2CVOA

Crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
348
structure length
347
Chain Sequence
b'KSGEEVRIAVLGASGYTGAEIVRLLANHPQFRIKVMTADRKAGEQFGSVFPHLITQDLPNLVAVKDADFSNVDAVFCLPHGTTQEIIKGLPQELKIVDLSADFRLRDINEYAEWYGHSHRAPELQQEAVYGLTEVLRNEIRNARLVANPGCYPTSIQLPLVPLIKAKLIKVSNIIIDAKSGVSGAGRGAKEANLYTEIAEGIHAYGIKGHRHVPEIEQGLSEAAESKVTISFTPNLICMKRGMQSTMFVEMAPGVTANDLYQHLKSTYEGEEFVKLLNGSSVPHTRHVVGSNYCFMNVFEDRIPGRAIIISVIDNLVKGASGQAVQNLNLMMGLPENTGLQYQPLFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Semialdehyde dehydrogenase
publication title Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
pubmed doi rcsb
source organism Oryza sativa
molecule tags Oxidoreductase
total genus 109
structure length 347
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2005-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2cvoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cvoA01
1NWHA 3OJFA 4WOJA 1ISGA 1PQWA 2CF6A 1TLTA 3QSGA 2H1SA 4J1NA 4TRJA 3ULKA 5KJFA 1L7DA 4LRTB 1JVSA 2HMUA 2CVQA 1A27A 2BH9A 2G5CA 1LDGA 4CM7A 3ROMA 1WXDA 1N7HA 1V9LA 4FC7A 3KYDA 4I08A 3JCZA 4E5MA 3IKVA 5IDWA 1VL0A 4HADA 3RUDA 4URFA 3QE3A 2IE0A 1E7YA 3ZGYA 3H9UA 3GN1A 3AUTA 4A73A 5ENDA 4DBVO 3FTNA 3ZW8A 5B12A 5B4UA 5IZ4A 5EMHA 3FI9A 3G3EA 1UXHA 3GZNB 4Z3KA 1EMDA 4JGBA 1HF3A 3QWIA 5AVOA 1I36A 1N2SA 3DMYA 3DB2A 4J0FA 3MOGA 1N5DA 4UUOA 2NVUA 5EQDA 4KP7A 3PEFA 1I01A 4RF3A 2QX7A 4MIEA 5BR7A 1I30A 2X6TA 3CZRA 4GLLA 2FMUA 3FF4A 2WSBA 2Y0CA 4IM7A 3ZV3A 4GH5A 5BT9A 4WE3A 3PDUA 4XGKA 1GPJA 3TL3A 5EPOA 2C20A 3FD8A 4JNKA 4BO6A 3GNSA 3T4XA 1HWYA 5CDTA 1PQUA 2BD0A 1IL0A 6ADHA 1EUCA 5T5QA 2ZQZA 2RH4A 2PGJA 5TGDA 1RM4A 5KJ6A 5CG2A 1UR5A 1DAPA 3WBBA 4O5OA 3TJRA 3ZU4A 2JD0A 2J8ZA 1GTMA 3VVBA 3U4HA 4AICA 4MVJF 3IJPA 4PGFA 4TVOA 5TX7A 3M1LA 1PR3A 1TT7A 4BNVA 1R37A 4CQMB 2NU9A 4YVFA 2ZTUA 3OHSX 1EUZA 4E2ZA 1F8GA 4WLVA 1R0SA 3JYQA 4OYRA 1H9AA 3V5NA 3AY3A 2TMGA 1CETA 2C07A 4L9RA 4J7XA 3DAPA 3DAFA 3GMSA 2WE8A 5K6AA 1ISFA 1S7CA 2CSUA 3IDSA 2O3RA 3HN7A 3PHJA 3H3FA 1EQ2A 2O4CA 5ER9A 3IQDB 1Z45A 3D1LA 4W9NA 2ZKLA 4N7RA 2GPTA 2JKVA 1T4DA 4WEOA 3DWFA 3I9KA 3F5SA 2OXIA 2NACA 5BNFA 4Y6PA 2V6BA 3AM3A 3GY0A 4XWYA 3SVTA 1H6DA 2CFCA 3P7MA 1JQBA 2BI7A 5H82A 5T6BA 3GVXA 3TZHA 2UUPA 1R0KA 2GASA 3HFGA 2P91A 3OM9A 3VOSA 3RUIA 2Q1SA 1MUUA 2PGDA 5IDXA 3KTDA 4BO9A 2G0TA 4RZIA 2D3TA 4BIIA 1JKFA 3EVTA 1DLJA 3EC7A 3HE3A 1R12A 4FCCA 1YKFA 4NBVA 1BTOA 1GEGA 4FS3A 2RH8A 1JWBB 4ZN6A 4FSHA 4CM6A 3JQGA 2HAEA 5L53A 1VJTA 4BO1A 4RQUA 3F47A 4OJNA 1GV0A 2I66A 1T4BA 1IE3A 4MO2A 4AJNA 2EEZA 2IYOA 2HMWA 1GZ6A 2UVDA 3DEYX 2DTEA 4XR4A 4JQCA 1GR0A 4YJHA 1BHSA 2OGUA 1U2DA 4GMFA 2BFPA 3WGYA 3U4DA 5G2OA 1CWUA 3PYXA 4CL8A 2BFAA 4B4VA 5C7OO 2PZKA 1L7EA 5ITWA 1KC3A 3UOGA 4Z9XA 2O4UX 2VYVA 4BNTA 1Y8RB 1UAGA 4IXTA 4OQYA 3G79A 3VHRA 3OMLA 1I3KA 3GNTA 1PS0A 1VSUA 3B6ZA 4EUHA 3HDJA 3IP1A 4CMAA 2W2KA 1PGNA 2AQKA 2Z95A 4WCDA 3K73O 3NGXA 1RYDA 2FWMX 2VWPA 1YO6A 1DC5A 2BMAA 4NBUA 1P0FA 4EEXA 3KHUA 1C1DB 3UGKA 4J2OA 3UKOA 1UP6A 4ZQGA 2J3JA 3V1UA 3VTZA 3VPSA 3U49A 3OF2A 1S6YA 3RASA 2W8ZA 3S1LA 3RVDA 2PD4A 4U0JA 3TSCA 4YYZA 5TT0A 1O0SA 3AU9A 2VCYA 5HM8A 2OO5A 4OMUA 3K96A 4QQRA 3OJLA 2CUKA 1K3TA 4IBOA 4OXYA 4S3MA 4RPKA 1HRDA 2I76A 5T8KA 4OAQA 4CQMD 3LDHA 1UXIA 3FBGA 4ZGWA 3S2FA 1RM3A 1Z7BA 1D7OA 2VHYA 2ZB4A 2J3IA 3GR6A 3OQBA 1VJ0A 1PL7A 3NTOA 3AK4A 3I4FA 3D3WA 5JY1A 3TZ6A 5KVQA 1IULA 1LXCA 1UZNA 4RLSA 1MFZA 1UDCA 3PHIA 2NQTA 5TT1A 1I33A 2YDXA 2FPPA 3FNEA 4TROA 4K9DA 1UH5A 3Q2KA 2GLXA 3GAFA 3LZ6A 3ZWPA 5G0TA 1NQTA 4GVXA 1HETA 3U4IA 1XU9A 1U4SA 1F0YA 4ALLA 3WDSA 5A5EA 1K89A 3RUAA 1Y9AA 3GZ4A 1Q7GA 3HDHA 1R66A 1N8KA 3H2ZA 3HDYA 1PGOA 1DBVO 3QVOA 4OKNA 1CF2O 1EDOA 3PGJA 5IXSA 2PKQO 4E5PA 3ZN2A 2HSDA 1YVEI 4CUZA 1LLCA 5JDCA 3ZWAA 2G82A 2BFMA 5GZ3A 3QWAA 1PJQA 1XQ6A 5BSGA 4I5GA 1NBOA 2VZ9A 4HX5A 3GUYA 4K6CA 4CM9A 2V6GA 1FMCA 4AVYA 1B3RA 2X1HA 2X58A 3U0BA 1KBZA 2NNLD 3CMCO 1YXMA 3H9GA 5KWEA 2A9FA 3D0OA 1MGOA 4L74A 4GBJA 4XYBA 4E2XA 4BGVA 4B4UA 1LNQA 4AJLA 1EBUA 3C7DB 4BV8A 1B8PA 4DYDA 1TEHA 2Z1NA 2NU8A 4BKUA 2E6UX 3CKYA 4U6SA 4I5FA 4P4GA 1Z6ZA 2ZIZA 1NP3A 4YT4A 2F00A 3UW3A 3A1NA 3DHNA 2PD3A 1IY8A 4NMHA 1LDEA 4A03A 2YHUA 4K26A 5EESA 2VHVA 4ND5A 1VKNA 3NT5A 2GGSA 5EIOA 4CM8B 3I9NA 1HXHA 1LRKA 1DO8A 3NDJA 4EYEA 4D3SA 3MJSA 3GN2A 1PGPA 2DUWA 2J3HA 4R3NA 2YDYA 2UAGA 3ZHBA 4XEHA 3GRPA 3FNHA 4ZQHA 3AM5A 2Q1WA 2ZYDA 4PZCA 2AA3A 1WMBA 4Z0TA 4ZQBA 1HDGO 3GC6A 5EL0A 4UVGA 3JQ9A 4DLLA 4XRGA 1BW9B 1AHIA 5B4VA 3A06A 3AFNA 4J43A 4JP2A 5ILGA 3CSDA 2CMDA 5JPIA 1U3WA 2QRLA 5BSFA 4A0SA 3GGGA 4IQ0A 2XOXA 4H15A 4XQCA 1HYGA 5F5LA 4GL4A 1AGNA 1LDBA 1BDBA 1SPXA 2E37A 4OGWA 5G4KB 4KUEA 1ENYA 1TT5A 3EZLA 3S2GA 3JSAA 3DXFA 4FQ8A 3KUXA 2OOSA 3H8VA 2HK8A 2Y1OA 1MXFA 1PTJA 1HSOA 3HHPA 3R3JA 3WG9A 1ULUA 5FI3A 1B0AA 1R15A 3NYWA 4L4RA 2EKPA 3JQ6A 1HEUA 4HNGA 1FJHA 4PZDA 3NX4A 1L1FA 1DB3A 4EGFA 3ZU5A 2B4TO 1ZK0A 2YJZA 4BMNA 2YFQA 4YAGA 1YBVA 1V35A 3ANMA 4PG6A 3KB6A 1PEDA 3RKUA 2O50A 4Q3NA 4E13A 4E30A 4O59O 4IMRA 4Y8VA 4K6FA 1Z73A 3QVSA 4MVJA 4OSOA 5A04A 4RQTA 4W82A 4YWJA 1OBFO 3AY6A 1QXSA 3Q6IA 1YDEA 3WMXA 3WJ7A 4CMCA 