3PZRA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Inhibitors with Selectivity against Members of a Homologous Enzyme Family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3pzrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pzrA01
3PQFA 2YDYA 3EYWA 4WLUA 4DRYA 1E5QA 1G0NA 3GGOA 3QY9A 3HFSA 4ND4A 4U7WA 5T57A 4G2NA 4M87A 3RFVA 1R37A 4FFRA 1LTHR 1VKOA 3SLKA 1DRUA 2FR8A 4MKZA 2O3UA 4OOEA 3OQBA 1GY8A 2VQ3A 3UF0A 5H81A 1BRMA 1RM0A 2PGJA 3NAQA 1M75A 2WDZA 4JX8A 1PGNA 5A5EA 1DPGA 4XQCA 4D46A 1RM3A 4RF5A 3T4EA 4I1IA 1WMBA 3PYMA 1MLDA 4K1LA 5HWSA 4PLGA 3DR3A 4YT8A 4K9DA 3D7LA 2GD1O 5FF9A 3WIDA 3P2OA 1VI2A 3AU8A 3D64A 1P1JA 3L0DA 2WMDA 3OIDA 4AJEA 4GKVA 5ES3A 1T2AA 5L95A 1F06A 1GEGA 5DOZA 1XCBA 3ONDA 2WWRA 2EV9A 2VRBA 4B3IA 3VPXA 2PZMA 2VNSA 3VOSA 4GBJA 2JD2A 1C0LA 2V6BA 3DXFA 4WOJA 1A7AA 3TFQA 3TZHA 2ZB4A 4P38A 4KWIA 3DMTC 3CXRA 2OORA 4UVIA 5JDIA 1KERA 1R0LA 4BNTA 2Y1OA 1KIFA 1L1FA 1PQUA 5COAA 1H0KA 4YPOA 1VSVA 5J9GA 3H9JA 5CDUA 3PGXA 1TT7A 4DA9A 1P1KA 1ZNQO 3HDYA 1V0JA 3LLVA 3C7CB 1EE9A 3FNEA 1TVEA 4IDDA 2ILTA 2C5EA 3NKLA 2EKLA 4E4YA 3RUCA 1N8KA 5JMPA 4E31A 1ISGA 1XLTA 4XR4A 3U62A 3TPCA 5DDIP 1B14A 2P2SA 3GEMA 4WCFA 4FQ8A 2X4GA 4DQUA 1ID1A 3F1LA 4ALNA 4R1TA 3WGOA 3RD5A 1R66A 1YOVB 5L7WA 4ZHSA 1ZH8A 1R12A 1XHLA 3R0IA 3QA9A 1V8BA 2EXXA 3IJRA 2VOJA 2GZ2A 4XQEA 2PZKA 1U2GA 1ZW1A 2DPHA 4ND3A 4A0SA 4G65A 2H1SA 5A03A 5K6AA 1QXSA 3IP3A 1OAAA 1VPDA 1ZVMA 1ZXBA 1O9BA 1HF3A 2DM6A 1K3TA 2OP1A 3VAZA 2GERA 1K6IA 3AFMA 2AQHA 1QYVA 4NDNE 1DFHA 1BXKA 1YDEA 3KM0A 2Y0EA 3BTUA 4PZDA 4J0EA 4RPHA 4NFYA 2ZATA 3EVNA 4UVEA 1CDOA 3S2EA 1UR5A 2B0JA 1XQ1A 1R4MA 4L73A 1EK6A 2WD7B 1PZEA 1WW8A 2Y68A 1WPQA 4TROA 4U6SA 3BIOA 5DZSA 1JU9A 1YDWA 5BNIA 3HSKA 2YZ7A 1W73A 1HDZA 1OI7A 4Y6PA 1YH3A 2Y1EA 1AN9A 4O6VA 3P7MA 4RF4A 1O8CA 1ORRA 1W0CA 3K92A 3WQSB 1B8UA 3KSZO 1PSDA 3JQ6A 3V5NA 1ULSA 4FJ1A 3ORFA 1NQTA 1DLIA 3BAZA 2GF2A 3JQ8B 2ZCVA 3GH3A 3DB2A 4CR6A 3GVPA 2W4QA 1F8FA 3WICA 3EAGA 3RBVA 3JSAA 1E3LA 1E6EA 3OHSX 2YJZA 4UAGA 4BNXA 3DZJA 2NU7A 4XYLA 4AJJA 5G0SA 5G4KA 2RH4A 2EKQA 3UICA 1I24A 5KNLA 4WCFC 3C1AA 2O3JA 1F0YA 2QIOA 3K5PA 4Y6RA 1HDCA 1ADBA 1X7HA 2X8LA 4MVJH 2EJVA 1BMDA 5L4SA 4NI5A 5T64A 2O23A 2DUWA 2BLLA 5COQA 1C1XB 1E6WA 5B4UA 4XGNA 4QXMA 1BW9A 1D8AA 1WZIA 3CPSA 2D3TA 4BMVA 3BMNB 4XRGA 2X9NA 4CMHA 1PGOA 1E3JA 1GEEA 5ICMA 3RCBA 5IJZA 5C37A 2HK7A 2VYNA 1FXSA 4YACA 2OFPA 1GYQA 4AFNA 3HHPA 4HKTA 3HDJA 2E48A 4ZQGA 4CV0A 1IL0A 1SC6A 3PDJA 1Q7CA 3UCFA 4QO7A 4DBZA 1IYZA 3T7CA 1EK5A 3PI7A 3ZU3A 2O50A 1Q7BA 4RQUA 3DZFA 1UZNA 3GZNA 3FPCA 4BNUA 5IF3A 4MVJG 3DOCA 3SC4A 1U8FO 2OL4A 1OC2A 3PQEA 4DTIA 1PGJA 1B3BA 2UUPA 1JTVA 3GY0A 4Z0TA 4B7XA 2YV2A 4JROA 4E2ZA 4QTZA 5JYDA 3JQAD 1PS8A 1QLJA 4NBTA 1J6UA 5A1TA 3RUAA 1BXGB 2CSUA 4E2WA 4WEOA 4BKOA 1JAXA 3D4OA 4J4HA 3ULKA 4W9NA 3I52A 5TIIA 1HYGA 2DTXA 3H9GA 3ETDA 4W4TA 5ITVA 4RLSA 3JQ7A 3EY4A 3INRA 5IN4A 1BG6A 3NTOA 4XGIA 3I4FA 4BO7A 4CM7A 5JO9A 3W8FA 4OOFA 4MIYA 1ZSVA 2PH3A 5JYAA 1J49A 4F46A 3W8DA 4CM1A 2VWQA 2FPGA 3FR8A 1NNUA 1FDWA 4RF3A 3A06A 2ZQZA 4CUJA 1GU7A 2GNAA 3KSUA 2OBYA 3BMNA 3KXDA 4UVGA 1CIVA 3KTDA 1B2LA 4J49A 5K0ZA 2UUOA 1DFGA 4OKNA 1HTBA 3E9QA 3KEQA 3GOHA 5GZ1A 3F46A 4CMGA 4DPMA 2ZYAA 3OSUA 4AJHA 4JBIA 5JCXA 1HWYA 1M66A 1MC5A 2FY8A 3VVBA 4J3FA 2X1HA 3E5MA 5JDCC 4LW8A 3WX0A 3I23A 3RJ9A 2B37A 1DIGA 1TA4A 1R0SA 2HAEA 1VL8A 3I3OA 4IMRA 4M49A 3S2GA 4OAQA 4EW6A 2VZ8A 1W4ZA 2LDXA 2IYOA 3VPGA 3VHRA 1Z82A 2HMSA 3WLFA 1HT0A 2GR9A 3GEGA 4S3MA 2WYUA 1NBOA 2C2XA 4D41A 1DSSG 1OMOA 1T2EA 2DT5A 1UDCA 4J2OA 2BGLA 3VH4A 4D3SA 4BNYA 4CR8A 4Z6KA 2X0JA 3BTVA 4BNVA 1TT5A 3W8EA 3OJ0A 4HADA 1NPTO 4AG3A 4LRTB 1DJQA 3DBVO 2DTEA 4QX6A 3AM5A 3AUSA 4XKJA 4XD2A 4NFHA 1A71A 1ZO8A 5IZCA 1WZEA 3IS3A 1OBFO 4WECA 4CMAA 1PX0A 3M1AA 3HG7A 4INAA 1GTMA 1HDYA 4IZIA 4XRRA 1MFPA 5DBIA 3Q9UA 4YT4A 1ZK4A 3UUWA 5ILGA 2Z95A 2CY0A 3ZWPA 5KJ6A 3RFXA 1Y5MA 1VC2A 5KJCA 3DMYA 2ZYGA 2QZ9A 4KZPA 5F21A 4YA6A 2EJWA 4BNZA 2QQ5A 2HSDA 1SOWA 3DHNA 1AHIA 5ADHA 3MJCA 3P2YA 1E1MA 5CG2A 1YOVA 3INGA 4BV8A 3B1JA 3X2EA 2B83A 4P22A 1NQ5A 2X5KO 1IPEA 3VH1A 4BNWA 5ER6A 1YONA 4LMPA 3FR7A 3ENKA 4QO8A 3U5TA 3VZRA 2GN4A 2YQ5A 2RCYA 4LSWA 2P68A 2HUNA 2P4QA 4JBGA 4G5HA 2BRUA 3KHUA 3DHYA 3UHAA 1QV6A 4MP6A 2ZJ1A 4C4OA 3R6DA 1U4OA 3QJ5A 1NQOA 1Y1PA 4JJIA 2CUKA 4E32A 3I83A 2H5LA 1ZJYA 2D5CA 2NSDA 3ROPA 2W98A 1I33A 1U7TA 1K5HA 1LLDA 4ID9A 1KETA 2ZB8A 2I6TA 4PLZA 1B8VA 1ISMA 2C07A 1EQ2A 3WG9A 3GN1A 1YB5A 3X2FA 4J4TA 3DOOA 5JLAA 1H2BA 4XYMA 4WKGA 2B4QA 2FSVA 1I2CA 4GX0A 2AQIA 1U9JA 3LU1A 1JWBB 4D43A 4E5KA 3RU9A 4DIFA 5L40A 2Q4BA 4JJFA 2NQ8A 3RUEA 2YQ4A 4PG4A 4AJ1A 5G0TA 2B36A 1E3SA 4BNLA 2QRKA 5U9CA 4IINA 2J5QA 5I8WA 4CLOB 1ADCA 4W9NC 1WNTA 2J3HA 3ZH2A 4JJGA 4PLPA 2PV7A 4EUFA 4CLRB 1DIBA 3V2UA 3LT0A 1O95A 3HN7A 3TOZA 3HB5X 3EDMA 1YQGA 4RZHA 3CKYA 1HL3A 4HP8A 4PLCA 4IDGA 1DFIA 4EEZA 2O3QA 4FBGA 4MOWA 3OP4A 4HFJA 2DQ4A 2WSBA 1VRWA 3WFIA 2HK8A 3GG2A 2D8AA 4RVSA 4QECA 3EZLA 3H3FA 4B7CA 5F1PA 3WWZA 1KS9A 3WFJA 2V7PA 5EMHA 1EE2A 2J5RA 1IZ0A 4I5DA 