3ZCXA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
total genus 116
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zcxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zcxA01
2C7GA 1GY8A 2E49A 1PZFA 4RV9A 4R5HA 4J4HA 4I9NA 4N5LA 4CLXA 3E18A 4LK3A 3I9JA 1FF9A 1B2LA 2Y68A 5IDWA 1VL6A 3I9MA 1DB3A 3WR5A 1XU9A 1Y8RA 1YQXA 3ZWBA 1A7KA 2Q2WA 6LDHA 1W0CA 4D7AA 3W6UA 3U4DA 4QEDA 3QA9A 1XU7A 5IZCC 4N5MA 2I99A 3W4KA 1BSVA 5LC1A 3KYBA 3HFGA 5F1KA 4I5FA 4IDAA 4NDNE 3DMYA 1SOWA 2JCVA 5CPBA 2ET6A 2X58A 2Q50A 4ZU3A 4A7PA 4CLRB 1TT7A 2FSVA 3WGGA 4HUJA 4J2OA 4ND4A 5JSFA 4CLEA 2H63A 1TXGA 5JC8A 3IOYA 4EUHA 1E3EA 3WQQA 1B26A 2Q1TA 4EEXA 3AOEC 1DBVO 4CMCA 4TRRA 5GZ6A 4M8SA 1ENOA 4GGPA 4ALNA 2NQTA 1RM0A 3I6QA 3Q6IA 4UUPA 2VZ0A 1R6DA 2X5OA 4EBFA 2IE0A 4WLOA 4NNJA 5L40A 5ICMA 2DU8A 4M49A 4INAA 4M1QA 4YJFA 4K6FA 4B4OA 1GEEA 1UR5A 1YVEI 1KC3A 2GF2A 2YJZA 3JQ9C 4AJLA 1P31A 1J4AA 2H5LA 3V1TC 5JPIA 1ZH8A 3AFNA 1R12A 1MUUA 1MXFA 3PHIA 4ZICA 1E1LA 1O8CA 5DBGA 4R1NA 4GSKA 2Q49A 4DVJA 5DT9A 3ICPA 4U0JA 3GQVA 3I9OA 3I5MA 1N7GA 4AG3A 3KETA 3DZBA 1IZ0A 4E12A 4AJOA 1U3UA 1GCOA 4WCDA 3MJSA 5T8KA 4CMEC 1HE3A 3LSYA 4E2XA 2FY8A 1DC6A 2AEMA 3I4FA 1VKNA 3PEFA 2NU8A 2O3RA 2NU7A 3E5RA 4OHUA 5A9RA 2V6GA 1YB4A 2NVUA 2O4CA 4HBGA 1U9JA 3K2EA 3BMOA 3A9WA 4E5NA 2X8LA 4U6QA 4DIFA 3GC6A 7ADHA 3ZU4A 1GYRA 5ILGA 3FN4A 1I3LA 4DPLA 1I3MA 2GZ2A 4KDFA 1G1AA 4FS3A 2CFCA 2JFFA 3PHHA 4FC6A 4HX5A 4IDFA 4TMFA 4JGBA 1XSEA 3KYCA 1U2GA 2UDPA 3ZV3A 3K6JA 4OOFA 1U1IA 3WLEA 5EJ2A 3NGXA 2ZCVA 3MZ0A 3WTBA 4KDEA 2PY6A 1C3VA 2CY0A 3PYMA 1MB4A 3DL2A 2Z5LA 4NFSA 5J23A 3EC7A 4PLCA 5L53A 2GO1A 3JD4A 1NPTO 3FPLA 2PK3A 2C54A 5KVCA 4Z6KA 3DBHA 1JDJA 3M6IA 4ALJA 1LSJA 3H3JA 1EFLA 1Y9AA 1JA9A 2VWHA 3F5QA 4RVUA 5ER9A 1YB5A 3DBRB 4MP6A 5DBFA 1KVRA 4NG5A 1O89A 2QRJA 4BVAA 1UAGA 3KYDA 3NJ8A 1H6BA 3JQAB 4DTIA 2YFQA 1BW9B 2O2YA 1GADO 3FBTA 4F45A 5IZ4A 1I33A 3LC2O 1NQOA 4J1SA 4IUYA 1F06A 3NV9A 3JCZA 4EDFA 1GUZA 2A9FA 2BELA 2W4QA 3CH6A 4YT2A 1I24A 4KQXA 4UEOA 2W90A 3M1AA 1ISJA 3WFJA 3ANLA 3KSUA 4WKGA 5DNAA 5BR7A 3G17A 4GVXA 2C59A 3CZRA 1EVYA 3VZQA 5K0ZA 1LBEA 4TVBA 2Y1EA 3DWFA 3IKVA 3OJLA 4XDZA 3F6YA 1EQUA 2HLPA 1H9BA 1W8DA 3IP3A 2FR1A 4P4NA 2J5RA 5HWSA 1ENPA 1PGJA 4NBUA 4A03A 4QFDA 4B3IA 5C3MA 3BXXA 4NBRA 3JSAA 3D7LA 2Q2VA 3FSRA 3OP4A 4J43A 4HADA 3IP1A 3F3SA 3ETEA 3GZ4A 4RCVA 5TS3A 4J7UA 2Z95A 4G81A 4R01A 3S2GA 2OZPA 1EBFA 1VPDA 1XQ1A 4IZHA 1XELA 1HSZA 4B4WA 1SZJG 1Z74A 2FOIA 4CMIB 2Y1OA 4G5HA 3OSUA 5L4NA 1HYHA 3EZLA 3DMTA 1UZNA 4ZJUA 4OGWA 5F3RA 3QWHA 5B4UA 1T24A 1I0ZA 4EW6A 2IZZA 3RBZA 5EESA 4KQWA 2Y0EA 4XJTA 3RUFA 1ZMTA 4OSOA 4TQGA 2X9NA 4MIEA 2ZCUA 3CMMA 3I23A 2O3QA 4NIMA 3WXBA 1U7TA 1Y8QA 1ZXBA 2VTEA 4WCFB 4DL9A 4Q3NA 1E7QA 3RU7A 1DAPA 1HWYA 2EKLA 1HSOA 2V6BA 3AM3A 5C7LO 2WM3A 3DBVO 4YQYA 2CUKA 1LRKA 2HQ1A 2W8ZA 3E6AA 3CIFA 3QWAA 3GPIA 4JLWA 2TMDA 1FXSA 1ONNA 2C20A 1A72A 2I6TA 1YONA 1NR7A 3LLVA 4J3FA 5JCJA 4WNCA 1TLTA 1PGPA 4CV2A 2E48A 2PZLA 4OKNA 1DDOA 1QYDA 4JXKA 4E5PA 2QZ9A 1WP4A 4TWRA 3EGOA 4ZVVA 3NGLA 1GL3A 1ZXLA 1V3UA 2WYWA 3ZU2A 4EZBA 4PZCA 4DIOA 4XA8A 4YJHA 4OXNA 4CMAA 5T57A 2PGLA 2ZTLA 4HP8A 5MGBA 2O3UA 4DXHA 1IB6A 1M76A 3F4BA 1JAXA 4WASA 1H5QA 2I65A 3HUDA 1GQYA 1PWXA 3ONEA 2PLAA 1ULSA 3NRCA 3ZHBA 1A27A 1CF2O 3WMWA 1P33A 3S2IA 4IGEA 1HTBA 3WTCA 3WYBA 5IG2A 3U4HA 3HDJA 1C1DA 3R3JA 2FPPA 5LDHA 5COQA 1YB1A 3GVHA 4CLOB 1LLQA 5HA5A 3DHYA 4GX2A 5T5QA 1BTOA 4IQ8A 4KOAA 1B7GO 1H6CA 1EE9A 1N1EA 2J3HA 5KJ1A 1UXJA 1HDZA 4YJDA 1PWZA 4CV0A 3L6DA 4XD2A 4QUKA 4M86A 3DZHA 2JAHA 3FRJA 1JAYA 2CVOA 2C29D 2YW9A 2EW8A 1J6UA 2I9PA 5KCZA 2AQHA 1I3KA 2BGLA 2GNAA 3KB6A 4MP3A 1U28A 1LC0A 1SPXA 5KTKA 5IFLA 4J9VA 4E5YA 2BI8A 3GVCA 5G0WA 4YAKA 3CMCO 1DHTA 2CZCA 3ETGA 3AY6A 1E3WB 2VN8A 4X54A 3HADA 2NTVA 2PD3A 2DC1A 4YR9A 2PKQO 5L51A 1GZ3A 4GL4A 1YBVA 1ZBQA 3WWZA 2P9EA 5KJCA 3CUKA 4CLRA 4RGBA 1UXHA 2R6JA 5DBIA 1NQ5A 2NADA 3QP9A 4YRAA 1GQ2A 3QHAA 3DR3A 3GUYA 1PJ3A 2OGUA 5IN5A 3BTUA 4BNHA 4MVJA 3DZFA 3H6KA 3QWBA 4IMRA 4L4XA 4LMRA 4UREA 4DLBA 4JN6B 2J8ZA 4F3YA 2HK8A 2PH3A 4H15A 2ZIZA 4DQUA 2VYND 2BD0A 2H1SA 1A7AA 1MC5A 4ESOA 3IC5A 3VDRA 4WK6A 2PFGA 3UAGA 4BKPA 1BGVA 1GYPA 1PJ4A 4ZGWA 2I66A 2TMGA 3JQ6A 2GDZA 3COSA 3DZKA 4CM6A 4CUZA 4ROSA 2NLOA 4JIGA 2Q1UA 4I5EA 2EP7A 1EE2A 1SC6A 4OM8A 3WJ7A 1X14A 3T7CA 5T64A 5MDHA 1E5LA 1O95A 2GYYA 1H2HA 1BWSA 1N9GB 4E3ZA 3DOJA 3U4CA 2YQ4A 3LK7A 3TOZA 3HN2A 4D0RA 3RSHA 2NTNA 2ZTVA 1Z6ZA 2HMWA 2QQ5A 4DUPA 3Q3CA 4E31A 4ND5A 5IXYA 2PWZA 3D4OA 1TA4A 3CSDA 1WMBA 4IDGA 3X2FA 4RL6A 2ZATA 1D8AA 2ZQZA 3HB4X 4YA6A 3VHRA 1JVSA 3GPDG 3SEFA 4CPDA 4BL5A 4XJSA 1BXGB 2FMUA 4U6SA 3PJDA 2GD1O 3AWDA 2H9IA 4PLTA 3RJ9A 3TN7A 1V35A 2V65A 5BSHA 5ER6A 5CAEA 3ZZNA 3NKLA 2EHDA 1GAEO 3ASUA 4ZQFA 2OUIA 1HDOA 5I7VA 1Z7BA 2DT5A 1X7GA 4DREA 1R66A 2Q4BA 1JWBB 1LSSA 1LDBA 5H81A 1XDWA 4XB2A 1R0LA 1BG6A 5TQVA 4IDBA 1Y7TA 1PS8A 2VCYA 3GEGA 3TDKA 4UUMA 1G6KA 1GEGA 4TZTA 2POQX 2UUPA 3DXFA 1NXQA 3JQEA 3PIDA 3PQDA 2YYYA 4ZQHA 4BMSA 4CLDA 3INTA 2VRCA 5JY1A 5U1PA 4O1MA 4FR5A 1T1SA 