2PKQO

Crystal structure of the photosynthetic a2b2-glyceraldehyde-3-phosphate dehydrogenase, complexed with nadp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
368
structure length
346
Chain Sequence
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPFCCKLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase B
publication title Molecular mechanism of thioredoxin regulation in photosynthetic A2B2-glyceraldehyde-3-phosphate dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 94
structure length 346
sequence length 368
chains with identical sequence Q, T
ec nomenclature ec 1.2.1.13: Glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).
pdb deposition date 2007-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
O PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2pkqO02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2pkqO01
4WCFA 4MPDA 1PZEA 3DAFA 5IN4A 3CKYA 2ZB4A 2I3GA 2V6GA 1K89A 3VDRA 1O8CA 1ZIDA 4PLVA 1TLTA 4RORA 3GEGA 4ZVVA 2GDZA 1RYDA 5ADHA 3GK3A 7MDHA 1QLHA 3HQ4O 4KQWA 5CEJA 2G0TA 2Q46A 3JQAA 2WEKA 3C24A 2DTDA 4J1NA 4Q3NA 1N1EA 4CMEA 4HFNA 2C2XA 4M8SA 3JQ6A 3F5QA 1U4SA 4IIUA 2VT2A 3EVNA 5JYEA 1LQTA 3BMOB 2RHRA 3JQEA 1ZUD1 4CPDA 1L7EA 1PTJA 2AEMA 4UULA 1ZXLA 4HNGA 4CV1A 1XQ1A 5HTOA 4J4TA 1I36A 2Q3EA 4BO4A 3IJRA 3JD2A 3ZWPA 3ZDFA 5G0TA 1D4FA 1BW9B 4C7KA 3DZGA 5KJ1A 3DWFA 5F1PA 1ORRA 3ETGA 3D0OA 3I9OA 4DGSA 4RJTA 3GMDA 1C0LA 3KSDO 4O63O 3GOHA 4WGGA 4KQXA 1YXMA 9LDBA 2VRCD 3GF4A 3PP8A 5BT9A 3C1TA 1E6UA 1M67A 3OH8A 4DMLA 2HSDA 4Q3AA 4BO3A 2JFFA 3DBLA 4CMIB 1A7KA 1VSUA 3WGZA 2YV1A 1XELA 2DBZA 2RHCA 4A2CA 1ENYA 1BXZA 3H3FA 3JQGB 3IQDB 1E1MA 1U2GA 4MOWA 1YB4A 4MP8A 4Q3BA 3RBZA 3JYPA 2Q50A 3PQEA 4NZ9A 4BNFA 4R3WA 3H8VA 1E3WB 4JNKA 4QQRA 2W2KB 5EN4A 4BMNA 3RBVA 2X9GA 4WNIA 1LXCA 4O59O 5ICSA 2IYOA 4DMMA 3MJVA 4AG3A 1ZK2A 1HWYA 5I9MA 1PIWA 4GLLA 1MC4A 3ZHZA 3B6ZA 3U4DA 3KOUA 4YACA 2ZTLA 1DC6A 6LDHA 3D4PA 5A06A 1ZVMA 1DBVO 3LT4A 1F06A 3OA0A 1A4IA 1U9JA 2O3TA 2VUTA 4Q39A 4RPJA 3WJAA 4BHTA 5ITVA 4IXTA 1IUKA 1I2BA 1KETA 4TVBA 2JFHA 2JCYA 2ZQZA 2WM3A 4ONEA 4OSOA 1TT7A 3VKVA 5ENVA 3HFGA 3IIEA 4JXKA 3K96A 1GV0A 1NWHA 4IGEA 5IF3A 4R9SA 4ND5A 2OBYA 5CDUA 4GX2A 2X86A 4DIOA 5G0VA 4YR9A 3AOGA 3QRWA 3E82A 3K92A 5DP1A 3QE3A 4J1QA 4KTVE 4KUHA 5H81A 4YPOA 3BA1A 4M54A 2Y1DA 3A1NA 2VHZA 4AJPA 3A28A 3HSKA 3NGXA 2B37A 1GQQA 3FNFA 4CQMB 3OECA 1B0AA 1JVSA 1KEWA 3IP3A 3D3WA 3OJFA 3I4FA 3JYOA 3JQFA 3I6QA 4J1SA 4CLXA 3V2GA 4BQRA 3ADPA 3C7DB 3MOIA 3T4EA 4I8XA 4GGOA 4XQ9A 2DLDA 1ZK3A 2BGKA 3H3JA 1MX3A 2WYUA 3WYEA 4YB8A 1ZK0A 5DCYA 5JDIC 5L7WA 1GD1O 2NSDA 3TFQA 4HV4A 4TZKA 3V1TC 1P1HA 2O4UX 2Y1CA 3LQFA 1E7WA 4IS2A 4EUEA 2NACA 5KVVA 2Y99A 5T8KA 3GH3A 4TROA 1YOVA 4A27A 1UJMA 5LC1A 4DL9A 3CINA 1IZ9A 5A9TA 3RBXA 4ZGWA 3DBRA 4PRLA 4J7CA 4I9UA 3QY9A 1H94A 2CY0A 3VPFA 3VDQA 2AMFA 2VWPA 3HFSA 3VPSA 2B36A 5IDQA 1CEQA 2EJWA 4HP8A 4E3ZA 3KSZO 1NHWA 1DDOA 4J0FA 1JN0A 1E7QA 1BXKA 3K31A 5EQFA 1U7TA 3E5MA 3ZNNA 3I9NA 2PKRA 2XF8A 2OHXA 3AY7A 4A5OA 1I3LA 1ULUA 1F17A 1Q1NA 2DFVA 4PN3A 2QRKA 3ON5A 4WCFB 1Z82A 3VZSA 2HMVA 4XX0A 1Z74A 4ROSA 4B4OA 3TDKA 5L95A 4XR4A 5TF4A 3W4KA 3V1YA 4P4NA 3U5TA 1B26A 1I0ZA 5JO9A 1YQGA 3UCEA 4E31A 1U2DA 4IGFA 4BNHA 3MJCA 4WNCA 3SC6A 4I5GA 3U3XA 1ZO8A 3ONDA 4J3FA 3FF4A 1GR0A 5AXAA 3VPGA 5EESA 3O4RA 3ETEA 1UH5A 3TL3A 4IQGA 2RH4A 2CNBA 1X15A 4EI2A 1V8BA 3RFXA 3C85A 3QHAA 5K6AA 3DAGA 4OL9A 2P5YA 4YJHA 2RCYA 4CMGA 1CIVA 2XXBA 3RCBA 3ZZNA 5H82A 5L7TA 3HN2A 3L6DA 2VZ8A 1DLIA 1E7RA 1GU7A 4I08A 3HE3A 1TA4A 4RLHA 1HL3A 4DYVA 3TJRA 5BSHA 3Q2KA 4W7HA 3MZ0A 3DBLB 3Q3CA 5JC1A 1GEGA 1ZK4A 3DOJA 3WTCA 4H7PA 4Y6RA 2DC1A 3KYCB 4W99A 1XLTA 3U4CA 5DOZA 3DBHA 1I2ZA 1EUCA 2ZCVA 4FFLA 4OOFA 2H63A 2NADA 4IJUA 3JD4A 4FGWA 5B1YA 5KKCA 4FD3A 4RCVA 3GGOA 1I2CA 2C07A 3F46A 2Z1NA 4M87A 3DOCA 1DJNA 1AGNA 2B83A 2Z5LA 3JQCA 3R0IA 2YW9A 4GSKA 1QV6A 4W7IA 3I83A 2EJVA 1YE3A 4Y98A 4D41A 3DTYA 4BB5A 4JJGA 1B8PA 4BVAA 2W8ZA 1EDOA 4CL8A 2O3RA 4PRKA 2B69A 4H3VA 1PJCA 2X6TA 2E37A 3DB2A 5JYAA 3EYWA 1H0KA 1NR7A 3IUSA 1XA0A 2Y1EA 3NGLA 4EW6A 4YDRA 3EGOA 3KUXA 5C7IO 3UVEA 4WLOA 2VQ3A 2Y1GA 5KJ6A 3OQ1A 4RO0A 1SPXA 5TIIA 8LDHA 3MTJA 1YDWA 1PQUA 4D44A 3JYLA 2EGHA 3FTPA 4PLWA 3IUPA 2WE8A 2IZ0A 4TVOA 1LDMA 3GEDA 3ZGYA 1ISFA 3DOOA 3SC4A 3WJ7A 1T24A 1NAIA 3WQQA 1LSOA 2XAAA 4M86A 3FD8A 4UVDA 1I33A 1AXEA 4KDEA 1PJLA 1OAAA 2POQX 2GNAA 4CLOA 3OEWA 3ENKA 1CYDA 5EIOA 3AUTA 2V6BA 3PWKA 2EHDA 3G17A 3D3WB 1Q2XA 1YQXA 2LDXA 5KJEA 1IE3A 1Q7GA 3I9LA 3S2GA 4URFA 1U7HA 3M6IA 3WIDA 3GNQA 1VPDA 3BHJA 1HLPA 3AM4A 4F46A 3ZWWA 4BIIA 3BYZA 2P9CA 1HYGA 3DEYX 1R15A 3CSDA 5JDCA 1EBFA 2DAPA 2EKPA 3K2BA 3KYDA 3WLFA 4UUMA 1PGOA 1GDHA 3OMLA 4CM9A 2A35A 2NWQA 4N18A 3RUCA 4BOYA 4NI5A 4WUVA 1NHGA 2AQKA 2HK9A 4P22A 3FRJA 1HZJA 4DQVA 1YOVB 3GNTA 4IDCA 5L45A 1ULSA 4NBVA 1DRUA 5CG2A 5L4SA 2DPHA 1KYQA 3FNGA 4FIZA 1QORA 3FR8A 4GPD1 1RKXA 1DAOA 1WAMA 3FI9A 4PLZA 1N7HA 3ASUA 1PGJA 2CUKA 4NH4A 2PLAA 5CPFA 4Z6KA 4CR7A 1MB4A 1U3UA 4P4LA 3AU9A 3PIDA 4ZRNA 3B70A 1YWGO 5GZ6A 1Y7TA 3JQFC 1LBEA 4ND4A 1NFRA 1QG6A 4XRRA 2DTEA 1HF3A 1M66A 4RQUA 1A7AA 1P3DA 