1VKNA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
340
structure length
340
Chain Sequence
HMIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEFDPEKVSKNCDVLFTALPAGASYDLVRELKGVKIIDLGADFRFDDPGVYREWYGKELSGYENIKRVYGLPELHREEIKNAQVVGNPGCYPTSVILALAPALKHNLVDPETILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSLEEIHEAYLEFYKNEPFVHVLPMGIYPSTKWCYGSNHVFIGMQMEERTNTLILMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 113
structure length 340
sequence length 340
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1vknA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vknA01
1ADGA 3NRCA 3ITDA 4YB8A 2WE7A 3OETA 5CPFA 2DLDA 4AG3A 4B4UA 4YACA 4YAEA 3GGOA 4EGFA 5F5NA 1G0NA 3DDNA 2I6TA 1LA2A 1R6DA 1UP4A 2ZKLA 3ASVA 4DQVA 4KUEA 3ONEA 1K6IA 1OI7A 2I67A 3VKUA 2QIOA 5IZCA 3A1NA 4UVHA 5C7LO 2HSDA 4RO0A 4NI5A 5CDYA 3CIFA 1YO6A 5DP2A 1E6WA 4XYLA 1O5IA 1E6UA 4J4TA 3GVHA 2J5KA 2H63A 4PIVA 2PFGA 4HNHA 3E18A 1B2LA 4L74A 5HWSA 2J3JA 3CKYA 1BXKA 4MVJP 2HO5A 1PL7A 3DMYA 4DYDA 3AM4A 4UAGA 1U8XX 4F6CA 1SB8A 3DMTA 4IUYA 3DBRB 4FJ1A 4W7IA 3NGLA 1PZFA 3BXXA 2P68A 3KYCB 2NU9A 1WAMA 2Y1DA 4JP3A 5FF9A 1FDWA 3LT2A 5BSHA 1X7DA 3HHPA 3DZFA 4YVFA 3PIIA 3FNEA 3CMCO 5AXDA 2X22A 1TT7A 2HCTA 2P9GA 3ZH2A 2V65A 4GI2A 3DAGA 5JC1A 1M67A 1PJLA 3C85A 5TT1A 4KWIA 3MJTA 2FZWA 1LNQA 1AXEA 2V6FA 4BNUA 4E32A 1NWHA 3OA0A 1WZIA 1GCUA 2CF6A 3H65A 3WX0A 3QVOA 2QZ9A 2VZ0A 3DFZA 1L1FA 2NVUA 4DA9A 3HDJA 1JLLA 2VT3A 5THKA 3WICA 2WMDA 4B7UA 1X0XA 2WJPA 4WNCA 1ULUA 3WMWA 2NVWA 3K96A 1NVGA 3U4HA 2PKQO 1SCUA 1GDHA 4CODB 3ONFA 4YJDA 1ENYA 4IQ8A 3GK3A 2IODA 1UDCA 3V2UA 2C2XA 4QFDA 1EUCA 4PLCA 2V7PA 5A9TA 2GUGA 4IBOA 1UP7A 1XQ6A 2F1KA 3HG7A 3JQAD 3T7EA 4GGOA 4MO2A 2DPHA 4M49A 4BO8A 4R01A 4U5QA 5KJ1A 1VKNA 1Q7BA 2Y0EA 3RJ9A 4BQPA 3C7DB 4Z0TA 4WCDA 7ADHA 1PR9A 4QSMA 4E5MA 2AW5A 3DZKA 2D1YA 4D3FA 3KZVA 4CMGA 1AE1A 3RCBA 4A26A 3OA2A 2O2YA 1Q7GA 3IKVA 3X2EA 4CLDA 1TEHA 5IG2A 3AUTA 4CMEA 4EUHA 4AICA 4OXYA 3KXDA 3JQAB 4ND4A 3UKOA 1O9BA 4A0SA 4NJMA 2HU2A 5I9MA 3ZNQA 3VZPA 4ALIA 4GWGA 4EITA 3R3SA 3EC7A 4CM9D 5C5IA 1PQUA 4GX0A 1L7EA 1NPDA 5L4LA 4R41A 4Q39A 4D3DA 5BR7A 3O03A 3AM5A 3RWBA 3S8MA 1BRMA 7MDHA 4G65A 1GU7A 2Q1WA 3ZWYA 4AJJA 1UDBA 3ZU5A 1PEDA 1T1SA 4BNLA 3IMFA 1BW9B 2Y67A 4YR9A 3DQPA 5F1KA 3D5TA 3FR8A 3E03A 1ZK1A 2BFOA 4TRMA 3EY4A 5K0ZA 1KEUA 3WLFA 3ZDFA 3H2ZA 3MTGA 3I4CA 3TPCA 1VSVA 1P9LA 3EYWA 1UXKA 5F3RA 1KS9A 2FY8A 1H9AA 1ZFNA 2QX7A 3F4LA 2OFPA 2X1HA 3P7MA 5B4TA 4B79A 2VYNA 1GV0A 4MVJF 4TROA 1YONA 1PGJA 5JNLA 1MFPA 4ZQGA 3K6JA 2VCYA 1U3VA 3GA0A 2VUUA 1K6XA 3GPDG 1ZKMA 4BNKA 2AA3A 1H9BA 3WBBA 4FFNA 1SO8A 2YV2A 3QSGA 2VHVA 1C0IA 4YAJA 2G76A 3DHYA 1PJBA 4II2A 2C82A 3NGXA 2OXIA 1DRWA 5COQA 3GDOA 1V9LA 5IF3A 1ZEJA 4ZU3A 3E9QA 1MV8A 4LSMA 3A06A 4QFCA 4CLRB 4I8XA 2YFQA 4AJ4A 3FTNA 4I5EA 1GZ6A 1I8TA 3IS3A 3ZWAA 3A28A 2OZPA 1Y81A 4L73A 5JLAA 4AJHA 1QP8A 1YKFA 4Z3DA 5K9ZA 1EVJA 1CWUA 2BFMA 4BGIA 4TWRA 1X15A 2AQHA 1BMDA 1E3SA 3WSWA 4KUGA 2IZ1A 3BMOA 5KKAA 3ST7A 3EDMA 2TMGA 2ZB4A 1Q0HA 4Q3BA 3ZHXA 1ZK3A 4B3IA 1XQ1A 2LDBA 1YB5A 4FJ2A 2CFCA 4HFRA 4BNTA 5JDCC 3PWKA 1M6HA 4WK6A 3U9LA 1HF3A 4A5OA 4NIMA 4U8GA 4XCVA 3F46A 1F8GA 4N5NA 2FR1A 1P77A 4OMUA 3VTFA 4MVJG 5JYAA 3WFIA 5JCJA 1BGVA 4J90A 4FPXA 3FN4A 9LDTA 4MKRA 4CM5A 2BGMA 2W8ZA 3JYOA 4B4VA 4R5HA 3TRIA 3E5MA 4IMRA 2Z5LA 3F4BA 3GFGA 2YQ4A 5A5EA 1O8CA 1A27A 3CXRA 3ICPA 1U7HA 1DC4A 3RD5A 4ZRNA 5HA5A 1FMCA 2O3JA 1IZ0A 5HS6A 3VPHA 1PS0A 2DTEA 5EPOA 5DNAA 3GUYA 2Q3EA 1UP6A 3GEDA 1A4UA 3H5AA 3WGTA 2J6IA 3GVPA 4MP8A 1O89A 1TI7A 5CAEA 4HFNA 3ZCXA 4YJHA 3MJVA 3OQ1A 5ER6A 2R2GA 3GAFA 1LDYA 3PDUA 1NQ5A 1E5QA 1N2SA 2OMEA 3EVTA 2C07A 4M87A 4HX5A 4N18A 1KOLA 1SEVA 2XPCA 3S2IA 1EE2A 2HJSA 2D59A 3IDSA 1ONOA 3VVCA 1EDZA 1ADFA 3P2YA 5HS4A 4II3A 2GZ2A 3UW3A 4KTTE 1ML3A 3QVXA 3AUUA 5TX7A 2VZ8A 4BNZA 1C1XB 2UVDA 2IE0A 2OL4A 2EIHA 4YAGA 1I2BA 3WJAA 3D3WA 3WNQA 4CJXA 4FD3A 4TVBA 1NPTO 3N58A 4XYEA 4CM7A 5L53A 4P4LA 4OGWA 1YBMA 3JQEA 1ONPA 1HYGA 3T4XA 1KEWA 1VC2A 4XQ9A 3LT1A 1H94A 1WP4A 4CM8B 4DMMA 2BELA 1Y9AA 4OKNA 4WCFA 3ANNA 2VTDA 4YCAA 4YJFA 2PY6A 2E6UX 4J49A 3QRWA 3GNQA 2C2YA 2RIRA 4XDYA 4EEXA 2Q49A 4IJKA 1U8FO 2VWQA 3C7AA 4J7UA 4J43A 4RV9A 1GL3A 4W6ZA 3FCOA 4GPD1 5I8ZA 4ONEA 3PP8A 4DTIA 2Y1FA 1N5DA 5A5FA 1YJ8A 3QWBA 3E5RA 1GAEO 1IOLA 1QYDA 3JD1A 5DOZA 2J5QA 2C20A 4B4WA 2RAFA 5BSGA 4WUVA 4XR4A 1NR1A 1SMKA 1NBOA 2PA3A 1C0LA 5TT0A 3S55A 2Q1TA 2Y93A 2DC1A 4O63O 3W4KA 4FGWA 1DO8A 2CVQA 2BFAA 1VRWA 2P9EA 5A3JA 3IC5A 4ND3A 1JVBA 1ISGA 1Y9EA 4PLFA 4CQLA 5CG2A 3JSAA 4NJOA 4MINA 1NTOA 5BNIA 2X58A 2GRAA 2JFGA 4E0BA 1E7WA 2VHXA 2BLLA 3DWFA 4BVAA 3JQ7A 4A2CA 2YZ7A 2HRZA 4BGUA 2OP1A 4ID9A 3TSCA 4FS3A 1FDSA 1ENZA 1P0CA 4QO8A 4AJPA 2YFHA 4IXTA 5KTKA 5C37A 2JFHA 3F1KA 4ZQFA 4ZN6A 3OJLA 4DREA 1UZNA 3CSDA 2NM0A 4S1VA 2WE8A 1LDMA 3DEYX 3RIHA 3NKLA 2EWMA 2FPPA 2AEJA 1HDRA 4JX8A 5DULA 4XIJA 5JDIC 3K92A 5T6BA 2NVUB 2OOSA 2Y1CA 3GMSA 3HWRA 4R1UA 2IXAA 1PL8A 4FJ0A 3I9MA 4A27A 4IDBA 4FFOA 1EVIA 1J6UA 4OYRA 2OGUA 1XCBA 2AXQA 3NT5A 1FK8A 1QYVA 2B69A 3BTOA 3PQFA 4HBGA 3LQFA 3PHHA 4LRTB 