1LC3A

Crystal structure of a biliverdin reductase enzyme-cofactor complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Biliverdin Reductase A
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 96
structure length 292
sequence length 292
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc3A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc3A01
4J1TA 3INRA 5FI3A 4DPMA 4ZVVA 3SEFA 3B6ZA 4BKUA 2BI8A 5JAQA 2DT5A 1EZ4A 1R12A 4G65A 4EUEA 4HKTA 1AN9A 3E5RA 2C2YA 3TFQA 3UICA 1DFIA 1AE1A 3PXXA 4E32A 2IZ1A 1WVGA 1W73A 1TEHA 2UVDA 4H7PA 4W7HA 3A28A 3IOYA 3U09A 4G2NA 3GC6A 4MIOA 3AUTA 3AUUA 1RKXA 1VC2A 3MJTA 3H4VA 3UXYA 1HDYA 4A10A 2DTXA 1O9BA 4O63O 1FJHA 1K0UA 1PL7A 1U2DA 3GOHA 2CNBA 2DC1A 4ALLA 1I2ZA 2JAHA 1VSVA 1SEPA 3V1TC 3KZVA 4YJGA 5ILGA 3BMOA 4CLEA 3GHYA 1GZ6A 1BDMA 1JDJA 2EERA 4YQYA 3GDOA 4WUVA 4CQMB 1K2WA 5IJZA 4BO8A 1U7TA 4XR9A 4OAQA 4AJPA 1O95A 1ZJYA 1YBMA 2R00C 5TT1A 1JWBB 3A06A 3DBLA 2JCVA 1DXYA 4Y8VA 4JGBA 1HDCA 1YB5A 3AM5A 1B3BA 3ST7A 1QYXA 3BMNB 1EQ2A 3AM3A 4J0FA 3ZWCA 1LX6A 4CV2A 1SBYA 1E3WB 2O3JA 2QZ9A 1V3UA 5TJ9A 1KEPA 2P9EA 2V6MA 3D4OA 5BT9A 2J8ZA 3ADOA 1HYEA 5MGBA 4NJMA 3VH1A 1PS8A 1KYQA 1PEDA 1U28A 2HK8A 4CM3A 1E1KA 4MDHA 3HSKA 4GSKA 4CL3A 1SPXA 1EUDA 5M6DA 2CFCA 2ZIZA 2BGLA 1P1KA 2X5JO 3DONA 2GN9A 3I1JA 3JQ7A 4YTEA 4BNXA 4TVBA 4KOAA 4HNGA 5C7LO 3H9JA 5T57A 5HS4A 4AJNA 2Q1TA 4P4GA 4ITUA 2EP7A 1T4BA 3KYDB 2Q46A 2Y1EA 5EN4A 3NRCA 3M2PA 3VKUA 2Z95A 3WTCA 3RI3A 3JYLA 3ZDFA 2DBZA 4IY1A 3PP8A 4ND2A 3M6IA 1IHXA 3H3FA 3NV9A 3NT4A 1O89A 5DF1A 2IZZA 4OXNA 5ENVA 4D79A 3E6AA 5JYAA 1LSSA 1ZSVA 3AOGA 1XIVA 2X9GA 4CMEC 1TVEA 3VH2A 3HDHA 2DBRA 4BV8A 5DP1A 3IC5A 2OMEA 1GPDG 3LT4A 3IP3A 4KDEA 1EUZA 2B37A 4HV4A 1LC3A 3RUDA 4IDCA 1MG5A 4OH1A 3Q3CA 1ADGA 2V6FA 4B7UA 5HBRA 4CL8A 2X86A 2E37A 3FPCA 2PGLA 3ZI0A 2Q4EA 4E31A 2C29D 2EHDA 1U4OA 1IPEA 4PZDA 4TRRA 2BI7A 2C5AA 5JO9A 3Q2IA 3CKYA 3GMDA 3QJ5A 4X54A 2AE2A 1KERA 3F3SA 5DP2A 4EITA 4DGSA 4HWKA 3H3JA 2NLOA 8ADHA 2QYTA 4W82A 1E6UA 2I9PA 2V7PA 4YT4A 5BSHA 1DSSG 2BF7A 2VHYA 2VWHA 5K6AC 2PD4A 3UCXA 5ENDA 1EVIA 1DRUA 1U5CA 2PR2A 2DU8A 3V1UA 3ASUA 3N58A 5EERA 2DUUA 1G0OA 1N9GB 3GVXA 3KLMX 3BZUA 3WQSB 4CMIA 3M2TA 5DNAA 4R1TA 2NV6A 2UAGA 2PGJA 4MIYA 2X4GA 2X8LA 2XXBA 1H6DA 1RYEA 3Q1LA 3PHHA 4I9NA 1R0KA 2V6BA 5T8KC 1CQIA 1ENOA 4W9NC 3OEWA 1Z74A 1DJQA 3D7LA 4R16A 1X0VA 2X5OA 1RPNA 4FFNA 4AL4A 1VJTA 3I9LA 4IJUA 3W1VA 3ZU3A 1Q2XA 1U3VA 2ZATA 3ZV4A 3OEYA 4YWJA 2AMFA 4M54A 5TGDA 4BO5A 4NFHA 3N7UA 1PGJA 2WD8A 4PLTA 3H2SA 4IXWA 3QVXA 3W8DA 2PH3A 3JV7A 3QQPA 3VTZA 4FBGA 2ZCVA 3VPSA 1OI7A 3D5TA 4K6FA 4LRSB 2D59A 4WASA 2FMUA 3CZMA 4L4XA 1P0CA 1LBEA 2OO5A 1XR3A 2J3KA 1GYQA 2VYND 3K73O 1ISJA 4J0EA 4LCEA 2VZ8A 3CMCO 1H5QA 3IKVA 1LNQA 2I3AA 1XQ1A 4R4JA 2GN4A 5DOVA 1WNTA 4L73A 3PWSA 1R0LA 5JSFA 5L53A 3PEFA 3DQPA 5JNLA 1YOVA 3ZWWA 1YQDA 3NTQA 3L6EA 1L7EA 1E7QA 4D0RA 4BKRA 5GZ6A 3D3EA 2QG4A 3I4CA 4OXKA 2VUUA 2YUTA 2B4RO 2IXBA 4GX5A 5U4QA 3ROPA 2NSDA 4ZHSA 2EWMA 4BNKA 1Q7CA 2RHCA 3DZKA 4ALIA 1YRLA 4M86A 5A06A 1H2BA 4E3ZA 4YQZA 1ZK2A 4W99A 3NDIA 1LLQA 2WE8A 4RJTA 3H9EO 1UJMA 4QUKA 3KEQA 3RASA 3GN2A 4FGWA 1CEQA 3OSUA 4GPD1 4YR9A 3GUCA 4NPCA 2TMGA 2X0RA 4FS3A 5DBIA 6ADHA 4KTVE 3JQ9A 4OIMA 1V3TA 4BNTA 5J9GA 1MFZA 3E9QA 4CMHA 3BMNA 4GGOA 2ZK7A 3SX2A 2D5CA 1BTOA 4BUCA 1E3WA 3KXDA 3TZKA 4R5MA 2FSVA 3KSZO 3FN4A 2D4AA 2OP1A 1DJNA 1GAEO 3PZRA 3I9JA 3MTJA 3RUAA 4TRNA 1UXHA 2HMWA 2RH8A 4JJIA 1UDCA 2VUTA 3KBOA 1DIHA 3JQFA 2JD1A 4A5OA 1PZFA 3WWYA 4HFJA 1V6AA 1K6JA 1EVZA 3ANLA 4LMPA 1I2BA 3KLPX 3R6DA 4IBOA 3O03A 1V0JA 4FJ0A 1KS9A 3KYBA 4N5MA 4XX0A 4ALKA 2QZZA 4GQAA 1NWCA 4JXKA 4XQEA 3I83A 4PLCA 1UAYA 4CLXA 5BNIA 1EVYA 2Y1DA 1BXGB 5I8WA 2QQ5A 2HMTA 2JFGA 1AGNA 4DL9A 3HJAA 3C7CB 1UR5A 3I9OA 2Q22A 3JD2A 1M6HA 2G1UA 1PL8A 3RC9A 4BIIA 2OBYA 2Y05A 5BR7A 4IJVA 5BSGA 1R15A 5B4TA 1EFKA 2WTBA 2AHRA 3H9UA 1ISIA 2I76A 4NBRA 1Y8RA 2HDHA 3LLVA 5L45A 3IUSA 3B1KA 4YAEA 3F9IA 4WOKA 2P9GA 2FR0A 1C0LA 1Y9AA 2VNAA 1M2WA 4E2XA 3R1IA 4FJ2A 3L77A 1OBFO 1GCOA 5T73A 3JQ9C 5TNXA 5H82A 1GYRA 5B4VA 1PJCA 1M67A 4BNFA 4P4NA 3D1LA 2J5KA 4FFOA 4E12A 3INTA 1ID1A 4FFLA 2O7SA 1BMDA 3DXFA 3COSA 2WD7B 1PJ2A 4JBGA 1D1SA 2YDYA 4DYDA 1QYCA 4F46A 4FC7A 4ZICA 2X5KO 4TKLA 3I5MA 2POQX 1Z45A 4IZIA 4CM4B 1HLDA 5TX7A 1N9GA 1ULSA 3JQFC 2ZYDA 4RPGA 2P4QA 1KVRA 4WOJA 1LQUA 2CMDA 1Z73A 5I9LA 1E3JA 4BO2A 2W2LD 1GV0A 3DZJA 1MC5A 3GFBA 3LSYA 1E7SA 4GX1A 4U6SA 1TB4A 4KQWA 1PS0A 4NU6A 2J5RA 2WYVA 1S7CA 4BS9A 2PA3A 2J5QA 1DHRA 3HN7A 1ZXBA 2AW5A 2Y67A 1NQOA 4YACA 3L4SO 4HX5A 4JLWA 4B4VA 2B69A 4CV3A 1YVEI 4O6VA 2DQ4A 3H9QA 5TC4A 4PRKA 3DB2A 1VL6A 3L9WA 1B16A 1HXHA 1UXGA 4FPXA 3DHYA 4RPJA 3E03A 1X14A 4I5EA 3VHRA 4IUYA 4I5DA 2PV7A 4R68A 4KWIA 1R4NA 2JHGA 2QIOA 3PHIA 3EC7A 3D64A 3CTMA 1GQYA 4OKNA 2NVBA 1T2EA 5DCYA 2IDZA 