1U1IA

Myo-inositol phosphate synthase mips from a. fulgidus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSKDKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reaching for Mechanistic Consensus Across Life Kingdoms: Structure and Insights into Catalysis of the myo-Inositol-1-phosphate Synthase (mIPS) from Archaeoglobus fulgidus
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
molecule keywords myo-inositol-1-phosphate synthase
total genus 113
structure length 392
sequence length 392
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1u1iA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1u1iA01
1NWCA 3LT4A 4PFJA 4WLNA 4PN3A 2Y99A 3K2EA 1VM6A 4MVJF 4CMBA 3LC7O 4ZJUA 1D8AA 1HL3A 1OMOA 3C8MA 4JJGA 1B8VA 5JC1A 3RVDA 1ISJA 4OMUA 5JCJD 1TT5A 3R1IA 4AJ4A 5CG1A 1ZK3A 3KM0A 5A03A 4PRKA 1C1DB 4NI5A 2PGDA 2DBRA 1FDSA 4RZIA 2BFMA 2FSSA 3RSHA 1WMBA 5FWNA 4FIZA 1B2LA 4N54A 3BTSA 4D43A 4B8WA 4KOAA 3AM3A 2AA3A 4RVDA 5DCYA 5JO0A 2HSDA 1O5IA 4AJKA 1CIVA 1C14A 4AL4A 1W8DA 4N5MA 1UUFA 5TSDA 2Q50A 2I3GA 3IIEA 4CM9A 3GRKA 1TT5B 1A5ZA 4RV9A 4XGIA 1PZEA 3DZFA 2X86A 2Z95A 4ALLA 3KLMX 1XCBA 3JQ6A 1FDVA 4J1SA 3GUCA 3ICCA 1CETA 1LSUA 1HT0A 4K28A 4WE3A 1CEQA 5G0WA 5IXSA 4CR7A 3KSUA 4YAKA 4R1NA 2LDBA 3RWBA 3ZGYA 3A1NA 1E7SA 1Q1NA 2HMVA 4GSKA 4WLUA 3GG2A 4IDDA 1YBAA 1BG6A 4LRSB 3KSDO 4I1IA 5C7LO 4J2OA 1XLTA 4XDZA 4XYBA 5U4QA 1L1FA 2D8AA 2I5PO 1A9YA 4NJOA 4QO8A 5DN9A 2HMUA 2GYYA 4CUKA 4C7KA 1DEHA 3PQEA 3FHLA 4S1VA 4Z9FA 1DRWA 2G1UA 3ADPA 1PJCA 1LNQA 1M75A 3Q3CA 3DZGA 4PLTA 1GTMA 1Q7GA 2D3TA 3ZNPA 1DAOA 2DT5A 4R1UA 3DBVO 3ZV3A 4XEHA 2OOSA 1X1EA 2JKVA 2ZB4A 2ZTVA 1Y5RA 4NH4A 1I01A 4RVGA 3WMXA 2CF6A 4BB6A 1E3WA 2AMFA 1ISGA 3KYCB 3NX4A 1IPEA 3AW9A 2W2LA 1NFRA 4QSMA 1NQ5A 3KETA 4U6QA 3BMQA 2PFGA 2QG4A 3T4EA 4YRBA 2HDHA 1ISIA 4YRDA 5B4TA 2EKQA 1BXKA 1QLJA 1E6UA 1CQIA 4NU6A 5TLSA 3P2OA 1P1IA 3QWHA 3VZSA 4CMEC 1LTHR 5A9RA 4CMIB 5I7VA 2BHLA 4ONEA 3AUSA 1RYDA 1F0YA 3I9KA 4B8ZA 2G17A 5GZ1A 1GZ4A 1TI7A 1YJ8A 3WGOA 5I8ZA 2I65A 3VKUA 2HMWA 2BLLA 2YJZA 4IJWA 4B7XA 4MKXA 3TZQA 3DAGA 1JWBB 5KTKA 5HWSA 1XA0A 3IP1A 3H2SA 5FEUA 4HUJA 3LC2O 2PD6A 3AFMA 4P38A 3DFUA 3E9NA 3GK3A 2NM0A 3KV3O 2CF5A 2YYYA 1SCUA 1JN0A 5BT9A 4P22A 3TOZA 1K2WA 5B37A 4WNCA 3DHEA 8LDHA 4NNJA 1KVSA 4XQCA 3LT1A 2E6UX 5IDYA 3ZWBA 1GCOA 1U2GA 1KY4A 2AE1A 1YQXA 1EE2A 4IMPA 3JD0A 4N5LA 3K8ZA 5HA5A 5T64A 5ER6A 4J7UA 3MJVA 2CSUA 1PGNA 1YXMA 1YBVA 2O2YA 1UXHA 3N58A 4M49A 1YWGO 4YWJA 4PLGA 4TWRA 4J49A 5KVSA 2Y0EA 2ZTMA 4FFLA 1HE4A 4QTZA 3OSUA 4XYMA 1PU2A 4WASA 3KBOA 3E18A 4RDIA 3WIDA 4MP6A 3EDMA 1MG0A 1EFKA 3OJEA 1ZCJA 1ZSVA 2DUWA 1R4MA 3EHEA 3WR5A 4TKLA 1LSSA 1GCUA 3B20A 2GERA 4EJ6A 3BMCB 1EVYA 1QYWA 1Y1PA 4CM8B 3ETGA 5JYEA 3FCOA 1NAHA 4BNIA 2EERA 1CJCA 4MVJE 3V2UA 1YB5A 1Z73A 4I08A 3BMNB 1RWBA 3DZHA 4DC1A 4FDAA 5MGBA 3MTGA 1NR1A 1B3BA 1UDAA 5A04A 4DPMA 1ONPA 1Y81A 4GMFA 3LU1A 5DOVA 4B4OA 4W82A 1O89A 1X7HA 2Q46A 2YQ5A 1X1TA 3FPLA 4BKQA 1RM5A 1U5CA 1Y8QB 2DTXA 2BELA 2RHCA 3IUPA 4GQAA 2NVUB 1YL5A 3NAQA 4BV9A 2O4UX 1YKFA 4IUYA 4Q3AA 2VHWA 1GYQA 3AY7A 4CM8A 4FOSA 1DIGA 4XJTA 5BSHA 1XQ6A 4FW8A 3SC6A 3X2EA 4NJMA 4PZDA 1LDYA 3K6JA 1HETA 3SLKA 4YT4A 4GSLA 2EKPA 1ORRA 3CXRA 2H5LA 1H6CA 4R16A 4L0QA 2FY8A 1JTVA 1WAMA 3WS7A 5L7TA 4J0EA 2V6MA 2A4KA 2UYYA 3ZWXA 4NBTA 3B1FA 3DEYX 1ZJZA 3SJUA 4R9SA 3PLRA 1WPQA 1WP4A 1IYZA 4Z9YA 1ZNQO 4CV0A 4LCJA 3BTVA 2V6FA 4RF2A 3UFXA 3WX0A 3E9QA 4RVSA 2BD0A 3QJ5A 4A73A 2IE0A 4ID9A 3JQ7A 5EQDA 3SJ7A 3AUUA 4WK6A 1J0XO 1BDBA 1UP4A 4LK3A 2Z1NA 1BW9B 4J7CA 3ZV6A 3GNTA 3RU7A 3VDRA 1IPFA 2PGLA 5KNLA 3QWAA 1HZZA 4EW6A 1SAYA 3O4RA 1SEPA 3I9JA 4NFSA 2XXJA 5EJ2A 1L7DA 1YB4A 3OIFA 5M6DA 4YJFA 4R5HA 3NGLA 1VJ0A 4XX0A 3OH8A 1LC3A 3E5RA 3NUGA 4IM7A 5HS6A 2QRLA 3TJRA 3VTZA 1N7HA 3CINA 1OFGA 5A06A 1MG5A 2YHIB 1RM0A 2V7PA 5KWEA 2DKNA 4LVUA 3WJ7A 5G0SA 5IDQA 4D44A 1E77A 1GR0A 3GVCA 3HE3A 1LJ8A 2PZKA 1EBFA 2VRCA 3W8EA 3D7LA 1PJBA 4M8SA 3DBHB 5GZ6A 5JYFA 1V3UA 3G49A 3ST7A 1NX6A 4GKBA 1UZNA 4NK5A 1C1XB 1XKQA 1DC5A 1LLDA 1QYXA 3ZU3A 2Q2QA 4OL9A 5THQA 1QYCA 4A03A 4XGNA 4WLEA 2H1SA 1YRLA 1F8GA 4ILKA 1SEVA 1LRKA 2GR9A 3GZNB 2NU8A 4RVFA 1TA4A 2NWQA 3E48A 3IQDB 2HK8A 3JQFA 1GYPA 3ETEA 3D3WB 1I10A 3WG9A 3D4NA 1RPNA 3WOHA 2HLPA 1GUFA 3AJRA 4CM5A 4B4UA 2Y1OA 4LCEA 3LDHA 4MO2A 3PTZA 3QE3A 3AI3A 4BNGA 2BFPA 4TRRA 4CMEA 4DQVA 3MJTA 5L40A 5EL0A 4BB5A 5KIAA 1UDCA 1UXKA 4AG3A 2AQ8A 2W98A 4D46A 1YDEA 1E1LA 1NASA 2JD0A 1QLHA 2VYNA 4J1QA 2Y0DA 2YV1A 1N2SA 3RUAA 4LVCA 1A71A 4RZHA 2GRAA 1PZGA 4PLZA 1BWSA 1U3TA 2FZWA 1RM3A 1E3IA 2UUPA 2VN8A 3PZRA 4Z3KA 5EESA 4JQCA 1GAEO 4RDHA 3TZCA 1PQPA 1MUUA 2QHXA 4Y9DA 4PG8A 3R6DA 5DOZA 3COSA 4UVHA 3WQQA 3F1KA 2B4QA 3I83A 4RQUA 1LEHA 1PS9A 2VOJA 2XAAA 3DONA 3WGQA 2RH8A 1TT7A 1CWUA 4JP3A 4TQGA 4R3WA 3FTPA 2JAHA 1IB6A 5JAZA 4CODB 4UREA 1NWHA 2Q1TA 1HXHA 3MJSA 3MJ4A 3MWEB 4JBGA 3E9MA 4E12A 4GLOA 4AJOA 3NEPX 3DDNA 1QXSA 2ZB3A 2B5WA 3DZKA 1B14A 4DLLA 1KEVA 3OETA 3KLPX 3U62A 1MX3A 1M6WA 1XR3A 1BGVA 3JV7A 4LMPA 3SX2A 3DAFA 1JKIA 4NPCA 3JD3A 4CMKA 5L4LA 5IF3A 4QFDA 5DBIA 1C0KA 3FTNA 4D0RA 1KETA 