2CZCA

Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from pyrococcus horikoshii ot3
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
334
structure length
334
Chain Sequence
MKVKVGVNGYGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASEEFIPRFEKEGFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKADVAEVSFVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPINAIKPTVEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFENTTRVLLFEKEKGFDSTAQIIEFARDLHREWNNLYEIAVWKESINIKGNRLFYIQAVHQESDVIPENIDAIRAMFELADKWDSIKKTNKSLGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase
total genus 123
structure length 334
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.59: Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)(+)) (phosphorylating).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2czcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2czcA01
1CERA 1WDMA 4IJUA 4JX8A 5GZ3A 5DOVA 2VT2A 3H8VA 4OQZA 4RF5A 1U5AA 2RHRA 5B37A 1HYEA 4NJMB 2AE1A 4D46A 2ZCVA 2X5JO 1O95A 4BNHA 4P38A 5BQFA 4CLRA 4XRRA 4F6CA 1C1DA 1PGQA 4J4HA 3S55A 3FPCA 4BKOA 1R15A 1X1EA 2D5AA 3COSA 3BHMA 3E03A 1WP4A 4DPLA 1GPJA 4N54A 4MP6A 4GX5A 3WNQA 3D64A 4BO5A 3CE6A 3D1LA 2QZ9A 1LTHR 2PKRA 3CTMA 4HNHA 4OXKA 4FFNA 3OEWA 3ZNOA 3AI1A 5KVVA 3DDNA 3LVFO 3PQFA 1GZ4A 1Q0QA 3QWBA 4AJ1A 2O7SA 4GX2A 3UH1A 5THKA 1YOVB 4A03A 1ML3A 2ZQZA 4QO8A 1G6KA 1T4DA 5BNFA 1C0KA 2FSVA 3OQ6A 4OXNA 3VDRA 1ZEMA 4R5HA 5KJ1A 1B8VA 1PL7A 3KYCB 4E2WA 3DTYA 4EJMA 1S7CA 4JJFA 4Q3CA 1T2CA 3PFWO 1IZ0A 2Z95A 3QSGA 5DP2A 3V8BA 3WGQA 4QX6A 1P1KA 4B3HA 3KYCA 3RUIA 4Y8VA 2Z1MA 4CUKA 2UYYA 2GN8A 1F06A 3RSHA 2I6TA 2GLXA 1FDUA 5EPOA 4BS9A 1NVMB 3B1FA 2O7QA 3RASA 2P9GA 1L7DA 1HTBA 1P1JA 3WJ7A 3AK4A 5J23A 4EJ6A 1YBAA 3W6ZA 3DQPA 5AQ1A 1YB4A 1GQ2A 4MVJG 1SCUA 1PQPA 2HLPA 1K6IA 4QQRA 3BYZA 3C85A 4GLLA 2XPCA 4L8VA 5FI3A 1B8UA 1KEUA 3A9WA 3JQFC 2ZTUA 1PEDA 3I6IA 2AG8A 4R69A 4YRBA 2IZZA 4FC6A 4IY1A 1HDOA 3PRJA 4TRNA 4CR7A 3ZW8A 1MXHA 1PZEA 2WEKA 4CM7A 3RUAA 5K6AC 5JW6A 1L7EA 2JJYA 1PL6A 1U9JA 2QYSA 4BNWA 3GFGA 3T7CA 4CQMB 1LRKA 4WLVA 1AHIA 3W8FA 3JQ7A 4EYEA 4U5QA 1CYDA 2PZKA 4B8ZA 1DLIA 4YJFA 3K2BA 1DJQA 4R5MA 3ZV3A 1XQ6A 1NR1A 1R4MA 1SAYA 4TRRA 4DLLA 1TI7A 3IQDB 2Y1EA 2HMVA 5TIIA 2ZJ0A 3FBTA 1EK5A 3KB6A 1DO8A 4BV9A 3JQ6A 4JQCA 5GZ6A 1O89A 3NT4A 4HFJA 1R4NB 3RCBA 4D45A 4OQYA 3C7DB 4HBGA 4DPKA 2YW9A 1DXYA 2Y1OA 2X22A 1I30A 3WYEA 1UXGA 4LISA 1TT7A 4Y6SA 1X14A 2BHLA 4XEHA 1DDOA 4WLUA 3OP4A 5LCXA 3PYXA 4WE3A 3TZQA 4CR8A 3CH6A 2I66A 4KUEA 8ADHA 4KQWA 5COQA 3FWZA 1GCUA 1UZNA 1Y5MA 1YDWA 1FJHA 2X7HA 3V2UA 5BSGA 1YJQA 5TGDA 1R6DA 4CQLB 1ZK2A 3L9WA 3GFBA 2EIHA 4KQXA 3VDQA 1ZSYA 1NR7A 4EZBA 3OIDA 1E6UA 1MXFA 3ZNPA 1N1EA 1M6WA 2WDZA 4H7PA 4RF3A 3EW7A 2B36A 1YB1A 2QW8A 2O4CA 5L7WA 5ITWA 2BRUA 1E1MA 4OMUA 4QFDA 4WCFA 4CM9A 4FFMA 1JKIA 1WDLA 4CM1A 1B14A 4HFRA 5GY7A 3IUPA 5IN5A 4DRYA 5IJZA 2ZJ1A 2OHXA 4U0JA 2C2YA 2CD9A 2HRBA 3TL3A 1NWHA 3QIVA 5JYAA 4KWHA 4NFYA 3Q9UA 1R0LA 1MV8A 3WX0A 4K1LA 5KVQA 4EEXA 4J4BA 1S6YA 2C54A 1I3NA 3ETDA 4E4YA 5JCXA 3RFTA 3P5SA 2WTBA 3V5NA 5JAZA 4WOKA 3JYNA 5HTOA 3MTGA 4GH5A 4NG5A 1JWBB 4DMLA 1SBYA 3ONEA 4YTEA 3WFJA 2VN8A 2Y0CA 2FPGA 3F6YA 2EKQA 4FSHA 3O4RA 4BKQA 2IXAA 3ZV4A 3PI7A 3M2TA 4NU5A 4IDDA 3FCOA 3JV7A 2J3KA 3IOYA 3GPIA 1VE9A 4IGFA 1XR3A 2VYNA 2GZ1A 2O48X 3PEFA 1A9YA 5TSDA 1ULSA 3EK2A 3G49A 4PZCA 3ON5A 3Q2KA 1K0UA 3D0OA 4MVJF 1HF3A 3WR5A 3F5SA 3GUYA 3JQ8B 3GT0A 2Q2VA 4FCCA 1D3AA 1PJQA 3PK0A 5A9TA 1YBMA 3SC4A 4YT5A 3GPDG 2H5LA 4NBTA 3JQAA 4TSKA 4YCAA 5COAA 2Y05A 3GN2A 1UZLA 4F3YA 2PD4A 3PJGA 5C37A 2WJPA 2YY7A 4IDGA 4IDEA 4YWJA 1JTVA 5JDIC 2B37A 4K6CA 1KC3A 3FF4A 4AG3A 3CMMA 4MIOA 3AI2A 4PVCA 1P74A 1YOVA 3OJ0A 4ALNA 3L4BC 1DC3A 5F21A 1HZZA 2Q4EA 2RAFA 5CPFA 4Y9DA 4XGIA 2WD7A 3G1UA 1LU9A 4GMFA 1HEUA 1DJNA 1DFIA 4FR5A 4BMSA 3QVTA 3AM4A 1E3IA 4WGGA 1E77A 5CG2A 5H81A 2PZMA 4YA6A 1N92A 3RU7A 3WDSA 1HE3A 4AJKA 2CF5A 1UJMA 3MOGA 4A73A 1PIWA 2WD8A 5JSFA 3LT4A 2CSUA 2B4TO 2G1UA 5KOIA 3JQAD 4YQYA 4WEQA 1GY8A 3JYPA 1UXKA 1M75A 1EMDA 3DB2A 5DBIA 3K96A 1JA9A 4D79A 5G0UA 3DZJA 3A28A 4U7WA 3QVXA 4MIYA 3GVXA 1IPEA 3EUWA 3ANNA 1YGYA 2G82A 3ZWOA 3LLSA 2X8LA 5BR7A 5G4LA 4BNVA 4BO3A 3PWZA 1LEHA 1XDWA 4N5MA 5JDCA 1T25A 2ZATA 3NGXA 1LC0A 2IE0A 3DZBA 1H6BA 4PCVA 1ENZA 4WNCA 4BNFA 4DLBA 1SOVA 4L75A 3ZZNA 2CVZA 4AJ4A 1HDXA 1D4FA 2W90A 3MTJA 1ZXLA 1GPDG 4HWKA 3DZHA 5I9MA 2OORA 4BMVA 4BNYA 4EUHA 1XYGA 3M1LA 2WWRA 1M2WA 4O5OA 3O8QA 4IJKA 5DP1A 4YJDA 4Z3KA 2GYYA 5ENDA 4AJEA 5A5EA 5IZCA 1JN0A 2QHXA 3F1LA 5I9NA 3Q1LA 3H3JA 3ROPA 3LDHA 1QYVA 3E18A 4J4TA 1R4MB 2PR2A 3EYWA 4WK6A 1X13A 3BMCB 1B26A 1BXKA 4I9UA 3KTDA 4J2OA 1PSDA 1DRWA 4DPMA 1MB4A 2A94A 1LLQA 2WM3A 4YQZA 2NM0A 3SJ7A 1R4NA 2DU8A 2GF2A 4EW6A 1X7DA 4RZIA 5T8KA 5TJHA 1UDBA 4RPLA 4Y6RA 3ROKA 3GEGA 2YDYA 1DC5A 3GDOA 3C7AA 5IFLA 4TKLA 4Z9FA 1EUDA 3V2GA 3RROA 2BI7A 4TQGA 4E0BA 5B12A 4U6SA 4AICA 4II2A 1HKUA 1O6ZA 1B15A 3WMXA 2NADA 4NU6A 3ZWWA 2O3TA 1JAYA 1J6UA 1EE9A 3PLNA 5ICSA 2B0JA 3VZSA 1E1KA 5A9RA 3DONA 3BMCA 4E5MA 2R2GA 3D3WA 3C24A 3WICA 1LLDA 3QWAA 5A9SA 3AU9A 1GFSA 3KOUA 4IDAA 1KETA 