2YV2A 3DZHA 3HADA 1MXHA 2YV1A 1HF3A 1Y5RA 3V5NA 3KHUA 2X7HA 4I8XA 2P5YA 1HSOA 1GQQA 4HXYA 4JJGA 5ER6A 5TS3A 4RPLA 4DC0A 3QVTA 2DFDA 4W4TA 5DDIP 3ROKA 2JJYA 4OJNA 2GZ1A 3WOHA 4E6PA 3FTNA 1A71A 3K6JA 1E6EA 3OBBA 4PG7A 4OQYA 2E49A 5BNFA 1P1JA 1K89A 2C20A 1TT5B 3ITDA 3K30A 3E8XA 4FCCA 4MKRA 4GGPA 3TWOA 2WYUA 4CODB 2NM0A 2VT3A 5DN9A 5LCXA 1RM5A 3K31A 3BYZA 2O7QA 4RLSA 4I1IA 1LQTA 4BNIA 3DBRB 1HETA 1YBVA 1OOEA 1ZH8A 1LLUA 4BNUA 4RVGA 5IDYA 3L4BA 2CF6A 3GEDA 1JAYA 5JDCA 5JCJA 1IY8A 1H9BA 2Q1SA 3A4VA 3DBHA 3GA0A 4R3WA 5F3RA 4E0BA 3DZBA 1QP8A 2PZMA 1JWAB 1AUPA 1ENPA 1HTBA 1NHWA 3MTGA 4PN3A 1LRJA 3ANMA 4XA8A 1ENYA 3HDYA 5AXCA 1YO6A 4MVJP 1YDWA 3G17A 1PSDA 3WNVA 4JQCA 3F1LA 1NPDA 4TWRA 1E1MA 3PHGA 1HYGA 2GR9A 2X58A 5H83A 3TZQA 4BO4A 5IXYA 5CDTA 3ZV6A 4CJXA 4CM7A 2B83A 4LSWA 4UVHA 3JQ7B 4Q3NA 4IS2A 3HZZA 5C37A 2FZWA 5DBGA 3ADPA 1UZLA 1JVSA 3MWDB 4F6LA 5L51A 2CVQA 2QYSA 3AY6A 5A04A 3BHMA 1W4ZA 4YEDA 3ZU5A 4YYZA 1SEVA 4XR4A 3OA0A 3PQEA 4EUFA 4QT0A 2HJRA 4KZPA 1PGQA 3GG9A 4NK5A 3QWBA 4AG3A 4IJWA 4F3YA 2E4AA 4IM7A 4D42A 1MFPA 5EQDA 4YJDA 3QHAA 1ISMA 3O26A 5TLSA 5B4UA 5KNLA 4R1SA 1P77A 4BNNA 3TSCA 4JN6B 2VZ0A 2AA3A 3QVWA 1U3UA 1W0CA 5CPBA 3T4XA 2SCUA 4XWYA 1BXGA 1CF2O 2PNFA 1NPYA 3LZ6A 4BGUA 1EMDA 3PJDA 5H81A 4D3SA 3UAGA 2CY0A 3RBXA 2JD2A 4AJLA 5L4SA 3UW3A 3ROQA 2ZYAA 4LCJA 2OHXA 3I3OA 1P1IA 2EV9A 3F4BA 2HO5A 3VH3A 4E5YA 3ZWOA 1IPFA 2DKNA 2P9CA 5JLAA 3HN2A 3P2YA 4S1VA 2BD0A 1I3LA 4JNKA 5C5IA 4HUJA 3KSUA 4NBTA 3AY7A 3ZN2A 4CPDA 4FFPA 4EDFA 4YT8A 4FR5A 2X0JA 1PL6A 3MOIA 2VRCD 1UZMA 1PQUA 1QORA 3CXRA 1WLYA 5FI5A 5JAZA 3B70A 1X1EA 3PYMA 3AK4A 4EJ6A 1JQBA 3BMCB 2Z1NA 1FF9A 3OJLA 4OMUA 5LDGA 1YL6A 2OGUA 3C85A 1GEGA 3RQSA 2WD7A 2NACA 3HUDA 1PGPA 3JTMA 3WGTA 3WQRA 4BO7A 4CMJA 2BELA 3O4RA 3G1TA 3RFXA 4A03A 1MV8A 3HG7A 4CM4A 1I33A 2PZLA 2YQ4A 4FJ1A 2IEDA 3UCFA 5HRUA 4J6FA 4NR0A 9LDTA 3GHHA 3H7AA 1ZNQO 3ICCA 1LDMA 4QECA 3F1KA 3E18A 4TRJA 1U3WA 4NG5A 1PJSA 4YDRA 4J2HA 3E1KA 5IAAA 4MVJE 2UUOA 1IUKA 2P2SA 2E82A 3U4DA 4RF4A 3PI7A 2J3JA 4Z9XA 4L8VA 4PG5A 4OOFA 3TFOA 3UKOA 4URFA 2EJWA 3ZW9A 4R54A 3PHLA 4P22A 3EUWA 3E82A 2W8ZA 3KM0A 1DLJA 4TROA 1ML3A 3AU8A 5JYEA 1QMGA 3DHNA 2QRJA 3U3XA 5EL0A 4MINA 3RVDA 1A27A 4DIFA 8LDHA 2YHIA 2LDBA 2P4HX 4II3A 2X22A 3DZFA 2JKVA 3GGPA 1IHYA 4UUNA 1V3VA 4DIOA 5A3JA 4U5QA 3AY3A 4B7CA 4PZEA 4PLGA 3RD5A 2A4KA 1DO8A 4RF5A 3PJEA 4PRLA 2DAPA 4RZHA 4LN1A 2Y66A 1YOVB 1IULA 2OBNA 2DTDA 1CETA 1F8FA 3HFSA 3I9KA 3JCZA 1EVJA 2O4UX 3K96A 4GH5A 4Q3DA 4CV1A 1DHTA 4R5HA 3TL2A 3LT2A 2EIHA 4RDHA 2W4QA 3AUSA 4DXHA 4L9RA 5I9MA 3H5NA 2QRKA 1WDKA 1ULUA 3DMTC 4CMEA 2WYWA 3LC1O 1VL0A 3SXPA 4L75A 1A4UA 2HRZA 4II2A 4JX8A 3OMLA 1SC6A 1X1TA 3HFGA 3OF2A 4K1LA 1VJ0A 2GN8A 1TT5A 2OFPA 2O23A 4GMGA 1FDWA 1LSJA 2VYVD 1VM6A 2VHXA 1A7KA 3NTOA 1X7DA 2JD0A 4DBZA 2VN8A 1UDBA 4JK3A 1XU9A 4BO9A 4WE3A 4QX6A 3DBRA 1T1SA 1FK8A 5KJCA 1T24A 4OSOA 4CLOA 3UHAA 3DHEA 1DC3A 3M1LA 4E5KA 4WGGA 3UF0A 3DBVO 1LSOA 2VZ9A 2C54A 5IFLA 4OYRA 4J9UE 1NFRA 3V2GA 3KUXA 1XA0A 5K6AA 3QA9A 2O2SA 1ADFA 2VWQA 4YRAA 2PZKA 2VT2A 5EINA 3MCVA 2ILTA 3L07A 3TF5A 5L3ZA 3JYQA 1GL3A 3LC7O 4MKXA 1YL5A 1EFLA 2WWRA 4MVJD 3VPGA 5GZ1A 1F8GA 1ZJZA 1QV7A 5FF9A 1SZJG 4D3FA 4R01A 5G0TA 1HWYA 1B8UA 1IE3A 1MA0A 1R16A 3GR6A 5CDUA 3DO5A 1LU9A 2YFQA 1N7GA 1GTMA 1XCBA 2G0TA 2HK9A 2I6TA 3HDQA 4J1NA 3GRKA 5T8KA 5JY6A 5IDQA 3OJFA 3UCEA 4W9NA 3ENNA 5KVQA 2QRLA 1EE9A 1J5PA 4Y9DA 5A05A 4BNMA 3NT2A 3CH6A 3FBGA 2GYYA 2J3IA 4LRTB 6LDHA 3ZWYA 1FDTA 1SAYA 2BHLA 2EKLA 3PLRA 3W8EA 5L7TA 3TOZA 2B5WA 2UV8A 2AEJA 1NM5A 1WAMA 2O3SA 1CERA 2XF8A 3MJ4A 4XB2A 1WPQA 3C1TA 4IDGA 4CM9D 4RDIA 3ITKA 4RORA 4CQLA 1EUCA 3F47A 2NTVA 1LLDA 5THQA 3OICA 4XGIA 3A14A 2HUNA 4DMMA 2ZB8A 4MVJA 4FOOA 4M1QA 3ZNNA 1U8XX 2PH5A 4YBZA 1G6KA 1Y8RB 4ND4A 4BL5A 3ETGA 1N8KA 3TJRA 1JVBA 1M76A 5K9ZA 4EGFA 1WDLA 4NDNE 2Z1MA 3Q6IA 2DBVO 3VH4A 1LUAA 3F6YA 1ONOA 3NT5A 2C0CA 2G76A 4HY3A 4IPTA 1U7HA 4EBFA 4XRGA 4Z3KA 5A1TA 1JKJA 3L9XA 1HYHA 1LRLA 1GYPA 1TXGA 3JQBA 3PK0A 3RROA 1E7RA 3FI9A 2YV3A 1HEUA 2GN6A 3HDJA 4YJFB 1B2LA 4E30A 5IF3A 4CR7A 1C0KA 3VDQA 4R69A 2Y1GA 4CM9A 3WSVA 1WMBA 3A1NA 2B36A 1P1FA 2G5CA 4LMRA 1J6UA 3ZV3A 1MUUA 1VI2A 2HK7A 3WWZA 4B79A 1FXSA 5CDGA 3BMCA 1I32A 4OO3A 2FN7A 3BTOA 3WBBA 4F6CA 1E3IA 1UP4A 1J4AA 1B15A 2ZTMA 1SNYA 3QWIA 5CFZA 1ZFNA 1Y6JA 2C7GA 2EGGA 5BSFA 2VHWA 2RH4A 4Q3AA 3TOXA 5ES3A 4HFMA 3OA2A 4XB1A 1UZNA 4GVLA 2PKQP 5FEUA 2Q99A 1ZEJA 3VZSA 1IYZA 1YDEA 2HLPA 2NU9A 5DBFA 3R3SA 2NTNA 3VAZA 3BTSA 1NXQA 2NVUB 3LYLA 3Q0EA 4NNJA 1Q7GA 3C8MA 3ZWVA 1XHLA 5KCZA 4E2WA 3N74A 2HQ1A 2XPCA 2O48X 3JYOA 5U9CA 3GGGA 1YE3A 1DLIA 4BNJA 1AXEA 1R4NB 1H94A 1QKIA 5ICMA 3WICA 5L40A 2HSDA 4U7WA 4IZHA 4RL6A 5KKCA 2C82A 4BKPA 4QEDA 1ONNA 2HMVA 2NTJA 3EAGA 1OZAA 2GASA 4FD3A 3V1YA 4EYEA 5KWEA 4GSLA 1JKFA 4J3FA 1EBFA 1BG6A 