1YS4A

Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
348
Chain Sequence
MKIKVGVLGATGSVGQRFVQLLADHPMFELTALAASERSAGKKYKDACYWFQDRDIPENIKDMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVSGAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLNLPTYAKPIVIREEIDRPQPRLDRNEGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVKKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title A New Branch in the Family: Structure of Aspartate-beta-semialdehyde Dehydrogenase from Methanococcus jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 102
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ys4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ys4A01
3OSUA 3R6DA 3GY0A 3DDNA 4OHUA 5JAIA 3GAFA 3PI7A 1I32A 1E6UA 1YRLA 2VZ0A 4MP6A 1UDCA 4BGVA 1LTHR 4IQ0A 2YFQA 1RM4A 4HV4A 3UW3A 3ZW8A 5IXYA 1ENZA 1L1FA 3A9WA 1T2CA 4BNUA 3BMCB 3GA0A 1O9BA 2AE1A 4E2ZA 3GHYA 1VL0A 4D7AA 4ND2A 3ST7A 4DREA 5A04A 3K5PA 2A35A 3EMKA 1ZJZA 4WCFB 3WIDA 3HDJA 2YY7A 4GAEA 4BNZA 2I66A 3JQBC 3IP1A 4B8ZA 4W6ZA 3VOSA 1ZK1A 2NLOA 2I76A 3NTOA 4YJDA 2R00C 1X1TA 4XQCA 3T4XA 3IOYA 4FS3A 4HP8A 1RM3A 3LC2O 4J43A 2VRBA 1IPFA 1VL8A 3JSAA 2BFOA 4CUJA 1Q0HA 3GGPA 3N7UA 3AU8A 3MZ0A 4LSWA 4E21A 5I7EA 1YB5A 4YRDA 3GPIA 2OORA 3G0OA 1R0SA 1CERA 3FWNA 4CQLA 1P1HA 3EVNA 4UUOA 4L8VA 4XB1A 4LGVA 3QWBA 3WXBA 4A73A 3FHLA 1J5PA 3JD1A 5GZ3A 2C7GA 5L95A 4WPGA 3MOIA 1IZ9A 1PZEA 4BO7A 2X8LA 3MTGA 1LC3A 1UP6A 2X0IA 2HK9A 1SMKA 5U9CA 3M2PA 2YUTA 4W82A 1C0PA 4BO5A 1OZAA 1ZVMA 1NTOA 2EERA 2P68A 4CLXA 5I7VA 1N9GA 4EEZA 1NP3A 4YR9A 3FR7A 1LDEA 3I3OA 2IRWA 3WFIA 4MJLA 2IYPA 1NASA 1U8FO 3K31A 2DC1A 2UDPA 3KLPX 3U9LA 1E3LA 1OFGA 2EG9A 2ILTA 2JD0A 2PZLA 4BUCA 3GLQA 3GDOA 3IQDB 4TRJA 1TI7A 3QVWA 3PYMA 2YQ5A 1ZKMA 4HWKA 4IGFA 4TKMA 2YV3A 3VKUA 1K6XA 3I23A 1EZ4A 1W4ZA 4ALNA 5A9TA 4RL6A 3DAPA 1EK5A 1LQTA 3KM0A 3U5TA 1NR1A 1DC3A 3WB9A 5EJ2A 2ZCUA 1UXKA 3AM3A 4XKJA 2D4AA 5ER6A 3EC7A 5A05A 3D1LA 4YJHA 4WOKA 4WLFA 1DO8A 4XR9A 1KC3A 4Y6PA 2FR0A 3DONA 1N92A 3H2ZA 1BG6A 3QP9A 2BGMA 3JQAA 1DRUA 3CINA 2HJSA 5DP1A 3Q3CA 1FJHA 2AEJA 2AW5A 4RF4A 3V1TC 4AVYA 1Z7EA 2E49A 2B37A 4FCCA 1U5AA 3WDSA 1K5HA 1A27A 2FR8A 1NAHA 1QMGA 3PGXA 4CMEC 4W7IA 6LDHA 4B3IA 5I7FA 5FEUA 1P1KA 3ZU2A 3E8XA 1H2HA 1EUZA 2Q1TA 2Q50A 5BNFA 3NT2A 1OOEA 1I0ZA 1ZMTA 5IFLA 1KC1A 2OBNA 4J1TA 3UKOA 1KS9A 3PXXA 1Q2XA 4BNJA 4C4OA 3F4LA 1X14A 5JCJA 3NJ8A 2BHLA 1JWBB 1KEWA 1BGVA 2J5RA 1KOLA 3RU7A 4Z0HO 1ZIDA 5TT1A 4E3ZA 1N2SA 4L9RA 4NJMA 4NBWA 3H9UA 1KVUA 4IINA 4EJMA 1H2BA 1JQBA 1TA4A 4J2OA 3F4BA 4R51A 3I9JA 4H15A 4CM7A 3ITKA 4CMGA 2FY8A 4LCEA 4XCVA 4DBZA 2B0JA 1QRRA 3W4KA 1MG0A 3WICA 4ND5A 3C24A 3ZWMA 1KBZA 1LLUA 2F1KA 5L40A 2OO5A 1R4MB 7ADHA 1Z7BA 4GX1A 2HJRA 4YAIA 4JJFA 1NHGA 3CZMA 1WPQA 3WQSB 1I8TA 1ULSA 1LDMA 4NNJA 5DBIA 1FMCA 5DCUA 3BMQB 4D45A 1PL8A 3MWEB 1N1EA 2Y99A 2BGLA 4DPMA 1QYCA 4DTIA 4Y6RA 5IDYA 2NU7A 2Y1DA 3DBHB 3P19A 3R3JA 3ZHZA 3GR6A 1QYVA 1JVBA 3ZHBA 4YXFA 2AEMA 2C0CA 4YT8A 3TZKA 4XJSA 2FPGA 4HNHA 4UVHA 4K6CA 2VT2A 1P3DA 1GFSA 2WYWA 4LMRA 2D5AA 1I3MA 4IZIA 4YB8A 2VNAA 3AI2A 4RPJA 3GAZA 4M8SA 4BQPA 2P5UA 2VWPA 3VTZA 4CUZA 2X0NA 4GMFA 1KY4A 1SO8A 4GI2A 3ZWYA 1FDWA 4OGWA 5DCYA 1KEUA 4II3A 3RKRA 1QV7A 4N18A 5TC4A 2VCYA 1HDCA 1EVJA 2NTJA 3GNSA 2I5PO 4JROA 1PS0A 3C1OA 5FI3A 1XA0A 3KYBA 4JBGA 3WLFA 5KJFA 3H65A 1GCUA 1HLPA 1ISIA 2IEDA 5BSHA 4DRYA 3AI3A 3C1AA 3DOJA 3GUCA 1HETA 4OXYA 2GZ3A 1B14A 1OI7A 3ZZNA 2CSUA 2EXXA 4LMPA 3TF5A 1P0CA 4DLLA 4J90A 3K2BA 1I10A 2JHFA 4NJOA 4IIUA 3HDYA 3WGOA 4PN3A 5A1TA 4RPKA 4R1UA 1E0DA 1MG5A 1XQ1A 2JCYA 3IKVA 3FNGA 4DUPA 1I2CA 2AQHA 2IDZA 3ONDA 1YL5A 5A03A 1VSUA 3KEQA 2GF2A 3PVZA 4J7XA 2JCXA 1M75A 4UUPA 4D41A 4BNYA 2I3AA 3ON5A 3UN1A 1Y6JA 4A7PA 1JAXA 1E7MA 3RUCA 1OAAA 3DOCA 2FRDA 3GN2A 4D3FA 2H5LA 4ID9A 1Y81A 4PZCA 2PY6A 3I4FA 4B3JA 4C7JA 1M67A 2GN6A 5FI5A 3E18A 4A26A 1PQUA 4BMNA 1ULUA 1TT7A 2JKVA 1HE2A 2Y0EA 4J49A 5B1YA 4CMJA 1IB6A 1NHWA 2DU8A 3K30A 3ZU4A 1PGQA 2FPPA 2OOSA 3D4PA 3IAHA 3O8QB 4DXHA 3HWRA 3U4CA 2ZYDA 3OQBA 3H5AA 3L0DA 2BD0A 1PJTA 3TZCA 2Y0CA 1HDZA 1E6EA 2J3HA 4A03A 4CLOA 2O4UX 3VPHA 4B4OA 3HUDA 1ISJA 3AOGA 1LU9A 3G49A 2Q1UA 3HN2A 3KSDO 2D59A 4M89A 4UUMA 4TRRA 1GZ3A 5A4DA 1C1DB 4CM5A 1SCUA 1E1KA 1SC6A 3KBOA 2P9EA 1JA9A 4R01A 4UULA 2YV1A 3JQ7B 2CVZA 3F46A 2HDHA 5L9AA 3BMOB 1XG5A 3HZZA 4PVDA 4IMPA 3NTQA 3ZW9A 3MJTA 3A06A 1DIBA 5JDCA 1IYZA 5L45A 4XD2A 4BNGA 1IY8A 4O59O 1DB3A 3U4IA 4DPKA 1HDOA 2P5YA 4RQUA 3C7AA 1UXIA 1NFQA 4LISA 3PQDA 5DULA 5K6AA 3ANNA 5KIAA 4WCDA 5L7WA 3ADOA 3PHHA 4ZN6A 4M49A 1U7HA 2IXBA 1NYTA 3DHNA 5A5EA 3VVCA 2RIRA 1QYDA 2J3KA 5KKCA 1DFGA 4B7XA 3D4NA 4JN6B 1PJQA 2O48X 3WMXA 5F5NA 4WLEA 1P77A 4BIIA 1WWKA 1HWYA 4GL4A 4B4WA 2NU9A 1GR0A 4M55A 4MIYA 2JL1A 4PRLA 1YXMA 4Q3DA 1SB9A 4GX2A 3KTDA 3LF2A 1XYGA 3CPSA 3QWAA 2IODA 5EINA 3OA2A 3HE3A 5HBRA 4GVXA 3WNQA 1SOWA 4PLCA 4CL8A 3I6QA 3ZNPA 1R4NB 1DDOA 1AGNA 3PFWO 1KIFA 3GRKA 4KUEA 4OOEA 3UH1A 1UP4A 1LXCA 1V9LA 1WAMA 2X4GA 4UVIA 3TL3A 1VC2A 1BW9B 4DIOA 2NVBA 3GFBA 4IDEA 4J16A 3U62A 4PCVA 5G4KB 2EKQA 3KO8A 4LW8A 4BGUA 2IEBA 4FN4A 4BO9A 4RQTA 