2VRCA 5T6BA 4BNNA 4CMEA 3TWOA 5T73A 3I9OA 3BHIA 1Q7BA 4ZVVA 1LX6A 4BO6A 1GQQA 1B16A 3GDFA 3BTVA 1ONNA 1EVYA 3C7CB 2CDCA 3H2SA 3IC5A 4HXYA 3WSVA 1Z82A 4KDFA 4A7PA 1DIHA 2OBYA 3JYLA 2BGMA 2FHSA 2UAGA 1AUPA 1U2GA 3UAGA 1ZNQO 3VHRA 4BO1A 2X1HA 2JD1A 1E7MA 1BTOA 1F14A 1FF9A 3RIHA 2YUTA 2O2YA 3FTNA 3GAFA 5T8KC 4I8XA 4D3FA 3RUDA 2EW2A 1DC6A 5AXAA 2LDBA 3V2HA 3GVCA 3ADPA 3K30A 5JAMA 3HWRA 2YV3A 2B5WA 3W4JA 1BG6A 3WTCA 5HWSA 3GZNB 4WCDA 2ZB3A 2DUWA 4ID9A 3RBXA 2YYYA 2X0IA 4YT4A 4E2XA 3WBBA 4FS3A 3BMOA 4H16A 3L07A 4LVCA 5KCZA 1HDRA 1KC1A 4L0QA 1JVBA 5F1PA 5KWEA 4ONEA 2JHFA 3F47A 5KVSA 4TVBA 1Q7CA 2CY0A 3WGYA 4WKGA 2Q2WA 2QQ5A 2NU6A 2DT5A 4EUFA 4X54A 1CIVA 3ZDFA 5JNLA 4OH1A 3LC2O 3UW3A 1U4OA 3F9IA 2I99A 2JD2A 5U4QA 3SLKA 2VOEA 4KWIA 1U3VA 4UVHA 5F1OA 5IF3A 4BNMA 1ADBA 4ALLA 1LQUA 3WYCA 1LDEA 1Y9AA 1LDGA 3RKUA 1P0FA 4BGIA 1GUZA 2PNFA 4INAA 3DOOA 1BW9B 3I4CA 4CMBA 1ISFA 1EFKA 3AOEA 4BGVA 2EGGA 3HDJA 3DWFA 3JQEA 3BMOB 4J49A 5C7LO 2DLDA 3QWHA 3AI3A 1NQTA 2AEFA 1XHLA 3OETA 4HX5A 3ROQA 2PWZA 1VM6A 4MVJP 3KSDO 1YE3A 3GNQA 3T4XA 4R01A 5BT9A 3I9NA 3GGGA 3LC1O 3HN2A 4LVUA 5CHEA 3NDRA 1YWGO 2ZB7A 2VWGA 4QFCA 2NNLD 3QWIA 5GMOA 4XQGA 4DTIA 1KVUA 4ALJA 4DBVO 5LDHA 3ETEA 4CLOB 3AFMA 2UVDA 1LUAA 3JQ7B 4FN4A 2WYVA 1GDHA 3ZWPA 3VPSA 4YAKA 3T7EA 1RYEA 3IP3A 2OFPA 1Q0LA 5G4KB 2E37A 1V8BA 4RLSA 1D7OA 4II3A 1KEWA 4DC1A 3KBOA 1B7GO 3RBVA 3JTMA 1WDKA 3INTA 5IZ4A 2VUSA 2CF6A 4I5DA 2BMAA 2VCYA 2AQHA 2P9EA 3EGOA 1LSOA 1YB5A 3AJRA 4IDFA 1YL7A 2W2KB 1DBVO 2C5EA 3V1YA 1EE2A 2QRJA 4AJNA 3LQFA 4NBVA 1PS0A 4LCEA 2A4KA 4BNTA 2C29D 3ITKA 4ZN6A 2CMDA 1WPQA 4I1IA 3F1KA 1K6XA 1ZVMA 1ENPA 4BMNA 5F5NA 3AUTA 2OUIA 4LSWA 5L7TA 3E82A 1QRRA 3WQSB 2AQ8A 2VRCD 3GOHA 3TQHA 1LSJA 3HB4X 4UAGA 3OHSX 2DBRA 1DHTA 2X58A 3AY6A 4GL4A 2BFOA 3ZHZA 4E12A 2SCUA 1KY4A 3QRWA 3ADOA 4EUEA 1QKIA 1LQTA 4D7AA 2O3QA 4CQLA 4YR9A 3V1UA 1SMKA 2NQ8A 2X23A 2X5OA 4FOOA 5A05A 1PZGA 2ZQYA 4L73A 1ZBQA 2DPHA 4PZEA 1E6WA 3WGGA 2FY8A 3ZHXA 2V6BA 2NWQA 4IBOA 1IB6A 3TJRA 4J43A 5EMHA 3RUFA 5JY1A 3L6OO 4H15A 1U3WA 3OM9A 4M55A 4P4GA 3OA2A 3L77A 3I83A 3DHYA 3IL2A 2CUKA 2YV1A 3UOGA 2DTXA 4BL5A 4O59O 1UP7A 4MJLA 2NVWA 5DOZA 5JYFA 5KKCA 1GEEA 2IZ1A 2BKAA 1PJSA 6LDHA 2IEDA 2FWMX 1PL8A 4IJWA 4CV1A 4R1NA 1VLLA 4BQRA 1GU7A 4QT0A 3HB5X 2B69A 1MA0A 4OSPA 4FOSA 5DBFA 3BIOA 3E5MA 4R3NA 3HQ4O 1KYQA 1NQOA 1NPTO 3EMKA 3NUGA 1HSOA 3OF2A 4CLRB 1QXSA 1CJCA 4PLPA 8LDHA 1B3BA 3AM5A 4OKIA 4NIMA 3DAPA 1N9GB 1E7RA 5T64A 2C5AA 2JFFA 4WNIA 4RF4A 1C1XB 1NYTA 5C7IO 2HAEA 3Q2IA 2I76A 2Q22A 1WNTA 4GMGA 1VJ1A 2OXIA 4IMPA 1GR0A 3EVNA 5JCJA 1TLTA 1PWXA 1EEHA 1SB9A 1C0IA 4MVJE 3EVTA 2DM6A 2D3TA 3W4IA 3RKRA 3Q11A 4BGUA 4CL8A 2I9PA 5L4LA 2OP0A 4LGVA 2Y0DA 3FN4A 3I9LA 2DKNA 2EKPA 3M2PA 2CZCA 4M1QA 1IULA 1J4AA 3ZU2A 2NVUA 2VYVA 1I8TA 1C1DB 2WYUA 3G17A 4I9HA 2GDZA 1X1TA 1Y9EA 3PZRA 4KP7A 1DSSG 2PZLA 4MP3A 1HLPA 3HE3A 3TOXA 1HYHA 3ZU4A 4PFJA 1I01A 4DQVA 5FF9A 4YYZA 4IM7A 4OGWA 3WG9A 3DFZA 5JLAA 1ZZEA 1F8FA 3TZCA 4DBZA 5CFZA 1YXMA 5HS4A 5A02A 5U9CA 4NDNE 1E7YA 3KEQA 1I2BA 4XYMA 2JL1A 3GR6A 4Z6KA 4UVEA 3NYWA 4RVUA 1D1TA 3C1OA 1U3TA 1HDZA 5A1TA 4QSMA 3KSZO 2W2LD 4JROA 5JY6A 1N7GA 4D44A 3MEQA 3H9GA 4I08A 4CUZA 4E32A 3NAQA 3KV3O 4PZDA 2PGJA 5ER6A 2YHUA 4OSOA 1A71A 2B4QA 1LXCA 3K8ZA 1GEGA 2O50A 3UUWA 3WB9A 1MGOA 3JQGA 1XLTA 5CEFA 3IP1A 4BNGA 2HO5A 2O23A 3M1AA 2GPTA 1I10A 2O4UX 5A04A 1N2SA 1U1IA 5LDGA 1Z7EA 4JIGA 4QECA 2HU2A 1ZUD1 1T2AA 2FZWA 4Z0HO 2W2KA 4BNLA 2D0IA 4CR6A 1PQWA 1K89A 3FR8A 5IAAA 1R37A 1E7SA 1AE1A 3PJFA 3PPIA 3TL2A 2GD1O 2P5YA 1SEPA 4LMPA 4AFNA 2C59A 3WQQA 2DBVO 2P2SA 3ENKA 3NDJA 1MC4A 4R1UA 4BNJA 2LDXA 3W6UA 4G81A 3HHPA 4B4WA 4BNZA 2Q45A 4JP3A 4HUJA 3NEPX 3F4BA 2PFGA 2EERA 3PWSA 3JD4A 4MVJA 4GQAA 3BA1A 3CZMA 3H9EO 4DREA 3INGA 3IKTA 4DVJA 2YQ5A 4B79A 4CLHA 4MVJI 2JFGA 3TFQA 1PGOA 1KVQA 4DGSA 3TPCA 4KUGA 1IPFA 1FDVA 3C1AA 3FHLA 2HSDA 1EDZA 1UH5A 4PGFA 1SB8A 2DPGA 1NP3A 2J6IA 3U3XA 1P77A 2RHCA 3F5QA 2H6EA 3KHUA 4ZQHA 3VPGA 2RH8A 4IIVA 3EHEA 4RQUA 5ITVA 2P9CA 4HKTA 4B3JA 4PLWA 2CDBA 4UULA 1V9LA 2XAAA 3NRCA 2AHRA 2UV8A 3ZU5A 5CAEA 2IODA 3IIEA 5TQVA 3ZWMA 4NZ9A 2EWMA 4Z9XA 4N5NA 4OAQA 4Z0PA 3I5MA 4NI5A 3FNEA 3AWDA 4M87A 4WECA 5JFOA 1BMDA 4JBGA 3S2FA 3MCVA 3DL2A 3PIDA 2E6UX 1MLDA 4F45A 1IOLA 2IEBA 1ZO8A 2GASA 3UF0A 4RGBA 5EJ2A 3DOCA 5ILOA 1JVSA 4W9NA 4AJIA 5A3VA 5TS3A 2DUUA 3L4SO 1YJ8A 4CJXA 2AG5A 1KOLA 3H2ZA 1PZHA 3GVHA 2V6MA 3AUUA 4KTTE 5B4UA 3DMTC 4OIMA 3HADA 4IJVA 4ZJUA 2O3JA 5L40A 4J2HA 1PJTA 2OOSA 1ZK3A 4FFOA 1E7QA 2GR9A 5JPIA 1PJCA 4XQCA 3PYMA 1R66A 4MPDA 1RM4A 1HSZA 1H5QA 1BVUA 1OI7A 4CQMD 4UVDA 5HA5A 3D4NA 2C0CA 1UXJA 4L9RA 1WZIA 3GRKA 3TZHA 4XYLA 4E5NA 1T4BA 3RQSA 3VAZA 1GCOA 2VT3A 1X7GA 3RUCA 3DZKA 4O63O 3OQ1A 2X5KO 5L95A 3K5PA 6ADHA 1SNYA 3K9QO 4HV4A 1DRUA 3C8MA 1FDWA 2AEMA 5TNXA 3GZ4A 4ZQEA 3ZH2A 2EV9A 1ZFNA 3PHGA 2VOJA 4PLFA 5ES3A 2H63A 4Y6PA 3EY4A 5CPBA 1K6JA 3RD5A 4BO0A 1M6HA 3MJSA 3NJ4A 3ZWNA 2W8ZA 1HLDA 1UDCA 1LNQA 4GI2A 1Y8RA 1BRMA 3FNFA 3D3WB 3JQCA 5L51A 1P1RA 4BHTA 1W73A 1M76A 2YFQA 1IHYA 1GL3A 4MOWA 4FBGA 1AN9A 5DDIP 1P1FA 1DIBA 4OO3A 3RC7A 5JO0A 3JD2A 4JXKA 4O1MA 3I4FA 