1RJWA 2AQ8A 5LDGA 4QECA 2C7VA 2O7QA 5HRUA 4YT4A 1Q7CA 3QWFA 2CSUA 2Q4EA 4RVHA 2O3RA 3U49A 3H3FA 1C1DA 2W4QA 5BSEA 3FHLA 3EAGA 1G0OA 2ZTVA 1NQTA 4F3YA 5B4UA 1T2DA 4HNGA 1PWXA 4EEZA 1S6YA 3PLRA 4FC6A 5C7IO 4YRAA 5DDIP 3LF2A 2ZB8A 4M86A 4XR9A 1X7HA 3PVZA 1IE3A 3UCXA 2B35A 3WDSA 3JD4A 1YGYA 3QWHA 3F5QA 1XDWA 4C7JA 3KYBA 3ZWPA 3NAQA 4HKTA 3WQSB 5A02A 1B8VA 1T2CA 4CR7A 1ISMA 4YYZA 2JJYA 2AMFA 1VLLA 3WOHA 2YHIA 4I5FA 3RJ5A 1EMDA 3W6UA 2R00C 2AQIA 4B3HA 4ZJUA 1R16A 1GQYA 1H93A 3MJSA 3CH6A 4RDIA 1WNTA 1M66A 2PD6A 4QUKA 3FBTA 3JQCA 3LT0A 2PLAA 4I9HA 4LN1A 1VKOA 1ZK4A 4RPGA 3I83A 1CIVA 2AHRA 4R1SA 3SJUA 3LYLA 3D3EA 1KY4A 5KOIA 4NFYA 4J91A 3KYDB 4XQCA 1I32A 3W8FA 3BA1A 2X23A 4RPHA 2PK3A 2GASA 3DFUA 1XELA 4FSHA 4PZDA 1KERA 3KVOA 1Y8QA 2VRCD 4I5GA 3AUSA 4RPJA 1EFKA 1DFGA 4D79A 4N5LA 3QW2A 5EERA 3DBLB 3JQ8A 1E1MA 2BFPA 1D7OA 3DBHA 1GYPA 1YOVB 1WLYA 4MP3A 4Y6RA 2J3IA 3W1VA 4AJKA 3VDRA 3PGJA 2GDZA 4KWHA 4U7WA 4GAEA 4FFPA 1G6KA 3MJEA 3H9GA 4NU6A 1T2AA 4UULA 4G81A 1DRUA 3M6IA 4XJSA 1DFIA 3VPFA 2VYVD 3TZKA 3AY7A 3GVCA 5TLSA 1XKQA 4L4SA 5KVCA 2FZEA 1C14A 1E1KA 4TKMA 1NXQA 1LDGA 4DQXA 4FQ8A 3ZV5A 2P2SA 1IYZA 4FW8A 4XEHA 1YH3A 3PRJA 1A72A 3RC7A 1CEQA 3AWDA 4GVLA 4L0QA 5ICSA 4OAQA 1L7DA 4R16A 3PHLA 4RVDA 2YV3A 2ZTMA 1K3TA 5IDQA 1PIWA 1ZEMA 4W82A 5H83A 4PFJA 5K6AC 4XWYA 4CM4B 3COSA 5I7VA 2PNFA 3LC2O 3QHAA 1EBUA 1LQTA 4BNYA 3G1TA 4W99A 4Z9XA 1LRLA 1DIRA 2ZYGA 3LC1O 1I3KA 4J0FA 3IJRA 4ND5A 3N74A 3OICA 5A4DA 1X13A 2Q99A 3D4PA 3FRJA 3TOZA 1E7RA 3LF1A 4LVCA 3CUKA 3RAJA 1SBYA 4Z6KA 3WYBA 2PTGA 3FF4A 1N8KA 3AW9A 5L3ZA 1UDAA 3WGIA 4K28A 1PZEA 3A14A 4YJHB 1IZ9A 3NT2A 1GD1O 3AU9A 4DXHA 5DBFA 2J5RA 1P1HA 4XQGA 1LLCA 1QYWA 1QRRA 2DM6A 3JQDA 4CQMA 5L95A 4HADA 5JXWA 4PVCA 4RPKA 4WOKA 4GLLA 1T24A 3VPXA 3RVDA 4M8SA 1B8UA 4W7HA 4YQZA 3ZWWA 4I08A 1I01A 2EKPA 1IHYA 5CHEA 3GH3A 5K6AA 3JV7A 2HMWA 3KBOA 1MFZA 3EW7A 1LRKA 3LSYA 2H9IA 3ZV4A 4CV1A 1YL6A 3ZU2A 1NASA 4E5NA 2DTDA 4XRRA 5AQ1A 2G82A 4NBTA 4TRNA 3ZWOA 2A92A 3QY9A 1LLUA 2YW9A 1JKJA 3D4NA 1E7SA 3F47A 5T57A 4E4YA 3TF5A 2O48X 1E1LA 2GYYA 3ITKA 1GTMA 2DKNA 2UV8A 4OH1A 1I3LA 1Z7BA 1E7YA 1KY5A 2FR0A 3NTRA 3JQ6A 1PU2A 1JTVA 2XXJA 1PS9A 2BRUA 3H8VA 5TNXA 3V2HA 1D1SA 3AK4A 3H7AA 4RLSA 1ZMOA 4E5YA 3RC2A 3PJGA 1GUZA 5G0TA 1WMBA 4B4OA 3PHIA 4Q3DA 3KEQA 4ND1A 1H6DA 2QG4A 4PLYA 3HB4X 4AJ1A 1B15A 2JD0A 4XB2A 3B70A 3DTYA 4YAKA 3DTTA 3U09A 3QP9A 1YQDA 3VVBA 4XB1A 3ZWMA 2X5OA 1VE9A 2E4AA 4IGFA 4IJUA 3BTSA 2EHDA 4IMPA 5T67A 1R15A 3U0BA 1Y8QB 2LDXA 1LXCA 1CERA 2D4AA 4XJTA 3JYPA 1ZIDA 1LSOA 1P1RA 2EJVA 3AI3A 3C7CB 2ZK7A 4IIVA 1UAGA 3F5SA 4Z3KA 5TRTA 3U4IA 3KYDA 3D0OA 3KO8A 3UCFA 4XZ3A 1ISHA 4OHUA 5T73A 1FXSA 3SC6A 5BQFA 1EK5A 2DU8A 1H2HA 2V6GA 3H6KA 4LCEA 1P1JA 2X0NA 4M89A 4DBZA 1GUFA 2EF1A 2I3GA 1FDVA 2O4CA 3UUWA 4R69A 2I66A 5ES3A 3SBOA 1OC2A 3OFSA 3G17A 1H6CA 3ANLA 5CPBA 3WTBA 1PR3A 4Z9FA 1YL5A 3DC2A 3KSZO 5JYFA 1QMGA 1R4NB 4D45A 4LRSB 1PTJA 1R0KA 4J0EA 6LDHA 1HLPA 1U9JA 1ZXLA 3EHEA 4D42A 1E3WB 3ZV3A 3DZJA 4JBGA 3ANMA 1VJ0A 4I9NA 3U4DA 1NR7A 1HT0A 1UAYA 4GGPA 1QV6A 3D1LA 4BHTA 3FNGA 3V5NA 2Y05A 4BNXA 3C8MA 2CY0A 4IS3A 3INGA 3JQBA 2GO1A 4RDHA 2ZIZA 3TOXA 1A5ZA 1LI4A 5TC4A 4YT5A 2ZJ0A 4WGGA 4CL3A 4EUFA 1B8PA 2H6EA 3EMKA 3S2FA 4YRBA 3BAZA 2WD8A 3GQVA 1TLTA 1C1XA 3L9XA 4B7XA 3Q11A 1FDTA 2VNAA 4CR6A 3WGQA 1RYDA 2A9FA 2HMTA 4WE3A 1BXGA 1IHXA 4CV2A 4O59O 4Q3AA 3GVXA 4Y6SA 4YJGB 3ZHBA 4BO6A 2G17A 1HWYA 4TVOA 3JQGA 2ZYAA 3CINA 1O95A 1DIHA 1EEHA 5L7YA 2PZKA 5JMWA 2FWMX 4DBVO 4FFLA 4XA8A 4YPOA 1T2FA 5JDIA 1YJQA 1MXFA 3E9NA 1T25A 4ZICA 2JD2A 4NBWA 3GZNB 3U5TA 2PR2A 5TGDA 4NBVA 2EW2A 5IDYA 3TL2A 4AJ2A 1R37A 2PGLA 2CD9A 3JD0A 3T7CA 2FSSA 3ON5A 1LRJA 2D5AA 4MVJH 1I2ZA 2ZB3A 4DUPA 1EK6A 1MP0A 4J9VA 4ROSA 3H9JA 5LC1A 1ZNQO 4NR0A 2EGGA 4AJIA 1SB9A 1YBVA 4J1QA 5I7EA 1X7GA 3B1KA 1R4MA 3GAZA 1N92A 1A7KA 3OJEA 4Q3NA 1XLTA 1ENPA 3KETA 4Q3EA 3PQEA 3C24A 3BMCB 2DUUA 3QE3A 1U2GA 3WGGA 1EE9A 2EP7A 4CM1A 3K31A 2D0IA 1K6JA 4OOFA 4XDZA 1SZJG 3JQGB 3PQDA 4BS9A 4E33A 4BO3A 2HK9A 2JHFA 4Q3CA 2O50A 3DR3A 4IM7A 4Z0PA 1PJTA 4RORA 4CMJA 1HSZA 4FCCA 2BMAA 1LTHR 4R1NA 4DC0A 5A3VA 1I33A 5CEJA 4BNMA 1DJNA 3K5PA 2FN7A 3PEFA 1R12A 3QA9A 3UGKA 3JQBC 4HFJA 4DLLA 2HJRA 1MC4A 1Z7EA 3CMMA 4FFRA 4JCOA 3ZNOA 4HP8A 4AJLA 3GC6A 1NX6A 3H9QA 4TRJA 4RQTA 2VN8A 4WASA 3JD2A 2VYND 1XIVA 3E1KA 4J7CA 3E6AA 1ADCA 4BKOA 2VHYA 4GSKA 3I9OA 1CYDA 5B4VA 2GSDA 1M75A 1GEEA 1QLHA 5GZ1A 3W4IA 4R68A 4OQYA 3UFXA 4BMSA 4P8RA 1E3JA 4UUOA 3ROMA 3UN1A 3SJ7A 2HQ1A 3HDYA 1P0FA 1H0KA 1LQUA 3ZZNA 4PN3A 2BI7A 5A1TA 1D3AA 5IXSA 4CV3A 3GDGA 3VC7A 1P1FA 1XG5A 5GZ3A 1ID1A 3IJPA 3O26A 2GD1O 4NMHA 3ZWXA 1T1RA 1BWSA 2GCGA 4LCJA 4BNFA 1LDNA 4XGKA 4HWKA 1DC3A 1WPQA 4RF2A 3MZ0A 2X5JO 1GYRA 1VL0A 3OHSX 2PH5A 5COAA 2CNBA 1KC1A 4BV9A 4BNNA 4LMRA 4GL4A 4U0JA 1Z6ZA 3VTZA 4R3WA 3DZGA 2DQ4A 2V6MA 3CTMA 3WTCA 3RQSA 2YY7A 4BB5A 2AE2A 3L6DA 4OKIA 5IFLA 2RH8A 3RC9A 3TFOA 3KM0A 3WGYA 1ZSYA 4A03A 4DPMA 1AHHA 1LU9A 1GADO 4BNJA 3I52A 2P9CA 1I0ZA 2WYUA 5B12A 2NACA 4EI2A 4DWVA 4EW6A 4MVJI 5FYDA 4D41A 2H1SA 1PJ3A 1ZUD1 2PD4A 3GRPA 3R3JA 1H6AA 