2CZCA

Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from pyrococcus horikoshii ot3
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
MKVKVGVNGYGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASEEFIPRFEKEGFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKADVAEVSFVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPINAIKPTVEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDSTAQIIEFARDLHREWNNLYEIAVWKESINIKGNRLFYIQAVHQESDVIPENIDAIRAMFELADKWDSIKKTNKSLGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase
total genus 123
structure length 334
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.59: Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)(+)) (phosphorylating).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2czcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2czcA01
3QY9A 3LF2A 4WCDA 4BS9A 2DKNA 3SLGA 4A27A 4JK3A 3VH4A 3WGZA 1NVTA 4ALLA 3RFXA 4CMGA 2OXIA 3GH3A 5HRUA 2I66A 1D3AA 1XGKA 1E7WA 1QXSA 5GMOA 3BYZA 3JQ7A 3TZHA 4U6QA 5TGDA 4CM8B 2D2IA 4A2CA 1GCOA 4BNVA 2C07A 4CM9A 1XHLA 2B4RO 2C59A 2QRJA 4MDHA 4ALNA 1I01A 3FCOA 3I3OA 3IC5A 3C1OA 1NWCA 1VI2A 3WWZA 2DTEA 3GLQA 3RC7A 2IYPA 1K6JA 2CSUA 3DBVO 2YV1A 3D3WA 3LQFA 4IXTA 1Q0QA 3EC7A 1RM3A 2A94A 2GR9A 2EW2A 3HQ4O 1PWXA 2P4QA 3WGGA 4AFNA 4E31A 1JVBA 3SJ7A 3VH2A 5A5EA 1YBAA 4BKRA 3DAGA 2VWPA 2DBVO 1JTVA 4C7KA 4D7AA 3LC1O 2FR0A 4XB2A 1K89A 2DUUA 4YA6A 3RBZA 3Q6IA 1U8FO 1NXQA 3ZWBA 3PJDA 3WYEA 1Z7BA 5L7TA 4BNJA 3FD8A 1UR5A 1R0SA 4FFNA 3HSKA 3DFZA 4CMIA 4BV9A 4GI2A 2GLXA 3ZV5A 3U5TA 3ZDFA 3K5PA 5IDWA 1I3LA 4YQYA 5JC8A 4RF2A 4DC1A 5EJ2A 4AL4A 5JAIA 1QV6A 1VSVA 1DRVA 1R66A 3ADPA 4IXWA 1I3NA 1D4FA 1VE9A 4E2WA 4EEZA 3MJEA 1E5LA 2AHRA 2JHFA 3NDJA 4K6FA 1LLUA 2I6TA 1B8UA 5IZ4A 4WE3A 1ML3A 2JD0A 4Q3AA 2HCTA 3L6EA 3C85A 3WFIA 1V0JA 3H9UA 3I9KA 4HP8A 4IJWA 3CIFA 2WYWA 1T4DA 3WLEA 2CD9A 5ES3A 4WECA 2ZIZA 5A9SB 1DJQA 1QG6A 2X22A 5HS4A 2B37A 5JSFA 3GQVA 2H9IA 4OKIA 1X1TA 4KP7A 3JQBA 4CM7A 4RPJA 1PQWA 2C2YA 4DQVA 1NQAO 1Y5RA 2FZEA 3JD2A 4L76A 3C1AA 3E48A 4RF5A 4LK3A 5F21A 1M2WA 2Y67A 2JJYA 3ROPA 4DWVA 3L77A 4KMSA 3PZBA 2GN4A 5AXDA 3DAPA 3QVTA 5GZ1A 1ZK3A 5M6DA 2Q45A 2Q1TA 3RC9A 1H2BA 3PDUA 1U4OA 1IZ9A 4I9NA 1HRDA 1NWHA 1C1XA 3A14A 3OBBA 1WP4A 2ILTA 3CEAA 5K6AC 3INGA 4YJDA 1KY5A 3Q11A 1YBMA 4G65A 1EBFA 3UXYA 3WXBA 5G0WA 2JCXA 2DUWA 3AFMA 4WUVA 3PGXA 1E77A 4Y8VA 4Z9XA 3QE3A 5U1PA 3P5SA 2XXJA 4R1NA 4CMIB 2R6JA 2YHUA 4BNGA 1GAEO 2JFGA 4N5MA 3NDRA 2W2LD 3OA2A 1O9BA 4EYEA 3I5MA 4YQZA 1O8CA 3EK2A 5CDUA 1QRRA 3QV1A 2YZ7A 1SBYA 4EDFA 1F8FA 4YAIA 1O5IA 4TMFA 4LISA 3NTQA 4NFSA 1LLCA 1T24A 3GVPA 4L75A 2Q50A 2J5RA 2GASA 3WLFA 3WMXA 1GADO 4UREA 4B8ZA 4EI2A 5KNLA 1Z7EA 4AJJA 1EBUA 4O5OA 5DP1A 2P68A 3PHLA 2CVZA 3RUFA 3VPSA 3OF2A 2RH8A 5ADHA 4RCVA 2O3SA 3GFGA 3E9QA 3GEGA 4YRDA 1RPNA 3BHMA 1ZKMA 2Y0EA 5CEEA 5G4KB 1E3IA 4Z0TA 4EW6A 1DIRA 4JIGA 1WW8A 4Q3DA 4DIBA 4EJMA 3GNSA 4OL9A 1KVUA 4D44A 3PVZA 2GD1O 5LCXA 1Q1NA 4TQGA 5C37A 3GMSA 7MDHA 3PRJA 4LN1A 2J3HA 1PJTA 2OBNA 4WNCA 3GC6A 5MDHA 4BL5A 4BO6A 3G3EA 3O9ZA 2DVMA 3N58A 4YB8A 3AY6A 5ENVA 4BO8A 5ITVA 1KEWA 1ISFA 1BXKA 4DIFA 1BW9A 2JL1A 2E82A 3PWZA 3NKLA 3ETEA 4BV8A 3JTMA 1H93A 2X6TA 3ABIA 4PG6A 1CJCA 3PYLA 2VWGA 1ZSVA 3V8BA 2B83A 3H5NA 3X2EA 3U3XA 2GZ3A 4MPDA 4IJKA 3WTCA 1F06A 1HLDA 3QVSA 4IDFA 4TRRA 4CL8A 3NUGA 1B14A 1PZFA 1ZJYA 3TOXA 3KUXA 5C7LO 1YJQA 3GZNB 1Y8RA 3W8FA 4DYVA 3PYXA 4KWHA 3U4HA 1GTMA 2VTEA 1U2DA 5A04A 2FN7A 3KZVA 3PK0A 4NBWA 1SOVA 3BMOB 2IZZA 3ZHYA 4BVAA 1HT0A 4BUCA 5JC1A 2J5QA 3VDRA 4J4HA 4KZPA 2FPGA 4CM4B 4KUHA 3MOGA 1VJTA 5KWEA 3DONA 1DDOA 3HZZA 1YOVA 1GQQA 5KTKA 2ZJ0A 4BOYA 3BMQB 5T5QA 4IZIA 2C82A 1B8VA 4WEOA 5JDCC 3BHJA 5A1TA 5L40A 1GL3A 3F4BA 3DBHB 1HZJA 4R51A 2Q99A 2PK3A 5HM8A 3D1LA 3QWFA 3ZWXA 2O50A 5T64A 3PQEA 4GVXA 4JN6B 4C7JA 3H9QA 4CLEA 1ENOA 1Y5MA 4NBTA 5KVSA 1AE1A 1CQJA 2E48A 4CMJA 3OH8A 1PJ2A 2EKQA 3JV7A 3DEYX 2AXQA 5U9CA 1ENZA 1FXSA 4BIIA 4PG5A 4TSKA 4LCJA 3KYBA 3OJEA 3V2UA 1WVGA 4GLLA 4XYBA 4JNKA 4CQMD 3PWSA 1E7YA 2VWHA 3DHNA 3SC6A 6LDHA 1ORRA 4I5EA 3FR7A 1UH5A 1J0XO 1B7GO 1SPXA 4I8XA 5IAAA 4B7XA 1F0YA 2VUTA 1U9JA 3ZWCA 4Y9DA 2X7HA 5FF9A 5ILOA 4J43A 5IZCA 4IJVA 3RKUA 3H65A 4D0SA 5ITWA 3OJFA 3BXXA 4BB5A 1NP3A 4TKMA 4Q39A 2DC1A 4FPXA 4E2XA 3ENNA 4RF3A 3GT0A 2TMDA 1OAAA 1HWYA 2JAHA 3GZNA 4CMEC 3CMCO 3LT1A 4GKBA 4PIVA 1HYEA 1K6IA 3PIDA 4YAJA 4D3SA 4ZJUA 5L7WA 3DOCA 1E7SA 1A71A 1H2HA 4U8GA 2VHYA 2B5VA 3M2PA 4NJOA 3E03A 3ZWAA 3MJ4A 1UZNA 1HEUA 2Y1EA 1EVYA 4CLRA 3ULKA 5TX7A 1CQIA 3GGGA 4OKNA 4PLTA 2P4HX 4QX6A 1UZMA 1LRJA 3OP4A 1DC4A 1KETA 3G1UA 4F46A 3I52A 2OP0A 4OH1A 2WWRA 3MZ0A 4MKXA 1KVTA 2ZYDA 3RFVA 3KM0A 1I10A 1ZW1A 2P9CA 4BNKA 3PLRA 3BTSA 5ICSA 1GQYA 3LU1A 2G1UA 1U3VA 4ZRNA 2DPHA 5DBGA 2ZTVA 1SEVA 2PD3A 3LDHA 2J3KA 2W4QA 5A3VA 1PJLA 1XEAA 4BNZA 3EMKA 1FDVA 3QVXA 4RLHA 1EE2A 1M76A 1N5DA 4E13A 4IMPA 4ZICA 3H2SA 5JMWA 5DN9A 1YS4A 1LNQA 4EUFA 1Y81A 4FN4A 1A9YA 1YB5A 3DZFA 3KO8A 3TJRA 2Y1CA 1PGJA 4BGUA 1RWBA 3MTGA 4FS3A 3K8ZA 4J7XA 2VZ8A 1H9BA 5BSEA 2AEMA 3D3EA 2VOEA 3WQRA 4WCFA 3Q1LA 1PSDA 3CE6A 5HBRA 2HO5A 2P91A 1P9LA 