1U1IA

Myo-inositol phosphate synthase mips from a. fulgidus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol-1-phosphate synthase
publication title Reaching for Mechanistic Consensus Across Life Kingdoms: Structure and Insights into Catalysis of the myo-Inositol-1-phosphate Synthase (mIPS) from Archaeoglobus fulgidus
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 113
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1u1iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u1iA01
4XQ9A 1SBYA 4PG5A 3I4FA 4BMNA 1J0XO 4EJ0A 1D7OA 3DR3A 3E82A 1K6JA 1R0LA 1KETA 3AUAA 4LGVA 2YFQA 4QX6A 2PV7A 3KOUA 4PLPA 3ZU4A 2DC1A 1CQIA 3EUWA 3AI2A 3KBOA 1EK6A 4J4TA 5IDWA 3WIEA 1DJNA 4R68A 3C8MA 1QP8A 4EJMA 2A92A 4FC6A 2AQHA 3RSHA 5A3VA 4TVOA 4BGEA 4C7KA 1BMDA 2EEZA 3H9UA 1KVQA 1R66A 3OQ6A 3RUEA 4HBGA 3HN7A 4JCOA 4XYLA 4RL6A 4FR5A 1S7CA 4PLWA 2XXBA 3AW9A 5T8KA 4I5EA 3UKOA 4NDNE 3VZSA 3WYBA 5A04A 3ZNOA 1FDVA 2NACA 4ZU3A 4CMEC 1ZH8A 3AFMA 1XU9A 1J6UA 4P4NA 2C2YA 3WNQA 9LDBA 5TS3A 1GPDG 1Q0QA 2AQIA 3TL3A 1RM0A 4IIVA 4D41A 4A5OA 2FP4A 5A06A 4HADA 1ORRA 4LCJA 4W4TA 1ISHA 4OH1A 3VPXA 1N7HA 2DT5A 1ADBA 1Q7CA 3RUAA 5F21A 1HLPA 3OSUA 2OOSA 1JDJA 1MLDA 3DZJA 3QP9A 5KVSA 1N8KA 4Z3KA 2IRWA 1ZUD1 3DZIA 3UHAA 4Z0TA 4QO7A 3GRPA 5U9CA 3JQBC 3I4CA 1LI4A 1O94A 4OIMA 1HDRA 5HS4A 3AI3A 4Y8VA 3ADOA 4O0LA 3WS7A 4Y67A 3KXDA 1I0ZA 4EJ6A 1WVGA 2WEKA 5CDTA 3VOSA 1BWSA 4GKBA 1WPQA 1KVUA 4CR7A 2Y1EA 3RU7A 1ZIDA 3B70A 1M66A 3HN2A 3IKVA 3KETA 2PK3A 4PFJA 5L7TA 1ULUA 5JYAA 4NHEA 4QSMA 3GDOA 4IS2A 1E6WA 1PWZA 4FOOA 1X1TA 1Y9AA 3BXXA 3I9KA 4UEOA 5G4KA 2AQ8A 1N92A 5KJCA 5CP8A 2AEMA 3TRIA 1ZFNA 1EDOA 2W4QA 4JQCA 2EKQA 5MGBA 3S1LA 4P4GA 2ZB4A 4ONEA 4CL3A 2BI7A 3DBHA 1PGOA 4UREA 3F5SA 3QRWA 1I3NA 5IJZA 5TX7A 1A71A 4MKRA 5AXCA 2VHVA 1LNQA 1IE3A 2D4AA 1P0FA 2J3JA 2JFHA 4BNKA 3WGHA 1UR5A 2ZB7A 4WJZA 5L4LA 2Z95A 1HDOA 3WG9A 4E0BA 3PQEA 4JJIA 5DOVA 1ZNQO 1F8GA 2J5QA 1OI7A 5IDYA 1LSJA 4DMLA 1OBFO 4YTEA 3ZHXA 3JQBA 4W99A 5EL0A 4HNGA 4UEJA 3GC6A 4Z9FA 4AJJA 4FIZA 4NU5A 3L0DA 4L75A 3OJEA 1QYVA 2FN7A 4YT4A 1A4UA 3HHPA 5DULA 1R12A 2EW2A 1IHYA 2PWZA 1QSGA 4RPKA 5CG2A 4LISA 2WJPA 4J49A 2J8ZA 2V65A 4RF5A 3FHLA 2IYPA 5I7SA 3UOGA 1FDWA 4J7CA 4RZIA 2JHFA 4E6PA 3LT0A 3V1UA 4NFSA 4R9SA 4CMAA 3HQ4O 4I5GA 3AI1A 4UAGA 1E3IA 4J0FA 4QO8A 1M67A 1XU7A 3OJOA 1NPTO 1EFKA 4I1IA 3P5SA 3WOHA 4BO8A 4GSKA 2BLLA 3ZCXA 1B8VA 3E03A 5TSDA 2VNAA 1YJ8A 1MV8A 3UW3A 2AE1A 3R3JA 3INRA 1E7QA 3D4PA 3AOGA 5JSFA 4WUVA 2NUAA 3IL2A 1P3DA 4RQUA 2YYYA 1ID1A 3L6DA 3KYCA 4GMGA 5MDHA 1I24A 2C82A 3GRKA 3DHEA 4OJNA 4E5YA 3SXPA 2EKLA 3OQBA 3KLMX 1Q7BA 1BVUA 1KVTA 2IE0A 2OO5A 4FDAA 3QVOA 4DYVA 3UUWA 3RUDA 1V3VA 4E31A 4NBUA 2P91A 1NHWA 2C7GA 2NADA 1ADFA 4FCCA 2JFFA 3TFOA 2VRCA 2PD6A 2IEBA 4UUPA 1EBUA 2WMDA 3I9LA 3N7UA 4U6QA 2VWQA 1NNUA 3ZWOA 5HTOA 2DVMA 4PN3A 3VPGA 3H9EO 3NJ4A 4YWJA 5A4DA 1JKFA 1B14A 5BSEA 1I33A 3JQ8A 4R3NA 4LRTB 1ZJYA 4FB5A 1U5CA 3OETA 4UUMA 5KKCA 3U5TA 3W8FA 4DBVO 3WJAA 3FNFA 5I7EA 1SPXA 3BMCB 4OMUA 5JO0A 4MVJF 1T25A 3PDUA 4OOFA 1DAPA 2OHXA 3ZU3A 5B4TA 2C7VA 1MG0A 3JTMA 4JBIA 3IOYA 1DIRA 2PKQP 3VAZA 3GGOA 4NBWA 2HQ1A 2Q3EA 1W0CA 1LU9A 4EZBA 5L4SA 1H2BA 1YQXA 5JS6A 5EPOA 4OKIA 1I10A 3ZV4A 1NWHA 3OIFA 1B8UA 2AHRA 3U0BA 5GZ1A 4DLAA 1ZVMA 2HMTA 7ADHA 3WBBA 1EZ4A 4BO2A 4ROSA 3PZRA 2DBRA 3BMQB 3ZWCA 4R1SA 2RAFA 4HFNA 3PRJA 5BT9A 1MUUA 3AOEC 4TRRA 1E6EA 2V6GA 2GZ2A 1ZMTA 2VNSA 2TMDA 3OECA 3O38A 3WGOA 3DZBA 5GY7A 2UYYA 2C59A 1EVZA 3VH4A 3MOIA 3B1FA 1Q2XA 1WXDA 3JYOA 2NTNA 2WWRA 5JE8A 5KJEA 3B1KA 4NI5A 1QRRA 3IUSA 3RKUA 1DC3A 3QQPA 4J6FA 5F5LA 3I6QA 1WDLA 5DBGA 5G0TA 4CQLB 2JD1A 1JLLA 2DFVA 3L9XA 3QWIA 4RJTA 1M76A 1PS8A 2I3AA 2VHZA 2ZQZA 5T5QA 2Z1MA 4IQGA 4K6FA 2YHIB 1SEVA 1U2GA 4M8SA 5ILOA 3DZHA 2GZ1A 5A1TA 1UXKA 4FD3A 3P2YA 2C0CA 3ZDFA 4ALMA 3RFTA 2HKIA 2WTBA 3GMDA 1LXCA 3D3WB 1KY5A 3FNHA 4C4OA 5JCJA 1F06A 1HSZA 4HFMA 4BNTA 4MVJP 3W6UA 4HUJA 4MINA 4R51A 4GH5A 4N5MA 2PA3A 3DAPA 1Q0HA 4I9HA 2E49A 4OKNA 1T24A 1WDMA 4X54A 1LBEA 4BO4A 1DRVA 4FW8A 1EBFA 4RVHA 3L77A 1MX3A 3ZW9A 1JAXA 5IDQA 4HFJA 3I6IA 5JMPA 4LK3A 3DZFA 3RI3A 3CH6A 2CVOA 3V2UA 5JCXA 3VKUA 2HMSA 3ETGA 3JD4A 2E4AA 3NEPX 5LDHA 2QQ5A 5IZ4A 4TKLA 1HZZA 1PX0A 1D3AA 3JQ7A 4NR0A 5DBIA 1U7TA 1T26A 4Z0PA 1U9JA 4CMBA 4LSWA 2OXIA 2BKAA 4WCFB 4YXFA 3BYZA 4BMSA 5TQVA 4BL5A 2YJZA 4YAIA 3BA1A 1KYQA 1V3TA 4PVDA 2O3TA 4WPGA 1XDWA 4ITUA 4YAKA 3CINA 3O8QB 4PIVA 4IMRA 3JD1A 1ENZA 2EHDA 4INAA 2FPGA 2WE7A 3ANNA 3GVHA 3OJ0A 5F5NA 4JXKA 5DF1A 5A9SA 2BFPA 3F5QA 1OMOA 1DXYA 2JAHA 4Q9NA 2NQTA 1GYRA 2JD2A 1PGJA 3I9JA 4XR4A 4ALNA 3S2GA 1GUYA 2P5UA 1BG6A 1EE9A 4JX8A 4OSOA 3LF2A 3UVEA 3G49A 1GPJA 1LSSA 3FI9A 2BI8A 3A9WA 3D5QA 4NZ9A 5T6BA 4YAGA 2G17A 2ZIZA 2DPGA 2O3RA 3IC5A 2V6MA 4DC1A 3DQPA 4D3SA 2AA3A 1AXEA 3I23A 3FWZA 4CUKA 1U28A 3UGKA 5LCXA 2VWHA 2ZYAA 1PL7A 5IAAA 3SLKA 2WSBA 4MDHA 3GUCA 3I83A 2EW8A 3QJ5A 4R4JA 4BNMA 4XYEA 1MGOA 2I76A 3AY3A 1U3WA 3F9IA 1N2SA 5JDCC 2V6FA 4YBZA 4AICA 1UZNA 3DMTA 4LN1A 2CMDA 4WKGA 5G2OA 1VC2A 3DONA 3LSYA 4CLDA 3T4EA 1XELA 3PXXA 1UJMA 4TVBA 4I5DA 