4UUNA 2O3SA 3ICPA 1TXGA 3PZRA 3RC9A 4BVAA 1VL0A 4OM8A 3VTFA 4M55A 4O5OA 1Q0HA 5JS6A 5TJ9A 3STHA 4PVDA 5DF1A 1FDSA 1VE9A 5JXWA 2O2SA 3F4BA 4F3YA 2YV1A 1J5PA 4E21A 2ZTMA 5B4VA 1QV7A 4CLOA 2EP7A 2HMVA 1JQBA 3PPIA 3PHGA 2PKQP 1JLLA 1LC3A 1PU2A 2GZ3A 2A4KA 2WD8A 4Z0PA 2VRCD 5TNXA 2X23A 3PWSA 2FMUA 4KUEA 4NBVA 3A14A 3RC1A 4IJVA 4BL5A 2CVZA 3AFNA 2NTNA 1U5AA 3BHJA 1K0UA 5A04A 4WNCA 3IQDB 1A9YA 1Z74A 4GLLA 5K9ZA 1H9AA 5C3MA 2NU6A 3H5NA 3I1JA 3OA2A 4A10A 1NFQA 3H65A 2P5YA 2ZB7A 2AA3A 1K6XA 3B6ZA 3L4SO 3WYCA 1FDTA 3GAFA 3AK4A 4R4JA 2VZ9A 4UULA 1ENOA 4KP7A 3SEFA 4TKLA 3IIEA 2VRCA 1I32A 2PD4A 3ITDA 4BB5A 3ZV3A 3E18A 1X0XA 5TS3A 4I5EA 4GX1A 4YR9A 4I5FA 5MDHA 2PKRA 3DOJA 1HYEA 5CFZA 3GDOA 1J4AA 3BTSA 1PL8A 2AW5A 4ZN6A 5JAIA 3GPDG 4YJGB 3PWKA 5EN4A 1LQUA 3O03A 4OH1A 1CQJA 3ZGYA 3R3SA 1Z6ZA 3G1UA 4MO2A 4J1SA 4XA8A 2PD3A 4MVJD 1E7QA 2O3RA 2AE2A 1UXHA 1UUFA 3RWBA 4FFMA 3TZQA 3IC5A 4RPLA 1EFKA 1XEAA 5I8ZA 4AJIA 1U3VA 3OJLA 4Y98A 3RSHA 2JAHA 3OMLA 5GZ6A 1N5DA 1B26A 3FBTA 4NJMA 4AJKA 4DLLA 2W2KB 1E5LA 1O94A 1WWKA 1JKJA 4D42A 5CDSA 4R54A 1MC4A 4CM4A 1O89A 4EUHA 4O1MA 4NHEA 5DN9A 4PG5A 4J7XA 1TEHA 1A9ZA 4FS3A 1A7KA 2Q49A 5L4LA 1DAOA 3FNFA 3ITKA 1LQTA 4ONEA 3RU7A 4W7IA 3Q3CA 4FJ0A 4N5MA 5TQVA 2BI7A 4N18A 4J9UE 1E0DA 2W90A 4DLAA 3C8MA 1O0SA 3VC7A 1HE5A 2I66A 5KKCA 2DBRA 4OQYA 1ONPA 4X54A 3A1NA 5U1PA 3K73O 4B4UA 3GVIA 3W6ZA 1U8XX 1EVJA 1VM6A 2OMEA 4R68A 4AJOA 3PZBA 4RDHA 5L45A 2QRLA 4MVJI 2A92A 2J3IA 3Q2KA 1R6DA 2HKIA 3W4IA 2BFPA 1PJ3A 3GT0A 4BGVA 4KUHA 1SCUA 4CPDA 3ZHYA 4OO3A 1YS4A 1E3IA 3E5RA 1SNYA 2WYWA 2XPCA 1GUYA 2FHSA 4S1VA 3VKVA 1A4IA 4P4LA 4U6QA 5DP2A 3ZW8A 4RORA 1P1FA 3GPIA 6LDHA 4AJPA 4XEHA 1ZMTA 1H2HA 2UV8A 4WLVA 3OJOA 4GX2A 2I65A 1JKFA 1XR3A 3QRWA 4YRAA 4L4SA 4IDBA 4FOOA 1YJQA 2PY6A 1H6AA 3DL2A 3TL3A 5IDWA 4YDRA 3TL2A 1QRRA 2BGKA 5LDGA 3PDUA 3SX2A 5EESA 3BMOA 4RJTA 2R00C 1VLLA 4YAEA 2Y99A 3ZV5A 1ZCJA 4XB2A 3L9WA 1BW9B 2P9GA 4XYEA 2O7SA 3TNLA 4MINA 4URFA 3KYDA 3PTZA 3ONFA 2GZ1A 5L51A 3GZ4A 3KYCA 3JQBC 4L9RA 5A3JA 4EYEA 2CDAA 3C7AA 3D5TA 4KDEA 2PNFA 4EJ0A 3C7DB 2OO5A 1WAMA 4IIUA 2X5JO 5KIAA 3RUIA 4J1TA 1I3NA 4E5MA 3FWNA 5CEFA 2GASA 5ILOA 3EVTA 3MOGA 2HMTA 3P19A 2EP5A 4BGIA 1ENYA 1MX3A 3ANLA 4RF2A 5KKAA 1JVSA 4WUVA 1IHXA 2NUAA 3RAJA 3ZWAA 5KTKA 3O8QA 3IJPA 4IIVA 2PZLA 3U49A 1I0ZA 1MB4A 3L4BA 4UVHA 3WSVA 3RFTA 4BO5A 1GCUA 3GAZA 1XU9A 5EQDA 1PGQA 3CINA 3B20A 5IDXA 1E1KA 3F3SA 2ET6A 4FFNA 3WYBA 3ZN2A 3AI3A 5EIOA 1GQQA 3ASVA 1VJ1A 1ZK3A 4XJSA 5KJFA 4A7PA 3MZ0A 1HSZA 2JFFA 1NM5A 4IQ0A 1X7DA 4J7UA 4NH4A 4YRBA 1M6HA 2ZQYA 1M76A 4B4WA 3N7UA 3RC7A 1DB3A 4M54A 3ZV6A 2Q22A 3HJAA 2V6MA 2Y1DA 4JQCA 2E49A 1DBVO 4O59O 1UH5A 1P77A 3D4NA 2FSSA 3AOGA 4NJMB 2CF6A 4BGEA 3DFZA 1DO8A 1CF2O 4PLFA 3ZI0A 4IY1A 2JAPA 4KUGA 3ZNOA 4TRNA 4CQLB 3G49A 3LC1O 4J1QA 4EJMA 4CLDA 5A06A 1AGNA 2FOIA 4GLOA 1U3WA 3U4CA 3GK3A 4H7PA 4B8WA 3COSA 3NUGA 3K2EA 4LN1A 4E12A 1MUUA 3ZWMA 4LRSB 1E92A 4TZTA 1A72A 3F4LA 2E37A 1UAYA 3QE3A 1AHHA 3KYBA 3H7AA 4QUKA 5G4KB 3RASA 5JC1A 3JD1A 1KEPA 5JYEA 4R3WA 1X1TA 3UN1A 5TLSA 4Z9FA 4TVOA 4LSMA 1YB4A 1XELA 3AU9A 5I7VA 5T6BA 2POQX 3GNTA 3VH2A 1ISHA 3JYLA 3WXBA 3JQ8A 4DIBA 1LNQA 3GEDA 4PLWA 4R1NA 1HSOA 4O0LA 1BVRA 3D3EA 4FPXA 4QFCA 1NXQA 3OQ1A 4DQXA 5JAZA 1T1SA 2NU9A 2FP4A 3GDGA 3DHEA 5JW6A 5ICSA 4OXYA 4TRRA 3ANMA 2NLOA 1EMDA 1T2DA 3U9LA 4OHUA 1NP3A 1DHRA 3LK7A 2GDZA 3DTYA 5GMOA 3B70A 4P8RA 2Q2QA 4BNHA 4U0KA 3RUDA 4KMSA 2P9EA 2OP0A 1HLPA 2AEJA 1N9GA 5G4LA 3AUUA 3DAFA 2DFVA 3QVSA 3AOEC 4OL9A 1FJHA 1H9BA 4ZQFA 4CM4B 2C7VA 2WTBA 3QIVA 2B5WA 2QYSA 4IS3A 3RBXA 3I4CA 7MDHA 4DPLA 1U1IA 3DEYX 4IUYA 4E0BA 5EQFA 1E3WB 2PKQO 4ZRMA 1Z73A 4KTTE 1ZZEA 3TZ6A 1G0OA 4DIOA 3V8BA 5B1YA 1PJ4A 2Z1NA 4KQWA 3VZPA 3ENNA 1KVSA 3KRTA 3M6IA 5L7TA 1YXMA 3WWYA 4BNMA 4B3JA 3WB9A 1BWSA 1C14A 1XU7A 2G5CA 4K28A 1LSOA 1DHTA 3ADOA 3QWIA 4I9UA 4TSKA 4U0JA 4YEDA 3CMCO 4R41A 3SVTA 4AL4A 3NV9A 2Q4EA 3GFGA 3DFUA 3FHLA 4YAIA 1GZ6A 1V6AA 1NTOA 1DC3A 3N58A 5ENDA 3OETA 1P1RA 3ST7A 4DQVA 3DBLB 1SEPA 3JD3A 5I9MA 2H63A 1KVTA 3I6QA 2IRWA 2GCGA 3NTQA 1EUDA 3AY3A 3GF4A 2OHXA 2GO1A 1GZ4A 2FPIA 1YKFA 3DTTA 4I5GA 2O3TA 1NVTA 2X5OA 4WE3A 4BO3A 1B16A 2HO5A 5B12A 1UDAA 3BMQA 3U4DA 4WK6A 1ZMOA 5H82A 3JYQA 2W2LD 2G1UA 4FD3A 5BSFA 4LVCA 1MG5A 3ZWWA 4R9RA 3E48A 2NQTA 2PFGA 2EG9A 4WLEA 2ZCUA 1BXZA 1EBFA 1NFRA 1R16A 4Q3CA 2IEBA 3JD4A 3WTCA 1KBZA 4J43A 5T73A 4WJZA 1NVGA 1OFGA 1I2BA 4J6FA 2B4TO 2B4RO 4OXNA 5G2OA 4PZEA 1F8GA 4CQMD 5I7SA 1I8TA 5T67A 1R4NA 1UP6A 3U09A 3TOXA 5HA5A 4GMGA 2AHRA 4YJDA 3TWOA 5JE8A 3HE3A 1F17A 4FW8A 1YGYA 4DYDA 3ZWBA 4BQRA 3PK0A 4B7UA 3WMXA 1P31A 4ZGWA 1OZAA 3MJTA 4PZCA 2X86A 1E7SA 1U3TA 5CEJA 4EGFA 1S6YA 2PH5A 3PRJA 4CL8A 4B4OA 1EVYA 3TZCA 4LCJA 2O7QA 3OQ6A 2NVUB 4DC1A 3D3WB 4NFSA 4HFMA 3JQFA 2HMUA 1X13A 1T24A 3AOEA 4Y9DA 3LZ6A 3PYLA 1PZFA 5TX7A 1C1DB 1PQPA 2PGLA 2RHCA 4UUPA 3AI2A 1LSSA 1XA0A 1PJCA 1YJ8A 3NJ8A 4CMKA 4IDEA 4GSKA 3CEAA 4ALJA 1H5QA 3I9NA 3T4XA 3VDQA 2NTVA 3LSYA 4RLHA 4E5YA 3D3WA 3DAGA 4IJUA 2YUTA 4G81A 2VNAA 1R0KA 1S7CA 3KLPX 4ALKA 5AOVA 