1U1IA

Myo-inositol phosphate synthase mips from a. fulgidus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
392
Chain Sequence
b'MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol-1-phosphate synthase
publication title Reaching for Mechanistic Consensus Across Life Kingdoms: Structure and Insights into Catalysis of the myo-Inositol-1-phosphate Synthase (mIPS) from Archaeoglobus fulgidus
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 113
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1u1iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u1iA01
3HDHA 5CDUA 1O94A 3HADA 1B7GO 4B7CA 3CPSA 1N1EA 3HFGA 1R4MB 2OUIA 4XB2A 3WGOA 1ZVMA 2X5JO 1T4BA 2WD7B 4NJMB 3EGOA 3OQ6A 3ON5A 4B4OA 1DSSG 2AE1A 4EITA 4D46A 1PL8A 4ALLA 1PGOA 1L7DA 1JTVA 1R4NB 4RORA 4I8XA 2FR1A 4WK6A 3V8BA 4OL9A 1DJQA 4Y67A 4M49A 4FR5A 2D0IA 2ZIZA 3D5QA 1HDOA 2NTVA 4DPMA 1KS9A 1WZIA 5KNLA 1NBOA 4IQ8A 1YRLA 3DZHA 4CL8A 1SEPA 2O50A 1J49A 3H9JA 3VVCA 4A0SA 4JCOA 5DNAA 1Y8QA 5TS3A 2VNSA 2YV2A 1H5QA 4FBGA 1QYDA 4J2HA 1NASA 1EVYA 2J8ZA 1HDGO 2HJSA 2IEDA 2VOEA 5KJ6A 1FDSA 1K6IA 1JW9B 5L95A 4RF2A 2XF8A 1T1RA 2RCYA 3HWRA 3MJVA 3W6ZA 1CQIA 3G0OA 1HYEA 1E5LA 4NBTA 1UZMA 5DOZA 2OP0A 1MX3A 3PLRA 3FNGA 5IN5A 1XYGA 3WG9A 1F17A 1ISJA 1KVSA 2Y0CA 1SBYA 5CP8A 1ZEMA 3HE3A 3U0BA 2DAPA 1HL3A 5HS6A 4EJ6A 3HN2A 4QFCA 5ER6A 4OHUA 4WLOA 1IYZA 5FF9A 4HNGA 4NFHA 5F3RA 1C1XB 1GZ4A 4CMAA 3TZ6A 1DOHA 1H9BA 2PA3A 3ENKA 5JFOA 4RQTA 5JSFA 3H3FA 4FQ8A 1N2SA 4TSKA 1E7SA 3CMCO 5T57A 2BFMA 2V6MA 2XOXA 1FDVA 5L7WA 3TRIA 3RKUA 1CJCA 1ADBA 2VYNA 3BAZA 4WEQA 4QO7A 1GUFA 4LCJA 4LVUA 4BNJA 2PKQO 1R6DA 2JHGA 1ARZA 3QVWA 3GOHA 4E5MA 4UUMA 3MJ4A 3BMOA 4GH5A 1L1FA 1YQXA 4Z3DA 1XG5A 2R2GA 5DOVA 4JJIA 1PJSA 1DAOA 2HDHA 3LU1A 1ZSVA 3AU9A 4OXYA 3IJRA 2EJWA 5B4VA 5T67A 4CR6A 2OZPA 4IZIA 5EQDA 3PXXA 3C7CB 4KWHA 3OMLA 3T4XA 1LQUA 2P4HX 1NFFA 2J3JA 4YRBA 2V6FA 4JLWA 1IULA 3Q1LA 2O2YA 3DZJA 3PGJA 2UAGA 4IQGA 2EERA 1XQ1A 4XD2A 2B37A 5FEUA 3PZRA 1DLJA 1YVEI 2DTDA 2X86A 4IZHA 4EBFA 2O3JA 3WGHA 4CLEA 1WW8A 4XX0A 3AY6A 4R1TA 2OFPA 4J16A 4RVHA 4YJHB 2ZKLA 3B20A 2PGJA 4WPGA 4YJGA 4KUGA 3ZH2A 3VPFA 1U5CA 2NQ8A 2OO5A 4QO8A 2X0JA 5IDWA 5THKA 1H6CA 1Z82A 5L51A 3QA9A 2V6BA 1K3TA 2I3AA 5G4KB 9LDTA 3EUWA 3V1TC 3P7MA 1O9BA 4URFA 5BSEA 5L7TA 3VPXA 4MOWA 1NPYA 2ZJ0A 5B1YA 3DHYA 4J43A 1KVQA 1R0LA 1SOWA 3B1FA 2HAEA 3K2BA 3U09A 4R5MA 4CM5A 4WNIA 2CVQA 3WOHA 1L7EA 2Z1MA 1XSEA 3TPCA 5FYDA 1D7OA 1RKXA 3PQFA 4XDZA 5TGDA 3JQCA 1HWYA 1QYWA 2UVDA 1F8FA 4Z6KA 1U2DA 2W2LA 1HDXA 2Q22A 5DULA 5T8KA 3PP8A 2RH4A 3LC1O 4WUVA 2I65A 4XZ3A 1NM5A 1BMDA 3IP1A 4CR7A 3SVTA 1XA0A 2V65A 3TZKA 4ZN6A 1ZBQA 2E6UX 2VUSA 1UDBA 3S2GA 3DOCA 2WEKA 3JQ9C 4JBHA 4D79A 3FWZA 5I9LA 1Q7CA 1GQ2A 2NTJA 4Y6RA 1M75A 1E77A 1GYQA 4B4UA 1VKOA 3H7AA 4GMGA 3MOGA 3C7AA 5IAAA 3VZQA 4AFNA 1LDGA 4MO2A 4W9NA 2XXJA 1ENYA 2EV9A 3FNHA 4ZHSA 1LJ8A 3ICPA 4LSWA 4CQLB 3C85A 1CDOA 5EESA 4JN6B 5J9GA 4AJOA 4HV4A 3PZBA 4D3SA 2BRUA 1DFGA 3SJ7A 4JXKA 1YOVB 5CDGA 3OQBA 1PGPA 3W8DA 4LMRA 3KO8A 5AVOA 3UKOA 3TL2A 2VHXA 1QSGA 2P5UA 2QW8A 3IJPA 3OJOA 3PIIA 1NTOA 1GADO 2NQTA 2ZYGA 3A9WA 4RJTA 1R4MA 5BNIA 4YWJA 1C0KA 2POQX 3DAPA 1TA4A 1PEDA 3EMKA 2WD7A 3IOYA 4NJMA 5F21A 1RYDA 2D59A 1JVBA 4B79A 1ZK1A 5EQFA 1E7QA 5T6BA 3E82A 2B69A 1CRWG 3C1TA 2E82A 2A35A 1NFQA 4ND3A 5HTOA 4C7JA 1Q0QA 2WD8A 2XPCA 2CVZA 1R4NA 1R12A 1O89A 4AL4A 1C1DB 1HXHA 3HUDA 4ND5A 4ND2A 1LA2A 1VL0A 1T2EA 4FC7A 4IINA 1DAPA 1MG5A 3ZNOA 4BB5A 3TF5A 5JMWA 2ZYDA 4ZRNA 2CF6A 4CM9A 2BELA 2X5OA 1EUCA 2EKQA 4MVJF 3RC9A 4J6FA 2HMVA 4ZQHA 5IJZA 4IMRA 4ZU3A 2DBVO 3QV1A 5JY6A 2E4AA 1I24A 3A4VA 4J0FA 1ZMTA 4XQGA 1DFIA 3U4DA 2EKLA 3NDRA 5CDTA 3DMYA 3D64A 5EL0A 3GEMA 4IIVA 4AJPA 3DTYA 3K8ZA 1PR9A 3NGLA 4FOOA 4JIGA 4RVFA 5TNXA 4L4RA 3WJAA 4E13A 4NHEA 3GFBA 1ISIA 2Y1OA 1B3RA 5A04A 1UXGA 3G49A 2W90A 2EW2A 1XEAA 4NBVA 2JCYA 3EY4A 2VWPA 3GEDA 5CFZA 1U4OA 2Q46A 1ZMOA 2NV6A 4I9NA 2Y1CA 1UZNA 1AHIA 1OOEA 3DHNA 3NRCA 1C1XA 4BO9A 4TVOA 4BNTA 2CVOA 2Y67A 1HZZA 2O4CA 3ZNQA 3PJGA 1EFLA 3GVHA 4II2A 5A3VA 2YFHA 2IODA 1EDOA 3QWAA 4I9UA 4JX8A 1BRMA 4RZHA 2C82A 5AXDA 5KKAA 4F6CA 5IZCC 1V3VA 5B4UA 2H9IA 2EHDA 3UUWA 1HTBA 1AE1A 1UZLA 3NX4A 2I66A 1P31A 1DBVO 1GD1O 4BNZA 4XEHA 1GAEO 2DT5A 5H81A 2WSBA 4RF3A 1QYVA 5KWEA 4Q3BA 1DC3A 4J7CA 2JAHA 2O3RA 1BSVA 3CZMA 4EEZA 2HLPA 4OQYA 4C7KA 5TSDA 2AQ8A 2BI8A 2VUUA 4DYVA 1N7HA 2FZEA 2ZCUA 3D4NA 3UXYA 1X7DA 1GTMA 1UXJA 3T4EA 4HBGA 4DQUA 3JD2A 5JC8A 5L4NA 5ITWA 3QLJA 4LW8A 2Y05A 3IS3A 4B3HA 5A5FA 3P2YA 3AUTA 5I8ZA 4DMLA 1B2LA 4DWVA 5KVVA 5JCXA 2LDXA 3HJAA 2NU6A 4YJHA 1ISGA 4CM1A 4DUPA 3QW2A 2AEJA 3Q9UA 4R9RA 2HMSA 4A26A 1MXFA 3I6QA 1VI2A 1HETA 1R0KA 1DRUA 1A71A 3QHAA 3E1KA 4BMVA 1JWAB 2WYWA 2PH3A 4FFOA 5T8KC 4YR9A 5G4KA 3JQ8B 5G0TA 2YQ4A 4QSMA 1A4UA 2C2YA 4UEOA 1NFRA 1GFSA 3S55A 4L4XA 4E6PA 5IN4A 3DAFA 4E5NA 4YYZA 4ALNA 5ER9A 4IUYA 5DN9A 5K6AC 1M76A 2YHIB 2HMUA 1K89A 1Y7TA 3CKYA 1PJ3A 4N7RA 3LT1A 4B8WA 5TT0A 3ZU5A 4E4YA 3GHHA 3VDRA 2RHRA 4OGWA 5JAIA 4C4OA 3L4SO 3GVXA 2WE8A 3NYWA 2IXAA 4XR4A 4MVJE 1MG0A 2EJVA 3DMTA 2VRCA 