3ZCXA

Structure of gapdh from thermosynechococcus elongatus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
b'SMVRVAINGFGRIGRNFMRCWLQRKANSKLEIVGINDTSDPRTNAHLLKYDSMLGIFQDAEITADDDCIYAGGHAVKCVSDRNPENLPWSAWGIDLVIEATGVFTSREGASKHLSAGAKKVLITAPGKGNIPTYVVGVNHHTYDPSEDIVSNASCTTNCLAPIVKVLHEAFGIQQGMMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVGLVIPELQGKLNGIALRVPTPNVSVVDFVAQVEKPTIAEQVNQVIKEASETTMKGIIHYSELELVSSDYRGHNASSILDASLTMVLGGNLVKVVAWYDNEWGYSQRVLDLAEHMAAHWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
publication title Structure of Gapdh
rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
total genus 116
structure length 338
sequence length 338
chains with identical sequence B
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3zcxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3zcxA01
4OH1A 5BSGA 1MUUA 4JX8A 3JD1A 1DOHA 4FGWA 3WTCA 3QWBA 2GN6A 1O0SA 2VYVD 1O89A 2DC1A 4MJLA 1LX6A 1MC4A 1NFFA 2HMTA 5JYEA 2QHXA 2LDXA 4JGBA 3A1NA 2D0IA 3BHJA 4XDYA 1EBFA 2J3HA 4LISA 2PZJA 3GGGA 4MVJP 2DTEA 4PVCA 1DFGA 5FF9A 1B26A 1C14A 5AOVA 3ZWNA 4TRNA 4PRLA 3FTNA 2O3SA 3ZWWA 4YJDA 2PY6A 1PL8A 1VC2A 4DPLA 1H6DA 4IQGA 4EGFA 4JJIA 3M2PA 4KOAA 3ANNA 3O8QB 3ANMA 1PZFA 1E3SA 3NT2A 4Z9XA 2CDCA 1EE9A 5EIOA 3VVBA 1CQIA 2B35A 2ZTMA 2C7VA 2X9GA 5TJ9A 4C7JA 1EBUA 3DBLB 1TT7A 4DIOA 3AW9A 3RFXA 1ZW1A 1CETA 3ZWCA 4RPLA 2G17A 2NVWA 3OM9A 2EG9A 2ET6A 2EHDA 3OSUA 3L9WA 4UEJA 3D1LA 2I3GA 1LRLA 1Y5MA 1HETA 2IEBA 4PLHA 1LJ8A 1HDCA 2EKPA 4G65A 3IUPA 3PHIA 1ISMA 1R4NA 2HRZA 2OP1A 3PTZA 4XYBA 4L8VA 1QYWA 1UUFA 5TC4A 4A03A 1B0AA 4AICA 3K9QO 1XGKA 3FRJA 1E6EA 2LDBA 3BMCB 4FJ0A 3CTMA 3K6JA 3PQEA 1OBFO 3JD2A 3DBRB 3KTDA 1W73A 4Q39A 4Y8VA 2GN4A 1S6YA 4DPMA 3C1OA 2GZ1A 2Q49A 2O3TA 3MWDB 4A27A 3NTOA 2ZYGA 2Z95A 5A5EA 1NHGA 1NR7A 3ASVA 3H8VA 1DEHA 4WNCA 2Y1GA 3O4RA 1AXEA 1V0JA 2DPGA 4TVOA 3L6EA 3O9ZA 4KUHA 1U4OA 3I9OA 2DPHA 5KVCA 3RCBA 3S55A 1XELA 4EZBA 4O5OA 1ENYA 1YBMA 3FNHA 4IBOA 1QYVA 3INTA 2GO1A 4K1LA 2VHZA 3GHHA 3RBZA 2FMUA 3RQSA 4W6ZA 1D7OA 1EVYA 3HB4X 2Q3EA 4JBIA 4P4LA 4CLRA 1GQYA 3GPIA 1EQ2A 4AL4A 1IE3A 4J9VA 1HRDA 3WJAA 5CDUA 1J4AA 1ZVMA 2GZ2A 5A1TA 2AG5A 2G0TA 4RCVA 1T2AA 4GX0A 2O4CA 3GK3A 4LSMA 2JD0A 1C1DB 1HTBA 2A35A 1M67A 2C2XA 1LXCA 1ENPA 1R4MB 2B37A 3ZI0A 2OHXA 4N5MA 5KJ1A 3HWRA 3KYBA 4RL6A 3WGTA 1PWXA 3K2BA 4YJHB 3F1LA 3DMYA 4E2YA 2Y0EA 4DREA 2YJZA 3E1KA 3ZWMA 3BTSA 2B5VA 4JN6B 3DC2A 3T7EA 4NU6A 3PIIA 1F0YA 3KEOA 3RU9A 3RUEA 3TZHA 3WGHA 3QV1A 4DC0A 2DUUA 1L7EA 1GD1O 3C8MA 3GMSA 5DN9A 2VUUA 3PYLA 3TZ6A 3IMFA 3B20A 1GPJA 3M1AA 2X4GA 1IZ0A 3LZ6A 3KYCA 4FOSA 4XQGA 1LDMA 1U8XX 3TZQA 3RC1A 1I3LA 4K6FA 4BKUA 4YAJA 4PG6A 1C1XA 2FOIA 2AEJA 3NEPX 1RM0A 4J4BA 1Y1PA 2AE1A 4YRBA 3DL2A 4WGGA 2DKNA 3Q2KA 1OAAA 5B4TA 4PLTA 4FQ8A 4AFNA 5GY7A 5T64A 3E9MA 2QYSA 2JAHA 4B3JA 5BQFA 1CWUA 5G0VA 2GD1O 1ISGA 5FWNA 1YGYA 2HAEA 3ZHYA 2Q1WA 2O7SA 1BVRA 1X0VA 3WMWA 1DIGA 1HLPA 1PJSA 4JNKA 1DB3A 5TJHA 2FY8A 1C3VA 1WMBA 4HFNA 5A4DA 1DC6A 1HDXA 1QRRA 4CL3A 1ZSNA 2RH4A 4TZTA 4RORA 3MJCA 4RGBA 2HSDA 3S2IA 1Q0LA 3M2TA 1BMDA 1NNUA 1VL6A 1YQDA 4CUKA 4CQLA 3WTBA 3OEWA 2P5YA 1I8TA 2CF6A 2F1KA 2JFGA 3VVCA 3VH1A 2VRBA 5IN4A 3NYWA 5L4LA 3JQAA 1SEPA 3WJ7A 1MXFA 3AY6A 4PLZA 1PGOA 4BGIA 3MZ0A 3DZJA 3TJRA 2PK3A 3ABIA 1KEUA 4BGEA 4DPKA 4DVJA 4B4VA 1Z6ZA 5G4LA 2C7GA 5HS6A 3U49A 4BGVA 4NNJA 3V1TC 5IDXA 1Z45A 5KKAA 2BFPA 5L95A 1NTOA 3KB6A 3PK0A 4YQYA 1OFGA 2ZYDA 1PIWA 3A4VA 1ML3A 4IDDA 3DHEA 1Y8RA 4YAEA 1DIHA 5KCZA 4IQ8A 3RC2A 1NM5A 3NKLA 3ITKA 2PD6A 5M6DA 3WOHA 4GMGA 4HV4A 1LRJA 1ZK0A 4QECA 1U28A 3OECA 1ULSA 1GADO 4GSKA 1U9JA 1AXGA 4LCEA 4NFHA 5DBGA 2J5RA 3QLJA 4Y6SA 2GYYA 3RVDA 2VOJA 2VZ0A 3O26A 5U4QA 1PGQA 3FHLA 1D1TA 1BDMA 4LRSB 1FDTA 1R4NB 2V6MA 2E49A 3HUDA 3QHAA 3UXYA 1K0UA 1BG6A 1VJ1A 1N7GA 3GEMA 2ZB7A 4WKGA 5CDSA 3JD4A 1EUZA 5ITWA 4TSKA 1XU7A 1ZUD1 3D3WA 1NQAO 1T1RA 3TZCA 3N58A 3V2GA 3TNLA 1F06A 4DBZA 1JA9A 1V8BA 5JYDA 5HRUA 4AVYA 1JAYA 4PG8A 4Z6KA 4D45A 1NPYA 3TPCA 1GL3A 3OIGA 3N74A 3HB5X 1ISHA 2O50A 4RZIA 2YW9A 4NU5A 4XDZA 4IDEA 2FP4A 4KDEA 2BF7A 4I5FA 3GPDG 1JKIA 4Z3DA 4PG7A 4I5DA 4BNGA 3H2SA 5B4UA 1BSVA 2P9GA 2GNAA 3FWZA 4IDCA 1C0PA 2JAPA 3H65A 1WDLA 3QVXA 1I01A 3LT1A 1HWYA 4B8WA 2VYVA 5L45A 1GUYA 1NYTA 3GMDA 1TEHA 1P1HA 1AN9A 4MOWA 4BNKA 3OJEA 3GDGA 2VHWA 4U6SA 3U4DA 2FN7A 4PGFA 1SC6A 5T8KC 1NQOA 2I3AA 1IPEA 4CLRB 4DGSA 2OMEA 4JXKA 4PLWA 1PJCA 4TZKA 4YACA 4RPKA 1FDSA 2NNLD 3F9IA 4WCFA 5A3JA 4P8RA 1A71A 3D4NA 1V35A 5A04A 2HUNA 2V7PA 1LC3A 3EC7A 2PWZA 3I4CA 4WUVA 3VZSA 4ALMA 1U3TA 4B4OA 1GQQA 4NBTA 2BGKA 1KBZA 2BGMA 2YYYA 1K2WA 2O3QA 4P22A 4R1TA 1PU2A 4XR9A 4BO1A 4E32A 4MVJH 1DIBA 3NDJA 4MIOA 1YH3A 3I9KA 5DP1A 1DIRA 3ON5A 1NAHA 1EUDA 1P9LA 2HLPA 3RI3A 2AMFA 4ALNA 1XQ1A 1QYDA 5KOIA 1W6UA 2Y68A 3ZU4A 4DRYA 2HDHA 2X58A 2AEMA 1M66A 4U0JA 5T6BA 5AYVA 4A0SA 3FD8A 2DBZA 3GF4A 3JQEA 4O0LA 4R16A 2AE2A 1CIVA 3KYCB 1A7KA 4D3SA 3PQFA 4XQEA 4BNZA 3GVCA 3ADOA 3OJ0A 1WZIA 4W99A 5KVQA 1P1IA 1E6UA 1XHLA 1C1XB 5KIAA 2JJYA 2FSVA 5F1KA 1RWBA 4IM7A 4NBVA 2NU9A 3Q3CA 2UVDA 3D3EA 3ZWXA 2I5PO 1SBYA 3GVHA 3SJ7A 3TOXA 1WVGA 1WPQA 