4YWJA

Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
b'MRRIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNLCLKLLDTAARVLGDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALWLEGKENGLYDMQDVLGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
publication title Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) from Pseudomonas aeruginosa
rcsb
total genus 79
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ywjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ywjA01
1BDBA 2EIHA 2OMEA 1NYTA 1YH3A 2D4AA 4CM3A 5C3MA 3JQBC 3I4FA 3OJLA 3AFNA 3Q2KA 3GNTA 4CMKA 1EEHA 4UVGA 5A9SA 5L51A 1IL0A 2PD6A 1PSDA 1GPJA 2X5JO 3MJVA 4BKQA 5AQ1A 3EY4A 1KS9A 3ZDFA 2G82A 5DCWA 1A4UA 5F1PA 4WECA 2VWHA 5DULA 4HFNA 3NKLA 4BGEA 9LDBA 1K6IA 1KOLA 1CRWG 1F8GA 4ZA2A 2H9IA 2HLPA 1PS0A 4XYEA 3TOXA 4Q9NA 1XQ1A 3UICA 4J1SA 3T4EA 3K31A 2OXIA 3UN1A 3ZHXA 1VL0A 1GZ4A 3LC1O 3ANMA 4C4OA 3HFGA 5JNLA 1J6UA 2C2YA 3IL2A 3WJ7A 3FPLA 4DTIA 1WZEA 3S2IA 4DMMA 3JSAA 3CUKA 3PJDA 4I9NA 3VZPA 1AHHA 5C7OO 3QQPA 1J4AA 3WJAA 5CDYA 3GRKA 1OAAA 2Q1UA 4E5YA 2NQTA 3ITKA 4YAIA 3L0DA 1BVUA 3NX4A 3NAQA 3VOSA 3AUAA 3RIHA 3TWOA 1JQBA 3HN2A 2JAHA 4Z9XA 5TX7A 1XKQA 3ZHBA 4XR9A 1XEAA 1RM3A 4NI5A 1U4SA 3DL2A 1BGVA 2PY6A 1KVRA 3W8FA 2VRCA 2O3UA 1IULA 2R6JA 4BQRA 2QG4A 2E82A 5CPFA 1ZK2A 3GG2A 5EESA 2W8ZA 4H7PA 1V35A 3ZWYA 1HWYA 5JMPA 3JQ9C 4GWKA 1DC6A 3C24A 4FFNA 3ZWOA 4ALKA 1E1LA 4BNNA 3GNSA 4UUOA 3BZUA 1QYVA 4CQLA 2P9EA 3HDHA 1MX3A 4GSKA 2ZKLA 4A27A 2HU2A 3HFSA 3UAGA 3PLRA 1QORA 2GSDA 4NJOA 2PD3A 5K0ZA 1V0JA 3Q0EA 2FP4A 4Q3CA 2DBRA 4CQLB 3JYNA 4E30A 3RD5A 4MVJF 4L75A 1B8PA 3H4VA 3ZWWA 4DLLA 1ONPA 1R66A 4DPMA 4RCVA 3PHHA 3RUIA 2O3TA 3NDJA 1BW9B 1CJCA 1YOVA 4Y8VA 4CR7A 2FSVA 4Z0TA 4J1TA 4CM7A 4XA8A 3IMFA 4YWJA 1EFLA 4J4TA 1PGOA 5JYEA 4TZKA 3ONDA 5A5EA 4MKZA 1E3IA 3QV1A 4R4JA 4BHTA 4EYEA 1U3UA 3CZRA 2NV6A 5IDXA 5HTOA 4D79A 1FK8A 3TF5A 3IC5A 1Y9AA 4OQZA 4BO5A 3DBVO 5FEUA 1WP4A 3AI3A 1R4MA 5EL0A 1ZK1A 1LA2A 2I3GA 2CZCA 3DBHA 4GAEA 4CM8B 2Y68A 4IQ8A 3WGQA 1Z75A 3RC1A 1DFGA 1YKFA 2UDPA 1FDWA 1F12A 4ALLA 5TLSA 5BR7A 1R4MB 3SVTA 3DTYA 3X2FA 2P5UA 4QSMA 5B4UA 1LQUA 4Z3KA 2O2YA 1P1IA 1K2WA 4TSKA 4JXKA 3D3EA 4XYLA 3LC2O 2HK8A 1LQTA 1WNTA 4CM9D 2CDAA 4HFMA 3JQ7A 4CODB 4CM4A 1NPDA 2WD7B 3QWHA 2CVOA 3ZGYA 3KYCB 3KXDA 1WZIA 5COBA 1IY8A 1N7HA 3RU9A 3JV7A 3UCXA 4EITA 5TT1A 5H81A 1WXDA 1TA4A 4E32A 2B4RO 5I7FA 4ALNA 3HDQA 2D5CA 1P9LA 5EERA 4FJ1A 2G1UA 3RASA 4AJ2A 4DQXA 1DIRA 3F1LA 3RUCA 5L53A 4BO6A 4PVDA 4QUKA 1LRLA 3FI9A 5F5NA 3QVXA 1BSVA 1QLHA 4WCFB 3SC4A 1XA0A 2CY0A 1VC2A 4U6QA 4BNHA 4CM6A 5JCJA 1I3MA 1KEVA 4H3VA 3WBFA 1JKJA 3ROKA 2J5RA 3GR6A 3ZV5A 3RKUA 3CMMA 4DQVA 1B2LA 3OEWA 4M1QA 1LJ8A 1VL8A 4R69A 1UXHA 4CV3A 5L9AA 4YJGB 3E48A 1XIVA 5A9TA 2OBYA 1KBZA 2VCYA 4D46A 2YV2A 1KC3A 2JKVA 3O26A 1GPDG 2EXXA 1I2BA 1ZK4A 4W9NC 1N9GA 1Y6JA 2FR0A 4AJKA 4BO4A 4E2ZA 1HSOA 3HG7A 4XCVA 5G0TA 2CF6A 3WGOA 3QW2A 2E37A 5KIAA 4HWKA 4NU5A 2DPHA 3PK0A 4MP8A 4XEHA 1GCUA 4Z0HO 3JQBA 4ILKA 2O4UX 4R01A 3KLPX 3NTRA 4DREA 4CLDA 3QWBA 2GZ3A 2YW9A 2ZYGA 3CE6A 1JAYA 3H2ZA 4R3WA 1SMKA 3HB4X 4B79A 2IZ1A 4G5HA 4J7CA 3VH3A 1YVEI 4RZHA 3FBGA 5CHEA 2EJVA 4YACA 4R9RA 4Z3DA 2DC1A 2VWQA 3KZVA 4MVJD 4CMIB 3GG9A 1X7DA 1OI7A 3NEPX 3D1LA 1C0LA 4ZGWA 1LLQA 1HYGA 2QW8A 5DBIA 4XYBA 3GDOA 1DJNA 5KJCA 3IP3A 1G6KA 3AY3A 5DP1A 2BELA 3D5QA 3ZWNA 2P4QA 3RJ9A 2ZYAA 3O03A 1T2FA 1ISMA 4NJMA 3IOYA 1X15A 2E6UX 2DBZA 4NU6A 5IN4A 4U7WA 1N8KA 5EINA 1YRLA 3ST7A 3BTSA 4D3FA 1XG5A 4B7UA 1HZJA 4F45A 3U09A 4CMGA 4NJMB 4YAJA 2DFDA 2X9VA 4YCAA 2R00A 5C37A 4J91A 1LDGA 1T1RA 1VRWA 3WLEA 4UUPA 1B26A 4IMRA 3G79A 5IZCA 4JBIA 5KVQA 2C29D 2IEDA 3JQAA 4XKJA 1NR7A 4DLAA 5U1PA 3OIGA 5JDIA 1QXSA 4RV9A 4WLUA 3DR3A 4KTTE 4LVUA 5I7SA 1MXHA 5F21A 5ER6A 3DZIA 1GEGA 1DBVO 4RVUA 5MDHA 3OEYA 2CDCA 1LLCA 4M54A 2J3KA 2D0IA 3F5QA 4M86A 3VAZA 2VRBA 4UEKA 4YQYA 4EJ0A 1T26A 3PGXA 1Z82A 5GY7A 5IN5A 3BIOA 2Y66A 4I5DA 1U7HA 2Q22A 1H5QA 4OQYA 1HEUA 3H3JA 2EGHA 4YRDA 1IHXA 3S2FA 2BFPA 2C59A 2X4GA 3GGOA 3AUSA 2ZYDA 5A03A 1HRDA 4OJNA 4RORA 3GK3A 4AJ1A 4IJUA 3LSYA 2I9PA 3HNPA 1EZ4A 3ZNQA 1P3DA 2WM3A 1LLUA 1O89A 2PH3A 2A35A 5KNLA 3JD4A 1BWSA 4MJLA 1ZEMA 3HADA 1O9BA 1VE9A 4AJHA 4FS3A 4QO8A 1FMCA 3TN7A 3DZFA 2OO5A 2NM0A 2UVDA 3WFJA 3E8XA 3DZGA 1UH5A 4FN4A 1SPXA 3GDFA 3PJGA 1YL6A 5DCYA 4DRYA 1UP6A 5T5QA 1BHSA 1MUUA 1Y8QA 3RFTA 1BXGA 3DAGA 4ONEA 3COSA 4CLRB 1B14A 1BXKA 4GX2A 1DDOA 3RBVA 3NGLA 1EE9A 1SNYA 5H83A 2NTJA 1Y8QB 3RUHA 3WS7A 3JQ8A 3RC2A 1KETA 3P7MA 4CUZA 2EWMA 1LU9A 1PJTA 1PJ2A 5FFFA 3BMOA 5JY1A 3CH6A 5DP2A 2CMDA 1DHRA 1QMGA 2ZIZA 3A4VA 3ETDA 1H6DA 4XDZA 3OP4A 1XELA 4UULA 3DTTA 3IKVA 1HDGO 2HK9A 3KOUA 5JLAA 1DFIA 1MXFA 1SCUA 4YT5A 4L74A 4J4BA 3FTNA 1O95A 2X9NA 2Y0EA 3ZI0A 3UOGA 1KEUA 1E7RA 4Q3AA 1N9GB 1KY5A 2TMGA 1F17A 1A9ZA 3ZWCA 3QHAA 1LC0A 4B8ZA 4RGBA 1E1KA 2C2XA 1KY4A 2W2LA 3NJ8A 1NVTA 2B5VA 2V65A 1EVYA 2PKRA 1HDYA 3I1JA 3JQFA 4EI2A 3GN1A 4B4VA 1B15A 1VPDA 3ZW9A 4PN3A 2X7HA 2D3TA 3PHLA 3I4CA 1DSSG 4IPTA 5TJ9A 5KVVA 3P19A 4L73A 4J16A 1A9YA 1H2BA 3EC7A 4N54A 2GUGA 