3C8MA

Crystal structure of homoserine dehydrogenase from thermoplasma volcanium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
324
Chain Sequence
MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILQDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Homoserine dehydrogenase
publication title X-ray crystal structure of homoserine dehydrogenase from Thermoplasma volcanium.
rcsb
source organism Thermoplasma volcanium gss1
total genus 114
structure length 324
sequence length 325
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3c8mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c8mA01
4LVCA 1EUZA 1C1DB 1E7YA 1SCUA 4B79A 3NT5A 4Z9XA 4Y6RA 3TZ6A 3TF5A 5BSGA 2V65A 1GQ2A 1RWBA 1HDOA 3DHNA 4XDZA 4B4VA 4BO9A 3F4BA 1AE1A 2BFOA 4P22A 3B6ZA 3QE3A 5BT9A 3VVCA 2RH4A 4HP8A 1QKIA 2J6IA 1ENPA 4XQEA 1SOWA 5IG2A 3V1TC 3BZUA 4BGUA 1E3WB 1YE3A 5JCJD 1A5ZA 2WWRA 4YA6A 4EBFA 1ARZA 4LVUA 2GN4A 3W8DA 1X0VA 2DU8A 1LQTA 3TDKA 1D3AA 4DLAA 2B5VA 2EG9A 4BIIA 2ZB4A 4PG7A 1I30A 2WMDA 3RUFA 3OIDA 4R41A 2B4QA 3PDJA 1U3VA 4TVOA 3I6IA 2PKQO 3GUYA 1E1LA 1QMGA 3DZIA 1YONA 1BG6A 4PN3A 3K96A 1EVIA 3RFXA 4GBJA 3WGQA 1XIVA 3O03A 3ZWOA 3LU1A 3C8MA 4XEHA 2A9FA 2XOXA 3WBBA 3JD3A 3DFUA 3QY9A 1ZKMA 4UREA 3V2HA 4QECA 4U7WA 3LC1O 1M75A 4M87A 4TRRA 4KTTE 4RPJA 4IZHA 1I3LA 2WD8A 2ZCUA 3ETDA 3P19A 4AJLA 3VAZA 3ASVA 2W2KA 3OMLA 4K1LA 2NWQA 4R3NA 2VRCD 1GY8A 2OBNA 1N7GA 3ZDFA 1E1KA 3OA2A 3H9GA 1H9BA 3DMTC 4OOEA 4ND3A 1B15A 4R54A 2Z5LA 3AI2A 3PTZA 3IC5A 4MDHA 5BQFA 3ZV4A 1NP3A 4BKRA 1B16A 1E6WA 2O2YA 3I5MA 5EPOA 4E6PA 4OH1A 2GZ1A 3FD8A 4F3YA 5CDSA 1MC4A 4KUEA 2PFGA 1HE3A 4W4TA 2BF7A 3IL2A 2NU6A 3B1JA 1I10A 3FNGA 3RIHA 3TZQA 3K9QO 3JQAD 2X1HA 3NX4A 2X22A 4ZA2A 3GPDG 3DWFA 1VL0A 4OMUA 3GDOA 5JBIA 5CG2A 4U6SA 5JFOA 3QV1A 1ZIDA 1ZZEA 1E3IA 5TNXA 4RVGA 1P0CA 5TLSA 1O6ZA 3SBOA 5KJFA 3U62A 2CF5A 2JHGA 4MP8A 2G0TA 3IIEA 2WEKA 4RVDA 1NASA 5JW6A 3DBLB 4CM4B 4J6FA 1QG6A 2HDHA 4N5NA 2FP4A 2B37A 3SC4A 5EIOA 4PG5A 2BGLA 3VH3A 4AJEA 5C7LO 2AEJA 2QYSA 2NADA 2OUIA 3C24A 2WYUA 3PJDA 4P8RA 3BMOA 3MJ4A 5T6BA 4DQXA 4GQAA 5EINA 1GPDG 4WE3A 4NQZA 1HZZA 3ZHXA 3WLFA 5JAQA 3ZV6A 3U4DA 2YDXA 5A5EA 3AFMA 3MWDB 5KJCA 1DFHA 3CMCO 1WLYA 2BELA 1KVTA 3G17A 3N74A 4Q3NA 2FPGA 4OXKA 4XGNA 2HCTA 3WMXA 3ZWAA 2FOIA 4TVBA 4CR8A 2FWMX 2DPHA 3GVCA 4YACA 2D5CA 4WLNA 3JD2A 3NTQA 4JBGA 3DMTA 2Q1UA 3Q9NA 3PZRA 3IUPA 1VJ1A 4ZQGA 5IZCA 4EEZA 3S8MA 4UEOA 1MG5A 5CFZA 2Q22A 2PGDA 4RPLA 4IQ8A 1K3TA 4ZN6A 1LI4A 1KEVA 4AJNA 3HN2A 1O8CA 4FBGA 4R1NA 3VC7A 1HDCA 2Q2QA 3LLVA 4CV0A 5JMWA 3D0OA 5CEFA 4MIOA 3AY3A 5A1TA 1HZJA 1X1TA 3EVNA 3RAJA 1EBFA 1KY5A 1WDMA 4HFRA 2NU9A 2BGMA 5L4SA 1R4MA 1D8AA 1P1FA 1HLDA 4GKBA 3CTMA 4M86A 1V3TA 4CLHA 4E5YA 4AL4A 3ZWXA 5KTKA 4BNZA 9LDTA 3WGIA 2B4RO 3GDGA 4J91A 3FWZA 3ZV5A 4AJ4A 1CF2O 4S3MA 2BI7A 2ZTVA 4YQZA 3S55A 1VJ0A 1H5QA 4YAGA 2BFAA 2DKNA 4MVJI 1VC2A 3HADA 4WLOA 1EQ2A 4FD3A 2BD0A 4NDNE 2P5YA 2X86A 3VPXA 1LNQA 3M2TA 4MO2A 2Q45A 1EVYA 3E6AA 3F1KA 2PGJA 2O50A 5L95A 1ISMA 4K9DA 1PZHA 1Q0LA 1M6HA 3TPCA 1BTOA 1P45A 5TT0A 2AQKA 4EDFA 2Z95A 1DIGA 3KSUA 4MINA 2AEFA 3FBTA 3K2EA 4UUNA 4GLLA 3BMNB 3F47A 1MP0A 1VL6A 2JAPA 2JJYA 3F4LA 1LDEA 3TOZA 1LSSA 1KBZA 1ML3A 1M6WA 4BNTA 4OJNA 3R3JA 4AJOA 4N5LA 3BMOB 1LDNA 3RCBA 4ZD6A 3IKTA 3MCVA 1DSSG 2PH3A 4GSLA 2OOSA 1O89A 3GFGA 3WQSB 3ADPA 3H5NA 2V6BA 3OBBA 2Y68A 3LT0A 4R69A 3GGPA 3TZHA 1MUUA 5JC8A 2FSSA 1DJQA 2D8AA 1NVMB 4J4BA 4PLCA 5HRUA 4XIYA 4E13A 2OP0A 2TMGA 4DTIA 3H2ZA 5F21A 3L6EA 2O3TA 2H1SA 4KMSA 4PZCA 1R4NA 5TQVA 4DLLA 5JCXA 5BNFA 2AE2A 4RF2A 4B3IA 4LSMA 1ZFNA 1RM5A 3HFSA 3OHSX 5LDGA 3E18A 4W7IA 2CF6A 4W82A 1H2BA 1XHLA 3WMWA 3V5NA 3DZGA 5HA5A 2WE8A 3ADOA 1EBUA 3U0BA 1G0NA 3R0IA 3BHMA 1BVUA 1IZ9A 1W8DA 4HWKA 2Q4EA 4CMJA 2ZYGA 1H6AA 5ICSA 1H0KA 3INTA 3DTTA 4BNIA 3G3EA 3Q2KA 1J6UA 1PZEA 4CM9A 1DHRA 3INRA 1UAGA 3U49A 2PD6A 3PVZA 3H9UA 2W2LD 3JYPA 1R4MB 2QYTA 3L77A 1C1XA 1HEUA 1TT7A 5HWSA 3S2FA 4X54A 3IQDB 2I3AA 1YDWA 2X58A 3OH8A 1W6UA 3MOGA 3ONFA 5DCUA 1U7TA 1DFIA 1DIAA 4BMNA 3C85A 3PQDA 4NH4A 1UXKA 5F3RA 1N9GA 1VKNA 1PGJA 1P9LA 3GDFA 1GQYA 5THQA 5JO0A 1B3BA 5BNIA 2PTGA 4PIVA 3L6OO 4DUPA 3CPSA 1DRWA 4R5MA 3DZJA 4Z0PA 1VRWA 1BVRA 3ZW9A 1RYEA 4Y98A 3RBZA 5H81A 2WE7A 5AXAA 4BO2A 2EHDA 1D4FA 1Q0HA 1JVBA 3CH6A 4ZQEA 1JQBA 3RASA 2VOJA 1TB4A 3DTYA 3ZHBA 4J9VA 1PWXA 3D1LA 1T24A 1FDTA 4Q3DA 1G1AA 3UFXA 3E5MA 4UULA 4E2XA 2XAAA 5JNLA 2Q1WA 1NR1A 1NHGA 4EEXA 4YVFA 4WCFC 4CODB 3UUWA 3R6DA 4GX2A 5L9AA 3HSKA 1BSVA 4MVJM 5KCZA 3RSHA 2B36A 3C7CB 2VHXA 3HZZA 4A7PA 2A94A 1ZSVA 2VYNA 1K5HA 3RWBA 5KNLA 4WNIA 1Z45A 1JDJA 3IJRA 4A73A 1YB1A 3CSDA 4WNCA 2PNFA 4PLHA 2E37A 5L51A 3L4BC 3OJOA 4J43A 1YB4A 1M67A 3H7AA 2O3SA 1KYQA 3PHJA 1QLHA 3GK3A 2X0RA 2P9CA 1GZ4A 2B83A 1CRWG 3OP4A 3GMSA 4XZ3A 4XJTA 5IJZA 3PYLA 1ISIA 3AI3A 3IS3A 3PLNA 1E3JA 4PFJA 1GDHA 4EUHA 1MV8A 3H5AA 2PKQP 3KYDA 4NG5A 3A14A 4CUZA 3JD4A 4HNGA 3PHIA 2Q2WA 4EZBA 5FI3A 5G0WA 1FK8A 3KSZO 4YAEA 2PZJA 5ICMA 2GSDA 1Q7BA 1FJHA 1QSGA 1ENZA 3CKYA 1ZW1A 3SLKA 1XKQA 3JD1A 1JAXA 4DREA 3QQPA 4D7AA 2EWMA 1LEHA 2VUUA 1YBAA 4E3ZA 