2WE7A 3CINA 3PWKA 1LEHA 4OM8A 4XCVA 4A7PA 1N1EA 1GD1O 2PZJA 3JQBC 5G0SA 1HZJA 5B37A 5EPOA 4BGIA 1B3RA 1MG0A 2GERA 2EKPA 3GDFA 5KJ1A 3AUAA 1PZGA 3OQBA 2QX7A 4JP2A 5DT9A 4N7RA 4PVDA 4RO0A 2X0IA 1DB3A 3W8FA 4ZQEA 1YXMA 3RCBA 1C1XA 2CVZA 3GZ4A 3BA1A 1PWXA 3GRPA 3PJFA 3AW9A 4M87A 1PR3A 4CUJA 1HDXA 4ALNA 1XEAA 4Z0HO 4OOEA 4UVEA 1PQWA 3EHEA 2X23A 3OIDA 1HRDA 3NGLA 4YB8A 4NU5A 1U8FO 4OGWA 5L7YA 1X15A 2DPHA 4A27A 3U5TA 1JW9B 3DBHB 2O2YA 2VYNA 1D4FA 1KVQA 4DUPA 1QR6A 2EEZA 2GLXA 4ZN6A 3RBZA 3RU9A 1KETA 2AQ8A 1ZZEA 1ORRA 5J23A 2P91A 3DWFA 4CM8B 3WIEA 3NJ8A 4QFCA 3DOCA 4KUEA 4CM6A 3Q9NA 4YAIA 4DYVA 3PGXA 1TI7A 5TSDA 4ID9A 3TL3A 1H9AA 3NAQA 5I7SA 2JCXA 4XDYA 3EMKA 5HM8A 4FFMA 2OZPA 2GPTA 2VHZA 3ZHYA 3O9ZA 3WFJA 2Z5LA 1KEVA 3C7DB 1U3TA 4AJKA 2TMDA 3ORFA 3W6ZA 1R4MB 3WR5A 4GLLA 3FWNA 3L6OO 2AXQA 4W7IA 3OFSA 3H5RA 1VRWA 5L95A 4XYGA 1Q0QA 2ET6A 3PIDA 1DIAA 2IYPA 1VJ1A 4NIMA 4B8ZA 2YDXA 1B8VA 4YA6A 1BW9A 4MVJF 4J1QA 1OAAA 3DMYA 3VC7A 1HSZA 3QVOA 4JBIA 1GY8A 3R3JA 3QIVA 4DPKA 1VE9A 3TZHA 2HMSA 2FR1A 4FIZA 4WLUA 3ZGYA 4BKQA 4JCOA 2D5AA 1VSUA 1QYDA 1Y9EA 2Q45A 2FZEA 3FNFA 4D44A 3E9NA 5CDSA 5JW6A 3U0BA 3O8QB 3S8MA 2R6JA 2X1HA 1KC1A 5DZSA 5A02A 4K9DA 4B3HA 4XYMA 4D46A 3QW2A 1E3LA 3G3EA 4ND1A 3MWEB 2GZ2A 1F0YA 2Y0DA 4QO7A 3ZV5A 1XYGA 2FWMX 3DTYA 1MP0A 1RM0A 4IIUA 3QP9A 3GDGA 5EESA 1ZW1A 4BB5A 4CLDA 4D7AA 3ZW8A 4J1SA 1NHGA 1HDRA 1PJLA 2C2XA 1XKQA 1DC5A 5F5NA 4IXTA 2Q4BA 5KJ6A 3G79A 5G0VA 2GO1A 2Q2VA 3DEYX 3H65A 4RF2A 3RSHA 4DVJA 5ILOA 1EBUA 4KMSA 2O3RA 4E5MA 3S55A 4YJFA 1PJ4A 3LU1A 3X2EA 2FR8A 1QV6A 3UOGA 4P38A 4GI2A 1ISFA 4O1MA 4NBUA 3ASVA 4R41A 4J7XA 5JPIA 4KUHA 4BO1A 5A4DA 3TN7A 2ZQYA 4BNZA 4ZGWA 1PZEA 1Z6ZA 2PY6A 1RWBA 1KBZA 2A9FA 1DBVO 1N1GA 5AOVA 5IZCC 1PX0A 4Z9FA 5CAEA 4R1UA 4XGKA 3OECA 4GVXA 4PIVA 1IZ0A 2HCTA 4ONEA 1O94A 4RQTA 3E5MA 4GX0A 2UUPA 1ZK3A 3GZNA 1E1NA 3WLFA 7ADHA 4FOSA 5JAIA 2Q50A 4IDDA 3EZLA 3FF4A 2EW8A 5JO0A 4WKGA 4XQ9A 2Q1WA 3K9QO 2QHXA 2EP5A 3ZNOA 5IN5A 2NQTA 2O4CA 3RC1A 4HNHA 2NVUA 3UN1A 1D3AA 5TRTA 3IJPA 3WGHA 3V2HA 3CE6A 4JP3A 5KOIA 2YHIB 4R3NA 4J16A 3EZYA 4YCAA 4CLHA 2J6IA 4AJ4A 3WFIA 5KVSA 4D3DA 3WGZA 5IN4A 5DOZA 2VTEA 3I6QA 1GDHA 1KVTA 3MJEA 4M89A 3I9NA 3VZQA 2D3TA 4PLPA 3WX0A 1R37A 3DR3A 1A5ZA 2FRDA 4CUKA 2O3UA 5JCXA 1PR9A 3UUWA 1NR7A 4MVJM 1T2FA 1XGKA 2ZJ1A 2AQIA 4C7JA 2W2LA 2ZTVA 3FPLA 4U0JA 2Q49A 1P9LA 3EW7A 4I5FA 4UREA 3ZWPA 4PLVA 1YWGO 3AI3A 3I52A 4BMNA 1PJ3A 4GBJA 2VTDA 4DPLA 2IYOA 3ZHZA 4DWVA 1ZMTA 3HQ4O 4GWGA 1P0FA 5C3MA 2JFFA 2B4TO 3GVIA 4ND5A 1HDOA 2WSBA 4MVJH 2IEBA 3VZPA 4E4YA 3WYCA 4WCFC 1YL7A 1CRWG 2RCYA 1QXSA 3DAGA 1LDBA 3UH1A 3GG2A 2EJVA 5A9TA 3SVTA 3LF1A 3V8BA 2Y99A 3GVPA 4IQGA 1TA4A 1LJ8A 4CLOB 3RC7A 5COBA 2AG8A 3LQFA 3UVEA 3AOEC 1IB6A 4Y6SA 3IMFA 4HFNA 3V2UA 2GF2A 2D1YA 4FDAA 2CD9A 2P68A 3DAPA 3JQAB 4TSKA 2ZB4A 1Q7BA 2IZ0A 4I9UA 1KEUA 1S6YA 1H6AA 3ROMA 5DCWA 5JMPA 5F1KA 4GWKA 4Q3BA 4AJEA 3AI2A 3QRWA 3S2FA 4CM8A 1GPJA 1M75A 1BRMA 2CVOA 3F46A 4BGEA 2DBQA 3GLQA 3P2OA 4BGVA 2LDXA 1EQUA 1F14A 4AJIA 5L9AA 3WGGA 1EK6A 4UVDA 3U62A 1X7HA 4B3JA 3GVCA 5ITVA 3RJ5A 3GF4A 5L4NA 4GMFA 2G17A 1G0NA 2I99A 3I6IA 3KVOA 1B0AA 4E2YA 3GAFA 4J91A 4XQCA 1H0KA 1BWSA 1R4MA 3HWRA 5JDIC 4FGSA 4UEJA 5A5EA 1I30A 5T6BA 1GUYA 3WGOA 1NBOA 3VPHA 3ZHXA 4BO0A 3PYLA 1GCUA 3TDKA 2WM3A 4O0LA 3CIFA 3P19A 5G0UA 4RVDA 4OKIA 1NNUA 4NK4A 4CQLB 3LLSA 4KUGA 4ND3A 2CUKA 3JQDA 4BMSA 4XYLA 1B14A 2FPPA 4H15A 4LVCA 3QWAA 4U6QA 4OXYA 1B7GO 3U49A 4CM5A 1T26A 4BNYA 2EF1A 2EW2A 2Y68A 5JFOA 1A72A 5CEEA 4Z0TA 3WSWA 3O8QA 3K2BA 1Y5MA 4CM1A 3ZCXA 1F17A 2AQKA 1LRKA 3C7AA 2DTEA 2D0IA 2ZTUA 3I9MA 4CLRB 3IAHA 3Q11A 1ZUD1 1XDWA 4IGEA 2X9NA 4DLBA 5AXDA 4RCVA 4MPDA 1DAPA 1WP4A 5I7EA 4PGFA 4AJ1A 3CUKA 1C1DB 1BDBA 5LC1A 1ENZA 3KSDO 5C7OO 1QYWA 4NH4A 2FHSA 1AHHA 4YT5A 5ICSA 3WB9A 3QSGA 2J3HA 4N18A 1RYDA 2Y93A 2D2IA 4PLHA 2B35A 1WXDA 3DMTA 4MIEA 4P4LA 4J2OA 4Y6RA 1ZBQA 1X13A 2BKAA 1FDSA 2C5EA 3CEAA 4UEOA 4W6ZA 3VTFA 1LDNA 1ZKMA 2AEFA 5BQFA 4XJSA 5AVOA 3I4FA 2E6UX 2H1SA 1NVGA 2AE1A 2VOEA 3L0DA 3PDJA 3VDRA 2OUIA 3SLGA 1SO8A 1NAIA 1ZK4A 5CDYA 4WNCA 1HE2A 1I2CA 4BV9A 1ZK1A 1SB8A 2FPGA 3AFNA 4IMRA 2X0NA 3NJ4A 3WS7A 3FD8A 3P7MA 2GRAA 1XU7A 3LC2O 1YONA 4E5NA 1YJQA 3KTDA 1OC2A 4K28A 4XGNA 4EEXA 1CYDA 3R0IA 1E7YA 4AJHA 3EDMA 3OETA 3OJOA 4IS3A 4L4RA 4OHUA 4Z3DA 4TVOA 5F5LA 1KVSA 3OIFA 4BNWA 4EJMA 2VRCA 4LISA 3LT1A 1BVUA 4Y98A 3RUEA 3SC6A 1NR1A 3RJ9A 4CMKA 4L74A 2VOJA 4FSHA 4R1NA 4MP3A 1CWUA 1GZ3A 2VWGA 4XJTA 1PJQA 4NZ9A 4RV9A 3DOOA 3M1AA 1BSVA 3JD3A 3OJ0A 4QFDA 5B12A 5GY7A 4WEQA 3BTUA 2GD1O 4WLVA 4H3VA 1KOLA 4TRMA 1N7HA 4WLFA 1EK5A 3IQDB 4WECA 4WLNA 3GGOA 2HJSA 1W6UA 1F06A 1DIGA 2ZQZA 3PLNA 5JC1A 1EEHA 5A3VA 1JA9A 1P1HA 4JBHA 4KWHA 3RKUA 5CG2A 1UP6A 3JQAD 3DAFA 4YXFA 1DIRA 4RLHA 4BOYA 3RAJA 5L7WA 1NX6A 2YFHA 2PD6A 1ZO8A 4INAA 