1VKNA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
340
structure length
340
Chain Sequence
HMIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEFDPEKVSKNCDVLFTALPAGASYDLVRELKGVKIIDLGADFRFDDPGVYREWYGKELSGYENIKRVYGLPELHREEIKNAQVVGNPGCYPTSVILALAPALKHNLVDPETILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSLEEIHEAYLEFYKNEPFVHVLPMGIYPSTKWCYGSNHVFIGMQMEERTNTLILMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
publication title Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
total genus 113
structure length 340
sequence length 340
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1vknA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vknA01
4INAA 1WVGA 3VPSA 4FR5A 5IN4A 4CMEA 2IYOA 1T1RA 1FK8A 4ND4A 4WECA 4OYRA 1NVTA 3IKTA 4IZHA 1LDEA 1BWSA 3B70A 2XXBA 1GV1A 1MP0A 4DC0A 2O2YA 2Q50A 4NBRA 4YTEA 4DYVA 1Y5RA 5IDYA 4XYGA 4IJVA 3RC7A 3W1VA 2B5VA 5JFOA 3ZWVA 4FFNA 5FWNA 1LQUA 1LDGA 2OZPA 1PZHA 4E32A 2A92A 5TT0A 3Q3CA 1MG0A 3QWIA 4WLOA 4IJUA 1PL6A 3KEQA 4F45A 1UH5A 3KO8A 3F4LA 4IQ8A 2VWQA 2VYVD 3IP3A 1EQUA 1YJ8A 2PTGA 5F21A 1U3WA 4PZEA 2WD7A 4E21A 4YRAA 1JKJA 4R1NA 2PH3A 3BMNB 4FBGA 3H3FA 1K3TA 1QMGA 2EG9A 5EN4A 4WCFB 3VH1A 4PLWA 2NACA 4MVJE 2X0IA 2DU8A 5F1KA 4L75A 5C3MA 4MJLA 1ISGA 1N2SA 3CIFA 3JQ9A 3A28A 5G4LA 4BKPA 2HCTA 3PIIA 3AFNA 1I33A 4Z0TA 4RL6A 1HYGA 1XHLA 1X7GA 2D1YA 1G1AA 4YBZA 1B8UA 4ALNA 3C7CB 1YWGO 3RVDA 2D3TA 3ZWYA 1H6AA 4YJFA 1YS4A 1J4AA 1FMCA 3AM4A 5IDQA 2I9PA 2ZYGA 3JSAA 5L4LA 4I5DA 5DOZA 3SJUA 3K73O 1PQUA 3JTMA 1HDXA 4PLPA 2YQ4A 1PL7A 5EMHA 5ENVA 1GYQA 3NJ4A 4CM7A 5KWEA 2E4AA 3NDIA 1WDMA 1XELA 1ZH8A 3U5TA 5F5NA 4IJKA 4GSLA 4PVDA 4IQGA 3ABIA 3CINA 2BELA 3RUCA 1C1XB 4YQZA 2DFDA 4ALKA 1E3EA 1K6JA 1P3DA 2AQKA 4BNKA 1E7MA 4IDFA 1Z7EA 4XQCA 4BNLA 1PWZA 2GD1O 3GQVA 4CLXA 2GO1A 3ICCA 4GWGA 3NV9A 4TQGA 3MJVA 1YRLA 2P4HX 4B4UA 4CV0A 3ROKA 1A4UA 4NFSA 4OXNA 2VQ3A 4QUKA 4RF2A 4YAIA 3ADPA 4HXYA 1QYDA 4RGBA 4E2WA 1UUFA 4QX6A 4IXWA 2NVWA 4OIMA 3QLJA 4JBGA 1X7DA 1EUCA 1HEUA 3P2OA 3IQDB 1D3AA 3ZNOA 3RBZA 3RUHA 5KJFA 4BS9A 4PG4A 3TZHA 1K2WA 1ZEJA 3JYQA 4FFLA 3JYLA 4MPDA 1R15A 4R3WA 3TL3A 2BLLA 4BNFA 3MOGA 4TRMA 4KQXA 5JDIC 1PZGA 1T4DA 1ML3A 4NPCA 1OBFO 4XGIA 3MWDB 3K8ZA 4DQXA 3VHRA 1ZXLA 5IXYA 3T7EA 4CV2A 4S3MA 2EF1A 2AA3A 3E1KA 4UVEA 3LC2O 4R5HA 1QP8A 2EKPA 5EPOA 1SOVA 1BVUA 4ZRNA 1DC4A 4H3VA 4XYLA 1IY8A 1O9BA 1QSGA 3I52A 4E0BA 4CUZA 3NAQA 3RUIA 1ARZA 4BHTA 1HTBA 5EIOA 3L4SO 3LC1O 5JYFA 1FDWA 2VHXA 4KWIA 3KEOA 4NNJA 5B4TA 1ZNQO 4IJWA 2ZCVA 4GX5A 3C8MA 3GG2A 2B37A 2OL4A 2CY0A 4FCCA 4JBHA 4QSMA 3CKYA 3PJDA 4Y6PA 2OMEA 3AU9A 2JFGA 2ZIZA 5EJ2A 4NFYA 4MVJM 1GZ3A 3NX4A 3INGA 1UXHA 1VL6A 4I9HA 4A26A 3F46A 2ZCUA 4D43A 4E2YA 1GYPA 4RORA 2RH8A 2E37A 3VH2A 4ZQHA 1H6CA 1ZZEA 3CE6A 4II2A 4XZ3A 4GMFA 3KRTA 4CMAA 4D45A 3L07A 3AW9A 1VSVA 3L6OO 1YH3A 2ZTMA 4RVHA 5G0WA 1MC5A 2O3UA 4L73A 1PJQA 1R4NB 1YB1A 9LDTA 2GLXA 4GBJA 4U0KA 1KVUA 2GN8A 1B3RA 1D7OA 4QXMA 1SC6A 5DULA 2B35A 3PJGA 3QHAA 4EYEA 4RDIA 2FP4A 5ES3A 2DUWA 5FI3A 3ZV4A 3D5TA 3ZU2A 4CQLB 3KZVA 3BMCB 1AE1A 1FDUA 3INTA 1ZW1A 3MCVA 3FBTA 3IOYA 2X9VA 3GVCA 2GN4A 3I9KA 4P4NA 4CMEC 4BKQA 4FC7A 3H65A 2CVZA 1ZJZA 3NT4A 5T67A 2B69A 2G76A 3RQSA 3COSA 2F1KA 3TJRA 4XIJA 4NHEA 1ZSVA 4I1IA 5DN9A 1RKXA 1NR7A 2VRCD 4BB5A 2HDHA 3G1UA 1NWHA 1XU7A 1YB4A 3B20A 4I8XA 4XQEA 1GUZA 3VKVA 3RC9A 1Y1PA 1SMKA 1I32A 2CFCA 1E3IA 3OJFA 3B1JA 1DFIA 4CR6A 3K31A 3ZWNA 1E92A 4NJMA 3WBFA 4IMPA 2ZB4A 4L4SA 3R1IA 4E5PA 2X5KO 3EGOA 4URFA 5T5QA 2EP5A 1FDSA 5AVOA 3HFGA 3LK7A 3JQ9C 1HDCA 5L4SA 1N1EA 3FF4A 1F8GA 3ZHBA 4L0QA 3EVNA 1CETA 5U4QA 5F1PA 3TZKA 2VYVA 3GPIA 1ZMTA 4K28A 4R4JA 1TT7A 3QVTA 5LDGA 3TZCA 4N5LA 4MVJI 3ONEA 4WE3A 2H63A 2CSUA 1KIFA 4OOFA 1CF2O 2YQ5A 1KVSA 4D7AA 3DFZA 2VHVA 3ENNA 3Q1LA 1I30A 3WX0A 1B2LA 2BGLA 2G1UA 4EGFA 3RC2A 1NVMB 3FTNA 4LCEA 1P0CA 1RJWA 4PLYA 4KZPA 3RUAA 4RF5A 4ZICA 4UVDA 1O0SA 3DHNA 3O26A 3QWBA 3K6JA 2I76A 1QKIA 1PTJA 3KYBA 1QYXA 3ZWWA 3R0IA 4M1QA 3V2HA 2AHRA 5JYDA 1N7HA 3GHYA 1U4SA 4G65A 4ZQFA 4DA9A 3QRWA 1LI4A 3GC6A 3OEWA 4BQRA 4DQUA 1V0JA 1DRVA 5DBFA 3VC7A 3RSHA 2CUKA 1HT0A 4UULA 3RJ5A 2P4QA 5CPBA 2YHUA 1BVRA 1RWBA 2UVDA 1UXGA 2XOXA 3E8XA 3PDJA 3QVOA 4R68A 5B12A 2PZMA 2PZJA 4FGSA 4QQRA 4Y98A 2WWRA 3QVSA 3AI3A 1SOWA 3O8QA 3IDSA 1TB4A 4CQMA 4YRDA 3KETA 4JN6B 4PG7A 1DC5A 2JFHA 4EJ6A 1LXCA 4MOWA 1VE9A 1Y9AA 5FF9A 3F1LA 2R00C 4XGKA 1F12A 5KJCA 4LRTB 3CTMA 1U7HA 5ITVA 4ZQEA 4XRRA 5MGBA 5AQ1A 1BXGA 1IYZA 3JQAA 4E30A 2YHIB 4WJZA 1AUPA 3ZNQA 2CNBA 5A3JA 1FDTA 4JQCA 1OI7A 2O4UX 2NVUB 1OC2A 2Y99A 3RUFA 3ZCXA 4MVJD 4DPMA 2BKAA 2HMWA 3B1KA 1LC0A 3M2TA 3HN2A 4U8GA 4IBOA 4K1LA 5JAMA 4AJLA 1I2BA 3ONFA 3PI7A 1GL3A 3E48A 4UEOA 2JD0A 1HRDA 4I5GA 3LT0A 3WIDA 4AJNA 1N5DA 4EW6A 3C1TA 2FPIA 2O3JA 3E9QA 4B7CA 1DJQA 1VL0A 3ZN2A 4U6QA 3MTGA 1BGVA 2VZ0A 4IS3A 1ISJA 1YBMA 2G17A 5DNAA 3QIVA 3UCXA 5L51A 2B36A 2BF7A 3VDQA 1T24A 2BHLA 3PPIA 4BKRA 4BVAA 5JC8A 2JCVA 1S7CA 3UKOA 1QV6A 1YOVB 2BMAA 2Y0DA 1E0DA 2D59A 3DONA 5I7FA 2YDXA 1YBAA 5CHEA 5JCJD 5ILGA 1VI2A 3DR3A 2PH5A 3JQ8A 4P22A 4A27A 4Z6KA 1ISFA 5HTOA 3QE3A 