2NACA 4ALJA 3JD0A 1ZNQO 3OQ6A 4HFJA 2PH3A 2B35A 3HG7A 5AVOA 4RPHA 4BO2A 2C54A 5JW6A 1IHXA 1LSJA 2EEZA 2V6MA 3I9MA 1E3SA 5ILGA 5C5IA 1D1TA 4JXKA 4QSMA 4CM9D 4J90A 4D0RA 1O95A 4JP2A 5C3MA 2NM0A 1DIGA 5BSGA 1P0FA 3L4SO 4R54A 3DBHA 1LEHA 2IZ1A 3KVOA 4J6FA 1N2SA 4Q3BA 2HJSA 2VRCD 3JQ9C 4ALKA 4EGFA 4I9HA 2BI7A 5FWNA 4DQXA 2HJRA 3KSZO 1NQ5A 4YBZA 4CJXA 3T7EA 4J1QA 2ZB8A 5EPOA 5G4LA 4YJFA 4L9RA 5IZCC 3F47A 3FNFA 2P5UA 3GDFA 1QYVA 1HLPA 2HK8A 2BLLA 4EZBA 3K6JA 4WGGA 4CQLA 4K9DA 3IIEA 1N9GA 1P45A 4LSMA 1QYWA 2VUUA 1DRUA 4BO7A 3ASVA 4R9SA 1Q7CA 4MIYA 2Y99A 4Z6KA 1HZZA 3ITDA 4PLCA 3W4IA 4XRRA 2OFPA 4UVGA 3IP3A 5IXSA 4MVJH 1TB4A 1JQBA 3OHSX 1Z82A 3H5RA 3PQFA 3RUHA 1M66A 3K73O 3G79A 2PKQP 1ZJZA 5KJEA 2JD1A 1FF9A 3PEFA 4MOWA 4FR5A 2OGUA 3W4JA 3FN4A 1DAPA 2X9GA 1F17A 3V1YA 4NHEA 4QQRA 4UEOA 4IZHA 5L53A 3D0OA 1WWKA 3NJ4A 4K26A 1F14A 3QP9A 4IDEA 1UXGA 3H3JA 4IJUA 4IDGA 2DQ4A 3AUTA 2JFFA 4NJMA 2FWMX 4DBZA 1ADCA 1P1RA 4BNYA 1PJBA 2Y1DA 3LLSA 5AOVA 1YWGO 3E5MA 4GX2A 1G0NA 1LRKA 1ISHA 2BGMA 4PLHA 5TC4A 1P3DA 3K92A 3LT2A 3PYMA 4G81A 1UDBA 4WEQA 4R01A 3GGOA 5LC1A 5DF1A 4DTIA 4RQUA 4N7RA 1MG0A 2CDBA 2V6BA 4ZQEA 4E5PA 4TRMA 4I5DA 2ZCUA 3IL2A 2VYNA 3UKOA 4J1TA 1Z6ZA 1RYEA 1NHGA 1ZXBA 2HAEA 2NVWA 4R4JA 3WB9A 1JDJA 4FCCA 1H9AA 4NBVA 1BXZA 3F5QA 1QYDA 2RHRA 1KS9A 3UHAA 4NU5A 3EZYA 4MINA 4PLFA 1R37A 3RU9A 4GX0A 1PGPA 3AOEA 1SZJG 3RU7A 5JE8A 2YFHA 2Q4EA 2AG5A 3DBRB 3HNPA 4WPGA 4MIEA 3KSDO 1VKNA 4CPDA 2PKQO 2ZJ1A 1JKIA 3U09A 2VYVD 1I30A 1NFRA 3VKVA 3LSYA 2RIRA 5I9NA 5AQ1A 1JAYA 2EJVA 4FJ1A 4JBIA 1XR3A 3C7CB 4M55A 4ZQFA 3DOOA 3H7AA 3ZWMA 1PS8A 2W2LA 4Z3KA 4AICA 1E1MA 1PEDA 3R6DA 4IS2A 2QQ5A 1PU2A 1YQXA 5KKCA 4MIOA 1PQPA 1YGYA 2CZCA 2GZ1A 2WJPA 3FNHA 1C1XB 2Q4BA 4PFJA 1HE2A 1IL0A 4ZN6A 4ND1A 1P44A 5CG1A 4MP6A 3W8DA 2BI8A 4XEHA 3TZCA 3JQCA 4RVDA 2EF1A 4CM4A 1VL6A 2AEFA 3UUWA 2Y68A 2HLPA 3QVWA 2VOJA 4DUPA 2I67A 3ZHXA 1DSSG 2OOSA 3L4BA 2ZB4A 3GGPA 5KIAA 2X5JO 1D1SA 5A03A 4WASA 2Y05A 3H3FA 4BNUA 3ZU2A 1MX3A 2H5LA 3TZ6A 4YR9A 3FF4A 5CDGA 1VLLA 2O7SA 1XIVA 4J3FA 4D3DA 1JLLA 3DZHA 2NU8A 1XCBA 2RCYA 2DTXA 4B8WA 5IF3A 1HDYA 1U3UA 3ON5A 3GDOA 4BO0A 4P38A 1E6UA 4W82A 4MVJM 4JBHA 1YE3A 2ZK7A 1WMBA 4XQGA 3FPLA 4KUGA 1T4BA 2DBZA 1BXGA 3LK7A 4XYMA 5KVCA 2X23A 3EY4A 2PZJA 4X54A 3EHEA 2NWQA 3FPCA 2CMDA 3S2FA 1KVQA 4IGFA 3VTZA 2PA3A 1O6ZA 3R3JA 4R9RA 4AJLA 2YV3A 3QQPA 3ZU3A 4OGWA 3VAZA 1T26A 3UH1A 4YJHA 2X0RA 3IQDB 1I3KA 4PRKA 5L7YA 5KJCA 2GN8A 2GPTA 1YRLA 1WDKA 3BTUA 1C0IA 2V65A 5F5NA 4CM1A 2ZQZA 1CIVA 2YYYA 1VM6A 3V1UA 2W98A 1KEUA 1KERA 3JQBC 4BKQA 2BFPA 5H81A 1NAHA 4RGBA 4GSLA 2Z1MA 1ZH8A 5F1OA 4NNJA 3IDSA 4J9UE 5B4TA 2FRDA 5T73A 3IUSA 3RIHA 3LVFO 1DPGA 1Y8QA 2GN6A 4CL3A 2XOXA 1R0LA 3RCBA 4CODB 4HWKA 1I36A 4FJ2A 3H9GA 1XG5A 4AJKA 1N1EA 3AOEC 1QORA 3WSWA 2B5WA 3UCXA 2V7PA 2CF6A 1C1DB 1VC2A 3KYDA 2R00A 4BO9A 5JYFA 5MGBA 3ADOA 1BRMA 3MWEB 4QUKA 3TPCA 4NBUA 3DC2A 3GVHA 4NH4A 2WTBA 4YEDA 4HFMA 5I7FA 4ROSA 5T6BA 3RJ9A 3C7DB 1ISMA 2ZYGA 2FOIA 2NTJA 4CV3A 3CTMA 5JY1A 3JQ9A 1QSGA 2LDBA 1QMGA 4I9UA 1U8XX 3RASA 3JQDA 5T8KA 2JD2A 2Y0CA 5A5FA 4D42A 4W7IA 3UVEA 1EEHA 2GCGA 3RROA 5EESA 4DPKA 3QLJA 4HFNA 3WICA 1I5RA 3BMOA 1G6KA 2YHIB 5JYAA 1ZMOA 3KEQA 4RLSA 3RUAA 4DXHA 4B7CA 1DB3A 4YT8A 3GA0A 3U4DA 3PWKA 1ONNA 4JJGA 4NU6A 4R1SA 4AG3A 1FDTA 3I1JA 4XJSA 3QA9A 4P22A 3OSUA 5KJFA 1DFHA 3SLKA 2WE7A 4DLAA 3MWDB 2I3AA 2HK9A 2PTGA 4IQGA 3M1AA 4L8VA 5GZ3A 3QRWA 4Q3EA 1JKJA 1RYDA 4NPCA 1GQ2A 4CQLB 3OEWA 1ZZEA 2IEBA 4TVOA 1DAOA 3VZQA 3ITKA 3CXRA 1ZSYA 3TQHA 3DDNA 3QHAA 2NVUB 1AHHA 3WR5A 4PGFA 1HDOA 3O4RA 2VT2A 5K9ZA 4XQCA 4LMRA 2XAAA 1OC2A 3Q2KA 3I83A 4PLWA 5L4LA 1VJ1A 4AJ2A 4J7CA 5T57A 4XX0A 4MVJA 5H83A 1DC3A 4HNHA 4E5NA 1A7AA 3EW7A 2E49A 2EJWA 3KOUA 4RQTA 1HSZA 2Q1WA 3OECA 4HXYA 4TRNA 4NK4A 1P74A 2CUKA 3ORFA 4RPGA 1ZCJA 4O1MA 1OMOA 2Q1UA 3DOJA 3JQFA 3GHYA 1PGOA 2PD4A 1JAXA 3COSA 5KOIA 4XQ9A 1WDLA 5ER9A 1Y8RB 2PKRA 1RM4A 4W9NA 3ANMA 3PJGA 1YQGA 1A4UA 2B0JA 1D8AA 1TXGA 3C3XA 3LT4A 3VPXA 1YONA 1BXGB 4EUHA 1UP7A 3NX4A 3F3SA 3PHHA 4J4TA 3Q2IA 3JQ8B 4R41A 3NV9A 2X4GA 4AJEA 4R69A 1I2ZA 1PGQA 2YQ4A 3HFGA 2IXBA 1XELA 3FBGA 1DOHA 2HSDA 3T7CA 4PG4A 1LA2A 1EK5A 3QWAA 1FJHA 1VPDA 3CZMA 3EGOA 3H2ZA 4BMSA 2IDZA 3FNGA 4ZU3A 1EDOA 1U3TA 1ZIDA 3DZBA 3I9JA 3ZV3A 1HDRA 3OETA 3H9JA 1IULA 4PRLA 3GZ4A 2SCUA 3FSRA 1GCUA 1BDBA 3L6DA 3D4PA 4TKLA 1ZFNA 2CF5A 3PJEA 3ZI0A 1RKXA 4WLOA 3Q0EA 4B3JA 3UOGA 2WM3A 4ZQBA 3ONDA 1Z45A 5B4UA 3QSGA 2I9PA 5G4KA 1JWAB 1QYCA 4Q9NA 5JCXA 2W2KA 2RAFA 3K30A 4XGKA 3VDQA 5JY6A 4ALIA 3B1FA 4GVLA 1YL5A 5TSDA 5A06A 3BMCA 1N1GA 3L4BC 5JNLA 1MFZA 4BO4A 2OO5A 5DZSA 4LRTB 1IPFA 1ZK0A 3O8QA 4FW8A 1GZ4A 3A9WA 4B79A 4OYRA 4XIJA 3RJ5A 3BHIA 3F1LA 1QLHA 3F6YA 2DAPA 4DBVO 1C0PA 1KVRA 1EQ2A 5KJ6A 3LZ6A 3DHYA 4RL6A 3UF0A 1ISJA 4A26A 3FBTA 2D0IA 2G5CA 4P8RA 1A5ZA 3B1KA 3WMWA 2OL4A 3UCEA 1SB9A 1CWUA 1I8TA 2WE8A 1Y9AA 1P1KA 2VHZA 2VZ0A 5EN4A 4FDAA 4QO8A 1F12A 4YAEA 1EQUA 3WDSA 5A05A 4IDAA 3WGYA 4N5NA 1KIFA 3DBLA 3E9NA 3JYOA 1ADFA 3JD1A 3VZSA 1B26A 4E3ZA 1D7OA 1R4MB 3O8QB 4PLZA 5JCJA 1SMKA 2OMEA 3FHLA 5JDIC 4M8SA 2RBEA 1OC4A 4MVJP 4MVJG 1JKFA 2VHVA 