3ZCXA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
total genus 116
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zcxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zcxA01
3NTRA 1GEEA 1F17A 4L8VA 4PG5A 2WTBA 4RF3A 1D7OA 3OJOA 5T57A 1JTVA 2FOIA 2W98A 1LSOA 3BHMA 4OO3A 4TVOA 4WNCA 2FPPA 5G2OA 1GD1O 3JQAD 4JCOA 1UDCA 4BNWA 3HFSA 1YE3A 1H93A 2JFFA 1P9LA 4LISA 3UF0A 2GLXA 5JY6A 1OI7A 5COBA 2DAPA 1PX0A 4A2CA 3CXRA 3W4KA 2EW2A 4XB2A 1E6WA 1NPDA 5CEFA 4W7IA 3ZHXA 1GCUA 3VH1A 2BFPA 2Q2QA 2YQ5A 4GGPA 3KLMX 4OKNA 1FDSA 1KC3A 1M2WA 2E49A 4WCDA 2YDYA 1U28A 3LLSA 4JP2A 4WLNA 4IBOA 4GX1A 4H3VA 4IQ8A 1O89A 2X9GA 4IS2A 1A4IA 1NM5A 1U7HA 2ZQZA 3P7MA 3PJFA 1XU7A 2C7GA 1G6KA 3LC1O 3PIIA 3KYCB 4BNUA 5A9TA 3V2UA 1YH3A 3PEFA 1WMAA 4BUCA 1KVRA 4BV8A 1PZFA 1NFQA 3BTOA 2HRBA 3B20A 3F1KA 3U49A 3VKUA 3WGYA 4XYEA 4J4BA 4WLEA 1CYDA 5JNLA 5T73A 5G0WA 3DMTC 1X7GA 1O0SA 4OAQA 2VQ3A 3C1AA 2ZB8A 3PHIA 3RIHA 1R15A 1HLPA 4EUEA 1BHSA 3EAGA 4D43A 2DFVA 2AG5A 2W2LA 4TRJA 5IZCA 3D3WB 5HS6A 4HNHA 3VH4A 3ADPA 4GGOA 2B0JA 5L51A 5F21A 3GMSA 1DHTA 3GPIA 2BLLA 1F0YA 1I32A 4W99A 3F5SA 3TNLA 3V2GA 4DQUA 1AE1A 3RUCA 3UAGA 4EI2A 3ICCA 5IZ4A 4OGWA 2J5RA 1NAHA 1QR6A 4EGFA 3ANLA 3B70A 4BO3A 4A0SA 3ON5A 4MVJE 2DBRA 3U4IA 3TZKA 3SX2A 1P1RA 4YAIA 1NBOA 1HDCA 1XG5A 4TZKA 1ZZEA 2A4KA 1LNQA 2O4CA 4I1IA 4TZTA 4A03A 5A4DA 5KVCA 1I01A 3DFUA 3DOJA 1N1EA 4B3IA 2ZIZA 4QQRA 1QLJA 1NWCA 1NVGA 3L07A 3LZ6A 4CM6A 3JQBA 3WR5A 4E31A 3DB2A 1HYGA 1MGOA 1Z6ZA 2B4QA 2OFPA 1OZAA 4JX8A 2XAAA 2Y67A 3P2YA 4BHTA 4D3FA 3AJRA 4E30A 1J5PA 1ISJA 5JDIA 5GZ6A 5IG2A 4KWHA 4TKLA 2G17A 2HMUA 2YUTA 3SXPA 1LRLA 3PIDA 4R1NA 3ZV4A 3TSCA 3EK2A 4JGBA 4PIVA 5ER9A 4NBVA 3ROMA 2DLDA 3I1JA 3RROA 3I6IA 3QWFA 3AU9A 4J3FA 4NFSA 3F46A 1A4UA 3BIOA 1JAYA 3ASVA 3NV9A 1PS9A 4PG8A 1VJ0A 4NU6A 1S6YA 2E37A 3KSUA 4YAGA 4J7CA 1JLLA 4RVFA 4XR9A 3PYLA 1TLTA 3T4EA 2B35A 1Q0LA 1LSSA 1LLCA 1YWGO 1FDUA 3QIVA 4YAJA 3WMWA 1DC6A 5C37A 1ZEMA 4D0RA 1EK5A 1Q7BA 4RGBA 1UXHA 5JYFA 1KEPA 1ZBQA 4BNJA 4EJ0A 3LF2A 4DC0A 3OJ0A 1SMKA 4OJNA 4DPLA 3PHHA 3COSA 3QLJA 2OP0A 4N54A 1Z45A 4IDAA 3ZI0A 2EERA 2NUAA 4LSWA 2UV8A 2PY6A 1DFIA 2NU7A 1NQAO 1HSZA 1RM0A 3SJ7A 5I7SA 3Q11A 5BNIA 3EVTA 1LC0A 3WNVA 4OHUA 4N5LA 3PYXA 2VUSA 3RUDA 1R0SA 4WLFA 3C1TA 4O1MA 4UUNA 3FWNA 5AXCA 5ADHA 1U3UA 2B4RO 2C82A 3BZUA 3I3OA 1BGVA 1YQXA 2ZTVA 1ID1A 4TRNA 3AK4A 5L95A 4FC6A 2GRAA 3EYWA 4L0QA 4LRSB 5I9MA 4E33A 3CZRA 1HDZA 2VUUA 3U62A 4NMHA 1LDBA 3MJCA 1R0KA 4UVDA 3PZBA 3OQ6A 4YJGA 4CMBA 4YT5A 4HX5A 1UXKA 2YV2A 4RDIA 1Y8QB 4XQ9A 5BNFA 2P68A 5G0SA 1U4OA 4PLTA 4XCVA 4BO8A 2DPHA 2PTGA 2X86A 2JHGA 3K30A 3AI1A 3WFJA 1PGQA 3DOCA 1QYDA 4IDDA 2F1KA 4CQLB 2JCYA 2DBQA 3GHHA 3N74A 3RI3A 2UVDA 1IHXA 1GR0A 3ZWNA 4CM9A 1R66A 1NP3A 4KZPA 3GAFA 5HS4A 1Y7TA 5AXDA 3IL2A 4MIOA 3BXXA 3DTTA 4NBRA 3WYBA 4GBJA 4WASA 3RSHA 1CQJA 1PL7A 2PD6A 3IJPA 5CPFA 2Y68A 4O6VA 1OBFO 1HWYA 1BW9B 4B3JA 1V6AA 1BMDA 2I76A 3G3EA 3WWZA 1U1IA 4FJ2A 5T64A 1GQQA 3Q2IA 3PI7A 3U4HA 1HDGO 2CSUA 4W7HA 4R41A 3VZPA 3R1IA 1CRWG 4XRRA 4G5HA 3AWDA 4C7JA 5B1YA 3KEQA 2O3JA 3QRWA 4KMSA 2Y1GA 1T1SA 3RCBA 2P4QA 3KLPX 1V3UA 2B36A 3H3FA 4GH5A 1ZK3A 4GVXA 4IDCA 3GQVA 4QUKA 3LYLA 4Y67A 4LGVA 4CM8A 4ZJUA 2GUGA 1GZ3A 4WLUA 3RD5A 2VHXA 1DOHA 3I52A 1A71A 2WD7A 2WMDA 3KXDA 1LDGA 4NBUA 4CLDA 4GWGA 4R69A 3QW2A 2CDBA 2X8LA 5IN5A 2V6FA 1JN0A 5HM8A 1E5QA 3UGKA 1HYHA 3DZKA 1GCOA 3TZ6A 1CEQA 5JDCC 3TL2A 2PK3A 4OYRA 1PJSA 1RM5A 4NFYA 4O0LA 3DBRB 4ZICA 3ANNA 3FD8A 2ZQYA 4CQMA 4EEZA 3KYCA 2IZ1A 3K8ZA 1Y8RA 3PHLA 3RFTA 5I9NA 5JXWA 1E7QA 1PZGA 1QRRA 2CDAA 4WKGA 2OXIA 4XYLA 3UFXA 1E7YA 3RC2A 2VNSA 4OL9A 1ZK2A 4AVYA 4JROA 3OQBA 4M8SA 1XCBA 1YDWA 3DHNA 4YBZA 4KQWA 3ZWOA 1CJCA 1X7HA 5T8KA 1W6UA 4ZQGA 5T5QA 2Y1EA 1PGJA 5GY7A 3WB9A 3VPFA 4TROA 5M6DA 3D4OA 4MIYA 1UP7A 3PGXA 3RUHA 2XXJA 1DRUA 1EDZA 4Y6RA 1X7DA 2E4AA 3ROQA 1BTOA 1N8KA 3M1LA 4AJHA 4E5PA 2DTXA 2RAFA 2J5KA 3ZDFA 1IL0A 4PLPA 3OIFA 4BO2A 4S1VA 4KWIA 1FJHA 4NZ9A 1K0UA 5DT9A 1CF2O 1LBEA 3F5QA 3HB4X 4IM7A 5CPBA 3QVTA 1C1XB 1HE2A 4AJOA 1NX6A 1M76A 1QLHA 1V0JA 5IFLA 5EESA 1QYWA 3AFNA 3EHEA 4J1QA 4BNHA 4B7CA 4XR4A 2RHCA 2X0RA 4KDEA 5MDHA 4G65A 4HBGA 2Q2WA 4AJNA 3BAZA 2O3QA 1G1AA 5KIAA 4WCFB 4Z9FA 3MOIA 3I9OA 2GPTA 1J6UA 2Y05A 1U3VA 4XQEA 4YRDA 3JTMA 4AG3A 1ONNA 3H8VA 1D3AA 4AJ1A 4BO4A 3F1LA 1HRDA 1A7KA 1R4NA 5TJ9A 3IKVA 2ZKLA 5JDIC 3QHAA 3OHSX 2C2XA 4PLCA 2CZCA 4FFPA 4J6FA 3QVXA 1V3TA 4BGEA 2D2IA 1DEHA 1CDOA 3VAZA 4J2HA 2P91A 3QY9A 2RIRA 1IPFA 2O2SA 3GAZA 3KTDA 4HNGA 5CAEA 3JYLA 3HADA 3W8FA 2Y1CA 2HDHA 5A05A 1FK8A 2RH8A 3ZWMA 3H9GA 4FOOA 5L7WA 2EKLA 4AJ4A 3IOYA 1UXIA 3CMCO 5C7LO 5JYAA 3DAGA 3VDRA 1SB8A 4IZIA 1ISFA 3TZQA 4A5OA 3PVZA 2JD0A 1GPJA 2ZCVA 3D4PA 3FNHA 2DU8A 4RLHA 1VLLA 1ZIDA 3ETEA 4IPTA 4DBVO 4RLSA 4URFA 2Y66A 3GOHA 4YACA 4M55A 4B4OA 2VWPA 4A26A 5JO9A 1K89A 4YJHA 1X0VA 1R4NB 4J16A 3E5MA 5JLAA 3QQPA 1QXSA 3VTFA 2GYYA 4MVJP 3R0IA 3AU8A 3BMNA 3MJTA 4UVGA 5EMHA 3INTA 3C85A 5AYVA 1OC4A 4FDAA 4CUJA 1PJ2A 1QYVA 3LVFO 1WXDA 4ZRMA 4M86A 1Y8QA 3FTPA 3Q0EA 