4YWJA

Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
b'MRRIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNLCLKLLDTAARVLGDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALWLEGKENGLYDMQDVLGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
total genus 79
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ywjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ywjA01
4QQRA 2X22A 4RGBA 4W9NA 3CKYA 5TJ9A 3NKLA 4R3NA 4HV4A 4EEZA 4D44A 1Z74A 1WDMA 3TF5A 3DZHA 3L6DA 4J43A 4CODB 4CM1A 3R3SA 4JK3A 2VWHA 3FNGA 3PQFA 1GY8A 4OM8A 1A71A 1LDYA 1X0XA 1ZVMA 4UEKA 3PVZA 3GUYA 3JCZA 1E1LA 1PZGA 2Y1CA 1DLIA 5TJHA 4FGWA 1O94A 2UAGA 1SZJG 5A9SA 5A5EA 4DL9A 4IDAA 1P0CA 1PU2A 2WYVA 4HBGA 2IEDA 1SO8A 1ZK0A 3DFUA 1J49A 1HSOA 1PX0A 1ZEMA 1ZUD1 2VUSA 1GZ3A 3QA9A 4R9RA 3MOIA 3NTQA 3PI7A 4FIZA 4CUJA 3MZ0A 1FDWA 5ER9A 4IDCA 5JO9A 2HO5A 1MG0A 1I10A 4E31A 1R0LA 3E5MA 2G76A 3K9QO 1HYEA 1BVUA 3RFXA 5G0SA 2BRUA 5DCWA 1QR6A 1CQJA 4OKNA 3IUPA 4PIVA 1PR3A 1YBAA 3WQRA 1U7HA 5JMWA 3BA1A 3BMQB 1MG5A 2VOEA 3TRIA 3KZVA 3ANNA 3QVTA 2QIOA 3UCFA 1HXHA 5BSFA 4H3VA 1D8AA 3WGTA 2W2KB 1XQ6A 3JQ8B 4BGVA 5CDUA 4P22A 5AXCA 3QV1A 2CSUA 3VC7A 4IIUA 2JAHA 3FR7A 4RLSA 1PQWA 3ZZNA 2IXAA 1Y8RB 4R41A 2Y1OA 2AE1A 4BGEA 3DFZA 4YJGB 2C54A 3PEFA 4AICA 4YB8A 1P1IA 4XZ3A 4DMMA 1G0OA 3PWSA 4BHTA 1U3VA 2PGDA 2DBRA 3FWNA 1LSSA 1ENPA 1BXZA 3AWDA 5G4KA 1PQUA 4IGEA 2PKQP 2C07A 1S7CA 3TPCA 2B5VA 1HDXA 1SEPA 4EEXA 1DO8A 6LDHA 4O6VA 3D5TA 4JXKA 2DPGA 3GVCA 3IS3A 2I99A 3E9NA 3V8BA 2OMEA 3I9OA 4BIIA 3PWZA 3WJAA 5G0UA 1QYDA 1Z45A 2C59A 3GUCA 1U4SA 3DAFA 3OHSX 3ADOA 3U5TA 3IDSA 2Y68A 2DLDA 2O4UX 3DAPA 4PLFA 4HFNA 5CEFA 1BW9B 4IDBA 4KZPA 3KYCA 4KTVE 3C3XA 9LDTA 1ISJA 5DN9A 2O3JA 2ZJ0A 4M55A 5B4VA 1CF2O 2I6TA 2X0IA 3LLSA 2VNAA 5JLAA 2B5WA 4XYBA 5ENVA 1LQTA 1GZ4A 3IUSA 4K26A 3SLKA 2DBZA 2FHSA 5CFZA 2VYVD 1GTMA 1H6AA 1JKJA 4BNUA 5KJFA 3GG9A 1P1KA 4I5GA 8LDHA 5EMHA 3ZU2A 3LYLA 3A06A 4DWVA 1YXMA 2Y66A 4OXKA 1YL5A 3W4IA 1YS4A 1ONPA 3ABIA 2DQ4A 4JQCA 2P9GA 1PGJA 1J0XO 1X1TA 1DRUA 2BI7A 5EJ2A 5HS6A 4MIYA 2CVOA 2WE8A 3GH3A 3KV3O 4CQMA 1GADO 3I23A 4DREA 1M6WA 2V65A 1H9AA 4RZIA 1C1DB 3WJ7A 3DXFA 2GASA 4PVCA 2Q45A 3GEDA 2FPGA 4W7IA 5BSGA 2VHWA 4UEOA 3GMDA 3JQ7A 5J9GA 4RF2A 1LEHA 1E77A 3GMSA 1ZK2A 4O5OA 3JSAA 5JXWA 1IHYA 1PEDA 2VUTA 2GNAA 3BHIA 5COQA 3RUDA 4EJ6A 4JP2A 3ZV4A 1UAGA 3QIVA 3AJRA 1W6UA 3FRJA 4NH4A 3BZUA 3WTCA 5I7FA 4BMVA 1ZJYA 1JLLA 4DQVA 5L4NA 1QMGA 4NFYA 3HN2A 4L75A 4MVJH 4CV1A 4RL6A 4GMFA 3DQPA 4E2WA 1UXHA 1WZIA 3GAZA 4I5EA 5GY7A 5HRUA 5JYDA 2Y1GA 4UVEA 7MDHA 3R3JA 5DBFA 2TMDA 6ADHA 3Q6IA 3V5NA 5KTKA 1ZBQA 1FDSA 3EZYA 1JKFA 4JBGA 1ZO8A 3WGGA 3PFWO 4B3IA 2J3HA 5H81A 3E5RA 1E6EA 3HB4X 1WWKA 5MGBA 1K89A 2ZYDA 3K73O 4YJFA 1X7HA 2YZ7A 5U1PA 3MJEA 3KVOA 4WLVA 2GRAA 2J6IA 3LT2A 4CV3A 5I7EA 3EK2A 3L6OO 3OIGA 4BGUA 4YACA 3D64A 3GFGA 4FN4A 1XEAA 4M1QA 1GPJA 1JW9B 4J9UE 4IDGA 2C5AA 3SXPA 5JC8A 4GX5A 3OP4A 1LDGA 2RHCA 3FTPA 2GLXA 3R0IA 3PGJA 4TZTA 2G5CA 4ZVVA 1ZSYA 3V2GA 5EINA 2A94A 4FFPA 1P31A 2G0TA 3VPGA 1UDBA 5ICMA 1E92A 3UVEA 1E5QA 3AUUA 2PR2A 3G0OA 5EPOA 3TOXA 3WNQA 3PYMA 1JWBB 3U3XA 1R15A 2Q1SA 3KYDB 3FN4A 4NFHA 4ZQEA 2XF8A 1O9BA 5F1KA 2V6MA 3I9NA 3WBFA 2E49A 3WG9A 3U4IA 2ZCUA 2CF6A 1I36A 1DC4A 4AFNA 5A9SB 1O0SA 5FYDA 1QYWA 3U4HA 2W90A 4J4TA 4FR5A 1H2BA 3CXRA 4RVHA 4IS2A 3S2EA 3HDYA 2BGMA 1FDUA 1NQ5A 1Y81A 4AJ4A 1QYXA 1CDOA 3DBRB 3GPIA 4MINA 4W99A 1CYDA 4GLLA 1HSZA 1YE3A 5G4LA 4IXTA 5I8ZA 2PGLA 5F21A 1GQ2A 3CH6A 3ICCA 3X2FA 4A10A 4E5MA 4OXNA 1R12A 5DOVA 2VWQA 1BHSA 1DFIA 1GCUA 5JAQA 1SBYA 1GV0A 4G5HA 4N18A 4NI5A 3OMLA 1GAEO 4PFJA 1HKUA 4YBZA 3GGPA 1KVUA 8ADHA 2GN9A 3QVSA 3RVDA 3H9GA 3RD5A 3ROQA 3K31A 4I5FA 4AJPA 1NYTA 4Q3NA 1YQGA 3B20A 1NX6A 2I67A 4GVLA 1E3EA 4MKRA 4WUVA 2EV9A 4IS3A 1TA4A 1ISGA 1VL6A 4XD2A 2YUTA 1RM0A 3ZCXA 4HNGA 5L3ZA 1PJLA 3VPHA 3WXBA 4BUCA 3FF4A 2AW5A 1QXSA 2GN8A 1A9YA 3H6KA 1B7GO 5AQ1A 5EERA 3G1UA 2P68A 4Q3CA 5G4KB 3ZV5A 4PGFA 4TZKA 4J90A 3WGQA 1AGNA 1EZ4A 1ISMA 3CZRA 5G0TA 1ZXLA 4QO8A 3GGGA 4DA9A 5G2OA 3IMFA 1N8KA 4JROA 4Y6SA 5AXBA 3M6IA 4AJIA 5F1PA 3VH3A 5L51A 3OF2A 3NTOA 2EEZA 4WCDA 3AK4A 4GKVA 2HMVA 5COAA 2W2LA 1NM5A 4LSWA 5B4TA 3D5QA 4O63O 3C1OA 1B14A 1ZKMA 1T2FA 3W8EA 2VN8A 3HE3A 3PP8A 3AFNA 4U6QA 1YJ8A 4HFMA 3D3EA 3OFSA 4D3FA 4DBZA 2PNFA 1MB4A 3JD0A 2H5LA 5B37A 1ZCJA 4ZU3A 1GEGA 1ENYA 4NNJA 5DOZA 4FJ0A 1PWXA 3HADA 3HQ4O 1I0ZA 2BKAA 4RQTA 1DHTA 1GDHA 5CDTA 4TRRA 1M76A 1AN9A 4XR4A 4W6ZA 1X14A 3ST7A 1MLDA 5FFFA 1LDEA 4F46A 4J6FA 3NJ4A 2WE7A 1T24A 3QHAA 4WLFA 1DRWA 4FFNA 5TX7A 2D3TA 4YJHB 4K28A 1CRWG 2BD0A 3AU8A 2PFGA 3GGOA 2YDYA 1YL6A 3JYNA 4C7JA 5MDHA 3I3OA 3E1KA 1WMAA 4NK4A 2H9IA 3D4PA 2X5JO 4PG8A 4NFSA 3OEWA 4J1SA 1I5RA 5FF9A 3W8DA 2YV3A 3H2ZA 4GWKA 4A0SA 4DVJA 3SVTA 3CTMA 4II3A 4B3HA 4CM8A 4EDFA 2HKIA 5F1OA 5BR7A 1WDLA 2X0RA 3GRPA 4CQMB 4GSKA 1SAYA 4MP3A 1L7DA 3PGXA 4ZQBA 2LDXA 4Q3EA 5AOVA 2ZQZA 4Z3DA 1PJSA 2Y99A 1LU9A 4Z9YA 2H1SA 1XQ1A 1KEUA 3N58A 3I9MA 3W1VA 1F8GA 1NPYA 3PZBA 2DTEA 2A92A 3BMQA 3JQ7B 4XGIA 4BNFA 1VKOA 2I66A 2QYTA 