1P31A 3VKUA 2VOJA 1H9AA 1PJ3A 2DUUA 2BD0A 3T7EA 3CPSA 2ZYAA 1KIFA 3VVCA 1C1DB 3ZCXA 4RF3A 3ZWNA 4YXFA 4LRSB 3FNEA 5KTKA 3PZBA 3IL2A 5B12A 5JCXA 3V1UA 3HNPA 5EERA 2OORA 4MKRA 5T8KC 5KNLA 1ENZA 1QP8A 4Z0TA 1MXFA 4EZBA 1DFHA 3UN1A 1PL8A 4B3HA 1PJ2A 1T2CA 4R4JA 3OETA 3WMWA 2I99A 4D42A 4FBGA 4RGBA 3AUUA 1CDOA 2X5KO 2NU6A 5GMOA 5DP2A 4WEOA 3EK2A 1NXQA 3B1KA 3FPLA 2DT5A 4E6PA 4PIVA 4XRGA 5F1KA 3BAZA 2JCVA 2WSBA 3FCOA 4Z3KA 2NVWA 5BSEA 1KEPA 5DF1A 3PHJA 1EEHA 4Y6PA 5TSDA 3QWIA 1SOVA 3NYWA 5B37A 4BNIA 2C5EA 4HKTA 3PTZA 5TNXA 4BNZA 4F6CA 3RASA 1PQWA 3NT2A 3WSVA 4DPKA 1YH3A 3AI3A 4CMKA 1DIRA 4MINA 3LC7O 5ENDA 3GVHA 3QWFA 4YJHB 1DC5A 1ISHA 4BQPA 3B1JA 3RC9A 1NQOA 4YT2A 2GN4A 1JLLA 2VHWA 4XB1A 3BZUA 3I6IA 2VWQA 4YT5A 3ROPA 3ZV5A 1XIVA 4ALMA 3ZW8A 4E33A 1C0PA 4J43A 1R0SA 5TC4A 3BMOA 5FEUA 1PWXA 1XCBA 3ITKA 4BKPA 1FDWA 1ZMOA 2E49A 2BFAA 4DA9A 2BHLA 5TLSA 3D5QA 2G5CA 3WDSA 4HWKA 2O7SA 4CMBA 5TRTA 1EQUA 1TI7A 2B4QA 4B4WA 8ADHA 1HETA 3QLJA 2O4CA 3WTBA 3OEYA 3GN1A 4D43A 5JYDA 4P4GA 2E6UX 3ROQA 3ONEA 3NDRA 3CXRA 5THQA 1N92A 1MC5A 1X1EA 2Q1TA 2Q2WA 2YQ5A 1VI2A 1R0LA 2V6FA 1Y9EA 1N7GA 3TOZA 4A73A 3W8DA 1BTOA 2SCUA 3GZ4A 4CMIA 4MVJE 1SEPA 4GX1A 1HE4A 5JCJA 5K6AC 4WOJA 3F6YA 3ZV3A 4BS9A 3ANMA 1J0XO 3JQGA 5EPOA 5K0ZA 2Y93A 4D3SA 3H6KA 4PVDA 1YBMA 3UAGA 4FDAA 5I7FA 2P91A 1U3WA 4BO5A 2HQ1A 3G1UA 3PFWO 1X14A 1Y81A 2FMUA 3PQDA 2H5LA 4HFMA 1VRWA 1KEUA 3DHNA 2YFQA 4UUPA 3JQAD 1UDBA 1LLQA 2NV6A 1TT5A 5GZ1A 2DFDA 3AOEC 4HBGA 3ZWAA 3PIIA 1NVMB 1ADCA 2YUTA 2JCXA 1B2LA 1G0OA 1FF9A 3B1FA 4UVIA 1PZFA 2FRDA 5K9ZA 1NPDA 4EEZA 2B5WA 2EG9A 4OGWA 5EQDA 4U8GA 2WYWA 3TRIA 3WNQA 4G5HA 1QXSA 1Y1PA 1XYGA 1LLCA 2R00A 3AU8A 4BO0A 1N8KA 5C7LO 2I66A 3OJOA 4S1VA 3FSRA 1QYCA 4DBVO 2Y68A 1NP3A 2IEBA 3BMCA 3OJ0A 1BVRA 3ASVA 3DDNA 3MJ4A 1V6AA 1I24A 1HYHA 3EAGA 1WDMA 1D1SA 1LLDA 1QLJA 3DZHA 3JD1A 1K2WA 2YV2A 5AVOA 2G17A 3HN7A 1E3SA 3TZHA 3QVTA 2UVDA 2OZPA 2J3JA 4M49A 3ZNOA 4AL4A 4XQEA 3V5NA 3KYDB 3RFTA 3UFXA 1SOWA 3K8ZA 1O9BA 1O0SA 4CQMA 1YB1A 1E5LA 3TN7A 1MFPA 3TQHA 1E6EA 2NM0A 1O6ZA 4E30A 4PZCA 1A9ZA 1E1NA 4C4OA 2X1HA 1XSEA 3DQPA 5T5QA 2GD1O 3JSAA 4PFJA 1DRVA 3KYBA 1WZEA 2X7HA 2X9VA 3ORFA 4JGBA 5TGDA 4BNUA 5A5EA 5IDWA 4UVEA 1HEUA 4BNKA 3KZVA 2B4RO 4XYMA 5M6DA 2VT3A 3PJEA 4A26A 5G4KA 3INGA 1H93A 1N9GB 2CF6A 2QW8A 3L07A 1Y5MA 2EP5A 4XYEA 3S2EA 4YCAA 1ADFA 4LVUA 3M2PA 1PS0A 1H6AA 1VC2A 3WGYA 3ULKA 4N7RA 1XU7A 4RVHA 4CUJA 1AHHA 3GFBA 5FWNA 1U4OA 3AI1A 2QRLA 5JDCC 5T67A 1R6DA 4B3IA 3F3SA 1U5AA 1PWZA 2DBVO 2HU2A 3UKOA 5IJZA 4O0LA 1JKIA 2WWRA 3FR7A 4J2HA 4J16A 4B79A 3OSUA 4AJEA 2IODA 4FFNA 3WB9A 3I9MA 4NPCA 2C20A 5U9CA 3G1TA 4J0EA 2Q4BA 4UREA 4D46A 4OQZA 3JQ8A 3RKUA 3ZNQA 3LT1A 1R4MA 2QX7A 3O8QB 1VL8A 4Z9FA 5ILOA 3KSUA 3WSWA 4ZQBA 4DIBA 3ZW9A 5IXSA 2C82A 2OOSA 4TWRA 2BI8A 3UCFA 2HKIA 3CZMA 3I4CA 4CM5A 2CVOA 4OXKA 4NU5A 3WOHA 1ONNA 2GN9A 2Y67A 2JHGA 5A5FA 3ZU5A 3RSHA 2E48A 3AUAA 1BMDA 1GYQA 3NDJA 4P38A 4EJ0A 3EUWA 5A3JA 3L6OO 3K5PA 4OAQA 1T2EA 1O89A 1YO6A 1ZJYA 2NQTA 4Y6SA 2Q1UA 4QFCA 4MIOA 4R1NA 1T2AA 2TMDA 5DCWA 2WYVA 3WGQA 1GUYA 3HB4X 4L76A 3Q0EA 4F3YA 3Q9UA 2PZJA 1PGQA 1GCOA 4EEXA 1KVQA 1E92A 4J1TA 1LDEA 2Y0EA 1WXDA 1BDBA 3ANLA 2BFPA 4EUHA 3UW3A 3AUSA 1T4DA 4BNTA 4L0QA 1T1SA 1T2FA 1FMCA 2F1KA 4BGUA 2JFGA 4R5HA 2OFPA 4XZ3A 5G4LA 2PWZA 4JROA 3EVTA 4CODB 3DZBA 2VZ0A 2PNFA 1YB5A 2PFGA 1DHRA 3JQ7B 1HT0A 1ZBQA 4L75A 4PVCA 2J5QA 3EDMA 4GMFA 2HK7A 3NDIA 4OQYA 5HRUA 4HXYA 2D5CA 4WE3A 2PD3A 2C54A 4WLUA 3S2IA 3KTDA 3KYCA 4XA8A 4RQTA 2FP4A 3KHUA 5LDHA 4RV9A 3OQBA 1KVRA 4JBGA 1Y5RA 5A04A 4RF4A 5IZCA 4R68A 1CRWG 4GQAA 3O9ZA 1Q0HA 2BFMA 5DULA 1E3IA 4RPLA 5L4NA 2C0CA 3OIDA 3DONA 3LC2O 1H9BA 2G1UA 4YRAA 2D2IA 1P74A 1JA9A 1TT5B 3Q11A 1GUZA 3U62A 2X22A 2ZB7A 1A4UA 1D8AA 1ZCJA 3KM0A 3PJFA 4S3MA 4E13A 1LRLA 2UAGA 2Z1MA 4FOOA 4GX0A 4KUGA 3WGTA 3WYCA 3WGGA 2AEJA 4PCVA 4RZIA 2NVUA 3N58A 3O38A 5JAIA 5JO0A 4LMRA 4J4HA 1DFIA 3UXYA 4H16A 4XYGA 4QUKA 3RFVA 3GUCA 1HDYA 1TEHA 4QO8A 1UXKA 1K0UA 3BMCB 4NBTA 3RUHA 4B7UA 4FOSA 1A72A 5KVCA 4WLEA 3BHIA 3E03A 1B14A 1DJQA 4G81A 1YQDA 1T1RA 5G2OA 1ZMTA 4FPXA 3PQFA 1N2SA 4Z3DA 4JK3A 1HDCA 2NU8A 1P33A 1P77A 5CP8A 3GAZA 3DC2A 4IQ8A 4FR5A 4YJDA 4YJFA 3I52A 4MVJF 4D3DA 2JJYA 2H1SA 4GKBA 3JQ9A 5CHEA 3FNHA 2ZYDA 1LDYA 4J7UA 5COQA 3AI2A 4YRDA 3RJ5A 2W98A 3BMQB 4XJSA 4QEDA 4AFNA 4NK4A 4FJ0A 3VZRA 1OOEA 2BGMA 1YBAA 5DT9A 2R00C 3PEFA 4WKGA 3G49A 1IULA 1FDTA 1MV8A 5COAA 3H9JA 1DSSG 5G4KB 5B4TA 3OA2A 2EF1A 3A4VA 1GUFA 3QW2A 4LGVA 1ONPA 2WD7B 3F47A 3RC1A 4IUYA 3L4SO 5ICMA 4K28A 4MJLA 1YDEA 3H9GA 2IZ1A 2J8ZA 3CTMA 3WQRA 4R54A 1U3VA 2DVMA 3E18A 1WMBA 4G2NA 3ZWVA 2FWMX 3KETA 1B16A 2YJZA 4PG7A 3RUAA 5DBFA 3RUIA 2H9IA 4IMPA 4B4VA 2FSVA 4OIMA 1E7SA 4Q3EA 1HSOA 5JS6A 2VNSA 3CZRA 2CVZA 1LX6A 3RQSA 5CDGA 1JVBA 4LRTB 5KIAA 4OXYA 3GDFA 1MLDA 4FFRA 4ZU3A 1NM5A 5ER9A 1YJ8A 1O94A 5A1TA 3QVOA 4XIYA 5TJ9A 2VZ9A 3TNLA 1GQYA 3U09A 1IY8A 3JQ8B 2EEZA 2O2SA 2B5VA 4AJIA 1R4MB 1GAEO 3G79A 4FS3A 1AHIA 2V7PA 3BTOA 1C1DA 2O2YA 3GFGA 2EWMA 2UUOA 3GAFA 3OJEA 1N1GA 3RD5A 3COSA 1D7OA 1JAYA 4NQZA 1DO8A 1D1TA 1Q0LA 3NX4A 3RVDA 1ZEMA 4J9VA 3UH1A 5JLAA 4LISA 