1YS4A

Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
348
Chain Sequence
MKIKVGVLGATGSVGQRFVQLLADHPMFELTALAASERSAGKKYKDACYWFQDRDIPENIKDMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVSGAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLNLPTYAKPIVIREEIDRPQPRLDRNEGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVKKYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title A New Branch in the Family: Structure of Aspartate-beta-semialdehyde Dehydrogenase from Methanococcus jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 102
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ys4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ys4A01
3ENKA 3IUSA 2VT2A 4J16A 1WVGA 3RBVA 4CR6A 1GUZA 1DSSG 2IXAA 1U8XX 2GGSA 1W8DA 1VRWA 4CLEA 5CP8A 4RPKA 2YUTA 3PYXA 1L1FA 1I32A 4MOWA 4BV9A 1P44A 2UV8A 2PD6A 3E6AA 3PWSA 5AYVA 4JROA 1FDSA 1UZLA 2RAFA 2PZJA 4NK4A 3RC1A 4HWKA 4AG3A 1B7GO 4PIVA 1OAAA 1VPDA 1PSDA 4R3WA 2CVOA 4QFDA 1ZK1A 3N74A 2X22A 1PIWA 3FTNA 1D7OA 4GPD1 1LDMA 4RF2A 3PFWO 4R9SA 3WFIA 2DUWA 3EGOA 1WWKA 1HZZA 2PGJA 4XKJA 4AJ2A 4XYBA 2J5KA 2EKPA 3QP9A 1A7KA 3BMCA 4RJTA 3OETA 3KEOA 4RQTA 2VHZA 3SBOA 2VNSA 2BKAA 3FRJA 5IXSA 3SLKA 1XELA 4GSKA 1Y81A 2ZB7A 4PG6A 1D3AA 4ZHSA 5GZ1A 3M6IA 5L95A 3WSVA 3KB6A 4BGUA 3WGYA 3H65A 5H82A 5FWNA 4PVCA 3GT0A 4B3JA 4NU5A 1KVUA 1EQUA 1I8TA 2YZ7A 3PQEA 3KHUA 3PRJA 3FD8A 2IEDA 1IL0A 1RYDA 2HQ1A 1F8GA 2C82A 4L75A 2EKLA 4NBTA 1C14A 4J2HA 3INTA 1LUAA 1SMKA 1NX6A 1DHTA 4UULA 2WTBA 3LLSA 3ZWVA 1U7HA 3ICCA 4IIUA 1DRWA 1YDEA 1HL3A 1BDBA 4B3IA 2GNAA 5JY6A 2O3JA 2NWQA 3GZNB 5L3ZA 1BDMA 2D5CA 4XA8A 4NBUA 2J8ZA 4FFNA 4FC6A 4CR7A 2NVWA 3OP4A 1TEHA 3DTTA 1ADFA 3WLEA 3IC5A 3NDRA 2P2SA 4LVCA 2G0TA 1BSVA 2RH8A 4D7AA 1HDGO 2UDPA 1NVMB 1TA4A 2AEJA 2GN6A 3I4CA 1BXGA 2HAEA 1U8FO 4UUPA 3I83A 3A14A 3P7MA 4WJZA 3ZV3A 1MGOA 2PKQO 5JAQA 3JQGA 1BVRA 1FMCA 2ZCUA 3WWZA 2HMVA 4BNLA 3RD5A 3U4HA 4DXHA 5BSFA 4XWYA 4YRBA 4ZRNA 4CUJA 1ORRA 4PRKA 4TRRA 3K73O 1HDOA 2BLLA 4KZPA 2NQ8A 4CV0A 3BHIA 5AQ1A 4GL4A 1KC3A 4GVLA 4RORA 3I9NA 3CZRA 4UREA 3KYDB 1E77A 1TLTA 3OMLA 4RV9A 1HYHA 2FSVA 1XQ1A 3AOEA 2DTXA 4GGOA 2ZJ0A 5CPBA 4YACA 4IDAA 3DL2A 4BKPA 1MFZA 1WP4A 1DPGA 2X23A 4MKXA 2ZTMA 3M2PA 3WXBA 3ZHYA 3ULKA 5I9MA 1J49A 2VHWA 3DHEA 4QSMA 1KOLA 3NRCA 4MIEA 3QA9A 1X13A 5AXAA 5JDIC 3C7AA 1P0CA 4ZVVA 3HFGA 1XG5A 4K26A 2VRCD 1HF3A 1Y9AA 1G1AA 3I9KA 4E21A 1PL6A 4BO9A 4EYEA 2V7PA 2Z5LA 3S2IA 4BKUA 3QVXA 4FFOA 4OGWA 1EE2A 2C0CA 4Q3CA 3VH1A 3HN2A 2Y1CA 5HS4A 4EW6A 1VE9A 2OUIA 3DZKA 2GN9A 1X7HA 3VKVA 2PV7A 1NQAO 1H5QA 1PGPA 2VYVD 2FY8A 2UYYA 5IDWA 1DJNA 4MDHA 2CDCA 3Q11A 2Y1EA 5DNAA 3MTGA 1HYGA 1P9LA 4IJKA 1R15A 4OXYA 4DIOA 3HQ4O 1GTMA 3KEQA 5COAA 3TDKA 1IHYA 1B15A 5LC1A 2OFPA 1XSEA 1IPEA 3KSUA 4WECA 4O0LA 2FMUA 3JQFA 2CD9A 3DBRB 4ZQEA 3V1UA 3LLVA 4BNZA 3UH1A 1RJWA 1N9GA 1ISMA 4FOSA 1LJ8A 4J0EA 5A9RA 3OA0A 2WYWA 2BF7A 3C1OA 4YBZA 3N58A 2WE7A 2IYPA 3NDIA 5I7FA 3ZWPA 5ITVA 1BW9B 4WCFB 4J1TA 4KQXA 1HWYA 2QX7A 3I9LA 2DT5A 4D3DA 2C7VA 5L40A 3VTFA 1JLLA 1D1SA 3JD2A 4DPMA 2H9IA 4OKIA 4BIIA 2FOIA 2VWGA 4CMAA 4NBRA 2X5JO 4F46A 1B16A 4URFA 2QZZA 4OOFA 4CLOA 1EEHA 1BGVA 2DUUA 3ZGYA 3AU9A 1NFFA 3E48A 3AUUA 3ZU2A 2Y66A 3E18A 1EK5A 2ZKLA 4IDGA 5BQFA 1JKIA 4FFPA 2JFHA 3OF2A 1OC2A 1I36A 4IXWA 3I9JA 3SX2A 2NSDA 5TIIA 1WMAA 1K2WA 5CG2A 2YV3A 3AM4A 3LSYA 4N7RA 2B0JA 1UXIA 4QQRA 1G0NA 5JC1A 4WCDA 5KKAA 3H9UA 3GDGA 4IGFA 3GNTA 1YH3A 1D8AA 5ES3A 2G76A 3DR3A 4LGVA 3QWHA 4R16A 3D4NA 1H0KA 4ALKA 3HZZA 2Y93A 3D1LA 3UCXA 4R54A 4B7XA 1H93A 2OGUA 3IAHA 3TZKA 4Y6PA 4XQ9A 4ILKA 1YB1A 4H7PA 3TF5A 4EJ6A 3DZFA 2V65A 4II3A 2FPGA 3JD0A 5JDCC 4XIYA 4O59O 1KVSA 3JYPA 3WB9A 2OL4A 4F6CA 2JAPA 4A0SA 3MOGA 2X1HA 4YRDA 4D0SA 3INGA 2OP0A 5BNFA 4BKQA 4R1UA 3PTZA 4I8XA 3CXRA 3HE3A 2EV9A 4KUHA 3Q1LA 5KVCA 3GGPA 1EVZA 4J9VA 4R1NA 1MP0A 3G1TA 3I4FA 1YL6A 4FFMA 4PG4A 5IXYA 3OJLA 3GG2A 1EK6A 1NHWA 5AVOA 1SNYA 1RPNA 5KNLA 4I9NA 1QMGA 4BO6A 2E49A 4MJLA 3GUCA 4YR9A 4JLWA 3DMTA 3JQAD 4R4JA 1I24A 1PS8A 4M8SA 4CM5A 1C1DA 1Z45A 2Q45A 4BHTA 1U2DA 2AQKA 2V6MA 3MJSA 3DMYA 3VC7A 1Z82A 3TNLA 4DVJA 2I5PO 4CLXA 5DN9A 1P1HA 3ZWOA 3ONFA 3NV9A 1E0DA 1O94A 2UUOA 3T7EA 4DA9A 3OIFA 2QYTA 1DB3A 4WLFA 2VQ3A 4FCCA 1E7WA 1HSZA 4U6QA 1L7DA 2X0IA 1KC1A 3GEDA 3NAQA 4XDZA 2HK9A 5CAEA 4R5MA 4OOEA 3HB5X 4Y6SA 4R51A 5A4DA 9LDTA 2DFDA 2GUGA 4IY1A 4CMEC 2YY7A 2QHXA 2OO5A 2JD1A 2VRCA 4ND2A 4CQMD 2XF8A 3S1LA 5G0TA 2UAGA 5TSDA 1TXGA 4MVJF 4GH5A 1OOEA 1J6UA 3FPLA 2X7HA 3RFXA 9LDBA 4R68A 4AVYA 4BMSA 2IZ0A 3SVTA 1LQTA 1E92A 3OHSX 3H4VA 2IYOA 2VYVA 2J6IA 1JN0A 1P1KA 4GMGA 1DIAA 4Z3DA 4CM1A 3ONDA 2XXBA 2VTDA 3H9GA 3RCBA 2VYNA 3WBFA 1VJ0A 2O4UX 1LSOA 4WCFC 4YJGA 3DB2A 2VUSA 2HO5A 4XDYA 2X8LA 3FWNA 1JTVA 3O8QA 4GSLA 4LSWA 4WNIA 1F17A 5LDHA 1OBFO 3RVDA 4TMFA 3B1KA 4KWIA 3I52A 3SC4A 1C1XA 4F6LA 5L4NA 2PD3A 1WDKA 5JYAA 2VWPA 3OJ0A 4MP3A 3MTJA 4IINA 1NM5A 4RF4A 2JD0A 4RGBA 1Q0LA 1CF2O 4I5EA 3WOHA 1YONA 2X9VA 4BV8A 1NHGA 2YV2A 2FHSA 4N54A 4XX0A 4UVEA 3QWAA 5EQDA 4O63O 2GZ2A 2GZ3A 5H81A 5A3JA 5T8KA 3ANMA 3JQCA 4DBZA 3GPIA 3D0OA 3W4IA 3PHGA 