3PZRA

Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with nadp and product of s-carbamoyl-l-cysteine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
370
structure length
370
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Structural Characterization of Inhibitors with Selectivity against Members of a Homologous Enzyme Family.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 123
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3pzrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3pzrA01
2NLOA 4GBJA 4P38A 2Y0CA 4ZICA 3BZUA 3QVOA 2ZYDA 4JGBA 3AUSA 4NBRA 1UP4A 2VUUA 4QEDA 4PVCA 2Y1OA 3F5QA 4A03A 4GH5A 2GO1A 4BUCA 3IJPA 2Q46A 2FP4A 3TF5A 3K9QO 2DBRA 2GASA 2EIHA 4WEQA 4WLOA 5DCUA 3RC1A 3OICA 2PKRA 3RJ9A 2UUPA 1Z73A 1CYDA 1XEAA 1K6XA 4OAQA 1NQTA 3V2GA 1T2CA 3GGGA 1BHSA 3KV3O 2X5JO 2YJZA 2OXIA 1E3LA 1PWZA 4GX5A 4BNMA 4E21A 1RM0A 3KSZO 3EDMA 2SCUA 2NM0A 4FFNA 3WLEA 4CLHA 4CL3A 1SNYA 4A0SA 2PZJA 2E6UX 3GA0A 2XPCA 1M66A 2FHSA 5I7SA 2H5LA 4IM7A 1I36A 3WIDA 4E31A 2QYTA 3NDIA 3C24A 1E5QA 3V2UA 2X6TA 4YJGB 3GT0A 2CVOA 1J0XO 1PJQA 3WQSB 2YV3A 2VZ0A 4ZN6A 4J4TA 4YT4A 3VDRA 4AJ2A 4PLPA 4DMMA 1BDMA 3B20A 1HF3A 2GN6A 4WLUA 4B4VA 1QSGA 2YQ4A 4DXHA 4YDRA 4RGBA 1TA4A 1WZEA 4JNKA 4DUPA 2B37A 3FNEA 4J90A 4PLHA 4RVSA 2EKPA 4CM5A 2DU8A 1E77A 1BTOA 4JROA 4NDNE 4O5OA 1BWSA 2GSDA 4TMFA 4NBUA 2IXAA 2CY0A 2VUSA 3G1TA 1U7HA 3HFSA 3I23A 4TRNA 4MVJD 3TL2A 1DFIA 3RUAA 2BI8A 3VH4A 5DDIP 1UXKA 1UDCA 1IY8A 3RC9A 1A4IA 3FPCA 4QUKA 5G4KB 4ONEA 1Y5RA 2YQ5A 3AU9A 3OIGA 4BO8A 4EGFA 5CDSA 1Z45A 2QRJA 1P1HA 1GV1A 1NASA 2IRWA 1E6EA 1GR0A 1ISIA 1HDXA 5A06A 4BO3A 3KYCB 4J0FA 2UV8A 3H4VA 1W0CA 1IHXA 2AQKA 2JAPA 3RUHA 3F1LA 3K30A 3NGLA 3UVEA 1DPGA 4Z9FA 3WICA 1F8FA 5DF1A 1X7DA 3CSDA 1WVGA 3WNVA 1DAPA 1GADO 3JQ8B 4LSMA 3CZRA 3OIFA 3SBOA 3KEOA 2JL1A 5KTKA 5CEJA 4M55A 9LDTA 4ROSA 2PLAA 4U5QA 2PGLA 3HDHA 4B3HA 4IJVA 2I6TA 1YONA 1P44A 2QQ5A 4I9NA 4G65A 5JC8A 1DRVA 1LUAA 3EK2A 3U09A 4RPGA 4Q3AA 2PR2A 4E33A 3WGZA 4YJFB 1GY8A 4E32A 2WYWA 4K6CA 1ZEMA 1GQ2A 5L7YA 3OQ1A 2OFPA 4CV2A 4GGOA 2C82A 3FR8A 5AYVA 2EKLA 2DTDA 4HP8A 5CDYA 4GWGA 1HDRA 5IXYA 1NFRA 4DYDA 2AEFA 2EW2A 1JU9A 4E5MA 1LI4A 3CINA 4IJKA 4H16A 1RKXA 7MDHA 1CETA 1FDWA 1P74A 5L51A 1N7GA 1WLYA 1A71A 1DC6A 1Y1PA 4NK4A 3ZNNA 2CVQA 5U1PA 5I9NA 5COQA 2GN8A 4IS2A 3GAZA 3RU9A 1GU7A 3BMQA 3D0OA 1CEQA 4XGIA 5EINA 4JK3A 5EL0A 3ZH2A 1M6HA 3E6AA 1ZSVA 4NMHA 4W99A 4MVJA 4ND1A 1E1KA 1MUUA 1KY5A 1CQJA 1EUDA 2DFVA 4R69A 3WQQA 4PRKA 4X54A 4W9NA 4YAGA 4Q39A 3JQBC 1LLQA 4I1IA 3IDSA 1F8GA 1ONPA 3SC4A 2DC1A 3EUWA 3ZU4A 3NUGA 4KUEA 4BKQA 4CV1A 1YH3A 1KY4A 5DBGA 4BO6A 3WMWA 5TQVA 4P22A 1HLDA 2DAPA 2O3SA 3QIVA 4IIVA 5TRTA 3RSHA 2DUUA 1GZ6A 2JFGA 1U2GA 1E3SA 3QWIA 5DOVA 2CFCA 5CEEA 2W2LD 3L6OO 1O5IA 1WMAA 1PIWA 5G0VA 5EIOA 6ADHA 3PJFA 1UP6A 1DB3A 4YXFA 3IQDB 1V8BA 4WCFC 3WMXA 3KXDA 3ENKA 2BRUA 2C7VA 3TZ6A 3S8MA 3AM5A 1JAXA 1FDUA 2C2XA 3U4IA 1GD1O 2J8ZA 3RIHA 4BKUA 4MPDA 5H82A 1TVEA 1A9YA 2EEZA 4BKRA 4BO1A 4EJ6A 1VJTA 2BFAA 4IMPA 2X0NA 4UREA 2P9EA 4QSMA 4WLNA 2B83A 3TSCA 3CIFA 1NAIA 3P7MA 2CVZA 3H65A 4BNVA 3CMMA 4QX6A 3WBFA 1U3VA 1W73A 2O3UA 3DB2A 1DHRA 1I33A 2NU9A 3DOJA 5T5QA 4L75A 4PN3A 2OZPA 1PQWA 1D1SA 4DWVA 1LRLA 4AL4A 3PHHA 2Y67A 1Y81A 3PYLA 2GCGA 1UJMA 4YR9A 2XF8A 3OJFA 4RJTA 3MJSA 4BNYA 5ER6A 3FRJA 5HTOA 1HT0A 1U4OA 3H9JA 5FWNA 1E7QA 3KOUA 4ZHSA 1BW9B 1SBYA 2CF6A 4CODB 1DC5A 5IZ4A 4I9HA 2RH8A 4D43A 3DBRB 2I5PO 1EFLA 2ZK7A 3PJDA 3PQEA 3S2FA 2DBVO 1PZGA 2QG4A 1NYTA 3BTVA 1ZNQO 2TMDA 2Z1NA 1YO6A 5AQ1A 1IE3A 1QORA 5KKCA 1EVJA 1LDGA 1X14A 3RKRA 3ASVA 3L9XA 1K2WA 2FPIA 3NT2A 1LDEA 3K92A 3H9QA 3VOSA 3ZU5A 4FCCA 4YPOA 2I65A 3K73O 1M2WA 1HXHA 4OMUA 2IZ1A 2VYND 3L6EA 3OSUA 3TNLA 1OBFO 1UZLA 3MJ4A 1Y8RB 2W2LA 2BD0A 4L4XA 1UDAA 2Y99A 2H9IA 3E8XA 1NPDA 4I5EA 5I7VA 1DFHA 3VC7A 1E3IA 1HDCA 1N1EA 4Q3NA 5HS6A 1C3VA 3RBZA 4FJ1A 4ZGWA 2NADA 4TZTA 5COBA 4BVAA 2YW9A 3H3FA 2P4QA 2V7PA 3VH1A 3U4HA 4RZHA 1OC4A 1R4MA 2DFDA 3WR5A 1T2DA 3AI1A 3EZLA 1M75A 3H2SA 3ENNA 1R12A 3GUYA 4CM9D 4QQRA 4NQZA 1GUFA 4D7AA 3GNTA 1Y9AA 4QFDA 2P9CA 1P0CA 3AY6A 3U4CA 5BSHA 4BGVA 1TB4A 1DIHA 5KOIA 3TJRA 1KEUA 2VNAA 2DT5A 1I3MA 5ADHA 3PHLA 2X5KO 4CM6A 5L53A 3TN7A 3W8FA 2AQHA 5HA5A 3I4CA 4CV0A 3IP3A 2QRKA 3RUCA 5TC4A 2FWMX 1N92A 3C8MA 1LBEA 3AUTA 3ZWYA 3ANLA 3JQFC 4WKGA 4MIEA 4FFRA 4BKPA 4OHUA 3GN2A 4YT8A 1WWKA 4HUJA 4UEJA 3ZV6A 1P31A 4W7HA 3RI3A 3ZWWA 3EVNA 1LLUA 5HWSA 3CUKA 2NU7A 2O4UX 4GSLA 5A02A 1IHYA 4H3VA 3ZWVA 4MVJF 1OMOA 2VWPA 4XRRA 2GNAA 3MJEA 1LLDA 4L4RA 2ZCVA 1CQIA 4EI2A 5AXAA 1QKIA 1CDOA 3DC2A 3JYOA 1U8FO 3RWBA 1X13A 3MOIA 5ICSA 1H2HA 2VYNA 4MOWA 1XU9A 3VPXA 3L0DA 4B3IA 5DBFA 4CUKA 3AK4A 2EJWA 3WGQA 2O3JA 4NJMB 1B2LA 4IBOA 4KQWA 3DMTA 1O9BA 1PJ4A 4IDCA 1Y9EA 4L74A 2QYSA 3HNPA 1JVSA 2ZTMA 2RCYA 3NV9A 1ISGA 1FMCA 1HRDA 3RD5A 4CMHA 1C0IA 2Q2VA 3KYDB 3X2FA 2VCYA 3V1TC 1UAYA 5L45A 3GVPA 1C0LA 3IKTA 4AVYA 3BHJA 3PIDA 5KJCA 3F5SA 4RPHA 4LCEA 1DIGA 3HDJA 4D46A 4AJLA 1BXGA 5LDHA 4CM9A 4GL4A 2B69A 3ZGYA 1P0FA 1KVQA 3DMYA 4A26A 3JQBA 1TT5B 5I9MA 3VVCA 4B4OA 