2CVOA

Crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
347
Chain Sequence
KSGEEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVDAVFCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLTEVLRNEIRNARLVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSSVPHTRHVVGSNYCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
pubmed doi rcsb
source organism Oryza sativa
molecule tags Oxidoreductase
molecule keywords putative Semialdehyde dehydrogenase
total genus 109
structure length 347
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2cvoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cvoA01
4D3SA 2ZTUA 4CM6A 4CM9D 3O38A 3LVFO 3W8FA 4CMIA 2VHZA 4OKIA 3JD0A 3ZWCA 1TXGA 4W82A 2X9NA 2SCUA 3AI1A 1WLYA 2GF2A 4E2XA 3W6UA 1E3WB 1WDMA 4DBVO 1C1XB 2C2YA 4XB1A 3VH4A 2W2KB 4PCVA 3SJ7A 5DOVA 2E4AA 4CLRA 3HB4X 3I6IA 1P77A 2LDXA 2BI8A 3GVXA 3GVCA 1KVSA 3ASUA 4J0FA 9LDBA 5JXWA 3VZRA 4JP3A 1I5RA 1ULSA 3MEQA 1E6WA 5KJ1A 2DTXA 4EGFA 1HKUA 1BG6A 4MP6A 4TRRA 1VKOA 2AG8A 3WGGA 5I7SA 2X0JA 3AJRA 3G3EA 3WWZA 3V1TC 1KOLA 1I01A 1XELA 4K6FA 4W7HA 2HAEA 1Q7BA 1BMDA 1N7GA 4WLUA 1DLIA 4BNZA 1WP4A 4M1QA 2DT5A 3TFOA 1TVEA 1R0KA 4BKQA 3C1TA 3DAGA 4KWIA 1VPDA 3D3EA 1MXHA 1M67A 2O2YA 1E5LA 3RBZA 3RUCA 4ZQEA 2AMFA 1JLLA 2Q4EA 1E7RA 3MCVA 1LSOA 3ZZNA 4XQ9A 1GL3A 4GX0A 1ZH8A 1SOWA 4QEDA 1YBMA 2C07A 2FWMX 3D4PA 3V2HA 1P1RA 2AEMA 1QXSA 2VHYA 1P1HA 4YRAA 5TC4A 4RF5A 1PIWA 4WKGA 1LLUA 5IDWA 4D0SA 3KEOA 4DPLA 1MV8A 4R69A 5C3MA 3H2SA 3NTQA 1LX6A 3MOGA 4WLOA 4YJGB 1P0CA 1QYVA 2IYOA 4XEHA 2W2LD 1TLTA 2HJSA 2DBQA 4U5QA 1F06A 3KXDA 2OZPA 2A9FA 2V65A 3BMCB 5JYFA 1LQUA 4IQGA 2D1YA 4E4YA 3FI9A 4ZN6A 2PGDA 4WJZA 1FJHA 2GR9A 3PHHA 2DC1A 1UUFA 2JD0A 4IGFA 1LRKA 1P1IA 5EESA 3VOSA 2HKIA 5DOZA 3IKVA 2DPGA 2VOJA 2Y1FA 3ULKA 5GMOA 4DQXA 1WXDA 4YT4A 5JMWA 4EZBA 4N5NA 1AN9A 4ILKA 4R5HA 3D0OA 4J4TA 1G6KA 2D4AA 1IY8A 1R6DA 1BW9B 1VC2A 1ZJYA 3DOCA 3X2FA 3NT5A 4L0QA 3ZWMA 1N92A 2YQ5A 1GQ2A 1KS9A 1U5AA 1Y8RA 1EK5A 2WYWA 1M6HA 1UZMA 2Y1GA 5G4KB 2E48A 2XPCA 3GUCA 4KUHA 5BNTA 3CZRA 1LBEA 1I33A 2AE1A 1CETA 4D44A 4FD3A 1PS9A 2HK8A 2I3GA 1PWXA 4Y67A 1K6IA 3WR5A 2OOSA 3GHYA 4CV1A 4ZD6A 3BTVA 1FF9A 1BTOA 2D3TA 3DOOA 3EZYA 4HBGA 2O4CA 4Z0PA 1G0OA 1DRVA 3HDYA 3B6ZA 3KSZO 3ZCXA 2C59A 2HMSA 3I5MA 4IDBA 3CH6A 3HDJA 4BNVA 3AUTA 4GKVA 4I9NA 3BMNA 1HEUA 2WTBA 2OP0A 1XHLA 2RH4A 4E5NA 3JQFA 4BV8A 3AU8A 3EK2A 1H2HA 1T2AA 2V6MA 3OECA 1PJLA 5G0VA 4JJIA 2G17A 4Y6SA 1ZK4A 3P2YA 4XRGA 3DBVO 3GMDA 3GPDG 1PJ3A 4NR0A 2GYYA 3K8ZA 1LC3A 1E7SA 1RJWA 3WXBA 1MGOA 3GR6A 3KHUA 1EFLA 4E5YA 1YWGO 2PD6A 4XRRA 3VZPA 4LRSB 3F1KA 4PLYA 4AICA 4TVBA 1H2BA 4RQTA 1R37A 3WTBA 2X86A 3ZV5A 7ADHA 5F5LA 5L7WA 2BRUA 2JKVA 1JU9A 1HETA 3FR7A 2VUSA 2VOEA 3WMXA 3QWHA 4H16A 4Q3CA 5JAZA 2FMUA 3VH1A 3OQ6A 4F3YA 4YEDA 1ADBA 1DDOA 1QORA 1EDOA 2I65A 2PK3A 2VRBA 2EJWA 4EBFA 3GFGA 3IOYA 3C8MA 3WB9A 1AHHA 4LRTB 4KZPA 3RFVA 4E2ZA 4K26A 1Z6ZA 4UUOA 1JKJA 1TA4A 1EEHA 2C82A 4U6QA 3D4OA 1N5DA 3JQ8B 3W6ZA 3WFJA 2C0CA 4MIEA 5JY6A 2YHUA 4JCOA 1DFHA 4GBJA 5IZCC 4RQUA 4CV3A 4RVGA 3GLQA 4WK6A 4RLSA 1F14A 3Q6IA 3TZQA 4MDHA 3G1UA 3IC5A 1W4ZA 5K0ZA 4E5PA 3ZWYA 4FB5A 3IAHA 2EHDA 4CM8B 4F6LA 1DRWA 2UVDA 4MINA 4XJTA 4HXYA 3SEFA 5DULA 1FDSA 2JCYA 2IEBA 4YACA 3C1OA 1DRUA 4ZA2A 4CLRB 4YJDA 1SO8A 1E1KA 4LGVA 1VJ0A 5LCXA 2G82A 4Q3NA 3WYEA 1LI4A 2I76A 3S2GA 3L4SO 1H0KA 3C24A 1A9ZA 5DF1A 4IS3A 4YYZA 1EFKA 2VRCA 1K6JA 4HP8A 3JYPA 1SBYA 4KDFA 2DUWA 1EE2A 1BVUA 2DBVO 5EL0A 1ULUA 1M76A 5HS6A 5G0WA 5JPIA 2HJRA 1SCUA 3PFWO 4WECA 2UV8A 3VTFA 3NGLA 5ITVA 5G2OA 3MOIA 4GPD1 3ENKA 2Q45A 3GG2A 1NWHA 1OZAA 3DZBA 3HADA 1UXKA 1YJ8A 1B8PA 4HX5A 2OBYA 4J6FA 3RUIA 4BB5A 3E5RA 5CP8A 3MZ0A 3CKYA 3Q0EA 1X0XA 3QVOA 4BKPA 1A4UA 3B1FA 3QA9A 5EPOA 1HDRA 1PEDA 2O7SA 4DIBA 3MTGA 4JBIA 2GASA 2HMVA 1FDVA 1KVUA 1PL7A 4BMVA 3ZU2A 3R3SA 1I8TA 1J4AA 1WDLA 2B0JA 1UP4A 2FZEA 3HDHA 2QX7A 2PKQO 1P1KA 5DZSA 3KV3O 3VPXA 1K0UA 3F5QA 2AHRA 2WYVA 3GZNB 3E1KA 2TMDA 3OIFA 4O0LA 5TJHA 3ZWXA 1LDGA 3H9UA 1NVMB 3TL3A 3PIIA 4TZTA 1KVTA 4E31A 3PFFA 3ZU3A 1UAYA 5KIAA 3CXRA 2I9PA 3UOGA 4NFYA 3RC2A 1CEQA 5BQFA 3PQDA 3SLKA 2AG5A 2D2IA 3WSWA 5I9NA 4H7PA 3M1LA 5CEFA 2NQ8A 4LCEA 1KERA 1AHIA 3GN2A 1ZXBA 1KC3A 1A4IA 5KVVA 4EW6A 2EW2A 1ISIA 3PRJA 3F9IA 2NTNA 3IKTA 2CF5A 2AA3A 4GKBA 4WEQA 2VNAA 1ZFNA 2HSDA 4J49A 4BNXA 1JWAB 2JJYA 1ZSYA 3I1JA 3H4VA 5CG1A 5K6AA 1B26A 2QHXA 4TZKA 4CMEA 1F8GA 1R4MA 3UCXA 3JQGB 2WEKA 4RO0A 3RC1A 4E2YA 3L07A 1CWUA 2F00A 3WGHA 3AM5A 1YOVA 3K30A 4E3ZA 1I32A 5C7IO 3O4RA 1ZZEA 1PL6A 4ALKA 5JFOA 2IDZA 1SZJG 1N9GA 4J43A 3FD8A 1FMCA 3EUWA 4P22A 1T2FA 2XXBA 2ZJ1A 3QWAA 3KSDO 1YQDA 4RCVA 1LDYA 1Y9EA 1KC1A 1PZGA 1ZO8A 3KBOA 1B8VA 5FFFA 2DFVA 4NU6A 4PZCA 4AJKA 3ZV4A 4B4VA 4I08A 4A10A 3LSYA 5JAMA 3PWKA 2FOIA 4FN4A 4Z9FA 4RGBA 1EMDA 5C37A 2ZQZA 1B3BA 2EP5A 3AI3A 4HUJA 4IDFA 1YOVB 2Y1DA 5BSGA 3E8XA 1P45A 2OHXA 3WJAA 4DLLA 3ZWOA 1IHXA 2IRWA 3Q2IA 4WCDA 3CMCO 1UXGA 4QO7A 3OEWA 1RYEA 2QRKA 2RIRA 4XQGA 4Y6PA 4CMEC 1E7YA 3H9QA 4GWGA 4OJNA 4PLZA 4WEOA 2O48X 3DOJA 3JD2A 3FNEA 2VT2A 1RM0A 1LDEA 1KY5A 2CDBA 4WNCA 