1VKNA

Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
340
structure length
340
Chain Sequence
HMIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEFDPEKVSKNCDVLFTALPAGASYDLVRELKGVKIIDLGADFRFDDPGVYREWYGKELSGYENIKRVYGLPELHREEIKNAQVVGNPGCYPTSVILALAPALKHNLVDPETILVDAKSGVSGAGRKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSLEEIHEAYLEFYKNEPFVHVLPMGIYPSTKWCYGSNHVFIGMQMEERTNTLILMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords N-acetyl-gamma-glutamyl-phosphate reductase
total genus 113
structure length 340
sequence length 340
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1vknA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1vknA01
3TOZA 1E3WA 4YVFA 1XR3A 3QWAA 3H5AA 1BSVA 2AQIA 4BV8A 4PN3A 1TLTA 4RVGA 3ST7A 3M6IA 1CEQA 1N7GA 3JCZA 2WYUA 3RWBA 3ZHZA 1B8PA 3WWZA 2WYVA 1V9LA 5IZCC 1OOEA 4DA9A 1YQDA 4J49A 1HEUA 1GPJA 3JD3A 3K6JA 4IZHA 1HT0A 3TZCA 2Y93A 2AW5A 4GWGA 1WMBA 1W0CA 3BTUA 3ENKA 1KEVA 4BGVA 2V7PA 4RJTA 3VZPA 4EUFA 3WGZA 5JXWA 1B8VA 2X5OA 1I3KA 3TZQA 4AJIA 1UJMA 4BGUA 3LLSA 1G1AA 4WASA 2C0CA 5FEUA 3DL2A 3RFXA 4ALLA 3PLRA 4UVDA 4WLFA 1HDYA 4I5FA 4IS2A 2OMEA 2VN8A 1UZNA 2JAHA 2B83A 1P74A 3WSWA 5A04A 3IIEA 1LDYA 4EW6A 4E5PA 2Z1MA 2FMUA 2ZYDA 4BKUA 3R0IA 2AQ8A 3GAFA 3NTOA 3WQSB 3A28A 3H5RA 4OXNA 4AJLA 3FWZA 4DLBA 1XWFA 3QW2A 3GFBA 5A9SA 5U9CA 4R5MA 5C5IA 1PJQA 2JD0A 5FFFA 4QTZA 4AJEA 4CMKA 1QP8A 3RUEA 1OFGA 4AJ1A 2GCGA 1ISJA 2ZJ1A 1U28A 1JU9A 4BIIA 3VHRA 5G0VA 5KJCA 4Y6SA 2BGLA 4MPDA 4GGOA 1AXEA 1DRWA 4J2OA 3UAGA 3PJGA 3CEAA 3GFGA 3K2EA 2AMFA 1SZJG 1GPDG 4OQYA 2X0RA 5JC1A 1PZGA 4DVJA 3HN2A 5L40A 1VJ0A 3ZNPA 4A03A 4J1QA 5HWSA 1ZNQO 3DTYA 4YTEA 2B4RO 1YQGA 3D3WB 5HA5A 1RYDA 4ZRNA 4MOWA 1P1KA 3ZU5A 1EUZA 2IEBA 1SB8A 1GR0A 3GDOA 4E5KA 5BNIA 1VRWA 1IPFA 3C7CB 4MVJG 3PGJA 4ZICA 5CG2A 1ULSA 2ZQYA 4XYGA 4O5OA 1VLLA 1KVUA 5EINA 5TLSA 2VWPA 1I8TA 3IC5A 4IQ8A 3MJTA 4QFDA 4W9NA 2UVDA 1N92A 3E6AA 4GWKA 1NVMB 2P4QA 2QW8A 2AE1A 4IDAA 1ZEJA 1Y81A 3KLMX 1N8KA 1B3BA 4N54A 2VNSA 3DOCA 4CLXA 3GPDG 4WNCA 4JCOA 4OJNA 3OEWA 2GRAA 2J3JA 4Q3NA 3PGXA 1XU7A 3D0OA 3JD2A 4EEXA 3WICA 4XR4A 3G1UA 1IHXA 4LRSB 1I01A 2D3TA 4G5HA 2E49A 4GL4A 2JCXA 1HLDA 3RFVA 4DPMA 3ICPA 4ZJUA 4BMSA 4YXFA 3PHLA 2E82A 3WLEA 4M55A 1PEDA 2IZ0A 1A27A 4I5GA 5L53A 2DT5A 4R5HA 4CUZA 3EYWA 4NNJA 1Z82A 3WFIA 4Q3BA 1HE5A 3VC7A 4HADA 3OICA 2DPHA 4XKJA 4WE3A 3DWFA 2QYTA 2YFHA 2ZTVA 4D0SA 4IJUA 3P5SA 1A9YA 3AY7A 1KVTA 4M87A 2B0JA 3VAZA 1DEHA 3MJVA 3BMNA 3UOGA 5C37A 1PWXA 4II3A 1YXMA 3OA2A 3G17A 4Z0TA 4FFLA 2O23A 4E2WA 3PJEA 3WQQA 1U4OA 3HDQA 3WGOA 1LSOA 1U8FO 3GZNB 4R16A 4B4VA 2O4UX 4J0EA 4O6VA 4BOYA 4FGSA 4E21A 3I83A 2EP7A 3UH1A 3JQBC 4GMGA 4DIOA 8LDHA 3PYMA 4AJJA 5TIIA 3VH3A 3JYPA 3E48A 3IOYA 3WMWA 1QYVA 5BSHA 2C20A 4NJOA 3I9JA 1VM6A 2PZLA 5I7SA 1H94A 5JW6A 3GA0A 5IF3A 4DC0A 4HV4A 2FRDA 1RWBA 1UP6A 4IJVA 4L76A 1PQPA 4DMLA 3RSHA 4FOOA 2RCYA 2I65A 3GLQA 3VZSA 1SPXA 3R1IA 4DPKA 1VJ1A 2Q3EA 3AWDA 3FBTA 1HF3A 5JY1A 4BO0A 4R1SA 3EUWA 2Q1TA 2W2LA 1O9BA 2QX7A 1PGOA 2NSDA 5ER6A 3UCFA 1NPTO 4BNGA 2JD1A 1VL0A 2YZ7A 4RF5A 5I9NA 3WSVA 3BMOB 1LDNA 2X9VA 3RC9A 4MO2A 4Z6KA 3TL3A 3TZ6A 1ZMOA 4OGWA 1AXGA 3TFOA 1Z6ZA 1ADGA 2WD8A 3JQAA 4E6PA 1ISMA 1Q0LA 4GGPA 3B70A 4IBOA 1QRRA 1D3AA 3GEDA 1BXGB 3HDJA 1JVSA 3F47A 1E7WA 3N7UA 3OQBA 3JYOA 4DRYA 1XG5A 3S8MA 3AOEA 1T4DA 5DBFA 4WNIA 1YL6A 3DAGA 3E9MA 4RVFA 4FQ8A 4GX5A 4H15A 1JKJA 3WGGA 1CIVA 1EMDA 3JYQA 4BKRA 4YAKA 3S1LA 3PZBA 4JNKA 1N7HA 4YJFA 4YWJA 4LVCA 4W4TA 1PJLA 4JJFA 2CZCA 1YE3A 3BHIA 2YV3A 2GN6A 2YHUA 4ZN6A 3CPSA 1QYDA 1SB9A 3BZUA 1LNQA 1I30A 1E5QA 6LDHA 4IMPA 4PZEA 1UR5A 3PFFA 4PZDA 1H5QA 3E18A 4OAQA 3G1TA 3ZWXA 2FR8A 1LQTA 1PL8A 1QYWA 2J3IA 1FK8A 1YONA 3F5QA 4XWYA 4A10A 2CNBA 2CVQA 2FPIA 4BO5A 5DCYA 1SOWA 2PV7A 3JQ9C 4EITA 5CEFA 3PDJA 1D1SA 4OKIA 2YDYA 4MVJI 2Q2WA 4R4JA 4CL3A 1ZZEA 4PLWA 4R1NA 4EJMA 4UULA 1UXIA 3GUCA 4ND3A 2GSDA 3I1JA 5TX7A 3CMCO 2DBQA 1PGNA 4BNUA 2QQ5A 1NFRA 9LDTA 5A05A 2DTDA 4ZQGA 1DAPA 1JKFA 3AW9A 3DC2A 4I1IA 4CMAA 1ISGA 1BDMA 1ZKMA 3L9XA 2VHVA 3QVSA 3VTFA 1NAHA 2NU8A 3BMCB 1NWHA 1Q7GA 3L0DA 3JQAB 1PL6A 1WDLA 2YYYA 4AJ2A 4II2A 3GNTA 3MJ4A 1TEHA 3GDGA 4N18A 3M1AA 3KYBA 2P5YA 2ZTUA 4XIJA 4E30A 2UDPA 2XOXA 4JBGA 3W8EA 3M2PA 4FD3A 4MIOA 3VOSA 4XYLA 4ONEA 1Y5RA 4F6CA 2GYYA 5EESA 5EIOA 5DBIA 1WMAA 3ZWMA 3MJCA 2QG4A 3DXFA 4CM9D 1R15A 2Y0CA 3H2SA 1DIGA 1NBOA 4L0QA 3DBRA 1H9BA 5KKAA 1PQWA 4GVLA 3JYLA 1GYQA 1EQUA 4E32A 4IDFA 4LSMA 3H6KA 5DN9A 3L4BC 3WBBA 3BTSA 3JV7A 3STHA 2W98A 4YJDA 3WWYA 1NR7A 3AY6A 3B1JA 3B1KA 2JFGA 1HSOA 4M54A 4QUKA 4UAGA 2AG8A 1DC4A 1FMCA 2HMTA 3NTQA 3NV9A 3K5PA 1ZIDA 4UUPA 5T6BA 1QYXA 3I4FA 5F21A 1KC3A 5EQDA 4BO3A 4FFRA 1DPGA 5T64A 3S55A 4OMUA 4ROSA 2ZTMA 1H93A 1UZMA 1O0SA 3ITKA 3PRJA 3FN4A 3T4XA 2BFAA 1Q0HA 2VTDA 3JQ6A 4A2CA 1QLHA 4ND2A 1PJTA 3DBHB 3OETA 3ADPA 2C59A 1PL7A 2DUWA 1P1JA 2X23A 2CUKA 3QLJA 3R6DA 4ND4A 4C4OA 2PWZA 4S1VA 1DDOA 3TPCA 2OZPA 1EZ4A 3CKYA 3IMFA 4BO4A 4R69A 2A92A 3CMMA 3WGHA 3QRWA 4TKLA 1R0KA 4EZBA 4I9UA 2RIRA 4I5DA 3WOHA 4HNGA 2NNLD 5IZ4A 4JIGA 4OHUA 2HJSA 1KEPA 2Z95A 3GG9A 3GG2A 