4YWJA

Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
MRRIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNLCLKLLDTAARVLGDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALWLEGKENGLYDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
total genus 79
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ywjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ywjA01
1XCBA 2YUTA 3OJEA 5F1PA 2PZMA 5G0VA 3MCVA 4FBGA 4UVIA 2VRBA 2WD7A 2I3AA 3O8QA 2BRUA 1QLJA 2BMAA 4Y67A 3B20A 3U4DA 2HSDA 2Y99A 4J2HA 1SB9A 2WE7A 4U6QA 1EBFA 4MVJG 1TEHA 1WLYA 5TJHA 5L95A 1XG5A 3GEGA 4XWYA 4PCVA 5KJ1A 3DAFA 3MJ4A 5G4KB 4FS3A 1U8FO 1IOLA 3W8EA 4P4GA 3M2TA 4KTVE 4YAKA 4YVFA 4J1SA 5JBIA 1X7DA 3QHAA 4KQXA 2C0CA 7ADHA 3EY4A 1SEVA 4Z0PA 3PHLA 3NT2A 3G0OA 4DBVO 2P91A 2X9GA 3KEOA 4B4VA 2OHXA 4C7JA 2QX7A 3ONDA 1Z7BA 4FQ8A 4II2A 5ENVA 5ENDA 2HMTA 3MWEB 4CQMA 1ZUD1 2HRBA 5A5EA 3V2UA 1E6WA 2R00A 4Y6RA 2V65A 3RBVA 3LVFO 4IJKA 4PGFA 3PLNA 1VSUA 5JCJD 1DOHA 1ISJA 1BXZA 2D4AA 1MP0A 1YBAA 4PG8A 5AXAA 1I30A 4OOFA 4DLAA 3VPXA 1YO6A 3GNSA 3DBLB 4J7UA 1GQQA 1KEPA 4Q3EA 3K8ZA 3ZWWA 3M2PA 4HP8A 2J3KA 3H3JA 2NU7A 2ZJ1A 3D7LA 3GHYA 1ISGA 4RVFA 4UEKA 3PJFA 2C82A 3ZHZA 3VPFA 4U6SA 3AM3A 3BA1A 3FNGA 3OJ0A 3DONA 3I9MA 4Q3CA 3SBOA 4A7PA 1AE1A 1MV8A 4RPLA 4E0BA 1KVRA 2ET6A 3CH6A 4GX1A 1I36A 2CVOA 2I65A 4OOEA 1PS0A 3OECA 4XYMA 4J2OA 1R0KA 3COSA 2Q46A 2I99A 1BXGA 3FBGA 4AICA 2GZ2A 1UXHA 9LDTA 3ICPA 5DOVA 5C3MA 4W82A 4UVEA 3JD4A 3DTTA 2GUGA 3D3WB 4LRSB 1KERA 4FJ2A 5HM8A 3UW3A 3OICA 1DFIA 3O9ZA 4XJSA 3VH3A 3OEYA 1N9GA 1E3EA 3A4VA 4RVHA 3NTOA 4WLFA 3U9LA 3SJ7A 4IGFA 2PD3A 3WYEA 4C4OA 5C7OO 3WJ7A 2NVUB 4ALMA 2UYYA 3EZYA 3RCBA 3HZZA 3MWDB 2VHWA 4RVUA 3UOGA 4CR7A 1NNUA 3AFNA 4CMEC 2HLPA 2NTVA 1HDOA 3EW7A 5JY6A 4NJOA 1B26A 1K6JA 1WDKA 3OQBA 1F0YA 4D3FA 4ZVVA 4QO7A 4FFOA 4XQEA 2VZ0A 4PRKA 1KEUA 1CDOA 3LLVA 1PZGA 4ZD6A 4CMAA 4WUVA 1C14A 4FFRA 3D4NA 4HY3A 4BNVA 1B8UA 5T67A 4EI2A 4XYEA 5EPOA 2JHGA 2C54A 4GAEA 4YTEA 5FI3A 4B8WA 4O5OA 2GN4A 5I7SA 3KEQA 5TGDA 1ULSA 5U9CA 1P0FA 2VWGA 4A5OA 2YQ5A 4CV1A 1DPGA 3KYCA 2WWRA 3I4FA 4Z6KA 4B3HA 3PP8A 3JTMA 2CZCA 2I67A 3F1LA 1C1XA 4TSKA 3OIGA 5JDIC 3VH4A 4WOKA 2VWPA 4UUMA 5A4DA 1UXIA 4BO8A 2X0IA 1IHXA 5B12A 4CM7A 1ORRA 2VTDA 2DPGA 5T73A 4R1TA 1OC2A 1D1TA 2YV2A 3ZWXA 3ZNNA 4IIVA 4HX5A 1PGNA 1SO8A 3HN7A 3OEWA 3HFSA 4UREA 2NQTA 5L51A 2G82A 4EJMA 4ZGWA 4Z9XA 4FB5A 2ILTA 2HUNA 4DLLA 4NIMA 3AW9A 4MIOA 1DO8A 1KC3A 2G0TA 3ETGA 5JLAA 2HK7A 4ND5A 2YHIB 1Y8QB 3CXRA 4YJDA 2PGLA 3GAZA 2DBVO 4XKJA 5FF9A 3WIDA 4IM7A 4QT0A 3JQAB 4MPDA 1UZMA 4BMVA 2W90A 3PFWO 3GK3A 1ZK4A 1DC5A 2X1HA 1KVQA 2WYWA 5KVCA 2JCVA 3C7AA 2PR2A 5BSEA 1YS4A 4P22A 4YACA 4K9DA 4JJGA 1T26A 3L0DA 2DC1A 3WGOA 1PZFA 1AXGA 1NAIA 1WXDA 4CLOB 3PHIA 1IHYA 4QO8A 3FR7A 3NDJA 4PG5A 5IDXA 4Y6SA 1W8DA 3TZ6A 3KOUA 2WYUA 4MIEA 1JW9B 2P5YA 2A35A 4UVGA 4EEXA 1JTVA 2VOJA 5HWSA 3ROKA 5ILOA 3AY3A 3OFSA 3ZNPA 1EUCA 3DOCA 2O4UX 3DEYX 2AA3A 2AE2A 3WS7A 3D4OA 3A28A 3PQFA 3RVDA 1TT5B 3NGLA 4J1NA 4I5FA 3BZUA 1UZLA 1JU9A 1NQTA 1Y6JA 3FNFA 1I24A 4FFPA 3GMDA 2J3JA 3VKUA 3JCZA 4GVLA 1XWFA 1NQAO 3WYBA 2QRLA 1T1RA 3TWOA 4BNXA 1V8BA 3TPCA 4J9VA 5BNTA 4J91A 4NZ9A 1B15A 3JQ9A 4F46A 1F06A 4OH1A 4XJTA 4E2YA 3GQVA 5JCJA 4BNZA 2EIHA 3N74A 1ENYA 3H8VA 1F17A 4GPD1 1VJ1A 4A2CA 4YEDA 4KTTE 1GV1A 3GUYA 1VKNA 3I9OA 2X9VA 4C7KA 4MVJF 1GU7A 1GZ4A 4INAA 3IMFA 1UP7A 4I9NA 1MA0A 2DTDA 3L07A 1HXHA 2B83A 1M6WA 5LC1A 3DZGA 4NQZA 1U9JA 3HNPA 4GKBA 2CD9A 4TKMA 1E7MA 1ADCA 1T2FA 4E5NA 4XX0A 5IAAA 5JY1A 1HT0A 3LT0A 5A9TA 3BMOB 4ZA2A 3NAQA 1JA9A 3OJFA 4PFJA 3FR8A 4Q3NA 5G0SA 3M1LA 2FWMX 1XDWA 1G0OA 5L4LA 2V6GA 2AG8A 5JYFA 1BXGB 1XU7A 5C37A 3TL3A 1NQOA 4BKUA 1FXSA 1Y5RA 4X54A 3CEAA 1O89A 3W6UA 2PKRA 1V3VA 1Y5MA 1GUZA 1GV0A 1N9GB 1PJBA 2OBNA 1P9LA 1TT7A 1LC3A 2D1YA 1U4SA 1ZSVA 3LZ6A 4AJEA 3KSDO 1LLQA 2IEBA 5AYVA 2ZCVA 2GSDA 1I5RA 1SOWA 1FJHA 1CJCA 4BNWA 4E31A 4PLVA 2ZYGA 2DUUA 3PI7A 5A04A 1JQBA 1D4FA 3ASVA 3FCOA 4N5MA 4DQUA 2YFHA 3QWBA 4WJZA 1EK6A 1QLHA 3ZU5A 4ALNA 5ICSA 3V5NA 2YDYA 1PEDA 1T4DA 1AXEA 1NHWA 1A27A 3GNTA 4YWJA 3EC7A 2E48A 1YJQA 5IG2A 4YJGA 4WPGA 1FDVA 4CQLA 1IPFA 2WYVA 3GPDG 3RUDA 1C0PA 1ZXBA 1T2CA 1C0LA 1JDJA 5G0WA 2ZB3A 3D1LA 2ZB8A 1TXGA 3LSYA 2WDZA 3VTFA 1LI4A 1MFPA 2P68A 1J4AA 4JROA 4CL3A 2JAPA 1R16A 3FI9A 3RBXA 1ISHA 2Q1SA 5KVVA 2FPGA 2EKPA 2EWMA 4JGBA 5G4LA 3RU7A 3QW2A 3NRCA 3QIVA 3NTQA 3KSUA 3GZNA 4Y6PA 3SVTA 2H63A 3OP4A 5JCXA 2DFDA 4IIUA 3S2EA 2GD1O 1U3TA 4XCVA 3AWDA 2O3QA 5EL0A 2G5CA 3RFXA 4OSPA 1W73A 1XHLA 3GPIA 1HRDA 2Q2QA 3EVNA 4LSMA 3UUWA 1IZ0A 1M2WA 3W6ZA 5JE8A 1R66A 2CF5A 3MOGA 3RJ9A 4NFHA 3KVOA 1R4MB 1YDEA 1E1MA 3CE6A 2OGUA 4OXKA 4GMFA 3DDNA 4GSLA 3RFTA 1GAEO 3QWFA 4O59O 3U5TA 3B1KA 7MDHA 4RDIA 5BT9A 1NP3A 4WCDA 1PTJA 3QVSA 1NFFA 3Q6IA 4EBFA 1LJ8A 1HYHA 2BGMA 2V7PA 3RUHA 3JSAA 4NMHA 2NSDA 4I5DA 5CEJA 1RKXA 1GUYA 1I2BA 2HMWA 1U3UA 1OAAA 4ALJA 4WNIA 3WR5A 2BFAA 4YPOA 1EQUA 3IUPA 3H4VA 3HWRA 2FY8A 1ZEMA 2PFGA 3CSDA 5JO9A 2NNLD 4EW6A 4DLBA 4UUPA 1EVIA 3NYWA 1I3NA 3I4CA 4ZU3A 4AJOA 4YT8A 1YQGA 1QYCA 