3PZBA 1I3NA 1KEPA 2P2SA 3DQPA 5LCXA 3KLMX 5G0SA 2BMAA 2C2XA 2CSUA 3UCXA 4UVGA 2A35A 3ETGA 5CP8A 5KVQA 3STHA 3WWYA 2CUKA 4R4JA 2VYVD 1LX6A 4A0SA 2FRDA 2UAGA 2RCYA 4XX0A 4BGIA 3A4VA 1U4SA 1E3EA 4M1QA 3NTOA 1VSUA 1U7HA 4YAIA 3OIGA 1T26A 3W6UA 4M49A 2VT2A 1C1XB 1PJQA 3DEYX 1HDZA 1SEPA 1I5RA 4BKUA 1OBFO 2NQTA 4WLEA 4XKJA 5A4DA 4FJ1A 3L4BA 3WG9A 4G2NA 3NUGA 1NXQA 3CINA 1N9GB 1X0XA 4WECA 2Q99A 5CDUA 1NAIA 4XQCA 1NQAO 2P9GA 1PGNA 1U4OA 4HXYA 4NBUA 1XQ6A 3TL3A 3FRJA 2DBVO 2ZK7A 3HDYA 2ET6A 2FMUA 5TS3A 1HLPA 1LC3A 2ZQZA 2G5CA 4D46A 2DAPA 1DRVA 4R16A 4D3FA 4IDFA 5JDCA 3GAZA 4CV2A 1CIVA 1YS4A 4PRKA 4DWVA 1GPJA 1MB4A 1RYDA 2X5KO 3D7LA 5FEUA 1GEEA 5TRTA 1LBEA 5GZ6A 5ER9A 3P5SA 1LUAA 1ZK1A 4UEKA 4ALMA 2Y0CA 4CM7A 1XYGA 3WGTA 4Y67A 4H3VA 1PZFA 4QO8A 1X1EA 2IEBA 3I83A 1NQ5A 3KSDO 2O3UA 3VTZA 2CY0A 2Y93A 4BQPA 4GKVA 5A5FA 4CQMD 3LLSA 5BNTA 1GYPA 4IPTA 2E49A 2C5AA 4L4XA 5C7OO 3SC6A 4E2WA 8LDHA 2P91A 4GL4A 2JD2A 4NHEA 3GHHA 3RVDA 2Y0EA 1EUCA 2O2SA 5JC1A 4N18A 2B35A 5TSDA 1V3UA 2OZPA 3AUAA 1ULSA 3W4IA 2J8ZA 1LSOA 1U2GA 4J2OA 1X7HA 5ENVA 4AFNA 2R6JA 3PIDA 1DAOA 1GR0A 4LISA 1QV6A 1DB3A 1VJTA 1H9AA 3F3SA 3KYDB 1C0LA 1LDGA 1Z73A 1E3WA 1MXFA 5ENDA 3H2SA 3PGJA 5ITWA 5K6AC 2RHRA 4HFMA 5CEJA 5TGDA 4G81A 5KKAA 1MA0A 1GV1A 5C3MA 4ZU3A 4ND4A 4MIYA 1S7CA 1IY8A 4TMFA 5CDYA 4NZ9A 1Z82A 2PD3A 4JJGA 1QRRA 3WYCA 4AJPA 5I9MA 3SEFA 1K89A 3DO5A 3DC2A 2I67A 4ZQFA 4U5QA 1EDOA 2ZB8A 2YFQA 4MJLA 3D3WA 4URFA 4WK6A 2O3RA 2VHYA 4E5KA 1GQQA 1L1FA 3ITDA 5TJHA 3RUAA 1GYQA 1NQOA 1LSUA 4OQYA 1J49A 2VZ9A 1G6KA 3WWZA 2YHUA 4H15A 4F6CA 3AOEA 4FFOA 5COBA 1UH5A 5CPFA 2OBYA 2UUPA 3IJPA 1ADFA 3NGXA 3W4JA 4WCFB 1Y7TA 3JQBC 4ZVVA 2QIOA 2JFHA 5IN4A 1UP4A 2Q3EA 5TIIA 4CMGA 5ADHA 1UDAA 2BGKA 2P68A 4OKNA 3OQ6A 3TFOA 3ZCXA 4PZEA 4RZHA 3ZNNA 4IXWA 2DUUA 3PK0A 3QSGA 3SVTA 3WOHA 6ADHA 1SZJG 5JY6A 3ZWWA 3RJ5A 4IJUA 1E7WA 1HDYA 1RM4A 2RAFA 3IKVA 2VZ0A 5KVSA 1XEAA 1PTJA 2EERA 4RLHA 3GHYA 4RJTA 2VCYA 4CV1A 2RIRA 1A72A 3BHIA 1N2SA 4MVJA 4P38A 4C7JA 4QO7A 2C0CA 3GT0A 1OC4A 3W6ZA 3NT2A 5JXWA 5HM8A 3Q11A 4BNVA 3GZNA 3BTSA 2FSVA 4A03A 1DIBA 3E5RA 1EVZA 3F46A 1YJ8A 4YEDA 5U1PA 3WB9A 1NM5A 3I6QA 1R0KA 3PEFA 4FR5A 2DM6A 1DJNA 5EQDA 4NBWA 4ZICA 4L74A 4XYGA 3NDRA 1Y81A 4XB2A 3GEMA 5EL0A 1BHSA 4PLPA 2OFPA 1FF9A 2CNBA 2FPIA 3ZNQA 4GAEA 3QW2A 1YGYA 2OP1A 2CDCA 3RKRA 1I33A 1ENYA 2AW5A 4BKPA 4YRBA 4UUPA 4I5FA 3NGLA 4DXHA 3D4NA 2H63A 1NFQA 2VTDA 4CM4A 4J1SA 2NACA 3BHJA 4XGIA 2O3QA 4AICA 4PLGA 4A26A 3PQEA 2VHVA 1PU2A 4I5EA 1A9YA 1CERA 3I4FA 1PJCA 3JQBA 2OXIA 4CM3A 1LA2A 1ZBQA 4E5MA 5HS6A 3JQ7B 3OFSA 4BL5A 1KETA 3NJ8A 4WASA 1KVUA 5L4NA 3VKUA 5KIAA 2EXXA 3JQDA 5CAEA 1PGPA 4RF4A 2JD1A 4YWJA 4GVLA 4J1TA 3L9XA 5JAMA 1UUFA 4ALNA 3JQFC 4JBHA 3RU9A 2AE1A 3PJEA 1GYRA 2JKVA 4QEDA 1I01A 3VZRA 1ORRA 2PA3A 3TOXA 1F14A 1ZMTA 3GPIA 5BSHA 3ENNA 4RDHA 3U4CA 1I2ZA 1T2EA 2PWZA 2ZYAA 4XQGA 4XRGA 2P9EA 4CLXA 1TA4A 3ZWBA 3H9EO 1EFKA 3R1IA 1NYTA 4TRMA 3D3WB 2ZATA 1J4AA 1UJMA 4II2A 1GD1O 4B3JA 4CMCA 7ADHA 2AHRA 1UZLA 3VZSA 1MGOA 3LC2O 4NPCA 2ZJ0A 4ZJUA 1DFGA 3BYZA 4YR9A 3PHLA 3IMFA 3H9JA 3BIOA 2YJZA 5CHEA 1EQUA 4IGFA 4IMPA 2D3TA 4NBVA 3LT4A 1K6JA 5G4KB 4CMHA 3JQEA 6LDHA 1E1MA 1T1SA 3ENKA 3PYMA 1GU7A 3T4XA 1Y6JA 4BNMA 1SPXA 4JK3A 5DCWA 4E4YA 4YAKA 1F0YA 2GDZA 2I9PA 3B20A 3MJVA 2HRBA 1ZH8A 4OOFA 4ROSA 1JAYA 2NU7A 3VPHA 3D5TA 4YDRA 4GMFA 4IDBA 2P4QA 4BNYA 4PLVA 3JCZA 2JL1A 4R1SA 2YDYA 4IXTA 1RPNA 4BNHA 5JO9A 3QRWA 3DONA 1EK6A 4FFRA 3JQFA 1I32A 5CDTA 3GZNB 3AUTA 4J4TA 2NSDA 3A06A 2D5AA 1I2CA 4JCOA 4BB5A 3ROMA 2Y1CA 2Y0DA 1FXSA 1PJ3A 3GR6A 3RC1A 4YJFA 4PG4A 3T4EA 3SJ7A 2GN9A 3ASUA 1C0KA 3RUCA 2GCGA 1E77A 1JWBB 2EW2A 1LLCA 2OO5A 5KJ6A 4LRSB 2DTXA 1HE4A 1H6DA 3P7MA 4UUMA 3JYQA 1NPTO 2H9IA 2C07A 4WUVA 5IF3A 1QYDA 3BMNA 2DT5A 4ITUA 4CMKA 4TKMA 4AJ1A 4RQUA 3O9ZA 4ZHSA 5GY7A 2W98A 2VNSA 5F1KA 4QX6A 2HMTA 2BFPA 5L7YA 3ZWVA 1ADBA 3UH1A 4CMIA 3U5TA 1YKFA 1ENOA 4F46A 2NM0A 4J7XA 4FPXA 2HMVA 1E3SA 1Y5RA 4Z0TA 4BO4A 4DLBA 2GNAA 3ZN2A 1F12A 2JCYA 5AYVA 4ILKA 5T5QA 4OQZA 1R15A 3LK7A 1NX6A 4KOAA 3B70A 1E3LA 1AHHA 1SC6A 1XLTA 2X7HA 3WFIA 3QVWA 4B4WA 3I9OA 4NNJA 1VKOA 3GGOA 4IDEA 5MGBA 1ZCJA 2I76A 4E31A 1OI7A 1RM0A 5AOVA 2NVBA 3RI3A 4CR7A 2QHXA 1U3WA 1B2LA 1O9BA 4XR4A 3HNPA 1EEHA 3QVXA 2XPCA 3EZLA 5TX7A 2DTDA 4XYLA 3H3JA 4AJHA 4G65A 2PY6A 4NMHA 3ZW8A 4U8GA 2G17A 3H4VA 4R1TA 2F1KA 5IDXA 1BMDA 2I66A 3GOHA 4BNLA 1YB5A 1PJTA 3HWRA 4HADA 4WLFA 4RGBA 4YRDA 2LDBA 5L4LA 4HKTA 4FFPA 4I1IA 1F06A 1H6CA 4CMBA 3LDHA 1H2HA 2HAEA 3PYXA 2JCVA 1YL6A 2JFGA 1U3UA 5KVVA 2J3KA 3CIFA 1ADGA 3I1JA 4EYEA 1ZJZA 1PJLA 2WM3A 4GGPA 4J0FA 3NV9A 3DBVO 1YOVA 3ZZNA 4ALKA 3K8ZA 2DBRA 4I5GA 2DFVA 4R01A 5F5LA 3AU9A 3R3SA 2UUOA 3PFFA 1ISHA 4J1QA 3SJUA 5IAAA 1A4UA 1X14A 4DPKA 4FFLA 3DBRA 3JYLA 5I8WA 3HN7A 2HK8A 2TMDA 3RROA 2BI8A 2JCXA 1B8UA 1UXIA 5KOIA 1ZNQO 1HDGO 2J5KA 3C3XA 3DBHA 4ZQBA 4J90A 4OAQA 3C7AA 1WWKA 4P4LA 5DULA 1YVEI 1MXHA 4XWYA 4R5HA 3WQQA 1XWFA 1XR3A 2AEMA 4CM1A 3LT2A 1FDSA 3JV7A 2X9GA 5A9TA 4CUKA 5A3JA 4IJWA 3HE3A 4Q39A 2QX7A 5EESA 3NYWA 4H7PA 3MOIA 3WJAA 1P1HA 2P5UA 2PH5A 3MJCA 1AXGA 3LC7O 1UXHA 