4RF3A 1HT0A 4HADA 3D4OA 2Y67A 1GQ2A 1BVRA 3Q9NA 4BO1A 2O3TA 4N54A 3NX4A 3LLSA 2HK8A 4XYBA 3VH4A 3WGHA 1E3WB 4RGBA 1QSGA 4K9DA 1RWBA 1PJ2A 2A4KA 1LJ8A 4RLHA 1ZK3A 1T1RA 3AU9A 3OH8A 4MPDA 4GKBA 4ZQGA 2CDBA 3DFZA 4Q3EA 4J7CA 3ZU3A 3VAZA 1E3SA 1ZJYA 2EWMA 4Y67A 1SPXA 2C07A 4MVJG 1LBEA 1GV0A 3WOHA 3DMTC 3A1NA 3S55A 3DBRA 4A0SA 1DC4A 3TZQA 5TLSA 1F8FA 2A92A 2G0TA 3M1LA 3RSHA 5T73A 4F46A 1JU9A 2CDAA 3INTA 2FSVA 1L7EA 3PQEA 4GWGA 2J8ZA 5DNAA 1B3BA 3I1JA 2YQ4A 5ITVA 2Q3EA 1R0LA 2B35A 3OJOA 3U3XA 3UCXA 4CUKA 4WKGA 3EAGA 4WE3A 1UJMA 2OXIA 1WDLA 4OJNA 1H6DA 2ZTVA 4HX5A 3K73O 4H3VA 1UXHA 2P4QA 4S3MA 2RCYA 4R1NA 1ONOA 4CM4A 4W7HA 4J0EA 4G65A 5HS4A 3LT1A 4ZHSA 3PLRA 5LDGA 3IL2A 3U49A 1EBFA 4QEDA 1QG6A 3OEWA 4GMGA 4GSKA 4Z9XA 4O63O 1I01A 2ZCVA 1M6WA 3FNFA 5K9ZA 3WJAA 4Y8VA 2IE0A 4ND4A 1AHHA 1P33A 2Z1NA 5JAQA 1EUDA 4J0FA 1LSJA 1A7KA 4NMHA 5DZSA 4RVSA 1MFZA 1MB4A 4MVJH 2O3SA 1B3RA 5AXDA 2O23A 5IDQA 2RBEA 3NEPX 2Q46A 1C0KA 3G17A 1U4OA 1DXYA 5GMOA 2JD1A 1DSSG 1F0YA 4J4HA 1LA2A 3Q6IA 1JVSA 3LU1A 3O03A 3RFXA 3G3EA 4ZQBA 2QHXA 3FSRA 3L4BA 4I5FA 2C54A 4CQMB 1X1EA 2YHUA 3AY6A 5A9SA 2GYYA 4S1VA 2HKIA 2C59A 2Q1WA 4IJVA 1V3TA 2X7HA 3ZN2A 1Y1PA 1DLJA 3PGJA 2FZWA 3VVBA 4WEQA 3E9NA 3PHIA 4R69A 3UFXA 4AJ4A 3HQ4O 2O50A 4B4UA 1YKFA 5AXBA 1XLTA 3HB5X 1T26A 3WYEA 4NH4A 2PKQP 3KYCA 2B69A 1E3EA 4E6PA 4FFOA 3GH3A 4IGEA 1B26A 5CP8A 2E82A 5C7OO 5DP2A 1Q7GA 5KVSA 2XXJA 3I9MA 3ULKA 1I3LA 2DBQA 4A2CA 1DJNA 1Y8QA 3WIEA 4KUGA 2Y1FA 1YL7A 3I9NA 4K1LA 5JDIA 1EDOA 4HFRA 1PSDA 3L9XA 2Y66A 3DZJA 5C3MA 3LYLA 3E1KA 3ZWNA 2TMGA 3QWIA 2B5VA 4WLOA 2NACA 1N8KA 5G0WA 3D5QA 1ZMOA 1O95A 1B15A 2HAEA 4PGFA 4TRNA 1UAYA 1AE1A 2QW8A 3FTPA 4CMIB 2JAHA 3RCBA 1IUKA 1UDAA 3W4JA 4O6VA 2DQ4A 5IN5A 1U8XX 2IZ1A 2WE7A 4YYZA 3JQ8A 3NUGA 3Q11A 4OM8A 2VUTA 3RWBA 1TT5A 3W8DA 4O5OA 5JC1A 2OGUA 4UVGA 2WSBA 4FJ1A 3D3WA 4HUJA 2XAAA 2QIOA 2OBYA 3GVCA 2O3RA 2PFGA 2FZEA 2EJVA 3E5MA 4GWKA 4CLDA 4IS2A 1NX6A 1ORRA 2RH8A 3BTSA 4YJFB 4P38A 5T8KC 5TGDA 2DUWA 2CF6A 3CSDA 4WUVA 1GYRA 5BSEA 2YDXA 1UAGA 4BGIA 2GDZA 2OMEA 1W8DA 4O1MA 1PL7A 5L3ZA 3IC5A 4ALLA 3QWHA 3ZCXA 5JYFA 1E7RA 4DQUA 1IE3A 2AQ8A 4I9NA 2FWMX 3MJVA 4NU6A 2P9GA 1EBUA 5JY1A 2WM3A 2GZ2A 2AMFA 3DXFA 2VQ3A 2HSDA 3TRIA 1HDYA 3ZV4A 1XWFA 4YQZA 2X5KO 2BLLA 2FPIA 4MVJF 1E1LA 1I33A 1VKOA 3STHA 4PRKA 5BR7A 3H9GA 3NDIA 1XIVA 3F47A 3TFOA 4BO8A 3JV7A 3MJSA 3IDSA 3WGYA 3GNQA 3JD3A 3TDKA 2DFDA 1HYHA 1YONA 3GVIA 1NPTO 4E4YA 4BKOA 4QO7A 1O8CA 3ROQA 3DL2A 1ISMA 2E6UX 2BRUA 5JBIA 3GZNA 4RVFA 2Q1SA 3JYOA 3UCFA 1GQYA 4XDYA 3UOGA 3ORFA 4H16A 1HSOA 4PLGA 1YQGA 2OL4A 3JYQA 4QO8A 1YJQA 1Z82A 4ZQEA 4AICA 1O89A 2FOIA 3IP3A 4L73A 1EE2A 3RUEA 1HYGA 5CG2A 1DC6A 5JO0A 5CG1A 1AXGA 5TQVA 1MC5A 3ZWBA 2NSDA 4YA6A 3GVPA 3BHMA 3BTOA 4JXKA 3RFTA 1YB1A 3BZUA 3H8VA 4OO3A 1WMBA 5HA5A 1DIHA 5A02A 2HMWA 4IJUA 1NR7A 4R16A 3TOXA 2PD4A 3P2OA 4DIBA 3F3SA 1JN0A 5CEJA 1EFKA 4M87A 5L7YA 2QX7A 3G1TA 3QW2A 2DT5A 1K0UA 4DGSA 1V6AA 4EI2A 1DPGA 3E9MA 2Z5LA 3UHAA 4CQLB 5HRUA 3AFNA 4MIOA 1PX0A 2PWZA 4ND3A 3CEAA 2GSDA 3MJ4A 3EYWA 4ALIA 4E2YA 1PGOA 1NQAO 2Y1EA 4HY3A 1FDSA 1R37A 1CF2O 2P9CA 2OP1A 4LRSB 2NV6A 4P4GA 2G76A 1VLLA 2WD7A 3PTZA 4CV3A 2BI8A 2PZKA 2YZ7A 1DHTA 3ETEA 1YQXA 1PJBA 1E5LA 4F45A 4Z0TA 4NK5A 3PHLA 4AJHA 5CAEA 4RDHA 1N9GB 4RZHA 4E31A 3K2EA 3WSVA 1QKIA 5TT0A 4E30A 3LLVA 3Q9UA 2NM0A 1VKNA 1S6YA 2BELA 1E3IA 4D3DA 3DMYA 5EIOA 3INGA 4RVDA 1DIGA 3RVDA 1K2WA 3F1KA 3DR3A 1UZMA 2O7SA 2CNBA 3ENNA 3PJEA 3PWKA 2B36A 2Y05A 1Y9EA 3V1YA 5AVOA 1ZEMA 5DF1A 1BXGB 2ZATA 4QQRA 4CMAA 2R6JA 3H6KA 1R0KA 4XYGA 1T2EA 2FP4A 3ZWCA 4QECA 3NAQA 4LRTB 3NV9A 1MGOA 3U4DA 4E13A 3DBVO 1EVYA 1PL6A 4E2XA 5KTKA 1OBFO 1U1IA 1D7OA 2XPCA 3OECA 4XGNA 5ER9A 1BTOA 3FPLA 4UEKA 4YJHB 1ZFNA 4QSMA 4D79A 4ESOA 3HB4X 4G2NA 3INRA 1NFFA 5C7IO 5LCXA 2I9PA 2ZJ1A 3JQAB 2Q4BA 4XGIA 1P1JA 1HE3A 4MOWA 3RI3A 1MC4A 4EUFA 1HSZA 3DQPA 4WLNA 3SC4A 2ZKLA 1K6JA 1WDKA 1ZXLA 2P4HX 2NU8A 3SBOA 1T2AA 3JYPA 3TFQA 3QSGA 3PQFA 2UVDA 1RYEA 3QHAA 3WWYA 4PLZA 1ZEJA 4OIMA 4PG5A 5EESA 4ZRNA 2YHIA 4J91A 3K6JA 5LDHA 5KOIA 1PWXA 2VTEA 3L9WA 2V6MA 4JGBA 5IG2A 4NI5A 1LLDA 2XOXA 2X22A 3LZ6A 4E5MA 4RORA 2QYTA 3ZWOA 2C5EA 4MVJI 1H6CA 2A9FA 3QIVA 1CETA 2I67A 4NHEA 5KVCA 2PGDA 2VHWA 4MVJE 3W1VA 1YDEA 2EF1A 3L6EA 2H9IA 3GQVA 4MIEA 4IJWA 4JBIA 3VPFA 1G0NA 2Q45A 3PJDA 1EFLA 3AOEC 4W9NA 4Z3KA 1U2DA 4F6CA 4ZRMA 3GEDA 2ZTUA 3NGLA 5CHEA 1I3NA 4GLLA 5JDCC 4XYLA 1U3TA 4CLHA 3E6AA 2DBRA 3GG9A 2C2XA 3AY3A 4MP8A 1WLYA 2UYYA 1LDGA 2A94A 4R68A 5A06A 4KQXA 3OJFA 4WNCA 5JC8A 1NVTA 1E92A 4BKUA 4B7CA 4HFNA 3TZHA 3V2GA 4HKTA 1AN9A 4DYVA 2ZB3A 1W73A 1Y9AA 1P74A 3V8BA 2F00A 1DAOA 3FNHA 1X13A 2DLDA 1GYPA 1GU7A 3CTMA 4QUKA 2BFAA 4IZHA 4YCAA 3F5SA 4QXMA 3IJPA 1WNTA 4KDEA 1FDVA 3ASUA 3LC1O 1C1XB 1HXHA 2PGLA 3ETGA 3QVXA 2W2LD 3KYDA 5B37A 4FFPA 1ID1A 1PWZA 1G0OA 1HL3A 1B16A 2W2KA 4N5LA 2AQKA 1BXKA 1PZFA 1YOVA 5U4QA 4RPGA 1A9YA 2CZCA 4G5HA 4IJKA 5EPOA 3BMQA 3EGOA 1MXHA 1U3VA 2EIHA 4J4TA 3SJ7A 1XEAA 1RKXA 4CM3A 4NFSA 3H7AA 5JNLA 3H2SA 2ZB7A 3BA1A 5AXCA 4P4LA 2FHSA 4W99A 2JCVA 2X0RA 2HMSA 3FNEA 4NBVA 5HS6A 4CR7A 5CDUA 3JD0A 