1YS4A

Structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
348
Chain Sequence
b'MKIKVGVLGATGSVGQRFVQLLADHPMFELTALAASERSAGKKYKDACYWFQDRDIPENIKDMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAVSGAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLNLPTYAKPIVIREEIDRPQPRLDRNEGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVKKYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title A New Branch in the Family: Structure of Aspartate-beta-semialdehyde Dehydrogenase from Methanococcus jannaschii
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Oxidoreductase
total genus 102
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2005-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ys4A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ys4A01
2A9FA 3PJEA 5DP1A 4FFNA 1BG6A 2X4GA 2YHIA 3QA9A 1T25A 2PV7A 3I52A 1HEUA 3EZLA 2RHRA 3JQEA 3AOEC 5AXCA 1WMAA 1A4UA 1O0SA 4XIYA 2O4CA 2C07A 4FOOA 3Q0EA 1B8PA 4BMVA 5U9CA 1H93A 1ENZA 2GGSA 3VPGA 3TOXA 5TQVA 1BRMA 1GZ4A 1PGOA 4PLVA 3LC2O 2HMTA 1C1DB 2FHSA 4J7UA 1R4NA 4RCVA 4ALKA 3LK7A 4OOFA 4YQYA 2PZJA 4MP8A 5A5FA 4R54A 4PRKA 3H7AA 1I0ZA 2Y1EA 4NQZA 2QYTA 4RLHA 3PHJA 3DONA 2IODA 2CNBA 3AFNA 1LRLA 4JNKA 4E5NA 1Z7EA 4ZQFA 3ROMA 2ZKLA 3I9JA 2BI7A 5IDWA 1ENPA 3GHYA 4YJFA 2B0JA 1KVTA 2BFOA 3C3XA 3G1UA 2VOJA 2JJYA 4QFCA 1BSVA 3ANNA 2HJRA 4OHUA 2ZB4A 4K26A 4YRAA 3DL2A 1GY8A 3OECA 1Q7CA 2O3JA 2ILTA 1GZ6A 4FW8A 4J49A 4WLEA 1KEWA 1ONOA 5L40A 4MVJE 1V35A 4PLTA 2PY6A 2FZEA 2G1UA 5KVCA 2GN4A 3WOHA 1T26A 4O0LA 4BO0A 4BGUA 1DB3A 4MVJF 4HNGA 3FNHA 4GSKA 4ND1A 5BR7A 4C7KA 3MJ4A 4A0SA 1S7CA 3OA0A 2DLDA 3L4BA 2YZ7A 4CMIA 3AUUA 1AHHA 5COAA 3AFMA 1LEHA 1YQGA 4FN4A 5KJEA 1FMCA 5JYAA 1HLPA 3DQPA 5CDTA 1E3WA 1EUCA 4DL9A 2NU8A 2HMSA 1UZMA 4B7XA 4E31A 2CSUA 3UW3A 1E5LA 4J1NA 4B8ZA 1ZCJA 2Y0EA 3LT2A 3LU1A 3ZW9A 9LDBA 1CDOA 3OETA 3VH4A 4TKLA 3DBVO 1IOLA 2C7VA 2ET6A 4TKMA 2A92A 3IJRA 4J0EA 1F14A 4HX5A 1H5QA 1EZ4A 1NFRA 3HDQA 5ENVA 2GD1O 3UKOA 1E6WA 1FDTA 3UN1A 2NM0A 3TWOA 3CMCO 3IJPA 5C3MA 3W6UA 4JBIA 2Q2WA 2WEKA 1NASA 2QYSA 2AQ8A 3ONFA 1ENOA 4IDAA 3A14A 4RVHA 3Q2KA 4ESOA 3N7UA 4P4GA 5JBIA 2OL4A 2WMDA 4JX8A 4E12A 5F1PA 4RV9A 4DGSA 4FFPA 4PLYA 2P9GA 5DCUA 2PGLA 3FR7A 4IINA 3WGQA 3UHAA 5IDQA 3D3WB 2X5JO 2OP1A 1AXGA 3FR8A 3GZ4A 1E5QA 2HKIA 3GQVA 3FPCA 4KUGA 1HKUA 2XPCA 3TRIA 2O3TA 3BMOA 2CVQA 2DU8A 3PWSA 4AJOA 4DC1A 3WIEA 1GV1A 4BL5A 2PWZA 4PZEA 3QWFA 5KVVA 5DOZA 4CMKA 5H81A 4KQXA 1VLLA 3ZNPA 2HMWA 3PRJA 3BXXA 2VQ3A 2H9IA 3NV9A 4N54A 4J2OA 4YB8A 1HETA 3E82A 1RKXA 1B7GO 4LISA 4CV1A 1BW9A 1GQ2A 5L4SA 3PYMA 2DFDA 2ZYGA 1NQOA 3JQFC 3VZPA 4P4NA 4W82A 1DO8A 2OXIA 4ZJUA 5K6AA 3IUPA 3E9MA 4Z9XA 5IXSA 3LQFA 3Q11A 1PJBA 1I36A 3U4IA 4TQGA 4WCDA 3Q2IA 4QFDA 5L7TA 2Q22A 3NYWA 1LSSA 2R2GA 4IMPA 3DTYA 4XB1A 2CVZA 2PFGA 2ZIZA 1H2BA 5DOVA 1TT5B 4BNHA 3HQ4O 3WSVA 1MX3A 1B0AA 1LC0A 3I4CA 3RWBA 4YRDA 4XQ9A 3RI3A 2BGMA 2Q4BA 4DIFA 4MIEA 1LRJA 2SCUA 1A9YA 4HFNA 4E0BA 3AUSA 1YS4A 4XA8A 3ZI0A 3NDRA 2FR1A 2UV8A 1FDVA 3SX2A 1NVTA 3WSWA 3CMMA 2VZ8A 2IE0A 1B3BA 1J5PA 2J3JA 3GNTA 4ALMA 5CDUA 4RO0A 1PZHA 4ZQHA 3JQ6A 2EV9A 4EBFA 2ZYAA 4ZVVA 4CR7A 1IPEA 4NZ9A 4B3HA 5I7SA 5C7LO 4E33A 5I9NA 3WGOA 4CR6A 1EBUA 4NH4A 1CEQA 5BNFA 5ADHA 2VWPA 3JTMA 3VC7A 5L7WA 3TZQA 4HWKA 5EINA 1D3AA 4IQGA 1KEVA 1OC4A 3MJEA 4R41A 4D0RA 3BYZA 4QSMA 1WPQA 5B4VA 1RJWA 4NK4A 4DA9A 3JD3A 3I9LA 4L76A 2NU7A 4ZGWA 4PLCA 4WNIA 3AI1A 3E03A 1SC6A 1UXGA 3EC7A 3NUGA 3ZV3A 4JBHA 3MTJA 1XSEA 1HE5A 4DLAA 4E2YA 3NTOA 4MIOA 3MEQA 1DIRA 2JHFA 5COBA 3S2IA 1D8AA 3G1TA 2NU9A 1Q7BA 5L7YA 1YBMA 3O8QB 4GH5A 5L3ZA 3UICA 4F45A 4JJGA 5DNAA 2PK3A 4OKIA 5ENDA 3ONEA 4QO7A 3RCBA 4XYEA 2GO1A 3TL3A 3ROQA 3K2EA 4BO1A 2GASA 1L7DA 1U3UA 1NVGA 1PQWA 1ARZA 4XWYA 1NQAO 2HRZA 1GPJA 1U8FO 1LXCA 1XLTA 3DZGA 4CM9A 3D3EA 5HM8A 1KY4A 1DXYA 1PJLA 2C2XA 3PGJA 3WS7A 1X7GA 3FPLA 4OAQA 3TN7A 2O3UA 2ZJ0A 1N5DA 3RUHA 4UVIA 4NBVA 1RM0A 4GGOA 1E3JA 3PQFA 5C5IA 1ONNA 1H9BA 1VKNA 5TF4A 3FHLA 1DAOA 2HSDA 3AM4A 1VJTA 3QQPA 4G2NA 4XYLA 4CLOB 5B1YA 1R4MB 2Q2VA 3T7EA 2C7GA 3I3OA 1AHIA 4JLWA 2RAFA 4D79A 2NU6A 3KSZO 4XGIA 3W1VA 4DUPA 2B35A 4NFYA 3CPSA 3OQ6A 2DBZA 5JYDA 1GCOA 1OBFO 2GYYA 5J23A 2ZATA 1NR7A 2EERA 3WFJA 4EUFA 5L9AA 5HWSA 1EUZA 5B37A 3L77A 1YO6A 3A4VA 3D3WA 2X5OA 4N18A 2FZWA 4FFOA 3WBFA 3JQAB 4PLGA 3VDQA 2O3QA 4H16A 4K6CA 4DQXA 1LDNA 3DO5A 2YV3A 1D7OA 1ZSYA 3GY0A 2P9EA 1LBEA 3GN1A 3QWBA 2NVUB 1UDBA 2WD7B 3VZQA 4BO3A 3PGXA 4GAEA 1F0YA 3JD1A 4WUVA 1PJSA 4XDZA 1MG5A 2Y0DA 3PJDA 4DMMA 6LDHA 2NQ8A 5GY7A 4WGGA 1N1EA 3H9EO 4MOWA 1IZ9A 4WOJA 3DXFA 1ZIDA 1B26A 1P1FA 3KBOA 3H5NA 5CAEA 2DTXA 2JCYA 1T24A 4MVJD 2D8AA 3PFFA 3B20A 2I5PO 1U7TA 4BGVA 3VZSA 1TT5A 1LQUA 2AQHA 4QECA 3PJGA 3W4IA 3HDYA 5KTKA 4FR5A 5FEUA 1P31A 3NT2A 3ROPA 1SEPA 2WYVA 5FWNA 3WNVA 4MVJP 1Z45A 1HZZA 1U2DA 1U7HA 1MV8A 3JQ9C 1I33A 4L73A 4HADA 1BDBA 1R0KA 3RIHA 4DYVA 3IQDB 4OO3A 4L4XA 5L53A 2CF5A 3LLVA 1ZSNA 4IMRA 5TT1A 3WQSB 4BO2A 3S2GA 1C0KA 2NTVA 3T4EA 5KJCA 5IG2A 4W6ZA 4U6SA 5EJ2A 3AJRA 2AE2A 5L4NA 2NVWA 3DBHB 1U4SA 2OBNA 3U09A 4K1LA 4RDHA 1XGKA 1F12A 3X2EA 1B8VA 3IMFA 