3PZRA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Inhibitors with Selectivity against Members of a Homologous Enzyme Family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3pzrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pzrA01
4LRSB 2X7HA 1E7WA 4TKLA 5F3RA 2RAFA 2GNAA 4Z9YA 3GPIA 8LDHA 4IS2A 4CUJA 2GZ2A 2GCGA 3FBTA 4MVJF 3ZH2A 4DC0A 2VTDA 2FPIA 1GEGA 3TSCA 4E5KA 1OBFO 4WPGA 3NT4A 3GG9A 5EINA 4G65A 1DFHA 1HYGA 5CDTA 3G17A 4Q3BA 1YQXA 1KBZA 3HZZA 4R16A 3PQEA 4G81A 3GVHA 2OMEA 3CZMA 5BSEA 3PDUA 2YYYA 4JJGA 4LCJA 3VH1A 3IKTA 4J1TA 2JFFA 1HDXA 4NQZA 2EHDA 4FW8A 4YBZA 1QORA 1H9AA 4GX5A 1F14A 5I7EA 4BQRA 1Z6ZA 3PHIA 4CMIA 4D3FA 4HFRA 2QRLA 1C0KA 4CODB 4MVJD 4DLBA 1GY8A 2IXBA 1KEVA 3IL2A 3ROQA 1ID1A 5JBIA 4K6CA 4BNWA 1JA9A 2BFPA 4LK3A 4M54A 3B70A 4ILKA 3QY9A 1ISIA 1M6HA 4YAJA 4PN3A 4QSMA 4R5MA 1SEPA 3OIGA 5I7FA 4TRRA 3CMCO 2QQ5A 5G0TA 4BV8A 3HDHA 4J2HA 3OA0A 4ALJA 2BLLA 3ETEA 1PGQA 3BTOA 1E3JA 3DHYA 5DZSA 1I0ZA 2H5LA 1QMGA 4ALLA 3DMTC 1MP0A 1PWZA 4XRRA 5EIOA 2AEJA 4XB2A 2W2KA 2PLAA 5B4TA 4CV0A 3WGTA 4F6CA 3VAZA 1VPDA 4RL6A 5DP2A 1QV7A 2GN4A 3UN1A 4CLXA 3Q2KA 1NNUA 1IULA 3DL2A 2CF6A 1HSZA 2WE7A 3V1TC 2HKIA 1RKXA 1U4OA 3H9EO 3C1OA 4MIEA 1Y1PA 3DZJA 1JAXA 3OFSA 3I4FA 3JQ6A 3H9UA 5JO0A 4B3IA 2A92A 5ENDA 3PXXA 4JJIA 3CZRA 2EEZA 4GKVA 5ENVA 1E7QA 3A06A 3B20A 1DEHA 5COAA 4CM8A 4XYLA 4N5MA 5FWNA 1LXCA 3CXRA 3P5SA 3LYLA 3E1KA 4PZEA 2VOEA 4RCVA 4S1VA 1B8VA 4LSWA 5JLAA 4P4GA 4WCFC 1U7TA 3FR8A 5GMOA 1F06A 3BMOA 1B2LA 3I4CA 1L1FA 2VYVD 4YRBA 2PH5A 4W9NA 1PTJA 4DGSA 2O3UA 4JIGA 3PYXA 4R1NA 5EPOA 2BH9A 4RPGA 2DT5A 2F00A 3DTYA 1XWFA 2Q22A 4FC6A 2IRWA 2DBZA 3VZRA 3SXPA 4CUZA 1GQQA 1KC1A 4XD2A 4GX0A 4AJKA 4XYBA 2PWZA 2DU8A 2C7GA 4IPTA 4MPDA 3OIFA 5A9SA 3DOJA 1ZK2A 3DOCA 4IDFA 4D0RA 3AI2A 1OAAA 4PCVA 2CY0A 4QUKA 3RROA 1H93A 3VOSA 9LDBA 3SEFA 1LSSA 3WTCA 3JQGB 2XF8A 2NSDA 2Q46A 4J9VA 5BSGA 1R12A 4LMRA 1ZBQA 1DHRA 3F4LA 2C54A 1DAOA 1DBVO 2D3TA 2I65A 1EDZA 3UF0A 3U4DA 1PL7A 1E92A 3UCXA 4YYZA 3PIDA 1O6ZA 2X9VA 2W4QA 3OQBA 1AUPA 2R00A 1P1RA 1QYVA 2GR9A 2WE8A 2B83A 4WECA 1E7YA 1IPFA 4HNHA 2Y0DA 1HETA 1YWGO 3C3XA 4OGWA 3TL3A 4XDZA 3E82A 1XLTA 1ZUD1 3H9QA 1WLYA 2UUOA 1PZEA 3OA2A 2H1SA 1G1AA 1GPDG 2OBNA 1I36A 4GWKA 3WSVA 2P2SA 1BVUA 3WG9A 3JD0A 4B79A 4YRAA 4HADA 1C0LA 4CQMD 1NM5A 3I9OA 4AJ2A 4Q3DA 4BNXA 4JCOA 2GF2A 2G76A 2GN6A 3L4SO 4YQYA 2HO5A 3LSYA 4E5MA 1GUYA 2NQ8A 3CIFA 2BELA 2WD8A 1IL0A 1EDOA 1UXHA 4FCCA 2HAEA 3NGXA 1X7GA 3SC4A 4YT8A 4NFHA 4IS3A 5BNTA 3DHEA 1Q7BA 1DPGA 1WZIA 1Z45A 1YH3A 1VI2A 5DULA 3OECA 3OM9A 1LU9A 4BNYA 3QW2A 4TRNA 3ZU3A 3HN2A 1K6XA 1KEUA 4AJ4A 1E6UA 2OHXA 2C7VA 3ZWYA 1BW9B 3HHPA 3IMFA 4DQXA 3ITDA 2Y1FA 2BI7A 4UAGA 5KWEA 2VNSA 4GMGA 5THKA 5C37A 1DFIA 5T8KA 3WYCA 5IN4A 1Q7GA 5KVVA 4ZU3A 5IZCC 1MB4A 5FYDA 4Z3DA 3KLMX 4AICA 1C3VA 1HDZA 4IXTA 4F3YA 4DLLA 3WB9A 1IYZA 1SC6A 3MWDB 3F4BA 3I6IA 3PQFA 1GYPA 1ULSA 2J8ZA 1C0IA 2ZB8A 4ZICA 3K8ZA 2AXQA 3I9MA 4PGFA 3U49A 4I5DA 4ZRMA 3RJ5A 4MVJG 4R51A 2VRCA 4W99A 3RWBA 2WYWA 5DOVA 3EC7A 3IDSA 2DUUA 1JVSA 1NPYA 2NVUB 2OO5A 3TZQA 3OF2A 4NK5A 2H9IA 4XJSA 5F5LA 1U5CA 3DBLB 2QRJA 1XQ6A 3ITKA 2P5UA 4P4LA 4W6ZA 2CUKA 4E5NA 4D0SA 1IY8A 4L73A 4U5QA 4L76A 1UXJA 1ZSNA 4W7HA 3C7DB 5I9LA 3IP3A 4XJTA 1Q1NA 2X6TA 3UCEA 1Q2XA 4WLVA 2HMVA 1CRWG 2DLDA 1T4BA 2GZ1A 1V8BA 2NTVA 2PV7A 3RUIA 5HRUA 5CDUA 1U9JA 4GSLA 5F5NA 1EK6A 1T25A 3JQFA 1W0CA 3HB4X 2IYPA 2HCTA 5TT0A 2YV2A 1NR7A 3IP1A 3V8BA 1U3TA 4JP2A 1E7RA 3VPSA 3ON5A 2PZLA 5T5QA 4EBFA 4YPOA 1N8KA 3GLQA 3MJTA 3M1AA 3NX4A 2E6UX 5TF4A 2PGDA 1E3LA 4P22A 4NJMA 4MJLA 2TMGA 2V7PA 4WNCA 1TT5A 4WCFA 5AXBA 3RI3A 3MOGA 2Q4BA 4BKQA 4IMRA 5H81A 3S2EA 4J7XA 5COBA 4RF4A 1IOLA 4XIJA 4D45A 1HYHA 3JD4A 5DBIA 2E37A 1FF9A 1EE9A 1GADO 1V3UA 4UEJA 1A27A 1B14A 1BWSA 2VHYA 3H5AA 3Q9UA 3HN7A 3KYCA 1ONNA 4XQGA 1HYEA 3PVZA 2B4TO 5JCJA 1U28A 1P9LA 1PS9A 5A02A 4LN1A 1GL3A 3OMLA 4FS3A 4PG7A 2BGMA 2ZIZA 4WLEA 4IBOA 3QWFA 4UUOA 3JQ9A 5G4KB 1IE3A 2O7SA 1UXKA 1N1EA 4RDHA 5A3VA 3RD5A 5BQFA 1I24A 2CDAA 3H3JA 4BQPA 1E3SA 1PGJA 4N7RA 2NADA 1M75A 4GSKA 4IM7A 2NU9A 1SAYA 3HUDA 1YGYA 2VZ8A 3VHRA 5G2OA 2Q2WA 3FTPA 3ZWBA 1UXIA 1NHWA 4YJHA 1B3RA 1Y9EA 2DVMA 1KVRA 1H94A 1Y8RA 2HRZA 3NDJA 4R9RA 2E82A 3DZKA 3W6UA 1CERA 1EQUA 2O2SA 2X0JA 4E12A 1RYDA 4PG8A 3E5MA 1SMKA 4O63O 4DYDA 3FCOA 2WYVA 2Y1GA 4IDGA 4IJKA 4DUPA 3DZHA 4OM8A 2GERA 2X0IA 2HJRA 3DBRB 3LC7O 3KYBA 3ZWOA 5K6AA 3ONFA 5K0ZA 4XR9A 1OI7A 3EZYA 3H7AA 2Q1SA 3WQSB 2NU6A 2Z1NA 3OJOA 4GGPA 3H8VA 3N58A 3EVNA 3WQQA 4PVDA 3Q2IA 4FJ1A 3ZCXA 2VZ9A 3V1YA 4OOEA 3ZWVA 1CDOA 3QWAA 4M86A 1R0SA 5ER9A 2DAPA 3JQGA 3S2FA 2PFGA 5A05A 2ZK7A 4MINA 2HK9A 4LW8A 2DQ4A 3H5RA 3LLVA 4NJOA 2UDPA 4DIFA 1QKIA 3JQDA 2JHGA 1EVIA 3LQFA 4FDAA 4DIBA 4FFRA 2JD2A 2VHXA 4WE3A 4XKJA 3MWEB 5B12A 4O6VA 1UDCA 2WD7A 5CPBA 3NTRA 2B69A 3NUGA 3WLEA 5BSHA 2YHIA 3UVEA 3ZWXA 2R00C 2OBYA 2NU7A 5KVCA 4P4NA 4PLTA 2TMDA 2OGUA 3MEQA 2Y0EA 5DN9A 5EQFA 1MXHA 3JQ9C 3G49A 3U5TA 4RVUA 3HDYA 3OICA 4WKGA 4FB5A 4OJNA 5AQ1A 1QLHA 5GZ1A 5L7TA 3EUWA 4CPDA 5JW6A 