3ROQA 3AUUA 4F6CA 1M6WA 4S3MA 3ETDA 4WK6A 1T25A 4Z9YA 3ZWOA 1Y6JA 3KBOA 4GKVA 4G5HA 4MKRA 3I23A 2X9VA 4A10A 4OXYA 4NFYA 1WNTA 3GNQA 4KDEA 2EXXA 4ZD6A 4DPLA 5EIOA 2QW8A 3INRA 3O38A 8LDHA 5L95A 1H6CA 4N54A 2EW8A 5IXYA 5EQDA 1U5CA 5A4DA 2H63A 2P9EA 2H6EA 2EV9A 5COAA 2ZTLA 4DGSA 2DTDA 2QIOA 3VVCA 4LSWA 4CV1A 3DWFA 2WDZA 1NFQA 2ZB3A 2F1KA 3W6ZA 4CQMB 4GMGA 1ZXLA 2CVOA 1XQ6A 3E1KA 1JWBB 3KSUA 3WNQA 1FDSA 5F5LA 1H0KA 3MOIA 4ND4A 4XDZA 4E21A 4BO3A 4B3IA 4DQUA 5DP2A 1UXHA 2NSDA 2VT3A 4P4LA 5G2OA 3RC2A 3QWHA 4W7HA 2I76A 1CRWG 4CR6A 4OMUA 1ARZA 1E3EA 1T2EA 3EYWA 3KLMX 4IDDA 3EZLA 4HUJA 4NQZA 3OA0A 3AY3A 4FGSA 4CR7A 4PLPA 4I5FA 2QRLA 3JCZA 4J91A 2GYYA 4WJZA 3ZU4A 3RFTA 1H6DA 5CPFA 4MVJE 4DLBA 1VKOA 2QZ9A 1PZHA 1NQOA 2C7VA 3N7UA 1HDGO 4PVCA 2IE0A 4JQCA 1X15A 4DPMA 1NQTA 4PCVA 4XDYA 4Z3DA 3ZV6A 4A5OA 2NQ8A 1G1AA 4M86A 2BRUA 4DMMA 3WIDA 2D5AA 4IS3A 2YHIA 1J5PA 1SAYA 2D5CA 2G0TA 2W2KB 4YRBA 4FSHA 4OSOA 2GNAA 3CSDA 4XQEA 2FSSA 4BMNA 4Y98A 4ONEA 1GEEA 3MJTA 4K28A 5L3ZA 1Z75A 1B15A 3IP1A 4FIZA 3WSVA 3GRPA 5J9GA 4I08A 2I65A 1A7KA 1W73A 1XQ1A 2GGSA 1J6UA 5T8KC 3TSCA 4O0LA 3L0DA 1TT7A 3HB4X 4WLEA 3RVDA 3GG2A 4RVFA 2NLOA 1V3TA 4GAEA 3GG9A 3B1JA 4RVSA 1LSUA 1PZGA 3U9LA 4NJMB 3INTA 3NDIA 1UAYA 4W9NC 1LUAA 2CY0A 3ZNNA 4BNHA 5G0VA 4CUKA 1NNUA 3DZIA 3PQDA 4OOEA 4UULA 1PL6A 2NNLD 5CDSA 1H6AA 3OJ0A 3DFUA 2AA3A 1K3TA 1R12A 4GX1A 2HKIA 4WLVA 1BW9B 4ZQGA 1E3JA 2OORA 2X58A 3TFOA 3HUDA 4FOOA 1M67A 5TNXA 3L07A 3JYPA 3PIIA 2C2XA 3GF4A 2B4QA 2UUOA 1A72A 4HADA 3RBVA 3F46A 3D4OA 4M89A 5DOZA 5F3RA 5A9TA 2EGHA 3ZCXA 1IPEA 1LXCA 3WQSB 3D3WB 1EE9A 5IDXA 5JAMA 3WFJA 3RAJA 1IY8A 3QVOA 5KJ1A 5C7IO 3A06A 3GR6A 5THQA 3RQSA 4JBGA 3ANLA 1KC1A 2PD6A 3I9OA 3L9XA 3SXPA 4J1NA 3VPGA 5DBFA 4D3FA 3PFFA 5CFZA 4R3WA 4RORA 2IEDA 1HETA 2PR2A 1LLDA 4PG7A 4XGIA 2TMGA 3LF1A 2EP7A 1SB8A 5JMPA 4M49A 2EKPA 1X7GA 3WJ7A 4L4SA 1MFPA 1YOVB 4QFCA 5DCUA 1E3WB 4A03A 2VUSA 2ZB7A 2VHXA 1P1HA 3WBFA 4RVHA 4YJGB 4NMHA 5G0SA 1U3WA 3B70A 3LC2O 4UAGA 4XIYA 4W4TA 3OIFA 1PJQA 4AJIA 1NR1A 1T2CA 2ZQYA 1O0SA 2FHSA 2X9NA 3HDJA 4IDCA 4XR4A 4CMHA 4Z0HO 1X7HA 3D7LA 2W8ZA 1X7DA 2DBRA 3TWOA 2XXBA 3GPDG 2AE2A 3RUEA 4ZRMA 1R4MA 5CEJA 2HRZA 3K2BA 1RM0A 1GYQA 1TT5B 4LMPA 2GN9A 3KXDA 5GZ6A 3ICCA 4PN3A 3B6ZA 1JW9B 1MB4A 1C0LA 3BIOA 4UUMA 4BKPA 1GYPA 1EZ4A 2YQ5A 3JD3A 5JDCA 3KV3O 4NR0A 3WYCA 1BWSA 1MC5A 2POQX 1UDAA 3SVTA 4U0JA 5KKAA 1R4NB 5L45A 3QW2A 2VWQA 3ZHBA 3E82A 1PGNA 1XLTA 3C7AA 3OM9A 2HMTA 3GMDA 3LLVA 5EL0A 5TJ9A 4TZTA 4ND2A 1PL7A 1BSVA 4AVYA 5BNIA 5JFOA 5AXCA 3VH1A 1HXHA 1KYQA 2DLDA 4J9VA 3SX2A 4FFRA 5L4SA 3NTRA 1AXGA 4L4RA 3WGQA 1GEGA 4RPLA 1EVJA 4IY1A 4BKOA 2Y0DA 2BD0A 5JDIA 3K31A 1U7TA 2BFMA 3FTNA 4INAA 1P77A 3CMMA 1LSSA 1GY8A 4JJFA 3IKTA 2Q2QA 3X2FA 5G0TA 2Q49A 4UUOA 3NRCA 1L1FA 5AYVA 1NPYA 1UXJA 4J0EA 2ZYAA 4Y6SA 5TLSA 1DLIA 4DA9A 3OMLA 2GO1A 3AI3A 3WGHA 4E0BA 1YO6A 3BMCB 1W4ZA 3KLPX 3WG9A 2B69A 3RUCA 1M75A 1MLDA 1GZ3A 3V5NA 1GV1A 3EUWA 2DPGA 2OHXA 3ZZNA 4D43A 4YAKA 1SEPA 1O94A 1ZK2A 3W8EA 4FFLA 3L9WA 1GD1O 1ONOA 3ZNPA 4F3YA 5I7EA 3IJPA 4MP3A 1GUYA 1K2WA 2O2YA 4ITUA 1UXIA 3U4CA 1C3VA 1TEHA 1TLTA 3MTJA 1R6DA 2D59A 3AY7A 2Q3EA 3GNTA 4UEJA 2O2SA 3U62A 2DFDA 2G76A 3AOGA 1ADBA 3FR8A 3STHA 5CEFA 2UDPA 1HDXA 1LX6A 4IPTA 1HE5A 4J1SA 5IJZA 4NI5A 1EK6A 3FNEA 4HFRA 4L74A 3FI9A 1NVMB 4R1TA 3S2EA 3E6AA 4MVJF 5I9LA 2CNBA 1QYXA 2PGJA 4BO5A 2Y1FA 3F9IA 3VHRA 5A3JA 2VQ3A 3A28A 4NBRA 1V6AA 4PZEA 2VNSA 4PLGA 5H82A 4CM6A 3VC7A 3TFQA 4UVIA 1A4IA 4GGOA 3E9MA 3VVBA 4DIOA 5L51A 2C0CA 2QHXA 1XU7A 5CPBA 2GF2A 1DBVO 1ZO8A 2PFGA 3OEYA 1ZBQA 3GVCA 2FMUA 3ENKA 2GSDA 2PLAA 3GFBA 3IKVA 1LJ8A 1LDMA 4GPD1 2HMSA 1ULSA 5DCYA 5ICMA 1A9ZA 1YH3A 1U28A 4M54A 1Y9EA 2O23A 4FOSA 1N7HA 5TF4A 4GMFA 2G82A 4J2OA 4P4NA 3C1TA 2IZ0A 5B1YA 3RD5A 2UV8A 4IIUA 4D79A 3DL2A 1LDNA 4UVHA 4BQRA 4RJTA 3AW9A 2JCVA 3WQQA 4GWKA 3WBBA 1XDWA 4RV9A 1LI4A 2X5OA 1H5QA 4HX5A 5TIIA 4FD3A 2Q1SA 2UAGA 4CUZA 1ULUA 3ANNA 4CMAA 1GPDG 5JCJD 3RC1A 3R3SA 4ND5A 4Q3CA 1PR3A 2RH4A 4EBFA 4XJTA 5A9SA 4BQPA 5CG2A 3EVTA 3NGLA 2IODA 1I2CA 2PWZA 3ONFA 1GFSA 5AXBA 2PY6A 4YT2A 5JPIA 2BELA 1J49A 1KBZA 2PGLA 1Y7TA 5DDIP 1T2DA 2DT5A 3K2EA 4J49A 1H6BA 3F1KA 1WZEA 4GH5A 4ZQHA 3JQFC 3IUPA 3JYLA 1EUZA 3R1IA 4CLXA 2QX7A 3H6KA 1CETA 1FDWA 1LU9A 2J6IA 2HMUA 2ZTMA 2O3RA 1E0DA 4TZKA 1B16A 1DJNA 3HJAA 4KQXA 3PDJA 5U4QA 4BNFA 2FPIA 3AM3A 1NVGA 3ZWWA 1ADGA 2NVUA 2WD7B 3I4FA 4AJNA 1UZLA 4IIVA 3TDKA 3JQAB 5JLAA 1DFIA 3S8MA 1LQUA 3DO5A 1EVIA 5JAQA 3D4NA 1U1IA 2J8ZA 4TVBA 4EITA 2CDCA 3MEQA 1V8BA 1YB4A 4R16A 1I3MA 5HWSA 2NVBA 3AFNA 1ZEJA 2IRWA 3R0IA 4IDBA 4RZHA 3HDHA 4JJIA 5COQA 3VH3A 4AJOA 1DEHA 2HU2A 4J4BA 1CDOA 1SO8A 1LDBA 2D8AA 2FR8A 1BMDA 2C29D 1A27A 4JLWA 2O3UA 3JQGA 4Y67A 2ZATA 4CV2A 3TL2A 2GERA 4B4WA 3LYLA 5I9MA 4FC6A 2E6UX 4GSKA 5IDYA 5I7SA 4EUEA 1ZVMA 5BQFA 3DZKA 1HDZA 2PZKA 4J0FA 4GWGA 3DMTC 4QTZA 4WLNA 5F1PA 3ZW8A 4XYLA 4JROA 4MVJD 4DRYA 4K6CA 5L9AA 4O63O 4CLRB 4G2NA 1E3WA 4ID9A 3DBRA 3CUKA 4ZHSA 5FI3A 5ENDA 1LSOA 4MP8A 4NG5A 4QO7A 4HKTA 3F5SA 1JU9A 1VRWA 2YDYA 5BNTA 3C24A 4CM5A 4PLVA 4F6LA 4M87A 2AQ8A 1UJMA 2B4TO 2QZZA 3GVIA 1N92A 2VNAA 