4YWJA

Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
MRRIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNLCLKLLDTAARVLGDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALWLEGKENGLYDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
total genus 79
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ywjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ywjA01
3KYBA 5TSDA 3O4RA 5AXCA 1CJCA 3F1LA 4FSHA 4RVDA 4UVDA 3RUFA 1UP6A 3H8VA 1LU9A 1GY8A 3PYXA 4MIEA 2AG8A 2YUTA 3E9NA 2VZ9A 3LT2A 4BNFA 4BNYA 1BSVA 5GY7A 2Q1SA 3V1YA 2P91A 3H7AA 2Q4EA 2Z5LA 4LCEA 4RPJA 3ROPA 1QYCA 1A4IA 3EW7A 1DAOA 4IDBA 1PGOA 1X1TA 4OJNA 4XQEA 4R5HA 3LF2A 2YJZA 3G17A 3DTYA 2EG9A 1NWCA 3R1IA 1KS9A 3PVZA 3ZZNA 3ROMA 4PLVA 1AHHA 3D1LA 4B8ZA 1LC3A 1N2SA 3HHPA 4CLRA 3AUUA 1PJBA 4E5KA 4PG4A 1JAXA 4UEJA 4BKUA 1QV6A 1MA0A 1WXDA 3H65A 1EDOA 2FRDA 3A06A 4FN4A 2X9NA 4CR7A 5IXSA 1ZEJA 3BAZA 3DBHA 1DLIA 1SEVA 3M2TA 3DHYA 1DRUA 1C1DB 1B3RA 2WSBA 3T7EA 5JCXA 1ZUD1 4GSLA 3UCFA 2P68A 5C7OO 3DAFA 1L1FA 4EZBA 3RUEA 4CLEA 3PPIA 4TKMA 3QY9A 2NTNA 3GF4A 3LYLA 3Q3CA 1GPJA 4J2OA 5JO0A 1DRWA 4YJHB 3KRTA 3JQ9A 2CDAA 3RKRA 4BKOA 4BKRA 5KKAA 4OOFA 3ULKA 4WJZA 5TT0A 4YEDA 3BTSA 3FR7A 1YGYA 5ENVA 4BV8A 1QXSA 3RBVA 4NBWA 3U4DA 3IOYA 2B4TO 2BGMA 3S2FA 2NVBA 4YPOA 4WLVA 1C3VA 4CV3A 2GZ3A 4AJEA 4PG6A 3L6OO 2P9EA 1FF9A 1P1KA 1F0YA 1E1MA 1Y8QB 2CDBA 3HE3A 1MB4A 3U4IA 5GMOA 1IZ9A 2PH3A 5BSGA 1ZEMA 4BQPA 2VHXA 2DUUA 2FPIA 5JLAA 4BB5A 4WLFA 3PI7A 2WD8A 2NVUA 4WEQA 5EQDA 5L7YA 5THQA 2C59A 1ZNQO 4Q3DA 3H5NA 3OJEA 3ZDFA 3AM3A 1XU9A 5H82A 5KCZA 2YY7A 2HSDA 3OF2A 4KOAA 1MV8A 3DWFA 4WCDA 2F00A 5C37A 4R1UA 1HTBA 4CQLA 4EUFA 4S1VA 3ZWAA 4GBJA 3GZNA 3OECA 2X86A 3WBBA 3BHJA 5IDWA 2IODA 3PHIA 3H6KA 4R1NA 1OZAA 3C7DB 3OJ0A 2BMAA 2NACA 3NDJA 1VL8A 5A4DA 4XA8A 1V3VA 2I9PA 1DRVA 3MJ4A 4BNVA 3GVHA 3IC5A 2CDCA 4YB8A 2NTJA 1U2DA 4YQZA 4LW8A 2PZLA 3PWSA 3GC6A 4HNHA 1HDYA 1CRWG 3G1TA 2EP7A 2JFGA 4ZRMA 3JSAA 4NJMA 2GO1A 4GVXA 4NFYA 6LDHA 3FSRA 3GGPA 2Y67A 4J7UA 2YZ7A 2FPGA 2W2LD 4IINA 4CLOA 1UXHA 2Q1UA 3U0BA 1OC2A 2VCYA 2F1KA 3OIDA 1YJQA 2J6IA 3VZSA 1CF2O 2WYWA 1WZEA 3R3SA 1PGNA 1T24A 2BFOA 2YFQA 1CEQA 2ZIZA 4GWKA 4WLUA 1YBVA 1NHGA 5KOIA 3VVCA 4EYEA 2I3AA 1O8CA 3QLJA 1WNTA 4FFPA 1VPDA 4RF4A 2UUOA 4CL8A 3I3OA 3D5QA 3FWNA 3GG2A 1BW9B 4A27A 2EKPA 1LDNA 2X22A 3JD2A 1QMGA 4CQMD 3H5AA 3WJ7A 4YJFB 1DC3A 2RAFA 4OIMA 3T4EA 1JKIA 3GRKA 1IPFA 1JW9B 3Q1LA 4MIOA 4MVJG 1FDUA 2UYYA 3NAQA 1PJ3A 1GTMA 3HN7A 5KJ1A 3PLRA 3O8QA 4FOSA 2VRBA 1HDRA 2EGGA 1NPYA 2D8AA 3I6QA 4GLOA 4DUPA 3CMCO 4QFDA 4UREA 3F1KA 3ZI0A 2HKIA 3U49A 4NPCA 4J1TA 2C0CA 2VYVD 1GEGA 5IZCC 1E7MA 1T2FA 5AOVA 1SOVA 3L07A 4BO1A 3ITDA 4HFRA 2IYPA 4R9RA 1XEAA 3SLGA 4TKLA 5A9SB 4PLHA 3E82A 2JFHA 4Y9DA 2HJRA 4XJSA 4YYZA 2GDZA 3HWRA 4Y6SA 1U4SA 4TRMA 1ISFA 4ALLA 3E6AA 3D3WB 3L4BC 1E6EA 3CH6A 4DLBA 1PR3A 4XYLA 3GQVA 4PGFA 4L8VA 3LF1A 3NJ4A 4ALKA 2P2SA 3PDUA 1OOEA 4H16A 3WGZA 2AG5A 2WM3A 3QWHA 4WGGA 2HMWA 4R01A 2ILTA 4IS2A 1LLUA 3D64A 2YHUA 5MDHA 1DHRA 1HETA 4FB5A 4XYEA 4JLWA 3QVWA 1E3IA 4NBRA 1O0SA 4A03A 4MKRA 1EMDA 5L53A 2DFDA 1LRLA 1SB9A 3DBRB 3E03A 2Q2VA 3GNSA 2PA3A 2VZ8A 1VKNA 1I2ZA 1R12A 4XYGA 3X2FA 1AN9A 1SMKA 3MWDB 4O59O 4CR8A 4YAGA 1RPNA 2I76A 4K1LA 1DPGA 4RPLA 3HDHA 1P0FA 4Q3NA 4R5MA 3TDKA 4FJ2A 2OORA 4L9RA 1ONOA 1R15A 3VH2A 3WGTA 3JQFA 1KERA 3A9WA 4FJ1A 1T2CA 4RF3A 1PEDA 3RAJA 2VHWA 3KB6A 2B36A 3RC2A 1D4FA 4PVDA 3P5SA 1DC4A 1HYHA 1M67A 3JQCA 3FD8A 5ITWA 4EW6A 2GNAA 1E6UA 4I9UA 2JCVA 3JQBC 1UP4A 1ZZEA 5B37A 4BNMA 3IUPA 3WLEA 3C7CB 3ZU4A 2ZYAA 4BO2A 3ZWVA 4B4VA 1DOHA 3OJOA 3H9UA 1ZO8A 4G81A 1VL0A 4R3WA 3HFGA 4OYRA 3DOCA 1G1AA 2CD9A 3HADA 3ITKA 1G0NA 4P38A 1FJHA 4E4YA 2TMDA 4IMRA 4TROA 1B16A 4L76A 2VNAA 1TEHA 5JS6A 1YONA 3IJPA 3QWBA 3ZWOA 1C1DA 3IS3A 3MOGA 4PZDA 1XIVA 4CMBA 3R0IA 1SAYA 1R0LA 3TSCA 2ZB7A 1E7WA 5A5FA 1PJ2A 4NI5A 1AXGA 1Z75A 2DTXA 1UDAA 2HMUA 4KMSA 2PFGA 4TZKA 5JY6A 2QZZA 4G65A 3TZQA 2W4QA 4QO7A 4W4TA 5EQFA 4YJHA 2X1HA 1RM3A 1P33A 2UAGA 4WEOA 5HA5A 2E48A 1H9BA 2QW8A 4Y8VA 4M54A 3OIFA 4N5LA 2R00C 1I36A 3PEFA 1LSUA 1SBYA 3WR5A 4NK5A 2X5JO 1M6HA 4BKPA 3PGXA 2A94A 1LJ8A 1N1EA 3O38A 4FDAA 4LMRA 3O03A 2WYUA 1J5PA 1LDEA 1X7HA 5HS6A 3CSDA 2Y93A 5KJFA 5A05A 3RC9A 3O9ZA 1ID1A 1Y8QA 1FDSA 1JTVA 3KYDB 4Z9FA 3ZWNA 3ZN2A 3V5NA 3DB2A 1E1NA 1ZJZA 2FZEA 3OQBA 1FDTA 2Y0EA 2HK7A 8ADHA 1ORRA 3D4NA 5JC8A 2Z1NA 2V6MA 1T25A 5F1PA 2O50A 4DA9A 2FOIA 2BF7A 2YV1A 4GPD1 3GDFA 4DQUA 2O3RA 4WCFC 1DFHA 1Y1PA 3M2PA 3D5TA 4N18A 4FIZA 4ZICA 1U9JA 4CM6A 1YJ8A 1PWXA 3GLQA 2O3QA 2PZJA 3OJFA 4HFMA 4P4NA 3FPLA 1NBOA 5ES3A 4PLFA 1ZFNA 1ULSA 5L4NA 3OSUA 1KIFA 1HDZA 2OHXA 4E2YA 5ICSA 4K9DA 3UFXA 4PFJA 5L9AA 3BYZA 1DC5A 1ISGA 4ITUA 3PFWO 4XGNA 4XB1A 3LSYA 1T2EA 1YB5A 4MINA 4Q3AA 2X9GA 4XQCA 3D3EA 4XR9A 3GK3A 2EW2A 4C7JA 1P1HA 3HJAA 4CLXA 1U3UA 3OM9A 2QIOA 5T8KA 3DBLB 4BKQA 3NX4A 2NTVA 3HUDA 1P0CA 3KLMX 1QYXA 1KC3A 3CZRA 3HDQA 4YVFA 3JTMA 4U5QA 5AXAA 1I2BA 1I3KA 3HSKA 4IZIA 1Z74A 3WGOA 1UH5A 2G1UA 3EK2A 3Q9UA 1EUDA 2EKQA 4I9NA 4QEDA 5B4TA 2C2XA 2HJSA 1B14A 