5G0VA 4AJNA 1I3KA 4CM1A 2EKLA 3UICA 5DT9A 2XAAA 2DFDA 1XSEA 2ZQYA 3AU8A 2XXBA 4E33A 4TVOA 3QLJA 2BD0A 2PKRA 1P45A 1KVSA 5A5FA 3PJDA 3TZHA 3ZWNA 3AM3A 4CM8B 3UHAA 4KMSA 2X22A 1EE2A 1GZ3A 1MC4A 1NR1A 4XEHA 3GG2A 1CYDA 4HNGA 3SJUA 4NBWA 1E0DA 1TLTA 3EZLA 3CPSA 1A7AA 4R3WA 1VC2A 4KDEA 1LEHA 2B35A 4IQ8A 4CQLB 5JCJD 5GZ3A 2ZJ1A 1W4ZA 4ONEA 4Q3CA 4U0KA 4CJXA 3HJAA 2RHCA 1PJQA 4BO8A 1DC3A 4JQCA 3IKVA 1JDJA 2EGGA 4HFMA 4BNHA 1NFFA 4L74A 5I7VA 3WR5A 3ANLA 5KTKA 1UDBA 2HMUA 4J4TA 4PLYA 3WYBA 1Y7TA 2JAHA 3GK3A 4AVYA 3GNQA 3BTVA 3PWKA 2O3JA 3I52A 1EQ2A 1T24A 2BRUA 3KB6A 5I8WA 3D3EA 1WPQA 2JCVA 3HADA 3MTJA 2PY6A 3HWRA 4YACA 3E6AA 1SNYA 4DVJA 1DSSG 1JTVA 1T2AA 1QYCA 1YO6A 4KUGA 3ETDA 3W4KA 2DPGA 3U4IA 4BVAA 1M6WA 1XCBA 2ZCUA 2P9EA 3OQ1A 2CZCA 2YV3A 1JLLA 4RF5A 5TSDA 4TROA 5A9TA 3AW9A 3LC1O 2RBEA 5C5IA 1H5QA 4GAEA 2EWMA 1EMDA 3TRIA 3WIDA 4OIMA 4CV2A 3L9XA 2GPTA 1P44A 4XQ9A 2F1KA 3U62A 3MOIA 1HLPA 5L3ZA 3DMTA 5TRTA 3HDJA 3ZNQA 1UUFA 1JKJA 1NXQA 4ZQEA 2Y66A 3PYMA 4I08A 4FJ2A 4L4RA 5H83A 5ICSA 3TDKA 4CV1A 4YRDA 3ONDA 4JN6B 4A03A 1BDBA 4QO8A 1V6AA 1C14A 5AXCA 3M2TA 3CUKA 1NX6A 4GI2A 4BNKA 4Z0HO 4ZQFA 3L07A 4UREA 3GZNB 3SX2A 3TWOA 4XGIA 1DRVA 3NAQA 5CDYA 3DTTA 4G2NA 1YL6A 4Z3KA 3NV9A 4BO2A 4BNFA 1HZJA 4K6FA 3ZU5A 3A1NA 3K5PA 2QIOA 4J3FA 4XGNA 3GDFA 2B4QA 3JYNA 4CLOA 1U4SA 4URFA 2LDBA 3FBGA 4KUEA 4NBTA 4JX8A 4WLOA 1IUKA 3C85A 2EW8A 3H3FA 2FSSA 3ZWWA 1HDOA 1UZNA 5FEUA 1YBMA 3DBLA 2PNFA 1W6UA 1I3MA 4J1NA 1U3UA 2FZWA 1X15A 3BHMA 1G6KA 1ZO8A 4XB1A 3OP4A 4IGEA 4WOJA 3ZV3A 3GGPA 3DBHA 3RU7A 1O5IA 1ZW1A 3IUPA 1PL6A 4CMIB 2X0RA 2D8AA 3GF4A 3LZ6A 3RKUA 2BMAA 3DAPA 4E2ZA 5JFOA 4ND2A 3GDOA 4RLHA 1A9YA 3S8MA 2G0TA 4CQMA 2X5OA 4K28A 4TRJA 4XYMA 1A4UA 1GQYA 4CMEA 2O2YA 4U7WA 1RYEA 2D59A 2V6FA 3GHHA 4OH1A 3UH1A 1BXKA 1GTMA 2YV1A 2C20A 2FOIA 1V3TA 1R0KA 3ASUA 4X54A 1BRMA 1DB3A 1A9ZA 2W90A 2OZPA 1T4DA 4KUHA 3D4OA 4OHUA 1Z82A 4BNTA 3CMMA 1H6CA 2JD0A 1MXFA 1YS4A 1U3VA 2IODA 1ZIDA 2ZTUA 1PJ2A 4DRYA 3LT1A 2VT3A 1GZ6A 3RIHA 1T2DA 1BG6A 3N7UA 3IQDB 4M49A 2YFQA 1HL3A 4DMLA 5JDIC 4IZHA 3WBFA 4EEXA 2R2GA 3GPDG 4B3JA 2RHRA 5IZ4A 2VHWA 3GGGA 1M2WA 3GNSA 3F6YA 3RC1A 4IIUA 4CQMB 2QW8A 4PLFA 1GR0A 4LSMA 1R37A 1TT7A 3TF5A 3DXFA 1D8AA 1MGOA 1XHLA 4CM4B 3Q11A 4J6FA 3QVXA 3ZI0A 3H2SA 2GYYA 2VUSA 1PQWA 4ESOA 4NG5A 2PD3A 2CVOA 3KO8A 3STHA 4CLRB 2JD1A 1PS0A 4RQTA 2ZATA 1B16A 3WWYA 2W2LD 4J4BA 2ZYGA 3TL2A 4BMNA 2EG9A 2X1HA 3WNVA 1LDEA 1NHGA 1E1LA 1ZFNA 3WFIA 1DJNA 4CMBA 4UUPA 3ZWMA 4ZJUA 4EZBA 1IHXA 1E5QA 4EJ6A 1P3DA 3GVXA 2G17A 3BYZA 3E48A 4KTVE 4CMAA 3I9NA 3DZFA 1EFLA 3FD8A 5TGDA 4DMMA 1RPNA 3GMSA 3E18A 2NTJA 1QG6A 2C82A 2WD7B 2BFOA 1PR3A 4IDDA 4R54A 4PIVA 3GFBA 4UVEA 5DCWA 5F21A 3D3WB 2GASA 1S6YA 2W2LA 4J43A 1X13A 4WNIA 4RVDA 1J49A 1O8CA 4IJWA 1E6WA 1ZK1A 4B4VA 3R0IA 4KZPA 3TOXA 4RF2A 3O26A 2E48A 1E3IA 4OYRA 3A14A 4W4TA 1GPJA 4W9NC 1GUZA 1XIVA 1YJ8A 3KOUA 3PIIA 2VUTA 3WGGA 4D79A 3RBZA 1C1DB 4HY3A 3F1LA 5JDCA 3PRJA 4EUFA 2RH8A 3LT0A 1DRWA 5KJ1A 1DIBA 1ISMA 3AUUA 2YFHA 4AJ1A 1LDYA 3FI9A 4AJJA 3KBOA 2E4AA 1WMBA 4IZIA 2O7QA 4NIMA 5HBRA 3V2HA 3ZNOA 4DWVA 3O8QB 5KOIA 1GEEA 1ADBA 2XOXA 3L4BA 3B1KA 3PZRA 3BMNB 1GU7A 4NPCA 3BMOB 2PH3A 4D3DA 2EIHA 4RPHA 3BIOA 3UOGA 2HK8A 5TNXA 2IEBA 1HE4A 1KVTA 2J3HA 3EY4A 4D41A 1MFPA 3GN2A 1WDMA 3OJFA 2HLPA 3QP9A 4ZQBA 4QQRA 4NR0A 2FPGA 3RUDA 4WUVA 3RCBA 1GDHA 1LTHR 3X2FA 4QT0A 4IGFA 5DBGA 3TZKA 4BB5A 1EFKA 5FFFA 4YT2A 1GQ2A 2WSBA 3K6JA 3QWBA 3JQ7B 3KSZO 1B3BA 4A10A 3JQAD 1BSVA 3NEPX 3A4VA 3C1AA 3ST7A 4F45A 4E30A 4GLOA 2YHIB 3KTDA 3PHLA 3TOZA 5COQA 5JDCC 4CM9A 1J6UA 5TJHA 1DLIA 1EVYA 4CL3A 3SJ7A 1P1JA 3K30A 4B8WA 5CAEA 1O0SA 4BMSA 3PWZA 2AEFA 2DTEA 5KJEA 5MDHA 1EBUA 1WNTA 4E0BA 3O38A 3COSA 4YB8A 2GUGA 4CLEA 3ROPA 3LDHA 1FDWA 5C7IO 4DYVA 3QQPA 1RJWA 1XDWA 2V65A 1DOHA 3ORFA 4MP6A 3PHHA 1K6JA 4NFSA 5JYEA 1DO8A 3ZHXA 1ZH8A 2LDXA 2W2KB 4C7JA 4PG4A 1UP6A 3KV3O 4IINA 1DIGA 4JGBA 1BTOA 3OH8A 3WGHA 1LI4A 4GX2A 1N1GA 2EJWA 2FPPA 1EBFA 4HX5A 4MVJA 1ZK3A 4JBGA 2UYYA 1BXGA 1DXYA 5I9NA 3A28A 2GN8A 1HDGO 4M8SA 5HTOA 1BXZA 5TJ9A 4PLZA 2CVZA 2VOJA 3MJVA 1NQTA 1SB8A 1FMCA 1E7SA 1MC5A 2HK7A 2OUIA 3OHSX 3E5RA 3JQBC 3PTZA 1KIFA 1HSOA 1Z75A 1I2BA 5EMHA 2NQTA 2VN8A 5G0SA 4BO0A 5KNLA 1E6EA 1P77A 2IZ0A 1YB5A 1RWBA 4O0LA 3RAJA 2EERA 4BNZA 4J91A 1NASA 1ZJZA 1ADGA 1J0XO 1WZEA 2EP5A 3HB5X 4A0SA 4BGUA 1GFSA 2W8ZA 4HUJA 4PLPA 4OO3A 1XG5A 1PS8A 4GBJA 1PJTA 5EL0A 5JC8A 3BMCB 4CM5A 5JDIA 2WJPA 1PQUA 4UVDA 4N5LA 3X2EA 3DFZA 1EUDA 2RCYA 4FOSA 3JQEA 4E6PA 4CLOB 4E13A 4HFNA 4Z0PA 4GVLA 2VZ0A 3GAFA 4KOAA 3H5NA 3QA9A 2FR0A 5IF3A 4MVJE 3K96A 3D7LA 5L4SA 5KVSA 2X9GA 1R0LA 1JN0A 4NBRA 3T4XA 5I7SA 2GD1O 2AG5A 4B7XA 4AJIA 2C29D 2ZB4A 3V5NA 5B1YA 2CSUA 1S7CA 7ADHA 2DBVO 3BMCA 3KRTA 3EK2A 1JWAB 3GOHA 5EN4A 3L4BC 1Y5MA 4Y6PA 4CMEC 1OOEA 1PJ4A 2H63A 4II3A 3OEWA 2G5CA 1GYRA 1PL8A 2VHVA 4XZ3A 5A9RA 2V6BA 4J90A 1U2DA 1VKOA 3SC6A 3AY7A 1ZMOA 1V9LA 4KDFA 4GL4A 4QX6A 5F1KA 3S2IA 2O3SA 4L4XA 4Z9XA 1ZNQO 2D2IA 3AM4A 5DCUA 2NUAA 5ITVA 1WXDA 2GO1A 5CEFA 1LUAA 2Y1CA 4CM3A 2ZYAA 