3ZCXA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
total genus 116
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zcxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zcxA01
1V35A 2RH8A 3OEWA 1X13A 3IIEA 1PZHA 4R3NA 2VHWA 1C0LA 1RYDA 5DDIP 2HMUA 2UVDA 3WR5A 3KRTA 1PR9A 1U3WA 1T1RA 1E1LA 4ZRMA 3INGA 4IDAA 5JO0A 2CDCA 2DUUA 3MJSA 3JQ8A 3WNVA 3BMCA 1G6KA 1C1DB 1N9GA 3ZN2A 4L4XA 1M6WA 1EVIA 3AU9A 5JLAA 3I6IA 4DMLA 3WBFA 1EMDA 2NU8A 3UN1A 4UUOA 3PYMA 1EK6A 1WZEA 3HFSA 2DKNA 3JCZA 4TQGA 1Q7CA 2J3IA 1V0JA 3WGOA 4YR9A 4OXNA 5CDTA 2PZMA 1WAMA 4B3HA 3ETGA 3SC6A 1Q1NA 2O23A 4MDHA 2Z95A 1PGNA 2YJZA 3PRJA 4BKPA 1ISJA 1XA0A 4FJ0A 2VNAA 3SC4A 3I9KA 5AVOA 2X5KO 2P4HX 2YY7A 4WKGA 1UZNA 5JC8A 3KETA 3ON5A 2DAPA 1DAOA 5AXDA 2AQ8A 1HETA 2E6UX 1R4NA 2C20A 2P5YA 4KDFA 4MIEA 4RPKA 4PG5A 1I5RA 1NXQA 2R00C 4JBGA 5JS6A 2EV9A 1XLTA 1GDHA 3IUPA 1I36A 4C7KA 4I8XA 4J0EA 4CLOA 5EESA 4RVGA 4E13A 1E3EA 2HK9A 4PLZA 3ZWVA 4AJHA 4YXFA 3UCEA 1EVZA 4OOFA 1GEEA 2DU8A 1U1IA 3WJ7A 1GV1A 1EEHA 1P31A 4PN3A 3RC1A 3MWEB 4WECA 2NVUA 3HDQA 4QFCA 5EJ2A 4PVCA 5MDHA 1WVGA 1K6XA 4YPOA 1ADBA 3NT4A 1T25A 1MB4A 3FCOA 2AEMA 2Y05A 1Q0HA 4ZQEA 4EZBA 3R1IA 4YAJA 3DHYA 3WDSA 4JBHA 1I3LA 1Y8QB 4XZ3A 3NTQA 2DTDA 3DEYX 3OBBA 3RUFA 1WDKA 1MLDA 2Q1WA 3AOEA 4AJNA 1GCOA 3QVOA 4L0QA 2ZJ0A 4KUEA 4UVEA 5DCUA 1YB4A 2GPTA 5TC4A 4BNGA 3PYLA 3Q0EA 1E6EA 1KVRA 1LLUA 3GVXA 2FPGA 3ZH2A 1LSOA 2JFGA 1OC4A 3C7AA 4JP2A 3DZJA 1BSVA 5THQA 2PKQP 2QIOA 4PZCA 5IN4A 5A9RA 1LA2A 5DULA 2IYPA 3O8QB 3G1UA 3AJRA 1X1TA 3FD8A 3GGPA 5IDXA 5AQ1A 2DFVA 1M67A 1PX0A 2VOJA 2UUOA 1XSEA 4DIBA 3ZCXA 3DZGA 4B4UA 4R41A 2DBRA 2B4TO 2YQ5A 5KJ1A 3VOSA 4YAIA 4GVXA 3TJRA 4KOAA 1IHXA 2Y1CA 2PY6A 1V3UA 3KV3O 1EBUA 3ZZNA 3ZV5A 1R37A 4IDDA 1ZK4A 4RLHA 2I76A 1UZLA 3QWFA 4R54A 3PYXA 2FY8A 2NSDA 5IZ4A 5A05A 1PGQA 4N54A 4DBZA 5KJ6A 1H2HA 3KO8A 1X14A 1PJSA 3ZWMA 4XR4A 4FB5A 4WCDA 4DQUA 5JCXA 5IFLA 3FNGA 5K6AA 3ROPA 5F21A 1U7HA 3F4BA 4XD2A 2AXQA 2FR8A 2NTJA 1UAGA 1ONNA 2VT3A 5JPIA 4DLAA 1TVEA 5KVSA 4XB1A 2LDBA 2QX7A 3BHIA 4RO0A 4CMHA 5I7SA 4E0BA 1IY8A 2H5LA 1I33A 4ALLA 4YTEA 3WX0A 3HB5X 5A4DA 1TT5A 4XIYA 4EI2A 4GKBA 3IJRA 2X0RA 3I5MA 2W4QA 1P9LA 1T24A 3D0OA 2DQ4A 3EDMA 1VRWA 1DIAA 4AJEA 1DLJA 5F1OA 3RFTA 2NU7A 3OICA 1DRVA 2OHXA 4GLOA 3STHA 4IGEA 5TIIA 3LZ6A 1E3SA 1VJTA 3LT1A 4IY1A 4OAQA 1GR0A 4FJ1A 1QORA 5IZCA 2ZTMA 1X15A 2VZ9A 4QO8A 3BHJA 5EQDA 3RU7A 3DBRB 4ZQBA 1HEUA 2W98A 3SLKA 2PTGA 5JMWA 4CL3A 4K6FA 3VZSA 3OECA 3SEFA 4L73A 4CR6A 2HU2A 4RF5A 5I8WA 4HX5A 2HJRA 1NAIA 4OHUA 5LC1A 2DBZA 1I2BA 4DPKA 2ZTUA 1ORRA 4QXMA 2WE7A 3ANLA 3DAFA 2IE0A 3KTDA 5TNXA 3ZW8A 3Q1LA 1I30A 1VC2A 2C5AA 3OF2A 4A5OA 1X7HA 2OP0A 4WCFB 4CMEC 1IL0A 5B37A 3H8VA 4JNKA 3KBOA 3OM9A 1AUPA 3HN2A 3U0BA 1UZMA 4GVLA 4RJTA 3S2GA 4MINA 3E03A 4J9VA 4YRAA 4URFA 1J0XO 1PJ3A 3E9QA 3RCBA 3QW2A 3RUIA 3W6UA 4AJ2A 2DC1A 3JD0A 4J4TA 1SEPA 2IYOA 1WP4A 2O7SA 1PQUA 2PV7A 2Q50A 3WFJA 2QRKA 3H9EO 1HKUA 1GY8A 1LDNA 2Q99A 1CIVA 1B0AA 4YAKA 4DBVO 2X9GA 4AICA 3NUGA 2X58A 3PJDA 2PKRA 4XGNA 4J3FA 4NPCA 2FOIA 3ZNNA 1ZK0A 2PGJA 4TRNA 4WE3A 3TZHA 1HT0A 3C1OA 1HSZA 3GOHA 4PG4A 5F5LA 4RPJA 1UDBA 1P1RA 4PLPA 1UP4A 1PS8A 5HRUA 2YW9A 2ZK7A 4M54A 1GU7A 1AHIA 4CLEA 1QYXA 1BXGB 5LDHA 4XQEA 2FZWA 2WM3A 2Y0DA 1TB4A 4FR5A 3DMTA 4J1SA 3ZHBA 1Z82A 4R51A 1A9YA 4GLLA 1DOHA 3JQBA 4L75A 3MZ0A 1A7KA 1IUKA 2BD0A 3I9JA 4D45A 5KKCA 1FJHA 4D0SA 1DDOA 1BDMA 3JTMA 3RUEA 4N18A 3RJ9A 5JBIA 4MO2A 4RVDA 5G0VA 1KEPA 4KMSA 4BNJA 2UYYA 3S8MA 2CVQA 2GRAA 5L7TA 1SOVA 3JSAA 1ZBQA 4PG6A 2O50A 3GH3A 4DXHA 3DDNA 2I6TA 1OBFO 4J7UA 2HUNA 2B36A 1BWSA 5C3MA 2HRBA 2WJPA 4GGPA 3KB6A 1FDUA 2EEZA 2JFFA 2DLDA 5JAQA 1E3IA 4E4YA 5GY7A 3ZU5A 4DGSA 2RAFA 3F9IA 2G5CA 5A06A 2VWGA 1DEHA 2Y1DA 3KYDA 3H9QA 3PLNA 4DLLA 2ZIZA 3QWIA 3D4NA 2AQHA 1D4FA 3DBHA 1B3RA 3AFNA 5A04A 2P4QA 1PJQA 4GX1A 2G17A 5BSEA 2B0JA 1O5IA 2B83A 1ULUA 1QYCA 3HDJA 1BGVA 4EJ0A 3B1FA 1FXSA 3UH1A 1UJMA 1EQ2A 1X1EA 2QZ9A 5AOVA 5BNTA 3RUHA 5IF3A 1H94A 4M55A 4UEJA 3AM3A 2O3QA 1O8CA 4XDZA 4CR8A 3RU9A 4PLVA 5ILGA 1H6AA 4B4VA 5BR7A 5CDUA 4E5KA 4U6QA 3DBLB 1NQAO 1SB8A 4IJKA 4WEQA 1HRDA 3JD2A 1ZMTA 3OA2A 2Y93A 4YJDA 4EJMA 4YRBA 1UP7A 1UXJA 5CPBA 1L7EA 3PPIA 3JQ8B 4LCEA 3BMCB 1F0YA 2E49A 3PZRA 1QSGA 3PXXA 5G0TA 3WS7A 2FRDA 1N9GB 2GUGA 3C24A 4IMRA 2GSDA 4IPTA 3RUDA 2HK7A 3JYOA 4UVGA 4PLCA 2PD4A 5BSGA 4LISA 4E33A 3HADA 3L9XA 3H5NA 3DAGA 1YDEA 4EW6A 4JIGA 2LDXA 4RVHA 3UVEA 3ADPA 3ICCA 2B4RO 3PWSA 1I2CA 4E21A 1KS9A 2X4GA 3PWZA 3CSDA 4DVJA 1YH3A 1SBYA 2AEJA 4R1UA 4W4TA 1AN9A 4YB8A 2O48X 3GRKA 2O3JA 1KY4A 2HLPA 3S2EA 4FFNA 4WNCA 5EN4A 1U8FO 3E5MA 3GA0A 5FI5A 1AHHA 1U3VA 2ZB3A 1IYZA 4MOWA 4JQCA 1R4NB 1UXKA 1Q0QA 2PNFA 3OIFA 4INAA 2PKQO 4E32A 4ND4A 2ZQYA 1GYPA 2Y66A 3OFSA 1GD1O 1U9JA 3U62A 4WLEA 2I66A 4EJ6A 4ZQGA 4BO0A 1HDOA 1RM4A 1C1XA 4QUKA 4CLOB 2HSDA 2EKLA 1U5CA 4PG8A 2XOXA 5COBA 1F8GA 2GN6A 3EC7A 2P9EA 2ZYAA 1RJWA 2VTDA 3FPCA 1Y7TA 4IDCA 4J2OA 5HM8A 1PZFA 2AA3A 1K0UA 2RIRA 1SC6A 1K6JA 1QLHA 2Y68A 2D1YA 4II3A 2NTNA 1R15A 4KQWA 4A27A 3H9GA 