1EVYA 2ZTVA 3VH4A 5IG2A 3UF0A 4DIFA 4RLSA 4JCOA 4B3JA 5HM8A 4W9NA 4TQGA 1IOLA 4FC6A 2NTJA 2VYNA 2Q22A 2HMSA 3GVIA 2AE2A 5H83A 3VAZA 3FWNA 4RPGA 4L4XA 3PFFA 1R4NB 4PZEA 4CM9D 4DC1A 4U6QA 3N74A 1YL7A 1PS9A 3H5RA 3WICA 3AM3A 5EL0A 1VL6A 3RI3A 3FTNA 4YJGA 5F5NA 3ZH2A 1WWKA 1Z6ZA 2NUAA 1E5QA 3Q1LA 1ADBA 3GEMA 4PG8A 3E5RA 4MVJA 1B15A 3OICA 4CLHA 3LF1A 5CEEA 2AG5A 1LSUA 2PA3A 5IAAA 4YT8A 4JLWA 2IZZA 3FHLA 5FYDA 2IXAA 3V2UA 1FXSA 3FBGA 4WCFC 4FFPA 1YBVA 4OHUA 1ISGA 2P9GA 3K73O 1E7YA 1DFGA 1SNYA 2ZTUA 4ID9A 2IDZA 1PU2A 3FBTA 4CLDA 3EZLA 3DZJA 3ZWXA 3DO5A 4DQUA 1KVTA 4F6LA 5LCXA 5BSFA 3MCVA 3KB6A 1RM4A 4CMEC 4HNHA 4CV0A 3C1OA 2VNAA 4LN1A 3DFZA 1WPQA 4JBIA 4IZHA 2VYVA 1K6XA 4XD2A 4YYZA 3AY6A 2HLPA 4PLCA 3V2HA 1IPFA 2CZCA 1NFQA 1EQ2A 2GERA 3QVSA 4E12A 4L74A 5ITWA 2ET6A 2QZZA 1OZAA 3VC7A 2BFOA 2EV9A 3C3XA 1X13A 4FW8A 1FDUA 4GMGA 3H9UA 2YDYA 4NFHA 4TRMA 3PYLA 3HUDA 1NQTA 5JNLA 2FZWA 1YS4A 3WGHA 4Y8VA 5AYVA 1A71A 1VJ0A 5T64A 3GZNA 3IAHA 3QWAA 4ALKA 4BL5A 5L9AA 2CSUA 3GVCA 2O23A 4GSLA 3VVBA 2AXQA 1AXGA 4TKLA 2ZK7A 3VPHA 1U5CA 1OC2A 3WBFA 4NNJA 3HJAA 1GZ3A 7ADHA 1DC3A 1MUUA 2C7VA 5DOVA 2NVUB 1D3AA 5T6BA 3RC2A 4ALLA 1H6DA 4AICA 1UXHA 3LT2A 1HRDA 3L9XA 1GZ6A 1W73A 4MO2A 4D7AA 5IZCC 5JBIA 1MG5A 1IB6A 2I9PA 3IKVA 4UEOA 4Z9YA 1IYZA 4IDDA 4FN4A 1UDCA 2BKAA 4RL6A 2GZ1A 1X1TA 2HMWA 4CM1A 5HBRA 4R1UA 4HADA 3M1LA 1B8UA 2Q2QA 4RVFA 2RIRA 4YQYA 3JV7A 3IP1A 1K6JA 3W6ZA 1B3RA 3VOSA 3P19A 1B3BA 1S7CA 4YJFB 3VH1A 4CM4A 2PD6A 2VHYA 4CMHA 4L9RA 1MP0A 2YYYA 2JD1A 2O7QA 4EJMA 4XGNA 3GDGA 1KEVA 1LNQA 5C37A 1YONA 4U6SA 4FJ2A 2IXBA 3NEPX 2BMAA 4PLHA 4RVGA 2ZYGA 3H7AA 3K2EA 3F4BA 4CV2A 1U3TA 5JCJD 2EKQA 3WWYA 1I3NA 4YAIA 5L51A 5J23A 1V3TA 4HY3A 4II3A 5U4QA 3DHYA 3LLSA 1HE2A 4KZPA 4W6ZA 5JFOA 3NT5A 3GC6A 1DEHA 4IINA 4YWJA 4BO2A 2W2LD 1ZSVA 4E5NA 3TL2A 2C5AA 1SAYA 1WZIA 4IIVA 1ZJZA 1EZ4A 4PG5A 3H5NA 4E32A 3UCXA 4E2ZA 1TB4A 1PX0A 4Q3CA 5JSFA 3RU7A 4JX8A 4ZQFA 5BNTA 1JKJA 3OJLA 4R9RA 4JN6B 2IRWA 3NTOA 1NTOA 1N9GA 2VWGA 4OYRA 2YZ7A 3FN4A 2FPIA 3JQ9C 3DBVO 4K9DA 4R51A 3IOYA 3UOGA 1NPYA 1HSZA 1HE3A 3BTVA 3BTUA 1SO8A 4RVSA 3HDYA 2VTEA 3GQVA 4HFJA 3PHHA 4DYDA 1GTMA 1YL5A 1A5ZA 3FPCA 4RVUA 5I9LA 5L4LA 3ZHXA 2ZIZA 5JYFA 2I76A 2E82A 2B35A 3CIFA 4QX6A 2D1YA 2D5AA 1WP4A 2BELA 1HYEA 3F9IA 1CERA 3MWDB 2X8LA 1WVGA 5TX7A 4DWVA 3PWSA 2ZQYA 1GL3A 3KLMX 4XQGA 3O8QA 2DUWA 3HDHA 2OGUA 1EMDA 2O3JA 3UGKA 4AJLA 1KERA 2YV3A 4BV8A 3E9QA 1JDJA 1ADGA 4CQMD 4LK3A 1VE9A 4EUFA 2QG4A 1VL0A 4YJGB 4KDFA 1JKFA 3MWEB 1AE1A 1T26A 5AQ1A 4EITA 4TRJA 1XEAA 3ZU4A 3M1AA 3ZWBA 3KBOA 1DIGA 4CM6A 1EFKA 1GEEA 1F12A 3I23A 2YHUA 2DBQA 2P5UA 1HE5A 3LLVA 4DLBA 2Q2VA 3TFOA 3DZKA 4CUZA 1UXJA 4JQCA 4RF5A 1V0JA 1HLDA 5FFFA 4NIMA 2J3HA 1L1FA 3WGIA 1UXGA 3CUKA 2ZJ1A 3DL2A 5ES3A 1VSVA 2V65A 5HA5A 4IJWA 3RAJA 3V8BA 4RZHA 3QWBA 1A9YA 4W9NC 3ZWMA 1GY8A 3S55A 4UVHA 2GLXA 2PZLA 2OP1A 3GVPA 4MP3A 4NBWA 2JKVA 1Y8QB 1E1LA 3JQ7A 3IC5A 4QECA 2HRBA 5AXBA 1NFFA 2X0IA 4JJFA 4MVJM 3PK0A 3PWZA 4WLNA 3AW9A 5L3ZA 3HG7A 3GGPA 2X5OA 4BNGA 1IHYA 1R66A 4JP2A 1DIHA 5JAMA 5A9SA 5MGBA 1M2WA 1T2DA 1YL6A 3AY3A 5BSGA 3WGOA 1E1KA 2ZKLA 4R41A 3MEQA 5I8ZA 3H9EO 1EE9A 3QVWA 3GZNB 4IY1A 4INAA 4E2YA 2VCYA 3JCZA 2UUPA 2PZKA 2GN6A 2VHXA 4RVDA 3LSYA 3GA0A 4GAEA 1P9LA 1BXGB 1R16A 5JC8A 4Z0PA 1B8VA 5JE8A 1U8FO 1PGPA 5DN9A 2JL1A 4GBJA 3H65A 1V9LA 3GNSA 2B0JA 4M55A 2GCGA 1YRLA 5J9GA 1SB8A 2CD9A 1UZNA 3NT4A 4NR0A 4DBZA 1W8DA 2AQIA 4PLPA 2PH5A 3ZU2A 3PHLA 1DOHA 1VM6A 3L6EA 4CMAA 4BNWA 1I10A 5BNFA 4ALIA 4ZD6A 1M6HA 1HDRA 3IDSA 4NBUA 3QV1A 3WFJA 5TS3A 2XOXA 1Q7BA 4YTEA 1G0NA 4CL3A 5BR7A 4K6FA 1JW9B 3PGXA 3OF2A 4CM4B 4JP3A 1FDSA 2CDBA 4E5PA 2HK8A 3PJDA 2AE1A 4PG6A 2O3QA 4CMCA 3H2ZA 2AA3A 1SB9A 5CPBA 1MA0A 3CMMA 1CQIA 3M2TA 2A9FA 5IDYA 2HJSA 5CG1A 3WQSB 1NBOA 1T4BA 4J49A 1IZ0A 4OKIA 4N5LA 4BGVA 1ZSNA 4GGPA 1PSDA 1Q0QA 4BNXA 1NVGA 4LMPA 9LDTA 2X4GA 3Q2IA 3ETDA 2YHIB 1UP7A 3WIEA 1L7DA 4CM8A 1I8TA 4GKVA 2OUIA 2Y05A 3E6AA 2J3IA 2EKLA 2OP0A 3BMQA 4IDFA 5JMPA 5T57A 4DRYA 5JXWA 3HB5X 4CM7A 4CM3A 3RU9A 2RBEA 1VKOA 3JYQA 4RPKA 2C59A 3LT0A 1U28A 2GPTA 1E3JA 1ENOA 1ID1A 2OMEA 1I32A 2X58A 2WTBA 2HAEA 2WD7A 3A14A 1JU9A 5CDTA 2P68A 3GG9A 1LLUA 1PJSA 4JBHA 1LA2A 3GRPA 3TZKA 5ILGA 1GYRA 4WJZA 3GPDG 3U49A 3QA9A 4K6CA 4ALJA 5F3RA 3IJPA 1M6WA 4XQCA 1LC0A 4PG4A 3I5MA 4IXWA 1NX6A 5ER6A 3JQBA 4HUJA 2WD8A 3VH3A 5DBGA 4XYLA 1Z73A 4GVLA 1OFGA 5JAQA 4CV3A 1VJTA 1Y8RA 2GZ3A 3R3SA 2GYYA 3O03A 1GPDG 1UR5A 4KTTE 3A06A 2NU9A 5L7YA 4MVJH 1H2BA 3W1VA 1UAYA 1XG5A 2G76A 1J6UA 2CMDA 2WDZA 4AJ1A 4CQLA 4DPMA 4FSHA 4R3NA 5BQFA 1ZK1A 3GRKA 1NNUA 1LUAA 1YVEI 3IMFA 4FFOA 3WLEA 3L4BA 4UEKA 4PLYA 1HDGO 1EBUA 1HDXA 2X23A 3D4NA 4D79A 1JAXA 1JWAB 2HDHA 2OBNA 3HHPA 1VLLA 2VWHA 2EW8A 4E2XA 1LC3A 2FOIA 5FF9A 4CUKA 1LSJA 5TJHA 5EJ2A 4B8WA 5B4UA 4NU6A 3OBBA 3DMYA 3ITDA 4WK6A 2W4QA 3FWZA 4MVJG 4ZN6A 4A10A 4N5MA 4XGKA 3ZWOA 2RAFA 2JAHA 4OOEA 3WFIA 3WWZA 3ZV4A 4I9HA 3RJ9A 1R12A 4NFSA 1YKFA 5U1PA 3WG9A 1I3MA 4BV9A 5IFLA 3QSGA 4ND3A 2HMUA 2GO1A 2QZ9A 4NHEA 1PJBA 4XR9A 1O95A 1R4NA 4NMHA 1LRKA 4F45A 3TPCA 2BLLA 4YRBA 1DPGA 1UAGA 1X0XA 4NG5A 1IL0A 1UP4A 4XIJA 