2CDAA 1V0JA 1Q0QA 4WLNA 3UOGA 3DZJA 3HFSA 1MC4A 1R4MA 5J23A 3JQ8A 4CR8A 3ETEA 3K8ZA 2EGHA 3GVHA 1QP8A 3VOSA 1N2SA 3JD4A 4HXYA 3U09A 1NAHA 3D3WA 2BHLA 3WYCA 3GNTA 4M54A 1Y1PA 1Y8RA 1Z6ZA 1DPGA 3NDJA 4MP8A 1XG5A 4XR9A 3GR6A 4L4XA 2HMTA 1PS9A 4R68A 2DKNA 4ZRNA 3UF0A 4MVJM 5T73A 4YTEA 1UZMA 3UHAA 2PA3A 4PZCA 4J49A 3FNHA 3RKRA 4FQ8A 2BFMA 3Q9NA 5I9NA 1JVSA 3C85A 3OJFA 2Q99A 4Y67A 1TB4A 5CPFA 2EXXA 2G1UA 4OQYA 2Q46A 4XIYA 1RKXA 3JQBC 3UXYA 3KOUA 3WLFA 1NQTA 1QLHA 2J5QA 3BTVA 3NT5A 3I9LA 4BNVA 4NU6A 1P3DA 5G0WA 1V8BA 4ONEA 3OJLA 4C4OA 3KUXA 2D59A 2QW8A 1HRDA 4YJFB 1UJMA 2I3AA 1NPTO 3NTRA 1DC5A 5KVQA 1Q1NA 4YT5A 4R69A 1IPEA 4ND1A 4FB5A 2WSBA 1X0VA 2NU8A 5L7TA 2HDHA 2IE0A 1HYHA 5KVSA 5DBIA 3RQSA 4LN1A 4CQLA 3BYZA 4FFMA 3NT4A 4J1NA 3ZV3A 3JYQA 3Q2KA 3H5NA 4OYRA 2X4GA 3HHPA 4RPJA 4BO6A 2D5AA 3FNEA 3I4CA 1OOEA 2O4CA 3BTUA 3A28A 3NGXA 1Y6JA 1Y9EA 2FPIA 4FJ1A 1K2WA 2XXBA 2IZ1A 3S2GA 3RCBA 2B83A 4XGNA 2P9CA 1LSUA 4FGSA 3HDQA 3L4SO 4TSKA 5JNLA 3DZKA 4CMEC 1SMKA 3GHYA 3H9UA 2HUNA 2IXBA 1FMCA 4BKQA 4CL8A 4XB2A 3SC6A 4BO3A 1H94A 2X86A 4CMAA 3WFJA 2NSDA 1JQBA 2AEJA 3VKVA 2OUIA 4FOSA 3VVCA 4NBUA 2OP1A 2FPPA 4UEJA 5JS6A 5A5FA 3FBTA 4H16A 1CWUA 2E6UX 2D8AA 2WD8A 2FZWA 4ND3A 1IHXA 4JNKA 1IUKA 5IDWA 2O3QA 4QX6A 4KWIA 4NZ9A 4Z9XA 1NBOA 2ZTLA 4XA8A 1W0CA 2OHXA 1ARZA 5ER6A 4A2CA 5I9LA 1I8TA 3OJEA 4KQWA 1PL6A 3WOHA 3TFOA 3GOHA 5T6BA 1LDMA 3ON5A 1B0AA 4HP8A 1WMBA 4NK5A 3CEAA 1BGVA 3A4VA 3FWZA 4U0JA 1GFSA 1ZZEA 2B36A 4U0KA 1PWZA 3VH2A 1EBUA 5KKCA 1YL7A 3JD3A 5CG2A 3QWIA 4Y9DA 3TOZA 5JY1A 1CERA 5CDYA 1RWBA 2WTBA 2X5KO 4BO9A 4IDEA 1HDGO 1PZFA 2B37A 4KMSA 2ZB8A 1PGNA 4H7PA 5HM8A 2R6JA 1MA0A 3IP3A 5JCJA 3ZWXA 2PTGA 4WASA 4AJHA 3IJPA 3ASVA 4IUYA 4BNWA 5ADHA 5THQA 1XIVA 3E48A 3PQEA 3DEYX 4EBFA 4FFLA 1DIBA 1EBFA 3GN1A 2C5EA 3NAQA 4UUOA 4RF5A 5A3JA 1M2WA 1ORRA 3UKOA 4B8ZA 4YVFA 3QWAA 2YV2A 4IMPA 2OOSA 1UP6A 1IPFA 2DT5A 3EVNA 5IJZA 3VZSA 4A03A 4YEDA 5ENDA 2ZB4A 2VRBA 3C24A 1MGOA 1PL7A 1DOHA 3ZWWA 3JQBA 3SJUA 1O8CA 4I08A 5KJCA 1E3IA 4WECA 1PZHA 4MP6A 2IYOA 5C7LO 4TMFA 4F6CA 5AVOA 2JCXA 2DUWA 1Y9AA 4DLAA 1I30A 1Z73A 4P38A 3LSYA 3TL2A 2Q22A 3B1KA 3NRCA 3L9XA 2Y0EA 4OIMA 3ROKA 3RC9A 1U1IA 1VKNA 4YAEA 5BT9A 4PN3A 3IL2A 3GNQA 2HK7A 4OAQA 4RVGA 1QYCA 1KEPA 4CLEA 4CLOA 1ZFNA 4I9NA 2IEBA 3ZW8A 9LDBA 4NHEA 1J6UA 4PLPA 4YQYA 4P4GA 2ZQYA 4UREA 4JN6B 5TT1A 4OGWA 3KYDA 3OQBA 3LZ6A 4EITA 3RWBA 1YONA 3PJEA 2VZ8A 1IOLA 3RBXA 1P74A 2AEFA 3AY7A 3I52A 4FC7A 3DHYA 3N7UA 1E3JA 3RUCA 1KOLA 4NJMA 3ZHBA 2NVBA 5JAZA 4RF4A 1BVRA 2NWQA 3AI3A 1GPDG 4WNCA 1H93A 2POQX 3OQ6A 1H0KA 1HZZA 3ASUA 1LI4A 4CMEA 2O3UA 2A35A 5TS3A 4F6LA 3OBBA 5DF1A 3GDFA 3DBRA 2CZCA 4PG5A 3RC7A 1H6DA 3Q3CA 1G0NA 1T1RA 1ZNQO 4CM8B 1BG6A 5JMPA 3RKUA 2CUKA 4TKLA 4PG7A 3DTYA 3VDQA 1CEQA 4OOFA 2VWPA 4R51A 2H6EA 2J3IA 2O2SA 3JQEA 1PJ3A 3AOEC 2JFFA 1PGQA 4BNNA 3ETDA 3PLNA 3OETA 3QWHA 4UVDA 4IQGA 4BGIA 4U8GA 2YHUA 1Q7CA 3DTTA 2GZ1A 3ORFA 1EVYA 4TRNA 1M75A 4ALMA 1R4MB 4GX0A 4GMGA 3QWBA 2BFOA 1DFGA 3INRA 1RM4A 1U2GA 4B4WA 4CLRA 3GN2A 4OJNA 3D3WB 4PLCA 3TL3A 1QKIA 2HK9A 2O50A 1SC6A 4GAEA 4WLEA 4YRDA 1DSSG 3DHNA 2A9FA 1ZMTA 2C82A 1U9JA 1RM3A 3BMOA 3QQPA 1HDRA 4L4RA 3KHUA 4DYDA 3H9QA 5I7VA 1LRJA 4I1IA 2WDZA 1MXFA 3Q9UA 3RU9A 2Y67A 3AUSA 1KYQA 1I33A 4LRSB 3ZHYA 1OI7A 2FSSA 5EL0A 3FR8A 1VRWA 3NGLA 1N1GA 2ZB7A 4BO7A 1QLJA 1A4IA 4BNXA 2Y05A 3L77A 3T7CA 4DLBA 4D45A 3O03A 1PQPA 3P5SA 2Q4EA 3PDUA 4IBOA 1A5ZA 1X7DA 5GZ6A 2P9EA 1NP3A 4UAGA 4GX1A 2EWMA 2PZKA 3AU9A 5JBIA 2WEKA 4XQ9A 3WMXA 1P33A 2IODA 4PCVA 2VQ3A 1E3LA 3ZHXA 2X0NA 5JFOA 3O26A 4WCFC 4YT8A 1HT0A 1C0IA 4MKXA 1ZK1A 4YDRA 1KEWA 2VOJA 3U62A 5GMOA 4HKTA 3HNPA 2JKVA 3KEOA 4CQLB 2I3GA 4KQXA 1HDZA 4NG5A 4RVUA 3DZFA 1K6IA 5KCZA 3DBLA 2HAEA 1NWCA 1BTOA 4LCEA 5EESA 4AJKA 1VSVA 4ZQFA 1NFRA 3QJ5A 1A72A 1NASA 4I8XA 4Y98A 4BB5A 4E2XA 4OO3A 1GL3A 3G17A 1QYVA 1EFLA 1BRMA 4YJHA 1GEEA 2HQ1A 1WVGA 4BNJA 4XDYA 4OL9A 2NLOA 3VZRA 5JO0A 2VHZA 1I3LA 1TXGA 2HMSA 1GR0A 5DBGA 4LGVA 5L7YA 3NDIA 1X7GA 2OGUA 3WMWA 4GKBA 4HADA 1ULSA 4E21A 3Q1LA 3CPSA 2PZMA 1SB9A 1NQAO 4HFRA 4AJNA 4XJSA 4PLYA 2AHRA 1R0SA 2O3RA 1B16A 5JW6A 3WQQA 2QRKA 3VVBA 1D1SA 2YW9A 1HYGA 5TIIA 2X9GA 2OZPA 2FMUA 4AJEA 1DIGA 2GN6A 3MOGA 1YQDA 5KVCA 4IJUA 3GLQA 3WR5A 1AHHA 2UUPA 3GVIA 4KDFA 1XCBA 4EJMA 1WW8A 2HJRA 2Q1TA 2VZ0A 4MO2A 1HTBA 3UN1A 2GGSA 2VRCD 4YAJA 3I9JA 1PJTA 1UP7A 2F00A 1NPDA 4ZQHA 3AOEA 5L4SA 4WKGA 4KOAA 1Q7GA 5AXDA 2NUAA 2NQTA 3KEQA 5C7OO 4H15A 4YXFA 3GA0A 3A9WA 1DHRA 4FOOA 2AG8A 3OQ1A 1F0YA 4JCOA 5LDHA 5KNLA 5IF3A 3GDGA 3WNVA 5KJEA 3TZHA 4HWKA 4E0BA 4UVHA 3F47A 3C7CB 5C7IO 1O5IA 2O3SA 2B4QA 3S2IA 2X58A 4DIOA 4RO0A 1TT5A 2TMGA 4D79A 2O3TA 4BNHA 4DIFA 2HRZA 4J3FA 2W8ZA 4DPLA 4L0QA 4RF3A 1PJCA 1NQOA 1WZEA 4GSLA 4PLWA 5KKAA 5IDXA 2D0IA 3TQHA 1H6CA 4YWJA 5U9CA 1DFHA 1L1FA 5KJ6A 1R16A 3OICA 1X1EA 4NBWA 3E9QA 3WIDA 1X15A 4NIMA 5JYEA 2I9PA 1GUYA 1IZ9A 5A1TA 1KEVA 1H2HA 2VYNA 2PH5A 1MUUA 3B1JA 1P0FA 4JJIA 3VZQA 4ID9A 2PGJA 2NQ8A 2EG9A 2YFHA 3RASA 3DB2A 2DTDA 4QECA 1E0DA 1XLTA 5JAIA 4CLOB 1U3UA 3NYWA 2HJSA 3WGYA 3HSKA 