3DBVO 4PLFA 4RLHA 4IJKA 2EF1A 1NVMB 2B4RO 4KDEA 3TPCA 1LUAA 4I8XA 4NIMA 2EGHA 5AXAA 4NDNE 3W8FA 2JFFA 1HZJA 1R4MB 1DSSG 1HYHA 4R16A 1U8XX 4DC1A 2VZ8A 1WLYA 3M2TA 3UCXA 2VYND 2Q46A 4DMLA 4MP6A 3PLRA 1R16A 3BYZA 1T24A 2UUOA 3EW7A 1HL3A 4ZRMA 1HSZA 4RVSA 4CLOB 4L8VA 4OSPA 3PDJA 5H83A 4RVFA 5JO0A 1SCUA 4B7CA 3GGOA 1FK8A 5GMOA 3UN1A 4YR9A 2PNFA 5I9LA 2FZEA 4WLNA 2Y68A 1KOLA 5IZCA 1LLDA 1YJ8A 1BWSA 3RUHA 3PWZA 2DAPA 5KCZA 4A2CA 2H63A 2DPGA 1B8VA 4B4WA 2NADA 1GAEO 2WE7A 2Y0DA 1MXHA 4WASA 3RFVA 2DQ4A 1DJNA 4PLYA 4PG7A 1B3BA 1D3AA 4EUFA 2AG8A 4RVHA 1IPFA 1GYRA 1SB9A 2P9CA 3U62A 3GLQA 1PJ2A 1H5QA 4HFNA 1ML3A 4QO7A 4HKTA 3JD1A 2Y1CA 4ND3A 3FNFA 2CZCA 4NU5A 4BNFA 1HE5A 1XSEA 4NBTA 4PN3A 2D1YA 3SJ7A 2RHRA 4BNKA 4F3YA 3JQAD 4Q3EA 4UVHA 3E82A 2NVUB 3KM0A 4FPXA 1OFGA 4B8ZA 4FJ1A 1XELA 3RCBA 4YJGB 3DZHA 2C29D 4E21A 1P1IA 3RFXA 3ICCA 5CPFA 3WQRA 2GN9A 2XXBA 4HP8A 4J0EA 4AJPA 3TNLA 3PHGA 2R6JA 1RKXA 4GGOA 3PZRA 1Y6JA 3AOEA 1ZXBA 5L45A 1U4OA 2YY7A 4WKGA 3OSUA 4E2WA 2IYPA 4BNUA 4O1MA 4U8GA 3ZNQA 4YA6A 3W6UA 1LSOA 3T7EA 4KTVE 4CLRB 2Q22A 1VI2A 4YAEA 3MCVA 1EE9A 2GO1A 3INTA 4IGFA 5EN4A 5GZ1A 3FNGA 1MP0A 1XU7A 1Z7EA 1H93A 2Y1DA 4GX5A 2J5KA 3JD2A 5KNLA 2QRKA 4JP3A 1F8FA 1NYTA 1KVSA 2DM6A 2NTVA 2VRCA 4B8WA 3KYCA 3C1TA 2OP0A 1I32A 2R00C 2FPIA 3BMOA 4BS9A 4CPDA 3T4EA 2B37A 3UFXA 1H6AA 1YGYA 3R0IA 4XD2A 4D3FA 2HMVA 3BTSA 3OBBA 3QA9A 4L0QA 4NK5A 1R4NA 2Y05A 3WS7A 1A9YA 5LCXA 3EUWA 4F45A 3K5PA 2PLAA 4IDDA 1NVTA 4OO3A 3WNVA 3JQFC 1VSVA 1UJMA 3F6YA 1QORA 4ZQFA 1QR6A 5THQA 5JYFA 3NRCA 1X1EA 1P77A 2VOJA 3ZWYA 1JTVA 2GSDA 3IMFA 3GDGA 2EP7A 4LGVA 2ZK7A 3C3XA 4ID9A 1PZFA 4JBHA 7ADHA 3GVCA 5IXYA 4JN6B 1WDLA 3ZU2A 3TDKA 1PX0A 2GNAA 3KBOA 1SBYA 3OJ0A 4J9VA 3GPDG 4YT5A 3VKUA 4BNWA 2UDPA 5KVCA 4ZVVA 2HRBA 3PGXA 1Q0HA 3RBZA 3ZWOA 2W98A 3MWDB 2O7QA 3IKTA 1YWGO 1UP7A 4LVUA 5GZ6A 5ES3A 3D4OA 3KXDA 3AU8A 3WTBA 1DOHA 2GF2A 1QSGA 3R6DA 1ZSVA 2AHRA 4NR0A 3V8BA 4AJHA 2Q1TA 2PH5A 3R1IA 4N18A 5F5NA 3PWKA 1BG6A 2X4GA 5G0SA 1ZNQO 1P1KA 4PLZA 2PZMA 4D79A 3IJRA 1GZ4A 2V6MA 3PVZA 1DRWA 2EXXA 1ZKMA 4MP3A 4TQGA 3SC6A 4XIYA 4FB5A 5LDGA 5KJ1A 4B3HA 2QZZA 2IZ0A 3KRTA 1BDMA 3QWHA 4FJ0A 4IY1A 1IZ0A 1Q7CA 1W73A 4E5KA 5I7EA 4Z0HO 3PP8A 4OL9A 4W4TA 4WECA 4CQLB 3WGIA 4GWKA 5JDIC 1CIVA 3A28A 4YJHB 4O63O 3DBRA 4HWKA 3KSDO 1DFGA 4R1SA 1CERA 1H6BA 1GD1O 1I3LA 1P0CA 2TMDA 4HXYA 4CM5A 3RC2A 5KJCA 5L7TA 3Q3CA 4N54A 3ZW9A 3Q2IA 4B79A 3DOOA 5TS3A 1UZMA 4N5LA 4BNMA 2NWQA 1R6DA 3DMTC 1C0KA 2FR0A 4R9SA 4PG8A 2HK9A 2NUAA 4PRLA 1ZK2A 1PZGA 4DC0A 1KEVA 1IYZA 5G0VA 3SLKA 3ZHYA 3ZWXA 4DYVA 5I7VA 4BGIA 1W4ZA 4FOOA 4YT2A 1XIVA 3E1KA 2AQ8A 4S1VA 4XQEA 4E0BA 4XYMA 4Z9FA 5L7WA 4ESOA 1N92A 3DDNA 1HE2A 3W1VA 1FDVA 3GK3A 3LT1A 1EFKA 3S2IA 3ICPA 3JQ8A 1BXZA 1DC3A 1IB6A 5TLSA 3RSHA 4WLUA 1H0KA 3KETA 2HO5A 1LJ8A 2YHIB 4E5YA 5U9CA 1FDWA 3O26A 5I7SA 4WLEA 1FXSA 4BQPA 3R3SA 3PZBA 2PFGA 2RCYA 1NFFA 3RC7A 4U0KA 1AXGA 4HY3A 3VZQA 4BKOA 3OEYA 4F6CA 2DU8A 4D43A 1LSSA 3ITKA 4CMIA 4NHEA 5T57A 3N58A 2ZB8A 1DAOA 3U9LA 1PS9A 5EJ2A 1T1RA 3GEGA 3M2PA 4J7CA 1DJQA 1C1XB 2ZCVA 2YW9A 2G1UA 3D3WB 2X86A 3BTUA 1IOLA 3UCFA 1GQ2A 3MJCA 3L9XA 4BMVA 3ONFA 4ITUA 1BXKA 3I9JA 3ONDA 3DBHA 5G0WA 3AOGA 2AE1A 1Q0QA 2GZ3A 2PGLA 4GKBA 1VL6A 3O8QA 3ZHXA 5JC1A 4B3IA 4FFPA 1QRRA 5L4LA 4MVJP 4N5MA 4QT0A 4II2A 3TOXA 4RVDA 4BMSA 1QKIA 1HKUA 2BKAA 3H4VA 1LLUA 1M67A 4DPKA 1ZZEA 3F1KA 3NGLA 3INRA 1VL8A 9LDBA 2AE2A 1EDZA 4OKIA 3C7CB 3L4BC 2PWZA 3DZGA 3KOUA 1E6WA 2VN8A 1KVRA 2G76A 1U7HA 5AXBA 4NBWA 2BFOA 4Q3DA 3VKVA 4AJJA 1UXGA 1P45A 3H3JA 1PJTA 1HLPA 3B70A 3DOJA 3KEQA 3LYLA 4XDZA 4CV2A 5KIAA 2ZTVA 4TKLA 2JFGA 1N9GA 4FGSA 3VPHA 1EBFA 3V1TC 5JW6A 1HTBA 1DDOA 4Z9YA 8ADHA 3JQEA 5JYEA 1NPDA 2GZ2A 1LLQA 3AUAA 2ZJ0A 4FGWA 5A02A 2ZTMA 3HFSA 1AUPA 1ZW1A 4LMRA 5TQVA 1UDAA 4A26A 3H9QA 4D7AA 3JV7A 1QV7A 3UHAA 4E31A 5ENVA 4MIYA 2PY6A 1ZEJA 3TN7A 1GFSA 1U9JA 2WJPA 2VYVD 3WB9A 3UF0A 4GLOA 3C1AA 4RDIA 2NU7A 4Y98A 2JHGA 2X9GA 4PRKA 3AUSA 1DIRA 4MKRA 1I3MA 3STHA 4IDEA 4TRNA 3H65A 4TZTA 3ZNPA 3FN4A 3JD4A 4RCVA 5TSDA 4QFCA 1EK6A 4KDFA 1FDTA 5KOIA 2FR1A 2C59A 1K5HA 4AJKA 5U4QA 2PZJA 1CRWG 4CLEA 3D7LA 4AJEA 3DC2A 5A03A 4BNYA 4TWRA 3OETA 3C8MA 3KSUA 2O3TA 3WLEA 3K9QO 4GI2A 1I0ZA 1C0LA 3QVXA 3BMNA 2GYYA 1R0LA 2IRWA 4MKZA 3BIOA 3RIHA 4PVCA 1OC2A 4XQ9A 5ILOA 5THKA 1I8TA 4AJ2A 4CMKA 1NVGA 1ZIDA 3RC9A 1O6ZA 4I5DA 3GHYA 1N7GA 3JQBA 2DBVO 4DIOA 3C24A 3GG2A 3HZZA 1SOVA 5JMWA 1X14A 1PWZA 4ZD6A 5BSHA 3QWFA 3BMCB 1U3UA 3CPSA 1ZVMA 3G17A 1XWFA 4L75A 4CUJA 2BGKA 2GDZA 4EUEA 2ZYAA 3FWZA 5CHEA 4Q3BA 1QLHA 1GEEA 1WDKA 4EJ6A 4IJUA 5C37A 1NX6A 2IZ1A 1YBMA 4YACA 1KIFA 4NH4A 4J49A 5FFFA 2Q49A 2HJRA 3E9NA 5TRTA 4QO8A 1CYDA 5FYDA 3WJAA 1P33A 4YAJA 2FSSA 4QFDA 1Y9EA 3OECA 1PU2A 3TZQA 3E9MA 4M49A 1MG5A 4H16A 1YQGA 4ROSA 2AEMA 4YBZA 1GADO 3PTZA 2Q1UA 4CMHA 2Z1MA 3IL2A 1UUFA 1GUFA 1N1GA 2C5AA 1NASA 1GYQA 1B14A 3EK2A 1RPNA 4ONEA 5TIIA 2VT3A 3VDRA 1PJSA 4CM9D 2P68A 5H81A 1UAYA 4IIVA 4WLOA 2CF5A 2I9PA 2DFVA 1KVUA 3ZWWA 1JW9B 3NT2A 3GEMA 1Z82A 3SJUA 1J6UA 1EUDA 4ND4A 1VLLA 1CQJA 3ENNA 3P2OA 5KJEA 3KLPX 4J1QA 3DOCA 2CDBA 2HK7A 2H5LA 2I5PO 1LDYA 4KMSA 4RF2A 