3ZCXA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
total genus 116
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zcxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zcxA01
1I3LA 3ZV4A 4NBTA 3TN7A 5JW6A 4N5MA 4M87A 2IYOA 3D4NA 3KBOA 3OA0A 1B3BA 5MGBA 2V6BA 4D79A 1GZ3A 4R16A 1NVTA 2X5JO 2ZB7A 2Z1MA 4S3MA 2PWZA 3OQ6A 4H7PA 1WWKA 3NKLA 3NJ4A 4YAJA 1AGNA 3ENKA 3I4CA 3ANMA 2GN9A 3DWFA 5U4QA 2VHWA 1YDWA 3VOSA 4R3WA 2Y99A 1SB9A 3KZVA 2I3AA 1NFQA 8ADHA 1DFIA 2PD3A 3ZCXA 4M55A 4HKTA 3PIDA 4YCAA 4CMBA 2ZTUA 1WXDA 3WICA 2HMTA 3WLEA 1QR6A 4MIOA 1HT0A 2FR1A 4OAQA 4GAEA 4CR7A 1EFLA 1TT7A 1DJNA 2IDZA 4ZU3A 5DDIP 4QTZA 3C24A 5JYEA 4U8GA 2QG4A 4EEZA 5IDQA 5B37A 3GFBA 5JC1A 5KCZA 4KWIA 1ENYA 4OXKA 4K26A 4UUPA 1RPNA 1E6UA 1P45A 3E82A 1SC6A 3D4OA 5JCJA 5ER6A 3U5TA 1HL3A 4YXFA 2Y93A 4O6VA 3FI9A 1PJBA 2X6TA 4DBVO 3JD3A 1ADCA 3HHPA 4XX0A 2UV8A 4KP7A 5TGDA 3O9ZA 5CEEA 3WGOA 4LK3A 1YH3A 3L6DA 2B83A 4BKRA 3U3XA 4AJPA 2FZWA 5A9SB 1ZNQO 3AFNA 3OH8A 1EE2A 2HDHA 2ZQZA 2X4GA 3IP3A 3GLQA 2GASA 3F1KA 4ZJUA 5AQ1A 1UAGA 2CDCA 3TZCA 2BF7A 3WFIA 4I1IA 1GR0A 2FMUA 4TVOA 1KC3A 4GL4A 4A27A 1YRLA 2C2XA 4DLLA 2JFHA 5TT1A 2D4AA 1ZBQA 2VWGA 4MVJE 2AE2A 5IZCA 4QFDA 4NPCA 2GRAA 2DU8A 1LDYA 4J3FA 3ROQA 4O1MA 4GVLA 2I6TA 3JYOA 3ZWAA 4CR8A 4BNMA 3GG2A 1UH5A 1XSEA 2D3TA 3VKUA 3PGXA 4KWHA 4BB5A 1HE4A 2P9EA 2VRBA 3JD1A 4KQWA 1A72A 3CXRA 3CPSA 4ONEA 5LDGA 2A9FA 1VPDA 2QRKA 2JD1A 2EKLA 4E3ZA 5TLSA 3OA2A 2I3GA 1C0IA 4GWGA 2HQ1A 3VPHA 4A73A 1XU9A 1B8VA 4IM7A 1YS4A 2CF6A 3GRKA 4ZRMA 1PGPA 1BW9B 3OMLA 3VH2A 3FNHA 4BKPA 2P4QA 4A26A 5C7LO 2EGGA 1H93A 1KVRA 4CMCA 2YFHA 1VKNA 2VYVD 4BVAA 1XHLA 5FFFA 3E18A 4YT5A 4J4HA 2CDBA 1DRWA 1KY5A 1KEUA 1P31A 3L4BA 5T8KC 1Y9EA 1H2HA 4N54A 4RPGA 1HDCA 2F00A 2WEKA 4Y6SA 4DREA 3KYDA 4AJJA 4FOOA 1NHGA 3QP9A 3H9UA 2DT5A 1RJWA 1PJ3A 2YV1A 3PQDA 3HZZA 3KLMX 4G65A 1QORA 3W8EA 4Y98A 4IJVA 4KZPA 5LDHA 3A1NA 1N7GA 1F0YA 2CZCA 4OYRA 2QQ5A 4M8SA 2BI8A 4UVDA 2O23A 2IYPA 3I3OA 3LQFA 4NFSA 3WDSA 4EITA 3VH4A 3VPXA 4ZVVA 4Z9XA 4B4OA 3EHEA 3JQ6A 5THQA 4ALKA 1OOEA 1N8KA 4PLTA 4CQMD 3ZW9A 4E21A 3DBLB 4D43A 2GYYA 1B15A 3ANLA 1JKIA 2AQ8A 3ADOA 4OHUA 2WE7A 2X58A 4F6CA 3D5QA 3PLNA 2E6UX 1UR5A 4CM1A 1WLYA 2G1UA 1MA0A 4CM4A 2FR0A 3N74A 5IJZA 3BMOA 3GGPA 1ORRA 1QLJA 1EVJA 4CV3A 4NK4A 2FHSA 2G5CA 1HLDA 4MINA 4JJIA 3JQ9A 1LLDA 2OHXA 3H9QA 2FWMX 1X13A 1AXEA 1X0XA 2V6FA 4BNUA 1GY8A 3HFGA 4RPLA 2NTJA 4ND3A 5JO0A 4CMIB 4MJLA 5DULA 5EMHA 4CLRA 4YRBA 3EK2A 3S8MA 1ZXLA 1VL6A 5TF4A 4XCVA 2EP7A 1AHIA 2OORA 1KVQA 1ZMOA 4M49A 4H3VA 4WKGA 3OFSA 4FCCA 4JGBA 1IE3A 2UVDA 5EJ2A 1GAEO 1DEHA 3Q9NA 1IHXA 1FMCA 2B4TO 3GC6A 4RF4A 2P91A 4R1SA 2IEBA 3AOEC 3NDRA 4A7PA 1VM6A 5GMOA 4HWKA 1H5QA 3BTSA 5AVOA 2VWPA 5L95A 2X9NA 3DO5A 1B16A 1VSUA 2D0IA 1NFFA 4R1NA 1RM3A 5CDGA 1IB6A 4QO7A 1I3NA 4NH4A 2YJZA 4R5MA 2X7HA 3QY9A 4MOWA 4YACA 3Q6IA 2EG9A 5GZ3A 4O59O 1ZH8A 1BSVA 5L4NA 1VSVA 2DPGA 4JLWA 1TI7A 4YA6A 1IULA 4WLNA 3UGKA 1JU9A 2CNBA 2GDZA 3WGQA 2C07A 3ZI0A 3W8FA 2RHRA 3F9IA 1LNQA 3F3SA 3GEDA 1QP8A 4U7WA 1LDNA 3QV1A 1C1XA 3PJGA 1EBFA 5M6DA 1EUZA 1D7OA 1KEVA 2X86A 1E7YA 4NJMA 3TZQA 5JCJD 3KSUA 4W7IA 4OO3A 4J7XA 4BNKA 4FN4A 4OXYA 2HRBA 1UXHA 3Q1LA 2WTBA 1ZJYA 1QKIA 2XPCA 5CDUA 3ETEA 1NQAO 5CDYA 5C37A 4YJHA 4J9VA 4DA9A 1Y8RB 3L77A 4MVJP 1C3VA 4IZHA 1PL6A 1U8XX 4EI2A 5ITWA 4GX2A 1AUPA 3K9QO 2FOIA 1LJ8A 1U1IA 4HBGA 4PGFA 4JBIA 3PHLA 1HSOA 2V65A 2NU9A 4RL6A 4C7KA 1NFRA 3JQ8A 1FDSA 1NYTA 3D7LA 1H94A 1JN0A 1V3VA 5G0VA 3GUYA 5KJCA 4UUMA 3E5MA 4WOKA 1LI4A 1KIFA 2GN8A 3E6AA 3FNFA 5CFZA 1K5HA 1ARZA 1PJCA 3WMWA 1NASA 1PIWA 4BO2A 1SAYA 3HUDA 1Y5RA 3EGOA 4AICA 1YGYA 2ZATA 3ZW8A 3OQ1A 3ZNPA 1N7HA 3OIGA 2O3TA 4YAKA 4Q3DA 3ETDA 3O26A 3AOGA 1N1GA 4RF5A 4D45A 3GOHA 3PJEA 3JQ7A 4R41A 1H0KA 2AEJA 3PFFA 5IN4A 4I8XA 1ZXBA 4NBVA 4QUKA 3DAFA 2JD2A 3KXDA 4P4LA 5G4KB 3JQCA 5KIAA 1PZHA 1CQJA 2WD7A 3M2TA 4EUHA 2UYYA 1KY4A 2VCYA 4WNIA 2PKRA 5JO9A 4IIVA 3ST7A 2ZYGA 1EFKA 3RVDA 1DBVO 1P1KA 4E4YA 3R3SA 4MKXA 4LVUA 2FPPA 3DAGA 3QWAA 2CVOA 3LT4A 3SLGA 4BL5A 1YB4A 4YEDA 1X7DA 4MVJA 4CLRB 1K6JA 1PTJA 5F1PA 1UZMA 5CHEA 1I2ZA 5TT0A 2B4RO 1QLHA 1UP6A 2PGLA 4NDNE 2VTEA 2GUGA 1QYXA 2AW5A 3GPIA 1X1EA 4HFJA 1IY8A 3PDJA 5TNXA 4FFNA 2IXAA 1FK8A 2OUIA 5L9AA 4QFCA 3JV7A 1ZJZA 3VPGA 3EVTA 2VYND 5DF1A 4RPHA 3DOOA 5KTKA 3DZJA 1WW8A 3AI1A 4KOAA 3V2UA 1TLTA 3SX2A 3TOZA 4I5DA 3SC6A 3JSAA 3JQGB 4YT8A 3T4EA 1DHRA 2PKQO 3DMTC 1ULSA 1GCOA 3PQEA 4PLYA 4LRSB 3DBVO 3TL2A 2ZKLA 4FFMA 5GZ1A 3WOHA 5L51A 1R37A 2BELA 3TZKA 2QRLA 3W1VA 4TKMA 1B14A 4BNHA 4Z6KA 1ADGA 4CL3A 2NV6A 1LDBA 4FSHA 3NGXA 2P2SA 2GO1A 5EIOA 4A03A 2I99A 1E3WA 3ON5A 2HMUA 4K1LA 4RVHA 4YVFA 3FN4A 1GQQA 2EHDA 4RQTA 3X2EA 3VDRA 3K73O 3VH3A 3ZHXA 4E6PA 1GDHA 1CEQA 2Q1UA 5DBIA 2Y1DA 3NYWA 3V1YA 1ZK3A 2E37A 2GCGA 2Y67A 4IJWA 4HFNA 4BO5A 5HRUA 1Z75A 4DLBA 4F45A 1NPTO 1ISFA 4CL8A 1LBEA 3K30A 4R51A 1UP4A 1Y8QB 1CERA 5CDSA 2GPTA 2ZCVA 1GPJA 2JFFA 3RQSA 3LVFO 3JQAB 5TSDA 3VH1A 4FB5A 1YO6A 2B36A 3PXXA 3H65A 3V1TC 3RBXA 1Z73A 5K6AA 4GKVA 2CVQA 3DZFA 1TXGA 