2OP1A 2UAGA 1YE3A 4G81A 5TNXA 3RC1A 3MOIA 3GVIA 3GT0A 3P7MA 3VOSA 5TJHA 1GV0A 1Y8RA 5KVCA 2ZCVA 1E3SA 3PHJA 4CLXA 5CHEA 4EDFA 3PFWO 4YAEA 3A14A 4IDEA 1F12A 2V6GA 1CRWG 3GY0A 1ZO8A 4O6VA 1EK5A 2EGHA 3WYCA 4KWIA 5DP2A 2C54A 2PLAA 4KTTE 4QUKA 1HE5A 4XYEA 5TT1A 2QRJA 3OFSA 3OEYA 2C5EA 4EBFA 1B3RA 1I3MA 1SOWA 1P31A 2PGJA 3ENKA 3MWDB 3K30A 3V5NA 1V8BA 2E82A 4WEOA 1JDJA 4RORA 1E5LA 4YAJA 2O2SA 3T7CA 4YJHB 3L9XA 4GLLA 2X9NA 5KKCA 3UKOA 3OBBA 3LF2A 2O3UA 2B83A 2FPIA 3HNPA 2E49A 4NFYA 4RGBA 2OL4A 4BO9A 4NR0A 1P1HA 5JE8A 4RF3A 4LW8A 2ZYDA 2Q22A 3GFBA 3UCEA 2PTGA 2W4QA 4ALNA 3ZI0A 4BO7A 1PS8A 1WDKA 3PHGA 2NV6A 1S6YA 3M2TA 1YVEI 5JYAA 4NDNE 1NFQA 2EKLA 2YY7A 3BAZA 4PG6A 4HNHA 1OBFO 1U4OA 3O9ZA 2VOEA 1LDNA 4TKMA 5CDGA 3DZIA 2OBNA 3AY6A 4IGFA 4CM3A 3LYLA 4RQTA 1E1NA 3UN1A 4X54A 2J3JA 4FC7A 4BUCA 1ZMTA 5MDHA 4EITA 3LC1O 2IYOA 4GX2A 4I5EA 4M54A 5F1KA 1Q7CA 3OEWA 5DCUA 1I3LA 2X1HA 2P91A 2VT3A 3WGIA 3PWKA 1TLTA 1EEHA 1NHWA 1QR6A 1F17A 2TMDA 1Y9AA 2IEDA 5DP1A 1QYDA 2BI8A 4IJUA 1DAPA 4R1SA 3IUSA 4BV8A 5A05A 2DFVA 1PX0A 2QYSA 4DLAA 1ADCA 4CUZA 3U0BA 5IXYA 4IY1A 4B3HA 3F4LA 4ALIA 1FF9A 3H9EO 2TMGA 5K6AC 3QIVA 1QYVA 1LLQA 3OHSX 2I6TA 4LMRA 3VH3A 3ZNQA 1PS0A 1Y8RB 4AJ2A 4CLDA 1AN9A 5C7IO 4GVXA 3I9MA 4R4JA 4UULA 4IMRA 4E3ZA 2WEKA 2NVUA 2WD7B 2NVBA 4AJEA 4PLVA 2A92A 1F14A 4JJFA 4I5GA 4TRMA 2PWZA 3PYMA 5TGDA 2ZJ0A 4HFMA 2AXQA 3H5RA 1QRRA 3SLGA 2JL1A 4NJMB 4E30A 2NACA 2I99A 5DBGA 4XB1A 4A7PA 1SC6A 4BGUA 4CMCA 4BNXA 4AJJA 3PQDA 1RM4A 1JU9A 1KERA 2VZ8A 1MB4A 1MFZA 2GLXA 1O95A 3QW2A 1UAGA 5HBRA 1X13A 1MC5A 3BHIA 3FI9A 3TL2A 1E7MA 4D41A 3JYOA 4JBHA 4L76A 4XRGA 1VRWA 2Z1MA 3CMMA 1B15A 1O0SA 3O38A 5G4LA 2GPTA 5BSFA 5JO9A 4DQUA 3C1TA 2EJWA 3I9NA 4B3JA 1N92A 4WCDA 4HBGA 2RAFA 4XR9A 4DXHA 3F47A 2FPPA 2O3RA 2BKAA 1ADGA 2VTDA 3FSRA 1A9ZA 4JGBA 3EZYA 1WXDA 1ENZA 4B4WA 4RPKA 3VZPA 3ZV4A 5JYDA 3GN2A 3ZCXA 3Q6IA 3DTYA 1ZZEA 2H9IA 3KB6A 4OYRA 2AW5A 4PGFA 1NHGA 3H4VA 3I52A 3WFJA 1LU9A 3A4VA 9LDTA 3PDJA 1GDHA 4YJFB 1ZXBA 5KKAA 1PQUA 5C7OO 1VJTA 3U5TA 1HYHA 1XELA 1LDMA 4B4VA 2HCTA 4XGKA 3VH4A 5C3MA 4L4RA 1J5PA 1I2BA 3NDIA 2XF8A 3CSDA 1NQOA 4K6CA 1LRLA 4CM4B 3ADOA 1KBZA 2JCYA 1C0LA 3Q0EA 3FBGA 3DOJA 1CERA 1T2FA 3CZMA 3GGOA 3K9QO 4URFA 4CM1A 4Y6SA 3QHAA 3NT4A 5T8KA 3HHPA 4J9UE 3HSKA 2PK3A 3RKUA 1DSSG 2C7VA 2VUUA 4CV3A 3ASVA 5A5EA 2ZATA 2B35A 2IZ1A 1Z7EA 2IODA 3GFGA 3L4BA 5AXAA 4WCFB 3ZNNA 1XIVA 3X2FA 1BRMA 8ADHA 4CQLB 2OFPA 4PZEA 1LRJA 1HE2A 4YT2A 2IZZA 1EQUA 2G5CA 3NDRA 1K6XA 4LSMA 4DTIA 1P3DA 4ALMA 5IFLA 1BW9A 4CLRB 3DAPA 5LCXA 1ZSNA 1JVSA 3GNQA 3PFFA 2OHXA 4GL4A 4YPOA 3ICPA 4BNJA 3QVWA 3IC5A 3KEQA 4HX5A 4D3FA 4E5PA 1NNUA 4KTVE 4MVJG 3ULKA 3W8DA 2P4QA 4KUGA 1PTJA 5A9SB 1KS9A 4E32A 1BMDA 2W2LD 2YHUA 4FFNA 1M76A 3L0DA 4YXFA 3HDHA 3DC2A 1I0ZA 3GMDA 3ZWOA 3UICA 1WNTA 2HMSA 1R0KA 3M1LA 4OM8A 1P1RA 4GWKA 4LGVA 3H8VA 4FFRA 1R12A 2B0JA 2E4AA 3PIIA 3DR3A 4J16A 4XWYA 4D42A 2DTEA 2VWPA 3LLSA 4TVOA 2J5QA 3GHYA 4BNFA 4RF4A 4CMJA 3WNVA 4JK3A 3OJ0A 1EDZA 4MPDA 2JJYA 3W1VA 1I30A 4A10A 2PD4A 2C29D 2FSVA 3FNGA 4BQPA 1GPJA 1T1RA 2VQ3A 3DBRA 5BSEA 3ZN2A 4R69A 1KVQA 3HZZA 3PEFA 1YL6A 4GH5A 5IG2A 1UXJA 1PQWA 4BNKA 5ITVA 1SZJG 4PG5A 1ZEJA 2DTDA 1HSZA 2YUTA 3GGPA 1R15A 4WCFC 2NTJA 1DFHA 1LXCA 5JMPA 3JQ8B 3IJPA 2DQ4A 2X0JA 2G76A 1U1IA 3JQFC 2GNAA 3JD2A 2PH5A 2FR0A 4F45A 5L51A 1ISHA 2FHSA 4CQLA 4DUPA 1H6AA 1IUKA 1HF3A 1FDUA 3ZHBA 4XQGA 3RJ9A 3AI2A 2ZB7A 4YJDA 4FJ0A 4Y67A 2NUAA 4FSHA 3Q11A 5C37A 3F6YA 1YL7A 1VE9A 3PK0A 3DB2A 1LUAA 2Q1SA 1XYGA 1Q0QA 5T73A 2FMUA 1X7DA 3CIFA 2X9GA 3F46A 3KYDB 4FS3A 5K9ZA 1DBVO 4J1NA 2QRKA 4HWKA 1AHHA 2QIOA 4NIMA 5EN4A 1PGOA 1N9GB 2PZMA 3AUTA 3PVZA 4FFPA 4B7UA 4J1TA 1MV8A 2CMDA 1CF2O 2X58A 4M89A 3WSWA 4ZHSA 2ZYGA 2FR1A 4XJSA 1PJLA 4BO2A 4Q3DA 3OJLA 4K9DA 3D3WA 4O63O 2IEBA 3D3EA 4MP3A 3WWZA 4UUNA 3U4IA 2VHZA 3DTTA 2HMTA 3HFGA 1DIRA 5CEFA 4RCVA 2BGKA 5CP8A 3RFXA 3PLNA 4W9NA 3UXYA 4BO0A 1EUDA 4CM6A 4JJIA 3ZWMA 4BO4A 3GUYA 1XWFA 4K26A 1N1GA 4WLVA 4R54A 1NFFA 1G1AA 2VHVA 2NNLD 4FGWA 3S2IA 2PZLA 3EGOA 1AXEA 2GSDA 3ZHXA 2SCUA 3WDSA 3D1LA 3ANMA 4ZN6A 1V35A 4OXYA 5JDCC 4DBVO 2Q3EA 2CVQA 3ZV5A 2X0RA 2J3KA 4BQRA 3WBBA 1QG6A 4H16A 4I9UA 2IXAA 1P77A 3NTOA 2RBEA 3B1JA 1KVUA 1ZJYA 4YJGB 4MVJH 3TZKA 1GEGA 1EVZA 1PL7A 3ZH2A 4IZHA 3WTCA 4R41A 4AJ1A 2PZJA 5KVVA 4MDHA 1K0UA 2CFCA 4E5YA 4CL3A 4IQ0A 2C07A 4MJLA 2VZ0A 2PR2A 1Z75A 1MP0A 1P33A 3BMNA 4OQZA 1EUCA 4TZKA 5TJ9A 3ROQA 3GZ4A 2EW2A 3FR7A 4Q3CA 2WYVA 2J5RA 5CEJA 3IL2A 3VTFA 3V2GA 5ES3A 4OKIA 3H6KA 3JD1A 3JQEA 3KYBA 1XU9A 4DRYA 5JY1A 3INTA 1DLJA 3GF4A 5G4KA 2JCXA 4Q9NA 1W6UA 3OQ6A 3EVNA 5JFOA 5IDXA 3U9LA 3PRJA 3ZNOA 2RIRA 1ONOA 3I4CA 1NPDA 3PHLA 3PQFA 5JNLA 3LT0A 5EERA 1JAXA 3MTJA 3G1UA 2FN7A 4R9RA 3PWSA 1OAAA 1KY5A 3WGYA 1N5DA 1DLIA 5KJFA 4PG7A 3QP9A 3ANNA 3K73O 1N7GA 1HEUA 2AEJA 2JFHA 2YV2A 3B1KA 3HG7A 5DDIP 4TMFA 1YGYA 3ZWYA 3GC6A 3FN4A 3R3JA 3P2YA 2Y68A 3I9LA 2IXBA 1KEWA 2C82A 1VL0A 2C2YA 2CUKA 4CL8A 3LK7A 4U8GA 4Z9XA 3EW7A 1O9BA 3PPIA 2D2IA 1IL0A 5AXBA 1DIBA 4AVYA 3RC2A 2DM6A 3G0OA 2BMAA 3O8QB 4O59O 4NHEA 3QRWA 4PG4A 4A27A 3M2PA 1ISFA 5HTOA 