2CVOA

Crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
347
Chain Sequence
KSGEEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVDAVFCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLTEVLRNEIRNARLVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSSVPHTRHVVGSNYCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative Semialdehyde dehydrogenase
publication title Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
pubmed doi rcsb
source organism Oryza sativa
total genus 109
structure length 347
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2cvoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cvoA01
3QRWA 3JYQA 1EQ2A 1ISIA 1Y8RB 2Q1TA 2PA3A 2BLLA 1C0LA 4YVFA 3JQ8A 2GR9A 1IHXA 3GEMA 1O9BA 4RQUA 4NMHA 5TLSA 1ZKMA 1U3UA 5FYDA 5A06A 1EDOA 1LDEA 3ENNA 4J43A 4DYVA 5BSFA 4L74A 4PG5A 5EJ2A 1ARZA 2HUNA 2XAAA 3FNFA 2P68A 1FDUA 1GAEO 2E6UX 2YQ5A 1ULUA 3SXPA 5L3ZA 1QSGA 3K92A 1PEDA 5FF9A 3K6JA 3R1IA 4L4XA 2BMAA 1ENYA 4Y67A 1MLDA 4JCOA 4KUEA 4YXFA 3A06A 4TRMA 1N9GA 1E7YA 1R15A 4BO4A 4CUJA 2ZB3A 2W2LA 3JYLA 2GN4A 2JHGA 4ALNA 3H8VA 4P4GA 4RF3A 3UVEA 1N1GA 1FDTA 3VH3A 2HMSA 4PN3A 1LX6A 1Z74A 5A9RA 4FGWA 4TSKA 3EUWA 4P38A 2QRLA 2Y1EA 4AFNA 4FQ8A 2HKIA 5T5QA 4TROA 1RYEA 4CV0A 7ADHA 3GAZA 2IYPA 1UP4A 5IN4A 1EDZA 1DIGA 3KEQA 3NGXA 4GWKA 2GNAA 3JD2A 1AHHA 3L0DA 4QXMA 4AJOA 4O63O 2B35A 1KEVA 1GV1A 1Z73A 3BMQB 3DAFA 2FPIA 1P45A 2VZ9A 1U2DA 4IUYA 4OQZA 5FWNA 3ZWWA 1D3AA 3AI1A 2G82A 1V3TA 3VKUA 1YVEI 1B16A 3JQ8B 4OJNA 3T7EA 4ITUA 3RBZA 1BDMA 3GAFA 2EHDA 1JW9B 2QZZA 3DBLA 1GYPA 1U8XX 3H2SA 2DTDA 3ONFA 5CHEA 4FJ1A 2HAEA 2FR0A 5EPOA 4Y98A 1NR7A 1VL8A 3H9GA 3RCBA 1BMDA 2V7PA 3S2IA 1SPXA 3CIFA 2AG5A 1E3SA 2PD6A 2PLAA 5IDXA 5EN4A 4UVIA 5FI3A 4J7CA 3D5QA 4MP3A 1AXEA 3GPIA 4K6FA 4BNFA 4OYRA 1UZLA 4DC0A 4C4OA 5C3MA 1QORA 3D4OA 1XA0A 2H9IA 4RVSA 3E5MA 3TFQA 4B3HA 1V3VA 1C0IA 1J6UA 5CFZA 3BHIA 3ITKA 1VSVA 1VJ0A 5A03A 4BMSA 5JE8A 1PL6A 1R0LA 2AEFA 3P2YA 4LRTB 1EFLA 5U9CA 5JAMA 1DIAA 1GZ4A 3Q11A 1PTJA 3DOOA 3V2GA 4CLEA 4YTEA 3ETGA 1VJ1A 2ZTVA 4BQPA 4XIJA 5KJ6A 4IBOA 1TVEA 2Z1NA 3V1YA 3LU1A 4OKNA 4YJFA 1MX3A 1PS9A 2NVUB 1A9YA 3ZV3A 5A5EA 2UVDA 1BXZA 4EW6A 4PLTA 4E31A 4R3WA 3GT0A 1H6BA 3HSKA 4MKXA 1TT7A 2O50A 2ZCUA 2FSVA 2EGHA 2QYSA 4U5QA 2D2IA 1H93A 3KZVA 1ZK0A 3PWKA 2EG9A 1C0KA 3NTQA 1VL6A 2I67A 1PWZA 4A7PA 1U7TA 3GDOA 1ENPA 3ANLA 3AUSA 4NDNE 4QO7A 3WWZA 2HSDA 3FHLA 1T1RA 1K0UA 3FWNA 1MC4A 4U8GA 4ND5A 3G49A 2DPGA 3PDUA 1ONNA 2OOSA 1ADCA 2P9CA 3LDHA 4B4OA 4BO9A 3RJ5A 3WGIA 4LN1A 2RH4A 5COAA 4XQCA 2BELA 1NR1A 1E5LA 4ALKA 2FWMX 3GVPA 3MJSA 1DOHA 1FK8A 3WMWA 5JYAA 4WOJA 2YFQA 3QWBA 3GHHA 4GH5A 2YV3A 3MEQA 4PVCA 4K1LA 1GY8A 4R41A 4LSMA 4GGPA 2EW2A 4CLDA 4R51A 3PHIA 4QO8A 2E37A 2Y0CA 4EJ0A 1A7KA 1YO6A 3H9QA 5A3VA 4E2YA 4CMKA 4CQMD 4P4NA 2Y0DA 4KMSA 1RM3A 5L7YA 3F4LA 2C2XA 4ZHSA 2TMGA 1E6EA 2NTJA 1LJ8A 2Y68A 2PH3A 2VOJA 4YR9A 2ILTA 1A27A 1NQTA 4BO1A 3DZGA 3KSZO 1U1IA 3O4RA 1MG5A 1KBZA 4YJFB 2PNFA 2YHUA 3WOHA 4XX0A 1PS0A 5ENDA 4R1UA 1I2BA 3WQQA 1PL7A 2ZKLA 5HS4A 3EZYA 1ADFA 1H2BA 1EVJA 3ADPA 1ZK3A 1DRUA 1GR0A 1LSOA 1JA9A 3K9QO 2HMVA 3K96A 5F5NA 3DAPA 1GFSA 4HY3A 1BWSA 3LLVA 4WASA 3IJRA 1PGNA 2Q4EA 3ZW9A 3I9NA 1KY4A 2PGLA 4GL4A 1D1SA 5ILGA 3BMCA 2NTNA 1HE5A 1GU7A 2QW8A 1DSSG 1LQUA 1NVMB 3PJEA 5TX7A 5TSDA 3W8DA 4Z9FA 5BNFA 2FSSA 3M1LA 4BNNA 1XHLA 4WLUA 1DFGA 1C14A 2J8ZA 5KIAA 3PQEA 4RJTA 2IZZA 1I36A 4Q3CA 4JX8A 1WZEA 3W6UA 3LYLA 1UJMA 3LVFO 4ZD6A 5KJEA 1C1DB 1MXFA 4KOAA 4IDBA 4FFNA 3HB5X 4I08A 4DVJA 4CMCA 3DBRB 4KP7A 1SZJG 1P77A 5DF1A 1O89A 4BMNA 4F46A 3JYOA 4NHEA 3GDGA 4H3VA 4XR9A 1AHIA 4EITA 1XU7A 3PQDA 5BSHA 3UKOA 3GFBA 1M67A 4FFMA 1GQYA 2Y1DA 5DCWA 4XGKA 3VVBA 4BV9A 4QSMA 3R3JA 1M66A 2AEJA 1P44A 3BYZA 3H3FA 1KERA 3N74A 4J6FA 2IXBA 1NP3A 2EF1A 4BKQA 4DIBA 1E7MA 4XIYA 1IZ9A 1TT5A 3PYMA 3O03A 3IOYA 4CQMB 4CL8A 2OP1A 2ET6A 4BHTA 3PHGA 2H6EA 1U3VA 3GDFA 2CDCA 1U28A 2A35A 5JYFA 3ASUA 3BA1A 4JGBA 3KEOA 4J1NA 4WGGA 1I2CA 3BMCB 4II2A 3LLSA 2UV8A 4WPGA 1FF9A 2YV2A 3RBVA 2O3SA 2GUGA 4RV9A 1FDWA 2C0CA 4BNTA 1YDWA 3FD8A 4RF5A 5I9LA 5KOIA 5G2OA 4BGVA 4NBWA 1GYQA 1GCUA 3NDIA 3RJ9A 1JLLA 4N7RA 2JFHA 2FMUA 4H15A 2Y67A 5IZCC 4Q39A 4YRAA 4MVJP 1CQJA 2Y93A 3AU9A 3R3SA 2X0RA 2AG8A 4NG5A 2EP7A 1YBVA 2D1YA 4FOOA 2PY6A 2BFOA 3INGA 2GPTA 3GHYA 3MJCA 5IZCA 1KYQA 3W8FA 1GV0A 2O4CA 4WOKA 5COBA 4N5NA 3C8MA 2Q1UA 1A7AA 2A92A 5CEEA 1YE3A 3CMMA 1A5ZA 4BKRA 2FR1A 3FSRA 4Y6PA 4YT2A 2D4AA 3JD0A 3TRIA 1PJQA 5KTKA 4WCDA 2NQ8A 4FD3A 3H6KA 5KNLA 1ZNQO 4GMFA 4IGFA 3KSUA 2EWMA 2O3RA 2VT3A 1KS9A 3PLRA 4BO5A 4OOFA 4EJMA 1C1XB 1YKFA 2ZB4A 5DBIA 2CF6A 4CM9D 1XG5A 1E7QA 5G0SA 4NBRA 1XELA 2GF2A 2WSBA 2X1HA 3NAQA 3ZHYA 4R1SA 1PQUA 2WYUA 4B3JA 3K8ZA 5KCZA 4IY1A 3GUYA 4XQ9A 1ZSNA 3FNEA 5G4KA 1TEHA 3D5TA 4MVJM 1MC5A 4BMVA 1IYZA 1EVYA 4FGSA 2EKQA 4PLWA 4CM4A 3H5RA 2R00C 1CIVA 3QP9A 4YAJA 3D0OA 4ALJA 4CLRA 3ON5A 2NU9A 4NJMA 4YJDA 4E4YA 3P19A 5CP8A 3FBTA 1UZMA 1IY8A 3GVCA 3AJRA 3WGQA 3DAGA 3ORFA 4NU5A 4D0SA 1J0XO 2J5RA 2RIRA 3E03A 1GQ2A 4L0QA 3GNQA 3DOCA 2R00A 1VLLA 1UH5A 3D3WA 3LF2A 1DDOA 3U9LA 