4IDBA 4JJGA 5K6AC 4YCAA 4M89A 3VPXA 3PJFA 3ST7A 2VQ3A 3ETEA 3KEOA 4ND1A 4P22A 1ZSNA 5HBRA 4BNZA 5HS4A 3EVNA 2VWGA 4I9UA 5CDYA 3BHIA 2VHXA 4CR6A 3GZNA 3B20A 1W8DA 4W9NC 2XAAA 1NWCA 3CIFA 3L07A 5JCJA 3N7UA 5TC4A 3AI2A 4NBRA 4OQZA 5B4TA 2O48X 2C5EA 3PYMA 1KY5A 3SC4A 1PS8A 4WNCA 5HWSA 4UEOA 4GKVA 4UREA 4UULA 4WLFA 5JMPA 4R3WA 5L95A 4MVJE 4TKMA 1P1HA 2NTJA 3DZKA 1JU9A 5IN5A 3F1LA 2J5RA 3RU7A 3U3XA 4MVJM 4XA8A 5JAMA 1YH3A 3SEFA 4WOKA 3HQ4O 4YRDA 5JLAA 4DL9A 4OIMA 3EGOA 2ZB3A 3JQDA 3NV9A 4XIJA 1E3WB 4MDHA 3JTMA 5G0UA 4CM1A 2E82A 1K2WA 3W4JA 3KYCB 4DGSA 1NR1A 4KTTE 4LN1A 3BMOB 4E2YA 3OA0A 2FY8A 2YYYA 2O2YA 4NJOA 1U28A 1V3UA 3JQAB 3KZVA 4R01A 4HV4A 1WAMA 1R4NB 1E7SA 3BMQB 3GVIA 1Y8QA 1Y81A 4Y9DA 3WTCA 2Q2QA 2O3UA 4LRSB 3HJAA 1JKIA 1ZFNA 1HYEA 3DFZA 3QLJA 2J3KA 3X2FA 3NT4A 2H9IA 5MDHA 4MVJD 3HG7A 1P74A 1D8AA 2HMTA 4BO2A 4I9NA 4QTZA 3D64A 2NVWA 1VE9A 2WD7A 1GQYA 3GVPA 2WEKA 5DNAA 3UCEA 4BNNA 4BNLA 4BQRA 1EVYA 3QP9A 2FZWA 4CR8A 5LDHA 3MWEB 4PVDA 2WMDA 4ALIA 1Y5MA 4XR9A 2DBZA 2J5QA 2X0JA 4R1NA 5COAA 3IIEA 3W4IA 3DBLB 4D41A 4YEDA 4QX6A 4L73A 1DFHA 2EHDA 2B35A 2Q4EA 2E48A 5A3VA 2ZATA 4RGBA 1DIGA 3PRJA 1KEUA 2GN6A 2DVMA 3A9WA 5KVVA 1AHHA 1EE2A 2PV7A 2RIRA 4LISA 3WR5A 5CEJA 2C2XA 4BO3A 3INGA 2VHZA 2LDBA 2IEDA 2X5KO 4BB6A 1XCBA 1EFLA 1RYEA 1G1AA 3GFBA 3E48A 3BA1A 3OH8A 4DREA 1PJ3A 1E5LA 3BZUA 5TNXA 3GGPA 4LSMA 1GZ3A 4R1UA 3L9WA 4Q3AA 3FTPA 4R51A 2VRBA 4X54A 3GVHA 5AQ1A 2Y66A 5AXDA 4M1QA 1ZEMA 1ENOA 4CV3A 2P2SA 3U5TA 1LC0A 3DR3A 1PGQA 2GUGA 2YQ4A 3VPFA 1OOEA 4D0SA 4R68A 1VC2A 2Z5LA 1Q0LA 1WWKA 1PJBA 3H6KA 4IS2A 4KWHA 4QECA 3HADA 2IXBA 4U7WA 3RUCA 4Y6RA 4RV9A 4WCFA 5M6DA 2A4KA 4ZRNA 3I9OA 4PLPA 4MKXA 3JQFA 2PH3A 1LQUA 1U5CA 5GY7A 3RUEA 1BXGA 4DQVA 3GPIA 5JCXA 1NXQA 1XLTA 3RJ9A 1RWBA 1H2HA 3ROPA 3CINA 2OHXA 1KERA 1NQAO 4IPTA 1KS9A 2GZ1A 3ENKA 4C4OA 1MB4A 1Y8RA 1OMOA 3P2YA 4HFMA 4CLDA 3MJVA 1J5PA 4CM4B 1QYXA 1GV1A 2VUTA 3JQ7A 3WGOA 1VKOA 1NAHA 2QHXA 2P4QA 4BGUA 1LQTA 1OC4A 4DPLA 1QYDA 4INAA 2VOEA 5A1TA 4LSWA 4J6FA 1YBAA 4PFJA 1T1SA 5ER6A 4GGPA 4BNHA 5JDCC 4D45A 2HRZA 3MOIA 1K6XA 4PLWA 5A9SA 2B36A 3ZHZA 1C1DA 4EJMA 3MJ4A 1DLIA 3NJ4A 3KYDB 1TA4A 3UICA 4Z6KA 2R2GA 1LRJA 5IJZA 3I83A 1XKQA 1H6CA 4DQXA 4TRRA 5JXWA 1NFQA 3VH2A 4CMEC 3ETDA 1P31A 4D46A 4E4YA 5CFZA 4CR7A 4DWVA 1QYCA 5CDUA 2VRCD 3K92A 1UP4A 1H2BA 3CZMA 5DOVA 2VHWA 1HDOA 3GDOA 1QYWA 3MTGA 4RF5A 4CMIB 1A7AA 3K30A 4D44A 3P5SA 3CEAA 4XGNA 2JHFA 3Q9NA 4FD3A 2B5VA 1SEPA 5A5FA 4PCVA 3IOYA 3NJ8A 4H7PA 4B4OA 2ZTLA 2A92A 4E6PA 1VM6A 3C7AA 3DBHB 5FWNA 3ADOA 3DZJA 4K1LA 4TSKA 3GH3A 4TVBA 4EITA 4J1SA 3O8QB 4OOFA 5HA5A 4G81A 3V1YA 1G0OA 4IZIA 3DQPA 4ALKA 1E3SA 4N5NA 4EEZA 1SAYA 1B7GO 4WNIA 1YQXA 3P19A 4FDAA 1TXGA 3LT2A 1SZJG 3F4LA 4YTEA 5KTKA 1PGJA 3VTFA 1KVTA 3IP3A 3DFUA 5DCUA 4YQZA 4R4JA 2GN8A 1O94A 3GQVA 3IAHA 2D8AA 2O23A 4M86A 1V8BA 1YJQA 3E9QA 3B1JA 3WYBA 2EKLA 2AEJA 1XQ1A 1B26A 3K6JA 3SXPA 2NLOA 3NTRA 1U3TA 1JN0A 4J9UE 1DEHA 4EI2A 3V2UA 1PSDA 3F4BA 1LDNA 1NTOA 4DTIA 2FN7A 1EEHA 2AW5A 1T26A 2PKQP 2C7GA 4LMPA 2DC1A 3W6ZA 2AQHA 1NHWA 4IUYA 4E12A 1YOVA 2IDZA 1CDOA 3GFGA 2JJYA 3RUFA 3JD0A 1H9BA 2VNAA 5JAIA 2HUNA 2Y0EA 1NNUA 2PK3A 2Q2WA 3PIDA 2DTXA 3VH3A 3E5MA 1PJCA 4Y67A 2PR2A 2PA3A 3HB5X 4K28A 4E3ZA 9LDTA 1F17A 1M2WA 3PQEA 3W8DA 2DKNA 3HNPA 4YRBA 2Y1GA 3S8MA 1NAIA 1MV8A 3ETGA 3WSVA 1C0PA 1M75A 4MPDA 1V3TA 1DRUA 3LT4A 5JAQA 3OIFA 3RU9A 2GR9A 4IXWA 1M6HA 3ZCXA 1NM5A 3UUWA 1FDUA 3FPCA 4BO8A 3ZWBA 4JJIA 4H3VA 3E5RA 2WYVA 2Y1FA 3ZU3A 2C7VA 1J0XO 2E4AA 2P5UA 3JQCA 4NG5A 4XB1A 2JAPA 2EW2A 3WGGA 1LSUA 4OXKA 1M66A 1SEVA 2HKIA 2C0CA 3ADPA 3VZRA 1JA9A 1X13A 4J2HA 2W2LA 3GEDA 3I3OA 4IZHA 5JYDA 2I3AA 4DXHA 2X5OA 4WPGA 3OIGA 4IDAA 1E1KA 4B7UA 1E77A 1BW9A 1EZ4A 1PQPA 4Z0PA 5JBIA 5TF4A 4ZU3A 4E32A 3JQGB 3WQSB 4DVJA 3L4BA 3TF5A 1YL7A 3LF1A 5IZCC 3I9LA 5DBFA 3HDQA 2WTBA 3WGQA 3BMNB 5ITVA 5KVSA 3S55A 3SX2A 4KOAA 3K31A 5A05A 3QJ5A 5DBGA 5G4KA 2D59A 3RI3A 3TFQA 1I5RA 4DPMA 4UVIA 2X23A 4J3FA 3FRJA 4A7PA 2ZYGA 4UUPA 3WWYA 3I1JA 2EG9A 3DL2A 1ZSYA 1YL6A 3RWBA 1GQQA 3F46A 3PFWO 4ZICA 4XDYA 1ZK4A 3PIIA 3K8ZA 1O8CA 3JYPA 4RPHA 3UH1A 1CQIA 3AY7A 1QG6A 4HFRA 3ON5A 1HDZA 3Q0EA 3VC7A 3UXYA 1C14A 1X7HA 4OHUA 2B0JA 2CDCA 1T2AA 3L6OO 5C7LO 1QLJA 4W99A 4Q39A 3TQHA 5L4NA 2JCVA 1GU7A 4XX0A 4YRAA 1W6UA 1E5QA 4C7JA 3PFFA 2W2KB 1PL8A 2B69A 2XXJA 3WGTA 3RFTA 2POQX 1MLDA 4GX0A 3HUDA 5EINA 3PWSA 3PJEA 3RBVA 1YB4A 2HCTA 1ARZA 5A4DA 5CEFA 3LK7A 5ADHA 4Q9NA 4BO0A 5MGBA 4NNJA 3B1KA 3I52A 7MDHA 4GSKA 3V2HA 4LK3A 6LDHA 3FR8A 4P4LA 4FFOA 1K6IA 1KEWA 4L76A 3KSZO 1UXJA 2P4HX 1JAYA 2W90A 2YV2A 2I3GA 1VRWA 2NQ8A 4XZ3A 1XGKA 4YJFA 3HB4X 5JNLA 2ZJ1A 1LU9A 4TRMA 1WDMA 3PJGA 2Q50A 4BO4A 3N74A 1E7QA 2JCXA 1JVBA 2HJSA 2LDXA 4M54A 1G6KA 1YE3A 3LU1A 2DUUA 1ADBA 2RBEA 2WYUA 1Q7BA 2VUUA 3WWZA 4G5HA 3AI1A 3V2GA 3ZV6A 4AJIA 2BGMA 1P1FA 4J4BA 1SNYA 3MJTA 1Y5RA 3EDMA 3NEPX 4AJ1A 1LEHA 1ENPA 4J4HA 1NPYA 4R5HA 4RPLA 2D5CA 1D4FA 3WGZA 3QVTA 4J7UA 2SCUA 3GA0A 4NJMA 4BKRA 3OFSA 4C7KA 3OJOA 1ZXLA 1VPDA 2VT2A 4JBGA 3U09A 1M6WA 1Y1PA 3ROQA 3VVCA 1GL3A 5COBA 5DP1A 4MVJI 3PJDA 2X9NA 4I5EA 5IAAA 3CMMA 3A14A 4ILKA 2FOIA 