4DLLA 1FF9A 2X22A 1F06A 3EY4A 4KQXA 4ZRNA 4A73A 1QXSA 2RIRA 3FSRA 1YL6A 3MJCA 3AY7A 3I4FA 2CDCA 4R16A 1E3EA 4CM1A 5JXWA 1ZKMA 4AICA 3OJLA 2A92A 3WOHA 4IDBA 3Q9NA 4IGEA 4B79A 1OAAA 3DHYA 4R1NA 1PX0A 1ZVMA 2Q1SA 2ZATA 3QQPA 5JO9A 5B12A 3QWHA 1MP0A 2GZ3A 3UHAA 3GMDA 5JY6A 4QTZA 1E3WA 1J6UA 4FC6A 4GLOA 2VHVA 2XXJA 3B1JA 3ANMA 3ONDA 4WCFA 2GD1O 1IL0A 3VZSA 3PFWO 1SB8A 2GZ2A 3PHJA 2DPHA 1YQDA 1Y8QA 2D2IA 2FR1A 4MP6A 4OYRA 5BSEA 5FFFA 1PU2A 3FF4A 5GMOA 2EP5A 2H6EA 1SB9A 3FR7A 1NNUA 1D1TA 4OSPA 4R1UA 2AE1A 4UVHA 5JLAA 2GDZA 4BB5A 4BQRA 4E2XA 2EWMA 4PZDA 3ZWCA 3PGXA 3OJOA 1UDBA 4Q3CA 3F46A 1XQ1A 3H9GA 3PDUA 1SAYA 3PTZA 2ZB8A 4ND3A 4RF4A 1ZUD1 1P45A 4BNIA 3ZHZA 1NWHA 2FSVA 5A5FA 5IZCA 5ICMA 3TZQA 4XJTA 3RUDA 2RH4A 1OC2A 5JS6A 3BHMA 2NV6A 3B1FA 2WEKA 4BQPA 4G2NA 1I2CA 2PGDA 4JJFA 4WNCA 1HWYA 3U0BA 3A9WA 4J1SA 4MO2A 4HX5A 1WPQA 4JIGA 1DHTA 3DOCA 2WD7B 4O1MA 1P1KA 3PQFA 1I3KA 4EUFA 2C5AA 2D4AA 3GFGA 4CLOA 3NTQA 4I8XA 1PL7A 5ILOA 1D8AA 3TOXA 2HMWA 3IC5A 1B0AA 3E82A 2P68A 3ICPA 3D5TA 1RWBA 3WSVA 3PGJA 4CMAA 5JCJD 3HJAA 4CMIB 2PTGA 4S1VA 1T2EA 2D5CA 3GR6A 5KJFA 2AXQA 5EJ2A 5HRUA 2NTNA 2PH3A 4E13A 2BGMA 2NQTA 1AHHA 4AJPA 2GYYA 2ZYGA 4TVBA 5JAZA 3UFXA 2JHFA 3JCZA 1V6AA 1ONNA 2X4GA 4NZ9A 4LCJA 5TJ9A 2C07A 4IQ8A 3KLMX 3DBLB 3ZV3A 4O63O 1VJ0A 5HS4A 4GWKA 2YHIB 1P1FA 2YZ7A 4CQMB 3G3EA 4INAA 1AN9A 4DQUA 4OJNA 2NNLD 5FI5A 2Y1EA 2VYVD 2OGUA 4OGWA 3DHNA 3GLQA 2ZTVA 2RHRA 2VZ9A 3S55A 5A04A 3WTBA 4YWJA 3OFSA 3VPFA 1W6UA 4ZQEA 3H5NA 3D4PA 4YRDA 4AJHA 2W2KA 5F5NA 1U4SA 4NBVA 8LDHA 3N74A 1P9LA 3W8EA 1LDYA 4YTEA 5KVVA 3ADOA 2G76A 3PDJA 4YJGA 1FDVA 5A3JA 1I32A 3QWAA 4BB6A 4O6VA 4GGPA 3ONEA 2P91A 4BV9A 2GPTA 4II3A 1ZEJA 1ADFA 2VOJA 3D7LA 4B4UA 1H0KA 1LRJA 3JQFA 3PI7A 1NQAO 1G0OA 1UXIA 2PH5A 3NKLA 3I9KA 1QG6A 5DCYA 1A72A 1SEVA 1DSSG 4ND5A 1M76A 1ZK4A 3DDNA 2PV7A 3KM0A 1PQUA 1GQYA 2NVUB 5A9RA 3S2GA 2DTEA 3HE3A 3C7CB 1BMDA 1DO8A 1VSUA 2I66A 4CMEC 3L4BC 3AUAA 4EDFA 1U3WA 5JCJA 4CMCA 4FOSA 3F47A 2WMDA 2YFHA 3HDYA 4M89A 5DT9A 3DHEA 3KLPX 5G4KA 3ZN2A 3ZWPA 2C7GA 1R6DA 1B7GO 4WECA 4NBTA 3VPHA 1QMGA 3DBVO 4IGFA 3QWBA 5JE8A 2ZTLA 3KTDA 1Z6ZA 3SEFA 4J1QA 2XOXA 3DZIA 1PS0A 5EERA 1PJ3A 5AVOA 2AHRA 4EJ0A 3ICCA 3OP4A 1LC3A 3DTYA 3SC6A 3I9MA 1IYZA 5B37A 3VHRA 5GZ3A 2AG5A 3HB5X 2AE2A 4BGUA 3IIEA 4IIUA 3ZNPA 5JC1A 3DZGA 1AHIA 4WOJA 5F1KA 2Q1UA 5JYAA 2DVMA 2I99A 5LCXA 2WDZA 4XYBA 4R01A 2VYVA 2YDXA 4I08A 3KHUA 3TDKA 5C7OO 1MLDA 5B4VA 1UZMA 3LLVA 1B8VA 1CF2O 5TLSA 2GF2A 4YJFA 1Q1NA 4XQEA 3GOHA 2R00C 4BMSA 3WJ7A 1YOVB 3V5NA 1EFKA 1E1LA 1PJTA 2QRLA 2VOEA 3RJ5A 3ST7A 2JFHA 4J7CA 4U6QA 4UULA 2CDBA 3UF0A 4TRJA 3LT1A 3TZKA 2JCXA 4FFMA 2HMUA 1DEHA 1PGOA 4QO7A 3BTOA 3DQPA 1G1AA 4FS3A 4U7WA 4CM4B 4XX0A 1N7HA 3RFVA 4XB1A 1HE4A 2DPGA 1E6WA 3MCVA 3HN2A 2J5QA 3JQAD 2OO5A 2Q1TA 3DEYX 1F0YA 1HEUA 4CMBA 3TOZA 5I9LA 4QO8A 2HJSA 1K6IA 2DTXA 2FZWA 3F4LA 1LXCA 2BHLA 4Z3KA 1U5CA 1XKQA 3H8VA 4GLLA 3FWZA 1Q2XA 1N9GA 1U28A 4YVFA 1RM5A 3FHLA 2HLPA 3CXRA 4P8RA 5K6AC 1A4UA 3O8QA 4Y6SA 1WZIA 2EW8A 3ETGA 4OOEA 3UW3A 4XR9A 4MVJM 2VWGA 5G0SA 4FGWA 2BKAA 4PG7A 2Z5LA 2C54A 3CPSA 3GF4A 1L1FA 1IOLA 2O3RA 1DAOA 3NGXA 1B26A 2UVDA 1T1RA 5DCWA 3E9QA 4HFNA 4Z9YA 2CDAA 5I7FA 2W8ZA 5T67A 1L7EA 4L76A 1R0SA 2Q45A 2IEDA 4CM7A 1UP7A 1OZAA 3ZDFA 1V3UA 3ROQA 2V6MA 4M8SA 4B7CA 4J0EA 4XD2A 4BIIA 7ADHA 3KRTA 4DC0A 3G1UA 4EZBA 3C7AA 3Q11A 2AMFA 5L95A 4K26A 3Q6IA 3DBHB 1MA0A 1NXQA 2D5AA 1ENOA 3S2EA 3PEFA 3ZHBA 4R1SA 1PZFA 3K5PA 2BGKA 4RCVA 3ROPA 1HDGO 4XIJA 3Q0EA 2VHWA 3NRCA 4UUOA 4JX8A 4E0BA 3GVHA 4E2ZA 2YV1A 1P1JA 2HUNA 4WK6A 5BQFA 1ISJA 1AXGA 2Q3EA 4KUHA 3X2EA 4J1TA 5A9TA 1EDOA 1DJNA 4E2WA 3QSGA 2EP7A 5L7WA 2A9FA 1KYQA 2OMEA 2NTJA 3JQAA 2IXBA 3LDHA 4PIVA 1XG5A 1LTHR 1RJWA 2PZLA 3H3JA 3V1YA 4S3MA 3LT4A 1JKFA 3BMNB 2A94A 2IE0A 2Q2QA 3GVCA 4B4WA 1PGPA 5T6BA 1ZZEA 3DBRA 3VKUA 2YYYA 1E7MA 3ADPA 3WNQA 3DOOA 5KCZA 4YJHA 2HK8A 2HMSA 2QIOA 1Z7EA 1OI7A 3JQ6A 2FPPA 5TX7A 1H6DA 3MTJA 1LDMA 1Z74A 3U5TA 3RC7A 4BGEA 4TROA 1NPYA 1YKFA 2GR9A 2PFGA 1VJ1A 1PJ2A 2UAGA 3DMTC 3QVWA 2PK3A 3K8ZA 1Y8RA 4NG5A 5AXDA 4L73A 2X7HA 4HY3A 2V6BA 2EV9A 1A7AA 5CG1A 3WGTA 1YGYA 4FW8A 1ZK0A 4Q3EA 4XZ3A 3ZHYA 4RL6A 3AFNA 1B16A 1KOLA 1JTVA 3F3SA 3G49A 2JKVA 1VLLA 1PJCA 3DZJA 3V2HA 4MP8A 3ON5A 3KVOA 1EK5A 1EE2A 1RYEA 1EVZA 4BO5A 1SZJG 1LEHA 4HFRA 4WUVA 4XWYA 3B6ZA 3LT0A 1YJ8A 2FZEA 3LVFO 4YAJA 2C20A 1K5HA 3F6YA 2A35A 4CMEA 1EQUA 3D1LA 3L4BA 3PJGA 1YS4A 1P3DA 1O0SA 4WPGA 1B15A 5IDQA 1YL7A 3BMOA 4R3WA 5L40A 3U3XA 3MEQA 3P2OA 1F12A 1YVEI 1IULA 4KZPA 4R68A 1NM5A 2I76A 3COSA 1LA2A 3JQGB 2W90A 3LU1A 4GX2A 1LQUA 4UVDA 3ZWBA 4TKMA 3DR3A 1XIVA 1C1XB 3GPIA 3GK3A 4RVFA 5A9SA 3WGIA 2O50A 5A5EA 2O2YA 5HBRA 3MOGA 3C1AA 2PD6A 3ITKA 4IDFA 2XXBA 2FY8A 4GPD1 1JQBA 4MVJI 3BMCB 3JYLA 4EEXA 4E12A 8ADHA 1B8UA 3QA9A 3V1UA 1KIFA 5JYDA 3B1KA 4K1LA 2FN7A 4D45A 5JAMA 4IXWA 4Z0TA 3GHHA 3ASUA 4U0KA 4AJ4A 2HMTA 3I6QA 4ND2A 4TRMA 3UN1A 3SJ7A 4BNZA 4IJWA 4GX0A 1QLHA 3NJ4A 3EC7A 3LK7A 5JDCA 1A27A 3TWOA 4MVJE 1SEPA 2R00A 4Q3DA 5IZCC 2Q99A 4A27A 3QW2A 1LC0A 1ZJYA 5IXSA 5BSGA 2HO5A 4R51A 3AM3A 