3C8MA

Crystal structure of homoserine dehydrogenase from thermoplasma volcanium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
324
Chain Sequence
MKTINLSIFGLGNVGLNLLRIIRSFNEENRLGLKFNVVFVADSLHSYYNERIDIGKVISYKEKGSLDSLEYESISASEALARDFDIVVDATPASADGKKELAFYKETFENGKDVVTANKSGLANFWPEIMEYARSNNRRIRYEATVAGGVPLFSFIDYSVLPSRIKKFRGIVSLTINYFIRELANKREFDDVLSEATKLGIVEKNYKDDLTGLDAARKSVILCNHLYGSSYRLSDVFYEGILQDRSFGKNERLVTETGIVNGKPSAESRIKSLDSNDYLLTLGKGSLGYQLQTDTNGTLNVSDLYDGPYETAGAVMNDLVILSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
publication title X-ray crystal structure of homoserine dehydrogenase from Thermoplasma volcanium.
rcsb
source organism Thermoplasma volcanium gss1
molecule tags Oxidoreductase
total genus 114
structure length 324
sequence length 325
ec nomenclature
pdb deposition date 2008-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3c8mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3c8mA01
2VYNA 3DC2A 1Q1NA 4M49A 5BT9A 4AG3A 5IFLA 5KJFA 3VZSA 4QT0A 1HDZA 4ZQGA 2AE1A 1B2LA 4ND5A 3PPIA 3KO8A 1WNTA 2OGUA 1ZEJA 2QZZA 3FI9A 4ZVVA 2RIRA 3JQ7B 4R5MA 3DZKA 4KTTE 1YB4A 5TNXA 1E1LA 3L9XA 4UVDA 3GA0A 2GYYA 1ZW1A 1NQ5A 3E8XA 1QR6A 3OIGA 4L76A 3X2EA 1CEQA 1E7SA 4GLLA 1RM5A 3KYCA 4B79A 3WSVA 4BNMA 2C82A 4GGOA 3KLMX 2ZATA 3VPXA 1JAYA 1EDZA 4TKLA 4O63O 4HNHA 3E9NA 3GNQA 3ZWOA 1Y5MA 1FDWA 1BWSA 4A27A 4IGFA 3INRA 4YRAA 4MIEA 3DHYA 4YQZA 2X8LA 4BO8A 5JXWA 4DIBA 3DHEA 1OAAA 5IDQA 3ZWAA 3ZN2A 2WD8A 5I7VA 1SEVA 3MOIA 5C7LO 2W4QA 3KOUA 4BS9A 4IDBA 4TKMA 4DUPA 3L4BC 3ZNOA 3CZMA 4ZQBA 3ZV3A 3AK4A 2FHSA 2PK3A 3STHA 4LW8A 3LT1A 3ANLA 1EE9A 3QHAA 4OSPA 3EAGA 4KZPA 1VSUA 3TSCA 4NZ9A 1BW9B 1GD1O 3RSHA 6ADHA 3JQ6A 3SLKA 4KTVE 4BNTA 1HKUA 1EK6A 3KSUA 3EMKA 1PJ3A 4QO7A 2W8ZA 3HN2A 2DFDA 1LSUA 1P77A 2QRJA 5G4KB 1LDGA 1XYGA 1N8KA 4DXHA 5J23A 4FOOA 4NR0A 1PIWA 2I3GA 3B1JA 3DEYX 4K1LA 1ADGA 1HT0A 1SC6A 3V5NA 1R4NB 1KBZA 3BMNB 4XYEA 5COAA 5JCJA 4LISA 1XWFA 1K2WA 1NASA 2Y1DA 3ZH2A 3LC2O 2GO1A 3LF2A 2CD9A 5BSEA 1C0PA 1S7CA 3O9ZA 1Y81A 2PKQO 2VWQA 4DMLA 1G0NA 2Z1NA 1C0LA 4BGEA 3AW9A 4MVJA 4WLEA 3ZHYA 4E33A 1E3EA 1RYDA 4B3JA 3PP8A 1AE1A 1SPXA 3OP4A 4JLWA 3BMQB 3AY3A 1LQUA 4OSOA 1JAXA 2GN8A 1NQOA 3GUYA 5F1PA 1F8FA 4ZICA 2AW5A 3SJ7A 2Q1WA 1UAYA 4D41A 3WJ7A 1Q2XA 1YJ8A 4D79A 3OQ1A 3LC7O 1E1MA 2B5WA 3MTGA 2CF5A 4ZQHA 5CDTA 4PZEA 4CM8B 4Y6RA 5JAIA 4IDDA 4Z0TA 4FW8A 1FK8A 3F1LA 4WNIA 4I1IA 5HA5A 3MJEA 3ONFA 2GZ1A 3MEQA 4GWKA 5TGDA 4CUJA 1LDMA 3F1KA 3G49A 3ZI0A 3H2SA 1OC4A 3ZHZA 3O4RA 4KMSA 3ONDA 4CQLB 3QV1A 2BGMA 1Y8RA 5I8WA 5L51A 1K6XA 3JD1A 4AJ4A 1T2CA 2OBYA 4PLYA 2EKPA 2NM0A 4Y8VA 3U09A 4BNJA 4BNWA 1KVRA 4D7AA 3G0OA 3UCFA 3OQ6A 2VNSA 4EEZA 1DOHA 2B69A 2FPGA 3FR7A 3ZU4A 1A4UA 5IZ4A 3A1NA 1B8VA 4AJIA 5JC8A 4ZN6A 2AQKA 1R0SA 5T6BA 1Y9AA 3JV7A 1GAEO 5EQFA 4NIMA 4ONEA 4JNKA 5TX7A 5B1YA 3JQDA 2NVUB 1KVUA 1E3JA 4QTZA 4HXYA 1B15A 2Q22A 3OM9A 5MDHA 2XXJA 1ZEMA 3UCEA 1XA0A 4A10A 3Q1LA 3AY7A 3KSZO 4P4GA 4PG5A 2A35A 3PZRA 1C0KA 1O6ZA 4CMIB 3V2UA 3WYCA 4PRLA 3LC1O 1U4OA 1CRWG 4FJ1A 4MOWA 4WKGA 4LK3A 2ZK7A 4RPKA 1EUZA 1GYRA 2NQ8A 1JTVA 2G1UA 4IGEA 4ND4A 1XCBA 4YXFA 2WE8A 3GZNA 1E6EA 2CVZA 3U62A 1DHTA 2FSSA 4ZGWA 2LDBA 2I99A 1KVSA 3EVNA 1V3TA 1X13A 3RASA 5A3VA 2HU2A 4F3YA 3CINA 2VUTA 4I5FA 2W98A 2TMDA 5KNLA 1M66A 3WDSA 4YACA 4BNGA 3ZWNA 1EVYA 3GEGA 3QJ5A 5LDGA 4ALNA 1E5QA 1PGQA 4BOYA 1H9BA 3LK7A 4BNHA 5CDGA 4P4LA 2NTJA 3VAZA 1QYCA 4IZIA 5EINA 4IDGA 3W4KA 1AXGA 1O94A 1PJCA 1WDMA 5H83A 1EQUA 4CR7A 2AEJA 1UUFA 2J3IA 5BNFA 5BNTA 3PHJA 1DIBA 4YAKA 2VOJA 3HDJA 2VRCA 1ISFA 1H93A 3OETA 4NJMA 1U28A 4MVJH 2EEZA 3GGOA 4O59O 2OUIA 2NNLD 1E3SA 5BSGA 2V6GA 1P1IA 1FXSA 3Q2KA 3K31A 5L95A 6LDHA 1ADFA 2NVWA 2V6MA 5L45A 4YJGA 9LDTA 4JIGA 1F0YA 4RQTA 1LDYA 1QLHA 1NNUA 1I0ZA 1R66A 4BO5A 1ENYA 2J8ZA 4RVUA 4LCJA 4JQCA 4YT8A 2FZWA 3RBZA 3DBRB 4O0LA 1IB6A 4A03A 4TRRA 1HLDA 3ZZNA 4BMVA 5ICMA 1W6UA 2B5VA 4QXMA 3K8ZA 4INAA 1MGOA 3VPHA 5A9SB 4PCVA 4IJVA 4MKXA 4WCFB 3OA0A 3GEMA 1YO6A 2QRLA 4OQYA 5DOZA 4RQUA 4J9UE 3S2IA 1FJHA 1WWKA 3EY4A 1VL8A 3K6JA 4XDYA 5I7FA 4YAJA 2AEFA 2R6JA 1RM4A 2D4AA 2YHUA 4CUZA 1GCUA 5JAQA 2V7PA 4G81A 5DZSA 2RH8A 1QLJA 1DO8A 5TQVA 1E6UA 3WBBA 5DOVA 4NMHA 3NT4A 3AU9A 1I33A 2UYYA 1LSJA 1N9GB 4OGWA 2WJPA 3T7EA 1ZJZA 2CUKA 2Z1MA 3FN4A 3MWEB 4DA9A 2PY6A 3I9OA 4DQVA 4PG4A 3DBVO 4R51A 1IE3A 2DBRA 3GGGA 3OJLA 4XIYA 5FI5A 2B4QA 3NDIA 5G0TA 2IXBA 5T73A 2VWPA 2PD6A 3QIVA 4DWVA 1Y6JA 4JBGA 3I23A 2Y67A 1PL8A 3WNQA 1BMDA 3HZZA 4XIJA 2QHXA 3NEPX 2Q3EA 4H7PA 4YJDA 3JQBC 4M8SA 3RJ5A 4Z3KA 1H2BA 2O2YA 3FF4A 2P9GA 4MINA 3BTSA 2EKQA 1I10A 4U0JA 3DWFA 5CP8A 2OL4A 4GKVA 4WLNA 4KDEA 2DPHA 2YV3A 1C1DB 4XX0A 5F5NA 5HM8A 3RUIA 4ESOA 1YL7A 3D4NA 3H9GA 4IJUA 5DP2A 5TT1A 3GPIA 1EBFA 4FSHA 4HX5A 4KUHA 1K89A 3K92A 3QWAA 2X9NA 4MVJP 4EJ0A 2ZCVA 1BXKA 2Q49A 1PJSA 3TOXA 4BO7A 1BXGA 1N1EA 4S1VA 2VCYA 5AXCA 1RWBA 3ZWVA 4CLOA 3PFWO 3RROA 2JD1A 4LSWA 5HRUA 3C8MA 2PA3A 5JMWA 2C7GA 3EDMA 1NQAO 1UZMA 4IZHA 1PS9A 2Y99A 3BTOA 5AXDA 4J49A 3C7DB 3TJRA 4YDRA 3WX0A 4XCVA 1ZSYA 3P2OA 1YGYA 4TVBA 3DAGA 3GVXA 5U4QA 3RI3A 1HRDA 3KUXA 1GV1A 1BVUA 5B12A 1R4MB 2CNBA 4YBZA 