3OFSA 2A4KA 3R6DA 3IQDB 5IDQA 5A4DA 3VKVA 1BXGB 2CDCA 2NU7A 2WWRA 4UAGA 3OA0A 1LXCA 4DGSA 2X22A 1U3WA 4WECA 3ZGYA 2QRLA 1GR0A 2PWZA 4CQMB 4DTIA 2Z5LA 4J7XA 1QYXA 4IDBA 1IPEA 2FSVA 4UULA 5COAA 4Z0PA 2ZB4A 1E6WA 3FI9A 3V1UA 2GASA 4U0KA 2DLDA 4B3JA 1MV8A 1Z7BA 4GKVA 1YOVA 2X1HA 3PGXA 2GN6A 2NUAA 4BKUA 1HDRA 1ZSNA 2ZB8A 3HN7A 3OJEA 4UEJA 1KIFA 2CY0A 3RIHA 4CLRB 4YAJA 2VRCD 3NEPX 4CR8A 3ZV6A 5ITVA 3ETGA 4Z0HO 3F47A 4PCVA 3DWFA 1NVMB 2B4RO 3H9EO 2F1KA 4PG4A 4FCCA 3TNLA 1LRLA 2AW5A 2GN9A 5ENVA 1F14A 3Q3CA 5G0VA 4QEDA 1Q0LA 1G1AA 1C3VA 4XKJA 1D1SA 3DXFA 1C1DA 1I32A 3GNQA 4FN4A 1IB6A 3LF1A 2W8ZA 4H15A 3D7LA 4CMHA 2J6IA 1UH5A 3NDIA 3RBXA 2HKIA 3NTRA 3JQGB 4E2WA 3OF2A 1LDEA 2A94A 1ZFNA 2WMDA 3IIEA 1U3TA 3IUSA 4IDDA 4GLLA 1V6AA 2X6TA 4TRRA 5JBIA 3VH1A 3VHRA 4PLHA 1XR3A 3K6JA 4E5KA 4J1QA 4G2NA 4CM3A 1VKNA 3WMXA 1XHLA 4D0SA 3KLPX 4Z9YA 2Q1SA 5KVQA 3AUUA 3KTDA 4Y9DA 1LX6A 2BLLA 4PLPA 2Q4BA 4MKZA 5HA5A 1DRWA 1V8BA 1KOLA 4QUKA 2BD0A 3KSUA 2G17A 3LF2A 3MJEA 4JROA 5A9TA 1PZHA 2JFHA 3ANMA 5F1PA 4PVCA 1X1TA 3GFGA 4MVJG 1NVTA 2X7HA 4BVAA 4GSLA 3COSA 4IDFA 3VH3A 1WDMA 2GZ2A 3WYBA 4GX2A 4J4HA 4J4BA 4P38A 4MINA 1D8AA 4WLEA 3RAJA 3WFIA 3WYEA 1HDYA 2GZ1A 2I6TA 4W99A 4ZVVA 1B0AA 5AXCA 3I5MA 1O8CA 3SC6A 4B3IA 1ZXLA 4FGSA 4ALKA 4D3FA 1I10A 3VZPA 3GGOA 1XELA 4IXWA 1KERA 4H3VA 2B36A 3SXPA 3IUPA 2Y0DA 4PZCA 1MUUA 4QX6A 2Y1FA 4DLBA 4N5MA 5MDHA 4CV3A 1V3TA 4MVJA 3ZWYA 2UUOA 4CLDA 1UAYA 3VTFA 3NT4A 1OI7A 4PIVA 1YL7A 1ML3A 3U4CA 4MVJP 3GDGA 4WLVA 1T24A 5TT1A 1PZGA 1A27A 1E3EA 1IL0A 3RFXA 5KJFA 1OBFO 1K5HA 4RVUA 5JE8A 1QP8A 1IOLA 4NR0A 4HKTA 1C0PA 1Y5MA 2I67A 3GNTA 1VE9A 3GAFA 3DBVO 1DIBA 3EVNA 1NAIA 2DBZA 1SAYA 3BHJA 1H2HA 4OSOA 3PQDA 4PLCA 4YT5A 4CL3A 3H9QA 4D7AA 2NTNA 4K6CA 5ILGA 4CMGA 3ADOA 3TSCA 3ZV3A 4MVJD 4DRYA 2OMEA 5KTKA 1AXEA 5TJ9A 3IP3A 2BFAA 3JQ8A 1YONA 2I5PO 2VRBA 1CF2O 1LDYA 1GDHA 2J5KA 1ZO8A 4N18A 1OFGA 1E3LA 5GZ1A 3DMTC 2FMUA 4WKGA 1SPXA 2QG4A 3RSHA 4A2CA 1CEQA 5KJEA 3AY7A 4YT2A 4RPLA 2YHIA 3MWEB 2PZMA 4ID9A 2GO1A 4PLGA 2HMTA 3F5QA 2HK9A 3F9IA 4J7UA 2YFQA 2HRZA 1I3MA 2Y1DA 3DB2A 1VRWA 3PJDA 1LRKA 3DBLB 4CODB 4OM8A 2B5VA 4LCEA 4D43A 3S1LA 4MKRA 2X8LA 1FXSA 4J2OA 4RQUA 4FDAA 3TZQA 3EHEA 1YB5A 4BL5A 1BXGA 3RQSA 3F5SA 1KEWA 3KSDO 4BIIA 1DIRA 3NT2A 1IZ9A 1JKFA 1YGYA 5DP2A 4CQMA 2PLAA 3GN1A 4PLVA 4DMMA 3ANLA 3RUFA 3DO5A 2EEZA 4K1LA 4TZTA 3FPLA 1I3NA 2G5CA 1JVSA 4BQRA 4CMEA 1LU9A 1P77A 2Y99A 1GV1A 5JYFA 2DBRA 1GEGA 2H1SA 2AQHA 3D4OA 4J4TA 2B4TO 4P4GA 5AQ1A 2GCGA 4Q39A 3TFOA 3UVEA 3KV3O 1LLUA 2X0IA 3OIFA 4D3DA 3EC7A 4CLRA 3LLSA 4CUKA 3ZV5A 1U3UA 2IZ0A 1NR1A 2GYYA 1ZSYA 3ABIA 1RWBA 2O3TA 3JYPA 3JD1A 4DLLA 4Q3DA 1B26A 3WDSA 5HM8A 2E49A 2IXBA 4CQMD 1PTJA 4L0QA 3VH2A 2I76A 4EUFA 1CETA 5A5EA 3G1TA 1OAAA 2GF2A 3WTBA 1KVRA 4E5PA 2PKRA 3BHMA 4KUEA 3X2EA 3K9QO 2JCVA 2O48X 1X7GA 1SB8A 4G81A 4OIMA 3CEAA 1PZFA 5A02A 2OBNA 1UAGA 2Q45A 3JQGA 4HNHA 3PWSA 1E3IA 3F4LA 3PQEA 1N8KA 3AUAA 5KIAA 2ET6A 2EWMA 4JBGA 3S2EA 3RFTA 4XWYA 2EGGA 4PGFA 1YWGO 1B14A 1X1EA 3GHYA 2VWGA 4KZPA 2XAAA 4ILKA 4YJFB 1DC6A 1NQTA 1SCUA 2ZATA 2IYOA 1R37A 1WZEA 1Y8RB 1P3DA 1WPQA 1E6UA 3LC7O 4MIEA 1WWKA 5AOVA 4BGEA 4NBRA 2W4QA 3KLMX 2Q4EA 1AGNA 5ILOA 1ZKMA 1DB3A 1RYEA 3RUEA 4O6VA 4DL9A 1MC5A 1HDCA 5C5IA 3NJ4A 3O38A 4TROA 3UGKA 2DPGA 4GPD1 3KXDA 5GMOA 1N5DA 5JDCC 4AG3A 4BO2A 2CD9A 1EDZA 5JMPA 1DIAA 1TT7A 4ALJA 2O2SA 1BVUA 4NFYA 2Q99A 4NJOA 2ZYAA 5BNTA 1KBZA 3WQSB 1P1IA 4DREA 3I9NA 3T7CA 1CWUA 1H0KA 3GNSA 2ZB3A 4BNFA 1E6EA 3CSDA 4E31A 5U9CA 3LSYA 3WTCA 2B83A 3M6IA 1R0SA 4R16A 1SNYA 1H93A 2VYND 2VYVA 3GPIA 2C59A 1EK6A 2YW9A 2C7GA 2G76A 5KCZA 3ANNA 4U0JA 1QMGA 3WWZA 4BNKA 1SMKA 3JQFC 1BWSA 2W2KB 1GCUA 3DBRB 1T2CA 2Q1TA 4DBZA 1ISHA 1PGJA 1JDJA 2AQIA 3PI7A 4BMSA 3ONDA 3GK3A 2Y1EA 4NFSA 2Z1NA 2EP7A 5HS4A 3RC7A 2JD2A 3ONEA 4RPHA 1EQUA 2VWQA 3ULKA 1RM0A 4DVJA 4KTVE 2GDZA 3A06A 5EPOA 5FI3A 3WICA 4P22A 4DQVA 4BO6A 4GI2A 5CEFA 3NGXA 4OH1A 1KC1A 5FWNA 2VYVD 3H8VA 4FD3A 1HZJA 1I2ZA 2AQKA 4JJFA 2X0RA 1EE2A 1J0XO 1QG6A 3M1AA 1PZEA 3QQPA 1PJ2A 1R16A 1MC4A 1W0CA 2GRAA 2IYPA 3D0OA 1DHTA 3Q2IA 3AOEC 1ENOA 3OQ1A 2PD4A 4UVGA 2I9PA 1QRRA 3C24A 3JD0A 1DPGA 2PD6A 3OJLA 2CZCA 1NWHA 2FP4A 3BIOA 5DT9A 1YJ8A 2VNAA 4U6SA 3LK7A 4R3NA 4DPLA 4L4SA 1UXIA 4GWGA 2FPGA 1JAYA 3PLNA 3K5PA 3WGGA 3VH4A 3E03A 3EAGA 1I3LA 3HDJA 3JQBA 2QZ9A 1DFHA 3TQHA 3VZSA 4BNXA 4BNNA 1TB4A 2QRKA 2CMDA 2Y68A 1LDMA 3INTA 1YJQA 4O63O 1EFKA 5JNLA 2W2LD 3L0DA 3H9UA 2PY6A 1HDZA 5J23A 1PL6A 2JL1A 2HK7A 3DBLA 4DXHA 2J5QA 5DF1A 5JAMA 4MKXA 3ENNA 4WLFA 4R1NA 3QJ5A 3FHLA 1NVGA 3R3SA 3WNVA 3FNFA 5K0ZA 1TT5B 2FPIA 3I4FA 4KP7A 4CPDA 3I9MA 4IIUA 3W8EA 1I0ZA 2QYTA 2BFPA 1P9LA 3UICA 4WCFB 4WGGA 2NM0A 2GLXA 1A72A 2RH8A 1P1JA 1LQTA 1ZK2A 2WM3A 3ZU2A 4D45A 3FPCA 4RO0A 1K0UA 2GN4A 4BNHA 3D4PA 1F8GA 3HZZA 2Q1UA 4DIBA 5I7EA 5JYAA 1N92A 4RDHA 2EIHA 3KVOA 1EE9A 1ZJYA 3AM4A 5IZ4A 4YEDA 5EERA 1QV6A 4UVEA 1D1TA 1E7MA 4R9SA 4IJKA 3CZRA 4MVJI 4PLZA 1T2FA 3PWKA 2GNAA 5HBRA 3ZW9A 2DTXA 1HYHA 4YBZA 5G2OA 1U1IA 4Q3AA 3C8MA 4NQZA 4Z0TA 4YVFA 3RJ5A 1H94A 1LI4A 1W73A 1P44A 1WVGA 1ZEJA 4J1NA 3T7EA 