3D4NA 2JFFA 3E82A 3ZW9A 1U2DA 2ZIZA 3IIEA 3GEGA 5FI5A 5JAIA 4J91A 1EVYA 3CUKA 2VNSA 3WQQA 2JD1A 2BLLA 2G1UA 3ZI0A 4CLOB 4R4JA 4BOYA 3GEMA 4J1QA 3GC6A 1CERA 3TWOA 3WX0A 2ZB3A 4S1VA 5U1PA 1RM5A 4EJ0A 4B8WA 4B4UA 3EAGA 3PVZA 4UAGA 5IDQA 3IDSA 3JQ9C 3U4DA 4R1TA 1KVQA 4YT5A 1PJ4A 3GQVA 5B1YA 1E3SA 2OL4A 3GH3A 1E3EA 3EVNA 1HYHA 1OFGA 3JV7A 5DDIP 2O50A 4E13A 5DBGA 2AQ8A 2VYVA 1WZEA 1F12A 3BXXA 1HDXA 5BNIA 4AJNA 3TL2A 3JQAB 4L73A 2UYYA 4QSMA 4DVJA 1JN0A 2F1KA 4EJ6A 4R51A 4N5MA 3RU7A 1WAMA 2Y0EA 2NADA 1RM4A 3GNTA 5CPBA 3RD5A 1VJ1A 3OQBA 4Q3EA 1U8XX 2CMDA 2WDZA 4NZ9A 4OIMA 3JQ9A 3BMCA 5ILGA 2O3JA 1NPDA 2P2SA 3WTCA 2EGHA 3QWIA 3DL2A 4BKOA 1FDWA 4FJ2A 5CAEA 1SB8A 3RCBA 2NTJA 4NI5A 2I6TA 3F1LA 5HBRA 1XKQA 4M89A 2BF7A 5L4LA 4IZIA 4BNHA 1U7HA 3D3WB 1I2ZA 2GZ3A 3E9NA 2UAGA 3OICA 2J3KA 1W73A 4YJGA 4DREA 1XDWA 3PK0A 1H6DA 1LTHR 1U3WA 1C0IA 2DTEA 2A94A 4PVDA 3CEAA 2B5WA 1PJCA 1ZXLA 3INRA 4Z9XA 1DC3A 1ZNQO 2W2LA 3EZLA 2WD8A 2FY8A 4U6SA 3B70A 3V1YA 2RHCA 3GRKA 4YDRA 4XCVA 4BVAA 3EY4A 3C7DB 4UVDA 4W4TA 2LDBA 5DBIA 3W8EA 2P68A 3I9LA 4TROA 3NDRA 5JC1A 4EJMA 2FZWA 2EKLA 3L4BC 1D8AA 5KWEA 3IQDB 3WS7A 4RPLA 4LMRA 5MGBA 5G0TA 1ARZA 1V3TA 2WJPA 4DMLA 3NJ4A 1LSSA 1GYPA 3GGPA 2FR1A 5A02A 1T4BA 2A92A 2WD7A 4CQMA 2VWPA 4NIMA 1UXIA 1O94A 4PIVA 4XGNA 5IDXA 1Y8QA 4AFNA 1JAXA 4AJLA 3L6OO 3OEYA 3UICA 8ADHA 4K9DA 3L0DA 1LUAA 3CTMA 1UXJA 1BXKA 1WMBA 3SVTA 4EUHA 1UDBA 5ICMA 1DC4A 4KUGA 1YKFA 4CQLB 3VZQA 1HDYA 5CDUA 4ZVVA 1TEHA 2DU8A 4UUNA 4AJIA 3BMQA 1HDOA 4U0JA 5ER6A 4WOJA 2DFDA 1X0VA 1C1DA 3RQSA 3I83A 2HMUA 2X23A 1A72A 3MTJA 3O9ZA 2A4KA 3DHYA 3QP9A 2X0IA 1T2EA 3I9NA 4PG4A 1K2WA 3U49A 3ABIA 1PZHA 2EERA 2GSDA 5A06A 3DZKA 5DNAA 1DJQA 4EITA 4KUEA 2JAPA 3PHJA 4YJFB 1UZNA 5DP2A 1ZMOA 2ZK7A 4TSKA 5KTKA 5EQFA 5B37A 1ZIDA 2HO5A 5U4QA 1PS8A 1Y9AA 2JL1A 2B4TO 3WG9A 2AEFA 3FWZA 1P0FA 3I4CA 4NMHA 3DTTA 3I4FA 5M6DA 1ZSNA 2PGLA 5TT1A 1E7WA 3KYBA 2FPGA 4G81A 3BMOB 2B69A 3T4XA 2B5VA 4WLEA 2EJVA 3N74A 1VKNA 1XSEA 2J3HA 3OM9A 1C1XA 4LW8A 4LCJA 4B3IA 4MVJD 4J16A 2H6EA 3PI7A 3BHJA 2PNFA 4Z3DA 2V6FA 3DHNA 2EXXA 4IZHA 4BNGA 1LDMA 1LA2A 3Q11A 5DCUA 3RJ9A 3JQBA 1I24A 2O23A 5ES3A 5H83A 3E9QA 3PHLA 4MVJE 4MKXA 1YO6A 2EKQA 3AY6A 4YAIA 4FC7A 3DWFA 3WDSA 3WSVA 3FNHA 3UCFA 4HFJA 3KO8A 5CPFA 4M87A 3VC7A 1UAGA 1U1IA 5GZ1A 3GAZA 4JX8A 1X15A 4X54A 2GRAA 3VKVA 3RUFA 3D7LA 2FPPA 3OJLA 3PLNA 3SXPA 5JSFA 3CPSA 4OAQA 3OA2A 1R15A 4P8RA 3K9QO 2FHSA 1PJQA 1YONA 2ZKLA 3ONDA 2ZCUA 1PGOA 3TN7A 5AOVA 2GGSA 2IYPA 5F5NA 4CLEA 5ER9A 5JCXA 4O1MA 1W8DA 2FSVA 3A4VA 5ILOA 3ZW8A 4F46A 1T1RA 1JKFA 4E30A 1X1TA 1TT7A 5HRUA 3ZNNA 4ND3A 2WM3A 2ZJ0A 4BNNA 1GZ3A 5FYDA 2HK7A 2Q3EA 3ANNA 4CR7A 1R16A 2W4QA 3ZWPA 2PFGA 3KOUA 4E21A 2FSSA 5CDSA 2X0NA 5IAAA 3Q3CA 5TGDA 1WNTA 5JCJD 3TF5A 1HE4A 4YRBA 1EZ4A 1U4SA 1PR3A 1ZK2A 2I5PO 1KEPA 5TNXA 3OETA 3I9OA 1PTJA 2VZ0A 4OSPA 4NK5A 2IEDA 3AFNA 3AUAA 4W7IA 4DYDA 4DYVA 4QFDA 1E3JA 3ANLA 1I2BA 3JD3A 5L45A 2IZ0A 1IHYA 4A27A 4CM1A 1PQWA 2AEJA 1IPFA 2Y99A 5T5QA 1AGNA 4Y98A 2JFGA 5EQDA 4BNFA 1D3AA 1T24A 1SMKA 4NBUA 3W1VA 1NAIA 3DBRA 5B4VA 1ZK1A 3ONEA 1PGNA 4D46A 5JLAA 4BNWA 1MG5A 4GWKA 4IDCA 2ZQYA 1AXEA 5T67A 5L4SA 1XA0A 2G0TA 4Z6KA 1BXGB 3TNLA 4FGWA 4NJMB 4DPKA 3BTOA 5K9ZA 1C1DB 1QRRA 4G2NA 4JLWA 3DBLA 3KRTA 4YAGA 1XQ6A 1Y7TA 3KYDA 2OXIA 3ZWWA 1B15A 4OO3A 3ZNQA 1R12A 3QJ5A 4DC1A 3ROPA 3PXXA 4CMAA 4ZRMA 1H6BA 2E49A 3KSUA 3GPIA 1GPJA 1V6AA 4AL4A 1T25A 1NQOA 3R0IA 4I9UA 4O6VA 4BO0A 2OO5A 4PVCA 4F45A 3QVTA 1OC4A 3T7CA 4A2CA 3RSHA 1B8UA 4Q9NA 3WNVA 4CQLA 1R4NA 4I5FA 2H63A 5GZ6A 1LC0A 1NWCA 1XIVA 2WSBA 5AXDA 2YFHA 5I8WA 3UF0A 4MIOA 1GAEO 1ISMA 2CD9A 3ZHZA 2J8ZA 3H6KA 1JA9A 3AK4A 4XX0A 3ZU5A 1JDJA 1HLDA 1HYEA 1P31A 3IUSA 4JNKA 2VZ8A 4GGOA 4BNLA 1QR6A 1IZ9A 2R2GA 3RC9A 5KJ6A 3WGZA 4U7WA 3DFZA 3HN2A 4YAEA 2Q1WA 3K6JA 1U9JA 3N58A 1GCOA 3DB2A 2GPTA 2DQ4A 3H65A 1RWBA 4CMCA 1NBOA 3GAFA 4QUKA 4NU5A 3TOXA 3VKUA 4CLXA 1ZSVA 1VL6A 1MLDA 4OQYA 3S1LA 3KTDA 3GG9A 4JK3A 5KNLA 1DIGA 2X5OA 4URFA 3EVTA 1NQ5A 4OYRA 4RLHA 3N7UA 3GA0A 2DKNA 2FN7A 3G17A 4CQMB 3RIHA 2X22A 5L4NA 4DXHA 1K6XA 2QRJA 1PWZA 4IIUA 4KWHA 4FJ1A 4RVFA 3UAGA 1CRWG 3ETGA 3VPHA 1M6WA 1DO8A 1N1EA 3RWBA 5JDIA 3A28A 3U5TA 1LXCA 1ADFA 2Q99A 1DIHA 4DRYA 2PKQP 5A5EA 1X7GA 4M54A 4EI2A 1W0CA 4YVFA 1SEPA 1ZEMA 2O2SA 1LDBA 1HSOA 1MG0A 1E7MA 1Z82A 3LF1A 3HN7A 5U9CA 5BSFA 1P9LA 1VI2A 2Q1UA 3QRWA 4XDZA 3EC7A 2QZ9A 4ZQBA 4D43A 1IPEA 4MO2A 4PZDA 4YA6A 1LNQA 3QY9A 4WNIA 4BO5A 4XGIA 1DLJA 4YR9A 5HM8A 2EW8A 3G49A 3ZNPA 1U4OA 5A04A 4MPDA 3RI3A 3WGTA 1YDWA 1H93A 5T73A 3OBBA 4NNJA 1B2LA 3AI2A 5DCWA 3EGOA 1ZK0A 5LDGA 2GD1O 4P4NA 3AUSA 9LDTA 5JO0A 1Z73A 4XJSA 4DIFA 2QQ5A 3ZHBA 1Q7CA 3AY7A 4Q3DA 2JHGA 2FPIA 2QRLA 1XYGA 4RDHA 2NACA 3H9JA 1YS4A 4RZIA 4BGUA 3F6YA 3HFGA 2IODA 5A05A 2BMAA 1TB4A 3LYLA 4JP2A 4WE3A 4Z0TA 4BO2A 3C1AA 2HRZA 1CIVA 3L9XA 2V7PA 4FR5A 1ID1A 4L4SA 3IP1A 1C0LA 5I8ZA 2OMEA 4J1TA 1ISGA 5JE8A 5A03A 4JJGA 4PN3A 1S7CA 3NDJA 1DC5A 5F1OA 4ZQHA 4NJMA 4OHUA 1GCUA 1CQIA 2C20A 1YJQA 1BXZA 2X58A 3CZMA 5L9AA 1I2CA 4WLFA 3AUUA 3HSKA 3GRPA 2CDAA 4XKJA 2R6JA 4Z9YA 2OORA 5KJCA 5CFZA 