5JFOA 4Q3AA 4QO7A 3BMNB 1QSGA 5FEUA 3GC6A 4R9RA 3MWDB 4FGWA 4FOSA 4P4GA 3WDSA 3ZW9A 3W6UA 4ND1A 1DBVO 2Q22A 5AVOA 2B5WA 4XDYA 3DZFA 1WDKA 1MFZA 1QYCA 3RASA 1XWFA 1PZEA 1ZMOA 2NU9A 2HK8A 4HWKA 5DOZA 3EDMA 3KEOA 2ZK7A 2G76A 2DKNA 3VZRA 3W8EA 4B8ZA 4DPMA 1SO8A 5ILOA 4NPCA 6ADHA 4I5DA 1HKUA 2D0IA 3NDJA 1NFRA 4PVCA 5DCUA 4F45A 5JAMA 3BMOB 2DQ4A 3DAFA 1YOVA 1A27A 2HU2A 5U9CA 4CL8A 1X15A 4XGNA 4WECA 3VZQA 4W82A 3ZV5A 1BRMA 3ZWAA 4M54A 1MB4A 3VTZA 3EGOA 2RBEA 4ZGWA 1WLYA 4NJOA 2J3IA 2HSDA 3ZNQA 4CM9D 1PR9A 3MWEB 3CIFA 1MLDA 3PRJA 5KJEA 3FNEA 3H6KA 3WBFA 4BNGA 4QT0A 3OMLA 3AOGA 3I5MA 4HUJA 2Q50A 4OXYA 3GR6A 3EMKA 3U4DA 3GFBA 1X1TA 5B12A 2OORA 2E48A 1BW9A 3ITDA 1YL7A 4BO6A 3JD0A 5TRTA 4E4YA 3VDQA 4BL5A 4IJWA 3SC6A 3ASUA 3A14A 1MA0A 5TNXA 2A9FA 3WIEA 3PWSA 5ES3A 5HA5A 3VPSA 5IZCC 2YHIB 4YRAA 2J3JA 4Y9DA 2YZ7A 1GU7A 1TT5B 4YJDA 4YAKA 3L4SO 2PGJA 4NU5A 4DTIA 3G17A 2FSVA 3T7EA 3JQ6A 1ZJYA 1Q2XA 2PGLA 2UUPA 4KTTE 3QWIA 1P1FA 1QP8A 1ZUD1 4QEDA 2FZWA 4J4HA 1X13A 1I2BA 1D4FA 1QG6A 2P9EA 5C7IO 2QRJA 3CUKA 5MGBA 4I9UA 4FB5A 3LLVA 2X5JO 1H6BA 1P3DA 4BGUA 3C7AA 4I9NA 1SEVA 3DBLA 3DZGA 2PZLA 5ILGA 1C0LA 1UZLA 2DT5A 1VI2A 5LC1A 4FFOA 3WSWA 3DZJA 4XYBA 1P1KA 4YJFB 3VPGA 1GFSA 3M2PA 2AA3A 4D7AA 1LDYA 3AY3A 2HMSA 5A9SB 3TL3A 5JY1A 5BSEA 2FSSA 1BDBA 4PCVA 3ZWXA 3WGIA 2DUWA 3CMMA 4DRYA 1P77A 1PJQA 5CG2A 2FR8A 1PU2A 3S2FA 4E21A 4R3NA 3DBRA 3PXXA 2GR9A 3UXYA 4BNNA 1YKFA 2OOSA 4YT2A 1ISMA 1K6IA 4RV9A 2O7QA 3K5PA 3FSRA 3DC2A 5DBGA 1HDRA 5K6AC 4GLOA 3KSDO 2FMUA 5DCYA 2X6TA 2DC1A 1Z7BA 1KOLA 2NWQA 1GUFA 3DZIA 1LJ8A 9LDTA 4KOAA 2OL4A 4XD2A 3EZYA 2PZKA 3HDYA 1I36A 3OECA 3F9IA 4XZ3A 4MVJI 3JQ7A 5JS6A 1P33A 3PDJA 4JP3A 3GNQA 2PA3A 4HXYA 2Y99A 3ZH2A 1U5AA 1B15A 4RPKA 2LDBA 3VH3A 3JYPA 5AOVA 2DFDA 5GZ1A 3HSKA 3NGXA 3DTYA 1H5QA 5DP1A 3FI9A 1E7MA 1N7HA 3ABIA 4FSHA 4FN4A 2J6IA 1KERA 4J0FA 5JCJD 1LU9A 5TQVA 2DBVO 1N92A 2AEFA 5FI5A 4WLOA 4HADA 3L9XA 1OC2A 4MKZA 4OXNA 1A7AA 3QV1A 1C0PA 5JE8A 4RVDA 1DRWA 1YBMA 1FDWA 5HRUA 5JAZA 2C20A 3KBOA 1ZSYA 4JBHA 5K9ZA 1ENYA 2X5KO 3FTNA 5L7YA 3AUAA 2CNBA 4YYZA 1GQ2A 3RUEA 4GX5A 5C5IA 4NBWA 4Z3KA 1ULUA 2BELA 5JBIA 3DBHA 4DWVA 1YS4A 4XJSA 1LLDA 1MXFA 2W2KA 4ALIA 1VKNA 4FBGA 1NASA 3GUYA 3OA0A 2WEKA 5LCXA 4XKJA 1DIAA 1I3LA 3DFZA 2HJSA 4MINA 2XPCA 2X22A 3ENKA 4HFJA 4II3A 4LMRA 1XDWA 3CE6A 4MJLA 1YGYA 1DC3A 1YB5A 3UN1A 3HDJA 1R4MB 4IIVA 3SLKA 4Q39A 1Y9EA 3GN2A 2I9PA 3AI3A 3K6JA 1TB4A 3ETDA 1E1LA 4J0EA 4IJVA 4M1QA 4I5FA 5EJ2A 2C07A 2BFMA 1M66A 2GGSA 4GSKA 1DFHA 5G0VA 2NU8A 1UR5A 3FRJA 4IQ0A 2BH9A 4DQVA 2GDZA 7ADHA 2HAEA 2WJPA 2Q1TA 1H94A 4CJXA 3S2GA 4HKTA 4KDFA 2QYTA 3RWBA 1ARZA 5BSFA 1SOVA 4I8XA 4BQPA 3HHPA 1TXGA 3F47A 1VPDA 3WGZA 2YDXA 3A9WA 4ALLA 5K0ZA 2UUOA 2VZ0A 1SNYA 4MP8A 3S8MA 4YA6A 1LTHR 4WJZA 3Q2KA 3HDHA 2TMGA 1PQUA 2D4AA 3ADOA 4CL3A 2C2YA 1YJ8A 2D5AA 3JQCA 4ILKA 4KTVE 1E77A 1E1NA 3HG7A 3H65A 2EP7A 1LC3A 3DZHA 1FDTA 3PYMA 1W0CA 2OO5A 1GL3A 6LDHA 4PRKA 3ZU5A 4DREA 2G0TA 1I3KA 4LN1A 1I33A 3NRCA 4IJUA 4ND5A 3A4VA 3JQ8A 3WNQA 4OSPA 4XDZA 4JBIA 4QTZA 4BB6A 3JSAA 2W8ZA 4DC1A 4B4VA 3LU1A 1EEHA 2V6GA 2V65A 5DULA 1MXHA 1GYQA 2G5CA 3BMCB 1N1GA 3C1OA 2W4QA 1Q1NA 3GGGA 3LT4A 4IDEA 4BNLA 1PTJA 1C1XA 4EJ6A 4B4UA 2JFGA 2O3SA 2VWHA 4GMGA 3FPCA 3SJUA 2YFHA 4DBZA 5KOIA 3PFWO 3TZCA 2HMVA 2BRUA 4CMEA 4ND2A 1M67A 3HB5X 3OETA 4R51A 4RF5A 4E2WA 2BKAA 2P9GA 3GNSA 2VTDA 2IEBA 2QIOA 1UZNA 1LDEA 1WWKA 3KYDA 1KY4A 4AJKA 3RFXA 3QVSA 1H6CA 4L9RA 1RJWA 3RU9A 4AFNA 3RUAA 3ONDA 2Q4EA 2DPGA 2Y0EA 3DXFA 1TEHA 3D5QA 3I9NA 3FHLA 3IC5A 2E82A 2PKQO 4Y6SA 1S7CA 1ZKMA 2X1HA 2P9CA 4GSLA 3CH6A 4RO0A 3BA1A 4J1TA 5KWEA 3EY4A 3NDRA 3PTZA 1AHIA 3PWZA 1G0NA 4W9NC 1WVGA 3H9QA 3LC7O 3PZRA 2Q1UA 1HDYA 3QVOA 2ZJ0A 1ADCA 4YCAA 2NADA 4FGSA 3MOGA 1Y5RA 1L1FA 3QE3A 3TWOA 4YJFA 4EJMA 2BHLA 3Q1LA 4B8WA 5ITWA 2J3KA 4NK5A 4IGEA 4L75A 3CSDA 3A28A 4EBFA 3VVCA 4BKUA 3HZZA 1XQ6A 3GEMA 1A9YA 4J91A 1DJQA 3BTVA 4TRMA 1EUZA 1VL8A 3M6IA 3DBHB 5JYEA 1F06A 1B26A 2Y93A 1N9GA 3VZSA 1GY8A 1PGOA 1SPXA 3B6ZA 4Z3DA 1PZHA 3RUFA 2DM6A 4BVAA 1BVRA 4XIJA 1F14A 1ORRA 1H6DA 1ADBA 3JD2A 4UVIA 2CY0A 1PQWA 4CUZA 1ZSVA 3SBOA 3MZ0A 1TVEA 5B4UA 3ZZNA 1NQ5A 2EV9A 2HKIA 3T7CA 3WGHA 4BMNA 4CV1A 1LRJA 4MVJM 2PGDA 1ENPA 3VOSA 1EDOA 4J9UE 1XSEA 1NWHA 2I3AA 4JN6B 1SZJG 1ZK1A 2DVMA 5L4LA 4CMKA 3D4NA 2B4TO 4DL9A 1MG5A 4FJ0A 2PD4A 2EJVA 3RBXA 3E5RA 1KETA 1EE9A 3C7CB 3BMQA 2Z95A 2JAPA 5DCWA 2LDXA 2QX7A 4R9SA 2WE7A 4P4NA 1NPYA 1R16A 1I0ZA 3WQSB 2SCUA 4Q9NA 1KIFA 3ZWCA 1EFLA 1ENZA 1DC4A 5L7TA 4CQMB 1H2HA 1DB3A 3AOEA 3WMXA 1E92A 2NVBA 4CM4B 3IP1A 5KCZA 1ULSA 3F4BA 4MPDA 4PLYA 4AJJA 4BV9A 4D42A 4JJIA 5A5FA 5JDCA 4U6SA 1JU9A 1P0CA 2IYOA 2DBZA 4J1NA 4JK3A 4WE3A 4AICA 4YDRA 2GN6A 2PKRA 1U9JA 4HY3A 1VSVA 4GX2A 4QECA 5TT0A 3WQRA 2AE2A 4ZN6A 3AM5A 4INAA 3RKRA 5CDYA 3IDSA 2Q1SA 1ZVMA 4OMUA 7MDHA 1EQ2A 1ISHA 2HQ1A 3NJ8A 2POQX 3RJ5A 5IXSA 4RDHA 1M6HA 3N58A 1XYGA 4WK6A 5ICSA 5G4KA 2QZ9A 4P38A 1QV6A 1V3VA 4U0KA 4DUPA 4F6CA 5KKAA 2NTVA 3ONFA 1I10A 1BXGA 3JQ9A 5U1PA 1UDAA 1HZZA 2PZJA 2HUNA 2NLOA 1WZEA 