2W2KB 3GNQA 2OHXA 3V1UA 2VHVA 3PQEA 1YBAA 4BGUA 2PH5A 3WGHA 4IQGA 3DAPA 3OETA 3BA1A 1RKXA 4FC6A 1KVUA 3CIFA 4BO3A 3FF4A 3TL2A 4JK3A 2B5WA 5FF9A 3QSGA 3DDNA 1NAHA 2WJPA 4KDFA 3RU7A 3SEFA 4PG8A 3DQPA 4D0SA 3PDUA 1TT5B 2VT2A 2GZ1A 3DHNA 4NK5A 3E9QA 1LXCA 2BI7A 4DUPA 1E7MA 1UDBA 4NBUA 5FYDA 1YWGO 5KVCA 1GUZA 1B3BA 2DFVA 1TT5A 3CKYA 5JAQA 5GZ3A 1JN0A 5BSHA 3ZU3A 4M87A 1EDZA 3JQ9A 4CLXA 5CDUA 1U3WA 5THKA 4TVOA 3TZ6A 4YDRA 4GL4A 5EIOA 2YUTA 3U62A 2WYVA 4D41A 2PZLA 2JFHA 1PS8A 4ZD6A 4CLHA 1FF9A 2RHCA 3GVIA 1SB9A 5CAEA 4PRKA 1LSSA 2DPGA 2NTNA 3RFVA 2PKQO 2PGLA 5L4NA 1LDEA 3OJEA 2H63A 4KWIA 3FR7A 3TPCA 2B36A 5KKCA 3ABIA 5JC1A 1JKFA 1R4NA 2HMVA 4E2XA 2IE0A 4HBGA 4OM8A 4R41A 1E3SA 1BMDA 1GQYA 3LU1A 1F06A 4WLNA 1V6AA 3DZKA 3TFOA 2JD0A 4IMPA 4S3MA 1XU9A 4I5GA 4ZQBA 1Y1PA 3G0OA 4HP8A 1YL5A 3QJ5A 4RPJA 1PR3A 3WYCA 3OJFA 4ZQFA 1EVZA 4BO1A 2Y1EA 3GZNA 1ULUA 4M89A 5AXDA 5JBIA 4IS2A 3QVSA 4CV0A 2ZATA 5F1KA 5JAMA 4B7CA 1F0YA 3ZHZA 3W6ZA 3A14A 3G1TA 1DPGA 2AHRA 5K6AA 1C1XB 3K8ZA 4PLHA 4EUHA 2VNSA 2ZCVA 4CUKA 2IZZA 4N5NA 2RIRA 1J0XO 1OC4A 1BRMA 1LDNA 4QXMA 1T2AA 2XAAA 5KTKA 2EF1A 4LW8A 4EUFA 5EMHA 1QV7A 3GVHA 4D7AA 1BXZA 2GN9A 1QG6A 3WXBA 4PLFA 4MVJA 2Y67A 1K3TA 4CQMA 3VTZA 4BB6A 3DAFA 1U8FO 1NHGA 2ZQYA 5JAIA 1OBFO 4JLWA 5LDHA 2Q4BA 2Y1FA 4KZPA 4PZCA 3ZNNA 1BDMA 3DFUA 2XOXA 1GEEA 4UAGA 1FDSA 1Y81A 3ADOA 4K28A 2FR1A 5ICMA 2CFCA 4YJHA 3VPFA 5B1YA 2O48X 3OFSA 2LDBA 1MG5A 3EGOA 3AM5A 3OJ0A 1XHLA 1SO8A 2YHUA 3WR5A 3JQDA 4GI2A 3WGZA 4NHEA 4G2NA 4U5QA 5IXSA 3ZWXA 4FJ2A 2IYOA 2VUSA 2IZ0A 4Y6RA 5C7IO 5HWSA 4OYRA 4IIVA 1JDJA 4CV1A 2EJWA 1M6HA 4B3JA 3H6KA 1TLTA 5TQVA 4PLPA 3PRJA 3PP8A 4R68A 3IQDB 5T6BA 4CLOA 1EVJA 4HUJA 2EERA 1NQOA 3OA2A 3B1KA 1SOWA 1I0ZA 4EJ6A 2FPGA 4YTEA 2UV8A 4CL3A 2I76A 1HYHA 4CMJA 3ZWVA 1PU2A 1PIWA 2EP7A 2BMAA 1M66A 2VHWA 1HF3A 3P5SA 4MIYA 3A1NA 4GMGA 1ZCJA 3TL3A 4YBZA 1NBOA 4W4TA 3O9ZA 1U9JA 4F46A 2PGDA 4NR0A 3U4HA 1LX6A 1DXYA 2GN6A 1WVGA 1M67A 3QY9A 1LEHA 1QSGA 4WOJA 4HX5A 5L4LA 1Q7GA 2EKPA 4GWGA 4H16A 3PJFA 4UUMA 5KJEA 3JTMA 4I9HA 4BNKA 4IGFA 1I32A 2FZWA 1PL7A 4BQPA 2F00A 1DAPA 3BYZA 3NDRA 2HMWA 3QRWA 1YS4A 4DIFA 3E5RA 1DIAA 1U5AA 1YB4A 3ZW8A 3KSUA 4YJFA 4BO8A 4JJGA 2OBNA 1I5RA 3AK4A 5JXWA 1P0CA 3C1AA 4YT4A 4RQUA 5C5IA 1YQDA 1DLJA 2X0NA 2HRZA 5AOVA 2B4TO 3AI1A 3ROQA 5HM8A 3D4OA 2OOSA 4KUEA 3RUDA 4A2CA 1ENZA 2NUAA 4YJDA 4ZQHA 2PZJA 1G1AA 3HZZA 4CM4B 4IM7A 5G0VA 4R54A 2J8ZA 3DXFA 2VHYA 1ML3A 1B3RA 5JDCA 3WB9A 3NGXA 3NUGA 2QRKA 3MJTA 1N92A 3L4SO 2J6IA 3Q9NA 4DPLA 2X23A 1ZNQO 1I01A 2W4QA 4L4SA 4BV8A 3U49A 4NFSA 5I8WA 3NYWA 4NNJA 1VJTA 3MJCA 3V2UA 1X0XA 1ADBA 2NTVA 3G1UA 4PLGA 3CZMA 1HSZA 1YL7A 1GFSA 4RF2A 2J5KA 3W4KA 1T4DA 1W4ZA 2WE8A 2Q2WA 4ZU3A 4PLWA 3I9KA 1A5ZA 1LC3A 4WCDA 1LTHR 3B20A 3D3WA 2ZB4A 1RWBA 1I24A 1Q1NA 3RCBA 3RVDA 3RBXA 3JYLA 5T8KC 3W8DA 5FWNA 1ZXBA 4R1SA 1C1DA 2EKLA 4E5MA 3BHJA 4NFYA 3KYDA 4XQCA 2PTGA 5EQFA 2X0IA 4QEDA 4BNFA 2X1HA 3ICCA 2JHFA 1PWXA 3FR8A 3CEAA 2HQ1A 5COQA 3S1LA 2J5QA 1DC3A 2G0TA 2Q1TA 3KYDB 4QQRA 2AEMA 3GLQA 3UW3A 1P77A 3GEGA 1R37A 3EHEA 1C3VA 5G4KB 1A71A 3LQFA 3K2BA 1ISIA 1JA9A 2W98A 1FDUA 4O1MA 5G0WA 3ZV3A 4AJIA 1O94A 2Q3EA 1U2GA 1YJ8A 1M2WA 2WE7A 4PRLA 5G0SA 4ZJUA 1B7GO 3V2GA 3EK2A 1PZHA 1XQ6A 4WNCA 4YAEA 2YHIB 3U4DA 1X7GA 4RDHA 3HUDA 1UUFA 2BF7A 4XWYA 5I9NA 1UAYA 1E7YA 1UZNA 3DBHB 4CM8A 5F1OA 3JCZA 2FSSA 3N7UA 4WLEA 4BNVA 4PG7A 1PQUA 3FNFA 4R1TA 3AI2A 5A05A 3KVOA 4AJLA 3PGJA 4WUVA 3LT2A 1EUCA 3B70A 4EW6A 3GQVA 3I52A 1Y5MA 1ISGA 2VWPA 4NH4A 1NM5A 3LK7A 4O0LA 3IIEA 3S8MA 3FPCA 2JFGA 3WSVA 1WMAA 2IEBA 1MC4A 4HNGA 3C7CB 1P1HA 3RUFA 3ON5A 2ZCUA 3GHYA 4IUYA 3VDQA 3WGIA 2Q4EA 4HKTA 5B4TA 5TSDA 3G3EA 3PI7A 5KKAA 3HQ4O 1NWCA 2DVMA 5T64A 1QYCA 3BTOA 3AY6A 3M1AA 1EBUA 1KC1A 2RH4A 4XZ3A 3UCFA 4YYZA 1WWKA 2UAGA 3DWFA 2Y1DA 2ZTMA 5K9ZA 1UP4A 4II3A 2O3QA 1VSVA 3KETA 3TJRA 2OP0A 4NK4A 3DO5A 4BKUA 3LVFO 4DL9A 1A4IA 1EFKA 1E5LA 2WSBA 4PLVA 4DGSA 5A4DA 2EKQA 2VYNA 4FOSA 4Z9YA 2V6MA 3WG9A 2AQHA 1SEVA 3CPSA 3KYCA 3L07A 4TRRA 3V2HA 2Q99A 2DAPA 2P5YA 3AFMA 3WDSA 5KWEA 1UP7A 3GZNB 2BKAA 4P4NA 2J3JA 3OJOA 1OC2A 4BOYA 1R12A 1ZJYA 4RPLA 3R0IA 4TVBA 4JJFA 3BTVA 5L7YA 1U4OA 4TMFA 1C1XA 2PZKA 4BKOA 5DBFA 2D59A 4KQXA 4J9UE 4JX8A 1NFRA 3UHAA 1UXIA 4FB5A 1CWUA 2FR8A 5JC8A 4P8RA 4DA9A 3FD8A 3PYLA 5AXCA 4DQUA 4E5NA 1JVSA 3T4XA 2BGMA 2BLLA 1OFGA 1E7QA 3I3OA 4FW8A 2CUKA 4W9NA 3VZQA 4JCOA 2AMFA 3SXPA 3LT0A 3WYEA 1PEDA 5JYFA 4E33A 4W7IA 3VZRA 1UXGA 3V1YA 3K2EA 5DNAA 1EQUA 4TZTA 4FFRA 1U28A 5I7EA 5IZ4A 4WLFA 1LBEA 1EK6A 4XD2A 1E6UA 2AE1A 1IPEA 2Y1GA 4J43A 4CJXA 1LDMA 4Q3BA 1Z45A 5J23A 1P33A 2HJRA 1PTJA 4LCJA 4BNWA 4PIVA 3I9OA 3BMQA 4FSHA 2IDZA 1HXHA 3C7AA 3MWEB 3DHYA 3RUEA 2Q49A 3GF4A 3KUXA 1I30A 4AJOA 4M55A 4G65A 4CL8A 2IYPA 5IFLA 2GN8A 4U0KA 2GRAA 1VJ0A 5DBGA 1I36A 2QQ5A 2G5CA 4D0RA 4NMHA 5BNTA 4YQZA 1I8TA 1R0SA 1CETA 2BH9A 2HMUA 5JY6A 4NQZA 4ZICA 4UVHA 4TQGA 4WNIA 4HFJA 1YQXA 1PZFA 3QWIA 4JP3A 2BGLA 5BSGA 3UFXA 2DKNA 2XXJA 3ADPA 1FXSA 1Z74A 3PXXA 1QR6A 5L3ZA 1IUKA 3FHLA 4IDFA 4AJNA 4HV4A 2JCYA 3WQQA 2CVQA 2O3RA 2WEKA 4AJEA 5MGBA 