4D79A 4RLSA 2GR9A 2NVWA 1KS9A 2H5LA 4YJFB 3OM9A 4M89A 4A27A 4RQTA 5DOVA 5I9LA 3C7DB 3DXFA 4QXMA 3ZU5A 4YYZA 3GN2A 3PPIA 3GGGA 2OL4A 4RF5A 3UHAA 2B0JA 1TT5B 4K6CA 5C5IA 2HSDA 3H65A 1VPDA 5B4UA 1E7RA 5JS6A 3GMDA 2D59A 3K31A 5G0UA 1Q7CA 4GX5A 1DC5A 1T2AA 2B4TO 2YYYA 2EEZA 2GERA 5T67A 5T8KC 3WNQA 4U0JA 2X6TA 1WDKA 3E8XA 4FJ2A 4YXFA 1A7AA 4CM8A 1T4BA 4CMIB 2JFFA 2ZB7A 1I2BA 1QV7A 2GPTA 1P44A 4D41A 4XRRA 4WPGA 2O48X 3JQAB 4TSKA 1AXEA 1BXZA 3G49A 3OEYA 5H83A 4RL6A 3A9WA 3H9QA 1E7MA 4C4OA 1H93A 1VLLA 3GNSA 3N58A 1GAEO 3WBFA 3IP1A 4J7CA 4AJ2A 4CL8A 4RO0A 7MDHA 4OM8A 3HQ4O 3ZNOA 2C54A 4BGEA 3TFQA 2VHZA 4HUJA 3GEDA 5A05A 4N5MA 2O7SA 4DMLA 4BB6A 1XU9A 4MIEA 1HYGA 4DQUA 4EJ0A 4EITA 4E5NA 2J5QA 1ONNA 1CWUA 1BDMA 5BSFA 2EP5A 4QFDA 2EP7A 1PIWA 1YBVA 4N7RA 1AUPA 1GUFA 1DC3A 3DOJA 1HF3A 3GG2A 4E12A 4GGOA 2ZKLA 4CLEA 1Y8RA 3E9MA 3FBGA 3O4RA 4EUEA 1YOVB 3DFZA 4E0BA 4HV4A 3UF0A 3BMQA 3LT1A 4PLWA 3QJ5A 1LQUA 5T8KA 2HMSA 1WW8A 3DBRB 3SX2A 3KUXA 1A27A 3RC7A 1B8VA 3PWZA 3EMKA 4KQWA 5U4QA 4IS3A 3LVFO 1LLUA 4YAJA 1ZXBA 2YHIB 3DBHB 3IDSA 1C0PA 3JQ6A 4NU6A 1DBVO 5IXYA 4PZDA 5KKCA 2I65A 3BA1A 4FQ8A 4OL9A 4CLRB 3M2PA 1WDLA 2GUGA 3KEQA 3TL2A 3QVOA 1E0DA 3WQRA 4PLTA 1B7GO 3GVIA 1UR5A 1NVGA 5DT9A 5IDWA 1PZGA 1NWHA 4B3HA 2HQ1A 2IZZA 3W1VA 2Z1NA 2C7VA 1YQDA 4EUFA 2HJRA 3FCOA 3ABIA 3UN1A 4ND1A 1M2WA 2VYND 3OQ1A 4JX8A 1LTHR 3NEPX 3JTMA 2C2YA 2X0JA 1HRDA 1I3KA 3I9LA 1Q7GA 4BO6A 3NJ4A 4YPOA 4WOKA 1CQJA 2O3JA 2NTVA 3ST7A 2EF1A 3RBVA 1QYCA 3F6YA 3QWHA 3VVBA 4BNFA 3WSVA 5KWEA 3PI7A 2PZKA 3MJEA 4TRNA 3TZKA 2I5PO 4PG8A 1I24A 3PDUA 4O59O 1ZUD1 3K73O 3GLQA 4DBVO 1ZEMA 4CM8B 3RQSA 4F6LA 1XDWA 3QIVA 1LDMA 1DO8A 4J4HA 4DC1A 2BFMA 1JWAB 5ES3A 4KDEA 1Q0QA 3QLJA 2IYPA 4E30A 1N92A 4PCVA 4TZKA 2J3IA 8ADHA 1GADO 1AN9A 3P2OA 3WGGA 1E5LA 2X5OA 3MJSA 3AK4A 4BMSA 1IOLA 3RD5A 2FZEA 3RBXA 4IMRA 3V8BA 5L53A 4RVHA 1KEUA 2DBQA 4BO5A 4BNJA 1IHXA 3TQHA 4O1MA 4RZIA 5MDHA 3JQ9C 4GX0A 1DIHA 2QRJA 1GUZA 5T57A 3EAGA 3W8FA 3VTFA 1CEQA 4D43A 4BQRA 4ZGWA 3ZWMA 4XR9A 5COAA 5HTOA 3AI1A 4BOYA 2CDBA 3T7EA 1LDBA 3OQBA 2CVQA 2DC1A 4FC7A 1U8XX 4FIZA 1XU7A 5DNAA 4JXKA 4CV3A 3CZMA 1VM6A 2WYWA 1NTOA 4B8ZA 3E9NA 4WCFA 5G4LA 3AUUA 2HK9A 5I7FA 2FR0A 4BNNA 1ZSYA 4J2HA 1XSEA 1GL3A 1Y8RB 3ZU2A 2CZCA 2VWPA 5DOZA 3FNHA 2GGSA 1NAHA 4PG6A 4L76A 5DN9A 4IJKA 3BMQB 3TJRA 2VUTA 1HSOA 5COQA 1U9JA 1JKFA 4KWHA 4XA8A 2EW8A 2D0IA 3FWNA 3HUDA 2ZQYA 3JQGA 3K5PA 3TN7A 5I7EA 4D44A 1EK5A 4YT4A 3WTCA 4L0QA 4MVJF 1ISFA 2GZ3A 4OYRA 3PXXA 4NFSA 2AQHA 4AG3A 1V0JA 2ZYDA 1NFFA 2AMFA 3K30A 1QORA 3C1TA 3VZQA 5KJ1A 2Q1SA 1J5PA 1FDVA 2HO5A 3UKOA 3G0OA 2EKLA 3FR8A 4ESOA 1HKUA 2NVUA 4R3WA 5JDIC 3VPGA 4INAA 3CZRA 3F9IA 3V1UA 3UOGA 3ICCA 3NTRA 2AA3A 5CG1A 5DDIP 2NU8A 3E1KA 4OSOA 2E6UX 2HRZA 3GVPA 4OIMA 3DZFA 1E6UA 3BXXA 1IULA 3QWIA 4IGEA 3W4KA 1YXMA 4YJGA 4DQVA 3B1KA 1LU9A 1YDEA 3LQFA 4CLOA 1LRKA 3AU8A 3PHGA 1ZSNA 2WJPA 4Y9DA 1P0FA 1T2DA 1DC4A 4L8VA 1VL8A 2J3JA 4XYBA 3VH2A 2POQX 4TROA 2CVZA 1WMBA 4Y6PA 3FPCA 2X4GA 4EGFA 1NPDA 3EGOA 5I7VA 4GMGA 2Z1MA 3ICPA 1PQUA 1B14A 3PWKA 3JQ7A 4NI5A 2J3HA 2C7GA 4Y8VA 4XJSA 1JW9B 3WXBA 4J0EA 4BO1A 2PR2A 3EDMA 3PIIA 4II3A 5JMPA 4D3SA 1R6DA 3OA0A 2ZTLA 5DBIA 1PQPA 3ZHYA 3F5SA 1K6IA 4M54A 1MX3A 1Z7EA 3F5QA 5JPIA 1C3VA 3ROQA 3E9QA 3GFBA 1Y5MA 3PJGA 2JD0A 4NK5A 3KLPX 3PWSA 1EUDA 4GWGA 4IJVA 4HNHA 3H8VA 1MFPA 1GCOA 2G76A 4BO0A 3ZWCA 2WDZA 3V2UA 2G82A 1HWYA 3BMCB 4IDCA 2EJVA 2D4AA 2IODA 4JP2A 4OKIA 2ZIZA 5J23A 1HDXA 1Y8QB 2FPPA 3ZU4A 1TLTA 3I9KA 2R00C 4KDFA 1NPYA 2VUSA 3OEWA 4YTEA 1N1EA 4FB5A 3DR3A 4ALIA 5CEEA 1T2FA 1HDRA 4BGVA 2AQ8A 2NV6A 2QW8A 3QP9A 3GVXA 5IDYA 4Z3KA 2X0IA 2X0NA 3DMYA 4MOWA 2AG8A 2P4HX 3HDQA 3OECA 1VI2A 1PL6A 4FCCA 4WLVA 3TNLA 4AVYA 5GMOA 5G4KA 3VKVA 3DOCA 4FFMA 1YQGA 4F45A 3GZ4A 1NQTA 4XGKA 4CMEC 4E33A 1TEHA 1XELA 2Y66A 1XGKA 1A4IA 1Z74A 1LSJA 3FNFA 3RUDA 2J5RA 4MVJD 4IZIA 3JQGB 3LYLA 1T1RA 5T73A 2OORA 1Q1NA 3Q0EA 1PX0A 1O95A 1BXGB 4Y6SA 4D0SA 2X23A 3BAZA 1WXDA 3S2IA 4B7CA 1ADCA 1DAPA 2YFHA 5H82A 4PRLA 5K6AA 4Z9FA 2DFDA 3F1LA 2YV1A 3CUKA 2DBZA 2DLDA 4TQGA 1O94A 1KVRA 3WIDA 4FFNA 2NVUB 3GUCA 1G0OA 4XD2A 2D1YA 1YO6A 5I8ZA 2PK3A 3UCFA 2V6GA 3K2BA 3OJLA 4JJFA 4O63O 4FSHA 4LW8A 4YJGB 4CPDA 5K0ZA 3BTVA 3GY0A 4CLOB 3JQ8B 2QQ5A 3PRJA 5G0TA 2QG4A 1WAMA 2CFCA 4OSPA 5HS4A 2Q50A 4RVFA 1P33A 4Q3EA 4XQ9A 5G2OA 1WNTA 1NBOA 1N1GA 1CQIA 1IL0A 1CETA 4BKOA 4LCJA 4IIUA 3PP8A 3KM0A 2SCUA 4O5OA 1ZEJA 4IS2A 2ZB3A 1LXCA 1QYWA 4BVAA 1JTVA 1U3TA 3OSUA 3LZ6A 3TWOA 1IE3A 3G79A 2XF8A 5T64A 4DIOA 4CM5A 1IUKA 3GEGA 1W4ZA 3MTGA 1OFGA 2I6TA 3Q3CA 5A9SA 4LMRA 4BV9A 3S2GA 4CQMB 3U4HA 3VHRA 3EZYA 3I52A 2HLPA 4MPDA 2W4QA 4K26A 5G0VA 5A06A 4E2ZA 1F8FA 1MLDA 4JQCA 5EQFA 4BKQA 4RF3A 2Y1FA 3PQFA 3UGKA 3MZ0A 2FR1A 4JN6B 1QLJA 1MC5A 1UXJA 2VN8A 4LK3A 4A10A 1MFZA 2X9VA 3ANNA 1I36A 3M6IA 4LN1A 3W8EA 1DRUA 4B8WA 2UYYA 1GFSA 3QWFA 3WYBA 5JCJA 4NFYA 1UDCA 1WPQA 2XXBA 3DAFA 3KYCB 1I8TA 1GZ3A 2HJSA 3I4CA 5JAIA 4DPMA 1TVEA 2RH8A 1EDZA 1JU9A 3KXDA 5DCYA 3VDRA 4PLYA 3AY6A 3UXYA 1SBYA 4IQGA 2JAHA 2YW9A 3GNQA 1ONOA 1HXHA 4KP7A 5EERA 4CM6A 1PJ4A 4E5PA 3I23A 1TI7A 