1ZXLA 4JN6B 3GDGA 1YL5A 1QYDA 1ISIA 1EUZA 3WNVA 2BGKA 2GRAA 4GI2A 2P9GA 3TNLA 1WW8A 4RDHA 1WP4A 3F4BA 4YRAA 4XYLA 2ZTLA 2PNFA 3GVIA 4J4BA 1VE9A 1DSSG 1B0AA 4J1QA 4FGSA 4XD2A 4XZ3A 4Z0TA 1PL6A 2PGDA 4CM4A 4FJ0A 2Q49A 1ENPA 1DJNA 1GZ3A 3U0BA 1GL3A 5TLSA 4CM3A 4LK3A 1HWYA 2EJVA 1VLLA 1P1FA 3RUFA 1I0ZA 4EJ0A 2E37A 5KJFA 4TQGA 3K73O 3TFQA 5J9GA 4WLEA 5T6BA 3TN7A 1D1SA 3H6KA 3UHAA 1DC4A 3V1YA 1S7CA 1MFZA 5CFZA 1HETA 2OXIA 3G17A 4KDEA 4YAJA 2QW8A 1EMDA 1KIFA 5JAQA 2E82A 1U28A 2FR8A 2RIRA 2AXQA 4JQCA 1GDHA 2I3GA 1PL8A 2P9CA 1LTHR 5ER9A 4BO4A 3KB6A 2FPPA 5DT9A 3ZWOA 2VTEA 2CNBA 4JLWA 4YDRA 1C0IA 3HFGA 4YR9A 3ASUA 2IODA 3I3OA 3WOHA 4E13A 4CMCA 4LVCA 1V3TA 4PZDA 4D79A 5I8ZA 1RM0A 3WQQA 3DMTA 2GYYA 3DHYA 1XYGA 4L74A 4H16A 1X0XA 3NT5A 4Q3AA 2O2SA 2Y1GA 2YW9A 3S2IA 4WNCA 1JKJA 1H6CA 2I76A 4J7XA 3UH1A 4R54A 4JCOA 2J3IA 1D7OA 4BO6A 4R9SA 1YWGO 1MG5A 1MC5A 4TRJA 4XGKA 4Z3KA 4W7HA 4DYVA 2HMSA 3KYBA 4KWIA 3GMSA 4F3YA 3ZWAA 1PJ3A 4QUKA 5JMWA 4FD3A 4GLOA 1O5IA 4CLXA 2EKLA 5CDSA 1K6IA 1ZVMA 2X4GA 1P1KA 3IC5A 2AQIA 3AI2A 4WLNA 5JDCC 1ZIDA 2Z1NA 1HDRA 4DWVA 2NACA 1RM5A 4R68A 5COQA 4A27A 1E3WA 3M6IA 4HWKA 1RYDA 4D42A 4ESOA 4R69A 3CTMA 2Y1DA 1DC6A 1H2BA 4I9UA 2NADA 3H9UA 1H6BA 3ENNA 4RZIA 4MKZA 2CFCA 1I8TA 5DOZA 4CLDA 5L45A 4ZRMA 1KETA 2B4RO 1HL3A 2EJWA 2QZ9A 3A06A 4XEHA 1HF3A 3ZU3A 4AJPA 1WDLA 2DTEA 4RF5A 4BO2A 4RZHA 4DREA 2YHUA 4DIOA 4YQZA 3QVTA 1UUFA 4OQYA 1W0CA 5ADHA 1SB8A 1U5CA 1NVGA 1KS9A 1LQTA 3RC7A 4OQZA 3VZSA 3SX2A 5CPFA 1EUDA 4HBGA 2QG4A 3CPSA 3QV1A 1PR3A 3KHUA 5JPIA 1XSEA 5L3ZA 2B4TO 4IMRA 1N1GA 3JYPA 4CQLB 4KOAA 4NBTA 5IZCC 3ORFA 1X7GA 5ES3A 4Z9YA 3WICA 2IE0A 4R1NA 2O50A 1GD1O 5EJ2A 2EF1A 4BO9A 1ZK1A 2XF8A 4II3A 4YB8A 5IF3A 4TZKA 4M89A 1IL0A 4UEJA 3C85A 1U1IA 3INRA 4UULA 3WLFA 3ANLA 3G1TA 3LT2A 2ZATA 4YRBA 3GN2A 4WGGA 3ENKA 3KBOA 3GZNB 3LF2A 2J8ZA 1YOVA 3H5RA 3S2FA 4U0JA 3I6IA 4IDGA 1WMAA 4BVAA 5I9MA 1A7AA 3EZLA 4W9NC 4FOSA 4LCJA 2NTNA 5B4UA 4NFYA 1BG6A 2Y66A 5I7VA 4DQXA 4MP6A 4PLGA 4R1UA 1EVZA 2EG9A 3WGQA 4RVSA 3K9QO 1N92A 1R12A 4DVJA 2RAFA 2E49A 3RC1A 1PWZA 2Y93A 1EVJA 1ZEJA 5EESA 4GH5A 1PL7A 4B3IA 1BW9B 1V6AA 2NU9A 4TROA 5L7WA 1K5HA 4E5MA 2JCYA 5GY7A 4F45A 4MP8A 1B8PA 5JNLA 1DB3A 4WECA 3WXBA 3OIDA 3VTZA 3DHNA 4XGNA 5AOVA 1DAOA 1NYTA 2QHXA 4QECA 2PH3A 3TOXA 1O6ZA 3DAPA 1R0SA 4BNHA 2B5VA 1R4NA 4I08A 4J49A 4PVDA 3WFIA 3ITDA 1C1DA 3E6AA 3AI3A 3IAHA 3N7UA 3HDQA 3GAFA 4LSWA 4BKRA 1I3LA 4U0KA 3VC7A 5TQVA 5A9RA 3AOGA 2NU8A 3GG9A 4HFRA 2FMUA 3ZHBA 4BNFA 5DF1A 5EQFA 4W7IA 5LCXA 5TRTA 4LGVA 1YB1A 4HXYA 3NT4A 4R16A 4Y8VA 1MXHA 1MXFA 3AFMA 2DBZA 2BFPA 3MJCA 1M66A 2RHRA 4TWRA 5DBIA 4EDFA 2E4AA 2FPIA 3PYLA 3U62A 2AW5A 4IJVA 5F1OA 1B2LA 5LDGA 4YT4A 1H2HA 3OA2A 2RHCA 1PJQA 1P1JA 2OO5A 2ZQZA 1YBMA 1HTBA 3WFJA 3C7CB 1VI2A 4O63O 3KV3O 4L75A 3ZWBA 4D41A 4BO7A 1LX6A 4OAQA 2PK3A 3E48A 2F00A 3DL2A 1ISMA 1YGYA 3FTNA 3DMYA 4CODB 1E3SA 4CUZA 4FFLA 2EKQA 3I83A 2Y1CA 4FDAA 2GLXA 3TF5A 3U4IA 4NBVA 1MLDA 5A1TA 3OM9A 5DCWA 4JJFA 2O3TA 3KTDA 4R5HA 3ABIA 3JQ7A 1KC1A 3K96A 4A26A 1DIAA 5KVSA 1BGVA 4HADA 1L1FA 4YRDA 4N18A 3ULKA 3JQEA 3OA0A 1GQYA 1LSOA 4N54A 1HYGA 5T57A 4AJIA 4CR6A 1E1LA 4W99A 1PGQA 1QRRA 2DKNA 1ZJYA 3FNHA 3MJTA 3W4IA 1EBUA 4K28A 3TDKA 4B4UA 4CM8A 1PJ2A 1GADO 5L9AA 3LDHA 3JQ8B 1DIRA 3RIHA 1VRWA 1DXYA 5T8KA 1SCUA 3R1IA 2W8ZA 2G1UA 3PJDA 3B1FA 4WASA 5F5NA 1ID1A 4R51A 3PHGA 1Q0QA 2O3UA 1EDOA 1VL6A 2UDPA 3TZKA 1YKFA 2C5AA 2AQKA 3BTSA 4MINA 2HMVA 2RCYA 1TVEA 4WKGA 1VM6A 3NDRA 3BTVA 3P2OA 3GHHA 4RO0A 3B1JA 1GCUA 2AQ8A 2X0RA 1SZJG 2W2LD 3JD2A 4PRLA 5CEEA 1JKFA 3F9IA 4WCFA 5A02A 2C2XA 2EGHA 2WM3A 2BH9A 2TMDA 1KYQA 1XA0A 3ZWNA 3H9EO 4J1TA 1G1AA 1K3TA 1MG0A 4Q9NA 4AJ1A 1XGKA 4DIBA 4PLCA 2D5CA 1N7HA 1X14A 2O3RA 1Q0HA 4I1IA 4CR8A 1PJTA 4TRRA 3WTBA 2V6MA 4BL5A 1EZ4A 4K1LA 2NUAA 3RQSA 3QVXA 2IZ0A 5MDHA 3ZH2A 3JD0A 4FOOA 4IBOA 4BNUA 3JQBA 4N7RA 4J3FA 1G6KA 3AJRA 5K0ZA 1VKOA 1TA4A 2PLAA 3H65A 3DFUA 2RH4A 5DBGA 1EE9A 3O38A 2HQ1A 4IXWA 4R9RA 5CAEA 3VHRA 3ZV3A 3GC6A 4IINA 3OQ1A 1KVSA 1I2ZA 4IZIA 1B8VA 4E21A 1N1EA 4OGWA 1UAGA 1WMBA 2ZB4A 3QA9A 1P1HA 3UGKA 4JX8A 1YJ8A 3MJEA 3DBVO 1L7DA 4XQCA 3LU1A 1RPNA 1LXCA 1X1EA 3GVXA 3EDMA 2VUUA 3BYZA 1KBZA 4E5PA 1ENZA 3DQPA 1Z74A 1VJTA 3BMCA 3LC7O 1K6XA 5JC8A 1P44A 4HFMA 1ADBA 1NBOA 4PLTA 4J90A 2XXBA 2J5RA 2AEFA 4NBUA 3C1AA 3GNQA 4Q3BA 3ZNQA 4WLOA 5TT1A 2OZPA 2V6BA 2FHSA 2JFGA 3V2HA 3H9GA 4UUOA 2WE8A 3GOHA 5COAA 4EEZA 4NPCA 2Q4EA 1PZHA 1NPDA 1ADFA 1R6DA 3DB2A 3WX0A 4ROSA 3MTGA 4GWKA 8LDHA 2RH8A 4CLHA 2B69A 1ZMTA 2LDXA 4BGVA 5IXSA 4K6FA 3W8FA 4U7WA 3MTJA 3BXXA 1JVSA 3TQHA 1YB4A 2NU6A 1J49A 4M8SA 5IDWA 1ZO8A 3H3FA 3X2EA 4Q39A 4CLRB 3F4LA 4LVUA 2GN6A 3ETDA 3FF4A 5A9SA 3Q0EA 2WD7B 3O8QB 1UP4A 1LRKA 1HDGO 1MUUA 4XYGA 4L76A 2IRWA 2FZEA 3BTUA 3GVHA 5BSHA 1MX3A 3OHSX 4L4XA 1LSSA 4OMUA 3O4RA 4D0RA 4E33A 4F6CA 4M1QA 1GTMA 1C1DB 4RF3A 5A06A 3QJ5A 2C29D 3VZRA 1HE2A 1BDBA 1VL0A 2FZWA 3Q2IA 3LF1A 1MGOA 3BMNA 3WGZA 3LT1A 4BO5A 1H9AA 5HS6A 1FMCA 4RCVA 1ZFNA 3TL2A 3WJAA 1E92A 4IDEA 2HK9A 5HS4A 4MVJD 4ZHSA 2UAGA 2X58A 3FD8A 4BB5A 