5TSDA 3AWDA 4ZVVA 3JYLA 5TF4A 1NM5A 4E5KA 4XYEA 2VHXA 4CM8A 3FI9A 5CEEA 2YYYA 2VWHA 1LSUA 5A3VA 3WR5A 1XU9A 2WMDA 3BMNA 4YPOA 5JFOA 3I6IA 3H4VA 1ARZA 2WE8A 2J6IA 4MDHA 2PTGA 5ITWA 4I08A 3KOUA 4CODB 5L4NA 2X9NA 4PIVA 4MKXA 2VTDA 4BO0A 2PD6A 4TZKA 3A14A 5ENVA 5IN4A 1Y7TA 2H1SA 4J2HA 1EDZA 4DC1A 1E7SA 2LDBA 2DFVA 2VYVD 1K89A 3AUAA 4L4SA 2PKQO 1RM5A 3MJEA 5IXSA 1FF9A 4Q39A 1H93A 1JAYA 1T2FA 3ZDFA 1ZSVA 2DPHA 4H7PA 2PLAA 3ABIA 3C1TA 1ZZEA 5ICSA 2Y0DA 2FR1A 3MWDB 3GOHA 1SZJG 3ZU5A 3T7CA 4FW8A 1TB4A 1LNQA 3WNVA 1DOHA 2ZYAA 4BB6A 1ADCA 1QORA 5L51A 2Z95A 4U6QA 2J3JA 2C29D 2P91A 4JP3A 4G81A 5TJ9A 1E7QA 3R0IA 4E2WA 4JCOA 3RROA 3S2FA 1JKFA 1OC4A 2DUUA 3ICPA 1P0FA 1PGPA 3DZKA 1HZZA 3OMLA 3DB2A 1NPYA 4NFYA 1B8PA 3ZWXA 3Q0EA 4CLOB 4OXNA 5A9RA 4RVGA 2H63A 4NBRA 5I9MA 1HE4A 1P44A 3RC1A 1VRWA 3L4BC 1M66A 3W8FA 3WTBA 2EKLA 3G1UA 4DYDA 4MVJD 4L74A 3RC7A 3RBXA 1A9ZA 5L4SA 1QP8A 1YDWA 3LK7A 4EDFA 1HF3A 4BVAA 3ZWPA 1E3JA 2EP5A 2WYVA 3HFGA 3PYXA 3UVEA 4IDBA 5MDHA 3CXRA 4MP3A 5M6DA 1TXGA 5DOVA 5A3JA 3ZNNA 2DVMA 1QXSA 4NFHA 5F5LA 2VOJA 4R3WA 4AJ1A 5JYDA 3JQGB 4ROSA 3C8MA 3O26A 4YBZA 4DC0A 4OSOA 4CR8A 3B70A 5GZ1A 3PP8A 1ISFA 4Q3NA 2QRJA 3TWOA 1R16A 5JYAA 2CDCA 3HSKA 2AE2A 3LT2A 1FK8A 3HADA 4QT0A 5JDIC 5EN4A 2GCGA 4CV1A 2WWRA 1HTBA 2O3UA 2VN8A 1C3VA 1BRMA 3JQ7A 3PHJA 3WFJA 4FGSA 5CDTA 3QQPA 3PK0A 4WLVA 2I99A 3EY4A 5HTOA 4IQ8A 5CDGA 1PS9A 5IJZA 2NQTA 2X6TA 4NK4A 3HNPA 4NG5A 4XQEA 4CM6A 3R1IA 2QYSA 3RUIA 5IAAA 1AXEA 5I8WA 4BNHA 2QRKA 3V5NA 3K92A 4MKZA 4U5QA 3JD2A 4B4VA 5L53A 2VYVA 3WTCA 3KEOA 4C7KA 4L76A 1KVQA 3ITDA 1D1TA 3FN4A 2O2YA 1DFHA 2QQ5A 3JQ9A 1PJ3A 2HMVA 1ONPA 4E32A 3NT5A 2BMAA 4GX0A 5KJ6A 1T24A 5G0VA 4FFNA 1GADO 3RC2A 4PLHA 1ZSYA 1LSSA 5CFZA 3KV3O 1LDYA 2Y93A 1C0IA 3EDMA 3PIDA 2VZ8A 4B7UA 1VJ0A 3KHUA 4GPD1 4R4JA 4URFA 5IDWA 4EJ0A 3IJRA 2G82A 1XELA 4CQMD 1B0AA 4U6SA 3H3FA 1NWCA 2V6FA 5DN9A 4BNXA 4YQYA 3IMFA 3QV1A 4AJLA 3UF0A 1LRLA 3QRWA 3R3SA 3DBRB 3GRPA 2OZPA 5ILOA 1IPEA 1DLIA 3NT4A 1X7DA 1QYXA 5CDYA 4YT2A 3DTYA 2EP7A 3GEGA 4JIGA 1U7TA 4YAJA 1ONNA 1JKJA 4TKLA 3B1FA 3B6ZA 4LN1A 5AQ1A 4BOYA 3NJ4A 1CEQA 3TZ6A 2NNLD 4FB5A 4KTTE 4RF2A 3OJLA 1CJCA 4PLFA 1XR3A 5T5QA 5L7TA 4KP7A 3FD8A 4CM4B 4TWRA 3A4VA 1CWUA 1A5ZA 4TVBA 2GNAA 1GY8A 4R54A 4XR4A 4OQYA 3RFVA 4P8RA 3E82A 4FGWA 1GYQA 3WS7A 2GN9A 2O2SA 3JCZA 4ZA2A 1U2GA 1FDUA 1NAIA 4IDDA 3DBLA 2HK7A 5JS6A 2X5OA 4E5PA 3WLEA 1BWSA 3I83A 2EHDA 2EW2A 5ADHA 4OQZA 1DEHA 3NKLA 1LLQA 2B5WA 3OIFA 1NWHA 2WDZA 2JHGA 4CLRA 1GQQA 4BNVA 5IZCA 1P1FA 4OOFA 2BFPA 3UXYA 1EVIA 1WVGA 3CMMA 4PLPA 3WJ7A 3RBZA 5KVQA 2DKNA 3C3XA 4HBGA 3VHRA 1GD1O 2AA3A 3WMWA 4LK3A 4E12A 4GQAA 5AYVA 3NGXA 3TOZA 3GVHA 4FJ2A 4UEOA 4PG4A 2AEFA 3BHJA 4U8GA 3WQQA 5DBFA 1GPJA 3ZI0A 1F14A 1A71A 5BNTA 2EJWA 1SBYA 3OIDA 4BNTA 9LDTA 3FTNA 2EV9A 1UH5A 3DZGA 4D0RA 1A72A 3HG7A 1KVSA 4E0BA 4RV9A 5B4TA 1ZK4A 2AG5A 1MLDA 3GK3A 1HRDA 1CQJA 4BQRA 3LT4A 1HZJA 1V0JA 2PD3A 3KYCB 3OBBA 3UUWA 2NQ8A 1D8AA 4EITA 4PLYA 4YJGA 1YVEI 5AXAA 2R2GA 2C5AA 2QRLA 1VL6A 4BMVA 1Y8QB 5BSFA 1LI4A 2I6TA 4AJIA 1O0SA 3WYBA 1CIVA 4IDAA 1HLDA 3S2EA 3OJ0A 3DC2A 4CQMA 4QFCA 4EUHA 1EMDA 3JQDA 3CIFA 5F1OA 4XRRA 4XWYA 4CL3A 3WBBA 1DIAA 3NRCA 3QVTA 2O3JA 1LLCA 4N5NA 1X7GA 3FRJA 4JJIA 2OUIA 1PR9A 5JE8A 3OQ6A 2O3QA 3C85A 3JQ8B 4JNKA 4BNKA 1ZXBA 1UZLA 3FF4A 4DPLA 1YL6A 1P1IA 3ZWAA 1TT5B 4AJEA 5I7SA 2EEZA 4Z9YA 4DA9A 1HDRA 2E48A 4JLWA 4RJTA 1DC5A 2DBZA 4PG8A 2UV8A 3D3WB 4U0KA 4Y6SA 2VRCD 5BNIA 3AI1A 3JYNA 4JK3A 2WEKA 1KEVA 3MTJA 3PDUA 2D1YA 5H82A 1M6HA 4EBFA 3GNTA 1XDWA 2GUGA 5G0UA 2ZIZA 3AFMA 4E5NA 3WGIA 1WP4A 4GVLA 1I36A 4XQ9A 4YT5A 2OHXA 4MVJM 3OM9A 5F21A 2NVUA 4M1QA 1PJLA 3I52A 1U9JA 4YVFA 2YJZA 1J0XO 4BO6A 3KETA 4I9HA 4YAGA 4NDNE 4ZJUA 2HRBA 4MO2A 1C14A 4YWJA 4ZICA 4Q3AA 1UXJA 4EYEA 4IBOA 3RUDA 3U09A 1ZBQA 4EW6A 4EZBA 1UUFA 2BGKA 4M54A 5J9GA 2QG4A 4WGGA 4IDCA 2PZMA 3FWZA 4IIVA 5CDSA 1K6IA 3GG2A 5JPIA 3O9ZA 2AQIA 4E5YA 5KVVA 4IY1A 4JBHA 1GCOA 1LDBA 3PEFA 4IMRA 3LT0A 5JSFA 1OC2A 1WMAA 2ZB8A 2JJYA 4W4TA 3ONEA 3GMSA 5FYDA 1ENYA 4YDRA 5KCZA 2B4QA 4IDFA 1LX6A 3BTUA 2V65A 2HQ1A 1YQDA 1I30A 3Q2IA 1RYDA 4J9UE 4AG3A 3GPDG 3E48A 3F6YA 5L4LA 2GO1A 4ITUA 4W9NC 1P1RA 5JO9A 3HJAA 1B8VA 1G6KA 1F17A 1KVRA 1Y8RA 3AJRA 1H9AA 4KQWA 5EL0A 3ZH2A 4FJ0A 4I8XA 1CQIA 4I5GA 1N1GA 4AFNA 3DWFA 1ENPA 2J5KA 1E7WA 1U3WA 3PDJA 3MJCA 4YT4A 1MFPA 1K3TA 4D3SA 1PGJA 1U5CA 3FR8A 4OXKA 2AXQA 1B8UA 2CVOA 2UUOA 3M2TA 3D3EA 3VZRA 1S7CA 3PZBA 3DZIA 1ENOA 3O4RA 2XF8A 1TLTA 2Y1GA 2E37A 4E33A 3S2IA 3H5NA 4JQCA 3ZHYA 1PJCA 3VH3A 3GMDA 5K0ZA 2SCUA 1U28A 1ISHA 4TMFA 3IKTA 2CVQA 1PR3A 2O4CA 3E5RA 1BXZA 3RIHA 4DIFA 3JQAD 2GASA 3EZYA 3HN7A 4IXWA 5THQA 3RAJA 1RJWA 3JQFA 1XHLA 1GAEO 3RJ5A 3O38A 4R1TA 2VHVA 4J1QA 4ALKA 2VRCA 5T67A 1KVTA 2EGGA 1HEUA 3K96A 4WASA 2DAPA 2DTDA 3RQSA 2DPGA 1IHXA 3K9QO 2UUPA 3BMCA 1EK6A 4CLEA 5JYEA 4YRAA 2W4QA 2O7QA 2WD7B 4WCFA 3A28A 3U0BA 3UGKA 5JCJD 4A27A 4UREA 5FF9A 1JWAB 2PV7A 2NTNA 5EQFA 1U4SA 1C0LA 2E4AA 1ZUD1 2W90A 1BVUA 4XQGA 4YAEA 1HDGO 2X5JO 4DWVA 1TEHA 1J49A 4BB5A 5B12A 1VPDA 3QLJA 3VKVA 2CMDA 2WYUA 1GDHA 3OETA 2HRZA 2VT3A 