1T2AA 1M6HA 3FF4A 4BKUA 3I1JA 1SZJG 3S2EA 3DZIA 3R3JA 2JD0A 2Q46A 2W98A 3BA1A 4RDIA 1BVUA 2PNFA 2IEBA 2V6GA 4EGFA 1PGJA 2UAGA 4HXYA 5BSGA 1T2EA 2EW2A 3E8XA 2GDZA 3HN7A 4JP2A 2PKQO 5HTOA 1RM3A 2X23A 4NFHA 4CQMB 2PH3A 1ISGA 3ENKA 1KOLA 1Q7GA 1DLIA 3O8QA 5EQFA 3OJLA 3U5TA 2Y68A 1YDEA 3DZKA 3KLMX 3JQGB 2V6FA 5TX7A 2WSBA 4GWKA 3WIDA 4AL4A 4DPKA 1SB9A 4NNJA 2IXAA 2R6JA 3K6JA 4IQ0A 4ZA2A 2B83A 4K6FA 3WB9A 4Z9FA 4OQZA 1ZFNA 1DRVA 2DBRA 3JYOA 4AG3A 4J3FA 4BNGA 1M67A 3QVSA 4Z0PA 3E6AA 3WGYA 2G17A 4ZRMA 5THQA 4YAKA 3WTCA 3PYLA 1NWCA 4E5YA 2IXBA 4PG6A 1AE1A 5A03A 5GZ3A 2NTNA 3DOJA 4R1TA 3S8MA 1HF3A 1NAHA 4TRRA 2HK9A 4XX0A 2CDBA 2VNAA 3EK2A 3OBBA 1P1KA 1CETA 4CLOA 1R4MA 3ZWAA 5AYVA 1K6JA 2YUTA 4XZ3A 3WGZA 3VDRA 4Z6KA 1UP6A 1WZEA 2DQ4A 5IZ4A 1PGQA 5CPBA 1O94A 3BTUA 1Y5RA 1PQUA 4O6VA 3HWRA 4FIZA 1ENYA 3KM0A 1UR5A 4MVJH 4EW6A 2Q3EA 4E2WA 3Q6IA 3DZBA 4CLRB 2PKRA 3QVOA 4BMNA 1YE3A 4RVFA 4ZU3A 3VH1A 3ZHXA 2R00C 3K8ZA 3PHGA 3CZMA 2RH8A 3ZZNA 4IDBA 4I08A 2AG5A 4CMGA 3JQAA 1GFSA 4WLFA 4CL3A 4B79A 5G0UA 2DBQA 3OEWA 1GADO 4WEOA 2Y1CA 5M6DA 4D41A 2X9GA 2AW5A 3N74A 4IY1A 4DWVA 4ZQEA 3SVTA 1WWKA 2NVUA 2WD7A 3PVZA 3VOSA 2PD4A 2IZ1A 1A7KA 3KTDA 4BV9A 3D5TA 5EIOA 4HY3A 1TT7A 4LVUA 5BQFA 1HDOA 4WE3A 3BMCB 3B70A 4UUNA 3WYEA 2OZPA 3B1KA 3F5SA 3ZV5A 3QV1A 1QLJA 1Y6JA 2YQ5A 2OBYA 1JKFA 2UVDA 5FF9A 3BTVA 5F21A 2P4HX 4GKBA 1QMGA 2UYYA 3EDMA 2BRUA 1HT0A 1UZLA 3OJOA 5JAZA 3IL2A 1D1TA 3LF1A 4QEDA 4YA6A 1I2ZA 5TGDA 1V0JA 4QT0A 3RAJA 1B2LA 4UVGA 1ZJZA 2AHRA 3GN2A 2P9CA 4WASA 4ZQGA 1LDMA 1KY5A 2PZKA 1F8GA 4L9RA 1QYDA 1ZK2A 3RU9A 2ZB3A 3AU8A 4EJ6A 3PJFA 1QR6A 4GLOA 4FJ2A 3FRJA 3UAGA 4GSLA 2XAAA 3KYCB 4BUCA 2DC1A 2VUUA 4E13A 3WGIA 1DIAA 2BELA 1PS9A 4YAIA 3ADOA 1N1GA 5IN5A 2EGGA 2Q1WA 5K0ZA 3A1NA 3ZV6A 2HLPA 3DBHA 4GX2A 3GFBA 2H5LA 2D59A 3K2BA 2VOEA 3LYLA 1Z75A 4BNTA 1E3SA 1W8DA 4EUHA 4RPJA 4IUYA 4Y6SA 5TJ9A 3VVCA 4A73A 1XKQA 1ORRA 3TPCA 1WLYA 3VPSA 4CUKA 4CM4B 4PGFA 4PVCA 1TLTA 4M55A 4A03A 2G0TA 1T2CA 4EZBA 4RQTA 1P33A 4H7PA 4CQMA 3EY4A 3OICA 3IUSA 1E7SA 1NBOA 1O9BA 4TSKA 4URFA 3PYXA 1CF2O 2Y99A 1YH3A 3JQGA 1P0CA 5T8KA 2BKAA 1V8BA 2TMGA 1ZJYA 3WWYA 4CM8B 1YBVA 3ZU3A 4CV0A 1PJ4A 3E5RA 1Q0HA 4ROSA 1E7MA 3S1LA 4KMSA 1SPXA 1IHYA 1OFGA 1KEPA 1T1RA 3QIVA 6ADHA 5G0TA 1BMDA 3QRWA 3KETA 4YXFA 4XRGA 3EVTA 3RFVA 1P9LA 3K31A 2POQX 3JYNA 4FSHA 1TEHA 5TNXA 2J3IA 2Y66A 5U1PA 3U4CA 1EUDA 1GYRA 3M1AA 4U7WA 4BO4A 4DTIA 2C20A 2VYVA 1PZEA 4LCEA 1NWHA 3O4RA 1CIVA 2OFPA 1H6CA 4BNIA 4W7IA 1DOHA 1I01A 4BO6A 1OI7A 4II2A 5AQ1A 3BAZA 4CMEA 1CJCA 4A7PA 1R37A 3BTSA 1GCUA 5GZ1A 4BNLA 2F1KA 2C5AA 1PS0A 5KJ6A 1YQXA 4DQUA 1LSJA 1Q0LA 3D4PA 1R0SA 3U4HA 3P2OA 4RVSA 5IZCC 1JAXA 3D64A 4U8GA 4CLRA 3GDOA 4W9NC 2FP4A 3WICA 3RFTA 2FRDA 1MG0A 3STHA 1M76A 3T7CA 2HCTA 5I8WA 2PGDA 3WQQA 3PZBA 3ZHBA 3FD8A 1YBAA 4ID9A 3CXRA 2YDXA 2X58A 4EYEA 2CFCA 4WOKA 4Q9NA 4ND3A 1NXQA 2B5VA 1K3TA 2CDCA 1CYDA 3BMNB 3FNGA 4PZDA 2GZ3A 1PJQA 3OEYA 3PQDA 4IIUA 5ILGA 3RUAA 3UGKA 1IL0A 3WWZA 2CF6A 1GYQA 1HLDA 4DBZA 1E7WA 2JL1A 4RF3A 2WM3A 1PU2A 4HKTA 3H5RA 3BMCA 1O8CA 3QVXA 3LT4A 1Z6ZA 2QZZA 2VRCA 5A9SB 3V8BA 3QHAA 4JCOA 4ND2A 2Y1OA 1BXKA 1GDHA 3U9LA 2ZCUA 4DQVA 4AJNA 3WLFA 2Q1SA 4FGSA 2NVBA 5HS4A 4GKVA 4MVJG 4J1SA 2YW9A 4MKRA 3PWZA 3I83A 2GR9A 2EGHA 4IGEA 4YT8A 3Q3CA 4D7AA 3H4VA 4OMUA 1DC4A 3JD2A 3P19A 4I1IA 3H8VA 1HZJA 5C7IO 2Y0CA 4CR8A 2VTEA 2VCYA 4IDFA 1RM4A 4YCAA 1ML3A 4EJ0A 4MVJI 1XDWA 2X0NA 2JFFA 5KKAA 4D44A 4D43A 1HE4A 2C82A 3FTPA 5JY6A 1YKFA 2X22A 3IP1A 2IYPA 3F1LA 2EJWA 3KYCA 1GD1O 2ZK7A 2AMFA 4DBVO 2YQ4A 2ZQYA 1LA2A 3WX0A 1EBFA 4YT2A 3ZWCA 2EG9A 3L0DA 4IZIA 2EP7A 1H0KA 5DN9A 4J43A 1U3TA 1QYWA 5G0SA 4ALNA 5JC8A 4JGBA 1E3EA 3IC5A 1DHRA 3B1JA 1I5RA 1LQTA 2WYUA 2Y05A 4EI2A 5A05A 2EP5A 1EVJA 5KVQA 2AEJA 4UUOA 3H9GA 4M1QA 4BNJA 1PQPA 2O2YA 3ANMA 1YWGO 4CM4A 4G65A 3PQEA 3HN2A 4JN6B 4HV4A 2P68A 1PJ2A 2F00A 3SC4A 4EUEA 4AJEA 1NPYA 1NR1A 5L95A 3I9KA 5B4UA 4MKZA 2CDAA 2OOSA 3NTRA 1I3KA 4J0FA 1ISHA 1T4BA 1XG5A 3ZNOA 5LCXA 4Y9DA 1WDLA 3F9IA 4LW8A 4NFSA 4CM8A 2I65A 2Q50A 3WQRA 4ITUA 3RASA 1H2HA 1AN9A 1KBZA 3WDSA 1G0NA 1DIBA 5JDIC 5KJFA 4ND4A 4XEHA 4S3MA 4D42A 4YT4A 4M86A 4NDNE 3RKUA 3KYDB 3CZRA 5JDCA 4PN3A 1LLQA 5GZ6A 4E2XA 1EFKA 5KWEA 2QRKA 2WDZA 3AK4A 3OP4A 1N9GB 2I76A 5CEFA 4HUJA 4MDHA 4RF4A 4BNYA 2BFPA 2O48X 4CMJA 3KLPX 2YHUA 1GU7A 1K2WA 4MPDA 2BGLA 2D5CA 5LDHA 1NPTO 4OIMA 4MJLA 3E5MA 4MIYA 5F5LA 1DHTA 2VTDA 3L6EA 3JQDA 1HTBA 1JWAB 5T64A 5EL0A 3SXPA 1RYEA 3ZWBA 2GUGA 2O50A 4AFNA 1VC2A 1M75A 1R66A 1ZSVA 3R6DA 4M89A 3L4SO 4WCFC 2X0IA 3FBTA 1NVMB 2NV6A 2AG8A 2W2LA 3GVPA 4N5NA 3U0BA 3WBBA 4Z9YA 4BNXA 4CPDA 4NMHA 5KCZA 2FPIA 1OZAA 3Q9UA 2X1HA 4YAGA 2FOIA 3B6ZA 4XGKA 1NX6A 3W4JA 4LCJA 3RVDA 1YOVB 3DBLB 3F3SA 4FFLA 3I6QA 3FN4A 2ZQZA 3OQ1A 3I4FA 1X15A 4B7CA 3M2PA 3ZHYA 2PLAA 4J4TA 1DFHA 4GWGA 1I3NA 3GUCA 3BMNA 3H2ZA 2WTBA 3ENNA 3DHNA 3GAFA 3PZRA 4IGFA 1F06A 1C1DA 3C7CB 3GVCA 5FFFA 1Z7BA 1HSZA 2E82A 2QRJA 2XXJA 1Y8RB 4EJMA 2VT3A 1EDZA 3I6IA 2VT2A 4QO8A 4YVFA 4TRMA 3VPXA 1G0OA 3PHLA 5A9SA 5TSDA 1MFZA 2DPGA 4LK3A 4TZKA 3LVFO 1VJ0A 4KDEA 4L8VA 1E1NA 1G1AA 3GA0A 4GVLA 3IOYA 