1VL0A 3OQBA 2J5QA 2Q1UA 4U0KA 4D0RA 3JSAA 4BUCA 1TB4A 3NTOA 1GD1O 2VHYA 3DAGA 4TMFA 2BFAA 3ITDA 4DWVA 2J3JA 4I5FA 2B83A 3D5QA 1ADCA 1O9BA 2FSSA 5IXYA 3B1JA 1X15A 3G3EA 4R9RA 5EN4A 5CEJA 4MVJM 3DBHA 4KOAA 1A9ZA 3ZWXA 2HJRA 4J9UE 2Z1NA 2QRKA 4YB8A 1VJTA 3LK7A 3RJ5A 1BHSA 2AEJA 1P44A 1E5QA 2DFVA 3M6IA 1YDEA 5I7FA 3BHJA 3CEAA 2VHZA 5DNAA 4WLOA 2PA3A 4CLOA 1ZH8A 3MOIA 3U4HA 1ZMOA 3EC7A 3PLRA 4IS2A 2NQTA 3JQ8A 4E13A 5JXWA 1H6DA 4MDHA 1NFQA 4L4SA 1ZW1A 3K92A 5DN9A 2VYND 2JCVA 4NR0A 4ILKA 5JS6A 4P4LA 1I24A 5EINA 2FOIA 5F3RA 1C0PA 3SEFA 1W4ZA 1K2WA 3PHIA 1QYDA 1PS8A 4F46A 2CVQA 5JO9A 1N8KA 1LDNA 3B70A 3HZZA 3QHAA 4J1TA 1WMAA 3P7MA 5CDGA 2NTNA 4XYGA 1I33A 3U4DA 2QIOA 5T57A 5L4NA 4J0FA 4YACA 4R4JA 1YVEI 1FDSA 3ZGYA 3TZKA 3ZWAA 4BOYA 2FN7A 4J3FA 1XCBA 2BELA 2PGLA 4WCFB 4BB6A 1RKXA 1U7HA 1G1AA 4BKPA 3BTUA 4PLCA 1T24A 3WWZA 2DBZA 4K26A 3ANMA 1UUFA 3H5RA 3PGXA 3H5AA 2BLLA 3BMNB 4UUNA 3ZHYA 2JAHA 4CMAA 1LLCA 1UXIA 3A1NA 2PKQP 2VUTA 4UUMA 1PWZA 1J49A 1SPXA 1H6CA 3GG9A 4BKUA 1V6AA 3ANLA 4TRJA 3RC9A 4RJTA 1UAGA 4ZQGA 1MG5A 2PZJA 3CZRA 4IUYA 4XR9A 5A3JA 3WJAA 4XRGA 3MJTA 4LN1A 5JE8A 3KUXA 5KNLA 4G5HA 2EP5A 4CMIA 4RCVA 3EZYA 1YL6A 2X0JA 1TEHA 4AVYA 3OECA 1UXHA 2D4AA 1JLLA 2H9IA 3NTRA 2GCGA 4UEOA 5JDCC 1P31A 4GLOA 2VUUA 3MZ0A 1PR3A 2EW8A 1P45A 1Y8RB 1PJBA 5DULA 4MIEA 2GERA 3GNSA 4CUJA 1I36A 2RBEA 5FWNA 2PH5A 5JAQA 1YONA 4B4OA 1U5CA 3OICA 3ZHBA 4GSKA 1ORRA 2ZTVA 4L76A 4PN3A 3ZNQA 3ZWCA 4GKVA 4HADA 3QE3A 4E6PA 1JAXA 4M86A 3DBLA 2TMGA 4DIFA 3FI9A 3FWNA 3ASUA 3I23A 2X9GA 4RVDA 3KETA 5FFFA 1N5DA 1QMGA 2EJVA 4UEKA 4DLAA 4ZRMA 3S2IA 5A9SB 4ND3A 2GNAA 1DLJA 2YHIB 3DC2A 2B35A 5JCJD 1A5ZA 1C0LA 1XIVA 1VKNA 3DZGA 3VZRA 4BNKA 1BXZA 2VHWA 1YL5A 4J1QA 2GGSA 1NPYA 2XF8A 1HE2A 3JQGB 2I65A 4A26A 2NV6A 2W2LA 3O26A 1H93A 3MJVA 3VOSA 2AMFA 1V3VA 4U8GA 1EVJA 1G0NA 4BKRA 4BIIA 3DBRB 3WIDA 3ZWBA 4J6FA 4R3WA 3R1IA 5H82A 1SEVA 2JD0A 3SC6A 3TRIA 3VH2A 2D1YA 2G5CA 1WW8A 4JJGA 3JQFA 1ZCJA 3WFIA 2JKVA 2A35A 1ZJZA 5TC4A 3AOGA 1JDJA 5TX7A 2VZ9A 2Y1CA 1GYRA 1QG6A 4F6LA 3HNPA 5EQFA 2Z5LA 4RPGA 1ZKMA 2X4GA 3SLGA 1U2DA 4YPOA 2JFHA 1FK8A 4XIJA 3JCZA 5MGBA 4YDRA 1LRLA 4I5EA 2YDXA 3E9MA 1YQGA 3VZPA 3WXBA 2X0NA 5COBA 1GQYA 1R12A 4CM6A 3BMQB 1E3EA 1XKQA 3GUCA 1KVTA 1E92A 3DBVO 1ULUA 1V3UA 1LDBA 1VJ0A 2BFMA 2ET6A 2Y66A 4XGKA 4YBZA 1BVRA 4W6ZA 4YXFA 2R00A 4IS3A 2VRBA 1NHWA 5G2OA 3BMQA 3N74A 1C14A 1DAOA 3WGOA 3DHNA 3L0DA 4D41A 4CM4A 1QV6A 2OO5A 2OL4A 3WLEA 1PGPA 4BNUA 1HYGA 2C07A 3KLPX 1R16A 5F1KA 4EBFA 1PS9A 3DFUA 1NQ5A 5TF4A 5JC1A 1ENYA 1P3DA 1EUZA 1HE5A 4RVFA 1JWAB 3TOZA 1IZ9A 3S2GA 1ISIA 2C7GA 4YAJA 3IS3A 1RJWA 5I7EA 3S8MA 1Y8QB 1PX0A 4JNKA 2J3IA 2Y67A 3L6DA 1H2HA 2EHDA 2Y1DA 4EITA 3QVOA 4R68A 2FRDA 5DCUA 1H9AA 1E3LA 4JCOA 5DBGA 3MJEA 2QZZA 1NHGA 4LW8A 1Z74A 2PV7A 4YVFA 3W8DA 4FW8A 5DCWA 4O6VA 1HETA 2CNBA 2X0RA 4XGNA 5HM8A 5KJCA 1O0SA 1BXGA 3DZIA 1KBZA 2GZ2A 1XSEA 3E1KA 3CINA 1CWUA 4B7UA 1U8FO 2VZ0A 3X2EA 3DBHB 1TA4A 3DOJA 1F12A 3I3OA 3IKVA 3KZVA 2NU9A 1YQXA 4HP8A 4YAEA 1I0ZA 1T1RA 4Q3EA 5G0TA 4BQPA 1T2FA 3I1JA 4CMEC 3MJ4A 4W7IA 1NX6A 4FDAA 3LT2A 1Y5RA 3ORFA 1KVSA 4ZQFA 1XWFA 3PJDA 2J8ZA 1Z7BA 3KYBA 4RO0A 4E30A 1I3KA 1WMBA 3V1TC 3FPLA 4LK3A 3DO5A 5TT1A 1W6UA 3TF5A 4K9DA 3TNLA 4ZHSA 3ICPA 1NFRA 3HDHA 2VNAA 2Y1FA 3LC7O 3IJRA 1Q7GA 4NMHA 4PG4A 2JAPA 3OSUA 1FDTA 1ADGA 3DEYX 2YZ7A 4OXYA 2FR1A 2E48A 2PLAA 3UFXA 4IXTA 4I9NA 1ISHA 3AUAA 3SJUA 3VC7A 3RWBA 5C7OO 4A2CA 2BF7A 4PG7A 3JQ9C 3VZQA 4CM3A 4ZQBA 2V6FA 1P1IA 1ARZA 2AXQA 2OGUA 4XZ3A 2D2IA 1J0XO 3HG7A 1NVGA 4UVGA 4PG5A 3HJAA 1X0XA 5HRUA 2AW5A 4M89A 4IMRA 4RF2A 1NASA 2E82A 5AVOA 1EVZA 1WXDA 1LDMA 2H1SA 3CIFA 1EFLA 3E9NA 2ILTA 1NWCA 3DMYA 3ONDA 4R41A 2P91A 4WASA 4FQ8A 4GX0A 4RVGA 5K9ZA 1EQ2A 3EAGA 2JHGA 4CM8B 4HFNA 3E48A 5C3MA 5FEUA 1Q2XA 5IN4A 2VWQA 4CV3A 3TFOA 5AXBA 3GRPA 1KIFA 1YBVA 4XQEA 4XYEA 5BSHA 4MP8A 2YFHA 5DT9A 3Q0EA 3FD8A 4CMHA 4FC7A 1LJ8A 3O8QB 4EJ0A 2AQIA 3VH3A 2UDPA 3VPFA 3P2OA 3VH1A 1ENOA 3STHA 3B20A 2P4HX 3AY3A 1DIRA 3BAZA 4YT2A 3KLMX 5B4VA 4E2YA 2BGLA 4FJ0A 1PU2A 1OBFO 5DCYA 1E3JA 1KEPA 3DXFA 4LSMA 3SBOA 4NJMA 3PTZA 1J5PA 2IRWA 3NTQA 4B4UA 2UUPA 3QV1A 1PR9A 4YJHA 2X86A 4LRTB 5DZSA 3RFXA 4GBJA 2Q1WA 2JCXA 1LI4A 3O38A 4Q3BA 1GV1A 1BDBA 3TZ6A 1P1HA 1L1FA 4E21A 2BH9A 2G0TA 4XDYA 3C3XA 1WVGA 4BO8A 3KYDA 4XIYA 2F00A 4GGOA 4PVDA 1BW9A 3WNVA 3OIGA 3GVPA 4OL9A 4Z0TA 1U8XX 1EDOA 3ZNNA 1ID1A 4RZHA 4GSLA 2UUOA 4RORA 2X9VA 1LA2A 1PGNA 5CEEA 4XDZA 5ADHA 2OBNA 2GN6A 4E33A 2VHVA 1NFFA 3NKLA 4CQMA 1UR5A 4PLGA 1YKFA 4XR4A 4C4OA 4EDFA 2Y93A 1MFZA 3G79A 1IE3A 4YJFB 4BO7A 1V3TA 1HDCA 4N18A 4CM8A 5H83A 4U6QA 3OH8A 4WOJA 1JW9B 3PP8A 4IQ0A 1ZMTA 2WYWA 4E5KA 4ALIA 7ADHA 1GYPA 1SZJG 2NSDA 5IDWA 3I9KA 5G0WA 1E0DA 2HJSA 2C2XA 1I32A 5K0ZA 1Y6JA 2PK3A 1KS9A 2XOXA 1QLHA 2POQX 3A06A 3Q3CA 4TKMA 2NUAA 4R54A 4MVJD 1QP8A 4HNGA 5I8ZA 4Y67A 3L4BA 3PJEA 4NPCA 4ZGWA 1K3TA 1XQ1A 3ZWYA 1VL6A 3T4EA 4ZICA 1LSUA 4D3SA 3F3SA 2D8AA 4Q3NA 5CP8A 1OMOA 4KUHA 2EGHA 1DEHA 3GAZA 1H94A 1RYDA 2O2SA 4ZA2A 4PLYA 4D0SA 3TSCA 2WMDA 4W9NC 1DC4A 2I3GA 2BFPA 4MO2A 1EVIA 3SXPA 2PD3A 2VHXA 1E6EA 1Y7TA 3AU8A 3VPXA 2EXXA 2DFDA 