3U4CA 3JTMA 1JVBA 4D3FA 4MPDA 3JD4A 3QWHA 4OOFA 2ZTVA 3M1AA 4QFCA 3GN1A 4LVUA 1D4FA 3LT0A 5HWSA 1VL6A 1DDOA 3Q2IA 3KVOA 2GUGA 1N92A 2EV9A 5JDIA 4PIVA 4CM5A 1H6BA 1BDMA 2X5OA 3LT4A 4DPMA 4O5OA 1NBOA 1IYZA 3P5SA 2HRBA 5ILGA 3UCXA 2DBQA 4WE3A 2D8AA 3OICA 4HFJA 3ZGYA 4JBHA 3JQEA 1NVTA 3D0OA 1DRUA 4F6CA 3OMLA 1ZVMA 4KP7A 2HSDA 3FCOA 1M6HA 2Y0CA 4HFRA 2YV1A 4MVJM 2RCYA 4WECA 4YB8A 4EUHA 3UH1A 4KWIA 4B3IA 1LSOA 1PX0A 2ZB3A 4QQRA 5L53A 1CIVA 5CPFA 4E32A 2PGLA 5KIAA 1M6WA 3RCBA 1Q7CA 4J4HA 4RPHA 4BO6A 5KVCA 3HADA 2VNAA 3PDJA 4OQZA 4YCAA 4Z9FA 2HJSA 4GPD1 1KC1A 1NTOA 4B8ZA 2VRBA 2IZZA 5G0SA 4BL5A 3VDQA 3PHIA 5F21A 4MIOA 1MP0A 3GT0A 2NLOA 4FDAA 4EUEA 2GASA 5A9TA 3D5TA 2HMUA 3AM3A 5JYEA 4MJLA 2B4TO 5H81A 3K96A 1P0CA 4DMMA 4R01A 1G1AA 4XWYA 4E12A 4WK6A 2ZJ1A 4CM1A 3BTUA 1DFGA 4G2NA 2QW8A 3TL2A 1P1HA 4UEKA 4B4VA 7ADHA 4HV4A 5FF9A 1JLLA 3GQVA 4Z0HO 3UGKA 4YYZA 1SCUA 2WWRA 3K30A 1HE3A 3WGIA 2IRWA 1ZK4A 3H65A 4Q9NA 1LLDA 1C1XA 4RF2A 4IMPA 1LRKA 5JW6A 3JQ8A 1GQYA 3TQHA 3AOEA 3TZKA 4ZRNA 4IQ0A 1Q7BA 3I9LA 1ZUD1 1XGKA 1YJQA 4OXYA 3ADPA 5FYDA 4A73A 1D7OA 1PZGA 3HFGA 4ZQFA 4B7UA 1GZ6A 2YFQA 1P1RA 3GDGA 4L75A 5C7IO 1PZHA 4IINA 2BI8A 3KEOA 4QEDA 4CLRA 5JFOA 4F45A 4RCVA 4DLAA 1KVTA 1DIHA 4BO9A 1UAGA 3WGHA 1DEHA 4EDFA 4TZTA 1HLPA 1UR5A 4CMJA 2VHZA 4ZHSA 3PQDA 5KOIA 3WICA 2P91A 3JQ7A 3EZLA 4YJFB 3KLPX 3EGOA 2POQX 1A71A 1VJTA 1BXZA 3GF4A 4UEOA 1XEAA 1HSZA 4IMRA 4TZKA 5KJ1A 2J5QA 3GHHA 4ZJUA 1IZ9A 3E18A 1N7GA 1AHIA 2CY0A 2E82A 4YA6A 3RC1A 3ONEA 4Q3BA 3UAGA 5AVOA 2VZ9A 3RC7A 1ZSNA 3U9LA 2JJYA 4GLOA 1JU9A 3ETDA 3JD0A 2NTVA 1E1NA 5EMHA 4FN4A 4GI2A 4J7UA 1P9LA 3KSDO 2F00A 1Q0LA 1EDOA 1PZFA 3WSWA 1BTOA 4Q39A 3LZ6A 2YQ4A 3L4BA 3DOJA 3ZWMA 5G2OA 4IDFA 3C7CB 4B4UA 4EITA 1WLYA 3PI7A 3AJRA 1TT5B 5FFFA 3BMCB 1AXEA 5JPIA 3PYXA 1YDEA 2AEMA 1HEUA 3RFVA 2O3SA 4D45A 4BNZA 4DYDA 5TSDA 3CTMA 2H63A 3O8QB 2BHLA 2HUNA 3IKVA 1ML3A 3L6EA 3LYLA 4C7KA 4ND2A 4DLLA 4IDCA 3TPCA 3GLQA 3NV9A 1O0SA 5ADHA 5A02A 2JKVA 4CM4B 1BW9A 4ALMA 4AJJA 1P1JA 1PL7A 1UXIA 1UXHA 1EUCA 2O2SA 3IL2A 1PTJA 2ILTA 3GDOA 3QVTA 5JCXA 5DDIP 1Z6ZA 2GN9A 3VZRA 4RZIA 2PZKA 4B4WA 5G4KA 3OEWA 2D5AA 2O7QA 3RUEA 3QY9A 1O5IA 4OYRA 2V65A 3JQCA 2C0CA 5EPOA 1NX6A 4J0FA 1PS8A 1E6WA 4TVOA 1SB9A 2YZ7A 2NV6A 1ZKMA 4FFNA 2JL1A 5COQA 3G79A 5T64A 3WLEA 4EYEA 2JHFA 1R4NA 4W7HA 5EESA 3BMNA 1RPNA 4DRYA 5H82A 2DAPA 3PJEA 4RPLA 4BMNA 3PGJA 4FFRA 1MA0A 2OORA 4XJTA 1PL6A 2BKAA 1PU2A 3QE3A 3WGZA 2JAHA 1IPEA 1X1EA 2BD0A 3F4BA 3GAFA 4JROA 4CV0A 2C20A 3JYPA 2OBNA 4TRJA 1DFHA 1U9JA 4GSLA 3DR3A 2G17A 4R1SA 3RFXA 2PTGA 5BQFA 4BHTA 2VZ8A 3BMQA 4B7XA 3OJEA 4KOAA 3RUFA 3HN7A 4J7XA 4RJTA 4WLUA 5KKCA 2YHIB 1WP4A 4PLVA 4IS2A 5FWNA 1I3LA 1MV8A 4GKBA 5IZCC 1OFGA 3BYZA 3E1KA 1OMOA 4DIOA 5JYFA 2PLAA 3KYDA 3H4VA 4BV9A 4CM8A 2VHVA 3T4XA 2C5AA 1LXCA 1KEWA 4UVEA 1KY5A 4DREA 3OA2A 1W73A 5M6DA 4I5EA 3A06A 1ENPA 3ASUA 1UXKA 3TF5A 4EUFA 3GRKA 3WLFA 3Q11A 1EBUA 3BXXA 3CKYA 4CL3A 4FBGA 2YW9A 3IJPA 4RZHA 1K5HA 2A92A 3MJSA 4CQLA 3VH3A 4CMKA 4LRTB 3V8BA 3KV3O 1A4IA 1YWGO 3WGTA 3RUAA 2UV8A 1MG0A 4FOSA 2J3HA 4NBTA 3M2TA 3CMCO 1ZNQO 2DLDA 1Z73A 3LQFA 3MJCA 3RQSA 2EF1A 1ZO8A 3WTBA 3W4IA 2AMFA 4R4JA 3PJFA 3JSAA 3WWYA 3MTJA 4DPLA 3D64A 4IM7A 3TZHA 3P7MA 2VOEA 5LDHA 1HDCA 1UH5A 5EQDA 4D44A 3WYBA 2WDZA 4J7CA 3GUCA 1LUAA 4BKOA 5F1KA 1NVMB 4RF5A 4MKZA 2X0IA 5JY1A 4MVJE 2NVUA 1U7TA 4ID9A 3CZRA 4K28A 4OAQA 1YVEI 1YRLA 2Y66A 4KUGA 4JXKA 1ZXBA 3U3XA 3ZWPA 2RHCA 4U8GA 3GK3A 3H9JA 4Z9YA 4CMIA 3RC2A 3UOGA 1LRLA 4L73A 4BO2A 1ADCA 3HB5X 1NFQA 5L7WA 1BSVA 4JK3A 2NU8A 1GUYA 1GR0A 4N54A 4EI2A 3ZWYA 1M67A 3G3EA 5ER9A 3KEQA 2YUTA 2AA3A 1V3VA 1IHYA 4PLHA 3NDJA 3PWZA 2FR0A 2HK7A 3ZNQA 3VPSA 3HUDA 3GOHA 1YQGA 1SB8A 3WS7A 2PWZA 1EVIA 2X1HA 2X22A 1PWZA 3OECA 2GLXA 5ITWA 1JKIA 4W9NA 1ISGA 2PZMA 5AXBA 3VTZA 3OBBA 2I9PA 4ZU3A 3QVSA 4CLEA 3C1OA 4LSMA 3LLVA 1XKQA 4BVAA 3FPCA 3UF0A 4OOEA 3PFFA 1JWBB 1A9YA 1V3UA 4J9VA 5CDUA 1DC4A 1IULA 5BSFA 3AU8A 2W2LD 5LC1A 1GPJA 3NRCA 1EFLA 3E48A 3SBOA 3VZPA 4E2ZA 5JYAA 1DC3A 5ILOA 4RF3A 1PR3A 4RLHA 1YL5A 1QKIA 3DZFA 3C24A 3ZWBA 5A3JA 3SEFA 1OOEA 3ZW8A 1GUFA 3TDKA 4NBUA 1ENOA 1CWUA 4CQMB 4BNNA 3H9QA 1RJWA 1JN0A 2WYUA 3PHLA 4E5NA 3H8VA 3ZW9A 5EL0A 1SOWA 4P22A 3AI1A 2O4CA 1LLUA 2GERA 1VKOA 2Q4EA 2I6TA 4K26A 2JCVA 4B8WA 3KHUA 2J3JA 4E5KA 3HNPA 5CG1A 1HDGO 3LVFO 2DFVA 4NU6A 1TB4A 3PLNA 4Q3CA 4HADA 4B3HA 3OJFA 2DBVO 2EW2A 4BNKA 3DBRA 3DZBA 1Y5RA 2RAFA 1K6JA 5CPBA 2PH5A 1ZCJA 1AHHA 3FRJA 3FD8A 1B26A 3HQ4O 4R3WA 5A9SA 5ES3A 3C85A 4WCFA 4WUVA 1XG5A 1JQBA 4B4OA 2VHXA 2QG4A 5C5IA 1J0XO 4XGNA 1UXJA 1ONPA 1LU9A 2O3RA 1LI4A 3JQAB 2BFAA 2EP7A 1N5DA 4HFNA 3TFQA 2ZQYA 5THKA 1A5ZA 1QSGA 3LSYA 3VKVA 2EJVA 3ETGA 3RBVA 5I9MA 4BQRA 2HLPA 3DZIA 1I2CA 2EP5A 1M76A 3KM0A 3R6DA 2ZIZA 4I5DA 1HSOA 4JP3A 1N9GA 4QECA 3TZ6A 2Y1OA 3OHSX 2X7HA 4Z9XA 5TT0A 1GTMA 5T57A 1ZMOA 4XB1A 5IJZA 4ITUA 4NH4A 2GN4A 2X5KO 2UVDA 1ISIA 2QZ9A 4L74A 2PZJA 4NK5A 2EXXA 4LRSB 1KOLA 4ALJA 5L7TA 3DHNA 3JQBA 4ALLA 4L4SA 2BF7A 5KVVA 3AUTA 4WNCA 2GNAA 1W8DA 4LMRA 4ZQEA 4RV9A 3KZVA 3JD3A 3QSGA 3VVBA 3H3FA 4CMBA 4Y98A 1HDOA 1PJ2A 5KKAA 4M55A 3UVEA 5THQA 1E3WA 2DT5A 3BIOA 