1F17A 9LDBA 5EMHA 1NQAO 2A4KA 3VH1A 2WM3A 4F45A 4UEKA 3DMTC 3PWSA 2J3KA 5DT9A 3BTUA 4BO2A 1NFFA 4DQUA 4F46A 4D46A 4NFHA 4QT0A 3DOOA 1MLDA 3TFQA 1F12A 3TWOA 4KOAA 1BXGB 1V3VA 5EL0A 2NWQA 3P5SA 4IGEA 4CMIB 3LLVA 4GWKA 3WLEA 1ONNA 3NYWA 5IZ4A 2ZB7A 1EZ4A 4CM3A 5A9SA 3V2GA 1ISIA 1LX6A 4BO1A 4CM4A 1O6ZA 3L0DA 1JQBA 5JYDA 3GLQA 4IZIA 2EEZA 3G1UA 1JA9A 1DHTA 3BYZA 3U62A 3ZN2A 2RCYA 5TSDA 1MG5A 4J7XA 2R00A 2Q2VA 1PJQA 5THQA 1PL6A 3BMCA 5DBIA 4YJFB 4ND2A 4URFA 3ABIA 5AOVA 3INTA 5L45A 4R54A 5CDSA 4HFMA 1N1GA 2J8ZA 3ETGA 4FC7A 4FB5A 1OBFO 3QJ5A 4J2OA 3Q9NA 5DZSA 1KEPA 3GGGA 4KTVE 1F8FA 2DT5A 4YXFA 2B4RO 3IUSA 4XIYA 4GLOA 2Q46A 2A94A 1FJHA 3JYNA 2W98A 3UOGA 2DUWA 5JC8A 1N1EA 1ZO8A 2Z1NA 4PLVA 4N5MA 2WEKA 1ZSNA 5F1OA 1ZXBA 4PLTA 2VOEA 5KJFA 1EVYA 2VRBA 4Y9DA 3HN7A 3QQPA 1A4IA 1KIFA 1DSSG 2GN8A 4BGEA 3IAHA 5A9RA 1QG6A 2O3QA 1GPJA 3MCVA 4UUNA 4H16A 2AQKA 4GMGA 3HFGA 3L77A 2IDZA 3LDHA 3OF2A 1PQPA 1J5PA 1E3WA 3AUAA 3BHJA 5ENVA 3PPIA 1MB4A 2C29D 2BF7A 2OBNA 1HE3A 3RUIA 1VJ1A 3DONA 1E0DA 1HL3A 1SOWA 2X86A 5IN5A 3H2SA 1ZBQA 3RUAA 3RBZA 2V6BA 2QRLA 2O3TA 4JGBA 1CQIA 3VKVA 2CMDA 4WLFA 4KUHA 3NTQA 1JVSA 5AYVA 4RJTA 1BVRA 4RQUA 4XGIA 2AG5A 5JAMA 3DOCA 1F06A 2GF2A 4NK5A 4FGSA 3EZYA 4Q9NA 2I9PA 3RKRA 2IZ0A 1JKIA 1I2CA 3FR7A 2Y1GA 3C3XA 2E82A 2CDAA 3L6OO 2BD0A 4E21A 2VZ9A 2FOIA 5TS3A 1K5HA 2WDZA 3TZ6A 4J3FA 1U5AA 1E1NA 2DFVA 5L9AA 2FP4A 5TF4A 3GN1A 4ZVVA 3OEWA 2ZTUA 1Z82A 4IDGA 1DB3A 3GEMA 4DMLA 1AN9A 4FN4A 2VT2A 5J9GA 3S1LA 5ITVA 1YBAA 4XYMA 1RM3A 3GHYA 3WWZA 2X8LA 3WNVA 4P4NA 2GN4A 2X0JA 1QYXA 2BGKA 1UH5A 3WB9A 5G0UA 3KUXA 1TT5A 4OSPA 2X9VA 5GZ6A 2ZTLA 1D1TA 4QQRA 3PJEA 4WCFC 3OBBA 5T8KA 4B8ZA 2P4QA 3JQ9C 1J4AA 1LSSA 4AL4A 4N54A 3QV1A 5I7FA 2C7GA 4PLGA 4O6VA 4IJVA 3ZU3A 3RROA 3W8DA 2ET6A 3OJOA 1P44A 1H5QA 1BDMA 3W8EA 4BO0A 1SPXA 2B83A 3GY0A 4W4TA 4ALJA 5FFFA 3LLSA 3TZCA 4CMBA 3O38A 4E30A 2NTVA 1BTOA 1U5CA 3JQ7B 2HKIA 2YHUA 3IIEA 3PLNA 4FOSA 3PFFA 1HDGO 4R51A 3ZW8A 4DGSA 4MVJE 2YUTA 5JBIA 4WEOA 4IDAA 5JE8A 4L75A 3SEFA 5JY6A 3GRKA 1Z45A 4L9RA 2IXBA 4MIOA 2IYOA 5T64A 5BNTA 4D3SA 4RZIA 2C0CA 4J1SA 5AVOA 2X0RA 5C3MA 2WD7B 4FDAA 5ER9A 3VDQA 3U3XA 1VPDA 3DO5A 4D7AA 1IB6A 1R4MB 3CZRA 3AOGA 5JCJD 4Y98A 3IL2A 2F00A 2VNSA 2VUSA 4EUEA 3AOEA 5JS6A 5TJ9A 2HUNA 4B3JA 4CV0A 3WJ7A 3M2PA 3NJ8A 3EVNA 1W4ZA 4R9RA 4EZBA 1AHIA 2O4UX 4RL6A 4XD2A 4E2ZA 1C0KA 1E7QA 2UUPA 1I36A 3PWZA 1NNUA 3W4JA 4ITUA 1NAHA 2OORA 1M6WA 3NDIA 1NHGA 2PZLA 2ZYDA 3G3EA 3GFBA 3U4CA 1EFLA 4YA6A 2HDHA 5IDXA 3OQBA 4RPLA 5G0VA 3UH1A 3VH2A 5KWEA 2DBZA 4WLUA 4ZA2A 1NVMB 3VZQA 3WSVA 3DBVO 4K6CA 2G1UA 1I5RA 4U6QA 3RI3A 4CUZA 2XOXA 4JIGA 3VZSA 4RCVA 3ZNNA 3IP3A 1WDLA 5JO9A 1PGPA 1ZSVA 3JQAA 4NFSA 4RVUA 5JSFA 3I9NA 3SXPA 1U3TA 3GNTA 1B3RA 1SAYA 3JYLA 5EQDA 1O0SA 3D64A 3RUDA 4JJIA 1UR5A 1DIBA 3UAGA 4MVJD 4TRRA 3RC1A 4BKPA 3DB2A 2VUTA 1QKIA 4AFNA 3BZUA 4KQWA 3UXYA 4R4JA 3RFVA 2I65A 3F9IA 4O0LA 1NPYA 1KC3A 3ENKA 2Y66A 5FEUA 3H5RA 3KV3O 3AI2A 4PRKA 3EUWA 5F21A 3G0OA 5AXBA 1NM5A 5G2OA 3LVFO 1X1TA 1TT5B 3MJCA 2ZCUA 4RGBA 3GZ4A 1KBZA 1P3DA 3AY3A 4H3VA 3SLGA 4Z9YA 2NVBA 3SLKA 3F1LA 3TL3A 3R6DA 1T2EA 1K89A 4DPKA 1XGKA 2DFDA 2WSBA 4DRYA 4YT2A 3N7UA 5L4SA 4K6FA 2B5VA 2EG9A 2B37A 3WXBA 2Z95A 2OO5A 3K2BA 1UJMA 5COBA 4R3NA 1EBFA 2IZZA 2PV7A 3NT4A 3PFWO 4CLOA 5CDUA 3H3JA 1LEHA 3VOSA 1LDBA 4BB6A 5DOVA 5KVVA 2QYSA 3VHRA 3ASUA 2RHRA 2QW8A 3PXXA 1UXHA 3G79A 1N7GA 3C1TA 1C0PA 3HDQA 3QVTA 4GKVA 3OQ6A 3IQDB 3W6ZA 4J6FA 1ZCJA 4BKUA 3KLMX 2P4HX 2YHIB 4CL8A 1NYTA 4R9SA 3E48A 6ADHA 1TVEA 4OOEA 4JBHA 2JAHA 4LW8A 3TZHA 1DHRA 4J16A 1I10A 3BHMA 3I6QA 3S2EA 4NU5A 4KQXA 1QYCA 2Y0CA 5U4QA 3I9JA 1ISFA 1E7MA 1HRDA 4QEDA 3WGOA 1UZMA 1U2DA 2WWRA 3WR5A 5KKCA 3F3SA 3K9QO 2Q4BA 1D4FA 3HADA 1HXHA 1CRWG 1UXJA 2OUIA 3KLPX 5DF1A 1BHSA 2X4GA 1F14A 4I9UA 5L4NA 5I9LA 1NAIA 3BHIA 1U3WA 1GCOA 2R6JA 3LT4A 2EV9A 5M6DA 1WWKA 3DZIA 4E5KA 1U1IA 3ULKA 2WYWA 4E3ZA 2IRWA 1YVEI 5BSFA 4DLBA 2WYVA 3UF0A 3ZNPA 5IN4A 4C4OA 2FPIA 4GX5A 2DBRA 1R0LA 4ALNA 1E3IA 4XKJA 1ORRA 2QHXA 1HDZA 4YAIA 5EQFA 4O1MA 2JAPA 3DZHA 3ZI0A 5ILGA 1PQWA 2PWZA 5JAZA 2QYTA 4J4HA 4MOWA 2POQX 4MKXA 1PWZA 4PZCA 4WLNA 2ZATA 2QRKA 4IZHA 5AXCA 3VPSA 3HSKA 3INRA 1XWFA 3KOUA 2ZQYA 1TA4A 5KJCA 1UXGA 4WOJA 3D5QA 4CMEC 3RUHA 2EKQA 3L4BA 4UVEA 3H5NA 4BNHA 4CM6A 1TB4A 3BMOB 1I24A 3AI1A 2A35A 4GX1A 1ZJYA 1OFGA 2Y1OA 2J3HA 4B7CA 4BV8A 5JMPA 1CQJA 3NUGA 4IINA 3BMNB 1CJCA 3WMXA 4A10A 2Q22A 3RUCA 3L07A 3OEYA 2E48A 2PKQP 2NQ8A 4RVFA 4IQ0A 4ESOA 2JCXA 4BUCA 4YJGA 1MX3A 3FTPA 1B7GO 2NQTA 4NJMB 3B1FA 4KMSA 4BO5A 1N7HA 4NBRA 3PGXA 2TMDA 5A06A 2NNLD 3I3OA 2ZJ1A 4E2XA 3RBVA 2OHXA 3PJDA 4CMIA 3HDHA 3O8QA 3WQQA 3DBLA 3WYEA 4PCVA 3KSUA 1P45A 3DAFA 1SOVA 2CVOA 1HDXA 2Y68A 4UREA 4HY3A 1MG0A 4BOYA 1HZJA 3BMQA 3RSHA 3SX2A 1I3NA 1DXYA 4XGNA 1QR6A 2EP5A 2X7HA 1PZHA 2BKAA 1ZH8A 2H5LA 1B26A 3D7LA 3WS7A 3JYQA 2D2IA 5EESA 3GNSA 4E31A 1HETA 2NU7A 1W8DA 4LSWA 4IDCA 1FF9A 3KEOA 1P1KA 5CEEA 4YWJA 4EBFA 3ZW9A 1KVTA 1MA0A 3MOIA 1Y5MA 2UDPA 2VWGA 1C1DB 4L4RA 3WWYA 4XRGA 1BW9A 4GQAA 4TSKA 5FI5A 5ITWA 1HZZA 1AUPA 1V3TA 1LJ8A 1YS4A 3B20A 2PZMA 5JYEA 