1OC2A 1RJWA 1XKQA 4OH1A 4WCFA 1T26A 2Z1MA 4BB6A 4Q3DA 2DPHA 4CLXA 1B8UA 1D7OA 5CAEA 3RBZA 2FY8A 3AI1A 4GI2A 2O2YA 3VAZA 4IJWA 1HDCA 4MVJA 3AUAA 3OIDA 4BNKA 4DMLA 4HFJA 3IC5A 4RV9A 3JQDA 3IKVA 1KBZA 1WDKA 1CETA 4U7WA 2R2GA 2NACA 4F45A 3GVXA 2WD7A 3QW2A 4NBTA 2AE2A 4PG4A 3G79A 3ZWNA 3TN7A 4NJMB 3PYXA 1XHLA 3K2EA 3PJFA 1BMDA 4BMNA 2JL1A 3WWZA 1SNYA 2NV6A 3OA2A 2EKLA 2B4RO 3GZNA 3U9LA 3ZNPA 4DQUA 4TROA 1K3TA 2WYWA 4B3JA 4ZHSA 2Y0CA 1JAXA 4L73A 5K0ZA 2O7QA 2GDZA 1UH5A 4E12A 4ND5A 3SEFA 2XPCA 4ZGWA 3EW7A 3M2TA 4J4HA 3DHEA 4DXHA 4JGBA 5KOIA 3DOOA 1P1HA 3LVFO 1IY8A 3EUWA 1GZ6A 2XOXA 2ET6A 3JD2A 4FSHA 1S6YA 1Y5MA 4BQRA 3PHIA 4EZBA 3WGOA 1GQQA 1EE2A 3S2FA 1HF3A 4J7UA 4N5NA 4BV9A 1JTVA 1KVSA 1KIFA 1HE2A 4WE3A 2X0JA 4ZD6A 3SC4A 3EDMA 4E33A 5B4UA 3CUKA 1P1FA 1LDNA 3AFMA 1E6UA 2DVMA 4FFOA 4I5DA 1E5LA 4GBJA 4IPTA 3ZHZA 4CPDA 1U8FO 2DUUA 4CLRB 2JFHA 3DDNA 4DPKA 3FHLA 4XWYA 1H5QA 5A06A 3KSUA 4DLLA 2AQKA 4CMBA 4IJVA 3L9WA 4MJLA 1E1MA 1ID1A 1NR7A 5DCUA 1FDVA 3BMOB 2P91A 4WNIA 1DXYA 2AQ8A 2VNSA 3VDRA 1Q2XA 4M87A 4E5YA 5EQDA 4TVOA 2DU8A 2EKQA 2VHVA 3ITDA 3UCXA 2AEMA 4EUHA 1UDCA 1I3KA 2WJPA 2UV8A 1J4AA 3AOGA 1BDMA 3QWFA 1JWAB 4LISA 3GF4A 4DRYA 3PLRA 1QV7A 3TZKA 1NHGA 2GN4A 1HETA 3WWYA 3M1LA 5DULA 2HMUA 3PK0A 2HU2A 1SEVA 4FC6A 5C3MA 4RVDA 1P77A 2PLAA 4LMPA 4DTIA 3U4CA 5TSDA 3MWDB 2JAPA 3ZNOA 4ALIA 4IZIA 3IAHA 3K30A 5ILOA 4XYLA 3IIEA 1E7SA 3WGIA 4CR7A 3TZQA 1DAOA 1PGOA 3RUIA 3JQ9C 1WPQA 5M6DA 2VT3A 1NXQA 3QRWA 3DBLB 1F14A 3JQFC 3P2OA 1N7GA 1M67A 4L4SA 4M49A 4YJDA 3O8QA 2UVDA 3UW3A 3PPIA 1K6JA 1HE4A 3CIFA 1SPXA 3C7DB 4O1MA 2HRBA 5HBRA 3H2SA 4BO0A 4E3ZA 1UXIA 3MTJA 2VCYA 4Q39A 2RH4A 3ONDA 2EW2A 2NTNA 5TGDA 3DOJA 3GZ4A 4XQEA 2BLLA 3VZPA 4R1TA 1BXKA 2GZ3A 2D5CA 3H9EO 4XIJA 2R00C 1GYPA 4N7RA 1EVIA 3KRTA 4ND2A 1JAYA 5IFLA 3S55A 3SJ7A 1EFKA 5IG2A 1EEHA 2BMAA 3UH1A 4BNMA 1OMOA 3DBHA 4DUPA 3GY0A 4CM3A 2C20A 2AMFA 2QHXA 1E1NA 1G1AA 4OMUA 4MVJG 4J1TA 1IL0A 2BGKA 4R4JA 1O95A 4QTZA 1EQUA 3TFQA 2AA3A 4RORA 5BNFA 1LLDA 1LA2A 3DO5A 2J8ZA 4BKPA 2NTJA 4CLHA 2NVWA 5CDSA 5IN5A 2Y1FA 4M8SA 1MFZA 1EUZA 3GEMA 4ROSA 1U2DA 3BHMA 1JKIA 3PHHA 3ZNQA 1GUFA 3DZIA 1E7RA 5ITWA 4GH5A 2OBYA 1TVEA 4JLWA 4E32A 4R01A 2YYYA 3LF2A 3LT0A 1T4DA 4W7HA 5DDIP 2P4QA 1UDAA 5JDIC 4MKZA 4WGGA 4WK6A 5JY6A 1EDOA 5K6AC 1UZNA 5GZ1A 3FD8A 4ALNA 3KO8A 1P1RA 2NU9A 4BNYA 1L7EA 2NU7A 4CMHA 4GVXA 4BNTA 1HLDA 1JU9A 5FI5A 4CM7A 2QQ5A 1HZJA 4RPKA 1TT5B 5K9ZA 3B70A 4IGFA 2X1HA 4EGFA 3F46A 4IQ8A 3ZNNA 1T2AA 2DTXA 4EYEA 3MJ4A 5CEJA 4QO7A 1Y5RA 5L45A 3IOYA 3UICA 3RFVA 2YHIA 4Q9NA 2DFVA 5L95A 4LRTB 3BAZA 1MV8A 1QSGA 4HY3A 2EF1A 1K6XA 4EJ0A 4YYZA 3I5MA 2P2SA 1V9LA 4K6CA 2PV7A 3E9MA 4ALKA 3PIIA 4YPOA 3E82A 3M1AA 1C14A 5DCYA 3BXXA 1YH3A 1P1JA 4R3WA 1OZAA 1DIAA 3G3EA 4FBGA 3LT1A 4MVJI 3OJ0A 4U5QA 2JD1A 1BSVA 2B69A 4IJKA 4WCFB 5A9RA 5H82A 5IDYA 1MC5A 1MFPA 3EVTA 2JD0A 3HUDA 3JQ9A 3GRKA 3KLMX 1YB1A 3LK7A 3MJCA 5LCXA 2JD2A 3HJAA 3V1YA 2ZYGA 1EDZA 1EMDA 3JQFA 2BFPA 2UYYA 5G0VA 3S8MA 4FFRA 1T2DA 1G6KA 1Y8QA 1ONOA 3L0DA 1E6WA 3HDHA 4KUHA 2WD7B 2GYYA 3CINA 1T2CA 4RPGA 2JFGA 3WYEA 5JCXA 3WQSB 1YO6A 3CMCO 3GZNB 2Y1EA 1Z82A 1XWFA 4ALJA 4UVGA 3HB5X 4IZHA 2OORA 3MTGA 2Q2WA 1R6DA 1NWHA 4BL5A 2EP5A 1IB6A 1B8PA 3G49A 3PYLA 5ILGA 2GPTA 4DPMA 4J9VA 3LC1O 1ZW1A 3JYOA 4XCVA 4E6PA 4J16A 4UUPA 3VTFA 3W4JA 1Q0HA 3AW9A 4J7XA 4YAIA 3TJRA 4KDEA 5CG1A 1YBVA 3AY3A 4WOKA 3IJRA 5U4QA 1V3TA 1YVEI 3MWEB 4J0EA 3E6AA 2Q1UA 4IDDA 3B6ZA 4QT0A 2VWGA 3RC1A 5T64A 3ZWBA 2CF5A 3RUHA 2D2IA 3PRJA 1LJ8A 3RSHA 4R16A 1PJ2A 4CM4B 4PVDA 1T1SA 4E5PA 4E5NA 1UAYA 2VTEA 4II2A 5HTOA 4PZDA 1QRRA 4GWGA 5JE8A 2BGLA 1ULUA 2V6GA 3WLEA 1C1XA 5JDIA 1QG6A 4L8VA 4NPCA 1LTHR 2HLPA 1XR3A 2P5YA 2YY7A 4AVYA 3F5SA 3KB6A 5IZ4A 4INAA 1DC6A 4B4OA 3WICA 3ZN2A 1IYZA 2ZIZA 1E1KA 3HFGA 1R0KA 4CQMD 4YR9A 3IKTA 4CV0A 3C1TA 4JP3A 3IP1A 3F1KA 3T7EA 3ONFA 1HDYA 4QEDA 3JV7A 1ZJZA 2FP4A 3Q11A 5IAAA 4MDHA 5H83A 5THKA 1U5CA 4O0LA 3RUAA 4A26A 2EIHA 2D1YA 4UUMA 4UVIA 4LSMA 4WOJA 1HE3A 4OOEA 4KUEA 4XRGA 4MVJE 3K96A 5KWEA 3DOCA 1I32A 2VUUA 3L4BC 3ULKA 5I8WA 4FPXA 3NDRA 3GHHA 4OSPA 4RQUA 1YKFA 4DC0A 1DJNA 3OM9A 1W8DA 1H9BA 1ZSVA 2D4AA 1CQIA 2Z1NA 3PFFA 4BNZA 1B3RA 5A02A 1NVGA 1XDWA 1NFFA 2PD3A 3O8QB 4P8RA 2NVUB 4GPD1 3LU1A 1PJQA 1TI7A 5TF4A 4NR0A 1HL3A 2IRWA 2BELA 2JHGA 5FWNA 4BMSA 4NDNE 4DBVO 3QY9A 1XYGA 2EJWA 3OH8A 4E2YA 2ZTVA 5I7SA 4EUEA 2GUGA 4TRJA 3QVXA 4LVCA 4Z3KA 4BNIA 1V3VA 2I65A 3ENNA 3PXXA 2CVQA 4YT4A 2O23A 3DZBA 1PJBA 4BS9A 4CMCA 4Y8VA 1U4OA 2DAPA 3H3JA 4CLDA 1C3VA 2VHXA 3PWKA 3F4BA 1IULA 5BNIA 4JBIA 3DBHB 1EK6A 4HX5A 1GYQA 1FJHA 4D0RA 3QSGA 2C7GA 3PDJA 2CVZA 1U5AA 1RYDA 3LC2O 5BSEA 3R6DA 3SLGA 4GLOA 3TWOA 2VYND 5DP2A 3S1LA 3ZGYA 2IYPA 3I83A 1B3BA 4CMKA 1ADFA 1DAPA 1A7KA 1F12A 3K6JA 2NTVA 5AYVA 3EMKA 2CY0A 5BNTA 1UZLA 3DC2A 5HA5A 3RIHA 4MIEA 3W6UA 4CMGA 1DC3A 2I76A 2YQ5A 2C2XA 4AJJA 4FW8A 1ISIA 2WM3A 1A27A 4PZEA 4MVJD 2PY6A 1HEUA 1UXGA 4A5OA 2QX7A 3EGOA 4LK3A 2NM0A 1E3WB 3L07A 4HUJA 5EQFA 1FDTA 1UR5A 2HMWA 2X9VA 1VPDA 3QE3A 4Q3BA 5A9TA 5TQVA 1DIHA 3UCEA 4CM9A 4JX8A 1V6AA 