1D8AA 2PKQP 4QFDA 1GZ6A 3HDJA 4FW8A 2CSUA 3D4PA 1LDGA 1AGNA 1X15A 2FHSA 2Y05A 3JQDA 4FBGA 1UZNA 3WYEA 5CEJA 9LDTA 4IQ0A 3HSKA 4GX5A 4F6CA 3RAJA 3VTZA 4L4XA 3LLSA 4D46A 5JCXA 1ZEJA 1CEQA 3LC2O 1SCUA 4XRGA 4YA6A 3NRCA 4I5EA 4NFYA 4NIMA 1WP4A 4J4TA 2UUPA 3CEAA 4YT2A 1I33A 1P31A 3VHRA 5CP8A 5LCXA 4JK3A 2GR9A 4HUJA 3VKUA 1LSOA 4NH4A 2WYUA 3JQFA 1LQTA 1Y9EA 1KC3A 3MOIA 1PGNA 1LA2A 4YBZA 4CQLB 1LLDA 4W7HA 2AW5A 1N1GA 2PZMA 2PGLA 4BMVA 5F5LA 1XQ6A 1IPFA 4IDAA 4MPDA 3LT4A 4Z9YA 4RPGA 3X2FA 3JQAB 4EW6A 2WJPA 1EZ4A 2GASA 4YT4A 1K6JA 5ILGA 4KUEA 4WLFA 2X0NA 3ZW8A 4GGPA 3KYDA 1RPNA 2HMWA 3I5MA 1NPDA 3GY0A 4IPTA 4E2WA 5A03A 1NQTA 4J4HA 2BFMA 1E7RA 4PZEA 5C37A 4M87A 1E3WA 1YO6A 4MVJF 2IYPA 3B6ZA 3EHEA 4PLPA 3WMXA 2AQIA 3M1LA 4WJZA 2JCXA 1O6ZA 1Y8RB 5KKCA 1HE3A 2VT3A 4ZN6A 1TXGA 2SCUA 3WX0A 4OL9A 4CM6A 3WFIA 3PPIA 4DLLA 1E3IA 2OZPA 1KYQA 3HN7A 3ZWBA 2UDPA 2JD1A 3WLFA 1ZXLA 3ZWYA 2W8ZA 4BVAA 1DC5A 1TB4A 4IY1A 3H7AA 4J90A 5ER9A 1PS8A 1XIVA 1A4IA 5IJZA 4CM4A 5JXWA 4CMCA 4Z0TA 3IP1A 1ISIA 1DIAA 2FWMX 1BXGA 2JHFA 3ZV5A 4W9NA 4R4JA 4NPCA 3GFBA 5CDYA 5DNAA 5IDYA 3D3WB 2DAPA 2V65A 1B8PA 2Q22A 3H9EO 1NBOA 1JW9B 1XKQA 1VJ0A 4G81A 4NR0A 4GBJA 4MKRA 3FTPA 3AK4A 4P4NA 2RH8A 2W2LD 4W82A 1B3RA 2RAFA 4ZQGA 3Q1LA 1UAYA 4CMJA 5G0WA 4D3FA 4RVDA 4AJPA 1V3VA 4ID9A 4JROA 5A3VA 4OKNA 2WSBA 1U3WA 2V6GA 3PGJA 3HE3A 3PFFA 3E9NA 3Q2IA 4UEOA 3RUAA 2CF5A 1U3UA 1HL3A 3QWAA 4GVXA 2A94A 2EV9A 5IZCA 4AJNA 4FC7A 2CZCA 4MP6A 2IYOA 2YDXA 3F5QA 2QX7A 3RUFA 2VUTA 3L4BA 3RKUA 5BR7A 2RHRA 1E6WA 5THQA 1DC3A 3S2FA 3ITDA 3B1FA 4B79A 3ICCA 4PZDA 5HWSA 4YT8A 3C24A 1RM4A 3PEFA 3JQ9A 3DBVO 5TT0A 1HE2A 2YV3A 3RUDA 4W4TA 5J9GA 4EUFA 1YOVA 3RUHA 1VKOA 1H6CA 1R66A 1GZ4A 3VTFA 3LU1A 2VYNA 3KV3O 1DFIA 4LCJA 4QT0A 2HJSA 4BHTA 5CFZA 2QYTA 1I36A 2FPIA 1KVSA 1A4UA 1E1MA 1A9YA 4E2ZA 1ZKMA 4OGWA 2ZYAA 5CDTA 2VQ3A 1E5QA 2VOEA 4RV9A 2B4QA 3IKVA 3OEYA 5I8ZA 1FJHA 1ZO8A 4Y98A 5TLSA 1NVMB 4ND5A 4BNYA 2C29D 2BGLA 3FF4A 3IDSA 4CLHA 3IJPA 5F1OA 2UV8A 4RPJA 4E5PA 5FI5A 3JD3A 3ZGYA 4A2CA 3I4FA 2DT5A 5HA5A 1Y81A 3U9LA 1E3JA 1P3DA 5TSDA 2EP7A 1U5CA 1B2LA 2IODA 3HDYA 1YB5A 3INRA 1QSGA 5U1PA 4E5KA 4GI2A 3L07A 4A5OA 3HNPA 2E4AA 3AOEC 3VPXA 3OQ6A 2IXBA 4U8GA 5TRTA 3GVPA 5JDCC 2HCTA 4ALKA 3DHYA 3PQDA 4TVBA 2PZLA 8ADHA 1VL0A 3E5RA 2GF2A 1XEAA 2AA3A 4J49A 1U7HA 1WXDA 3PZRA 3SEFA 1X1EA 2H63A 3EVNA 3NT4A 2QG4A 3FBTA 3NJ4A 4B7UA 2ZTVA 4JCOA 3BTOA 1QYXA 4A7PA 4BIIA 1X14A 1ADCA 1MC5A 1R16A 1V6AA 3ASUA 4XGIA 4B3IA 3JYPA 4AJEA 5AXAA 1HDGO 1H2BA 1U7TA 3UF0A 2C5EA 2J8ZA 1BXZA 4YAIA 4GGOA 5DDIP 3HDHA 5JYFA 4YB8A 1GY8A 1WNTA 2VZ9A 4M8SA 4BNXA 3EW7A 3KO8A 3BTUA 3VKVA 1Z82A 4CR6A 1NVTA 1EDZA 4IUYA 4FFNA 4OMUA 3K5PA 4MIEA 1ZMOA 2POQX 2Y99A 3GVXA 4HFJA 1LU9A 5JY1A 4IDBA 3OP4A 2NU8A 3KZVA 4AJLA 5JCJD 4XQ9A 2NTJA 4F3YA 1MP0A 3ZNNA 1JWAB 3AUSA 4FN4A 4M1QA 5G0UA 4IIUA 5KNLA 4K28A 4XX0A 1BGVA 3ICPA 3RJ5A 5HM8A 2WE8A 1TI7A 1FDVA 3HHPA 3QIVA 4CM1A 4RVUA 4GMFA 4YYZA 1B8UA 5I9NA 1H2HA 4BO9A 5BNTA 3PXXA 3AFMA 3WLEA 3NAQA 3WYBA 2VWHA 5A9SA 2ZKLA 3K2EA 3KYDB 3WYCA 1D3AA 3PWZA 1UZMA 2X23A 3R3SA 3JQ7A 3IC5A 3PHJA 4E31A 5I8WA 3HN2A 4WOJA 1R12A 3HFGA 2IEDA 5H83A 1E3WB 5AXDA 5EQDA 3ZWPA 4BNFA 4XIYA 3PGXA 4R9RA 1VLLA 1N9GA 2QQ5A 3AI3A 4BNMA 3PHGA 4R01A 4JP3A 4AJIA 3EZLA 5DOVA 3FPLA 4L75A 1KVRA 4RLSA 3F46A 1V3TA 1NP3A 5JAIA 1XWFA 3PP8A 2X5KO 1JAXA 2DFVA 2X86A 2R2GA 4DTIA 3IIEA 4CM9D 1K6IA 2J5QA 3MEQA 3CE6A 3OQBA 4L76A 1Z73A 4DWVA 4CM4B 1LEHA 4XJSA 4AJJA 2QRLA 3K30A 3AFNA 4J43A 1O5IA 2PV7A 3LC7O 2EIHA 4YRAA 1EDOA 3L77A 3MCVA 2YFQA 3D0OA 3KSUA 3UH1A 1DDOA 1E92A 1P74A 2OP0A 3L4BC 3VPGA 5DCYA 3PRJA 5JLAA 4DBVO 1D4FA 2VNSA 2P9CA 5TQVA 3EMKA 2BLLA 3JQ9C 3GAFA 2ZCVA 5IFLA 1OOEA 1WZEA 2EEZA 2Y1CA 3ADPA 1U1IA 4ZQHA 2I9PA 3U3XA 2PD3A 2PNFA 2CVZA 3L6DA 4ZU3A 2OOSA 1FDUA 3AU8A 2J3JA 2NTVA 2PD4A 1YS4A 4LK3A 4KMSA 4YJGA 4RDIA 3WIEA 1K6XA 3HQ4O 4R5HA 1UXIA 4IGEA 4Q3CA 2Z5LA 4XGNA 2ZTUA 3V1UA 5COQA 1U2DA 4YPOA 2NSDA 4BO4A 3AI2A 1NR1A 2GDZA 1LLCA 2C20A 4IGFA 2OORA 2X9VA 4OQZA 3DTYA 2P9EA 1T26A 2FPGA 5JO9A 3G1TA 1T2CA 3RWBA 4ZRNA 3I52A 4I5GA 1HE4A 3VPSA 1Y9AA 4XYMA 3SX2A 2BRUA 4ALLA 2HRBA 2V6BA 4WASA 5G0SA 3NTQA 3CINA 4ZD6A 5COAA 4WPGA 1YOVB 2HK9A 3QP9A 5H82A 1OI7A 1NQ5A 2H5LA 4FS3A 5IXYA 3JQGA 1HDZA 1KIFA 3PLNA 5HBRA 2EP5A 2J3KA 5A9RA 3BTVA 2DQ4A 1GUZA 1N2SA 4B3HA 3W4JA 1BXKA 2D8AA 2UAGA 4FCCA 1GYQA 4TRMA 3W6UA 4BKRA 4URFA 4I9NA 2O3RA 3MJSA 1UR5A 2B69A 3WXBA 5K6AA 4FFLA 4JQCA 4XEHA 4UUOA 2P68A 1RYDA 1YJ8A 1YQXA 1BHSA 5BSHA 5ILOA 5C7IO 4BOYA 4GSLA 5ENDA 3IKTA 5BNFA 4UVDA 2WEKA 4CR8A 4NMHA 4D7AA 5BNIA 1NVGA 3ZU5A 1TA4A 1G6KA 3OA2A 1P44A 1PZHA 2Q99A 3E5MA 3QWHA 4NBWA 3UICA 4D3DA 1JN0A 3U62A 3VOSA 1KS9A 2WYWA 2EW2A 4EJ6A 1M75A 2IRWA 4BV8A 3WWZA 1B15A 3WGOA 4GWKA 3IP3A 4DYVA 5DOZA 1H6AA 4R3WA 3KUXA 4XB1A 2W2LA 3SC6A 5JFOA 1YBVA 1U5AA 3G79A 3I9LA 3RKRA 3F3SA 4DMLA 2D5CA 2JFHA 1K89A 5DF1A 3RJ9A 5BSFA 5A9TA 3QE3A 1YDWA 1X7HA 3H9QA 1CF2O 3HJAA 4FJ2A 4AJHA 5KJFA 1BVUA 4NJMA 2PTGA 3GZNA 3WIDA 1LC0A 2O3UA 4LSWA 4ROSA 1GZ3A 1GYPA 1VM6A 2AEFA 1XU9A 1SO8A 3TZKA 2H6EA 2IE0A 3VDRA 1P1FA 1FF9A 5I7VA 1TLTA 1HF3A 2C5AA 