4CR8A 4G2NA 1MFPA 4OHUA 4UEOA 2Q45A 2O23A 4JLWA 4FJ1A 2Q2VA 2AEMA 1VL8A 5F5LA 3RUIA 3U4HA 4MIOA 4OOEA 3AU9A 5COAA 2QZ9A 4CQMA 3BHMA 4A5OA 2HO5A 3GH3A 1NR7A 1DO8A 1ULUA 3NT2A 4KWHA 3OJFA 1AUPA 4CM9D 1QORA 2O7QA 3PDUA 5DBFA 2O3SA 3GG9A 4L9RA 1JA9A 3GVPA 4XD2A 3H5NA 5DF1A 4IIUA 4DLBA 1BXGA 3TSCA 1TXGA 3RASA 1JLLA 1YO6A 4FBGA 1XG5A 3H65A 3LF1A 1X15A 3OA2A 3C85A 4I9HA 3RUEA 4AJIA 5JXWA 3TNLA 4W99A 2AG5A 1T24A 4C7JA 5CDTA 1NVMB 5CEEA 5I9MA 5JMWA 5A1TA 1M2WA 4E2WA 4IINA 1HYGA 3DMTC 1U8XX 2QX7A 4WECA 2X5JO 4R3NA 3S2GA 1PJ2A 4A26A 2JHGA 4BNLA 4DBZA 5T5QA 1P45A 4BL5A 1DPGA 4DIBA 3JSAA 4TRJA 4E5NA 1Y6JA 4BGIA 5KCZA 3UF0A 3QV1A 1R6DA 3JQBC 1PJSA 3UH1A 4CMHA 2BGLA 1LDEA 1U3VA 1SPXA 4IBOA 2B36A 3V1YA 4YT5A 1N8KA 2HQ1A 1DIHA 4RLSA 3PYLA 5IN5A 9LDBA 2JHFA 3LLVA 4BNUA 1A7KA 4E0BA 1LX6A 3TWOA 3Q2IA 4KQWA 3F5QA 1J49A 3DWFA 4YAGA 1K6IA 3H9JA 4Y98A 3P5SA 1HDOA 3GPDG 1UXIA 5ER9A 2HK7A 3I6IA 1ZXLA 4ZD6A 4IDFA 3H9GA 2CDAA 4YEDA 1GFSA 3BTUA 3PJEA 3RUDA 5HRUA 1T2EA 1FDWA 4XQEA 3RD5A 1JAYA 4ZQGA 3WLEA 2HRBA 3VC7A 3HDQA 5A3JA 5CPBA 5KJ6A 5L7WA 1EUZA 1DRUA 1VSVA 4YJHA 4BS9A 3L4BC 1B26A 4RJTA 2EGGA 3RFTA 3I6QA 3ZZNA 3QA9A 4CLRA 3HFSA 4CLOA 3C7AA 3AU8A 4MINA 4L4SA 4FQ8A 4OJNA 1PGJA 4BGVA 4D45A 2GF2A 3EUWA 1Q7BA 4P8RA 4FPXA 4QXMA 3VHRA 4EI2A 2HU2A 3IP3A 1D7OA 1X0XA 4RPHA 4WUVA 2WE7A 2FRDA 3N74A 2D59A 5A02A 4QX6A 4E2YA 4L74A 4Q3BA 3I5MA 3AOEA 3H5AA 2PH3A 2HRZA 1T1SA 5AYVA 1ZK0A 1A4UA 2C5AA 3KXDA 4IDBA 1EVJA 5EQFA 5JW6A 2O3JA 2W8ZA 3E1KA 3DBLB 3FRJA 3PGJA 4CR6A 3VVCA 1ZIDA 1UJMA 5IZCC 3GHHA 3OIDA 3KYDA 3V8BA 1WZEA 3K5PA 4ZQBA 2OZPA 1GD1O 5IZ4A 4JX8A 1DRVA 2DBQA 1P74A 3M6IA 4HADA 4H15A 4MIEA 2GDZA 1T4BA 4EJMA 4UVDA 1DC3A 1PSDA 2A9FA 2PY6A 3IJRA 3QY9A 1BTOA 3KZVA 1DB3A 3S1LA 4BO3A 4OKNA 4CQMB 4EEXA 4JCOA 4CLEA 2PNFA 3GPIA 2O4CA 5F1PA 5AXDA 1OC2A 1G6KA 3AWDA 1I3NA 4XYGA 1O94A 1YOVA 2P5UA 3I4FA 1QMGA 3OF2A 5T57A 3ETDA 4CQMD 2WDZA 4IPTA 3HN7A 4W4TA 5FFFA 2B4RO 2GASA 3JYPA 4BOYA 3MZ0A 1HDZA 1VJ1A 3VZRA 4A0SA 3GDFA 4BMVA 2NTVA 2OO5A 2AQIA 4TZTA 1DFGA 3BMOA 4BNZA 1J4AA 4U7WA 4YT8A 1QV6A 4D3DA 4EEZA 1DC4A 4WNIA 4LRTB 2OORA 1FJHA 3ANLA 1HDCA 3CUKA 5TF4A 3S2EA 3VVBA 3SXPA 3WGHA 5CDUA 4CLOB 1CDOA 2WTBA 3A06A 1ARZA 5DT9A 4CLHA 1W4ZA 1PWXA 3V1TC 2BFOA 1PR9A 3HADA 1PL8A 4KP7A 1Q0HA 1MC4A 4II3A 4ND1A 5JY6A 2YQ4A 4F46A 2Y05A 2VZ9A 4GGPA 1D3AA 2ZIZA 4WLOA 3E5MA 4DC0A 1LC0A 3D5QA 1YB1A 3LVFO 5CG2A 5JAIA 4RF5A 3BHJA 3HJAA 4NK4A 3WBFA 3I1JA 3VPHA 4RPJA 5CDYA 4NFHA 5I9NA 4K1LA 1B16A 3JTMA 5JCJA 1HDYA 4HXYA 4P4GA 2NQTA 2IYPA 2GN6A 1WVGA 3CMCO 4NQZA 4UVIA 5BNIA 1BVRA 1H94A 2NU9A 4BO5A 2VUSA 1MA0A 1MGOA 1N1EA 1VI2A 1Z7BA 4S3MA 5KJEA 4JN6B 3Q2KA 2CVZA 1BHSA 5F21A 1YQDA 3JQ7B 4J9VA 4CV1A 4EUHA 2EF1A 4BNYA 1BDMA 1V3VA 2R6JA 2ZQZA 3KO8A 3GAZA 5LDHA 2Y1EA 3E03A 4GX0A 3DOCA 2Y1GA 2GN8A 1Y9EA 3WB9A 1P0CA 1R4NB 4QO7A 1X14A 1TVEA 2YZ7A 3KRTA 1D4FA 3GRPA 2DFDA 4O1MA 4YJGA 3U09A 1LLCA 3JQ9A 4KDFA 3ZWNA 5C5IA 2A35A 4BNWA 1MLDA 5B4UA 1TB4A 3F1LA 2ZJ1A 4CUJA 2X6TA 1B8UA 1ZW1A 1B7GO 4IS3A 1OOEA 2Y93A 3TRIA 4ND4A 5KVQA 1R0LA 4O5OA 4BIIA 1UH5A 2D1YA 3GEGA 3JYNA 4M87A 4GI2A 3NTRA 4Z0TA 1I2ZA 3I23A 3NDJA 1ZBQA 1LSOA 2ZQYA 1OI7A 1GL3A 1Y7TA 3JQAD 1ONNA 4HP8A 3DHNA 1A7AA 2GZ1A 3C3XA 3ZHZA 3L6OO 4ND5A 4DWVA 2X4GA 4BKOA 2P2SA 1WLYA 3D64A 1P1KA 4UEKA 3TL3A 3UHAA 4DVJA 3FF4A 1E7YA 2HK9A 2FP4A 3ROKA 4AICA 2ET6A 1IHYA 4PCVA 4YQYA 4XB2A 2DU8A 4PIVA 4ZRNA 1PIWA 4AFNA 4H3VA 2O3TA 4QT0A 3HWRA 1E3EA 1JKJA 3MEQA 3U4CA 1HWYA 5HM8A 1NQAO 4YTEA 1DHRA 1PL6A 3OMLA 1GEEA 5COQA 3JCZA 5BNFA 2EG9A 1NVGA 4OH1A 3FR8A 4ZU3A 2I9PA 1GYRA 4FN4A 3S2FA 3E6AA 4I9NA 3VKVA 3OIGA 1JWAB 3W4IA 5CFZA 5IN4A 5ILGA 5A4DA 4YR9A 4HNGA 2WSBA 3K92A 1A4IA 2NLOA 5BNTA 4BNHA 2QZZA 3WWYA 4BKUA 2GD1O 4ZQEA 1U3UA 2O3QA 5JDIA 1TEHA 4RVHA 3NRCA 3TPCA 1P1JA 3GNSA 1KEPA 1E7RA 4J7XA 1PEDA 4OXKA 3GDGA 4Q3NA 1YONA 1R66A 1T2CA 1U7TA 4Z6KA 4DQXA 4NBVA 2CDBA 1U9JA 4F6LA 1B8PA 3PI7A 3PIDA 5JDCA 4QQRA 3G79A 1M66A 4WPGA 3B70A 4YCAA 1RJWA 2QYTA 4B3IA 4R5MA 1O6ZA 4FCCA 4M1QA 3FPCA 3GA0A 5B12A 3GVXA 3RKRA 4U6SA 1UXGA 5JS6A 3OM9A 2J5KA 2YFHA 3PHHA 4YYZA 3S8MA 4KZPA 1HDGO 4WOJA 1T2DA 1KC1A 2WYUA 3LT2A 2DBVO 3CPSA 1GQ2A 2I67A 2X5OA 4ZICA 4MVJA 4AJNA 1C0PA 1Y5MA 2WM3A 1L7EA 3O03A 3DZBA 3PJDA 5B4VA 1NPYA 3TFQA 4PRLA 1WMAA 4FC6A 1N9GA 4DGSA 1HSOA 4J90A 5AXCA 2YHIA 3JYLA 1P1FA 2JAPA 4AJLA 2R2GA 5THKA 2D5CA 5EMHA 1B0AA 4JXKA 2CDCA 3ENNA 5ENDA 1E5QA 5L53A 5KJCA 1I36A 2Q1UA 3NYWA 4P4LA 4CPDA 3JQDA 3F9IA 4HY3A 3T7EA 5ENVA 3WNQA 2ZK7A 2R00A 5JPIA 3P19A 2NQ8A 1KIFA 5ILOA 3CEAA 4ND2A 3WJAA 5JSFA 1H0KA 3IS3A 5G4KB 4WEQA 3QVTA 5AVOA 1C1XA 2ZTUA 3VDQA 2E48A 3NKLA 4IXWA 3ZWWA 3INGA 3ZWVA 1E6WA 3RBXA 2I76A 2V65A 1XHLA 1SNYA 3W6ZA 3FNHA 2UVDA 1VSUA 5I8WA 1DJQA 1KOLA 3T4XA 4B7CA 4MVJD 3CZRA 3WQSB 5G0VA 4BGEA 3BIOA 3VZQA 5DCWA 4BKPA 1ULSA 4FFOA 1Y8QA 4EYEA 1ZFNA 1UP7A 1LDGA 3QVXA 3WMWA 5L4SA 2WYWA 4GKVA 3HB4X 5I7FA 4PLWA 2NADA 3EYWA 1IZ0A 3R3SA 3SBOA 1IY8A 3B6ZA 3RQSA 3I3OA 1NYTA 3TDKA 4ZGWA 4RPGA 3JQGA 4D79A 2G0TA 1WDMA 4J0FA 2AEFA 3HUDA 2G82A 4NBUA 5TQVA 3RJ5A 3SVTA 5EIOA 3L4SO 2P4HX 3C1OA 