5THQA 3OECA 5AXBA 1ZK1A 3W4JA 1PEDA 1ZMTA 1HZZA 1V35A 2NU8A 2QW8A 1NHWA 1ID1A 3R1IA 1SO8A 1YJQA 5KKAA 4CMGA 3KYDA 1YDEA 3PWSA 1H6BA 4EUHA 2HKIA 2VNSA 1JDJA 2FSSA 4A7PA 1XSEA 2G0TA 4CMJA 3FI9A 3TQHA 4WGGA 4F45A 3JV7A 1Q0QA 1ARZA 3WQRA 5EQFA 1YDWA 5TS3A 2PNFA 5DNAA 3G79A 2B0JA 4YJDA 2GLXA 4YT5A 3NTRA 1E7YA 4CL8A 1XCBA 1TT5A 2NVBA 5K6AA 4P4NA 3WTCA 3LC7O 1NVGA 4CLDA 3UUWA 3EVTA 2OHXA 2POQX 4TRRA 3EW7A 4KDFA 3LF1A 3JQ9C 2VN8A 4IDAA 2W4QA 4KUGA 1T26A 4UEKA 1K89A 3PJEA 1TXGA 4CUJA 4OOFA 3GH3A 1U5AA 4K6FA 2EXXA 4PLTA 1MFZA 4DIFA 1ZFNA 3RBXA 4CR6A 4Z6KA 2E82A 4YBZA 1GL3A 1VM6A 1R4NB 4UEOA 3WSWA 1I01A 2IODA 4CLEA 3RBVA 5AXCA 1C14A 1ZXLA 3JD2A 3LQFA 1QLJA 1YXMA 4RPLA 5G0WA 4ILKA 1Q0LA 1RPNA 4EUEA 2AQIA 4CQMD 5CHEA 2AQ8A 4D0RA 2TMGA 3ZU3A 4BMVA 1BVRA 5EMHA 3AFMA 2WYUA 1W8DA 4DL9A 3PYMA 3DZFA 2B36A 5KJEA 3W6ZA 4FFLA 3Q2IA 3QVXA 3CMCO 2GUGA 3GZNB 4KP7A 4CM8B 5JO0A 3MWEB 4FDAA 3GEGA 1ADCA 5L4NA 4FN4A 1XU7A 1DC4A 1YBVA 4U6SA 4E5PA 1VPDA 5DP2A 1X0VA 4YA6A 2I9PA 3WWZA 2OORA 2YHUA 1Q7BA 3BYZA 4ZJUA 1PS9A 2Z95A 3NDJA 2J3JA 1S7CA 3T4XA 1GQQA 4JLWA 3ZV5A 4BHTA 4W82A 3RROA 3CEAA 4LVUA 4M1QA 5BR7A 3DZBA 5J23A 1KVRA 2WD7A 3U62A 5JAIA 1I10A 3SLKA 1LLCA 3TRIA 1NPTO 1AUPA 1ZH8A 4KMSA 3SX2A 3N58A 4C7KA 1GUYA 2D59A 3BA1A 5JMWA 5IDYA 3A1NA 5A3VA 2OOSA 3DTTA 4A5OA 4ZQHA 2PD4A 5ITWA 3TFOA 2E48A 2AEMA 3ETDA 1XHLA 3P19A 3GAFA 5ITVA 3GRKA 4CMIA 4RV9A 1JWBB 3DFUA 3E1KA 2QX7A 4NK5A 4NR0A 3I9NA 1NBOA 2ZJ1A 4RLSA 3ZWMA 1O6ZA 3IP1A 1NX6A 1CIVA 4R54A 5CPBA 5JW6A 2Y1DA 1PQPA 2FR8A 4TQGA 4XR4A 2JFFA 1KERA 3ANNA 3I3OA 3WYEA 5TT1A 2V6FA 4LVCA 2HK7A 3W4KA 3VPGA 3T4EA 1GCUA 3GC6A 3O9ZA 5T57A 3K96A 4WASA 1XQ6A 2O48X 2YHIA 4KWIA 3E9NA 2D1YA 4W6ZA 1ZK2A 4CQMA 1FDSA 4YT2A 3GG2A 2C29D 3DAPA 1SMKA 2VZ8A 1HSOA 3EAGA 2J3IA 1I5RA 3I9LA 1ISFA 4J2OA 4PLFA 5H83A 5JPIA 3WGGA 5HM8A 4DBVO 2NU6A 2VRBA 4GSKA 5LC1A 2WM3A 3JQDA 5G0TA 2PA3A 1ONOA 4QECA 3TFQA 3LC2O 1I3LA 1K0UA 2HU2A 2YFQA 3LYLA 2BFMA 2JD0A 1I2BA 4IDEA 2UDPA 2HCTA 4LW8A 3AU8A 4OSOA 1HYHA 1X7HA 4IQ0A 1HSZA 5IJZA 1ENYA 3DO5A 4FFPA 3JSAA 4XQ9A 3IL2A 1H94A 3G0OA 4XEHA 3E48A 4GQAA 1E3JA 4PRLA 5IDXA 2QZ9A 1R0KA 4WNIA 3CZMA 4P4LA 1E7RA 4CJXA 1HYEA 4PVDA 2DBQA 4BNGA 3VAZA 2Q4EA 3HWRA 5L4SA 4OIMA 2O7QA 4Y9DA 3CTMA 1ZCJA 3PIIA 4R9SA 3W4IA 1YQGA 2Q49A 3WGHA 3KSUA 3WBBA 3FWNA 4TVOA 4KTTE 1ZIDA 4HBGA 4BNJA 1NFQA 3GVIA 4B8ZA 1FDTA 4BO9A 1R4MB 4HFJA 1ZK3A 4J6FA 2ZIZA 4G81A 1A9ZA 4P4GA 3OF2A 2X86A 4N5LA 3NAQA 1Z82A 3HDQA 4UUPA 2R2GA 1HL3A 3Q1LA 1UH5A 4XQGA 3D3WB 4XQCA 3QWFA 5C7IO 3U49A 1OFGA 4AJEA 4YAIA 1XELA 4J49A 4MVJH 5IAAA 4XYMA 3QV1A 3FN4A 2FOIA 1TLTA 2DQ4A 4YAEA 1SCUA 4IJUA 4UVIA 2PKQO 3JQCA 4ZD6A 1YB5A 3DWFA 1HDYA 4BNNA 1EMDA 4FJ0A 2NTVA 2G82A 3RAJA 5TT0A 1R16A 5KIAA 4M49A 2BFOA 2VTDA 1IZ0A 4DPLA 3QJ5A 4I5FA 1TT7A 3U4DA 1G6KA 5JNLA 4BNHA 3WB9A 1VRWA 6LDHA 1D3AA 1A7KA 1U8XX 1UXHA 2AA3A 5COAA 1QP8A 5TJHA 1BSVA 3C3XA 4JP2A 5FEUA 2QHXA 3JQ9A 4RVGA 3OA0A 3VVBA 1DXYA 4D42A 2PY6A 3NTOA 5JAQA 5G2OA 1VL0A 3I1JA 5LDGA 3K31A 1U7TA 4CQLB 1HZJA 1QYVA 5U4QA 4XDZA 3L9WA 5MDHA 2ZTUA 2PZKA 2V6GA 5JYEA 3ZWNA 1YWGO 3Q3CA 1TI7A 5JYFA 4DA9A 1Q7GA 2BELA 4ND4A 2HSDA 1ZW1A 4IS3A 4TSKA 4GKVA 4OL9A 1ENZA 4XB2A 1EDZA 2ZKLA 1RM4A 2P2SA 3MTGA 2FR0A 4Z0PA 1PWXA 1GYRA 2IYPA 3D4NA 3RVDA 4HNGA 4RF5A 4J7UA 4IDGA 1D4FA 3P2YA 1BRMA 1YB4A 3GUCA 3UCEA 9LDBA 3GG9A 4B8WA 4RO0A 5TIIA 1GZ4A 1XA0A 4NFHA 4BO0A 4I5DA 5JMPA 1ZSYA 4EEZA 4L9RA 1YBMA 1BXGB 4CPDA 3GQVA 1E1MA 2WYVA 1YE3A 3MJTA 1LSJA 5G0UA 3RQSA 4MVJG 4E5YA 4OQYA 3BTSA 2PGJA 2JCYA 2WSBA 2X9NA 3GHYA 4AFNA 1E6UA 3E9MA 4GX1A 2WD8A 4D3DA 5IF3A 1YL5A 4E5KA 3I83A 3MWDB 3H9EO 1DC3A 2Y1GA 3HQ4O 1NVMB 2X0RA 1U3UA 5I8WA 4JBIA 1LJ8A 3ZU2A 4NFSA 4K28A 4PG8A 1ML3A 4WLEA 1T2FA 3DZKA 4AJ1A 1E3WB 4WCFB 4F6CA 3SVTA 2Y0EA 3D3EA 4RZIA 1NFFA 3IKVA 1UUFA 1Y8QB 2DLDA 4WLVA 2GN4A 2P5YA 4ALMA 1ENPA 4A2CA 1JVBA 2X8LA 3FCOA 3IOYA 1DIBA 4E2YA 1WDKA 1LU9A 2O4CA 2X9VA 3KYCA 4ZRMA 5I8ZA 2YV2A 3GMSA 3QVTA 4JBHA 4N5NA 3TZHA 3KETA 2XAAA 3LT2A 4R41A 5T8KA 3ROMA 1ZO8A 3PHIA 3SJUA 2O23A 1GFSA 1NVTA 3KB6A 1ULUA 4YQZA 3JQ8A 2I3AA 4BOYA 3VTFA 3CKYA 3JD0A 1K6JA 1JKIA 1HE2A 3BMNA 5U9CA 1LDNA 1GTMA 3C7DB 4PLZA 2YY7A 4F46A 4D3SA 3TPCA 3DFZA 1NTOA 3RASA 1LNQA 1KC3A 4DYVA 4IZIA 1DJQA 1WP4A 2Y68A 2P5UA 2DM6A 4DC1A 1JA9A 1UZNA 1JW9B 4AJKA 5JDCC 4BL5A 2EKQA 1B14A 5JCXA 5F21A 1HE3A 3FTPA 4BNKA 5F1PA 3JQ7B 5A1TA 3OJEA 5EN4A 3C85A 2RAFA 5EQDA 3UH1A 1M67A 3PZBA 3T7EA 5C5IA 3CE6A 4OO3A 2O2SA 5KVQA 1NHGA 4DRYA 1I8TA 1YQXA 1YB1A 3GDFA 4ZU3A 2PZMA 1VSVA 3UGKA 2VHZA 3E5RA 4M86A 1J4AA 1JWAB 1PZEA 3GVXA 3NX4A 3QRWA 5JBIA 1QYDA 3KZVA 5KWEA 2C2YA 5FYDA 4GKBA 2RBEA 3NDRA 1UXJA 4B7XA 1HDZA 4Q9NA 5B4TA 2FRDA 4EW6A 2VHYA 4AJIA 3PWZA 2O7SA 3NT4A 1EQ2A 1N2SA 3KBOA 4RLHA 4YCAA 4HNHA 3GGOA 2NACA 4F6LA 4XCVA 2B5WA 2HQ1A 3NT5A 3OIDA 3RFTA 4FBGA 4DPMA 1B3BA 3F1KA 3L77A 3VZRA 3JQGA 4ZQGA 1P1IA 3T7CA 1JAYA 2WJPA 5L3ZA 1C1XA 2AG8A 1Y7TA 1ADBA 3RCBA 3K2EA 4IUYA 5KNLA 3UOGA 2JJYA 1HKUA 1M6WA 3U9LA 1QYCA 2BGLA 4JXKA 3VH2A 4I9UA 3WWYA 3D64A 3G17A 3BMCA 3E03A 2HRBA 2B5VA 3VTZA 3PHGA 1HETA 