5HA5A 3HB5X 4NIMA 1E7WA 1HE5A 3WIDA 4Q3EA 1W73A 1E6WA 3NV9A 4L4RA 2BHLA 4O5OA 6ADHA 4W82A 2OGUA 2Y0DA 4IZHA 5IJZA 5KOIA 1GUFA 1HYEA 1HDCA 3GUCA 5HS6A 2OP1A 3ORFA 4RQTA 3ONEA 3RC7A 4P22A 3WLFA 3PWSA 3OA0A 1ONNA 4UVDA 3CINA 5ES3A 3RFXA 3UH1A 4R16A 3JQAB 4LSMA 4F6CA 1PR9A 3MWDB 3D5TA 5AXAA 3PWKA 3ZZNA 5L40A 5HRUA 4HY3A 2XF8A 3L4BA 3TDKA 4ND4A 1ZK0A 5I9MA 3TNLA 4R1NA 5JO9A 3WICA 4MINA 5TRTA 4BMSA 3TQHA 4AJJA 3DMTC 1BVRA 1DAOA 3INGA 2GASA 1NX6A 1UXKA 4J6FA 3JQCA 2GYYA 3KBOA 2W90A 3UKOA 2GF2A 3LYLA 4IJWA 3H9QA 1RM4A 4KP7A 3WQSB 3LT1A 3JQGB 3VH1A 5BSFA 1B8VA 2Q2QA 4Y9DA 4Y6PA 5HS4A 4MPDA 3PZRA 3JYOA 3HDYA 3AUTA 4ND3A 2ILTA 2X5OA 3GDGA 2C82A 2JCVA 4IDCA 3W6UA 3OHSX 1ULSA 1ADFA 4BNMA 1HE4A 3FCOA 4NBVA 3PJEA 1ZVMA 3GEMA 4KMSA 3U4CA 2VYVA 3W4IA 2VWGA 4QECA 1WPQA 5CDTA 2CD9A 3CXRA 4AG3A 1LLDA 4GX1A 4J1QA 5JE8A 5JYDA 4DVJA 2HMTA 4ALJA 4RO0A 3AUUA 3AOGA 4RZIA 4R5MA 4JIGA 3Q11A 2Y1CA 2PA3A 1I2ZA 1X7HA 3D7LA 3JYPA 4U8GA 4EJMA 4HXYA 4Q3DA 4D45A 1X1EA 2X9GA 1G0OA 1EQ2A 1GCOA 5TS3A 1GQQA 1QYXA 4RVFA 1KEWA 4IDBA 4NDNE 1DLIA 4TWRA 4XGNA 5EQDA 4P38A 1TI7A 1PGNA 4B8WA 2JJYA 3M1LA 2X5KO 2GCGA 3K96A 5BNIA 1VJ1A 1EUZA 2WYUA 5C7LO 4LK3A 4TROA 4FQ8A 1H9BA 2ZTUA 4KTVE 2ZTLA 1V3UA 4YAGA 5FI3A 2AQKA 4J3FA 2EHDA 3NJ4A 2HK7A 2YHIA 3N74A 4BO9A 4L0QA 5T57A 1YB1A 2Q46A 5I8ZA 4ROSA 4I08A 8LDHA 4Q39A 1P1JA 4PG6A 4FGWA 3CSDA 2Q1WA 5IAAA 5ILGA 3OICA 3AY7A 4BL5A 3KV3O 3EVNA 3AJRA 3VH2A 2NVUB 4ALMA 3EDMA 5T73A 1OMOA 2GGSA 2Z95A 3D4NA 3F9IA 4P4GA 3G49A 2O3SA 5HBRA 1K6JA 3FSRA 2NVBA 4K6CA 4WKGA 8ADHA 4E2YA 3K73O 1Z6ZA 1XSEA 4XJTA 4BNXA 3ZWMA 3WIEA 1JAXA 1WDMA 4BNGA 2I67A 3G17A 1MA0A 3PWZA 3DONA 2WD7A 3IJPA 2B4QA 4G81A 1K0UA 5G4KA 3FRJA 5IG2A 1I3KA 4MIOA 3FBTA 2RCYA 2AQ8A 5JYAA 1N7GA 4IQ0A 5TJHA 1NWHA 1T1SA 2YQ5A 2YFHA 1L1FA 1HDRA 1QP8A 4J2HA 2BFMA 4W7HA 3X2EA 3H9UA 2YJZA 1X0VA 3NT5A 5IDYA 4OGWA 1MFZA 2H1SA 3PHJA 1T2CA 4AJPA 4FPXA 4EZBA 2PFGA 3O8QB 3GH3A 5A06A 1GY8A 4BUCA 4YVFA 1E3EA 5A1TA 1PGQA 1QV6A 3FNEA 3N58A 3EAGA 1PQPA 4Y98A 1GQ2A 2RBEA 3V8BA 2POQX 3PHIA 1Q7CA 3HHPA 1A7AA 1KVQA 4C7KA 5JAZA 1MC5A 3WTBA 3DOJA 3VPGA 1JLLA 2VYVD 1PWZA 3MJEA 1YDWA 1T2EA 1CQIA 4LMRA 1CDOA 2VOJA 2ZB3A 3I9LA 2O50A 3INTA 1XDWA 1PJQA 1KEPA 4CM1A 3EZLA 2Q1SA 3E03A 1IHYA 2Y99A 3GVCA 1YE3A 3T7CA 3BMNA 4A7PA 2EP5A 5CG2A 3R1IA 4AFNA 4E2WA 4JQCA 2YY7A 5J9GA 1O6ZA 2P68A 4CQMB 3ZV4A 5CEEA 3IUSA 3OM9A 2YYYA 1QLJA 4I1IA 3JD2A 4PVCA 4Z0PA 3TZHA 3WFIA 4ZVVA 5L45A 5IF3A 2GDZA 4RF3A 4XQGA 5JMWA 3GRPA 1H6BA 2QZ9A 1SOVA 3VKVA 4E5KA 2VUTA 4FGSA 3SJ7A 4IGEA 5A9SB 2YFQA 4GGOA 1LSJA 2HRBA 4JBGA 5B37A 3Q2IA 4FFPA 4UUNA 2ET6A 1RYEA 3PLNA 1PS9A 3ZH2A 2I6TA 2I5PO 4BNTA 4E31A 2J3IA 5DOVA 5JPIA 3SLGA 3FWNA 1N1GA 2AEFA 1R0KA 1PJ4A 2DQ4A 3ETEA 1NXQA 3VH4A 1E1NA 5ICSA 3BHIA 4A73A 1Q0QA 4MO2A 4HADA 2LDXA 2QRJA 3VPXA 1ZEJA 3VZSA 1CQJA 4I5FA 3HDJA 5AXBA 1I2CA 3KHUA 3OBBA 2WMDA 1WDKA 1A72A 3UUWA 1O5IA 2YQ4A 2IRWA 3UVEA 3DBRB 1NQAO 2VTEA 1OOEA 1MGOA 1GV1A 1SAYA 1XGKA 2IXBA 2W2KA 4WPGA 3AOEC 3DBRA 3DFZA 2ZJ0A 2FOIA 4JN6B 3EZYA 2VOEA 2PKQP 4OXNA 3KSZO 1QRRA 3L6OO 1UZLA 3MOIA 3QVOA 3VPSA 4ZRNA 1YDEA 1E3WB 2VQ3A 1DRVA 1Y5RA 1I3NA 4JP2A 1GYRA 3MTJA 3Q9UA 4RLSA 4MIEA 1K5HA 4Y6SA 5TC4A 3KM0A 4BIIA 4UVEA 3GAFA 5TIIA 4L8VA 1T25A 4GX0A 3LLSA 3JD0A 3UF0A 3DC2A 1RM0A 3EUWA 2GERA 1ID1A 3GAZA 4D3SA 1IZ9A 4ND1A 3L4BC 5EPOA 2V6BA 3ICPA 1S6YA 5AYVA 4DBZA 3PFFA 4E6PA 2D2IA 4EEXA 2B37A 4OXYA 3H8VA 5L4SA 4OHUA 1ZKMA 4K1LA 2QYTA 4CLRA 4IDGA 2G17A 5GZ6A 1V3VA 2C7GA 2YDXA 5DZSA 1NR1A 3TZQA 4NFHA 4AJ4A 1ZH8A 3JQ8B 1R16A 3K92A 3OH8A 4J1NA 3QWAA 1DEHA 5GZ1A 3KYBA 3C8MA 3BMNB 5T8KA 2HJSA 1Z7EA 2AE2A 2QYSA 3JQ7B 1DO8A 3EMKA 4QT0A 1D7OA 1NP3A 1LUAA 1ZSNA 4YB8A 3AM3A 1W0CA 4CMAA 1ENPA 5A3VA 4IS3A 2B0JA 2X6TA 2VUUA 1NFQA 3D3WB 3GMSA 3R3JA 4S1VA 5ENVA 4MVJM 4D43A 1HE2A 3JD3A 3ZHYA 3JQ6A 4L76A 1H0KA 1LRKA 3S2EA 4DC1A 4WGGA 1P1FA 3BMQB 1CIVA 5BNFA 1AGNA 1V9LA 2UYYA 4D42A 4INAA 3WWZA 4WASA 2FPIA 1GYQA 4OSPA 2DU8A 2VNAA 1PZGA 4GLOA 4FFLA 4RF4A 4XIYA 7MDHA 4R9SA 5A02A 1TEHA 2J3HA 4YA6A 2JL1A 4CLOB 5L7WA 4ND5A 4RVHA 4CUJA 4RJTA 2ZB8A 2GN4A 2VYND 2PNFA 2PV7A 1B0AA 2JD1A 3AW9A 1WW8A 4ND2A 3VVCA 5IDWA 2NQ8A 3OECA 1L7EA 1UZMA 3QP9A 4RVDA 1NHWA 1HZZA 3S55A 1H6AA 2Z5LA 1DHTA 4U0JA 3A9WA 1QYWA 1IYZA 2EV9A 2I65A 4MVJG 1R15A 4MVJP 2C07A 3GFBA 3AU9A 4TKMA 3TZKA 1PJCA 3LF1A 2JAPA 3BXXA 3OQ6A 3NTQA 3QLJA 4LCEA 1E3JA 4GMFA 1EUDA 3FN4A 1YXMA 4ESOA 1ZMTA 4CMIA 1OZAA 3L9XA 3A06A 4YAKA 1LI4A 3E1KA 1EE2A 4BKPA 3Q1LA 4JJIA 4ZQGA 1JW9B 4OSOA 3AWDA 2C20A 1JTVA 4E4YA 1S7CA 4BGIA 4AVYA 2HDHA 2BRUA 4FD3A 3GFGA 5IDQA 3MOGA 4UEOA 2CF5A 4BS9A 1TB4A 4J0FA 1JWBB 1VLLA 1GYPA 1DC5A 1HLDA 1X13A 1ZMOA 3C3XA 1AHIA 1IB6A 3WMWA 3OMLA 3L9WA 1P1RA 4J7XA 2C54A 2NVWA 1GUYA 4IZIA 1HDOA 2C0CA 1VI2A 5CP8A 1AUPA 2OFPA 2X8LA 3U4IA 1XWFA 4OXKA 3GPIA 3BAZA 5LCXA 4XRGA 3UXYA 3WNQA 5JDCC 2Y05A 3JQAD 3AOEA 1T4BA 3W8EA 3ZCXA 4IXTA 5CG1A 1XR3A 3ITDA 1ZBQA 3DBLA 4MP3A 4K26A 2PLAA 5DCUA 4GKVA 1U2DA 5EN4A 5KJFA 4N5LA 5BSEA 3C85A 4WLVA 5F3RA 3ZU2A 1AE1A 3K30A 4DPKA 1NTOA 4BNIA 2IXAA 5TGDA 1MP0A 2O4CA 2QIOA 