4YWJA

Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
MRRIAVVGAAGRMGKNLIEAVQQTGGAAGLTAAVDRPDSTLVGADAGELAGLGRIGVPLSGDLGKVCEEFDVLIDFTHPSVTLKNIEQCRKARRAMVIGTTGFSADEKLLLAEAAKDIPIVFAANFSVGVNLCLKLLDTAARVLGDEVDIEIIEAHHRHKVDAPSGTALRMGEVVAQALGRDLQEVAVYGREGQTGARARETIGFATVRAGDVVGDHTVLFAAEGERVEITHKASSRMTFARGAVRAALWLEGKENGLYDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
total genus 79
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4ywjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ywjA01
1GQYA 1QORA 3NTOA 4NFSA 5CP8A 2O3JA 5A3JA 4HFJA 4TVOA 4CMJA 3GF4A 2HMSA 3DMTA 4FCCA 3TDKA 4YRDA 1LEHA 1TVEA 4R5HA 1C0IA 1C0PA 1ID1A 1SB9A 4HFMA 4RLSA 4ESOA 4BKUA 3LLVA 1Y8QB 1F8GA 4QO8A 4FBGA 3C8MA 4WOJA 4OGWA 4JP2A 4H15A 3KBOA 2EKPA 4HNGA 1I2CA 5JDCC 4P8RA 3WBBA 2V7PA 5LDHA 1CYDA 4D43A 5L7TA 4BUCA 4J49A 3ZNNA 5T64A 1B16A 4HFRA 4KUEA 2FR1A 4AJ1A 2WYUA 1HDOA 1KBZA 3DXFA 4YQZA 4AG3A 1H6DA 5DN9A 4E4YA 2VRBA 4RF4A 1YBVA 5F5LA 3DZFA 4ALIA 5DF1A 4Q3AA 4W9NA 2VHVA 4KWHA 3GOHA 3DHEA 4G5HA 3JQ6A 3EZYA 1KC3A 4UUOA 3I9KA 3PHJA 4J1QA 2JFFA 5COQA 3QRWA 4BO6A 4ALMA 3DB2A 4XDYA 2UUOA 1PU2A 2ZK7A 1C0KA 3OHSX 1AN9A 4RVFA 1D8AA 3VVBA 3AFMA 4CR6A 3VH3A 5HTOA 2CF6A 3GZNA 2DVMA 4XYLA 1VC2A 4DC1A 2NU9A 3F9IA 1RM4A 4GVLA 3N74A 1YVEI 3M1LA 2FMUA 4I9UA 1SMKA 1YL5A 4ZICA 1UJMA 4OKIA 1D7OA 1NPYA 1GYPA 1X7HA 5GMOA 2JCYA 3QVWA 2JHFA 1AXGA 2VT2A 4ND1A 4PLZA 2FR0A 2X58A 3ZV6A 2CUKA 4URFA 1BTOA 2FWMX 3Q0EA 5AOVA 1YBMA 1VI2A 4B4UA 2CFCA 4ID9A 4I5GA 2VOEA 3HN2A 3JQ9A 4OJNA 2G5CA 2W2LD 4ZQEA 2X5OA 1IY8A 5DZSA 1KEUA 5IDWA 4FS3A 1B15A 3EAGA 2AHRA 4IJUA 4ZQGA 5G0VA 4EUEA 2G76A 1YWGO 1SEPA 2IDZA 4MO2A 1U1IA 1O9BA 2VTEA 3RC7A 3FPLA 3GEDA 3F4LA 1PGNA 3DONA 3BHMA 3H8VA 3VOSA 1EK5A 4Q39A 4YDRA 4Z9XA 4A7PA 4QTZA 1ZJYA 3O8QB 2J3JA 2X0IA 2Q4EA 3RROA 1E5QA 2B5WA 3GVPA 3NDJA 4J3FA 5BSHA 2UAGA 2BH9A 2FPPA 4BOYA 1DIAA 5A9SA 4K6CA 2NVWA 1LJ8A 5A4DA 3V2UA 3DOOA 4FFRA 4HP8A 4GI2A 1GU7A 3AUTA 1Z6ZA 1BXGA 1KVQA 3AOEA 4OYRA 1OC2A 4YT5A 5ICSA 5IDYA 3VH4A 1FDWA 2X23A 2V65A 2CVOA 1Y9AA 3F1KA 1NYTA 3A06A 4R01A 3L0DA 2PD6A 5H81A 3D0OA 4IDCA 1PGOA 2DTEA 4L75A 2ZTVA 5T8KC 1I36A 5BNTA 1QLJA 2EERA 3OQ1A 5T6BA 4PLPA 3WLFA 1UAYA 5I8WA 4ONEA 5G4KB 4BO4A 2D2IA 4R4JA 4J0EA 3VC7A 4BO0A 4WEOA 2NU7A 3TWOA 5HS6A 2Y1OA 4PZEA 4HBGA 2YZ7A 1P44A 4J7UA 5CPFA 4AJ4A 3AY6A 1YQGA 1NFQA 4EI2A 3ANNA 2VYNA 1ZUD1 5AXDA 4DIFA 1U3TA 2CZCA 1E1MA 2B4QA 4NK4A 4DVJA 2EIHA 4NQZA 3SX2A 4ZVVA 5CDUA 2DFVA 2ZQZA 3MWEB 4IDBA 1GPDG 2X6TA 4M55A 3AY7A 4FFPA 4OOFA 2CSUA 1KYQA 1Z74A 1LLUA 2ZQYA 1B3BA 4LVUA 4CMIB 1E7MA 2DPHA 1T25A 4GVXA 1I0ZA 1P0CA 1T2AA 4B4WA 5L95A 5JCJD 3T7CA 4FFNA 4D3FA 4R5MA 1ENPA 3C7DB 4CMKA 2OOSA 4IDEA 3VTFA 4E2YA 4UUNA 4IMPA 1J6UA 1NM5A 3W4JA 3CXRA 3ENNA 3Q2KA 4O59O 3RUAA 3DZJA 3RC2A 3IS3A 2HUNA 2O7QA 3WBFA 4BIIA 3NDRA 1CJCA 1LLCA 2DUUA 2X5KO 5KVQA 1KY4A 1I8TA 3I9JA 4G81A 1T2CA 3S2FA 1MXHA 4KZPA 2NU8A 1CQIA 1HTBA 2BI7A 5THQA 5A5FA 5ILOA 4P4LA 2V6FA 3E48A 1PJ2A 2PFGA 4WJZA 6ADHA 3EZLA 4DYDA 3OJEA 3GLQA 4F6LA 1N2SA 1YB1A 3GPIA 4M49A 3PRJA 4KWIA 3MEQA 3FNHA 4YCAA 2HAEA 2D3TA 4BGUA 3DFZA 4E6PA 4ND5A 4MVJH 1HF3A 1HETA 4D79A 3AJRA 4NH4A 3HG7A 3VPXA 4CMIA 4DTIA 4R9RA 1T26A 4UEJA 3RWBA 1LQTA 4RVHA 4J1NA 2EXXA 2B5VA 5KOIA 3E9QA 4YWJA 4RVUA 3WIDA 4BO3A 2W2KB 1DBVO 1VL6A 3W8FA 1WDMA 1DPGA 5CEEA 3L4BA 3WIEA 1ZK2A 1CDOA 4GSKA 3IUSA 4EDFA 3JQBA 1H94A 3AFNA 4QECA 1N1GA 3WYEA 4ALNA 4ALKA 3D1LA 3CINA 3PI7A 2CD9A 3QWIA 2WSBA 1VKOA 2QZZA 3GN1A 1SNYA 1JKFA 1E3LA 2JKVA 3JTMA 3PDUA 5JAIA 5JYDA 1X0VA 5B4UA 3PXXA 2B4TO 5IXSA 2PY6A 1P3DA 1XQ6A 4JBGA 3LZ6A 4RL6A 1ZMOA 1J5PA 1Z82A 5A05A 2CVZA 3OM9A 4R54A 1U7HA 2PZKA 3KM0A 4L73A 1GPJA 3R3JA 1HWYA 1UXHA 4RPJA 5DCWA 4YAJA 2B35A 4KDEA 3V1YA 1XWFA 4XR4A 2D59A 1Q0QA 3INGA 4DQXA 2HK7A 3TZCA 2VYVA 5CDGA 3RJ9A 1EUZA 4BO9A 4GMGA 2ZB8A 4U0KA 5FYDA 4IGFA 1PR3A 3GDFA 1CETA 1KEVA 2FZWA 2D8AA 3NTQA 1MFPA 3T4XA 2D0IA 4QUKA 4TQGA 5L51A 2A4KA 5IN5A 1NPDA 3C24A 4LRSB 1OC4A 3FRJA 4TRRA 4PIVA 3DBHA 3OETA 2HLPA 3T4EA 2PGDA 4O63O 3O03A 2YJZA 3ETDA 5KVVA 3FBGA 3OMLA 4IIUA 1HDYA 1R4MB 4B79A 3WGIA 2H1SA 4EZBA 1ZK1A 1KC1A 1H6AA 1HYEA 3K9QO 2ZTLA 1NQOA 3I1JA 5B37A 2V6MA 1L7EA 4ZQFA 1PJ4A 5U9CA 1DC6A 4W99A 1ENZA 1BW9B 2YDYA 2Q2VA 1O6ZA 3ZDFA 4OAQA 5EERA 2EW8A 4MVJG 1VL8A 3JQ9C 5KKAA 4FJ0A 7ADHA 5TT0A 3CH6A 4TKLA 3DDNA 1WDLA 2HO5A 3V8BA 4JXKA 3CE6A 2DTXA 5A06A 5ER6A 5FEUA 5KJFA 3IOYA 3NTRA 4GX1A 1E3JA 3W6UA 3VZRA 3TOZA 2C20A 2I9PA 4ROSA 1RM5A 3L9WA 3TQHA 2NNLD 2I5PO 1P9LA 1L1FA 4R69A 3CEAA 4EW6A 1Y5MA 3S55A 4TZKA 1ZH8A 1YH3A 4Q3DA 2CDAA 3OICA 2XXBA 5I7VA 1BVRA 2AEJA 1O0SA 4JJFA 1B0AA 3KEQA 2GYYA 3EVTA 5COBA 4NIMA 1MP0A 3VH2A 4BNXA 3PQEA 4BMNA 2WTBA 4Q3NA 4GX5A 4DGSA 4RZHA 4IJWA 4WE3A 3U4HA 2R6JA 4II2A 4INAA 1ADBA 1Y8QA 4D41A 4MKZA 3F5SA 1PL7A 5EN4A 3UCXA 4E3ZA 1PWZA 4JK3A 5F21A 3ICPA 4RVGA 1U2DA 4CUZA 2C5AA 3AI3A 2PD4A 1A4IA 1C1DA 3JQDA 3BMCB 3S2EA 5DOVA 4JROA 1WXDA 3P19A 1E77A 2HK9A 4Q3CA 1S6YA 1LRJA 2Q1WA 3K2EA 1SB8A 4BB6A 3AOGA 3P7MA 1WMBA 4ZQBA 2VWQA 4J4TA 2FY8A 4YJHB 4C7KA 2JD0A 1YRLA 3ADOA 2UV8A 1YDEA 