1PJCA 3B20A 3K9QO 1EUDA 3PHJA 4MO2A 4BNNA 1KEPA 2IYOA 1MV8A 3HHPA 1GYRA 4HBGA 2QRKA 1C14A 1MC4A 4BKUA 1E1NA 3GAFA 5A9RA 1GU7A 4NK5A 2Z5LA 3F4LA 3V2HA 4XA8A 4YXFA 5DOVA 1T2AA 1V3UA 4YJFB 1E7MA 4I5GA 4OQYA 5DULA 2WYVA 2HMVA 4GLOA 5I8WA 1BGVA 2WSBA 3Q9UA 3G17A 4HNGA 2JFHA 4XD2A 5JBIA 3E18A 3FTPA 1P1JA 2E37A 2O48X 4XB1A 1PIWA 3GVXA 3KETA 2NQTA 4ZGWA 1B8PA 3AJRA 4N5LA 4KDFA 2E4AA 2PH5A 4Y6RA 5BT9A 2Y66A 3U0BA 1S7CA 3PJFA 4R5HA 4OO3A 3CKYA 1JVSA 3NYWA 4XRGA 5B4VA 1KVSA 4CLOB 3IMFA 4DMLA 5JS6A 4IMRA 1SNYA 2Y1GA 2YDXA 5TS3A 3GPIA 2V6GA 4B4OA 3AK4A 1GUZA 4CMEA 5C7OO 2NADA 4YWJA 2A9FA 3VZRA 3WNVA 4FJ0A 5G0UA 2VCYA 4CMKA 3G49A 4OHUA 4BO1A 3OQ1A 1ENYA 1B3RA 6ADHA 4PG8A 3IJRA 4BHTA 1C1DA 2FZWA 3OICA 3OQBA 1K5HA 1R4NA 3MCVA 3GDGA 3IAHA 4UUNA 4E30A 1KOLA 4II2A 1XSEA 4IUYA 4XWYA 2LDXA 3ZNQA 9LDTA 2X0IA 4CLHA 1YJ8A 3GEMA 1HDCA 1HL3A 3JQ6A 3JYQA 4RDIA 1K6XA 5FFFA 3W4KA 3ZW9A 2FPPA 1E7RA 1N9GB 1IOLA 4YYZA 1I0ZA 3DTTA 3IS3A 2OZPA 2OUIA 1U2GA 4UVEA 4A73A 3DBLB 2I3GA 1NFFA 4JX8A 3E5RA 3UW3A 4YPOA 1QLJA 4CMBA 1OFGA 4BB6A 3CINA 3EVNA 4O59O 3HWRA 4D45A 3O03A 4XYGA 4FFPA 4C4OA 3GRKA 4IQ0A 3QIVA 1R16A 4RF4A 2GDZA 3WX0A 1S6YA 4R5MA 2VN8A 3TF5A 4E12A 4QFDA 4S1VA 4YTEA 1NASA 5JO0A 3S1LA 4OJNA 2EIHA 3DAFA 1NR7A 3JD4A 1VL8A 5CAEA 2P2SA 3PZRA 2EGGA 1NAIA 1YL6A 2A92A 5IFLA 3JQAD 4U6SA 1NPDA 4R68A 3ZWPA 3DXFA 3DMYA 1LDEA 2BKAA 3ICPA 4DL9A 1HYHA 1GUFA 2J3JA 4XGNA 1WXDA 3SJUA 2NUAA 3BAZA 3NEPX 1LDGA 3BTOA 4W99A 3ZWNA 1BG6A 3KYCA 4XYEA 1LC3A 3L6OO 1EDZA 2XF8A 4MJLA 5TT1A 4GGPA 5HS6A 5COBA 4CLDA 1AHIA 3ZU5A 4CM3A 3GK3A 1XA0A 2NTNA 1JA9A 3MJVA 4YJHB 3DHEA 1WZIA 4L4XA 1W0CA 4OXKA 5TQVA 4H7PA 1ONPA 1UP4A 1I32A 2QYSA 4PZDA 4TWRA 5IG2A 1U7HA 4U5QA 1X0VA 5HA5A 4U7WA 2D4AA 3ZGYA 3AU9A 4XZ3A 1GZ6A 3W1VA 1QP8A 3M2TA 1P1FA 4XKJA 1KY4A 1M6HA 5IN4A 2AQKA 1DHRA 3DMTA 3I4CA 3BZUA 3PTZA 3NT2A 4E2YA 4E2ZA 3VPFA 4H3VA 2HMWA 3WOHA 1RJWA 1T1RA 5JAZA 2R00C 3JQGB 2BH9A 1QV7A 1NYTA 5JXWA 2YFQA 1TT5A 5TRTA 2I99A 4XCVA 4YACA 4QXMA 1X13A 1OI7A 2BHLA 1N7GA 3VTFA 2IXAA 2O4UX 3AI1A 2EP5A 1Q0HA 3TRIA 4W6ZA 2Z1NA 2O3QA 4KTTE 1E7QA 1MUUA 3ASUA 1V3VA 5EERA 1YKFA 4BGIA 3VOSA 2WYUA 1NPTO 1MXFA 4WNIA 1X1EA 3A1NA 3RSHA 3ZHZA 2VHWA 3FRJA 5K0ZA 3ETGA 3ZWVA 7ADHA 1DC5A 5BR7A 3EAGA 3OIDA 4N18A 4OSPA 3JQAA 1PS0A 4MVJI 3TZKA 1XU9A 4DYDA 2NU7A 1T2FA 1UAGA 5F1KA 3WIEA 4AJPA 1HE4A 5B12A 5THKA 1Q2XA 3MJCA 3Q3CA 4FB5A 4IM7A 2WEKA 1P1IA 4AJHA 2Y1OA 2UVDA 4YRAA 1SCUA 1Y8QB 2HDHA 1CEQA 1LLQA 5A02A 1BDMA 4BGVA 3CH6A 1WMAA 3H8VA 3ZH2A 4BNXA 1SOWA 1DLJA 1YB1A 3QWIA 1H94A 1EMDA 3NT5A 4B4VA 2Q46A 2PZMA 4QECA 4KQWA 2YV2A 4OOFA 1WAMA 1HTBA 1L7EA 4LVCA 4Y6PA 3BMNB 1UDCA 2O4CA 3ZWYA 1PJ3A 2DM6A 2Y93A 4B4UA 2JAPA 1AGNA 3JYNA 4J2HA 5LDGA 3UCFA 1YBVA 1ID1A 1P33A 4ND3A 4U0KA 1QKIA 1OOEA 4H16A 4NDNE 1SC6A 4YT4A 2X0JA 5KCZA 3A4VA 4JCOA 4GL4A 3ST7A 4CMCA 4CV0A 2Q2WA 2AE1A 2P5YA 3I6IA 1ZK4A 1JN0A 3H9EO 2CFCA 3SEFA 4EEXA 4CM8A 5B37A 4RVGA 1E1KA 1WDMA 3TNLA 1PJSA 1QR6A 2V6FA 3D5TA 4JP3A 3G1TA 4NIMA 3PXXA 4LW8A 5CHEA 2I5PO 4WCFC 1YXMA 3G0OA 3Q9NA 1PR9A 8ADHA 2VRBA 2B36A 1GR0A 2DU8A 2C5EA 4AJ1A 4GX5A 3KEOA 1HF3A 4ALMA 4NFHA 2EG9A 3JQ8A 3RUIA 4CR8A 1HSOA 4TRJA 4F45A 1DIHA 1G0OA 2FR1A 3BTVA 1B3BA 4E5KA 3KHUA 4J7UA 1R15A 3OJLA 5ER6A 1YVEI 4HV4A 4YDRA 3AM5A 4FBGA 3RBXA 1BHSA 2BGLA 3ONEA 1DC6A 2NU6A 4WLUA 4OIMA 1MXHA 1GV0A 2H1SA 2ZCVA 4URFA 3WGIA 3GAZA 2YY7A 3OJOA 3JQ7B 4RPKA 3VPHA 4UUPA 3FWNA 2EWMA 1VSUA 4IGEA 2O7QA 2A4KA 3P2YA 1YL7A 1CF2O 2BMAA 3EDMA 4E32A 4FC7A 4M1QA 2ZKLA 3P2OA 4L0QA 1GDHA 3GEDA 4FGWA 4UVDA 5AXAA 4A0SA 4D41A 3BMNA 3WWYA 3LT0A 4K1LA 3P19A 2HQ1A 4B7UA 4JGBA 1F8GA 1LRLA 1EFKA 1KC3A 4L73A 5TT0A 3RWBA 3S2IA 5L4NA 1T1SA 5J23A 4DVJA 3WS7A 1FMCA 3AI2A 5FEUA 1R0KA 1NX6A 1U4SA 2ET6A 4Z0PA 5T67A 2BGKA 5EINA 3GN2A 3HB5X 1IUKA 1I2BA 3V2GA 2FSVA 2W90A 3I6QA 2Z95A 4IQ8A 3TL3A 1I24A 3PHGA 1W6UA 4GQAA 2AW5A 4NZ9A 4YVFA 1ISIA 2FY8A 1DHTA 2GZ2A 1XYGA 5TJHA 3PGJA 3KYDB 2G17A 1Z74A 3UFXA 3ZNOA 2X5KO 2ZTUA 3AUSA 2R2GA 1V35A 2FP4A 1NHWA 1XWFA 2F00A 3SC4A 4D46A 1EUCA 3M6IA 3D5QA 4IINA 3NTOA 4HY3A 2WD7A 2OBYA 1W8DA 5BNFA 3AUAA 1LQTA 3GOHA 4CUJA 3HN7A 1MG5A 1PZEA 1BVRA 1WLYA 5I7VA 1DFGA 4EJ6A 4XR9A 5IN5A 4E5YA 4YCAA 2WMDA 4RO0A 1X14A 3HDQA 4E5MA 2GUGA 2VTDA 3PPIA 2J3IA 4BNTA 2PNFA 4GBJA 4LVUA 3DZJA 3GUCA 1TA4A 1C0KA 3FWZA 3DQPA 2Q22A 4A7PA 2YUTA 3DB2A 4ILKA 3KYCB 1MGOA 2GRAA 2NTVA 2C7GA 2X86A 1LBEA 4AJ4A 4KWIA 1E5QA 3LC7O 3WGTA 2EKLA 4O6VA 4Q3NA 1EFLA 4RDHA 2NU9A 1PX0A 3S2GA 3VZPA 3GY0A 5EMHA 4UEKA 4DLLA 1OZAA 1P0CA 4TROA 4R1UA 2CVQA 4BNMA 4YT5A 5CDTA 3HFSA 3CPSA 1IB6A 1K0UA 3IOYA 3NGXA 5FYDA 3E8XA 4RVUA 1VL0A 1PJ4A 1E92A 1Z73A 1O89A 3HE3A 4KUEA 5JO9A 1RM5A 1VJ0A 2JKVA 5JYEA 3BMQA 2O3JA 1E6WA 2UUPA 3KRTA 1AUPA 4QT0A 3NAQA 4OXNA 1AN9A 4BGEA 4PLYA 5BSHA 3TN7A 3CZRA 2X0NA 3M1LA 1NTOA 3WTBA 4MKZA 1PQUA 1LC0A 2AEJA 4II3A 2NV6A 3TZQA 1Y1PA 3RKRA 3NJ8A 2DBQA 3KTDA 3UICA 1PWZA 3VKUA 4E4YA 1MP0A 2DFVA 4OQZA 1LTHR 1ZK1A 1B0AA 4WKGA 3T4EA 4CLOA 3GN1A 1WPQA 2C20A 4B3HA 3P7MA 1NBOA 1DIBA 2YW9A 3BA1A 1PL8A 1E3LA 1YDWA 2HK7A 2P9GA 5DCWA 5FI5A 3T4XA 2XPCA 1E6EA 2JHGA 4Z9FA 1IZ0A 1ENPA 1P31A 