5T67A 2GZ3A 1GZ3A 2ZATA 1U7TA 1ZO8A 4N7RA 1IB6A 3K8ZA 3FI9A 2XXJA 4LSWA 1N2SA 4WPGA 3A28A 2W90A 3QY9A 1AE1A 3L9WA 5LCXA 4J1NA 4I5DA 3NDJA 2SCUA 3M1LA 1JU9A 3EVNA 3GUYA 2OO5A 3OP4A 3TZKA 4BHTA 3MJTA 1VJ1A 3KYCB 1I32A 3VZPA 3COSA 3TZCA 5C7LO 1T2FA 1AXEA 1HXHA 3LVFO 3KEQA 3RSHA 4ND2A 4U8GA 3LK7A 3K2BA 2AG5A 3HDHA 2BRUA 2O4UX 2R00A 1LRJA 2O2YA 3GT0A 7ADHA 4G2NA 4ITUA 4FPXA 4EDFA 4I5EA 3LLSA 2J3JA 4RL6A 3GGGA 4ZA2A 2Z1NA 3JQFC 4MIYA 3GNQA 1R66A 2NNLD 1OZAA 2BELA 1ONOA 1KIFA 4R1NA 3WB9A 4Q3BA 3C8MA 4XGIA 1LUAA 3JQAD 3H65A 1I0ZA 3AU8A 4WLNA 3JYQA 4MVJE 1JKJA 2OGUA 1CEQA 3DBRA 5TSDA 2Y99A 1DO8A 2CNBA 3O03A 3BTOA 3SXPA 4NFSA 4CUJA 2VWQA 4BKUA 1UR5A 1ZSVA 3S55A 4UVDA 2AQIA 4KWHA 5IDWA 5HS6A 3B70A 5ER6A 4GAEA 3CKYA 3GRPA 1MUUA 1EBFA 2JKVA 4JCOA 2OP1A 5TF4A 4Y67A 5DNAA 3AUSA 2GGSA 3WTBA 5JC1A 3ZV4A 2PLAA 4D7AA 1QLJA 4WCFA 4PLHA 4YJGA 4BO1A 1N7GA 1O0SA 1CF2O 4J49A 4XB2A 3QP9A 5HTOA 1HL3A 3K92A 3GG9A 1LDEA 4R01A 2AMFA 3DTYA 2X5OA 2YUTA 3OIDA 2DM6A 2Q2WA 3H9JA 4Q3EA 4W6ZA 4DIOA 1ZKMA 3WOHA 4I9HA 2Q45A 5CHEA 1HDGO 1Y8RA 1KYQA 1TT5B 1RM0A 2WWRA 1Y9EA 3JYNA 2F1KA 3JQ7B 3MJ4A 3N7UA 1P1JA 3HUDA 1YJ8A 1V9LA 2P9GA 4BNMA 1GFSA 5IAAA 1F17A 4NZ9A 4QQRA 5CP8A 4NBVA 4NMHA 4B8ZA 4RZIA 4GX5A 3E9MA 1NPYA 1N8KA 3MEQA 3RBXA 5EIOA 1FDVA 3WJAA 2Q46A 5JAZA 3LLVA 3WYBA 4LK3A 4BNFA 5KJFA 3AM5A 1ARZA 4LW8A 1MFZA 3GNSA 3GN1A 4GQAA 5H81A 4WASA 4YJFB 3WGGA 1HDZA 2JD0A 5U9CA 1H2BA 4F3YA 3D3WB 4BGUA 1GCUA 1DRWA 5I7FA 4D3FA 3LF2A 3ZWAA 4Z6KA 1OI7A 3OJOA 3W4IA 3ZWNA 3MCVA 4XX0A 5TJ9A 3P2OA 4FOOA 1PWZA 4E2WA 3GQVA 4DLBA 3ZV6A 1E7MA 3M6IA 4QSMA 1T4DA 5G0WA 3V1YA 3NV9A 2ZYDA 4CV3A 2B69A 3OEYA 4EEZA 1UXGA 4NJMA 3RVDA 4MVJM 5KJEA 4PLGA 2X0IA 3TQHA 1YS4A 1XHLA 5A9SA 1H93A 1U2GA 1XDWA 4W99A 1CETA 4CUKA 4F6CA 1KEVA 4BQRA 1EUZA 4MVJF 1N5DA 1XIVA 3O38A 4NNJA 3IS3A 1QV6A 3FF4A 3GLQA 4DC0A 3W8DA 2XAAA 1CQJA 3GFBA 3ICPA 1BVUA 3OH8A 3GEMA 3VAZA 1P0CA 1HYEA 3RI3A 5TQVA 4D0RA 2RCYA 2CVZA 1PU2A 5GZ3A 4K28A 3FR7A 1NHGA 2DTEA 4K6CA 1Z7EA 1LRLA 4S3MA 3FSRA 3LC7O 1B8VA 4A26A 4NBTA 4KDEA 3ROMA 4ZJUA 3NDRA 4NHEA 1B2LA 4ID9A 5JDCC 4EYEA 2H1SA 4JGBA 4LN1A 4CL8A 4CMEA 4MJLA 2B35A 4IZHA 4MKXA 1E1MA 1YB1A 1GYRA 3F3SA 2X1HA 3DBLA 4DUPA 4E3ZA 3GZ4A 4CODB 4WOKA 4E31A 4FN4A 4JP3A 1Y1PA 3GMDA 4ALNA 1VLLA 4NBRA 4DYVA 2EGHA 4YAGA 4R1TA 1QXSA 2G1UA 2QRJA 1NM5A 1X7GA 2AE2A 2G76A 1PR3A 2V6MA 4CM5A 5L51A 3GN2A 1F14A 1HDRA 3GHYA 4CLRB 3PZBA 3AI3A 4O5OA 3RIHA 4BO3A 1DFHA 3JQCA 3MTJA 3KYDB 4YQYA 3TSCA 3KSZO 1JLLA 4B4WA 4XWYA 3DBHB 3RBZA 1B8PA 1P33A 2E82A 1YONA 5EQFA 2O4CA 5ITVA 4Q3DA 5H82A 3IOYA 5FWNA 1ZUD1 2GO1A 1A71A 5A02A 4PRLA 5ADHA 1LSUA 1DB3A 2XPCA 3H2SA 3F1LA 1KEUA 1K6IA 1M75A 3E8XA 1JVBA 1VPDA 1OC2A 2FR1A 4BNLA 3ZHXA 3AM4A 4OSOA 4FBGA 2FMUA 3GAZA 3QA9A 4GWGA 5JAMA 4JBIA 5T5QA 4R68A 4GI2A 2BGKA 3P5SA 1PQPA 4WGGA 2GF2A 4BNXA 3TFOA 2EW2A 4EUEA 3KEOA 2IZ1A 8LDHA 3WXBA 4YJHB 5KOIA 2C54A 4OJNA 1XEAA 3PQDA 1BMDA 4OIMA 4MIOA 1I24A 4YEDA 1NNUA 2Y1FA 4H7PA 4BNTA 2J6IA 1JKIA 1EUCA 3C3XA 4CMCA 2V7PA 1DRUA 2GCGA 3FWZA 4Y8VA 4U6SA 3MJVA 3VPHA 3PGJA 4UUNA 3ITDA 4E12A 2RHCA 3L0DA 2I3GA 1B26A 4YQZA 1EDOA 1XYGA 2GN4A 3GEGA 4CM4B 4GMGA 1R16A 1QYWA 4FGSA 4BO5A 3L07A 4BO4A 1ML3A 5JYAA 1NFFA 4XCVA 1EE9A 3NRCA 3WFIA 4AJOA 3BMNA 4DTIA 4HADA 3QWHA 3KYCA 1ISIA 2HKIA 2YDYA 3VH4A 3GZNA 3CMMA 4EITA 3N74A 3U5TA 3G49A 3W8FA 5GZ6A 1YO6A 4HXYA 4XRGA 3UF0A 4R4JA 4WOJA 2E37A 2NU9A 3HE3A 4OQZA 3T4XA 3ZNPA 4DQXA 5A3JA 3WBBA 4WEOA 2VRCD 4XJSA 1YDWA 4AJ4A 4IQ8A 3MOGA 5TJHA 1UDCA 3VZRA 4PRKA 2DT5A 1C1XB 4E30A 5JCJD 3CINA 2DPHA 2Y1OA 4M86A 1YRLA 2BGLA 1MXHA 1ZJZA 3B6ZA 3IP1A 1GTMA 2C07A 2NQ8A 3W1VA 3GVCA 2JCYA 2G0TA 2ZB4A 3KSDO 2HRZA 3TZ6A 4CV0A 2QYTA 4J7CA 4AL4A 3SVTA 4MVJD 2HO5A 1Q7BA 3U4IA 1UXIA 2QG4A 1MG0A 1GUYA 4I5GA 3A4VA 1D8AA 4HKTA 2NTVA 4Y98A 4BMSA 4IQGA 3EVTA 1RM3A 2D2IA 1U28A 2JHGA 3ANNA 4G65A 2FZEA 2O3SA 4HNGA 4AJPA 1JAYA 3HSKA 1SOWA 2DBQA 3I83A 1ZK1A 4Y6RA 2I99A 4FIZA 4FFPA 3RFXA 1JWBB 4PLYA 4RDIA 1QKIA 4L8VA 3HJAA 3CTMA 3C7DB 1HLDA 5EMHA 3E48A 1WDMA 5A5FA 1Z75A 3HB4X 1XKQA 1PJBA 3RQSA 3VVBA 1LDMA 4W9NC 5AYVA 2BFOA 1DFIA 5KWEA 3OA0A 1MFPA 4XYMA 1C0PA 3JQ7A 1RM5A 3NGXA 3L6EA 5ITWA 3DZFA 2IRWA 4UEKA 3CIFA 5KCZA 4R5MA 4EGFA 1G0NA 5C7OO 2FWMX 1TA4A 1NFRA 4LCJA 4RZHA 1Z7BA 2PD6A 3PHIA 4M49A 1BVRA 3WQSB 4B8WA 2B37A 4A73A 3BMOA 3QRWA 1R0KA 2PWZA 1ENZA 2BFPA 1IOLA 3NYWA 3EK2A 3U4CA 1VM6A 1E6WA 4YJFA 1RKXA 4W82A 3JQ6A 4G5HA 3JV7A 2ZCUA 4CMJA 2PGDA 3D3WA 8ADHA 3UAGA 2VYND 5DN9A 9LDBA 4TKMA 1JKFA 4XYEA 4YDRA 3E1KA 4FD3A 4ALJA 3B20A 5ILOA 2J3KA 3PTZA 3KHUA 2UUPA 1WW8A 4Q9NA 4CMGA 4H3VA 2VN8A 3BTSA 2BGMA 5I7EA 4LVUA 4YJGB 5C5IA 1Q0LA 2JCXA 1E5LA 1K5HA 4XYLA 4IJVA 1KBZA 1UAYA 1I01A 4CPDA 2OOSA 3FNEA 3QE3A 4FC7A 2VRCA 4GGOA 3JQFA 2CD9A 4D43A 1ENYA 3EW7A 5JCJA 3G17A 4B7CA 1U8XX 3ZGYA 4NG5A 6ADHA 1Y8RB 3FNFA 3GY0A 3KVOA 3FBTA 3OIGA 4KTTE 4F6LA 3GPDG 3D4OA 4JN6B 4OSPA 4B7UA 4Z9XA 2YHIB 5TLSA 4QEDA 2Q1UA 3VPFA 3W4JA 4FCCA 1YL5A 2GZ1A 1HYHA 3F1KA 3ZV3A 5JMPA 3MTGA 3DWFA 4BMVA 3G1TA 1W6UA 1KY5A 2C0CA 4MVJA 