1HDRA 3WIEA 3QWFA 1JVBA 4H7PA 3WGZA 1Z6ZA 4XIYA 3WYEA 2RHRA 5B1YA 2LDXA 3ONEA 1R4MB 3U3XA 4F6CA 5L9AA 2HUNA 1JKFA 1XU7A 2GGSA 4G5HA 2J8ZA 3DMYA 4P4NA 4RL6A 3RC9A 1U8FO 4BMSA 3G3EA 3DMTA 1FDTA 3F5SA 1NM5A 3A9WA 3ZU2A 1H9BA 1LBEA 4XRRA 4FOOA 5H83A 3AM4A 1EVIA 5G0UA 3VPFA 3E82A 2IZ0A 3IMFA 3QSGA 3R0IA 4ESOA 1H2HA 1SBYA 1I8TA 5AOVA 1ZVMA 3ZDFA 2DLDA 2NSDA 5GMOA 4BNTA 1U4SA 3DFZA 3FNFA 5FF9A 4DL9A 1LI4A 3BXXA 3GAFA 5IAAA 2I66A 4MKZA 2D4AA 3NV9A 2GZ2A 2UUOA 4WKGA 2IDZA 2JD1A 3PWZA 4BVAA 4L4XA 2EIHA 4I8XA 3QVSA 3ONFA 5KJ1A 1K89A 4E31A 1GPDG 1EK6A 2WMDA 4CMGA 2PA3A 5CPFA 1H9AA 5TT0A 3JQ8A 4NMHA 4JROA 4GAEA 1M67A 3RAJA 1UAYA 2VHYA 4BNNA 3QWIA 4Y8VA 1K3TA 1XDWA 2Q4EA 1P44A 2BRUA 4Z3DA 4DYVA 3OJOA 2Y1CA 2C59A 5CDSA 4GMGA 4D3SA 4IS2A 4E4YA 1YJQA 4BHTA 3A28A 1U3WA 1C1DA 4IQ8A 2VCYA 3UCXA 3NJ4A 3RUHA 2BF7A 5DNAA 5JAQA 7MDHA 1NVTA 3NT5A 1AHIA 1GUZA 1M6HA 4Y6RA 5CAEA 1EDOA 2VTEA 5ADHA 2JD2A 5KOIA 3BMCA 4ND3A 4HV4A 4WLFA 4NBWA 3M1AA 2P9GA 4R68A 1ID1A 2VNAA 3HDJA 2A94A 3EAGA 1GU7A 4WGGA 1AGNA 3AOGA 2C20A 3TZHA 3HN2A 2HKIA 3SC4A 5FI3A 4PLCA 3KYCA 4IZIA 3RROA 5I7EA 4U0KA 4ALJA 3JD4A 1F8FA 3U49A 2Q4BA 1ZMOA 2X7HA 4DMMA 4CMAA 4GGOA 3RI3A 2YV3A 3C1AA 1HLDA 1VLLA 2QQ5A 1SO8A 2H63A 4ZA2A 4XR4A 2W2KB 2YDXA 2RH4A 2WD8A 4KDEA 2X0IA 1LA2A 1C0IA 4OSPA 4BKRA 2P5YA 4CV2A 1PGQA 2GUGA 1MXHA 4J4TA 4TSKA 1BVUA 4AJPA 1ZKMA 4R01A 1H5QA 3GZNA 4B79A 1R16A 1I33A 1PJ4A 3DL2A 5JAMA 1EMDA 3ITKA 4YVFA 3WGTA 5I7SA 3RBZA 4HFRA 5BR7A 3TF5A 1U28A 2X23A 5T8KC 2X5KO 1VL6A 3AI1A 1LQTA 3TZ6A 5L3ZA 2D0IA 1LQUA 2C7GA 4WJZA 1E3WB 3OQ1A 2DAPA 3UGKA 3RIHA 4QECA 3GLQA 4C4OA 5JDIC 1G0OA 3LZ6A 2OMEA 4OGWA 4UUOA 1KVTA 3C7CB 1ZH8A 4XCVA 3GGGA 4FR5A 4PZCA 4ZRMA 4PLPA 5A3VA 3KSZO 4N18A 3C24A 3WXBA 1I24A 2B37A 2PV7A 2RCYA 2ZKLA 1JQBA 1FXSA 1H93A 3PHIA 5DZSA 5L4NA 3F3SA 3FWNA 2CZCA 1P0FA 4J4BA 2FR8A 3DZJA 2D5AA 1QP8A 4DPLA 4W7IA 3ROPA 5T6BA 3RFVA 1LLUA 3UW3A 4UEJA 4OAQA 3ROMA 3BMOB 1UZMA 3K31A 4YBZA 5EINA 3DXFA 1AE1A 1FMCA 3WSVA 4DPKA 4E5MA 1ZEMA 4TROA 1KC3A 2J6IA 4LSWA 2POQX 7ADHA 3VH2A 2ILTA 5F1OA 3Q9NA 1NXQA 3LQFA 2YW9A 3JQAB 3G17A 1HYEA 3EK2A 3K2BA 5L45A 2OUIA 1DOHA 2W2KA 1K5HA 4IGEA 2V6BA 1NBOA 3S55A 4GVLA 2GO1A 6ADHA 2Q49A 3PYXA 4XZ3A 2AG8A 3BTOA 4E2ZA 1GADO 1X0VA 2HJRA 1S7CA 1R0SA 3EMKA 3N7UA 4KMSA 4NG5A 3MJEA 1A72A 3IDSA 4YQZA 4Q39A 1E3JA 1GY8A 3AM5A 4MIYA 2GZ3A 1HTBA 2VHXA 4IDCA 2EHDA 5TC4A 3ONDA 2EJVA 2C0CA 4W9NC 3GOHA 4XQ9A 1NQTA 4EUEA 3CTMA 3HB5X 1HLPA 5COBA 2OP0A 5EPOA 4FGSA 4OO3A 5ICSA 3C7DB 2FOIA 3H7AA 3TN7A 3AFNA 2DPGA 2WWRA 2P68A 5A9TA 1QSGA 1T2AA 3QLJA 2PKRA 3UVEA 5J9GA 4UVEA 4MOWA 1RKXA 3LSYA 4DA9A 4CJXA 3D0OA 2Z5LA 1PJTA 3ITDA 4QFCA 2JCVA 4L8VA 3V2HA 2FZEA 4JBIA 1ZK2A 3GEDA 1EBUA 3PP8A 5A9SA 3EY4A 2Y1DA 1P9LA 2VRCD 2P9EA 1T26A 1DJNA 3G1TA 3JQGB 1ZK4A 4HFJA 3VH1A 2VT2A 2PKQO 3O26A 4BO1A 4EJ0A 3WQRA 5H82A 1UR5A 4PLYA 4EUFA 4R51A 1O8CA 3KOUA 4IJKA 2FWMX 4O0LA 2P9CA 4UVGA 3ZWPA 6LDHA 1SB9A 3H3JA 4RO0A 4PLFA 1GUYA 1BSVA 2WJPA 1PWZA 4AJHA 5L95A 4DMLA 4BO6A 4II2A 4OOFA 1D1SA 3E8XA 1CQJA 4WCFA 2YFQA 1OC4A 3GN1A 1HRDA 4NZ9A 4HKTA 3OICA 4L75A 3ZW8A 4JNKA 2Q99A 4W7HA 2Y67A 4JP2A 4J91A 4TRNA 4J4HA 4A2CA 1W0CA 5T67A 2BH9A 1KEUA 2DUUA 2AHRA 2O50A 1DFIA 2CVOA 2PD3A 4DIFA 1E1MA 1VC2A 3H9UA 3TOXA 3U4DA 4M55A 4J43A 1NAIA 4L73A 2NU7A 4I5DA 4J6FA 4Q3EA 4J3FA 1HZJA 2J3HA 1RYEA 1U5AA 2BFAA 3NTQA 1EE9A 3GEMA 1QKIA 3ZW9A 4CM4A 2E37A 5ITWA 4Y6PA 4YAIA 1JW9B 1F06A 1ENPA 3VAZA 1H2BA 2VWGA 3WLFA 1XSEA 2EV9A 4ALKA 1BXGB 2JFFA 4I5FA 1V0JA 1Q0LA 1SB8A 4RPLA 1WZIA 1EZ4A 2X0NA 4N7RA 3EZLA 3GVHA 4YACA 1V6AA 3OQBA 1J6UA 2GCGA 1GZ6A 3JQAA 1IZ9A 3EVTA 1ADFA 3H2ZA 3PJGA 3SEFA 1SOVA 1ISMA 2OXIA 4MVJI 2HJSA 4KUEA 2BI7A 3RUFA 3Q9UA 1AXGA 4ZQHA 4MKRA 1EQ2A 4FD3A 2EP7A 5F5NA 4D7AA 4IJVA 1PR3A 4DREA 3DO5A 3VPXA 4W6ZA 1IHXA 3CE6A 2VRBA 3BZUA 1PZHA 1V3TA 1NPTO 3DBHA 1V9LA 3PXXA 3KTDA 3RC7A 2VUTA 3W4JA 1U2DA 3GQVA 4GWGA 5JC8A 1YQGA 4IQGA 1CYDA 4XYLA 2YDYA 1Q2XA 2VYVA 3F4BA 2B4TO 2BGMA 2EW8A 4KQXA 4E33A 1MXFA 1X7GA 5F3RA 3BA1A 1ENYA 3HQ4O 2EEZA 4EGFA 3JYQA 5BQFA 4KUHA 1GQYA 1SMKA 3WFIA 2Y0CA 4UUMA 1WW8A 3BYZA 4IIVA 1E7WA 1ZUD1 2JFGA 4XKJA 2B69A 3FBTA 3JQ9C 5FI5A 4YB8A 3IOYA 1ZK1A 1DIAA 2HAEA 3STHA 4GBJA 5JBIA 2F00A 3H9QA 1G0NA 5K0ZA 1IULA 3GR6A 2VYND 1YDWA 3AUAA 1E92A 3NGXA 5LC1A 2UDPA 2VWHA 3IAHA 1UP6A 2CY0A 4E5KA 2X22A 5J23A 3ORFA 2GN9A 1UZLA 5K6AA 2EP5A 1DXYA 1YH3A 4OIMA 5TIIA 2FPGA 3D5TA 1YBMA 2X9VA 2UV8A 2ZYAA 3ZHYA 4DYDA 3W4KA 2VWQA 5IDWA 5U9CA 1A27A 2XPCA 4GX5A 3ON5A 3UCFA 3ZU4A 5G2OA 3QWBA 1E0DA 3L77A 1I32A 3WYBA 4R1TA 4ZQFA 4OXNA 1R37A 3IKTA 2C2XA 1E3LA 4E2XA 2F1KA 1GZ3A 3CKYA 1Z82A 2VNSA 2AQKA 4Z0HO 1HDXA 1BXZA 4MP8A 4E6PA 3OECA 2CNBA 3JQCA 4PLHA 3UOGA 4BNMA 4HFNA 3OP4A 1I3KA 4CMIA 4FJ2A 5TX7A 1YS4A 3GMSA 2DC1A 4K6FA 1EFLA 4OSOA 3VPGA 1NP3A 3OA0A 2O7SA 4NBRA 5AQ1A 1PJ3A 3D4PA 3RCBA 2GN4A 1XGKA 5IJZA 3H3FA 3RBVA 3AY3A 2WE8A 2W90A 2X8LA 4U0JA 3TQHA 3L07A 4XA8A 1WDLA 5TRTA 4YDRA 3UAGA 3PGXA 3QVOA 1FK8A 3DHYA 4YA6A 1XQ1A 1T25A 2EWMA 4WOKA 4UUPA 1W73A 4YRAA 4IDAA 5DULA 4CM7A 5TS3A 1KYQA 3WICA 1H6BA 2OGUA 3D4OA 2OBYA 1Z45A 