 4FQ7A 1SHUX 2X5OA 4H77A 3L4SO 4NY1A 1QK5A 2ET6A 1IHOA 4GGOA 3ZHCA 4ZHQF 1KWKA 1IOVA 2ES4A 2QMHA 4HAIA 1Z17A 4RSGA 5B6PA 1GUAA 2CNWA 1AK1A 3LZCA 4IDAA 4LHVA 1RKXA 1RI2A 3GYGA 4I6JA 3WLMA 4BC0A 5K0JA 2HF7A 4IDDA 4QXRA 4DV0B 4DL9A 5I7WA 2DH6A 1SB8A 3FKSD 2J3HA 4WKCA 1L7PA 4COKA 4QBHA 1Q74A 2IYZA 2XKJE 2XR1A 4JIMA 2GBLC 1KY2A 1PHPA 2A67A 1QAOA 2ICAA 2RK6A 2QI9F 4LYYA 4F9FA 1G6KA 1DEXA 4NOKA 4G2NA 1CRWG 3DD1A 1NF9A 2V8BA 5AVKA 3WKEA 2DPXA 3CX7A 1J90A 4RVDA 1U63A 2H1CA 5GGXA 3OUTA 1DDOA 4RWEA 4CM7A 4L4ZA 2OFFA 1HFWA 3WWYA 5B1DA 1FEZA 1EHCA 3NAGA 4KXYA 5KX5B 3ONDA 2CL6X 1T35A 3IJPA 1SA0B 5ECYA 4G41A 3ROTA 3QJ5A 4F46A 2M98A 5CEEA 1U28C 2PUCA 5GZ6A 2JI6A 3LLSA 4WK0B 4YV1A 2WZDA 4TYNA 1SQSA 2ILVA 2YHIA 3KGDA 1EZ1A 1L4YA 4ETIA 1JV2B 4QJ5A 3LCRA 4UTXA 3C7TA 3HKDB 3GDFA 4XJTA 3PCRB 1P74A 1ECCA 3HG7A 2GVNA 1J9EA 3I01A 5EJEA 4NFSA 5ITZB 3A1UA 2HD4A 3Q0TA 4GXTA 4D4JA 3UJDA 3R8XA 1DADA 1X9GA 5CB4A 2B82A 3AG6A 3GC6A 4DA6A 1O9HA 4Z7QB 5F3WB 1U0TA 2XCQA 1DKPA 1IULA 4ZCQA 1RI1A 3HGMA 2IIPA 3JQGA 3WLFA 4RTLA 1ZIOA 3FKSA 2FW0A 2Z8ZA 3IWBB 3HWRA 1P19A 2ZJ0A 3Q5EA 2YFHA 1WMBA 1BKDR 2LGJA 3AEUB 1PQPA 1PZMA 2E55A 1V95A 1GQYA 2G0TA 4I6EA 5E4YA 4DG8A 3P9KA 3ZLTA 4NVRA 3D5QA 2EGGA 2ID8A 1CK4A 3R0ZA 1WV0A 5DKFA 5ALVA 3RFFA 3RF6A 2I8LA 4RXUA 4PPFA 4PZ9A 3TDMA 3IQIX 4EHJA 1AXGA 1VHJA 4JOQA 3OY7A 4IQGA 3ZNQA 3FDFA 1D03A 4PCVA 1L5NA 4H3KB 3NTRA 2QVCA 3VSBA 4KQIA 2OBFA 1M76A 1N6KA 2WINI 3LF1A 1QPGA 4NESA 4PZZA 4QTZA 4CR7A 4EEXA 4F5EA 5LU8A 4C2UA 4MWDA 3SC6A 2VQDA 2ZUVA 3TINA 2R4QA 4NMHA 3PSAA 1HLDA 2VC2B 3D7RA 1DQYA 1QRAA 3QFSA 4QEDA 1FB5A 5FBQB 4IRMA 3HSKA 1LD3A 1NW9B 2HCBA 3BXEA 3HYRA 2A0WA 4NYJR 3O8LA 3WRYA 3QMWA 2FKNA 4ZICA 3KCNA 1EGAA 1Q14A 1RQRA 2Z8YM 4OXKA 4B71A 1JHVA 5HQTA 1UBCA 1D09A 1EXVA 