1AHIA 1TLTA 4J7CA 4FC6A 3VZRA 3ETEA 1PGOA 7MDHA 1ISHA 3PRJA 5JY1A 1J49A 1N5DA 3F5SA 3HB4X 1MGOA 1FDUA 1XELA 2EG9A 1C1XB 4PVCA 5U1PA 3ZNQA 1I10A 4Q39A 1O0SA 2IRWA 1WW8A 4PLYA 1VPDA 1NP3A 3B1JA 3GEMA 4KDFA 4HFRA 3WNQA 2YZ7A 2FPIA 2Q3EA 5G4LA 1OFGA 1HKUA 1DPGA 4GX2A 3VPFA 5G2OA 1H6BA 4QO8A 5AXAA 1UAGA 5T67A 5JYDA 3GPDG 1ZIDA 2YQ5A 1N2SA 4BNVA 3TPCA 1E7WA 1E6WA 1BXZA 1ISGA 2ZKLA 1KIFA 5I7FA 3HB5X 5JYFA 3ONFA 1LTHR 4CV0A 3IDSA 4XRRA 5GZ3A 1MX3A 2W2KB 4LSMA 1IOLA 2JHFA 3QWHA 4KP7A 1ZK0A 2YY7A 3EVNA 4S3MA 3JQAA 4CUZA 3PYXA 3JD0A 1XG5A 4GL4A 3BHIA 1YBAA 2ZYGA 4LVUA 3ZWAA 4RVHA 1T4DA 2C7VA 1F12A 4GKBA 2HMUA 4EJ0A 1IL0A 4E13A 2E48A 4RGBA 1BGVA 1T2DA 3E48A 4FB5A 2PKRA 4Z0PA 2HAEA 4DLAA 4DQVA 3FWZA 5JE8A 4BO6A 3MJVA 2VYVA 2BLLA 5TJHA 1UH5A 2IODA 5CPFA 3S2IA 4DRYA 1BW9B 1ZXLA 1PWZA 2BRUA 3DDNA 4ZJUA 1E3SA 1YQXA 4XZ3A 3FR8A 2B5VA 4B4OA 1R0SA 1YB4A 1M6WA 4YPOA 3F4LA 3LVFO 2H5LA 1R66A 3KOUA 1TT7A 1NFQA 1GQ2A 1I24A 2GDZA 3NYWA 1UXJA 4I9HA 1VKNA 3BXXA 2NADA 3NDJA 1E0DA 1UDAA 3EGOA 1E1LA 1PQPA 2PLAA 1T1RA 4MJLA 2PGDA 2I66A 3UGKA 4XQGA 5G4KB 1SB9A 1ZMOA 2DLDA 3D5QA 3JD1A 3RBVA 1SOVA 3TRIA 5IG2A 4YAGA 2W90A 2AEMA 4RF3A 5G0WA 1PJBA 1YS4A 3ZWMA 3FNHA 2GZ3A 4Z9YA 3T4EA 4EEZA 4MVJI 5KIAA 4PG8A 3GEGA 4MP6A 4ZQBA 2AG5A 2RAFA 4PZCA 1P3DA 1QSGA 4AJOA 1X0XA 2V6GA 5A9RA 3RUCA 4Q3CA 1LDEA 2ZCUA 4CLRA 3G1UA 1QLHA 4MKZA 2HRBA 4WK6A 1HE4A 4YRBA 4EW6A 4AJ2A 1QYVA 3DOJA 1FDVA 1C1DA 1V35A 1PZHA 4G81A 3PFWO 3KRTA 5TT0A 3H8VA 1M66A 3H9GA 2VNSA 4C7KA 1NVMB 4WCFB 3X2FA 1OC4A 3NGXA 4TMFA 1B8PA 2GCGA 4XYEA 2CSUA 5K0ZA 4XYBA 4DQXA 4EZBA 4D0SA 4NMHA 2ZB7A 3O38A 3ICPA 4M49A 2VQ3A 4ROSA 4BQPA 4GLOA 4EI2A 1VKOA 1B26A 3G0OA 2AQHA 1I0ZA 4MP8A 4L76A 4N5LA 4GKVA 4JIGA 3GZNB 1J0XO 1HDZA 3WIDA 4PLZA 4NFYA 2BFAA 4A2CA 3VPXA 3DC2A 1UXKA 1NQAO 1PU2A 4IGFA 3ZNPA 4D41A 1DFHA 4DIBA 5HS6A 3WXBA 4XIYA 5IXSA 1EDOA 1PS9A 2A94A 4J7UA 3OHSX 1YQGA 3JYNA 1QLJA 4TZTA 1HE3A 1ZCJA 1V8BA 1DIBA 5TIIA 3DFZA 1O8CA 3EYWA 3C24A 5HWSA 1H2HA 1AXGA 1ADBA 1I36A 2YW9A 9LDBA 2YJZA 1E7MA 4KQXA 2P5UA 1CDOA 4YAKA 3FBTA 1K6XA 1WZEA 5GMOA 3TQHA 5JAMA 4UAGA 3E9MA 3DZGA 3KETA 5FYDA 3FRJA 1XLTA 1Y8QB 1RM4A 3BTVA 4ZD6A 5CHEA 1KC3A 4D43A 3PVZA 4C4OA 2Q1UA 3JQGB 3WJ7A 4CQMD 3GAZA 5KJEA 3GFGA 4O59O 4BMVA 3I23A 1EE2A 3JSAA 4WJZA 1WDMA 4BHTA 2PFGA 3SBOA 3TZCA 2CZCA 1LA2A 3CZRA 1Q0LA 4FQ8A 4HBGA 3PWZA 3GVHA 5CEJA 4DREA 4U8GA 3AI1A 1P74A 2GNAA 5FWNA 1BVRA 5F1OA 4HADA 1Q0HA 2D8AA 4UUMA 2RBEA 2CDBA 2IXAA 3VOSA 1T2CA 4BQRA 4ZRMA 4ZQGA 3ZWXA 3IS3A 4NFSA 3HE3A 4K26A 5F1PA 4BO3A 3WLEA 1VL8A 5AQ1A 1C0IA 4JJFA 2DUWA 2WJPA 4NBWA 1Z7BA 1JAXA 2BFOA 2GGSA 3W6UA 2NU8A 2W2KA 1A9ZA 1CJCA 4AFNA 1ZSNA 4PLWA 4PFJA 4R9SA 1K3TA 3NDRA 3GQVA 3GPIA 3RC2A 4CQMA 3FTPA 1PGNA 3NUGA 1G1AA 1JN0A 1NQTA 1L7DA 2C07A 4RPHA 4UUPA 1SOWA 2JFHA 1P33A 2CDCA 4RVSA 4MVJG 5AXBA 3H2ZA 2VUSA 4E33A 1HL3A 3H6KA 5IDWA 5IZCA 1HLPA 4A0SA 2JL1A 5AYVA 1UP7A 2A92A 3NX4A 1WWKA 4J49A 3QWFA 1V9LA 3ON5A 1DRWA 1H93A 3AWDA 3D0OA 5COQA 2WEKA 3Q9UA 4RPKA 4UEKA 3RWBA 3D3WB 1ZSYA 3ZU4A 3NEPX 1GUZA 3MJCA 4Y67A 3TNLA 1NQ5A 1O6ZA 4XKJA 1E77A 1IZ9A 3QVSA 1QRRA 2VCYA 4ZU3A 4PG6A 4N54A 4CMCA 4YJHB 5EQFA 4M8SA 3BAZA 4B4UA 3GNQA 3CPSA 4XEHA 1RJWA 2OOSA 3OM9A 5IDXA 5CG1A 3H5AA 3OQ6A 3BMQB 1EDZA 3IP1A 3AFMA 2OXIA 4A73A 1I8TA 1HT0A 1MLDA 2PWZA 5G4KA 4ILKA 3STHA 4NBVA 3GMSA 2PKQO 2DPGA 3U4CA 5A9SB 3KYDA 4EUHA 4F45A 5LDHA 4CMBA 3PQDA 1E92A 4I08A 4ALJA 1P45A 1LDGA 1GEEA 4IDBA 4ALMA 3U4HA 1K5HA 3C1OA 2FSSA 2ZJ0A 2BGMA 3S2EA 2H6EA 3U9LA 1A9YA 3HNPA 3WQQA 3AU9A 4CR8A 4OSPA 3OH8A 1DFGA 3ONEA 4IDAA 2NU7A 3P5SA 4PG4A 1DC6A 1NYTA 3RU7A 2OL4A 2G82A 3FSRA 1KY5A 1O5IA 2Q2WA 2R2GA 3JQ8B 4OQZA 3K2EA 4D45A 1LSUA 3DZIA 1DDOA 3EVTA 5A03A 4CMGA 4DBVO 2I65A 3RUHA 3C1AA 1ONPA 4WCFA 1YGYA 4G5HA 1D7OA 1P31A 1T25A 4WNIA 4YRDA 2HKIA 2NWQA 3AJRA 1Z75A 2CF5A 4XIJA 3JYPA 4DTIA 3KO8A 3JQCA 4GAEA 3AOEA 4Q9NA 1MXFA 3GH3A 4NJOA 3WG9A 3B1FA 3SC4A 1RM3A 3PJGA 4BVAA 5I7VA 4TZKA 2NUAA 2V65A 2X6TA 4IDFA 3NTRA 1U2GA 4WCDA 3WDSA 4O5OA 2BFMA 1FMCA 1I5RA 3IJRA 5DULA 1A4IA 2YYYA 3MOGA 1Z82A 3JQ6A 1P44A 3JQEA 3HHPA 4XDZA 5ITWA 2Y0CA 2GUGA 4Z6KA 1NAHA 1VLLA 3ANNA 1U9JA 4PCVA 1LI4A 3ULKA 3FCOA 3K8ZA 3T7CA 2UDPA 3KYCB 3RFTA 2BGKA 4WEOA 3K92A 2DVMA 3B20A 4NQZA 3RUIA 5BNTA 5JDIA 3OP4A 3SJUA 4AJJA 4U0KA 1SCUA 4IIVA 3D4PA 3PIIA 1NVTA 1P1RA 3TZ6A 1R6DA 2H63A 2BMAA 2UYYA 2JAPA 2X9VA 3WGIA 1E5LA 3W4KA 2O3QA 3GNSA 1MB4A 4QQRA 1XQ6A 4J4TA 2PTGA 3ZU2A 5JXWA 1DRVA 3BIOA 3WYBA 1LC0A 1Y8QA 3ABIA 1L1FA 1GU7A 3EK2A 2IE0A 4UULA 2YHUA 1Y1PA 1QG6A 1NASA 4MOWA 3RIHA 2GSDA 3JQGA 4M55A 4FFRA 3GUYA 3ZWNA 1X7GA 3ENKA 1XWFA 5JCJD 2A35A 1OMOA 2O3TA 4WLEA 5FFFA 2Q2QA 5L4LA 2B0JA 4J90A 4DA9A 5TF4A 5HTOA 1NTOA 1YKFA 4YAJA 3SLKA 5A5FA 1LDYA 2F1KA 5DCUA 4B8WA 3MZ0A 1JTVA 1NFFA 3DFUA 3NKLA 1YH3A 5T64A 5HA5A 3WMWA 3GK3A 