3KHUA 4LISA 3KEOA 1U7HA 1HE3A 4MVJP 1YOVB 3K96A 1OZAA 3NJ8A 3ZWCA 3O8QA 1I2CA 3DQPA 2VYVD 3QQPA 2XOXA 1QV7A 1VPDA 2IRWA 3DOOA 4OQYA 4ITUA 1I5RA 2DPHA 2NTNA 3GDOA 4BMNA 3MCVA 4FB5A 1ADBA 5L7YA 4GX1A 3UUWA 3L6EA 4RLHA 5A5FA 2Q2WA 1ZSYA 3W6UA 3WTBA 1ENOA 3V1UA 1XEAA 3RU9A 4D0SA 3L6DA 2CD9A 1NTOA 2DVMA 3DBLA 5H81A 4N5NA 4XDYA 2PKQP 3WGGA 1VKNA 4M86A 4GPD1 4DIOA 4EZBA 1PZFA 1IE3A 3VPSA 3Q1LA 1E6EA 2QW8A 4TVBA 1D1TA 3EC7A 5I9LA 4U5QA 1GQQA 2Y66A 4XIJA 4MVJM 2O48X 2R00C 4F3YA 2XXBA 3IKVA 3W8FA 1T4DA 1Z74A 3I9OA 4LN1A 5GY7A 5HS4A 3INRA 1LDBA 2NU6A 3KVOA 1GV1A 3HDYA 3ZWAA 1DC6A 2Q1WA 2I3AA 4PVDA 1C3VA 2AQHA 3PZBA 4ZVVA 3ABIA 4INAA 1IOLA 2ZCUA 3FWZA 3AK4A 3TFOA 1HKUA 4JIGA 3L9WA 4IXTA 2H6EA 1WWKA 3BMQB 2DBZA 3MOGA 1ML3A 4PVCA 1PJQA 4BNVA 5IZCA 1KVRA 5JCXA 5BSGA 2ZB8A 3CH6A 5GZ3A 1UDBA 4ROSA 4NU5A 3FNEA 2AE2A 3JQBA 1E1KA 5U1PA 4Z0PA 5JLAA 1K6JA 3DBRB 3AOEC 5LDGA 1VKOA 4IDGA 4FFMA 1LSJA 1E7QA 3FD8A 3MJCA 4RVUA 4J2HA 4QEDA 4BO8A 3KUXA 2Y1FA 5FYDA 3RUCA 1DHTA 4E21A 1DDOA 5ICMA 4E13A 5G0TA 2ZTLA 1H6DA 2J3IA 3ZU5A 4G65A 2EXXA 3PJFA 2WD7A 1R4NA 2B5VA 3ASUA 2NVWA 4UAGA 1PGPA
chains in the Genus database with same CATH superfamily
3V46A 1L5QA 3JAWB 4PFJA 4YNBA 4PN3A 1S0UA 2IPNA 2PWYA 5EWJB 4A0GA 2FKAA 5DE3A 3QVMA 3N2ZB 4O2BB 4BJ5A 1Q19A 4ENWA 4G5FA 4C5BA 5K8JB 4LJ6A 5B7QA 2JGLA 1B8VA 3AERB 1ZGJA 2NNWB 4BRZA 5BWMA 2V5VA 3I0MA 2BFCB 4YAWA 1JA0A 2PUFA 4AS3A 4Z4GA 5CG1A 3L04A 2FQQA 1BXRB 3KM0A 1WW3A 3GLVA 4HAYA 3G9TA 4NI5A 4WOPA 5KX5F 2PGDA 2F43B 4GMDA 2V3VA 1Y1TA 2L42A 5J3JA 3LAWA 2QGFA 2EG5A 3CS3A 3ELYA 1E4VA 1L4EA 5LWQA 2F3TA 2J31A 3RSHA 1JKMA 5ALOA 1T8TA 1X9GA 1KQGA 3NGMA 2KE5A 4B8WA 1ONSA 4PYKA 1Z08A 2H59A 3AM3A 2AA3A 4RVDA 3OZVA 4IV0A 5EE0A 4A8HA 5JO0A 2VJQA 3EASA 1X7ZA 3EWSA 3KJZA 2J9XB 2PGOA 3K3PA 4HOYA 2ONJA 5EPEA 2ZYIA 4QDUA 4W8HA 4AYXA 1NN1A 3SZMA 4WD3A 1JMYA 1WVIA 1FW8A 5CFNA 2JANA 1JG2A 2HSZA 2CXQA 3OD5A 4JLKA 4ALLA 4IG4A 4J1SA 2ANCA 3OZFA 4YMUA 1NYRA 2AYYA 3ICCA 1HT0A 3L8YA 2R48A 1CEQA 4JLUA 5SYAA 3WMFA 1UQTA 4B7ZA 5D5QA 2XZLA 2AFIA 3KSUA 2QROA 4KXLA 3VR4D 4E2FA 2BL4A 4KNYA 3A1NA 4O29A 5D3ZA 3RRXA 4YUAA 3NONA 3ZD7A 3GG2A 3I5XA 4IDDA 1YBAA 3D2CA 1BG6A 3R40A 3KSDO 3LOUA 4I1IA 1Z4NA 2YJTD 3AEUA 2V6JA 2WZCA 4XDZA 5U4QA 2CBXA 5F4ZA 4NJOA 3W77A 3B1VA 5DN9A 1JR2A 3NOXA 4CUKA 1YZVA 3B5IA 1GQRA 4HDAA 3FHLA 4HPWA 3CWQA 4MV7A 1WXFA 3HCAA 3MGBA 4C87A 4DQDA 1QC5B 4EYKA 5LU8A 2VC2B 1Z4JA 1CQWA 1H1LB 2FEAA 2FZVA 2G1UA 2HCBA 2RGXA 1PJCA 4I1UA 7AT1A 4UXJA 3WWOA 2B8TA 5B58T 3ND5A 3CLVA 2D3TA 1TA9A 2V7QD 1KQ3A 4PIMA 2A9JA 2J4CA 3KJNA 3ZXIA 4C05A 4Z3OA 2DT5A 1MEJA 4YRCA 3STUA 2QPLA 3TIVA 4EG5A 5A0TA 2OOSA 1X1EA 5CDFE 5E2IA 2A3NA 4NH4A 4K5QA 5FOUA 4TUYF 3K1AA 3QJGA 2AMFA 2X6QA 1LBTA 3QFSA 1KOJA 1LVHA 1Z2CA 4QRHA 4BLTA 4QSMA 3ZX5A 3QE0A 1E4EB 4PRYA 1VHLA 4YRFA 1SXIA 3DOEA 1H65A 1HQCA 2HCRA 2QG4A 2ZYSA 4L3WA 5HXAA 4YRDA 4JSTA 1MABB 5B4TA 3JS5A 1PTKA 2I4RA 2YX1A 3LBYA 3QXHA 4IGKA 3ZBPA 4V39A 1CQIA 1L5MA 5TLSA 1JBQA 4NE9A 1KRWA 1GILA 4KWEA 4DG5A 4DR2B 2Z2JA 2MMGA 1G8FA 1Z12A 1P1IA 3TKAA 4GZ3A 4FW9A 1EJ0A 2WUFA 3QWHA 4RD4A 1REQB 1NRJB 3CHYA 1Z34A 4NP6A 4MHOA 4OG2A 2AZMA 3WAKA 1PTJC 4CMIB 1AG9A 3CRMA 4D9IA 4RTRA 5LQUA 3A25A 5ESRA 4PX3A 2BHLA 4ONEA 2GLTA 2PLRA 1ZONA 1WABA 2DE0X 2I87A 5GZ1A 1GZ4A 3GEIA 1EHIA 3I9KA 3WGOA 2F3PA 1VYHA 1Z9BA 4BVJA 3THWA 2YJZA 1MTOA 1R7RA 2DH6A 5ALLA 4YR7A 4ABYA 1L5WA 1KQFA 4MKXA 2B94A 1D2AA 5HPYB 5JVDA 2J09A 4E94A 1IG0A 2Q8PA 4GYWA 3VYTB 3FDZB 3WIOA 2BMVA 4RDXA 2J0QA 2WUGA 3IP1A 1QGAA 4IQ4A 2VH5R 3H2SA 4NYMQ 4WERA 5FEUA 4CG3A 4B6FA 1NJ2A 3KQUA 1GGFA 2PD6A 3MBIA 2WWGA 3ZD6A 2Z6AA 1CF9A 2WF5A 3OAAD 1UANA 1ZN8A 3PR2B 1JN0A 1ETHA 2AF3C 3M33A 1AN0A 1L5GB 3TSOA 5F3DA 2R8ZA 5KC8A 4AS1A 1K2WA 1VBMA 2UXDB 1VHJA 3MTQA 1T8UA 4J07A 4PSUA 4HS9A 1O2DA 3D43A 1KVSA 4XQCA 3LQYA 3ORHA 5BNWA 1AB6A 1PK9A 3A6LA 5LQKA 5IP5A 1U2GA 3ROTA 3SS7X 3O4JA 1MEEA 1EE2A 1NXVA 3TSZA 1PG2A 1OI3A 1F2VA 3L4KA 1XL0A 1CJTC 4OHCA 4LJ8A 5C7YA 3A9VA 3O8NA 1UWLA 2Y92A 1U9YA 4QXPA 3WL6A 4M49A 3L5OA 3K6KA 1Q0RA 2C2OA 4YWJA 2G6TA 4PLGA 4DLNA 1V43A 5KVSA 2FK7A 3BBLA 2ZTMA 4FFLA 2HM7A 4PXAA 4GBGA 4QTZA 3OE5A 3FCSB 4XYMA 1AKWA 3FGOA 1SA0A 2IELA 1WB5A 2ZYWX 3P0RA 4WASA 1HFEL 4RDIA 4QREA 4Q9IA 3QG5A 4MP6A 4U6NA 2PCLA 3EDMA 4BLUA 1Y80A 3RV4A 2ESRA 2YWDA 3OJEA 1JF8A 3WKDA 1ZCJA 5AK6A 1PX2A 1RHKA 3IP5A 5EYPB 3TKLA 3CEJA 3DV0A 3CM0A 3STXA 1GGHA 3B20A 4G5OA 2A9RA 4MS1B 2AN4A 3BMCB 2DFKB 2P6RA 2NU7B 2P6UA 3TLXA 5LYJA 1VECA 5JYEA 5AUQA 3LZDA 1NAHA 2E1RA 1ZVVA 1OGIA 3VNRA 3M4YA 1DAGA 1W5AA 5JHHB 2EERA 4MVJE 3M4XA 1C7EA 3BMNB 3HXMA 3MWLA 4WBXC 3N07A 6Q21A 1E79D 1NR1A 4LZJA 3MCAA 3ESCA 3IT3A 2H2FA 5A04A 2PLFA 3OJWA 4YK7A 5HRCA 4B4OA 1JKJB 1ZVKA 2FG6C 2KB0A 2XADA 2YQ5A 1CRZA 1WZUA 2M6RA 2YVUA 1QDEA 4WOCA 4S12A 1WRBA 5I9IA 5A5VA 3H5TA 4CDNA 1A04A 2FQYA 4YP5A 2IXGA 4M0KA 4TWIA 4GQAA 4MKGA 2V1XA 1F6WA 3NAQA 4JNCA 4QG7A 2VK2A 1Q3HA 2O4UX 1KZYC 2C7PA 1Z6XA 4BVFA 4JVNA 4Q3AA 3I72A 4DYHA 1GYQA 4EG6A 1BQ3A 2XCSB 5BSHA 2YMLA 4PZDA 4QOGA 4B84A 5K0JA 4K46A 4YT4A 1AH2A 5D6OA 5EP1A 5F12A 2B7LA 2H5LA 1IDOA 4QBGB 5LZ8A 