1YRLA 5J23A 3GMDA 4U0KA 5KJEA 3OMLA 4FBGA 4J9UE 2EERA 3WQRA 4IY1A 4I1IA 1LLDA 3JCZA 2Q50A 3AY6A 2NV6A 3L9WA 1PJ2A 1NVTA 1Y7TA 5FWNA 1BDBA 1YDEA 2O7SA 4DL9A 5CFZA 3PDJA 3OIDA 2DAPA 3X2FA 5ICMA 1LLQA 3ZHZA 1WVGA 1A9YA 3NX4A 1VSUA 3C1AA 3NV9A 5KCZA 1DIGA 1Y8RA 5JDCA 4ZD6A 1KYQA 3ICCA 4I5DA 2OBYA 3ROQA 4ZGWA 1T4BA 5U9CA 1ISJA 3L4SO 1Q1NA 1Y8RB 3KHUA 4KZPA 2D3TA 1V0JA 3RUEA 4H7PA 3HFSA 3TQHA 3E9MA 4ZHSA 3AJRA 3OP4A 3OH8A 4M55A 2NLOA 1JWBB 2XF8A 4MVJA 4CQMB 4YTEA 4UVIA 5TIIA 3KSDO 3SC4A 3IP1A 4BQRA 5KNLA 4BIIA 5DP1A 2XXBA 4R5MA 3MTJA 4L8VA 2EJWA 2EGHA 3DL2A 5T8KC 1IUKA 3MEQA 1HDCA 4AJEA 4MJLA 5AXAA 3O4RA 5LCXA 2YDXA 4K1LA 4FOOA 3AFMA 2I99A 2ZCVA 3ZV6A 3M1LA 1GZ3A 3MWEB 1D8AA 1KVQA 1U7TA 2I3AA 1E6EA 1QSGA 1S7CA 3KB6A 4CMKA 5DCYA 4GX2A 4L4XA 2HMSA 1GPDG 3FPCA 4GH5A 1SNYA 3ADOA 1PJ4A 4JLWA 4WLVA 1ENOA 4CQMD 4UEJA 3B1JA 5I7SA 4WJZA 1RM4A 1KVUA 2DTXA 2E49A 2PGDA 2W90A 1OOEA 4MPDA 2B5WA 4J1NA 4GVXA 2IEDA 4IPTA 4MIEA 3FWZA 2RH4A 2GR9A 4B8WA 4YEDA 4WECA 2VYVA 1JDJA 1DC5A 8ADHA 4F6LA 2EXXA 4PLPA 2NTNA 4WLOA 2BH9A 3QWIA 4ALMA 4NQZA 4DYVA 5MDHA 3WYCA 4NG5A 2GN9A 2PZJA 4UEOA 2C5AA 1QORA 1HE2A 3P19A 1CF2O 3TNLA 1DRVA 1DJQA 3K30A 4EYEA 1X14A 5IXYA 1PX0A 1T4DA 1KVRA 1E92A 5H82A 4M54A 3NTOA 2VHZA 1O94A 3SVTA 2C59A 2BGLA 1K0UA 1X0VA 3QLJA 5JO0A 1AXGA 1XYGA 1ZVMA 3FNHA 3GN2A 4E13A 1VI2A 5G0SA 2VRCA 2GPTA 2B36A 2FPGA 3FPLA 1IPEA 4PLWA 3M2TA 1DPGA 1DAPA 1HLDA 3LK7A 3DXFA 5I9NA 3FI9A 4S3MA 5CP8A 2I5PO 3I5MA 3I6IA 1ZK2A 2GZ3A 5IJZA 2Z1MA 4IDFA 4YBZA 1N9GA 4CM8A 3HNPA 1JAYA 4PG4A 4LVUA 1MC5A 3GF4A 1C3VA 5IZCC 3LC7O 4ALKA 3HE3A 1A7AA 3KTDA 3D4OA 3TJRA 1ZK0A 4WPGA 1YXMA 3H4VA 2NSDA 2HMUA 4OM8A 1GV1A 2W2KB 3OJ0A 1PS8A 2Y1EA 3ZWCA 3PI7A 4GMFA 4XYBA 1ULSA 3RUFA 2PKRA 3I9KA 2W2KA 4YQYA 1JWAB 4DVJA 3OSUA 3A4VA 3HN2A 1WDKA 1DEHA 5HM8A 3GVIA 2Q45A 1M2WA 1BVUA 1WDMA 5A05A 2YV1A 2JCYA 4FIZA 3IKTA 1RM0A 5I8WA 1VM6A 5DCUA 3NEPX 4RF4A 3S2GA 3BMNA 4P22A 3KRTA 3UCEA 1PGNA 3IUPA 5JFOA 2OP0A 1NQOA 3GOHA 3GG2A 4QXMA 1A9ZA 1UXIA 4JNKA 2SCUA 1GR0A 4HV4A 3F6YA 3ZWVA 5U1PA 5L51A 1VL8A 3ADPA 2E37A 4JJGA 3GGPA 3OM9A 1ADBA 1BG6A 1B0AA 3TZQA 4CMCA 4BNWA 1JU9A 2HK7A 1U4OA 1GYQA 1I30A 4INAA 3C1OA 4EJ6A 1PGQA 3MWDB 3OECA 2CUKA 5JY1A 2DBVO 4J4BA 1YL7A 4IIUA 5JAIA 3I9LA 1XSEA 3UHAA 4PG8A 1HE5A 1HKUA 1PGOA 2B0JA 3QVSA 4AVYA 3R0IA 3TDKA 4RVGA 5A03A 3EK2A 4TZKA 3WFJA 1Q0QA 2B4TO 2Q1UA 4N7RA 3ETDA 2Y0DA 4H15A 4PRLA 5ILOA 4E12A 3MJ4A 5CDTA 1PZGA 1P33A 3Q6IA 4FFMA 4KDFA 8LDHA 2FRDA 2Q1SA 1XA0A 3PHGA 1M76A 1HDOA 2X5KO 1LUAA 5F5LA 5JCXA 1PJSA 3JTMA 4CUJA 5DCWA 3EZLA 4XX0A 4K9DA 4JP2A 4IXWA 2GERA 2AEFA 4MKZA 2BI8A 4RF3A 2Y99A 2D5CA 1EUZA 4OQZA 1NFRA 3PZRA 1AGNA 4OSOA 1J0XO 1IULA 3VPGA 3JQFA 4OO3A 3NDJA 2VOJA 1ZJZA 2D8AA 4UUPA 4TZTA 4X54A 2NADA 4CLXA 4JN6B 3ETEA 4DPLA 4WLEA 4EJMA 3PYXA 2Q2WA 3VZRA 1DIAA 3QVWA 2HAEA 3GG9A 1R0SA 3GDFA 5CEFA 1KETA 3I4FA 4EDFA 3H9EO 1Y1PA 1DOHA 1TXGA 4CMHA 4LMPA 5C7OO 3EGOA 1DAOA 4M1QA 4A7PA 1FDUA 1XU9A 1CDOA 4K26A 2JFFA 1EVZA 2CDBA 4CR8A 1I3MA 5KJ6A 1P1IA 2HMVA 2O3SA 2VWPA 1F0YA 1WZEA 2W2LA 1YE3A 4NNJA 2VHWA 3Q0EA 2DVMA 4O5OA 3HB5X 1PJCA 2EW8A 1MGOA 4DIFA 1JAXA 4D44A 1DLIA 1HYHA 1YQXA 4OIMA 1J49A 1GQQA 4FR5A 3ZHYA 3FD8A 1IY8A 4Y6PA 3OIFA 1Y6JA 1LC0A 2RBEA 4TKLA 3AU8A 1SC6A 3WGHA 4G5HA 5EINA 1XHLA 1DBVO 1XU7A 2GNAA 1NHWA 1GUYA 1JKFA 4NDNE 4P4GA 4G2NA 4PG6A 2EKLA 1YWGO 1WMAA 4BO7A 1XR3A 3KYCA 4OXNA 4BKQA 4U6SA 5JAQA 4AJOA 2QQ5A 5ADHA 3ZWNA 4D0SA 1HE4A 4JK3A 3WIEA 1QXSA 1NFQA 3K73O 1JN0A 4W9NC 2HLPA 4NZ9A 3HJAA 2I76A 3HZZA 3PYMA 4AJNA 3PHJA 3LZ6A 1GEGA 3L6EA 3RU7A 4E6PA 2UUOA 2RHCA 1OMOA 4IDDA 4YRDA 1P31A 1U3UA 2VQ3A 5G0WA 3AFNA 5TJHA 4MDHA 4NHEA 3UICA 4PVDA 4ILKA 5LDHA 2GGSA 2G0TA 1QV7A 3VH4A 3Q9UA 1IL0A 4E2WA 1W0CA 2C54A 1KEVA 4WKGA 2JKVA 4UUMA 4KDEA 4GKBA 3IOYA 2JCVA 4BL5A 4R1TA 1W6UA 2NUAA 1RYEA 2AE1A 2NTJA 3QIVA 3FNFA 4IJWA 1W73A 3RKUA 4DC1A 3HQ4O 3DHNA 4GSLA 4XQEA 3UVEA 4BNGA 3E82A 2FR8A 2FMUA 4MIYA 3OIGA 4WNIA 2AEMA 3CE6A 4QO7A 2VWHA 5TQVA 5A9SB 3D3WB 3LU1A 5HTOA 1PSDA 5G4LA 5JW6A 4NPCA 2GLXA 3AOEC 3RFXA 4LISA 2IEBA 3ROKA 3JQ8B 4CPDA 3DBHB 4BKRA 1SEPA 3V1UA 4DIBA 1HSOA 2P5YA 1LC3A 5H81A 3B6ZA 3FSRA 2WD7A 5GMOA 1R4NA 4CLHA 3WGZA 1Z75A 1QLJA 2FSVA 3CZMA 3GPIA 4MVJM 4ZQEA 4MP6A 4JBIA 2X6TA 5A04A 1YDWA 4NH4A 4TQGA 5KIAA 4BNIA 3VAZA 4J2HA 4ZQHA 3ONDA 2GZ1A 2CF5A 4BMVA 2PGJA 3GHHA 1EQ2A 5ENDA 5B1YA 2W2LD 3O8QB 2YYYA 5HBRA 3Q2KA 4LK3A 1RKXA 4UVDA 4Y8VA 4D0RA 4RVSA 3GUCA 4TMFA 1UUFA 1MUUA 3PIDA 3RBXA 1R66A 3FBGA 1YB1A 2CVZA 1LDEA 2PD3A 2CZCA 3E8XA 4E2YA 2ZQZA 3ENNA 4KP7A 1E3EA 3GT0A 1V8BA 1B16A 1VL6A 4NBUA 5KVSA 4PG5A 1HDYA 3JQ9A 1GFSA 2X9NA 5FI3A 3O9ZA 1KVSA 3DHEA 3GR6A 1WXDA 5F1PA 5BNFA 4Z0HO 1IPFA 1ZZEA 3PYLA 2JD1A 3AM3A 2O2SA 3H9UA 4RLHA 3WIDA 5CG1A 5L40A 3L4BC 4JXKA 4CLEA 2DBQA 5MGBA 1Z74A 4CLRA 3CPSA 2P91A 3ROPA 5KVQA 3G49A 5T5QA 3NDRA 4PLHA 2CDCA 3RU9A 1U4SA 4Y67A 3RFTA 4CUKA 3I23A 1GZ4A 1V6AA 4DIOA 1JW9B 3V1TC 4WEQA 3JD3A 3GEGA 1K2WA 3BIOA 3ORFA 4D43A 5B37A 1B14A 4LGVA 3V1YA 1E5LA 2VTEA 3RASA 1WW8A 2AG8A 5DBGA 1XEAA 1G1AA 1OAAA 4HUJA 1HEUA 3QWAA 4OXKA 4YT8A 2GN6A 