3R3JA 4MO2A 2VCYA 2ZQZA 3QHAA 4ND1A 3MJSA 4EUHA 3WGIA 4OXKA 1LBEA 3D3WA 4AJEA 1TB4A 6LDHA 4RLSA 4YDRA 1ZSVA 1AXGA 1ADCA 4RPJA 2D4AA 2ILTA 4J9UE 4YEDA 3P2YA 3ULKA 1X7DA 4Y8VA 3K2BA 4WASA 1K89A 1WWKA 2IXAA 4HWKA 5IDQA 2JL1A 4XQCA 4MOWA 4UUNA 3VH4A 2NTNA 3OJLA 2ET6A 4QECA 3RKRA 4BL5A 3OEYA 4DQVA 3GA0A 1HZZA 3GH3A 1R4MA 3RBVA 3KEQA 1CETA 5CP8A 3VH2A 1Y81A 1M76A 4NBUA 5DCYA 3PHGA 5IFLA 4HBGA 1OC4A 2FRDA 4Y98A 4EEZA 4JNKA 4IQ0A 4UVGA 3GUCA 3WJAA 2G1UA 3HFSA 3HFGA 3U4CA 4BNJA 3NJ4A 1P1IA 1ZSYA 3HG7A 5T64A 3D4PA 1DIRA 5HA5A 3CINA 2FY8A 2VNAA 4PFJA 5IN5A 4H7PA 4BKOA 4BUCA 3BHJA 1I30A 1BGVA 1BDMA 3VKVA 4Q9NA 3G1TA 5DP1A 4BNGA 2GGSA 3F3SA 2X23A 1NYTA 3DBVO 1DC4A 2JJYA 3ADOA 2O4UX 1H6BA 3T7CA 3ZU4A 3QWIA 1HDYA 1NQ5A 1X0VA 5JY1A 1GV1A 2AG8A 1PWXA 3AFNA 3JV7A 4QO7A 2PR2A 4HV4A 2OFPA 4A27A 4O59O 4I5EA 2UV8A 3E03A 1DIHA 3DBRA 3WLFA 4F46A 1D1SA 3O4RA 4I8XA 1LA2A 3NT5A 3KYDA 2X9NA 5KJCA 5G4KA 4CMGA 1PJCA 1OMOA 2VRBA 1CEQA 4RZHA 1PU2A 1E5LA 4RGBA 3T7EA 5LCXA 3V2UA 1OC2A 1HKUA 4J49A 3RUAA 3WWZA 3RUCA 1B8PA 1GYQA 1SEVA 5M6DA 3BXXA 3TZ6A 1ONOA 3ZWPA 1D3AA 2VYNA 2IEDA 1V3VA 3WBBA 1C1DA 1ZK0A 4ZRNA 2WWRA 3JD2A 3RUFA 2EJVA 3DONA 1XEAA 1V0JA 4RORA 4CR7A 3A9WA 3S2GA 5CHEA 4UVIA 3DAFA 3DMYA 4CLDA 3G1UA 1HE5A 5JNLA 1NPDA 2PZKA 3C1TA 2Y0CA 2C5EA 5T6BA 2B5VA 4O5OA 1ENPA 4C7KA 3I3OA 3ZWCA 1R6DA 1Z74A 1TI7A 5JC1A 3FNEA 1T2FA 2BI8A 4I9UA 4LVCA 1RM3A 2Y99A 3ZU2A 2HUNA 5A4DA 1LLQA 2D0IA 2C07A 3UKOA 4NHEA 1Q0LA 4R3NA 3U3XA 2BF7A 1F8GA 3OJEA 3ZN2A 1C0PA 3WFJA 2OXIA 5H82A 1Y5RA 3GQVA 4PLWA 4GLLA 3KM0A 3GFGA 5A1TA 2X58A 2SCUA 3WGYA 1KC3A 4UUMA 1T2CA 4ZD6A 3TNLA 4AG3A 4ZQHA 3MZ0A 5ER6A 3W1VA 3PZBA 3ZGYA 3ZV6A 2I76A 2PD6A 3GVCA 1X0XA 4RO0A 3LU1A 1EK5A 4FPXA 1AGNA 1EUZA 4AFNA 4DIOA 1JKFA 5T67A 2FSVA 3PEFA 1LRKA 3GMDA 5AXAA 1HRDA 4JLWA 1B8UA 4E32A 3E9NA 1N7GA 2Y67A 3QV1A 4IXWA 2G82A 5IG2A 3ENKA 5BT9A 1CQIA 4EYEA 3GRKA 4AJHA 4RJTA 1VL0A 1XU7A 2IE0A 4J0FA 3VPGA 4IDCA 1NBOA 4DC1A 4DPMA 1KEPA 3P2OA 4AJOA 3AK4A 3H65A 2IZZA 1OZAA 1P1KA 5JY6A 1YB1A 3R3SA 4Y67A 5L9AA 1AHHA 5JO9A 1FDSA 2OOSA 1L7DA 2VWHA 4WLUA 4E2XA 3GT0A 5BNIA 4A5OA 1UDAA 3AOEC 3JTMA 4EUEA 4R01A 3TQHA 4XX0A 3FWZA 2VWQA 4IY1A 1PZFA 3I83A 1XKQA 1DJQA 1ZZEA 2P5YA 3KLPX 3JQ8A 4Y9DA 2AQKA 4D3SA 5JS6A 5K6AC 1EUCA 3ASVA 4YJFA 4BNVA 4JBHA 1VJ0A 4FFPA 1I32A 4MVJH 1Y6JA 4A2CA 4BS9A 5AXDA 1HT0A 2E49A 3OIDA 1Q0QA 1NTOA 4IDBA 1HEUA 4ALMA 3VZQA 2PGJA 3DB2A 1L7EA 3D4NA 2JFHA 4NJMB 1W8DA 4XGKA 1LDMA 1FDVA 1NP3A 3BMNA 3D5QA 1PR9A 1KY4A 3PHJA 2WMDA 3UGKA 1LDNA 5CPFA 2EW2A 4Q3NA 1TEHA 1PZGA 4DL9A 4CUKA 1GCUA 2QX7A 2HRBA 3DQPA 1CQJA 1X1TA 4EW6A 1D7OA 3PP8A 2HMTA 4UVHA 1YQGA 3WTBA 3CE6A 1DLJA 1VL6A 5FI3A 3M2PA 3Q6IA 1B15A 1ISFA 5JAMA 1VSVA 3BA1A 3L6OO 1YL7A 4C4OA 3VDRA 1YKFA 4ZHSA 3H9JA 7MDHA 4XYEA 3IJRA 4L75A 5BSFA 1NAIA 1T1RA 1I3LA 1MUUA 2RIRA 3U0BA 4FBGA 2D1YA 3B1FA 5AVOA 3U09A 3HSKA 1TXGA 5C3MA 3K2EA 1H6AA 1ADFA 2FR1A 4U0JA 4TQGA 2R6JA 1XELA 4FFNA 1XR3A 1E3WA 3QRWA 3FSRA 4J1SA 4N5NA 3VH3A 1UXGA 5TT1A 1Z7EA 4HFJA 3RJ9A 3W4JA 1DC5A 5JMWA 3FPCA 5I9MA 4CLHA 2O50A 4OKIA 2V6GA 4D7AA 4J2OA 2QRKA 2J5QA 2QYTA 2YQ5A 4W7IA 1AN9A 1Y9AA 2O3QA 4PG5A 2CMDA 1QRRA 2PZMA 5CG1A 4ALIA 4RV9A 4BNMA 3H4VA 1ZMTA 4N18A 2VYVA 3SLGA 4CV3A 1R66A 4BO9A 1VL8A 4PVCA 1HF3A 4IJUA 1XQ1A 2NACA 1YJQA 1B26A 3FHLA 1EEHA 4DA9A 3IAHA 1LNQA 1P1FA 2UUPA 1Y8QB 4BOYA 3JYQA 4WEOA 4H15A 3JYOA 1FK8A 3OSUA 3WGZA 5EERA 1LQTA 3PDJA 5CDGA 1VJ1A 5A03A 3NJ8A 4BNIA 1A5ZA 2J3KA 4DTIA 4P8RA 2NV6A 1AE1A 2QYSA 3E8XA 4FGWA 2J5RA 3PQDA 3ABIA 3WDSA 4CMJA 2PKQP 1LDGA 2EF1A 1W73A 1A4IA 3HE3A 3IC5A 2FHSA 4B3HA 2HSDA 1WAMA 4XYGA 3R6DA 1VKNA 3L77A 4OXNA 1E7MA 1R4MB 1AHIA 1ZJYA 3B6ZA 4K26A 4RDIA 3VZSA 4BGEA 3JQ7A 3D5TA 3EYWA 1PGPA 3GHYA 2X0NA 4LVUA 4S3MA 4E21A 4YAEA 3WOHA 2WEKA 1K6IA 1I2CA 4E31A 1V35A 2VUUA 2FZEA 1ZK4A 2WYUA 1ZXBA 5CEEA 2DC1A 5JYDA 2VHZA 1QYXA 3UFXA 4NH4A 1DIAA 1I10A 1Q0HA 2DTXA 2FR8A 3L6EA 4QFDA 1T26A 4CQLA 1YQDA 1IZ0A 3EDMA 4DBVO 4XWYA 2NWQA 5JAIA 3KEOA 3L9WA 2O3TA 3DAGA 3R1IA 1PSDA 2J3JA 2Q45A 4M87A 5EJ2A 2JFGA 3RU9A 1NQAO 2YDYA 1X7HA 3FN4A 3O8QA 4U6QA 3PLRA 1VE9A 1UP4A 1U2GA 1A72A 1H6DA 4DBZA 4DXHA 2OL4A 4GPD1 5DNAA 3W8DA 1DC6A 4FOOA 5TC4A 1JU9A 5B4VA 3PGJA 4E5YA 3KZVA 1LSJA 2AQHA 1UH5A 3AI3A 5LDGA 5KKCA 1TA4A 2Y1EA 2V6MA 4BO4A 4J0EA 4WGGA 3UCFA 1KEWA 4P38A 4DREA 5KJFA 5GZ6A 1P33A 4MVJM 3H2ZA 1YE3A 1O95A 2I66A 4LCEA 1QXSA 1KY5A 5ES3A 3ANNA 5J9GA 5DF1A 5BR7A 1ZCJA 3I9KA 2DBRA 4CMHA 3Q9NA 4CM6A 1DDOA 3F5QA 2FN7A 1UP7A 2BFAA 1NVTA 3LF2A 4RPLA 1E1NA 3VDQA 2O4CA 1ENOA 3FR7A 4ZA2A 4R1TA 2JCXA 4PLHA 1LLCA 4CMCA 4R1SA 4BNNA 5L40A 3WGQA 2CF5A 3I23A 1KOLA 1BHSA 5JPIA 4LGVA 3DEYX 2NNLD 4RVFA 2Z95A 3IS3A 3DZBA 4GGOA 1ZVMA 5A3JA 1NQOA 2DUWA 3TFQA 2Y68A 1YONA 1RM0A 1N7HA 1I3NA 1U3WA 3CKYA 3AOGA 3CTMA 3JQCA 4OKNA 4RPKA 2P9GA 3H6KA 4CLRA 5JXWA 1GD1O 4WCFB 4BHTA 4YJGA 4NNJA 3AUAA 4MIYA 2AHRA 4BO5A 4R5HA 2Q4EA 2Q2QA 4ZVVA 4YJFB 2PKQO 2P4QA 5ADHA 3ZHBA 1LDBA 3Q1LA 1UR5A 5J23A 2O23A 1N2SA 2AA3A 2Q99A 4NDNE 4ZGWA 4B4WA 1QV6A 1FXSA 3QJ5A 2BGLA 1DFGA 