1ONNA 3AUUA 5F5LA 2QYSA 3DAPA 2EGHA 3DAFA 3NTRA 3LDHA 4NPCA 4HKTA 3OH8A 1U4SA 4I8XA 4R9SA 1XIVA 2P9CA 3L9WA 4RDIA 4W9NC 2C7VA 1X0XA 1C1DA 2VTEA 1BG6A 3GHYA 1J49A 4J6FA 4CM3A 3DFUA 3DBLB 5JO9A 4BO4A 5DBIA 1V8BA 4XYLA 3FNHA 4FPXA 5TF4A 5B37A 2IEBA 2HQ1A 3WFJA 1P33A 1P45A 1T2AA 4OKIA 4CM9D 4AJKA 1NAHA 3DDNA 1E7QA 3WIEA 5T67A 3WFIA 3FTNA 3CUKA 1A7AA 3I6QA 1MUUA 1DXYA 2O7SA 4J2HA 3QWFA 1NWHA 1YB1A 3AM5A 3RBXA 5DCUA 3QLJA 3V2GA 4PN3A 2I5PO 3WGYA 4MVJI 3F6YA 3HJAA 4GX0A 5TLSA 5EERA 2YJZA 3BZUA 3A9WA 1T4BA 2WD7B 4BNVA 1DRVA 3WB9A 4IIVA 4Z0PA 3WYEA 1VJ1A 4MP8A 2PZLA 4FFOA 3ZWWA 4CR6A 4J4TA 3W4JA 2YV2A 3UXYA 4EBFA 1OBFO 2Y1CA 3NTQA 3SC4A 2HMSA 3PIDA 1F14A 1WPQA 4E2WA 1YONA 3C1TA 3WMXA 1P44A 1A72A 3DZHA 2CMDA 3DZJA 2FPIA 1BGVA 1LDNA 1LDEA 1B16A 3SC6A 2ZTUA 1HZZA 1ZK2A 4FFPA 1E5LA 3S55A 2JFFA 2PFGA 4WJZA 3SX2A 2ZYDA 3JYOA 4WCFC 2J5RA 2IDZA 3GRPA 1PQUA 1YS4A 1PS0A 2CSUA 2XF8A 5BSHA 1G0OA 3W6UA 2QQ5A 3D3WB 5B4UA 1NHWA 1KERA 2GZ3A 1NAIA 2D59A 2Q2QA 3NT2A 2G0TA 1XLTA 3B70A 4P38A 4BO1A 4D43A 4TROA 2AG8A 3DOOA 3PIIA 2VWHA 2GGSA 4XEHA 4HWKA 3PLRA 4NFSA 2PKQP 5K0ZA 2DC1A 3DB2A 4U7WA 4JP2A 4D3SA 3I9NA 1Y8QB 1X15A 4DC1A 3B20A 5CG2A 1YQDA 2Q1SA 2O4UX 8LDHA 3NTOA 1E0DA 3RAJA 2X5JO 1DHRA 2ZKLA 1V35A 4JBIA 4LCEA 2C59A 3FNGA 2C07A 4P8RA 1K0UA 3GVCA 4XKJA 3K9QO 3GY0A 3WR5A 1F17A 4IBOA 2IEDA 2GF2A 4MO2A 4E31A 4CQMD 1ZXLA 1PGNA 2J6IA 2RH4A 3I83A 2HJRA 5TJHA 3VDRA 4AL4A 1GPDG 3U5TA 2DVMA 3KETA 4KQWA 4IQ8A 1NYTA 3BHJA 2HCTA 4XQ9A 3VVCA 4TWRA 2FZEA 3H5NA 5FEUA 1M75A 4BB6A 2OO5A 2BGLA 1H6CA 4NNJA 5DBGA 1SO8A 1YOVA 3MJVA 4IQGA 2Y93A 4FFLA 1J6UA 1ZMTA 4PG8A 2ZYAA 5DCYA 1ULSA 2OZPA 4R41A 4HFMA 3VH4A 3BHMA 1WXDA 4XR4A 1LQTA 3DONA 3LT2A 1I3KA 4RVFA 1SEPA 2OOSA 1SZJG 1VSVA 3U4DA 3CPSA 3BMOB 3ST7A 2CVOA 2Y0EA 4EZBA 3T4EA 5L4NA 4UVGA 3S1LA 2JD2A 3WNVA 5KJCA 3INTA 1JA9A 4NJMB 2NUAA 4BNFA 4DBZA 3PWKA 4X54A 3ROPA 2UUOA 4R5HA 3L77A 4R16A 4ALIA 3N74A 4XQCA 4E0BA 4TMFA 4Q3DA 4U6SA 4YJFA 5EJ2A 4OM8A 4N5MA 1CYDA 1UDCA 4GAEA 3IAHA 2QX7A 4MVJG 3K73O 3GFGA 2E37A 1Z75A 4LVCA 1KS9A 2DPGA 4CUKA 4N5LA 1OZAA 1HDYA 3I3OA 3PJDA 4YAEA 2VTDA 3GG2A 2WSBA 2NADA 4XYMA 4N5NA 1T25A 5K6AC 2VUUA 4G65A 1D3AA 1MFPA 4CLDA 2R00A 1Z45A 4GMGA 1UP6A 1T1SA 2CF6A 2HDHA 4B7CA 3N7UA 2EKLA 1C0IA 4FR5A 4EEXA 2PKRA 1DJNA 1GL3A 2W2LA 5HS6A 5A9RA 5C37A 2HKIA 3I9KA 4CMGA 1I30A 4FD3A 4RO0A 4OIMA 1XQ6A 3QVOA 1Y9EA 3ZCXA 1PGPA 4WLFA 4E5YA 1Z7EA 1MFZA 3HG7A 1E7YA 2NU7A 2YFHA 5IDXA 4E2YA 1GDHA 2E49A 1HDXA 1WVGA 3BMCA 4D42A 4XYBA 1NWCA 1F8GA 3UHAA 4E6PA 1MC4A 1I8TA 3RKRA 1B0AA 3COSA 3S2EA 4DGSA 4TQGA 4WCDA 5A04A 4W7IA 3CEAA 3MZ0A 3DO5A 3TL3A 1E77A 2D5CA 3EK2A 4BIIA 4NK4A 4U0KA 4NG5A 3JYNA 3NGLA 4CM4A 4XGKA 5BR7A 1GY8A 4P4NA 2JAPA 2P4HX 2E6UX 3EVTA 3GG9A 1ISMA 3LU1A 2GSDA 1Z7BA 3ITDA 3Q6IA 2GDZA 4ILKA 3ZU3A 1UP7A 3C7AA 4Y6SA 1RKXA 4QFDA 5L9AA 4AJHA 5A4DA 2ZCUA 1U8FO 2I3AA 3VKUA 5CEEA 2W90A 1LA2A 4QO8A 2B0JA 1DC6A 4DL9A 1SBYA 2IODA 2OFPA 5I9NA 5DULA 3WG9A 1DSSG 2EJWA 4GX5A 4JCOA 2FSVA 2IE0A 4PLWA 1GUZA 4NJOA 3WGOA 5K9ZA 4XZ3A 5C7OO 4UULA 2YY7A 2VHWA 5DCWA 1EMDA 3LLSA 3RU7A 1NR7A 1WZIA 4Y6PA 1QV7A 1KC3A 2NWQA 1NPTO 2Y1FA 1I36A 3BHIA 4CMAA 3VC7A 2ZTMA 1VL0A 3FR8A 5KVSA 3FBTA 2G76A 3EYWA 3KBOA 4AJPA 2WYWA 2DTEA 5IN5A 1B8PA 1PJQA 3EZYA 4JN6B 1BXGB 1GZ3A 5IZCA 2WM3A 2C2XA 2V6FA 1ONOA 5HBRA 2AXQA 1NFFA 1LJ8A 4E5PA 2D2IA 2B37A 2FP4A 1U3WA 3D3EA 1DPGA 1GFSA 1XQ1A 3G17A 4L0QA 3B1KA 2Q4BA 1GYQA 1GEGA 2FY8A 4R1NA 5B4VA 4RF4A 4RPJA 2ZB4A 2Q99A 2UUPA 2Q50A 3ZU5A 2GD1O 3I9MA 4CV2A 3E9QA 4UVIA 3GFBA 2HK9A 3ZV5A 3GAZA 3R0IA 1XDWA 1T26A 3R3JA 3KYBA 3X2FA 1BDBA 3AM4A 3RIHA 4UUOA 3WXBA 1HDRA 4Y9DA 2VZ0A 2R00C 2JD0A 3IP1A 4NQZA 3S2FA 2GN6A 2ZB8A 4A5OA 1J4AA 1I01A 3VPFA 4PG7A 2VYVD 4DTIA 3F9IA 2J5KA 3Q9NA 3FTPA 1HTBA 1QYVA 3GH3A 4CM9A 4CMEC 2DQ4A 3PYLA 1V0JA 5KJEA 5TS3A 1TI7A 1EVZA 5F1OA 4S3MA 3TOZA 1RYEA 5JS6A 3ABIA 3WQQA 1ISHA 1SNYA 1QV6A 4IXWA 2GRAA 1EZ4A 4J4BA 2O3TA 2O23A 2X9VA 2PNFA 4FFMA 2Q1TA 3JQFA 4FC6A 4PLTA 1F06A 4PFJA 2P4QA 4CLHA 2PD3A 3O03A 3TRIA 4IPTA 3W8EA 1IHXA 1A27A 4IDEA 4EGFA 5JY6A 4CV3A 3HB4X 4LGVA 4YT5A 1K6IA 1E7WA 3IIEA 2XAAA 3I4CA 5CEJA 1PGOA 1ZFNA 4I9UA 3GVIA 4UAGA 2WEKA 4URFA 3GVHA 1PGJA 2OXIA 3IDSA 1AN9A 2I66A 4D0RA 5CDSA 1VPDA 4DC0A 4PZDA 4RLSA 3W1VA 1NPDA 3NX4A 3Q0EA 1YQXA 2RBEA 4XD2A 4F6LA 1Q0QA 1HWYA 5L4SA 1E92A 5JE8A 5JMPA 1H5QA 1YKFA 1ZZEA 3H5RA 4XYGA 2NQTA 4FB5A 1VKNA 3I5MA 3LF1A 3BTVA 1U7HA 3C3XA 4E21A 3PEFA 1XHLA 1C1XB 4AJOA 4IIUA 1O89A 3IC5A 5CAEA 3RUCA 2F1KA 1AUPA 1EK5A 4U5QA 4YT4A 3RD5A 4K9DA 3PHGA 3GEDA 2Y68A 2C2YA 1QYDA 1U2GA 3I1JA 4PZCA 1FMCA 3NJ4A 3PYMA 3RUDA 1GCOA 4YJHB 3R3SA 2BH9A 1ISJA 1KVQA 2NACA 4GH5A 4R1UA 4CLRB 1FDTA 4CLXA 3H9EO 1R0KA 1KYQA 4IS3A 1IL0A 3I6IA 4C7JA 2CDAA 4GGPA 5AQ1A 2W2KB 3F5QA 3OQBA 4FGSA 1JKFA 4BNXA 4CQMA 4D46A 3DBHB 3KB6A 2WMDA 4UREA 3U4IA 4M1QA 2WYVA 1LBEA 3OJOA 1E7MA 5DNAA 2X0RA 4GMFA 1NFRA 2I65A 2V6BA 3CH6A 2FPPA 3NT5A 4OL9A 1ZSVA 1C14A 1VE9A 5IN4A 1W4ZA 4E13A 1QG6A 1X0VA 5CFZA 1QP8A 3IUPA 4UVHA 3DMYA 5TC4A 4YPOA 4IY1A 4NBWA 3GC6A 1B7GO 4J1QA 5J9GA 3I9JA 3KRTA 1ZK0A 1Z74A 3L0DA 3CMMA 1RM3A 1KETA 1DIRA 3AFNA 1VLLA 