3N74A 4YAKA 4GWGA 4PIVA 3I9MA 4D0RA 5IDXA 1XELA 1BXGB 1HRDA 4EITA 3GT0A 3GVIA 4OAQA 1EBFA 1I3LA 2GN9A 3WMXA 4XJTA 3CINA 3Q2KA 4MPDA 2Q46A 4Q3BA 2XPCA 4P8RA 5IAAA 2BKAA 1BW9A 2FZWA 4QUKA 4R9SA 4RVFA 5JDIC 4IJKA 4JP2A 3GR6A 2I6TA 1M66A 3F5QA 4YJFA 1SPXA 3UN1A 4A0SA 4NDNE 1LLDA 3PZBA 1UAYA 1Q7GA 2B5VA 3DZKA 4HADA 5IG2A 2GSDA 1DO8A 2Y05A 2RHRA 5TNXA 4JQCA 4LRTB 4Z6KA 4LISA 4CM3A 1IY8A 3AUTA 3PGJA 4Y67A 2BFMA 3RVDA 2JHFA 5L3ZA 4RV9A 4AJ1A 2J5QA 2GCGA 4BV9A 4IDCA 3VPFA 2PD6A 5G0SA 4FR5A 2DU8A 1YQXA 1NQOA 2GRAA 2Y1EA 3I9NA 3VPSA 1MX3A 3Q11A 3DFUA 1DIGA 3EGOA 1B2LA 3L6EA 5G0WA 5A9SA 2PNFA 5U1PA 4F46A 1OAAA 1KVRA 2NQ8A 2PWZA 1N7GA 4RQTA 4CJXA 4FGSA 1U3TA 4J7XA 4BHTA 2C29D 3PJGA 4KQWA 1P9LA 3C1TA 3D3WA 1HSZA 1A71A 4GAEA 1DFGA 3S2GA 3A4VA 2WWRA 3H2ZA 3UCXA 1D8AA 3UHAA 3DMTC 1C0KA 4MVJE 4CM9D 1YS4A 3E9QA 4NHEA 1LQUA 3DZIA 3CUKA 1LSJA 1NQ5A 2DAPA 3HFSA 4LN1A 1LC0A 1NNUA 2DLDA 1ADFA 1A9YA 4K28A 4GKBA 1KC1A 2O48X 3GFGA 1CIVA 1F8GA 3DBRA 3RD5A 5DOZA 1DIBA 4JBIA 4MVJA 3GGOA 2YHIA 2EKLA 3ONFA 4HKTA 3OEYA 4BNNA 4BS9A 4PLCA 1VJ0A 1HL3A 3RJ5A 1EEHA 3MEQA 3OJLA 4CM8B 4WPGA 4YTEA 1N5DA 4L4RA 1YWGO 3GVXA 3F5SA 5H81A 3ROKA 4CV2A 3Q9NA 1CYDA 2PD4A 5TX7A 4DREA 1CETA 2JHGA 2XXJA 4CQMB 4IMPA 5ENDA 3VVBA 3ZWXA 3ANNA 3OP4A 4B7CA 1IHXA 2DBRA 2WE7A 2I99A 1MFPA 5ADHA 3PTZA 1HE5A 1QYDA 4E21A 2V6GA 4CV0A 3WFJA 3N58A 4D44A 1BMDA 4BO3A 5A5EA 3QQPA 1ZCJA 3V1UA 2BI8A 5IDYA 1DJNA 2VOEA 2P4HX 1HDCA 4DIBA 2JKVA 5ILGA 1C0LA 4J4BA 3TJRA 2BGKA 1YL5A 4ALNA 3MOIA 1QKIA 2ZB4A 3P7MA 2BH9A 3VDQA 2J3HA 2Q99A 4LVCA 3HDJA 3WTBA 4W7IA 1S6YA 1UXKA 2EV9A 2HCTA 1X15A 1ML3A 3KUXA 4BOYA 2PZMA 5KKCA 2ZTMA 5CG1A 1QP8A 4HWKA 4GMFA 1M76A 4RVHA 1I8TA 1UAGA 3OBBA 4GL4A 4CMEC 5H83A 2G0TA 3BMCB 1U5AA 2LDXA 1XA0A 4J6FA 4JP3A 1HZJA 3RUAA 4PLWA 3GPDG 2OUIA 3WGIA 2I67A 3F4BA 2B37A 1H2BA 2CSUA 2XXBA 3PIDA 1ONPA 3JQAD 5BNFA 4AICA 4FFLA 1TT5B 3GMDA 1D1SA 5DCUA 2PH5A 5HWSA 3WGYA 1IL0A 1I3MA 2D4AA 1PS9A 4URFA 1H6BA 2AQHA 3I5MA 3LLVA 2O4UX 2UDPA 5CDYA 3I1JA 4L4SA 4RGBA 1CWUA 1GQ2A 3COSA 2X0RA 2YFHA 4B3HA 3BZUA 2I5PO 2OGUA 4HBGA 1C0IA 1ULUA 3GEDA 4E2WA 3ASUA 3P19A 1X7DA 4W99A 3KYDA 4RVUA 2DT5A 3WQQA 3WBFA 1HDXA 2C2YA 4BGIA 3C7AA 1TXGA 4OM8A 1KEUA 2Y1CA 3LC1O 4NK4A 4IGFA 5CPFA 1MG5A 3VKUA 4JXKA 3H3JA 4Y6RA 3F6YA 1JWBB 1GDHA 3DHEA 2NQTA 4WASA 5I7SA 2HRBA 5T64A 4ZVVA 3L0DA 1FMCA 1PWZA 5CG2A 1KYQA 3DC2A 3PHHA 2HRZA 4BO6A 4JJIA 3G3EA 4ZA2A 2DPGA 2AEMA 2J3KA 3RBXA 1NWHA 5JAQA 4XRRA 1LSSA 1WDKA 3C8MA 3MTGA 4EDFA 1R37A 4MOWA 1JAYA 3DEYX 5HM8A 2POQX 3KSDO 1R4MB 1DB3A 4MP6A 4DRYA 3DR3A 5A3JA 2TMGA 3RSHA 1WZIA 1Z82A 4IDFA 3LU1A 2O2YA 3SJUA 4B79A 3DBLA 3GOHA 5BSEA 4DTIA 3IMFA 2B83A 2NU6A 3WQRA 3FI9A 1H6AA 1YVEI 1DDOA 3H9EO 2FPPA 3SC4A 2Q1TA 2RCYA 4E5PA 4NQZA 4BO4A 1UZMA 1M2WA 1ZK2A 1EBUA 4EEZA 2PK3A 4K6FA 5LDHA 4XB2A 1PJSA 2DBZA 3NTQA 3JYQA 3OQ6A 1HE2A 1BXGA 3B1FA 3PXXA 3H2SA 5F5NA 4LGVA 4FFMA 4J43A 3RU9A 1GUZA 5EL0A 1P3DA 5HTOA 3NV9A 3QVXA 1BXKA 4RDIA 1PS8A 2E4AA 4DBVO 3I9LA 4UUOA 1RYEA 4ZQEA 4XIYA 3MWEB 4TRJA 3NKLA 4ID9A 3DBVO 2BRUA 3VHRA 4RL6A 4D43A 2YV2A 4KZPA 3ZNOA 2D5AA 3H9JA 3FTNA 1X0XA 4WOKA 4D7AA 2PV7A 4LVUA 2YYYA 4AJOA 5KVSA 1DAPA 1GU7A 5AVOA 4R69A 1KETA 1F06A 1LTHR 4NG5A 3K73O 5JBIA 2W2KB 2VHZA 1N1GA 1UXJA 3K92A 4YAIA 4HFNA 1H2HA 1R16A 3WNQA 2B69A 4WNCA 1MFZA 5K6AA 2FR8A 4W9NC 4RLSA 4DIFA 4NMHA 1RM5A 5EJ2A 2Y68A 4RJTA 4BNXA 4JN6B 4EI2A 3ZGYA 4PZEA 2X0NA 4CM5A 4JCOA 1F12A 2X8LA 3OQ1A 3UGKA 1UDBA 3RFTA 4ZGWA 3DQPA 1HWYA 3MZ0A 5EN4A 3BTOA 2OP1A 2NV6A 3AJRA 3NDIA 4ND3A 2GERA 5G0UA 2BLLA 1E7QA 3I4FA 1A9ZA 3HG7A 2J8ZA 4FQ8A 5DBFA 3LT1A 4JJGA 2HUNA 5IF3A 4OGWA 4P4GA 1XU7A 3KV3O 4RQUA 2FMUA 1UUFA 5JE8A 1GQQA 5L7TA 3NDRA 1VJ1A 4DPMA 2RH4A 1HXHA 1PL6A 5CDSA 3EZLA 1JKFA 1ZH8A 4BNLA 2Y1FA 2UVDA 1ZSVA 2W2LA 2AW5A 4BGVA 1SC6A 1HT0A 3F3SA 1J4AA 1HLDA 3WNVA 4J4TA 3U09A 1HE4A 2JAHA 5K0ZA 3WIEA 3K9QO 1Y8RB 4KDFA 3ZV3A 3VKVA 1W4ZA 1C14A 1ENZA 5IN4A 5I8ZA 2GR9A 3PRJA 2AQIA 3BTUA 2G82A 1PIWA 3FTPA 1KVTA 3VAZA 4Y98A 3VOSA 1PQUA 4RCVA 4BNTA 4CM8A 1WWKA 5JMPA 5TT1A 1P74A 1SOWA 2B35A 2Y66A 4J1SA 4XD2A 1IUKA 5L4LA 1BVRA 1DJQA 5G2OA 5FYDA 1NR1A 4CQMA 5J23A 1F17A 4CL3A 2VTEA 4IZHA 1NXQA 4A26A 3GH3A 4Q3CA 2DC1A 4JBHA 5GZ1A 3D4PA 3PHGA 4PRLA 3IKVA 4AJ4A 3A14A 1I3NA 1PZEA 4XDZA 2RH8A 3PQEA 4O1MA 2VZ0A 1V35A 3LDHA 4NBUA 4OMUA 2X58A 4FGWA 4R16A 4WKGA 4CM7A 3TZ6A 1NVMB 1SCUA 1EUZA 1KBZA 2W90A 5KVCA 2VYVA 3CEAA 2EXXA 4ZU3A 3NUGA 4DC0A 1E3JA 3AY3A 1ZBQA 5L4SA 1VI2A 4XZ3A 2Y1GA 4EEXA 3GUCA 4JX8A 3DMYA 3RU7A 3ABIA 1QG6A 1PGQA 2J3IA 4CUKA 3AUAA 5T73A 1LBEA 1AUPA 5G0VA 3M6IA 3A1NA 1RJWA 3OIGA 4QXMA 5JO9A 2DUWA 1ZMOA 2OFPA 2C20A 4PLPA 3ZHBA 4M89A 4BQRA 5B12A 4OHUA 2Z95A 3HB4X 3BMCA 3Q6IA 1RM0A 3PQDA 1J0XO 4O0LA 1ZKMA 1Y9EA 2FWMX 3K6JA 5CPBA 4AVYA 3OETA 4O6VA 3MJSA 1YOVB 5FWNA 3KOUA 5DOVA 4Z0TA 1TT5A 5EPOA 5C7IO 5B4UA 4KP7A 5KIAA 2YQ5A 2WJPA 3JD0A 2ET6A 4S3MA 3U4CA 1K0UA 1SB8A 2OBYA 1YBAA 3O26A 1V3UA 4M55A 4WUVA 4FFRA 3TN7A 3V1TC 1KEWA 5L7WA 5U4QA 5JYAA 1HZZA 2P9GA 5AXBA 1H6CA 3ROQA 2C54A 2O23A 3GNTA 2GUGA 3P2OA 1N9GB 