1U7TA 3MEQA 1UDBA 1HDCA 1NR7A 1P1RA 4YJGA 3KYBA 2Q4BA 3I9MA 3F9IA 4I1IA 1E7MA 4O6VA 3PPIA 4IS3A 2BELA 3FHLA 1UXKA 3FSRA 2O3SA 3GDFA 3LVFO 4WEQA 2XF8A 1E92A 1MG0A 2IODA 3KO8A 2P9GA 3ASUA 1YQDA 3MTJA 3UVEA 1A4IA 1DFIA 2NV6A 2PD6A 3ORFA 3DTYA 4M55A 2O3JA 5IN4A 4LVCA 4EJ0A 1E7RA 1H94A 4XRRA 3LC1O 2JFHA 2P5YA 4A10A 4GQAA 2I67A 1E7WA 2YQ5A 3BHJA 2JCYA 3PXXA 4HBGA 3WQQA 4JIGA 2ZCUA 4NK4A 4CLRA 4RPGA 3BTOA 2DFDA 3ZWVA 3E03A 4UEKA 4R69A 3TRIA 1PIWA 1ZJZA 3C85A 2W4QA 5CEEA 3H9JA 3NDIA 1Y8QB 2OUIA 5F1KA 1I3NA 3EMKA 4NFYA 4B3JA 1OAAA 4PLGA 1K0UA 3PQFA 3ANNA 4TZKA 2QW8A 2WD7B 1SOWA 3LLSA 3TOZA 1PZHA 2C54A 2V6FA 5IDYA 3U4CA 5I7FA 4DRYA 3Q1LA 4PLVA 4AL4A 4UEJA 3OP4A 4RF4A 5I8ZA 1LC3A 1P44A 1X0VA 2B4QA 3OICA 5DOZA 2DLDA 3WICA 2V7PA 4DIFA 1V0JA 3VAZA 3ZH2A 4J90A 4CMJA 2X0IA 4AG3A 3RROA 1SB8A 3QIVA 1JDJA 3O38A 4BKPA 3ZNNA 3GOHA 5JAZA 1ISHA 2FHSA 4O0LA 5DN9A 1AN9A 1W0CA 4BNIA 5B37A 3GNQA 1LTHR 4MVJH 1TT5B 4FFMA 4FIZA 4ZA2A 5JS6A 4HFJA 4J4TA 3L6EA 4BB5A 2FSVA 4G65A 3OA2A 3ROKA 1QP8A 4WGGA 5EQFA 1MC5A 2GRAA 3G49A 5A9TA 5G4LA 4AJ4A 1A4UA 1HDYA 1JWAB 3PLNA 1WP4A 4JXKA 3AW9A 3TFOA 1WVGA 3CE6A 3VH4A 4JJFA 5L40A 4EZBA 4CM3A 4BL5A 3DAGA 1U3VA 1Q2XA 2VZ0A 3WYEA 3WSWA 4KUGA 3H9EO 3IUPA 4WJZA 4E5NA 5JYAA 4ALMA 4BNGA 4DMMA 4PIVA 4YJDA 2I65A 1U5AA 4EBFA 1DPGA 1RM5A 2Y1EA 4CQLA 3AUUA 1X15A 4WCFB 4RJTA 2DT5A 2EERA 3ZI0A 4CLXA 5EERA 1Q1NA 3ZWMA 1BXGB 1TB4A 4YPOA 4FR5A 3L4SO 1O5IA 1ISIA 1OZAA 3LQFA 4UUNA 1LDMA 2C82A 2DBQA 3I5MA 1U8FO 3WYCA 4Z3DA 1E1LA 1E3IA 3TL2A 4CUKA 4D0RA 1NQOA 4ZJUA 1WPQA 5JCJD 1SC6A 1BVUA 3JQ7B 4XYLA 4JROA 5JO9A 5FF9A 3RKRA 3O03A 1YL5A 3ITDA 2E49A 1Y7TA 3VPGA 5CPBA 4U6QA 3CUKA 1KYQA 1ZK3A 2AQIA 1GY8A 2YV1A 5A9SB 2X7HA 1QMGA 4XYEA 5U1PA 2EJVA 3FCOA 4EW6A 2WM3A 4W7HA 2F1KA 1ZO8A 2NTNA 5HTOA 3ZV4A 3E8XA 3SBOA 1GCOA 4FN4A 1HT0A 5BNTA 3JYOA 4YQYA 3LF2A 3WX0A 5B1YA 2YHIA 4PLCA 1F12A 5C3MA 4HNHA 1LI4A 1RM0A 2G17A 5CAEA 2CY0A 3QY9A 5K0ZA 4YXFA 3KVOA 4BNJA 2OMEA 2EV9A 2O7SA 1WZEA 1HE3A 4JBIA 3CXRA 3WIDA 2IXAA 4IIUA 4F46A 4BVAA 5C7IO 4P4NA 1NQ5A 3I23A 5J9GA 1MX3A 3NDRA 4RL6A 4IQ8A 4P38A 1F14A 1O9BA 3BHMA 1C1XA 5JY6A 1X7DA 4OXNA 3EYWA 5COQA 4CODB 2FRDA 1ZMTA 2D4AA 1B8UA 1IZ9A 1EQUA 2BF7A 4FOSA 1QYVA 4UUMA 4J1TA 1J4AA 4RPJA 3NAQA 4ZQEA 1P3DA 5DBIA 4RORA 4GX2A 3WFJA 5T64A 4BKQA 1ID1A 3D5QA 4F6LA 1PR9A 4R9RA 4UVEA 3IUSA 4XYGA 4BGEA 2X8LA 3AFMA 1U2GA 1E6UA 4A27A 2QZ9A 2OORA 4IGEA 3ZZNA 4YAIA 1E3EA 3HWRA 3IC5A 1G0NA 1LX6A 4PLHA 2OP1A 3I6QA 1ONNA 4OM8A 5T73A 5KKCA 3Q9UA 3JD3A 1B2LA 4A5OA 4HUJA 2I99A 1E0DA 2AG5A 3RBXA 1XA0A 2XPCA 4NU6A 1YOVB 3PHHA 1LRLA 1FDSA 2V65A 1NPTO 2DBRA 3QVWA 4CQMA 1A72A 1WZIA 3AM4A 1ULSA 5F21A 4CMEA 5A3JA 2EWMA 3NUGA 1XEAA 4LW8A 3ONEA 3FR7A 3WBFA 2HU2A 4ALJA 3JQBC 1E3JA 2WWRA 2CNBA 4UAGA 1QV6A 4NZ9A 4R41A 4YDRA 5CDSA 1DC6A 2ZQYA 2FR8A 1U1IA 1FF9A 3FWNA 5K9ZA 1GUYA 1K6JA 4MP8A 4D3DA 5ICMA 4AJOA 1VJ1A 4NI5A 3COSA 5L9AA 4FFNA 1ADCA 3D5TA 3G1UA 3VZSA 4IDGA 4IDCA 2QYTA 5L51A 2O2SA 2GCGA 4PG4A 1GUZA 4GWGA 2NU6A 3JYNA 3ANLA 4KUHA 1GDHA 3K2BA 1A5ZA 1B15A 2Q2VA 2QRJA 3RAJA 2JD1A 1HDXA 2J6IA 1NHGA 3LT0A 4OOEA 4G2NA 4DA9A 2GD1O 3QQPA 3G1TA 3NKLA 5AYVA 2NSDA 1A7KA 3OQ1A 1YDWA 3MZ0A 1JAXA 5AXCA 4BNXA 1EVJA 4E33A 1DIAA 4MIOA 2ET6A 2X22A 1ADFA 1EVZA 3WXBA 1ORRA 4BOYA 1GCUA 1SO8A 2P9EA 4QSMA 5CP8A 1A9ZA 3GF4A 1PWXA 4R5MA 4GPD1 4PG5A 4JK3A 1PJLA 1YS4A 1ZCJA 2R00A 4XB2A 5JE8A 5T8KC 4M87A 3H7AA 1GYPA 1CEQA 2NVBA 3PHLA 4IJVA 1C0IA 3O9ZA 2RAFA 4FFLA 3DBRB 1X7GA 1P9LA 2OZPA 4GX1A 3A4VA 3KLMX 4XGIA 3L77A 4XJSA 5T67A 5L7YA 1C3VA 3QHAA 3KV3O 4NFHA 3RC1A 4NQZA 5J23A 1ZJYA 2HDHA 3BMCA 1BVRA 1DC4A 2OBNA 2YUTA 1OI7A 1DIBA 1V3VA 1ZH8A 3M6IA 3ABIA 4WK6A 3ZNOA 1NFRA 4FJ2A 4CV1A 4CL3A 2DTDA 4IQGA 3ZWCA 3WLFA 1KVQA 1LA2A 4GMGA 4BUCA 3CH6A 1IHYA 2C2YA 3DZIA 5HS6A 3Q11A 3RJ5A 1A71A 3PI7A 1BGVA 3DTTA 5ICSA 2VTEA 3JQ8B 2OBYA 3MJEA 4WUVA 5DZSA 4JLWA 2QQ5A 1KEPA 2RHCA 1P1JA 3GUCA 2D0IA 2BI8A 3GAZA 3L6DA 1E3LA 4Q3CA 4R1TA 2YV3A 2HQ1A 4YJFB 4I9HA 4NPCA 4FBGA 3ZDFA 1BMDA 1HLDA 3OJEA 2QG4A 1XR3A 4CV0A 3EY4A 3GT0A 4RVUA 3TZCA 1LBEA 2EJWA 1XG5A 1ZBQA 1ADGA 4BO7A 1D1TA 3F3SA 3DO5A 5I9MA 3T7CA 3H5NA 1E6EA 1HE4A 5LC1A 4CJXA 5DCWA 2CD9A 3B1FA 1CJCA 4FFRA 5BSEA 5IFLA 3BXXA 5JDIA 5L4SA 4J91A 8LDHA 2IZZA 2UYYA 1V6AA 1DIHA 4MOWA 1BSVA 5DP2A 2X0RA 1EVIA 2Y67A 3G0OA 1MC4A 1PJ4A 4M8SA 4NJMB 2OFPA 4MINA 4QXMA 3H5AA 1T2EA 3WGHA 3GMDA 1XHLA 4B7XA 2IEBA 1EK5A 5IDQA 3O4RA 3I6IA 4BO5A 4L4XA 3WIEA 1YONA 1ZK1A 3OEWA 2VUSA 1F06A 3X2EA 2CVOA 1XDWA 2VYNA 1DXYA 4XKJA 1I2CA 3DMTA 4RO0A 3JQ9C 1E1NA 1D1SA 1KETA 4U5QA 2Q45A 2EW8A 3HN2A 5CG1A 1T2DA 1KC1A 2YFHA 2EGGA 3BTVA 5JC8A 2X0NA 3LLVA 4LCJA 2AXQA 3AJRA 5KKAA 1T2CA 1MA0A 2WDZA 3QWBA 4CLHA 4KZPA 5DCYA 4DLBA 4R54A 2Q99A 3ASVA 4RVGA 1BRMA 4W6ZA 2W2LD 4ND2A 4W7IA 3HSKA 2D2IA 2CDAA 2EP5A 1YB5A 4GVLA 2NM0A 1B16A 3LC7O 2HMSA 5I8WA 2FPGA 2FP4A 3PQDA 4QUKA 3CTMA 5TJ9A 3E18A 1SMKA 4J16A 1T2FA 2VWHA 2BRUA 3WFIA 5JFOA 3PK0A 1J49A 1N9GB 2UV8A 3VDQA 2BHLA 4TMFA 4YB8A 1Z74A 2PKRA 5I9NA 1WMAA 2DPHA 3EAGA 1E3WA 3WNQA 1IHXA 1X0XA 1PL6A 2AMFA 2GN4A 3S2EA 4II3A 1JLLA 5IG2A 1YRLA 2I6TA 4RZHA 4EDFA 3I4CA 3W4KA 