1GY8A 2UYYA 1GQ2A 3OJFA 5CDGA 2BHLA 2O23A 3JQFC 2DPGA 2PH3A 2XAAA 1ZW1A 4YDRA 1RM5A 1OC4A 2Q2QA 5DN9A 1ARZA 1B3BA 3FWNA 1A71A 1E77A 5EJ2A 1Q2XA 4BNVA 4RF5A 3M1AA 4A73A 3I1JA 2QZZA 3Q1LA 1E3LA 1NWCA 1X1EA 2FHSA 2ILTA 2X0IA 1BSVA 2JL1A 5L7TA 3PTZA 1DC6A 2HRBA 3DBRA 4L76A 4XYGA 4PG7A 3PZBA 3MOGA 1YOVA 3DOJA 4RZHA 5L7WA 4NK4A 4JROA 5JPIA 3ZWBA 4OJNA 4E5PA 1EDOA 4GBJA 4JQCA 1EUDA 2NU6A 2QRJA 4ZRMA 5EIOA 4BMNA 1LBEA 1H6BA 4CQLB 1YQGA 3BMQB 1Q0LA 4ZQBA 3NJ4A 1DLJA 2B4QA 4HXYA 3PK0A 1NP3A 4IS2A 5EN4A 2NU8A 1LSJA 3HUDA 4EJ0A 4QX6A 4DLAA 3CEAA 4IQGA 4W9NA 3R1IA 4UVGA 1ZMTA 5G4KB 1OZAA 4ALLA 3P2OA 1RWBA 2X9GA 4BO4A 4CM9A 4CLOB 3DAPA 5G4KA 1YB4A 5GY7A 2WTBA 2YQ5A 3ZU4A 1V3UA 2O3UA 1HTBA 5IAAA 1VJTA 1LSUA 3Q2IA 1RPNA 3PJFA 5BT9A 2UAGA 3Q3CA 3WBFA 4PLZA 4P38A 3TN7A 1DDOA 3ZGYA 3A9WA 4CMAA 2P5UA 1Z73A 3K2EA 1HYEA 1MXHA 4IDEA 1CETA 4BGVA 1Y5RA 2JHGA 4J1TA 4QTZA 1N9GB 4BO9A 3GZNA 3K8ZA 3V8BA 5IDWA 3T4EA 4WCFB 1U28A 3VH3A 4JJFA 1T26A 3DZBA 2G5CA 3BTVA 2C5EA 4PZEA 3STHA 4PGFA 1DFHA 1V35A 1BXZA 2YJZA 2HK8A 1UZLA 3WG9A 2IYPA 1P74A 2YDYA 4C7KA 4OL9A 1H2BA 1EQUA
chains in the Genus database with same CATH superfamily
1ADGA 2OV3A 3MS2A 4YB8A 4QQFA 3NP7A 1EX9A 2DLDA 2OXEA 4B4UA 5HZGA 1RWPA 2WB2A 4K9SA 1WXQA 1G0NA 2Z2YA 1FUUA 1QAOA 2ZQ5A 3SZLA 1XD2A 1YB6A 3EIEA 1ZGHA 3ONEA 5H3HA 3VKUA 3UA3A 1U8AA 3RVJA 3A1NA 5ITZB 1JA1A 1OZFA 4UNRA 1Q20A 2NO7A 2FMFA 1SWVA 3CIFA 3GB9A 3IUQA 2XVZA 1D1PA 2UYCA 1O5IA 1E6UA 2WJYA 2FW6A 3H1TA 4J4TA 4M0UA 4EHDA 3D54D 4D3ZA 4PIVA 4B6RA 3BDIA 3E18A 1I94B 4L74A 5ELMA 1H4QA 4S24A 3H17A 5JH7F 2J3JA 3FM9A 3H42B 4ENPA 4FNMA 5JEEA 1FY2A 2WZBA 3JXEA 1PL7A 2RKOA 5EI5A 5GM2A 1MU0A 4DDUA 4AWBA 1U8XX 3H5WA 1AKYA 3FYUC 2BCEA 5CLHA 4BNDB 1Y8CA 2OO3A 2QJOA 4RNDB 3JWIA 4W7IA 1U7DA 4H6XA 3UWOA 1P9WA 3F90A 1ST3A 1VLMA 4OGFA 4BEJA 5KTSA 4KQKA 2NQ2C 3VQTA 3LG2A 5FF9A 1BWQA 1KFBB 2DQSA 2ZT7A 4YMLA 4P31A 5A3RA 4LE1A 3PIIA 1JFFA 3CMCO 2IVZA 2HU7A 3DULA 3TUJC 2HCTA 3LPCA 4JBNA 4ZCPA 3SC3A 4M88A 3G8AA 1EZZA 1OVGA 4UU7A 4B34A 4CFSA 3NC1C 3D4LA 2QB5A 4FMCF 1QANA 1PJLA 4J0CA 5TT1A 5DJ5A 3WGKA 4LHEA 1DKLA 1XCGB 2DWQA 2FZWA 3MJTA 4OLHA 4PC2A 1LB1B 5EMMA 3SJZA 3V9PA 3WBKA 4EY8A 1AHNA 2D0PB 3ESCA 1WZIA 2EW1A 2A9OA 3AIKA 2HWUA 3H65A 4RM3A 5GWXA 2IHYA 4LNAA 2B2XA 1QPGA 2FWBA 3FGOA 4AY5A 3BEOA 4G1MB 2GJSA 1SXIA 3NI2A 4ITRC 1RXYA 1D4ZA 2WMDA 5HIMA 5BOSA 3W6OA 2XI4A 3UAZA 2AG0A 1L7QA 3KV1A 4RPIA 5JCPA 1UOOA 3K96A 1FZQA 3PD0A 4Z5XA 1NX9A 3FDZB 3FHTA 1U7ZA 2P6NA 1S02A 1MAAA 3IEXA 3ONFA 2C83A 4YJDA 5AOCA 4IRMA 4JB8A 4GDFA 1IQUA 4J76A 3GK3A 2WMOB 4P53A 4OI1A 1CVLA 2R1UA 4ZHQA 3V2UA 1QWOA 4EVRA 2WT8A 3EEOA 5C8DA 4PLCA 4NV1A 5A9TA 4OYLA 2FLVA 4K9RA 1UP7A 2XDWA 2HHHB 2R1TB 3CCBA 4MYCA 4GGOA 4XUEA 4MO2A 4WT7A 4BO8A 1XJWA 1U2TA 2LIVA 4J0HA 1GDDA 2C2WA 2OCKA 2CV2A 1ORHA 3DP9A 3JX9A 1Q7BA 4NBNA 3LOPA 2Y0EA 3VZDA 3QVGB 4Z0TA 3UMVA 3P0FA 2WIGA 2DYKA 2ZLBA 4DRXA 3TCNA 1X94A 4X0EA 3OPQA 1K86A 1XRRA 3A0UA 3IT2A 4KR0A 4C30A 1XZKA 3FOEC 3KZVA 2R7NA 4NTZA 3UJ3X 1AE1A 3M89A 3RCBA 4EFMA 2IYLD 5ELXA 3EBLA 1M2JA 2BUAA 3NV7A 3WJ1A 3KOXA 2C7RA 4JV5B 3N05A 1E9SA 4A5SA 3KIPA 1UFOA 1KFJB 5ITSA 3QHPA 3KXDA 1AZSC 1JSZA 3JQAB 3L7NA 4ND4A 3KUCA 4C4TA 1KO7A 3K0KA 4MH0R 4NEGA 3OBIA 2CB9A 2IOHA 3HO1A 3QLVA 4M1YA 5C1PA 3ZNQA 2HNAA 4F04A 2LCIA 3AFIA 3R3SA 1QVZA 3MNFA 2ON6A 3JAWB 4GX0A 3FW1A 3PIRA 2PX5A 2ADFA 1QFXA 3MMXA 4R41A 3D3JA 3AM5A 1X87A 4N39A 1BRMA 4PBRA 5A71A 1VRCA 3S8MA 4GEGA 1HG0A 4PHHA 1OREA 4WXPA 5EHXA 2F3SA 2Q1WA 1AQNA 1WZ2A 2WTAA 2UZ1B 4B3XA 2UXDB 4BFTA 1T43A 3CX7A 3CO0S 3PNYA 2RFLA 4MCHA 5BN4A 1JQ5A 3L8HA 1BW9B 1JALA 2QNBA 1QH9A 3JVUA 3DQPA 5F1KA 3D5TA 4DR3B 2BVNA 5EQTA 5KDLA 4FFBA 2G9ZA 4NU8X 2M6SA 4ZEVA 2GK7A 1UKCA 5KSPA 3KEFA 2ZI6A 3AR5A 1YE5A 1DEAA 1G5RA 3ZDFA 4ARSA 3R5SA 3G0BA 4BMPB 1BDIA 2WWVD 3QEAZ 3W5DA 3TAHA 3ASZA 2AL7A 5F3RA 5FTLA 4E51A 2IEZA 2IHTA 2OFPA 2PS1A 3C5HA 3I6ZA 4NOMA 5AK6A 1JNXX 2M6LA 2ZIVB 4ACBA 4FEYA 2QZSA 2YIDA 1YONA 1PGJA 3OC6A 1MFPA 3ABRB 2OCXA 5GONF 5IAEA 4GP6A 2W6ZA 3BFJA 4WN3A 3KVYA 2M98A 4JBYA 2CK3A 1EFUA 5FKJA 2L18A 4N7BA 4BNKA 2ZSBA 3IIJA 2X0KA 3QKSB 3WBBA 3R5XA 4XJVA 2UYHA 2ZM5A 4KRGA 5DHAA 1D03A 3PSHA 4FI3F 1EHYA 3P2IA 4UNSA 4UNPA 4YAJA 1Q17A 2MSKA 2ZS9A 3DHYA 2IUSA 2VP4A 4UU1A 5EE5B 2HK6A 2IUTA 3FNRA 2RJOA 2OXIA 4HLUC 4OHBA 3TVTA 5I51A 3USZA 1DL5A 4A15A 5DTRA 4QLOA 1JB1A 1F20A 1T8UA 2Z5FA 3E9QA 3IH5A 4BXOB 1JXOA 4KQ6A 4QFCA 1KDOA 4WNAB 4IIJF 1DELA 4MUEA 3U13A 3QOWA 2XMPA 3A4IA 5IS2A 3BWCA 4I5EA 2X3YA 5AFSA 5J47A 1JZTA 2BEWB 2ECOA 1IDOA 3UXEA 3WISA 4Z2YA 5FBLB 5JLAA 1YKFA 3HCCA 4MWBA 4DNXA 4D99A 1EVJA 2IDJA 3ELUA 2H85A 8AT1A 5K9ZA 4JYCA 6GPBA 1HQDA 3N8GA 1BMDA 1WOMA 3A6KA 2VT6A 4I4CA 1E9FA 1AF4A 1L4GA 5JD4A 2IZ1A 3M33A 3PKJA 3ED1A 1JDZA 5AK3A 2BKUA 5TMBA 1RXEA 3EOZA 1Q0HA 2ZE5A 1ZK3A 3EXIB 1YB5A 2O59A 2BM1A 3W6NA 2A1IA 5KQGA 4AECA 1PFUA 2BMWA 1YI0A 4W8GA 4BNTA 1N78A 1C9YA 1EX1A 1TA9A 1SBTA 1U7PA 3D9QX 3E23A 4ZO9A 1GWNA 3HNRA 3NFYA 4A2WA 2O20A 4XCVA 5JUWA 3C4JA 4BX8A 4KX5A 1G6HA 4H3HB 3GFTA 3WL4A 3CJRA 1XMJA 1Y6ZA 2P6UA 1Z8FA 5CYOA 3TQIA 1GRVA 2XVXA 