5COBA 1LTHR 1EQ2A 3K2BA 3RUHA 5EIOA 4Q3AA 3GNTA 1EE2A 3DQPA 4EJ6A 3ZDFA 4NBVA 3SXPA 4TRMA 2HAEA 2WTBA 5JBIA 3D1LA 1NXQA 1WZEA 4GQAA 1BVRA 4PLCA 4YWJA 2LDXA 3NUGA 1DLJA 1I3NA 1YBAA 2SCUA 1TLTA 2C54A 2JFGA 4M87A 3FNEA 3JQAA 1WAMA 3JQFC 1FDUA 2P68A 1KEUA 1CF2O 2EHDA 2A9FA 1LDBA 3UKOA 4BNLA 3EC7A 3SJUA 2AE2A 4XGIA 3V1TC 2DBZA 2ET6A 2ZYGA 2BMAA 1U3TA 1AGNA 4WOJA 2A94A 3JQGB 3ICCA 5CHEA 2O3JA 3VH1A 5TRTA 1ZIDA 3ROKA 2HO5A 3AUAA 2PD4A 1MX3A 4BNYA 4BV8A 4A7PA 1VM6A 1CJCA 3FNFA 3TFOA 4OMUA 4WASA 2BLLA 3C1AA 2BELA 5AOVA 3DTYA 3H5AA 1T2FA 4ND1A 3JQ9C 3DMTC 1XU9A 3PTZA 4XR9A 4YT2A 2P2SA 4FC7A 1O8CA 1WW8A 2YDYA 3E9MA 1B3BA 2IZ0A 4DVJA 1PSDA 4MP6A 1K3TA 2AG5A 5DT9A 3PVZA 3K5PA 1MB4A 4GVLA 2Y1EA 3F47A 4ROSA 3P2YA 2JHGA 4FIZA 1U3VA 3H2ZA 3F3SA 4OXKA 5AXAA 4DIFA 3DBLA 5IAAA 1PQPA 3WQSB 1GQ2A 3M6IA 4WLVA 3KXDA 3RJ9A 4DYVA 2HK8A 5T8KA 4R54A 3JCZA 3ORFA 2VUSA 4W4TA 5JYDA 1MLDA 1GU7A 3NYWA 4GX2A 4LN1A 3TZCA 1YBMA 2FWMX 3ENKA 4W99A 3V2HA 4A2CA 1O95A 1H0KA 2X9GA 2P5UA 2D0IA 2Q2VA 1T24A 4PLZA 5LCXA 1DRWA 3ETEA 4AFNA 3I4FA 4WEOA 1QYWA 1YXMA 3QVXA 3AUSA 4UUNA 4AICA 1UDBA 3FPLA 2VT2A 3KYDB 3KYCB 4GSKA 3V1UA 1GV0A 2VT3A 4RDHA 2J3KA 4PVDA 1EUDA 1Z82A 2NSDA 4RGBA 1R15A 3ZHXA 1I2BA 2DUUA 2H5LA 3IS3A 2WD7A 4I08A 1PJ4A 4O1MA 5KCZA 4BQPA 2X6TA 4NI5A 3HWRA 2UDPA 3E5RA 4AVYA 4PLPA 4D0SA 1MC5A 1DAPA 1LX6A 2QIOA 3RC9A 2H9IA 4OKNA 2GPTA 3A14A 3R1IA 1ZK1A 2AQHA 2FR8A 3FSRA 5ENVA 3ROMA 3F4LA 1QRRA 4F46A 1Q0HA 4AJ1A 2O48X 1ZJYA 4J0EA 3H7AA 3OEYA 5I8ZA 1QORA 2OP0A 5I9LA 3CSDA 5IG2A 3BAZA 4H15A 3D3WA 2Y0DA 1DAOA 1L7DA 2FOIA 4AJLA 4EJMA 3AFMA 2CVQA 3PXXA 1A7KA 1E7RA 1LLCA 2ZJ0A 1TT7A 3MOGA 4W82A 2HMWA 3GVPA 1ADBA 2P5YA 4BNUA 2HMTA 3IQDB 1P1KA 2PR2A 2QYTA 4IUYA 4JJGA 1Y8QA 1LSSA 3Q9UA 1FF9A 3NKLA 3UICA 5L7YA 1VRWA 1UZLA 3UN1A 4BKQA 2VHYA 4M89A 3WIDA 3ZU2A 5A5EA 2QRKA 1ARZA 1ZH8A 4IJWA 1YB5A 2VYVA 5F3RA 1KY4A 1PQWA 3F46A 4FJ2A 1ORRA 4UUPA 4L4XA 1I2ZA 1HE5A 1TEHA 4RVSA 1TA4A 4MVJF 1QXSA 1QYXA 2AHRA 5FI3A 4KWHA 1XU7A 4OH1A 3INGA 1DC5A 1LEHA 2VQ3A 4NFYA 2Q46A 3NAQA 4C4OA 2HMVA 4FJ0A 5JDCA 4CMCA 3H3JA 4UEJA 2O50A 5A06A 5L4LA 2BI7A 1D8AA 1N7HA 2FMUA 4N7RA 1D1SA 2R2GA 3L4SO 1D1TA 2Y1GA 3ICPA 4GL4A 2NU9A 4J91A 1KEVA 2Z5LA 3K2EA 5T8KC 5HS4A 2VWGA 5C3MA 3ANMA 3QA9A 1ID1A 4I5GA 5GZ6A 3HDQA 4PGFA 3BMOA 1ULUA 1X7GA 1VJ0A 2EW8A 8ADHA 3TN7A 5IF3A 5TIIA 4Z3DA 1R6DA 4NFHA 2B35A 1Y7TA 3PHHA 3RFTA 3VH2A 4M54A 3V1YA 1YDWA 4MKRA 3QWIA 5G0WA 1R4MA 2DTXA 2I67A 3BA1A 4HY3A 5JC1A 1H2HA 1Y1PA 4CPDA 3DTTA 3I52A 5L40A 4JJFA 2DKNA 4XB2A 1HYGA 1Y8RB 2PGDA 5K6AA 1H6AA 1NP3A 1T1RA 3HHPA 3ZWXA 2X23A 2X86A 4YRBA 4L4RA 4WLOA 2CDBA 5GMOA 1JWAB 1LRJA 3ITKA 3M2PA 2TMGA 1IOLA 3IJRA 4Y67A 3ZV4A 1V9LA 4KUEA 3VOSA 1PEDA 3MWDB 2IXAA 3HDYA 1H6DA 1CQJA 3EW7A 1HXHA 5EN4A 3WJAA 1DBVO 5KTKA 4J1SA 2BFOA 1U8XX 5BNIA 1YBVA 1UZNA 2O3QA 1N2SA 5ITVA 4HNGA 1LNQA 3U4HA 4PVCA 5MGBA 5G0UA 3L6OO 1VI2A 1X1TA 3CIFA 4R3NA 2Z95A 1YE3A 4J16A 3HE3A 4DLBA 1C3VA 2XOXA 3E5MA 2UAGA 5A03A 4BGVA 1I32A 3T7CA 4XRGA 4YAIA 3IMFA 5A05A 3E03A 4YR9A 1CDOA 2C5EA 2VYND 3EUWA 2AQIA 4H16A 3PQEA 3WMWA 1R16A 2BGKA 4FCCA 3ANNA 3A28A 3E82A 1MXHA 1PJBA 2NVBA 1GYPA 1MXFA 1WDKA 3GZNB 4J1TA 4BO0A 4CL8A 5A5FA 4KQXA 2D3TA 1WDLA 4CM7A 3VTFA 1EFKA 3SVTA 1SOVA 2Y05A 2H6EA 2X0NA 1YH3A 2EIHA 1HETA 2B83A 4DQUA 5HTOA 4YVFA 1LC0A 1O9BA 3F5SA 3GNSA 3ADOA 2X58A 2P9EA 4NDNE 3GZ4A 4A0SA 1IUKA 3HSKA 1E3WB 1ZBQA 4WEQA 5G0VA 1XR3A 3IKTA 5JDCC 1NM5A 1T4DA 4MP3A 3WTCA 1IY8A 4GWGA 4G5HA 3AOGA 4HP8A 3ZHBA 3RWBA 4BGUA 2GZ2A 4OO3A 2B36A 3GDFA 1PJTA 4ALKA 5ER6A 5JLAA 4L8VA 2JCXA 3OF2A 4PLFA 1X14A 3ZV6A 5ICSA 1B3RA 3MJ4A 1IZ0A 2G82A 1DIAA 4BO3A 3ZNPA 3IP3A 3ZWCA 4PLGA 3JQAD 3H9UA 1SMKA 3JYQA 3RU9A 4NU5A 1EEHA 1T2EA 3WBFA 1RM0A 4N18A 2IZ1A 4E5MA 5GY7A 4K6FA 1KEPA 3DFZA 1R0LA 1SAYA 1LC3A 4YJGB 1Q7GA 1NVGA 3AI2A 4IXTA 5KJ6A 1P1FA 3WQRA 1WMAA 3PRJA 1GEEA 5B4TA 5JAZA 3WGGA 1KIFA 1B14A 1PJLA 4BKPA 3TWOA 2FR1A 4QX6A 1VC2A 4BGIA 5DBFA 4U6QA 2CFCA 3GR6A 3FHLA 4RL6A 2FRDA 3D4OA 2CDCA 3TNLA 4XDZA 2X4GA 1UDAA 3H6KA 3O26A 1DIGA 4XQGA 3GGPA 4TSKA 3HDHA 4GX1A 4IJKA 4CMEA 4RPGA 4E4YA 2C29D 3AWDA 3PK0A 4II2A 3N58A 2DUWA 2EWMA 2G5CA 3GMSA 3PDUA 4HUJA 1DLIA 1E1KA 4OXNA 1BHSA 1L7EA 4ZA2A 5AYVA 5IXSA 1TT5A 1U1IA 5JCJD 4OHUA 4AJ2A 1U5CA 1DJQA 1P31A 2PV7A 3NGXA 1MG5A 1DFIA 2H1SA 3VHRA 9LDBA 5IDWA 3O8QA 2BRUA 2CZCA 3FBGA 4L9RA 2E4AA 1T2DA 4H3VA 2AQ8A 5I7SA 7MDHA 4RVDA 3CE6A 2ZQZA 2OP1A 3U49A 1CETA 2DTDA 4R1TA 5IDYA 4MVJD 4DPKA 4CODB 3QW2A 3DOCA 2NTNA 1F12A 3VZQA 2OMEA 4NBRA 3EHEA 4DQXA 5ENDA 4E30A 1GZ4A 1V6AA 2XPCA 3HFSA 1UXGA 2JFHA 3UFXA 3IUSA 4K6CA 1J5PA 2RHRA 2IYOA 2VN8A 4JX8A 4R69A 3FWZA 3QQPA 5KWEA 1UJMA 3B6ZA 2GR9A 3MJTA 2GCGA 1HE2A 2ZB7A 3A4VA 3JYLA 5CDYA 4J90A 1E3LA 5DF1A 2D1YA 4J3FA 2Q1UA 1HF3A 2O3UA 1DB3A 5U1PA 3GN2A 3DZGA 4FQ8A 1CERA 1PZEA 4YAGA 4KDFA 2IYPA 2Q45A 1X7HA 4R9RA 5KVQA 2PGJA 3ULKA 3D4PA 1JW9B 4EW6A 3PQFA 4I9NA 4I9HA 4OJNA 1W0CA 3CXRA 4WOKA 3WWZA 4LMPA 4XA8A 4YRDA 3ROQA 4MIYA 1P0FA 5JNLA 3Q3CA 1YOVB 3B1FA 4BUCA 1EVJA 4XJSA 4Q3NA 1NHGA 3JD2A 2YQ5A 4CLOB 3UUWA 1PWXA 3ON5A 3QP9A 2BFMA 3OFSA 3ENNA 4GVXA 2YHIA 4YJHA 2WE7A 3GPDG 1R12A 3QVWA 