1OFGA 3U9LA 4CMBA 3DHNA 2G1UA 3DBLB 5DOZA 3RC9A 1EQ2A 3TQHA 5GZ3A 1VKOA 2PV7A 3EZYA 3FNHA 3SJ7A 1A4IA 1PS9A 3BMNB 3Q9NA 4AJIA 2WTBA 4CV1A 4GAEA 4BV9A 3D4NA 4IMPA 4YQZA 2C0CA 2EGGA 3RKRA 5EINA 2A94A 2OHXA 1IYZA 3DBRA 3RBXA 3WNQA 1LU9A 4EI2A 3PQEA 4LMPA 2LDBA 1YBAA 2IYOA 3JQAA 1FDVA 1BW9A 1K5HA 4IBOA 4RPJA 4CQMD 1NFQA 3BTSA 4LVUA 5KNLA 3GHHA 2BGMA 5IN4A 3DOCA 2C82A 1M67A 1DC3A 2CNBA 5FI5A 4CM8B 1X7HA 2PKQP 4RF4A 3GZNB 4FN4A 3ENKA 1JW9B 3WGTA 3R0IA 1W6UA 3E8XA 3C1AA 2VHVA 4JNKA 2O7SA 1VSVA 4EUFA 1I2BA 3GAZA 4B7XA 4W7IA 3ROPA 1UXGA 5ICSA 2VYVD 4MVJD 3GN2A 4E4YA 2XOXA 4CODB 2X9GA 1C0IA 3ZWPA 1EUZA 3UKOA 2AG8A 5C37A 4JCOA 3ZCXA 2YDYA 5IJZA 3AOGA 2O2SA 4NMHA 4KZPA 5LCXA 2WD7B 1WXDA 1A71A 4KWIA 3GR6A 4NI5A 1HF3A 1AHIA 1DPGA 1ZW1A 4KUGA 4F6CA 4R41A 1NHGA 2PGJA 3NYWA 2YFHA 5CG2A 4CMIA 1MC4A 2CVQA 1FJHA 3K5PA 4DMLA 1DJQA 4FD3A 2Q1SA 4L0QA 4WECA 4BB5A 3NJ4A 1E7MA 3H9QA 4PLZA 4BNFA 3ZWOA 3NT2A 1XA0A 2BGKA 2JD0A 2ZJ1A 3M1LA 3WMXA 1B8VA 3AUUA 4XQCA 5T8KC 1GV1A 2OFPA 5FYDA 4B7CA 1U2DA 1NVTA 3HDYA 1ZEJA 3JYLA 4CM5A 4RJTA 3GDOA 1E92A 2OP0A 1LJ8A 3WFIA 4Z3DA 2VOJA 4YCAA 4WCFA 2FZWA 2GCGA 3KSZO 4MVJI 3DQPA 4D45A 3RWBA 4CM3A 4P22A 1AE1A 3RBVA 1ISFA 1G0OA 2GZ1A 1HDCA 1TT5B 4YRDA 3IKTA 3FPCA 3RKUA 3A06A 2A92A 1NP3A 4O5OA 1M75A 4D43A 3OJFA 3SVTA 2JD2A 3OIGA 5DP1A 1R37A 3GK3A 4PG6A 4Z0HO 4J0EA 3DTYA 4H3VA 3U0BA 3NTOA 4Z9YA 4FDAA 1Y5MA 1PS0A 1I3NA 1ZO8A 3EYWA 3F1KA 4CM9A 5HM8A 4U5QA 2W2KB 1E7SA 4WLEA 1NHWA 1UP6A 2BI7A 4D3FA 4S3MA 4XB1A 1XHLA 3KM0A 5CDTA 1LDNA 4R68A 5GMOA 1HT0A 2P2SA 2VZ9A 3GGGA 2Z1MA 3L4BC 4CM4B 2HJSA 1UDCA 3AJRA 2VRCD 2Z1NA 1BHSA 1N2SA 3PVZA 4YT8A 3H3FA 4OL9A 3ZU3A 3ZWYA 3OA0A 3K31A 3VZRA 1BRMA 4A26A 3K2BA 2IEBA 2CD9A 1CIVA 4FQ8A 3S8MA 3VPSA 5L7YA 1ZVMA 4J16A 4CLOA 2HRZA 2WYVA 3INGA 1JWAB 4FOSA 4K28A 2Y99A 3VH4A 4YAJA 4PIVA 4TROA 3ZWXA 4ALLA 1SBYA 2I3AA 4IS2A 4IZIA 4A2CA 2PA3A 1B0AA 3O26A 2F1KA 3VVBA 5T6BA 3RUDA 3GUCA 2VUTA 3JQAD 1Z45A 4NPCA 3S55A 1YQGA 5EN4A 5JAZA 1BMDA 2RCYA 3L0DA 2VWGA 3T4EA 1PL7A 4Q3DA 3H9UA 3ZH2A 4OSPA 4ID9A 2CF6A 5A02A 3MCVA 3RQSA 1U4OA 5TC4A 4AJ4A 3W6ZA 3A14A 4R54A 1E3WA 2NU9A 4BGVA 3E9NA 1VSUA 3QW2A 3VPGA 5BQFA 3GDFA 1DAOA 3MWDB 2FR0A 2D59A 5A06A 4J2HA 1T25A 4OMUA 4BNUA 1I5RA 5BSGA 4QO8A 1UH5A 1DIGA 1NQTA 4L4RA 3W8DA 5JBIA 5I7SA 1ONPA 1E1KA 1GTMA 4CMHA 4QSMA 4E13A 4QQRA 4W82A 1YXMA 3QRWA 3WICA 1Y6JA 2ZKLA 2HUNA 4D41A 2AE1A 4AICA 4YBZA 2YY7A 3VPFA 4CV3A 1I8TA 1IUKA 3WSWA 1NTOA 3OH8A 1X15A 3KRTA 3JQ8B 4GKBA 4YEDA 1ML3A 5K6AA 3IUSA 1OZAA 3DMTC 4L74A 1EK5A 2VZ8A 3UW3A 4H16A 5BSFA 3ZW9A 3EVNA 3L9XA 1V0JA 3K92A 4PG5A 2EJVA 2QZZA 2X6TA 2Y05A 4M89A 2C5AA 4MKXA 3H9EO 3HG7A 4JROA 1YJ8A 2DTDA 3WBBA 4XIJA 4BHTA 4GX1A 1OC4A 4MO2A 2D8AA 1O0SA 2A4KA 3I52A 3VVCA 5JY6A 1BVUA 5JLAA 4BGUA 2Y1DA 2BFAA 3N74A 2P68A 3IAHA 3QWFA 1N9GA 5TLSA 3GNQA 1TB4A 3KOUA 3RU9A 4YACA 4BNJA 1IPFA 4LSWA 4ZRNA 3AUSA 3RAJA 2B83A 4NJMB 2AEJA 1UP4A 3ZWAA 3I83A 1NBOA 2DBQA 4CR7A 5BNTA 1CERA 4Z0PA 1P3DA 3C8MA 1BXGA 1NWHA 2PD4A 3GG9A 2OBNA 4D0SA 1ADGA 1V3TA 4LN1A 5EIOA 4CM9D 1PJSA 2RAFA 3C3XA 1NWCA 3B1JA 2VTDA 4GSLA 3ZHXA 4BMVA 1NPDA 4Z3KA 1E3IA 1DFIA 2XPCA 3L9WA 3PJFA 4RQUA 3OFSA 1GZ6A 1U3TA 3FWNA 3HQ4O 5GZ1A 3LT1A 3ONFA 1EFKA 3WSVA 1KERA 4W7HA 4B4UA 4LCJA 4ZA2A 4YDRA 3L4BA 1NNUA 3PFFA 4YPOA 4IIVA 2WMDA 3KXDA 2JCYA 1LC3A 1J0XO 1HRDA 1T2DA 1QYXA 2IZ0A 1FDWA 2VHZA 4BNNA 1WPQA 5CPFA 5DOVA 4DYDA 3R1IA 4M87A 4W9NA 2Q1WA 4OQZA 1R16A 2C2XA 4J0FA 4AJEA 4GBJA 3DBLA 3RC1A 4HXYA 4DPMA 1YH3A 3PFWO 5JYEA 2YDXA 1SO8A 2WE8A 4XYBA 3MJ4A 3BMNA 4YRBA 2UVDA 4RVDA 2ZYDA 1WNTA 3E82A 4EGFA 5CP8A 1MX3A 3IMFA 1E6EA 4AJNA 2C07A 1FDSA 3TZCA 5I8ZA 1ZUD1 3E03A 4TVOA 2DBRA 5CDSA 4R3NA 3GF4A 5KJEA 3HN7A 3ANNA 1C0LA 1PQPA 2JHFA 2PR2A 3H7AA 1DEHA 4UUOA 1WMAA 2DFVA 5DDIP 3P2OA 1UXKA 1PL8A 3DZIA 1Q1NA 1B16A 4CM8A 4RDIA 1YJQA 2NSDA 1D3AA 5GY7A 3S2FA 3GZNA 4HFNA 2GN8A 3I3OA 4BO4A 4FFLA 2B4RO 2B5VA 3C24A 3CINA 2DBZA 3VH3A 4A5OA 5M6DA 1D7OA 4IQGA 1KEUA 3FI9A 1B3RA 3ZWVA 5JAMA 3SXPA 1FK8A 4LVCA 5BSEA 1H94A 3NT5A 3C7DB 2CDBA 3ADPA 4DMMA 5HTOA 4JJIA 4TRJA 3ZNPA 2ZQYA 3KZVA 4RZHA 2GRAA 4JK3A 4KP7A 4U0KA 4GX5A 5CFZA 2EXXA 4RF5A 3Q1LA 1QKIA 1B14A 4DRYA 5B1YA 2WD7A 4W99A 1U7HA 1VLLA 4B7UA 3IQDB 1HDGO 4EUEA 3D1LA 4IPTA 1ZK1A 2NVBA 1YS4A 4FB5A 1MFZA 3GVXA 1E7YA 4E32A 4DIBA 5TIIA 4D3DA 4J90A 4BNLA 3KLPX 2ZK7A 3PHGA 2EG9A 5HBRA 3WBFA 3TZKA 5EQDA 1WDKA 3ZV4A 4NBVA 3RUCA 1HEUA 3BHMA 3MEQA 2ZYAA 2X0IA 1ID1A 1WWKA 3OA2A 3VAZA 2FPGA 3UVEA 1LDEA 3OQBA 1OAAA 2V7PA 4PLFA 3WGYA 3TNLA 4UULA 2C7VA 5A9TA 4D79A 3TZ6A 1KVSA 4BNGA 1YKFA 4J1QA 4Q3BA 3G1TA 3PJEA 3D0OA 3AY7A 4PVCA 1TT5A 3I9NA 3S2EA 3OIFA 1VI2A 4A73A 1OOEA 4Y6SA 3PQFA 1JLLA 3PRJA 1IE3A 1IULA 2PZJA 4XKJA 4XQ9A 3WS7A 4C7KA 1PJTA 2R2GA 3ITDA 1YL7A 2W2KA 2Y0CA 3OECA 1I36A 5JFOA 4XCVA 3KTDA 2I76A 1C0PA 4NFHA 3WQRA 5I9NA 2AMFA 2B4QA 2DPHA 4FGSA 4R1SA 3WGHA 1E3JA 4JP3A 2DUWA 1JQBA 3RUIA 5JYAA 1YDWA 5F1PA 5AYVA 3C7CB 1GDHA 4CM4A 3GFBA 1RKXA 4BV8A 4CLHA 2G0TA 1I01A 5CG1A 1K6JA 1L7EA 5I7FA 1ENZA 4A10A 4L76A 4WNIA 1RYEA 