3UICA 3FNGA 1WP4A 5I9LA 1VL6A 1I0ZA 5L95A 2FR1A 4NIMA 2GN8A 3P2YA 3HDYA 1WVGA 5CDUA 1MXFA 1U7HA 4RORA 1SNYA 1ZMTA 1E1LA 1X14A 1DBVO 3NTOA 1ISHA 1DIRA 1L7EA 4B4WA 4KWHA 1KVUA 4RDHA 4YRDA 1P1RA 3AUSA 3DOOA 3KTDA 2HO5A 4PZCA 2E37A 3KZVA 4AL4A 1I5RA 1ZW1A 4AJ2A 3OICA 3DZBA 4BUCA 2AQKA 5J9GA 3EC7A 2PKRA 3DFZA 1EFLA 4LRSB 1BHSA 4GX0A 2QYSA 5DT9A 1EVZA 1OFGA 3V8BA 4QT0A 4DPLA 3VDRA 5LDGA 1T4BA 1YO6A 1LUAA 5JDCA 1E1KA 1R4MA 4RZHA 1EQ2A 1GFSA 2WDZA 3U4HA 3AOGA 2VRCA 3WYCA 4IGEA 4L4XA 4ALMA 5B1YA 3JD4A 5DBIA 5KJEA 3W8DA 3JYNA 3OEWA 4NFSA 3E5RA 4N5MA 2VRCD 3F46A 2E82A 3F9IA 3IIEA 4XYMA 4Z9YA 1C1XB 2VUSA 4HV4A 5A9RA 4GI2A 2DQ4A 7ADHA 3W6UA 3JQAB 3OH8A 3DO5A 5ILOA 3B20A 4BMVA 1K6JA 5F1OA 1BXZA 1HYGA 1PR9A 2D5CA 5G4LA 1UP7A 3GHHA 2ZYGA 2J5RA 5TRTA 2VQ3A 3T7CA 3WDSA 4ND4A 4DC1A 1SO8A 1LLCA 5F1KA 1IPEA 4GMGA 2AMFA 4RLHA 1J49A 1H5QA 2DKNA 4I08A 4LSWA 3FPCA 4B4UA 1EVIA 1Q7BA 4EUEA 3ZHXA 1LI4A 2R6JA 2V6BA 4EGFA 4WLEA 4U0JA 3ONDA 5KVQA 1JVSA 2IZZA 4GVLA 2O3SA 3ICPA 2JCYA 3ZNPA 4I5FA 2W2KA 1N8KA 2GGSA 4YCAA 3LVFO 5BSHA 3LC2O 4BVAA 1G6KA 3KEOA 3H4VA 3AY7A 4YACA 3JQ9C 2X0JA 4U6SA 2CY0A 2Y99A 4BNIA 2PGJA 1EVYA 3TWOA 2QRLA 2FSSA 1LX6A 2V7PA 4OQYA 2ZTUA 3IDSA 3ANLA 3UAGA 4IJWA 1O94A 1PZFA 3GG9A 4E5MA 9LDBA 5JY1A 1LSOA 3NRCA 4ZQGA 1X1EA 4J4HA 4G2NA 1QYVA 1GYRA 3E9MA 1HLPA 4HX5A 1U28A 4ZRNA 4Z0HO 1H6DA 2OBNA 4CPDA 4PVCA 3BMOB 1DC6A 2AXQA 1Y5RA 3I9OA 4ZHSA 2GPTA 2X5KO 4RO0A 4Z9XA 4CLDA 1QLJA 4B8WA 2DBQA 1B7GO 2IXBA 1O95A 2BI7A 4QTZA 4O63O 1BVUA 1V8BA 1B3BA 4YXFA 2NUAA 4CMCA 1NVGA 3UVEA 2JAPA 3ETGA 1HE3A 2NNLD 1KEVA 2YDXA 5HRUA 1HYEA 4GLLA 2VOJA 4TZTA 1P1FA 3TQHA 5JCJD 1Y8RA 3ETEA 3UUWA 2IRWA 4L73A 2Q4BA 5CDGA 1EZ4A 1E77A 4ALJA 3EY4A 4E32A 4DXHA 2BD0A 4PG7A 4WECA 5TLSA 3GVCA 1U8XX 4DMMA 2NSDA 2QX7A 4ZQBA 5C7LO 4OQZA 3W6ZA 2GD1O 2VWHA 2ZKLA 4D46A 5I8WA 4Q9NA 4UUPA 1ENOA 4QQRA 4JNKA 4ALIA 3R3JA 2FHSA 4CMIB 3QV1A 3BMQB 3OA2A 4CM4B 4ZJUA 4PG5A 3NEPX 1YKFA 2IDZA 1NYTA 2DBVO 1Y5MA 4FC6A 3ORFA 4F6LA 2Y1OA 3CPSA 2P5UA 4IJUA 4BB6A 1NTOA 4PLZA 2C7GA 5EMHA 1A27A 4IQ8A 2QG4A 3FNFA 1IE3A 2E49A 2HMTA 3PDJA 4IQGA 3SJ7A 2ZQZA 3GAZA 5AQ1A 5A3VA 1GV0A 4BNZA 1O89A 5BQFA 1O6ZA 3KO8A 3WTCA 3HNPA 1O9BA 4CMGA 4DLLA 4OSPA 2C7VA 3RUHA 1VSUA 2NU8A 2BGLA 2VHYA 2JD2A 1JDJA 3CE6A 2VNSA 4G5HA 4E13A 2GLXA 3KVOA 2Y0DA 4WCFB 4K26A 1K89A 5DULA 5KJCA 4KUHA 4A5OA 2JD1A 2EWMA 1VM6A 1DFIA 3AM5A 4RF5A 3DAPA 2FR0A 5DCWA 5KVVA 5MGBA 1EDZA 4WNIA 1U3WA 3IJRA 4BNWA 2DFVA 4CUZA 4BO0A 1VLLA 4II2A 3STHA 3DXFA 1EFKA 4J0FA 3JQ8B 2W8ZA 3AU8A 4I5GA 3BMNB 1P45A 3WOHA 4E31A 2VYND 5A03A 1ENPA 1PJ4A 2E6UX 5B4VA 1D1TA 1YOVA 3TOXA 3VH3A 4CM9A 2RIRA 2V65A 3VH1A 4M86A 1V9LA 3WICA 2BFAA 4II3A 4IDDA 3PQFA 4AJLA 2GF2A 3BA1A 3L9XA 3RJ9A 1AHIA 3FHLA 2H1SA 3PIIA 5BR7A 5CEFA 1U7TA 4P22A 3IL2A 1JLLA 1YXMA 3ZWPA 3S2IA 3VTFA 1PS0A 1QYWA 4KWIA 1E7SA 3H3FA 3B1JA 1N9GA 5I9MA 4CMKA 2YQ4A 2O7SA 5COAA 5KWEA 3ADPA 2IEDA 4DQVA 3DOJA 2X7HA 4AFNA 3SLKA 1CQIA 1K2WA 2VUUA 3LZ6A 4WLNA 2P4QA 1ADCA 1W8DA 1WDLA 3WGQA 2HK8A 2X0IA 3AOEC 4J7CA 4PLTA 1JWAB 4AJIA 4DL9A 1I33A 4L74A 3MJTA 2Q49A 3NTRA 2GYYA 3F4LA 2D1YA 2XOXA 3TRIA 3MJCA 3DONA 1Z45A 2Q3EA 1T2DA 4HNGA 2H63A 1EK5A 3PJEA 4GGOA 3IKTA 2DTEA 3X2EA 4BO5A 4M87A 4MP3A 4YWJA 5IZ4A 1O5IA 3EDMA 1XSEA 5TS3A 3TOZA 3JQ7B 4GX1A 3FR8A 5DN9A 4BIIA 3JV7A 4Z3KA 1QRRA 3I9JA 4RF2A 1ISMA 3CMMA 1NASA 4CUJA 5BSFA 3HZZA 4A2CA 2OL4A 2IYOA 3ZH2A 3WQSB 1NPDA 4IIUA 4OOEA 1IOLA 3ENKA 1DIAA 4HY3A 1PL8A 1OMOA 4J1NA 3JQFC 3QW2A 2C07A 3AU9A 2WE8A 3K2BA 3DL2A 5IZCA 4HUJA 4ILKA 4PLGA 3S1LA 1Y9AA 4IDEA 4YA6A 3WX0A 3IP1A 1ZXBA 4XR4A 1IB6A 3K2EA 1YDWA 4NR0A 4MKXA 4FFOA 4IIVA 1FXSA 1GCUA 1W0CA 1QV7A 4R41A 1C1XA 4RVGA 4UULA 4ZQHA 4XEHA 1A7AA 3JQAA 3HB5X 2CZCA 1GPDG 3FNHA 5T57A 3UKOA 1B15A 1TT7A 3KSZO 3L4BA 3CZMA 1MLDA 3ADOA 3K5PA 4QECA 2B5WA 1R0KA 3TL2A 3ZHZA 3ETDA 4EBFA 5BT9A 2J3JA 1U3VA 1X7GA 3ZNQA 3PP8A 3UH1A 4D41A 2ZTVA 3G49A 2IXAA 5T5QA 3IP3A 2AA3A 2HMSA 3N7UA 1GUFA 1KVSA 2A9FA 7MDHA 4ROSA 2EIHA 3OFSA 1PQWA 3PWZA 3K96A 3VPXA 5DCYA 3W4KA 1EE2A 1XR3A 1LDMA 3AI1A 3EAGA 1K6IA 4INAA 2DTDA 1PJCA 3I9KA 1T1SA 2NM0A 4LMPA 3QIVA 3ZV5A 5JW6A 1HSOA 3RI3A 4TQGA 4C4OA 4MJLA 5ICMA 3B1KA 4CODB 1UJMA 5JC1A 4UVGA 4DVJA 1LA2A 3FBTA 3GA0A 4FOOA 2P9CA 4DIOA 2JD0A 4YRAA 1Y7TA 1MP0A 4OXYA 1A7KA 5L45A 2I3GA 4PLYA 1UXGA 1GCOA 2Q50A 1PZGA 3JYLA 3FN4A 3SC6A 4N54A 3EVNA 3RBZA 4U8GA 2NADA 5K9ZA 3JQBA 3WSVA 1EK6A 3BMOA 3H5RA 4I5EA 3GN1A 4LCJA 3VZQA 4H15A 1UDCA 4AJNA 1K5HA 5AYVA 3GUYA 3INRA 4UAGA 2J5KA 4D45A 1E3WB 1H9AA 4MVJH 3PHLA 3INGA 3LT4A 4MVJM 2A92A 2JCXA 1FK8A 3WFIA 4IDAA 4XGKA 2ZQYA 5JXWA 2D3TA 3V2GA 3UXYA 4ZN6A 4MIYA 4MVJF 3U3XA 1M75A 4J9UE 4ND2A 4UEOA 1C0PA 2B4QA 3PJFA 4LK3A 1XYGA 3ZCXA 4BNJA 1P44A 1HDOA 3KYCB 4JBGA 4ZD6A 4IXWA 4H7PA 2CUKA 1E0DA 4GX2A 3AWDA 4I1IA 5U9CA 4GSKA 4ND1A 1PTJA 2G5CA 3W8FA 4E3ZA 2EGHA 1I32A 1Q0QA 4CMIA 3BMQA 3GMSA 1WDMA 3SVTA 2ZK7A 2R00A 2EERA 2VHVA 3JQGB 2EF1A 3WYEA 4CM4A 3ZW9A 2CMDA 3ONEA 4W6ZA 4DQXA 3QRWA 3E1KA 2JJYA 3GAFA 5T8KC 1ISIA 1FDWA 4YT5A 3D7LA 2QRKA 4J0EA 1MG0A 1YBMA 5TF4A 1TA4A 