1XQ6A 3CPSA 4BKOA 4BUCA 4Q3AA 5AXDA 3RROA 1MB4A 4DREA 4E2ZA 3RC2A 1WAMA 4C7KA 4M55A 2PD3A 1EQUA 3HZZA 1PIWA 4JJFA 4NR0A 2B36A 4PLZA 1T2CA 3C1AA 5ENVA 2VHWA 3SEFA 3OECA 1R37A 2NU6A 2OMEA 1DC4A 2HK7A 2P9EA 5I9MA 3GVIA 4RVDA 1HRDA 4UVEA 2FZWA 2RHCA 4GGOA 4CM8B 1CDOA 5TJHA 3ZGYA 1Z82A 3EHEA 3QHAA 4RZHA 1E3LA 3F5QA 3CXRA 3GVHA 3C7AA 5K6AC 4OIMA 1R4NA 3NKLA 3TSCA 1DIBA 1Q7BA 4O0LA 4ZU3A 3UN1A 4I5FA 3O38A 2D0IA 4E5KA 1YBAA 2W2KA 1AGNA 3LC7O 3VPGA 1I30A 4BIIA 5TS3A 3GGGA 3OICA 4PGFA 3GNSA 5JO9A 5K6AA 1PJSA 3E48A 5U1PA 4NFYA 2OXIA 1DJQA 2HLPA 3STHA 4CJXA 4UVDA 1GTMA 4AJIA 3IDSA 4MIYA 5JW6A 2EERA 4CM4B 2E48A 3GH3A 1E0DA 4GMGA 2ZYAA 3Q9UA 1NQ5A 4NJMB 4Q3NA 2PH5A 4GX0A 3HUDA 4NK4A 5KWEA 5EMHA 5THKA 4WLFA 5A1TA 1PZGA 1DPGA 1YGYA 2FRDA 4RLSA 5JAIA 2NU8A 3KOUA 2QQ5A 1B3RA 1J4AA 5DBFA 1BXKA 1ZFNA 3DHYA 1SB8A 1FDSA 1NFQA 2YDYA 4UUPA 4AJHA 2P9GA 4E3ZA 4KZPA 3IP1A 2VNAA 5GZ1A 1VE9A 4IM7A 3EC7A 1UDAA 4YRBA 3T7CA 9LDBA 3BTUA 3NUGA 5BNTA 2HMWA 4E5MA 3NJ4A 3B6ZA 3FI9A 2X9VA 1N92A 1XCBA 1DHTA 4LRSB 3BMNA 5B12A 1UXHA 4R5HA 1IB6A 1SC6A 1B7GO 2LDBA 5DZSA 5H83A 3AWDA 1KY5A 1PGOA 4IJUA 1UXIA 1HE3A 1MUUA 4IS3A 1WMAA 3ANMA 4DPMA 3RUAA 3BMOB 2HJSA 1TB4A 3EZLA 3JYNA 1X15A 3I9JA 2RAFA 1I8TA 1I33A 3HE3A 3IAHA 4O59O 3WB9A 1HZZA 2GN6A 4BNVA 2H63A 1T24A 2ZYGA 2V6FA 4GLLA 3HNPA 3ZWVA 3U3XA 1E7WA 1TLTA 3ZV4A 1A4IA 4ALMA 2CD9A 4WUVA 3VDRA 2DFDA 4M87A 4YT8A 1DIRA 4GSLA 4RVFA 4DIOA 1ZMTA 5JCXA 2EIHA 4L75A 5BSEA 1P31A 4BB5A 1T25A 2WYVA 2WD7A 2OUIA 4K6CA 3WBFA 1E1MA 4JP3A 1NVGA 1LDYA 4KUGA 3O26A 3ROPA 3PGXA 3LZ6A 4YAIA 4XZ3A 4JQCA 2FPGA 2WYWA 5EIOA 3W8EA 1GYRA 1P3DA 5GY7A 3RI3A 4AL4A 2X23A 2AQHA 4RPLA 2A9FA 2D3TA 2O48X 2QX7A 1Y5MA 3N58A 4YACA 1ZUD1 4R3NA 1OBFO 1T2EA 3PJFA 3OM9A 4J1SA 3QA9A 4CMBA 3VH2A 1JKFA 1IE3A 4FSHA 3MZ0A 1HE4A 3AOEC 4KQXA 3EMKA 3VPXA 2O4UX 5GZ6A 5T64A 3RU9A 1LQTA 3GQVA 1XQ1A 3GEDA 3H5NA 3INRA 5IDWA 2P2SA 2I6TA 4ZQEA 5G0TA 3RUDA 4BOYA 3FNHA 4D3FA 4PG7A 4DQUA 5TRTA 3AOEA 3FPLA 3KM0A 5I8ZA 4YJHA 3GNTA 3GF4A 5L4NA 1DLIA 1E3WA 2YHIA 4FPXA 1QYDA 2NSDA 2HDHA 4WJZA 2A94A 3HFSA 4N18A 1P0CA 1HDXA 1GEEA 3WQRA 1SNYA 2UAGA 3D3EA 3VTZA 1ZSYA 3R6DA 3WIEA 2NUAA 1EBUA 2I65A 3WGYA 1YL7A 1XU9A 3WS7A 3DXFA 2CNBA 4A73A 4OH1A 1P1FA 1LC0A 4FOSA 4DLLA 4E12A 3I6QA 4J0FA 2W2LD 1HDZA 3DMYA 3L6EA 4J16A 3JQDA 5B37A 4LGVA 3ZCXA 4IIUA 5JY6A 3TL2A 1PS8A 3CSDA 4HX5A 1F0YA 1EE2A 1VL0A 2WD7B 2HMTA 4M89A 4EUEA 1M76A 3M6IA 4D44A 3DEYX 1VKNA 5A04A 1DRVA 3F6YA 3KLMX 2JAPA 4GVLA 4BVAA 1PJLA 1EK6A 2WDZA 1Y7TA 1Q7GA 2X58A 1AUPA 3Q9NA 2SCUA 4BKUA 3JQ7B 3BTOA 3AK4A 2AXQA 3NDJA 2DFVA 3I4FA 3EVNA 1BVUA 4FJ2A 1LXCA 3JQAD 3QWFA 1PGPA 1O5IA 2IEDA 4R16A 1PJTA 4AJEA 1CEQA 2W8ZA 4XB2A 4NFHA 2DC1A 1YJQA 2GCGA 5L40A 3FCOA 1PU2A 2IRWA 3DZKA 4KUHA 2ZQZA 4M54A 3DFUA 2VWGA 4DRYA 2NV6A 4MIEA 3JCZA 3JQGA 3B1FA 4EUHA 4TVOA 3LC1O 2DLDA 2ZB7A 3EGOA 5JCJA 4F6LA 3GMSA 4YJHB 3KYBA 1QLHA 1E3WB 2YHIB 2CUKA 1JN0A 4ND4A 1G0NA 2JD2A 3RD5A 3CMCO 5FI5A 4CPDA 3ONEA 1YQXA 3A1NA 4BNJA 5T8KC 1PJBA 4L8VA 1FDVA 3JQAA 1HLDA 4Z0HO 4D79A 3MJ4A 4DPLA 1L7EA 4MDHA 5T67A 2HQ1A 1NFRA 1Z6ZA 3L77A 3DR3A 1KVTA 5CPFA 3LK7A 1HKUA 5T8KA 5ER9A 1K2WA 3F47A 5AXBA 5TC4A 4B8ZA 3I3OA 1WDMA 5C7LO 3INTA 1JTVA 5CDGA 1H9BA 3W4KA 1P1IA 3JQ9C 1E7SA 3JQBC 3GOHA 3DDNA 5GMOA 4FFPA 4J1TA 5JS6A 5CEJA 1ID1A 2UYYA 3IL2A 2W90A 4GAEA 2JCVA 4Q9NA 1T2DA 1P1KA 2GZ3A 1Q0QA 3DZIA 3IUSA 1ISFA 3MTGA 3KVOA 4MJLA 3JQ9A 1IOLA 4HFJA 5L53A 2P4QA 4CV2A 3JQBA 1V0JA 4D45A 5DCUA 5U4QA 2IYOA 2OFPA 2VTDA 1JVBA 1W0CA 3V1TC 1N9GB 1EZ4A 5DOZA 4DGSA 3F9IA 1HL3A 1KVQA 1KC1A 2OBNA 4DBVO 1VPDA 1ZVMA 2PK3A 3TWOA 1H6DA 1NBOA 3WICA 5EERA 1ML3A 3H4VA 2LDXA 2NQTA 2HO5A 4WNCA 4IDFA 1WZIA 2G1UA 4OOEA 2ZIZA 3T4EA 3AM4A 2C5EA 1A72A 3PXXA 2CDAA 3S2EA 4YAGA 4NNJA 2BRUA 1UP7A 3F46A 3GRPA 5DCYA 3GUCA 4QQRA 3JQAB 2VHYA 3TZCA 1BXGA 2V6MA 2ZTMA 1X0VA 4NQZA 4E2WA 4EEXA 1PZFA 4WLNA 3AY6A 4IXWA 4YT5A 5HM8A 1NPTO 4I9HA 2C07A 3SVTA 3OMLA 5F1PA 2DBRA 5HTOA 3DBLB 5I9NA 4BGIA 2YFHA 2X5KO 4ONEA 4FN4A 2JFGA 5I7EA 4IDEA 5T6BA 9LDTA 3WIDA 4ZQFA 3ZWOA 1Y81A 3Q2KA 4GPD1 2GN8A 2VCYA 1ENOA 4BKPA 3X2FA 1MP0A 1ZMOA 2E4AA 3LT2A 5EINA 5F1OA 3SBOA 1GZ3A 1U4SA 1C0PA 1KEPA 3IP3A 4FFLA 2O7QA 2ZTLA 2CF5A 1ULSA 2I66A 2DBVO 3PJDA 1EK5A 4E0BA 3OEWA 4UEJA 4QECA 2VQ3A 5KKAA 3SLGA 2JD0A 3QQPA 1KIFA 4NBVA 1WDLA 2AA3A 4OKIA 1ADBA 4YDRA 3RFTA 5C5IA 3RC7A 1J5PA 1NQOA 3ZU2A 3KHUA 3E9QA 2HK9A 4J4TA 4WEQA 4PLVA 4S1VA 4MO2A 3HDJA 1PQPA 1V9LA 3CH6A 5BR7A 4WEOA 1QG6A 4R1TA 1JWAB 4ILKA 3VH1A 5J9GA 1SEVA 4GKBA 4IINA 4E33A 5L95A 3H9UA 4NJOA 5BSGA 4BNUA 1K6JA 4XDZA 2VNSA 2Q2VA 1NXQA 4D0RA 1C3VA 5T57A 3RIHA 3SJ7A 4CUZA 2C82A 5IDQA 3CEAA 1V3UA 3VAZA 3DC2A 1H2HA 1Q1NA 3PI7A 4CUKA 4GX1A 3OEYA 5HRUA 1I3LA 1BXGB 1HDRA 2NVWA 5AQ1A 3CUKA 1BG6A 3GN2A 1P9LA 1OOEA 1WDKA 2Y05A 1KC3A 1KVSA 2EEZA 1WVGA 1B8PA 2DT5A 2OBYA 4HP8A 4IZIA 1O0SA 1BRMA 4IDAA 3QWHA 4J9UE 1A9ZA 3PLNA 4RPHA 4CL3A 5KJFA 4UREA 1CRWG 3GG2A 5ES3A 4P8RA 3OIFA 4YAEA 4K26A 1U5CA 3MWEB 5H82A 1QYVA 2I5PO 3I1JA 4RPJA 4XYGA 2O7SA 4F3YA 1N8KA 4BB6A 2C59A 1LLQA 3MWDB 3NTRA 1T4BA 3TDKA 3AI2A 1U3TA 3F4BA 1XWFA 