1EZ4A 5I9NA 1P1IA 1IOLA 2VYND 1ZKMA 3H9UA 4FC7A 4RZIA 1F12A 5JY6A 1GCOA 1UZMA 4PCVA 4PLHA 3OEWA 4C7KA 3ZHBA 3H5RA 1R4NB 1T4BA 4FFPA 1YVEI 1AE1A 3H2ZA 1V9LA 3GVCA 1RYDA 4GVLA 3W4JA 4WLNA 3MOIA 1PS0A 4PVCA 5JAMA 4LVUA 5THKA 1NPDA 1N9GB 4B8ZA 5F1OA 2VHYA 1G6KA 1LRJA 3HN2A 4MKXA 1UXKA 1T2CA 1U3UA 1SZJG 4D0SA 2ZYDA 4YQYA 2O48X 2Y0DA 4BKRA 4EUEA 1HDXA 1Y8QB 2HJRA 3GVHA 3I5MA 5BT9A 9LDBA 4YXFA 3L6OO 2ZTUA 4YT2A 4I9NA 1EVIA 1LJ8A 1ZSNA 3FTPA 3QWFA 1GZ3A 1YO6A 4DPKA 1X0VA 2WJPA 1HRDA 2ZKLA 4RVGA 2Q2VA 4Z3KA 5EL0A 1HE2A 3G79A 4JK3A 3UFXA 4XIYA 1UAGA 3RKUA 3EW7A 4Y67A 4Q39A 1C3VA 1NWHA 2VN8A 3F9IA 3AY7A 4BO4A 5FEUA 3VDRA 2VWHA 3DBLA 5AQ1A 4E3ZA 2TMGA 2Y1CA 1PGPA 4XB1A 4L4XA 2VUTA 1B0AA 2F1KA 4UREA 1IHYA 5U4QA 5JYFA 1WP4A 3JD2A 3H8VA 3K96A 4BNNA 1QYCA 5CPFA 2H9IA 5TRTA 2GUGA 4ZQEA 1RJWA 1I3MA 1SO8A 3UVEA 1U28A 5IAAA 1XQ6A 1AXEA 2BI8A 3L07A 2G17A 3R1IA 2Q99A 4QEDA 3ZW9A 2GYYA 4DYVA 2GN8A 1QYWA 2EIHA 1T1RA 4BNJA 2Y1FA 3BMCB 1UXGA 2W2LA 3WJ7A 4FC6A 5TGDA 5G0WA 4UEKA 4XDYA 4GI2A 4MP3A 4IQGA 4IXWA 5A9SB 1GL3A 1TB4A 4OKIA 1HE4A 3GA0A 2YY7A 4BMNA 4ND5A 4A2CA 3ICCA 1LRLA 1N7HA 1DIHA 2JL1A 4OJNA 3G17A 3ZU5A 3I9LA 3K8ZA 4RPGA 3TZKA 2D2IA 4DLBA 3HB4X 1MP0A 3VPHA 2C7GA 3FSRA 1H6CA 2ZTVA 2BGMA 1T4DA 2VT2A 2NWQA 1EVZA 2TMDA 3NGLA 2HJSA 3HNPA 1P9LA 4H15A 4ESOA 3O9ZA 1JKIA 1BTOA 3I6IA 4ZA2A 4XR9A 4YAGA 4U8GA 3VVCA 5DCWA 1EDOA 2XOXA 2EGHA 3F47A 1UZLA 3DC2A 4GL4A 2X58A 3AI1A 3PYXA 3ZWNA 2AG5A 4M86A 2GN9A 4L4RA 1PJLA 4R3NA 4NK4A 4RPJA 4WGGA 2NU8A 3I9MA 5HM8A 3TJRA 3KYDB 1M67A 1WDKA 1OOEA 3PLRA 1PR3A 4K6CA 3PP8A 2Q1SA 1YWGO 1XYGA 1QP8A 4D0RA 2C82A 1KY4A 3TN7A 4D3FA 1NWCA 1P1HA 4FGSA 2DKNA 1LLUA 4AJ2A 4B3HA 1SB8A 3MJ4A 4NIMA 2C2YA 2ZIZA 3GN2A 3PQDA 2XXBA 4NG5A 4CMEA 3GHHA 1NPYA 4HFNA 2RHRA 3OJFA 4H3VA 3S2FA 3S2IA 4MVJE 1C1XA 2VOEA 1XSEA 2UDPA 3JQ7B 1ZBQA 3OIFA 1BSVA 4WNIA 4NBRA 4A26A 3OICA 4Q3EA 3FCOA 4CM5A 1C0IA 5BSHA 2Q46A 5CPBA 1Y5RA 4ZJUA 3CSDA 4GWKA 2HRBA 3VZSA 4YWJA 3EZYA 3ZNQA 3QWAA 4M8SA 1P74A 4U5QA 3H2SA 1YE3A 3FI9A 4A27A 2O4CA 3L6DA 3MJVA 1L7DA 4Z0HO 1VJTA 3I9JA 3NEPX 4NNJA 3DMTA 3NRCA 3NDIA 4ZQHA 3IL2A 4P4NA 3G0OA 3QVTA 3S55A 4A5OA 1GDHA 3GNSA 5JAQA 1NQAO 2DBQA 4Q3AA 4NU5A 1Z75A 3GC6A 3GG9A 4CM8B 3DO5A 2CDBA 2OBNA 3KYCB 4YQZA 5JDCA 3WLEA 4CLHA 1KC1A 2HMWA 3WGIA 4MDHA 1X15A 2PK3A 3D4PA 5HRUA 1MGOA 4WASA 4M1QA 3VKUA 4J7CA 5JBIA 4YT5A 3U4HA 2X6TA 2EGGA 5AXAA 3KETA 1D1TA 1YL5A 3OA0A 5A9SA 5FYDA 4PIVA 3MWEB 3P5SA 4IJKA 2HCTA 5T8KA 4E33A 2Y93A 1ZEMA 4YJFB 2P91A 4FSHA 4ALMA 4DUPA 3CZMA 1BDMA 4IZHA 5B37A 2C0CA 5FFFA 4BV9A 2NTJA 1YQDA 2Y0CA 1OC4A 1V3UA 3AWDA 3NGXA 4J0FA 3WBFA 4MVJM 3Q0EA 4HFRA 5BQFA 2DFDA 1B15A 3FPLA 4OMUA 4BNKA 3LLSA 2V6GA 3GUYA 2X0RA 3ROKA 1CYDA 4MIOA 3WOHA 2OXIA 1E7YA 4L8VA 3DZHA 4TQGA 3E1KA 3I9OA 1Z7BA 3ZU2A 1FK8A 4YJGA 1I30A 4EBFA 2LDBA 3IAHA 2NM0A 3JQ9C 4TVBA 4BS9A 1CWUA 1RPNA 1U5CA 4FFLA 4FJ2A 4J1NA 3BHIA 4B79A 2CVQA 5DCYA 3F5SA 4RVHA 1DRVA 3IUPA 2WYVA 3OIGA 4JP3A 3JV7A 1GD1O 2I3GA 2X0NA 2C59A 1LDYA 3LT1A 3QSGA 1ONOA 1LA2A 3RC2A 2EWMA 1RYEA 2VZ0A 4BKUA 3K9QO 3F6YA 1A4UA 1Q0LA 5F1KA 2EW8A 5DOVA 1JN0A 3F1KA 2AEFA 2YHIA 3C24A 1O5IA 4GMFA 4E5NA 1FDUA 5KCZA 1ZFNA 2QHXA 4ND1A 1DC4A 1E7RA 1EDZA 2RBEA 2VHVA 3CIFA 5CHEA 2V65A 1JW9B 4CM9D 1JVBA 2AE1A 5CP8A 1KVUA 4N5NA 3C1OA 5DULA 4AJNA 4R01A 1R4MB 4K26A 4XYBA 1HKUA 3WSWA 1CERA 3CUKA 4TWRA 4GSLA 3IKTA 1W8DA 2W2KA 5KVQA 2GPTA 4GWGA 3CTMA 1KEUA 2HK9A 3V2HA 2BFAA 2VUSA 2YFHA 1CRWG 1ADFA 4HBGA 2YFQA 2O4UX 2CD9A 4I9HA 1NHWA 1LI4A 5MGBA 4RV9A 4IXTA 3HUDA 1YQXA 2WEKA 3DZKA 3INTA 3W4KA 4H16A 3LVFO 3OBBA 4WLFA 2QX7A 3LDHA 4JNKA 1E6UA 1H94A 3LC7O 2IODA 1Y9AA 2VHXA 4EJ6A 1UDBA 4E6PA 4M89A 5CAEA 3PIIA 1ONNA 4CLEA 4CUKA 4BHTA 5GZ3A 4MKRA 4KQXA 1IPFA 1GQ2A 3FWZA 1LSUA 4YJFA 3NT4A 4MVJA 3WGHA 3WDSA 3QW2A 4R1SA 4RL6A 2DUUA 4KTVE 4EI2A 2HLPA 1B8PA 1ULUA 4FGWA 1I10A 5CG1A 4Y6SA 3H4VA 3D1LA 1B7GO 2FRDA 4PGFA 3GRPA 1PJSA 4HWKA 1ISIA 2P4HX 2V6FA 3M2TA 3JQEA 3K31A 3IDSA 4ZVVA 5L7YA 5LC1A 3AUTA 1ENZA 5F3RA 4DGSA 4E5PA 3I9KA 3LT4A 1IZ9A 4DWVA 1FDVA 3O4RA 3ROQA 2PZJA 5G0UA 3ZCXA 2BD0A 4FFOA 3WBBA 3NTRA 5F5LA 1AUPA 4GKBA 3RUHA 1NASA 4CMIA 5FWNA 1Y8RA 4JBHA 5JO0A 4GX5A 5C7IO 5AYVA 1E1NA 2RAFA 4HXYA 2PR2A 4IGEA 3FN4A 1NVMB 3JD0A 4ZRNA 3WNVA 3HZZA 1PJTA 1H93A 4MPDA 5KVVA 2Q1UA 1DIAA 3BMQB 5ITWA 5C7OO 1F14A 2J3JA 5A3VA 1ML3A 1KY5A 5DBFA 3RKRA 3DBRB 2EHDA 1CQIA 1DC5A 1HE3A 3H6KA 4UUOA 4JP2A 4CM6A 5HBRA 5B4TA 1GV0A 2JFGA 2IXBA 4ALLA 5TF4A 4NMHA 3Q11A 4NK5A 4R5MA 5M6DA 5COBA 3QP9A 4NPCA 4NJOA 5DP1A 1HDRA 1XIVA 5BNFA 3DBHB 3UOGA 4BIIA 4BKPA 4R16A 1A5ZA 3LF1A 4CMJA 3QQPA 3JQ9A 3GHYA 4FN4A 2J5KA 4RDIA 2Q1WA 3H5AA 5JCJA 4LCEA 3HADA 3MCVA 1KYQA 1UP4A 1Y9EA 1LDGA 3U4IA 3GR6A 5I7EA 3ZNPA 3ONEA 4D3DA 3ON5A 3HDHA 2OGUA 4MP8A 3QV1A 5L9AA 1RM5A 1LUAA 4PRKA 1T26A 4CQMA 2D1YA 3JYOA 4IDFA 4XCVA 3RUFA 3MTJA 3E82A 3EC7A 1IUKA 3A4VA 4OXKA 3O26A 3RJ5A 4EEXA 2Y66A 1GUFA 3CH6A 4GH5A 1N2SA 4Q3NA 3RROA 3ZHZA 4PN3A 3DZIA 3LC2O 1EBUA 4NZ9A 4BO1A 3V1YA 4O63O 3SBOA 1KVRA 5IG2A 4XJTA 1TI7A 1ZXLA 4CV3A 4D45A 