4U6QA 3F4BA 2YDYA 2BFAA 1HLPA 5KVCA 1O5IA 5T64A 1MG5A 1DC5A 1YJQA 2E82A 3NDJA 3E5RA 1GFSA 1I3MA 2W2KB 3S2FA 1R15A 1LC3A 3SJ7A 1Y1PA 5A02A 1NX6A 4OKIA 3DONA 5KJ1A 1LDGA 5ILOA 4W7HA 3H2SA 2VZ0A 1P74A 1E5QA 3HN2A 4IUYA 1FDWA 4CQMA 3KM0A 3I6IA 3CINA 5EL0A 1LU9A 2BRUA 1JAYA 3Q11A 3WTBA 1J0XO 4IBOA 3MTGA 4BO9A 3I4FA 3B6ZA 2O3RA 3U62A 3TOXA 4IS2A 2Q46A 1HKUA 4OXNA 2OXIA 3Q2IA 5A5FA 3ZGYA 2AEFA 1ZSVA 4F6LA 4DUPA 5JYDA 3LLVA 4MVJM 2D5CA 1A71A 2GR9A 1ONNA 2LDXA 4RV9A 2GSDA 4E33A 4IJKA 2TMGA 3NT2A 2X0NA 3WIEA 3WX0A 3L4SO 1I3KA 2Q50A 4XEHA 4E30A 5HS4A 3ZWCA 4YAIA 4CM6A 1H6BA 4RPKA 1BXGB 3PP8A 1BVRA 4YAEA 1P9LA 3ITKA 1SZJG 4R5HA 1T2CA 2LDBA 3GEMA 1TEHA 1UP7A 1V6AA 2PH5A 1G0OA 4PLPA 4TZTA 1ZK4A 3JQ9C 4TQGA 2HO5A 2YHUA 2Y0DA 3NTQA 3IAHA 4O0LA 3WR5A 3KRTA 1EQUA 4YRDA 1JQBA 3ONDA 5I9NA 3Q9UA 1K6XA 4HFRA 5KVSA 3WGGA 3VZSA 3P5SA 1I0ZA 4N5LA 2C7VA 3E03A 2GERA 4II2A 4BNXA 1GL3A 4PLWA 3NTOA 1EZ4A 3OF2A 4Z0TA 3SC4A 4J0FA 3WG9A 5T73A 3MJEA 1BXGA 3CUKA 5JFOA 5JDCC 2VHZA 4MDHA 3JQBA 4RVGA 3GMDA 2JD0A 1U3TA 1PJ4A 3AY7A 3ZN2A 2O3SA 4JXKA 3DHYA 1H6DA 3S1LA 4YTEA 1LLUA 3U9LA 4AFNA 2PNFA 5U1PA 3C85A 1WP4A 2JHFA 2Q1SA 1E7WA 3ASVA 4U6SA 2ZCUA 4PIVA 1DIHA 1ENZA 4JNKA 4FS3A 3CZMA 4OSPA 3ZWMA 2J5RA 1ZCJA 1M6WA 2OMEA 4ZQGA 2NNLD 4DMLA 2DTXA 3NV9A 1GZ4A 4NJOA 3C3XA 4B7CA 2FY8A 4RVSA 4FDAA 3GHHA 2EP5A 4MVJG 3GZ4A 4HXYA 4G81A 1UAYA 3IL2A 1ZZEA 3WGYA 3LU1A 3L0DA 4DRYA 3ASUA 3D3WB 1GUFA 1Q7BA 4WJZA 4RLHA 3HN7A 4ALJA 4CMAA 4E12A 1TVEA 1DC4A 4FBGA 1PR3A 4YYZA 1R4MB 1WDLA 1LA2A 2QZZA 3ADPA 4I9HA 4NFHA 3E9QA 3OBBA 3L9WA 4FJ1A 3GUCA 2VHXA 4B4UA 3FPCA 4CM3A 4GH5A 1E3IA 4GLOA 4XR4A 2FZEA 4YRAA 1GQYA 4L4SA 4HV4A 4PVCA 2JCVA 2NUAA 3PZBA 1U7TA 1ULUA 3QWBA 4ND1A 4UVIA 3ZZNA 2B69A 1F17A 3LLSA 2CDAA 2O3JA 3WIDA 2OGUA 4JROA 1ENPA 3HWRA 3UCXA 4LMPA 1DSSG 4BS9A 2WD8A 6ADHA 2BH9A 1SB8A 9LDTA 4OOFA 5G4LA 3K6JA 4L76A 1DRUA 2AXQA 1DLIA 1I2BA 4MIEA 4E32A 3PZRA 4KQXA 2Q22A 4JIGA 4W82A 1R4MA 1ENOA 2HK8A 1GYQA 1JLLA 1P77A 2HMSA 2RIRA 3GVCA 2HU2A 1NVGA 3WQQA 2DBVO 5IDWA 3HJAA 1N9GB 3LSYA 4GPD1 4ZN6A 1Q7GA 1NBOA 3GR6A 1PS0A 3AWDA 4FQ8A 4CLOA 5I7EA 4FGSA 1HZJA 3GH3A 3L07A 4FC6A 5A06A 4ESOA 3I9LA 5L40A 3CMMA 2FPIA 3CH6A 3ZWOA 3M2PA 4OKNA 4BNWA 1BGVA 1PU2A 2OFPA 4TZKA 1ID1A 1DXYA 1W73A 4WK6A 2Y1FA 2GZ2A 1DDOA 1SMKA 2EEZA 1PZGA 5CAEA 3NTRA 4J1QA 3K2EA 4PG6A 1GADO 5EPOA 3KTDA 3ORFA 4O5OA 1U9JA 4CM8A 1E6EA 1G0NA 1OC4A 5TX7A 3FHLA 4D41A 4EDFA 4E5NA 1IYZA 4RF3A 5DCYA 4XDYA 4X54A 3T7EA 3DQPA 1MX3A 1PGNA 1DB3A 4PG5A 3QHAA 1P1IA 4EW6A 3OEWA 4DL9A 1PJTA 3TZ6A 1DPGA 2BFOA 4CLOB 2OZPA 1HEUA 3MJCA 1KYQA 4R69A 4AJ4A 4XYLA 1Z7EA 2B35A 5IF3A 4NU6A 3GDOA 1JWBB 3P2YA 4CV0A 3LT0A 1KVUA 3MWEB 3C7AA 4XZ3A 2Y1OA 2NU8A 4CUZA 1NNUA 3STHA 2C59A 4RGBA 4YT2A 1NHWA 1SOVA 3D0OA 2CUKA 4EJ0A 4YR9A 3DOJA 5JYFA 1MP0A 2W8ZA 3ZV3A 2ZB3A 3V2GA 3V8BA 4AJIA 4CMEC 2B5WA 3UVEA 4E13A 4E5PA 5A05A 5KKCA 4XB2A 3RC1A 2DBZA 4IMRA 3QWIA 4UAGA 4TWRA 5ES3A 3RC7A 1MXHA 3EZLA 4FPXA 4J1SA 2D8AA 4D3DA 2DTDA 4J16A 2VOEA 5JAZA 4G2NA 3JYLA 3U4DA 3ZV5A 4YWJA 4NZ9A 1A5ZA 1YE3A 1RKXA 2EW2A 1RYDA 1I5RA 1F8GA 2QW8A 2VHYA 3R1IA 1DOHA 4GSLA 1QRRA 4AL4A 1VL0A 4WEQA 3DHNA 1M76A 3MJSA 1XQ1A 1BTOA 3TZHA 2FSVA 1DIRA 3F4LA 2ZJ0A 3GEGA 4RVUA 1U7HA 3U4HA 2J8ZA 3IIEA 4KTVE 2C54A 4J91A 4XIYA 4EJMA 1VLLA 1F8FA 1O6ZA 2Q1TA 1Y81A 1E3LA 3T7CA 2PV7A 5JC8A 1U2DA 5I8ZA 4MVJH 2O4UX 2PGDA 3GNTA 3VHRA 5B1YA 4IIUA 2WMDA 2AHRA 5DZSA 4FR5A 5A9RA 1UXIA 3D64A 1YOVB 5BSGA 3KOUA 4XA8A 1DAPA 2E49A 1LTHR 4BGVA 1BDMA 4AJ2A 2HK9A 3WJ7A 2HMWA 2OL4A 3JTMA 4NBUA 5T57A 5THKA 4GWKA 4BHTA 3PWKA 3SJUA 3DTTA 3I9MA 2NWQA 1BHSA 3TPCA 4J2HA 3NT4A 3LF1A 1KETA 1ZFNA 4P38A 1NR7A 4ZHSA 1U4OA 1T2FA 3AUTA 3ROKA 3RUEA 3TFQA 1MGOA 4GMGA 1VC2A 2D2IA 4OIMA 2IEDA 2C20A 4IDGA 4IDBA 4R9RA 5DN9A 1ONPA 4CM9D 2X0RA 1HDGO 1HSZA 4R1TA 3GNQA 1QV7A 3RC9A 4IINA 3RFTA 1O94A 4R01A 5COQA 1N9GA 3QE3A 4BNZA 5CG1A 3WBBA 1H6AA 2W98A 5KJEA 4EGFA 2NTVA 1GEEA 5EQDA 2QX7A 3QVSA 5JNLA 2VUSA 4CQMB 1EK6A 1Z45A 2I76A 4GQAA 4MVJF 3D1LA 3WQSB 3RKRA 1ISJA 1XEAA 3MWDB 1XKQA 3MZ0A 1BXZA 1CETA 1G1AA 3H4VA 2PZJA 3I9OA 4WNCA 4HP8A 4IY1A 5MDHA 4AJOA 5AYVA 4BKQA 4IJUA 4WUVA 3AI2A 2Y68A 4KMSA 3WWZA 1Q0QA 1XR3A 3AJRA 5CEJA 1Z7BA 4WCFC 4DPMA 4F46A 1HE5A 2J3KA 5JMPA 3B70A 3NJ8A 1YQGA 4PCVA 5U9CA 4XKJA 3KB6A 4CODB 2Q2WA 2W90A 3EY4A 2G76A 3G3EA 3ICPA 1FDUA 3DTYA 1ADFA 4XYEA 2NADA 1LQTA 4K28A 4CMEA 5A1TA 4UUOA 1UXKA 5GZ6A 2O3QA 5TJHA 2H9IA 1U4SA 5ENDA 3BMNB 4O63O 2PR2A 4R9SA 5H81A 3WNQA 4BKOA 2NU7A 1B7GO 4CJXA 5A3VA 3PHHA 4NI5A 2O7SA 2Q45A 3DR3A 2TMDA 3JYPA 4HFMA 2YUTA 4BQRA 4QSMA 3OECA 2JCXA 3LC1O 4LISA 4DBZA 3WNVA 3SXPA 3RSHA 4CM5A 4DYDA 1LSSA 2AG8A 1H6CA 4RF2A 4RVDA 2ZTLA 4TKLA 1R12A 2RBEA 2G82A 3RJ5A 1RM5A 2A35A 3ZNQA 5B12A 1MLDA 2BFMA 2BGMA 2NVUA 2GN4A 2WDZA 4FOSA 2O7QA 1R6DA 3EMKA 4XD2A 4E2WA 7ADHA 4ALLA 1XWFA 1U8FO 1JW9B 4UEOA 1DIBA 3JYQA 3QSGA 4W9NC 4K6CA 2A94A 2AQIA 5L45A 1I2CA 3PYMA 4ZGWA 1QG6A 2NACA 3PRJA 3ZU3A 3DZIA 4ILKA 2B37A 3RUCA 2YZ7A 2DKNA 1D1SA 3DBRA 2WE8A 4RJTA 2DFVA 1BG6A 4L4RA 1CRWG 