2W2KB 1ZJZA 2J6IA 3W1VA 1ADGA 4FB5A 1WDMA 2VT3A 1UR5A 3KSDO 1LRKA 1N5DA 3JYPA 1QYXA 4C7JA 5A4DA 2JAHA 1G0NA 4GMFA 2I67A 4OQZA 3BAZA 1U9JA 1GPDG 3GGPA 4Z3DA 1PJLA 5TNXA 3M1LA 1BDBA 3ETEA 4NU6A 2BF7A 2J3KA 4ZVVA 4Y6RA 2Q22A 1U1IA 3WXBA 1WNTA 5BSFA 3BTUA 3D5QA 3SXPA 1X7GA 4Z0HO 4YRBA 1C1DB 2AEJA 4J1NA 1T4DA 4J3FA 1IB6A 2FPGA 4PZEA 2Y1FA 3KUXA 3WGYA 1XDWA 1XLTA 4CLXA 5DP1A 1LDBA 2B35A 3AWDA 4JCOA 4E3ZA 1BW9A 2YUTA 3FTNA 4QFCA 1DOHA 2J5RA 4Y67A 3WG9A 1PGNA 4D79A 1IZ9A 3QVSA 5CDUA 4CLRB 4GMGA 3KYBA 1P1RA 4FR5A 2ZB4A 4Y98A 2IZZA 3H2ZA 1R15A 1H93A 2WWRA 4Q3BA 5CEFA 3GY0A 4JN6B 5AOVA 3PXXA 2NVWA 1C0KA 3VH3A 1ISMA 4J4BA 3R0IA 1EVIA 2JCVA 3NYWA 4LMPA 4FGSA 1MXHA 1EUCA 3I6IA 3JD3A 1E5LA 3HG7A 1JKJA 4TZKA 4C4OA 2BLLA 5C7LO 4HFMA 3W8DA 1YRLA 3ZHXA 1GYPA 1DLIA 4Y6PA 1O8CA 1GEGA 3S1LA 4OKNA 5I7EA 1R4NA 2B4QA 2BI7A 5L4LA 1GAEO 4FD3A 1MXFA 4PLCA 1HTBA 3K2BA 5ENDA 1GPJA 4LMRA 5THKA 1K3TA 4J16A 3I5MA 3STHA 4MKRA 3JD1A 3PK0A 3GNSA 4RDIA 2X5OA 3WLFA 1B8PA 3FPLA 3B70A 4NH4A 1W4ZA 1MB4A 3IUPA 1PGQA 1F17A 1LSOA 4ALKA 5BNTA 4IINA 3EYWA 4NBWA 4BMNA 4MDHA 1MC4A 4HKTA 3FD8A 1O95A 2NQ8A 2EG9A 4IXTA 4UVGA 4YYZA 4XJSA 3GZNA 1MG5A 1H2BA 4CV3A 2DKNA 4BNFA 1I2ZA 4CM8A 1GEEA 2NWQA 1E0DA 4B7UA 1R0LA 1VL8A 3Q2KA 1LSUA 1YBAA 4BO4A 4IPTA 1ZSNA 1LQTA 1MV8A 2A4KA 1N9GB 1PGJA 3FBGA 1XGKA 1ISHA 1UAGA 4GI2A 5CFZA 1CERA 3HHPA 3ORFA 2EHDA 2ET6A 1ULSA 4NJOA 3RUIA 2EERA 2PWZA 3O8QB 5CP8A 4FIZA 1EVYA 3ONFA 1D7OA 4CR7A 4F3YA 2GRAA 2BH9A 3GDOA 2X0IA 5EPOA 4J9VA 3ZWXA 2Q50A 3GEMA 4CM3A 4E30A 4PLGA 1AE1A 1MFPA 1OOEA 5KJ6A 1V3VA 1E7SA 3PP8A 4LN1A 5IFLA 3WX0A 3M2TA 3PWKA 4BNXA 1PTJA 2E49A 1TEHA 3L07A 1CWUA 3OM9A 3OHSX 1EZ4A 3JD4A 4XKJA 2OP0A 1DRWA 3MZ0A 1XWFA 1VI2A 4UAGA 4PG5A 5IN4A 3WYCA 2YDYA 3L4SO 4DBZA 2BFPA 4NJMA 2EF1A 2EGHA 1CJCA 2GZ1A 3HN7A 2GGSA 2OP1A 1Y6JA 2X58A 3GN1A 1ZBQA 3PRJA 4M87A 4EYEA 4LRTB 1MG0A 2JD1A 3BXXA 1BG6A 4GVXA 5C37A 4BS9A 4YEDA 1ORRA 4FSHA 2X1HA 1FJHA 2HRZA 3H7AA 4ESOA 3AOEC 4LSWA 1WAMA 4J43A 4RDHA 5F5LA 4R4JA 4FOOA 1T2AA 4R5HA 4EJMA 4JP3A 4WE3A 2Y1CA 3GEDA 5L9AA 3WGOA 1N1GA 5H81A 3JQAB 3ABIA 2NSDA 2ZB7A 4DLBA 1QRRA 3IJRA 2CNBA 2Z1MA 5KVSA 2D8AA 4BNUA 3QP9A 4D44A 4DVJA 2WE7A 5T64A 3RC2A 3ZZNA 1H9AA 2ZQYA 5F1OA 2LDBA 3NEPX 4YJHB 1V0JA 1BXZA 1F14A 4R1TA 3BIOA 3WIEA 4WLFA 5IN5A 4ALJA 3C1TA 1PSDA 5BNIA 2E4AA 1H5QA 2B4TO 2Q4BA 3HZZA 4GAEA 4N54A 1T1SA 2HMVA 3VKVA 3AW9A 4DGSA 2C59A 4NIMA 1DFGA 2VWHA 3ITDA 3OH8A 3GDGA 1X15A 4IDDA 4DQXA 3F4BA 1QV6A 4O0LA 1PJBA 2I3GA 1U3TA 4LRSB 2CMDA 2Y93A 3BMQB 4J4HA 2CF5A 4NFYA 3O26A 1FXSA 4LGVA 1HDOA 5TF4A 3D4OA 4G5HA 1AGNA 5CDTA 4CR8A 1DBVO 1MGOA 3OA2A 3D3WA 4IY1A 5DULA 1DDOA 1E92A 3HADA 3BMOB 3INGA 3N7UA 1I30A 3VZPA 4L0QA 4FC7A 1B3RA 3I52A 1PS8A 5IG2A 3KO8A 1VE9A 2IDZA 2WE8A 5GZ6A 4RF2A 5ENVA 1DLJA 3WDSA 5KJ1A 3H9UA 2VUTA 3V8BA 5A9SB 3PPIA 4BNTA 5A05A 3WS7A 3WFJA 2UYYA 2H63A 4RORA 1KEWA 2C5EA 1NR1A 3JYNA 4YRAA 2ZYAA 4E5NA 4XRGA 3JYQA 1JLLA 3I9OA 1IPEA 1EK6A 2ZJ0A 4JJIA 4ZQBA 3OMLA 4B3JA 1T24A 2HDHA 2JHGA 1P77A 3QHAA 2OBNA 5CAEA 1U2DA 3OJ0A 3LSYA 1H6CA 3HB4X 4WCDA 2ZCUA 5T8KC 1N8KA 4CQLA 3FNFA 3Q9UA 2C0CA 3M2PA 1L7DA 4NPCA 1H6AA 4KOAA 4AG3A 3ULKA 1GV0A 4U8GA 3PQDA 4OXNA 4E6PA 4QT0A 5JDIC 3RKUA 1I24A 3DBLA 1BXKA 2F00A 4D3FA 4Z9XA 3HFGA 4MIOA 4IMRA 2QZZA 5T73A 1VKOA 1KVSA 3INTA 3PLNA 3EHEA 3QLJA 2J3HA 1AXEA 2WTBA 3IUSA 2EGGA 1I3NA 3R3JA 1X0XA 3O03A 3EGOA 3GPDG 3DL2A 4HWKA 4JJGA 1QR6A 4ZA2A 3K6JA 3C1OA 1Z75A 2VQ3A 3ZNOA 2P9GA 1J49A 4MVJP 1O89A 4D0SA 3M1AA 3ZCXA 1PL8A 3L6DA 3R6DA 2IYOA 1VKNA 2CD9A 4FFOA 3IS3A 4XDYA 1NQOA 3LC1O 4MKZA 3RFXA 4BO7A 1PR3A 4DPKA 5GY7A 4OH1A 1PZHA 2G1UA 3O38A 3DONA 1KBZA 4BNWA 1R37A 5ILGA 2PKQP 2D3TA 4YAKA 4QXMA 3RU7A 4YQYA 5K9ZA 2Q1WA 5B1YA 1NQ5A 4DIBA 3AI3A 1BVUA 5CDGA 3VPSA 2NVUA 2B4RO 4W7IA 4I5GA 2BMAA 4UVEA 4OXKA 1QYWA 3I9JA 1IUKA 3GFBA 4DTIA 2DUWA 2X0JA 5F3RA 2HJRA 2ZQZA 4WJZA 1GUZA 1MC5A 2P4HX 2PD3A 2Y0DA 4K9DA 4XYEA 3ZNQA 1Z7BA 5TSDA 4RVDA 3LLSA 1EE9A 4PG4A 5MGBA 2G5CA 2HAEA 5DBIA 1GZ3A 1XR3A 4AJJA 4ALIA 4XGKA 4XA8A 4R5MA 2W98A 4JBGA 3R3SA 5G4LA 1SOWA 3LF2A 3ROKA 4RPKA 4MP3A 4AJNA 4BO2A 4FJ2A 4XIYA 4BGIA 1QV7A 1KS9A 2Q2WA 4N18A 1T4BA 4OXYA 3E5MA 2VWQA 4A10A 1WW8A 3DAGA 5DOZA 1PJSA 1SPXA 4LISA 4R3NA 1XYGA 3MJVA 4PLWA 4MIYA 2F1KA 3AOGA 2FMUA 4RF3A 3OQ6A 4PCVA 3UCFA 1A5ZA 3VZQA 3UAGA 5A03A 4U0JA 1BGVA 2CSUA 2Y66A 3AOEA 1C0PA 4ZQFA 3TZCA 3GNQA 2E37A 2ZB3A 4NI5A 3ZWAA 1LX6A 3OEWA 1NAHA 2VTEA 4BNLA 2DBZA 4J2HA 3AM4A 3A06A 1YOVA 4OM8A 4BV8A 4EITA 4URFA 1DIRA 3JQ7A 4J7XA 4RQTA 4NHEA 2R6JA 2VRCD 4N7RA 4UUMA 5IDWA 4KWHA 2H1SA 4NNJA 3ZW9A 4HV4A 2AW5A 3P5SA 1E7WA 3ZWOA 5M6DA 2CZCA 1X1TA 3AJRA 2J5KA 4CM4A 3DXFA 1GCOA 3ZI0A 3A28A 1NWCA 4PZCA 1NR7A 3IAHA 4LK3A 1KVUA 3W6UA 4L4SA 4ID9A 2G17A 1RYDA 1IPFA 3GRPA 2X23A 3QY9A 4RVHA 2IEBA 3WJAA 1VC2A 3F9IA 2JD2A 5JSFA 4YB8A 3JTMA 1WMBA 3H5AA 5K0ZA 4GVLA 4PG6A 2UUOA 1V3TA 1KETA 4UUNA 5DZSA 3ZW8A 4FQ8A 4XYGA 3OQBA 5GZ1A 4EBFA 1E1NA 5FF9A 1V9LA 2O3QA 5BT9A 4DIOA 5DN9A 5J9GA 4J91A 4OKIA 1WXDA 4Y8VA 2OUIA 5CPFA 4PFJA 1PL6A 5ER9A 2X9GA 4PLVA 4ALNA 4E4YA 2V65A 2EJVA 