3D7LA 4CR8A 1U2DA 5G4LA 1LLQA 4MDHA 3WGQA 4YQYA 4XQEA 1HYHA 1NR1A 2W2KA 5U9CA 1U5AA 1GQQA 4A26A 5GZ3A 4ZD6A 1OC2A 3DBHA 5JAMA 3OSUA 2DU8A 3VPGA 4QSMA 1B8UA 3UW3A 3RKUA 4AJEA 4ND3A 3D5QA 1N1GA 1NQTA 3M1LA 1HYEA 2NU6A 3ASVA 2EERA 1JVSA 1QMGA 1H9AA 3PWSA 3PZBA 3GMDA 1ZK3A 1TXGA 4Q3EA 2OHXA 1HZJA 4FS3A 1YL6A 3E6AA 2EGGA 3L07A 3O38A 4IDAA 1U3UA 4II3A 4NHEA 4J2OA 3S8MA 2B4RO 3OIDA 4RVGA 4WPGA 5JO0A 2PH3A 5IXYA 4PG6A 2HRZA 3NDRA 4Z6KA 1JDJA 1I24A 1S6YA 1P74A 4JGBA 4J1NA 4YEDA 5JDIC 2YDXA 2ZTLA 1XSEA 4D3DA 1R37A 3QWBA 3U0BA 4E3ZA 5A1TA 1A9ZA 1FDSA 5GZ1A 1I5RA 4FGWA 4HBGA 5I7EA 4BKRA 3SLGA 2Q2WA 3W8FA 2X0JA 2E48A 5JSFA 4QUKA 4JJIA 3P19A 5L3ZA 4CV1A 3AY6A 2DM6A 1GADO 2JCYA 1HE4A 3PGXA 1CQIA 1X7DA 3PJGA 4BB5A 4R68A 1P3DA 4BKUA 4W6ZA 3JQGA 3WOHA 3S2GA 5CEFA 2VRCD 2I76A 4CMHA 1FDVA 4AJNA 4J43A 4E2XA 2XXBA 3ZNNA 3JQ9A 4CJXA 2YYYA 3DMTA 4GBJA 3RVDA 4CM6A 4ZRMA 5TJ9A 3G1UA 1L1FA 5DP1A 3QRWA 5DN9A 1WMBA 3FWNA 4XRRA 4WGGA 3AI3A 4BNIA 1M2WA 1IPFA 3W8DA 1ENZA 3NJ8A 4O6VA 3KTDA 1G6KA 2FN7A 4RORA 3OIFA 1I3MA 1PR9A 1UP4A 4PRKA 1XELA 1NPYA 3DXFA 3JQ8B 3OJ0A 4TRNA 1TVEA 3DL2A 1BRMA 3G1TA 1E3IA 3L6DA 1H94A 4YTEA 2A4KA 3TZQA 4RVHA 3MCVA 1OI7A 4BMSA 4DBVO 4M86A 2BFPA 1HL3A 5T5QA 3W6ZA 1JKJA 3IOYA 4UUMA 3AOEC 2EG9A
chains in the Genus database with same CATH superfamily
1D2EA 2VYNA 4M49A 1Q1NA 4ZI2A 2C88A 3Q7TA 3L1KA 1K3UB 1QGYA 1FY2A 4E3WA 2ZJYA 4KVZA 3TD9A 2AE1A 1B2LA 3NHUA 4ND5A 5J59A 3GXOA 5HUHA 1WUKS 3PPIA 2JI4A 3KO8A 1MZVA 1Y3HA 3II6X 3O3OB 4MUJA 2AFIE 5DLYA 2FMXA 4EYGA 3AVVA 1QLWA 1TQ2A 2AR0A 3UG6A 4JB3A 1O96A 2IYXA 2WICA 2O06A 2R5WA 1JQLB 1GGMA 3ND5A 4I1VA 1AGPA 4C89A 2QVCA 5CM2Z 4K0KB 1X7ZA 4D9FA 2YN2A 3BWVA 4OXRA 3OD5A 3E2PA 2VDQB 3C5WP 1SIOA 1KL7A 3MJRA 1GCAA 3GA0A 5GJBA 4NOKA 2P65A 1BHO1 2AJ8A 3DV0A 3LKZA 1CEQA 1UC5B 2AT1A 1KBQA 2QL9A 4MA4A 5KHAA 4UXHA 3IVRA 3SBXA 2C82A 1HTTA 2D5LA 1SZDA 2ECOA 1TU3A 2GMWA 3NUQA 4OHWA 3VGPA 2VG8A 4YJ2A 4TKLA 4M60A 4YMSA 1JR2A 1RPTA 2MT9A 5JSYA 2GETA 2QY9A 4RY2A 2XECA 2RB4A 2Q4OA 3M6UA 4UE3S 3ELUA 3GNQA 1TVKA 2IXEA 3WDMA 2FCAA 2PN1A 3ZBUA 2CC2A 2ZSKA 1BWSA 4TXHA 4X90A 1QZXA 4D5EA 2X3YA 4A27A 4IOLA 3E7XA 3INRA 4AMUA 3IALA 1CEXA 4YQZA 5EXEA 2X8LA 3C3WA 4BO8A 2BGGA 3A58B 4HDRB 2QPAA 4YP7A 1UPFA 4LC0A 5AVVA 2IV7A 3WL6A 2WD8A 5FPHA 3ZN2A 4AYWA 3HUFA 1TGYA 4EA7A 4F2HA 4DVGA 3I6YA 4M6WA 4WZ6A 2R62A 2JG3A 4TKMA 4BC1A 3HXLA 3U3JA 3PR1A 4JBWA 1EH5A 2G80A 2BUAA 4BASA 2ZLBA 3D9QX 2IYUA 3UAWA 3W0LB 3STHA 3SFVA 4CEJA 4C5AA 4LW8A 3LT1A 1G8FA 1W4RA 4EG6A 1N6RA 1UKEA 3C8HA 3M6MD 2FZCA 3KCNA 4OSPA 3RVJA 1C8BA 1EINA 3BH6A 4IFEA 4KZPA 1P4AA 4COOA 3TSCA 4QPCA 5JD3A 2C9DA 4OIFA 3RSHA 4QXPA 4P5EA 2JJMA 4Q1AA 3TRHA 4YCCA 5IJ9B 1NJ5A 1EUCB 1LW6E 2VO1A 3GQBB 3LP8A 5TEVA 4G1BA 4QLAA 3C6KA 2PL1A 2W8ZA 1EVKA 1HFEL 2DFDA 4MUBA 1E4EA 2Q7OE 3WWOA 2O9JA 2QRJA 4BN5A 1LK0A 1MAAA 2PUVA 1L6IA 4IFTA 1C4WA 4DXHA 2J7KA 2MYTA 1PT7A 1G20E 2XA2A 4Z54A 1PIWA 1PT5A 4JI4B 3HTXA 1GKUB 4IG9A 2EC5A 4EQ6A 3HO1A 4GO1A 1P18A 4R3UC 1ADGA 3QMVA 2DG2A 3FTDA 5T3UA 3V5NA 1R4NB 2B78A 2GCEA 4L5IA 4C4ZA 1L7BA 5JCJA 5KYKA 1AX9A 4B3MB 1PK7A 1TYZA 1ZUNB 1JHZA 1L8XA 1Z0SA 3MWYW 4PFSA 1VA4A 3TNJA 1A04A 3H2HA 3SC2A 2GPYA 2QE6A 3A3OA 3M3HA 1NL3A 1UIMA 1JTEA 5LBUA 3TSZA 1CYEA 5BSEA 1JR4A 3BBPA 1Y81A 3F7OA 4PYNA 3FCXA 2C03A 1W9HA 2H4YA 2ZIVB 2Z1NA 2IHZA 1PUJA 4MLCA 5E8JA 1RLIA 3AW9A 3UXEA 2X0FA 1NDQA 3ZHYA 2IBTA 2YVLA 2IIBA 4FKBA 1F9EA 1AE1A 2JHPA 2OGSA 2QT0A 1YS1X 3DJYA 3HKDA 3BMQB 3AY3A 2OCGA 5DHUA 3RS9A 3I3SR 4TWZA 2JBHA 4OSOA 3TNDA 1E63A 4JIMA 4YO7A 1IEVA 1PFVA 2YINC 3RPEA 2OILA 3QUCA 2AXEA 1C4KA 2BEUB 1JAHA 2AW5A 1J56A 3DNFA 4M22A 1ZD3A 1DQZA 3HCAA 1YJ8A 4D79A 5C1BA 3OQ1A 1E1MA 2CCGA 4Q6BA 1GLVA 1QHSA 2CF5A 3FZQA 4ZQHA 2WC1A 4PZEA 2CL0X 2JIOA 4D6YA 1YI0A 1F0KA 5KC8A 5FI1B 5IT4A 1LZKA 1TUGA 1IUNA 4HAXA 1M0TA 1QTRA 3KKMA 2Q28A 2QENA 3DE7X 2CL7X 5TGDA 5FCDA 2PM8A 4TYYA 3ECAA 4R7ZA 3LAWA 1ADYA 3UAZA 3ZE7A 3ONDA 4GRIA 1LGYA 2CJWB 3QV1A 1N0VC 4NEQA 2VDPB 1Y8RA 3NH6A 3X43A 4Y0VA 1JDVA 5ECGC 3STYA 1PNQA 5L51A 3I0ZA 2X8WA 4IEEA 4E5SA 4PLYA 1SKUA 2CNWD 4WZBB 2O2XA 1JEJA 4OGKA 4BNWA 1Z4KA 5KNDD 4JDUA 1MZPA 1QK3A 3NVDA 3OQ6A 2VNSA 3I09A 4JCCA 4WCVA 3SZRA 2VJAA 3VZCA 4BEWA 2B69A 2VHQA 3ZU4A 5KSOA 1XK6A 3A1NA 5CVVA 4OQXA 2OAP1 2GAJA 2DKOA 1YZGA 1Y5IA 4ZN6A 1RBZA 1XN1A 3JYHA 4IF6A 5T6BA 2O8CB 1H4VB 2M6RA 3JV7A 4ZWNA 2YZMA 4DAEA 2Q29A 1MH9A 3WLPA 1M1NA 5B1YA 2NVUB 4INPA 4V0MA 2PJZA 3KJEA 4V2IA 3T5AA 3L7YA 3T0GA 3T3PB 4WDRA 1UM9B 3HO6A 4QTZA 4GC9A 3H5OA 3OM9A 3QENA 4R71A 4A1FA 2ORYA 3UCEA 1CLUA 2B34A 5J5AA 2C2GA 2XB6A 2C99A 2C7RA 1LV8A 4O2AA 4B9AA 1C0KA 3SEAA 4H6WA 4CMIB 4PRLA 5EJ8A 1P0QA 3T5PA 5KU7A 4PICA 2CHFA 1TUBB 3G59A 3L41A 4UU8A 4I19A 4FJ1A 3K0FB 4B2YA 1NVXQ 4S04A 2EJTA 4IH4A 4B3GA 4K05A 4OYLA 1OXXK 4RPKA 1EUZA 3UG7A 4KHPB 2FG6C 2G1UA 4Y2XA 1CEEA 1RYBA 1RACA 1T0JB 2HV9A 4ND7A 3EBOA 1WBJB 3ANXA 3GZNA 3J80A 2CVZA 2ZWAA 1C3XA 2Q6IA 2EZUA 4Q5IA 2I99A 3RF7A 3VVLA 2X3FA 1GPUA 1HM5A 1OWPA 5DXJA 5A3VA 3OZVA 3RVOA 2FQXA 2VUTA 3UB3A 2FUG1 3K71B 1Z5ZA 3L6RA 5A0VA 4DR3B 2QXTA 1MJ5A 2IYRA 3RRYA 3W1EA 4EY3A 4L9WA 1BCRA 4KLNA 4YGXB 2J59A 1YS2X 2LCFA 