3ZV5A 4BQPA 4TRJA 4FB5A 2ZATA 4KUGA 1R4MA 1TA4A 1RM5A 3CH6A 2RH4A 2HJSA 4UEKA 1JAYA 2A35A 4UVGA 4IDCA 1C1DA 2A4KA 3DHYA 1GD1O 4FOSA 3RBXA 1E77A 3V8BA 3RCBA 2Y1FA 4GI2A 1M2WA 5TX7A 1EZ4A 4Q3CA 1ZXBA 4MP8A 2JAPA 3WXBA 2JD1A 1PGOA 1IB6A 5JE8A 2ZTVA 4CMHA 4JK3A 3F3SA 1PJSA 3H3JA 3FRJA 1JVSA 4RJTA 2VRBA 1E5LA 3FCOA 4BGUA 1IHXA 1WDLA 2ZTLA 4CM1A 4FIZA 4ZGWA 3AJRA 2RCYA 4IXTA 1CYDA 1E7QA 4CM6A 3U4DA 1PJ4A 2B0JA 3GUYA 4CMGA 1ORRA 4OAQA 3TZQA 4BO2A 1AGNA 2JCYA 2ZK7A 3SXPA 1BSVA 1ZMOA 4MP3A 4PCVA 3RC1A 3ZWMA 4EEZA 3PWSA 2OORA 3DL2A 1E3LA 3T7CA 3OSUA 1HSZA 4XCVA 4B4OA 2ZYAA 1CERA 3D3WA 1GPDG 2VOJA 3DOCA 2VRCA 4R9SA 4BIIA 3NEPX 4H15A 2FSSA 3WJAA 3D3WB 2AE1A 3K2BA 3WTBA 1JDJA 2EJVA 7ADHA 3QQPA 1YL6A 3PWZA 4WUVA 2GSDA 2J3HA 3FTPA 1BXKA 2C59A 1BXZA 2H6EA 4J0FA 4YACA 2E49A 3GA0A 1PR3A 5AXAA 4QO7A 3DBVO 3LLSA 4AVYA 4J91A 1Q7BA 3O4RA 5C7LO 4M8SA 2IXBA 1F8FA 4NI5A 5L53A 4E31A 1NWCA 1UJMA 2PGLA 3GEGA 2X0NA 2PD6A 4QEDA 2DPGA 1NX6A 3AY6A 4EI2A 5A9RA 1EFKA 4AICA 5L4NA 1VJTA 1DJNA 4DTIA 3DBRA 4I5FA 4CL8A 1QORA 1LLUA 1HE5A 5DDIP 1N1GA 1X7HA 3LYLA 1E3WA 1E1MA 3DDNA 1H94A 4BO3A 2CDBA 3O9ZA 2C29D 3Q6IA 3DFUA 4CM3A 1ADCA 4JNKA 4BL5A 3WGZA 1D1TA 1X15A 1LX6A 2NSDA 3S8MA 1NNUA 4UVIA 3WNQA 4YR9A 1RYEA 1P74A 2Q4BA 3A9WA 1W73A 1P1RA 4J1NA 5I7VA 2GZ1A 1DDOA 1GFSA 4BKUA 2C20A 3ITKA 3EUWA 3BMQB 4PVCA 1AXEA 5DCYA 1ZFNA 3RBVA 2JFFA 3ZWOA 3BIOA 3VPFA 4BNGA 3WMWA 4J9VA 3GHHA 3PTZA 3WGQA 3OM9A 2Z95A 2EWMA 3C3XA 1JTVA 1H5QA 1R0SA 2BGKA 3HDQA 3KYDB 5IG2A 4IGEA 1ULSA 3ZDFA 1XGKA 4KWHA 3EW7A 5A9SA 3H9QA 4A7PA 3H6KA 2Q1TA 1GZ4A 2RHRA 3D4OA 4N5NA 1CIVA 2OBYA 1HWYA 4J1SA 1ONNA 4TMFA 3NDRA 4BO0A 3SEFA 3S2FA 4DXHA 1LQTA 1U4OA 2Q4EA 4DRYA 4HX5A 1JQBA 3LDHA 3C1OA 2J8ZA 3WGTA 3Q2IA 2IZZA 4I5EA 2O50A 2GRAA 4KOAA 4M87A 1E3SA 3ICPA 3TQHA 1Q0QA 4XD2A 1SEPA 4CL3A 4YXFA 5HA5A 4E5YA 4AL4A 3H2SA 1DAOA 1ID1A 1JW9B 1L1FA 1Q1NA 3WOHA 3PHHA 1LDYA 2NLOA 3FPCA 3CSDA 4RVSA 1I10A 3UUWA 2Y68A 2EEZA 3DTYA 2X22A 1Q2XA 1ZK0A 3OMLA 1IULA 3OJEA 1I3NA 4FN4A 3PP8A 1NPYA 1WXDA 2Q45A 5U1PA 4MVJA 2D2IA 3ZW9A 3NTOA 2I5PO 2PLAA 4M89A 1E7YA 3HDJA 1Y8QB 3UCFA 1Z82A 3QWHA 1YGYA 1O8CA 3FNGA 4N18A 2I65A 2YV1A 5CDGA 1C0KA 2HKIA 1X0XA 1N8KA 4Q3BA 4CLRA 4CV1A 2R6JA 4XKJA 4DUPA 8LDHA 4M49A 3QVWA 3TOZA 2EHDA 2NQ8A 1E1LA 5KTKA 4RZHA 2O3QA 2WD8A 3D0OA 3H7AA 3NTQA 4CMIB 5M6DA 4TZKA 1KYQA 4UUPA 4Z9FA 4GX2A 4J4BA 3EVTA 4PLGA 3AWDA 4BNJA 3JYPA 1DRWA 5F3RA 2UV8A 5ICMA 3HDYA 3GFGA 3KYCA 3DZBA 5LCXA 1HL3A 5L7YA 2DPHA 4WEQA 5JCJA 3WJ7A 5HBRA 1CWUA 1DIRA 3RAJA 2QIOA 1HE3A 4ZQBA 4HV4A 4EITA 1XDWA 2IE0A 2I3AA 3I9LA 4TRNA 4LMPA 2VYND 3BMOA 3VZSA 1PX0A 4C7JA 3Q9NA 2GASA 4WNCA 1PR9A 4ALJA 4FQ8A 3WYEA 4PGFA 1KEPA 2AE2A 3RKRA 4AJ4A 4D3SA 4WGGA 5DF1A 4QT0A 2PGJA 1BW9A 4LISA 4GVXA 4BNIA 3WWZA 4L76A 4IGFA 4N5MA 1RM3A 6LDHA 1E7SA 5BNFA 2DLDA 1Z45A 3NYWA 1C3VA 5A03A 4Q39A 4ITUA 3JQ7A 2EV9A 1R0LA 2WD7B 5K6AC 2CDAA 1E6EA 4BGIA 3PWKA 4XYBA 2X8LA 5COAA 1NAIA 2V7PA 5K0ZA 3JQ7B 2JD2A 4Q9NA 5IZCA 4TVOA 4UUMA 4BNYA 4DPLA 1YQDA 3DEYX 2HUNA 1GEEA 4FOOA 4MKXA 4JJIA 4B3JA 3RUDA 1PJLA 4O1MA 1M76A 3FPLA 3GOHA 5IF3A 1Q7CA 5JAQA 5FYDA 4ND1A 3U3XA 1P45A 1DFHA 3GUCA 2WYUA 3VVBA 3LQFA 1KVRA 4J49A 4CLEA 1UAGA 3W4IA 4AJPA 4BO7A 1U3UA 1B3BA 1UDBA 1V3UA 4IDEA 3VTZA 4YJFB 4D79A 3QP9A 1EDZA 4XJSA 1T26A 5AXDA 4HWKA 4WLUA 1I0ZA 2PZKA 3MJCA 4O59O 2FMUA 4J43A 4ROSA 3VH3A 1M6HA 4DL9A 1X0VA 5I9MA 4GX1A 4MIEA 4TVBA 3AUSA 4OOEA 3IP1A 4OM8A 4MKRA 5KJ1A 3A1NA 4Q3EA 1A7KA 3VZQA 1HYHA 3OECA 5J9GA 4K9DA 1HETA 1KVQA 3PQEA 3W4JA 2Q2WA 3N7UA 1WWKA 4G81A 3KTDA 4O6VA 5TF4A 3ZHYA 3ZH2A 5A1TA 2Z1MA 5JXWA 1GAEO 5GZ3A 2HLPA 3SLKA 4PLTA 2D4AA 4YAKA 2UAGA 1Y9EA 1ONOA 2O4CA 3B1FA 4N54A 1R12A 4L4RA 5DBGA 3TOXA 4NFHA 1HDZA 4DIOA 1ZBQA 1OZAA 4ZHSA 1WMAA 2EGHA 1QR6A 3GNTA 3SC6A 1DIGA 2Y1CA 4JIGA 1QRRA 4O63O 4XIYA 4B79A 2R00A 4E13A 2OFPA 3KVOA 3TRIA 1HE4A 1B26A 2NV6A 3RFVA 1PS9A 1GR0A 1LTHR 4AFNA 2Q2QA 4CV3A 1J6UA 1DHRA 4KDEA 2Q2VA 3GGOA 4W82A 4BO1A 5JW6A 2IEDA 1DC3A 3P7MA 3IIEA 4JP2A 1VSUA 2Q49A 1SPXA 4QECA 2I66A 4OKNA 1B16A 1NASA 2QW8A 2W8ZA 3RJ9A 4FFMA 3GVHA 1QYWA 3N58A 3DC2A 1ADGA 1MUUA 3E5MA 1M67A 2WTBA 4FC6A 2HSDA 4K6FA 1ONPA 4ESOA 7MDHA 2WM3A 4RVUA 3IL2A 4E2XA 1EUDA 1HKUA 2WE8A 3DZHA 2CVOA 1U28A 5JYAA 2O23A 1O6ZA 2UUPA 3P5SA 4BMVA 3I5MA 1A72A 1H6DA 4FJ1A 2VHZA 3Q9UA 1RM4A 2HAEA 5I7EA 3PLRA 2NU9A 1PSDA 2X4GA 2WSBA 3D5QA 3HB5X 4WOKA 5IDWA 4RPKA 4GL4A 3TN7A 3OFSA 3H9EO 5TIIA 4N7RA 3ZWXA 3GT0A 3A4VA 1C0PA 4EUFA 1GTMA 2FZEA 3MZ0A 3U09A 4RVFA 3TL2A 3VPHA 3W8EA 2HQ1A 2P68A 3O03A 1E6WA 1SCUA 5JS6A 1RM0A 2NADA 4L4XA 4XA8A 1JWBB 4PG5A 4LMRA 1JLLA 4ZRMA 4MIYA 1GCOA 3ZNNA 1PGJA 2WYVA 4OXKA 1LBEA 3P2YA 1VC2A 4MDHA 5JO0A 4YJHA 3NRCA 1LC3A 1PZEA 3RU7A 5A3VA 4NJOA 5G4KA 3C7AA 1YBVA 4NG5A 2YYYA 1G0NA 1QLHA 3W6UA 5TC4A 1EDOA 5G4KB 1EVYA 3S1LA 4UAGA 4FD3A 3WYCA 3F47A 1GEGA 2P5UA 3NJ8A 3GDOA 4NBUA 4F3YA 4L74A 3HFSA 2PD3A 1D8AA 2OHXA 2WMDA 2PKQP 3S2GA 1ZIDA 1PQPA 4EZBA 3OETA 4R9RA 3GMSA 5I8ZA 4B7UA 4BNXA 4FW8A 3U4HA 3RKUA 1KS9A 4IPTA 2O3RA 3SC4A 4OJNA 3WSWA 1IOLA 2AW5A 3L9XA 4PFJA 5GMOA 5JY1A 5A02A 4MP6A 1NR1A 4ID9A 4RZIA 