2PWZA 4R1UA 4Z9FA 3RBZA 2VZ0A 2AG8A 1HDZA 2AW5A 2W2LD 3FNGA 4MOWA 3PFWO 4YT2A 3MCVA 4TRJA 3NRCA 4LGVA 4WE3A 4OH1A 4E12A 1KERA 5ITVA 2H5LA 3UGKA 4MVJE 4GQAA 2JFFA 4AICA 3E82A 3M2TA 5CDGA 1X14A 3L77A 1LSUA 5CPBA 2PZMA 4UVIA 3JQFC 3VHRA 3VPHA 1ZW1A 2Y93A 1GAEO 2DT5A 3KTDA 1D1SA 3PVZA 3PYXA 4OOFA 1WLYA 4B4OA 2E48A 2FY8A 1W6UA 4PCVA 1ENYA 4NG5A 2X22A 2P91A 4N5MA 4YJGA 1NPTO 3FWZA 4YEDA 4ZN6A 4CMCA 4CMBA 1J49A 4FFMA 3E6AA 4DXHA 3TSCA 1I33A 5F5LA 4QTZA 3HSKA 5G2OA 2I66A 2I99A 4HNHA 5B12A 5A3JA 2ZK7A 2ZQZA 3DHEA 3GC6A 2C7VA 2AA3A 4R3NA 2IODA 3QIVA 1Z7BA 4I8XA 4JNKA 2X0JA 1E3LA 4LRSB 3F1KA 3NT2A 2HSDA 1LSOA 4E21A 1RM5A 3HWRA 3SC6A 5DDIP 1X1TA 1K89A 5BQFA 4XX0A 5G4LA 3GZ4A 5JS6A 3D64A 1R0LA 2VHXA 1A27A 5K6AC 1PJBA 1GTMA 4QFCA 5JCXA 4BGVA 4EGFA 1I10A 1Q2XA 1V3TA 1XCBA 3WWYA 2B69A 4UREA 4GLLA 1Y7TA 1YONA 1SB8A 1HL3A 3ZWPA 2PK3A 3FNHA 1G0NA 2NWQA 4II2A 4KDEA 1Q0HA 2A92A 3RUAA 3ZU4A 1HDXA 1IZ0A 3KLMX 4CMEA 4PG4A 1EVIA 1HE3A 2AQIA 5U9CA 4XDYA 2H6EA 1E7SA 4D44A 1P1KA 2NU9A 4N18A 4DBVO 4K6FA 1PJSA 4LN1A 3GPDG 3HE3A 3BHMA 3PPIA 4NZ9A 1B8UA 4KUHA 4F3YA 4P4LA 4CPDA 4ITUA 2FZEA 2G76A 1J5PA 3U3XA 2GPTA 1K6XA 1MG0A 1ZSYA 3K6JA 6LDHA 3E9NA 4IBOA 1KVTA 1YBMA 1DJQA 3DEYX 4RL6A 4WEQA 4A0SA 5KVSA 3SJUA 1VKNA 4BNZA 1T2DA 1MLDA 5FI5A 4E3ZA 4NBRA 1YGYA 2XPCA 1E1MA 5L7TA 3GA0A 1XYGA 4XQEA 3GVXA 3I83A 5A5FA 1E77A 4OOEA 3GMDA 2WDZA 5JDIC 3WYBA 1ZZEA 2BFOA 1YBVA 3WMXA 2WTBA 2Q50A 3Q3CA 5U4QA 4CR6A 1C0KA 1ZUD1 4TKLA 2GLXA 3QWFA 4BV9A 4MVJH 4PZEA 4B3IA 1MFPA 4RVGA 2DTDA 3MJ4A 4YT8A 4JGBA 4FC7A 2D1YA 1UDCA 5CDSA 4E5PA 1HT0A 1ENOA 1WMBA 3LDHA 4RPKA 4OAQA 3WNVA 3LLVA 4MVJI 4DYVA 4FFOA 2TMDA 3QA9A 1UAGA 3H5AA 1BG6A 3B1FA 3EW7A 3H5RA 2Y0CA 2ZTVA 3I9JA 4M49A 5JW6A 1NVGA 4XQ9A 4Q3NA 1WDLA 4WLOA 5JSFA 2NSDA 3E18A 2VN8A 3RJ5A 4JBHA 2X86A 3OQ1A 2Z1NA 3R3SA 3I23A 3GGGA 4W99A 1R6DA 1DB3A 2WWRA 2EW8A 3GY0A 2P2SA 1GZ3A 4IJKA 3H3FA 3L6EA 1KIFA 3ZWBA 4NBWA 2NU6A 3F4BA 4O59O 4WCFA 3D4PA 1GV0A 2FRDA 1DIHA 1Y8RB 4CMHA 2BGKA 2Q45A 3QVWA 1L7DA 2EGGA 2P9CA 4CQMD 4FJ0A 4J4HA 3GEDA 4BMVA 2QX7A 1D8AA 4BB5A 4GX5A 1GD1O 1PX0A 4O63O 3VDRA 3V5NA 3M6IA 3BMOB 1PGPA 4XJSA 2HCTA 1LDYA 1YOVB 4GPD1 1E6EA 3H7AA 2HO5A 4OKNA 4BO7A 1TXGA 1LRJA 2I3AA 2QHXA 3OF2A 4XGKA 3V1TC 4DYDA 2YZ7A 3EYWA 5EJ2A 4QX6A 2VTDA 1H94A 4OL9A 4WK6A 3I6IA 1UDAA 3M2PA 1IE3A 4PLZA 4WCFC 2V6FA 4WOKA 4ALIA 2YV3A 3WGYA 1ZJZA 2VRCD 2B35A 3B1JA 2JHGA 4J9VA 3ANLA 2HUNA 3IJRA 1VL6A 4XGIA 1CEQA 1YB5A 3RROA 4KUGA 3DMTA 2CDBA 1KYQA 2E4AA 1F14A 4IDAA 3JQGA 4CV2A 3GVPA 1B16A 3H2SA 5ITWA 2EEZA 4ZQEA 4FIZA 4KWHA 2DBQA 5TNXA 3DZBA 4NBTA 3KSDO 1LDBA 1H93A 4FBGA 3BMCA 5THQA 1A7KA 4B7XA 4C7JA 4IDDA 2A9FA 3F46A 1RPNA 2B83A 5DT9A 2XXBA 3I9MA 1PL6A 2VZ9A 4B4WA 1HKUA 2FPPA 3HN7A 4XYMA 4CM9A 5AVOA 1BTOA 3WQRA 4JROA 4BNJA 3BMCB 4I9UA 4A26A 3VTFA 1SZJG 3T7EA 2PD4A 2EG9A 2O3JA 3PYMA 2D5AA 2SCUA 3DZHA 4GGPA 5T67A 4E13A 5CFZA 2UUPA 2O7QA 4A03A 1NAIA 2OL4A 5ER9A 1M76A 3NTOA 2NLOA 2NU7A 1XU7A 4DC0A 3KO8A 3F47A 5G0UA 3WX0A 5H82A 2AG5A 4LVCA 5DOZA 5LC1A 2F1KA 1NVMB 3U5TA 4BNLA 1AXGA 4X54A 1P45A 1O0SA 1SEPA 2FWMX 4IJVA 1VKOA 3PIIA 3FTPA 3RAJA 4DMLA 1CF2O 4PFJA 1U3TA 1GL3A 3P2OA 3K5PA 2RH8A 4B3HA 1ONOA 3H9JA 3ZNPA 3TFQA 3E9MA 2C5AA 3I6QA 5DF1A 4K9DA 7ADHA 2X0RA 4A10A 1PL8A 3O8QA 4R51A 4DIOA 3NT4A 2Z1MA 1PZEA 2E49A 4HFRA 4YJFB 1EBFA 5M6DA 3TRIA 2BFAA 3C1OA 5ILOA 1N2SA 3KB6A 1Q0LA 1Q7BA 1ZXLA 4FDAA 4KQWA 4E0BA 1JKIA 4CMEC 5COAA 2Y1OA 4YJHB 2RAFA 5KCZA 2OUIA 1DOHA 4XB1A 3RI3A 2FN7A 2R2GA 3LZ6A 3P2YA 3IDSA 1T24A 4DWVA 3B6ZA 2DM6A 4L4XA 1P31A 1PJ3A 1TVEA 4L9RA 1IPFA 2YV1A 4BNYA 4IDEA 2ZJ1A 1Y8RA 1ADCA 1DIBA 1F8FA 1TT7A 2V6GA 3CTMA 2AEJA 2JD2A 3GHHA 5DN9A 4I5EA 4XRRA 4BKRA 1FJHA 3EVTA 3H9GA 3TOZA 4N7RA 2VZ8A 1W8DA 1ARZA 3PIDA 3I5MA 3LT4A 5B4VA 3IUPA 3R6DA 4J2OA 4OIMA 1ZFNA 3ZU5A 3LC7O 1NFFA 1ZK3A 2CNBA 3ENKA 3OSUA 1NQTA 3JYQA 4J0EA 4PGFA 2GD1O 1AXEA 3SBOA 5LDGA 4RLHA 3F3SA 3WSWA 4AL4A 3WBBA 1H2HA 1EDOA 4PLYA 2GO1A 3H5NA 4U6SA 2WYWA 4A5OA 1JVBA 1EK5A 1U3VA 3W1VA 3DB2A 1D4FA 3ZN2A 4OO3A 2HKIA 3UCEA 3U0BA 3L6DA 2DUWA 2QRLA 1JWAB 2FMUA 1GR0A 3ZV6A 2D8AA 4DIBA 1CYDA 2YDYA 5ENDA 2FHSA 1RYDA 3K9QO 3WGTA 3KEQA 4ID9A 3ASVA 5I9LA 2GR9A 1Y9EA 3OIFA 3RQSA 2P4HX 5A9RA 4YRBA 4RF5A 3PQDA 3RC9A 3F5SA 3IS3A 3JQEA 4J90A 3DZJA 3GUYA 1DRUA 2NU8A 5KJ6A 3C1TA 4J49A 1ORRA 4CLEA 1IOLA 1U1IA 1C14A 2X58A 1ZIDA 3STHA 3SLKA 3ZWAA 3S2GA 2DTEA 3O38A 2C5EA 3VC7A 4BVAA 1V8BA 3JD1A 2DTXA 2HMSA 5TF4A 4IY1A 4XIJA 4URFA 1FDTA 4R5HA 1MV8A 1E3WA 4H15A 2NACA 4Y67A 5TT0A 3RKRA 1E5QA 1HETA 4LRTB 1JU9A 3HJAA 3QVTA 1NASA 1XLTA 1ISFA 2ZB7A 3IAHA 3WOHA 3PDJA 3BTUA 3DMYA 4W6ZA 3Q6IA 2P9GA 1WAMA 3ULKA 3D0OA 3F4LA 1VM6A 4PLTA 2GNAA 4DLBA 2OZPA 3O4RA 1O8CA 4RDIA 1RJWA 2JCXA 4J7UA 3SX2A 1NQ5A 1UR5A 4GSLA 1YQGA 3ZNOA 2V7PA 3MTGA 3H65A 1NNUA 3MJSA 3VVBA 2PR2A 1P0FA 1QKIA 3OIDA 4CR8A 4WEOA 4RPGA 3PHGA 4XR4A 1HTBA 1GU7A 4UEJA 3QE3A 1ISHA 4BO0A 2DUUA 4OMUA 1EMDA 2RHRA 1U5CA 3KEOA 4CM5A 5CEJA 4D3DA 1N5DA 3I9NA 4EUEA 3IKTA 4MKXA 1M75A 4GBJA 4GVLA 4YR9A 1SC6A 3W4JA 2VHZA 1U8XX 4EDFA 1DC4A 4EEZA 1MB4A 1DFHA 1GDHA 4BO2A 