3RC1A 3VDRA 4E0BA 4UEJA 1Q7BA 4ZQFA 1VL8A 1QV6A 3NT4A 4E2XA 4CLEA 2HMSA 2EW8A 1DHRA 3A06A 3GGPA 3H2ZA 5TT1A 1JVBA 4PVDA 3R3JA 3KEQA 3VH2A 4BO8A 3BXXA 3OHSX 1ENOA 3ZU2A 2X4GA 4AJHA 1VJTA 3AOEC 3JQCA 4KOAA 2VYVD 5AVOA 2AEMA 1HLPA 2O2YA 2UYYA 3WB9A 5LCXA 4GX1A 2C82A 4D0RA 1FDSA 5DT9A 3DZBA 3AU9A 3V5NA 2W2KB 4G81A 1L7EA 5DP1A 2W2LD 3K8ZA 4FFPA 4D3SA 4BNIA 2OFPA 3D64A 1C14A 4PG4A 2NTJA 3U62A 2OL4A 3UUWA 4DBZA 4PLVA 1WLYA 4A73A 1T2DA 4CR6A 2FZWA 1IE3A 5JCJD 4J7XA 1N5DA 2NTVA 2EHDA 3N58A 3QP9A 4Q3CA 4GX2A 3U4HA 3OIGA 1M76A 3GR6A 3LLVA 3C3XA 1EBFA 2YW9A 4WJZA 1R0SA 2C54A 3V2HA 2D4AA 5JDIC 1EDOA 1JDJA 1PR3A 4YAIA 1GUFA 2NU9A 2Y0DA 3GF4A 3RQSA 2TMDA 4D45A 3SXPA 1YOVB 3BMQA 3B6ZA 3C1OA 4GAEA 1PQUA 3RBXA 1Y8RA 3S2EA 5C7LO 1OZAA 4D7AA 4CLRA 4R41A 1ZSNA 3ICCA 1YB5A 3RUCA 2QZZA 3PHIA 3QQPA 3CXRA 4JBIA 1BXKA 3DOOA 1VPDA 4W9NC 1YJ8A 1A71A 1EK6A 3KZVA 1AHHA 2YUTA 1KVRA 1MGOA 3WJ7A 4MKRA 2GN4A 4MVJP 4DQUA 1NM5A 3WDSA 3OP4A 3IDSA 1IUKA 1EDZA 3CSDA 3TNLA 2CDAA 4TROA 1E77A 3KSUA 1RM5A 4I9NA 4NBVA 2XXBA 5F5LA 5CEEA 1H2HA 2VUUA 2O2SA 2Y68A 3RKRA 2C07A 2ZIZA 4GBJA 4MKXA 3DZJA 3ON5A 2V6MA 4TSKA 1TT7A 2HK7A 3GVIA 1JA9A 4FSHA 1P33A 5TRTA 5I7FA 4J1TA 2JFHA 4PVCA 2DTXA 1KEUA 4YAJA 1L1FA 4NH4A 3JQEA 3ZW9A 4PFJA 4UEOA 2JHGA 4J4BA 3U4CA 3VDQA 3JQ7A 4IDDA 5JAQA 5ITWA 3L6EA 1Q2XA 1HL3A 4YPOA 1GD1O 2FN7A 4N5LA 4ZD6A 2UUOA 3UKOA 3W4JA 1BMDA 1I10A 1K5HA 1B8UA 1PZFA 1SOVA 4D3DA 2YQ4A 4HFRA 4NJMA 2ZYAA 5CG1A 4CQLA 1I3NA 1A9ZA 3ZI0A 3HFGA 1UXKA 4TQGA 2AXQA 3RU7A 3DFUA 4CL8A 3FR8A 2QIOA 4MVJM 4J7CA 5G4KB 3HJAA 4BQPA 4YT4A 1DOHA 4GKVA 4YQZA 1F17A 1XSEA 3RIHA 3OIFA 4OYRA 1GZ3A 2B37A 4BO2A 3Q1LA 2G1UA 1WAMA 1B3RA 4FGWA 5CDSA 4JN6B 2Y0EA 3JQDA 3Q9UA 1HYGA 5A9TA 1EE2A 2IRWA 5ILGA 1YL7A 1U3WA 1ONPA 4KQWA 1YKFA 4DQXA 1E3JA 4XQCA 1SMKA 2P2SA 2QRJA 1N9GB 5H83A 1EVZA 4CM8B 4QXMA 1NP3A 1XA0A 4C7JA 4ALKA 5L9AA 4Y9DA 1HDGO 4FPXA 2DFDA 2RH4A 2ZTLA 4XQEA 4HFMA 1D4FA 1B7GO 3KEOA 5HBRA 2H63A 2EGGA 2RH8A 5KJ6A 3Q9NA 3ZN2A 4XQ9A 2DKNA 3V8BA 4D46A 1ENPA 2IEDA 3O8QA 1HSZA 3ANMA 5DOVA 4ESOA 3ADOA 3LC1O 3U09A 1HDZA 2Y1DA 4A7PA 3EVNA 1ISHA 1RM4A 1E6UA 3PHHA 5BSFA 1KVQA 3QV1A 2FSSA 3JQBA 1GEEA 1SCUA 5MDHA 3F3SA 2P9EA 2VHWA 3HB5X 3PWSA 3O26A 2XXJA 3C24A 4XYBA 1XEAA 1HYHA 3ZNQA 5KTKA 1E1LA 2PFGA 1NNUA 3AI3A 2YV2A 4CV0A 3OM9A 1B15A 1ONNA 5G4LA 3ULKA 4IJWA 1G0OA 1R12A 4FC7A 3RU9A 1WDKA 2X0JA 3O38A 4PLFA 2NUAA 4KUGA 3NDIA 2FHSA 4XD2A 2I5PO 1DHTA 2OUIA 4HFJA 4B7XA 5IXSA 1YQXA 3JD1A 1LDGA 3W4KA 4YBZA 3KB6A 1Y1PA 1DLIA 1PJ4A 4MDHA 5H82A 3K96A 4J90A 5K6AC 3DDNA 3Q11A 4RL6A 1HDXA 1YBMA 4NU6A 3WNVA 4BNTA 5GZ6A 1LSUA 2O4CA 2PD3A 2ZKLA 3BAZA 2AHRA 5HRUA 5COBA 4KTTE 1C1XB 2P68A 4W7HA 5A3VA 3AI2A 3NEPX 3DZIA 3ZV5A 5KIAA 2Y99A 4J9UE 3PPIA 2QHXA 3RFTA 5KJFA 3TFQA 4K28A 2D5AA 4RLHA 5G0TA 1DC6A 3QVTA 1P44A 1OMOA 4XDYA 4YT2A 3WGIA 2DPGA 2C29D 5IDQA 3D7LA 2J5QA 2NADA 2QYSA 4LN1A 1BGVA 1Y9AA 2DQ4A 4XX0A 4UREA 3FF4A 1LX6A 1PJ3A 3TN7A 3KSZO 1K6XA 4U8GA 3RBZA 2PLAA 1WXDA 3Q6IA 1K0UA 1NYTA 4WPGA 3ZZNA 4R9RA 2CY0A 3ROKA 5ER9A 2JL1A 2GZ3A 2Q46A 3GEMA 4B4UA 4Z9YA 1UP4A 3OQ1A 4UUMA 5L7YA 1F8FA 4AJ4A 4TRRA 3LT0A 2I67A 2G17A 1C0IA 5T8KC 4GLLA 3EY4A 1E6EA 2B4TO 5JYFA 5M6DA 3KO8A 1Y5MA 3R3SA 4B79A 4FB5A 4BNJA 5TGDA 5G4KA 2EP5A 1HRDA 3C8MA 1V6AA 2G76A 3NJ8A 4PG6A 2POQX 3VTZA 1FJHA 3KM0A 4DXHA 1GZ4A 3CINA 3A14A 3DZGA 2O50A 3K31A 2HCTA 4BKQA 1W4ZA 3AM3A 4PCVA 1A5ZA 4YRBA 5I7VA 2C7GA 4RPJA 3D4OA 4YJFB 3PWKA 2A9FA 5DDIP 1LA2A 3EZLA 4GX0A 4M89A 2WE7A 1H6BA 2Y05A 4BMVA 1IOLA 1YH3A 5IXYA 3BA1A 2R2GA 3TJRA 3U49A 4IS3A 1RM0A 3L4SO 3RUHA 4RF3A 4JK3A 4D3FA 4DLAA 3GVXA 1Z73A 3LDHA 4NK4A 1XHLA 4A5OA 4YAGA 3EK2A 4OH1A 5KOIA 3RASA 3OSUA 4W7IA 4CM6A 3X2FA 2VUTA 4K6FA 3PP8A 4W82A 3UXYA 1NQOA 4CM8A 4O0LA 5B4TA 2FSVA 3H8VA 5JLAA 3GZ4A 1OI7A 1YDEA 4AFNA 4YJGB 2X1HA 3IJRA 2GNAA 4BHTA 1BW9A 1C0LA 1M6HA 1JAYA 3BMOA 3N74A 4YT8A 5ENDA 1O5IA 1P1RA 3HUDA 4J6FA 4ALNA 4RO0A 2X5JO 4RF4A 3ZWOA 2DBRA 4NDNE 4FW8A 3U5TA 2GGSA 5FI5A 4TVBA 5F1OA 4RZIA 1HKUA 4YRAA 2VQ3A 2O3QA 5IZCA 1KIFA 1T4BA 5T5QA 4D44A 5C7OO 2C5AA 4YR9A 3RC7A 1TXGA 3DBVO 4JLWA 5HS4A 3I6QA 4E2YA 5KJ1A 5GZ1A 1NXQA 1PIWA 2IYPA 4NI5A 4NJMB 4D79A 1QKIA 3IP3A 1XDWA 2HLPA 2RHCA 5L7TA 1K6JA 2EEZA 1K6IA 3OH8A 3GY0A 2HRZA 2HMUA 1NVGA 3KYCB 4S3MA 2WM3A 2OBNA 2IDZA 4YEDA 4L8VA 1NTOA 3OJEA 4I08A 3KHUA 5JO0A 1WZIA 2PK3A 4IDBA 1MV8A 1GUYA 2HMVA 4ZRMA 1AGNA 2VT3A 4IINA 2GUGA 1RKXA 3KOUA 3DBLB 1P0CA 3WQRA 1FDWA 2Q49A 4R3NA 4RQUA 4W6ZA 4JQCA 3QY9A 3JD0A 4NU5A 5T8KA 3ROMA 1MG0A 3AUAA 4P22A 2ZB4A 4BKOA 3AM4A 4PIVA 3CE6A 2DUUA 2ZB3A 3QWHA 4FIZA 2W2KA 4EUHA 1DRVA 4ZVVA 2I76A 5JO9A 3KBOA 4HWKA 4I8XA 4K1LA 5T73A 4PLYA 3RAJA 1W8DA 1DXYA 1DJQA 3IQDB 4PLHA 3MTJA 4YB8A 2X7HA 3GUYA 1TI7A 1ZH8A 5CP8A 4NBUA 1WWKA 1X7GA 1DLJA 4O63O 1ZK0A 4J0FA 1PS8A 3LF1A 1M6WA 1ADFA 3Q2IA 1U3TA 5AXDA 2J8ZA 1SNYA 2ZJ0A 1CJCA 1KYQA 3ZHYA 3IJPA 3K9QO 1PJSA 2JJYA 4CLRB 1YVEI 2FOIA 3IUPA 5KJEA 4AICA 2VHZA 4UUOA 3BMQB 4L73A 1UDCA 1HE2A 2AEJA 2V6BA 4LSWA 4GH5A 2Y67A 2RAFA 4D43A 1GYRA 4L9RA 1E3SA 1DSSG 3HWRA 5I9MA 3F6YA 4ZQHA 1E7SA 4BNZA 5I8WA 3WJAA 3H3FA 1I2ZA 