5K9ZA 1KY5A 2V6GA 3ORFA 3JD3A 4GVXA 3KYBA 1DHRA 4M8SA 1SC6A 3NUGA 4GL4A 1WAMA 3G1UA 3GT0A 4I5EA 5GY7A 1R66A 3V2GA 2Y66A 4IDCA 5BNFA 1LLDA 1I30A 4XR9A 3C3XA 1UR5A 3K30A 2CF5A 4CM9D 4YA6A 4NK5A 5U4QA 2DBQA 3S8MA 3VTZA 1PSDA 2CUKA 1U28A 5I7SA 5LDHA 1ONOA 7ADHA 4FSHA 4RPKA 5F1KA 1E7YA 4R4JA 4YJFA 3C1OA 3HNPA 3ZWVA 3WLFA 5G0SA 3QE3A 2FHSA 3E9NA 5DCYA 1YQGA 3U4HA 1YDWA 5FFFA 3AOGA 5EINA 4RCVA 1I01A 1ZXBA 1Y8RA 5LC1A 3ZU3A 1NAHA 2BHLA 4FFLA 3OEYA 5JW6A 3KHUA 1PJBA 1K6JA 3GRKA 4GGPA 4WASA 4AJ1A 1O5IA 4P4LA 2VZ0A 4BNWA 3RKRA 2FPPA 3JQEA 1ISFA 3UH1A 1E5QA 3VPHA 1ISMA 1T25A 5A9SB 3ZWMA 5KKCA 4XYEA 2DC1A 3GN2A 1E1NA 3H2SA 1I33A 3L9WA 1XU7A 3TOZA 1G0NA 2O7SA 1HYGA 3LZ6A 5JDIA 1MB4A 1TLTA 1NQOA 3ONFA 2B5WA 2VHYA 3AWDA 4BMNA 5L4LA 1FMCA 4BGVA 3D3EA 3NV9A 4BHTA 5JC1A 2C54A 3FNEA 3NAQA 1N1GA 1GQQA 3D5TA 2FZWA 5FI5A 1HE2A 1YBVA 3FRJA 1VL6A 3K92A 5JY1A 3DZGA 5TRTA 4BKOA 4I5FA 5DBFA 2W2KA 3L4BA 1LLCA 2HCTA 5L7YA 4NI5A 4KDEA 3DBRA 1D4FA 3H3JA 4KTTE 4N54A 2NLOA 2GD1O 2PGLA 5I9MA 1GL3A 3BTSA 3F1LA 4HFRA 4O5OA 1S7CA 5IXSA 1Q7BA 3MJCA 5COQA 4P4NA 2C07A 3OBBA 1YL5A 2IE0A 1BTOA 4I1IA 3I83A 4RPGA 6LDHA 2FOIA 1PL7A 1WNTA 1ZH8A 2NU9A 4BOYA 1KYQA 1HE4A 3H5NA 3JYOA 1OC4A 3DOJA 3V5NA 4Q3EA 3F46A 4ESOA 4DIFA 1HRDA 4GAEA 3UHAA 1Y9EA 1IE3A 2BH9A 1Z6ZA 1NX6A 2DKNA 2EW8A 2GR9A 2O3QA 3IC5A 3K2EA 5JCJA 4B4VA 2GPTA 4YAIA 1XGKA 3QVXA 3ZN2A 1HSZA 3S2FA 1HT0A 3V2UA 1GPDG 1Z7EA 4XIJA 3W4JA 3ZWWA 4XRRA 2JHFA 4PLFA 3WLEA 4RDIA 3SLGA 4W9NC 3KUXA 2GN8A 3G17A 3WGQA 2QX7A 3MTGA 3LT0A 5IXYA 2PZKA 3DZBA 5CDYA 5JYDA 3ASVA 4BO3A 1BVRA 1P45A 3KETA 2EP5A 1U3VA 4PLTA 5H83A 1E0DA 3JQ6A 1V9LA 4JQCA 1VJ1A 1EEHA 2VHZA 4FPXA 1T2AA 1VJTA 2TMDA 4LK3A 2DFDA 1PJTA 3GVCA 1E3SA 4GSKA 4J9VA 1X15A 1IHXA 4RZIA 1ENPA 3IAHA 4Q3CA 4AJKA 1YBAA 2HMWA 5GZ6A 1TEHA 4CQLA 5GZ3A 3O26A 4K26A 3L6OO 2C20A 4YQYA 2C2XA 5JO0A 1TVEA 3PYXA 3QRWA 3WFJA 3WGTA 1M6WA 1E3JA 2D3TA 2WYVA 1B15A 3AI1A 2B35A 2VCYA 4DBVO 4TKLA 3RD5A 4LRTB 2P9EA 4NBUA 3SX2A 2CDAA 1Y81A 2Z95A 4BUCA 4OJNA 1TT5A 3DZKA 3Q0EA 1P1HA 4J91A 3RWBA 3OICA 1PX0A 4BO5A 4WCFA 3OEWA 4UUOA 4GKBA 4DC1A 3GZ4A 3BMCB 3ZCXA 4JBIA 1B8PA 1GCOA 2PZLA 1MFZA 1GUYA 4A5OA 3KYCB 4HFNA 4CMCA 3PIDA 4PRLA 2F00A 4E2XA 1LSJA 1NP3A 4W82A 2PKQP 5A03A 1SOVA 4BO4A 3PPIA 5B37A 4WE3A 3E9MA 5KVSA 4QQRA 3GH3A 2BI7A 3X2FA 5DCUA 1BXZA 3INRA 3GVIA 4AICA 3I9OA 3QIVA 4HXYA 5CG1A 1DDOA 2D1YA 4DA9A 1HLDA 1KEUA 1C0IA 1ULUA 4OXNA 3WSWA 5ICSA 3ITKA 3L07A 3TJRA 1ZK3A 4NBWA 3OECA 1WDKA 4K9DA 3NT5A 2X5KO 3F3SA 1DIGA 3RBVA 1HE5A 1P1FA 2Y1GA 3K96A 3LLVA 2XXBA 1NPDA 2SCUA 4M89A 1AXGA 1S6YA 3GLQA 4CMIB 7MDHA 2IEBA 4XJSA 3UCFA 2QIOA 3CE6A 2PNFA 4GWKA 1FF9A 3TL3A 3KRTA 1O0SA 3VVBA 3V2HA 1X13A 1I2BA 4X54A 3B70A 3A28A 4BS9A 1RM3A 3R3JA 4HADA 1UXKA 3U62A 2LDBA 3HSKA 5CEJA 2TMGA 3AFMA 2EF1A 1YH3A 3M2TA 4PG5A 2OGUA 1YS4A 1QLJA 4R51A 4WOJA 2P5YA 4O0LA 4YQZA 5EJ2A 1JN0A 4DLAA 5L40A 5AYVA 3PHHA 5L3ZA 4FFNA 1M67A 1XIVA 3QWBA 3R1IA 1NQAO 1HEUA 2CSUA 2D2IA 4UVHA 3P5SA 4CV0A 2RAFA 3KYDB 1BG6A 3H2ZA 5JO9A 1RJWA 1M6HA 2AG8A 4W6ZA 4YTEA 2DUUA 4AJJA 4LGVA 3FD8A 2AE2A 2YHUA 4DYDA 4R1SA 4E33A 4WNCA 2J5RA 3FTPA 1ONPA 4E2YA 5A9SA 3I3OA 1PS8A 4TMFA 1XKQA 5JPIA 2X0NA 3JQDA 4BKPA 3OM9A 4Z3KA 1BGVA 1EQ2A 4UEKA 4YJDA 4R41A 5DBIA 4Y6PA 2IZZA 1DLIA 4FC6A 3E6AA 4OYRA 5ICMA 3GUYA 3LDHA 3NJ8A 4MP3A 4BO0A 1YBMA 4GQAA 2D8AA 4E5YA 3JV7A 2E48A 5C3MA 3FSRA 1RPNA 2D5AA 4PFJA 4GMFA 2ZTLA 3WSVA 1RM5A 3KB6A 4OQZA 3CH6A 3U9LA 1BXKA 1M2WA 3OSUA 3JD4A 1HE3A 3WB9A 2H63A 1YKFA 3DAGA 3A14A 1ORRA 3UF0A 1GUZA 3WGZA 4OSPA 3OJFA 1Q1NA 2P68A 3DFZA 4F45A 3H65A 3PFWO 5U1PA 4CM8B 4ONEA 1PQPA 1J6UA 5IDYA 4RF4A 3IMFA 3ROQA 4WLNA 1BHSA 3JQ7B 4IXTA 1DC5A 1EK5A 1PIWA 2OOSA 4BNVA 4ITUA 3RU7A 3WYCA 1LTHR 1GZ6A 2NVBA 1O95A 3GF4A 3VC7A 1NXQA 3OETA 4BKRA 2WYUA 5DBGA 4PN3A 4R69A 2DM6A 4FFMA 4UVIA 3AUSA 1YL6A 1MXHA 3PHGA 4EEXA 5HWSA 3OIGA 4Z9FA 3WR5A 5DCWA 3ZI0A 4IY1A 3RUCA 2Y0EA 2D4AA 5IF3A 3BA1A 3HB5X 3QSGA 4CM7A 2BKAA 3CMMA 4OKNA 3DC2A 4RVGA 1PJLA 4CLOB 1F0YA 1TXGA 3JYNA 4D41A 1PWZA 1X0XA 1EBFA 4R3WA 1GEEA 2PV7A 2OP1A 4OAQA 2OXIA 5MGBA 1OC2A 2DQ4A 2VT2A 4H7PA 3QVTA 1T1SA 1T2DA 3DHEA 3NTOA 3HFSA 4K28A 1JLLA 4HY3A 4KDFA 1GQYA 3EW7A 4E12A 3ZWAA 3AFNA 2C0CA 3ADPA 2VTEA 5TQVA 3NTQA 1Z45A 4I5GA 2C5AA 2DU8A 2UYYA 4TKMA 2YV1A 5C7OO 3E48A 4IQ0A 5TC4A 3D1LA 3JQ9A 4QFDA 3E5MA 2ZQYA 4NU6A 2Y93A 2BF7A 4WCFC 1ZW1A 3OHSX 5EN4A 1EUZA 1FJHA 1E1KA 3GDOA 3M2PA 1YB4A 5C7IO 2FY8A 3Q2KA 4AJLA 1NQ5A 4BNUA 2CDBA 4XGNA 3FTNA 5JS6A 4HFJA 1K2WA 2O4UX 1EMDA 1XLTA 2PFGA 1ADFA 2VHWA 1CQJA 3Q9NA 4LVCA 3ZNPA 3U4IA 5G0UA 1JA9A 3QP9A 4FJ0A 3FCOA 4R01A 4ZJUA 2B0JA 3TWOA 5ADHA 4YB8A 2P2SA 2UV8A 1P33A 4S3MA 4FIZA 1V3UA 2W98A 3GMSA 1N7GA 2JD1A 3RVDA 5T64A 4W7IA 1NHGA 4XRGA 1P74A 5TX7A 4ZICA 3QVOA 4PLYA 3G79A 3GAZA 3QWIA 2X9NA 3STHA 3BMCA 4YAEA 3S2IA 2OL4A 2Q49A 3B1KA 3OA2A 1XQ6A 4D0RA 1H9AA 1X7HA 3I6IA 3VZRA 4A7PA 3GPDG 3KYCA 4XIYA 3ZHBA 2OHXA 1E1MA 3EK2A 2HO5A 2BGKA 1Z74A 3BYZA 4A03A 2EGHA 1P1KA 4QECA 1GPJA 2BGMA 1JKJA 3GC6A 4RL6A 5IFLA 4J3FA 3LC2O 1TI7A 2RHCA 4RPJA 2BGLA 1PGQA 1EZ4A 4XQCA 3OP4A 2D5CA 