2NLOA 1KIFA 1P1JA 3GF4A 1IB6A 1P3DA 4MKZA 4NJMB 3VPFA 4BV8A 1UDBA 4WKGA 2H6EA 2BKAA 1C14A 1DLJA 3IAHA 2HMWA 1PS8A 2YZ7A 3S2EA 3WIEA 4BO7A 2CDAA 1PJBA 3HB4X 3I9JA 3EW7A 3PHHA 4I8XA 5ILGA 1JLLA 3DDNA 4BNKA 4D45A 4BHTA 4O0LA 1LLQA 5L40A 1WZIA 2VRCA 1EE9A 5IZCC 9LDBA 2HU2A 3I3OA 5B37A 4NK4A 4FN4A 1DLIA 1TT5A 4UAGA 5J9GA 1L7DA 4ZRMA 1BDBA 4MVJH 5ITVA 4PVCA 4YRAA 1W0CA 4UVDA 3ZNPA 1ZJYA 1RKXA 5A04A 3NT4A 1B26A 3ZH2A 1Z6ZA 3WLEA 3D4OA 3M1AA 4BO3A 4DIBA 1Y9AA 4UVEA 1PL8A 3ANLA 1QP8A 4PGFA 1S6YA 3RC2A 1BRMA 2YV2A 4HFJA 3FN4A 3JQAA 2E4AA 4L73A 3Q6IA 5KJEA 4XB1A 2B69A 1H94A 3JD0A 3DHYA 3ONEA 1V6AA 4TKLA 4CL3A 2ZCVA 3X2EA 3UVEA 1TXGA 1GZ6A 5JSFA 1EFLA 2IEDA 1PGQA 1RJWA 3FR7A 1WMAA 1I0ZA 5HBRA 1W73A 4B7XA 5A9SB 5AXBA 2FY8A 1ZK4A 1K2WA 1R37A 5F5NA 3WSWA 1VSVA 4IDDA 4GVXA 4A5OA 4ALJA 3EK2A 3BTUA 1A9ZA 1U2DA 1YBMA 2V7PA 4L9RA 4A2CA 3WGZA 5A9RA 2C5EA 3ONDA 5EMHA 5IDQA 2VRBA 4R9RA 1HYHA 1EE2A 2X5JO 2R2GA 4D42A 1Z75A 1PEDA 2YQ4A 2I99A 3PLRA 5DBFA 3WYEA 4UVHA 1CJCA 1N5DA 3KO8A 1M66A 3ULKA 5U9CA 3INGA 2NTNA 5I7SA 1GEGA 3ZWYA 5FYDA 2VQ3A 2A92A 1ZVMA 4Q3AA 1X7DA 1P1KA 2CD9A 1X15A 4IM7A 5LDHA 1IPEA 3X2FA 3E48A 2D2IA 3KHUA 4DVJA 1NVTA 4HX5A 2GO1A 2E82A 1U1IA 3AFNA 2FN7A 2WSBA 1HE2A 2VTEA 4W9NC 1CDOA 1ZK0A 1Q2XA 3SXPA 2EGGA 1ZK3A 4B4UA 4JGBA 4W7HA 1T25A 1P1RA 1OC2A 4YT2A 1O5IA 4RV9A 4Z6KA 2IXAA 3QVTA 4MKRA 4IQ0A 1SOVA 2Q2VA 4CLDA 1IYZA 5B1YA 3SLGA 1PWZA 2IYOA 2YHIA 2IZ0A 3WGOA 3OIFA 3VOSA 4WJZA 3GH3A 1SO8A 4YCAA 4CLRA 3WR5A 3FHLA 1E6EA 2QRKA 1OOEA 3KOUA 1SMKA 3KYBA 4AJKA 1J0XO 1ONPA 3HG7A 2Y1DA 3RJ9A 3WGHA 2W2KB 3UCEA 1BGVA 5I9NA 4TRJA 3EY4A 2AQIA 4R1UA 3LSYA 4QQRA 3D64A 4YJHA 3MWEB 5IN5A 4Z0HO 5A02A 2GN8A 2UDPA 3AWDA 4ALLA 1JKJA 1R0SA 1A7KA 3GC6A 4D3DA 1JN0A 1HETA 4FOSA 4IBOA 4TWRA 5TF4A 3OF2A 5AXDA 2F00A 3IUSA 3I9MA 1UZNA 1DOHA 4KUHA 2Q46A 1WZEA 1SAYA 4GLOA 2RBEA 4DL9A 3OICA 1PQWA 4QT0A 2RHCA 1P74A 4M8SA 2HK7A 1PL7A 4P4NA 4U6QA 2VHWA 4EI2A 1NWCA 1PR9A 3NKLA 2QZ9A 3VH4A 1E5QA 1H6BA 1KVSA 4KZPA 4GWKA 4OO3A 4WGGA 3RFVA 4W9NA 5B4VA 2Y05A 2LDXA 1AGNA 3QA9A 5CPBA 3ZHZA 3GNTA 3U9LA 2C20A 1YL7A 1ZXLA 4OHUA 4J9UE 4OGWA 3GRKA 3UW3A 2HUNA 2Y67A 3ZU3A 1UP7A 5JY1A 4WLUA 1N7HA 5JYAA 1B8PA 2BH9A 4JJIA 5IXSA 2GN6A 4I9NA 4ONEA 1WP4A 4UEJA 5AQ1A 5CDGA 4S1VA 2VOEA 1PSDA 5L7WA 4IY1A 4BNGA 1KVQA 2IDZA 4MVJP 3H3FA 3WICA 3KTDA 2BLLA 3AM3A 4CM9D 5IFLA 2GYYA 4IDAA 5AVOA 1EVJA 1UAYA 1KOLA 3GN1A 1GUYA 4ID9A 3AOGA 4Q3CA 4NU5A 5JE8A 5L3ZA 3KETA 1V35A 4DGSA 3BTOA 3QWBA 3A1NA 3DZHA 4GX1A 3ZI0A 4NR0A 4IDGA 4DIFA 3DZKA 4I9HA 2PV7A 3KRTA 3K92A 1HSZA 3DHEA 1U5CA 4IINA 4I08A 3RC9A 1E92A 1L7EA 3ON5A 2AXQA 2ILTA 1EZ4A 3FTNA 4UUOA 4M55A 4W99A 3HDHA 1F8GA 1XA0A 2OMEA 2Y1EA 3FF4A 3WGYA 2A4KA 2GRAA 5EN4A 3GQVA 2BHLA 4GI2A 2C82A 5B4TA 1IHYA 5IZ4A 1EMDA 3EHEA 5BSEA 4JROA 4O6VA 3KBOA 4JIGA 5JLAA 3RKUA 3HDJA 1ISJA 4Z9YA 1R66A 4CJXA 3VDQA 4ND5A 3AUSA 1U8FO 2CMDA 3A28A 2W8ZA 3Q2IA 4LGVA 1NR7A 1K0UA 1T2CA 2PZMA 2W2LA 2X8LA 2Y99A 3DL2A 4Q9NA 4YJHB 1SEVA 4NBRA 4NFHA 4YB8A 3C1OA 1T4DA 4LCEA 2DUWA 3AM4A 3H5RA 4CMAA 4MVJG 1U28A 1P1IA 1D1SA 3MJTA 4BMVA 3EYWA 4HBGA 3PJFA 4E32A 1FMCA 4J1NA 3ZWPA 4DPLA 4RVSA 3VPSA 2C59A 4HFNA 1LJ8A 3ITKA 3T7CA 2CVOA 1YH3A 3KEOA 1P31A 3WTBA 3FTPA 4MP3A 2EKQA 3LF1A 3DOOA 1ID1A 3WJ7A 2IXBA 4FGSA 4J3FA 4Z3DA 3RUIA 1KY4A 5FWNA 1YQXA 4DA9A 4WEOA 3ROPA 4BNWA 4E21A 2XXJA 4L4SA 4IUYA 1Z7BA 2GD1O 1ZK2A 2GLXA 4XIJA 1QYVA 1IZ0A 2VWHA 2I3GA 1V9LA 4PLFA 3DAPA 1VE9A 2EV9A 2O23A 3Q9UA 2UVDA 3O38A 3WFJA 3HJAA 4J16A 1SB9A 4LMPA 2WD7A 2E48A 5TJ9A 3AW9A 2DPGA 2ZJ1A 3IOYA 1QXSA 2OHXA 2YUTA 3JSAA 3BMCA 2YY7A 3GAFA 4CQLA 3O26A 3P2YA 5AXCA 1JA9A 3EUWA 1Y8QA 2PGLA 3L07A 5K9ZA 3L6DA 3B1FA 1ZMOA 3TRIA 1E7QA 3KB6A 2EGHA 2C29D 2OGUA 1ULUA 4KWIA 5JDCC 3VZPA 4FOOA 4W6ZA 1QR6A 4GH5A 3L0DA 2Q4BA 1B0AA 4L75A 4QTZA 4EJ6A 4WEQA 5F1PA 1R4NB 5C37A 4YT8A 4XYMA 4IIVA 1BW9A 3PGXA 4MP6A 4YBZA 2GASA 4OXNA 2NUAA 4LSWA 1O0SA 3GG9A 3U4IA 3H6KA 2IZ1A 5BR7A 4QSMA 1R0LA 2O7QA 1V3VA 3U3XA 4CUJA 3OJ0A 1LDYA 4ND2A 5ER6A 3G1UA 1LRLA 5DF1A 3D5QA 4R9SA 2Q1TA 3WS7A 5JYDA 3FNEA 2PZLA 3V1YA 1AHIA 3GA0A 1E1NA 3NAQA 4DRYA 3DB2A 3DZBA 4JBIA 4RORA 2Q49A 3CEAA 4I9UA 3JQCA 3O8QA 1KC1A 4J7UA 1HTBA 3S1LA 4CR6A 3QHAA 3HHPA 1BXGA 1XCBA 5TC4A 4QUKA 1OZAA 5DP2A 2VYVA 4ZQHA 3RUHA 2PD4A 3FI9A 5GZ3A 1Y9EA 2FZWA 2WTBA 2FR8A 3GVHA 4AJJA 4B7UA 2Y1GA 3ETEA 1YWGO 3ROKA 5JYFA 3JQ9A 3L9WA 3RU7A 3UICA 4YJDA 1D7OA 4XYEA 4RVUA 1XG5A 3NDJA 3FPLA 1E7SA 2QZZA 1N8KA 1JKIA 4HY3A 2O4UX 4PLZA 4RDIA 1C0IA 3JQ8A 4DC0A 1NNUA 3KZVA 4R68A 4J49A 2JHFA 4WOJA 1UZMA 2NQ8A 2EJWA 1M76A 3UAGA 4R51A 2EIHA 3RUEA 5L45A 1YJQA 1QYXA 2YQ5A 4BS9A 4ZRNA 3AOEC 1JVSA 2VNAA 1PS9A 5A03A 1YRLA 4FC6A 4K28A 3EC7A 4L4RA 1U5AA 3NRCA 4NJOA 2BRUA 3JYOA 4RPHA 2V6FA 5F1OA 4YQYA 3GRPA 3AY7A 1Y1PA 4BO8A 1DDOA 3ZV3A 2IE0A 2PLAA 3OJFA 5LC1A 1DPGA 3NDIA 1GV0A 4XDYA 4DMMA 4GPD1 1C1DA 3CMMA 1PS0A 4YT5A 4WCDA 1MG0A 4DBZA 3TZCA 3M1LA 1LC0A 1OAAA 4CQMA 3QWAA 4JLWA 1D1TA 4BNUA 1ISGA 4DYDA 2WD7B 3Q1LA 5JAZA 1PGOA 2UV8A 1PJSA 1I3MA 1HYEA 2PKRA 2GF2A 4P4GA 3WNVA 2HMUA 3HFGA 1PR3A 2NNLD 4CQLB 2VWGA 4TZTA 3WDSA 1X7GA 