3OBBA 4W99A 5C7OO 1UXGA 2GN4A 3F46A 1WW8A 2E6UX 2WDZA 3KLPX 4NG5A 4QFCA 3H9EO 4YWJA 4E5NA 2UUPA 1VSUA 3BMCB 4EBFA 3BTUA 3DHYA 3UKOA 1QP8A 5BSHA 2PKQP 1BG6A 2NADA 1F12A 3L07A 4KP7A 1GAEO 3JQBC 4YYZA 1B2LA 4M55A 1HLPA 2PZMA 5FI3A 2VT3A 4CM4A 1SB8A 4NFHA 4J1QA 4W9NC 1X7DA 2Q1UA 3P5SA 2HUNA 1Q7CA 1U2GA 4EGFA 1GYPA 2RIRA 3U0BA 4CL8A 3ZV5A 1LA2A 1LBEA 3DBHA 1N8KA 4BB6A 3R6DA 3D7LA 1VL6A 4TRNA 1A5ZA 2NTNA 1GU7A 1PJCA 4LSMA 5ICSA 3JQDA 3PPIA 5IJZA 3W1VA 2CVQA 3CMCO 2BFOA 4S3MA 1KIFA 1AN9A 2R6JA 1NAHA 1GZ3A 2D0IA 2JAHA 1GY8A 4M49A 5C3MA 4BNWA 3DFZA 3OECA 5COBA 5L9AA 5CDGA 3L6DA 1GADO 2EERA 5K9ZA 3W4KA 3EK2A 4CLDA 3H5AA 1BXGB 1DO8A 3AK4A 1PJLA 2RCYA 4CV1A 2GD1O 2VHYA 3BMQA 3MJTA 4PLHA 5T5QA 1IPFA 4CLHA 1QYDA 3C24A 1XYGA 3KOUA 4YCAA 3GH3A 1Z73A 4RPHA 1U28A 3UGKA 5U1PA 1GPDG 1PS0A 1SOVA 2EJWA 2NVUA 4QXMA 5EESA 4L0QA 1QLHA 1I33A 3IDSA 1LC0A 5DOZA 5MDHA 3JQEA 2NTJA 4E33A 4CMGA 1HE2A 1ENOA 3JQAA 3RIHA 1ZW1A 4BNJA 2GERA 1P1IA 3RKUA 5IZCA 4DLBA 4DQUA 3FTPA 3VDQA 4JP2A 3NJ4A 5CEJA 2EKQA 1EVIA 1NPDA 3HG7A 1UXJA 4GWGA 3WX0A 1J0XO 4CM6A 1I3KA 3ZWCA 1Q0HA 2Y1DA 2AEMA 1VL8A 3CZMA 4OM8A 3A9WA 3BYZA 4W82A 4NFSA 1UP7A 4L4SA 1M6HA 4QTZA 1LNQA 5JYEA 4IDCA 3DBVO 2DQ4A 3WGTA 2Q2QA 4OKNA 4RLHA 2PR2A 1W73A 1GQQA 1P74A 1EFLA 3PEFA 4R9RA 3WFJA 4Q9NA 5BR7A 5IN4A 4NMHA 4CQMA 1PJ3A 1XLTA 3L6EA 1PWXA 2Q1SA 1KEWA 3KVOA 4OO3A 1IZ0A 3HDYA 3ZN2A 4ZICA 3F5QA 4Z9YA 3DZBA 3K30A 3AUAA 1O0SA 5KKCA 4DYVA 3PQDA 1O8CA 3RASA 3NEPX 3VH4A 3HSKA 1YWGO 4I9UA 1HSOA 4FQ8A 4BNIA 1ZCJA 4EEXA 2Z1NA 1ZXLA 3DEYX 3ITDA 3Q2IA 4CMCA 3AUTA 3ZWAA 3PI7A 1E7SA 4U0KA 5CG1A 1BRMA 1G0OA 3VDRA 4KTVE 5GMOA 1E6EA 1IZ9A 1LU9A 1WDLA 5JW6A 1PJQA 4UUOA 2POQX 2Y99A 3NTRA 4K1LA 1PR9A 4Z9XA 3GN2A 4YAEA 3TFQA 3GFGA 2ZYDA 2LDBA 4K6CA 2PK3A 3QWFA 3WIDA 3IKVA 1BVUA 1I5RA 1N9GB 4PG8A 3K92A 2VHXA 2OXIA 3GAFA 2TMDA 4J7XA 1H6BA 5BSEA 5CEEA 4QEDA 1T1RA 3DOOA 3IS3A 2CDBA 3PFFA 2NV6A 2Y1OA 1B14A 5L51A 2XAAA 1KY5A 1TI7A 3PK0A 2CMDA 4B7CA 5A1TA 4BNKA 3UF0A 3AI3A 4NU6A 1CQJA 1OZAA 2EHDA 2WE8A 1BXZA 3ZNOA 4CLOB 2CNBA 3GGGA 3S55A 4LVUA 1K3TA 4ZQFA 4R1TA 4DLLA 2Y0DA 3CEAA 4PZEA 4JCOA 2W2KA 4ZD6A 1W0CA 1X7GA 1SB9A 3W8DA 1PL7A 1IB6A 2Y0CA 3DZGA 1JDJA 3WGQA 3FBGA 4FJ2A 4UAGA 4WNCA 3KETA 3GGOA 5TF4A 4YAIA 3KV3O 3GLQA 3WGOA 2DU8A 1V35A 1U9JA 1I10A 4WLVA 1PZHA 5ENVA 2EIHA 3K9QO 2PNFA 4CM7A 4J4TA 3F47A 4BGIA 5K0ZA 2Y68A 2BMAA 3ENNA 4AFNA 2X86A 1ZBQA 2EF1A 1JWBB 4XYGA 3RUFA 1RWBA 1ZXBA 4DBVO 3HDJA 4ALMA 3RBZA 1BWSA 4YQYA 4BS9A 3V1YA 3T4EA 1GUYA 2NU9A 1F06A 2GCGA 4YAJA 2NU8A 4RVSA 5B4VA 2AW5A 3R0IA 4Z0TA 1XIVA 4ZU3A 4Q3NA 1X1EA 4E5MA 1E3EA 3UUWA 3P19A 5FF9A 4H15A 2WD7A 1I3MA 2O50A 2DVMA 1R4NA 3RFVA 1P77A 3OA2A 4NK5A 3L0DA 1KERA 2BI7A 1HDZA 4UVHA 3WYCA 4E2XA 3F6YA 3GVCA 3GRPA 1NR7A 4MO2A 3AOEC 1R0KA 4PLVA 3NGXA 2YW9A 5IDQA 3TOZA 3PHHA 5T73A 5J9GA 1M75A 3FI9A 2VUTA 4X54A 3WNQA 3GK3A 4JNKA 1JVSA 3GC6A 2I76A 5C5IA 2Y0EA 4W7IA 4MVJD 3QV1A 1OI7A 4GVXA 3G0OA 3RU9A 2Y67A 1FDTA 2C2YA 4BNVA 3NKLA 3C8MA 1C1DB 1M66A 4MP6A 4UEOA 3QIVA 2BFMA 2NTVA 4ZRMA 4J6FA 2BD0A 2I65A 3QY9A 4CJXA 5KCZA 1DBVO 1NBOA 1RYEA 4IM7A 3NT4A 3O38A 1HYEA 2RH4A 1CRWG 4MIOA 5CEFA 4A27A 4R41A 4BNHA 5KJCA 3FNEA 1A4UA 1XKQA 3M1AA 2DBRA 4BO5A 4GI2A 4J3FA 4RZHA 1DIGA 3KYCA 5KOIA 4KWHA 1PTJA 1NR1A 5JO9A 2X9NA 1TT5A 4P4LA 2BFPA 1UP4A 2JJYA 1JU9A 3L9XA 3UICA 1GZ6A 4G65A 4BMVA 2X58A 2AQIA 2Q49A 1HZJA 1ZJYA 1T2DA 3D4PA 4CODB 1T2AA 3JQFC 4TKLA 4L9RA 2HMSA 3L9WA 5JMPA 1ISFA 2Q46A 4I5GA 2TMGA 1GFSA 7ADHA 2PZKA 3U9LA 3GG9A 4TVBA 4ITUA 3VVBA 4HADA 1DAPA 3HNPA 1WMBA 3SLGA 2P5YA 5T67A 4S1VA 5I9LA 3ANLA 4GKVA 5TT1A 5B12A 2FWMX 4P4NA 4YJGB 1PL8A 3S8MA 4DLAA 3O8QB 2P9GA 3WYEA 5KTKA 1IYZA 1I0ZA 5GZ6A 4D44A 1Q2XA 3PIDA 1XDWA 1Z7EA 1C1XB 3F4LA 4HNHA 3HUDA 2OZPA 2AQ8A 3F1LA 4E2YA 1PGJA 1T25A 4DIFA 3GEGA 5JAZA 2O7SA 3SC6A 2OORA 1LC3A 1XWFA 2CF5A 3E5MA 1A9ZA 1MLDA 3WQQA 3Q9UA 1QLJA 4W6ZA 2FZEA 1PQUA 1Z75A 1ZK2A 1YDWA 2EGGA 2GASA 2WYUA 3A1NA 2O3RA 3SXPA 5CDYA 2R2GA 2GF2A 4B4VA 3GN1A 3PP8A 3GPDG 3WWYA 1YE3A 1Y1PA 4UUNA 5A9TA 1UDBA 1SAYA 2C20A 3BMNB 2F1KA 4BNTA 3K96A 1O5IA 1EUCA 1YL5A 5A3VA 1DLJA 1UR5A 2A92A 3DZHA 4WEOA 3H5RA 7MDHA 3CSDA 2X5KO 3A28A 2Y1GA 3W4JA 2PD4A 3PDJA 3TWOA 3HB4X 3ZZNA 2C54A 1K5HA 3D3WA 4G5HA 1YRLA 4LW8A 3V5NA 5F3RA 5IG2A 2E48A 2Q2WA 5IDYA 4BOYA 3LDHA 5F1PA 4FFLA 4RPLA 1F14A 4CM4B 1V3VA 2NUAA 3OIDA 5KWEA 3WJAA 4UVIA 1P1JA 3JV7A 5C37A 2AQHA 3VZRA 1HTBA 2O3SA 4PLWA 3DBHB 1WAMA 3H6KA 4U7WA 3B1JA 4CUKA 1GD1O 4Y8VA 1NWCA 4OQYA 4CMHA 4DREA 4XEHA 3S2EA 4A03A 4PGFA 4YAGA 1QV7A 3V1TC 2BHLA 3BTSA 3G17A 1GCUA 2B5WA 2P4HX 4ROSA 4DYDA 3PQFA 4F3YA 1CWUA 1LLUA 3TZCA 2W2LD 4CM9D 4RZIA 3PJDA 4NR0A 4WLUA 3UAGA 3EDMA 2ZB8A 3LVFO 4RLSA 5TJ9A 1PGQA 2A9FA 1PZEA 3PLRA 4Z0HO 1Y8QA 1Z7BA 1U1IA 1XU7A 3LU1A 3MOIA 3JQ9A 3JQ7B 4XQCA 1Y8RA 5ENDA 1LSJA 3DMTC 8ADHA 4L4RA 4C7KA 4YEDA 2GRAA 5EL0A 5K6AA 5DDIP 4PLYA 3FWZA 3QJ5A 3BMQB 3NYWA 4JJGA 1R16A 1ARZA 4NFYA 5AOVA 3TJRA 4CL3A 4PLPA 2IEBA 1HLDA 3Q0EA 2ZB3A 3PHIA 2AA3A 1F0YA 3OJOA 2NVUB 4FOOA 3QVOA 4XZ3A 3GHYA 4MVJA 1H94A 4EUFA 3KXDA 2QYSA 3UN1A 4FIZA 3ETEA 4L4XA 1NFRA 4M54A 