4JK3A 4XB2A 1QP8A 5TC4A 5GMOA 5KJCA 4CQMB 3IL2A 1LDYA 4IMPA 4A03A 4EITA 2Q4BA 2BF7A 5HBRA 3RD5A 3RKRA 3ZN2A 4CMEA 4UVHA 5GZ6A 3W8DA 4DC1A 4ND1A 1U5AA 3UCEA 5DBFA 3HJAA 4MJLA 2NV6A 3JQFC 4OSOA 4E32A 2ZYAA 1EDZA 4L9RA 4I9HA 1YH3A 5G2OA 4XRRA 4R4JA 3CIFA 4DPKA 1VL8A 3E5MA 3ROQA 3LYLA 1LDMA 2ZCUA 1PJSA 5I7EA 3ZV4A 5IZ4A 3RWBA 1D3AA 2IZ1A 3JQ7B 3JD1A 5TF4A 2J3HA 2Q1WA 2EP5A 1Z73A 1NQ5A 4XGIA 5L7YA 3V1UA 3FHLA 2HJRA 1Q1NA 2OMEA 4IXTA 4HKTA 4ZQBA 2VT3A 1J0XO 5KWEA 5TSDA 4YCAA 3FPCA 1PJ4A 4AFNA 4I5EA 1LDGA 1LLCA 4DQVA 3E5RA 1T2AA 1FK8A 1NXQA 2JD0A 3RUEA 4RQTA 3FBTA 5THQA 5AXBA 4CUJA 4CM1A 4MVJP 1JWBB 1IULA 3L4BC 5F5LA 3PYXA 1XU9A 4W6ZA 1UP6A 5JDIA 4BGEA 2RBEA 3DBRA 1UJMA 4NU5A 1P77A 1I3KA 3VPHA 1OZAA 3FSRA 2Q3EA 3GRKA 1LBEA 3DZIA 5JYEA 2Y0EA 3UCFA 1DBVO 1VSVA 2O48X 3ETEA 1ONNA 4QSMA 3PJEA 2CVZA 2DTXA 2WEKA 4FIZA 4ALLA 1PQUA 4JP2A 3MOIA 5F21A 2IXAA 5BQFA 5JYDA 3VH2A 4NU6A 1P1RA 3ANMA 1CIVA 4RV9A 4BO3A 4F6LA 1CETA 2C7GA 3HHPA 1JKIA 1DJQA 4RORA 3H2SA 5ICMA 2V6FA 3CKYA 3R0IA 1DRVA 3PZRA 4MKXA 3OJOA 1ZW1A 2ZTVA 4RQUA 2D3TA 4Z0HO 4RF2A 4YA6A 2WD8A 4YBZA 4OXYA 2B0JA 3WMXA 1D8AA 2C20A 1IB6A 1L7EA 4XA8A 5JW6A 4D46A 3NGXA 2AHRA 4NR0A 2Y67A 3E8XA 3EYWA 5IXYA 2VYVD 3KYCB 5KVQA 4HFJA 4QEDA 2GCGA 1GYPA 3O03A 3R3SA 1H94A 2CDCA 2B36A 1BRMA 2ZJ0A 4NH4A 4WLVA 2G17A 2VHYA 1C1XB 1KEWA 2W2LA 4OM8A 1BHSA 2I9PA 5CEFA 3CUKA 3QWAA 5DDIP 3I9NA 5BSGA 2AEMA 3INTA 4BNNA 5H82A 2C07A 3BMCB 1N2SA 3U49A 1H6AA 1I32A 3BHJA 4CMBA 1I3MA 4ALKA 1QKIA 4IQGA 1F8GA 1LSJA 4A0SA 3A9WA 1Y81A 2HDHA 2NLOA 5KIAA 4DGSA 4AJKA 1WVGA 1YDWA 3U3XA 3H5NA 2Q1TA 5DNAA 4IY1A 2W98A 2DQ4A 4BUCA 1YL6A 4MOWA 4YQYA 3D0OA 4QX6A 3GT0A 4L4RA 4M87A 3RUIA 4NBWA 2DLDA 4N5LA 3JYOA 3U09A 3BAZA 4MVJI 4GVXA 4GX5A 1HDZA 6ADHA 3Q2KA 3GH3A 1I2CA 3NV9A 1DC3A 2PV7A 1NVTA 1U3VA 1OC4A 3KM0A 3HDJA 3WQSB 3ZZNA 3STHA 4BHTA 1NHGA 4AJHA 2EGGA 4KP7A 3KXDA 1EFKA 1CQIA 1IZ9A 1Y1PA 4G81A 3JQFA 3TSCA 1Q2XA 1GY8A 2ZQYA 3DC2A 4RVGA 5EIOA 5JC1A 1BWSA 1T1SA 2UV8A 2OUIA 4JIGA 4L0QA 1NPTO 1LSUA 3AOEC 2CF6A 2W2KA 2C2YA 2GNAA 4BNYA 3C7DB 5A9SB 4FCCA 3A14A 4M55A 1IYZA 4D3DA 1XLTA 4ITUA 1N7GA 3UF0A 5TX7A 1ZMOA 4NK4A 2IEDA 1JAYA 3B70A 4J43A 3PQDA 4AG3A 3JQGA 3ON5A 1OFGA 1U7TA 3G79A 4UUNA 4XDYA 4MO2A 2AE1A 2UUOA 1NWCA 4Z9FA 1ML3A 1PS9A 3BMNB 1HDYA 2EERA 1DLJA 4MDHA 3Q11A 5DN9A 3V2GA 1NM5A 3PHHA 4MKRA 3PYMA 2FP4A 1UDBA 3PK0A 3ST7A 4ALIA 3DXFA 4IJWA 2Y0DA 3DZJA 3PPIA 3ZWCA 4BO0A 1BVRA 5LDHA 3KSZO 4BQPA 2B5WA 3S2GA 4CJXA 1T24A 4IDDA 4KMSA 5ER6A 5HRUA 1H93A 4GQAA 1WPQA 4ND3A 4LMRA 4TVOA 3VVCA 1GFSA 2X86A 2OL4A 1HLDA 4LN1A 4P38A 5KKAA 2IZZA 1T2DA 2O2YA 5JSFA 1N5DA 3IP1A 5EN4A 1BVUA 2QRKA 2FOIA 4G2NA 3DAGA 1M67A 4HNHA 5JMPA 1LU9A 5DP1A 3PFFA 4EJ6A 1MC4A 1HLPA 1OMOA 2J6IA 1S6YA 1DRWA 4G5HA 3D3WA 3OF2A 4O0LA 1E5LA 2ZIZA 1WNTA 5FWNA 2HAEA 4FC6A 3V1TC 1E77A 5FEUA 3O26A 5JO0A 3GGOA 1F8FA 3IQDB 4MVJA 3HN2A 2X5OA 5BNIA 2Q2WA 5HA5A 5B37A 2NVUA 4CMKA 1UR5A 4KZPA 5KJEA 1PR9A 2H1SA 2CVQA 2YV1A 3L9XA 3MJVA 2R00C 1WWKA 1H6DA 4GGPA 2YQ4A 3E9MA 4P8RA 2HU2A 3W1VA 3T4EA 2C59A 4RLSA 4FN4A 2O7QA 4BMNA 3LQFA 3JD3A 1E7WA 1ZH8A 1LRJA 3OETA 3HDHA 4NFSA 4EUHA 1QXSA 1X13A 2ZTUA 4YT5A 2W4QA 4IS2A 2ZK7A 5IJZA 3CZMA 3PGJA 2UVDA 1QYXA 3DFZA 9LDBA 1SEPA 2VWQA 3AK4A 2R6JA 3LLSA 3WWZA 3VOSA 3IS3A 1EVYA 4CLEA 1EEHA 4XDZA 1KY5A 1ZJZA 5IDYA 1E1NA 4YJGB 4CPDA 3ONEA 1O9BA 4WLUA 3D5QA 4E2WA 3D3EA 3PWZA 1KOLA 5TT0A 2CSUA 3RC2A 4CUKA 1VC2A 2X5JO 1PGPA 3AI1A 3RAJA 2SCUA 3ZNOA 3RU9A 4B7UA 1ZBQA 1PGJA 2JL1A 2DU8A 1XR3A 3G49A 4BO1A 3I5MA 3QVOA 1ADGA 1P0CA 4LISA 4OJNA 2GGSA 4CM5A 1ONOA 1AHIA 4NNJA 2PD4A 2FR0A 3VZQA 3AUTA 5BSFA 1DAPA 4E4YA 2CUKA 2D8AA 2PZKA 4GMGA 4B4WA 1RWBA 4GL4A 3GLQA 4D7AA 1BXKA 3ZU4A 4ID9A 4IPTA 4XYBA 3ZV6A 3C1OA 5EQDA 3DR3A 1K0UA 4CMIA 1F12A 1AN9A 5BR7A 5C7LO 1LDNA 3GEDA 1QR6A 3OSUA 3D5TA 5GZ1A 4WK6A 1FDTA 1ZCJA 4S3MA 1O0SA 3BHMA 1W4ZA 3LK7A 3HQ4O 3D4PA 1SAYA 4R3NA 3UKOA 3HE3A 4P4NA 1QSGA 3GY0A 1AHHA 1AGNA 3WLEA 2YHIA 2PKQO 4URFA 1HSZA 5CG1A 3IKVA 1BTOA 1Q7GA 1H5QA 1OOEA 2OORA 3GRPA 4TRNA 1E3LA 3LC1O 4LCEA 4ZICA 3JQAA 2DAPA 4IDBA 3U4CA 1U4OA 4XQGA 3SLGA 4UAGA 4H7PA 4ZQFA 4B3JA 3JV7A 3GUCA 5JFOA 1ZK3A 1LLUA 1PIWA 1K2WA 4HUJA 5G0UA 1GQ2A 1VJ0A 1JLLA 3C1TA 3GA0A 4FFMA 3K5PA 2VYVA 1Q7BA 3WGYA 1YRLA 4BKPA 3JYLA 3BIOA 3EMKA 2JKVA 4NK5A 3Q3CA 2O4CA 4BNMA 1TB4A 2AG5A 1GEGA 4JBHA 3I9LA 1K89A 5DP2A 2CDBA 2WJPA 1ARZA 4GBJA 2FSVA 4D45A 1P31A 4NJMA 1RM4A 4PLPA 1IY8A 4AL4A 1P74A 1U2DA 2A9FA 2OP1A 2Q45A 1VPDA 2HCTA 3FN4A 4B79A 1YXMA 4WE3A 5AQ1A 5KJ6A 5A3JA 2Q1UA 1XEAA 5M6DA 2W2KB 5K6AC 1TT5A 2LDBA 5B1YA 2XXJA 4BNGA 3HADA 3IKTA 3WMWA 5I7FA 1HE3A 4CM4B 4CM9D 3BTOA 1B7GO 1UXGA 4Q3DA 1BMDA 2I66A 4MVJE 2VHVA 3PDUA 2VHXA 1ENOA 5CHEA 1A4UA 3H7AA 1CYDA 1GPJA 5JAZA 1RJWA 3JQGB 4PN3A 1PGOA 1LRLA 3P19A 5JDCA 3SLKA 3RFVA 3Q9UA 4TRMA 1ZNQO 4RF4A 3PGXA 4IS3A 3OH8A 3AY7A 1OI7A 4O6VA 4BNTA 3JQ6A 5KOIA 4TKLA 3FPLA 1E1KA 3ZWVA 1ZZEA 1SPXA 3AUUA 5KTKA 4Z3DA 1KEVA 4XQ9A 3EK2A 2WTBA 3QE3A 3RI3A 5J23A 1HZZA 1Z7EA 1J5PA 4R01A 1HDXA 1GZ6A 3HG7A 5TNXA 1A4IA 3L6OO 4BNLA 2YV3A 2X23A 