2GERA 1UXGA 3UXYA 4JQCA 4KTVE 4D41A 3S2IA 1H9BA 1KVTA 1SOVA 2OBYA 3AUUA 4ITUA 1GYQA 3EZYA 1VL6A 4HXYA 1EUZA 3DBHA 4CUZA 3QE3A 4L8VA 3CH6A 5FI3A 4ALLA 4O59O 3FNGA 2GN9A 1GDHA 3A14A 4KDEA 3PVZA 5JY1A 1R66A 1ZMOA 4TKLA 3PZRA 1S6YA 2Y05A 4H7PA 4N5MA 5CG2A 1DRUA 3OBBA 2RHCA 5EESA 1FK8A 1PR9A 2CUKA 4DQVA 3A4VA 2O3TA 3IMFA 4CMKA 2IZ0A 3RUFA 5TGDA 4RQUA 2VRCA 1EBUA 2OL4A 3M6IA 1WDLA 4PGFA 4DMLA 1T25A 4W4TA 4R9RA 4WOKA 3H5RA 4BKOA 3FBTA 3AY3A 5ES3A 4W9NC 1I0ZA 3WYBA 2ILTA 1C1DA 3UKOA 1Q0HA 3EMKA 1KC1A 4MINA 3HUDA 3PFFA 1HYGA 4DREA 1JN0A 1HE5A 3OEYA 1KEVA 4TWRA 3H6KA 4PLYA 4AJOA 3VDQA 5JDIA 4XGNA 3O4RA 2VHXA 4HADA 3FNHA 1CRWG 3TL3A 3JQEA 5BNFA 1LSSA 1P33A 3E18A 4IQGA 3DAFA 3DZHA 4CLRA 5B4UA 4XYLA 3UICA 2LDXA 4WEOA 1Y5MA 4FPXA 3INRA 1MX3A 1DIAA 1HLPA 3GZ4A 3NJ8A 3OETA 4IZHA 5JFOA 4DLAA 4MJLA 3AI2A 2NUAA 4RPJA 1RM3A 1Q7CA 3LZ6A 1EBFA 2VT2A 5C3MA 3PLRA 3RUEA 1SC6A 1X1EA 4J9UE 4YACA 5L7TA 4CLOB 5KVCA 4NU5A 4H15A 3PYXA 2HK9A 3ZV4A 1NP3A 1J5PA 4RVUA 3UCXA 3BHIA 3HSKA 1ZXBA 4MKXA 3KEQA 3WFIA 1O94A 1EEHA 4M54A 3SLGA 1KEPA 4II2A 2D0IA
chains in the Genus database with same CATH superfamily
1OFHA 5CA0A 3CW2A 4H6XA 2Y0CA 2ZYDA 2YQZA 3AUSA 4NBRA 2JRCA 4Z4HA 4LWPA 1UQTA 5LBTA 1CRLA 4FEGA 4A9AA 2Y1OA 3F5QA 4EA9A 1Y8ZA 4XTCS 1A9OA 4GH5A 4FMCF 5ELMA 4M7OA 4KWTA 3V2IA 4W5OA 1MOPA 3QVKA 3IJPA 5J2UA 1SUAA 3TF5A 1YJAA 2R48A 3KAPA 3NS7A 3TZBA 3GQBA 5JWOA 2H31A 3GLUA 5J5AA 2EIHA 1RI5A 3WGJA 1E2BA 5ERYA 3E58A 4I36A 4M9XA 1TF7A 3CVJA 1AO0A 4IDOA 3KZ1E 3U39A 5CK4A 2ZREA 3K9CA 1O08A 2PZEA 2G9RA 1QGOA 2UUPA 4KO2S 3COYA 1ICEA 2WUWE 1NQTA 2D13A 3FE2A 2H1LA 3JALB 4ZDKA 4F2GA 3KR9A 2XKAA 4Y6GB 2OXIA 5I47A 1RJFA 4GX5A 4N7MA 4NZZA 3KSZO 1GL6A 5I51A 3OQIB 3VZCA 5E4JA 1BMFD 3JVEA 1GLNA 3TCKA 5JRJA 4R31A 4H7IA 1TYZA 1SNYA 4CBVA 1YIDA 2R6CA 2I3DA 2PZJA 2R9VA 2XNJA 4UDYX 3GA0A 3IPCA 5GM2A 1M66A 2HMYB 3P0HA 4W1QA 4ZXFA 4HDOB 1BX3A 1YAJA 1P4JA 4IM7A 3F3KA 4DWOA 2QYTA 4TLLB 3MUOA 4YJGB 2OCKA 3WNZA 1Z4PX 3GT0A 4OYLA 1FRFS 3BL5A 1EXMA 4L22A 4AJ2A 3L7BA 1BDMA 1GUBA 2GN6A 2VK8A 3DMDA 4FYMA 4QQKA 1G66A 1I72B 3DD5A 4WADA 1JDBB 4RGBA 5CHYA 2ID9A 4DXHA 4E03A 1WZEA 2ZZNA 1JU3A 1N2CA 1FFSA 1UPCA 4AY6A 1C7IA 1JHPA 2GX6A 2EKPA 3E22A 1E77A 3DOHA 4O5OA 3HH8A 3A1TA 1UIMA 4TMFA 4PSAA 5BOSB 3OOJA 1KMIY 2JA2A 1U7HA 3HFSA 4GMXA 2QVCA 3I23A 1QCZA 3LY7A 4HGPA 4DLZA 3A6KA 1DFIA 3PEEA 1MO2A 5E6SB 1TZCA 2BM8A 3VH4A 2ZZMA 5JQWA 4QYWA 1FVOA 2HBRA 2I6GA 2QP3A 1YI8A 1PFGA 3LAWA 3ESQA 4G63A 2F48A 3RC9A 4NVRA 5G4KB 1NURA 4LOIA 3OIGA 1MAWA 2AYYA 3ZBUA 2Z6AA 3THOA 1SUEA 1TKBA 3CUYA 2G08A 3GBVA 4NS1A 4I8IA 1YR1A 1E6EA 2H2FA 3L79A 3OX3A 3WHPA 4D74A 3ZHQA 3KYCB 4DQDA 1WRBA 3DEAA 4J0FA 4RK0A 1SA0A 3T4UA 4A92A 1G7TA 1W0CA 1KSJA 2QQGA 2YFYA 1MJGM 4OHVA 2I4TA 3NGLA 1DPGA 3I92A 1XMQB 2QW1A 2VSOA 4TTVA 3W2HA 1FFBA 3MGKA 3WNVA 1KI9A 1W4LA 2G80A 3E1SA 4GICA 4EVRA 2FU5C 5C81A 2ZSJA 3IUQA 1C30B 4UHFA 5IJ0A 3SBOA 2FZCA 3MINB 1JHQA 5KTKA 1AC5A 1KHTA 4N0QA 4TTJA 1Z12A 4N5DA 4U2EA 4U5QA 1ESMA 4JUBA 3AZQA 2H1RA 4CN9A 1P44A 4F38A 1E3TA 2YWXA 3CVWA 4G65A 1DRVA 2VTKA 1W59A 1Y7PA 3U09A 3OJCA 4E33A 2PKXA 2J3LA 2JJ1D 3THRA 1RP7A 1FFAA 1LD3A 5JMTA 1GQ2A 2EBUA 3T7SA 1ZN2A 4PXYA 1QQ6A 4GGOA 2QA5A 3TLGB 3HXPA 5AYVA 4JBNA 3DPIA 5KMGB 2EKLA 2DTDA 3HGMA 3GJ8A 3AQIA 4GWGA 3WRYC 4DDTA 2XHEA 5CDYA 3EPJA 2AEFA 2IW1A 1JU9A 1R9JA 1LI4A 1D0VA 1G64A 1YQTA 1WS6A 5DTMA 4EG6A 3ZLJA 2OCBA 3ABSB 2XUJA 1AKMA 5PGMA 4GI7A 1NXSA 3E23A 2QAIA 1N7GA 1MHTA 3UK2A 2Q7XA 1QRAA 4PC2A 3VZBA 4HEHA 1E5TA 3IA2A 2C4WA 1GNLA 2H2AA 5EXEA 5HJ2A 1LTKA 3KE8A 1KZGB 4IS2A 4TV9A 3L1VA 1GU7A 5COQA 3MC1A 2IPMA 1XKXA 3D0OA 3TDMA 1YDGA 2DKFA 5B7QA 5EL0A 1M6HA 1ZSVA 4CU5A 1K06A 1YIOA 3C5VA 4MVJA 4BZWA 3IQHX 1E1KA 3KEMA 4V1CB 1EAMA 1CQJA 2CE2X 1QE0A 2IIBA 2PCLA 4LZOA 1J2JA 4X54A 3WQQA 5E3IA 2Z5VA 5L3QA 4RSGA 1AGPA 4I1IA 3IDSA 3I0MA 2YYAA 3QHPA 3GJ0A 3TD6A 5CX1A 1F8GA 1KIMA 1QANA 2DC1A 3EUWA 4KXYA 3HCAA 3NUGA 4K7JA 4BKQA 4CV1A 2EWVA 4BO6A 3HCRA 4PX2A 1M6EX 2VL7A 4OF4A 1ZR2A 4AYWA 4P22A 3N2KA 2Q5EA 1KMMA 1EX9A 4AQDA 2ZIXA 5TRTA 4LTDA 1RHKA 1GZ6A 3C3DA 5DOVA 4KACA 1OH5A 4IJMA 1X8JA 2VATA 2W2LD 4TWIA 3FZYA 5CEEA 4L7VA 1WMAA 2G1PA 1PIWA 2REXB 1DKNA 1UP6A 1JEQB 1F4VA 5FI1B 1NNSA 6Q21A 1XYYA 1V8BA 3LVRE 4WCFC 1CS0A 1K66A 2QN1A 3I8XA 3ENKA 3W3ZB 3WMXA 4AO7A 4LJYA 3HR7A 3IEIA 2C94A 3AM5A 3Q10A 2VPYA 3C87A 4DQKA 4JLBA 3RIHA 4BKUA 3R74A 2VHCA 4MPDA 4OQMA 1HNWB 1J00A 5KU1A 1VJTA 5HUQA 4UHCA 1FNCA 2X0NA 1AK2A 2NO6A 5K3BA 4DADA 1BO6A 3BH6A 4B0PA 1ES9A 3R41A 2BTQB 3WL3A 2B83A 1L3BA 3IIIA 4Y2HA 2MU1A 1QWSA 1GKKA 2VO1A 2CVFA 2HSWA 3BIWA 3IP7A 4JQSA 2ODNA 2QU8A 4OVKA 4QXAA 1M34B 4ARZB 4BNVA 3IDAA 2YXEA 1MX5A 4TKVA 4YR7A 2CFTA 3I0NA 2JIZD 3QQ5A 4F2PA 3DB2A 1RXCA 4PN3A 4HNTA 3ENQA 1ODTC 1B42A 4C6HA 1G3RA 1D1SA 4LOJA 4AROA 2PJRA 1Y81A 3K16A 4OI2A 4EB8A 1TFUA 4GLJA 5KUTA 2H2IA 4D4KA 4P5PA 5ER6A 3E4DA 4S0XA 3HP1A 4JQOA 1ZICA 4FDTA 1ZL2A 3IP5A 4PONA 3SYKA 5FWNA 1ZXXA 1CQZA 5CCXA 1BA3A 4O2BA 4BVJA 1BW9B 5DMXA 1SBYA 5BR4A 5T6MA 4ND6A 2AD1A 4EF5A 1PR5A 2QTBA 3HZHA 1DC5A 4KGVA 4UFNA 1NW5A 5KSOA 3VNAA 