4QO8A 3MCVA 3QHAA 1KY5A 5TJ9A 3RUIA 5JFOA 5CFZA 1BDBA 2PY6A 2O2SA 3RC7A 3GZ4A 1ZK4A 1Z6ZA 3JCZA 5EIOA 4JROA 1RKXA 1KEPA 1SZJG 4N7RA 3ICCA 3QJ5A 4AJPA 1TB4A 2ZTLA 5G0TA 4WOJA 4WCFA 1E6WA 2OZPA 3IAHA 1WAMA 3L77A 3DZFA 5GZ6A 3WGHA 5COQA 1XQ6A 1W6UA 5T6BA 2HDHA 1WMBA 1V6AA 3E8XA 4AJKA 3UW3A 1ISJA 1XKQA 3RUDA 4R4JA 4FCCA 2FN7A 1LNQA 3INTA 4YJGB 3JQ8A 4JIGA 4PCVA 5CEEA 1PU2A 3BMNA 4CMJA 1BWSA 4E5YA 2WEKA 3K8ZA 3L9WA 1AGNA 5IN5A 2I65A 3PLNA 3V2UA 2ZB8A 3RKUA 2VT3A 3ZU2A 2VTDA 3LC7O 1VE9A 4C7KA 5THKA 1T26A 1LQTA 1P77A 1ZVMA 5ITVA 2W98A 3CXRA 1LXCA 5LCXA 4PN3A 2EJVA 1GEEA 4E33A 3C1AA 4DBZA 5F5LA 1XG5A 2GN6A 4E2XA 4HFJA 3NGXA 5I7VA 3E48A 2Q45A 3JYPA 1B0AA 3QE3A 4J49A 3RROA 4J3FA 1NX6A 5CP8A 1GZ4A 4XRGA 4AJHA 5I7FA 2ZATA 1D3AA 5JAMA 2ZCVA 1U5CA 4W7HA 2XAAA 3NJ8A 3K31A 5EERA 3RASA 3NT5A 1H94A 5G4KB 1GUYA 1NAIA 4QSMA 4YT2A 3GRPA 1Q7CA 1U2GA 4TRRA 3C24A 4IS3A 5JDIA 1H0KA 5JAZA 2A35A 3SBOA 2JFFA 1JN0A 5DDIP 1N7HA 3GVPA 3WMWA 3SX2A 2AHRA 1R4NB 5AXDA 2CVQA 4O5OA 1Q0HA 1WMAA 3JQ7A 2DM6A 4MP8A 1YE3A 2ZCUA 1JA9A 1QR6A 3PYMA 3L6DA 5DBGA 4XWYA 3KBOA 3IUSA 2ZB3A 2PKQO 1PGJA 3JD1A 3JD3A 2VWGA 3H9QA 3DHNA 5A06A 5A02A 4CMHA 4B3IA 4BNGA 3PYLA 1Z7EA 2ZJ1A 5EINA 4OXKA 5DF1A 1GZ3A 1QLHA 4OL9A 2AEJA 3KSUA 2OOSA 1W73A 4DMLA 3QWFA 4UVIA 2PLAA 3TFOA 2RBEA 1Q2XA 1OBFO 1BDMA 3ZWCA 4XKJA 4BL5A 1V3TA 1LRKA 3LK7A 4FS3A 1BTOA 3PHJA 1ZK0A 2Q2QA 3R6DA 5C5IA 3JQEA 4YRBA 3EUWA 2AQ8A 5TGDA 2OO5A 4OKNA 5LC1A 1DXYA 1X0VA 4CM1A 3DMTA 4ND5A 1CQJA 5DP1A 3GY0A 3S2EA 3G0OA 1P31A 3ZV6A 3GEGA 4FPXA 4J2HA 3AFMA 3G1UA 5FI3A 1KY4A 5C3MA 1PL7A 3JQ6A 2WD7B 2XF8A 2X5OA 3DDNA 4UVEA 1U8FO 1LRJA 3TPCA 4LSMA 1PSDA 4MVJP 3PZRA 5DZSA 5T67A 1YDEA 4GX5A 5IJZA 4E0BA 3GDOA 2O3UA 2GZ2A 3EYWA 2D59A 3VPGA 1YL7A 4R3NA 2VWPA 2DPHA 2GZ1A 5DP2A 4RPGA 3Q0EA 3E5MA 4BO9A 2VWQA 4DLAA 1NP3A 1GYQA 3AOEA 4NU6A 3UCEA 4EJ6A 1G0OA 1E3LA 4D0SA 1ENYA 3JYOA 4R1SA 3JQDA 1JU9A 4DWVA 1DLJA 3MTJA 3D0OA 4D79A 2IZ1A 3AW9A 1EVJA 3ON5A 8LDHA 3WS7A 1NPTO 4Q3EA 4GH5A 2Q22A 1GV1A 4QFCA 3ZU3A 2BHLA 4Z3DA 2G76A 4BGEA 2CVOA 2H6EA 2VT2A 3C1OA 3FF4A 4IM7A 4R68A 3ST7A 4BNUA 2YHIB 4YDRA 1E5QA 1YB1A 4F3YA 4YR9A 4TVBA 2C5EA 2LDBA 5IDQA 4XQ9A 1HF3A 4CV1A 5CEJA 1GYPA 1E3SA 1E3WA 3DZGA 4OO3A 5A9TA 4KQXA 5EESA 4BMSA 1VRWA 1ZK1A 3OA0A 4U7WA 3BTVA 3UOGA 2UUPA 5IXYA 4XDYA 2PGLA 1YH3A 5CHEA 4WE3A 2HMVA 3VPHA 1MGOA 1E7RA 2C82A 4WLOA 4CMEA 3KYCA 4TRNA 1P1IA 4D3FA 5I9NA 1VKOA 3W4IA 1M6WA 3WYBA 5GZ3A 3U62A 4CR6A 1I2CA 5TJHA 5ER9A 1YQDA 4R51A 1BG6A 3K30A 1ZSNA 4OSOA 2PKQP 3RFVA 2VN8A 1NQTA 3JQGA 1CDOA 4XCVA 2O3TA 4NBTA 2NLOA 2CVZA 3ZWBA 2SCUA 3ZHYA 4D42A 5KTKA 3FCOA 4NZ9A 5JMWA 1E92A 1RYDA 1PGPA 4F6CA 3ZWYA 1F8FA 4B3JA 1XHLA 2OXIA 3SXPA 3TNLA 3NT2A 3OHSX 4YQYA 1N92A 4DGSA 4BNKA 3W4JA 3RC1A 2IZ0A 1E7YA 2YW9A 4BMNA 1VC2A 2CFCA 4Y6PA 2O7QA 4MVJI 2PD3A 2VUTA 2WMDA 4FC7A 1JVBA 3CKYA 1DEHA 3RCBA 5FF9A 1I30A 2AE2A 1A4UA 2Z1MA 2CNBA 2YV3A 5TIIA 1NQAO 2OP0A 3VTZA 3I52A 2QYTA 1X13A 1TLTA 4Q39A 1NAHA 1AXEA 1RWBA 4DPKA 3LT0A 3LLSA 5CAEA 9LDTA 3WLFA 2Q2WA 2O4CA 3U9LA 2HAEA 3KETA 2HU2A 3I23A 1A5ZA 2PTGA 3VZPA 1GADO 1IZ0A 4YJGA 3PFFA 2NU9A 4A10A 1GZ6A 2WYVA 1Q1NA 1TVEA 4HXYA 1ADBA 1Z73A 3GGGA 4IDGA 4D3DA 4IUYA 1HKUA 1YQGA 5COBA 4Z0PA 4OKIA 2HQ1A 4L75A 5K6AC 3E18A 5JYEA 3QWIA 4UUNA 5JCJA 2BELA 3ZWWA 3OMLA 4IPTA 4UUMA 3I4CA 3CTMA 4F45A 3WG9A 4J9VA 1PJQA 3PJDA 1ARZA 3WB9A 1H93A 4KTTE 3AK4A 4BO8A 2YDYA 3FBGA 3ZNNA 4E12A 3QVOA 5JYFA 1ZK3A 1K3TA 2Y0CA 1Z7BA 3QVSA 4CMAA 4YT8A 4A73A 3PWKA 1GAEO 1YRLA 2EEZA 2NU7A 3BXXA 4J90A 3LQFA 5I7EA 1NM5A 3D4OA 1FDVA 5TQVA 2FY8A 2B0JA 4CLRB 1DHTA 2H5LA 3KLPX 4M1QA 4XYBA 3FRJA 3BHMA 4KUEA 4I8XA 4NNJA 2R2GA 5G4KA 1XCBA 5HS4A 4KTVE 1R6DA 3WWZA 3T4XA 4IY1A 4YBZA 5TC4A 3S8MA 4RPKA 3DBHB 1EUCA 2FSVA 2OMEA 1D7OA 3ANMA 1A72A 3KHUA 4FFNA 4FJ0A 4L0QA 3EVTA 3WWYA 4IQ0A 5JPIA 1R4NA 3B70A 2PGDA 1I10A 3EMKA 1LDYA 2B4RO 3B6ZA 5KJ6A 2X23A 2RHCA 3RIHA 3TF5A 1K6XA 4EJMA 1U1IA 3QVTA 4ZQFA 1ZJYA 5F21A 3ASVA 3ZWMA 4W9NA 1R66A 3PK0A 1JKJA 1SEPA 3GPIA 1XQ1A 3AFNA 4HP8A 4M8SA 5DNAA 2GN4A 2ZYDA 2WTBA 5BNTA 1TI7A 3DTTA 3I6IA 4ONEA 3HQ4O 5JYDA 2VYNA 1LEHA 2JL1A 1P1JA 4NU5A 1ZIDA 3RUCA 4J16A 5F3RA 4DYVA 4XIJA 1B8PA 5CDTA 1BRMA 1NFQA 1GL3A 1T1RA 1HEUA 3AM4A 2QZ9A 4YAEA 4CLHA 1LDGA 4KUGA 2EHDA 5ER6A 2QHXA 2NVUB 1QSGA 2CF5A 1R0SA 4RVSA 4OXNA 1XDWA 2G17A 3GEMA 4GKVA 1ONNA 1T4DA 1GD1O 1GQYA 4JK3A 1ADGA 1NFFA 3GN2A 1AE1A 4GGPA 1B26A 4BNHA 2A4KA 4CQLB 4E2ZA 1RM4A 2EW8A 2WD7A 4E5NA 3S55A 3CIFA 2BFPA 3GZNB 4NBVA 4JJFA 1MC5A 3AI3A 3QP9A 1L7DA 1JQBA 4R1TA 1UZLA 3GHYA 4FBGA 1F14A 1NR7A 2AEFA 4IXTA 2IEBA 4BO7A 1MC4A 1YB4A 3BHIA 3WSWA 2NVWA 1Y6JA 4XX0A 2X6TA 1NVTA 4FD3A 3IQDB 2AE1A 2P5YA 1IYZA 3AY6A 3FWZA 3U5TA 1I24A 4XGIA 1QORA 3WXBA 4AG3A 3A28A 1S7CA 4NJMB 1PZHA 4H3VA 2DVMA 3C85A 2EP5A 3VC7A 4FW8A 5A04A 2V6FA 4P4LA 2FP4A 2Q1WA 3M1AA 3W1VA 4CLOB 2D0IA 4YT4A 1PJTA 3SEFA 1LDBA 1OC4A 3GNQA 4TSKA 3F47A 3GFBA 1MUUA 4ESOA 5L51A 4NH4A 2H9IA 4U6QA 1E3EA 1CERA 1EE9A 1WPQA 3DAGA 4MVJD 1T2AA 1PQPA 3ENNA 5JSFA 4TVOA 5BNIA 1BGVA 2IE0A 4MDHA 4YAJA 1PJLA 3C3XA 1NHWA 