4ZRMA 1SBYA 3ANNA 2Q2VA 4XB2A 1ADGA 4OKIA 5A04A 1E0DA 4YRAA 3GN2A 1FDVA 3MEQA 1UJMA 2EW2A 3C7DB 4BMNA 3ONFA 4FOOA 1H9AA 3AU8A 5GMOA 4B4UA 4EBFA 2O7SA 3OQBA 1ISJA 1PGJA 1C0PA 1NPYA 2NNLD 3ASUA 1P44A 4XYGA 5JO0A 5JFOA 4LSWA 4WJZA 4F6LA 1DIGA 1ZO8A 4QFDA 1M6WA 4LISA 3ENNA 5L95A 3ROPA 1KVSA 1LNQA 1U7TA 5CEFA 3KRTA 4O6VA 1N1EA 4TRNA 3H9EO 4IXWA 2CVZA 9LDTA 3ETGA 4MP6A 1GZ6A 1QYDA 4LMPA 4FCCA 3U9LA 3GT0A 4GVXA 4RVSA 3CMCO 3E5MA 3DOOA 1BXGB 4PLCA 1R4NB 4MDHA 1AN9A 1E92A 1ZSVA 2O2SA 3NDIA 3PEFA 5ADHA 2GZ2A 3PQFA 5IZCC 1PJLA 3GOHA 3TZCA 1YO6A 2CSUA 4RPHA 2VT3A 3RWBA 3RSHA 2NVUA 2R00C 4YXFA 2AXQA 2OORA 4FR5A 1C0IA 1HLPA 4ZHSA 3WTCA 3DOCA 3INRA 4IINA 5I7VA 2DLDA 4QO7A 5KJ1A 4NPCA 3VKUA 3WGGA 2UUOA 1CERA 3ROMA 4YPOA 1GADO 1BW9A 1P74A 4PZDA 2PGJA 4Z6KA 1Z73A 2BD0A 1I3LA 1D1TA 4KOAA 4TRMA 4BNUA 4MKRA 1H6CA 3AM4A 3DBLB 4M8SA 2O23A 3LF2A 1D3AA 2NADA 2A4KA 2BI8A 2WD8A 4IIUA 1UXJA 2QZZA 4PG5A 3PZBA 3MZ0A 3IP1A 5BT9A 3PTZA 1DRWA 1VSUA 5JCJD 5IXYA 1PQWA 3A28A 3GGPA 3F6YA 4GKBA 2DBVO 2HAEA 2A94A 1C1DB 4GH5A 1YJQA
chains in the Genus database with same CATH superfamily
3IP9A 1BDBA 3E3MA 4WK0B 3WNCA 4L0CA 5CD1A 3MHTA 1ZN8A 1GTRA 4ZEOA 3GFOA 4QATA 1AD2A 3AT1A 1MOQA 1FUUA 3GNTA 3IT2A 4NY1A 1NP6A 2R7LA 4QDTA 4UVGA 2QTFA 1GCIA 3SFVA 4KBYA 4A3SA 1N0VC 2PD6A 3KALA 1GPJA 1VIVA 1F4PA 3MJVA 1FNSA 1EFRD 2HBZA 1DJLA 5DT2A 3L8FA 1PG5A 3X0DA 1U3GA 1VB3A 3CBQA 5H4GA 3IR6A 1JT2A 3BF7A 1QHNA 1FFDA 3MJHA 2HGZA 2GN1A 4BWYA 2Q5CA 5BYJA 4WECA 5DTIA 2ZPTX 3RRMA 1IBKB 1C3OB 1Z2DA 4H7FA 2OCGA 5I8PA 1TE2A 2QX8A 1UEIA 1CRWG 4ZA2A 3SQXA 4ZC1A 4N0MA 2XR1A 2D54A 1H2FA 3QLVA 1W5TA 4K6HA 5ETJA 3UICA 1OUMA 4LOJA 2OPHA 1J2YA 3IUEA 4J1SA 1PR5A 4EI7A 2Z6QA 1AG9A 1VL0A 4WA7A 1NDUA 4MAMA 4JVMA 4KWCA 2IYLD 4GEKA 2H3HA 1U0EA 1PFWA 5JNLA 3W3ZB 2GO7A 3CZCA 4KI0A 1K7CA 3ECSA 1F8UA 4DTIA 1OPXA 2WI8A 4I9NA 4RKRA 5C7OO 4LY9A 1PO7A 4PONA 4EX6A 1T10A 2XF2A 3GRKA 1KDRA 2NQTA 4NU0A 4Q4JA 3NHYA 2NU6B 1R6BX 1YAJA 3VOSA 3NX4A 4QBFA 3TWOA 1Y5IA 4F5YA 1JQBA 4UCWA 3HN2A 3OCWA 4RM3A 2F3PA 1RLTA 4EA7A 4O89A 5F3DA 3ZHBA 2J0EA 2ZU0C 4HS4A 4A82A 4AMUA 1NLFA 3LPDA 4AD8A 4NI5A 1VMAA 5GOTA 1ODIA 2H5JA 1BGVA 4X8OA 3IAXA 4ZO9A 3UJ8A 1Z62A 4ZI7B 2PY6A 3W8FA 2EARA 5EE1A 1IJFA 4QRDA 1N2CA 1ZOPA 2JKZA 2O3UA 2AKAB 2P9BA 2VPQA 2QG4A 2YHBA 3P9PA 4TKVB 2XUGA 3TZBA 1E0AA 4KI7A 3L18A 3U7JA 4BZQA 1T9CA 1X7WB 2DSTA 3GG2A 3HNOA 3L0SA 1O6BA 4QJ3A 1UDRA 4DCSA 1V35A 4UTXA 1E69A 1XMSA 3JQ9C 4GWKA 4Y6GB 1CUSA 4BNNA 5IJZA 4DV6B 1ZQ9A 3U13A 1BWQA 1DL5A 4ENVA 2QUAA 2ISCA 4UUOA 2WZCA 4X1OA 2P9EA 4FMDB 4S1TA 1K97A 3KJXA 4BAUA 3MYRA 2GSDA 4NJOA 4ZPJA 1FFXB 4MVCA 5FULA 3NHJA 1Z63A 3Q0EA 2GDJA 2WWWA 4Q3CA 2FQXA 4G37A 2ZI9A 4E30A 1W76A 5CH5A 4HATA 3FA2A 4DDKA 4L75A 3CB4A 4QXPA 3U3DA 1FSSA 4DLLA 1ONPA 2C77A 1AKRA 2GARA 2PX3A 3P9RA 4IL5A 7ABPA 1EX6A 1W36D 2V0GA 3EISA 1R6UA 3PHHA 3NDJA 2OV2A 1BW9B 4R2XA 2OCBA 3JVDA 4CR7A 1KOFA 1L4UA 1NV8A 1WE2A 1G66A 2YFKA 3EAQA 3R23A 1RR6A 4YO8A 3IMFA 2ZIFA 4DSOA 2F8TA 1EFLA 4CN9A 2VNIA 5FBKA 4IMIB 1P3JA 4MKZA 3QYAA 4UTZA 2XMCA 3WFZA 1U3UA 3ROTA 2M32A 3BJIC 2RARA 3B2QA 1LS6A 2C4NA 1DAEA 4RH1A 1WUHS 3P71T 3QLTA 2YY6A 5DHAA 1RHKA 1M5UA 1ZIXA 4C2BA 2KBEA 3WB1A 3ELUA 3NC0C 3PC8A 4BO5A 5D1NA 1MDBA 4PR0A 5G3ZA 2GBLA 1IVYA 4BAGA 3COJA 1TFUA 4HB3A 1ESNA 4BNDB 4MMZB 1R4MA 1XWWA 1ZK1A 1TCBA 3F74A 3JALB 3T7KA 4Q9JA 3D2BA 5JISA 1Y1QA 2PLNA 5D51S 2Y68A 3WGQA 2CFTA 1Z75A 1B6TA 3RC1A 3EN0A 1YKFA 3K0BA 4QA9A 3MWDA 1FDWA 4UBIA 4YO7A 2QSUA 1F12A 3TR6A 3VRHA 4B6RA 3LRPA 4B3FX 1CIJA 2VUHB 2VSXA 2SKDA 3KYJB 3G2IA 3E7XA 1XTUA 4MUYA 4RHUA 3NGMA 4JOCA 1YR9A 4M0MA 3H17A 3A10A 4O2LA 4BPRA 4TSKA 1YZ3A 3CURA 4XYLA 3MB5A 2DHRA 1LBSA 1NI3A 1LQTA 2H4HA 3E8MA 3CZAA 5FIUA 4PYJA 3LVBA 3V46A 4B32A 4TWBA 3I2KA 3JQ7A 1SG6A 3P9NA 4WFIA 1W29A 4RH3A 3OTOB 2WD7B 1DG1G 4Q6WA 3D1JA 3M89A 2FUNB 3O82A 3QI7A 1ISPA 3R4VA 4FLEA 3BZWA 4H4DA 1ZISA 5CAEB 4KQKA 5GVSA 2I91A 3ECCA 4FMPA 4PQRA 3CVJA 4LVOA 3LL7A 4KAFA 4I50F 4CU5A 2B4RO 3MLEA 3B5EA 1PJAA 4GM0A 1US8B 3ZDAA 4FJ1A 1P9LA 5IULC 3LSTA 3ZLTA 1G20B 1UKZA 4K3VA 5K4GA 4RJIA 2AKEA 5L53A 1UPFA 1EFTA 1R27A 4LSGA 3YASA 2I2AA 4LDPA 5JATA 5LQJA 3OQNA 1NSYA 1FDOA 3KAJA 4YRFA 1OZFA 1BSVA 1QLHA 4NZYA 4WCFB 3I39X 2CY0A 2W2XA 4U6QA 5ANRB 3T5GA 1MHPA 3WBFA 3KEGA 4OHBA 1IWPB 1JKJA 4JC4A 2PQ2A 1C1YA 5ARCA 2JVKA 2H0AA 4EIWA 3ZQKA 4F4DA 3U1VA 1YZNA 4M1QA 1LJ8A 1T9AA 4R69A 1UXHA 2H2FA 4AK1A 3VYSB 2XD9A 2VK1A 4C5AA 1ESZA 1GKIA 3E48A 4DDHA 3FTFA 2OBYA 1KBZA 1XTZA 2FRXA 2YV2A 1KC3A 1HBJA 4OG2A 4YFYA 4DG5A 1W2WB 2VH5R 3ESYA 3F8WA 4Y2RA 2R7KA 4B6PA 2ZU6A 4GMDA 3UUEA 1HYBA 1PDVA 1XD9A 1TVKA 1DX9A 1EP9A 3BORA 1ATZA 5BR8B 3B9QA 3VR6H 4AJKA 3F9RA 2CF6A 4RNCA 3QW2A 4N82A 1L1EA 3JQRA 4JUBA 4MHOA 4P82A 4WQMA 4TWAA 2XMZA 4C0KA 3HFRA 4QU9A 4R2HA 3ZDQA 1SQGA 1QJCA 1QGDA 1SIBE 2OO7A 2Q5HA 2AJBA 1ICIA 2VHQA 1X7YB 2YZ2A 2FN8A 4Z0HO 3JQBA 4FFBB 2O4UX 4C6TA 3L8ZA 4JJZA 4ZVRA 5TMDA 2Z3VA 1OYYA 4G4GA 4B83A 1OXBB 1KEEA 4LF7B 2I4OA 2OKCA 2C4WA 1DX4A 3P2EA 2GZ3A 1QMPA 3QWBA 3KG2A 4X9XA 4B79A 4R3WA 3QPCA 2QJOA 1WSWA 1HX7A 4DNXA 3VH3A 