2WYVA 4EW6A 5G4KB 5A9SA 3TFOA 5GMOA 1MX3A 1IPEA 5C7OO 4L4XA 2UAGA 2FY8A 5A02A 3I4FA 4EUHA 2ZB4A 3E9NA 3E48A 5JMWA 1T26A 4I08A 2P4HX 4J1SA 1T2DA 2HCTA 4NK4A 4IXTA 1U3TA 3O9ZA 3NAQA 3MEQA 3U3XA 1XQ1A 4RORA 2HO5A 1HSOA 1MC5A 1E3JA 3E9MA 3N7UA 2NNLD 4U6QA 4UUMA 4OSOA 4Z9YA 1A5ZA 1BXZA 1PEDA 2H1SA 1RYDA 2RHRA 1E7WA 3EVNA 3IUSA 2C5EA 4GMFA 3P5SA 2X9VA 3QWBA 4RCVA 5F3RA 1KVSA 5EL0A 2I66A 5IDQA 4ZQFA 4D3DA 4OM8A 1C14A 4R54A 3AY7A 3JQDA 4EUFA 4R01A 2FN7A 5EQDA 5L40A 3FR7A 4AJ2A 2G82A 4DIFA 1HE4A 1RPNA 3IQDB 1T2CA 2D59A 1P1JA 3RBVA 1HTBA 4XEHA 2C29D 3MTJA 1GUYA 3O8QB 3STHA 3WOHA 4WUVA 4Y98A 3HN7A 2FZEA 3RKUA 3TRIA 3M1AA 1H6AA 4WCFA 4WOKA 3WWYA 1UDBA 3OP4A 3DMYA 5JC8A 5KJ1A 3OIDA 3H9EO 3VKVA 1E1KA 3NYWA 1U8FO 3ZNOA 4J49A 1PL6A 4PRLA 4XA8A 1V8BA 2P5UA 1HETA 2O23A 4E13A 5KVQA 2O4UX 2QYSA 3HDQA 3PQDA 1GQYA 2H5LA 4BGVA 3WTBA 4FFMA 1MFPA 1YXMA 4YJHB 4DIBA 1MUUA 2VZ8A 5I7EA 5JC1A 3GUCA 3RQSA 1XIVA 1H9BA 1B16A 3FNFA 3GNTA 4RPJA 1VJ1A 3GFGA 1P0FA 4YT4A 1SBYA 5DN9A 4CV3A 1AXEA 1LUAA 1E3WB 5G0TA 4BO5A 2WD7B 1VRWA 8LDHA 1ADFA 1IB6A 2HK7A 2GNAA 2PD3A 5F1OA 4LRTB 4PG7A 5HTOA 4CV0A 1B8VA 3RC9A 1YL6A 1ZEJA 3JQ8B 2Y1FA 4RZIA 1I30A 4QFCA 1P45A 5DZSA 2AQKA 4JQCA 5FFFA 5AQ1A 1K6JA 4CMIA 5TLSA 2EGGA 5TC4A 3U4CA 3ZU3A 4B4WA 2P2SA 3BTSA 3AOEC 3UVEA 3OEYA 1I3MA 2EJWA 2AQHA 2V6MA 4J90A 1VL6A 4FFLA 3C7DB 2X23A 2YW9A 3KETA 4MP6A 3OICA 2DTDA 3OQ1A 4IMRA 5B37A 4ALNA 1KYQA 2IEDA 3MJEA 5EERA 5F5LA 4IDBA 3BYZA 3F3SA 2GN9A 3KUXA 1AXGA 2WSBA 1BDMA 4R16A 5C3MA 2QRLA 3TOZA 1YQDA 1OFGA 1U5CA 5DNAA 2AE1A 1XHLA 3NTQA 4PZDA 3WQQA 4B3HA 3Q3CA 4YPOA 2VT2A 1PIWA 1FF9A 1B14A 1NHWA 5L3ZA 4PLFA 1QORA 3QA9A 1ENOA 3S55A 2BFAA 1OAAA 1BVUA 1B2LA 1MP0A 1N2SA 1C0IA 2YY7A 4PVDA 2EW8A 2PNFA 1TI7A 1IHYA 2V6BA 4NFHA 3GT0A 5GZ3A 2C54A 4BNZA 1Q0HA 3E03A 1YOVB 1UZMA 4NNJA 1BXKA 1X1EA 4IQGA 5JW6A 4ITUA 2VN8A 5IXYA 5BSHA 3GZ4A 1XU9A 1E7SA 2GF2A 4BNYA 5J23A 2VHWA 1I8TA 4M87A 3OJFA 3GN1A 3GPDG 4Q3BA 3TZHA 5T6BA 4BKQA 2CFCA 4DLBA 2R00A 2A92A 2W2KB 5CP8A 3D64A 3H2ZA 1DAOA 4RZHA 3UCFA 2C59A 1IOLA 4D46A 1PL8A 4CR6A 3TF5A 3IS3A 2YHUA 4CM4A 3TPCA 3P2OA 1RM3A 3HUDA 4UEJA 3FR8A 5DOVA 5IDWA 3B1JA 1EE2A 2VCYA 1VC2A 5I9LA 3WLEA 3KV3O 1J0XO 1JQBA 4KUEA 4YRBA 1B8PA 1I5RA 3K9QO 3HN2A 4XGIA 4BB5A 4CODB 4IZHA 5A9RA 4NDNE 3UKOA 5TJHA 4MVJA 2B69A 4CLRA 3TJRA 5I8ZA 4RF2A 3GG9A 1W73A 1T4DA 1FXSA 4EZBA 1DIBA 4E2YA 4PLGA 5CEEA 3L6OO 1UXGA 1EBUA 4CLXA 2PH5A 4GQAA 4LCEA 4QXMA 4NIMA 1NVMB 4UAGA 2QZZA 3ENNA 5KJFA 3ETGA 2IODA 5FWNA 1GEGA 3JQ9C 3JQEA 3GDGA 4JLWA 4R1TA 3WFIA 4U0JA 3ZWPA 1J4AA 1SEPA 5JCXA 1E3IA 4N5MA 1Q7GA 3AUSA 8ADHA 2GO1A 2AQIA 3Q6IA 1R6DA 4Y6PA 4OH1A 5ER6A 3V1TC 1QMGA 1HDOA 1L7EA 5EIOA 2AQ8A 2H6EA 4D0SA 4MVJD 1PS0A 2JJYA 3ORFA 4J2OA 3M2TA 2AHRA 3JQFA 4B7UA 4MO2A 3ZV6A 3IKTA 4D79A 4BMSA 1Y1PA 3D0OA 3WSVA 4K28A 1NVTA 4A73A 1ZCJA 4GL4A 2NV6A 1B7GO 4U7WA 2WYUA 1DRVA 3SEFA 4E32A 4I5EA 4ZHSA 3U09A 4QX6A 5TGDA 1LSJA 4CMEC 4X54A 4E12A 2VYNA 1NHGA 4QSMA 2XXBA 1ADGA 4MOWA 1PJBA 5JAIA 3GVHA 1BXGB 4GKVA 3V2HA 4FW8A 3R3SA 3DL2A 3K92A 4HFRA 3D3EA 1XGKA 3W8DA 1IULA 3GY0A 4YJGB 4RF4A 5L9AA 5F5NA 3R6DA 1N7GA 2BI8A 2WE8A 4D3SA 3GVPA 4XWYA 4PG4A 5AXBA 4R1UA 1ZO8A 1X14A 5T67A 4ALMA 3LT2A 4DGSA 3ZW8A 4Z0HO 4J7UA 5LDHA 2R00C 4F6LA 4A7PA 4IIUA 1BG6A 1IE3A 1UP4A 1WPQA 2JL1A 3KYBA 4WLVA 4WNIA 4C4OA 1HE5A 3AFMA 1B3BA 5TX7A 3SC4A 3H9UA 2GD1O 5KKCA 1LSUA 3GRPA 2BD0A 1GAEO 1VJTA 3L0DA 4UUPA 3ZHYA 3H7AA 1DLJA 1DAPA 1MC4A 3GZNA 2GN8A 1H2BA 5CDTA 3NKLA 2J3HA 1U2GA 4Z6KA 4ID9A 3GHYA 2YYYA 4FCCA 4D44A 3KOUA 1Z74A 5A5EA 4DLAA 1ZW1A 1KC1A 3I9JA 3JQAB 3HWRA 4JJGA 4IINA 4BNMA 3T4XA 1WAMA 3ZGYA 4CUKA 1PJLA 1LRKA 2VHYA 5F1PA 3QWAA 4R3WA 1A9ZA 1O6ZA 3TFQA 4E5YA 5JCJA 1V9LA 1BWSA 1JDJA 2WDZA 4KQXA 2GN4A 4W9NA 2WYWA 1Q7CA 4U8GA 5BNTA 1CQIA 1GDHA 4GAEA 2EG9A 1GYRA 3DBVO 3LQFA 4KUGA 3ULKA 3ZU4A 3JQ7B 1IUKA 2B83A 4DYDA 5J9GA 1J49A 3NGLA 4RVUA 3PFFA 3V1YA 1XELA 3NT4A 4Z0TA 1JW9B 1SCUA 3NT2A 4TWRA 4Z9XA 1ZNQO 4GLLA 5G4LA 2IYPA 3NJ4A 2CUKA 3RAJA 1ZH8A 4BKRA 2VZ9A 1Y8RB 4FC7A 1YVEI 1SAYA 4LW8A 1NXQA 1YDEA 1LI4A 1LDMA 2O2YA 2D8AA 4NJMA 1SB9A 3GLQA 3UICA 2UYYA 2NTNA 4TSKA 5H83A 2OBNA 2I65A 4L73A 2ZYAA 1T25A 2CVQA 1PR3A 1PSDA 2VHVA 2YV3A 4LMPA 5F1KA 1ISGA 3A06A 3NDIA 2YHIA 1I3NA 3FF4A 4J9VA 3G1TA 1CWUA 3NT5A 3INGA 4PLZA 3AI2A 2BGKA 3MJVA 2VOEA 4G2NA 4XIYA 1CERA 1LA2A 3JV7A 1YB1A 3OA2A 1KEVA 3OF2A 1O9BA 1WNTA 1PWXA 4GI2A 2QQ5A 5KTKA 2CDCA 1EMDA 4FPXA 1T1RA 2EP5A 4D45A 3PP8A 1DIHA 3ZV3A 3CINA 3GEDA 2VOJA 2NU6A 4BGIA 4Q3EA 4ZQBA 4BO7A 1TA4A 3QVWA 2Z1MA 4O59O 4OQYA 2B5VA 3GK3A 4E3ZA 1QV7A 2HMTA 2X5OA 4CR7A 1P31A 3V8BA 1JWBB 5COAA 3Q9NA 1JVSA 3ZN2A 3PLNA 1AHHA 3UCXA 2OMEA 2O50A 1EVJA 3HE3A 3HFGA 2FP4A 4UVEA 3OBBA 3LSYA 3FCOA 3ROKA 3IUPA 2X0NA 4DVJA 2V7PA 3GEGA 4CM7A 1DSSG 4K6CA 4CLRB 3IJRA 3KB6A 3H5RA 1Z7EA 2PKQP 1JWAB 3E18A 1IZ0A 1Y5MA 3PDUA 4ND3A 3ZWWA 2VYVA 4H16A 4BO9A 4J43A 2VUTA 4MIEA 3DWFA 3U5TA 4BMVA 3WGTA 5H82A 2Z1NA 2WD8A 5A1TA 4ONEA 3U0BA 4I5GA 2HLPA 3VC7A 3DHEA 1VL0A 1F8GA 3INRA 4R5MA 3O4RA 3JD1A 3PJGA 5EPOA 