4RLSA 4XYMA 1I5RA 2GERA 4N5LA 3VKUA 3CINA 2E37A 4PG6A 1PJ4A 3L6DA 4JP2A 5DDIP 4OOEA 5CG2A 3WBBA 3ZWNA 8ADHA 4YACA 4BV8A 2QYSA 3SC4A 4CMIA 4CUJA 1A7KA 2P4QA 3AI2A 4XB1A 3JTMA 3ST7A 4KQWA 3BTUA 1WMBA 4RV9A 4L75A 3DBHB 1ONNA 4M86A 1G6KA 3P19A 3MEQA 1ULSA 4EJ0A 2HRBA 4IS3A 4KMSA 4XGIA 3WMWA 3JQAB 4FB5A 4G65A 1XDWA 2YUTA 3ITDA 4O1MA 1U5AA 5KVCA 1KEPA 1VSVA 4IGEA 4XDYA 2QRJA 5CEEA 3BMNB 2GZ3A 4XQ9A 3KZVA 4GLOA 3MCVA 4HFMA 3KSZO 1PWXA 2R00A 3DFUA 1DJNA 1LNQA 1WDLA 3PYMA 3F4BA 2YY7A 1SEVA 4CV2A 1Y1PA 1BDBA 2NACA 2FWMX 3I23A 4S1VA 3BHIA 3KYDA 3W4IA 3KEOA 1DXYA 3RI3A 3WXBA 2DFVA 5C37A 1QV7A 5TF4A 3GUCA 3K31A 4IJWA 2IDZA 3O9ZA 3U49A 5IZCA 5KJ1A 5AXAA 4KWIA 4WEOA 3BMQB 4Z9XA 2P9GA 3L6EA 4FJ2A 4PLWA 3FWNA 3MJSA 4XYBA 1GU7A 4IDEA 1X14A 2ILTA 3RBZA 5BSHA 2WDZA 4MIYA 5HRUA 4GBJA 5BR7A 4RGBA 2VOJA 3FN4A 1G0OA 1EBUA 1H6AA 3W8FA 2OORA 1AUPA 2ZTMA 3PHIA 3PJEA 4LMPA 4R1UA 5THQA 1QXSA 3OIDA 4QT0A 1X0VA 2GSDA 4IM7A 1WP4A 2UUPA 5IG2A 3E5RA 4Q9NA 1IY8A 4EZBA 1LC0A 1KETA 4GGOA 4YDRA 1JU9A 1SZJG 1Y6JA 4IJUA 3V1YA 2X9GA 5A9RA 4N5NA 3PJFA 2YYYA 1E7WA 5IDXA 1VL8A 3GMDA 1DO8A 4CM8A 1BW9B 2PD3A 3R0IA 3I9JA 4KOAA 4LRSB 1E92A 2Q1WA 2HU2A 2A92A 3JQ7A 3GRPA 4ZA2A 4E21A 2EXXA 4CV1A 1PQWA 3WS7A 4AJHA 2DPHA 1F06A 1A9ZA 3PVZA 2ZQZA 2YQ5A 2C29D 3RUHA 3HQ4O 4ZRMA 4BNLA 1A9YA 1A5ZA 2WJPA 1YQDA 4U5QA 5A06A 3RJ9A 4AJNA 4RVSA 3GEGA 4D44A 4NDNE 3ZWBA 1KY4A 1MGOA 1U8XX 5I7VA 3PDUA 4CLOA 5KOIA 5K6AA 1GYPA 2X58A 4NMHA 1U9JA 2YJZA 3L77A 4CMEC 3MWDB 5CDSA 3L9XA 1CIVA 5M6DA 5BQFA 1YXMA 2X4GA 2H6EA 3TDKA 3MJTA 4OO3A 4YT8A 4HP8A 4RVDA 2V7PA 3DOOA 4F3YA 4U6QA 3FBGA 2NU8A 2X23A 3P2OA 2OBYA 2VTDA 3DEYX 2NVUB 1NYTA 4RF5A 1D3AA 4BKQA 1E3WB 3VPGA 4BNMA 4PG8A 2Q2QA 4FW8A 3I9KA 4DC0A 5JXWA 3ETDA 5F1OA 3RUDA 1I36A 4IJVA 3PTZA 4NIMA 1UDAA 4L73A 3GZNB 5A1TA 4GX1A 5C7LO 3N74A 3TFQA 1B8VA 2BMAA 2IRWA 4CMJA 3HHPA 2YDXA 4YAKA 2FR8A 1MP0A 3WIEA 3BZUA 3GDFA 1ZUD1 1LC3A 3JCZA 4BGUA 4BO8A 4L8VA 4F46A 3H6KA 4ND4A 4YRAA 4IMPA 4E32A 5H82A 4ZD6A 4CM4B 4TRNA 4ZGWA 4XYGA 4LN1A 4ZQGA 2VUTA 2PR2A 3ZV4A 1C0LA 1PJCA 1AHHA 2CFCA 4J1TA 3O03A 2WTBA 9LDBA 1U7HA 4D42A 3CTMA 3AJRA 1RM4A 4J0EA 2H5LA 3EZLA 4YT4A 5I7FA 4O59O 2HK8A 2HQ1A 1IZ0A 1FK8A 2HUNA 2JD0A 1DEHA 4DPKA 1VM6A 3B1JA 1UXHA 2FR0A 2R6JA 3AW9A 2Q50A 1QYCA 1GY8A 1V0JA 3QY9A 3ZU4A 1Y5RA 2AMFA 1U2GA 4E2ZA 2Q2VA 1ADCA 4TRJA 4NK4A 1BDMA 1SO8A 4G5HA 5EIOA 4IBOA 3DDNA 2PGDA 4B7XA 4EJMA 1MLDA 3D3WB 4YPOA 4KUHA 1CYDA 1N9GB 4MJLA 1LRJA 1LUAA 5ENDA 4MVJM 3SJUA 1VJ0A 1HSOA 1XU9A 5CPBA 1WLYA 5KJCA 3A1NA 1IPFA 1Y9AA 1LEHA 3M1LA 4NG5A 4M87A 2ZB7A 1WXDA 3I52A 3O4RA 2GUGA 3O8QB 4W7HA 4ZQEA 3PHJA 1JQBA 2R00C 4J49A 1UJMA 3DBHA 1EUDA 3GGPA 1T26A 4UUNA 2J3KA 4BNIA 1P0FA 1NR7A 4HX5A 1GZ3A 3EVTA 4A10A 1ZK0A 1YO6A 3JQAA 1LBEA 4OOFA 2VT3A 3G3EA 1B16A 2PTGA 4ROSA 1GV0A 5I9NA 4B7UA 3EDMA 3H9GA 2EG9A 4XYLA 2J3HA 4NH4A 1U8FO 3NDJA 3ZDFA 1OZAA 3BMNA 4EDFA 2QHXA 1HLPA 5LDGA 4TWRA 4OKIA 3E18A 5A3JA 4BQPA 1MFPA 3ZWXA 4FFRA 3TZCA 4XA8A 1ZK4A 5I8WA 3Q6IA 1SB9A 3PFFA 4HUJA 4I08A 4I9HA 3OH8A 2BFOA 4LISA 3JYQA 4R68A 4TVBA 3TOXA 3ZNNA 4M54A 3IL2A 1W8DA 3ETEA 1ZIDA 2P91A 2NADA 4L74A 4JGBA 3TZHA 5JLAA 3BMQA 3FR7A 1R15A 3FR8A 1FDTA 3JQAD 3JSAA 1ZJZA 4CLHA 3UFXA 3GY0A 1E7RA 4EI2A 2AHRA 1QR6A 3GR6A 3CIFA 3RFVA 2G0TA 2JCXA 4Y8VA 5G0WA 2FN7A 3WGYA 4RLHA 4IS2A 2AA3A 4AJIA 1PS0A 3PRJA 4L76A 1PU2A 5T73A 1A7AA 2VZ9A 2DUWA 5L9AA 1XWFA 4EGFA 1JAXA 3ZWOA 1Q2XA 3JQBC 3DL2A 5JAZA 4WJZA 1YB1A 4A73A 4JK3A 4XQEA 5L4SA 1PGNA 3LYLA 2G1UA 1BW9A 4M55A 1OMOA 3TN7A 1YE3A 4P8RA 1B3BA 4OMUA 4BGIA 5L53A 1NHWA 4F6LA 3GA0A 3MTJA 3RCBA 5CHEA 2HJRA 3N58A 1C14A 3I1JA 1QKIA 1I3KA 5F5NA 1KC3A 4B8ZA 1LSUA 4AJ2A 4BO7A 5TIIA 2RIRA 4PRKA 2VN8A 4ZQFA 3FBTA 2NNLD 3ROMA 3WQRA 4EUEA 5JCJD 5BSGA 3Q11A 2ZTUA 2ZTVA 3UW3A 5LCXA 3EYWA 1Z75A 3NKLA 3N7UA 4B4WA 4TRMA 2Q3EA 3SLKA 1F12A 4U8GA 4J9UE 1LLQA 1HKUA 3RROA 1I2CA 2VHVA 2C7VA 4Q3NA 4Y6SA 1KVUA 2IZ1A 3DZFA 1ZNQO 5DZSA 4YXFA 4YAGA 4II3A 2YDYA 3JYLA 2ZCVA 4GVLA 3FF4A 4DQXA 4FOSA 1K6XA 5TJHA 2PK3A 1PJQA 3VDQA 4PZDA 3GGGA 3KM0A 4E0BA 3BTOA 4PZEA 5DP1A 4KQXA 3RC1A 3WJ7A 3ZW8A 3C1AA 2A9FA 4J90A 1KEVA 1FDUA 4ND1A 4GX0A 3H5AA 3DZIA 2AEFA 2NVUA 3UAGA 1E3WA 3H5RA 1Y8QB 4CMBA 3AM5A 3K73O 2NWQA 3UCEA 4ZQBA 4JNKA 2P9CA 1GYRA 4UUPA 5BSFA 4EW6A 4FGWA 3DR3A 1NPTO 2DVMA 3OJ0A 3PK0A 4GX5A 3RU9A 3I9LA 3GZNA 1ADGA 3PDJA 4TZKA 1FDWA 3PHLA 4JJGA 2DTEA 3LVFO 1LDNA 4NNJA 1EVIA 4E3ZA 1IUKA 3WWYA 2VZ8A 4EUHA 1NNUA 4WOKA 2JJYA 5CAEA 4YRDA 1H6DA 4WLUA 4CM4A 1ZZEA 3KBOA 3WGIA 5CPFA 4QTZA 2I99A 3SEFA 4CJXA 3HB4X 2FSSA 3MZ0A 1YDEA 1Q0HA 3I4CA 3ZZNA 1UP6A 4NU5A 5JYEA 2PH5A 5B4TA 2YZ7A 3GG9A 2QZZA 1LSSA 4FS3A 3GVPA 4NPCA 3HDYA 2FRDA 3RUAA 1ID1A 1IHYA 4MP6A 1A4IA 2WE7A 1LSOA 2JKVA 2I3GA 2Q2WA 5G4LA 4W4TA 3HG7A 1B8UA 1HF3A 4HWKA 3UN1A 3E8XA 3KOUA 3H4VA 5A05A 1J4AA 3AI3A 3WX0A 2JFFA 2PZJA 3LT2A 4MDHA 1ZCJA 2ZJ1A 3D3WA 4J1SA 3UOGA 1N9GA 4H16A 1Z73A 3U5TA 3ZHZA 3QVSA 2JAPA 2CNBA 3BMOB 4EYEA 4IDGA 4FFPA 3ROKA 1UP7A 1W6UA 4BNGA 4AJ4A 5JDIC 4LSMA 2AEMA 3LT4A 1CERA 4FJ1A 3UCXA 1UDCA 1DIHA 4BV9A 1H2BA 5JAQA 3O8QA 1DC4A 4R54A 