1XHLA 2Q49A 1PEDA 3S8MA 1EE2A 5A05A 2VUUA 1LQUA 1ZEJA 3K6JA 4GWGA 1QYDA 2IEDA 4UUOA 3F4LA 4KWIA 4MKXA 1V35A 3TOXA 1U1IA 2Q1SA 5C5IA 4H15A 4E5KA 4NDNE 4G65A 4E0BA 1Z7BA 5HS4A 2Q99A 5A9SB 5AXDA 3U4IA 3DMTA 3DR3A 4R1TA 1PZGA 2YY7A 4ESOA 3LK7A 2PH3A 3WR5A 1AUPA 4RF2A 4ZICA 4MIEA 3PLRA 1RM0A 1P1KA 3B20A 2C29D 3H9QA 1I01A 2GZ2A 2CDCA 1NVTA 1KC3A 3PVZA 3R6DA 1DLJA 4DUPA 4N54A 1F8GA 3SJUA 4KP7A 1PR3A 4YVFA 3H2SA 1BGVA 2V6MA 4WEQA 2CF5A 4PGFA 4QO7A 1OMOA 1C3VA 2VYND 2UYYA 1NQ5A 5LDGA 2HO5A 1QYWA 4YT4A 1MG0A 5IDXA 3PYXA 4NFYA 3UHAA 2PTGA 3E48A 2X0NA 1R37A 3ENNA 4TRRA 1I30A 4BUCA 4YAGA 1PL7A 4I1IA 5MDHA 4I5EA 4CMJA 4AJ2A 2VUSA 2YDXA 4MVJI 4MVJD 5IZ4A 3KLPX 3RUEA 2I5PO 2JAPA 1PS8A 4AVYA 3LF2A 2LDBA 2EP7A 3SXPA 1RM3A 4BKUA 2VOEA 4ZQGA 3PDUA 1VKNA 2QYSA 3L77A 4DREA 4IDAA 1EVZA 1YGYA 1KY4A 3DZIA 5A4DA 5TT1A 4OO3A 1HDOA 4BNLA 4Y67A 2WE7A 2GF2A 1V3VA 4XGIA 2TMGA 3ZWYA 3QVXA 4BGEA 1NAHA 3STHA 3D7LA 1LDGA 3DHEA 2VYVD 1DXYA 2BRUA 2QQ5A 4O5OA 3BMNA 4CM8B 3ONFA 2NU7A 3D4OA 3U0BA 1ONOA 2J5RA 5A9RA 3OM9A 3OP4A 1FK8A 3WYBA 5I9NA 1T25A 1JWBB 1LTHR 1X7HA 2ZTMA 3JYNA 1WW8A 1OI7A 4BO8A 1PZHA 3GGGA 4XDYA 3C8MA 1MXHA 4D3FA 5G0SA 1P1FA 2OXIA 1Z75A 4UAGA 4ZHSA 4J90A 4MP6A 5DZSA 1VJ1A 2PV7A 1F0YA 2GSDA 2P2SA 2BH9A 4WECA 1EK5A 4IPTA 3R1IA 5FI3A 4TZTA 4BNJA 3ROMA 1WDLA 4B4UA 2GASA 3ABIA 5TT0A 4WPGA 1GZ4A 2R2GA 4IDGA 1NWCA 4JJIA 3KO8A 3LC1O 3GPIA 4IS3A 1Y8RB 4MDHA 5A03A 5I7SA 1KBZA 4BKQA 2NVBA 1DHTA 5I8WA 2ZB3A 1G6KA 3CEAA 5CAEA 1ZZEA 1ZW1A 1QSGA 4YAKA 1QYXA 5IN5A 1BWSA 4CQLB 3EY4A 4YAEA 3INTA 4PZDA 4DTIA 2J3KA 3WS7A 1W6UA 3K30A 2AEFA 1C1XA 4FFMA 4EDFA 1C0IA 3GVXA 1P0CA 3EMKA 3VH2A 2C2YA 2Q45A 2J5KA 1Y6JA 1UXIA 3OIFA 2VRCA 4IDBA 1LRJA 3KV3O 4PLGA 4YQZA 4FQ8A 3G0OA 4FCCA 4DXHA 4R01A 1XDWA 2OL4A 3F1LA 4E2WA 4XCVA 4MKZA 3MJTA 3JQBC 3SBOA 1S6YA 2PGLA 2EIHA 2ZATA 3QP9A 4WLFA 1CETA 4ZA2A 3E1KA 5I7EA 4KWHA 1J5PA 5C7OO 1QYVA 4I9NA 5DDIP 3NTQA 3NJ4A 4BKOA 1XGKA 1P44A 3PLNA 4J9UE 2A4KA 3ZU3A 2DPGA 1HKUA 5A02A 1UZLA 3NAQA 4BNYA 1F8FA 1K3TA 3P2OA 3LZ6A 2ILTA 4Q9NA 1EVIA 3L4BC 5F1OA 3JQAB 5G0UA 4LSWA 1PL6A 4OJNA 5JW6A 2EGGA 1EUZA 1KS9A 4Z9XA 3C7AA 1KY5A 3AFNA 3RUFA 4Z0HO 4R1SA 2Y0DA 3QJ5A 1CWUA 2XPCA 3ICPA 3VTZA 2D4AA 1NASA 3ST7A 4ZJUA 2YQ4A 3T7CA 4OM8A 2AW5A 4O6VA 3GLQA 2X9NA 5L40A 2XXJA 5AXCA 4U7WA 4CLEA 5F5LA 1Y8QA 1BSVA 3AWDA 2BI7A 4BKRA 1GFSA 2O3UA 2NTNA 2AQHA 3IKTA 3X2EA 4GVXA 4CJXA 1P45A 4TMFA 3MOGA 4L8VA 2Y1FA 3S1LA 4QT0A 3GR6A 1LDNA 3PZRA 2HMTA 4UVGA 4BMVA 3HADA 1EUDA 2Y66A 3TZQA 1N5DA 4QXMA 2HUNA 3PDJA 2NLOA 1JQBA 4DVJA 3GT0A 4BB6A 1E3LA 1SMKA 2A92A 3PI7A 4PLTA 2PGJA 3AOEA 1IPEA 5JPIA 1EFLA 1E0DA 4DLLA 1CF2O 1HZZA 2PK3A 3QQPA 3QWHA 1BXGA 4GLOA 2Q1WA 3DFUA 4BMSA 1ZFNA 2QHXA 5FI5A 2PR2A 3DMTC 5KKAA 1ML3A 4XWYA 1ARZA 4KOAA 2NQ8A 5KJFA 2I65A 1PGNA 4P8RA 3VZQA 3JTMA 3JQDA 3D64A 3PHGA 1BHSA 2GN8A 3C1AA 3TSCA 3ROKA 4IM7A 3ZHBA 3W6UA 2UV8A 4D0RA 3D3EA 1E6WA 4W4TA 2UDPA 4D0SA 3G3EA 1NPTO 2D59A 1FDVA 3GHHA 3GHYA 5BNIA 4L4SA 1ZKMA 3C7CB 3O26A 5A3VA 1R0KA 2A94A 1CJCA 4LCEA 1SZJG 4OH1A 4WASA 4X54A 3RIHA 4EYEA 5CDSA 2ZCUA 3ZV6A 3OFSA 5KWEA 3BMNB 2FSSA 3PYMA 4M1QA 3E8XA 3SLGA 2PKQP 1PQPA 1M76A 1V3UA 1BDMA 3H5AA 4HFRA 2JHFA 3I1JA 1P1JA 3SX2A 3RUDA 4NK5A 4E5MA 1CQJA 2DBRA 2FR1A 1SEVA 4YA6A 3EW7A 2I67A 4BGIA 4Q3DA 3AFMA 5L53A 1GYPA 1DRWA 4BO9A 4B7CA 2RH8A 1X7GA 2JD0A 2YHIA 3W8EA 3TZ6A 3D5TA 3Q6IA 4BNNA 4DC0A 3NJ8A 1X0VA 4YBZA 5THKA 3GMSA 1LU9A 4W82A 4E21A 1OC4A 3H4VA 4OSPA 5CDYA 3I3OA 5DCUA 3LYLA 1C14A 2WMDA 4II2A 2VN8A 3ZN2A 4XEHA 4YEDA 1IHXA 1QR6A 2FR8A 3HDQA 2R6JA 4LW8A 3SLKA 3GUYA 2HJRA 1YJQA 4EGFA 3KVOA 2I6TA 1K6IA 5TQVA 1WMAA 1LJ8A 2QYTA 3ZWCA 2QRJA 3RWBA 2HRZA 3A9WA 4IJVA 2Z95A 3U4HA 3L9WA 3JD0A 3EZYA 1Y9AA 2QIOA 3TWOA 4IMRA 4A0SA 2GGSA 3DBRB 1ISJA 1P0FA 3PXXA 1UUFA 2DM6A 3BIOA 1C1XB 4E5YA 3OHSX 1A27A 1G1AA 4WOKA 1WLYA 1GCUA 3GN2A 1KVSA 3MJSA 3WXBA 3CH6A 4AJ4A 3AM5A 1ZSYA 5AOVA 3HZZA 1E3EA 1P1IA 1H6BA 2J6IA 2DTXA 3E9NA 4XDZA 4CLRA 2WJPA 4GWKA 4ITUA 3VZPA 4A7PA 3AK4A 4L4RA 2VHVA 3W4JA 4FJ1A 4XJTA 3HWRA 4UEJA 4NJMA 1JTVA 3ADOA 1RM5A 3F5SA 2EW2A 4XB2A 2VTDA 5IXYA 1U8XX 1EVJA 3PPIA 1PJTA 4XYBA 1MGOA 2BF7A 2JD2A 4J4BA 3E9MA 3VPXA 1E7MA 3S2FA 3NTRA 4J2OA 4KMSA 3PGJA 3AJRA 1KVUA 2C7GA 4LSMA 4BNMA 4HX5A 4WCDA 4MIYA 1ZNQO 3IS3A 2F00A 3P5SA 1QMGA 2CFCA 4KUEA 2NTVA 5G0WA 4RPHA 2FHSA 1BRMA 1M75A 1WDKA 2P4QA 2X0RA 3WNVA 2ZB8A 4AJJA 3DAPA 3K9QO 3T4XA 1P1RA 1MFZA 6ADHA 3LVFO 3WBBA 3DZFA 4IBOA 5EMHA 4QTZA 4TRNA 1TXGA 4Y9DA 4ZRMA 2G82A 4ILKA 3GY0A 3ZHYA 4ALNA 1ENPA 2IYPA 3OQ6A 4IZIA 4K1LA 3SEFA 3HDJA 4DPLA 3W8FA 1QKIA 3EHEA 3INRA 4QSMA 4EJ6A 5JY1A 2GUGA 3UICA 4AJHA 4A03A 4XKJA 1UZMA 1NYTA 2CDAA 4DQXA 4BNVA 1HDZA 2O48X 3LDHA 4M89A 4GX5A 3GDOA 5KVSA 4IJKA 3NV9A 1BW9A 1KOLA 1RWBA 3GG2A 3DBHB 4BO1A 3CE6A 3I9JA 1X7DA 1DC4A 2I3AA 4RDIA 1K5HA 1RPNA 1XR3A 3R3JA 4C7JA 2CVQA 2FY8A 3UUWA 4FGSA 3QIVA 4ND1A 5KVQA 1Q7CA 1RJWA 4MVJP 5GY7A 4PLFA 1RYEA 3VTFA 3CMCO 4ND2A 4B7XA 4DLAA 2PY6A 4L73A 4TSKA 2PGDA 4ZQHA 2E4AA 2FN7A 3U9LA 5DNAA 1ISMA 4R5MA 5HS6A 1Z7EA 1DAPA 3WX0A 3RKRA 1PJ4A 1NR1A 3Q9NA 1J4AA 3KEOA 3MTGA 3TZCA 5KJCA 4QFDA 2D8AA 4IDEA 3N7UA 