2NU7A 2B7CA 5KVQA 2P4SA 2DHRA 3I58A 2OB1A 3RRNA 1LS6A 2CZQA 2VWPA 4WOJA 3K53A 4B2PA 4I1SA 3HEAA 1V48A 2VHCA 1P7VA 5KVAA 4D8VA 1ENYA 3GNTA 5LZ4A 4LXUA 5CA0A 2FPMA 3ZW7A 3NVKI 1N36B 2NP6A 4Y9SA 3AVTA 1K97A 3UJHA 3P45A 4U2DA 5FFMA 3LJKA 2I7CA 4RXTA 1G8HA 4FE3A 1M0SA 3LCMA 1Y6JA 3U7QB 1AGNA 2YZMA 4FLFA 4HNHA 4TTVA 1KQNA 6ABPA 2VH2A 3G2PA 4GRAA 4O4JA 5HS6A 5MDHA 3EC1A 3O92A 5TPZA 1OUMA 2GN1A 5JU6A 1YR1A 3GLGA 1XKXA 4GL4A 4J0FA 2YTZA 2V4ZA 3CX3A 1YR3A 4WBNA 1L4LA 2ZLBA 1QE0A 2YJ4A 1HLPA 4IIJB 1CHDA 2HMVA 1ZGGA 2XNCA 2LCFA 2Z3VA 4IVNA 5IKOA 2YV4A 5FWAA 1ZGCA 2PHZA 4YWHA 1X39A 5DEOA 4PYJA 1PR5A 6CHYA 5TT0A 1A4XA 4OQLA 5L40A 4N47A 4DCCA 4UE3S 3QYFA 3FZNA 3NIGB 4OJYA 4YJHB 3GQVA 4HQNA 1X14A 3ZTWA 1DAPA 1AGYA 1Z0AA 2C1EA 3FTCA 4MB0A 1H1TA 2G76A 2WHXA 3EPPA 4ZT5A 3PEVA 2WJIA 2GPNA 1U8UA 3C1AA 2IPMA 2YBDA 4OM8A 2EC5A 4DZZA 4BJ1A 3IQDB 4IYJA 3HLYA 2RDMA 4RPCA 1LTHR 2Q27A 2HEGA 2M1ZA 1EFKA 2W0SA 4EKNB 2PUVA 5JS6A 4RK1A 4KBFA 1LBQA 1URPA 1HE2A 1POWA 4PC7A 4IQ8A 3WGOA 5FD8A 1HEIA 1LDYA 3EEFA 3TOXA 1VZ2A 2XMSA 4JITA 3TMKA 1AK2A 1HDGO 1Y4ZA 4IHKA 2YUTA 5JJIA 2W4MA 4TV8F 4UZFA 1GTJ1 3RBZA 1U2RA 4RF3A 1YL6A 1KQPA 2CF6A 3IKTA 1QR6A 2NZUG 2Z09A 4E5YA 1NXXA 1G0NA 3DE5X 4R16A 1RRPA 2BR3A 4P53A 2RBEA 2VEOA 1NRJB 1TZBA 1DG3A 1E5QA 1GQQA 4FYVA 1BHQ1 1DX9A 4C3VA 5IWAB 3K5PA 5HEKA 1P17A 4FZ5A 4QQNA 4BNXA 1BVRA 1QS0A 2DQKA 3KEFA 4W63A 4BMCA 2E21A 4L50A 1D6SA 5KOJA 1R0CA 3FTFA 2X19A 2H5EA 3T9EA 2FF7A 1K6XA 5H1YA 4TZ0A 3VVCA 3Q72A 1NY5A 4L78A 3SBDA 4RTSA 4GI2A 2QGFA 3WYEA 2H6EA 2RIPA 1ADBA 1DV1A 5CCEA 2O48X 4E03A 1EIWA 3GQBA 1FJ2A 1G8YA 2YXPX 4K26A 3F8TA 3B70A 3KYCB 4BQOA 2EWMA 1C9JA 2VCYA 3ZQKA 3FOCA 3GNQA 1I4OA 4WCFC 2Q0XA 4TKVB 3IDZA 2GWHA 1XNGA 5D5QA 2C96A 4COOA 5F2KA 3S2FA 4MICA 1YRHA 4JB3A 3RR2A 