1H6CA 4BB9A 1W87A 3KUCA 4L0QA 1GAXA 4LGYA 1JDSA 4EHFA 2ZI3A 2FY8A 3DM5A 3QOXA 1JTVA 3QENA 2R6ZA 5BN5A 5DHAA 2X0KA 3ET4A 2DHEA 2PMBA 1F4VA 3EC2A 4DLWA 1Z2EA 1MDBA 2P6OA 5J2UF 2OV3A 2VPYA 3AEZA 1U7ZA 3U40A 3MXTA 5CA0B 5HZKA 1N33B 5KKNB 1XLUA 1TUIA 2E5FA 1T0PA 3JTEA 3NEAA 3UFXA 3E9QA 4RESA 3HS3A 4YMLA 1QHGA 1HH4A 1TIKA 4FYJA 2ZUWA 4LEIA 4M0CA 4AY2A 2JB9A 3UK1A 3EIWA 5K0BA 4TQ9A 4MZXA 2WV7A 1UP4A 2Z1NA 1VL2A 2VDRB 4I3FA 4KV7A 1FFWA 3RU7A 5LQCA 1KWKA 3A4IA 5TDHA 3OLYA 4B32A 4G36A 1P91A 1SAYA 2R6DA 4ARAA 5BVGB 1E60A 3I9JA 1NBAA 4NFSA 1NR5A 3CVVA 1VGQA 3H6GA 4YJFA 5M6DA 1CUVA 3HJUA 4GRAA 3ZHRA 2PGNA 3PFKA 4DUYB 4MW4A 5DNWA 4KQEA 1ZM3A 4GM0A 4QRDA 5JIBA 3VTZA 4RIGA 4BEWA 2R3SA 1OFGA 4YS6A 5ALJA 3LD9A 1HT1E 2HPAA 3G5MA 3DT6A 5KWEA 4AMYA 3TINA 4LVUA 3FOBA 3GJZA 4FOPA 3HE3A 1FUIA 2PZKA 4MZDA 4MLDA 5KWJA 3KZCA 2V7TA 1XK7A 1UIRA 3QBTA 4UD2A 3VM6A 5D01A 1N2CA 1H22A 1AKRA 1TCUA 1U1EA 2WJGA 1RCFA 2ZRMA 1JIIA 1XWWA 3VNUA 2OSBA 3PQVA 1C1XB 1K2VN 1RWVA 4TV8B 1QYXA 4H0FA 4NOLA 1NMSA 3P9IA 1HT3A 4TQAA 4ZAZA 4UHHA 3ZU3A 4BWYA 1QYCA 1CYEA 4HQKA 2R8YA 2ZCJA 4DHEA 3ZCQA 2PX6A 4NL4H 2NU8A 1DEOA 4C7OA 1HQYE 2BF4A 1OUMA 1TA4A 2NWQA 4F2WA 3AFHA 4TX1A 3SYTA 4C4YA 3TLCA 2HA0A 1RPNA 1H5NA 2J9FB 2ZJYA 1GUFA 5CD1A 1A9TA 1R9JA 3SQLA 4O2LA 2X0DA 4LCEA 2XKJE 4MO2A 3L7AA 1BJTA 1NI4B 2ZJ8A 2DCMA 3AI3A 3PTZA 2HIGA 3FVTA 2VZEA 3QE3A 4HNRA 3UUFA 4Z7NB 1U0OC 3HU2A 1GP2A 1UDCA 1V8ZA 2Q28A 2FX2A 3AI7A 2YWEA 2FSGA 3PGMA 1WO8A 2C99A 2WHPB 2XQIA 4LSGA 1E8DA 4F38A 1R8XA 1J7KA 4JVLA 3L0OA 1ZBDA 3E4DA 2PX0A 3MNFA 1WBBA 2IEAA 1J8VA 4OQQA 4UBMA 2UUPA 3NRJA 1RKVA 4RNCA 4JC8A 2X19A 3TZCA 3FZEA 1MUUA 1SVMA 1DBQA 3KALA 4HDMA 4YAOA 5E8RA 1PV4A 1HUQA 2B4QA 3I83A 1N5MA 3IAAA 4RQUA 3UATA 3R3WA 3Q88A 1H5UA 3U7HB 4OHKA 3TR5A 2XAAA 2QVYX 4BRSA 2OVFA 2OY0A 3RVQA 1NUTA 1W9HA 2R79A 3O2NA 4RELA 4DIEA 4DLZA 1IB0A 4O4IB 4A0QA 1CBUA 2JAHA 3L41A 3OU6A 4CODB 2A1TS 1UBHS 2GK3A 2OVBA 7REQA 1HXHA 2JA2A 1FNDA 3WMRA 2WZQA 3MJ4A 4W5TA 3I2YX 1JQJC 2XDAA 4NYJQ 3SM3A 4E12A 2WM9B 5KQSA 3GDWA 1QXSA 1EM8B 3H2BA 4LRQA 1QU3A 3TZEA 1G5RA 1ADYA 5HZMA 2B5WA 2JLAA 1PR2A 4DLLA 1F4LA 1KEVA 4IWNA 5A3RA 1GGEA 4D8UA 2YBDA 4CF6A 1UC4B 4F2HA 4KREA 1BGVA 4ZT4A 5JNUA 5TPZD 3IVRA 3NKFA 2QVGA 4XXHA 3M4NA 2QMHA 4HDNA 1E9VA 1KSFX 2JG3A 1W5EA 4NPCA 5L4LA 3MLAA 3SFTA 5KYGA 2R6FA 2RK6A 3UWPA 4AM8A 1XAGA 2SHKA 3BJEA 3CJTA 4TLBA 3ILYA 2A88A 3NBYC 4NLLA 4UBNA 2HSGA 1NN0A 1E2HA 2VT7A 3RC1A 3MOIA 4O4JF 4PC3A 5C1IA 4HVCA 2W9XA 1TGVA 2HMAA 3GT0A 2HBYA 1Y8RA 1H8EA 5BR1A 4QEKA 2DQYA 4EWLA 2COEA 2Z57A 3PFWO 4YJGB 3OZSA 3A14A 4P5EA 2SECE 1D2RA 4GNRA 4DDTA 1EK5A 1E9EA 3WYCA 1TM1E 2WT9A 4IWXA 4W7SA 5EWLA 2PLAA 4KTTE 4DV2B 5J2UA 4GI7A 3OEYA 3C8HA 1GKYA 1B3RA 4Q7LA 5IAJA 3ROFA 2DKOA 4WEOA 3BJZA 2FOXA 1E5LA 2OQRA 3VU9B 1ZLYA 3BXZA 1HLGA 2QOEA 1L5YA 1RWQA 1PVDA 2O3UA 4FMDF 4PO1A 2B83A 4EPTA 4HN9A 4UHKA 2FPIA 1E2JA 2E49A 4L9WA 1XPUA 2GZSA 2DOKA 4FZRA 4Q1DA 4BO9A 2BGGA 2QN9A 2W4MA 1XRRA 5H16A 2ZYDA 2Q22A 3GFBA 3PL1A 1PR0A 1XJWA 2H11A 2W4QA 4FGZA 1WKVA 4N6OA 4ZOLB 3T7TA 4XE5A 3ZI0A 4A8JA 1PS8A 3A9UA 2R47A 3R0VA 2NV6A 5FWYA 1ZCZA 2G25A 4NCXA 4NDNE 5JYAA 3RVRA 5JCPA 1XQVA 1KI9A 3C0KA 2YY7A 3R9KA 4B73A 3JQRA 3SXUB 1OBFO 1WBJB 2P9BA 2LNDA 2VNIA 2VOEA 1DADA 1LDNA 1W25A 1WDWB 2C2KA 2E6KA 3HY3A 4QPDA 1G9TA 3UPTA 4CKWB 4ZGBA 3HKDA 4AT1A 3AY6A 1OPRA 4IGFA 1Z4OA 4CM3A 2I4TA 4QJ4A 5DM70 1E1NA 5AVYA 1BHQ1 3BCUA 3FY4A 2I80A 5AIAA 4DA7A 1GTVA 1ZMTA 2GCPA 5JECA 2A9QA 1EB9A 2R62A 2TECE 4NCKA 4I5EA 1KDRA 2GA8A 1LVUA 1Q7CA 3OEWA 3SHVA 4CIYA 1I3LA 4LJRA 2VT3A 1R8YA 3PWKA 3KTAB 1TLTA 1EEHA 2EBWA 2W6QA 1F17A 4JC5A 4RBNA 5B3AA 3GLIE 1VIVA 3D6JA 4O4IF 3F97A 3RJMA 3W9BA 5LJLA 1QYDA 2PRKA 1Y42X 2PJUA 3QU4A 3G0HA 3BAFA 1VBNA 1PX0A 3ZLTA 1CUUA 1PNVA 2YIDA 4DLAA 4P98A 4EJSA 1QDUA 5AWFC 3U0BA 1ID8A 3KJEA 4ALIA 1FF9A 1WXXA 1JJ7A 2V7VA 2TMGA 2WF7A 1E63A 4WQMA 3QIVA 5K6AC 2RGRA 3I76A 5IBQA 2X9LA 3K4PA 1V4BA 2WP8J 3EOAI 5IH3A 1Z18A 1XFAA 1Y8RB 1X7WA 4EF6A 4XWWA 5BN1A 1AM4D 3VSEA 5C7IO 3QYPA 1PO7A 3HEAA 3QPVA 4JYMA 4GVXA 4R4JA 4I4CA 3I2FA 3FDJA 4IMRA 5KTTA 1WXGA 1FSZA 4GR5A 3BCSA 3JVDA 4AJEA 2A92A 10MHA 2FSFA 4AKTA 3R3UA 2BM0A 1WCWA 5YASA 5TGDA 1SUAA 4O89A 1R9MA 2GPSA 2ZJ0A 3RNOA 3GLGA 1E6CA 2A57A 3EZ7A 5KHOC 2W2NA 3CVOA 1K8RA 1XXLA 3N0XA 4NJMB 3A1CA 2GD2A 2AK3A 5DBGA 5KX5B 1SC6A 4BGUA 1L6RA 4BNXA 4ZVLA 1RM4A 4C2TA 4KKXB 5FPYA 2NXJA 3C4QA 3W5CA 2FPRA 1UMCA 4OHZA 3T1VA 2ISQA 2L19A 3QW2A 1KDZA 2EKBA 1MC5A 2FCRA 3BHIA 1NQUA 3TL2A 1ODSA 1E7MA 1SCBA 3QHPA 4OGKA 4OMDA 3X1ZA 3A1UA 2A0XA 3HYTA 2XE7A 3H6HA 2F43A 3CMMA 1C3LA 4CRWB 3I4LA 1V2GA 2G4CA 3SDSA 5BSFA 5LDDC 4NJEB 3V97A 3EPHA 2FPUA 5F33A 1E2MA 4MUJA 2ZRFA 2E4XA 2RE8A 1KH1A 4HBGA 3G5AA 3AFOA 3F47A 4FYPA 5THXA 2O3RA 4HD8A 4DXDA 1YUBA 2WRZA 4TYQA 1H23A 1QP7A 1GT91 1QVZA 3HXPA 1V8FA 1SUPA 3EZYA 1WXQA 3L49A 3PGKA 3LO8A 3PUWA 4JGBA 5IFKA 5K45A 5I3ZA 1EFVB 4B4WA 4E08A 4RPKA 2WUDA 2OQ2A 1FPMA 4MRNA 4R2HA 5JYDA 3PDCA 1ZRSA 3S28A 4Y2PA 2LCFA 2QUHA 4KYTA 3X2SA 3Q6IA 2H9IA 2PO7A 2BM8A 4YP6A 3GARA 3OT5A 4RY9A 4PGFA 3H4VA 1RJEA 1U1GA 3I52A 5ALDA 3G0BA 