2HRBA 1HE3A 1UP6A 5DNAA 3HN2A 3TOZA 1Q7BA 1L7DA 1N8KA 4I1IA 3PFWO 1LDYA 3ZN2A 1I33A 1YQDA 2RHCA 3DR3A 4BMVA 1X0XA 2AQIA 1XKQA 4ZVVA 4ESOA 3MJSA 1PS9A 4KTVE 5I8ZA 1KEVA 4ZA2A 2CDAA 4P4GA 3V1TC 3K96A 1DRWA 1BTOA 5IDQA 4KOAA 1HYGA 4LCEA 4OM8A 5DT9A 3RUDA 4IBOA 4LRSB 4BNLA 3I9NA 2BFAA 2OP1A 5LDHA 3U4IA 1OBFO 1Q0LA 3WYBA 2UYYA 3RI3A 1ISGA 4QEDA 3ZV4A 3C8MA 3N74A 3OIGA 4PVDA 2X8LA 5DBIA 4LGVA 2JCYA 2EERA 1FK8A 4YAGA 2QYTA 1UUFA 2AMFA 4CQMA 3SBOA 4BNIA 3GHHA 3ROKA 4J16A 2O3TA 4FFMA 3WJAA 3GUYA 1NM5A 4FQ8A 1CYDA 2VYND 1BVUA 3UAGA 2VRCA 1TVEA 1EVZA 2YJZA 1IHYA 3AWDA 2BFOA 4YJGA 4DREA 2A35A 4E33A 3OFSA 4WOKA 5CP8A 1FDUA 2PGDA 2QG4A 3AU8A 3U49A 5KVQA 3HADA 2X1HA 1YDEA 2WD8A 3S55A 3ROMA 2C5AA 4WCFB 3JQEA 4WOJA 3JSAA 1AXEA 3UGKA 1J4AA 3QWBA 3HDYA 5CDYA 5GY7A 1UXKA 1V9LA 2VZ9A 5K6AA 1ZUD1 9LDBA 5HTOA 1GPJA 1ZSNA 4FFOA 3I9LA 4E6PA 1Q7GA 3KB6A 3H5AA 5KVVA 5BSFA 4DC0A 1CERA 3DZGA 1ZEMA 4WLFA 1HKUA 3O26A 4EJ0A 1E1LA 3AM4A 1B2LA 3PP8A 3WGOA 2VYVA 1PTJA 4RZIA 4BNWA 4H15A 3QJ5A 2AG8A 2D3TA 1ZMTA 3DTYA 1IYZA 4PZCA 1DXYA 2HUNA 1DIAA 1IE3A 2AQHA 2J5KA 4OAQA 2D1YA 3D64A 3NT4A 2PZLA 3PI7A 5EQFA 3W6UA 5JYDA 3PHIA 3PLNA 3UN1A 1U5AA 1DO8A 1MA0A 3H4VA 4R3NA 2BF7A 2EHDA 1TI7A 2PV7A 2Q2VA
chains in the Genus database with same CATH superfamily
3QY9A 4BS9A 3ZY3A 3DR5A 1VLMA 1DQYA 4QUJA 1ZNYA 3MBIA 1T2VA 2CLDX 2GZDA 3IUBA 1MX9A 4CMGA 4URVR 4AZ0B 1T1EA 3HA2A 2WP0A 1W8IA 1S2OA 3KQPA 4XIFA 2I7XA 1KQ3A 3F7NA 3B3GA 4BCDA 5BV1A 3HWWA 1DTSA 4MEJA 4GR5A 3TZHA 3V4OA 4CFYA 1P9WA 4QHTA 1P5HA 2D2IA 1Z8FA 4RA6A 4LK2A 3RTDA 1SQ5A 3UB2A 4X60A 3WK8A 4BNVA 5J3JA 2E9SA 1E59A 2QE6A 3UMFA 5LP1A 3I01A 4U2DA 3UAOA 1I01A 1TZMA 4P7JA 3RTBA 3HBFA 1TM5E 3P9IA 1XMSA 3FCOA 3I3OA 3C1OA 5E9WA 1UPXA 3SFZA 3ANXA 1ZBDA 4J76A 3W3AD 1IU9A 3CF2A 4KWTA 1OF1A 1M0WA 4BTLA 3HYRA 1RRPA 2FWPA 1YFZA 2GR9A 2Q5IA 3HQ4O 3K15A 3ZEAA 2P4QA 4HDRB 3FCXA 5F7ZA 1M0EA 2FSPA 3K0AB 3EGDB 4H6XA 5IBPA 5A5EA 2O59A 3MSXA 1IUPA 1CJKC 1KXJA 1UBTS 1EFVB 2NW6A 2IUFA 3DAGA 2IVFA 2VF5X 4YMIA 5FWXB 3TLBA 2FR0A 2B5OA 2ORVA 3IDAA 4YA6A 2P62A 3QFTA 2I3BA 1W5AA 1Y3FE 1Z6XA 1U8FO 4LJ8A 1WY5A 3ZWBA 2JJ1A 2GM5A 3OEHA 4X6YA 4NCIA 4OHOA 4BNJA 4US1R 2JVIA 3FD8A 4W5RA 1R0SA 4MRNA 3C8UA 2QPAA 3NHRA 4RTMA 1MTOA 3V8NA 2JBWA 2J9FA 5EMKA 3HSKA 1UBCA 3DFZA 1DU4A 2F9MA 4JVNA 1JEYB 2FX3A 3G8YA 3B2EA 2YN0A 3FJOA 4R2LA 1L4FA 4B9AA 4D4MA 3L1IA 2FFAA 3U5TA 1ADJA 1G6Q1 2YMPA 3QE4A 1F8UA 3AVPA 5JC8A 4RF2A 5IVHA 3SM9A 5REQA 5JAIA 1QV6A 3SHVA 4AULA 1R66A 1L3CA 3ADPA 5HYVA 5TQ2A 1D4FA 3PNSA 4E2WA 4EEZA 1TQHA 3EG5A 5IRCD 4YMHA 2EYQA 1DDIA 3I62A 1T4MA 5EJIA 1T6ZA 1GITA 1B8UA 1G21A 3KQYA 3L82B 2JD0A 4JU9A 1AGXA 1IXRC 3HYCA 3JWGA 5EZ5A 3L6EA 3RSQA 3PSHA 1V0JA 1QFZA 3F5MA 3I9KA 2HU5A 2R8PA 3ND6A 2JGMA 1Z3IX 2WYWA 3VHLB 4GKKB 2ZJAA 2OENG 1KDPA 2CD9A 2LNDA 2WP8J 3KHKA 5CH8A 4KIFA 3IDQA 2ZIZA 3R40A 3RHSA 3IPLA 4EI8A 5AK0A 3GQVA 1RAEA 2H9IA 5LP6F 3FDJA 1ESMA 2XNDA 1UEIA 3JQBA 1UMBB 1M34E 3TAUA 1R0CA 3HYTA 1U04A 4DQVA 4EJ2A 1NQAO 1W88A 4TTAA 3JD2A 2I1QA 4RZ2A 3IAS1 3GRRA 5F7OA 3BH7A 1TGVA 2PSDA 1C9YA 2ADOA 2AC4A 1LPSA 4DWVA 3RVSA 3EWIA 5AXDA 4Q1EA 3OO0A 5JFGA 4QBKA 4P1ZA 5BRNA 1TM1E 4RJKA 4BMDA 2OFXA 3ISJA 4I9NA 2OCXA 1HRDA 3AESA 4GR4A 1C1XA 1MT3A 2Z8YA 4JOBA 3A14A 3STXA 3NVMB 3RS8A 1ZLYA 3IVCA 2EP8A 4KPUB 3BSYA 5EG5A 3TD6A 4PNHA 1RMYA 4PFSA 1YRHA 1KY5A 5CFMA 2AFHB 4YUWA 5JD3A 1Y89A 3Q6MA 2O6LA 4YUXA 4WUVA 1JQJC 1E77A 2WU8A 1LFAA 2BCEA 2XLCA 2P1DA 3P5SA 2CHEA 1F3LA 1C8LA 1NJ5A 2ZRKA 4EG0A 5JHHB 4HNUA 2ZZNA 2J4DA 4R1NA 2I03A 4PAMA 1AOXA 1J0BA 1EX6A 2R6JA 1BOOA 3H1TA 2ZWPA 3KU4A 3OU2A 4QPCA 3M7IA 5HIMA 2AXEA 4OIFA 2HADA 1BMFA 2DHDA 5T4HA 3C8HA 1XZEA 3M6MD 2A58A 3PNPA 1P60A 3DSRA 3BGIA 3NHBA 5DRTA 5CDUA 1SBYA 4ZVQA 4JBLA 3BM5A 1U8CB 2BEUB 4LYHA 2OYRA 3F8WA 3C6XA 1O95C 4NFSA 2BIFA 2EBFX 4H0FA 3GVPA 3HR7A 2Q50A 2J5RA 3LPAA 3DVLA 4HXFB 2QN2A 1GWNA 2P0EA 2BSQA 1CIPA 3QPUA 4DM4A 2KW5A 2EZTA 2ZE7A 4O5OA 1NP7A 1DUIA 1M2GA 3RVNA 1QRAA 1N8SA 1CLEA 3RADC 1U3FA 3PHLA 3S4YA 3IXMA 4WAUA 4GOXA 4KOEC 1SVNA 5A4FS 3WBKA 1AGYA 2RH8A 5DWVA 3DLAA 1KQFA 2A1UB 3EOBI 3GEGA 3P5BA 3TGWA 1D4ZA 4FYVA 5EWJB 1UDRA 4R71A 5TMEA 3HS3A 2CDRA 4Z0TA 2YNMD 2CLKB 2WU1A 1W5TA 3B8EA 4MVXA 5D86A 4L0CA 3L2OB 1D04A 2DR3A 4Q3DA 3RYCB 3I1IA 3GLIA 2W48A 4QYTA 2BM9A 3QELB 2GD1O 3ZW7A 3IP9A 5LCXA 4PYOA 4EQ6B 2QEQA 1G60A 2OHVA 4HGPA 4TKUB 3TIFA 7MDHA 4V02A 1RP7A 3HTXA 3TDNA 2OBNA 3GC6A 4CF6A 1AK1A 4Y2QA 3MTAA 2W58A 5C1OA 2HQSA 4BL5A 1J5XA 1R0BA 2DVMA 3TBHA 2JFXA 4KQMA 1ZRHA 5DRYA 1SCBA 3WL6A 5ENVA 5C8YF 3KZXA 1H8EA 1BJTA 2RB4A 4YY3B 1TAQA 4DLSA 7GPBA 1BW9A 1GHTA 3AETA 2WZCA 3PWZA 2X15A 3NKLA 4RC9A 4XW2A 4BV8A 5JJCA 4DCCA 2IEZA 5LZ4A 1KPGA 3ABIA 3EISA 1DAMA 3PYLA 3AUYA 1JXOA 2B83A 3VO9A 4ZV4A 1S89A 4DMRA 2I34A 4F56A 3BCSA 1JH8A 2GZ3A 2E21A 4HEQA 3OLYA 1UKZA 5ICEA 1IVYA 5LQNA 1SRRA 4QBFA 3BIWA 5ALHA 3SWWA 1EHYA 4TRRA 4EB6B 9ATCA 4K5QA 1GZ7A 3VU3A 2WQ6A 3NUGA 1B14A 4XJVA 4BVLA 1BFUA 1F9EA 2R44A 1CS4C 3RWMB 1F0PA 2BEVB 2MR6A 2ZUCA 1EP1B 4M76B 4UBKA 2BCGY 3RR2A 3W8FA 1J39A 2WZBA 1NIJA 2P9YA 3SDSA 2PEYA 4IYRA 2I6QA 4RTLA 2B2NA 4U7TB 5ERGB 4LYYA 1ZCZA 