2J3IA 5EQFA 4AG3A 4AJKA 3WGIA 4JJFA 2HK7A 1IPFA 4BMSA 4RDHA 1XQ1A 3SX2A 4NJMB 1E7RA 3KSDO 5IZCC 3WDSA 3H5RA 1SBYA 1T4BA 4DLBA 2FPPA 3PJFA 4LCJA 3ITDA 3TWOA 1EVIA 3UAGA 3VZRA 3GR6A 1F0YA 1P9LA 5IN5A 2NU6A 1OMOA 3JQGA 1DEHA 4G5HA 3JQ6A 4FFPA 4XR4A 3PGJA 3T4XA 1NAHA 3FNEA 3ZHXA 2DUUA 2ZJ1A 3KXDA 4GAEA 5B4VA 3PZRA 4FJ0A 3BA1A 4GVLA 3E82A 3GG9A 3OF2A 4C7KA 3TFOA 1A9YA 3GEMA 5A5EA 3SJ7A 2GNAA 1DPGA 5FFFA 1HDGO 1D4FA 3L77A 2UDPA 4GKVA 1LSSA 1CEQA 4OHUA 4QFDA 2CMDA 5BSGA 1WPQA 2JCXA 4IDGA 3UVEA 2BFAA 4EEXA 1UDCA 3LT4A 1B8PA 3LT1A 3D4PA 3ZWPA 5IAAA 2DTXA 1X13A 1TLTA 1N9GA 2Y1OA 3QWFA 1UP4A 3I9JA 3DBLA 3PZBA 3V2UA 3ZU5A 3AFMA 1LRKA 2JJYA 3UN1A 1A71A 2Y67A 4U6SA 2VZ8A 1IL0A 1U9JA 2ZB8A 1G6KA 2I67A 1DBVO 4KDFA 3S55A 1PL8A 3ADOA 3WLEA 3WTCA 2X1HA 4R41A 2O7SA 3WGHA 4F6CA 4ALLA 2O2SA 2XAAA 5U9CA 2YY7A 1XG5A 3I9OA 1KOLA 3AU8A 3ZI0A 1NPTO 2Y93A 3RROA 4I9UA 4IS2A 3E18A 1ZUD1 3SBOA 3O8QB 4EBFA 2VN8A 3LT2A 4CQMB 3WYBA 1K6IA 2PR2A 3GN1A 1K5HA 4ZU3A 3MTJA 3HDHA 2VZ9A 1TT5A 2AG8A 3DAFA 2EERA 3PEFA 5ENDA 5JC1A 1U8XX 5ILOA 5I9LA 1ZK4A 5IZ4A 5L7WA 5AXBA 5FEUA 5GY7A 1BXGB 5TGDA 3JQAB 2DBRA 4NZ9A 1NTOA 3JD0A 1Z6ZA 4BO8A 5KJ6A 4UUNA 2OP1A 5G0SA 3GDFA 1YJQA 4NH4A 4ZA2A 1ENZA 2C2YA 2EKLA 4CM8A 1P33A 3ZU4A 3QVXA 4HFJA 3KOUA 4RVGA 4Y6SA 5B37A 3I6QA 2RIRA 4BNNA 1ZSYA 1U7TA 4QFCA 1ISIA 1LNQA 2PWZA 5TT1A 5CEEA 2GZ2A 4XJTA 1HXHA 5T57A 4TWRA 4BKOA 2AQIA 1PIWA 4RQUA 2B4QA 5JY6A 3HE3A 4B8WA 4NMHA 4Z9YA 4B7XA 1EVJA 4CR8A 1MV8A 3WG9A 3UCEA 1HDRA 4LSWA 2Y1GA 2J5KA 2GPTA 2RAFA 4XYMA 1J5PA 4M55A 1ENPA 4OSPA 5EESA 3GDGA 3VDRA 2FSVA 5A5FA 3EMKA 1F14A 1EBFA 1DIAA 2VHWA 1B7GO 3FN4A 3EZLA 3H8VA 3JQ8B 1JU9A 4NQZA 1CRWG 3AUUA 3LF1A 1C0IA 3N74A 1LJ8A 3TSCA 4R16A 5BR7A 3L9WA 2PK3A 1Z73A 1R4MB 4P38A 1DO8A 3UF0A 3R3SA 4BO4A 3DXFA 4XRGA 3JD2A 4MIOA 3RIHA 4GGPA 1C1DB 1I5RA 3GGPA 3ZW8A 3E6AA 4MVJH 1NFQA 3ONDA 2FY8A 1FF9A 4XB2A 1VJ1A 4YQYA 1T25A 3E03A 1E1NA 2IXAA 2BI8A 2P91A 2ET6A 4RLSA 1BTOA 3RUEA 1MFZA 4LGVA 3A06A 3PIDA 4WASA 1G0OA 1P44A 5EQDA 4IINA 1WAMA 3TFQA 3C85A 3HJAA 2X9GA 3FI9A 3NGXA 3DOJA 4PN3A 5HM8A 3S2EA 3H9GA 5MDHA 4IDDA 3FHLA 1DOHA 1LLCA 1QYCA 2C2XA 4J9UE 3QV1A 1T2EA 2VHYA 4D3DA 1PU2A 4LVUA 3ETDA 1YQGA 3UH1A 2DTDA 4LN1A 2Y0EA 3PK0A 3V2GA 4WEOA 1LLQA 4AJIA 4NBWA 3F6YA 4J1TA 3DBHA 3I83A 1FDVA 4JROA 3Q2KA 1OC4A 2VCYA 1KY4A 4TSKA 2A9FA 1AXGA 3KLPX 4RLHA 2E82A 5KKCA 5KKAA 1T2FA 3WQRA 3GMDA 4OMUA 3WFIA 5B1YA 4PZDA 3EY4A 3MJSA 4OL9A 5K6AA 4LW8A 3EAGA 4AJOA 3PYMA 3WNVA 4XDYA 4KTVE 2GDZA 4WLEA 2GGSA 3DQPA 2HRBA 2E6UX 3BTUA 4FSHA 3DTTA 4KUHA 3QA9A 2E48A 2DQ4A 3GZNA 1W6UA 3DZFA 3PHGA 5JAZA 4CJXA 3VVCA 5HS4A 5A04A 5C7IO 3NTRA 3ST7A 1MC4A 2VT3A 4J3FA 1GQQA 4DQVA 2SCUA 2Q1SA 1E1KA 2P9EA 5CG2A 1PEDA 4JCOA 1UXJA 1CJCA 3H4VA 4PRLA 3HADA 5C7OO 2W98A 3ANNA 3IJPA 4YAEA 3BHIA 1I24A 1MXHA 1MXFA 5JMPA 1UR5A 4J6FA 3WIEA 1VM6A 3DBRB 2C7VA 2Q1WA 1X1EA 2V6BA 1XQ6A 1E3WB 4YJGA 5KVCA 2VUUA 4B3IA 2DT5A 4BB6A 1P1IA 1VKOA 2X5JO 6ADHA 4RQTA 4J4HA 4W9NC 2NWQA 5J23A 1GUYA 1WLYA 4DIFA 5THKA 4Q3DA 1IUKA 1NVGA 4IZIA 2GYYA 2CZCA 4F46A 1U1IA 3F9IA 2HMUA 3ENKA 3DOOA 1YXMA 1MFPA 4R51A 3CMCO 3ROQA 4IMRA 4J2OA 5JYEA 5TJ9A 3TPCA 5JBIA 4M86A 2PNFA 4A5OA 4KUEA 2Y05A 1SEVA 4D41A 1P1JA 2PZLA 4NBVA 3IJRA 1UP6A 2X86A 3KM0A 4ND2A 5A9SB 2EGGA 2PY6A 3VKUA 1A4IA 1C14A 1YQXA 1ZJYA 3GLQA 4DC1A 2NNLD 3RFXA 4WLFA 3PJEA 5A9TA 1H93A 1H6BA 3HB4X 4J2HA 4M54A 3PFWO 2YFQA 1XWFA 5BQFA 1HYEA 2FN7A 1I8TA 1OOEA 1Y8RA 1LU9A 2QRJA 4BV9A 1DSSG 3DAGA 4DMLA 1LDNA 4GPD1 4H7PA 1KEUA 1YB5A 3AM3A 5G0UA 3V1YA 9LDBA 2OO5A 2I99A 1XLTA 2OBNA 3UFXA 3VZPA 1XSEA 5L9AA 4A2CA 5TLSA 1V6AA 1XKQA 4CPDA 1NHGA 5CFZA 2HMVA 4W7IA 5HRUA 3PDUA 2PGDA 5DBIA 2YV2A 4J1QA 3Q11A 3QJ5A 3C24A 3QSGA 4R1UA 4NK5A 1K89A 4CM4A 1R16A 3FWZA 4CMJA 1PJCA 3BTOA 2XPCA 3X2EA 4NK4A 2B5WA 4XR9A 1LSJA 5BNIA 3ZU3A 1PWXA 3DWFA 1KY5A 2PD4A 2PA3A 4E6PA 3DZIA 5JPIA 1FJHA 4WK6A 2OOSA 2X7HA 3DZGA 3GEDA 3ZV3A 2YV3A 3EYWA 4R1SA 3RFTA 3MWEB 5DP2A 4CLRB 2FWMX 2OP0A 3KSUA 2HMSA 4KP7A 3GY0A 3DHEA 3D1LA 3TNLA 2C0CA 3PGXA 2VTDA 4E5NA 4CUJA 1ISMA 1YDWA 1X1TA 4OQZA 2BFOA 5JNLA 2B4RO 4ZD6A 1TEHA 2GCGA 2NUAA 1ISHA 5T8KA 1EE2A 3JD4A 3AY7A 3MJEA 4AJ2A 3AI1A 2VUSA 3KYCB 2GN9A 2NTNA 4WOJA 2W2KA 2GZ3A 5G0VA 5CP8A 4FFRA 3G0OA 1O89A 2JHFA 3ZWBA 4D0RA 4BOYA 1ADFA 1WP4A 3GVIA 4XX0A 2Z5LA 4JBIA 5AXCA 5G2OA 3BMOB 3UICA 3WQQA 3HZZA 3ZHZA 4NU6A 4Q3NA 1TI7A 4GWKA 2RBEA 3AM5A 4D44A 4LVCA 3WR5A 1ZK1A 2FHSA 4U5QA 3GVPA 4JXKA 1NHWA 1GCUA 1QLJA 2EW8A 2HU2A 1Z74A 2VNSA 2V6GA 5KJEA 1O95A 1BW9B 1PGPA 4Y67A 3G1TA 4OQYA 2AMFA 5DOVA 4LSMA 1CDOA 1GY8A 3W8DA 4J0EA 3BAZA 1H2BA 2DTEA 2XXJA 1NPDA 2O3SA 1ZEMA 1VKNA 3MOIA 1LSOA 2H9IA 3R3JA 4A03A 3OH8A 2AQHA 3L4BC 2CF5A 1MGOA 4FS3A 3IC5A 1VJ0A 2X6TA 1TVEA 2C54A 1GDHA 1K0UA 1LDMA 3BMNA 3OBBA 2IEBA 3OEYA 4R1TA 5DZSA 1XCBA 1DC6A 3OIGA 4BNZA 1AN9A 4WCFA 3WFJA 4NR0A 3PLNA 1NQ5A 3E5RA 1YKFA 2O48X 2ZQZA 4YJDA 1F06A 3JQBC 4ALMA 2Q22A 2D5AA 2QYTA 1IPEA 4GLLA 5CDYA 3OHSX 5L3ZA 3DAPA 4OKIA 3RWBA 4BNMA 3TF5A 3WGGA 2FR0A 2IZ1A 4A0SA 3K96A 1AHIA 4NBTA 5A4DA 2GN6A 1I36A 2FPGA 3OQ1A 4YAJA 4DWVA 1XR3A 1UZNA 1HDYA 4PLZA 