4GQAA 2Q2QA 3SBOA 1PJQA 4PLVA 4DLAA 4FFMA 2IODA 5DZSA 4C7JA 2CDCA 1PJLA 2PKRA 1R0KA 4I8XA 2UYYA 3QVXA 2DM6A 2FR8A 3GRKA 1KY4A 4BIIA 3P7MA 2PZMA 3WLFA 4OXKA 4P4GA 1HLDA 4F6LA 3W4IA 2E82A 1I30A 4GMFA 1SB8A 3A4VA 1LQTA 4RLSA 4BS9A 1A4UA 1Y5RA 3QLJA 3CZMA 1GQQA 1IZ9A 3TF5A 2B5WA 2IXAA 3KBOA 1NQAO 4RQTA 2P5YA 3UHAA 1ZSNA 3DAGA 4J49A 1VL0A 3M2TA 2B37A 4LGVA 3PLRA 2J5QA 2AE2A 4IJWA 4BO0A 4UVHA 1YL5A 3ZHYA 3FBGA 3NTQA 1ZJZA 2VOEA 4DYVA 1YO6A 2ZB3A 3UH1A 2QYTA 3UF0A 4BUCA 3FTPA 4HWKA 5CEJA 5BNFA 5T67A 3LVFO 2EP5A 3PHLA 4BKQA 3V5NA 2D4AA 1MFPA 1U8XX 4L9RA 4WUVA 3VZSA 4GWKA 1WVGA 3GEMA 1SMKA 3Q11A 3GN1A 2D1YA 2O3JA 1GD1O 4UEJA 3AUAA 2X23A 5TNXA 4YT5A 4PCVA 1CEQA 3BAZA 3HB5X 4MVJF 3OBBA 5JMPA 3DAFA 4Y9DA 4IDDA 3T4XA 3VC7A 1DXYA 1CDOA 1E7RA 4LISA 1P77A 3B1KA 1H6DA 5F1OA 2CVZA 4RVFA 4KWHA 4R16A 3EY4A 4LW8A 3G49A 2GASA 4XRGA 2GLXA 3JQ8A 3MOGA 5CDUA 1ZK4A 3FR8A 4JJGA 4PLGA 5TT1A 2JAPA 3T7EA 2JJYA 1DSSG 2CMDA 4NH4A 1SOVA 1YQDA 5K9ZA 1N5DA 4FPXA 4ZRMA 4E21A 1KEPA 1PSDA 4FC7A 4RPKA 1UJMA 2P9CA 2EF1A 1DOHA 3GH3A 4RPLA 2HMUA 4WCFC 3D4PA 2I3GA 3KSDO 4L8VA 4DC1A 2VHYA 1LEHA 4M55A 1GCUA 3ICCA 4GGOA 3UXYA 4YAGA 4R4JA 1E77A 1R0SA 4IS3A 2OOSA 3ITKA 4AFNA 2D5AA 4AJKA 4CJXA 1T1RA 1WDMA 4HY3A 4XX0A 5CDGA 5JCJD 5EQFA 3VTZA 5I8WA 2W98A 1OMOA 4KTTE 4NJMA 1KVTA 1Q0LA 4GWGA 2Q4EA 1PGQA 1IL0A 3H5RA 2QYSA 2WD8A 4Y8VA 3HSKA 4ZHSA 4JBHA 1XGKA 2JKVA 1VJ1A 1PL6A 2NACA 5TGDA 4XGKA 3B6ZA 1LRJA 5A4DA 1BXZA 1PR3A 3OQ6A 3EMKA 4XGIA 2IZ1A 1LSUA 4JBGA 3ZV6A 4XYLA 4R1TA 3C1OA 2R00A 3GAFA 3EVTA 3VOSA 2VHWA 3ENNA 3ONDA 4UVDA 3TL2A 2X0RA 3FNGA 4UAGA 1A5ZA 3K30A 4MP8A 3AI3A 4MINA 4DQXA 1HKUA 5A3JA 3LC1O 1KC1A 3LQFA 4NU5A 3OJOA 1NFFA 4YXFA 1R15A 5JNLA 1QV7A 1P0FA 1Q7CA 4L75A 2D2IA 2HJRA 3O8QB 1NX6A 1GUFA 3JQDA 2BLLA 3FR7A 1F8FA 1EUCA 3FNEA 3TFOA 3SJUA 4ND3A 4DBVO 4YT4A 1QYCA 5KIAA 4ZQBA 1E1NA 4EJMA 1LLDA 2VNAA 3PP8A 3FNFA 5ENVA 1FDTA 4YTEA 4KUHA 5T73A 3P2YA 3CXRA 1ZKMA 3EUWA 3TJRA 2Q45A 4FIZA 2PGDA 3BTOA 5JYFA 1Z73A 4CMGA 4D46A 3DAPA 3AM4A 5AXAA 5IDXA 4MIYA 1O94A 3UUWA 1F0YA 2AQ8A 4BNYA 1HL3A 5U9CA 1UZLA 2VRBA 2JCXA 3GGPA 3RUHA 1LRLA 3AU9A 3BYZA 1LDYA 3BMQB 4ONEA 2ZJ0A 5ILOA 5A03A 3OHSX 3DDNA 1ENYA 3A1NA 3NTRA 2IDZA 2X9VA 1SNYA 3FWZA 4I1IA 3PWSA 4G2NA 2J3KA 3GEDA 4DA9A 2HK7A 2X86A 5CDYA 1SEPA 1F8GA 1ISIA 1XLTA 3KEOA 4TKMA 3PLNA 2YQ5A 2NV6A 2HRBA 3CE6A 4RF3A 1JVBA 1NAHA 3WJAA 4AJ1A 5AOVA 3LU1A 3ZNOA 2V6FA 3AUTA 4YB8A 2NVWA 3V8BA 4B3JA 4E2WA 4MVJE 3GGOA 4ZD6A 4E5KA 5K6AC 1ZMOA 2G5CA 3WYEA 4ALKA 4FCCA 1IY8A 4BO8A 2HKIA 1ZJYA 1X1EA 3HWRA 1DRWA 2YHIB 1QYVA 3LT2A 4BQRA 1XQ6A 1E6UA 3HDHA 3H2SA 4NBWA 3AW9A 3N7UA 3WG9A 3EHEA 4LCEA 4ND1A 1RM5A 2X22A 2G17A 3QVSA 2EW2A 1V3VA 5DF1A 2AXQA 4OAQA 2AQIA 4U7WA 3RCBA 4WE3A 4R69A 1HE2A 3QVTA 1U4SA 2P4QA 5B37A 4XZ3A 1B3BA 3PWKA 2RIRA 3KHUA 2X0JA 1MP0A 4QFCA 3H2ZA 3G1UA 2EGHA 5DCWA 5H83A 3WDSA 3IL2A 3LF1A 3D3WB 3ZWWA 3DB2A 1T2AA 3DZJA 4NFYA 5JDIA 4I08A 5COAA 4PG7A 1AXEA 4B4VA 9LDBA 5ITVA 3WX0A 2NUAA 2B0JA 4RDHA 2LDXA 2GUGA 4GLOA 5F5LA 1ZNQO 1LXCA 1PZHA 1HZZA 1N7HA 3JQFA 3BIOA 2GERA 3RD5A 3ROMA 3MJVA 1EVZA 3BZUA 1P74A 1Z75A 2HMVA 1V6AA 4BGIA 1QORA 4N7RA 4BNZA 3AM5A 1P1RA 1KOLA 4LRSB 3OM9A 1X0XA 1H2BA 1DFGA 4UVIA 4B79A 3JYQA 3LC7O 4E5MA 4IXWA 3UOGA 1YGYA 4QX6A 5TRTA 4FFPA 1GUYA 4RVHA 3LT0A 4OJNA 3ON5A 1PR9A 3VZPA 3GMSA 3Q2KA 2I5PO 4W9NC 1CQIA 3OETA 5C7IO 4XGNA 3QJ5A 3CKYA 5IDYA 5THQA 1QYWA 4AJHA 5L7WA 3JQGB 1AXGA 1ARZA 5AXCA 1H6AA 1T2CA 4GX0A 1EDZA 1NR1A 1Z7EA 1IOLA 5F5NA 4YYZA 1RPNA 1LQUA 4TKLA 1AUPA 4R51A 1LX6A 3O03A 4P4LA 3WQSB 5JDCA 4KUEA 3EDMA 3JQ7B 4UVGA 1M6WA 5L9AA 1PQWA 2EKQA 4QTZA 3FF4A 3PI7A 2QRLA 3RFXA 2BF7A 3F1LA 4FW8A 3NT4A 3ETDA 4IM7A 5FF9A 1NYTA 3GNTA 2AEFA 1J49A 1DRVA 3D5QA 3BTVA 1YBMA 3DC2A 4NZ9A 3PGJA 4YVFA 1SCUA 2X0NA 4DGSA 1T2EA 1VL8A 1BDMA 5ADHA 4QT0A 3BA1A 2NQ8A 3UCFA 3NDJA 3G0OA 3ZI0A 4BNXA 4CQMB 3RROA 1XEAA 1H9AA 4IJVA 4RPHA 4URFA 5JCXA 2GN6A 4I5DA 1KS9A 3UN1A 5B12A 1FDUA 3ANMA 4UVEA 2QX7A 1R4NB 4AJJA 4CQLB 1Y9EA 3I9KA 3I4CA 5JC1A 1F17A 4GPD1 1E7WA 5HS4A 4N54A 4TZKA 4WLVA 1B8PA 1RM3A 1VJ0A 1DIHA 5FI3A 1U5CA 4PVDA 1GU7A 4BNIA 1XKQA 2X4GA 4FSHA 5JAIA 4EJ0A 1T2FA 1F14A 3F46A 3V2GA 2RBEA 3PK0A 3TPCA 3SX2A 2Q22A 4NHEA 5JXWA 2FHSA 5C7OO 1A9YA 2Y0DA 3FTNA 2OP1A 4MIOA 2I67A 1YWGO 1D4FA 3JV7A 3PJGA 3TL3A 5ITWA 2ZB7A 4XEHA 5EPOA 2UV8A 5TJHA 1LA2A 4ZQEA 2B36A 1JKJA 2NNLD 4O6VA 4W6ZA 2YUTA 5B4VA 3JD1A 1VE9A 1L7DA 4KMSA 3UICA 4IXTA 1B8UA 1P1KA 4OXYA 2ZTUA 3NDIA 1CJCA 3ASVA 2Y66A 2GGSA 1LUAA 1XWFA 3H5AA 1ZSVA 2QIOA 5G0SA 4DQVA 2DPGA 1U3VA 4YWJA 1UAYA 1YOVB 1LSOA 4EITA 1PIWA 1AGNA 3PTZA 3NDRA 2D5CA 2FWMX 3HJAA 2FRDA 3MJTA 2BMAA 1ISMA 3H5NA 1RYDA 3OF2A 1TVEA 3UCEA 5I7EA 1YE3A 1C1XB 2J3IA 4MOWA 4RO0A 3JD3A 3QY9A 1HZJA 4WPGA 2PD6A 3ZNNA 4CMJA 1UZMA 3V2HA 3UGKA 1LDGA 1NVMB 4I9HA 4BO9A 5JO9A 4XYMA 4CMKA 5IF3A 4R5MA 1NVGA 1UP7A 3PXXA 3E5MA 2EJWA 4J4TA 1WLYA 4K6CA 1MLDA 1HE4A 3NX4A 1QR6A 3GFGA 2CDAA 2DTEA 4Z9FA 4EJ6A 1HDRA 4C4OA 2BH9A 4FOOA 1SEVA 1V9LA 4HKTA 4WLFA 5G0UA 4ALMA 3TOXA 2PH5A 3UFXA 1KEWA 2AQKA 