4IJWA 1O6ZA 3JQAB 4JJFA 5DBFA 3JCZA 3G3EA 4CMIA 1YBAA 3IIEA 1MA0A 5BSGA 2CZCA 4CM8A 3QVTA 4CMKA 3WYBA 2QRKA 1WZEA 1JAXA 1GV1A 3OQBA 1VLLA 2IODA 4LCEA 3NTQA 3RC2A 2D1YA 3X2FA 1MXHA 3H9JA 4Y9DA 3FNGA 1E7YA 1T26A 4WASA 3ZNQA 4AJKA 1HT0A 1TT7A 3U4IA 6LDHA 2ZIZA 1A4IA 2Y1FA 4DIBA 1DLIA 3OEYA 4Q39A 4PZDA 4PG7A 2D4AA 2HU2A 1DRVA 2GPTA 4IJUA 4IDDA 4GKBA 3ZU3A 5T6BA 1JW9B 2AE1A 1ONPA 3DBLA 3JSAA 4D42A 3WGHA 4XIJA 4YB8A 1LSUA 1NQOA 2VUUA 1NPTO 3MEQA 4NJMA 4RO0A 5KJEA 5A02A 3I23A 4FD3A 3AJRA 3LK7A 1B0AA 2Z1MA 1JAYA 5AXCA 5JCJD 2X0RA 5EERA 1U3TA 3DZIA 4IPTA 5KJ1A 1H6CA 3MJEA 1ISHA 1QSGA 2AEFA 2X5OA 3RI3A 4U5QA 1WNTA 1GEGA 3KBOA 2DBZA 5T8KC 1GQ2A 1U3UA 4IZHA 4AL4A 2G1UA 2FR1A 1A7AA 1M6WA 5CDUA 3Q3CA 5M6DA 4IXTA 3WTCA 3GRKA 3TPCA 3TL3A 4YTEA 3QQPA 3Q6IA 3DAFA 5EPOA 4TVOA 4Q3BA 3JD3A 2CVZA 4FSHA 4CLRA 4CM3A 4BL5A 3QE3A 4XJTA 5I7EA 3SJ7A 3QHAA 4YVFA 4E5YA 4DL9A 4XYEA 8LDHA 2DTDA 4K9DA 1LRKA 2EP7A 3WG9A 5I8WA 1T24A 4XD2A 2QRLA 4YT8A 2D8AA 4G81A 1OC4A 4XJSA 2WSBA 4XRGA 4LRTB 3GAZA 5DF1A 5EN4A 5F5LA 3K8ZA 2C5AA 4MVJI 3NT5A 1LX6A 1VL0A 4KUEA 4OHUA 5JYDA 2ZB4A 3CTMA 4L74A 1S7CA 2YYYA 2W2KB 1ZIDA 1PJBA 1NQTA 2J3HA 1KEPA 3E9NA 4UUMA 2Q4EA 2Q4BA 2YDXA 3P2YA 3H2ZA 5BNTA 3NDJA 1IE3A 2C7GA 3O4RA 4INAA 4J4BA 3PIIA 4BGEA 4XQEA 4FN4A 4XR4A 1HDRA 4DMMA 1W6UA 4DGSA 3VHRA 2C2XA 1B8VA 1KVTA 1WXDA 3U4DA 2CY0A 4IQGA 1PZFA 2FPPA 2D3TA 4EJMA 5A03A 1J4AA 3TL2A 5HRUA 1T1SA 4WOKA 4L73A 4EUHA 3E5RA 1XR3A 1ISGA 3TN7A 3KSZO 2GO1A 5FYDA 5GY7A 5TC4A 4Z0PA 1K89A 3RROA 3ZI0A 4CM9A 2O2SA 2B36A 4JXKA 2J3IA 1DIRA 5CDSA 4U0JA 1B8PA 5JAIA 1XU9A 2B83A 1R4NB 4O1MA 2O23A 3LT1A 2F00A 4Z6KA 1EDOA 3RSHA 2Y05A 4D45A 1A72A 1GCOA 5IZCC 1C3VA 1O9BA 3K6JA 3HDHA 4P8RA 4OH1A 1P0FA 4PLGA 3UCFA 1I01A 1DHRA 1KEVA 3AM3A 3NGLA 4B79A 2I6TA 5DCWA 2X0NA 1I3LA 2VOEA 2ET6A 3KSDO 4Z3KA 1YXMA 3GVHA 3GA0A 4MVJH 3WMWA 2C5EA 4CV2A 4BMNA 4JK3A 3U5TA 4WK6A 4J9UE 1ML3A 1AE1A 3ADPA 5A9SA 1VC2A 3KZVA 2DKNA 1DAOA 1R4MA 2PZLA 3G49A 3JQ8A 1YJ8A 4RQUA 2JCYA 2IZ1A 2FSSA 3QSGA 3TQHA 1JKJA 3AWDA 1ZO8A 2HK8A 4BB5A 1ZSNA 1DFHA 2NNLD 1ENPA 3KYCB 1GQYA 4XGKA 4HNGA 1TT5B 5TT0A 5DP1A 4KTTE 1E3IA 2B4QA 3EZYA 2YFHA 3AY3A 3UOGA 1EVJA 3E82A 3UFXA 3BTVA 4XRRA 1U3WA 1E3WA 4JN6B 3V8BA 3W8EA 4WE3A 3OFSA 1QYCA 3OH8A 2JFGA 3RFTA 3ZWMA 3NT2A 2NVBA 3EHEA 4BKOA 4ZQBA 1TVEA 3OEWA 3EC7A 4DPKA 3DOJA 4LCJA 1SOWA 1YQGA 5THQA 4YT2A 4CPDA 1JWAB 5JCJA 3JYLA 3H3JA 4ND5A 3TZ6A 2NU7A 2G5CA 4YDRA 4E3ZA 1RM3A 3C85A 3DWFA 4B3HA 1RM0A 4I08A 4CQLA 3IQDB 4NBVA 3D64A 4D43A 1ZEMA 3H8VA 2X6TA 1LLCA 3A4VA 3HWRA 1SEPA 3GUYA 1PWZA 5G0SA 3JD1A 3GQVA 2OHXA 4TWRA 4ZN6A 5L7TA 3JQGB 4BO1A 1I30A 2QRJA 1YS4A 1QXSA 3ONEA 2ZYGA 3WTBA 3ZV6A 1ADGA 4D79A 1H2HA 1MG0A 1OFGA 3R3SA 2J5QA 4AJ1A 4GBJA 4NPCA 3TZHA 2CUKA 2PH5A 3PZRA 4QX6A 4OXNA 2IRWA 1K6JA 4AICA 5AXDA 1MB4A 1ADBA 4GX2A 4AJHA 3GF4A 3I6IA 2J3JA 4PFJA 1J5PA 1O95A 1PJTA 1Y5MA 3OJFA 4IIVA 2A94A 4WCFA 1SPXA 2JCVA 3H7AA 2AG8A 2ILTA 1SO8A 1XCBA 4IMPA 3ROPA 1NNUA 3NX4A 3NTOA 1VKOA 4ALJA 3ITKA 5JC8A 1YL7A 1BXKA 1FDUA 1PZGA 1XHLA 1YKFA 1DRUA 3D3WB 3WICA 1ISIA 5DULA 4HKTA 1ZMTA 2Q3EA 1ENZA 5ILGA 4JQCA 2A35A 3IL2A 2X0JA 3AM5A 3L4BA 4NI5A 4B8WA 5JE8A 4DQXA 2VN8A 4WGGA 5HWSA 2O7QA 3VH2A 3DDNA 1QYWA 2CDAA 4EUEA 2DTEA 1BTOA 1S6YA 2E82A 1R6DA 3E9MA 4P22A 1JQBA 2IXBA 5TRTA 3RUDA 1RM5A 4GMFA 4IQ0A 1QV6A 1I2BA 1SCUA 4IQ8A 1M2WA 4D46A 2VZ8A 4HFRA 1IULA 3RC7A 3AFMA 4DC1A 4RF5A 2XOXA 4XYLA 3HHPA 1AUPA 2ZJ1A 3RJ5A 3V2HA 3DFUA 3ROKA 3B20A 1Y8QB 4ZA2A 2EXXA 3TOXA 3VPHA 5A05A 1SBYA 1XGKA 1Y8RB 1LDGA 1IY8A 5IDXA 3AUSA 2O48X 4ZJUA 3KTDA 4FGSA 1LI4A 2VZ0A 5I7SA 1B8UA 3H3FA 3U4CA 4ZQHA 1T2FA 1LEHA 4CR8A 4I5FA 1E7MA 1PU2A 2Z95A 3B1FA 4RVDA 2GN8A 3PZBA 3LC7O 3AW9A 1T4BA 2I66A 5DZSA 5JPIA 5LDGA 3T7CA 3BXXA 4QO8A 4E0BA 3PLNA 2ZK7A 3PYMA 4GAEA 2X4GA 1EQ2A 4BQRA 1YVEI 4BO4A 3LC1O 4J4HA 3SEFA 2G17A 3OQ6A 4CMIB 3RC9A 2J5RA 4Q3DA 5IZ4A 1NPYA 3FNFA 3OJEA 3JYNA 4CM8B 2Q99A 4AJJA 3DHNA 3N7UA 5JSFA 2Q1WA 5IFLA 4OXKA 2V6BA 1N7HA 3KO8A 2VZ9A 4N5NA 5G4KA 2Q2VA 1XA0A 3AI1A 5CPFA 3VH3A 4JIGA 3CKYA 4P4GA 3BIOA 2R00A 2XPCA 1IUKA 4H3VA 2HRZA 5G0WA 4MVJG 1ZMOA 2H1SA 2ZCVA 3PGJA 4J90A 4M86A 1H9BA 1EUZA 3IJPA 1F8FA 4TSKA 5IAAA 3DBLB 3P2OA 4BNNA 4YRAA 2YQ5A 2HMWA 5L7YA 4JBHA 4NJMB 1XQ6A 2W98A 3RUCA 4B4UA 1QRRA 4NBWA 1UAGA 3GZ4A 1NXQA 3F4BA 3GMSA 4PLTA 4DUPA 3QLJA 4ND3A 4R3NA 4BQPA 3CMMA 3H5NA 2P9EA 2PWZA 3WDSA 1E6UA 2NU6A 2EJVA 4IMRA 5TQVA 4E12A 5COQA 3W6ZA 4DC0A 1K6XA 4B7UA 5A5FA 2ZQZA 3RAJA 5HA5A 2EG9A 3ETDA 3O26A 1Q7BA 5G0VA 3DXFA 1ONNA 1MFPA 1SEVA 3GVIA 1JA9A 4YJFA 1AXEA 1P31A 3R1IA 2PA3A 3ZW8A 5I9NA 1DIHA 2DPGA 4YQZA 3W6UA 4XYMA 4Y6RA 3VKUA 2E4AA 3GVPA 1KEUA 4YT4A 2J3KA 2BGMA 1GUFA 4PVDA 1KVRA 4RPJA 4HUJA 1MC4A 4CLRB 1QYVA 1AGNA 1DDOA 1PGOA 3WGIA 4HP8A 1EVYA 1D4FA 4IDBA 1YGYA 3I1JA 1UH5A 1U4OA 4E5KA 3JD4A 3JYQA 3G1UA 2ZTLA 3GHHA 4BNYA 2LDXA 2JFFA 2PKRA 1T2CA 4JGBA 1YOVA 1CEQA 5A06A 1LQUA 1CYDA 4MVJM 5HM8A 3G79A 5JFOA 3AY7A 1ZK4A 3BHMA 3V2UA 5C7IO 1AXGA 3AU8A 3WNVA 3ZWXA 2WJPA 4E2ZA 5G2OA 4K6FA 4IS3A 4FB5A 1N92A 1UUFA 1ENYA 2JD2A 2UVDA 3VPSA 4C4OA 3IP1A 4KUGA 3IOYA 3BA1A 