3UGKA 4CLDA 4YA6A 4DBZA 4J7UA 4YRBA 1ZSNA 5CPFA 3H2ZA 3LZ6A 4W99A 4GQAA 2OUIA 1U2GA 4TKMA 4E3ZA 1L7DA 3M1LA 4JX8A 2A94A 4OH1A 3RU9A 4B3HA 4DMMA 5I9NA 1M75A 3GNSA 4TROA 4AJJA 4E4YA 2H1SA 3PVZA 5I7SA 4PLFA 5L45A 2PKQO 2UUOA 1U8FO 1QXSA 2P9CA 1M66A 4RVDA 1C1XA 4X54A 2QHXA 3G17A 1I3KA 2NVBA 1R0KA 1P1KA 5A05A 2QQ5A 3H9JA 3IAHA 1Q0LA 1A7AA 3ZNPA 4CODB 3NT2A 2JKVA 5HS6A 4CQMD 1LRLA 4E5MA 2R2GA 2NU7A 5KVSA 3JQEA 3V1TC 4EJMA 5KIAA 4DBVO 1MLDA 2HRZA 2IDZA 3BZUA 3M1AA 4RV9A 4W4TA 1Y6JA 3AOEA 4JLWA 4Z3DA 1WMBA 3OP4A 5JAIA 1MB4A 2EW2A 3JQAD 5C5IA 2DFVA 1GQ2A 2Q99A 3FR8A 2DM6A 1XYGA 3PHLA 1MX3A 4MVJG 4Z0PA 3U9LA 1H2HA 1R66A 2XF8A 1LRJA 3RD5A 4A10A 1JA9A 1VRWA 4FFOA 1OAAA 1YE3A 4RO0A 1M6WA 4BNHA 1LLDA 3JQDA 2EKQA 3JYOA 1WNTA 1A5ZA 4YEDA 5K9ZA 3CPSA 1H0KA 3SVTA 4P4LA 3GRKA 3JQCA 2AEFA 2QYSA 3EZYA 4UEJA 4DPKA 4DYDA 3ETGA 2QRKA 5TRTA 5KVQA 4BNVA 5BSHA 5DCUA 4Y6RA 1U3VA 4WCDA 3L6DA 1JKFA 4R54A 3OQ6A 1F17A 1Z75A 1ZK2A 4IDAA 1TXGA 4DLAA 1XA0A 3WWYA 1T2DA 2I3GA 3VOSA 1P31A 1BRMA 4J16A 4L8VA 5EL0A 2P9GA 4I08A 4UREA 4Y8VA 2X9NA 5ICSA 4BO6A 2D5CA 2VWGA 1KETA 2HK9A 5CDUA 3ASUA 5ER6A 1V9LA 3T4EA 1YO6A 1PGNA 5T8KC 4GLOA 2W2LD 4IM7A 3VPGA 2QZZA 3VPXA 1KEWA 4NIMA 4XB1A 2PV7A 1U5AA 1N92A 2GERA 4PLCA 4B4WA 3U62A 1R4NA 3B6ZA 4DGSA 3SLGA 1B14A 4HFMA 1PJ2A 5IXSA 4JGBA 3BHJA 4J7XA 2AQ8A 4YJHB 1HF3A 2X23A 4RPLA 1EK5A 4YWJA 3TZ6A 5EINA 5T64A 5H82A 2GR9A 3QW2A 3PYLA 4CQLA 5LDHA 3K9QO 1BMDA 3BMCA 3GNQA 2TMGA 1D1SA 1KEVA 1KC1A 4GMGA 1VPDA 2LDBA 2ZTUA 3LF2A 5DP1A 1KC3A 4XYEA 2ZYDA 4BMNA 1GPJA 1EQ2A 3U0BA 3W4KA 4E2ZA 4OGWA 1WDKA 3D3EA 4YDRA 4GKBA 3GFBA 3HHPA 2JHGA 2HJRA 5AYVA 2PFGA 4XWYA 5TJHA 3KB6A 5G0TA 5BNTA 5JLAA 1UP7A 2AXQA 3WQSB 1LEHA 2ZJ0A 3EC7A 3FR7A 2V6MA 4K26A 4Q3AA 3K30A 5T6BA 2YDYA 4H16A 2VYNA 2JAHA 4QTZA 3GRPA 3IMFA 1I2ZA 4AJ1A 1ZO8A 1ADBA 1YDEA 4PZCA 2TMDA 3PQFA 1Y81A 3HG7A 3WICA 1LA2A 4JP3A 4HBGA 3JD1A 4GGOA 3WS7A 1P77A 4WCFC 4FGWA 1EFLA 3U49A 2GF2A 3JQGB 2EJWA 4HUJA 4D42A 1JWAB 1SO8A 2G82A 5LC1A 3FNHA 4BV8A 2C7GA 4YVFA 1E5QA 4HY3A 1PZFA 3F5SA 4PLHA 1NYTA 5DT9A 3W8FA 4J90A 2Q46A 5KCZA 5ITWA 2W4QA 3PRJA 1ZVMA 5T73A 1DLIA 4RPJA 4O5OA 4BO9A 2G0TA 1KVTA 2CVQA 3GZ4A 4G2NA 2NM0A 3ORFA 3OJLA 4O0LA 4KQWA 1ENYA 4CMKA 3CMMA 3F5QA 5BSEA 2FR1A 1YVEI 2X0RA 1NM5A 4L9RA 1Q0HA 1Y7TA 3AUTA 3NGLA 3O38A 4YB8A 1UAYA 1IZ0A 1B0AA 2CF6A 4UUOA 5KVVA 2FRDA 5BT9A 1ULUA 3MJTA 1N9GB 1PS8A 1HSOA 2BRUA 2QG4A 1I3LA 2V65A 2ZKLA 4FDAA 4P4GA 4XQ9A 3INRA 3DBLB 5AOVA 4Z9XA 2BD0A 4IDBA 3DMTA 1Y5MA 3KBOA 4W9NA 3VTFA 3PFFA 4RCVA 2VNAA 2YW9A 4FJ2A 3GAFA 4HFRA 1PJ3A 1B8VA 2F00A 2J3KA 3MJ4A 3OIDA 2C5AA 3KV3O 3IS3A 3AOEC 2J3JA 1AHHA 2POQX 1GUFA 1T1SA 4UVHA 3I1JA 2ZB3A 3RI3A 1SZJG 3UW3A 4E12A 5H81A 2Y66A 4W7HA 5DCWA 1S6YA 3CXRA 1YL5A 1TT5B 4RF3A 2WEKA 3VH4A 1H9AA 3CUKA 3K92A 2D8AA 4QO8A 1NQOA 2P2SA 4PG8A 3LC7O 2YJZA 2YUTA 3H5AA 4CLOA 1DLJA 3BXXA 2H5LA 3NUGA 4HNGA 1BG6A 4HADA 3WB9A 4CLOB 4PRKA 2WJPA 3JD3A 3BTVA 1NBOA 1E7WA 1XIVA 4NDNE 4OO3A 8ADHA 4AJHA 3UHAA 3G79A 3HUDA 1EMDA 5L7TA 4DLLA 5CDSA 1LDBA 1NP3A 3BYZA 4RPGA 3EK2A 4CM9D 3WGOA 2YHIA 1N7GA 1P0FA 1A9ZA 4YT8A 1HLDA 4F6LA 4CM8B 5GZ1A 4GH5A 4ZVVA 4YT2A 2NVUA 4R69A 1V35A 4AJEA 4WKGA 1JKIA 2J5QA 1RYDA 3ANLA 3GH3A 4WLVA 2O7QA 1PJBA 1NXQA 3LLVA 1E6UA 1R6DA 5JDCA 3BHMA 1DFGA 4CLHA 2DC1A 3GF4A 3UOGA 3BTSA 3DO5A 3WGYA 4W6ZA 3HSKA 2BFMA 5JSFA 2J6IA 4FPXA 2B4TO 3CZRA 1U3TA 2Y1EA 2DVMA 3KUXA 4WLNA 3OA2A 1RPNA 4PG6A 1LSUA 1MG5A 1PJTA 3WLFA 1R37A 1P1HA 3MEQA 3FBGA 2YFHA 2J5RA 3PHJA 3R6DA 1LUAA 5C37A 4YT5A 2RHCA 3VAZA 1GZ6A 3JQFA 4WPGA 5FI5A 1XU9A 4YCAA 2EXXA 1BDMA 3PHIA 4II3A 1B15A 4B4VA 1YOVA 4D3FA 3G49A 1X14A 4MKZA 1L7EA 3OICA 3ZWAA 5CEJA 2X5OA 4HNHA 4RPHA 4E5KA 3QWAA 4S1VA 4KMSA 1V8BA 5IJZA 1I2CA 2FZWA 2WYWA 3GAZA 4XGNA 2C82A 4B8ZA 4CUKA 5IFLA 1KBZA 3L0DA 4J7CA 4LK3A 4R5MA 3HN7A 2NTJA 2VOEA 1O94A 3G3EA 3I4CA 1JN0A 5TS3A 4A73A 5TQVA 3OQBA 3PYXA 2FR8A 1I3MA 2W2LA 2DBVO 3HNPA 3JCZA 3I9NA 1ZK3A 1DB3A 3C1AA 2HO5A 3EDMA 5CDTA 2CDCA 2QZ9A 4BGVA 1HZJA 2P5YA 2Y0CA 2NTVA 2Q3EA 5CAEA 2GUGA 2PKRA 3X2FA 4PLVA 3E9NA 4CMBA 2VWHA 3AI2A 2NQTA 4OSOA 5L40A 3UXYA 2NU8A 4WNIA 3GK3A 1DHTA 2ZB7A 1HDOA 3M2PA 3DBHB 2Y1DA 1GYRA 1NFRA 3AK4A 5JO9A 4J4TA 4IIUA 1EEHA 1NQAO 4ZN6A 1U5CA 3NT5A 1HE2A 3FNFA 2AEJA 4YT4A 2DKNA 1DRUA 1GV0A 5COBA 1NQTA 1UZLA 1CQIA 4IUYA 3I4FA 4CR7A 1VLLA 1ZCJA 4ALIA 5A06A 3JYNA 1UXKA 3OA0A 3L4BA 4BNWA 4CMCA 2WDZA 3NDJA 5GZ6A 3DZKA 5F5LA 2EP7A 3DMYA 3RASA 5I8WA 4MVJP 1EK6A 1YONA 1GQYA 3GZNB 1VL8A 4P8RA 4R01A 2OXIA 3IUSA 3GVXA 5EERA 5JMWA 2IZ0A 4OXYA 3JQBA 3V1UA 4CM5A 4BUCA 3I3OA 3I23A 4I9NA 3E9MA 5KOIA 5B4UA 2DAPA 4MVJF 2QX7A 4DREA 3I9MA 1IE3A 1Q7GA 3HQ4O 2JL1A 4E33A 2VTEA 3W6ZA 1V3VA 4BO5A 1OFGA 2IRWA 3WMXA 2DBQA 3ULKA 2X0JA 4K6CA 3FWNA 1UZMA 3GGGA 1NFFA 2D0IA 2FOIA 2WE7A 4EJ0A 3TDKA 3DMTC 4Z0HO 4YJGB 3M6IA 3STHA 5TSDA 3PQDA 4ONEA 4GX0A 3D64A 3WBBA 1DAPA 1EE9A 3OJ0A 2BI7A 1XEAA 1ZKMA 1T2CA 3AOGA 1ENOA 2IODA 3ZV6A 3KHUA 1BHSA 1MA0A 1KERA 4Y9DA 1HLPA 1FXSA 1HZZA 1SB8A 1P1FA 1SB9A 3AY3A 1W4ZA 2C5EA 3I6IA 1W8DA 2VT2A 1SNYA 2I6TA 2VWPA 3BMQA 3L6EA 2Z1NA 3QY9A 1W0CA 2QRLA 1IHYA 