5JCJD 4RVUA 1LDEA 5CDGA 3GMSA 1XKQA 4IMPA 1EQUA 1Y81A 1HXHA 2OZPA 1X14A 1DAPA 2E4AA 3OF2A 1L7EA 1A27A 1KVQA 2SCUA 2VUUA 3BZUA 3ADPA 4L76A 4YAJA 1QYDA 4DC0A 5EINA 4D7AA 3HWRA 1NHGA 3ZWVA 3TQHA 3Q6IA 1DOHA 1HDGO 1PIWA 1MXFA 4BGUA 2ZJ0A 4EZBA 5IDYA 2J6IA 4FDAA 4QQRA 5LCXA 2OOSA 3VZQA 2NV6A 2GN6A 1O6ZA 1YBVA 5G0VA 3CE6A 2FPPA 4GQAA 2Y67A 1IB6A 2DVMA 1ADGA 4K6FA 3HQ4O 3S1LA 1EUZA 2D4AA 3JYPA 4YAKA 1I2ZA 2HDHA 3V1UA 3FNGA 1JWAB 1NFFA 2VT3A 3FF4A 5DT9A 4NBWA 1FMCA 5H83A 5ENVA 4BUCA 5A9RA 3B1FA 1QYXA 3KEOA 5AXBA 5GY7A 2IZ0A 3Q9NA 3ASUA 1NAIA 3QWBA 1IE3A 3PLNA 4GGOA 2VWGA 3KV3O 3NT2A 3PHHA 3SC6A 4F6LA 2P9CA 4BMSA 1I3LA 1I36A 1HDOA 4GGPA 2VYVA 1U2DA 5AXDA 1LX6A 3PGJA 4ALIA 4BNGA 1T2FA 3UH1A 2JHFA 2A35A 4QT0A 1QKIA 4FR5A 3DBRA 3EMKA 3U0BA 3JQFC 5IN5A 2AEMA 4BO2A 5JC8A 4FOSA 1Y7TA 4TKMA 1TT5B 1WMAA 1ARZA 4R5HA 2PWZA 4XQ9A 4DREA 2YHUA 1P3DA 2Q1TA 3AM4A 2ZK7A 3QVOA 1E77A 4OSOA 4RCVA 5J23A 4HUJA 4J9VA 4L75A 5T8KC 3JYNA 4BO6A 4CMIB 2UAGA 4B4VA 2A94A 2BKAA 4PG8A 2VHZA 3BYZA 3JQCA 4WCDA 4W6ZA 2YV3A 1RWBA 2OUIA 3S8MA 3R3JA 3EGOA 3D0OA 3GZNB 4N54A 4CODB 1CEQA 2J3KA 4ROSA 5ER9A 1WDLA 2PA3A 4XZ3A 4CL3A 1GFSA 1KEWA 1LEHA 2C29D 3OH8A 2NVBA 3VH3A 4JGBA 9LDTA 2FZEA 3DZGA 2GLXA 5IFLA 1LC0A 5K6AC 1LLQA 4GPD1 2G76A 4XX0A 3TRIA 1NX6A 2PD6A 5EPOA 3ZZNA 1Z45A 1ZUD1 4F45A 3D5QA 3PHIA 1EUCA 1T25A 3MWDB 3DBHA 3AW9A 3ETEA 3JCZA 3WNQA 1D4FA 4YCAA 5TT1A 3PJFA 4TMFA 4BKQA 1PEDA 3IKVA 3ZWYA 2YW9A 3Q2IA 4P4GA 3QVWA 1U4SA 1ZEJA 5JPIA 1DEHA 2XXJA 2D59A 2RH8A 4CV2A 4DVJA 3JQAB 2IEDA 2JCXA 2PGDA 3OFSA 3KOUA 2Z5LA 2A9FA 3HDQA 1YBMA 4PG7A 2EEZA 4XWYA 2JHGA 1CJCA 2Z1MA 4WEQA 4LGVA 1V3VA 4OSPA 1BXGA 1Q2XA 3KZVA 3VTZA 1PQWA 4XIJA 3WQRA 3IUSA 8LDHA 3E9NA 3PEFA 4PG6A 3E03A 1GPJA 1Y8RB 4WLOA 2GGSA 4DMMA 1NYTA 5A9TA 1GUZA 3ZWOA 4MVJF 1LXCA 4YTEA 1SBYA 3GGGA 1GYPA 5KVCA 4OYRA 1B3RA 1VJ0A 2EW2A 4CR7A 1V35A 1GYRA 2HQ1A 3EHEA 4QSMA 4YB8A 4HNHA 4DBVO 3M1LA 2DBZA 3PJDA 4FIZA 3WJAA 4E2XA 3MEQA 2YHIB 2NNLD 3PJGA 3ZDFA 1D1SA 3QVXA 4OGWA 2CVOA 4WPGA 3H3JA 4I8XA 5KOIA 2DTDA 3NDJA 1AXGA 5DCUA 2WE7A 4NR0A 2XAAA 2I99A 3K6JA 4L74A 1NR1A 2FR1A 8ADHA 4R1UA 2IXAA 1YB1A 1XGKA 4Z9XA 4CJXA 1JDJA 3NDRA 4XQGA 3ZU4A 4AVYA 1LRKA 3NJ4A 6ADHA 1UXJA 4Z3DA 2AQKA 1P45A 1JA9A 2DLDA 3SXPA 2PTGA 3H9QA 2I9PA 3MJEA 3WMWA 5KJ1A 2DBVO 1PTJA 3AUAA 1R15A 1HZZA 1J0XO 2YYYA 2Q50A 5KWEA 3JQGA 1PL6A 3GMDA 3L77A 3JTMA 1VKNA 4RQTA 5IZ4A 4J2HA 4WCFB 2D0IA 4CV1A 5IXYA 4XGKA 3WQQA 3L4BC 2IYPA 1E3WA 3PJEA 2BHLA 1JAYA 4BB6A 3KSDO 2X9GA 2JD0A 1NAHA 1H6DA 4PLTA 3PFWO 5DNAA 1GAEO 1WLYA 4GVXA 2QG4A 1IULA 1DRWA 2ZTLA 4R9SA 4J90A 5JDIC 3Q1LA 1XDWA 2EKPA 4HV4A 3DONA 1DDOA 4ILKA 4CM8A 4JXKA 2I3AA 2X9VA 2YDXA 2D5AA 4A73A 1GQYA 2VCYA 3KUXA 1BDBA 2AMFA 2P5UA 3RBZA 2JCYA 4MIEA 2C54A 4JCOA 3WGYA 4ZQBA 2XF8A 2WD7A 5F5NA 3JQBA 4Q3BA 3TF5A 4W82A 1PJBA 2EF1A 4FB5A 2QW8A 1GR0A 1YL7A 1YL6A 4UEJA 3BXXA 3ZWCA 1RM4A 2BELA 5L53A 1ZK1A 2C20A 2VTEA 1QR6A 2CF5A 3OJEA 2AXQA 4YVFA 3TFOA 2GRAA 3B1KA 3JQGB 3CZRA 4NQZA 3WTBA 5KVSA 5I7FA 4IS2A 4TRMA 3BTOA 4YRDA 3JQAA 1N1EA 1KOLA 1PS9A 4CM3A 2B35A 3AJRA 3A9WA 1HLDA 1SEVA 3QLJA 3WGTA 3GFBA 1BGVA 4CQLA 1MG0A 4IDAA 5AVOA 2Y05A 3BA1A 1SB9A 4IM7A 5I9LA 3PHLA 1MA0A 4E30A 2DPGA 1DJNA 4L0QA 3IP1A 3NYWA 1RKXA 3PWZA 2R00A 1SAYA 3W1VA 5TJHA 2JKVA 1LLCA 3PVZA 2C5AA 2IZ1A 1ZK2A 3GGPA 2G82A 1SMKA 3M2PA 2Y1GA 3H9EO 5FI5A 4IBOA 1DIRA 3AM3A 4CM9A 1WVGA 3ETGA 3U3XA 3DWFA 5TC4A 4CLRA 3FRJA 1D3AA 2VWPA 5JMWA 5JY1A 2G0TA 2X22A 2HU2A 5T5QA 1E7MA 1V3TA 3BHMA 4ZU3A 2J8ZA 1SPXA 3KO8A 1QMGA 1G1AA 3FD8A 4CMEC 4LK3A 4WOKA 1HZJA 1H6BA 3C1TA 1P44A 4BO8A 2IZZA 3QHAA 1D7OA 3KVOA 3LT2A 3O8QB 2X7HA 4IGFA 1KC3A 4DMLA 4BO0A 1UXIA 4D79A 1X1EA 4IJWA 4IQ8A 5BSEA 2I67A 3ZWXA 1WXDA 4ND2A 4E2YA 3E9MA 3WYEA 4BNFA 1DXYA 3KLMX 1QLHA 3E8XA 1EEHA 4OIMA 3PHJA 5IDQA 1N7GA 3UGKA 3DDNA 1EFLA 2F00A 1M6WA 2R6JA 3VPSA 1LDBA 5L4NA 1P0CA 2QRJA 1PZGA 3WGGA 1VSUA 1N92A 2AQ8A 5CDYA 2X0IA 3WS7A 4RPKA 2BH9A 2CFCA 4NU6A 3WIEA 4AICA 2EERA 3GLQA 4CUZA 1PL7A 3F5QA 1SOVA 5HTOA 3GVXA 2Q45A 2FN7A 1IY8A 1Q7GA 1Q0QA 4EDFA 1YBAA 3RIHA 4AJ4A 3BMOB 2VHWA 4DL9A 3SLGA 2E82A 2H6EA 4N5LA 4KOAA 3BMCA 1YRLA 4XYGA 3GRKA 4ZICA 1LDMA 4PRLA 3L9XA 1KEVA 2HRZA 3MJSA 4FCCA 3T7EA 3IMFA 3DAPA 4BOYA 2CZCA 2FZWA 4A03A 2B5VA 4YJHB 1P33A 3FBGA 2Q3EA 5A02A 3UCXA 4EITA 3EUWA 1GV1A 3FTNA 5A4DA 3HFGA 2GSDA 3C3XA 1PWZA 2NVWA 4R51A 3UXYA 4PLVA 3MTGA 1MFZA 1ENPA 3PFFA 3KBOA 5TSDA 2QYTA 3UCEA 3ZHXA 5JFOA 2VYVD 1E3EA 4C7JA 4N7RA 1UJMA 4J4BA 3CMMA 1X7GA 4YBZA 3ROMA 1HYHA 2FWMX 3VPFA 4MVJP 3KB6A 3UKOA 3K2BA 4Q9NA 2B69A 1HETA 4J16A 3WGQA 2BFMA 2NADA 3GUCA 1U7HA 1MXHA 1XWFA 4UVDA 3RQSA 3TDKA 3UW3A 1ISJA 2JJYA 1Q1NA 1ZK0A 3PXXA 3TSCA 1LSJA 1LBEA 4CLXA 1Y8QA 4IDCA 3GQVA 3LQFA 5A05A 2O2YA 3SJ7A 4CMBA 5CDTA 2DAPA 4JLWA 1C0KA 5HS4A 2UVDA 1N1GA 1PR9A 1W6UA 3LF2A 3OEYA 1BVUA 4OQZA 4HNGA 4ZD6A 5AXCA 1GADO 4BO9A 5CEEA 4PLYA 1I3KA 1MV8A 4XDZA 2CDCA 3OECA 2CMDA 2AG8A 5JNLA 5EERA 2ZB3A 4RVFA 5FI3A 1P0FA 1K6JA 1QSGA 2BFOA 4UEOA 4J91A 1QORA 2VTDA 3EK2A 3DZBA 1TLTA 2IDZA 4KDFA 4HY3A 4AJLA 