3D0OA 1HE2A 3O4RA 3BIOA 3ULKA 4M54A 4NBTA 1GZ4A 3H5RA 3I5MA 4BS9A 1IZ0A 1BW9A 1QG6A 3N74A 3Q6IA 3RIHA 2AQKA 1XGKA 1AHHA 1XG5A 1EMDA 1T1SA 2BHLA 1MC4A 1NWCA 1BDBA 2FMUA 3ZNPA 3R3SA 4ZQFA 1HZJA 2YV3A 1ZEMA 1P74A 2H5LA 4IMPA 1IULA 3V5NA 2Y0CA 2UAGA 1T2CA 4AJIA 1PJQA 5L7WA 4RCVA 1XQ1A 1UH5A 2H63A 1N9GB 4O5OA 1C1XA 3JCZA 3RROA 4F3YA 3FBGA 4BO5A 5JDCA 1HXHA 3E9MA 1DJQA 5KJ6A 5LC1A 3EAGA 4B7UA 3WXBA 2ZTUA 1GUZA 1DFIA 1PQWA 3W4JA 3KYBA 4CV3A 3DAGA 5K9ZA 4N7RA 2XPCA 3D3EA 3EMKA 3GAZA 2FRDA 4XRRA 1YQGA 4IPTA 4W6ZA 3UCXA 3VTZA 2O3SA 3GPIA 4FFNA 2YQ5A 4MJLA 5EINA 3TZHA 3FD8A 4ZHSA 1Z73A 3OP4A 1AE1A 1J5PA 3AWDA 2B4RO 1O95A 4CM3A 4UVHA 4K28A 1GZ3A 3TQHA 5KCZA 3HSKA 4XB1A 3WMXA 1GD1O 5ITVA 1B3RA 4JBHA 4U6SA 4R41A 3E1KA 3U49A 4IIUA 4RQTA 2FSSA 4YVFA 3PFFA 1B0AA 2GYYA 1YKFA 3ANMA 4GBJA 3TF5A 1YBVA 4H15A 2V6BA 3O03A 5ICMA 2I65A 4RPJA 4HKTA 3AUUA 5KVQA 4I9UA 1LC3A 3RBXA 3TPCA 4P8RA 2GR9A 4J1SA 3BTUA 1BXGB 4J91A 1GL3A 2AEFA 1V0JA 3KLPX 4PZCA 4D46A 4CM9A 4DGSA 1GYPA 3JQAA 3W4IA 5IDXA 3HDQA 3FTNA 2R00A 3AY7A 3Q0EA 2IODA 1R37A 4BQRA 3EZYA 3K96A 4YA6A 3WR5A 4BNYA 4CM4A 4PG7A 3ABIA 4WGGA 2E6UX 4GX2A 4NH4A 4YRBA 2BELA 3QSGA 4WLFA 1E1NA 3L07A 4QUKA 3NX4A 1E7WA 2Z1NA 4CLOA 1ZMOA 2ZCVA 4YQYA 3GLQA 4TMFA 3S55A 4GGOA 1BXZA 3RAJA 5H83A 3I3OA 4TQGA 2Y05A 1Q1NA 4D3DA 1PL6A 4E5KA 4TZTA 3PHJA 1JKJA 1VL8A 2UV8A 4FJ0A 5G0SA 4EYEA 1VI2A 1M6HA 5THKA 3WQRA 3WLEA 1E3WB 4GWGA 5IXYA 1WMBA 1QYCA 2J5KA 1KY4A 4EITA 4BIIA 2ZTMA 4IQ0A 3RUCA 1DDOA 4J4BA 4DTIA 1E5QA 4NJMB 3OICA 1L1FA 4GPD1 1AUPA 4WLEA 1Y6JA 4J43A 3GNSA 4EGFA 1S6YA 4UVDA 2C54A 4MVJH 1HSOA 4IZHA 3JD0A 1NXQA 4YAJA 4ZRNA 3S2FA 4FFPA 3ZNQA 4DLLA 1J4AA 4GWKA 4DWVA 3RC9A 4L9RA 3EHEA 3H9QA 2O7QA 1HE5A 3O26A 5JC8A 5KKAA 2NTVA 5TT1A 4BGIA 1X7GA 5J23A 3RASA 2GERA 3SVTA 4O6VA 3QIVA 1YJQA 1YGYA 3L9WA 4NIMA 3WTCA 4ZVVA 4L4SA 4BO6A 1DPGA 1YQDA 5DDIP 3JSAA 3H65A 3IUPA 4BNLA 3PJFA 3WFIA 1NBOA 2A35A 1Y5MA 1PJ4A 1KC1A 3HE3A 1H93A 4IDBA 2GUGA 4WCDA 1NFRA 1UXJA 3WYCA 1SZJG 2VRBA 4IBOA 3DWFA 3ZWAA 3LC2O 2B83A 2BGMA 1G0NA 3QVWA 4MKZA 3K2BA 2GSDA 5EIOA 3PIDA 5DP2A 1LTHR 1H6CA 1N5DA 3LZ6A 2FOIA 1MXFA 3FPCA 4LVUA 3A1NA 3JD3A 3BTSA 4RPLA 1W4ZA 3GAFA 3BMQA 1NYTA 4O59O 3NKLA 2HMUA 3OEWA 3GVIA 2O4UX 4R16A 1AGNA 3RWBA 4F45A 5C5IA 4Y6RA 3ZWBA 1SO8A 3ASUA 4E4YA 2W2LA 4MVJI 3GHYA 3K5PA 1NQOA 1HKUA 4DVJA 3I1JA 1M2WA 2PKQO 2P5YA 1V9LA 1D1SA 3HB4X 3GGGA 4BO3A 1NM5A 3ICCA 3MJEA 5TGDA 1QLHA 5JC1A 5L4NA 1GADO 3AUTA 4XYGA 3KVOA 1K0UA 2X4GA 3IKTA 2CZCA 4DQVA 4CQLA 2Y93A 4YT2A 3GZNB 1HDXA 2G76A 2O7SA 3QV1A 4QXMA 2PZKA 3IMFA 4I9NA 4XYMA 2PH3A 4AJPA 2AG8A 3EVTA 4B8WA 3OJLA 1ZK2A 5TIIA 3F47A 5HWSA 1HF3A 4R1TA 3MZ0A 5BNFA 3DBLB 3JQCA 1RYDA 2C5AA 3P2OA 1YBAA 4U0KA 4ZQGA 5H81A 3Q11A 1JA9A 1XIVA 5JDIC 3ZWVA 3D3WA 1Y8QB 3KEQA 1EVJA 1HDYA 2BF7A 3PEFA 4CMIA 1K5HA 1Z74A 5T73A 2PKRA 2V7PA 4PZDA 3ZWPA 4N5LA 1SNYA 2B5WA 1ZBQA 3U4HA 3FSRA 1ENOA 1DSSG 3MCVA 1EEHA 1OC2A 2QG4A 4OAQA 1DC5A 3D4NA 3OFSA 2H9IA 3GQVA 4BNXA 1H6DA 4D42A 4E5PA 2DAPA 3PPIA 4EEZA 4PG8A 1ZSYA 4BO9A 1ML3A 4IJWA 1QKIA 1LQTA 2C29D 4ZJUA 4HP8A 1MFPA 3PQFA 3LC7O 3AJRA 3C85A 4R54A 2FWMX 4UULA 4XR9A 5COQA 3PDJA 2Q2WA 5C7OO 1FXSA 4CUJA 3CSDA 3VH1A 3EGOA 3D7LA 1OAAA 3T7CA 1YL7A 2D8AA 1E77A 1Z75A 1FF9A 5M6DA 3I9NA 4WCFA 5EQFA 4YDRA 1CIVA 3LK7A 1WNTA 1GAEO 4XQGA 4ZQEA 5AYVA 4OL9A 4XGKA 1SAYA 1AN9A 4IGEA 3KV3O 1U3VA 4IJUA 4H3VA 1TEHA 2B37A 2VWPA 3JQEA 4NBRA 5JDIA 2YDXA 5KVVA 4PG4A 1NPDA 4B4UA 3DHNA 1ZK4A 1TB4A 1ZK3A 1KEUA 1B2LA 4EUHA 1KC3A 3QLJA 4J4HA 2ZB3A 3LF1A 3I9OA 4B4OA 2J3IA 4ZRMA 2EIHA 3E5MA 4IQ8A 4RPHA 4QFDA 2A4KA 1YOVB 3C1TA 3FCOA 3KYDB 4FS3A 2JKVA 1G1AA 3GNTA 4JJGA 4M55A 3ZV5A 4J1NA 3MJ4A 4NK5A 3IJRA 1CRWG 4KUGA 4Q3CA 3ITKA 4YCAA 1WZEA 1YBMA 3PTZA 4WEOA 1T2AA 1TT5B 1UP4A 1C14A 3M1LA 1GQ2A 3P7MA 5L3ZA 2E48A 2X23A 4CLXA 1E7SA 1EFLA 1Z82A 2AMFA 3MEQA 3PYXA 4FGWA 3KUXA 3HDYA 2BMAA 3BHIA 3GR6A 3PWKA 3LC1O 1MFZA 3CZMA 4II2A 1G6KA 4HV4A 2Q1SA 3QE3A 1EUZA 3BHJA 3V1TC 1IHXA 4PLTA 1SCUA 1HYGA 3RFVA 1VL6A 3PGXA 4NG5A 2NU7A 3GZ4A 3BMNB 4PG6A 1QR6A 3K6JA 3Q1LA 1HE3A 1PJSA 4GVXA 1LLUA 2LDXA 3WX0A 1NHGA 2PNFA 4MP6A 5EERA 3KM0A 2J3KA 2X5KO 5BNIA 4YJDA 3VVBA 1QV7A 1ZEJA 2P68A 1EVIA 1X13A 3LLVA 1K2WA 1CETA 1UXHA 2NVWA 3GA0A 1TVEA 3DFUA 1XYGA 1TXGA 3AK4A 5L51A 4Y6PA 3UF0A 3EDMA 5IG2A 4MP3A 5JAZA 2P9GA 5I7FA 3BTOA 3T4XA 4TRMA 2HRBA 3ZU5A 3G1TA 1R4MB 5HRUA 2PH5A 4ALIA 4B3JA 2X5JO 4OQZA 2DBVO 3RU9A 3CIFA 4IDGA 3OJFA 1E3LA 1LRJA 4Q3AA 2W2KB 2PR2A 1U7HA 4B79A 1A4IA 1KERA 4RLHA 5FWNA 1FJHA 1IL0A 4XEHA 2EGHA 2VYND 1E1MA 3I9MA 3TOZA 4PLFA 1BTOA 4MIYA 4CMHA 4Q3DA 5EESA 1MXHA 1PS9A 4YJFB 1U3UA 2HJSA 3DTYA 4L4RA 2G0TA 3RC2A 1P44A 1UDAA 2D5AA 4OHUA 1XKQA 5L53A 3LU1A 3HNPA 4PRKA 3PHGA 1MB4A 1W6UA 1VSVA 1Y1PA 2UUPA 3NDIA 3PP8A 2Y1OA 4I08A 5IFLA 5B4VA 1YXMA 2DUUA 3QW2A 2H1SA 3KHUA 3IJPA 3PQDA 4MVJE 4PVCA 3AFNA 3ZNNA 5F1OA 5IXSA 2Q1WA 2ZKLA 2EF1A 4Y98A 3B6ZA 4KTTE 4NJOA 2E37A 4B4WA 1CERA 1NR7A 3IDSA 2XF8A 1SB8A 2HK8A 4R3WA 3D64A 3RBZA 4E21A 1B3BA 1ZCJA 4IJKA 1DC6A 1E1LA 4GVLA 4LMRA 4GKVA 3GH3A 5G0VA 3NTOA 1HEUA 3DOJA 3Q9NA 