3AU8A 4JX8A 4WJZA 2AHRA 3KEQA 2JL1A 2NTJA 1NASA 2RHCA 4BMNA 1NM5A 1Y81A 2IYPA 4AJPA 3MJCA 4YAIA 2BKAA 4MVJH 3F4LA 2QG4A 5KKCA 1IHYA 1E3SA 1EK6A 3UCXA 3PYXA 1CQJA 3JQBA 3O8QA 4Q9NA 4PRLA 1P45A 1X0VA 1S7CA 5KJ6A 3WGIA 1ZEMA 2D3TA 1T4BA 4ALIA 1HDXA 3KLMX 5JS6A 2B35A 1E3LA 2Y1FA 4P8RA 3BHJA 2EWMA 4RVGA 4PG8A 3PZBA 4GI2A 3WNVA 1DJNA 4NJOA 3V2UA 5A5FA 4J1TA 2XAAA 5DN9A 3ROKA 5FWNA 4XIYA 2EEZA 1Q2XA 1K2WA 3NUGA 3QE3A 2WYUA 4J1NA 3RVDA 4O0LA 4W4TA 5TX7A 2WE7A 1YDEA 4PRKA 1MG5A 4YJGB 5HRUA 1CYDA 1NFRA 4GMGA 3BMCB 3U4IA 3OMLA 2GN4A 4BNVA 2Y93A 1UUFA 4J7CA 1XIVA 2Y67A 3BMQA 1P1JA 2YV1A 3DEYX 4O59O 3E9MA 3D64A 2YZ7A 4IGFA 5DULA 1XR3A 1W4ZA 5IXSA 4DBZA 1WZEA 4FJ2A 4GKVA 5JE8A 3WIDA 3GA0A 5IZCA 3GLQA 3GNSA 4AJ2A 2C2YA 1MG0A 3CTMA 3MTJA 4MPDA 4BQPA 3TRIA 5KVSA 4H7PA 5U4QA 1OBFO 1RWBA 4GLLA 3R6DA 4IDCA 1BDBA 5KVVA 2VNSA 3JQCA 3BHIA 2O4UX 3MJEA 1LNQA 2BHLA 3ZNQA 3EW7A 2FN7A 5JW6A 1WW8A 2WWRA 1A9ZA 3WB9A 2PNFA 1X1TA 2RH4A 3AOEA 5G2OA 3ORFA 3G3EA 3ST7A 1XG5A 3L77A 4JQCA 3F5SA 5DP2A 1VM6A 1R4MB 2OORA 4U8GA 1PTJA 3PYLA 1ISHA 3K73O 1LDMA 5CHEA 2VYNA 2YHIA 2Q99A 1ISGA 1UXIA 2IXBA 5L95A 2B4TO 3CEAA 2DLDA 2EIHA 1CWUA 3HFSA 1WAMA 1GYQA 2EV9A 4FJ0A 1PQUA 4J91A 1O9BA 1ADFA 4KTVE 3JQ9A 1HYGA 2NWQA 5ES3A 1PZGA 3ZU5A 4CR8A 1VC2A 3ULKA 4WOKA 1PGOA 1PX0A 3X2EA 2ZYGA 4R9RA 3RASA 3KO8A 5B4TA 2W2LA 2WJPA 1ZIDA 4CR6A 3DHEA 5AXDA 3RUEA 1DLIA 4E6PA 4I5GA 4OO3A 5G4KB 2GZ3A 3D3WA 1K3TA 2VWQA 4CM1A 1HXHA 1G0NA 4BO6A 4ND2A 2O23A 2P4HX 4OH1A 4CMEA 3VDQA 1TI7A 4Y6RA 2YV2A 3QIVA 9LDTA 1DLJA 1C14A 1ZK3A 2R00C 2O48X 1Z82A 1GFSA 2AA3A 3HNPA 4II2A 3PZRA 1SAYA 3HHPA 4XQEA 1EVIA 4MVJM 4MJLA 4BKUA 4XQGA 1N92A 2P91A 2BRUA 4RVSA 3OICA 4J6FA 1K89A 2VQ3A 1H93A 1ONOA 1KIFA 3I1JA 4CUJA 1UDBA 3DO5A 3I6IA 2O3TA 1QV6A 3ADOA 5ENDA 1XCBA 4BOYA 5L3ZA 5A05A 4TRMA 5EMHA 1JKFA 1DIBA 4WLUA 1N1GA 4L73A 1QSGA 1EBUA 3JQGA 1DFHA 2QRKA 2EKPA 3TFQA 1NAIA 1JN0A 4DC0A 3SLKA 5TSDA 4BNTA 2CSUA 3VTFA 2E6UX 3ZV5A 3C1TA 5A9SB 1IHXA 2XXJA 4Z0TA 1KY5A 4L4SA 2NU6A 3STHA 1WDLA 1EDOA 5TF4A 4CUKA 4PG4A 7MDHA 2SCUA 5G0TA 1SB9A 3JQ7A 3ZWMA 3GG2A 2XF8A 4JBIA 4LSMA 1Q7GA 1UDAA 2QW8A 1P1FA 2ILTA 1GPJA 4NK4A 2P5UA 1Y8RB 1ZSYA 3AFMA 3C85A 3QVOA 1DIAA 1Q7BA 2P9GA 1P1HA 4S1VA 2VT2A 4GVLA 2UAGA 3O4RA 1W73A 1GPDG 4OQYA 3PWZA 4IDEA 2J5KA 4Q39A 2XXBA 4BNWA 3P19A 3OJ0A 3SC6A 3W4JA 1ZFNA 3H65A 2DTXA 1O5IA 4E30A 4NQZA 3VKVA 4UEKA 4PZEA 4TRNA 1EZ4A 2BFOA 4CQMA 2WEKA 1B15A 1ORRA 1V8BA 2ZTMA 1LTHR 1PJCA 2D0IA 3G79A 4JJFA 3RC7A 4MKRA 3GMDA 4RLHA 4XYGA 5IDQA 1KYQA 3VH2A 3B70A 1KBZA 1R4NA 1ZZEA 4CQLA 1JKIA 3VPHA 3H4VA 1IPEA 5KOIA 3AI1A 4XR4A 5EERA 3NEPX 3FHLA 1K6XA 3GOHA 4LRTB 4BO3A 4PLPA 1Q0HA 2HMSA 2DKNA 4DPKA 3HDQA 2VYVA 1T26A 2VWPA 3GDGA 4MVJP 1PJ2A 4RPGA 3FD8A 1M66A 3L6OO 1U5AA 1DRUA 2J3JA 3KVOA 3PPIA 4RZIA 3P5SA 5DCYA 1BVRA 1CRWG 2HDHA 3U62A 4YJFB 1C0KA 1GZ4A 2AG5A 3LLSA 3WWYA 3W1VA 4AVYA 4MKZA 5LDGA 4D44A 3A28A 1I10A 1OI7A 5HS6A 1PGNA 3I9LA 4WLNA 3V1UA 3H8VA 4ITUA 2VHXA 3WGQA 4HFJA 3KV3O 3QV1A 2PZKA 4F46A 1CETA 1HLPA 3CPSA 4E2YA 3IDSA 3QWIA 5JYDA 1VRWA 3HZZA 4WEQA 2X1HA 5L45A 3INRA 4QECA 3WIEA 1AN9A 1P1IA 2Q46A 1YOVA 2W2LD 5JDIC 4BKRA 3NAQA 3L4SO 3K9QO 2F00A 3W8EA 4ZN6A 1ZCJA 4OKIA 3O9ZA 1Q0QA 4R3WA 2AW5A 2OO5A 3DONA 4HFMA 2ZB4A 3JQFC 1C1XA 5JMWA 3ZW8A 3LT4A 4PN3A 3IIEA 2NM0A 4AL4A 2NVUB 3QSGA 2IEDA 2FZEA 1MGOA 1MA0A 3DFZA 3BMOB 4Q3AA 3LF2A 4YAEA 3ABIA 4N18A 3E48A 4BO1A 2O50A 5AXBA 4WOJA 3TSCA 1LI4A 3TWOA 4XDYA 4R1UA 4BO2A 3GT0A 1QLJA 5I9LA 1U8FO 1P9LA 3RC2A 3H9GA 4E33A 4K26A 1FMCA 1OC2A 4JP2A 3R3SA 3KYCB 3JYPA 5A5EA 4UUNA 4Z9XA 4NU6A 4K9DA 4OYRA 4PLWA 3S1LA 2HMTA 4G65A 3WGZA 1X13A 4N5NA 5C5IA 4HNGA 3AY3A 1YRLA 4CM7A 4ZQGA 5G4LA 3IS3A 2DBVO 1KEVA 4Q3CA 4BNKA 5EL0A 4GH5A 2OXIA 3DZGA 1VJTA 1JTVA 2V6MA 4D3SA 1QP8A 2JHGA 2E37A 3EAGA 3AK4A 3O38A 3QVWA 1S6YA 3JYOA 4FGWA 4PGFA 5JDCC 3U49A 5AVOA 1O6ZA 2HU2A 4DWVA 3F47A 1HETA 1GV0A 3TZHA 4FJ1A 3D5TA 5BT9A 2HAEA 3JYNA 5L4LA 2GPTA 3MOIA 4PFJA 3DBHB 4DLLA 3WYCA 3N58A 3EK2A 3GY0A 1I2ZA 5KKAA 1P0CA 1LLUA 4E2ZA 4IQ0A 4FFRA 2G76A 3KYDB 1HE5A 3D3EA 3M2PA 5IAAA 1K6IA 4Y98A 1EEHA 2ZB8A 4IINA 4WEOA 1XYGA 3U3XA 4RORA 5FEUA 5L7TA 1DC4A 6ADHA 4MDHA 3ZGYA 3U09A 4YJGA 1DO8A 2FSSA 3E9QA 4BNMA 4OIMA 4XWYA 3BMCA 4B8WA 1HDYA 1MV8A 2WDZA 4II3A 4M54A 2DUUA 3ROQA 3OQ1A 4Y6PA 5A04A 3ZWNA 5BNIA 3KUXA 2BFPA 3JTMA 3SLGA 4BB6A 3HE3A 3MWEB 3K8ZA 4FFOA 3RFTA 4PZDA 3U5TA 1D1SA 2CF5A 2PTGA 1EMDA 3PIIA 2X5JO 4IIUA 5KWEA 1PZEA 2HCTA 3C7AA 3GVPA 1JU9A 1PJBA 5COBA 2JFGA 3WOHA 2FP4A 3PHJA 5F21A 3PGXA 1TEHA 1QXSA 1F12A 1X7DA 2FPIA 4O63O 3VPXA 4B8ZA 1PU2A 5CEFA 4Q3EA 4P38A 5KVQA 1ZK2A 4FFNA 3TZQA 2G82A 1J5PA 2BFMA 1BXKA 2H6EA 4D42A 1PEDA 1EUDA 3RI3A 1E6WA 4XRRA 1K0UA 1DHRA 1KVUA 5A3VA 3RFVA 2HK9A 5H82A 1M6HA 3DFUA 3W8FA 1MXHA 3SC4A 1ADBA 4NBTA 3RUAA 2OBYA 1R4MA 3F9IA 4J9UE 4EYEA 5JO0A 2J6IA 3RIHA 4A27A 4E0BA 4BO7A 4NR0A 1DC5A 2DAPA 1D1TA 1LLCA 3GHYA 8ADHA 5CEEA 4TSKA 1QLHA 2UUOA 2C5EA 5TJ9A 1M2WA 2DFDA 2DVMA 3FCOA 4OOEA 1WZIA 1ZK0A 1ULUA 2IRWA 3Q0EA 2JD1A 3Q9UA 3JD0A 4XR9A 5I9MA 