1HZZA 3W4IA 4WLOA 2ZTLA 2RIRA 1I01A 4DC1A 1JKIA 4YJGB 3QV1A 3RFVA 2BFPA 3BMOB 5ER9A 1DOHA 4R51A 1WZIA 4TQGA 1C14A 5C7IO 4H16A 1WMAA 2XAAA 4LW8A 5COAA 2NNLD 2XOXA 4CMAA 3G49A 5THKA 2O50A 2XXJA 3S2GA 3DBLB 2C59A 2CDAA 3KB6A 4NI5A 5B1YA 5ADHA 5I8ZA 3U4IA 3OJEA 4AICA 2VRBA 1U1IA 2OP0A 3KEOA 1HE5A 3QLJA 1KY4A 4BNGA 3LF2A 3PTZA 3ZH2A 4AVYA 4BKOA 4UUOA 1YJ8A 5F21A 1Y81A 3ZHBA 1LXCA 4FN4A 1I3KA 3INGA 5CP8A 3VKVA 3CMMA 5EMHA 3IIEA 1C0PA 2Y1CA 3C3XA 3FNEA 4NJMB 4DMLA 4IQ0A 4E2ZA 3DL2A 3QY9A 3K5PA 1Y7TA 4YVFA 1U5AA 5KJFA 5CEFA 3VVBA 2BH9A 1Q1NA 1PTJA 3D3WA 1GFSA 3EY4A 1D1TA 1I3NA 4E21A 5BSEA 3IUPA 3L6DA 1CIVA 5KVCA 2F00A 5TQVA 1C3VA 5IZ4A 3PDUA 4DLLA 1PJTA 2VHVA 4UVGA 1I3MA 4YJHA 3T7EA 1H6CA 3WBFA 2FP4A 4A26A 4BB6A 4CR6A 3JD4A 4YT2A 3PFFA 4UVIA 4QTZA 5KTKA 3PHJA 1UUFA 1PIWA 3BMQA 2Y1FA 4JROA 4TKMA 5JMWA 2DFVA 3A9WA 4J43A 3KV3O 3ONDA 5A9SA 4LK3A 3WGYA 1KVUA 2NU6A 1Z7EA 4PLFA 3D4NA 1CQJA 2NVWA 3CSDA 3W4JA 4BNLA 4R9RA 1W8DA 2EKQA 3WTBA 2EXXA 3FHLA 1BXKA 3SJ7A 5MDHA 4J4BA 3OQ1A 4QXMA 4ZQHA 4IDEA 3PPIA 4Q3EA 1YB1A 1NPTO 3ZWBA 1NWHA 4FW8A 4IQ8A 3JQ8A 4LGVA 1JU9A 3Q2KA 2Y1OA 5JS6A 4B4WA 2RHRA 2FOIA 2B4QA 3ZZNA 3RKRA 4ZQFA 1HDGO 1E5QA 1E3EA 2FY8A 3MJSA 3OIGA 1ZVMA 3L4BC 4MO2A 3IKTA 5JDCC 4HP8A 4B7XA 4L0QA 1SMKA 3GY0A 3UFXA 4NHEA 4B3IA 1ARZA 4J9VA 2NQ8A 4KTTE 2DM6A 2I5PO 2PD3A 3LK7A 2HU2A 2VWPA 3FR7A 4I5GA 3BHJA 1MC4A 1ZEMA 4IINA 1XSEA 3DTTA 3GT0A 1UXIA 1A7AA 4CMIB 5KVVA 1GADO 3WGQA 2PK3A 3GN1A 1N92A 5EIOA 3PQFA 4DQUA 3PGJA 2R00A 1GZ4A 1U4SA 4BNHA 4QSMA 2QW8A 1DC4A 4RVFA 3FNGA 4XD2A 3WYEA 4ZA2A 1LLCA 5I9NA 3F5QA 4Y6PA 3IL2A 2H9IA 5JBIA 2ZB3A 3WJAA 1BHSA 3QE3A 5T5QA 4E5PA 2I3GA 5EJ2A 4RZIA 3S1LA 5JC8A 4P8RA 5KKAA 2W98A 1D8AA 3RUFA 3KYCA 4IMPA 3PZBA 1KEWA 2JCYA 2OORA 3WMXA 4L4SA 4ESOA 4K6CA 2WMDA 2WDZA 2I67A 3ETDA 3AM4A 3VVCA 2Y0EA 1ADCA 1DEHA 4J4HA 4RVUA 3MEQA 1GR0A 4IJKA 4OL9A 4WPGA 1K6IA 4RQUA 1JLLA 3LT0A 4N5NA 1DAOA 1GUFA 1GV1A 3LDHA 2EGHA 4ZRNA 3GNTA 1T2AA
chains in the Genus database with same CATH superfamily
4J1TA 1C30B 3INRA 4ZVVA 3IBFA 3C5WP 1UJ6A 5JBNA 3B6ZA 2IZ5A 1DMSA 3PDWA 3QU4A 1EZ4A 1DTEA 1OJ7A 1Y5IA 3LJKA 3N5KA 1I7QB 3D0KA 3P2KA 1DUVG 1E79D 4HKTA 2HD4A 2PBFA 2QPTA 1VPLA 2C2YA 3HA7A 5K2OA 2Q5OA 1DFIA 1AE1A 4E32A 4BE4A 2IZ1A 1Z4JA 2I7TA 3DPIA 5DKFA 1W0KA 2R86A 3BSFA 4ZI7F 2R1TA 3OPYI 2HC9A 5LUAA 3PXAA 3NB0A 2OM2A 5ALHA 1OXKB 1Y1TA 5GIOE 3F67A 3D1JA 1OWPA 3FPSA 5FTMA 1VXOA 5DNVA 4B40A 4MIOA 3LP5A 3ONWA 3N2GB 4NYIQ 3MJTA 3CJRA 5JADA 1KWKA 4TUYA 1DT3A 3ZGZA 2ZJFA 3MB5A 4DG9A 2DTXA 1O9BA 1K0UA 4BPBA 3NAMA 2JAHA 5BUZA 3B12A 3KZVA 1U8AA 3PD7A 4IMJB 2P3LA 4AD8A 4CLEA 1YZFA 1L7MA 1ZBDA 2ZAMA 3O1IC 2WRZA 2EERA 4YQYA 4BLUA 4D9BA 4CQMB 5AM0A 1K2WA 2FPRA 2O2ZA 1U7TA 1H8EA 3HRHA 4OAQA 621PA 1O95A 2UU9B 5F76A 1NBAA 1TF7A 4GE3A 2G40A 3DBLA 4I9FA 1V5GA 2IP4A 4MQFA 4OB7A 1Z6AA 4F72A 1WPRA 4B46A 5KSYA 4WKOA 1YB5A 3K1JA 3QM1A 1IHPA 1QHIA 3DO6A 2DUMA 3BRWA 3PG5A 4H17A 4P7FA 1I7CB 3TZEA 1E98A 2WIBA 3AM3A 3VZBA 4J0FA 2YHSA 6ABPA 4EIWA 4PZ0A 1DC8A 2I6GA 1DWPA 2IEAA 2YBDA 5TJ9A 1KEPA 4GOKA 5AKYA 5EIEA 2P2GA 5JHGB 5KQMA 5BT9A 3W6PA 1EGMB 3FAKA 4L8WB 3DNFA 4CQNA 4X8OA 2RGWA 1ZGZA 3C43A 4DXAA 1KYQA 1J2TA 2C83A 4B6QA 5JYCA 1U28A 1XYYA 2WWXA 4RMGA 1KIMA 4XSVA 4MW0A 1KQOA 1RSZA 4GSKA 4PYKA 2RE8A 1EUDA 2E4VA 2IUEA 5M6DA 3A1TA 2WTEA 4YGYA 3RK4A 3AJ9A 5TPWA 2PRSA 4RTKA 3VPDA 2GN9A 4YTEA 1E62A 2XMSA 3T7JA 1SHZA 4OK6A 5CTAA 4C76A 1FFEA 4AX8A 5C7LO 3H9JA 3G88A 5SICE 3ZVRA 1V43A 2Q07A 4ZOQI 3K0KA 4AJNA 3T06B 2IV2X 4P4GA 4UCQA 3WLAA 4JASB 3LV8A 3W1WA 1AZSC 2Q46A 4V3BA 3P0JA 5EN4A 3S1AA 4EK9A 4EUKA 1P60A 2DHQA 1WEKA 2VBGA 3G5TA 4K9MA 3VAYA 3G6KA 3CX6A 4R2JA 1TEVA 2H1LA 1YMQA 3H84A 4YK7A 3WTCA 4EHIA 3RI3A 4EHAA 4H59A 1FTYA 3SHVA 4N0PA 3AEQA 1BIFA 2C1EA 3H0EA 2NSYA 1WU7A 1P5JA 3LRXA 3EEFA 2YWBA 3NT4A 1O89A 3TM5A 2D13A 4FMCB 3E6AA 1ZSVA 4IX9A 1CD5A 2YN0A 2RGNC 2PPVA 4QKQA 1XIVA 1BO6A 3N0XA 4MS4B 1SKUA 3DYBA 3K0BA 4I55F 2FW6A 2QSZA 3F90A 3ESCA 4OK3A 5DIFA 1Z88A 2QT1A 4KDEA 2F62A 1LC3A 1DRKA 3FPEA 1GDDA 1MG5A 3F3KA 1ADGA 1TU3A 4O89A 2OFOA 3COWA 3LX6A 3M49A 4FSXA 4KE6A 4CL8A 1OYWA 3LQYA 3ZI0A 3ACCA 4HD8A 5GVSA 3AVVA 3R0JA 5KNBD 4AYTA 3SWWA 4PGHA 1POXA 3U2QA 5FI1B 4MV1A 4PZDA 2I2CA 1IFXA 3ZV7A 2BI7A 4S0ZA 2WF7A 3UQYS 2PBRA 5DE3A 1N3LA 1OPRA 2HU8A 1TU4A 4X54A 1PWYE 1KERA 3IPXA 3KXPA 3I34X 3ANYB 3H3JA 1NVAA 1PJAA 4W82A 5HZHA 3Q9LA 5EFOA 1SXHA 4HN2A 1ZCZA 3BN3A 4F2HA 5HPYB 2HYDA 5D86A 2GF0A 3G2MA 4J0HA 2GK7A 2YWEA 4FE7A 3UCXA 3HVHA 2H57A 4CCYB 2QN1A 1ATZA 3A6ZA 3LA8A 4LOKA 3W0LB 3R7LA 1EVIA 4CRWB 1U5CA 1YZGA 5K3AA 5A6SB 3BGOS 3V1UA 2EBWA 3I28A 4U7PB 1G0OA 4GUDA 3KLMX 4FMPA 3BZUA 3KKEA 4X1IA 3RS3A 3M2TA 2ZVQX 3SYNA 3WQSB 4CMIA 2IDMA 4FI3F 4TV8F 5H70A 4QG3A 1NXXA 5BSTA 1BU8A 3VGPA 4KO3S 2UUAB 1H9CA 5KMGB 1E9VA 3QZUA 4HSEA 4LRYA 