3LT0A 4R01A 5CEFA 3Q6IA 4XYLA 1JWBB 4NU6A 3PVZA 3FBGA 4YJGA 3UAGA 4GI2A 4YRDA 4CMIA 5FEUA 1ISMA 4FR5A 1ZJZA 2V6GA 4RVGA 1K5HA 2G17A 4RL6A 2CSUA 3TQHA 4CV1A 3WYBA 2X5JO 1I5RA 1DEHA 2VZ8A 4KTTE 5JYEA 4Q3BA 3D4NA 2HCTA 4GWGA 2GZ1A 1OZAA 3AFNA 3NX4A 1CJCA 1N2SA 4EGFA 3WBBA 3RUFA 1SEPA 1GCOA 1VRWA 4Z0TA 4OXKA 4ZQGA 4BGEA 1LBEA 3TOXA 3VZQA 3KBOA 2FHSA 2R6JA 4DWVA 1I3NA 3C1OA 1T1SA 4S3MA 1W8DA 3KO8A 4Q3EA 2Q46A 3HB4X 3RWBA 1PR9A 2NLOA 3HN2A 3QVOA 2X9GA 3W4IA 3AM3A 3MOGA 4BL5A 2EJVA 4CM3A 3U5TA 2AHRA 4TRRA 3PQFA 1UR5A 5KVCA 1UXKA 4I1IA 3ST7A 1HYHA 4E30A 4XKJA 1O94A 4GX5A 3FN4A 4NIMA 4YQYA 4B79A 3QWAA 3Q0EA 2J3HA 4L4RA 5M6DA 1PL8A 2BGMA 2GGSA 2OP0A 2P4HX 4MKRA 3ZV6A 2OORA 1Y1PA 3L6OO 3VHRA 3RC1A 1SB9A 4BNGA 1B14A 4A10A 4HNGA 4I8XA 3PP8A 1MFZA 4BO0A 4PG8A 2DUUA 4E21A 1ZSVA 4XCVA 4IQGA 1RM0A 3RUCA 5DP2A 2X0NA 1HYGA 4G65A 5JMPA 3H7AA 4XWYA 1LSSA 5KJ1A 2Q3EA 4W7HA 3OQBA 2QHXA 1UAYA 1U7HA 2VYNA 1QYXA 2I76A 2Y1CA 5G4LA 4QT0A 4BNWA 2GD1O 1NWCA 4W82A 4IJKA 5F5LA 3H2ZA 3PIDA 2VYVD 1MFPA 1DAOA 4J4BA 4N5MA 2UUPA 3ABIA 1UAGA 5A3JA 4MIOA 4BNKA 4LVCA 2NWQA 1VJTA 4LMPA 3B1JA 4RCVA 5IZ4A 4ZJUA 4XR4A 1NTOA 1LC3A 2EXXA 2PKQP 1HDYA 3WX0A 4CM7A 1RM5A 2PZLA 1TT5B 1YBMA 4GX2A 1DB3A 7MDHA 3K2BA 1SMKA 1UP6A 3G79A 1GUYA 3ZWAA 3NRCA 4BO8A 3KLPX 3LT4A 3O8QA 4URFA 5A5FA 2POQX 2BFMA 3OA0A 2BH9A 2GZ2A 2Q22A 3DQPA 4CQLA 3WMXA 1FJHA 2AEMA 2PKRA 5TJ9A 1NAIA 1R0KA 4CMEA 1RKXA 4JBIA 3RQSA 2VYVA 2Y1FA 4TMFA 4DLBA 4QFDA 4LW8A 5I8WA 4OHUA 4CMJA 4EZBA 3PWZA 3OIGA 3UHAA 3U0BA 3ZHZA 2HRZA 1F8GA 1Y9EA 1G0OA 2NU7A 3GFGA 4N54A 4INAA 1H6CA 1VC2A 4IXTA 3P2OA 3E18A 2BGLA 4CMAA 3VPHA 3IQDB 4OQYA 2OGUA 3WFIA 1QR6A 1WWKA 1LDGA 1QYCA 3WXBA 1R4MA 4NZ9A 4U6QA 3K73O 4FDAA 5HA5A 5L7WA 1LSUA 1ZEJA 3A4VA 3IKTA 3BIOA 4NBTA 3V2HA 1K6XA 1T2FA 2W98A 4XDYA 1B26A 4CV3A 4JIGA 1RM4A 1TXGA 1NHWA 4E32A 4E13A 5G0VA 3E9MA 3EAGA 4IZHA 2IEBA 4TKMA 5H81A 2PZJA 4WCFC 2B4QA 5G0UA 2AQKA 5BQFA 2BFPA 3D1LA 3UCXA 3PYXA 1NPDA 1H6AA 1RYDA 3WQSB 5CDYA 2X5OA 3D64A 4J91A 1F14A 2YDXA 1KVRA 2JJYA 3KYCA 3CINA 4WCFA 4DBZA 4BGUA 1F12A 1LSJA 4RDIA 5L4LA 3UOGA 4HXYA 4NH4A 4TRJA 2Z1MA 1UXGA 1SBYA 3QVSA 3WDSA 3WG9A 2X0IA 3ZWNA 3FR8A 1IPEA 1MA0A 5DOVA 2VRBA 4CQLB 1NM5A 2PZKA 3JD4A 4BNZA 6LDHA 4RVHA 2BI8A 3C24A 4PLPA 4UUMA 3BXXA 4JLWA 3GMDA 4D43A 1DC5A 1R0SA 1UZNA 4EI2A 4AJKA 1IL0A 2OHXA 5G4KB 2FY8A 4AJNA 5GZ3A 2B0JA 2QIOA 3E5RA 1D7OA 4M86A 4WECA 2J5QA 2GN9A 1ZEMA 3GZNA 4PIVA 3DBHA 3OFSA 4JBHA 1U9JA 3TL3A 3WGTA 2WJPA 3U09A 4PRLA 4CLRB 4RGBA 2O23A 5C7OO 1PJCA 2GRAA 2RH8A 3AM5A 1EUZA 4QTZA 4YEDA 5EL0A 4E5YA 3B70A 3WJ7A 2WTBA 2Q45A 1RPNA 2I3GA 1YS4A 3HWRA 1JU9A 4PG6A 3OETA 3D3WB 4LVUA 4D3DA 3CTMA 2OL4A 2FR8A 1OI7A 4Z6KA 3U62A 3MJVA 5IN5A 3LF1A 3NT5A 3T4XA 1DC6A 2O3JA 1I2ZA 4J9VA 5T73A 4CMGA 3MJEA 1I3MA 3OA2A 1SOWA 2D8AA 2FN7A 3KRTA 4CR7A 4TZTA 4UVHA 5HBRA 2AMFA 3DZJA 4DL9A 3KYCB 4WCFB 4PCVA 1FMCA 3OJFA 4CMHA 1EUCA 4EYEA 1BTOA 4BNHA 3ZNPA 3OF2A 4O1MA 1LNQA 1LEHA 3ENKA 3F5SA 3AUTA 3FWZA 3MCVA 5TT0A 3DMTC 4YCAA 2BF7A 2WEKA 3AUUA 1R4NB 3WGZA 4HV4A 4XYEA 5FFFA 4G2NA 4Y8VA 4LCEA 5JC1A 4MVJI 2X9NA 1GZ6A 2W2KB 4YWJA 1NQAO 2WWRA 4A26A 3UW3A 3L07A 3RKUA 2VRCA 3AU8A 4DQXA 1E77A 3DMTA 3S55A 4RF2A 4YB8A 3PFFA 4Y9DA 2GDZA 5JPIA 3ZW8A 2NTVA 2IZ1A 2B37A 4B4WA 1PZHA 1ISGA 4A2CA 3Q1LA 4ALIA 4MVJF 4YPOA 2J3IA 3DBHB 3EW7A 3ZNNA 3SLKA 1JVSA 4F6CA 1MV8A 2B69A 3DBVO 4DQVA 3GEGA 4TVBA 1AE1A 2IE0A 2JAHA 1KETA 4D42A 1HF3A 3JV7A 1TA4A 1BHSA 3WYCA 1Y6JA 4TKLA 5F21A 3VH4A 4LISA 1A71A 3V5NA 3L9XA 3JQCA 3VVCA 2V6BA 2VHZA 4XGIA 1AN9A 4D3SA 1BW9A 2B4RO 4YAKA 2YZ7A 3V2UA 2JFFA 3CZMA 1KVUA 2QRJA 1PX0A 3ROKA 1YH3A 1MG0A 1PJ4A 4MKZA 3PK0A 1DFHA 1HLPA 1LLCA 1Y8RA 2UUOA 3AW9A 2CVZA 2IODA 3C7DB 4II3A 3TN7A 4BO7A 5JXWA 3A9WA 2JD1A 3E82A 5MGBA 2CZCA 4TWRA 4ZICA 3PPIA 1CYDA 2RBEA 2UDPA 3SX2A 2Y0EA 3ITDA 5ILOA 4FCCA 3GR6A 3OJOA 1N7GA 1O8CA 4J4HA 3KETA 1CERA 2O3QA 3BMNB 2OZPA 4FC6A 4OGWA 1GDHA 3KB6A 5HWSA 5A9TA 5IG2A 1E7RA 5AOVA 5DN9A 1MGOA 4D7AA 3BTSA 1Q2XA 2BHLA 1X14A 2JCXA 3ICCA 5KVSA 2F1KA 1LDBA 3QSGA 2RHRA 2GLXA 1W4ZA 1YB1A 4OM8A 2Y1OA 3NGLA 3W1VA 5KVVA 1EFKA 4ROSA 4MOWA 1ZJYA 1Z45A 2R2GA 1PSDA 4FS3A 3G3EA 4BNIA 3QV1A 4U0KA 1LRKA 4CM5A 4J2HA 3VOSA 4NK5A 1QLJA 1D8AA 1IULA 2C7GA 2DUWA 3FRJA 4PLHA 1WXDA 3JTMA 3GY0A 1U3WA 3PWSA 3H9EO 3PIIA 2O2YA 2DPHA 4JJGA 1B15A 1XSEA 2ZJ1A 1O95A 1X1TA 4B4UA 3RVDA 4YQZA 4F45A 3WFJA 2X7HA 3TZ6A 1CETA 2QYTA 4RORA 5JCJD 5AVOA 1EBFA 2P5UA 4XJTA 1D1TA 3DL2A 4WK6A 4YA6A 3BMQA 1J49A 4XEHA 3OQ1A 1DLJA 3ZNQA 1LLDA 4UEKA 3S1LA 4KWHA 2B5WA 3FPCA 1YXMA 1ENZA 4PLFA 5C7IO 3GGOA 1OC2A 1V35A 4BNYA 5L45A 1Z75A 1G1AA 1CWUA 2V65A 3TZKA 3ZV5A 3ETDA 4LK3A 1X7GA 4AICA 2C5AA 3WTBA 5TQVA 3I9OA 2GO1A 3K30A 3G1TA 3ASVA 3NYWA 3WTCA 2VN8A 4G5HA 3QY9A 4J7UA 3ZN2A 1P1RA 1XYGA 3RFXA 4ND2A 1QP8A 1YQDA 3I6IA 2EP5A 2NADA 4AJ1A 3ZWMA 2Y1GA 3NEPX 4RQTA 3QE3A 4DTIA 2VUSA 3I9LA 1ADGA 3WSWA 1ZK1A 2X22A 2WD8A 1DXYA 1HT0A 3JQFC 5EQFA 4A0SA 3OJEA 3QVXA 3I9MA 3ZWPA 5CDUA 4OXNA 1SO8A 3EDMA 4EEZA 3RC9A 4HWKA 3L4BC 2HU2A 3TJRA 4FJ0A 1M2WA 4YT4A 3NJ8A 1P1JA 1M6WA 2EJWA 2VTEA 4RVUA 3RASA 4HBGA 