4FGWA 4ILKA 4YJHA 3OJLA 1EQ2A 1ONPA 4KWHA 1Z45A 4DC0A 5COBA 3TZHA 3BMOA 1YONA 4RL6A 5K9ZA 2EP7A 2BI8A 3K31A 4XR4A 1SC6A 5IZCA 2GR9A 2O7SA 8ADHA 2Y05A 2NQ8A 1HE5A 4IDCA 3K30A 3G3EA 1ZKMA 4DRYA 1O8CA 2GPTA 3AY6A 2VUSA 4XIYA 3RROA 3TJRA 1QORA 4FJ1A 4HFNA 4PZEA 5U1PA 4PVCA 2GZ3A 2Z1MA 2QQ5A 1UZNA 4ZQHA 4B7XA 1I01A 1UXKA 2EEZA 2J5KA 1QV7A 2Q99A 4I8XA 3ZHXA 2VZ9A 1HDCA 2GZ1A 4IZHA 5B4TA 3GVCA 4HNGA 3A1NA 5JYAA 4ZJUA 2VNAA 4Y9DA 2BLLA 4OKIA 3JQ9C 1Y9AA 3WGIA 2FRDA 1E3WB 4W9NA 1LEHA 1U2GA 4IJUA 4PLZA 4KUGA 4RPGA 4FPXA 3GDOA 3ZCXA 3SEFA 4GX2A 3FTPA 4QFCA 3AM5A 3QRWA 1UXJA 1YB5A 4FW8A 3VDRA 2HK8A 4IUYA 1GUFA 1NR7A 4PZCA 1GR0A 4RLHA 2DBRA 4NI5A 2JHFA 1B3BA 1CWUA 1DIBA 4G65A 1E7QA 3SJUA 4FR5A 4J16A 3PIDA 3E18A 3PXXA 2PZLA 5CP8A 4OHUA 3F5QA 3ZWPA 3NEPX 1LDEA 4CMJA 4JXKA 3VH1A 4MVJH 2JD1A 4GX0A 4BV8A 1PJLA 3EVTA 4BKQA 2ZTMA 1U7HA 3WQRA 3ZWMA 3GFGA 4IQ0A 4XRGA 3I1JA 4DMLA 2B35A 4M86A 1V9LA 2I6TA 5JAIA 1DFHA 5CDYA 1CEQA 1LUAA 3PEFA 3KUXA 4IDFA 1FDWA 1PSDA 3S8MA 3P2YA 3BMQA 4TZTA 1M76A 5L4SA 2D0IA 1ISFA 1A72A 3ZU2A 2VCYA 4DBZA 5I9LA 2VZ8A 5KCZA 3ONFA 4E5KA 4GSKA 4J0FA 2G76A 5CDTA 3ADOA 5L53A 4OXNA 1EK5A 3IP3A 3AU8A 3DWFA 3PLRA 4RPKA 2X9NA 1R4MA 2B4QA 1YOVB 4E3ZA 3WSVA 2PGJA 2FN7A 5K6AA 2P2SA 3WYCA 3WG9A 5AVOA 3JYQA 1CERA 4NG5A 4CMIB 1O95A 2PA3A 2BFOA 5DULA 1YVEI 1R0LA 1YL7A 3RBZA 4AVYA 4CV2A 1JN0A 1NAHA 4CL8A 5CPBA 3ZW8A 2FR1A 3PWSA 2EHDA 2WMDA 2Z5LA 3ZDFA 2XPCA 4NBRA 4BNKA 1A9ZA 3WNQA 4L8VA 1QMGA 1U8XX 5G0TA 1GCOA 1V0JA 2VT2A 4WOJA 3I52A 1UDAA 3T7CA 2O3JA 4LMPA 4N5NA 4IQ8A 3VPSA 1RYEA 1CRWG 3QQPA 4PIVA 1R4NB 3ZWYA 1FF9A 3E03A 4ZN6A 2JFFA 3PVZA 3L4SO 1XQ1A 3TOZA 4YJFA 1FDSA 1SBYA 1P45A 4FFNA 1XIVA 3ZV5A 1IE3A 2VUTA 2HMUA 3QWHA 4YYZA 3WGGA 1PX0A 5CDGA 3H9JA 1Y7TA 2P4QA 1HE4A 3BHIA 1E5QA 1UDCA 3S1LA 4NHEA 4QTZA 4D0SA 3E1KA 4NJMB 5DZSA 2Q50A 3ZW9A 3CMCO 4BNIA 3DOJA 3L9WA 4DMMA 5U4QA 2NWQA 5C5IA 4EZBA 3AU9A 3QVWA 1LDBA 2HRZA 3S55A 4IGEA 1E0DA 4LRTB 4H15A 1Y8RA 4CV0A 4XR9A 1BSVA 2VRCA 2EXXA 1JWAB 2DBQA 4AJJA 1Q7CA 1LNQA 2ZYDA 4RPHA 2X5KO 2NVWA 2CY0A 2YDXA 4P4LA 4MVJM 2X22A 3VKVA 4AJLA 3WB9A 3GZ4A 2H5LA 4O1MA 2Y1OA 3QSGA 5B4VA 2FSSA 4J4HA 5JAMA 4H3VA 3E9NA 3QLJA 2Z95A 4CV3A 2X0JA 3T7EA 4E2XA 1X7HA 1H9BA 2VYND 2C5EA 5H81A 4D44A 3K2BA 4L4SA 4S1VA 3MZ0A 2POQX 3HSKA 3H2ZA 5ITVA 2Q2VA 2DT5A 2EW2A 5AXDA 4LW8A 3GG2A 3KYDA 1E6UA 3VVBA 3K6JA 4CM8B 3HUDA 1MB4A 4R1SA 1ZSNA 1XKQA 1NFQA 3QP9A 4JNKA 4E12A 5DCUA 3KLPX 4YJHB 1E3IA 4Y98A 5IN5A 2GERA 1P33A 3F6YA 5CG2A 4ZRNA 4E5YA 3CZRA 2A94A 3WWYA 4YAIA 3W4KA 4CM9A 1ZK0A 4ND2A 1R15A 4CMHA 5DCYA 2HO5A 4DIFA 1LA2A 3PHJA 3UAGA 1UH5A 1CQJA 4UVDA 1HKUA 3PTZA 3NTRA 3H9QA 1M75A 3DTYA 3Q9NA 3JYNA 1Z6ZA 3R3JA 2BFMA 3QY9A 2BD0A 4WCFB 1DFGA 3UXYA 4EYEA 4JP3A 5F1KA 1LLDA 2NM0A 3DBHA 4D43A 4R5MA 4RJTA 1Z75A 4MP3A 3KO8A 2H6EA 4BB6A 2VWHA 5C7IO 3CMMA 2IYPA 5EMHA 2DM6A 1C0KA 3VAZA 3X2FA 1DLIA 3FWZA 3GR6A 4PG7A 3JQAD 2YYYA 4CM6A 2HKIA 2O3SA 1NFRA 3ZGYA 3IJPA 3UVEA 3KRTA 4RGBA 4BV9A 4I5GA 3ITKA 5ITWA 1XELA 1SNYA 3OBBA 3N58A 3DMTC 2E6UX 4J7CA 4FSHA 1V35A 4YAEA 3FWNA 3WBFA 1HSOA 2H9IA 2ZKLA 4IDAA 4DTIA 3QWIA 2JCXA 4BS9A 2X0NA 4DPLA 2VN8A 4J9UE 4YAGA 2IXBA 4BKOA 1ZSYA 1ULUA 5IFLA 3L77A 3VZPA 2OOSA 3DZHA 3RJ5A 1WZIA 2CMDA 4R41A 4QXMA 5EERA 1E7YA 3EHEA 1QYVA 2PH5A 1KVUA 3KZVA 3ROMA 3RUAA 4J0EA 4NDNE 1E7RA 5AXCA 3VDQA 5T5QA 5L4NA 1R37A 1A71A 3RC9A 2C7VA 3EGOA 1IUKA 2QIOA 1OBFO 6LDHA 2X7HA 1YE3A 2D5AA 2VNSA 2GN8A 2BGLA 2JAHA 3WIEA 4GWGA 2BHLA 3BMQB 2I5PO 2PWZA 3SXPA 3L6DA 1NVMB 1ZK2A 3EAGA 1WZEA 3R6DA 1X0VA 2O23A 4BOYA 2WSBA 3SC6A 4OIMA 3RSHA 5HTOA 1JAXA 4CQMD 5BNFA 2QYTA 1B14A 1BW9A 3PIIA 3GN1A 1I33A 4L73A 4K6CA 1W6UA 5TS3A 4BGIA 3HDYA 3WSWA 2YJZA 3F1KA 3NKLA 3ROPA 1PQWA 3MEQA 2PKQP 1KVTA 2DPHA 3LC2O 3I6QA 3RASA 3UFXA 3TFOA 1F14A 3WBBA 5MGBA 5CDUA 5L7TA 3NJ8A 2EW8A 1A5ZA 3OQ6A 5G4KA 4ONEA 4E6PA 2PY6A 1U3WA 4HV4A 1HYEA 1X15A 1TLTA 4PLYA 1PWXA 1N8KA 3GF4A 3PWKA 5T64A 2ZB7A 1DIGA 3DZKA 5TIIA 3ZI0A 1DRUA 3ANNA 3K2EA 3UICA 4PG6A 2J5QA 2X8LA 2VHZA 3PRJA 3UCXA 3HB5X 4EGFA 4YJFB 3DOOA 2DUWA 2QZZA 3B6ZA 1P3DA 3ADPA 4U5QA 5A5FA 3MJSA 5A3VA 2P4HX 2IYOA 3K92A 3L4BA 4R3WA 3F5SA 3KETA 2GO1A 3LT4A 1PZEA 3I23A 5FYDA 1PJCA 2R2GA 2VQ3A 4MIYA 3INGA 1CF2O 1EE2A 2OP0A 1LC0A 3PJGA 3DBLA 3V8BA 4YT2A 1JVBA 2P5UA 5H83A 2YZ7A 1B16A 3NJ4A 3IJRA 3PQEA 2AEJA 1GEEA 4RPJA 1T4BA 3HB4X 4PLWA 3OMLA 5F3RA 1Y8RB 2D2IA 1E7SA 1NR1A 3SC4A 1HZJA 2X6TA 4B7CA 1NX6A 1SOVA 1DIHA 3NUGA 3H5AA 1XQ6A 4B8ZA 4DPMA 3F3SA 2Q22A 1G0NA 4ND4A 4JBGA 3GGPA 3CINA 4OKNA 2AMFA 2UUPA 3NDIA 2A92A 4KDFA 4DXHA 1J6UA 1YQDA 4B4OA 2Y68A 1IPEA 4KUHA 5IN4A 2IDZA 3VPGA 1X1TA 3JQ8A 3JQDA 4PG4A 1QG6A 1LQUA 3L6EA 4A73A 2BI7A 4DYDA 1UAYA 2PTGA 1Y9EA 2NVBA 4AJ2A 4KUEA 2VOEA 2JD2A 4FC7A 3RKUA 3NX4A 3KYDB 3GVPA 1KY4A 3DHEA 5KKCA 3FNEA 3TRIA 2BELA 5JXWA 1Q0LA 3GDFA 1T2EA 1YBVA 2OBYA 5TJ9A 4AJNA 4OL9A 3TZQA 2Y1FA 4DUPA 1FDUA 4WEOA 4UEOA 1T25A 3WDSA 4A10A 1DEHA 3DBRB 4DL9A 1C3VA 1QV6A 4J6FA 5I8WA 2GN9A 4XIJA 5L40A 4BIIA 3I9KA 2F1KA 3FRJA 3IDSA 1A9YA 1GYRA 4EUEA 4KQWA 2D59A 3C3XA 1O94A 3KLMX 1YQXA 