3K5PA 3GN2A 4EUEA 5L95A 1V3TA 4BNTA 2X58A 2V6FA 1JVBA 1EUZA 2BGMA 2UYYA 3DB2A 3KYDA 1JAXA 3NKLA 3HWRA 2AEMA 1E3JA 1J49A 4IIVA 3CEAA 4BGEA 3K2EA 1Y8RB 1UXIA 4YYZA 2LDXA 1C0LA 2Q1UA 4RF4A 1GADO 3FD8A 4LRSB 5JDIA 4MINA 3OJOA 4ND5A 5KNLA 4TZTA 3D7LA 3IKVA 2ILTA 3EHEA 4HFNA 4IY1A 4ILKA 5BSFA 1I01A 3P19A 4DIBA 5JDCC 3FSRA 3WSVA 2EIHA 3ZZNA 2C07A 2CD9A 3U4CA 1K6XA 3ETEA 3ROPA 5HWSA 3IUPA 3ROMA 3PXXA 4CM4B 1PQWA 1QG6A 4YPOA 2W90A 2DBZA 1H9BA 3GPDG 1Z7BA 2OGUA 3CZMA 4XEHA 4CM9A 2VUTA 4GSKA 1WZIA 3ON5A 5ER9A 1DXYA 1EBUA 2O3TA 4XDZA 5IDXA 3H9UA 1WZEA 2AG5A 5H83A 3LSYA 3JQFC 4YAGA 2BFPA 3LU1A 4R3NA 4KTTE 2BH9A 2B83A 1J0XO 1O5IA 4Z3KA 2ZQYA 5CEFA 3ANMA 1YL7A 3ZWCA 4ZQGA 2IYPA 1WW8A 4D46A 4NU5A 4HKTA 2HK8A 3U4IA 1Y8QA 3D4NA 4C4OA 1CQJA 1BDBA 3KSZO 3AUAA 4IQ0A 3Q0EA 2HMTA 3OIFA 4MO2A 4D0SA 1IZ9A 1SAYA 1DIBA 3F1KA 4BNUA 3JV7A 4ZJUA 2YZ7A 3ASVA 4PIVA 3KLMX 5THQA 3LVFO 3C7DB 3F4BA 1EVZA 1GU7A 4CMIA 3V5NA 4U0JA 1QV7A 2W2KB 3DZJA 1U2DA 4TKLA 3H5NA 1PGQA 3S2IA 3ZGYA 1DIHA 4JJGA 4TRRA 4EUHA 5ADHA 2G5CA 4DVJA 4U7WA 1UDAA 4ND3A 1A27A 1T2AA 3A14A 5JCXA 4HP8A 5TNXA 5COQA 5CG1A 1QYVA 5F1OA 4EDFA 4XQGA 1PS0A
chains in the Genus database with same CATH superfamily
3VPSA 2L19A 3OQMA 3I32A 2ZSHA 4JMPA 4CMEA 2DHRA 2A1TR 2G08A 2IYOA 3IE2A 3NIBA 4ND4A 1UXOA 4IZHA 1E5TA 3BD6A 3B70A 4OV6B 4E21A 1GV1A 1MP0A 3EGWA 1LCIA 2O2YA 1BVYF 1Z6PA 4DYVA 4MRSA 5EKDA 1VMEA 3UO8B 3THWA 1E6KA 4KHPB 3W1VA 2ZYRA 3LK6A 1XUOA 2BR3A 3AT1A 1L4FA 3Q40A 1LQUA 1LDGA 1NRWA 2C9CA 2I2BA 2Q5HA 1RAGA 1DKQA 1UKVY 4K03A 3UAWA 3W5VA 2G7MC 4AQYB 3Q3CA 4UU7A 2FK7A 5GM2A 4CHGA 2HU8A 3IO5A 2QE7D 4HLQB 4IJUA 4PC2A 5IAOA 1QRSA 3OM0A 4UE2A 3P52A 4JZYA 1WA5A 4IDOA 3F4LA 4A8JB 2VWQA 5CJJA 3IKMB 1G18A 2VYVD 3IP3A 1JQ5A 2IYTA 2XHEA 3FVQA 5AOCA 2FZCA 3D8BA 1KP9A 5IC5A 3U7IA 5F5XA 3VV3A 4AYTA 4YCLA 1QMIA 2P9JA 2PTGA 5F21A 1U65A 1TRHA 1J20A 2WD7A 2PAAA 4OQXA 4YRAA 4GPAA 2PH3A 2OILA 3NHFA 5D84A 2GWHA 4HS4A 5HGXA 1YZFA 4WCFB 3ZUGA 2WPDA 5E3JA 2XXAB 4ZU1X 1Q3TA 2WDPA 1PFWA 5F1KA 3WGNA 4L75A 3AO0B 1DMRA 5KTRA 3R9IA 2DY1A 2CYBA 2QL6A 1KMNA 3JQ9A 1C9JA 1DTWA 3VR0A 3NDPA 3KQVA 3HB9A 4C6RA 2HCTA 5BRJA 3AFNA 5IWAB 1QKKA 1XHLA 2XODA 3LW8A 3OPQA 1WPGA 4YBZA 4RIGA 1ZD9A 5TR9A 4N47A 4CFYA 3G2JA 1YWGO 1Q0UA 4KXYA 2P2NA 3L0BA 1UPBA 4I81A 1T4MA 2YVQA 4GPBA 3OQVA 4HG2A 3ZWYA 1X2BA 3WADA 5AESA 1OI2A 2G9VA 4IXDA 1J4AA 5IAGA 4I5DA 4DDWA 4GRDA 3FOFC 2RH9B 1CS0A 1HDXA 2OCDA 2WJAA 3NC1C 4E07A 5EMHA 1TW3A 1W34A 1T9ZA 1DQYA 3NIFB 3NJ4A 3EWSA 1P73A 1UT5A 4ZDJA 1XELA 1ZH8A 4BUJA 1L3IA 5PNTA 4F9FA 2FN4A 1U04A 4MB6A 4GSLA 4P86A 3EBOA 2BELA 1WMDA 3DV0B 3HJFA 3RE1A 2XCOA 4L72A 2C9ZA 4JJ8A 4LRWA 3VU9A 4CVNA 3WIUA 1K6JA 5H1YA 1GITA 1CY0A 3ZK7A 1ESEA 1E7MA 3VYUB 2GCOA 3Q3JB 5L3SA 1P0MA 3GQVA 2GO1A 3HFRA 3U7JA 2XLCA 4GWGA 1U1FA 3NV9A 4FR2A 4TQGA 4WBNB 2X7JA 1W0JD 3LFHA 2RIPA 5DNWA 5BMOA 2VQ3A 5FD8A 3V3TA 4YAIA 1CRPA 4HXYA 5GQSA 1YQUA 2ZWIA 1JR3E 2P1RA 3TRHA 4IXWA 2ENWA 4C29A 4EB6A 2V4ZA 3N05A 2VF4X 4X91A 3KJXA 4PC6A 1OA0A 1RCUA 2OBXA 3KVVA 4ZT4A 2R7LA 3VYRB 5BWOA 4C04A 1G4AE 3IQDB 3CHYA 4PG4A 3DDWA 5DYYA 3UMVA 5AFSA 5DYTA 2M1ZA 3HZHA 3SHVA 4A2WA 1KO8A 4ZZ1A 4D9JA 1QQTA 3JYLA 3M6MD 3WMEA 1I3OA 4FYIA 2YIVX 2Q0XA 3TL3A 4NZOA 3GEEA 3BDIA 3AGPA 3MOGA 4IHJA 3RS5A 3BD7A 1ML3A 1E2FA 1JAHA 5IXYA 3R3XA 3T7EA 2HQSA 2H4FA 3INYA 4Z2YA 2OGWA 4TWBA 2WT8A 2BEKA 4YLGA 5ITZB 1QK3A 2RHBA 5IKEA 1QP8A 2EKPA 3OZ7A 3N8KA 1XCPA 4HMOA 3HRIA 5DI9A 3S1SA 4H3VA 4RV5A 3ZJ4A 1QSGA 3QU9A 4E0BA 2PS0A 2PQ2A 3NAQA 1CZKA 1FP7A 4KN5A 3WLTA 4DLZA 3PB3A 5EIOA 2C5HA 4IF6A 4A4DA 1P5JA 3L4SO 2KE5A 1P4HA 2VHXA 3FKSD 1X9IA 3KEOA 3O4IA 2OCIA 4KWIA 4NG4A 3VKWA 1C81A 3AEZA 4MLPA 2ZCVA 4KQ6A 3IRVA 4YP7A 4AJ9A 4X1IB 4DBLE 2B37A 1RXEA 2XH8A 4DZRA 1A8QA 3RJMA 4AN1A 5LP6F 2IHKA 2OMEA 4QXRA 2C5GA 4XWKA 4OGLA 4FFBA 1T3HA 3AVPA 4M0FA 4DV4B 1LVUA 2AOWA 4MVJM 1GZ3A 3FVWA 3GLIB 3IR7A 3ROFA 4A26A 4B33A 1PDWA 4QGGA 3ZWDA 2E37A 1I7CB 1PV2A 1ZZEA 4II2A 2RHMA 4GMFA 2PAFA 3P97A 1J8DA 4CMAA 3AW9A 3LWNA 5BR4A 5G0WA 5K3BA 1WKCA 4AAYA 5D5QA 4LNUB 3UJ6A 1J22A 1PJQA 2XE6A 1P7CA 3EWAA 1JIXA 5T4HA 3AL0C 1TOAA 9LDTA 1KEEA 4OFWA 3DO6A 4DA8A 4GZ6A 1KVUA 3JRNA 3TH5A 1Z5NA 4YRKA 2OFXA 4H7HA 4JCCA 1T6NA 2OFOA 5I6DA 3ZJTA 4RDIA 2GPNA 5AVVA 4W5NA 3E9DA 4B3FX 3LQRA 5FI3A 3ZU2A 3WL4A 3ZV4A 5E7QA 4CQLB 3WNBA 3KZVA 3ZDRA 5IKPA 3N8NA 2HT1A 1L3CA 2QNIA 4OQDA 2NZXA 2QUJA 4JL5A 3KTOA 4RU1A 3KKZA 3Q3VA 2WOOA 2WZQA 4KQJA 2X9VA 4UDYX 4EX6A 2R8BA 3P0EA 3L6RA 3MSCA 2H4HA 4TYQA 4BKQA 4CMEC 4OI0A 4B3BA 3AF5A 4DM7A 1OXBB 4PCAA 5YASA 4XGRA 3ILSA 1EJ6A 3OZIA 2F8MA 2G76A 3RQSA 5F3DA 1AY0A 1CCWA 2F1KA 3TJRA 1PN3A 4XIJA 2OAEA 1TTQB 4IZ6A 3EC2A 1CJMA 1XP5A 4RIEA 4YS6A 4L8FA 3A58B 3K0FB 4QFMA 4WX2B 3TQCA 3MJFA 1BH2A 1W25A 1AA9A 1CDEA 1XU7A 2C98A 1YB4A 3B20A 1P7VA 1QC5A 2J85A 2WHPA 3HB0A 3Q87B 4GR5A 4XQEA 2NP7A 5AJHA 1GUZA 2GD2A 3ZE6A 4OBBA 2GOYA 1EWYA 2CYCA 3WLMA 2RHLA 3C4VA 5LVAA 1E3IA 1MT3A 1QIKA 2V7QA 3DKKA 4BQIA 1J8VA 5TMBA 4NZMA 3HHEA 3WBJA 2OPHA 1JDTA 2E87A 4EUKA 3MAGA 3MFYA 4IMPA 4R98A 3VHXB 4Q24A 4F5WA 4URFA 1EKXA 2G63A 2VJDA 4F4DA 3B9BA 1JDSA 