2X9GA 3ROMA 3VC7A 6ADHA 3RASA 2VHZA 1A4IA 1KERA 4AJNA 3BHIA 1BDMA 4N7RA 1WZIA 4RLSA 1ZNQO 1EUCA 1H0KA 2I65A 2TMDA 4Q3BA 4DBVO 4IUYA 4DQXA 4CMCA 5BSGA 2PA3A 4FBGA 8LDHA 4FC7A 5HWSA 2HU2A 2GLXA 1DJQA 3I9LA 3ONFA 5TS3A 4ZGWA 2Q99A 5JAMA 1EE9A 1I3KA 4J3FA 4OKIA 1D3AA 1NBOA 1PU2A 3AM5A 1ZO8A 5DCWA 2D8AA 3TSCA 3AK4A 5KJCA 4PVCA 2D0IA 5G4LA 4OKNA 1I5RA 3ANMA 1N7HA 4FOOA 3FPCA 1B2LA 4GGOA 4BKQA 1X0VA 4NIMA 4HXYA 1Y5RA 3ZNQA 3CZRA 4AJOA 1R6DA 1Q0QA 3H3JA 1YGYA 3MOGA 4WJZA 4J1NA 4KWHA 4RVUA 2AHRA 5I8ZA 4HNGA 1FXSA 1BXGA 4PG6A 1MA0A 2ZTLA 1NPDA 3M1AA 3Q2KA 5DBGA 4Q3CA 2YHIB 3JD4A 1Z73A 4KTVE 2Y1CA 1Z74A 1NVGA 4PG7A 5CEFA 1PGNA 1ZCJA 1HE5A 1PJ4A 3DAFA 4UVDA 1GEGA 1I24A 1YBMA 4WOJA 3IS3A 4FD3A 1JLLA 1PIWA 3DZBA 4LVCA 4BKRA 4CMHA 5KWEA 2X86A 3KRTA 3BAZA 2BH9A 2C20A 4NJMB 5T8KA 4DL9A 4MKRA 3T7EA 1GUYA 4ZQHA 1N5DA 4BNWA 5IF3A 4R5MA 2HCTA 1SNYA 3VZSA 4AJJA 1N7GA 1LSOA 4Y98A 3VDQA 1D1SA 1SEVA 1WDMA 1JTVA 2PR2A 5ES3A 3RU9A 3SEFA 3SXPA 1PEDA 3QVOA 1QV6A 4IDGA 5LC1A 3V2HA 2GPTA 2FSSA 3TNLA 1DRWA 4PLTA 1UZNA 1E6WA 2GGSA 2C7VA 1LRKA 2NWQA 3KB6A 3JQEA 5T64A 3FCOA 1YS4A 2ZTMA 3OJEA 1O5IA 4M86A 1GUZA 5K6AC 3OA0A 4DLBA 5J23A 1PQPA 2ZYGA 4OAQA 1P45A 4Z0PA 1MUUA 3KVOA 1UDBA 5T6BA 4CM9D 4RCVA 2VWGA 3W8EA 3EUWA 3KXDA 4RO0A 3QE3A 4DMLA 4F6LA 3WBFA 3KYDB 3FBTA 3UAGA 4R3NA 3AM4A 1DAPA 1QYWA 2FMUA 2W2KB 4CV0A 5BT9A 4D43A 3PFFA 3WGTA 3WQRA 1M76A 3V1UA 1IOLA 1YOVB 3PRJA 4F3YA 1XSEA 3SC6A 1R4MA 1KYQA 4PLWA 2QZ9A 1T1SA 3JQ9C 1R12A 3PIIA 1RM0A 2VYND 2VHYA 3OF2A 4DMMA 4RDIA 4U0JA 1XCBA 3SLGA 3ICCA 4FPXA 3JQBA 5FWNA 2X1HA 4BV8A 3RUAA 1AHIA 4AJ2A 5JCXA 2Q22A 2LDXA 2WTBA 3KSUA 1VJTA 2R00A 3PHGA 4U7WA 3WSWA 3DBHA 1VE9A 3VH1A 4CM8B 5ENDA 1GEEA 1C1XA 3W6ZA 4ALJA 1NXQA 1DIRA 2B4RO 5DT9A 1X0XA 3BMNB 4D44A 1SEPA 3D5TA 4Z6KA 1H5QA 1X15A 4BO3A 3DFUA 3RUFA 4IXTA 3ZGYA 1XQ6A 3P7MA 3EVTA 4WLUA 3RD5A 4BO2A 2OP0A 4J1SA 3QWFA 5IZ4A 3DEYX 2GR9A 3HHPA 3AY7A 3ETDA 7MDHA 4YACA 1YB4A 3PJFA 2BF7A 1DHRA 4B79A 4B3HA 4RVHA 2EGHA 3VTFA 4ILKA 1ZH8A 1NFRA 4L0QA 3HDQA 1IHYA 5THKA 1YBAA 4WECA 2CUKA 3JQCA 4R41A 4QFDA 4Y9DA 2RAFA 4D42A 3H9EO 4ALMA 4BKPA 1GZ4A 3X2EA 2JFHA 1MP0A 3VZQA 2YW9A 5C7LO 3ASVA 5TJHA 1SAYA 5F3RA 3Q1LA 4NU5A 3CMCO 1MX3A 3IUSA 4IQGA 3SX2A 5AOVA 3TL2A 4CPDA 1BSVA 1JW9B 1LRJA 2DBVO 2XXBA 4IM7A 4UEJA 4FDAA 3T4EA 3DZHA 4CMBA 1LQUA 3BIOA 2GN8A 2CFCA 3PWSA 4RZIA 5KKAA 4XIJA 5JW6A 2W98A 2NU6A 3KLMX 4YEDA 4WNIA 9LDBA 1BMDA 2POQX 5IZCC 3PPIA 3VPXA 1O6ZA 1DBVO 1G1AA 1F06A 1NVMB 4CM9A 4ZD6A 1YE3A 1F8GA 3KUXA 1EEHA 2RH4A 3ZNOA 3LC7O 3W4IA 1J6UA 5IDXA 4BMSA 4D0SA 2Y68A 5G0TA 2H6EA 4I5EA 3WG9A 5G2OA 1XGKA 3OIGA 2W2LA 2PKRA 5MGBA 1GL3A 3SVTA 4PZDA 4L75A 3GT0A 4Z9FA 3PLNA 1KETA 1KEPA 4CMEA 4YRBA 3L4SO 2VYNA 4J9VA 4K26A 2NADA 5C37A 2IZ0A 2GD1O 1V3VA 1XKQA 1E77A 2X9VA 2HO5A 1HKUA 3F5QA 1EQ2A 3LSYA 3L77A 1WXDA 4PFJA 3BTVA 3GGGA 3GFGA 3GDFA 4FC6A 1DRVA 3O8QA 1IULA 3QA9A 1E5QA 2PGJA 2RHRA 1ADGA 2Q49A 5CPBA 2CF5A 2DTEA 5JY6A 4HFJA 4LSMA 1VSVA 3QVSA 3D64A 4CM1A 3SLKA 1JKIA 3GF4A 3VDRA 3H9JA 3UCEA 4FFRA 3KZVA 1J4AA 1V8BA 2NVWA 2V6GA 3EK2A 4OMUA 3TN7A 3E9QA 3DTTA 1C1DA 4XX0A 4BV9A 2YFHA 4A5OA 8ADHA 3LDHA 3B1JA 3X2FA 1NNUA 3C7CB 3AOEA 4LCJA 1I2ZA 4R9SA 1ZSNA 3BMOA 4FFLA 3ZWVA 3L6OO 4XGKA 1GV1A 3QY9A 3MCVA 4DQVA 2IXAA 4DVJA 1EQUA 3JQGA 2CD9A 1A4UA 3NYWA 4NBTA 4P22A 3DZFA 3HDHA 2WD8A 3K8ZA 4PZEA 1UXGA 2Y1OA 3GDGA 3QJ5A 4XZ3A 3ZV5A 3OQ1A 4UAGA 2X23A 5F1PA 4ZU3A 1A7AA 2JFGA 2D2IA 4TVOA 5KJ1A 4J4BA 2HLPA 1D4FA 4RPHA 3EZLA 3ZV6A 3PYLA 2D5CA 4BNFA 1LC0A 3EW7A 3VPSA 4R5HA 1Q0LA 4BGEA 3P2YA 2C2YA 5TIIA 4NZ9A 2I3GA 1YBVA 3GN1A 3COSA 3B1KA 4KOAA 2P2SA 4XB2A 3L07A 2PK3A 3D0OA 1H6AA 3DOOA 4CMKA 3M6IA 4YTEA 4IPTA 1TVEA 4R1SA 2VNSA 4XEHA 1XU7A 3I9KA 1R4NA 4BNNA 5HM8A 4UVEA 1LEHA 1E1MA 1PJSA 4KDFA 4TSKA 1W0CA 1H9BA 1PZGA 1QR6A 1HYEA 3GZ4A 2EW8A 2FN7A 3LF1A 3WWZA 1YWGO 1BW9A 3SJUA 2JD2A 2VOEA 4MVJA 1JDJA 3RC9A 3I9OA 3LVFO 3RBVA 5G4KA 3OICA 4XDZA 1X7HA 3IIEA 3P5SA 4IS3A 1ADFA 2Q2VA 5JAZA 5I9NA 5JXWA 1E3WA 1GUFA 3RKUA 2ZQYA 4EJ6A 4TZTA 4MVJP 3NDJA 5TNXA 3GGOA 4BNLA 1VI2A 1NQOA 3DBLB 3DHYA 1ISGA 4P4NA 4BL5A 4BNIA 5JMWA 1UP7A 4OYRA 1Q1NA 3GVXA 1HDXA 5EMHA 3ADPA 3N74A 4BS9A 4EEXA 4XIYA 2CY0A 4CLRB 3ZWWA 1B7GO 4JJGA 3AUUA 4MINA 4WK6A 2G1UA 5COQA 5B4VA 1GTMA 1CRWG 2PZJA 3E03A 3VH2A 4FQ8A 4NBUA 5KJEA 4QX6A 3WGQA 3ENKA 3WYCA 5DDIP 2PH3A 3OFSA 4FR5A 4II2A 1E7YA 3PJGA 4KZPA 4UUNA 5COAA 3GEMA 4A10A 3IUPA 1KY5A 4K28A 1BDBA 2Q2QA 3S8MA 5A5FA 1Z75A 1O94A 4Z3DA 1Z6ZA 5A9SB 2ZK7A 3JQFC 1SOVA 4OL9A 5KNLA 3UICA 1MXFA 1ML3A 4PLVA 2ZJ0A 2ZB4A 5ICMA 3NDRA 3OEYA 1YH3A 3CE6A 4XA8A 4YJGB 2YDYA 4BO4A 3B20A 4OH1A 4JX8A 3BXXA 4WCFC 3OHSX 2ZQZA 5JLAA 2WJPA 3GHHA 4NPCA 3KSZO 1CYDA 3MEQA 5GZ6A 1OMOA 1R15A 1PS8A 2B83A 2QZZA 5FFFA 4RF5A 1ADBA 2VZ9A 4BHTA 2V6BA 4I1IA 1T4DA 2J5QA 2DTXA 3ROPA 3U4HA 3AUTA 4ND1A 3VPGA 3RUHA 3CH6A 4QTZA 1E1NA 2GN4A 5EERA 2GRAA 4O0LA 5GY7A 1I2BA 4GLOA 2IZZA 3WGZA 5U1PA 1FDTA 2EKPA 4L4XA 5B4UA 2VWQA 3VZPA 4AL4A 2NUAA 4GX5A 4XJTA 2AG8A 1PQWA 5H81A 2IYOA 1T2DA 3I5MA 1T25A 3PZRA 2HMTA 3DAGA 4NR0A 5COBA 3TQHA 1T4BA 3F1LA 3TPCA 1PTJA 1DFIA 