2OORA 1WCWA 4DLYA 2ZGVA 4M9ZA 5FHRA 4EVQA 3QLUC 3STYA 3BHJA 3F67A 4QXMA 3EGDA 5JATA 5IUJC 3OQPA 3L2OB 4QYIA 5DGIA 5TJ9A 2IFTA 2ZI4A 1T1EA 2BOVA 3RSZA 1YSCA 3MCAA 3UK7A 3AKZA 2Q7OE 1SJ9A 1KDZA 1JFSA 4JN6B 3LTEA 1SFRA 3LQYA 1JQKA 4LVCA 3IOBA 3ZKAA 3AW8A 1AT1A 4G01B 1QTRA 3EOBI 3NVAA 5EIBD 2WI8A 2H2WA 2W8BA 3BWDD 3CSUA 1CERA 1XP8A 2O7RA 5L3VA 1JWLA 5IVHA 1DCFA 3A3YA 3PEUA 5CB6A 5KNCH 2I3GA 1RE1A 4KQ6A 1JHDA 2XB9A 2MWMA 5DE3A 1K6JA 1IJKA 1UOEA 2AZ4A 4YO8A 4NJEA 3OE7D 1NJGA 5A3RA 4P0PB 1C7FA 2PM8A 3A31A 4XQEA 4G56A 3S1AB 4AC9A 5FFFA 2IS2A 3GOQA 6NULA 2C20A 1KEZA 3CO0S 4MTLA 2R11A 1GUYA 4YS6A 2O8BA 1ODKA 3EUAA 2OE2A 4TSRA 1OLSA 5EC8A 3ETJA 4PN3A 2BISA 4L0QA 5IX8A 3BXFA 2GHIA 4ZXPA 1TIKA 3UA4A 3BMNA 1VG1A 1OZGA 2A5YB 2PL1A 3TYXA 1PGJA 5KYXB 4Q1EA 4OX9Y 4GWKA 3UVEA 3WJ2A 3S55A 4OMUA 3IP5A 1YI1A 3NIDB 2ASEA 2O4UX 1CUYA 2HA5A 3QTTA 4FSHA 1YS2X 1C0KA 1MLDA 2HMTA 3EQ7A 4BJ6A 2Q5HA 5FO1A 3L7MA 4TXLA 4J03A 1I4WA 2RIRA 3KQWA 2SNIE 2KYRA 4I2NA 4KQEA 4L07A 3OZTA 1L5QA 4Q9HA 3ZDYB 4CTMA 1R8YA 4L4SA 2XQFA 1TRHA 1NVFA 1Y5IA 1FU8A 3SC2B 2QMQA 4WZAE 2AZTA 5CLJA 1KOGA 2ZCJA 4YMSA 3FMPB 2HLNA 1XZLA 3QXCA 4MGEA 4RK0A 5HRCA 3GGOA 3OJ0A 2VO1A 3UT5A 3GFFA 5B36A 3O3OB 1SY7A 3BEDA 3GMIA 4IKEA 3AUUA 1QZTA 4GFDA 2HYIC 4WY5A 1SD2A 4MMZB 5A4KA 3R44A 4LXGA 2OZPA 4ANFA 3HB7A 4EJSC 1RJ9A 4L9WA 2IP4A 5CNMA 5A06A 2FQYA 3GO4A 3WGMA 4KP7A 3W5CA 2NU9B 5AW2A 1QONA 3JAKA 4UEWA 5EJ4A 1IZYA 4XDZA 1ZM2A 4FILA 3UBMA 1QRUA 5WRFA 4N3CA 1X9IA 3T5DA 5TF4A 4AULA 2BMEA 2WNHA 3U37A 4AX4A 4BQFA 1BS9A 1J7KA 1SKBA 2VJOA 4ZP1A 5JDIA 1NJ1A 2C9OA 1QVAA 2TECE 1G1AA 1HETA 3VO1A 3ETGA 2A1UB 2DTEA 5IC5A 5HGJA 3NJ8A 3WO1A 3VR6H 1ZH8A 3W4KA 2C5LA 2AOUA 2O6HA 4ISBA 2QBYB 3A3NA 4WNCA 4UTPA 3GJQA 1ZAKA 4M9SA 4DV4B 2I1QA 1KQFA 1HL7A 