3INGA 4JP3A 2O7QA 3B6ZA 1V35A 1NWCA 3GQVA 3SBOA 3RC2A 5L45A 3PEFA 4CLXA 2G82A 3L4BC 1J5PA 3ZHXA 3C7DB 4I5DA 4ALMA 4U7WA 3BTVA 2O3UA 1QORA 2VWHA 3DONA 4A27A 4UREA 4WCDA 3W1VA 5JDCA 3IDSA 4UVDA 3IKVA 1VSUA 3VAZA 2O23A 3CXRA 4TQGA 4YJGB 5AXBA 3ZWPA 4IGFA 4CM6A 1H6BA 1WMAA 4K6FA 3IKTA 4IPTA 2RBEA 3LQFA 1P0CA 2J3IA 1VLLA 1DRVA 1U4SA 2UDPA 3AU8A 4OXKA 4AJEA 2QQ5A 3GG2A 4L9RA 3ROPA 3AK4A 1PR3A 4DIOA 1MA0A 3CUKA 3AM3A 1XCBA 3BXXA 4M1QA 1ENZA 1P1RA 3AY3A 1I8TA 5F5LA 3JQFA 4PG7A 5COBA 5ES3A 4ALIA 1UP4A 2X9VA 1VPDA 5T5QA 4XJTA 2AXQA 4XCVA 3W6UA 3VPSA 4MP8A 2EKPA 4MIOA 1JKIA 3WIDA 3U3XA 1E1LA 3QWHA 4CUZA 3E9QA 5BT9A 2O3SA 1AN9A 4XGKA 1VC2A 3WBFA 1LDBA 3ICCA 3WNQA 3HDQA 1T4DA 1UUFA 4MPDA 2NVWA 4IDAA 3F6YA 5EMHA 5TLSA 6ADHA 1Q7GA 3PYLA 4CMKA 2ZK7A 4MVJH 2VQ3A 4Y98A 4BO1A 3DQPA 3DTTA 4R5HA 1QLHA 4E30A 2HSDA 1O6ZA 2JFGA 3WQQA 2C5EA 2NSDA 3F1KA 2YV3A 2AG5A 2GGSA 3RUIA 5B12A 4INAA 1U7TA 3KEQA 3W4KA 1KVTA 3ZWCA 3QWFA 1JWBB 3VOSA 4YCAA 3EZYA 1W4ZA 3ASUA 4BNYA 4PVDA 3PWZA 4NZ9A 1EVJA 4AVYA 4BB6A 3AOEA 1PQUA 1EVZA 1M66A 2B4QA 3ZHYA 3MOIA 3RASA 1PS9A 4QXMA 8LDHA
chains in the Genus database with same CATH superfamily
4FDUA 5CURA 3C5EA 3AEYA 1K2VN 4X20B 3V8PA 1QKJA 3KAKA 2IOFA 5FYQA 5F78A 1E32A 4A5SA 2Z5FA 3HADA 1B7GO 4LBWA 5CXUA 1N1EA 3JASB 4PBRA 1CC1S 2JFBA 4JBNA 3R7LA 1FP7A 5F5XA 2WD7B 4DIEA 4QFMA 5IU6A 2LCQA 1G66A 5BXYA 5K0CA 1DSSG 2RGGA 4FMPA 3RWOA 1AQLA 5BW6B 2BLNA 4L78A 2YTZA 4D46A 1PGOA 1H3EA 2GFIA 2VDKB 4KQJA 5BSWA 1SC9A 3RVNA 2XXAA 1AQ6A 1R4NB 4RORA 4MKHA 4R1OA 2BFCB 4I8XA 4OX9Y 4OHYA 4YP1A 3I6MA 2PL3A 1XTQA 2VL7A 3EVAA 4OL9A 4M49A 1KEEB 5T6MA 3NR2A 1N0UA 1XALA 4FR5A 4EO4A 3OTHA 1EUYA 3D5QA 1HDOA 1KDZA 1TYEB 3ABZA 1WZIA 3D8BA 4OI4A 2FVYA 5FTMA 5KNLA 1NBOA 4IQ8A 1IDN1 2C5HA 2OV4A 4JQYA 3RT1A 3I2KA 4ENTA 4A0SA 3NHSA 4MUKA 4QAQA 1RLTA 3IV6A 4WCVA 3EXIA 5FJJA 4HSEA 4AMUA 1XTTA 3P4YA 3IO5A 5TS3A 2XCUA 1ZH4A 1IQUA 4TTRA 4YCDA 4XGRA 4EW1A 3LGXA 2UYCA 4FBGA 2J9GA 2OE2A 3FPHA 1QYDA 1TUEA 1EX1A 3AFIA 1YS6A 3BICA 1NASA 4HH3C 5KSYA 2GI4A 1S3GA 5DM4A 1T9AA 2HJSA 1RPAA 4P6VF 4B85A 1YOBA 2IEDA 2VOEA 5E38A 1EHYA 1WA5A 1JW9B 2EU8A 2JJ2D 2WPDA 2KBEA 2XF8A 1T1RA 2RCYA 3W6ZA 5GQSA 3LPMA 3V6LA 4IWXA 3II6X 1E5LA 3TBFA 2QM0A 4PX9A 1QIHA 5K3FA 2QM7A 2GT1A 1L5NA 1F17A 4JFRA 3ZOZA 4RHTA 1SBYA 4A6EA 2QZJA 4LTDA 3U44A 4KGZA 1ZEMA 1W34A 3WK7A 4PO3X 4RPCA 2DAPA 2PMBA 4MRMB 4U7GA 5D5HA 5HS6A 4EJ6A 5CB4F 5ER6A 4OHUA 4J3FA 1NW6A 1U2RA 5E4YA 4WZBA 4TLEA 3C5CA 1RBZA 2BFNA 3FETA 2PA3A 3ZJYA 4UTNA 2AKYA 4JB0A 3JW8A 2XZDA 5BSKA 4TSKA 4ZRDA 1P9WA 3V80A 2DB3A 4YECA 3ETJA 5E3JA 4B9AA 5KQMA 2XOXA 9GPBA 1FDVA 2HU8A 3TRIA 4MR9B 1V11B 1XVVA 2O8EB 2GJ4A 1ADBA 4F93B 1K1EA 3PC4A 2W83A 4OP3A 2GEVA 4WEQA 1GUFA 1K6MA 4LVUA 4UASA 2CDNA 2G06A 2F4VB 3IP9A 1Q1ZA 3DMDA 3QVWA 1UBLS 4YDSA 4E5MA 4JASB 3KSMA 3MJ4A 1KYZA 4TTSA 1Y3DE 3NM4A 1E1QD 1QH1B 1VE6A 2UZ0A 4Z3DA 4DSZA 4RHFA 5KOHA 2V4MA 2XMRA 3EYAA 2G70A 2IEZA 1EJ2A 2QYHA 4JJIA 3AF6A 1NN3A 3WI7A 1ZSVA 3D7MA 3AU9A 3P9RA 2C4WA 3E81A 4OAPA 2E85A 3C3WA 5T67A 5TQ0B 2OZPA 5JQGA 4ZCLA 5K3BA 3H42B 3ZZ0A 1APBA 3C7CB 3T4XA 3GLGB 1D2AA 1LQUA 2P4HX 2QU7A 2J3JA 1XE3A 3BEDA 2W48A 3GLSA 1N34B 3DZJA 2QV7A 1VHWA 3CU5A 2N3ZA 1XQ1A 2ORIA 4XD2A 3CSSA 5FEUA 3NS7A 5CA0F 4IZHA 1G8YA 3S99A 2JEYA 2WSLA 2PSEA 1WXWA 5F3DA 2PRJA 2W2TA 3DNFA 3GFSA 2W6ID 4CLEA 5LR6A 4BECA 1VYUA 2QV0A 1CR2A 2VDPB 2GZRA 3LA6A 4HATA 4ZYWA 1SCBA 4J16A 3DKIA 2ZREA 4YJHB 4PW0A 1CUCA 4WPGA 3WMRA 4KUGA 3ZJUA 4ARCA 3GCXA 3OFKA 3WBKA 5EJ8A 4RTSA 1CDEA 4G63A 4R2LA 2W4IA 2WKWA 1FL9A 4UZSA 3UK1A 3J81k 2X0JA 3WL3A 4EX7A 1H6CA 1Z82A 3H2YA 4BMYA 1K3TA 1FS5A 4LDQA 3ZLBA 4TSFA 2DKFA 3A1TA 3V1TC 3E3MA 4NX2A 4YRJA 1KVQA 3M0EA 2ZG6A 3B1FA 3K2BA 1MN6A 2REQA 1TIKA 4CM5A 1XZBA 3N86A 4MZXA 1L7EA 4QELA 7REQA 2MTBA 2Z1MA 5EE9A 2L17A 1QQAA 1XRMA 4UKDA 4XUGB 3WLJA 1D7OA 5JYBA 1SVUA 4WI1A 3ZDEA 1W2HA 4PYKA 1VZ3A 3KCQA 1HWYA 3GMIA 3VKWA 5EJ9A 4HAUA 2O8CB 4KMOA 1NZJA 1FBTA 1U2DA 2AMLA 4TLMB 5LNK1 2Q22A 1GZSA 3CUEF 4OM7A 1W52X 2AOTB 3LQ1A 5K8IA 2AMJA 1KK2A 4CR7A 1NLYA 1YNOA 2V65A 2VRWA 2MYTA 3MMZA 2H16A 1CZLA 3ROGA 3EXFB 2X5NA 1ZBQA 1QIJA 2E6UX 2VUSA 2WU0A 4AG5A 1NGSA 4B3IA 5CH3A 4D8YA 5BMVA 4C78A 5BN1A 5D8DA 1YS1X 4M98A 1SKAA 1W96A 2VTKA 3AHGA 1X1SA 4YP6A 4GKJB 2VTBA 1Q7CA 1DAMA 1TZ2A 1WBBA 1Q6ZA 3KQSA 1CLEA 1KQ3A 2E1RA 3D54D 3MOGA 2QMHA 2H48A 3UUEA 3VZQA 5I01A 1JR3E 1LDGA 2PKEA 2WJ4A 4W9NA 3ZWDA 1TJ5A 2YIDA 2AR0A 2EV9A 3I30X 3TI9A 2BFEB 3FNHA 4A82A 2Z2IA 3BGWA 4DDTA 4LSWA 3IPRA 1CDOA 1JSRA 4AX4A 3K0CA 5IF9A 2YOHA 2Q2NA 3OPYB 3BHNA 1SRQA 3WY9A 4HV4A 2PL5A 3Q7PA 3SJ7A 3E22A 5CDGA 5CFOA 4UXHA 1PGPA 2CXUA 2P9FA 1YI8A 4LMRA 5AVOA 2NUAB 1QK4A 5CT9A 2B21A 1Z36A 4HLUA 3PIIA 2M98A 1NTOA 4QBKA 2COKA 3AXSA 1THTA 4OBBA 2ZYGA 3MD9A 5BNIA 3S0JA 3FJ1A 2Q41A 1TA4A 1PEDA 2GX6A 3OLXA 5IJXA 2BKLA 4BFUA 4NJMA 1JVBA 2HA6A 1ZK1A 4JKYA 1KZ4A 2G1AA 1CRWG 3C1TA 3FUCA 2QX8A 2PM8A 2VA9A 1A5BB 1DDGA 1I3OA 1ZGCA 3PR1A 3T3DA 4ZYTA 3TTXA 2IV7A 2CVZA 3M9XA 2I2CA 1BQ3A 2F2TA 1ZX1A 1GR1A 1C1DB 1HXHA 2QVCA 4TMTA 1VL0A 4EI9A 1B93A 5ITZB 1DAPA 1LK5A 4IEIA 3TLXA 