1CDOA 1YO6A 3AUSA 5TX7A 5I9LA 4K6FA 4B8WA 4I5DA 2JFFA 2JAPA 4KWIA 3EHEA 3AW9A 1BHSA 1PZHA 4N5MA 3S1LA 1H94A 1Q7BA 2RHCA 3LQFA 3CUKA 1QLHA 3H5RA 1VJ1A 5DOZA 2X0JA 3GC6A 4XYMA 1ZW1A 4L4RA 1P9LA 4KMSA 4FSHA 1AUPA 2NVUB 2J3IA 1IL0A 4J6FA 2GERA 2YV2A 5CPFA 1W6UA 1RPNA 3I4CA 4CMIA 1V35A 3DHEA 3TJRA 4DLAA 2PNFA 4XRGA 3V2UA 4TRMA 2VUUA 4CR6A 3OP4A 4WEOA 4BNMA 5JMPA 1LUAA 4FIZA 5TRTA 5G0SA 3ZV3A 1Z45A 2G17A 1UR5A 5BQFA 3FBGA 4I9UA 1P31A 3JTMA 4TROA 4EUEA 2UAGA 1EVZA 1M2WA 2GZ1A 4JP2A 1U3UA 1L7DA 3RJ9A 2BKAA 3BYZA 3PWZA 2B4TO 3WX0A 2HMUA 2Q2WA 5C5IA 4YJFA 4KUHA 1VM6A 2X58A 1NQ5A 4J7UA 3N58A 4ZQFA 4INAA 4CV2A 2VUSA 2V7PA 1WW8A 1SB8A 4CJXA 4GGPA 2BFMA 3HFSA 4LVUA 1NQTA 1Y8RB 3ROKA 3GUYA 2C82A 4GH5A 4ONEA 3GZNB 2ET6A 1Q7CA 1F12A 1GZ6A 2NTVA 4FOSA 1Y5MA 2DM6A 4Q9NA 1IZ0A 4D46A 4HFMA 3JQ6A 1GPDG 3NTRA 3D7LA 1ZK2A 2D3TA 3ZHXA 3S2GA 4AJKA 3L6DA 1MV8A 4NQZA 4AJPA 2G5CA 4FFMA 2OFPA 5F1KA 3DMTA 3F9IA 2HUNA 3G79A 2PH5A 1V3UA 5H83A 3WGGA 4OSPA 4TQGA 1LDNA 2Z1MA 3C7DB 1QLJA 1ZK0A 2W8ZA 5T57A 1YJ8A 4YAKA 4GKVA 4GSLA 1R66A 1WZEA 3DO5A 3W6UA 2BI7A 3H9QA 5EQDA 3CKYA 2Q4EA 4R9RA 4GBJA 4EGFA 3ANLA 5ILGA 4X54A 4RPLA 1H6BA
chains in the Genus database with same CATH superfamily
1OI2A 3VO9A 3GY0A 1GZVA 3DDNA 1QB8A 4JL6A 3FW1A 1VFPA 2PSHA 3GAFA 5AUOB 2QSJA 3PI7A 1E6UA 1P9WA 1G8JA 1YRLA 1B1AA 1C1HA 1YZNA 2VZ0A 3ODPA 3Q6NA 4R31A 3RLIA 4AK9A 4CKBB 4EO4A 4BGVA 2BSQA 3WJ1A 1O9GA 1KK3A 1RM4A 4OG2A 3IPRA 1GTL1 2FMKA 2QGFA 2BFFA 1IY1A 1KJYA 3BMCB 3DG9A 4L6AA 5CLLA 4E2ZA 1M2OB 2CCJA 4IEFB 5E4YA 5J4LA 3NEYA 7MHTA 3W5SA 1DEOA 5A04A 2MSNA 3U3ZA 4FGJA 4I3FA 1ZJZA 4WCFB 4ARZB 2I54A 4WXEA 2XTZA 2ZYUX 4D4HA 1KRWA 3GRYA 4ATNA 1OGJA 3LSTA 1L7RA 3KU4A 4GS5A 4PXSA 1YF3A 4AF7A 1C7IA 1RRMA 3EXHA 4B8ZA 2EGUA 3VOSA 1ZK1A 1W5BA 2VXCA 4GUDA 3KQHA 1YR1A 2Q6VA 2ACVA 2R00C 2CXQA 3P9RA 1UC9A 1Q15A 2C95A 2FFHA 5DNCA 5H8WA 2XNDA 4HEHA 4UNQA 4Q16A 1FRVA 5IAGA 1NLYA 3O84A 3LC2O 1V4VA 4UJ5A 4J43A 4EYSA 4G0NA 3U3DA 3UMVA 3K15A 2V9PA 3FMFA 2NV2B 1Z2EA 4E7PA 3JSAA 1HLFA 2BFOA 4WA7A 3HNOA 3QEOA 3ZQUA 4CUJA 3TUZC 3GGPA 2OXRA 3VC1A 5I7EA 1JDSA 1ZGAA 2FEWB 2AG1A 1EUCB 1CERA 1FL9A 1R0SA 1P1HA 3H5OA 1NT2A 4HAOA 5J59A 4CQLA 5IWAB 2XGJA 2IIBA 4N5DA 4ZEMA 2YH2A 4L8VA 1P5FA 3ODGA 5ENZA 1XE3A 1QK4A 2PZBA 3DR5A 1D09A 2VBFA 3QWBA 5B3AA 5TB5A 4TXJA 1CUEA 4FOPA 3RADC 1ZR2A 2O54A 1T9BA 3FFWA 1JB1A 4UXJA 2RD2A 1NOKA 2C7GA 2NO1A 5BW8A 3K0KA 3MOIA 2PZEA 4M0CA 5DGDA 2ZFUA 3GBPA 3MRVA 1N7JA 2XQVA 4UM9B 5IVPA 2QI9C 4QOSA 3QXGA 1U7OA 2AG6A 1ZHHA 3BRCA 1ZGBA 4RU1A 1NTOA 2EERA 2FDXA 4PSKA 5ELLA 4YQEA 1UDXA 1XVVA 3WZ2A 1NP3A 4EEZA 3UJ9A 3FVTA 5FIUA 1WMDA 3SK0A 1P9NA 4QATA 1MCZA 4LZZA 1HFJA 1ICIA 1V43A 3PC3A 3U9LA 4BTVA 1GPH1 1VGQA 2UUCB 1N75A 2PZLA 4BUCA 2YJTD 2IYVA 3GDOA 1QHHA 3IQDB 4OQEA 3RS3A 1BKDR 3M6FA 1TI7A 2PVCA 5ITZA 3PYMA 3K70D 1N5KA 2MSCB 2QE6A 4IGFA 2HPZA 2H7YA 1PJRA 4Q7EA 2R2AA 4R0NA 2FDRA 3MCZA 4ALNA 4CTOA 1MJGM 2R6CA 3F4KA 5DTJA 2W6JA 1DC3A 3WB9A 1E9RA 2XUPA 4Q9HA 3KLOA 5MFPA 5FFNA 3HKBB 2CW5A 2O2DA 5A05A 1FFBA 2P69A 4I3GA 3GJ5A 1N0WA 4R2XA 3D1LA 3IEUA 1ACJA 2XZPA 2C9ZA 4FM9A 3EDOA 4XR9A 4Y6PA 2VHCA 4AG5A 4LOKA 4Q24A 1J22A 1N92A 1UWVA 1V1RA 3IWDB 4IIJB 4A36A 4JLMA 3G6KA 3NXKA 1LBQA 2JIOA 1J9ZA 3STYA 4YRZA 4A8JA 1DRUA 3OCZA 2WJHA 4G1FA 3ONWA 2Y9PB 3Q3CA 5DP1A 2IW3A 1XP8A 2IELA 2OHHA 3CR7A 4W8GA 5D87A 2EFEB 2WV9A 2MR5A 4LWQA 1W5FA 4YJ3F 1X7YA 2Z2YA 3PKJA 2FR8A 5MN4A 4GZ6A 5CM8B 5BWCA 4CEJB 3QH4A 3RVNA 3HCDA 1EUZA 3R8XA 2RG7A 5BNFA 5FOQA 1Z22A 1IHUA 3QU2A 2OBNA 1CZOA 4J1TA 1CUSA 5LLSA 1Q2XA 2IEIA 1DKQA 3JWHA 3MB8A 3O21A 4F38A 4UOQA 5KU1A 3B2QA 4NDAA 4DWOA 3ZYZA 2BHLA 1JWBB 1O9HA 1BGVA 2XMQA 3NWJA 3OC6A 3WMGA 4Q5IA 1T3HA 2IS6A 4Q19A 4NBWA 2HHAA 3H9UA 2HWXA 3LGAA 1VJ5A 1ECJA 2VAXA 2J46A 2XYPA 4P36A 4BE9A 5DWVA 3U4QA 1HG1A 1JZSA 5LWQA 4J2OA 1FQKA 3ZW7A 4HQLA 1WHTA 2B98A 2HA4A 4HBZA 4P7JA 1L5QA 3C1UA 3TG2A 3ITKA 1VIAA 2QIPA 2XYQA 1JQ5A 4CMGA 1LBIA 4UE3S 2VQDA 4PZLA 4XCVA 3I2FA 5E7QA 4DB4A 4WZZA 3I1YA 1QWSA 2UVPB 3W1EA 3DHVA 4MUNA 2P27A 5ARCA 4QUJA 4IDPA 4D8VA 4ND5A 5CD9A 1G21B 4COOA 2HN9A 5L40A 3D8NA 3ZCPA 1PX2A 1PVDA 3D5EA 1E63A 3DNFA 3O8NA 4N3NA 4GX1A 4YAIA 2HJRA 4KIJA 5EFZA 3OZRA 3R9WA 4M37A 3HABA 2RMKA 2UXCB 3WQSB 1FMJA 1DAHA 1E0KA 1KGDA 5DBIA 3UV6A 5FHRA 3WGNA 2FWRA 5JQGA 4CEIA 2C8KA 1N32B 4IHJF 3HEMA 1I7CB 1PL8A 3SVZA 3BRQA 3C97A 5A3SA 2W43A 2B2NA 1AM4D 5CHYA 2HV9A 3BORA 4Y2VA 2BY4A 4HDNB 1Z6QA 3RNLA 5AK4A 4QHSA 3E9CA 4QVGA 5K4AA 5CCEA 3RJZA 3GDWA 4M1SA 4IJMA 3P19A 5IANA 1BCSA 4MV0A 3ZHZA 2ZBVA 1G5QA 3TQRA 3RJTA 4G9GA 1IONA 4XIFA 1YS1X 5FBZA 1ZAKA 3ZHBA 4YXFA 1N33B 2AEMA 3H1EA 5EQTA 4YT8A 4XJSA 5DRYA 3R7BA 2FPGA 3LX4A 3MHTA 4R1PA 3PQ2A 2JLAA 4L8YA 4NL4H 4NCXA 2REOA 4XIIA 3KB2A 5CH5A 1P3DA 2SECE 1FDOA 1WF3A 2WYWA 2ZTSA 4X41A 4BUJA 4AQDA 2IP2A 4IZIA 4U7FA 2KBEA 3TSYA 4J7AA 2H2WA 3TKYA 3KWJA 4Y0NA 5A0VA 1ZU4A 3CF0A 3PT9A 3IE2A 2GKOA 2VLIA 1XMSA 2RBKA 1FYFA 3H4MA 3TO5A 1KY4A 1SO8A 5IUKC 3ESYA 5A4FS 5HKOA 5DCYA 1FLAA 3H5WA 1NSFA 2C3YA 3BREA 4D6XA 3LUCA 1A95A 3Q87B 4KI7A 1KAMA 1Y3FE 3OESA 2AUTA 2VCYA 1A98A 3N6VA 3PXBA 1Z4JA 4PBTA 