3VNRA 1E1RD 3A2KA 1SOVA 2JLBA 3BMOB 3AJAA 4HQOA 4NZZA 1WLSA 4XSHA 5SYAA 4BUCA 1T9HA 4CG1A 4B7AA 4YAUA 2E5FA 2OZKA 3K9HA 3O1LA 3AFGA 1TTPB 1GG2A 1YS1X 4MAAA 5KWEA 1ULBA 4J0IA 4R9UC 3AILA 3A9CA 4F9TA 2P6MA 3IP7A 3FF1A 3JR3A 2BGUA 1RHKA 2DR2A 2HSZA 1V16B 1DXOA 2IUEA 4DLUA 1F2TA 5T5QA 2JLWA 4WEOA 2WUGA 1MIOB 4V0ME 3SR3A 4R51A 5DI3A 5HM8A 2F2TA 3WKEA 3OOYA 2JIDA 4LOAA 4OCZA 3AESB 4UNSA 2ZSUA 3EP8B 1MRSA 4GVXA 4OBBA 2RBKA 4C7JA 1DBIA 1I4LD 4YS6A 4KAFA 2X5XA 1YRAA 1AA6A 2LTAA 5KVSA 4NBTA 1N7JA 3TM4A 1ZI8A 5FA5A 2WK1A 4CMJA 4O29A 4V0MA 3WADA 1RJ9B 1ZJ6A 5DYGA 1U2GC 1RE1A 2O14A 2AXQA 2NO0A 4UUBA 3TLGB 2LPMA 1G8JA 2PWYA 4DKJA 3OJEA 5DISB 4XYBA 4OFZA 3EXEB 4HVAA 1OLUA 1RLTA 3BCRA 2ID8A 2RSLA 3D2CA 3NXSA 5TPWA 2SKDA 5EJ4A 3C7TA 4GMKA 4Z7OB 2GILA 2Z0MA 2C4MA 5EJ7A 2RGUA 3LECA 5KSWB 2WR8A 4PV7A 1I7BB 1R18A 2ZPUA 1J0XO 1B7GO 5DYTA 3R8FA 5JV5A 1KP9A 2GCOB 2GPSA 3FCYA 2BDUA 1F0YA 2VUTA 3Q0TA 1RADA 4O2BB 3IWDB 4J43A 3M6AA 2BMDA 1CIJA 1YTLA 3G2IA 3I45A 3MMZA 3PD7A 4NEGA 4PFQA 2XUJA 3RKUA 4BB5A 3PXEA 4IKOA 4QPDA 3F73A 3DTVD 3DJYA 4KO1S 4Q39A 1D9XA 4RF3A 5EVCA 3OCUA 2AJ8A 1JKMA 2VEDA 1XQ9A 1W1IA 3ZDEA 2H7VA 4KODA 2AFIE 1HYEA 1EZZA 1UANA 3KJNA 2ZUFA 1S5PA 1UBSB 3NU1A 1HH4A 3D7MA 3BJMA 3I2YX 4YAJA 3NOXA 2WNSA 2Q2NA 1H1LA 4HQNA 3UUFA 3EARA 2Q6TA 5I5EA 5KOJA 1QJCA 1A71A 1KI6A 2PBLA 2G72A 2PBRA 5K7SA 2IPAB 3V3KA 5J2UB 1W76A 3Q3VA 3ZWAA 1HEUA 2Y1EA 3MCAA 4YRJA 3E35A 4O2LA 1AK9A 4ISCA 5TX7A 4OKNA 4BAGA 4GP7A 2P4HX 4YRZA 2AFIA 1ODFA 4X71A 1DKPA 1QIMA 2R65A 1UZMA 4WNAA 2O7NA 1LRJA 5FCDA 3SQNA 4EFNA 1DC4A 821PA 3ZDYB 1I4DD 1PZNA 3BZWA 3G1UA 4PM4A 5HBGA 4F46A 3U4MA 4K2HA 3NTXA 2JGFA 3MZ0A 2K6GA 4J0KA 1HT2E 5AVJA 4UFNA 5HFAA 4JDUA 4DZRA 3AEUA 4AU1A 1DTWB 1J24A 4D8XA 4K9OA 2ZYDA 4TPKA 3RFVA 2VO1A 1H3NA 1ZW1A 1MAUA 1KNXA 1TKRA 3K9CA 4ZAZA 4BNKA 2QX6A 1GQYA 2BISA 2FPIB 5ICSA 2V8OA 2G1UA 1U3VA 1DEAA 4TMZA 5DBGA 4G4SO 2HXYA 2J3QA 4OQPA 1BS1A 1UMDB 2WZQA 4PPQA 3W7VA 1XVVA 1PJLA 2FRVA 4NCKA 2R8ZA 3LCMA 4HGYA 3E7FA 1OLXA 4KL8S 3QVXA 5KOJB 4DLNA 1EE2A 1N5DA 2HNAA 5K0JA 2C97A 4ZICA 1WY7A 2ROQA 5D7NA 5SZJA 2I1LA 1CR6A 1Y4DE 3LFHA 5KINB 1A7UA 1N25A 3BH0A 4WZAA 3WJ1A 1ZAYA 1YS4A 2IF0A 4QL3A 1LBTA 1DWQA 4BGUA 3QF4B 2XNCA 3CJTA 4KXYA 4ZVOA 2QNBA 2AF4C 3MTGA 2F3TA 2HK6A 4OJTA 3BRQA 1Q14A 2PT9A 1E1CA 2BEVA 3ZQJA 1ZGHA 2WAOA 1KFJB 1PLKA 3A3PA 1WRBA 2FRDC 4JGGA 2FEKA 3ETJA 4C5BA 1OB5A 3WQRA 2R1TB 4WCFA 5AKYA 5CXQA 2I2XB 3X1ZA 3Q15C 5FOQA 8OHMA 2HO5A 1P0MA 4FCWA 5H0IA 4H4DA 3OPYA 4INZA 2AUTA 1Z33A 3AR3A 4BC0A 1GT6A 2KI5A 4G1CA 1F7UA 1VPEA 1EX1A 3AB7A 1HYQA 4LF6B 3B6MA 3JD0A 4GI5A 1NN3A 1GGFA 3GD7A 2PH3A 3U56A 2B35A 1FQWA 5AVOA 5JD5A 1AZLA 4JIGA 1YT5A 3L7KA 1LSJA 1IHXA 4KPUA 4RIHA 2XKBA 1IZ8A 3CLKA 3RYFA 5C5IA 5AVRA 4UAVA 1D1TA 3ZY4A 5GV7A 2PTHA 3H0CA 3MRSA 4Q9IA 3B9PA 3K4PA 3L4SO 2CNKA 2C2HA 2OB1A 3DBHA 4ND8B 3TLMA 4TQ9A 2IZ1A 4D56A 5HKOA 1DDGA 1EKXA 1JAZA 1SUCA 4MYUA 4KQ6A 4Q3BA 2HJSA 2CKDA 4JKIA 4EGFA 2BFEA 3PC4A 1BOFA 2BI7A 3D6VA 5FWNA 2IYNA 4MGYR 1DKMA 3H9BA 4GNKA 5IYZF 2O8VA 4M1MA 1FX0B 4J1QA 4LHXA 4LJLA 4ZMBA 2ABWA 4C0WA 2ZT7A 1IQRA 3P52A 4PX2A 1ISRA 4QLOA 3B89A 3FNFA 5JXGA 3GDFA 1HLPA 3I04M 1TF2A 3IFSA 1A82A 3O9MA 4MQ5A 4ICIA 4NOMA 4WGGA 3SC2B 1GPH1 2RGYA 3FI0A 4TLBA 5AW2A 4LSMA 2FW7A 3HKEB 1B74A 4HDRA 4GICA 2GHIA 4R9SA 1JFFA 1K86A 4P3OA 4NZYA 1JHZA 1NBAA 4G1BA 4YP5A 4HRXA 5DM0A 5ALPA 2IXTA 5FL7A 3WRWA 3ITDA 2XMQA 5FPSA 3HXQA 1P2UA 2XCQA 4H1UA 3JARB 4ZU6X 3L8HA 1AMOA 5IFLA 3MD9A 5IXSA 1OU4A 3O1HB 5TY0A 3OHSX 1TOAA 1Z82A 3H5RA 1PWHA 1A1VA 4BWGA 4F2HA 3WNBA 3B2QA 3QPVA 2CKMA 3G79A 2PKQP 3KLBA 4N7BA 3GMTA 4UBNA 5DW3A 3K0BA 1CJVC 1FF9A 2B7BA 1CDEA 2IYAA 3PEFA 1UOEA 4OHYA 1UBGA 1NW3A 4FR5A 5ALXA 1BMFD 2QYHA 5ECWA 3IVRA 3JR7A 3FN4A 4OHXA 1X7XB 2WB2A 3OFJA 2P2ZA 2R6R1 3N0WA 1PR6A 3H8JA 1FA9A 1RXIA 4PGGA 4IZHA 2R7LA 5FNVF 1ZIXA 1FRZA 2WIKA 1K8ZB 1Q83A 2AYYA 4JX9A 5IPFA 2JRLA 4K26A 3QP9A 1E94E 3ZHZA 1UXGA 2Z58A 5BMVA 3HK2A 3MNFA 1P2GA 1KSHA 3I12A 2CUZA 2BTEA 3DBIA 5H4HA 2XOKD 2DQ4A 4X92A 3BWBA 2R68A 5AJZA 4DR6B 3OBIA 2J32A 3NPMA 2G09A 1G55A 3KDSE 1NBME 1SR8A 1FFDA 1YS9A 4BNYA 2HREA 1THTA 1QDUA 3RVRA 3BULA 3ZXXA 1TIPA 1A8QA 4GE3A 4PLHA 1E9SA 2IY9A 4XVHA 4G81A 5DNCA 4Q9DA 1E6CA 1WCV1 3B3FA 1Y9DA 5DF1A 4KR6A 5BN3B 2AS0A 3W6NA 3WZMA 1PW5A 2VHEA 4CKEA 5H59A 5FAKA 2ISQA 2JBAB 2QW0X 3F5DA 4I5DA 3JQQA 4CHTA 4E09A 4CF3A 3IL2A 2FFHA 1CY8A 2I29A 5B58T 3TIVA 3U7FB 1Z6ZA 3B1VA 3R0QA 221PA 2DHQA 3PT5A 4MQ6A 2KE5A 1IY9A 1KGSA 2HAEA 5LKRA 4HWOA 5J2UF 1RBQA 1G5PA 3HA5A 3CNQS 3UHAA 2R7AA 2ZRPA 1RAFA 2CK3A 2IH2A 1RTKA 2Y4NA 2F62A 1R37A 1A3CA 1D2GA 4C0QC 1K3FA 1PSWA 1VFPA 4RLQA 1Y33E 1UINA 1UPFA 3AOEA 3Q88A 2HEGA 5JE8A 2Q4EA 1PLJA 3HNPA 3EWSA 1M8JA 3LX6A 3HVKA 1NVFA 3QE9Y 3VYRB 3ZIUA 4F9FA 3HB9A 3W1WA 2V3WA 2UUCB 1I30A 1NFRA 2WUFA 3LSYA 1E4EB 1DUVG 2HU8A 3AV3A 2WUWE 3MERA 1CS0A 4FDLA 2M2IA 4M0CA 1RKUA 1XJWA 1Z4OA 2EJVA 3EA0A 1T3ZA 2BONA 1MABA 1V5GA 4M55A 4NKRA 3TR5A 2JFYA 5DE3A 5GM2A 1HV8A 3TAHA 3DXXA 3UKJA 3PEWA 3KYJB 4LE1A 1AO3A 1BEEA 3DZ8A 4EW2A 1W30A 2MT9A 4NECA 5J2TB 4AICA 1U6JA 1M0TA 2QG9A 4IS2A 1B6RA 2GCIA 2YJ4A 4UXHA 5EHQA 