1NPTO 1JKIA 5A04A 1D4FA 1HWYA 1KYQA 2FWMX 3GVIA 2HDHA 4M89A 3WIEA 4YXFA 3DDNA 1MG0A 2ZTVA 1X1EA 3GZ4A 4BO6A 4QTZA 2GZ3A 3OETA 3BAZA 5IJZA 5L7WA 3AU9A 3PGXA 3RBXA 1JAYA 3F5SA 1EVJA 1PIWA 3GNTA 5I8ZA 4BIIA 1UZMA 5HM8A 1VM6A 2B37A 4M1QA 1UZLA 1LRJA 4B8ZA 3NDRA 2CDCA 1JW9B 4YJHB 1AXEA 1KETA 1HDRA 1MA0A 2ZCVA 4R68A 2PGLA 2Q1UA 1HTBA 1M66A 1G0OA 2DPHA 1T1SA 9LDTA 4MDHA 2Q2VA 3WMXA 5DBFA 4Y6RA 3RQSA 1LLUA 4F6LA 4EDFA 3VKUA 3KSUA 4RZIA 3UW3A 5U9CA 3JQAA 1NVGA 3W8FA 3NT2A 4AL4A 2FMUA 5AYVA 4FC7A 1F12A 3LVFO 4XR4A 4IMPA 4R69A 1U5AA 1JWBB 2ZTMA 1XA0A 1YBAA 2Z5LA 5B37A 4R4JA 3KYCB 3I9JA 2Y1DA 1E77A 4NU5A 2EV9A 5IDYA 4TRMA 1DAPA 4NZ9A 4CM7A 4YAIA 4LRTB 5HWSA 3VTFA 2OORA 5KCZA 5L4NA 3S55A 5KKAA 3FNGA 2QZ9A 3OBBA 2AQ8A 1LC3A 4ALKA 2PK3A 3GUYA 4XA8A 2FP4A 2J6IA 2Z1MA 3TFOA 3INRA 3INGA 2C59A 3WYEA 4MVJI 5ICMA 2BGKA 3ZV4A 1M67A 5K9ZA 4YJGB 3VPHA 1B0AA 1BVRA 3NRCA 4JROA 2H6EA 3RSHA 3KXDA 4OOFA 1IHYA 5GY7A 2P68A 1SB9A 3RFTA 1VJTA 2QG4A 2NU8A 1J4AA 1LJ8A 1HE3A 2JHFA 4EITA 3ZHYA 3ENNA 4WEQA 1Y8RB 2ZKLA 2GDZA 1G0NA 3AY3A 5JCXA 4CL8A 3ZNPA 1QP8A 3GEMA 3V2GA 4BGVA 3FNFA 3C7AA 3QWHA 4TWRA 3KVOA 4XRGA 1J5PA 1F8FA 5LDHA 3ZDFA 4JBIA 2P4HX 4BO3A 5A9SB 3G79A 4N54A 3L0DA 1GUFA 3DC2A 3DZGA 4BKPA 1NWCA 2I5PO 1DHTA 2NM0A 4ALNA 1HE2A 2I67A 3VPFA 3EHEA 2HQ1A 4IDEA 5F1OA 1WDKA 3IJPA 3Q0EA 1WW8A 5B4UA 2OP0A 3T4EA 1JVBA 1NVMB 4R41A 3I5MA 2AMFA 4JK3A 3GR6A 1YOVB 1F0YA 2EGHA 4BKUA 3CSDA 3RUEA 1XU9A 1LQUA 1EVZA 4XIYA 2AE1A 4JXKA 2NLOA 4MIOA 2YW9A 4I5GA 1PJSA 2QHXA 4Q3AA 2ZYDA 1VRWA 1Y8QA 5L4LA 5EESA 3JQBA 1WP4A 3FPLA 2O48X 4KTTE 4FR5A 5G0UA 4TZTA 1ORRA 3LC2O 1YB4A 3IIEA 3MJ4A 4NBVA 4NI5A 4TZKA 4WCDA 3WX0A 4RVSA 4FN4A 3G0OA 2GN9A 1SPXA 2AE2A 3JQFC 3JQAB 1FDTA 3DWFA 4ZN6A 1IB6A 3AUTA 1SOVA 1X14A 4IQGA 4YAKA 3GY0A 4TMFA 3C8MA 1K5HA 4PRKA 1U1IA 4PLVA 1GV0A 1I8TA 3RC7A 3HQ4O 2PTGA 3LF1A 4D43A 1LSUA 1LLDA 4MKXA 2YQ4A 1QYDA 5L45A 3MJEA 4XQEA 4YVFA 3WICA 3QVSA 3BMQA 4AJPA 3NKLA 4D44A 5JYAA 1P0CA 1BW9A 1YDWA 5LC1A 3I9LA 4PLGA 3Q3CA 3RC2A 2X4GA 1WDLA 1LC0A 1ENZA 4CR6A 3E9MA 4BO1A 2VWGA 3QVOA 3DR3A 4Q39A 2B36A 1R4NA 3UAGA 4J16A 2C2YA 2Q1WA 3L6DA 1BMDA 3FF4A 5C7LO 3B1JA 1P0FA 1IPEA 1ISHA 1PJBA 5JMPA 3ETGA 4Z9FA 3RUHA 1KS9A 4MP8A 5KIAA 3PFFA 2ZB3A 1PGNA 1ZKMA 3CEAA 2PD4A 2EXXA 4IJVA 4YQZA 4Z0TA 4YWJA 1H9BA 3UXYA 3D0OA 3IUSA 3WMWA 4D42A 5TLSA 4FQ8A 4HKTA 1WVGA 2X5JO 4TKMA 4D46A 1KVUA 2EKQA 1E1MA 3RC9A 2WDZA 2VT2A 3EVTA 3INTA 1Z73A 3ZHZA 3AM5A 3DBHB 1RM4A 1TT5B 1D1TA 2DTDA 4YA6A 4R1UA 4BGIA 3WQRA 3C7CB 3GEDA 3DOOA 4YJDA 4OXYA 5TS3A 4FGSA 2I99A 4O1MA 4QXMA 1R4NB 4RVGA 3LLSA 3LT2A 4BB6A 5A5EA 5HS6A 2J5KA 2ZJ0A 1I2ZA 4ROSA 5CEJA 1XYGA 3DFUA 5IXSA 3TN7A 4W82A 2NVWA 3F9IA 3FTNA 3RASA 1GAEO 2HMWA 1R16A 1HLDA 1K0UA 4J1QA 3D64A 5L7YA 3VC7A 5BNFA 4IUYA 3SVTA 1ZXLA 2O3RA 4UEKA 1MX3A 3DO5A 3ICCA 3LK7A 2HJSA 3ROKA 3BMQB 4YTEA 3PFWO 5ITWA 3BHIA 1Z7BA 3VTZA 1PJ3A 4HXYA 1ML3A 4H3VA 4GVXA 2YY7A 3P19A 3MCVA 3JSAA 3RVDA 1GZ4A 3D1LA 5L53A 3PLNA 4EJ0A 4GMFA 4EGFA 4PZCA 1YDEA 5IZCA 4GWGA 2XPCA 4JP3A 4LMPA 1P31A 4H16A 4BNLA 3NTQA 2X5KO 3EW7A 3AOEA 3JYLA 3U4HA 1LSOA 4XCVA 5T73A 4WLFA 2RH4A 1ULUA 1YL5A 1C1XB 1YRLA 3LT4A 3DZIA 1NAHA 4B4UA 1YXMA 4MKZA 4YT4A 2NVUA 4NU6A 4UEOA 5IDXA 4E2WA 4PLCA 4I9HA 3VVBA 4FFLA 4DPLA 5DOZA 5FF9A 2D5AA 2VYND 5KVQA 1HXHA 1U8XX 2D5CA 1E3WB 4FFMA 2AEMA 5THQA 4E2YA 2GSDA 1CIVA 3HNPA 2GLXA 1ONPA 4A73A 1KVQA 2B0JA 4BKRA 3PWSA 1BXGB 4GH5A 4YCAA 3BTUA 2CDBA 2CVQA 4MKRA 2B5WA 2CFCA 4G5HA 4KP7A 4OAQA 1OFGA 3TZCA 3OQ6A 4I5FA 4BNUA 5JSFA 4J7UA 1SCUA 4Q3EA 5F1PA 3GZNA 4DLAA 5CFZA 3S1LA 2I3GA 2A9FA 2EP7A 3AFMA 3JCZA 2GRAA 3C24A 1NWHA 1PX0A 3PYLA 2P91A 1O89A 3GC6A 2YDXA 4QEDA 4LISA 3F46A 3BTSA 4R9SA 3W8EA 2ZTLA 1QLJA 5U4QA 2W98A 1ENYA 1ISJA 1EZ4A 1B7GO 4OQYA 5U1PA 3O03A 1P74A 3NDIA 4RF3A 3AI1A 4NK4A 4ITUA 3AY6A 1I5RA 1PZHA 4BV9A 1SOWA 4OSPA 1T2EA 5JAZA 3PJEA 1PQPA 4KQXA 4L8VA 3F47A 3JD3A 3EMKA 2CD9A 2WTBA 3QSGA 2YHUA 5IAAA 2YZ7A 2A4KA 5T57A 2C2XA 2I9PA 1H2BA 3WJ7A 3ZNNA 2X8LA 4KWIA 3ZW8A 4EJMA 2VRCD 1P1HA 4Y6SA 1UJMA 3W4IA 3GGOA 4OL9A 4NFYA 1HDCA 1A71A 5L51A 3GN1A 1YVEI 3OJ0A 4ND3A 3M6IA 4IDAA 3MJCA 3VVCA 4FJ0A 4A26A 4I1IA 4E3ZA 2X86A 3UUWA 3AWDA 2CNBA 1I33A 3JD1A 3JQ8B 3TJRA 2OP1A 4J7CA 4TVBA 5JE8A 4CR8A 5TQVA 3GRPA 1E3EA 4WLNA 4HP8A 2DKNA 4QFCA 1C1XA 4YAGA 4Z6KA 1H0KA 4IIVA 2AW5A 4E5PA 2ZB7A 2Y93A 4OMUA 1MFZA 4INAA 1TVEA 3ZV5A 4CM4A 2DFVA 5IDWA 5ILOA 5JAQA 1O9BA 1SO8A 3V1UA 3KETA 1K2WA 1JQBA 1MLDA 3FNHA 2IDZA 1PJLA 2UVDA 3N74A 5CG2A 2J3IA 1YBVA 1QYWA 1UAGA 2I6TA 3SLKA 1UAYA 4FFOA 4L4SA 4MP3A 3ZZNA 3AUSA 3K92A 1PEDA 1U8FO 3ICPA 4KWHA 3TPCA 3SBOA 2VTEA 3K31A 2Y05A 4ND5A 4OSOA 2B4RO 1DRUA 2PA3A 4CM9D 1NFRA 3K9QO 2Q1TA 1SZJG 3QIVA 1WMAA 2YUTA 5AOVA 2BFMA 3P7MA 4WK6A 3EGOA 3AJRA 2HMSA 3NTOA 4GKBA 3ROMA 4BO7A 2P9CA 3QE3A 2DBQA 1QSGA 4GQAA 4RQUA 1R15A 1XGKA 3CH6A 3VPXA 1KERA 4FSHA 4B7CA 1CJCA 2A94A 3WNQA 3EAGA 3KUXA 3F1KA 4YT5A 1N9GA 4B4OA 4UULA 3GDGA 2NVBA 1RM5A 2VQ3A 6ADHA 2HU2A 4EI2A 3QVWA 1GCOA 1N5DA 3G3EA 2UAGA 2QZZA 3M1LA 2YJZA 2XXJA 2A35A 3PPIA 3NGLA 