3T38A 1E3DA 4FEGA 4WY5A 4ZK2A 1AQNA 5ALYA 1H69A 2I91A 1ZXBA 3AETA 1SGWA 5C7OO 4LMAA 4R31A 1HYHA 4RETA 4B4VA 2HCTA 2IYYA 4QVGA 4DLTA 4EK9A 3V48A 1AQIA 1UODA 1OLSB 1PAUA 1NQOA 2PQ6A 2XOEA 3ZQUA 1LPMA 3ADOA 1KBZA 2I03A 3DEAA 1SVUA 3Q0EA 2TSYB 4FE4A 5K7SA 1T2FA 1S96A 2QW0X 3AL3A 1RP1A 1U3DA 2P77A 2RHGB 3HA3A 4PXSA 5FEMA 2VP3A 5C8VA 2PT6A 1F0KA 1X19A 4Y6SA 4CM1A 1E5DA 5FADA 3HHPA 1XQXA 4LNUA 2P3QA 3OT1A 5CVTA 2VAXA 1E3TA 1DSSG 2DBYA 1SXQA 2WVHA 3ZVRA 3QPAA 4RD6A 3B8EA 4IIJB 2BFNA 2ZT5A 1AJEA 5DN6D 1W19A 2VHCA 3VJLA 3QEKA 1EJ2A 2BMJA 2ZATA 3HO8A 4OB8A 4GE3A 2IZ1A 5AM5A 4IOLA 2IODA 3L4BA 5AQEA 4WCFB 5A1JA 4FTWA 4I1SA 1DOZA 4TTPA 4MGIR 4S1PA 1KZ1A 1T36A 4TMWA 1PUIA 3HY6A 3DLTA 5LOVF 3U7QB 4LRXA 4YT2A 2JDIA 4XTRA 1Z0KA 4Y1GA 3IRUA 1I0LA 4TT3D 4LSMA 3FOWA 2I1QA 4DTIA 2YN0A 3B60A 3CZPA 3ID6C 3QELB 1KYXA 3QG1A 5F3WB 4WN3A 4C3VA 1JBEA 1L4LA 2AN5A 3UMVA 5AJYA 1UBGA 3JRXA 3PFFA 3TFWA 1RR6A 4GL4A 4EQZA 4ENVA 1EK1A 1NW9B 1W34A 1DKOA 3ICPA 1L3IA 4N01A 5GVRA 3IC5A 3KEQA 4D3FA 4E5PA 1Q0PA 1XC7A 3H4TA 1ZL2A 4MVJG 3G0DA 3HZRA 5LZ4A 1PTJA 1KS9A 2H1VA 1IEWA 3KVNA 4DA8A 3IBCA 4FFNA 4B71A 4IX9A 2ZRIA 3RRBA 4DJFC 3UICA 1MB0A 5A7FA 4GZ5A 4Z2AA 2JLQA 2XEXA 2PSSA 2AYZA 3L8ZA 4WZAA 4LGVA 4NZMA 4A0RA 3FKSA 2E4AA 3IEUA 3U81A 3T5AA 1JNYA 3LLSA 4PX5A 2J5QA 4A8PA 3O3MB 4BNFA 1M2VA 5EKSA 1F2UB 5DTQA 2COKA 1BMFD 2E4VA 4V0QA 2J9YB 1C3XA 4V0NA 1EDZA 4MPDA 1KK2A 2JJYA 4DV5B 5BMOA 2PD4A 1T1RA 1Q7RA 1XNGA 1R6UA 1K4KA 3R7DA 4OK3A 5HMMA 4DT1A 2DXIA 3LHFA 1KVQA 1OX6A 2CJXA 3I0NA 2QJRA 4GH5A 2WD9A 1UXJA 3UUGA 1Q16A 3NHUA 4KN8A 4U5XA 2ZJ4A 3ILVA 3NZEA 4PWZA 1TU3A 1J2UA 5FBKA 4BNKA 4PG5A 1LKZA 3P96A 1KFBB 3GGPA 3U16A 2XVXA 4BLSA 4XVHA 3BF7A 3OIYA 1MD9A 1KXJA 4PQEA 4C7XA 5IVHA 2E9SA 2NTJA 3EAQA 4EA8A 1NF9A 2JJ2D 3SS8A 2WB2A 3JQ8B 3E5HA 4CKZA 3IJPA 4BECA 2FV8A 2OENG 1AV6A 5HIMA 1TYZA 3QSYA 1PYGA 3GT4A 3JQFC 1KEEA 4UATA 2XWPA 3DKKA 2XA2A 3EUFA 2BM1A 1V1MA 3I39X 2AV6A 2X8AA 5BUSA 1W36B 2BEKA 2L2QA 3H0WB 3E2MA 2PH5A 4H7FA 3MWFA 2OBMA 1ISHA 4DUPA 1RWKA 4WADA 2ERYA 2ECQA 1IUKA 4QD3A 3WFZA 1LD3A 5BY2A 4JC0A 2XDWA 4HGRA 5ALKA 1FDUA 4X7MA 4KR6A 4UTPA 2QM0A 3AI2A 4LVOA 4NZNA 1NUAA 1U8CB 3TXAA 4B75A 2AZ4A 4Y67A 1MAWA 3O0DA 4I0WB 2PVPA 1YDMA 3T9BA 3NVMB 3RC8A 5I4CA 1PT7A 1M1YE 3F6YA 2PO5A 3AHCA 3IBYA 2NO0A 3PK0A 1IXSB 1PEYA 2I4MA 4QARA 1ZM4A 4RE6A 1RBZA 3TSYA 3A2MA 4QGAA 1XYGA 1Q0QA 4QYWA 3E1GA 4C6RA 3D59A 2JGRA 4Y2QA 5EQTA 5K9ZA 3F46A 2HSJA 4J1NA 3WDKA 3KX2A 3TRFA 2FX5A 3ICQB 1PGOA 2QR2A 2DWQA 4FFPA 2XMRA 3H87A 5NULA 3QBEA 1TECE 1T43A 1Y4UA 3HL0A 2CMDA 2HPZA 1V8DA 5FPPA 3QFCA 2ID7A 3DV2A 3UJDA 1NMXA 4BJ6A 1PJLA 2WJYA 4RCYA 4DIUA 2CBZA 1SM4A 3GJ5A 2AEEA 2KW5A 1Z0ZA 2IEBA 9ATCA 3CPHA 3QLVA 1WEKA 4HNAA 4HMPA 4DMCA 1SCNE 2HMTA 3HP4A 4IUCS 2BGKA 4PO8A 4KLRA 4BZWA 4LY3A 5J4HA 2PRZA 4BO0A 2VJMB 3AIOA 3BXOA 5CDHA 2BY4A 1E1CB 3NVKI 4CM6A 4G6ZA 1JFVA 3NVAA 2HD4A 4JJIA 3TBHA 4ETMA 4ZVMA 1XWFA 3KD3A 1RLMA 2HWWA 5K20A 4HDQB 1N1GA 2LP4Y 5F51A 3U7RA 4R54A 3MB8A 1SKMA 2Q0HA 3S2IA 3S1SA 1UKBA 2XT0A 2IBMA 1TQ8A 3GJ3A 4TUYB 3VR3D 4ZJZA 1Z2PX 1FBTA 2XQKA 2Z4TA 2OQVA 1PR1A 3DEKA 1Q6YA 1Q0UA 1YHYA 1J0DA 2GSDA 3NXSA 1GTJ1 3V8NA 3WZMA 1N6NA 4DBVO 1OLXB 2Q6LA 5JRZA 2WIJA 2O7NA 1M2JA 2X0RA 1P2FA 2O6HA 5C8ZA 4MW9A 3K1ZA 3B1ZA 3WBBA 1ZC4A 2PSEA 3QJYA 4C2AA 3F3KA 4H16A 2QN3A 2IXAA 1P77A 1V7CA 4ZQIA 2ID9A 1GWNA 1MRSA 3N5CA 3NTOA 5JD5A 1V1MB 4XWGA 1SG6A 3FCUB 4I81A 3W9UA 4TV8A 3H5WA 4IZHA 2EJBA 3CLKA 4LHVA 1HFJA 2QSZA 3LRXA 4M9XA 5ARBA 5BSKA 2JZCA 3PX2A 5KVVA 1MJGA 3DOFA 3EF1A 1K0UA 3CCBA 2ARKA 1Z5UA 1ZRNA 3JAKA 4HLNA 1QQBA 5JARA 3GLHB 2PR2A 1OIVA 2OEPA 3FBWA 3Q3HA 3R3YA 4OQZA 2Z3WA 2P79A 4Q02A 3RFCA 3YASA 3TUZC 2BHSA 2RJOA 2WYVA 2J5RA 3CVUA 3IA7A 1Q0SA 2PRIA 1XD2A 5JZOA 1VZ2A 5H80A 4QYSA 3BWBA 2VA8A 3O8OB 5DTIA 5ES3A 2B3DA 3VBCA 3ZE1B 4TS4A 2FN9A 4DEXA 3JD1A 3JQEA 4NFLA 3E61A 3INTA 1LB1B 5AI9A 5G4KA 5ULLA 2YCLA 4KYIB 2HHAA 3EVNA 2GRUA 2X2EA 3LLMA 3X44A 5IDXA 3U9LA 3PRJA 5KQGA 4KRYA 4Q24A 4KNVA 3SBEA 2YOHA 3ROZA 2RIRA 1PD1A 1NPDA 3QXCA 1GLGA 2Y6UA 1M6VA 3P9QA 3RHTA 2YOFA 3HCEA 3MTJA 1VJRA 4G41A 5FCDA 1BS1A 3JVVA 1KY5A 3WGYA 1DLIA 2ZWIA 3D6AA 4PG7A 2V5AA 3QP9A 5KJFA 4WW0A 1RWWA 4ZALA 3UG7A 4KR2A 3MIIA 3ICOA 4AWXA 2AEJA 2YV2A 4EPRA 3L4EA 2Z6UA 3BBPA 1YGYA 5KMGA 2BR5A 2FOLA 1A82A 2XUKA 4AUNA 3GC6A 3QOYA 3FN4A 2CLCX 4IL5A 2JKZA 1N2CE 1XXHB 2OK8A 3FG9A 4Q01A 1NJ5A 2C2HA 3EP5B 4LGCA 3GLTA 2JIDA 3SHFA 4YMSA 1A9XA 2QAIA 4LRWA 4NESA 1MAUA 1SXJA 2CUKA 3V1NA 3L79A 4EX6A 4Z9XA 1N8TA 1O9BA 1M8FA 1VRCA 1MIOB 2ZS7A 2DM6A 5E6SB 1P75A 1VKJA 1ZYUA 2R8XA 1M8KA 1IZ8A 2SICE 3G0OA 3V6MA 1ZM7A 4Q3LA 4P4TA 4OQEA 1DCKA 1XOIA 4ZHQA 4ZYZA 1Q0ZA 3TIIA 4D4JA 2BDTA 1RAHA 3TAXA 4F3RA 1E58A 1C50A 3ADKA 2O23A 4IGIA 3PT9A 2Q2VA 3RSLA 4EY6A 5TPWA 1IHPA 1Q1ZA 1VL8A 5E4JA 2H48A 4OOEA 3IXLA 3N2GA 3MUEA 4R2WA 1FNMA 4BRUA 3B3GA 2X41A 1QIEA 2PU7A 2HO5A 3GH3A 1KP9A 1NR7A 2GEBA 3NHSA 1V7PC 1UKEA 2J4FA 4KWHA 3GQBB 5T3UA 3OJFA 4Y1RA 1QORA 3F78A 4ZDKA 2I7XA 1RE0A 2HHJA 2YRFA 4RHXA 5J9FA 2O3SA 3SR0A 5K4GA 3GVPA 4XD2A 4DLBA 3BXPA 2V03A 4ZFNA 1JIVA 3TUXA 4GQBA 3WK8A 1RJ9B 