2AE2A 4BQRA 3JQFA 3L4SO 2ZCVA 5KVQA 3DWFA 4ZQHA 4AVYA 3ICPA 3ZWCA 2TMDA 3PRJA 1DO8A 4RPKA 3ZNOA 4IDDA 3L4BA 3X2EA 2CY0A 4UUNA 5K0ZA 2PV7A 3IKVA 1PR3A 2VOEA 8LDHA 2NVUA 3HADA 4JN6B 5TGDA 3VKVA 3QVTA 1HXHA 2Q1SA 2J3KA 3HDYA 3WR5A 4NFSA 3ZWYA 2OO5A 4R4JA 1RWBA 3GRKA 4FB5A 4JBGA 1HE2A 3O9ZA 4R69A 3KUXA 4HFRA 3K2EA 2H5LA 3JQ6A 3OHSX 1N5DA 3CZRA 4RPGA 5DULA 4OMUA 4QEDA 1V6AA 1X0XA 3WGGA 3TPCA 5JDIC 3ROQA 5IJZA 1Z7BA 1OAAA 1BVRA 3E9NA 2CDBA 4J3FA 1VI2A 3VTFA 3DZHA 3JQGB 5CPBA 4QFCA 2ZYDA 2DTEA 5B1YA 3E8XA 1QXSA 4UVGA 4B7XA 5JDIA 3IMFA 2I9PA 3QJ5A 4PRKA 4B8WA 4M49A 2H1SA 3EVTA 2C20A 4NBUA 2CVQA 3GZ4A 3NT2A 1WLYA 4ZN6A 3B1KA 2O3TA 1ISHA 5L9AA 3WSVA 5I7FA 2FOIA 1E6UA 5ICMA 3F3SA 1DIHA 1JAXA 3V8BA 4ESOA 3EYWA 4K28A 1FXSA 4WLEA 2X86A 3WWYA 3DFZA 5TIIA 2ZATA 3A14A 4ZQBA 5CAEA 4KWIA 3H65A 2W4QA 1X7HA 4I5EA 1PJ3A 3DOJA 1BGVA 3ZWBA 4D46A 4XRRA 4PZEA 1HDOA 4DC1A 2IZ0A 2C2YA 3DTYA 4GQAA 1ZCJA 1RJWA 3H3JA 4FW8A 3IJPA 4MVJG 4XJSA 3KV3O 3TFOA 4J90A 3U4HA 2CFCA 1HSOA 3PEFA 3UCFA 3N7UA 3ZHBA 1VKOA 3P7MA 2DBZA 3FNGA 4DLAA 3DO5A 4ND1A 3TF5A 3HFGA 3D4PA 1LRJA 1U2GA 1SCUA 3PZRA 1LDNA 1YDEA 2DKNA 1LA2A 3QW2A 2JL1A 1X13A 5DP1A 4DUPA 3NV9A 1B8UA 3BAZA 1DJNA 4PLYA 2DM6A 1JDJA 1YWGO 3ZZNA 4A27A 2WMDA 3GVXA 3RUIA 5KJCA 4R9SA 1W73A 2O2SA 2JCYA 3P5SA 4ZRMA 2E82A 5L7TA 1CQIA 4Z9YA 3BZUA 1P74A 3Q2IA 1WP4A 3I5MA 4DMMA 1H9AA 1ZZEA 5LCXA 3OH8A 1C1DA 1BSVA 3OQ6A 3QIVA 4Y6RA 4J49A 1I3KA 1UXJA 3DBRA 3SC6A 2YQ4A 4H16A 1OMOA 1O6ZA 3GA0A 3UF0A 1V8BA 1EUDA 3S2FA 3RUEA 1R6DA 2J3JA 3DZBA 3UXYA 1QV6A 1Q0LA 3MJTA 3PZBA 4QUKA 2J5KA 4WLVA 4UUOA 1XKQA 4PLCA 1EVIA 5JNLA 3MTJA 3ANNA 3U49A 1WPQA 2CMDA 2E49A 3JQEA 4EDFA 5MDHA 2D5CA 4JROA 1XDWA 3M2PA 3ZDFA 4KDEA 2Q4BA 1QMGA 3QWIA 2XOXA 3AUAA 3IC5A 5CG1A 4I9NA 2FZEA 3DHNA 4IJWA 4RZIA 1WNTA 2VWHA 1W6UA 3PDJA 4L9RA 3KSDO 5KKCA 1GL3A 4J1QA 5JDCC 1Q7CA 4E5NA 5JY1A 3OJ0A 5JAZA 4NPCA 4CQMA 4BS9A 4IPTA 1L1FA 4IDGA 4HFMA 1LUAA 1ZO8A 1Y9AA 3OBBA 4AJJA 2WE8A 5AYVA 4CLXA 4XQGA 2VZ0A 1P33A 3LQFA 4W7IA 5JDCA 1BDBA 1ORRA 3AI3A 4J0EA 3VZPA 4J2OA 4OAQA 1IZ0A 4BNXA 4ZGWA 4XYBA 5B4VA 3HHPA 4GBJA 1I0ZA 4CR8A 3PYLA 3LSYA 1AXGA 1UDCA 3COSA 1B0AA 4JK3A 1H5QA 3M1AA 2PZMA 5AXAA 1PJ2A 1ZK2A 4UULA 3WGOA 4PZDA 4P22A 5JMWA 3HJAA 5LDGA 1EMDA 1U4OA 4KTVE 2CVOA 1R12A 1WMBA 3GLQA 3PTZA 4HNHA 4I9UA 4DXHA 1LRLA 4Q3DA 1LDMA 3GN1A 5DBGA 3PJGA 4DA9A 2C7VA 1YONA 4ZVVA 3VPSA 1ZW1A 1E6WA 4AG3A 2QZ9A 1YOVA 3PHHA 5I7SA 3C85A 2D5AA 1DFIA 4MPDA 3KXDA 3TNLA 1XEAA 1GUFA 3G0OA 3ZU3A 5IF3A 2PGDA 4XD2A 2PR2A 1MXHA 2Z95A 4M8SA 5ER6A 4MP8A 2VYND 3Q3CA 3A28A 2G76A 4OSOA 3GPDG 4FIZA 3OSUA 5F3RA 2EKLA 1Q0HA 4EBFA 1ZBQA 4KDFA 3WGHA 3U4CA 1QKIA 4LSWA 3V1UA 3D7LA 3ZWXA 1E5QA 2YJZA 1C1XA 5B4TA 5HS6A 3VDQA 1ZXLA 3DTTA 4E2XA 4XRGA 2F00A 4JP2A 3PFWO 4YJGB 1OFGA 5ITWA 1I10A 2Y66A 4CMIB 1EE9A 4I5GA 5K9ZA 3WNQA 1I01A 2GSDA 3BTVA 4OL9A 4N5LA 3U4IA 3I23A 1ZH8A 1NVTA 3C1TA 4R9RA 1F06A 3WNVA 4WNIA 1UUFA 1XLTA 2D59A 3ZHXA 3PGJA 1H0KA 1OC4A 1QYWA 4B7UA 4CLHA 4IIVA 4MVJH 2VT2A 1L7DA 5JYDA 4BO3A 4TZKA 4XYMA 3ROMA 5DNAA 4K9DA 3F1LA 4FFOA 3UICA 4PG4A 2C54A 4XGNA 4BO2A 4XA8A 1IHYA 4BNLA 3HDHA 4Z3KA 4JNKA 3GK3A 1R16A 2PGJA 1GADO 3HDQA 2DQ4A 1HZJA 3HN7A 3WJAA 4IJVA 1HSZA 3FTPA 4FFRA 4B4VA 4RLHA 1YOVB 1GD1O 3QVWA 4WKGA 4CMEC 3HQ4O 3I4CA 3NTOA 5J23A 1NPYA 1KEUA 4J7XA 3ZU4A 1NNUA 1KEWA 3VPFA 3TZQA 1E1LA 4LCJA 4A5OA 4DMLA 2Q2WA 4OSPA 3E1KA 2NVBA 4IMRA 4PVDA 2B83A 2VUUA 3H9JA 3I9KA 3KTDA 2GASA 4AJ4A 8ADHA 4YYZA 3ZU5A 2X4GA 1U5AA 2EW8A 2ZTUA 3I52A 3OIDA 5JAQA 2B5VA 2DVMA 2HRBA 3LT1A 5THQA 4CM8A 4Z3DA 5CG2A 2B4TO 1E1KA 3FTNA 4U0JA 4Z9XA 2JKVA 5EQDA 4L4SA 3RFVA 4HFNA 1CF2O 5IAAA 1YQGA 3AOGA 2Z5LA 4R54A 4OO3A 4RO0A 3I83A 1E3IA 1WW8A 4W99A 4DYDA 1Z7EA 3UH1A 3L6DA 3WLEA 4QX6A 2ZB8A 3ETEA 2ZQYA 6ADHA 4IQ8A 3EK2A 4CR6A 3AFMA 5A9SA 2ZK7A 4AJPA 2DBQA 2BI7A 1X1EA 1LLUA 3ZH2A 3RUHA 4YBZA 2DU8A 3FF4A 4JJIA 5TF4A 1P0FA 2YYYA 4WLOA 4BNMA 2PD4A 2A4KA 4CM9A 4OXYA 3JYPA 2G0TA 3KYDA 1HDCA 4ND3A 3K5PA 2I99A 1R66A 5IXYA 4H7PA 4B7CA 2BD0A 2IXAA 4TQGA 3S8MA 5L4SA 4HUJA 5ITVA 1DRWA 3SC4A 2QRKA 3W6ZA 3O8QB 5ICSA 4EUFA 1Y5RA 3S2GA 5AXCA 1T4DA 2GYYA 5IXSA 2Q49A 2P91A 2JHFA 1ZIDA 4ZRNA 1YB5A 4O5OA 2NM0A 4DIFA 1E3EA 2XPCA 4CM6A 4Y6SA 4PZCA 4GSKA 3VZRA 1K89A 1VSUA 4L76A 1T2AA 4M1QA 5A05A 3ONDA 4MVJE 4A03A 1NASA 1NHGA 2DTXA 3GG9A 3IIEA 4UAGA 1NFFA 4XQEA 2Q2QA 4R1NA 1NAHA 1ONPA 4AJ2A 1M6HA 1R4MB 5JSFA 1D4FA 4R5MA 3G17A 4GLOA 2DAPA 2XXJA 4RDHA 2VHVA 4IMPA 2VHXA 2Q1WA 3TOZA 5IDYA 4FBGA 1F17A 3BMOA 1T26A 4W4TA 1K6IA 3NT4A 2ZJ0A 3UCEA 1DC3A 4WE3A 5A9SB 3W4JA 1P1HA 3ULKA 2VRCD 3MOIA 1EEHA 2P5YA 4IS2A 4LMRA 4E6PA 2YW9A 5ADHA 4MINA 3F1KA 1HETA 1IUKA 1S7CA 2HMUA 1NWHA 4FC7A 1GPDG 1E1NA 1HEUA 3ADOA 3KYDB 5B4UA 1LI4A 2EGGA 3EY4A 3VC7A 1Y8QA 3ZI0A 1SAYA 2G5CA 2Y99A 1HTBA 3WYEA 3R0IA 4PLGA 2VUTA 2EKPA 1PGQA 1ZXBA 2QG4A 5L51A 1NX6A 3RU7A 1PZEA 5JO0A 4CM1A 1HWYA 4D41A 1U8FO 2XXBA 4RF4A 2NNLD 1UDBA 1DBVO 4GVXA 4AJLA 3U4DA 1DAPA 3DB2A 1K3TA 1YB4A 2YV1A 3HG7A 3B20A 2FP4A 1QV7A 5LDHA 3CKYA 2AW5A 4IGEA 5JBIA 1XIVA 3JSAA 4PFJA 5A4DA 3UGKA 1PQWA 1YJ8A 3VZSA 5JC8A 5IFLA 