3RBZA 1YQDA 3M2TA 3PGXA 4MKRA 4N5LA 5DNAA 2D5AA 4GSLA 3ROPA 2C5EA 3JCZA 3RU9A 3NUGA 1E3WA 4Z6KA 3P5SA 1H2HA 2OBYA 5TT1A 1ZJZA 1CQJA 4TROA 2ZB7A 3PYLA 3LC7O 3ICCA 1OBFO 4LCJA 1ADGA 3KSDO 5JYAA 1EQ2A 3PQDA 3GQVA 4B4VA 5JXWA 5TRTA 3G49A 1DHTA 4UAGA 3IP1A 4DLBA 5CFZA 2OP0A 1GEEA 1WLYA 1R0SA 1Y8RB 4E2XA 1NHWA 1NVGA 1FJHA 4J1SA 3ULKA 1DC5A 3FCOA 1EUCA 3K8ZA 1NTOA 3HDQA 4WNCA 1R6DA 3ASUA 3AM5A 4BHTA 3JSAA 1SOWA 3BMCA 1SAYA 4CMEC 4CM9A 1NXQA 2P5UA 2VZ0A 4UVHA 1I30A 2PK3A 4M86A 4JP3A 3I9MA 3WNQA 4CM9D 1P1IA 2GASA 1VLLA 2YHUA 4Z3KA 1PJSA 1Y6JA 3D4NA 3ZNPA 4NFYA 4NG5A 4LSWA 1F06A 1ML3A 4XZ3A 3UHAA 1I3LA 1P31A 2EP5A 1X14A 1HLPA 3SC6A 1GEGA 4IDFA 2X0JA 3GT0A 4PVCA 5TGDA 4TMFA 2I6TA 1E3WB 3KV3O 4YA6A 1YONA 1YQXA 2Y1FA 4FFLA 1V6AA 4BL5A 4PLHA 3H9GA 1ZVMA 1QYVA 1D1SA 4HXYA 3DMTC 4WCFA 3W8EA 3R6DA 4YRBA 4RQUA 4DRYA 5C3MA 2WYWA 4WECA 3O8QA 1JKIA 1NVMB 2D5CA 1GZ4A 1PZHA 3JYNA 3QW2A 4BNHA 5JY1A 3BMQA 3STHA 4L4XA 4FGWA 2Q49A 3I9OA 2YHIA 1UZNA 1PGPA 3BTOA 5BQFA 2D4AA 1E1LA 1LBEA 4MP3A 3U62A 2DM6A 1JN0A 4XCVA 1SZJG 1LRLA 2IODA 2P2SA 4PG6A 1X0XA 1G0NA 5DDIP 4I5DA 3RJ5A 4D3DA 4YAEA 3G0OA 1ULSA 1N7GA 5A3VA 3GNQA 1P1RA 4I08A 3O38A 2Y0CA 4YEDA 1PJTA 5JPIA 3WMWA 3MCVA 1BWSA 1YS4A 2JL1A 4GKVA 3QA9A 2J3HA 1ZEMA 2BFPA 3I6QA 4PLGA 1N5DA 4GH5A 4QO7A 4A2CA 1D1TA 2NTNA 5J9GA 2CVQA 4XEHA 3RUDA 1ZMTA 3F46A 2HRZA 2X86A 3H4VA 5CHEA 4PG4A 4R16A 1VJTA 3UAGA 1K3TA 4BO1A 4EUFA 4HNHA 5EESA 2E37A 4Z3DA 2Y68A 3HQ4O 4I1IA 2W4QA 2FPIA 1NAIA 5FF9A 3I52A 3RFXA 3GVIA 1JLLA 3ZW8A 3BA1A 2CDBA 3DQPA 1GZ3A 1Q1NA 2VNAA 4FC6A 4E0BA 3D64A 3LU1A 2GPTA 4OM8A 4MVJE 8LDHA 3UICA 2WD8A 3RUCA 1NHGA 1U3WA 5K6AC 1ZK4A 5JC8A 4NBWA 5KJCA 3TFOA 2AE1A 4NFHA 2NSDA 1JKJA 2RHCA 4ZD6A 4OSOA 3ONEA 4FGSA 1PTJA 1XEAA 1G1AA 4Z0PA 1EZ4A 4OIMA 4BNFA 1R12A 2AA3A 4M8SA 1EK6A 4NDNE 4EJMA 1UUFA 7MDHA 1PZGA 4I9NA 4ZRNA 4BNMA 4YAKA 5BNFA 1NR1A 3PTZA 3BMNB 1ZKMA 1P74A 2VTDA 4BKPA 4UVEA 5U1PA 4NR0A 4R51A 3I5MA 3VPGA 2A9FA 2IYOA 1U4OA 2AW5A 3CKYA 3WWYA 2X0NA 2J3IA 3IP3A 3K5PA 4CLRB 1GUYA 3JQEA 3EDMA 1ZXLA 4U7WA 2HJRA 1DSSG 1HYGA 4W9NC 1U28A 2VYND 4RPGA 1B8VA 1IE3A 2C0CA 2DBRA 5G0TA 1GV0A 4E5YA 5EPOA 4J4BA 2GLXA 1HSOA 1V35A 3ZV4A 5G4LA 3BMOA 4ZQHA 3E03A 4GPD1 3ZU5A 4NNJA 1YE3A 2BGLA 4BMVA 3IC5A 1RM3A 1H9AA 1MXFA 3ZNOA 3NT5A 5JDIC 1PL8A 4I9HA 1M75A 2DC1A 3KSUA 3WX0A 1GL3A 1I3NA 1W4ZA 2PA3A 4L4RA 3V5NA 1LU9A 4YR9A 2VOJA 3G3EA 4TRJA 5CAEA 4BS9A 3O4RA 5F3RA 1ONOA 5T57A 3WQRA 4WLNA 4DUPA 3HB4X 1UP6A 3WICA 3DZBA 3ZWNA 3IUPA 4CR8A 5JAZA 3RFVA 4CQLA 5KCZA 1IYZA 2C2XA 5AXCA 2VWHA 5F5NA 2DQ4A 4KUGA 1NP3A 1E3SA 1ZCJA 1PS9A 4R1NA 2VRCD 4JGBA 5DBFA 3S2GA 2BFMA 4EJ6A 4PLCA 2WJPA 5EQDA 4BNLA 1DIRA 4W4TA 4JLWA 2O23A 4WLUA 3H9EO 3A9WA 4IS3A 1DJQA 4CLHA 2CDCA 1BXKA 1LX6A 1ZNQO 4XB2A 2UVDA 3ZN2A 3VKUA 1IPFA 4MVJA 3UXYA 2PNFA 3P2OA 4B7UA 5ITWA 1QRRA 3GHHA 1T4BA 3DR3A 1YO6A 1YXMA 2AG8A 3PVZA 2EF1A 4IGEA 4D45A 1DLIA 2GN9A 5ITVA 2OFPA 1B26A 4FJ1A 1IUKA 1DXYA 2W98A 3OBBA 2HRBA 2Q2QA 4PLVA 1BVUA 3ZWYA 2I3AA 4BNJA 4M87A 5JW6A 1GDHA 1PSDA 1WW8A 2Z95A 4J7CA 3AY3A 3E82A 1PZFA 3QWAA 1XHLA 3O26A 5LCXA 4CQMA 1Z73A 1MC4A 3AM4A 4CQLB 3ZWXA 1IHXA 1T2EA 3EUWA 5IN4A 1JVSA 2P9GA 3PJFA 3JQ7B 2RHRA 5TS3A 1HZZA 1DFGA 3TNLA 1CIVA 3ZWPA 2WD7B 4FQ8A 1QMGA 5JMWA 1PGJA 1OAAA 1BRMA 3C1OA 2O2SA 3R1IA 3WGYA 1VJ0A 1UXJA 3GUCA 3SBOA 5G0SA 3VTZA 2WDZA 4QXMA 1ISGA 3L07A 3FBTA 1R37A 4WPGA 3I4CA 3H5NA 1HE2A 3IIEA 1H5QA 2R00C 2FOIA 3PWZA 5BSEA 3KYBA 2YY7A 1GYQA 4Z9FA 1CRWG 3PWKA 2YV1A 3E8XA 4PRLA 5T8KA 1I2BA 4UVGA 3G1TA 3E9MA 1CEQA 4CLOA 1T4DA 1NWHA 1WPQA 1SO8A 2QG4A 1HDCA 2P9CA 3D7LA 1B14A 2AQIA 3KTDA 3WR5A 1HLDA 1MC5A 1UXGA 2HDHA 3ZWMA 4RZIA 1H9BA 1NX6A 3DBVO 1J4AA 2GF2A 4FIZA 4MP8A 1E7SA 4TVBA 4R1UA 4MVJM 1UP7A 4OHUA 1F12A 5JDIA 4XJSA 1YDWA 1RYDA 3RC1A 1MLDA 4NBVA 3H9JA 4N5MA 1JAYA 4YJDA 2VCYA 1A9ZA 1NPTO 3ZHZA 1H6BA 2IZ0A 1LA2A 3EYWA 1NBOA 3CZMA 3DBLA 5DBGA 5AVOA 1BSVA 1EVIA 2EHDA 1HE4A 2OO5A 4O1MA 3W6ZA 3G1UA 3Q3CA 2P91A 3ZV5A 5I7EA 1N1EA 1DB3A 3MJCA 5FI5A 1QP8A 4PN3A 1E5LA 4OOEA 2GN4A 4RLHA 3NT4A 3K6JA 3MZ0A 2NTJA 3HWRA 3HFSA 1ZK3A 4U8GA 1I5RA 1U9JA 3MOGA 2YFHA 1R4NB 4XIJA 2J6IA 3DL2A 2VT3A 1YB5A 2I76A 1MB4A 1OOEA 2C07A 1MV8A 4CM4A 4AJEA 2PGJA 1DOHA 4X54A 3OQBA 1DIBA 1Z7EA 1CERA 5G4KA 1E7QA 1KEPA 2O4UX 4RDHA 1Y8RA 5H82A 5C7LO 3JYOA 3S1LA 2C2YA 3Q6IA 4N54A 4ILKA 4HUJA 1DAOA 3MJSA 3U4IA 3PZBA 1K89A 4ZJUA 1T1RA 3DBLB 1VPDA 2ZTMA 3VKVA 3FR7A 3OQ6A 2PKQO 3JQ8A 1FMCA 4YT2A 4K9DA 4CM5A 4XKJA 9LDBA 2AEMA 4CLXA 2PV7A 4CM8A 4Z9YA 2IXBA 2GZ3A 2Y67A 2HK8A 3AW9A 4YT4A 4P4GA 3M6IA 3BHJA 2Q1SA 3GDGA 3X2FA 4GAEA 2H9IA 4GX0A 3GA0A 1KEWA 1MFZA 3N7UA 4R3NA 1LDEA 3FR8A 1GY8A 1SBYA 3A14A 4J9UE 1HZJA 2Z1NA 4CUJA 4GLOA 2NV6A 4J4HA 3GZNB 3DZHA 1VRWA 1TT7A 1QLHA 4LRTB 2QRJA 3LSYA 5EINA 2BLLA 5F1OA 1UXIA 2VZ8A 4PRKA 1KIFA 2O3UA 1ZBQA 4BNYA 4C7JA 4EUHA 2Q3EA 1JTVA 5ENDA 4A0SA 3MJEA 3OJOA 2OHXA 1VM6A 3CTMA 1S7CA 4CM1A 2NACA 1GCOA 5COAA 1DRVA 4DPMA 1LSSA 3EY4A 4CLDA 4PCVA 5IZCC 3L9XA 3SEFA 4BNZA 1DEHA 1I33A 2AG5A 2BKAA 4AJHA 3ZHBA 1YKFA 1DLJA 1GQ2A 4RF3A 2C29D 2I99A 4HFNA 2YUTA 1JWAB 