2ZRNA 3N0XA 2IP1A 5FKJA 4KYIB 2CBZA 4HDMB 1S7GA 4KFCA 2FMTA 5LNK1 4BNHA 5CDGA 1F6DA 2H57A 2ENWA 2NTJA 3GT7A 3P71T 2J85A 5CT6A 1T10A 3GJ5A 1VPTA 3QELB 2C2BA 1CZRA 1ZX1A 3CLTC 3KQWA 4R9VA 5CLIA 5EINA 1A95A 1K66A 2QGNA 3DE0X 3G6KA 4IDGA 4KNWA 1LVHA 3B1ZA 3NBKA 5JYBA 3USES 1EQUA 3UHOA 4CR7A 2VJLA 3QEMB 2J3IA 3WGNA 2BTEA 1VQ1A 1FLVA 1QANA 1BFUA 1JG1A 1KR5A 1L7PA 3EGXB 1G5RA 2DWPA 2EJUA 5ALVA 2VOJA 1N5JA 4KC0A 3KQLA 3DDSA 1SVWA 1QHNA 2CN1A 3VR1A 4A6DA 3PNSA 1U28A 4IOJA 5CT8A 4O59O 4HQ0A 5IP5A 2OUIA 1WXGA 3Q7IA 4TLMB 1JP7A 4RD1A 4O4JA 3B13B 3BH7A 1FXSA 3RW9A 3DL4A 3EDRA 3Q2KA 3L93A 2QTMA 3K31A 6LDHA 1MRSA 2CUZA 2YXNA 3R6WA 2GKGA 3KTAB 2ZUUA 4HH3C 4RGVA 1JENB 1ESCA 1Q17A 2GKOA 3H2KA 1PFGA 5CB8A 5KWIA 4F4FA 5FI0B 1OWOA 4ETNA 2Q5QA 4KE6A 2V45A 4D8XA 1ECGA 1T6YA 3EZGA 5EUQB 2EX4A 3KZCA 2VNHA 3AHDA 1B6RA 1EUDB 1GCGA 2FOLA 3LNCA 4PWYA 1CZHA 4K88A 2J8ZA 1QUFA 1SWVA 1ZA2A 4LCJA 1HOXA 1EB9A 5GV7A 1U0JA 2R11A 3AZQA 3DBRB 3DTVA 1E3DA 2J08A 1MH1A 1W34A 2JAXA 3EUAA 3HHEA 4G86A 4O2AF 3FMPB 4JWTA 2B5VA 1SJ9A 3EF1A 5I01A 3QNWA 3WL4A 2M6LA 5A9SB 4PCVA 2XRYA 2WKWA 1ABFA 1NU6A 2BGIA 4M8KA 2ZE5A 4Q1DA 5DYNA 2BHSA 4WCFB 3ZCQA 4BMCA 1DEXA 1YO6A 3DCNA 4G84A 4UCFA 4Y1GA 3GRVA 3FOEC 1U11A 2QD5A 1CZOA 1WWKA 2Q07A 2LPMA 2XUGA 3EY4A 4MQEB 4IW3B 5FPTA 6PFKA 5I7FA 4YAJA 1CX9B 3ZDCA 1NMSA 2YHUA 5I9BA 4TM7A 3WL8A 4C2UA 3CXUA 4FE4A 4G1VA 4UHFA 4YRCA 4WERA 4DKXA 5LYJF 5JAQA 1SKMA 3IVAA 3Q7PA 2V7PA 4Q4DA 3LG2A 1Y8CA 1J9EA 1C3JA 2XZTA 5TQVA 1JFVA 1E6UA 3IVXA 4A9AA 2IVFA 1O4WA 4NMHA 5AICA 5KTMA 3NT4A 4OA8A 3EXFA 1N9GB 4YCNA 1QO9A 3NB0A 3T7EA 1ZJZA 4KSCA 3RANA 1G5FA 4G26A 2AL7A 2VP5A 4DLNA 1QG2A 1E69A 2WUVA 5B55A 1RZRA 1E9DA 2V74B 1CQPA 4FU0A 4JWKA 3C4VA 3GGGA 4M0UA 5FI5A 3T99A 1IMOA 2HY7A 2YL2A 5EG5A 1U8CB 1CUDA 3D81A 4DNFA 1V95A 1J2RA 3A3PA 3K9CA 3SC3A 2IXBA 1EDBA 4JJ7A 1IJFA 3KZNA 1KKUA 1P9RA 3C3DA 2VF2A 2JGJA 4XFDA 2NYRA 3FZEA 4JZKA 3WNQA 1BMDA 2H3EA 3HZZA 1V71A 5B30A 2C4NA 1OF1A 2QHXA 3NEPX 4FKMA 4X5OA 5P8WA 3RJ5A 3DHWC 4S24A 1H2BA 3W5DA 1ULAA 2NNWB 1ZD1A 2O2YA 4HOYA 5C8YF 3PFHA 4U0JA 3W5SA 3BUSA 1BX1A 3VVMA 3E3OA 4WLNA 4IHKA 5F5NA 3ZZ1A 1Z7GA 4KJZA 4OJKA 4JDPA 2C94A 4MMYB 2I2FA 2CBGA 1TJ5A 4M1YA 4QARA 1URPA 3TXXA 5DSTA 5KQGA 5DP2A 4A36A 3GPIA 1EBFA 3BKWA 4B43A 1RW4A 3ZGNA 2RK3A 1YZQA 3WLTA 2LUOA 2ZRMA 2X9NA 1D2RA 2D1QA 5G1NA 5BPFA 1OZGA 1PI3A 1ZVJA 2UYCA 3AI7A 2PWAA 2IWRA 3SZMA 2CJXA 4Z99A 2YXLA 3AGPA 2P6PA 2VPTA 2Q49A 1Z4MA 3N86A 1K6MA 1DNPA 4S1VA 4Y9UA 2QAGA 3ZWVA 3PFWO 3O8OB 2UYOA 3FPEA 2FTKE 2VHEA 3M70A 3R3HA 4FCWA 5EIBD 2E55A 3IPLA 5JJBA 4Q82A 5B64A 5FR1A 2R6R1 1S2IA 3I2FA 3EDMA 1OFUX 4PY2A 4Y1EA 5G40A 5TMDA 2BSQA 2BCEA 4EZIA 2HDNB 1FFXA 1R5NA 2AG0A 3VNQA 1E2MA 3G2KA 5AXDA 3NXKA 4JI8B 2BL4A 3AR7A 3L4KA 2J7PD 5EFZA 5REQA 2OYCA 1SHZA 3KYJB 1M8KA 1UQTA 3G9QA 5IK2A 4GKKB 1YGYA 3GVXA 1QC5B 4DANA 1YR6A 2CLEB 3S5UA 1WETA 2BFBA 1L8OA 2PU5A 3O8BA 2YY6A 4KQ6A 4YBZA 1Z7YA 3I9FA 3PDCA 3JTMA 3U4CA 4D3FA 5JJCA 4AN0A 2O1XA 1M7BA 3DKVA 3JD4A 3QWHA 3ESQA 4BJ3A 2RKWA 2ZTVA 1ZGAA 3M1AA 1TZJA 2AWNA 4IIYA 4QOSA 1SIWA 1CY0A 2P4SA 3SBEA 2XGOA 4AS2A 4JT8A 2WVHA 1VL6A 1T8PA 3OZDA 2OV3A 4ZI7F 1DDOA 3ESXA 3QGMA 2IYVA 1P2VA 2QLFA 3NGMA 3S1SA 1OW3B 1QO0D 3E35A 3LIPA 1JHXA 3QXHA 5JDIA 1UJ6A 3ETHA 3LT4A 4DPMA 3RT7A 1IYZA 4BB0A 2HRBA 4MQ5A 4RD2A 4HI0E 4E4RA 1X38A 1YRAA 2JFUA 2GZHA 4WE3A 2XCQA 4XVUA 3AFHA 3HUTA 3OICA 1WEKA 1XYVA 4RLQA 2X0DA 2Z83A 3SYMA 2PX3A 3A8TA 3BXPA 4TXNA 3FYUC 2P27A 5K05A 1EA7A 1U3GA 3D0OA 4TYNA 4L5YA 2ZRJA 5F35A 5JCOC 3L0SA 1CJUC 3OAAA 3VKHA 5HIKA 1JHAA 1SA0A 3M5CA 4ID3A 5IARA 3PXAA 1U2PA 4LI3X 5LXTB 3QVUA 1L5OA 2DFNA 1S0UA 2Y0CA 4HFRA 4RLFA 4YB8A 4EH1A 5T7BA 1Y48E 3PFBA 5AVSA 4Z4QA 3EXEA 5CVDA 5CT5A 1S2GA 1EHIA 1EX9A 1BQEA 1PX0A 5F9MA 1CIVA 1GVNB 3I2KA 3QPUA 4MCIA 1Q1BA 2QUAA 5CPFA 2IZ7A 2XV1A 2FEOA 1MVOA 4Z9BA 5K0EA 3SXUA 5CM9C 3RCBA 4RPHA 4BO6A 2Q4RA 5C8ZA 2D2FA 3FKSD 3G8DA 2YZGA 4YCAA 4OQZA 3THRA 3VU9A 1KC1A 5CA0F 4Q05A 1TZKA 2I3ZA 3A7DA 4MW6A 3Q6NA 3DUFB 5G0SA 3T6KA 4AULA 3VDQA 3PHIA 5F21A 4IHJA 4WI1A 1QS0B 2ADOA 3GT0A 4EUEA 3D5TA 5JZ9A 2HT1A 3FWPA 1ZIPA 5LQUA 2W6MA 4MJLA 1XXHB 3IA2A 4XWYA 2COUA 1L8LA 2ZJ1A 4WK6A 3BTUA 4MQFA 2AVDA 1SBIA 3LUKA 4HGYA 4B4VA 7ADHA 4F0JA 2NP7A 2C1XA 4YYZA 1SU6A 1SCUA 2WWRA 3CJQA 1V1MA 1KS2A 2QVBA 3NBFA 1ZK4A 1C30B 1PR2A 1TC1A 4GOND 1WHTB 4F4DA 2G08A 2D1RA 1QUEA 3V42A 4X6UA 1PNVA 3GLHE 2Q9UA 1CQXA 1GQYA 4TLCA 2M1ZA 2P4UA 3LUPA 1GNQA 3L7AA 3O31A 4ZP1A 1OB5A 1D07A 1T1JA 3IQGX 4IQ0A 3JWPA 3I9LA 1GA1A 5FYDA 3ADPA 1FU8A 2I80A 1D7OA 1PZGA 3HFGA 4ZQFA 4A73A 2QSJA 4LHSA 4LJRA 5D84A 3TB6A 5KYUB 1P1RA 4H77A 1BZYA 1PZHA 4IINA 4JB8A 2LCIA 4QEDA 1IAVA 5AJWA 3SOPA 2QL6A 3E81A 3PCRB 3EPJA 2JB9A 5EFOA 4F45A 3IIMA 4BO9A 1F51E 1L5HB 1UAGA 1HC7A 4GXRA 3G68A 4H7EA 2WA2A 1FDOA 3O4JA 3N0TA 3WGHA 1PG5A 5DBOA 4CCYA 3WLKX 3E7DA 3CT6A 5EXDA 2VHZA 3PQDA 5KOIA 1CJMA 3OESA 5DH9A 2P91A 3JVDA 4BJ5A 2Q5JA 3RSLA 1E4VA 3EVAA 1OWLA 4Q4AA 3EGOA 2XTZA 3GF4A 1BXZA 4HMQA 1GT6A 4UEOA 5F2EA 1P2SA 1XEAA 3RRNA 1MN6A 3HLKA 4YI5A 1K9SA 4B5LA 4M9XA 3F9RA 3M4ZA 4PZZA 3CBQA 1MQ9A 5KJ1A 2QD3A 4ZJUA 1IZ9A 1N7GA 1AHIA 1ZGGA 2VSFA 