3L77A 3TZHA 4N18A 3UFXA 3DBRB 3H5AA 1N9GB 3RUHA 1X7HA 3NUGA 3AM3A 4FFPA 3U4CA 3VZSA 2OFPA 3WGOA 3WBFA 1NTOA 4LSMA 1ZVMA 4GX1A 2QIOA 4PLPA 2YUTA 5I9MA 3ADPA 1GUZA 2NU7A 4EEZA 4PG6A 2PTGA 3MWEB 4BV9A 5IJZA 1ADCA 3HNPA 3BYZA 2POQX 4XDYA 2VTDA 2YZ7A 1E1MA 1EK6A 5G0SA 3DR3A 5DN9A 3A9WA 3ITKA 4NFSA 1LLQA 4NBVA 5ENVA 2J5QA 3AU9A 2BFOA 4XWYA 3TOZA 1HWYA 2JD2A 4NJOA 2OBNA 3EDMA 3OSUA 4CMJA 3UN1A 3KLPX 1IZ0A 3MJ4A 1HF3A 1JW9B 1A27A 4YBZA 1PZEA 4LISA 1U5CA 1HE2A 1GZ6A 3S55A 1KVRA 1O95A 1Y81A 4XD2A 5F3RA 4MVJA 3B1KA 3GZNA 3PTZA 2A35A 3NV9A 4MOWA 3GMSA 4J3FA 3RBVA 3T4EA 3SBOA 3ZV6A 5JC8A 4RZHA 2NVUA 3R6DA 2EF1A 1IUKA 4RJTA 5KJFA 3DC2A 1AUPA 2Y1CA 3DZGA 5ICSA 3O26A 3VH2A 3WGQA 3ZWVA 5L51A 1L7EA 4IY1A 4BNJA 2YW9A 1MC4A 2DLDA 2C2XA 4PLHA 4QTZA 4HFMA 2GDZA 2HLPA 3WIDA 2X9GA 1ISJA 3LT0A 3V1UA 3VVCA 2YHIA 1I3LA 1V3UA 3KM0A 4RVUA 2C7GA 3A14A 1N2SA 2HCTA 4PRLA 2X5JO 4CM5A 2G76A 2IE0A 4W99A 4CLOA 3LC7O 1WW8A 3D1LA 2GN8A 3RC7A 3RFXA 4GI2A 4FDAA 2CF6A 4ND5A 3WLEA 1B14A 1IL0A 4BO6A 3I23A 4PZEA 1DFGA 1UDCA 1R4NB 2EIHA 4TWRA 3VDRA 1NPTO 2GERA 4P38A 4D3DA 4UVGA 1BXGA 3K73O 4ZJUA 5ENDA 1DXYA 1H5QA 5J23A 4R16A 4AJJA 2B4RO 1V9LA 1J5PA 3ROQA 2Q4BA 4M55A 2WWRA 3F47A 3PP8A 4ZICA 3AOGA 1ENOA 3UCEA 5CHEA 1UR5A 4CV2A 4DA9A 1Q2XA 3U9LA 4A5OA 5A9SA 1EUDA 2P91A 2PWZA 5EJ2A 3QQPA 4LVCA 4ONEA 2P9CA 3F4BA 4XYMA 2CSUA 4KMSA 5THQA 4ZRNA 1J49A 1X14A 3H3FA 4BNIA 3WJ7A 4K28A 5IZCA 3BMOA 5BT9A 5IXSA 4GVLA 4CM4B 3G0OA 2Q2VA 1DJNA 3JD4A 4G5HA 1HZJA 2QYTA 2DTDA 5KJEA 2BFPA 1U3VA 2Q46A 1LSJA 5JCJA 3JYQA 1I10A 3CE6A 2OGUA 2GO1A 4BNUA 3F5SA 4CV0A 5COAA 1H9BA 3AOEC 4RVHA 3FF4A 4NPCA 1EUZA 4YCAA 1PS0A 4BGIA 3OHSX 1MX3A 3C3XA 2WE8A 3O03A 1D1TA 4PLWA 4E32A 5AXCA 1E3LA 4YWJA 2OP1A 1N1GA 2J3JA 4M49A 2XF8A 1E3IA 3GDFA 1KYQA 1N7HA 3WMWA 1UJMA 2EP7A 3DTYA 4OMUA 1JTVA 1OC2A 3K2EA 3R1IA 4R1SA 3W4JA 2EG9A 1YQGA 1ML3A 1EDZA 3WWYA 1JQBA 2J5KA 2P5YA 4ZQGA 1Z45A 4WLVA 1J0XO 2PGJA 3QVXA 4ZQFA 4S3MA 3RUAA 1U7TA 4AJ2A 3ZHYA 1X7DA 4RF2A 1VM6A 4J90A 4I8XA 4L4XA 1HT0A 4KTTE 5TQVA 4IM7A 1DHRA 2GNAA 4II2A 3K5PA 3L9WA 3LT1A 4IIVA 4DL9A 1DIRA 3PZBA 3VDQA 4YT2A 3NKLA 4ROSA 3JQFC 3DZJA 1KY4A 4LK3A 4ESOA 2HK9A 3QVSA 4XQCA 4LN1A 2XAAA 2NVBA 1PGJA 2ZTVA 5GZ3A 4WGGA 1Y1PA 2P9GA 4ALMA 2Z95A 4GVXA 1YB5A 3KYCB 2BI7A 2VYND 1DAOA 3NT2A 1WDKA 5TX7A 2E82A 3COSA 3NGXA 1G0NA 4RL6A 4YJHB 4MIYA 3BMNB 4A7PA 3AW9A 4J7XA 4E2WA 2V6GA 4WUVA 4UEKA 5AVOA 1O5IA 4GQAA 1NX6A 2FRDA 4IXWA 4IPTA 4BB6A 1QKIA 2BGKA 1OAAA 3H2ZA 2IZZA 3EHEA 2V6BA 4H15A 5TSDA 2EV9A 1AXGA 3MJSA 3WYBA 2RCYA 2ZYGA 5JBIA 1QSGA 1NPYA 3P7MA 1D4FA 2BELA 2GZ1A 3KYCA 1Y5MA 4BHTA 3E48A 4B4WA 2CFCA 3UXYA 1FDTA 3BA1A 5JNLA 4FJ0A 2UUOA 1N8KA 3RUDA 4I5DA 4R9RA 1YL5A 2Y0CA 4DQUA 3ZHXA 4C7JA 1BGVA 2HMTA 2PH3A 5TRTA 1YH3A 1OOEA 4CR8A 3NJ8A 3OP4A 4CUZA 5A1TA 1EBUA 2Q2WA 1U8FO 4FFLA 5A4DA 3M2PA 2JFHA 1PQPA 2PZLA 4A73A 3O8QB 2CUKA 1XLTA 4B7UA 2D59A 4QO8A 2D0IA 1H9AA 3T7EA 5A3VA 5J9GA 3DMTC 2O3QA 5L95A 1PJTA 1PJ2A 1SNYA 1YBVA 1GR0A 3U4HA 2R00C 5KCZA 3QW2A 4PLGA 2BGLA 1KEUA 4CJXA 3HQ4O 2PZJA 5F1PA 3FBGA 1BVRA 4BNTA 4BMSA 2JCXA 2BFAA 2X7HA 3JQBC 1NAHA 4FCCA 1LSUA 1ZMTA 2JHFA 3V2GA 1M2WA 5A9RA 2VHXA 3Q2KA 3PJDA 3U4IA 4BO9A 3RAJA 4RPJA 4A0SA 1E5QA 2Z1MA 5IZ4A 4AG3A 1LEHA 4PFJA 1TT5B 4D79A 5A9SB 5B4TA 1ISFA 4Z3KA 4FFNA 4KTVE 1L1FA 4IJKA 4DIOA 5COQA 4GLLA 2D5CA 1FDUA 1ZBQA 3B1JA 1NQAO 1QLHA 2VQ3A 5EN4A 4MVJM 1PGQA 3GHHA 3FN4A 1QYWA 4W9NA 4TRJA 3Q9UA 1Q0HA 5T8KC 3H7AA 3M1AA 4J7UA 5HA5A 5L53A 3UUWA 3QIVA 2PV7A 4E0BA 1ENZA 4JXKA 1BRMA 4HFRA 2QG4A 4BGEA 3UHAA 5JS6A 3AOEA 3DONA 1ENPA 2X6TA 4IMPA 4HV4A 4GAEA 3TRIA 4FFMA 4J2OA 3S2IA 4J4BA 3EYWA 4OL9A 1X13A 1TI7A 3IJRA 3IP3A 2VRCD 2VWQA 3S2EA 4JBGA 1ZW1A 4W9NC 1MA0A 3BTUA 4EUEA 3DQPA 4L74A 3D3WA 1T2CA 2HDHA 5T8KA 1DHTA 4RF4A 4B3HA 1ZCJA 1FXSA 1KEWA 4XYBA 4GH5A 4XA8A 1HE3A 5JDCC 2EGGA 1EE9A 4M8SA 3PYMA 4ZGWA 2DAPA 4BL5A 2R00A 2ZB8A 2W8ZA 2GZ2A 4AVYA 2PR2A 2Y66A 4KP7A 3ROKA 1OMOA 2CVZA 2C5EA 1NXQA 5ITWA 1MFPA 2PY6A 4J9UE 3AWDA 1BDMA 4AJPA 2B4QA 4E33A 3ORFA 3PJFA 2NQTA 4OXKA 3GN1A 1WZIA 4J9VA 2HUNA 3PHGA 4ID9A 4HWKA 4TMFA 4BO3A 4OOEA 3JQAA 3MWDB 5IN5A 1IB6A 3RBXA 1K3TA 3ZDFA 3GGGA 3MJTA 1ADGA 5JYDA 1YL7A 3FPLA 4NH4A 1RPNA 1ENYA 2YY7A 3DAFA 2B37A 4FQ8A 2CVQA 3QWBA 3DHEA 2WYUA 3ZU4A 5LC1A 2D8AA 4ALJA 1Q0LA 3KUXA 1NVTA 4WCFB 5IDYA 1DSSG 1MB4A 4WCFA 1H6CA 1A9YA 4YJHA 3S2FA 3IS3A 3W8DA 4CMHA 1GUYA 1NFFA 3DBLB 5KKAA 3IUPA 5CEJA 1DC6A 1WWKA 3P5SA 1NQTA 3Q9NA 1HLPA 1W6UA 4WLNA 5HS4A 1MFZA 3FSRA 3V8BA 5AXAA 1E1NA 4JN6B 2HRBA 4IQ0A 2ZYDA 4IS2A 3W4KA 1M75A 3NRCA 4IQ8A 4L9RA 3UVEA 3VH3A 1SPXA 2CDCA 4NHEA 4ALLA 2Y05A 2NWQA 1E7QA 5TT0A 1IOLA 3I52A 3D5TA 1K89A 3JQGA 5FI3A 1R4MB 4PLCA 4RPGA 4R68A 4IMRA 5G4KA 3SLGA 1QYDA 4HNHA 3I9JA 1P3DA 2RAFA 2YDXA 5L3ZA 2Q1TA 3KEQA 4JGBA 4XR4A 2W98A 3VPFA 5JMPA 1V3VA 2BKAA 2VCYA 4BO1A 4IGEA 4W6ZA 5CEEA 2H1SA 2Y67A 3L6DA 4OQZA 3ZWBA 3JQEA 3GUYA 5BNFA 4P4GA 4XR9A 4YXFA 1Z7EA 3FCOA 1CJCA 3OJFA 2PA3A 5JYAA 3NTRA 3KLMX 1QG6A 5F21A 4MVJH 1PJSA 3RUEA 4CLHA 5KVCA 1NHGA 4PGFA 5AQ1A 4DC0A 4GLOA 4DBZA 3LZ6A 3R3JA 4Y9DA 4B7CA 3RJ5A 2IXAA 