1DIRA 4I9UA 4QXMA 4PLYA 1E5QA 2HO5A 3LYLA 4WGGA 2EERA 2O7QA 3DOOA 1Y8QB 5L4SA 4QO7A 3L07A 5A9SA 2O3SA 3JD2A 3OIDA 1AHHA 3DTTA 3V1YA 3ZDFA 3OJEA 2VUUA 4BO5A 1T4DA 1I2CA 1YL6A 1ADCA 5DCUA 2GN9A 2Y1CA 2DQ4A 1I32A 3H9JA 5G4KA 3RJ5A 1RM4A 5JAQA 2Q3EA 3GRPA 1EVJA 3LDHA 1GR0A 4CL3A 1QRRA 2A35A 2VUSA 3OEWA 4IJKA 4IJUA 4XYEA 1N8KA 2B69A 5THKA 4J4BA 3L6EA 8LDHA 3IJRA 3K96A 4ILKA 5AQ1A 2JFHA 4BGEA 5J9GA 4EEZA 3LZ6A 4Y67A 4PLHA 5G0VA 3ZWCA 1Y1PA 4YJHB 1NPYA 2RHRA 1RJWA 2X7HA 3ZHZA 2RH8A 4HFRA 3WGOA 3MTGA 4A0SA 4CL8A 3B1FA 2YHUA 4HV4A 3E1KA 2HSDA 2WSBA 2QHXA 3IJPA 4MVJG 4IY1A 3VKUA 3AI2A 1L1FA 4R9SA 3B20A 2OL4A 3ZN2A 4NK5A 5KJFA 3JQBC 1E0DA 1P44A 4FBGA 1KVQA 3PDUA 2Y1GA 3Q2IA 1HYEA 1KETA 1E1MA 1QMGA 5A1TA 4RF2A 3IUPA 4BKOA 1C1DB 2GSDA 1QG6A 3QQPA 4HNHA 2X5KO 2OMEA 2VT3A 1H0KA 3PDJA 3VH1A 2YV3A 3OEYA 1U3WA 2GR9A 3GVIA 4K1LA 2E4AA 5TT0A 5FFFA 4J7XA 4B3HA
chains in the Genus database with same CATH superfamily
1Q1QA 1GY8A 2XOKD 4G0UA 4LS3A 2BBWA 3RVRA 3MBOA 1JAHA 4R5HA 1JQJC 4J4HA 2BFFB 1U0EA 3E18A 1JPNA 2TRSB 4NCKA 5CB0A 2ACKA 3I9JA 4EKIA 3VTKA 5IDWA 3BRQA 3NXSA 5B3AA 3FYUC 1DB3A 1OWLA 1CUBA 3MILA 5JISA 1VCIA 2FSFA 2FFRA 2VPTA 3O91A 3WR5A 3DLAA 3ZWBA 1J7KA 1A7KA 2N46A 3KHTA 3TW8A 2AX3A 4ZCSA 5FKJA 3QA9A 4BLQA 2W00A 3AONB 5JRJA 5BN3B 2FWNA 5IZCC 3G82C 3IDOA 4M36A 4LYDA 4TWJA 2HRCA 4TLLB 3V6MA 3T5CA 3D7SA 3W4KA 3PG5A 4HJRA 2HA0A 4S2EA 2HGSA 5F1KA 5FL7A 5JARA 5CVVA 2VP5A 3KVYA 4IDAA 3IESA 2EG5A 5FBQB 5LXTA 3UJAA 3DMYA 3IV9A 3IO5A 4UFOA 2Q50A 3CW8X 1WPGA 3TDMA 4CLRB 3NLLA 1RAIA 4FYVA 4EFMA 4HUJA 4J2OA 4LDAA 1H1TA 4I6GA 2FPRA 4C2AA 2JFXA 2GM3A 1H2EA 1M6NA 2X5NA 3CWQA 2H63A 3O3MB 5AKLA 4JP5A 4BNNA 5JC8A 2CJYA 2V74B 2IOYA 1SQ6A 1E0AA 4EYGA 2OAGA 4BEJA 4CMCA 1UBTS 4TRRA 2PSSA 2PLNA 2YVLA 2BF4A 4JR1A 3PC4A 2QJFA 1IONA 4GZ5A 3IUYA 5AUQA 3T0GA 3N53A 3P2KA 2L82A 3BJRA 4URUR 3HGQA 4I4NA 1B1AA 4KK4A 4DA7A 2JIRA 3Q6IA 4D92A 3SR3A 4YMLA 5EMKA 2V7WA 2X5OA 1NDHA 4F1JA 1EWRA 2TECE 3FKSA 1IQPA 1IAVA 3EXHB 1WUYA 3GJ4A 1LPPA 3PVSA 3WE7A 3WYGA 5DU2A 4M1QA 4O29A 4YJFA 1FYXA 4MW2A 4H0CA 3A6LA 3RRBA 1I4OA 4AJLA 2CXQA 3RARA 1CX9B 1E98A 2E4YA 1SUFA 3VZCA 4QZVA 2C8JA 2H5LA 2WG2A 5DYIA 3HM2A 3V1TC 3ZTYA 1KTIA 3R8FA 1WRBA 1YTUA 3LKDA 2HO4A 1R12A 2Z3ZA 1P4AA 4OYHA 4LF6B 3BCUA 1B6RA 5ALUA 2RGNA 3O8OB 3EMDA 4IO1A 4EG8A 2II6A 2VUIB 3WL6A 4NJEA 3AFIA 3ZZ1A 1TTQB 3QJGA 2QMYA 1Z4MA 1IZ0A 2HRRA 2QAGC 4C29A 3LZDA 4E12A 1QO0D 3DYBA 3WI7A 4MUIA 3UC9A 4BEBA 5LQDA 1QE3A 1WXFA 4V2IA 3N8KA 1DE0A 1E3QA 3I53A 1KU6A 2FY8A 2ZE7A 3DFIA 3KJNA 3I4FA 3R9WA 1E5DA 2GPNA 3S5JA 2Y1XA 1J33A 3PXAA 1N3BA 1TD1A 4XWOA 1M0EA 4CKCB 2O3RA 2NU7A 4H4CA 4FMBB 4EDHA 2CYBA 2AWOA 1RQLA 2EZ9A 3N8IA 2V6GA 3SQOA 3MOSA 3ZE2B 5KYWB 2DQKA 3T3HA 3TYXA 5GTDA 1JXMA 2DEUA 1EFCA 2G6TA 1QPBA 2BFCA 2QLJA 4CCYA 5JR3A 2LXNA 3ZU4A 1GYRA 2J9FA 2M9MA 1XXHB 3FN4A 1FTNA 5EHXA 4JJZA 2H59A 4DPLA 1I3MA 2IEIA 1Q20A 3GEBA 3SC2B 1M9NA 3S29A 3PD0A 4X8HA 1E2GA 3AFOA 3AJEA 4WVLA 2CFCA 5KYUB 2JGDA 1UBKS 1BQEA 2JFOA 3OQPA 1HORA 3OPYA 5ECYA 5EVCA 1W34A 4IZOA 4TMFA 4UTRA 4A5SA 1JNYA 3WAGA 1SOUA 1U2GA 3IAM1 1UC5B 3TBHA 2WK1A 1M8FA 5C4GB 5ELMA 1N78A 1U8UA 3CS3A 3E2PA 3M6LA 4M9SA 5HIKA 3MZ0A 5TF0A 3W5IA 2O0KA 4FVTA 1VE1A 4KDEA 4CHGA 1YVPA 1TW2A 5CFOA 3RE1A 2RGXA 3F71A 4FBMA 3S70A 1U65A 2B8JA 5ITSA 2NO5A 1TO6A 3U7EB 4GT1A 5CD1A 5GV7A 1WP9A 3QKRA 4HAVA 5L53A 3Q8LA 1DZIA 2A9JA 3VHXA 2PK3A 1KHHA 2AZTA 3A4IA 3ACDA 4G4JA 4FZVA 5BNWA 4ZAGA 1XVUA 1R7RA 3DKIA 4IZ6A 3M6IA 4K86A 4O4LA 4K40A 3R20A 4ALJA 2JLUA 2RHOA 2WFMA 1RWMA 4A9AA 2HU7A 3G5AA 1JA9A 3MYYA 4RVUA 1OREA 3WADA 3IERA 2A58A 1YB5A 1MJGA 5SZHB 2R7LA 3K0FB 3IB3A 5DBFA 1XJCA 4YIKA 3GLHB 2DWQA 2DECA 3IIKA 1UAGA 4BVAA 2H4FA 2OFXA 4A6PA 4C0HA 1KP9A 3MQFA 3FPEA 4DTIA 4LJ9A 1AVTA 1OAOA 1VZ2A 1BW9B 2WHYA 2O2YA 2YFQA 3HKEB 4YBRA 4AX8A 4F92B 1Z39A 3M6WA 2EKDA 3Q0IA 1JEYA 3ORHA 1XALA 4E15A 2XYPA 4GGMX 4J1SA 4L9WA 5BWBA 2MCFA 3NV9A 4BDSA 1HL7A 5EE5B 4EDFA 1ZM9A 2RKBA 1IN8A 1GUZA 2GSWA 4UBIA 4DQKA 7AT1A 3FDXA 1CUUA 1I24A 4P92A 3ESQA 3CLUC 1U9YA 3HBAA 5D1HA 3AEQA 1SKQA 2HC9A 3WFJA 3ANLA 5BR7A 2CE2X 4QWWA 3WLQA 3G17A 4ZAZA 2ASVA 5ALRA 3DEKA 5EZYB 1PF7E 4BVEA 1XN4A 2PSJA 2EP8A 4UBKA 2XVYA 3GW8A 4RMNA 2Y1EA 3DWFA 3IKVA 3QVLA 3L1HA 4YP0A 1L7PA 5FPPA 3WGJA 1W8DA 2LGJA 4O4IF 3LY7A 1SA0A 4ZVSA 4KLNA 4A1OA 5HWSA 4NBUA 5LSAA 4B76A 2J0VA 3HI6A 2QN7A 3N2KB 1Z4OA 5CM2Z 3TR5A 3T12A 1T9ZA 2HA3A 3BXPA 3F5FA 4FGUA 3T0FA 1WF3A 2WINI 3QKWA 3NHPA 5LLDA 3LFUA 4NSNA 3MUFA 3OVMA 1AV6A 1VRVA 4F56A 4QOSA 2DHQA 5FUMA 4JR2A 3WVNA 3OLZA 1HG0A 4J7UA 1J8MF 4G81A 1CSEE 2ZYTX 4RACA 5AJTA 2WF9A 1V6CA 4JWTA 2C0QA 1Q0TA 3D6UA 5HCIA 1SZJG 1Z74A 2FOIA 4KXLA 1P17A 3ZC3A 1FFYA 3HP7A 2OO3A 4ABYA 5L4NA 3KQUA 1QC5A 3C16C 4JI8B 1YZQA 3ZLBA 1FFCA 3V32A 3EZLA 1J07A 2OESA 1VA4A 3QWHA 5AKEA 3U61B 4K9QA 1I0ZA 2AN1A 3A25A 1XVTA 3EXIA 5DI3B 4EW6A 1XNRB 2IZZA 3B3QA 4N6GA 4O2LA 3DOFA 3RUFA 2JG3A 2X9NA 2ZCUA 5DH9A 4BEWA 1AUVA 4GMXA 4EHJA 1ZXBA 1E1YA 2VTEA 3L7LA 3QG1A 2F3QA 3FDZB 1RMTA 4LZPA 1RI4A 4JEIA 3CEMA 1H8HA 