3PQEA 5FTNA 3DFMA 1CLUA 1XL1A 2OHVA 4BZPA 4D0NA 1U1EA 2DBVO 2Z1NA 1NYTA 3RRMA 1YO6A 5AQ1A 1IE3A 4LYEA 3L9XA 3W1WA 1K2WA 2FPIA 3NT2A 1F0KA 3EOZA 4URXR 2NT3A 3K92A 3WQHA 3LMKA 1C4WA 4GM1A 4WWHA 4YPOA 4WZBE 2QK4A 1A7JA 5E95A 1M2WA 2LTAA 2C9CA 2P6MA 3N53A 4LZWA 3R75A 3L8DA 3WNBA 3IV6A 3H11A 5AH0A 4C4YA 1KXJA 3N5KA 2R1VA 3VA7A 4PCLA 1OBFO 4BQQA 3MJ4A 2ZLBA 4DBLE 1CZHA 4UOQA 1EB8A 2BD0A 4D2IA 2Y99A 2H9IA 2QU7A 3E8XA 3W0LB 1FP4B 1HBJA 1ZIXA 2PSJA 4G1EB 2L17A 4IQ4A 3VC7A 5DM70 4XWGA 1R4ZA 3CN9A 1ZU5A 1E2MA 3WJ1A 4BB9A 2WSSA 1UJNA 1TW3A 3D43A 5HS6A 4CU2A 2V54A 3MWYW 4IIEA 4WESA 3KJIA 4FJ1A 2WRZA 4ZGWA 5BQPA 5GPBA 2O8DB 3H3FA 1E4EA 1EWRA 5JD3A 4BQIA 3ORQA 3VH1A 3U4HA 1E6KA 1MQSA 1OKKA 1N6PA 2DFDA 3D6JA 3RV3A 3WR5A 3L6CA 3I9FA 4YHHB 3I58A 2H1CA 3LXMA 4MAMA 2ZXEA 3FUUA 1XQWA 4KE7A 4GYYA 4REMA 3HZRA 1JTFA 3EIXA 1R12A 3ENNA 4HGNA 3HY4A 3QEMB 4QQRA 4FSXA 5BQ5A 3RODA 4Z7NB 1XVTA 3ZGLA 1UMBB 2Y9MB 3U4CA 5A4MS 1JEEA 5KOIA 3L7IA 2EFGA 2VNAA 5DJ5A 3GZTB 1OZHA 2AQHA 1A8SA 1T3SA 5IBQA 1FJGB 2I91A 1FXUA 3AF0A 3DDUA 4EY7A 3DE6X 1KZ1A 4HQLA 1G7RA 3V7NA 2HNAA 3LL7A 3KL2A 4BMXA 1M2NA 4RJKA 3L02A 5GADl 3T9AA 4JYPA 1N92A 1LBEA 1TNDA 1VLZA 3ZWYA 3GWZA 1KOFA 1IBMB 4MYSA 3PRKE 2IJGX 3BXOA 1E20A 1QKJA 1WWKA 4DXAA 5HOQA 1SVSA 3RI3A 4R2JA 4INJA 4LMBA 2VA8A 3EVNA 1JHXA 4F97A 1D8TA 3CUKA 2NU7A 1YACA 3B1ZA 2O4UX 1NT2A 1GXSB 4ACBA 3GX1A 3BM5A 4MVJF 4XRRA 3M82A 5DU2A 3R20A 3LUDA 2BFCA 3QXCA 1RAFA 3C3MA 3IPAA 4X6XA 2ZCVA 4KYVA 4GUAA 1ZD5A 1QK3A 3DC2A 3WMEA 3KVNA 1ZVVA 3IMKA 1LFAA 3LUBA 3FDXA 4B33A 5JT1A 2DFPA 2JI8A 2QRNA 3CLUC 4K6MA 4OGGA 4TL7A 5D2CA 1O77A 1JFFA 2VYNA 1ZHHA 2ZWVA 3G2MA 3CKKA 3TLYA 4AUMA 3VR2D 5M5BA 2F1IA 3A1FA 2WY2D 1XDZA 2QJFA 4IEFB 4CUKA 3GLFA 2ODPA 3KPUA 3OZ7A 4NJMB 1M2GA 2KLHA 4K9LA 5BSUA 1ABFA 1EZ1A 4NOLA 2PPVA 2QF7A 3OKAA 4IDCA 4KDRA 2PA0A 2QYSA 1JVSA 4UHJA 2ABWA 2KX7A 3AH8A 3AERB 3NV9A 3R0VA 3VYSB 1FMCA 2Q2VA 1KJWA 3MN1A 4L7QA 1IQRA 4NKRA 1UAYA 4IKEA 4M1MA 2GBLC 3LX8A 4A23A 3IKTA 2P62A 1X9IA 5DTJA 5AMXA 3G59A 5G3YA 1SC4A 3FZQA 1DIGA 3F3MA 4UM8B 4D46A 1XKTA 4E08A 3DEFA 2HR1A 3QKSB 3K1TA 1XTPA 4YLEA 5HKOA 3VSAA 1O1YA 1XRRA 2WKSA 3I5AA 4HJXA 4CM9A 1MZVA 1KFEB 2P9YA 1EFUA 1P0FA 1U0OC 4KQ9A 3B2QA 1UJBA 2IPNA 3AKDA 3UHPA 4HLNA 2QS9A 4DLLA 1FF9A 2H4XA 1F06A 2X22A 1MJFA 1SVOA 3EY4A 4HAXA 3U9TA 4ZRNA 4A73A 2I4LA 4MQ5A 4PHGA 5EMKA 3QOXA 4R16A 3MJCA 3AY7A 3C3AA 3I4FA 1CZNA 1ESZA 1M9NA 4Y2QA 3GJXC 1ZKMA 2PKEA 4PYNA 3EULA 4DWWA 1B2RA 4V0NA 5KQGA 2A92A 3WOHA 4GYKA 3QI2A 3Q9NA 4ND7A 4LBWA 4NATA 2R7MA 1K97A 4B79A 3DHYA 4LQLA 1PX0A 1ZVMA 2Q1SA 2OK8A 2ZATA 4RY8A 1K5GA 2EZUA 3E9ZA 3LHKA 4P0TA 4V0OA 2GZ3A 5FXMA 2FLWA 3GMDA 5JY6A 4H7EA 1S9DA 4HI0E 3C45A 1MMFB 4HLUC 4EJFA 4GLOA 1J6UA 3M1YA 4ZVLA 1UJ2A 4WCFA 1FFDA 2ZAOA 2OO5C 2P4UA 3ONDA 4MR8B 4Q3KA 3AV3A 4M0UA 5CX4A 5LKAA 3GROA 3PFWO 1M3SA 4MP6A 4CWAA 4GL2A 2OGWA 2Q9AA 3BH0A 4PQRA 5IW8A 3M7IA 5EXXA 4ZEVA 5KX5A 1U3FA 1E2EA 3A1CA 3A4TA 2EP5A 4J6EA 4MA5A 2C78A 2O1SA 1BU5A 1OFUX 2P9QA 2H6EA 1Q15A 1WV0A 1PN3A 2TECE 1Z18A 2C3PA 2OXTA 2F55A 1NNUA 4R1UA 4UNNA 3OZWA 3N2ZB 5HKAA 1JPNA 5JZBA 3L6RA 2IP1A 2EWMA 1DP4A 4PZDA 4TS1A 1GZ5A 3IODA 1SC9A 2BDEA 1Z0IA 3PTZA 1GT6A 5FWXB 3Q8MA 4LY0A 1T9KA 1UEJA 1P45A 4UUBA 1W1IA 2DSNA 3V4PB 3ZHZA 1ZY2A 2WBLC 3SZLA 4BVFA 5BW6B 3H42B 2C0PA 5AD1A 1KQ3A 1YTLA 2R6DA 4ZEXA 1W4AA 5JD5A 1OC2A 3V8MA 5KSWB 1J0EA 2WIBA 3W7BA 2FE1A 4U3JA 1I2CA 2WJ6A 3R5KA 4A4DA 1Q0TA 1VLVA 4FEEA 3U0BA 3NGMA 1JDTA 5J2TB 1E18A 1NW6A 3NUQA 1TQ6A 3G2KA 1C7EA 1XPRA 1OCEA 2AFHB 2WYIA 5GOTA 1J70A 4O1MA 4NSNA 4EUFA 1M5RA 2GJKA 4AS1A 3GFGA 1RBQA 2HA3A 1RC8A 2HIMA 3D59A 1ABEA 5HMMA 5HSGA 4B1FA 5B1EA 1CJTC 1UK9A 3HI4A 1D8AA 1EFPA 3WWCA 3X1KA 2HMWA 1R5OA 1B0AA 2RH9B 3E82A 5BR1A 2P68A 3HRKA 2V7BA 1YS7A 2XCOA 1RWBA 2M1XA 1KZ9A 3WGNA 3EXG1 1USIA 2IYXA 3IYLW 1DAIA 2QP9X 4CMIB 2BMFA 5L3RA 4PBTA 4MYTA 5LZ7A 2HHAA 4TTSA 4XIFA 3P52A 2IBMA 1X6VA 3CGWA 1Z22A 4L3WA 1J9ZA 5K0GA 2LW7A 5HRUA 4ZQCB 1SQ0A 2BH2A 2WIJA 4LGYA 3L4EA 2OPBA 3FCXA 2C3UA 3LRPA 4R7ZA 3GIWA 4CTKA 1R5JA 1TC2A 4NV3A 1IHPA 2ZYGA 3GLIE 2DP4E 3FRIA 2PUEA 1LF5A 4TVBA 4N76A 1NJ5A 3GH1A 2WNIA 5CGQB 1KRXA 3H75A 2JHFA 2G06A 1RLUA 3NBYC 2E1PA 2X4GA 4NZ9A 4G1UC 3MLEA 4Z7JA 4B3SB 2C07A 3RBAA 4IQ8A 3EN0A 3KOMA 1FFGA 2XTNA 3LWZA 1IVSA 4TUYB 1AQJA 2XUZA 4GWKA 2H8GA 4REQA 4C07A 2VS1A 4CQMB 4HWGA 2CJFA 4INAA 2ZSIA 3QEOA 4OJNA 2C5LA 5DHPA 2WQ6A 4B2LA 2I6XA 5JALA 1L5RA 2J87A 1D2MA 3DHNA 4KLCA 4OGWA 4Q9JA 4DCMA 1XPOA 3OQIA 1TX4B 1XJQA 4TYMA 4M9UA 3KJGA 1JLSA 1LK0A 4YWJA 2QW0X 2BM9A 1JKMA 3D4PA 1QQ7A 3UJPA 4TWAA 4US1R 5F5NA 4XW2A 5EAIA 8LDHA 4NE2A 1QDUA 3DVSX 3N74A 1HK7A 3ADOA 3AIOA 2M98A 4YJGA 5I7AA 4M2LA 1A7UA 1F5SA 4MS4B 2P2CA 3VC1A 5AWFC 4K1XA 1J0CA 2ECQA 2GPTA 2WTEA 1ZEJA 2BFBB 3EPBB 1IY2A 3OTHA 5IEBA 3USZA 4M0LA 5JH7F 3OTWA 3D7LA 1G21E 1K9VF 3V33A 4B4UA 5IPFA 3PI7A 3RV4A 1NQAO 3NKLA 1QG6A 2O20A 3SWWA 1DSSG 5A7FA 1VHWA 1ORIA 4X45A 3WOVA 4YO7A 4DQLA 1LV7A 1RI1A 3OEHD 5F76A 2XUOA 4S04A 3LLCA 5AM4A 2DTEA 1H8HA 3VDMA 2ZYWX 1VSUA 4CMEC 2QJTA 5E6SA 1U0HC 4EY8A 2DQYA 1ZUNB 4KVAA 5FNVB 