1NR7A 4R01A 1RYDA 2O3TA 4NDNE 4IINA 1Z75A 4B8ZA 3OJ0A 5IG2A 2GN9A 1DOHA 1GUFA 2C29D 1Q7GA 4YTEA 2C5AA 3RU9A 2C54A 4LSWA 5EIOA 2W2KA 5L7TA 1XWFA 4GX2A 4CLDA 5A5FA 2YYYA 1ZJZA 4BO8A 3PLRA 2CZCA 4XQEA 3C85A 3DEYX 2O3UA 1NP3A 1E92A 1SOVA 2CVOA 3L6EA 1LJ8A 2VHWA 3PWZA 3U3XA 2YFQA 4I5EA 4LVUA 1GV1A 3GT0A 5B12A 2OUIA 3SC6A 4K6CA 1P1JA 1B16A 3GNSA 1H94A 5LDHA 4E5MA 4RPHA 1PQUA 1WPQA 3DZFA 3D64A 2HU2A 3JD1A 4BUCA 2PZMA 3HUDA 4CM8A 1RM3A 4YAKA 1XR3A 5BR7A 1EVIA 5IF3A 4JQCA 2CNBA 5H81A 1DB3A 3F3SA 1NFQA 4NBRA 3FPCA 3PDUA 4KQXA 3HWRA 4FOSA 4CM4A 4GL4A 2DPHA 5CG2A 5T6BA 8LDHA 3WFIA 6ADHA 1MUUA 4CMKA 3C7AA 3LT2A 5I7VA 4J1SA 3TPCA 4NBTA 2YDYA 2Q50A 3JQ8A 2AQHA 4RPKA 2ZATA 2ZTLA 3PIDA 4AJ1A 1PZFA 3JQ6A 3OFSA 5HTOA 1GYQA 3P2OA 3TSCA 1E77A 1EBFA 1YBAA 4R41A 1C3VA 1HZZA 4D41A 2PKRA 5EERA 3A06A 3GVIA 1ONNA 3QVWA 4GMFA 1CQJA 2IZ1A 5TF4A 3PGXA 2O7QA 4PG7A 2VT3A 1YQXA 4UUMA 2NU8A 1F0YA 4Q3AA 1Y5RA 4BMNA 4CM3A 1SEVA 3MJCA 4KDEA 2PH5A 1YDEA 1HDZA 1NYTA 3FR8A 1OBFO 2YV3A 2B35A 4N7RA 1JVBA 4CMBA 1NVGA 2GN4A 1UP7A 2VUTA 4B3JA 4I1IA 4DWVA 4Y6RA 3FWNA 4ND4A 4MJLA 4M86A 5CDYA 1I3KA 1JWBB 2BHLA 3I3OA 4F6CA 3I6QA 1T26A 3DZHA 5AXBA 1VJTA 1DAPA 3VTZA 4OGWA 3OJOA 2I99A 3QV1A 3INTA 1CDOA 2PLAA 3K92A 4U0KA 5I7FA 4L4RA 2AQKA 2B83A 2NTVA 4HFNA 3LLSA 3RROA 4Y8VA 3ZN2A 5FEUA 3BZUA 5T57A 1ONOA 1VSUA 2I3AA 1YVEI 4B79A 5KKCA 1VL8A 2JAHA 4KOAA 2Q49A 3PYLA 1SB9A 3PDJA 4FW8A 1WMAA 1O6ZA 3WLFA 2NNLD 5TIIA 3FNFA 4J1NA 4QECA 2Y0DA 1I0ZA 2NV6A 3H9GA 1GFSA 1NHWA 4OKNA 1JAYA 4UVHA 2NU6A 3TZ6A 4YT8A 1RKXA 4OXNA 1VE9A 1I3NA 3LU1A 3VVBA 3ZWAA 1HL3A 5L40A 2H5LA 1U3UA 4XYGA 5A3JA 1Y8QB 4CUJA 1XG5A 5IN4A 1NR1A 5C5IA 4TVOA 4I5GA 3CIFA 1R0SA 2GLXA 1D7OA 3OA0A 4D42A 3E03A 3O8QA 2CY0A 1XU7A 1MXFA 3GDGA 4PG8A 4TRNA 3LC2O 2ET6A 4PLFA 3QWFA 1Q1NA 3JTMA 4IDAA 5MDHA 3ETEA 4R9SA 4DQVA 1DBVO 1G1AA 4YRDA 4BQRA 3ASVA 3LLVA 1T1SA 3TQHA 2NVUB 2O4UX 1YE3A 2X8LA 3BIOA 2Q22A 1EQUA 4XZ3A 1KBZA 3AY3A 4WASA 3GGOA 3OF2A 3VPGA 4JROA 4NFHA 3NAQA 4C7KA 1LQTA 4BQPA 1ONPA 4R1UA 2O3RA 4RVSA 4CR6A 5KVSA 4EUFA 1VLLA 3JYNA 4FC6A 4XB2A 4YJFA 1P44A 1PGPA 2Y68A 3P19A 1DIAA 4IJUA 1QV6A 4WCFC 1KIFA 1FK8A 3BHMA 1O9BA 4IDGA 4CMIB 5TJ9A 1ZK3A 3UKOA 2NVWA 1R0LA 1UZLA 3HDQA 4PLVA 3TZKA 3FTNA 4NQZA 3GVPA 4K1LA 3WGYA 3DZIA 3TDKA 3ZV3A 3GDOA 4PRKA 1E3WA 3OMLA 1O8CA 3NDIA 5C7LO 2JCVA 3RVDA 1HYGA 3NX4A 1YXMA 3M2TA 4UUPA 4D45A 5JYEA 1A5ZA 1XCBA 3JYOA 3RFTA 3GZ4A 1GQQA 4GGPA 2X4GA 3BHIA 2PD3A 3HHPA 4MP8A 1CYDA 1TT5A 4ALIA 2UUPA 1O89A 1AE1A 1ZKMA 4U8GA 2P5UA 1S6YA 1U3TA 4DGSA 2P9EA 1EVJA 1ZEJA 4P4LA 3V2UA 2O3SA 3GY0A 3ANMA 4UEOA 4UVIA 2J3IA 2YV1A 1MP0A 1H6AA 4FIZA 4QXMA 3Q1LA 3STHA 2HQ1A 4I9HA 2YJZA 4A26A 4A03A 1GY8A 1HSZA 1NNUA 4OM8A 1XGKA 3ZWNA 4GMGA 3PEFA 4GSKA 3K2BA 4CMGA 3K96A 1BW9A 4YQZA 4TKMA 3VPSA 5JY1A 3B20A 4O59O 1HDCA 1VL0A 3KZVA 3FBTA 4IBOA 4DTIA 4UVEA 2ZYAA 3WICA 3ENNA 2VZ9A 1EUCA 3PZRA 3NTOA 2AQIA 1IYZA 1V0JA 5DP1A 1A71A 2PZKA 3GK3A 4JJFA 3ADOA 4AJHA 4QX6A 1HE5A 2AW5A 4FFOA 5DBFA 4DLBA 1A7KA 1BDBA 3OJEA 5T64A 4MKRA 4CODB 4FSHA 3HG7A 4XYLA 3H5NA 4IXTA 6LDHA 1KETA 1YRLA 2FR0A 3GFBA 5B4UA 2WE7A 4ND1A 4OXYA 3PHIA 4BNYA 3KYDB 1QMGA 3HZZA 2Y93A 2VWGA 1F17A 4PG5A 4TRMA 3WOHA 1E6UA 3JQDA 3TZCA 4EEXA 1C0KA 1GZ4A 1YGYA 5G0UA 3JQ7B 2GN6A 3SC4A 1BHSA 2FP4A 2W90A 4YAJA 4YB8A 3W4IA 3K31A 4R3WA 1LRJA 4UEJA 2G5CA 1MC5A 1PL8A 2ZTMA 4R3NA 4GX5A 3AFMA 3ZGYA 3PJEA 5KOIA 2B36A 3JQCA 5TS3A 3NYWA 2DM6A 2BD0A 2QZZA 4ZU3A 3GEDA 3DMYA 4BO4A 2Z5LA 1LU9A 4BIIA 1F8FA 3WQRA 1GADO 3DAPA 5TLSA 3PGJA 4QFCA 3GF4A 4J4HA 2Z1NA 2VN8A 3DDNA 3RASA 2YQ4A 1B3RA 3ST7A 2ZCVA 4MP3A 1BSVA 2D5AA 3WNQA 3QSGA 4BKRA 3NEPX 4HKTA 5A9TA 4GSLA 1XQ1A 4UREA 2GCGA 1PX0A 1BWSA 5JDIC 1T2DA 2AE2A 7MDHA 5IXYA 2BFMA 4N5LA 5DCYA 5ADHA 4QQRA 3CINA 2DBRA 1P1FA 3FRJA 4RV9A 4RORA 1NM5A 4XYEA 4L75A 4E6PA 3LDHA 3ZH2A 4WPGA 2X0RA 3EW7A 3H8VA 3PWSA 5I9LA 3GOHA 2X5KO 2ZB4A 3QHAA 5IFLA 1QV7A 1UDAA 2C7VA 4EYEA 1ZUD1 3TJRA 1K5HA 4J0EA 3KB6A 4HY3A 1GQYA 2I67A 3H9EO 5F1KA 4AJEA 1GTMA 2DBZA 4YQYA 3SX2A 5KVQA 2Q1SA 3INGA 3VHRA 4YPOA 1KEVA 4R5MA 1E1LA 1PJBA 2WMDA 3JCZA 4JBHA 4RF3A 3D5QA 2J5RA 4DPMA 5COBA 3LK7A 4G65A 3ETDA 2AXQA 1YB1A 3IL2A 4PLTA 1LRLA 2EKPA 3CMMA 4ALNA 3ZNOA 1Y6JA 2YV2A 1L7DA 4B4OA 1HTBA 4DMMA 4AJOA 2ZB7A 3H3JA 1ORRA 3PQEA 2NM0A 4CM7A 4FPXA 4AJ4A 4R54A 1A7AA 3FHLA 2H9IA 4HNGA 4CM9A 4H3VA 3WBBA 1NFRA 1X1EA 4OH1A 4TQGA 3TFQA 3JYLA 4D3FA 2DVMA 3H5RA 4RVDA 3DXFA 1NASA 5EMHA 3A1NA 3DBHB 1DIBA 1UH5A 3BMQB 4INAA 3UH1A 4LMPA 3G79A 4WOKA 3QE3A 3WIEA 3IJPA 1J6UA 4HADA 3LF2A 3OIDA 2X1HA 4UULA 1O0SA 2EWMA 2QYSA 3GVHA 4J7CA 4R1NA 1GV0A 3HJAA 4ZHSA 1C14A 1E0DA 2NLOA 2QW8A 4NK4A 4BNKA 4IJVA 4KQWA 1I30A 3DO5A 4O63O 3U09A 1OI7A 2Y1EA 3VAZA 1D1SA 1VRWA 1GEGA 4B7XA 1Z74A 2X9VA 5I7EA 3DBHA 4CPDA 4ITUA 3BTSA 3FNGA 3M6IA 4O5OA 5AYVA 3UGKA 3X2EA 4N54A 1R66A 4BO7A 1LLCA 4FBGA 3WYCA 5H82A 3EMKA 1QP8A 3HE3A 1Z7BA 3WQSB 2VWHA 1T4DA 1CF2O 1V8BA 2RHRA 5EINA 3C7CB 3E18A 1C0PA 1U28A 1IE3A 3KVOA 1GYRA 1Q0QA 3LT4A 2UDPA 3PYXA 1ISHA 2VTEA 2EEZA 1YB4A 5G4LA 4FS3A 4MVJP 1GD1O 1M66A 4CQMD 3IMFA 3RKRA 1IULA 3E9MA 2PD4A 3DMTA 