2PUTA 2ZJOA 4RH1A 3ZE9A 4I4TA 1KZ9A 2CUKA 4C4PA 1GOTA 5BVGA 2C61A 2HQ1A 4E11A 2W8ZA 4EHKA 2BGIA 1XKXA 1Z68A 2VZEA 1GPUA 2I6UA 4MUGA 5GM1A 3W34A 3ZEAA 2C20A 1ONNA 4YC7A 4QBTA 3TL6A 2NW6A 4BPBA 1BJKA 1NR7A 3IPAA 3H5TA 4QGHA 1TLTA 1HURA 3ZXXA 3LNCA 4KRFA 1RQPA 1D0VA 1DDOA 2X42A 1AG9A 1P7WA 3OZ7A 1ZVJA 4JXKA 1VPVA 3WLJA 4IYJA 1T13A 1ZXLA 1JAZA 1EFUA 2G40A 2VYCA 3IQEA 4TN5A 3ZU2A 4EZBA 4PZCA 2WJGA 5E1DA 5IK2A 1IZYA 4J0IA 4CMAA 3I28A 2PGLA 2ZTLA 4HP8A 5KHOC 5MGBA 2FFBA 2O3UA 4LJSA 4DXHA 1XAIA 5CT8A 3DBIA 3H4IA 4OF4A 2W43A 1JAXA 4TTSA 2VJPA 4WY8A 4G56A 2R5NA 2I65A 1E1RA 5J4VA 3CX4A 1W19A 2O1SA 4WY5A 3CO0S 2BJWA 4LJ6A 1GPBA 3EAFA 2Q27A 4YP7A 3UJ8A 3S2IA 3M9LA 4YV1A 2BL4A 3PQ7A 3C14C 1UK8A 1MT0A 4H17A 4J0KA 4O4HB 1UJ4A 3TPZA 3QOWA 1U1CA 1C1DA 1GTJ1 2GJ4A 2BEJA 3QXHA 1LVHA 1S4QA 3D7RA 4G4IA 4BQNA 4W5TA 4ENVA 4EB6B 5DW0A 1YB1A 4CLOB 4HNTA 4FFDA 4QDOA 1KKMA 4REQB 1LLQA 1S0UA 3DHYA 5LOVA 4R9VA 2WUVA 3QGMA 2BFNA 4JLJA 4YMHA 2XY4A 1ZWKA 1J0AA 4ZOCA 5J5CA 2ZBDA 4K9RA 3TNJA 1RQ7A 3TCNA 3MCWA 1HDZA 2Q5QA 5EQTA 4EMBA 3D0KA 1Q12A 2XCRB 2P30A 3WRXC 2IHNA 2XDQA 4EM6A 1G8HA 3LCCA 3LGXA 3QF4A 2IJGX 3LO8A 4MUAA 4QUKA 4F96A 2IS6A 1JAYA 2EW8A 4E5UA 5A4FS 4MVYA 5AHXA 1T9GS 3WRVA 1M7GA 1T0IA 3G89A 4US0R 4D9EA 1RBZA 2BGLA 2GNAA 3LDGA 2PUCA 2JIBA 1U28A 1U0NA 1SPXA 4BLWA 1CNMA 4NEQA 4R9NA 4Z1MD 5KTKA 1P8JA 4TS3A 2J0SA 4XVRA 5CHYA 3B9BA 4HTFB 2VF7A 3SIWA 1DOAA 2AN3A 2QL6A 3ETGA 3JWIA 2AOTB 3NBXX 3HADA 1LVUA 2NTVA 1GGEA 2PD3A 3GT3A 4ZOEA 2NU9B 4UU0A 4YR9A 5FV4A 5J4LA 1EIWA 1YS1X 4GL4A 4EYOA 4REMA 2HV9A 2P9EA 3HA2A 2J9XB 5A7HA 5KJCA 3OIUA 2WWFA 5LA6A 2HLNA 2D2VA 5IANA 1UXHA 5DBIA 3C3PA 2NADA 4MQFA 4ZCRA 4JHLA 2Z6AA 1JSRA 3MCZA 1NXPA 1Y1RA 3GUYA 3R3HA 4LBVA 4R2WA 3ZDBA 3D8SA 3BSSA 5KNBA 5GOTA 2XCUA 3I72A 1XTBA 1SY7A 3WK5A 3TOVA 2CV0A 2H8KA 4F3RA 3HJFA 2JLQA 4BNHA 3MFQA 4BE7B 1IDOA 3DZFA 1GG5A 4GOMD 5G1NA 4C30A 1EDEA 3V4OA 3PQCA 3GI1A 3IHTA 4JN6B 2ZPUA 2WFAA 2PH3A 2ZIZA 3CX7A 1EFVA 1G55A 1WZNA 2BD0A 1DEOA 2OVBA 4LJ8A 4PWZA 4UUAA 4ZCQA 1QPGA 2C3YA 3NAGA 3NTLA 2VJMA 4MNTA 4MRSA 3A4NA 2PFGA 4WK6A 1GYPA 1PJ4A 5EP4A 1YQTA 2I66A 1T8TA 5C1BA 4RK4A 3WYDA 3BD7A 2CDRA 1AK9A 2TMGA 3OIYA 1KH2A 1RAEA 2RGAA 1KYTA 1MAWA 2Y2UA 3COSA 3B60A 3BCSA 3TLGB 1G7SA 4QGAA 3ES9A 3R75A 4OM8A 2W7TA 3IOCA 2DETA 2B1GA 1YR7A 4IIXA 5MDHA 1O1YA 2WHPB 4HGNA 3L1KA 4B40A 3X1ZA 2NZVG 3SOPA 3DUFA 3H86A 1MAUA 3D7MA 1WXEA 1XZPA 4KKVA 2GYYA 4B8YA 2GILA 4B3DA 4KQ2A 4DHEA 3QYFA 4DJFC 5G02A 4XVUA 1N9GB 3KLNA 5ADUS 1NP7A 1QX4A 2XYHA 1E9RA 4DA6A 1MC8A 2YXPX 3H16A 2NTNA 3HJGA 2VYQA 2OCGA 4DUPA 3EPJA 1TYEB 4ND5A 3D4OA 1E8MA 2ZI3A 2Q2NA 3TEFA 4GC9A 1G7CA 4IDGA 2B1QA 4RL6A 4HVLA 2J59A 3HDVA 5A62A 2R4TA 3ZYZA 2Q3JA 4YA6A 1JVSA 2YZ2A 4INOA 2IYXA 2IZ6A 3S2UA 4EW1A 3SEFA 4FWIB 2NOAA 2Q5FA 3OURA 5IUNC 4BL5A 3M3HA 4XJSA 4FHEA 4R7ZA 1H3EA 2VP9A 4YR7A 4EO9A 2LCQA 3EX7C 1XNHA 1Q1GA 4JEHA 1CUYA 2QJRA 3RM3A 4IVRA 4AP6A 4MWDA 1R5BA 2JZCA 2VH2A 2IW1A 3K53A 4V0LA 3ZZNA 4QEKA 5IT5A 4D9MA 2ZVPX 4E70A 4Z8XA 2YWEA 1N32B 4RIFA 3DZ8A 1VIDA 1GAEO 1F9EA 3EWSA 1S8NA 3QUSA 2OUIA 4JJ4A 3LPAA 5I7VA 2C7PA 4IRMA 1X7GA 1JSCA 2AFHB 2WAOA 1HMYA 4M2LA 5J5AA 3ZGNA 4DREA 5BXYA 5AKJA 1JWBB 3H83A 3SHOA 1LDBA 1XDWA 2IUEA 4XB2A 4PQGA 1FJ2A 3OU7A 1QF7A 1QHNA 1X3SA 1BG6A 3ICOA 1Z3IX 1VP3A 1Z5UA 2AYXA 3AV0B 3STVA 4QTYA 5AVRA 4IDBA 3F3YA 1DBIA 3TDKA 1XFDA 1UZAA 4MB2A 1AKUA 3KOYA 2VPWA 2WJVA 2F90A 3F8WA 3RYFB 1NXQA 3PIDA 4HEJA 4E1BA 5EA2A 4BMSA 3CLVA 5DE3A 5JPCA 1PV1A 5U1PA 4EB8A 4TM7A 1JHAA 1EUYA 3UY4A 4IJQA 3W9UA 4NZMA 3G9ZA 3NATA 4RZ2A 3U9LA 1P7YA 2WU0A 4MTCA 2O8VA 1F0KA 1E1QA 3RC9A 3D6TB 4BGDA 4PZ9A 1Q0ZA 3A3OA 3AY0A 4NBSA 1LFDB 2PV7A 3N6XA 3EZYA 4RHXA 4TTPA 3MS7A 1ZR4A 3DTNA 3OY7A 2ZSUA 3B13B 3CZQA 4PZUA 4XTCS 1NURA 2GK6A 2VNHA 4M1TA 3TIXB 4AJIA 4D99A 1WW3A 4WZBA 3LCRA 4EELA 2JARA 2D8MA 2B9EA 2OFOA 3T5GA 5KEIA 2JIMA 4UM9B 2EGGA 5HM8A 4RK1A 1G7RA 5E8RA 5EWLB 4YRRA 3RKRA 4LYFA 3DBRA 1IYZA 4HVAA 1NRIA 3K35A 4MLZA 5JSZB 3EULA 5E7QA 5EZ6B 5HIMA 1L5ZA 2XT0A 5I4CA 3DDOA 4MQEA 4E22A 4OK5A 2VEDA 3FNRA 4MHSA 2QQFA 1FDVA 1WDWB 3W6OA 3GLTA 1LF0A 1SRQA 2RJOA 3AHGA 1IMOA 3EXG1 1RVDA 4H2DA 4LVUA 3V1LA 5IN4A 2BHRA 5IJXA 3B3JA 3G7SA 1QGUB 1S2GA 1M0SA 1DC3A 2FDCA 1RWKA 1KH3A 1X7HA 5D87A 2PKQP 3T3IA 2FSHA 4NCIA 1ODTC 3A0RB 4KXUA 3PGLA 3JVUA 3E8XA 2Y77A 1RMYA 4H6PA 2ZJBA 2P75A 1Z4KA 1OHHD 5H68A 3RFFA 3SEZA 4WZAB 1I2BA 4A0GA 1ECGA 1V16A 1WA5A 3M5PA 3PFIA 4H77A 3ROPA 1U5BB 4DIUA 4F4HA 2NV2B 2CE7A 3GN2A 2AMYA 4DF3A 4XOIA 1YK1A 5CBKA 2X9GA 1C0IA 1ZUNB 4MS4B 4X9XA 1N75A 2Q5LA 2VDLB 3UKOA 3ZWPA 5HIAA 4O4IB 4HR7A 3ZCXA 1E9FA 4JCOA 5LQKA 3AOGA 2DBYA 3P9SA 3K0BA 1BN6A 3R77A 1MW8X 4C88A 4NMHA 4NNOA 3WO1A 2R66A 4BCDA 3W3ZB 4LK2A 5CFQA 3AQIA 3HSSA 4NI5A 4KYTA 5HHTA 1O58A 1A5TA 4QNMA 1E2IA 1T5IA 1ZA1A 4OB7A 3GRZA 1O54A 4F6CA 1UZUA 1P3Y1 3AW8A 4KQ6A 4JEMA 2YFHA 2Y0PA 4MR9A 2YNMA 3IKMB 2JASA 4G0ZA 3T34A 4BBPA 3UT5A 3ZKWA 3EQ8A 3ZDXB 4NFLA 3ZJ5A 3H9QA 2FH5B 4P53A 3NT2A 1XA0A 3V9PA 3QVGB 2JD0A 1ZNYA 1JFFA 1X2EA 2IKSA 3WMXA 2H1CA 1K68A 2IYFA 