3FFWA 4YA6A 3UAGA 1CY1A 4LF5B 3L6BA 1V6SA 5CXXA 1HQYE 3JTEA 2RH9B 3U9LA 4I4IA 1ZG3A 1WD5A 3DH0A 3O8CA 2GYWA 3LGSA 3HVKA 2H5IA 3ETDA 2XQVA 5GONA 4MWSA 5EMHA 4FN4A 4GI2A 4TS3A 3WB2A 2W37A 2QTHA 4J7UA 1P9LA 3DW1X 1NI5A 1G3IA 2V9ZA 2FEKA 4ZPXA 3I6ZA 4B4DA 1KMHA 3IP8A 5EAIA 4TKVB 2YQ4A 3TH5A 5B7QA 5JPDA 3MIZA 2VCEA 1VLJA 4LJAA 4DJJA 3DXZA 4PEVA 3P2MA 4EITA 1E9RA 1LB1B 1TT5B 5BYAA 1L2TA 2JEOA 5DISB 3DOUA 3KOXA 1AXEA 4DHEA 2J5XA 3AYXB 5JPIA 3RRXA 2J4CA 4DXAA 1HEUA 4INJA 1KK2A 4HGPA 4WW0A 4BNZA 3GROA 1FQOA 2H7YA 5KTRA 3GLRA 3W2HA 4DYDA 4S05A 3E1SA 5FBLB 2BHLA 5ELMA 2ZSEA 3CF4G 1ML3A 3N75A 1WCIB 1Y7LA 5A4IS 4URWR 3NYQA 1L0BA 3ZJTA 1TAUA 3M6FA 5A02A 2JKVA 2MSLA 3F8SA 4CM4B 5J5CA 4KBFA 2XDAA 3IDAA 3ONWA 1W1UA 3IMKA 1P1JA 1PL7A 2EIXA 2GZAA 1GQSA 2ZI3A 4V0KA 2O2SA 4KSBA 4BY9E 1RCFA 3IL2A 2ST1A 4AT1A 2PUGA 1UINA 2GN9A 2P6MA 2YXBA 3AF0A 2WR8A 1LBQA 4HWPA 1IN7A 1CD5A 1ICEA 1MBZA 2PZKA 2XCIA 3NBAA 4O3FA 1JPNA 2W2QA 1DMSA 4ME6A 4WT7A 3TS1A 5BN5A 4OYRA 4GQIA 2NPIA 2C0CA 2OAEA 3JQCA 4KXNA 3X1JA 1AGXA 1TEXA 1V2GA 2XF2A 4JGGA 1PS8A 3P9XA 4TVOA 4CIDA 2JANA 5C35A 2BDEA 4JLAA 1SD1A 1ZKMA 2EFYA 1XMJA 2C4WA 3DFIA 3LO8A 5KNDH 3WLEA 1IIBA 2WJGA 3J81k 1Q0UA 1KQFA 4DRYA 5H82A 5ESRA 3R7WB 1XU4A 3MJHA 3PJEA 2DPMA 2VQSA 3UPDA 1MA0A 4XJTA 3VR0A 4UHEA 3P4YA 2FMFA 2BKAA 2FSVC 4QA9A 1PU2A 5BVHA 2B20A 2KMLA 3OCVA 3WGZA 3GJ3A 1EP2B 4Y1RA 1IPEA 1X1EA 2I8AA 3MWLA 2D8MA 4UBLA 2OBNA 4GSLA 2D0OB 1EGVB 3DR3A 1RRPA 4UAJA 4C04A 1X87A 2EP8A 1HFJA 1Z4OA 3RFXA 2VZ8A 4G1FA 3D4IA 2CJPA 2Q5LA 1A9SA 4OHOA 3NTVA 5CRIA 3WRVA 3OJEA 2GCNA 3RUFA 4DZTA 5KKCA 2PZ8A 3REGA 1WP4A 3A1UA 3M4XA 4PLVA 1VFPA 1MR3F 5LB4A 1I3LA 4WOBA 4B3FX 5HHTA 2P3OA 3GEPA 1YDGA 4FM9A 2YFKA 1VIDA 1WUHS 2CYBA 4EHHA 5GONF 1OMOA 3RSSA 4B3SB 3BX1A 5AJUA 4UQPA 1C2TA 3L4EA 1ECPA 1KY5A 3IDQA 2OCAA 4FHEA 1ENPA 3TIVA 1UXKA 1NE7A 3BAFA 3HKCB 4K9OA 1SC3A 4NBLA 2RJ3A 4UUBA 4EHJA 3WLFA 5IPFA 4RZHA 5BWCA 3O1IC 4ZAZA 2QV7A 1SXJA 5EHNA 1G8SA 1O1YA 2NU6B 1TA0A 3FCUB 4PW0A 1OFUA 3PX3A 1TC2A 1ZQ1A 2FFJA 4LRTB 3MAAC 4P36A 3V8BA 1J0AA 2BDTA 3IILA 1Y3DE 2UV8A 2O52A 3RREA 3U3KA 2FB9A 3C39A 4C3VA 4QOIA 1NC1A 1Z73A 3LQFA 1KZYC 1QIEA 3BXOA 3I8SA 2A9VA 3HKBA 4ZZIA 3WTBA 1OYVA 4R9NA 4OY3A 2P79A 4R4JA 4MI1A 4G56A 5IKOA 2WKSA 4OQLA 3DJFA 3OM8A 5FL3A 4DPLA 5AKZA 1NBWB 2PYIA 3D64A 2XT0A 2XNDA 1KFKB 2HV8A 2VOEA 5LDHA 4D44A 5IBQA 1L5SA 2FQYA 4JP5A 4BKOA 1H05A 1VBNA 1U7TA 2A2ZA 2B1JA 2BEVB 1KSGA 3QQ5A 1Z15A 3QVVA 1Q6YA 4KB5A 2WTXA 1Y7HA 4R40A 4NX2A 1JBQA 3R23A 4V0RA 4P6VF 1J5EB 1DT5A 2Z9CA 3GK3A 3H9JA 3M6AA 4Z9YA 3LKBA 2VYCA 1HEIA 2KM1A 5LIPA 1OYOA 3D3JA 2GEKA 2P2ZA 1Q0PA 5AW1A 5H9VA 4L73A 4MW2A 1MOQA 1B42A 2XQGA 3FCYA 2FN4A 3O9VA 2FG7C 1PTJC 2FW0A 1P8AA 2ZAMA 5C53B 1T29A 3G9UA 4GP9A 2JIPA 4IVPA 1BSVA 2OPHA 1JNYA 1GR0A 2YZNA 3ZIAA 2YV5A 4QUEA 1T43A 4NEHB 3ZWYA 4Z8XA 1C9JA 1NG9A 1F1JA 1VLQA 3G3EA 3GJ4A 2N46A 3K20A 3KEQA 5ER9A 1X74A 3IPCA 1WZCA 3CX8A 4Z5XA 4P80A 4L6IA 3HYCA 4K9PA 1Q7TA 1U8AA 4PLHA 4RY9A 3NDJA 1T4MA 1Z3IX 2R96A 4G0VA 1RWNA 4UHDA 1YUNA 2WJHA 4PC2A 3EYAA 2ZBFA 1I7QB 4II7A 1Q57A 1YQGA 4R0MA 3TZEA 3V8QA 2XMDA 4NXNB 1EVIA 1DKLA 2X1HA 4A8TA 1NR5A 1QH8A 2GLXA 2G09A 5ITWA 5K8VA 2ZXUA 4TTQA 1ISGA 1RKQA 2PZMA 5AXBA 2OORC 1B4DA 2G4CA 2O57A 3QVSA 4ZU3A 3VTZA 4Z1OA 3CLVA 3EEQA 3LLVA 4GEGA 4JUDX 4KWTA 5AVJA 4EP1A 3DTNA 5JJ5A 2WB2A 4JS0A 4FNAA 2X1MA 3GGJA 1JWBB 3X1DA 4YCLA 1GPYA 2BSAA 2O7VA 2OZLB 3RVBA 2W2LD 5EIWA 5LC1A 3WLRA 1NRXA 4YRSA 1EFLA 3CS3A 4FMBB 1LNZA 3LY9A 4PO9A 3VZPA 1DC3A 1DUIA 4RK5A 1NOJA 1QKIA 2GAAA 1JX6A 2PMFA 3DZFA 8ATCA 4RD3A 4B9EA 4GGMX 2QAIA 1GQRA 5IJ0A 1FFSA 2ZVDA 4CQMB 4BNNA 1RJWA 2K5UA 4CEHB 4GI3A 4CRWB 4C7XA 4E14A 1COWA 2CWDA 1ZN9A 2J4DA 1OTYA 2FP3A 4G24A 4F60A 4E5NA 3EUEA 2BBWA 3OI7A 4ZO9A 5J1TB 3H8VA 2F3TA 3F6RA 2JGAA 3QE0A 3K5HA 4GVPA 1F9AA 1SOWA 4P22A 2XJ4A 1OBOA 5K3CA 1VKOA 4K26A 2QTBA 4MJ7A 10MHA 4B8WA 4H7HA 3KHUA 4NONA 4OYHA 4P5DA 2J3JA 3VR6A 3CF6R 3DV0B 2QR2A 3BWCA 1KOFA 3HNPA 3NXSA 5BVGA 5C32A 1T8YA 2HJGA 1TB4A 3T1VA 5IMBA 2F90A 5A0FA 2VIIA 4LNUB 1AUOA 3LRPA 2WINI 3OJFA 2G9NA 1Q22A 1JXMA 2X9QA 3CZCA 3HMKA 3GJSA 5I6DA 2GSWA 2G0AA 3DZBA 1JSXA 2RAFA 3FBWA 2PH5A 2GEJA 2PUCA 4MGKR 4EPRA 1GLGA 4K1XA 2XKBA 3CRW1 5FUMA 2O2IA 1B23P 1KQNA 2CSXA 4A91A 1Y42X 2XVZA 3C85A 1JQKA 4L5JA 1V7PC 1J99A 1XG5A 3F6BX 1JQBA 3Q1KA 5D3MB 4QJ4A 1OJ7A 5C5IA 1Z5GA 3MRXA 4R2JA 5IW8A 1B6SA 4B5KA 4PBTA 3JQAB 3F73A 1P2GA 1Z16A 1WF6A 1NN3A 2AR9A 2MINA 3L5KA 5E1OA 4WACA 2PYDA 1A5ZA 4I1RA 4L2IB 2WIJA 1QSGA 1Z2PX 4TSRA 2BFNA 2VVTA 3FMGA 4U2BA 4AXBA 2XYGA 1XZHA 1BMQA 4UHJA 3ETGA 4QQ8A 2RGNA 5I9MA 1J2EA 1SU7A 2WWIA 2CXHA 3MF4A 3DZIA 5CH8A 2EP5A 2PSEA 1QPZA 4MZXA 2XY4A 1FNCA 4V03A 1W4CA 1BHJA 1ST2A 1JEEA 3REQA 1HSOA 1DTWB 1H2WA 2IOYA 4QECA 1JG7A 4TV8B 4DADA 2SECE 1AIPA 1GUBA 5TT0A 3VR5A 1GTMA 5T57A 3FJOA 1UBOS 3MCWA 2IQ5A 1S3SA 4ITUA 4NH4A 3Q3VA 1ISIA 4WKBA 4NK5A 4ALJA 1I3CA 2ORIA 4FS8A 5F7JA 4AZ3B 3GEEA 3JQBA 4QXQA 4ALLA 2GHTA 4L4SA 2BF7A 4RYDA 1JS1X 1RLMA 2M98A 2IEGA 4LMRA 1B76A 1BS2A 1C3OB 3AG6A 3QSGA 3C3YA 2ZW9A 3BK7A 2G6BA 4Y98A 1PJ2A 3H8SA 3WAJA 1DQYA 2F62A 3C3PA 2DJ5A 4HVCA 2RIPA 2QU8A 4HKTA 1NLUA 