5JNUA 2ONJA 5J2TA 1QIGA 3OLXA 2QUIA 1E1RD 3KPYA 1ECBA 3GCDA 2PQ2A 1JXMA 3D7LA 4W6QA 3OC0A 2XUDA 2A5GA 3I9LA 4IJUA 2AN3A 4OQFA 3OZVA 1P9OA 5H9VA 3BDIA 2HWYA 3OURA 4Z9AA 3PA8A 4OKSA 2AMFA 1M6VB 4BO5A 3Q3VA 2LW7A 5F12A 2PJUA 3A6GA 4U6NA 2P11A 1NM5C 2GARA 5BPFA 4AMUA 2WD8A 4PLTA 2IE8A 1VSQA 4PAOA 3JV7A 3VTZA 5FHRA 1P75A 4S35A 4WDQA 1GUAA 4EG1A 1N2HA 3SJBA 5KYYB 4GZ6A 2XD9A 1SKAA 3VPSA 1JQEA 1OI7A 2NO1A 4JHLA 3VU8A 2IS4A 4P9NA 2D59A 4YP9A 2PFKA 1JENB 4DJFC 5AW3A 2DERA 1P0CA 4O2BF 4QJ4A 4F4IA 2OO5A 4AURA 2YIJA 4Z54A 1XR3A 2F67A 4UM7A 4ZIRB 4ZYTA 1CLUA 1SHJA 2G1AA 1GYQA 2GJSA 5H80A 5KTNA 4ASUA 4XDGA 3THXA 4XB6B 3CMCO 1B43A 2PBZA 1H5QA 2Y8EA 2LP4Y 3ESBA 3IKVA 3PHBE 3Q3IA 4FYJA 4JBWA 4B44A 5DYWA 2QUHA 3G89A 1OVGA 2YVQA 1GR1A 2WU4A 3GJ4A 2PX8A 4L73A 4LDJA 1YFJA 4FTWA 3MXOA 5JSFA 3NC1C 1TDJA 4GICA 5JNLA 2V0CA 3BS4A 5G1OA 4WV3A 4Q9IA 2G9ZA 3HH8A 4UU8A 4D0RA 4EB0A 4PPYA 2FW9A 5JSUA 3AO0B 4ZVNA 4FOLA 1GFZA 1HKHA 1Z5ZA 1HUQA 2B4RO 4Q3OA 3TLYA 4BRSA 4DQKA 4YRKA 3R8XA 1DGQA 3DZKA 4UBJA 1ODLA 1O7JA 1YRLA 4RMIA 4L2IA 4U7FA 2MSCB 4ZTBA 3SYKA 4OBEA 3TR6A 2UVQA 1VE3A 1GG9A 4ZAVA 2CLHB 5FNZA 4F21A 2QX4A 5KYUB 2Y92A 3KEQA 4HX2A 2Y6VA 3A9UA 3GN2A 3NU1A 1CEQA 3RASA 4ZJZA 4EG6A 4XM1A 1R74A 3LTEA 2CXOA 2QPLA 4C4TA 1S9DA 3BGVA 3CWCA 1Z0IA 4F12A 1IAQA 4FMDB 4HSGA 3AR3A 4OXQA 1MFZA 2RC5A 3UO8B 2J0UB 3V7FA 4YFVA 1CSEE 2AHOA 1ISPA 4GGOA 2Q3HA 2ZK7A 1O77A 5GJCA 2D5CA 1SH7A 3OE5A 3EZFA 2O8CB 3HWSA 4JVSB 4R5MA 2FSVA 5EEHA 2D4AA 4X94A 4UCFA 3F9CA 3PZRA 2FLWA 3RUAA 5JANA 1I7BB 4MYHA 1FFXA 1JEEA 1QWSA 3IVMA 1UDCA 3L5KA 5BR4A 2V3CC 2IV3A 2VQSA 3DULA 1KQ3A 4WACA 5A7HA 1RHRA 4A5OA 5FA6A 3WWYA 3ZJXA 2PWYA 1E1CA 1KIAA 5ALXA 4GP6A 3KLPX 3WV4A 3ZS8A 4A5SA 1DT5A 3F98A 4FJ0A 1V1MA 2B1JA 1KY2A 3KYBA 2UVPA 1YR2A 4IWXA 2HSJA 4B2YA 1YACA 1N2OA 1KFBB 4MS1B 1NWCA 4BTVA 4AWBA 4JXKA 1XMOB 1XVIA 3I83A 1FS4A 2FX2A 1SBQA 5B3JC 2OV1A 4ZOLF 1OWLA 4CLXA 3PWTA 1ABBA 4Z4HA 1FNNA 1GNRA 4N76A 1EVYA 3FTEA 2XTJA 4TM8A 1U6IA 4FYKA 1BXGB 2C3UA 2QQ5A 4CKZA 1OF1A 4DV7B 1AC5A 1YVPA 1PR6A 1TQ4A 1E9RA 1HY3A 2DWPA 1NQWA 1UR5A 3EBPA 1JG4A 3WDMA 4DAOA 2R6GA 2PKXA 3GLHE 3CR3C 3PCRB 1T9AA 3WAKA 3RC9A 1XDDA 2B3DA 2Y05A 2WWHA 1YS6A 3WMRA 5BR7A 4P86A 5BSGA 4XGQA 1TEXA 4EABA 4ZO9A 1EFKA 1JFTA 2AHRA 3H9UA 2QI9C 2I76A 4DKXA 4G1EB 4JYBA 1QCYA 4TV9B 3DJYA 3PS9A 3VX3A 1JJBA 3IUSA 4U2CA 3B1KA 2R47A 3ZWDA 2UZ1A 4R98A 1SBTA 4I55B 2F3TA 3VBEA 4YUWA 1I7MB 4WOKA 1PEYA 4E2XA 3R1IA 2ZJ2A 3TJZA 3CZQA 3K8YA 3L77A 1OBFO 1GCOA 4O2AA 4D2IA 5TNXA 1OVMA 3E7PA 3PGLA 5H82A 3UJ9A 1GYRA 1P8JA 3QKWA 1PJCA 1M67A 1QQAA 3PGA1 1FRFS 3SICE 3G0HA 4BNFA 4P4NA 2YYAA 4QQNA 3L0CA 2J5KA 3E81A 4FFOA 4E12A 1JFLA 4ZHQB 3M6VA 4OP3A 4GBGA 4TM7A 2C0PA 1GG2A 3DYVA 2ZI7A 4P3KA 3LLCA 1YF3A 2WM9B 5BQ3A 3COSA 4TLBA 3U6KA 4PRYA 4QFMA 1FRVA 4ZICA 4ZT7A 5DW0A 4ZVOA 4TKLA 1OLUB 4URZR 2AT1A 2BP7A 3NHJA 1PJZA 4NULA 3TFWA 4JV5B 5LDDC 5TX7A 3VV2A 1F0NA 1ULSA 1U1GA 4RPGA 1Y7LA 2AL7A 4DR6B 1HH4A 4F84A 3T4UA 4B35A 1TIPA 4Y2UA 4IO0A 4QYSA 3HU3A 3DUWA 3WNDA 3EFOA 1PYDA 2W2LD 4KHZA 2GPJA 4DSOA 3B1YA 4TT3D 1XO1A 4YRJA 3TE6A 4BBZA 4NYMR 3OZ7A 2BFCB 1G4UR 2Z2YA 1ZL0A 4WOBA 3MT8A 1BFKA 1ZXBA 2Y67A 4TWIA 1NC1A 4Y0VA 3AFHA 4TSFD 3H13A 2VK1A 3DZ8A 3E3LA 4PCUA 4WH0A 4D9KA 4CN8A 5FOQA 4YACA 1FY2A 1JHXA 5DBEX 4GXQA 3MFQA 1YVEI 1V71A 3UHPA 4PRKA 3DB2A 2BTQA 1KAHA 1B16A 1SXJA 4FPXA 1UJ2A 2QEQA 1J1IA 3DHYA 4GRIA 2QW0X 2EWVA 4TYPA 1DJPA 3X1YA 2CV1A 2A4MA 1OFVA 2RGBA 4I5EA 4IUYA 4R7TA 4M1MA 1XRMA 4C2BA 4KWIA 2IYEA 1R4NA 3BSWA 4P92A 1RQRA 5EUBA 2ZAIA 3OWOA 1GQYA 1KO1A 1WL8A 4E11A 4ZYLA 1Y7IA 3H2HA 2VUIB 4H6PA 4JY7A 2BMDA 3VNVA 3DZHA 4RKFA 4DLRA 4JVNA 3OZUA 1S8FA 2FW8A 4JJ7A 4CI0B 1BCSA 1JIVA 4BFWA 2HV9A 2P4SA 1OZ0A 2P5YA 4WL0A 1EG2A 3I3SR 1YNOA 4BFLA 2XOEA 3OD1A 4O2BB 1CJUC 3DB1A 1I6MA 3ROFA 2E5WA 4JAVC 4OA5A 5ER6A 3KL4A 4DC0A 3QVTA 1N2XA 1QH8A 2DFDA 4W4TA 3A9SA 4OJNA 1GIAA 5IJXA 3ROKA 4Q1CA 2R2AA 5LIRA 1HNWB 2J41A 2GCOA 4FZVA 2O57A 4D0GA 4Q4DA 2XCRB 1E6EA 1UK9A 2HJVA 8MHTA 1EJ0A 1JG6A 1QK4A 3WK7A 4HDRA 5BVGA 1RC0A 1L5NA 5A0TA 1DRJA 4UC0A 5A4MS 2AIRA 4YJ2F 3K30A 5EWJB 3E8XA 4JI5B 3HXTA 2Z6UA 4AZ3B 1FX0B 2O20A 2WA2A 5AKKA 2NM0A 1E32A 1GT6A 1ZD9A 2VT3A 1I4TD 1F4LA 1RM5A 2G36A 1Z12A 3MYYA 2O0MA 1IB0A 3PCTA 1A5BB 3BYZA 5HR5A 1LQTA 5CTJA 3MLBA 4BNIA 4ZK6A 2Q9UA 3KQKA 4MDYA 4G0VA 3QU2A 1M34E 1ZH8A 4MQ5A 4WTOA 3U1VA 3PSAA 1T4MA 2XH8A 3NTVA 4INPA 3L4BA 3GEDA 3LYAA 3LXRA 4LXGA 4EAQA 1JQAA 2Q3FA 3WLQA 1LW6E 4F85A 3DZBA 4HHEA 3V8MA 4NKRA 1ENPA 1NHWA 2RONA 1LRJA 2C61A 1CS0A 3ANMA 4QYIA 5JASA 3HDYA 2IGBA 3SXUA 4UFPA 2H1HA 3DLIA 2Y4NA 1T5LA 4GRDA 3G8AA 2W2VA 1D2AA 1X8LA 5EJFA 1EP9A 1DKUA 2LTAA 3F1LA 1NPDA 4RELA 2BM0A 4MRMA 3PHGA 4UASA 3EP7B 4UHEA 3VBCA 2Z2ZA 4EI9A 3HB7A 1SA0A 5CDTA 5AK0A 4CJXA 3V97A 5IXYA 4WN3A 1VYHA 2B83A 3D7RA 4DWWA 4AKIA 