3PJGA 1E1KA 2C0CA 4J4HA 4M55A 5ILGA 3QVTA 2IZ1A 3ANMA 4L9RA 2JKVA 3U9LA 1F17A 2AQIA 4OQZA 1FDUA 5T8KC 2Q50A 4YR9A 4U8GA 2EKPA 4E4YA 3GEGA 4AJLA 4DQUA 3BZUA 1PGOA 3O9ZA 2I3AA 1U7HA 2BHLA 2Y1OA 4FIZA 4II2A 4FD3A 4A7PA 1Q7CA 1YOVA 1A7KA 5A06A 1QR6A 3PI7A 4MVJP 3PJFA 3WGOA 1ISGA 1FJHA 3HDQA 1ZEJA 3NYWA 4CMKA 2DM6A 5IXYA 5C7OO 3RFXA 4ZQGA 3ZW9A 4B7UA 3KYDB 2Q3EA 5EQDA 2C5AA 3I6QA 2BKAA 3JYPA 3MTGA 4TSKA 4ND4A 3FRJA 3K73O 1K3TA 5HS4A 1CF2O 1SBYA 3WXBA 2JCYA 4BMVA 3KSDO 2VWPA 5G4LA 3KHUA 4WOKA 3I1JA 3ADPA 3E9QA 1O94A 1NFQA 1ZEMA 3GAZA 1H2HA 1LX6A 4L0QA 4NMHA 3VZPA 5CDSA 5L95A 3W6ZA 4JJFA 2POQX 2PZJA 2WM3A 4GX1A 3WSWA 1VSUA 1VLLA 1MG5A 1IZ9A 3H9GA 4WJZA 5G0WA 3IOYA 4PZDA 4DPKA 3PK0A 3WS7A 1I01A 4KQWA 4ID9A 4K1LA 4PG6A 4I9NA 4U6SA 5FI5A 5KJ6A 5TIIA 1N9GB 3RFVA 3FWNA 3ONEA 1LRLA 3DHNA 3ZWAA 5MGBA 3GVPA 1ARZA 5DDIP 4K9DA 1MV8A 1CWUA 4XDYA 5TX7A 4PRLA 4RVHA 8ADHA 5JYFA 2JAPA 2IYOA 2Q49A 1N92A
chains in the Genus database with same CATH superfamily
2AD1A 1Q1ZA 4TKLA 1E7WA 3FTCA 4YO7A 3PXDA 2QE7D 4RNDB 2PCLA 3ZDYB 1X2EA 1QZXA 3GPIA 4NV3A 4F2PA 4IS2A 2GZ2A 4MVJF 2X42A 5ILQA 4YCSA 1AF4A 1GEGA 3TSCA 5ISMA 2CFSA 3ZCUA 3DE1X 1F5SA 2BE9A 3GG9A 5K8VA 3QKRA 3VR2D 5JJIA 4UARA 1T5SA 2C42A 1RLIA 2YVQA 1WW2A 3WMRA 1RAHA 2PWPA 1SBIA 3KL4A 4HWPA 2K7FA 1BCRB 1G2QA 2Q1XA 2R6FA 2W2NA 2YOHA 1XDUA 3GVHA 3L93A 2NXJA 2DE0X 4GP9A 5BSEA 4BXOB 3QJGA 3U44B 4KJZA 1FX1A 1SG6A 1QHYA 2ZU0C 4RD4A 1ABBA 1HDXA 1NVVR 1OLUA 4TN1A 4FWIB 2EHDA 4DJTA 2HWXA 3OCXA 4LGMA 5A7HA 3GLSA 1EVQA 1R5OA 5LJLA 2RC5A 2O8NA 3LNTA 5CT9A 3TG2A 1ZM4A 3IWDB 4XSGA 3FA2A 3SZUA 3TMYA 4BQRA 4D3FA 2PQ2A 1JEYB 1FFSA 4D9CA 3P27A 4UNIA 2LGJA 2QRLA 1XZPA 3OT5A 4JR1A 4M0PA 2W6JA 2E7ZA 4ZYLA 4X1IB 2ABWA 2FKNA 4CODB 1GY8A 4IIJF 4UPVA 2LCFA 1E3QA 1O95D 3CR7A 2VXCA 4ZTBA 4ARSA 4R7TA 4UU1A 1ID1A 1MJFA 4FDMA 1JA9A 2ZRDA 1PAUA 3BJIC 2QF7A 3B70A 3HGQA 1ISIA 4ILKA 5JYCA 2EYQA 3KT8A 4NNOA 4L72A 2VAWA 2QVLA 4Q4AB 4QSMA 4OQLA 2O1XA 4KAAA 3CUTA 3UMSA 2QV0A 2VHQA 4DR6B 2AN1A 1CY2A 2CHGA 1Z38A 4ZDIA 1Z2DA 2IE8A 4RJJA 1YCDA 3C5VA 5K8LA 2ZYIA 3OA0A 1Y9ZA 2ZULA 4K8OA 4Q1CA 3D59A 5JXGA 3L4JA 4GZ5A 4N8EA 2HGZA 4LY3A 2IW3A 2H3HA 1L5WA 1QO0A 1KSGA 5BN3B 5JSYA 5I7WA 3SS7X 1I0ZA 2H5LA 1QMGA 5KYUB 1X1AA 5FOTA 3DMTC 3ZC3A 4P32A 1PD0A 2H4HA 2OR3A 3U9TA 5EIOA 4XB2A 1LLFA 4GXQA 2W2KA 4TLBA 3VU1A 5B4TA 3OP1A 4NMMA 3WGTA 4F6CA 2NSLA 4HLUC 4HAOA 1N4AA 3GLGB 3QV2A 4BVFA 3DZ6B 2Q6IA 4BV2A 4UHBA 1PNTA 1QV7A 2GN4A 4M0DA 4KNYA 4BCDA 1E4EB 1IHPA 4J16C 1ZWLA 3Q2KA 4GYWA 4DIMA 1NNUA 2BV3A 1UANA 3DL2A 1Z4PX 1HSZA 4YWHA 4EKIA 1BMFD 4Q7LA 3ENQA 1LCIA 2G07A 1ABFA 2JCSA 4MUJA 5AW5A 2A78A 5AQEA 3ZY6A 1Y1PA 1NJ8A 1YZQA 4N49A 1M1YA 3OFSA 2PRSA 4C01A 5IH7A 5BRJA 5K8UA 3WY9A 1JIUA 3H9UA 4ARZB 4JJIA 4NAHA 1ST3A 5ENVA 4O4IB 3T3MB 3BCSA 2HV9A 3A06A 3ESCA 4MCAA 3TQCA 3TVYA 3MERA 4EL5A 2BCJQ 1PJ8A 5MN4A 4N5MA 2ZFUA 5E2BA 1LXCA 1SFRA 2ZQ5A 3CXRA 3OX1A 4Q93A 4ETMA 5JFTA 1KI3A 4PZEA 3T1TA 4RCVA 1KRWA 4CKCA 1NW5A 1MO6A 1K7FB 3EEFA 2OCKA 4K8RB 1TYDE 4P4GA 4WCFC 3OKAA 4ETWA 4PYNA 1F06A 3OE1A 3DZ5B 1B2LA 3JAWA 4KV9A 4Y7DA 1T3GA 5K0EA 3EQ7A 2PH5A 2V74B 5TQ2A 2EYUA 3FGZA 1AHPA 3P9YA 5KX5A 1DC8A 2BFFB 4P4UA 3F7TA 1E2LA 4JIGA 3ENZA 4QBIA 4R1NA 2HPHA 3SJZA 3LOQA 1IOWA 3PNVA 2A0XA 5EPOA 1Z13A 2Y0BA 1FE8A 2F00A 1CD5A 1EWRA 2CLLB 3SYLA 2XUGA 3NEYA 2C61A 4MSUA 4Q7QA 3TOCA 1CUIA 4X66B 3WXMA 1ZA2A 4YGYA 3KQHA 1WHTB 4CUZA 4G0WA 1R10A 2ZSUA 1M7HA 4U7GA 3EX7C 2C7GA 1JHYA 1FRNA 2BGIA 4G4SP 3DOCA 3A1TA 4D0RA 3AI2A 2RK4A 1Q7RA 3HBMA 2CY0A 4NU0A 3RROA 9LDBA 5F51A 1P7VA 1QANA 3NC0C 3SEFA 5B1SA 4DV0B 1D2NA 4K9QA 2FLKA 1E9FA 3L1IA 1R12A 5FFNA 5A3QA 3ETCA 3SQMA 3ZE1B 1JMVA 2W11A 2VBCA 1DBVO 3KALA 2OO7A 2NTEA 3TTUA 4LUCA 4H9GA 4ZCTA 4LNAA 4N39A 4MHOA 4OHRA 2KE5A 3N8HA 1HL7A 3OSZA 5CFQA 4HWOA 1T1GA 3KR9A 2OB1A 1PL7A 3AETB 1NRXA 3L6RA 3ONVA 3UCXA 3PIDA 2M9MA 3OQBA 1FX0A 1P1RA 2QM3A 1R5JA 4NEQA 4KZKA 4PRZA 3QITA 4Z7NB 1VLHA 3S7TA 1HETA 1YWGO 1T9AA 3TL3A 1W85B 2XYGA 1C29B 1EP2B 4I1PA 3E82A 1XLTA 4CKEB 1Z0DA 3BSFA 2YNMC 1YR8A 2UUOA 3H9QA 3HLTA 4FR0A 3I6MA 1ZN7A 3OA2A 2AOTB 2N42A 1D2GA 1G1AA 4LQLA 3ER8A 2QPAA 5LBUA 3KQKA 4G6ZA 3GLVA 4XX0B 1OH7A 2PUBA 2YHAA 4YRAA 2C2MA 1NY5A 1KMIY 1C0LA 1MTZA 3E3OA 3WLTA 3CPJB 3FCUB 1N1MA 3IQXA 1CR0A 4NU8X 1NUSA 5KREA 5BR4A 2PMBA 1TCVA 1PSWA 3G2PA 4M9XA 1NQXA 1DKRA 4YQYA 1U2SA 4CIXA 4YS6A 2H11A 2Q0QA 3OCCA 4O2AB 4PAQA 1KAEA 5IW8A 4DA7A 2C4TA 4LPKA 1OAOC 2Z3VA 1WG8A 3MHPA 1VCMA 4R31A 4ZYTA 5CB4B 1NLZA 3LL4A 4L6IA 3HU2A 3S1SA 4FMBB 3NGXA 2POCA 3SC4A 4NYIQ 3Q8XB 1ZJJA 2VS1A 1W8IA 1YZFA 4HDMA 3UK1A 4ECEA 4KCGA 4BFCA 1FJ2A 4OJYA 1WZIA 1QQ6A 3CPEA 5G41A 3OQMA 2RMKA 2HWUA 1Q57A 2OCAA 2WOOA 3OECA 2VQSA 1T9HA 1WS6A 2ZBEA 1QF7A 3L7OA 4TRNA 1TFRA 4QULA 1ECBA 2CNKA 1E6UA 5CTJA 2V5VA 1SUSA 2C7VA 4Q02A 2PMWB 1AZSC 3C4VA 3CF2A 1E60A 1EFVA 3IMFA 3I01A 4DQXA 3QXSA 1N0HA 2Y1FA 3WYAA 4O4JB 6ABPA 4ER6A 2H1CA 1RRGA 1SCUB 4YC7A 5YASA 5EJ8A 1M1ZA 3SQOA 3T3OA 1HM5A 2ICAA 3KZKA 3N2EA 5KVVA 1BS1A 3WYCA 1Q7GA 5ALRA 3L49A 1MB4A 1XQVA 2WJWA 4LXYA 