3CZRA 3V2UA 2PZKA 4PRLA 3COSA 2PY6A 1PX0A 3DBLA 3H9GA 2J5KA 3DBHA 4RPLA 2O3UA 3ZH2A 1A4IA 1J4AA 2NU7A 3RCBA 4FFNA 4D42A 4DBVO 2ZATA 1X14A 3NGXA 1YB1A 3ZGYA 4EDFA 2IYOA 3PIIA 1VE9A 4XGNA 1J0XO 3PK0A 3QJ5A 4BNWA 1T1RA 2YQ5A 1DBVO 1P1IA 2ZK7A 3CZMA 4YA6A 1PJ2A 4NPCA 3DR3A 4WLOA 2R6JA 1V35A 4HX5A 3ONEA 3GN2A 2CF5A 2UAGA 3PLNA 2UV8A 5CDUA 3OF2A 2Q1WA 3P7MA 1HTBA 5THQA 2OO5A 3ZWAA 4Z9XA 3ZNOA 3KYDB 4DUPA 4BGIA 4KWIA 4IXWA 3H3JA 3W1VA 3O03A 4LK3A 4YCAA 1A4UA 3B1FA 1DFIA 3IP1A 3VVCA 2XPCA 4ALIA 1I3LA 3IS3A 4PLPA 3RC2A 3NRCA 6ADHA 3INRA 4DYVA 1FXSA 4U6SA 4YACA 3P19A 2VYNA 3OBBA 4DIBA 2O3JA 1LLDA 4RVHA 4Z9FA 5TQVA 1JLLA 4WCDA 4EBFA 5FI3A 3H5NA 3KTDA 2EJWA 3SC4A 2YHIB 1E1MA 2ZQZA 1I33A 4XGKA 5TSDA 4RZHA 1P0FA 2I9PA 4DPLA 3NKLA 1O95A 4PG8A 3NAQA 4PLCA 4F45A 4OOEA 1DC5A 1NFFA 5BR7A 4WEOA 1CQIA 3DHNA 2BFMA 2RHRA 4EEZA 2GN8A 4CUJA 4QQRA 1GZ6A 1X13A 5G0SA 1EFKA 2Q22A 1UDBA 5F3RA 1NFQA 4R54A 3FR7A 1NASA 3LQFA 1GY8A 2I3GA 1E1NA 5B4UA 5BSGA 5JBIA 1QORA 2ZYGA 5ICSA 5L7WA 4AJNA 3ZHBA 1MB4A 4RQTA 4L4RA 3HG7A 2DBZA 1S6YA 4B7UA 1NQ5A 1E92A 1OC2A 4NFHA 2YY7A 4UUNA 4AJKA 5KVQA 1U7TA 1ZK2A 5JDCC 1HWYA 3H9UA 4GPD1 4XRRA 2P91A 5JAMA 4P8RA 2VWQA 3ABIA 1XKQA 5TS3A 4GSLA 3UVEA 3I4CA 4F3YA 3JQ8B 4B3HA 5EMHA 2B35A 5CAEA 3TSCA 4H16A 1R16A 2PKRA 4M1QA 4MKZA 1PU2A 3QWBA 2WTBA 2HUNA 1NPDA 1SAYA 4CMGA 4CLOA 1BG6A 2VHYA 3NUGA 4L74A 2BKAA 4ZA2A 4CMEA 1MXFA 3ENNA 5G2OA 4LISA 1Y8QA 1LRJA 5KVCA 4RGBA 2VHXA 4BNYA 1PSDA 3IAHA 2YV1A 3CTMA 2HO5A 4PLZA 1GADO 3FWNA 1C1DA 3EVTA 4B4WA 2WSBA 4EJ6A 5MGBA 3BMCA 1DB3A 4BGEA 5A9RA 4P4NA 1QMGA 5JE8A 1QLJA 1GQQA 3OQ6A 3ORFA 4ZHSA 1C1DB 2J5RA 2C2XA 4M8SA 5K9ZA 5AOVA 1YO6A 1C1XA 4U5QA 3D1LA 4JJIA 3ZWNA 1JTVA 4BO9A 4AJPA 4QO7A 4A27A 2BI8A 5A5EA 3BTVA 3E5RA 3AUSA 4NQZA 4AG3A 1I2CA 4DIFA 4IPTA 2V6GA 1JWAB 3FCOA 3GNSA 4YJHB 1LJ8A 2BFOA 2Q4EA 3H4VA 1H2BA 3TRIA 4BL5A 1Z74A 1VL6A 4A0SA 1PR9A 4BNXA 1E7QA 4TZTA 4DWVA 1GEGA 3HNPA 4MINA 5ES3A 1M66A 5J23A 3NT5A 2CDCA 4IGFA 4PZCA 4U0KA 4XDZA 1GAEO 2O3TA 2QRLA 3P2OA 3C1AA 4DQVA 4XQGA 5JFOA 3MJEA 5JMPA 4BVAA 4WCFB 3HDYA 9LDBA 3MWDB 1CERA 2IZZA 4M49A 3H9EO 4XA8A 3ZU4A 4J1NA 1I3MA 4MP8A 4QO8A 3HE3A 1E7MA 1RM3A 1NPYA 1LU9A 1XGKA 3GAZA 3JQ7B 1O8CA 1T25A 3D4NA 2O3RA 3SJ7A 1NHWA 3TF5A 4RVDA 1W73A 4XJSA 1MFZA 1U2GA 5KCZA 2NTNA 3FHLA 3W4IA 4FBGA 4MP6A 3VH1A 4CR7A 1XQ1A 3TDKA 1JWBB 3BMNB 1B0AA 1MG5A 2O3SA 1E3LA 4Y6PA 5EJ2A 3E5MA 4FJ1A 1BXGA 1I32A 4PG7A 1B14A 2AA3A 4RLSA 3BTOA 2IXBA 5BNFA 2NVUB 4BNLA 2OP1A 2VRCD 1V3UA 2D1YA 3FNHA 4U0JA 2D59A 1YRLA 4IJKA 3EC7A 4FN4A 3DQPA 4Y6RA 2WDZA 4DL9A 5DBGA 1E0DA 1PZHA 2FP4A 2PGDA 1Z75A 1EEHA 1X1EA 3GHHA 4CPDA 1WVGA 3PJDA 3Q2KA 3ZWPA 1I5RA 4QX6A 3VPXA 1LI4A 3GH3A 4CM7A 4E5YA 1ZJYA 4P4GA 3ZV4A 5JYEA 3JYNA 4JJGA 5L4LA 1F0YA 1K3TA 3UF0A 4L4SA 4QECA 3VZQA 4CM3A 3K73O 2SCUA 1WDMA 3LC7O 2B36A 2DC1A 2EW2A 3RROA 2DAPA 3PQEA 4E31A 5DOZA 4QT0A 2NQ8A 1UDAA 2VCYA 5U1PA 3C85A 3MEQA 3S2FA 1N1GA 3WYBA 1YOVA 4J2HA 3X2EA 1X15A 1Q1NA 2J3KA 4DGSA 2A4KA 1GFSA 1BVUA 2BGKA 2WD7A 2JD2A 1QV7A 4CLHA 4D41A 2O7QA 4XZ3A 3OMLA 4JX8A 3WXBA 2ZCVA 2X6TA 3HB4X 3CIFA 4JGBA 4GMFA 4BO6A 3OJOA 3IUSA 2VYND 4WUVA 1LDBA 5A03A 2AE2A 4WLUA 5BSEA 4JP3A 3OFSA 2EXXA 2JCVA 2HU2A 1ORRA 1GV0A 1ZJZA 4Q3AA 4WGGA 1KC1A 1KS9A 5THKA 5A5FA 2P9GA 7MDHA 4UVEA 3F4BA 2Y66A 2Q2VA 3GEGA 1C0PA 1ULUA 3F9IA 1EE9A 1X7HA 3KVOA 1GCOA 1XELA 3H9QA 2EKLA 2F1KA 4KDFA 5L51A 4RCVA 1RYEA 1NR1A 4U6QA 1B26A 1F14A 5JS6A 3GNQA 1ML3A 3QVXA 5AYVA 1QSGA 3ZHXA 4HUJA 2IXAA 1F12A 4NFSA 3PHJA 4FCCA 1PJCA 5ADHA 4L4XA 1DC3A 1EUCA 3LT2A 1LSSA 2ET6A 1LLCA 1LC0A 1NQTA 3I23A 1LLUA 3FSRA 4IIUA 3WX0A 4EJ0A 3GT0A 2Y1CA 4Z0PA 1LLQA 3OA0A 3AUUA 3EMKA 2GD1O 2D0IA 4BUCA 2PA3A 1H6AA 1I36A 4Q9NA 3F1LA 1HE3A 2I66A 3HN7A 3PZRA 2V65A 4BB6A 5A02A 1CETA 2FR1A 8ADHA 3MOGA 2GZ1A 3JQFC 5BT9A 4B4OA 5K0ZA 1ZXLA 3QSGA 3DEYX 1IZ9A 4OXKA 2AQKA 3I9LA 1MFPA 3TZKA 2PKQP 3HZZA 3RVDA 3NYWA 3ASUA 4HXYA 1UH5A 3PFWO 1R4NB 2VTEA 2BF7A 2Q2QA 4RF2A 5IDXA 3JQFA 1WNTA 3D3WA 3L6OO 4TRMA 1PWZA 1OBFO 3ZWVA 1P45A 1Y9EA 4HKTA 4UEKA 1T1SA 2PTGA 4NBRA 3M2TA 1TB4A 3GDFA 1MA0A 4FJ2A 1E5LA 1X0XA 2R00C 3KYCA 5HTOA 4URFA 5IN5A 4RVSA 3FNGA 2NVBA 3ASVA 1E7RA 2R00A 3F5SA 3EHEA 3UW3A 1E1KA 5F1KA 2Q99A 4R51A 4LVUA 1R0LA 1AUPA 1ISIA 5COAA 1P9LA 4DMMA 4CV3A 3E1KA 2X8LA 2GDZA 2YDXA 3GVCA 5KWEA 4Q3DA 4Y67A 1JW9B 5DCWA 3PXXA 1ZVMA 1DJNA 2GF2A 1U7HA 1T2EA 1VKNA 2PZJA 4E5MA 1Z7EA 3T7EA 1ZW1A 4IY1A 4I5EA 3E82A 3RJ9A 2OBYA 4BO7A 3F1KA 4CMCA 5L45A 3JQGA 5KVSA 4CR8A 1NWCA 4UVIA 3W6UA 4E3ZA 1BW9B 2FY8A 3OIDA 3LC2O 4YJGA 1OC4A 1JQBA 3BHMA 4GI2A 3A4VA 1ZO8A 2WD7B 5CPBA 4WEQA 2VRBA 2AG5A 1PS9A 4NMHA 1ZXBA 4RORA 3L6DA 1VSVA 5B4VA 2EIHA 3PQFA 4CMHA 1HETA 4XIYA 4E33A 5IJZA 5GY7A 3JD4A 2BMAA 1U2DA 3ROPA 4K26A 1E3WB 4E4YA 1D1TA 2YJZA 4GSKA 2JAPA 1P31A 1UXGA 3MWEB 1EVJA 3AUTA 3TL2A 3GQVA 2TMGA 5JY6A 4YDRA 1QG6A 5HM8A 1J5PA 4RDIA 1T24A 5A4DA 4FDAA 4MJLA 5JDIA 4J9VA 2BRUA 1ISFA 2CMDA 2W8ZA 5HS6A 3WTCA 4EUEA 1T2CA 1GQYA 2VZ9A 2X5KO 3EW7A 4E2ZA 1DIRA 1HDOA 4Z3DA 2BH9A 2Z5LA 3E03A 5F5NA 4ILKA 4N5MA 4IDGA 4OQZA 2CF6A 4LCJA 4FFMA 2EF1A 4E5NA 5EL0A 1ZSVA 