4P4GA 4KTTE 3KM0A 3JYQA 3BYZA 4R9SA 3BZUA 2VRCD 1BW9A 3OBBA 5GMOA 1M76A 4EUEA 2CVOA 5F5NA 5CPFA 3PYMA 4XYLA 1LSJA 3Q11A 5ENVA 4CMEA 1DSSG 4BNLA 2QZ9A 5JO0A 1B3BA 1UDBA 5DBFA 3R3JA 3A9WA 3WGIA 1LI4A 2GSDA 1R15A 2RCYA 5KVVA 2VYND 4WLUA 3VPFA 5A9SB 2R00A 3E6AA 5DP2A 1SB8A 3JQ7B 4AJ2A 5CHEA 1Q2XA 2EJWA 1PS0A 1YB1A 3WSWA 4YWJA 1UXGA 2GN9A 1I2BA 1SEVA 3QSGA 1R0LA 1P0CA 5ER6A 4CLEA 3CIFA 1N9GB 1AUPA 4HNHA 3GGPA 1O9BA 4XJTA 3U4HA 1LDEA 1DPGA 2DVMA 1RM3A 5C3MA 2VT2A 3AOGA 3H3FA 1UP4A 3PVZA 3WGYA 3GDFA 3PLRA 1NPTO 5BSEA 1ZSVA 3ZNQA 3GNTA 4DL9A 2EXXA 3KSDO 3HDQA 1UP6A 4O1MA 4PRKA 3T4EA 5B37A 1XSEA 5LDHA 3B1JA 3MJ4A 3UAGA 1ISFA 4NDNE 2E48A 1YJQA 3DONA 2EWMA 2CY0A 1HSZA 3GFGA 2OUIA 2I99A 3QRWA 2P5UA 4BB5A 5EESA 1R0SA 4BNVA 3I3OA 1Q0QA 5H81A 1UXKA 2O2SA 2YQ5A 5ADHA 3ANLA 4PCVA 1CRWG 3BHMA 5HTOA 3QY9A 2R6JA 2WM3A 3GZ4A 3H6KA 4BO8A 3VPHA 3OJOA 2G76A 1F12A 4GVLA 4R5MA 3LVFO 1C0IA 4YJGB 4R3NA 4C7KA 3VC7A 1UDAA 3WQRA 1AHHA 3LC1O 2W90A 4LRTB 5JCJA 3JQ8A 5K6AC 1LDYA 4LGVA 2Q2WA 4TMFA 1HDRA 1PJLA 2AXQA 2HK7A 3CKYA 3QVWA 3INGA 2P2SA 1H5QA 4J3FA 4OSPA 2A9FA 3FCOA 1IB6A 4D42A 1YE3A 2D5AA 1GYRA 4CPDA 3PHHA 3KETA 3VH3A 3PWSA 4BNIA 4CL8A 3GUCA 2O3JA 3CZMA 4GL4A 2JL1A 2HMUA 1X7GA 5TIIA 1HKUA 2Y1FA 3VZPA 3RC7A 1Z7BA 3UN1A 3JQGB 5KJ6A 3WWYA 5F3RA 1RKXA 3C7CB 4YR9A 4RF5A 1U3VA 1NFRA 1HT0A 3TSCA 2JCYA 3DZFA 3IOYA 1ONPA 4HX5A 1DJNA 2FR0A 3GRKA 3W1VA 5G2OA 3RUCA 3QQPA 1X0XA 4YAKA 3B1KA 4II3A 2Y0CA 1SAYA 2X22A 2I66A 2ZIZA 1A9ZA 5CDGA 1CQJA 3JQBA 2BHLA 2BI8A 4INAA 3G1UA 4GKVA 1FMCA 4J2OA 2Q50A 2BFOA 5C7OO 4J1TA 4HADA 3O03A 2ZCUA 4CM9A 4Q9NA 2PH3A 3DZBA 3GT0A 2DFDA 1JDJA 4WLOA 1GU7A 2JKVA 4P38A 1VKNA 2JD2A 5EL0A 4KUGA 1K3TA 1JVBA 3VZQA 3CMMA 1UJMA 4OIMA 3RFVA 1ENZA 1LLQA 2NWQA 4GX1A 3FR7A 1X13A 5FYDA 1ZXBA 5LDGA 3NUGA 1ADFA 3DZIA 1MA0A 1DAOA 1GCOA 4XGKA 3I6IA 3JCZA 3GN1A 1QV6A 2WD7A 2AQHA 4I1IA 3KLPX 5JMWA 3S1LA 4CMHA 1HYHA 4MVJM 2Y1OA 2D59A 1AHIA 5JY6A 1RYEA 2DTXA 4G5HA 2Y1DA 4U6QA 2UUOA 2YFHA 4RVSA 1EK6A 2VWQA 4XWYA 5JS6A 1MGOA 4FOOA 3MOGA 4WEQA 3I23A 1E7QA 1YL5A 4KWIA 1YB4A 4CQMD 4A10A 3JD0A 5JDIA 4L4RA 2B5WA 4E33A 4UEKA 2E37A 2B4TO 1UXHA 4NJMB 4NBRA 2R00C 2YV2A 1JKJA 3GZNB 2I65A 1MG5A 3HG7A 4AJ4A 1DFHA 4BO6A 1EUCA 5IAAA 1YBAA 3F1KA 1WLYA 4GPD1 2RHCA 5EN4A 3EK2A 3Q6IA 3GQVA 3MJTA 1TT5A 3A28A 3JYLA 3ULKA 1O94A 3ZV4A 3WGZA 1VPDA 4FGSA 4BQRA 5I9LA 2G1UA 3EGOA 4BO3A 4GAEA 5KJEA 3GN2A 2O2YA 2PR2A 1IHYA 3WBBA 1BW9B 2Y67A 4N5NA 3Q0EA 1HYGA 2I6TA 1SZJG 4MP8A 3W8EA 1UP7A 2VHYA 3ZV3A 3U4CA 5L7TA 1GDHA 1I30A 3NDIA 5B12A 1FK8A 4HP8A 4IJWA 2OBYA 4DXHA 5A06A 5C7LO 4BNUA 3DB2A 3WDSA 2EKLA 4BKPA 1PL6A 5AXCA 4R1UA 1IYZA 4D41A 3GUYA 1NWCA 4ND2A 1ORRA 4YQZA 5JAQA 1ARZA 1QXSA 4B7CA 4N7RA 1IUKA 3ORFA 1V9LA 3ENNA 2CDBA 3I83A 4E5NA 4TRJA 3HZZA 3FSRA 1ZMTA 4IJVA 4ZQEA 3COSA 2VTDA 2X0JA 2WMDA 1L7DA 1LBEA 5IZ4A 4FFOA 1GCUA 4AJOA 3N7UA 2C07A 1PTJA 4XZ3A 3TFOA 3F47A 1GAEO 2EGGA 1T1SA 4J91A 1MXHA 3DMTA 5I9MA 3PHLA 3FPCA 1L1FA 2YZ7A 4R1SA 3JTMA 3L6OO 4ZQFA 1ZIDA 2DLDA 1IL0A 3D5TA 4J1QA 1Z75A 3GOHA 4QO7A 1N92A 3JV7A 3EUWA 3G17A 2DBRA 4OXYA 4A26A 5A02A 1G0NA 1OZAA 1NFQA 4ZHSA 1ONOA 1SOVA 2YV1A 1V3UA 5CPBA 4NJOA 3TL2A 3DEYX 2J6IA 4TKMA 4PN3A 2OBNA 3OIFA 5IXSA 3GNSA 3PYXA 4TROA 2B36A 1H93A 4R54A 4DC1A 5IF3A 3GH3A 1H9BA 4WCFC 2IZ1A 4DA9A 3LSYA 1ZNQO 3L4SO 1BTOA 1WDMA 4EEXA 3JSAA 3DFUA 5JW6A 1HE5A 5BT9A 1DRUA 1GPDG 4E0BA 5JPIA 1PR3A 3OICA 2HKIA 3H5RA 2OO5A 1M6HA 1HEUA 1Y5RA 2CUKA 1C0KA 1ZSYA 1MV8A 1B8VA 2VHVA 5TNXA 3ZHBA 2HJRA 4BL5A 4K26A 5COBA 2Z1MA 3JQ8B 4NZ9A 4UVIA 1QKIA 5EERA 3EDMA 2EW8A 3AUUA 4DYDA 3H9GA 2VRCA 5A05A 1JQBA 2XXBA 4WLNA 2GPTA 5TX7A 4CV1A 3RBVA 1RM5A 2FR1A 2JCVA 1ZK1A 2J3IA 1PQUA 4WCDA 3S8MA 4U7WA 4A73A 4CMKA 3ONEA 4EITA 5IDQA 1F8GA 3QVOA 1BDBA 4WCFB 3RASA 4FDAA 4NK5A 4BGUA 4DIBA 4M89A 2WWRA 4CLXA 4S3MA 7MDHA 3IUSA 1HSOA 4R41A 1DLIA 3EY4A 3UCEA 2C54A 3NT5A 2D2IA 1LSSA 3EZYA 5I7SA 1YL6A 4PLCA 2BI7A 1GUFA 3PJFA 4IIVA 4PLGA 3GNQA 3GAZA 4Q3BA 4E13A 4M55A 2GZ3A 4AJKA 3MJVA 1Y6JA 2H9IA 4YTEA 1N1EA 3NJ8A 5CEEA 3CMCO 1PJQA 1WAMA 4H16A 1R37A 2YY7A 3AUTA 4E21A 5KTKA 1C1DA 3DHNA 4HY3A 3BHIA 2X0RA 5L53A 1X7DA 1ZK4A 4Y9DA 4H7PA 3ROKA 5GZ3A 3CXRA 4XYEA 3DR3A 3WGQA 4RF3A 1ZEMA 1VE9A 1CDOA 1ID1A 2QRKA 1B16A 1WW8A 3FNGA 2X8LA 4H15A 4MO2A 2D3TA 2FZWA 2Z1NA 4EDFA 3WNVA 1JWBB 4DQUA 1NASA 1HYEA 4RF2A 1W8DA 4ND3A 3JYNA 4BS9A 4CUZA 5DCWA 4FFRA 4GLLA 3PZBA 3JQFC 4BO5A 2O4UX 2X5JO 5T73A 4D0RA 4CLOA 5GZ1A 4MVJE 3F5SA 2WD7B 4BUCA 2VCYA 5T5QA 3C85A 3KRTA 4RVHA 4EUHA 4EYEA 4RQTA 4TRRA 3P2OA 1EEHA 4YCAA 1YXMA 4ND1A 3QVSA 5FEUA 1Q1NA 5FI3A 3W8DA 3CH6A 1P1JA 1H94A 1LSUA 1PJ3A 4BV9A 2Y93A 3DBHA 5K9ZA 3D4OA 3O38A 4HFMA 4QX6A 4L9RA 3DXFA 4IS3A 3VDQA 3RIHA 2X5OA 3SVTA 4L74A 1ZBQA 1T2FA 4CMGA 5KWEA 4FSHA 3WQQA 4AG3A 2IZ0A 1KVUA 4IXTA 4J9UE 3IL2A 3TFQA 1IULA 1TT5B 3H3JA 5DT9A 3RC9A 1ADBA 4K6CA 1MFZA 4W7IA 4BKQA 3WSVA 1EVZA 1T2EA 2TMDA 4I9HA 1O95A 5FFFA 2NV6A 1P0FA 3OQ1A 2DM6A 1Q0HA 3GG2A 4WEOA 3UVEA 3FNEA 3F4BA 3W4IA 8LDHA 3UUWA 1UXJA 4F45A 3DMTC 1XA0A 3DQPA 3WFJA 4OSOA 5ICMA 4E12A 3R6DA 3OJLA 3I6QA 2YUTA 4R68A 4ZQBA 4W9NC 4OJNA 3SLGA 4BNHA 1J5PA 