4AWBA 2XXAA 5A6SA 2XMCA 3V80A 3ZK7A 2JEOA 2GXSA 2V7EA 2A84A 1H3FA 3K5HA 3KPJA 3P9QA 4IXTA 4EW2A 5HIAA 5GIPE 5A2QA 4MK4A 2G6TA 4R8SA 2Q4RA 3JARA 3F4BA 2CN1A 4EG8A 1TZJA 3UJ8A 5F7ZA 1UXOA 4Y2XA 5IX8A 3FUVA 5HJ7A 1NVVQ 1SKBA 2OVBA 1M5TA 3CJRA 3CVVA 1BH2A 2VBIA 3K8ZA 3I9MA 4KOEC 3W5VA 5LMCA 4OU5A 4I5DA 3F6PA 2JHCA 4MVJG 3GEEA 3HVRA 1WMSA 4ZU6X 4ZK2A 4W99A 4B85A 1YZKA 5BWMA 5LQAA 2UYHA 4PGGA 2DUUA 4ZKDA 1ELOA 2RARA 2PT5A 5FNZA 4C7OB 3ZXYA 2F1OA 4GOJA 1D6MA 4TMZA 2IU3A 1AQ6A 4JENA 1CUWA 4RABA 1ZD9A 1ZUNB 1DKOA 3JARB 3KAQA 3OFVA 1XQ6A 1DMSA 2P5UA 4G07A 1VL5A 5CVDA 5ED4A 4W6ZA 3K8YA 5DHAA 2ZEJA 4GRIA 3RK4A 1J8MF 3GJ3A 3W3AA 1M8KA 3I92A 3CH7A 3O3NB 1W2WB 4MW0A 4JJKA 1SCDA 4B17A 4U5QA 3U44A 3QPAA 1UXJA 2O7NA 1N9KA 4BFXA 1J25A 4W7HA 1BCRA 4EGJA 1L4GA 2NO0A 2FV8A 3HKEB 4XJTA 3UT5B 2B4YA 2BWJA 4WZAE 2Z8ZA 3GLFB 5G1OA 1AH2A 2ROQA 1EIZA 2QZ4A 5C9ZA 2HMVA 1RYNA 3L2OB 2P2CA 3DNMA 3PTLA 4I8IA 2V4UA 3AW8A 2GAOA 1UJBA 2J7PD 2NV0A 1EM8A 1R0RE 5FYQA 3RUIA 4BAUA 5CDUA 5HRUA 4PGHA 3NHLA 3RTDA 5F5NA 1T25A 4OQMA 4YIKA 1RAIA 1EB8A 6GPBA 1NJ6A 1J39A 3DP9A 4EY4A 2XUFA 3U1BA 2IYPA 2HCTA 2EL9A 3OCZA 4JLJA 2JLUA 1E7RA 3AEYA 2WUWE 3ON5A 3A32A 3DYBA 3PKJA 2GTIA 1U90A 4KFSA 2X2OA 4DTCA 4XDGA 4IFBA 3MJTA 1NNEA 3NX4A 5TF4A 1Q91A 3WNZA 4RE5A 1UJ5A 3KK0A 3ZHQA 1EQAA 3OHMA 1DAGA 5INTA 1L5NA 1Y37A 2TMGA 2R86A 2E6KA 3OZFA 3C1UA 2B9EA 3F3MA 4EPXA 1IXZA 4P7BA 1L7BA 2FK7A 4JSTA 4L0CA 5ALOA 4ENSA 2ECQA 4MAAA 5JH7B 2GXQA 5AXBA 1X1RA 3COZA 3MOGA 3K05A 3RI3A 3ZK8A 2Q4BA 1CZUA 4DHWA 4IMRA 1TIKA 3DPIA 4JEIA 5E6RB 1QFMA 3T5TA 4ZXPA 1IOLA 2WJVA 4BVJA 2ZIAA 1TCCA 4OXQA 3IEMA 4LYAA 2Q07A 4P58A 1DOAA 3IVGA 1GA4A 1NP7A 4I50A 4PW0A 4LWQA 3X1XA 4KYTA 3ZI4A 3OT4A 4UEJA 3WFZA 4PX3A 4E11A 4YRMA 4Q7KA 4AY5A 3Q9UA 4JVSB 2O07A 3NPMA 3KYCA 1RWVA 3N9IA 5HVNA 4FE4A 1SGWA 2RGXA 3L7BA 4WKCA 3LPAA 1ZRHA 5T4BA 5E1DA 1TKAA 1R3UA 1GL3A 3KKNA 4H3SA 3I12A 4WLEA 1UBTS 2FW8A 2UKDA 3GFVA 3QWFA 4L5IA 3JQ9A 1Q5PA 4RDHA 1XUOA 4UFOA 5ERXA 5BQFA 2VDRB 2VSXA 3MINB 1HURA 1DKQA 1I24A 2CDAA 3HL4A 4OBBA 1PGJA 2Y92A 3WWEA 1KFJB 3NFRA 2NZ2A 2G9ZA 1M75A 2M6KA 3ZXUB 2Y77A 3Q40A 2QU7A 1GPNA 4JDPA 2YHSA 3QI2A 4CGYA 2H2DA 4ESHA 3TGPA 3IQWA 3PC7A 3V8NA 2OVFA 4I4CA 3MG9A 3DZ8A 1UXIA 5DGCA 1JR2A 2HRZA 1Y8RA 1NW8A 1UKZA 4GNRA 1QRAA 2JH8A 4RD1A 5IC4A 2IXFA 1K8YB 1PLJA 1XCPA 1EQUA 3REOA 1RYDA 4QC2A 3E5MA 3OPMA 4ARVA 1XDSA 2DLNA 2PAFA 1Q1QA 2ZVQX 2FSPA 1RFLA 3VV3A 1FDOA 4IJKA 2BFFA 3UHJA 5FPKA 3DZHA 3RLFA 1I2DA 2GERA 5BOSA 5DGIA 2HJRA 2J0UA 3GEIA 4Q4CA 3PD1A 3ZWOA 1CLUA 5GM2A 1GKYA 1V47A 3OCUA 3ZGNA 1ML4A 2AXPA 2R6R1 4XR9A 3EZYA 2O1SA 1EAYA 3H7AA 1VBFA 3GA7A 3FTQA 2GM5A 4OQNA 4XFKA 4BN4A 5J2TA 4NATA 4E51A 1BFUA 2PLRA 1JJBA 2DFLA 3OJOA 1L8LA 4IG9A 3CLSD 3RYFA 1P4HA 3EVNA 1V25A 2R47A 2QBYA 2R3SA 4ZC1A 3EYAA 3STUA 4PVDA 2FLVA 3AJ9A 3G2OA 4DBLC 1COWD 3V1YA 3QU7A 4OOEA 5I4IA 4X1YA 3QWAA 5DHTA 1R0SA 4G1VA 3JQGA 2PFGA 3T3NA 5A05A 3A9CA 4D0NA 4MINA 2G9NA 3UIEA 5JS2A 3H5RA 3HGMA 2WUFA 3H99A 1ESNA 1NLUA 2FPMA 2UDPA 3GDHA 4DIFA 5EZYF 1L1EA 2JFWA 2JHGA 2XT6A 1EVIA 3CLKA 1BO6A 1XPJA 4FDAA 4YRNA 2ES4A 4FFRA 4NOJA 2GD0A 5D3MB 1UOPA 2H9YA 2H5EA 2VHXA 4LJYA 4LVOA 5SY9A 4QYIB 1C2YA 4CLQA 4E7OA 2VH1A 1D07A 1K4KA 2BTOA 1JZQA 2RGDA 3EIWA 3EBOA 3QYPA 4W63A 2WD7A 5DYNA 3USES 2FXVA 3NUGA 3PUXA 4CFYA 3PTAA 4C1NA 1ZUIA 4ER7A 3C5HA 4V39A 3MMSA 3PLAE 4PLTA 2PX8A 2I7DA 2OGUA 1KFBB 3SM3A 1OPXA 2WIDA 2HL6A 3GWZA 1RRMA 2P2YA 5DLPA 4HHEA 5DN9A 1YDFA 3IUEA 3ESXA 1CT9A 1PYGA 1J2JA 3JR7A 3OOYA 4RVUA 3QUBA 5F76A 1UADA 2VPYA 1Z4IA 2ZPUA 4RD0A 4ZCIA 5AQ1A 2WF5A 3FYTA 1WETA 1QLHA 1B2RA 1XNJA 5GZ1A 4J0HA 1S96A 1TW2A 1OA0A 4S05A 2JFXA 3UJPA 2JIRA 1I3KA 2EKLA 2VPPA 3I8XA 2WIKA 3A2NA 2QWXA 1IMOA 4FEYA 3UICA 1UBOS 4JB3A 1TGVA 3EEBA 3LGSA 2B8WA 3FCCA 3OG9A 1SKYE 5DSZA 4E33A 3QLJA 1LZLA 5GM1A 2PKRA 1P45A 1KPIA 3NANA 3FWPA 1X1BA 1ZH4A 2FXIA 4AN4A 4MTLA 4NCHA 3RSOA 3PJDA 4CDGA 1X9HA 1GNRA 3OUTA 2GF0A 2P67A 4HNSA 4J76A 1N57A 4U7PB 3ZH9B 1HYQA 1MC4A 1CP3A 2JDID 4QARA 2A9KA 4B40A 3GG2A 3MRXA 2JHPA 3EZLA 3CPSA 1A7AA 1ESZA 5FRDA 5HUHA 4R3WA 1I7QB 1VC2A 1ULZA 4IQ8A 3A4LA 1CZOA 5ALEA 3FUTA 4V1CI 2IEGA 1ZRNA 4U0KA 3KQSA 1DAHA 2RHCA 2BZ0A 4PX5A 3RDPA 2PUEA 4WTOA 2XADA 1J8VA 1JDJA 2QKYA 3IKVA 1H1LA 3TX6A 4BNHA 3KTOA 1DO2A 2H31A 1IRIA 2LRHA 4R1PA 1EVLA 1I14A 2HMUA 3EF0A 4L9AA 3TB4A 3WYBA 3NB0A 1Q83A 1SH7A 2JAHA 3GK3A 3LPDA 3ZJYA 4MI3A 4DCVA 1VHWA 3HA3A 4NABA 2O3JA 3RF7A 3NOQA 1CUHA 2OHOA 3W2IA 1XZHA 3O8NA 3KB6A 1WPQA 4PYMA 1LQ2A 5KPJA 2CBGA 2O0KA 2FOLA 4BQNA 2J5BA 3VKWA 4A4DA 2ZR0A 2D0OB 2BGTA 5J1TB 3A3OA 1I2MA 3K8OE 1JIQA 1YO6A 2ZI5A 3KR1A 5AVWA 1P72A 3CPHA 4NPAA 3KGDA 3W4KA 5KMGB 3ROTA 3BILA 2ZCUA 1NQVA 2Z3WA 3THSA 1N6IA 1UPCA 4F1KA 3Q8KA 2A5JA 2CZCA 2YV3A 3I1IA 4XJVA 5TSDA 1EXDA 2OBMA 4PANA 4TROA 3CX3A 3IP9A 3ZLVA 3LC1O 1SHZA 3DZCA 4GAEA 1PDWA 4L8WB 4QPJC 4D9HA 1QHHB 2QNRA 3WIDA 4OSEA 5KEIA 3DVRX 3TR6A 1XEXB 3A9SA 3L9XA 2GPTA 2DRIA 3JRNA 1ODJA 3A1DA 4Q05A 3GJ6A 5ARBA 1VKHA 4G84A 4XQ9A 4YP6A 3STXA 2AWOA 2PL5A 3KVNA 4GR4A 1SCNE 2F1KA 1FX0B 2Z5VA 