1GQYA 3PQDA 3OA0A 1YB4A 5CEEA 1ZK3A 2X5OA 2X9NA 2VTDA 1OBFO 3LLVA 3EYWA 4CR6A 4B7UA 1E7WA 1KETA 2YDXA 3UAGA 3WFIA 1Z75A 3CMMA 3DL2A 2AQHA 1VL0A 2WYUA 1AHIA 3W8FA 4PLZA 4YAKA 2DBQA 3BTSA 3VHRA 1GCOA 2Q3EA 3D4NA 4CUKA 1I24A 2IZ0A 3GVPA 2AG5A 1UUFA 4E30A 4OSOA 4JIGA 2YHIB 3PJDA 3QP9A 4CMJA 3DZGA 5L9AA 3ITKA 3PHGA 4IIVA 2O7SA 2ZATA 4D41A 3VPSA 1KVQA 3FTNA 3H65A 2ZCVA 3D4OA 3ZV6A 2GZ2A 1LSOA 2G17A 3AY6A 3HN7A 4A27A 4R54A 4A73A 2PWZA 4TWRA 3ZU4A 1IE3A 3L4BA 4Z9FA 4K6FA 3ZH2A 3JQAA 4QUKA 3RU7A 1HE5A 2V7PA 3LF1A 1YDWA 4B4VA 2JHFA 1KVRA 1DRVA 3F3SA 2BFAA 4DIBA 4M89A 4RDIA 2FR1A 4YT2A 1VSUA 4Z0HO 3K92A 3TNLA 1GYRA 4BO1A 2HSDA 2QYSA 3ZWAA 1XU9A 2VHYA 3MCVA 3ZWOA 2GSDA 3FBGA 1H6BA 4NQZA 1ZSNA 1DB3A 3ANMA 1E3SA 2C2YA 4FCCA 4R9SA 3EHEA 1FXSA 4TKMA 1Y8QB 4URFA 4AJ2A 1YRLA 1RM5A 4L9RA 2GF2A 3WSWA 5T5QA 1DJQA 4WJZA 1PIWA 1D3AA 1LDBA 2QZ9A 1ZEJA 1KY5A 2LDBA 3F6YA 4UULA 3H9JA 1XGKA 4CUZA 4KP7A 3VH1A 4CM5A 1KC1A 2B35A 1NAIA 5A05A 2EKPA 2UUOA 2VZ9A 4PLGA 4EW6A 4PRKA 2FRDA 2CMDA 2W2LD 5HS4A 2E48A 2Q4BA 3OEYA 4O59O 3DMTC 5IZCC 1NHWA 4KWHA 4E4YA 2DC1A 3ICPA 2C0CA 4MOWA 3OECA 1ISHA 4OQZA 4BO4A 4XJTA 1N92A 5JAMA 2FN7A 1VC2A 3E8XA 3ZW9A 1HWYA 3LC7O 4ESOA 4E5KA 4P4LA 3ZWMA 3M2PA 4XYEA 1B2LA 1KY4A 3JYPA 3U49A 1Z7BA 2RBEA 3RUFA 1TEHA 3WGZA 1LNQA 4NBVA 4J1QA 2FR8A 2RIRA 1LXCA 3TDKA 5JSFA 5L7WA 1KERA 4XGKA 3JQGA 2SCUA 3CSDA 4Y6RA 1I01A 4XRRA 4AJ1A 1KS9A 3I4FA 4JJGA 3LDHA 4J4BA 4EUFA 4D3SA 3KETA 2UDPA 4ZRMA 5FEUA 1XU7A 3T4XA 1C1XB 3WTBA 1KVTA 4K1LA 2EW8A 4BO2A 4GX2A 3FCOA 4D3DA 2Q2VA 1A4UA 3V1TC 4Z0TA 3WYBA 2J5RA 3KYBA 4ZA2A 4CV2A 3KLPX 4ZICA 1SB8A 3AM3A 2ZKLA 3BMCB 2PZLA 2E4AA 3HZZA 1UXKA 4N5LA 1WXDA 4XQCA 4FJ2A 1K0UA 4S1VA 1YGYA 5JDCC 4U6SA 2QRLA 4BOYA 2X7HA 3RI3A 3DONA 1JN0A 1LSJA 5BSHA 3DBVO 5TLSA 1GD1O 4IINA 3WB9A 4BKRA 1LLQA 1OFGA 3BTOA 3O38A 5L4LA 1SOVA 1XELA 3GPDG 3HWRA 4ZN6A 4GL4A 1N9GB 1LBEA 4WEOA 3JTMA 1E7QA 4I9UA 3I6QA 1AXGA 1TLTA 2ZTUA 1DLJA 2ZK7A 4CL3A 1ML3A 1VE9A 2OFPA 1LC0A 2ZYAA 1ZMOA 4N5MA 3JQ6A 4B7XA 1WAMA 3ZDFA 1J5PA 4R5MA 4RZHA 4Z6KA 3WSVA 3JQCA 2W4QA 4J0FA 2FWMX 1BXGA 1DBVO 2JCYA 1D4FA 5HWSA 1P9LA 3G1TA 3T4EA 3EAGA 3TSCA 5IDQA 3RFTA 4XDZA 3V1UA 5LDGA 5IN4A 3VPXA 3ANLA 5DNAA 1EUCA 1PS0A 4WLOA 1YJQA 2CD9A 3NJ8A 3D1LA 2QG4A 4D42A 3SBOA 4ALLA 3DAGA 2AXQA 1M6HA 3WIEA 1ENZA 1IZ0A 3FSRA 1TT7A 1ZK4A 2WWRA 1EK5A 1ISFA 1C0KA 2NNLD 2VT2A 4QFDA 3BMNA 4PLHA 2EP7A 4ND4A 1P44A 5T67A 1NNUA 4CMIA 1N7HA 2FR0A 1YQXA 3TZ6A 1B15A 3H3FA 3A14A 3R1IA 1LUAA 2HK8A 5DT9A 3VH4A 1F06A 4XB1A 4LMRA 1I3NA 3C7AA 5TT0A 3DMTA 1Q7BA 2A4KA 5IZCA 4KTTE 3KSDO 1WNTA 3ZU3A 1U8XX 2ILTA 2WMDA 4AJOA 4CM4A 3GG2A 1YOVA 3AM5A 3GQVA 4FDAA 1HLPA 4J7CA 1EVJA 4DQXA 2RCYA 5T57A 1D1TA 2VYVA 2FOIA 1PS8A 1A9ZA 1T4BA 1OC4A 4BVAA 3KBOA 3P19A 1LLUA 1QORA 2JJYA 2PD4A 1UXJA 3I6IA 1Q0LA 4X54A 1NVTA 1GU7A 3HDJA 5EIOA 1DEHA 3UFXA 5KVVA 1AUPA 4EI2A 1ZIDA 3I9KA 3WDSA 4QFCA 1MX3A 1FK8A 4UUNA 1SOWA 5KJ1A 1O6ZA 4IMRA 4B7CA 3ZWVA 3E03A 1R4NA 4R5HA 4J2OA 4DC1A 3P2YA 3H7AA 2C29D 5LC1A 1B26A 2RHRA 1Y7TA 2CDCA 2XAAA 1ZXBA 1YB5A 2E37A 3ADPA 3EZLA 3U4DA 2I5PO 4RCVA 5DZSA 4IDFA 3IQDB 4IY1A 1VLLA 3WGHA 4D46A 4JJFA 4RVFA 4YQZA 3ONEA 4BKOA 2Z5LA 3INGA 1U3WA 4C7KA 3JD1A 2NU6A 1EE9A 4BNGA 3FI9A 5JDCA 4E13A 3KSZO 2JCVA 4WEQA 2VRCA 3CZMA 3SX2A 1EUDA 3H5RA 3F5QA 4D7AA 2PK3A 2ZTMA 3AI2A 1PTJA 4XKJA 5ICSA 5JCJD 2NVUA 3F9IA 2Y1DA 4MVJF 2EHDA 2Q1WA 3JQAB 3RAJA 3KYCB 4AJLA 3RROA 1VI2A 2BH9A 3CE6A 2B0JA 4ZQGA 4P4NA 2Y0DA 2YV1A 1YWGO 1ONNA 3GC6A 5T8KC 3KXDA 5JYFA 4J2HA 4WPGA 1MP0A 1LC3A 4N54A 1AE1A 4PLVA 1PR9A 2RAFA 3GAFA 3TZCA 1PJ4A 5DP1A 1BWSA 3RJ5A 1ADCA 4W4TA 4BV8A 1V35A 4IXWA 1ZH8A 2OBNA 2X23A 3ZWPA 3RC2A 4OKIA 4DGSA 1LQUA 4PG6A 3DWFA 5ES3A 2BI8A 1LRLA 3N74A 3HG7A 1VJ0A 2GD1O 5F5NA 3EC7A 3GDOA 3ZWYA 3P7MA 2ZB3A 1ADBA 4GGPA 3LQFA 1LLCA 4QSMA 3ZU5A 4YRBA 3LT4A 1PZEA 2OL4A 2B4TO 3MJSA 3FNFA 3W4KA 1MXHA 1W73A 4I9HA 3INTA 1F8FA 1DIRA 1XSEA 3BIOA 1N1EA 3A1NA 2H63A 1GUZA 4RVSA 5CP8A 2W2KA 1E3WA 3ROPA 4RJTA 1C0LA 1U7TA 2DFDA 1VM6A 4RLHA 1UP4A 4MPDA 5TRTA 3FPCA 3D7LA 3MJTA 4OXYA 2OXIA 3PZRA 3WBBA 3JQGB 4YJGA 2Q2QA 4R1UA 1T2EA 4XYGA 5GZ3A 3ETGA 4B8WA 4JBHA 4Y6PA 5C37A 1NR1A 1VL8A 4Z0PA 4LCJA 1NFQA 4YAGA 2G82A 4PRLA 3F1LA 3X2EA 2GR9A 2J3KA 2EJVA 2PZJA 3GEGA 5A4DA 2OP0A 4Q3AA 4QXMA 1R37A 4MVJP 1CIVA 3C1AA 1E7YA 3E18A 1DDOA 3Q2IA 2YQ4A 1ENOA 2Z95A 4RDHA 4D43A 5B1YA 4ZJUA 2F1KA 3ZI0A 3H4VA 3WS7A 2QRJA 1EQ2A 4L76A 2C7VA 5C5IA 5KIAA 4XQGA 1NTOA 3ROMA 4NU5A 2BF7A 1W4ZA 3RUEA 4PLTA 3K5PA 5CPBA 3K2BA 1SCUA 2X6TA 1BDBA 4YA6A 3O4RA 3F4LA 3C8MA 1BW9A 1I2CA 1QV6A 1LRKA 2IDZA 2P5UA 1YDEA 3MEQA 3KTDA 4W9NC 3OIFA 3KM0A 1OAAA 3UUWA 2YJZA 4LVUA 5CHEA 3GFBA 4BO5A 1A7AA 2Q50A 1RPNA 7ADHA 1PSDA 1K5HA 3PTZA 2J5KA 1PL8A 4CJXA 2RH8A 2CNBA 1YBMA 5L40A 5TNXA 1VJ1A 5AXAA 5L53A 2NADA 3DMYA 2GO1A 3VPFA 3JYLA 2OO5A 3ENKA 5TC4A 2GERA 1BXGB 1N5DA 5COBA 1NVMB 2GCGA 3GT0A 2IZZA 2EGGA 4GQAA 3GNSA 4F3YA 5ITVA 1KC3A 1B8VA 4LW8A 5I9MA 4W82A 1F17A 2PD6A 3FPLA 4ILKA 4WLUA 3VKUA 4BQPA 5T8KA 1E7MA 4CM9D 2R00A 2DM6A 4L74A 3AUTA 2FZEA 2HCTA 2PKRA 4D0SA 