2EV9A 5CDSA 5BNIA 4BV8A 4IDCA 2YUTA 5TNXA 3GZNB 3FR7A 4X54A 4E5PA 3GGPA 5COQA 3JD3A 4DPKA 4O6VA 2WM3A 2PWZA 1B3BA 2GERA 2X6TA 3PHJA 4L73A 4Z0PA 3BHJA 2PFGA 2PKQO 3AY3A 5LC1A 1EVZA 1F8FA 1GUZA 1PGJA 3C3XA 5JLAA 4ID9A 1PWXA 1G6KA 4NI5A 1SOVA 4UEOA 3RBXA 2VWQA 2VWPA 3TZHA 2BKAA 4TRNA 1YL6A 2HJRA 2HK8A 1H94A 2BFAA 3NDRA 4CLOA 3JD1A 3DHEA 3SJUA 4B3IA 1JKJA 1B8VA 3UUWA 3CE6A 2I3AA 3H5AA 1JQBA 4C7JA 2C29D 2AQIA 1GEGA 3C7CB 3WLFA 1QRRA 1Y8QB 4P4LA 1YL5A 2Q50A 1IPFA 3M2TA 1N7HA 4I5DA 1E3JA 4IQ0A 3QLJA 5CDTA 1HYEA 4U6SA 3L9WA 4EJ6A 1DHRA 5F1KA 3UFXA 1JKIA 1NYTA 3K31A 1GPJA 2BGKA 3BHMA 5EESA 4U7WA 2AE1A 4G81A 3RSHA 4HADA 3JQ7A 4CODB 5JFOA 4HKTA 4ZA2A 1VM6A 1LU9A 3AY7A 1X7DA 2J6IA 2WE7A 2Q99A 3E6AA 1LTHR 1HDGO 1XGKA 1E92A 5A02A 1N1EA 4GKVA 1XR3A 1GQQA 3RAJA 4MVJD 5DT9A 4MP6A 4ALLA 3OJLA 5G0WA 1M75A 4W9NC 2O3UA 2NACA 1YRLA 2RCYA 2AQ8A 1A4UA 5TT1A 4W6ZA 2XF8A 5I7VA 1ISJA 3IUPA 1I32A 1TI7A 1KOLA 3GC6A 2PTGA 3PHLA 1JAYA 2FPPA 2YY7A 4W9NA 5BT9A 1S6YA 1I24A 5C37A 1ZK4A 2X8LA 3DONA 4KQWA 1B2LA 3G1UA 3IS3A 4JXKA 2IDZA 4BO6A 4R68A 1BW9B 1ONOA 5DDIP 3DZFA 2X0JA 4CLOB 3OP4A 3RKRA 4XB1A 3LC2O 4MVJA
chains in the Genus database with same CATH superfamily
3JYQA 3VGJA 1ISIA 1A8HA 3VOTA 4RZUA 4BXOB 1Z08A 2CNNA 4RFSA 1C0LA 3G02A 4BC1A 2M9MA 4RQUA 2W5UA 4MULA 4TM8A 3N2GA 5H7XA 2Q6IA 5TLSA 4JLBA 1JJ7A 1FIUA 1ZKMA 1RE1A 2XQJA 4EF5A 1H22A 1KHHA 1NSTA 3HJHA 1LDEA 2RKWA 3NHKA 4X91A 2ODQA 5EJ2A 1VMDA 5EE0A 2GVDC 2YNMD 2YS6A 1QHSA 2LWIA 3IEUA 5BN5A 2XAAA 4ZZ2A 1A97A 4O2BF 3IO3A 3T3EA 4UM9B 4D98A 3I01A 3GBVA 3ID6C 4DCGA 5KOHA 5KTRA 3H05A 3GLSA 5K2OA 3SXPA 1GPNA 4TQ9A 3L2OB 4W8HA 5EKTA 3V2IA 3AUXA 3SMVA 4ZOEA 1PEDA 1Y6GA 5FF9A 4XPIA 1ESNA 1FTSA 2IVZA 1V8DA 1JAHA 4C4ZA 1Q12A 5BQ3A 2JGRA 2WF6A 3C6YA 4L4XA 2BMAA 1SCNE 1TZCA 4WZAA 4Y67A 1MLDA 2HX1A 5GV8A 4TRMA 3G23A 5E4YA 1R15A 1N36B 3BREA 2QD3A 2ZB3A 1HFKA 4CIWA 4F1JA 1U8AA 1QCYA 2WIKA 4YQFA 2RGRA 4KR2A 3Q87B 2GN4A 3WAKA 4ALNA 5FWAA 4P4GA 621PA 1N5KA 2NXCA 1FQWA 3ILVA 2B92A 4NJEA 5HF9A 4F3RA 1L8LA 3GUUA 1TTHA 4RIEA 3HKBA 4OHFA 3HI6A 1EPUA 1BX1A 4B3TB 1MMFB 1T0HB 2WAXA 4KBGA 4MAMA 2DF8A 5G1NA 3WYGA 5F4ZA 4PF1A 4FQ8A 4PC2A 4AK9A 1P0PA 4CF4A 5CB4B 2HKIA 5T5QA 2IV2X 2BIFA 4TYNA 5IN4A 1OX4A 1E6CA 1NMSA 2ADFA 2JATA 3AQIA 1PZNA 3KEQA 4GWKA 5FD8A 3TRKA 3WZ2A 4CG3A 5LJIA 4ZI5A 4O63O 1U1CA 3HNRA 1KEVA 1CUEA 4WT7A 5FPPA 3HXMA 4AN0A 5B6IA 1P45A 1E9EA 1NMXA 5BQ5A 2X2FA 3WWDA 1G63A 1RACA 1V3TA 2VNKA 4CEJA 2RK6A 4G07A 4RFSB 4C4RA 1YVEI 2OHVA 1E2BA 3DM9B 3ZVNA 1V96A 4OB6A 1UZAA 1YDHA 5D1NA 3RDPA 4M9UA 3T95A 1DNPA 1BDMA 2EHDA 3DBLA 4EJSB 4OGFA 3V4OA 1AMOA 1PFVA 2ERCA 1GYPA 2XNCA 4Y2YA 1ZD3A 2R65A 1SA0A 1JDZA 5H1YA 5BN5B 4QU8A 3PFNA 3ZLJA 5DJ5A 1U9IC 2PL9A 4OGKA 3RCBA 2F9MA 5KTSA 2H2DA 1C2TA 3FTDA 1FFYA 1WXQA 3P27A 5FT9A 4AF7A 3AINA 3GT4A 5FI3A 4UVIA 1Z28A 1Q11A 2WNIA 3OVMA 4JI4B 3MUEA 1AXEA 4K6FA 4BNFA 3ISVA 3TD6A 4E70A 4OYRA 3C43A 2J3EA 3FPAA 1NW3A 1ISSA 2JAOA 3S3TA 4N4AA 4C4OA 5C3MA 2OV3A 2H18A 2H9IA 3SR3A 5FBKA 4RVSA 4TWJA 2H7CA 2BMFA 1B0PA 1I94B 4LNUA 2R8OA 2UZ0A 3PU6A 1V3VA 1C0IA 5TPWA 3ITKA 1VSVA 1VJ0A 2A0KA 3CH5A 1BDHA 4BMSA 1R0LA 2AEFA 4GGMX 4NJEB 1GZSA 4JDPA 5JAMA 1PTJA 3V2GA 4KR7A 3DOOA 5BT8A 3R0QA 1U7OA 4TTPA 3RSLA 1VYHA 1Y1TA 3AEUA 3WRYC 3PD0A 1QGZA 4NCHA 1TVEA 2GLUA 2Z1NA 4GI5A 2P7HA 3LX8A 3ZV3A 3BEOA 4G8DA 4LWPA 2J3MA 1SU7A 4ZEMA 3H1TA 4ZVKA 1OX4B 2UVDA 3LUKA 1BXZA 5A2QA 5G40A 4PLTA 4R3WA 1FMLA 4RJIA 4ZI7F 2B0CA 3UJCA 1QGUA 2GAJA 1I14A 1BJKA 2C9BA 1GAQA 3I30X 2QN1A 5LQJA 4PN7A 1L7NA 4CEJB 3TNDA 4PNPA 2D2IA 4ML3A 4WK0B 1WXGA 3WNDA 2IPMA 3KZVA 2ASVA 1A1VA 3PWKA 4PCAA 4YO8A 1CZLA 1PEKE 1TTPB 5FPKA 2NNWB 4MWBA 1VL6A 2P65A 2I67A 3FDIA 3VPCA 4YMVA 3BXHA 2Q8PA 1YJXA 3GDOA 3LY7A 3VTAA 2EOAA 3AUSA 3P9QA 4I66A 4NDNE 3ZDYB 5GVSA 3FHLA 1F5NA 1I4TD 2A8YA 2NUPA 1K0UA 1S2GA 1YC2A 2E87A 3SMQA 3AUYA 2NAFA 5EQTA 4D4GA 1ADCA 2QENA 3WGIA 3ZI4A 3KEFA 2XKAA 1MC1A 2JGEA 1SC3A 1E5LA 4IDHA 3ABOB 4ALKA 4DA7A 1FK8A 2VDUE 3JWPA 2GZMA 1JEJA 2QMYA 4LWQA 2YV3A 3AIMA 1BEUB 3GA7A 4X71A 3MEQA 5DHQA 3P0HA 2O2DA 2VF2A 4GNRA 2QPOA 2IHTA 5DTJA 3N2YA 4WJKB 1SZDA 4PX3A 3UMRA 3WO0A 4QO8A 3OKFA 3CF0A 1A7KA 1YO6A 5DE3A 2DHCA 3MJHA 4MWDA 4BFCA 4LNUB 2CBZA 2Y0DA 5TPWB 2FZ4A 5L7YA 3MG9A 5BOSA 5LQRA 1J99A 2NTJA 1LJ8A 3G5MA 3O94A 4FOTA 3L0SA 2PH3A 2VOJA 2N9UA 4AIRA 4XVCA 4YR9A 1XXHB 3OKPA 3RSQA 5EJ8A 1NQTA 4MIKA 3IAFA 3AEUB 3KKKA 4BO1A 1U1IA 3PC2A 3BRSA 4Q7QA 4F2GA 3O4RA 4AG6A 1C9KA 3GLGE 3WHKA 4BLQA 1XKLA 5CGQB 1Y0BA 1K08A 2R25B 4DA0A 4QJIA 4RHYA 1J1IA 5C51B 1SM4A 1M2HA 5ENDA 1IHUA 3WQQA 5CA0B 2ZKLA 3T7DA 1J22A 2C3OA 1WKBA 2O5VA 1H2BA 4KW7A 1QGUB 1AOXA 4LGMA 2TMYA 1JPJA 1SCJA 1QB7A 3FA2A 3LUBA 4Z8XA 4ECAA 2H5EA 3N6VA 4U39A 5FL7D 1N3IA 3F7MA 1IXSB 4DLTA 1C4XA 3K9QO 3K96A 3LH5A 4QDZA 1QIDA 3CZ9A 3EOZA 3GJTA 3LDGA 4KXQA 1BWSA 2BE7A 1XA4A 4NCJA 3O4VA 4QFMA 4FOLA 5FO0A 3KVYA 2VNIA 1H9CA 1NW7A 4IXMA 2KPOA 4R2MA 2PGLA 3O9MA 3HA5A 4GL4A 1D1SA 2AN5A 3BMCA 3UT0A 2NTNA 3OCVA 2CD7A 3ZTYA 4BC0A 1C5KA 4DNFA 1NW9B 2Z0MA 3AJ9A 3IIMA 1OZFA 1O0BA 1A04A 2CUTA 2CMGA 3SYRA 3BCRA 1I13A 1KFCB 4Z9FA 