3K9NA 4CFZA 4DXDA 3DMTA 1GPUA 4LSGA 1UUFA 1IQUA 1ECPA 2GPAA 2PLWA 1JKJA 3B6KA 3MTIA 3S27A 5AOBA 3MCTA 3WGKA 4JP8A 3CNLA 4LF9B 4ZQEA 1JQ3A 2NYAA 2O57A 3FVVA 3G89A 4AKEA 5TE9A 2Y66A 3N5CA 2KM1A 3L0IB 2RH9B 5H83A 1Q0ZA 4C7MA 4CV1A 1WDTA 2JGLA 1GLGA 1IN5A 2QNIA 4HB4A 2IYXA 1F20A 1V6AA 1C14A 4DQKA 1OBOA 5JBNA 1LVGA 2GEBA 5J2TF 3ER6A 4LG1A 3RHTA 3NM4A 4Z0HO 1PR1A 3L07A 4XPZA 4TYNA 2I8AA 2ZJ7A 2IEIA 3R7WB 3GLRA 1U9YA 4PZAA 3W78A 3KQOA 3TOSA 1DRVA 4MA5A 3TTWA 3NAQA 3UKOA 3VMMA 1LK7A 1DQYA 1QAOA 2AR7A 2I7TA 3CN9A 4HQKA 4ODIA 3V8MA 4DMKA 2CXHA 4EG1A 4Z3KA 1YVDA 4KRXA 5ERYA 4BO2A 4K6FA 3GB9A 4HGPA 3A1NA 4LJSA 3TZEA 2AG1A 4XGNA 3GDFA 5CFRA 4L0DA 3Q5GA 1FUYB 4H3KB 4GDFA 2WUEA 2LDBA 2PS9A 1OZHA 5FBKA 2PT6A 1OX4A 4YFYA 4JY7A 4XSVA 3FJ1A 3C6BA 3O4IA 1IUKA 1JDBB 2ZJBA 1GZUA 1XROA 1XRPA 2EW8A 2FSSA 5AKXA 5TGZA 3R0XA 5BWLA 1EFUA 1SQGA 1YBMA 2C4NA 1ZUNA 2C4HA 2NO9A 2PNFA 4GI7A 5HE8A 5SYAA 3M6AA 3EY9A 3L05A 4F8EA 5DX1A 1S1CA 2PX2A 1G6KA 1ZO8A 4LKRA 5ALUA 5I45A 2I91A 2JJ1A 1C7JA 5TV2A 4WOJA 1KU0A 4O2LA 4TMKA 1T15A 3GGPA 2IY8A 3T99A 3IUPA 3F0TA 1PL6A 1ZOOA 1KK2A 3WWDA 1RR6A 4CMIB 5HKKD 2X0RA 5FOSA 3MTDA 5JMTA 1UKEA 3RKUA 1TUBA 3P52A 1KH3A 1KOJA 2FWNA 1FMJA 2QSUA 4MJ7A 4XFJA 1MJNA 4IEFB 3S8MA 4CQMA 2CHFA 4Z54A 3R5FA 3IB6A 4H1WA 4KFRA 4F9TA 2E4UA 2O2YA 3T4PA 2WZQA 3MLAA 3UK6A 2FOIA 1BJTA 1I6LA 1A9ZA 2W90A 2OZPA 3S99A 3QGMA 3HB1A 2W0SA 1FNSA 3D7MA 4MICA 3KLNA 3D4OA 1SJ9A 4R8LA 5EUBA 3SY8A 4AMYA 1IN6A 3V4OA 5EIBC 3BE8A 4BNTA 2IFTA 4EKNB 2GQ0A 1BWPA 1CXZA 5D01A 1YS4A 1ZH0A 2IODA 1GUAA 3EC1A 4UU7A 4RL4A 5BMVA 4FYYA 1SCQA 1HOXA 1PJ2A 3HCDA 2PQ0A 2YBDA 1GZ6A 2HA4A 2Q21A 3FUCA 3BGWA 4XH9B 3TPFA 3IQDB 3B82A 3PI6A 4M49A 2HYIC 3LFUA 3LLUA 2QAIA 4IOLA 4C0BA 4FNGA 4JYBA 4UNQA 5JJCA 2AS0A 4FZJA 3KHKA 4Q1AA 1O58A 4RXMA 2IHJA 3KKMA 3LYAA 4PCUA 2C9OA 2VHWA 3PXAA 1G38A 1AD2A 3REQA 2ZVPX 1XCOA 4HNQA 1GR0A 2ZBDA 1P5JA 2TS1A 3NVDA 3OLVA 1R37A 5CGQB 3AL2A 3VSEA 5JXIA 2A7XA 4FHEA 1LVUA 4OTZA 1TNDA 1XHLA 2EBWA 1KZ7B 3KQWA 2VK2A 5TPZA 3PPXA 4BLPA 3H2SA 3PHBE 5AKZA 2GYYA 1MRZA 1ZNWA 2EZ8A 2G1KA 2YXLA 3BL6A 3K8QA 2GXUA 3SSAA 5HYVA 2ZIFA 1RP1A 4UKDA 5IRCD 3KO8A 3STHA 1I72B 4AG5A 4E30A 2AC4A 3KXKA 3MUEA 2A5YB 1GTJ1 1XCMA 2ZUVA 5E6SB 3U0VA 3JVEA 4QEZA 4QATA 4J4BA 4XGQA 2HT1A 3RF6A 1VHJA 2VA8A 3C0KA 1JT2A 4P31A 3WNVA 2QZPA 3NO4A 3BWYA 2V7BA 1BDHA 4BLSA 3U7RA 1R5NA 3ZZ0A 4OUDA 3BSWA 4EZBA 1P3DA 2FUKA 1I3OA 3IIJA 4JITA 4B0PA 2G17A 3BYZA 1LJLA 3V8QA 3WYNA 4CMAA 1ZITA 3R5SA 2PRIA 3EG5A 3TLJA 1E9DA 4EQZA 3GH1A 2OUKA 2OCLA 3PCTA 2FGKA 3H13A 5EJ5A 4KQKA 3P2KA 3HXMA 2NTJA 2VCHA 2XOKD 5B3JA 4HEA6 4NFLA 3TJMA 3KDSE 4IDDA 4PIVA 1WUHS 1EYZA 2PKCA 3DA8A 3HA7A 4N4AA 3MBOA 4P3XA 5DCWA 1MJGM 2GASA 3SJBA 1JPVA 4RJKA 1NP6A 4WNIA 1RTTA 1RKQA 4RVDA 2G0NA 3SPXA 2CC2A 3KXPA 5JZBA 1ZK1A 3QSYA 3NHRA 1NVFA 4OYRA 5BMVF 3PFBA 3A14A 4W4TA 3K70B 4TX1A 1G3RA 3PIIA 4CG0A 1NYQA 1KI7A 1XF9A 1L7RA 2CXOA 4D79A 4BPBA 4A2QA 1T2NA 5JDCA 3TIFA 1KMNA 2C2ZA 4EUFA 2B34A 1V1JA 1P0QA 2F9MA 2NAPA 3FG9A 2WM8A 3EFEA 4HX9A 1PD1A 1PQ4A 2FMXA 4JL8A 1ISMA 2YASA 4OJMX 4AJ1A 2DFKB 1GNQA 3FI9A 4AJJA 4B6GA 4BFUA 5CTAA 4IZIA 2R1ZA 1GUDA 3N8KA 3DMNA 2HTFA 5HBRA 3V2HA 3ZNOA 3O8QB 2BFCA 2QTHA 4QNMA 1HMPA 2G9UA 4XLLA 4R0NA 2SECE 2H2AA 4CWAA 3L4BA 1XJQA 4X6LA 4EKYA 1V7ZA 3EGVA 1SG0A 3QF4A 2I80A 4JSRA 5F7JA 2EIHA 1GG5A 4PSUA 4RPHA 2GNOA 3UOGA 1T36B 3ZDAA 4D9MA 3PE3A 5DMHA 5FWXB 5TNXA 1NI4A 1HE4A 5FTNA 1OGIA 3TAXA 2J3HA 1O5TA 3EY4A 4LJ6A 3OJFA 3UPDA 2CFTA 4LZAA 4UXIA 5EE9A 4D41A 2EFHB 2HLPA 1SBNE 3QP9A 2C9MA 5E4FA 3OC6A 4M0FA 4NR0A 1SUFA 4WUVA 1TAHA 2Z83A 1LTHR 2OHJA 4QT0A 3E70C 1JFFB 2FMIA 2WF6A 5FFFA 1RIFA 3FHJA 1GDDA 3SQNA 1NOJA 3QWBA 5K3BA 1DMRA 1ZCZA 3JQ7B 4RCZA 2O14A 1KZ9A 1BSVA 1A8HA 2AI3A 2XQKA 3TSZA 1IDN1 1Q77A 2B1GA 4QWMA 1SIBE 2R84A 2QR2A 4GLOA 4DMFA 4H60A 2YHIB 2WF9A 2WP8J 4F04A 1COZA 3PHLA 4X63A 5JFGA 5HP4A 4V24A 3OFJA 4UTZA 1PVDA 3RW9A 3I64A 3VVLA 5H9WA 1JFVA 4QGFA 2EDAA 2PRKA 4CL3A 4AP5A 1Z7WA 2EFDB 2J7PA 1O0SA 2YJ6A 4BMSA 5C5CA 3AZQA 5MDHA 1VE3A 4ECAA 1WNTA 1WV0A 3H4MA 3AIOA 3O38A 3IVRA 4BJ1A 3ROPA 2IIPA 4IGAA 1I79B 5JQGF 1N0VC 1TZ2A 2AMYA 3OI7A 4Q4LA 3DW1X 5C7IO 4DCSA 1XVIA 4LY6A 2NZUG 4UXJA 1XDWA 3RSCA 2F7SA 3ORFA 4MP6A 1NV9A 3KWMA 5DBOA 3JR3A 4GZMA 3DC7A 3AVQA 3NBMA 3PHHA 4NFSA 4LRXA 3ILSA 4MO9A 1UP6A 4YRPA 5HJEA 5ITZB 1N6PA 1U9CA 1VL2A 2F17A 1QPBA 2P9TA 1BTOA 1XTQA 2A30A 2WU3A 3R41A 4EGSA 1JU4A 1XJ0A 4KIGA 2WSSA 2RAUA 4EEKA 3ZS9A 1XLTC 4M0UA 1IY1A 4HEHA 2WQZA 3ICEA 1VJDA 4JFRA 4QU5A 4F1WA 4BB9A 3H5IA 3O7WA 3ANYB 4MRRA 4GXNA 521PA 4AKGA 3DFFA 1CCWA 1NI3A 3LPLA 3U19A 1Z0IA 3MJRA 4MGIR 2PZAA 4TUYB 3WL4A 5HTOA 1L5SA 1EU1A 4LZWA 1XD9A 2TMKA 3LPCA 1SB8A 5IH3A 2ZT8A 1L5LA 3K9GA 1KIFA 5JSHA 2GMWA 1PKXA 1Z75A 2RBKA 3ID6C 3IIKA 3MD0A 1EWYA 4X8OA 5GIOE 1RWNA 3TLGB 5EIFA 3EBLA 5IJAA 3AUJB 5CBPA 3EMVA 4MI9A 4I0WB 4NZYA 4ZOLA 3L06A 2HCRA 5KNCH 4KO4S 2DZDA 1UPAA 4A23A 3LBHA 2P75A 2ESRA 4O0LA 1K0FA 3VSCA 4KU4A 1JEYA 4J91A 3GPBA 1WQ3A 2NO4A 5JD3A 3OTHA 1ADGA 1J0XO 1WZEA 4LNUB 4OI4A 3EP3B 2PZEA 