1M66A 3ZWAA 3GUYA 4CM8B 2XF8A 3WGQA 1OI7A 4YB8A 2I3GA 4D46A 4IBOA 1R16A 3FTPA 1LLQA 5T5QA 2Q99A 3PHGA 2C59A 3PHIA 5A02A 1MGOA 3QLJA 5A9TA 5A9RA 1ZXBA 3HJAA 1V9LA 2NQ8A 3LF2A 3PP8A 1DIHA 2I66A 3ZW9A 5G0UA 4AL4A 5JBIA 1K6JA 3R3SA 1GV1A 1WWKA 3ENKA 4N5NA 1LC3A 3HE3A 4QEDA 4ALLA 3D3WA 4E31A 1QYDA 5AQ1A 3L6DA 1YJQA 1ISHA 4L74A 5CDYA 4CPDA 3WOHA 5JMPA 1QG6A 1HL3A 4E5NA 3ST7A 1PWXA 1U8XX 2JAHA 4MPDA 2G1UA 3IKTA 3HDJA 4J90A 3GG9A 3JQBC 5K0ZA 1A72A 3KO8A 3MJTA 4K26A 5KKCA 4EYEA 1TLTA 3JD3A 4IIVA 4ND2A 4XQ9A 4FJ2A 1BXGB 4FFMA 4YACA 2IZZA 4PLWA 3DTTA 1QYCA 2RAFA 3PGJA 3ZU2A 2TMGA 3UVEA 3GRPA 4NHEA 4U6SA 4UULA 4XRRA 2Y1GA 1ZEJA 3WS7A 5TQVA 1EUDA 4NZ9A 3OP4A 4F6CA 2ZCVA 5JAMA 2GN6A 5MDHA 1DC4A 4GQAA 2EJWA 1PGQA 4LSMA 3ZWOA 2ZJ0A 3KXDA 5THKA 3MJVA 1HDRA 3K73O 2Q50A 4MOWA 2QYTA 2YV2A 1LSUA 1PS8A 3GG2A 1R66A 1A9YA 1X1TA 1W73A 1WAMA 1PJCA 4UREA 3EGOA 5FFFA 3FNGA 1K5HA 4F46A 3E1KA 5KTKA 4BKOA 1HKUA 4XYBA 4CV3A 4RVSA 3SXPA 2DUWA 5I7SA 1QKIA 3GNSA 1Y5RA 1E1KA 3ANMA 3QIVA 4CL3A 2X8LA 4NU5A 5JCJA 3B70A 1AGNA 4WEQA 1ISFA 4L0QA 2OORA 3PIDA 2E82A 4DA9A 2WWRA 1EFKA 4CMCA 2VYVD 4E2ZA 4AJJA 3ZWWA 5I9NA 2PZLA 3P2YA 3UKOA 2ET6A 3VZSA 2E4AA 4C4OA 1H93A 1DAPA 1ONPA 4IY1A 4UVDA 3WYCA 4BNKA 3DBRB 3E9NA 3ITKA 1BW9A 3DHNA 4GGOA 4A27A 4BGEA 4HX5A 5JNLA 5FWNA 4WLOA 5BSGA 2EKQA 5TLSA 2VWPA 5L45A 3L4SO 1Y1PA 1AE1A 1VSUA 1BHSA 1M76A 5G2OA 3MWDB 3ZCXA 3W4KA 4JIGA 2X22A 1HDGO 1YGYA 1UDBA 3U5TA 3HSKA 1GYRA 1V3TA 3D5TA 3GGGA 4E30A 4YYZA 5LDGA 4HY3A 3WLEA 3GDOA 4QT0A 1PIWA 1V3UA 2FHSA 1RWBA 1YL6A 1WDKA 2GSDA 3LK7A 3QE3A 4YT8A 1PEDA 2GRAA 4RVDA 4L76A 4DYVA 2VNSA 4E5PA 1H0KA 1GR0A 5JCXA 3AWDA 5CG2A 4AFNA 2O2YA 3H3FA 3DZIA 1VL0A 3ADPA 4G2NA 2O3RA 1ISJA 1GAEO 3B1KA 5L9AA 2EEZA 5TX7A 2WMDA 3JQAA 2Q22A 2A35A 4RORA 1IB6A 3EMKA 3AUSA 2HKIA 4HKTA 4NBTA 5T67A 1LNQA 2GN8A 2HQ1A 4EEZA 1ADCA 1G0OA 1IPEA 2ZYAA 1T24A 3WGHA 3C3XA 4BNWA 5IDXA 5H83A 1DDOA 5GZ3A 2ZJ1A 3NJ8A 1ORRA 4YVFA 1JW9B 2AMFA 4WLFA 1TT5A 3A28A 3SLGA 1VJ1A 3QHAA 4DBZA 2OGUA 3TN7A 2IYPA 1XDWA 2JAPA 3QVSA 2BFOA 1I32A 1HXHA 4IJKA 4DWVA 1PQWA 1Y81A 3OIDA 2JD1A 3V1UA 2AQKA 2I65A 3GVCA 5HWSA 3Q9NA 3VZPA 1NFRA 1ZIDA 4U0JA 4CV2A 4CV1A 3H65A 1Z45A 3AUAA 5I9MA 3JQAB 3F4BA 3GN2A 4B3HA 2E6UX 2X4GA 3LDHA 1PQUA 4IZHA 1DJNA 2B36A 3CUKA 4YTEA 1PX0A 4RPKA 3QP9A 1EE2A 5CDTA 2EGHA 2RBEA 4MIOA 3A1NA 4LGVA 1RKXA 4IUYA 1SPXA 4K6FA 3QSGA 3ZU4A 4QSMA 3QJ5A 3H3JA 3G17A 3TL3A 1E7WA 2QRKA 3ZV3A 4HWKA 1EEHA 4E13A 3AU8A 3A4VA 2DBVO 4I5EA 1BMDA 1DHRA 2JFGA 3WJ7A 2H63A 4XGNA 5JDCA 3QV1A 4L8VA 1Q7CA 3LLSA 4QQRA 2GDZA 3QVOA 1F8FA 4GBJA 4LK3A 4XGKA 1DIGA 4EGFA 4WKGA 4XQGA 4JBHA 3F1LA 2AE2A 4CLOB 5ER9A 4CMHA 3WQQA 1RM0A 5DULA 4GKBA 4GWKA 2FP4A 3M1AA 4KDFA 3WFJA 5KIAA 5TF4A 1LUAA 2G0TA 3DFUA 4Y6SA 1ONNA 1HDZA 1W6UA 4J91A 2WEKA 4L4SA 1NQTA 3OJ0A 3JQFC 4A26A 1N9GA 4RV9A 5KNLA 2W8ZA 2OMEA 4FC7A 3LT0A 1MA0A 1Q0LA 1HSZA 3KUXA 3JQGB 3ZHYA 1UZMA 3GH3A 4PLYA 1UP4A 2O3QA 1U8FO 2Z1MA 5JLAA 4A73A 4BVAA 3GMDA 1YBAA 1R15A 1BGVA 2NM0A 1O95A 4MVJI 2WE8A 4AJIA 5GY7A 1B2LA 4KTTE 3LC2O 1NVTA 1N7HA 1YB4A 5DP2A 4YBZA 2DBQA 3HUDA 1B8PA 3DMYA 3NGLA 1VSVA 1BXZA 3TZQA 1O89A 5IG2A 2VZ9A 3KZVA 1FDVA 2PGLA 3FN4A 4IINA 4QX6A 4E32A 4DBVO 1QYXA 3AK4A 2YW9A 4LISA 5EJ2A 4YRAA 4MJLA 1C14A 4ZU3A 2O4CA 1U5CA 4Y9DA 3KLPX 2A94A 4CMBA 3Q9UA 2DAPA 3PWSA 5DOZA 3QVTA 3JD4A 1RPNA 4IDDA 5ADHA 3H7AA 4QFCA 5I8ZA 1GUZA 1I3KA 4WLVA 2Q4BA 2VUUA 1JVBA 3T7EA 2BF7A 2BGKA 2JFHA 4MVJF 2ZIZA 3LF1A 1PL6A 3SLKA 1HRDA 1J49A 2B37A 4P22A 1XQ1A 4R68A 3N58A 5CEFA 1HT0A 3B1FA 4DMMA 1N9GB 2DU8A 3JQGA 1P45A 1ARZA 3VAZA 1Z7BA 2Y1EA 3NV9A 4UUMA 5LC1A 1O8CA 1XU7A 4E33A 5B12A 1RJWA 3GEGA 2Q2WA 4CLEA 3JQ8B 4Y98A 2HMUA 4NBRA 5IDQA 3H2ZA 4HADA 4J2HA 4YJHA 1A27A 3KYCB 2G17A 1UDCA 4BO8A 4E5MA 4XRGA 1GTMA 3L6OO 2DT5A 4BGIA 2HMTA 1DO8A 2VHWA 5A04A 3JYLA 4IDAA 1RYEA 3RVDA 2X9GA 1QYWA 3I9NA 2GZ2A 9LDTA 2ZKLA 3PYXA 1P77A 3ABIA 4EEXA 4ZHSA 1AHIA 3E5RA 2Y1CA 3AOEC 3OSUA 3WMXA 3DC2A 2PZMA 2Q46A 1Y9EA 4O5OA 4TWRA 3PHLA 5JO9A 1NQAO 5JC1A 4XQEA 3GC6A 4R41A 1LRKA 2H5LA 2HSDA 4JJGA 1YJ8A 4IQ0A 5IFLA 3FNFA 2F1KA 5L40A 1KVUA 3KVOA 4BNUA 3GFBA 4NK5A 4ZRMA 3TZKA 3VDQA 4IM7A 1ZSVA 3OEWA 1EMDA 1EFLA 4YJFB 1LSJA 3GGOA 4S1VA 5G0WA 3GRKA 4DPLA 3ZH2A 5KVSA 5J23A 3D5QA 1IL0A 2P4QA 3U0BA 5B4TA 3DOJA 2PD3A 2O3SA 3BMNA 4O0LA 4PLTA 4I8XA 4RDIA 2YQ4A 4MIEA 2VHZA 4II3A 2LDBA 3JQFA 4MKXA 2C54A 4GL4A 1KY5A 3UH1A 4GX2A 5KJ1A 2IRWA 4WCFC 1O94A 1GCUA 3B1JA 5IF3A 1ZSNA 2VQ3A 2NVBA 8ADHA 2PKQP 3INRA 3LT1A 3WG9A 4DQVA 2C7GA 5MGBA 1X7GA 4CLRA 3C7CB 1A71A 2YFQA 1IZ9A 4IQGA 1O5IA 3ROMA 3HZZA 2X5JO 1C3VA 5IXYA 5KWEA 1LTHR 4Q3EA 4Y6PA 5JS6A 1ISIA 4M1QA 2RH4A 3D3WB 1M6WA 3RQSA 4IQ8A 1GQQA 4OL9A 4GWGA 2J5RA 4XGIA 4FW8A 1D4FA 1ZO8A 1UZLA 3E5MA 3W8DA 3TZ6A 3WGTA 3ETGA 4UVIA 4NU6A 3NJ4A 3DAFA 4M54A 3INTA 4DPKA 2B83A 3ZWCA 3ZGYA 3E6AA 2J5KA 4PVDA 2B4RO 1HYHA 4YJFA 4OXKA 2DLDA 2RCYA 1XGKA 3K31A 4E21A 2X1HA 3WSVA 4B3JA 2ZB4A 1F17A 1PJBA 4PG5A 1SCUA 3WWZA 5KJEA 3CMMA 3TF5A 2XAAA 4AJKA 1FF9A 3DZGA 3VH1A 1JU9A 3JQAD 3IJPA 3GR6A 3DWFA 2V6BA 2FSVA 4D3SA 4U5QA 5K9ZA 2AEFA 2YV3A 