4XX0A 1I2ZA 4K9DA 2PH3A 4XEHA 1XA0A 1U3TA 4FD3A 4FS3A 3VTZA 4OHUA 2EERA 3L6EA 3NEPX 1C1DA 3PHLA 4J91A 3COSA 4GGOA 1VJTA 1WLYA 3BMNB 3OJOA 4XYMA 4CMIB 4B79A 3O9ZA 3NX4A 4MIOA 4A7PA 3OSUA 1O89A 1WP4A 3I1JA 3DR3A 1FF9A 5JPIA 2CFCA 1AXEA 2XXJA 4NBRA 4BO8A 1JA9A 3PJGA 1LX6A 4IQ0A 1YOVB 1ADGA 2Q49A 1C0PA 3D0OA 3QLJA 3QVWA 4AL4A 2QZZA 4IM7A 3JQAD 3U0BA 1T25A 1EVZA 4KUGA 4TRMA 2J3JA 5IXYA 3V2UA 1CJCA 3NT2A 4AG3A 2X8LA 5JYAA 2W98A 5K6AA 3STHA 3WX0A 1RYEA 1JVBA 4YRAA 3ZWCA 4DYVA 3QVOA 3NV9A 3BMCA 1Z7EA 5A04A 3NUGA 4G2NA 5F3RA 4S3MA 2DBVO 4ITUA 4M86A 1PGPA 2E82A 4CM6A 4YCAA 4TQGA 4BKUA 1R4NB 2AQIA 4G65A 4RPHA 5EN4A 3RBVA 5F5LA 2FSVA 2YFQA 1I2BA 2ZJ1A 3RJ9A 4BNLA 1I3MA 3H8VA 3PIDA 4R1NA 4HNHA 2CDBA 1N9GA 4NJOA 1X13A 1R66A 3Q0EA 2P4HX 3PHJA 5A03A 1GV1A 3B1FA 5FI3A 3EY4A 3W6ZA 4E2ZA 1HDOA 2Y93A 4NMHA 3GK3A 3UGKA 2V6FA 5IXSA 5BQFA 5JC1A 2O48X 4B4UA 1V3UA 1U28A 1P45A 1JDJA 4R1SA 4G81A 3V2HA 5A3VA 3H5AA 3MJVA 3AM4A 4RPLA 1M66A 2PKQO 5CDGA 3BHJA 4TVBA 5B12A 2V6BA
chains in the Genus database with same CATH superfamily
4QQRA 2X22A 2UVPB 3RYFB 5TJ9A 3NKLA 3QKWA 2UZIR 3R3WA 3CM0A 2HDNB 1H0HA 2CLSA 3EZ2A 4HGRA 5F3WB 1JHYA 1WDMA 3WMRA 3R3SA 4RJ2A 5AJUA 4KPGA 4OM8A 1A71A 1R0ZA 3KQUA 1GHTA 1U2EA 1TU0A 1Z6YA 3GUYA 1WLSA 3TCNA 2AR7A 2WRZA 3LHDA 2PSFA 4DG9A 3FPJA 3I2HA 3SHOA 5LKAA 1SZJG 2O06A 2P78A 5BY2A 1KEKA 5I51A 1GGKA 3V8PA 3SZLA 1PU2A 1R0CA 3DFUA 1SO8A 1U81A 1ZK0A 3KLBA 4ZT5A 4EO7A 1UBSB 1M8GA 1VKHA 1XVLA 5JARA 2A1TS 4TS3A 1QTNA 1U0SY 3ND9A 2I4TA 3ADCA 3S4YA 1MX5A 3AUJB 2B7CA 1CJMA 1MO6A 3K1AA 4UMDA 5ER9A 3R5SA 1VBNA 5JO9A 4DCGA 4FT4A 3ZE9A 1R0LA 2HC9A 5KSOA 5DGXA 4A0FA 5EHGA 3OQIB 4F86A 3K9QO 2G07A 2WJWA 3FTQA 5AH0A 3U3KA 3FLBA 1WJGA 3JALA 4B3DA 1U9ZA 4QVIA 2O2JA 1AN0A 2UZ1A 2XDYA 3HKEA 4RKFA 3NWEA 4PGAA 1PR3A 2ZYTX 4R2XA 1LJLA 4RKQA 3BA1A 4BEVA 3BMQB 1GG9A 5HKLA 3A9RA 3NHUA 3D6MA 3F71A 4C08A 3KZVA 3QV2A 4U7PB 1U0GA 1JBEA 1F3OA 4IV5A 4C0JA 4GPZA 3UCFA 1Z26A 2EGUA 2AMVA 5JFGA 4H3VA 2WLTA 1F4LA 3QEJA 4MVYA 3TEFA 5C8ZA 1B76A 2OZLB 1E59A 5CDUA 2JLUA 5FNVB 3QV1A 2CSUA 2FX3A 3K7EA 4IIUA 1C9MA 2O6LA 4QU5A 1SUWA 2JAHA 3SF8A 3T41A 1S3IA 1GTVA 2BL4A 1NQVA 3CEPB 2VSQA 2C9OA 2IXAA 2Y1OA 4HN2A 3BORA 4K86A 4PS1A 1FLDA 2W6ZA 1ESDA 2XMBA 4IMIB 3G8DA 4HXEB 4LPKA 1XFAA 1V2GA 4YJGB 5AW6A 5K0SA 4YB8A 3DMNA 2DBRA 3FWNA 4I1YA 4ESVA 4N7BA 1P2VA 5GM1A 3NOOA 2QS9A 2MDTA 4TT3D 5JAHA 1OTYA 4XVHA 1U7ZA 1SEPA 4RZQA 4EEXA 1RQLA 2EZ4A 3OPVA 4B3BA 1VL2A 1ABFA 5KUTA 1SG0A 4L5CA 2OCBA 3D5TA 1Q0UA 3BB4A 3B6JA 3NOQA 4JXKA 5K8CA 4YV0A 3IS3A 3TMYA 2F9FA 3TQTA 2AUNA 5AM5A 5JSUA 2OMEA 3ZCUA 1COWA 1WZCA 1SVIA 1Z6AA 3I9OA 3VGPA 4BNDB 4EG1A 5J4VA 2ZSUA 5G0UA 2QUAA 4A0HA 3GUCA 1QPGA 3HEAA 1G5PA 2NGRA 2NO7A 3OHSX 3NLLA 5T4EA 2ACWA 1NU6A 3ADOA 3IDSA 1JHOA 4GS5A 2Y68A 3EXIA 1AV6A 1ZNZA 3H99A 3DAPA 3SYLA 3EF0A 1JAHA 3P9QA 4M6WA 4DUZB 5CEFA 2A5JA 1X70A 3MA0A 4DV6B 4QM7A 4ZTBA 5FCDA 3C3XA 2IHZA 9LDTA 1ISJA 5DN9A 1G5IA 2ZJ0A 4TYNA 4PNEA 2I6TA 2DQZA 3LLSA 3UPDA 3OFJA 2VNAA 4QGGA 3PTLA 3ACDA 4HMQA 2PGAA 1YCDA 2YXNA 7REQA 3H42B 4K26A 4OREX 1ZBDA 2Q6LA 5I45A 2YN4A 1A95A 5JCZA 3H11A 4B6QA 5DLYA 1PFKA 1X7ZB 3TBHA 2G88A 4EVRA 3DYVA 3WK8A 5CFZA 1LPMA 4D02A 1P60A 3CR7A 3RADC 4Q9KA 1GTMA 4BNUA 1C4OA 3GG9A 1P1KA 4ITVA 4JXJA 5FFMA 1P2TA 4FKZA 4LJKA 4R1QA 5HR5A 3AR3A 1SA0B 1FFXA 3BXHA 4PW0A 3SY8A 4GXNA 3DVQX 4TSFD 4TQUS 1QQTA 4KK3A 2Y66A 2VBGA 1DVRA 2VDQB 3K71B 2FRXA 4WTOA 5EI5A 3W4IA 3RSOA 3UH0A 3ABIA 1PR2A 3IPLA 2FMIA 1JSZA 4ZEXA 3ZY2A 1DRUA 2PWPA 3RFCA 2P1DA 2BI7A 3I6YA 4ME6A 5EJ2A 3FMOB 1XCJA 5E95A 5KDLA 2ODEA 5JD4A 5FOUA 3KV3O 4CQMA 4XX0B 5BOSA 1V26A 1RWPA 1E1RD 2DPYA 2IDMA 3HUEA 1GADO 3PJRA 1BA2A 8GPBA 1H9AA 2A0KA 3LKDA 1NBMA 5CBPA 1E1DA 3N39C 1C1DB 2Q29A 1OYOA 2GASA 2AOUB 3DM9B 2FPGA 3IR6A 2WWHA 4W7IA 2V1XA 2VHWA 1U4NA 4G5OA 3GMDA 3CUWA 1WMFA 3DE2X 2QWXA 3QM1A 2QR3A 4LJRA 4UDYX 2DY1A 4EECA 3GMSA 4JH0A 5CX1B 2WF5A 3HDGA 4YUAA 2PXCA 1QK4A 2JGDA 1ZK2A 3D0RA 4KQ6A 4TLLB 4BLUA 1N0UA 1QMIA 1IHYA 3BHIA 2FFRA 4EJ6A 2V54A 3C3DA 3R41A 1O58A 3RUDA 2IPMA 4U7HA 4DCUA 1UAGA 2J0EA 2GO7A 1GPNA 1W6UA 4MIKA 2WBLC 3BZUA 4GLJA 4GPIB 5AP9A 3TIXB 3VOBA 3I37X 4OHVA 3ZJUA 5DX8A 2Q3FA 3K0CC 1BOOA 4E3WA 5L4NA 5K3OA 1IHUA 4GPBA 4NFYA 3HN2A 4NPHA 2ZJ6A 4DARA 1SWVA 4CTNA 1BX0A 3RVJA 4CV1A 3U17A 4O3MA 4P54A 3EXFB 2OCLA 3URMA 2P7HA 1OJ7A 4N5HX 4MV5A 1V47A 5KBYA 1QHHA 3E3MA 5GY7A 4XGQA 1OXSC 4ZDWA 4HS4A 3TMKA 3G7UA 1PR6A 3PLAE 2Y1GA 4UVEA 1L5WA 3R3JA 2TMDA 2QRGA 3FSGD 3IWBB 3Q6IA 1K7SN 2GOYA 3DVRX 3VSDA 5E1DA 4C4XA 1ZBQA 5KTKA 3IKJA 1ZN8A 4E4RA 3EZYA 3KAKA 2WJ3A 2Q41A 4DM7A 1WV0A 2N1MA 3TAHA 4ZOAA 5DN6D 1E6EA 1ZMRA 1EBBA 3ACCA 5ALQA 1P9OA 2WU1A 4F5YA 3D0KA 3ROTA 3GT4A 5KNDH 3EPRA 4Z1MD 4YJFA 1X7HA 4IJ5A 2H07A 3Q15C 3DE1X 5U1PA 4P0QB 2O8BB 1NATA 2J6IA 3UUFA 3E22A 4PSDA 5D5QA 4CV3A 1BKDR 3AP1A 3Q8WA 5F77A 1OWPA 2HIMA 4FYXA 4M1QA 1W0JD 3MOSA 4IDGA 4UXHA 1RQ2A 3QITA 5JC8A 4YRQA 3CV3A 2AYYA 2RHCA 2C4VA 2WMOB 3LGAA 3OC6A 1CUBA 4XM0A 4CHTA 4G41A 1Q0PA 3OCZA 1YR8A 3NM4A 5EJAA 5AKYA 1RFGE 4KQEA 4OB6A 2V7WA 4HX2A 4DNXA 4EP1A 