4R8RA 1V71A 3OX2A 1NE2A 4J0HA 2Q8QA 3C1OA 1XA0A 4Q4AB 1N25A 2F8SA 1GCUA 3PGKA 1PFYA 1Z7WA 2XB6A 1ZCAA 4NOMA 3BRWA 3MPUA 1JLKA 5HZHA 4DLPA 5BSHA 4DRYA 3A9UA 3C1AA 3AG5A 3M5WA 5FUVA 1W4RA 4A0GA 2EWVA 3L82B 1OI7A 3ZZNA 2EXXA 4KFCA 4NPAA 2PJRA 1EJBA 1NBMA 1P0CA 1WSBA 2QTZA 3CRW1 1C9NA 1VDZA 1SQGA 1P2GA 3UA3A 4EMSA 4Z86A 1Y3AA 2BMJA 1I10A 3E0XA 4RMNA 2AXPA 2C96A 1NXPA 2FI1A 2JHFA 4UHJA 4IIUA 1ULBA 5ISMA 1BHJA 3EZXA 1RTKA 4R1UA 3D3KA 2ISSD 1MG5A 3D6NB 3MS4A 3UFBA 1EXDA 3IKVA 3RIYA 2AQHA 3KKKA 3FCAA 3ZH9B 5A03A 1UAAA 4NECA 1EFRA 2FCAA 4DDTA 1A04A 3U61B 3H0KA 3I8SA 2JCXA 4XPZA 2ZJFA 5E0OA 3SICE 3TIGA 5HKKD 1UQUA 3BD8A 3F90A 4YR7A 3O7WA 5AM2A 3U7FB 2HGZA 1JS1X 1RZUA 2O0JA 1Z6TA 3AKDA 4JR0A 4MUMA 3RUCA 4MR9A 2R0QC 4RD3A 4MYSA 3QKIA 4ID9A 1Y81A 4O4IB 1Z16A 4YO8A 3L0PA 5LB4A 1OKKA 4MUAA 3UK0A 5LIPA 1EFUA 3A37A 1U1CA 1EP3B 2PIAA 5D8DA 1D9ZA 3B53X 1JG6A 1NMEA 3E18A 1FUIA 1MIOA 3H19A 2L19A 4HS9A 1ULUA 2JKVA 4JXJA 2Y0EA 2D0PB 4FONA 1N6NA 3DHWC 5DLEA 5B1YA 1MT0A 1IB6A 1NHWA 2PUJA 4KPYA 4RWZA 1LPOA 3O47A 1NW7A 2P2LA 2QA5A 2DX7A 3VSAA 2H2IA 2HSEA 3MJRA 3WRVA 3O8QB 5ERGB 4B9AA 4DXHA 3FHOA 2RKWA 4NCHA 1P8JA 2ZYDA 2QMQA 2VBGA 3H5AA 4X91A 4V0LA 1E94E 1X9GA 4O2BA 5ALSA 3UAZA 1VQ1A 2CLLB 3BL8A 1XRRA 3LCMA 4JODA 4MQEA 3DUFB 4LNHA 1DCTA 1EIWA 2O4UX 4I81A 4B4OA 5LSAA 2WT8A 4IIJF 1A8PA 1ISJA 2W6NA 1LU9A 3G49A 5FJJA 5FH9A 5EJ6A 1R6XA 3T4PA 3OE7A 4U2FA 2D59A 4GBMA 5I3ZA 4DV0B 3GOQA 4OQ4A 5A4DA 1YI8A 1ONSA 2FMIA 4CM5A 3W5CA 3LIPA 4HAXA 2BGGA 1JA9A 1P7YA 4R01A 4N7BA 3C3PA 2WB2A 1D2NA 2WJWA 1T9CA 3EJ6A 3F46A 4GU5A 2OEPA 4N7JA 4DCGA 5L9AA 1NXXA 1XG5A 3HZZA 3GGDA 3IDFA 3MA0A 4MQFB 5LYYA 4E1BA 2GSWA 2A0WA 3DGFC 3FTDA 4WSOA 4CIDA 5GVRA 1QPBA 4DSTA 3BT7A 4WD3A 4ERXA 4EVIA 1A5AB 3L7DA 5JHHB 3V4RA 2VK4A 1A2BA 2OZLA 3NR2A 1C80A 1HTTA 4JVNA 2VF2A 1PW5A 1D6SA 2WTEA 4OXXA 3SEZA 4L2IA 4MTCA 1U7ZA 4UMFA 2Q0SA 2I87A 1CT9A 2DY1A 1A2QA 4MI6A 4RQBA 4TWIA 1YQEA 3SHOA 3A26A 1U7DA 3I76A 3RSOA 1QVAA 5LQJA 3TB4A 4KR3A 1UYJA 3KALA 5K6AA 2WZCA 1Y4UA 4OATA 4WCDA 1HT3A 5L7WA 3C74A 2J30A 4I1UA 3FETA 1XPRA 3D3NA 1S9DA 4TUYA 1U7HA 1CQZA 5FNZA 4RK0A 5A0TA 3DHNA 4NY1A 1GT6A 4TS9A 2GMWA 1XTVA 3VVCA 1JJ7A 2IXTA 3R6GA 4WDRA 4AO6A 4BVEA 2BISA 1M10A 1L5LA 3D4NA 1JL3A 3VBCA 3PTAA 4WLEA 1P77A 3BD9A 1DWUA 4AZ0A 1WWKA 1HWYA 4B4WA 4WACA 5H68A 3C8HA 2CJXA 4PRLA 3N05A 4NEGA 2Q5LA 4Q3DA 2XHEA 4MEAA 4GX2A 3I04M 2CC2A 2YXPX 2GCPA 3QWAA 16PKA 3KLBA 3ZKWA 1Q1QA 2QN8A 2BT4A 3HUUA 1SXJD 2K4MA 3IVXA 3HVUA 5EKXA 2B8WA 1NC1A 4DLXA 1SOWA 2AYYA 1UJ5A 1UEIA 3ZD8A 4S1PA 1E2EA 2H4ZA 1PVVA 3PFWO 4ITRC 1OWLA 3FKSD 3L8YA 3GRKA 4KLCA 3U3MA 2FPUA 3LRPA 3NYIA 4CKXA 2FWIA 1Z4MA 4EHHA 4WVLA 5PNTA 4V3BA 2R65A 1U1EA 1Z5WA 2NVBA 3QHPA 1XD9A 2G0AA 4ZEOA 3UB2A 1NVEA 3D6MA 1Z15A 3ML1A 3KO8A 4RKEA 5HP4A 1I7DA 1H42A 4FN4A 3UG6A 1ZL2A 1HT0A 5SZHB 3CW2A 3ZY3A 5KKCA 2F3TA 2EEPA 2O3TA 1CK4A 1NN5A 2FN3A 3NX4A 4RKYA 1EGMB 5LUAA 4UNSA 4YO7A 3ZE0B 2A4KA 2Y92A 4K87A 1W8IA 1M83A 5KOJB 2A14A 4UD2A 2VQ6A 3DFZA 2H0AA 4Q3EA 4WCVA 1IJFA 5KQRA 4NZMA 2REQA 4U7DA 3Q3JB 1ZJYA 1YJAA 2EWMA 4U7JA 3ZWKA 3WOHA 2CFOA 3V8NA 3DMTC 3DYIA 3P2KA 2QVGA 4HPXB 3DBRA 4YCCA 1YCGA 1DC4A 1W94A 3OJCA 5BV0A 3DL7A 3FHCB 4D6PA 2A92A 2XA1A 5T41A 3VDNB 5T73A 2ACKA 1JU9A 1CFZA 2CDAA 3C43A 3D4IA 3GLKA 1JAHA 1L7EA 1T6NA 2GHQA 4KIGA 4D8XA 5DNAA 1LJLA 4ENQA 2IY9A 2Q3EA 3FGPA 3FOBA 3UC5A 3NIBA 3EAGA 2OXIA 1UJMA 3DZ7B 1S3SA 5C8XA 1WDLA 4OJNA 1S2DA 3ACDA 2WFLB 4UBNA 3ZVLA 2AX4A 2H9YA 1E20A 2ZWVA 1DKMA 2E87A 4HX5A 4I4TB 4BP8A 1SZPA 3H3XA 4OHZA 1UXHA 5FD8A 4TKVA 1ZD8A 2RCYA 3NHKA 5BXYA 4YLGA 1K92A 2F3RA 2QVBA 5J9FA 5IT4A 1JQLB 1S1MA 4OV6B 4ZO9A 4D4JA 1NSTA 4OLFA 3H5LA 3CN9A 4LJ5A 3OEWA 4GMGA 2GN2A 4GSKA 2WF8A 1QE3A 2FQYA 3V6MA 4O63O 3IBSA 4O29A 4EG0A 3WJAA 3OOEA 3UGQA 1IFXA 5AVKA 1C3EA 2IE0A 2Z1NA 4UEQA 1RFGE 3MCWA 3NBYC 4WN9A 4NMHA 1VZ2A 4JJ8A 2YRFA 3FUXA 1EM6A 4OUDB 1PWHA 4JYPA 1MB4A 1MABA 2CEAA 1SXPA 1WZUA 4YMLA 1NU6A 3DMRA 3K0AB 5AXDA 4C1NA 5IU6A 1A5SB 3WHKA 3NEPX 5IDQA 3ET4A 4E4TA 2I8AA 2HZBA 3FXAA 1U4OA 4R1LA 2PRSA 1SCDA 4GIBA 3WKEA 1DXYA 2ODPA 2QTAA 2X3FA 4KIFA 2ZETA 2ODAA 3ECCA 4O4IF 4J4HA 1FFHA 1P9RA 2GAIA 3QJGA 1JVSA 4ZQBA 2G3YA 4CQMB 2C54A 2HRDA 3S40A 1NONA 1W44A 4KE9A 3TTSA 5AIAA 3VYRB 3ZUGA 2C59A 2Q1WA 3L79A 4OGFA 1V3TA 4BQEA 3FCUB 3ZN2A 3PGJA 2BZ1A 2FZWA 2FPLA 3VVBA 1FUKA 1W88B 1IBRA 3E9NA 1RSZA 4FEGA 1EEXB 4JV5B 4BCBA 2OORC 1NXSA 1WJGA 1US8A 2O50A 2A88A 4OCZA 5AXBA 3GLTA 3HB5X 4F91B 4H18A 2AZMA 2DYKA 3LI2A 3KYCA 4IIGA 4ZI7A 1HQKA 4IG4A 1I3OA 3C4VA 2QAJA 2AH5A 4IGEA 5G40A 3DT8A 1D2CA 3F3YA 3QI2A 4FE4A 4ZVOA 1U7PA 3QIAA 2AT1A 1DZIA 2HBYA 4ODIA 5FQNA 4L5AA 3QOWA 5T4FA 1IEQA 2FXVA 1T9HA 5AD1A 1EX6A 1OPRA 2BGWA 3NRJA 3PE4A 5FLKA 5K4HA 3FROA 4YP6A 1T9KA 3C8DA 3I9NA 3IUYA 5JDIA 1FP1D 5G41A 3SEAA 1GARA 1X8KA 1Q3TA 3VVMA 1P6UA 3DZJA 1YFKA 2JBAA 3ONVA 2MMGA 1XCOA 2PZGA 3LYLA 4FGKA 4D82A 4UAUA 3QWIA 4BLRA 3PC2A 4AWAA 2AC7A 3WK9A 2NACA 1N8KA 4LSZA 5G0WA 5ARBA 3D5QA 4A3SA 3VSDA 2QUZA 3BULA 4OAPA 4TRNA 1AN0A 1M2NA 3FFTA 2JAHA 3RCBA 3RC8A 1NMSA 1UDAA 3KT3A 4O6VA 5IN5A 3W4JA 5CB8A 4L9WA 2IOYA 