3O9ZA 1M76A 5DT9A 2XXJA 4Q3EA 3UHAA 2O4CA 3CIFA 2DM6A 3FCOA 5A5EA 3L4SO 5JAMA 2HJRA 3WGGA 4L76A 3TFOA 1FDWA 3I9MA 3ABIA 4RDHA 3EAGA 2JCXA 1B3BA 4ND4A 3GMDA 1NP3A 1EDZA 1ID1A 1H9AA 3JQ9C 3JQ6A 1BHSA 4EI2A 3EVTA 5CFZA 1GYQA 4RDIA 5K6AC 2A4KA 2RHRA 1MV8A 4BNFA 5B4UA 4RVHA 1HDXA 4CMBA 4I1IA 5F5NA 4J0FA 3DAGA 3ASVA 1U4SA 4EITA 5AXBA 2I9PA 2DC1A 2C59A 1PJ2A 4IUYA 2GYYA 4UVDA 5ITWA 3ZNPA 2DPHA 3PJFA 4A7PA 4OQZA 3RU7A 4J2OA 4ONEA 2QG4A 1HDYA 2YV1A 3MWDB 1ZSVA 1ZNQO 4OSPA 2PGLA 4Z9FA 2HMTA 1Y5RA 4WPGA 4FW8A 3ST7A 1DFGA 4WLEA 3GR6A 5TJHA 4M89A 4D0RA 3DONA 4NHEA 1LRLA 4HV4A 3U49A 3DTYA 1UAYA 4FFRA 1ZVMA 2QIOA 1C0PA 3GNSA 1GR0A 1KS9A 5ER9A 3TRIA 1UXHA 1I3NA 4A5OA 4BUCA 1V0JA 3TSCA 1NVGA 2BI8A 3AY6A 3OM9A 4Y67A 3W8FA 3ZW9A 5DBGA 3RKRA 4D41A 4NNJA 5A9SB 1LRJA 1E3JA 1NAIA 2FRDA 1U3VA 3WS7A 2VOJA 4DQVA 1R4MB 3JQ8B 5JBIA 1VSVA 1DFIA 2WWRA 4C7JA 1ZFNA 1DIBA 1R0SA 1R37A 1P3DA 3MJVA 3R3JA 2DAPA 3EZLA 3BMOA 4XGNA 1EZ4A 1Q0QA 4XQGA 3WBBA 5B4TA 4WUVA 5TNXA 4FJ1A 4IS2A 5HS6A 1ZK3A 4N5LA 4II2A 1O89A 1DOHA 1GV0A 1EFKA 2DBQA 5L45A 1E3WB 2D5AA 1CETA 4JJIA 4NH4A 4KDEA 4N18A 4HX5A 1ZZEA 3F5SA 4GLLA 3I5MA 2ZATA 2AE2A 1HE5A 4M87A 4A26A 1YBMA 1I2CA 4GX1A 1YBVA 3VPFA 1A9YA 3KM0A 4GQAA 2FZWA 4GWKA 2I99A 2ZQYA 2P68A 3WSWA 3DC2A 1NFQA 4DWVA 3DAPA 3WLFA 5H83A 2RHCA 3A06A 4DRYA 3RWBA 1ADCA 4TZKA 4CQLB 1CERA 2HDHA 4AJIA 5BNIA 3U09A 5KJ6A 3V2GA 1Z74A 3LF1A 3EUWA 3L77A 3ICPA 5F1OA 2DLDA 4WLNA 2C07A 5JLAA 4MIYA 2VYND 3PWZA 2Q22A 2P91A 3H9QA 4R5HA 2JL1A 5JXWA 3FHLA 1X14A 1KVQA 4HBGA 4TROA 1X1TA 3F9IA 3JTMA 1X0XA 4DTIA 3VZSA 4BO0A 3O03A 3M2TA 4JBGA 3ZU4A 1LXCA 1WDMA 2WMDA 3AI2A 4LRSB 3ORFA 5FI5A 3H2SA 4ALIA 1E5QA 2BELA 5TLSA 3KUXA 3GDFA 5IF3A 1R66A 3LQFA 3VZQA 4L8VA 1B26A 3DZJA 4J7CA 4RVGA 2AG5A 1E1KA 3WIEA 2YHUA 4GX0A 4BGVA 3B6ZA 4G2NA 5ADHA 5KJFA 4PZCA 3AFNA 2I67A 1IOLA 2OP1A 3INRA 2YHIA 2O3QA 3K2EA 3E8XA 2B4TO 4IJVA 1WZIA 2QQ5A 2B5VA 1EBFA 2FN7A 4I9HA 4YJHA 4CQMB 1UXKA 2QW8A 2HCTA 4IGEA 1E1NA 2GDZA 5EJ2A 1HE4A 1LDEA 5C7LO 3DOCA 1FXSA 3HADA 4JBIA 4E6PA 5L4SA 1DEHA 5TGDA 3FBTA 1M67A 2O3UA 1DXYA 4HY3A 1JKFA 4E2WA 1KBZA 4AJEA 4W4TA 4TRMA 3RUIA 4BNGA 4GLOA 4F45A 3RQSA 4DPLA 3ZWNA 2V6FA 1LSSA 1B3RA 3SJUA 3RBXA 5A04A 2VNAA 4Q3AA 4JP3A 1E1MA 5F21A 4AJOA 5JO0A 3ON5A 5JDIA 1VM6A 4BVAA 4OSOA 4LN1A 1ISJA 2H6EA 3STHA 3NJ8A 1KETA 3KYBA 2P4QA 2O3TA 4UVGA 4XB2A 3LF2A 1P1RA 2I3GA 1NQ5A 3LC2O 2YFQA 2VRBA 1SZJG 1U5CA 1QKIA 3RUEA 3VOSA 5DOVA 1V6AA 2Q1TA 3VPGA 4AJLA 4TRJA 2BGKA 3E03A 4HFNA 4J91A 3RJ9A 5MGBA 4J43A 4EZBA 5JS6A 1JVBA 2HMUA 3MZ0A 4O5OA 3GY0A 4LMPA 1G6KA 3EW7A 1YB5A 2NM0A 3UVEA 4I5DA 5HBRA 2GSDA 1C0KA 1W4ZA 3PYLA 2EW2A 2SCUA 4AJNA 2YQ4A 4FC7A 3K5PA 4R01A 1VJ1A 4FS3A 3HJAA 4MINA 1A71A 1EE9A 4FR5A 5U4QA 1HRDA 4FGWA 3DO5A 3CH6A 3ZNNA 1LLQA 3IKTA 3VZPA 2JHFA 4BKRA 1X15A 2IE0A 4BO7A 1LDBA 2JKVA 2HSDA 2FP4A 5T57A 4IDFA 4MPDA 2DBVO 5G4KB 3QWIA 1FK8A 3LYLA 3OICA 1RM4A 1OMOA 1R12A 3PDUA 5CHEA 1VKNA 2WD8A 2NACA 1UZMA 4NZ9A 4D3SA 3GVXA 4YA6A 1PGNA 4A2CA 4KOAA 1L7EA 4J7UA 2FR8A 3PJEA 1TB4A 1PR3A 4RL6A 5T64A 3ZWWA 2QZ9A 4MKZA 4KQWA 5TS3A 3GOHA 1UDCA 4OMUA 1UZNA 3GEMA 5L4LA 2Q50A 4XR9A 3RUHA 2OBNA 4PCVA 4BNXA 3GFBA 2CSUA 2W2LA 1H6DA 3D3EA 2OOSA 5B1YA 3EVNA 3C7DB 4A73A 3CPSA 3PHJA 5EINA 2PLAA 5G0UA 2EP5A 2VHVA 3PXXA 2WD7B 2W4QA 4RVFA 2BRUA 4EDFA 1Q7GA 1QYXA 4YXFA 1ZH8A 3GZNA 4HFJA 3OIGA 3D5QA 3C3XA 3EY4A 4YJFB 1A27A 5G4LA 5CDTA 1PX0A 5DCYA 4CUZA 1H6AA 1NTOA 4XGIA 1PS9A 4GX5A 4OYRA 5LCXA 2FR0A 4OIMA 3C7CB 4W7HA 1FF9A 4LK3A 5L7WA 2IDZA 4HFMA 4PRLA 1VJTA 3F3SA 1FJHA 4DMLA 2WEKA 3UCEA 3D5TA 4WEQA 4ZGWA 3UXYA 1E3LA 4M1QA 1MXFA 1GZ4A 2AXQA 3LT0A 3L4BC 5JDCA 4XCVA 4YJDA 5GZ3A 1GDHA 5I8ZA 2C29D 1YOVB 1E5LA 1MX3A 3I3OA 4OAQA 1MUUA 4E30A 5DP2A 3EYWA 4WLOA 3VTZA 2B35A 2EGHA 2P9CA 4E4YA 1XEAA 2YDYA 1U5AA 1ZK0A 3BTOA 3C1TA 4R1SA 3HFSA 3IUPA 1C0LA 1LDNA 3KYDA 2G82A 2FPIA 5THKA 4BNUA 4EEZA 4BO2A 4ALNA 2AMFA 3AOGA 3BMNA 4PN3A 2PGDA 4O6VA 4RPGA 2V6GA 5KIAA 3KLMX 3QVWA 4YT5A 4ID9A 2B4RO 2BGLA 5EIOA 2H5LA 1BMDA 1HDCA 3MWEB 3K31A 3PJGA 1N5DA 3VAZA 1WLYA 2HKIA 3BAZA 1HE3A 3VVCA 1PQWA 4B4OA 2NLOA 2E37A 2PH3A 1KY4A 3PGXA 4LMRA 5HTOA 2HK7A 3E9QA 1UJMA 1E6WA 2ZYAA 4QUKA 1NWHA 4A10A 1U7TA 3FF4A 4GGPA 4IBOA 2CFCA 5EMHA 3VPXA 2WYVA 4KMSA 3WGZA 4E5PA 3ZWBA 4RF3A 3LZ6A 2I3AA 4AJPA 1E1LA 3OSUA 4WOJA 1PJSA 2P5UA 3MJCA 1HKUA 5KVSA 3LT2A 5ILOA 4U6SA 1R0LA 5J23A 1CDOA 4CMEA 1Y6JA 3X2EA 5BT9A 4PLCA 4Y98A 4EJ0A 3MJ4A 3BZUA 3ZCXA 4PG5A 4TKMA 5KVVA 1PJ4A 3LT4A 4ALLA 3GDOA 4UEKA 3B70A 4TQGA 1P33A 4JX8A 4BNMA 3ROMA 3E1KA 2X9GA 3DBRA 4YAKA 3JQ7A 4U8GA 3ZWYA 3S2GA 3CUKA 4RCVA 5ER6A 4RVUA 2EEZA 4QECA 3HDQA 2VWQA 2R00C 1CJCA 4XB1A 1NYTA 1QG6A 3RUAA 1ZEJA 2BH9A 4QT0A 4J1NA 1BW9A 4NQZA 1H2BA 3ASUA 1K0UA 4E31A 5F1KA 4R69A 6ADHA 1Q1NA 3PVZA 4FDAA 1ZJZA 1NASA 3ETGA 3M1LA 3L6OO 2PY6A 3ZHZA 4ND1A 3Q2KA 1E7QA 1Y9EA 3FSRA 2D2IA 3Q9NA 1YO6A 3CE6A 1N1GA 5I7VA 1LLDA 1DJQA 1V3UA 3ZDFA 1GL3A 2VCYA 3BMOB 4H16A 4BO3A 1VI2A 2HRBA 3QW2A 1YQXA 1IHXA 1N1EA 2BFAA 4FPXA 3KRTA 4WKGA 4AJ4A 4CV3A 2W8ZA 1GEEA 2OMEA 1MC5A 3MCVA 2GR9A 3WR5A 3U62A 1E3SA 4N5MA 1Y7TA 1RKXA 3OQ1A 