1VJTA 4XQGA 4A7PA 5L40A 1Q0LA 1E5LA 3QA9A 3RFXA 3H9GA 4W82A 1XLTA 4B7UA 3NYWA 3MJVA 3TL3A 2QRJA 2D2IA 2QQ5A 1WLYA 4NJOA 3TZCA 4QX6A 5JAIA 2PR2A 4N5NA 1DIHA 1ZXLA 3EHEA 1PX0A 5FI5A 3WIDA 5JNLA 4PRKA 4DYDA 6ADHA 1KOLA 4OH1A 3DZHA 3KM0A 3AI2A 1LLQA 4RZIA 1U4OA 3O8QB 4E6PA 4TMFA 5JDCC 1GR0A 3QWAA 4M49A 1EQUA 5A1TA 3BIOA 3WGGA 3RWBA 3DZJA 4BGUA 4PG8A 4MO2A 2ZJ0A 4K6CA 4B4OA 4B7XA 4D3SA 2X4GA 3NGLA 4EJ0A 1IULA 3NT4A 1NFRA 3MJEA 4TWRA 3ZU5A 3L4SO 1VSVA 3G79A 1UZNA 5KNLA 2UV8A 4I5DA 2Y1DA 3UF0A 4IJVA 1WW8A 4X54A 3EZYA 3M1LA 4J1QA 4KDEA 4UEKA 5HBRA 3W8EA 5M6DA 4RPHA 4R54A 1Y81A 2I66A 3TZKA 1B8VA 1ZSYA 1YL6A 1KVQA 5IFLA 4U0KA 4WK6A 2X9VA 1J6UA 3V2HA 1XWFA 3VH4A 3QSGA 1OI7A 4NFHA 1HDGO 3FNEA 2O3JA 2HLPA 3I83A 5FEUA 2NWQA 4AJJA 2CF6A 3GDGA 3KXDA 2HK9A 3VZRA 3WJAA 4EUHA 3TZHA 1I01A 3TFQA 4MKZA 3KEQA 1B8UA 2PZKA 3HN2A 3RQSA 3ZW8A 4YJDA 4E30A 1UR5A 5FFFA 2C5AA 4JGBA 1IHYA 2EJWA 1XGKA 3Q2IA 4J91A 4UVHA 1MXHA 1UXIA 2GASA 3ZV4A 1DSSG 4GQAA 4IBOA 4I9HA 1V0JA
chains in the Genus database with same CATH superfamily
4WZAA 4YRZA 4ETMA 1V2GA 3MWFA 1CUJA 4FDTA 1L7XA 4JCCA 3O4RA 7REQB 2W93A 4YUXA 1XOIA 1X77A 4RVDA 4UVDA 2I8LA 3NI2A 1G3RA 4KNWA 3JARB 2Q1SA 2Z1DA 3VR4A 1I72B 1XTTA 1H85A 3H7AA 2Z5LA 1W2GA 1OFUA 4UHDA 2R7NA 2LZ0A 4PNPA 4YP7A 2XZTA 3ROPA 1QYCA 2XKKA 1UKYA 4NU8X 4C0BA 5LQNA 3EW7A 1NJSA 3KV1A 1PGOA 4IDBA 1DC8A 3JVDA 4R8VA 4UCXA 3EG5A 3WGNA 5EZYA 1Z2AA 3G17A 4G8JA 4PHFA 4ZYWA 2O5CA 1RD4A 3R1IA 1N2XA 2E3JA 4PSDA 1BD3A 4URVR 2R5WA 5BVHB 4PLVA 5HK9A 4DDWA 4NU0A 3D3NA 4BVHA 7GPBA 3HGQA 1ETUA 2XHEA 3AUUA 1L7AA 1PJBA 3I6MA 2DT8A 1I4WA 4PG4A 3UFBA 4Z5XA 2BYTA 2FXVA 2OO7A 4CTJA 5I4BA 2XCLA 1N8NA 4FHZA 1CUGA 1T1JA 3A4NA 1HTWA 2VI5A 1WXDA 4KXVA 5F52A 3UAYA 2Z30A 4KKXB 5BQ3A 5IBCA 1DARA 2HU7A 2YINC 2RKBA 5AESA 5IXSA 4NL4H 2BFDA 3FIJA 4OEHA 4DLPA 3BAZA 3H4IA 5L3SB 4ZZIA 1GTSA 2ZETA 3G5UA 1C8VB 1SUSA 5LZ9A 2AOXA 4K6MA 1P9WA 1H2WA 1KGSA 4RETA 3UCFA 2BHTA 4ZREA 1T6BY 5C7OO 1Y3IA 3G2JA 1KI8A 3LUKA 4CLEA 4KACA 3UBMA 1X7YA 4ER3A 4YPVA 4RSGA 4HLQB 2P30A 3GF4A 3JZMA 2OV6A 4FDLA 1TM1E 1T5SA 3LO5A 4N12A 5D00A 1GPJA 1E9FA 3D9QX 4AN1A 4J2OA 1EGAA 3FNRA 4RHCA 3KRTA 3FCAA 2PWPA 4WERA 3C3PA 1JT9A 1NA5A 2JBAA 1F4LA 4IEIA 3ULKA 1A4RA 5C35A 2OZEA 1YTLA 1FSFA 5TT0A 3TW8A 1UDWA 2XYQA 2IWRA 1T8TA 1VMKA 4MARA 1SOMA 1V37A 2QMZA 4JC5A 4FCTA 4LXXA 2YR0A 4EENA 3HR8A 3U60B 3U4DA 2WG2A 5TVKA 2B4TO 2II6A 1GZHB 5IDVA 2NVBA 3V80A 3TDMA 3OQJA 4LNUB 3UQYS 4P0PB 3EP9B 1SKQA 2DWQA 1ORDA 4CV3A 4YI5A 3LVBA 1W5BA 3L6OO 1L5SA 2IKQA 2LE0A 2JFWA 3HE3A 3U4IA 3WL4A 3ISVA 5BSGA 1ZEMA 2FW9A 4JUIA 4BQPA 4PYOA 5JCOA 2DUUA 3NGMA 2DF8A 3P97A 5GTDA 2HSJA 3K70D 3FMOB 2H1WA 3PR2B 4O4HB 4OLFA 3FCSB 1W59A 1KARA 2KB0A 1JG7A 4X66B 3M5WA 4B48A 3S2ZA 4YXWD 3ZE0B 3GCXA 4OP1A 3ZDFA 3AM3A 1XU9A 2PH7A 3GCGA 4KE6A 4GMHA 4PAWA 4WZZA 3UV7A 2YY7A 2E55A 4BPRA 5I47A 1RPTA 5FL7A 2F00A 2AOUB 1S01A 2ORED 1XV5A 1KYTA 1XFAA 1OKKA 1KMHA 3BE4A 1YR1A 2H2IA 3GZNA 2X86A 4ZU1X 5BR4A 3S5JA 5AK6A 4AWAA 4P0QB 2QGFA 2EL9A 3AJEA 3H6KA 3QBEA 1FTNA 5JEEA 2BMAA 3CKMA 3F2VA 2HJWA 3NDJA 5BYBA 1RSZA 4B34A 1E2HA 1O08A 2CEAA 3F8TA 5EHNA 2V1XA 1OJLA 4KRYA 4Q4AB 4EHBA 4XA8A 2PSFA 5A4DA 1FP1D 3MJ4A 4FI3C 1O97C 4AS2A 2HT1A 3IC5A 4TTIA 4YB8A 5CNKA 4IEFB 2PCLA 5CT9A 2R6AA 1FB5A 3VPBA 3CLKA 1KAOA 1N0IA 1YHNA 4GWLA 2DCUA 1CRWG 4NF2A 4CCWA 2QDKA 1Z22A 2EP7A 2ZJBA 5K8IA 2HNAA 1YA8A 2R1TA 4PZLA 3A6PC 4Y2PA 3F98A 3GGPA 5GIPE 3OC0A 4JVMA 4PR0A 3RR2A 1RBYA 5JZMA 2ZSDA 1MH9A 3IURA 2W9XA 3LXXA 3HU3A 4CLOA 1OC2A 1YA4A 3IQIX 2VCYA 4M9RA 3UPUA 2IS2A 5CM8B 2C7QA 1DU4A 1TCBA 3IDFA 1Z26A 2WYWA 4MQMA 3GEHA 4TKZA 4YHHB 2YN4A 2X8BA 4P82A 3ZJUA 1T24A 3A25A 5K09A 1CEQA 2ZIZA 2ZG6A 4WLUA 4WV3A 1NHGA 2WBLC 3QU2A 5EXTA 3VVCA 1RE0A 4EG3A 5JOQA 3JWEA 1TM7E 2GMWA 3DZCA 2QQEA 3FKSA 3PT5A 2XUIA 3FSGD 2YNMC 3G0GA 3ZBTA 3V4RA 2OHHA 4JLDA 1VHQA 1TZJA 4GQIA 1BW9B 2NZ8A 3A3NA 4A27A 1PQYA 5BSTA 5JNVA 5MN5A 4UPDA 5AVQA 3N70A 4Z4IA 1UJ6A 2B20A 1OXKB 5TV2A 3QPBA 2AMYA 4OIMA 3GRKA 3T4EA 3JAMA 1IPFA 4MW5A 1VBMA 3EGCA 4MVJG 1FDUA 2AXNA 2UYYA 1NI3A 3NAQA 3QPAA 2XT9A 5FKJA 1EP9A 5JHHB 2DETA 4F56A 2CMHA 5KNCD 3QPDA 2VJKA 3UT6A 5KMGB 1MPTA 2ATIA 2DJ5A 2R6ZA 4QUDA 3RBAA 4HVCA 3RABA 3KLNA 1PLJA 1Z4KA 4FOSA 4MUYA 1KYWA 3G8DA 1MBZA 2Q3MA 4X60A 1BJRE 4GLOA 4IIFA 3TZLA 4DUPA 3W5UA 2VT6A 4AZVA 4UQPA 3LUGA 3GX1A 3GUHA 3O95A 1KI6A 2Q5CA 3DDZX 2OBLA 2WF6A 1FFWA 4CEIB 3U49A 4J1TA 1P5HA 2W6IA 3HCOA 4OATA 1UBNA 1QH8B 1Y1LA 1Z16A 1E59A 3FPBA 5F2EA 1ZJ5A 3D8RA 2F62A 4BO1A 3MG9A 1TYBE 4TKLA 1W88A 1HBJA 1W36B 1DEOA 2IPMA 1E2UA 1OZHA 3LQ4A 2JFHA 2PFSA 4G01B 1TVCA 3THOA 1A77A 4R8RA 4ZAZA 2R96A 2J3QA 1ZYUA 1VE1A 3LDAA 3GNLA 1D6NA 3TIXB 4MWSA 2YYZA 4RYDA 3E6AA 4R7GA 4DCTA 2B1GA 1YRQA 2XVXA 1I7LA 3H9CA 3L4BC 4MQBA 3WLPA 1PR3A 3WJ2A 4XYLA 5K2MA 3R3WA 1QX3A 3NJ4A 4WN9A 3OQMA 5H3CA 3AF2A 3WGZA 3KT3A 4C4AA 4N40A 2HMWA 2WSSA 1LJLA 4PQYA 4I1UA 2OCDA 1EUQA 5B58T 2B8NA 1DHRA 4LDNA 1HETA 3GQBA 1G8FA 4EB3A 4JLWA 4Y6LA 2WVAA 4AULA 1E3IA 1ZW6A 4HWSA 2PSJA 3W5JA 5B6IA 5KTRA 3BQMB 3CKKA 2Z8YM 3IEPA 1L7OA 