2G1PA 2GYVA 3A6FA 4YYZA 1XLWA 2VAMA 4OM8A 2IPMA 5GJCA 1Q0PA 1G21E 1XEXA 2EX0A 2WA2A 3EPBB 5AKHA 5EIHA 3T7IA 3PKZA 3GRRA 3LHIA 1DV2A 3W8DA 2D13A 2P2CA 2BMEA 3DCNA 2BN4A 4O5OA 5A4KA 2OCDA 3EH2A 3W6OA 4WBNB 5I51A 2WSBA 1M0EA 2E18A 3N8NA 4QM6A 1U98A 4HUJA 1NC3A 4LJYA 4FX2A 1UFVA 2QIOA 4NCKA 4OTZA 3AWIA 3MYYA 3Q7RA 4GL2A 1VCMA 2JLQA 3FOAA 1Q21A 4GWKA 5H9VA 1AC5A 3TLJA 2RH8A 3GEHA 3ZBPA 1R5NA 3ZU6A 5FKJA 4UCXA 3IWCB 2BCJQ 2EFYA 4I9FA 2PWYA 3AEUB 3W1WA 3VU0A 1JDTA 3M34A 2YDXA 4TQAA 1U31A 1PHRA 1RRGA 2ZSDA 5JNUA 2YXLA 4CKEB 3EWNA 3AUYA 3IDOA 2F8TA 5L3ZA 1X7XB 2HO4A 2J67A 4XX1A 2ODEA 5ALEA 3TD6A 2QDXA 4YRNA 4IVPA 2FWMX 4NU6A 2OENG 3F7TA 4TX1A 3DV0A 2V4MA 1MJGA 4Z9BA 1EBUA 4CF4A 5IKXA 2C5HA 1P7VA 1NVFA 2IUSA 1WXFA 3OO0A 4FMBB 2CHFA 4P93A 2YS6A 1EAMA 1SR8A 4AI6A 3JAKB 3PLAE 1HDYA 4ETNA 2MSEB 4GI1A 3BILA 3H8JA 3ZV4A 4EDHA 1SU7A 1GTZA 1PFWA 2X5KO 2BLLA 1I33A 4NULA 3B60A 4LZPA 1QRAA 3DUWA 1V3QE 4JOCA 4HRYA 4BXOA 4KXYA 2AOVA 1M6NA 2ECKA 3SC2B 4UTZA 3MJSA 3IDSA 3WGYA 3JD3A 3TDKA 2P3SA 4OK5A 4FYVA 1NPTO 1F20A 2BP7B 4E4YA 4LBVA 3UPUA 3ICWA 1UWLA 4EB3A 2FQQA 3IKMB 3D2CA 1RRVA 3GWGA 2X2OA 1JA0A 5HE9A 2IK8A 2KW5A 3EZGA 1MGPA 1O96A 1SZDA 2PS1A 3R3UA 4WI1A 3EVZA 4Y18A 2ONJA 4DCVA 5HIAA 4IFEA 3D1JA 1GSAA 1KO5A 2GI4A 3ZDQA 4A0HA 4TWJA 4JYAB 3WC4A 3IAUA 2EJCA 4PLGA 2IY7A 5JR3A 1YJQA 3AR2A 3HZHA 2PUGA 2JIPA 1BX3A 2KB0A 4AICA 3IP3A 3HB9A 3L7MA 5KYNA 1EE2A 3RVMA 3ZV7A 3QA3E 1JJIA 4ZZ1A 5CFRA 2YZNA 2IHZA 1J09A 5CG2A 1WKCA 2HCJB 1DC6A 3L3BA 2KBFA 3P9QA 3TVYA 4BFCA 2IKQA 5CG1A 4XWGA 4H0NA 4EW2A 2R6DA 4EG8A 2ZDGA 4LDNA 4TV9A 2C97A 2WUDA 1G5IA 1TYDE 1I79B 3HNRA 4AUEA 4LHEA 2O20A 1DAFA 1NN1A 4I4TF 5CJJA 3EP7B 1Y6ZA 2VTKA 4A2CA 3GLHA 4YQFA 4MX8A 2PL9A 2PKYX 4WKCA 4QRIA 4ZO6A 2A9RA 1YRWA 4R16A 3G7NA 1BFKA 1XK6A 3P2OA 5IAJA 5GIPE 3N0TA 2O2GA 3F3SA 3RRBA 4QQ8A 1CCWA 2AN3A 4Y2RA 3TVTA 1UKYA 4GKKB 1BMTA 4G0ZA 3AXTA 4JLOA 1CF4A 5IKEA 4X3PA 2QX7A 2VPYA 4MI3A 1XFAA 4C3OB 1JUDA 1MVLA 4DGSA 4HQ6A 1DPGA 2BCGY 3E9MA 1PR6A 3F2IA 4RCZA 4I3HA 1TC1A 4JELA 3UHAA 3CF2A 1EHIA 1QH8B 1WCIB 2NZXA 1XEWY 1PGOA 4KMOA 4MA5A 3W2IA 1JILA 2FH5B 3REGA 4U9UA 4ILEA 5IBPA 1R37A 2DQZA 2L18A 1OI4A 2OP1A 3LPCA 4LRSB 2IHYA 4QFMA 5F3WB 3P8ZA 2WD7A 4JFAA 4QREA 3N3BC 3SP1A 4CV3A 2ZI4A 1E3QA 3ETEA 4PHTA 1YQXA 1MVNA 2GHIA 2QZ4A 3FRHA 3NVDA 5FBLB 3NTXA 4Z0TA 3VAYA 4NK5A 1NJ6A 1YJBA 3AT1A 5M5BA 2FHPA 1B0UA 4RDHA 1T36A 4E31A 4G37A 1VJRA 2PANA 4RM3A 3VV3A 4PTYA 5D1HA 2I03A 3LLVA 4LAFA 1QANA 1GSOA 2HRRA 2NM0A 4LXHA 2IYWA 4PZ0A 3VX4A 4EHIA 1NBEA 1JALA 1OFVA 2FX3A 1R6TA 2WLTA 4NLLA 4CKWB 3ZY4A 5KQSA 1YFLA 5TQ2B 2J7KA 3I39X 3S1AA 1KSHA 3LDUA 1DIGA 1IC6A 3EFEA 4NZPA 2OK8A 2WG2A 3ETNA 3VNQA 5J1SB 5JCZA 3OURA 2PGOA 1UZMA 5CTJA 3PEYA 3PWKA 3SR3A 3IOBA 4UFPA 3T1NA 2DXIA 2YWJA 1ZEMA 1VMAA 5AVOA 2H06A 2ST1A 1E2DA 4QQRA 5DF1A 2R6JA 3CEMA 2OE2A 5BN5B 2W2TA 4XYGA 3ROTA 1I4TD 4LRTB 3MYRA 3U4DA 4C4XA 1PL6A 2O6HA 4E2XA 4JH0A 1U1IA 2AOXA 4ABTA 2PKXA 3EW9A 5F52A 4D79A 2ZYSA 3N8IA 2I2AA 1FS4A 1NW3A 5HIIA 1JR6A 2Z6QA 3QQ5A 3ABZA 2ZRKA 1B8NA 1OXKB 4WQMA 4DR2B 4Y6QA 2H65A 3CRZA 5HM6A 1U7UA 1B0PA 2DR0A 2WWHA 4RIIA 3K72B 1P1JA 4I55B 1B8OA 1M2EA 3CLHA 2I8LA 3F6EX 4M21A 4W1QA 5KAPA 1HE3A 4HG2A 2VJNA 4C76A 4GWLA 3EQ8A 4RGVA 4WLNA 3FPSA 3ZQ6A 3CWZA 1K6JA 1A88A 1X77A 1FX0A 2JAWA 2WW8A 3FH0A 3SBOA 4UTPA 3BE6A 1G7SA 2CXPA 5LN1A 3GLIE 1ZRNA 4YMHA 2UVDA 4G86A 1AF4A 2BR5A 3HYSA 3I0ZA 3NWOA 3PQ3A 3QHAA 4PLZA 4L15A 2PFKA 4OM7A 5ALJA 4WBNF 2HTEA 2XWPA 3QBJA 5KYUA 2QT0A 3N0XA 1KORA 4ZCLA 3GRUA 4JI6B 1Z35A 1H1DA 3SPXA 1WSDA 3K6JA 5H59A 2AEEA 3WB2A 5LDHA 4MYRA 2V6MA 1UC8A 4NI5A 1LLDA 2XVYA 3GRCA 1PT6A 4ML3A 3SWWA 3LJKA 2X22A 3LZ6A 3UMYA 1TYAE 4RORA 1IMOA 1ODLA 1CJKC 2H4WA 3LHSA 3PXGA 4WVFA 1XKTA 3KPUA 1H6CA 1EX7A 1XNJA 2R1TB 3A70A 3QIVA 3COVA 1DJMA 1V8PA 8MHTA 2PGDA 3V3TA 4HD8A 4URZR 1M6VB 2EF1A 3GQVA 4JBIA 3UQYS 3VPFA 2P2DA 2H4FA 1V16B 3QNUA 4G25A 4JB0A 1KYWA 3OZBA 2MYTA 4BLPA 1UPTA 3TDMA 3AOEC 2ODBA 3U7EB 1IY9A 3G9UA 2AK2A 3U3OA 4F6CA 1S8NA 1BIFA 2WAYA 4OHMA 2ZTUA 5LQMA 4EG6A 1H2YA 1VCHA 3ADBA 3P9PA 4XSGA 5K20A 3I30X 2MTBA 4YI3A 1KFCB 2CE2X 2DBRA 1SHTX 1XCGB 2QRGA 4F9EA 5FUWA 2HMYB 3IALA 4Q4DA 2P6NA 3IEXA 1T29A 4JBWA 2C8LA 4PO9A 4PZZA 3WWOA 1RRKA 5JH7A 2UUAB 1N2CB 2HJWA 5JC8A 4C1BA 4Y3UA 2YVKA 3IKJA 1JEJA 2ES4A 4B7CA 3TZHA 3UZUA 1ZCBA 4HKTA 1SUEA 1W5AA 2ZB3A 3WIBA 3WKCA 5KQGA 3JARB 1O3YA 3LUKA 1P74A 2QMYA 3V8BA 2Z3ZA 4MW9A 1X13A 2DLDA 2QV7A 1T0BA 4MWZA 1AIPA 2BFAA 3AQIA 2ADFA 1HOTA 4EW1A 2V3CC 4C78A 5IKPA 3IJPA 4LKRA 3BL5A 4Z7QB 1P2DA 2AN1A 2G80A 4EVRA 3RG2A 5ICEA 1C3XA 5GIOE 4JT8A 4WIAA 3QVXA 3T94A 4DSUA 4MUXA 1GKLA 1ID1A 3QUAA 3WK4A 1KFKB 4EZIA 3UMCA 3RARA 1Z7YA 5C52B 4WKBA 4PC3A 3K1YA 3IUNA 1IH8A 4XPIA 5DO9A 3TLXA 3FDIA 5DIZA 1A9YA 4JHXA 2YHBA 4IJKA 3BMQA 5HF6A 4BTEA 2CZGA 2BAGA 1XEAA 1C9KA 1RKXA 2GK4A 2XGGA 3BF7A 3K5IA 3QFSA 3H84A 3TX6A 4ZDIA 5JNLA 3WFZA 1YDFA 3JVEA 3EMVA 3MBKA 4QELA 5AXCA 3RYIA 4J16C 4RZ3A 2HMAA 3NBZC 3X1WA 4P4LA 1GPYA 1T4CA 4J76A 1VHWA 1XZJA 2EFHB 2HK6A 3FFAA 4V03A 1GL6A 2DPXA 2OC4A 1RYBA 3D6TB 5CDUA 5JMTA 5K6TA 3PNYA 4P84A 2JZOA 