1YJ8A 4LMPA 5JLAA 5DDIP 4BKRA 3JYQA 4ZQBA 4CL8A 4QX6A 4CLEA 4NR0A 2ZJ1A 3ZNNA 5A06A 2PD3A 5JYEA 1YJQA 3DR3A 2ZTLA 5F1KA 5CEEA 3LC7O 3ZWNA 3P7MA 4I5DA 3JQ8B 4JK3A 3C8MA 1Q0QA 3WJ7A 4ILKA 3DMTA 3BIOA 3WMXA 1RPNA 1BVRA 4B3IA 1PX0A 1L7EA 1C0LA 1SCUA 4XIJA 2ZB8A 1PS8A 5COQA 4BNKA 1GQQA 5JCJA 4DPMA 3D4NA 3A06A 3H6KA 3KO8A 1YB4A 1PR9A 4J16A 3CEAA 5DF1A 3VPFA 1MB4A 2DBVO 4CM7A 1KVSA 3FWNA 3O9ZA 2ZTUA 1DC3A 5JY1A 2WWRA 3WYBA 1IUKA 4L74A 1DBVO 3IP3A 3W8FA 2GPTA 5G4KB 1LU9A 5DCWA 3HB4X 4J90A 4OQYA 2I9PA 4HBGA 4BVAA 1SNYA 3O26A 3E9QA 2QRLA 4LSMA 3A9WA 3C7AA 2Q4EA 5BNTA 5JC1A 1TXGA 3QVWA 3GAZA 4B7UA 1GTMA 3JQ7B 2EHDA 1EFLA 1MXFA 1GQYA 1N7GA 3I5MA 3QW2A 4BGEA 4PFJA 5AVOA 3UUWA 1M6WA 1IZ0A 2J5KA 3L4BC 3AM3A 4M8SA 4Q39A 2HUNA 2IZZA 5HRUA 1SO8A 3DHYA 4XJSA 4R1NA 4QQRA 1NNUA 5ER9A 1DC6A 2HAEA 8LDHA 5I7FA 4UUPA 1VKOA 1ZK1A 1ZNQO 5DCYA 3KYDA 2GZ2A 3MJSA 4Z3KA 3IDSA 3P5SA 3UXYA 4IS3A 5JE8A 3UF0A 3LSYA 2X6TA 2DM6A 2C2YA 3HUDA 4JBGA 1M66A 2X5KO 2Y67A 1N9GA 1K5HA 3KEOA 3RC7A 2P2SA 4C7JA 4XB2A 3TF5A 2V65A 4E5MA 2NWQA 1OMOA 5B4TA 1E1LA 1FDSA 5C7OO 1ONPA 3DWFA 4IJVA 3RC9A 1W73A 3ROKA 1LX6A 3RUEA 3OJEA 4K9DA 5ITVA 1GUYA 3TZKA 2W8ZA 3L6DA 1E6UA 2YJZA 3PLRA 1U1IA 3F5QA 2O7QA 5A3VA 3BMQB 1H6AA 1Y5MA 2VUSA 3AI3A 4RF5A 1HDXA 1LDBA 3MZ0A 5CDSA 4R1SA 1ZO8A 3VVBA 2H63A 2DUWA 4L75A 3GH3A 5ES3A 1LDGA 2E6UX 4R3NA 4M49A 2HDHA 3OIGA 4PG8A 5IN4A 4AJJA 3NJ4A 4NK5A 4BKQA 2NQTA 3H2SA 3K92A 2Q49A 1V3UA 1YOVA 3DBLA 5DBFA 4F6CA 4PG4A 1X1EA 2CD9A 4IPTA 1NAIA 1U3WA 2Y93A 1GUZA 1XU9A 5CG1A 3GPIA 3WYCA 3NRCA 3CE6A 3W4KA 3EMKA 4AJ2A 2UUOA 2QG4A 1PGNA 4PCVA 4BHTA 1H6DA 1UXKA 3UCEA 3JD4A 5K6AC 1E3LA 1Y8RA 2H6EA 3PK0A 1NM5A 4WECA 4RZIA 3K9QO 4GLLA 4CM3A 3V2UA 1FK8A 1SAYA 1W0CA 1XR3A 4AJKA 1DRWA 2EWMA 4DLLA 3ZNQA 1NQ5A 2VWQA 3KEQA 4AJ1A 3L6OO 4CODB 3RUIA 1R12A 2HJSA 4DIOA 1U28A 1NFQA 2A4KA 2J3HA 1KVRA 1E6EA 4GI2A 3OM9A 5AXAA 1E1MA 4IXTA 5AXDA 2VRBA 4FJ0A 1I2BA 5AOVA 2W90A 4R4JA 1HSOA 3SEFA 4O63O 1A72A 4FJ1A 4P22A 4MO2A 2VWGA 4DMLA 1IHXA 2NACA 3DZJA 2AQIA 2PH5A 3ONDA 3VAZA 2BFAA 3MCVA 5FI5A 4C4OA 3KSDO 4AJHA 1H94A 1TVEA 2BLLA 4CM9D 1EK6A 1I32A 1EQ2A 2VYND 3KYBA 1P1RA 4ZN6A 4I5FA 3TZCA 4AVYA 4H3VA 2QX7A 4OL9A 4YBZA 3PP8A 1LSOA 3LZ6A 2QQ5A 1A27A 3ZWMA 1V3TA 1E0DA 4XCVA 3WGGA 4CM1A 3WXBA 1X7HA 3K30A 3C1OA 3ZWYA 5G4KA 2HU2A 3V2GA 4D3SA 4DYDA 1XYGA 3AI2A 4J9VA 5I7EA 3S2FA 5JNLA 2W4QA 3G3EA 5DT9A 1T2FA 4HFJA 4AJIA 4IDCA 2J8ZA 5ITWA 4IDGA 9LDTA 1KIFA 3F47A 3E1KA 1SMKA 1T1SA 3JQ7A 2RHCA 2X9NA 2QW8A 1U9JA 1ZUD1 4I9HA 4R51A 1DFGA 4B4WA 5TC4A 1EQUA 2X0RA 2IZ0A 3C7DB 4WLVA 1MP0A 3RBZA 4RORA 1J4AA 1Y81A 3AOEA 2FSSA 4NBTA 4BQPA 3COSA 4E6PA 3DB2A 4U0JA 1QV7A 1TA4A 1JA9A 3VZRA 3SBOA 1YDWA 5MDHA 5EESA 2O3RA 3PHIA 2TMDA 1XQ1A 1UJMA 3LT1A 3INRA 1Z82A 3ST7A 1JAYA 2XOXA 4LGVA 3OIDA 1HWYA 2FR8A 3JV7A 1UUFA 4DC0A 4R9RA 3AM5A 1QLHA 4GL4A 1LSUA 4FGWA 1UXHA 4RVUA 3QP9A 1GEGA 2BGKA 1FDWA 1NHWA 2X0JA 4PZCA 4U0KA 3SLGA 5JSFA 5T5QA 3ZU4A 1GPDG 4RPGA 4CUJA 3D1LA 3NGXA 3ABIA 3TL2A 1HL3A 5EPOA 1VM6A 1BWSA 3LDHA 4OXNA 4ONEA 2PA3A 1BXZA 5A04A 3BMQA 1PJCA 1QKIA 1VE9A 2YY7A 3HNPA 3HSKA 4I5GA 3ZV4A 3R1IA 3EZYA 1JTVA 3ZWPA 4I9UA 1YONA 1HDGO 3PIDA 3FBGA 4TZTA 1P77A 2JCVA 3INTA 4NPCA 1E3IA 4RVDA 4YRBA 2GNAA 3D7LA 3ZU2A 4FB5A 4LMRA 4TRJA 2E37A 3GZNB 1BTOA 3H9JA 3GMSA 2V6BA 3MWEB 4A26A 3GUYA 2FR0A 2GN6A 4Q3BA 4Z3DA 1PL6A 2C5EA 4RLSA 5BT9A 2D2IA 4Y6RA 3NJ8A 4XYMA 1T4DA 4GMFA 2E49A 3KXDA 3V1TC 5F3RA 4XKJA 3HG7A 1R15A 2EF1A 4CV2A 4MVJM 4BB5A 1YQDA 4KUHA 1EK5A 1LLDA 3C24A 1I8TA 2P4QA 3CTMA 3IS3A 1BHSA 2DTDA 4FCCA 4R16A 1KEUA 3I9MA 3TZ6A 4I8XA 1Y7TA 2P91A 4Y67A 1JKIA 2I66A 1A9ZA 1MLDA 2OHXA 4D0SA 5IFLA 1FF9A 4W99A 4KP7A 4P38A 7MDHA 4DPLA 4YJHB 1QRRA 5BSFA 3QE3A 1K6XA 3JCZA 1QYVA 4B4UA 1DSSG 4I5EA 2EJVA 5KIAA 2O4UX 5CDYA 4Z0HO 1U2GA 1C1XB 4BB6A 1DIGA 5BSEA 1X14A 3RUFA 3EVNA 1Y9AA 3GK3A 4BV8A 2I67A 3DTTA 1ADGA 5IXYA 1LTHR 4JJFA 1Q2XA 2BH9A 2B4RO 2XF8A 2QIOA 1YL7A 7ADHA 1PWXA 1QYCA 2QHXA 1GR0A 5CHEA 1FXSA 3G79A 5G0VA 1EMDA 2DUUA 1F8FA 3GVHA 3GOHA 5J9GA 3GGOA 1F17A 4RPKA 3AOGA 3GEGA 3QVTA 1GZ3A 1PR3A 1JVSA 4B4VA 3RC2A 4J1TA 3JQFA 4TVBA 4O1MA 4LN1A 3QSGA 2HMVA 4MINA 1X0VA 2B37A 1VSVA 3EGOA 5H82A 4P4LA 1E92A 5HBRA 3QWHA 3RJ5A 2WE7A 3JYLA 4CQLB 2VHZA 1W6UA 4CUZA 4INAA 1PSDA 3RJ9A 4BNUA 2FY8A 1K0UA 3CINA 4F6LA 3RSHA 1TI7A 3NDJA 1ZKMA 3UCFA 3S55A 1VL8A 4GMGA 4BNNA 3SC6A 3LT0A 3NX4A 1W4ZA 1I3LA 1PJTA 2P5UA 1ULSA 3PI7A 3ZGYA 2EKLA 1E7RA 3CSDA 5A9RA 5JMWA 2OUIA 4DXHA 3ZH2A 3D4OA 1NPDA 3MJTA 3OA2A 1PJ3A 2E48A 3ETEA 3GEDA 3EUWA 4R1UA 4M54A 4II3A 3D0OA 4XRRA 2X9VA 5JAQA 2DPHA 4UULA 4IM7A 3QWIA 1IB6A 3GDFA 4HFMA 3GDGA 4R9SA 2VHWA 5A4DA 1JWBB 4DIBA 2QZ9A 1SEVA 4QXMA 1WW8A 2HQ1A 2DKNA 3SJ7A 2Z1MA 4LRSB 4EEXA 1I24A 3IKTA 3AY6A 2HRBA 3L07A 3KSUA 4FS3A 3FNEA 4BIIA 1KERA 3PHHA 5AXBA 2J5QA 4NG5A 2OGUA 4CLDA 3JD0A 2YDYA 1KC1A 1O89A 2Q2QA 2HO5A 4FD3A 4JQCA 2V7PA 3JQBA 4J9UE 3L9XA 4R68A 2O23A 3OJFA 3G17A 3NT4A 1EE2A 1HYEA 2FWMX 3GZNA 3GRPA 3HJAA 5JO0A 1P3DA 4N5MA 3UVEA 1XA0A 5CP8A 1V3VA 1HDRA 2NNLD 2PTGA 2P5YA 8ADHA 3OFSA 3RBXA 1ZK4A 2Z1NA 5ER6A 2OO5A 1DAPA 3CIFA 2BD0A 1EVYA 