3FBTA 3M1AA 3WMWA 2PZLA 5DDIP 4JCOA 3UAGA 4GAEA 3VH1A 1ONPA 3SLGA 1O89A 4L4SA 4Y6SA 5BQFA 3JQAA 1N1EA 3NTQA 3DZBA 5BNIA 4FC6A 5AOVA 3BMQA 1TI7A 4KWIA 3QRWA 2AEFA 4D42A 4WCFC 4CM8A 4P8RA 1M76A 1MFPA 3AI3A 4LCEA 1XYGA 4CMGA 1DRVA 1RJWA 2OL4A 1HZZA 4GSLA 1YB1A 4BV9A 5A06A 3FPLA 4PZEA 1IUKA 1ISJA 4ZHSA 5IF3A 1DHTA 4MJLA 4PLTA 2BGLA 3QV1A 1ENZA 3TZKA 2GERA 3DZFA 3DONA 3GG9A 5JSFA 3PYLA 3DBLA 3L0DA 4XJTA 5DF1A 5DULA 1ISMA 4QEDA 4ALNA 2B83A 1E1MA 2EKQA 3BAZA 4IJWA 1WNTA 2QYSA 5FI5A 1HDRA 3D4NA 3QW2A 3DHEA 3K2EA 3ZV5A 4DUPA 2Y93A 4OH1A 3LC2O 5L3ZA 3GRKA 2PTGA 5A9RA 4JX8A 4NFSA 3TWOA 2EIHA 1JKJA 5FEUA 1I2ZA 5F1PA 5TJHA 1DHRA 2H6EA 2QIOA 2ILTA 4CMBA 4KQWA 2Q3EA 2JAHA 3H2SA 4YAKA 2O3QA 1AXEA 4DQUA 1ZUD1 4IINA 4IDFA 1IPEA 3F5QA 4KQXA 2A35A 1TVEA 1AE1A 5F3RA 5HRUA 3VZPA 3WOHA 3H5RA 3D4PA 2HLPA 3D3EA 2BLLA 2X9VA 3LSYA 3IS3A 1PZEA 3ZWNA 2D5AA 2VNSA 1LSJA 5DT9A 4DIBA 2JL1A 4BHTA 3DHYA 2YZ7A 4XQGA 3C1OA 1UZLA 1R4MA 1I2BA 2CVZA 4DLAA 1I10A 2A94A 2WD8A 4AFNA 3RD5A 2VTDA 3EZYA 2ZB7A 3RQSA 3AOEC 4MVJG 2Y99A 1O95A 1T25A 4YT8A 3W8EA 3JYLA 3OQ6A 1KY4A 1I24A 2B5WA 1ZMOA 5F1OA 4CLOA 1X1TA 4CM4A 4RDHA 2VWQA 4XCVA 1Z75A 1ONOA 3AWDA 5CDGA 5C5IA 4FW8A 4IMPA 3OIDA 4UVDA 1GPDG 2X5JO 1WW8A 3E6AA 2JD2A 3EHEA 3GHHA 4DBZA 2WYWA
chains in the Genus database with same CATH superfamily
4RQAA 2NTEA 2H5EA 2ATVA 1ISGA 4FKZA 2CF6A 1TLTA 1LQ2A 2H1SA 1P2UA 4TRJA 3ZZTA 1G21E 3GROA 4I2VA 1JVSA 2HMUA 2XTJA 1A27A 1KAOA 1K7CA 3WE7A 1TZKA 1RVDA 1ZRHA 4XUCA 1T9HA 4DCTA 1KZ1A 1WXDA 3H0EA 4XFKA 2WU4A 5CUQA 3GJ8A 3ND7A 1V9LA 3O4GA 4I08A 5IYZA 4G26A 3AKCA 3DBOB 4G4SP 1RI3A 3VR2A 1VL0A 2G09A 2QQFA 5HKOA 4EO9A 2JFBA 1THMA 4KX5A 3ZD8A 1V7QA 4U2CA 1E7YA 3LGAA 2FDXA 1G3UA 3H9UA 3VPCA 1S96A 3MA0A 4ZVRA 5AW3A 3II6X 5ENDA 4FYVA 4A73A 4DBVO 1QOQB 5AI6A 4EG8A 5B4UA 3FI9A 3N5KA 2FYTA 2BP7B 2WKSA 1RI1A 1UXHA 4UHJA 1EMDA 5C5EA 1ZOPA 4JGBA 2FWJA 4AD8A 2PRZA 1L1QA 3B52X 4Q01A 1XCOA 5E6SA 4E03A 1B6RA 1N2SA 3HVKA 3DB2A 2GTIA 1WNFA 4I4TF 5AP9A 4D0NA 7REQA 4JVLA 3CF4G 2Z30A 1N5DA 2YVUA 1OBVA 3NHLA 1BYIA 3PPXA 4J0JA 5JTUA 3PEFA 3OZFA 2IUEA 5E6UB 4AZSA 3NTVA 4RF3A 4TMTA 4MB6A 5IH3A 1ZOOA 2FF7A 4PS0A 1YB6A 2JK1A 3OX3A 4GLLA 4IVQA 3EVBA 4IM7A 5ELMA 4PHGA 1GGVA 2E0IA 3R6GA 1JB1A 1Q15A 4GH5A 1ULTA 3KOOA 4EELA 1SKYE 3H18A 1JIQA 4KXQA 4XGKA 1WVIA 1UOEA 4BO6A 2JGAA 1HWYA 2JJ2A 4P86A 4UUBA 5EE5B 3ZYCA 3DZ3B 1F1BA 4KRYA 5I4KA 1GTSA 4UHFA 1FU8A 3Q7QA 2QN9A 2H59A 1IL0A 2MYPA 3BK2A 1FFHA 3KQQA 3QTLA 3QX9A 5T5QA 4D8WA 1G4AE 3BWYA 2WYHA 2DY0A 5FI0B 3TUTA 3Q7PA 3EZ7A 1Z4JA 2GVDC 4WIAA 1JJAA 2JK0A 2FVYA 2V9PA 2F1HA 4ITRC 4ENUA 3EZ6A 3WBBA 4O5OA 4X61A 1CY6A 3GGDA 4MVYA 4AG5A 4IKPA 2BHNA 1YRYE 5BR8B 1OROA 4KQEA 4BGDA 3IJPA 3SDSA 1OTHA 2PMBA 1G9XA 4TVOA 4YXWD 4YY3B 1NJ1A 4TT3D 4DCSA 2PBLA 1VE7A 3B85A 3ZI7A 5AWFC 3D1VA 4RLQA 4K81B 1F8GA 4F0JA 3H0WB 3DOFA 2IVZA 4G1UC 3DQZA 2E4XA 4DSOA 1TZ2A 2NAFA 4NZMA 5TEVA 4ER7A 4C87A 3GLRA 5D7NA 4L9RA 1A9XA 4ZC8A 3SSMA 1CZUA 4HAZA 4FWIB 4PW0A 2FUNB 2B2XA 2EQBA 3QE4A 1OWMA 4M7PA 4R8RA 5LN1A 3VYVA 2JLRA 5FWYB 2BGUA 3ZS8A 1O4WA 2A14A 3DUWA 1TK3A 3GUZA 1O7JA 1Z45A 3I4LA 2V97A 1QU2A 3F3YA 4X91A 3JW8A 1RHMA 4WEOA 3PHCA 3LVBA 5P21A 2VJCA 3MBOA 3F5SA 3SOPA 4FX2A 3VOTA 1G21A 3ELDA 2QX9A 5ALEA 4CFYA 3THWB 4OQPA 4C0JA 4KXXA 2V6BA 1WY5A 4REOA 2F9LA 5J5CA 4DA0A 2YWJA 3INNA 3B8HA 2I2WA 1EK1A 5EEGA 3PA6A 2UUPA 5D87A 1R0KA 3HFGA 5FBHA 1AN0A 3B3JA 3ZU6A 2Q1SA 1KAHA 2PGDA 1BE8A 4ZEOA 1U31A 2H57A 5IDXA 3QFSA 3KTDA 3NATA 3FYHA 1G59A 3ZDBA 1TQHA 1DKPA 2C7PA 3IUEA 4JJ7A 2D3TA 4FN5A 1QH1A 4BIIA 4EHHA 1J8VA 2AN4A 3SF8A 2BYTA 5CXUA 1GHTA 1U8ZA 3HE3A 4QODA 1A2BA 2RJOA 1F8UA 4RD0A 2FFHA 3A4IA 1WHSA 5AK0A 4RSHA 5I3CA 2DCMA 4NBVA 2PWBA 2FPLA 3E0XA 2GKGA 3Q8KA 2RH8A 3FY4A 3B12A 4FSHA 3JQGA 4EBBA 1VJTA 1TU4A 2PPVA 3SXJA 4K9RA 4D9HA 3W1EA 5A0VA 4E5SA 3U1VA 2VXOA 1NMYA 1Q92A 4Q4AB 1T2UA 1A1VA 2HNKA 4AJNA 2VO1A 4OJMX 2IPAB 3C15C 2EEZA 2IYOA 1TEVA 1H1TA 5LFAA 4TYMA 4K9OA 2IIBA 1J9ZA 2X8AA 5EWMB 2DTEA 3L6BA 3DS8A 1YSCA 2IQ5A 1NVDA 2E1PA 2ZJ4A 4NCKA 2OGUA 2ZWIA 1QQ6A 3I8XA 2OC4A 5IJ0A 1U9IC 3DDUA 1AMUA 5FUMA 4RTRA 4F04A 1BE1A 1OXTA 3A6EA 1XTVA 3R8XA 4EGQA 1H3FA 1OWOA 3CVVA 4BE7B 3E22B 1G41A 1EJ6A 4YRLA 1T91A 5K8UA 3FFXA 1VSTA 4F71A 3PXBA 1QP7A 5FOXA 3R20A 4FYJA 3V8QA 3KCNA 4UXIA 1I3KA 5I9BA 3IWCB 3EVFA 4HAXA 5ERYA 5AW5A 1N2HA 3DZCA 1VLVA 1VSUA 1LV7A 2QGNA 1DZIA 3LE8A 3F7OA 4MIKA 4HB2A 4A8HA 5E4JA 4EUHA 5JBNA 1XJWA 1YK1A 3HB9A 2VQDA 1SCQA 5JSUA 3E7XA 2YJ4A 3RV3A 1IBKB 4WCDA 2ZRBA 3MD9A 3V8PA 1RYDA 3ENZA 3PUXA 4MWDA 1MEJA 2G83A 3VNUA 3QSYA 2ONKA 4PYKA 1K8ZB 4IKEA 2VWPA 4J75A 1A8HA 2BMAA 5KNBA 4NBUA 4YWHA 2NYUA 4QJ5A 3BZBA 4O8JA 1UP6A 4W8GA 4ZQGA 1MU0A 4L3VA 3V1UA 1N5RA 2C8KA 3VTZA 3U49A 1FYXA 1FTWA 1SXIA 3R0XA 4QATA 3V00A 2Y77A 4C0BA 2JH8A 2XR1A 3S1LA 3Q6MA 4KI7A 5E9WA 1SCAA 3QEMA 1PT5A 2XRZA 2PD4A 1CZNA 1JSRA 2ZRPA 3G59A 4YYZA 1DS6A 1O0SA 3LZCA 4HGPA 5FPTA 3CRQA 3AU9A 2JAWA 5GJWC 5HM8A 2DJIA 1W2GA 1M5UA 1VMEA 4KR2A 1XEWX 3AY0A 3BGWA 3K96A 4FLFA 1COZA 3OJLA 2ZU0C 2CUKA 4OMUA 1K3TA 1U2SA 1WMDA 1ZN7A 4IBOA 4F12A 3QVKA 5DSZA 1T6XA 1HRDA 2OBLA 3AUJB 2REBA 2FKNA 