4DXHA 3I9MA 4JNKA 3W4IA 1E3SA 1XR3A 3H5NA 3HJAA 1B8UA 4MVJH 1SC6A 5ENVA 4DMMA 4WPGA 2PLAA 2WM3A 4WEQA 4E6PA 3GRKA 5L4SA 4YT8A 3WYCA 1D1TA 4R1SA 4L4RA 4W6ZA 3VPXA 3KZVA 4YQYA 2QG4A 3GVCA 2CF6A 2NQ8A 1P1IA 1W8DA 4Q3CA 1P44A 4CLOB 4HFMA 5I8WA 1E1MA 1B3RA 1P1HA 3W4JA 2RCYA 4F3YA 2Q49A 4LVCA 1QKIA 4XB1A 2JCXA 5DP2A 3GDOA 3EW7A 1NPTO 4MKXA 5A04A 5FF9A 3SVTA 4YXFA 2X0IA 4CM8B 3WGQA 1YBVA 3OJEA 1O5IA 2C5AA 3GGOA 1HXHA 1HDXA 1ZK4A 3S2IA 4EITA 1GZ6A 1LQTA 3C8MA 3OFSA 3AUTA 1EZ4A 5IJZA 1A72A 3DR3A 2ZYDA 2PWZA 4IMPA 4YVFA 2I99A 4OQZA 5L45A 1PJ4A 5TS3A 1ONPA 3JYNA 4IDGA 1EK6A 5G0UA 4RQTA 2EHDA 4L76A 2A94A 1PJ3A 4CV2A 4A27A 4HP8A 3VH2A 2J5QA 1PGPA 4H15A 4ALJA 4IGFA 4OOFA 1VM6A 3IMFA 3K2EA 3Q9UA 1ZSNA 3DHYA 2Q4BA 4LVUA 4AJIA 5CDSA 3PK0A 3TQHA 3WIDA 2C7VA 1NQOA 3ROPA 2RH4A 3E6AA 1LQUA 3ST7A 3LF1A 5JAQA 1DHRA 2Z5LA 2EWMA 3BHJA 3KM0A 4JBGA 4Q3NA 5EQFA 4FFNA 4N5NA 4K6FA 4GPD1 3I83A 4A10A 3LK7A 2JKVA 1AGNA 4O63O 1PS8A 4YAEA 5JPIA 5BR7A 4U5QA 3DOOA 3K31A 1TT5A 5L4NA 3RVDA 1ZK0A 1K5HA 1E6EA 3EUWA 1KY5A 5TSDA 4AJLA 2VRCD 2CF5A 4FFRA 1N5DA 5K6AA 4PLWA 4ZQEA 2ZB7A 4N18A 5KVSA 4YQZA 2YQ4A 2DUUA 3MJ4A 3MTGA 3ZNNA 2FWMX 1R4MA 2Q45A 4CMCA 2Y0CA 1C1DB 3VVBA 4W4TA 3ZWBA 2OHXA 3DONA 5KJ6A 1E3WA 4ND4A 3OJLA 2YJZA 4O5OA 5COQA 3WS7A 1IY8A 4E2XA 3FN4A 2VWGA 1C1DA 1RYEA 2GZ1A 1DIGA 1GV1A 1KEUA 1TT7A 4OXKA 2AG8A 3OEWA 2FHSA 4TKMA 5TIIA 4MP3A 1YBAA 1UJMA 1WMBA 4OKIA 1IYZA 4E2ZA 2D5CA 1PJCA 4RPLA 2IXBA 3JQGA 5BT9A 3QWHA 3WG9A 3QJ5A 5IAAA 4D41A 4IUYA 3K73O 1UAYA 2ZATA 3PPIA 3ZU2A 3AUUA 4ESOA 3B1KA 2EXXA 4BNIA 5B4TA 2BGMA 3NTOA 3E1KA 2F00A 5A3VA 3L4BC 4FD3A 4OOEA 3W1VA 3GF4A 4BO1A 4CLOA 3GVXA 4IXWA 1RM4A 5ENDA 1BSVA 2NTJA 3NX4A 2WWRA 2I3GA 4TVBA 4EEXA 5KNLA 1F8FA 2NACA 4AL4A 4UULA 3G0OA 4BNFA 3WICA 3CPSA 1XLTA 2G1UA 2OBYA 1YO6A 2X0JA 3WXBA 1B0AA 1LLQA 3TN7A 4NJMB 1ZXLA 1RWBA 3S2EA 4CM1A 1V35A 1JKJA 3I4CA 3QP9A 1H9AA 1UH5A 3PHGA 4PZEA 1HLDA 4G81A 4Y8VA 4E0BA 3QSGA 4WOJA 4M49A 3VHRA 3KO8A 1XKQA 2OP1A 4MVJG 3V1UA 5IF3A 4K26A 4CLEA 4PZCA 2EF1A 4GX0A 3NEPX 4EDFA 3R3JA 5L53A 4R5HA 3G49A 1EQUA 2PR2A 3BMCA 3LDHA 4CPDA 4DLLA 1ISIA 4NG5A 3JYQA 2PV7A 1GZ4A 4ZVVA 3ICPA 1KS9A 5HWSA 3I9KA 3GZNB 2H9IA 4CMAA 3KRTA 1EUDA 3UOGA 4RVGA 1MG0A 4IY1A 2ET6A 3K2BA 4XGKA 2PZMA 1GPDG 3BTUA 4WCFC 5B4VA 3LC2O 1NR1A 1DC5A 3OIGA 4E5KA 4UEOA 3RBZA 2OZPA 1M6WA 2Y1OA 1H0KA 4XJTA 2IDZA 3IIEA 1SOWA 3L9WA 4BNKA 3E9QA 3IP3A 1DXYA 3H3JA 4FQ8A 2D3TA 2UDPA 1E6UA 4CMIB 3DZBA 2JAHA 2C0CA 5JMPA 3B1FA 4ZU3A 1XA0A 1VSUA 3WJAA 5BQFA 2JFHA 2NSDA 4TMFA 3I23A 3DQPA 2O3TA 1UAGA 1MV8A 4NBTA 4XYMA 1ZJZA 3RC7A 3UUWA 1YONA 4E5NA 5A03A 1T24A 1EUCA 2NM0A 2X7HA 4RPGA 1VKOA 1P74A 2AEJA 3ZWYA 5THKA 3FNGA 3ZNPA 4RVSA 3RJ9A 5BSGA 3A1NA 5FI3A 2FR1A 1ONOA 5DDIP 3O03A 2VYVD 2HJRA 2VT3A 4ZD6A 3AW9A 3O26A 3X2FA 1DDOA 1CIVA 1WP4A 2ZYGA 4OIMA 4BS9A 2X4GA 5DBFA 5KJCA 1YRLA 3GGPA 4CMGA 3W6ZA 3FPLA 1ML3A 2GSDA 5IN4A 2GCGA 3EC7A 1G0OA 4XYGA 1Q0QA 1WDLA 5EN4A 5I7FA 1KVTA 3ZHBA 4GWKA 1RKXA 1CETA 4FIZA 4FR5A 2PFGA 1GUZA 1YB4A 4LK3A 3H9JA 1DIRA 3HNPA 4XQCA 1JKIA 4FJ1A 5DBIA 4F46A 1HT0A 2P5YA 2YFQA 4BNXA 3GA0A 4CM5A 1U8XX 1O95A 2ZCUA 3UH1A 3ZHZA 3U9LA 4P4LA 4YWJA 4WEOA 3ZCXA 5CG1A 1DO8A 5T8KC 3LT1A 1ZFNA 3I6QA 3KHUA 4WGGA 2IXAA 1LXCA 2HRZA 1E0DA 4RPHA 1EBFA 1LLUA 2QHXA 2ZTMA 4UVHA 3P19A 1FMCA 4J7XA 2ZTLA 4RL6A 1HE3A 1EVZA 1U4SA 3H2SA 3WX0A 3BMOA 3AY6A 2QRKA 4M89A 1L7DA 4JIGA 4UUOA 4XQGA 3DBLB 1Y6JA 1HZJA 2YV1A 1YL5A 5DF1A 4MVJF 3RUIA 1DJNA 4LCJA 2A35A 3BHIA 3D1LA 4BIIA 3DDNA 3O38A 1ZXBA 3GG2A 3PJDA 2W90A 4DIOA 1NAIA 1U7TA 1AUPA 2HMWA 4PN3A 2GZ3A 2GASA 4B7XA 2XF8A 4RJTA 1WW8A 3JCZA 4PFJA 2CMDA 4K9DA 4ROSA 3L6DA 4II2A 3FBTA 5U4QA 2ZB3A 4S3MA 3MCVA 1D1SA 1XEAA 4GVLA 5A3JA 1GTMA 5ITVA 5CEJA 2EGHA 3F6YA 4MDHA 2IRWA 5IDXA 4YR9A 1HEUA 1LDNA 1GV0A 2O48X 1O94A 1K3TA 1C3VA 4RQUA 3ZWVA 1EFKA 1DLIA 4QO8A 2EIHA 1OMOA 4R68A 4TRRA 3GH3A 2ZJ1A 1GYPA 2Q1WA 4XRGA 4P22A 3C24A 1E7RA 2I67A 2W2LD 1Y81A 4UEKA 5TT1A 2EEZA 1R0LA 1Z73A 3D3WA 3KVOA 4TQGA 2X58A 3AM4A 4JJFA 4BO0A 4NHEA 1JVBA 2BGLA 5HBRA 1E3EA 3WGOA 2JD2A 3ONEA 2VHZA 2NVUB 1K6XA 3JQBC 3JYOA 2CVOA 4L4SA 3E8XA 1HF3A 2J8ZA 3PQEA 1K2WA 3KYDB 4P8RA 3CKYA 4KUHA 2Q3EA 4PG6A 3DO5A 4L74A 2JD1A 1PWZA 2EKPA 3GMDA 3I9LA 1EVIA 5JSFA 4ALKA 4CQLA 4BKOA 4Q3DA 4Z0PA 5JYDA 1JAXA 3EZLA 2QW8A 1JA9A 1T4BA 4IS3A 3O8QA 3WGGA 3GDFA 1AN9A 3PGJA 3HQ4O 4AJEA 2BFOA 4GKBA 3OSUA 3JD4A 2O7SA 3PQFA 3LT0A 4J4TA 2EKQA 1F12A 2NVUA 2VTEA 2I6TA 2FPGA 1NYTA 5H81A 1NFFA 4FS3A 3TOXA 4BQRA 1JKFA 1U3WA 1UUFA 1W4ZA 3DAPA 5CDUA 1DFGA 2VRBA 4MKRA 1DPGA 1HYEA 3G79A 3PWKA 4YEDA 2VYND 4BKPA 2ZTUA 3GVIA 2BMAA 4CLHA 3G1UA 3KSZO 2TMDA 3PHJA 2Q46A 2FPIA 3K96A 3L77A 4CMHA 3UCEA 1Z75A 1E5LA 3X2EA 1PQPA 1N9GB 2R2GA 2NQTA 2NVWA 2VRCA 3ANMA 5FYDA 5CDGA 9LDBA 2OGUA 4DYVA 3CEAA 1QYXA 4DPKA 3JD3A 2AMFA 2IZ0A 3D5TA 4PLHA 4BNVA 5I7VA 3BMQB 4XX0A 1T2FA 2Q99A 4N7RA 2B37A 2Y0DA 4YB8A 4PGFA 2GERA 2IZZA 1VE9A 2AW5A 4BOYA 1OOEA 1HL3A 1LEHA 2CD9A 2Q2VA 3FWZA 4NR0A 4LSMA 3FBGA 3D7LA 1KVUA 3H5AA 2R6JA 4RVHA 1UP6A 3DEYX 1E3LA 2DTEA 