3Q1LA 5G2OA 4E32A 2YYYA 1OOEA 3BHIA 4YJGB 4RJTA 3HFGA 4UVDA 1GUFA 1A5ZA 4KOAA 1QG6A 2EKQA 1MA0A 2W2KB 1DLJA 4FQ8A 4ALJA 4YQZA 3TQHA 5JFOA 5DULA 3AY3A 2C0CA 5T57A 5KOIA 2ZTMA 1QYXA 4EITA 5EMHA 2VHXA 4YJHA 5GMOA 1YVEI 1ISFA 1R6DA 1BGVA 3KVOA 4WLNA 3EAGA 5THKA 1CWUA 3DHEA 3GVIA 3OSUA 3ON5A 4RL6A 4CQMD 3TJRA 4BGIA 3C1AA 4RPHA 1KVUA 1LLCA 3G49A 3U62A 1BDMA 1C1XA 4BNVA 2C54A 1QXSA 1HE2A 3PWKA 1C3VA 4RQUA 1ZEJA 3GGGA 1LDYA 1RYDA 1I2CA 3IIEA 4J2HA 2V6MA 3W6ZA 4CMAA 1P1HA 1IULA 3DFUA 1GEEA 2BMAA 1HYGA 3ASUA 3KB6A 3OH8A 2GF2A 1DJNA 3ICPA 3ZU5A 2YV1A 3VHRA 4AJPA 4FC7A 3RU7A 1UAYA 1EDOA 3BHMA 5LC1A 2EKPA 3OF2A 2WE8A 1CQJA 1UZNA 3P2YA 1VL0A 3WTBA 2PGJA 2BFMA 4FBGA 1A4IA 2VYVD 1CRWG 1YL6A 3AUAA 4MKXA 3UOGA 1U3VA 1E7QA 5DP2A 4DREA 1ADBA 3SJUA 1VSUA 4RPLA 5FYDA 4BNWA 3RUDA 3GVXA 1JN0A 1MC4A 3F6YA 4XQGA 4U5QA 4YAJA 4MP6A 4UVEA 2OORA 4F46A 1SOWA 1WDKA 4CQLA 3ZCXA 3ANLA 1MGOA 2DFVA 1VI2A 3U49A 5T8KC 3JYPA 4Q3EA 4IJKA 3BTOA 1MC5A 4TWRA 4YJDA 1I10A 3ORFA 1HYHA 4Q3NA 3UH1A 4WLUA 1WMBA 1XIVA 3TSCA 3RROA 4Y98A 3VPHA 3DMYA 4XYBA 4R3WA 3JQ9A 4A2CA 3GHHA 2Y1DA 4NJOA 3DAFA 1K89A 1X13A 3GFGA 1B15A 4GX5A 4BQRA 3MTGA 4OGWA 2Y1GA 3ITKA 4JXKA 1IPFA 2Z95A 4HFRA 4PLPA 1C14A 4W7HA 2DT5A 4IIVA 3BHJA 4PVDA 5KNLA 3VH2A 3OJ0A 3ICCA 1Y1PA 1B14A 1ID1A 3GG2A 1ZEMA 3E48A 5T73A 1IYZA 4GPD1 3IAHA 1U4OA 2PD6A 2Q1UA 4WPGA 4CMEC 2GLXA 3RD5A 4AICA 2VRCD 2G76A 4MVJA 5IAAA 3HADA 5HS6A 2DVMA 1B3RA 3KV3O 1S6YA 1CQIA 3B1FA 5JXWA 4NBUA 4RZHA 2GSDA 4TVOA 2ZB7A 1EVIA 1EEHA 2VZ9A 4ZRNA 3PDJA 4XGNA 4CJXA 4D3DA 4PLHA 4UEOA 1BXGB 1O6ZA 1HDZA 4NIMA 1IY8A 4DRYA 3LF2A 3NDIA 5EERA 4UEJA 4BO5A 2PZMA 1O5IA 1QORA 1U5AA 2NADA 1B8UA 3HDHA 4D46A 2BI8A 3DBRB 3QLJA 5JAIA 1Z73A 3GPDG 4OKNA 1PWZA 1JDJA 3PFWO 2AEMA 1I3MA 4LVCA 5ICMA 4E30A 2J6IA 1M2WA 4CMCA 1WNTA 4YPOA 1JKJA 3PIIA 4IBOA 2VWHA 5F1OA 1WDMA 3GNQA 3DOOA 2B5WA 2GZ1A 4PLWA 5TIIA 2Q1TA 1EVZA 1QV6A 1MUUA 5TT0A 4HNHA 3ZWVA 4W4TA 4XDYA 1PZFA 4U6QA 3GNSA 4YJGA 5A3JA 1J0XO 1KC3A 2JD2A 4WK6A 4M87A 1LRKA 1Y8QB 2W2KA 3K73O 4NJMB 4S1VA 1JW9B 4WLOA 2AE1A 3CH6A 1DDOA 2GRAA 1EE9A 1R0LA 4D3FA 4LRTB 4YR9A 3JQBC 3ZWWA 5EQDA 2D5AA 4BKPA 2ZYDA 4RF2A 3EYWA 1NTOA 3L9WA 5TLSA 1DJQA 3H65A 1UDAA 1UAGA 2HK7A 3E9NA 1OAAA 3GG9A 4XQEA 4L4SA 3GEMA 5A9TA 2R00A 3WR5A 3CKYA 1SOVA 1ZW1A 2VYNA 2GN9A 5TJHA 3SLKA 3RBVA 4YWJA 2PKQP 1ZK0A 2LDXA 4E4YA 4YDRA 4KTVE 1N7HA 4IQ8A 4YEDA 5TRTA 1AXEA 2EXXA 1P0FA 5F5NA 1GAEO 5T67A 3VKUA 5DBIA 5CDGA 3ZDFA 2PR2A 3KRTA 3LLSA 4NI5A 1HDYA 2FSVA 3JQCA 4OYRA 5A1TA 4OJNA 3CUKA 3ZW8A 1JQBA 4YACA 3HDJA 2PZLA 4BOYA 2OP0A 4IS2A 4AJLA 4ND5A 4OM8A 2EEZA 4Y6PA 4KWHA 2IEDA 5LDGA 4E5KA 3X2FA 1QSGA 3VKVA 3F1KA 2VZ0A 4N5LA 2C59A 4ZHSA 3ETGA 3F4BA 2GERA 3GF4A 3W8DA 1GL3A 3RFXA 3GR6A 2E4AA 1ISMA 1IE3A 1NHGA 2W2LD 5C37A 1LNQA 1UH5A 4B3JA 1PGPA 1XCBA 3PDUA 3DFZA 1XWFA 2AA3A 2DTEA 4J1QA 3UFXA 4J7CA 3W8EA 3C1TA 3NGLA 3ULKA 4ALIA 5JDCC 5JAMA 2RCYA 5K9ZA 4B8WA 1V6AA 1JLLA 3NTQA 2Q45A 3HHPA 2D3TA 4KWIA 3DDNA 2YFQA 4IJUA 3U4DA 4UVHA 2FN7A 1ZXBA 1A71A 4KUEA 2B4TO 1PL8A 2CUKA 4XYGA 5L51A 4J7XA 3AWDA 4CM5A 3BZUA 5U4QA 3T4XA 5G0WA 1ZH8A 3RQSA 1HRDA 4XD2A 1UXJA 3A28A 4ALLA 2AQKA 1R16A 5TS3A 5ICSA 4E2ZA 4PLZA 3WNQA 1X0XA 4GX0A 3V1YA 3O03A 1ZVMA 3ZN2A 5I7VA 3GLQA 3WLEA 1GYPA 1Y9EA 1A7AA 1QP8A 2RH4A 2WYWA 4GGPA 1BXGA 4A5OA 3FCOA 3MOGA 1PZGA 4BO9A 1LC3A 4IXWA 3VTZA 1AUPA 3GMDA 4GBJA 3TFQA 3TOZA 4JROA 4JP3A 3AY7A 4YTEA 2AEFA 3DBRA 4A27A 3TNLA 1Q1NA 2RBEA 4N7RA 4OSOA 4R5HA 3ADPA 3TZHA 1DRUA 2BF7A 1P44A 2VN8A 5BSHA 3H9QA 4JIGA 1LDEA 5FI3A 1I30A 3JQ8A 4NHEA 4CV3A 1JVBA 1J6UA 4NBRA 5JCJD 3WFIA 2LDBA 3G0OA 1HDCA 5CFZA 4CM6A 1UXIA 3MJCA 1MXHA 1DFIA 1YXMA 2A94A 3ZWOA 4TMFA 2XXBA 4HP8A 2JAPA 4KQWA 4J6FA 2FPPA 3ZWXA 4LSWA 4DVJA 1Y8QA 1PL7A 4NJMA 2C29D 3JSAA 3Q9NA 3RC1A 3QY9A 2UUPA 4L0QA 1JU9A 3PTZA 1NYTA 2I6TA 1YB1A 4Y8VA 5JW6A 1K6IA 2JD1A 3K96A 4E21A 4R5MA 3VH3A 2D4AA 4J4HA 1U8XX 2NUAA 3HE3A 4UEKA 4J91A 1RM5A 3TDKA 4WCFB 3FI9A 4BKOA 5IZCA 1X7DA 1DIHA 4WNCA 4W9NA 3DMTC 5JS6A 3U3XA 1TB4A 4YT5A 1OC2A 1XQ6A 1ADCA 4WEQA 4YYZA 4FDAA 4OH1A 3K5PA 5G4LA 2GN8A 3M6IA 5A5EA 1H6BA 1V9LA 3I9OA 4BNFA 3HB5X 4XR4A 1B16A 2CMDA 5JO9A 3OQBA 1D1SA 2NSDA 5JYFA 4QUKA 4WKGA 3H9UA 2X7HA 3IKVA 1LJ8A 1J49A 1P45A 4FFMA 5JMPA 4CLXA 1ZXLA 3PPIA 4IZHA 4OSPA 4KTTE 4UREA 3N58A 4UAGA 3RUCA 3V2HA 3WMWA 5MGBA 3H3FA 1NFFA 1VPDA 4BO8A 4PG7A 4DLBA 2EIHA 4CMBA 3H3JA 2YV2A 2VNSA 3NAQA 1LLUA 4GVXA 1D4FA 2Q99A 1C0IA 2O7SA 3GGPA 1DC5A 3DOCA 5I9LA 4FPXA 1KYQA 2JKVA 4L4RA 3V1UA 1ISIA 1G6KA 5ILOA 2D1YA 4QTZA 1N92A 1ULUA 2YHIB 2H1SA 3RKRA 3FNFA 1N8KA 1UP7A 4PG5A 4NU5A 1UDCA 4BS9A 5JCXA 3FTNA 2NTJA 2Y1FA 1PTJA 2X86A 3NKLA 2B4QA 4MP3A 4KZPA 1PEDA 4PIVA 4BNMA 3HZZA 4GQAA 4Q3CA 3M2TA 1ADFA 5JPIA 4A10A 1DEHA 2DAPA 2Z5LA 3FWZA 1HXHA 2A35A 1R4NB 3FSRA 1XHLA 3WG9A 2VHVA 3INGA 5DZSA 4EEZA 1NP3A 5IDXA 4R01A 2VHYA 1YL5A 1ZBQA 1ZMTA 3ITDA 1YGYA 3KHUA 4NU6A 5B12A 1C0PA 2IRWA 4XQCA 2UDPA 4Q3DA 5I9MA 1XEAA 4OXKA 3AW9A 4YJFB 1WVGA 2JHGA 1XELA 5IF3A 1YB5A 1UP4A 5I8ZA 2O2SA 4Z0TA 3F4LA 1CERA 4D45A 5KVSA 3WJAA 5L45A 4P8RA 3DEYX 1Z74A 1WXDA 1N2SA 1FJHA 2J3KA 1LI4A 1PIWA 4FFRA 