3O9ZA 2XF8A 1DFGA 3VPSA 3GC6A 3DBRB 3GGGA 3L77A 1VI2A 3FBGA 2ZB7A 4KTVE 4PRKA 5TT0A 4O59O 3DB2A 4CMIB 3FTNA 3UGKA 2A35A 3DHEA 3D4PA 3INGA 2H5LA 2H9IA 3NX4A 1GYPA 1T2AA 2PR2A 3PTZA 1O6ZA 4KQXA 3DO5A 1YJQA 3AM5A 4HY3A 1BXZA 4J3FA 4OKNA 5G0UA 3I9KA 5GMOA 1L7DA 3G3EA 4G2NA 3ONDA 5T67A 5CHEA 2HQ1A 3NJ4A 1ARZA 3E9NA 4IDCA 1OAAA 2NVWA 3K30A 4WLNA 4WCFA 1GTMA 2WYWA 3GMDA 2HDHA 1M2WA 2P4HX 3TWOA 4CV2A 3ANNA 5AXAA 5DF1A 3AJRA 3QWFA 1GDHA 2X9NA 3PDUA 4ZQBA 1M75A 3NDRA 2D2IA 1SBYA 1I24A 1R4MA 4MVJE 1PGPA 3WNQA 3WS7A 2X0IA 3ZWCA 3DAFA 4HFNA 1HE4A 4WK6A 4IZIA 1HDCA 2E37A 1I0ZA 1I2BA 3MTGA 3EDMA 4N5NA 3NDJA 4EI2A 1R4MB 2OXIA 4JROA 4CM4B 5IAAA 5IDWA 1B2LA 1MXHA 3HDHA 3ROQA 3JTMA 3U3XA 1W6UA 2OP0A 4BB5A 2EKQA 4R68A 3U9LA 5EQFA 1J6UA 2PD6A 1LUAA 2CDBA 1U9JA 5F1PA 5BQFA 3EGOA 4XB1A 3LYLA 4CJXA 4DC1A 4K9DA 3DZHA 4FOSA 3PYLA 1NAIA 2EERA 1EQ2A 2PD4A 3UCXA 4AJOA 2ZB8A 1H6DA 5TJHA 1ZSYA 4B8ZA 4RPKA 4CMJA 4QFCA 1A72A 1YL5A 2GLXA 1LRKA 4HNHA 5A3JA 1DFHA 4CLOB 3LU1A 2P9CA 1DIHA 1C0KA 1U3UA 1IB6A 4IMRA 3MOIA 3SLKA 3A9WA 1XCBA 1YBVA 3W6ZA 1TT5B 3OJLA 1X0VA 2E48A 2DFVA 5H81A 3V1YA 1HDRA 2P5UA 4CQMA 3S2GA 1O89A 3ZDFA 5FWNA 1TA4A 1U4SA 1WW8A 3GHYA 1ZK3A 4NK5A 3DMTC 3FD8A 2GO1A 1YB4A 2NACA 3DMYA 3RJ5A 2YFQA 3AFNA 4CM4A 5DP2A 5DZSA 2OORA 1U3VA 2FR0A 1LRLA 3UHAA 5AQ1A 1KY5A 2E4AA 2OGUA 1D7OA 5ITVA 2AEFA 5EPOA 1CQJA 1D8AA 4FJ0A 4CM5A 4ND5A 2WE8A 3AFMA 4EGFA 4F6LA 3PEFA 1KETA 4OXYA 3QE3A 1DAOA 2I3AA 3OEYA 3DTTA 3ZV3A 4JXKA 4WCFC 1V3TA 4L75A 1A7AA 3OJ0A 5KKCA 2VWGA 3WFJA 1LQUA 2B5WA 5JMWA 2Z1NA 1U1IA 1B16A 1MLDA 4KUEA 5TJ9A 4NHEA 3UICA 1KERA 4P38A 4CLDA 1TVEA 5EERA 1IY8A 4TRNA 2Q4BA 1EVYA 3BYZA 4MP3A 4OL9A 2G82A 2HRBA 5JSFA 4CMBA 2YHIA 2WEKA 3FPCA 4CM9A 1EK5A 3UFXA 3C7DB 1DIBA 5J9GA 3V1UA 2V6FA 3WG9A 1J49A 3JQGB 3WGYA 3GRPA 3PWZA 3GRKA 2D8AA 4BS9A 2DU8A 2PH5A 2EV9A 2CD9A 3IKVA 2Y1EA 1MUUA 3INTA 3I5MA 4BO1A 3D3EA 5B37A 1UXJA 5IN4A 1O94A 1VSUA 4IIVA 1V8BA 2VUSA 1S7CA 4BNFA 3RUFA 4MVJD 4CV1A 1CRWG 1EBUA 3FPLA 1VKOA 1CDOA 1UXHA 1YGYA 1P77A 3PVZA 1IZ0A 4J16A 5TF4A 4E12A 5EN4A 1YS4A 1IL0A 2B69A 3I9NA 5JPIA 5COQA 3Q3CA 4XCVA 3ZV6A 1YDWA 2HKIA 4TZKA 4EYEA 5JAIA 4NG5A 2VRCA 5CDTA 1GQ2A 3C1TA 1CWUA 4Q3EA 3ZNNA 4B8WA 1GL3A 2I99A 4HBGA 2FPPA 2UUPA 4PLTA 4NFYA 4PG5A 2JKVA 5CPFA 3RI3A 3AI1A 3HHPA 5IG2A 2LDXA 1SC6A 3BHJA 4BNNA 1R37A 4KUHA 2DM6A 4Y8VA 2CVOA 1IHYA 1LTHR 3VH4A 4ZGWA 2G5CA 1C3VA 1Y8RB 5ILOA 2X9GA 2VT2A 3SX2A 4YYZA 5ICMA 4ZQEA 3JQ9A 5B1YA 1FDUA 2QZ9A 5IFLA 3PQDA 5DCUA 2WMDA 4LMRA 2J3HA 3FI9A 1UZLA 4X54A 4G65A 3ZWBA 3EZYA 3KLPX 1P1HA 3TZHA 1ZK4A 3G0OA 3D5TA 1FF9A 3PHGA 1RPNA 2FWMX 3LZ6A 2VZ8A 3WLFA 2GN9A 4R1TA 1E3EA 3UN1A 2EWMA 1U5CA 2H1SA 3HSKA 3KRTA 1LC3A 1LDMA 2BGMA 5CEJA 1V3VA 5I8ZA 3AOGA 3ETGA 4FC6A 4GQAA 1DO8A 2GERA 2Q1SA 4KMSA 4H7PA 4MVJA 1HZZA 4J4HA 5BNTA 1ENZA 1P3DA 3GN1A 1FDTA 1IYZA 3I3OA 1SO8A 4J7UA 3ZW8A 3JQAD 2EJVA 3DONA 4DLLA 1HZJA 2JCYA 3GVHA 4BQRA 4WOKA 4J91A 5B12A 2BLLA 2HMWA 5LC1A 5A06A 5U4QA 1PS0A 3A1NA 3ZU3A 1EVIA 1ADBA 1T26A 1ZBQA 4E13A 4IM7A 1JKIA 4J4TA 5A9SB 2Q50A 3LF2A 4XGIA 2HAEA 3RUIA 1FDVA 1BHSA 2X22A 3SEFA 3RKUA 1Q0QA 3PIDA 4M86A 2I6TA 4B3IA 5G0WA 3SJUA 1SEPA 2FZEA 3H65A 3KV3O 4XB2A 3CH6A 1ZEMA 3DMTA 1R4NA 2B4QA 3ONFA 1G0NA 4R3WA 3LVFO 4LCEA 4TWRA 2BELA 4MVJH 1YWGO 3KSDO 1WP4A 4KDEA 5CDGA 5L4SA 1KVSA 4LW8A 5KVVA 1BDBA 3M1LA 3BIOA 4INAA 1AE1A 1QR6A 2X86A 2FPGA 2WJPA 3I52A 3GK3A 1YBAA 4FFOA 4BV9A 2EGHA 2NWQA 3MCVA 4BKPA 3DOJA 3GVPA 4OOFA 4XR9A 4Q39A 4RDHA 2C2YA 2GPTA 1HXHA 2JFFA 4TKMA 4DYDA 2JHFA 2CFCA 3H9JA 3VPFA 3VZRA 4TVOA 1GV1A 3IKTA 3WTBA 3WR5A 3I6IA 1LDEA 2XAAA 3WMXA 4OSOA 1H6CA 2OOSA 2DBVO 3E9QA 2DVMA 3ZWWA 5K6AA 1NVTA 3U4IA 4OM8A 5T57A 3JSAA 4GLOA 5CDYA 1XU9A 3KUXA 4Z0HO 2O7SA 3SLGA 4ALJA 4CM1A 4CQMD 4A26A 1UAGA 2C7VA 3NT2A 2HJRA 3EAGA 1H9AA 3WIEA 4CMEC 4Z3KA 3ETEA 2OHXA 1PTJA 1BVRA 2W90A 1G6KA 2NVUA 1TT5A 3KXDA 3FRJA 3HQ4O 2QRKA 3F46A 3VPHA 5FYDA 4B3JA 4JP2A 2AQHA 3WYCA 4J43A 3P2YA 5DULA 1ZMTA 1LXCA 1AHIA 2H6EA 4WECA 3VPGA 3G49A 4PLGA 2VWHA 1LEHA 4RPGA 2EG9A 3U0BA 4ZU3A 2GZ2A 5JC8A 4HP8A 1WPQA 3SVTA 2VOEA 4LMPA 3ETDA 2PNFA 2NQTA 2B5VA 1KBZA 4JBHA 3LT1A 2Q1UA 3ZCXA 2ILTA 4TMFA 2IODA 4J1SA 1N1EA 3I9OA 3D5QA 2HK8A 2A94A 2G0TA 4LRTB 3TQHA 2E6UX 3AU8A 4GVXA 1P1FA 2BFPA 4YQYA 1ID1A 1RJWA 3LSYA 1HYEA 1XYGA 4NZ9A 4R01A 4TRJA 4DREA 1JN0A 1N2SA 1U5AA 1ZUD1 4IQGA 2NV6A 4PGFA 4XEHA 4AL4A 4Y98A 5C3MA 1ZK1A 1Y6JA 1GUZA 2BI7A 5LDHA 1AN9A 4FR5A 2PZMA 3NGLA 5JCXA 5JAZA 4C7KA 1PJBA 3PYXA 2LDBA 2HSDA 2DLDA 2GR9A 1Y7TA 1U8XX 3VKUA 4I9HA 1CYDA 5JYDA 3OJFA 2PGJA 1KY4A 5ENVA 5JCJA 3DAPA 3RD5A 1DIAA 3ANLA 4KWHA 5I7EA 1NQAO 3GOHA 4CQMB 5KNLA 3V1TC 1JAXA 1ZFNA 3KETA 1KOLA 1X7DA 3WIDA 1E7YA 4GKBA 4P4LA 5CFZA 2PKQO 2C5EA 3QHAA 4UVHA 1H0KA 4RVUA 1XLTA 4NBWA 1VC2A 5LDGA 2NU6A 4NIMA 4XJTA 3SC6A 1A7KA 1MP0A 1NX6A 4AVYA 4FS3A 4U7WA 1BRMA 4BNVA 1MX3A 2WWRA 3QIVA 2ZCUA 2NLOA 5TC4A 5IDYA 3GPIA 3UCEA 4NR0A 2CSUA 5JYAA 1KEWA 3QA9A 1T2FA 4H3VA 2W4QA 2VYVA 5C7IO 4IXTA 3GGOA 1UAYA 3VKVA 1DRUA 1M67A 4O1MA 1LSJA 1UUFA 3T4EA 4UVGA 3K92A 3B20A 4ND1A 2Y1FA 3LK7A 1PGJA 3FNEA 2PGLA 3L4BA 