3V3TA 1VB5A 3LG2A 2I2AA 4IS2A 1NVFA 5KNCH 2AFIA 2FZWA 3B78A 4F96A 4BCCA 3AIIA 4YRGA 1C5KA 3MWDB 4J16C 4F6LA 2CVQA 5F4ZA 3OQNA 1KO8A 5A04A 3NNNA 3OEED 1LBIA 1SEVA 2WYOA 3A9CA 4A0GA 1NJ6A 4XI9A 1JE0A 2C9ZA 1I2MA 4QT0A 4RD4A 3T41A 2I55A 4L02A 4AG3A 5J9FA 3M70A 4MRNA 1K8YB 1KJNA 5DWVA 2Y0BA 3T3NA 3IELA 3KNZA 3QHAA 1P1BA 2ZSHA 3VR2D 4BN0A 4OF4A 3E4DA 1ISMA 2V6JA 3ZDEA 2F17A 4OXIA 4C89A 2P0AA 2P9JA 5KNLA 4R1SA 4CDNA 4UE6A 1GAQA 2IY8A 2R1VB 3K70D 4JN6B 1H1DA 1ODIA 2V0NA 1Z63A 2VVTA 1QU3A 4HN4B 2VP2A 2PVPA 4YRTA 3VNAA 2JGDB 5CPBA 4D4JA 1MT0A 2PT6A 3AGPA 2XZLA 2BR4A 2EBFX 1T2UA 3RODA 1Y33E 3PJDA 5H81A 2IUUA 1EYZA 3UAGA 2CY0A 1U7OA 4MRVA 1K86A 2AR7A 2D0PB 4ZOLB 4KQKA 3E35A 2OPBA 1NRXA 2XCLA 4LCJA 5G41A 3C14C 2AN1A 1WXFA 2ZUCA 3I3OA 2EV9A 3L0YA 4F2DA 2I0FA 5JFGA 5J1SB 1M6YA 1V45E 1IPFA 5JLAA 5DM4A 2YVLA 1MR3F 4EHBA 4EY5A 3T5TA 3PFGA 3U3KA 4NBTA 3AY7A 2QN2A 4CG2A 2ZPUA 2CNLA 4G1UC 2HR1A 3FNRA 1KFKB 1UKVY 3O9MA 1ZAKA 4WDRA 5JI3E 4I14A 5HYVA 2G9UA 1GRNA 2BCGY 4YT8A 2HRRA 4FR5A 4G9GA 4RKYA 1U7WA 1WB4A 1KZ4A 2X0JA 2WW8A 4D5GA 8ATCA 4UCXA 2OENG 3AZOA 2JLBA 1I80A 1UZMA 3CXRA 1YCHA 4MUEA 1KE1A 5E4JA 4KHPB 5I01A 1GOTA 3UC5A 4MUFA 4QULA 1X1EA 4LYFA 3SR3A 2QJOA 1GLGA 1WSAA 2D5BA 1V6SA 3WGJA 4EYQA 3AVPA 4K8RB 3FTQA 3RDPA 3EPBB 3BMCB 4GMDA 3OJLA 3DMDA 4P2BA 5LDGA 2IUSA 3DVLA 3UJNA 1ACJA 2HB6A 2OGUA 1N6KA 1RDFA 1JJVA 2Q3CA 1CC1S 4JLKA 1DCFA 1RKQA 3FYTA 4KQ1A 2NACA 3C97A 3NANA 4H2DA 4J3NA 1PGPA 3ZD9A 3WGTA 2XVZA 3OT5A 4BO7A 4GOND 4TWJA 1BE1A 2BWJA 5DWQA 3VV3A 3VMFA 2BELA 2GBGA 2ZKIA 1ICIA 1HA3A 2FG6C 2K4MA 1JILA 3G1TA 3OZAA 1C9NA 3HG7A 1I33A 3LUBA 4L95C 3SR4A 3UK7A 3J81k 3K1TA 3IHTA 5HRUA 5BQ5A 3PTAA 1XTJA 2RHGB 1WY5A 3EC1A 2VYFA 1X6VA 3G2OA 4NICA 4CYMA 2IFTA 3PRYA 5C8YB 5L8VA 3E18A 2V7GA 2ENWA 2PWBA 1X92A 1G2QA 3M6FA 4NG5A 5K03A 5EXEA 1MOPA 4YDRA 2NSJA 1WXWA 2AKEA 2Y27A 4LJAA 4WKPA 3I53A 3QFCA 1HRKA 3QF4A 3DAHA 2FVXA 4JYMA 4GYJA 4LJ4A 1LF0A 5J47A 2QUJA 4OOFA 4TVSA 1EXNA 2XB6A 3ME5A 4QQFA 3IPYA 1TD9A 3PFIA 2EJWA 3SM9A 4HQOA 4P22A 3SF8B 3ZW9A 4B0PA 4GLFA 1DAEA 2XKKA 2P5TB 3KM0A 3AU8A 1YU9A 2BIFA 5B3LA 5AVYA 3NWOA 4MINA 1LF5A 1UWVA 1KJ9A 3GO4A 3OQIB 5DTJA 3TAHA 8LDHA 3P0FA 1AS0A 4DABA 4ER6A 3SD7A 3CN7A 1YE5A 4ZEXA 6NULA 4C5CA 1IHYA 1HQKA 1VP3A 1XJ5A 1DELA 2BMEA 3P5BA 4QYXA 5EIBC 3LO5A 3N8IA 5IF9A 3IP6A 3QX8A 3RD5A 1DO8A 2JH9A 3PJEA 1RC8A 2XB4A 1MC1A 3U13A 2P2CA 2Q3BA 1FTSA 1WM1A 4LN1A 4RZHA 5EXDA 4EVQA 4CIAA 4RTMA 4DCUA 1IJKA 3WNCA 2CW5A 2DTDA 1F8FA 2X3FA 4H0NA 3ER6A 5IM5A 2CFTA 1Q22A 3MELA 3TL2A 3LT2A 2EIHA 3O4HA 2OXCA 4RDHA 3FMGA 3SXJA 4FLEA 5DLQC 1ZH2A 2WZDA 3IWDB 1EWRA 3B89A 1G41A 5I9MA 4KR9A 1QF6A 3GJ0A 2EX1A 3OQOA 5KYXA 1VL0A 1YVRA 4QAQA 2HRZA 2O6LA 4II2A 4M0UA 2IH2A 3PI6A 2F7SA 4YN3A 1X1TA 3G9TA 3FNQA 3R7SA 2H48A 3W9YA 2ASEA 2QV7A 3IA7A 3UWPA 3R40A 2OFPA 1RAGA 2O23A 3OZGA 1FDWA 3MTBA 4QOEA 3V1MA 5LQAA 4MWOA 3G2IA 2II6A 2HFJA 2XITA 4IJ6A 4YFYA 4FFBA 3RLFA 2XUQA 4BDTA 4C01A 2RCNA 3EASA 4WK2B 1XU9A 3FFAA 4BO9A 1I2DA 2WVJA 4P84A 1QQ5A 1T1SA 2O59A 1ULAA 1FK8A 1PJRA 5KJCA 1I7SB 2ORIA 3IE0A 2FA9A 2ZI5A 4LBWA 3CBQA 3DHWC 4O4HA 3UHAA 1DC3A 3D7SA 4RS4A 3JWJA 4GPTA 2VHEA 3HU1A 4FBMA 1IDN1 3FJ1A 3DBVO 1D4OA 3KALA 1OFUX 2HA6A 2OQRA 3GEIA 5EE5B 5C2JB 5LU8A 1KO7A 2R79A 2ZR7A 3U17A 3ZOZA 1XA0A 1ZH6A 4Q9AA 3VNUA 1ADFA 1XZEA 1B76A 5TC4A 4EZEA 1UT6A 1EAMA 1MNAA 1WW3A 1XZBA 4LHXA 2VT2A 1CP2A 1U63A 1N2IA 2IK8A 3L07A 5FBRB 3ZJ4A 3TF5A 1YUBA 3JYQA 1GL3A 2FMHA 1Z06A 4MVJD 1N8SA 3M4XA 1ZLYA 2POCA 1E4EB 1P5ZB 1E5VA 5DYTA 5FF9A 2QUBA 4C4AA 4D3FA 4R01A 4ESHA 1J21A 1Z2AA 1LZLA 3TW0A 1U2ZA 3F78A 1HWYA 3IOCA 4G5FA 5B5SA 3PQ6A 5J5CA 4D6XA 3PX7A 1Y7PA 1LU9A 3R3HA 1N7GA 3QXHA 2HK9A 1DG9A 2I6TA 1D2GA 3NORA 4K1XA 1SXPA 5JY6A 4Q00A 3SJCA 4QD3A 3ZJUA 4FD2A 3MMPA 4P93A 4X1YA 3DVAB 5KVQA 1ZU4A 4PZLA 4RLQA 3HO1A 5E6SB 3ZBTA 3EIUA 3NT2A 3ZVMA 3VDMA 1ZI8A 1IG3A 1R7RA 1P73A 2QXTA 1NKVA 1MORA 3ZWYA 2MWMA 1LPNA 1W29A 1XV5A 2BHLA 2EKLA 3PLRA 3TOZA 1H8HD 2B5WA 1CHDA 2UV8A 1GGFA 3VR6A 2O3SA 3CNEA 3SGLA 2XF8A 3A1EA 4IDHA 1WPQA 1Z28A 3LGAA 3QEKA 4IDGA 4RDIA 3TE7A 1CY4A 4CM9D 1WMSA 4AI6A 1FC0A 1C3XA 4WCVA 4MAMA 1NE2A 2I34A 2DJIA 1HT3A 3U7RA 5K0CA 1M5RA 5THQA 4YO8A 2IKSA 4HLNA 4XGIA 4K9NA 3PGMA 4I1YA 3AF5A 3LWNA 1SHLA 4JXXA 2OAEA 4M1QA 4IG9A 4Q4JB 1U8XX 4TKZA 4NCHA 5D1NA 5NULA 3N0TA 4UQPA 1MBZA 3KPUA 4ND4A 2QROA 4FZ5A 1CB0A 5P8WA 2EW1A 1N8KA 1YZHA 1RYNA 1M76A 4HDNA 4QRHA 3KOYA 5FH9A 5K9ZA 4JYPA 2Z1MA 2J7KA 3A6FA 2QTAA 4UHBA 4PINA 4DCSA 2GCPA 4K03A 2GAFA 3HEMA 4DJDC 1ONOA 2C0CA 3MLAA 2G76A 1P5RA 4GU5A 1U7HA 4HY3A 4IPTA 5DHQA 4EBFA 5BW4A 1FXWA 2I22A 3L9XA 1HYHA 1LRLA 1GYPA 1AKRA 3JQBA 1HV8A 4ZVTA 3ROEA 4EBBA 1HFKA 3QOXA 4ENQA 3TXXA 5EYPB 3NDBB 2Y71A 3FI9A 2YV3A 1HEUA 2GN6A 3HDJA 2CK3D 3Q7RA 4DMFA 3IQXA 2G63A 2A9QA 3KVVA 3LHDA 1C0KA 3TW8B 4R81A 4R69A 