4N5NA 3PRJA 1Z45A 3BHMA 4GH5A 4RDHA 2W2LA 3WMXA 2W90A 4LCJA 4YAJA 2OO5A 4JIGA 1E3WA 1FJHA 5GZ3A 2W2KA 1AN9A 4E4YA 4FC7A 1BVUA 4O1MA 1QRRA 4U5QA 4I5DA 4NJOA 5EINA 3I9KA 3X2FA 4LVCA 4ZQEA 1DIBA 1XQ6A 3PJGA 1DIAA 1SC6A 1KC1A 5JMWA 2YFHA 3DXFA 1SBYA 1I5RA 4GI2A 2BGLA 4U0JA 4D45A 2FPPA 1HTBA 4CR8A 2PD4A 1ISIA 4AJNA 1LEHA 1W0CA 2D0IA 4GL4A 5C3MA 4I5FA 2B4TO 1C0KA 1LI4A 4WLVA 4OXNA 5COBA 2HCTA 1UDAA 4CLOB 5JDIA 1TVEA 4UUNA 5JAZA 4NBRA 3SJ7A 4BO7A 1UP6A 2DU8A 1GV1A 3NKLA 2PZMA 2P9EA 2X0JA 4J91A 1NQAO 2PKQO 5F21A 2NNLD 1DB3A 2Y0CA 1LSSA 3KRTA 1SCUA 1W4ZA 3LU1A 1H5QA 3RC7A 4AJOA 3NUGA 1EK6A 3P7MA 2AG8A 2ZJ0A 1OBFO 1GPJA 1GQ2A 3VHRA 1GADO 4J7XA 3BTSA 1XU9A 1QV7A 3D1LA 1I3KA 1E77A 2FPGA 3SVTA 3KEQA 2AHRA 1PJQA 4EBFA 5JY6A 3W4IA 3ZNPA 3F1KA 1J49A 5I7VA 2H6EA 1HXHA 4OKNA 4FB5A 4AJKA 1F14A 2O50A 5DBIA 3L0DA 5B4VA 2Y1OA 2AQ8A 3ICCA 3OIGA 1H6CA 4TKMA 3PHIA 1B7GO 1EDZA 5T73A 1O5IA 2P4HX 2GRAA 4U0KA 1BG6A 5CFZA 2GR9A 3KXDA 4BO6A 5KCZA 1LDBA 4CLRB 4J6FA 2DKNA 1ZXBA 2X5JO 3EC7A 4NJMB 2IE0A 3TF5A 3BXXA 4IQ0A 2FR0A 5HWSA 2Q4EA 4B8ZA 3MJEA 3P2YA 1XKQA 4R16A 4CR6A 2D3TA 1XWFA 2VRBA 4K26A 2DQ4A 3DTTA 5KOIA 3RROA 3ZI0A 2EERA 2O3SA 2EXXA 1ZH8A 3JD3A 3NRCA 1H2HA 4R69A 4OMUA 1PR9A 5CEFA 2FZEA 3ANNA 1WNTA
chains in the Genus database with same CATH superfamily
5J4HA 4YRNA 5AK4A 1E59A 2MU1A 2V6GA 5SYAA 1TJYA 5CNIA 3VDRA 1TQ6A 1ZIDA 3QNUA 1R6AA 4FKBA 4ZVVA 3SEQA 5LN1A 2ASVA 3A4NA 3QF7A 2BM8A 1SM4A 1XVIA 3U7HB 3KUUA 4L28A 4MUXA 5CEJA 4KQWA 3JQAA 2Q46A 1IOVA 2NO4A 2WEKA 2FOXA 3C24A 3GCDA 3C70A 5DE3A 1JAIA 4DSNA 3KNZA 3FX2A 1VIVA 5IF9A 5FO1A 1YAJA 1M73E 5DGHA 4KPUB 1U4SA 2F1IA 2OR3A 3FDXA 4IIUA 1RJGA 3T4UA 4ARAA 5JYEA 2ECOA 2JAOA 1LQTA 2XV1A 3WYNA 1Y8CA 1L7EA 1PTJA 2C5BA 3JPWA 2EKZA 4NCHA 1ZXLA 5I51A 1AQJA 1DRKA 4Y1RA 4HNGA 4DWJA 1LW6E 2G4CA 1V6SA 2VRNA 4YFYA 3O8BA 1H23A 3G9XA 3VOTA 3C0KA 3ZDFA 5G0TA 3WAJA 1D4FA 4P4SA 3CBGA 3AJ8A 5DLQC 2J45A 2QN8A 5F1PA 4LV6A 3ETGA 5J2TB 4RJTA 3GNLA 1CG6A 3KKOA 4O63O 3KJIA 4HAUA 3JZIA 3N0VA 2QT9A 3CZ5A 1YXMA 4WGGA 4C4TA 1XRNA 4HEA6 3PGVA 1XTJA 5ARBA 4MR7B 1E1DA 1C8BA 1M67A 1ZS9A 2EVWX 1VCOA 3O5AA 4M99A 2HSDA 1B8NA 2A33A 3OZBA 4WTOA 4BO3A 4C6HA 2EL7A 5CIYA 1X19A 1VSUA 1MQSA 1QC5A 1ULTA 3AWIA 3M9XA 4LC1A 5ECGC 2DBZA 4HLNA 5AJYA 4A2CA 4YDQA 4CDRA 1BXZA 2JIZA 3UG6A 5E4JA 3T3HA 3VU8A 3JQGB 4LGMA 3V4ZA 2XJ9A 1E1MA 3GW8A 4K0RA 4BFSA 3MWKA 4CCSA 2FXIA 1YB4A 2ZDHA 2IBSA 1X9IA 3JYPA 2OXTA 2FN8A 1A5BB 3HZOA 4JNKA 3UOAB 4QQRA 5KYXB 3EDQA 4EB6B 4PSDA 1W47A 4KDRA 5DEOA 4ZCQA 5G40A 3SSOA 2ROQA 1M3SA 1YBFA 3TQSA 4R0NA 4KAFA 5T7BA 3T7KA 1AKNA 3OLVA 1VTKA 1OU4A 3MJVA 1XJ0A 4F4FA 3T38A 3ZDYB 4IH1A 3VTAA 1RRFA 4EUFA 1PIWA 4GLLA 4GOKA 1MC4A 4YNBA 3U4DA 1Z35A 5FP0A 1FDOA 2X2OA 4YHHB 4YACA 4D02A 4EGJA 1DC6A 3QBEA 3K16A 1TIKA 3KZMA 3H97A 1BOFA 2VP4A 1AQ6A 2YOFA 4LJ4A 2GOYA 1ZUWA 2Q0HA 1K7CA 2JGDB 2ZLBA 2ZGVA 2IIVA 1A4IA 2Q3LA 3ZE0B 2VUTA 5AW7A 2ANBA 3MMXA 4IXTA 2FSGA 3MLBA 2IK8A 2RGNC 2WHEA 3QM1A 2ZQZA 4NV3A 2R96A 1ND6A 1KQOA 3E8MA 2YY5A 4Z4QA 3T1YB 3OVMA 2BTEA 4ONEA 2O0LA 1TAUA 3MS2A 4OSOA 1JHOA 1YDFA 5FR2A 1LJLA 2QRVB 3SYTA 2G04A 2OO5C 1G5FA 4N8DA 1PBTA 3KLNA 1OH7A 5CCXA 2C9YA 2QAGA 3EXHC 4NPHA 4R9SA 4QUEA 3QE0A 4MV3A 4Y2HA 4DIOA 2G8NA 2WM9B 1N5JA 3OFND 3LXUX 2OV3A 4QULA 2CFIA 4K2HA 4WFQA 3MJRA 2Y1DA 3QKUA 1EXNA 3GA5A 4TLBA 4D98A 3CT4A 5KX5B 3NGXA 2B37A 2CLCX 4QYSA 1X87A 1YC5A 1DAMA 4X6YA 3WISA 1ANKA 3OECA 2NV2B 1OCEA 1YDMA 1L5QA 4FCWA 4EATA 3OJFA 2PO7A 1S8AA 3JYOA 3JQFA 2ZJZA 4OSEA 2NTYC 3V2GA 3MOIA 1EJ2A 1KGDA 2EAUA 3ZXYA 1DBPA 3I12A 2CZQA 4U3JB 2AMVA 5TPWA 4GGOA 4TYMA 2WKRA 4P86A 3LDGA 2VHTA 2WYUA 4TVKA 5HOEA 4JL6A 3WGUA 5DCYA 2AJLI 1JYFA 2ODTX 2NSDA 5HKOA 4P54A 5LP6A 1X74A 2O4UX 1OJ7A 3M70A 2VAPA 2L82A 1E7WA 2OHFA 4IS2A 1EWVA 3NONA 3RODA 2BMWA 5KVVA 3V7YA 3U39A 2QM3A 3JR3A 1P61B 4TROA 2O7RA 1UJMA 2WPNA 1MEJA 5LC1A 4Y2JA 3CINA 2Z6AA 2CC2A 2R1TB 4QE3A 2NZ2A 3SF8A 3ZYCA 3CXUA 3VPFA 2A30A 2HADA 4OY3A 4AYXA 2XLCA 3CVWA 3HFSA 1TFRA 1DVRA 3VPSA 1YOBA 3CUWA 4L9WA 1KDYA 4LTMA 2GESA 3KZCA 1QO9A 1CJMA 4BRZA 4J3JA 4IH4A 1K6EA 4HP8A 4E3ZA 3ZD9A 3RRYA 1URPA 1NHWA 4DMRA 1FZTA 4IV5A 4WESA 4J0FA 5CIWA 1YVPA 1YZTA 2F3PA 4X20A 7AT1A 4JVOA 3I5YA 1BXKA 5IH3A 2VI5A 3D6UA 1G4AE 3WICA 4L22A 3NNDA 3IV9A 4HAYA 4YRTA 2PKRA 3KQUA 5J4KA 5JPCA 3AY7A 4NECA 4FP9A 3B3QA 1T8WA 3G0BA 5C8YB 2WICA 1WSDA 2W4MA 4PN3A 3IHTA 4ZO8A 5AVSA 2O5EA 2ZVDA 1NF9A 4WCFB 4EGAA 5DRYA 1RXIA 3LPNA 1Z82A 3DCYA 3W8RA 3WHIA 3RVQA 1YAHA 4MUHA 4PS1A 4UJ5A 1Z74A 2MIIA 5IM4A 4BXOA 4CEJA 1KMMA 1OT3A 1Q20A 1WB4A 2QW1A 4XR4A 3C6KA 4PQGA 3A1VA 3CNHA 5B58T 3ZV7A 1ZXXA 4IDOA 2G06A 5IANA 4FQ7A 5D3KA 4TS1A 3KS9A 1KAEA 4HEQA 5AH0A 4IGFA 2WT4A 5GM2A 4UTNA 1EWTA 1RHUA 1XMJA 2I1WA 1AQYA 3AQ4A 3LIIA 4MQFB 3IRVA 3D6VA 1R8YA 2P4EA 3ONDA 4AWXA 1CNFA 1EDEA 1HTTA 1GR0A 1RFLA 3DPUA 3FF4A 4J3FA 4S2EA 3SY8A 4JASB 3LOQA 3LQRA 4NMXB 4GLFA 1PR6A 1XOIA 3G2KA 1B00A 3JRXA 1WMFA 4G84A 4Z1MA 3O4RA 4MGZR 3ZK8A 1UH5A 4IQGA 1K5DA 2CNBA 1YQQA 1X15A 2R4QA 1WPXA 5BV1A 1Z8FA 3RFXA 4DIMA 3FCUB 3CLKA 4BECA 4GRIA 5JSYA 1VYVA 3C8UA 1XNJA 1O95C 2RCYA 5JYBA 3O0TA 4HAIA 1G6HA 4CMGA 3RCBA 