3LYLA 3IOYA 3UAGA 1E1LA 4F6CA 5LDHA 2JD1A 1QG6A 4R69A 3WGZA 5C5IA 4JIGA 4ITUA 3ZV4A 1K2WA 5BR7A 3W6UA 2RIRA 3GDFA 4QFDA 3N74A 5BNTA 4Z9YA 1Y6JA 3L6EA 1LDNA 3G1TA 1I01A 1K89A 4PFJA 1PWXA 4W7HA 3AY6A 1VL6A 1BHSA 4UUMA 5TT0A 2Q2WA 3DQPA 4NBUA 1CETA 4D44A 1C1DA 3JQDA 1PJQA 1E7WA 1Z7EA 2WE8A 3WR5A 4YYZA 3PIDA 2WM3A 3FNHA 4CMCA 1FF9A 1WDMA 3A28A 5L3ZA 1ZSYA 1NR7A 4Q3DA 2NVUA 2BMAA 4MJLA 1HEUA 1XG5A 2I5PO 2E6UX 4TZKA 5BSGA 3V2GA 4RVDA 2QZZA 3E6AA 4IPTA 1DC6A 3ANNA 4JN6B 2DC1A 1DLJA 2JCVA 4BNIA 4HX5A 2R2GA 4LISA 3QWHA 1PJ2A 2UYYA 1C0PA 4RGBA 2DU8A 5C7LO 2BF7A 1PZHA 1LU9A 4I08A 3SJUA 4KWHA 5THQA 3C85A 2W8ZA 4II3A 5IZCC 3O38A 5JSFA 4TRJA 1I5RA 3GNQA 3ZNNA 4II2A 3V1TC 2JFHA 5EJ2A 3ABIA 7ADHA 1ISFA 1M2WA 3K30A 4CQMB 5DBGA 3NT5A 5IXSA 2I76A 2CNBA 4LMRA 1UP7A 4RO0A 4GAEA 2PLAA 4W99A 2NACA 3OM9A 5HS6A 5A5FA 3RI3A 1ZJZA 4E13A 1ZIDA 1GPDG 3G3EA 2IE0A 4YJHA 3RVDA 3NX4A 4BQPA 4Y8VA 5KJEA 4DXHA 2FR0A
chains in the Genus database with same CATH superfamily
3PQFA 3EYWA 1EUDB 1U98A 4WLUA 5C5CA 4G9EA 4MS1A 2VDWA 3QY9A 1HL7A 2ZW9A 2W6OA 2HSGA 4ZPXA 2A1UB 3USZA 1P7ZA 3CX3A 2DY1A 4HNAA 2ORIA 3SICE 3VU1A 4A0QA 2O3UA 4MKZA 1FNBA 4TGLA 3OQBA 4TUYA 1VDZA 1RM0A 1UFKA 2BMVA 1QE0A 1BH2A 4ZQIA 5AJXA 1CQIB 1JFVA 3Q3GE 4XQCA 1JR3A 3FZEA 4GYWA 4X24A 1J07A 1XDGA 2Z4TA 2W2NA 3Q1KA 3GWZA 3TQOA 2N3ZA 3DR3A 2WT8A 1T2NA 5THXA 3MWYW 2AR0A 4PZLA 3A6GA 2HLNA 4PAOA 3QEOA 5B2ZA 3WIDA 1LGYA 3P2OA 1VI2A 1P1JA 2X0DA 2IBTA 4GE0A 2PMKA 3K0EA 3MILA 2A3RA 3G89A 3AONB 3O4GA 4KVGA 4M6WA 1E8MA 4NCNA 5IJWA 2GKGA 4JUDX 1TCBA 4KHZA 1Z06A 5CJJA 3VX4A 1YS9A 4JAVC 1KI7A 2BGRA 3CLUD 1NRXA 3MXOA 1A88A 1V26A 1YHYA 4UMDA 4MKIA 1MOQA 3VPXA 3TTXA 4O2AB 3HUFA 2JD2A 1FP1D 3HY6A 1PEKE 3CNBA 2QN7A 1A7AA 3OF5A 2PRYA 2ZB4A 4H6XA 4PHCA 1UEXC 2Y4OA 2XNDD 2Y71A 2ODEA 3EBPA 4LXYA 4ZO8A 1JDVA 2UVPA 3R3WA 1KIFA 1OWPA 2V54A 1L1FA 5FOQA 3HCNA 2IS6A 5JJLA 2H65A 4H0FA 3SZOA 4A82A 1VRCA 3H9JA 4IDOA 4OFZA 2Q3MA 1TT7A 3T6KA 1ZNQO 2BUAA 3LP5A 1V0JA 4UM7A 3CUTA 2AI1A 3MYYA 1EHYA 5M5BA 4O2BB 1U0RA 1TVEA 3F8TA 3AUXA 3RYFB 4EHAA 5CXQA 2C5EA 1E2NA 2EKLA 3NKLA 2HSZA 4Z1MD 3EQ7A 5MN5A 2PFKA 1EVKA 1LBTA 4ZTUB 3TPCA 3ACDA 1BD3A 1HFKA 2WHEA 3H5VA 2P2SA 4UE2A 1QZZA 1P5JA 3GJ4A 4DQUA 4ZYLA 3KFLA 3ZUPA 2JC3A 3GLHE 4DLWA 4ZN6A 3FPGA 1X70A 3AJ8A 1QVWA 3P9ZA 3D1JA 3NCHA 5FUVA 5FPYA 3RD5A 1BGXT 3IURA 1HMYA 1ZH8A 1R12A 3CRMA 3R0IA 5EZYA 1J2TA 2R7NA 3IJRA 5AKKA 2GZ2A 4XQEA 1SC3A 1UDRA 5ENZA 4ZVUA 1NI4B 3M1YA 4A0SA 3C74A 1T6XA 5IF9A 2H1SA 4YFVA 1U8EA 4TLEA 5K6AA 1QXSA 3F8SA 1OAAA 5BW6B 5DN6D 4LE2A 4WRRA 2J0UB 4R1QA 1HF3A 3D6FA 4U2CA 1K6IA 1MOSA 3SYRA 1M1YB 3D7RA 2V7GA 1YB2A 3QXGA 1EFRA 2HBQA 1WB6A 3HA5A 4RY8A 4X8MA 3KM0A 1ABEA 2O0MA 2Y0EA 4HDOB 4RPHA 5E7JA 4YUAA 3MGGA 3R7SA 1JQAA 3QA3E 3QPBA 4IOMA 4UVEA 1XQ1A 3RK1A 1VECA 4ZT5A 3WE7A 3TUTA 3DEJA 4KO8A 4V0QA 1G8SA 1V96A 3C6ZA 1YDWA 3NHRA 3IB3A 1AUQA 4J0KA 4LPSA 4JFRA 1H66A 2YWXA 4EKGA 3H17A 4JLSA 1ZA1A 3IT0A 1W73A 1HDZA 3LHIA 4IVRA 1GPYA 1WG8A 1OWLA 3RARA 1U9YA 1ZCAA 3DZ7B 1IJFA 5IAKA 3R7FA 3GLFB 1AN9A 2FETA 4RF4A 3QVJA 3AEUA 5A4JA 1LJUA 1FFBA 2QRMA 2GYVA 1B8UA 3EVDA 3KSZO 2O07A 1K98A 1PSDA 2C61A 3K92A 3V5NA 1ULSA 3OO0A 4FFBA 4G1BA 3VR5H 4B6RA 2P9JA 4CRWB 5IMSA 2A14A 3C3MA 2XGJA 3M5DA 4MUJA 1SUDA 4OAPA 2W2XA 1KKUA 1RYNA 3O7MA 3ZXYA 1EIWA 1CX9B 2ZCVA 3M70A 3E81A 4KIGA 5LWHA 1F6WA 3GH3A 2D5IA 3Q3IA 3B7WA 5FBQB 2GBCA 4NOMA 4TL7A 5DEIA 3D2LA 2CBGA 3CVJA 3SBEA 3WICA 3RBVA 1Z22A 1LPOA 4BB9A 2YJZA 4L57A 5FOSA 3RGGA 4BGDA 4XYLA 3QVVA 4O4IF 2R44A 4RHFA 2R25B 3FETA 5AHKA 4AKIA 5AIBA 5IHXA 2R4QA 2IYAA 3U3ZA 3FPHA 2D1TA 2O3JA 3K5PA 4Y6RA 4J0HA 1DUSA 2X8LA 3DTVD 1AKEA 1LKZA 1ZD3A 2BH2A 3M9XA 1QQAA 2O23A 2DUWA 4MXDA 4U7TB 1TVMA 1C1XB 1WHSA 1K92A 2IHUA 2XCIA 4IICA 1WY5A 3ZKWA 4FUQA 1WTAA 1Q21A 4GSYA 1XN4A 3BMNB 4IHJF 5A4FS 2XBUA 4FNOA 4D80A 4C6SA 4HNAB 1G1MA 1E3JA 1FE8A 2ZIAA 5IJZA 3ZXUB 2CCGA 1RI5A 3O2JA 4MROA 1Y6FA 4MRVA 2HK7A 121PA 4RLQA 1UBLS 2Z08A 2XMBA 1AQNA 1ZVVA 2IF0A 1GYQA 2OFPA 5BWBA 2Z2XA 1JZQA 1IM8A 1RVDA 4G36A 3HDJA 2E48A 1RHQA 3KZCA 4XUDA 2JBAA 1I94B 4BAZA 4LY0A 4RQAA 4EI8A 2ZIXB 4KYTA 2MR6A 5JZVA 4CV0A 4B35A 5KDOA 3K6SB 1Q7CA 1II8B 1KJNA 2NYAA 4QO7A 4QICA 1NN1A 1PDVA 5JRDS 1TGVA 4MJ7A 3T7CA 1GPH1 1RCFA 3DNFA 3TVTA 3C98A 4X85A 4RQUA 5ILQA 1XZJA 3GIWA 2FUNB 4Y2JA 1T3GA 1Z3CA 5GV7A 1NL3A 4A2WA 2W6CX 1RQ7A 1AUXA 3DWGA 4RLFA 5E0KB 3QF4B 2JGRA 3ZW7A 1UC4B 3ONVA 3UMBA 5L8VA 3E22B 4OA8A 3SC4A 4D8VA 5L3QB 4GW3A 1DINA 2FMHA 3GY0A 1LTKA 1E98A 4L95C 4OQXA 4Z0TA 1AK9A 1RC0A 2VK2A 3P0HA 2OHVA 3SC2B 4E2ZA 1LVGA 2JBHA 5JYDA 1SD2A 1Q83A 5EZSA 5ABPA 3H0EA 3HKCA 1G60A 5A1TA 6CHYA 1BXGB 2CSUA 4EW1A 4WEOA 3N39C 4WKNA 4JIMA 2ACWA 4P2BA 1RWXA 3D4OA 4J4HA 3N8IA 2PX4A 5TIIA 1A95A 1E6KA 3G5MA 4FNGA 3DKIA 1K7YA 1KJ8A 1QOZA 2DTXA 3JATA 3ETDA 1IMJA 3OCVA 1YCHA 5HG0A 2WZDA 3TW8B 2AKEA 5TARA 4WHMA 2CK3A 1DS6A 4XGIA 4UTRA 1E6MA 2ECKA 4OKSA 5FAKA 1G8AA 1P8JA 3LCVB 4FCTA 4ESEA 5JYAA 1RE0A 1S8NA 5FOTA 3M6FA 4QLBA 5D85A 4EJSC 1X7XA 3EMDA 4OHCA 2FPGA 3OQOA 1FDWA 1PFUA 4DMCA 3EIHA 