1TJYA 5BNFA 1N5IA 3RARA 4MJXA 4PAWA 4BGDA 1DDGA 2DQKA 5KX5F 1SUDA 4WLUA 4TMWA 5IKXA 1S8AA 2W2VA 5GM2A 1NQVA 4N0MA 4IZ6A 1Z0AA 3VOAA 5HYVA 3AJ8A 3MW8A 1WX1A 1NW5A 1QCDA 3PQ7A 4YS6A 4CCSA 1SKQA 1Z0IA 3KJQA 1ZDMA 1NU6A 3LYLA 1EQAA 3OFNA 3DVRX 1RAGA 2CLHB 2PWBA 3VZBA 4QM6A 3DZ2B 3DBRB 1SZJG 3HI4A 3QLEA 4IOJA 2I80A 4MYUA 4XLTA 2OWEA 3GDGA 2VG8A 1ULAA 1ZUWA 4PM4A 3O4IA 1SWWA 2ZDGA 2EKZA 4CT4B 4OUDA 2IH2A 3RYHA 4ZZ1A 5GWXA 2Y1DA 2G63A 5DCWA 2JA1A 4BV9A 3D0KA 4QSMA 5EIHA 3CUYA 3KR2A 3OWHA 2HL6A 2WKWA 3KTOA 1TCCA 1N77A 2OM2A 2HHCA 4GOKA 4IVRA 1BEEA 4IKOA 1K68A 3VDXA 2Q4RA 1BVYF 2XX3A 2XYPA 1KERA 2ZW9A 3DFFA 5I5EA 1HNWB 1JYSA 1C41A 3C48A 2HY7A 5ESXA 1UBRS 1W94A 1HQCA 2EF1A 4K0RA 3EZXA 3RV3A 4BKQA 3C70A 4YXWD 4RTQA 4E5VA 1DQYA 3CKKA 1L7MA 1SHJA 3W1WA 1C80A 1E79A 3DDOA 4C4PA 2XYRA 3S0JA 4CL8A 4PYKA 4YECA 1FYXA 4ETWA 1Z68A 2G80A 4V24A 4OCZA 1U28A 4O8JA 2A35A 3ASUA 4JLNA 2A9PA 4J1NA 5CTJA 1ABBA 5LBIA 4ENUA 3BMCB 3V34A 3PUIA 1PEYA 3LLSA 5L3SA 4LQDA 1MHTA 1ADJA 4RV9A 5F35A 1VZ3A 2FWBA 4Z99A 3MWFA 2C0CA 3ADCA 4OB7A 1YDWA 1QS0A 2A30A 4Q24A 1P91A 3TYXA 3NLLA 1UBJS 1CLUA 1QH1A 1L5LA 4ZTBA 5KDDA 1C8BA 4M98A 1M74A 3U9TA 2NO6A 1UDXA 4NBWA 1F2UA 5JATA 1CJMA 4GKAA 3R7WA 1G8HA 1JLLA 1IN4A 3T9FA 1AMUA 4NCAA 2BGTA 2WJAA 4WACA 2F3QA 3LCRA 4BVJA 1WIWA 2Q6TA 2QYOA 4H4DA 2X3YA 3LTEA 1J06A 2G83A 2N75A 3KQSA 3NASA 4NG5A 4A8PA 4CTKA 5GIPE 4FOOA 3NRJA 3KTAB 4FKMA 4N3BA 4HQLA 5AJUA 2Z1DA 2GPTA 1CRLA 1J9GA 4YV2A 1JR3A 3N8KA 3SDZA 1KYQA 3BBLA 3I8XA 5IVIA 3SBXA 4O4LB 3UMVA 4DLYA 2CK3A 1DQSA 1RIFA 1TKBA 2DUNA 3C39A 3COVA 2F3RA 3FY4A 3RYHB 4NEGA 3HRKA 4EX6A 1VYUA 3C8MA 1L1QA 1QBGA 3T1OA 2Q1UA 1U7XA 1P4GA 5EJFA 5AVWA 1PTKA 1E9CA 1YE3A 3ETNA 4OQNA 4BKRA 5E1OA 3FOBA 5M3BA 1M1NA 2FR1A 3G5LA 5ALUA 3RG8A 4Y6PA 4BIMA 4EHAA 1GPWB 2D1QA 3JD0A 3QXJA 4QD3A 4CNQA 3TIIA 4OY3A 3H6KA 4RK1A 2XZOA 4XWTA 3EJWA 2GN0A 3QNUA 5GJVC 4A16A 1R6VA 2G1AA 1MW8X 1ETHA 1YFZA 4IGFA 2YXLA 1NJGA 2VT3A 2XD9A 3ZW7A 2GM9A 1FRVA 2IHYA 1DBRA 2GCPA 2YMMA 4RZ3A 4BO5A 1VCIA 1YKFA 1WSBA 2GS9A 3W7AA 4QLOA 5DBIA 2CF6A 3EIWA 1P6QA 3MTBA 4CM9D 3A0RB 1M34A 1XG5A 2LIVA 3HV0A 3A9RA 5LQNA 1J07A 2OGSA 5G0SA 1SXQA 4NBRA 13PKA 4MA5A 2UUBB 4QPJC 2X1HA 1FTQA 3CRNA 4XJVA 4B3CA 4CLQA 3K0KA 2P2NA 3SYTA 5KCZA 4L0DA 5LKAA 3GUYA 4XQ9A 4EKDA 2IEAA 2F4VB 2PZBA 2EDCA 4QQKA 1ESCA 4EB8A 2AKAB 1ZSNA 3FNEA 1TEHA 1CY4A 1SBNE 1WQ4A 1SXJA 1Z83A 3M8KA 4JOQA 1RPJA 4M2LA 4OQQA 2CLFB 4Q3OA 4BMVA 5J4YA 3KHSA 3R7WB 1IYZA 5E9QA 2IW1A 2H59A 3HP4A 1EJBA 3CVOA 4PLWA 5KHOC 2YWEA 3ZU6A 3EFHA 4A1OA 2L18A 3H5RA 1MEJA 1EU1A 4DLRA 2Q0XA 4ALJA 4UCXA 4B76A 4G97A 1SXHA 3WXMA 1K7XB 4IR7A 1FP1D 3GVCA 1KK1A 2V9PA 1XC7A 4FIDA 1CUFA 4EFMA 2J5RA 5ICEA 1J5EB 3C6MA 5F78A 5TF0A 2H00A 1VLLA 4EA6A 1EWVA 3U9LA 1NN3A 4BUCA 2ZI6A 1AG9A 5CW1A 3ILSA 4KH1A 3T3MB 2JHCA 1M0TA 5JPDA 4Q3AA 1T0BA 4H1VA 5ECYA 2RAPA 2X7JA 3EQZA 1AH2A 1Z4QA 4M0FA 1R50A 4EQZA 3CEHA 1DX9A 1Z5NA 2O5EA 3K2QA 4EH1A 1NNI1 3A1VA 2B36A 4H0NA 3VNAA 2HIAA 4UOEA 2AN9A 1KMNA 2XZDA 2VHWA 3G0CA 5I9IA 2QTLA 1AUOA 1OASA 1TCAA 1XROA 1R37A 5K3DA 2FRXA 2JPDA 4ZYUA 2OMEA 1DC4A 2P9EA 3F7OA 3TEFA 4RVDA 5HZKA 4CRWB 1YR8A 3IERA 2JEZA 1VLJA 1SBCA 1RWVA 2ACKA 1D2HA 2RHCA 3G2IA 3P4YA 2GYWA 4GGOA 5TJHA 2EHJA 1YS9A 1M34B 1Z82A 3O92A 1XX6A 4RZHA 1GUBA 4CL0A 3GVHA 5BQOA 3C7AA 1FSGA 2I3ZA 1R4NA 3ILYA 3NKLA 4FMDF 3TSCA 3NI2A 4O0LA 2WJ3A 2FMFA 2QUZA 1B2RA 1ZINA 2COEA 2QD4A 1QMIA 1QIMA 4QU5A 4B0PA 1AQNA 4YMTA 1L5ZA 1X86B 2D2EA 5E1BA 2Q5CA 3VPGA 1U11A 5JHGB 1G5HA 2MINA 2W6ID 5TS3A 3GGGA 2IS1A 2QPAA 3DOIA 3ZDEA 1GO2A 1QVVA 5DWDA 5U1PA 4C0KA 1QP0A 5CLHA 4NFYA 3TRJA 1TDJA 3BPSA 4OJYA 2JLVA 1DJQA 4DCVA 2C2GA 4QSHA 2HLPA 4LS3A 3STHA 5B7GA 4R7GA 4AJIA 5I4IA 5JFTA 5JW6A 1L8AA 1BU8A 1TVKA 2EERA 3LA6A 5DYTA 4UQLA 1JLRA 1Q57A 3IOMA 3L41A 1E0DA 4GMGA 4PFKA 4AXBA 5FRDA 4YRCA 3CONA 3UAOA 1BD4A 4NK4A 3CIOA 5EMHA 4N49A 5G1OA 5THKA 4WLFA 3DMNA 4ZOQI 1YGYA 3G0HA 3ODGA 2NU8A 1IM2A 3B6MA 3ZVLA 3KOUA 4U7PB 2ACWA 1SQ5A 2QM8A 1QUFA 3OF5A 4QUDA 4NBKA 1R6XA 1YDFA 4PXAA 1H8HD 4KQKA 5CD1A 3IJ5A 3OTGA 4U7DA 5IVDA 3OFJA 1N0VC 1Q1BA 2YDYA 2P9GA 3IT0A 3R7SA 3QBJA 1CUAA 4L5YA 4YIKA 4KZPA 1DOAA 4IM7A 3ERCA 4RPIA 4YUVA 3C3JA 3NEYA 2Q6LA 1LQ2A 5E7IA 3BS4A 1FSZA 3A04A 4KPGA 1HDIA 3FLEA 2A78A 5BNTA 1UIRA 5J4VA 3H04A 1QNLA 2Z8YA 4OQ4A 4PSCA 3VVMA 3B6ZA 1SKMA 2XCUA 1XCBA 2G8NA 4AY2A 4MW1A 1FNCA 3BMNA 5BQPA 3S1SA 1WU7A 5HKOA 4BJ1A 3CNBA 2WTNA 4I9FA 1FFDA 4MQLA 1S1MA 1SC6A 1WUJS 4UW9A 1K7CA 1CQXA 3S2SA 2IF0A 5DZSA 4BAGA 4DC9A 4ZQCB 3AWDA 3TZLA 2ZBGA 4Q21A 1MUUA 3CZPA 1V6CA 1KTIA 4DV5B 4YV0A 3ANMA 4DPMA 3D0QA 4LY0A 4BFLA 3DO6A 3KZOA 2ZWAA 4B34A 5HHTA 3AZQA 3BMOB 2EX4A 4HX9A 2YZ2A 1X15A 1YB6A 5BN4B 3AIOA 1I33A 1XOIA 3ENVA 3KP1A 4NTZA 3WB9A 2HLDA 2GN6A 2GYUA 4JC4A 1RI5A 4BNVA 3FGOA 4AZTA 4GLLA 3HNPA 1DAHA 3DEFA 1N1MA 3GJZA 5ARDA 1TVKB 1FUEA 3H1GA 4DSUA 3ZE9A 1OGJA 3E3LA 2QD5A 2OQIA 4M83A 4MYCA 4WUVA 2CXUA 2Y1KA 4BZQA 5HFAA 2P75A 4M87A 3C87A 1MJ5A 1E4EB 2BGUA 3FJ1A 4YT8A 4JYMA 4NDAA 1FX0B 4RVFA 1XJWA 5JCXA 1HV8A 2EIHA 4L75A 2R7KA 5BSEA 3VJMA 4BFYA 3JTEA 3LQKA 2JHPA 1BQ3A 2WD7A 