4XIYA 3SJUA 1B7GO 1QYCA 3I9KA 5JAQA 3ROMA 2XXJA 4D7AA 1GU7A 2TMGA 1EVZA 2Y1OA 3LQFA 5HWSA 1GEEA 3MJEA 2NUAA 4CL3A 2Q2QA 2VHVA 4MVJF 4IDDA 1PU2A 3JSAA 5K6AC 2BGMA 1VSVA 3I9MA 4FGSA 4TKLA 4IUYA 3LC1O 1P74A 3JQ7A 5FWNA 1JVSA 2RBEA 5FF9A 1HRDA 3HB5X 3OQ1A 1DPGA 3F46A 2HMWA 2E6UX 3HFSA 3OIGA 3ITDA 4Z0HO 1HDGO 4OOFA 5BSHA 4C4OA 2ILTA 4FFRA 2VYNA 1WVGA 4L76A 5THKA 4BS9A 1E6EA 4JIGA 2IXBA 1U2GA 3E6AA 1HXHA 4D0RA 5JO9A 2BH9A 1YL6A 5JW6A 1UXHA 3ICCA 3RKUA 4Q39A 3ICPA 3BAZA 3DFUA 4MKZA 1Y8RB 1PSDA 4IDEA 3GNQA 4EDFA 4IJWA 1DEHA 3PQFA 3E5MA 2J6IA 4NG5A 3FTPA 1SAYA 2RH8A 4CL8A 1XU9A 1EQ2A 2NSDA 2DUUA 4CUKA 5CDTA 2I66A 5CDGA 1B0AA 1LLDA 4DUPA 4BGVA 4L8VA 2P4HX 4BNMA 3AM4A 3CSDA 4ND2A 2NU9A 3QLJA 1QYXA 1V35A 4J2HA 3S8MA 1P33A 3OH8A 3ON5A 2WD7B 4MVJG 2P4QA 3L4BA 4XGKA 4BKUA 1PR9A 3U0BA 4II3A 4FOOA 1GPDG 3UW3A 3G1TA 3PPIA 3JQAD 1DFIA 3MJVA 3NT4A 2YHIB 2E37A 2GUGA 4Q3BA 3PJGA 4QT0A 4E5KA 1XEAA 4MVJI 1I3MA 3KETA 2FR8A 4DLAA 1JKIA 5BSEA 5DT9A 1I36A 4OSOA 5L7YA 1SC6A 1LDNA 3ONFA 3V5NA 2XOXA 2VUUA 2VYVD 3U62A 1GDHA 4NBWA 5GY7A 5C7OO 4E12A 4RDIA 5JDCA 1QLJA 3WGIA 3F4LA 4XIJA 1UP6A
chains in the Genus database with same CATH superfamily
2XUZA 1S8OA 5JECA 4KQ2A 4U2KA 2EU8A 2QJFA 2ZTUA 4EGJA 3O38A 7AT1A 4KC0A 4TV9F 2XE7A 2JAXA 3O90A 3KL2A 4JLSA 2V1XA 5KCMA 3ZWCA 1TXGA 2X9NA 2JIZD 1ZMXA 1OA1A 1ZJ4A 1W5TA 2HWKA 1IXRC 2VDWA 1AN0A 3H05A 3HP7A 3O3MB 2PQ0A 5HM6A 4E2XA 4CLQA 3DEJA 4N4AA 4QULA 1WDMA 1A4RA 4DBVO 1KNXA 2A9OA 4HPXB 1NNLA 2PEYA 3ENVA 5E7MA 1PEAA 2HO4A 2IHBA 3VH4A 4HGRA 4MWEA 4BNDA 4DZRA 4DA4A 4PCVA 2E4AA 4JBWA 3TTSA 3G2LA 1V43A 3QF4B 3RIGA 4DGQA 3ODGA 3VJLA 3MGAA 2ERCA 1KVSA 1CZLA 2IU6A 1SBZA 3VZRA 2F3UA 1I5RA 1EX1A 1ULSA 3K32A 1E6WA 1XXLA 2C57A 3KT0A 3QYFA 4I1RA 5DE3A 1Z7GA 1A9XB 4KQJA 4ZO9A 4Z4HA 2ZXEA 3PNBA 4KYIB 4W5RA 2I22A 1JPUA 3KU4A 1YZNA 2QV0A 5DGHA 2X0JA 5ARDA 2FF7A 5AVXA 1EUYA 1TGYA 4GD3Q 3KBBA 3OCVA 2JKZA 4W7HA 1YZTA 3EUFA 1A8HA 2POCA 4B2IA 1EWKA 1BMDA 1HPLA 1N7GA 2YZNA 1DLIA 2GHTA 4XSHA 4UM8B 1E2IA 2DT5A 1TVEA 1R4ZA 2G70A 1Q44A 3A10A 4FXPA 4X24A 1JG4A 1WUIS 3DAGA 3LBHA 4KWIA 4TTSA 4Y6QA 4XE5A 1VPDA 3D3EA 2G07A 1MXHA 1M67A 1FXWF 1E5LA 5EUCA 4DA8A 4ZQEA 4POOA 3MCVA 2ZAMA 3ZZNA 5J1SB 2P0AA 1GL3A 1ZCBA 4GX0A 5G3ZA 1W4BA 1GNLA 5FNVA 5F2NA 1NYRA 1JR3A 1ZH8A 3CS3A 1YBMA 3TSZA 1DWPA 3WIUA 4D4HA 2FEXA 1QXSA 1P1HA 3PEYA 4YRAA 3HVRA 4RF5A 3WGLA 1II8A 5IAJA 2QBYA 1A2KC 1R74A 1UM8A 4HDMA 3ZGLA 1NMYA 4QM7A 4MA5A 3LK6A 4M7PA 5LZ2A 4YUYA 4DPLA 1W88B 4R69A 5JG7A 3E0XA 2WWYA 2PS0A 4PZPA 2DCMA 2OZEA 4DNFA 3PC8A 1XZAA 3MOGA 2PZAA 1YR8A 1P0CA 1VE3A 3OWOA 4MUNA 1JE1A 4YRPA 4QYWA 4QYSA 2IYOA 4AT1A 3NH9A 4URVR 4RKFA 3I5XA 1IIRA 5L3SA 2NU7B 2DBQA 3QE0A 2R8PA 2V8OA 5EOVA 5KOHB 3V00A 4L22A 1LQUA 2G5GX 4LHEA 4HLCA 4L7QA 1HLFA 4AO8A 4BQOA 1E1QD 3GGSA 3DFMA 1O57A 3O2SB 4P53A 1RBZA 2PGDA 1TYCA 1KEEB 4XM1A 1FMFA 3PHHA 1X7YB 3ZI7A 2CL0X 1UUFA 2Y0PA 3G68A 4GPAA 4R1LA 1QHHA 1ZD1A 3Q7QA 3ZQUA 3ICEA 1YA4A 4UQOA 1NLUA 2HKIA 2BBTA 2FP4B 4GM4A 5DOZA 2QAJA 5A4AA 3ULKA 2VOJA 5TR9A 1SU7A 1TE2A 2FUG1 2GO7A 4HI0E 4EZBA 1W87A 2G8NA 3W1WA 1X3SA 3G2KA 5DHFA 3T1OA 4ILKA 1BDJA 1POWA 3EGWA 1SK8A 3JRNA 3BXGA 4BV2A 4EEZA 5GV8A 3OCYA 3VAAA 3GMTA 2VDUE 1IY8A 3ZDEA 4LWPA 1JKMA 1ZJYA 3EZ7A 4L0QA 4HNTA 4OHYA 2CNWA 5HP4A 1UFVA 1GQ2A 1NVBA 1E9VA 1U5AA 2WYWA 4OP2A 1A2BA 2FVYA 4BB0A 5BNTA 1LBEA 5IAEA 1FUUA 1SHLA 2I3GA 2HK8A 3COYA 2XITA 3GV0A 3QG1A 3QTTA 3QU4A 4YMLA 2K2WA 2OOSA 1DXQA 3CO5A 3FHJA 3UJ9A 3KUCA 2IP2A 1V1MA 4WD3A 4CIXA 1BOFA 1DOZA 1FF9A 1F6WA 1HRKA 1SCJA 1Z6GA 2V45A 3KKLA 1PV1A 4PTLA 1PUJA 2ICAA 3PFKA 2II6A 3R5TA 1RAGA 3RRXA 4F4HA 3F0TA 3FJ1A 4N5DA 4QICA 2CLEB 2ZUVA 2J9YB 1FNSA 1RAFA 3IEKA 4EVSA 4AQDA 2YWXA 1R0RE 1QO9A 1HT3A 4V2UA 4CKEB 1W7AA 3B6ZA 4TV9A 3ZCXA 1XZBA 2N1MA 2GKGA 3VVMA 4BAGA 3CH6A 3K05A 2DKOA 3MPUA 3DEHA 3AV0B 1TOAA 4EX6A 2QNIA 1JG3A 3E23A 4E5NA 2HUPA 3JQFA 3AU8A 3DWIA 4XX0B 3NV7A 3OECA 3DLCA 5AUNB 3K0SA 1CUDA 2R7NA 3ITNA 4JJIA 2C7PA 3U2QA 4CGZA 3RVQA 1NLYA 3JAWB 2X5NA 4GQBA 2IVFA 2VF8A 3P2YA 3A9TA 1TCCA 3Q8XB 5H7XA 1U1GA 3L7NA 3GMDA 3RK1A 2WWTA 4NR0A 1V4NA 5ED0A 5SZJA 3VZDA 2GHRA 1CJSA 3QKIA 4NESA 1RJWA 1MVLA 3CW9A 3UK1A 1NVEA 1U8AA 3M4ZA 1KOFA 3QF4A 3PA6A 4WTOA 5LXTF 821PA 4RD3A 1YWGO 3GZJA 4IIFA 1PD0A 2I2WA 4LRSB 1U7UA 2H2GA 4NZNA 5GONF 5FFMA 3TQTA 3GB9A 2IZOA 5BYJA 2WLSA 2FE1A 4ZAZA 5IABA 3ZV5A 4UQPA 4XUDA 4AN4A 1IM2A 1JU9A 2I1QA 3BDIA 3FXAA 3GEHA 4KITB 5IPFA 2H48A 1MRSA 4Q3CA 3OQ6A 3G6WA 3ZWQA 4F3YA 4KFUA 2GZAA 4LUCA 4US2R 3HCRA 5D86A 2H52A 2M6SA 3FFAA 4OHBA 3GFGA 3IVGA 3GQBB 3UC5A 3RAEC 3WB9A 4PFSA 3WYFA 4RJJA 1Q1EA 4NX2A 1EFRD 1GVHA 5KI6A 2EBWA 2E1PA 2QD5A 3K94A 1M2OB 1O96A 2WJAA 3ZDYB 5IANA 3D7KA 5B7GA 1VE1A 1N5DA 2IYAA 1R6TA 2IUEA 1MB2A 4V0SA 1TEVA 2J0VA 1D7AA 2QSUA 3F8TA 2YHUA 1DFHA 1ESEA 3QX3A 1PG2A 4YS6A 1D04A 4JR2A 4UCFA 4EATA 3EBPA 4CV3A 4WK6A 3GLQA 5LUAA 3TZQA 4MXDA 1DG1G 1JHDA 3T95A 2O5VA 3R5HA 3G1UA 5J5AA 1Y1TA 4XCXA 4CN9A 1OR8A 4QGFA 4REMA 3ZWYA 3T1QA 2ZAGA 4JLKA 1ICEA 3AP3A 3SEFA 4MYDA 5DULA 3I37X 3CURA 2IEBA 1FTWA 4YACA 3T3NA 4ZA2A 3HA3A 4YJDA 4AUEA 1SO8A 