4RVFA 2O4CA 4Q3NA 3RIHA 3U49A 2DQ4A 2YDXA 4NK5A 2NVBA 1OBFO 1PJSA 3Q0EA 1T25A 1HDOA 2UUOA 5TC4A 1B8UA 4YBZA 1KEWA 3IUPA 1HYEA 3O38A 1PQPA 3DXFA 2NVUB 4AVYA 3HB4X 4CLDA 4FIZA 4DQVA 4IPTA 3DBHB 3QA9A 1E7MA 3FTNA 5CG2A 4L8VA 2BHLA 5T67A 4XQCA 2O2SA 3ROMA 3FR7A 4KUEA 3NAQA 4GGOA 3HDYA 3JQAD 3OIFA 4BMVA 2PY6A 3NUGA 2EWMA 5IZCC 2EERA 1YBAA 1IZ0A 2PLAA 4UEKA 1A9YA 3LZ6A 5JYAA 2ZIZA 4P22A 1QYCA 4PZDA 3Q3CA 1ZMTA 2GLXA 4DMMA 3GAFA 1B26A 2DFDA 4FFPA 3RFXA 3WXBA 1XLTA 1YWGO 1EEHA 3WSWA 1E3SA 4N5NA 1QXSA 3UN1A 1NXQA 1NAHA 3KVOA 2CMDA 1HETA 3TFOA 3QW2A 4GGPA 1QMGA 3MTJA 2PFGA 3RBVA 4R54A 1NQ5A 1GZ6A 3GDGA 2PD6A 3HFSA 3VDQA 1CYDA 5EERA 1PL8A 3BTOA 3KUXA 4BNLA 3LDHA 1EBUA 4XGKA 5HTOA 4CLEA 1PWXA 4UUNA 5HBRA 3FNGA 1E1LA 3BMQB 3C1AA 4IQGA 3E1KA 2H5LA 2VWHA 3I6QA 5IDXA 5JMWA 3GZNA 1GTMA 5DCUA 4B8ZA 3JQEA 2ZJ1A 3QWFA 2Q99A 3PTZA 4B8WA 3BHMA 2XF8A 3RBZA 3BTVA 4TRMA 5FF9A 3AOEA 4HUJA 1YQDA 3WJAA 2VZ8A 1W0CA 2POQX 2VNSA 3JQAA 5HM8A 1NWCA 1QSGA 3H9JA 2C5AA 1K0UA 3AW9A 3GDFA 4FFLA 4CMJA 4CQLB 3GFGA 3LC2O 4TRRA 1KC1A 4ALNA 5F5LA 4E5KA 4OQZA 4IGEA 2HLPA 4BKUA 4Z3DA 3G1UA 2OBYA 2X5KO 3EUWA 5K0ZA 3LT2A 5G0WA 5TQVA 2FSSA 3H9GA 4PLGA 5B4VA 3ICCA 3MEQA 1NVMB 5I7FA 3C8MA 3M6IA 1RM4A 4YJGB 4BGIA 4OM8A 3UICA 4A10A 1EVIA 4OGWA 4WCFA 4KUHA 4XWYA 4JJFA 3V1UA 2R6JA 4EEXA 2ZK7A 5I7SA 1U28A 3EZYA 1ML3A 1WDKA 5F1OA 1T1SA 2NU6A 3PYXA 3VZPA 1G6KA 2ZB8A 4NU5A 1LLQA 3GA0A 1VJTA 3NX4A 4IDAA 2D59A 3U4CA 4E0BA 2YHIA 4LN1A 1C0KA 4Q9NA 4EUFA 5IXSA 3JQDA 4MKZA 4CPDA 4CV2A 3OEYA 1P0FA 2DBQA 2I66A 3H5NA 3H6KA 1VJ1A 3A9WA 1GYRA 4XDZA 4XYGA 3GHYA 2GNAA 1E5LA 1SNYA 1NWHA 1OI7A 4GBJA 3V2HA 3VPFA 4YJGA 1UDBA 2ILTA 4MIYA 4TSKA 2VZ9A 2J3IA 3KYDB 5ICSA 1EDZA 2PD4A 1GCUA 1P1JA 4F3YA 2XXBA 4EYEA 2YQ4A 4LW8A 1JTVA 5FEUA 1EVYA 1RWBA 2H63A 1OC2A 1B2LA 1ISGA 1OMOA 1V8BA 3E48A 2SCUA 5FYDA 2QHXA 5AXDA 2NVWA 5K9ZA 3GPDG 2RH4A 4JJGA 3CSDA 4CUKA 3U4IA 4FFOA 5G0UA 4DIBA 5EESA 5DOZA 4E2ZA 2C0CA 2E48A 5IN5A 4OMUA 3DBLA 5FI5A 1NM5A 1MB4A 2PA3A 5HA5A 4ITUA 3IKTA 1BDBA 3GAZA 1CWUA 2XAAA 1L7DA 4QECA 4B7XA 5CDTA 4J0EA 3UXYA 1UDAA 4D46A 2OBNA 3I9JA 3EDMA 3N58A 3VC7A 3ZU5A 4XJSA 5CPFA 4FGWA 1K2WA 5C5IA 3INTA 4Y9DA 5F21A 2AE1A 2RCYA 4R1UA 3TRIA 2X0IA 4BIIA 3F47A 1D4FA 4BOYA 3GT0A 1LUAA 1I30A 2X5OA 4PZEA 1LDEA 3PQFA 2X9GA 1ZVMA 4HNHA 4DQXA 4QEDA 1U3UA 3IP1A 4XYBA 1PSDA 2CY0A 3FF4A 4BNJA 4WLUA 4IDCA 1P33A 3OJLA 3VVCA 3JQ8B 3I9NA 4NR0A 3TNLA 1YB5A 5C3MA 4NBWA 1KOLA 2DTEA 3PEFA 3JCZA 1MUUA 1WNTA 1M6HA 1HE3A 3GN2A 1PWZA 3TL3A 4AJLA 1F12A 1E3EA 1QYWA 3A14A 1ZK2A 4J4TA 1DC3A 3F6YA 2AEMA 3PFWO 4WGGA 3VTZA 5JSFA 2ZTMA 1A4IA 2GN6A 5JAQA 3RUFA 1EK5A 9LDBA 4L4XA 3A4VA 2Q4BA 4BNTA 3KSZO 1E7SA 1T1RA 3HB5X 3SVTA 1WVGA 3B1KA 2DPHA 3LT1A 3PWZA 4JP2A 4RORA 5AXBA 2GF2A 1LQUA 4MP3A 4H15A 1YDEA 3KV3O 1Y5MA 4LCEA 4PFJA 3TSCA 1A27A 3VPSA 1AE1A 3PK0A 4PLFA 3EAGA 3BTUA 5BSEA 4UEJA 3L6EA 1F14A 3WLFA 3VAZA 4EJ6A 4BUCA 4EZBA 3CIFA 3DEYX 5IDYA 3NT5A 2W4QA 4NNJA 5ICMA 3WYBA 4NBRA 1LSJA 3N7UA 4CR6A 2ZTVA 5DCWA 4DC0A 2GD1O 4DGSA 3UAGA 1YB1A 1EUCA 1DHTA 4Q3AA 1X0VA 1EUDA 3AUUA 1DLJA 4BO8A 6LDHA 1O8CA 2P9GA 2B4QA 2I9PA 4IDDA 3D5TA 5AXCA 5JE8A 4B3HA 1R66A 4DIFA 4XIJA 3BMOB 1TA4A 4ZQEA 5LCXA 3C1TA 3WGTA 4E5YA 2GZ1A 4L75A 3DZGA 4U0JA 1WZIA 3RUHA 4YDRA 1U3VA 3JQFC 4ND4A 1W8DA 1Q7CA 1I8TA 5T8KA 1NQTA 4B4WA 3B20A 3QVWA 3HDJA 1IHYA 2C5EA 2ZB4A 4CUJA 2ZYAA 2AMFA 4WPGA 3BYZA 3B1FA 4ZRNA 3TQHA 2EW8A 5L4SA 1LLCA 4YJDA 3ZWBA 2JAHA 4Q3BA 3AFMA 2BGKA 4PRLA 4W99A 4K6FA 3RU7A 2AQHA 2VRCD 2O50A 1YQXA 1U2GA 4XRRA 2WSBA 3H5RA 3FNEA 3JQ7B 3QJ5A 5JBIA 2VN8A 2DBRA 3CEAA 5CEFA 3FWNA 3AM5A 4FD3A 1T2DA 4J1NA 4ALMA 3F1LA 3H3FA 4KTTE 1C1DB 5B4TA 2EIHA 3D4PA 1KERA 2IODA 3G17A 3MCVA 4LSWA 4PLCA 5GY7A 4AJ1A 4CMGA 4E2YA 1MV8A 2C82A 2I5PO 2X23A 1ZEJA 4PRKA 4RZHA 3AU9A 2X8LA 3WS7A 1PZFA 4UULA 1HDRA 4E5MA 3VKVA 2J6IA 2Q1WA 5COAA 3PWSA 1Y8QA 3E9MA 2CSUA 2HUNA 2QYSA 4IXTA 1PGQA 3DB2A 2PZLA 4BO3A 3ZDFA 1L7EA 2JL1A 2R2GA 1LRLA 2ZQYA 1P1FA 3ITDA 2PKQP 4XQGA 2YQ5A 5I9MA 2P5YA 2PZMA 3I5MA 4BNGA 4UREA 2WYVA 4PN3A 5I8WA 4CM7A 3H3JA 3OJEA 3DOCA 3PIIA 3FSRA 4NG5A 3MOGA 1B0AA 2HAEA 5H83A 4NIMA 1NPYA 3I23A 1BWSA 3EYWA 1C1DA 2W2KA 4B4VA 1UZNA 2UUPA 5JDCA 3H8VA 2FR8A 4Z9YA 1HDXA 4Z0PA 5A9TA 2Y1EA 3DHEA 2VOJA 4I5GA 2EKPA 4YJHB 4LVCA 4GSKA 3FR8A 3BHJA 3ZWXA 2I65A 3DFUA 3GF4A 3RASA 3C7CB 3ZH2A 4BB6A 3IS3A 4LSMA 5I9LA 1RYEA 4OQYA 2V6MA 5BSFA 1NQOA 3GVPA 3K5PA 3DMYA 3R6DA 3PPIA 1J5PA 4IDEA 1WZEA 3M1LA 1E1MA 3G1TA 1UZLA 4HY3A 4CQLA 1ISHA 1BVUA 2WYWA 3RAJA 1XYGA 3ONEA 4IDFA 1TB4A 3K92A 3MJ4A 3D3WA 1N1EA 4WECA 1JVSA 1QV6A 3H9EO 1BXKA 4D3FA 2DLDA 4MPDA 4U0KA 3E8XA 3BMCB 2I67A 2DUUA 1ZUD1 2Q2VA 2Q2QA 4RO0A 1EQ2A 4DIOA 1PGJA 1S7CA 3RCBA 1E3JA 1M67A 1SEVA 1R4NB 1Y6JA 1ZK1A 4AJHA 4NFYA 4CLXA 5KVVA 3Q2KA 1M2WA 2Y1CA 3VZRA 3RJ9A 3HADA 4ZQFA 1HE2A 4JP3A 1IL0A 2QIOA 4QT0A 4UVGA 2WD7B 3S2EA 1YJ8A 1GEGA 3P19A 1O89A 4L74A 3BXXA 1PR9A 1GQ2A 1O9BA 1C1XB 2YHIB 2E4AA 1D8AA 2VHVA 4RPJA 1I24A 3ENNA 3TDKA 1X1TA 3BA1A 3CZRA 3BMCA 3EVNA 1PJLA 4M89A 3OP4A 5DNAA 4OH1A 5F3RA 