3RC1A 4IDFA 2E6UX 3CZMA 1R12A 1WZIA 1YQGA 2BI7A 2AXQA 3CTMA 1KEWA 4NQZA 2JCVA 2VNAA 5LDGA 3UHAA 1R37A 2OUIA 4I9HA 4KP7A 1T2AA 3PJEA 1GADO 4JXKA 3VPHA 1PGNA 1Y9AA 4CM3A 4HFNA 1I2CA 3RU7A 4E5MA 1WDMA 5A06A 4NH4A 3MJSA 3NUGA 1I2ZA 4B79A 1NR7A 1IZ9A 3L4BA 4UREA 3WTCA 4QFDA 2O3RA 3SLGA 2XOXA 1O8CA 4K1LA 4ZA2A 4DA9A 4HV4A 3TDKA 3UW3A 3DMTA 2O3UA 4ZQHA 2CVZA 4NI5A 3WBBA 4YTEA 1I24A 1Z82A 2IE0A 3JQFC 3IAHA 3RFVA 1ZMTA 1UXJA 5AXAA 4EYEA 1NTOA 3OM9A 4DMLA 3C3XA 3ITKA 3AM3A 2I5PO 1EVYA 2BF7A 2FRDA 3WJ7A 5CFZA 4R4JA 3L6EA 3OH8A 2HK9A 2ILTA 4AJPA 2H63A 5THQA 3JQAA 3S1LA 2FR0A 1FDVA 3V5NA 1X0XA 4H7PA 5EINA 4CQMD 1KBZA 1C0KA 5IDYA 2GZ2A 3WYEA 4CR8A 5KVVA 2D1YA 1NNUA 2PH3A 5ICMA 3PLRA 3JQGB 1LX6A 4ZRNA 1KVQA 4PLVA 2X9NA 1YJQA 3H4VA 1D8AA 1PJTA 1T2EA 1NQTA 3WLFA 2VWQA 4IJKA 4BNTA 2AEMA 5CHEA 5JO0A 3E82A 2Y1DA 5TF4A 3F4LA 4CMJA 4C7KA 1M75A 4DQXA 1U2DA 2JHFA
chains in the Genus database with same CATH superfamily
4JT4A 4L8VA 1EA5A 2WTBA 2V1UA 3IHLA 4RF3A 4MYCA 3OJOA 1WCV1 1JTVA 2FOIA 2W98A 1LSOA 2GJSA 4XWGA 5HFNA 5T57A 3RIGA 4D9FA 4JCOA 3JQAD 2GPBA 1ZM9A 4IOLA 1GKUB 3HFSA 1QHGA 2KM1A 2JFFA 4W1RA 2NPFA 3MWGA 3OZ7A 5CJ2A 5JY6A 1S8AA 1UC5B 4O89A 1UFQA 1U7DA 4RZSA 4EEKA 2XECA 2IBTA 3O93A 3V3KA 4CKWB 4OHCA 4YGXB 3CXRA 3JSXA 2HWWA 1WPXA 3IQXA 2CLMB 1Q50A 4D8XA 2BKVA 3A6ZA 1KI9A 1LLFA 2GZSA 4KFCA 3DE5X 4U2FA 5DV9A 1NVDA 4Q01A 3TAUA 1NLMA 3HR8A 1B6SA 4WLNA 4XLLA 1NZJA 3OIVA 3DNMA 4IBOA 1JLSA 4LYEA 4IH1A 5EWMB 5JROA 4CEJA 2QRZA 4ENVA 4IQ8A 1O89A 2D54A 1HT3A 2X9GA 3L84A 4I2VA 3QUAA 1A4IA 1NM5A 1U7HA 2ZQZA 3P7MA 2FK7A 1XU7A 2AL7A 1QQ6A 2C7GA 2R6CA 5FRDA 4ETWA 4D3ZA 1CBUA 3T38A 5KINB 3AR4A 3PEFA 3NHLA 2FEWB 5C31A 1KVRA 5EI5A 4G36A 4BV8A 6ABPA 2P8JA 3BGVA 1NFQA 1Q17A 5C51B 3T0IA 2WICA 3DH0A 2GNPA 1VHWA 3LRTA 4XYEA 1O94D 4J4BA 4N5HX 5E6UA 2A88A 1N8SA 5CA1B 2Q3HA 5T73A 1UOPA 5ALEA 5HP4A 3DMTC 1X7WB 2W5UA 3QTBA 1G6Q1 1O0SA 3KKPA 4PZUA 1CRLA 1Z83A 4ZO4A 4ZYWA 3VI3B 1HBJA 4OGKA 1A8UA 2ZT6A 3K0BA 2ZB8A 4UD2A 2QT0A 4U2GA 1P0IA 1HLPA 3EZ6A 3NHUA 3EAGA 1WUKS 1HLGA 1QVVA 1JZQA 1WDWB 2AG5A 1JHVA 3LO8A 2EAUA 4D43A 3D3WB 5IZCA 1C2YA 2EX0A 1JDZA 4P84A 3E3MA 2ATCA 2DWPA 2PJUA 3C3JA 4LG1A 5CK4A 1E2BA 1VPTA 2HPVA 4QXRA 1E94E 5F21A 1IUOA 3ZH9B 1NOJA 2J3QA 4D99A 4KXQA 1R9GA 3BL8A 4J8PA 2HEGA 5FX2A 2IS6A 3ZY5A 2NU8B 3HK2A 1G9TA 2P3QA 1XOIA 3Q7PA 4WESA 1ODKA 3V2GA 5HDQA 1U7WA 2ADOA 4JLBA 2Q8PA 4DW8A 4EI2A 4OP3A 3ITNA 4PNZA 2J33A 3WLMA 4HGZA 3FSEA 3PNYA 4FHDA 3K0FB 1ECCA 3GLGA 2P1RA 4P5EA 2H5IA 1UJ5A 3VR4A 3ZE6A 1MEOA 3SX2A 3WL5A 1NRIA 5BSWA 5EXXA 5G1OA 2Q28A 2XUJA 4TZKA 1LNQA 2XW6A 3NNSA 4PNPA 3NBUA 4ZO7A 3RWMB 3VI4B 2X4DA 4FDVA 5HIMA 1QRTA 2PHZA 5GJCA 5JHHB 1GTRA 1N1EA 3MRVA 4QTXA 3PBKA 2VDJA 2BKUA 1CUZA 2O8NA 3PC3A 1NWCA 1HFKA 3PUIA 3ZDAA 2UUAB 4KR9A 4RESA 1O4WA 2XWBF 5DGXA 5YASA 3VBEA 3L79A 4C6TB 3EMDA 1PR4A 4YV2A 1Z6ZA 4QFBA 4RZ3A 5IBPA 2IYFA 2XAAA 2Y67A 5IHPA 3PEVA 1CF4A 2XE4A 3ZCUA 1ULZA 4GL2A 3U81A 1LK7A 3C8ZA 4QODA 1Q0ZA 3SMVA 4ZMSA 4KWHA 5LYJF 4TKLA 1QGUB 1X6VA 4EJ2A 1VGQA 4WGFA 1BWPA 2XNJA 1LRLA 1QFXA 1SVNA 1Z25A 2J3MA 2L18A 3PIDA 4R1NA 3ZV4A 1LS6A 3FMFA 3NR2A 5ER9A 3RYIB 5DSZA 1FMTA 1SELA 1AUXA 3I6IA 2H3EA 3QWFA 2WRZA 2QJRA 4XASA 1T15A 2FJPA 2HPAA 4GRDA 1UEXC 2X0KA 5IWAB 1GGNA 3EPAB 1XRMA 1DINA 4OI2A 4WJKB 1JDUA 1O6CA 1S6YA 4FBLA 4Z8XA 4AKGA 4MWSA 4KR0A 3BL6A 1PT5A 3AKDA 3UAWA 4RVFA 2HLHA 2GN2A 4W5HA 4ESVA 5H70A 3PXDA 4RD1A 2B35A 2ZRKA 3EXIA 3KG2A 3P0EA 3QKWA 1LLCA 2OWDA 1FDUA 1Z4MA 2PRJA 3O95A 3QIVA 4A82A 4D9MA 3D4LA 4HZUA 3DGEC 1S2MA 2JS7A 1RPTA 4F3NA 3CNNA 3LX6A 5BMVF 1W4RA 1VYHA 1DO0A 2VDLB 5JYFA 1L7QA 3MPUA 4K9SA 2G72A 3QELB 4EJ0A 4YLYA 1NI5A 1JBQA 2IY9A 3DE3X 3LHKA 3UC5A 4DC0A 1OWMA 2AWNA 3EQ2A 4UMFA 4DUGD 5T4EA 4DPLA 1L4NA 1SJ9A 3LNTA 3PE6A 2GBFA 2WWWA 4GD3Q 5G41A 4N54A 1Z45A 3M4JA 1JYFA 1QH0A 2CHGA 4MWCA 3NHJA 4JJ4A 1Z2DA 3JAKB 1SBHA 5EFOA 4BC1A 3H1FA 2UV8A 4LSWA 2PY6A 1DFIA 1XRLA 4G23A 3ZVNA 3DQZA 4BB9A 4KPUA 1DXQA 4RZ2A 5I7SA 5FHRA 5CLGA 4JB3A 2PX2A 4LYHA 4DAOA 2WB4A 4ER0A 2VQ6A 2CFRA 3RSSA 3MRSA 1EIWA 4P0TA 2DY1A 4ZARA 4AKEA 3C1TA 3EP3B 2ETVA 3EGVA 4PIPA 4MX8A 2OYRA 3J81k 2VXOA 1U3UA 4EKIA 2HADA 4BX2A 4CG1A 1V37A 1USKA 4ZEOA 1ID1A 4OIFA 4QAQA 5IEJA 5L95A 2F3TA 3AZOA 3HU3A 2MSEB 3PFHA 4PNHA 3HXQA 4LRSB 4US1R 1XEWY 3PFNA 3DWEX 1FBTA 1CUHA 1PZXA 1TQ6A 2Y9PB 4Y2JA 1R6UA 3I2YX 1HDZA 2C58A 3HP4A 5IUKC 1JU4A 2R87A 3WL7A 4Q3KA 5J4YA 3LXXA 3E3AA 2GPWA 5HZGA 4NMHA 3HMQA 3ZQ4A 4CHGA 1G4AE 1UMDA 4QT4A 4S12A 1FSGA 1L9KA 4G4SO 5AW3A 4EPRA 4NRDA 4CG0A 4URWR 2WZDA 4NAVA 1QGDA 3CQ9A 4REOA 3EXHB 1U0TA 1D09A 4YMUA 1LVGA 3MBOA 2NPOA 2GYVA 1H0RA 3HCOA 3EVDA 1IHOA 4FE7A 4JUBA 2HCBA 4K86A 1BNCA 3DDOA 4C1BA 1L5HA 4ENPA 3K30A 5BSKA 3AI1A 4I55F 3WFJA 1NLFA 4CQLB 2F1KA 1Y3BE 4KO3S 3H13A 2DBQA 1N5RA 4H2DA 1I7CB 1IHXA 5LP6C 2G67A 4OB7A 1NP3A 4KZPA 2XGSA 621PA 2P5SA 1X39A 5HQ3A 4B6GA 1Y7TA 2I2WA 3U37A 4JLOA 1Y8CA 2HF2A 4MIOA 5BVGA 3P96A 3JY6A 3SXJA 1S1MA 3WMFA 3T99A 1PL7A 3CTPA 4FLFA 3WLQA 1AKEA 4UNPA 1FCJA 3NM5A 5CPFA 1VG0B 1G5QA 1TZMA 