2NVBA 2WE8A 1CEQA 1IYZA 1Y1PA 3LZ6A 1GAEO 4XD2A 2J5KA 3ULKA 3PDJA 3GMSA 2ZYAA 1Z75A 4W82A 2V65A 4NBUA 4YJGA 2BD0A 1DFHA 3RJ9A 1B3RA 2ZYDA 1EBFA 3GEMA 4G2NA 4J9VA 2A92A 4NK5A 4FGWA 1DAPA 1F17A 2D5CA 4RQTA 2VQ3A 5JYDA 4S1VA 3QY9A 3H65A 3UCEA 4DYVA 3GGOA 5ICMA 2CVOA 4CMCA 1QORA 2HK7A 3VKVA 3QA9A 5G0SA 2Q50A 1MC5A 4C7KA 1Y81A 3U4CA 1PQUA 1YH3A 1UAYA 1H2BA 2DQ4A 1CF2O 3BXXA 4B7XA 1E3WA 4XCVA 3H5NA 3LF1A 1ISJA 3NX4A 1QSGA 4TWRA 4J1SA 4M54A 3AY7A 4IGEA 5G0VA 5ER9A 3L6EA 1PTJA 1RPNA 1UZMA 3FR7A 2IDZA 3JYOA 3U4IA 1E5LA 4L4RA 4M49A 4AJHA 3PYLA 4UREA 3ZW9A 3OJFA 3D4OA 5IDQA 2XXJA 4RVSA 2BI8A 3UGKA 4CM5A 2R6JA 3GVIA 3KO8A 1SOWA 5EESA 4R16A 3ONFA 3HUDA 7MDHA 3PFFA 3TN7A 2Y99A 3FNGA 4P4NA 5A4DA 4IZHA 1CDOA 3K6JA 3ICCA 1JU9A 4JBHA 5CDSA 1ISGA 1WLYA 3UCFA 4AL4A 3GG2A 1X7HA 1ZIDA 1UP4A 3K31A 4ND4A 4RPHA 5KKAA 3WLFA 4QUKA 4BNIA 5KIAA 4NBRA 5T67A 3P2YA 1NXQA 2O3RA 4JJIA 4E2ZA 4Q3AA 1MG0A 2RH4A 1ZK0A 2P5UA 1R0SA 4IINA 2I3AA 3N58A 4MVJH 2CFCA 3H9UA 5TT0A 3U49A 1ISMA 2Q99A 4KDEA 4YAIA 4NK4A 3NT2A 1Z6ZA 5IDXA 3WMWA 4GGPA 4OOEA 4XQ9A 3IMFA 4G65A 2VYVD 2FP4A 4PLZA 2HMWA 4W4TA 3QWFA 4GWKA 2QYTA 4A10A 1UP6A 1U7TA 3VPHA 4D3DA 2NTJA 1TT5A 1EBUA 4IQ8A 3SVTA 5FYDA 3H6KA 4DQUA 3GLQA 4IQGA 3KXDA 1VRWA 2WD7B 1CETA 4XJTA 1A72A 3G1TA 3PDUA 4NFHA 1GZ3A 1ONPA 5L53A 3S1LA 4H3VA 1WZEA 1JQBA 3JQAB 5AYVA 3JQBA 2ZB4A 4Q9NA 3WGZA 5BSFA 3PHLA 3OFSA 2HDHA 5IXSA 1BXGB 1VC2A 3FSRA 2ZKLA 2ZTLA 4WPGA 3KRTA 4JP2A 1OC4A 3ETGA 1MFPA 1ZSNA 4D42A 5THQA 4YT8A 1QYXA 2HUNA 2O3SA 3AW9A 1TXGA 3QLJA 4ND2A 5BNTA 1RM0A 2D59A 4E3ZA 1T2DA 1Q0HA 4YRDA 3E5RA 3GH3A 1LBEA 2VWHA 1VPDA 3AM3A 5B4TA 1ZJYA 3NT5A 3DR3A 5AXCA 1A7KA 2AQKA 4OM8A 1CRWG 3H4VA 4J0EA 1C1XA 1WAMA 3A4VA 4B3IA 4IZIA 4RV9A 2EP7A 3D5TA 4RLHA 4YJGB 1OZAA 3CPSA 4ITUA 4DIOA 4J91A 4CLXA 1T2EA 1TVEA 1E3WB 4ND1A 4OJNA 3U09A 5CG1A 1ADFA 3NJ8A 3IDSA 1P33A 4LCJA 2GO1A 4JN6B 1GTMA 2PH3A 5KJ6A 4CODB 1LSSA 3DMTA 1DPGA 3KYDB 5AXDA 4DIBA 5K6AA 4PIVA 5KJFA 2QG4A 4B7CA 1A7AA 2OZPA 2ZYGA 1XELA 2PD6A 1PZFA 4RPJA 5T5QA 4TVOA 4XWYA 4ALMA 4WCFC 1E3SA 2V7PA 3GY0A 4WEOA 2XXBA 5CDUA 1AHHA 2J5RA 1K5HA 3QP9A 4NH4A 4QO7A 2EKLA 4WUVA 5L4SA 2Q49A 1Z45A 3RBZA 1NBOA 1DHRA 4GVXA 3A14A 1A4UA 3VTFA 4DYDA 1HE4A 4UEJA 5EL0A 1N7HA 3LSYA 3UKOA 4PLTA 1B8PA 1YRLA 3KVOA 4CV0A 3R6DA 2FZEA 1H0KA 3RVDA 3RUEA 5FI5A 3OIFA 1VSUA 3GGPA 3H9JA 3DTTA 1RWBA 4Z9YA 1XGKA 1NQAO 2WSBA 2VNSA 1NVTA 3INRA 4NFSA 3WIEA 2OMEA 1VSVA 1YQDA 3CUKA 4JBIA 4HY3A 2NLOA 3CXRA 4CV2A 2G17A 3QVSA 4J7CA 4XB1A 1GADO 2IYOA 2R00C 3OBBA 3H3FA 4PLVA 4XJSA 4BO2A 4K28A 1F8GA 3NV9A 5J9GA 4B8WA 2Q2QA 4M8SA 3X2FA 1NAHA 4XB2A 4IIUA 3UHAA 2DTDA 2Y68A 1KEVA 3VH4A 3OJEA 5M6DA 4FD3A 3NDIA 4RVHA 5BNIA 1B0AA 3LYLA 4FJ2A 2DTEA 4N5LA 1JKFA 3GK3A 5EERA 1EK6A 4FPXA 3PIIA 1MUUA 2NACA 4IDBA 4RL6A 1X0VA 3OJLA 1VI2A 1HRDA 3LT1A 2NU8A 3E8XA 3Q9NA 1P0CA 5L7YA 3LU1A 3ZV6A 3B1KA 5BSEA 3PXXA 3GA0A 4CLDA 5I8WA 3CSDA 2X9NA 3PHHA 1KY5A 1LLUA 2DBQA 1AXEA 4OOFA 4E5YA 2Y1GA 3O9ZA 1ZEJA 4BVAA 3PVZA 4TRMA 1LDYA 3ZU3A 1A4IA 4XYBA 4CL3A 4CLEA 2FR8A 2W4QA 4ALKA 1T26A 4NJOA 2VTEA 1OC2A 3AFNA 3ST7A 4S3MA 2YQ4A 4Q39A 2GSDA 4ROSA 4J7XA 3WYBA 5EIOA 4WLNA 4CM9D 4XKJA 1WWKA 3E6AA 4AJOA 2P68A 4DMMA 4QTZA 3F4LA 1E1NA 2HMUA 2Y0EA 1O94A 3GHHA 2FPPA 4NHEA 4ND5A 1F0YA 1LC3A 5KVCA 1JKJA 1T1SA 4URFA 5B1YA 3CMCO 1FMCA 4J16A 2O3UA 3IAHA 4PLHA 1U4SA 3RAJA 1V0JA 3K73O 2HKIA 1DIAA 3GN1A 4UVIA 3ZWVA 3RC2A 2E49A 4UUOA 4CPDA 3ASVA 1P9LA 4QEDA 4IDCA 2ZK7A 3R3JA 3JD3A 4D43A 3GZNA 4GX1A 5IG2A 4I5GA 2OP1A 4ZRNA 4E5PA 1HDYA 3GC6A 1SC6A 4EI2A 2Q1TA 3HFSA 2HMTA 2HRZA 2Q46A 3HSKA 4UUPA 1XU9A 3RU9A 3I52A 3RC1A 4FIZA 3TDKA 1AXGA 4CMJA 2HQ1A 3RUHA 3EDMA 4AJLA 4GWGA 4RDIA 5JBIA 4B4VA 4PG8A 3K2EA 1N9GA 2QRLA 1PGJA 4NBWA 5DF1A 3ENNA 3N7UA 2RCYA 1QLJA 4JK3A 3WS7A 2EG9A 1E7WA 4AJPA 1YO6A 1ONOA 3DHEA 3U0BA 5U1PA 1EZ4A 1A27A 4GKBA 3SX2A 3WTBA 4MKZA 4FGSA 3GQVA 5A03A 1QYWA 3EZLA 1FXSA 2W98A 1I2ZA 3L9XA 3OMLA 4CMGA 3U62A 1BSVA 3JQ9A 1V35A 3GEDA 3ABIA 1OOEA 4MINA 3IJPA 1QYCA 2YJZA 2IZ0A 1GUYA 2EJWA 3JYQA 3D3EA 4C7JA 4HFMA 1U3UA 3B6ZA 3WOHA 5HS6A 2ZCUA 4R1SA 4KMSA 1BWSA 3ZN2A 3Q6IA 4BB5A 4ESOA 1AGNA 9LDTA 5TJ9A 4IPTA 2GN9A 5KJEA 4NQZA 2DAPA 3BTSA 4Y98A 5AOVA 1XEAA 2PY6A 4BO9A 4WJZA 5TRTA 4AJJA 4XX0A 1UDAA 5IZCC 4NNJA 3KM0A 4OKNA 2DVMA 1ZK4A 4TZKA 1VKOA 3W1VA 4N7RA 2AE2A 4PRKA 3OA0A 2ZIZA 3MWEB 4BNXA 4PG6A 1KERA 4J90A 4DUPA 4WLFA 4CMKA 4R1TA 5JDIA 3PZBA 3LF2A 5C5IA 1NTOA 4PRLA 1H6AA 3JQDA 1DIGA 4YJHB 1I2CA 1MP0A 1R0KA 4FB5A 3R0IA 5HBRA 3WGTA 1G0OA 2HMSA 2VWPA 4J1NA 2NVUB 3WGIA 4W99A 3WWYA 4FFLA 2AA3A 2YHIA 3WGHA 1W8DA 2I5PO 3PQEA 1PJ4A 4DXHA 1HT0A 5G4KA 3BTOA 1GV0A 4Z3DA 4BO4A 3UN1A 3G0OA 3NGLA 2IXBA 1HWYA 5JMPA 1LRJA 1C3VA 3U9LA 4GPD1 4YAGA 3W8EA 3UVEA 1GUFA 4R9SA 1GYQA 4GAEA 2GUGA 4YRAA 1GZ6A 4MKXA 3I9MA 4Q3DA 1QR6A 3KEOA 4L74A 1NM5A 2JCYA 5ILGA 1MX3A 4BV8A 3ROMA 3PQDA 2C7VA 3P19A 2P4QA 4K6FA 1DRVA 1XU7A 4YEDA 5L3ZA 5L45A 3ZI0A 5JMWA 3CKYA 4RDHA 4O0LA 4TROA 4W7HA 2WE7A 4CMIB 4FFPA 3BMNA 3PHJA 3OJOA 5CDYA 1CQJA 2A9FA 1IY8A 5A5FA 3ZCXA 9LDBA 3QVWA 1PJLA 4A5OA 3HDQA 3W4KA 1HXHA 3F46A 4OYRA 1NAIA 4KTVE 3IUSA 5ENVA 5MDHA 4TZTA 4BGEA 