3DM9B 1QZZA 2NN3C 4UTPA 1H1LA 1P5JA 4TKUB 3E9RA 1GCIA 4CQJA 4YRKA 5K8TA 1ZGAA 1YB6A 4BQIA 4RJTA 1NR5A 4B35A 3UGQA 3DE4X 3P2MA 4G3XA 1E20A 5HZGA 3WWCA 3DQPA 2ZDHA 4CCWA 1QNFA 2H85A 4P22A 1AE1A 1K7FB 2YMLA 3BL5A 3VPCA 3G8YA 1PFVA 4HH0A 1JLKA 1G8FA 3EDQA 5CRIA 4AI6A 2WRZA 5LP6A 4ZT3A 1Z0UA 4RLFA 5IJAA 3SJAA 3A3PA 1H8EA 5AFSA 2FGJA 1GCAA 2ZDGA 3SVTA 1GDDA 1VIMA 5DP1A 4S1WA 4AWBA 3BOSA 1DAFA 1N0UA 4RFSB 5EHNA 4F9FA 4H1WA 1ZJWA 3KVNA 3EXEB 4LI3X 3OD5A 1NW6A 3NNSA 1G5TA 3W7BA 1I3NA 4GECA 4D8WA 4HRXA 2D1SA 1ZCBA 2VAWA 4BBAA 3QBTA 2ONZA 3NZEA 4DW8A 1D2GA 1G4UR 3V8PA 4PEVA 1XHLA 3KM0A 3BK7A 1SULA 4R2MA 1LLFA 1LDNA 2CL7X 3ANSA 3E0QA 4R68A 5DNEA 1U6IA 2P2SA 3VOTA 5JSUA 4TUYA 1P0QA 3UK0A 1JDSA 2HLDA 3E58A 3GOQA 1D0IA 2HJSA 4KQ9A 3UK6A 1UDCA 4FILA 2FN3A 2JLBA 1ND5A 3HEMA 2E1RA 2VRCD 4UNNA 4EG6A 4CIVA 1BHSA 4TYPA 2AOWA 3PVZA 2Q7DA 5LNK1 1R0XA 3R9IA 1KR5A 1BRMA 3K2BA 4X66B 4FQ8A 3IRUA 1X1SA 3A0UA 3WLMA 4NL4H 1ZVMA 4I50F 3OMXA 2AF4C 2R4QA 5D85A 4YRTA 4OMDA 4NV0A 3TE7A 5DF1A 1SXJD 2Y99A 2OV4A 1RHUA 3GH1A 4ZO4A 1IBMB 4U39A 3OCCA 1TJ5A 2Q2OA 1R74A 4YH1A 1K6EA 4IZIA 2VATA 1CRQA 1EDBA 2ZAGA 4A2CA 4YMUA 1ZOIA 3JATA 4OY3A 5TEWA 2G9RA 2WV9A 4WOCA 5T6BA 5B55A 3IH5A 5MF6A 1PDOA 4RS4A 4LOAA 4QUJA 4OUKX 1P19A 4N82A 4XLTA 3R6WA 3JQAD 4NENA 3S55A 3TRJA 1MV5A 1Z8HA 3UOAB 1BMDA 3OKAA 4Q4AB 5F73A 4IP0A 3L0DA 1UANA 2R47A 1F3OA 5DPMA 3H9UA 4HZUB 4OSPA 1MDFA 1NF9A 1U0SY 2MJLA 3MCVA 1DV1A 3RQSA 4HNUA 4KIUA 3OLQA 3H1FA 5TC4A 1QQ5A 3W6ZA 3ILYA 4R54A 2AFIA 3WJ1A 2VSFA 5JRZA 1E69A 1DXQA 2OZLA 2QTAA 4FIDA 3SDSA 4QGSA 3D6AA 1G3RA 1VSUA 4LOIA 2MT9A 4UBLA 3V8RA 4MB6A 2GXSA 3S1SA 1G21A 5A4AA 4UDYX 3LWZA 4ND6A 3GDFA 1E1DA 3LBHA 1C3OB 1E1CA 2D59A 3G0CA 3JTEA 4OP2A 4QO8A 4DADA 1NQTA 3F78A 1M5TA 1KI7A 2ZUFA 4A23A 4HQLA 5A3QA 3HJTA 1FIUA 3UMJA 2CBXA 3FE2A 4E13A 4W5QA 4W82A 3I2FA 5AICA 1ML4A 3NDBB 1Q2UA 2EEPA 1MVLA 1Y6JA 3QEMA 1PL0A 1SN7A 3S0JA 4AICA 5JXHA 1XF9A 4YBZA 2G5TA 3LCJA 3NOVA 3ZE0B 3D8NA 4CV3A 1NVXQ 1I8TA 4L7VA 1EFRA 3AFGA 3B1WA 3LI2A 4A1FA 1IUKA 3TEJA 1KJ9A 1ZAKA 4JBNA 4PV7A 1FSSA 5C3UA 3KRTA 5KTMA 3I42A 1VDMA 1L4LA 3H4MA 4YEDA 1QWOA 1MTZA 1BCSB 1XXLA 1OZAA 4OQ4A 5K6AA 1EK5A 3C41J 3BWXA 1ESNA 1HRKA 3T54A 4OJYA 3BWYA 1DX4A 1NZDA 4PG5A 1ADYA 1KK2A 4M89A 3O8DA 4OHBA 3T06B 1A8QA 3H9EO 2VR1A 3HG7A 1VP9A 3LLCA 4XIIA 3HYNA 3IMEA 2W58A 2XUKA 3B9QA 3QMVA 4MA5A 4XIJA 1Z0FA 4I46A 1O0SA 1JHYA 3VVCA 4BGUA 4B74A 2BIFA 3N74A 5TLSA 3IAHA 5ALTA 1GGHA 1R5JA 1VKZA 2DXIA 3RU9A 3OMWA 4LJLA 3W78A 5CITA 1V71A 1IPFA 4NAHA 2GVZC 2I6SA 2REQA 4LSWA 5ALPA 3W8NA 1QP7A 1V8FA 2LIVA 2Q5OA 3BWMA 1T0UA 3I2GA 1XCMA 4PAOA 1PFYA 4A6EA 5B30A 5BW5A 3ZXUB 3BG5A 3HYSA 3ZWAA 3I83A 1Q84A 4X24A 4OBXA 5CA1F 1MC1A 1NMZA 1Q74A 1E18A 3ZWQA 4ZEOA 4INPA 4ZMBA 3RODA 2YWHA 4BJ6A 5GIOE 4B81A 3DZCA 1VB3A 3VFDA 3HEBA 4L0MA 4XW2A 2PD4A 5G41A 1BXRB 2HYDA 4BZPA 4OQEA 4F85A 2PX6A 1JQEA 4D0SA 2IF0A 2H1OA 1LBSA 3JZIA 5EOVA 1E79D 2FW8A 3IQIX 1PNVA 1T8RA 3RSQA 2RAFA 3KYIB 2IELA 3KZ1E 3TNFA 4FHDA 1CZRA 1JHPA 1NPDA 2ZRBA 1E3IA 3GLUA 1HDIA 5C9ZA 1UJNA 2DPMA 1G9TA 3SOZA 1C30A 1JXAA 2EX0A 2F8SA 2ZCJA 3F7OA 3HQ4O 2VC2B 1GTRA 4DLUA 2H3HA 4N6NA 2VHTA 4B2PA 4DV2B 2PG3A 4B4UA 4LCJA 2VBGA 1X8JA 5BYAA 3F7NA 3KKOA 3I32A 1FUEA 2CLHB 3T1TA 5K6TA 4YDRA 1NNUA 2V0CA 3PFFA 2VJYA 3AERA 2CEAA 3O5AA 3L5KA 3GLVA 3PFKA 4IIVA 5AJUA 1CKEA 3VR3A 1J0XO 2ORYA 2IZ0A 2VHZA 1WPQA 5F3DA 2JLZA 1C8KA 2WJWA 1KI9A 4OQZA 1QTIA 1R16A 2C2XA 1HT3A 4J0FA 3U9TA 4B6EA 1OA1A 1OYVA 3DBLA 3LRXA 5B2ZA 4L3OA 2BE9A 4CTJA 5HX7A 3U4QA 1KEEB 5JYEA 3K4QA 4X97A 1J2RA 1SO8A 2GKGA 3Q3HA 5DGTA 3DHWC 1C50A 1T2NA 1U8CB 4YRBA 2ZYDA 2R1TB 2QL9A 2VDWB 1WNTA 4CKBB 4G9BA 4LHYA 1H66A 4KO4S 1MX3A 3ZVRA 2P6OA 4CEJA 1JLMA 4NOKA 4M1MA 1FDSA 5I8ZA 2FUNB 1ZUD1 1RI5A 3IQFA 5GINE 3PE4A 2YVQA 3CUTA 2X2PA 1BD3A 1F8XA 4D4LA 1C7ZA 2IHVA 2I3BA 2ISCA 1EESA 1DKPA 5E7MA 2Y76A 1K97A 1O4VA 3ANNA 1PQPA 3L8FA 3E9DA 2M1ZA 1XYVA 3JR7A 5JXIA 1CS0B 4WK4B 3ENVA 1LJLA 1PL8A 1Q1NA 3DZIA 2XBLA 4Q66C 2HMYB 3SIXA 3GUHA 4CM8A 4LF4B 2IEGA 1N6PA 1XT6A 5L6LB 1DO2A 4U3JB 5K51A 2FJ0A 2SKDA 1DINA 4XWAA 2LCFA 1CP2A 3UMCA 4MDFA 2QTNA 3CINA 4ZOBA 1YQEA 2BY4A 1OGJA 3VH3A 4UOQA 2HFKA 3TVYA 1KEUA 1B3RA 1L4UA 1OTHA 2IUYA 3K72B 1IVYA 1FK8A 4LVCA 3WQHA 3NT5A 4PS1A 4AUNA 3ADPA 4DMMA 4MRMA 4TQUS 4JJIA 3A4LA 1OX4A 1YMVA 4TRJA 2WKSA 1UOPA 2ZQYA 4FE7A 5DTRA 2GRAA 3UK7A 2Q62A 1E99A 1S8FA 4KP7A 4UBJA 5TARA 5CFZA 1W44A 2QN8A 2V55B 1W2HA 4JXXA 3EXHC 4UJ3A 2NPIA 2EXXA 4RF5A 3W05A 1B14A 2ZPAA 1PAUA 3QW4B 4DRYA 4ZK2A 5KNDD 2GESA 4ND8A 1JS1X 2WD7A 1ACJA 3LW7A 4ND7A 5HK8A 1G5PA 4QT4A 1U7HA 2W6JD 3CTPA 3HU5A 4L72A 2ZSHA 1BWQA 3AR3A 2YJ5A 4IPTA 4EUEA 1MFZA 1QYIA 1RS0A 4Z7QB 1E7YA 3EC1A 1O95C 3I8OA 4P5EA 2PMDA 1CQXA 1JB1A 4B34A 2IPMA 4FDUA 4IHQA 5FFMA 2ZK7A 4LY6A 1AZLA 1GWNA 4XLLA 2CXPA 3BZBA 5DK4A 4JUDX 1KNXA 4NPAA 5HBRA 3TJMA 1QE0A 3HY3A 4FI3C 2LWIA 3ZV4A 4EG4A 4MR8A 2DP4E 3OESA 2EJBA 5DNVA 2IYSA 3UJ9A 2BISA 2JK1A 4CW7A 2PX0A 4Y0NA 1KMHB 1WWKA 2PRJA 3QM1A 2X15A 3OT1A 4BFZA 3SN6A 3C3JA 2V7PA 1GSAA 5KNCD 1PV4A 