5ICFA 4FR0A 3RUPA 4K9OA 5LCXA 3EFOB 3T3EA 4Q6WA 4MR9A 1WW3A 3LHDA 5E2IA 3L4SO 1H0KA 2BKVA 4O2AA 3TW6A 3FMOB 5EKXA 2BRUC 1K1EA 1GZ7A 1NUQA 1EFKA 1O6CA 2EL7A 4HP8A 4HRAA 4R8LA 4RBNA 2JLQA 3B7GA 4Z4FA 1EE2A 4PC1A 2HBYA 1N1MA 5EL0A 1AHNA 3Q3EA 4GEKA 3ZE1B 4D6PA 3FCEA 4LJ7A 2UZ1A 3FM9A 5HS6A 5BPFA 4PZ0A 2C2GA 4NL4H 4JVNA 2UV8A 4AY4A 1XJWA 5CFOA 2WZQA 4ZYZA 3DR5A 4GPD1 1NV8A 1UBGA 1Y5NA 3GG2A 3HADA 4KWTA 2O0MA 4O89A 1AKNA 2OBYA 4BB5A 5CP8A 4H3KB 3LDGA 3MZ0A 3SP1A 3P0JA 3PLAE 2VLIA 3W5IA 1E0KA 3KV1A 3Q0EA 4B87A 2IOQA 4UTXA 4LWOA 1NBIA 1A97A 5DXJA 2XD4A 2QD2A 4ZVSA 3BSYA 3M70A 3CGWA 5HKAA 5C52B 2O7SA 4JBIA 2GASA 3C70A 1VPTA 2HMVA 4I5IA 3SVZA 4G3XA 2BJVA 2RHGB 4L95C 1DEKA 1I8TA 4X84A 1UP4A 2COUA 3ESZA 3FB4A 1ACJA 4LHYA 4OFZA 5SY9A 1H2ZA 4TVSA 2PKQO 1V95A 5DZSA 5KOYA 2REXB 2SBTA 2IIQA 2P7HA 4BVFA 3ESCA 2AHRA 3CB4A 5TJHA 2TMDA 5A4JA 2GK7A 5C8YB 5FBRB 3WWDA 2FZVA 1VLVA 3DD5A 1NVMB 1KRXA 2GXSA 3PIIA 3G9XA 3H0WB 1NATA 2WSSD 3PKZA 3WNBA 3ZXUB 3LE8A 3KNZA 4DCCA 4E31A 4V1CI 3KKKA 5E4TA 4PN7A 1TX4B 5TVKA 1YZGA 2I9PA 3UOGA 2O6LA 4NFYA 5A0TA 5C1BA 1EG2A 4YP5A 2WSIA 2WFLA 1DO2A 2WWGA 2HR1A 2A0YA 4X1KA 4DXDA 1JXQA 2NUBA 2XCLA 4OXQA 5BQFA 3RKSA 1N1DA 3GH1A 2WFMA 3IR5A 1G3UA 4GU5A 3G5LA 5ALHA 5EA2A 2WJ6A 4BFTA 4D8UA 5I9NA 4KDCA 4AMYA 1JHUA 1SIOA 3L0PA 1UOPA 4G5OA 4MA0A 4GLBA 2EQBA 1ZXBA 4Q0MA 3DA8A 1EH5A 1U2SA 1AZSC 3BK2A 3MUNA 4B9EA 2BISA 4H31A 5BMOA 2EW2A 1ISIA 3P1JA 3AFIA 2NO5A 4TYYA 2NTNA 2JAWA 3U1TA 2OBMA 3TXAA 4MV3A 5J3JA 3IKTA 3EEOA 4ISBA 2QUIA 4FE4A 2A1IA 1HNZB 3B7PA 2IY8A 3L5KA 4YV0A 3OZWA 4DAEA 5AVYA 1A3CA 1VHQA 3F7TA 4BNXA 1O08A 3C3KA 2HK6A 1AT1A 4BKMA 1IBKB 2QHXA 3D59A 4M98A 4CMEA 4TTJA 3DG9A 3M6AA 3ML1A 2JGEA 2YQZA 2UUBB 3EULA 3QPWA 1FQOA 3AFGA 4CZ2A 1XCOA 3L07A 1CWUA 3IUQA 4D82A 4QRHA 3RT7A 5BWOA 2ZRMA 4D74A 4IW3B 2P3LA 3B5EA 5LP6B 1AKMA 2LP4Y 3SOZA 4UW9A 1AUOA 2I2XB 4BMVA 1MB9A 4C3OB 4W63A 4YONB 5LD2C 1OSNA 3O4RA 5EKSA 4PO9A 2RKWA 1PL6A 4RD6A 3T7RA 3VU8A 1WPGA 4ALKA 5AW0A 1N77A 1SZJG 2BMDA 3FD8A 2C04A 3KT3A 1WMEA 2WJ4A 4E1AA 1EDDA 1GN8A 1OFIA 2PV0A 4JLMA 5NULA 4K6OA 3V48A 4DNQA 2G9UA 3KSDO 3R7WB 4EFKA 4F71A 3PPXA 3ADBA 4DS3A 1LDYA 3DKPA 5CCXA 4GNRA 1X19A 3C6ZA 1CPYA 3NTLA 4TTTS 5JRJA 1OZ0A 4ZYWA 1O03A 2RK4A 2C1EA 4GEGA 1GILA 2DPYA 2V58A 3KLOA 5CA0A 3ZV4A 4Y6OA 4CIYA 1A96A 3O3CA 3JZFA 1KJJA 1I3CA 3BE5A 4FN4A 4QC2A 3UB3A 5C37A 2EP5A 4TX1A 5EQJB 1Z0ZA 3MGCA 4O4HA 3JAWA 1NYQA 3EY9A 2ZWMA 1TGVA 3BGWA 1UQTA 3HA7A 3NVDA 4JJZA 3W5JA 2H0AA 1GNQA 3E8XA 4TKVA 2RHWA 2XDYA 2E85A 5LLDA 2XNSA 1U3FA 3PXDA 4JUBA 2GNOA 5JQWA 1NF3A 1IHXA 2IRWA 3ZJ5A 1UXGA 2B0CA 4QO7A 2OZLB 4WZAE 2V3WA 5BO5A 3T7TA 1VPWA 5DEIA 4FGKA 4FKBA 4Y6PA 5DBOA 2H1CA 4JP1A 4D3YA 3AZOA 4L6AA 4OJNA 2CMHA 1K5PA 2F3QA 4B2LA 5C8XA 1FMLA 4MYRA 3FNEA 4EABA 1LDEA 2O06A 4YCCA 2YVKA 1OREA 3E82A 2ZYRA 3PCRB 1U2DA 1FVHA 2ZIZA 5HGJA 2JFQA 4MS1B 1CQZA 3GEGA 5FI5A 2HM7A 4J91A 3CUKA 4N6OA 2G0NA 2BWJA 2Z30A 2A86A 5BSTA 2G1UA 3FCAA 1EDBA 3HYCA 3WYDA 8AT1A 2JDIA 3V7YA 4FB4A 1VKZA 2NW6A 4MDEA 4BRSA 3DOEA 4CG1A 4YWHA 4EJ0A 4TVKA 4PRYA 5U1PA 5IDQA 1T4CB 4XJXA 2CLOB 3JQ9C 4E3WA 3U4DA 1E20A 4EB8A 2FG7C 2QR2A 3GQVA 1FDOA 1BQ3A 2TRSB 3I5AA 3VOBA 3EVNA 1OFGA 1VJ5A 4OI2A 2Y9MB 3UTCA 2OGWA 2GJ8A 3ILYA 1FE8A 2KBEA 3R5FA 4G07A 1F12A 1Q57A 1Z2PX 3BXXA 3D9QX 3IURA 1FS6A 1HDXA 4FFWA 4UFOA 4AJNA 2JBAB 4NCXA 5HPYB 4L73A 2OV4A 5JJIA 1FNBA 4O29A 2JKYA 1MNQA 2MR6A 3VBEA 2IPLA 4GPIB 5C7YA 1H0RA 1Z26A 3KZMA 2H08A 4WADA 4I8DA 2FRVA 1YMQA 2BEJA 2O6HA 4I55F 5D01A 2V7UA 1VJ1A 2WUGA 4YJ3B 3T3GA 1BFUA 4NV3A 1IVNA 1U8XX 1UFQA 2WDZA 3MK31 3REGA 1E2DA 1CQPA 3U7GA 2FW0A 1R5BA 4OIMA 3JQ9A 4EHHA 2ZRLA 3LCJA 5ILGA 2WJVA 5AI5A 1XMJA 3WTCA 4B32A 4YBRA 1GOTA 3A6LA 1ZC3A 2DWPA 4J0GA 3DL2A 4BKOA 2XQKA 4CTJA 2XXAB 3KQMA 4YH1A 5CFMA 3D54D 4Y2TA 4JLUA 1YZLA 3RCBA 3IAM1 5ESDA 3SS7X 2A88A 2G1AA 3F1LA 3OZAA 5HBRA 4UDOA 1CU1A 4M89A 4AZSA 5L4LA 4K6KA 4BNHA 4E4TA 4GQIA 2X9QA 2J3KA 5AW6A 1W73A 4YJGA 3I58A 3JX9A 2F67A 4KLCA 1LTHR 4L3VA 3WOVA 1C0IA 5CDFA 5F2KA 4FYHA 3ZJTA 3U9TA 1P2GA 4ZJPA 1PJCA 3MD9A 1ZXLA 1J8MF 3QENA 3SFTA 1U5BA 1NXWA 1Z25A 2BPOA 3WQBA 1DC3A 4LOHA 1EXMA 2H4YA 4ZAXA 3EZLA 1OJLA 1YZQA 4ZO7A 2W00A 2BN4A 2ZUCA 2F48A 3V1YA 4MQEA 3GRKA 5BSRA 4YDRA 1J00A 3TQQA 2G9NA 4BVAA 2VK2A 2RC5A 3EY4A 3P2EA 2OYRA 5I7HA 1U6KA 4UVDA 4RHTA 4DDVA 1P1BA 1OPXA 2H18A 2LDBA 1MO4A 2P68A 5CXSA 2OSVA 3LYHA 4L07A 7REQB 5ALEA 1JFVA 1WNFA 2OFWA 3IDAA 3NDRA 3TRDA 2Q2NA 3ZE6A 1MZVA 2F4VB 1XI2A 4TWBA 1JEYB 4EJMA 3S2YA 1D0IA 1C8KA 5IKPA 2PRKA 2WG2A 3PQ7A 1KO5A 5AJWA 2LGJA 2ATIA 3FPFA 2NPOA 2FSGA 3GIDA 5KWEA 4LF9B 1FFGA 3WS7A 4ERNA 1MJFA 1IONA 3HPQA 5G0TA 1ARZA 1V3TA 4GP7A 1K7SN 4NOKA 4WZZA 3KQYA 3W3AH 2J07A 3GGPA 4LV6A 3E22B 4Y1RA 4ON9A 2A92A 3H9CA 4CQMA 2VWPA 1O94A 4XGNA 4DG9A 5LJLA 1XLVA 2JIPA 4IUDS 4Y6LA 2WM8A 3HRIA 5DM60 8ADHA 4HAVA 1OFHA 4Z8XA 3L0DA 1FW8A 4DDTA 1D1QA 5DSTA 2D1QA 2QTZA 3SVTA 4EUHA 1UDBA 3JQQA 2FZLA 2QX9A 3QHPA 1JSCA 1MF7A 3CUSA 2DX7A 2ZM6B 1QX4A 1SIUA 4TTVA 3NONA 2XA9A 3U3MA 5CDUA 1M1YB 1Q11A 3L6BA 1T8PA 3HB0A 4GMXA 4HD8A 3PFGA 1TEHA 4DLVA 2GEBA 4AJIA 