3GVHA 1X13A 4Z0TA 5BT9A 1FDSA 2X0RA 5TJHA 2HMVA 4ND4A 3PLRA 2NUAA 2W2KA 4JCOA 5HS4A 1LDGA 2FZEA 2QIOA 5TC4A 3RIHA 3ZZNA 2ZCUA 3ASVA 4AJ2A 4HV4A 3GNTA 4IS2A 1Q0HA 2Y99A 4B3IA 4I5FA 5M6DA 5IJZA 3KLMX 4ALJA 1LDYA 2O3TA 3NDIA 4JN6B 2JJYA 4DIBA 1U5AA 3RC9A 4W82A 4GGPA 1C1XB 3Q2IA 4YJGB 3RUIA 5HM8A 2EW2A 4RPHA 4U6QA 1EBFA 2OL4A 2IE0A 3M2PA 4M89A 1NWCA 2PTGA 2VUTA 1Y7TA 1UXKA 3AUUA 4KP7A 4UEKA 2VWGA 3RUFA 4A10A 2CNBA 2EG9A 3GZ4A 4TSKA 4XB1A 3U3XA 2BELA 4DREA 5L4LA 1IULA 2JHGA 3D4PA 4Q3BA 4R1TA 4BO2A 3PJEA 4BQRA 4JQCA 3FD8A 1MG0A 1GFSA 5C7IO 1OZAA 5DCUA 1P1FA 2X9VA 4IPTA 3RI3A 3VPSA 2BFAA 1E6EA 3VZQA 4KQXA 4YPOA 1Q2XA 4H3VA 3JYPA 3MJ4A 2NTVA 3ZNQA 4CQMB 2D1YA 3H6KA 3IKVA 5ENVA 3BZUA 5AXAA 1H6CA 3JV7A 3OH8A 5C5IA 1MX3A 5GZ6A 1LDMA 3I9LA 4Y8VA 3DO5A 2DPGA 4MVJP 3UOGA 4LW8A 2OBNA 2FR8A 4CJXA 1BG6A 4TRMA 3ZWBA 5HRUA 5C37A 2YQ5A 4R3WA 4TRNA 3UF0A 3WGGA 3QY9A 3OEYA 2W2LA 1I01A 3H5AA 5GZ1A 3KB6A 2B69A 3AI2A 3L4BC 1E6WA 3TRIA 1NAHA 1ZK0A 3FTNA 3PQFA 5TSDA 3UN1A 4LMRA 1X15A 1XCBA 3PHHA 4BV8A 1GUFA 1TEHA 4JBIA 4WASA 3U4CA 1UAGA 1YOVB 4EITA 3GMSA 2W90A 4LN1A 2DKNA 4MIYA 2CF5A 3X2EA 3FWNA 5U4QA 2BD0A 3HHPA 1EBUA 2Y66A 2GCGA 4D7AA 1U7TA 3RASA 1T1SA 1NR7A 2UYYA 1KETA 1XU9A 3I3OA 1PJ3A 4PG7A 3SC4A 3WNVA 3JD2A 2IZ1A 2EGGA 2OP1A 2QYSA 3COSA 3GVXA 4OXNA 3PFWO 1PQPA 5ILGA 5F1KA 4CM7A 5A1TA 4J16A 4BO7A 4DC0A 1XSEA 2Y93A 3RBVA 2BHLA 3OF2A 1KVSA 3BMOB 3K92A 4G65A 2WE7A 1EVJA 4A5OA 5EIOA 4J1TA 1B8UA 4OQYA 1R0KA 3CPSA 2F00A 1SEVA 2WM3A 3ROKA 4P38A 3UW3A 3DAGA 4FPXA 3RFTA 5L53A 1JAXA 1QR6A 3UCEA 2NADA 3Q11A 2VUSA 4WLEA 5JY6A 1R4NA 3K2BA 4K28A 3H9UA 4BQPA 2AQHA 3FPCA 5L4NA 3FNEA 2JD2A 1EE9A 3HDHA 1LQUA 4CM4B 5KVCA 1I10A 5AXBA 2C7VA 2Q45A 1ISMA 4BGVA 1PR9A 1P1JA 1FXSA 1L7DA 1KVTA 4B7XA 3E18A 2XPCA 4NJMB 1M67A 4MDHA 4AJPA 3GY0A 3IDSA 3MTGA 3RKRA 1C1DB 5TJ9A 1FDUA 2HCTA 4D44A 2Y1DA 2Q1UA 1U3UA 2IXAA 3WTCA 1B7GO 1QV6A 1N92A 4FOOA 3PPIA 4UEOA 3WYBA 1DRUA 3PDJA 1QV7A 2OZPA 1P33A 1F0YA 1XG5A 4TZTA 3SJ7A 3V2HA 3DAPA 1LC0A 2RIRA 3SVTA 3H5RA 4AJOA 2G82A 4W7HA 2DFDA 4CQMD 4WOKA 1WZIA 4XJTA 3IJRA 3WB9A 1KVRA 3GEMA 4XYMA 3TFQA 4Y6RA 4RF5A 4RJTA 3NYWA 3G79A 5A5EA 4IMRA 5F1PA 1PJQA 2OXIA 2GUGA 3FHLA 5TIIA 2CMDA 1IZ0A 1AXEA 3SJUA 1EQUA 5DCYA 2POQX 4MP6A 1GADO 1Z75A 4DLAA 3LC1O 4K1LA 4KQWA 4WUVA 4YXFA 1DC3A 2NLOA 3NAQA 3NKLA 1XLTA 4BNVA 1ENOA 4PLFA 4BV9A 5CG1A 2GO1A 4O6VA 4W6ZA 1I2ZA 3HN7A 3NRCA 1FK8A 1EVYA 2JCVA 2VRCA 3HDYA 3JQ7A 1TXGA 2WD7A 2P5YA 1YL7A 1C0LA 4J2OA 3ONFA 3WXBA 4FDAA 4B7CA 3Q1LA 2Y0DA 2ZYDA 4TKMA 4DLLA 1WNTA 4R1SA 3QQPA 1H2BA 4BO5A 5B1YA 4CL8A 1V0JA 1TA4A 2GR9A 4GMFA 5IZ4A 5ICMA 4WK6A 3DTYA 1JA9A 3L6EA 4NPCA 3RD5A 3WSWA 3GFGA 1NNUA 3WQSB 4F3YA 3JD0A 1E1NA 4MVJD 4ZGWA 4JJIA 3DHYA 2DBZA 4XR9A 4AVYA 3QVXA 5ES3A 3C1AA 1PS0A 1XIVA 5BR7A 3NT2A 1HE3A 2Y0EA 4Z0HO 4IXTA 1XYGA 3LT2A 3BHIA 2P4HX 2HU2A 4E12A 3CIFA 4P4NA 4ITUA 3ZHXA 5CEJA 4J7XA 3MOIA 4IDGA 4DIOA 1IOLA 2RH8A 4FB5A 3W4IA 3ANLA 3ROQA 1J0XO 2ZATA 2NVUB 2BGMA 4XX0A 4EJ0A 2WYVA 4FN4A 3WGOA 2BRUA 3BYZA 5I9LA 2SCUA 4J43A 3PJGA 4Q9NA 3ITDA 1TB4A 3KYCA 3RUHA 1HE5A 3I4FA 4NMHA 5KJ6A 3OA2A 2NU6A 5BNIA 4PG8A 3F5QA 4FOSA 4PZCA 4RPLA 1EDOA 5I7FA 5CDSA 3UCFA 5HBRA 2FN7A 1LI4A 4FSHA 2O7SA 1UH5A 4WCDA 4MINA 1V8BA 3HB5X 5JE8A 4RF2A 4BKRA 3CMCO 3B6ZA 2FSSA 4RCVA 2H6EA 2X7HA 2JCXA 4W7IA 2EP7A 1G6KA 4IZIA 4JX8A 4UUPA 1K6IA 2UUPA 2HMWA 4BMSA 3ONDA 3RSHA 2O50A 2QQ5A 3UGKA 3BAZA 3QWHA 4OQZA 1DFIA 1GZ6A 3GK3A 3WFIA 2PKRA 3RKUA 3R0IA 3BTUA 1U4SA 2NVUA 4N7RA 3U49A 4KTVE 1V3VA 3D4OA 4B4OA 1PJLA 1ZZEA 5A9SB 3BTSA 2GGSA 2NQTA 2I67A 5T73A 1ZW1A 3PYMA 4XYEA 4ZA2A 3VPHA 1CF2O 1Q7BA 4CM6A 1OFGA 2EWMA 5EMHA 5JSFA 4IJVA 2LDXA 2J8ZA 4BNTA 1DRWA 1OMOA 3NX4A 3F47A 3OECA 3RU7A 3MTJA 1ZFNA 2QZ9A 4EBFA 3HNPA 1E7RA 2NWQA 1E0DA 4AJLA 1A5ZA 3DOCA 4WNIA 1X1EA 1JDJA 5DT9A 3FF4A 4CODB 2P9EA 1KS9A 3U9LA 3I23A 1R0LA 3PFFA 4OMUA 1KERA 1NQ5A 2A92A 2PH3A 3KETA 4BB5A 2VHYA 4OH1A 3W1VA 3WTBA 4S3MA 1WVGA 3PIIA 4CUKA 3RUEA 2XOXA 1N8KA 2QRLA 3RAJA 3GAZA 3CSDA 3F3SA 3WJAA 4E2WA 2VN8A 2TMDA 1WMAA 3H9QA 5L7WA 3GPDG 2HJSA 4BNIA 1PZEA 1ZSYA 3OJFA 2J3KA 3KEOA 2B0JA 3F6YA 3GAFA 1K2WA 1E3IA 5EQFA 3OA0A 4AJNA 3H2SA 2BI8A 2ZTUA 3U09A 2YDXA 5EL0A 3U4DA 3AI1A 1VE9A 1K0UA 2EKLA 4CR7A 1SC6A 1HEUA 2YYYA 4KUHA 2IEBA 1P0FA 5AYVA 2PWZA 2PH5A 5A03A 2OUIA 4NBUA 4FD3A 1P1HA 2UDPA 4B8WA 2J5QA 3TSCA 1GD1O 3QWBA 1VKNA 5HA5A 4H16A 4OO3A 3ZI0A 4R9SA 1LLDA 5L7YA 4B8ZA 3S2IA 4D0SA 2DTDA 4WCFB 2P68A 3JQCA 4CV0A 1TT5B 3PLNA 5DBIA 2ZYGA 1M6HA 3IQDB 5IZCA 3V2GA 4DMLA 1C1XA 3BXXA 4YJGA 1F14A 1I3MA 3RBXA 3KSZO 5CPBA 4YAIA 4KMSA 4XQCA 1E3EA 3BMQB 1FDTA 4CMEA 3HFGA 3TPCA 4ZN6A 1ENYA 1EVZA 4YAGA 5JO0A 2YHIB 1T2FA 2Y05A 4QFDA 3KOUA 3TJRA 1X7DA 3EC7A 3ZU3A 4XA8A 3PK0A 3WDSA 2PR2A 5DP1A 3ORFA 3PZRA 3C85A 2EV9A 4OXYA 1CWUA 3FWZA 3V1TC 5JFOA 1LDNA 3EVNA 1TI7A 1WP4A 3K30A 4CMGA 2GZ1A 3FI9A 6LDHA 3IL2A 1EDZA 3DEYX 2GD1O 3EW7A 4D0RA 3LVFO 1DFHA 4KOAA 3LT4A 4FFOA 4GLLA 2E48A 1BDMA 1E92A 3TL2A 2Z5LA 1AUPA 4XD2A 3KRTA 4ND3A 2ILTA 4RQTA 4PFJA 3O9ZA 1JWBB 1A7KA 2O48X 2GNAA 4A03A 2AQ8A 3D3EA 5JAQA 2FPGA 