2W6ID 2W8ZA 4HUJA 2OESA 2IEAA 4L78A 1UBNA 1AKMA 4OO3A 5DX0A 4DKJA 1O9HA 1PEAA 4G1EB 4GBJA 4FGUA 3L1JA 4QDKA 5MFPA 2XEDA 4IW3B 2WJPA 3BMXA 5C2JB 1Y3DE 4IX1A 5LZ7A 3TTTA 3I30X 4LCBA 3L7LA 3HVIA 1NXPA 1SBTA 4FOSA 4E6PA 5C81A 2Y8EA 2HIMA 2B82A 2R7KA 4GVLA 1W35A 2VZ0A 2O2GA 3EXG1 1JT9A 3LBAA 4JL6A 3A1WA 1BGWA 2GN2A 2OILA 3C74A 2H2FA 1TUIA 1BU8A 3K96A 3L0ZA 3UV7A 4GZ6A 4UNRA 1P6UA 4NBRA 5HQ3B 1FNMA 4DSNA 1XF1A 2GD1O 2AG5A 3D6AA 5KYUA 5EZ6B 3AVXA 1TK2A 1C8VB 1ZOLA 4WADA 3OO0A 1G9TA 3LRPA 2C29D 4X64B 4DOMA 2ZI9A 4D9BA 3V5NA 5J2UA 2IZ7A 1TUBB 5B1YA 2NP6A 2CSUA 1S7CA 3T3IA 1J20A 4Q9JA 3KRTA 1A5SB 3EK2A 3I53A 3L7MA 3NCHA 1Y5MA 2WU8A 1FY2A 5EN4A 1VP9A 1IM8A 3A1VA 3X1DA 4EFDA 4II3A 1JWLA 2C9DA 5EHQA 4J7AA 5IUKC 3Q85A 2GARA 2VHVA 3DE0X 2ZUTA 3GLIB 5FLXA 1NYLA 3V7YA 1PBTA 1Z36A 4IDPA 4KDFA 5KO2A 4QX6A 1NF2A 1C4WA 2BHSA 5ECYA 1BS9A 2Z6QA 1ZNQO 2D2IA 3AM4A 2J0QA 1JDSA 2NUAA 3F6RA 3QQ5A 1DX6A 4ZV9A 1WXDA 1JHVA 4UFPA 3GCGA 5BWCA 5ITVA 1UFQA 3AO0B 3PCXA 1G3UA 5EJAA 5AW0A 2OCIA 1C8KA 2QTTA 1QFYA 1XYYA 2YV5A 3KXLA 4HRVA 5JH7F 4MO2A 5MFZA 1T3ZA 1Z6PA 3P1JA 4FHGA 4MUKA 4X7BA 1TECE 2XMSA 3GX1A 4LOLA 4DG5A 3V4FA 1ZZGA 3DDSA 2H06A 3D3WA 1XTTA 3AQ4A 3IQZA 3LKVA 4ZAZA 3RVMA 1JIIA 3RYIB 3WMFA 1MRNA 1AXGA 3VNVA 2BH2A 4E08A 4HJXA 3HTXA 3ULKA 4L50A 1AIPA 1JB1A 3K2BA 1LPAB 1PBNA 2R79A 3PEVA 2IXAA 3IOMA 4I7EA 4O2AF 5ABPA 3RSFA 2HEIA 4MOWA 2QOEA 4UUNA 3SS9X 4MAMA 3VH4A 4DQVA 4ESVA 4BL5A 5BW4A 3AH8A 2C3YA 1SR8A 4J0CA 1BXRB 3GA0A 2VQFB 3P5BA 1SK8A 4KVZA 1F7UA 2XCTB 1Y3FE 3G0IA 3T7IA 4DKXA 3L4EA 3HNOA 2RGWA 3H0KA 4NCKA 1CUYA 5CP8A 4YBRA 3ZW7A 1U0RA 3RREA 2RCNA 1HFEL 1Z3CA 2GK6A 3JRXA 3JWGA 4GSYA 1N6LA 5IFLA 1RQLA 4JOQA 3DVSX 2FLWA 1CSEE 4HBGA 4DLKA 2ZSKA 1PDOA 3B9BA 1ZD1A 2AX3A 3C45A 1MCZA 4JNKA 3TE7A 3W3AH 4TWBA 4Z7JA 2G1UA 1PV2A 4K7JA 2H0QA 4LTMA 4CEHB 3NJ4A 1V1RB 2EGUA 4C0XA 4UTRA 2I1LA 1CP2A 1KA9H 3CINA 2EDCA 2XSZA 4H7PA 2GPJA 4BKOA 1QFXA 2WHPA 1NBIA 2GCIA 1ZJWA 3MILA 1BVYF 1BDMA 4O4HA 3BRWD 2P9ZA 4Q9NA 1U63A 1EGQA 1IU9A 5DLEA 5AVUA 2JJYA 2P6NA 2O4UX 1UJCA 3RYFB 2JI6A 1T8UA 3SKXA 1O96B 3R0ZA 3T7CA 3ZGOA 2B98A 3EARA 5JY1A 1GV1A 2EZ9A 2XCOA 2PNJA 4AECA 3R7SA 2VJKA 4B4KA 2BDUA 1VBMA 2Z0MA 2CJWA 1C80A 2UV8A 1DIHA 5BV2P 3I42A 1CJBA 2CK3A 2H1WA 4P82A 2Q28A 1TTPB 3QX9A 3O4RA 3Q9SA 4HSEA 4I8XA 4XE5A 3RH0A 3SOZA 2YN0A 4KQIA 3QKTA 2I2DA 2D2XA 3KYDA 3W04A 4ENTA 4OB7A 5G4KA 1FFXB 5FOQA 1F2VA 1OMOA 2G3YA 4ZI3A 1D1PA 4HQFA 1IM5A 4X20B 2G6BA 4OREX 2O05A 4MWSA 4OXIA 2ATIA 4C0AC 1NL3A 2BFCB 2X7XA 3B89A 1KDOA 5J9FA 5JI3E 5HCIA 1IBMB 1GRCA 1K66A 1OC2A 3ANXA 2OB2A 2FX5A 3OT1A 4I6EA 4J49A 3Q72A 1Y33E 3H7IA 4OXXA 4QIHA 1PZNA 5EWJA 2X8WA 2PUDA 4KREA 4KIUA 5EWMB 1F7VA 4OGGA 1MH9A 1EM6A 4HH1A 4OV6B 1GFZA 4BMDA 1QRSA 3RUFA 4MYCA 4REOA 1F3LA 3QEKA 1RQNA 3MHTA 3GXOA 1VIMA 3KJHA 4ACAA 2XNSA 1KHTA 3LP8A 4G1BA 4UVIA 4FE7A 2ZUWA 3S2GA 3T94A 4DLYA 1RS0A 1RD4A 5LPNA 2H18A 2O54A 5T6BA 5A62A 2NYVA 3Q7EA 3B5IA 4EPVA 2FF5A 4YNBA 1X1SA 3QNUA 3VHQA 4J3JA 2IELA 3OLQA 3LSTA 1GNPA 3EP5B 1WU8A 3N59A 1MQ8B 1HE8B 4KQ1A 4B74A 1DPFA 4I9UA 5BOVA 4C78A 4LVCA 1RM3A 3UJBA 4G5RA 2Y99A 1PO7A 3B9QA 3WJ1A 2HSJA 1PE0A 1W85A 1WJGA 4MS3B 5GAJA 5I6DA 4JT9A 3DCIA 3R5HA 3GCXA 4R3NA 2ZJ4A 1F8GA 1JP7A 1B6GA 3FH0A 3OJEA 1VG0B 1Q19A 2IF0A 5FL7A 4GKJB 1NU8A 3RC8A 4CKZA 2CUZA 2C98A 1ECLA 2D13A 4QGSA 2XUIA 4QXAA 1S2OA 3TRFA 2NT4A 1AMOA 3PQ5A 1V71A 4GLLA 3HU1A 4LF6B 1ODSA 4ZEXA 1LW6E 3KUUA 3QVMA 3ZCRA 5JADA 4ZD6A 1KC3A 2CMGA 5ALWA 2X2PA 4P93A 2UZ1A 2A7QA 4ZQHA 3MZ0A 4JBYA 4LYJA 1B76A 1E1CA 3GVCA 3FYHA 1UK7A 2P4UA 2ZBVA 4ZVQA 3ZWDA 1QS0A 2XGJA 2H4WA 2HJHA 1BA3A 2OLEA 3D6VA 3I1YA 3NOXA 4GPEA 4LECA 2RE8A 3D3NA 4DIOA 1XKLA 3PNSA 3QOWA 2VP6A 4JB2A 3UGJA 5JMWA 2Q3HA 1HRDA 2QXYA 3M3HA 3UJ7A 1B8UA 4ZV7A 3LCJA 3BDVA 4X44A 3PNMA 4JQZA 4IXWA 2YMPA 4MUFA 2YMLA 4EYEA 1AQNA 1QK4A 4KO2S 2PU5A 4KK3A 1VKRA 1A9PA 3R3SA 4FFBA 5JY6A 4Y67A 5HZHA 3BDAA 2PGOA 4ROTA 4TWJA 3IFSA 4F60A 4LJKA 2CMFA 1FDSA 1MOPA 1L7DA 1YASA 2FPGB 5KYXA 1JFTA 1FVXA 1DKLA 4X84A 5BNIA 5LYJF 2GILA 3LDUA 3TQHA 2GOYA 3U31A 2VI5A 2NN3C 1X80B 2MOKA 2VWQA 2IOFA 1XVUA 3BRCA 3I83A 3PFHA 3P96A 1D04A 4M8LA 4Q1EA 4C04A 3F5MA 3STWA 3S8EA 1ZZEA 3HY6A 3KYJB 5AI4A 2BFBB 1KSJA 3AZPA 3JQ8A 3NKVA 4Y9DA 1XRQA 3DUFB 4D3SA 2BMDA 3GEBA 3D4IA 3HEAA 4CKXA 4D4MA 3ASVA 3W6NA 1W30A 4JBHA 1I32A 1N7IA 3HU5A 1Z9BA 4H1HA 1G20B 1U5BA 2JGIA 3QEMB 3R7AA 1YA6A 5EUCA 2Y76A 4DCMA 3N8NA 4M37A 2P77A 3UPUA 1C5KA 4LXGA 1NTOA 4ZREA 3W5CA 5KYWA 4PCAA 4QFMA 4R2XA 3D4NA 5DB4A 3O8OB 4IIHA 4V38A 5JSKA 4S1WA 1PHPA 1W8DA 1XDDA 4JUIA 2CLOB 1RC1A 3ZJUA 4IEIA 5BSRA 3Q8LA 1ZQ9A 3I6BA 3D5QA 3L6CA 3QA3E 4ND8B 4WJLA 4OMCA 5CPFA 5J2UF 3DE2X 2EW2A 2PX3A 2D8MA 3N0XA 3TCKA 1U2TA 1TEHA 3NHUA 1PZGA 1GCUA 3E5NA 1GCIA 1YRQA 2HRBA 1CQJA 2HMTA 1YQGA 3GUZA 1DLJA 1OB2A 2GYVA 1F2TB 3Q6IA 2LVBA 1ISFA 3STVA 5JAMA 1VSVA 2G5GX 1ZC3A 4C4OA 1I80A 2C95A 1US8B 1YKFA 3C14C 3GDWA 7MDHA 4W9MC 3B2EA 4TL7A 2VEOA 3O8OA 1IHOA 1ZONA 3L7AA 3QI7A 1T1RA 5K3SA 3G8DA 1KYIA 5FUQA 1RRFA 2RIRA 2ZPAA 5G02A 3EXHB 3DE3X 1WY5A 4MZXA