4CLXA 4HV4A 1YWGO 1GZ4A 1PZGA 3TRIA 5ER9A 1OAAA 4Q3AA 1ZSNA 3U4HA 4JXKA 1NR1A 1L1FA 3CMCO 1QYDA 3TL2A 2YHUA 2Y67A 4XDYA 4XQ9A 3WQQA 4CMBA 5ICSA 3VTZA 1CDOA 1UUFA 1DIGA 3PJFA 2VUSA 3NGLA 4BV8A 1QRRA 2NQTA 1LQUA 3PQEA 2NUAA 1PTJA 1NWCA 2QW8A 2G82A 1W8DA 5L53A 3A1NA 4BMNA 3TN7A 3H7AA 1SCUA 4F45A 5TS3A 3S2FA 3RASA 2GNAA 3K9QO 2YQ4A 4E2YA 4NH4A 4NJMB 2TMGA 2VHXA 3OSUA 4XRRA 4J4BA 5JDIA 2GZ2A 1EFKA 2CSUA 5A9SB 4CMIB 2I67A 3EHEA 4CLRA 5IG2A 4WUVA 1DJQA 2CF6A 3JQAB 3Q11A 1QMGA 3L4BC 3WG9A 4OH1A 3R0IA 1J4AA 3EGOA 4IM7A 3FTNA 2P91A 3VPGA 2IEDA 4D3DA 3VH3A 3ZHZA 1B7GO 4NBUA 4RPHA 3W6ZA 2PH3A 3SJ7A 3NTOA 4BGEA 3D64A 4BIIA 4ROSA 3M1AA 4FS3A 3WWZA 5DZSA 1WNTA 1PL7A 4IIUA 4Q3NA 3WGTA 5DP2A 5HBRA 3I9LA 3WIDA 3G0OA 4CM6A 3AOGA 4WK6A 1YOVB 3DL2A 5I8ZA 2OORA 2WSBA 4B3IA 4R5HA 4NIMA 5JO9A 3UXYA 3V5NA 1OFGA 4YJHA 3OJ0A 1C0IA 2E4AA 2Q22A 3DBVO 4XA8A 3AOEC 1NPDA 4D3SA 1HLPA 4J1QA 2EP7A 3GDGA 1ENPA 3E6AA 1JQBA 4WLVA 4TVOA 3UOGA 3V2UA 3IL2A 3PHHA 2IDZA 4J7XA 3PQFA 4XYBA 1B14A 1FDWA 3GAFA 3HQ4O 4AFNA 2J5RA 1DHTA 3PDJA 1QP8A 5I9LA 3GGOA 1W0CA 1ZEMA 5MGBA 2R2GA 3PEFA 5COQA 4RLSA 3O26A 3VPXA 4JLWA 1PJTA 5I9NA 3BAZA 3GC6A 4CM4A 1H6DA 1NQTA 3GVHA 3AI2A 3I3OA 3FHLA 3DQPA 1Y5MA 2BLLA 1S7CA 2Q1SA 4R1SA 3WICA 6LDHA 2EHDA 4YT8A 4FW8A 5G2OA 2BI8A 1DC6A 2OFPA 7MDHA 4IJWA 5JDCA 2POQX 2VOEA 4Z9FA 1GADO 1SB9A 4I5FA 4HFNA 4Z0PA 2OMEA 4XEHA 1NVMB 5KVQA 3WGZA 4ESOA 5JY1A 2OL4A 1O9BA 3P2YA 1N92A 5IDYA 5F3RA 4LMPA 1YBMA 3DR3A 1A4UA 3BIOA 1KVUA 5JW6A 1MXFA 1CQIA 4O0LA 1A7AA 2FP4A 5A3VA 2ZB7A 4P8RA 4MVJI 2VYVD 1HE4A 3BHMA 3HHPA 1WPQA 4IS2A 2P68A 1HDCA 4TMFA 5K0ZA 2C59A 1LTHR 4A0SA 1YL6A 4ALKA 5M6DA 2WDZA 4J91A 1KERA 1HZJA 5FYDA 4ZU3A 4RQUA 3ZU2A 5G4KA 2ET6A 3NEPX 1NR7A 1DBVO 1MA0A 1GV0A 3CH6A 5AXCA 3ZWCA 3OQ1A 2X8LA 1H9AA 1X7DA 3BMNB 4IDFA 4RGBA 5LDGA 1GQYA 2H63A 1ONPA 2HDHA 1WDLA 3GZNB 2OUIA 1DJNA 3PHGA 4NI5A 3GNTA 1GQQA 4U5QA 4A03A 1BG6A 1DIHA 3ONDA 5KVCA 4ZICA 4PLTA 1A5ZA 4CM8B 4NJOA 5TX7A 2X0JA 5FFFA 1HDXA 2X23A 2JHFA 3S2IA 5K9ZA 1EVJA 3RROA 2AQKA 4TZKA 4U7WA 1XG5A 3Q2KA 2D5CA 2NVBA 1JAXA 2ZKLA 3D5QA 4P38A 3O4RA 1MC5A 3WGYA 3C1AA 1LX6A 3E18A 1YVEI 3ADOA 5CDGA 4MP3A 1YE3A 2XXBA 3LQFA 1Y6JA 1R0SA 3TNLA 1K2WA 2OZPA 1RPNA 5ES3A 4BNZA 1L7DA 4Y9DA 4YT5A 2EWMA 3ITKA 5U1PA 2AEFA 3NDIA 1JN0A 2EJVA 2VHZA 4XR9A 1ZW1A 1XCBA 3QHAA 3X2EA 3QSGA 3WYEA 5L45A 2GDZA 2Y0EA 4IBOA 3FPLA 1P1HA 3AY7A 3JQEA 2IXAA 5AXBA 3AUAA 4OXKA 3HN7A 1P1IA 1IZ9A 1KVTA 3MJEA 3ORFA 3PP8A 4C7JA 1D1TA 3PI7A 5L3ZA 2PFGA 1LC0A 3JQ9C 4MPDA 3L6DA 3PK0A 3DZBA 3ZWYA 3KUXA 1MP0A 1LXCA 2RBEA 2VNSA 4GSLA 1XU9A 1YGYA 2BKAA 3G79A 1DAPA 1KEWA 4M87A 3OQBA 1WZIA 2IODA 3E5RA 1OOEA 3GF4A 3NT2A 3WMWA 2EW8A 1T2DA 3ROQA 1Q2XA 4PLFA 2HAEA 3IMFA 1FMCA 2DVMA 2Y1GA 1T26A 5CDSA 3DB2A 1BRMA 1LC3A 5IXSA 3KM0A 3HG7A 3FWNA 1J6UA 4ALIA 3UKOA 3OHSX 4R69A 2YHIA 3GHHA 1NQ5A 1Y9AA 1NP3A 5L4NA 5T73A 3GMSA 3I4CA 1VL8A 1AGNA 2GN9A 2Q49A 2A4KA 2VYVA 2FPPA 2QYSA 3T4EA 5BSHA 3UFXA 3K96A 5IN5A 3BMOB 5JYEA 4BB5A 5G0UA 2NADA 2D4AA 1EE2A 2EKPA 2BFMA 3EAGA 4UREA 5BNFA 3I4FA 2UV8A 3X2FA 1BXZA 3Q9NA 4UUMA 2X9VA 3WNQA 5BSFA 5I7VA 1GAEO 2H6EA 3MWDB 3DHNA 4HFJA 3PJGA 2YV2A 5DBGA 1JVSA 1A9ZA 2PH5A 1SPXA 2PA3A 3IJPA 1ZJYA 5T6BA 1E92A 4MKZA 3KYBA 4O63O 5L9AA 4JK3A 3V8BA 3U49A 3EY4A 2JAPA 3KLPX 3JQGA 4WLOA 4HBGA 3NT5A 4QECA 4W9NA 4CR7A 3TF5A 4YYZA 2IZZA 5EERA 5JFOA 4BNIA 4GH5A 1P1FA 1FK8A 3I1JA 1RYEA 2D59A 1LQTA 4HUJA 4CMIA 4DC1A 3UW3A 1DXYA 2Q1TA 2WD7A 3LYLA 4BO9A 4I08A 1EFLA 4D46A 3F4LA 3AY3A 4IDEA 3JQAA 3ZWOA 2I9PA 4W7HA 5JE8A 3QLJA 3SX2A 2CDBA 3TZQA 3WSVA 2ZTLA 4CQMD 1B16A 1E7QA 4YCAA 2ZYGA 5FI3A 3CE6A 1I2ZA 4Z0TA 3GEDA 1DIRA 1O89A 2JAHA 2EERA 4CV2A 3TWOA 3OJLA 3L77A 1YB5A 4RVFA 3IKVA 2Q2QA 4ZN6A 4I9NA 1EQUA 4IXWA 2I5PO 1XR3A 2W2LD 2Y1EA 3PFFA 4PFJA 1YOVA 4B3JA 5ENVA 1P74A 4CQLB 4XKJA 5HWSA 2V6FA 4DWVA 5JNLA 3OJFA 1A72A 1IPEA 3SLGA 4KTVE 5DOZA 4GX2A 2R6JA 3ZNQA 4YT4A 3AUTA 4MP6A 3BZUA 3DHEA 3RC9A 1M76A 5IXYA 3I52A 3RUCA 4AJ1A 4E5PA 1DSSG 1E7RA 1C14A 3A9WA 4BS9A 2AE1A 5HA5A 4XIJA 4Z9YA 4EBFA 1LLQA 2OXIA 4BO8A 3ZW9A 4BO6A 1M66A 1PL6A 3BYZA 1A27A 1JDJA 3NJ8A 3PWKA 1B8UA 3DZIA 3U4DA 3VH1A 5KIAA 1HDYA 2WYWA 4TRRA 4DIFA 1VE9A 4ZHSA 4FFMA 1YBAA 1HYGA 5CDYA 2EXXA 4XQCA 5T8KC 1C0KA 5FF9A 1LI4A 1EK5A 2HMWA 5T64A 4JJGA 4AJLA 1N1GA 2QRLA 3LSYA 3R3JA 4AVYA 4CLHA 1QR6A 1G1AA 3SJUA 3TFQA 2BH9A 1U3TA 3F5QA 5EL0A 3K6JA 4PCVA 5L7YA 3GUCA 4UUPA 3Q2IA 5KTKA 1MG5A 1OMOA 1PJCA 2ILTA 2Z1MA 5THKA 4LRTB 3AI1A 2JD1A 1GYQA 3H6KA 3CZRA 4XYGA 2CDAA 4L4SA 2AHRA 2JFHA 3ZI0A 2PK3A 2V6BA 2VWHA 3L4BA 2C7GA 3ONFA 2FPIA 1WMAA 3Q6IA 1W73A 3WLEA 1LLCA 2D3TA 5KVVA 1H6BA 3ENNA 1T2AA 4M8SA 2DTXA 1HE3A 1TXGA 4DA9A 1U5AA 1IULA 3UGKA 1NVTA 3AUUA 4CQMA 4E6PA 1R6DA 3ST7A 2ZB8A 1LDYA 1J49A 1HF3A 4DL9A 4MVJH 2I3AA 1PJ2A 4IIVA 4IJUA 5BNIA 3DONA 5L40A 4RV9A 2VUTA 2GR9A 3GDFA 4BNUA 3GFGA 4BNYA 2NVWA 4S1VA 3U9LA 3GR6A 1ZK2A 3F47A 2DFDA 4HFRA 3BTUA 4NU5A 4CM8A 3O9ZA 4XQGA 2X86A 2J8ZA 3UCXA 5CEJA 2W2LA 1TLTA 2HCTA 4P4NA 4U0JA 4J6FA 1YQGA 3N58A 2VTEA 1MX3A 3ASUA 2BFAA 