1M2VB 2W00A 3VU1A 4ARBA 4URUR 3W05A 1KEZA 2CEKA 3ENQA 3JQ9C 4KQIA 3AFHA 2R79A 1RFLA 4KQEA 5JHHB 1F8GA 3FWYA 5EPUA 4AMVA 4B87A 4L0QA 2XUHA 5KYVA 1KBOA 2BCJQ 1ZL2A 2O59A 2XQFA 3TZKA 4KE9A 1US8A 4UBMA 3AMVA 3GPIA 3EPHA 5LA6B 4TWZA 5LDGA 3TZCA 4WE3A 3O8OA 3A9UA 4CXMA 4AXBA 3PVCA 2Q3DA 4LKOA 4RSMA 5HIKA 1V8ZA 2WC1A 1KVSA 1UBMS 2Z4RA 3DFZA 4OL0A 1CY8A 3ZKWA 2NX2A 1J07A 3FFBA 2G1UA 1Q84A 5IAKA 4EGFA 4UFPA 4ENRA 5LPNA 3QX8A 4HDNB 2C3OA 5CCEA 3ZZMA 3C8UA 3F8TA 1ZWLA 4PLYA 5I9TA 1WBJB 3H3XA 1QIHA 2L2QA 3WGLA 1LV7A 3UBTA 3A6FA 5KU1A 3EGDB 5CU7A 3DHNA 2I76A 2JH9A 1YMQA 1TDJA 3KYBA 1EX7A 3R0IA 4M1QA 1JR6A 2KMLA 3V2HA 3T3NA 5JYDA 3H1GA 3GHYA 4G65A 4UBIA 2A5YB 1EPUA 4K9LA 4ZQFA 1LBHA 4LV8B 2OWDA 4W8OA 1NJSA 3ZXXA 4DQUA 2PBLA 2XBUA 4G25A 1EXWA 1UODA 2RGEA 5JXHA 4GUAA 2GXSA 3BA6A 4BTLA 4DQKA 5ELMA 4N9WA 5DRYA 1IRXA 3SFVA 5KQPA 3YASA 4EHAA 5K0GA 3HBFA 3D4LA 4RFLA 2P4QA 5ALLA 4BLRA 2EQ5A 2G6TA 4OHMA 5CA0A 2AYXA 3DDOA 2XOXA 3E8XA 3FCUB 5DCLA 3IXLA 3QVOA 1Y7HA 1MZVA 1XZ8A 2R25B 4QQRA 2OCYC 1R2QA 5ALGA 1KNQA 4CQMA 4NS4A 4A0FA 1I4LD 2VYCA 3B3FA 1RADA 4YRDA 3UENA 4MVWA 1XKLA 3AEYA 2OK7A 1M0EA 4PG7A 4EJ6A 3F67A 4DEXA 1LXCA 5AIBA 5FF9A 4QOIA 3F1LA 5REQB 1USUA 1VTKA 2VK1A 1GKLA 4XGKA 5LJIA 4OK6A 1H1TA 1XT6A 2R60A 3CTMA 4WXPA 2XKJE 1WUTA 2JH3A 1E2EA 5MGBA 2XWJI 3ESAA 1GTL1 1EZZA 1BXGA 2GHTA 2PL5A 3BDVA 4IH1A 4LYFA 4E30A 1QVWA 1T36A 2BF4A 2Z30A 1Z07A 5AKIA 4ZCLA 3OLZA 5DM0A 1OC2A 2Y99A 4NHOA 4X0EA 4PC3A 1OLSB 2W6ZA 2WV7A 1HBJA 1MJGA 4U7DA 3B1KA 1KXZA 1E89A 1Y1SA 5IAEA 3A32A 3O0DA 4IBOA 2FMIA 4K1LA 4EKEA 1C4XA 1JSLA 5ADVA 3RIGA 3E48A 4UEOA 3BVPA 5KQRA 2VUHB 3PD1A 1KDTA 4QXAA 3LT0A 2VQFB 4AJNA 3G85A 1FOEB 2YR0A 3L40A 1U7PA 3C1TA 4CF3A 3PF8A 3JASA 3EGXA 4Z9BA 5CB0A 2DPXA 3EA0A 5AJZA 1E69A 3UWPA 2AKEA 2KB0A 4I1RA 1X39A 2P7HA 1VJ5A 5F9HA 3OC0A 2VZ0A 4IS3A 1OZ0A 1RLOA 4CL2A 2CXPA 4M7OA 3PQCA 3NOOA 4Q7LA 5DNAA 3QIVA 3U56A 3SX0A 3H1PA 4NV0A 5AOBA 1F38A 2QM7A 2OM6A 2VXBA 3ISTA 1CUBA 1Z4PX 4Q03A 3QTBA 5E6RA 2BHLA 3AR7A 3C6ZA 3VDQA 1XNQB 1R0RE 4W1PA 1U7UA 2ZSIA 3I73A 4F84A 2JCVA 1S7CA 2O2CA 5GJWC 2BMAA 2Y0DA 1Z47A 1E0DA 2D59A 2QBYA 2AL7A 4OJQA 4IAOA 4B3XA 3W3AA 1WEKA 4J07A 4JKYA 4P22A 3OY7A 4Z6KA 2ZUVA 4R9NA 3FAKA 1ISFA 4RD1A 5K8JB 3B3GA 1FUKA 3QE3A 2ZUEA 2PKWA 1DO0A 3N0WA 5LIPA 2OGTA 2VLBA 2BIFA 4D74A 1Z7WA 3CBGA 3VVLA 2G25A 1WXQA 2MTBA 2YY5A 2CNKA 1HNXB 3WDKA 2IYZA 8GPBA 2XCSB 2J9FA 3FG9A 4IQFA 5ERGB 3II6X 1E3DA 3CB2A 4PICA 4TV8A 4IDCA 1C7FA 2A4KA 4JUFA 3RBXA 3WLRA 2LUOA 1N3IA 3RCBA 1L9KA 3GD7A 3OZEA 4GI2A 1U0GA 3QU7A 5FWYB 3LUHA 4MRAA 5JNSA 2R9VA 2V4UA 3OLYA 4GIBA 4U2FA 3BE5A 1T8UA 5L3RA 5ABPA 1FRNA 5JE8A 3WXBA 4RTSA 4X45A 3Q72A 4LSGA 2ZTVA 2BFCB 4CMHA 3K0BA 4IXNA 3A6HA 5CAEB 3I39X 4HPXB 5AI4A 1YR6A 4BJ3A 5HE8A 2E5WA 1JG4A 4GG1A 1WDLA 4O4LB 4X71A 4CM1A 1IIBA 1QWSA 1Z36A 2GZHA 2R6ZA 3AJRA 3CO5A 2JFVA 4Z4IA 4M0PA 3VPDA 2B0CA 3DOHA 1CYDA 1R9GA 2PRZA 5JQGB 3KZMA 3Q41A 2XLBA 4Y9RA 2QK4A 3GUYA 1GPUA 2WSIA 1XALA 1ORRA 1OTXA 2G36A 4OAQA 3TZQA 2LCFA 1AGNA 1VL2A 2JCYA 2ZK7A 3SXPA 4DF3A 1BSVA 2PJZA 4PCVA 2H17A 4XQ0A 3V4PB 1IN5A 2GFIA 2OORA 4UASA 3T7CA 3OSUA 1HSZA 3UB2A 4G1VA 5EJAA 1RC0A 3DW1X 3EJ6A 3P4UA 5IASA 4G36A 4EWLA 3B3AA 2ZYAA 3EZXA 3SZUA 4R9SA 1GA6A 2VRCA 5ETJA 4BIIA 1CY7A 3GAAA 6ABPA 1NURA 1W29A 2DGDA 1JEYB 1KMMA 1T0IA 2I6SA 3HPRA 2IPAB 2JS7A 4O1IA 3K2BA 4JR2A 4KXXA 4NZYA 3S8YA 3IBFA 3FRHA 3MGGA 2NQ2C 2QKYA 1ZNWA 2WMNB 2P77A 4BPBA 4Q1VA 4AKTA 3ABQB 4AIRA 4Z4CA 3FZNA 4WUVA 2J3HA 4HGZA 3W5AA 2FEXA 5HOQA 4UU8A 2QTVB 1CV2A 1JMVA 1RHKA 4YCJA 5BUCA 1QUFA 2C59A 3D4IA 3PC4A 2GWRA 4IYJA 2R84A 2E49A 2GTHA 5FNVB 4NV3A 4CN8A 8OHMA 3DBVO 4DTCA 1W581 2IHTA 2XHZA 1Q7BA 3DYIA 5C7LO 3O4RA 3TDNA 1JPVA 2BMEA 2QVXX 5DYWA 1AF4A 1ZNZA 4NI5A 2MYPA 4N3NA 5L53A 1DJLA 3R7AA 2PGLA 3RTEA 4ICIA 4PZZA 2IEZA 3RG2A 3L7MA 1QTNA 3HRHA 3DGFC 2ORIA 5A0TA 3Q8LA 2E89A 1NX6A 1THZA 4OY3A 2O52A 2E3JA 5H4GA 4AICA 5HW0A 1F48A 3ZY2A 1VJTA 3DBRA 3N28A 1E8MA 1ZAKA 5AW3A 5CJPA 2OD9A 5JFTA 1E0JA 4MUJA 4UUQA 3V00A 9ABPA 2WJHA 1E3WA 2FJUA 3DPSA 3IQHX 1E1MA 3J7TA 4OUKX 4W5RA 3DDNA 3VHQA 1CZUA 2PGNA 3Q6IA 1J90A 1U9ZA 2L82A 4CM3A 1ADCA 3N59A 1QFXA 2QAJA 4ARCA 1TO2E 3WGZA 1DP4A 3CM0A 4L9SA 2JIZD 1B1AA 3PBKA 5F12A 5FR1A 3VKHA 1T5TA 1WXFA 3DTVA 3S8MA 4UVIA 4QG3A 3G0IA 3H6GA 2ZS9A 1P1RA 3KJEA 2P9YA 1LPSA 3EF1A 4K88A 1GKIA 2Y1LA 1J06A 4TT3D 5HTKA 4E94A 1DINA 2ISSD 4KODA 4PVCA 1LJUA 1JJ7A 5DCYA 3BHNA 3ER6A 1ZFNA 4JLPA 3BIOA 4BMPB 3VPFA 3H0CA 4DHEA 5C8DA 4NSNA 3WMWA 4DJJA 3GHHA 3PTZA 4RV4A 1CR4A 2FGJA 1V37A 3EEQA 1SCJA 3GEBA 1Y3AA 2EWMA 2VVTA 3EZ7A 5GJBA 5SZHB 1OX5A 2BGKA 3KYDB 3I0ZA 1XGKA 3OM8A 2JAQA 4KWHA 5A9SA 3H9QA 4YMLA 5JASA 2EAUA 1CK4A 3VR2A 2JG3A 4ZVSA 1CIVA 2DFTA 2F2TA 2OZVA 4AP6A 4M9XA 2F8TA 1RW4A 2IEYA 3TMAA 1JSXA 3SEFA 3S2FA 1BQ3A 1K8YB 4O3MA 4TMKA 1PNRA 5CLQA 1KH1A 4DRYA 3OZWA 1JQBA 5EQTA 5A3QA 3WGTA 621PA 4ZU6X 4I5EA 6PFKA 2QENA 4GBGA 4OHZA 3TR5A 2GPYA 4M87A 1NUQA 3C3JA 4LX8A 2P4UA 2Q6LA 3VR6A 4G1CA 3VR3A 1VHTA 4MNTA 4CL3A 4DJFC 5IT4A 2X3YA 4EQ6A 4YXFA 5HA5A 1B0UA 3PS9A 1THTA 1EXNA 1W5AA 2HA0A 4AL4A 2EL9A 1NP7A 1OW3B 1JW9B 