2XF2A 2W6NA 4PONA 1BW9B 1V6AA 1XD8A 4D4MA 1BH2A 2I76A 4C7OB 5BQOA 4D4GA 1EUYA 5IFKA 3CVYA 1U1IA 3O8LA 4NWIA 2G1PA 4D9KA 1FP4A 3VR5A 1S3SA 4BFZA 2QRGA 4HXEB 3K9WA 2GEDA 3MUFA 2ZU0C 1GRCA 3KKLA 4G86A 4LTMA 3VZPA 4XRRA 4ZJYA 1FVFA 3CPEA 3IO5A 2WU3A 2VJYA 3AHHA 4C7JA 3PGLA 4C5AA 3OPNA 1I79B 1JR3A 1FLNA 4IV8A 4G1VA 4YCCA 1T1SA 3C3EA 2PRYA 2CNKA 2B36A 2QX6A 4KVGA 4QUDA 4MITA 4HLUC 4QU0A 1WMEA 2XVXA 1TAUA 2HF7A 1WG8A 4M0LA 3SVLA 2ACEA 2DX7A 3H2JA 1MT0A 3QBDA 4C7OA 2E9SA 3KQQA 1SU4A 3RIYA 3DF9A 3N53A 3LPAA 2OENG 4TQ9A 1A71A 2IP4A 2WD7A 2XQKA 1LVHA 1LDGA 3REOA 3ZGOA 4JZYA 4CLDA 4R69A 3QW2A 4HDRA 4MYUA 2EDAA 3M81A 2C4KA 3A2MA 4L8GA 2V6FA 3UNXA 1Z0SA 1RWOA 2F3UA 2IS1A 4L08A 2GKOA 4IO1A 4LBVA 4E4RA 1MC1A 3ACBA 3RLIA 4Y1GA 2YINC 2O0MA 2OMKA 4ND7A 1E89A 4RK7A 4F4UA 4KYIB 4B5KA 4P7KA 1SN7A 3FUTA 2O57A 1JZTA 2ZWAA 3D3QA 3EC2A 4UBKA 4ZICA 2YNMA 3U4AA 3IP9A 3WZ2A 1VPVA 4C0AC 4KQCA 5BWLA 1EFRA 2IZ1A 3BAFA 3K8ZA 5I9NA 5JXWA 2CV1A 1E7QA 1FDOA 1N5MA 1OYYA 1QRRA 2CDAA 3O3MB 4O3FA 4U39A 5EZYB 3UFXA 1SQFA 4F9GA 3KXPA 2BDEA 4XYLA 1V1RB 3ZY2A 5AW2A 2JGMA 5J4KA 1RHMA 4RMIA 3VH4A 4W1QA 1H8ED 2OZKA 2FSIA 1CJCA 4ETIA 2ZS7A 1KDOA 1NVXQ 4L15A 3IWDB 1W6UA 2ID9A 2PGXA 3OPYB 3TV1A 4RMHA 5T8KA 1S2LA 4RX1A 2FMIA 5B1IA 4KIWA 2XUAA 1A8SA 4TROA 4MV1A 3CE9A 4Q4HB 1DCTA 3TSOA 1G8AA 1QF7A 1DL5A 5J2TF 2BSAA 2BUAA 4LV5B 1S3IA 3PGXA 2BHNA 1E60A 5EJEA 4W8HA 1EDZA 2PEYA 2BR3A 3HYCA 5CNMA 1X7DA 3TBFA 1QDLB 4Q9DA 1BTOA 4ZV4A 2QSUA 4N47A 2QL7A 3IVAA 3M1LA 3P32A 4G07A 4TVKA 1NV8A 2ATIA 2DTXA 1WB9A 1IL0A 4BO2A 4R9NA 3RIEA 1RLUA 2SHKA 4KWIA 1FJHA 4QQ8A 1FSZA 1H8EA 2FN8A 2QLFA 4YRIA 1AUQA 5AM5A 1UWKA 1ISRA 5DT9A 2V7BA 3UKJA 2RGBA 1LBEA 3F5QA 3K1AB 4G0QA 3TUZC 1T13A 1RXUA 5G3YA 2PBFA 3ELBA 2FPRA 3LH5A 4AJOA 4MUMA 4JSYA 4NOMA 4QELA 1NX6A 5EXEA 1KSFX 5IFLA 2P0AA 3DOFA 3PD7A 4H1TA 1QYWA 3OLXA 1T3ZA 3EHEA 2V6JA 1RWNA 2Q7DA 1TCBA 2VNIA 3VHLB 1N5OX 4XR4A 1F9AA 3EEBA 3FYUC 1II0A 1GL9B 3HVHA 4WXPA 2RBGA 2XVYA 2W7TA 1G1AA 5CYPA 4DLZA 2RGUA 4Z9FA 4B3DA 5HE8A 4G0WA 1J6UA 1H23A 1U3VA 5JBQA 4TWZA 1T1IA 5CD9A 4AJ1A 4DR5B 3F1LA 3PQ6A 3L7YA 4B4KA 2WJ4A 1IBSA 3IKVA 3TRFA 3OHSX 1FNMA 2C5FA 2QQGA 1X9IA 4L2IB 4FFPA 3VYSB 10MHA 4BGEA 3KKOA 1M0WA 3BGSA 2ZDGA 3P2JA 1VE7A 1BX1A 3QMVA 4RFSA 2P91A 1G3IA 5DGIA 4DSOA 3QY9A 1QHEA 1WZUA 2RIRA 4ZOCA 4CKWA 3OX3A 1P1CA 2DERA 3M5CA 2Y1CA 2HDHA 3L04A 3R24A 5A05A 1V1MB 2RH8A 1Q20A 3PFGA 1B0PA 2D1FA 3QVUA 4FOOA 2EKLA 4FXPA 4HNTA 4JS0A 3FJYA 4QFMA 1JEAA 4UU0A 5AWFC 1MTOA 4TN1A 1SB8A 3VDRA 4LIPD 1I4TD 2PZAA 4ENTA 4FFBA 4A5OA 2JD0A 3G85A 4EUKA 3ETEA 5K03A 1QIHA 3ELYA 1DQPA 3GOHA 1L8AA 2A78A 2Y27A 5KYNA 1UBEA 3N05A 2GUWA 3PXGA 1ZI6A 3R4VA 1R4NB 3DWGA 2HREA 1X70A 2R11A 1SQ5A 1HI9A 1F0PA 4UW9A 3ZGVA 4BAGA 3E5MA 1NLYA 2ZJOA 4C2BA 5AFSA 1DKPA 3D3KA 3R0IA 4C88A 3RS4A 1YR6A 3K1YA 1RABA 1CR4A 5EE9A 4V3BA 3VA7A 4L8WB 1CJUC 1I5EA 1Z2AA 2O52A 3CEJA 5EAIA 1Z2CA 2J45A 3EPHA 3FNBA 5B3LA 3FTPA 4IZOA 4EY5A 3MMZA 3Q0EA 3T5PA 4QO7A 2MYNA 3BMNB 4R6WA 4Q4AB 2WR8A 3ZZ1A 5ALUA 4R9RA 4FOSA 4FGWA 4K9NA 4N48A 5K4AA 1FS4A 5DO9A 3FCSB 1KRWA 4EGCB 3ODPA 4UXHA 1U7XA 2AFHE 3MWFA 5AVOA 3MYRA 4KQ2A 4IHJA 3DZFA 1OAOA 1MFZA 1QYCA 3RASA 1UM8A 1UBTS 1D8TA 4JVSB 3WMRA 1XWFA 4C22A 3NH6A 2NU9A 3TGWA 1P2SA 2HK8A 3VNRA 4ENRA 1SZCA 3QPDA 4M1KA 4HGRA 3RM3A 3I92A 5JIBA 1G2IA 1VLQA 3ZU6A 3ZWDA 2OV8A 3O3CA 2ZK7A 4Q9HA 3W8EA 3VZRA 4RHTA 4L5IA 1Q3TA 4OBXA 1NUUA 5CVJA 2JFQA 1YRHA 3DDWA 3G2PA 4LNHA 3AJEA 3T7RA 5FNVB 3R3VA 2XRZA 2PRZA 4YV1A 2H3HA 4AO6A 2BGTA 4B48A 1UKCA 3G59A 3OKPA 1JHOA 1XZQA 4R84A 1RZRA 4XGNA 3ZV5A 1FZTA 4JC4A 4RZUA 3MELA 5AK6A 5CXUA 5HM6A 4DV2B 2AOUA 3TXYA 3EGOA 3OE1A 5TF0A 2NG1A 1RNLA 3LBYA 4XE5A 2ZWMA 4YYEA 4NJOA 4RY9A 1IMJA 3AP1A 2HSDA 3DEZA 3TVYA 5DNDA 2PVCA 5FFMA 2YYSA 3MRTA 4K2AA 3G0BA 3TUIC 4UBMA 9MHTA 3WBFA 1Z0FA 4NY1A 4HUJA 1KAMA 5CK5A 3U4DA 3O5AA 2VJCA 1MKYA 1TLLA 3V2IA 4F71A 3GJ6A 1BW9A 2EBUA 1WHSA 1YL7A 3ITDA 1LVUA 4FR2A 3QE0A 3OLCX 3WLTA 3V4VB 4L85A 5TRTA 2VTBB 3MMXA 4M60A 4BL5A 1PLJA 5FWXA 3SC6A 3ASUA 3A14A 2FQ1A 1VE1A 1SCBA 1EM8B 2A9FA 4KZKA 5ES3A 1T9CA 5TNXA 3WIEA 2YHIB 5K8VA 3TD9A 5J2TA 4AZ0A 1ZOPA 3AEKB 4IJ6A 4DT1A 1EGAA 1QB8A 1B2RA 2NIPA 4YRAA 2FQQA 5JD3A 3TEFA 1CVRA 1GU7A 3OPYI 3L7LA 4MJ7A 1U65A 4DTIA 4DJ5X 3MQ2A 3DVLA 2FSVA 4Z1OA 3H2BA 1KKLA 2OCIA 5PGMA 4NDZA 2JIPA 4RADA 4A23A 5IAOA 2C9DA 3BJZA 2ZR7A 3AG5A 3OJXA 1WZCA 2OCGA 2O2HA 5EQTA 3LQKA 4P53A 1E8DA 1ZUD1 4QEDA 5MHTA 2FZWA 3DMFA 3V8PA 1Z0IA 4X3PA 5F23A 2ZSKA 2ZM5A 4K6MA 1OTXA 4AQ7A 4HDSA 3U5ZB 1WXGA 3LOQA 4ADSG 4LJKA 5C7IO 2QRJA 3CUKA 1JZSA 2JVKA 3H11B 4KDCA 4RLFA 4M9SA 4LBZA 2V7QA 3DBLA 2WUFA 4GM1A 4OBBA 4OQ4A 2OQVA 3T1TA 2ODWA 1P2VA 1C0LA 2PZLA 1Y9JA 4O8JA 3DDCA 3KUUA 4QOJA 4FFOA 4BV3A 5BWBA 5JJKA 4P35A 1YKSA 3CJQA 2C88A 4YJFB 4ZFNA 3S70A 4O8CA 1YVPA 2FETA 2UVPA 3IUBA 2AA3A 1RWPA 2WG1A 3C3BA 4I1PA 1LDYA 3AY3A 4FCWA 4Q9KA 1E5DA 4FYVA 5L3SB 4ZKDA 2FSSA 1UM9B 1H1LB 4JP5A 4DQDA 5CM2Z 1WCXA 3CMMA 5LQSA 3AF5A 3UT5B 3W7BA 3HJTA 4JL6A 5CG2A 4DV3B 1V5FA 1XAHA 1Y1KE 2QSZA 5H3LA 2G9NA 4C4AA 