3RK4A 1L4GA 1LVGA 3D6HA 2VQ6A 3KQMA 4UDOA 1XZCA 1SKMA 1U8YA 3DV9A 4EOGA 5GJCA 3KLPX 4QUEA 5G4KA 2C7GA 1NM5C 3ZGNA 3EWAA 5KKNB 2JAWA 3AG6A 3H5VA 4GD3Q 3WDLA 4CKBB 1NT4A 3AR5A 2KS6A 3KTDA 3LCRA 1U90A 2MINB 1GTJ1 3DLPX 3PG5A 4Q05A 2IUEA 5LZ8A 2FETA 1C29B 2YCBA 4KPUB 5B3LA 2J33A 1KOJA 4DM3A 4BQEA 4NCNA 2W2TA 3DTYA 1E3QA 5LYYA 4NEHB 4OATA 5B37A 4UTPA 2ARKA 1YZYA 5GZ3A 1UBRS 2HN9A 2LWIA 3HB5X 4ZALA 1VL5A 4MV6A 1U9CA 4KMRA 4BGUA 2RHHA 2ZCJA 3D7RA 5JOQA 3L1IA 1CY8A 1NA5A 1FBNA 3ND7A 1C30A 1AHIA 1KPGA 2GBLA 1N0VC 1EWKA 2QGNA 2V59A 3MF4A 4MVWA 1RXUA 3ZZMA 2IKQA 2Q1UA 4JODA 1KSFX 4Q4AB 5I9IA 1Q12A 2I99A 1M1YE 4XYBA 2OBLA 3GFFA 4BV2A 3PC2A 4I08A 3KHUA 3H0KA 4JAVC 5CA1F 3ESCA 3BCHA 2BCEA 3WLSA 1B73A 1JHDA 1Q1NA 3GT3A 1SUWA 1NXXA 2P1ZA 4HWSA 2E89A 4EVSA 3GOHA 3PHCA 5AUNB 1P2TA 7MHTA 1L5FA 2AR7A 4X60A 1E1LA 2VOEA 3TLGA 3ST7A 3UWKA 1NP6A 3C5EA 2FK8A 4IKOA 2UZ1B 1IXKA 2VBFA 2XYQA 2PVCA 3UF0A 4EY6A 3PITA 5JS2A 3TZKA 1O9GA 2D74A 2JCXA 2HMUA 1IZ7A 2NYUA 4FFMA 4OMCA 4U2FA 4DNXA 4JHLA 1TZBA 1G1AA 3SXJA 3STWA 4Z7QB 1T9BA 1RXWA 1RTKA 4EJ2A 1EXDA 4XX0A 3RFVA 4BTEA 3MNFA 4J0QA 3AF4A 4X3OA 4HWTA 1NQXA 2ZUTA 1BOFA 2J5QA 1YZ3A 2OO5A 3M0EA 4RTPA 4QO8A 2VPWA 3WAGA 1RYBA 3F4LA 1LXCA 2XJ4A 1R1DA 2BHLA 3ROZA 1MTZA 1JDNA 3GYGA 4HDKB 4J8PA 4UBIA 1E79A 1JAZA 1SG9A 4UUAA 3H6HA 4ZT2A 1M33A 3B9BA 4MLZA 4DDVA 2I2CA 3ZY5A 1N9GA 5LLDA 4YVFA 1CFJA 1RM5A 2BSXA 2FGKA 3CXRA 4L8YA 4QPNA 1A4UA 3O8QA 4EZEA 3V4VB 3R0ZA 4JDUA 4RUKA 3ETGA 3VKFA 2QRHA 2YHSA 3BJIC 3UMBA 1BKDR 1H8EA 2VWGA 2PWBA 2GXAA 1Y82A 5HIJA 2C54A 1YR3A 2AG1A 4LNUB 1L1FA 2FAXA 1UM8A 1T9CA 2UVDA 3M81A 1G8MA 1Z6PA 3B1XA 2BMVA 2HREA 1EK1A 4LDNA 4JI1B 2H2HA 4ES6A 2QX8A 4YRNA 1KFJB 4OHKA 2PS0A 1J2TA 2CNDA 3L8GA 2PLWA 4R6WA 1TEVA 2WMOB 2ZOSA 3ROQA 4B7CA 1K8RA 2FN9A 4M8SA 2A7QA 4J0EA 7ADHA 1UADA 4V3CA 4EZBA 4IZ6A 3Q11A 5L95A 1R9MA 1GKLA 3DBHB 3FDFA 1MA0A 3Q6IA 1XCGB 4LI3X 1EWTA 5FADA 1P61B 3VR4A 4LXHA 2C5SA 1ENOA 3MRVA 4OYYA 3IMGA 3BF8A 3PEFA 4QGBA 3WLNA 4HNAA 4RCVA 3ROPA 4NMXB 1GM5A 2BTQA 3Q0EA 2AG0A 4OX9Y 4PYJA 1IJKA 4JX8A 1K63A 3GVHA 3HVUA 5G3ZA 5AUOB 3L0PA 3GV0A 1H1TA 2FTKE 1M34A 2YV1A 1KQOA 3JQQA 4WK6A 3RT7A 2QTTA 3GP5A 1E89A 4G0QA 3MMXA 1DDIA 4KC0A 3N3AC 1GKYA 1ISJA 3AX6A 2OECA 2YIJA 4QXQA 3D6UA 2Q3EA 1X86B 1YS9A 2ZRGA 1L7RA 4QUHA 4RDXA 4XOUA 1Z8DA 4L8GA 3SFZA 1DJNA 3PRYA 1U7ZA 2OGSA 3QSGA 2VZEA 2QDKA 4IGIA 1FX0A 4QNRA 1L7NA 2Z3VA 3BCUA 4IZOA 3SZMA 3LFTA 1CUDA 1COWD 2W6JD 4RTJA 1BRTA 1XG5A 2A78A 1GRRA 2DECA 2YVAA 3A8TA 3H3JA 3ISJA 2VZLA 3OZEA 3SHTA 4S3MA 1ZMXA 2DHRA 5CYPA 2H4HA 1UINA 3ZGOA 1DBPA 2CCGA 4PFQA 3EARA 5NLLA 1E8MA 1G5FA 2E2WA 4B4WA 3AVXA 4EG1A 2VR1A 4YMHA 4M8NE 5DIZA 5K0JA 2YYYA 3TL6A 4E7PA 3DOOA 4ITRC 1JHAA 3DHWC 1Z9BA 3C15C 4YJHA 2CXOA 2ZUFA 1FPQA 3F5DA 4HT3B 4Z3OA 3H6GA 4GMHA 5BWBA 1H6DA 1UPTA 2NUAB 4YUAA 5IKPA 2ZRKA 4JOBA 2FVXA 2UZ0A 1Z74A 4DY6A 4F12A 3U5TA 1NUUA 3OD5A 2OV8A 4TROA 1UM9B 1AZLA 1ZCBA 2VK1A 2GR9A 2G3YA 3PCXA 4N0EA 4A0GA 3D7KA 3K5HA 5IKOA 2AKEA 3ES9A 3AVPA 3K8ZA 3KG2A 4PHTA 4ARBA 4W5RA 1DKQA 1REQB 3DV2A 2X7HA 3EVFA 3OJXA 1G8FA 3C98A 4HY3A 4L73A 4P1ZA 1A7AA 2CDRA 2FN8A 4I7EA 5FA5A 5TARA 3ZS9A 4C4SA 2D6FA 4RMNA 5JS1A 4RL6A 2G72A 2IITA 4IHJB 4QE3A 2XMBA 1B16A 1E6CA 1TE2A 1LZLA 2O8DA 1Z4NA 3G49A 1JXQA 4CQNA 3V2HA 3CU5A 3BRWD 4N12A 4TTAA 2DKOA 4XARA 4BO5A 1TU0A 3EDOA 1SZJG 3L06A 3EVAA 2GZHA 4FOLA 4PBRA 5DGIA 4EUSA 5K99A 3GI1A 4H0CA 4YAJA 3QEMA 1D6MA 2C20A 3TVDA 2A35A 2FP4B 1K3FA 1W5EA 3EE6A 3K9LA 3PNBA 4Y2RA 4CMEA 3QVUA 2X6RA 4OBWA 1O0SA 4BEJA 1ZOOA 5HMLA 1F12A 4KZPA 1XB2A 5FL3A 1NM5A 4J94A 5ARBA 1AKTA 1Z4IA 5JSUA 2VQEB 5J4KA 2OEPA 2BGWA 2X6QA 5PNTA 2VQSA 1E5XA 1LQUA 3EW9A 3L8MA 4RAOA 2Q8PA 1GTRA 5CR9A 1QVZA 4L5JA 2D4HA 1C1XB 1W87A 2XTMA 4R71A 2C4MA 1Q3HA 2O1WA 4RVFA 4GIBA 1QFJA 4PXSA 5A5EA 2O2YA 3CVUA 2WC1A 3MPOA 1M7GA 3F8SA 2WWTA 3QMWA 4Q9HA 4WZ6A 3WLMA 1K68A 3SX4A 1JIXA 3ITKA 4MCAA 2QAJA 3BMCB 1U2SA 4NE9A 2VIIA 4XD7A 2I8LA 3TECE 1P6QA 3V1UA 2IU6A 3RSCA 2KM1A 1IJEA 2ID4A 4WKPA 1MIHA 4K1LA 5E8RA 4YLGA 2ZULA 4RY9A 2I3BA 2QLJA 4M9CA 3DQZA 1A77A 1KKUA 1HOXA 1RHJA 4TRMA 3VKWA 1DAEA 2XWJI 4YQFA 4RK4A 3SF8B 5A4AA 4RK7A 3BSWA 5BUQA 1DDGA 3HUUA 3SJ7A 2H07A 3PXGA 2IWRA 3IDOA 2XUGA 5JXGA 6ABPA 2PUCA 1NF3A 2H0RA 3F96A 1P5FA 1KJ9A 3EC7A 3F3YA 4Z8YA 3AV0B 2IUUA 1KSGA 1BWRA 2CHGA 1XPUA 1NVKA 2Q99A 3E8MA 1ZOLA 4LJ4A 3QW2A 1ZJYA 4RFSA 5EPUA 3RYIB 3V8QA 3W6OA 4R51A 1NU8A 3JASB 4RHUA 3SN6A 3TR0A 1XQYA 4IMIB 2ERYA 3W4JA 5SYAA 5K0SA 4KHPB 2H0AA 1HZZA 3U4MA 2MSWA 1YRBA 2GCEA 2QW8A 3JZMA 1Y3FE 5C31A 3AERA 5B3JC 1VQ1A 2ETXA 1T5DX 2FEAA 1H6BA 4RIEA 5JYCA 2HKIA 1JDJA 2DR0A 3PT5A 4A7PA 4ZVMA 2I9KA 4CMJA 4QT4A 5C8YB 5KJCA 3P0FA 1N5RA 4KOEC 1G2PA 3WQRA 4EECA 1E99A 2BEWA 3F98A 2YHAA 3IIJA 4ODIA 2X3FA 1VB3A 5TS3A 2OOKA 1FP6A 1PYGA 1JRLA 3HPRA 3DLBA 2PNFA 3P96A 3TJMA 1N2XA 5LQJA 1DOAA 1XP5A 4KYUA 1FU8A 3C1UA 4P4NA 2RGGA 3ZHVA 3LC7O 5IFKA 3FH0A 2A57A 2JH9A 1Y1LA 2ZS9A 1EFRD 1X74A 3LQKA 4R05A 3SVLA 1SBIA 3GA7A 2W6QA 2VN8A 5AKEA 2QZ4A 5JMOA 4HPWA 1CUJA 1Z3CA 4KUGA 4UEKA 3SVZA 1EIWA 1J22A 1TQHA 2FX3A 4AUNA 3FIJA 2IHBA 