4WK6A 4WLUA 4GQAA 4XKJA 4B4VA 3FN4A 4U0JA 1RM5A 3FNGA 4BQPA 4L0QA 3SX2A 2HRZA 3CUKA 3F1LA 1TT7A 3MJCA 4QECA 5F3RA 4ID9A 4MKXA 1LEHA 3KSDO 4OXYA 3VPSA 1P31A 2VOEA 1XR3A 4NMHA 4PLYA 2NU9A 3CEAA 1HL3A 3K2EA 1ONNA 3HB5X 2BRUA 1O5IA 4WEQA 3V2GA 4CLEA 4M89A 2ET6A 3EZLA 3M6IA 2EG9A 1PGPA 1VLLA 1I2BA 1GZ6A 1DFHA 4CLRA 1FDUA 1ZSVA 2HDHA 3QWAA 4GMFA 3NYWA 1ADGA 1UP7A 4N54A 2YQ4A 4E32A 1U8FO 3KRTA 4DPKA 3AU9A 1DC4A 4K1LA 4GSLA 3G17A 3PLNA 5COAA 3K8ZA 1XQ6A 2D5CA 3PLRA 3ETDA 4A10A 4NJMA 4BGUA 5JY1A 3OQ1A 4NBVA 1P45A 5AQ1A 2LDBA 1ONOA 1VL0A 2JHGA 2HMVA 3ONFA 2HUNA 2J6IA 3WFJA 4NNJA 4FPXA 2DFDA 2JCVA 1Y8RA 5TT0A 1O89A 5CG1A 3OBBA 1LC0A 3K9QO 3A14A 3ETEA 3LT4A 1UP6A 4IDAA 5IN4A 3VVCA 3UICA 1PJ2A 3F4BA 2JL1A 2X58A 3V8BA 4HY3A 3ZWXA 5F1KA 2ZCUA 1DIBA 4KDEA 4B3HA 1BHSA 2AXQA 2BGKA 2VZ0A 1VE9A 2CDCA 3JD2A 4YJHB 3ZV3A 3WGTA 2IYOA 3X2EA 1I32A 5B12A 2OL4A 2QRKA 2EP7A 1Q0LA 1UXIA 3OM9A 4CODB 4M87A 3DMTC 1EK5A 3U4IA 2GF2A 2HJRA 1V3UA 2Q45A 4Y6SA 3SJUA 1OZAA 4QQRA 4TZKA 3H8VA 4FOSA 4PRLA 2X1HA 1P77A 4BB6A 3DOCA 3AM5A 4W7IA 4B8ZA 2BFOA 4YJGB 2X0JA 5KNLA 2HK7A 4PZEA 1SC6A 4U7WA 3I52A 3TZ6A 3ADPA 2VUSA 1VJTA 4FFLA 7MDHA 1UUFA 1GR0A 2J3HA 4XQEA 4FFRA 3OF2A 1H9AA 5CHEA 1ZXLA 1E7YA 2FZEA 4LW8A 5JO9A 3QA9A 5JFOA 1QYWA 1ONPA 2X0IA 4PLCA 4CQMD 2VCYA 2B4QA 3SC4A 3C7DB 5TJ9A 3QWFA 3CPSA 2OMEA 2QHXA 4LRSB 1ZW1A 4YR9A 3JQGB 1KS9A 4FFOA 1A9ZA 3L4BC 2B0JA 4K9DA 1NVGA 1C0LA 4HFRA 1LLDA 3AU8A 4BNHA 1P1KA 2CDBA 4G2NA 4RVUA 1LSOA 1B7GO 1JKIA 2IDZA 3GZNA 2P4QA 4LCEA 1AHIA 3KO8A 3ON5A 2I67A 4HWKA 2NVUB 1QORA 2Q4BA 3N58A 1RPNA 4Q3EA 4YACA 4ND3A 4U5QA 1GY8A 2A94A 3LT2A 2VUUA 4XZ3A 1B16A 3OA0A 3VH2A 2OFPA 3GT0A 5C3MA 2YV1A 4J3FA 4WASA 5C7IO 2EJVA 4BKUA 4CM9D 3JQAD 3U62A 3BAZA 2Q1UA 3UAGA 4A0SA 1E0DA 3MWDB 3FRJA 4BMVA 4KP7A 3R0IA 6LDHA 4EBFA 2PZJA 4XWYA 2Y1DA 1HDZA 3S8MA 1R15A 1WP4A 2VHXA 2X7HA 2ZJ1A 1MP0A 3Q2IA 4DIBA 1DIGA 1RKXA 5AOVA 1PQUA 3DO5A 4ZQHA 1YL6A 4P22A 1KOLA 1C1DB 1M6WA 4WNIA 1RYEA 3L4BA 4FBGA 5BSHA 4AFNA 3NT2A 1GU7A 3ST7A 1VPDA 4NFYA 4GX0A 2FY8A 4CR6A 5KJ1A 4XDZA 5JAQA 3RD5A 4AJKA 2X86A 4R9RA 3GN1A 5A3JA 4P38A 2R00C 1WZIA 5TJHA 3ZHYA 1NX6A 1N1EA 5U4QA 1GQYA 4RF2A 1UDBA 2VT3A 1LDYA 2I5PO 5ER6A 2WD7B 1DFGA 2PZMA 1C0PA 3RUHA 3G1UA 1SEPA 2D0IA 3ANLA 1A7KA 2I3GA 4F46A 1PZEA 1P33A 4AJLA 1D4FA 4Q3NA 1BDMA 1E92A 3JQ9C 2NQ8A 1E3SA 2O4CA 4FJ2A 5EJ2A 1LRKA 1T4BA 4XGNA 4RDHA 1V8BA 3ROPA 4RLSA 2VHWA 5A03A 3NGLA 1RJWA 4CMJA 3U4DA 4E2WA 3ZHZA 2Q4EA 1HT0A 1U3TA 4MIOA 1QYXA 1CYDA 1YOVA 2CDAA 1QLJA 1YO6A 4E2XA 3F3SA 2HCTA 4FFMA 3WWZA 2G5CA 3IS3A 3UFXA 4TRNA 2C07A 3DBRB 3LYLA 3FBTA 1EQUA 5HA5A 4ALLA 4Z9YA 3CMMA 2X9NA 3H9GA 3WWYA 3H5NA 2X9VA 3LQFA 4J0EA 1PZFA 3AM3A 4OQYA 3H7AA 3STHA 4DUPA 4O63O 1ZK1A 5JW6A 3DL2A 3WGGA 1BGVA 3T7EA 1NVMB 2X0NA 1LUAA 1XHLA 1B8PA 4KDFA 1XEAA 5I8ZA 1MC5A 3BMOB 2GDZA 3ONEA 1T2FA 3JQ9A 4XB2A 1X7HA 3F1KA 1E3JA 4JNKA 4TRJA 3WGIA 4ZD6A 4GL4A 2GN9A 5G4LA 4A2CA 1CF2O 1VRWA 2PTGA 3COSA 2AEJA 2OUIA 1A27A 5JLAA 1IB6A 5BSFA 1T1RA 4H16A 4XGIA 1UZMA 2HU2A 1T4DA 4IM7A 3WMWA 3TN7A 4NK4A 2I66A 2HO5A 5KTKA 3GEDA 4RO0A 3RC1A 4W9NA 2PFGA 1NQAO 4KMSA 3DOOA 4BNVA 2GASA 3U3XA 4DL9A 4D79A 3C7CB 3NDRA 3TFQA 1LQUA 4BNWA 1UZLA 3EY4A 1Z7EA 1CQJA 4IGFA 4CM6A 3GVPA 2VWGA 3KZVA 1BRMA 3H4VA 3CMCO 4E12A 1QV6A 3NRCA 4Q3BA 3C24A 3RBVA 1JWBB 2O3UA 3MJSA 2WD8A 4E30A 3QHAA 4RVDA 1HETA 2IXBA 3PWZA 4BNZA 4N5NA 4J90A 3BMCA 5T64A 5KIAA 1ZO8A 1J49A 3TWOA 4E5NA 1F12A 2EERA 1PR9A 2QZZA 2W2KA 4XDYA 3TZKA 1H2HA 1KEVA 4XJTA 2EV9A 5ILGA 1JW9B 1ZZEA 4HXYA 2UVDA 4XA8A 5TF4A 2DU8A 2DBQA 2VYVA 4FJ1A 4DPMA 3ZW8A 4O1MA 3Q2KA 1CJCA 4J16A 3LLSA 2J5RA 1SB9A 4GLOA 2EP5A 3GUYA 3NJ8A 4CM8B 1X0XA 2NNLD 1WLYA 3D1LA 5FI3A 5L7YA 3ASVA 2JAPA 4W82A 4E2YA 3TJRA 3OA2A 3DAFA 1R0SA 5AXBA 3GVCA 2QZ9A 1NAIA 3IP1A 4DIFA 2Q22A 1NVTA 2X22A 2RH8A 2VN8A 3E6AA 3ZHBA 5A9SB 3RFXA 1E7MA 3E5RA 2Y67A 3ROQA 1Q7GA 1C3VA 3AM4A 3GHHA 4ZGWA 4JROA 1U1IA 2PGLA 2SCUA 2VUTA 5FFFA 2RBEA 5A5EA 3AY6A 3HFGA 2HSDA 3A4VA 3WDSA 3WIDA 1GV1A 5KVCA 4E33A 5C7LO 3FWNA 3GG2A 3WJ7A 1U2DA 4N18A 4LVCA 3SBOA 1IZ9A 1JQBA 1X1EA 2W90A 3AUSA 1GDHA 3QVSA 1GTMA 1QXSA 3FNEA 4XX0A 3W4KA 5HM8A 2PD3A 5JBIA 2PGDA 3S2IA 1O9BA 3SC6A 4I5FA 4YYZA 1X0VA 3GDFA 4B7XA 1XA0A 2DM6A 2YHIA 2ZTLA 4TWRA 2ZJ0A 2AE2A 1JTVA 3RJ9A 1DHTA 3CZRA 4WCFC 1HDGO 4KWHA 4CV2A 4BO7A 5C37A 8LDHA 1DLJA 3EK2A 2GCGA 2NVBA 5FYDA 1LDGA 2GPTA 3PHHA 4ILKA 2CF6A 4JP2A 2RHCA 5JNLA 3W1VA 4ND1A 1ARZA 5GMOA 1EUCA 1YRLA 1DOHA 1NAHA 1P1RA 4CLHA 4D43A 4KQWA 3HG7A 1PTJA 1PJTA 4L73A 1YH3A 2QRJA 4MVJA 1L7EA 4RDIA 5GZ3A 1ISJA 2YV2A 1C0IA 3R1IA 5CDYA 1BW9B 3PJDA 1RM4A 1ISIA 4G81A 2B36A 5DCUA 4AJHA 5JMWA 4C7JA 5BSGA 2NSDA 4E5MA 3UXYA 4IXTA 1ZK0A 2A9FA 3HWRA 3PK0A 1N1GA 1YDEA 3RUFA 2O3JA 4YB8A 4K26A 4RPGA 4BNJA 4ALJA 5FEUA 2OP0A 3E9NA 3MJTA 1MA0A 5A9RA 3JYLA 4YT5A 4CM5A 2EJWA 1WAMA 1DHRA 4ND4A 3KB6A 3GK3A 2XAAA 4RVSA 4YEDA 3VDRA 3MTGA 4Z3DA 1LX6A 4MO2A 1EDZA 2QIOA 2WYVA 1SOWA 4TKMA 1C1XB 1UAGA 4UUNA 5L95A 2Y0EA 2VRCD 1AXGA 1IPEA 1E7RA 1NFQA 4YJHA 3PHIA 2IXAA 4A7PA 2AW5A 3ZZNA 4CMEA 5I9LA 2X6TA 4IY1A 3O8QA 4I8XA 