4C4YA 5JYAA 2C61A 1KPIA 4DSTA 1BGVA 3SU8A 4FPXA 3FN4A 2J6CA 4DRZA 1RMTA 2HSEA 2XT0A 5B7QA 2V3VA 4FCWA 2GAJA 3ANSA 4LYGA 4R5HA 1E1DA 3E5MA 4RK5A 1WEHA 4EHKA 1US8B 2VJAA 4O8CA 1E2PA 2Q28A 3IGFA 3ZDZB 2G04A 2ZIFA 1AC5A 1Q12A 5D6NA 2A58A 2FZKA 4HT3B 2YQ4A 5A5EA 3ECCA 3U6BA 3X2SA 3ICPA 2BZ0A 1U7HA 1DC4A 4IJQA 3RD5A 1EBBA 3D2CA 4ZRNA 3CLRD 5HKOA 4ED9A 1ZA2A 1XMQB 1C80A 3ENQA 1T91A 5HS6A 1YD7A 5E9QA 2ZANA 2QUIA 3SS8A 3H11A 1X7WB 1GRQA 2DTEA 5EXXA 3SHWA 1DQNA 4FOTA 1P7ZA 1TYZA 1AXRA 3D1VA 1A4UA 2Q41A 3QYAA 1PVDA 1QQ7A 5GADl 3S2UA 2J6IA 2Z5VA 4MP8A 5BXYA 1O89A 1LZKA 1OH8A 5HM6A 2O8EB 3Q72A 4KXXA 4KLCA 4C4XA 3DCJA 4YJHA 3K2QA 3L8EA 2R4QA 4AZSA 3IBCA 2R2GA 2KQUA 2OYSA 2WWXA 3GAFA 3JWHA 1ZWKA 3FUWA 4LRYA 2HQRA 4EFKA 3EVTA 2C07A 5IULC 1R8SA 4M9XA 3S2IA 3ESXA 1JAIA 3F5MA 1CY1A 3MS4A 2WZDA 4UBLA 1PEKE 1AZLA 2WUVA 2I9KA 5IKPA 4M60A 1Y7HA 2XMCA 3GQBB 2OHVA 3C8DA 5EJ5A 5CNMA 3DA8A 1UPTA 3QVXA 3AUUA 3AZPA 5TX7A 2VXCA 1C1XB 5HR5A 2ZM6B 2IE0A 2OL4A 1SWWA 1PD0A 2WT9A 4YAGA 3D3WA 3AR3A 3WNQA 2ZJBA 2H4ZA 4FD3A 4CJXA 1DT3A 2FV8A 4Q3OA 4UTPA 3PXDA 1RW4A 2JLQA 5K3BA 4DBLE 4XYEA 4YJ2A 2KBEA 4IOKA 5MF6A 1L4EA 3BXEA 1TJPB 2WPDA 3TB4A 1WUHS 1ZBDA 4EDHA 1JEAA 4OGWA 3E7DA 5I4KA 2V55B 5IJ0B 3BDVA 3NBXX 2JIBA 4JQZA 5C1DA 3EA5A 4XUCA 1MTZA 2IOQA 4JKOA 4QYMA 4G01B 2QG6A 1KEWA 4KKVA 1DZIA 4QYIB 3LT1A 4YECA 5K0GA 4NYMR 1E8NA 3KNZA 2QXUA 5K0BA 4CBVA 3PX2A 4PCUA 1E2QA 4YCAA 4YJFA 3GYBA 1EVKA 1Y33E 2P40A 1TU4A 3QRWA 3RAEC 2H1WA 2RIRA 2H3EA 4XDYA 1V11B 3OJCA 4DMKA 4IJKA 2IS2A 3S2ZA 3C7AA 1GL3A 3L41A 4W6ZA 4XM0A 4GPD1 5I8ZA 2JLVA 3PP8A 3C16C 5FA8A 3T3IA 4PPYA 2FUEA 3WLIA 5A5FA 1BXRB 3NTVA 2IE8A 4O29A 3OKCA 3QWBA 1NNLA 4TQAA 2GZAA 2XA2A 5LM3A 3LKVA 3IBTA 4FHEA 3HKBB 4GIBA 1N1DA 5DOZA 2PT7A 4ZDWA 2VH1A 4K2AA 1Y3HA 2W48A 3PDHA 5AJUA 4B4WA 4WUVA 3RVRA 4OGKA 3WAGA 4N41A 1RXUA 3BH7A 3KOMA 2WM9B 3T5MA 2PA3A 1C0LA 5TT0A 5JZVA 2RGEA 1QIIA 3K32A 5F2KA 4D6YA 1HG1A 1GJRA 4ENWA 1DO8A 1L3BA 2BFNA 1VRWA 3BGSA 2HSZA 2YMQA 3IC5A 3ODPA 2DX7A 2I87A 4P9NA 3V55A 5DX1A 4MARA 1KZ4A 1K08A 3UBTA 3U48A 3FYCA 4GNKA 1EB9A 3PDIA 4KLRA 4Z0NA 3TTYA 5CG2A 4MINA 1RE1A 5B3JA 1C4OA 1JFTA 3R0JA 2GRAA 3RS3A 2JFGA 5GM1A 2VHXA 2WG0A 3K0AA 4BVAA 5KQPA 4ZT3A 4N47A 3TE7A 3COJA 3PD7A 2RGYA 1J8DA 2GZDA 2IW1A 1V8ZA 2JLAA 4JUBA 3ZUGA 4QO8A 2D7CA 2WTUA 3BS4A 3KS9A 1ODCA 5KTKA 2NZVG 4DLNA 4ZN6A 1N9KA 5I4BA 2NM0A 4LECA 2OCPA 2BJHA 1Q1EA 2YZMA 4K88A 4UXIA 1OFIA 1KMNA 2PDAA 4FQ5A 4J0IA 3D7MA 5AKYA 4BJ6A 1AMOA 1N7IA 1Z6GA 5DM4A 3RIHA 2UUCB 2EWMA 2XNHA 4MV9A 3DZDA 4URUR 4RTSA 2JHPA 3DEFA 1RPAA 1V43A 1YZUA 3DNPA 3K92A 5T6BA 2DR2A 3RC8A 4M9CA 2BWJA 2OOSA 2NVUB 4EYKA 5JRDS 4MX8A 1KR5A 3F0TA 2IXAA 1PL8A 4FJ0A 1ZM9A 1BS2A 1RHMA 3I9V6 1GG9A 2XE4A 3OZUA 4FFOA 4V1CA 2OGUA 2AXQA 1FK8A 3BTOA 3L8ZA 3PQFA 2WW8A 1Z3IX 3P20A 4HNAB 2XWBF 2GJAA 5TY0A 5I47A 3LQFA 1AQJA 3P9CA 4ZPJA 1THMA 1N5KA 4HS9A 3ISJA 3VO2A 5LDGA 4IXNA 4D9IA 5EZSA 5IJAA 3K05A 5C81A 3I5YA 4P3XA 4YASA 2QJWA 3G2KA 3HLTA 2H57A 3VR5A 4OP1A 4QQKA 3WKCA 1JQDA 4HWPA 3A26A 3EX7C 2ZTVA 4H59A 4AYTA 1T2DA 4TKVB 2CHEA 2IY8A 2PS3A 3B8HA 4FC6A 4F4HA 4YRZA 1AOXA 1CY2A 2HI0A 3EVEA 5GVRA 4YRAA 4I4TA 1QR2A 3FCUB 4XR9A 1X7HA 2FKAA 3CPEA 1IE3A 2LV8A 3UCXA 1WUJS 2PBLA 1EP3B 1GFIA 3JD4A 2A1UB 1KMHB 3GT4A 4IWNA 4PZPA 5EMKA 3ZWPA 1DU4A 4HKTA 3PQCA 3WQSB 5E3JA 4CR7A 2JA1A 1UXOA 2EU8A 2JJYA 1P81A 3DE4X 1H66A 1QRTA 3CSSA 1E2KA 2X2FA 1DS6A 3FH0A 1GPLA 2J6BA 5ARDA 1L5NA 1TK9A 3EXG2 3WLNA 5C5DA 4DSOA 5CA0B 1UJNA 4IV0A 1EMDA 2P2DA 5I7HA 2AQIA 2JH3A 4ISCA 4B3HA 1R16A 1Y3FE 4ZJUA 2C31A 2ONKA 4J0QA 1ZOOA 3V4FA 4D9HA 1KYTA 2G08A 4RDIA 2PD6A 1CU1A 4U7TB 4XWTA 1KWKA 5ALIA 1CVIA 2YIVX 2GK3A 1B23P 3ROZA 1FIUA 3PU6A 3ONWA 4MGHA 2W42A 1B6RA 1DKUA 1IEWA 3ME5A 1CIPA 1W19A 4KVZA 3OG9A 3P2JA 4JC4A 1QIHA 3ZZTA 2D1FA 4DMHA 2JDIA 9ABPA 3Q3GE 1K4MA 1KY4A 3R7WA 2X23A 2PMWB 3FCYA 4FSDA 2MIIA 4DT1B 2GX6A 3FSGD 4PZDA 1KMMA 3GJTA 4AXXA 3T38A 2W70A 1GNQA 2IYAA 2IU0A 1DAFA 4I5GA 5IJXA 3OLVA 3W78A 4YCBA 4DNPA 3KDAA 4D79A 5FWYA 1GNTA 1N6RA 4L8FA 4QLAA 5CB6A 3QW2A 2FA9A 3TMYA 2E4YA 2P69A 2R62A 3RJMA 4JLPA 2KHZA 3JQ8A 3KZNA 3AW8A 3DBHA 3ZCQA 1AQIA 5HK8A 4D0NA 4MP3A 4Y6RA 5EHQA 1U7OA 2FPPB 4AJKA 5J63A 3QF4A 1JIVA 1YHNA 2ADOA 3KB1A 5B1HA 3PR1A 2GDZA 2OVBA 5J4VA 3L5KA 4FGZA 5B30A 4GAEA 2VSFA 1GU1A 2Q5EA 1G6KA 3DLPX 2ZI7A 4FNOA 4X90A 1DG1G 1EG7A 1UBTS 4AO7A 4F60A 5JHHB 1ZAYA 4MUAA 3A6DA 4F91B 3C5CA 3M6IA 2A8YA 3EGDB 1Y9JA 5AICA 4Q19A 4TWJA 1KEEB 2P65A 4DARA 5AUNB 2OFFA 1MAWA 1MVLA 1VP9A 1FP1D 3SEQA 3PX3A 3VU0A 1UPAA 5EEHA 2OWDA 1NXQA 3HEMA 1Z06A 3T5CA 2P2SA 3OPYI 1V8DA 4FW8A 5CCDA 2GILA 3BGDA 1YH3A 2XQVA 4KR2A 2VO1A 4W1QA 3H04A 4IIYA 4B3MB 1ZD2P 3MN1A 4L0QA 3NW9A 2LRHA 3NWOA 2CMFA 1L7DA 4RVDA 2VPWA 2UYQA 2YV3A 3PHLA 1CF9A 1NLYA 3B1XA 1K3TA 3HCWA 4TTVA 5AK5A 5LXTF 5H83A 1SUAA 4OH7A 2PUCA 4HWTA 2JLXA 5K6AC 3Q7SA 4CM4B 2FWIA 3COSA 3NWEA 4KWTA 5I7VA 1QTRA 4CEHA 1JZSA 4TUYB 3Q8MA 1XVVA 1TPYA 2JIQA 1FDIA 1LBIA 2M1XA 2O2HA 3QHAA 4DMCA 1DARA 3HA5A 2C7QA 2MYPA 3IEKA 5AHKA 3TSWA 2UUAB 5K0LA 1L6IA 4Z9XA 3LI2A 4BX2A 1DKMA 2B4AA 2FK7A 2UYOA 2ZYGA 3G2IA 