5A1TA 4N7RA 4BNMA 4R9SA 3JQ8A 3AK4A 1QYCA 4CUKA 1Z7BA 1K89A 2VNAA 3HADA 3CUKA 2NM0A 4MIYA 2GASA 4WOJA 1BTOA 1EUDA 2RBEA 4IUYA 2X58A 4WLEA 4WKGA 3T7CA 1R6DA 3W8FA 3RUAA 2EKPA 2IZ1A 4XYMA 4YJHA 5JDCA 3NTRA 1K2WA 2Y1GA 2DTEA 4ITUA 4K6CA 4WLVA 4ALMA 1UP7A 3DHYA 3L07A 1F8GA 1X1TA 1LBEA 1XQ6A 5TNXA 1GU7A 4OSPA 3O8QB 3LT4A 4F46A 3PI7A 1EFLA 3H7AA 1IPEA 3Q0EA 3V2GA 1NHGA 4IDEA 2Y1OA 1ADCA 1R66A 3HFSA 1MC4A 2VOJA 1ENYA 1MC5A 4LGVA 1QXSA 3L9WA 3O4RA 4RV9A 5I9LA 5JNLA 3GMSA 1E6WA 2Q45A 4NBTA 3F4LA 1Q7CA 4IQ0A 3WYEA 2VZ0A 4OIMA 1F06A 1N9GA 5GZ3A 1Z45A 3TOXA 5L95A 4QSMA 4YRDA 4YT5A 3SBOA 1E3IA 3QVOA 5L3ZA 3GZNA 4R1UA 5FF9A 1GCUA 3FTPA 4BNKA 1Y8QB 7ADHA 5AXBA 3WBFA 1V0JA 4B7CA 3I9MA 3QVWA 4CMIA 1CF2O 1IULA 1WZEA 3K2BA 2X0NA 3E8XA 4BMNA 4YAEA 3W8DA 2CVZA 2BHLA 1PGQA 3MJSA 4BNHA 3MZ0A 4ID9A 1ONOA 3OECA 3QWIA 3KYDA 4XRGA 3DZFA 2BD0A 4IGEA 4CQLB 3DFZA 4RPHA 2O48X 5AXCA 1BWSA 3WGQA 4CODB 2J6IA 3G79A 4XYEA 3ITDA 3S2IA 5DNAA 2IE0A 3IL2A 4KZPA 2HK9A 4MVJF 3U4DA 1XIVA 4QEDA 4DTIA 1ZCJA 3ZWYA 4W99A 3VVBA 3AY3A 3RBVA 3FNFA 3C7AA 1PZEA 5L4NA 4MIEA 3DZKA 1SEVA 2F00A 3PJFA 4OO3A 3WGTA 3RUDA 4KP7A 2D5CA 2PH3A
chains in the Genus database with same CATH superfamily
1CULC 3QWAA 4P3OA 1BSVA 2YMPA 5E2AA 3N0RA 3SEAA 3I8OA 2C2HA 1JG6A 3HJCA 1CEQA 1Y3IA 4C0WA 3UXHA 4F4FA 5HPYB 3JAMA 2JLYA 3G2JA 1DARA 3FFAA 3HLTA 3IPAA 4UAJA 1B8PA 2P7HA 1UFQA 2JHAA 5HBGA 1HEUA 3TCKA 4J0IA 3A6EA 4Q9AA 3V00A 2WFAA 1P3Y1 1XZLA 2FPGB 4JI6B 1JTFA 4O8JA 5IU6A 1BDIA 3IT1A 1ZOOA 4GWGA 3IUNA 1M6YA 2YV4A 3UATA 3NW9A 2AUNA 4ERXA 2O8DA 2C9BA 3VMFA 4BGVA 3GGJA 4RJTA 4XSGA 1WTCA 3CUYA 3RK4A 3WGZA 5IYZF 4FXPA 3JX9A 4BTEA 3WKAA 1ZZGA 3HJUA 4J75A 1ZH4A 1G1AA 1NTRA 3LLSA 4JR2A 2C0CA 1Y3CE 3LQ4A 4H35A 2QVLA 3PLRA 4WLFA 2GD0A 2B1IA 4IS2A 1U2SA 5FJJA 5JATA 1UZNA 2G7MC 5DHFA 3WSWA 1AKEA 5IF9A 1N25A 3IIEA 4PTYA 3T0FA 2FMUA 2QTZA 1OZHA 1UT5A 2WYIA 4HEA1 2FMIA 4Y2RA 4UUBA 1XZHA 4HYYA 1TUIA 4ARBA 4C4PA 4RVNA 4XM0A 1XWFA 4OYHA 3AZOA 2ATEA 3BSWA 5A9SA 2JGMA 1PJQA 1RXEA 2WJVA 3KFVA 1DQZA 2YYAA 2FSGA 1EFVA 3QMPA 5LQNA 3CX7A 1U28A 1AG9A 5KJCA 2QPLA 5CLJA 1WJGA 2IYAA 4MMXB 4Y6SA 4EHLA 5JJ5A 4GM4A 2OQIA 3EA5A 1AXEA 2IHVA 4YRTA 4L6AA 4B2PA 1IJKA 3CEAA 4CKEB 4DN6A 2XUGA 3OKPA 5DHPA 5ELMA 5HF8A 4RY8A 5J58A 3RYHB 5TMEA 1AQUA 4PIMA 1AO0A 4OQYA 2VJPA 2I9KA 4NMMA 2X0RA 4M7OA 1JHDA 5JC1A 3VYUB 1I5OA 4DVJA 1Z2CA 5BVHB 1BX3A 2YWRA 2PMWB 3JAKA 1L8XA 4ZJZA 4KHPB 3AEYA 1BMQA 4PV7A 4RPCA 1N2IA 1RYDA 1J0BA 4MLCA 1JDBB 1E5TA 3OJWA 3UAXA 3NH9A 5SZHB 1UAAA 1S1MA 1VCOA 3AB3A 4GZ6A 1WE2A 5EP3A 3TJMA 3MIIA 2KBEA 2FFHA 1VRWA 4C6SA 2QTVA 3C7CB 2FNAA 1E5DA 2LCIA 3TE6A 2VL7A 3IBGA 1JJAA 1RYNA 1ULSA 3P96A 3PPXA 3TBHA 1XCMA 2OBFA 1A0OA 3AVUA 3GJ3A 2VWPA 3FW1A 1OH5A 4IQ8A 1QAQA 3ORYA 3E6AA 621PA 4F1WA 5EMKA 1MAWA 3O7MA 5EJ7A 4OQLA 3Q40A 1LK0A 4KXMA 4K9KA 1J06A 1E3MA 3RE1A 5EEGA 1DRKA 1CD5A 3C5HA 3CRQA 3G5LA 3T0GA 4N54A 1Z4MA 2FG7C 2ZVJA 3KJXA 4WNCA 3ZI7A 4BVGA 1JF8A 2YWEA 1N4DA 1H1TA 1CBUA 1S3SA 1I6MA 4H6WA 4MUGA 2IYYA 2Z9BA 3JD2A 4D9KA 4X62B 4EEXA 3WICA 2Q0XA 3W8RA 3IPRA 1IHXA 4LRSB 1I01A 3LXUX 2E49A 3DMHA 1HLDA 3J81A 4DPMA 1KQFA 2FX2A 3BCRA 1XF9A 3QMWA 5IC6A 4YXFA 1L5RA 3WLEA 4M55A 4EI9A 4KVFA 1SA0A 1A27A 1EEXB 1W9HA 4I5GA 4LCBA 3WHKA 3KALA 1WPGA 5I45A 4NLLA 3SQNA 4YMSA 4LY6A 5EJ9A 3C4JA 1Q3HA 1X8JA 1KJQA 1D6MA 1IEVA 4WE3A 1DEKA 1HQDA 1L7MA 5E4YA 4BCBA 1ESCA 2NYUA 3EJWA 3RUPA 5FLKA 3ZJYA 3GIWA 3IP5A 3UW1A 1LFDB 3P5SA 1TMOA 1XCPA 3I72A 2VHUA 3BD7A 4M87A 4X71A 4KR7A 2QT1A 5C46F 1ZR2A 5AI9A 3O2NA 3UOGA 4RH1A 4ZMRA 4II3A 1NW6A 4M1KA 3V8PA 4G4IA 4B9EA 2HXYA 1P3JA 3TX6A 3JVEA 2O23A 4FFLA 4ENVA 1K8ZB 1XDDA 2OCGA 4R1OA 2R79A 4P7GA 3P26A 2ZI6A 3U80A 3O75A 1MZVA 1Z08A 2QX9A 3DYVA 1JS1X 3I83A 2EP7A 2P9TA 1PBNA 3UJDA 1RC8A 3E8MA 8LDHA 5F35A 3PYMA 4K9PA 5TIIA 3VH3A 3JYPA 5G02A 5C34B 4Q4HB 1OIVA 1VHQA 2GK7A 4I50F 1QYVA 5D8DA 1MEJA 3MMXA 4Q48A 5L3QB 2GN2A 2C20A 2AOUA 2Z09A 1VM6A 1SHUX 2EKBA 2RAPA 1H94A 2V7UA 4U2FA 4OJQA 3CVWA 2RHWA 3H2HA 5CX1A 4L76A 1VTKA 1XHFA 3RSHA 1JFFA 4F56A 1OGIA 2I65A 2M6RA 2A1UA 2V5UA 2JLRA 4DPKA 1VJ1A 2Q3EA 1KZ6A 3AWDA 4QFBA 3O73A 2YOGA 4D8VA 8OHMA 4BO0A 2FSUA 4V39A 1AOXA 3A1CA 3A11A 2Q1TA 5FPSA 4B84A 2QXYA 1I51A 1O9BA 1SQ5A 1UOEA 1YDFA 4RMNA 1Q83A 5AT1A 1PGOA 1BH2A 4LC1A 4UHFA 5IKMA 1MB9A 3UCFA 1G41A 1NPTO 3HKBA 2V8BA 2BVNA 2NW6A 2O2ZA 3EB9A 2A67A 4HTFB 3TM4A 1DQNA 3F9CA 2JVKA 1Y7HA 4CNBA 1LDNA 4Z4HA 1KZ7B 3BDIA 4OK5A 4PWZA 5EKUA 2CK3A 1C1YA 4JEIA 5FQNA 3SI7A 2IXFA 4ITVA 4XUDA 3VX4A 1OX6A 3W5AA 4JELA 4U7HA 1SVLA 1YE8A 5HZGA 2NYRA 3JQAA 1ISMA 4F91B 3B70A 5TVOB 3DR5A 3GEDA 4BLVA 4V1CA 2J0EA 3FMVA 2YXPX 4NAHA 1OA0A 3ZK9A 5IJ9B 3T1QA 3IPYA 1VL1A 2DQYA 3N7UA 1VIVA 2VPYA 4TLBA 3V8RA 4V24A 4YBRA 1CUDA 4YLGA 5DEIA 3L40A 3D6AA 1X7ZA 5DBFA 2FW1A 3EPPA 1YL6A 3WGKA 4BP8A 5AVUA 3WGGA 1TAHA 4GX5A 1KFJB 1JKJA 1WS6A 3OD5A 1KYTA 2ZZMA 1EMDA 2INGX 3G9TA 3M89A 2ZRMA 4CDRA 3EIOA 5HZMA 1RBMA 4KQCA 2JIOA 5GM2A 1DAGA 1N7HA 1PZMA 4AQDA 4JI0B 2V7BA 1KO8A 4BIMA 1NVUQ 3R76A 3BHIA 1F4PA 2GN6A 2YHUA 5AJHA 1RLIA 3HUEA 4I55F 2EW1A 1GZ5A 2YIJA 1T9DA 1LNQA 4Q4JB 1GILA 3CISA 