5C2JB 3PUXA 3LGXA 4DB2A 1EFVA 3N9IA 5CJJA 2GZ1A 1T8RA 2C2MA 2JJ1D 2WJPA 2XXAA 3PI6A 1I2AA 4BWFB 2H52A 1QGED 3H86A 1H8ED 2AYXA 3QG1A 3ETHA 5JXIA 1P44A 4HYQA 3W90A 1CKEA 4LTMA 3QVGB 1Z16A 4Q5IA 4DWJA 2EF1A 2V7UA 2AK2A 1OXXK 3GUZA 3PPYA 4YV7A 1KI8A 3LPNA 3UM9A 4Q24A 3ZQKA 2Y68A 4KNWA 2BJHA 4QDKA 2VOJA 4PXYA 4YR7A 3CWCA 2Q5EA 2QE7D 5AVQA 2E4VA 1IN6A 1DSSG 3EQZA 3LIIA 3NNSA 3DLBA 3L4BA 4M7OA 1INLA 5EJFA 5E9JA 3AP2A 2QAJA 3ZDRA 4LHYA 1NXTA 1ZI9A 4WASA 4BNUA 1C9MA 2GN2A 2GPYA 2H5LA 3P32A 2HF2A 1UFQA 4PE5B 3H0WB 5FLYA 1VL1A 1LW6E 4RAQA 4D3DA 4RWEA 2C4HA 1UT8A 2V7BA 1XCBA 2J7PD 2RCYA 2WU3A 1TZ2A 4RU1A 2JGNA 4O2BF 3T5BA 3UGJA 1JHQA 1HDYA 3OZXA 1TUBB 5EJ6A 5F9MA 4OYHA 121PA 1FZTA 1E6UA 4CF5A 3EYAA 4W82A 3UHFA 1YE3A 2ZK7A 2CFOA 4XQGA 2I4IA 1ZC3A 1S96A 2NO7A 4G56A 4N0MA 1T4BA 2A5GA 1KH3A 2DBZA 1A1SA 2Q6IA 3O84A 1SBNE 2XRMA 2NNWB 4EPXA 2WWTA 3FPCA 1KZ7B 3X1JA 2QXYA 4IGFA 3I1FA 4BMXA 3T06B 3H2HA 2G67A 4R9RA 1A9XB 2YV3A 1VCNA 3ESRA 3QQPA 3W78A 4EENA 3UH1A 3VAZA 4QTYA 4HL6A 3KOWA 5EGSA 5G53C 5BV0A 1I3KA 2BHTA 4PRKA 4TWJA 1DC7A 2VXOA 2GN8A 2GPTA 3Q3HA 1GSAA 1YB2A 5EKDA 4M0FA 1C0IA 3JWIA 4TV8F 1CE8A 2ZQZA 4YCLA 4X1YB 1CIVA 2NPOA 5F73A 2JEYA 2GCNA 4IIJF 3V1UA 1W52X 4H1HA 1TA9A 2G8NA 3G23A 4ZT2A 2DULA 2YTZA 2CFRA 1IEQA 2W98A 3A6LA 1ZM7A 1F8YA 1H2FA 2OHGA 1NI4B 3Q7QA 3ZK9A 2I71A 2OQIA 3HZRA 4GSLA 3SFVA 4MW9A 1DJMA 2FG5A 3EC1A 4RCYA 3A1FA 5LPNA 3OTGA 2IV7A 5I4IA 1CJSA 3IUSA 1K27A 2RBGA 5HEKA 2GN6A 4J16C 2YS6A 3TTXA 2HWUA 3D9QX 1GRQA 4PRZA 1G1MA 2C9OA 3EVDA 4C04A 5IKPA 3AVQA 3H9GA 2F55A 1Q44A 3S5UA 1U8EA 5LXTB 1N1EA 3AOEC 2JFQA 3L0PA 3WSWA 1OFUX 1M5RA 2V7PA 4EMSA 1SBCA 5BXYA 3SE0A 1C1DB 3I9V1 2R00A 2NU6B 5JYFA 1E1CB 1WVIA 2VAWA 5J43A 5PNTA 4QUKA 2A7QA 2DWOA 3TPCA 2V5VA 3DC2A 5JATA 5THXA 4YEDA 3H8WA 3CKKA 1I4WA 4HFMA 3QF4A 3OPVA 2HHLA 1W96A 4Z9BA 3C7DB 4C20A 4EHBA 1ISMA 1YUNA 4RK5A 2NTJA 2QI9F 3CTMA 3LMKA 1QSGA 4DXAA 5ETJA 3HUUA 1G7RA 4I9UA 1K7SN 1U8XX 4H77A 4L51A 4MXDA 2H2FA 4N5DA 4RY9A 2ZTSA 5IK2D 1NVDA 2WFLA 4D42A 1WVMA 3GUHA 3T5DA 1AU9A 4RHTA 3V1LA 4HFNA 1UZUA 3DE6X 1SKBA 1Y3CE 1E1QD 1EAMA 2HRQA 2YHIB 3VU8A 5AKIA 2H2GA 2JZCA 5G1NA 4KREA 3ZTTA 4ARCA 5H3CA 4ZOAA 3PVSA 2D0PB 2OY0A 3RUAA 4CN8A 3P0EA 5AM5A 2J0UA 5CVEA 2BMVA 2ON6A 4JB3A 2MSCB 4TSRA 1E8DA 1XQYA 5BQXA 1SUEA 4EI7A 2E3JA 3CLRC 4NU6A 2NZ2A 3I1JA 3ILYA 1L2TA 2COKA 4P22A 1W5EA 1GA4A 1O5OA 2EJTA 3HI4A 3D6FA 1EXMA 1Z8NA 3Q3EA 4PHCA 4UMDA 1IG0A 4ZXPA 2TMKA 3H5IA 5B5SA 3EQ9A 3QRWA 3W6PA 3BBLA 3H1BA 3TK1A 1GQ2A 3ZHSA 3C16C 3GLVA 3LFTA 3ZX4A 4TVOA 3N70A 4BZZA 2SNIE 2Y3IA 1IIRA 3AHDA 3TQHA 3QHAA 4BIMA 1AHHA 3EJWA 4PGFA 1WKCA 5BV7A 3O4RA 1DBQA 2PJUA 4E94A 6AT1A 3IVXA 3ENQA 2XAAA 1BDJA 3HYSA 3BL8A 4KAXA 4PLWA 4X45A 1RXVA 2ZIXB 2JFWA 3LP8A 4XX0A 4RHFA 4CIVA 4MV6A 2FPRA 4Q9JA 4E5NA 1ATIA 2TECE 1RCFA 2FWJA 4KMMA 4MV1A 4R9VA 2FWNA 4C0LA 3KOUA 2JGKA 3VXKA 1OKKA 2V0NA 3Q6NA 4KQCA 4LJYA 5PGMA 5C8ZA 2A67A 4TRNA 4HDNA 4NK4A 1Y48E 3ORFA 1JALA 4RPGA 1ZCJA 1EDEA 2Q1UA 4QARA 1XOIA 3DOJA 3IGFA 3JQFA 4M1WA 5FWDA 5AVZA 4FWBA 4F2PA 1JHAA 2PD4A 5KOIA 2GCPA 4XQ9A 1WDLA 1XP5A 5JUWA 1VIDA 3B7WA 3WLLA 2EQAA 1RM4A 4W9NA 2IY7A 4Y2JA 1RHQA 5JADA 1ZD9A 1D8AA 3TZEA 5JHGB 1N2EA 1R5OA 5CLQA 2WG1A 4A4DA 5FTKA 1RRVA 4BMOB 3NX4A 1KQNA 4B75A 4EZIA 3VDMA 4K9MA 1L6IA 2FSIA 3PHHA 4OREX 3Q2IA 1H1TA 3LUPA 4JBNA 3NBAA 4LNUA 4JC5A 1NUAA 4MA0A 1RC1A 2BL4A 2X4GA 1RRCA 1OZ0A 2YV4A 2FPOA 4FFVA 3SZMA 3OCYA 3Q40A 1MO2A 1R74A 1SCIA 3QUSA 2FE1A 4WNAB 3JALA 4JUDX 3UK1A 3I42A 2GZRA 4HH3C 2C4VA 2VDKB 2YCBA 4DDVA 2WPDD 1LA2A 3GLSA 2DLCX 2MWMA 3OCCA 1KTVA 2EKBA 4WA8A 5K4AA 4EG6A 3LTNC 1JWLA 4BP8A 3GB9A 3CZMA 4BMSA 3FCAA 5KYNA 5I7AA 3FNGA 3OQHA 3F6PA 4WOCA 5BXQC 3CPJB 1ICIA 2XHZA 3DZBA 2BGTA 4XVRA 3PD0A 1JENB 3W05A 4YDHB 1S2DA 2OM2A 2SCUA 3FSRA 3T99A 3A6PC 3L6DA 5EJ5A 2E55A 3FTFA 2IOQA 3NEJA 3D4PA 5B3KA 2LXNA 3FROA 4TKLA 3CONA 1H85A 1ZCBA 3PJEA 1RKXA 1T3SA 2YNMC 2FSGA 4WLOA 4R8SA 3UJ8A 4XX1A 3PC2A 4J8PA 5HF6A 3TLCA 4B3JA 3BGWA 1N33B 3ONDA 1PNQA 5K8LA 2P9HA 4RTQA 3TRJA 2I9PA 1X6VA 1DQPA 1QYCA 2P2CA 5JCXA 2R47A 3OJXA 1FNBA 2W2KA 5TV2A 1I7DA 3UMMA 1V7CA 1Z68A 4QDUA 3H1AA 5LIRA 3K30A 2LZ0A 4KPEC 4MKHA 3EMVA 1TD9A 2OO5C 3FETA 3EFEA 3IERA 3OFKA 3AVWA 1ETUA 2SHKA 4PAGA 4R2IA 1OT5A 3VUFA 1M8GA 1MFZA 1NJ8A 4QIHA 4LRTB 3G59A 1TMKA 3F6RA 4QUAA 4FW8A 1DZ3A 1GZ4A 1WBJB 1ZHFA 4QDTA 5E6RA 5EZ6B 2NZVG 1TCBA 1XNHA 2XB4A 4LWQA 4OYRA 2IV2X 1N9ZA 3A1TA 3IAFA 5LZ8A 5L3SB 2NSLA 3R09A 3RJ5A 1QLHA 2DAPA 4XWTA 2JFVA 4R8MA 2KLHA 4D3SA 1PUJA 3LZ6A 1XUOA 1PV4A 3RYFB 1ISJA 2X8JB 2C2OA 4O89A 1JG1A 4P8RA 1A5ZA 1TZKA 4PNZA 3JRXA 2JLRA 3BERA 3OESA 3WMWA 1QQ7A 4XARA 1KK2A 1N6RA 1PDVA 4Z3OA 5BSVA 2YRFA 4GQBA 1I8TA 2WE8A 1H8HA 5B1DA 5CD1A 3M6WA 4GPTA 1YFLA 2VZ0A 2XCOA 3EXHB 1S0UA 2LKDA 2R7NA 5EN4A 1RXCA 2W0MA 2XYVA 3NDPA 5JT1A 3ZVLA 4Q1CA 1X1AA 1V43A 4YAEA 5A05A 1VBNA 4JSTA 1R4AA 4N5NA 5BQOA 5KQSA 2XCUA 3DBLA 2ECPA 3JVVA 4HZGA 4I3GA 1MAHA 4PS0A 1ADFA 2NO4A 3N76A 2Z5GA 4PQRA 3RSZA 1CZLA 2YMMA 4B6EA 1D7OA 3C3CA 1OXVA 4RJJA 1RJEA 5K2MA 2OILA 5BURA 1M2VB 5K3CA 4ZEOA 4C08A 1E60A 1F1BA 1RVV1 2P65A 5E1BA 1SKYB 1EGQA 1P0PA 1OC4A 