3JWPA 1M83A 1VP3A 2G1KA 3G5LA 4V03A 5EYPB 1XZQA 2ID9A 5ICGA 2O19A 4JOBA 2LCIA 2HBYA 3V8EA 3N0WA 3TZBA 6YASA 5CB0A 4B45A 1OJ7A 1QFZA 4RKRA 3DULA 3KEMA 4CM9A 4WESB 2BELA 1EUCA 4H1VA 1N3YA 2IXFA 4ZI7F 5JJIA 3QVVA 3RNOA 1B6GA 2R11A 1USGA 1CY0A 4D4HA 5IFKA 2DBVO 3QV1A 2ZJ8A 4XQGA 2O8BA 3U4DA 1S9HA 1PKXA 2EKLA 2KWIA 4AKIA 1P2FA 4RKQA 2J7PA 4RJIA 4OHMA 5HTOA 3BH6A 3KC2A 4LZWA 1I13A 4AJPA 5FLXA 3U61B 4FHFA 3ZDQA 2QLMA 2P30A 5CVVA 3ZCSA 1ZD4A 1ETUA 3Q41A 3HA3A 3TW3A 2B20A 5EE5B 5CD1A 3ABSB 4ZOLF 3GFBA 2ZM6B 1SUSA 3G49A 1V2GA 1WDWB 2QSYA 1XEAA 3DXXA 4ZTZB 1WMDA 3FIUA 2KS6A 1Q95A 1R0CA 2VWPA 1AG9A 1U7ZA 1X1BA 2JH3A 2Q46A 1ZMOA 2WW8A 1W1IA 1CNFA 3DB1A 3S81A 4ZP1A 4O02B 3BD7A 4BASA 2C2GA 3DHNA 1VDMA 1Y42X 2Q6TA 3L02A 1C1XA 3M89A 4M0PA 5CVJA 1QMPA 3QKRA 2CVOA 5F7JA 4LJLA 2O4CA 3ZNQA 3U16A 1FNBA 1LBIA 5SY6A 1ESDA 3FOCA 1GNRA 3FVTA 4II2A 3TW4A 5C80A 3MQFA 2IODA 3DEKA 1A9XA 2PQ2A 1ZBDA 1F20A 2C82A 3ETNA 3L2OB 3O4FA 2Y77A 3P20A 1N8TA 2F7SA 1V3VA 2NXNA 4RFSB 2AFVA 1WTAA 2H9IA 5B4UA 1VI6A 5ELMA 3UUWA 3G88A 1HTBA 1FRQA 1AE1A 3IWBB 4GPAA 4Q16A 2QTVA 1M6EX 3HKDA 2H52A 3MYRA 3THYA 4J0CA 1GD1O 4AZ0B 4BNZA 3PUXA 2WSBA 3QV2A 4PX3A 1J99A 1KNQA 1FW8A 4QGFA 1DC3A 1GPMA 3OC6A 1BSVA 3CZMA 3F6RA 2QN9A 4EEZA 2D5IA 1BKSB 4L5YA 1UEIA 1A9QA 2QPAA 1S7GA 3OPMA 4Q6WA 3I9V6 1II8A 2FKAA 2IJGX 4JBYA 3HXQA 4MCHA 2UUCB 3RKSA 1WV1A 4QUIA 2VUUA 1A69A 5CVEA 1V6CA 1GTMA 1U1EA 3R5XA 1MDFA 1TEXA 4UNNA 2ZJ6A 4DQUA 5JZSA 1OGIA 2PWAA 13PKA 1E5VA 1W5AA 1KPHA 3Q88A 4LW8A 1GAQA 5BOVA 1W93A 4AMGA 3E2MA 1OLXB 5JYCA 5I8ZA 2CE2X 2ZZKA 4LV5B 5H68A 4DSUA 4EBBA 4NXMB 1B2LA 4HEA1 3M3DA 3H2HA 3ZUGA 5JCXA 1VL2A 1H0RA 3IEUA 3LW7A 4OHBA 1QWSA 3HJAA 1GTSA 2NU6A 4G0MA 5E2BA 2BM0A 3OE5A 4X91A 3P4XA 4BEBA 3AKEA 3QVKA 5CIWA 4D9JA 4R9RA 1RZVA 1PT5A 3KJFA 4CFSA 1MXFA 3CJTA 3I6QA 5LZ5A 1HETA 1YQQA 2B82A 3THOA 4TZ0A 5CB4A 5HUQA 2WNIA 3HJTA 1DRUA 1A71A 1HT2E 3Q3JB 4HNVA 3E1KA 1PF7E 1UK9A 2D1QA 2ZQ5A 5CVUA 3SYNA 4BMVA 4Q7QA 5IK2D 3DT9A 3JQ8B 3SVLA 2YQ4A 4EHKA 4M9ZA 1UBSB 2ACEA 5EWJB 2C2YA 2XYPA 3CW9A 4J3JA 1BO6A 2BFDA 3P5BA 3T5DA 3H1GA 3SHTA 5IN4A 1Y6ZA 2VLIA 5ALNA 5AO9A 4YYZA 1VHQA 3DLIA 3MTIA 5K6AC 2VVTA 1QC5B 2HMUA 2DMRA 4XFJA 1X3LA 2H31A 1TC1A 2ZRAA 3LHKA 1QFXA 1ODCA 3W9UA 3IHWA 3UOWA 2FN9A 2X3YA 2ENUA 3X3HA 3ZE9A 2IYVA 1DL5A 3NUZA 4L8LA 5TT0A 2VCEA 3VA7A 2DWQA 3NHMA 2FW6A 4Q7JB 1FFEA 3JSXA 4F1KA 5KOYA 2VAPA 3GVXA 1IHDA 3AP3A 2A1TS 3LH5A 3ZX5A 3MCTA 1U99A 3IT2A 3VR1A 1ZNYA 3V8MA 1MG0A 5BT8A 2ZSJA 3OFSA 3EPLA 1KAMA 1RABA 3IQDB 3K8QA 3M6AA 2QVGA 4MITA 4HNQA 1BXGB 2CDCA 4YIKA 4X24A 3OA0A 1LFAA 3WMGA 2X22A 1T91A 1U3WA 4BVBA 1L4KA 1BVYF 1GR0A 2IZ6A 1OROA 1XLUA 2EG5A 2Q0QA 1T3GA 2Z8XA 4OP1A 1CX9B 2QSJA 3V33A 4BFLA 2RAVA 4CQMB 1N5IA 2IP4A 2XBLA 3BQNB 2Z5LA 4RA6B 2VQ6A 4F3NA 1M0SA 5CA0A 4IDBA 1XJCA 2FSVA 1FNCA 1A8QA 4PYOA 5EIEA 4UOQA 3UTCA 2GCOB 2HRQA 4RH1A 1V16B 3RRJA 2GS9A 3BE8A 2WWTA 4NOKA 5FQNA 4MQEA 4GKVA 4B3JA 5HW0A 2FWIA 3E9RA 1K9SA 5SZKB 1OFTA 4HQFA 3OY2A 3PGXA 4O2RA 4N49A 2CV2A 3OJEA 4KPYA 1W88B 1C30A 4EHNA 1L7OA 3DT6A 4EARA 3AG5A 2CY0A 4LXHA 3RIHA 4JI2B 4KR2A 2VRCD 4N9WA 1WCIB 4UC0A 5JI3E 3GLFB 3ETGA 1KXJA 3ZXIA 2DFTA 3VZBA 1Q3TA 4DLKA 3ZS8A 2QJWA 1ISPA 2CLSA 5J3JA 4LDZA 5CFQA 2OO3A 4NE2A 2IHTA 2B4RO 2XB9A 3LYAA 3SS9X 4PG4A 3A6ZA 4GEKA 4GFDA 1O96B 5EE1A 3IWCB 1F14A 4V1CB 1D2EA 5I7RA 2B94A 3IKLA 4FLEA 3QVGB 2JI4A 4I9FA 4J03A 4QEDA 5G0VA 1G1AA 2HQSA 1GQSA 3DXFA 4HN9A 4ZK2A 4JUBA 4K8RB 2PMDA 1IB6A 3ODGA 5CLLA 2BDUA 1U2GC 2R68A 2QF7A 1I4TD 4WBXC 1IY9A 2WSMA 4Z3OA 3QITA 1NMSA 3EF1A 1WMEA 2VDQB 3FZNA 3ZKWA 3O8DA 1ZRNA 3LQQA 2AOUB 2G25A 2F1IA 2ZE7A 3OF2A 2X0FA 1LDEA 1XAGA 1B74A 1JENB 2VPIA 4E94A 1U3TA 4IDDA 5JNSA 2BGIA 4GLLA 1V6AA 4TRRA 4Y2JA 3WWDA 3QNUA 1JT2A 1JEEA 2ZSBA 4PLHA 4XTRA 3ZX4A 1ILWA 1GXSA 4LY6A 4F0JA 1VKNA 3WMXA 4DKJA 2RHHA 1QCDA 1KORA 2N47A 3CNBA 5CA1F 4S1WA 1LX6A 4FHEA 4PLPA 1LZKA 5B1EA 4L57A 2P2CA 4MKZA 3HCNA 2J0QA 3PPWA 5JWRA 5B2FA 2CKDA 1XF1A 4MWTA 3LF2A 1GVHA 3MJEA 1HLFA 4UBKA 2IYAA 5A9TA 1M8PA 3AJEA 1X1TA 3S40A 4ZYUA 2O8DA 1EP1B 3GFGA 4KJXA 1UM8A 1NVTA 4MRAA 4U2GA 5FOTA 3DTVA 1ZM9A 3B51X 2XDYA 3Q5EA 4IXMA 2WZDA 4JJAA 1RQXA 2FYTA 2Q3DA 3FMOB 4HG2A 1WDMA 3VH3A 2GZ2A 2FV8A 3WZ2A 5C4MA 3WYBA 3EQ2A 3GLFE 1TDJA 2JEZA 1F38A 3T9EA 1KK1A 5J4YA 3OLQA 1HQKA 4PICA 5KU1A 3HHEA 3KFLA 5HCUA 5AXCA 3HXKA 2CT8A 3ZJ5A 1O8CA 2W37A 1G8JA 3I4LA 2J85A 4O4HB 2VDWB 1BN6A 3MBOA 5TY0A 1KRXA 3QGMA 4ALKA 4D3FA 2WJJA 1QZTA 1YR6A 4EG3A 5JADA 1YRQA 3VOAA 3EIQA 4M3NA 1LFDB 1Z0ZA 4HRYA 3ES9A 3SM9A 1O77A 4D3XA 2OSVA 1B23P 3IUPA 5D5PA 5DLEA 2C77A 2Y0DA 3NBFA 4RIHA 4F5YA 1USVA 4PZCA 4Y0VA 1MUUA 1MW9X 1SZDA 1V41E 2Q6OA 1M2NA 2Y1FA 3NC1C 4N5MA 5DGCA 3JRNA 4DLNA 5MDHA 3DLBA 5ETJA 1CJVC 4DA8A 1WUIS 1WO8A 4RTKA 4ZI7A 3ZWYA 2UUOA 3WK9A 2PJRA 2WFZA 3E9EA 2FPKA 4MV3A 1II0A 1MJGM 1OI7A 2I54A 1KJQA 2WMYA 1N25A 4R3UC 4EH1A 4MUEA 2BTOA 2ZI6A 3U4CA 2ETVA 4YIHA 3K72B 5I9TA 3VDXA 4QARA 1WEHA 2FFAA 1A27A 1QYRA 2X2PA 3D6UA 4UPDA 1K5HA 4A2QA 4DSAA 1I14A 1A88A 4UCFA 1STOA 1OF1A 3NBZC 3RK0A 3IAM6 1RKVA 2I67A 2J3LA 1VE9A 4ZOLA 3GAFA 2JNWA 