1H0KA 2YFQA 3E9QA 2PD6A 1A7KA 3WGTA 2EV9A 3OIFA 4W4TA 1PS8A 4QFDA 1PU2A 5EINA 4QQRA 2Y0CA 3U4HA 4TMFA 2CDAA 1NPYA 3WGHA 1V3UA 5I9NA 1GYQA 4TVBA 1PQPA 4JJIA 4K26A 2VYNA 3DBHB 2PZJA 4J4TA 3M1AA 1P1IA 3IUSA 2QRJA 4OO3A 2JJYA 4PLHA 2AQHA 5ILGA 1M6HA 5FFFA 4WEQA 3IIEA 1BDMA 5KNLA 3PZBA 4YXFA 4BMSA 3T4XA 3RUCA 3I9JA 2HJSA 2GDZA 2BKAA 4ZQGA 4GLLA 4ZQEA 3PDJA 5T8KC 4XB1A 2DVMA 1NWHA 3DZBA 1NASA 4EUFA 2OFPA 3P7MA 2GF2A 2XAAA 1QYWA 3AUSA 4BQRA 3TZCA 3ZHYA 5THKA 1E3JA 2GASA 1HEUA 3D64A 4U8GA 4DA9A 2A4KA 5FI5A 1B3RA 1WDMA 3F47A 3P5SA 4BGUA 3AOEA 4E30A 1SMKA 1GPDG 4BNJA 1DHTA 4M49A 3W4JA 3C8MA 2Y1EA 3GEMA 1E6EA 4PLFA 3Q1LA 3IOYA 3E82A 4RVDA 4WCFC 4GKVA 5GZ3A 1RM3A 1NTOA 4D3SA 3AM4A 2DFVA 2QYSA 3AUAA 3C24A 5JS6A 3DZFA 4M54A 1I10A 3G1UA 2XOXA 4GGOA 3JQCA 3ICCA 1Y8QA 4OYRA 4E2ZA 3DO5A 3UN1A 2VRCD 5A03A 2TMGA 4CMGA 2P9EA 5A05A 4JBIA 1Z82A 2YY7A 2B37A 3F46A 1EFLA 1WAMA 3GFBA 5IDQA 1TI7A 2JFHA 4AJ4A 3GGGA 3JQBC 1DDOA 2NTJA 3WTCA 3EUWA 1DHRA 4CLOA 4CLRA 1AUPA
chains in the Genus database with same CATH superfamily
5F1PA 1QIKA 1AVTA 1YI1A 2PZMA 4G09A 2OG2A 2PL9A 3IP7A 4BE4A 1SCKA 2ZSIA 3M6WA 3TK1A 3SDBA 4QOGA 2HSDA 4PTLA 3NNSA 3LV8A 3GOQA 1PK8A 5GWXA 2OFXA 3KQVA 1C7FA 4Q82A 5AKGA 4DARA 2PU7A 1T9HA 3RGGA 1CFZA 2FUNB 4F2DA 2O06A 5DTIA 1RE0A 1OIXA 2IDMA 1REQA 2V54A 3DAFA 4L02A 2XSZD 3MJ4A 4PCVA 2VSQA 4FS3A 4OL0A 5EJ5A 2ZXUA 4U5XA 4PPNA 4EMBA 1NVBA 1IOLA 3JVUA 4QBGB 4Z7QB 5HJ7A 4KTVE 4FMCF 1IWPB 1C3OB 2FOLA 4J1SA 2H06A 2VUHB 4AIIA 3N76A 1E2DA 3DFIA 3F0TA 3NT2A 4HWGA 4DBVO 2P91A 2WQZA 2OBXA 5IM4F 4NSNA 2WICA 4Q1DA 5K0BA 4L51A 2OHXA 4RGVA 3NBQA 4Q9DA 1R18A 3TF5A 5ENVA 4LF9B 4CQMA 5A5EA 3L8CA 2O8DA 1E6WA 2NUTA 4YMTA 4IDPA 3CKKA 3GRUA 3QYJA 3JPWA 1VSUA 5JZMA 1MR3F 2D4AA 2V7VA 1YE8A 1MP0A 2FP4B 3JX9A 2P3LA 3NHPA 3MTDA 4ZANA 5FLYA 1BA3A 4MQ6A 5AXAA 3U37A 4RIIA 3ZIAD 1RRKA 4DLAA 1IMOA 2P79A 3GNSA 3L40A 5D84A 1ZWLA 4WIAA 5LDDC 1F1BA 4L78A 3NCHA 1EFCA 1QONA 2ZJ1A 4GLJA 3D1JA 3FZEA 5JXGA 1CZRA 2QROA 2WAAA 2WP8J 4LHSA 3RWMB 3QJGA 5AQEA 5FOTA 3C3BA 3E35A 1TKAA 3HMKA 1WZNA 3MGCA 3IR5A 1BWPA 3AM3A 4TV9B 2HEIA 1WVMA 3OJ0A 3P9CA 4FYIA 3SBOA 3EPBB 4A7PA 3AVXA 4RPLA 3L6UA 2R79A 5C2JB 4E0BA 5J4LA 1L1EA 1IXKA 3OD5A 1I36A 2CVOA 2JEZA 2HQBA 3BGOS 2WD9A 2GX6A 3ZR4B 4KGDA 1PS0A 4A23A 3PFKA 4JXZA 5EZ5A 2VYQA 1ZINA 3HV2A 2VUIB 1YR9A 3PGA1 4M0DA 5IARA 4AS3A 2W6QA 2B3DA 5DWDA 2Q46A 2I99A 4FU0A 5EMLA 5K0SA 2J31A 2FCRA 2GPNA 2GI4A 1G9SA 3V4SA 4DSUA 5AOCA 2C2OA 4W82A 4H4EA 2FU5C 3O73A 2CUZA 4LRSB 1KERA 4RM2A 3TG8A 4WAUA 1R9NA 1X8KA 2QR2A 2WT8A 1GN8A 1NU6A 5JT1A 1JSZA 1Q77A 1N9GA 1XVUA 3A4VA 3ENQA 4L57A 4OA5A 4RVHA 3SEAA 4PNZA 5AJTA 3CGWA 4UM9D 2AIRA 1C8VB 1HFJA 4MS1A 4DRZA 3JPYA 3HCCA 4MGEA 1Y9DA 1Z6XA 2JIMA 2XQGA 3QUSA 3CF4A 2E7ZA 2W43A 4Z8YA 5DNEA 2NVUB 3EZYA 3RCBA 2BCEA 3HZZA 4RVUA 1QTIA 2SICE 4N3NA 3UOGA 3GP8A 3OTWA 2AKAB 3SF0A 3DL4A 4H35A 1W2GA 1Z35A 4FZ5A 1CS4C 2JDIA 4EK9A 4LC0A 1RSZA 1S3FA 4MS4A 1PLLA 4TMYA 3WGUA 4D8UA 4F8EA 4U1RA 5C8YA 1QVAA 1F6DA 3GJXC 1G2QA 3ZWKA 1GCAA 1K6JA 4MDFA 1MOPA 3QTLA 1F8UA 5AT1A 4ZVVA 4QHSA 4X9XA 2Z43A 2IBTA 2NQ2C 3DM5A 3EH1A 3J7TA 1VG9B 2C9YA 3LLVA 3QK7A 3ZXYA 2Z4SA 4FNAA 4FFRA 2CLEB 3MNFA 3D4NA 4YHBA 4DR2B 4BNVA 5F98A 3ZVRA 1B8UA 3A05A 1K9SA 4EI2A 3LW7A 5FYQA 3DDSA 3TMKA 3QFRA 4YTEA 1L4HA 1XMIA 1J2EA 5I7SA 1PE0A 2FLWA 1RIFA 2QT0A 3KEQA 3I1FA 3QMMA 1ULSA 4MLDA 1P0FA 2VWGA 2XF2A 1JXMA 2AI2A 5JXJA 2YQ5A 4OU4A 5WRFA 4G1BA 3H97A 3PCXA 1DPGA 2YY6A 4RWEA 5BOVA 3N8HA 1RTTA 3H2BA 3QIAA 4XM1A 3RFFA 5JV5A 2XT9A 4Q9LA 5DH9A 2PX6A 2A4MA 3ZHRA 5LL6P 4MHTA 2W2QA 4DBLE 2J3DA 1RRCA 1KQNA 4BVHA 3PXCX 1ZGBA 5JDIC 1HH4A 4O4HA 2ECPA 1T2UA 2ST1A 5CTJA 5H3HA 3DOFA 3H0KA 4RTMA 1UXIA 5ELXA 2GD6A 2HIAA 1IHXA 5CURA 3W06A 4LEIA 1ORRA 1SVWA 2WHPB 4R1TA 4JB0A 1HE8B 2YV2A 1FUKA 2ONYA 2GT1A 2QMHA 3BILA 3ZWXA 5I7OA 1QIEA 4KLCA 3OX3A 4UREA 5DMHA 4GOND 2I71A 4JD5A 2HF8A 3QTTA 5L51A 3QVGB 4K0RA 4ZV7A 4KODA 1IWBB 2HUNA 2QJRA 2UZ1A 1M5UA 2WWXA 1FFXA 1DG9A 3OTGA 1T8TA 2UZIR 3AW9A 4CG1A 2ZSEA 4H1WA 5DYGA 3OAAD 3UQZA 3QLVA 3KLOA 4REQB 3RBAA 1Y8QB 1MJFA 2F6RA 1F9EA 2EAUA 1DUVG 2PGLA 1VPTA 2NXJA 3GAZA 3JASB 3D4BA 3EA5A 3IBTA 2G9UA 3OTQA 3PXEA 1WV1A 3TGWA 3WNZA 4Z53A 2ATCA 1RE1A 2C00A 2GEVA 2R86A 4MPDA 1UZMA 3K0CA 1T0BA 3N28A 4HWOA 4QYIB 3EWNA 4TT3A 1XZLA 4YJKA 4EJSC 1ZK4A 3GP5A 2X76A 4HDSB 3UB4A 1EWVA 5D8DA 3RRJA 1M83A 4BX9A 2PR2A 2VK1A 4WI1A 4C29A 5K3SA 2Y3IA 1G3RA 4OHBA 3CVYA 4IRUB 4K9DA 4JJGA 3L0DA 4CLOB 1AXGA 1DV1A 1WXDA 5JD3A 3HZRA 1UBRS 4E3ZA 1LH0A 4YMGA 1JX6A 4MO9A 1OYOA 3L1JA 5IDXA 1XP5A 2HSJA 4TTIA 1IUPA 3NHAA 2RGXA 4OQLA 3RV4A 2A0WA 3W1WA 3TZ6A 3KOUA 3QVMA 2WYUA 1ORWA 4QOFA 1IQ0A 4UVGA 5KNBH 5C9ZA 3J81A 2VOJA 3S3TA 5ES4B 5HWSA 1SBHA 3MWLA 3DDOA 2EKDA 3DOCA 5EMNA 1JEOA 1K8YB 1N8TA 1UBJS 1O03A 2AA3A 2AE2A 4C0KA 2CDRA 3GX1A 4Z7OB 3D4OA 3A28A 1ZZGA 2XB6A 3M34A 4KLNA 1VDMA 4PV7A 1E2GA 5BQOA 3PE3A 3O90A 1QHGA 4HQKA 4J1NA 3SJZA 1NLZA 1UZLA 2P1RA 5HXAA 1NQTA 1XVVA 4AQYB 4FFPA 5EXPA 3T1YB 1KJYA 3GMDA 3I2FA 5D1NA 5ALSA 2WZQA 1GRNA 1Z88A 3KU4A 3JCZA 4GVLA 4MCAA 