3IIEA 5K0ZA 1LSUA 1Z7BA 1GQQA 2YUTA 4XYBA 3ENKA 4G65A 2QRLA 4CQMB 3GY0A 3QVXA 4M1QA 1PR3A 3GPDG 1KBZA 3PFWO 1I36A 1NASA 1NQTA 4IJVA 3DFZA 2YHUA 4YJGA 4GX1A 2NWQA 2PLAA 3JV7A 1F0YA 1OC4A 3CKYA 4OXKA 5GZ6A 1PWXA 5CEEA 2BFAA 2JD0A 3C1AA 1QMGA 4ND5A 1VSUA 4CV1A 1LDBA 3C1OA 4WLVA 1DRUA 3TL2A 5DCWA 8ADHA 2JFGA 2YDYA 2IZ1A 4P4LA 2B69A 3W8DA 4BNNA 3WGYA 1B15A 4AG3A 1IUKA 4QEDA 4RGBA 1KVRA 3E18A 3IQDB 1TI7A 2GNAA 3OMLA 1XLTA 2VHYA 4EDFA 4PLZA 4Z9XA 1ULSA 3WQQA 2DTDA 3CXRA 4AVYA 1P0CA 3FR8A 4UUOA 3W8EA 3JYQA 3JQGA 4GGPA 1I2ZA 2FR8A 3ENNA 4R1UA 1YDWA 4BVAA 4EI2A 3JQAB 2Q46A 2NU8A 5ES3A 2JCYA 5DZSA 2POQX 1PGNA 5A05A 2DPHA 3NT4A 2NM0A 1H0KA 4CM4B 5ICSA 1PJ3A 1GCOA 1NQ5A 1XWFA 1R4NB 4ZQBA 2O23A 3GVXA 4QFCA 1K89A 1YB1A 1PL8A 4CMKA 3WQSB 1YL5A 2EGGA 4MP8A 3U9LA 1X14A 2NVUA 4DMMA 1ZXBA 4CLOB 3EVNA 2CNBA 1JU9A 4JJFA 4M49A 4TROA 2ILTA 5KWEA 1D1TA 2DKNA 2YZ7A 1HWYA 1LDMA 4MVJG 1P1JA 4OYRA 2JJYA 3ZWMA 2RIRA 1VJ0A 4DIOA 2I99A 2P9EA 4S3MA 5DT9A 4WOJA 3ZH2A 3DZGA 3EYWA 1BVRA 2B4TO 3NT5A 4ZN6A 5CAEA 3GNQA 2B5VA 4EUFA 2FR1A 1I3MA 4YAEA 2O2YA 3ONDA 3KTDA 5L45A 1H6BA 5L9AA 5HBRA 2FR0A 4NPCA 1WDKA 5HS6A 1H5QA 2TMGA 5G0WA 5CDGA 5JCJD 4D3FA 1GV0A 3K30A 1N9GA 5LDGA 1C1DA 1IPFA 4B7CA 4F6LA 3PWSA 2GZ3A 4JIGA 2ZB8A 1GYQA 3C3XA 4PLVA 3LT1A 4BO1A 2QYTA 4J2HA 3PJGA 2HLPA 3D5TA 1I8TA 1CWUA 3ITDA 5DN9A 2DLDA 5TRTA 3TDKA 1O0SA 4OXNA 5L40A 4QT0A 3WSVA 3V2HA 4IDFA 1I3KA 2WD7A 1T2DA 3G79A 1V35A 2ZYGA 4YRAA 2BH9A 2QYSA 4TSKA 4JGBA 3HJAA 1XSEA 2W98A 3IAHA 5ENVA 1DBVO 1R16A 3U4CA 1PJBA 2WE8A 4OM8A 4BNIA 3H3JA 4WNCA 1A5ZA 4A27A 2YY7A 1P9LA 5IZCC 1SMKA 4XCVA 1FK8A 5I9MA 2VT2A 4QTZA 3X2FA 1LDEA 2D3TA 1I30A 3FTPA 2VTEA 1Z6ZA 1LJ8A 1M75A 4E3ZA 1DRWA 3E48A 2Q1TA 4YPOA 3GG9A 1X7DA 3PHLA 5DNAA 3KSZO 1VM6A 3INTA 4DBZA 2JCXA 4WE3A 4RZHA 3PIIA 1IYZA 3UN1A 4BKQA 4CJXA 5EN4A 3DBRA 2Y68A 4HX5A 1PS0A 2Y1FA 1BXGA 4XJSA 4ALKA 1W73A 3KSUA 2W8ZA 1PZHA 3H5AA 5CDSA 4CM1A 4MIEA 4NQZA 4EEXA 3INGA 4GX5A 1NR1A 3B1JA 2FPPA 4F6CA 4BNFA 2VZ8A 3QY9A 1A9YA 2X5OA 1VKOA 1DLIA 4HNHA 3E9QA 3WB9A 3GF4A 5COBA 1U8XX 2HAEA 3VZRA 2VTDA 4BNGA 4A26A 3JYNA 4RF4A 4DQXA 3PGJA 1GFSA 2WDZA 5A5FA 2DQ4A 1U4SA 4PCVA 4CMGA 3DBVO 3BMOA 5B4UA 4XD2A 2OP1A 1E6UA 1PSDA 4UVGA 3ZWWA 3S2EA 5K6AC 5IZCA 2C2XA 5BNTA 2NV6A 3WYEA 4DLBA 5TLSA 1T2EA 3MTJA 4IINA 1LLQA 3EC7A 4D45A 3HUDA 5AXDA 5BR7A 3DC2A 1E3WA 4XRGA 2BFMA 2GN4A 5B1YA 3NTQA 2FPIA 3SEFA 1OOEA 5H82A 1IY8A 2BGLA 1HYHA 2GO1A 3OIGA 3DB2A 5DP1A 4KOAA 4S1VA 3L4SO 3PYMA 2ZYDA 3GEMA 3RJ5A 3K31A 1WWKA 1K6XA 4CMIB 3AOEA 2ZATA 3H9JA 5BQFA 1PQPA 5EQDA 5B37A 4MOWA 1WW8A 4L76A 2VYNA 3P19A 1DIAA 1YWGO 4UEKA 2O2SA 1QYDA 2VZ9A 4UVEA 1NTOA 2P2SA 1YE3A 3HDHA 1E1KA 4D7AA 3VPFA 5ER9A 1ZKMA 4PGFA 3H2SA 4R5HA 3V1YA 4L8VA 4LMPA 5U1PA 5JYFA 1RM3A 4RF3A 1H9BA 4BKPA 2O3QA 3ZV6A 1F17A 4KWIA 3VHRA 2PZLA 5FF9A 4D44A 3PZBA 4NU6A 5IF3A 5G4KB 4JK3A 1E5LA 4CM7A 1HE4A 3WICA 3K73O 4EW6A 3RVDA 1Y7TA 5K6AA 3G0OA 3ZI0A 2AG5A 1PIWA 3KEOA 4H7PA 3BTVA 3SJ7A 2H6EA 1I5RA 3DBHB 3MOGA 1FMCA 4CM8A 3L6OO 4BUCA 3MWEB 2O48X 3QVTA 3PVZA 1TA4A 5TNXA 3DHYA 2OBNA 5THQA 3FF4A 2IZZA 3TSCA 1P1IA 1YONA 4BKRA 4ESOA 3NUGA 1KEWA 1IOLA 1H6AA 1V6AA 3VZPA 3VDQA 4L4XA 1A72A 2CY0A 1PEDA 1P1FA 3O9ZA 5JY6A 5I8WA 3OEYA 3VZQA 3ZWYA 3DXFA 5FI5A 1UDCA 3VH3A 3PYLA 2Z5LA 2GN8A 2Q49A 3EW7A 1JAYA 3E8XA 2QX7A 4DPLA 4OGWA 1UAYA 5I9NA 5CPFA 5J9GA 5JYEA 1DO8A 1KIFA 1K6IA 3CE6A 3DDNA 4DREA 4J1QA 1HYEA 1RWBA 1PZGA 4JN6B 2F1KA 3TNLA 2OORA 3UCEA 1LA2A 4U8GA 2QW8A 4EUEA 3CTMA 4BNUA 1JWAB 2B35A 3GMSA 4MVJM 4BV9A 2CUKA 4GLLA 1C0KA 3JQDA 1PGQA 1GEGA 4IS3A 2RH4A 4DC0A 2WYUA 3M2TA 1F14A 4IXWA 4Z6KA 5CEFA 2NU6A 1L7DA 3BZUA 5JAIA 2OBYA 1VKNA 1KVSA 4B3IA 1TLTA 3Q9UA 5ENDA 2VOJA 1HTBA 3DBLA 2P9CA 4ZICA 2EKPA 2Q2VA 2FHSA 3WBFA 1HDCA 4W7HA 3D4OA 3ZGYA 4Y9DA 3JYPA 2YFHA 1EUDA 1X15A 1ISMA 4AJEA 1Y8QA 3SLGA 5CFZA 2PD4A 2G82A 2UDPA 3GN2A 3KYCB 4FSHA 4AJOA 4E2ZA 4LSMA 1XCBA 4K6CA 3ZU2A 2CD9A 2O50A 5DBFA 4PLGA 3H2ZA 4L74A 4CUZA 1HRDA 4Z0HO 5T67A 4BO0A 3RQSA 3MJVA 4JP3A 4KZPA 2OZPA 3Q3CA 4II3A 2YW9A 3G3EA 5IN5A 4YT8A 4D0RA 2DUWA 3NV9A 3HDJA 4J7XA 2EXXA 3LVFO 3IP3A 4GAEA 1NPYA 4J1TA 4ND2A 2X8LA 3JQ8B 3QWBA 1WMAA 2WM3A 3VKVA 1OFGA 1FDSA 2F00A 2CFCA 5G0UA 5KOIA 2E82A 1LLCA 1ENYA 9LDTA 2X9GA 5DCYA 2FZWA 3RUIA 5CEJA 4BKOA 5JXWA 1Y9EA 3R6DA 3W6ZA 1PJLA 1SOVA 2C20A 3ORFA 3VC7A 4AJ2A 2CSUA 4J2OA 1EQ2A 4BOYA 3WLFA 4A03A 3B20A 5F1PA 1NFFA 5A02A 4WLNA 1H94A 4XQCA 3F46A 4DYDA 1EE2A 3H3FA 3OIDA 1MG5A 3A28A 3RKRA 1D8AA 3NGXA 3OHSX 4WLOA 4CQMA 2D59A 4DA9A 3C7AA 1ZSNA 5JPIA 4KQXA 4W9NC 5AXAA 1P1HA 4IDDA 3KYDA 4JBGA 4R01A 1R6DA 2C5EA 4R1NA 4CV0A 1GCUA 1FDTA 2Q99A 2Y66A 4JLWA 3QWHA 1O6ZA 4M86A 2XXJA 3GGPA 3ICPA 2DTXA 3HZZA 4FC7A 4R5MA 1VJ1A 1N7GA 2VYVD 1EVYA 3DMYA 1YB4A 5KJFA 2NLOA 1TT5A 4IUYA 2WYWA 1JVSA 1W8DA 2X0RA 3PI7A 4J9UE 4URFA 1KEPA 3RC7A 4DXHA 4IDCA 1ISGA 3H6KA 4IZIA 5CPBA 1JVBA 2XOXA 2R2GA 4AL4A 5ADHA 1GUFA 1E3EA 2GRAA 3NDJA 4RVGA 2GN6A 3K92A 5JYDA 1YS4A 4FGSA 1G0OA 2G1UA 1I2CA 4AJ1A 2PGJA 1PJCA 4OSPA 2Q50A 2P4HX 1CDOA 3BHMA 1JN0A 2BD0A 4NFHA 3FR7A 2Y1CA 2HMWA 5CDUA 2DBZA 