4CM9D 1B15A 3DFUA 3RJ5A 1E3WA 1U2DA 2AW5A 3I6QA 4KP7A 1YKFA 1NTOA 4MP8A 3EUWA 5HS4A 4WCFC 1DC4A 3LU1A 2O3TA 4P22A 4E2ZA 3PFWO 1IPFA 4RDHA 5TGDA 2CZCA 3WWYA 5B4VA 1PGJA 4LSMA 2O3UA 3LC2O 3ETEA 3INTA 4OKIA 2FHSA 4BNNA 2J5QA 2PZKA 4YWJA 3VKUA 5G4KB 3I9MA 3DMYA 5DCWA 4E5YA 1FDTA 4YBZA 3T7CA 4FOSA 1LSJA 1UP6A 4J43A 3OJEA 2D8AA 2VZ8A 1GEGA 3IDSA 1KVSA 3DO5A 3QIVA 2NU6A 1T4BA 3K30A 4WLUA 3RFVA 3V2GA 4NK5A 3QV1A 2PR2A 3VH2A 4BKQA 4Z3KA 3PIIA 1E3LA 3Q9UA 2ZCVA 3KOUA 1I10A 1G0OA 3NX4A 4PVDA 5TRTA 3ROKA 4CM7A 4WNIA 2NACA 2JJYA 4Z3DA 1T2CA 3K31A 1W4ZA 4P4GA 3EZLA 9LDTA 3VTFA 3F5SA 3PJEA 1E7YA 5B4TA 2A92A 5CPFA 3IUSA 3UCFA 1F8FA 5DF1A 3ZDFA 2VQ3A 1RWBA 4ILKA 5TT0A 2EG9A 4OKNA 1P45A 1K3TA 1GZ6A 3HZZA 4R3WA 1EUDA 1BDBA 1CYDA 1E1KA 3WYCA 2YDXA 1E7WA 1DIBA 4I9UA 4BV9A 4ZRNA 1BHSA 1KVQA 4MKRA 2XF8A 4L9RA 4Q3CA 5EPOA 2Y0CA 4C4OA 4YVFA 4CV1A 1ISMA 1QG6A 1YQXA 2V65A 1ID1A 2X5JO 3QVXA 1R4MB 2QHXA 1JWAB 4E2XA 1PZEA 3A14A 3NAQA 2C82A 1BXKA 3INRA 4ZD6A 4EUHA 4P4LA 1XGKA 4M1QA 2C2YA 2GN8A 2JD2A 1GQ2A 2C2XA 1LDBA 3DTTA 3KLMX 4BUCA 1PWXA 5CG2A 2WTBA 3EYWA 4OOEA 3PDUA 3VKVA 1PJ4A 3KXDA 1E0DA 5T57A 4Y6SA 4R16A 1E6UA 4NFYA 5JXWA 3D5TA 4RCVA 5JSFA 4BKOA 3E82A 5A5EA 2VUUA 1ZXBA 4N5LA 2PGLA 4BGIA 1LEHA 4CM9A 2P5UA 4RF2A 4DQVA 2YV1A 3NJ4A 1Q7GA 4HP8A 4OXYA 1ZIDA 4QO7A 4QFDA 3RWBA 3OQ6A 3ENKA 1EDZA 3KSUA 1U4OA 1SAYA 3VVCA 2EJWA 1LNQA 4BB6A 2X0NA 1ZFNA 1LRKA 3TOXA 4A2CA 3GVPA 1H5QA 3CUKA 3RAJA 1BW9B 3DOCA 1IE3A 2J3HA 4TSKA 3ETDA 2IEBA 4QTZA 4RORA 3H9UA 4NBWA 2EGGA 3QVTA 3I23A 4FQ8A 1V3VA 4Q39A 4CLDA 1I3MA 3L6OO 4J2HA 3CXRA 4RF3A 3JQ9A 4I1IA 3JD4A 4EUFA 5CFZA 4RQTA 3U09A 2VRBA 5DP1A 3RD5A 4LGVA 3F46A 4G81A 2HK8A 2W2KB 5KNLA 4BGVA 3I9OA 3FR8A 1Z73A 3DOOA 4CQLA 1ZVMA 3GDOA 4U0KA 3QJ5A 1VKOA 4N5MA 4KQXA 1E1NA 2D5AA 3UICA 3ZWPA 5J9GA 3JQGB 3C7CB 2P9CA 1P1KA 2A9FA 2OBYA 3NKLA 1EZ4A 4AJJA 3UHAA 4B79A 4RF4A 3DOJA 4IZIA 3QVSA 1GUZA 5F1PA 3M2PA 4L4RA 3H5RA 4WJZA 1VL6A 3BXXA 4NR0A 5TT1A 1NBOA 5IJZA 4N5NA 2C7VA 1NX6A 2WD7B 4FFRA 4J0FA 5CEFA 3GVIA 3LDHA 3L4SO 2EP5A 3TPCA 2VT2A 2YFQA 4E5MA 2ZJ1A 2WD8A 5CG1A 4FFOA 4OMUA 1U4SA 4BO2A 3FBGA 4GX0A 1DC3A 1BTOA 1C1DA 4ZQFA 3WTCA 3PLRA 1WXDA 3CZMA 4NK4A 5L4LA 3K73O 5G0SA 3LC1O 4IUYA 2YZ7A 3DAPA 5GMOA 2FSSA 3QVWA 2VYNA 1QV7A 1SMKA 2FN7A 4M89A 4LRSB 1I8TA 1DFGA 4RPLA 3OMLA 2DBVO 2HMVA 3RUAA 3LF1A 3NTRA 2E48A 5KKAA 5A1TA 1E77A 2WE8A 3OETA 2WMDA 1O95A 4B7XA 4CMKA 3BMQB 4IGFA 3TOZA 1Y5RA 2DPGA 1VJ0A 2B5VA 3AFMA 3PGXA 1NASA 3LT0A 4JJIA 4EEXA 2AG8A 2RH4A 1TI7A 3R6DA 4TZTA 5A9TA 2NM0A 5J23A 4KUGA 2TMDA 2CFCA 3SBOA 3U3XA 4UAGA 1B3BA 4IXTA 3S1LA 1TT7A 3WGQA 2X9NA 1O6ZA 4JX8A 4YA6A 4O6VA 4GSKA 1E7SA 2GYYA 1LLDA 5B1YA 3IAHA 4F46A 1WWKA 3GPIA 2UDPA 1ZEJA 4PGFA 5GZ1A 1N1EA 2Z5LA 1D3AA 4BNVA 4Y6PA 3VHRA 4BOYA 1KETA 3PHLA 3FN4A 5CEEA 4UVHA 4DYDA 5A03A 1R0LA 4RPGA 4BO7A 4K26A 3F6YA 1LSSA 3C1TA 5COAA 3ZU4A 4IINA 5JYFA 2EIHA 1NQOA 1ZK3A 4AG3A 4ND5A 3AK4A 3WMXA 4YT2A 1ZCJA 4PG7A 3RKRA 4CJXA 3DXFA 1GUFA 2X6TA 3FTPA 1CERA 1YL7A 3JD1A 3WGHA 1HTBA 1Y8QA 2WYVA 5B12A 4D42A 1H0KA 3B1KA 4OM8A 3KZVA 3V1UA 4O1MA 1D1SA 1UH5A 3QWBA 1XQ6A 3ZWXA 1MV8A 2C29D 1ZZEA 5K6AC 4UULA 1QYVA 1LBEA 3IC5A 3D3EA 3H3JA 1ENOA 5F1KA 1CRWG 2WEKA 1MGOA 3BTVA 4RVUA 2Q4BA 1PQWA 1VSVA 1VKNA 3IKTA 3VDQA 5C37A 2IXBA 3EZYA 4O59O 4GMFA 4XJTA 3O8QA 4ONEA 3W4KA 4BQPA 1V6AA 2X7HA 3JQDA 2VCYA 4H15A 3ZU3A 4BKRA 1X0VA 2UAGA 1AXGA 3D1LA 4CQMB 4KZPA 1JW9B 2JCVA 3M2TA 4NDNE 4IDGA 2NLOA 2D0IA 4XGKA 4BNKA 1HWYA 5T8KA 1KOLA 1ISHA 3HDYA 2PZJA 5JY6A 2YYYA 2NVUB 3V1TC 3VZQA 3ZHYA 5JYDA 3T7EA 1SEVA 4ND3A 5L7WA 4MVJG 1F12A 5DCYA 1DLIA 5IZCC 4NFHA 4ND1A 2HQ1A 2B5WA 1ADFA 4FGWA 3WGIA 4YAEA 5C7IO 2H9IA 3HWRA 4CM3A 5ICMA 1E3WB 1ZMOA 3ASVA 1P0FA 4R9SA 4IMPA 4TRMA 3I9NA 4ZVVA 1PJLA 2BMAA 1LDGA 4J1TA 4PIVA 5IDQA 5G4LA 3TDKA 4IQ0A 3LT4A 1M6HA 3DC2A 4KWIA 3QQPA 5FEUA 1LU9A 3VPSA 1V3TA 3P7MA 4R9RA 5DBFA 4LVCA 4E5NA 1P77A 1J5PA 1D7OA 3JD3A 4YACA 1WLYA 3H5AA 5AXAA 4OYRA 2NV6A 1E5QA 4TKLA 1UXHA 4ZGWA 2HJSA 2ZTVA 2RHRA 4BNWA 4LMRA 4DMMA 4OQYA 4OGWA 5DT9A 5H83A 1VI2A 1YXMA 4D44A 3VC7A 1R4MA 1CJCA 1PS9A 2OBNA 3Q3CA 2BHLA 1PGOA 1HZZA 5DOVA 1DPGA 1V8BA 3C85A 1Z74A 3DZKA 3CPSA 2O3RA 3WLFA 2HMSA 4ZQHA 3CEAA 4D79A 4TVBA 3EMKA 1I3KA 1PL8A 5F5NA 3WSWA 3PHJA 1S6YA 2YV3A 1NWHA 2BF7A 1T2EA 4L76A 1DC5A 2B4QA 4FSHA 2YFHA 1H6CA 2GERA 5U4QA 3R3SA 2A35A 2A94A 3MJCA 4A7PA 4GWKA 5KJCA 4FDAA 4AJKA 4CMAA 5EINA 1T1SA 1N7HA 2QZZA 1TEHA 3HFGA 4KUHA 1VSUA 5BT9A 1IHYA 2P2SA 3DMTC 4QX6A 1GPJA 4A10A 1A4IA 2JL1A 4CM1A 3JQBC 5JAIA 2Q4EA 1DHRA 3MOIA 4B4OA 3H2ZA 4K9DA 1SNYA 4TRJA 1PGPA 3VDRA 3WQRA 1MC4A 4J16A 2CF5A 4HY3A 4HNHA 1BW9A 4QT0A 3V2HA 3UUWA 3K2EA 4TROA 4UEOA 4DPMA 2VHVA 3HNPA 1VL0A 1H9BA 3ZWBA 3IQDB 4HWKA 3B1JA 1ADGA 4NU6A 2WYUA 2ZQZA 3RBVA 3JYLA 5L95A 1K89A 1E3JA 1HSOA 4ALMA 1JTVA 4BNHA 5JDIC 5L4SA 3ULKA 4TWRA 4GKVA 1Z45A 4FC6A 4X54A 4YRDA 3H4VA 2W2KA 5B4UA 4CUZA 4UVIA 1PSDA 4OL9A 2FSVA 3ZNOA 4L74A 3JYPA 4HFMA 1ISGA 2CUKA 1LJ8A 2VHYA 3LT2A 1WMBA 2W8ZA 3K5PA 4WLFA 3E9NA 2O2SA 2Q2VA 1GPDG 3DZHA 3A06A 