3VKUA 4GOXA 1NBIA 4MRMA 5F4ZA 4OQDA 4IIJB 3ZJUA 1E60A 2M6RA 5FBZA 3KTAA 1V8BA 2YASA 1ZD2P 2IU4A 4R05A 1U2ZA 4D99A 5JPCA 4ZZ0A 2HDWA 2I8CA 3VU0A 4JKYA 1JFSA 3D31A 3KB2A 3GQVA 2FEXA 5JCJA 4K6GA 4BNZA 3RAGA 3UMJA 1XFAA 1LPNA 3PGLA 2AMLA 2YZNA 4M1WA 4MYUA 2VQSA 1TRHA 3ESQA 3HM2A 2VP9A 1E20A 4HDMB 4I6JA 4HVTA 4YEDA 3STYA 1UBSB 4TKUB 1L2TA 4C7KA 1V37A 2HHAA 2RHHA 3BREA 4FKBA 1GRCA 4QQ8A 4GEGA 3WKEA 2P6UA 3QX8A 1QG4A 1TF2A 4QXQA 2DTDA 4ZI2A 2WTNA 2IIBA 2A3RA 1HXHA 1W75A 2AUMA 3FPSA 1T0UA 2XE7A 1U9JA 4PAWA 4QYSA 3HNPA 1JR3D 1ODSA 4GKBA 5LA6A 2WIKA 4R2KA 2V9ZA 2AFRA 2ZJ6A 2PUTA 1ADCA 3BK7A 1Y1RA 3C74A 3H42B 3NWJA 3WRVA 2QMYA 5A5GA 4LXGA 4RZ3A 4ATNA 2ISCA 3LT0A 4UE3S 1D0SA 2OGSA 2H54A 4FNOA 5JQGA 4JEUA 2RG7A 3U3KA 5K5EA 5G0SA 5D5PA 1E66A 1XX6A 3DXXA 1JDBC 2FWMX 1A82A 1E2MA 1MD9A 1XDWA 1Q74A 4PM4A 5ESXA 1G0OA 3SI7A 2PT9A 1GQFA 1CJBA 1Y3CE 1YRBA 2WWIA 2GEUA 3D6UA 1PR2A 2RGNA 4DABA 4G36A 3KQQA 4HAWA 3UFBA 3RU3A 2LE0A 3EIUA 4F2GA 1IU9A 1D2MA 1PT5A 4EZEA 4JLNA 2PKRA 1V3VA 2NXCA 1DARA 2A88A 1J20A 1NM5C 1FMTA 5EJIA 4ZVRA 1N9GB 1PJBA 1Y4DE 3KK0A 3OCUA 1TT7A 3W3ZB 4MS1B 1Y3AA 1YDFA 4ZI3A 4AJEA 1ZSVA 2BHNA 4ZT4A 4DR4B 1E5VA 4HEA6 5AYVA 3ZHVA 4C3ZA 4E22A 3HR8A 4YNBA 1FJHA 1WXGA 4IDNA 1KU6A 5KOJA 2Q4TA 1ST3A 3WL6A 4PLVA 4BJ6A 5AI8A 5T3UA 2TSYB 2PLNA 3RODA 3LUHA 4M1ZA 3PI7A 1JQBA 1D4FA 2HH9A 4DQUA 3BK1A 2WOOA 1TZKA 4WJZA 1CJTC 2CLKB 4MS4B 3JY6A 2YDYA 4NAHA 2QMUA 4TYYA 1A27A 5C8YB 3EC7A 2E48A 3G9XA 1YJQA 2RJNA 2XNDA 5IG2A 4CQLA 4F93B 4HDRA 2HXYA 4N3CA 1TGVA 3D8TA 3QI7A 2QS9A 1IPFA 1I13A 1SFRA 3SS7X 4DMFA 1KHTA 2QWXA 3S28A 1P7PA 4MK4A 1BS9A 1ZXBA 3QLUA 1C0LA 4PZZA 2XMSA 5G0WA 2XXAA 1ZRMA 3D1LA 3FPAA 3O1HB 5DI3B 1P5HA 4HDCA 3SY8A 1TXGA 2HWYA 3JAKA 3R4VA 3DCJA 1WCXA 4G4SP 2FN9A 4GWLA 4CTJA 4KKVA 2M32A 4AKTA 1FOEB 2PM8A 4N40A 1LI4A 4GDFA 3EXEA 1MFPA 2P68A 1J4AA 1U8YA 4JROA 4A1OA 4ZDIA 5A2GA 3FI9A 1ISHA 1FNDA 2BJHA 5G4LA 4REMA 4OBWA 3ZY2A 2C7OA 3KSUA 3WIOA 3GZNA 4B6SA 4LMBA 1J7KA 5JCXA 3S2EA 1ZJWA 2GD1O 1DAFA 1CJKC 1U3TA 3O6VA 2C4HA 3AWDA 5C53B 3VR3A 2R6DA 1DX4A 3KKQA 5EL0A 1S3GA 5JRZA 3RFXA 4FDVA 4MMYB 4OSPA 1PJ8A 3L8MA 4BRWA 1PFGA 2G3YA 3DDUA 3GPIA 3LKVA 4UDOA 4FR2A 2ZRPA 2PSDA 4F8JA 4O4HB 1YQWA 3UUWA 2OHIA 2R1TA 1W35A 3QVUA 5CJ2A 1R66A 1X38A 1Z68A 1LBHA 4QUDA 3VX4A 1L7OA 4JZKA 4JJ4A 3UJHA 1NZDA 5SV2A 1ZLYA 2WFAA 2AOVA 2OGUA 3A2MA 5FT9A 4GMFA 4DDVA 5BVGB 3K0AB 2BM8A 4TN1A 2IYFA 4GSLA 1WPRA 1X7ZB 3RFTA 5B64A 1JVNA 3AFOA 4J0DA 2OC9A 4P33A 4YBRA 7MDHA 1X1DA 5BT9A 1NP3A 2H1VA 1TADA 1VG1A 2DWQA 4GBED 4DNOA 1Z4QA 1FXWF 4LECA 4Q6WA 4S1PA 1AC5A 1X7WA 4EBFA 5FR2A 3DR5A 5IVIA 5LQDA 4P7BA 1FFXB 3V2IA 1IN6A 3K0FA 3L1IA 4I5IA 1RKXA 3V7YA 3CHYA 3SJAA 3PEWA 3HCNA 3HCOA 4L5CA 3SOZA 3WR5A 2BFAA 4DV5B 1EQUA 1ZEMA 5K09A 3JVDA 3N0TA 4EZIA 3I4LA 4L8YA 2ZOSA 2NNLD 4DR6B 3B8HA 5CT5A 4UUPA 4AY6A 4AJOA 3RRBA 1SXQA 2BFFB 1XRSB 4I4NA 4WZAA 5IK2D 1J1UA 4JN6B 3UMSA 3CIOA 2G70A 4GOOD 2LCIA 4UNPA 2PMWB 3BE4A 3OEHA 1OXKB 5AK4A 3UWPA 1W4RA 5CNIA 1EUZA 1T5OA 1WXXA 1XRRA 4GI2A 1FVFA 4YX9A 4BQIA 4DLRA 3CB2A 2IWHA 2PZGA 3N2GA 4MB2A 2GBCA 2QGNA 1YRHA 4XYLA 4MMZB 5KWIA 2PNFA 2DH5A 2EX1A 1GPH1 4PYOA 1BFKA 1CXZA 1VE9A 1DSSG 3HXLA 1JE0A 1RKQA 4Z0TA 3LDGA 2C94A 4EJFA 4BXOA 1ENPA 3I39X 3ZEIA 2D7DA 2FW6A 3DDCA 4XIGS 2ZBVA 3WGKA 1WXIA 2EJVA 3JVVA 4I81A 3IB6A 1XD8A 2E37A 3DW3X 1KSHA 2CL5A 3P20A 4I1VA 3UM9A 4ER0A 3K73O 4KFUA 3TFQA 5BN4A 2B4AA 1J90A 1ZNYA 3EUAA 4QRIA 5LMUB 1T8SA 2HA3A 1JPVA 2PMCA 3H6KA 3P9QA 1DC4A 4NCAA 4TYWA 1YZKA 4H6VA 3U4MA 3V1YA 1S7CA 1SVIA 2UYQA 2DHDA 3RT9A 2QW8A 3NW9A 3UH0A 2BI4A 1Z6TA 3E7PA 1W46A 3HCFA 3K4QA 3DD1A 1AG9A 2RIRA 1PBTA 3LPCA 4JQCA 3TLXA 1GDHA 4ZALA 2I3GA 1PL8A 2BSQA 3QVLA 3JAWB 4MAFA 1LPBB 1QHSA 2JW5A 621PA 1DI0A 3L05A 3LS2A 4BO4A 2WNIA 4KV7A 4JVMA 5DT9A 5JNVA 2JHPA 5KOYA 3HA3A 1YHNA 5C4MA 4P0QB 2OWEA 2VTEA 1NBMA 4OBEA 4P54A 4X3OA 3HFGA 1AF4A 1QV9A 5HIJA 3R5FA 2IODA 3TNDA 1WUJS 4YUWA 2H4WA 1CD5A 2IYVA 1NVVR 5EXEA 1E0AA 4CMCA 4LVCA 3LQKA 1PP4A 5JNTA 5AVQA 3HXOA 4D79A 1GXSA 4AURA 1YR1A 1RM0A 1SA0A 2GYYA 2K7FA 1C41A 1PWYE 2IYYA 4UPDA 1IEWA 1ST2A 3SN6A 1HLGA 1U2DC 3BB1A 1IOVA 3E7FA 3IKJA 4YV1A 3SWWA 3VKHA 3EP8B 1N1DA 4I2NA 5HF8A 4D9IA 3AHHA 3FDJA 3LZDA 1JKJA 5DT2A 5H9VA 5LA6B 3GGJA 4J7XA 1EE1A 4R54A 3LNTA 4JCOA 5CVJA 1V7ZA 2PG3A 5DW3A 1XZJA 1HTTA 2A2ZA 3N2YA 1R9GA 4R9SA 3RABA 2FJ0A 2KSQA 4XGKA 4BO6A 3PE6A 4KQ9A 4IRMA 1NXSA 3EE6A 2ORYA 4B76A 4DYVA 2RARA 4EG8A 2FUG1 5JQGB 1Q50A 4QUKA 1E9SA 2Y92A 2CVFA 5T6MA 4TXMA 4CLXA 2X4GA 2GK6A 3CZ4A 1P1KA 4IWYA 3E2IA 4EPYA 3AI2A 2I8LA 4YFVA 5JDCC 2Z8ZA 1M7BA 1ZIDA 3Q1KA 1I6LA 1I4LD 3VI3B 4Z3OA 2X0KA 3T4PA 4MQBA 2R25B 4R68A 2M9MA 2QK4A 4A0FA 2YC4C 4D42A 2O1EA 3L01A 1BFUA 1VXRA 2W6CX 2AC4A 2Y1DA 3CTMA 4KR2A 2HWWA 4PSAA 5L45A 5DOZA 4M4SA 2Q7OE 3U19A 6CHYA 3QW4B 4D02A 2Q3HA 1SQGA 4ZRMA 4X66B 5LZ9A 2ZUCA 4B87A 2B4RO 5EHZA 4JBNA 1QF9A 4V38A 4EKGA 3Q40A 4FR0A 3P2IA 1HF3A 1UEXC 3GU3A 1WDLA 2DTEA 1B4DA 4RF5A 3ZU3A 4AY5A 5DYTA 2ZG6A 4DREA 1T43A 1CVRA 4BN5A 3OE4A 3QVTA 3LY8A 1FZQA 1K6MA 2I4OA 2DJIA 3RC7A 1LX7A 1T1JA 2C42A 