2Q2QA 4B4WA 1ZFNA 2P4HX 3CPSA 1NHWA 4CMAA 3DAFA 3RBXA 3V2HA 2X7HA 1H0KA 4UAGA 2PGDA 4CMIA 3OMLA 4ZICA 4J7XA 1I32A 4EBFA 7ADHA 1SOWA 2G82A 3GLQA 4K9DA 1FDWA 3ZH2A 3IJRA 2PKQO 4MP3A 4FFPA 2Q46A 5ITVA 3GGOA 5JAMA 4RVFA 2NADA 3OHSX 3AWDA 5EMHA 4GKBA 3DTTA 3U4IA 3ZV6A 3GEDA 3AM4A 1PJ4A 1YDEA 3TL3A 1PZEA 4OAQA 5IZCC 1BXGB 3QW2A 4CODB 4HKTA 2C0CA 5JC1A 4XCVA 1F17A 4Q3AA 4Q3DA 5L4NA 2ZJ0A 3B70A 4M49A 4PIVA 4Q3NA 1LUAA 2W2KA 2Y0DA 1GEEA 1QP8A 3G49A 3ZNPA 3R0IA 1EVIA 1SMKA 4JBGA 3DZHA 4KWHA 4XA8A 3PIDA 4E6PA 3U09A 5CG1A 4ITUA 4CQMA 2GLXA 2X1HA 1KOLA 1E7WA 5K0ZA 3FBGA 4U0KA 4X54A 3QVTA 5I7EA 2QRJA 3E03A 4J1NA 5TF4A 2CVQA 4YDRA 3VH4A 3C3XA 3GR6A 5JC8A 3CSDA 5B4VA 3ETEA 1G1AA 1MFPA 2Q45A 4L0QA 3U0BA 1E7SA 5AQ1A 1KY5A 1OC4A 3NGLA 4Z0HO 3Q9UA 5EQFA 3WG9A 1W0CA 3SXPA 4IDFA 3GDOA 5TT1A 4IS2A 4ZA2A 4JJGA 1EMDA 4CM8A 4RJTA 3ZN2A 5JSFA 2BELA 1A27A 3NV9A 3WNQA 2NU7A 1M2WA 2E82A 3CZRA 1LQUA 2Y1EA 4J2HA 4LW8A 4KP7A 1YONA 5F21A 4HBGA 3ZDFA 4M86A 1DLJA 1WWKA 1XYGA 1NX6A 1Q7CA 4YEDA 4Z9FA 2X9NA 4CR7A 2NUAA 3H5AA 4IJUA 4KZPA 3R1IA 3D5QA 1PGPA 2RIRA 3AU9A 5JAZA 3FNFA 3ZWAA 4EJMA 1Q7GA 3PJDA 5IN5A 2VUSA 4ZVVA 4ALJA 3UGKA 2QW8A 4E5MA 1SNYA 1XDWA 3A06A 2A92A 2NVBA 4D0SA 4DUPA 4PVDA 3ENKA 2AQKA 4PLFA 4DLAA 3E48A 1T24A 2DTDA 5L4SA 1JU9A 2ZJ1A 1P1RA 4Z0PA 3I9MA 4F6LA 4N54A 5DULA 1JTVA 1RJWA 2BH9A 1EK5A 1GEGA 2ZK7A 4L73A 5JMPA 3W4KA 1P45A 2PKRA 3KEQA 3K73O 1A7AA 2E6UX 4ZGWA 3HFSA 2EJVA 1CYDA 5T8KA 3Q9NA 4CLOB 4BMNA 3P7MA 5L9AA 2NACA 4E2XA 1E3LA 2FRDA 3KSZO 3VAZA 1PSDA 4GH5A 5G4KA 4BQPA 1ISJA 4NBUA 2WDZA 2OGUA 1QYCA 3LT2A 4FIZA 2PLAA 2OXIA 2Q4EA 1P1KA 3KOUA 3V5NA 4UVGA 4O63O 3DBHB 1NWHA 4BO0A 4QQRA 2J5KA 3U5TA 1I5RA 5JYAA 1VSVA 4TWRA 4WLEA 3D7LA 4EI2A 2GERA 3QJ5A 4UVEA 1KERA 4JIGA 5JNLA 1B14A 1K5HA 2GUGA 3DFZA 3PJGA 4HNGA 4HWKA 4CM7A 1E1LA 4CJXA 1KC1A 3OA0A 4QXMA 4R69A 4CV3A 3PFWO 2ZB4A 3H4VA 4I8XA 3PI7A 4YAGA 2WD8A 4QSMA 3BMNA 5KJCA 3PJEA 3OH8A 4B7XA 4BNWA 2VN8A 2Q4BA 3GEGA 4WECA 1Z74A 1HZZA 3F4LA 1I3NA 2XOXA 3UCXA 2ZQYA 1A72A 4CV2A 1T25A 2I76A 2NU6A 2UYYA 1PJ2A 4KQWA 3OETA 5KVSA 2QZZA 1EVJA 3H2ZA 3I9JA 4N18A 2H1SA 3SJUA 4BNNA 1NAIA 2XXJA 2YQ4A 4RVGA 3BIOA 4XD2A 4XB2A 2WYVA 3FR8A 2D4AA 1JVSA 2B83A 4CMIB 4ZJUA 1J0XO 4MVJA 1J6UA 1EFLA 2XF8A 1YL7A 2GRAA 3BA1A 4RO0A 5I7FA 3QWFA 3NDRA 1Y7TA 4GQAA 3OIDA 5TS3A 2HU2A 4DQVA 4OXKA 1P77A 3BAZA 4FD3A 1YWGO 3FI9A 3IQDB 1EFKA 4OXNA 5MGBA 1HZJA 4YXFA 4FJ1A 9LDBA 4Z3KA 1ZH8A 4IZIA 1DHRA 1KEPA 1MG0A 1NXQA 2YDYA 2W4QA 3ZHXA 2HMVA 5L7WA 4PZCA 3DO5A 2XAAA 4O6VA 1KVQA 1C0LA 4NFSA 3LK7A 3GC6A 3LF2A 1GV1A 1ONNA 4QO8A 4XIJA 5L40A 2W2KB 3K92A 3ST7A 4GLOA 3H9JA 1G0OA 2NTNA 3K31A 3DDNA 4WLVA 4PG5A 1PQPA 3UKOA 2BD0A 4NK4A 4HXYA 4CQMB 3JQ6A 1T4DA 2FSSA 3P5SA 3T7CA 4S1VA 1XCBA 1ADGA 1IOLA 4PLVA 3RD5A 4E30A 2YHUA 4ESOA 1H6BA 2JFFA 3VZRA 2VHXA 1PQWA 1GQ2A 4Q3EA 1JLLA 1YRLA 2Q1TA 4M54A 2IXAA 4EJ0A 3SLKA 5J23A 3MTGA 1PL7A 3WBFA 4J7UA 1PS9A 4J7CA 4CM8B 1E1KA 4YRDA 3W6ZA 3BMOA 1IHXA 1YKFA 4F46A 5THKA 2NLOA 3JQCA 1VL8A 2F00A 5ES3A 2EERA 3D64A 3PWKA 4MVJI 4Y6RA 4UUPA 4WK6A 4QUKA 1ZJZA 3AUAA 1E1NA 5B1YA 2QIOA 4D79A 4FC6A 4BKOA 1KY4A 3V2UA 2AQ8A 4OYRA 4U5QA 2VWPA 3F6YA 1MB4A 3MTJA 1AE1A 3HADA 1U4SA 2OFPA 4IMRA 4XKJA 2NVUA 3ROMA 2O7QA 3DAGA 4UUNA 3K8ZA 1R6DA 1KVTA 5L3ZA 1LDBA 3DOJA 3AM5A 4C4OA 1DXYA 3QA9A 3C1AA 4DQXA 1VRWA 3VH2A 5LC1A 1B7GO 3DOCA 1EE2A 2VWGA 4RLHA 3LDHA 4ND4A 1I3MA 4NHEA 3FN4A 4FPXA 4N5LA 3RU7A 1N8KA 1GTMA 4RDHA 1LRKA 4BMSA 4E4YA 3X2EA 4Y67A 3ETGA 2VZ8A 2PZKA 4OQYA 4MKXA 1Y8QA 3GVIA 1YQGA 4KDFA 4NI5A 3G3EA 3WS7A 4LVCA 1DC4A 1DBVO 4ALIA 1PZGA 4BNJA 2O23A 3IAHA 3ZZNA 5IG2A 1I3KA 4IZHA 4IMPA 3TDKA 3ONFA 1E7MA 3WGGA 3LQFA 4CMEC 3GA0A 4B8ZA 5G4KB 3L0DA 5DBIA 1DJQA 2V6FA 1O8CA 2DU8A 2WTBA 1QG6A 2I67A 3FWNA 2PH5A 3NX4A 1LTHR 3AY7A 1PJTA 4IJKA 5IDWA 2DUWA 3CUKA 1BRMA 5EJ2A 4EEZA 1MX3A 4J16A 1GR0A 3DAPA 2ZQZA 1ZK2A 3S2GA 4B4UA 2O48X 2C82A 4Y6PA 5L7YA 4YJFA 3PDUA 4XQCA 1CJCA 3M6IA 1N7HA 4G2NA 2EGHA 1UZLA 3EYWA 5CAEA 5U9CA 3C1TA 3MJEA 2YHIA 2GN8A 1QV7A 3QWIA 5EPOA 3TN7A 2G5CA 2HQ1A 4DIFA 2ZATA 2HK8A 2VTEA 5EINA 1VSUA 1PJBA 4MIYA 4XR4A 3WICA 4UREA 3TF5A 3AOEA 4XRRA 1I2ZA 3ZU2A 3BMQA 3SC4A 3ZWOA 4WOKA 5JDCA 5HS4A 3BMNB 1E77A 2DBQA 5DCUA 2EF1A 4RQUA 5ICSA 2ZB3A 1BWSA 1FXSA 1HDOA 2Q1UA 1PEDA 4CLDA 5JBIA 4LVUA 2FPPA 2PA3A 3BXXA 4OOFA 1IZ9A 4UULA 3UHAA 3ETDA 3KHUA 3H9UA 3MWEB 4R1NA 2EKQA 4TQGA 4TKLA 4HFRA 3GRPA 4BNTA 3TRIA 3V8BA 2X0IA 1JKFA 1I10A 2CFCA 3DZGA 1N5DA 3LYLA 3W8FA 5GZ6A 4I9UA 3O8QA 4BO7A 6ADHA 3ZWVA 1QLJA 2B4RO 3UW3A 4MINA 3E82A 1T2DA 3P2YA 4QTZA 3E18A 4PG4A 4I08A 2CMDA 4OKIA 4ZRMA 1CERA 1F8FA 3DBLA 4JBHA 4AJ1A 4DLBA 5JE8A 4L4SA 2PGJA 4RF4A 4FB5A 1KETA 1HXHA 3C7DB 1KEVA 2D1YA 2VNAA 2CD9A 2PFGA 3C7AA 3I1JA 3NGXA 3ONDA 3S2EA 3ROPA 3UCFA 3V1YA 1Q7BA 4D44A 2HO5A 3L9XA 2BFAA 4LMPA 1LDNA 2JHGA 3AJRA 4J0EA 1X1TA 3AI1A 2X6TA 2B0JA 1KEWA 3E9QA 4FFMA 4PFJA 1UAGA 1PX0A 3PDJA 2FR8A 3RUIA 1PGJA 2TMGA 3BMCA 1SPXA 3GHYA 4NG5A 3ZNOA 3DBRA 2ZTLA 1ZJYA 4MKZA 1D1SA 3OFSA 4RZHA 2GGSA 3H5NA 2Y66A 4FR5A 4ILKA 1IY8A 2AG8A 3G0OA 4BO2A 4LN1A 3TOZA 1S7CA 1E3EA 3SBOA 2CNBA 1I24A 3GG9A 1LNQA 3K96A 