4YPFA 3ZZNA 1PRYA 5L7TA 2BKLA 2Q8PA 4LBVA 1CP3A 3J81k 2BPOA 2D5LA 2ZRLA 3MN1A 2CLHB 4DA8A 1XD9A 3HE3A 1QNFA 3W2TA 4PCLA 4DCTA 4JFRA 3SXUA 2OPHA 3H5LA 3NANA 1IIRA 1PVOA 4C7VA 2WIKA 4YONB 3NTUA 4GM4A 4MS3B 3MZ0A 2IP2A 4MCIA 5JC1A 3IUQA 1X1QA 5HYVA 1IBCA 2J4FA 2DC1A 2Z8YA 3SSNA 3AF2A 4QIHA 4IRXA 5I47A 4UMVA 1C30A 1CFZA 1EUCA 1QHGA 2COEA 2ZBPA 1J2YA 4X8OA 1O9HA 3M6AA 2BFNA 4EYGA 3OTHA 3R5TA 3THYB 5TVOB 4OOFA 4QYXA 1PR0A 4IJUA 3K94A 1PTJC 5KKCA 1ND5A 1AMUA 3SE7A 3TAXA 2BP7B 3PE6A 1WMEA 4A9AA 3F46A 4WXHA 4DWWA 4GOLD 5TEVA 5KSYA 1Q77A 5LLDA 4BY9E 2Z5LA 3JQCA 4EI9A 2WKQA 3R0IA 1A7JA 2XRYA 2AKEA 2EYQA 3S4YA 4Y98A 3AF4A 1VBKA 1XEXB 4E1BA 3DTYA 1C0EA 6PFKA 4BB5A 4UNQA 1B8PA 1MKYA 1RYNA 4BVAA 1SHLA 1EDOA 2W8ZA 4H7IA 5D3MB 5A2GA 2G1KA 5JEEA 4CL8A 4BE7B 2R87A 4ZKEA 4PRKA 3TCNA 3ZGZA 4I8IA 1WDTA 3B5JA 3B5IA 3CJRA 2JC3A 4D9NA 2BZGA 4DCJA 5BWNA 5C5EA 3AVVA 2X6TA 1SOAA 3FOAA 4Q1AA 1VMEA 1M7BA 2QM0A 5JYAA 2FFBA 2ZIFA 3OCUA 1XI2A 4UTZA 2RDMA 4S1WA 2KW5A 1E4OA 3KVRA 4O1IA 1NXVA 3M1IA 1ZOIA 1HLGA 1D09A 3RT1A 3F49S 3UQYS 4PCUA 3KUXA 2WYOA 4WLOA 2Y27A 3IIKA 2PDAA 5KJ6A 3OQ1A 5BUZA 3JQQA 4JI1B 8LDHA 1P4HA 4DWOA 1BVHA 1J5XA 5H9VA 3U13A 3DL7A 2EGHA 1P6UA 4R2LA 3U7FB 2Z8ZA 3OZDA 1JS1X 3DOOA 5AICA 2ZRAA 1E2EA 1MRZA 2W7TA 5E7IA 4H9GA 1D5WA 1XD8A 5DI3B 3KFLA 4W5RA 1IMJA 1TCAA 1O6FA 3M4JA 3P9ZA 4UVDA 2FW8A 3QX7A 2JGFA 3DE2X 1BGXT 1AXEA 1TEXA 1ZI9A 1XD2B 2KWIA 4BB0A 2OFXA 3OEWA 5DBHX 1ORHA 1CYDA 1UK8A 4KVGA 2IEIA 4OMFG 5EIOA 5I7UA 3NDBB 3WRYA 3PWKA 2EFGA 3ZQ4A 1Q2XA 2LDXA 5KQRA 1PKEA 4UFPA 1F3LA 1U7HA 3M6IA 2YXPX 1ZIOA 3GNQA 3WIDA 1HLPA 2EX0A 2PL9A 2XMZA 3BYZA 2P9CA 2IX9A 5D01A 4JB8A 4ZWNA 4RTNA 3ZE1B 1PJ8A 2VPIA 4PXSA 3K2BA 3F6SA 3TMKA 1J1UA 3KYDA 1E9DA 3NCTA 2Q4RA 3BWXA 1C9EA 4UUMA 1CQXA 1M2GA 1PGOA 3ESZA 3OMLA 5FNZA 4BP3A 2OG2A 2A35A 2BMVA 1BE0A 4P9NA 4BOYA 2X9LA 3RUCA 5CRIA 1W1WA 5ICGA 2WBLC 1F2UA 2NV0A 1ZD8A 2QAGC 3HCWA 2C96A 5L45A 4BYMA 3FI0A 2Z08A 3D7NA 1DRUA 4HGPA 4V0SA 5CG2A 4CKCA 3BF7A 2F9FA 3FNGA 1WOMA 1LVHA 4X63A 2FOLA 2XTNA 4JXJA 1RKXA 1L7AA 1PNVA 2WTUA 1PGJA 4H7EA 3ZQUA 2PLAA 5IUJC 2YBEA 5KHOC 1MB4A 1U3UA 3I9V6 3KU1A 4FGUA 4LAFA 4P4LA 2BFBA 3UAXA 1YWGO 4PSVA 3JQFC 721PA 3ZDQA 3TM5A 3I2JA 2AF3C 4X1OA 5KYUA 3O3NB 1M66A 2XIJA 5ALYA 4IXNA 4LZPA 3PDIB 2R6GA 1A7AA 1QKJA 1P31A 1BKSB 1YS2X 1KR5A 2EFEB 1PJ3A 2GBPA 4J94A 4RLFA 2Y3IA 3ZLTA 3CPSA 1R0WA 2ZYAA 3EB9A 3K8YA 1ZCFA 1E58A 5GGXA 4RF3A 5LP6C 1XTUA 2ZIXA 3FNEA 4G0QA 3PZBA 5B1DA 5KTKA 1F60A 4FWIB 3L2OB 5B12A 3T7RA 4WKBA 5HZKA 2JB9A 3V1UA 5EERA 2OORA 4MKRA 2QBYB 1M0SA 1GPUA 1HFJA 1IWPB 2IITA 4Z0TA 3UN1A 3WK7A 3EPLA 3ND7A 3NM6B 3MFQA 4B3HA 4CLQA 1PJ2A 1T2CA 1S01A 4R4JA 3E1SA 5JMTA 1WW3A 3LP8A 1I7CB 4JGGA 3R8XA 1DG9A 4RGBA 2WZCA 4OQEA 2XGJA 3IAS6 2W6QA 5DP2A 4PBTA 1W96A 3FPLA 2P1ZA 2IUEA 4E6PA 2ZREA 1NRJB 4Y6GB 3BAZA 5F1KA 1YKSA 3KQKA 4WW0A 1SHKA 3TOSA 5BSEA 1KAGA 2R8XA 4Y6PA 3WGLA 1IM2A 4FWBA 3QWIA 5TSDA 3R76A 1Q50A 3N3AC 1XTKA 3PTZA 3RADC 4Y6QA 5TNXA 1OILA 1PQWA 3QXGA 3DOIA 1V8PA 5C51B 1L9XA 4DPKA 1W5TA 2TYSB 3EDYA 2NUAB 3N76A 1R8QA 1YR2A 2CNWD 2V0CA 4G8JA 5HJ5A 1T3SA 1W5EA 5U4XA 3WSTA 4CMKA 4MINA 1EX6A 4TV8F 4D8TA 3QPWA 5EFZA 3HC7A 3FDIA 1R6VA 2XVYA 1Z5NA 2V0NA 1UBRS 4YJHB 2C7QA 3TLCA 3B1JA 3RC9A 3K3PA 4AN4A 3DCJA 2I3DA 4XB1A 3BZUA 3QNWA 1VBNA 4YT5A 4C3OB 4KPUA 1AH2A 4UUQA 2V9ZA 2QRNA 1KWGA 3VYRB 2OXRA 1Y7IA 4J43A 2BSAA 5FEUA 1NI4B 1XCBA 2GARA 2P0AA 1L4EA 3ED5A 1KE1A 2BSXA 2CHEA 4NF2A 4PNHA 4AZ0B 3PQ7A 2BHLA 2BGUA 4IMJB 5HCIA 4YCDA 2V74B 1WMDA 1OWMA 2C4WA 2ZPUA 1E2KA 1Y0BA 3KB8A 1XRQA 3M6VA 5CT5A 2O7SA 4ZEWA 3WDSA 1EQUA 2P2LA 2B4QA 4IGIA 5CK5A 1HT3A 1A1VA 4D43A 3H5VA 5CNKA 2CLOB 5JYDA 1JDVA 1OB5A 4BVHA 4P4GA 3ONEA 4XOUA 1M1UA 1XYVA 2F67A 5IAJA 1ZD3A 4LYGA 3IP8A 1R9JA 1LWNA 2CB0A 5DWQA 2RC6A 1Y98A 1VI2A 2IHJA 3TOZA 1EHCA 2BEUA 4CF6A 1CX9B 2L19A 3GZ4A 1SEPA 3GCGA 1IXYA 4GX1A 1HE4A 3LL7A 4WOJA 3I0ZA 2LCQA 2F48A 3DOEA 1KZ6A 1Z56C 1SUWA 5G1OA 4IHAA 4C3ZA 2QSUA 3A4LA 3EA4A 1UC8A 3B3AA 3JQGA 4L5BA 4QXAA 1O95D 1AG9A 5CFNA 5B7PA 4FEGA 3H6KA 3UAGA 3QXCA 3UJ6A 3WP0A 3TTXA 4BFWA 4XUGB 5I7FA 3S8EA 3CVUA 3A1EA 4EB6A 4I3HA 1O6BA 1WOYA 3PFWO 1NZFA 1X14A 2VCHA 5BMVB 4X65B 3MUOA 2Q3JA 2XCOA 4NC9A 3WIVA 4AQ7A 1B74A 3O8DA 2RAVA 4HFMA 5J1TB 1QZTA 3IH5A 1KEUA 2DBYA 3M34A 2JFXA 4IV8A 3KG2A 3JQAD 2CW5A 1Q1AA 2QN2A 4IEFB 5EXDA 1DTWB 5ULLA 4BQOA 4P34A 3M1YA 4YDSA 4Z5XA 1N6NA 2MTBA 2DFDA 3ZWAA 3S3TA 4DR5B 2JZNA 4AQYB 1FW8A 4L9SA 4KQ6A 2EF0A 3Q72A 2BFWA 4CCAA 3MRTA 1NJ2A 1XTIA 2BSQA 3VI3B 4DA7A 4RACA 4PFKA 1NZDA 1B2LA 3BGVA 4H77A 5H0IA 4UVIA 2AR7A 4MRNA 3DFIA 5B1SA 3RTDA 5A7HA 2C7RA 3A3NA 4IIXA 4OGWA 3A1SA 3GFOA 2W93A 4U8GA 3J80A 3TRIA 3BL6A 2YINC 4G5HA 1QXSA 2G4VA 1II0A 3MWJA 2WHPA 3AU8A 4XLLA 4CTMA 3NHZA 2I66A 1XDUA 5SICE 2IOFA 2XVMA 3QVVA 3OJ0A 2IEBA 4GQIA 2ICAA 1BU8A 2O2EA 4NL4H 5CLLA 1IY0A 2DT8A 4WNYA 1Y3DE 2FE4A 3DDNA 3MJ4A 4GC5A 4TV8A 2ZB2A 3DJFA 3GELA 1I24A 3I2HA 1UBEA 3K72B 4D5EA 4EPVA 1LLDA 1QLJA 4L72A 3JD1A 1SUDA 2YV2A 5AVOA 3HN7A 5CYOA 3QVTA 3KR1A 1E2FA 4TT3A 2OZPA 2J3JA 3PEEA 4B3CA 1Y6QA 3JXEA 4H0CA 2JIZD 4YASA 5EI5A 3P0FA 2GYVA 1SOWA 5KX5A 2CE7A 