2I3GA 3C85A 3DAGA 4WJZA 4R69A 5KJ1A 3H5AA 4IDEA 2JCXA 3DZHA 2VUTA 5DBGA 4NBWA 2O3SA 4GX1A 3PLNA 1E77A 1E7YA 4B4OA 2IDZA 2EW8A 2CZCA 2WD8A 4XJTA 2I3AA 1WAMA 5IJZA 4RGBA 3EHEA 4CMIB 2HMUA 2BHLA 3QWAA 3AU9A 1P74A 1O95A 1P1IA 3MOIA 1VL6A 3R0IA 1E3WB 4AJ4A 4TRNA 3KUXA 2JFHA 4BO7A 1YRLA 5JDIA 2CVOA 4OXYA 2X8LA 3GC6A 5CG2A 4BNZA 3OMLA 4TROA 3F46A 3NEPX 3WGHA 3DC2A 1VRWA 4OOEA 2I99A 5H83A 3VTFA 2G5CA 1WP4A 1X1TA 3AUTA 4I9NA 4X54A 4IDDA 1NQTA 3HFSA 1ZZEA 2CY0A 2IYOA 3GRKA 3OHSX 2OMEA 4XR9A 3OIFA 2YFHA 5EN4A 4PRLA 1FDUA 4FC6A 4CMHA 3DZFA 3V5NA 3KOUA 1AGNA 3DAPA 2WJPA 3ETDA 4IJWA 2ZCVA 3PXXA 2GCGA 3TFOA 3KZVA 4WCFA 4YAEA 5HA5A 2G82A 1E1KA 1KVQA 1T2DA 2FMUA 3MWDB 1DPGA 2NLOA 3O38A 1U5CA 3BMOB 2HK8A 4ZICA 1WZIA 4PLFA 3LC1O 2B69A 4UUMA 5CPFA 5BNIA 2RIRA 2AXQA 1KETA 3R3SA 4BMSA 3QJ5A 3E18A 1MFPA 5A02A 2ZTVA 1ISJA 4FOSA 3I23A 1L1FA 5KKCA 1SBYA 1XU7A 3JQAD 3PEFA 4G5HA 1GV0A 2JFGA 3M1LA 3UCXA 2B36A 3NT5A 4O59O 4RVGA 4K28A 5L4LA 5T6BA 4E3ZA 1BW9B 4H15A 1ZK3A 4O5OA 4KDFA 5IDYA 5CEJA 4G81A 3ASVA 3GT0A 4ZD6A 2JAHA 1P1JA 3MJVA 1HE3A 4EDFA 1H9AA 4F3YA 1RWBA 4J4BA 1VJ1A 3EW7A 1ZMOA 2FPGA 1KS9A 2J5RA 3D5QA 4E5PA 1SB8A 4JJIA 3WGTA 4Q3AA 1LUAA 3I9NA 2D0IA 4CLHA 3ZHZA
chains in the Genus database with same CATH superfamily
2HIMA 3PJEA 1R6VA 4F2GA 5DP1A 3MILA 1BG6A 3QA9A 2BDUA 1WTAA 3P9NA 3EZLA 3I76A 3KQSA 4QUIA 3V7UA 3OPYA 2SCUB 5TVKA 3CB4A 2GXQA 1I7PA 1XRLA 2FX2A 4XIYA 2O4CA 2BUBA 5HZMA 5U9CA 1L7XA 4IH1A 1H93A 2GGSA 3IV6A 3N2KB 4K03A 4M1OA 4ACBA 4GMDA 4RY8A 1BRMA 1GZ4A 1PR4A 4HN4B 3IUBA 4JYBA 4PTYA 5D3KA 3VR6H 2YMQA 3TBFA 2R751 3WLTA 4PX2A 1JS1X 1NLMA 4ALKA 2OILA 4RCVA 4YQYA 4OOFA 4Q34A 2PZJA 2OOKA 4X6XA 3IA2A 3RYFB 4PRKA 1PEYA 5A5FA 1P18A 1I0ZA 3II6X 4N65A 4B3BA 4IMJB 2EZ4A 2Z5VA 2QYTA 2WHPA 2VPYA 2YNMD 3LAWA 3DONA 4O4HA 4P7FA 4E5NA 1JG7A 4D9JA 2FK7A 3NYQA 5HW0A 4B35A 3KBBA 4LMAA 3C5VA 4YJFA 2BGRA 2HRDA 4IDHA 1B1CA 3U7QA 3W5BA 3O7MA 5AVTA 1KVTA 3T5AA 3I1IA 3CX8A 3EVEA 4JBYA 2VBFA 3L5OA 3C3XA 4U2KA 4N12A 4BQFA 2JJYA 1EHYA 3CU5A 4GKAA 1BSVA 1WCYA 1NXXA 3DW3X 4QUJA 5DX1A 1V16A 3OECA 4G25A 4NECA 2RDMA 5IVKA 1DAIA 2ILTA 3P2JA 1N1DA 5DBOA 3LPCA 1X86B 1FP4A 3NRJA 5EA2A 5J58A 1C9YA 1V35A 4PLTA 2NU9B 2OPHA 1KJ9A 1FXWF 2RGYA 1PK8A 1QQ5A 2FZEA 4X1KA 1U5BB 2B8TA 3EPRA 3PNSA 1QGAA 4PQFA 3KAPA 4PIPA 3WOHA 3ZHOA 1V7ZA 3TZEA 1T26A 1T5BA 3JWIA 4P3OA 3L7MA 4ND1A 4GSKA 1N5OX 2XA9A 1C9NA 2XEXA 2NZYA 3GP5A 5A5VA 4C7KA 4A0SA 5BMVB 1S7CA 2DLDA 2F2TA 2IYFA 3FSJX 1AHHA 2XQFA 4UFNA 3HZOA 2WSIA 4YRSA 1W5TA 1LEHA 2ZS8A 3U3ZA 4FN4A 3ML1A 5JYAA 4HSEA 3RPEA 2XB9A 1E3WA 2KI5A 2O6LA 3EZ7A 3Q7TA 4QELA 1GO2A 1SBHA 4A6XA 3WIUA 5IK2D 1UZMA 2XE6A 2XYRA 3F7TA 3UW3A 1B4DA 1WB5A 4HLUA 3ZTWA 2IWRA 1KQFA 2Z83A 3ZHCA 4O4IA 1HEYA 3LT5A 5JSUA 5MHTA 4FYIA 1ZL0A 4WH0A 3WLLA 3C6QA 3O8DA 3CH7A 4I50B 3HJNA 4W1RA 3DBVO 3TPFA 3H2IA 4RACA 1Q1EA 1BH6A 2HA7A 1OXXK 4TKMA 3W2HA 3O4IA 4J0EA 5IC5A 2ZB2A 1A8HA 1JG6A 1XQVA 2QPTA 2VHJA 3RV4A 4F38A 5ALGA 1EZ4A 2GPAA 5D51S 4ZTBA 3UKOA 2NU6B 1FDTA 4U7JA 4BP9A 1ZA1A 1DZIA 4C1NA 1ZUNB 3X1XA 3L5KA 4JBIA 5C3MA 1NASA 1VIDA 2QYSA 2AQ8A 3DP9A 3N28A 1ENOA 1NMEA 1CZLA 3ONFA 4IDAA 3S27A 2CDRA 1QZXA 3EXHA 4MR8B 3CY6A 5JBIA 4P4GA 4YCJA 1CD5A 4IO1A 3TQQA 2HPAA 2WMDA 4PIMA 3WJ2A 1CFJA 4PLYA 1L7AA 1V71A 3B6IA 2PGLA 4IINA 4KFUA 1FRFS 4Q9LA 3UB3A 4LYYA 1OWNA 4M99A 2CHEA 4NYMR 3UHAA 1KH1A 5IDQA 1BMFD 3FR8A 5AKKA 3R24A 2ZRNA 5FOSA 3GQVA 3WL7A 1C29B 4Q47A 4KUGA 1HKUA 4EW3A 3O8LA 1IK4A 1QOQB 1WEHA 5EWMA 5E7MA 1Y7IA 4NCHA 3WIEA 1RLUA 5L3QA 3M6UA 1V9SA 2PFKA 3I12A 2LP4Y 3HLKA 2UUBB 1T0UA 3OX1A 4BNDB 2EAUA 4ZVNA 5BSVA 4CKBB 1CE8B 1JG1A 5H81A 1PN3A 4HN9A 4CE6A 1JQ5A 5K1ZA 3PRJA 3RAPR 4MAMA 4J0KA 1PNVA 2FUG1 2H9IA 4N54A 3NYRA 2GBPA 4J2OA 4Q0MA 4RSGA 1HETA 4YB8A 3E82A 4UTOA 1VTKA 3NHKA 1IIRA 1GQ2A 1G2IA 4YNBA 2IS2A 4JASB 5E1MA 1USVA 4ZXPA 4IIJF 4EY5A 2FW1A 3GRFA 1J2RA 3E9MA 2ADMA 4QBFA 5CAEB 3K72B 2GRUA 2JBAB 4LJ5A 2OAQ1 2ZPAA 4LOLA 2PEYA 1L5ZA 4JJZA 1A69A 1Q84A 2P9ZA 5H80A 3NYWA 1LSSA 2FMIA 5LZ5A 3B78A 2B0CA 4IMPA 3DTYA 4RK6A 1A9XA 1J00A 3EGVA 3MVEA 2J45A 4BNHA 1UC5B 1TAUA 1E32A 3BWYA 4NS4A 2ENUA 4PZYA 1RC0A 2CHQA 4AQ7A 1CIJA 3EVDA 1BU8A 4XQ9A 4M1KA 2OXTA 3S0JA 1U8UA 3JWJA 1PNQA 2PRYA 4HGQA 4A6EA 5CFPA 4MIEA 2GBLC 4HFNA 4ARVA 1O5OA 4RJLA 4XDHA 4DSTA 2E2WA 2R68A 2WWHA 3ZI0A 3G68A 2FR1A 1G8FA 3FOCA 3S8YA 3IO5A 2BSXA 2CUTA 2IQ5A 3S2SA 2F90A 3K8QA 5LQMA 2IE0A 1B3BA 1NP6A 2E5FA 3ILYA 4ALMA 4YMHA 1BWQA 4KX5A 4RO0A 1PZHA 4EATA 4ZHQB 1XAIA 2QT0A 4KBYA 2IPAB 4ECEA 4KR3A 3NW9A 2B8NA 4ZVVA 4Z1MD 2VIIA 1IPEA 4LDJA 3UWSA 4TLLB 4HWOA 4C06A 5I9NA 4XLTA 1CEQA 1OB5A 1H66A 2PLNA 2VWPA 3MMZA 2JLBA 3TW0A 1KKUA 3VC7A 4EW2A 3TZQA 3DUFA 4OJTA 4TVSA 5L7WA 4IQGA 1XZCA 3P4UA 4RMIA 4FBLA 1WD5A 1RWQA 1YS2X 3MJEA 3RYTC 1I94B 3UPUA 4ZOLB 4B46A 3GJ4A 4QSMA 4QU5A 2PQ6A 5JJ5A 3SSAA 3UAVA 4L76A 1DBPA 2G83A 2G70A 4X71A 4XUDA 3AI1A 4G8JA 1SC6A 4X90A 3UAYA 1U4NA 4ON9A 3W5UA 3EPKA 3BIJA 4LF9B 4Z4EA 3FDZB 2ZBQA 4EZEA 2GX6A 2XA2A 3MB5A 5IDVA 1MAVA 4AULA 1HE5A 5DWDA 1VLMA 4MIOA 2BW0A 5F1YA 2DR2A 3SU8A 1D8AA 2VP0A 1Q7BA 1YBMA 2FUCA 5DNAA 2O1SA 4UTVA 2O8FB 