4GX2A 3KXDA 3WR5A 3A14A 3DOOA 3JQBC 4OOEA 3KVOA 4RPHA 4NQZA 3LLVA 3KBOA 3DZKA 4JJFA 1U2GA 2W98A 1TVEA 3BMOB 4YT5A 3EAGA 3NTRA 3LT0A 2BKAA 1I0ZA 4IINA 5G0TA 1LLUA 3E8XA 1ZZEA 4IXWA 1M6WA 4GWGA 4E5YA 3TWOA 3KLMX 3P19A 3I9NA 4O59O 4KQXA 4R51A 1PWZA 4WE3A 1PR9A 4ONEA 3UFXA 5AXBA 2Q1SA 3WQSB 1T4BA 2IZZA 2XPCA 3JQAD 6LDHA 1EQUA 2P4QA 3ZU3A 2HMSA 2NVUB 4CM3A 2ZB8A 4QEDA 1R4MA 5DZSA 1E5LA 1QLHA 4MVJD 3AY3A 1YVEI 4CV0A 3ZHZA 3LF1A 3ROQA 3T4XA 3RROA 2ILTA 4DMMA 3RFTA 1P33A 5JDIC 1WMAA 4H3VA 1VJTA 4OM8A 4YJHA 3ZCXA 1DO8A 4CUJA 4J6FA 1W4ZA 3UOGA 1Z7EA 4PLYA 3TQHA 5TGDA 1ENOA 2NM0A 2NQ8A 5CEFA 4J1SA 5MDHA 2P91A 1H9AA 3EVTA 4MDHA 4XYGA 3ZW9A 2Q2VA 2GCGA 1Y8QB 4JLWA 4YVFA 5T67A 1UDCA 3WB9A 1DRVA 1HLDA 4CMBA 1QORA 5L51A 1ZK3A 1GFSA 4JP2A 4QFCA 1GV0A 1ZCJA 1WDKA 4KTVE 4UUMA 3RSHA 1J49A 1F14A 5AVOA 1DAPA 1E0DA 1ULUA 2BMAA 1OC2A 2CDAA 2OL4A 3AM3A 4II2A 2NQTA 1VI2A 4D43A 2FZEA 1QR6A 2IDZA 1U8FO 3OJFA 4OO3A 4WNIA 1E7YA 1UH5A 1OMOA 5CG2A 3IS3A 2C59A 4MVJG 1XR3A 1QMGA 1I2CA 3JYOA 2WE7A 1R0KA 5T57A 4OHUA 4IDGA 4J0FA 2A4KA 2DBVO 4YJFB 4LMRA 2RBEA 1XG5A 1HDYA 2C2YA 1DHTA 5C5IA 4CM5A 1MLDA 3DWFA 4BB6A 1A5ZA 2YHIB 3OF2A 5A5FA 1XLTA 1SB9A 5F1PA 1DRWA 3STHA 4UVHA 2AHRA 4E3ZA 3BMQB
chains in the Genus database with same CATH superfamily
4X66B 3ANTA 5H68A 4ZVLA 1IWBB 2BBWA 3JD1A 1S2NA 2ZRKA 2RHBA 3QWBA 2XUKA 2RK6A 2XMDA 4A16A 5J47A 3ZY6A 4A0RA 4G0UA 4C0LA 3D8UA 1CR4A 1EDDA 2DC1A 3BJEA 4FNGA 5CA0B 4WBNB 3RVOA 4KO2S 3A25A 1ZUNB 4KXFB 2H18A 2LDXA 1KFEB 1FX0B 3BHJA 4AN0A 3GJ5A 1ODJA 2J3HA 2F1IA 2XBUA 4IQFA 3OTQA 4BYGA 2PZJA 2V7GA 4MVJP 3D0KA 2OB2A 1XJQA 2QG6A 3QUBA 5CHYA 3DEFA 3QYPA 2XT9A 3TW4A 5BN5A 1MIOB 1X70A 2Z6VA 4TRNA 1C9KA 5KPJA 3FTNA 3V6MA 5CYGA 2H08A 2JK0A 2OCPA 1XMXA 2XUJA 5E1BA 5GJVC 3ZWWA 3ZGZA 2PY6A 1VC2A 4DPLA 3F8WA 4UNPA 1UT5A 3TZLA 3M2PA 2ZAIA 4I3HA 4KOAA 4GKKB 1RTKA 3OMXA 4YO8A 4DSUA 3SHWA 1BCSA 4IMIB 4UEQA 3GLTA 1QRAA 1MBZA 1E3SA 3G23A 3MUFA 1XMIA 1GPMA 1EZ1A 1OGJA 1N2IA 2ZI9A 3IBFA 4X95A 1EE9A 1K7EB 3GFSA 3VVBA 1TQ8A 5TJ9A 2C7VA 4KGDA 2II6A 1OYWA 3OZBA 5BV7A 4H0CA 4H6PA 4DIOA 1YVRA 1HT3A 1KYZA 1ZW1A 1CETA 2G1PA 4RPLA 4M6WB 1PR4A 4F2DA 1MR3F 1FPMA 3PCRB 4JKYA 1A4XA 4N49A 2MHCA 3F67A 3LGXA 2F8SA 2I3GA 1E5VA 1Y5MA 5H7XA 2CUZA 3EFBA 4IRXA 4PLHA 1FYEA 2VS1A 1M2GA 1LPBB 3EP5B 3DKPA 4J07A 1UODA 1HDCA 3FMVA 1PN3A 3IUPA 3PHIA 4RKEA 4CKBB 2AFHE 2O2IA 3PTZA 1GPNA 2H8KA 2OP1A 1Q1QA 1ZIYA 1AT1A 1SBTA 5DXAA 4A03A 4QYMA 3W5VA 5BUQA 3K9QO 3JU3A 3Q10A 2FXIA 2LDBA 3BMCB 4LQCA 3VO2A 1NURA 5JAUA 1ZJ5A 2VBIA 3SR4A 1XTBA 3W2GA 1PT5A 1TCUA 3DBRB 3JD2A 1W73A 4ZT7A 4V0ME 1S6YA 2C1EA 3TOVA 4DPMA 4QREA 1ZI9A 2FE4A 3B1YA 4FDMA 4NCNA 3MWDB 3WOVA 4A27A 3NTOA 2B1RA 4O89A 4AZTA 2EBUA 1L4NA 3H8VA 1QIFA 4BZXA 1OR8A 1TMOA 5CFMA 1R6AA 4P35A 1AXEA 1IVNA 3JQPA 1HUQA 2ZYTX 2XNJA 2QP9X 4NKRA 5FA8A 4MS1A 2I8CA 1HV8A 1T9BA 3RR2A 3I9OA 2OAGA 4A6XA 3LL7A 2IOFK 1JFFA 3SZGA 2UUAB 3ZI4A 2GTPA 4E15A 5FTNA 1X3LA 2VSYA 2IDJA 1NMQA 4RPCA 1ENYA 2L42A 3W1WA 1ZOSA 5BVGA 5CD9A 2GO1A 2ZYVX 3RIXA 2HDOA 1JFRA 2X76A 3RBZA 1IN7A 3A6ZA 2O2DA 4KVGA 2OM2A 2P0YA 4W6ZA 4FP9A 1EVYA 3RRXA 2YCLA 1JI0A 2Q3EA 3IQHX 1CB7A 1RT9A 4MQ6A 3TOSA 4BBPA 1KMHB 3W6OA 1GQYA 3VR3A 3ELBA 3GPIA 4ER6A 1IE3A 3KDPA 2KJQA 2P1DA 3WJAA 1X1SA 5CDUA 1EG7A 2GZ2A 2G0TA 1T2AA 2DT8A 2O4CA 4FU0A 5HJEA 1THMA 3M83A 4GXNA 3RUPA 1IBMB 1J1UA 3AT1A 4X64B 4UNRA 2B99A 3Q15C 4NCHA 5LR6A 4MMZB 4Z4IA 3BWMA 1LXCA 5TV2A 3U1VA 1ENPA 1R4MB 2O06A 2GWHA 1WVIA 2YS7A 1K88A 1U8YA 3Q5GA 3NQ41 4MQEB 4NH0A 4GKJB 1E69A 1K92A 4L51A 2VDMB 4G5QA 1SHJA 3K2BA 2IIBA 2YJ5A 3KQYA 4QPDA 4DREA 3KU4A 2ZGVA 4G8JA 1WBJB 2K6GA 3TIVA 3ZIDA 3H17A 4UEWA 9MHTA 2B5VA 5DXJA 1QP0A 1W5EA 3GRZA 4XSGA 5EE5B 1RD4A 1O2DA 3RU9A 2BEUB 1VBKA 1LV7A 1U2TA 2IXTA 2WA1A 3L8GA 3KZKA 4D81A 2QG9A 4INZA 1GD1O 1EESA 3NYIA 3QMWA 1OLXB 4B6EA 4NONA 4I50A 5DKFA 3IMFA 2J6BA 3K94A 5BV0A 1M2NA 2X4GA 1XXHB 4G26A 1FA9A 1I79B 1PQYA 4XD7D 1LDMA 1VXRA 4DCCA 2XE8A 1TKCA 2ENUA 1UADA 3RC1A 3RE1A 3TZQA 3WGLA 2J4FA 1SGWA 3NHSA 2ZOSA 2DP4E 2G67A 5FA5A 1RM0A 3IWBB 1JIVA 1Y1PA 2VDKB 3II6X 3DL2A 1PYGA 1RFLA 2H4XA 2ZT8A 4HN9A 421PA 4M1MA 5K01A 4A8HA 4FFWA 4CG0A 1VPEA 4FM9A 1Z2CA 4KIWA 1RXSA 3N7AA 2FWBA 3K1AA 3DMNA 2WINI 3MYYA 2H1FA 4LV8B 5DIZA 5HQ3A 4R2IA 4JYAB 1EYZA 3DMDA 1HOTA 1N36B 1ACMA 4UTOA 4XPIA 1JKXA 4IFTA 3SF8B 2CB0A 4C0BA 4TYWA 4K9RA 4PWZA 1KY2A 2V7QA 1BVRA 4K6KA 2QVLA 2C4MA 3WMWA 1JF8A 3G7NA 3ZBPA 4Z4HA 3GH1A 4IEIA 4R8RA 4CIAA 3CW2A 3HB9A 3NAZA 3MB8A 4KQKA 3ZQ6A 5CA1F 4BE4A 3PC8C 1Z33A 3HSYA 1CY6A 2GO7A 3ELDA 2RH4A 3OPYA 2Q3LA 3MD0A 4F11A 3IP7A 3I01M 1VLVA 5NULA 4QUHA 1J8FA 4DQLA 3ZOKA 3M2TA 3HVIA 5IBPA 3O2SB 3RM3A 5K05A 1A8PA 3UATA 2F2TA 1YQDA 2H4JA 1U65A 2IXGA 4FOLA 4CUKA 3OEWA 4EF5A 1F2UA 2F1KA 4UFOA 3L82B 5HRAA 3ZCTA 3NIFB 3KQQA 1A2OA 3NYWA 4C6HA 2L18A 5KBYA 4EHJA 1EWKA 3NZEA 2QRGA 1PGOA 4MJ7A 1GPLA 5FL7D 3TFWA 3WWOA 3MZ0A 2HRQA 4CIVA 1MC1A 3GO4A 4ASUA 3SE0A 2P7HA 3ABIA 3KJQA 1T8TA 2LKDA 4DVJA 1XMSA 3ZD6A 3AO0B 3QBJA 3U49A 2C7GA 1MU0A 5IDXA 4NATA 3A6HA 2WUEA 5L95A 4AXXA 3KQNA 1PNOA 1XNGA 4XX1A 3PK0A 2PUHA 3BWBA 4LYYA 4RYLA 4EA8A 1IJEA 2ZYDA 