3IJRA 5A3JA 1Y9AA 1PGOA 4KDFA 4BO6A 3H5AA 3JYNA 1Z6ZA 3AUSA 3UF0A 1C14A 1FDVA 3P7MA 4KDEA 4I5EA 4J43A 4BNVA 4DLAA 1HYGA 1N5DA 2NQTA 5JAMA 2J5KA 1T26A 1XA0A 4FFRA 2JAPA 3WGZA 2FN7A 4YPOA 4S1VA 3HDQA 4BMNA 1ZK0A 3D3EA 4PG8A 3G49A 5K6AC 3WSVA 4MO2A 3DBRB 3ANNA 5C7OO 4ZD6A 3DL2A 4FW8A 3CE6A 4MKRA 4XQ9A 1J6UA 3K8ZA 1ISMA 1U3WA 4LMRA 5LC1A 1DFGA 1O95A 3RU9A 4PLZA 3F46A 5JDIA 3OICA 3NEPX 3WFJA 3IQDB 4JCOA 3MJTA 5ADHA 5G0SA 2BMAA 4DPLA 4YQYA 3R3JA 4IZIA 4RDHA 1ZKMA 2YFQA 1IPFA 2C7GA 3NRCA 2HK7A 1WAMA 1P1RA 1H2BA 2ZYDA 4XR9A 2NQ8A 2JJYA 5DBGA 5F5NA 2WJPA 3GGGA 4GX1A 2WYUA 2EJVA 1HZZA 3NDIA 2FPGA 2VYNA 5KVQA 2RH8A 3HE3A 1LEHA 1E1NA 1DRVA 5JS6A 1K3TA 3OHSX 4J9UE 1U5AA 4Z3KA 4BO4A 5T6BA 2IXBA 3ZWVA 1CIVA 3QRWA 3KHUA 4RQUA 1IUKA 3K2BA 3ETGA 1CJCA 2EXXA 2VWQA 1PQUA 1BMDA 1GV0A 3PJFA 4BO1A 5G2OA 4XQEA 3KSDO 2BFPA 2IRWA 5J23A 2QZ9A 4J2OA 3GN1A 2OP1A 5F1KA 3PHIA 1Q1NA 3GK3A 1YBMA 3JD4A 1A7AA 1R16A 4RCVA 3VTFA 1DAOA 3ZU2A 1YL6A 3GRPA 3PDUA 2VQ3A 4ZQBA 3JQBC 3PHGA 3BAZA 1AN9A 1X7GA 4WEOA 5BSHA 4M86A 4WASA 3AK4A 1SPXA 4BGEA 5ER9A 5BNFA 3V5NA 2D5AA 1XG5A 5HWSA 2VT2A 5DT9A 4AJEA 1GU7A 5L3ZA 1MC5A 1GUYA 2YV2A 2EJWA 4FC7A 3AM3A 3FBGA 2H6EA 2Y05A 4I9NA 1ZSYA 3PYLA 4MVJD 2VYVA 3FWZA 4RZIA 4WLEA 4CMHA 4AG3A 1PS8A 3G0OA 2A92A 1EDOA 1GUZA 1BRMA 2HJSA 1I36A 5CPBA 3IUSA 1FF9A 1YVEI 4YJFA 3H7AA 3GQVA 1VJ0A 1K6IA 2B5VA 5DBFA 4BGUA 1DIGA 2GGSA 1SBYA 3JD0A 4QO8A 1DFHA 2G17A 2PTGA 4OL9A 4WLOA 4W4TA 3ZWWA 3UFXA 3G79A 4A2CA 3ZWNA 4NMHA 3KLPX 2H1SA 4RLSA 3NGLA 5TJ9A 1M66A 1LSUA 5KOIA 1JKFA 1ZO8A 3A06A 5BNTA 2HJRA 4ID9A 3OETA 2Y1GA 4MP8A 5JY1A 3WMXA 1T2EA 4D3SA 1UUFA 2DVMA 4TRNA 1YKFA 1HDYA 4CV1A 4C4OA 5B4UA 5IFLA 3S2IA 1K89A 2UDPA 3ULKA 3AUAA 3IMFA 2X22A 1P1HA 4MP6A 4XJTA 1UXJA 3HDHA 5G4KA 3U09A 3PLRA 2VRCA 3RC2A 3P2OA 1MFZA 3O8QB 4OJNA 5EINA 2VUTA 4J90A 1B3RA 1YBVA 1RM0A 3ROPA 4Y6PA 1JAXA 3FBTA 4J1TA 3QQPA 2Y66A 1NAIA 1PQWA 1D3AA 1PS9A 3OSUA 3QIVA 3W4JA 1XGKA 3DZBA 5EN4A 4WE3A 1BW9A 2Q4EA 3I1JA 1R0SA 3OIDA 2CF5A 4JBHA 3FD8A 1PZEA 1VRWA 1DJQA 2QRJA 3RWBA 4GMFA 3WYEA 2YY7A 3HQ4O 3F5QA 5KNLA 4A5OA 3UH1A 1LDMA 3OJ0A 3WWYA 3GY0A 2YV3A 1NTOA 5KJFA 2BD0A 4JN6B 2AA3A 1M75A 4L73A 3E9NA 1WMBA 2P9CA 1A9ZA 1ZW1A 4G5HA 2HMVA 3GMSA 4Z9FA 1SO8A 3OM9A 1LC0A 4D44A 3DZKA 3ZU4A 5JLAA 1SEPA 5IG2A 4WCDA 1NPDA 2V7PA 3F5SA 3I52A 4Y67A 4DWVA 1T4BA 3BIOA 1PJ2A 1GD1O 1P44A 2R00A 3AM4A 1DIAA 4IQ0A 5FI3A 5BNIA 3VVBA 4D0RA 4QX6A 2HSDA 2JKVA 3AU8A 3KYBA 4QXMA 3QLJA 1MXFA 4N18A 5TS3A 2CVZA 1YL5A 1HF3A 2C2YA 4JQCA 1I32A 5DOVA 4D7AA 4YAGA 3H2ZA 5I7VA 5JAIA 1LRKA 3ZNOA 1JDJA 3EC7A 1PX0A 1WDMA 4P8RA 4M54A 5H82A 3W6UA 5BQFA 2BGLA 4J49A 1N2SA 4II3A 4XGNA 4AJKA 3QVXA 1XELA 3T4XA 4KUGA 3HNPA 2IZ0A 4L9RA 2FRDA 4CM4B 1OZAA 1T2AA 4B3JA 2EKQA 1CQIA 3WTCA 1EMDA 3UKOA 4DC1A 5A03A 1ZIDA 2X9VA 5BT9A 3GG9A 5L7TA 1LSOA 1H9AA 3GGOA 4EBFA 4E31A 1WMAA 4H16A 4WLFA 5JY6A 3DMTA 3WGHA 1V9LA 3IOYA 4CMIA 4NHEA 4ZA2A 1V3TA 3RROA 3EW7A 1ADBA 2YW9A 3W4IA 1HTBA 1C0LA 4W6ZA 1P0CA 2O3UA 3A28A 3RFVA 4C7JA 2Z95A 2JCYA 4ZICA 2CD9A 4Z0HO 3UCFA 3DBHA 1NR1A 1PL7A 3OJOA 5ILGA 1XDWA 4J6FA 4R3NA 3AI3A 4NQZA 3ZWPA 1UXGA 3QVOA 5FWNA 3IJPA 5CP8A 2HCTA 5HS6A 1V0JA 4L0QA 1E7RA 2FP4A 2JFGA 4R4JA 1ZSNA 1YL7A 4BO7A 1B8PA 1Q2XA 4IQ8A 1X7HA 3PHJA 3KEOA 3UCEA 2YYYA 4LRTB 3JD2A 1YOVA 1U5CA 4BNNA 4INAA 3CTMA 5DP1A 4GVXA 3DC2A 1TT5A 4M1QA 1LX6A 2P4HX 4D0SA 2A4KA 3O8QA 1OAAA 2DC1A 5A9SA 2DUWA 3KO8A 4GX5A 1Y7TA 4EUEA 4K9DA 1E1KA 3FRJA 3W8DA 2OO5A 3FPLA 1JA9A 1X14A 4IS3A 4TROA 5JXWA 3QWHA 1MFPA 1ONOA 4FJ2A 4NJMB 4HADA 4BQPA 1NP3A 3L9XA 3BMQA 3RUAA 2R00C 1JKJA 1H9BA 3ZHBA 1ZEMA 1D1TA 1XIVA 3O4RA 1E6WA 3L4BC 3SEFA 4TVBA 3KEQA 2ET6A 2RAFA 1QYDA 2PK3A 2J5QA 4PG7A 2AQKA 5JCXA 1Y8RA 3U0BA 5C7IO 2B0JA 3GNSA 1GPDG 3RI3A 4XRGA 2P68A 1TT5B 2XOXA 1IZ9A 4B3IA 4B7UA 1KBZA 3FTPA 4I08A 4TRJA 3BZUA 5COBA 1E0DA 3CKYA 3QVTA 1P3DA 1O0SA 4J7UA 3ABIA 1W4ZA 3RUIA 5J9GA 4Y8VA 1FJHA 1T24A 4BMSA 4JBGA 2NM0A 3IC5A 4B79A 1PEDA 2RHCA 3DAPA 2Y0EA 3R0IA 4PZCA 3PJDA 1VKOA 3AY6A 1R0LA 4BNIA 3I9KA 1MG0A 2IZZA 1KS9A 2VT3A 3HSKA 3WB9A 3KYCB 3W6ZA 3GVIA 2VUUA 1YXMA 3UOGA 1A7KA 3S55A 1Q0LA 1E92A 4I9UA 3C7DB 1EVZA 4LGVA 4ZQHA 5TRTA 5BR7A 4WCFB 3CMCO 1LRJA 4J4BA 3I83A 4GX0A 1F06A 2PGJA 2PZKA 3B1JA 4ND2A 1CF2O 2EV9A 2CFCA 3JQGA 3S2GA 3ZWYA 3GVHA 3WQRA 1DO8A 1W6UA 4QQRA 3L6OO 1I10A 1QYVA 2J3HA 3INRA 4W9NA 3X2FA 1N92A 3SBOA 1SCUA 2VNAA 1V35A 2HKIA 2JHGA 2UAGA 4ND5A 4BV8A 2WWRA 3HG7A 4A0SA 4ALIA 3KYCA 3GVXA 1PJQA 5A04A 4I5FA 2Z1NA 7MDHA 5DP2A 3TF5A 2WM3A 3RKUA 3PGJA 2NTNA 3RD5A 4IMPA 2X1HA 1HRDA 1UJMA 1XQ6A 3WYCA 2J3JA 2NLOA 2OOSA 2Z5LA 4GLLA 5EQFA 1E7QA 1R0KA 2X0JA 3LC7O 2BKAA 3ZNNA 5A4DA 2VTDA 2XXJA 3IDSA 2GZ3A 4AJNA 4TMFA 1Z82A 1L1FA 5IXYA 3W4KA 2Q49A 4ROSA 1HYHA 4DXHA 4YJFB 4DPKA 5TIIA 3ZHYA 4YT4A 2DAPA 1V3UA 3OJFA 3PVZA 4CLHA 4MVJI 3C1OA 3PI7A 4JX8A 5ITVA 3INGA 1X15A 4OSOA 3O03A 3M1AA 1DC6A 3KETA 1KVSA 4D42A 5T5QA 4DVJA 4YQZA 4PLHA 4IXWA 3AY3A 1HWYA 4XB1A 1I33A 1E3WB 5G0TA 4GKBA 5AXAA 2G0TA 4BV9A 3FCOA 3DFZA 1AHHA 1EE9A 3ZV6A 1FDTA 3UUWA 2QYTA 