3A06A 2ZQZA 3CR8A 3O75A 2HTEA 3M6AA 4CUJA 3O6VA 3KSUA 3O9MA 1X1QA 3L4KA 4DV6B 4DV1B 3AR7A 1RU3A 1ISRA 1Z5UA 2R7KA 3KTOA 4ODIA 5LQNA 3BQMB 3BH7A 3QXXA 1LQ2A 1HTBA 2RH9B 4R1OA 3KEQA 1IZ7A 2DHDA 3KQTA 1YASA 3CF4A 1L5HA 4DPMA 3LW8A 4DLYA 4A91A 5MFZA 5EE0A 1OA1A 2BEUA 4AJHA 3CSSA 3SP1A 5JCXA 1IN6A 2OVBA 5CCXA 4JHXA 2IUTA 4L0CA 5ALKA 1XTRA 5BQOA 1FYWA 1QHNA 4JJ4A 3GNLA 3OPYB 3PJRA 1Z4OA 1X1DA 4G6ZA 1YD7A 3VVBA 4HDSB 2BP7A 2P6UA 2DFPA 2WJZB 2XKBA 3EIQA 4GI7A 1TKAA 2B37A 3CX8A 3NHAA 4X1IA 1R0SA 4ZTZB 5CB0A 1KFJB 2CZGA 1HURA 2YZMA 3UMRA 5KNBD 3FDZA 1RZRD 2IYOA 1S8FA 1AGPA 2A86A 4ENSA 1DX6A 4TWIA 3VHRA 2HMSA 4LJRA 2ZRHA 1K63A 4HRXA 3FDFA 1F6DA 3IQGX 3F6CA 3GEGA 3KJEA 4G5GA 1XDDA 2F1RA 2O52A 3MUOA 1Y33E 4PHTA 1GL6A 3GJXC 2DT5A 1UDCA 4J2OA 3D6MA 4KWEA 1GTL1 4RD6A 5HF5A 1WBBA 5MF6A 2WIKA 2X2EA 4Q7LA 4UU7A 5HGJA 4K88A 3OCWA 3W3AH 3Q87B 4L8LA 4B3RB 1TT5A 2WSSD 1FP4A 3K0CC 2W6QA 5REQB 1DAHA 1VPTA 3V2IA 1EU1A 3OE5A 4DIKA 3OJ0A 1WOYA 1OVMA 2AL7A 1FFCA 3LBYA 3W9BA 2ZXUA 1E2QA 5FP0A 1SUIA 4AZSA 2QVBA 3MFQA 3M6LA 3T5MA 4QYIA 3AUSA 1B41A 4QX6A 2MSLA 4XKJA 1DJPA 3RODA 3NHZA 5I9SA 4WERA 3OQHA 1WZEA 3VV3A 4G1CA 3KOOA 1VLVA 1HNNA 3HG7A 3TLCA 3O93A 4XUGB 4YT4A 2HMYB 2GCOA 4FX5A 3H5WA 4P33A 1ZK4A 3STYA 3UUWA 3ZWPA 2CY0A 4ICIA 2QROA 1YNSA 3SIWA 1ZMBA 5F2EA 2WQ7A 5KJCA 2FFBA 3OTHA 4K9LA 5CW1A 4EA8A 1FU8A 1GNTA 3E7XA 4KZPA 4POAA 2FTKE 1MQAA 2AZMA 4IP0A 4J0IA 5F21A 2PMBA 3WLOA 1C4WA 1DV1A 2QQ5A 4IV8A 2YOHA 2Q7OE 4LWQA 4BNZA 4X7MA 2W2OA 3NZEA 1BS1A 3EXIA 1SOWA 2O1SA 4M9ZA 3RU2A 4C0AC 5F9FA 1YQEA 5BWCA 2J59A 3EAFA 4ESVA 4PPYA 1ZUNA 5CX1B 1UF9A 3PC2A 4U9IS 2C96A 4MUYA 3WNBA 1PR0A 5FI0B 3B1JA 1ETUA 1XWWA 3IQEA 4KOEC 2B83A 3X2EA 2R4TA 4WVLA 2BR5A 4BNWA 5DK4A 1H0RA 3KJQA 3ZDXB 4C1NA 5KTSA 2OB1A 1SG6A 4HEA6 1B1AA 2RCYA 4L85A 2ZJBA 3RYHA 4HEA1 2A0KA 2P4QA 4YRRA 5B7PA 5KQRA 4MYUA 2EC5A 4B84A 4E03A 4JLVA 4TLDA 3WGUA 2ZJ1A 2AEEA 3T94A 2EQAA 4C4OA 2VJLA 3HP7A 3K1AB 1G2QA 3PV0A 3R6DA 1G4AE 1NT2A 2AZ4A 3HB1A 2O06A 1YK1A 3ZJXA 2ORVA 2C5BA 1ZJYA 2D5CA 2HU8A 2P0YA 5GM2A 2O2CA 2W98A 3IT1A 4ZK6A 4C22A 3RKSA 1LZLA 1GG9A 1LLDA 3I34X 3LCCA 2AI2A 3C6QA 1AJEA 1Q3TA 4OHZA 1ISMA 5FA5A 1P2VA 2EF0A 2WHYA 3Q0IA 4RD2A 5DX0A 3WG9A 3GN1A 1YB5A 2I2AA 2Z9CA 3F6BX 2KB0A 4XYMA 5LOVA 4WKGA 2B4QA 3O82A 2ISCA 1KFEB 1PWYE 1QIIA 4ZJYA 1I2CA 1SK8A 4M7WA 1ZZGA 3FYUA 2XUIA 4NVRA 2AQIA 1Y4ZA 3IUEA 4KQEA 1XZMA 3T99A 1NNLA 4D43A 1ZD2P 2HH9A 2XVZA 3D2AA 2IX3A 3L92A 2HYDA 3QMVA 2RK3A 5KNCH 2NO9A 1MX5A 2Q4BA 5FRDA 2NQ8A 4GP9A 4HVTA 3QPUA 4QSHA 3RUEA 4FKZA 3FPKA 1E3SA 2VAXA 5U9CA 2RMKA 1U2EA 1U90A 2J5QA 4F1JA 1ADCA 3ELBA 2J3HA 3QUTA 4KIWA 4B44A 5J4HA 1KDPA 5JD5A 1NBEA 2NZXA 4JJGA 4NZMA 4YXWD 4DC9A 2BFEB 1DIBA 3V2UA 3OLXA 4EUFA 1ETHA 4Z54A 3TOZA 1N6NA 1DBIA 2J45A 2JVIA 4PGMA 4ND6A 2WJIA 3Q41A 1YQGA 3KKKA 4IDGA 1DFIA 3L79A 3RR2A 2FRXA 1CIPA 5EHNA 1KAEA 2SHKA 4ML3A 3EAQA 2HC9A 1FTSA 3OP4A 4CQNA 2J3DA 3O8OB 1KPIA 3IPXA 4QPJC 2WSIA 1IY2A 1R0RE 3H3FA 4M0EA 4MCAA 5DYNA 3SF0A 4B7CA 2GEKA 2B8NA 4DIEA 1P4JA 3WFJA 1EE2A 2Y8EA 3AR5A 4PO1A 3REGA 4EL5A 4URVR 3NXKA 4BVLA 2WTMA 1OGYA 2HHJA 4I5DA 2VTKA 4KGVA 3KAKA 1TXGA 3DEIA 3RC9A 4L2IA 5HCNA 2VDUE 4DNOA 4F97A 1QB7A 1WP9A 3PX7A 3JW8A 4YP1A 5IMBA 2AWNA 4O5OA 3VGJA 2BMJA 3I04M 1GZUA 2G9NA 3STHA 1EM8A 4GOXA 5DO9A 3T0IA 1GUDA 5JXWA 1VE9A 1BS2A 2EJUA 3WA7A 3PFBA 1YCFA 4X94A 5B4VA 3JRNA 5ED0A 1QH1B 4DDKA 3DM5A 1CCWA 3AQIA 3P9QA 2G0AA 1C8LA 4BTVA 2WIAA 3SU8A 5K3BA 4EELA 5KYYB 5CRIA 2H18A 2ZSJA 1LC3A 5K5EA 2ATEA 3EZ9A 2A4KA 3IV9A 4GKKB 2WWVD 5IT5A 3F96A 3RS7A 1R0BA 1IQPA 2FMUA 3H2IA 5K3FA 3G59A 3HKBB 3E8SA 3FMIA 2XITA 4WGFA 2V1XA 1E0SA 1ODKA 1Y0BA 3E5HA 1KDTA 1TC1A 3GUUA 3LCRA 1TJ5A 3AFNA 3LIPA 1VBFA 4K9MA 2HQOA 2QVCA 2B3DA 1H8HD 3BN3A 1U5AA 3E61A 5TVKA 2IQIA 2N47A 1E2PA 4R9NA 1J99A 5K9ZA 1KY3A 4GLLA 2O0HA 3AF0A 1H9AA 3TV1A 1VXOA 4V3CA 3WRWA 4EFKA 4QLAA 1FVFA 2NU6A 1NNEA 3OA2A 1F3LA 1G8KA 3SX4A 3EZFA 4B6EA 3VR5D 4E07A 1DEKA 3GAFA 4TTJA 4ZAYA 2ONZA 3LA8A 2VZ9A 5F77A 5ICGA 1ZH6A 4JOSA 4KP7A 2P35A 1R9MA 3H84A 2FVXA 4BQFA 4KXLA 5CM8B 2RHGB 4RFVA 2ACEA 2ZRFA 1JI0A 3SBXA 3ZXXA 3ZV3A 3E18A 5TS3A 4D26A 2QRNA 4GX1A 4KQ6A 2DCMA 4WXMA 4B2PA 3AUJB 4PHFA 3GEIA 1K0FA 3DMRA 2OT3B 1XCOA 2IX9A 4P80A 5KI6A 1SQFA 3PHBE 4HDSA 3K8QA 2I2CA 4YJGB 5AVJA 2NX2A 4DLPA 3PWKA 1EA5A 5FV4A 1YR8A 2B92A 3NHPA 1V25A 1YU6A 2GN0A 2D7CA 3M9WA 3OC6A 3ITEA 1GTVA 1NIJA 1HQYE 3NANA 5CX1A 3R3SA 2HFJA 5PGMA 3ZGYA 3EXFA 4B7AA 3QUQA 4MVJD 4G67A 3UENA 1E7QA 4YCNA 4TKVA 1X9GA 3UJBA 3ADBA 1UUFA 1I51A 3O8CA 1RWOA 1YZLA 4LDRA 4RPLA 2GCEA 3SIPA 3WDMA 5ALSA 4Y98A 2GWHA 3BGSA 4NYIQ 4DNXA 3HMKA 3TZBA 2Z2JA 2IYXA 4U3JA 4BX9A 2FPKA 5SYAA 2JLYA 5GZ6A 4IHAA 1DQPA 5J2TB 2CCJA 3MC1A 1KK1A 1WWKA 1GRCA 3R5SA 1JKJA 3P0JA 5CDSA 2YX1A 1KEEA 1Z7GA 1QGYA 1PV1A 1JDBB 2PEYA 5E7IA 5EVCA 3SZMA 3WWEA 3UPUA 4EUHA 4G8BA 3RK0A 1P3Y1 4AXBA 2WQ6A 5DN9A 3AVWA 5DEOA 3JYHA 4DYHA 1D6NA 2P9FA 1TEHA 2YIMA 1A7KA 4C7BA 1DAOA 2QR2A 4AX8A 2I33A 3A9CA 2ZRGA 1OROA 3EX7C 2YZ2A 1Q6YA 4OFBA 3GFQA 3GP3A 3L7KA 4HSEA 1TOAA 2IY8A 1T36B 