3L93A 5CHEA 3U39A 1HT3A 2F9FA 1EK1A 5EUBA 5C1DA 1DELA 1G5QA 1IOVA 1U0GA 2VDWA 4NYJQ 4ZXPA 5T3YA 4YRNA 5ADWA 5FRDA 4XM2A 4AZ3A 4MVJD 2QAGA 2JHPA 4Q1DA 3VNUA 3NEPX 1GSOA 3QJYA 4XOUA 5DTEA 1LLQA 1YR8A 2QW8A 2XIQA 3HO6A 2GM9A 4EYQA 3HM9A 4YN3A 5KJCA 2ZYVX 4BJ5A 3AY3A 5ALOA 5F4BA 4ZVLA 3B38A 3TCKA 4NZOA 4ZQIA 4NJMA 1L9KA 3O03A 5BQPA 3RJ9A 3IOYA 5HFAA 5AVYA 1WULS 5K3EA 1FFXA 2E6UX 5DM60 2DBZA 3THYB 2AF4C 2QMQA 1N8KA 1WW2A 5EINA 1P91A 2WKRA 3SY8A 4ZDIA 3EIOA 4PW0A 4D3FA 2IYWA 5A4IS 5KEIA 4F45A 3WLMA 3U09A 2X1LA 3GA5A 5DGIA 1W88B 2X9VA 3K0FA 4YCAA 4JFAA 1ZY2A 1M7GA 5C37A 1M0TA 1DEKA 3VU9A 1T1RA 1IDOA 1VRWA 2V7TA 4EYOA 1EUDB 4UC0A 4JI5B 2IY8A 3G79A 4IKPA 3AC0A 1GPMA 4OP2A 2DY1A 2XZLA 3HBNA 4PTZA 1H1LA 2FLVA 4RV9A 3GXOA 1Q77A 1LY1A 4KTTE 4LVUA 5I7SA 1JWLA 2YRXA 1G6OA 2W43A 2WA2A 2X6QA 4R31A 4E08A 1W49A 4RVUA 3C74A 3GRAA 3DDZX 1OLSA 4JDPA 3ROFA 1FYXA 1LLCA 4IKOA 4ECAA 4PZLA 4M54A 3ZTTA 2BTQB 4KNWA 2AVDA 3GJ7A 3VAZA 3L05A 2ZREA 2VAVA 2GTHA 1YMQA 5GY7A 4HF7A 4V1CA 1EP3B 2HA3A 5GJVC 4I5DA 1U7HA 1ABBA 1DAGA 1G6Q1 2Q22A 1H5QA 1HMPA 3K9NA 4FYIA 5FTJA 3HKCB 5B53A 4L07A 1IHXA 2BFPA 3O3MB 4HGZA 2HWUA 1P0MA 2OGZA 2WFMA 3AUSA 3H8SA 3IQGX 3PUIA 4ZVOA 1M1NA 2XDQA 2IU4A 3KKNA 4IJUA 4MYCA 1AO3A 2VP5A 3CUTA 4CM5A 1EZ4A 2I7DA 4RABA 2AWNA 1P3DA 4H59A 3UMYA 2WM3A 1O89A 1PK7A 4C0JA 1F5SA 3OLXA 1QIMA 2VDUE 3GBPA 4YCSA 1C9YA 2I3BA 3DO8A 2QX6A 5BVHA 1NJGA 4KG7A 4E15A 1Q0TA 3K5HA 2VRNA 3TTTA 4FS3A 3WHPA 3L2OB 3G0GA 2YMPA 1RACA 1U2SA 3FBWA 4RACA 5E4TA 4TS9A 2HIGA 4KWTA 3Q7IA 4ZKDA 1RQXA 3RI3A 4AUEA 2FFAA 5B5SA 3PJGA 2A78A 3VYTB 5DJ5A 5CDFA 1V95A 1GZHB 4KXQA 4LRYA 1BHSA 3DJYA 5T5QA 2BBTA 3T5MA 3WVNA 2Z4TA 2PSJA 4U1RA 3KSBC 3NETA 4NCIA 3K1TA 2A9VA 121PA 1CB7A 4YRIA 3FAKA 4Q7JB 1EE9A 1SNYA 3FVVA 1UWKA 2H29A 1XDDA 5DNYB 1UL1X 3OQHA 3JQ8A 2C2GA 2ZS9A 2BF4A 3V4FA 2EWMA 3UT0A 4GC9A 2ZWMA 3BMOA 4YCMA 3PC4A 5TR9A 3SDZA 2Q0SA 3PQ5A 2QENA 1DHRA 1QMGA 1CJTC 1WXWA 1ZGCA 2ZIZA 2GF9A 2FWAA 1V1RA 4ZPXA 1MMFB 2W4MA 1HG0A 4HXEB 1DQNA 2HF9A 4OMFG 3U16A 2VAMA 1RCUA 1Y9DA 1ZL2A 4PIMA 4RIFA 5ENZA 1P3Y1 3VNRA 4QGSA 5FUQA 3FTNA 4MI3A 5DRTA 1XKTA 3DO6A 3BQNB 3CNEA 1FRFS 1CC1S 1GL9B 2D2VA 2EDCA 2EKBA 2PRIA 4IG4A 4QGFA 3UOGA 3WK8A 2XVXA 4DV1B 1N9GB 1U31A 2J33A 1N34B 4QUHA 4J29A 3WYAA 4I1RA 1S2OA 1CY2A 2C2XA 1KY4A 3NDPA 5TXGA 3R7AA 3WL7A 1UPXA 2B5OA 2B5VA 1GN8A 3C3YA 3QUBA 4UM7A 1QTQA 4G36A 3QBVA 4P4UA 3DKIA 4CI0B 1ICEA 5M7EA 3UF0A 3JQFA 1VFNA 1Z28A 3GN1A 1B15A 4IX1A 4NG4A 4YJ3A 4B4VA 5I9IA 4JFRA 1VPDA 1BWPA 3PHLA 2RGXA 4IPTA 4RCYA 3FTEA 2XJ9A 1GU1A 2KI5A 4LTDA 3MMSA 2ZJ6A 4J16A 1A9YA 1KARA 2OHVA 3MERA 1H2BA 1VE3A 1V71A 2B6NA 4OHPA 4P31A 4ER5A 3QVJA 1I9CA 2ACWA 4N1AA 3WLKX 2PBRA 5JMOA 4D4KA 3ROZA 4DOMA 3OETA 3FUVA 3PGLA 4JT8A 1QANA 1ZRNA 3UXMA 1RKXA 4GPZA 4AULA 3Q72A 1KVUA 4LXYA 2BIFA 3AWIA 5GPBA 4KPFC 1FVHA 4CT5A 2ZUEA 1QH1B 1XVLA 4BP1A 1HQDA 3F8TA 1V2HE 1Z8DA 3QSGA 2YVAA 3TCNA 4CCYB 3CKMA 3VNVA 1S8FA 3RU7A 1P4JA 2GCIA 2VNHA 1UWLA 3PDUA 4Z1MD 1JJAA 1TT5B 2VT2A 4KACA 4ASUD 3OZ7A 1VL2A 3U19A 4X97A 2BI7A 1Z4LA 2H11A 3B7WA 4DUPA 4I6EA 4L5JA 3PUJA 1F1JA 1E7MA 5FYDA 1BEEA 3TUZC 2K7FA 4RKEA 5KVCA 3FTDA 1GZ7A 3TZEA 3SBEA 2VT7A 2DFVA 3HUEA 1TT5A 1ZN9A 3CKYA 5JAQA 3V1MA 3S5UA 1JNYA 4PX3A 4G01B 5BSHA 1GGNA 3ZU3A 1EDZA 3JQ9A 1BHO1 4LDJA 5CDUA 1U3WA 1CKEA 3DEZA 5D3MB 1AF4A 3G2QA 3V8QA 4BPBA 1JG4A 3T5DA 4G5XA 1L4LA 3PGKA 4GL4A 4EA9A 4H7IA 1KJJA 3U62A 3KJIA 4UNSA 2OCYC 3TVTA 3V7YA 5HBGA 4LYYA 3T95A 3LUHA 1UF9A 2RHCA 3PG5A 3GVIA 3NJRA 1HTWA 3O4GA 5IBRA 1RFGE 5IJWA 2WBLC 1BJRE 2R1VA 3WAJA 2Y4OA 3PXDA 2D1TA 3OTGA 4P5PA 4HAYA 2JIRA 2A9RA 1W94A 4KWIA 3CPJB 1YU6A 3A4TA 3FR7A 4L8LA 3SJAA 4LE2A 1MQAA 3K6SA 2IIBA 4Q4AA 5JC1A 1CUWA 3BD8A 2DE0X 2IE0A 3BH7A 4FGZA 3ESAA 1E3SA 1BMDA 1BQEA 3KOMA 1FUEA 1WHTA 1F06A 1LKZA 3PGMA 4WLNA 4A2PA 4MV5A 4AURA 4D8VA 2ZWAA 4I5GA 1EAYA 5BURA 5CVJA 4HP8A 1UK9A 5EPUA 3QJ5A 1GNQA 1GG2A 1JBKA 1WB9A 3WYCA 3OJFA 4FT4A 4ZQFA 3KVVA 5JUWA 9MHTA 1EVZA 3GPBA 2AVNA 4IKEA 1IAQA 2Y1EA 5AJVB 1ULUA 4MR8A 1BWRA 3ZEIA 1SU6A 4LXXA 3QVSA 1G8AA 2X8BA 4YRSA 3BE8A 4C2UA 4C89A 3R74A 1XK7A 2C94A 3A14A 2C4UA 2Q9UA 1DAHA 4PLHA 2VNSA 4DEVA 1G7SA 5TQ2A 4XGQA 3IEKA 5KTKA 4OI2A 1J56A 1LFAA 1XZNA 2FFQA 2KW5A 1RXYA 3BMXA 3ICVA 3EFOA 2JAOA 3OKFA 4YRTA 1H65A 5EWJA 2W9XA 3T06B 4D5EA 4GG1A 1XDUA 1PNRA 3WXBA 4ARUA 1HG1A 3R6WA 4MVJA 4PLFA 5BPFA 4B3GA 2HTEA 5EZSA 3GLIA 2ATCA 4Y1RA 2N3ZA 3OMWA 2HCBA 3A3OA 4LIPD 5JAIA 4JLWA 5DI3B 3X1DA 2Q4BA 2ZYWX 5LDHA 4YUZA 4KFCA 3W7VA 1E5VA 1CIPA 1U6KA 4NCAA 1K5DA 4CFZA 3ZCUA 5U4XA 1FDSA 2XHEA 3ZE1B 4EQZA 1C4XA 1IHOA 2FR1A 3VKWA 2VHJA 3PHCA 1FB5A 3AM5A 2V96A 3OJ0A 2AXEA 2B2XA 2PS3A 2Q5JA 2YHUA 5BWNA 4G2NA 2P6NA 2BFFB 3BK7A 4BVBA 3KZ1E 4H18A 2JA2A 1DV2A 1P7CA 2Q4TA 2VJNA 2Z6VA 3I04M 4OMCA 1CDEA 3HLYA 3Q8XB 5J2TF 3SEAA 5FWAA 4Z4HA 4LOLA 4R2LA 3HVHA 1Y8CA 5EZYF 3SG0A 1XTKA 1QTIA 1JA1A 1JDJA 1V39A 1Y7LA 4MR7A 1WP9A 1QVAA 4OHXA 2O1EA 4CV1A 4G1MB 5JQGB 1Z29A 5K8IA 2FG7C 3GRFA 1CQJB 1P1BA 2FQWA 3OBIA 3LC0A 5FNZA 3QFCA 3EPHA 3U26A 3G88A 5EVCA 3PP8A 2IV7A 4CE6A 5FV7A 4GDMA 1ZX1A 5C2JB 5AVXA 