4NBRA 4A03A 4MKRA 4ASUA 2NO7A 1TUEA 5I9IA 5L53A 4F6RB 2H2FA 1SB9A 5I5GA 3E03A 1R12A 4XYGA 5AW1A 1SMKA 3IR6A 2CCGA 2I76A 2W6JD 1PWYE 1DPGA 2EBWA 3IT1A 4K1LA 4HB0A 2X0DA 2V7XA 1SCQA 2CZQA 3ADBA 1KXJA 2GILA 2YOGA 1H1LA 4EPRA 1VSBA 2PMCA 4IF4A 3F96A 2WIFA 2WKQA 5TDHA 2WF5A 3C6YA 3UV6A 1H2YA 3VH2A 1Q0PA 3A9WA 1Z5WA 1ZM4A 4FJ1A 1T2CA 5AKZA 1E4EA 4BKMA 4CIVA 2L42A 3KB6A 4C4ZA 3OY7A 3QOXA 4JR0A 4RTMA 1E0SA 2X8AA 3B9BA 4L2IB 5TVGA 3P5SA 1MQAA 4YCCA 2A3NA 1HYHA 1W96A 2Y1KA 3HVJA 4QEKA 4US1R 5ITWA 1JJ7A 1E6UA 1UIRA 1EX7A 4I9UA 2JCVA 1LBIA 4AZ0A 4C7BA 1Q19A 5B37A 1SUWA 5L3VA 2FF5A 2HWWA 4GM4A 3V4SA 3WLEA 2G07A 4ZHQA 1J21A 3C7CB 5KWSA 4PX3A 2X2OA 1U7DA 3TCKA 3G0DA 4FVTA 3ZWVA 1DOHA 1XO1A 2C9CA 3Q10A 5H80A 2XMSA 1VL0A 4PX9A 4OHCA 2FEKA 3ITKA 1G0NA 4P38A 3P20A 1FJHA 1ZAKA 1KFCB 3ETCA 4EH1A 3UJNA 1ODIA 2C3YA 1B16A 3CUYA 2VNAA 3FCYA 1Z33A 2QA5A 1G63A 1YONA 3IJPA 1GHTA 4QTUB 2DWOA 2OGTA 1EXWA 3OCCA 2O07A 3RNOA 2EZ9A 2QAIA 2XB6A 3BEDA 2MSDB 5HTKA 4QNRA 3AR4A 1T15A 2PMFA 3FMPB 3OWXA 4UXJA 5BN5B 4G5OA 2QLTA 4QOIA 1JDUA 1E7WA 4LAFA 3SHOA 2GJAA 1PJ2A 4F9FA 1CZNA 1UWLA 1QU2A 1L4BA 1UDAA 2PFGA 4H4DA 2XD4A 4ESHA 3LIPA 4YJHA 2X1HA 3JWIA 4OP2A 1NW3A 3SNHA 2UAGA 5BW6B 4JI7B 1E79A 2E48A 2ON6A 5I45A 2XMCA 4M54A 2B34A 1EPUA 3K15A 1PW7A 3MIZA 1G8MA 1C30B 5EMKA 4FUQA 1YS7A 3SZRA 2AG6A 2X5JO 3PXUA 4BKPA 3ZHVA 4LMRA 1JQ5A 1Z62A 3O03A 3V7UA 4DADA 3EPPA 5LJIA 1X7HA 2HYIC 5BXYA 4MI3A 5FFNA 4L0DA 4AS1A 1NRWA 5KJFA 3RC9A 3PBKA 5A62A 1RI4A 1FDSA 2Q6LA 1ZAYA 1A04A 4JJAA 1OZGA 3OZEA 3ZN2A 3ZWNA 3O8RA 3V5NA 4GM1A 1E1NA 1DXOA 2JEZA 2R25B 3IMCA 3OQBA 2Y0EA 1TK2A 1FQWA 3PQ6A 8ADHA 3U39A 1PL0A 3TUZC 2EIXA 2ASVA 5JC8A 3O82A 2IY9A 3MB5A 4TX1A 2OXCA 1W6RA 3WP0A 3OTOB 2KE5A 1EJ0A 1T25A 4MPPA 2DULA 5F1PA 1ZU5A 2FUEA 1ZDMA 2HA5A 3KCNA 4ZC8A 4BQFA 1VLVA 2BF7A 2YV1A 1PCXA 1G2PA 5HUHA 5P8WA 1PLKA 5CYGA 4E5VA 4MV8A 1F7VA 1C9MA 3P52A 4M9XA 4V0NA 4O2RA 3PFIA 1P9NA 3QX9A 1ZM2A 3MC1A 5CLQA 2XWJI 5EMNA 3TTWA 3LPAA 2O0LA 1RVDA 1SUAA 3QVUA 4NS1A 2Z3VA 2ECKA 2GBCA 2Q29A 3HXPA 3GLQA 4RZ2A 3EP6B 5BSVA 1Y63A 2C92A 2C98A 4HEA6 4HTAA 3FPLA 3L0OA 4S2UA 5AT1A 4OMDA 1I2MA 1ULSA 5BUCA 3OSUA 5MN6A 1HDZA 1K7FB 2E4UA 1HX7A 3GXOA 4E2YA 4IGAA 1A5SB 3ZZMA 1VCHA 1DV2A 3BYZA 1ISGA 4ITUA 3I58A 5HIJA 4XB1A 2RK3A 2R85A 3SJZA 1UFOA 4LJ4A 2D5IA 4XQCA 2X9GA 4IXNA 3ZDXB 4AG6A 3UG7A 5DYYA 4XR9A 3FE2A 1C1YA 3ICQB 4GZ3A 3VHLB 4B76A 1YUNA 1ESNA 1VA4A 4K1XA 4CI0B 2C61A 1SBNE 2JHCA 2VH5R 3OM9A 3T1VA 4I1VA 1Q83A 1XZQA 1Q16A 4BKQA 4HWTA 3IAS1 1MMFB 1Z2PX 1P0CA 2TSYB 1WSWA 3BE6A 3W8RA 2CNLA 5CA0A 3GARA 4OHXA 2H2AA 4LZJA 2ZI9A 3IO3A 2XEDA 1I3KA 4R2XA 4IZIA 2R6R1 3WGOA 5D2CA 3ZZ1A 3J80A 1YS2X 3V97A 3ORSA 1QGOA 2ZBQA 3FHTA 2J09A 3NIGB 5B4TA 1B14A 2QN8A 4JJ8A 3CRVA 2Q27A 3D5EA 3L6CA 4MYCA 4PIVA 3UOWA 2VQSA 1XELA 1BXGB 1RHMA 1HLFA 3R6GA 3GT0A 2YWGA 2O7NA 4MHOA 1EBFA 4P36A 3SDZA 1HG1A 1NQUA 5LB2A 4B2YA 4WQMA 3A27A 5ERGB 3Q2KA 2I1QA 4IOKA 4KLNA 2VDWA 1ORWA 3EXHB 4P8RA 1E3DA 2WKPA 5IAAA 5KYKA 3ESBA 1QO0A 4ARVA 3DZ8A 1SU8A 3U7QB 4JP2A 3GR6A 3B53X 4X95A 4N65A 2QSYA 4YJFA 1ZD9A 4L9WA 1BKYA 1VI5A 1ZRNA 2HA4A 3BJIC 3FAZA 4C5CA 1MV5A 1UAYA 5TVOB 4BRZA 1GZUA 5IG2A 3IJ5A 2X3YA 3DEAA 3RVRA 3UNXA 3DM5A 1NP6A 4KO3S 5TNXA 4CTOA 4CM3A 3LP5A 4O4JA 4Z4GA 4R9UC 4UE2A 4TLBA 4ENRA 1J0AA 2MU1A 4DLYA 1KF0A 1PD1A 1E66A 5L3ZA 3OJXA 3IDQA 5KX5B 3H05A 4RV9A 4AJ1A 2VH1A 1Y3DE 3CSUA 3P45A 2OR3A 4BDSA 4IDCA 1Z9BA 3GZTB 1SQ5A 3VPFA 1IVNA 1DAMA 1P73A 4FR5A 3FM9A 2NX2A 4LHXA 2GRAA 5AW7A 2WAXA 3Q11A 1VIAA 3DFUA 3EGOA 3L6EA 3OEED 3EXFB 3A58B 1UEXC 5FLKA 3KZMA 5A9SA 1OB5A 3HJNA 3MFQA 3REGA 3DEKA 4GP9A 1PYGA 4D6XA 5B6JA 1KVRA 2NQ8A 4PNEA 2MJLA 2Z4TA 3B6EA 2CEKA 4CJXA 3LP6A 3UENA 5BMVA 1Q7RA 4WXMA 5H4HA 3HPRA 3BWXA 1FXWF 2XWPA 2G08A 4LZLA 3QPUA 1HSZA 1DFGA 3NTXA 4IHAA 3TB4A 3HKDB 3ENQA 1R6VA 1C7QA 1K66A 5IBRA 1OBOA 3P0HA 2RGEA 5SV2A 4EA8A 3OCYA 1W48A 4Y30A 5FUVA 2JGIA 5ECGC 3BCSA 3E9QA 1LQUA 1JIIA 2DLNA 4AS3A 4TV8F 1ZKDA 3E05A 1LC0A 3HFSA 1JHZA 3PR3A 4QDXA 2DLDA 3AUJB 4QOHA 4ZEXA 4H1UA 3G85A 2R44A 2O05A 3R40A 5EWLB 1FJ2A 4KN8A 1KC1A 1JDNA 3GFGA 1JAIA 1IJBA 1S8OA 4HN4B 5AKIA 3TINA 5DEOA 4BJ5A 4JBIA 4MVJA 4GG1A 4Z86A 2ESRA 3MWDA 1KI3A 4BNNA 1TM2A 4PLCA 2GESA 4RIHA 4C3ZA 4KFTA 1SBHA 3RJ5A 3MEQA 3LCMA 2PLRA 4V03A 4WPGA 1U80A 4I3FA 1L9XA 1YWGO 1F2UA 4GI5A 3U19A 5H81A 1XK6A 2J7KA 4F60A 4IFBA 1YNOA 3JX9A 2PN1A 2VKTA 2VRWA 4DREA 4FMDF 1E96A 3SHTA 2XXJA 5KAMA 5TEWA 1X87A 3VVBA 5HOQA 2B8JA 3E53A 2KQUA 4Y6GB 3PQ8A 3MAGA 4AK9A 5LOVB 1IHXA 1G5HA 1WKBA 4PQFA 5JS7A 1P5RA 4LPSA 2I99A 1TADA 4EW1A 1MEJA 3P9KA 2P6NA 4AKHA 5ELXA 4CV0A 1L5KA 4NHOA 3GBVA 4Q6WA 3WFJA 1C9DB 5E38A 1FLAA 4BO3A 3LHKA 3QQPA 2H54A 1MX5A 3IDZA 1ZCJA 4TS4A 2JLUA 5IWAB 2BC9A 2OLJA 4A4DA 2H9AA 2YFYA 4F4JA 4UQOA 5KNBH 3RYCA 3KQNA 5AR1A 2WV7A 1SCUB 4TZ0A 2C4KA 4IUBS 2IYEA 3S2SA 1DJNA 1QQ6A 2YJ6A 4M1MA 3DKKA 3KWFA 1HDCA 2IWHA 4IHQA 3X3HA 5ILGA 2XYVA 4LQDA 4JT8A 1C0LA 3EJ6A 2OESA 2BGKA 1CDDA 2QNBA 3OZDA 1E1YA 2D13A 4LQCA 3N9IA 3RVJA 1QHHB 2IXDA 1EESA 1MORA 2WPDA 2XMQA 1SHLA 2C78A 3BREA 2W42A 3Q7SA 