3NPMA 2ISQA 5EXPA 5CT9A 5HG0A 3U48A 5AW9A 3PFFA 5IC4A 2QUAA 3E18A 3WB0A 2OXTA 2KQUA 3ZWXA 2PFKA 5ANRB 3WI7A 4U7JA 2J3IA 1N5IA 5HE8A 5BN4B 3TK1A 4YFVA 1A9RA 4A10A 2CNBA 2ZS7A 4KE9A 2FPIA 4LYDA 4QUAA 3CNNA 4BVBA 4BQEA 4EITA 2PXCA 3DFKA 5D5HA 5AIAA 1HM5A 1JZSA 2SECE 1JPNA 1MO5A 4OKIA 1XMSA 4PQFA 4CL3A 2CJYA 2XMCA 4BWYA 1YKGA 2ARKA 2IYLD 5CLQA 1UXIA 2NZXA 5CA0F 5BQOA 1RMTA 1Y8CA 3GUCA 1JFLA 5CB4A 3CB4A 4X63A 4OA5A 2Z2IA 1IMJA 1Z34A 4WXYB 2DBQA 4EFMA 1KE2A 1ODIA 1EP2B 4BNUA 1THZA 4G41A 2JCGA 5LQJA 1ZH6A 4W5JA 4TTRA 5C81A 3WISA 2VKTA 1CUIA 4YO8A 4OJTA 3TE7A 4AS2A 1XRJA 2DTDA 1VCNA 2OO5C 1G9XA 4NCXA 1DAPA 3AW9A 5TV2A 3EVGA 4OPMA 1Z6QA 4R2WA 1NAHA 5EGSA 1KZHA 4RABA 1NWHA 5EGNA 2B4AA 4HAXA 5G3YA 3GI1A 4QBGB 3M5PA 1JIUA 3QU5A 3UMMA 2QMEA 4ZI5A 2CMFA 1J2EA 1T29A 4A8JB 3R4CA 5KNDA 2QN3A 1EKXA 2P3LA 2XKBA 4DG8A 3M2PA 1S2GA 1NY6A 3VOSA 3TLJA 4BFUA 3MCWA 1ZC4A 2ZE6A 1Y5RA 3OZ7A 1I6LA 5EESA 1QMPA 2GCOA 2P40A 3PNLA 4JVMA 4YHBA 3U6BA 1WLSA 1R15A 1KHHA 1RE0A 4FI3F 2Q5OA 2QGZA 1NBOA 1XD2A 3BWYA 4QTXA 5J2TA 1H9BA 3K16A 5DNYB 3LDGA 3C3MA 4OXXA 4GVLA 1S89A 1YZGA 2P6PA 2RHMA 3G68A 3GUHA 4XCQA 4TMXA 3V8MA 4N41A 1D4ZA 4O33A 3G9XA 4MS4A 5LSAA 3CWZA 3JV7A 3KJQA 3OPMA 3P0HA 5BSTA 3FOZA 1UIRA 1XWIA 1DXQA 2ZI5A 3AY6A 3OSZA 1TKAA 3EISA 1O97D 4QUKA 4BUZA 1O5OA 1OWOA 1PUXA 2AG8A 3RQIA 3RTCA 1T0BA 1DC4A 1F4VA 4ZK6A 3PWTA 3NTQA 3NV9A 2B21A 5ADWA 5F7JA 1XRMA 3AEZA 1FZTA 2HCFA 3N07A 1L7XA 4Q19A 3K0AA 3H05A 1KC3A 4ZVQA 5HXAA 1Y7LA 3MN1A 2FVYA 4N12A 3CCBA 4FFRA 1DPGA 4BO3A 1GO2A 4KIUA 3S55A 3QKTA 1FFSA 4H3SA 2XDWA 2VXCA 3U3ZA 5CFPA 1QGED 1JAZA 2WIJA 1ZH0A 5CMLA 4PHTA 1SURA 1UZMA 5LU8A 1O0SA 1R4AA 1UBCA 3STUA 2RARA 3VYVA 3JQ6A 2XBMA 3MTEA 4Q9JA 1UBKS 1TL7C 2H0QA 3DBHB 3OETA 4M1TA 1J9ZA 3DLIA 2GRJA 3OIWA 1RMYA 2C59A 2XE4A 5ILQA 3LV8A 5TEWA 4ZV4A 1Z5UA 1GNLA 1SG9A 3HDGA 3ZK7A 3BKWA 5E0KB 5DLYA 4DVGA 4C4OA 3K32A 5J4LA 1MO6A 1U7XA 4G0VA 3O8BA 2ZITA 3O74A 4YRKA 6NULA 4MGKR 1COWD 2WD9A 4P36A 4R69A 2A92A 3CMMA 2XCRB 3QRWA 4MXDA 5CTAA 4EZBA 2JJQA 2QJRA 2YJTD 4ZU1X 2Y27A 4JIGA 4AB1A 3P2MA 2HJSA 1KEPA 2Z95A 4WNAB 4XLLA 4HQFA 1L5QA 1KYZA 1DOAA 1T36B 2C58A 1K6EA 4TXHA 3NT4A 3IUMA 3QSYA 4LJAA 2EW8A 1HFWA 2IYEA 5TT1A 3HCCA 3M49A 1CJVC 1ECPA 1J7KA 3D0QA 4BQFA 4BO8A 3BXXA 1YNOA 2EX1A 2CNWD 2O1WA 3FDZA 1GNSA 3MRTA 5BR1A 1M34B 3W7VA 3TW8A 4KHZA 4KOAA 1K06A 2VYVD 2ADOA 4WFQA 4ENTA 1YUBA 5BQ3A 4DSUA 4MA5A 1KFBB 2M6LA 3WK5A 2FQYA 1EWTA 1W76A 4MI1A 5HFNA 4MMYB 5K3BA 4R7TA 2W2KB 4ZCTA 4IIJF 5FYQA 4BNIA 1WCYA 4O4IF 3WYAA 3V7NA 4RTJA 3GD7A 3OLYA 3KOZA 1WUKS 2EFYA 3DEIA 3GLVA 3LYUA 4GBED 3U62A 3UUWA 2SHKA 4CCYB 4JZKA 1WLYA 5LQRA 3GCZA 4KX3A 3IHWA 5E3IA 1SIUA 1IE3A 1LW6E 1HURA 3I6BA 3THWA 3PUVA 1H3NA 1IJBA 3Q7IA 1B2RA 4Q3CA 4XIIA 4GX2A 3IPLA 3RVKA 3U4HA 2HHHB 2CL6X 2IS1A 3OIGA 5AVSA 1FXWF 3HRKA 5IAGA 3AXSA 2PRKA 3ZY5A 1VG9B 2Z4RA 1LVGA 1FXWA 1EDOA 3LSTA 5F51A 3IYLW 4ZV9A 3CRZA 5TMPA 1EP3B 1C3OB 1RAFA 4YMGA 3KOXA 1NRXA 4JMPA 8ABPA 2BSAA 1XL1A 3RG8A 1RQ2A 5DCLA 4ZIRB 3KFLA 1XLUA 2E7ZA 2GRUA 4YP1A 3FAZA 1NF9A 4W63A 4NS4A 1L5GB 4KRYA 1TYZA 2J46A 5CA1A 4PX5A 4CT0A 2KHZA 3OEHD 5C8DA 4PZ9A 5FXMA 2MYNA 3MGBA 1U65A 2C57A 3DNPA 1IAQA 4Q03A 1T0IA 1NDUA 2W22A 5E6UA 2YHAA 1YZHA 2J30A 4OM7A 4C6HA 3I04M 1BXKA 5CBPA 1VKRA 2JH3A 4KACA 1HBJA 3EA0A 3HY6A 4GPTA 2YUTA 3KX2A 1MGOA 4Y2YA 2MINA 2FUG6 3KV1A 2QTLA 4WY5A 4AMVA 3O95A 1RE1A 3HU2A 3R6LA 1DC7A 3D4BA 4AC9A 1GLNA 4D4HA 1KU6A 1Q1GA 1OFTA 3NHMA 4FFDA 4OGFA 5E6RA 2GBIA 5J5VA 3KSUA 1RM5A 2AW3A 2VYFA 4I1PA 2XQKA 4TSRA 2P9BA 1SUBA 2AFIA 1LTKA 5C0OE 3N87A 1H2HA 4AZ0A 2VUUA 3AIIA 4U7TB 1QPGA 1IEQA 2Y68A 3RKRA 1PT9A 1ZONA 4G23A 3GLFB 4ZO4A 2WG1A 4ZI2A 2GZSA 2ZIZA 4JFAA 2H31A 1KAEA 4GBGA 4I8IA 3GIDA 2V6MA 1EFRA 1RVDA 5LPNA 2HK7A 4MW0A 3GVIA 4P0TA 2QSYA 1U1EA 5GJVC 5PGMA 2JFHA 3DLPX 3I0MA 3COPA 2W2VA 3NJRA 3EG9A 4LBZA 4UBOA 3HTXA 2XNJA 4YRZA 1LBQA 1N5KA 1Z4IA 4H6XA 4ZVRA 4AT1A 2BSQA 1V41E 3A6LA 4OHVA 5A4FS 3F8TA 1DBIA 3VGPA 4UARA 1VI5A 4UXJA 3N9IA 1J2UA 3HO8A 4J4BA 1NU8A 3U4CA 4AWBA 1BXRB 4E15A 3U3DA 3JW8A 4O4JF 2QVXX 1B0ZA 1TOAA 4KX5A 5DHRA 1YK0A 3L6EA 3L8FA 3DNMA 5HK8A 1QF6A 2H54A 4EYKA 4P0PB 2WM2A 4JQZA 1KTVA 2WWGA 4N5LA 5ICCA 1ZD9A 2UUOA 4ESEA 1BMDA 1I10A 1XEXA 1B8UA 2XZDA 1V3QE 4GMXA 3WSTA 1PZFA 2FUCA 1QH0A 1WUIS 4HFRA 2ZYAA 1I3NA 1CUYA 1UPAA 1TMYA 1B43A 3S8YA 4G1UC 1GNVA 3GELA 4MJ7A 4MV9A 1SXJD 5CLGA 5ALNA 2H9YA 3FR8A 4KREA 3HYLA 4JB2A 4MQUA 3IALA 1WSWA 3ERCA 3R9KA 1ILWA 4BJHB 1DVRA 1GKUB 1XD2B 1MJGM 4L0MA 5EZQA 3UO8B 1G5PA 2YCLA 2OC4A 4XWTA 1SR8A 4ADSG 2EQ5A 3K6SA 2X5NA 1YI8A 4CIBA 4KYTA 3EZ7A 2IHBA 4FGWA 5EJ6A 2VTBB 1QGZA 1C4OA 4PAMA 3UAYA 2H2AA 4L15A 2FMTA 1HYGA 5HZHA 4U3JB 1EE2A 1CY1A 4DIEA 2H4FA 4M1OA 4XVRA 1Z83A 1CUZA 2H8KA 1YKFA 1E3JA 2VSOA 2ZKIA 3DWIA 3GT4A 4IJ5A 4O1IA 4P5DA 2Y4NA 5H16A 2QRJA 2P90A 3GJZA 4IMIB 4MV6A 1Z2EA 2H4XA 3KKLA 3RV4A 1SQ0A 2WZQA 2PCJA 1PDOA 3DTVA 3K0BA 4LY3A 3CUWA 4MYDA 4QBKA 4JLMA 3RGWS 3SU8A 4CKBA 3ROGA 5FNVA 2I22A 4C3ZA 4QIHA 3SG0A 2J9XB 4HFMA 1CDEA 2J9FA 4UHCA 1B7GO 1ZUNB 5FNVF 2M6SA 3RIXA 3ZZ0A 1XZFA 4P84A 3NOXA 3ZN2A 3U9SA 4XQ9A 4D46A 