4NDNE 5JCXA 3QWBA 4E32A 3NUGA 1EBUA 3IP3A 1MG5A 1N7GA 1EMDA 4ESOA 3PWKA 1ONOA 1ULSA 1YJQA 1SC6A 3F1KA 4NJOA 1T2EA 3JQBA 3QRWA 1HEUA 4FBGA 4FJ0A 1DC4A 4MVJP 1D1TA 1QORA 3U3XA 2B69A 1GYRA 4W9NA 1ZUD1 1CIVA 2RBEA 1AHHA 1HXHA 3EMKA 3I9OA 1PQPA 3BHJA 1V9LA 5EQFA 4IDEA 3ROQA 4IZIA 3C1AA 4J1SA 2EWMA 3TZQA 2HLPA 1V3TA 1E7RA 1DC5A 5B37A 3JYOA 4B8ZA 1NVTA 3ZH2A 1HETA 3QVSA 1DC6A 4UEJA 2NQTA 4OJNA 1LDYA 4TZTA 1K6IA 2ZTUA 3K2BA 1CQIA 4YPOA 3FN4A 4MVJE 1FDVA 5IN5A 3ANNA 5U9CA 3CINA 3T4XA 3IMFA 4BO8A 2PTGA 1LTHR 1PEDA 4P38A 3FR8A 3ZU5A 4KDFA 1UP6A 1P45A 1N2SA 4LISA 3FPCA 4MP8A 3ADOA 3GNQA 1V8BA 3IJRA 3D4OA 2GZ1A 2EW8A 1WPQA 5JY1A 1YB4A 1QR6A 2W90A 4NIMA 5FFFA 4B4WA 3WMXA 2PFGA 5JMWA 2YHIB 3PHLA 2YJZA 1ZSYA 4QO7A 5TX7A 1T4DA 2IZZA 2ZTVA 4PLZA 3DQPA 3FNHA 4PLFA 1KYQA 1UDAA 1GPJA 4YJHB 2AHRA 1AHIA 4D3FA 2B37A 3UW3A 2WM3A 5ICMA 3S2FA 3WQSB 1ULUA 2OBYA 4K28A 5FEUA 2VWHA 2D59A 4E13A 3FR7A 2DFVA 3HN7A 3ZV4A 3COSA 2HJSA 4MKRA 5L53A 5KVQA 3I6QA 3WQRA 2VTEA 1DC3A 1EUDA 2JHGA 5DCUA 2CF6A 4HXYA 1YQDA 3ZHBA 5JNLA 2H63A 4ZQGA 4CMJA 5JYFA 4J49A 4OL9A 1C0IA 1Z6ZA 2GLXA 3WJ7A 2O2YA 1I2ZA 1ZKMA 1P1FA 5DBIA 3ZHXA 1X0VA
chains in the Genus database with same CATH superfamily
3CVWA 2VT2A 2AJBA 4QAJA 1WVGA 3RBVA 4OXQA 3ELDA 5ECYA 5CH3A 4Q7EA 2QTTA 3VMFA 4HNVA 2C5HA 2C9MA 2QL6A 4RABA 4D9GA 4RIHA 2FPOA 1KFKB 4TQUS 4LV8B 3HVRA 1VRWA 5AT1A 2B92A 1WB9A 3PWTA 2YUTA 4G0YA 4HDKB 5DW0A 3L49A 3RV3A 1Y4AE 2XWSA 2UV8A 3NPAA 1FYVA 4Q7QA 2QYOA 2P6UA 2QL5A 1Y6GA 2R751 1D6SA 4JGGA 1NZDA 2RAFA 5JTTA 3OPMA 2PZJA 4NK4A 4EM6A 1PR0A 3RC1A 2QSYA 3A3YA 3C5HA 2PRKA 4HWKA 2XTJA 4AG3A 1IN1A 1B7GO 1K7XB 2VXCA 2FP3A 4PIVA 1OAAA 4A16A 1R3DA 1DKUA 4S12A 1PTKA 5CXQA 2ZI4A 3SPXA 3WXMA 5DNYB 1KZ1A 1G1MA 2ZRLA 4U2GA 5J3JA 5LU9A 3FTNA 3ZKAA 1D7OA 3D7NA 3PFWO 4FHFA 4R9SA 2J4FA 5HJ5A 1ZMXA 1WWKA 1HZZA 2PGJA 4C0AC 3PBKA 1UBTS 1JIKA 1QIFA 1W1IA 2J5KA 4KO1S 1RJFA 5EE9A 4AUMA 1A7KA 1J0AA 2XVYA 3H83A 3OLVA 5FTKA 3KEOA 2QUIA 4RQTA 2VHZA 5HYVA 4HZIA 2BKAA 1RKUA 2IUTA 3HB0A 3AEQA 1D4OA 3VUEA 2ID4A 4GSKA 1Y81A 4P82A 1C50A 3HZHA 1D8TA 2O2ZA 4ZHSA 4Q6BA 5DXJA 5KYVA 5FWNA 3RAFC 4B3JA 4FGKA 4ZYWA 3PQEA 3KHUA 4NLLA 2DWOA 3K8QA 3PRJA 1TTHA 4AZTA 2ZBEA 4EYGA 1KKUA 5K5EA 1BMTA 2C82A 1TM1E 1KSHA 2YS6A 4R40A 2IP4A 3QKSA 4ARUA 3LIIA 4J2HA 3INTA 3MS7A 4BTVA 4KQIA 4BJ3A 2LKDA 1OFUX 4O5AA 2F3UA 5E7MA 1DHTA 5J63A 3LLSA 5CCDA 2VH2A 3ZWVA 3OHMA 3BIJA 1U7HA 2REXB 4R81A 2VA8A 5IVKA 4YUAA 2WI8A 3C3KA 4JC0A 5JY6A 3PX2A 4GDFA 5L3ZA 3GZNB 4B3MB 1U5BB 4FT4A 4X44A 2J9FB 1OTXA 2J8ZA 2LD4A 4EMTA 5B7NA 2QRZA 4JQOA 4NULA 3VSDA 3GJ0A 1EG2A 1V26A 2RH8A 2REQB 1NJ2A 1YI0A 4MYCA 1HDGO 2UDPA 1KBOA 4UZSA 4U39A 1X7XA 4HDMB 2HAEA 1U8FO 1ZIYA 2ODAA 1QF6A 2ZOSA 3A14A 3NVMB 4G8DA 4G8JA 5GP1A 3WYFA 1QG0A 3Q2OA 4E2FA 5JAQA 4JL8A 1BVRA 4QQ8A 1GOTA 1ACJA 1SG6A 2ONJA 4D82A 3HRIA 3LVQE 3AUJB 4R8LA 5ILQA 3RS7A 4S04A 4BNLA 1G16A 5HFJA 3BSSA 1UFOA 3B9RA 3C3CA 3HR7A 4NCIA 3RQIA 2JLXA 3KYIB 4QQNA 5ALJA 4ZRNA 4CUJA 1AUXA 2VQDA 1TQ6A 4XVCA 2C9YA 4AZ3A 5C1OA 3GLTA 3OEHD 3N07A 2BLLA 2MMGA 4KZPA 2NQ8A 4QA9A 4ZHQB 4CV0A 4KQMA 4F8EA 4UTNA 2E87A 5AJUA 3NTVA 4RVNA 1CEYA 1RACA 4QG7A 3HCNA 4NAVA 1SRQA 1TYBE 2AG1A 3D02A 3U40A 1S3FA 1HYHA 2FPIB 1JI0A 1UEIA 1XQ1A 2D0DA 2DTXA 1H2WA 2FSVA 2GZHA 2ZJ0A 3GCXA 4GGOA 4NDZA 1UDRA 2QMUA 4OP1A 1RQRA 3DL2A 3WO1A 1YB6A 1WP4A 3L7DA 4ZVUA 3TCKA 4BKPA 2IIVA 2XYRA 3A6FA 3HLTA 4PX5A 5FQOA 3ORQA 2REOA 3M2PA 4YNBA 4N5HX 2H51A 4QE3A 2AXPA 1H5NA 4MIEA 1NW9B 1X13A 4YFVA 5E4YA 3VI3B 1JDVA 5FO0A 4B09A 2QRVA 1R4AA 4ZI7A 3Q8WA 1ITZA 1KSGA 3VXKA 1JHOA 1XG5A 3BG5A 2VRCD 4CI9A 1N6HA 2EFHB 1RJ9B 2GMWA 2R6DA 5JSZB 4BO9A 4AY5A 4EHLA 5I51A 1QH0A 3KALA 3QVXA 2PS1A 3A6DA 4NP6A 1QRSA 1S2IA 4BO2A 1EE2A 2PGIA 3CKKA 3WNZA 2YWCA 2YVLA 3VH1A 4EA6A 1JFFB 3HN2A 2FPMA 1V4NA 2Y1CA 4EW6A 3D2LA 2NUTA 3TQRA 1JA0A 4L28A 3UATA 2DFKB 5M3BA 3U7JA 5I7RA 1LF5A 1GILA 2CLSA 2V59A 1NSTA 5BYJA 3VKVA 4JXXA 1N25A 1H5QA 4DLPA 2ZYTX 4LKOA 1P91A 4OLFA 3WMFA 4CIXA 5IDWA 4RYLA 3VAYA 1KYTA 1VPEA 2D5IA 3Q11A 2Y1EA 4Y2PA 3FOAA 1QTQA 3OOYA 1Q17A 4IJKA 1R15A 2OYRA 5FBWB 3TVYA 2PX2A 3LDUA 3RM3A 1GTMA 1F4PA 3SBEA 1EVKA 3B13B 4DWJA 1B15A 5LC1A 2OFPA 2KBEA 3E5HA 1CZLA 1E18A 3IPRA 3FOBA 5HRCA 1CD5A 5D1HA 3OPYB 4PQYA 4M7OA 1U1DA 4X9XA 2XF2A 1GA4A 3QJYA 1TYDE 1EGVB 1M33A 1Q57A 1XFAA 4E70A 5MFZA 3LLVA 3WYGA 1JEQA 3AR5A 5DHRA 1RJWA 4ZKDA 3IJ5A 1ISMA 4Y9TA 1S4MA 2QQ0A 1BE6A 2WZCA 4GOLD 3E05A 1AMOA 4LI3X 1WZCA 2I62A 2JAUA 2QN1A 3N58A 2VPWA 3M82A 5D7NA 3SDSA 4ARZA 2JK0A 2HO4A 5KTNA 5F2NA 4KVGA 3MIIA 3VU8A 3ZWPA 4A2QA 4DXAA 2AFHB 5I7FA 4FGUA 3G1WA 1YU6A 4JGIA 4NATA 3PA6A 1BW9B 1GKKA 1M2OA 1Z88A 1UBSB 1YCGA 4Q03A 4WXRA 4WZBB 4GE3A 1K7FB 1LVHA 4Q01A 1KIAA 2DT5A 2GN0A 3PC7A 4YK7A 4RD0A 5L40A 1G20E 2CHEA 3VU9A 4FMDB 1AH2A 1XDDA 2JATA 2C88A 3I9V6 4XTCS 1ZRSA 3F9RA 4G5XA 4BIIA 2X5JO 1HFEL 1Q22A 2OQRA 3G0IA 3OQVA 4K6GA 4YI3A 4BFSA 1Z4NA 5IKEA 1XPRA 1EEHA 5CFPA 3QTLA 3IR6A 2ATEA 5H5JA 3ZGYA 1EHCA 3EUEA 3R3YA 1RTTA 2CVFA 3SOZA 3H17A 3LK6A 1R4ZA 1RI3A 1CZOA 4ICIA 4LC9A 3X1YA 4C4RA 1A9TA 4CLDA 2W6QA 4RM3A 2WM2A 3E18A 2J0VA 