3BMNA 6ADHA 2W2LD 3ROMA 2UUOA 1R4NA 1CEQA 4YQZA 4BHTA 1I01A 5TC4A 3OH8A 3HFSA 2I9PA 5A9TA 2PY6A 1PU2A 3ROKA 2IEDA 1O8CA 2OGUA 1DAOA 3M1AA 4GI2A 2NTJA 4CLRB 2Q2QA 3JQFC 4J7UA 5AVOA 4RV9A 5EMHA 2GD1O 1Z45A 4E13A 3DTTA 4D0SA 1A7AA 4IDEA 4FQ8A 2Y1GA 3DEYX 3FPLA 1Y5RA 3RCBA 4YRDA 3L6EA 4Q39A 2DTEA 4PLHA 3A06A 5ITWA 2CVZA 3JQ6A 3PJEA 3WGZA 3VPHA 4CMCA 1R4MA 3LDHA 1BSVA 4XIJA 3F6YA 1DIHA 1ZJZA 3GFGA 2GLXA 2VQ3A 2RCYA 1F8FA 4AJNA 2CF5A 4BV8A 4XIYA 3GEGA 2FSVA 4G5HA 3HADA 3DZKA 1B26A 1ADCA 4KUHA 3ZN2A 1R0KA 2Y99A 1DB3A 2R6JA 1Y8RB 4BGVA 4OOEA 3NTRA 3JQ7B 4ZA2A 2ZK7A 2D1YA 2Y0DA 4KTVE 1DEHA 1LDNA 3GFBA 1ISFA 3WTBA 4FN4A 4J9VA 3TZQA 1YVEI 2ZQYA 3NAQA 2GGSA 4MVJD 4YJFA 3TOXA 1ENPA 2RHRA 3WNVA 4OO3A 1NP3A 4BB5A 1Y81A 2HK9A 4CPDA 4AJ4A 1K3TA 5T57A 4A73A 4MPDA 1BXKA 4CR8A 3ZWNA 4DRYA 3JQFA 1U4OA 2CVQA 3UCFA 5T8KC 4WOKA 4CL8A 5I7VA 1YB5A 3WGQA 4UVIA 2D2IA 3TZCA 1HLDA 2I6TA 2ZTVA 3GDGA 3M2PA 1U5AA 5DOZA 1LRLA 3U09A 3WSWA 4R69A 3UH1A 4KUEA 3F4LA 3VTFA 1UXGA 2IZ0A 4DQUA 3GOHA 5JAMA 1GEEA 4WECA 4RORA 2EWMA 1I3LA 4RVFA
chains in the Genus database with same CATH superfamily
4XQ9A 2XDAA 3EPLA 5K45A 4GF5A 2YJ3A 3T95A 4WK2B 3PDWA 3DR3A 1XD9A 3DR5A 1H2YA 3PC6A 1LW6E 1DEKA 1ULBA 2GPWA 1XRLA 1R0LA 4HPXB 4QVGA 3QLVC 4DMHA 1DU4A 3CVVA 2F2TA 2ASEA 5EMLA 3MMSA 1VFPA 4PLPA 3ZU4A 4QUJA 1F8XA 2DC1A 1CQIA 3GT3A 3MA0A 5DGTA 1EK6A 4D3XA 4Q0MA 3WIEA 1W2WB 3RC8A 4HH0A 4UHKA 5B57C 1D2AA 2WJ6A 1V71A 1C1YA 4BN5A 1QP8A 4V02A 3FOFC 2A92A 2VSYA 3A1EA 2NT4A 4EATA 1W48A 2AQHA 1FNNA 1VE3A 2BGNA 2QN2A 2EYQA 4HDQB 4HGPA 1NJ6A 2G3YA 4O02B 4ODIA 4R9VA 4X7PA 5DRTA 3ZD8A 4C7KA 3QSYA 2EEZA 3H9UA 3I30X 5KYVA 1R66A 3CF2A 4HBGA 4QUIA 2NT3A 1JIQA 2W48A 1NXPA 3HN7A 4L6CA 4GI1A 1J8VA 1YRQA 5BUZA 5K8IA 1TM1E 4PLWA 3BBPA 3W79A 1IXSB 4DLNA 4I5EA 3VZSA 2D2XA 3PC2A 1OSNA 2NUBA 2J3EA 1GAWA 2ZRBA 1GO2A 4ZO6A 4ZU3A 4B3GA 3AFMA 1J1UA 1KFCB 1E0KA 2HD4A 4IDOA 1R9JA 4WN9A 2C2YA 5AKYA 2EZ9A 3WNQA 1IHPA 4CDGA 2PRSA 9LDBA 4QOSA 1GPDG 3NOVA 2AZTA 3RAPR 5A6SB 2W5UA 1WEHA 5EPUA 5IAGA 3RREA 2EWVA 4F97A 2H0QA 2M1XA 3OX4A 1SIUA 1N6IA 3G0BA 4W1PA 1J8YF 1G6HA 4TTVA 1BCRB 4MA5A 4NP6A 4C0QC 5SICE 2F8MA 3LX8A 1IK4A 1URPA 2KB0A 1BX1A 1LJUA 1JZTA 1QC5A 1QTRA 1RE1A 2ZRCA 4PZLA 4UTXA 1QOPB 3OSUA 2R7MA 1MLDA 2JFZA 3EY9A 1I9GA 1N8KA 2PE5A 1P60A 4I7EA 3VU0A 1ZUD1 3DE6X 1Y63A 2Y77A 1ODCA 1Z62A 2WMNB 5GPBA 5JIBA 2EQBA 4EGSA 1NRIA 3SBDA 4IUCS 4ARZB 3M81A 3LBHA 3OTOB 3AI3A 4UZSA 2P6MA 3DHVA 1ZAYA 2G88A 3P9SA 2Y76A 3KXDA 3KQWA 1WVGA 4QYMA 4RX1A 5D7NA 3VOSA 2H0AA 4ENPA 2Q0QA 1TJPB 2R62A 1R6AA 3CF4A 4PRYA 3FNBA 3AR7A 1JPNA 2VQEB 3LKBA 1BEZA 1Z38A 2O14A 4JLDA 3E9YA 1HYBA 2HN9A 1UANA 2CXNA 3L1HA 4QSMA 5EPOA 2IUUA 3TO5A 1W36C 1GDTA 1A77A 2AYYA 1HTTA 2C9CA 3BL5A 2REOA 4JGIA 5G4KA 2GT1A 1RTTA 3F98A 2P0AA 1A5AB 2Q3JA 4C4TA 5KJCA 5LQAA 3FGPA 4PWZA 4EJ2A 5FLYA 3QEBZ 3CX3A 4UHBA 1S8NA 1XAGA 1GGFA 3FDIA 4CN9A 4CZ2A 3SZ3A 4YCCA 4C7VA 4OYLA 4ZC8A 3FBWA 4CL3A 3A6HA 1ESEA 1YI1A 3BSFA 2CGEA 3H84A 5G3ZA 4UREA 2XCLA 2C9MA 2NO6A 3EDQA 2JS7A 4BNKA 2D4AA 1P0FA 1USKA 3R7BA 3RT7A 2BUCA 4PO9A 1ZM7A 3WGHA 5LL6P 4ZDJA 5CBPB 2PDAA 2Z95A 1QIIA 3WG9A 2ZXFA 2R79A 3PQEA 1KHHA 4DMLA 2IOHA 3SQLA 4NH0A 4G5YA 1J2UA 3DMHA 5HF8A 5BWNA 5G1NA 2QTTA 3QXSA 5KTNA 4UEJA 1J2RA 1S96A 4B3CA 4AJJA 3AR6A 1GPBA 1OZGA 2W6OA 2AOTB 4NU5A 5CX1B 3WB1A 4OHOA 2NP6A 4L75A 3EBLA 1C8VB 1SC9A 4H1UA 2YJNA 3RNOA 4DDHA 2OO5C 2OSVA 2J3DA 3P0EA 2EZ8A 4OK6A 1JEEA 3HMQA 5EWMA 1CR2A 1W5EA 1YA8A 4K0KB 2NUTA 1EESA 5AW1A 3L4EA 1ZI8A 1LF0A 2WJPA 4J49A 4LXTA 5DGIA 3VUFA 1FYEA 2GJAA 2J8ZA 1XAHA 4BLTA 5C8YB 1G17A 3CJRA 4NENB 3DDHA 1EP3B 4X84A 4N5HX 1FDWA 4J7CA 1I3OA 4RZIA 1TPZA 1GA1A 3NZEA 3I32A 2CCJA 2OQIA 1D2EA 2R65A 5FWAA 2DX7A 4UAGA 5TY0A 3UAWA 4QLAA 3FUWA 1AIPA 4QO8A 5KOHA 1R00A 1MO6A 4L2IB 4PYLA 1TU4A 1M67A 3WRXC 1KYIA 1XU7A 3AFIA 1EFKA 2OHJA 3C5CA 5EZ6B 3WOHA 4MGHA 4WNAB 1OU0A 1JDTA 1KP9A 4TX1A 1UK7A 4GBGA 3T1NA 3T35A 2YVLA 1B8VA 3I73A 3AJAA 4IIJA 2VNAA 1YJ8A 4Y9RA 1MV8A 2AE1A 4M0CA 2PRJA 3INRA 4EQZA 2WG0A 4M1SA 4RQUA 3RS5A 4F21A 3L6DA 5AVUA 2ZJZA 4N8EA 5IM4F 1OJLA 2ZWPA 3IHLA 4B9EA 2JLXA 1NBWB 1M6NA 1BGWA 2G5GX 2ENUA 4W8HA 1D7AA 2FK7A 3OQBA 3IE1A 1MC8A 1KVTA 2C1EA 2IE0A 1OH5A 1UKCA 3QVOA 3DE2X 3UG6A 1NUUA 4CCYB 2C7GA 4I1PA 2BFDB 2PYDA 3E23A 3H87A 4KQFA 4FCCA 4QICA 1ZI6A 4MRAA 3S8EA 1AKQA 2VRCA 1V16A 3IUNA 4FYJA 2O1EA 2WMDA 4UUPA 4HAVA 2VWQA 3WLIA 1H1DA 3ZWOA 1D04A 2PU7A 1FYVA 3I6YA 4JITA 1FUUA 1LBHA 4XPIA 3BCRA 3OU6A 5D1NA 1X7WA 4I50A 3TQQA 1VIAA 3FYUB 5K3CA 4YI5A 1B14A 2H16A 2EDCA 5BSEA 4ENRA 4LRTB 2QMYA 1U5CA 1KI6A 3IEUA 3OETA 4G23A 2H85A 4AMVA 4BJ5A 3W8FA 4B35A 5INTA 2IBSA 2VA9A 5I7EA 3EOBI 1Z8FA 3BMCB 5JAMA 4OH7A 4DAOA 3H2BA 4I6GA 4B6GA 4OI2A 1JQEA 4C4AA 3H5IA 5JNVA 1BH6A 3UQYS 5CYGA 4HDMA 4I3FA 1F5NA 1NURA 2FX2A 3MW8A 3DT6A 4GDMA 3TRKA 3LQ4A 2HSWA 3SXUB 4EMSA 3FRIA 3W3AH 2Q3EA 1JIXA 1W0CA 2GVNA 4I1SA 1U81A 5L4SA 3G7SA 3C74A 4R0VA 3OHMA 5AKEA 2D74A 1FE8A 4N49A 4OJYA 2QNRA 2VZEA 2FSFA 1D5WA 4OKIA 4YCMA 6ABPA 3EMBA 2AR9A 1RU3A 3AR2A 2P2ZA 1OH8A 3SF0A 2AHRA 1I7CB 3FCXA 1ZVMA 1V45E 