4AZVA 2VP5A 1SHUX 5EINA 3DVLA 3OFKA 1TPZA 2WPNA 5KNCD 4FFPA 2QP3A 2QN1A 2H2AA 5AKJA 3VPGA 2CL0X 2CJWB 3QVKA 4XX1A 3AUUA 3UVEA 2PR2A 5AUNB 1BX3A 5BN4B 1V8OA 1I2MA 3KAPA 3OZTA 5HQ3B 4ZREA 3ZV7A 2Q1SA 4NFHA 3TD9A 3T1HB 1JJIA 1KA9H 3KCQA 4EVQA 5CCBA 3EXG2 3D6NB 4FOPA 2C94A 4NNPA 5F1KA 3M6VA 2NUTA 3I9NA 2E49A 4G8DA 3L1VA 3AF6A 4I50B 3RDPA 2JJ2A 2XMGA 4L6AA 4DMKA 5FUBA 5A9SB 3C8ZA 3WIVA 3QFHA 4FWTA 5HQTA 3JWGA 3CIOA 3E7WA 5AVYA 3C6MA 4OI0A 1DNPA 1QYWA 5B1HA 1VP3A 2W90A 3U4HA 5FPHA 4DCSA 4URHA 3BJIC 3RIMA 5B53A 1EGMB 3HDYA 3AVPA 3QNWA 4O4IF 1GARA 2COEA 2F2TA 1W46A 1GUAA 4AJ4A 1QYXA 2O5CA 4WHMA 4BV3A 3ZIDA 2PMWB 4MINA 3GPIA 1CYDA 2Y77A 4I36A 2OBMA 4F9EA 2AFIA 4G0ZA 4GLLA 4UNSA 4OLBA 1YE3A 3I39X 5I8ZA 1GPYA 4CT0A 2PGLA 1SUDA 1OXXK 3LQYA 1WXXA 2P9JA 4NE7A 3X2FA 3K3PA 2EVWX 4CN8A 4OXNA 2WP0A 4WOBA 4IAOA 5DOVA 2NXNA 5F23A 4WN3A 1CB7A 1QJ4A 2AOTA 4R8LA 2A86A 1CQJB 3AFHA 1UFRA 4MWDA 1U2DC 2C8KA 3UA4A 4C0SA 4GUAA 2VA8A 1GV0A 1F0KA 5CFPA 1TW2A 1ZNXA 2L2QA 1LFAA 4XSGA 3GJRA 4DM3A 3J7AC 5ANRB 4ZTUB 1BAPA 4BLWA 1ZR4A 3IEVA 2GN9A 1RI4A 1E8DA 4QXOA 3QU5A 5C8YA 5G1PA 3RVDA 2CT8A 3RD5A 4MJXA 4E1VA 3GRZA 1XAIA 3ROQA 4LI0A 4TYYA 1L5FA 3WKCA 3B20A 1NX6A 4GVLA 3KKLA 1L6RA 1ZWKA 4WUVA 3CUYA 4IS3A 5KYYB 1Y6GA 1Q15A 1TA4A 1A76A 4US0R 2BMJA 1N7JA 1GO2A 3BCSA 5L3QA 4FI3C 2PJRA 1AUXA 3V7YA 3U7FB 3DHVA 4HSEA 3QNUA 3HA7A 1V8FA 2RC6A 1A7JA 4W6QA 4C22A 3DZ4B 4BUCA 1NJSA 2PSDA 2PEYA 4TKVA 1NVWQ 3IXMA 3EW9A 1SBNE 2QUIA 2BONA 3G1UA 3G9UA 4CKCA 2SECE 5G4KB 1CUWA 1JHXA 4PGFA 3ZV5A 4J90A 2E87A 3VNQA 1QONA 5G0TA 4QO8A 4BJ6A 4DMGA 3GGGA 1L4LA 2NN3C 2V5AA 2YWHA 4I9FA 3RSSA 4JROA 3TLGB 2A1UB 2H2WA 3NTOA 4PPNA 1WABA 3AK4A 5COAA 4QWMA 5BN1A 4LSWA 3L8GA 4AG5A 3M5DA 4JXXA 2ACVA 2IU6A 5FYQA 5EJGA 1ZKMA 3NTXA 1T2FA 2EFCB 5I7AA 3AUXA 3W8EA 4V0QA 3A1SA 4CXMA 5JJKA 4NDAA 3AFNA 3HHEA 4B2PA 4JKYA 2B1QA 1RXSA 2PNFA 1NW8A 4HJXA 3OPYB 3CLTD 5HILA 5B37A 2PQ2A 4KWEA 3IAXA 1ENYA 4NNJA 3WLQA 4J0IA 1ZCBA 4OU5A 4U7JA 1JSLA 4YBRA 5DOZA 5IBQA 5JSHA 1L0BA 1WW3A 3G2HA 4YCNA 5HJ2A 5JSKA 1HT3A 5CFQA 3HADA 3EWSA 3INYA 3HL4A 3PKZA 4LZLA 4TL8A 2BKAA 1P18A 1LBHA 1NJ8A 2B2NA 5EXSA 1M76A 4BJHB 1JR6A 2B4YA 4UW9A 4XR4A 2RONA 1ML4A 5REQB 3FVWA 5TARA 1MLDA 3RB8A 1NC1A 2VPXA 4MUXA 4QUIA 2VPPA 3PFIA 2FWPA 2YBDA 3NJ4A 5IK2D 5DGCA 3P8ZA 2YWEA 4K6OA 2GKOA 4NBLA 5IANA 4YJHB 4K28A 3IP7A 1NI4A 2Q3BA 2YDYA 3JYNA 2CV2A 3E1KA 3KL2A 1U8EA 2VSFA 4RZSA 5DB4A 1H2FA 3VI4B 1A8PA 1W49A 2O0JA 1I5RA 3W8DA 2BV3A 3M6FA 2IH2A 3H2ZA 4GWKA 4BBPA 2BWJA 3N8KA 3OIVA 4II3A 1A9SA 3MG9A 4UHHA 5F1OA 1OZFA 1WDLA 2ZWOA 3U9SA 4AQDA 4GP6A 1RHRA 2FUCA 3BD7A 4GSKA 4MW6A 4RD4A 1UBLS 1K27A 3PGXA 4IWYA 4Q3EA 4NNOA 2ZQZA 3DQQA 1COZA 3F97A 3U7IA 1NXPA 1PJSA 4P3KA 4YXWD 4UD6A 2FPRA 4FYVA 2H1SA 4H3KB 5F2EA 1KDPA 2VF8A 1T8UA 2H52A 2HRQA 2I2BA 1NPYA 2DTEA 3NIGB 4LXUA 1U8YA 4V3BA 4X1OA 2I66A 5FLYA 1XB2A 5KOYA 3LFUA 3UOGA 4JLMA 1EAMA 3FW1A 4IX1A 1FTWA 4X84A 5DBHX 3X2SA 4H6WA 1MC4A 2XADA 2X7JA 3AFGA 3JQ8A 3K8ZA 2ZUDA 2BTOA 5HF5A 1QP8A 3VOSA 1N2SA 1JIIA 3JD4A 2V4UA 2ZJOA 3WRVA 1E2LA 1RRPA 2GBLA 4M54A 1VHDA 2LZ0A 3IQWA 3PBKA 3O75A 1DPGA 5LUAA 2FFAA 4KV9A 5C8VA 4X3PA 1MF7A 3N87A 3SSMA 2JHCA 5T73A 2QJTA 4YTEA 4DDMA 3UHAA 1JR4A 5FPTA 2D1RA 3A4YA 5KTTA 1UKBA 2BFMA 1V5WA 3OJFA 3UHFA 2Q99A 5K1ZA 5CPFA 3WWPA 9ATCA 4QUHA 2G1UA 3BQNB 4XVCA 2Y1WA 3A37A 3KOUA 3A7DA 2C7RA 4LECA 4TTVA 1YZLA 4I4TA 3U9TA 1YNSA 2XUKA 4I8DA 4KVZA 3FH0A 5JJBA 1P3DA 1WOMA 4YALA 5L6MB 1FLAA 2HPZA 2YZNA 5J2UB 3LY9A 4UNNA 4B3GA 1EDBA 4P3OA 3FVVA 5I5GA 2YVAA 1RXVA 1HRDA 1XD2A 1KNXA 3RS8A 2I3AA 2OLKA 2BC9A 4REOA 4WESA 1Q1NA 5KVQA 3EUEA 2QD4A 4R69A 1UMDB 2A9JA 1AURA 1S2GA 5K03A 1GZHB 3NH6A 3X1MA 4EUSA 4CKEA 5C1PA 2OM6A 3R5FA 2PUVA 1DG9A 3RQSA 1REQA 1HDIA 1DEKA 1HQDA 2R1VB 2XWSA 4J0DA 4P0TA 4X92A 2D0DA 5FHRA 4FFMA 3G2NA 2K87A 3FJYA 1FDOA 4HN9A 4ZVSA 3ZXXA 1SZCA 2O05A 1QYIA 3QQ5A 2XT9A 3TYXA 4HC4A 2QW1A 4GO1A 3A4MA 3R4VA 3LX5A 4NYJQ 4AROA 5LNK6 2AC2A 3I0ZA 2MSEB 1ZOPA 3PC4A 1L5MA 3FKSA 5LBUA 2VDUE 4JHXA 1XK7A 2ADOA 4Z4IA 3KE9A 1Y9EA 3IILA 2GCNA 2GVNA 2HWXA 2PZGA 2VL7A 3JAMA 1NYQA 1XI2A 5KYKA 2B83A 1QFJA 4XGNA 3IUQA 3MSCA 1Q3TA 2YS6A 3B13B 1LSUA 3E5HA 3QENA 2B3TA 4UATA 2VJNA 2Z58A 3HBMA 4P7GA 4X61A 4YRGA 3E7FA 3F78A 1JQLB 1P4AA 3DZKA 1FRZA 4HGQA 4CMEC 3RT7A 2TMYA 2JLRA 3DFKA 2GM5A 2JAXA 4G85A 4IFIA 1XD8A 2HUNA 4QBGB 4UMVA 4MNTA 3UV6A 4BKQA 2B1GA 2PM8A 2WG0A 4WERA 2X86A 4B40A 5D5PA 4NY1A 1FFYA 2A0FA 1OIVA 4ARZA 3AL0C 1GXSB 3UB4A 3VKVA 3NHFA 2NUPA 1YQUA 2O0LA 4FOSA 4ECAA 1U8ZA 2HA3A 3IAM6 1W94A 2Q5HA 5I7WA 3N0RA 3FBTA 4P4TA 4H16A 1CWUA 3IBGA 821PA 1IHXA 1Z0KA 1JQAA 5IDWA 3RC3A 1CRLA 5M7EA 4TWIA 4JP8A 2A9KA 1E0SA 1W19A 3B1VA 3N7AA 1YQWA 4W8OA 4XA8A 5E9QA 1F8YA 3CWZA 3OJEA 5ER6A 4FYJA 3HSSA 1YK0A 5L51A 2C4WA 5B6PA 3OEHA 4QYTA 3GOHA 5T6BA 1J7KA 1LPNA 2LVBA 1B0AA 2XUFA 1CRQA 1P7YA 1WMBA 1MBZA 1EINA 2OCIA 3SYMA 1TTPB 2B36A 3HUUA 4U0KA 3SD7A 1V45E 4UQPA 1QQBA 1YL7A 5K5EA 5DM0A 5J3JA 3MVEA 2QYHA 3TOZA 4CCWA 2G0AA 1TRHA 2J87A 1EWTA 1HQKA 3B3QA 5CDYA 2FSIA 2R8XA 2WTBA 3B6EA 3C15C 4OXQA 4XUCA 