1QTRA 5K3DA 1RZVA 2IV2X 2VF4X 3GRYA 4JL5A 1Q16A 4OHZA 1IHDA 1B42A 1H5UA 2WJZB 3QTBA 5BNZA 1C4WA 1TAGA 2DR3A 2G70A 1L7AA 2V7WA 3A0UA 1FSZA 3K0CA 4ESVA 3ITKA 2QTMA 4EB6A 1Z9BA 1CUVA 5DHRA 2DR2A 4QDZA 5EMNA 4G5RA 5JV5A 4RZ2A 4M9QA 5ICFA 2AGVA 1ULSA 4MV1A 2B9VA 3K2IA 5AW2A 3H4TA 4B2IA 1AXGA 4KLRA 1T9GR 4QOIA 3RVDA 2GM5A 1Y3BE 3KKQA 3FOWA 1BWRA 1D1TA 4JQOA 1BDMA 3BFPA 3EOAI 3PFKA 2E49A 3HUDA 4QYSA 2Z6AA 5ADWA 1N7GA 3GEMA 5CDSA 4PNHA 1OF1A 2ACWA 4P1ZA 2F4NA 2VBFA 1XU7A 2ZI6A 3QUSA 2RHWA 1G2IA 4DM4A 3TNLA 4DF3A 1Q91A 3DYBA 4RAQA 5HRUA 3MF4A 1Z37A 2AC2A 1BMFA 4EP1A 1GTG1 621PA 1QNFA 2JJMA 2R2AA 2IUSA 2ZRFA 1DAMA 1XPJA 3N74A 4L6CA 1YDGA 3PXDA 2BMWA 4H35A 3AUYA 5FUVA 4B83A 5FNZA 5CM2Z 1NBME 4GR4A 4IDEA 3ZS8A 4DLSA 4KDEA 4IG4A 4I5FA 1PLLA 5EXDA 1JKIA 3VAAA 4MS1B 1V7PC 1PKEA 2CVHA 4U02A 1JFFB 3PC6A 4FR2A 4BLPA 2P9GA 4WVFA 3OJCA 4PTYA 3RF7A 1Z07A 5BVGB 3BL6A 1WDLA 1JIIA 3C6KA 4GZLA 2CLHB 3AVOA 1RWXA 2Z8YM 3RS8A 2B1GA 2P6UA 1WKVA 1TEHA 4NZPA 4DDHA 1IIBA 4OXIA 2VHWA 1EUQA 1XX6A 3IKLA 5JROA 4I1UA 4NAUA 2VQSA 2YHBA 1NQOA 2Q6TA 1PAUA 2OMEA 2QB5A 1TJ4A 1PJCA 2AS0A 4EM6A 2Z9DA 3M0EA 2MYTA 2DMRA 3F9IA 1KYTA 1TF2A 4GRDA 2JHAA 5A0VA 5A3JA 1NN0A 2EL9A 1EI9A 1UF9A 2JPDA 2JVIA 3D8TA 3V7FA 5GJCA 4F9EA 3D4NA 1YV9A 4LBVA 4QJIA 1HK7A 3VGJA 4WUVA 3VZSA 3RPEA 4RQBA 3SZUA 3JVUA 1R64A 2WU8A 4KWTA 1Y7IA 1EGVB 1JR4A 1UINA 3EP9B 1U1GA 1G21E 2BGMA 2YYYA 1MF7A 1P91A 2YWEA 2WF9A 2VBGA 4P22A 3C7TA 5DNEA 4BO1A 4CU2A 4BQEA 2QWXA 1ST2A 4MVJH 1DIBA 1XD2A 3B3FA 1P72A 1YH3A 2CKMA 3NDJA 5CFQA 2XQFA 3FPSA 3RJMA 5JMOA 1BYUA 3T5CA 1NF9A 3ZXIA 4ALNA 2F8TA 1XL0A 4ND8A 3GEHA 3H1AA 3W5SA 1TD1A 2H1RA 2X58A 2A9RA 3WLSA 2LV8A 2YMMA 3RTGA 4V0MA 2KQUA 3LBNA 3Q5DA 5FPYA 4I50B 4UNNA 4W1QA 2VR1A 3HDTA 1BCRA 3LY7A 3V8RA 1YUBA 5DM70 3WXMA 1CIVA 2QUIA 2FNAA 3BILA 4OBWA 3AUFA 4BXOA 4W99A 3T3HA 4G07A 5L3VA 1XHLA 3K4QA 3PA6A 3QBDA 3TGPA 2EYQA 3D7SA 2W8BA 4PU0A 5CM9C 3I1YA 5TPWA 3ZE6A 3KR2A 4JCCA 5IP5A 3OZSA 4KN9S 3DAHA 4NBVA 4D4KA 3Q3CA 4MW1A 1BKDR 3D3EA 3G59A 5B2EA 5FQNA 3ZVMA 1L3IA 3WIBA 2Q5JA 1F4LA 4OB8A 3K1AB 3GJRA 3MYRA 3H6GA 2HW8A 1WPQA 1D8AA 2EEPA 4YONB 2HA2A 1RAGA 2HD4A 5HQ3B 1Y1TA 3HDJA 4FW8A 4S04A 3OLZA 2Q3BA 1LDGA 4NC9A 4E4RA 1HFJA 1B6TA 2PRSA 2WF5A 2Y05A 3LZCA 3W5JA 4QJ3A 5CEJA 9LDTA 3HSKA 3EASA 5DYIA 3DA8A 4OXRA 4D46A 5JCXA 2IITA 1ZEJA 3OBIA 5CDFA 1O0BA 4XRGA 1E94E 2P1RA 1LW7A 3NRCA 4RD2A 3V8MA 2FH5B 3I04M 4I1YA 1KMCA 2HWKA 2RB5A 1WP4A 4J4TA 4JXXA 2IF0A 1Q95A 3GCZA 2UUPA 4LDZA 5FBRB 3CEAA 4CLHA 1HT2E 1QO0D 3VHRA 5LUAA 3OPYB 3L7JA 4PPGA 2QTNA 4HDOB 4QNNA 1JEJA 2Z4TA 1FVXA 4HXGA 1Z4IA 2HJWA 2WYUA 4FD2A 4MGZR 3RLFA 2FUNB 5I9IA 1GUDA 3F4KA 3IPYA 5JJLA 4IJ5A 1NTRA 5AK3A 3WZLA 3FUCA 1DX6A 1FFAA 3A1WA 1LH0A 4TV8F 3A05A 4IVNA 4W7HA 1F2UB 1G20E 4X9XA 2CL6X 1N1GA 4C87A 1VKHA 4EHBA 1DZIA 1VL2A 4LWOA 4Q01A 5F4BA 4RPGA 4ZQCB 1H8ED 3ZJVA 1JPJA 1LZLA 1VGVA 2AC4A 1KJQA 4MHTA 2VATA 4KUEA 5K5EA 4NXMB 1DXOA 3KUDA 1UFRA 4HI0E 4LV5B 4XFDA 1US8A 1FSPA 3I5MA 1IN4A 3IX7A 3MFYA 1OXVA 2CYAA 5A03A 2HV8A 4KLZA 5LL6P 4P3XA 5LP6C 4MW6A 1TQDA 3Q8XB 5ALIA 4AB1A 4HATA 1DV1A 1KI8A 3BF7A 4DV4B 4LK2A 3WMXA 4GPIB 3M1LA 3MNFA 1JNYA 1YRBA 2RHHA 3KPVA 2TSYB 3LYAA 4MGKR 2QZ4A 2FSGA 3B2EA 5KKCA 3R3VA 4DJAA 2LVBA 3N3AC 5F2OA 5ES4B 5TDHA 2JLRA 5CM8B 3L0SA 4PFQA 1KYQA 4EK9A 3HN7A 3NV7A 4EB6B 4R3UC 2JD1A 4R1PA 4G84A 3WLFA 1ZXLA 4C29A 2R11A 4EG0A 1OH8A 1KDOA 2RBKA 2W8ZA 3F78A 3UUGA 1TB4A 1DTEA 2WF6A 4UHHA 4S1NA 5ALQA 1U8ZA 2VEDA 2ZAGA 1QV9A 1XIVA 5FBQB 2ZYHA 3N5CA 4CM4A 4CMCA 4Y2VA 1XEXA 2OD7A 3L0ZA 3SE7A 4LF4B 1E0SA 3OAAD 2V1UA 3ZV5A 1BE0A 3LOQA 2NVOA 1TFRA 3F97A 1L6IA 2Q6KA 4HR7A 3MCZA 5IKEA 4DM3A 4ISBA 1IBLB 5H9VA 4B31A 3QX7A 4X8OA 4RM3A 4G0XA 4HQLA 2F8MA 1J06A 4YI3A 5J58A 1AMUA 1UBMS 2V65A 3NRJA 2Q22A 1XKQA 2QTVA 1MX9A 3IPXA 4CW7A 2XVMA 3MRTA 4G81A 4GBJA 2EX1A 1VB3A 3AK4A 3FTPA 1AZTA 4P4NA 3PDIA 3Q85A 1NOKA 4U2KA 3U3ZA 1X39A 2RAFA 2AMVA 3ZR4B 1ZLYA 1QONA 2W6ID 1UAYA 4G37A 1X92A 1NXVA 1TAQA 3HJTA 1KYVA 2FWNA 4RVDA 1NUQA 4IH9A 1D2CA 4ID9A 3TNFA 4DSAA 1YRHA 4G3XA 1DAIA 3B7PA 2BFCA 2JJ1D 1WQ4A 3HE3A 5BVHA 2AJLI 3CGGA 3E9NA 4JNCA 1E2UA 1DQSA 2E5WA 2XYHA 3C3MA 4J8PA 3E3NA 2HBQA 3T3GA 4AJNA 1ZUHA 2CZCA 3FZYA 2B7CA 1JHDA 2YDXA 1W59A 1Y9JA 2A0YA 4E4TA 3T38A 1KHTA 3FCUB 4H17A 2YRWA 1IJFA 2H9AA 4IXDA 3ZGXA 2RHRA 2Z58A 4LJ8A 4MVYA 1DC3A 3S2FA 2N0SA 3V42A 2R0QC 4G9BA 3B85A 3B1FA 4B79A 3ICCA 3HU5A 3ZBTA 1BJRE 4AO7A 1RM4A 3PEFA 3JQ9A 3MPOA 4M1OA 4NICA 4YNBA 1OBCA 4GPBA 4N7JA 5IAEA 1HE2A 2Q1XA 5FL7A 4ZVPA 1VMAA 2XR1A 4W4TA 4EUFA 4IYJA 3QKIA 2XGMA 2A14A 2QZJA 3B6MA 1ZRMA 1VKOA 2DY0A 3ACCA 1H6CA 5JU6A 4M76B 3SFTA 3LU1A 5TGTA 1DFIA 4QT0A 3W04A 2HJSA 2J9YB 1KJ8A 4IEFB 2CNOA 5CFZA 4RTKA 2FPIA 1A4UA 2O8VA 1E1MA 2IELA 4YRSA 4GZ6A 3WLJA 2VQ3A 5AVZA 2VOEA 1W1WA 1WG8A 5DEOA 4YR7A 5GPBA 3MMXA 2VDVE 2B4QA 3C4JA 2EOAA 3IIIA 1U0OC 2GD2A 3IMGA 1FJHA 4R1MA 4ZAWA 5I8ZA 1PFWA 4BGDA 1NUAA 1A2QA 1XD2B 3R3UA 5ALKA 3EGDB 3RU2A 5CX1A 2C29D 4YJ3F 2WLTA 4CLQA 4AMUA 1Y9ZA 1RWVA 2W43A 1DUVG 2NZ2A 4MPJA 3EF0A 1WMDA 2DGDA 3E4DA 4KPFC 1SC3A 3N2LA 4A2CA 1K06A 1YI0A 1Y81A 3GLVA 4ND8B 4P08A 5HA5A 1ZH2A 