1S96A 1D2AA 3F3YA 3E9CA 1EUDA 3DB1A 3SX2A 3VZSA 1H2XA 4U39A 4UPVA 5JPIA 3ELUA 5EJGA 3SQWA 1JDZA 3EMVA 4LYHA 2JRCA 6YASA 1QB8A 2PX4A 4WBXC 5J1TB 3ND8A 3K32A 4CQLB 4HDRB 3EF3A 5KYTA 1JSRA 2N9UA 1KI6A 4RW0A 2A9OA 4Z9YA 1PVOA 1GL6A 1Q0RA 1QIJA 2ZEJA 3WYGA 1OILA 1SUCA 3MWYW 3VZDA 4ACBA 2XXAB 3A3YA 2O50A 5JZBA 4XVCA 5L3SA 4G56A 3N6XA 1Q15A 2ONKA 4BO9A 1VLHA 3DMHA 4II3A 5AK5A 4EB0A 4K3VA 4MR9B 5IF3A 3O8RA 5EOVA 5J2TA 4UEJA 2PWYA 3INRA 1YMVA 2QORA 2YXLA 3P9XA 1WBJB 1I5OA 3H13A 3C6BA 5HUHA 2V3CC 3ENKA 1TA9A 3GZNB 3WK4A 1G2OA 1LV8A 1NDUA 2EDCA 1VIYA 3CR7A 3E3LA 3VHRA 1YOVA 1CP3A 1M8FA 3S2FA 4QGBA 3VR1A 2UYHA 3B51X 4XWKA 1A7AA 1D1PA 3EZLA 2OVBA 4W9NC 1Q5PA 1N2CA 2G77B 1P5JA 2FUCA 5JBNA 4URWR 4HLUC 1A76A 3NWEA 5D7BA 4ZKDA 1DADA 2Q9AA 2X14A 5I7VA 4MUKA 2R1TB 4UNRA 4ZVSA 2IXEA 3WGQA 1NW9B 3K9QO 1RJDA 2VSYA 1NW4A 4RVSA 4WUTA 4F3NA 4JB8A 5C32A 4A15A 1Z3CA 2BZSA 4R98A 2E49A 3MQ2A 2Y93A 4RD1A 4IEFB 4DJEC 3GBPA 4ZJYA 1ZEJA 4KNYA 1WW2A 5EESA 3ICEA 4GH5A 4NPHA 4BRZA 3RFUA 5L7WA 1PW5A 3V9PA 1K5HA 2ZYIA 1YULA 4IQFA 4J6EA 3U9SA 2JCYA 4FFBA 1Z6QA 3FMPB 4BFTA 3BCSA 5JNLA 2CWWA 3IIMA 2ZBRA 1A4XA 2CE2X 3N53A 4WECA 1UQTA 1AZSC 1N34B 4NDZA 1X7WB 4ZI5A 1MX5A 3TOXA 3WGMA 5AM0A 4YUZA 4J49A 4WDQA 2C8VA 2RH5A 3K0FB 5KQPA 4M53A 1IPHA 2ZWVA 3HJUA 1KZ9A 1C9NA 2VDMB 3EDQA 3K7EA 4IFIA 5J63A 3IAHA 4MW0A 4H27A 3C48A 2PYIA 3Q5DA 1TD1A 4UQOA 3QM1A 1FFHA 1I6KA 4U0KA 3F6BX 5IAEA 1E79A 3VC7A 5TQVA 3OQJA 4YROA 4HFRA 3PD1A 1N7IA 5KCMA 2GM5A 2QLMA 4MPJA 5LD2B 2BHRA 4Y8VA 2IUSA 4FOPA 1MXHA 2OXTA 1N36B 1MXFA 2DBZA 3TTUA 1X42A 3B6EA 3OF3A 4TWRA 4UXIA 4EVQA 1DO2A 1U6JA 5DBIA 1LY1A 3LKZA 3IKTA 1SIWA 5FA8A 3T0IA 5EJ9A 3LX4A 3GIDA 5LDGA 3HVHA 4YT4A 1UMKA 3N2GB 4WY5A 1NIPA 2P2CA 2ZRHA 3OA2A 3RS4A 3UTDA 4G0WA 4N76A 3TS1A 5HILA 1OFHA 1SKAA 3WFJA 4QDJA 1QTRA 2FH5B 3OP1A 3KV3O 1O95C 1IN5A 2HIHA 5FA6A 4D41A 3QFCA 1RXEA 4UDYX 3ZWBA 1O8BA 5DYWA 2XUQA 4BO7A 4OAQA 5TQ2A 2PK3A 4BXOB 4JYCA 3UAWA 2F00A 3DO6A 1GTL1 3Q7PA 2Q3LA 3FTNA 5ARCA 4CODB 3NYRA 1PDOA 2FETA 1S9DA 1QMIA 1OA0A 3AZQA 4HX2A 2RC6A 4LXHA 3WLPA 3I83A 1EBBA 4Y9SA 1ZVVA 3JR7A 4NBVA 2J45A 3EEYA 3OM9A 5DCWA 4HNAB 2EFEB 1O5TA 4P08A 3CV3A 1AZLA 1KC1A 1OYWA 1Z2OX 3EG5A 3ECAA 2CHQA 2QZJA 2VDOB 3FUVA 5KVSA 1KYZA 4MA5A 4NLLA 4RKRA 5JTUA 3SNKA 4YRDA 5AICA 1QGDA 2J9FA 3K0KA 3OA0A 2CXHA 2IT1A 1X8JA 1NSFA 4K87A 4AJIA 1O96A 3D4LA 3I6MA 5LQMA 5AW6A 1QMPA 1DPFA 3QGMA 3U7RA 1C9MA 1E1LA 5A2QA 5FX2A 2XLCA 4O2RA 2DKNA 2I1QA 1ANKA 3MJTA 2WLTA 4B4UA 2YOGA 4U6NA 1NMEA 1Y8AA 3PFIA 3LDHA 3IUMA 2LD4A 1SQ0A 3TX2A 1ELOA 2Q21A 4RETA 5GJCA 3RIHA 4YR7A 1DXYA 1JA0A 3A4NA 2C5GA 4RAQA 2G1UA 1GXSB 5EFZA 4WASA 4D6XA 5F5NA 1SA0B 4R51A 1SCJA 2GPWA 2QVXX 3NIGB 1EDOA 4H7JA 1V4VA 2UDPA 2CC2A 2CFOA 2IU6A 1OI4A 2J85A 4DTCA 1YR3A 4MINA 5BUCA 1JKJB 1ZN7A 1TVEA 3H7IA 3M9XA 3NDRA 1PLJA 4XD7D 3TVYA 4OB8A 3V80A 1EB9A 1VG0B 4NARA 3HFJA 2FK8A 4PRLA 4YALA 4UZFA 5EXSA 5C5EA 5KYNA 3CVVA 2CV0A 5J2UA 5B30A 1JJ7A 1S3SA 2LPMA 3G59A 3UT6A 5AI4A 1FBNA 4NBSA 4LTNA 4M0LA 3ZWNA 1ODFA 3ABRB 1G1AA 1VPEA 3T4UA 1L1QA 3I0MA 4ZK2A 3KJFA 5AHXA 4AJ1A 5F2EA 2QBYA 2O2CA 4PLCA 4JMPA 1APBA 4CR8A 1Y6GA 4Q4HB 1CY0A 3DYBA 2IZ0A 3R7LA 2OCIA 2J1LA 2X7JA 2IZOA 2CLOB 3JD0A 3T7RA 1DXHA 1I2MA 1T1IA 2EGUA 5LKRA 2BGIA 2A9PA 3ED1A 3GL9A 4LHWA 3Q6MA 1G6KA 3AJRA 3P2JA 4HRYA 4JKOA 1UKYA 3H65A 3T8YA 3DFUA 5KSZA 3G7UA 2RH4A 5DBGA 1H8ED 4R1OA 4AZ3A 3E8SA 5ESRA 2Q6IA 3KJHA 3IWBB 1YDMA 1KAMA 1LTQA 2IEIA 2B6HA 3FUTA 3O38A 4IXWA 5HIIA 1CDDA 1D5CA 1JMKC 3NEAA 2ZUWA 3LQRA 4TSRA 1EHYA 4LHEA 3WL5A 3MTEA 3GC6A 4IINA 4UZSA 4P53A 2HNAA 4P32A 3OURA 4A8PA 4IZIA 3VJMA 3S1SA 4E21A 4OGWA 3D6NB 1QG0A 4WADA 3HYCA 3QA9A 1L7DA 3RTAA 1XNGA 3KNZA 4QPJC 4AN4A 4TV8F 1OB5A 1OXSC 2HJHA 2P2DA 1AMNA 1KI6B 2BR3A 3I76A 1JQ5A 3JALB 4TL8A 4HN9A 2D3WA 2FW0A 1ETHA 4P3KA 2VKQA 2Q5HA 2J9GA 4GNRA 4OK5A 3VU1A 3BMCA 1G8GA 5L3SB 1P44A 4B6EA 2PKYX 5DXJA 3VV2A 1JEJA 1XVAA 1KYIA 1YVDA 2J4CA 3I6YA 3DV0A 3EDRA 4HAYA 4J90A 2OCDA 2XXBA 1QZTA 3BWBA 3GZJA 4NBUA 2NZWA 3GNQA 1UDXA 3OE7A 5DSTA 2JIRA 5LQUA 2RHMA 3A1EA 4Y2TA 3LAWA 3D4IA 1Q1BA 1NP7A 3N05A 4QGAA 4EFKA 5HKKD 2OZPA 1UADA 2V6BA 4ITVA 2HZBA 4I1UA 3H9GA 4BVLA 4UUOA 2C57A 2R3SA 5E7QA 3AY0A 4CT0A 1P7WA 2H3EA 1JIVA 1QQ7A 3L4EA 3M0EA 1QFYA 3MS7A 1IH8A 4NPCA 4N8EA 4PNPA 4FIDA 3RS8A 2WKRA 3DS8A 4BTEA 3IQFA 3E7WA 4BASA 1NPDA 3M6XA 4M0EA 5C4GB 1R6DA 3DB2A 3WX0A 4LWZA 4ZZIA 2R6CA 3MTGA 8LDHA 4F92B 1EWQA 1KJIA 4OSEA 2LDXA 3IMKA 2BMFA 4NULA 3NB0A 2FTKE 1P5FA 5BV1A 2PX0A 3QKUA 1CF9A 2IOQA 2HXSA 3M89A 4BV3A 3TQHA 2OGTA 5GIOE 2PR7A 4F72A 1AUOA 3H3FA 2O7RA 1H65A 1YVUA 2JIPA 1Z5VA 2ZIVB 3D3KA 3ETDA 5A9SA 4FFBB 2ZUEA 2QLJA 5BN5A 3Q0EA 1VHLA 3VO9A 4D1YA 1ZGCA 1ODLA 4TVKA 3UW1A 3P94A 1UP4A 2QXUA 4DZZA 5JARA 3I5XA 1HDGO 1K7CA 1MUUA 2EFCB 4PICA 5CJPA 2ZUSA 3MLAA 1H1LB 1XFDA 4AKHA 3OHSX 4IDOA 3SP1A 3BWCA 4PQRA 3ONVA 2E55A 3O4RA 4E33A 3NALA 1X6VA 5BUSA 1NNEA 5K20A 3QE9Y 2FPRA 1S89A 4RF3A 2UVPA 3ORSA 4H7IA 4JOSA 4KGZA 4LJ7A 1XDUA 1YE5A 3CF4G 2QN9A 3KAKA 1MGOA 4LS3A 4TV9F 1OQAA 3RS0A 3VSDA 3WGZA 1KYTA 1RI5A 2M1ZA 3NQ41 