3D3JA 1YS2X 1L1FA 3WOHA 1J00A 4D8WA 2XT9A 1F7UA 4MPPA 5LNK6 3ZHVA 2AJLI 1I10A 1EA5A 1MNAA 3DUFB 3MRVA 2ZRFA 3ND8A 5DE3A 1O96B 5HIJA 4OG2A 4CF7A 2FUG1 1OE0A 4QYTA 2WTNA 1NJ6A 2MYTA 2GZSA 2PCJA 3B36A 4XEUA 2ZCJA 3I2GA 3OMLA 4GFDA 4Q9AA 2SECE 1YIAA 2XUFA 3PDWA 2P11A 4P1ZA 3RGWS 2LGJA 3OJEA 3RSSA 2COKA 5IX8A 1IOWA 3PP8A 2DETA 2Q45A 4S0XA 3RHZA 5CDHA 5U1PA 4X94A 2QY6A 2D2IA 4C4YA 1DTEA 3NC0C 1FYVA 4ERXA 1PFQA 1ICIA 1Q14A 4M89A 2KQUA 1KAQA 3HDJA 1WHSA 2AOTB 3K1TA 3P9CA 1Z82A 1NC3A 3T8YA 3GJ8A 1YGYA 2GN2A 3NHUA 2C9DA 2FFAA 1OKKD 3FNGA 3L0PA 5CDGA 4FZ3A 5CCXA 2HKIA 1IXSB 1X0XA 1XTSA 4GYWA 2H1OA 2A3RA 3D3KA 3F3MA 4XKJA 8LDHA 4AKHA 1PT5A 4M49A 4P3NA 3AF4A 3FHCB 2JLWA 1IJKA 1C1YA 1XTPA 3AC0A 3AZOA 3DVLA 2RAVA 2GB4A 1OHHD 3HA7A 1WNFA 3N8GA 3P9NA 4GNKA 4C87A 2ZI3A 3A9TA 3MLBA 3ANSA 5E95A 5GAJA 4BYMA 3BXPA 1Q77A 2OV8A 3KEGA 1CZHA 3E53A 4CMIB 3OT4A 4PV7A 1KYQA 2P79A 3SM3A 2QYHA 3SHQA 2G9RA 2XUJA 4P92A 4QRDA 4BUZA 1P2BA 4BNJA 3RS3A 3TAXA 4Q1EA 5F3RA 3ZCPA 3GFGA 4KPGA 4QJ4A 3TG2A 4DR6B 3U40A 5EXXA 2IZ7A 1SFRA 1T5SA 4I50A 5JYBA 3GLGB 2DPHA 1KSFX 3N2GB 3I04M 5DSZA 3KAQA 3O4VA 5KNCH 4GD3Q 1FDRA 5HBRA 4ARSA 3U1TA 4WBNF 3RAJA 2Q07A 3PA8A 4FX5A 1SXHA 4G0XA 4TXNA 2AGVA 4P84A 5AVQA 2LIVA 3SNKA 4ZYXA 1NNEA 3KZXA 4LMPA 1NJ1A 5HUJA 5EEGA 3HDGA 1G3RA 5MFPA 1HH4A 3E15A 3P4XA 3THWB 4WNCA 1PR9A 3GJTA 3OKCA 1KF0A 4MV0A 3NBKA 4CL0A 3ESZA 4WNAA 3JR3A 4PGFA 3HM9A 2AE2A 5LZ5A 5BYKA 2F17A 2YINC 3O3NB 2P62A 1X1QA 3LY7A 4LHXA 1IAVA 2GRUA 1IZYA 4AP5A 3URKA 3K71B 1BWPA 4J1TC 4QT0A 2PGJA 1BW9A 1JR4A 5FOWA 2H4ZA 3QPDA 4GVXA 4BNIA 2OORC 1RAEA 4Y2GA 4RKFA 2LBPA 3N7AA 4B6SA 1RM3A 5FUYA 6LDHA 1E7SA 1QH8A 2GILA 2WHEA 4ETNA 4EKIA 1IMJA 1MOZA 5LYJF 3NYWA 1C3VA 2NYUA 5A03A 2F3SA 2YRWA 5D2CA 1ONSA 1K98A 4MGEA 2JW5A 5AUPB 4OLBA 2WD7B 4LXHA 2FW1A 3FAZA 2X0FA 1IOVA 3DXXA 3X1ZA 3DE6X 3K9GA 5COAA 4FMBB 5K0ZA 3E3NA 4LOIA 1SVNA 1QMHA 3WISA 3RTGA 4Q7JB 3GCXA 3MXOA 5IZCA 4UUMA 4BFSA 1U90A 3T4UA 3VISA 1BVHA 3ZJVA 3RLFA 2O2IA 1R0CA 3RUDA 1YZNA 4CF4A 1C3EA 5IF3A 4BFUA 3U4MA 1ZJJA 1DTWB 5JAQA 4YAWA 1T10A 3A6DA 1RQNA 1HFJA 3WKEA 2P8JA 2H9YA 3QPAA 1ZD2P 1OIVA 3G9UA 1ZCFA 1RQLA 2M6SA 5CK5A 4WOPA 3MT8A 1PW5A 3PR3A 4IDEA 4JB3A 1SIWA 4D79A 1OBCA 1ZQ1A 2D7JA 2M6RA 1SUIA 4Q02A 3CX4A 5AXDA 3A3NA 4WLUA 3ZXSA 2V9ZA 1CS0B 2FMUA 4J43A 1WY5A 3V4LA 1Z2PX 3I3SR 2QMOA 4NZPA 4GX1A 5I9MA 4S2UA 5I7RA 4OOEA 1BQEA 3BGVA 5A1JA 3KB2A 2WT9A 4MV1A 4OM8A 1KK0A 3KJNA 3LKVA 2PEZA 4JUIA 4MKRA 4V0ME 2QW1A 3TQFA 3ZDYB 1HYHA 3ABRB 2QMQA 1D2MA 3OECA 4Y0AA 4P2GA 5CFNA 4C2TA 3A9VA 4W8HA 3VU9B 1YR9A 4KYUA 1WCIA 1HETA 2VJOA 3EXIA 2Q2WA 3EY9A 3N7UA 2GCOB 1J9ZA 4QU0A 1CR2A 5L3SB 4G0NA 3UNXA 4DCNA 1RWNA 5HDBB 3BIWA 3B51X 4IGKA 4JODA 4F04A 4WV3A 3HLYA 5DNDA 1H5NA 2HLPA 1C3LA 1QGZA 3D7MA 4LQ4A 4UTNA 1PG0A 2Q9AA 3NVMB 4CE6A 2I8LA 2GD6A 2XRMA 4N1AA 3B1FA 1JFFA 4N54A 4UAJA 4PBRA 3V4VB 2OC4A 4FNAA 4RHFA 1PT8A 3I64A 2J6CA 2B3TA 2I6XA 1SUAA 1OZAA 4URVR 1RC1A 1UM8A 3UHFA 2NSLA 4H17A 4H7IA 5D3ZA 3H05A 4G84A 1CNFA 3OCVA 3SC6A 2CV2A 1DIGA 1P9OA 2A78A 2MIIA 3H84A 3QH4A 4Z1MD 7MHTA 4O63O 1LPMA 3QI2A 4IHJB 4B79A 3U7EB 5ES4B 2G6BA 5LB2A 3THOA 3TRIA 2CNWD 4K6KA 1TC2A 3DVQX 4BC0A 4XXHA 1T9GR 2Y71A 2CT8A 5JS7A 4PFSA 2OD7A 2Q2QA 1JJBA 4CV3A 1J6UA 1DHRA 4DLTA 1AQ6A 4CYMA 2VJQA 5JW6A 2IEDA 4JP2A 1QCDA 3IIEA 5GONB 1DBIA 1VSUA 3U3KA 1PNTA 3TTSA 4CCYA 2PUBA 1SPXA 2FG5A 3C87A 3U7RA 2I66A 3LQQA 1B16A 3TCNA 1SULA 1UC5B 5EGNA 1T9KA 3OKFA 4LYDA 1C5KA 3KQKA 3CZPA 3L7IA 4Y2XA 1K4MA 3H42B 5F2EA 5LJLA 1YA8A 5AW4A 3NQ41 4A23A 4IFTA 2CL5A 1HI9A 1DBQA 1ODCA 2ODAA 3LHFA 2CD7A 2QTCA 4C2AA 4KFTA 3TEMA 3NBAA 1MOSA 3KNZA 1VGRA 1OLUA 3K0CA 4MHOA 4AG6A 4RVUA 4ESOA 7MDHA 3KXIA 1HO3A 3ZKAA 4MQEA 1CHNA 1WV1A 3IGFA 4FFBB 4F6RA 1Z0UA 3CEPB 1OYYA 3IUBA 3IUNA 3MCZA 3PXCX 1ACLA 5LA6F 1O6ZA 2ZR7A 4K6GA 4EYOA 3WA7A 1ETHA 2QVBA 3O9MA 3QOFA 5I7EA 2NU9A 3D5QA 4RSGA 1A9QA 2IUSA 1QGAA 4FQ5A 1BJKA 1RRFA 1A3CA 2DG2A 1TMGE 3OD5A 3H9EO 2OMKA 3AIIA 3SR4A 3TN7A 2YIMA 1KJQA 3GRUA 3WQBA 2YY6A 3A4VA 2B30A 3C70A 5BV7A 1KZ4A 4FHEA 4EUFA 3L46A 1X6VA 3HC7A 4RTLA 1KEEB 5J4LA 4A9AA 2MR5A 4XH9B 3KYIB 3TL2A 3W8EA 1Z13A 2XIJA 4EGCB 3CH4B 1PFYA 3EXHA 3O03A 1U11A 4LXXA 1MO2A 4PZUA 2C7QA 3LUFA 5JS6A 3OSZA 1A4RA 1XDBA 3BGIA 1AZSC 2BZSA 1U2RA 4N5IX 4PG5A 4LMRA 1D9XA 5CTJA 2OR3A 4ZMBA 4LF5B 1T0BA 3B6EA 2E4YA 3EC1A 1PGJA 2B1JA 3AERA 4AY6A 4HGPA 1IVNA 1SBQA 3EPJA 4F3CA 3NRCA 1PZEA 4LYHA 4UC0A 4Z4HA 4D0LB 3H9BA 5A3VA 2C0PA 2J0SA 3C5CA 1CUSA 1YBVA 3FXAA 5HSGA 1W47A 1G0NA 4UCQA 4LWPA 1OASA 2B2XA 1EVYA 1UMBA 1WMSA 1RQPA 2C77A 2IYRA 2J46A 2QUHA 4GM1A 3ZVRA 5K3DA 1KMQA 5BV2P 1E94E 1Q6ZA 2H5IA 4R0NA 4F3YA 4L74A 3GGJA 3VU0A 3HFSA 2WQ6A 2PD3A 1EINA 3ND9A 4KE7A 2JVIA 5BVHA 2PKQP 1KOGA 1XJ5A 3FCXA 1SUEA 3LD9A 3ZCQA 5F3WB 2IOQA 1VJCA 2IS2A 2AR9A 1PQPA 1ULZA 4LDZA 1QC5B 1CT9A 3OETA 1T5OA 2H54A 2WHPB 5I8ZA 5FBRB 1JHMA 2Z9BA 2RMKA 4ZCMA 2QZPA 3IT0A 2RSLA 2O3RA 1RKVA 1YR3A 3JZAA 3JYHA 3SC4A 2KBEA 3WSWA 2PLNA 1YDMA 3LHSA 4YFYA 1PL0A 3S70A 4YALA 2XDYA 2J3IA 1LBTA 4AG3A 4DNXA 2GYUA 3CKMA 1MAUA 2PBZA 4JJFA 4J75A 1IPFA 1M83A 2HA5A 1XQ1A 2QTGA 4RDHA 