1PEAA 1E3JA 1KIMA 2J3QA 2PUVA 5F64A 2EP7A 1FQWA 2CXHA 4N7MA 1W2GA 4UPDA 2JNWA 4PCUA 1BCRB 1A04A 2SBTA 4E5KA 2I2DA 1I80A 1X1CA 2ZKIA 2DHEA 4PBRA 4XASA 2BR4A 2BGRA 2RHJA 2G04A 2QR5A 2GF9A 4OD0A 4M0CA 3PQDA 4TVBA 4IVRA 4V2IA 3KR0A 5JDCC 4ALKA 4BVFA 1KEKA 4X61A 2NSJA 1FRQA 1XEAA 1E89A 2AA3A 2W8BB 1U7HA 1XMJA 3KJHA 4J49A 1JAIA 2F1HA 2HQSA 2PYZA 5TPWB 1D2MA 3SEFA 1QFSA 4KMMA 2ZJ6A 3NJ4A 4B7UA 4DMCA 1JEAA 1BO6A 1NVVR 4DE5A 4GFDA 5P8WA 4Q1AA 3V8QA 3JTEA 1RYBA 5ALHA 5HOQA 2QUAA 1X14A 1ADCA 3EVGA 4EI8A 2ZANA 1SURA 5DO9A 3CH7A 2YMQA 3MS4A 1LBHA 1JXQA 1H2BA 1F4VA 1K9SA 1QYRA 4RSGA 3EEYA 5C5EA 5IK2D 2DPLA 2WJWA 3NUQA 4DB2A 1Z36A 1I9GA 1ZRNA 1KJ9A 2VFAA 1L3CA 2EVWX 3L8EA 4ANFA 3FUTA 1WNTA 3N70A 3KQMA 2ECFA 1N6PA 3MGBA 3ZZ1A 1CHNA 2QTRA 3KXLA 3NBXX 3N59A 4Q4JA 2ODQA 3FZGA 1Z82A 4KGVA 5B64A 3IAM1 1NVTA 3L49A 3SS8A 3TKYA 1CZOA 1X42A 2ZI5A 3A4YA 2YYZA 4EFMA 1OXMA 2Z4RA 4KE7A 4Y3UA 1LPNA 5AJTA 5ELMA 2NO6A 3BXGA 5BSUA 2FDCA 2POQX 4HFJA 3RS7A 3SD7A 4RKRA 3LCRA 3LIIA 2B0CA 5KQGA 2G6TA 2L17A 1ATZA 1CUCA 1N8NA 5JCJD 2WG2A 2NTJA 4F3YA 5GIOE 5IJ9A 1N0WA 4HWRA 3BKWA 3P4UA 5LQSA 4CCYA 5I4CA 4O4JF 5JI2E 4K28A 3PXGA 4XX0A 2MSNA 3ICPA 1VE1A 2A4MA 4BN5A 1RPTA 5HM8A 3KXIA 3DHWC 1E9BA 1FDVA 2QLBA 3TRDA 4CKEA 4UCXA 4DLTA 3KB2A 4GMFA 3H2YA 1RMYA 2ACKA 3NIDB 3OZXA 4QJ5A 4YYZA 4C7OA 1KMNA 2E85A 2XI4A 5LOVF 2KWIA 3CG4A 1QPZA 3FG9A 4QVKA 3ZD8A 5BNTA 2INGX 2ZBQA 1ORTA 3U7JA 3CUVA 3WLEA 3N1UA 1CUZA 3IBGA 4CU5A 2ZKLA 2BUBA 4HQNA 4OHXA 2C9OA 5C4MA 1US8B 5FV4A 2RGYA 3L0BA 1UZMA 3OM1A 4E31A 2O5VA 3HN2A 1S5PA 4WOJA 1EX7A 1R12A 2FCRA 4FN5A 4I7EA 3TUXA 4IIHA 2FR8C 1WUHS 3GFTA 4M1EA 1L5VA 3BE6A 1F7VA 2HTFA 3GBSA 3JS5A 4ZJZA 2C7PA 5BUZA 1VIAA 4XIYA 1P0QA 2H2AA 5IKOA 3AI3A 2GI4A 3PHGA 1RS0A 3TDNA 3ABSB 5KUTA 4JP3A 1II0A 4RXMA 2CHEA 5DM1A 1KVRA 5K0TA 2NSLA 3AONB 2X3YA 1V3TA 3BRWD 1S2IA 4RH3A 3WHIA 3K71B 4JYCA 1HY3A 1NF8A 1XWFA 2I4OA 1Z08A 4L07A 4AKGA 2X5KO 1JAXA 2DFVA 2X86A 3AP1A 3MW8A 3A9VA 4LI0A 4Q37A 4ZT3A 4DTIA 1JH8A 2GK7A 2QP4A 5JEDA 3BGDA 1J1ZA 3TTUA 3OQBA 1G8AA 2IFTA 1NYQA 1SK9A 4CM4B 5JCOC 3UPTA 2GA9A 1XEXB 3AFNA 1O5IA 3BVPA 1R1DA 3K30A 4J43A 2EIHA 1PT6A 4OREX 5D3MA 1KZ9A 3U17A 4MV3A 3L77A 3MCVA 1OGYA 3VV2A 3IA2A 1NMXA 1FB5A 2N47A 2ZR8A 1DDOA 3GW8A 4RH1A 3L4BC 1EIWA 3FMFA 3QMPA 4V2UA 5H3CA 3E23A 1JG6A 4P34A 1AZLA 2WNHA 4G5OA 3AR9A 5JLAA 3G6KA 2ZJ7A 4WFQA 2GBGA 5DM0A 4N8DA 2Z6QA 2ZP1A 3EMKA 5DTJA 2QTVB 4TTIA 4ARSA 3GAFA 4U5XA 4AMZA 4CG1A 5IFLA 4F4UA 1PR6A 3NHFA 3PDIB 3B3QA 1NNLA 4FCTA 4ERXA 2QNIA 4ZQHA 3ZHRA 1G20A 3L6DA 2CVZA 3LKDA 2R65A 4N76A 2GZHA 2J3JA 5AVUA 1ACJA 1YHYA 3IWCB 2JLCA 2BFCB 3GJSA 4WI1A 1U3FA 3LY5A 2H1VA 3WIEA 4D9IA 3QLTA 3R75A 5BVHB 4IGEA 2PMKA 1T9CA 2G36A 3REOA 4L4YA 4YCBA 2NSDA 2PUJA 2Y2VA 4BO4A 3JZIA 1NR1A 4HN4B 1IEWA 3OX2A 1RP1A 3DEKA 1TUGA 4GU5A 2Q2NA 4O4IF 2PJZA 4RGYA 4KHZA 2W6JD 1M2KA 5DNCA 2WIBA 3T5AA 3LQ1A 3ED5A 2E4ZA 1I7BB 1HE4A 4BLOA 2QDXA 3RSZA 1OFVA 4M99A 4XYMA 2BRUA 1OAKA 2CC2A 2RJ3A 2PBLA 4FWBA 4WASA 5LJIA 1H8EA 3NTQA 2QAJA 2G9UA 4RX1A 4HTAA 2EG5A 4FS8A 2HK9A 5H82A 1OI7A 5IXYA 3M70A 4XUDA 2R8EA 1LK0A 1EK0A 2D2EA 5A9RA 3BTVA 1GUZA 3NP7A 1CX9B 2FPIB 1N2SA 3C3EA 3EVAA 3QKRA 1OX6A 1I2AA 1UQTA 2XMGA 3G0BA 1JLSA 1JG2A 3RVNA 3SEAA 2X19A 4I55A 7MHTA 3W6UA 2J87A 2NYUA 1LD3A 1B6RA 2B61A 3LT5A 2JBAA 4I9NA 4JELA 2O3RA 1JAZA 4URFA 5JADA 5K6AA 4JQCA 1ZS9A 3SMVA 2CXSA 2KYRA 5CX1B 3TLJA 2PZ8A 2Q6IA 3KCQA 3WGNA 4B0OA 5CXQA 4LF5B 1YQXA 4TTPA 3X1ZA 1LGYA 3HGQA 4PM4A 3M5WA 3U5ZB 3PUVA 5ILOA 4BOYA 4OAPA 4OP2A 3IKTA 2BTEA 2MSDB 1KAEA 2MTBA 3OM8A 4UVDA 3I72A 1V1RA 2WEKA 4AU1A 1GA6A 1SHKA 1SZDA 1EDBA 1YK1A 4UKDA 5EMKA 4JQYA 3E22A 4D7AA 5BNIA 3EEOA 5I51A 2HCJB 3OA2A 3OAAA 3N0VA 2Q99A 3E5MA 3IOEA 3PPYA 4QAJA 3U62A 1KS9A 2FMTA 2BR5A 5IJAA 4D0GA 2EZ8A 2EW2A 4REMA 1KRWA 2YWJA 1MEEA 1Q22A 3NOVA 2RKOA 2IRWA 1QIDA 1VLHA 4W6QA 4CLOA 2O8CA 1D0SA 4P53A 1B41A 4H1VA 3VSEA 4ESHA 3IP3A 2WIFA 4UW9A 1OPXA 4F04A 1TPYA 1QHGA 4GNKA 5EKUA 1H6AA 4EW3A 4YP1A 3O4GA 1C3JA 4XB1A 1YBVA 1U5AA 3RKRA 2W6IA 4KQ2A 1VG0B 3F3SA 4DMLA 3RJ9A 2QN1A 3Q7EA 4Z7OB 1TCCA 1XZBA 2CMHA 3J81k 2NXNA 5A9TA 1IXZA 4FLFA 3BJZA 5TGZA 3AF3A 3L7NA 3UT5A 4M7WA 5A4IS 1YDWA 1X7HA 3EJ6A 3R0ZA 4LJ9A 4BMYA 3JVVA 4ZCTA 5KYNA 2JJ1A 1V8PA 2VJQA 1Z3IX 3DWIA 3MA0A 4G0QA 2B98A 4MI1A 3QU7A 4G89A 5FUBA 4ENSA 4KRFA 1V6SA 1TL7C 2PTGA 5KX5A 1LK5A 4BP8A 1WZNA 2AR0A 2DF8A 2QMHA 4LSWA 1U9IC 3UG6A 4Q4JB 2YFKA 1RXUA 4JR2A 1GYPA 2FZVA 2FX2A 1XU9A 4TUYA 3TZKA 4WJLA 1YVDA 3DE6X 4K40A 4P7GA 1P1FA 5H4HA 1UKAA 1X1BA 2V7VA 4R6WA 3SHVA 4Y2GA 2FZ4A 4P4GA 3WGKA 1OWOA 2P2CA 3KM0A 1E2NA 5FLYA 1G8JA 2JA1A 5IJ9B 1KK0A 2NAPA 4BLVA 1NZDA 1XTIA 1QOZA 2QLMA 4CCYB 4HK4A 4DNPA 2RONA 4XX0B 1M76A 4EUEA 5FQOA 2PXHA 3CKMA 3PYMA 3AP3A 4CKEB 2B82A 4C7OB 3HCRA 3ZQ4A 3CRRA 3LBYA 4OHPA 4BNLA 1UWKA 3CLUC 3LM8A 4J29A 5DBFA 4N3CA 2P11A 3RJZA 3FYTA 2GPAA 1MO6A 2OD2A 4Z4FA 2FMHA 4RCYA 1R15A 1SHUX 4GVPA 1ZD3A 2J0VA 3C39A 3ZI7A 3K6RA 4F5EA 1EXDA 1VPWA 1JQ3A 2A0KA 2NTYC 3VPFA 4A8JA 5FADA 4US2R 3E6AA 3R9XA 4X3PA 1Z0IA 3BF8A 1ULAA 1W30A 1SB8A 3V48A 3U4QA 4UQPA 3GCDA 3RTDA 1AKWA 4KX5A 3NOQA 5J1SB 4FI3F 3QXHA 