5BUQA 1YU9A 1V5GA 4G4JA 1XAGA 1A04A 1VB5A 3G2IA 4BNNA 2C97A 2ZIGA 4YT2A 4N3GA 5AM2A 3P97A 1ISMA 1K6IA 1YZFA 4F06A 2FI1A 5FPHA 4I6JA 5JVDB 1I4DD 1L5OA 1HDRA 5HEKA 5K6AC 2DGDA 5SY6A 4GLOA 3T3OA 1BMTA 4Q3BA 5DCYA 1GZHB 3DAOA 2JEYA 3SBXA 1TCVA 1Z7BA 1KOLA 3WY9A 2GJ4A 2NWQA 3OAAA 2IH2A 1LJ8A 4KOAA 2GXSA 3RK1A 2F90A 4URXR 3QJGA 2PL3A 2PZKA 4U7FA 3EBLA 5EPUA 2OZLB 3W3AD 2WG2A 4KDRA 1SD2A 5JS6A 2QMHA 2HSGA 2JAOA 3K32A 2OCBA 3GNQA 3KB1A 4FXOA 3PX2A 4KN8A 3CW9A 4LPKA 1R8SA 4DY6A 3A6EA 2Y99A 3ZH2A 2OWEA 2L0XA 4F5EA 3FMPB 5CVCA 1W0KD 4MGHA 3ZK7A 3ROGA 2Z5FA 3X0DA 1EWVA 2FPPB 1JDVA 3JYPA 5AOVA 2D74A 5FADA 1QX3A 3OOYA 3H2HA 3T41A 4BVGA 4CL2A 1I6WA 3AEXA 3OFNA 3ELUA 2H1HA 2PYZA 3AKEA 1S2GA 3HUUA 4GT1A 1PK8A 5A62A 5FBWB 3I1YA 5EPEA 4XWWA 5K6TA 5ECDA 2FB9A 3ZCPA 1UPFA 2BBSA 5REQB 4ZK2A 4RA6B 1ORTA 2LTAA 5E1DA 4NOLA 1JKMA 3L9XA 3OE5A 4Y1RA 2BV3A 3VX4A 1CNEA 4RVDA 1DRWA 1MGPA 3BGOS 2B1IA 3CZ9A 3PNOA 2RC6A 4MPRA 3KLBA 2C20A 1KE1A 4D57A 5CNJA 4ZI7F 4ZZ3A 1ZSYA 2GCNA 5KX5F 4DIDA 4WXEA 2X5KO 3N8NA 4LYJA 5L7YA 4KW7A 1ESEA 4C0KA 4YYZA 4KNYA 3RUEA 4MUYA 1A97A 4GE0A 4Z3KA 1ULUA 2BELA 1GZVA 2CJWA 4MQLA 4NDAA 5HKLA 3WGKA 3U6BA 2BWJA 2I2CA 2PRKA 4JOQA 3SP1A 3FVWA 3C4VA 3ED5A 1BMFD 1ZL0A 4FBGA 1P0MA 2WEKA 4Q24A 5LZ5A 5LUBA 1F6DA 3FCYA 1YMQA 4HFJA 1J25A 2ZE7A 2VO1A 2I6GA 4P3XA 4YUZA 1QPGA 3IUEA 1H2FA 3RAEC 1YF3A 1JHMA 1UMKA 1OIWA 2IX3A 1Y9EA 2W6IA 2XWQA 3A1UA 4DMUB 1BO6A 3RIMA 3H5LA 1UJ4A 4MV8A 1SU8A 4NL4H 3GXOA 2EKBA 3WJ1A 4IJVA 4M1QA 3PXEA 3D6MA 5DM2A 5EJ2A 2BFMA 4EYOA 3O8DA 2VPPA 4DZRA 4GSKA 5CBPB 3KR2A 4RC9A 2NU8A 1DWPA 1NXVA 3TVTA 5LU9A 4LDQA 3WB1A 3TI9A 3FRJA 4IQ0A 3NC1C 3DO6A 2YCBA 4DQVA 4UAUA 2JA2A 2CT8A 2WJPA 2BMFA 1BMFA 1XTTA 2F1RA 1TUBA 2QI9F 2QTGA 2XMZA 4P98A 2G09A 4HKTA 2ZZKA 2Z30A 1V41E 5EP3A 3V4LA 4YHHB 1JG1A 4NMLA 4V3CA 3S2SA 1EKXA 4U3JB 1VI5A 2QE7A 4EECA 2Y76A 2AN1A 1EP2B 3WGZA 2K4MA 4ALLA 4XTRA 1H4QA 1NUPA 1A9PA 1NNI1 1JJBA 2PT7A 3CX7A 2UUOA 5HILA 5JR3A 2YVLA 2ZVPX 3L1VA 4MP8A 1LTHR 4WJZA 4NBNA 3OTGA 5ALNA 3WFZA 5G53C 2GZAA 3HDHA 2YWRA 1YUBA 4CL3A 5IVHA 3ESZA 3QPWA 1GUDA 2D5AA 1YJ8A 2CJPA 2N1BA 2PGAA 1VCIA 2VJMA 4ILKA 4KTVE 4DWWA 5H8WA 3Q88A 4ABYA 3PNMA 2QEQA 1H2XA 3DZHA 2R44A 1FDTA 3UMVA 4CQJA 5FUQA 3PYMA 1VA5A 4MV3A 1GL3A 4YY3B 4LOJA 4PRKA 2ZUDA 4IQFA 3NZEA 4M53A 3ZU5A 1WETA 2HGSA 3MLBA 4PPGA 1IBLB 4DREA 3IBFA 4IIJB 2Q5EA 1O1YA 4I66A 1R8YA 5J47A 1C7IA 3PD1A 3LUDA 3WNQA 4B2PA 3KV1A 1YDGA 1V8ZA 3DUFA 1DBQA 2GA9A 2MMGA 1KI6B 2CC2A 2W8ZA 4DC1A 3GJTA 3QFFA 5JI2E 3BWBA 3F2IA 1J22A 1GSOA 2BSXA 4B4VA 2XNCA 1MVOA 1OXMA 3LU1A 1EEHA 4Q1DA 5ED4A 3U60B 2V6GA 2X6RA 1SXQA 1OI2A 3IEKA 2V65A 4IWYA 1DCFA 3KQKA 1MXHA 4LJ6A 2B1RA 2G5CA 1N1GA 2B7LA 2W4QA 1QK5A 4EJ6A 5HDBB 2XT6A 2PX6A 4OHBA 4BRSA 4DDWA 2JFGA 2O3SA 2VWHA 1AGXA 1LW7A 4GMGA 5E9AA 3SJUA 4TYYA 4H18A 2YFHA 3GT3A 1J0EA 5DPMA 1XCOA 2UXDB 3PFWO 1RJFA 2ZRLA 4GYYA 2G5TA 2XDWA 4NE9A 3NB0A 2ZRDA 3KTAB 3FB4A 2V0NA 3H75A 4A0GA 3HB5X 1NW9B 2ZUCA 4RF5A 1R6TA 3CRQA 4BTLA 4AKHA 4ZQIA 2BKAA 1EM6A 3HB0A 4OJKA 3GNSA 2ZXEA 2FGJA 2QIOA 1S4MA 2CWDA 1DTWB 1LDEA 1ECLA 2PN1A 2WKQA 3KYDA 3R41A 1Y6RA 2HNAA 3LVQE 1CUJA 1N2IA 1ZGZA 4AJKA 4AUEA 2BM8A 3VKHA 4L9RA 3ABQB 2UZ1B 1RMQA 3L8GA 1Z15A 1NXTA 3DKRA 1G5TA 2MSLA 2R5FA 3HCDA 3RG2A 4AP9A 2NOAA 1VE6A 1A2KC 1D4OA 4LUCA 1TEHA 2N9UA 3OPQA 4HEHA 1JBEA 2AN5A 1SVIA 3T7TA 5KUTA 4M0DA 5J2TB 3BWDD 4TL7A 3DEKA 4AK9A 4K87A 2PKQO 3L6CA 3TD6A 1MRNA 1U81A 1VQ1A 2B21A 2B61A 1F0NA 3ASYA 1V47A 4HN9A 4O1IA 3HO6A 4GSLA 3GEIA 4RO0A 1JA1A 3BA1A 4I3HA 3FMIA 1HEYA 4MDEA 1K7EB 1CZNA 1Z3CA 3HABA 5AKIA 3NDRA 4O33A 4EI7A 2FWJA 1YCHA 2ZT8A 5ES4B 3E4CA 2CXHA 1WVGA 4CU5A 2B92A 4FUQA 3H9QA 3PZRA 1YZVA 2ODTX 2Q1UA 3R5HA 1XNRB 3BX1A 3R6WA 1FLAA 1ZU5A 1XJCA 3G0IA 1HDYA 3QVOA 3E2MA 3KQOA 4YAUA 4IH9A 3MOGA 3TWOA 2IVZA 3O1JC 4YMIA 3Q1LA 3E7DA 4EJMA 4B8WA 1ILWA 1K5PA 5KX5A 5MFPA 2B98A 2IPMA 4S2UA 1FFXB 3A28A 5CNKA 5K0LA 4QQKA 3VVCA 1LPMA 1OI4A 4ZHQA 1Y6FA 1T1EA 5ELXA 3HZZA 1QDUA 4CN8A 1KORA 4L95C 1DJQA 1FFWA 3TJZA 1FMLA 2XZPA 1YE8A 4PZAA 1VL8A 1IUNA 3DL0A 3M6IA 1K1EA 4D9CA 1YIAA 3D2BA 1F06A 5HF8A 3ZVLA 2Y93A 3EVFA 4RM3A 4JLAA 2IH4A 1FUIA 1PGOA 3WKBA 2XQGA 1XAJA 4Y2XA 1M7HA 4HGYA 2KB0A 2ONKA 1BVRA 2VSYA 5KQPA 5LQNA 3N3AC 2FJ0A 5HUQA 1AZWA 1E63A 3OEHA 3LWDA 2CY0A 2YBEA 3QFCA 1VPEA 4S04A 4Q66C 1FDRA 3F6PA 4HDKA 1U63A 4CNBA 2GJ9A 1K8YB 3BD7A 4HNSA 1IHUA 2Q3DA 3E58A 2DFKB 5AJWA 2QAGC 4NV1A 2JFYA 3CGWA 3O82A 4CV1A 4N3BA 1JEYB 4GI1A 2E6KA 4MVJM 1ZICA 4C20A 1VB3A 1A96A 1ENPA 2WU8A 4UQPA 3WGLA 1AGPA 4J9UE 4FDUA 2RGEA 2YJ6A 5ALJA 3RT9A 4JN6B 5ADVA 1CVIA 4EH1A 1ZK1A 4F2HA 1IM8A 1QMHA 5I7AA 5HTKA 1DQRA 1MG5A 1TFRA 2RAVA 2EJVA 1E4VA 1YDFA 4N1AA 4LRWA 4TLDA 3U3ZA 2OCAA 4HEA6 4EJSA 5DCWA 2GZRA 4TLLB 1RI4A 3ZWCA 2SCUA 1VKZA 4NYJR 4E51A 1TZBA 1GVHA 1OX4B 2I03A 1DC4A 1NVVQ 5IKMA 1I2DA 5ALYA 4CQMB 4F56A 3PIRA 1H2HA 1DB3A 5DW3A 5AKKA 1S8OA 1KK1A 1M1YB 2C8KA 4MYDA 1F2TA 5PNTA 3IP1A 5KCZA 1PL0A 1W1WA 3T3MB 5BNWA 3B60A 2GYWA 2XLCA 1GGFA 5A5FA 4ANFA 3EWAA 1ATZA 4HRVA 4ZAGA 4AIIA 1DKNA 1UQRA 