1T0UA 3UW1A 5BQFA 4FFPA 1OFIA 1K8RA 3CVYA 3QUBA 4C04A 1TC1A 2FN8A 1BJKA 4G5GA 1OC2A 3I32A 2X6RA 3O84A 4O2AB 3ZBPA 4KQEA 1I36A 1Q7EA 4B82A 1QE0A 4IFIA 3S6JA 1JLKA 3DAYA 4ZOLF 3FVTA 2O2IA 3SZUA 4IJ5A 1MJGA 2BMJA 1WMAA 1K2WA 3CKMA 2WSIA 3LSYA 3SS9X 2H1OA 2G9RA 1G4HA 3HA5A 1OXXK 4KIUA 3JTEA 2NZYA 1IY2A 4WCDA 5HXAA 2YXDA 5B58C 5LA6F 4D8UA 3FOZA 3GDGA 4JUBA 1KF0A 3BDIA 1YH3A 1FNNA 2BE7A 4LJLA 3GQBB 4OI4A 3VOBA 5DM60 3E15A 2E4ZA 2FETA 3K71B 1RZVA 3OZIA 4LYEA 2Y93A 4UU1A 1VSQA 5BRAA 5IUKC 4EF4A 1TDJA 2X8AA 4YAOA 3TZKA 1C8LA 2I3BA 2Q5EA 4XQ9A 2JI7A 3IHLA 3ROZA 5C4IA 4H7PA 3AVVA 3TF5A 1RRMA 4C4SA 3R7WB 1M34E 1VG0B 2W83A 4Y0VA 2EVWX 1R8QA 4GC5A 4PSKA 1JSCA 2ZPTX 2DXIA 1NXSA 3JYPA 3PC2A 1ZD2P 2OL4A 4F6CA 4A0SA 2DR0A 5K0TA 2OXEA 3GLKA 4Q1AA 2X1HA 3I6ZA 3W9SA 1L4FA 4NARA 3CXUA 3V4LA 2OP0A 4D0SA 4J0HA 4D9HA 1OLUA 4R1UA 4JKOA 1L7PA 3PTZA 4DQLA 5LP6A 2JB9A 3CXRA 3SSOA 3Q1LA 1EVZA 4YP0A 1Q2UA 1RKQA 1PK7A 2P40A 1O87A 3BRSA 3G1TA 2RC5A 3HCCA 3OURA 4G1UC 2CEAA 4LJ9A 3UV3A 3MLEA 1WZ2A 1DE0A 4N01A 3DOEA 5DMXA 2WILA 1NHWA 3ZDYB 2Z8YM 5CVDA 2FMXA 5B2EA 2BEVA 3V9PA 4PZAA 3HP1A 1B8OA 4C6TA 4I9NA 4LDJA 3GUCA 1HDEA 4YR9A 2K2WA 4K0RA 2H5JA 3JQAD 2B98A 4R4JA 2GA8A 1PS8A 4M8SA 3KKKA 4TTVA 3KZOA 1Z45A 4LGMA 2GBLC 3NHZA 2LBPA 3R5JA 3MJSA 5IAEA 4FHZA 3DMYA 2CMGA 3OI7A 2LE0A 3EN0A 3TTUA 1IMOA 1UMDA 1P0MA 3VC7A 5DN9A 4DVJA 1T4MA 3H1EA 5B7QA 1YSCA 3C70A 3PDIB 1E0DA 4OU4A 3LXMA 2UUOA 4GIBA 3TGWA 3IO3A 2HXGA 4LXHA 5FXMA 1VG1A 5DM4A 3HEBA 3T7EA 3WB0A 4BE7B 2QYTA 1DB3A 3HMQA 4DDHA 4Z4IA 2VQ3A 4POOA 2W6JA 1E7WA 1HSZA 1L7DA 1XMXA 1JSLA 5JHGB 1RTKA 2AX4A 1BWPA 1XD2A 3HB5X 3K0AB 3N0WA 3MS2A 4I55F 4JX9A 2DFDA 2GUGA 3NWBA 4W8OA 5F78A 2YY7A 1TF7A 3H1FA 3TZLA 3WL7A 3VR1A 4BTLA 2O8BA 4MWGA 1Y37A 5L3VA 2W6PA 2G9VA 3FUUA 2XWBF 4WKNA 3V8EA 1TXGA 4AY3A 2QV0A 2V5UA 4WD3A 3D6HA 3A04A 4ZC8A 1NBWB 2Q2NA 4IMIB 4JSYA 3T06B 4PWYA 5H16A 5IK2A 2P6RA 1UINA 1XZDA 3JARA 3U48A 9LDBA 2V7VA 2XRYA 3D7MA 4G25A 3L3BA 2IZ0A 4I1UA 2HBZA 1LQTA 1XTPA 3SVTA 2G40A 3OHSX 1KRHA 2H4XA 3H4VA 3W0LB 1EBBA 2VYVA 2FUEA 2QUBA 2QN2A 2A86A 3AO0B 3GGCA 3MAAC 3ND7A 4Z3DA 3RWOA 3ONDA 4EMBA 2BV3A 5B6JA 4I9FA 2WLSA 3QUQA 4GI7A 3FFBA 3R3ZA 1H2YA 4HAYA 2F9LA 4LSGA 2PAFA 2LCQA 1VJ0A 1QG4A 2O4UX 1E2FA 3LCVB 4YJGA 2X7JA 4N03A 2P79A 3O8QA 2IOFA 3B5JA 3TW0A 3P8ZA 1E89A 4IO1A 1F7VA 4URHA 1XMIA 1P2DA 4KN6A 1VL1A 1XTRA 1T6YA 5A2QA 4FHGA 3KQUA 4RAOA 4RF4A 3QU9A 1TUEA 4TTAA 3K15A 1Q0LA 2A5FA 3F3MA 4LQ4A 3LKZA 2AYXA 2ZIEA 1W4BA 4UUBA 1NHGA 2YV2A 1G8HA 2FCRA 3B3FA 3DBOB 5E6RA 3TFWA 4N54A 4XX0A 4UVEA 3MLBA 4AWBA 5KQLA 2BUAA 2GZ3A 2Z5VA 4AKIA 3BDAA 3T4PA 2YYZA 4IUDS 4BUZA 1SOUA 4TSFA 3GPIA 4DBZA 3W4IA 2BI4A 3PHGA 3OBBA 4W99A 2VZEA 5KNBD 3NWPA 3F46A 2E6UX 1X8KA 3BJZA 4K9MA 5KSPA 4QSHA 3VO1A 4YWJA 2B6NA 4LVOA 4RKQA 1VGQA 4DCNA 2IOHA 3UHFA 4Q1BA 4BYMA 4EBFA 1QGED 4WINA 3UKOA 4BEWA 5LQCA 1U1CA 1GPUA 2I8CA 3AF5A 3CURA 4I4IA 5DYWA 3AEQB 1XKXA 4YBRA 2GAFA 1G2PA 2FG7C 3L07A 5DGXA 3OEED 1KE2A 1U8UA 3OLCX 3FDIA 3F5DA 3EQZA 4N39A 5F12A 1HLPA 4PYMA 3UENA 1I7LA 3IERA 5AJHA 2Q5HA 2VT3A 4HGNA 2FEKA 3T5DA 4NFHA 4UHFA 3H5IA 3RUCA 4J1QA 4Z0NA 3M3DA 1X7DA 2Q1UA 4PZZA 2FYTA 2ZIUB 3LUHA 4CL8A 4GSYA 3QKSB 3ZV5A 2C3PA 1XALA 2Y71A 4KXXA 2XT0A 4AP9A 2B21A 2YASA 4X6UA 3IEMA 2FE4A 1H9CA 2NTNA 4GRIA 1Z7GA 4H59A 4TWBA 1EJBA 3KKZA 3FKQA 4KYIB 5FKJA 2RGCA 5LLTA 2WV7A 3BSFA 1KZ7B 3PPIA 5IJZA 4HB3A 1U90A 2A14A 2EU8A 3W1VA 2BFOA 5I47A 2EFEB 3WLNA 1CXZA 4LQDA 5D51S 3GDHA 1AN9A 1RLJA 2PRIA 1JQ3A 4HWTA 5T6MA 3WL8A 1ATIA 3QXGA 3CX7A 5G1OA 3RS8A 2IH2A 2VDRB 3OE5A 4QBIA 4W5QA 3DFZA 4QOEA 3U44A 4HUTA 3ZDAA 4X8HA 3ZQ6A 3SZOA 3L6DA 5B36A 1M2FA 5E3JA 1KDVA 2EERA 1ECJA 5K9ZA 2Z8YA 4MRSA 3R5KA 1X7XB 3RRBA 3AVQA 1NXOA 2I7VA 2ZYIA 3AR6A 1MEOA 3K70D 1R0XA 2V97A 1L3CA 3MJTA 4UZFA 2IYLD 1M2KA 4KHZA 4MEAA 3ZJYA 1D4AA 4YCAA 1RU3A 2XX3A 1U11A 5U1PA 1GPDG 4Q9LA 1IEQA 1ZX1A 1JQLB 1T15A 4DLNA 3A1TA 3GROA 1GGHA 5LZ8A 3VPGA 3E2IA 4BAZA 1CE8A 1CUWA 4L0QA 4AZ3B 1SA0A 2HMYB 1YTLA 1ZOLA 4DRXA 3JQEA 2J41A 4CMGA 1Y5IA 1I79B 3IBFA 2HV9A 5J47A 2BSQA 1UPFA 4N0QA 1ZW1A 3GRVA 3H8SA 4BNJA 4L5IA 4C0HA 1FCJA 1JIQA 1BHO1 1DTSA 2R1TA 5EP2A 3TLAA 2R85A 4HS4A 4UEWA 4DJDC 4KMOA 4DQUA 5IZCA 4K2HA 5KQSA 5AVQA 4IJMA 1HG1A 1ACMA 4FILA 4X60A 4LFCB 4B8ZA 3NJ4A 3HB9A 3R3WA 5AO9A 4NDAA 2A5JA 4JU8A 4GWGA 3W2FA 3WRYA 4XFDA 2ERYA 2FZLA 1U0GA 5C32A 1SOMA 2JVIA 3ISJA 1CUZA 4LRYA 3A31A 3BYZA 1YUMA 2JIZD 4YRLA 4L4SA 1LZLA 1MO4A 1JFRA 3RHZA 4QTZA 1Q16A 3OVMA 1Z0FA 2QRVB 1K97A 2JZNA 1VZ3A 2Q2QA 2XJ4A 4IWNA 4N49A 4DHEA 3EWAA 4TV8F 4EYSA 3PTLA 4ZI7B 4RTOA 3PEFA 2JHPA 4LOKA 3VZDA 3L6EA 3EGXA 2DBYA 3HBAA 4NENA 2PLRA 5DT2A 3VR5D 1RXVA 1YI8A 3KVOA 4OO3A 3OZWA 1P9NA 4UKDA 4Q3LA 4GMHA 3ZN2A 2QY6A 2W4IA 4XI9A 2VR1A 4Z9YA 3RAGA 3P9YA 3ORRA 2BEWA 5BOSA 4AYWA 1XK7A 3FWYA 3KR1A 2NUTB 1D2AA 1FTGA 1O0SA 3IB6A 4DYVA 3PQDA 2WUEA 3ELWA 2I03A 4LYHA 4MARA 4PXYA 5ALKA 4V3CA 5SZHB 1AOXA 3ERCA 1YWGO 5TPZD 2KJQA 3RIGA 1ZIXA 3V4ZA 3MAJA 2X8WA 2BZ0A 3FUTA 3ZGXA 1N7JA 4MYSA 4NU0A 1RI5A 1EJ0A 1C7EA 3K9GA 4CMCA 5K8CA 3RLIA 4KR7A 5CITA 1G0OA 5GMOA 1ODSA 5AM2A 4C7BA 1DGQA 