1XAGA 1UXKA 2MIIA 3OSZA 2HCTA 5KKCA 1KYZA 1RIIA 1W0JA 4IHJF 1UKEA 5JNSA 4GI3A 2ZAIA 1I8TA 1UAGA 3CQ9A 4GL4A 4Y2GA 1RP1A 1C50A 1PR6A 1HZJA 1V8OA 2XKBA 2HEIA 2IK8A 1JVNA 4BC0A 4XVCA 5A0FA 3KQKA 5KSOA 2YMPA 4Z99A 1WLSA 5HKKA 2I67A 3F4BA 1RWOA 5FBZA 3PIDA 1L4GA 4DLUA 1N0UA 4HMOA 3VO2A 2ORWA 4X97A 5I51A 1EBBA 1KSFX 1TT5B 1QH1B 4EKGA 2DGDA 1D1SA 5DCUA 5SYMA 4LHVA 3CWQA 2ZYTX 1OLSA 2PIAA 2OV8A 4L08A 1T1GA 2H48A 4KQEA 7YASA 3M3PA 1R50A 4Y7DA 1JPVA 3O1IC 4LZNA 1H6BA 1DZIA 1FU4A 1K8ZB 3B7PA 4DSZA 2VR1A 3HO8A 3N8IA 1EP2B 3H1PA 3KJGA 3COSA 5CDFA 2C7RA 4WZAE 4NV3A 4Q0MA 2OGUA 2XSZD 1YGPA 3HXKA 3S6JA 1KJZA 1ULUA 4LF6B 5JLJA 5K3FA 1GVHA 1MTZA 3KOYA 4GW3A 4TQAA 1JEYB 4NTZA 2DT5A 3S4YA 4QYSA 1C4OA 2YMLA 1SD5A 2C2YA 2OUKA 3IA2A 3I01M 3WGMA 4C04A 3EDYA 1N2BA 3FUTA 2JCGA 3C7AA 4OM8A 4DR6B 3LC1O 4K2AA 2B1JA 4TLDA 1YHZA 1T34A 5JSZA 3LVRE 4M9SA 1MG5A 2EQAA 4FCVA 4JXKA 4Y6RA 1JWBB 3T99A 3GUVA 3SHQA 5IM4A 4M2LA 2B8TA 2HLDA 1TGYA 1KRWA 4BRSA 3RSZA 3LG2A 3RANA 4M1YA 2OO3A 3ZCTA 4DEXA 1YRAA 1L4YA 3X1YA 3WNDA 4KR3A 3EDOA 4Q7EA 1PWZA 3E4DA 3HCCA 2G80A 4HRYA 3IUYA 1F60A 4CKBA 3PHHA 3FTDA 3QI2A 4BLOA 3ZD7A 4NNPA 3DOEA 2QLMA 3RBXA 3VUFA 5JAQA 2NG1A 4QEZA 3ICWA 5KHAA 3MSCA 1JFFB 1Z68A 1SUDA 3G2LA 3UHJA 3OKCA 4GL2A 3DQZA 5AIAA 1ECFA 5SZJA 1JAYA 5HM8A 4D9JA 4PYQA 2A58A 5CCBA 1R4MB 4KVGA 1O5TA 1O95C 1XXLA 2I34A 4FUTA 5FQOA 3T5AA 3N2KA 3AB7A 2CL7X 4H08A 3MINB 1AIPA 4PO8A 4HDKA 3BRCA 3SZMA 1Z82A 2CJFA 5G1NA 3NNDA 1ULBA 4RH3A 4UJ3A 1CBUA 1M8KA 2O2YA 5UKDA 4C0KA 5C4IA 2I9KA 3DBLA 3GOHA 1V9SA 1ZWLA 2FYTA 2PE5A 2IVZA 4TN5A 5LN1A 2NU6A 2G88A 1TAHA 1H6AA 1P4AA 1D9XA 2GK3A 2Z58A 2FEAA 2ZFUA 4FFSA 4IIGA 3NTLA 4DXDA 2FPPA 2XUPA 4DV2B 2Q1TA 3RWMB 4UPEA 1UZMA 1M2JA 4UCWA 1EBUA 1ZK2A 4GBGA 4K6FA 4QATA 4UXIA 1NM5C 2QVLA 3N87A 1ODJA 4Z9BA 2I54A 4URXR 3CNOA 4NYJQ 1OU0A 1W9HA 1DKUA 1YIAA 1I5OA 2A4MA 3H2SA 3TPZA 5F5NA 1WCIB 1H5NA 3FI0A 3RU9A 4YJ3A 1QIEA 1IQPA 3AHEA 1P3DA 2HREA 5EL0A 3W78A 3HA2A 5JJCA 3QVXA 5K99A 5HTOA 1PS8A 4HQLA 4EWLA 1JI3A 1W4BA 5J5AA 1JSZA 1H0RA 1S1MA 1M1NB 2YJ3A 4XIYA 4F91B 1Z7WA 3VHRA 3R9XA 1ONSA 2XX3A 3HABA 3SR4A 3UJ8A 5FDFA 2D5AA 3H9JA 5BN3B 1TZ2A 2CB9A 5CDHA 3T94A 3IVXA 1VG1A 4BFTA 4D3YA 4D7AA 4BXOA 2YYYA 1IM5A 1WSBA 1NVVR 3DFIA 3EZ7A 3JQQA 4M21A 4BRUA 4EDHA 5HRCA 1DAPA 1IONA 1GNSA 1GU7A 3NWBA 4R69A 1RBQA 3K73O 3IVAA 2FPXA 4M83A 3WO0A 3W9YA 3B5IA 1QMIA 1DOAA 2ACWA 4MULA 1L1EA 1R16A 2HRCA 4LOJA 5TPZD 3UJ9A 3ZIAD 2C57A 2FR8A 4A23A 4DIFA 2EQ5A 2WHPA 1QS0A 3M4NA 3L7BA 4RLFA 1V96A 2VJBA 1V5EA 2P3SA 2Y68A 1RMQA 2I78A 3SJCA 3TO5A 4BP8A 4EI2A 5BV7A 3W5DA 2B4KA 5C46F 2VNKA 5BSMA 2XH8A 3U44A 1RZRD 4N41A 5KYTA 2GT1A 3V7YA 1YZ3A 2X2PA 3RFTA 3BSFA 3DQPA 4PS0A 5FR1A 3WMEA 4DR2B 3MZ0A 4D0LB 3VNUA 3ZV7A 3K9WA 4J8PA 5EIBD 4ND3A 4YN3A 3R3ZA 4HNSA 5HDQA 2JBHA 1D0VA 1EVEA 4H7KA 4UM5A 5CURA 3EVGA 3GLGB 1PKEA 3SQLA 5IWCA 3DH0A 3FWPA 5F9FA 2CXHA 1AK9A 1K27A 2HUNA 1RJ9B 4BX9A 5CBPA 4KR9A 2AJBA 1JJBA 2CXUA 1T8RA 1M5RA 2J0UB 4K03A 4R2LA 4JSTA 4ZV9A 1GQQA 2XODA 5JE8A 4DA0A 3E3OA 3MUFA 4EPVA 3HZRA 5IUNC 3OCXA 1KYXA 1TQ2A 3NATA 2UVDA 2FRVA 3V6MA 1MAUA 1GRQA 3WV5A 1HLDA 2QR2A 3WNVA 3CM0A 4GOMD 2BFCB 5K0ZA 4RA6A 4US0R 4OJYA 3WIEA 2C7PA 4KDFA 3AF0A 5AKHA 2WG1A 5EXXA 3N5CA 2DFPA 4J2TA 1GGHA 4DSUA 1KP3A 2XECA 3FMIA 1OT5A 1AS0A 2G82A 4O4IB 4RKYA 1C3XA 2GHTA 3E27A 3DM9B 2HFJA 2C0QA 1MPXA 3K4PA 1YR9A 3GLSA 4X7MA 1DJLA 4GPAA 1VPVA 4KC0A 4QTTB 3UJ3X 1NXSA 2FMHA 2FGJA 3D31A 3DCIA 3K0FB 4CM8A 3VR2D 2A30A 4XSVA 1WWKA 1E61A 3A70A 2WWFA 1EINA 2RH5A 1YR3A 1JEAA 2PUVA 1EGMB 1GPMA 5TR9A 2G1PA 3CF6R 5FYDA 5LZ7A 2V4ZA 4CQMA 1U2ZA 3LKDA 1F17A 1B41A 2VTEA 1NXQA 3GH3A 3SDBA 4KBYA 721PA 3KELA 4YO8A 3DF9A 3K94A 4Y2QA 3S40A 3B9RA 5GZ1A 3PHGA 3ECAA 3NPAA 3IKVA 4CKYA 1I3NA 1QPZA 2ASEA 1NLMA 1V35A 1VG8A 1GFWA 1OAOC 3IUEA 3TMYA 3LDHA 4H1WA 4KMOA 1DX4A 5M29A 2OPHA 4J3JA 2JCBA 2X58A 4X9XA 1RLMA 3RM3A 4GXQA 2R7KA 3A9SA 3ZY2A 4BLRA 1XMVA 4R16A 2CLMB 1TNDA 1QB8A 1DADA 1KBZA 3TXXA 2M2IA 2W90A 1EXDA 3QUQA 1K68A 5KVCA 4OXQA 3AV3A 3NUGA 1JA1A 3IPXA 2NU8B 1E3JA 1DAHA 5IC5A 3SKYA 1VI2A 4XZ3A 4AM8A 1UQRA 2P9YA 5BV1A 1Z2EA 4YV1A 1BN6A 2H7VA 5E0OA 1OFVA 2V7QA 1QBKC 1HFKA 2P41A 3NWJA 1PGQA 1XVTA 2A5FA 3U13A 3DXXA 3HNRA 1AMOA 2B6HA 1LBEA 2XITA 1AUPA 3AY0A 3GFVA 1OXTA 3OIGA 3P0RA 4LJ9A 3GJ3A 4PLPA 3E22A 3PSAA 4BQRA 2GZMA 2P77A 2YXDA 1CULC 3BMCA 3Q6IA 4LBYA 3WLLA 5KOIA 1ZKMA 2YVQA 2FWMX 3L6BA 5LYYA 1G7TA 1OA1A 3K6JA 5IHPA 3OETA 2HNKA 2JLBA 1YOVB 2IE8A 4ZIRB 4V24A 4FNOA 4HXGA 4OV6B 4LJSA 1UBJS 2K7FA 3PNKA 1BE1A 1KSHA 5JD3A 1N4AA 3STVA 2WJPA 3JD0A 4AI6A 4S3MA 2G0AA 3DDSA 2OBYA 2P2DA 1NE2A 2VHQA 5TGTA 1YBAA 4MLPA 4URHA 2JGMA 4JP8A 3ZY3A 1SC1A 4DB2A 3K4HA 3LGSA 4RMNA 4TWJA 2G9VA 5BV0A 1DMSA 1KEWA 3NOOA 5U4QA 1K06A 2VYQA 5JYAA 1HZZA 1OQAA 4BZPA 1PT5A 2O23A 2OCXA 3P2OA 3UICA 4CL2A 2A5GA 4OF4A 5ICEA 5FO1A 1KNXA 5EJ4A 2QPOA 2R2AA 2EZ8A 5CDUA 3U7HB 1U7HA 5DCLA 4Q15A 4AQ7A 1SNYA 1CQIB 4ABYA 1ZA2A 4HLUC 5K0CA 2CYCA 4Y1FA 5F4ZA 3IB6A 5JTUA 1FSPA 2B8EA 3CZPA 4KWHA 3ZXXA 1ES9A 3EMDA 2DCMA 2G6BA 3DE5X 1U9ZA 3IXLA 3NHKA 3DTVA 