2IYOA 4P33A 5KPDA 4AICA 3ORQA 4YDRA 3EGCA 4FGKA 4D80A 1RQ7A 2GN6A 5BWNA 1K3UB 2PKRA 2W93A 3MF4A 1F5NA 4HY3A 2IU0A 3SDZA 2KYRA 4KQ6A 5IJAA 4BZPA 3AVWA 4IEIA 1A5TA 5CDYA 1L4FA 4L16A 2RGCA 1HNNA 1EQ2A 3K9FC 3AVQA 3ETCA 2HQ1A 5IXSA 2POQX 2ZWIA 3LX5A 1KI6A 4MUNA 5G40A 1JIVA 1XYGA 3N58A 3L4EA 3MJFA 3IOBA 1FUYB 2QQFA 1M2KA 1E0SA 1V3VA 2YS6A 3B89A 2ZVJA 4FKZA 4YRPA 1CY7A 2XMDA 4KLRA 4TLCA 4YK7A 1I10A 2L42A 2UZ0A 1HZZA 2PZJA 2HUNA 2QD2A 1QTIA 3H42B 1TK9A 5J3JA 1WZEA 4EX6A 3AXSA 4FZ3A 2G3YA 2ZANA 1MJGA 2D00A 4PEVA 4YRRA 4QDKA 1N6IA 1IPEA 2PU7A 3PX3A 4PAMA 2PUEA 1OX4A 5EIFA 3GBVA 4PBSA 1WQ1R 2ZB4A 4AK1A 4IUBS 1XPJA 3EFBA 2V0CA 1FSFA 1ZC3A 1S2NA 3PQCA 3PT5A 3IT1A 4I08A 2P4HX 1T2DA 4DA0A 3IMGA 1JDSA 4C0JA 4MRAA 1U1GA 3LOUA 2EFDB 1VSBA 3C16C 2D2EA 3LUPA 4E1AA 1HQDA 5H0IA 1XQ1A 2OV4A 1YQQA 3N87A 4PO8A 5E3JA 2HO5A 1WMSA 3H05A 1MC5A 3D6HA 3KT8A 5GOZA 3HCBA 1RYMA 1SKUA 4QPCA 3H5VA 3E9MA 2ZDHA 3TQSA 1J8MF 1TUBB 1OFUA 3VO2A 2O2JA 3O1LA 2CK3D 3VSAA 1PEDA 5HZHA 2A7XA 1XZPA 1M8GA 4LZLA 5CFRA 5KNCD 1SUEA 5BRNA 4R7GA 5T4FA 4AULA 2ODEA 3ESRA 1E7WA 2CNDA 4KNWA 1ZHOA 5D84A 4YRSA 1KVSA 3BF8A 3Q3EA 4YCBA 4QSHA 4ZQFA 4D3DA 1O6BA 3IQZA 2B2XA 4K3VA 1CB0A 4M1WA 3UT6A 3X1YA 5CFMA 3IAS1 2FV8A 3W5DA 3K9LA 2I71A 2VF5X 3DCNA 4HI0E 5HPYB 1QH8B 3IQDB 4YV7A 1UC9A 1P3JA 1IAQA 2OHHA 3KQSA 1P1JA 1OXKB 2ZTSA 1HTBA 4XEHA 4UNIA 2X9QA 3F98A 5C52B 3LQRA 1SA0B 3FRHA 4BYGA 4QQFA 1VBFA 2LRHA 3OCXA 5BYKA 2QNBA 1A0OA 1ODSA 4TTVA 3X3HA 1LPSA 2HHAA 4JJKA 2ENUA 3M1AA 4WCFA 1M7BA 4WOKA 3WWYA 1Q1AA 3OP4A 5KJ1A 3OIDA 4FFWA 1J21A 2Q27A 1U8FO 1X1RA 4RETA 1PL6A 2BP7B 2A0YA 2P2CA 2O23A 2P5UA 1OX6A 3DKKA 4E13A 1E0AA 3ND5A 2O4UX 2OV3A 1PYGA 2QYSA 3IV9A 2NXCA 5GV7A 3MCUA 4MWOA 5FXMA 2G88A 4CFSA 1NA5A 5FWDA 4P83A 4CKYA 1TJ4A 3E7XA 3MIIA 2OFOA 4I9GA 1YXMA 1G5RA 1KFCB 1MUUA 2JI9A 3FTQA 2DQYA 3AFGA 3OZFA 4N39A 1BCSB 3V3TA 1EFVB 3FNFA 2JLVA 4HQ0A 2XYRA 4RPJA 4B3CA 1OF1A 2JGDA 4WZAE 1PVVA 4GQBA 2WWIA 1SBYA 3RABA 2ZG6A 2XUDA 1XDGA 3OIWA 2WD7B 8LDHA 1FDIA 3C98A 3LBNA 2HYDA 4HDKB 5EIWA 1B8VA 4LMAA 1GHTA 1YVDA 4CEIA 1YGPA 4GYKA 4UEWA 1ZEJA 4FMDB 4OCZA 5EGSA 1G8GA 2CFTA 2WF6A 2X40A 1GNVA 3DLAA 4BVLA 5I7WA 5BYBA 5LP6F 4QFCA 4PRZA 3REQA 5DZSA 3GIWA 1UF9A 2O8EB 2I6QA 2EG5A 3DVSX 4OX9Y 5FFFA 1AO0A 4B6QA 3VJKA 5EKDA 3EVCA 4A3SA 5TLSA 1M1UA 2AUMA 3QW4B 4HNVA 4KR7A 3AOEC 2C4TA 4B4DA 2GK3A 4RIIA 3OEYA 1XTPA 3R7BA 2EJWA 1Q14A 1XPUA 3CNEA 2MSCB 3MMPA 3TQIA 1HG1A 3M83A 4FFLA 1CJMA 3CVJA 5LMUB 1Y34E 3CLUC 3NC4A 4MS4B 1AQLA 3MXTA 1VG8A 3NAZA 3OICA 4AUNA 3WRXC 2IEGA 2Q6OA 5BY2A 3U7GA 4BB0A 3BYZA 3OPMA 2QUJA 1F9EA 2CL6X 2QAGA 4R16A 2DR0A 4DLVA 3G5MA 1T36A 1YB7A 3B7PA 3Q41A 1OFGA 1VHQA 5DNAA 3RT1A 4RK6A 3NTQA 5AKGA 1FU7A 1BAPA 3CKKA 3Q3CA 2A30A 1D1QA 1PIWA 3ZD9A 1CG6A 1I1HA 1NHWA 1VL5A 2XOKA 1QORA 3QA9A 4PLFA 3S55A 1CUEA 2QROA 1JQEA 3QLUA 4IGAA 4PHHA 1EAYA 2CXOA 5C1IA 5FPYA 1Z5GA 5AVWA 5L3SA 4RAQA 2YXEA 1B2LA 2CHUA 1MP0A 3TOVA 5IJWA 1C0IA 2CCJA 1HE8B 4HSGA 3VR6A 1KHTA 1GZ7A 3SYKA 4JOSA 2JGAA 1U3CA 3O0TA 3EB9A 3O8NA 1GT6A 1WCIB 2XJ4A 1YZ3A 4BFCA 2NX2A 2V59A 4FEYA 1RC1A 1YUNA 4GU5A 3VO1A 3QX9A 1BXKA 1LI7A 3KU4A 3EXG2 3ZHUA 5JW6A 1XTRA 1PR6A 2VN8A 2R97A 2PZFA 3GZ4A 5EMNA 5BSHA 1XU9A 3OLYA 4Q3OA 3EDYA 2Q5CA 3AUYA 3OJFA 5K3DA 2D1TA 5FA8A 3H8SA 3FYUB 3VR0A 1K4KA 1YB2A 1Q84A 3FPKA 3TZHA 3H0EA 1EXMA 1CUFA 4Q47A 8ATCA 2A92A 4ZTZB 2NYRA 3QXXA 4LMBA 3D64A 2QTFA 4G01B 4PICA 2C59A 1IOLA 5KPJA 2ZWPA 3LAWA 2IS4A 3DT9A 3IS3A 3QVMA 4O4HB 1N0WA 4CM4A 2W8BB 4PFQA 2AFHA 4RANA 3FR8A 2P0YA 4IWXA 3F7NA 1VC2A 2GFHA 3K5WA 4IMJB 5C81A 5I9LA 3KV3O 4LDRA 2B1QA 2GEBA 3KTFA 3X1DA 4D0LB 4B5LA 4CODB 1AKNA 2QLLA 3THYB 1H5NA 2R6DA 2KBFA 4K9LA 4NDNE 5JD6A 5TJHA 1MHPA 1BE1A 3EQZA 1M6NA 4FOTA 4F6CA 4LZWA 4LZJA 4ZVMA 3WLSA 1XROA 1YC2A 2VDUE 2WKSA 4RF2A 1V8OA 4YP0A 1T4DA 3BK7A 1FXSA 3PLAE 1Z4PX 1L3BA 1AKRA 1DAIA 1ZNYA 3L6OO 2PUWA 3FGZA 1GG8A 1P5ZB 1V39A 2JGIA 3FE2A 4OP2A 5DGDA 4KX5A 1VLVA 4UAGA 2QZZA 4G85A 1ETHA 1SC3A 3NU1A 3ETGA 4GPBA 1JSLA 1T8RA 3ACDA 5FWNA 4ZC8A 3ZXIA 3KU1A 1RBQA 3QV2A 2PBZA 3AP3A 1J4AA 1F5SA 3AVVA 1MO3A 1F1BA 4G4IA 5JCXA 2HWYA 3KAKA 3H0VB 4QICA 8ADHA 3H11A 1WXIA 1U0SY 1ECFA 1H3FA 1XVIA 1B8NA 4IKPA 5AHXA 3NDPA 4OH1A 1YFLA 2FUKA 3V1TC 4BZQA 1VLZA 5ECYA 3B6EA 4D0SA 4MVJD 4HQKA 4J2OA 3DJYA 3JQFA 1UIRA 1T9HA 3CF4G 2VAXA 3HBAA 1RYHA 3WSVA 4BMSA 1T9AA 4JA0A 1PJAA 1KPIA 4PXYA 1ZCJA 3HV2A 4GL4A 4LVNA 4BNDB 4RAOA 2WYUA 4MQUA 1WEKA 3RS3A 4F0JA 1JQ3A 1Z4JA 5TGDA 4X54A 2Y4OA 3LSTA 4E12A 3QEMA 2B8TA 3N2ZB 2JIBA 3G5UA 5DM0A 2IYUA 4HUTA 2PSSA 5IRCD 4X61A 3LTNC 4W5TA 1BCSA 6GPBA 1ZD1A 4RK0A 4UHDA 4B76A 4WACA 1SXGA 2GF0A 1BXGB 1YMVA 3V2HA 2D5IA 2FEKA 3I8XA 4HFRA 4X97A 4KIFA 1I6LA 3QOXA 3GY0A 4YJGB 1H4VB 2ZT7A 4Z53A 4EY7A 1K66A 3I09A 4I46A 1GTVA 2HJ9A 4D3SA 3WMGA 1DQNA 1X80B 5B1SA 4PG4A 1X2EA 2ONYA 2P4UA 4WRRA 5AXBA 1X14A 5T67A 3VR2A 5HIAA 5JMOA 3MIZA 3KUKA 3BFJA 3SGLA 5DW0A 1SCUB 3LTEA 5CDFE 2X77A 1YD7A 3SZOA 2AFIA 3IP6A 5KTYA 3TQRA 3VO9A 1BG6A 4ZYUA 3C97A 3IR7A 2HT6A 4WNIA 1TADA 2QGFA 3G7UA 2V3VA 2KPOA 4JLUA