3FFTA 5T8KA 4QYMA 1M2FA 1C80A 5K0BA 5REQA 4CQMD 3LDHA 4L5CA 1IM2A 3L0SA 1K6MA 4QAQA 5EIEA 1RLUA 1A04A 1WMSA 2VJMB 2ZB4A 5BN1A 2J3IA 1VJ0A 3LOQA 5SV2A 5E38A 3IA7A 3CZCA 3TZ6A 3GJZA 3K8YA 1JENB 1CTQA 1YDFA 4JQSA 1UZNA 2H16A 4FGZA 1MFZA 4INOA 4CKYA 1P4GA 4FHFA 3PHIA 5FTJA 3KJEA 4I55A 4RCZA 3U1BA 1D9XA 2HIHA 2HRQA 4RK4A 1I1OA 4QU5A 5KYWA 1GG9A 4RTMA 4AO6A 2GBCA 2ZI5A 1P5RA 4K05A 4HGNA 3LZ6A 4HS9A 5LA6A 4AK9A 2I2BA 2Q6IA 1IEWA 2P6MA 3U4IA 4DRXA 3FCAA 2LUOA 1E2KA 1U4SA 3LCRA 5JU6A 4LFBB 1Q7GA 4WX2B 2IDMA 4EKYA 2GCPA 2WRZA 2OWDA 1KNQA 1Y37A 1Y7LA 3JX9A 4MQEB 4ZJYA 3LW7A 3QVOA 4OKNA 1UJBA 3PGJA 4F8YA 1NJGA 1YDHA 3LG2A 5SY9A 2ORWA 2YVAA 4E5PA 1TRKA 4EX6A 1RXCA 2DCUA 2ILVA 2Q07A 4OK5A 1COWD 1YVEI 2LD4A 1LLCA 5E9AA 5IKXA 1AKEA 3PNQA 4DLWA 5C8XA 1UOOA 5D84A 2FN4A 3KWLA 2PUHA 2YXNA 3WDLA 4US2R 4I5GA 1GPH1 5C81A 1WF3A 3V7NA 3E1GA 3GUYA 5KZMB 2PJUA 1Z6GA 3OCYA 3QVMA 4RKEA 1Y3FE 2DQSA 2V6GA 1JRLA 1HO3A 1T9BA 2HBRA 4CKZA 4K3UA 4F5WA 2W9XA 2JJ1D 2PL5A 2RGNC 1KBZA 3CMCO 1BC5A 2YY5A 3H9GA 3H87A 4A0QA 4ZDKA 3K20A 1DRJA 1MGOA 3VNBA 3PC8A 3I42A 4NENB 5A4JA 5KHOC 1RWVA 2DPXA 4DLKA 2YIVX 2QD2A 2WLSA 3G9XA 3IH5A 4JA0A 2NU8A 2E6UX 3CKYA 4PX3A 2R87A 2H7CA 4P4GA 2ZIZA 1A9PA 2GCEA 3AYXB 3M3PA 1HE1C 1PEKE 4L7VA 2F00A 3BDVA 3AHJA 2P41A 3JVDA 1ESCA 3A1NA 4H3HB 3V3TA 2PD3A 4MKGA 3P2EA 5KYVA 2XXAB 1LDEA 3SS8A 4A03A 1AUOA 4FT2A 2YHUA 1S8FA 3A2KA 1U94A 1SC1A 2D13A 1RU3A 3I9NA 2G9NA 5IHPA 1Z15A 1ZKDA 1DO8A 2W6CX 4MPRA 3KQLA 1GA6A 2DUWA 2IU3A 5CM9C 4R3NA 5EJ8A 2RGYA 1XB2A 1M5TA 2O0LA 3FLBA 3ND6A 3P4UA 4QFMA 1TEZA 2H3HA 1OV4A 4AXXA 2WUWE 2Q1WA 1FRFS 2XI4A 1KBQA 2PV0A 4PZCA 1REQB 4Z0TA 3RHFA 6AT1A 1QF7A 2PTHA 1GGNA 4MZDA 3GC6A 5EL0A 4UVGA 2C77A 1GNTA 4RTOA 4HAVA 5KPDA 1U6JA 3N9IA 4UBJA 1RE1A 5CJJA 4RS3A 2VAMA 1AHIA 3VKFA 2PSHA 1JYEA 1M72A 3A06A 3NEJA 4G07A 4QUIA 4BWFB 1FA9A 4K46A 4J43A 4JP2A 4NX2A 4ADSG 5A4FS 4QXAA 1CFJA 2P7IA 2XB2A 3CSDA 2EL7A 5KYKA 1KMCA 3QLUA 4A0SA 2BEWA 3ABOB 3A9SA 2D00A 3TPFA 1QRSA 4DM7A 3X1WA 1KI8A 3GGGA 1QFSA 4EGSA 2R1VA 1OLUA 5DM60 1BDBA 1SPXA 1WSDA 2Q28A 4M6WB 1GAQA 2D0DA 4YDHB 3EZLA 1GAJA 2C00A 1E9BA 2OXFA 5CDFA 4EO4A 1AF7A 3OE7D 3DXFA 4K0RA 1IATA 3GFFA 4X97A 2PXAA 4A23A 4QC2A 3HKDA 5D1NA 1DV2A 3O7WA 1HSOA 4C7VA 1QQ5A 5J3JA 1Q0UA 3RG2A 2MR6A 1PBNA 2ZBPA 1B0AA 1R15A 4L4RA 1W9MA 5HFAA 1QOPB 3JQ6A 3QBEA 1ZAYA 4N6GA 4WADA 1NI3A 2C5GA 4HQNA 1FQOA 4LBVA 4N40A 3KPVA 2XDAA 3TTUA 4A16A 4RIEA 2QX4A 3UMVA 3L4EA 1A9QA 1OXMA 2IPLA 1DP4A 5EFZA 3HO6A 2VPXA 4TMYA 2O50A 2B92A 2QMHA 3F7NA 3OE5A 4Q3NA 4EKIA 1AQIA 4KU4A 2WVGA 2CLSA 4K6FA 1Z73A 3KDAA 4M1MA 4Y8VA 3TQTA 4MVJA 2F7SA 4W82A 1OB5A 1FFSA 4MJ3A 1QXSA 4LTNA 4FZ3A 4TYQA 1JDTA 3WJ7A 2G6BA 5HKKA 1VBFA 3R5FA 1B1CA 3AVVA 3BEDA 1E89A 2EF1A 2J6HA 2X2EA 1XMSA 2VJNA 1EWKA 4IX1A 1VGQA 4TMWA 1Q95A 5AXAA 3SY8A 5JEDA 4FGLA 1HZJA 2OBMA 1DSSG 1HYHA 1MJFA 1U8XX 4KLRA 4R16A 4WESA 2BL4A 2VZ8A 5KAMA 2R47A 3TNYA 3KXIA 2FFAA 4QIHA 2R3SA 4MP6A 1NKVA 4LVOA 2JI8A 5KHLB 1GAXA 1KKUA 3L0IB 8GPBA 1GZUA 1FX0B 2UUOA 3EW7A 4Y0AA 5ALYA 3ZXIA 2ZT8A 4ZRMA 4RZ3A 4WBNA 1O97C 3TM4A 3WL5A 3UT5A 4ARBA 4CLOB 4COOA 2O19A 2ZVQX 1V11B 3U3ZA 5J4VA 2XVYA 3JR7A 4IHJF 1G5QA 5H83A 3BEOA 3EP4B 3R40A 4IIEA 3TRHA 5LQAA 3D3JA 3A4LA 3GGOA 3JVEA 4PTLA 4QJ3A 1KYTA 2CWDA 2A58A 5IZCA 1RJGA 2BUAA 4YFVA 1DBQA 4EFLA 1IN5A 3KPJA 5B3JA 1U5BB 1XTJA 4HGZA 1VLQA 3V4FA 3RTEA 2VNJA 1W581 1ILEA 2E6KA 5IKPA 3GT3A 5I01A 1Q5PA 4WK0B 5C8VA 2PJRA 3RYHA 1N3YA 2Y4OA 5AUOB 3RFVA 1U28C 4WASA 3BK7A 3V97A 1DJNA 4PLYA 1MJNA 2ZSFA 5HKBA 3IR7A 1QO7A 3NHPA 3UATA 1NXWA 1IPFA 1GYRA 2OGWA 3CRVA 1X7WA 1X1RA 2JAQA 2VDPB 1K27A 3FHJA 1ISSA 1ML3A 3L92A 3Q7EA 4QO7A 3O7MA 3T4PA 5BUSA 4YRMA 2J5BA 3RIEA 3A6DA 2ZXEA 3HCDA 4LCBA 4RGVA 4UARA 3MGAA 2JGKA 4BNFA 2O8BA 4XM0A 3WFZA 1TTQB 1XSEA 3OQIB 4XLZA 1TMOA 1E1RA 2CNWA 2D1YA 2JVKA 2FR8C 2QPTA 2ZPAA 4JVMA 4Q6BA 3W2FA 1XQVA 1CQPA 1UJ5A 1G20B 2Z8ZA 3DW1X 1CUWA 3JQAD 1R6BX 1U7WA 4M0DA 4UVHA 3K0EA 1T8RA 2GHRA 1K1EA 1OHHD 4FJ1A 4TKUB 1XELA 5PNTA 3KR2A 1SHJA 5HMMA 4F8EA 5E7QA 5E0OA 3B6JA 2WWWA 2GN9A 2PXCA 3F6EX 5FX2A 1E60A 2HTEA 4AJPA 5A5GA 3PHGA 4GGOA 3PZRA 5ALRA 4KQJA 5DWVA 3I9FA 2RK3A 1XE3A 5E2IA 3TLZA 4PCLA 1XXHA 4FXOA 4JB0A 4CN8A 3NHFA 3ZDDA 4F3TA 2YY7A 2ZYVX 5EY5B 2QMOA 3DLBA 2IYPA 2Q0HA 2Q21A 4O1MA 1VJCA 2QTMA 2PN1A 3HKBA 4IL5A 1OU0A 1LSOA 4R8KA 3W6UA 2JGJA 2EFEB 3ZGOA 1C4OA 4IGFA 5JQGB 1WY7A 4CWAA 1MP0A 2O1WA 2Y1DA 1H93A 1NR5A 4PO9A 1V9SA 2IH4A 3JD2A 3UTCA 3ADDA 4C2UA 2CCGA 2VNIA 2DM6A 3DMDA 4D9MA 2VRCA 4L4UA 4ZARA 4HT3B 3FHTA 1FYEA 4TTQA 5D8DA 1JQAA 2B9VA 3HA2A 1JDUA 1H23A 2R65A 4IICA 3S5UA 3BMOA 5CXXA 2C99A 4LXIA 2CXQA 1TGVA 2C1EA 4CTMA 2ZUDA 2Y92A 3EZNA 5ALNA 5MF6A 3M4ZA 2CXXA 3R0IA 2Q0SA 2Q5IA 4I8IA 5ANRB 5JNUA 3KFVA 2GA8A 4WNAA 5ALPA 3H9BA 3OBBA 4L0QA 3C6QA 2NT4A 4UTNA 1G2IA 2FK7A 2O54A 1A9YA 1CT9A 3WYDA 3H83A 3WNVA 1IEQA 2GX6A 3MWJA 2O07A 1VSVA 5DGTA 3IEKA 4P2BA 1QFXA 1QORA 1OQAA 2C0QA 4KIFA 4OLAA 1XLVA 4ENWA 3ZWYA 4N39A 1JTVA 2XZOA 1VBKA 3GDGA 1BXRA 4P92A 1Z3CA 4DM3A 4ID9A 5FLEX 1D7AA 4HMPA 4JBHA 4PWZA 1A2QA 5A0FA 3A6PC 1WQ3A 1WDLA 1JAIA 3VC3A 3S1SA 2LP4Y 1VIDA 2AFIB 3GLHE 2V7GA 