3GVXA 2AN1A 1QKIA 2B1JA 3RBXA 1F17A 4MO2A 4EI2A 4V24A 1F8XA 3LHIA 4RTPA 4IP0A 2WIAA 1CVLA 3CZCA 4MV0A 1JG4A 4DLKA 1IOWA 3PF8A 2X9LA 2GBIA 5CT8A 1XTUA 5AIAA 4CTKA 2DZDA 1N4DA 2IGTA 3DDZX 1ZJZA 4X3CA 3VHXA 4UVEA 1R9MA 4P8RA 1NBMD 2A9OA 3CN7A 1EZ4A 2V6MA 3N2LA 1KP3A 2ZXEA 3OZSA 1ND6A 1XD9A 1JEQB 2YJNA 4R1TA 3RIMA 3T5AA 3W9UA 821PA 3DEIA 4E6EA 3FHCB 2FZGA 1U31A 4JOSA 4M55A 3OJFA 2IA5A 3CUWA 1RWNA 5HRAA 2XY4A 5CBPA 5AJWA 1EUDB 1OWMA 1VI6A 2X22A 2X2EA 1XEWX 4UD2A 2HADA 3KZ1E 2FKAA 1I6MA 1MF7A 2FI1A 2WNIA 4LHYA 4CDGA 5HOQA 3AIOA 3CUUA 4PANA 3TNJA 1P1KA 1IH8A 1N0VC 2XUDA 3TLMA 1XZMA 3ZG6A 4B3JA 1B3BA 1H2AS 1RXUA 3BXHA 4Y1EA 1T3SA 1E58A 4XSHA 2PMEA 3G9UA 2P3LA 1AU9A 1IRXA 1GZ3A 3UJCA 1JU9A 4GGPA 1EUYA 2UU9B 4E5VA 1JXQA 1Q21A 4YUYA 3RSHA 4I9HA 2WWIA 1FLDA 3ZVKA 2GD2A 2ZUCA 1UJ2A 3KYJB 3F7TA 4RVNA 5BO5A 2CMFA 3DWFA 4NZYA 3P9XA 2Y0CA 4KV7A 3EIOA 1RQNA 1M54A 2A30A 3BMCA 3OG9A 4C78A 4PYNA 3OLYA 5E2AA 2A5LA 5FBRB 1UEIA 4FYXA 3DOJA 3I6ZA 4NV1A 3N7AA 1HLFA 3FMOB 2YJZA 4Y9TA 4A6XA 2LRHA 1THZA 1GL9B 2VJMB 4W8GA 3NEYA 4WCFB 1QH0A 3GP8A 4I4TA 1NBMA 1VRCA 2LBPA 4IF4A 2XHEA 3G49A 3JQ9C 2PS0A 4FR5A 4PGFA 3ZTTA 4JAVC 4DXDA 4LQLA 9LDTA 4Y98A 1T6NA 5JDCA 5DXAA 4E14A 3G7NA 4B7XA 2C7OA 4UHJA 3E3OA 3AB7A 2XVAA 2GOYA 1Y8CA 2O1XA 2QD1A 2ZZKA 4BNDA 3TTUA 1TAGA 4IFTA 4YJ2A 4CR6A 1M8JA 2DUMA 3C8DA 5CXQA 2XF2A 4HAVA 1JHYA 3DCNA 3G59A 4KIFA 4C0XA 1GKYA 2D8MA 4EVSA 2W2NA 5EJIA 4BBPA 3F3MA 2FEMA 3T5TA 1NQVA 2F43B 4MUFA 3U13A 5GWXA 4YWJA 2Q3CA 3IUSA 4ENVA 2RHWA 2GZRA 5FPYA 3KKNA 2I3BA 1XRPA 4HDRA 2JEYA 3DL2A 2O8FB 5AKLA 2B36A 1IOZA 1N2JA 3PYLA 2BGJA 2V9PA 2Z98A 3KYBA 2WAOA 3E9EA 3QUBA 1NASA 4QELA 5E9WA 4BNLA 5KINB 2D3WA 3W7VA 5EKXA 1HDIA 5ADUS 4TYWA 1YQDA 2XTMA 3QBJA 4REQB 3I30X 1DXYA 1BDHA 1M1UA 3ML1A 