4URFA 1IOLA 4BO0A 3LK7A 1LXCA 1HXHA 2EF1A 3DZHA 3UHAA 4J7CA 1JWAB 5JPIA 1Q0HA 1A4UA 4N7RA 4DQUA 2P5UA 3IKVA 1WPQA 5A5EA 2D1YA 3TWOA 4CMKA 1FXSA 3TJRA 1MC4A 1J49A 2Q3EA 4LCJA 1JVBA 4PVDA 3LF2A 4IGFA 3BMNA 1YONA 2AG5A 3RUDA 4FJ0A 4YB8A 1VI2A 4XGIA 4Y6RA 1S6YA 2Y0CA 1OFGA 4CM8B 3OQBA 1KVTA 2F1KA 2HRZA 4HX5A 2BLLA 2NSDA 2DM6A 4RDIA 5AOVA 4UVHA 1SOWA 3UW3A 1ISIA 1HDZA 4Q39A 5KWEA 1CDOA 5IAAA 1XCBA 5JDIC 4U5QA 3GZNB 4DYVA 4Q3EA 2EGHA 1VL8A 4PG4A 1XU7A 4P4GA 3K31A 3ONFA 4E2XA 2IZ1A 1J4AA 3LYLA 8LDHA 3COSA 1E77A 4GI2A 1GV1A 3ZHZA 3MOIA 1R4NA 3DDNA 4BNYA 3WGIA 1GYPA 4XYMA 4Q3CA 3SLKA 5IZ4A 4UVEA 1T4DA 1AXGA 4DTIA 5L53A 4HNGA 1IPEA 1UDCA 1Z74A 1KEPA 3MJVA 4JK3A 5KKAA 5L7WA 5L4LA 1VE9A 4P4NA 3WBFA 2C29D 4R68A 2PH3A 4CM9A 3VZQA 5KJ6A 2OP0A 4OOEA 1C0PA 2IE0A 3BHIA 3JQFA 3K96A 5L7YA 4BNFA 2W2LA 2O2YA 2BI7A 1I01A 4PLVA 2V6GA 4WLVA 2W2LD 2O48X 5ENVA 4WOJA
chains in the Genus database with same CATH superfamily
3V4OA 4ZEWA 1U28C 4N5MA 3MN1A 4C4AA 4ABTA 4KYTA 1ZOSA 2FPGB 4G8DA 1VHTA 5EWJA 4MI6A 3OA0A 4LNHA 1MB3A 2JEYA 4QYMA 5GM2A 2A8YA 3QBVA 1GTZA 3IWBB 1GZ3A 2QLTA 4ZVPA 2CV2A 3SE0A 2BFDB 3PC2A 3FGOA 2HI0A 5K5EA 4YAJA 2OBBA 2IPAB 3IXQA 1A9XB 2FN3A 3WP0A 5LLDA 4I2VA 3ENKA 1XD8A 1V9SA 3UTDA 3IT0A 2QJOA 3DE4X 1FRQA 5DM4A 3EARA 3CZ4A 4JB8A 2Y99A 2ZB2A 4TLLB 5DXJA 1CJTC 1NFQA 3HYRA 1DFIA 4MQLA 3O73A 4MR8B 2IW1A 4OYLA 5JS1A 4UE3S 1E5DA 4ZVOA 4CMBA 2DLCX 2YZGA 1NVUQ 1WUJS 4QRIA 4Z4EA 3A6EA 2FP3A 3BRWA 4GXQA 4LZZA 3FNBA 1E3TA 2EP8A 3KWLA 4TV8F 2ISSD 1KI6B 4JODA 3IHWA 1TT7A 4HK4A 1F0NA 4LPKA 4GVPA 5DHFA 2JBWA 4QTZA 2BDEA 4U8GA 1CG6A 2QG4A 1EFTA 1JPNA 5JC1A 3DMFA 3L7AA 5KCZA 1PN3A 3FFBA 4KWIA 3OU6A 2PXCA 4C06A 1E0AA 5B64A 5D6NA 2GEFA 4UUPA 1RC0A 4LZOA 3U3RA 2R1VB 3S6JA 1Y3DE 1Q0RA 1GILA 4J76A 5JCJA 4W5OA 2X7JA 2XQIA 4Q4JB 2Y77A 4RLQA 2IFTA 2ZIEA 3D7SA 3H0EA 3ZX5A 1FNCA 1L1RA 1RJFA 1CVRA 3FI9A 3GB9A 3I3SR 4LYGA 5KNCA 1D8TA 2X6TA 4DBVO 1ADCA 3R40A 1USWA 1N6HA 1MGPA 1DGQA 4XX0A 5KYVA 2PYIA 1XCLA 4HATA 1FFGA 4LAFA 2FUKA 1YZQA 3QFTA 1M2FA 1G3QA 5AKXA 2FR8C 2BRUC 1T3LA 1YH3A 3OTGA 3D7KA 3MMNA 5EC8A 2WWVD 4BKRA 2WM8A 4TTPA 3OH8A 1EE2A 2ZQZA 3VR6H 3TZBA 5WRFA 4NZYA 3GLQA 1FX1A 1K5GA 1G9TA 2FFAA 2Q5OA 3F1KA 1GARA 2FSPA 3M83A 4YRRA 3ETLA 5AK4A 3M3HA 2VLIA 5AQ1A 4FE4A 2CDCA 4KKVA 4WI1A 5KUTA 2NO7A 2GEKA 3WFIA 3DAHA 4DT1B 2KX7A 1ZS9A 2SKEA 2XJ4A 3BULA 3Q7RA 4FSDA 4Q34A 3H2GA 3GW8A 3T8YA 2M32A 1KU6A 2ZT5A 1YZFA 1YRLA 2C2XA 2PSJA 5AJTA 4B3GA 4CF4A 1JR4A 5L6LB 1ZBQA 2YJ3A 2AE2A 2XYHA 3QU7A 4LJ9A 4NPCA 3W2FA 1MOPA 1NBHA 1LDYA 2FPIB 4NLLA 3ROQA 4BMZA 3QPDA 4MWEA 4QG3A 2D2VA 2WVHA 1PD0A 3D2BA 3HJRA 4FFBA 4LQLA 5E4YA 1P5FA 3ZWAA 4CR8A 2XZLA 4BNMA 2YJGA 2ZDQA 3OG9A 3K1AA 3PC8A 1M9NA 3PGXA 2REQA 2PT7A 5EIWA 2PUDA 4B32A 3CXRA 2W22A 3CPSA 2FEKA 3KQSA 3L06A 4ONEA 2C99A 3TV1A 5LDGA 3V80A 2DPXA 5LP6F 3L41A 2EKLA 1K06A 4E3ZA 3ABZA 3FMOB 3KR9A 4DWOA 5HJEA 3OA2A 1C0IA 3L46A 1W4CA 1DKOA 2HQ1A 3W90A 1R1DA 4A73A 1B8VA 2O8DB 2H3EA 1PGPA 3TS1A 1GZ7A 2D1QA 4C89A 3FVVA 2WU4A 2P4QA 2EGGA 1XZLA 3PGKA 4RKQA 4LSGA 4RGVA 1Y42X 2VYVD 1B8NA 1BAPA 1D6NA 1V7CA 3MRSA 1NJ1A 3FXAA 3BXHA 4J4HA 2CDBA 3DV2A 5EP3A 4KO8A 1DQPA 1N2CA 1P31A 2ZSEA 4ZHQA 2XRZA 3AJAA 3OQIA 2QTRA 4OG2A 3RWOA 3WY9A 1FUEA 3CZ9A 3IAS1 5G40A 3JZDA 5H68A 4DREA 2W4MA 3IT3A 4OLFA 4RPCA 5J2UB 1XN4A 2WUFA 3H9UA 4AJJA 4U6NA 1B23P 2LPMA 1RJWA 1PJ3A 4UD2A 3U61B 2EX1A 4AKHA 1U02A 4UAUA 1JU4A 1HM5A 1E94E 2NYUA 1KKUA 4COOA 4Y98A 4Z1MD 4DB4A 5CDHA 5HNKA 1SXJA 5DCLA 4M9RA 4OYRA 1IRXA 2VK8A 3CNQS 2BI8A 4UVDA 2WTEA 3ML1A 2AN4A 4G23A 2XUHA 1CB0A 4IKEA 4HDSB 1KMNA 3VH4A 1TQ6A 1ZM9A 2A0UA 5FNVB 3R2JA 2PEZA 2IYSA 4LXUA 4Z9XA 1NRXA 4B4OA 4ERXA 4DMGA 4FHDA 2YIDA 4ZT4A 2ACEA 1C9YA 2X4IA 4POOA 1U8EA 1N8KA 1WUTA 4CQMD 1RE0A 2GKOA 3CR8A 3KKOA 4H6WA 5EE9A 4E21A 3DBLB 4M46A 3G2IA 5AM5A 4AWBA 1WJGA 1NT4A 3ANLA 1KO4A 1XTTA 2HCJB 5TPWB 2ID9A 2AQ8A 4OHUA 2WE7A 2I6XA 3H7IA 4H18A 2HF9A 4DJJA 3SZRA 2ECQA 4EI9A 3IVXA 1ZCAA 1ZJWA 1CE8A 3ID6C 5FULA 3N74A 1O8BA 1QLJA 3H1GA 2GCEA 2O14A 4GLFA 4KX3A 5LR6A 1AMNA 4BZZA 2QE7D 1P4AA 3SC2B 2WYIA 2C8VA 4JJIA 1ZI6A 5K2OA 3JQ9A 4E5DA 1X0XA 2QL6A 4RIGA 3ZXYA 7MHTA 2UYCA 4L8GA 4ND3A 4NP6A 1MKYA 1RSZA 2QRMA 4H7HA 4CMIB 5JXIA 5EIHA 4CLRA 2JASA 3FCCA 2C8KA 1K6EA 4LNUA 4HJRA 3BRCA 4LOLA 5E6RA 3FB4A 5TF4A 1EXDA 1ORVA 1JU3A 3GPLA 3OFSA 4TYYA 4JGBA 5E2AA 1IE3A 5EJ2A 5AW4A 2N42A 1FMCA 4KN9S 4LDJA 1S2GA 4KAXA 3JTEA 2QROA 4PICA 4R1SA 2L42A 3NDRA 4A7PA 1VM6A 1H5QA 3ESXA 4FKBA 5AVOA 5HE9A 5L95A 5EEGA 4PV7A 5JXGA 1NVVQ 1RXSA 3DO5A 1TZKA 1DX4A 1ZIPA 1WZNA 1NFFA 3UJBA 2ZGVA 5C3UA 1UWLA 5DT2A 1IB6A 2KI5A 4UHFA 3E9ZA 4IX9A 2YFYA 4RACA 5IX8A 5LA6A 4LZJA 1O94C 2O19A 2EL7A 4R5MA 2Y71A 2X7HA 1FU8A 2F17A 3Q6IA 2AKYA 2EG9A 2IH2A 3NOQA 1INLA 3FPGA 5KOHB 3PUHA 4UNNA 2CB9A 3L8DA 3GLUA 3R41A 4WLNA 1ZZGA 4KMMA 4XUGB 2BUCA 1CUFA 2WMNB 3F6RA 1YZYA 3ZI0A 4BMPB 3EMDA 2FZKA 2RHRA 3F9IA 3F3SA 2JIMA 4RKRA 2QM0A 5K20A 1L5YA 3B3AA 3FRHA 4XIIA 1KEVA 3IP7A 2Z8XA 3IKJA 4NJMA 3TECE 3I62A 5JCJD 3DNFA 2VFAA 3VBEA 4AZTA 4W7IA 