4NCXA 4EHIA 3RWOA 3R20A 5IVDA 4P31A 1XCPA 4EY5A 3A4NA 1MZPA 3JZMA 5EFOA 4ZZ2A 1EZ4A 6Q21A 4Z99A 4ROSA 4UEWA 5DO9A 3R7DA 3VNVA 3A4TA 1RPJA 5E7MA 2HZBA 1IWOA 3D0KA 3IUJA 4PC2A 1WX1A 4E5VA 1TCBA 2IUFA 1ZMBA 4C7OB 3AOEC 5ALDA 3ZE2B 3SSAA 3KPWA 3B6EA 5DTQA 3O92A 1ZMTA 3K1YA 3P27A 4RLQA 4INPA 1J2TA 3TTSA 4A82A 5JBQA 1D1QA 2XVYA 3OCXA 3WGOA 2DFNA 5NULA 3DZBA 5GY7A 1WB9A 2EX1A 1EQAA 1EVZA 4IGAA 3SQNA 1SK9A 3DCYA 3MOIA 3B1FA 1T43A 3AJEA 1EGAA 1SVUA 3HN6A 1ZIXA 3D6HA 4Z2AA 1QDEA 4ACBA 5HOQA 1T6ZA 4Z7NB 4DBLE 1U0GA 5IKXA 3PD1A 4W5NA 4M1TA 1DC3A 3TLEA 1W4BA 3IV6A 4KVFA 2DQKA 2QRVA 3WQHA 3LRXA 1A9QA 2PLRA 4OXRA 2PJRA 1YTUA 4D74A 1N6RA 2HWXA 3L8FA 4P08A 4F5YA 1RYFA 1G20B 1NI4A 1T8SA 3A2NA 4K6FA 1SEVA 4MJXA 3B8EA 5TDHA 1J97A 1RPTA 1FQOA 1GUBA 1X94A 1CULC 1XTZA 2DP4E 2RG7A 2GZ1A 3DZHA 3NBFA 1NJGA 3LG2A 4FNMA 5A1TA 2NOAA 1IZ8A 1KMMA 2EHJA 3CZPA 1L4YA 1KZ7B 3H6HA 3I6ZA 3W5UA 1O6GA 3C45A 4UARA 4HFMA 5BORA 1GZUA 2FEOA 3W6UA 1WF3A 4MINA 2AFIE 4WRRA 5DLPA 1E2NA 1LPAB 2PA3A 1U2PA 1X7XA 3N8NA 3MAGA 3OM8A 4RTJA 1CY2A 2YVAA 3P8ZA 1VZ3A 4OKNA 5THXA 1QHSA 1WDMA 1GZDA 2GBPA 4ARSA 4QJ4A 4BZPA 2WWIA 2BR5A 1QE5A 2FFJA 4MEAA 2HF8A 3ZW9A 4RD2A 2BEUA 4Q4JB 2NZWA 5IVKA 1F2UA 1Z06A 4HFJA 1GTG1 1NSYA 3IIJA 3ZDRA 4LK3A 1N2JA 3CH6A 1R0BA 5JCXA 1WV1A 2AKAB 2O9JA 3LE8A 3R0ZA 4JS0A 1GNLA 4A0FA 3VVMA 1OZ0A 3CU5A 5IZ4A 4GPTA 4ZYZA 1PCXA 4OIFA 5EE3A 1PX0A 2H2WA 3B3GA 3T99A 4HOYA 5DBIA 4C6TA 2IS4A 1XMJA 4FDLA 4LFCB 1AD2A 1E0AA 1WKVA 3V8EA 1SN7A 4Q9LA 4BLOA 4LSWA 2OXIA 2V3WA 2ZT7A 5JADA 3BYZA 5AK4A 1AQUA 4YXWD 3B1WA 5TQVA 2MYNA 1UKVY 2BP7B 2WPDA 1ABBA 2YJZA 3O8OA 4RHTA 3DAHA 5HXAA 1HE1C 1KYQA 2IKSA 2C7PA 2ON6A 4BFSA 4PVDA 1QHNA 3V3TA 1HH4A 2O3TA 4O2BF 4WPGA 1XDWA 1CE8A 4ITUA 4L9SA 4EA6A 4WW0A 3O8QB 1YS1X 4PIVA 1IM8A 1SXPA 4RS4A 3CR7A 1CFJA 3DDZX 1NVBA 1ZJ4A 1SXJB 4JLNA 4C7BA 4EA7A 5KYWA 1N2GA 4I2NA 2W4IA 1ENZA 1ZGJA 4INAA 2ORIA 2WE7A 3GVHA 3L0CA 3L8EA 5A9SA 2C83A 1K7YA 4JXKA 4AQDA 5LN1A 2ZZNA 1Z25A 3MMPA 1Q0SA 4QYSA 2HK6A 3L7IA 2JAHA 1PV4A 1OXKB 4NCJA 2W6QA 4GPZA 2Q5HA 3LHSA 2O8VA 4WX2B 2ZE6A 4AKEA 3UUGA 3LFUA 5AJXA 3HXOA 4ZEVA 3QVKA 3UVEA 2GPBA 4TLBA 3CBQA 5AW6A 5LMCA 1U02A 4CT0A 4FR0A 3W04A 3DTNA 1V7PC 3FHOA 2ZIZA 3IC5A 2PHZA 1SG6A 1H65A 2V6MA 1YU9A 3QX7A 4D3SA 2AA3A 3L18A 1S02A 1AXEA 2ZIFA 3FWZA 3MBOA 3U7GA 2WUFA 3AXTA 3UGKA 2C8VA 2ZYAA 4KAXA 3G13A 4RTOA 1PL7A 1E61A 3VISA 4RYLA 3JVUA 3WE7A 1ANKA 5J2TA 2DSNA 2HQBA 1KK3A 3OZDA 3HLYA 4ITRC 3DWIA 3PXCX 3QKRA 3SVZA 3IMEA 2FZCA 3HKCB 5CVCA 3HCOA 4AIIA 1MJ5A 3CEHA 1UBGA 1DL5A 3HCFA 4OX9Y 3AMVA 1U3WA 1II8A 3IRVA 4GMKA 4UMFA 2V6FA 4RWEA 2F67A 4B75A 2G6BA 4LWZA 3N2GB 3VO9A 4MPPA 4D80A 2VHEA 4NE9A 2CHVA 4IQFA 3FPAA 4LN1A 2XOKA 3BWMA 4DRXB 2CMDA 3VSDA 2ZS9A 2XUHA 4WJKB 4UOEA 4BZZA 3G1WA 1UJMA 2DKFA 4TVBA 2P27A 2VP0A 3D0OA 2PRYA 3GIWA 3LY5A 4I5DA 4Q37A 5AW9A 3VAAA 4WKCA 3UK2A 4ZI7F 4N47A 4M54A 3ZEAA 5FBQB 1Q0TA 4FHGA 3I5MA 2B1QA 1QG6A 3NIBA 3Q6IA 2JZOA 1XGKA 4CKEA 3PTLA 2B82A 3FH0A 5TR9A 4GR4A 4EW1A 3T41A 2PUAA 1O54A 1BDBA 1P39A 4PYMA 1CP3A 4EYGA 1E59A 2QMQA 3IOEA 2V54A 1HZJA 4R2WA 1L5OA 1ZUNA 2MHCA 2YV3A 5CAEB 1ZEMA 2P9BA 4IMPA 5DSZA 1SQ0A 3C41J 4H08A 5AQEA 1KYXA 4ERNA 5D86A 2C97A 4K8OA 3TLMA 5DSXA 3HYTA 8LDHA 1PJQA 2PGNA 1ZGHA 1WRBA 4J75A 4O2BB 4RCVA 1XQ1A 1Z17A 2A1UB 1RLJA 1SELA 4O5OA 5J5CA 3JCZA 3RROA 3FBGA 1O77A 1W87A 4TT3A 5JDCA 1JENB 4MWOA 1DJQA 1QTNA 3WKEA 3P4YA 3BBLA 4WESA 3WXBA 3FW1A 1GUZA 1O6FA 4HL6A 5K9ZA 5BSVA 3AVXA 3DAGA 5JSZB 1T9CA 2NPOA 4MRMA 2XPCA 3D3EA 4NJEB 5K4AA 1YQGA 4G85A 1S1CA 4DIKA 1ZPDA 3VTZA 1JSLA 1OLSA 1PR2A 2VDUE 1H5UA 2YQ5A 3N8DA 4HB3A 5BMVF 3MGBA 3TZHA 2PSEA 3FD8A 4ZHSA 1N8TA 1PK8A 1Z73A 5JNWA 3L7LA 1AE1A 4CG0A 3RB8A 5GJVC 3OPQA 1O95A 5DTIA 2H31A 5JS8A 1GZ3A 5KCZA 3QHQA 1QCYA 2B2CA 1YU6A 1GD1O 1UK9A 2IYNA 1EX1A 1JI0A 4G1UC 4WN3A 4Q1EA 2G4LA 1BJRE 4RK7A 3NXKA 2WIKA 4R41A 1KZ6A 1CCWA 5IX8A 3NWJA 2H9YA 1QCDA 4GDFA 1JMYA 3NR2A 4RQTA 4YVFA 1OKKD 3MUFA 4EMTA 3PX7A 1B0AA 2CL5A 4CDNA 1HFEL 3BWXA 5KPJA 1YKFA 3ANMA 3I04A 3ENWA 4M0MA 4Y2TA 3X1JA 4DIUA 2I7DA 1JJVA 4AP5A 3PITA 4H15A 4I3HA 6YASA 4RTSA 1DT5A 3O03A 3C3DA 4G0WA 2WUVA 3HJNA 1VCHA 3CPJB 5ALXA 2JIMA 1TZKA 4GIBA 2QP9X 5KVQA 2HGZA 5H4GA 2E5WA 4YV2A 4P8RA 4IVPA 4J1SA 3KWMA 4FNAA 4BQOA 1IOWA 3CLTD 4ZJPA 3ELDA 4W5HA 4PZPA 4NV1A 3WQBA 4DGSA 3VPBA 2H1WA 3SMVA 1A1VA 3JQAA 4F2WA 3MBIA 4Y6GB 3W4IA 3KC2A 2XUKA 4QBIA 4EABA 4EHBA 5A0TA 3S28A 3K7EA 1VKZA 1ZCBA 5TF0A 4YA6A 2XNCA 3KFXA 1ULZA 1KAGA 4ZI7B 1IH8A 4I4IA 3NP9A 3LUAA 2DECA 5M04A 1ZIPA 1Y4SA 1TUEA 2I4MA 1T36B 1T4CB 3I61A 2OFFA 4AKIA 1E7WA 3QKSA 2VTKA 2Z1NA 1LBQA 4KGXA 2ZUBA 2QL5A 4KZKA 4M99A 1ZMOA 1A69A 3THRA 4PX9A 1FXWA 2BC9A 5HW0A 5CVDA 1C4KA 4GGOA 2YYAA 1BXZA 3OIUA 5DHAA 3ZJYA 1MQAA 5H83A 4TQGA 1PL6A 3GEIA 3A6GA 1F51E 1UDWA 1VCIA 1VL8A 1RXVA 1OR8A 2PJZA 3D3JA 3H86A 1MHMB 3PD0A 4FJ0A 4AURA 4EYEA 4HQLA 2GRUA 1MB0A 1E3WB 2AF3C 1JT9A 1N7JA 2J5KA 2YWRA 1Q0PA 4EITA 4YMLA 1NW6A 4U2BA 4P3XA 2DT8A 4DTIA 1FTNA 3EZXA 2ONJA 3G8AA 2EEPA 4HNRA 3CXUA 1NVEA 1PRYA 2G8LA 4FMBB 1L1FA 3T06B 2ZSEA 1MTZA 3MUOA 5BURA 1JFTA 