2GZ3A 3GMDA 1O8CA 2FR0A 4J7UA 3UXYA 2RIRA 3AUSA 1XG5A 4LRSB 1OAAA 3S2EA 2EEZA 4EEZA 3VTZA 3PWKA 1PJ2A 2V6GA 4EGFA 2DC1A 2I67A 5IDYA 5F5LA 1BGVA 2Q4BA 3QW2A 3DZFA 2ZB8A 3DAFA 3RI3A 1DB3A 4DL9A 1KVRA 3LLVA 4JGBA 3OEYA 5A06A 1E1LA 2NU7A 3RFVA 3FNHA 2E4AA 3U5TA 5I7SA 3D4PA 1M67A 3MWDB 3E9QA 1HL3A 1M66A 1IL0A 1DFGA 4P22A 4FJ1A 2VTDA 2Q3EA 4LMRA 1DOHA 5I9LA 3WSWA 4E31A 4DC0A 3WQRA 2PKQO 3UICA 4WLEA 3DBLB 4A0SA 1N1GA 4GVLA 1D8AA 1I3MA 2TMDA 2B4RO 1D1SA 2C20A 2C82A 3AOEC 3UCXA 3C1TA 3DBRA 4ZU3A 1NPDA 1I3LA 1HDGO 1EUCA 2GRAA 1VL8A 3FBGA 1HZJA 2VZ8A 3JQBC 5JC8A 2HK9A 1XA0A 1RM3A 4QXMA 3WBFA 3O03A 3H9QA 4A27A 5JYEA 1SO8A 3FTPA 2Q1SA 3VKUA 4DQXA 2YV2A 1BDMA 4L4XA 4RPKA 2FPIA 1IUKA 3HFGA 3GHYA 2PGDA 3JD0A 1CQIA 3GNTA 3GDGA 1YS4A 2EF1A 2ZTMA 2PTGA 3BZUA 1OFGA 3FRJA 2F1KA 2GN4A 4JLWA 3HDYA 3I6QA 4R51A 1H9BA 1Z73A 1Q1NA 1W0CA 2BGKA 4CM4B 2G76A 3PGJA 3D7LA 2HK8A 4KZPA 3VVCA 5LC1A 2NTVA 1RM5A 3MJCA 1B2LA 2QX7A 3ZV5A 1TT5B 1ZXBA 5KTKA 2J3HA 5JAIA 2CDAA 2IYPA 2B5VA 4IXWA 3LT0A 2X6TA 1PJ3A 4FFRA 1U28A 5L9AA 1NNUA 1O5IA 1ZSVA 1QV7A 3HN7A 3JD1A 4DA9A 5GZ1A 3H7AA 1I5RA 4ZD6A 4XA8A 3QJ5A 3I9JA 5EQDA 4OHUA 1ZK1A 3VVBA 4AJ2A 2FMUA 5TLSA 3QQPA 5CDTA 5I7VA 3R3SA 3KSUA 2HCTA 1Y8QA 4P8RA 1IHXA 4MKRA 3GF4A 1EQUA
chains in the Genus database with same CATH superfamily
5BRAA 5BV8A 4XIGS 4OJKA 4JX8A 4NABA 2WAOA 1ITZA 2YWHA 4P3YA 3MMZA 5CCDA 5CFRA 3AF5A 1OHHA 4C06A 1WHTB 3QH4A 5LSAA 3CVYA 2FKNA 3W7AA 5K09A 4C0BA 4O02B 2OSVA 5JTTA 1ZRMA 2JLYA 4P08A 2QYHA 3PUJA 3HPRA 4PRZA 3T61A 3X44A 4TV9F 1GIAA 3EIOA 3IAFA 4EGJA 1PF7E 3OESA 5CB6A 4RIEA 1C1DA 1DIOB 3AUJB 3D7KA 3SXUA 3UWPA 1J8QA 2BHRA 3K1YA 2UU9B 4OJQA 4OB8A 2C5FA 2H7CA 4XTRA 3RUPA 3DF9A 1R15A 1T1GA 3MCAA 1X1CA 2GPJA 4E1BA 3BHMA 3E03A 5HE9A 1GPJA 3LUCA 4P1ZA 2HSGA 4GX5A 5DM2A 3T35A 1XBTA 2GYVA 3WNQA 1G1MA 2QU7A 1J24A 4K9LA 4JUBA 3ROXA 2QZ9A 3ZNOA 4DA6A 2ZYSA 3N8GA 4FFNA 3WP1B 2R7NA 4LXIA 5GGYA 2QF7A 2CXOA 3DGEC 1GZ4A 3EGDB 4AC9A 4F97A 5A5GA 2D06A 3ESDA 3ZVNA 4NC9A 3J7AC 2VO1A 1OXBB 3FZYA 2Y0PA 3UH1A 1KO1A 5THKA 4Q02A 3USES 2V7QD 4A03A 3F6RA 3KOOA 2O2JA 1ML3A 1J0AA 3BZBA 3W2TA 4TLMB 5TARA 1G6KA 4GE0A 1C0KA 4MDYA 2CJWA 3KJEA 3VDRA 1IJBA 3WLQA 4MWOA 2VPXA 1ZEMA 3QG1A 4FINA 3T5GA 1D2EA 3KPYA 4QOSA 1PL7A 3DTYA 1P2SA 1QNLA 1T2CA 1IZ0A 2Z95A 4KZKA 2JLQA 5DP2A 3WZLA 4H7EA 4QX6A 5I3ZA 2QI9C 1UKAA 1TQ2A 3KYCA 5C8YF 2AWOA 3FX2A 4CUKA 2UYYA 4MA4A 4NG4A 5KTMA 2I6TA 3ZQJA 3QU4A 2GRJA 4Y2PA 4GLFA 5CURA 3LZCA 4BS9A 1W8IA 1ZOSA 3M6FA 4P34A 2FOXA 2VHCA 2G3YA 4ZYXA 3SWWA 3RASA 2P9GA 4JOBA 1HTBA 4PSUA 5DTQA 4DWWA 5JJKA 4G4GA 1SCNE 3SIPA 4W8GA 1EE1A 1RTKA 3RVRA 3ENZA 1FEZA 2BR3A 4MVJG 1DJPA 2J31A 5B2EA 4G4IA 5ALNA 5C51B 3HXPA 4FHFA 2Q3BA 3AQIA 2A9VA 1TF7A 2AFHE 1E79D 4JBYA 1KEUA 2XNCA 4PBRA 4RD6A 5KREA 3BA6A 3LA6A 4BX2A 5TVOB 2D5LA 3D7SA 1US8A 2QZSA 1CVLA 3I6IA 2AG8A 4G36A 1ICEA 4R69A 4ZAWA 1OWOA 2IZZA 3SF0A 3GZTB 1S8OA 1Z34A 3BXZA 4KDCA 1XPJA 4M0KA 3L49A 4TRNA 4TKUA 2FJPA 1R6XA 4XUGB 5DHUA 1EEXB 4PIMA 3ZW8A 4CR7A 4OIFA 4CT4B 1LV8A 1RXCA 2AN1A 4HDQB 3SHQA 3WHIA 4R83A 2G6BA 3H86A 2KSQA 3HZOA 3KJFA 3TLEA 1KDVA 1SWWA 2PT7A 4KXNA 1L4MA 1YD7A 4L08A 4Q4HB 5K0LA 3T7CA 4CQMB 2H2GA 1GPLA 1LRKA 2QT0A 3JQ7A 2I6GA 4U5QA 1CYDA 2JNWA 3ONWA 4GR4A 4Z4FA 4ZVNA 1DLIA 5I3CA 1UPBA 1ZKDA 3HCWA 3QHQA 2FOLA 4Q12A 4KR9A 3ZV3A 1HO3A 1SAYA 1UBHS 2MR5A 2RJOA 5ALKA 3IQDB 2Y1EA 2HMVA 1JHDA 4KYUA 3FFAA 3FCEA 5TIIA 2VPTA 4JB2A 1P8JA 2XBLA 4S1OA 3KB6A 1WTCA 5GM1A 1L5KA 4ZOLB 2CMFA 1U4NA 3UH0A 5GZ6A 1ZM9A 3NT4A 1FSFA 4L3OA 3W1EA 1LGYA 4GLJA 1E4EB 3EDYA 3K9WA 3TR5A 2X13A 2GJ9A 3I76A 5BQPA 4QQ8A 4TKVA 1I30A 1V5GA 2DWQA 4Q9KA 5CD9A 4QVIA 1ZHOA 1UXGA 1JYSA 1NI5A 4ERNA 1JPUA 3DCIA 4LC1A 5FPTA 2LKDA 3DFFA 2G9ZA 2WIJA 4CE6A 5DIFA 2XSZA 4WLUA 1KEEB 5HCNA 5LCXA 3QKSB 3BL8A 2ZUFA 4E3WA 5CX1B 1AKWA 4X20A 3AHGA 4CR8A 3CH6A 5CCBA 1E2NA 5BW6B 3CW8X 1NIPA 4MQFB 4N39A 4RULA 2VDVE 4PX3A 1Y5MA 3K6KA 3V8VA 3ZWDA 2BP7B 5FUBA 2XT0A 2A5JA 3V2UA 1DCFA 2BHNA 4PC7A 2X42A 4K5QA 1ACMA 2PUWA 3MYRA 3ORHA 4ACAA 1MIOA 1ZK2A 3GFBA 1W4AA 5CITA 3M6XA 4AT1A 2XBMA 5LQUA 2OCGA 2ONKA 1NR7A 4EZBA 3OIDA 4TSFD 3T3NA 3ZNPA 1N1EA 1U8EA 1YR1A 2WDZA 2WVJA 3M4NA 3NLLA 4G89A 4EFMA 3BRQA 5ALMA 4PZ0A 2SICE 5C53B 5L7WA 1QK3A 5ITWA 2QU8A 1E79A 1WOMA 3H13A 1Y82A 2VIIA 1KEZA 3HGQA 3NI2A 3O4HA 4Q3KA 3OZDA 4CM9A 4R05A 1ID8A 3M6VA 1B14A 1EXMA 2Q9BA 5GY7A 3GB9A 1K08A 2OTCA 2OHXA 1DEOA 1R9NA 2ZJ1A 1K0FA 5BSKA 3GWZA 3JR3A 3QIVA 2L19A 2IUEA 5JYAA 5AO9A 3RIEA 1A0OA 1MV8A 3BRCA 3WX0A 1EGAA 5JD3A 1G5PA 4HH0A 3UA3A 2NAPA 4JUDX 1G18A 3DVSX 3F3MA 4LWPA 2I7XA 3GJZA 2WTBA 1X1QA 1P19A 5HTOA 3MTGA 1O5TA 5MGNA 3QPBA 1GPWB 1KOJA 3O7MA 1JWBB 2YV5A 3PE6A 2QXUA 3SN6A 3CF4G 4C14A 3UGJA 3WFJA 5ADVA 2VN8A 3F6YA 3S5JA 3IQHX 3ISVA 3WRYA 1OB2A 4DIUA 2EKQA 3FVVA 1FMTA 2VEDA 2IXAA 2OHOA 2HNKA 4IV0A 3S2ZA 3PI7A 1MHTA 4PPNA 2NZUG 3JV7A 1J07A 4KC0A 3ZHQA 1RXIA 1VE9A 3GPIA 3RAEC 1XR3A 2VYNA 2O48X 2DX7A 1FSGA 1QX4A 3B3FA 2CLOB 5K51A 3IKLA 3A58B 2YMLA 3ON5A 4MVJF 3F5SA 4RENA 3D4BA 2AOTB 3GT0A 5BN5A 5LXTF 1LF5A 4DUGA 1YBMA 1Q77A 1IVSA 1IWOA 3A0RB 4YT5A 3SK0A 4YP6A 4YCMA 1Z9BA 2DULA 4UBKA 