3C7AA 2AXQA 3I83A 5L4SA 2E49A 3AU9A 4L9RA 3I6IA 4J0FA 4LCEA 2QW8A 4N18A 3KYDA 4XYGA 2V6GA 4BNNA 1UDAA 4BKQA 3L77A 3PJDA 4H7PA 1MG5A 1XKQA 1A7AA 3PEFA 4DXHA 5TNXA 1YOVA 2ZB3A 5K6AA 1U3VA 3BIOA 1B3RA 3KHUA 2XXJA 4LMPA 3NEPX 1LXCA 1QSGA 3DBRA 3JYQA 3GHYA 5FI3A 3OFSA 3OJLA 4J6FA 3AM3A 3DZKA 3VVCA 3UFXA 4AICA 4J9VA 2C82A 4FR5A 3K96A 1ULUA 4OKNA 1M2WA 1D3AA 1XR3A 3RCBA 1P1KA 1AHHA 2VHXA 1BDBA 1E7YA 4IXWA 2PZJA 1IHYA 5C7OO 3ON5A 1HDXA 3FSRA 4DQUA 4E5KA 3EHEA 4YQYA 4BNGA 3TZHA 3HADA 3OIFA 3VHRA 3GGPA 2BMAA 3S8MA 3VDRA 4WGGA 1E6UA 4OSPA 3B20A 2PLAA 1XA0A 3QWFA 1Q7GA 4CM3A 1QXSA 2QX7A 3TOXA 1K6XA 5JYEA 1W0CA 1MUUA 2R2GA 1JQBA 4XDZA 3DBHB 5BSFA 2X9NA 4D42A 3KYDB 3CZRA 3NGXA 4RGBA 4DL9A 4NJOA 2FRDA 1SOVA 3LYLA 3VPFA 1R4MA 5JYFA 1LSOA 3EK2A 3IMFA 1WZEA 3BTVA 4JNKA 1NASA 2R00A 3C1TA 4Y67A 3JD1A 4RO0A 1XELA 4NJMA 1NFFA 1UR5A 1LDBA 5B4VA 1T2DA 4PGFA 1W8DA 1A4UA 2CY0A 4PZDA 4XWYA 5IAAA 2Q1TA 3IAHA 5L3ZA 2EJVA 2GERA 3OIGA 4NI5A 4F45A 3WGZA 1KOLA 1I24A 1ADFA 2IEDA 4LVCA 3LQFA 1U2GA 2QHXA 3ZWVA 4CMAA 4XIYA 3ETEA 3UUWA
chains in the Genus database with same CATH superfamily
1JHAA 1GQYA 1QORA 3NTOA 1C9JA 1XXHE 3ND9A 1OUMA 2I7VA 4NFSA 3V1LA 3D6JA 4HFJA 4P4TA 4R81A 4Z9BA 3X2SA 1LV7A 1B23P 3F9CA 1Z28A 2HMSA 2XWBF 4P5PA 4YI5A 1CZHA 2VJAA 2CBGA 3IELA 2OWEA 1VMAA 2X15A 3PE3A 3TVYA 1FTQA 5AKEA 3ZTYA 2R44A 2AR7A 4ESOA 2FZ4A 5CT6A 1TTTA 3ADBA 3I1YA 2P1ZA 3NHUA 2PMKA 2AZ4A 3E3NA 3LLVA 2ZT7A 5D84A 1F8GA 3UWOA 1DJLA 5BOVA 5MFPA 3F97A 4YN3A 3CUWA 4JP2A 3P9PA 5E2IA 2IU0A 3CZAA 1JX6A 3LYHA 2A5JA 4LI3X 4Q4JA 4ZPJA 2V7PA 1CYDA 1JFFB 1WOMA 3BWEA 4OGGA 5TEWA 4D43A 4N40A 3E9CA 3B85A 1HDOA 2XMPA 3FOBA 3F6CA 1M2FA 1H6DA 4IF4A 5DN9A 3CM0A 4E4YA 1XA4A 1AB6A 1Y6FA 4M53A 4MMYB 1XMOB 4LXYA 2R6AA 4Q3AA 3IKMB 4KWHA 2PX3A 3GOHA 5DSZA 1YMUA 2DWPA 1P73A 3DXXA 4O08A 2M6LA 2XYPA 3L7YA 4MWEA 5FLEX 1SY7A 4G5HA 2J67A 1KAOA 1QO9A 2WA1A 1JJBA 1ZCBA 4LEIA 4DW8A 5ALJA 4UUOA 2P0AA 3IQIX 1JIUA 4J1QA 2F1JA 4BV3A 4V1CB 1Z7YA 1D07A 1XBTA 1RAAA 4RV4A 4JUCA 2GPYA 2CGEA 2FSVC 3C98A 3CE9A 3DB2A 5M3BA 3S7ZA 4EA9A 1PU2A 3L6BA 4BRUA 2AKEA 2HNBA 2Q9BA 5I4BA 4JGGA 2AUMA 1TPYA 2XDAA 1RXWA 3L1VA 1BEUB 1HQYE 1NIJA 1O2DA 2AOUB 2RE8A 2HNAA 2IUYA 2WSLA 1QP7A 2J7PA 3GZNA 4MQ6A 2CEKA 4LOAA 5E95A 5CD9A 1P61B 2R8XA 5C1PA 5AM0A 3ZC3A 2JIMA 2NU9A 1FFBA 1XZAA 3PVCA 4BX2A 1RM4A 3VRHA 3N74A 1XTQA 1YVEI 2FMUA 1SUIA 2HC9A 3L18A 1D7OA 1KF0A 5BN5A 4PWYA 4C5AA 4HQLA 3OC0A 4H4CA 5GMOA 3EXFB 5B7NA 4RTNA 1I4TD 1AKRA 4WXHA 2JHFA 1NMEA 4Q1VA 2H1FA 4PLZA 4UD2A 1IOWA 1NMQA 2FR0A 4GZ3A 3FPEA 2XMCA 4K6GA 1PEYA 1M2VA 1Z2PX 3SKVA 1O58A 2W6ID 5AOVA 1NXTA 3MLBA 2GFQA 2C97A 3D6AA 3G2LA 1SBCA 3AJAA 2VOEA 4Y6QA 4LKOA 4ZQEA 3TJMA 1KH2A 1OB2A 4DV4B 1IY8A 5DZSA 1KEUA 1RQPA 2P5SA 1OVGA 5IDWA 4FS3A 4Q1DA 5JQGB 2AHRA 2CLSA 3DTVA 3MTAA 4J16C 4D6PA 2ZIXB 1P17A 2I78A 1KNXA 1E1RD 2R8YA 2X76A 3O93A 1G21A 2IDZA 1U1IA 3OM0A 1OR8A 3KTOA 3U7GA 1VI6A 1LW6E 1ZD8A 1OX6A 1M2NA 3OZTA 1OT5A 2A59A 1PGNA 4WESA 1I6LA 4AO7A 1UMCA 5A71A 5KU1A 2FJ0A 3H8SA 1ZGCA 4FP9A 1EK5A 4WJLA 3QMPA 1ES9A 2FGKA 2OAEA 4GO1A 4TM8A 3REQB 3R20A 1E59A 1JHOA 2NV0A 4OQDA 1AA6A 3W9SA 4F6RB 1DWOA 1Y1RA 1ZJYA 1WZNA 3ASYA 3M6MD 1YZQA 3K2QA 4PU0A 4ABTA 3CZCA 3RROA 4TN5A 3DB1A 1DKUA 1ZWKA 2RBKA 3GVPA 2BJWA 4F71A 1G98A 2UAGA 2ONKA 5C5DA 5CA0F 5JZVA 2FPPA 4BLQA 1PBNA 5A9SA 4K6CA 2QQGA 1T5BA 5BRNA 4HPXB 3M9WA 5TQ2A 4ZCSA 2ZUEA 3VI3B 1GU7A 3OZBA 3OOSA 1Z6ZA 4F4HA 5BVGA 2HCFA 2ZSHA 2AFVA 5I48A 4NE7A 1K8ZB 1RT9A 1JG7A 4JWTA 1GNVA 2CLIB 3FG9A 3PUZA 2W7TA 5FBZA 2J9XB 4YT5A 1YIDA 3LWNA 3OZWA 5AM2A 3H6HA 3BQ9A 4P3PA 3QFHA 3TTUA 1HC7A 5IDYA 3SP1A 5FT9A 5BWMA 1L4YA 5CVEA 4KKVA 2Q28A 2W2VA 3A06A 3PDWA 4JLUA 4NMWA 4R01A 4Y9SA 4EHHA 5H81A 821PA 5LUAA 1O08A 4MGKR 1AQYA 4BYMA 4B1FA 1NXOA 2VPQA 1G2IA 2W93A 1DEAA 3DLIA 1NDUA 3BCRA 1QNLA 5HF5A 1QLJA 3OQ1A 3L40A 4RTPA 2W6JD 3MQFA 3H5VA 1XZDA 4LPKA 3RVLA 1U31A 1W9HA 4DMUB 3R3WA 1KI4A 4FT2A 4WEOA 3CX4A 2WD9A 4W5QA 2Y1OA 4PZEA 5E2AA 4WZAA 1UC8A 1VSQA 1CQIB 1NUAA 3F0TA 3I4LA 1SQ0A 3IEKA 4GLBA 1ZRMA 2G4VA 4EI2A 1A5SB 4PM4A 1RRVA 1T1JA 4EUKA 2B4QA 2EIXA 1K5PA 2AG6A 2EIHA 4Q7QA 4ZVVA 4XM0A 2X6TA 4NZMA 4LQCA 2IDMA 4DC9A 3G0DA 3GFTA 1XWWA 1B3BA 4MITA 2BFWA 2J3DA 1E7MA 3BFKA 3A6GA 4FU0A 1I0ZA 1T2AA 3VTKA 1PHRA 3OUTA 5JCJD 2E55A 2EYQA 4RZUA 4YUAA 3ZCRA 4RABA 1KJYA 1AB5A 2ZJ7A 1V41E 4CMKA 2OOSA 1NJ8A 4IDEA 4I1VA 4ZVMA 3VTFA 4UUNA 1JQLB 4JI5B 1X70A 3RPEA 3MWJA 2DF8A 1F5SA 3IEXA 3VX3A 5H16A 4O59O 5L3QA 1VGVA 4PE5B 3SHOA 1GLNA 1THMA 3JQPA 1MF7A 4BIIA 2JEZA 2ERXA 4PZUA 2I7TA 3OEEA 1R9GA 4AKTA 4N7BA 2H1VA 4CU5A 1IB0A 4TMZA 4JYZA 1DX6A 3VVLA 1C7FA 4V03A 3WZ2A 2QE6A 4QLAA 2QZJA 4UBLA 3WJ1A 4KZPA 2QNRA 4ER7A 2FUKA 2JFQA 5DHRA 5A5FA 2DUJA 1OIVA 2BR3A 2OHOA 1KU0A 4IX1A 4MV5A 1FUKA 2BIFA 3EZLA 2O8EB 4O5AA 1GLGA 1O54A 1A9PA 1AS0A 2MMCA 2JGDB 5AESA 4M49A 1VPVA 4JIMA 5F1YA 3MEQA 3GPCA 3UB2A 5F33A 5D3QA 1JPUA 1VP3A 5JXJA 4RTKA 2JJQA 3KALA 3C87A 3ENVA 4I8DA 4KQKA 4AURA 3K1ZA 2QM0A 4CMIA 5FAKA 4TWIA 4R9RA 1XQWA 1T26A 1GL9B 2UYCA 2RHTA 4OHMA 2R6DA 4RVHA 3LQKA 2JFNA 1DBIA 4I1UA 1IHUA 