1LRJA 4UVIA 2DQ4A 3C1AA 1K6XA 3DAGA 5JDIA 5L7TA 1DC6A 2FHSA 3CXRA 4FW8A 3ANMA 1DIRA 3OJEA 1DEHA 2B5WA 2EKPA 4FS3A 3V2GA 1KC3A 4BNXA 3KYCA 1CYDA 1F17A 1R16A 1HT0A 1BW9B 3EVTA 5A3VA 1V8BA 1BWSA 1ZO8A 4JNKA 2W90A 2Y1OA 3G1TA 1RM3A 3L4SO 4EJMA 3JYNA 3RFTA 3E03A 2O4CA 4FJ0A 5DBGA 2AG5A 4I5DA 5TT1A 1BXKA 1FDUA 5EJ2A 3KV3O 3LF2A 1UXGA 4C7KA 4DYVA 2GZ2A 1PJ2A 2NTJA 2VWQA 3ORFA 3O8QB 3AM5A 3TSCA 1GCUA 4LRTB 5M6DA 1X13A 4NJMA 5FI5A 2G1UA 3QVSA 1GTMA 3FSRA 4D0RA 4EW6A 4U0KA 3D4PA 4B4OA 2IRWA 3U09A 3IP3A 4KTVE 5DP1A 2YV3A 1OMOA 4FDAA 3ZWNA 1R12A 1A71A 3K6JA 3COSA 4OXYA 2WYVA 5DZSA 1P77A 2DVMA 2QRLA 4KQXA 2DTEA 1YL5A 5FFFA 2HKIA 1KERA 1DHTA 2ZTUA 1WVGA 5GZ1A 1HE5A 4NIMA 1FDWA 4Q3BA 5B12A 1LLDA 4RCVA 1XQ1A 3VH1A 4MKXA 5ILOA 4N54A 3N7UA 2V6MA 3WX0A 4RPGA 3ZGYA 1HL3A 4PVDA 1NFRA 3MEQA 3OETA 4G5HA 3HB5X 1UP6A 4K6FA 2R00A 1KEWA 4BUCA 2X9NA 5C7IO 3AJRA 5THKA 3KVOA 4JP3A 1IPFA 4E2YA 3E82A 4MVJE 2VT3A 1SNYA 4FGWA 4KUGA 4AJIA 3D3EA 2ZTMA 5KVCA 1NHWA 3MTJA 1DXYA 3PFWO 3CE6A 4NBTA 5FF9A 4RPKA 4CMEA 1SB8A 4H16A 2VZ8A 4QFCA 5JYEA 3I9NA 3DBLA 4XCVA 1B3RA 4GSKA
chains in the Genus database with same CATH superfamily
2OO7A 2R5NA 3T34A 1SCUA 4HTAA 4W8OA 3NT5A 5EXPA 1G42A 1Y82A 1YOBA 2FZ5A 2PL3A 2XLBA 3LUPA 2ODBA 3TZ6A 4Y6RA 3DC7A 3SBXA 4UPEA 5BSGA 2GILA 3KVNA 1S0UA 5C2JB 1KYYA 4Y0AA 4BO9A 2D1RA 2YR0A 4WGFA 2KBFA 4FOTA 4MR7B 4RD6A 1NXSA 3JALB 5ARDA 5SYAA 4GXRA 3HCNA 3OLCX 1KI3A 4P2BA 5BT9A 4C88A 1FCJA 4HP8A 2WU4A 2ZRGA 1IZ7A 1XZAA 2J6IA 2WA2A 4LC9A 4YAFA 4BECA 1MC8A 5IG2A 1L3BA 4QYMA 3OESA 2ZWAA 1YE3A 1C2TA 3QG5A 4HAIA 5FTMA 1ZIYA 2Q5QA 1SZDA 1A5ZA 4KBFA 2WTNA 2WWRA 1SUSA 2B5OA 2IIBA 3B9PA 2XADA 5H7XA 4ZK6A 4V0ME 4DUZB 1MVOA 1T3LA 3WLQA 1GCAA 5CNJA 1S3IA 3ACBA 4KMOA 1C41A 2A7QA 4EVQA 2QT1A 4Q93A 2B5VA 4ZCMA 1R1DA 2IYNA 2QU7A 3HB7A 4BWFB 1TM7E 2WMDA 3JWPA 4J76A 5TARA 2YIMA 4ZC8A 1Q1QA 2B4QA 3RUFA 3SSOA 1U3VA 4B80A 4C4YA 4DUGD 1E0AA 5MGNA 4LYJA 2K5UA 4W5TA 4MV4A 1GGNA 1XVLA 4MLPA 3ZD9A 4KREA 4Y3UA 3RLIA 2V7WA 5J59A 1HY3A 4GBJA 3LJKA 1Z16A 3WGQA 1X2EA 3O03A 3NEJA 3C8MA 4HHEA 3W79A 5K2OA 3DFUA 3KQNA 3D6VA 1ZKMA 3NLLA 4OUKX 3TNFA 4DDKA 2AN3A 1X92A 5K0FA 3V2HA 5B57C 2PQ0A 5C31A 2EKBA 2PUEA 3K4PA 2FQWA 3ZY2A 3LC1O 1NLYA 2BHRA 4MGYR 1QHXA 1ZH2A 5AHWA 4HNAB 4M83A 2IXDA 2WD8A 4MV0A 1JIIA 5CFNA 2ZCUA 4TLLB 1U98A 1UM9B 1TO6A 1U7XA 5J5AA 3VAZA 2X19A 3FSGD 3DHWC 4MCHA 4DWOA 1VPVA 5CFRA 1CUSA 1DTWA 5F76A 4J0HA 2ODQA 1G18A 4AW9A 4ZEXA 3ZDFA 3OA2A 1H9BA 4EB6B 3OZCA 3EDOA 1VB3A 4R54A 3Q3EA 2Z5LA 3A27A 3AI2A 2GEFA 3SQOA 1FYDA 3F2IA 3ZV4A 1C0EA 4R1MA 3GLIB 4I55B 4DG8A 4MW4A 4UNNA 5EPOA 3UK7A 4OH1A 1RJEA 3G68A 5CK5A 2ENWA 1O57A 2AV6A 4KUEA 1R9JA 2O1WA 1E20A 4W4TA 5E7JA 2F17A 2W37A 3D8BA 3OFJA 1I10A 4EMTA 1HURA 4QGSA 1A9PA 1F2UB 1K7XB 3JQAD 4OLAA 3NX4A 2OFXA 1CJUC 2FPXA 1KI9A 5IASA 2A9RA 4V02A 5EKTA 3UJDA 1N9KA 4YUAA 1VJRA 5EGSA 1E2PA 1QS0A 3D3JA 5I7UA 5JBIA 4OGKA 4D2IA 1Z12A 3WP0A 3QV1A 2RH5A 3LQQA 1ZIDA 1ZZEA 1XZLA 3GFOA 5HIMA 1VXRA 3KHTA 4HZGA 4H7DA 3RTDA 1J0DA 1U2PA 5IAEA 4DY6A 3SZMA 1G98A 3GD5A 4JLSA 4RTNA 3U62A 2V55B 1S01A 1ADYA 2G0TA 5HCIA 3IIEA 2UZ4A 4RVDA 1NASA 5E9JA 3DBLB 1ZGHA 5B1HA 5IEJA 2OILA 2CK3A 2FEKA 2W6PA 1OE0A 3FVTA 1U7DA 2OV4A 3LP8A 4ZKDA 4BJ1A 5EIOA 2BGLA 1JR3D 2Q7XA 2WWIA 5C7LO 2AEJA 2QYSA 3DKIA 2YW2A 2NADA 2OUIA 2QRVB 2WYUA 3OAAA 2WUVA 4X1IA 1DUSA 3BMOA 1WX1A 3ZHVA 5JROA 3MJ4A 4YAWA 5DIFA 4GQAA 1N0UA 1IAVA 4DQXA 1GPDG 4JQZA 4O4IF 1HZZA 3LXMA 2HTFA 1H3NA 3EDYA 4PTYA 4XE5A 3VRHA 4NENB 3MWDB 5KJCA 3COYA 1T91A 4OXKA 3GROA 3WMXA 5JS8A 4CR8A 2FWMX 4JXJA 2AFIE 4JFRA 4J94A 4JBGA 1I0IA 1HBJA 3PFNA 3I1YA 1XUOA 3AF2A 2OQVA 5ALGA 4POOA 3M82A 1KI1A 2JFOA 1UK7A 3U7JA 3QG1A 1YB6A 5BW6B 1D6NA 3S8MA 1J2JA 1SA0B 5EJFA 4H7FA 4D9JA 1RQNA 2Q22A 2PGDA 2HSZA 1K3TA 4R9UC 4ZN6A 4I4TA 1L5SA 2NNWB 4UHEA 3IAEA 4D8UA 4K8OA 3SC2B 1GSAA 4JH0A 3RNOA 5FNZA 2AK2A 2QTFA 1A8HA 2YX1A 3FY4A 2M6SA 1O8CA 3BK7A 3HN2A 3BB1A 1LY1A 3N2NA 3QPCA 4FBGA 2DPMA 1G66A 3NB0A 4Q9KA 1PKEA 3LLVA 5KHOC 3CF2A 2K87A 4YV7A 4OHYA 3HYSA 4B40A 5A1JA 3AW8A 3D0OA 1CYEA 3C3AA 3L4EA 3AY3A 4MIOA 1VHQA 3AILA 4O4HB 4RVOA 3RTBA 4B5KA 3PKIA 1M9NA 3EVNA 1KIAA 1VLQA 1EBFA 1BCSA 1UBJS 2F3UA 4MROA 1GGHA 1N8TA 3JQRA 2BGMA 5L4SA 3GLTA 2JG3A 1D8AA 2PMDA 1HLDA 2YASA 4NRDA 1Z6TA 4M86A 2M6KA 3ETCA 1KZ7B 1YFLA 4FSDA 2RC6A 4E5YA 4AL4A 2QTNA 2XNSA 2IYFA 1KI7A 2NO4A 3ZWXA 3WGIA 4BNZA 4I7EA 4QVGA 1NYLA 4BP8A 2QUAA 4ZYXA 2JGKA 3OZRA 3R5FA 3CRW1 4U9IS 3ZV5A 2VJPA 3T1TA 3CX6A 4S3MA 2IJGX 2X3UA 3NIFB 2ZTVA 1NBME 3K1TA 4XDGA 4YQZA 1QKKA 3FYTA 2PJUA 4LWOA 5ERXA 3S55A 1VJ0A 3HS3A 2AUTA 4YAGA 2AFHA 1WMFA 4F6RB 2CV2A 1JXQA 1KZ1A 1KI4A 1I1NA 1MO4A 4EO9A 3VX4A 1EQ2A 3V4OA 2BD0A 1TJNA 1FFXA 1XKTA 3KXLA 3R76A 1LNQA 1SHKA 1G9SA 2E1PA 2ISSD 2WKSA 3M0EA 2NAFA 3PE6A 4I1RA 4UW9A 3G2LA 5EWJB 5IYZA 3UHOA 5LP6B 2NSHA 2DY0A 3DE0X 4MB0A 2EX1A 2B30A 4I2NA 5L95A 1ISMA 4FFVA 2IZ7A 2WT4A 4RVNA 2C78A 3AHDA 3A9RA 4INJA 4H6VA 1ZHOA 1DUVG 3W1EA 1UBTS 5DYGA 4EDFA 4Q7EA 1AU9A 4MWGA 3E8MA 2EBUA 3B3FA 4UTNA 3WZMA 3IEMA 1NF9A 1W46A 3N70A 1YF3A 5B3LA 1D5WA 2CNNA 2E3JA 4GLLA 1LS1A 3RANA 