4GPD1 4AJIA 1I3NA 1Y81A 2CMDA 1UDAA 1PS0A 2EF1A 1BXGA 1CWUA 2DUWA 4JROA 1GL3A 2X22A 2PD3A 3RC7A 2F00A 3D7LA 3WIEA 4NQZA 3DFZA 3TL3A 1ZSYA 1R12A 3H3FA 5CAEA 3AY6A 2I65A 4IDBA 5DBIA 3AWDA 3RC2A 2EKQA 3ZWWA 1U3UA 4BVAA 3GK3A 2BI7A 4BL5A 2FR0A 1ISFA 2NWQA 3PIDA 4II2A 1PEDA 4H16A 4K1LA 3RKUA 1JA9A 4D41A 1SO8A 4W7IA 1X0XA 1IZ0A 1FF9A 2GD1O 4J4HA 3AW9A 1F06A 4DPLA 1KC3A 1NAHA 4GL4A 2VWPA 4FFLA 1YBVA 5BQFA 2CY0A 1KC1A 1ADCA 1XU7A 2O7QA 1Z6ZA 3ONEA 1YJQA 1EVYA 1XELA 3D4PA 1NHWA 1NVGA 2GASA 1ZXLA 1NPTO 2C5EA 3BA1A 2J5KA 4DRYA 3ABIA 1O94A 3P19A 5I9MA 4J90A 3W8EA 1SZJG 1FDSA 1P3DA 3ANMA 2CVOA 2IZ0A 2Q3EA 2HMTA 4Z0HO 3QWAA 1ZH8A 4PZEA 4IS3A 4PZDA 3GG2A 5ENDA 3PVZA 3BMQA 4OO3A 1NYTA 4RVSA 3FNHA 3G3EA 4JJFA 2VZ0A 1ZNQO 3FRJA 1YQDA 4MVJP 4GBJA 1PIWA 2GLXA 4J9UE 2QQ5A 1XWFA 1ULSA 4DREA 4PLWA 1M2WA 4FJ2A 1C3VA 2PZLA 1NFQA 1HE5A 1XQ1A 2V6GA 1HE2A 3IP3A 1P44A
chains in the Genus database with same CATH superfamily
3LUCA 3NWOA 1VIMA 1UBHS 2R5NA 1X13A 5DV9A 4MIKA 1PZHA 4RU1A 5SZJA 5KTOA 1U2QA 5DTIA 1TE2A 2HMUA 4AK1A 3PR3A 2FEXA 3KRTA 3RVRA 4DLWA 4E30A 4EYSA 4ZRMA 3INGA 5JO0A 5LZ7A 4UBKA 3SJBA 3JQ8A 3WNVA 4DUYB 1EFHA 3BMCA 1G6KA 1NF2A 4KXWA 2FX5A 2XE8A 1QHYA 2HWYA 4DOMA 1YD7A 1ZWLA 2XRFA 2QMEA 4FKZA 4ZO7A 5AVSA 3E5HA 2OEPA 3UN1A 5EWLB 4UUOA 3PYMA 2AT1A 1GUDA 3F74A 3SIXA 1WZEA 4B35A 2DKNA 1XRMA 3BEOA 3WK6A 3G23A 2IYYA 1XZHA 2I6SA 3KL2A 5SZHB 2F8MA 4AS1A 3DXXA 2ATCA 1MIHA 1B6GA 3GBVA 3E3NA 1U0SY 3V6LA 2ZRHA 3LLCA 2M1ZA 3VO9A 2Z5VA 4LV6A 2FCAA 3INNA 1WAMA 1KEEB 4B3HA 4X60A 1O97C 3SC6A 3WLNA 4NHOA 5LP6B 5IM4A 1UEXC 5J5CA 3EGWA 1PGNA 1RTTA 1KY3A 1QWSA 1UPTA 4CNQA 3HSSA 2P4HX 3EPLA 2F8TA 3CUVA 2H54A 3VHXA 1W76A 1DAOA 2Z2YA 5FPYA 4AIRA 3W6OA 3LY9A 4KMRA 1DP4A 2H16A 4CCWA 4FDMA 1N5KA 1OROA 4RPKA 4K9KA 1DBRA 5FYQA 5K2OA 4BQSA 1W5TA 1XLTA 3IUPA 2O1XA 4C7KA 1G6HA 4KN8A 5CMLA 4CLOA 4NLLA 2HK9A 3ZWVA 4PLZA 621PA 1KOGA 5AKHA 3OLQA 1EFDN 4RA6B 1Y8CA 5KDOA 3KOYA 4US0R 4MQEA 4ZI7F 3BWCA 5K99A 2V7GA 2I2DA 3GJTA 1PVOA 1YK0A 3CEHA 4LRXA 1BWPA 1GV1A 4GE3A 5C8XA 1KORA 2CXUA 3SKVA 4GEGA 2WUVA 4FDTA 1XMQB 1F2DA 4E46A 2GAFA 1LK7A 2ZRCA 3KSRA 5LMZA 5TPZA 4QFCA 1M2EA 1V6CA 1IN4A 4ZVTA 4Z4HA 1O0CA 2JIZD 2JGNA 5JSQA 4EZBA 1Q0HA 1T3HA 5KSZA 1M2OB 3DHYA 4DCCA 1L5HB 3VPAA 2XX3A 5AHWA 4JBHA 2HQOA 2VO1A 4WZZA 4BAGA 3M6XA 3NTQA 1QR2A 1O58A 4AZ3B 4BBZA 4WFKA 1FP1D 4AJNA 3IQIX 2INGX 3I6BA 5AJZA 4N40A 4I1SA 2ADMA 3P8ZA 3GH1A 2J0UB 3IULA 4UBIA 3W2TA 2GPTA 3PX3A 4BNGA 1MT0A 4M60A 1O3YA 2WFAA 3RYHA 1KVRA 3AERA 4FMCB 2JFGA 3CE9A 3K0HA 4F72A 2J08A 5TARA 1Q0UA 5NLLA 2G36A 3KQWA 4JP2A 4RHXA 4UDYX 4MW6A 2QIOA 2CVFA 3AHCA 3IAS6 3LDUA 5TQ2B 4AG6A 3KCQA 4GT1A 4GOMD 3S27A 4KO1S 3HJGA 2C4VA 2OCXA 1X1TA 3LQ2A 4HRYA 4N0EA 2D0DA 3R8XA 1MGPA 1V5WA 3WA7A 3JZIA 1PX0A 3DKPA 3LH5A 1UDRA 1P5RA 4FOPA 3ZCPA 4B4UA 3ZCXA 4FEYA 3VHQA 1FJGB 1T2VA 2VDQB 1G9XA 1OYVA 1V11A 1X9IA 2DJ5A 3FFTA 3GIDA 1E2HA 2VHUA 4GVXA 4KFTA 2O7NA 4MGKR 3PFNA 1SKAA 3ELBA 1VLVA 1L3BA 1Y9ZA 1I4WA 4NXNB 2PEYA 3OOEA 4YCJA 1EBUA 3ZV5A 4JVLA 5A7FA 3ZK8A 2A5YB 3WRXA 4DADA 5K3SA 4CF6A 1ZK4A 3EP6B 3IT1A 3WO0A 1Z4LA 2EOAA 4N8DA 3QWFA 3PYXA 2FY8A 2IHJA 5G3YA 4M1YA 2PUJA 4UHDA 4IFTA 2ZI6A 2V3VA 5AVXA 3ZWMA 4XR4A 2WKRA 2SCUB 1JFFA 4K0RA 2PWPA 3FGPA 3HYLA 3MT7A 3TLGA 1I7DA 1OF1A 1R3DA 1CZKA 1U7HA 1V1JA 5K0ZA 2CE2X 1QHHA 2VH1A 5KQLA 3ONVA 3DL0A 1XMXA 2O6LA 2WB2A 4DLAA 1TVEA 5KVSA 1MB2A 1V2HE 3OUUA 2LDBA 1QTIA 5LB4A 1TQHA 1JPVA 1KP2A 2OR3A 1QFYA 4YASA 3NFYA 4E0BA 2EF0A 1IY8A 1GPNA 3B6JA 3WLJA 6ABPA 2BZSA 1YR8A 3PHCA 1WTAA 2E4WA 1GKLA 3TW3A 3OOSA 3OT1B 1JG7A 1ESZA 2H52A 2OV6A 2QVYX 3EC1A 4HPWA 2O8VA 3IJRA 4KSBA 5REQB 4F2GA 2X0RA 1Q16A 3LW8A 3UA3A 1SFRA 1J8DA 2J4CA 5BXQC 3M6FA 3CLRD 1T6YA 2SICE 2DQ4A 4FLEA 1Y0BA 2C1XA 3E1GA 5F1OA 3X1MA 3RFTA 2NU7A 3OICA 1J23A 3HXTA 3ENZA 4GLOA 2G28A 1CNMA 4IGEA 1E3SA 1RHQA 9ATCA 4IY1A 1E9AA 1N2ZA 4FT2A 4WN9B 3BHJA 3SLKA 1Z15A 2ZRKA 3Q3IA 2R97A 2W93A 2G0NA 4FK8A 4K6FA 1TRKA 1BE1A 1TIBA 3OECA 3VV2A 2PWAA 2VI5A 1VECA 4G4SP 5HKLA 1CP2A 1V25A 3ZY4A 4URHA 3N87A 2JLXA 3STWA 1EZ1A 1Z5OA 3GLHB 1A2KC 1NAIA 1T3TA 3G6WA 4JNCA 4X63A 5IM5A 5IYZF 4D6XA 1XZAA 2DBZA 4GDFA 1YR2A 2ZTUA 1KXZA 3LL4A 1ABEA 1W6RA 1Y9JA 3STYA 4HMOA 1V9CA 2RARA 1U5BB 3JZMA 2V0NA 5CH8A 2NNWB 4ZAGA 3AP3A 3OF2A 1T6BY 1GQOA 3O3CA 4WCFB 4A5OA 4FSDA 3FOAA 4BTEA 1N6NA 4YRNA 3WLRA 1ZOIA 5B37A 3WQBA 1JIJA 1U0BB 1NBAA 1AUPA 4J29A 5AW2A 2B5OA 2A1TS 2P6PA 2P6NA 3FNQA 3FHOA 3NOQA 2V9CA 2DY0A 1ACJA 4JYMA 3VU9A 1ODTC 4URFA 4UM8B 4C0AC 3FLEA 3GL9A 3RUIA 1RRPA 3ZX5A 4PWZA 4JOQA 3DZ7B 2RHBA 2CJWB 2Q6TA 2YNMD 1PQUA 1FBNA 2Q50A 3O73A 1TQDA 4UEQA 2R1VA 3WFJA 3LE8A 1ZI9A 2IYAA 4EHBA 4GPIB 1CIVA 2YHBA 1B0AA 1V1RA 2A9KA 4QU8A 4YAKA 3KLNA 2X9GA 5IH7A 3HJHA 3ICVA 5CB4A 3PJDA 2PKRA 4HQFA 4NX2A 2FOIA 4TRNA 2GN2A 2QY6A 1L5QA 5BW5A 1M1YB 3P94A 1WKCA 2W70A 1DC8A 2HH9A 2P4EA 3UG6A 3ZBQA 4DQKA 5F51A 2AG6A 2C77A 4FEGA 1C9YA 4I6EA 2COEA 4LKOA 1SJ9A 3Q7RA 5JG7A 3VYVA 2RHWA 2H07A 3G2NA 4MUIA 1W48A 1X2EA 1GU7A 1P5ZB 3L1UA 3L8EA 4X20B 4JI6B 2JFBA 1I94B 