4HPWA 1OYYA 3JQAA 3PQ6A 4KGDA 1EJBA 2IEIA 4TSKA 1BKYA 2YR0A 4UNIA 4YCAA 3HBLA 4G5RA 3B1XA 5E7IA 3VO2A 5C37A 2O8BA 2OVBA 5C18A 4KPEC 3THXA 4K9RA 4LZZA 4WA7A 5SZJA 1E9RA 2HLNA 3Q4GA 5JDIC 3ND8A 4H9GA 3FF4A 3DOFA 4AG3A 4JI4B 5C46F 1KH2A 2VK2A 1QKJA 1QS0B 3I01A 1P74A 1YOVA 3ESYA 1NMQA 3U6BA 2QN2A 2W2VA 4FS8A 1J2YA 3P45A 2YICA 4FFWA 5CPFA 2QPOA 3EF3A 3FKQA 2G70A 13PKA 1LCIA 1ZD5A 4HNTA 1RPJA 3AM4A 1E3IA 4LG1A 1ZJ5A 2RKOA 5DHTA 3C1UA 4CCAA 2CUZA 5H81A 5I45A 1N92A 1IN1A 4AJKA 1DV2A 2NUBA 3HSYA 3NIDB 4L78A 2V45A 1K63A 3RVJA 1UJMA 4R1MA 2JVIA 3SZMA 4A73A 5LNK1 4AYTA 1J8FA 2H7VA 4BP9A 3L06A 2IW3A 3P2MA 4JASB 2CL5A 4L07A 4YRPA 3PDWA 5AKJA 3OZAA 1D8TA 2WKWA 2CSUA 5JAUA 3D2CA 3BGVA 2B4TO 4QPNA 2R65A 3G2HA 4B4KA 3MBIA 3L7NA 2C9MA 1XRPA 4X92A 4IHJB 3DB2A 2QDKA 1GPAA 4Q4JB 5DBIA 4CW7A 1JA9A 3I5UA 1KK0A 1XMSA 5DXAA 4D79A 1J2TA 3DZJA 1W34A 1EFHA 3DF7A 1XMJA 1XZAA 3I2HA 2BJVA 1YGYA 3OP1A 3TNDA 4D9FA 3LLSA 3AM1A 3QKRB 1M0SA 1WW2A 4Q7QA 4JVLA 5KQMA 4WVLA 5G4LA 4BO3A 5JDCA 1EUYA 3NGXA 3D4IA 1LC0A 4RH0A 1H6BA 3HJBA 3GJ5A 3I45A 4LYHA 3BWCA 1ENZA 2Z2ZA 3AR6A 3V33A 4WNCA 2VP3A 5KEIA 3MAJA 4L75A 3TG2A 1K7YA 1XEXB 1HDXA 4YMLA 3D81A 3PUZA 2OO3A 4ND8B 5J59A 5EJ4A 3DZHA 2ATIA 4EJ2A 3BMXA 3CH7A 1U3DA 3JAWA 4WINA 4F85A 5DYIA 1H22A 3KZXA 1OY1A 4RTPA 2WWRA 4MV3A 5JFTA 1G38A 2CBGA 3O8QA 4YWHA 4DQLA 3FZGA 4Z3KA 2XYHA 2GYYA 1YK0A 2CKMA 3GROA 2P9FA 3OX4A 4JL5A 3L0IB 1ISRA 5C5DA 2ZANA 5I9NA 1U7WA 5E0KB 1PO7A 3L8DA 4KFUA 3LDHA 4IDOA 5E6SA 1DKUA 4J4TA 2PR2A 3EYWA 4WK6A 5DYTA 5TGTA 3WWEA 1B26A 4L5CA 3D4LA 3DE7X 4DPMA 3B1ZA 1P5ZB 2VHEA 4Y2TA 1MB4A 5DI9A 5AKHA 5AVWA 2E85A 3OOJA 3CJQA 3HO6A 1LLQA 1N4AA 3S8EA 2XE8A 1UPFA 2FX5A 5SZKB 2J9GA 3ECSA 3H2IA 4MUMA 2GF2A 1QGDA 4H6PA 2HXYA 3OZEA 4XAQA 2JANA 5C3UA 3BIWA 5T8KA 1UDBA 1BA2A 4R2WA 3PE4A 1QQ6A 4IDHA 4TLEA 1J8YF 3HYLA 4Z9FA 3KQHA 3BQ9A 1CUSA 3KAKA 4RK0A 3JWIA 5HPYB 5JHGB 4FK8A 4II2A 5CNIA 1XDUA 2NADA 4D82A 4NU6A 2O3TA 3BREA 3KWJA 4MUIA 1E20A 1SHTX 2RFLA 1H2WA 1J6UA 5CHYA 5ICSA 1J00A 1E1KA 5A9RA 4GPTA 4WKBA 2ZRGA 4EKEA 1PJ8A 2C57A 2WJZB 1JEAA 4UTOA 3WICA 4C29A 4DR6B 1QB8A 2ZQ5A 3GLHB 1CB7A 3R9XB 2BMWA 5EIAA 3HM9A 3B8EA 1YUBA 1NRJB 3KOUA 2C00A 2PX5A 1T6XA 5HUQA 4REQB 1NU8A 1I7SB 3Q5EA 1XA4A 3AKCA 4FCVA 4X62B 2NN3C 4YCSA 5KQPA 4BO6A 1GA1A 1B16A 2HRQA 4A8PA 1BFUA 2XCTB 1EVYA 3G7NA 1K8YB 1SUSA 2OR3A 4R0VA 3RADC 3A2KA 3H2SA 4ZEMA 1MB9A 2PSJA 4CBVA 3WSVA 2JZNA 3D0KA 4KDFA 4DIOA 3EIFA 4EL5A 1DIHA 1YB7A 3A11A 1UT6A 2UAGA 1WV1A 4LQLA 5ITZB 2BEWB 4QC2A 1JHYA 4TS4A 4RBNA 1JFSA 1ZNQO 1V26A 1DWPA 4BO1A 1ZJJA 2YUTA 3GAFA 1J9EA 1L4BA 3WIVA 2YJGA 3RUDA 1UODA 1SHUX 1DC6A 4YK7A 5AXAA 4OVKA 5FCDA 1N6HA 3GVCA 1V5IA 3MLEA 1UADA 2XUHA 1GITA 5I7AA 4RJJA 1UKEA 2R5FA 2Z04A 5DHSA 2ZETA 1QGUB 1W76A 4Z1OA 3EPLA 4OQMA 1SURA 3W4JA 2B2CA 1GAQA 4C89A 5HWSA 4WCDA 3C6YA 2XRZA 5KPDA 2W2MA 4WT7A 4PFQA 1FYFA 5KI6A 1QYIA 2HJGA 3S70A 2BT4A 3S4YA 4IIJA 1N2OA 3BKXA 4LDNA 2ZE8A 4H16A 4GI7A 1A7JA 1W4BA 4KAJA 1EDEA 4B7AA 4L0QA 1JVBA 5HF9A 3I34X 5CFPA 1F9AA 3F47A 2HZBA 1Q7CA 3WGYA 2Q2WA 3E2IA 2NU6A 4N8EA 2DT5A 4NPHA 4EUFA 3ADDA 2J3QA 1L4LA 1X87A 2PDAA 3A2NA 4OH1A 3AF0A 3K0BA 1K88A 1VKRA 4XLZA 3UW3A 2I99A 5BRJA 3BGDA 2EDAA 3PGVA 4XPZA 1K3UB 3FHOA 2YXPX 4FMCF 4BNMA 3LGAA 1ADBA 1GLVA 1H3FA 1GO2A 1G3RA 2AZDA 3I28A 2PMFA 1T9GR 2FW1A 4M0DA 4QGHA 1Y9AA 1LDEA 3A9UA 3UATA 4NU0A 3TK1A 5JQGF 3FHJA 1GUZA 4IMIB 3CC8A 3ZJTA 2D2FA 2JK1A 1K86A 3OTIA 4UBOA 4Z2YA 4CMBA 1EFKA 4KVZA 5IJ9B 1L6RA 5LQSA 4KQ6A 2EGGA 5JMOA 3DZ4B 3CWCA 3DWFA 1RZRD 4OLBA 3ZOKA 2AN5A 2ZIEA 3JZAA 1QIKA 4DKXA 1VLQA 1T5BA 1HX7A 3QWHA 3L05A 5EC8A 1GU1A 5D6OA 3SZ3A 1TLFA 1XHLA 3L82B 1W0JA 2PTHA 1VM6A 4QLOA 1YE3A 4TMYA 3T4XA 1X8XA 3E27A 3KQPA 4RK5A 3I9NA 4MYHA 4TUYA 3LC1O 3HN2A 5CHEA 5BT9A 3NDRA 2GPBA 3TZLA 2EZ9A 3O5AA 4PYRA 3LNTA 2ZB7A 1RWPA 2NU8B 2VWGA 2WFMA 2A9RA 4DCVA 4MHOA 3QWIA 4U63A 3M6MD 1OW3B 4E11A 2OY0A 1RYZA 2QN8A 3RREA 4ALJA 2YWCA 2OBMA 4RHCA 3ETEA 3QI2A 4CLOB 4FR2A 4UNNA 1IN4A 5HUJA 5E4TA 2ZPUA 4AO7A 3VPSA 4F93B 3ZE6A 3PX7A 5JWOA 3IP3A 1TD1A 3PX3A 3MB8A 1D7OA 4II3A 1Y7PA 2B9EA 1B7GO 4JKIA 3JRWA 4L5BA 4NYMR 4OU4A 3EC2A 1WDKA 3A9TA 4RDCA 1TK3A 2IVZA 4MV0A 4OI0A 1DAMA 4C7MA 2DPYA 1G5TA 3A04A 2VCYA 5CJPA 2P9EA 1KHHA 3QF4B 1BS2A 3AJRA 3TZEA 2Q7DA 1N5KA 3S7ZA 5P8WA 2IJGX 3UV7A 4O08A 2QQ0A 4HAXA 1PHPA 2QW0X 2QRJA 2ZDGA 5A2QA 2G25A 5HG0A 2J4DA 2CMDA 2RGWA 1ECPA 3T0GA 1HK7A 4RK1A 3PQ5A 2RD2A 2OV2A 4U2FA 4BMNA 1NULA 4B3XA 2PUEA 5DN6D 3BVPA 2SHKA 3DVAB 4NCHA 1NATA 3IVMA 3OF3A 2XW6A 1KI2A 2JFUA 3L8ZA 3QU5A 3TQHA 3VU9B 5ALZA 3OHSX 2DBRA 1DHTA 1VOTA 1DAKA 3F7NA 1VJRA 2BFOA 3E7DA 3MILA 4H60A 4HN4B 5D6NA 1KY4A 3HP7A 3TIIA 4LJ9A 1QKIA 3HA5A 3EOBI 2HTEA 2O3QA 2HSZA 5FOSA 4D7AA 4EUEA 5CYGA 3CYFA 3V1UA 1SMKA 1DRKA 1ECJA 2X23A 2X5OA 3CA8A 4PZLA 1IPHA 2EFYA 3C6ZA 2ZT5A 5DJ5A 5TEVA 3LPCA 2ZQYA 4EHBA 2GLUA 3ME5A 4TMZA 4ZQIA 4GYJA 3RVSA 4MWTA 2PMWB 1EM8B 2V6BA 2HIMA 4MDFA 1K7EB 5EMHA 1KEEA 1YRYE 4KR2A 4TYYA 3V55A 1U3WA 1IQPA 3PFIA 5ALUA 1WCWA 4LQCA 1PNQA 1DJOA 3EPRA 2PG3A 3OA2A 3D7NA 3M5DA 3I83A 5EMJA 4AKSA 1VSTA 4F4CA 2QRGA 2BGRA 1A9XA 2DTXA 3KBBA 2YOGA 4HWGA 3I6ZA 4O59O 