4WY5A 3B78A 4MEAA 2ODQA 3DFMA 4DR4B 1CJTC 3ISJA 5BSRA 4OFXA 3C8MA 1LBQA 3P2MA 3VC7A 4NJEA 1AU9A 1L7OA 4OQYA 3DOFA 2NTEA 4QUBA 2L19A 5GPBA 5U1PA 3K73O 1QVAA 3ANTA 4R40A 5HBGA 4L7QA 1U8XX 5B1HA 4C0XA 1VM6A 1ACJA 4R68A 3PZBA 2JKZA 2W4IA 4CFSA 3Q40A 3B9QA 2KBFA 4F5DA 4Q7KA 4MVJI 4QUHA 1FFAA 2IOFA 4DABA 3FVVA 3NHYA 2HKIA 4R1LA 1R0ZA 3WV5A 2IU3A 6AT1A 4KUHA 1SCUA 4D4MA 4DMRA 2A9PA 2FLVA 5J5AA 4AP6A 2FN4A 4TSRA 2B1JA 3E5RA 3TXYA 4EHJA 4RTLA 4LYDA 2WYWA 3KKMA 3VKVA 2HTFA 3MLAA 2F90A 1T0PA 3BEDA 2ZYTX 3VXKA 4L3WA 3ZW8A 2PLFA 1ZL2A 3BDVA 1IAQA 1ZUIA 4R0NA 3HR7A 1IOVA 2J0EA 1IHDA 3IBSA 2BI4A 1UPCA 4NV0A 3E15A 2XZLA 1CUWA 3VYTB 1SXHA 3OJOA 2B1QA 2CJXA 1H2WA 4OJQA 1E1YA 1L7AA 1XR3A 2GXQA 3PFKA 3QRWA 4L4SA 4ZYZA 2I3DA 2J9FA 4FOOA 1YJQA 1H6AA 4KRXA 3BL5A 5LUAA 4XFKA 5FPSA 3T3NA 1XCJA 4X3CA 4LJ6A 5D86A 3AB3A 3ORHA 3SX2A 1XVLA 4RJTA 5A6SA 3OKFA 3ZV5A 1QHIA 1SGWA 1ZCJA 3H5IA 2MWMA 4OL0A 3L9WA 2CLCX 1U8CB 3F7TA 3O73A 4CI9A 2AOVA 5LZ5A 3UAWA 3TW3A 5JBNA 4MINA 2VHJA 3L5OA 3WRXC 4C78A 3FUXA 2QN2A 2QQGA 1VP3A 3HUUA 3PTZA 4URFA 3VNVA 3KYCA 3JQBC 4TT3A 1GTRA 4EYEA 3C1UA 1EHIA 3D5TA 4BZPA 3H8SA 2V58A 3WB2A 4FS8A 3UWDA 3G2JA 1WAMA 2GHIA 5ARDA 3TJMA 3QE9Y 2ODNA 2QNBA 4DANA 1I3NA 3EGEA 2ENUA 4M60A 3EPJA 1F2UB 5BRJA 3ADDA 3P19A 2PU5A 1TECE 3E22A 1AO0A 1ENYA 1MX3A 4IZ6A 4C21A 3U60B 4UBLA 4WUVA 3U80A 5KTKA 4MW4A 5JXHA 5C0OE 2V4UA 3U3OA 2ZBVA 1I0ZA 3IODA 1GXSB 3BCSA 3TNDA 2AB0A 1TK9A 3GAZA 1XU9A 5EQDA 1PGQA 3QLVA 4S0XA 3AUFA 2AR9A 5IDXA 1SVIA 3B7PA 2ET6A 3LW7A 1IUOA 1RQLA 4FFNA 2XNHA 3E3AA 2ZYUX 3WYBA 3GL9A 3ZN2A 4HAWA 3VJMA 1GQQA 3ICQB 1EAYA 3OZRA 3QX7A 2OK7A 1UWLA 1KK3A 1LV8A 1XNHA 4R0VA 1Z0JA 3DO8A 4KQ2A 2JFFA 2FUG1 1M6HA 2ZQYA 3CWZA 3LDGA 2R0QC 3WNCA 1AKQA 1M76A 1OA0A 1ZINA 4JENA 5JD3A 2A57A 1TF5A 1V71A 3RC7A 1IN8A 1DB3A 1REQB 2Q22A 3ABQB 1OXTA 1KJ9A 2OUKA 4G25A 3RAGA 4EBBA 2V6MA 1ILWA 2ZULA 3HCRA 4Q47A 1DBVO 4QPCA 5DHRA 3N8HA 3M4JA 3KSBC 5DHSA 3B82A 2CF6A 4NJMB 4YO7A 2H59A 2Z83A 5CIWA 5FORA 3L46A 4WZAB 1PBTA 1QCZA 4CKWA 4KUGA 4TRNA 3V4SA 1L5YA 3LC1O 4DIMA 3BVPA 2PKWA 4CLDA 1MO3A 1HR0B 4EG4A 3ETCA 1ZIPA 5IUJC 3OLCX 1QTRA 3PXAA 4GLOA 1ZPDA 4H7PA 4YJ3B 3ZBTA 5EP2A 3NUGA 3K2EA 1TAGA 2V7XA 2ZJOA 4KQCA 5EZYB 5K0LA 3WLKX 1A72A 1KBOA 3V00A 2E37A 1VYHA 4Y1EA 3KR1A 3S5JA 5K3CA 1U99A 2V59A 3SCZA 2F3TA 1C3JA 1BMQA 3Q6MA 3QU2A 5G4KB 2PUDA 1U63A 2VA8A 3JD1A 4UHDA 3QVLA 1NE2A 2O8NA 1BXRB 2IUFA 2P11A 4LRYA 4QYSA 4LSMA 3K1YA 5K2OA 1XELA 3AESB 2I7TA 2VXCA 3PUJA 4ME6A 1R8JA 4Z8XA 4LQLA 5DYIA 4YRLA 3UFXB 3L7CA 3FCXA 3JYLA 1XPJA 2DX7A 4QNRA 1RYBA 3I12A 4HAUA 4R1NA 1HSOA 4R8LA 4R2MA 3E0XA 1D7AA 2Q4DA 1Q0TA 3E7WA 4XFJA 2J5BA 2QK4A 2GTPA 1XKXA 1BKSB 1CZRA 4OATA 3RDPA 3TR6A 1T29A 1NXQA 2Z6VA 3F74A 4K1XA 4Q9AA 3C14C 3F78A 1O5TA 3EPRA 4D8TA 2BMFA 3DHEA 3GA7A 4N82A 5JW6A 2VG8A 2O1EA 2B5OA 4KNVA 3R7WA 4TRRA 5AVKA 2SCUB 3CRQA 2Q6VA 1EMDA 1SK9A 2YJ6A 3QXSA 4HH3C 3U9LA 4D25A 1NP3A 1DHRA 1O54A 1TK2A 2VLBA 4RETA 3DTYA 5GMOA 4BNHA 4MUMA 5B58C 3BSFA 4FILA 4KAAA 1UT5A 4NHOA 3KAPA 2G1KA 3HSSA 3HXTA 4KK4A 5DRYA 4HQRA 2AEJA 1W7AA 2DUJA 4ASUA 4RKRA 3AUUA 3GGJA 5EXXA 3UJ7A 4HN2A 1P60A 4C4XA 4CNBA 4ETMA 2DR0A 4KKVA 3ZPXA 2G9UA 3QIVA 2QYSA 3H1FA 1F8YA 1FS5A 1LPMA 3TLKA 4NESA 1LB1B 2DH5A 4E0BA 5EQFA 1SVSA 3WKCA 2VH1A 1Z73A 3N0WA 5KX5F 4XAQA 1M2HA 4QXOA 3HBMA 3Q7SA 5CFLA 3CG0A 1PJ4A 4MSUA 4F4JA 2H8KA 4MV1A 3W9SA 1C8KA 3K09A 3LZCA 4ZKDA 3ZJUA 3M6IA 1VBKA 2GZDA 4M88A 4UTVA 4BNMA 2E3JA 5DYWA 1XU7A 2P2ZA 1WXEA 2G5CA 4K28A 1JMYA 5CYPA 4ZEVA 3ADOA 4K87A 2YJTD 4BWVA 3VNUA 4KRGA 2ZRJA 3NV9A 3DFUA 3GFGA 2I4NA 4HI0E 3D5EA 3WLLA 3A7EA 3HJRA 3N58A 4MV3A 1CU1A 1P1RA 2HYIC 1SEPA 3LVQE 5IC6A 1SC4A 5IAGA 3VDXA 1IZ8A 1TMKA 3I1IA 4ZOAA 5AR1A 1LF0A 4PXSA 3EQ9A 2IRWA 1U65A 4WDRA 5EP3A 4EP1A 4EMSA 3GRVA 5I7OA 1KQGA 4UUBA 4XB6B 3NTQA 2RHMA 1EUDA 4OHMA 4G84A 3HXOA 1QRTA 2K2WA 3O5AA 1GZ4A 5K8CA 1RZRA 1AZLA 3LGXA 5AWFC 5AVYA 4I5GA 1NUQA 4MVWA 5D3QA 1NVTA 4WE3A 1NMQA 1SBIA 3ORRA 5KHOC 1B16A 2PX5A 2ORED 3W2TA 3GFSA 3FDJA 5B58T 5B12A 2YASA 1I7QB 2PKYX 3FGPA 3GMTA 1C2TA 2I6SA 3MRXA 4RCZA 1Z2AA 3RS0A 1CB7A 2OFFA 4GOKA 2Q6OA 2PEZA 3SYMA 1JLHA 2CC2A 4EX7A 1LFAA 2OECA 4BBZA 4FD3A 3TNYA 1N2OA 4K40A 3ZZ1A 3OZGA 2CVHA 5FLKA 1J21A 2QRVA 4LVCA 5BSFA 3TBKA 4HNTA 2OV1A 3NYIA 1COZA 3E48A 1KDVA 1XK6A 3L2OB 2ZCUA 1KE2A 1NFRA 3O3MB 2J0QA 3WTCA 1C4OA 1AN0A 3N3AC 1WKVA 2NP6A 2PH1A 2NT3A 3OJXA 4YUVA 2B4RO 3VX3A 1QOQB 4OP1A 5CM2Z 1EZ1A 1F8GA 4RCYA 1WW2A 3TOVA 1E2BA 5EIBC 4M22A 4F3CA 3U09A 2ZWIA 3EP9B 4LNUB 4D9FA 6PFKA 2A7XA 3TWOA 2P0AA 5I4KA 3HE3A 3BK2A 4FW8A 4KW7A 1ZD4A 1THZA 3KHKA 4N3GA 5IASA 2G1PA 2H7VA 1J7KA 4J03A 4CKBA 2CGEA 3PK0A 2X1VA 3WMXA 5C7YA 1P31A 1JR6A 2NTYC 1OZAA 3M34A 5CEJA 4EGFA 2BZSA 4DNPA 4JYAB 4B4OA 4N8SA 3BRWD 2O8BA 3FOAA 4RXMA 5H0IA 4ACAA 2XLBA 2BZ1A 3HCCA 3ENVA 2V9CA 5IBPA 1JP7A 3TKYA 3JQFA 3W2EA 1YS7A 4D5EA 4K9NA 1T24A 1MO4A 4UBOA 4TUYB 5CYGA 2HW8A 1OW3B 2HV9A 3HEAA 5ALNA 5TX7A 1PQPA 2PGLA 1MVNA 2RHCA 3QNWA 3VZDA 2F8SA 1JZSA 1GPNA 1RXSA 2GARA 3KXPA 3PC8A 2FGKA 3RYHB 1AZTA 1JSXA 