4R68A 5T6BA 3VXKA 3LUJA 5AD1A 2D0OB 3OA2A 3K8QA 4EJ6A 4ZTUB 3VAYA 1T36A 3LX6A 2UV8A 3FLBA 3V1NA 1MH9A 3BJZA 1WABA 1DEOA 2I76A 2I3DA 3PVCA 2BFDB 4HK4A 4P08A 4CMJA 3RYHA 1T5TA 3G2OA 2K87A 3A70A 3EHDA 5CGZA 3A9UA 1GPNA 4PCUA 3NG1A 2PR7A 1HF3A 1PD0A 1XJQA 3P5SA 3TL3A 3IE2A 3I64A 4AMZA 1US8A 4P80A 4W4TA 5D6OA 2HM7A 2F3QA 2BR5A 2R5NA 4LK2A 4F46A 5HHTA 3DEHA 4KIFA 3KR9A 4NR0A 4RY0A 1BO6A 4GP7A 2R8ZA 1RE1A 3WK7A 3EDRA 4X8MA 3SSMA 3E9CA 4P3NA 3HCCA 1G21E 2W6QA 1M67A 1MQ9A 8OHMA 4MQBA 3BWMA 2AG0A 4WY5A 4B2IA 2CMHA 4NABA 4E1VA 1X3LA 4HX5A 1F9AA 4AWAA 4UE3S 4UOQA 2DQZA 4NV3A 2VJKA 3SYTA 1HOXA 4FN5A 5F77A 5FHQA 4MW5A 3ZR4B 3MCTA 4KPUB 1JI3A 3HKBB 1WMEA 4H16A 1V26A 2FI1A 5IVKA 3A7DA 4E5UA 3KELA 2HCRA 2QOEA 2C4HA 1RQRA 2V03A 1PL7A 1BZYA 2WVAA 3EUEA 2E55A 2FMKA 1E2DA 2C04A 4UW9A 2KJQA 5BV0A 3E5RA 1GAWA 3ZW8A 5LMUB 3D3NA 1NF3A 2HCFA 3N07A 4RULA 1E2HA 3K32A 3DKVA 4MYTA 2WM8A 4M76B 4M0UA 1ODKA 3KLBA 2FSGA 4RQUA 2H1RA 3MK31 3Q88A 4YT4A 2HK6A 4QSHA 3ZTYA 4WOCA 5AOVA 2HRZA 2NUAB 3ROQA 5CFOA 5M29A 3V1KA 4I4TB 3D4OA 3B9RA 1K75A 2OOSA 3AR4A 2P65A 1J24A 3GRCA 2QPTA 1FX0A 3QA3E 4H6VA 4WH0A 5DYWA 5EVJA 3QNWA 2NUAA 2QLBA 3CFYA 4LXQA 2B8JA 1WCXA 2YWCA 3AO0B 4NNOA 1G8KA 1KAGA 3SMQA 2YC4C 1SCAA 4KQ6A 3SZLA 3GEEA 5G0VA 2J31A 5AVVA 3WGNA 2VHYA 1B3RA 1NLYA 5JDCA 2UUAB 3NUGA 5AMXA 1W6RA 4MYDA 3RHSA 3UBTA 2AL7A 4UEQA 4YP7A 1PL0A 4RXUA 1UJ6A 2WB4A 4WZBE 4O2AB 1RI1A 3Q9NA 4DPLA 1D6SA 4MHTA 1I01A 2WKWA 2IYUA 3NP9A 5AI5A 4BV8A 4GT1A 5DLPA 5I8WA 5EP1A 2VCEA 3MJCA 2GEFA 3EZXA 3ND7A 4DCGA 1ADBA 2WRZA 3WDLA 2X7JA 1DQPA 1DEAA 4HN2A 4I2VA 3KAPA 4JAVC 2CLFB 1SCKA 4BFTA 1MIOA 4X1KB 4TLCA 4H1TA 4G9EA 4KRYA 2BRUC 2JAQA 5B1SA 4BEWA 3DE6X 4IFEA 2NV2B 2XUZA 2ZT6A 1HMYA 3ZY5A 1LC3A 3IBSA 1EWRA 1LTHR 1MZVA 2G80A 1QBGA 1NKSA 2ZBUA 4AMVA 4D9GA 4WN9A 4GOOD 1I24A 2FWRA 1TZJA 1Q1NA 2ZRLA 4DANA 4ZHQF 1TCCA 3QKSB 5BOSB 2WJVA 3JYLA 1K4YA 3OIWA 1QCDA 4OYHA 3OPNA 4MUFA 2YWFA 2EKLA 4AMBA 5FOTA 1R8XA 4NFYA 2ODPA 2IHTA 1WZCA 1H3NA 4S2EA 4DLWA 4F93B 4R1QA 2JHFA 3T5BA 2WZBA 4AK9A 1A1SA 3CEAA 2HQ1A 2QGZA 4M9UA 3FVTA 2PL1A 1DC3A 2G0TA 3ZGOA 4F5WA 2CFSA 2RI0A 2HU8A 3IHTA 3GO4A 4GECA 1B1CA 5JNVA 1P77A 1JPVA 3VO8A 5G4KB 3BRWD 4I36A 3K2BA 4KO1S 4YP5A 4JI3B 2NMVA 2J0VA 1O94A 4XASA 5ILQA 4AMGA 4BEBA 4M98A 2Q3MA 3PB3A 1B7GO 3IIMA 4C6RA 2HYIC 4IIBA 3V2GA 3JPWA 2CLMB 4LQDA 2ZTSA 1QDLB 1XQ6A 4JWTA 3SXUB 3S2YA 4ZI5A 1BVYF 3D6UA 3HUDA 4P2BA 4RDHA 4EKNB 1UUFA 2BF7A 4F6RA 2O07A 1QIKA 1U02A 4MR7B 2FPPB 1ZGHA 3UOAB 2VJOA 4DY4A 1E1QD 3Q3GE 3EASA 3QMMA 2GCEA 3MWEA 8AT1A 4WLEA 4BNVA 3QM1A 4N3AA 5HFNA 5J3JA 3CG0A 2AD5A 1UBGA 4HRYA 4ZOLA 2X77A 3NHWA 3LT2A 1EUCA 3CC8A 1E59A 1HURA 4X5OA 1M72A 4INZA 4PHFA 1Y5MA 4DCOA 3CLRC 3ABQB 3QK7A 2Z83A 2J4FA 4O0LA 2EFGA 3S1SA 4CXMA 3GAAA 1L7RA 3IIEA 1U8ZA 3S8MA 3BERA 1DT5A 3FPCA 2I3ZA 3T3GA 2F3SA 2JFGA 2PT6A 1J2UA 1ECGA 1WMAA 3KTAB 3BX1A 5J47A 3NWJA 1MC4A 1QFZA 2C9OA 2OHGA 4HNGA 5C1IA 5AUOB 4WD3A 1E1QA 3BWXA 1V9CA 3TTXA 4BMCA 2IU0A 1N2XA 3FIJA 5BRJA 4FFDA 4Z86A 3HQ4O 2NUTB 5T64A 1ZW6A 1JG3A 1EBUA 1KC1A 3I0MA 1V1JA 4WCVA 1TTPB 2IDJA 4RL4A 3ETJA 4MUNA 4UD2A 4OI0A 2XODA 2VA9A 3MAJA 4YRRA 2FEAA 2VQSA 1DO0A 3KETA 3LKBA 3ZVLA 3IQZA 1MGPA 1LV8A 4BKUA 3LVFO 1EFKA 1XD2B 2HY7A 1E5LA 1LJUA 4HC4A 4HDMA 5DM2A 3TKAA 4PBRA 4X62B 1E9FA 1A2KC 1E2GA 3BSSA 3C87A 3ND6A 3F67A 5EJ9A 1GKYA 3WG9A 1DDIA 3UWMA 1O4WA 2R6AA 4H2DA 1RYBA 1UK6A 4B46A 2O8FA 1U2DC 2B9VA 3LGAA 3AJEA 3KUCA 1QIDA 1U9IA 2Q5OA 3IXQA 3NBAA 3CXUA 3R7FA 4CDMA 4ZOQI 3QKIA 5B3KA 1Y82A 3I2JA 2WOOA 2G28A 3SNKA 4WZAE 2ZE5A 1D03A 3ILYA 5CM9C 1NMQA 2FPXA 2OXCA 2J3JA 1O95C 2Z43A 1OC2A 3C41J 3M33A 4P54A 4ISBA 2B6HA 4LYGA 5KAMA 3R0IA 4UTPA 2XCOA 5HR5A 1U4OA 1GUDA 1YBFA 3ZJVA 5AVTA 4KRGA 1KK2A 1XE3A 5DBFA 5GONF 2GX6A 1ULTA 1LVUA 2NVOA 1NFRA 2UVPA 3CE9A 5EOVA 4QUDA 2P75A 2O5VA 3WLLA 4URWR 3M6MD 3ZIAD 1TRHA 1U8EA 3M9WA 4DA9A 1AQUA 2R48A 4IGAA 1X38A 1FBTA 4J3NA 4DQUA 2FF5A 2JLYA 3T4XA 1E7QA 1UM9B 5AW3A 2CUKA 4LDAA 5AW6A 3ICQB 4PM4A 1J1ZA 1JHPA 2AMFA 4LECA 3LT0A 3WYEA 3EDYA 5KC8A 5JYFA 1JI0A 5AM4A 5CU7A 4G5YA 3BXPA 5K3FA 1ZAKA 1DS6A 3AYZB 3G5MA 3GJ6A 5DNAA 4JV5B 2XUOA 4MI9A 1Z2CA 4QLAA 3MELA 3OCZA 5ARDA 5FPYA 4M7OA 1N5OX 2MWMA 1Z45A 4K2HA 4G0XA 1XZDA 3HH8A 4C5BA 3P2IA 3FHTA 2ZSDA 2YICA 2LIVA 3RS8A 1JHUA 2JZNA 3RPEA 3NATA 5JNRA 1S0UA 4UATA 1VB5A 2WNIA 4MWBA 4AKGA 1QP0A 4DHEA 3DAOA 3PGVA 4FWIB 2XW6A 3NWOA 4XUDA 2O8BA 2HB6A 4RPIA 2GN8A 1TW2A 2BBSA 2HHCA 3KVYA 1S01A 2I4MA 4U0KA 5FQNA 3H2IA 5DBGA 3UJ9A 4RK4A 2YS7A 3D8SA 1GA4A 4GVPA 4D0RA 4BGDA 4RJLA 4PYKA 2LIPA 1PX2A 2BH9A 3IWCB 3A3YA 2V7UA 3GWZA 2PPLA 2ZUWA 2ZSAA 4ZICA 4IHAA 4NQZA 4X24A 3THWB 2WTMA 2NXEA 4NOLA 4M1MA 3SZ3A 2BTEA 3MCZA 2HBYA 3C4JA 4YMLA 1PZFA 1VKJA 2QAIA 4P35A 3HU5A 3CHYA 2BGLA 5DTJA 1NTRA 2DKNA 2XXJA 5E7IA 1FA9A 1GGHA 1NW9B 2IEZA 2NXWA 3AGPA 4QE3A 5HJ2A 1IUKA 4DV0B 3K9HA 10MHA 4HQ0A 4X3OA 2WVGA 4LYHA 2CVQA 4NHOA 4PF1A 3PSHA 4AJEA 4MPJA 2I6SA 1D6MA 2G04A 2TMYA 5HA5A 5ADVA 3NNNA 4N8SA 3B1WA 4ZQCB 3LBFA 4N47A 4IHJF 3RS4A 3GLGB 2OCLA 3FVWA 5EZYB 5J4KA 2RHLA 3W6OA 6ADHA 1BQ4A 4MR8B 5DTQA 