1SU8A 2YX1A 4ZVVA 1WBDA 1NM5A 2V45A 2O06A 1QQ7A 2JH3A 2QF7A 2YIVX 3IE0A 5KCZA 1GJRA 1SHKA 2UZ4A 3H4IA 3GLRA 4UCWA 3S27A 4BFYA 5BSVA 4XGIA 1LSUA 5A3VA 3WR5A 4UBJA 3TXYA 1GNRA 1FOEB 1U8CB 3L0YA 2QJTA 2WM2A 4AMUA 1ARZA 2J6IA 2OD7A 1M6YA 3DEZA 4RZUA 4F8JA 5JV5A 1W0JD 3OFND 1PHPA 4CN8A 4EFMA 3QSYA 4ZRDA 4B6OA 1G8SA 3F6CA 2X9NA 2ZWAA 2VTDA 2DCMA 3DTVA 4TZKA 3X1MA 4C2BA 4DSNA 5GWXA 1A1VA 3A3YA 4NOLA 1VPWA 4OYYA 1N6IA 1P2VA 3IIIA 4DC1A 3RODA 1WDWB 2AOTB 4OI1A 2WSSA 4U7TB 3THWA 1EFPB 3SQNA 2WIFA 1JJFA 3ELYA 1QYIA 5BNWA 1WXEA 3AKEA 3LHKA 1H93A 2PMDA 3L7CA 3SD7A 2D1QA 4RADA 4ISBA 4Q4HA 4YRCA 1GZ7A 1XL1A 4KN9S 1TYZA 1FFXB 1PO7A 3BCHA 3DLBA 5ICSA 2FR1A 2YMPA 3GOHA 2RHMA 1HX7A 2ZSIA 3ZU5A 5C8VA 3OT4A 4RCYA 3KZOA 3FDZB 3M70A 3VNAA 3ZY6A 1B41A 3LNCA 3G0GA 1IBSA 3M5CA 4RPIA 2A1UA 2JFVA 1QORA 1UJ4A 2QM8A 2G1JA 3A0UA 4U6QA 3VO1A 2JLWA 2C29D 2P91A 2FPPB 2XUGA 3QMVA 1MX1A 3HBMA 4ZI5A 2BBOA 4CI9A 1VL5A 5IW8A 1A2OA 4UMVA 1Q16A 1E7QA 2H16A 3R0IA 4XVUA 2QMZA 3S2FA 3HACA 4DMUB 2R47A 1OC4A 3OOWA 1I7NA 1M54A 1BFDA 3HGQA 1W2HA 3KK0A 3DZKA 3OMLA 2COEA 3VU8A 2REXB 1B8PA 3FB4A 2KWIA 3H1PA 1SWWA 4KWCA 1T1IA 4WK4B 5A9RA 2V7QD 1UZUA 4LYFA 4WN3A 3BICA 1HE4A 5CLQA 5KSPA 3ZC3A 4I55F 1PK7A 4MGHA 1ORTA 4JENA 4ENPA 2QNBA 2BW0A 2R4TA 3C7TA 3HCOA 3L4BC 4K9NA 4P3XA 3UW1A 4QZVA 3Q4GA 4MVJD 2WUVA 2ZCJA 3SKYA 4L74A 4QYIB 1JG3A 1VLZA 3IAFA 2W22A 3KTAA 4KK3A 3LK7A 3SZLA 3ZJ5A 1QC5B 1H1TA 4HDCA 4EHJA 5A5VA 2XRMA 2RKOA 2DHEA 1R2QA 4DDVA 2EP5A 1L7VC 4X0EA 3UVEA 4IDBA 5K1ZA 3EGDB 4H1TA 4Y1EA 4MP3A 2O8CB 4X6LA 2B94A 1KQPA 5AW5A 2ZXUA 5A3JA 2D0DA 3KWMA 2PSJA 4UCFA 5B1SA 2FK8A 2C4NA 5F5LA 2FA9A 1IM8A 2VOJA 2YRWA 4FI3C 1KDYA 4AJ1A 3D2AA 3NHUA 2PMBA 2ZRCA 4ZEWA 4JZKA 2A8YA 2TECE 4ROSA 3T9DA 2YTZA 2OCPA 3QE0A 4UW9A 2A84A 1FYEA 1E0SA 1CRQA 2P4EA 4A1OA 2QG9A 3JAWB 4CR8A 4F56A 1U0OC 1ISFA 1PTJC 2OSBA 2IPAB 3WB1A 1R16A 3LT2A 3O8DA 3Q98A 1M1YA 1LJUA 3LDFA 4AU1A 2HEGA 3G68A 3FVQA 1E2NA 2W00A 2OHFA 5LL6P 1S2OA 5KYWB 4FGSA 3I1FA 5AM4A 5IX8A 1LPNA 3JZAA 4JEIA 4WLVA 3OI7A 2Z5GA 4X7PA 5CDGA 5IJZA 3V8QA 3TSZA 3IEKA 2PL3A 2X6TA 3OAAA 2V5VA 4R8VA 2K7FA 4NK4A 3ZWQA 2F1HA 5L6LB 2XKBA 1OSNA 1WCV1 5JISA 3RB8A 1CJSA 1NR5A 1AXEA 2BM1A 5I8WA 1AKQA 3PUIA 3K92A 4I4NA 3GFVA 2VP6A 2W5UA 4HXGA 1Y1LA 2COUA 5L53A 3JS5A 4ZVMA 5H1YA 2HF7A 2P65A 2VUIB 3ITDA 3VXKA 2O2YA 1NI4A 1DFHA 4HJRA 1OHHA 1MTZA 2HMVA 2D00A 4NWIA 2KM1A 4B6RA 2BMAA 2I3ZA 5KJ6A 2WG1A 1T24A 3WP0A 2HA6A 3B5JA 1C2YA 1GADO 4WT7A 3SX4A 1KO1A 3CX7A 1I4DD 1N8SA 3QXHA 3VHLB 4K81B 1ZSYA 4HTAA 1MQ8B 2JI6A 4F4CA 3IMGA 4YIKA 2ACEA 5LQUA 1LDYA 2GJ4A 3LFHA 3MAJA 1FQOA 4JR2A 4YMUA 1C0IA 4UTXA 5EZSA 3IRUA 3DZ3B 2F9MA 4IMJB 2VZ8A 3UYLA 3KDSE 4QBTA 1GLGA 1XAIA 4R4JA 2WLSA 5JPCA 5IDWA 3MRTA 2NW6A 1A97A 3IJRA 3MT0A 4YFYA 4EJ0A 2C2HA 4A92A 1HQCA 1I3CA 1FU7A 3MC1A 2QE7D 1B0AA 4DDKA 3RAEC 1SUAA 4M99A 3DDHA 3KE8A 4BNXA 4YQYA 4C4AA 4W9MC 4P0QB 4O8ZA 4PNHA 4DRZA 1ZJJA 1TK3A 3SI7A 1XFDA 4L5IA 2XNKA 2F3QA 1RADA 3DZ5B 4WXRA 1OVGA 1J23A 1F3LA 4R9NA 5JAHA 2J5BA 1WPRA 4Q4JB 2JS7A 4IH9A 2OZPA 4ZTBA 2EKZA 2V8OA 2B1GA 1KF0A 1A82A 221PA 4Y9TA 5HIKA 3BXPA 3VKFA 1SXIA 4RVOA 4YT2A 3FAZA 4NAUA 5HFAA 2R1VB 3R7LA 1WUTA 2X8JB 2EP7A 1AQJA 2X5XA 2GHRA 4L72A 5EXEA 2GJAA 1XROA 3PFNA 4TZ0A 1S5PA 3T5DA 1JKJA 3B6ZA 3LP5A 1QPGA 4FKZA 3UUEA 1R8JA 3IV6A 2JGIA 5BSUA 5KSOA 3UMFA 2WC1A 4BV2A 1IBKB 4MYTA 3OJLA 4YP0A 5BVHA 3A2LA 3QUSA 5LKAA 2BRUC 4D0LB 2O8DA 1Y1QA 4PY2A 3S44A 4C5CA 1Z3IX 5B2FA 2GNAA 4KU4A 1CUAA 1IUOA 4OQYA 5M29A 4AY4A 3OP1A 1KIMA 1NA5A 4GPAA 4G0WA 1GYQA 3B12A 3CG4A 2O2SA 2VS1A 1L5ZA 3CR8A 3JCZA 3LCJA 1NAIA 4UZFA 4DMGA 3HFRA 2WZQA 4GGMX 1ND5A 1IHPA 4ZU1X 5JJBA 3I0MA 3F6PA 3OZEA 1BWSA 1CB7A 3I83A 1C3LA 2EHDA 4FIDA 4JOSA 4UPDA 3OT5A 4KHZA 4Q37A 2B7LA 1I7SB 5C51B 1DEHA 3NKLA 4JI7B 4NESA 1LLQA 4RMIA 3H2HA 4Y0AA 4OHPA 1NWHA 2IL1A 3NVAA 1O0CA 1ZS9A 1UC5B 1ZH6A 1PK9A 3DAOA 4CBVA 2BFPA 3AVTA 3PPXA 3A6GA 3RTEA 1E5VA 5CCBA 2X1LA 2IHVA 4LNUB 2N47A 2WMYA 1L5KA 3U26A 2ZIEA 1Q77A 4G0MA 3HKEB 2V7UA 4HBGA 2AA3A 2IP1A 3MJFA 4HL6A 3WMWA 3ZLTA 4E12A 4MVWA 2BDTA 1FY2A 3TOZA 4ACBA 1FSPA 1PSWA 4PWYA 3RIGA 4UEOA 4N0QA 2AEFA 4U8GA 1M0SA 5DBFA 3N28A 1F14A 1A71A 1ZC4A 5K8VA 4OJYA 5HZMA 3OIDA 4BNTA 2F1IA 1UH5A 3DZGA 3KQLA 1A72A 3RK0A 1KVSA 4ZT6A 3O5AA 1ZK4A 1Q44A 2AI3A 4NE7A 4BBPA 1CS0B 2JGKA 4WJLA 1HRDA 3C4QA 2I91A 1YJCA 1U63A 1SU6A 4Q34A 4Q00A 3OBBA 1E4OA 2PSSA 1D8AA 1PJZA 3KJNA 3DNMA 4YREA 1YVEI 2JBWA 1SHZA 3NTUA 4X6YA 1P39A 5H70A 2R2GA 3ESBA 3F5DA 2Y6VA 3R6WA 4PIPA 5CX1A 2HFJA 2UZ1B 2PR7A 2VNJA 3QPUA 2K2WA 3MW8A 4LV6A 1UKCA 4V2UA 4AD8A 3O9VA 2P9ZA 3C5WP 3X1JA 5IULC 1LI4A 2ONKA 1IZZA 2I7CA 2OG1A 1Z26A 2PQ6A 4AJIA 4Z8XA 2J9RA 2X4LA 4COKA 4BLWA 2PYDA 4W5QA 3OJ0A 1RQLA 5KOHB 1E79A 4MCJA 3JQDA 4YRTA 4ARAA 1TRHA 4G4IA 1S7GA 4R40A 4XWYA 1XAJA 2MINB 2DSTA 1SCQA 3AL0C 5FP0A 2O3JA 2QN9A 3FRJA 2DUNA 3PDHA 3C87A 5JE8A 3OQ6A 3OPMA 3QLUC 3Q7PA 4F96A 4FDMA 2PFSA 3JQ8B 4JNKA 2BGNA 3VJRA 1BE8A 1USVA 2AV6A 4C01A 5GOTA 3KD3A 4LG1A 1E59A 3M5PA 2PX6A 3WL8A 3K6KA 1RNLA 1G2QA 1Q11A 1ETUA 3FCYA 2GD2A 1MEOA 2EEZA 3BJZA 3DE1X 3N7AA 1I7PA 1QGOA 5E6UB