4WI1A 2A0WA 5JXHA 3LPLA 1ZD8A 1F2TA 3I45A 3IJRA 3LPAA 3N74A 3KHKA 4OHVA 1UBLS 1X13A 5KYWB 2HRRA 3CRQA 2HWXA 2VP0A 3LF1A 3CUKA 4IX1A 1SBYA 4Z6KA 2PTGA 4X20A 3FF4A 5HP4A 4N0PA 1N8KA 1Q91A 3AW9A 3I2FA 1NXVA 1XQWA 2QNIA 4K28A 2Z5GA 4ZAXA 3UT5A 4CKBA 5K0CA 2O2ZA 1V1JA 3PV0A 3CLKA 3R0VA 4MR8B 3AU9A 3FMFA 1TYDE 1L1RA 1JHPA 1X7ZA 3GZJA 4H0FA 4XQGA 1LLCA 1PG5A 1QYWA 4LJ5A 4DXHA 1HL7A 2CXQA 2HU5A 4YJKA 1II8B 5KU7A 3JQDA 4YGYA 5L95A 2GHQA 2VVTA 4HADA 2XBLA 2Z2KA 2FN8A 3E9ZA 5C1IA 4PVCA 4WN9B 4NEQA 3IMKA 4WOKA 3SJCA 3M4YA 3VPXA 3L46A 1ZGCA 2W22A 2CHQA 1QUEA 4I1YA 1R0BA 1SVWA 2GZMA 2DG2A 5AVYA 1UEJA 1FPMA 4G0NA 4RM2A 2V7EA 5CHEA 3PE3A 1IHYA 2X76A 3AR9A 5LKAA 1GOTA 1RHRA 1JHZA 1W25A 2JPDA 3H1GA 1IY1A 2R7KA 5DYTA 3D3NA 2EFGA 1S2IA 2KI5A 1EGHA 2XE7A 2D2VA 3CGWA 3IB3A 5DU2A 3LSYA 1SXHA 3EWNA 4CV1A 2CMHA 3CSUA 3ZV4A 1NN3A 1UDRA 4FK8A 1ZH0A 1KI8A 2DTDA 1SOMA 1E2FA 3AF3A 3KE9A 3O31A 2G82A 1TVKA 5DIZA 5FYQA 4EG4A 2CSXA 5AJWA 4TLEA 5EP4A 5JI3E 4LHSA 4TRNA 5K6TA 3G85A 1MOSA 3QY9A 4Q7EA 4LWOA 3R20A 3KQSA 1E2HA 1KSFX 4UUBA 2O48X 1S8AA 2CD7A 2EL7A 4HB4A 2GYYA 2VDJA 1M34A 3ITKA 3CW9A 8OHMA 5C53B 2DKNA 3ESZA 2UV8A 3PB3A 1Z7BA 4P5EA 3U6KA 1NQUA 5D87A 2FR0A 1ZXXA 3WHPA 3ZS9A 3NTRA 4NV3A 1PU2A 1OHHD 2ZETA 2I7VA 3BE5A 4RQBA 5SYAA 1MKYA 1PS9A 5JV5A 1N33B 1G4HA 2JFXA 1O87A 1HI9A 3GEHA 3C87A 3K1ZA 2GZRA 1GTVA 3UMMA 3LOUA 1TJYA 3ABOB 5HJ2A 4QHSA 4G9EA 1WV1A 4IHKA 3PHIA 1F0KA 3IP9A 3ZY6A 5BV1A 4KSCA 1GPBA 3CV3A 4LSZA 5AW8A 3P4XA 4I5IA 1J7KA 4PFSA 2OCDA 3KG2A 3QF7A 3RM3A 4AJ1A 3B70A 5LLTA 3U09A 2Q4RA 2A1UA 5D5HA 2P3QA 5CTAA 3KWMA 1DWOA 2Z57A 3T9EA 2C94A 2GPAA 2R1ZA 5AKKA 4KXYA 5TMPA 3LRXA 1Y8QB 2GBLA 4AO6A 5IT4A 2LDXA 1CERA 1OBOA 1DEOA 3JYPA 4KLAA 4ER0A 3VNUA 2H4WA 1P1RA 2YWXA 3C7CB 1G3UA 1LWOA 2XUDA 3F5SA 4Z3KA 1W46A 2QAIA 2Q5IA 3KYDA 4EW1A 1KRWA 1ISHA 5T73A 2F6RA 2JFWA 4IDNA 2VHCA 3F9CA 4I1VA 3SC6A 5BV0A 4ZARA 4LCEA 1U0RA 4C6HA 3L82B 3V3TA 3V8EA 1RZ3A 3RAGA 4BQSA 3N6XA 3EXFA 1NKTA 1JHDA 3CCCA 4DV6B 4JENA 2DE0X 1Z88A 3H6HA 2Z1DA 4Z9FA 5HNKA 2XUAA 3LCMA 4C0KA 3OZBA 6LDHA 4D45A 1JHOA 1W93A 4HZUB 4ZCTA 3V32A 1ZXLA 2JIDA 3ZV3A 3DZJA 1Q0PA 1UDWA 1YSCA 3U4DA 1PDWA 2G9QA 4RKWA 1IBCA 4TV8F 3KUKA 1YZYA 4JBWA 3WGJA 2YRXA 3V5NA 4MWSA 1KDRA 2QVZX 4ZRDA 2AJLI 4BBZA 3C8MA 4KQ9A 2A84A 2HNBA 2DPMA 521PA 4UAVA 5TMEA 4FWTA 3SZUA 1SK8A 2R4TA 2PH7A 3R44A 2OQRA 2TECE 2ZIZA 3TOXA 2IH5A 3SJAA 3A2NA 1CJVC 3ACBA 1QCDA 4CL3A 2CLSA 2H6EA 2AMYA 2PZAA 4HMQA 1TRKA 1KXJA 4RKQA 4BTEA 3V4OA 4PSUA 3GXBA 1HV8A 1NXXA 2JH8A 3L9XA 2WIFA 1FEZA 1GA4A 3Q11A 1QG2A 1FDTA 1W4AA 3FBWA 3M9XA 3NR2A 5C3UA 1KK3A 3OU6A 4HQKA 1MJGM 5HKAA 4Q48A 4QYSA 3GVXA 3JWGA 3L7YA 5F51A 4BV3A 2D3WA 2ZYAA 3SVLA 1E99A 1O95A 1DIHA 1EEHA 4Z51A 1JH9A 1RIFA 2ZEJA 4PO9A 4XASA 4Y6OA 2F17A 3WWDA 2HYDA 2JH9A 2HGSA 1YJQA 2VDPB 1OFVA 2RDMA 3KZOA 3E9NA 4OQFA 1T25A 5EKTA 3U26A 3EIWA 3GZNB 3U5TA 2PR2A 4NBVA 4JA2A 5JU6A 4G07A 1QJ4A 2F64A 1D8TA 4MTLA 2PGLA 1G3QA 1S9HA 1N6IA 3B1YA 3IQIX 4BVFA 1N8TA 5LQAA 1IVYA 1KU6A 3F6SA 2FSSA 1LTKA 4P1ZA 1FLVA 1V4VA 2Q4OA 4D81A 5ELLA 1BXRA 3UWKA 1ZR2A 4MVJH 1B0UA 4Q24A 3ZQ4A 1QDUA 1I7NA 2WM8A 1VYTA 3H84A 3IALA 1EK6A 1M8FA 1MP0A 1VXOA 2WFLB 3H9JA 1ZNQO 1NUQA 2JGDA 2Z2IA 1MVOA 3FYTA 4NR0A 3BERA 5JG7A 2WILA 1GKIA 5LDDC 3K1AA 4J1QA 1N9ZA 4NBKA 4U7JA 1FFHA 1D2HA 2ILVA 4ML3A 3VOBA 3N7TA 3OTHA 3FWHA 4FLMA 5BW8A 3KETA 3MG9A 3QH4A 2RH5A 3LNTA 3OM8A 4OJKA 5DBEX 2W58A 1QH8A 2DUUA 3BMCB 3OTIA 4M9UA 3WGGA 5M04A 1EE9A 1M1YB 2EP7A 2H7CA 2XUZA 4KR9A 3DUFA 3R7LA 4CM1A 1GPAA 2Q0XA 1H8EA 4DKXA 3L43A 1L5RA 1PUIA 3LY5A 4P3OA 3KTAB 3W06A 3PQDA 2YOGA 4CIWA 4CEIA 1SQ5A 5F33A 5IJ9B 5JLJA 2AV6A 4Q3CA 1U9YA 4MSUA 5CNIA 1V16A 2D8MA 1PJTA 1E18A 2I3ZA 4IM7A 2ZYTX 2VAWA 3DV2A 4M22A 3E53A 4ENQA 1D2GA 4HGZA 4TWIA 3GA7A 1W5BA 4L6IA 3OOJA 3PRYA 3CN9A 5A3VA 1I33A 4B35A 3NHAA 3GJ0A 4BNMA 5IUNC 2H2AA 2FN7A 1TKRA 6REQB 1FFEA 1KYYA 5AM3A 4GP9A 5KNDD 1A5SB 1QQAA 2PA0A 4LA4A 3WLLA 1Z7EA 3CMMA 4JCOA 1Q2UA 4TV9B 2MT9A 5TGTA 5EUQB 2WF6A 3AHCA 4C88A 1O0CA 4KODA 4IHJA 4LFBB 2FG5A 3WK4A 5JISA 2QD2A 3E2IA 3U60B 4E46A 2RI6A 1KO4A 1WCWA 2VK4A 2VN8A 1DTEA 4F2GA 1H69A 3OQMA 1UC8A 3U61B 2PSJA 3VPCA 2VYND 1XIVA 2H2DA 3E1KA 3HM9A 2EX0A 2V8OA 1E4YA 3EXEB 4DIEA 3E6AA 4BKOA 4EH1A 1YU6A 4NCHA 4QDKA 5DI3A 1PBNA 3MWFA 2VC2B 4P36A 4F9FA 3L79A 2QR5A 2NYVA 1VSQA 1T6NA 3DHWC 4GPEA 4OQYA 5KBYA 3EJWA 4ZPXA 2YVUA 4UUOA 4Z9AA 5EUBA 3DCNA 4WNYA 4C01A 3SJ7A 5KYUB 5CK5A 2HQ1A 3HDYA 1P0FA 1WNFA 1H0KA 4GPTA 1F4LA 4WMLA 1LQUA 1CDEA 3REQB 1QVAA 1APBA 1S01A 3HJNA 1T5LA 1JT2A 3H9CA 2PXAA 3BBLA 1E2GA 4MIKA 3RO7A 3VC7A 3ZI4A 3ZWXA 4A1FA 5CXQA 1T1RA 3OESA 4LCJA 2ZJ2A 3REQA 1LDNA 3CBGA 4JVOA 2ZAMA 1L5KA 1RT9A 3UMRA 4IIEA 5FEMA 1Z4IA 1R5JA 4FX5A 2IZ7A 2X5JO 5COAA 1NVFA 3OHSX 4HNAA 1FVFA 2IWHA 1FOEB 2PUEA 4BV9A 3EULA 1SELA 3DUFB 4LMRA 4U0JA 4BEBA 2ZRFA 4F2WA 1L4UA 2EX4A 4BJ5A 2FZ5A 3RS4A 1AKWA 4BB5A 2AE2A 5IFLA 1IFXA 3SN6A 4LJ4A 3ZK7A 1E2DA 4DB2A 2APJA 1F1JA 1PV2A 3KM0A 4NOJA 1PK9A 3VNVA 5AVWA 5KTNA 1AHHA 1LU9A 1GADO 4BNJA 3QM1A 1U11A 1E20A 4KN6A 5FV7A 1U4NA 1XX6A 3ND6A 2NACA 4P4TA 2RBGA 4AYWA 