3BD8A 1XJWA 3H2IA 5AHWA 2GEUA 5JYBA 4HUTA 2XA9A 4AMZA 1KAHA 2JIQA 2ZB8A 3GFRA 3TOCA 6REQB 4QDKA 1RHJA 2R6JA 3IHKA 1C2TA 1S2IA 5GQSA 2NOAA 2HGSA 3KOXA 2W2PA 5FNVF 3TW6A 4LNAA 4UHFA 2D7JA 2W83A 3ABSB 1CUVA 4D9BA 1XIVA 2IK8A 3EMDA 3E48A 4EF6A 3OX3A 3DEYX 4XJVA 4B3MB 5CURA 1DIBA 2VDVE 2IA5A 3QX3A 4A91A 2VJLA 1QIKA 4RF5A 3ZE2B 3SYNA 1QGZA 2MR6A 4GDFA 1ORRA 2XE4A 5ICFA 3KSRA 1A77A 1FB5A 4IIJA 3CXUA 1D09A 4WOCA 3USCS 1IPFA 2DT5A 3T7IA 4O4LA 1UPBA 2WFZA 1QO0D 1VRCA 2VRWA 4A03A 4AMBA 1T5BA 2ENUA 3D6HA 3HU2A 1O97C 1XPUA 2VRBA 4ISCA 3PEWA 1RWVA 2VJAA 4A4DA 3ZWWA 1YA8A 3JQBA 3ZS9A 4I08A 4RUKA 3JS5A 5KJCA 2XVZA 3RG8A 1CUYA 2GAJA 3KQOA 3KXIA 4PIPA 3RANA 4MP6A 3VO2A 5KWVA 1VFPA 4L22A 2ERCA 3U37A 3VBCA 4F6CA 5KYYA 3G8BA 4Y9UA 5JRJA 1B4DA 4X1KB 1GRRA 4P38A 3NIWA 4ARCA 4C07A 2HWKA 3KHKA 2Q22A 1EFCA 3NKVA 2J9FB 1KZYC 4OGKA 3AR7A 3NRCA 3EZFA 3UIEA 1SD5A 2E3JA 2Y0EA 5FR1A 4BUZA 3RC9A 1VKNA 1H05A 5KINB 3IL2A 1SVSA 5JS2A 4CLOA 5ECDA 2QLFA 2G36A 4FYPA 1GLVA 2XJ9A 4ZANA 3WGMA 1J6UA 1G3UA 3OCCA 4FHZA 2UUBB 4PLPA 1XV5A 3Q7SA 5HCIA 1M6EX 1VXOA 4NU8X 4UREA 5JEEA 2MYTA 1HK7A 3KYDA 2ZI6A 3OLQA 2ZR9A 1HFEL 2CFOA 2J4DA 5JH7B 1TYEB 1KJYA 3FPGA 3PJEA 1IOLA 2FPWA 3ELUA 3M4JA 3L1JA 1CX9B 1P74A 2C58A 1KI1A 3A36A 4RIGA 3AY7A 4X90A 3BCUA 1TZBA 2RHJA 1B23P 2RJOA 3C45A 1FP4B 3OIUA 1Q17A 3NXSA 1TM3E 3OCXA 2BGRA 4N3BA 3ZHBA 2CMFA 2NVBA 2GYWA 5JAZA 4TOIA 3AI3A 4MGZR 3SIXA 5ICEA 1ODIA 2POQX 3OQ6A 5FA6A 5FPPA 3B2EA 4P83A 3B51X 1G2OA 4HNTA 3TSZA 1TD1A 2GZRA 2JAOA 4CYMA 2VDWA 4C0LA 1GZ5A 1HH4A 4MQMA 4B47A 4PG5A 3RC7A 3BK7A 3PWTA 4LWQA 2XWQA 4LF9B 1G0NA 4HXFB 5IPFA 1E60A 1T1RA 2QJWA 4CM8B 2GZSA 3I76A 1KZGB 1D2RA 3NFRA 5EFZA 5JMPA 4ZVMA 1TQ2A 2QTZA 3IA7A 4L4ZA 4C6HA 4TKLA 3ERCA 2JI4A 3JAKB 4PG7A 2I6SA 1NLYA 2X8JB 4KX3A 3RTGA 2VWPA 3TECE 3NM6B 4TSRA 1ZX1A 3VR4H 2CNKA 2FW9A 4MHTA 2JFFA 2G6BA 4FW9A 4YCCA 2ACEA 3ETDA 1E1QA 5CA1A 1MNAA 2H59A 1XTBA 3LUDA 3QWHA 1ES9A 3S99A 4U8GA 5I9SA 4OHRA 5AVSA 1W85B 1XTVA 2BEUB 1BGWA 1EWYA 2X0EA 3V6LA 1EVYA 1O6CA 3HCRA 4I81A 1D2GA 1OX4A 2GJAA 3TVTA 2WNIA 1LV8A 1R4MB 2A14A 1XEXB 2QR2A 1XTPA 2VHEA 4NYIQ 3QWBA 4R98A 1I9GA 5E4TA 1BE8A 1U63A 5BPFA 2FSFA 4BP1A 1B0ZA 2A57A 3CSUA 3M5WA 3OC0A 4KQIA 5K6TA 4PLCA 3D3WB 1TFRA 5J5CA 2GPBA 4G5GA 1BE6A 3LFHA 4LOJA 1V11B 4RHTA 4Y2UA 2G7ZA 1TCUA 4WLEA 3VHXA 2YWFA 2IYRA 3QKUA 3DHNA 1FYVA 1U1FA 4H3SA 3ZCRA 5KTSA 3U1BA 5I47A 1LBTA 2HREA 2C82A 4IUDS 1UT5A 3FMIA 4QJ3A 2YNMA 1RM3A 5JD3A 1FUYB 3K0AA 3ZE0B 5KSYA 3OT4A 4C5BA 3LPAA 1MXFA 2V7TA 5GONB 3MIIA 5C9ZA 4EG6A 1HYBA 3NOVA 2Q2NA 4GKAA 2B8NA 5KYTA 4R2KA 3FFBA 2HJ9A 1QCYA 3CZCA 4ENQA 2EKBA 2Y05A 4P3XA 2BGJA 4Y1GA 2JIZA 4ZI7B 1PQPA 4JA0A 2ZAIA 3LLCA 3OAAA 5K3DA 3QKTA 1UBNA 2Q3CA 2C5LA 3QLUC 4IBOA 4L9SA 1A5ZA 3TIVA 2XCOA 1K7CA 1IHOA 2HTEA 1HTTA 2EWMA 1XZBA 2P9ZA 2LNDA 2V4MA 2OESA 2FWJA 2WEKA 3AU9A 3P0IA 4PYRA 4Q5IA 5C32A 2IODA 2WPDD 3RAGA 2X0NA 2P27A 2ZIXB 3F5FA 4RD1A 5EMMA 1HT0A 3E9RA 4DXAA 1ZK1A 3U62A 2ATIA 2E85A 2XODA 2AW3A 2J6BA 3LVQE 1HDZA 2P90A 4RVUA 4TL6A 1SHLA 3UV3A 1QGYA 4LCEA 5EESA 1EJ2A 4KVAA 4AJKA 4UAVA 5IBRA 4DE5A 3FOEC 3MRTA 3EFBA 4L1KA 1C7FA 1X19A 4XIGS 4EQ6B 1NASA 4H18A 5BYAA 3PEYA 5K8LA 3F67A 1T3HA 3QG1A 5F3DA 3G17A 1Q0RA 1QYVA 3C7TA 3H86A 1OROA 2FEMA 2FPIB 3A1TA 4J7AA 1GEEA 1W52X 4S1WA 4XDYA 2FOXA 1WMSA 2LBPA 2YHBA 1ST2A 1GTRA 2FNAA 4I50F 3GBPA 5JO0A 2ZIWB 1I79B 3ESZA 4F4HA 1TXGA 2Y4NA 1GR0A 5DBGA 3I01M 1NT4A 3THWB 1FRVA 4BXOA 1F2TB 4EMUA 1XPOA 4HADA 3RS3A 4JU8A 1PT9A 3LGXA 5AR1A 3C3EA 3GUVA 1CUEA 3Q1LA 2BZ1A 1QE3A 3BULA 3O2JA 4TMVA 3VV3A 2L17A 4F4UA 2C78A 1BFDA 4UMEA 2ONYA 4HFRA 4AJNA 1X1RA 3KP1A 1G20B 2AHRA 3AEQA 2O3RA 4WT7A 2QRKA 5DIZA 3NM5A 1G291 1UDRA 4KZKA 1HYGA 2A9RA 2G1KA 3C3WA 3E9EA 4WFJA 2Q5FA 1ACJA 1T4MA 2I34A 1ABEA 3HZHA 4GM4A 4AJEA 2HSEA 4JENA 2BCJQ 4EF4A 1KYVA 5EIFA 2QD3A 1VE6A 1KBOA 3BWDD 4IKOA 3GJ8A 4GM0A 4P36A 4GFDA 4DV0B 2QRQA 3SIRA 4DR5B 5JIBA 2KBFA 2H92A 4OAPA 2G4CA 3I9JA 1PQ4A 1W0KA 3ENQA 3UNXA 2AJ8A 1ZJ4A 3FCXA 3U0VA 1NLMA 1GNSA 1F7VA 3EQ9A 3NHKA 2OK8A 3AOEA 3KBBA 1CYEA 3QHPA 2ZRFA 1MB0A 4I3GA 1AZSC 3VQTA 4F38A 4RTLA 2NQTA 2A30A 3KEQA 5B7NA 5ELXA 1XJCA 4OBWA 3WP0A 3VHQA 5C7OO 3QYAA 3RYHA 1BROA 1QBKC 3E7DA 3ND8A 4QOHA 3KV1A 5HPYB 4FOOA 3HB0A 3OQ1A 3UWDA 1UQUA 2WFAA 3LUGA 3TI7A 2YYZA 2GPSA 5DVZA 1M5RA 4GOKA 4S1TA 3FB4A 4EKEA 4EPVA 4JCCA 5LDHA 5KNLA 2I1VB 1WXGA 4V1CA 5IF3A 4DVGA 1NF9A 4UVHA 4RJKA 2Z9CA 3G88A 3BM5A 2WICA 1O5IA 1KFKB 2B4QA 4Y2TA 3S2IA 4BZZA 2VXCA 3ZD9A 4DIOA 5B5SA 5JNSA 1V8ZA 2C3PA 2Q5IA 4XEUA 4F8EA 1RNLA 5JNUA 5EPUA 3FYUA 4IV0A 3LM8A 3VR1A 2JH9A 2RAUA 5T4FA 3Q8MA 4LMBA 4XCXA 4Z4QA 1WZEA 1P61B 1E1YA 2A5YB 5EVCA 2NZYA 1M8KA 2JK0A 3UYKA 1JILA 1H6CA 4YWJA 4QOEA 1WOYA 3GWGA 4FGKA 1L1FA 1C7QA 4ASUA 4MAFA 3BE6A 4I1OA 4OKSA 4G36A 5CM8B 2MT9A 4AX4A 1VLZA 3WIDA 1X15A 1P5HA 4NIMA 4JSYA 2I9PA 2QXTA 3CB4A 1GUYA 3ETNA 5KTMA 4TUYA 1KEVA 1GTSA 4M9CA 2ZFUA 2QROA 3U26A 2VYNA 2OQIA 4F3NA 1P0FA 2WVJA 2LCIA 4I1UA 4WXEA 5DSZA 4EW1A 2OBLA 3UUEA 3PUZA 1OH6A 2EG9A 1FL9A 1POWA 2R9VA 2YFHA 3H83A 1TJYA 5IVIA 3RASA 2XNSA 4CLQA 