1JQLB 4DJJA 4DDVA 1QH8A 1P1BA 4LWZA 5EGNA 1T9GS 3GZJA 3DMHA 1VL6A 4XPIB 2JJYA 3C6ZA 1GG5A 3VPBA 4PEVA 4WX2B 1LSSA 4MDEA 4NE9A 1FZTA 3ECSA 4QXQA 4JNCA 3HA2A 2BR5A 4MQEA 2W2MA 3W9UA 4N5LA 4HYQA 4N0DA 4U8HA 1KYZA 4P93A 2J31A 4G4GA 3RU2A 1N2GA 2HT1A 3RCBA 2PQ2A 1O58A 1C3OA 1Y37A 2QTGA 3CRVA 2FB9A 1KO8A 2PWAA 2GBFA 3KYJB 3GFGA 5CT9A 2AOUB 4DA4A 1X70A 2FXVA 2V9CA 1KMHA 3DVRX 3GGPA 4RD3A 3LBIA 3N8DA 3UAZA 1JZQA 3ODGA 3MS2A 2C9CA 4JLVA 4NQRA 3PXCX 2AVNA 4ZRDA 2CCJA 5GAJA 4WA8A 3WLAA 4Q4CA 5E9WA 4I2VA 3QIAA 1QF9A 2P78A 5BRJA 4MPPA 4MW7A 3HZRA 5FR2A 1QG4A 1ZM3A 4OI1A 1R4NA 4EBBA 3ZZMA 5BNFA 1M1YE 4B3IA 4ARCA 3LWZA 4E08A 3E18A 5C4MA 5H5JA 2WYHA 4R98A 3SHVA 1Z06A 1XHLA 2H7VA 3KSBC 1FRVA 2WE8A 3KOXA 4K81B 3ADOA 3U0BA 2ACVA 3BHMA 1E4YA 1RQLA 2O05A 4YP1A 1SQFA 2A2ZA 3LX6A 4EA6A 1K08A 2J9YB 5ICSA 5A4IS 4TXLA 3INTA 3DZ3B 3OQIA 2QR3A 3SS8A 4EHIA 3HO1A 3AMVA 2BJHA 4QDUA 4MV8A 4Y2SA 2ZXUA 4FYYA 3RVKA 1FNNA 1BMTA 2A1UB 2VH5R 2H54A 4NAVA 4P81A 4UDNA 1U0EA 1CFZA 1R4MB 3JYPA 3Q40A 4PANA 3AONB 5C1IA 1G3MA 5AUOB 4P84A 1K88A 5DIZA 1PR2A 2ZWOA 2GZDA 1W6UA 4N5IX 3AXSA 1A2BA 2QTAA 5ESXA 3C85A 4F8JA 3L04A 4NH4A 1Z0AA 5F3RA 5T4BA 3NFRA 3U56A 3GAMA 2CL7X 4ETMA 5JO0A 5CVVA 1B3BA 1KSJA 4BFZA 2QW1A 2WZCA 3L6OO 4U2KA 4DUPA 2QQGA 1KEZA 1YR3A 5C81A 3V4VB 1E2JA 1CF4A 4DDMA 3QLUA 4WSOA 1RYEA 1OAOA 1L8AA 2AR0A 3IE1A 3RIYA 3RBZA 1TYEB 1GNSA 2WE7A 2YJ5A 3GELA 4K03A 1OU0A 2CNWD 4NMMA 3CH6A 3CEPB 1JQBA 4CEIB 3TRKA 2B82A 3DTYA 3KJZA 3ZS9A 4CDMA 1JSXA 3EB9A 3ZHBA 2NT3A 2N1BA 1SHZA 5HPYB 1PWXA 1L2TA 1U0BB 1T24A 1ECGA 2ZDGA 3B13B 1KMMA 1S89A 4Q3DA 3N87A 3M5PA 3E5MA 5FORA 1ZN8A 1AZSC 1N3BA 2REOA 3ETHA 4UULA 2XAAA 3A3PA 3FZGA 2IU4A 1VCHA 1QZTA 3N7TA 3FUUA 2HV8A 4GX2A 2F3SA 2YVKA 2B36A 3PQ5A 4MWTA 3VTAA 1CE8A 1NRIA 4BASA 3WVNA 4DRXA 5KMGA 3ZDAA 3KOZA 2A94A 1ZSVA 2ZJFA 1QGUB 1K5HA 4R8MA 3RWBA 4WNIA 5KNLA 4U7DA 1VLHA 3CSDA 4D9IA 3DJFA 2WUFA 4QXPA 3HSSA 4ZANA 4OQ4A 2Z58A 2DZDA 3L4BC 3PUWA 5L51A 4UEWA 5KOJB 3AEUA 3PPXA 5H59A 2OYRA 1SCQA 1N5LA 1WR8A 3OJOA 2C7OA 3O1HB 3EC1A 1M67A 1XTJA 1NDQA 1WUJS 1KK0A 1QLHA 1PSWA 3DEKA 2X0RA 3EVCA 5M04A 2IP1A 5ECDA 4ZXPA 2X0EA 2WHPA 3S2SA 3FJYA 2XWJI 3QFSA 1WV1A 2ZCJA 3GMSA 1P4AA 4NE2A 1YTLA 1MJNA 1SU4A 2C3MA 4OX9Y 3EVAA 3PLNA 4CIXA 5ISMA 1KI6B 1T3GA 2PJZA 3EOZA 3H5AA 4X1YA 2WKPA 3C3CA 3JD4A 4YJGA 2V59A 4YYEA 4N5HX 2ZS7A 4PFKA 5G0WA 1GNLA 1WF3A 3IV7A 1LBIA 1QSGA 3BXPA 3WYFA 5EJ7A 1P19A 3FKSD 1ENZA 4KGDA 3H0KA 3SLKA 2ZT5A 5LQNA 4RY9A 1XKQA 1VYVA 3KTAA 4I36A 3OZ7A 4EYSA 1C4OA 3P45A 1DTSA 1G2OA 3QYPA 2A5GA 1ODJA 5LU8A 2G8NA 1LEHA 1PT5A 4QPDA 1AURA 3ILVA 3PR2B 2QMZA 4INPA 4G26A 3IELA 4QM7A 1IC6A 3FOFC 1L1RA 3RADC 1KEPA 1QDLB 2P2SA 2R5FA 3DQPA 3DT9A 1UPFA 3KLMX 2O14A 2P2LA 3VXKA 5JAPA 4O29A 2PG3A 4FSXA 4H7HA 4KSBA 2Z2YA 3F7TA 5UKDA 2FK8A 4LYHA 3H1GA 2AF3C 2EFCB 3STHA 2CXXA 1L7MA 3MRTA 3OLXA 3W3ZB 4LTNA 4RD4A 2QUIA 2ZSIA 3AP2A 5D7BA 2CVHA 5K8IA 4ISCA 1E3EA 1U7HA 1ZX1A 4YAIA 1W30A 4CN9A 3G9UA 1Z56C 3Q3IA 4O5AA 4BJ3A 1C1XB 2RGUA 3AZQA 2R1TA 3BX1A 3TL6A 1CUIA 1HT1E 2VP5A 1OBFO 2P4UA 3L05A 5CVEA 5EVCA 1SC4A 1Z2OX 2R9VA 5A4DA 3WG9A 3LVRE 2CWWA 4X3PA 3U26A 2XNCA 1JH9A 3VAAA 3IQFA 4H31A 1HGXA 4H08A 4ZI2A 2XUAA 3VNBA 2OCGA 4M0MA 3G23A 2E18A 3E35A 4HH3C 1FSZA 4ZAFA 1NQAO 1QU2A 1U4OA 2LWIA 1DZIA 1EXVA 3KALA 1RAEA 3I5AA 2FMUA 1HLPA 1L7QA 2BP7B 3GLHA 2YCBA 3AKZA 4WDRA 1Z0KA 1DRVA 1I6KA 3ENZA 4KPUA 4R16A 5JDCA 3GAZA 4Y1RA 4IJ5A 1CIVA 3ADKA 2ZJOA 1RYDA 3T3DA 4ZHQA 3QE4A 1LI5A 1PEKE 5FEUA 3P5SA 3T7IA 2ONZA 2Y0CA 1VIAA 3WGTA 4BQSA 4FHCA 1Y8CA 3B82A 2Q5JA 3H5VA 1LW6E 3H0EA 1NQ5A 3KSDO 3L7IA 3SFVA 3CNBA 3CY6A 3VTZA 4I81A 4MRAA 3DO8A 5A7FA 5A0VA 4LMAA 3IP5A 8OHMA 1PDWA 1YASA 2HWXA 3NHMA 1QIMA 4CQMD 3U7QB 5KYGA 1HNWB 4KHPB 3P20A 3FYUB 3QXXA 1T1JA 5C7OO 3DVAA 4PINA 2G9RA 2VDKB 5H9VA 4ZVPA 3WYNA 4NHEA 4M7RA 3GHHA 3JTEA 3N0WA 5JC1A 1EUCA 4NZMA 2YXEA 2XYVA 4LQCA 3A9SA 1SXJC 2FUNB 5DRYA 2WA1A 1W52X 3NOQA 1U2GA 1OX4B 1Q3TA 4KR9A 1GSOA 2PX2A 4HLUA 1O95C 4K40A 1P8AA 1VFPA 2QN3A 3VGPA 1U11A 4LBZA 2DETA 1OX6A 4EJSB 2F67A 4ZO9A 1YZKA 3PD0A 3F6BX 3NH9A 1Q1GA 4O2AB 1C2YA 1NJGA 4IICA 3TK1A 2G88A 3WL6A 5CEJA 4KFCA 3RGGA 1TVKB 4M0DA 2CUZA 2QQ0A 2IXEA 3JW8A 1V16A 5TY0A 4EY7A 4XYLA 4W9MC 3FVVA 3UMMA 3IP9A 1ZNZA 3Q7TA 4B6EA 5B5SA 3OFKA 1ZRSA 1QRRA 2HTEA 4KE9A 1TUGA 3A3NA 4AJPA 1C1YA 3OZIA 1KDVA 5JVDB 1R7RA 4DBLE 1K89A 1Q21A 1X8XA 2QTLA 5KDDA 5KVAA 5DNEA 1UINA 2HSWA 4GOOD 2ZB8A 4MJLA 4URFA 2I6XA 4WK6A 4A8JB 1GQQA 5BRAA 1WBDA 4LGYA 3DZ6B 2IF0A 4P7BA 1GYQA 2YV5A 4MAFA 1XJ0A 4L6CA 2R751 5F98A 4QG7A 2YHUA 4F6CA 1AS3A 4CTMA 4U4AA 4CWAA 1UH5A 1CRPA 1JP7A 1YJBA 4DCSA 5LNK6 3HHEA 1NXPA 1GO2A 1V39A 2OBYA 3PUZA 2BBWA 1JE1A 1E6MA 2QORA 1NMSA 1N2XA 4JB8A 2IF2A 2QLFA 4KRXA 3S68A 2BHSA 4WCFB 3C5HA 3P9KA 2V4UA 2WZQA 3D7NA 4H1UA 4RKQA 2DHCA 5CB4A 1JQJC 2QIOA 4BN5A 4CKEA 4P7GA 2EFDB 5AMXA 3FHTA 5FI1B 4KAJA 4B2PA 3EXG2 4JZYA 1HFJA 3VQTA 2CT8A 3IPYA 2BGKA 2P68A 4OKNA 3OQ6A 2IV3A 3ZCXA 4F60A 5MN5A 1LTQA 2HJ9A 1VKJA 4TTIA 3SVTA 2ERCA 3JZAA 1SZJG 3OIWA 3ZWWA 3HABA 1WABA 2B61A 3CR3C 3THWB 2VZ0A 3LSTA 2GOYA 5KVSA 1PTJA 1UJNA 