3PFKA 4OB6A 3SGLA 2XVYA 3ANMA 3EVCA 1CSEE 1L4YA 4N3BA 4PHHA 5DOVA 1NKTA 3L5KA 5IASA 2CLMB 3U5ZB 1SVWA 1XP8A 3NV7A 1EAYA 4CCSA 1Q7TA 3WMEA 4YAOA 3GLUA 4DWWA 3COVA 4M9CA 4F6RA 5K6RA 1GEEA 1RMQA 2WBLC 3K1AA 4Z49A 2FUKA 3QFHA 5BOSA 2P9EA 3SIWA 1ADJA 3MWDA 2Q62A 1Z6GA 4KFSA 4X7MA 5KNDH 1DT3A 4FUQA 3VTKA 3FYUA 3ZNQA 2G0NA 3AR3A 2B30A 4AY4A 3JTEA 2CMHA 2H5EA 1P62B 2YV2A 2UVPA 1D9XA 3NDPA 3U56A 1IDOA 4KITB 3KKOA 1E6KA 2DT8A 1MHPA 2DY1A 3QBTA 5FI1B 3RU9A 2VK2A 2F3SA 2NAFA 3QVGA 3GX1A 4UEQA 1GM5A 2XLBA 1KO4A 3OQIA 2IS2A 4XD2A 5BYJA 3VR5D 1K27A 4LJ7A 3K35A 3K9BA 1DHTA 1Q0RA 2OUIA 3MMZA 4WBSA 4GRIA 2G8NA 4QOHA 4BAZA 1LDGA 3UJPA 2D4HA 1Y1PA 1DLIA 1BE1A 3KB6A 5H82A 1JAHA 2JGFA 4RL6A 4HZUA 3E3NA 3EVEA 4FYIA 3AEXA 5GZ6A 2PQ6A 4YK7A 2PD3A 1RAHA 5BWBA 5FOVA 3T9FA 1JFSA 1M2FA 4JBYA 4LI0A 2H1IA 4KTTE 5A2QA 5DWQA 2P68A 521PA 1VZ3A 1G66A 2HSJA 3WGLA 3ZV5A 2Y99A 4J9UE 5KJFA 2QSJA 1TF2A 1YV9A 3S8EA 1TFRA 2E9SA 3KSMA 3OLWA 4XB6B 5HSGA 1PRYA 2FG6C 1Q1EA 1DCMA 1OMOA 1M2OA 3OI7A 2IHJA 4RULA 1WCXA 4ND7A 2C29D 1G4UR 3D7LA 2ZBEA 4PC2A 3ZHQA 5A5GA 2NADA 5I3ZA 1OBHA 1E2KA 1BGVA 1TD9A 1TVMA 1U0NA 2WKQA 2CDRA 2IHKA 4HN2A 5ALMA 5EHQA 5GGYA 5BN3A 3LRPA 3GT3A 5J47A 4RQBA 1PJ3A 3ZE8A 3KSZO 2MYTA 4U8GA 4B3CA 2PLAA 1KR2A 1OX4B 3PNQA 3Q6IA 1Z6YA 5JI2E 5CXXA 2WFZA 2GZ3A 1FYEA 3OPNA 3GLGB 2J1LA 2WF7A 3V7UA 1QVVA 1T4GA 1M1ZA 4NMLA 4UUMA 5C1PA 1HFJA 1KSHA 2GEUA 2G17A 1CCWA 5T8KC 2QEQA 2IPXA 1OIXA 1VLQA 4B09A 4OUDA 1E6EA 2B4TO 2NZ8A 4QNRA 5K03A 5KQRA 3GDWA 3A6FA 3OQIB 5G4KA 2HA5A 2IWRA 2EP5A 1HRDA 3AF1A 1GSAA 1V6AA 2QMUA 2VBIA 3IQGX 2BKLA 5D5PA 5FRDA 4I3HA 4UM8B 4L4ZA 3DZ8A 3UWKA 3KM0A 3NMUF 4QRIA 2XCLA 3W8NA 1IXRC 2AHOA 3A14A 3DZGA 4B6OA 2OG2A 2PWPA 4BMOB 4P4TA 4QAJA 4E51A 4P3NA 4LMBA 2DXIA 3AM3A 3EWIA 4CEJA 5AOCA 1XZPA 1N2CE 2X41A 7REQB 3KE8A 3SPXA 3UENA 1JHRA 4KBYA 3QM1A 1HRKA 5HFAA 3THSA 2IXTA 3BIWA 4GBMA 1Z6TA 1JX6A 4QYTA 5DDIP 3RANA 3EXFA 2C5FA 5HKLA 1HTWA 4AMZA 1MX9A 5AVJA 4GX0A 5DM0A 4WD3A 1FRQA 3FRIA 3SF8A 4BMVA 2R2GA 3TJRA 2RIPA 4KLZA 3L4SO 4IOKA 3RUHA 3GEHA 4GPZA 2VI5A 3E9RA 1VPEA 3LDHA 3RJMA 1R88A 1GHTA 2OZVA 4A5OA 4YAGA 1LWNA 3T1OA 2QL6A 5FPHA 4WJLA 4C0AC 3LQYA 1RXCA 2JBAB 1NVAA 4KN9S 1CQIB 2R4QA 1CVRA 4J0HA 1WZCA 5B4TA 4FX5A 1Q17A 2FSVA 3NANA 4EA9A 3H8VA 4I4TF 1VJGA 4A0HA 3LCVB 4AFNA 3BQMB 1AC5A 4INZA 4YJGB 2X1HA 3AF5A 3FJYA 1B6GA 4DRZA 2XTAA 4BHTA 4TYNA 1RC1A 1M6HA 2DJIA 3BMOA 3ZEAA 3N74A 5LU9A 3PUHA 2Z4TA 4PTZA 5ENDA 4YT8A 1P1RA 4QM6A 2HBQA 4JKYA 1NW8A 1NW3A 2NN3C 4ZO7A 3SY8A 4KQIA 3V1NA 5D85A 3NKVA 1XNGA 4RF4A 2ZI7A 2DBRA 4QPCA 3CNHA 1XEWX 2XQGA 4D4GA 1FFWA 2CL5A 2CFRA 3CW9A 3FTDA 2VQ3A 4D97A 4REMA 2AMJA 2BM1A 2CUZA 5K8IA 3HJRA 1TXGA 3SXJA 4E1AA 1EHYA 1I2AA 2CCJA 3I6QA 1D9ZA 1A7UA 4QTTB 1PIWA 2QSUA 2H0AA 5E95A 3QKWA 1QKIA 2J87A 1HEYA 3ME5A 4X20A 1NLFA 3GH1A 3OO0A 5L7TA 4TMVA 2OCAA 4LRQA 1K6JA 2JFZA 5E1BA 9GPBA 4R0NA 4FMPA 4AO8A 2PS3A 2X5XA 2HMUA 2OUKA 3UV6A 1D4OA 2CJWB 1IIBA 1U5BA 4TSFD 5AHKA 2QLBA 2WYOA 3NRJA 4H7IA 4JC5A 2ZJAA 2VUHB 4YEDA 5TGZA 5FBKA 4CDGA 4GLJA 4MRAA 4DRXA 4EF5A 3VQTA 5CB4F 1L7NA 3UC5A 3DLAA 3KQVA 3ILYA 4I08A 3JRWA 1RLMA 1CDZA 4XM2A 1HQYE 4CBVA 3UJ6A 4D0NA 9ATCA 3E23A 4EG8A 1NVFA 2TMYA 1MO4A 2PK3A 2QRHA 1MBZA 3ANYB 4ZRMA 3VOBA 2IZOA 3DA8A 4IINA 4IYRA 4B6PA 2XCOA 3L4EA 2BH2A 2GUGA 3KOUA 4IV0A 1UWVA 4QYSA 2YY6A 1ELOA 2XYQA 3IB6A 1BA2A 2HH9A 3JD0A 3JZAA 1QAMA 2ZRAA 2BISA 5J2UF 1QYIA 4DSTA 3GLFA 4BX9A 4R40A 3ORSA 1QO0A 3VPDA 2OEPA 4L50A 3BKXA 1OXBB 1Q14A 1XC7A 4B74A 3DP7A 4FIZA 5FLEX 1QF7A 1R7RA 1DRVA 3TMKA 4O3MA 1S9HA 1GWNA 3RM3A 2JJ1D 2QF7A 3W6NA 3WRXA 4G6ZA 5DNCA 5JO9A 4HAIA 3RTEA 2C2ZA 1POXA 5FWAA 3D6UA 5AVYA 4K1LA 4BBJA 4WL0A 2IDJA 1Q0TA 1W8DA 1DJQA 1NI4B 5DGDA 2MINB 4PLHA 2GLTA 2GWRA 3A2LA 2CHUA 2X7HA 3GUYA 4CCAA 4M22A 2ATCA 3Q85A 5ARDA 2R1TB 4X91A 3VKFA 4ZOQI 3ETNA 2OK7A 5FR2A 2GHIA 1DLJA 2ZSIA 4FOLA 1P72A 3OZAA 3S1SA 1G60A 4O63O 4OI4A 2WVGA 3C5EA 3Q2IA 4UPVA 2J8ZA 3SSAA 4Q66C 1U2EA 1CJCA 1TIPA 1KYQA 2WUEA 3A2MA 4US1R 5C1DA 3T3IA 3ZHYA 3S2SA 2BLNA 2FOIA 2RD2A 1RADA 2GLUA 3G7UA 4RFSA 3QX7A 1BWRA 2JLAA 3O93A 4FW9A 4R2JA 4S1WA 3RRFA 1UINA 4JLKA 1UDCA 1HE2A 2GCPA 3ANSA 2VH5R 4LSWA 2ZRPA 1NW9B 2PMKA 1N2OA 4J0QA 3F7NA 1JR4A 1GYRA 4L9RA 1E3SA 3M6UA 5AOBA 3CBQA 5HMLA 1E20A 2W2QA 5I9MA 4E5UA 3F6YA 1WPRA 3G2NA 3I2HA 5AHWA 4BCCA 1U63A 2TSYB 4QJ3A 5KWSA 4R9NA 4OYLA 4EY7A 2FN4A 3H3FA 3CZRA 1AQLA 1SCDA 3V2UA 3VPBA 2RKWA 3A4LA 2OC9A 3Q12A 4NH0A 3H9GA 1UMCB 2J5KA 1TC2A 3QXGA 4O2BF 3QUBA 5K01A 1R4ZA 4D4KA 5EZYF 1J4AA 1O5TA 2TRSB 3RCBA 2QYHA 3A4TA 1R27A 2OR3A 3C3YA 2X9QA 4FFNA 4NULA 4O2BA 3RAFC 3B3AA 1WY7A 2RGUA 2ZATA 1X14A 1OXKB 3LWZA 1KEEB 4LDJA 1TYCA 1YB1A 3KDPA 1MVLA 3OE5A 1K2VN 3OM8A 4RKYA 3ZGYA 3PIIA 5EIAA 5KWIA 4XGNA 2X8JA 5LQDA 1J0XO 1BS1A 3IVAA 1T1RA 1JR3A 2E87A 4ZAZA 2PUCA 4YRFA 3Q87B 4QVIA 1E9EA 4NPCA 1V35A 3GN2A 1X70A 3PUWA 5KC8A 3CHYA 2E89A 4DLUA 2UV8A 5CDUA 1DT5A 3P7MA 1L0BA 3U40A 5FFMA 3V1LA 4QDTA 4Z9XA 4E03A 3QITA 3ZNOA 3OC0A 1UMDA 4HO1X 4KWIA 2DR3A 5JXJA 4LK3A 2OSBA 2R6AA 4HQNA 5TMBA 4JR1A 2A0XA 2QR3A 3HUFA 2YMLA 1DFIA 1RQRA 3B1FA 3IP1A 3M3DA 3VVCA 