3L06A 4ZAWA 2K6GA 4KACA 5SY9A 4K1LA 2FOXA 1W76A 1KIMA 3LKBA 3QLTA 4QOIA 2HJHA 3GN2A 1KDTA 2VYFA 3GFGA 1PDWA 4K6CA 4P5EA 2PK3A 5JOQA 2P8JA 1JEQB 3MFYA 4JJAA 3AVPA 1I5RA 1WRBA 3NNDA 4PG8A 3KB8A 2BUCA 2GM4A 2BL4A 2OXIA 2R4UA 5HQ3A 1RABA 2CZGA 3O2JA 1FSZA 1TCUA 3N0RA 4PFSA 5JTUA 1N5MA 2HHCA 1U8CB 5BSEA 2IYYA 5CEEA 2ZRDA 1GUBA 1T1RA 4GOOD 2OAQ1 1M2OB 4HRXA 5I7OA 3T7SA 2YS7A 2J3EA 2I4TA 4EVIA 1B14A 1W0JD 1TI7A 3C3AA 2PT5A 3UWSA 2PQ2A 1TOAA 1ZN7A 2ASVA 5BV0A 4Z4HA 4QU8A 3UMRA 1CQJA 1E2MA 1G4UR 1GITA 1HLFA 3CW8X 5K0JA 4GYKA 1D7AA 2EHDA 3KWLA 2HIMA 4JI6B 1X9IA 3DHVA 3BKXA 3DULA 1ZKDA 3GGGA 3CW2A 3CX8A 1QF9A 2HF8A 1T1GA 4EHNA 2GO7A 2DLCX 1KXJA 2PHZA 4HAOA 2PVSA 2ZPUA 4JCOA 5F33A 1EU1A 1ZQ1A 4KVZA 1N3BA 4L5AA 2XUIA 4ZO6A 1M5RA 3I73A 4JT8A 1JDJA 4B3IA 3WGQA 3TBFA 5HMMA 4RESA 4FJ2A 3G02A 4UAGA 5KWSA 4P36A 2GFQA 2MSCB 4B0OA 4J6EA 4WFIA 4C22A 1VQ1A 1E2IA 3ORHA 2RKWA 3PNYA 3AETB 3AL2A 4UNNA 621PA 3DOHA 3K9QO 2PNFA 3NHWA 3F47A 1U0HC 4QDUA 4V1CA 3DM9B 4AFNA 5JVDA 2V4ZA 2O8NA 1ZBQA 4TTSA 3KSMA 3Q1KA 1JWBB 4XYGA 3RUFA 1ZXBA 3ME5A 4GHWA 4DBVO 2WIAA 3QKTA 4EKIA 4LKRA 4BV2A 4F4DA 3DYVA 4ZI2A 2R6FA 3KXIA 4DJEC 2P0AA 4EVRA 2WFZA 2XADA 3DW1X 2CK3D 4OQ4A 1NT2A 1PFQA 1YMUA 2FA9A 3CJTA 4FOTA 4HK4A 4RVSA 2AXEA 3GW8A 3MN1A 4P0PB 3MTAA 3OCCA 3O0DA 2P2CA 1OJLA 3FOFC 3MMPA 4Z0TA 4C7OA 1MD9A 1XIVA 4D74A 1X1EA 3QV2A 3UAZA 4E5MA 3GAMA 3SN6A 2P4EA 2FTKE 2PQMA 5FF9A 3QFTA 4R83A 4XWGA 3G5UA 1KI7A 1OBHA 3KHTA 4DZZA 3KB1A 2WJGA 2WD7A 4LWOA 4EJSA 2W2PA 2HMAA 4FOPA 2HPHA 4YMHA 4UPVA 1Q3KA 2EQBA 7ABPA 3AX6A 3L0DA 2FSGA 1GRVA 2CLDX 2R2AA 3PQCA 4R9UC 1M2JA 4DA6A 1OLUB 3LFUA 5MFPA 3GVCA 5LP6B 3U0VA 5IMBA 3HFRA 4EMSA 4KN9S 4KW7A 2QMOA 2RJNA 1L1RA 4U2CA 1SU4A 1L5VA 4V0LA 3ZD8A 4F4HA 4POAA 4DNFA 1ZR2A 1JR3D 2F9FA 4GOMD 4QYIA 1SHTX 1T3LA 4X54A 4E5SA 1ULHA 4RK6A 2OHFA 2EHJA 2ZJAA 4K5QA 2Y0EA 2OLJA 1DV2A 1NC3A 3G6WA 1QVAA 5TDHA 2BEVB 1DJPA 1S2LA 1Z5PA 3L7NA 4ZV9A 3IQIX 4C6TB 1RC0A 4LE2A 4GVXA 2J45A 3G0OA 1XP5A 4FWIB 1YDFA 2Y67A 3T3MB 1EP2B 2B1RA 4RIFA 5JWRA 3W5VA 2AOWA 1NJ1A 4ZZ1A 3E3OA 3IEUA 5ALTA 3ZEIA 1RQXA 3MMXA 1M66A 1QGYA 3THSA 2B1IA 1UMDB 3QIVA 1KH2A 2FQQA 2NTVA 3SJCA 3RTGA 4DV0B 2DPXA 1PR1A 4UDNA 3MA0A 5AMXA 2OO3A 1DRKA 4I3FA 2RH4A 2PXHA 3DAOA 5CEFA 4JJ8A 4DSAA 4CG2A 3R20A 3PITA 4GXRA 4RY9A 3L0YA 1S1MA 4CHTA 4DEXA 3UJ9A 1PTJA 3DFKA 2QKYA 1RRKA 2BFPA 2O8BB 1UP4A 2JJYA 3AY0A 4P32A 4EQZA 3BEDA 4PGGA 1JU9A 2AB0A 3TR6A 3I1FA 1XCLA 3EEQA 3UICA 3W1EA 3DE7X 4D25A 2IZOA 2Q49A 1GZVA 1HZJA 1Z18A 1KYVA 1P1BA 2ZJ4A 5D86A 2OG1A 4EGQA 4F9TA 4KV9A 1T2AA 3OE4A 2ORED 2QJFA 1R18A 4TKLA 2BCJQ 8OHMA 4K81B 2HMSA 3L9WA 2YUIA 2CMKA 3WIVA 4FFWA 5JMPA 1ISFA 2Q46A 1IWPB 3L01A 2IBSA 3MUOA 7ADHA 1VRVA 2PRZA 4TVBA 2EKZA 1LW6E 2O6HA 4ITUA 5BVGA 2P5YA 4D0GA 4CQNA 3TIIA 4S1VA 3ANLA 4GKVA 1SXJE 3UQYS 2GT1A 3EODA 2JGRA 4J1TC 4YJGB 3GBSA 2GKOA 2JCBA 3O8QB 1DEOA 4HXEB 1XEFA 3D8UA 5FJJA 2XNKA 1C7JA 1K68A 4RHCA 1IXSB 1NLYA 2X4LA 1BS1A 5K03A 4D44A 2OAGA 1XDWA 3EEIA 4XCQA 3LE8A 2RGEA 2X9LA 3HUDA 3JR7A 4HDNA 1FRFS 4HH3C 3DVRX 1RXCA 1GGNA 3F1LA 1BE8A 4A15A 3KJNA 1PGJA 1T25A 4DR4B 1IZ8A 2QGFA 1F2UA 4N82A 1QGDA 1XWFA 3F90A 5AJVB 2OCKA 1MLDA 4ZOLA 1GNLA 2H0AA 3MILA 3Q3VA 3GCGA 5E6RB 2PX3A 4ME6A 3IH5A 4XX0B 3SR4A 3DDSA 4A36A 2QUKA 4UE3S 4LOJA 5C5DA 1O4VA 1UFKA 2R2GA 3AHCA 2H1IA 3AL0C 2HX1A 1XMSA 2F17A 3KE8A 3HKCA 4DZRA 5JCOA 1Y1PA 3M33A 5F7OA 1SAYA 1X3LA 3BMNB 3BL5A 4GZ6A 2F1KA 4BNTA 1T43A 3IWBB 1GG8A 2IYWA 1E61A 1O5IA 1EUCA 2P11A 3CPJB 4HXFB 2OB2A 3VZBA 2A92A 2OM6A 4PQFA 4WEOA 4X41A 5JUWA 4TN1A 1RRFA 3RAEC 3CSDA 4D97A 1L4UA 1RQLA 3PDJA 1GJRA 3TWOA 3ZZNA 2CN1A 2R6GA 4G5HA 3LHIA 4LW8A 5TMDA 1FDOA 2Q2WA 3MWKA 5IDYA 5E9QA 4OLJA 5BR1A 4BOYA 1PG5A 5F1PA 2HI0A 4B0PA 4B6JA 5JNUA 2NUAA 4HX9A 1GRRA 1LBQA 4AY6A 1XN4A 5K4AA 1J99A 1T1EA 1P1JA 4QBTA 1U6KA 4CKCB 3MRXA 2O3SA 4GNRA 4TV9F 3V1MA 2BFWA 1A2QA 2FVYA 2XOEA 2XTZA 2JJMA 4PLWA 4XASA 5IM4F 1MH1A 2RI6A 1XQXA 4K6KA 4MO9A 1E8MA 1TAGA 3IUQA 4WL0A 1NWCA 2PX4A 5IXJA 3B89A 3OM1A 2VG8A 2WIFA 4YAGA 3ETLA 2BHLA 1QTRA 1UK9A 2A9PA 3G17A 1DWQA 3JQRA 4N8SA 1W48A 3FZEA 2OD7A 4EPVA 4KXLA 4EYKA 3JY6A 5CHYA 5ALDA 3AVTA 2O06A 2B4AA 4ES6A 2W2LD 3W77A 1Z62A 4WLUA 5TARA 4CM9D 4DCPA 4NY1A 2C3UA 3H04A 5ICGA 3LVFO 1OH6A 2XA9A 3SHVA 4D5GA 3F2VA 2J0UA 4Z0HO 1Y8QA 3K20A 4YCBA 3U44B 3LU1A 4YQEA 2IZ6A 1NVEA 5JECA 1V4BA 1DAFA 4OGGA 2IWHA 2MSKA 1ZVJA 4XQCA 3IWCB 1Y8RA 3EFHA 3KEGA 1SC9A 1YQ9A 4DR2B 1S89A 3DMTC 4C7KA 1L0BA 2J30A 1XOIA 1SHLA 1JHVA 1ZJ4A 1KYZA 3VVLA 2YN2A 4EY3A 1WSAA 3FWZA 3U61B 1YHYA 3PHBE 4MYDA 4JJGA 3W04A 4XVUA 1W6RA 2W2OA 3R74A 4EH1A 5DVZA 5F2KA 1QK5A 3RVOA 3TJRA 4CL3A 7MHTA 2NG1A 1NXVA 4RQAA 4AQ7A 1K08A 1AZSC 3Q0EA 1HLDA 1UBHS 2ZB3A 3L0IB 3PHIA 3ZCTA 3FDJA 4DQDA 1NNSA 4EO4A 2ZUTA 2DSNA 1CE8B 2WFAA 3GHYA 4FMCB 1CSEE 1V37A 1GRCA 1SA0B 3UN1A 1E79A 3ILVA 4GNKA 1SK8A 3LH5A 3M5PA 1WU7A 3IB3A 4L4XA 4M2LA 4YAUA 2HZBA 3A1UA 4JJFA 4Q4HA 5EJ9A 2WHXA 3C8UA 2R1TB 1G21A 2E4VA 4DAEA 5DHQA 4CMIA 4P53A 1QZZA 4QBKA 3KKEA 1GCIA 4Z2YA 3QVTA 5BRNA 3WYBA 2QRKA 2DQZA 1JAXA 4GGMX 1GWNA 3X2FA 4EY6A 2R8EA 1E7YA 4EY5A 4B84A 