3WK6A 4X6LA 3MWFA 4PGMA 4F9EA 1N3LA 2AT1A 3K20A 1Z22A 4XYEA 5FO1A 3AUYA 4BO1A 1SM4A 1LPMA 2CGEA 3PQ3A 4EVRA 2AFVA 2X2EA 3F7OA 2GASA 3NEJA 3WO0A 1L7DA 5AVUA 3V00A 3G9ZA 3K1YA 1NGSA 3D6AA 3QMPA 1M5TA 3B6KA 4I46A 4DXDA 4G0PA 4JU8A 1RLTA 5FPTA 3NHWA 2WZDA 1ARZA 2I1VB 1UEJA 1XLTA 2V5UA 4IYJA 3DZGA 4CM9A 5K6RA 1QYRA 1KY4A 1LPNA 2C2XA 4Z86A 3TSYA 4C4AA 4GRIA 1T9CA 4INZA 2C57A 2CXUA 2C9YA 4A91A 3RUHA 4UVIA 1RM0A 1WP9A 1DXHA 4JX9A 1E3JA 4QYXA 1P3Y1 1Y9DA 5FPYA 4XYLA 1RFLA 5C5IA 3KSRA 5FXMA 5B5SA 2PANA 5DXAA 4CLOB 1VL1A 3KTAA 1VCHA 2Z0MA 2C7GA 2IUSA 2B7CA 2YYZA 4A0RA 3UK2A 4JLWA 2Q6LA 3UB2A 4XGIA 4ARAA 3QU5A 5D7NA 4AUKA 4DUPA 3LL7A 2B35A 4GWGA 3CPSA 4UZSA 4A23A 4BB9A 1FUUA 3OQ6A 4ACAA 4C29A 2PUAA 1S02A 1NOKA 2C4TA 1XTPA 4GYYA 4KLRA 2PVSA 5AW4A 2ZATA 2ZIVB 3ROEA 2XE4A 3R9WA 2J08A 2Q07A 3GB9A 3MT9A 5DHSA 3U81A 3IVMA 3L77A 4G36A 3I8SA 4LNHA 1YO6A 4DUGD 4PHHA 3NTXA 1QH9A 3HJCA 2QK4A 1EGHA 4Z3DA 2BTOA 3UUEA 1V6SA 3CRVA 4KPGA 5F7ZA 4RTSA 1RI4A 2TS1A 3HO8A 4FMCF 4GOXA 4M1MA 1Z0JA 1Z4JA 3JQAB 3V1LA 3WO1A 3SD7A 3EUAA 2FNAA 2DX7A 2BV3A 1QJCA 4S1WA 5KYVA 3FCSB 4DQXA 1E94E 5DV9A 1F8UA 1NW6A 3P0FA 2P78A 1V96A 2WHYA 1V2HE 3U7IA 3B2NA 5AKZA 3B5JA 4R8SA 2P9EA 3WNBA 4AG5A 4D80A 2ZSBA 1HFKA 1XBTA 5IH3A 3FFAA 3L04A 3QWBA 1UDBA 5LXTA 1Z5PA 4MQ4A 4V02A 2O5EA 3RAEC 1AU9A 1W87A 3PCRB 3Q4GA 4DMMA 2GPJA 2QNBA 4EEKA 2NQ8A 5IBCA 2IHJA 3C8HA 2NMVA 4J0HA 5DNYB 1NJ1A 3GJYA 5C8XA 2P75A 5LLTA 4I0WB 1PT9A 1MJGA 1ZM4A 1AHNA 4Y0VA 2NUBA 3H5NA 1LBHA 2LTAA 2JCYA 1MKYA 3EZ9A 1O03A 1NYLA 3GAAA 1OBCA 1Z63A 3GI1A 3FZYA 2OORC 3DXZA 4WBNA 1JDBC 2GTPA 3ZZMA 1XJWA 3T7IA 4A6DA 1U7TA 2I5PO 2QRZA 3C6KA 4JR2A 3SJZA 4A8PA 1A2KC 5AVRA 2OHJA 5C52B 2AQHA 4DLXA 2XRMA 4BFXA 4G85A 1YVUA 2VPZA 1SEPA 1ETHA 1UWLA 3FNIA 4MVJP 3N0XA 2G8NA 3QITA 3RF6A 5FOQA 3G89A 1XEXB 1U2DA 1U7HA 4R1QA 5ITSA 5LMUB 2CNLA 4HADA 5KQRA 4G8DA 2MINB 2Q0HA 2Q8PA 1XNRB 1CJVC 2ZI7A 2RC5A 2XUHA 4L4XA 1Z9BA 1ZSNA 5HF9A 2OCAA 1W4BA 3T3MB 3CF4A 4XIGS 1NVXQ 1G5QA 3WQSB 4C87A 4DE5A 4M0EA 1DT3A 3BE6A 2FPKA 1E89A 4I4TF 4HAOA 3LY5A 1MEOA 1R74A 1NUAA 4LJ7A 2GETA 3N86A 1OLOA 4FT2A 4U6SA 2Z58A 5EJ2A 5BN3A 4MV4A 3AJRA 2AE2A 5L4NA 4W5RA 3VJRA 2NVWA 2YOGA 3IGFA 4AK1A 5L3SB 3ZDXB 4PYIA 2LNDA 1MOPA 4W1SA 1ZI6A 3U09A 2GNPA 2PL3A 2YWGA 5EZYA 4IFTA 3S2EA 4ZO9A 3DZIA 1JENB 1IWOA 3GP8A 1XQ9A 1W19A 1UWKA 2Q4TA 3EQ9A 3ISVA 1Q0ZA 2YVUA 3PQ8A 1ZJ6A 2H59A 5BSTA 5C4MA 3ZU6A 5EJ9A 4ETIA 4OREX 3AH8A 1DKUA 2EW2A 2GDZA 1A5SB 4MYDA 1UEIA 2E1PA 1R8XA 1KJNA 4JJAA 1BQ4A 5HTOA 1CEEA 2FOLA 2X23A 1KU6A 2X77A 3RYCA 3UKJA 1MW9X 1ISGA 3ENKA 3K1TA 1E5XA 2EBFX 3A0UA 4BZPA 1KAQA 1Y48E 1P2UA 1R5NA 1OZ0A 2HRQA 4R2HA 4QQNA 3JQGB 4TLEA 4LX0A 1A4XA 4B47A 2XUKA 3ZBTA 2CXQA 5TX7A 3MQ2A 4YJ3A 1H05A 2WSBA 3WIDA 5ALJA 4JI4B 5DN6D 1UJNA 3NP9A 4B7AA 3HI6A 2IFTA 4EX6A 4E22A 4IQ0A 4RYDA 1BJKA 3AERB 4YALA 4Z9FA 1V26A 4AN0A 1ZFNA 3T5PA 1Q6YA 3MQFA 2DBRA 1WQ3A 1TZJA 4RGVA 5CLGA 5ICEA 4LF7B 2UUAB 3TLGA 2VDOB 4Z0PA 1UJ2A 3E6AA 1Z6PA 2FN9A 2ARKA 2G17A 3R3VA 5GJCA 4JC8A 4BMZA 1KPIA 1X7ZA 1F9AA 1C0EA 1OILA 3CO0S 3WTCA 4NNOA 4YAKA 1M1UA 4E1VA 4E5YA 5F4ZA 4KPYA 5A03A 5GZ3A 1UM8A 2CLLB 3VYWA 1HF3A 2Z04A 2ZXFA 4X92A 5EKTA 3LHDA 5HR5A 1SUIA 3CN7A 5IAOA 4NKRA 2B9EA 4RXMA 2A14A 3W5CA 3NGMA 2PT9A 2ZBFA 1P1KA 1CETA 2BGNA 1XMJA 4DDMA 1N3IA 1YB2A 5F2KA 5EJ8A 5AYVA 1K6JA 2G7ZA 4XZ3A 3WGZA 4GQIA 3ZE6A 1UP6A 3M82A 2UXBB 2DQ4A 5IZ4A 1PGQA 1TKRA 2HD4A 4JVOA 5FNVB 3BE8A 2K7FA 1K8QA 2OLJA 3HWRA 1ENYA 1BHO1 1VJ5A 4N0MA 2C31A 2FXIA 2I4LA 3NYIA 4EW6A 1CUHA 3QOWA 3SN6A 2V9CA 2WP8J 4RK7A 4TV8B 1IHOA 2HBZA 4YRPA 2PKRA 2FP4B 3IBFA 3M1YA 3CZQA 3FPKA 4IUCS 4QUGA 4W9RA 3VHXB 2CWWA 3WP1B 3CZMA 3ZZNA 5I9BA 3BRCA 4MYUA 3D8TA 4TQUS 4IQFA 3TFWA 1GFSA 1KIAA 3KZMA 2X5NA 4TMVA 1E9DA 1ULAA 2ZROA 2LR0A 2NTYC 1GADO 3OQVA 2Q5IA 2OAEA 4D41A 5M6DA 2ZUBA 4GRAA 4P84A 5AVWA 3P4XA 3U39A 4UU8A 1RYFA 2E7ZA 1WWKA 1W36C 4HRVA 1U98A 1GPBA 2EX1A 2PD4A 1V11A 1Z2NX 2IZ1A 4MICA 3P2KA 5D01A 5IYZF 1QQAA 2H9YA 1Q20A 1V1MB 3SY8A 1OBOA 1REQB 2ZIWB 1FFDA 2ASEA 2EYUA 3KTDA 1P1BA 4FYVA 4FOTA 4BV9A 1UJCA 1TT7A 3HBJA 2VXYA 4IVRA 5AD1A 5IHPA 3I64A 2XKBA 3EAFA 3IULA 3EDQA 1NU6A 3IPLA 2NVOA 4YI3A 4LNUB 3SOPA 3WYEA 1IN6A 3B1KA 1MCZA 4Q82A 1UL1X 4PYQA 1CQPA 3SZLA 1RZVA 3OZTA 1JKFA 5DK4A 5GJWC 1KE1A 5IKPA 1SXHA 5C8DA 1I7BB 4NV1A 2P4HX 4GKBA 3L0ZA 1T29A 4EVSA 1MA3A 5CXSA 1U6IA 3EDMA 4EKDA 3H97A 1E58A 4IJ5A 1UZLA 2VL7A 2YIMA 3OJOA 1D1TA 2JNWA 3VR5D 3LF1A 4BLOA 5JH7B 4Q48A 3IL2A 3KOMA 4DLUA 1GLNA 4QEDA 4WDQA 5E6SB 1UPUA 1Y8CA 2YWDA 2YX1A 3VPAA 2GBGA 3K1AA 3CNEA 4IZ6A 2VHTA 4RVNA 1AF4A 3RAJA 6Q21A 1B2LA 2ZW9A 1WMEA 4L28A 2XZOA 4YCSA 2P9CA 5DSXA 1T4GA 3SFZA 1Q50A 4N40A 4MZXA 1KY5A 4L9RA 1XWWA 1DTWB 3MWKA 2PZGA 4HJRA 1K88A 3S7TA 4F3TA 2ZB3A 1SXJC 1QPBA 3MINA 4DSAA 1R0YA 2WQ6A 2YNMA 1DBIA 3RNLA 1ISSA 3OHMA 2X2PA 2GYVA 2MSDB 4Q1AA 1XCJA 3DXYA 2BTEA 4BUCA 1ZWKA 2VUUA 4B3DA 5BWLA 5EJAA 3WGIA 4B3GA 1G6HA 2X7XA 4OGFA 5CVDA 4U2DA 3BFKA 2XYHA 2OBFA 4O2LA 2AK2A 5J2TB 2WLSA 3DBHA 1G38A 3GFBA 3N75A 2ANCA 3R0QA 1E69A 4A4DA 1UPCA 3LYLA 1UKBA 1BKDR 4ZI3A 5K8TA 1Z75A 1FZTA 5I8PA 1FCJA 1X6VA 1U0HC 1XKQA 