4D96A 1NF2A 2XCQA 3D02A 1UANA 3L8FA 5HS6A 3TMAA 2GXAA 4WN9A 1ZFNA 3BXFA 4I1YA 3TAHA 3OEED 5HS4A 4FOTA 2F1JA 2GJAA 3TW6A 4ZHSA 4J76A 4J07A 2X58A 4BB5A 3PXUA 4KU4A 3C8HA 3RIXA 2FX5A 3AP3A 1P7CA 2N47A 2OB1A 5TC4A 2SKEA 3A3PA 5GMOA 3GLUA 3I32A 3AVWA 3VYUB 3BJIC 4M9UA 2BF7A 1Y6FA 4JUCA 2ZZKA 3G5LA 4ZT7A 3WIUA 1BCSA 4PO1A 1XN1A 4DC1A 5TQ2B 1M8KA 1W30A 3WP0A 4OJTA 4IHAA 3RS2A 1TM2A 1U5AA 4IYRA 3UCEA 5DBFA 5JS2A 3WHKA 1V45E 3T15A 4MJLA 4OSOA 2YHBA 3TCKA 2C9MA 1CY6A 1DAMA 4J2TA 2FLVA 1E8NA 3D3JA 1P2VA 4LC1A 4NZMA 4TLLB 3VR2D 2PRYA 2B1RA 4B6JA 1J9EA 2IYQA 3CVOA 3WV4A 5K8LA 1G38A 4XRRA 3CJQA 1YJ5A 3WWDA 1D07A 1H8HA 3O4VA 1WF3A 3SFTA 3IIJA 5I7EA 3ZV4A 3BT7A 3RWBA 4I1OA 3PFCA 5DTRA 3H4TA 2EP5A 1NQ5A 2QTHA 4MPPA 4DADA 4JB2A 1GRQA 1QP4A 2ZRGA 2QXTA 2Q07A 5L7YA 3FHLA 2H51A 2HJRA 2J9FB 3IT2A 3V1UA 1Q1NA 2OMEA 2XITA 2VT3A 3EOZA 2O5RA 4U7HA 5AKZA 5JSQA 3HJRA 3LYUA 3K71B 3ZGVA 4AFNA 1LLCA 1TU0A 1M1YE 5JXIA 1M3SA 2Q3DA 3U4QA 3OFND 1FK8A 1NXQA 1EFTA 3RUEA 5AOBA 3HJBA 1H5UA 5AHRA 3L7MA 4OREX 3TL6A 4CM1A 4CUJA 4MVJP 5BOSA 5BN1A 1UODA 4PZ9A 5F5LA 3ZDAA 1N32B 1XU9A 5JDIA 4BGEA 3DBRA 1QE3A 4HLDA 1UJMA 4NU5A 4OU5A 4Y6QA 5J58A 2JH9A 1W581 1G291 4ARZB 4ND7A 5C35A 5T4EA 3IDAA 1IWOA 3ETEA 1BYIA 4W5JA 3IVRA 4QSMA 3V4FA 1DRJA 2CVZA 2D54A 1IEXA 4N6OA 1OA1A 1RZVA 1YA8A 3WLNA 3DVRX 1SK8A 4NTZA 1B42A 4Q47A 5CT4A 3SK0A 2Y4NA 2Y77A 5AVWA 5F7JA 3SF8B 1M9NA 2BZ1A 4N0EA 3KVYA 2NPOA 1O87A 5DHTA 1CETA 4LWQA 4IICA 4EFNA 2OV2A 4EHDA 2XGJA 3NUQA 4RORA 8OHMA 3E5HA 2DP4E 3RREA 5ICMA 1QE0A 4JBWA 2PH7A 4H31A 2QBYB 2XQVA 2HOQA 2NO6A 4QJIA 3R0IA 1ZL0A 1KORA 3PZRA 2FN3A 1TOAA 1DAGA 5M7EA 1TF5A 3HLYA 1JLMA 1XALA 3QG1A 4YP5A 3RPEA 3ZGXA 1G60A 2BMEA 4C04A 1G8FA 5C1IA 3L49A 2CVHA 3K9CA 1VDZA 3QOWA 1KMNA 2RGEA 1XQVA 4NG4A 3CRQA 4I6EA 2VJLA 4EJSA 4UNQA 5BSWA 5AW8A 2A5FA 1HM5A 2C61A 4JU9A 4X62B 3LO5A 2ZVDA 4D46A 3NGXA 1JEYB 2NYAA 3PUIA 5CLQA 4PYRA 4X45A 1RABA 3EYWA 1KTVA 3KYIB 5DHRA 4AZ3B 5KVQA 4F86A 5IXYA 1QNLA 3QMPA 1JLRA 1GYPA 2ESRA 3LUGA 3PX2A 4RFSA 4XDHA 1TCBA 3V8PA 5DNWA 5AW3A 4TMVA 2R87A 1E9BA 3QU4A 3L3BA 4MVWA 3ZXIA 4DQKA 2Q5IA 2A8YA 2QL6A 4NH4A 2G17A 2FK7A 1PT7A 2OHVA 3I8XA 1ZKDA 2N1MA 4KL8S 1KEWA 4QJBA 4MXDA 1G20E 2XDQA 1C8LA 1N6IA 2WB4A 5FFMA 3U7FB 4L6CA 3TSWA 3IAM6 4H7EA 3I9NA 5D01A 1BH6A 4MTCA 1OXMA 3ZVMA 1R8SA 3P9YA 3INTA 1QQBA 2E1RA 5H82A 1O94C 1B93A 3BMCB 1W9MA 2W0MA 2H17A 4CMBA 1I3MA 2D0OB 2WUGA 4ALKA 4XFKA 4ZYVA 4RTSA 3FOCA 2RCNA 2AEEA 3IA2A 3DV0B 1F8GA 1UJBA 2BGJA 4ZREA 4A0SA 1THMA 2I3DA 3A9WA 3CONA 5KIAA 1WVGA 3B38A 3WLTA 3ISVA 5DNAA 4K6MA 5ILQA 3TOVA 4BUCA 2HQOA 1YL6A 4WKBA 5CDFA 4B46A 1P0MA 2Q7DA 1PW7A 2BBOA 2F9FA 3GT0A 3OG9A 1P60A 1RWWA 3RJTA 4GR9A 3KUCA 3RUIA 7AT1A 4F1WA 2BDUA 3PLAE 1RMTA 2O0KA 3JYOA 3RYFB 5LZ4A 1Z0KA 1QU2A 1JAIA 4ZVKA 3ZCTA 3U09A 5HFNA 5E7JA 4TXNA 3Q2KA 3LK6A 1UJ6A 1F2VA 1NW5A 4UE2A 4GMHA 3NV9A 3UMMA 5JISA 4LRQA 1NVTA 1JL3A 1P75A 4TSFD 4JI6B 3DOEA 3WQSB 1U5BA 1XHEA 3KX2A 1ILWA 1JAZA 1P4GA 5JSKA 4BHTA 2PXAA 1WKCA 4FW9A 4HXFB 1GUBA 1NHGA 4GF5A 4XWOA 2OBFA 4KP7A 3RQIA 2Y9MB 3M3HA 2X0FA 4M0CA 3VNAA 2UZ4A 4Q1CA 2FMXA 4G81A 1B6GA 3FUUA 5EJ8A 2RH9B 5JC1A 1T1SA 4ZAWA 2IA5A 2NO7A 1G4HA 4X8LA 2AOXA 3RVLA 3AOEC 1LSUA 1WMSA 2QJWA 2W2KA 4A1FA 2GNAA 2HF2A 1KAQA 5A9SB 1CUGA 3O0TA 5BN5B 3FGPA 2VHTA 3P9RA 1M1NA 1DQNA 1IYZA 2J4FA 4M55A 1KK1A 4EUKA 4Q03A 2DGDA 2BHSA 2WAYA 1K68A 1N7GA 1SZDA 2W71A 3OT1A 3ZDYB 5JSHA 3DPIA 4NK4A 1U1CA 2QVGA 1V5GA 2I4NA 4DVGA 1VRCA 3FSJX 3QE0A 3EBLA 1BE8A 3PQDA 4LGMA 4AG3A 1EUCB 4RZXA 4CQNA 4LJYA 3LBHA 2NO5A 3ZGLA 4UUNA 1N2GA 1XWWA 4LKOA 2UVPB 3OE1A 1UYJA 1NWCA 2UUOA 2VDKB 1IBCA 3UXEA 3W1EA 4AN1A 5BMOA 3MWEA 2QSUA 2R1UA 3KR2A 2J0VA 2L18A 2IW1A 5CMLA 3R7WA 1ABEA 1R0XA 4MDHA 1USIA 1OFUA 3B8EA 1NM5A 1T2VA 3HRHA 4AWBA 4EY4A 3PYMA 4JYPA 1G55A 1UDBA 4ALIA 1G7CA 1KPHA 2IYLD 2Y0DA 3EW9A 1KMIY 1ESEA 3A4TA 3ZWCA 2P3SA 1GG9A 1NXOA 3RSCA 3RHTA 3G1WA 4G4GA 2JLBA 5DWQA 4P9NA 1GWNA 4OGFA 4AJ9A 4GQAA 1XCLA 1S1MA 4LK2A 4LMRA 2JH3A 2E6KA 3RS3A 1GFSA 2OL4A 3PGVA 3OZCA 1MZPA 3KUKA 3TSOA 3Q3GE 1KR5A 2O2YA 1NJ8A 4TN5A 1CUHA 1QRAA 1R6BX 2A7XA 1NUHA 3NCTA 4PW0A 3VRHA 1GNLA 5CM2Z 1CIPA 1OT3A 2Q5LA 2ZDGA 3PNSA 4JAVC 3UT5A 4CKCA 4E07A 1J99A 1Z18A 2XI4A 1M67A 1LU9A 4KI7A 2QY6A 3KS9A 3VOAA 1K1EA 5FB3A 3A2LA 4MV3A 3EIHA 5JS8A 2BBTA 4KE7A 5UKDA 1II8B 3E70C 1DUIA 1HT2E 1NG9A 1QB7A 2E2WA 5TVOB 1E0JA 1WNTA 1QWSA 2PL5A 4LDRA 2V97A 4OHRA 3W2IA 5C8YF 2CJYA 1QE5A 1YC5A 2V6JA 2Y71A 1URPA 3LJKA 2ZYSA 4K5QA 2ON6A 2ZSDA 4X7BA 5ALQA 3RR2A 1E1QD 4R2LA 4L8WB 4J29A 5ADWA 2AX4A 3LWNA 3URKA 4GUAA 1TQ4A 2PUJA 4M9CA 3ZDRA 4G07A 5B37A 4KZPA 2H31A 3FYUC 2H1SA 5K8UA 2YV1A 1JPNA 2AV6A 5BOSB 2FG6C 4B2PA 5E1DA 8MHTA 1S2NA 2HU2A 2REBA 1NA5A 1SXJA 3SSAA 1SUWA 5ECYA 5MF6A 1X86B 1GM5A 3WJ1A 3LG2A 4FN4A 5KEIA 3W9UA 1QCZA 4C9BA 3IJ5A 3AF1A 4WNAA 3TDMA 1ZH8A 1L5WA 4NFSA 4CF5A 3IGFA 1OLUA 1QXSA 1WSAA 3A9UA 4DA0A 3BF7A 2ZTUA 3B3AA 1SUIA 4YT5A 3A1UA 3UG6A 4G0YA 5K0TA 3I2IA 3WLAA 1Q19A 1KZ1A 1W88B 4JELA 4QUAA 2GCOB 2BEVA 2UVDA 1QYXA 9LDBA 3I0NA 3LLSA 4R8MA 1T6XA 3AB7A 3IS3A 4FBLA