2RKWA 3A6FA 3DE1X 4HN4B 2FEWB 3VKUA 3KOZA 4GC9A 2UDPA 1EDBA 4BNWA 4WZBA 4HATA 5ADUS 3ZWOA 4DNPA 1X74A 4Q9AA 1MHMB 5LOVF 4MW0A 3D4OA 3AU8A 3UT6A 5B2FA 1DOHA 2FSFA 1NJ6A 1QSGA 2GF2A 4FZVA 3CZ9A 4WXHA 3ZE6A 1ESZA 1A9SA 1NMEA 1NONA 4JJZA 4N18A 1FNDA 4RZXA 3FAKA 4D79A 3ORHA 3S8EA 1K8XB 1W5TA 5JWRA 1U0NA 1JDVA 3IJRA 2C7RA 1I7CB 1EBBA 1VPVA 3RR2A 4BVHA 2PFSA 2ZBGA 4KW7A 1MD9A 1MTOA 5LDGA 3ICOA 5KJ1A 1G5HA 1T5DX 2BSQA 3KRTA 4C6RA 5FHRA 1C7ZA 2CFSA 4IY1A 2ZIWB 4EG6A 3Q5EA 3VR2D 4Z0HO 3QEKA 1JHUA 3U40A 5BSKA 3WGIA 1YR3A 5HIIA 1EHIA 3A28A 3IURA 5LZ9A 5LBIA 4FMPA 1G3QA 1L5KA 3UC5A 1ODFA 2FG5A 2V9CA 4QNRA 5FNZA 4HXYA 4EYGA 2ISCA 3AG6A 3H1TA 3JAKB 1SCIA 3VHLB 1NTRA 1OT3A 1YNOA 4BDTA 4N54A 1TVKA 4PZYA 4I9FA 3F3KA 3CW8X 2QUJA 4B79A 3DOOA 3VO8A 3YASA 4N5LA 4BNMA 4L3WA 2OSBA 3ENWA 4S05A 1AT1A 1U7PA 4HUQB 4ZIRB 3DMTC 2ANCA 4G2TA 1DZ3A 2QLBA 3L3BA 1CUJA 2Z9DA 2LGJA 1P1CA 2BDTA 5DI3A 5K3FA 3DMNA 2PRSA 1IYZA 2R8PA 3I28A 1VLJA 2WIKA 3AB8A 1F2UA 1W4ZA 2GEJA 1XIVA 3KU1A 4GVPA 5FOWA 1K97A 2AQ8A 4S1VA 1ZNWA 1MX9A 4HQOA 4XQEA 5EZYA 3NWOA 3SR0A 3ZLUA 4Z9FA 4E0BA 5L7WA 4ESOA 2JFQA 3W1VA 2F1OA 3KVNA 3AH8A 3GK3A 4G1BA 4UW9A 3T7DA 2A1TR 2C42A 4UZEA 3T7SA 2JJ2D 1UL1X 2GKOA 1V3QE 1K88A 4AMUA 1DC3A 1IB6A 2WPDA 4G1VA 5IU6A 3CHYA 3N05A 5TLSA 2GHQA 3F8TA 1A4RA 1H0KA 2CNNA 2YMLA 2HO5A 1LJ8A 1ZQ9A 3FMFA 2MINA 5KVAA 2ACEA 4HB3A 2QLMA 4N3AA 5U9CA 5I7SA 1L8QA 1FXSA 3ELBA 4XPZA 2WW8A 2MCFA 4YMHA 2PFGA 3CF0A 2R84A 4UQOA 4ZV7A 3MILA 1DEAA 5B5SA 5JD6A 3TLJA 3AKZA 4BKOA 3HA5A 3TRDA 2DU8A 4LYYA 5FOVA 4ZOQI 4HGRA 1LSSA 4M1TA 3I61A 1A5BB 1RWMA 2O9JA 2VK4A 3A10A 5GVSA 3PUKA 1T1RA 1W36B 3AW8A 1M6YA 1R3UA 2J85A 2OILA 3BD6A 3QFFA 1C1XB 1M54A 3FDIA 4IFTA 3FZNA 1F2VA 3QGMA 3D3WB 4MQ6A 1IOLA 3UCFA 1KARA 4B3CA 4NCIA 3IEMA 2TSYB 4GXNA 4LUCA 1EWQA 4M36A 3L9XA 3ADKA 3E3NA 4BMVA 3L5KA 3O2QB 4K9LA 5G0WA 3DFMA 2NO9A 4DV5B 2GZ3A 3Q10A 3B3QA 4O3FA 3LHSA 1ODKA 3K4QA 5JC1A 2QRVB 4PIMA 4RANA 2Z9CA 5FR2A 1YS9A 4PQRA 2OZLA 5L4LA 1OXBB 1T9KA 5K0NA 1GWNA 4BMSA 3L8YA 4MQFB 3QF7A 1HKUA 5GP1A 3RHSA 4QJ4A 3EXFB 5EUCA 5K5EA 4MDFA 1YZKA 2W11A 3ZKWA 1LLUA 3VVMA 5BVGA 3U6BA 3SCZA 1JAHA 2GFIA 3KKOA 3SJZA 2BDEA 1PT6A 3GFRA 5BV1A 1EFCA 5KCMA 1KDPA 4TMVA 4OQMA 1P60A 2VN8A 2G76A 5IKOA 3B89A 1ABFA 2JIZA 1CBUA 1MVLA 4Q47A 4Q3DA 5LP6A 1RYHA 2QTGA 2H1IA 3L0PA 3O95A 4LHWA 4U4AA 5JSHA 3K1AB 3H3JA 1PJTA 3O9VA 2AKEA 2OUKA 4RVCA 1IUNA 2LCFA 2AYYA 1UDRA 1YJ5A 2WNSA 2XUKA 3CZ5A 4DDUA 2FEAA 1F6DA 2J09A 5DISB 4OX9Y 4CV2A 4P98A 2ZTVA 4O29A 3HGTA 5A6SA 2CBZA 2RBGA 4EVRA 2QD1A 2K4MA 2VHJA 4R9NA 3V1TC 1GG8A 2CLCX 4FMDB 5EFOA 4WXEA 4EL5A 1GQSA 2QX8A 2R1TB 4MK4A 3T12A 4AQDA 1NPDA 3IUJA 2GZ2A 4FGWA 4XWAA 6REQB 2ZTMA 2X41A 3DF7A 3KOYA 1AUPA 1KU6A 3L1IA 2PUJA 3NVMB 3LY9A 4JUCA 4LMRA 4PRZA 4YUVA 5TQVA 2ZRAA 2TECE 3RK0A 5J4KA 4I99A 1A5AB 1SOMA 3JV7A 1QDEA 2NAPA 2V3WA 3UHAA 2GXUA 3HUEA 4E31A 3TM5A 1XAGA 2MYTA 3A0UA 3TN7A 3UJBA 1U9ZA 1DINA 3VNRA 1I5EA 5I4BA 5KWSA 1LH0A 4HDRB 4D4HA 7YASA 3NQ41 3AVPA 1SGWA 2HHAA 1Y89A 3WB9A 1RT9A 2WT4A 5H4HA 3RVSA 1QC5A 4GD3Q 1IHDA 4IIDA 4PPNA 1FVOA 4AW9A 2ZDQA 3FJYA 3BSSA 3HP1A 1X6VA 1DIRA 4MKRA 4V0MA 2O8EB 1FYVA 1ZD1A 3AR5A 4IDEA 3OFNA 3KZXA 2PSFA 5EJGA 1RIIA 3TEFA 1U6IA 3JD4A 3JVUA 5BR1A 4I4LA 5TSDA 4QFCA 3RSFA 3VJLA 4AZ3A 1TKRA 2GSWA 1JI3A 3A6LA 5BWLA 2FR1A 4L28A 4RCYA 5AO9A 5F3WB 2GBIA 2DSNA 4OYYA 5EZ5A 4LXTA 2V0CA 4ETMA 1VL2A 2FNAA 2XMPA 4CLEA 1CPYA 4AJEA 3DC2A 2AOVA 3Q0TA 2R0QC 2UXDB 2B1RA 2ZXUA 4TWRA 3BJRA 2YNMA 4Q03A 5CLJA 1C41A 4JL6A 1XC7A 4LQLA 1I0ZA 4YRNA 4FZRA 3BMNA 4OGFA 2XJ9A 3EFEA 1XJ5A 3SD7A 3BIOA 3DCNA 1FFGA 3WYNA 3G02A 3TTTA 1JEEA 5DM70 1I8TA 1S8NA 3PFHA 4UJ3A 3I5XA 1GVHA 4CMKA 1NLMA 3RC9A 2XYQA 4BAUA 3G13A 4XUEA 1MIOB 1NDHA 1N7GA 2V55B 3GHYA 1W4LA 4HX2A 4M0MA 3HZZA 4TM7A 5AW9A 2OV8A 2I91A 5JMWA 4HAUA 1OJLA 2ODQA 3MG9A 1FW8A 1ACLA 4UZSA 4X8OA 2BTQA 2ZVJA 1L4HA 2Z1DA 4CKBB 3BMCB 4GI7A 2QVYX 4W1QA 3CNEA 4TV8B 5LMUB 2OD7A 5DTQA 2P67A 2W2MA 1RQGA 3GFSA 3UGJA 1EUQA 4D9KA 2ZYAA 1XZPA 1Z22A 5CHEA 4Q3BA 5JAHA 3HZOA 1IXRC 1H1DA 4IV5A 2R8OA 4IJUA 1H5NA 2GCNA 4LZLA 4ZAZA 2XQGA 2QSYA 2ZIXB 3STTA 2M6RA 1XTBA 4HGOA 1GT91 3B2EA 1N0VC 1PRYA 4IIHA 1KIFA 4NH4A 1Q7RA 2CVFA 4J49A 4U00A 2F1JA 5FFFA 3T5DA 4JBWA 4A82A 5DH9A 3UZUA 5TRTA 5ILQA 2FN8A 4FWTA 1HRKA 1L4FA 1CDZA 1O77A 4B7AA 4N41A 3GRUA 1P33A 3KEMA 3N0TA 2FTKE 1M7HA 2VBCA 1G6OA 1JTEA 4QFDA 1WXHA 3AZOA 3E9MA 4KFCA 1HH4A 1P29A 3EFBA 3IFSA 1Z0SA 4H16A 4PICA 4ROSA 5C32A 5IANA 2O5VA 4YLYA 1EHCA 1VA4A 1RCTE 2B8WA 3DMHA 5IW8A 4DLZA 3PTZA 4XVCA 4OHKA 5AVZA 2J3DA 4CMHA 1XNJA 4TS3A 3TCKA 3CH7A 3P9NA 1PKXA 3M9XA 3D8SA 1E9EA 3TZBA 4YMGA 4RTQA 1W94A 3R8FA 1X9IA 1YB7A 4UBNA 4AKSA 1O0CA 2FKAA 4C08A 4CHTA 5DWDA 2OGSA 1W76A 2P35A 4J0QA 4UXJA 2ZBVA 4YMVA 1L1EA 2Y71A 1KZHA 1KIAA 2Z0MA 1CEYA 2IS4A 1JJVA 2JLAA 4Y1EA 3CX4A 2QLJA 5EIBD 1JW9B 3QXSA 1Z82A 4LDQA 4QOEA 4YRPA 4FP9A 3OCZA 1G8KA 3DVLA 5ABPA 2Q5CA 5EJ7A 2OT3B 3ENNA 2QB5A 3P2OA 5IK2A 3VNSA 1W96A 3DOCA 3DZ6B 5EHIA 2I5PO 1LDYA 5AKEA 3ZZ0A 1F6WA 4IDBA 4RF2A 2CDRA 4S04A 4M89A 4CKEB 3PJFA 1AX9A 5HS4A 4BNZA 4X00A 3L7MA 2BP7A 2R5NA 2A7XA 1W8DA 2K2QB 1EPUA 3ISJA 