1FA9A 3BF8A 3HU1A 5FJJA 3TPCA 3TXAA 3C8ZA 4F6RA 3VPSA 1RQXA 1KI6B 2V0CA 2HF2A 4CUKA 5E7IA 4KXNA 1UJBA 2G0TA 3VVMA 4KQ9A 3C3YA 5AM4A 2OFOA 1HE1C 2ABWA 3GFQA 2RGCA 3LOPA 4RQTA 4YGXB 5HJ7A 2J67A 4H7PA 4CG2A 4FZ3A 1ZGBA 2UVPA 3EY4A 3ZK7A 3U6BA 4RZ2A 2GZMA 4FDMA 2P1DA 1VYHA 3A10A 1E7SA 3RC8A 2MMCA 5E4FA 1M1YA 3WADA 3NHBA 1SKBA 1J24A 4RK4A 1ODKA 2IK8A 3KEGA 3TV1A 4P58A 4CXMA 2ZSDA 2BKAA 5JZBA 1XUOA 3LH5A 3O6VA 5ERXA 4CM8B 4IUDS 5A71A 1XDGA 1YBVA 3TB4A 3H75A 3C5CA 3S1LA 6PFKA 1DCMA 2HFKA 2BBTA 2PT6A 4UJ3A 6ADHA 1G9TA 3I9V6 4D57A 3ROZA 2C88A 4XRGA 4YXFA 4G84A 3WV4A 4FSHA 1Y89A 2NZ8A 4F2DA 4W8HA 5LP6C 4FI3C 1YDGA 4TLDA 1GYRA 3OI7A 3U4CA 3V32A 4MDFA 2C20A 4REOA 4S1OA 821PA 3O8OA 4LCEA 1E1QD 1Q19A 2XADA 2V5AA 4I14A 1H6CA 4W7IA 4YP1A 1M9NA 1OFUX 3AR7A 1CS0A 4N4AA 5A5DA 1Q0SA 2DBYA 2JB9A 5AQ1A 3I72A 3BAZA 1TQ8A 4HD8A 1F0PA 4JH0A 2NYRA 3NM5A 4A7PA 2BFWA 2ODWA 1BX0A 2C9ZA 1R37A 4C9BA 3BTSA 4EK9A 4ZAGA 1GCUA 4DNQA 2LXNA 4BNLA 2F1KA 2C03A 5KJ6A 1H1LB 3L02A 4UHFA 3EY9A 5GINE 3U4HA 3M70A 5EE0A 4ZT4A 2PIDA 3P2OA 1I5OA 3EJWA 3L1JA 4ZYLA 1AQUA 3IKLA 4U8GA 4JUFA 4CLRA 4OLBA 3R2JA 3ESRA 2QTGA 3B7PA 3DWEX 1FMFA 4EH1A 3T9AA 2BKXA 5JVDA 3HKDA 1JU3A 3WQQA 1BMQA 4ZC1A 3PZBA 4DWJA 4DNFA 4RHYA 5C4IA 4ENQA 1BCSA 1KDYA 2C2GA 2X58A 1U0JA 1MX5A 3TM4A 3K5IA 2BOVA 2CFCA 5DB4A 1HYQA 3DCYA 3GRUA 2W6ZA 5HJ2A 1NMXA 4ND3A 3QE0A 2VF7A 3ZVLA 1K3TA 2CDCA 3FNGA 1PJQA 4IIUA 2BJWA 4N0QA 4DM7A 4WZ6A 3WWZA 3AEUB 3AIMA 2OB1A 3GIWA 5FPKA 4KQJA 2MYTA 2Q6TA 3KGDA 4U6NA 2X4DA 4JOBA 5E4TA 1PU2A 1YJ5A 1FJXA 3H5RA 3BMCA 1BAPA 1ZM2A 2NO7A 1SN7A 1P75A 3HYLA 4CIWA 1O8CA 1ZBDA 2H2IA 3LT4A 2WD9A 1Z6ZA 4HDQB 4PGGA 4CDRA 2QZZA 3HJBA 1OYWA 1T8WA 2CHFA 3OU6A 5IT9A 1IZ8A 1N57A 2D5IA 4Y6QA 3G0DA 3LHFA 3OMWA 3DE0X 1Y6GA 1VCNA 3QHAA 4IR7A 4LY9A 4WN9A 1GDHA 2ZCUA 4W1QA 4C07A 2Q62A 3QZUA 3TNYA 3CVXA 5EKSA 4GKVA 4J1SA 2CLMB 3ZDZB 4MKRA 6NULA 1IIBA 5H0IA 4D8UA 2GCNA 5DEIA 1PTJC 4BFVA 1NF8A 1DKNA 1HQKA 2PLRA 4WZBE 4YDHB 3TR6A 1M2OA 2GESA 2HSJA 1DRKA 3H4VA 4OMUA 2A5FA 5AI5A 3P19A 3GUVA 3LW7A 4MRNA 4U02A 1CVLA 3ECSA 3ANYB 3TVDA 4JGGA 4RAQA 4CR8A 3CO5A 3TMKA 4HNAB 3IRVA 4IDFA 5HSGA 4AY6A 4HVLA 4EJ0A 1JEOA 1XDWA 1RYBA 2X0NA 1CSEE 3ASYA 4IOKA 2JFFA 3QXHA 1P1CA 4GXTA 3UZUA 4ENWA 1ECPA 5KKAA 2XT9A 3RNOA 3VISA 4D44A 3V80A 3FTPA 5FD8A 3B6JA 4BQSA 2E85A 1SCUB 1SCNE 1L5RA 4CLQA 2ZK7A 2AMFA 3I1FA 1XCOA 2PDAA 3R3UA 4MUYA 3TBHA 3WX0A 1V7CA 2ZI6A 5K45A 4YT2A 3D0QA 4JBLA 4YIHA 2EG9A 1H0KA 2DQYA 4RZXA 1IY9A 1QYWA 3FSEA 5AQEA 2KS6A 3EA0A 5CYPA 5JC8A 1E3EA 1VOTA 2XMZA 3F4KA 4C7BA 3WRXC 1ORVA 1I5RA 1W0JD 2XKKA 3CGGA 2VNHA 4EKNB 4JZYA 2EL7A 1FB5A 3NB0A 5KVQA 1MF7A 2XUJA 3H9GA 3ZIDA 1K86A 4HYTA 1UDRA 3SYMA 4CM4A 5AHOA 4G65A 3TG2A 2BE7A 3U17A 3W5AA 2DUMA 4O2BF 2BEVB 4HV4A 2F00A 2V97A 3SC4A 1UT6A 2R25B 1QGUB 1B2RA 1A8UA 3I9KA 5JBQA 4AP5A 1ZGAA 2CD7A 5B4UA 2CDAA 2PRSA 3BEOA 3NTRA 1V2GA 1J21A 4J0FA 2PHZA 2Q5LA 2XQKA 3AHDA 3SIXA 1FYDA 2H9AA 3JU3A 3FCYA 4X6UA 5LOVA 3H1FA 4GUAA 1ZW6A 2IUTA 4PS1A 3F9IA 4B6QA 3AF0A 4JOSA 5KNCH 3ND9A 1MX1A 2Q50A 1Z62A 3ENZA 3LX6A 4IIJB 4ITUA 2EFGA 2QGZA 1PNOA 4TKVB 1H2HA 2PQMA 2QS9A 3CVVA 1KBZA 1X77A 3UPDA 4JLDA 1OE0A 5LLSA 3N0WA 1YS9A 2OM2A 3JASA 2FU5C 2OEPA 3E1GA 2ZRGA 3BDIA 2GNOA 4ED9A 2AI1A 3BKWA 4D8XA 3OKAA 5CA0A 4YT4A 3CZRA 3Q7RA 3QA3E 3RRYA 2C2MA 4A2WA 4HJXA 1LLQA 3MN1A 5AVVA 2IY9A 4EG1A 5FTWA 1EFKA 1P4AA 2WDZA 2AFRA 4NBNA 4D9FA 3OP4A 1Y63A 3ONWA 1NY6A 2JLUA 2COKA 1KDPA 3GJZA 1ZJ4A 1VE6A 4J0DA 4MDHA 3H87A 4TS3A 3SMVA 2MWMA 1RW4A 2B1RA 4BXOA 4BJ6A 2MTBA 3CNHA 3NAMA 1NR5A 2GEJA 1K4MA 4LOIA 2MSLA 4KN5A 1ZD3A 3ETJA 3G7SA 4B34A 3KB8A 3N5CA 5HMLA 1VBNA 3ZWBA 2UXDB 1SCIA 2YRXA 3VR2D 1VC2A 1R66A 2EBUA 4OP1A 3MTIA 4QL3A 3O21A 3HEAA 5KQGA 2DFLA 3U16A 3OQMA 2Q3LA 2NV6A 1AB5A 3MGGA 2Z6AA 2R60A 4TSRA 2YN4A 2W2LA 4YHBA 3M9XA 4QAJA 4N5NA 1ZYUA 4P5PA 2WY2D 3WBBA 3ACCA 4BNXA 4D25A 2FQWA 3BWCA 4QPPA 3ZBQA 1PL0A 3KVVA 3Q9UA 2PKXA 4NS1A 4HLQB 2X1HA 1RD4A 1BNCA 5A0TA 5DPMA 3AFHA 1FTWA 2BHSA 2ZYTX 3FW1A 1CG6A 4XGKA 1NX6A 2SBTA 2ZI3A 1IU9A 1JV2B 5JCPA 2WWXA 2WLTA 3DBLB 3L2OB 1J0DA 3T3GA 2AJ8A 3I4FA 1IONA 3M2PA 2C7QA 1T10A 2WM2A 4DNPA 4Q7MB 4NEHB 4KR2A 1DFHA 1GGVA 1QGZA 1Z3CA 1RYNA 2AZMA 3FLMA 3GUCA 1AK2A 3E9YA 4OQNA 5FBHA 1UQRA 3HCAA 1QIKA 3EZ2A 4FHCA 1NSYA 2DHEA 4WFIA 3WP0A 1KYIA 5IAGA 1O96B 4WNYA 3QPDA 4AKIA 4EJMA 2IYQA 1IOVA 3LXMA 3RHSA 1KYWA 4M36A 4UTPA 1GZVA 4BQOA 3EP7B 2IV7A 2VDVE 1PYGA 2ZUDA 3KKOA 4I2NA 4Q3LA 1S2GA 2BMVA 1ZVVA 3KR1A 3R6WA 3QEMA 3LVFO 4Z53A 4IIDA 1I2DA 2QSUA 1X3LA 3GA0A 1G1AA 1Y3DE 4DCGA 5DDIP 1I0IA 3DKPA 3KL4A 2RI6A 1PZMA 3HA2A 3B8EA 3JRNA 4RELA 4BKRA 4CL8A 2H4FA 2XWPA 4XSVA 4NR0A 1F2UB 1N8NA 4DYHA 1V5IA 2ZJ1A 2Q9BA 1L4YA 5A06A 2Y92A 2OPBA 4MRPA 4FYJA 5JYEA 5F1KA 3DR3A 5CEEA 5M5BA 5IKOA 3TGPA 3E61A 4FOPA 5CVTA 1NW7A 3LC7O 3O1LA 3VOTA 5BYAA 3ZIAD 5BW6B 4I5DA 5DGDA 2O8CB 1QNLA 2H2WA 2PRIA 3PFIA 4ILKA 4MHSA 1FJ2A 2FUEA 1N2ZA 4YCDA 3VBEA 4CFSA 3DMTA 1Y6RA 4HXFB 4R31A 3U19A 4KOEC 1IY1A 1BVRA 4B3IA 4P6VF 4GSYA 3JARB 1L7EA 5EJGA 3D7MA 4HEA1 4PBSA 2HWWA 1PS8A 4H7JA 5COQA 2RGDA 1M34B 4BNKA 1GQQA 1U8CB 4DPMA 3DWIA 3K0SA 