4DMHA 1JE1A 1MOPA 2AN9A 1KS2A 1ZN2A 3GUCA 4AZ0A 2AFHE 2FUEA 2ZJOA 3VO1A 4RY9A 5ICCA 3WLFA 3RC7A 2YJ3A 4A6XA 3M70A 3PWSA 4XFJA 3SR4A 2JFVA 2QTVA 3HJHA 2JGDB 2AFIA 2XGGA 3RFXA 1P60A 4FW9A 4R16A 2HNBA 4IWNA 2NSJA 1C9DB 5BORA 4XD7D 1ZHFA 3PNVA 1JP7A 2ZWIA 1NT4A 1H1TA 2YS6A 2J6BA 4BAZA 4RVNA 2ES4A 2FPWA 3M5DA 2XF8A 1QF7A 3GDHA 3HJRA 4Q19A 2PGXA 3REFA 3QEOA 4C03A 4N03A 1CEEA 1GARA 5JO9A 2DF8A 4JJEA 2H06A 4I81A 3DMTC 4WIAA 3ZKAA 2QYOA 2DBYA 2JEYA 4M0FA 1QRTA 4E51A 4OQNA 4FZ3A 4MAAA 1JJVA 1V7ZA 2XDWA 5FUBA 1UODA 3H9QA 3FAZA 2GZMA 3K8OE 1B8VA 3PCTA 4TL8A 1ZH6A 4ZVUA 1L5KA 2QRNA 1E61A 1M2VB 2VDPB 4MPDA 5JPDA 1VTKA 3E7PA 4EG5A 1W5FA 3M5WA 2X5OA 2XE6A 1X7XA 3GDGA 5EE5B 3WDMA 3CO0S 5IYZB 3IEIA 5JYCA 3U4QA 3AERB 3W6UA 2X8AA 1VKRA 1L1QA 5LU8A 4M8IA 1CP3A 4FMBB 4XOIA 2JRLA 1Z16A 2ZBQA 3WXMA 2EBFX 1ZVMA 2VCHA 3GEMA 4RQBA 2P30A 1QRUA 1BD3A 3U4CA 3QE9Y 1N2EA 4AX8A 2XMRA 3KU1A 4QECA 2D8MA 1IBRA 1WPQA 4J3JA 5E9QA 4ZYUA 2IL1A 1BFKA 2PGNA 3DLCA 4GX1A 4C29A 5BUZA 4W9RA 3C5HA 5JYDA 1OZGA 4KPYA 4ALJA 1AKQA 2PUVA 3FCCA 3KQOA 5IW8A 3WIVA 4F1KA 5EMNA 2Q3CA 1I2ZA 1X7HA 4B2PA 5JWRA 4OB6A 1MPTA 2QIPA 4QGHA 2Y92A 5E2AA 1ZOOA 1X1EA 2X9GA 1G6HA 1T15A 2ZUFA 2QI9F 3IWDB 1Q16A 1TVMA 2BFNA 3GLFB 5EQDA 4RVFA 4V02A 2R60A 3EVBA 2Q5QA 3DKPA 4MDFA 4CF7A 2CXPA 2ZAIA 1TI7A 2P6OA 3KQSA 4XLLA 1PGNA 1RTTA 4AP9A 2JJYA 4EUNA 1Z8HA 2W58A 3M1LA 5BW8A 2X5KO 2GCGA 3K96A 4WXPA 3UO8B 3DXXA 3HI4A 2O7NA 4RYLA 1VJ1A 3GEPA 2CXNA 2WYUA 5FYQA 5JZBA 1Y8ZA 4TKUB 1V3UA 3HVIA 4YAGA 4J3FA 2EHDA 4LC9A 2WPNA 1PG0A 2YHIA 3BXEA 3TI9A 3ZQJA 4BO9A 5T57A 3AL2A 1JECA 2Q46A 4KQMA 2GN2A 2DECA 4IG9A 4B9AA 3QFSA 3FGOA 4Q39A 3TLGB 3SWWA 1K8YB 4PG6A 2X4LA 4FGWA 2Q1WA 4L8YA 4P0TA 2QTTA 1V41E 2YW2A 5ILGA 4F8YA 3EIWA 4FOPA 5F78A 1HFWA 3I2HA 4IIDA 4BL5A 2RGNC 1NY6A 3KV3O 3EVNA 2WUDA 2GZHA 2ECQA 3AJRA 1WCWA 1K3FA 3E05A 1WCIA 2Z56A 3F5MA 4MRMB 1QYIA 1V96A 3R7NA 4YLEA 3DA8A 2NVUB 3NM6B 4ALMA 2GT1A 5T73A 3BCUA 3CRRA 4WOBA 4ZCPA 4D8WA 3F9IA 1D2EA 3IIJA 3C6KA 3THYA 1U2QA 2O2EA 4C14A 3GLGA 2AC2A 3EVGA 3FMGA 2H7XA 2NVBA 3FSRA 4K6CA 1FNDA 8ADHA 2GH1A 5A5VA 2CL0X 1FDRA 1RRPA 3AW8A 4XUEA 1VXRA 4GKKB 3ZWMA 4RFSB 2ODBA 1CY4A 1JAXA 3AHIA 3ESCA 3GCWA 3JAKA 1PFGA 3OQVA 3G17A 4AY4A 3PWZA 3RVBA 4G56A 2J67A 4C87A 1II8A 4PGHA 2ZJBA 4GU5A 4G81A 1OXKB 4IIGA 3T94A 1RZRA 4DC9A 1N6LA 3REQB 2BDTA 3RV4A 2BKVA 3FRJA 4OK6A 1KMNA 4MIOA 1KRHA 1ZNWA 4OKSA 1C3LA 2RCYA 5P21A 2AQ8A 1II8B 1N7GA 1KKUA 3UTDA 4HH1A 3MRVA 5B1IA 1E0KA 1Q3TA 2GAAA 4NVRA 3ZI7A 3OPVA 4XEUA 3ISTA 1U98A 4M60A 3H9UA 1AKUA 1X0VA 1L4YA 1L5QA 2FXVA 4FUTA 5AT1A 3OU7A 2BHTA 1NRIA 2CHUA 2P9JA 4V38A 5AIAA 1T2CA 3LYHA 1ODLA 4FYYA 4M53A 2Q9CA 3T7AA 4LHXA 4EZBA 3I72A 2EF0A 3NC4A 2JNWA 1B8OA 2R1UA 3AEXA 3OF3A 3BBPA 3O8QB 3RVOA 5HPYB 1NY5A 4QOHA 5A06A 3HDVA 4BUCA 3ZY3A 3WL5A 2AJ8A 1KYZA 1UBMS 4IIFA 3COYA 4ZDJA 1A9XB 4GXQA 5AKKA 3N58A 4CL2A 4DVGA 1PQPA 4JWKA 5I7AA 2CEKA 3MYYA 3WBKA 1B4DA 3MLBA 1TAHA 5K0BA 3AESB 2POQX 4UM9D 3SYLA 1VSBA 5IM4A 4C7KA 3DP7A 1JIQA 3WTBA 4S12A 4HZUA 5DISB 2RB5A 2VYVD 2YJTD 2CV2A 2W6MA 1CQIA 4LZZA 4LYJA 3OIVA 3W5UA 4DIMA 2XLBA 1B41A 2ZB3A 4X6LA 1WETA 2PUAA 4CEJA 1E96A 3O5AA 4ODIA 4CM1A 1SUFA 3CUWA 3RYFA 1NU6A 3T7CA 4LJLA 1YOBA 1J70A 3DYIA 4TMZA 3ADKA 3SEZA 1U7WA 3IJ5A 1DX6A 2B21A 3GRYA 5J9GA 4JQCA 4CQMB 4HWSA 3OJWA 4PRZA 1QLJA 1L8XA 1IZZA 3PFHA 1NVAA 3TZHA 5L45A 3O0TA 5JMWA 1A0OA 3ZLVA 3I62A 2P0AA 2VXOA 4LF6B 3V7FA 4PZUA 4FKBA 2YFQA 3OPYA 2WYHA 3AERA 4ZVKA 1DAFA 2WIKA 2HRBA 1I7CB 3WI7A 3Q2IA 4FILA 4D6PA 2ZRCA 4JQZA 1AUQA 3TGWA 3EE6A 4KV9A 1NVDA 1B6RA 3D02A 4U8HA 2WF5A 1X8JA 4PAQA 5BSKA 1BN6A 3EDCA 3SLGA 4A0QA 1JUDA 2IYAA 1M8JA 3KK0A 3HUTA 5ALGA 5DO9A 2Z4RA 4IVQA 1S3GA 1VG8A 1JU3A 1PJ4A 2DQ4A 3ETEA 3WK6A 1BDHA 2OGSA 1E1NA 3HCEA 3PJRA 3GJSA 4MO2A 4JLVA 2QRJA 3PFGA 3VPXA 1QH1A 4Y2VA 4EHFA 5DIFA 3VSBA 1DOZA 3ZTWA 1UKAA 2FZ5A 4UQPA 1WDKA 1O96B 3UUWA 3TMKA 3G2MA 1C7RA 3KE9A 4FTWA 2WINI 2FSHA 3DBRB 3KEFA 4K6KA 4LX0A 2GTPA 4RD0A 4KOEC 1JG2A 4R7GA 1PW5A 1FNCA 2VQ6A 3M1IA 4US2R 3ET5A 3R6LA 1VYHA 3S44A 1STOA 4R0VA 4WPGA 3WZMA 2GFIA 3AOEC 1NYLA 1VGRA 1YJBA 3DFZA 2EZ9A 3E35A 3GLTA 3JQPA 4QNRA 4U7FA 4UHJA 4N5HX 3GLIE 4KQFA 4QRIA 1I3OA 1XRNA 3AFGA 5KMGB 1UZLA 5A4KA 3WRXA 4ZKEA 5IVIA 3UANA 3VPSA 2ZI5A 2FB9A 3U7QA 3UB3A 1I3NA 2DB3A 4CDNA 4C01A 4QTXA 4TTTS 5F4ZA 1J8VA 1V7CA 4F96A 2Z2IA 1M54A 4MIEA 1K5HA 1LPBB 1Y7HA 2QQFA 3KR2A 3KM0A 4BIIA 3COWA 4HEHA 3WWEA 1SUPA 1WZUA 3VUFA 4GL2A 1DKLA 4EVSA 2G5PA 3GJXC 3UG7A 1QDEA 4L72A 2PSHA 5CCBA 3VTAA 2GERA 5DMXA 3GAZA 4BQSA 4D3SA 5LM3A 4ND1A 4OI1A 3AJ9A 3I05A 4EMBA 3I04A 1QK4A 2V6BA 3PA8A 5FPQA 4IJ6A 2O8NA 3GP5A 2FW6A 5AYVA 1J7JA 4IDHA 4F84A 4YJ2F 4IIHA 2LP4Y 1JEYA 5AIBA 3HHEA 5KSYA 3MJRA 1ZKMA 4OHUA 2B3DA 2ZRBA 4Q48A 1E89A 2JAUA 3LDFA 4H17A 5G53C 3TBKA 2DWOA 4F56A 5B2EA 4CLRA 2G17A 4U9HS 4XGRA 3TNJA 1V5IA 1XAGA 3OY7A 4UBOA 2CLLB 4BJ6A 4AJ4A 1CUCA 4POOA 2P2DA 1TA0A 2WFAA 5CT8A 3AUJB 2OD7A 3OH8A 5JSYA 4QXQA 1DEHA 3KYBA 4QPZA 2P79A 1X6VA 2AE2A 3JQ7B 2QYSA 3LWDA 1DO8A 3A11A 4KRFA 2XSZD 1G3QA 1NUTA 2KPOA 4Q9AA 5JBNA 1KTIA 1ENPA 4AF6A