4PLCA 1PFGA 1E4VA 4OSOA 1N5KA 2WU1A 3TDMA 3IPLA 1EG7A 1TU0A 3IGFA 4EJSB 4K6CA 3RHFA 5ILGA 4CMGA 3ADOA 3EP9B 3TSCA 3AR9A 3ZV3A 2Z4RA 3UK6A 1JR6A 2OMEA 3QKIA 1XFDA 121PA 1WPRA 3AZQA 3IP3A 2YMMA 5EHQA 3TW8A 3ZKAA 3I5YA 1JH8A 2I5PO 1TO2E 3BBLA 3O8LA 1LDYA 1GDHA 2HNAA 1KYVA 1ZO8A 4N6NA 4N18A 2FPGB 1E3LA 1U02A 1OGYA 5EI5A 3DMTC 2FMUA 5K1ZA 1C4XA 1F6BA 1QVAA 1SPXA 3MQ4A 4ZOEA 3GX1A 4B75A 5KJEA 4BJ3A 1PVDA 4RPLA 2PZEA 4ID9A 4QYTA 1NP7A 3CLKA 5KSOA 3F6SA 2HFJA 4E5SA 2EOAA 4J2TA 3CCFA 3SHOA 4N7MA 1U2PA 2ZBVA 5FBRB 5HE9A 3RC3A 5C1DA 3DB2A 1RLIA 2GXSA 4IVQA 3T41A 1LRKA 4CODB 1YHYA 3QBTA 4CGYA 3BB1A 4R1MA 1JHOA 2ATXA 3N2ZB 4OM8A 4ZQIA 3R75A 3V2IA 4ZFNA 2XB2A 4KFTA 3D2BA 4FX2A 4IG9A 4JGIA 4WN9A 3TLKA 2X8LA 2BHNA 1QG4A 4RQUA 1P72A 5FBVB 1VJCA 2HMAA 5T7BA 1EINA 3T9BA 1F7VA 4D8WA 4BL5A 2FPIB 4Q34A 4NCXA 5F51A 2Z8YA 5B2EA 5C52B 1AKNA 3HDTA 2YNMA 1P7PA 4L95C 3Q8WA 4DHWA 3F5SA 1KEWA 5BY2A 1JSXA 5FBHA 3N75A 4X97A 8GPBA 3T1QA 3O21A 2ANBA 2IIPA 2PLAA 1NJ6A 2QTTA 3GN1A 4UBIA 4WIAA 1W0KA 2GTHA 4B6GA 5LWQA 3A8TA 3BFKA 4GPTA 1TCBA 4DANA 4DWWA 4A92A 4K9PA 4JJKA 3ESAA 3DO5A 3M4NA 3ZE7A 3KDAA 4QFBA 2FKNA 4JT2A 4S04A 3L6RA 3ZXSA 1E9EA 2P2GA 4AWBA 2ZDHA 1JVSA 3AP1A 3PWTA 1FSZA 2J9XB 3FCYA 1Z4NA 3Q7TA 4H60A 3BXEA 4O8ZA 4JLBA 2DBRA 2AQHA 4J4TA 4PYJA 2XIQA 4X1KA 4A8JB 2W43A 2GAOA 3F2IA 2ANCA 3CCCA 4FNAA 5I7UA 3GJ4A 1J97A 2WNHA 2CDRA 1RI5A 4Q7MB 4PPYA 5B6IA 4NZMA 3EC7A 5DHQA 3A6GA 3OPQA 3RVMA 4LE2A 4WXYB 1U3UA 3ZV5A 4CUKA 1RQLA 1ECPA 5HG0A 2ZBRA 4KDRA 4MWZA 3D1JA 1EP3B 4RD2A 4PINA 1CF4A 4YJKA 1B26A 3IQXA 4KVAA 1TD1A 1RJDA 2CJWA 2LKDA 4PX2A 6GPBA 1L2TA 3FH0A 4MVXA 5FNVF 3WSVA 1VJDA 2B8EA 4G6ZA 1CY8A 5A5EA 2A5GA 2GF2A 5JTUA 2L82A 2PKRA 3BHMA 3DYIA 4BWYA 2H7XA 4KUEA 4M37A 3GWZA 5LA6F 8ABPA 4PZAA 3KK0A 4QGAA 5F77A 3W8NA 3U19A 1UAGA 1KU0A 3FW1A 4C30A 1I4WA 3JQGA 4MW5A 3PWSA 1Z33A 4OAOA 1PBNA 4NCHA 2RB4A 3JAWA 2FPNA 2V6JA 3BDAA 3RSOA 2QJTA 2ET6A 5KIAA 4B2IA 1J5EB 3A1SA 1YZQA 3PU6A 3RFTA 4XWYA 4PCUA 1V7PC 3T7AA 1EWTA 3GHYA 2VWGA 2B99A 1JAIA 2GBGA 1G42A 1KDVA 4M0FA 2CXOA 4ILKA 1NQTA 3NHLA 1XNGA 2HWXA 2OY0A 2IQIA 1AKUA 4CIBA 1OTHA 3DNPA 5KYGA 5J47A 2CL7X 2VXYA 1QVRA 1WPQA 1Y8RB 2EFGA 2MYNA 1E6UA 3QNMA 1WWKA 2YUIA 4Y9SA 5AW8A 1KOFA 1PJZA 3FLMA 4DMRA 5ILOA 2Q4EA 3C6KA 4JP8A 4F3RA 3VHXB 1DB3A 1V3QE 3RUEA 4G89A 4O6VA 1T6YA 4KE7A 4COOA 3RYCA 2WZQA 1MC5A 2MYUA 1RQ7A 3L0YA 1HDCA 4GR9A 2I8LA 2FPPB 2NZWA 4TQAA 1YMUA 5I9BA 2DPGA 4GPD1 3UGKA 5E6RB 3KOYA 5ESXA 4HL6A 4DB2A 4JLSA 1DIAA 2CN1A 2IU0A 1ORHA 1TT7A 4ALJA 4NFYA 4TOIA 2Q99A 2ZE8A 4X9XA 2ZYAA 3S7ZA 3OCUA 3GPCA 1P1IA 2OBMA 1C3EA 3EPKA 4FHDA 1ZINA 4D5EA 3I9NA 3L1IA 4DJTA 5BV7A 3CZ4A 4DNFA 4ZYYA 1QJCA 2Y2VA 2QPTA 3NW9A 5GIPE 3MUFA 5U9CA 2HGZA 1LF5A 2VQDA 1AT1A 4Q4HB 2CUZA 2C59A 1FE8A 2MSLA 4WY8A 2IU6A 2OKCA 5B6PA 1QK5A 5KCZA 2D06A 2VG8A 1QMGA 4CCAA 4BNKA 1NY5A 4K3UA 4DT1B 2P67A 3B13B 1K7CA 1KFBB 1Y7IA 1YAJA 2W2KB 2IVFA 1CVLA 1GCUA 2ZIVB 3H5VA 4O4IB 3FTQA 4CEIB 3DJFA 3P45A 4ND6A 2O1SA 3ONNA 2Q1TA 3W3ZB 1X7XA 4ZJPA 1ISHA 1AKWA 1GRCA 2AQIA 1OH8A 1RC1A 1UOOA 2NO6A 3ONDA 1IM5A 5AM3A 2WK1A 1V5FA 3GK3A 3KR9A 4C0XA 3NBYC 1NVWQ 2FF7A 2QRVA 3K0FA 2JD2A 2J33A 1GQRA 3PNOA 3KQWA 3H1FA 4ZT2A 1S3IA 2VWQA 3ULKA 4TM8A 3CRNA 2W2VA 3O8NA 4UAUA 1IQPA 3A06A 5DYYA 5EPOA 3RS7A 1SULA 3LWZA 2PIAA 2ROQA 2WHXA 3KZOA 2RHWA 3A6KA 4URHA 4BO6A 4DGQA 4DQLA 5CEFA 5CA1A 2BOVA 1KC1A 2V8OA 1XDDA 4ZOBA 4ZO7A 1JPUA 2VYVD 5FWNA 1HZJA 1U65A 2DFNA 3NJRA 1CHDA 3LP6A 3WKCA 1AQIA 1GUDA 4ARZA 4B3BA 1Y7PA 2AQKA 4JJFA 4QTUB 1GILA 5I3ZA 2P4SA 4D82A 1ZJ4A 5IMBA 4ZEXA 1EX6A 1JT9A 1BD4A 1FYVA 2VHTA 4OU4A 3GV0A 4FGLA 4OREX 1SCKA 1W0CA 5DEOA 4RA9B 2GBFA 2OC4A 3BILA 4Y2GA 5AKJA 3USZA 3VHLB 3VXKA 3UJHA 1ENOA 4G8CA 4YI5A 1KMIY 5CTAA 3SY8A 4Q3LA 2I9PA 3GELA 1QRRA 3JD0A 4ICIA 2PD6A 3OJLA 3FDZA 1EI9A 3WGNA 2O2GA 2Q1XA 1R27A 3V8NA 1TKBA 4CIDA 3WLMA 2JIOA 1UL1X 2PU5A 5FI1B 4AS2A 1JP7A 2VNAA 4U6SA 5IHXA 1UKCA 4R3NA 2DBYA 3VYTB 5MFPA 1VMEA 1ZD3A 2FMTA 1DWQA 1CY6A 3DDCA 3L8HA 1H2ZA 3O8BA 3PE3A 3WGGA 3JQBA 4BPRA 1LD3A 1UBKS 3GXBA 4I55F 3VU9B 1SVOA 2RGRA 1H4SA 3HL4A 3SQOA 5K0EA 3MWEA 3LHDA 1Z5PA 4PF1A 1LDMA 3HUTA 1ODIA 4A8TA 5CITA 5C9ZA 3E3AA 4JEIA 1YJQA 4O63O 5JNLA 5A6SB 3EOZA 2F55A 3H9UA 1HDZA 3HYSA 2PUJA 5TB5A 1PL6A 1ZH2A 1YIDA 5AVJA 2FW8A 4O4LF 5KPDA 3DBLA 3BWCA 2XY4A 2J4DA 3RJMA 2IXTA 3R4VA 2UXBB 4A16A 4MKXA 3ENNA 4WLFA 2WSSA 5ES4B 2GPNA 4G0YA 1EFRD 3MWFA 1RI2A 2Z83A 5ALGA 3VX3A 3ZIAA 3L3BA 5IT0A 4QQKA 1P5RA 3FNFA 1JGTA 5ARBA 2ZE5A 4D6PA 5K0ZA 5HHTA 4FNOA 3RTEA 1A2QA 3FUTA 1N7IA 1AKTA 2FVXA 3I9MA 1J8YF 4INZA 4GLBA 4M8IA 4IIUA 4UU7A 1ZICA 2QYTA 1PHRA 4LG1A 3FWPA 4FMCF 4BU0A 3FOZA 1S0UA 1KBOA 2NM0A 2PH7A 3R7AA 4HGRA 3LFUA 5D87A 3OOYA 1RAGA 2AR7A 2WM3A 3TG8A 1N6NA 1EHCA 3J7AC 3PTLA 3D59A 1M5TA 2REBA 3DE3X 3E5HA 4YBRA 4CIWA 1PW5A 2JIBA 2HNKA 3TRFA 2Q1UA 1W8IA 2ZULA 3TOCA 2EW1A 5CIQA 4WD3A 1RPZA 4RDHA 2EIHA 2OK8A 1W4LA 1EE9A 1XZMA 1V48A 3IR7A 3GFRA 4CKWA 4KR9A 3HU2A 4DR5B 2QX9A 4FLFA 4UU1A 2F59A 4UVEA 1W4BA 1E7MA 1VI5A 2EDAA 3VQTA 5CJJA 4H7JA 1P4HA 4DARA 1LTKA 4PLZA 4RJ2A 3PWKA 2PKCA 3FKQA 4BBAA 