2EERA 2ZEJA 3BN3A 5FPTA 2GLTA 1HFWA 2VCYA 2IEZA 1UOQA 1PWEA 4OA5A 1HO3A 4QXAA 1DAKA 1ZOLA 2EFEB 2NXEA 4RKYA 1EX6A 4MVJA 1WIWA 2BR3A 2GK7A 3WMFA 2WSSD 4C7JA 5LYJB 3EEIA 2V5AA 3C5EA 4RH3A 3KSAC 5JXWA 5FOTA 5HM8A 1CUJA 3JATB 4BNVA 2RAPA 2H4YA 3BTSA 1V2GA 2FSVA 1Z4JA 1DIBA 2RSLA 2ZYRA 2WBLC 2C00A 4G0UA 1EVZA 2J0EA 3SHOA 2PS3A 2FQ1A 2OOKA 2BDUA 4YEDA 1KTVA 1LPAB 1J07A 4Q7JB 1EXDA 3WB9A 1FP7A 2E85A 5C0OE 4ACBA 2CXNA 2DM6A 4V2UA 4Y6LA 4DRZA 4NBWA 4L74A 4PO8A 3FCYA 3EF3A 1N6LA 1NSFA 1GUDA 4HLQB 4XB2A 2PXHA 3GEMA 4RWEA 2AL7A 5IBQA 2P9BA 3WO1A 4FYPA 4GF5A 1QMHA 2PLFA 4HBZA 1ENYA 4BCDA 3QITA 3IV9A 1L5YA 3QNMA 4QDXA 4RZUA 2JKZA 1QIDA 3D4NA 1NVXQ 2ZRQA 3ID6C 4GM0A 4IW3B 3RSQA 4FNOA 2AXPA 3SEZA 1RACA 2YV4A 4AU1A 3KAQA 5IVKA 1PCXA 2O3QA 5KYWB 5CLFA 1U8AA 4PLGA 4KGVA 2G5TA 1QCCA 3PQEA 1PU2A 3GFVA 1J5XA 4I5EA 1A9YA 2GZRA 4DCCA 7REQA 2IXTA 1KRHA 3F6SA 4HAXA 4MJ7A 1E2KA 1D9XA 2I71A 1XD2B 4LI0A 4MPJA 4O4LF 1MZPA 3P9NA 1ACLA 3U40A 1ESMA 1Q15A 1KVUA 3ZR4B 4IL5A 5TPWA 2QTZA 2JGJA 1I7BB 2GD6A 3GOQA 4YWJA 2C96A 1SWWA 4J1TA 5JAMA 1UUFA 4F4UA 5FWAA 2F7SA 4JYAB 1GRNA 2J30A 5GONB 3RU9A 2JKVA 4QEDA 1OKKA 2R4QA 1I01A 5BR8B 2D2EA 3JX9A 2F1OA 1DCTA 1C3EA 2GTHA 3LGXA 1ZS9A 2XE6A 1F14A 1ZMTA 2I4RA 2CMFA 4OFBA 1JJAA 5BSHA 4RDHA 3WLLA 3IHKA 2FW9A 3ROEA 1S9DA 1I2ZA 2C4KA 4I4TF 3PQ4A 4PGMA 3C3YA 3H5LA 1CR0A 2YXPX 1Z7YA 2ZYAA 2MINB 4CLXA 3ZWBA 4MDFA 2R4TA 5HK8A 3RT9A 1RXEA 1IQUA 2WJYA 4XSHA 1ZLYA 1J4AA 1YHNA 4YFVA 5P8WA 2H1FA 4KO8A 1UJMA 4II2A 4ESHA 2V4ZA 2O07A 7ADHA 4ZOCA 4P1ZA 1RU3A 3H4MA 1C1HA 1JPJA 1H2EA 3WNCA 1BOFA 2NYUA 3O9VA 4MA5A 3FDFA 4CKCA 5CXSA 3NM5A 3IMFA 1FSFA 1Y9JA 1DBIA 3H9JA 4C4XA 1KMNA 1XRSB 3CW9A 3K0CC 1M2VA 2D3TA 3AJEA 4QNMA 4P32A 4Y6QA 4CBVA 1KQGA 3FCEA 3IEVA 1GLNA 2VDWB 3LT4A 1K6JA 1PVDA 2FN9A 3DDOA 1IWBB 4IV8A 3MJDA 5LA6A 3I76A 1A04A 1D2EA 1L4MA 4EM6A 2F3QA 4HYYA 4FGJA 3DE1X 1PT6A 1TM4E 1T1SA 2P5TB 3DV2A 3ENKA 3K9CA 3QMWA 1GU7A 1USKA 2NO7A 4Y2UA 2PT7A 3T4XA 1KAQA 2WJIA 1WUIS 3MINB 4JK3A 5DCWA 4E4YA 5F7XA 1VG1A 3MPUA 2I9PA 2AIRA 1XLTC 2C2HA 3EGWA 4OOFA 3V97A 2FUG1 1TIKA 3ISTA 1XZPA 1T5DX 2R8RA 3AZPA 5IDVA 4YDRA 2OBXA 4IDBA 10MHA 3I04A 1U2DC 2B0CA 4M8LA 4UEQA 4IVNA 3SI7A 1QGED 5EEGA 5TXGA 3QBDA 3MUEA 4BRSA 2IYXA 2OD9A 4BNHA 1SCNE 3RV3A 3RFUA 3UYKA 4TUYA 3DCJA 1L7BA 2GM5A 4XQ0A 4UBIA 1XMVA 1I32A 4YIHA 4RVCA 3AUTA 4OLFA 1BU8A 3H04A 4P2GA 1L8QA 1YZYA 4G23A 4EATA 4B7AA 5D1NA 3EPJA 3OZTA 4LUCA 1FXSA 1PJ3A 3MTQA 1A1VA 3MERA 3T4EA 1IEXA 1Y33E 2ES4A 3PFKA 4X3CA 2CE2X 5DGXA 3SJ7A 3GARA 5BV8A 5EQJB 1E77A 3K0FB 4DLVA 2FWRA 2JLCA 3WXMA 5LB2A 1CTQA 1RFLA 2AMVA 1AT1A 1HE4A 3DDCA 1P0MA 1BZYA 1NPTO 5JNSA 2A3NA 4WUVA 5IF3A 4BFCA 2Q3LA 3DTNA 2DT5A 3BKWA 3PSHA 4IV5A 1LK0A 4QRHA 5EXDA 4CFSA 4TKMA 3AY0A 4AJ1A 1V1MB 1L6RA 5HRCA 5IH7A 3KL4A 2HMTA 2WLTA 4JHXA 4MS3A 3ZWVA 1ADBA 2Q6OA 5IJ9A 3U5TA 3KAKA 3IKMB 1YKFA 1ENOA 4GPBA 2NM0A 1VG9B 3DZ8A 2HMVA 2WWXA 1PJ8A 4OL0A 5GGXA 4BO4A 1GPMA 4GKJB 2GK4A 1F12A 1TJYA 3EZ6A 4IG4A 5ALNA 1UMCA 2BL4A 2OBMA 1MQSA 2GK3A 5AYVA 3KOWA 1UFRA 4DGQA 4ZEVA 3QVLA 1SUDA 5CAEB 1ZD9A 1RHQA 2VDNB 2A0FA 1JBQA 4M7OA 2ZRLA 5E4JA 3IURA 2Q41A 3B70A 1AHHA 2I8LA 1ORVA 2GPAA 3ELWA 4TWZA 4HQ0A 1APBA 2PL9A 4X20B 1X7ZB 1VKOA 3KELA 2JFWA 4G9GA 4IDEA 3NIDB 3EIHA 4J0JA 3PJRA 3N2IA 1P18A 4MGEA 5AOVA 3NVMB 1CQZA 3RI3A 2BEUA 2R8YA 2C31A 4HWGA 1NNEA 4DZRA 4XR4A 1DQNA 4ZZ0A 3QVXA 5TX7A 4GYWA 2OFWA 1VI6A 2ECFA 3HCWA 4G65A 2PY6A 4F4JA 3IX7A 3FX2A 1O0CA 1EG7A 1WVMA 3V4FA 4N0PA 3A6KA 4OQLA 5IM4A 1WLSA 2F1KA 3C3PA 5DJ5A 1BMDA 1E8NA 2B92A 4OI4A 4BNLA 1YB5A 1W94A 1PJTA 2W6NA 3HWRA 4HADA 4KH0A 1NTRA 3KFVA 4UD6A 1BEZA 4YRDA 3U17A 2LDBA 4PNEA 2ZDHA 3GRRA 2AUMA 4DSAA 4I1IA 1H6CA 1G8JA 1H2HA 2VJKA 2YFKA 3EGDB 4G1VA 4OB6A 4C0JA 3TMAA 5E1DA 2BFNA 4PYJA 2J3KA 1ADGA 1K2VN 2DH5A 5K45A 8MHTA 3LXXA 2VH1A 2WM3A 4L5YA 4D26A 3C6KA 1JYFA 1XEFA 2WFLB 3NV9A 2BSXA 2QW0X 4OKSA 1XYYA 4QU5A 4WZBA 3UAXA 4LNAA 1QRUA 3ZZNA 4C30A 2DBRA 2NTEA 5ALUA 1RBZA 1IMOA 4R01A 1SHUX 3AU9A 1JLMA 3AUXA 1VHLA 5EE3A 5F5LA 3HI4A 2XUOA 1YJXA 2NZXA 3DBRA 5KTYA 4GKAA 3JYLA 5I8WA 2Q9CA 2ZAGA 4RBNA 3ORSA 4TSRA 3A1WA 4NAHA 5HE9A 2QAIA 4DLUA 1UXIA 3A7DA 4WZBE 3EIEA 3UG6A 1ZNQO 5FNVB 3K9GA 4M0FA 3RSZA 4E1BA 3C7AA 1WWKA 3FW1A 4P4LA 5DULA 3VPAA 3I9FA 1EFPA 1WCYA 4MW6A 3WQQA 4WK0B 1XWFA 4EF5A 1XVAA 2NUPB 3JV7A 1EUYA 5BW8A 2XMPA 1Y9ZA 1Z5WA 1N2HA 4CYMA 5D3MB 4PBSA 4Y2VA 5EZYA 3A1FA 1K8YB 1MAWA 3KKOA 2PH5A 1ZWLA 4MIKA 1UXHA 3IPLA 3EEOA 4PM4A 2NVWA 4CTKA 1ABBA 3KKKA 3I2JA 4AROA 4C0LA 2P11A 3OM9A 3BE4A 1VJ5A 5F1YA 3VV2A 3DLTA 4Q66C 3N2YA 1C8BA 4CL0A 3D6TB 1OVMA 1G3QA 2SKEA 2WILA 1XTPA 1C4KA 3GN2A 3NKFA 4PSDA 3ZU5A 3K16A 2JFXA 3H17A 3N2ZB 3QPAA 2XQFA 1KP2A 1VSQA 3F6CA 4RC9A 2NZYA 5E6SA 2V6IA 1X80B 5A62A 1TT5B 5EI5A 3V8VA 5C5IA 1KTIA 3PLAE 3H65A 5JS1A 1RBQA 1NRWA 3DOIA 5CRIA 2OZKA 4DMCA 2VP0A 3TXAA 4TQAA 5G0UA 2YWFA 3EQZA 2IBSA 4BB9A 1DC5A 2B4TO 2EEZA 2QLMA 4FYJA 2NO1A 2V54A 3BDIA 4B33A 5LD2B 1INLA 4FJ2A 2OCDA 2QD3A 3KCNA 1QV7A 2GPTA 1OUMA 3IDZA 4YGXB 5AOAA 5BYAA 5LJIA 3V4SA 2HJVA 4CF4A 2WOJA 5KPDA 1BXZA 3A9CA 2OHHA 1H42A 2GKSA 1QGOA 3H4IA 4G1MB 