3MGCA 3IS3A 3O8CA 1JR3E 2X6QA 3I34X 1M0WA 1NZJA 3IHKA 5LQKA 2GWHA 3TGWA 4C0JA 3U81A 5REQA 1BMFD 1E1QD 4YACA 2VYNA 1UANA 3S3TA 2RHOA 4EJFA 1Q22A 1QPZA 1P81A 4LFCB 5HMMA 4JUAA 4F93B 4RE5A 1QBGA 1M1XB 3LUJA 3HEBA 1E1MA 3RIEA 1SG0A 5B36A 4JH0A 2F1HA 4EF6A 1QDUA 1DE0A 1VHLA 2VQDA 4YECA 3IAFA 4DPLA 3VXKA 1O95A 4PLCA 4RENA 3UB4A 4F45A 4MGYR 1NFFA 2O9JA 3BIFA 1DMSA 3DD5A 5FPQA 3BWCA 4S0ZA 1U0OC 5HTKA 2VK4A 2EYUA 5NLLA 4UHEA 1DXHA 4IH4A 1EFKA 1K0FA 3CYFA 4A3SA 2IQ5A 1CR1A 4U7GA 1UDBA 2ZE7A 3NAZA 2CNNA 3RC3A 4B6JA 3AR9A 3DAYA 2ZWPA 2BTQA 3ZDCA 3CW8X 1FVXA 1YBHA 3LQFA 1NASA 1GY8A 1E1NA 3O4HA 2PH3A 4OBBA 5A4MS 3AM1A 2E4VA 5AHXA 1QORA 5L7WA 2ZRDA 3BG5A 3BUSA 4JDPA 4P08A 3ZHBA 1T8TA 3VSEA 4FKZA 1OBCA 2DBZA 2P5SA 1NQ5A 1ZGGA 4NFHA 4YPVA 2YY7A 4RCZA 2BTOA 1V8PA 1U7TA 3OC6A 1ZK2A 5G1OA 3T34A 4PQYA 5LM3A 1KBQA 1A2BA 1OCEA 4RADA 1UXOA 1XCGB 3EPAB 3DMNA 4LNUB 1ZRNA 2VWQA 2NVOA 5AHOA 1J2RA 4LXTA 5D3ZA 4H7DA 3V1MA 4S1PA 1MV5A 3JQ8B 3V97A 1RFLA 5GADl 1X9HA 2F67A 4JU9A 1XNJA 3IXLA 3TSCA 4DKXA 1WBBA 1UC8A 3LLCA 3EZGA 4QBFA 4TUYB 4KXVA 4UD6A 5TQ2B 1LWOA 2Q7XA 1UWLA 5F52A 1BKYA 2BFCB 2HUNA 3GEBA 4ASUA 4QTYA 3L4KA 1YBFA 3QTTA 4GUAA 3KZOA 1A9PA 3FHCB 3FSEA 4HDMB 4ZA2A 5BYBA 3ENNA 1Y37A 1YMQA 1Z0UA 3D1JA 1EAMA 3QXHA 2H4JA 3WYNA 4F85A 1DCFA 5IX8A 2IQIA 1PNQA 3P9ZA 1UQUA 3AVOA 4ZOLA 4A82A 5JWRA 3IAHA 2BGGA 3L4JA 5ICEA 4PX3A 1GADO 3IXMA 4KBFA 3GUVA 4KIWA 2FSIA 3K94A 2B7LA 2IA5A 4ZO8A 4DMUB 1M5RA 3EVTA 1LY1A 1PEAA 2WSBA 1JXOA 3B6IA 1G8JA 4IXDA 5FA6A 2WSYB 1GNPA 2ORVA 1C3XA 2QRQA 2NU8B 1JQDA 3V4FA 4TWBA 2OXFA 4YJ3A 3V32A 2YWBA 1GQQA 3R9XB 1IQ0A 3IIKA 1LPNA 4FHZA 5E38A 1KIMA 3IVMA 4MV3A 2G88A 2PJUA 5KTOA 4AZ3A 2EWWA 1Y3HA 5K9ZA 5AOVA 1YO6A 2FLWA 5EVCA 3FHTA 4U5QA 1PW5A 2Q9AA 3CLHA 4UXIA 2GYVA 1UFRA 1J00A 4R71A 1JTVA 5TS2A 3DEHA 1L6IA 1AUXA 1PT8A 2OOKA 2ZT7A 3TLGA 4UTXA 4ME6A 4AG3A 1Z35A 2GESA 3UXEA 4HVCA 4IR7A 4L7VA 1R3DA 1UKEA 2V6GA 1AQYA 1JWAB 3EEIA 3BK2A 5AQEA 3FCOA 3GNSA 2O8BA 2FCAA 2Q4EA 4BNDB 2C2KA 4BL5A 4V1CI 1BYUA 1QGYA 4I19A 5EIFA 1LPOA 2I2BA 2P9ZA 4PYJA 4FT2A 3FPHA 4DWVA 1XZCA 3URMA 1TM3E 2I71A 1M66A 3S6JA 4AF8A 3A6PC 3P27A 5IRCD 1WMFA 3BWVA 1UEIA 3P2OA 4IXMA 4DQVA 1OROA 5JFOA 3MJEA 3RSQA 1XZKA 5CNMA 2ZJ3A 3AC0A 3D6HA 2IEAA 5LA6A 1XEXB 5BQXA 3CQ9A 4QYXA 2GNOA 4YMUA 9LDBA 1Q1ZA 3N75A 4DIMA 1WB9A 4M49A 3H9EO 1YCGA 4OEHA 2F64A 2GT1A 4J1NA 3CBGA 1RR6A 3PGLA 3QEOA 4MP8A 4EYQA 5HUHA 1E7MA 1NPYA 2WMOB 2ZRKA 4Y6GB 2ZYSA 3WWPA 1UKZA 1T25A 1ZH2A 1SG6A 4C03A 1RWMA 1NHWA 2FN3A 3DOFA 1J8MF 1YRWA 4RVDA 1QGOA 2R1ZA 2VJDA 2NTNA 3FHLA 3KTAB 3W4IA 2C0QA 1L5SA 4RHCA 3B53X 4CR7A 1JIVA 1I5EA 1KMQA 4EGQA 2XD4A 3N59A 3OX3A 3DT8A 4FFSA 2F3RA 4HDRA 3TI7A 4BJ3A 3G89A 1M1NA 4LHEA 2AVDA 3UA4A 2EX0A 3BMNB 3DLBA 4R31A 2WNSA 2X3FA 4ZC1A 5LJLA 2IU4A 2MIIA 3GLTA 1E58A 1J1ZA 1ZHOA 1XTJA 1BXGA 1I32A 1G291 3R0JA 2AA3A 2JLXA 3DVLA 3K4HA 2IXBA 5BNFA 1RWPA 2NVUB 1EFRD 2DHQA 1P7YA 3C87A 4NYIQ 2I6UA 2ORYA 1YRLA 4IJKA 4QXPA 4D6YA 2WDZA 4O4JB 5A6SB 4DR5B 5DBGA 1ZA1A 2PIDA 3ASYA 1Z75A 1HKHA 2L17A 4JODA 4YCLA 5K0FA 1NYLA 5M04A 4DKJA 4L8YA 4X85A 1SIOA 1UQRA 4HQOA 3FUVA 2QQGA 3S7ZA 3GGCA 2F1OA 1TIKA 4P4GA 3VSAA 3WRWA 5GIOE 4JJGA 1K3TA 2Q9CA 1Q91A 3UF0A 1VFNA 5JZOA 4BV2A 2X9LA 2JK1A 4QECA 3R7LA 1KQOA 3HYSA 5IUJC 2B1JA 2Q0SA 4RK4A 3K73O 2SCUA 2VF8A 1PV2A 2G5PA 4ZAGA 4A8HA 5TMDA 2NUPB 5CITA 2PX4A 1QU3A 2A1UB 4XI9A 2GBCA 3GLHB 3PT9A 4BE9A 1MQSA 4DV0B 5LQMA 5FBRB 4PCAA 1NLYA 3AL0C 3IHTA 3G2MA 3BRWA 3MEQA 1JIXA 2XDYA 1YOVA 2H52A 3HVHA 4J2HA 5THXA 3X2EA 4LYAA 1Q1NA 2J3KA 2V7VA 4NE9A 2D0DA 4NAVA 1L4FA 4J0CA 2BGKA 1GTSA 2PCLA 1QV7A 1DWQA 3A2KA 1WO8A 2XADA 3AINA 3VR2A 3FMOB 2AN4A 3TQQA 1T1EA 3WMRA 3WXBA 3RT7A 3A26A 3CIFA 1NN0A 3NUZA 3PG5A 5DYWA 4BO6A 1CDDA 4UPEA 3IUSA 7GPBA 3NAGA 4C4SA 2ID7A 3UM9A 3OPXA 2AE2A 3VKGA 4H7FA 2O54A 5AM5A 1LKZA 2JCVA 2G8LA 1ZJZA 2F2TA 1KS9A 1IOVA 1REQA 3DKRA 5THKA 2FQQA 1XCOA 3P0IA 2JEZA 1G6HA 1NRJB 2Q2VA 3GEGA 3GJ4A 4EGJA 4R9VA 1Q2UA 1XELA 4BXOA 1T3ZA 4L5BA 4QVKA 3MILA 3U2QA 1NMXA 2P2GA 2R47A 4EPWA 3QE4A 1NR1A 4RJJA 2BCJQ 1B26A 3CFYA 1ML3A 1S9DA 4FK8A 4KB5A 5DYNA 3EQZA 3BJEA 5JXHA 3F73A 1ZOPA 1OHHA 3A0RB 3DVAB 4X41A 2PS1A 4GI3A 4GWLA 1LSSA 2ZOSA 3D3NA 4YV0A 2ET6A 5JROA 3O2QB 3NBQA 2OENG 2PS9A 4XCXA 2XWJI 1BS2A 3L82B 4MUJA 3K9WA 4IO1A 2QU8A 4Y3UA 3WX0A 5JECA 3GT0A 3ZLTA 3O1IC 3N6RA 1LLQA 5JH7F 3FCXA 3OA0A 2JBHA 4ETMA 3L0SA 1HOTA 2PUHA 3H7IA 1KZYC 1XJCA 5IT4A 2GD1O 1BEUB 2D0IA 3BCSA 4MW6A 4PPNA 5HDBB 3TX2A 3T12A 1BX1A 5IBQA 5JZMA 5KYKA 4MI9A 5E7IA 1I36A 1PEKE 4OSEA 2O0KA 3AG5A 4L22A 3VR3A 3T3OA 2J5XA 3OO1A 2DFTA 1P2SA 1ZD5A 2IKSA 1YKSA 3F1LA 4OFZA 4HNUA 3ZJTA 1DAIA 2V65A 1SCQA 4BB6A 1J1UA 3QYJA 5AVTA 2H51A 2GZ1A 1EX7A 1UKYA 4Q34A 1NUSA 1HPLA 4JLVA 1V7CA 4N3AA 4KJXA 4WY8A 5DTQA 5AKYA 3PNBA 4R05A 5BT9A 3R7NA 2NAPA 4DV4B 1IZ9A 3WAJA 1RACA 2YASA 2FEPA 4GZMA 4K6KA 4OXKA 5ESDA 3I9LA 3TUZC 1EUQA 2ZSJA 4G0WA 2BEUA 3RVDA 4WW0A 2V6IA 5FADA 4PYQA 4KE6A 2JG3A 1D03A 1HT2E 5FAXA 4KPEC 2YFYA 2AG1A 1IJEA 1ABEA 3EGWA 4U7PB 4E5SA 1UYJA 1IZ7A 3L6OO 2ZUWA 4TRMA 2FPWA 1SC9A 1U80A 3AUYA 3JAKB 4D9CA 4HATA 1WY5A 5HK9A