3HYCA 3DMTA 3OD1A 1Z82A 3B7PA 3KS9A 2XKAA 4GLLA 1UDXA 5EQTA 2WY2D 3A6JA 3BCRA 3W34A 2FPLA 2BD0A 2D4HA 3K9BA 3U7GA 4D45A 3H4MA 2XTAA 3PXUA 5BN3A 1DDOA 2WV9A 1BDMA 3JTMA 3QF4B 2HFKA 2UZ1B 4H0FA 3JASA 4Q7KA 3RUEA 4D9KA 4EMUA 4MO2A 4DCTA 3B85A 4RVDA 3BJEA 5G0VA 4BYGA 5DLQC 4BNJA 3WGVA 1OHHD 2FE4A 2ZSDA 3IODA 1UWLA 4KFCA 2JIRA 4KHPB 2II6A 4N12A 3GZJA 5I5GA 4CKEB 4HDSA 3DDNA 2I6TA 4J7UA 3BIWA 4PHGA 3G68A 3WYGA 1DWPA 4X7RA 4CEIA 2WJPA 3N3AC 1F3OA 1SA0B 2PS3A 3EFBA 4WBXC 3U7RA 2DLDA 2AV6A 3OWOA 3AIOA 4B83A 4EG5A 3F7NA 4Y1GA 1L9KA 2PLWA 3H16A 2H00A 4RENA 1GTL1 4NCAA 4NMWA 1G38A 1B23P 5D6NA 1X19A 4RZXA 2O59A 2WHPB 2Y1DA 4RIGA 3H9QA 2APJA 2HQBA 3DWGA 3R44A 4DLLA 1CE8B 4YUYA 4O4JB 4OH7A 5JVDF 1W5FA 3D4NA 4LYYA 3WMFA 3DV2A 4YMWA 3DBHA 1D4FA 2QX9A 3HYNA 3HHEA 4XVCA 3PV0A 1B3RA 1W88A 4UKDA 1XVIA 3IXLA 1ZA1A 1TKBA 5LYJB 2ZQ5A 1PJQA 3H3XA 4GX1A 1YQWA 2O5EA 2G17A 1UOEA 4PGAA 1FLAA 2X4LA 2QN2A 2YJNA 1GXSB 4UMEA 2YCBA 1UJMA 2B7BA 4JYZA 3BGWA 3DE6X 4MDEA 1I3CA 4MNTA 1JG4A 5C4MA 3WWEA 1RIIA 2YKGA 3U6BA 3N8HA 1YAHA 1O8CA 5A6SB 3RU9A 4PLVA 2MMGA 4G5GA 1BVHA 2ZXEA 3MG9A 4UTOA 2NSHA 1E3QA 4NAUA 2JGEA 5LJIA 3K35A 5CDUA 4E5KA 2PH7A 4HZIA 4U6QA 4ISBA 1NQAO 1KK1A 3LX8A 3BK1A 1HRDA 2RGDA 2VDJA 3JD2A 4FMBB 4AZWA 1U65A 2E7ZA 2QTCA 4L16A 4YRBA 2OFWA 3QPCA 1T6XA 4EO4A 3MYYA 3R4CA 1SXJE 5AVRA 3JQ8B 3BMCB 3WS7A 1QAOA 4IEFB 1QSGA 3IMKA 3V8EA 1DJOA 2FRDA 4F3RA 2P2LA 5JATA 3C24A 2I2BA 4IMRA 1FNMA 4UHKA 5TGTA 4N48A 4IPTA 2ZE5A 5LXTF 1MHTA 2WOOA 4PLCA 2PD4A 2WKQA 5BSGA 1JQAA 5JI2E 4I2NA 4L02A 3FXAA 3X1KA 5LOVA 3WYDA 4JDPA 4X41A 3DAGA 4PYQA 3IE2A 2IHKA 4KQ1A 4RVHA 2J9GA 3ICCA 2QGNA 2GZSA 3FSEA 3GMIA 5B1IA 3TJZA 4WBSA 1MW9X 2XV1A 4E6EA 2X4GA 2CMKA 3N6RA 1LCIA 1IH8A 5FH9A 5JRZA 4DLUA 3JSXA 4R1UA 2J67A 3B2QA 3N8DA 3UAXA 4HAYA 2M9MA 4ND8A 4G8BA 5FBQB 2X3FA 2O3JA 1KY4A 2OXRA 1F6WA 1SR8A 3S2EA 4FFNA 5JD3A 4HQ6A 4UBJA 2V97A 1TOAA 3ECAA 4WNCA 3HVHA 5EN4A 3VHXB 5K4GA 2R4UA 4HF7A 4TLDA 3RW9A 1AHHA 1U3VA 1D5WA 3JVUA 2IGTA 1EP3B 4MOWA 4E32A 4D25A 3FDIA 3K16A 4UUQA 3GD7A 4BV2A 4BO0A 3C5WP 5CGQB 1IJEA 3OLWA 1C1XA 1Z07A 4COOA 4CLOB 1XZNA 2XOXA 2XYQA 3QOFA 2MDTA 5D3ZA 1F8GA 3FPCA 3ILVA 1K92A 5KHLB 4XQ0A 4LS3A 3VC1A 1G291 4MQEB 3B8EA 1S2MA 1PZFA 4Q3OA 1Z34A 5J63A 1YUNA 4HB4A 1US8A 4RNDB 1KPGA 2WZBA 2IOFK 3SX4A 1KBOA 1CNFA 4WA8A 2Y68A 2D1YA 2Z2ZA 2M6SA 4A27A 4ZHQB 3H9GA 3N0WA 2QROA 3GQBA 5T67A 3SD7A 1J5XA 4XIFA 4UTVA 1U7TA 3CY6A 2BMEA 2FX2A 1YIDA 2KMLA 3ITEA 3OT4A 4HR7A 4N7RA 4PFKA 4V0NA 4EKNB 3V8PA 2IZ5A 5LR6A 3K6SA 3CX3A 4ERXA 1SG9A 2XXJA 1N2SA 1SCQA 3NTLA 3MQ2A 4HAXA 3FGZA 6CHYA 2AFIA 4D4GA 1P18A 4NXMB 3B48A 4G0QA 1M34B 1J25A 4ER7A 1WQ4A 3CURA 4QHYA 3PJRA 5GGXA 3GFOA 3GUYA 3OP4A 3TZKA 5J4LA 1A50B 1P2DA 4BWFB 2Q3HA 3MJTA 3SZLA 1I32A 4MRNA 5DLYA 4OX9Y 2ZI9A 4HRAA 3T5PA 1CUCA 4RX1A 5SY4A 3LVFO 4WESA 4ND2A 1RBYA 3LK7A 4GRIA 3K2BA 1K8QA 1ODSA 4KE7A 1N6IA 4QQNA 3BOSA 1GR1A 2I8AA 3EEYA 2O2YA 3GT0A 3OX2A 5I9BA 4PTLA 1KMCA 1BEUB 5A4MS 4MULA 2J07A 2XUFA 2FB9A 4RL6A 5CJPA 1U4NA 1S2LA 1NUPA 3JQFC 4ZA2A 3PR1A 3D6FA 1NT4A 3ZXYA 2NNLD 3ABSB 4ZANA 3ESDA 5A7GA 1ONOA 4MUGA 1M5TA 2W6ID 3WB9A 3DL4A 4B80A 1EHCA 5FLKA 2ZIAA 1AZWA 5I4KA 4MV3A 3H65A 4I1RA 5FJJA 3AU8A 3W7AA 5BYAA 5F3WB 2OM6A 4ZT2A 2TYSB 3ZIAA 1E4EA 1RYFA 3WNBA 421PA 2FW1A 2HU8A 3BH0A 1V4VA 3K1TA 3LIIA 4ZVSA 1XXHE 5TSDA 2Y99A 1DO8A 1P8AA 2PAFA 3ODPA 1P2TA 2XZDA 3BTOA 4G4SO 2QUBA 4M0CA 3RRXA 3FPSA 3SXPA 2GJ4A 4BKUA 2UYHA 3M6AA 1QHFA 4J3NA 1K6MA 5HCUA 1WB6A 4Q4DA 2H59A 3A8TA 3O7WA 1IHDA 4FUQA 5IDWA 3B70A 1W4RA 5E4FA 5ER6A 3GRPA 2QPLA 4JCOA 1EBFA 3DUWA 3T1VA 4B44A 2PL9A 3IWDB 1Q7EA 1LVUA 5EMMA 5TF4A 4Y67A 5IX8A 3Q8KA 2AC2A 3EGDA 2GGSA 4C3ZA 5JC1A 3DMRA 1PR2A 3FYSA 3TLGB 3FFBA 3ZK7A 1QLJA 3UATA 3A10A 4H7DA 4F11A 2WINI 3IELA 4F9EA 2RHDA 1QE0A 3M9XA 3NASA 3KWFA 4R2MA 3G85A 4UMFA 5I5EA 3MHPA 1PTJC 4QTYA 2QRVB 1QO7A 3OIDA 1L7MA 4RHCA 3H9JA 1OR8A 1HDEA 4ZOAA 3WGNA 1TO1E 1GM5A 2QYOA 3WOHA 2COKA 2ZBQA 5HK9A 5JEEA 3ZUPA 1HUQA 3RRFA 3JYNA 5T7BA 2F1KA 2A2ZA 3DW3X 4TWZA 1V9LA 2ZS9A 3MCAA 3F90A 1GFSA 4MW5A 3KAKA 5ESXA 3R7SA 1F17A 5KAPA 1OWNA 1E2LA 2R84A 1UC9A 3IPRA 1Q2UA 4YJ3F 1LPAB 2NU7B 3D6VA 5K1ZA 4DNOA 2N9UA 3DL7A 4KO3S 3T7IA 1H8EA 3KR9A 1JX6A 1XT6A 2D13A 4MQFB 1JMVA 2X3YA 2EFHB 4CL0A 1MNQA 2YJ3A 1BJRE 3L7NA 4IR7A 5P8WA 1IN1A 1ARZA 1F8YA 1MFZA 1HURA 3A6FA 4KX5A 5E3IA 5KDLA 3UWMA 1XJ5A 2K7FA 1M1ZA 4B7AA 4IUDS 4L2IA 3PFKA 2GJ9A 1NUQA 3GLIB 3D3WB 5CLQA 4ZAWA 3T5TA 5I7FA 2D7CA 3P20A 4D3FA 1NV9A 2V6IA 1W9MA 4W5NA 3K0EA 3AF0A 5TJ9A 3QFCA 2ZRMA 3N8GA 2MYPA 3OC6A 3P2OA 5HYVA 4F5DA 2YS7A 1ZCZA 4XDGA 1FY2A 1XLUA 2E4XA 2J7PA 3GQVA 3H2HA 4MPRA 1E7MA 3VV3A 4DLBA 2C5FA 2FG5A 2P9ZA 3GLUA 4BCCA 3V1YA 3LCVB 3NV9A 4OP2A 4R9NA 5J58A 3FPFA 4LJRA 1QK5A 5DBHX 4UNPA 3PHBE 3C3KA 4LOIA 5JSZA 1FS5A 3VU9B 3MD9A 4DCPA 2G9VA 5DGIA 3K4HA 2EX1A 2QU7A 4HD8A 4KRGA 1TCVA 2A6PA 2X0IA 1E9CA 2V4UA 3A9SA 5FFNA 1V9SA 1YS4A 2RGGA 2E5WA 5A9SA 2YWEA 1KJ8A 4C3UA 2LVBA 3KZ1E 1XDWA 4W99A 1CETA 2IEIA 3T61A 4C04A 4CUKA 2R1VB 2PRKA 2B1RA 2WIAA 4J7AA 4LTMA 