4ZCTA 3AINA 4KLZA 1SIUA 1L4UA 1NI4B 3VR5A 5B4TA 1FMTA 2O48X 2C5EA 3PYMA 1KY5A 1JIIA 1W19A 4X3PA 1P19A 4WZAB 3TLMA 3TOVA 1WETA 3H1BA 3NAZA 5L95A 1TUEA 3KUKA 1I1HA 5LMNB 5EPUA 2HLNA 1DXOA 2NUBA 4F6RA 2FPSA 4XVHA 3PUIA 3EIQA 3SQMA 4C20A 1D5WA 1NRXA 2J5RA 2XGGA 3QQ5A 3M70A 3W6PA 2JLSA 1OGJA 2ZU6A 2IA5A 1YH3A 3E53A 2K5UA 4RTSA 4B5LA 5HF5A 4MQMA 1W4AA 4ECAA 2ONZA 4RETA 4BQFA 1QIFA 5FBQB 1S2GA 1L8OA 4DL9A 5BSUA 4ETNA 3IPAA 3JQDA 3RREA 1E3WB 1R6UA 3K9WA 4G0VA 5K4GA 4YK7A 4CM1A 1A76A 1C7FA 1HQCA 1K2WA 3MFYA 1EVLA 3I8SA 5EE3A 4B8YA 2JIPA 1KI4A 3ADCA 3G8BA 2B8JA 2E5LB 3JATB 3WRXC 5JD3A 4E2YA 1CY8A 2ZYHA 3JARB 2A3RA 3EGXB 3K72B 2O2YA 1V3UA 3FVTA 4L8GA 4OAPA 2ZRNA 2XMBA 3AR6A 2F9MA 3C8UA 9GPBA 1GNRA 2NO0A 1Y81A 1Q22A 3LDGA 3TIXB 2I2AA 3GRRA 4LRSB 1ZFNA 2R1UA 3N2GB 4JQYA 3OEHA 2FSPA 4HSEA 1Q2UA 2EWVA 3MLBA 1L3IA 4MVJD 4HQFA 2PZAA 4BO2A 1BDJA 1T0JB 4AULA 3BB4A 5DHUA 5BSMA 1CVIA 4TV9F 1VE9A 1PFYA 3FPGA 3GVPA 5DNAA 3VJMA 4E70A 2OLEA 4BFVA 3BGDA 3QP9A 1K7EB 2IHVA 2XIJA 4QWMA 4Q0MA 3IESA 4XWOA 2WMDA 3RF6A 2HSEA 3TGWA 3QI2A 2QRUA 1XZCA 3MCUA 3GT4A 2Z2JA 4RXTA 5COAA 3IIEA 4D6XA 1A8QA 1XFAA 2YXLA 1LK5A 4QX6A 2JARA 3DBLB 4L73A 5A3SA 2B35A 2Z9BA 3MBIA 4PSUA 4YLEA 2GBLA 1G8YA 3AF4A 4Y2RA 3PRJA 1V5FA 1KEUA 1L5OA 2FZKA 2GN6A 4P5PA 2P5SA 4MS1A 3A9WA 3D7MA 1O6GA 4LQDA 2YMQA 4LISA 3WR5A 1U2QA 4U3JA 3SM9A 4BLWA 1Y5IA 2HSWA 4R6XA 4BO3A 2VHZA 5T7BA 5H8WA 2VP2A 2BMVA 2IEDA 2VRWA 4MLCA 4FXPA 1EFLA 4TXMA 2WTUA 1G1AA 5D3ZA 3OQPA 5KWIA 4PGMA 1Q0TA 5KMGA 1E5LA 1UBUS 2HF7A 2Z98A 5TNXA 4JHXA 3L9WA 3FTPA 2OO5C 5HUJA 4IH1A 2J0QA 3EYAA 1XZHA 1TMGE 1JEAA 1FNCA 2B99A 1QUEA 4AT1A 3K4HA 1WV0A 1L4KA 5AXDA 3WV5A 1XMVA 1AUVA 1ENOA 1M2VB 2NXWA 3D6UA 4O33A 4QD3A 1APBA 4LRYA 2HB6A 4KLNA 4P33A 3DR3A 1QCYA 3A05A 4OJKA 4HLUA 3VPFA 4A8PA 5FFMA 1VB5A 4R68A 4C4SA 1FMFA 1Z56C 1VC2A 3GD7A 4TOIA 4IS2A 1XEXB 3OZXA 5E7MA 2YHBA 2BT4A 5EWMA 3HADA 3RVJA 2OHHA 1DAHA 1N6KA 5F78A 2XUFA 3LWBA 1LS6A 2J87A 1QMPA 5KTPA 4H3KB 3IQHX 2EKBA 2OB1A 2R25B 2CNWD 1E1RD 3LGXA 4DQVA 2W8BB 1NXQA 4H4CA 5JCXA 1B8NA 1YDMA 3TE7A 1C7QA 3G0BA 1MB4A 3E22A 1CS4C 1SVLA 3P2YA 4HFMA 1PK9A 4JLUA 4H7FA 3NBQA 2NUAB 1QYXA 4V0LA 3F97A 3GJYA 3O3CA 3JQ7A 3WGOA 5I9TA 4IRXA 1D6JA 1R8SA 1Q3KA 2ZJ6A 3IT2A 1AGXA 1OC4A 3GEEA 4GYWA 2OORC 4MWOA 4QQ8A 4XFJA 4JI6B 3HZHA 3UV7A 4C0AC 3V1MA 3CUYA 1N32B 2VRNA 1KH1A 2GM3A 2H51A 3NEAA 1XF1A 2D1QA 3UWDA 2W7TA 3D1JA 4G4SO 4IRMA 5FH9A 4ZI2A 1IIBA 1K8QA 2IS2A 4IV8A 4W5RA 4EK9A 2ETXA 4GZ6A 4QPZA 5DSXA 1HOXA 4KIUA 1XQXA 3TZEA 4EJMA 3MJ4A 1Z18A 3BAFA 3KYDB 5ALLA 2R2GA 3FH0A 4P3YA 1WW2A 3CF4A 4QRIA 1LRJA 5AI8A 5DX8A 3PR2B 5C34B 1XKQA 1H6CA 3DE7X 3TR6A 4TRRA 4HGYA 3RAPR 3K09A 4MI3A 4D46A 1P31A 1VSBA 1NVWQ 3ZJ4A 5MHTA 2QXUA 3B5IA 4FYMA 2VRCD 3VDNB 1UP4A 1H2BA 1AZTA 1QYWA 2Q7OE 3MTGA 1K5GA 4NMMA 4D44A 2QAGC 1L7XA 3Q9NA 2HFJA 1T43A 2BCEA 2ZG6A 5A5FA 8MHTA 4LFCB 5CNIA 3QVJA 2VHUA 4B4OA 2PUCA 5K05A 2ZTLA 3CRW1 4M76B 1B76A 3RGWS 3G1WA 2I3DA 4R1PA 3JYHA 3IPYA 1GKYA 1RRKA 1VM6A 1YFZA 2PHZA 3DBHB 3SXUB 3DZJA 4M0FA 2WSIA 3GH3A 3O8QB 4OOFA 2D2XA 1E79A 2FX3A 2ZJFA 3U4GA 3UMMA 5FOSA 1S02A 4IXDA 4L50A 4S35A 4N5NA 4Z0NA 1BOOA 1B7GO 4Q4CA 4EY3A 1E4EA 4MJ7A 1I4WA 2N3ZA 1EP9A 4Q34A 4BDSA 3UAYA 4EKGA 5B7NA 3DA8A 5A3QA 1PGJA 1N4DA 1EUCB 1NVFA 2IOFK 1FVXA 4BVGA 2B6NA 2IYVA 4YUWA 4R4JA 3GNLA 1O94A 2FPOA 1RR6A 3GQVA 3IAHA 1JIJA 3KQMA 5KWJA 4OV6B 1NC1A 5LXTB 4TMXA 2EKLA 5G41A 6NULA 2ZSUA 4ZKDA 3EEFA 3RVLA 2QLNA 2V3VA 4EI2A 1DEHA 4TWJA 4BCBA 1DCMA 3ZQJA 4G85A 3WAGA 1LDNA 3H16A 1TK2A 3L5OA 2PGXA 3C3EA 1VOTA 4ND6A 4NCXA 2FN7A 4X20A 5LYYA 3CO0S 2NU9B 2E4YA 1WXFA 3CEHA 2AW5A 4QBTA 4QOJA 3ZDYB 5C35A 4OBWA 2PKQP 2C7GA 2ZAGA 3A6ZA 4URXR 4FONA 3P9XA 4TKZA 4IUYA 1XZQA 4E12A 4PINA 4MW2A 1YOVA 1CDOA 5BVHB 3GFGA 5L8VA 3JD0A 3T95A 1GLGA 1TDJA 3V55A 2HUNA 1IZZA 4BN4A 3TB4A 3PTLA 1NNUA 2PK3A 2Q2WA 4HXEB 4PYQA 1FLAA 3PIDA 4BX0A 2VAWA 3LQKA 4Y67A 2PA3A 3LPDA 4EI7A 3VZCA 1IN6A 4CDGA 2AUMA 1LPSA 3W8DA 1MOQA 3WI7A 3FGZA 3L7YA 2AUTA 2COKA 1E2UA 3A1SA 3EMVA 2DKNA 4YRBA 1NNEA 3S8MA 1NAIA 4Z7OB 3O8RA 5AKZA 3K0AA 4MUYA 3NBKA 1G64A 1WULS 2VCEA 3PQ3A 1DRUA 2WV9A 3B7PA 3IIKA 4P32A 5HF8A 4EVSA 5AVRA 1PLLA 3LYAA 3COYA 3ZTTA 3LPAA 3VSDA 1G8PA 4B3BA 1M6HA 1NM5A 1K75A 2C2WA 2JASA 3KPYA 5GM2A 3TW8A 2C61A 4KEAA 2XKBA 3CG4A 1T0IA 2F9FA 2WYVA 3WB2A 1N57A 1VCNA 2C5BA 2C7VA 2C4TA 3ICVA 3ILSA 1KYIA 5DNEA 2FW1A 5I45A 3W5BA 2ODEA 3JQCA 1JFFA 1NUTA 2AJDA 1SG6A 4M83A 4XB1A 1V47A 2WG1A 5DWQA 1C0EA 2EW2A 2I6UA 1DV1A 1Y42X 1A50B 1GIAA 1M66A 2EYUA 1YAHA 3EPRA 2HKIA 3PQCA 3THRA 1JZTA 2QY9A 1JA9A 1E6LA 4Q18A 1G8JA 1KQ3A 2W71A 3EG5A 1WV1A 3JZDA 4H77A 1RRGA 1GA1A 1XZJA 2OZEA 4IZHA 4P5DA 4Z86A 4A6DA 4DXHA 3L7OA 3O91A 3O4FA 4IDAA 1HR0B 4A1OA 4C0QC 3NAGA 5F5XA 1PQPA 4Z0PA 2ZUVA 3QXGA 3C6ZA 4AKIA 4DLRA 3LQYA 3TLXA 4F5DA 2ODWA 4XIFA 4C0KA 2QN3A 3MTEA 2J9GA 3WQSB 2IYXA 2OECA 2E55A 1LKZA 2IU4A 2BY4A 1FFCA 2FZLA 5DBFA 2C4VA 2WPDD 3GWZA 4A0HA 1LF0A 1NSTA 2AR0A 2ZSDA 3R2JA 1W0JA 4DIDA 3F5DA 1RYZA 3O1LA 3O5AA 3EGDB 3ST7A 1P6XA 2PBZA 3QJ5A 3T1OA 2JFUA 1EFRA 1UODA 1JDSA 3JSXA 4M1WA 3TFQA 3A70A 4DPMA 4DZZA 2X23A 3RS7A 3FRJA 1Z0KA