2BZSA 1FXWA 5ERYA 2Q2NA 4RVUA 3ILSA 4RFLA 1AG9A 2R4UA 1MGPA 1DBVO 1TVCA 3WIDA 4DCPA 1JHRA 4QBHA 5CEEA 4FDLA 4H27A 2G9RA 2IDKA 5KQPA 4LXIA 4GQIA 2V96A 2F3QA 5F52A 1GG2A 1I6MA 3WIEA 1GTSA 4IOJA 5AVQA 4GSKA 1BH2A 3DEZA 3DO8A 4C05A 5HZGA 2QLTA 3IUSA 4UE3S 4KIFA 4IWNA 2G06A 1P75A 3WYEA 1EP3B 3GGDA 3CINA 3PI7A 4HLUA 4ALKA 1U28C 2CD9A 2KS6A 5B3JC 3Q4GA 2AF4C 1L7VC 3WKAA 4ARBA 4PYJA 2AD5A 5GP1A 3TB4A 5JYDA 1JKFA 2P11A 3A3OA 1RWVA 4D97A 4YUZA 5B4UA 1OXBB 3PXXA 3QKSA 1KIAA 1HO3A 2WT8A 3SZUA 4IV5A 3F4KA 1P3DA 2C78A 1V1JA 3TKAA 4URUR 3FH0A 4ZP1A 3B5IA 3U4MA 4AKIA 5A05A 3BE5A 5DI3B 2YWXA 4R54A 1U2ZA 1U7HA 3KM0A 3TTTA 1GPJA 1T36A 4M7PA 4LYFA 3T4PA 3FFXA 4Q3OA 1YR8A 4RPJA 5DCWA 1YS2X 1LTKA 4ZPXA 4EG8A 5DK4A 1XWFA 1R4AA 1QV9A 1KAMA 2D59A 2HA2A 3INGA 1H05A 1DQRA 2DWUA 5JS1A 3OQMA 1R1DA 2ON6A 3UG7A 3UA3A 2VYVA 2BONA 2XUAA 1MA3A 2Q3CA 2BCGY 3L7JA 3LECA 5CDGA 4BO9A 3UW1A 5A62A 2ZB8A 1RHJA 3K09A 3OF5A 5FYDA 4GMKA 5LMNB 3ORSA 1TRKA 3N8NA 1RZRD 1E2FA 3TTVA 1FC0A 4YCBA 4DBLE 1T10A 4UTNA 3PCTA 2D8AA 3NTQA 5K6RA 3U7RA 2AG1A 3W90A 4I50F 2VQSA 2QW1A 4QUKA 5E3HA 1JDVA 3B82A 1KL7A 2A4KA 1QQ5A 2BRUC 2FWBA 2XRYA 4PSKA 4LRSB 1HLFA 3AVWA 4JJ6A 1EA5A 1QK5A 3CVUA 3CTPA 3DMDA 3TKLA 2QL6A 2ZYTX 1YULA 3E3MA 4M0DA 2HLPA 4Z86A 3T4EA 4IYJA 1SUCA 3WK8A 3RWMB 5CXXA 2YJZA 5IBCA 3EPRA 1C30A 1V95A 3IBTA 2BE9A 4TMYA 1QF6A 1SELA 1ZC3A 3OMLA 1HDYA 1ZISA 3GX1A 4EZBA 1ZK1A 4OQQA 5G02A 1H6AA 1HYEA 4YRRA 3WLLA 3WLTA 1NQOA 4LWPA 3A1EA 1KQFA 2V6MA 3B8EA 1JHMA 1EZZA 1HT2E 1NF8A 3LOPA 4EMUA 3HVUA 2PUVA 1GKUB 3TMAA 3CLTD 3NBFA 1URPA 5BURA 4MVJG 5EMJA 3JQ9C 3V8QA 1CNFA 5JNRA 4LXHA 4RKFA 1D7AA 1WDLA 4AD8A 3H18A 1JTEA 5ITSA 3I8XA 1THGA 5ALDA 3SBEA 3CHYA 2H92A 2FG7C 3TAHA 4XWAA 3W6UA 4L22A 3SY8A 1IBSA 2C20A 4ROSA 1V5WA 1OV4A 3N8KA 5C53B 1DKNA 3E61A 3SQXA 2FU5C 4FMDF 4JUDX 1Q14A 4OLFA 1P9LA 2TMYA 3T7TA 4HLQB 3S55A 1QNFA 1ZH8A 1GFZA 1T4CA 2INGX 4TZKA 4BFUA 1Q91A 4CKWB 5THXA 2EBHX 1S89A 5I7VA 3K9LA 3RHZA 3QYPA 4JBNA 4YUWA 4BC0A 5LWHA 2AOTA 2TMKA 3EVTA 2Q5IA 3RREA 5E6SA 2ZRDA 3O8DA 4DCJA 1TZKA 2RHBA 4UTXA 2R6HA 5IK2A 4M9RA 3VHXB 1XRPA 2E4ZA 3QUQA 4HVTA 2Z83A 3FYSA 2WFZA 2YIVX 1U2DC 3H0EA 4MV4A 3URKA 4DGSA 1TEZA 4RZHA 2MINA 1RMQA 1Y3FE 4IJWA 2CLOB 2VTVA 3PXCX 4GRAA 4EG0A 2R6JA 3X43A 1BEZA 3SYTA 4NXMB 1JQDA 4OQEA 3F5SA 1PL7A 1OHHD 3KK0A 5EN4A 2B1JA 1QYIA 2RG7A 5F21A 3UCXA 4CDGA 2ZDGA 4CUZA 5K7SA 1ILEA 3V8RA 1P1CA 1LQ2A 4RY2A 5FULA 5FI1B 1GCIA 5BVHB 3ZZMA 4JI7B 4TLAA 5F77A 1SWVA 4W6QA 1WXDA 3JRNA 3G9QA 4GBGA 4B09A 4ARUA 1KZ7B 4C07A 2IP4A 3FLEA 5CJPA 1UBRS 1S6YA 1AD2A 4Y6OA 1Z63A 2F1RA 1JR3D 1LRJA 1CS0B 4IMJB 2Q1WA 4JT9A 4BB6A 5EP3A 2BDUA 3OMWA 1WPGA 1P8AA 4KFRA 2PUCA 2P79A 1WMBA 1TDJA 1DJMA 3KQMA 3AVPA 2FY8A 1U7WA 3R74A 2B21A 5KEIA 3OBIA 3RBZA 1YQDA 1Z3CA 4L3OA 5DMHA 4ZCLA 4R2KA 2M98A 3BB1A 1W46A 3PGXA 4XWGA 3ZTWA 1DELA 1P2GA 4KI7A 3N2GA 1I4OA 5DNAA 2OK7A 3RU9A 1MD9A 1DBPA 4QTXA 3S68A 1T91A 1NNI1 1NF3A 1NVFA 1E3WA 2EBUA 5FEMA 2BEVB 1WXIA 3ZOKA 2OBYA 3MSCA 5KYXB 1R0RE 2ZB7A 3LC7O 3BORA 3E4CA 3QFSA 1YGPA 4HK4A 4H60A 2WIFA 3ONNA 4EECA 2Z9CA 5E7IA 1BX3A 3SJAA 1EQ2A 3I39X 3QM1A 3TW0A 5E9QA 3IODA 1KE1A 1TVMA 5AHKA 2PV0A 2ZYSA 3G49A 2P2GA 3UK0A 3UY4A 4E4RA 1V37A 4AMBA 5JD6A 3I0ZA 5CFZA 2F67A 1IN4A 2JPDA 4JL5A 1IZ8A 2CUTA 3MB8A 3E5HA 4Q48A 1U8EA 1L7QA 2OGWA 3ULKA 1IXZA 1DC5A 3VKFA 3W6NA 3HWSA 4QOJA 1CUBA 4TL7A 4ZAGA 5E6UA 3AM1A 1NTOA 2QJTA 1SCQA 2PT9A 3ASUA 3DVAA 1DS6A 3PHBE 3WI7A 2UXBB 3GLFB 2AG0A 3PUHA 1SAYA 5CW1A 1JEJA 5J1SB 2P5UA 4UVHA 1I30A 3I9MA 1S3GA 1B8NA 3DCIA 3WNQA 2CDRA 1P1IA 1QO0D 2J07A 1JIIA 9ABPA 1VLLA 4Z3KA 5KMGB 3ZVNA 3MT8A 1QHHA 3D4NA 4XJXA 4K86A 3FWYA 3TNFA 1QHXA 5PNTA 1V45E 2VK8A 3T3OA 4RAOA 3S28A 2L19A 5JJIA 4M0CA 2E85A 2O8BB 2VDNB 4OV6B 4FYVA 3TV1A 1HLPA 3C48A 4Q34A 1G3QA 3AFGA 4MWOA 2YINC 3X1MA 5JPCA 2O6LA 4ZT4A 3NH6A 3OPXA 5JFTA 3KV3O 1YQXA 2Y1FA 2CK3A 4FFLA 4RX1A 5TPZD 2H11A 3HY4A 3IBFA 1N2HA 1JEQA 4XOUA 1VLMA 4RJJA 1PHPA 4P83A 4QQNA 4WZZA 3FTQA 1QYVA 5J4HA 2ZE8A 4DTCA 1D1SA 3FFWA 2C1ZA 3DMTC 4MQ5A 4F2WA 2FI1A 1A4XA 3KOMA 1MX1A 1BS2A 5BV8A 3T1VA 4RQUA 3KB8A 2Q3MA 1PT7A 4HWRA 4MGHA 4E07A 3TOCA 4ZOLA 5A6VA 4Q9AA 2WYWA 3OPYA 3O8QA 4OXXA 5AH0A 2QV7A 4RK0A 1P19A 2EWWA 1T9HA 2G5PA 3EFBA 1DZ3A 3LFUA 1YJBA 4FZRA 2D5CA 1KP9A 2FAXA 3D81A 1WDTA 2JI6A 1Y80A 2WSIA 1L5MA 1IONA 2O14A 3JYNA 5JVDA 1NYQA 3VXKA 1W581 2N46A 1MIOB 1JG2A 2C5FA 3DLAA 4MW0A 5CW2A 1CRZA 4FGWA 7ABPA 3NMUF 3I9OA 1W1UA 3SQLA 1I72B 2SCUB 2VHEA 4BUZA 3VSCA 2XIJA 3EC1A 1F20A 1GRQA 1E1LA 2CXOA 3LHFA 4JT2A 2DM6A 1LRLA 4A2PA 4OG2A 2JFZA 2BE7A 3MRXA 3T0IA 4LZJA 5KB3A 1SCDA 2RJNA 1G0NA 4M7WA 4I5DA 1U8ZA 4YAEA 4MYUA 4RE6A 3EMBA 1N7GA 5A3VA 3N5CA 1LKZA 1TF2A 5CT5A 4JEHA 2A0YA 4I08A 3O38A 4HJRA 2Y0CA 3DTVD 3RAPR 3T1NA 1QVWA 1PJTA 3IXLA 3UTDA 3V3KA 4RZQA 3MCVA 3VPBA 4BVFA 3KZ1E 1AO0A 2G07A 3QA9A 1ZEMA 2BFPA 1QLWA 1N5DA 2HQOA 2ETXA 1ZVVA 4C5CA 4QO7A 4ZGGA 3QH4A 1O0CA 4KN5A 4DCGA 3SFZA 5J9GA 3L46A 4K9LA 2NXNA 1SC4A 1ZMTA 4HYEA 3SIPA 4DUGA 3PXEA 3VBEA 3W3ZB 1Z2DA 1DQSA 1PFUA 4W5OA 1VJTA 1NNSA 4QDUA 5CH5A 5AI6A 3T3HA 3X3HA 1GTVA 1HRKA 