1BX1A 2E4WA 1O9BA 2I4NA 2XZPA 1CUUA 2G1JA 2XODA 1YB1A 2O8VA 5KDLA 1KWKA 2PUGA 3TQHA 2X5NA 1E2JA 3VJMA 3RVLA 4NU0A 1VJ5A 3L0ZA 3EBOA 3OQJA 2IPLA 4BV3A 5T4EA 3LYHA 3OZUA 1NW7A 4EKNB 4U3JA 2XGSA 4B6GA 2ID8A 2GD1O 4MHSA 5CBKA 2Q1XA 1DRVA 2VSFA 4WKCA 5A5VA 1YFJA 2FDXA 5A5EA 4Z8YA 2GCOB 1HEUA 4MHOA 3BQMB 4KI7A 2ZI5A 3D2CA 1D6SA 3PJEA 5G4KA 3TW4A 1H93A 3L79A 3IUJA 3L07A 1Y5MA 4CQJA 5LZ9A 5FHQA 2G71A 1XZIA 4LVUA 1APBA 5ERXA 1SQ6A 4B5KA 1DKOA 4AY3A 1VC2A 3RG8A 4MWSA 5AUQA 3ULKA 1TAHA 3P9YA 4RVHA 3DEIA 4D4KA 1AHHA 4EA8A 2R1TA 2QRLA 5T67A 3F3SA 1TYZA 3HXOA 3KQYA 4L07A 4KE9A 2R7LA 4UHJA 5EXPA 3UKOA 4AECA 4PZPA 1CRPA 4BVJA 1JXOA 1NKTA 3JS5A 3KQTA 4ZOAA 5IJZA 4LVNA 2ZYVX 2CL0X 5CH5A 4HVCA 5K01A 1U3DA 4KQ9A 4TYQA 2WWRA 4GE0A 4B3DA 1CEEA 3UJHA 3AR2A 1CLUA 4J16A 4PX2A 3VYWA 4EYKA 5CVJA 4XM0A 2VPWA 3DLCA 1CNMA 4FFNA 1FIUA 4DV2B 1HKHA 5U9CA 1NSTA 1E3QA 3Q7SA 4UREA 3QY0A 3BRQA 5I3ZA 3AEQA 4OQZA 4PYIA 1KJZA 2ETXA 3O8QB 4EYSA 4Z9FA 4PYQA 5ILOA 1IUPA 3EGCA 3KSUA 1KO4A 4ZQBA 2V3CC 2FK8A 3EVBA 5I4IA 5F12A 5L3VA 2IYZA 4YFVA 4MDFA 3CZMA 1UKCA 4TKVB 4W1RA 4AULA 5AVYA 1OXBB 4C43A 3I62A 2QJRA 2MOKA 2GKSA 1PV4A 2OOKA 2J6BA 4I8DA 3Q15C 1MAHA 2QPTA 4OGKA 4P92A 4KQJA 5DHTA 5TEWA 1FJXA 2REXB 4PEVA 3G5TA 5A3JA 2QX6A 4OAQA 2AG0A 1TLLA 2B7LA 2NQTA 4Y6SA 3TW0A 2GTHA 1XTBA 2H0AA 3OX2A 1M2FA 3DUWA 3KLOA 5FWYB 3HB4X 1GUYA 4H18A 4INOA 5JXIA 2ZUSA 2C4KA 3Q9UA 1S3GA 3QIAA 4V3CA 4JLVA 3PRHA 1T36A 3HKBA 2R6AA 3HO8A 1JLLB 3LKVA 3M5WA 4EEXA 1ZR4A 4MQFA 4JB3A 2OORC 1WXDA 3IPXA 3VC3A 2BFPA 4XVQA 4GPBA 4PYRA 2C0PA 1A77A 2GWRA 2IOFK 1KMNA 3AUSA 4FFVA 5HF6A 1JEYA 1GSIA 3QKSB 4L0QA 1I14A 1UFRA 1CYEA 1YNSA 1EX9A 2G09A 2GYUA 3SNKA 3URKA 3V55A 4EQ6B 2WWHA 3BK1A 2P6PA 1NGSA 3V34A 2OFPA 2BJVA 3BXOA 3MAAC 3T5GA 3U5ZB 2LXNA 1V25A 3EVTA 2WQZA 4HVAA 3VISA 1K97A 3W5DA 1V5FA 1YB5A 1R1DA 2AXEA 1FS5A 1DHRA 2K6GA 4EY7A 3OI7A 3U3OA 1YS7A 1HT0A 2EFDB 3H0CA 4U1RA 1K7YA 3G5MA 3H9BA 3N6VA 4L75A 3FGZA 2UZ1B 5JZBA 1M5RA 5FTNA 9ATCA 3EDMA 2HK7A 4W6QA 4L8WB 1TVKB 2QUHA 3RTCA 3ZUPA 4MS3A 3ROZA 3EOZA 5SYNA 2SICE 4JU9A 2QD1A 4EG1A 3TEJA 3I6YA 1GGNA 3IMEA 3KHUA 5LDHA 4AY6A 3OQBA 3TH5A 1KJWA 1W48A 3ZPXA 2NSJA 5BN4B 1TZCA 3O9ZA 4WKNA 2BP7A 1V48A 1U0RA 4JSYA 3LY9A 4TQ9A 5K5EA 1UPAA 5L4NA 3IFSA 3EP5B 4Y6LA 5JHGB 3B1XA 1L7QA 1YZYA 3NMUF 3HJUA 3HYNA 4LJKA 2ZI3A 1E6MA 4JVNA 4YV2A 1TT5B 1F5SA 2DHQA 3A6ZA 4F4IA 3SJBA 3ZLJA 2ZB7A 1A4UA 1D8AA 1NBAA 3GBSA 3O1HB 1LRLA 2J08A 2LCIA 1PFGA 2XCQA 2UAGA 3MC1A 2ZIWB 3HZRA 4JBYA 1XNQB 4KG7A 3EIXA 3LVRE 1S0UA 4Z1MD 4MITA 2VJPA 2F1JA 4D25A 2GAJA 4FDVA 4OJTA 3GROA 1QZZA 2GZHA 5MN6A 1K8ZB 4BLOA 2AEJA 3IEKA 4PCVA 3S1AB 3N58A 2C83A 4HO1X 4K6MA 4DLVA 4GZ3A 4LMRA 2PSFA 3U0VA 1TUEA 1UBFA 3DR5A 4H16A 2R8BA 3C14C 2A1UB 4RZSA 1EXWA 4IUCS 3GUCA 1QB7A 4KGDA 2BISA 2JBHA 3CZ4A 3R24A 5B53A 1T4CB 3VI4B 2OBLA 4YP7A 3JYHA 2I34A 3PHBE 4FOSA 3RVSA 4M6WB 1A72A 4PHCA 3TQRA 5KVCA 2O59A 3OE4A 1U7ZA 4NG4A 4ENPA 4TL8A 3FY4A 3F2VA 2WJHA 1UODA 3UHOA 4ZYYA 4I55F 3V7WA 5ALDA 1T1RA 5DI3A 2FFHA 4FHEA 3P8ZA 4LK2A 2O2IA 5JNSA 1HDCA 2NU8A 4QRHA 2P2CA 1P77A 1XD2A 2FTKE 1JIIA 3C8HA 3PRYA 5K03A 1QNLA 5MN4A 2OKCA 1IK4A 2OGTA 5REQA 4B9EA 4D9GA 1YQ9A 4LFCB 3ANXA 2VDQB 5DK6A 1HE1C 1OXVA 4PU0A 3ZLVA 3E7FA 1Y1TA 4J7UA 2HM7A 4YRDA 4KPYA 4PANA 3W2GA 1BCRA 2WT9A 5KSPA 1RCUA 1ZQ1A 1YBAA 4Z7JA 2PV0A 2H4WA 1EJ0A 1W2GA 2PPLA 4YRZA 2AFHB 1DO2A 1IULA 2WWTA 1NVVR 4IQFA 3H9JA 4ZYTA 4K86A 1IXKA 5B4TA 1MZPA 3ZX5A 3BKWA 1GUFA 3QW2A 3JQRA 3RC1A 2F90A 2A5GA 1OPXA 1O96B 1YCHA 4JJ4A 4K28A 2Q4DA 2BW0A 4O4IB 4MJLA 5C1IA 5KDDA 1KKLA 4QGFA 4F5ZA 4DV4B 5D5HA 4DR1B 1G20B 5EZYF 3NTXA 3B85A 2JH8A 5IASA 4MYDA 1STOA 4EKYA 1W88A 3NXSA 3HU2A 821PA 3KETA 2XVXA 2R47A 2YJZA 4KFRA 1YF3A 3I6BA 1SC3A 1Q84A 1F9EA 3L04A 1E7SA 4OIMA 1XZMA 2D2FA 4O4LF 4QPZA 4BFVA 4QPNA 1HSOA 4R1OA 3RSFA 2RGDA 2DSNA 5KYTA 2RAUA 2QNBA 1Y82A 1EVLA 4NS1A 3UT6A 4FFRA 4JUCA 4TTTS 1EESA 1O94A 3HKDA 2B4YA 2H54A 3IT2A 5TJ9A 2WKSA 3PDIA 1BX0A 1I5EA 1ULAA 5DBEX 4DLSA 2B5VA 4Y18A 3E4DA 4D4GA 1TMYA 1N6PA 3RK0A 3ZX4A 1AHIA 1II8B 1R10A 1WKVA 2V7PA 4TMZA 1K9VF 4IDQA 5EIFA 3TR6A 1EB8A 3WRXC 4QXOA 1D7OA 3EVGA 4LRXA 4DLNA 4PW0A 1U8CB 1XDDA 1HQYE 1ORWA 2QBYA 1XVLA 4NQZA 1DO8A 1D1TA 1SK9A 4BJ5A 1RCFA 2IYFA 2XGGA 4HWOA 4J9VA 5C53B 1GPBA 4LISA 1G8PA 5BWBA 2RJOA 2QEQA 5GAJA 1JZQA 5ALMA 2CJWA 4K81B 5C5DA 1Z83A 3VH4A 2WKWA 2WU3A 3WI7A 4P3OA 1TGYA 4B3JA 4JCOA 2VK2A 2HA2A 5IG2A 1WKBA 4TQGA 4WK4B 1IJEA 2NTJA 2P30A 3TQFA 2QJFA 3E7PA 3GVIA 1J7KA 1PLLA 1Z22A 3FWNA 3OCWA 3R8CA 1KZ4A 5GONF 2FPOA 4RMHA 4MUGA 1PEAA 3FOBA 5AJWA 3ET4A 4AG6A 3TW3A 1YRHA 2I87A 2YWRA 1AK9A 1NNLA 2PVPA 3H5RA 4LXYA 1FX0B 4M7RA 4TQAA 5B3JC 1T8PA 1A82A 1NVXQ 2AFVA 2XYGA 3ITNA 3M3DA 2II6A 2KMLA 3Q40A 2GD6A 1ZG3A 4HRAA 1Z6ZA 2NUAA 1W4CA 3FKJA 1E5QA 3Q1LA 3IT1A 3MWEA 1QQ7A 4QHYA 1NMXA 3PWTA 3GLGB 4M1MA 3LF1A 1LFDB 1NT2A 1TK9A 2AG5A 1UJ4A 2VBGA 4YT8A 3P96A 2O1SA 3A9CA 2R65A 3QVGB 5EWJB 2YMPA 2GFQA 4WCFC 3FBGA 4FTWA 1WZNA 4M4SA 1YBVA 4OHUA 5AJXA 3MAGA 3WBKA 3QV2A 4ZFNA 3LK6A 4G0NA 3N6RA 3FWPA 4S35A 2JJQA 2IDZA 3CNNA 4TTRA 3ANSA 4LKRA 1LTQA 1T5DX 4F93B 5BN5A 3DMFA 2VBCA 3PX2A 2CXSA 