1LVUA 2IKSA 2VDWB 2BM8A 1OYWA 3HXPA 4IV0A 1JAHA 1H5QA 3CT6A 3I9NA 2B8TA 4GDMA 3R8XA 1Q57A 2NTVA 1NUPA 3LSYA 1JEJA 4XJVA 3TLAA 2Q5HA 2ANCA 4HDMB 4I4IA 4BLWA 4BQPA 4E5YA 4G81A 4L50A 3TIXB 1N2CB 3JWHA 4IUDS 2FUKA 1O97D 4ZMBA 5EWJA 1P61B 2R96A 1E4YA 4F11A 2VYND 5CDYA 3GRAA 2YS7A 4JWTA 5JY6A 2I2DA 4U9UA 4MS3A 1Z2CA 1Z6YA 5IM5A 3NDPA 4JKIA 4X8LA 4C7KA 3KQUA 1UWCA 2NIPA 4QU8A 5H4HA 2Y1LA 5DNUA 2F8MA 3GXOA 1R4NB 4FFPA 2BUBA 3EVGA 2JLVA 3SXUB 4NMWA 1RYDA 2FWAA 3CLSC 4GT1A 3HM2A 1DWQA 3EVEA 4DCJA 4ZALA 1SXJA 3AJEA 2WP0A 1PK8A 2YY6A 5EZ5A 1CUUA 1A8IA 4DFDA 2F59A 2IYSA 4PO3X 2R3SA 5AW9A 4B8ZA 5LP1A 2J4CA 2P2LA 4YRCA 4AC9A 4CL0A 2BM9A 1GZVA 1UXKA 1L5VA 1UBTS 2I2XB 3F3MA 3HR4A 1SZJG 3ZY4A 1CPYA 2HA7A 1NV9A 1HDXA 4JT4A 4PC7A 4HDQB 4UNSA 1ESDA 1OIXA 4DSZA 4M0FA 2IYWA 1JDSA 4RMHA 5CCBA 2R11A 1XN1A 3S5UA 1EP2B 1A2OA 4UAUA 2O7VA 4ZHQF 1SUEA 5KHLB 3OT5A 1A9QA 4I9NA 1EVIA 1WRBA 4L07A 3QWFA 4MUXA 1D0VA 3P1JA 4JSTA 1YO6A 4DPKA 1YRWA 2QZPA 3HH8A 4TMWA 4Y2VA 3H2KA 1VLQA 3X2SA 4YV2A 1HE2A 3G79A 5J58A 3EP6B 3UFXA 4XIYA 1UAGA 1NBAA 2BUCA 3EW7A 4Q39A 4WXEA 5AKEA 3OMWA 5C8YA 2HD4A 2K6GA 4UARA 3F9IA 1NVDA 3OM1A 5FEUA 3EWNA 1PV2A 3DBLA 3KFXA 4F3KA 1D4AA 4MGIR 1GUAA 3RF6A 5AQ1A 3HCBA 2TMGA 3ZHUA 4MNTA 1PGPA 3BXHA 3OPYA 3HJCA 3TLBA 3W7AA 4CL2A 4G4IA 4LWZA 3EIUA 1T5HX 3T7SA 3LVRE 3P9YA 4FHFA 3S70A 3LGSA 5JZBA 1LFDB 3BXGA 4O2BF 2W42A 2IS2A 3KK0A 3I4LA 5BV1A 2J31A 1OAKA 1XKTA 2GLTA 2GUGA 4MMYB 4ZQEA 4C43A 1SO8A 2WF7A 5K8JB 3GJ5A 1XQ6A 1EFHA 4DG5A 2EL9A 2VCHA 2BI8A 4G09A 2VKQA 2REXB 3Q9SA 4EFMA 4MLCA 1V1RA 2RGCA 1MOPA 1GARA 1QYWA 2QI9C 2RGBA 3HA2A 3BMCB 5IS2A 1AGXA 1UXGA 2QRUA 2W2LA 4OIFA 4Q4AA 2XY4A 4FC6A 3EPKA 4AY6A 4UEKA 4QATA 4YJ2F 5ALEA 1J8FA 3V34A 1NXSA 2A5DA 3V80A 4TT3D 2WLSA 3D6UA 5ULLA 2OC9A 1TB4A 1USWA 4RFSA 2YY7A 1P2SA 5E3JA 1X2EA 2F3PA 4A2CA 1TYDE 4AS3A 3ICCA 3COJA 2OCXA 2JGMA 3KFVA 1LNSA 1RJFA 3KR0A 1KJJA 3I9LA 3KSRA 3PGKA 4OFWA 3Q3VA 1MN6A 1V4NA 3N28A 4BVKA 5IT9A 1HQCA 1TUBA 2AI3A 4PGGA 3ZUGA 5BV8A 2VXYA 3WLPA 3FSRA 3VGPA 1EFPA 1HUQA 2BGMA 1JA1A 1T4DA 4N3BA 3LKDA 5BPHA 2J9RA 3GO4A 1H4TA 4WXRA 1EXDA 3HNPA 2IYVA 1JKIA 5KPDA 5EHGA 3I04A 4X93A 3TVDA 1BJRE 5EIXA 3RTCA 1NVBA 3KZNA 1F2UA 5HKAA 3WC4A 1RQRA 2DEUA 5K51A 1QQTA 2J48A 2C9YA 3C3JA 4F91B 4GL4A 1C7JA 4MCHA 2R1VB 3D8SA 1L7BA 2PO7A 5BNZA 3TVYA 4RNDB 2K7ZA 2HIGA 4M8KA 2XXAA 2X6RA 4R3NA 4NK4A 3F73A 4ZKEA 2CMFA 3X0DA 3AXSA 1II8A 3UGJA 1OOEA 1RFGE 4JX9A 4UNIA 2RIPA 3ZCQA 2W0SA 5CB4F 1YRBA 5FH9A 4IV5A 1VMIA 5C51B 4K6CA 1XZFA 2Q3BA 3D3KA 4D0RA 1QP8A 7MDHA 4JJKA 1KY4A 3C16C 2R85A 1Q95A 2FH5B 2H16A 4WZAA 2R6ZA 3LY8A 1XJ0A 2XMCA 3MJ4A 4Q4JB 2W7TA 3BRSA 2C2YA 4EMUA 4IJ5A 4I1VA 3TGLA 2I6GA 1J1UA 5AFSA 1J23A 3I09A 3OJFA 2OA0A 3S2FA 1GKIA 1E9DA 1C1XA 1K1EA 1R3DA 1WHSB 2Q3CA 3EGWA 2UDPA 3JQ7B 3OIFA 1BSVA 2RC5A 4WNIA 2MYNA 3WL5A 1FS4A 4FMBB 3WVNA 3ZE2B 1XROA 4KJXA 1KU0A 4KLZA 3OLYA 3ZIDA 3OCYA 1KMHB 3MGBA 5BQXA 1LV7A 5BSHA 4D8XA 8MHTA 2UZ4A 5EG5A 2W4MA 4IR7A 4TV8A 5BOVA 2YIVX 2ZI4A 4A2PA 2ZVDA 3RIXA 4YWJA 3R20A 3WNDA 5KC9A 1ZICA 3QWAA 1CB0A 1Y5LA 4MZXA 4N39A 4DDMA 4B3XA 1QFYA 3L6DA 3MJVA 4MA0A 1YU9A 3GGCA 3PGMA 2I4IA 2R8PA 1VJTA 2GA9A 3CVXA 2ZYWX 4DLTA 4M9CA 1CT9A 3DMTA 2YVUA 4GQBA 5DWDA 3BRCA 3DMNA 2B34A 3G0OA 4A5OA 5HP4A 3GNSA 2DBQA 2GKSA 4I4TF 3ACBA 3GLFE 3GC6A 4EYOA 3RYIA 1JEYA 1AV6A 3L05A 2XWSA 2XOKD 4UOQA 2CDBA 2HLHA 3BCRA 2GZRA 5JDCA 1ITZA 3S81A 3UJNA 1ORIA 1KC1A 3Q88A 3WGIA 4O2LA 3HZHA 3IMKA 3I0MA 2XGOA 4LVNA 2CV2A 3RTBA 1RWNA 4GRIA 3SQWA 1N2XA 1B0UA 1WKCA 2WK1A 4YT5A 3QXJA 2X6TA 1ZRHA 1RVV1 2Z4SA 1YL5A 3OA0A 3TDNA 2WWYA 4BMOB 1RJ9A 4Q16A 4ZWNA 2ZR8A 1ZMRA 4KXQA 4WKCA 1C30B 4I46A 5A9SA 3HXQA 4RABA 3KIPA 1KSFX 3P5SA 4IJKA 4MWTA 5CR9A 3SIXA 3GRUA 2WJJA 3OU2A 4I1SA 5ALGA 2DPMA 4DOMA 3LYAA 2HCBA 3P2EA 4RSMA 5FIUA 3RTAA 2OEPA 4L16A 4FSHA 4EHBA 3CZMA 2A3NA 3WLRA 2XRFA 2QWXA 1JPNA 5FBRB 1V3UA 2IV7A 3L6BA 1L9KA 1T9AA 3WBFA 2E21A 4XVQA 4HFRA 3WYDA 2DFDA 4BXOB 4YROA 4EH1A 1YZHA 3KVRA 3QHPA 3QXCA 4EG5A 2X0RA 5JHHB 1TYAE 5K6TA 1BJKA 4J8PA 4MIOA 3ECSA 1VIMA 2EKZA 4V24A 1U8AA 2XUJA 1W19A 1E7YA 1Q3HA 3PWTA 4L8VA 3MIZA 3I9OA 4IFBA 4KE6A 3SDBA 2RGYA 2GAAA 1WCIA 5GJVC 3Q7PA 3A31A 4H08A 4EBFA 1HLGA 4Q9IA 1C7RA 5AUQA 5GWXA 2NM0A 1FRNA 4P35A 4DWWA 4ZHQA 3JQ9C 1KEZA 1OFIA 1XA3A 4JB8A 4J1NA 1E0JA 3QU5A 3LWZA 3MJFA 2AYXA 5AI6A 3F5SA 4ARUA 2XDAA 3BSYA 5BP7A 5KSOA 1BU8A 1DRVA 3IUPA 3RABA 5AW1A 4KXMA 3OIGA 3L8FA 3UIEA 3VPAA 3NP9A 3JV7A 5DN6A 5JQGB 3P9NA 4B34A 4HGOA 4D9NA 3LT1A 1LDYA 3I32A 1RKQA 2EWMA 1RYEA 1QHEA 1S3SA 5K03A 3M4YA 4TXJA 3O47A 3L0BA 2WWFA 2YR0A 2FMTA 3EGDB 5DOVA 1JN0A 2PH7A 1DT3A 2D1RA 3II6X 1DBWA 2J4DA 4YRFA 5EIHA 2ZRAA 4GMFA 2QVZX 5KCZA 3PGVA 3PGA1 4ND1A 4LY3A 1EDZA 1TVKB 4TN5A 4UM9B 5SYNA 1TPZA 3CLVA 4FSDA 1JW9B 4CM9D 5BR8B 1FLNA 1KYZA 3REQB 5AUNB 5IVPA 1OY1A 5JQGA 3OKAA 1KPGA 1H1TA 4F7DA 3EP8B 4K26A 4X90A 5J1TB 3ZE7A 1FTWA 3B5EA 4C6TA 1FQOA 3P9CA 4URYR 1W8DA 3KVNA 1RAGA 4HWOA 4LV6A 2GPTA 6GPBA 2IBSA 1E6LA 2XMDA 3AV0B 1KEUA 2XE8A 4BLVA 1CRWG 1ADFA 1M1NA 1KU6A 4I9HA 1MZVA 2CD9A