1WQ1R 4J0GA 1GL7A 1UYJA 5EESA 1CJSA 1XAGA 2VBFA 3OFVA 4KW7A 3SBXA 1GQSA 2AF3C 3FOZA 3HQ4O 2W4QA 1WD5A 2FPIA 1KJQA 2JI8A 2ZBEA 4N0EA 4BFVA 3Q7PA 3GVIA 1II0A 1VKJA 1XMXA 1DX4A 2AJCA 3HB0A 3H4TA 4RKWA 4OVKA 3ZW8A 3UMFA 4JKOA 1GZ3A 1OAKA 1U8CB 3H8JA 3O4IA 4FC6A 4L02A 3F5DA 2AK3A 3E8MA 4OM8A 1EK0A 5BQ3A 8LDHA 1PG5A 3L43A 2GBLC 1Z33A 1NHGA 4DNOA 3VC1A 2NUTA 1XVLA 4ZK6A 4KR2A 1V7QA 4NY1A 1M6YA 4ZCMA 1VCIA 3ELWA 5KYWA 3TFOA 4KBFA 3VZDA 1KOGA 3EXHB 3RBAA 1V1RA 1WE2A 3HS3A 3P2JA 2NSDA 4N9WA 4PRYA 3SXUB 3H04A 5KWSA 1OZFA 4LE0A 3L0ZA 2IH5A 3I5XA 2QD5A 1CEYA 4ZD6A 3Q98A 4OSOA 1ZOLA 5AVXA 5FAXA 1YB2A 2A86A 2GEUA 3AESA 3RV3A 5LZ5A 1KA9H 1YFZA 1G1AA 2WLTA 5FUVA 2XQIA 2YUIA 4OIMA 1XNQB 5HKAA 3W78A 1LPMA 5AI0A 1KI7A 1IAVA 2RKOA 3VR0A 4C0LA 4M8SA 4PAOA 3SZRA 1QVZA 1UUFA 2YVLA 4DA4A 3BWYA 4HR7A 1WUYA 5EUQB 2FQXA 5DSXA 4B0PA 3QLTA 3BSYA 2QS9A 2BM8A 1YDGA 3B52X 4PW0A 4EQ6A 4CLQA 1PZGA 1QJ4A 1YZ3A 2QNIA 3LVQE 4A6XA 5FWXB 5LOVF 4Q6BA 5DX0A 2ZRFA 5KSPA 2DGDA 1L6IA 1WO8A 3T94A 4EPYA 2RK3A 2VK1A 3ONVA 4NAUA 1QS0B 3RS7A 4R2MA 1USUA 2YQZA 3DE1X 4HQ0A 4UAJA 2XDWA 2HRCA 4QGBA 3Q7SA 4WXPA 1E98A 1NUSA 4R51A 2V3CC 4N76A 4Y6LA 4P3OA 4JR1A 4KLNA 3NR2A 4DIUA 3DPUA 5EZYB 4JI6B 1OCEA 1PK7A 2IPAB 3S27A 2J3IA 4AMYA 2YVUA 4HEHA 2XJ4A 3IHTA 4B81A 1J21A 3MUFA 4KWEA 2J30A 4N3AA 1OKKD 3BJMA 4JUFA 4OFXA 4X45A 3GEEA 3EDMA 1PTKA 2QLJA 1O97C 3EP6B 2VG8A 3HVKA 2GJ8A 1CR6A 3QX3A 2V7WA 3LI2A 4U7WA 5DYIA 5LB4A 1QO0A 2VYND 3KSMA 5LBUA 2DBRA 1B8VA 2BMDA 1Z15A 4D8YA 4E5YA 4UU7A 1TFUA 3ZY2A 3OJXA 2JBAB 1YTUA 4C6HA 1V35A 2NZJA 4MWZA 1Y4UA 4XB6B 3WLFA 4HQKA 1YUMA 2G9VA 5AP9A 3V1KA 2CJXA 5J2UF 5CG1A 4HRVA 4LHWA 5FHQA 1TCUA 1LGYA 3NWPA 1GA6A 5JDIC 2PEYA 2G67A 4I9HA 3IAS1 5KSZA 4GDFA 1M75A 3B13B 1AF7A 3WXMA 1FA9A 2A9OA 4MYSA 4YMSA 1SG0A 4BIMA 4BZWA 3C6YA 2V54A 3AW8A 4WHMA 3OIUA 2GTPA 2NSHA 2QRNA 3GIWA 3AB3A 1LU9A 4WX2B 4F85A 3FUVA 4O3MA 2ODQA 2VOJA 4FOTA 4TRJA 1JWLA 1RMYA 4PS0A 4WY2A 1RBZA 3K4PA 3RSSA 4E1VA 4H4DA 2ZSAA 1BVYF 1ONOA 4YJ3A 3RTCA 3M6VA 4WLNA 4EY3A 5LUBA 3WICA 2IU4A 3SR4A 1HNWB 3SQDA 3IUPA 4GL2A 2GZAA 4JYMA 1PWHA 2IPXA 5AXCA 2HJVA 3VYVA 3LGAA 5F5NA 4DA8A 3QPDA 2IOHA 4OK6A 1WQ4A 1ZCJA 1QIHA 2ZAMA 2FVXA 1C7ZA 1NW4A 3UMGA 1OBOA 2Z08A 3BGSA 4JGBA 1Q19A 2WJAA 4QRIA 5DBFA 2C5GA 5CVJA 5DM0A 2BFMA 5FOWA 1TIKA 3WGKA 5KYYB 4PLCA 2J9FB 1DIRA 1C5KA 1LPPA 4HWSA 2AJTA 4LHEA 5DIZA 3H9EO 1EGAA 4BFXA 2HDNB 1GGMA 3ECCA 1IPFA 1N5MA 5KAPA 3DV9A 4KFUA 3BEOA 4OGKA 1F7VA 4JX9A 3KB1A 4UCQA 3ZYCA 4CT0A 3CN9A 4D45A 1WG8A 2OV2A 3EOZA 3Q3GE 3RFUA 1WSWA 5AKGA 3O82A 2X8AA 1Z5VA 4LTDA 4ZREA 2VXOA 1OYOA 1B26A 1W4AA 3MWLA 1DXYA 4YS6A 5KYNA 1TLLA 4GP7A 5JSUA 3ZGXA 4CF4A 1LS6A 4JC5A 1F38A 2HT6A 2SICE 2ZWVA 3EHDA 5LA6B 1PSDA 2Z95A 4U2KA 5TXGA 4C01A 4D4HA 4L5BA 4EY8A 5B58C 3GL9A 3GLKA 5AD1A 2EWVA 5JAUA 3D7MA 3OLZA 4HPWA 4ZEVA 1XHLA 1IXSB 1DG3A 5HE8A 5LCXA 5EJMA 1JG3A 1IHXA 1FSGA 1T2EA 3EUWA 3DKRA 4NU8X 3FGZA 5AW8A 3GLHA 5IN4A 5JNWA 2XUGA 2P9GA 2UXCB 3JQ7B 2NU8A 2XNJA 3BJRA 3GLSA 4RVNA 1JXMA 3C1OA 3R1IA 1BRMA 2YY6A 4LOHA 3WGYA 3R9XA 4S05A 3F8TA 3LL7A 3DA8A 1F2TB 2A0UA 3W5CA 1LTQA 3LG2A 1SVLA 3E22A 3O8RA 2WDZA 4PTYA 1JHUA 1ISGA 1MOSA 3N2LA 1F8UA 4WPGA 4H77A 2YWFA 3H5NA 1HE2A 3PPWA 1DKOA 4QBFA 3IIEA 4TL6A 2QMEA 4JCCA 4C4OA 1FPMA 3E8XA 4PRLA 3USES 4UVGA 1NSYA 1ZUNB 3E9MA 4CLOA 1T4DA 1RE1A 4G0NA 5JADA 1ZD3A 3ZQKA 1WPQA 3R8CA 5HQJA 1B14A 2VYFA 3KTDA 4X3PA 1ZOOA 1UXGA 2HDHA 4S1PA 3DBVO 1Z4QA 2GF2A 3WWEA 4MP8A 5E6RA 4K87A 1E9VA 3FUXA 1U1CA 4E08A 4HHEA 5CXUA 1RAGA 4HDMA 4LOIA 2FMXA 3AUYA 4HOYA 3N2ZB 4UUQA 1V11A 4LJ6A 5JDIA 4XFJA 4KMRA 5JROA 2IS2A 4LVNA 1RYDA 3RC1A 1EYZA 1X86B 4A15A 1MLDA 2LE0A 5JXGA 2ZRJA 1R5BA 4YJDA 3LUJA 1YJXA 1E3MA 1A9ZA 1NPTO 2HB6A 2B20A 4KPUB 4UTVA 3FVVA 1AMNA 3F8WA 3DBLA 1GKKA 4KQJA 4PX2A 3MGBA 5JAHA 5AVOA 1FUUA 3WYGA 3H1EA 1Z0SA 2EHDA 2BEKA 4DQ0A 2CNNA 4W8HA 3E7PA 4EHKA 1L5SA 1UBSB 4HTFA 3ZV5A 4M98A 5I7EA 2ZKIA 1U98A 2C58A 3NQ41 1L7AA 3M3PA 5DX1A 3RYTC 3SF0A 4BTVA 4M99A 1V1MB 2PQMA 4PN3A 4CEIA 1IQRA 3TQCA 1OKKA 3UJBA 4HAXA 4RLHA 3D1JA 3ZY6A 1XB2A 1UBGA 1H65A 4EK9A 1G2OA 3JASA 5GOTA 1USIA 1U9JA 4TUYB 1TYDE 4B6QA 1ORIA 4XIJA 4CG3A 3E3AA 2IW1A 4JHXA 1XE3A 1UBTS 3IR6A 3BBLA 1MB4A 3ABOB 4P80A 1QRAA 1R0ZA 4CM4A 3QELB 4XPZA 1H3EA 3RS3A 1DOHA 4O1HA 3NHJA 3ABZA 3E2PA 4X54A 1JYFA 5DBEX 3ABRB 1JJFA 3Q7TA 4CIXA 3P9IA 5H80A 5FOQA 1WXHA 1XFAA 1RYYA 1Q50A 2EU8A 4NMMA 2HRQA 5JJ5A 3RF7A 3LBYA 5C7LO 3L1UA 4EO7A 1UC4B 1ML4A 2I54A 2DQKA 4QC2A 2Y0BA 4HH4A 4TMVA 3Q6IA 1GDDA 4KR7A 3FCSB 2YV5A 5CD1A 2ZRHA 1U2EA 2WJVA 4XPIB 1U6JA 4RD6A 1BE0A 2XRFA 2ZPTX 2HGZA 2DUNA 5AOBA 3CZPA 3RYIA 3VKVA 2N75A 4TLDA 1IU9A 1C9YA 3C6MA 3UJPA 2P2DA 4YMLA 4B7ZA 4FZVA 1ZN7A 4Z4QA 4LJSA 3JQ8A 2I2WA 1WW3A 3EP4B 3K0CC 3ZDAA 2MYTA 4CM5A 3OTOB 4UBOA 1G7CA 4BB0A 2ANBA 2VC2B 3E0XA 3IYLW 3UJAA 2ZIUB 2P78A 2P7IA 4C3OB 2PV7A 4CM8A 2ZJ8A 4Z9YA 4WK2B 1YRYE 4CQNA 2WR8A 2Y67A 4V1CA 1XEXB 1FIUA 1T34A 3MT0A 1AK9A 3FYTA 1RQXA 4M0KA 2GOYA 3ABSB 3X2FA 4GX0A 4BJ3A 4WFJA 1KEWA 3A7EA 4G0VA 2UVPB 4OEHA 2I34A 5EHQA 1XYVA 1HZJA 3GEPA 4GLOA 2RIPA 3KQVA 5GPBA 