3A9UA 5HPYB 3DV0B 4K6CA 1JQAA 1XRQA 3OFVA 3PGXA 5JRDS 1IHPA 2M32A 2WYWA 1E2FA 1JIXA 1JP7A 1UK9A 2XD4A 3OO0A 5C80A 1F4VA 2YJGA 3FLMA 3W8EA 1GYRA 1P3DA 1Y1RA 4KO8A 4MS3A 5KSPA 4AL4A 4EMSA 4F5YA 4EHFA 1ZA1A 2R4TA 4D0LB 1V45E 3N58A 1Q1ZA 3GMTA 4TSRA 4LMBA 1IXKA 2WSIA 5FI1B 3OM9A 4XJXA 4FSDA 4HEA6 3F0TA 3W3AA 4JSRA 3VH2A 5HUQA 1JKFA 1QDEA 4RS4A 4MCHA 4MUFA 4B82A 3TTWA 5EXSA 1RC0A 3D3KA 4OGGA 1QIIA 3A6GA 2DKOA 3HB7A 3VQTA 2G0AA 4CIXA 4URWR 3QKWA 2O4UX 3LUPA 4MUJA 2ZE7A 5T64A 3RU9A 5LOVA 1ZL0A 1LQTA 1QFYA 3E7WA 3KJIA 1XQ1A 3INRA 5DX0A 2HQBA 2P2SA 1U7WA 4J0GA 1XZIA 4EDHA 2W22A 2C1EA 2ZSEA 4F60A 3QOFA 1ZD5A 4IJ6A 4ZXFA 2R1TA 1SKYE 3AHHA 3O3OB 1XZQA 5AW9A 3KGDA 4D57A 5DGTA 1K88A 4TMXA 4F9GA 3S5UA 3HFSA 1QQTA 1KIAA 4WZ6A 4N18A 4IFIA 1QE5A 5ALHA 4BLTA 4YAFA 3D3EA 1OBHA 3OTQA 1Z7YA 1TKAA 2Q1XA 3OT5A 4IV5A 3TBHA 1OIWA 4Q9IA 1EBUA 2I65A 3WGYA 3JATB 4BRSA 1FFWA 1UEXC 1F8XA 2XEXA 3QPBA 3DXFA 1UPUA 1HY3A 2AC2A 1P1FA 2Y1WA 3MBIA 4FOSA 4TS9A 3ZE2B 4E12A 5K45A 3SLRA 1KJQA 4J0FA 1HDZA 2JLCA 4YCBA 4EHJA 3L6EA 3W5UA 5B37A 1WVIA 1EDDA 4IIUA 3R8CA 4R1MA 4DZRA 3FE2A 4KODA 4YBRA 3REFA 4HX5A 1F0YA 4DW8A 2WD7B 1GRRA 2HK6A 3NHSA 4JHXA 3FUTA 5FPYA 4M89A 3M6IA 1Y7PA 1AX9A 1QQ5A 1KAMA 2SECE 1ZS9A 1KY2A 1CIJA 3IQZA 4OD0A 5T4EA 3R6TA 4BVAA 1PJLA 1EK6A 2H3EA 2WDZA 4CIDA 1Y7TA 2X58A 3IR5A 3FJYA 3Q9NA 4TTJA 3JQ7B 4BKUA 2JZNA 3AK4A 1W9HA 4MEAA 5JS8A 4BU0A 2OTCA 2AXQA 3NDJA 1MJNA 1ZM3A 3I4FA 4P53A 1RXVA 1PGPA 1DRJA 5K0FA 3TGLA 4FYHA 1CEQA 4NFHA 4XVHA 1YJQA 2XYVA 4X97A 1PU2A 4LSZA 1PR0A 4ZO8A 5LOVB 1XF1A 3HB0A 3KQNA 1ECJA 2FWPA 2IOQA 4J0DA 5IMSA 2NV6A 3AERA 3C74A 2ZRGA 4BLRA 5B2EA 5CFRA 4EUHA 2GEUA 2NV2B 5ALQA 3AJEA 1A82A 1QFXA 2R1TB 1GGEA 3EGOA 2HPHA 1A2OA 3DQZA 3BBPA 2QIPA 2QX9A 2CUKA 2Z04A 4RY8A 1EE1A 4R7ZA 5TQ0A 3RD5A 2MSCB 3DZ4B 5D6NA 1M7BA 1CUCA 3ONEA 4CPDA 1YQXA 1G7CA 2PYZA 3A1NA 4JUBA 4O8CA 1GZUA 1Y34E 2BL4A 3E53A 4M1TA 4BNJA 4HDRA 2AMLA 1PN3A 1VSQA 4L8VA 1GCAA 5ES3A 4EY7A 1JQJC 2GOYA 4CCWA 3B9PA 3JQAA 2EARA 1OFUX 3KKMA 4PPNA 4RNCA 3RAGA 3QHPA 4DJFC 5AW2A 2GRJA 2R1VB 3MJ4A 4R84A 3TW6A 4CCYB 1POXA 1NFRA 3NOXA 3DZ8A 3R8XA 5C9ZA 3F47A 3IDFA 3V80A 4L78A 2E89A 3LQQA 3AL0C 1Q3TA 1YJBA 3OTWA 2DLNA 3NONA 4QTTB 1J1ZA 1KZ1A 1JTVA 3KPWA 4BFWA 4FS8A 2R0QC 2TS1A 1P1IA 3JQ9C 4JX9A 3EZ2A 3UYLA 4DMUB 2G4CA 3ELDA 2RGWA 1KK3A 3GOHA 4LOHA 2E7ZA 2RD2A 1MNQA 3QOXA 2BF4A 2W90A 4GAEA 5IM5A 2YICA 1T2DA 4Q9NA 3U1BA 5GADl 2P3LA 3DZIA 2GZ3A 3EP6B 1Q95A 3IUSA 3PPWA 4MJLA 1WCWA 2D3WA 2WK1A 3CF2A 4WXPA 3ZV7A 4WKCA 1IVYA 1HH4A 1V0JA 5L53A 1IY2A 2C2ZA 4OX9Y 3PUYA 5U4QA 2B5OA 1J8MF 2C04A 3BCHA 2VTDA 1ORIA 4UBOA 4NV1A 5C1IA 4DGSA 1ZD8A 2E4ZA 4OQLA 1KC1A 3AL3A 4K3UA 3DUFA 4OI1A 4Z8YA 2WTMA 4GL2A 4DBVO 1ZVMA 1D8TA 3TWOA 4EATA 1NBOA 1P9OA 3ES9A 3ZS9A 2WTEA 3PXBA 3AERB 3ELWA 4QELA 2HO5A 5A2GA 4LCBA 5HF5A 1CB7A 5L8VA 1JKXA 5JUWA 4LYDA 3ZDDA 1V2HE 1I3CA 4H35A 4ZREA 5ALJA 2P8JA 4MWEA 4V2IA 2BCJQ 3HBFA 1JEQA 3PXXA 2IHKA 2J67A 4KL8S 1O9GA 2DJ5A 4NYMQ 1JEYA 2XGGA 1K4KA 1V7PC 4HDRB 4UDYX 5ENZA 4JP1A 3MJDA 3OQJA 3NH6A 3GUCA 4QQRA 1RR6A 3JQAB 1Y9JA 3PUJA 3HK2A 3WKBA 2CFIA 4QUEA 4Z4FA 2RH9B 1XQXA 2XNDD 3O93A 3O8DA 2WFLA 1T3LA 4RJLA 3S29A 1K3FA 2ZTMA 1AKTA 4AUMA 4YV7A 1VP3A 3COWA 2QN7A 1PZFA 4Z7JA 4EVSA 3MGCA 2R86A 3R9XB 2NXEA 3SVTA 4I9HA 2C07A 1J2UA 1W49A 3OMLA 1WF3A 4WIAA 4PRYA 5F1PA 2V0GA 3EXG1 2DWUA 5HTOA 1A98A 3BWVA 4MQ4A 3PXGA 5I7RA 1H1DA 1VG1A 3NEAA 1IXYA 1D7AA 2DFLA 3DE6X 5LP1A 3LI2A 2P0YA 4BPBA 1BWQA 5I9NA 2FJUA 4GM0A 2ZT5A 2YFHA 2P3SA 1EWYA 1Z8FA 2JGDA 4DKXA 3EOAI 4I8IA 4Q15A 5KWJA 4OA8A 5ITZB 2I7VA 1W35A 3EJ6A 4IDEA 5T6BA 5I7EA 3DAHA 3T6KA 1M7HA 3O1HB 5A4JA 1XMOB 2GN8A 2ZZNA 3MWDA 4ZC1A 4BKPA 3G8CA 4AYXA 1UJCA 3VO1A 1P9WA 1VZ2A 4BLOA 1MP0A 4Y1RB 4DCUA 2E4AA 2G4LA 3LT2A 3GLFB 4MUYA 3IP3A 1SVNA 5IYZA 2ZTLA 5GVRA 1ULSA 4ITVA 2DBVO 3PJDA 4NF2A 1ELOA 4G3XA 4XGQA 3VXKA 4QECA 1PBTA 1JJIA 1XV5A 2N1MA 1KIFA 4NBVA 4JV5B 4I4TB 1SKAA 3AB8A 1DXHA 5LWHA 3IVMA 4BE7B 3BQNB 3FYDA 5FNZA 4GE0A 5EEHA 3WKEA 3BH7A 2OCAA 2L82A 3GJRA 1HO3A 4O4LF 1SVUA 1TYDE 1XYVA 2GZHA 5AKGA 1DEOA 4HNVA 4CIYA 2VXBA 3CE9A 2B7LA 2HQRA 1PQPA 1XMSA 3MCWA 3CH6A 4I55A 4OQDA 4X6YA 5BR7A 4F9TA 2IU6A 4LOKA 3R3YA 2C77A 3D5EA 1T5DX 4H6WA 1TJNA 4MI3A 5DBOA 5L95A 3H9UA 2ZTHA 4EECA 2FOLA 1JEQB 1CQPA 1K6JA 5AJZA 3GP5A 2Q2VA 3W0LB 5IT4A 3ROTA 4D0RA 1JEYB 2FG6C 4FGLA 3SJ7A 3A4TA 1L4UA 4G0YA 1GTL1 4R2KA 5KQMA 3VAZA 1ZHHA 4JI3B 1Q1NA 1A4XA 3PI7A 4MUEA 3D3NA 5DU2A 3OEYA 5DHAA 3X43A 4D6YA 3PSHA 3IBFA 4V1CB 5DNEA 3F3KA 1HDRA 2NVWA 3UO8B 1AKEA 1P9LA 3OFND 4U9HS 2ZUCA 3B2QA 4Z7NB 4BQQA 3UJ3X 2HWKA 1YB2A 2CCJA 1UOQA 4KAFA 5DLDA 2XMCA 4C3OB 1O0SA 3AQ4A 3FUCA 2VL7A 3CJTA 1AQ6A 4IDAA 1RVDA 2FK8A 4WUTA 1TE2A 3NYIA 4E6EA 4DG5A 1PVDA 1RXYA 2G6BA 3BDAA 3WOVA 2B4YA 3OWOA 1M2NA 2JGDB 2I5PO 5H82A 4ARAA 3I1JA 2IOHA 4KFUA 1YRAA 1ZQ1A 1C4KA 2GN1A 2JF0A 3HL4A 2JDIA 4BB6A 3CB4A 4F6RA 1EFRD 1OKKD 1V3QE 1MH1A 4ZZ3A 3MWDB 2R48A 3NTRA 2XMDA 5AQEA 4HGRA 1EK0A 4R01A 3PNQA 1YFLA 1JWBB 2ROQA 3B5EA 3PVZA 2IS6A 3UMJA 1ZKDA 4HL6A 2WKSA 2R6ZA 4YRDA 5HUHA 4L57A 3JVUA 1OZGA 3PGMA 5IYZB 2JFNA 5K8CA 