1DTEA 1DAKA 1T0JB 3W5UA 3ZQ6A 5AW4A 4B5LA 5H8WA 1PUXA 2DTXA 1HYHA 3WDKA 3AKCA 4JU9A 1COWD 2E18A 3OM8A 1H94A 1W73A 3HO8A 1P44A 1Z5GA 2B1JA 5IKPA 3HVIA 4IWNA 5K9ZA 3R8XA 5HQ3A 4RY0A 3UA3A 3JD3A 2H4XA 3G2QA 3BXZA 3G2OA 4I0WB 1WUYA 4XOIA 3SMVA 4FN5A 3DQQA 3G1UA 3EGCA 5I45A 1B6SA 3WAKA 4N7BA 3W7VA 3GPLA 1V1RB 5IASA 2ZUDA 4WVLA 3R3WA 5INTA 1SUPA 4H3SA 4ZK6A 1N5RA 4H1UA 3C3XA 3QFFA 4NYJQ 4B5KA 3RFUA 2R1TA 1GZDA 3DP7A 1WMSA 4WSOA 3FOBA 5U4QA 1C9KA 2JVIA 2VSXA 3D6JA 4Y9TA 2OGTA 1BZYA 3VTZA 1PSDA 2CUKA 1U28A 5J2UB 3UO8B 4RTJA 3BWMA 2ZBPA 3DO8A 3F6BX 4OCZA 4HOYA 4RLFA 1TQ2A 3BWVA 3FM9A 2I7CA 4OMCA 5HOQA 5KWSA 4UJ3A 3HNPA 3UJ6A 4UOEA 1XMXA 3QE3A 3KEFA 4NAUA 5FFFA 1JJFA 5HKKA 2NP7A 5F4ZA 3FUWA 3SDZA 4ZCMA 1I01A 1TTQB 3TKAA 5LC1A 2JRLA 3CEPB 3AYXB 2OTCA 1CS0B 1MEEA 1PKEA 5JW6A 4HQKA 3ZD6A 1N2ZA 2AUMA 3GRKA 2M1XA 3UMBA 2VZ0A 3PGA1 1MOPA 3DKVA 4ZAVA 3THXA 3OOJA 3PX3A 3VPHA 2OLEA 4M88A 2PR7A 5DLYA 1OFVA 3ZWMA 4YAUA 2DC1A 3GN2A 4HQNA 2RHMA 1X1AA 3JVEA 3LS2A 1LX7A 1E1NA 1KK3A 1BOFA 4KWEA 1F51E 1PO7A 2C42A 2DR0A 5JCOA 3CNLA 4MW2A 4YRSA 1XU7A 1OKKD 1UKEA 2ESRA 2HM7A 2WRZA 4OUDB 1UZUA 3KT3A 2LXNA 2OO5C 2CJFA 3OIWA 4XM0A 2XKKA 2AZMA 2Y71A 1V2HE 4BQIA 3SYLA 1QIMA 3OQHA 2SHKA 5HK8A 5CCXA 2ZI3A 1P8JA 4BMNA 1QUFA 3D3QA 5IULC 4UPVA 4ZO9A 1XKLA 3FNEA 1IBMB 1N1GA 5ALOA 2J0UB 2YCLA 3Q3GE 4HN2A 4JJ8A 3BOSA 4R84A 5FNVA 5FI5A 1HE2A 1G2IA 2FE4A 4JP5A 1J00A 1NSYA 1YBVA 1VL6A 1VG1A 2O05A 1DOZA 3ZH9B 5BUSA 5BWBA 4HGZA 5LA6A 4MV9A 1PZXA 2F64A 2WJZB 5EJAA 4BKOA 4I5FA 3UJ7A 3VDMA 4BP3A 4D2IA 2H59A 3PR3A 2J0SA 5KQGA 1D4FA 2YZNA 2I03A 3OUZA 4BB0A 3OZEA 4MYSA 1QIKA 3STWA 1GL3A 3U39A 1WD7A 4L28A 5KYXA 1Q7BA 3BGDA 3PF9A 4LRYA 1O57A 1QP4A 4LK2A 1YL5A 4NATA 4PSDA 1BTOA 3K1YA 3QX7A 4GC5A 3D31A 3GXOA 4I1IA 3WB0A 1EPUA 2QQFA 3OKAA 4MRPA 4PNPA 3W7AA 4IDHA 1N5LA 4I7EA 4QODA 1HE4A 4QYIA 1G98A 1MMFB 1NBAA 1S01A 2GM5A 2O2CA 5DRTA 5EXEA 1NYQA 2X1MA 1KE1A 3KKPA 5JCJA 4I3HA 1VZ2A 1FSGA 4JOCA 5A1JA 1XGKA 1TX4B 4XIJA 1GPDG 5FWXA 1IK4A 1UZAA 5CLHA 2JHFA 4PLFA 4MYHA 4HI0E 4G0OA 4C21A 4GF5A 4JH0A 3G17A 3MTGA 1N9KA 3ZPXA 3ZCUA 2AOTA 4KYTA 1X38A 3ASVA 4BO3A 2GK7A 4I1OA 1P45A 2JZOA 3TQRA 3HEAA 4BMCA 3EQZA 3EWNA 4RZ3A 3AL0C 4BLPA 5KHOC 5DGIA 1IEWA 5H83A 3ERCA 3SG0A 4HYTA 1G4AE 2HU5A 1VJ1A 5TPWB 4FPXA 3AILA 1Z15A 1OFHA 2BJVA 3BCSA 4NH0A 3U26A 3SD7A 4EENA 1R50A 5IYZB 4CTMA 4YMWA 2DFDA 4DCUA 3IURA 1E3SA 2WUEA 4AKEA 4C5CA 2YW2A 4PV7A 1NI3A 1NRXA 1G63A 2HH9A 3I8SA 4JJ4A 1ENPA 3I39X 4CFZA 1ZC3A 4EQZA 5CMLA 1NBME 1NJ1A 4E7PA 5GZ6A 4Q37A 5GZ3A 1VCNA 2G5PA 4K26A 1E2QA 2QD1A 3OUUA 1QB8A 1Q92A 1WP9A 4EFDA 5KNCD 4DV3B 2C2XA 4NCNA 2N9UA 3PYXA 1TRHA 4YI3A 3WFJA 5KWIA 3VMMA 3NKVA 4O8CA 1E3JA 1UBCA 4LZPA 3BXHA 4XARA 4L5IA 4YONB 3W9SA 3AI1A 3IAEA 4DR7B 2B35A 2VCYA 5ERYA 2XADA 3RD5A 3KQNA 4IX1A 4LRTB 2I34A 1CQJB 3RYFA 1KZ1A 4OU5A 2ZYVX 1E9FA 3S70A 3SX2A 2FWNA 1E2PA 3V8RA 1XMSA 5JOQA 3L82B 4DCVA 2G4LA 3SM3A 5DTIA 4NULA 4YRRA 3LUBA 2ZJ2A 5CDHA 4J91A 4FOPA 4BO5A 4UFNA 4MW0A 3P2IA 4IRMA 3Q12A 3VR6A 3TMYA 5EUBA 3TSWA 3U80A 1HOXA 3O73A 2OFFA 3QE4A 2VYFA 3MT9A 2IL1A 4DC1A 1EGQA 2Z30A 4JBIA 4PYLA 1BH6A 1Q44A 2P6MA 3TUIC 3UJ8A 4F8JA 1U3FA 1GCOA 4LWPA 1ZGJA 4FOLA 5LM3A 1T2NA 1BFKA 2RDMA 5CVTA 2HBZA 3N2GA 4CG1A 2Z3VA 4HFNA 3UHPA 2J9FA 2G40A 1XTSA 1LSJA 1UFOA 3USCS 1SOVA 1XWWA 1IN4A 1LV8A 3IDFA 5KVSA 1Z6PA 5HFJA 4CN9A 3KDSE 2BI7A 5HUHA 1Q20A 2HTEA 4F5WA 3CZ5A 1XXHA 5JWHA 4Q9AA 4AICA 1JXOA 1QGED 1WW3A 2UYQA 4YPVA 5BV8A 3AETA 1Z16A 4F7WA 3A9CA 1MJNA 2D1YA 2EX1A 3CZAA 4DA9A 3ENWA 5MN6A 5E4JA 2I62A 2MSNA 3QMMA 1KEUA 1EIWA 1RBQA 2PUTA 4JJZA 3HJFA 4RQBA 4OLFA 3I28A 3GEIA 5ICSA 1DJPA 2XQGA 3ITKA 2WIAA 4X62B 1ZCAA 2QL7A 1ZK3A 2D74A 1IH8A 1WDKA 1G5HA 2BZGA 3MK31 4K9DA 3N5CA 3OECA 2PWBA 2WHRA 2FUNB 4I55A 2A0WA 4WH0A 3L1UA 3QU4A 3TSYA 4Z0NA 3ZK9A 2RC6A 1P1FA 1ZW6A 1SUEA 2PSJA 2XXBA 1NPDA 2Y1GA 4M89A 4ZZ1A 5E1DA 3OCJA 3U31A 7MDHA 4XJSA 1ADJA 1NUQA 3PA8A 3REQA 3BDVA 3AHIA 1QK3A 3TL3A 3G2NA 1CUWA 3MWGA 4O4LA 3CLUD 3IELA 3V2HA 4X54A 3PQVA 4EB6B 3WNDA 1D2RA 1VE7A 1RM3A 1NONA 3DMGA 3GFFA 1UXKA 2P1RA 4RK5A 3V7NA 4BS9A 4E08A 4HPJB 4YRZA 1C41A 1WXFA 2JATA 4HTAA 5AI5A 4EATA 4JGGA 5FPQA 2TMGA 2X15A 2WPNA 2EF1A 2NTEA 1YH3A 1T2UA 1KZGB 4PG5A 1OWNA 1ZUWA 1YS4A 2KW5A 5KYYA 2NYAA 2EZTA 1JN0A 3QELB 3UOAB 4DLAA 3MUOA 4OJKA 4MNTA 3BM5A 3GJ8A 1R00A 3PHHA 4FFNA 1AK1A 1XIVA 4QPPA 2RARA 2YWFA 3HCBA 4XI9A 1HEUA 2CSUA 3IOEA 4LBZA 3WL8A 1KDPA 3DF7A 3I04M 3ZLUA 4A0RA 1I5EA 3A3KA 2RAFA 4FMBB 3BK2A 4P3NA 1PV4A 3E9YA 1BEUB 1M6HA 1B4DA 1MB3A 2B1GA 2RI1A 2XUJA 4W6ZA 2HZ7A 4XUCA 3ZHCA 3EGXB 5FL3A 4IIDA 4BN4A 4DYDA 1W7AA 4O3MA 3U4MA 4E33A 1O7JA 2J67A 2Q5JA 3CLHA 2OR3A 2I6UA 5DNDA 4ZAXA 3TLGB 3PB3A 2X0NA 3JQDA 3P9IA 5AHOA 3KPVA 2RGDA 3ZHRA 3GQBA 2ZUCA 3R7FA 4UEKA 4R41A 1W5EA 2C5LA 3ND7A 3EVEA 4HTFB 1DLIA 4N3NA 3MGCA 3FAKA 1GG9A 2VPWA 3IUNA 3GUYA 1TEZA 4WACA 3IB6A 1KYWA 1CFZA 1S89A 2X8AA 4MUJA 1AGXA 1RPNA 2HF2A 2JGNA 2DFKB 4OQZA 3CH6A 4KO4S 3RRFA 3THSA 1KTIA 2Q3JA 4X8LA 5DNCA 1M2WA 1YV9A 4LY3A 1JF8A 2VAVA 5H70A 3ZCQA 3QX8A 1HE3A 4UMVA 3ZTTA 1MTZA 2H63A 4MLCA 2XT9A 3ZCPA