4OO3A 1HQDA 1T43A 1F3LA 3GMTA 2JK0A 1SVIA 3ORYA 4OXYA 2FDRA 1XLTC 2PJZA 4TLCA 2HRBA 3VKWA 2BGJA 3R74A 2CLKB 4EYKA 1DAGA 2OYSA 1UF9A 3HY4A 1QCCA 2A1IA 4KK4A 2WTBA 1Y8ZA 5F9HA 4Y1RA 1WB9A 1JENB 2F90A 5KYXA 2WILA 1Y8RB 1MZPA 2YN0A 1PL6A 5ITWA 4IDNA 3BN3A 3CB2A 1BMFA 4V1CI 2E5LB 2RBKA 3O82A 1G16A 1ZH2A 1XZBA 2OECA 4PGFA 1P9WA 3HDGA 3EZ6A 1LBHA 1HSOA 1SR8A 2I8AA 2J48A 3ILYA 1N36B 1UKZA 2NU9A 5FPKA 4X97A 4NCHA 5JJBA 1GGMA 3D02A 3VSBA 3TH5A 1FDSA 1JFTA 4HQLA 2P35A 3EPJA 4BC1A 4EB6B 1H94A 1DAIA 1SBHA 2OK7A 2K2QB 1V3VA 3TTTA 3U7IA 5G0VA 3BSFA 3IIMA 5E7IA 4UUMA 4WOKA 1M2HA 2IU4A 1KIFA 2GN8A 5IAJA 5IVDA 2QVGA 4KBYA 3WKDA 1PLJA 1YZNA 4NULA 4RWEA 1KWKA 4BO2A 5HF8A 3AR5A 5AVZA 2BTQB 1VLMA 1X3SA 3IE2A 1TTHA 4AW9A 3OQ1A 1N7HA 3OIGA 2C83A 3CBGA 1D2AA 4YAKA 3T12A 2AFIB 1YNSA 3AOGA 3A1SA 4KLNA 4URUR 1C3EA 1Q14A 1YJ5A 2Q6IA 2Y3IA 4ADSG 2I78A 4H1VA 1FFAA 3JQ7A 3PFFA 1XAJA 4P86A 2CZQA 1L5NA 1XMJA 4NBVA 3G68A 1KXZA 1U7WA 3LUKA 2PR7A 3W6NA 2WP8J 2JD2A 1JVNA 4P4LA 5G4KB 5DYIA 3KELA 1N78A 1CQJA 2PX8A 3F6EX 4DR2B 4EUHA 2DPLA 2UYYA 3LBAA 4WNIA 4JVSB 1RCFA 3MCUA 4DCNA 4DR7B 4IDHA 2PLNA 2R6CA 2ZIAA 3PNBA 1P1KA 1BEEA 3K16A 3CHYA 1G5FA 1JNYA 1A2BA 2FPPA 1WS6A 4FKZA 3I0ZA 1M6NA 4ZWNA 2R3SA 1VL2A 4ANFA 4YEDA 2RGCA 4MVJA 1JQLB 1K6JA 2G08A 2H1VA 2XQVA 2GM9A 2L0XA 3DMHA 1R74A 2QT9A 4OHOA 3NCTA 2CJPA 2QTCA 5JV5A 3A6GA 4NCKA 4QYWA 2Q21A 3O9MA 3BWDD 2B4RO 2PGLA 3K2IA 4NDNE 2VTEA 2GUGA 1MN6A 2AW5A 4QA9A 2X77A 5JH7F 1K7YA 3LNCA 3WLLA 5K8IA 3TTUA 2C31A 1R8QA 3U1VA 1IY8A 2DFLA 4FFNA 1FK8A 1IAQA 2OUIA 2XJ9A 4W6QA 4A0QA 1ZOOA 6NULA 3C5CA 3M6FA 1Y1TA 4KXNA 3VPGA 1U2SA 2PKXA 2RD2A 2DG2A 3B5JA 1Z6AA 2QF7A 2VYND 4FW9A 1JDUA 4H1HA 4DLPA 5KTKA 4GZ3A 1Y1RA 3ZLBA 1Q92A 1WW8A 1AGYA 3ANXA 4YCMA 3LUFA 3QXCA 3H75A 5FYQA 1F2UB 2R8PA 4RHYA 2OYRA 1PDWA 4MNTA 1C4KA 3W34A 4W1QA 4I5DA 5ERYA 1R8JA 3JSAA 1L4NA 2O0LA 3VAAA 4CKEA 4L5YA 3JQGB 4EA7A 5B3KA 5HSGA 1Z9BA 2FN4A 2GESA 3B51X 5TQ2B 2PKQO 3DMTC 2BZ1A 1ESMA 2H1CA 2F3PA 1ULSA 1GCOA 3LBYA 4QASA 5C4MA 2QXUA 3DKKA 3CV3A 4C0QC 2XB6A 2BELA 2QSZA 3HLTA 4JB2A 1BE6A 1QHGA 1PRYA 3WRYA 4BNHA 2ZJYA 4Z6KA 2Z04A 1SOMA 1LDBA 1NKTA 1HQKA 2NV6A 3IERA 1BA3A 4MARA 4CL3A 2VKQA 5AVYA 1XZFA 3DOEA 4R83A 2GA8A 5EIOA 3O75A 1J9EA 4B1FA 2QV0A 2G80A 3EVEA 2I99A 3BKWA 2HMUA 1JTFA 2C2KA 4YPVA 2DSNA 3FN4A 5AJXA 5B3JC 5IU6A 2CWWA 1YD7A 4G0WA 1LK5A 4RQTA 2AOUB 4RA9A 1SM4A 1CEQA 1UEXC 3QPAA 1ZK3A 1JEJA 2GCGA 2Y67A 3B9BA 4JUDX 2XUGA 3DOHA 2FUCA 2R2AA 4UBIA 5JZVA 5FJJA 1P7WA 1U8AA 1Y8QB 1AKUA 4BATA 2ZCVA 3BDVA 4CCSA 1JJIA 2YWHA 4MGZR 3H8SA 4Q4LA 2E0IA 3CLVA 2H48A 4FONA 2FKAA 1UIRA 1OTYA 1P6QA 1CY8A 3EFHA 3GRZA 4HH4A 1RMQA 4FB5A 1YO6A 4HX2A 4RNCA 2X0EA 2DETA 1I9GA 5TE9A 4PX3A 4XD7A 4DCUA 2CVQA 3DM5A 4U6QA 5J1TB 3S4YA 3C3WA 1QB8A 3OM8A 3A9TA 1P2UA 4IL5A 5T64A 1J33A 4PSVA 4MUNA 1MG5A 4YQEA 2WFLA 1TZMA 3JWGA 4IHAA 3NDJA 3LUPA 3E5RA 2E4WA 4L9AA 3PCRB 4BWVA 3LOQA 3BXFA 1OT5A 3CUVA 5EHNA 5PNTA 3RODA 3QLUC 2BCGY 1LC3A 1PNQA 1IJEA 1W5FA 2WWWA 1MQAA 2C61A 1V37A 1NX6A 1VIDA 2JJ8A 4HJXA 1B93A 5E4TA 3W9YA 2BF4A 2ZR0A 4ZKEA 2VJNA 2VPIA 3CB4A 3DAOA 3HA2A 3RVQA 4FLEA 1JFSA 3WLSA 4V1CB 4I1PA 4FX2A 2WAOA 1Z6GA 2VZ0A 3SBEA 3AIIA 4IVQA 4JOCA 1QVRA 3HN2A 1NVEA 4HDMA 4NKRA 4CQMA 2Q5JA 3ZCRA 1U7UA 4ZT7A 5BO5A 2BRUA 1E1CB 3SJAA 4DZRA 4C29A 4KRYA 1CEEA 4BO9A 2CBZA 4GIBA 1LPBB 1O58A 1YV9A 4MH0R 4UPEA 4NZPA 3OZEA 1HKUA 4QBGB 4V0OA 1FIUA 2OXIA 5ALZA 5EHZA 4B3MB 3OKAA 2QTBA 1RI3A 4WBSA 1Y4SA 1ZSVA 4M8NE 4EHIA 1H4QA 5EYPB 1E5TA 3M3DA 3LLVA 5JYDA 3M9XA 4NE7A 2LKDA 4ARCA 3KVNA 4OA8A 3EDQA 2KYRA 4E33A 4NL4H 1JGTA 2W6QA 3C3JA 3QKIA 2X0NA 3F3KA 4FHGA 2LBPA 4HQNA 1WXEA 2CHVA 2V7XA 3RVJA 3V4LA 2IVZA 3WIEA 4MRMA 3WX0A 2X2FA 2QUJA 4HYTA 4TWZA 3AGPA 1I3KA 3JU3A 3QV2A 4XEHA 1CFZA 4N8SA 1HO3A 4YMSA 5HS4A 3PTAA 2AVNA 3UWKA 4YAIA 4XWTA 4YMLA 2ZSAA 1OASA 1B6GA 2FOXA 5CJ2A 2H1HA 1BXGB 3DP7A 5J43A 2NSYA 2J4DA 5CYFA 4ZVTA 4MS1A 4JHXA 2HMYB 3WQBA 1SZJG 4EFKA 3GLGE 3QOWA 1LBSA 1RLUA 3L82B 1A9XA 4D57A 5C8ZA 5GIPE 1FXWA 4LA4A 2ZVJA 4NECA 2BHRA 2RI1A 4PLPA 4HHEA 3A6JA 1A5AB 3O1LA 1KU0A 4TQGA 4B34A 3UPTA 2HO5A 1T9KA 4QZVA 3IAHA 4PX5A 1QOZA 5TXGA 2GTHA 2IEYA 3K8YA 3WR5A 5A4JA 1GWNA 1EQUA 4YRDA 5BSRA 5JARA 3IVGA 1UMBB 3Q9UA 3GLHE 4R2HA 1TTPB 2JLVA 3HXPA 3WGGA 1FYEA 3RHZA 4L8FA 4AXXA 3NB0A 5DNYB 1X42A 3EPAB 1GZHB 3E03A 5CNIA 4II2A 3JWJA 1VQ1A 1EZ4A 2A5YB 3MYRA 1C4WA 3E81A 3TUTA 3OF2A 4Z0TA 3Q41A 2OCKA 4J0FA 3EXHC 2BFEA 3FOCA 3CUKA 4WAUA 5JFOA 1PT5A 5JDCC 4B46A 3ZY4A 4WH0A 4KNYA 1VLVA 1WSWA 1I13A 4MRNA 1ZJ4A 1MJHA 1MD9A 3EP4B 13PKA 3ZJYA 5JISA 1I9CA 1U3TA 3IJ5A 4MHOA 1PK9A 3IAFA 4LE1A 3AKYA 2O3SA 1P9OA 4QL3A 2HCBA 3DHYA 1N2ZA 2AR9A 1AC5A 1ND5A 1QM5A 2CXTA 4DUGA 4EFNA 2PNFA 4DMHA 1I7DA 4XX0B 1Y9JA 2Q1SA 4ZOEA 3W5HA 3EC2A 3CW2A 4PIVA 1DIHA 3E22B 4FU0A 4QOSA 5H02A 4JNKA 1K8ZB 2OYCA 4ND7A 4OLJA 4OSPA 3G0GA 3ZR4B 5KYYA 4HXFB 5ELMA 2J5RA 1ZCJA 3MTIA 4H7EA 4RSMA 4ZAVA 4B5KA 1YS1X 2A1TR 3LCMA 4O29A 2IYEA 2XZOA 1AZTA 2DTXA 2YXLA 5JI2E 2HB6A 1GZ4A 3K0FB 1O6CA 4NJOA 1GKYA 1EX9A 1VYTA 2AMJA 2NUPB 