1J5XA 3UTDA 3KTDA 1CE8B 1I5RA 2C9YA 4EECA 4HO1X 2RAUA 1D04A 3TAHA 2WF9A 3K9LA 3MLAA 3V4ZA 1N6KA 1XDGA 3FFBA 1Q6ZA 3E9YA 2A59A 2OB1A 2RH9B 1GCAA 1TL7C 4LC0A 1JTFA 4Y18A 4CDNA 4N48A 1EFLA 3AVVA 4PRZA 2W6PA 2X0KA 3RFUA 2ZWOA 4LRSB 2B8WA 2QLJA 4DG9A 3KVYA 2MR5A 2VBFA 2EFEB 1F1BA 2IYUA 3EA0A 2ZXUA 2QQ0A 2HMAA 2R4TA 1JHQA 1Y3FE 4JYPA 3FPEA 3F6SA 1PBTA 3Q7RA 1OX4B 3ZE9A 4JOBA 3ZQJA 5BOSA 5HQ3A 2EARA 1GKIA 3G68A 3Q0IA 3VDRA 3ZPXA 2ST1A 4R05A 2H7YA 4I3GA 5JDCA 5HJ2A 4YRAA 1E1KA 4YRCA 1EQ2A 2ONCA 3TW3A 2Q21A 4OBBA 4HGZA 3U4HA 2VRCA 4G5GA 5AHRA 3VOTA 1A8QA 4DY4A 3GGCA 1B8OA 4ALMA 1CJKC 1P2BA 1WBDA 5DBIA 5T4BA 2UUAB 4C2UA 1RLUA 2O52A 1SCIA 5F4BA 1GTG1 1WU8A 1XZLA 3JYNA 1A9XA 2ZUTA 5KSZA 3BKXA 5U4XA 4MRNA 2BE7A 2FPOA 4F2HA 2CHGA 3D7SA 3IIEA 2E82A 2PWAA 3F9IA 3G8BA 3PUJA 4XYMA 1DAFA 1HG0A 2Q5OA 4TZ6A 5A9RA 3IHLA 1Y33E 2DQ4A 1SQFA 1YKGA 7ADHA 4EVSA 3EFEA 4UOQA 1VSQA 1XJQA 2UXDB 1OXUA 2RGAA 1N78A 5F1OA 4DUGD 1E2QA 1HYGA 1PR9A 2QE7D 3AF6A 1ETHA 1ULTA 1E8NA 2FW7A 1B6TA 1RYFA 3AEQB 4X94A 4RTQA 1W52X 3PFNA 1FW6A 1KQ3A 1W8IA 3F6EX 3NHFA 3Q8XB 4ND4A 4XVQA 3ACCA 2GAAA 2ORVA 2FRDC 3UJDA 2BEVB 1SO8A 1GPH1 1N6PA 1IPEA 2C03A 3E5NA 3O31A 4RLHA 5F1KA 4BCCA 1EYZA 2Z4SA 1QVWA 2DKNA 5LA6B 2ZBFA 3V1NA 3FPCA 4LXUA 1EHYA 1XMXA 1BE6A 1EVIA 3R44A 4A6DA 3DZ5B 1LI4A 1WTAA 3ZHXA 2V6BA 4K7JA 5IRCD 2ZWPA 2Y92A 4U0JA 1H3NA 5KVQA 1QLWA 2O3SA 4PINA 1OWMA 1QQTA 3ILVA 2QKYA 2ZROA 3ANTA 4YCAA 3SMQA 1GQRA 1XN4A 1PSZA 3LVFO 1KPGA 2V96A 2YMMA 4JGIA 5AKKA 4E3WA 1HNXB 2BSAA 3AY7A 3I30X 4FZ5A 4KIUA 2X0JA 3UGJA 1NBME 4U6SA 1HEYA 3KD3A 3QXJA 4P2BA 4WACA 7ABPA 1JDBB 2FSSA 3LXUX 4BNDA 1LX6A 3PNQA 4QXQA 2XQFA 5LD2B 3IDSA 4O8JA 2XHZA 1Z8NA 3GG9A 1WF3A 1X1QA 4LBZA 1JSLA 2BFEB 5F12A 3NRCA 8ATCA 2E85A 2ODTX 3NHYA 5JRDS 1F4PA 4J4HA 4DIMA 3SZGA 2HWYA 3DFFA 1BWRA 1NQWA 3ER8A 3E9MA 2BPOA 1HLPA 3BB1A 4ES6A 4X20B 4ZRNA 5AVVA 2PUEA 2FUNB 2I7DA 3K8OE 5B7NA 1O94D 3IVMA 4CPDA 1TKRA 2QWXA 1DC6A 2IHZA 2JLWA 2ZZMA 4FEAA 1GLVA 4ZHSA 2QL9A 3LECA 1ZINA 4MROA 4MUEA 1QLJA 1WVIA 4Q4LA 2PBRA 3FGNA 4CT5A 5AI5A 3MVEA 1O95A 2HV8A 4O63O 4PTLA 3GAAA 5CNJA 3VX3A 1B3BA 1U6KA 1V16A 4CMCA 4P6VF 1COWA 3SHFA 4C43A 4EVIA 5ITZB 3MK31 5E8RA 1ZITA 1WXQA 2NNLD 1SQ6A 4DQKA 4MWTA 1CQPA 5LP6F 1U8YA 5HIAA 2VOJA 3FPFA 4TZTA 1P1FA 3TQHA 1RXWA 2IBSA 2P11A 1Y8RA 3M8KA 4KYUA 4O0MA 2Q4BA 2CNOA 1SG6A 2BGUA 1P5ZB 2HK6A 3EY4A 4BV2A 5IASA 1B0UA 3B3AA 5TPWA 4DXHA 2BD0A 4G8CA 5F98A 2IEAA 5DI3B 1TUBA 1IWPB 5KYUA 5TLSA 1AX9A 2HMYB 2WNHA 2WVJA 5IJ0B 4PZ9A 2VWHA 2ZKLA 4XGQA 1GNLA 2C8LA 2G5TA 3U7GA 4EQ6B 4MA4A 3DNMA 4MR9A 4KSCA 5CRIA 1ENOA 1WD5A 4MHSA 3UMRA 4X24A 2ZSUA 2JJQA 1H0SA 3AETB 5BYAA 4PG5A 5JHGB 3WNCA 1VCOA 2O8EA 3U16A 1V4VA 2CUZA 3ZBQA 1Y5MA 4E09A 3ABQB 2J59A 3L0SA 2DPMA 4JY7A 5D87A 1ZOSA 1K97A 2JAOA 1XKLA 1S5PA 5AKGA 3AL3A 2RI0A 2YJTD 4IQ8A 3L7LA 2QRMA 3TQSA 1CW2B 4EF6A 3WOVA 2HMTA 3PDJA 4AP6A 1Z0SA 3EY9A 4IVNA 4XVRA 4IHJA 2LRHA 4J94A 5K0NA 8ABPA 1ZJ4A 1OYOA 1UM9B 1G98A 2AN4A 1STOA 3KO8A 3T5DA 3S27A 3PKJA 1BHQ1 4NFLA 1TA9A 4UBIA 3GDWA 4OSPA 4PAOA 4XW2A 2CV2A 1VSUA 3QKRA 5B53A 5EUBA 2NZYA 2VHYA 3U6BA 1M5UA 4JXXA 4MQLA 5K2OA 3ZDCA 2V7TA 4MX8A 1T9HA 4AECA 3KHTA 2ID7A 1RQPA 4C3OB 3ZIDA 1RYMA 1ABEA 1SK8A 1ADYA 1ZISA 5HQTA 3LO8A 3PGMA 3MF4A 2FR0A 4WW0A 4Z4QA 2JVJA 3KKLA 4ZCRA 4KHZA 4PTZA 1F0KA 3DPIA 2E4VA 3M6XA 1O03A 2PZAA 4BMPB 5I7HA 4FE3A 4X92A 4HDSA 3C39A 3DXFA 4G8BA 1SXJC 1S8AA 2W8ZA 3BMNB 1P45A 3WOHA 4E31A 2AG1A 5A03A 1EJ6A 1JXQA 2E6UX 2E4YA 3BFKA 3TOXA 4A0QA 5B4VA 2PXAA 1ZCAA 3WICA 1JQJC 3DMHA 3ERCA 1SC9A 1FS6A 3DV0B 4AJLA 3L9XA 5AKJA 1AHIA 4L27A 5LPNA 3PIIA 3IKJA 4GI7A 4IZ6A 1OX6A 4P98A 1WMFA 4IDPA 4QPJC 3V1KA 5H70A 2XOKA 4UU7A 5EI5A 4C9BA 4X6LA 1CPYA 2ZYWX 3ZWPA 5KTYA 4KMMA 4MW6A 2Q7XA 4HMQA 1GTL1 2BM0A 2BBWA 4O4HF 1TVKA 4MV3A 1VRCA 2J9GA 2QGNA 4LDQA 4ZDJA 4CMKA 1N9GA 5I9MA 1M8PA 2C3OA 4MVYA 1KPIA 3QKWA 1WOYA 3ADPA 1SHJA 1PKXA 1TJYA 4Q9DA 5DIZA 4C4YA 1TF7A 4GYWA 1EG7A 1C8KA 1WJGA 4AFNA 3SLKA 4AO7A 3THSA 2BTQA 5EHQA 2VUUA 1GN9A 3HS3A 4G1UC 5CW2A 1RWQA 2AH5A 1SPBS 4PLTA 2GPWA 4WRRA 5KNDD 1GKLA 4F71A 5DTEA 3T3GA 2Q0SA 2SHKA 4DL9A 2ZR9A 2BCJQ 1I33A 4L74A 3UGTA 3MJTA 1HGXA 3H5WA 5CX1A 2Q49A 1KFBB 1PSWA 3F4LA 2D1YA 3PC3A 3LCUA 5CYPA 5IEBA 1SBCA 4Z51A 2UZIR 4PE5B 1Z45A 4RS4A 4OHMA 4GGOA 4GICA 5CYOA 3VKHA 4B5KA 1XYVA 1WUYA 2ABWA 4BO5A 3PPWA 1D07A 4CCSA 4PHTA 4YWJA 1WVMA 1O5IA 2P2GA 2XQKA 5LP6C 1IFXA 4B6GA 1XSEA 5TS3A 1G5FA 3TOZA 3CVXA 1FFXA 3CZ5A 4G41A 3VR6A 3FNQA 1JX6A 3W2HA 4C1NA 2O5VA 4NCAA 5BSFA 2NQ2C 3IULA 4UEWA 3HZZA 4A2CA 1QNLA 2OL4A 4Q24A 2IYOA 3ZH2A 1RI1A 1XZEA 4F5YA 1NPDA 4IIUA 1PJRA 3AFOA 2F48A 4LE1A 1U0OC 1CRLA 1QKKA 3I12A 2R62A 4HY3A 2GEKA 3EIQA 4J1NA 2R3SA 5CXSA 2C07A 1R27A 3AU9A 3RJMA 4AIRA 5ECWA 5EJ9A 3LX6A 3P4UA 5IZCA 3EAFA 1R9GA 1T0PA 1Y9AA 2Q1XA 1P29A 1RC8A 1ZXBA 5I3ZA 3QF7A 4MKXA 4NS4A 1ABBA 4FLEA 4HJXA 2VT7A 5K8VA 1XPUA 4OJQA 2Z2ZA 3AYZB 1GCUA 1S2MA 3X1WA 1QV7A 2REQB 1C1XA 2X1MA 4RD1A 3KTAA 1WY7A 2VVTA 3D8NA 4OHOA 4RVGA 4UULA 3LUCA 2IYRA 1RJEA 2I4NA 1A7AA 1L5LA 3W7VA 3ZJYA 1IQUA 5T57A 1GFIA 1B15A