1MABA 3MHPA 4RKFA 4DN6A 5KKCA 5JYFA 1GGEA 1GEEA 1QGYA 4MWEA 3T9AA 2IEDA 4CV1A 1JSZA 2ASVA 2UVPB 3H05A 2GBCA 1G41A 2QE7D 3GJSA 2RK4A 2XLCA 3LI2A 1MA0A 5HFNA 1YFJA 4FOSA 1M54A 3TBHA 4R3NA 3HA7A 3EMKA 3ACBA 4PNEA 3HCCA 4YRQA 4CLRB 2KQUA 2O5CA 4NV0A 3T9EA 2AD1A 2VDQB 4JL6A 4PLPA 1CJCA 5BOSB 2AD5A 1XOIA 2CEAA 3GAMA 4OKIA 3U3MA 3VZBA 2DR2A 3RFUA 3EOZA 4EYGA 2JFFA 1XCPA 3OQJA 2XIJA 4E1VA 3MGKA 4R71A 3GLFA 1MJ5A 4AKTA 4Y0VA 2I76A 2NAFA 4B6OA 5TY0A 4GMGA 4F96A 1I7LA 1JSXA 1VJ1A 1ZIOA 3HBMA 3N2IA 1GR0A 1PEKE 4DLNA 1MW8X 1FDRA 4KHZA 1TLTA 2HXGA 1PWXA 3UK2A 5J2UF 1R5BA 3EVTA 1FXWF 4TUYF 1QANA 4UHBA 3Q11A 1Q0SA 1NI3A 3QTTA 4BGUA 4LGVA 4M7PA 2DKNA 5DM70 2CZCA 5HKKD 3WY9A 5LB2A 1FQWA 3ZU2A 3N3AC 2NVUA 2VYVA 2PYIA 1W88B 3NWEA 1C1DB 3PNOA 4MB0A 4DVGA 2ZZMA 2GDZA 3DQZA 1X1TA 3KQNA 1PT5A 3MWKA 1R6TA 1NNLA 1L5GB 4GG1A 3PZRA 3F8WA 4G0ZA 2PZLA 3TOXA 1HLPA 3NBFA 3G5AA 4INZA 3ZU4A 2ZIVB 1SA0A 2QPAA 2YMQA 3JWGA 5EKTA 1KOGA 3HKCA 4IM7A 4JBXA 4OGWA 4S1NA 5C5CA 1OXMA 3TLZA 2BMEA 1ZZEA 1MO3A 4FXPA 2H0RA 4D4HA 3U7EB 1VYUA 1UBNA 3CCCA 3A4MA 3KZMA 4XVQA 3K1JA 2V7GA 3FY4A 3H42B 4LC0A 3QA3E 3DDHA 5U9CA 2XRYA 2JLXA 4C2UA 2GARA 5JUWA 1V47A 1C3OB 1I2BA 2AS0A 3EZFA 1FXWA 2B7BA 4QPJC 3GR6A 3BS4A 4Z6KA 2ST1A 3GMIA 1BWRA 4RVUA 3TLBA 4QG3A 2F9LA 1U3TA 2PWAA 2ZI9A 4DR7B 4B3GA 3OQOA 4QSMA 5EVCA 2PS1A 2EG5A 5KOHA 1N7GA 1XLVA 3MJDA 1Z0FA 1EFPA 3H9GA 3SAJA 4BYMA 5K2OA 3GYBA 3QEBZ 4I08A 2ISCA 2QVBA 2XH8A 5ER6A 1KMHA 4N6GA 3QKIA 2YHUA 4ANFA 4BAZA 4QQKA 5A71A 4BFWA 4LDJA 2NTEA 4AK9A 4WX2B 5A0TA 2VPYA 1LXCA 1QQ5A 4LZNA 2OBXA 2W7TA 3UUWA 1QO0A 3FPSA 5CEFA 3P9RA 2FSFA 2O23A 5A04A 1N2SA 1U1IA 2KW5A 2FEOA 2P3LA 2QGZA 4XE5A 3RS0A 1S9HA 3W3AD 1T2AA 2RBGA 3DMPA 3C87A 4K9SA 2GAAA 4UFPA 3FR8A 1FFXB 3PJFA 5FEMA 5KS2A 3TL2A 3IMEA 1NLZA 1Q21A 3FWKA 3IBSA 2HD4A 1SEPA 1Z0AA 3H11B 4C88A 4QJ3A 2L18A 4NF2A 1W1WA 1MC4A 1XZHA 3U7FB 4BFXA 2LDXA 3KNZA 3HHPA 3KOYA 5AW8A 1EFDN 1I9CA 3AINA 3CH4B 1JSRA 4HUJA 1VLHA 2QZPA 3QI7A 4UE3S 3EPPA 4ZVPA 1SHKA 1KRXA 5AUPB 4FEAA 4GQAA 3BA1A 4S12A 3ASZA 4DREA 2GM5A 2Z1DA 5FOQA 1O95C 3TFQA 1YDHA 3SFVA 2JH9A 3FNIA 3TPCA 4DGSA 1H5NA 2O6LA 4J0CA 3TNJA 1FDVA 3FHLA 3F49S 1ZI6A 1SCBA 4J0GA 3EVEA 4K9OA 3B3JA 4KIWA 1FPMA 4PGFA 1V43A 2OV1A 3M33A 1NP3A 3IB6A 4LBWA 3VVMA 3U3XA 1TYDE 1NUUA 5ETJA 2GN2A 4TQUS 1DCKA 3GLIA 1W5AA 2AZTA 5IC6A 3WO1A 3VPGA 1NVVR 4IIVA 4GICA 1JFTA 4II7A 4HKTA 1V6SA 1S3IA 2P9CA 5TPWA 2W2OA 3FGZA 3IPYA 4BLRA 2CDBA 2K5UA 3MUEA 1G7CA 4B3JA 1P0QA 1V9LA 2XAAA 4F56A 3K0FB 5HW0A 1O6CA 3R3XA 2DT8A 3ONVA 4RYDA 2GCIA 1OWLA 5BSWA 2AHRA 3OUTA 5JCOA 2CE2X 1THGA 3ZU5A 2JCGA 2XWJI 2NT3A 1N6NA 1N6PA 3AIMA 3OJXA 4Y6QA 2AFHB 3W6OA 1Q3TA 1ULTA 2GT1A 3EEYA 3MWFA 4PR3A 4Z9XA 2J5XA 4QYSA 3L8EA 1U8ZA 2A1UB 4N5NA 4Z0PA 3FVTA 3W5CA 2WQ6A 1H4QA 2PS9A 4JIMA 4NI5A 5EP2A 3K4HA 5JFOA 1YZKA 1KH1A 1TJ4A 2BGNA 2GUWA 1BMDA 2F1JA 2HHCA 2IDKA 3IP7A 4BTLA 3U60B 1E3QA 1CUVA 2J3EA 5SV2A 4LY6A 2JGKA 4O2AA 5A2GA 4FDUA 2ZR8A 2CK3A 2OFWA 4PXYA 4DIEA 3VHXA 2PGAA 3HVIA 3UF0A 4RGBA 5BV1A 3BIFA 2BTOA 3AUXA 1IXZA 2XTNA 1PJRA 1R18A 1XVVA 2VH1A 3AKDA 1GZSA 3QW4B 3GRRA 1QH1A 2GXSA 1GJRA 5ESRA 2YXDA 4W9NA 1XN1A 4AJIA 5K20A 1S2IA 4L15A 1RCUA 2W0SA 4X41A 2BUCA 4UTNA 2BZ0A 3ZY6A 3H2ZA 1PZHA 1AQUA 1DAHA 2CGEA 2R8EA 3GVHA 4X6UA 4KTTE 5B3JC 3UGTA 2WFZA 2YASA 3HADA 5SYAA 1U2ZA 1CUWA 1LH0A 2O3JA 4B0OA 2II6A 4MRRA 1ZK3A 2R3SA 3LQRA 5JPIA 2XWPA 1T8WA 2JEZA 1MJHA 1NBAA 2IGBA 4OU5A 3SQDA 4LYEA 3N2ZB 3NR2A 4D8YA 1CR2A 4E15A 1HSZA 1H5QA 1QWOA 3KPWA 1OI7A 5TXGA 4MS4B 2MDTA 1KJJA 4ZVMA 3VISA 3AERA 1I1NA 1WXWA 1QQTA 1UXJA 2AC2A 3L7OA 3OFVA 2NXNA 1WZIA 4XYLA 1P7YA 3CUEF 3K32A 3ILXA 3RQSA 1GCOA 3DEJA 1JVNA 3GQBA 3NIBA 4TYQA 5CA0F 3DZKA 4O63O 3ICEA 2E0IA 2YTZA 3O8NA 1AVTA 3K5PA 5EWLB 3KQKA 1DRUA 3C8MA 1BEZA 1FDWA 1JR3D 2C94A 1ZR2A 4IKOA 3PDIB 4ZQEA 1ATZA 5JH7A 3IAXA 2QENA 1P7VA 4LV8B 3PHGA 4EP1A 4WJLA 5A7FA 1Z7YA 1VBFA 4PLFA 5ES3A 1C50A 1WUYA 3HEAA 3TLMA 1K9VF 5A6VA 2F55A 4IKPA 1UMCB 2ZWPA 1IBMB 2OCXA 2I8AA 5D00A 4BO0A 4GDFA 2PBZA 1C2YA 5IPFA 1RCTE 2IVFA 1I1OA 2XTJA 3NOQA 3T3PB 2ODAA 2J3MA 5FIUA 4GI2A 3G0IA 5LLSA 4FGJA 4GHWA 3C97A 2X3YA 3FNFA 1E2BA 2H3EA 1AGPA 2DZDA 4IIDA 4QBFA 3QX9A 4PWZA 1UAAA 4NXMB 4UCXA 1AA9A 4QYXA 1YIDA 1IHYA 3IA7A 3DLAA 4MOWA 2OYCA 1AN9A 5DDIP 3K1AA 1P1FA 3U4QA 1KQ3A 3RC7A 2DY1A 2ISSD 5FOVA 1OH5A 2VH5R 3ODGA 4JXKA 2AT1A 4UATA 2CWWA 5DV9A 1VL0A 3UM9A 3OQBA 1JR3A 4NCKA 1GGVA 3QLVA 5TPZD 3NTOA 2X2EA 3WB1A 3ZJ4A 4CDGA 4AXXA 3ZR4B 1EAYA 4DSNA 4X1OA 4DWVA 2DERA 3VUEA 1I3CA 2QT9A 2A33A 1AKRA 1U1FA 3BWEA 1ADCA 1Z13A 5B3KA 3K0KA 5ADUS 1DTWA 2JIRA 5L6LB 3JWJA 3OZGA 1X15A 3G3EA 1M7HA 1OU0A 3ZDBA 3ZZ1A 3MGCA 3G9UA 4JLAA 5BR1A 4XASA 4BVJA 2YQZA 3OQMA 1QIHA 4J9UE 4YDSA 3QEJA 1AKVA 5F77A 3LK7A 5ALOA 4YNBA 1BHSA 1CY6A 2CKDA 3HBJA 4U5XA 3RJ5A 3P2KA 4BNDB 4ZEWA 2OPHA 3C6KA 1E5QA 5C80A 4NRDA 4UOQA 3KAQA 1EDBA 3UANA 4UNRA 4M7RA 5GGXA 5L3RA 5K8VA 2UZ1A 2VHZA 1G3IA 3BXHA 3CU5A 2WHXA 3MD0A 4BXOA 1XT6A 2V55B 4V3CA 2GN1A 1USKA 1QE0A 3PLRA 3A6HA 1T5DX 1QHNA 1RVDA 2B30A 3TSOA 3WE7A 4MDHA 2P2YA 1NFQA 4PN7A 2ZYHA 2ZAMA 3K92A 4ZPJA 5DN9A 4U7HA 5E2IA 2P35A 3LHFA 3O2JA 