2EP5A 2LTAA 5MN4A 1YRQA 1MZVA 2Q4DA 3C6ZA 2ZUUA 4AN1A 1SU7A 1ZZEA 3LECA 3GLGA 3WGYA 1IN7A 3LU1A 4DV2B 2VEDA 3Q98A 4RLHA 5FBRB 4JUCA 3DE3X 4E12A 1TVEA 4U2KA 3KD3A 1DC4A 4RH1A 3WLAA 3NAMA 4YYZA 4LXQA 1LA2A 1L4MA 1TVKB 2YOFA 1DQNA 5KU7A 1UBHS 3BUSA 4B0OA 1J8QA 4A1FA 1W52X 4FJ1A 4B4UA 4II7A 2A78A 3Q72A 3TEMA 2IZOA 4XR4A 4GLOA 1OHHD 4M6WB 4CM3A 1TPYA 3N0WA 1N4DA 2VJKA 4ZDJA 5CXQA 5ICGA 1PK8A 3AEKB 3DBIA 4PVCA 1CY7A 2JS7A 3GAMA 3K1AB 2FNAA 3EP3B 3BHNA 2FSFA 5AOCA 3QELA 4CDNA 5CA1A 3RHTA 4K3UA 4K87A 5E7QA 4GM4A 4JKYA 1F17A 3LLSA 4CWAA 1Z4PX 2DH5A 2OGUA 5CAEB 2UYQA 3AINA 2CNWA 1QO7A 3MSXA 1G8KA 4LJ6A 4BS9A 5JSQA 2AI1A 2BJWA 5GOTA 2XGJA 5B57C 4E5UA 2OVFA 4ER3A 3ZCTA 2PZFA 1OYVA 1DLIA 1ZC4A 3PZRA 5SY4A 2WQ7A 5JECA 1WEKA 1HLFA 1JSXA 1IVNA 1LK7A 1TGYA 1GGJA 1VXRA 1XDGA 3UV6A 4O8JA 4AURA 3PB3A 1THZA 1J2JA 1MO4A 1R4MA 3UWMA 2HK8A 1JLLA 2RIRA 3FZGA 4GUAA 1NVGA 4FZJA 1Z7GA 3LSYA 3A9SA 3IAEA 1JSLA 2MR5A 1Q7GA 2QX8A 2AOWA 3AWDA 4FQ8A 2XWJI 3CLRC 4FC6A 3DUWA 3FYUA 3I9LA 2ES4A 4DQ0A 5L3SB 5I9BA 1BS1A 3MYYA 1NE2A 2H9AA 3S28A 4I19A 3QUSA 4L27A 1TQ8A 4OKNA 1YA8A 2B8NA 3SMQA 1PU2A 4BNWA 4RM2A 4P80A 4G0QA 1DXYA 1MIOA 4WK6A 4MV9A 2PUJA 1DDOA 1SMKA 3RJMA 3VOTA 4ZTUB 1PZGA 5JVDF 4Q02A 4E46A 1FS5A 4TMVA 5IMBA 1RXVA 5ALRA 4J1QA 2D7DA 4F9GA 1WXIA 3B85A 2XCSB 5EPOA 1T6YA 2GFQA 1OC4A 3NHKA 5F3DA 3B36A 5JWOA 1IYZA 2GAOA 1NMZA 2YJ6A 3H2HA 1OWOA 4TVKA 2PX5A 1R9NA 2Q27A 3U39A 1XP8A 4X54A 2YN4A 1MX3A 1ZKDA 1K8YB 1PGNA 3NRJA 1E2EA 1CV2A 5SYAA 3OEWA 2E1PA 4DL9A 3DDSA 4M2LA 5DTJA 4TS4A 2HL6A 3DKVA 3IB6A 1Y3FE 3IO3A 1Z7EA 4L6IA 3OUZA 4WK2B 5LWQA 5JVDB 1JWBB 5K3CA 3LT0A 1B41A 2A3NA 1SCJA 1X70A 2Y1OA 3OUTA 1NNUA 3EH2A 4F4IA 3REQB 1FBTA 2ERYA 3ZZMA 1I4DD 4TLDA 1NHWA 1SOVA 3B2NA 3D0OA 3C8HA 4MYUA 1C8BA 3W3AH 4YR9A 5JYFA 2MSWA 3ROGA 4M38A 1A8UA 1P0IA 3V8BA 4AMUA 2B5WA 3UVEA 2PZGA 1SIOA 4O4IB 3TW8B 4NS1A 4Q9KA 2ZRFA 3RC1A 3ZS9A 4IMRA 3ZHRA 2P1RA 1POWA 5AO9A 5ES3A 4B9EA 3GRFA 2EX0A 1AK2A 3L79A 3B78A 4FPXA 5JJCA 4N5DA 3LCJA 3WIVA 5AVVA 5C80A 2MSEB 3GFFA 3QH4A 4NENA 4AK9A 4TS9A 4RJLA 1KDZA 2V58A 4AN0A 2JGJA 3FVTA 5JAZA 4PGHA 3JYLA 3HKCA 2JGKA 4M83A 3V9AA 621PA 3OLXA 1SXIA 2LD4A 3FYHA 2C7RA 1MV5A 2EW2A 2VHYA 1RYDA 2VZLA 7GPBA 3ZZTA 2SNIE 3JATA 4DEXA 1SU4A 2GJKA 4TYQA 3TE6A 5CB4F 1QVAA 3ZWQA 1VIVA 1M76A 1KSJA 1XRQA 2IEZA 1CRQA 5ITZB 1BTOA 1BX0A 2Q1YA 3K05A 4BE9A 3E27A 4GYKA 3NONA 2OPBA 1A8IA 3F0TA 2QKYA 2WAAA 1HTWA 1W88B 3U4HA 4XIYA 1E2LA 4CETA 3CU5A 2V3CC 3C14C 1O6ZA 2OC9A 2W6PA 1ODTC 2NYRA 1Y81A 2ZYTX 4D96A 1U2DA 3HPRA 5ALKA 5K0TA 2WU3A 2CMGA 5BWBA 2O4UX 2LGJA 1BNCA 3GNTA 1JYSA 5AW9A 3TTXA 3YASA 5B1YA 3M1IA 1C3LA 1A7UA 3LC0A 4G85A 4EGQA 4LF7B 2VBCA 5BSGA 3KOUA 4EL0A 2H1WA 4I4TB 2PDAA 2RHLA 2E49A 4BGVA 4GPEA 2Y0BA 4PF1A 4AJ2A 1AF7A 3OJWA 1YULA 2HMWA 2P1ZA 3WJ7A 1YIAA 4TKUA 3FFAA 3UK1A 5T57A 3KL2A 1AUXA 4L7QA 3WWEA 4JJEA 2FCAA 4B47A 4BHTA 3SJUA 3DTTA 4OHZA 1FFXB 1XTIA 5HRAA 5KNDD 3LF1A 4GBED 3BF8A 2HRCA 2VXOA 3MUNA 4MB0A 4PX2A 4ZHSA 4EAAA 4EX7A 4LOJA 2KBEA 3TFQA 2RCNA 4PTYA 1OH5A 2H17A 2P78A 3M8KA 2BR3A 3I2FA 2D2IA 3FSGA 4IDBA 4IDGA 4AKSA 2CVFA 3EWNA 5JS7A 2X0RA 4G9EA 2QMHA 4QEZA 1WD7A 2OAQ1 3AUJB 4R1TA 4RFSB 2B2XA 1J8FA 3KZOA 1N9GA 3QE3A 4BNZA 2GQ0A 2B7BA 3I76A 2ZPTX 3ECCA 2W98A 3JAKA 2X2EA 1W48A 2PYDA 3N5KA 4KPEC 4X1YA 2BSXA 3KLBA 5LXTA 2QX7A 1TYEB 4M0DA 4BVLA 5JNLA 2O2IA 4F3NA 4MUFA 3ZHOA 1Z45A 4JYBA 2BFCB 4B87A 4WKCA 2JFWA 4PYLA 1EEXB 3K9CA 2G83A 2BFBA 4Q18A 3MZ0A 1BXZA 1OZGA 2XB8A 4LDQA 1PSZA 3B8HA 3N3AC 2ESRA 4GO1A 1A50B 2PZJA 2QGZA 3LP8A 3FUVA 4HNRA 4HP8A 4ZPJA 1MABB 4GS5A 4EQZA 3COPA 3EMBA 3FDIA 4IJUA 2AJLI 1RPTA 3J7TA 3KYJB 3FCYA 2AFRA 1Z0AA 2YYSA 3FPAA 3G9TA 3Q7QA 5EIBC 1TD1A 1Q0QA 4C78A 2ZE5A 4CIXA 5GONB 4XVQA 1XVIA 4DPMA 3KP1A 4JL6A 3X1XA 4F46A 3UUEA 3LGXA 1CUWA 1M2KA 3K70C 3ILXA 2WVAA 2FG5A 1OY1A 2DOKA 5JMPA 5ADUS 2HA7A 1HH4A 3B70A 1YQGA 2I2CA 1Z37A 3FPSA 3QKRA 2RIPA 4QICA 4CODB 4O2AA 4W1PA 3FPJA 5LDDC 3GLFA 1YS7A 2R66A 2UUBB 1D6MA 2MYPA 5F98A 1N8TA 1BROA 1RTTA 1LBIA 1FDUA 3KQQA 3DTYA 3KT8A 4O4JB 4PSUA 2JEOA 5KTMA 3HVIA 4NCAA 1LQTA 1GPH1 1L4LA 5IBPA 4CMEA 8AT1A 3AHEA 2O3QA 4FCTA 3CNNA 2QSJA 1EP9A 1U4SA 1P6XA 1E89A 1W59A 5ENDA 3ZJVA 1J00A 1A04A 3AF3A 1B7GO 3S44A 4FKMA 3BK1A 3CFYA 4NI5A 5LOVF 3L5KA 3QQ5A 5TEWA 2R85A 1N0HA 2HQRA 2H3HA 5L8VA 2YUTA 1GNRA 4BQRA 4IKPA 2NUBA 3NVDA 4LISA 4MI9A 3RSHA 2QVYX 3IRVA 3G7NA 1LSSA 2AG8A 1H6CA 2WSIA 4QT4A 5CD1A 3VSDA 4B44A 5IEBA 1H23A 1AO3A 3ZNQA 3QU9A 2R8ZA 1GNLA 1YACA 2JKYA 3D1VA 4TN1A 4R05A 3FZYA 2NVUA 2WDZA 2JEZA 3LM8A 4FOSA 5HIIA 1JV2B 1RFLA 1R6DA 2A7XA 3EMKA 4KSYA 3TB4A 2EHJA 4ALLA 1SUCA 1P61B 1XWFA 3HXKA 1P73A 3JYQA 3QG1A 2NZ8A 5TQ0B 5C51B 1CYEA 2ZU0C 4K6CA 1NQXA 2XVMA 1PTKA 2JLRA 2HFJA 3QKUA 1E6LA 4BZXA 1C29B 3CWCA 3KFVA 4PC6A 2Z4SA 1GQOA 1L3CA 1E0JA 1WD5A 4CG0A 4X6LA 3QLVA 1V41E 2NACA 3AHGA 1MEOA 1A96A 1PL0A 2PANA 4TV8B 3RG8A 2DQSA 1L8LA 4CVNA 4M1TA 1SELA 3KKNA 4P7GA 3RUCA 4CU5A 4IMJB 4QARA 4RJTA 5EZYA 3UFBA 4I36A 5I4IA 3DLHA 5D1HA 5JI3E 2QG6A 2F1HA 4Q3NA 1V2HE 2G0NA 5C0OE 4BFLA 