3G13A 4OOFA 3KKEA 2IC5A 4K6FA 4RPCA 4P4TA 1UC8A 1J5EB 1Q1GA 1S8FA 2BMJA 2SICE 2ZIUB 4L0MA 2H1IA 1QIEA 3M33A 4LJSA 3RBXA 1MU0A 3FFAA 2AK3A 2WIFA 4CR6A 1AMNA 4PU0A 4UE2A 4HGOA 1GL3A 3P9PA 4WK4B 5JTUA 2C9YA 1EGHA 4G6ZA 4MR8A 1IY1A 5AW7A 1M8PA 2B7CA 4I50B 2UUAB 3AIIA 4EPXA 5AXCA 3JD2A 1AA6A 1UBOS 1QLJA 4KO1S 4PAMA 4RPLA 1ACLA 5G0WA 4DA4A 4BAGA 1QK4A 4LZAA 1ATZA 3GAMA 5CHEA 4D0RA 4HH4A 1XMIA 3MXOA 4UXHA 1FSFA 1Q83A 3TTTA 3AR2A 3T94A 4BMVA 1T9HA 3AFMA 2WYUA 5EIEA 1FSSA 1PFUA 1Z4JA 5JZSA 1B23P 5KJEA 1E8NA 4FFLA 3Q2IA 3B5EA 4HB3A 4RAQA 5CDHA 2OCGA 4R7GA 2GUGA 5HE9A 4KP7A 3PGKA 3JWIA 3AESB 4CM8B 3OLYA 2GA8A 2YASA 3ABRB 3D8SA 4LAFA 5EYPB 1CUYA 3G2OA 1XU7A 4TTQA 1J7JA 2ACEA 2OKGA 3AI7A 4NOKA 4DV7B 2ZBGA 1IXZA 5K3CA 5GVRA 1GTG1 1W46A 4YA6A 5J5CA 3X1JA 3WHIA 2I9PA 2GN2A 4N0DA 4B80A 2RI0A 2ZUUA 3OQOA 4U7HA 2ZUBA 4F4UA 1FUIA 5ANRB 2AOWA 2ZBEA 3NDJA 5K4GA 2WW8A 2J3JA 5C4GB 1KU0A 4F71A 3ZV5A 2IY9A 2XCLA 5J2TA 2GD2A 4BAUA 3D6MA 4LVUA 4M1QA 3DZBA 4DSZA 5K2OA 1ZI6A 2AFHA 3V55A 1KVRA 3LHDA 1EGMB 4M9QA 4BZZA 4IGKA 3RSOA 1P4HA 3CNNA 4NNPA 1Z5OA 3KUCA 2P6PA 1EHCA 5A5GA 2OG1A 3M9WA 2PMCA 1A5SB 4QU9A 3B3JA 3TSWA 2AI1A 2X76A 3A1NA 3QELB 2OOSA 4MW9A 3HO1A 2PD4A 3OTGA 4PEVA 2E48A 2Y76A 2AEMA 4DYHA 3T5BA 1KK3A 3WL7A 3OPVA 3DDOA 3GRKA 4IO0A 4CMIA 5HRCA 5BR8B 4Q0MA 1G8JA 3DFUA 3E1KA 4N9QA 1ODSA 3OIVA 3MTAA 3P20A 5DNYB 1ECPA 2WT8A 2XADA 5LA6B 3UAWA 3J81A 5CPBA 3ICOA 1R7RA 5DEIA 2JFFA 3NHZA 3AILA 4U02A 3IAFA 2RC5A 4L27A 3IP9A 4TTRA 4B6OA 3T1VA 2V6FA 2WV9A 2PYDA 4OX9B 4LVCA 1QONA 4MPJA 1TVMA 2XUAA 1EFHA 1J8DA 5ALEA 1FNMA 1IEQA 3OPXA 3RTAA 4ZK2A 4I6JA 5HHTA 2J3DA 4TUYA 1XQ6A 2O48X 4EBBA 2RKWA 5CDSA 4KWIA 3E9NA 4KVGA 2BFWA 2ZRIA 3IT3A 4CQMA 3IBCA 5H4GA 1GCAA 1THTA 4UPVA 4RKRA 1AGYA 5I9BA 1HSOA 4DLVA 1PWHA 3BWMA 5JD4A 1JEAA 3WKEA 4HGYA 2J3IA 3I9LA 2PMWB 2GEBA 3NBXX 4PPGA 1FMFA 2VDQB 3H8SA 1EJBA 1FDIA 2QEQA 1E1QA 4S1TA 3ZD7A 4B7AA 4EL0A 1TUIA 2WLTA 4R8LA 3HMKA 5EJ4A 2J7PA 3FMIA 1ZH4A 3DDSA 1GOTA 4Q03A 4V02A 2PA3A 5FV7A 5KWVA 4J03A 1DO0A 1F8YA 1L5VA 1RQPA 3LHIA 1NV9A 5AK0A 3TFQA 2UXCB 1JQAA 2HF8A 1QAMA 4DR3B 4W7SA 2Q7OE 3U40A 4XLTA 2OAEA 2VDLB 2OZLB 3TTYA 3AU8A 3WFIA 2HD4A 3KQWA 3W5HA 3S2ZA 1YUBA 1ATIA 5D3MA 2BFBA 3SIXA 4FFPA 1U3DA 2A1IA 5IWAB 3X1WA 1H94A 2Q9BA 2B4YA 4R0VA 4UJ5A 2I62A 3KB1A 1DMRA 3QX7A 1E3JA 4PRLA 3HBNA 4UE6A 2QTGA 4M36A 2YVKA 4BECA 2AJTA 4MGZR 3FOWA 4CIBA 4KR3A 1YA6A 3HJCA 2G09A 1MAAA 1WSBA 1TIPA 3NG1A 3ESBA 4X5OA 3HJRA 3TO5A 4DRZA 5HNKA 2D2FA 4KN5A 4LCBA 1OIVA 2O7QA 4K6GA 1XA4A 1TM3E 4OIMA 4Y9DA 4AU1A 2MMCA 4KPEC 1P5HA 3RAPR 1XJWA 1ZUNA 3IAEA 4UTRA 2JJMA 2YBDA 3MIIA 2HL6A 3KSUA 1PDVA 4FQ5A 2OLKA 5H3LA 2HSZA 1XAJA 4MV4A 3FWNA 1Y6FA 1WMSA 3IBYA 3ZWKA 4DJJA 2XNSA 3TIGA 2GEUA 1N78A 2QE7D 3LGXA 3ER8A 3RAEC 4HQRA 3VC3A 2MINA 4P4GA 4G81A 5CLJA 1DOZA 3OF2A 5LN1A 1NBMA 4I1OA 1U9YA 2OCXA 4LEIA 3W5UA 1JEYB 2HQBA 1NMQA 2JLRA 2R2GA 2A0YA 5C8VA 4XQGA 4OGFA 3GFOA 1G8AA 3LFHA 1G9TA 1KFKB 3MGAA 5B3JA 5MFZA 2H54A 2YZNA 5FBKA 2ODBA 2RJOA 1CNEA 2BR5A 3WHLA 4YXWD 3IHKA 2R96A 2R11A 3PPVA 5AW0A 2YOGA 1Z0AA 1H05A 1WUKS 3AB8A 4IJUA 5DTQA 1I2AA 1JBQA 1YB5A 4DLWA 1HDYA 2HADA 4I9FA 4Q4AA 4FJ0A 3ESDA 4BNNA 3T3NA 3RAJA 3W05A 5CVTA 4N41A 4HVAA 2OGZA 3IELA 2A86A 4GGMX 4UD2A 5GP1A 2M6LA 3B51X 3KP1A 2WHRA 4B71A 5KIAA 1ULZA 4RXUA 2GK4A 3CEPB 5A6SB 4DPLA 1TT7A 1C7JA 3U4DA 4FZVA 4RQBA 4QU8A 5EZSA 3ZTWA 4BNHA 2UZ4A 4B3RB 3K70D 2JVKA 3AC0A 1U8XX 3EGDB 1QP8A 3OZCA 4AS3A 5KNBD 1TLFA 3I1YA 1ZC3A 5KYVA 3T5TA 2JFVA 5FEUA 3PQVA 3OA0A 2UZ1A 3WK5A 3RGWS 1DXYA 4D42A 5CAEB 4ESEA 1HC7A 1VL0A 3HABA 1VBKA 4NF2A 1Y6GA 3K31A 1U7TA 3HKDB 5B3AA 1HZJA 1HT3A 1QYVA 1CQIB 5U4QA 4XDZA 4Y2JA 3FPAA 1U2RA 1RWQA 4CF3A 4KV9A 5HDBB 4KAJA 3SLRA 2PZKA 5B1SA 2A9RA 3LKDA 3TKYA 4RC9A 5T3UA 1T3HA 1WULS 2YHBA 3T5PA 1TJNA 3Q3CA 3MJRA 1GG9A 4ZCMA 4CIDA 1G8KA 4BFCA 1WZ2A 2WSIA 3WLRA 1W0KD 3NHRA 4HDKA 3QENA 4OQNA 2WMYA 4TSKA 2UUCB 1P60A 2H9YA 1M5TA 5AVRA 3E4CA 4UBLA 3WA7A 4Q6BA 2Y0BA 1XFDA 1D6SA 1VA4A 2P2SA 5E7IA 3H2IA 2H00A 2FR0A 4QEZA 1QZZA 4HAUA 2TMYA 2UZ3A 3O2NA 3R7BA 1R2QA 3PUJA 4TLEA 5AW3A 5ULLA 4RF5A 4D9CA 2B1QA 3BGWA 4NESA 1D4FA 3WWEA 9LDBA 3F7MA 3GUCA 3MWKA 4CKYA 4G9BA 1XA0A 1NC3A 4UCWA 1SBZA 4BO0A 4LNUA 2R1ZA 1KYZA 3UUGA 1ZSYA 1D2HA 4EGAA 4LJRA 4OD0A 3FCUB 3NHKA 5GTDA 3TVYA 1GPH1 2ATVA 2G8NA 2WYVA 1S7GA 2R6FA 2Z2IA 4KQHA 1LSJA 3FWHA 3D31A 5G0UA 3TTUA 3UM9A 2GBGA 1N1DA 1DG1G 5JFTA 4E5YA 2H8KA 3BTSA 3B9QA 2PGJA 3DQQA 2VRWA 3GHYA 1ZU4A 5GONA 5CDFE 1I7BB 1MD9A 1KFBB 2IYAA 2WZCA 4AFNA 4EA8A 2BP7A 1JQDA 2CL0X 4PO3X 2WD8A 1T6YA 3C5WP 4DAOA 3ADDA 1WSDA 2I6QA 1YL5A 1XMVA 1QYIA 1E1DA 1QHEA 5TQ0B 1MO6A 3RJTA 3TMYA 5KTOA 1RRKA 4KXUA 4ITVA 2HIGA 4KFCA 5CH5A 2Y1GA 4C05A 5B64A 4Q9AA 3UWMA 2XCIA 2VNIA 3A6FA 5I8WA 2X2OA 1Z26A 3V97A 3ZU2A 3KKOA 2YW2A 4K28A 4DARA 4EGSA 2CE7A 2HCJB 3HU3A 1ML3A 2FFHA 1O95C 3NFYA 3P0EA 4WLEA 1SZDA 1E9RA 2GN0A 2PWYA 2OHFA 2JVIA 4XVQA 3DZKA 1DKUA 4HVCA 4TKUB 2D7DA 4F6CA 2H7VA 1YCDA 1Y48E 5AK4A 4AC9A 2JGKA 1NFFA 2JJ2D 1PBNA 1DXQA 1UUFA 1Y7HA 1Y8QB 1JJBA 3A9SA 3HJBA 4WLVA 4WACA 4ZYVA 5FBVB 5IJWA