4PCLA 5EUQB 5H83A 3PU6A 5AUNB 1IBLB 4BQQA 4RL6A 1QC5B 4A91A 3CKKA 3HCRA 5F73A 1XVUA 4HRYA 1E7MA 2UUCB 1H93A 2D2XA 2GVDC 2ZBFA 3HVIA 2ZBEA 1YK0A 2V7VA 2XVZA 1QAQA 4DLRA 4F5ZA 4AJ2A 1MW8X 4RO0A 3FPBA 3IUQA 3O95A 2RI1A 3ZNOA 1BYUA 4GWLA 2C54A 1GZ7A 4FGLA 1B93A 2FCAA 2BMFA 1USGA 4M36A 2BMWA 5BNZA 4B3TB 4BFWA 1Z0ZA 5IK2A 2BCJQ 3E7DA 4FR0A 2ABWA 4J0IA 4EJ0A 1U0FA 2Z3VA 2J5QA 4JQYA 1GGVA 3TAHA 2A7XA 4QLAA 5TMDA 1CWUA 3QFRA 3BD9A 2O7NA 3TQTA 4Q00A 4KPFC 4AIIA 3AFHA 3B3GA 3RTEA 3T7SA 3ZBPA 3LWNA 3I39X 4OLJA 4EQZA 1HF3A 1J90A 3UT5B 1QFZA 3ZJXA 3FSEA 3ZOZA 1OBOA 2ZKLA 2EYQA 3F7MA 5EHZA 3QXGA 5FWYA 1RABA 4ITRC 2C7RA 1NQVA 2XA9A 1LW7A 3HBNA 4CFYA 1B6TA 1YOVB 3UH0A 2XYPA 4HV4A 2FG6C 3N2GA 3BMQA 2DKOA 1ZM2A 3UV6A 1MVLA 5F3WB 2A84A 2C1XA 4BWVA 3SX2A 1CR1A 3O91A 5CX1A 1E4EA 5NULA 3PWZA 3CX7A 3EMKA 1U90A 2O8CA 5JEEA 4K9PA 5FBZA 1OI3A 2IS6A 5H3LA 1IY2A 3DBHB 3D0RA 1C0PA 3II6X 4MTLA 2JGIA 4B9EA 1YA6A 1DBVO 1YJAA 5IXYA 4PZDA 2VK1A 4CLRB 3BD7A 1KAGA 3C70A 3I42A 2GUGA 1E0DA 4FXPA 2V0GA 1MB2A 4LGMA 1VPTA 2AC7A 4PLTA 5C8XA 3OPVA 2PMEA 4EY3A 3HXMA 4ZJZA 1EFRA 1MBZA 4EYKA 1HDEA 1PZGA 2I55A 5BMOA 4ZHQF 5DBHX 3T3OA 1NWHA 4W1PA 5IH3A 1C3XA 3JARA 1O08A 3W1VA 3I53A 4YRQA 2UYHA 3WWOA 4AKTA 1G5QA 2VXOA 5DK6A 3PD1A 1MF7A 2O06A 1QHIA 3IH5A 4ND1A 3HZOA 1M2WA 2YJ6A 3GGJA 3TNJA 2YN0A 5IT0A 1LTHR 1QCYA 1E1QA 3PDWA 4FLMA 5FA5A 5FV7A 2C2YA 4YCSA 5KYYA 3QJGA 4HEQA 1GJRA 3DMFA 4OFXA 4QBIA 4QUHA 1J97A 2CWDA 2D7DA 4BO6A 3NJ4A 5CB0A 1S2IA 4I3GA 1AO3A 2B1RA 3I0MA 5GV8A 2Y6VA 3SQNA 4M4SA 5EOVA 4PQYA 3OE4A 2BGJA 4KQMA 1PYGA 2P9QA 4NU8X 1EX9A 5JEDA 1EHYA 2WQ6A 1L7VC 2QN2A 1RI1A 1S3SA 4P53A 4PYRA 5JD3A 4XJXA 1TX4B 3WMEA 1O54A 4YUWA 1I24A 3LUKA 4BLUA 4AZVA 3WK9A 1X19A 1ZUD1 4PZLA 4LYYA 3B9QA 1ZEMA 5BV1A 4HNTA 4QVKA 1S2DA 3BWEA 4HQRA 1W2GA 4YO7A 1TZJA 2WSIA 1DO8A 3C39A 4UE2A 2GPYA 3GJ7A 1TGVA 1Z6YA 1JWAB 3IBGA 4UMFA 3ZE8A 5AW6A 3VAYA 4WN9B 3QTBA 1AQ6A 2QQEA 3SICE 3T5MA 1XAHA 3R3UA 5G1OA 2IPNA 1SRQA 3BIWA 4JQOA 1YI1A 8ADHA 1GADO 1Z4MA 4F9EA 3P2OA 3G9TA 3EIUA 4OJQA 1E5LA 2XLCA 4M98A 5I6DA 2QF7A 3M4JA 3MJSA 2QN1A 2CJWB 2LTAA 2F8MA 4N12A 2WW8A 3UEOA 2JLZA 5F12A 3AVVA 2E4UA 2W6MA 3CWZA 3W3AA 4IMRA 3HKBB 5L53A 2QMUA 4OCZA 2I4IA 5I5EA 1SVSA 2V74B 2QRGA 4BNJA 2DXIA 3TPFA 3TQHA 5MDHA 2JGEA 1QFXA 2QRJA 4IFBA 1QO9A 3SN6A 4U3JB 1CEQA 3VTFA 1I2DA 4RHUA 4FI3C 4O4IB 2P1DA 4ZGWA 1OLSA 3JS5A 1Q20A 1XP5A 3AYXB 3PDIA 4G8BA 4HN2A 5HTOA 4DA8A 2CDBA 3T7EA 3OZAA 4RADA 1G7CA 1LNZA 3KOOA 3CX3A 3E2IA 3L18A 5DKFA 3FGZA 4FIZA 1J99A 3FLEA 4JI4B 3ZTTA 2SHKA 1Z5UA 1F2TB 1TRHA 3H2BA 5H80A 3TLEA 4GOXA 3CZMA 3EIXA 3UMVA 4YXWA 4AX4A 4D57A 3C15C 4ZCSA 1UBSB 5G4LA 2C3YA 1E61A 3AUUA 1XALA 2HK9A 4DIEA 5I7FA 2O57A 2PA0A 3MC1A 1ZSYA 1XSEA 1GL3A 1CZNA 1Q5PA 1Y8RB 3G8DA 4PGAA 2BRUC 2VWPA 5DOZA 3ZXXA 2GGSA 2RG1A 5H8WA 3ZDCA 3TH5A 4BLSA 3VFDA 3GT4A 3N3AC 4COOA 2VUTA 4WXRA 4MHOA 5EHXA 5BSUA 3OEHD 3LKVA 4XA8A 2XI4A 4FUQA 3EUFA 4P3XA 3HUDA 3FWNA 3K5PA 2ZQYA 3L5OA 1F9EA 1II0A 1IRXA 1W49A 1EK5A 1XT6A 1XTUA 4RH0A 5TF0A 3TIVA 4EAQA 2OESA 4MVJF 2UUBB 2HY7A 2QRHA 4UU0A 3SXJA 1IK4A 3RBAA 3HYCA 5F9FA 1G3IA 1GZDA 2C2KA 4E70A 2AQHA 1SZCA 1WJGA 3FLAA 2HR1A 4U63A 4JI3B 1NFFA 2AMFA 1QORA 3C1TA 3CNLA 2COEA 4JR0A 5ALFA 3NCHA 5KJ1A 1FDVA 5T4EA 1JQ5A 3A1TA 2EKLA 1JEJA 1OQAA 4BWGA 5DPMA 1QYIA 2BFCB 4G4IA 5KU1A 4MUYA 5I3ZA 3VPGA 5H4HA 1PNQA 3K1ZA 2XCIA 3V1UA 3UOGA 5K01A 3NTRA 2N75A 3ND6A 2ZIUB 3E1KA 3K2QA 4H7KA 3VVLA 5AKXA 4EPWA 1E94E 2H4HA 2WKWA 4PSAA 2QD5A 3ELBA 1LKZA 1SWVA 1JSLA 4ROTA 4IRXA 2OWDA 1VDZA 1YDEA 3LQFA 1CQJB 1PDVA 1W4BA 3N8KA 4QJ5A 2WJPA 2DFLA 3L40A 1T2DA 3I1IA 1SULA 1DAEA 1V5EA 1VCNA 3P2EA 4IJ6A 2P8JA 3M89A 3REQA 5FRDA 4XYBA 4PBTA 1ZD5A 2BCEA 2POQX 1ZYUA 3JR7A 5I7VA 3GIDA 4EENA 4GMGA 3LUBA 5AW7A 2XVYA 4KPGA 1P2GA 3RJMA 4D6PA 1R0ZA 4P4UA 1B14A 3G2HA 2MSCB 3DTVB 3RG2A 2V03A 1SUBA 2QMHA 5DNUA 4DN6A 9ATCA 2C97A 2C7GA 3PNYA 4HQLA 1JW9B 1KJZA 2A5DA 2AOTB 2EW1A 1U9ZA 4HRAA 1FBTA 4II3A 3SR0A 5AUPB 4BE9A 3UBMA 3BFKA 1K4KA 5DBIA 1C7ZA 1E3TA 4BIMA 4BEVA 4M54A 2B7LA 1Z7EA 5JPIA 2A78A 2Z2KA 3H1AA 3TM5A 1JH8A 3KLPX 3TLJA 2FSFA 4JBWA 3C4JA 1R3DA 4HNHA 4IJVA 3UMYA 4KDCA 3LCJA 1JMKC 1GCOA 5LZ9A 1DMSA 5EPEA 4H17A 4YCDA 1JB1A 3V2UA 2G82A 3DZDA 1VYUA 3HDVA 5DNCA 4OV6B 3UENA 1I72B 4QEZA 3O3OB 1C3JA 3R5JA 5HOEA 3ZU4A 3EDRA 2HDOA 1UMDA 4YDQA 3RHSA 4DCVA 2R00C 1CG6A 3HA5A 5GIPE 2VUSA 2F3TA 1ULHA 1HDRA 2JGLA 3L02A 1A88A 2W6JA 3QZUA 4Q21A 3U7RA 4BGVA 4Z3KA 5AM2A 3R3HA 1AQIA 4MOWA 4NARA 3ZQ4A 1UZUA 4EFMA 4F86A 2ZIWB 5JD4A 1GUBA 4UZSA 5ALHA 3BEDA 5K20A 1EHIA 4IP0A 4E5UA 1R3UA 1XRQA 1PL6A 2QM7A 6AT1A 1A9QA 3EULA 4MRVA 4D9FA 4AKSA 1CZUA 2YWBA 4NZNA 4JBNA 2ID4A 3LCRA 4FFMA 4H3SA 4S1WA 4P83A 3L7KA 5FLXA 2PWBA 2ZRFA 3RYCA 4CMEC 3EVEA 4FT4A 2WF9A 1ESEA 3HB1A 3VI4B 4HQNA 4RYLA 4EB3A 2Z30A 2ZUCA 2JGDA 2QUKA 2BVNA 3OQNA 3RE1A 5DYNA 1V95A 1VDMA 3EEYA 1YACA 1SXJA 2FK7A 3JQGB 3R40A 5AW4A 4CW7A 4URYR 5AKIA 2G0AA 1V11B 3HY3A 2A1IA 1WD7A 2XBMA 3Q0EA 1VMIA 1PX0A 1O95A 1ZBDA 4IF4A 4TUYF 4Y6SA 2JI7A 1EHCA 2Y6UA 3T1YB 2DB3A 3UB2A 3AV0B 1ADCA 2WU8A 2ZRAA 5H82A 4YJ2A 2FJUA 3AEKA 2DFDA