5FYDA 4D41A 2L2QA 4Z4IA 5E7MA 1E5XA 2IHKA 4CG0A 3SYNA 4BDSA 1XRMA 3R3JA 1DAEA 4AI6A 2BGNA 2F9LA 1M54A 2O0LA 4YUZA 2ZR7A 1A69A 1RAGA 3QU5A 5B55A 1QG4A 2JGAA 2GAFA 2ZVJA 1J5EB 3B53X 1PR5A 2J3KA 1TQ4A 1O1YA 4UCXA 1V16B 3G2HA 4C22A 2HH9A 2QPAA 3OCYA 3PC4A 4BTLA 4JP5A 1WF3A 3P4YA 4RDXA 4IYRA 1LW7A 1DJMA 5AKIA 4FXOA 4ZOBA 5AVXA 4OAOA 3LBYA 3DOOA 1Z6QA 4CEJA 3QVUA 7AT1A 2GRUA 4CWAA 5ISMA 3QKUA 2E6KA 1IDN1 3VRHA 4DEXA 1RBZA 4AZVA 4M7WA 3TFQA 2ODTX 1USKA 1L9XA 1SFRA 3DOHA 2EKDA 1V3VA 4MQ6A 1X1CA 2QD5A 3L7MA 1I3OA 5EL0A 3RVQA 2NWQA 1PFVA 1RXCA 5HSGA 2OD7A 2HNKA 4IKOA 2C9DA 2AVNA 1AZWA 3CE9A 2CBGA 2V74B 1ZVJA 3LLVA 4GXTA 4GWKA 3WLEA 5IZ4A 1O03A 2I34A 4AQ7A 4G0WA 1QGDA 3UHFA 1FYXA 3IYLW 4CM3A 2NYUA 2L69A 1DKNA 3AJEA 3HUTA 3HZOA 4MV5A 3FOWA 4XCXA 2W6NA 1CUWA 2XWJI 3B51X 4MI1A 2BYTA 2XEXA 3DUWA 3SQWA 1DC8A 1DOAA 1PFQA 3RVOA 4RSRA 5LIRA 3B12A 4E70A 3G1UA 3MINA 2G5PA 1PBTA 4HNRA 2GJKA 4RENA 1AK2A 3AVQA 4I6EA 5K45A 2R00A 3W5AA 2J67A 1NLMA 2QR2A 2RARA 3H18A 5ABPA 4GGMX 1PJQA 1TOAA 4TMKA 1PL6A 1N3LA 2GJ4A 4QUEA 5DXFA 4R54A 4EHBA 4Y6QA 2GVNA 1N1GA 1Y9ZA 2J8ZA 2P2ZA 5ECWA 1QGED 3M6UA 1ZUNA 3R3HA 1VPTA 4IO1A 1OZHA 1GTL1 1D2MA 1OXSC 1NVVQ 1HRKA 2YW2A 2Z8YM 3IMEA 2O8DB 2B4RO 1J8MF 1G42A 3FMVA 4NMWA 3GJQA 4LHZA 2W98A 4M8NE 2C7PA 3KWJA 1E79D 3EWSA 1L7PA 1NA5A 1X7XB 2OQ2A 4C89A 4MDYA 4LV6A 3KQPA 5JS2A 1JFVA 2ZRHA 5KJFA 5DVZA 4Y9DA 2Z83A 1CX9B 4NU0A 2HLHA 3GJ4A 1KIFA 4I14A 1DSSG 3ONNA 4BGEA 4JI0B 1RMQA 1UBSB 2WU1A 3NVAA 4H7HA 4MRAA 1KR2A 1XI2A 1D6MA 5SZIA 4WZAB 2HO4A 4HDRA 1GPJA 5FH9A 2AOXA 4JA0A 1YQQA 3L77A 4BFLA 2BP7A 2IDZA 4GC5A 3K4QA 3PT9A 1PQPA 1J5PA 5CH8A 3VI3B 5KTOA 1M7BA 1FX1A 2Y9MB 3ACCA 4MNTA 3DV0A 4KPFC 4H6WA 3C3BA 4WXRA 2VK8A 1QE3A 1F6BA 2OBNA 1NBEA 3SM3A 3AR4A 3B3FA 1Z5OA 1LK0A 3UHPA 4QXOA 3GRUA 4ZMSA 3WI7A 2WZCA 1W36D 3DONA 1CZHA 1SOWA 4GDMA 4EA8A 4YR7A 2P4SA 4JGBA 2IY7A 3JS5A 3Q7EA 1QV9A 1CQIA 3UHOA 4V38A 2Q27A 1HDIA 3R24A 1KYWA 3NTQA 4KUHA 1JVSA 3EXEA 4I1SA 3RDPA 1AS3A 3G8CA 2QL6A 2WG2A 3GRVA 4FGSA 4NK5A 2PX6A 2PXCA 3C3AA 1UOPA 1XKLA 3GELA 4AX4A 2I9PA 221PA 3JZFA 3R8XA 1E9CA 1TZ2A 3DXXA 1I2CA 5HXAA 4CQNA 1RJGA 3C3XA 2E82A 2CDAA 3LPDA 2I4IA 1N2OA 2BD0A 1W52X 1BN6A 3I32A 1KTVA 4O4IB 3H6GA 4TV9A 1DBPA 4U6NA 4E21A 3RRNA 4ZK2A 1L1EA 2WDZA 4NICA 1VIMA 4M8KA 3RJTA 4COKA 3HKDA 4X1KA 4BV2A 1ETUA 3RANA 3QY0A 1E1NA 4M76B 2DFVA 4WK2B 3T4PA 1OT5A 3D7RA 3U3RA 4BRUA 2BHTA 5TF4A 3WA7A 2IU4A 2AGVA 4DNQA 5J4YA 5JNSA 2R6FA 2EBWA 2YXLA 3HPQA 1TCBA 4GKAA 4DJJA 2ACEA 4ENSA 1ZRMA 2CNDA 5DASA 4ZREA 1RZRA 3G1WA 3A4TA 3T9CA 2FWJA 1QF7A 3SSAA 2VT2A 4R7ZA 1SBIA 3S1LA 3AR2A 2P27A 4Z9BA 3VJKA 1CUHA 1MRSA 2QX9A 4A0HA 4BPRA 4E2FA 4MUMA 1Z8HA 2C9CA 2C7OA 2X0JA 3VYSB 4LS3A 4B6GA 1ZUWA 1C7FA 1T9HA 1ECGA 3ANXA 2XMGA 4G0QA 4H0CA 5AD1A 5GZ6A 1D1TA 1YI8A 1UMCB 2F8SA 3UB4A 3H99A 2BTOA 4WCFC 1E79A 5KEIA 3JQ9C 2TRSB 1LSSA 3PC8A 1QU3A 1TVKB 5FTMA 3UB2A 5I7FA 4GRDA 4NSNA 4Y2UA 2PWYA 4O6VA 5EJ4A 5GVSA 1ISSA 2PGIA 2PRYA 4OFWA 4ARUA 4B3GA 3RROA 1K4KA 3T1VA 1R7RA 2GBCA 1EM8B 2OUKA 3OJOA 4K03A 5HF5A 4BNNA 3I6YA 4CF7A 4JI1B 2C96A 3AF0A 3MYYA 2B83A 4O2LA 4E14A 3THXA 3VDXA 3LLSA 1BN7A 3OF3A 3TKYA 3RVNA 3DWGA 3AUJB 2XVMA 3W9SA 2ENWA 3IIEA 3QELA 1Z4PX 1HDGO 3N2GA 3ZJ5A 5IAGA 2YUTA 1YHZA 4H9GA 2RKBA 4WFJA 1QQBA 1XN4A 3DWEX 1PJRA 3RIYA 1PT9A 1QGZA 5TMDA 5JE8A 3MOSA 5JY6A 2Q2OA 3GRKA 4RU1A 1Z45A 1ZZGA 3MAAC 3QNWA 3G59A 2ZUEA 1ELOA 2C0CA 3BDAA 5AVOA 4U7HA 4G89A 4JIMA 5C3MA 3KQUA 2WD7B 1QCYA 4FDAA 5IYZB 2WPNA 3VDQA 2AC2A 2PANA 3CH5A 4WOCA 3I0ZA 3WLJA 1E3TA 5CAEB 1IB6A 1JQ3A 3EZFA 1V48A 5JCJD 2ZJ5A 1FNCA 3GV0A 3G7SA 3EASA 5JS6A 1FQWA 1PF7E 2C9MA 1LBQA 3R0QA 4Q0MA 1DV1A 5TJ9A 4CV0A 5KC8A 2QQFA 2SBTA 3WJ7A 4X94A 4OB7A 1LQ2A 5JS1A 3K70D 3HYCA 3BULA 3FGNA 3EVNA 1W4ZA 2FR8C 4FWBA 4R9RA 1LBSA 4IV8A 4JQSA 1C0KA 1RLIA 3FNBA 5GV8A 3RPEA 1NNUA 1G4AE 4AP5A 5B3JC 3W4JA 3B2QA 2C4UA 5BWOA 1NAHA 4LCBA 2FX3A 2HTFA 2PZLA 2ZYDA 3N87A 4L0MA 1EFLA 1CT9A 2N75A 3H1PA 1GO2A 4LC0A 2HHCA 3MYRA 3EN0A 1RWOA 2HDHA 4YROA 4ISBA 4M1ZA 5IDXA 5KWEA 3UH1A 2PUHA 1EFPA 4RKRA 4M1SA 3TG8A 5AO9A 4TXHA 2IHNA 1YQWA 2GM9A 3H1BA 3B5IA 1EVQA 1A2BA 2G1UA 3LQQA 4K6CA 3ZZUA 4JIGA 5EP1A 3VZSA 3IP3A 2ZPUA 5JO9A 5F23A 2BEUB 1QO0D 1ZSVA 3JQAA 2HW8A 2HA3A 5AI5A 2BOVA 2QLNA 2LD4A 1I1OA 4EF6A 2V7TA 2ZPAA 2MWMA 3NASA 4KQHA 5BO5A 1UR5A 1DIBA 2VK1A 4PYQA 2LCQA 5CB4A 3C3PA 2V98A 4LWZA 5EZYF 2WHQA 4BKPA 3HK2A 4B7AA 2VSOA 2R4UA 1G5QA 1KZYC 2BV3A 3P0IA 1PSZA 3GI1A 1WHSA 4KQWA 3PC3A 5CA0A 1TMKA 2OHIA 1U65A 4PO3X 5DLEA 3EFBA 1KC3A 3ENKA 1QOPB 1W2HA 2Y66A 2DETA 2QD3A 3AI2A 3H0VB 2GWHA 5T3YA 1E6LA 3S1AA 5F21A 3G0OA 1X7YB 4J1TC 5AXBA 1NM5A 4ZFNA 3LVFO 3Q3VA 4EA9A 3OTWA 4NVRA 3ETNA 5FWYB 3S1AB 4EHNA 2VH5R 3HR4A 5AUPB 1I4LD 1UMKA 3GFQA 2JZNA 1SUIA 2RHLA 3SLGA 2GB4A 3B78A 1P6XA 4Q66C 3TNFA 2WTMA 3IDFA 4Y2VA 1FMTA 1QQ5A 5FTWA 1Z12A 1Z5NA 3M34A 1K89A 1XGKA 1FSSA 2OT3B 2VUHB 2WSBA 3U3OA 3CNBA 4K6FA 2B37A 2ZRAA 5CD9A 3L1UA 3K2BA 5COBA 3O8LA 1EBFA 2BGJA 2DP4E 1QYRA 1KWGA 5CDUA 5KVAA 2PL3A 3VOSA 1U0LA 4MUKA 1LDBA 4BB6A 3TS1A 5KVVA 3LSTA 1WEKA 3PXGA 2PYDA 3T15A 3NQ41 5PNTA