1H0RA 4I8XA 3FUTA 3MVEA 3L9WA 2NGRA 4Z8YA 4I55F 1X0XA 3RIMA 2JJ2A 1C1DA 3G9XA 3GHYA 5F3DA 1QB7A 4WA8A 3ZTTA 3AXSA 4U6NA 5JO9A 5IASA 1WV0A 1V8OA 3TLCA 1C0EA 4KR2A 5JXIA 1Q84A 3FNHA 4ZOAA 4DV6B 4XVCA 3NHYA 2W2XA 5TF4A 1KJ8A 2IXGA 1XAJA 1JQ3A 2XEDA 1PQYA 4DS3A 3T3HA 2IPXA 4BVEA 5JTTA 1YQ9A 1Z5VA 3DDNA 1E7QA 5ELLA 5T67A 4U5XA 2VFAA 1DWOA 3OT1A 2BR5A 4OK3A 2EGUA 4P3PA 4B3TB 1GFWA 2RC6A 1C80A 1NOKA 1SUCA 3B3GA 3CUKA 1HNNA 4XASA 4BGDA 3T52A 1DMRA 1RFLA 3AEXA 4Q47A 3QWFA 4NJEA 3MBKA 3Q3IA 1TJYA 4MW5A 4MWTA 5AOCA 3D43A 4C2AA 1L5NA 1JV2B 2ZP1A 3R0VA 5JNUA 1G20B 1BIFA 3VR3D 1DPFA 1YFJA 4RMNA 3WGYA 1USKA 5HZHA 4ND8A 3WL5A 1THMA 5EERA 4DMGA 2OBFA 2IP2A 4LG1A 2R86A 1T4BA 1UWKA 1I3OA 1DRVA 2WD7B 3KAPA 1V4NA 4IIVA 4Z0PA 1VJ1A 3ZCUA 2PZLA 5K0TA 2RE8A 2OOKA 4FFOA 2JFWA 2VBIA 3OY2A 1UMDA 2J09A 4MV1A 4BP3A 2N47A 4N65A 4KR9A 4L5BA 3NTQA 3SC4A 2HMSA 4ITVA 4OI2A 2EL7A 1WPQA 2ZR8A 3C1TA 1YS7A 3U40A 2PMWB 2J6BA 3LYUA 3MT0A 3RVLA 4B6GA 3ICWA 1XMOB 1ATIA 5M34A 4R1MA 1XUOA 1B6TA 3ABSB 1BGVA 4GIBA 3QU7A 4GEKA 1RQ2A 5CDFE 3OQMA 3AKDA 2ID7A 1E5LA 2RK4A 4P34A 3FVWA 3H1AA 5AJXA 5IT9A 1B0UA 3HCBA 1LZLA 4DLTA 3GGCA 4JVSB 1YAHA 2CLOB 2IDZA 3GRPA 4I50A 5AT1A 5BSHA 3FUWA 3VYVA 2QQ5A 2GX6A 1NA5A 4C0JA 1CUFA 2PKXA 2XYHA 1M6NA 3MAJA 2G0TA 2WT9A 3KPVA 4L5CA 3HY3A 4L6AA 3UEOA 5J4KA 4QC2A 4JX9A 3G0GA 4ETWA 4PQGA 1T0UA 2WD9A 3DOOA 2REQB 2QRMA 4TROA 1B73A 3P4UA 1FB5A 3SVZA 4D9CA 4IL5A 4HWKA 4NFSA 4U9HS 1Z39A 2FF7A 2DBYA 4N5IX 2XWBF 3I9NA 4D3SA 4E5UA 1F7UA 3S0JA 1P2DA 2QTRA 1AS3A 1QIDA 1J2YA 4IWXA 3UUFA 1KMMA 2O4UX 2BN4A 4XPZA 3ZGLA 8LDHA 2F9MA 4JD5A 2O8FA 4JXXA 3FNGA 3MCZA 3RC8A 3NJRA 4DDHA 1E6MA 1K0UA 2CFTA 3MMZA 3HCRA 3VJLA 2I7XA 3K9QO 3WR5A 2AJDA 2QQ0A 3AYZB 4ZOLF 1HKHA 4EB6A 4E31A 3KCQA 2WUGA 2QOEA 2J6IA 3WL7A 1VG0B 5ALTA 5MF6A 3VTKA 4EG5A 1DJOA 4AL4A 3KETA 1JIVA 2DVMA 3NHLA 1QYIA 3CW9A 4MULA 2JFBA 3WY9A 1X1DA 2MDTA 2Q0XA 4R2IA 4AXXA 4CG2A 3UMSA 3SWWA 3GP3A 2ZUWA 5EY5B 1XPJA 3Q4GA 1M75A 4NENA 4YFYA 4QODA 4BB6A 2FUNB 2OO5A 5BW8A 1NLFA 2CB9A 5EJ9A 1OAOC 2NXEA 3BRCA 3MJVA 3PE4A 1FMJA 1XALA 2Y93A 2WDPA 3P20A 3PCXA 4JLJA 1EM8B 4XI9A 5D3QA 2ZYAA 4OHZA 5LP6A 5CCBA 1TQ6A 1J2TA 2AZ4A 4HFMA 3FRIA 2NU9B 4MCHA 1JLRA 5CLGA 3DONA 3NORA 3R6TA 4EF4A 1XKTA 4RVFA 1E5TA 3OCUA 2ZOSA 3CPHA 4QREA 4UAVA 1ZI8A 1QHXA 1E1QA 5EEHA 3Q8KA 1ISRA 3CPSA 1JLKA 2JASA 3ST7A 1N33B 3FLBA 1AS0A 2MSKA 4OX9Y 5LOVB 1ZD4A 1U6KA 1KP9A 2NZUG 2Q6LA 4IILA 5L4NA 1YIOA 3WNVA 5KJCA 5J40A 5C4MA 3W3AD 5KTTA 2WG0A 4B31A 3INTA 5AI8A 5HK9A 2HU7A 2JGEA 3HI4A 3JQRA 3QX3A 3E15A 1ATZA 4DBZA 4X54A 4PC7A 3WMFA 2UUOA 4ER5A 1TYDE 2P6OA 4R5HA 1W5EA 3SQNA 2VHUA 5LJIA 2UUBB 2ZFUA 1UDRA 4R16A 5K0FA 4ALIA 1KRXA 4PAGA 4Q3DA 1WLSA 4U6SA 4YJFA 1THZA 5ALSA 5EJ2A 3H1TA 1P2UA 3CEMA 4MEBA 1K1EA 4C6RA 1AF4A 3N3BC 2EARA 2ID4A 4GAEA 5ELXA 3U1VA 1RKBA 3UO8B 1ND5A 1O97D 2E37A 1LI5A 3MNFA 2JNWA 2ISSD 2MCFA 1BFDA 4ER0A 5IKMA 5AVUA 2V55B 3TRJA 1U2ZA 2HPHA 3I3OA 3PJDA 4N5LA 2YJTD 3DB1A 4YUYA 2G9UA 3LY8A 4N5NA 3CR8A 5K6AC 5HG0A 3HUUA 4Q00A 2R00A 1ODSA 3P5BA 2CBXA 4Q19A 1G7TA 3DOIA 1Z45A 3NHPA 3W2IA 3PWTA 3ZWKA 3JWIA 4BRSA 3DMNA 4FR5A 1XTQA 5DTMA 5KTSA 1XZEA 3SXJA 2IP4A 3FVRA 3KWMA 1HZZC 5HS6A 5A9RA 5C37A 1QYRA 3NYIA 4WJKB 1ZOIA 3I9KA 3MPUA 1HA3A 5FA6A 4CMGA 3GCDA 1G60A 1UADA 1D2MA 4RO0A 4QUAA 3GI1A 3MGKA 4ED9A 2VH2A 7MHTA 1PX2A 4E5YA 4YLYA 1Z7EA 2YJ3A 4AQ7A 3Q98A 4QWMA 4UFNA 3HG7A 2NU7A 2YFHA 2J3QA 4FMDF 4E2YA 4DJDC 1HDXA 4H2DA 1WVGA 3T5GA 2NO7A 3TUJC 3SZ3A 1NWCA 3N0VA 2OENG 4DEVA 3PDWA 3PEWA 4TGLA 3QX8A 2VHJA 3ZWDA 1B0AA 3COSA 4KAXA 4N5DA 3PX2A 4DGSA 3R6LA 5A04A 4WBNA 1P3Y1 2UKDA 5BXQC 1Z8NA 1XFDA 1R0ZA 2CXNA 4C7MA 4HDNB 5AI4A 3D54D 2IH4A 3K05A 1LPMA 1IBSA 3PFNA 2QMOA 3I34X 4DSOA 3DCIA 1S2DA 3JYNA 3HA3A 1NRWA 3EXFB 3OUUA 4LPKA 1WKBA 2VRWA 1SCDA 3PGVA 4QAJA 2R47A 1T9ZA 3EVTA 4JR2A 4N6NA 3J7TA 1S3GA 3BD6A 1IEXA 3KDAA 4X7BA 5EKTA 4JODA 3ISVA 4TTJA 1FX0A 1T3ZA 3FTQA 3Q6IA 3UMRA 1O95D 5J47A 2ZS8A 2GDZA 1S8OA 4CKCB 3Q3GE 3HJGA 3MN1A 4Y6SA 3R0QA 5FNZA 3FA2A 3AJEA 4D57A 3W5AA 5CEEA 1LA2A 4G0YA 5F9HA 5DGCA 3TLZA 2PS1A 1JB9A 2P77A 2JA1A 5I9NA 5BMVB 1IZ7A 3EVBA 2XIJA 2PKEA 3CX7A 4GOOD 3E9RA 4X8LA 1DSSG 3HV0A 5DYYA 5A71A 1QMIA 2C2WA 3VDXA 3CLHA 3AM1A 5GAJA 3LUDA 1W52X 4BBJA 5FX2A 3D6HA 4UOZA 3N6VA 4XZ3A 4O2BA 3SQLA 3DMFA 4UULA 1MJGA 5A3QA 4C3ZA 3RU7A 4QE3A 3MRVA 1QV7A 3IVGA 4DRZA 1NPTO 1ORDA 2H07A 2ZANA 1I36A 5LJLA 2ABWA 2R0QC 3G2IA 5K3SA 1RCTE 4JJ8A 4WXEA 3S5JA 3VC7A 3BEDA 2WIBA 1THTA 1PEAA 3DHVA 3NHSA 4MPTA 4NC9A 2G76A 1E5VA 2WYWA 4CKEA 5EJMA 5TR9A 5IZCA 1MO3A 4MWZA 2PLWA 2W2PA 2FZVA 3PTLA 1NSTA 3BXHA 2D2IA 3L06A 1WKVA 3T95A 3FKJA 5HSGA 4EARA 1U3WA 2IW3A 1GFSA 2G1JA 3D3EA 3G17A 3QBTA 2Q4BA 4CM3A 3IUQA 2QAJA 1GEGA 2FY8A 3G2PA 4R1NA 2IDMA 4RF4A 2Q99A 2Q50A 4F9TA 1FQWA 3L0CA 1FCJA 2KS6A 1JLMA 3L8CA 4XLZA 1R6AA 5REQB 3A6JA 3WJ2A 3D4BA 4HUTA 2ZUSA 4S1TA 2HK9A 3ZV5A 4JEHA 4UNIA 4EVQA 4NS1A 5J3JA 4LFAB 2QJFA 3A4IA 1T26A 1NJSA 3WAGA 2WZCA 3C6QA 2YYSA 2KSQA 2VNIA 5F64A 5LMCA 3KELA 2QPLA 4FWTA 4JL5A 1IOWA 3VU0A 3TQTA 4BXOA 3RIHA 1C9KA 1SELA 2DCMA 3IUBA 4RHTA 2VJBA 3G0BA 5GVSA 2ERXA 2VZ0A 5JWOA 5KHLB 5E0OA 1GDDA 3MFYA