2JB9A 3SEZA 4C29A 3CUSA 1U3UA 2CC2A 2PV0A 3WGYA 3BSFA 1J07A 1RJWA 3MWLA 5B1DA 4TQ9A 3H1AA 1XKQA 4Q7LA 6Q21A 4WCFA 4QYSA 4JVNA 3NHJA 4RTJA 1KOJA 5G41A 4Q3DA 4X8MA 4UHKA 5FBZA 3RBAA 5DHFA 1B8UA 1D7OA 2QIPA 2O2YA 4X94A 2F9MA 2CHUA 3DE7X 1V41E 2YRFA 3EB9A 4IJWA 4BNKA 5JALA 2VDOB 4QUAA 4DW8A 1F48A 4H9GA 3IKVA 2MSLA 1F6DA 2N75A 4L2IA 1KBZA 4R2IA 1Y4AE 5JS7A 1RXCA 4U7WA 1FJXA 1D2MA 3GCGA 4AZWA 1Z5WA 4YMIA 3NBFA 1E0KA 1OI2A 3IR7A 4J0HA 2IPOA 2DHQA 2AZ4A 3EQZA 2AE2A 4XTCS 3FCSB 4PG4A 3G79A 1XWWA 3TN7A 5K0NA 3VUFA 3ZWNA 3IO3A 4NJMB 4CDRA 3PYXA 1ISPA 1U0LA 2ZUBA 1B6RA 1XP8A 5DO9A 2FXIA 2IY9A 3GCZA 3LPDA 4BMNA 3WWZA 4RH3A 1SNYA 2NV6A 3OA2A 3FHOA 3ZNPA 4MWGA 2GWRA 5IJ0B 2RH5A 5DEOA 1K3TA 1CU1A 3RSZA 3F6BX 1NRIA 4ZHSA 2Y0CA 1JAXA 2ETVA 4L73A 3THYA 2O7QA 4WZAA 1JYSA 2GDZA 2I2DA 3N05A 2ICAA 5EKDA 3TQCA 5KNDA 1N0HA 4FCWA 5DTQA 3ZJXA 1GPAA 4JGBA 3DOOA 3SEAA 1P1HA 1IY8A 2YW2A 4DA7A 3EUWA 1GZ6A 1T0JB 2W4IA 2XOXA 3D5EA 2ET6A 3KZOA 3JD2A 1C9NA 1FVFA 2PQ6A 1T5DX 1HFJA 3PHIA 4YRMA 4L16A 4EZBA 1ZM2A 3WGOA 1J2YA 3AHCA 1KO7A 5FBKA 3M81A 1GPUA 3AF3A 2XT6A 4J7UA 4N5NA 3ZK7A 3H97A 1JTVA 4HJRA 3M7IA 2QXUA 2X0JA 2MSDB 1Z2CA 3N75A 1KORA 3GLIA 5BNZA 1O0CA 4MUGA 1QZZA 2GEKA 2ZRIA 1NVDA 3HUTA 4E33A 2PANA 1ZIYA 2AL7A 1XALA 2F8SA 3KEFA 3K0CA 2YC2C 2HIAA 1E2IA 3QFRA 3LLMA 3AFMA 4ARBA 1BXRA 4DUGA 2I4RA 1U8FO 2F3TA 2FSUA 1KEZA 3LW7A 4CLRB 4EAQA 3L18A 1I2AA 4JYPA 1SKYB 2H7CA 1BJKA 3BXPA 3HWSA 3UMFA 4UTVA 3UWOA 1YQEA 4BB0A 1YZGA 5A06A 5I3ZA 2O8FB 3ELBA 1S3GA 1QS0A 3F8TA 1X1BA 3KR9A 1P5RA 4OY3A 1TAQA 2ZSEA 3BMOB 5AO9A 1ODCA 1Z6QA 4WNIA 4JUDX 4RS4A 1QHXA 3JVDA 2W7TA 4IFEA 1N1DA 5J2UF 4PHFA 4AQYB 1ZM9A 2DU8A 4TVOA 1FP2A 1GCIA 3LD9A 4QLAA 5HF6A 2WJPA 1I3KA 2UV8A 5KZMB 1IN8A 5T3YA 2B78A 5JISA 1JWAB 2JGLA 2QR5A 2EW1A 4KKXB 4L5IA 4NE9A 3LQQA 4DRYA 2W93A 3TZKA 1NHGA 3AERA 4H08A 1ZJ6A 3FCYA 2MSWA 1J2JA 2DFLA 3PK0A 2HU2A 2HMAA 5ALVA 4RVDA 1HTWA 4Q16A 4LMPA 2KQUA 4DTIA 4R2LA 4GXRA 1KBQA 2B2CA 3MWDB 4RGQA 4EJ2A 1BU5A 4ALIA 1V16A 4EVSA 4WZZA 1D8TA 3TQFA 5F7ZA 1U2SA 1MW9X 3TZQA 1PGOA 3JQ9C 3TLZA 5M6DA 1Z17A 3LQRA 2EZ9A 3AKEA 5H5JA 2P3QA 2FSHA 4HAUA 3W5DA 3QRWA 1Q92A 1V4VA 3F3YA 1Z07A 4LGMA 5BNFA 4P5DA 3G82C 3P2OA 3DOIA 1M67A 5KX5A 2JI6A 3K8YA 1JNYA 5GWXA 4F5EA 1CS4C 1K6JA 1UIMA 1KQ3A 1AKUA 1RRKA 3G7SA 4FGJA 3AIKA 3KSMA 4IGIA 4G4SP 5H4HA 3CIFA 5IJWA 2NZWA 3FUCA 2I2CA 3VX4A 3QXHA 2QT9A 3FNBA 4DF3A 3BF8A 4YLEA 4ML3A 2ZS8A 3Q0TA 2EW2A 4RELA 1JA1A 4DLXA 1Y4UA 5TGDA 1XOIA 1P2UA 2CFSA 1N5RA 3I2KA 2FEWB 1EFHA 1IATA 3VZPA 1ZMXA 1AGPA 4NF2A 3GDWA 3B6MA 2R00C 1GYPA 4N7RA 1EVIA 1MABB 2XTMA 3KRTA 4ND2A 1MDFA 2BFBB 1NV8A 4DCMA 3S55A 2H1VA 2Z3WA 3GA5A 3GOQA 2R1TA 1OXKB 3V2IA 4BASA 1OMOA 2GT1A 3EGDB 3PT5A 1Y9DA 3GY0A 3VM6A 5KMGB 2OECA 2AMFA 2WU8A 2QHXA 1E1NA 3LUBA 5FOXA 1ZESA 3REQA 4R4JA 1E8NA 2QLTA 4IVNA 1SELA 1UM9B 3U13A 9GPBA 1LLDA 1NMYA 2LIPA 1NNEA 3TTXA 4J3NA 1SKYE 1U2TA 2J8ZA 3KKKA 2NTJA 3OT5A 2NVWA 2JIPA 4ZAYA 3T54A 4EAAA 1CJSA 1RPZA 1OXVA 2NXCA 2V9PA 2Y1FA 5DH9A 5IN5A 4OF4A 4OHMA 4QNMA 4QYIB 2GHIA 2WAYA 1U2DA 3BICA 3LQ1A 1TM2A 4FLMA 4G26A 4EH1A 4PC3A 4WW0A 2BFDA 1RHMA 1STOA 5EWLA 1EHYA 4OK3A 3LF2A 3D8SA 4YUYA 2YCBA 3EQ6A 2AD1A 4ER7A 4KRXA 5JJLA 3D8BA 3L7AA 4W7HA 4A0QA 1UDAA 1DDIA 3DW3X 4Y2PA 1D7AA 5JDIC 1XCPA 2N47A 3A1DA 3A0UA 1JDBB 4WK6A 2ZRPA 3WLAA 2VH2A 4OJTA 4FFBA 1K06A 1J23A 3FHCB 1O94D 1Z9BA 5AKZA 5GZ1A 3FD8A 1EX7A 2OCGA 1BCRB 2NYVA 2FPOA 1P1RA 1ZKDA 2XMSA 5A71A 1JI0A 5JEDA 5G3YA 2C9DA 3WNZA 2YMPA 4O3FA 5AM0A 5TVGA 1PKXA 3EXEB 2FMTA 4J07A 3NU1A 3AGPA 4IGFA 2FDCA 3C0KA 3WAGA 1CP2A 3MYYA 3NHMA 3A31A 1H4QA 3TKAA 1XKLA 4RMNA 1F5SA 1WCWA 1I7PA 1NLUA 1NVVQ 3KWJA 2EFGA 4POAA 1IBRA 4QO7A 5L45A 5GVSA 5M04A 1IOVA 3UICA 4TV9B 2YHIA 5HZKA 2DFVA 2VSOA 3OPNA 2HQRA 5L95A 1TYZA 3GB9A 1S96A 2P6MA 1LFDB 2ZU6A 4L02A 2QTNA 2P2SA 1QZUA 4C4PA 4QHTA 1K8XB 1VBKA 1Y42X 2CZQA 1TUBB 3PIIA 4RK7A 1M2HA 5IVDA 4ALKA 3BXXA 4F5DA 1RPAA 3MWJA 4REMA 4OJKA 2WFLB 1YH3A 3DOEA 3OLYA 5SY6A 2XQIA 4G1UC 3VO8A 4R3WA 5J4HA 4D26A 3A2KA 5DM60 1J1UA 5JH7F 4QA9A 1T0UA 3TNJA 2C8JA 4HQ0A 4MVJI 5AI4A 3AJEA 1BSVA 3R3VA 3QUBA 5FKJA 3F7OA 1Y1RA 1US8B 4IJKA 5CT8A 2QV7A 3KDSE 3T3PB 4BCBA 1MFPA 3EVTA 4BVJA 3MXOA 5F2KA 5IULC 3TV1A 3HUDA 4G5XA 2XGJA 5HGJA 3KLMX 1YB1A 2BHTA 3LK7A 4EKIA 1MQ8B 1Q0SA 2HQOA 2R66A 3JPWA 4EA6A 1EDZA 1OBHA 1C7IA 4P7KA 5LU9A 1UPTA 3W77A 1AGXA 1T2DA 1W4LA 3SKYA 2AZTA 3QHQA 2QU8A 3BGWA 3MW8A 4KGZA 4P0PB 1GPH1 2QL7A 3L0DA 1E6WA 2AZMA 3PEUA 4IL5A 1P5ZB 2PRZA 3NC0C 4K05A 2QB5A 4ZO6A 2WD7B 3WB1A 1G17A 2I78A 3IV6A 3CINA 2XX3A 4PR3A 2Y2VA 1PFUA 5FWDA 2AOVA 4RYDA 1C3LA 1M34E 4C5AA 4HQ6A 2J0SA 5JSQA 1JDZA 2PTHA 3GZNB 2Y1EA 3H75A 3IKLA 3L8DA 5DGHA 4AZ3B 4O29A 4ALJA 4EHKA 1FVXA 1T5LA 2B1IA 1A50B 2OR3A 3FVTA 3PEEA 1I4WA 2C8LA 2Q2WA 4AC9A 5A0TA 3MFQA 1N2OA 1OWOA 4TZ6A 2GPTA 1EFUA 2A9VA 2KBEA 1VPEA 3UEOA 3QZUA 1QIFA 2IYLD 3LA8A 3EFHA 3FPHA 4FIDA 4LVOA 3CX7A 4KRGA 3VYVA 3L41A 2VP3A 2VH5R 3Q6MA 5CG1A 3IUJA 2VPWA 3IJRA 2R85A 1V3TA 2JS7A 4TMZA 4QU9A 4QBFA 2XUJA 3MWEB 5F35A 1G66A 4IWNA 2FWIA 2Q1UA 4PC2A 3E9CA 4Q34A