3DZDA 2RGGA 2XKBA 3BMQA 3HU2A 4MVCA 1GCIA 1JFSA 2J9XB 4IR7A 4ZJYA 5MN5A 4WOJA 2DFDA 3BK7A 3KQOA 5E7JA 2HQOA 4Y7CA 4ZHQA 1QZXA 2HMUA 2W5UA 1XTJA 1ZMRA 1A72A 2I62A 3GJXC 1ZJWA 4WNAA 3DHYA 1HX7A 1T2EA 3I9NA 5FBVB 4IIEA 3ABIA 4ARVA 3QEBZ 1KYXA 2GSDA 2XTMA 4UAJA 5E1DA 5C32A 2ZUWA 5A06A 1E6KA 2G6BA 1XHFA 2NZWA 1J22A 1AM4D 1K7CA 3LBFA 1K66A 1MIOA 1R4AA 5BQPA 4I2VA 4ARZA 3ZCQA 4EAQA 2DWQA 4YJFB 4CTOA 4Q48A 5KWVA 2JH3A 3IPXA 4OVKA 1HORA 1U81A 5DHPA 3WLOA 3R5JA 3WK7A 5B37A 3A3NA 2HO5A 4N3NA 4NCNA 2P27A 3NI2A 3JWEA 1QHGA 2XMPA 2P2NA 3L1UA 2NU9B 5L4NA 3OEEA 3AVWA 3SQXA 1J9EA 1FRZA 5M2QA 4GXQA 2XWPA 4LRUA 2R6DA 3NAGA 1W0JA 2RDMA 2IP1A 4G81A 1HQCA 4QRDA 1UEJA 4JB0A 3SY8A 1LJUA 4G09A 1YRBA 3GEEA 2V6JA 2OHOA 4CNBA 1C1XA 5FNVF 4LCJA 4O08A 1UPCA 2A5GA 2H6EA 1KARA 2K7ZA 3CNOA 1QB8A 2CNWD 2DP4E 3A1DA 3H4MA 2EXXA 1CT9A 1V11B 1QP0A 1LDMA 1IZYA 1GPLA 1FXWA 3Q11A 2V6IA 2XWBF 3CYFA 5AI0A 5DCUA 1R6AA 3TRKA 1PUXA 2ORED 3DUWA 1UFOA 4LGCA 5HUJA 2QY6A 1MJNA 2FCRA 3RYIA 5ES3A 1TUEA 2DPMA 2ZVDA 1R9NA 3IVRA 3RS0A 4D4GA 3E2PA 5DWVA 4MKXA 4CKCA 4X1IA 4IEIA 3PQ6A 3KUUA 1Z0DA 3D0RA 3NOXA 5K0GA 4RZSA 3DH0A 1M83A 2HPVA 3FNHA 3R76A 4ECEA 1U1CA 1XCPA 3KO8A 3KWMA 2C94A 4M87A 4QUIA 5CPFA 4LHXA 3VC7A 2PFKA 2CNLA 2MYUA 2UZ1B 5LOVF 1C7IA 4JX8A 1JIUA 3BWMA 3DXZA 3VKVA 2GRAA 4YRZA 1WUHS 1UAAA 2IW3A 4A6PA 3D7LA 1T1EA 4QODA 5JTTA 3SXPA 2XCRB 3CPSA 3LUDA 1XN4A 4NLLA 4OAQA 1R15A 4TUYA 4UD2A 5DBEX 1ZX1A 4PXYA 3ZLTA 1V26A 2AI2A 1PGOA 4NAHA 4DLXA 4QXQA 3RWOA 2OO5C 1T3HA 2VJQA 4CL0A 1JAHA 5BN3B 2B1GA 4ZI7F 1SXJA 3ZCVA 2O57A 3MRXA 2HJWA 3KKOA 5JSKA 4DQ0A 1DCMA 4JB3A 1VSTA 3UAYA 3LUFA 1KI2A 3ZW8A 1TZCA 3E2IA 1G59A 4ND3A 1CS4C 2LKCA 2ZJ0A 3N86A 3OT1A 3OT1B 4D5EA 7ABPA 2RHTA 2FZGA 3D3JA 1Z0FA 4HGOA 2QU8A 2Q3EA 2J3QA 1KO8A 3PXBA 5G1PA 1R16A 4IIJA 3H83A 3K5HA 2PFGA 2P1RA 2Y71A 2EX1A 3G9QA 3KOUA 3MINA 3RRYA 4UNQA 4BE4A 4UZSA 2W6MA 4RY8A 1OFUA 4LG1A 1NRJB 3R5SA 5FUVA 2X3UA 5P8WA 2PN1A 1HE4A 3DAHA 5AOAA 3QX8A 3E05A 1XKTA 3G5AA 3EA4A 3R09A 1U4SA 3AWIA 4GOXA 1PR3A 2V7QD 2Z5VA 3KAQA 1IUPA 1ZK2A 4DR7B 5HUQA 3I9OA 2DYKA 5DTIA 2DHRA 4EYQA 4UTZA 1LPBB 5DNYB 4OSPA 5AFSA 5FXMA 4DYDA 4URZR 4DYVA 1M2JA 3ANLA 1JNXX 3KKPA 3LFUA 2IS4A 3M6FA 4CM1A 1PQWA 4LOAA 2AEJA 2Y99A 4QTXA 1ESNA 4X6UA 4AZ0A 2JFGA 2GXAA 4RENA 4C2AA 3HO1A 4XLLA 1KYVA 1XA4A 4NBUA 5AO9A 2ZS9A 4LFCB 3H84A 2G4CA 4DLPA 1MCZA 1RLJA 1PGNA 1UPAA 1R0WA 1MG5A 4GWKA 3NYIA 5KYKA 2AC2A 4N01A 1QZ3A 5LLTA 1AXEA 1HFKA 4CBVA 3THWB 1FFYA 2WM9B 3P9QA 4LPKA 2QM7A 4P83A 1O87A 5M3BA 5A0VA 1MJ5A 3JW8A 3O7WA 5LSAA 3K09C 4BXOB 1UC5B 2NU8B 1IQPA 2MSWA 3EOZA 5EJFA 2JRLA 3QUBA 2BV3A 4G1MB 4NJMB 3TNLA 4DPKA 5JVDF 1PFGA 5K9ZA 4XIJA 1QRRA 4TMYA 4B80A 3DBLA 3KRTA 2FW8A 1OH7A 3AL0C 2O5EA 1XQ6A 1Y7TA 3ETJA 4Q9KA 1U2GC 2D5IA 2OR3A 1B15A 4FILA 4L27A 3STTA 1JDVA 3V1MA 2FCAA 3QLUA 1BN7A 3E4CA 3MTAA 3OZDA 3P9ZA 3ROPA 1RWXA 2J31A 3SJBA 1N3BA 4B6PA 4EECA 2W8BB 3EVEA 4I9UA 4QJ4A 1EM6A 1KYYA 4MGZR 3HC7A 3S70A 2OO5A 4DT1A 4A2CA 2ZZMA 4HRYA 3AJDA 2PT5A 2ZRNA 1ORTA 3WNVA 3ZOZA 3U60B 1Q3KA 4DV6B 3CH7A 4D0LB 2YIDA 1JDZA 5GZ6A 1DJPA 1PW7A 3EPHA 1XRSB 5TEVA 2BDEA 2NTEA 1PFQA 1EFCA 1ISMA 4B6GA 1VBMA 1JA9A 4AP9A 2WIKA 2ZRAA 5JD3A 1AQLA 2W43A 3ZU5A 2PUDA 1K6EA 4Z86A 2Q7XA 5EP3A 2AN4A 1YACA 4NMLA 4B8YA 3AIKA 2O2IA 5LFAA 2ZE8A 1S89A 4WOBA 4R2JA 3F2VA 2C31A 3BGIA 4U7WA 3DFZA 4BMPB 3SX4A 3AJ8A 5ICGA 5AIAA 2C2OA 3KG2A 3NXKA 2DQYA 2JJ1A 4KO4S 5CYGA 1NVAA 2OAGA 3DB1A 1ZQ1A 2QAGA 3GAFA 3TOXA 1ZSVA 2H2IA 1L7PA 1Q7TA 4ND8B 4QGHA 5KSYA 5DPMA 1DUSA 3O75A 4JK3A 4M76B 3L8GA 3NANA 2DHDA 4DR6B 4URFA 3QLVC 3GEPA 3DM5A 3QIAA 4FUQA 4AO7A 2O1WA 2ZIFA 4V0RA 2ODWA 1K4MA 3DFIA 4OHVA 4B46A 4ENUA 2DKNA 3PGLA 3RIHA 2X22A 4KBGA 4L4YA 1K6XA 1Y7HA 3IELA 3SICE 4DXHA 2AT1A 3IV9A 1PWZA 4F6RB 1SBNE 1VHWA 5LBUA 4ZAGA 3ESAA 4U5XA 4BLRA 4ROTA 3C3DA 1N8NA 5CCBA 1GPBA 3PX7A 4BE9A 3A28A 3KE8A 2UYGA 4GO1A 4Z9BA 3QBEA 4JQOA 3HDGA 2JGNA 4M54A 4BRWA 1OH5A 2IEYA 2SKEA 4F72A 4JVOA 1NVUQ 2IXDA 5CGQB 1SEPA 1ZEMA 2FPLA 2REOA 2XJ9A 4F85A 2PXXA 1HSOA 1MG0A 2QMZA 1E4YA 1XVIA 1VIAA 2YOGA 2C3OA 1DQYA 1CR6A 5U9CA 5FBQB 3BZWA 1BKDR 1WL8A 3BRWD 4D6XA 5BSFA 3EWNA 221PA 4B6EA 3WV4A 2QZ9A 2ZREA 3MCAA 1IPEA 5JSQA 2YUIA 3QY9A 1T3LA 4DWJA 2HNAA 2E0IA 4RM2A 4XGIA 4P7BA 4YR9A 2VSNA 5HM8A 4B3RB 4B17A 4A82A 3B5JA 3GW8A 4IIHA 1ZDMA 2PUHA 2VHTA 4KXXA 1B2LA 1VYVA 3LQ4A 4HZGA 9LDTA 2QP4A 2E4YA 3ZV7A 4W5QA 4H1HA 4F9EA 4XJSA 1QQ5A 2PUVA 5JJLA 4DIFA 4GYYA 1U9CA 1JLHA 3TOSA 4MZDA 4DM4A 1Q7CA 4O4HF 2XKKA 4P0QB 4G4SO 5JH7A 2FPIA 2P9BA 3MUOA 4BEWA 4HNAA 3TG2A 4MW4A 1XTPA 1HLGA 3FYDA 3ZUPA 3EPRA 1YS4A 3G0IA 4N5HX 3RRNA 2Z9BA 4YALA 4BGUA 2HYIC 3HFGA 2IODA 3SFZA 3IP7A 3WLJA 3LYLA 4JP2A 3TCKA 1KJQA 2VF5X 1JT9A 1J2JA 2BZ0A 4G6ZA 5DW3A 1QRUA 2CBGA 3L9XA 3FWHA 2V7PA 3MJHA 4FYYA 5DISB 2DXIA 1YS6A 4Q4DA 4L4SA 1C0LA 1XWIA 4IWYA 1R9JA 2NZJA 2OMEA 3FHCB 5I8ZA 2X4IA 1P61B 1DZIA 2DQZA 4JJGA 1QVWA 4QATA 5JQGA 4KGXA 5HIJA 4G01B 4KX3A 4DJ5X 4YR7A 4ZQHA 1QFYA 1EQAA 1YS9A 1CQIA 1X1QA 1Y3AA 3AGQA 4OHUA 1YJQA 5AI6A 1TRKA 2X2OA 3CZMA 3HBNA 3RYIB 5L9AA 1TUBB 1ZLXA 2XV1A 3GRYA 4YXWD 2XAUA 