5AKYA 3KO8A 3BS4A 4B6PA 4J16A 4EJSB 3PNQA 1JMYA 5AWFC 2K2QB 4HNTA 2DBVO 4GF5A 4ZV9A 1R0XA 2BN4A 3EVAA 3OX2A 3FWNA 4C03A 4JI7B 4ER5A 1DC3A 1A8PA 2BH2A 2BDTA 3D31A 1HMPA 2JKYA 4QJ5A 3RT1A 3C3MA 4EVQA 3QSYA 3LP6A 4GZ5A 1LU9A 4MNTA 1IY0A 1P5RA 1EIWA 4HBGA 3CEPB 1SNYA 3O26A 4OF4A 3E9QA 1G59A 2H57A 3AESB 2Q4EA 2WWGA 2GM5A 5JC1A 1GPNA 4PYKA 2JJ1D 2NYAA 4DM3A 2YVAA 2J46A 1R0BA 3EFEA 1L9XA 1CJBA 1PTKA 1E6KA 5KYXB 1PLKA 2C99A 1L8OA 1QVVA 1WXGA 2QUKA 3RSFA 8GPBA 2XI4A 3L06A 2QN7A 2UU9B 1IQRA 3QF4A 4R84A 4JVMA 3ZKWA 5LP6F 2JG3A 4NDZA 2BVNA 4ZMBA 4Q39A 1TKAA 3CQ9A 3H5OA 4HWSA 4KR7A 4IFIA 1SO8A 4L2IB 1PDVA 4IXMA 1QH1B 1NIJA 2KQUA 3DHYA 4HL6A 4R1NA 4RWEA 4E7OA 5KX5A 3TKYA 3R5HA 3TRHA 2OXEA 1NNUA 1BYUA 1J8VA 4IWNA 1Y98A 2VNKA 4BX2A 3JQPA 4LCBA 3TQTA 3SDSA 2IPMA 1GAJA 4HLUC 3WB2A 3JRXA 5DCYA 4B3MB 2IIBA 1ECFA 1UOPA 1MPTA 5HUQA 3JALB 3IDSA 1CQZA 2O0MA 1FFEA 1SBTA 1O9HA 1P29A 2QL5A 3P5SA 5JE8A 3HBFA 3HWWA 3F5MA 1SQGA 3LSYA 1I7LA 2OWDA 1QCDA 1YMUA 3AYXB 3BIWA 5DM60 1W5SA 3JR3A 1Q1BA 3GOQA 1ZAKA 3KEOA 2EYQA 1AOXA 1VHTA 3JR7A 4U3JB 3OE1A 4EX7A 5LQNA 5J4KA 1TPYA 3R5SA 4KJZA 1C8LA 1H2YA 1TX4B 3ABOB 2H5JA 3CJTA 3LA6A 4IOLA 4UNSA 3H9BA 4BCCA 5C7OO 4TSFD 3ZDYB 1ILEA 3BJZA 4BAUA 4HQRA 3FPEA 1LX6A 3E22B 3OJEA 3RUEA 2CCJA 2CZQA 3EXHC 4K9DA 1T1EA 3FNQA 2JA2A 3FWYA 1V5WA 2ZR8A 2FSUA 1OY1A 2ZJOA 3TZKA 2QTHA 2CJYA 3L6DA 3EE6A 4F9FA 2YJZA 5FWYB 1U1IA 3F5QA 1T5DX 1OX4B 4YCBA 5AK6A 3X2SA 3BMQB 5CB0A 3EIFA 2B2CA 4EW1A 2IXTA 3IURA 1Y5MA 3AI3A 3B3QA 3IJEB 4KGZA 4BQNA 2QSYA 1DWUA 1HDXA 1X1RA 2VKQA 1LDBA 5KTRA 3OCXA 2A0XA 3QXXA 4URHA 1MOQA 2X9QA 1W4LA 1EGQA 1ZO8A 3TI7A 2Z2YA 3FGZA 2MHCA 3NHPA 4HAXA 3KU1A 1G2QA 3NORA 2E6UX 5JYBA 1HO3A 2J9FA 1UWVA 2AXNA 1NUPA 3N8HA 2AFIE 3NJ4A 4I66A 2FG5A 3G5LA 3H2SA 4P36A 5T41A 3UMFA 2CNNA 4YWHA 1XZJA 2WTXA 3F6BX 1YOVA 3G0IA 4QTYA 2CVHA 4F6CA 3L0YA 1NAIA 2Y93A 4JLMA 2G71A 1XU9A 4UUQA 3K15A 1TM7E 2E5WA 5CG1A 3LY7A 3OTHA 3O1HB 3WLMA 1FBNA 3CE6A 2IEIA 3LDUA 2XRFA 5E0KB 2QG4A 1F48A 1PGNA 1JEEA 2C94A 3S7ZA 3J81A 4PCVA 2XZDA 2ZJYA 2JGMA 4V1CI 1UXKA 2W58A 3JD4A 3NWOA 3Q15C 3ZW7A 3AB3A 1E3LA 4DIEA 1WUYA 1XD2B 1JQKA 3R23A 4MUIA 2H6EA 3OOSA 3PEUA 3VR5A 3ZYCA 4B6OA 5KZMB 4RZIA 3K9QO 1LTKA 4B6GA 4RPIA 1ZOSA 3NQ41 3PUXA 1FK8A 4KE7A 4R2JA 1XR3A 2Z2XA 4UARA 4YXWD 5KDDA 2DKFA 2JGJA 3ZNQA 2VJQA 4G63A 4UMDA 2C9MA 3L6OO 4CTOA 3I5XA 4OM7A 4QGSA 4KGXA 1POXA 5H4HA 3LM8A 3TLYA 5F2NA 2A4KA 3AC0A 1N2CA 2J3HA 1KVRA 5CDHA 2H52A 3AQ4A 4GI2A 2VDKB 2DPYA 5AXAA 2R8YA 3JWHA 1TMYA 1VPLA 3PF9A 5FUYA 1U2EA 3VNSA 5ILQA 1VG1A 1GTL1 4FJ0A 4CU2A 1I2BA 1WUTA 4CEJA 3K1ZA 1SULA 1ECCA 1ZM3A 2K87A 3LL4A 3NIGB 3ZZ0A 4EHBA 2ZE6A 1A72A 2YW2A 3TW8B 4AURA 4FJ1A 2UYOA 1IHXA 1EFCA 3E9EA 3K35A 5BYKA 4LWOA 1AVTA 4PFSA 4P0QB 5EC8A 3L7DA 2BR3A 2BLLA 2HF7A 1E8MA 3I8OA 3PXDA 4OX9B 5GOZA 1CUIA 4UBKA 1QIFA 3FDXA 4H3VA 1OREA 3CNQS 1RRMA 1QO9A 2CJXA 3WC4A 4KRFA 4CM1A 3TW3A 1E0DA 3KC2A 5I3ZA 1RABA 1NF3A 4D9BA 1NXTA 1PDOA 3C1OA 4L08A 4S1PA 2EQBA 2DERA 5G4KA 3G6KA 4UHEA 4BEWA 4M0FA 4H9GA 1WIWA 3EFBA 1GPLA 4Q18A 1YCGA 4LG1A 2R79A 4XM0A 4KSCA 4IDGA 4BBPA 5FWXA 5JMOA 1QMHA 3BN3A 2WA2A 3ELUA 4ZZ0A 1A9OA 3E1KA 4HATA 4DMGA 3MOSA 5IYZB 1QU3A 4UHCA 4UNPA 1ZUD1 1CR0A 1U9JA 4I9HA 1EA7A 4KWEA 5TC4A 4B4WA 1K8ZB 1G3RA 1N6OA 4L5CA 2Q3FA 3BKXA 3ORYA 3U0VA 3PC3A 3RBZA 1Z4MA 4RORA 2D2XA 1UF9A 1Z12A 1DT5A 3ODPA 3SBEA 3WK8A 4ZYZA 4NBTA 3KJQA 5HDQA 2ZJ7A 4C4SA 3O8RA 4QM6A 2Z57A 1W1WA 3Q8XB 3IWDB 4U0JA 4Q7QA 1XYYA 1TA4A 2DCMA 2FRXA 1XLTC 3THYB 2NO1A 1TE2A 1RLMA 2UZ4A 2O3RA 5KEIA 3OIUA 5CM9C 5B1HA 2I2DA 4EY3A 4BAGA 4FFBB 4QBGB 3ST7A 3OZ7A 1EU1A 4LEIA 2RHBA 2IJGX 3GQBA 3ZEAA 1JU4A 3UO8B 3ZWQA 1DL5A 1RJ9A 1Z4KA 4R9RA 4LY3A 4L9SA 4DC0A 1QLHA 3HLTA 4FQ7A 4B3CA 5G3ZA 2Z9CA 3QP9A 1GEGA 1W0KA 3RG2A 4X1OA 3C6ZA 3O2JA 5J5AA 4ES6A 2J9GA 2XNDA 3HO1A 3DO6A 1FDWA 4PZCA 4ZALA 1EIZA 4Q9AA 3SLGA 1KY3A 5LVAA 3NHMA 1R5JA 4YMLA 1NW9B 4TTSA 1QWOA 1W47A 3QUAA 4OXXA 5EPOA 1FSGA 4UUBA 4XW2A 1R6BX 2NP6A 2RKWA 4INJA 2J48A 3WLAA 1O1YA 3WL3A 5BOSB 3HSKA 7YASA 2NO4A 3R1IA 2C5BA 1JTVA 3E7WA 4RMJA 1YONA 2VF4X 3PIDA 2XVYA 2ZWAA 3HYCA 3P0HA 4CEHB 1S0UA 4TZTA 1P77A 4NPCA 1ZHFA 3AJAA 4C7OB 4DSNA 4YRBA 3KD3A 3D7LA 1JE1A 1RQ7A 4TRJA 3ZU2A 1R27A 2R6HA 3G2MA 1YK0A 3PL1A 2FPXA 4EHKA 5JFGA 1FTGA 3RKSA 4RQBA 3NKVA 2FPLA 2YBEA 5KAPA 3U56A 4QOJA 4A26A 4KLAA 2HTFA 2PE5A 1AGRA 3QV2A 1HG0A 3KUKA 2PG3A 4HDNA 2E89A 4RKFA 2BBOA 3PG5A 3VJMA 4Y6RA 4XYMA 2GPYA 4GMFA 2WMOB 2Y1LA 3DEAA 2V8OA 4OYYA 4UM5A 1R15A 3OPYI 1VYUA 2QUIA 1G7SA 2Q0XA 4NEGA 4BB5A 4HGPA 2EBWA 4KUHA 4HGZA 3HR8A 1OLUA 3JAWB 4N7MA 1TJYA 4R16A 4FCCA 3I9MA 3UA3A 3TZ6A 3AZPA 1AS3A 3EDOA 3H5IA 4Y67A 1JKIA 1EINA 2I66A 4XVQA 4ND8B 4BX9A 3LC0A 2L17A 4LNAA 4AMUA 1RCUA 2I6SA 1MIHA 1VLJA 1Z7GA 4HQNA 1COWD 4DPLA 5EIFA 2L2QA 1SVNA 4P3YA 2GEVA 5DIZA 4RMHA 1ZR4A 1Z6YA 4MAFA 3PUVA 1QYVA 1O2DA 3LRPA 3JAKA 5B7GA 2VH5R 3U7GA 4B6EA 3L7LA 1XHFA 1U2DC 3CC8A 4MV3A 3GJ3A 2WJVA 2A84A 5A4MS 1QVAA 5EP2A 5BSEA 4F12A 1HEIA 3RUFA 4OY3A 1DIOB 1G3IA 2EZ8A 1UK8A 1Z8NA 1Y9AA 4NV0A 5K0LA 2YC2C 2ROQA 1CZRA 5IXYA 4GQBA 1SHLA 1SVWA 1LTHR 4JJFA 3EPPA 1Q2XA 3JZAA 4JITA