5JAUA 3ZWXA 2BL4A 2H4JA 3GXBA 5B30A 1KVTA 1XZAA 5JBNA 2IPOA 3MCVA 3LAWA 4ZO9A 1CFJA 5D86A 5TQJA 3KDPA 5F33A 4CV0A 1GTVA 1I79B 1OGIA 1ULZA 4A6PA 4TN5A 2G83A 3HTXA 2XBLA 4YJ2F 2HU5A 3MK31 4ND7A 4EHBA 3PHCA 5EZYA 1K4MA 3AY6A 2HLPA 3MTBA 1L6RA 5CNMA 3HVRA 1NY6A 2V3WA 3RJMA 2JLZA 4WX2B 3VDXA 4I4TF 1N2CB 1VPTA 2F59A 1Z6TA 2ET6A 5A3RA 3PQ2A 3OOHA 1ZOSA 3NHRA 1JEAA 2Z5FA 4HYTA 5A0TA 5JS1A 1VLZA 4FW8A 3AVOA 3WYAA 3DZ4B 3U3MA 1ZI8A 1BJRE 3AB7A 2FDRA 3HCFA 4YMVA 5BNWA 1YS4A 2C98A 2PS0A 4GXTA 3Q5EA 2QN6A 1FUKA 2GPJA 4EF4A 4DB4A 2I1QA 3IAHA 4ALKA 3ABOB 3HY6A 4DOMA 5L9AA 1L6IA 1H1DA 1PDVA 2G0NA 2O23A 3FIJA 4GSLA 4QUJA 4Z0NA 4G5FA 5C31A 1KFJB 1OC2A 2QSJA 1JJAA 5E6RA 3E7XA 2OXEA 2A59A 2YCBA 4KXLA 1KDRA 1EFPA 2IW1A 3BD7A 2JGJA 2NVUB 3HXLA 2J9YB 3RC2A 5T6BA 2H85A 1QWSA 3ESCA 1AMNA 3T9AA 1JQAA 1UXHA 1GZ6A 1SUAA 5JADA 4PC2A 1W73A 4MO2A 1JH9A 1EEXB 1L5YA 1QP7A 4Z9YA 4R9VA 4IHJB 4EZIA 4IDDA 4I4CA 4FN4A 1L5SA 3ZCUA 4JLOA 2WRZA 4LJ5A 3RUPA 4AK1A 2ZQ5A 4PZZA 2W2NA 3CZPA 3M1LA 1YS1X 4HPJB 5TDHA 1B8UA 4RVFA 4JNCA 3COWA 3B6EA 1IC6A 3JV7A 3EODA 3PQ8A 2F1HA 2XTZA 4EUNA 2O54A 1I80A 1DJMA 1O03A 1GILA 3GCZA 1FJ2A 4YJFB 3VH1A 1XZFA 1JSCA 4ZAWA 1FMFA 4CMHA 3D6NB 2V55B 4L9RA 2X6RA 2YYYA 4FYKA 4JI2B 3GDGA 1KEVA 4QVIA 4KFUA 4LJLA 4KR2A 5C37A 2CN1A 5EHIA 2WJYA 3R9KA 1YR6A 2JHPA 3V7UA 3WWCA 3FDZA 2VP3A 5BVHA 3O7WA 1F6WA 2FETA 2BMAA 1JAHA 4PLHA 1RQ7A 1TKCA 3H7AA 3AHCA 1CDDA 1NQXA 2ZSAA 4FFSA 4M83A 4QA9A 1I6KA 2EKQA 2H8KA 3KUDA 3MHPA 5C9ZA 2P67A 4W5HA 2ZUEA 4LJSA 3DHYA 3V8RA 2PUVA 3T52A 3NT5A 3GC6A 4IINA 4BO2A 2AMYA 4J8PA 1ZSVA 4PC1A 1UEJA 1M33A 1V16B 4IIVA 2ZUFA 1E9RA 5K8LA 3EZXA 2ZT8A 4PAWA 1WR8A 3UCXA 4V0ME 5BMOA 2AR9A 2CCKA 3VFDA 5F9MA 4A0FA 1N5KA 1H3NA 2CCGA 4JP8A 5CVVA 3SHTA 4DQ0A 3PQCA 4EG3A 3QVKA 5BR4A 5CFLA 1WF6A 2NPOA 2P2GA 4BCBA 2FVYA 4R9RA 4ZTZB 4MRSA 1T5LA 2IRWA 2HO4A 2ZU0C 4I4TA 2HSGA 5EUCA 1Z4IA 2ARKA 4NZNA 3CRW1 2Q0SA 1N9ZA 2R84A 3MMPA 3IOYA 3UOGA 4ZZ2A 3ETNA 4F4CA 3AR3A 1HE3A 3E61A 2DWQA 2QTZA 1IBKB 4QOJA 2J7PA 1SO8A 4RQBA 4N0PA 1Z0KA 3EAFA 5E9AA 5FPPA 1JHRA 2WT8A 3TL6A 1M2HA 1YL5A 1N75A 1A5ZA 1TD1A 3BCHA 5A4FS 1QZ3A 5BQXA 1MW8X 3ZHTA 5L4LA 1V2GA 1FFXB 4KWEA 2NQ2C 2HWXA 5KTTA 4WGFA 1KKUA 1SPBS 2D1YA 1NMQA 2REQA 4AZ3A 4QUAA 3OPVA 1Z8HA 1HYEA 3F9IA 1XJQA 2F43B 4RFSB 5TX7A 2LVBA 2ZBRA 3PWSA 1EFTA 3B1YA 2A5LA 1GL3A 2XKJE 3KLMX 5I9TA 4XQGA 3CLSC 3O8QA 3IPLA 3KUCA 2OGUA 3DLIA 3JU3A 3ZDCA 1ADYA 2NT3A 3UGKA 1D6NA 2IKQA 3E9QA 1JDJA 1G3UA 2X6QA 1U7UA 2RMKA 4KRYA 4LK3A 4C7MA 1QPGA 1VE9A 4PIPA 5D7BA 1QYRA 5DBOA 2UZ4A 1O94C 1SCBA 1MAWA 3UUGA 4HLCA 3NPAA 4HJRA 1M1YB 3GP5A 5CXSA 4C2AA 1NKVA 2ENWA 3IELA 1NUPA 4NOJA 3KHTA 4UXJA 2V59A 1G1MA 1F7UA 4QM6A 1AE1A 2QTMA 4WV3A 3M33A 4ZREA 5E38A 5DWDA 3V4OA 4AAYA 3IKLA 5FWYA 1XEAA 1K06A 1VYUA 2QTWB 3BE8A 3VSCA 3FYCA 3HACA 1BXRB 4K40A 4B47A 2B4AA 1IJFA 1BWPA 5K3FB 2AX3A 2Y6UA 4JLJA 5A4AA 3RSSA 4DLZA 5LD2B 2GX6A 2H1VA 1Z13A 3I09A 1ZN8A 2AXPA 3E35A 1FFCA 3DZKA 3O4IA 4DLBA 1QWOA 3BIWA 4WXPA 1LS6A 3TCXB 4B75A 4C20A 4EKGA 3CONA 1ZA2A 3VR5A 5FFFA 4XSGA 4GP6A 4NIMA 5FKJA 3WGIA 3K0HA 1DAIA 1IXRC 3CUYA 1AKRA 1QCZA 3I05A 3K09A 2BBOA 2PUTA 1N2ZA 4EQ6A 4RZHA 2XWSA 1SVMA 4KQKA 2GHIA 2VTBA 2LBPA 1OFIA 3EPBB 3WK8A 3KEMA 2PZLA 3GVPA 4MP3A 3CVXA 4KITB 2HV9A 4IZ6A 3T3EA 4ZZ0A 1GT91 1E1LA 1V7ZA 3PPWA 4PN7A 1U7OA 4KGVA 4WLNA 1PKXA 3D4LA 3E84A 5DSTA 3GGPA 4BNGA 2G7ZA 4H27A 4HXFB 3REOA 4D0LB 2GEFA 4JP2A 9GPBA 4ZANA 3E9RA 2FZLA 2W6MA 3Q10A 4KC0A 3GEEA 4C6RA 3AESA 4GUDA 4GQBA 1EUDB 4LOAA 3BJMA 2OHHA 3WGOA 5GIPE 1E1KA 3L4JA 2XCRB 1OI4A 1Y6RA 5K8JB 2Z3VA 4H3KB 4WOPA 5IC6A 2I6FA 2VK4A 2JGNA 2GF0A 2Q5FA 2PXHA 4KN5A 4K9KA 1XZKA 4RVDA 1FRNA 3TRFA 3W2EA 4C04A 3SEZA 1BXGB 2PSHA 3LS2A 5JC8A 3ISJA 1T4GA 4AS2A 4FXOA 5JE8A 1JQ3A 2CHVA 2UYHA 8ABPA 2JL1A 1XLTC 3R0QA 1P7VA 5ALEA 4N5HX 2C31A 3DKRA 1J2EA 2GCGA 1YRLA 2R8RA 4FCTA 4DIEA 3EIOA 4MW5A 4BFTA 3X0DA 1N5MA 3NT4A 2G72A 1Z36A 2WC1A 1XWWA 3W8NA 3ZU2A 1JT2A 1VBFA 5HKKA 4EHIA 4N39A 1KDZA 5E6UA 2EDAA 1G5HA 3O4GA 1OI3A 5AJVB 4ALIA 2PHZA 4ZD6A 5K8UA 3H16A 3N8DA 4B84A 3VPDA 3P45A 2VHJA 3ONNA 3QV1A 1REQB 2OAQ1 4EO9A 4MUJA 4RV5A 3S1AA 1AK1A 4YH1A 1Q7BA 3KU4A 2BDTA 5KEIA 1MCZA 3GJYA 5UKDA 2C2BA 5BR7A 2BGGA 1JW9B 3OZTA 3K20A 4MW6A 2YMMA 2WR8A 4R1PA 3OD1A 1FDSA 1CE8B 1Y7PA 4FZRA 1CZHA 1G3RA 2NXEA 1K86A 4EX7A 4M6WA 4G67A 4G8DA 2BY4A 2ZWPA 1B42A 2QE7D 3OJWA 1MA0A 1PT6A 2YVQA 3KXLA 1EQAA 2D0OB 1AURA 5EHGA 5CG1A 2J0VA 2H2DA 1T4BA 2RG1A 4A82A 1IZ0A 4OKIA 1XKLA 3FOZA 2PCJA 1W75A 1E9BA 2NO6A 3JSXA 4K2AA 1Q0QA 5FWXA 3D3KA 2E21A 5K0LA 1FMTA 2VTKA 3Q2IA 2X4GA 2JA1A 3AI7A 3ETDA 5BSMA 2FW6A 4DV0B 3OU7A 4JJAA 3R5XA 1IM5A 5E8JA 3FPBA 5BW5A 3OZIA 1KYYA 3AKEA 1FVOA 5IJWA 3E6AA 2BJWA 2V03A 3KQWA 1V47A 5KSOA 3OQVA 1A9XB 3ZD7A 2J3IA 4LQ4A 4IDFA 4OB7A 2XXAA 3RSGA 1GHTA 3KVVA 1W0KA 2JCSA 4LRWA 4NARA 1OW3B 4TV9B 2FWRA 2HCBA 3W1EA 4CM3A 2FH5B 3JYQA 3ZVNA 2AFHA 4GBMA 4L50A 4BZPA 1E3JA 1ENOA 2OMEA 4Q1CA 2A1IA 2G25A 4ITVA 3NBMA 4W9RA 5E2BA 4F4DA 3TV1A 4N3CA 3QU9A 1JU9A 2MJLA 5LP6F 3HDVA 4JT2A 2TMKA 1O96A 4M1SA 1UJBA 1THZA 2YJ4A 5CT4A 4OG2A 1ABEA 2QRQA 1R0YA 1GYRA 4WJZA 1SIWA 3B2NA 2C5HA