1XMPA 2NV6A 1SBNE 3GZNB 5DI9A 3RU2A 1VRWA 1IBLB 4QQ8A 5C46F 4LRTB 3JZMA 3UMYA 1OTHA 2IXDA 2NU9B 1V2GA 2ZUDA 5D1NA 3U9TA 3GAAA 1QMPA 1VIVA 3ZD9A 3AF4A 4IFTA 3PHCA 1SBHA 4RIIA 2CLMB 2Q6KA 2Q21A 1W25A 3PQ2A 2Q3EA 4YP5A 5ENDA 4C7JA 3R8XA 3OJOA 1GVHA 1XKLA 3TUTA 1I5OA 1XDGA 4CM1A 2DBYA 3ZE1B 3EX7C 2A14A 2VCEA 1DRVA 4DPMA 3EY4A 3FIJA 3IAM1 1MJFA 4PCLA 4PCVA 4A92A 5JXIA 1T8RA 1LF0A 1H1DA 1F48A 2Z8XA 4Y9UA 5D5QA 1M34E 2CEAA 4P92A 4JHLA 3S3TA 1RQLA 4YCSA 2XDQB 5JI3E 5FV7A 3ZJVA 1XI2A 4O89A 1YKFA 4Y2YA 2HWXA 4QVGA 2I99A 2IUTA 3G2MA 1AS2A 4DQKA 3GUYA 4G5XA 5JD4A 4Q4LA 2XF8A 1OI7A 3UHPA 4D3ZA 4D46A 2FQQA 2PA0A 1HV8A 1S1MA 3T9DA 1LLQA 1MEOA 4I2NA 5T5QA 2C59A 4M9ZA 1SUPA 2CXUA 1MGOA 1QVAA 1H2XA 3G6KA 3GJZA 3O92A 3PQCA 3PUIA 1D0IA 1SVOA 1V9LA 1MW8X 3LF2A 2RKBA 4NCAA 4R98A 5JBIA 2ZUUA 3RRMA 2GB4A 4YBRA 3TG2A 1QTNA 2J87A 1LC3A 3HE3A 2PEZA 1P2TA 4YYEA 4B46A 4PHGA 5AQ1A 3GT4A 1YJQA 1DUSA 5PGMA 5FA5A 4UM7A 1RQGA 3WOHA 5CDYA 1G66A 4YV7A 1P9NA 2Q4DA 2PDAA 4HI0E 1YQWA 3KOXA 3ST7A 4B5LA 4EGSA 1PWXA 3I04M 2WKWA 2GEDA 2PU5A 2G1UA 2ISQA 3K05A 2VSOA 2JEYA 4J90A 4TYMA 5JD3A 3VTAA 4YCMA 2RAVA 3N6XA 1A72A 5K0ZA 4IH1A 1LF5A 4K26A 2JCBA 4JR0A 1HORA 4P08A 1TQ8A 3ZOZA 4EFLA 2X0KA 5B64A 2YL2A 3LVRE 4IIVA 1VB3A 4FFDA 3GW8A 2GH1A 2I4IA 2XMSA 1Z88A 3UNXA 4ER6A 2XNSA 3ZU2A 3DE3X 2TMGA 4PAGA 2YJNA 4HAOA 5FWAA 3WGLA 4AWAA 1JDBC 1PNVA 3TQRA 1JR3A 4U2DA 4OLJA 1CT9A 2D1QA 2YYAA 3SLRA 5JALA 5JPDA 3IESA 5T4HA 2R1UA 3K0BA 4I4CA 5C2JB 4BY9E 1A2QA 4UMEA 1G64A 1BU8A 3WB1A 2EJWA 2E7ZA 3FBWA 1U0HC 2FN8A 3V4VB 2ZJ0A 5FOVA 1ZQ9A 3K73O 4C6TA 2YV2A 1PS8A 5KNDD 2CB0A 1OHHA 3REOA 3T41A 3W2TA 4H2DA 4YDSA 4N6OA 4IHKA 2B61A 1K5HA 2JFVA 3BJIC 3EVZA 5A1JA 1OJ7A 1ZG3A 1HKUA 3KTAB 3U60B 1M1XB 4G85A 1AV6A 4F86A 1YFLA 3WIVA 1G42A 2J3MA 1WU7A 1E1KA 5BYAA 4CL3A 3KXPA 1E4OA 1HURA 3P26A 5FUWA 1FE8A 1K4MA 4L0QA 1K2VN 3CEHA 4RANA 2OORA 1L5VA 1Z4MA 1Y37A 2RAPA 2WWRA 3VSDA 3BIXA 4E2ZA 1XN1A 4UC0A 3ZWWA 4UPEA 4IKOA 2ZRAA 2UZ4A 1R64A 1YR2A 5CM9C 9MHTA 2BGTA 1GQFA 2E4AA 4ENUA 3QVLA 1G6OA 1V16A 5AVUA 4H7DA 2DFNA 2R47A 3IAS6 1G2QA 1WQ3A 3G8CA 1ONPA 2Z8YA 3JY6A 3THXB 2HSGA 3P94A 4Q37A 3EVFA 1IXKA 5CGZA 3E9NA 1Q3HA 4LYJA 3AJEA 3ITKA 4QYIA 3HO8A 2M1ZA 4V0ME 5LYYA 1WABA 3SFTA 1PL0A 3ZW7A 6YASA 1YIOA 4BGEA 2FDRA 2LIVA 4G5QA 4HX5A 5JNLA 4BB9A 2JRLA 3ND6A 4PC1A 5EIAA 1VIMA 4DDMA 5A0TA 4R40A 4UMVA 2IIVA 5K0EA 4GPZA 5ALKA 1Q6YA 3E9ZA 1EXWA 3HLYA 3LL4A 5LU8A 4XVRA 521PA 4TMTA 3DLBA 4PQYA 3NVKI 2BMJA 1UK6A 1UDBA 1L8XA 1GYRA 4FKZA 3FOWA 1RJGA 4N48A 1NXVA 2QR5A 3WKDA 3CC8A 2P75A 2C9CA 2FFAA 4HZIA 2OZLA 1YKSA 3PSHA 4BE4A 3LOUA 1Q0TA 1UKCA 2H1OA 4KN6A 4GPTA 1SZDA 4L0DA 2BFBB 1L0BA 2GRAA 3KKMA 3GBSA 4GZLA 4C0JA 2AZDA 4EF4A 3GLIA 2VNSA 4WADA 1MENA 1Q17A 1NVBA 4OMFG 1H0KA 3VU1A 3TNYA 2JGDA 3FHCB 5KYUA 2O2YA 3TQQA 3DZIA 4TWBA 2ZIEA 4RJKA 3PUJA 1RWMA 4J94A 4NBKA 4X1KB 3U3ZA 3N7TA 1M34A 1GAEO 3B1KA 3OCVA 5BUZA 2C5SA 2F64A 1NLMA 2OBFA 5A4JA 3O2SB 3ZDEA 4Z3OA 4B3TB 3ZD7A 1IB6A 4P82A 2QRHA 4UTZA 3AUSA 2BKLA 4IQ4A 2XVYA 2TRSB 4QG3A 2MOKA 2HQ1A 4RTMA 2VDOB 1HK7A 3NI2A 3AKEA 4A0RA 2I4OA 3EASA 3K0AB 4EAQA 5B1EA 4BNWA 3VBCA 5H83A 4RTQA 5IDXA 1DZIA 3M5PA 1QUFA 5E8JA 2ZJ1A 3KSRA 3T34A 2B25A 1G5TA 3AVXA 2HLDA 1U2TA 1L5LA 1B1CA 3HV2A 1N25A 2NSYA 4YVFA 1JW9B 2E1RA 3IX7A 1XD2B 2GM4A 1ORHA 4YALA 2N42A 3MGAA 3NHRA 1TT5A 4RETA 3TW4A 2AVNA 2EKZA 1VJ1A 3GCGA 1T3TA 3CBGA 3TN7A 3QFFA 3KKKA 3KOYA 3T3NA 4F3KA 2Q4TA 1J9EA 4NONA 2ZSJA 2DXIA 3VNRA 4V38A 1AHNA 3QVSA 1I32A 1BHO1 1HXHA 3COYA 3IUJA 1L5HA 1PQWA 1PJRA 4EELA 4TM7A 1SU8A 2HBYA 2JKYA 3OIDA 3KJNA 4HZGA 1K97A 4DIDA 1V8DA 3BD7A 3FZYA 1X2EA 2HCRA 3VUEA 3T1OA 3ZIUA 3GVCA 1EM8A 4YV2A 2P1DA 2PMDA 2MSEB 2WOJA 3HSYA 1F2UB 2H16A 2I91A 2CLHB 1V6SA 2GETA 4CV1A 4GOKA 1E9SA 1Z45A 3AUAA 4TTRA 1KSJA 1WHSA 2RB5A 2GRUA 4KN9S 5HK9A 1L7PA 3GN2A 4B3HA 2Q5OA 3LDHA 1PQUA 1GUBA 1DJNA 3D2CA 3L4JA 3CUKA 3IURA 1BN6A 2PT7A 1K98A 4BKMA 5CDTA 3RVNA 4HQOA 4LGVA 3LT5A 5IYZF 4IUYA 4A6EA 4ZV4A 1X9HA 1PLJA 1XXLA 1OPXA 2YZMA 5CLLA 4N7MA 1KO4A 5ERXA 3H86A 2HWYA 5IMBA 4KAFA 4HWKA 3AFHA 3RAEC 5FA6A 1Y1LA 2YHAA 5TV2A 1AO3A 2LCFA 2XCQA 1Z2AA 2CXPA 2Y8EA 2QN1A 3KLOA 4PCAA 2DBVO 4I5EA 1NKTA 3UT6A 1BMDA 1U99A 2JFGA 4BLRA 3CUUA 1R6VA 3WJ7A 3ONWA 2REOA 5IKXA 1F7UA 1BX1A 4L8VA 1Q7CA 3I5UA 3LLSA 4ESEA 3LTEA 4CIBA 2OV6A 2H65A 4XM1A 2GEBA 5K3FA 2BBTA 4DVGA 1F8FA 4QJIA 3WDLA 4KR9A 4J0HA 5FOTA 5IJ9B 2ZR0A 4WV3A 5HK8A 2WFAA 2IUFA 1T6XA 4MI6A 4X8LA 4COOA 4CMHA 3O2QB 2ZM6B 3WLQA 2Q5EA 5J3JA 2RGUA 1CDEA 1A98A 2PS9A 2PJUA 3RC8A 2A9PA 1XHEA 4X41A 5DULA 2G25A 1J7KA 3FOCA 1II9A 2OBXA 3M1AA 3WFJA 1N0WA 2J9YB 3EEIA 3CLUC 1N0HA 3UWSA 5KIAA 3DFUA 3H1BA 3HLKA 3QW4B 3IPYA 2PWAA 1K9VF 3EXG1 4HB2A 5EWJB 1QOPB 1MAUA 1Z2OX 3DVSX 3HCPA 3KX2A 2R7LA 4ZYVA 2BBOA 5K8TA 1U4NA 4XQ0A 4C3UA 1D6MA 3TKYA 1F0KA 1RR6A 1MA0A 4Y9RA 4DV3B 1W59A 3IVRA 5I4IA 1FCJA 2D62A 5IC6A 3PV0A 4A73A 5LLTA 2R8BA 1AH2A 4A2CA 1L9XA 4IFIA 3FPAA 2B2XA 2GHRA 3RG8A 3UAXA 3WIUA 4AJIA 3D5EA 5K3EA 1G8PA 2GCPA 3ETLA 4IXNA 5TARA 1Q11A 2OKGA 1NVTA 1NQWA 2X40A 3OX3A 4L1KA 3BH7A 4B73A 2ODAA 4YBZA 2PKE