1UKAA 2P65A 4OA5A 5CYPA 3SX2A 1E7RA 1VHWA 3KSDO 4NAHA 5IZCC 1R0XA 5L8VA 4KQMA 3WDSA 4DR4B 1T4BA 1SOUA 2QPOA 3ISJA 1ZVKA 5FBHA 3MN1A 2PBFA 3ITDA 1Y98A 1QPBA 2OGZA 2YYZA 2R5FA 2WF8A 4FMPA 3TWOA 4W9MC 2RHGB 2Z57A 3DBIA 1KI6A 2QE7A 1UWVA 4EF6A 4ZZ0A 1Q21A 2AFHB 1P9LA 2YS6A 1FTYA 1JMYA 2MHCA 3FUWA 2WD9A 3HH8A 3TLKA 3JQ6A 3OMXA 5K3SA 3SGLA 1MN6A 3FNEA 1FRFS 5EJEA 3G13A 4MI1A 2JJ1A 4CKBA 1SKAA 2QU8A 4GAEA 3MERA 2QX6A 1GZVA 3PCTA 1PHRA 3Q7QA 1ID8A 4MR9B 1BD4A 2ZSJA 2OYSA 3BA1A 3GO4A 3S1AA 3O8OB 4DBLC 2HTEA 4XJXA 4OHXA 2WVHA 2W22A 2DOKA 3F2IA 1A9YA 1WPRA 3I2IA 4KLRA 2YZGA 2FPMA 3VDNB 3DG9A 4ZZ3A 1I72B 1JLHA 1RBMA 1JTFA 4X60A 3ZKWB 1YZKA 1RLIA 3FGZA 5EXPA 1K3UB 3ZC3A 2UVPA 2DKFA 3KPYA 3MWLA 1LSSA 4OHUA 2VSQA 2HA4A 1SPBS 2Y2VA 3GJYA 1U3GA 3GRAA 3IMCA 4Y7DA 4IDGA 4UZFA 4OMFG 4TL7A 1UDCA 2X8WA 3D0RA 1NLYA 2NUBA 3OZFA 4BPRA 1G21E 3ES9A 1QX3A 1B6GA 3IAM1 4TZ0A 3FPBA 1X13A 3CUWA 1EDDA 1UP4A 1PWHA 3TZBA 4C7BA 4FSXA 1JG1A 2AYYA 3O21A 5B58C 4MV8A 5KTNA 3ZIAD 1O4WA 1E64A 4PNHA 5IC6A 2EZ8A 5ILQA 2IHJA 5IC4A 2JAWA 2WINI 2K2QB 4X3OA 4V1CI 2JJYA 3UN1A 2Y67A 3BFPA 4U6SA 1E9RA 3F7TA 2C9MA 2VJCA 2ZB8A 2HREA 2FEWB 5LXTA 2IHNA 3HVKA 1ZOSA 3B5IA 4MPJA 1J56A 4WY2A 2YWHA 1RYBA 4R41A 5CA0B 2HXSA 3GFRA 1FP4A 2IUEA 2YY7A 4JQYA 4DV5B 3ESXA 1NPTO 4O08A 3VYVA 4DLRA 5C4MA 4B6OA 4IS2A 2ONZA 1N6OA 3D6VA 4CLQA 1YZHA 4U8HA 4XFKA 4WMLA 3HCRA 4CQMB 3WYBA 1K6IA 1NUTA 2W6QA 1K5HA 3TQIA 3MTJA 5I4CA 3ZQJA 2XA2A 2D7DA 1TT5A 3N53A 3NP9A 2ZOSA 3MUOA 5CXXA 4ZV9A 3EVFA 5HP4A 2EERA 5DEIA 4JLOA 5ENDA 1G38A 2BAGA 4O4LF 4AULA 5ILOA 5HKKD 5L7WA 2MSNA 2JATA 3AIMA 3VO1A 2Z6UA 5J2UA 3VC2A 1BXGB 4PZAA 5TGDA 2ZRMA 5JQGF 2GZDA 1R6BX 1T36B 4INOA 1AGXA 1Q16A 1XL0A 1L5KA 3VR5H 4KLCA 4MYRA 3EGIA 1KORA 4LHWA 5G1OA 3ECAA 3GDFA 2X3UA 1Z2DA 1NW4A 3DEZA 2CFOA 4JFRA 3ZDZB 5C8VA 3FUXA 4ZA2A 2R6HA 3M4YA 2EKLA 3DF9A 2JLQA 4PCLA 2ZJAA 1P33A 2OLJA 2W48A 3Q10A 3ZQUA 4BEBA 3JU3A 1A1SA 5HFAA 1KH3A 1VYUA 3JVEA 2JANA 3K0CC 4H9GA 2HBRA 4Y1GA 5DSTA 1Z9BA 3NONA 4UTXA 4OPMA 5B37A 1XVTA 2RIRA 1ZSYA 1T29A 4HQOA 1M0TA 1PEKE 2PWZA 3B1YA 3NANA 2Q8NA 3FTDA 3EGXB 3JASB 3LH5A 3KV1A 2IJGX 4QL3A 4W5OA 3M1IA 3G8BA 2GK4A 3C1UA 4GM0A 4ZTBA 5ARDA 3EZFA 3TLCA 4B7XA 1I6LA 2JHPA 5BV8A 3GP5A 1MV8A 5HQTA 5FNVF 1JPNA 1SKYB 3CZ9A 3WG9A 4JLVA 4OI4A 3MWFA 5E6RB 4ODIA 2AXEA 5EP2A 1MB0A 2J5KA 2WUDA 3GFTA 1OV6A 5A6VA 1U6KA 1Q11A 2XTMA 3OFKA 2QBYB 3BIFA 3EMKA 3C5EA 4ZYWA 1B7GO 4GYYA 5I7OA 3EZLA 2BDUA 1WEHA 3TQSA 3H8VA 2H2HA 1CRWG 2A84A 2PYZA 3MCWA 1DELA 4GMHA 1Z2NX 5BR7A 4YBRA 2WY2D 3L9WA 4WERA 4BP3A 2K7FA 1A9SA 1CUWA 4CETA 2ZRJA 4ASUA 2Z09A 3P2JA 2J9FB 4BO4A 4HAIA 1XB2A 5BMVF 4XRGA 3JD2A 7ABPA 5I7HA 2C5LA 1GN9A 4JJ6A 3GPCA 4TV8B 4GGPA 1GGEA 2Y9PB 3GGPA 5BRAA 2AC7A 1E3TA 3ONDA 2Y6UA 3UK1A 5AW0A 3SBDA 2F9MA 2C9OA 4YCSA 3K0KA 3H87A 5J59A 1E1NA 1EX6A 2IXAA 4JT9A 3RUEA 2QPTA 4M9QA 3MQ2A 2H18A 4LGVA 2XCQA 3A06A 4YP9A 2P9BA 3ORYA 3WAKA 4ZOBA 1YHZA 3FI9A 3KK0A 3OLWA 3DOJA 3OEED 2GRJA 1ZP6A 4AN4A 1XMSA 1JFRA 4KH1A 3S2EA 5MDHA 2ZJFA 2PL9A 3DVSX 4IDDA 2IBSA 1GNTA 2Z98A 2C2XA 3QV1A 1CX9B 1W4RA 5HCIA 3X43A 5CCBA 4RJKA 4F1WA 1DKOA 2VHYA 3AVUA 2QTAA 3ZDAA 3ETDA 1Y3IA 1KO4A 2JI8A 3PT9A 4KKXB 4AN0A 3MTAA 2Y0EA 4CN9A 3PK0A 3V2GA 4HEJA 2DEUA 1D2AA 1F9EA 3FSJX 4BJ6A 5JI3E 1FDVA 4DCCA 1QHIA 3SU8A 3Q2KA 2VCYA 1BAPA 3LWZA 4TSKA 3DJYA 2A9FA 1SXJD 3CKKA 3KLPX 2FX3A 4K87A 4MVXA 4RLHA 4XTRA 3OLCX 3GMDA 3GPBA 5A7FA 3KU1A 5FX2A 3MJSA 3BQNB 4PXSA 7YASA 1A5TA 1ZDMA 1E5DA 2ALJA 2XTZA 5KAMA 4F06A 3BT7A 3DQPA 2MSWA 4EG5A 1V43A 2E6UX 2HRBA 5EUBA 1NI3A 3R7NA 4E08A 1JI0A 5LBTA 1NJGA 3GZNA 5ADWA 2ADFA 4EIWA 2I55A 3DZFA 4C5AA 3H2HA 4PS0A 2VO1A 2ZE8A 1NVVR 2GHRA 6REQA 1NN3A 5FTNA 1GQQA 4LDNA 1KP2A 2SCUA 2Q1SA 2YRFA 4FEYA 4AKEA 3F2VA 4JSTA 4IVQA 4QOHA 2O0MA 5GWXA 5G3YA 3A37A 1W93A 4LYJA 1N6PA 1UXJA 1N4DA 4M0MA 2Z43A 3PIRA 2Q7OE 4ERNA 4P7KA 4PRLA 1NM5C 3AVQA 3ANNA 4G0YA 4CTNA 3THSA 5INTA 4YAEA 2RHOA 1I24A 1MXFA 5SY6A 2GUWA 2PFKA 3DBRB 3KOYA 2C7VA 2H8KA 5T6MA 1J39A 4KI0A 4TYYA 4G41A 2C92A 1II8A 1Z4LA 1E3WB 4JL8A 3FSGA 1OH6A 4MW5A 4K86A 4M60A 4YJGA 4B3IA 4E3WA 4DA7A 1P1IA 2HY7A 5K51A 4DLKA 2QVZX 2WP0A 6ADHA 1EH5A 1TM3E 1XF1A 4RQTA 5J23A 3G2OA 3ZW7A 3BE4A 2J9GA 3DTVB 5THKA 1GM5A 2Y27A 5EI5A 5BWLA 4DV7B 3OQIA 2GYYA 1E9VA 4MRRA 2WIDA 3OZUA 4M7WA 2CMFA 2EBUA 1VL1A 3DOOA 3ENKA 2KLBA 4X8MA 3PHBE 3RVKA 3BZWA 5JZOA 4BVGA 1TW2A 1CEEA 3ROQA 4Y2JA 4F4IA 3TB4A 2BTEA 2ZWMA 3HKCA 1P6XA 2ISCA 3EASA 1WB4A 3TPCA 4M86A 1PV1A 1KI8A 2C2KA 4A5OA 1QZ3A 2J9YB 5KTPA 4ML3A 5KNDD 1KSJA 4CIXA 3IP7A 4DOMA 2XNDD 5LL6P 3KM0A 5A9SB 2EGGA 1V6SA 2ATCA 3GLQA 1FE8A 5KS2A 2NNLD 4FVTA 3RFXA 2CLHB 3SYNA 3ED1A 5H59A 1XRQA 3WIOA 4WINA 2IPMA 2OXCA 2O05A 2G9NA 1FX0A 4DYHA 3F6PA 4ZYLA 1FUUA 3ICWA 2E6KA 4R1QA 5EUQB 1UCFA 2EZUA 1G42A 2QRJA 5HQ3B 1XMJA 2DH5A 4DDVA 1FJGB 4DMLA 4GPD1 2QD2A 2GEUA 3M82A 1XCGB 1YJBA 2HFKA 3TRDA 2QI9C 4CFZA 3L43A 4GT1A 5JT1A 5G0UA 3COJA 1O6BA 1AQYA 2P2ZA 4EQ6B 1GJRA 4BZQA 5I3ZA 1I0LA 1V6AA 4CPDA 2ONCA 1YDHA 5CFZA 2VHUA 1GVHA 3CA8A 3PDUA 3LGAA 1TMKA 3DZ5B 2PGDA 2QD4A 2YV2A 2CL0X 3IMKA 3R40A 5AM0A 1J1UA 3OTQA 1SG6A