2GN1A 4L95C 1JKFA 3ROQA 4JQZA 1M6WA 3F6EX 5ALSA 4QGFA 1G6OA 2AHOA 2FK8A 4N12A 4KSCA 3ZWOA 4D74A 2PUBA 3KBOA 4MKRA 5I3CA 4A10A 3TSZA 2K4MA 3BCHA 4X64B 1L5NA 2X1MA 4M1EA 4ZD6A 3HCBA 3IDZA 2WOJA 2TS1A 3SJBA 4BQNA 3W2IA 4TSFD 4N54A 1EM8A 3PR2B 1Z6AA 5KAMA 3HZHA 5IMBA 3VZCA 1CHDA 4FZRA 4ZCTA 5IXYA 2PUFA 3H1EA 5A4DA 1L9XA 4REOA 3NETA 1MKYA 3A6FA 3VKHA 1X9GA 3E27A 3HV0A 5COAA 1M5UA 5FI1B 3ZU4A 4DGSA 1OH7A 3D31A 4LSWA 3QSYA 3DWFA 1RAAA 3K71B 4P0QB 3E3LA 4KO3S 1JSRA 1WHTA 4MTLA 2FW9A 5CDHA 5AK5A 4LZZA 1SU8A 2CVOA 1IWOA 4IZOA 1JWBB 4Q4JA 3K09C 1N4AA 4DN6A 2ZS9A 5F23A 3BK1A 4Q01A 3WFZA 2VDJA 3AR9A 1NKSA 1SELA 3JWJA 1FDSA 4G07A 1H0KA 5F5LA 3WXMA 3ZUGA 4XDZA 1F0KA 3SR0A 1LNSA 3HY6A 3L02A 1Z0DA 2VH2A 1SY7A 3G2JA 4HN4B 4K88A 7REQB 2H11A 3MA0A 5FXMA 2VT3A 3L7AA 4BU0A 1CRWG 1ZM4A 3PQVA 4EH1A 4MRPA 1E3EA 1V4NA 4B76A 1P5ZB 2CHUA 4KIUA 5IJ0B 1WO8A 3K70C 3TGLA 4IDDA 1NN1A 2XGSA 4RNDB 1GA6A 5TMDA 2PAAA 4MYTA 1J2EA 3QNMA 4H3SA 4RA9B 5FFNA 5CA0B 2KX7A 3E5HA 4BJ6A 5HGJA 3C3MA 1N5OX 4V0RA 4ZVUA 1U3GA 2D74A 1XNGA 2HHJA 3JX9A 1DMRA 1JU4A 1YMQA 4ERXA 5CPFA 1EIWA 4JKYA 1GUDA 2FP4B 5JCOA 2XUKA 4DLZA 1FTYA 1M2VA 5DLEA 2C7VA 4GECA 1YAHA 1VI6A 2WVJA 4RCZA 3CG4A 5TARA 1PT5A 1X15A 1IEXA 1TK3A 2WWXA 3VTKA 1EXNA 1P3JA 2QQGA 1NQTA 3E53A 3H4TA 4UHKA 1SBHA 1XZKA 2JFBA 2V74B 3HVJA 2OWDA 3JVDA 4RKQA 1QGUA 2XNKA 3LD9A 4P92A 1OVMA 2W2TA 3CRW1 3DOUA 4IS3A 4ZOQI 5IT4A 2I6GA 1ZRMA 4FE4A 2JGEA 4F2GA 4G0PA 4UDXX 3P9RA 1QFSA 4Q9HA 1OTXA 1QHFA 3CSDA 2FSSA 2YVKA 3FDIA 3EZGA 4QGGA 4K28A 1Z75A 4IIEA 3IP1A 4ZT4A 4PYMA 3UAXA 3WSVA 4Q9LA 1H4VB 1P17A 1QIJA 3RS9A 2I65A 4YYEA 2FLWA 2H4ZA 3RV4A 4C6TA 5KPDA 2XMRA 1P6UA 2RGDA 4B8YA 3RVDA 1AKNA 1D03A 2XH8A 3FVQA 1U0GA 1UMCA 3M3DA 1V3TA 5EIFA 2JHAA 4PXSA 5K01A 5CU7A 3ER8A 3LKBA 4IQ4A 1GNPA 4EHFA 1LSUA 1PZGA 2BM8A 3QM1A 2VDUE 1RQNA 1US8B 3QVLA 1MB9A 4IFEA 1T9AA 3S3TA 3TB4A 1GTJ1 2YWDA 4W9NC 1VI5A 3GH1A 1BO6A 2R86A 2ZVQX 3HJFA 1N6HA 3LRTA 5ALRA 1CRZA 3EIQA 3KS9A 2GJSA 3N87A 3PQDA 4UULA 3QEAZ 1PL6A 4QOHA 4W1SA 1FIUA 4AUMA 2AA3A 2IBSA 1KKMA 2A1TS 5K2OA 2VSNA 4HLDA 1EG2A 1Z5OA 3MAAC 3SICE 1WKVA 1E3JA 5DT2A 4OATA 3U39A 4UTZA 3HUDA 1T9KA 4UE2A 3PWTA 5ALZA 3PIIA 3JY6A 3I28A 1UXOA 3PNVA 5ARDA 2UUOA 3RBVA 3F46A 5E95A 4URUR 5A9TA 1QQBA 3DTNA 3E61A 1T4CA 1TO2E 1LXCA 1GOTA 1A9RA 5AVUA 3D3WB 4IIFA 3U31A 4BX0A 1CR2A 3OFNA 4W5JA 5JAMA 4RXUA 2CLSA 4X8MA 3IBYA 3GEBA 3IODA 2NV0A 1R6VA 1DX4A 3EH1A 3WL7A 1ND6A 4G84A 4CDGA 1R0YA 2IUSA 1T6BY 2B98A 3ANLA 3S7ZA 2PD6A 3L9XA 5EC8A 5JLJA 3HXOA 4MUGA 2EJBA 1ZNZA 1YS7A 2SICE 2QY9A 3R3YA 1S2GA 4QE3A 3C3KA 1LLDA 5DTRA 1JHXA 4U3JA 4XGIA 2TMGA 5HDBB 3T7DA 1Z2EA 1YA8A 3LF1A 1KFKB 4P36A 4RYLA 2EKPA 2R0QC 2R96A 2Q1XA 1X7ZA 2ORWA 1E3TA 1MFPA 1XRQA 1PK9A 2ZU6A 2Z1DA 3D3KA 3D7NA 1Q74A 1CBUA 2WT9A 4CTNA 2PUEA 2HC9A 1JJVA 2CZGA 1WABA 2VHXA 3PLAE 3T1YB 2QK4A 3MSCA 1MAAA 5TDHA 2WA1A 4P82A 3LBHA 1YZHA 2CFTA 4NBNA 1YE5A 4KYIB 2B34A 5G0SA 3A6DA 2FMHA 5IAEA 4AQDA 3QEOA 4X9XA 2JARA 2CHGA 3ADKA 3EUFA 1XZCA 4GGMX 4Q7LA 1DXHA 4XIYA 4LDAA 3BSFA 4X61A 5SZHB 3RWOA 3W2TA 3LAWA 3V8EA 4CIYA 2MOKA 2D4HA 4LHEA 5GGXA 4JY7A 2CMFA 3HDJA 3LE8A 4IDCA 4OK3A 5BOSA 1S9DA 3WGJA 1RE0A 3D7LA 1RI4A 4M9CA 3RF7A 2XRZA 2BTQA 3RUEA 1T5TA 4RS4A 3ZCUA 4ZRMA 1R4MA 4DHEA 5CEJA 1L1RA 2F3SA 1Q20A 1X1CA 2HRZA 2JK1A 3K2BA 1TCCA 3M0EA 1RM0A 1GYQA 4LMPA 3SG0A 4PQGA 3X1WA 3R5XA 3I8XA 5CM2Z 3KXDA 1RVDA 3ICCA 3B6ZA 1HYBA 5DI3B 1C0LA 3KK0A 4HWSA 4UUMA 3X1YA 3ZZMA 4U7FA 2YQ5A 4AMUA 2HF7A 5JDCA 3NIFB 4NR0A 1BWSA 1L4BA 3WIVA 4K6HA 3OFND 3QH4A 5FKJA 4U0JA 5MN4A 3F0TA 3HKBB 3V97A 3VZBA 5L45A 4L3VA 4HQLA 2WQZA 1P8JA 1E8NA 1TKBA 2HMYB 2XYGA 4TUYB 2JFUA 3LVBA 5I4KA 3P9CA 3E82A 2GAFA 3O1JC 4MUBA 1GLNA 1XLTA 1LKZA 3C7AA 2HMTA 3L7YA 4YRGA 4B35A 3TOVA 2VJAA 3CG0A 3O3OB 4M0UA 4OA5A 1QDEA 4TZTA 2YIVX 4ZC1A 1BSVA 2X8AA 3BXZA 3KL2A 3PRKE 4R2JA 5HIIA 4AVYA 3CF6R 3VH1A 5BNIA 6Q21A 5JFOA 1KYQA 3SX2A 5FTJA 2COEA 4N8SA 1U6KA 3VPAA 2Y9PB 2OLJA 5IW8A 2ZIGA 1FP7A 1W2HA 4PBTA 2YJGA 5ES4B 4RPLA 1KMQA 4H0CA 4BKOA 2BZ0A 1HEIA 3QQ5A 3K31A 5LZ5A 1RPZA 4DY4A 1PRYA 2QL5A 2W6IA 3OY7A 3C74A 1O6GA 1MHPA 1GY8A 1T35A 2ZI6A 2AZDA 2FFQA 4IHJB 2CL6X 4Q9KA 1OAKA 4NYIR 3BK2A 1X9HA 4Z7NB 3IKTA 1KRXA 4ZARA 4P54A 5CFLA 1NT4A 4CQJA 1OAOC 1B8OA 4Y2PA 4BWVA 1MZPA 3NRCA 4MA5A 3W9YA 1AVTA 2R48A 1NPYA 4Y6SA 5EXEA 3E8MA 4OHPA 3WGHA 2GHRA 3C4QA 4W7SA 1LI5A 3PR1A 3DEIA 1YO6A 3BMCB 3LUBA 5AJXA 4EG4A 4FT4A 1H2XA 1J7KA 2AOTB 4OLHA 1MLDA 2IE8A 1RI2A 5DNEA 3NWJA 3ZK8A 2ZRBA 2AT1A 1V45E 1YC5A 1QP4A 2OHXA 4C1BA 1FNMA 1SEPA 1GLVA 1DQRA 1O94A 4M8KA 3ROTA 3U37A 1AQIA 1U7WA 1ONOA 3GJ7A 1U0JA 5C35A 3AP3A 2UYHA 1FLAA 3TLKA 1SXJE 2H3EA 4G2TA 3RVJA 2CL0X 3MPUA 1MQSA 1GGVA 3F8TA 1RLJA 2QLNA 3A7DA 3U81A 3T9EA 4AN4A 1C3VA 2J3EA 3IQXA 5KHLB 3IA2A 2OV8A 1NOIA 3KELA 3B8HA 1YTUA 3MTJA 2BT4A 4UJ3A 2D59A 3AY7A 3LOQA 3GNTA 4QU5A 4ZCIA 2O2SA 3S2UA 2DFDA 2EEPA 3HVIA 1UDWA 3C1UA 2AFHA 4HGZA 3TLAA 3JRNA 1P19A 3DEKA 2X5NA 1SXJA 1HDXA 2PMCA 3T9FA 1YC2A 1R00A 3SN6A 1NW7A 4J1SA 1A9XA 3UAVA 5IH3A 2PH7A 5JIBA 4HFRA 1LB1B 2PRIA 1P29A 1TLFA 2VS1A 4MVJF 4G4GA 2AVDA 4BO5A 1FEZA 1QFYA 2Y1FA 1XEWY 5EP3A