2RFLA 3P4YA 5EWJA 4ZCMA 3AM3A 3D3EA 5AW6A 5J4HA 4MIKA 1CZKA 1FYVA 3BD7A 2XI4A 1CDEA 3NPMA 4RF5A 3NQ41 2FWRA 1KEEB 4NECA 3R9IA 3R8FA 5AJXA 3CSSA 4FFOA 5CYFA 2IP2A 3UC9A 3PFHA 2EWWA 1VE3A 2F64A 1MQAA 1DKOA 5AW8A 1WSBA 3OPNA 1EVEA 5I47A 1V5FA 2VF8A 4GBJA 4OKIA 1SOVA 2XNDD 3K15A 3DWGA 4GDMA 4WFJA 3VI4B 1N2CE 2WPDD 2ZVDA 5IDXA 2WYIA 4IIUA 2PD3A 4IWNA 3ZEIA 1EK5A 4BBJA 4OFZA 3M1YA 1CNMA 1N7HA 2GFHA 2OHXA 2NIPA 4A15A 4J91A 3EQ8A 1V5WA 3LYLA 2VF2A 4QRHA 1BQ4A 3K6KA 1Z5NA 1T5OA 1X8XA 2ODTX 4IHQA 1PYGA 3GGSA 1MV5A 2UUPA 4CL0A 4DSTA 4G1FA 1NN5A 5TY0A 4XW2A 4XDGA 5KNBH 1Z5GA 1IG0A 4WFQA 5GZ1A 4MJXA 3F6CA 4E2XA 1IQ0A 2VWHA 3UGKA 2BEJA 4ZFNA 2HK9A 1UJNA 4EJSB 2X40A 4KQCA 2PCLA 1T9GS 4B6EA 4XA8A 2OB2A 1USWA 2Y1KA 1IXZA 1DTEA 1U0LA 3ITKA 4JR1A 4MV7A 4XCQA 4DCTA 1PQWA 2CW5A 1JQJC 2DP4E 4IOKA 1P9RA 1D1QA 1Z2OX 2IHUA 3KJNA 3PHJA 1KZHA 2EOAA 4BATA 3ZLJA 2BHTA 2WK1A 2X6TA 3OHPA 2CFIA 2BSXA 1RQLA 4HGOA 1B8UA 1KI6A 1N2XA 2CB9A 3NASA 5G1OA 5C32A 3OE1A 3WRYC 2J9RA 3DYIA 4G86A 5ERGB 1EK1A 2GNPA 4MKRA 2NSJA 3GFQA 4I2VA 4S1VA 2FPWA 2P5UA 5E1DA 1GXSA 4NTZA 3S28A 3DKPA 4OP2A 2H2GA 4KITB 4RKRA 1JKIA 3A36A 3WXBA 4O0MA 1T6XA 4HB0A 1K27A 4NOMA 5J4YA 4N3NA 5IAAA 3OA0A 1JSXA 1CDDA 3MN1A 3BWXA 3KL4A 2Z1NA 2WPDA 1R4NA 3DD5A 5I48A 3CW8X 2D2FA 1FRQA 1QYDA 2PRJA 1ZU5A 4MI9A 1C2TA 3SJZA 3NP7A 3D7NA 2HXYA 3ZU4A 4GM4A 3TIIA 1M74A 3MT8A 4XAQA 1CUXA 4HZUB 2W6NA 3NIWA 5D1NA 1M73E 4HXFB 3PGMA 4QPPA 4G0WA 3VTZA 2PKXA 4ERXA 1XZDA 1OBHA 1Y1KE 2FZKA 2NPOA 3LUAA 1EM8A 4BMYA 3IDOA 3ZU2A 4Z6KA 2W2QA 3K70D 1XX6A 3AGQA 4N6NA 3L7BA 3WGIA 2ZJ4A 2RKOA 1XKTA 1LV8A 1H0SA 3D4IA 3W05A 2YOHA 2B9VA 1G42A 2DU8A 3HVJA 1YZHA 1H65A 1NE2A 1E0SA 1XU9A 2AFVA 4E5NA 3JYNA 4JP5A 2FMHA 3OPXA 1PS0A 3QPUA 3OC6A 4YVFA 1Z26A 4Y0AA 2XGJA 3H6GA 5KYYB