1DO2A 1DU4A 1XJCA 2DQ4A 3EUAA 2V7WA 3IAM6 1PJAA 1O03A 2IBMA 3AXTA 4IYJA 4GOMD 4LZWA 5DYTA 2PUAA 1HDOA 2RB4A 4ID3A 1FYDA 2XOKA 1KEWA 2JCGA 2VLBA 3O38A 4LJLA 4QBFA 1PQPA 2RKOA 3DXFA 4RY9A 4AVYA 2IHJA 2G09A 3FH0A 3PC8C 2OQ2A 3FCUB 4DQVA 5J2TB 4IPTA 1SXGA 3FTNA 3FVRA 1CD5A 2EJUA 3T3NA 1P2GA 2BHLA 3NBKA 2XCTB 2XVAA 1BO6A 1R64A 1A1SA 2QRVB 2CNWD 3PRKE 1RIFA 3NAQA 5EG5A 5H7XA 1KZGB 1D0SA 4YASA 3OIFA 3KQNA 2O8BA 3GGJA 1NY5A 5IZCC 1JR6A 1YBAA 4UEKA 3QITA 2ZBGA 1A9YA 4KFTA 5JYAA 4P22A 4CBVA 3X0DA 2GBGA 3Q3CA 1B26A 2Q5EA 3ODPA 4LPSA 2SCUB 3I72A 2PL5A 3WJ1A 2LCFA 4JLVA 4F06A 5IW8A 2ZJBA 3TLMA 1SHJA 3WSWA 2AEEA 3FDZB 1PR1A 4Q1BA 1W75A 1LPOA 1BXRA 4L8LA 5KEIA 3X44A 3QW2A 3QX9A 3I6BA 4GGPA 4TTIA 1LW7A 3RBVA 4IJ5A 4EYSA 4ZT6A 2G28A 1PVOA 2G1AA 1YCGA 5E6RB 2D74A 3RM3A 3F7OA 3SIXA 5AKEA 3VDQA 3MD0A 5K3SA 5D8DA 3SYNA 3W8RA 5HOEA 1HA3A 1E0SA 5JADA 4OI1A 3FJOA 3D8BA 4MROA 4E70A 5I4KA 1ZN7A 1G5QA 5FO1A 3SQDA 3GJ8A 3WRYC 1PWXA 3AHFA 4EG3A 2QTFA 5CGZA 3QFFA 4D99A 3RAFC 3PA6A 3C1AA 1IXSB 4IQGA 5J4YA 3VR3D 2H5LA 1VBNA 1I7NA 1W85A 2VWHA 3EPRA 3N87A 4AM8A 4UZEA 5ARCA 4FI3F 2ZITA 5IDXA 2EWVA 2GI4A 4Q1VA 1L5HA 2Q99A 1ZPDA 2OUKA 3DYVA 3BHMA 2AX4A 3FOBA 2XF8A 3H83A 3JALA 3Q0TA 4LF5B 2I4LA 4ON9A 1KQPA 4KDCA 3NM5A 5CNJA 4D4LA 1ESNA 1C8VB 3PPYA 3CW9A 2P65A 4GZ6A 4BB9A 1SCNE 1NXVA 3WJAA 1JRLA 3CZQA 2FZ4A 1NUPA 1D1QA 1G17A 1VA5A 1DBIA 1SBIA 2POQX 2HWYA 2MYNA 3AT1A 2Q7XA 3JQAA 2ZI4A 1NWCA 1QSGA 3H9JA 5HM8A 4DCMA 2C5AA 5EYPA 2RHHA 2F8SA 2ZI7A 1YMVA 1Z4KA 5I5GA 4P98A 1YB6A 2HW8A 1BKDR 4AXBA 4FVTA 4TZ6A 4V0RA 4CQLB 4CMJA 5KHLB 3HRKA 4TRRA 4QM6A 1YS2X 3E0QA 3BGIA 3EWSA 4U5XA 1AGPA 4RX1A 3UFXB 2P4SA 2VP0A 1IWBB 2Q6OA 2ZXFA 4MRMB 2IBSA 2MYUA 4KIWA 4ZVQA 4E5KA 4Z3DA 1FFEA 1YQ9A 2OBYA 3G1UA 3N39C 4IICA 2BOVA 4JQOA 4NMWA 3DGEC 3H17A 4PWYA 4CF5A 2ZVPX 3LHKA 5IFKA 3LT2A 1QJCA 4BWGA 1XT6A 3GJZA 4EVIA 1CEXA 1II0A 1RM4A 4Q9IA 4BGIA 1QGYA 3UICA 1I6KA 2F9MA 4P0QB 1EVIA 4WCFA 5EUMA 2R65A 5JQWA 2QVLA 2BT4A 3NLLA 2R6JA 3DL7A 1IVSA 3EWAA 2OG2A 1U28A 4WVFA 5I7SA 2OSVA 1I14A 1D5CA 2BFDA 2IW3A 3AYXB 4H9GA 1WCYA 4BNDB 1N77A 1V4NA 2Y8EA 4JFAA 1G6KA 3AVUA 2YXEA 1D4OA 5ILQA 2HD4A 3HBAA 4D9IA 4EB6A 5K8JB 3K9FC 1VJTA 3NX4A 3RYIA 4E0BA 4NNOA 5JD3A 4TKZA 3AP1A 3ZTWA 1C1YA 5GP1A 4MR8A 2LE0A 2PL1A 3HFRA 4P84A 3A1CA 4AK1A 2GM5A 3FA2A 3KTOA 2JAUA 4RJ2A 3OQHA 3P4UA 4N7BA 4G1EB 4ZAGA 1NVVR 2SHKA 3MA0A 4MI1A 4AMGA 5BSKA 2I66A 5CVJA 1KI6A 3ELBA 4OL0A 2XT6A 1U7ZA 1A2OA 3OTQA 4UM9D 3TR0A 2GNAA 1E5LA 1XA3A 3DBOB 4GBJA 1VIAA 3VPFA 4F8JA 2HK6A 2JA1A 4YJGA 5MFPA 4TSKA 4G07A 5LA6F 3W5AA 1XNRB 2GM3A 3HB1A 1T1EA 1GAXA 1MHTA 1FNBA 4ZOCA 4PFSA 4XWGA 2VPTA 5NULA 3GCDA 1TK9A 4KEAA 4F3YA 2AI3A 2IP4A 2XXBA 3QY0A 4NBKA 3RWMB 1IXKA 3LKDA 4EYEA 3J81k 1PT9A 2YQ4A 3ND8A 2A0XA 2DT8A 2NZYA 2O1WA 4KN8A 3PXGA 1CQJB 4C20A 5JD5A 1QMPA 2ISQA 4MV5A 4BECA 3LLMA 1N6LA 3R7AA 1RWBA 2ZI5A 2H63A 5J5CA 1T8SA 1TKAA 3QX7A 1V8BA 3B3GA 4W1RA 1GGFA 2HSJA 5AHKA 5FNZA 4I3GA 4DLYA 4EKGA 4YPFA 1TLLA 2WDPA 1DAHA 2QHXA 1X80A 4YUVA 3GPDG 1H42A 2I4IA 1XFAA 1SCQA 4BPBA 1USGA 1V43A 1JG4A 4DIBA 3QX8A 3K0FA 3UA4A 3L0BA 2DWCA 5DOZA 4UHBA 2C0CA 3MERA 4MLDA 1H2YA 4Y1GA 4OMUA 1U1CA 2IK8A 3K09A 3PUWA 4AG6A 3U6BA 1NM5A 1ILWA 1TYBE 2NW6A 2VSNA 4YCDA 5B2FA 3ICVA 2O59A 4UDNA 5J1SB 2QN7A 3GAZA 1GL7A 1Q83A 4FILA 2IC5A 2FQ1A 1CWUA 2XAAA 1L7DA 4YCLA 3FFXA 3D81A 1HT2E 1LVGA 3Q88A 4MQ5A 2E7ZA 1ORDA 2Q6LA 4ZZ0A 1AMUA 3T95A 4FGWA 5E2IA 1ULBA 3G82C 1DKMA 3B38A 2EW1A 4HS9A 1TUGA 1A4XA 5F21A 4KIGA 2IH5A 4BEWA 4FS8A 5IUJC 1A2KC 3ASYA 2QMOA 3IQWA 3U17A 4C7OA 3GT0A 1G21E 4N12A 4PZEA 1LDEA 3A3PA 3BE8A 1ZVMA 2FEOA 3D8TA 4QEDA 1T9AA 1T9DA 1XQXA 4WK4B 2XX3A 2AR7A 1U6JA 1GPMA 3BKXA 2DQYA 3FF4A 4KQ2A 5ECWA 2IYFA 4ZU6X 1JDSA 1L5KA 3VVCA 3OJLA 1Y6ZA 3EZXA 1Q0PA 1FTQA 3I9NA 3TNLA 4N41A 2COKA 4AULA 1J2RA 2DTEA 4ZQIA 2WQ6A 4CT5A 4OUDB 3D7NA 4MRPA 3WO0A 2WUEA 1WNTA 2O8DA 2A9PA 4CKZA 3C0KA 3GEBA 3HXQA 4RTRA 2O0MA 4U9UA 1SKUA 2XIQA 4HYQA 4QWMA 4Z7NB 2GAAA 4EA6A 3KJGA 1E3EA 2ZBPA 4J4TA 2QZ4A 2E85A 5IJ0B 1DC3A 4AKEA 2H29A 4YRMA 4MPTA 4RK1A 1DUVG 1FRVA 1K3FA 2Z5GA 1E4EB 4CF7A 5JSFA 1G38A 5JMTA 3H11B 3DTVD 2PCLA 4Z8XA 4AZ3B 1DG9A 3A4VA 3IHTA 1I0IA 2WFMA 1S01A 3OQIB 3FLBA 2W6CX 4IIJF 3F6PA 3HB5X 1ND6A 1CDDA 5J2UA 2RGRA 1U90A 2JA2A 2RBGA 1JFVA 5I48A 2YY6A 1ZCFA 4LWOA 4JP2A 5EWMB 4R1LA 3CVXA 1LQUA 2Q5FA 1JEYB 1ZNYA 1PFWA 2G9ZA 3T38A 3DWIA 3TSCA 1AE1A 4OKSA 5CFLA 3LCCA 3BTUA 3D54D 5LQNA 1K66A 2H4JA 3RV3A 4KWTA 2NSJA 2ZIFA 2A5GA 3L6EA 3OT1A 3WLFA 5JS8A 3VAZA 3FPHA 3ZVNA 2ZZNA 4N48A 1DKNA 3B1XA 2PGXA 2ZETA 4KO3S 3AKCA 1L4EA 4U1RA 3DEYX 5JSKA 5FNVA 1Z12A 4YNBA 4OPMA 2WT4A 2D06A 4NBRA 1TADA 4NFLA 4X91A 4F3CA 4JQZA 4I81A 5CD9A 2FEWB 3ZI7A 4CR6A 2ZTVA 2IEGA 4NH0A 4NCIA 3AERA 2GD1O 4DGSA 1Y5IA 1UT6A 4D8YA 1YB1A 3LQKA 2GEJA 1V6CA 3VJKA 4AROA 4GP6A 3AEYA 4B7AA 4ARSA 3QEAZ 4BO8A 2QGNA 3A2LA 3SVLA 2VHJA 2NO6A 4IIDA 5AXCA 1YA6A 3D5TA 3HL4A 4FUQA 4YP0A 5JE8A 4DIFA 1EESA 2FX3A 2JNWA 2HEGA 4ZQEA 4K81B 2GZ1A 1R0RE 1SKAA 3ABRB 3DZGA 4L75A 3UY4A 4ZZ1A 2IS4A 4JUBA 1WZIA