3GNSA 2J3QA 1XN1A 3UHFA 1L4GA 3EVEA 1CUBA 1P5JA 1S9HA 1QGUA 3U5ZB 1YIOA 1GXSB 2RHWA 2AOWA 2VDVE 4IZHA 5DYWA 4ZRNA 1MO2A 4QOJA 4RTLA 1J4AA 2WINI 3TRHA 5ALVA 4DWVA 3RC9A 4L9RA 5CLLA 4YONB 5ALEA 5BMVB 5JTTA 1TYBE 2O7QA 2IPLA 2ZAIA 4Q3LA 4I3GA 5KKAA 3NM5A 4M1ZA 2ZT6A 4UHJA 3Q41A 3RASA 2ECFA 2GERA 2I4NA 2Q5LA 3IAUA 4MWSA 2R1ZA 4AK9A 5KZMB 1JNXX 4KI0A 3GZJA 1BFUA 1T5HX 1YJQA 4JJ7A 2QMZA 3WTCA 1TYDE 5AO9A 1QO0A 1VE1A 3G9XA 5DDIP 3RK4A 1TCCA 4OUKX 2GB4A 3S5JA 5HQ3B 2FW0A 1KYVA 3R7LA 4BKPA 3D0RA 1O94D 2HHHB 1QTIA 3R3YA 4AM8A 3GJZA 4LY0A 1LY1A 2REXB 4IDBA 1P6QA 2R6FA 4XM2A 3WYCA 1XVIA 4ENQA 2CXOA 2XB9A 2VRBA 2H1VA 2H54A 2JRLA 1Z56C 3BZWA 3OJCA 4HDNA 3ZWAA 4NDZA 4RNDB 3I1YA 1MJNA 5FPSA 1KSJA 4EF4A 4OLBA 3RU3A 3K2BA 5JANA 4E7OA 1W88B 1WZUA 4P3PA 5EHGA 1QB7A 3BFXA 3LM8A 3U17A 1N5DA 3H05A 4QTYA 2GXSA 2HPZA 2V59A 5BVGB 5B2FA 2JEYA 3GAFA 3F49S 1NF9A 4RKWA 1FMJA 5EE1A 4O59O 1UDRA 1EH5A 2ZUDA 3NKLA 3RVMA 4A91A 1EXMA 1VB5A 4OJMX 3OEWA 5CNIA 5KNDH 3DEKA 5B6IA 1N5MA 4JBWA 2Z2ZA 4MJ7A 4R16A 1AGNA 1RR6A 3Q3GE 4RCYA 3NHWA 3KUUA 2J6CA 4H6XA 2AHOA 1U8AA 1EAYA 1SO8A 4JP1A 5FO1A 3GHYA 4IOLA 4DVJA 4M1WA 2OB1A 3L40A 4ZZ3A 2PUHA 2PKQO 3H18A 4ARVA 1V9LA 3H0CA 4CKCA 3HB4X 1N1DA 2N47A 4B3RB 1IXKA 4BO3A 5ESWA 1I9CA 1JG4A 2ZBUA 1N75A 5JC1A 5L4NA 3B7GA 5LQCA 4R81A 1XLVA 3FDZA 3JSXA 2IBMA 4RIGA 3PV0A 4RTPA 1HKHA 5ALQA 1XQYA 2X4GA 2HYDA 3L7AA 4I99A 3HCBA 1PDOA 1HV8A 3QF4A 5EJ9A 1HDXA 3OF3A 4LOIA 3WIBA 4LQDA 3P9YA 1EFVA 3EC2A 4HR7A 5TPZA 1P2TA 2PZKA 3BWDD 3IMFA 1BS2A 2PH3A 4PZ9A 4UQLA 4YYZA 3ED5A 1GRVA 2FZ4A 3SS8A 4ZDWA 2WYIA 3GMTA 2FZLA 3UB4A 5HWSA 1J9GA 5KNBH 1Z0ZA 2IYVA 5IDYA 3JQCA 2IHZA 4WKPA 2ZRQA 2IW1A 1XDDA 1N33B 5H81A 1KOJA 1YQEA 4F2PA 3D3WA 1Y1KE 3E0XA 4C0HA 5KTMA 1Y8QB 3VI4B 4U2FA 3PR2B 3GRZA 4FNOA 3KEQA 3PICA 4QIHA 2BF7A 1AC5A 2HNKA 3F8SA 3PEFA 5ALNA 3VKHA 3T5CA 4RHCA 1Z28A 3D8BA 3KKQA 1JG2A 1NI3A 4KE6A 3H5VA 1Q50A 3Q85A 3A3PA 3QPBA 5EZYA 4WTOA 2PRIA 1CP2A 3M6AA 3IWBB 1SC3A 4OAQA 3W2GA 9ABPA 2GK7A 3G2OA 3HB9A 4KFRA 3OFSA 4ND6A 4US0R 3GQVA 4BNXA 1QONA 5BOSB 3QENA 1H6DA 2RAVA 4UTRA 4RSMA 1AK2A 3KSBC 4AS3A 1ML3A 4EYOA 1QKIA 3CLUD 3BIFA 1HDIA 2JIZA 3M4ZA 3PUVA 4PPGA 4A6XA 3M9LA 5HX7A 3RSZA 4EKYA 5KS2A 1VYUA 1OWPA 4R54A 3GQBA 2FWMX 3TVYA 3WLJA 5EJ4A 1S5PA 3TLAA 1GGHA 1K1EA 2GWRA 3BULA 4TN1A 5DYGA 5CCEA 2Q2WA 5HMLA 4XLZA 3LCRA 1QPGA 5C7OO 1F3LA 2M2IA 4FZVA 4KXLA 3CSDA 1CTQA 1E79D 3VH1A 2NSYA 3EGOA 3D7LA 3LD9A 1UC8A 3T7CA 5JAUA 1YL7A 2D8AA 1Z75A 1XJCA 1FF9A 1OI4A 5BN4A 4WCFA 4NAUA 4YDRA 1CIVA 5EQFA 1JG1A 1WNTA 3ZHSA 2XCRB 1EVKA 3CVYA 3ZUGA 2BBOA 4OL9A 2O8NA 1NRXA 3WV4A 1AN9A 3MWEA 3KV3O 4Z7JA 5JISA 4XSVA 1TEHA 2B37A 1CB7A 1TC2A 1QAOA 3CKLA 3GLIE 2MCFA 1GR1A 3G2PA 4K9SA 1U0NA 3U81A 1ZK4A 1TB4A 3U7QA 3VOTA 4L57A 4QGGA 4WACA 4CQJA 3BSYA 2WIJA 3UWKA 4WBNF 1XD8A 3I9OA 3IQFA 3K3PA 4LHVA 4QBHA 1BROA 4B4OA 2EATA 1AMNA 2EIHA 4V2UA 1DDGA 2ZR8A 2IEGA 1M2GA 3BDVA 3E5MA 4QFDA 4RPHA 2A4KA 2H3HA 1FSPA 3LPNA 1YOVB 4L85A 3GLFE 1OVGA 4G0PA 3FCOA 4E88A 1T13A 1S2OA 1JEQA 4IWYA 3DGEC 4I1OA 4ZZ0A 2C2HA 4OGKA 3UFXB 3FTDA 4BY9E 3DF9A 4NK5A 4S24A 3TW3A 1WVMA 4AW9A 1WXHA 4NBSA 4EHLA 4RTNA 1LGYA 3QFTA 3UAVA 3DYVA 3DXYA 3HV0A 4EDHA 1EKXA 2V7BA 3BD7A 1OA0A 1SQ6A 3ABQB 1M33A 1D9ZA 2TS1A 1T4MA 3SHQA 1AQJA 4MV4A 5AR1A 2ZSKA 2A7QA 2Y9MB 3D59A 1BQEA 1R0ZA 5L3QB 3PYXA 1QVRA 3PLAE 3F7NA 2BFCA 3C5VA 3LC1O 1CNFA 1W5SA 3JZFA 3U7JA 5C46F 5K05A 1E9DA 1E3MA 3UMFA 4HV4A 3EWIA 1VJRA 3QE3A 1VLZA 1KAHA 2PIDA 3UMRA 4B09A 4CEJB 4OUDA 5C31A 1SCUA 1QGDA 1PFYA 5IKMA 2XUIA 2NU7A 2E89A 2IT1A 3GZ4A 1IVNA 3BMNB 3R7AA 1QR6A 4FLEA 4TWIA 1GGJA 4RSHA 4XWTA 3T9BA 2BYTA 3GJ5A 1LCIA 2RI0A 2AI2A 1BN7A 2BFEB 1YZFA 3OEHA 1GCIA 1LLUA 1WVIA 2GMWA 3OIWA 1KRHA 4MB2A 3KWFA 5HQTA 1NHGA 5EIXA 1L7QA 1U7OA 5EERA 3PNBA 4HGQA 5ERYA 1NW7A 4RMJA 2JJ8A 5CT4A 2J31A 4EI9A 1G8GA 3OZRA 3OZWA 4Y6QA 5FHRA 1WL8A 2AJBA 1NU8A 2BE7A 1N9ZA 1PQYA 2QW1A 2UVPA 1JJBA 1XYGA 1TXGA 1RJFA 3DFUA 3FLMA 3KG2A 3LXUX 5I9BA 3BFPA 1MX9A 4J03A 3UF0A 3UG7A 5IG2A 3RIXA 4QODA 5I7FA 5LBIA 1HQYE 3BTOA 2LE0A 2OKGA 1SCNE 1Y7PA 2HRBA 3G1TA 3TNDA 3ZU5A 4FE4A 2Z6QA 2PH5A 2H1OA 2QYOA 4OQZA 4B2YA 3HK2A 4YCSA 1QHYA 2FEXA 3RU9A 3MXOA 3CIFA 3DLIA 2BFWA 1SCDA 2IXDA 1PJRA 2W6ZA 2WP0A 2XNJA 4IDGA 3OJFA 4ZTBA 4LSGA 1TEXA 5GJBA 4HDCA 3UPTA 4Q48A 1KERA 4JENA 1L7VC 4RLHA 1LNSA 2YY6A 3LO5A 4FYMA 2QZ4A 4G4GA 2AFHA 1TQ4A 1M8GA 1NMZA 2AJLI 2VYND 4IJ5A 4YGXB 1Q77A 4YRCA 4MAMA 3SNHA 4MW1A 4WBNB 3I9MA 1LW7A 3BRWD 4QPDA 3L7CA 3PEYA 1Q1ZA 2QD3A 3PS9A 1EFPA 3DUFB 3DTYA 5E8JA 4A1FA 1L0BA 1P44A 2G0TA 3I72A 2J0EA 3I8SA 2NXNA 5FJIA 1N5LA 1TOAA 2JATA 4EGAA 3UA4A 2R96A 2XUAA 3OUZA 2BE9A 4KO2S 3F74A 3PHGA 4C78A 2WR8A 4NNOA 2OV6A 3IB3A 3TXYA 4ZTZB 2QR5A 3C3MA 2Q3MA 2XMCA 4MLDA 5ALMA 2P2DA 1S7GA 3I01A 3SC2A 5B4VA 4X71A 3MTBA 3D43A 5CFNA 4IZ6A 1T10A 3PQDA 2IYUA 4IDHA 4YHBA 4ZI3A 5AKXA 1MJFA 2Q3HA 4Y98A 4NJOA 4B4WA 1E2JA 3PENA 1IWBB 2W83A 1T5BA 4L15A 2YOGA 1QGZA 2ZSJA 1NR7A 1XEWY 1LS6A 1SB8A 2IUEA 2VVTA 2X4LA 3OM0A 3Q8WA 2O20A 4KAJA 3MC1A 3SZMA 3D64A 4DUGD 1B3BA 1ZCJA 4ZHQF 1ZM2A 4N1AA 5B6JA 4CQNA 