1N6RA 5CA0A 1XIVA 4UDNA 4YREA 1V1RB 2A9JA 1KQFA 1EX1A 3KELA 5ARBA 5DB4A 4KH1A 4PPNA 3T8YA 1CQJA 2HCFA 2X19A 3DDWA 4NOJA 1S3SA 2XNHA 3GEMA 4QPNA 2HU7A 3RRZA 3VAZA 1G5PA 1P0CA 4ZOEA 4RY2A 1CR2A 1A8PA 3MUEA 3OZSA 2RCYA 4JLOA 2CVZA 4L9SA 4A0GA 3IPYA 5GZ3A 4K28A 2PKCA 5CLGA 4LYJA 3BPSA 1THGA 1Y89A 2ARKA 2DTEA 4TXLA 3VJMA 4KPUA 4JI8B 3LC7O 4UBNA 1IC6A 3PE6A 4D5GA 1TPZA 2A33A 4WA7A 1TTTA 4NCNA 4NBTA 2QT0A 3ROMA 4F5ZA 1C9EA 4J0KA 2IY7A 4WJKB 2H1SA 2HDOA 5C2JB 2VA9A 2ZTHA 4MJLA 1A8HA 1RCTE 2WHQA 3CCFA 2JI6A 5SZKB 2YOHA 4F60A 1YDHA 2Q62A 2FFJA 1GYRA 4E3ZA 5EIEA 4PYKA 4M37A 5ULLA 3KD3A 2B6HA 1XCOA 2GEBA 1Y1PA 5EE3A 3SYNA 2XEXA 3KUCA 1R8QA 3L1HA 4JS0A 1WXFA 3RT7A 5A71A 4YR7A 2XNDD 1TUGA 4YI3A 1M8FA 2GHIA 4UQLA 4V24A 4HDSB 3IILA 1M2NA 2CLFB 2ZAMA 3K0FB 1DELA 3EVAA 3GN2A 4X95A 4DV6B 3EN0A 3BGOS 5BW6B 3ZVKA 3IVMA 4B6PA 3PZBA 1PW5A 1RP7A 4I1OA 2OE2A 1BX3A 1R64A 3E7FA 3RIHA 3DEFA 3JQCA 4XWTA 3QU7A 4BO3A 2FFHA 4RTRA 2XUPA 1YUMA 3IIMA 1EE1A 4GVPA 4NV1A 4RMHA 3P2JA 3V4SA 3DBHB 3MLBA 4J0QA 5BN1A 2XODA 4PNZA 3I62A 2O4CA 4GOKA 4Q3DA 2P7HA 1M2JA 4EHNA 1L2TA 4B84A 1XDBA 4DQVA 5EMLA 4R0MA 1JKXA 3H2SA 3MPUA 1VKZA 2P67A 1Y42X 3H8JA 3TUIC 1FZTA 3T0GA 2QVGA 3A04A 4C29A 4CCAA 1X92A 1PHRA 2W2NA 3FB4A 5BR4A 3L49A 2H31A 2O2ZA 4RJLA 1A4XA 1XZJA 3KPUA 3P9CA 4GWGA 1JI0A 4GECA 1VDMA 3EOAI 5JAMA 1M6EX 5FRDA 1WOMA 5FOWA 2QM3A 3HUTA 4IDQA 3BH6A 3PXAA 4UFNA 5CD9A 2PX8A 1YF3A 4Q05A 3KEOA 5B53A 8LDHA 1CXZA 1CUGA 1T10A 3WXBA 1RQPA 3VNRA 1IB0A 1C7JA 1SVUA 5DM4A 1G2IA 3N70A 3NBXX 1BMDA 4MIOA 1P4HA 2NT3A 1D5CA 3FW1A 4PTZA 3U9TA 1Z25A 2Y1FA 3ZXIA 3D9QX 1Q6YA 4I36A 4NBSA 2Q6VA 3ZDDA 1JKIA 2YC4C 4QIHA 2LKCA 4ZI5A 1Z8FA 2XTNA 3KKPA 1DRUA 4P2BA 4YRKA 2P6UA 4INOA 5EE0A 4W5RA 3KQUA 2B0CA 1U7UA 4YN3A 4KH0A 4XFDA 1UEJA 3C3WA 4RKRA 5FHRA 4AMBA 5LQAA 1JIIA 2R86A 3PGJA 1QF9A 3I72A 3RVJA 3NBAA 3ITDA 4X66B 3PPYA 2IWHA 5LJLA 2V0CA 2Q9BA 3NIWA 2Q4OA 4LDPA 4GMGA 4O4IA 3DPIA 1QYWA 3ITNA 4FGSA 1QO9A 1K8XB 1VXOA 1NFFA 4GRAA 1CB7A 1VJGA 4FZVA 5EHGA 5FFMA 5PGMA 4MV5A 1HT1E 4R8SA 1BGWA 4ND8B 2YDYA 3MJDA 1APBA 3NDBB 4K6KA 4OEHA 3SU8A 2XRYA 4EITA 4ZYLA 3G49A 1Z5PA 3OO0A 1EK1A 4XRGA 1YO6A 4HXYA 2MSDB 2XUIA 4R05A 3TLAA 3AG5A 2RBKA 3HE3A 2X1LA 3OIVA 3Q9SA 4RIHA 1REQA 2NO9A 2VRCD 3EZGA 1I80A 4TYNA 1Y3CE 3MOGA 5TJHA 1KI1A 3AVVA 4KYVA 1E6CA 1U6IA 4RTSA 3E3OA 2DT5A 1C1XB 4NRDA 1I14A 5HF5A 4CKBB 4DEVA 5JCJD 3CINA 1I6WA 2GPYA 4IWYA 1YRLA 2ZRLA 1MXHA 1NBMD 2ZJ7A 4PSDA 5GJWC 1GTMA 1JQ5A 2NQ8A 4BN5A 4MWZA 4LZWA 1YS7A 3PTAA 3QEAZ 4QBTA 2D54A 3IV6A 3T12A 1JRLA 1QPGA 1US8B 2XT0A 2P5TB 3REOA 2HRZA 4A15A 3G9QA 4I55A 2QYTA 3TUJC 2IS2A 1JSCA 3W05A 4MAFA 3W5IA 1DEXA 3GEEA 5E4TA 3T15A 4U02A 2H92A 2R66A 4AF6A 4A5SA 2HO5A 3SVTA 2MINA 1CR4A 1DEOA 3KJHA 3M8KA 4OHRA 3GQBB 5GONA 5D5PA 4CG1A 4V0MA 1UXIA 2OZKA 2OWDA 3L5KA 1CX9B 4K5QA 4PEVA 1GUYA 1HPLA 1LBIA 2ZI7A 4IDHA 1ORIA 5BNZA 1JJIA 2D5IA 4DCJA 1H22A 4HKTA 1KJNA 2QRQA 2AFIB 1QTNA 3T6KA 2OCBA 1FFGA 2O3SA 5KNDA 1JAYA 2R8ZA 3LS2A 3USES 3PGMA 4JP1A 2JIBA 4M0PA 2ZVDA 3T7JA 3GV0A 3UAOA 3WIVA 1JWBB 1RSZA 2MTBA 1SBQA 3AEQA 1QKIA 2W9XA 2RGUA 4OLJA 2HFJA 2EJUA 1FSFA 4MARA 1U04A 4XSVA 1B2RA 1HLDA 1TCBA 1Q44A 2BVNA 2NQ2C 1YOBA 3OAAD 1MB9A 5EMHA 4BE4A 5B2EA 5A5FA 1NBWB 3N76A 3UC9A 2BM9A 3HB4X 1XN1A 4DRXB 1PJBA 3GPCA 3RQSA 3L6UA 1U11A 3MCTA 5DT2A 4YGXB 3I5UA 1ECCA 3QE2A 4X45A 1HRKA 2R1UA 3AUYA 4HUQA 1SQGA 1FRZA 3BGSA 3G7SA 1C0PA 3JQ7A 4QXQA 3NGXA 1SURA 1QH1A 1XCJA 3DZFA 1PQ4A 3G9ZA 3Q7QA 4UEKA 3CIFA 4D2IA 4R5MA 1ORDA 3QMWA 4F8YA 1OREA 1NNI1 5C7OO 2AOUA 1NFRA 2L18A 3FMVA 2XVAA 4WGFA 1FXUA 2PD6A 5DTRA 3W5CA 3PHIA 3CZQA 4J94A 1E4EB 5KC8A 5DMXA 2H0AA 1ZWKA 2WP0A 3FA2A 3MWYW 5I9IA 5ELXA 1N0HA 1Y8ZA 1S1MA 1K08A 1Y7PA 4RD3A 2FEAA 2GPAA 1ENZA 2BFPA 4PGGA 1E6WA 4L22A 1RKXA 4JI2B 3GMTA 3TAHA 2ODEA 3WA6A 5L6MB 2PG3A 1Q15A 1OIWA 5C8YA 4EFNA 2GDJA 1VCIA 3FHJA 1G6Q1 3MWDA 4AD8A 9LDBA 2WLSA 2DPLA 2O8BA 2EC5A 2PXXA 3MAAC 3DZDA 2O2CA 4PYLA 3QI7A 4ALJA 1QQ7A 2GPJA 4YAFA 5ILOA 2C3UA 4M1WA 4XPIA 2BHTA 3EGDB 5LD2B 2VN8A 3OD5A 3BTSA 4F9FA 5C5IA 1E5LA 1T5HX 1GARA 2HXSA 3NEAA 3ZI4A 5BVGA 2R6DA 3I6MA 3EG9B 3OIWA 3SX0A 2NMVA 3E7XA 3JQFA 3BA6A 4BE7B 5D1HA 4L6AA 4AY6A 1X8XA 4KNYA 2Z08A 1PZNA 3KR0A 3PQ5A 4HLNA 4NS1A 3EW7A 4FGJA 1RE1A 4H1UA 1U8XX 4TKZA 3S3TA 2Y3IA 3TI7A 3FNFA 1U8AA 1TUBA 4P3YA 1TD1A 3CVOA 3PT9A 3BXGA 3HUFA 4LBZA 4Q7JB 2JLQA 5B1DA 4Z9XA 4B7UA 2IEYA 2YHIB 4YMTA 1R9GA 2BH2A 5BO5A 3CLTD 1U63A 5BXYA 3W4JA 5HZMA 2VTBB 4IH4A 5E8JA 3V1KA 3NANA 1CUDA 1KZ1A 2ROQA 5ESDA 4B75A 2G1PA 3L02A 4O1HA 2HSJA 1KY5A 2EZTA 4D4KA 1SKYB 9MHTA 1HX7A 2GM5A 4RW0A 1K27A 2UZAA 2B94A 3TRIA 3EQ8A 1QX3A 2PJUA 4Q3AA 1A1SA 3TZBA 4EL5A 1QLWA 2FDXA 5GJBA 1NR1A 2IYFA 4PNPA 4EF5A 4M9XA 1C8BA 3M82A 4YRTA 5DN6A 1QYDA 2C5SA 3TL2A 1NXTA 5EKTA 1QIHA 2YHUA 2F64A 1NLUA 3D3JA 5D6OA 4HCJA 3PITA 3UUFA 1VPEA 3Q3EA 4DN6A 1KI2A 2L69A 4MTCA 2XOKA 4UD6A 1IY9A 4BP9A 1THTA 3OUTA 3J7AC 3E22B 1A9OA 2VUSA 3NGLA 4RZUA 1SVIA 4TL8A 4KPYA 4R2JA 4BV8A 3ZJXA 1JSRA 5H80A 2FMXA 2YN2A 4RCYA 4BYMA 3KQTA 5JZSA 1PTJA 4O2AF 