1UJBA 3OFJA 4RL4A 2IXFA 2ONJA 3TZ6A 5DBOA 3EG5A 3FYCA 4J1QA 3F9CA 3R7WA 3PJEA 2INGX 3P0RA 3D0OA 5LR6A 1G5FA 4JMPA 3AUJB 4PVCA 1INLA 5IAEA 5LFAA 2H00A 1XCJA 4DV4B 3PLAE 4BJ5A 4OHFA 1OOEA 3OJWA 1PZXA 1P61B 3VUFA 5M3BA 3W2FA 1JHOA 1NC1A 2HTFA 4JAVC 1IULA 3W5VA 2W83A 5JNUA 1WXGA 2AR9A 1W25A 3WHLA 3WS7A 4AQDA 3CNNA 1J97A 3OF5A 1T4MA 4NDAA 1PJTA 3FGOA 1Q57A 4TT3D 2W2KA 4CIBA 3GUZA 2Z5GA 4XB6B 1W4LA 3ZGVA 5JFOA 1NQVA 1YFKA 1XDZA 1WCYA 5K4GA 1C0PA 1KH1A 1W2WB 4NFHA 3U3OA 3E23A 3WRWA 3WQRA 2DPHA 4FGSA 4R1SA 2GK7A 1E3JA 2DUWA 4BVJA 3SR4A 4WA8A 2QDXA 3DP7A 4G85A 1EXNA 1S2NA 5F1PA 3RUIA 4AROA 4ENUA 3MTDA 4EVSA 5DTIA 3WP0A 3P9NA 1V9CA 3L7JA 3GFBA 1G3IA 1TA0A 3EWIA 2O8FA 2MSCB 1Z18A 1X6VA 4R1QA 2FWIA 1H05A 1NI4B 3IQGX 4U02A 3CVYA 1L3BA 5CG1A 3E5HA 5J5VA 3AL0C 1RCFA 1E3MA 2XVMA 4DR1B 1RYEA 2ZYRA 1JA1A 5K4HA 4FDMA 4GR9A 3OQJA 3SBOA 2QNIA 1N4AA 5HVNA 4NWIA 1PJQA 3MVEA 5SY6A 3TIIA 4FFMA 1UJCA 3PNSA 1X74A 2KS6A 1E64A 4I50B 4LZNA 4HT3B 3LYAA 1PJLA 1R18A 1R0KA 2EFGA 4I8XA 4FINA 3LLUA 1TCVA 1VCHA 2DM6A 3GRKA 5CXXA 2B4AA 2QTHA 1F0NA 2WT9A 1JLRA 4KR7A 1V11A 5BSKA 3WLFA 4F8EA 4OXKA 4AUMA 4F6LA 1Y1LA 4LDJA 3UAZA 3HZHA 2RI0A 3A4VA 3OTOB 3AILA 3HB1A 4CE6A 3G0HA 1W6RA 4GLFA 4MS1B 1U1GA 4JIMA 4NE2A 3ADBA 2HK6A 2MWMA 5CJ2A 5IF9A 3KBOA 2QY6A 2BSAA 2V98A 4OA5A 4B2YA 4WNAA 1AA9A 1SKBA 2YX1A 4GP6A 1RD4A 2JJMA 3N39C 3FLAA 2Y4OA 4J49A 4UE6A 2AHOA 2N9UA 4IJWA 4DV5B 5IEJA 1M6VB 5DM0A 3UAYA 1YO6A 2BHSA 4DYVA 1VIYA 2D0PB 1ECBA 3VISA 1OFVA 4BUCA 3FTPA 4ESEA 4POAA 2FUG6 5CEJA 5FTLA 1A76A 1AOXA 2PRSA 2EP5A 5JQWA 4L3WA 4ZZ1A 1KOJA 1QCZA 1U8XX 2DH6A 2GZAA 4V1CI 1YJAA 1DJMA 3JS5A 3WLSA 3GEMA 4JNCA 5TPWA 1SMKA 3GN1A 4IIBA 1OGIA 4CU2A 3AZPA 3OX4A 1GXSA 1XTZA 4RM2A 2IEAA 4MVJF 5JMPA 2J3EA 1FNSA 5J58A 4IDDA 1FP4A 1EZZA 4GOKA 1ESCA 3QV2A 4Z54A 1CDOA 4BE9A 1E7RA 5FWXB 5EHIA 4HEQA 1VG9B 4MQLA 5F1OA 4HDKA 1M83A 3WYAA 1H4QA 4KWHA 2HCBA 4IOMA 2I7CA 3I09A 3ASYA 3L6UA 2HSJA 3ILSA 1WO8A 1YZUA 2OKCA 4N40A 2GLXA 3RHZA 1QKJA 4II7A 1ZK4A 1HQDA 2MHCA 3ME5A 5TT1A 4RA9A 2P69A 1YQDA 1WE2A 3PXDA 4IVPA 4KI7A 4RPIA 1YE5A 3EHDA 3I1FA 4JP8A 4OQMA 1L5GB 4YP5A 2XTNA 4IOJA 4ZOLF 4FC7A 1AK2A 1ZN7A 1JECA 1UJMA 4ZHQF 3MK31 2JLWA 5CLQA 1X8LA 2EF1A 3UAVA 1DOHA 2Q5JA 4LBZA 3OQNA 1N5IA 4DOMA 3D4PA 2IH5A 3N5CA 5KC8A 3TI7A 1Z5PA 3C4QA 3URMA 5JTUA 3ICCA 3UXYA 2WDPA 5KTOA 1E77A 1Z4NA 2TMYA 5EYPB 3R9KA 3ITKA 4AFNA 2DPLA 6YASA 5JD4A 2I34A 4RXUA 1K06A 1P18A 3NHUA 5CJJA 1RFGE 4JJEA 4AMYA 1DELA 1OMOA 4FOLA 4H31A 1ESZA 1XEXB 1KVTA 4NJMA 5TMDA 3SBDA 3UTCA 2HHAA 2IYQA 4BMZA 2FWPA 4MKHA 4QELA 4B32A 4BVGA 2FE1A 1PGQA 4KMMA 1VYTA 2P5SA 2QYSA 3GBPA 4AZ0A 2L19A 4V2UA 4EPWA 4UFPA 1XGKA 5CA1B 2JKVA 1FFGA 5JUWA 3B6ZA 4IHKA 5A4DA 1DWUA 2O8CB 1PR3A 5TQ0A 1QGED 1UBFA 2HIHA 3EMKA 1AB5A 1YZHA 3ILHA 3GMTA 5LQMA 2R00A 2P4EA 1WQ4A 3NAMA 2GM9A 1JXOA 2EZTA 3R5FA 1MVOA 1OXUA 3BD9A 4ACBA 4UVDA 3A9SA 4RE6A 1N6HA 5T4BA 1V5IA 1IQUA 3NUQA 4UQPA 4MW6A 2H4HA 3RREA 1Y9JA 3SG0A 3A1SA 3CT4A 1ZITA 2QL5A 2ICAA 4MP8A 3WK7A 3AI3A 2VJLA 4PF1A 4P3XA 4YXFA 4UNQA 4GXRA 5KSZA 3PEEA 5FO1A 1XTTA 1NI3A 4AYTA 1QAQA 4DV1B 5LYYA 4KSBA 1C3LA 1P0FA 1P5FA 2SECE 5IHXA 2D2IA 3H5OA 2Q3LA 1CQJB 4ZP1A 5T4HA 4CL2A 1BS9A 4ZV9A 3H11A 4HB3A 4J0GA 3BCHA 4KXWA 2WTXA 1ECLA 1G20E 2GCEA 1F8FA 4LHWA 1EUCA 1P75A 2JBAB 2QRUA 3FNEA 2XR1A 6NULA 5AW6A 4I5IA 1UMCA 4GNKA 3H0KA 4ND3A 4PQRA 5B58T 1PJAA 1VPEA 3U19A 3HYLA 4YT4A 5EKXA 3I5XA 2FMTA 4QQFA 1ZM4A 4ZQBA 2BEWB 4EJMA 2P9QA 3FZYA 1Z5NA 4G23A 1Q7EA 1Z25A 5A1JA 5EJ6A 1DEAA 3U2QA 5BXQC 3L79A 2F8MA 1YR6A 2EZ8A 3CXRA 3E5NA 1WMEA 3DNMA 3HJRA 3P5BA 4Q7MB 3RO7A 3L6CA 3URKA 2OD7A 2PGDA 5JYFA 4XCQA 4CXMA 4D46A 3DAPA 3LCUA 3AM4A 4Y9TA 3UAWA 3UGTA 1NUHA 3DMRA 2CLFB 3OP1A 1QOQB 1PQ4A 2EVWX 2V5VA 3CM0A 1YKSA 4WKNA 1GKUB 2BCEA 4CCSA 3ZE7A 3F4KA 3UYKA 3AB8A 4KKXB 5HSGA 2VBFA 4P58A 3RUHA 3BYZA 1THGA 3HBMA 2ZJ0A 3NOOA 3PICA 5CFLA 5A03A 2C04A 2CDNA 2I33A 3PNPA 3OHSX 2A3NA 1Q7RA 3BXFA 4FE3A 4KR0A 1ENYA 1LTKA 1IQRA 3FWZA 2IDZA 3RB8A 4G2NA 3IPYA 1SQSA 3KQSA 3S2SA 4FZ5A 3U7RA 2Q6TA 1GT91 1QTNA 5CDYA 2IYNA 2VPIA 1SEPA 5DASA 5ERXA 3QVKA 1NMQA 1U0LA 1YS6A 1GQSA 2MYPA 1CY6A 4JZKA 4WXEA 2HRBA 2BT4A 2NYRA 1N9ZA 3CE6A 6CHYA 1JVBA 1KPHA 3BJEA 2WQZA 2V7VA 2AOVA 5DXJA 2G63A 3BRWD 1KJWA 3KVRA 5DIZA 5PNTA 3ZBPA 3ZNOA 1OWPA 1R6TA 3KD3A 3KKMA 1J5EB 4B3JA 2G5PA 4E2WA 4MVJE 4E5KA 4ZD6A 2AFRA 5HFAA 2ZOSA 4YMGA 1OILA 1SPBS 2XVXA 2AMJA 3IP7A 3OZDA 1ZMOA 4MCHA 3WYEA 2IX9A 3N0TA 2ZUDA 3B5JA 1IY8A 1O6FA 4BO8A 3R7DA 1X1EA 3HWRA 1JGTA 4XAQA 5A0FA 1R27A 2J3DA 4TYQA 1I7CB 2JLYA 1HNZB 1J20A 4OKSA 1AGXA 4Z4GA 2DWCA 4O4JF 3IAEA 3SHTA 3KUDA 1KI2A 1JH8A 2IF2A 4M3NA 5DNUA 1SXPA 4ZYZA 3U1TA 2CKMA 4EVQA 4FT4A 1V3VA 5F7OA 3OZFA 4JX9A 4JBLA 3RCBA 2GKSA 2QU7A 4U7WA 4OX9Y 4G4SO 1HE2A 1L6RA 3MRTA 2C4TA 3QPAA 2VDUE 2O8EA 5CB8A 2P4QA 5B37A 2Z2ZA 1B3BA 4OPMA 3NBAA 2CV1A 3FI0A 2ERYA 4EYKA 3HKBB 4DR7B 5IJ9B 1MP0A 2NO4A 3E27A 1JZSA 1WDTA 2HQBA 3GJ5A 3HXQA 4QULA 1MHMB 1N0VC 3QVVA 5ICMA 1CR1A 1Z4PX 1T2AA 3DZJA 5JDIA 4NCJA 3PQVA 3R0XA 4B4VA 3EG9B 1QO0A 4KO8A