4IUBS 5EZYB 4OSEA 2WHYA 4PHCA 4RV5A 3OCZA 3V7FA 4C05A 1ZGAA 2V55B 1E79D 1QVAA 2V6GA 1X7YA 1AQUA 3HKCB 3PGLA 3RGGA 5IAEA 1DAMA 1RTKA 3STTA 1ANKA 1OLXB 5LBUA 3TQHA 4Y2HA 3U3DA 2F43A 2AOTA 3O1IC 2VPXA 1TM5E 3M6XA 2GBLA 2YWFA 4BTEA 3WK9A 4KTTE 1QTIA 1X77A 4I55B 3U3JA 4U2BA 2GZ1A 1OZAA 2VJNA 2YJ3A 5DRYA 3U48A 3ETCA 1NKTA 4EGFA 1I72B 3B6IA 5HK8A 1SEPA 1WU8A 3K8OE 2Z56A 4B44A 1KFKB 1LPNA 1CZOA 2CMKA 3HBJA 4BGEA 1E6MA 1R9MA 3TOXA 3DJFA 1V39A 3HMQA 3URKA 3VZQA 4F04A 1E99A 1QRTA 1Y3CE 2R6JA 4QOJA 4FCTA 2CKDA 4RJ2A 4ARSA 3RADC 1EVQA 4BVKA 1JUDA 2YY6A 2Y27A 1PRYA 4U9UA 2F8LA 3GLIE 5IMBA 1HG1A 3VPAA 3RWBA 3F8TA 2W37A 3OD1A 4MGYR 5JZOA 2ECFA 1O94C 1FSPA 4XFDA 3LP6A 2ANCA 2QTMA 3ITNA 4ZODA 3U5TA 2X6QA 1E94E 1N2BA 3WQHA 1ZGBA 2GZRA 1MDFA 4HATA 4P80A 5FYQA 1UXKA 4AZ0A 1JDVA 5DGIA 2W2XA 5AOCA 4WINA 1XXLA 3GFTA 4WZBB 1XPRA 3WLNA 4IIGA 4NIMA 5C3UA 4A6EA 3QWAA 4U7TB 2CK3D 4B79A 2J3HA 4ZARA 1UBCA 3CG4A 3I1YA 4IGKA 5JROA 2OP0A 2P4HX 2JI7A 4G24A 1L5RA 3HA2A 4NWIA 1E96A 3L6OO 3LVBA 3VHRA 3PE3A 3WB0A 3RC1A 1SB9A 1CPYA 2Q5QA 3GJ6A 3D1VA 4BNGA 3ZGXA 5IT0A 1T1IA 4IL5A 1QX4A 1U2PA 2ZIUB 3H18A 4BO0A 4LTMA 1A0OA 2XWBF 5FA8A 1JSXA 5J2UF 4L3OA 4EPYA 1RM0A 1YRHA 1L3IA 5FQOA 4B46A 3A6PC 1HYGA 1FUYB 2XVZA 3ASYA 3TDMA 3OQBA 2QHXA 3W5HA 2AOTB 3TUIC 1JDUA 2QNIA 2I76A 3FLAA 4O4JA 3T9DA 3V8VA 4DQLA 2QUHA 2A5LA 3GFQA 4W82A 1COZA 4IJKA 5F5LA 1E4OA 1MA3A 2WF7A 3H2ZA 1N0WA 2CGEA 2VYVD 1N6PA 1P0MA 1ISRA 2ZJAA 3A6EA 5FTJA 5KQRA 5B1IA 1DAOA 4RDCA 1N78A 2H4JA 2HWXA 1Z6PA 4KVAA 5A3JA 5I7OA 1OIVA 2JJ2A 2NWQA 2WP0A 1ACLA 3AR2A 4P7JA 4MEJA 4ZCPA 1SOUA 1L4GA 1D6NA 2WF5A 4HK4A 4RCVA 1SQ0A 5BUCA 3CRW1 4G84A 4XR4A 5TPZA 3L1UA 4GPIB 3IHKA 3QHQA 3AKZA 3WX0A 4CM7A 2JFOA 1RM5A 2PZLA 4ZVQA 1TT5B 1XB2A 3K2BA 2Z83A 1SMKA 2ZYUX 2R8PA 1JMKC 1Z6AA 3A31A 4LTDA 1ZD9A 2REBA 3G79A 4WL0A 5F9MA 5GOZA 2PS3A 3B8EA 3MUFA 4QWMA 4D3XA 1M83A 1USUA 3NRCA 1XZFA 4KCGA 4I3GA 3KLPX 4P7BA 2FEOA 2A1IA 5ITSA 5KNDA 1YZGA 1FMJA 2AIRA 2POQX 4Q1FA 5KYXA 2FX5A 3ROZA 4KR6A 1UOPA 2BH9A 1G8AA 3GJ7A 4CQLA 5AD1A 3WMXA 3BD6A 1F5SA 2R97A 2VCEA 4YYEA 3OX1A 1R0KA 2ZIGA 5CIQA 1RKXA 1KSGA 4JBIA 2QTWB 3DT6A 3RQSA 4C0JA 1DT5A 1D0IA 5JADA 5L6LB 3IAAA 4DLBA 3GH1A 1WMEA 2QGNA 2NN3C 4HVAA 3L84A 3IOCA 4NE7A 3PWZA 1XA3A 1T8SA 4OHUA 4RA9A 2HRZA 4NYJR 2Q41A 2WUFA 3LCMA 3VU9A 2DSNA 3VDMA 1PZMA 3GFGA 5HZHA 3BXZA 3SHWA 4EOGA 1V4NA 3P2OA 2W43A 3BKXA 3M5PA 1KH3A 1U0SY 5D2CA 1WSWA 4X8HA 1PV1A 1QR6A 1WWKA 3I9FA 1CDDA 3EGXB 3WXBA 3SE7A 1R4MA 2SKEA 3I76A 3K73O 3H1BA 2XGJA 3R4CA 3V1LA 3TLAA 3OC0A 1WB9A 3KJFA 4ZU6X 3A9SA 1RABA 1JTEA 2W98A 1JH8A 2Y0BA 3QOYA 4XDYA 1QO9A 2J7PA 2V0NA 3CNHA 4JIGA 3C41J 4K81B 3C3DA 4MWOA 1UC9A 2A1TR 1X1CA 3EZ9A 4O4JB 1RI1A 2QOEA 3WSTA 5BW4A 5LYJA 1RM4A 1TXGA 1NHWA 1Q17A 3B6JA 3OPVA 1CY2A 2GBGA 4NE9A 3E9MA 4MWZA 5BW8A 4ER5A 1MAAA 3E22A 1BH6A 1ZR4A 2GSWA 2VRNA 1QHIA 3COZA 3JZMA 3ZD6A 4H3SA 4P5DA 4YMHA 4MQMA 1WB6A 3UT5A 5AJWA 5KI6A 2AQKA 5CCEA 2X5NA 5IAOA 3RC3A 3IJEB 3D1LA 2OXCA 1G19A 1NPDA 5CA1B 5CDYA 4TT8A 3D64A 1YFKA 4J91A 4DUGA 2NO9A 1ZH4A 2X14A 5EMJA 1E1QD 4BGUA 1NM5C 4RDIA 5CYOA 1JQ3A 3GELA 3K05A 4G01B 4HXYA 4AS2A 1GOTA 3AHEA 1DARA 3DLAA 5JWHA 4URZR 1G4UR 2QN3A 4A82A 2H2FA 3WG9A 2AD5A 3FR8A 5F12A 3T12A 2Q3BA 1ZMXA 2VRBA 3RJTA 1Z2NX 1UJ5A 3IT2A 4CQLB 3I5XA 4BNZA 4UNIA 6LDHA 2BI8A 2W8BB 4QDUA 4X64B 3ZOZA 4GFDA 2EATA 2XJ4A 3UV6A 1D2GA 1DC5A 5HF6A 4AJKA 1IL0A 1UWCA 1AU9A 2OHXA 5G4KB 5TB5A 3WQBA 1MAHA 2C3YA 1JBEA 2B0JA 2P9YA 4G63A 4MARA 1D7OA 3UGQA 4RIHA 4BVBA 2W2QA 1THMA 3T41A 2PSFA 4N7BA 4HDSA 3RT9A 4I1PA 4PIVA 1R9NA 5JMTA 3DBHA 5KMGA 1VIVA 4AP6A 1DJPA 1F60A 2CL0X 1XE3A 4I9GA 1LPBB 3KLNA 1G41A 1H3EA 3V7WA 1MENA 1XNJA 2AK3A 3B70A 4PTYA 3WJ7A 4QBIA 1E5XA 4GXQA 1NUAA 1S02A 3NWJA 2W2PA 5I7HA 1RPNA 3UJNA 3FCEA 3HXTA 2B7BA 3BWYA 2I1LA 5ALEA 2FDRA 1FLVA 4DGQA 5HZGA 3F49S 3TIGA 5LYJB 5K3AA 3DOEA 2NO4A 3PFCA 5AW6A 3JASA 3T4XA 3NT5A 3E22B 2J41A 2WPDA 3T5DA 1Z63A 1R74A 4XOIA 4POOA 2JZCA 2FPSA 3AH8A 3UT5B 4CMGA 3MJEA 1LBTA 2QYHA 3PD7A 5BV8A 1JI3A 2CV0A 1PR4A 5AM5A 5HQ3A 2ODBA 3DZ7B 2D8AA 2FN7A 4P3PA 4ZO4A 2WI8A 2Q0SA 4XM0A 5EI5A 5IJ9A 1OH8A 2EGUA 3IWDB 3HXQA 3WL6A 3E0XA 3U4MA 1EHYA 5LXTB 2JGNA 2HU5A 1EUCA 3OJFA 1M1YB 2BM1A 3BFXA 5LQDA 2PZEA 1N2CA 1AGRA 1N0UA 2RONA 4BYMA 4QNMA 5C1OA 2Q9CA 3EA5A 2LCFA 2IHJA 1QHGA 3AUTA 5TT0A 1YR3A 1NYRA 5HIIA 2AXNA 3HB1A 4RH0A 1GNQA 1Q1EA 3NM4A 1B41A 1LCIA 3WGZA 4XYEA 3VSEA 2GK3A 5INTA 2ECQA 3OJXA 4LEIA 4Y8VA 3CNNA 2X2PA 3E81A 3HLYA 5FAKA 1GZ6A 2W2KB 1K97A 1NQAO 3N0WA 4J0QA 3BVPA 4IZOA 5HG0A 2JBAA 2VRCA 3L18A 3NAMA 4FYIA 3DMTA 4MLCA 3RKUA 1YTUA 3S55A 1RZRA 3MXOA 1HQKA 4L8LA 3LYUA 4C2BA 1YMQA 2H4ZA 3BL6A 3R0ZA 2NTVA 1PUIA 3CS3A 5JPIA 5BWCA 5HW0A 4QVIA 1KXJA 1J1UA 1JSLA 3E2MA 3WLKX 3K32A 4HDSB 5KMGB 2ZAOA 3DBHB 3EW7A 2NPFA 2AI3A 4MPPA 1JVSA 4D5EA 3F90A 3O75A 1MV8A 2XGOA 2P27A 1D03A 2H1HA 1YHZA 3PC8A 2FYTA 1DXQA 2P35A 2QRMA 1BHSA 1ZC4A 5JWOA 4CTMA 1EZZA 3VH4A 3U16A 1KP9A 3L9XA 3L0ZA 1G6Q1 2OCXA 3SVZA 2VHZA 4XGIA 1QTNA 2G1JA 2OKCA 3BZWA 3LMKA 2B4RO 4CI0B 1BCSB 4DBLE 5EAIA 3V2UA 2WWTA 2XB2A 4IRXA 1ICEA 3JASB 1KVUA