4LOAA 1FFYA 4GPTA 2V5AA 1P73A 2G82A 4ZMBA 3AHEA 5A4FS 3OZTA 2YJGA 4S1PA 1GKIA 3X3HA 4NTZA 5TS3A 4F45A 5DM70 2JLYA 2XXAA 1QDLB 2YQ4A 1UJ5A 3A6KA 3AUXA 4E2YA 2TMGA 3E2IA 2VHXA 1NI3A 3LDGA 5L3VA 2GM9A 4XRRA 1G20E 1K4MA 2HJWA 4Q19A 4BX2A 1QUEA 4GM4A 2O0MA 1X7YB 1ZM9A 1DEAA 5A9SB 1KJIA 1J39A 1MH1A 4US1R 4CMIB 4KMMA 3C41J 1NJ1A 5JAHA 1YE8A 5IG2A 2IVFA 3DCYA 2WF6A 1QIGA 2C5BA 2FA9A 1RXYA 2HF8A 3JQAB 3L4BC 1QMGA 3WG9A 4A0HA 4OH1A 4ARBA 4TN1A 4ER0A 5CA0B 4KXYA 3H1TA 3Q8XB 4R1QA 1CQJB 3KUUA 4JUIA 4C6SA 3LQ1A 4FYJA 4P7FA 1U1EA 5EUQB 2AKAB 4LTDA 4QJ3A 3A37A 5E9JA 5B7NA 4RZQA 4NBUA 4UE3S 5TB5A 3ZU6A 1IU9A 1FP7A 1TYCA 4P92A 3FHTA 4BVJA 2PH3A 4MYHA 3QX9A 3NTOA 4Y1EA 3SJ7A 2GLUA 3W6PA 2PCLA 3M1AA 5CFMA 1UZUA 3WWZA 4BLOA 3QVVA 4IIUA 3GIWA 3MINA 5L3RA 1H85A 4B5KA 1L8XA 4M4SA 4B6FA 1Y1RA 3OY7A 3P5BA 1Q3HA 4QDXA 1FB5A 2PGXA 4JLSA 1FOEB 3G0OA 3S5UA 3WIDA 3G59A 4DJFC 4B3RB 2AR7A 4P81A 2YMQA 3OZVA 4MVWA 4FHDA 4HRVA 2I4OA 1QWOA 3TIIA 5TQ0B 1EFUA 1JUDA 2OORA 4CKZA 4B3TB 4X0EA 3V80A 5JO9A 3NATA 4W1QA 1OFGA 2H08A 4PZZA 2X13A 2QP9X 3BJRA 3REFA 1UL1X 3DZ2B 2Q22A 3DBVO 4XA8A 5JH7A 1N2EA 4LRUA 1XTBA 5DTQA 5EEHA 4D3SA 4J1QA 2ASEA 3GDGA 3G9XA 3ORHA 4WLVA 3IL2A 1YTUA 2DPMA 1E89A 3PHHA 4IIGA 4WHMA 4XYBA 3WB2A 2F9FA 1Z0UA 2O05A 3R9WA 1JPNA 2YNMA 1J70A 2B8WA 3D8NA 2XADA 3D7NA 1CHDA 3I2GA 3ZCTA 4XVRA 4GL2A 1CW2B 4UTRA 3GGOA 3BSFA 1ZEMA 2GPSA 2WAXA 5E2BA 4ZVRA 4NMXB 3MYRA 5CU7A 3ZHCA 3LP8A 5DX0A 1FTSA 3GZTB 2W6JD 3KEMA 1WEKA 4DDKA 1U0JA 3GC6A 1H6DA 2AN3A 2V7XA 4EGSA 1ATZA 4RXMA 4PQGA 3DJYA 3GVHA 1I72B 3QTLA 1F0KA 2UYOA 3FHLA 3CH4B 5EZSA 1Y5MA 2BLLA 1OI2A 3G2MA 2XCQA 4QFBA 3R7LA 3RTCA 3C4QA 3WICA 3FNRA 4DY4A 4EDHA 3PENA 2H18A 1NE2A 3AR5A 4JSTA 1MV5A 1KJYA 3T0FA 3V1MA 3B9BA 4IJWA 5IUJC 4D3XA 3U17A 2RKWA 3MJFA 4Z9FA 4OX9B 3OZRA 2JFNA 4HFNA 2OMEA 4XEHA 1J2YA 2QW0X 3C6XA 1VBKA 3EVBA 3FZEA 4LVNA 4UFOA 3VTKA 2ZR7A 4P0TA 1HMYA 2O8EA 3DNMA 4RY0A 3PGA1 4CN9A 3PX7A 2ACWA 5IDYA 3CNOA 5F3RA 3TINA 1D03A 1N4DA 3MLEA 1DCMA 2GMWA 1T3ZA 1S89A 2HWXA 1DRJA 4GLJA 3DR3A 4M0EA 5EJIA 3K0SA 1PFGA 4ERNA 5HF9A 3C98A 5D87A 4D3ZA 2ERCA 4XH9B 1BQ3A 2DFTA 3RUPA 2IIQA 3CZAA 1PJ8A 1WF6A 3SE7A 4YP1A 2BF4A 1CYEA 4ENWA 1H4VB 3T5AA 1L5SA 4P8RA 2QPTA 3LW7A 1HE4A 3BHMA 1IEWA 4G6ZA 1R6TA 1S8NA 3PS9A 1RJDA 2OYCA 2F90A 5DX8A 4RFVA 1HI9A 1MAAA 3RVPA 2XIQA 1XDGA 5M6DA 3EXG1 4OFXA 1SVOA 2PRIA 3CH7A 3V8VA 4ALKA 6AT1A 1W2WB 1IK6A 4UXIA 2F3SA 2G5PA 2IK8A 4BUZA 1KEZA 2O06A 3DHWC 3OIYA 4ZU3A 1I4TD 2Z4RA 3DH0A 3QX7A 3EIWA 2WG2A 5KTRA 2EATA 4OHPA 1N1DA 1C4WA 4ZT4A 1RI4A 2ZM6B 2QL9A 1F7UA 3CH6A 1XMJA 3N0VA 5D3KA 4DLRA 2X8LA 1X7DA 4ZAZA 2AWNA 1QP4A 4V0LA 4KIGA 2WVJA 3CUSA 2AN5A 2CYAA 4URZR 4F1KA 1WDLA 3HCOA 4LBWA 1O2DA 5AD1A 1XL1A 3ABOB 3GNTA 1BG6A 3P2MA 4R3UC 4UM7A 3KHTA 3M3HA 4X00A 1A5ZA 5TX7A 1T8UA 2X0JA 1P2GA 2EFYA 1USVA 2GTPA 2VUHB 3F8WA 3HKCA 1AOXA 3MGAA 1XG5A 3C8HA 3OCYA 3OF5A 4GC9A 4X44A 1JGTA 2NVBA 1TA9A 4RZSA 5HVNA 1GCGA 1QOPB 3O4RA 2R1TA 2RHMA 3WGYA 4KW7A 4QXRA 4ITVA 1YVEI 1S96A 4Y3UA 1ZJ6A 2PYDA 3NAMA 5HF6A 2CLOB 1XVTA 1QH8A 4OGFA 1R0SA 4KREA 5CM9C 3B1WA 2NYUA 3M4ZA 1K2WA 3DKIA 4LOHA 2OZPA 3EAFA 3RRYA 5ALXA 3EWIA 4XE5A 3T7KA 1L7DA 4HB2A 3WDKA 4TYYA 1O8BA 2EWMA 2WC1A 1AJEA 2CLSA 1YVUA 4FDVA 5GJVC 2XTMA 5GONB 1LBQA 2VHZA 4JR1A 5KBYA 1ZW1A 1EAYA 3LLMA 1WDTA 2CNLA 3QSGA 3WYEA 2Y0EA 4IBOA 5DNDA 3UT5A 4CWAA 4N0QA 2YOGA 3BXPA 2IXEA 1IBMB 2HM7A 2H2AA 4EKIA 2JGFA 1NJFA 4OXKA 1RAGA 1KVTA 1IZ9A 2BFFB 3OOWA 3ORFA 3PP8A 4O2BA 4ARVA 4C7JA 3HTXA 2PFGA 2YQZA 3EVEA 3L6DA 1W36B 1JDTA 3KUXA 1MO4A 2Q9AA 4LRQA 1MP0A 4OUDA 3FJYA 1Y6RA 2PUBA 4HAWA 1NXOA 3SPXA 3CNBA 1XU9A 1FTYA 3QGMA 1YGYA 2WFMA 3KAQA 3LXRA 4JB8A 4YMUA 2H29A 4JR0A 4MW7A 5LQUA 2FZGA 1CRLA 1GOTA 1K86A 2ZT7A 3I2KA 3P0EA 4Z4GA 5KTYA 4GFDA 3ZE0B 5CLFA 1HO3A 1ELOA 4JBNA 1V41E 3ROQA 4GPBA 4PLFA 1VLMA 2HAEA 3IMFA 3SYKA 3HO1A 3VSCA 1FMCA 2YV5A 4CVNA 4MTLA 3VR6A 1NRWA 5CDSA 3DTVB 1GSAA 3VNBA 3C3EA 1BRMA 1SCKA 4ZGGA 4G1UC 4G1EB 1GL7A 4LOLA 2FWIA 4HUQB 5C0OE 4JGGA 3VOBA 4AROA 1JYFA 1NMYA 1VG1A 4Q4JA 1QH1B 1Y9AA 3UJ9A 1FVFA 4EP1A 5L4NA 3RV3A 4DIDA 2BEUB 3CJRA 2AOUB 3CRZA 4M0FA 4BVFA 4ZOCA 2TMKA 4QOEA 2ZP1A 1VGRA 4Q7LA 4BUJA 1AKUA 4XM0A 2RAVA 2A30A 2Z9DA 3T4EA 5BSHA 4C08A 4X8OA 3K96A 4WVFA 5JYEA 1RT9A 4N4AA 3IPCA 2NADA 2VPQA 2W2XA 5G1OA 1MPTA 1E0AA 5AI5A 2D4AA 3P9ZA 4LPKA 5KSOA 5DLPA 1NBIA 1S9DA 3OPXA 1BXZA 2IKQA 1AT1A 3KU1A 2H4HA 4UUMA 1PUIA 5C8YB 3WNQA 5BSFA 1L5KA 3MWDB 1O9HA 3KJNA 1IAQA 2FZ5A 4AXXA 2YV2A 4NCIA 3VR2D 1FVOA 2ESRA 5AJUA 2YVLA 3V7NA 2PH5A 5FOTA 1RU3A 1SPXA 2A0XA 2AUMA 2D2VA 2YICA 4XPIB 1E92A 1HE8B 4MKZA 1O6CA 4KGVA 4S2EA 3FFWA 1N25A 5T6BA 4O63O 3JYHA 3GGCA 5DISB 5IASA 4TWBA 4F4DA 1AKTA 1JEEA 1MT3A 1N3IA 1VYHA 2ZBPA 1EM6A 1U8TA 3R3XA 4P58A 4N0MA 4BC1A 4S04A 3NT5A 1Y4UA 4DCUA 3LUGA 3DKVA 3OZDA 3PKIA 2IZZA 4YYZA 3D6JA 5JFOA 5DHUA 2HJHA 4Q0MA 1A04A 3VYUB 4QDTA 2D59A 3IOBA 1JHZA 2C4KA 1YC2A 2PX0A 1TUBB 4LRYA 3UW3A 1LF0A 5HP4A 5EZYF 4BO9A 1EFLA 2VS1A 3QTBA 1UQUA 1X8LA 3FMIA 1FSPA 4W7HA 3QLJA 3TZQA 4IRMA 1T3SA 2HLDD 5KEIA