3GD5A 3ICVA 1JLLA 1I7MB 1NXPA 5FTJA 2CNOA 2QUKA 4D3XA 4ZZ0A 1YCHA 3C85A 4GQIA 4PGGA 3RUEA 4EY7A 1XD9A 3SHWA 3TRHA 4W99A 2AG5A 2C7QA 5AW5A 2ZJOA 3BWDD 2QTZA 4DV6B 4EFMA 1G42A 1F9EA 3C3YA 1SD2A 5JMWA 3EZ2A 4PZUA 1M2WA 5KNDD 4IINA 3K70D 2ZBVA 1U8XX 3DMTC 2D54A 5CH8A 3BL5A 3PC7A 4JLSA 1J07A 4X66B 3CWCA 1PJ2A 4DBZA 2EYUA 5D86A 2FDCA 3HCBA 3THWB 4KFCA 1VHTA 2LV8A 1SBNE 1BN7A 1W46A 2I8CA 4RV5A 5LZ7A 3BA6A 1QE3A 1WKBA 5KCZA 1H9CA 3JQBC 3BC1A 1PJSA 5CK4A 1HURA 2VQFB 2BGLA 4L07A 1U3VA 4R8KA 4F5WA 3QX3A 1WB6A 4I4TB 4M9QA 3P27A 1FJXA 1DIHA 4RLSA 3LLVA 4D26A 1QTNA 1QBGA 4E0BA 1LX6A 3CVXA 3LVRE 4J16C 3OLWA 4QDZA 2QG6A 4P82A 5I9LA 3NXKA 3F5QA 3ZHTA 5HYVA 1US8A 5JZBA 3P9ZA 1Y1QA 4YAGA 1K6IA 4JYZA 1FRFS 1SZDA 1ZGZA 4TV9A 1XMQB 3PEVA 4DMHA 5AHRA 2HRQA 1HDOA 4LRYA 3EBOA 2HK7A 3GZJA 3KVRA 1U0HC 2O7VA 3L1KA 1XCPA 3ZD9A 1N9ZA 3H9GA 3AV3A 4K8RB 4JELA 2V7GA 4MRMB 4KBGA 4QU8A 3BTUA 2YC4C 2AC2A 3PJEA 3QV2A 1COWD 3PQ8A 5TGZA 3T7JA 2G08A 4U63A 1JAYA 4ZQGA 3ROGA 4BFSA 1TZ2A 2WJZB 4FILA 4G9GA 3VC7A 2BP7B 1CNFA 2QX6A 5A3JA 2WJ4A 3L8EA 2VVTA 1VSVA 3B89A 4LJLA 4YJHA 4QASA 4D6PA 1XTBA 2GVDC 4NONA 4BS9A 1QVWA 3C3WA 2GXSA 1B26A 1TUEA 3ZPXA 4EI7A 2PKYX 2YVLA 3RFTA 1S1MA 4F92B 1JDPA 1NMYA 2GRJA 3AU8A 3P5BA 5DGXA 2OV2A 4IIJF 4GL2A 2QTFA 1E1DA 4MDFA 3IEPA 2JLCA 1TQ6A 1PGJA 2Y77A 4OJNA 4FPXA 4EHIA 3B6KA 2UVQA 3ACCA 4C89A 1X0XA 4YAUA 4JLPA 4B6JA 3FYDA 3KEMA 4S05A 2VJPA 1D4ZA 3TLGA 4L74A 1UJ2A 2NP7A 3I5MA 2XUOA 2D13A 3HABA 3ICWA 4Q9DA 5HCNA 4A4DA 2JFVA 3HJBA 2F7SA 5AYVA 1RLIA 1ZK0A 3SMVA 4D80A 2C5AA 1EUYA 1SCJA 1K86A 5SV2A 3IQGX 3D2AA 2GJ9A 1X3LA 3FRJA 1WZNA 3WRXC 4CL2A 2OKGA 4AY4A 4F4CA 1FXWA 4KVGA 3V8BA 1E8MA 5AVVA 1VDMA 3EIFA 4KAFA 5FBWB 4NKRA 5JFGA 1DCTA 4BFYA 4ZZ3A 4TPKA 4YJKA 4QHSA 3T95A 3UUEA 2ZBQA 4C6SA 1P74A 4K81B 3GFTA 2CYAA 5K3FB 5IF9A 3VKHA 4MIEA 3F6BX 1H8ED 4ZCSA 1HMYA 5SYNA 2ZJZA 4UVDA 2JIZD 4X94A 4RACA 3WGNA 1R8JA 1YQTA 4BFZA 2O8CB 1F2DA 2A9FA 1OX4A 3ND6A 3QY9A 4HWRA 4E1AA 1B23P 5B55A 4OKNA 4CQMB 4JCOA 1LQ2A 2XGSA 3GPIA 1DINA 4K2AA 1N6HA 5BSUA 3UWOA 4G1MB 4RY0A 4PZYA 1Q50A 1ZH2A 5AM0A 1JEOA 1MW9X 3GQBA 2PZBA 2R5FA 1NMZA 1I3NA 2G04A 2ZRCA 5J5VA 5TVGA 2M6KA 2PEZA 1O94A 4M1MA 4QFBA 3I4FA 5T57A 2WDZA 1XALA 3MBOA 4L08A 2HDNB 1M74A 4WDQA 4Q4AB 3UBMA 3VU0A 2B4RO 3AETB 4KFRA 3SSAA 5LMNB 5NLLA 2QJOA 4X20B 3RAGA 1HDZA 3VZRA 2I2DA 4R1PA 2NTVA 5EXSA 2OO5A 1YBFA 3ENVA 3HUTA 4IDPA 4MR7A 5DASA 2Q7OE 2H06A 2AQIA 3U2QA 4MUHA 3STWA 5JJKA 4B6OA 1Y3CE 3A26A 3EVBA 3OIVA 3KSMA 4D3DA 4EEZA 4DMUB 1O96A 2C2ZA 1FJHA 2P0EA 5EMMA 4OX9B 1AIPA 3SXPA 3VVBA 3WGHA 5CDUA 4CLOB 3LKBA 4R71A 5HKOA 1ECBA 4UBIA 1P61B 5EHXA 2C9MA 1GU1A 4Y1EA 4ARZA 1QCDA 1W4ZA 1XN1A 1USWA 1YCGA 1PR9A 3HADA 3L92A 1Q0HA 4QNMA 3PRKE 5JAUA 2YS6A 5K5EA 5IT0A 4ND1A 2GM9A 3AY0A 4TKUA 1RXWA 1SBIA 4F46A 5JXGA 1G66A 2IF2A 1W6RA 2ETXA 2JGEA 2Y05A 1D3AA 2ZAIA 4FLEA 4G8CA 4DC0A 1LC0A 3D5QA 3LVFO 1V1RB 3CLRD 5IKPA 3U31A 1USGA 2MT9A 3HVKA 4X1KA 2VKQA 1UOPA 1WY5A 3A11A 3I1JA 3IALA 3OT4A 4GPZA 4RPJA 5HJ2A 3UJ8A 4K1LA 5I9NA 3FWKA 1YRWA 1Y7IA 4MGZR 2OAEA 1Z06A 2XB6A 1XI2A 2GJ8A 3DTVD 4KPUB 4MGEA 3UJAA 4HXYA 3S99A 1ZI9A 3ZGZA 2IYPA 4Q7MB 3CMCO 1K3FA 1DEKA 4NQZA 3VU1A 4CI9A 5BNIA 4BLWA 2ZWPA 3NIWA 3AXSA 2XWSA 3D6NB 4C3UA 4I2VA 1FC0A 1MA0A 5K6RA 1ICEA 1YR8A 4S3MA 5BV7A 2AJLI 2ZB2A 3A27A 1C2TA 3ERCA 2KQUA 3WLHA 1T0IA 3HO1A 4EUHA 4ZO7A 4RD1A 2AMJA 4BNYA 1Y6GA 1KSJA 3IVCA 5L6LB 2FUCA 1CDEA 1XNHA 4KFSA 3WK4A 2O19A 5K3DA 1OLUA 3ZY2A 3DYVA 4D9MA 1XRQA 5FTLA 2ZQZA 2NG1A 1DXQA 1L7OA 1QKJA 1YZKA 2XOKA 3AEKA 3E03A 4IH9A 2VBIA 5LDHA 3DOCA 1WETA 2IVFA 4LYAA 2GN8A 2FG5A 4TWAA 3WB9A 1NBHA 3OAAA 1WHSA 1R4NB 4GBED 4EO7A 3KRTA 4NC9A 4ZTBA 1VCNA 3JALA 3A4LA 4YJGA 4ZVNA 3KT6A 1T4CA 1RHJA 1U7WA 4L78A 2A35A 3EP6B 3O47A 1ZISA 3NLLA 2Z2YA 4QYTA 1MLDA 5B4UA 1TB4A 4QBFA 2WJVA 3V2IA 4FFBB 5AT1A 3EXIA 4CUJA 4CHTA 3X1JA 1RAAA 2CFOA 4K6KA 3DW3X 1UKVY 4U9HS 4OHVA 1EGHA 4BIIA 2OAGA 2XYPA 3CIOA 5L3RA 1UH5A 2D1YA 1A98A 3GEGA 3FPBA 3PDWA 3U7QA 1WB9A 5AW6A 3TGWA 4OJTA 4Z0TA 4IKEA 1NXSA 3K16A 4LBVA 4OP1A 3RS2A 5JI3E 5MN4A 4RZSA 2FRXA 4KVAA 4L9AA 4FP9A 4P32A 3AHDA 1GXSB 2XRMA 4QOEA 5FPTA 2YFYA 2FA9A 4MNTA 4E46A 4HP8A 1FRNA 1J0BA 1D7AA 1WR8A 4GE0A 4EGAA 2JFUA 4HN2A 4PIPA 4NNOA 2XWBF 1IWBB 5ALPA 4O4IA 1ZIPA 5BXQC 2O20A 5BUZA 2P2SA 4G8BA 2QAGB 2GBLA 3I73A 1P1KA 3L0YA 4B85A 5C80A 5FBRB 4DVJA 1KZ6A 3FF4A 2HK9A 4AICA 4AAYA 4JOSA 2A84A 4XB2A 2XUGA 2I1WA 1SWVA 2XUDA 5KWSA 3EP8B 4H3VA 1IBSA 2VF5X 3HKDB 1E3EA 2LTAA 3N05A 4PR3A 3T3PB 3LY9A 5DH9A 2ES4A 1ZKDA 2MJLA 5EHNA 1HWYA 3WGMA 4EKEA 4JCCA 2JGKA 2XIQA 5IC4A 2EFCB 5DM0A 1NQAO 5COQA 5BNFA 2OCIA 4AZ0A 1NVGA 1CEEA 1QPZA 1SQGA 1Z29A 2I9PA 3OZIA 1QTRA 4ZI7F 5F35A 3NC0C 3CZ4A 1E69A 4Q47A 3UXHA 2XEDA 1DUIA 3VKVA 1RHQA 4IF6A 1OWMA 1RAIA 1NRXA 1CQIB 5ILGA 2BUAA 4JOBA 4YR9A 1G3RA 1WCIB 2WAAA 3GT7A 1A4IA 2YWFA 3MMZA 4JBXA 3G8BA 1MF7A 4G1VA 1U6KA 1DBSA 5AVJA 3UOWA 3S8EA 5JALA 1CP3A 3WWYA 1F2TB 2GD1O 3WLIA 5JMOA 1U3UA 5JDIA 1Z2NX 4HXGA 4BN0A 2F8LA 3A3OA 5BOVA 2W42A 1U0RA 3EQ8A 5IVIA 1U0TA 4Q3NA 1L8QA 3N86A 3SE0A 1R66A 1L1QA 1T2CA 2ASVA 3OI7A 4RKEA