1GPH1 2WRZA 1GTRA 1NV8A 1ONSA 3P94A 1SEVA 3OU7A 3QSGA 5FTJA 1XMVA 2XNDA 1A50B 2HHJA 3HZRA 5ER6A 2UXBB 4EHIA 3CIFA 1YHNA 2YOHA 4MW9A 1QCYA 3B1WA 4BZQA 1YK0A 2QUJA 1FP6A 3A6EA 3OUTA 4XJTA 3PENA 3F96A 1LDEA 3SHTA 2DRIA 4FHFA 4R8LA 3M5PA 1Y5NA 4DA7A 3HXTA 3HYCA 2VT2A 3AOGA 4ZT5A 5EE1A 3NIBA 3WGYA 4YUVA 5ALTA 5H02A 1CUIA 1JZQA 2C92A 1J5XA 2XB9A 1JI3A 4LC9A 1QCDA 4Q6BA 1SWVA 2V3WA 3ZU6A 3UAYA 3GNTA 1H22A 1N5OX 3IAXA 2AJ8A 4QASA 5D3MB 4O1MA 4W8HA 3T4EA 3SCZA 1JBEA 5DHQA 3KQOA 3MJ4A 3NM6B 5F7JA 2IIVA 3U7FB 1YGPA 2F1RA 3C7KA 4OXXA 1QB8A 2O57A 4RK0A 2CY0A 3PDCA 1UC4B 2OUKA 1EXNA 3DMRA 4RY8A 3ACDA 2OSVA 2I99A 1FRNA 3I5YA 3FPFA 2QJTA 5K0GA 2HWUA 4UU7A 5EESA 1RWMA 2FN4A 3FW1A 4QXPA 2ZSIA 5IK2A 1FSSA 4GRIA 1UXKA 4HPXB 5H81A 3T1YB 4F3RA 2NV2B 5DI3A 2BDEA 3ANLA 5JXJA 1CRWG 2XUGA 5HTOA 1G20B 2IC5A 2R6JA 3H6KA 4L4ZA 1XF1A 3OJOA 4KBFA 2ZAMA 1U2ZA 3LLCA 1U4NA 2AZMA 2OBLA 3A4MA 5EKTA 1KXZA 2RH5A 3AJ8A 4E70A 2FPWA 3CU5A 2D00A 4X65B 1QU3A 3WYGA 3IWDB 3VC7A 1UDAA 2BEKA 5ESXA 6REQA 5KQPA 3B2NA 4RE6A 4R84A 5JCJA 1AF4A 3JQ8A 4GP9A 2P4EA 4UHBA 3TXAA 5BWLA 1N0UA 1GLGA 2QVYX 4G24A 5DT2A 4EI9A 3LLMA 2XDAA 4L5IA 1PJLA 2AXQA 1Y89A 4EVRA 2QRZA 5C31A 2JFOA 4OSPA 5I7AA 3L5KA 1Z5VA 1JHRA 4XH9B 1GKLA 5EKXA 4D42A 3PIRA 1QGDA 4E51A 3MWJA 4CPDA 5J43A 3LUBA 2ZM6B 2IS1A 1X7ZA 3VH3A 3GJ7A 1UBUS 2UZ1A 1YB6A 4OP1A 5SYAA 1MDBA 1E2KA 1N2HA 2HUPA 3HY3A 2NXEA 2X4IA 3HL0A 4PR3A 4YRQA 5TIIA 2FZKA 3KU1A 1IK6A 5KJ6A 3EMDA 4YMIA 3WWYA 5F3RA 5L6LB 1DG3A 4WH0A 3RNLA 3JAWA 1NFRA 2P4UA 3QKRB 4AECA 2XJ9A 4R2JA 3GJQA 2MOKA 3HSSA 4HX5A 1DJNA 2FR0A 3GFFA 4I55B 1C4OA 4RIFA 3WAJA 1GTSA 4JT8A 5BSTA 2JBAB 3R7BA 5FO1A 4PZZA 3RUCA 3HVJA 2X22A 1PX2A 1Z4OA 4QRDA 5MFPA 2RD2A 1CXZA 1CNEA 5CDGA 3BRWA 4HB2A 3B9QA 2IZ7A 3G1UA 4YRNA 1FMCA 1HO3A 4Q34A 2Q50A 2BFOA 3CVUA 5DMHA 3S2SA 1SULA 1V1RB 2Y77A 3N53A 5C8YA 5HHTA 2DWCA 1J9EA 1JH9A 1J0CA 1C8KA 2PH3A 2Q27A 2QRHA 2ICAA 2XW6A 3DZBA 3NHUA 3R4VA 3RFUA 5C1BA 3E22B 1QHXA 2JKVA 2DH6A 1V71A 1YJAA 5LDDC 1K3TA 1RE1A 1JVBA 3INYA 3M6XA 3RFVA 1ENZA 4OB6A 1AUQA 2NWQA 1F1BA 2EFGA 5TEVA 1OV4A 4GX1A 3UPDA 5JS7A 1FQJA 1ZXBA 3D43A 4J0DA 5FWDA 5LA6F 1EA7A 1NF3A 1ADFA 1MA0A 5BSVA 2GQ0A 6CHYA 4B45A 1GCOA 1C7ZA 4XGKA 2O8CB 3I62A 1KMIY 3NM4A 2ZUUA 4RACA 3LFHA 3NNSA 1WXGA 2ATCA 2FYTA 3F8TA 1M34A 4Y6QA 3C6YA 2VAWA 1AHIA 4GGMX 4LZOA 4KR7A 2Y1DA 4JD5A 3TSYA 2H4ZA 3P20A 4LIPD 3GMTA 3HBFA 3G9ZA 1GZVA 2EDCA 1ZW6A 4ER0A 3UT5B 4CQMD 3JWPA 4A10A 3JD0A 5JDIA 4L4RA 4EPWA 1X8KA 4UEKA 4U7GA 3FOAA 1LS1A 1XF9A 2PU5A 1QDEA 3DD1A 1UBEA 5KX5B 1MMFB 3EVFA 1H2RS 5LU8A 2GILA 1WBDA 4JLVA 4EPYA 1YZQA 2B8WA 1CJKC 4TUYB 5AK6A 5D5HA 1KQGA 3F1KA 3JR7A 3M6WA 1WLYA 5D87A 1Y3HA 4GPD1 2W6JA 5EN4A 4BMPB 1KKLA 3ULKA 2PUGA 5IBQA 3A28A 4MDEA 3ZV4A 3WGZA 1VPDA 4FGSA 4J0GA 4P7KA 4MV0A 2HBYA 4GICA 1OZGA 4TYMA 4FOPA 4GAEA 5DLQC 5KJEA 2O2YA 5HJ5A 1VBMA 1W36C 2PR2A 4PQEA 3WBBA 3L7OA 2Y67A 5GIPE 4JT9A 3CVOA 1U28C 2ISCA 1XK7A 2YW2A 3FHJA 1SZJG 1VP9A 5HOEA 5JXIA 5BWBA 1K66A 1MAUA 3FVWA 4XARA 1GDHA 3AVUA 1V37A 1ABFA 2WIAA 2HN9A 3DM5A 4Q9AA 4P5PA 3T5GA 3QFRA 2OBYA 4LOLA 5FD8A 2MYUA 2VDPB 3WDSA 3VJRA 3ME5A 1NW6A 3QBTA 4QAQA 4X3OA 2C9MA 3FVTA 4LKOA 5D3QA 4A8JB 5AVTA 4R1UA 1UT6A 3DLHA 1ORRA 3KIPA 3R9XB 1FQKA 1Y7HA 4JSYA 3RSLA 1QTIA 1Y80A 4DT1A 1DQNA 1Z0SA 1EK1A 1FU8A 1XZIA 1Z0FA 2QGFA 4ARZA 5HPYB 2IH4A 1IUKA 3ORFA 4P36A 3L6UA 1QAQA 3AEZA 4MVWA 3WHLA 4E5NA 2H0RA 5ALVA 4YFVA 1TTTA 1LBTA 3QXJA 3DFFA 4IJVA 4MTCA 3WK6A 3L7AA 3K1TA 2VTDA 3VBCA 2X0JA 5FWYA 2HC9A 4BWGA 2DQKA 2G83A 5B3AA 1PUXA 5CGZA 3LQ4A 3N7UA 4XZ3A 3TFOA 2J7PD 4GDMA 1GAEO 4WSOA 4M8NE 1G8GA 1FUUA 1ODIA 3OHPA 2P5SA 5F33A 2J3LA 4EOGA 2GH1A 4FYVA 4CN8A 4Q47A 2C95A 2HWWA 3BJRA 3PHLA 3HJRA 2MCFA 6AT1A 4JYZA 1G9TA 3EE6A 3PS9A 2YZ7A 2VF7A 3D6AA 3N2IA 4PYJA 1CPYA 2DLDA 2XZOA 2ZS8A 2ZJAA 3LQRA 4LYDA 4YRLA 5AI4A 4YRMA 2ZIFA 3JV7A 3RADC 1DADA 2B8TA 3QX3A 1V96A 3ZTYA 1BS2A 1G0NA 1OZAA 2AYZA 3G5TA 3E9CA 5CPBA 1N5IA 5JFGA 1LVUA 3DEYX 1GKKA 1I7CB 3CEJA 4L7VA 4TKMA 1G98A 3OURA 1PDVA 3FOZA 1RCFA 4OKSA 3PYXA 3FUXA 4R54A 4YDQA 3NBUA 5IYZA 5LBTA 2FUG6 3CVXA 2IZ1A 1WCIA 4PNPA 3D4LA 4YRPA 3L4SO 5DI3B 3H1PA 5KSPA 4DAOA 2NYVA 4JZKA 2C1ZA 3TM4A 4RU1A 4M1ZA 4EGJA 2XVXA 1HE5A 3OCWA 4JWKA 3N2KA 2O20A 3GAAA 4TMKA 1UBNA 3M9LA 3OICA 2HKIA 2QI9C 2YL2A 3H5RA 4WMLA 4AD8A 1LFAA 4ZZ2A 1JR3E 1ULHA 4I36A 3DL0A 4YMWA 2CUKA 1C0KA 1Q77A 4FZJA 4DCMA 6REQB 2HJRA 3AF1A 4HUQA 3VPCA 2Z1MA 1N0HA 3CNEA 1D4AA 1QKIA 3JQ8B 2QMUA 4HH0A 5AHXA 4QTXA 3VBEA 2AW3A 1A2BA 3RTEA 5IJWA 4DLVA 5A05A 1RQNA 2XXBA 4HAVA 4I6GA 5K51A 3RBVA 1S2LA 2C9YA 4EG7A 1Z5WA 4EO9A 1CZNA 1L7OA 5FHRA 1KTVA 1N0IA 2CNLA 1KGDA 2YJTD 3W5UA 4DV5B 3OZVA 3NVKI 3SKYA 3CCFA 4GUDA 1DKRA 3G5LA 4JODA 4CMKA 1C30A 2JIQA 4Y6OA 4EITA 2UZ1B 2PSDA 4WCFB 2VEOA 2XUHA 3JRNA 3L7IA 4FDAA 1QRUA 3HZHA 4DIBA 2JKZA 1EX1A 3EQ2A 4FKZA 1NP6A 1HSOA 2ZDHA 4JJ8A 3LHDA 4AZSA 2D2IA 2PS9A 2QX6A 3EZYA 4E94A 4BMCA 1YL6A 3ER6A 1B0PA 4MW7A 4HGZA 1QMIA 1JQDA 3JAWB 5EVJA 3H4MA 4PLGA 3GNQA 1JUDA 2OE2A 3HJHA 2G25A 2GZ3A 2P3QA 4KXLA 2ZYIA 1A0OA 4PAQA 4Q3BA 4LE0A 4FXPA 4WTOA 4Y2PA 3JATA 1N1EA 3ZHCA 1V7CA 1YJBA 5CEEA 1KDPA