3DE0X 4CQJA 5JMOA 1HT0A 1K5DA 1NP7A 1SZCA 3ZIDA 2AKYA 4NVRA 1KEKA 1DLIA 2NNWB 2QGNA 2VEOA 3E1SA 2VFAA 4Q39A 1G66A 4PZDA 4EW3A 1AKWA 2VKQA 5K8LA 2GPTA 3MBIA 2FMTA 4C2UA 4ND7A 3IPCA 1MORA 2AJTA 3ZU3A 5KOHA 1RPJA 1JW9B 2OBMA 2YJ6A 3IX7A 1ONPA 3DBLA 3JXEA 4OM7A 4D42A 2HLNA 2OESA 3L8HA 4XIJA 5KO2A 4FDLA 3MEQA 4H17A 4KJXA 1Z22A 3JPWA 4L0DA 4KDRA 1R8XA 4U9UA 4C4ZA 5IC5A 2VPXA 5I01A 5K0EA 1Q0TA 3OX1A 2BEWB 2GPSA 2GBPA 4MGYR 3ZDBA 1GZ7A 2B3DA 2BPOA 2QN7A 5EUQB 1FFAA 1Z2NX 5AXCA 3KTFA 1BCRB 5C8YF 2QT9A 4IF4A 5FBHA 4KOEC 2OK8A 2AH5A 1U3TA 2H3EA 4MW9A 4R0NA 1V9SA 3NRJA 1XQWA 3GZTB 3O3CA 2RK6A 2C8VA 4LYDA 1QSGA 1V11A 2X5OA 3DF9A 2WBLC 4YC7A 5DX0A 2O5CA 2I4OA 4LAFA 1NQVA 4ZIRA 2B7BA 2G80A 4FW9A 4RMNA 4KMRA 1ZIPA 5FCDA 5T8KC 1DT3A 1GQ2A 3KAJA 3WKAA 4KHPB 1CZRA 4IZHA 3IUJA 3R5HA 1MR3F 1NBAA 3T38A 1BU5A 1VCMA 4BP9A 3OZSA 4XW2A 1U9ZA 3L7LA 3K70C 1U7XA 5C0OE 4R8SA 2ZG6A 2K5UA 1ODKA 1PT5A 2EZTA 2UVQA 3C6ZA 4WFKA 1SVSA 3Q6IA 4RJIA 3LYAA 1J2TA 4QPZA 1W94A 1U0TA 5EPOA 1Y89A 4TXJA 4Z4QA 2CVZA 5HQ3B 4FSHA 4BL5A 2C77A 3KD2A 1DC7A 3IAAA 4XJTA 1W7AA 3QHAA 2CUTA 5BWBA 4E5YA 1P2BA 2QJWA 2Z5FA 8LDHA 3MGAA 5B2ZA 3UWKA 2ZEJA 2YOGA 1TO2E 3ZZUA 1E1RA 3TUJC 4YT8A 3GP3A 3WKBA 1TTPB 5LNK6 1OC4A 3OZCA 1GTG1 1KO1A 1FQJA 1YZFA 4QBHA 1CQJB 3TSAA 2NO9A 2BGUA 2I1WA 3V7YA 1KYWA 4ML3A 3PPVA 4K1XA 4YPFA 4R0MA 4HVTA 4XXHA 3RS4A 3H2YA 2WLTA 4U2DA 3NT5A 4KUEA 1VL0A 3UQZA 3B7WA 4NMXB 4F8JA 1THZA 3O93A 5ICCA 4WXMA 1IXKA 3EOAI 3I62A 4QYTA 4S05A 1TFUA 2J3HA 1CJMA 2PN1A 1G2IA 3DPIA 5DBEX 2A1UA 3UJAA 1WTAA 2GBIA 5BNTA 3NDJA 1IE3A 2ODPA 8AT1A 4CGZA 2XDQA 4F5WA 1LPPA 4INAA 3AEUA 3PIIA 3VGPA 4BGEA 2FNAA 3IAM6 1AK9A 4FN4A 1AIPA 1HDRA 1PHPA 2G5GX 3TG2A 4ZVQA 4H08A 2ZBRA 4DGSA 3O75A 4LI0A 1B8VA 1E2JA 5CH8A 2AZXA 1D2EA 1PNOA 4V1CB 1ULZA 5JVDB 5FTNA 1KYXA 1MZPA 3BERA 3UHOA 1JHRA 1HYBA 3P9PA 4BASA 1J4AA 3AF2A 3K4QA 3TL2A 4EJMA 2IHVA 2JEYA 4I8IA 1T1SA 2ZE8A 4L73A 3F2IA 3RK0A 1SVIA 3AKCA 3UJ3X 3E5RA 2V98A 2WAMA 5D1NA 3VSBA 4ZYUA 3KSZO 3TUZC 2A7XA 5I7AA 3U6KA 3X1WA 1ZXXA 1M74A 3AR2A 1U2ZA 3AEKA 3ZI0A 1TTQB 2OCAA 4MIKA 2B36A 3FCSB 4C7OB 1BFUA 4R7GA 6NULA 5CDSA 5AK5A 2VHQA 2QN8A 1B8PA 3W5HA 1T5BA 4OF4A 2C2OA 5B5SA 1NW5A 5E6UA 5JS7A 4EJSB 4H60A 4X63A 8ATCA 5JXJA 5HP4A 4O1MA 3GFPA 1QO9A 3LT1A 4Z6KA 4H7HA 5J4VA 5AW5A 3A32A 4MUAA 1YQEA 2L17A 3NVKI 4C0QC 2QR2A 3HDHA 5CK5A 4N47A 3UCFA 3PNMA 2J08A 3RT9A 3GRZA 4QYIB 2C1EA 2QSZA 2ARKA 5AM4A 1KZYC 4LXXA 1VIVA 2W0MA 4HF7A 2C3YA 3KSDO 2KS6A 3URMA 1EEXB 1YXMA 3GVHA 2KQUA 4MVJH 3WMWA 2C5EA 3KSAC 3IAFA 1MHMB 4JK3A 1TYZA 5JQGF 4B34A 5A0FA 2RBGA 5DW3A 1KI9A 2XOKA 2WA2A 3EQ6A 5HX7A 3ESQA 1IUPA 1PJZA 2LXNA 3H2HA 4EG8A 4GEGA 4L02A 2PS9A 2XZOA 5ADWA 2NVOA 2OR3A 2PZLA 3JQ8A 4QBFA 5DBOA 3WP0A 1L4LA 4LJYA 1JX6A 3EXAA 3KOYA 2QF7A 3L6CA 1HV8A 2JLZA 1N3IA 2FEAA 2JCYA 4RQUA 3SY8A 2C7OA 1PFVA 2YR0A 1QBGA 4BB5A 2QMEA 3U7HB 2FXIA 2RHLA 4U7HA 3UT5A 4QYMA 1GQYA 2C4VA 3ECAA 4ER7A 4HNGA 3TKLA 3OLXA 1MX9A 3T6KA 3I53A 3AY3A 1EVJA 2NW6A 3KOOA 4MQLA 1E3QA 2VF7A 3B9PA 3EOZA 4JLBA 1XCOA 5L4SA 3AFOA 4BIMA 4JN6B 2V9ZA 3V8BA 2O0JA 2B30A 2AI3A 2VF2A 2WKPA 5CLFA 2JFGA 5AI0A 4U00A 4GUDA 4M0PA 1QHGA 3VQTA 2NVBA 3L6BA 3H8WA 1UYJA 1T9GR 4DPKA 3DOJA 4V24A 4UM7A 5THQA 4CPDA 3AB3A 4EGCB 1ZR4A 5AVTA 2IF2A 5BVGB 1ZD5A 2EX4A 3OX3A 4FQ7A 5MN6A 5BMOA 3OKFA 1NG1A 4G01B 1I6WA 4C78A 2PSHA 5KPJA 3GLGA 3K6KA 2QSJA 4I08A 3MPUA 4IEFB 1EIWA 3WLKX 3PUJA 1WBBA 4Z2AA 3I2YX 2V5VA 5EE3A 3VJKA 3E3LA 4D43A 4IRUB 5EMMA 1I2MA 4W8GA 4OXXA 1COWD 4DDWA 1PWZA 1UJ6A 2MU1A 5CLHA 1ODIA 2OHXA 3NHBA 5HFAA 4ON9A 4HDNB 5IF9A 3T3PB 1I30A 2FLVA 2XE7A 2XTMA 4CYMA 1QXSA 3ONEA 3UC5A 2FW7A 3WTBA 3WLQA 1ADGA 4BE9A 4D79A 4OJKA 3R3SA 1MG0A 1F2UB 1G291 2H1WA 3CBGA 2CL0X 1JR2A 4ZOLB 2C04A 2KI5A 1Q7RA 3W5SA 2C4WA 1FQKA 4YLYA 2QZJA 3QE2A 4JJ4A 4P84A 3PZRA 4QX6A 1YK1A 1GQOA 3L1IA 2AOUA 4K40A 1YZVA 2IRWA 1QIJA 3PRHA 4AICA 1QRTA 3ITEA 1GCAA 3EXEA 4H1VA 2OV4A 2HNKA 4JYBA 4X91A 1ADBA 3LVRE 3HKCB 5BN3A 3KPVA 3RRMA 1DKMA 4UXHA 4AJHA 2D8MA 3U39A 3U4DA 1L5RA 4P1ZA 4IIVA 4PPYA 521PA 4UBJA 5EJ6A 4RZ3A 1EUCB 1UKVY 4G89A 2FQXA 5ESWA 1JYSA 2AG8A 3FFWA 1G5QA 1Z0JA 3X2SA 4XD7D 3VNBA 5HDBB 4MK4A 2XQIA 5C34B 3NX4A 2FQ1A 1T35A 4UPEA 4CI0B 1BXKA 4Z8YA 5FL7D 5A6SA 2I6GA 3VPCA 5KS2A 1KAEA 2CXXA 2VK4A 3T0FA 5DULA 3SZ3A 1VSBA 4HKTA 1ZMTA 4QELA 5BYKA 3DCNA 5JCZA 2PZGA 4EW1A 3QMMA 1XJQA 4NI5A 4YP5A 2VPZA 4J16C 4RKYA 2NUAB 5JE8A 1TC2A 1WQ3A 2VN8A 2XDYA 3F6EX 1QKJA 3C8DA 1H1LA 2B61A 4P5PA 1QYWA 3A9UA 1CRZA 4GYYA 5AK4A 2E82A 1R6DA 4FEYA 3VBEA 2NO6A 1P4SA 4C05A 5KWIA 1JQBA 3RREA 1L6IA 3AR8A 2W6NA 4LJ6A 4QL3A 1G4AE 4B73A 4IQ0A 1U80A 1KI8A 2EX0A 3EXG1 3HDTA 3HRKA 3ITNA 4IQ8A 4O4JA 5CRIA 3SK0A 4FK8A 4D46A 1CZKA 3P96A 4LUCA 1IULA 3RC7A 4D6PA 4MHSA 1VKHA 4RF5A 2R8RA 2OWEA 3T5MA 3L8DA 4KO8A 3HZOA 3TNJA 3NC4A 1KZ9A 1V5WA 3B5IA 5A71A 3RJ5A 3V2HA 1H3NA 1SRRA 3CN7A 3HYNA 4ROTA 3U6BA 1FVFA 1TZKA 2FGKA 2J0UB 1Y8QB 3CLKA 4BVEA 2H2DA 2EXXA 3TOXA 1KJJA 2Z83A 1Y8RB 1ABBA 1HR0B 1IY8A 1LLFA 3NANA 3OPNA 1T5HX 4MZXA 1K7CA 2VDVE 1O6FA 3EIXA 4KG7A 1MJ5A 2VZ0A 4BZXA 1B8UA 3H3FA 4YMGA 4JBXA 2C83A 2H0QA 2WJA