3BJMA 2R6JA 2VPPA 3HNOA 5IH7A 2PFSA 3G7SA 3Q1KA 1XRLA 2XB9A 1ZZGA 3JQPA 4N18A 1EJ0A 1G16A 3UFXA 3S2ZA 1NT2A 1JA1A 2IOFA 3MRTA 2P78A 3H5AA 4U00A 2GRJA 3RUHA 3NUGA 4FFPA 1TF7A 4KRYA 1PK9A 5AI8A 2QGFA 1QHSA 1WXGA 3I28A 1NTOA 1TLLA 4B4KA 5KDDA 1WO8A 1ZI6A 4GX1A 4XLZA 3GBPA 3NUZA 5AW3A 2V03A 3QBVA 2NZ2A 4PG6A 4LGYA 1QRAA 2FXVA 2Z09A 3ELDA 4Z49A 3HNPA 3BYZA 2VTDA 3LBYA 3PXCX 3HNRA 5EMKA 4DC9A 3HGTA 3ITKA 2KWIA 4G4GA 4NFSA 4L72A 1CDZA 2QTMA 4CI9A 4EO4A 1RJFA 2HA2A 1HWYA 3SC2A 4GHWA 2HFKA 4CMJA 2NTYC 3KLPX 4Y0NA 2I1LA 3MJ4A 5DTMA 4UU7A 1PZEA 1PI3A 4LISA 3SBEA 1CF9A 2Y3IA 4CDGA 1KVRA 3AR8A 5G41A 1EP9A 1N2CE 1O95A 1Y81A 4XD2A 1WXFA 4KGVA 3GZNA 4ENPA 1BH2A 1V9CA 1GO2A 3NV9A 1ECLA 1P7PA 2GA9A 4H77A 3RBVA 3ZV6A 3AINA 3T41A 3TUZC 4PIMA 4Q7KA 4RZHA 1CY7A 2NVUA 3TQFA 2A84A 5YASA 2DRIA 3OZIA 2OGSA 4DMUB 1BVYF 4OL0A 1IOZA 4FT4A 5F33A 2P9FA 5ICSA 1G4HA 1L7EA 4BNJA 1L7VC 1SCKA 2YW9A 1WDWB 2A59A 4PLHA 3ZQ4A 2GF0A 2X0KA 3Q10A 4ZOAA 4S1WA 4CHTA 5JALA 4C22A 4TXHA 4XPZA 3V1UA 3QJYA 3WRYC 2RK3A 1GPMA 2C7GA 2HCTA 2MMGA 2B8NA 4UHCA 4KQIA 3WGJA 1Z36A 3LC7O 1SVWA 1EX7A 2C5BA 2QB5A 3KALA 3P52A 2RAVA 3RNOA 4GI2A 1U98A 3OCUA 4FDAA 1CUCA 2R87A 3EXAA 4JEIA 2B82A 4L2IA 5BW6B 4BUJA 4D9HA 1N9KA 3IIMA 1QS0B 2RGEA 4ZEVA 1G98A 2AG0A 4RGYA 4MWTA 4NTZA 1IL0A 3VR0A 4PZEA 3REFA 1DFGA 1KL7A 4KIWA 1K0FA 1MO3A 1N2GA 2JIRA 1QHEA 1R4NB 2OV6A 2ZIEA 1ZS9A 4D3DA 1NPTO 1CS0A 1T0IA 2GERA 5AOCA 4UC0A 2D13A 3HCNA 1BNCA 5FWXA 4BE7B 4ZJUA 5HUHA 5J23A 3I01M 2GBLC 2IP4A 3AB8A 3DAOA 4MR8A 4AJJA 4B7ZA 4JXJA 1GITA 1AKTA 1NUSA 1CDEA 1NMSA 2BJHA 3P5BA 3R6WA 1UMCA 5KDLA 3LUGA 3EVDA 1UJNA 3L06A 2JJ2D 4DCJA 2CUNA 3AOGA 4KODA 4OFXA 4TMTA 1L5SA 3LLUA 4KAAA 3I6YA 4RSHA 2KX7A 3ZVMA 1UR5A 4U63A 3KTOA 5AKGA 3A31A 1C4XA 1EUDA 2IL1A 3EGXA 2PWZA 3IXMA 1DT5A 4UZFA 1A2OA 1V1JA 3VHQA 5EJ2A 1YNOA 4LVCA 4B6RA 2P9CA 1OLSB 2XYQA 4EBBA 5BW5A 2CFIA 3WQHA 1OXBB 2N42A 3PBKA 2O2ZA 1FMJA 3PPWA 4ZRNA 1J49A 5EP1A 1LNZA 3AT1A 5E1MA 3H3FA 2NO6A 4UTOA 4KXYA 2OOKA 4F2HA 4TXLA 5IZCA 4JY7A 3OJWA 3CKLA 5B3AA 3IUEA 4POAA 2QUAA 5BT9A 3N28A 4GVLA 4JZYA 3AUJB 4CM4B 3CSSA 5FL7A 4Z7OB 2Q2VA 3EMVA 4G5HA 4IFEA 1JMKC 1HZJA 1JQLB 2W2QA 3LVBA 4IGAA 3UMCA 1NNEA 5KJEA 2BFPA 1JBEA 3L8DA 5JCJA 3UMBA 1JE0A 1N5LA 1UPFA 3LHFA 1ZIOA 4XPIB 1QHFA 4GFDA 1I10A 3SD7A 4AIIA 3SYRA 4CV0A 1XZEA 3F5SA 1M5UA 1H9BA 1X7ZB 1P0QA 2EG5A 4QPCA 4FDMA 1FUYB 3UFBA 4NPCA 1EUZA 3P0EA 4IICA 1P81A 2XZPA 3N8GA 4JMLA 3AILA 2WE8A 5JQGF 3O03A 5FA5A 4S0XA 1EP3B 2R4TA 4E32A 1W6RA 1NBMA 1VE6A 5AXCA 4YWJA 3R7NA 1ZBDA 1KGSA 1ZGAA 1N1GA 3FPHA 4FD2A 3MHPA 1E3IA 4QJ5A 4DIEA 4ZCRA 3DTYA 2PSSA 4S2EA 2XWJI 4OMUA 4DFDA 1JTVA 4LRWA 4QTUB 4XIFA 1R0BA 4TT8A 4IXDA 1YQGA 2B98A 1EDZA 3RF7A 4B43A 5IKEA 3ZJVA 1O58A 2P5YA 2B2NA 3H97A 3VNAA 3IEMA 2HCBA 2VEDA 3ENZA 5BUQA 1J0XO 2PGJA 1M8KA 3FUWA 5ALKA 1J1IA 1SVSA 1U7TA 4Q1CA 4Q21A 4YNBA 3EF3A 4RF2A 2HA4A 3DXXA 3U39A 1L1RA 2Z57A 3QLUC 2CLIB 2G40A 4MGEA 3RVRA 4QJIA 2SNIE 2PZ8A 2ST1A 2H4XA 1DHRA 1CUSA 2GNAA 2QI9F 1DIOB 3L9WA 3LT1A 4JI8B 4DA7A 4HATA 3ETCA 3KUDA 4RETA 3NKLA 5BYKA 3JQFC 4KYUA 4YP6A 4M8NE 1LQ2A 2H7CA 4LK3A 5EJ6A 1XZMA 4LDQA 3HGQA 2WG1A 2WIJA 3ZBUA 2ATEA 5E3IA 2QM3A 3KPUA 3PC8C 4C43A 1VI5A 2PXCA 1DV2A 4KCGA 4L02A 1WUTA 3D31A 4CN8A 4EM6A 3RRJA 3KKNA 4RU1A 1UYJA 2ZP1A 1D09A 2EBFX 2JFUA 4PBSA 4A8PA 3I1IA 2FWBA 3BMNB 1YVRA 4A8JC 2SKCA 3H8SA 3UWPA 1XCGB 3UT5A 1NN0A 1CJVC 4E2WA 3S27A 1OF1A 1VQ1A 3DEFA 3LDAA 5T4BA 5FUBA 4UEKA 1S4QA 2VZLA 2VATA 2JI9A 3BL5A 5EHNA 1NX6A 4OLJA 4C4SA 1QKIA 2IZZA 2XDAA 4Y2HA 1NU6A 2V6BA 1S2NA 3EWAA 5TQ2A 1P7YA 4BQNA 1Z5ZA 3LL4A 3MJSA 5BRJA 3SJAA 3A32A 1L5HA 2Q3BA 3R9IA 3RR2A 1XLUA 1ZD4A 1D4FA 3PUXA 4NMWA 5GJWC 3FMIA 4RMNA 4Q6BA 5FA6A 1RBYA 1Y5MA 3TSWA 4WERA 1P4GA 2R6AA 1JHXA 2AOUA 4FMPA 4B4WA 3DL7A 4LV8B 1W46A 4J3NA 3RUDA 5MF6A 4DWOA 1ZVVA 4RDCA 4BN0A 4ARUA 2VKTA 2ZBUA 1U7ZA 4PCUA 3HL0A 3H5VA 4Q34A 1B00A 1GGKA 4RMHA 5TRTA 1YH3A 3TTTA 2PBRA 3A05A 1LI7A 1R7RA 2YXPX 5A1TA 4S1TA 3IMGA 1U8FO 1VE7A 1VGVA 3C6MA 3MMSA 3SC2B 2WU3A 2D4HA 3VV3A 2I2CA 4DUGD 2Q1XA 5B1DA 1NXSA 3M2PA 1Z62A 2WJIA 1QYRA 2AFIE 2NXJA 4ZT4A 3O8QB 4HAUA 3EC2A 2CUKA 5JT1A 1XLTA 2CBXA 2WAXA 2D59A 2DFTA 4QO8A 3VXKA 1MVNA 2D0IA 2ZGVA 3RT1A 2JGJA 3V1LA 3ZS8A 1UPBA 3AB3A 1W0KA 4B44A 4CF6A 3I01A 1PR4A 1PV2A 1PJTA 2B21A 4X63A 4KVZA 3R41A 4JT4A 2R1UA 3OQJA 4QGGA 1BQEA 4CJXA 2IE8A 3AKEA 4RTQA 1FFBA 2PZJA 3MBKA 1F9AA 2PCLA 2REQA 2VCEA 3I2YX 3AFHA 1KDRA 2Q5HA 4KI0A 3KDPA 3MQFA 1QVZA 2CFTA 5KQPA 3T1YB 2F17A 4PY2A 2HREA 5GONA 3IO5A 5AJVB 2X7HA 4LJLA 5AHOA 3SK0A 5LB2A 2ZXUA 1YCDA 5GQSA 1BDHA 5IAGA 4OQFA 1ADYA 2QL5A 3A3KA 1M2WA 3H5IA 3IEUA 3O74A 3B78A 3C3BA 5TQ0A 2VUHB 3Q0TA 5TY0A 3UJDA 4DR1B 2YWGA 3P27A 3PFCA 3QVGB 1E5QA 3TLYA 5JAOA 2OFFA 4J03A 1X6VA 1BMQA 1WMSA 2R2AA 3Q15C 5F78A 3RVJA 1ISFA 5B4TA 3GCDA 4OLBA 3BRCA 3ILHA 1EJBA 3ZXYA 2J09A 3P9KA 3TEMA 4OB6A 4IJKA 1DINA 4L6IA 4IGIA 2HPZA 3ZIAA 5K8VA 3I53A 3B1JA 1OJ7A 4D8YA 4DMKA 5LQAA 2CCKA 3I64A 4FLEA 5DN6D 3R5KA 5KTOA 3WKAA 1L7NA 2QPTA 4TRJA 1MQAA 3Q9UA 4BNKA 5BMVA 1AUQA 4OYYA 1GRRA 3M1AA 4MUKA 5L53A 3UUWA 3QIVA 2CB9A 4GIBA