1KU0A 4LMRA 4GVLA 3EPPA 5DNCA 4V1CA 1B74A 3GH3A 4EFLA 2F3PA 5KQSA 3N2IA 3EEIA 3IT2A 3GI1A 5BV1A 4MSUA 4YRNA 5K3FA 4W1SA 3GLHE 4MZXA 3PNSA 4F8EA 4YROA 4L0QA 2SICE 2W70A 4EFDA 4IG4A 5JOQA 2D0PB 1TT7A 3T54A 5AI4A 2MIIA 2B4YA 2ZOSA 2VJLA 3EF3A 1R10A 2QLBA 3AFGA 4QECA 3WP0A 1GCGA 4MKXA 1FRFS 1LEHA 2X8JA 3FY4A 3I9FA 4NE7A 3H4MA 4RJIA 4UM5A 1N6PA 1NVVQ 4TV8F 2WV7A 4AMZA 2FZGA 3OESA 5DLQC 5T4FA 3WLPA 2NU9A 3CEAA 1SVWA 4N40A 5K2MA 3X3HA 2DSTA 2BRUA 5EJIA 4EKDA 5KO2A 4KVGA 2IU3A 1TKCA 1V8PA 3IVAA 4I55F 4YP6A 2V7QD 3M6IA 1VLLA 2OM6A 3ZXUB 4ZEMA 5KSZA 1GZ6A 2AG6A 4CLRA 1ZSVA 4M8LA 1WUJS 4NYJR 3NYWA 3UHPA 221PA 2CXUA 4QARA 5EWJB 4CM8B 4A3SA 1UP7A 4FMCF 3N2EA 4J0KA 5ESXA 7REQB 5ALOA 1RJ9B 3HEMA 3K1TA 1NVXQ 2JGKA 4FLFA 2EQAA 4G26A 4H6WA 1LS1A 4E32A 1L4HA 3GLUA 2WILA 3MILA 1JIUA 1H8EA 1OAOA 4HDAA 1W94A 1DC4A 2XNKA 5BYJA 5BVHA 1QDUA 5KTSA 3N0TA 4EG7A 3G17A 2R6AA 3FZQA 3OQVA 4RXMA 3ZBTA 3IJEB 1UOPA 2X0FA 1NVUQ 2QIPA 2VPZA 4MGZR 3PLRA 3QU9A 3ETCA 1O5TA 4NJMA 4DABA 4U7DA 1RWWA 3A1SA 4UBKA 2JHGA 3HLKA 4KRYA 3SG0A 3ZBPA 4CL0A 2MT9A 5BQ5A 4A8JC 2QG6A 3D7KA 1YUNA 3GCWA 3HY4A 2R0QC 2P6RA 2WVHA 2JCVA 3NBQA 2F3SA 1CQXA 3OLVA 1F0NA 3SWWA 2PXCA 3HWSA 4ZU1X 1LC0A 4N03A 5CG1A 1OI3A 3LT4A 3GJ6A 4BN4A 4LOAA 4R84A 5AM3A 4KN9S 3ZGLA 1UP6A 2QAGA 2FSIA 1T3GA 4N6NA 3T7DA 1G5IA 1FEZA 3UICA 5HG0A 2X58A 5F1KA 1JDZA 1YSCA 4KDEA 1J5EB 1BHSA 3HVRA 1REQA 1U8TA 2I71A 2VZ0A 4HAZA 4KXQA 3TCXB 3UB3A 3T4PA 3UWSA 5AK0A 2ZBFA 3ZV3A 3WGTA 1PNRA 1VE6A 1K4KA 1H3NA 5B12A 1QFZA 1W0KD 2VHJA 3NU1A 3ORSA 5I9IA 1CY0A 3PFCA 2XQFA 4M87A 5AUQA 4C07A 3U4IA 1AK1A 1UM9A 3O74A 1E2PA 2NSJA 3SJUA 1DCMA 4QQRA 1U7ZA 4TZKA 1MF7A 4HUQB 5E6UB 4BB6A 3QVLA 4RA9B 4BRUA 3EVCA 3OZUA 1YS6A 4H31A 4YJGB 3CUUA 4WVLA 4L22A 5C7YA 4C04A 1KSHA 2J9RA 1SUAA 3MTIA 1M34B 1GKLA 4R8VA 2HK7A 1SC6A 1SKBA 3HLTA 1FRNA 4TKUB 4U7WA 2P75A 1CRPA 1W4CA 3RYHA 5FR2A 4L4ZA 3ADPA 2D2EA 4BX0A 3TEMA 4D26A 2CXTA 1GR0A 1QAQA 2JBWA 2YXBA 4P0QB 3DMGA 3AL0C 2GPJA 1GWNA 1R3UA 4E2FA 1AH2A 1ZXLA 2W7TA 5FPTA 3TGWA 2JGRA 5JO9A 4QGBA 3QA9A 3SR4A 2IXTA 3JX9A 4LE1A 4MYSA 3ZEIA 4TV8B 4CTJA 2V4ZA 5JFOA 5KYYB 4KXYA 5TGTA 2G0AA 3C7DB 5EE5B 4MUMA 5KYKA 1NC1A 1N6KA 3GZTB 1XPOA 4I55B 3GXBA 4FDUA 1TA9A 5J2UB 3SZLA 1A76A 5AKLA 4LRSB 1PT9A 3OE4A 4F4JA 5K0CA 4H0NA 5JZOA 4MPJA 2JAXA 4K9DA 2EBFX 5IUKC 1C0LA 4P0PB 1VOTA 3EZ6A 2CNOA 4FMCB 5LU9A 1LLDA 5KBYA 1QF7A 2P6OA 2ZGVA 3FYHA 4IIDA 2PWYA 2LGJA 3GZNA 4ZEWA 1W44A 1E2FA 1GNPA 2WK1A 3FSGA 2IBTA 5A6SA 2I67A 1GILA 1N2BA 2W22A 2HWYA 1NI5A 3QNMA 3CLVA 3PFIA 4FX5A 5GP1A 4PNZA 1JR2A 1VGRA 3DSRA 4EH1A 1KMQA 4KXNA 4ND3A 3BEOA 4U5QA 3TUZC 2FZVA 2POCA 3IKMB 1B16A 1L4NA 1P4RA 2R48A 1N34B 2OFPA 3AUFA 4OHRA 4P5PA 3IBFA 1J7JA 2BEJA 5C3MA 2J5BA 2YV1A 4YRGA 3L8DA 4QJBA 3U62A 2BTQA 3BAZA 4LJ7A 3MWDB 1Z9BA 4GXNA 3D7MA 3WGNA 5KSWB 1U9IC 3BK7A 4JUDX 4ASUD 1P0MA 2PS3A 4KSCA 1NJ1A 4OXQA 3ELWA 5EGSA 4HNQA 1HDZA 2XIJA 4JVLA 3GLGE 1R15A 1VJCA 3ZK7A 4DIBA 1XNGA 1ZA2A 2QLJA 3O7WA 3ACBA 2B0CA 4LI3X 4F72A 1PQUA 5K1ZA 4KVZA 3FYTA 1NW4A 3WKAA 5LFAA 4GYWA 5AFSA 1CUUA 5CFLA 1C1DB 2AN9A 4BRZA 2R11A 3NT2A 3C98A 1KKUA 1IMOA 1N2XA 3BDIA 1RHQA 2P79A 2AOXA 2CB0A 3JVDA 2OFWA 2I4LA 2D1SA 3R3VA 4UBJA 3HYLA 4CR6A 4XDZA 3PUKA 1S2IA 2XNDD 2ZVDA 3E1GA 3G0DA 5EXXA 3GN1A 5JAQA 3RD5A 3AI7A 3CZQA 1O87A 1XYVA 3WK4A 3ZHYA 2XE8A 2YY5A 4X6UA 2BFBB 4C5CA 2R1TB 1SBZA 3QIAA 2AK3A 3JPWA 2VT3A 4DLZA 4U8HA 5EQTA 3S1AA 2WD7B 1DFGA 1PV2A 4FQ7A 3IMGA 4PF1A 1QF6A 1P2UA 3RUHA 1SEPA 4YLGA 1Y82A 1U0TA 3ANLA 4MB6A 4UJ5A 5LLDA 4YGYA 3N9IA 3EC1A 4EENA 3WBJA 4AJLA 2IP2A 4ZV4A 5FWYA 5F23A 3OTHA 1ABEA 2NQ8A 1OLUA 4JB2A 4DSUA 1V7CA 5CBPA 1T4BA 4XGNA 1RHUA 3WSTA 5I4CA 1ZBDA 3ZDCA 1PDWA 4GC5A 2NUPA 1NNEA 2ZYIA 2GZMA 3VR4H 1EP2B 2FUKA 3NGLA 2Z5VA 4E2WA 2XTJA 2O2JA 5CT9A 4AUNA 1HT0A 3GCXA 3GRUA 3K8OE 4MIOA 2AOTA 3E27A 5CX1A 1QYXA 3K70D 5ARCA 1YK1A 1A88A 2C04A 3TIFA 2ZULA 2XMSA 4PGMA 2CKMA 2O2IA 4ONEA 1OXTA 4GUDA 4W5WA 4BX2A 1FU4A 2EX0A 3QBJA 2C07A 3DBRB 1Y9ZA 3HH8A 4FI3C 5EKXA 1JXQA 5A71A 2H2FA 3EPKA 4GOOD 1E5VA 3WLMA 4PNPA 4ALLA 3NBXX 4Z9YA 3CMMA 3R74A 5C8YA 1PD0A 5J4YA 4DWJA 4BQQA 4J0EA 4NCIA 5HGXA 1PAUA 3H7AA 3STHA 3DE7X 1W4LA 4P84A 3DL2A 1XC7A 1AG9A 1BGVA 3CPEA 1ISPA 5F35A 5WRFA 3UMSA 5HIJA 4LMAA 3TECE 1BMFD 4JWTA 4RGYA 4TQAA 4JXZA 1TO2E 1NVMB 2X0NA 2YRXA 1PUIA 1XHLA 2C4UA 2FW1A 5F3DA 2XBLA 1ZD9A 2QXUA 3SKXA 1G5PA 1NJ2A 4WNAA 3CCBA 8ATCA 3ONEA 1G6Q1 1T2FA 2NPIA 4FXOA 3RTDA 4DZZA 1Y4AE 2X4DA 2GN9A 1Z5UA 1Z4MA 3JU3A 1RLIA 721PA 2O0JA 5SZIA 1VRWA 5BN1A 1T5TA 1WKBA 2OUIA 3DE3X 2P77A 4TYQA 1UZMA 1WJGA 4GQIA 1X6VA 1T4DA 3WMWA 3M5WA 4NK4A 2BKXA 4ZAFA 3AF1A 1KQ3A 1UPFA 2FPIB 4AECA 5PGMA 5KTKA 4MVYA 3VFDA 4D3ZA 2BM9A 3M1IA 4DDKA 4D9MA 3G8YA 1ZGCA 4KMSA 2HXGA 3IDZA 4BN0A 5KX5A 5KQPA 2FMHA 1U8EA 4OLHA 4RV5A 1ZVKA 4S1TA 3FKQA 3C87A 2II6A 4B4DA 2RE8A 1Z7EA 5B53A 1QX4A 2DQZA 2FG5A 4YDQA 4EWLA 1BRMA 3A3NA 3WAJA 1QV6A 1JWBB 2O2HA 3O2NA 2QTZA 2WD8A 4PINA 4QDTA 1NT4A 2XWJI 1W1IA 1YZTA 2G40A 2IXBA 1LK7A 1MMFB 1OFHA 5DSTA 5KQLA 4N5NA 4J90A 3BMCA 5KIAA 4N82A 1E2HA 4JL6A 1L4FA 1ESCA 2QZZA 2EERA </