4F3NA 4NR0A 1FYVA 4ILKA 5SZIA 1BYIA 2YUIA 1II8A 5F3RA 1U0EA 3NBUA 2QXTA 4DCOA 3GPLA 1JJBA 1HFKA 121PA 1SD1A 2H08A 2PAFA 5EOVA 5FNVB 4F2HA 4DMFA 5ALVA 2O20A 2ATCA 1YZUA 1O0CA 3B70A 1EH5A 1H4TA 1DBIA 3A1EA 4OHBA 5LA6A 4S2EA 4ZHQB 3WLRA 4LNAA 1E58A 1Q6ZA 1WL8A 5CLQA 4DFDA 1KEKA 3PEWA 1EFVA 4XYGA 1NT2A 2QIOA 4H59A 3LCCA 4OYLA 5T57A 4YACA 1YVEI 2B5OA 5DEOA 3S44A 3QKRA 3TM5A 3TQFA 3RYCA 4BMCA 1GVNB 2BELA 2C3YA 2QJWA 2QVLA 3HNOA 3PGA1 5HF5A 1XV5A 2IHYA 3G9QA 4BMPB 4BKPA 3JARB 1JF8A 1T24A 5IVPA 4JENA 1TQ4A 1OGJA 2ZJZA 3OT5A 3Q7IA 2JCBA 3H5IA 1SH7A 2JAHA 3EXIA 4CMAA 1WR8A 4CKCA 2G1JA 2YW2A 3A1NA 3KWLA 3VNBA 2XUFA 3K8YA 2H1CA 4IKEA 5DTIA 1JIUA 2PKEA 4Q03A 4EOGA 3MT8A 1V6AA 5BR4A 1W87A 3K6SA 4O4HB 1Q95A 1RKUA 4JWTA 4QD3A 5K3OA 5FQNA 2D6FA 1SVUA 1XL0A 4WZZA 3CZRA 2JLUA 2PSDA 1ZM2A 4XR9A 5A3JA 3CZPA 3WJAA 4XRGA 1JTFA 1M0TA 2GFQA 4EI9A 2ACEA 2EP5A 3E23A 5HE8A 1W30A 4N7BA 1YL6A 2NPFA 4AVYA 1TEHA 2YCBA 2AG1A 1N6RA 4UBNA 1Y42X 2Q4RA 5LFAA 5KHOC 3J81A 3N6RA 2ZRNA 2QLNA 4NTZA 5AOBA 5E6RA 3QNMA 4UEOA 2G40A 3BSWA 3JRNA 3QU9A 3WLKX 3EMDA 4GLOA 1TZKA 3TINA 4ZGBA 1U0TA 3O90A 1P45A 1L8LA 1Y8RB 2WTEA 1PJBA 2J0UA 1WCV1 2VCEA 3OIVA 3OZXA 5MN6A 2VHQA 4LDPA 1OCEA 5DULA 1QC5B 1OH6A 5K3SA 2F90A 2GERA 4EWLA 3K15A 5BSVA 3MBOA 3VR6D 3D54D 2COKA 1G21A 1U9IA 1YONA 3LNCA 1RLMA 3OICA 4ME6A 3VR4A 1ORRA 3ZHBA 1XEFA 1T6ZA 4PN3A 3SYTA 4MR8A 2OORC 5D1HA 1TAQA 3QE3A 1QO7A 4E6PA 2D3WA 4NDAA 5ALSA 4CYMA 2ZWVA 5A4MS 4YP7A 3KHSA 3FDIA 4JKYA 4AY4A 4KMMA 5BPHA 4HGNA 3I23A 3V9AA 4H77A 2HF2A 1FTNA 2DH5A 3FA2A 2RC6A 3V3TA 4QUAA 1P91A 4UEKA 1AO3A 4XGRA 5GAJA 5A9SB 3IE1A 4ZYYA 1RI4A 3QZUA 3MD9A 1T9CA 1DLJA 3R5KA 4OQ4A 3O9VA 4Y6LA 5JCJD 1CBUA 4O2BA 3R5SA 1KJQA 2CJYA 3D6TB 2ID8A 1YL5A 1U7DA 1UBFA 2LV8A 2GGSA 3HU1A 4J16C 3FUTA 3R7NA 1HE2A 2YH2A 1D0IA 2FWRA 2HRCA 4NDZA 2AMFA 3MC1A 1V3VA 1EVJA 1A76A 2NYAA 4GKJB 3F2IA 1E66A 2CBZA 2Q29A 2W6ID 3DBRB 5FBHA 2O54A 3LWZA 1EUDB 1YU9A 3EQ8A 1S7GA 1SEVA 3VH2A 3P52A 4OAOA 2D1YA 2PO7A 2H1HA 2E55A 3R6GA 1KI6A 2HSEA 4QSHA 1ZXXA 1EWQA 8ABPA 4S1WA 3JQFA 5AKZA 3U0VA 3VSBA 3P9IA 1XA3A 2A35A 3M0EA 521PA 4LOAA 2QBYA 2WU1A 3DC7A 4K6OA 1JU3A 4PF1A 5J9FA 1X7ZB 2FEXA 3C6MA 3HACA 3VR4D 4FMPA 1JDJA 4ZI2A 5TX7A 3DLHA 2X14A 4UMEA 4NENA 1NLMA 4IW3B 1PBTA 4HATA 1EFPB 1JHZA 2EARA 4QTYA 1HNNA 5JZBA 1KZ6A 3C6XA 4ER0A 3G7SA 6NULA 5GJBA 1KJZA 1E5XA 4DWOA 3Q7PA 1C8KA 3REQB 4I5EA 7GPBA 4BZXA 5LLDA 1MA3A 1YQGA 2M6SA 3R24A 4LSZA 3VZPA 3ZCRA 4H7DA 3RTBA 2WIKA 2VF2A 5G1PA 1RU3A 1B41A 4JEUA 4RIGA 1E3EA 1LZLA 3EXIB 4JX9A 1WOYA 4NYJR 1KVTA 1E92A 1VJ0A 2ET6A 3ZW7A 2BFMA 4JI7B 4OHRA 2JEOA 4YP5A 4A6EA 2Z6QA 1SUCA 4KV9A 3H0WB 4P33A 3T7SA 5JVDA 3WYDA 1DAOA 3WGOA 1KYXA 3HY4A 4LCBA 3L0DA 5FBWB 5EIXA 3FTCA 4LK2A 2XKAA 3RYCB 1HYGA 4GUAA 5AJUA 5KDOA 1U2QA 4GRDA 5DASA 2JIZD 3DZDA 4YV2A 5TF4A 5HXAA 2IBMA 3W8NA 1ENYA 1OQAA 3LKDA 4MHSA 1JBKA 2MYUA 3A2MA 3EEBA 3PG5A 1CK4A 1H0RA 4LHSA 4RVFA 3T4PA 1RKQA 1Z26A 1XRLA 2AWNA 1ISIA 3FYSA 3S2GA 4DB2A 4KU4A 3GLSA 1RJWA 4JLJA 3S8MA 1Y8QB 4DCMA 2Y67A 4TTAA 4EA9A 1H2HA 2HMAA 1UZUA 3JASA 3QVOA 1Y6QA 3E2MA 2Z2YA 4DJFC 2WZDA 2VNJA 2Y2VA 4OXQA 3R7FA 3V00A 1IN7A 4OI1A 2FRDA 1RYNA 2RB4A 4MV9A 3MJEA 5DBGA 2IY8A 3K9GA 3ESAA 1CZNA 5ABPA 2COEA 3W8DA 1Z5NA 4AG5A 3GLFB 4JLKA 4DR5B 1FFGA 2JAOA 2ODNA 1Y9JA 2XGOA 5IDVA 2WWVD 4O6VA 4KYTA 2CNBA 4XGNA 1XNRB 3HGTA 4TV8B 1O0SA 3WWPA 1FFYA 1KBZA 4KLNA 4TLBA 3EIHA 1I2MA 1QFJA 3GLHA 3OE4A 3P0FA 1XSEA 1L4FA 1LLFA 3VYSB 4D99A 2VZ0A 4EYKA 4HTAA 3IVAA 1QZUA 2VDNB 2PU7A 1COWD 3VR3A 4ZVOA 3TUJC 4AU1A 3KZVA 4U2DA 3IDZA 2PANA 2NU9A 3NW9A 3ZE9A 5EE5B 3T52A 2DB3A 1MORA 2L69A 4HP8A 5B6PA 2A86A 2HV8A 4YAEA 3GUZA 4GZLA 1SC1A 2HCRA 5KBYA 3PLAE 1JDSA 3N8IA 4CMEC 4FDAA 1Y5RA 3B7PA 4TV8F 3PJDA 2J8ZA 3KYBA 4L27A 1V96A 4M83A 1I3KA 4RO0A 5FBLB 5FTLA 3KQLA 3B3QA 5TT1A 1GCGA 2GA9A 3TNLA 3ICPA 1BIFA 3FLMA 3CVOA 2X0FA 5HF8A 5M34A 1USGA 1A5TA 3HDHA 4FYVA 4DC9A 5H70A 2PUGA 4Y0AA 2V3CC 2HK6A 2J9YB 4TLCA 5KNBA 1H66A 2JAPA 5AK4A 1ANKA 1YDMA 1FDTA 5F21A 1TUIA 1GL7A 2GJKA 2UZIR 1LVGA 3CKKA 4QWWA 2ATXA 2ZXEA 5K4GA 2E48A 1KKUA 2EYUA 2ZTHA 3LQ2A 3T54A 1ISHA 5IARA 2Y3IA 5CFMA 4A2CA 1V7QA 5CT8A 1VSBA 3VZQA 5LMUB 1HE1C 4MSUA 4ZQBA 1T0UA 2IF0A 2V6FA 2A67A 3NPMA 3IHKA 2CXNA 2H11A 4N4AA 4C2BA 4AZ3B 1DI0A 4UVGA 4XZ3A 4QELA 3IT0A 3FUWA 4XIIA 4YJ2B 2ACKA 1J22A 5DNVA 1X0XA 2E4WA 2R1UA 4DV6B 1R64A 3C3EA 3ACDA 3OU6A 4G9GA 1ZVVA 1Z39A 3L8FA 4IMRA 3LV8A 4B9EA 4G84A 2JS7A 3U1VA 2GCNA 2CXRA 1EFLA 3X1DA 2ILTA 3R8CA 1YS2X 3MNFA 3NEAA 4LUCA 4XWKA 4FQ8A 2D8MA 4GX0A 3EAGA 2O7VA 5DYGA 3E48A 5HK9A 3PNMA 4AS2A 2J1LA 3E8MA 5IN4A 1E18A 2VWQA 4R1QA 3IWCB 2J87A 2HBYA 1JKJB 1KIFA 3R7WA 2H5IA 3KTAA 2AN9A 2H18A 3FD8A 3L0OA 5DT9A 3VR5D 5HR5A 4BP3A 5B6IA 1GNPA 3VYVA 4RY2A 1SPBS 2ABWA 2UDPA 3JPWA 3M9WA 1A95A 1JEQB 3K70B 3KSAC 1RZVA 1TLLA 1U99A 1NKSA 1TJ5A 2M32A 1I14A 1H85A 3O2SB 2XUAA 1C41A 2VI5A 2YBDA 3KU4A 4GMHA 1QONA 1HMYA 2P9JA 3GA7A 3RPEA 4BWFB 1MO6A 4YT2A 5B4VA 1BD3A 2BGLA 4K8OA 3WIOA 4E2YA 2H8GA 3E3MA 1GGJA 1XAGA 3OEHA 4KN9S 1OA0A 4G0YA 1E4OA 2B7LA 1G21E 3AR7A 1VRCA 3C74A 3SE0A 5EHXA 2MMGA 2UZ0A 4GMKA 2UUPA 3Q85A 1WMFA 4YJHA