3KTAB 2Q5EA 2WJ4A 4AP5A 2VDMB 3DTVA 1NJGA 4JI3B 1SVMA 2QLNA 3A1NA 4LMRA 1N5RA 2V8BA 3T54A 4JR1A 2HK7A 3WWZA 4PIMA 1C7RA 1I32A 3V9AA 3WP1B 2FN7A 5CYFA 1YZLA 3NEYA 3QY0A 4KSCA 3AEUA 3EGDA 7REQB 1UP4A 1J4AA 3JZMA 2WK1A 1QIFA 2BEKA 2W37A 4M9RA 2VHWA 5LQSA 3WZMA 1RRKA 1PZXA 5ES3A 1E5DA 2PA0A 4HFMA 2VJKA 2GLTA 4TYMA 5ECWA 5E9AA 1ODKA 1BXRA 2PLWA 4BNDB 4GVLA 3CVWA 1BEEA 4Q5IA 3VO9A 2P9TA 1ZEJA 1M7BA 1T3GA 3H17A 2A9RA 5CLGA 4LTDA 4MW1A 2NU9A 2WD9A 3ZZUA 1AS2A 3VAZA 3G68A 4FCVA 3BTSA 1MRZA 2YIVX 4MLPA 1LK0A 1YRWA 1VG8A 3QK7A 3T3GA 4HGYA 3UPUA 4ZAYA 3Q0EA 2XE8A 3FGZA 3A4YA 3VKFA 2I4RA 1AKNA 2JVJA 2HJGA 2RSLA 2XPCA 3K1AB 2I3BA 1GA6A 4RKEA 1GGJA 1Z15A 4REQA 5E9WA 3RTEA 5LLSA 4AMZA 2ECPA 1WD5A 2XE4A 4W9RA 2EKBA 1G2PA 5ESRA 2TSYB 1H94A 5FORA 2RKOA 4I4TF 4US0R 3RVPA 1FFBA 1VQ1A 3GYGA 5L40A 3CRVA 2CEAA 5KNDA 3F73A 3EODA 3N70A 3AJEA 5DWDA 4LWQA 3NPAA 1U2SA 3DXXA 4G86A 4QLOA 2OBXA 3NHPA 1NMEA 4BZWA 4NAVA 4B3CA 2NTJA 3EAGA 3VXKA 5HXAA 4B6OA 1RPZA 3C5HA 4FD3A 5K4AA 1QFZA 4FDUA 1JKFA 2AD1A 5JJKA 1EBFA 1T6XA 3HACA 4XCVA 3V4LA 4DUGD 3MTIA 2V54A 1RS0A 1UEIA 2VXBA 1A88A 1BROA 1JVNA 3B3QA 1HZJA 5EFZA 1UFQA 5EPOA 2XTMA 5G0SA 5HBGA 1AH2A 5KJ1A 3GDFA 2QX7A 3P0HA 1UBGA 3AR7A 3BCUA 3FW1A 4FVTA 1V5EA 3GCWA 3KHKA 4YRSA 5LJLA 1DB3A 3IUQA 1Z5VA 2J46A 3UB3A 4W9MC 3TLMA 5L3RA 3LPNA 2V98A 3BA1A 1PWXA 3EIFA 3GRPA 1J9GA 3C45A 5CIQA 1BYUA 1JJIA 1TGYA 5LKRA 3ZY5A 1Q0SA 5DHTA 1Z26A 1EX9A 1D2EA 2QN6A 4B43A 3FTFA 821PA 4YB8A 4NU5A 1Z4MA 1K1EA 1X15A 1MO5A 4G0XA 2O2YA 1E9DA 2JW5A 3WRYC 3DM5A 1JFFB 1QR6A 2EEZA 3JZAA 2VJMB 3KWMA 3UT5A 1KETA 2H9YA 1OREA 4DN6A 4K0KB 2YYSA 2GA8A 2AQ8A 1ORRA 3SKXA 1XZCA 2ZAOA 2R7AA 1HQDA 1CJBA 6Q21A 1DPFA 3DOCA 3N39C 4CM6A 2GEDA 1JF8A 1WXQA 5CX1B 2VSNA 1DAMA 2E89A 4XPZA 3J7TA 4ID9A 3VYVA 3TL3A 5HKBA 1WB5A 4ZT5A 3NAQA 3O84A 2FGJA 1ZA2A 1A4XA 2ZBVA 1YR8A 3T5MA 2VHZA 1V8ZA 4KXUA 2ZUVA 2I03A 4MQEB 2Z5LA 3S27A 1RE0A 1U3TA 2TMDA 3ORFA 2Q5LA 4DV2B 2ZI6A 1XZPA 4FEGA 2VEOA 1U8CB 3M0EA 4X95A 1TJ3A 4W7IA 4FHZA 4AX4A 1HEYA 1T3LA 5JYBA 3IAUA 4DNQA 3QPCA 3GLTA 1MOZA 4JUBA 1YRQA 1Z5UA 2CXRA 4K5QA 5EHXA 2YMQA 1FUIA 3MAAC 4HDSA 1XOIA 5HCUA 3CGWA 3CZ9A 4B8ZA 2HGZA 3H1BA 2IHKA 2OC9A 3RABA 4J1QA 4MVJF 4GP7A 1J06A 4L16A 4MCHA 4PAWA 3ZDCA 5MN4A 1L9KA 3MUFA 3VC7A 4U02A 3QVOA 1X7XB 3KKLA 1AOXA 3SQXA 4P7JA 1QKJA 4DPKA 3QIVA 4A82A 2FPPB 2ACEA 3LY8A 2FR1A 5TVOB 4NYMQ 3MWJA 3I32A 2WSIA 4TVKA 5ISMA 4JCOA 5FNVF 1HPLA 3CLUD 3W3AA 2HA2A 2Q45A 2RGEA 2BEUB 3HCDA 5GWXA 4FQ7A 4URHA 3OE1A 3W8NA 1FCJA 4A0RA 3MT7A 1M1UA 1QJ4A 1NLZA 2CLLB 2R6JA 2ZBDA 3DOEA 3O8QB 4LC0A 4N3AA 1XQWA 1XZHA 3L5OA 5DZSA 3V7YA 4AN1A 2ONCA 1SUBA 3WDKA 4A0QA 2B4AA 2ZJOA 3IT0A 2GZ2A 5TE9A 1UJBA 4ZVSA 2Y0DA 1CUGA 2IU0A 3A1CA 2FWMX 5IW8A 4BB5A 4COKA 1ORDA 4D7AA 2V7EA 1CQWA 3K53A 2KSQA 2HN9A 3OMWA 4J1SA 4TQ9A 1NHGA 3SZLA 2VR1A 5F5NA 2I80A 2MCFA 2DJ5A 3HJRA 2JANA 2Q4BA 2PSHA 1EVKA 2QRZA 4UM5A 1VLQA 3G79A 3W5IA 1JMYA 2BEWB 2GO1A 2Q2VA 3CUYA 4V2IA 1T2VA 2H1OA 1FMFA 4RF2A 4DVJA 4BLPA 4IRMA 4GKKB 2AS0A 3JZIA 4AF8A 5LQUA 5EEGA 3ZCUA 2C4KA 1U0SY 3TIXB 2AZ4A 1MEJA 1TNDA 4KKVA 3OQMA 2FR8A 5U4XA 1E8DA 1XXHA 3UOGA 2JAQA 3CTPA 1ISFA 3RU3A 5CIWA 1IM5A 5EAIA 3KWFA 5JPIA 5LFAA 4R1MA 4HNRA 3BE5A 3DFKA 4K9RA 4BO1A 1Q0RA 2P2ZA 2AN5A 1HYQA 3RS2A 1PUIA 4BNZA 2PGAA 3WHKA 1W52X 1Z6ZA 2FPGB 2G3YA 2PKEA 3NHFA 4EP1A 4B2PA 5J43A 1KBZA 4Q03A 2F43A 1N1GA 4ZO6A 1JG3A 3R9XA 1PX0A 3N8GA 2CE7A 3DE1X 4XGKA 1NUHA 2X1MA 3DLBA 1Q50A 3FKSD 1J2RA 4UKDA 1IZ0A 2HCTA 3WLLA 2UYOA 3ABQB 4K9PA 3TGLA 2JLSA 3CKKA 2ASVA 3GZNA 4FKBA 4DSAA 2FSPA 2XIJA 2QP3A 1YAHA 3AT1A 4LSZA 4D74A 2B8JA 2Q50A 1CT9A 1SUDA 4L5IA 1DKMA 3JS5A 4K46A 1UANA 1X39A 2Q1WA 4LOJA 3U9SA 2EP5A 4LZZA 2WINI 3EVZA 1OTHA 3BSYA 4OBWA 5IN5A 2X14A 3VPAA 2NQTA 2O4CA 3FCCA 3RC1A 1KH3A 4HWGA 2W11A 4YIKA 3TAUA 4DF3A 3IJPA 4QODA 5F9FA 4YRRA 4EKYA 4Q21A 1RU3A 5AKGA 3DE6X 2WR8A 3BRSA 4EI7A 2PL5A 3KIPA 3U1TA 4JLBA 1E0JA 1OFTA 5DOZA 1MGPA 1Q1GA 1HK7A 1JNYA 3OZEA 4HN9A 4TKUA 4GDFA 4ER3A 3EGCA 2BW0A 1Q0ZA 4FZ3A 2YXLA 4E1AA 4BZXA 3SY8A 1S2MA 2XUOA 1T5IA 4PLPA 1XQYA 2V59A 1K08A 1QCCA 1VYVA 5ALEA 5JCXA 1T2FA 2JZOA 5FEUA 1NZFA 2NV2B 4C7JA 5HKOA 4B3SB 1ZUHA 5A0VA 1ZNXA 4U0JA 4YECA 1P9LA 3DUFB 4NS4A 3ZVKA 2MSWA 2PMCA 3A7DA 4PLVA 3ZWPA 1ZIXA 3I52A 3QBTA 3U31A 5MN6A 2HCRA 2QQ0A 2QM0A 1PT7A 2VTDA 4K81B 2IYOA 3EVGA 3QEOA 3HQ4O 1P0FA 1NXOA 2JFFA 3QGMA 1CF4A 2ATEA 1EFPA 1PK9A 5HE9A 4OLBA 2FQXA 3IPCA 5AESA 1CULC 3EXEA 1A9PA 4WWHA 3GLKA 5M5BA 2A5FA 2GK6A 5M34A 3EGXA 3Q3EA 2ZXUA 1BHJA 2XECA 4KXVA 3CLUC 1EFVA 1Y8CA 4CKEB 2BDTA 4KN8A 2XKBA 4P35A 1LDBA 1JAZA 3M7IA 4Q7KA 5ALKA 3ZYCA 2JFBA 4QGAA 2PYIA 2JHPA 5CVEA 2Y99A 1U7PA 2ZSFA 3SP1A 1TA4A 3DZ5B 1G7SA 3LQFA 3AOEC 1CUZA 4GF5A 1VBNA 1WXIA 3TSWA 3E9YA 2GT1A 1E2PA 2VDOB 5DSXA 2CD9A 3E2MA 5IEJA 2RHDA 1BMFD 2H2AA 3FYUA 3IOEA 3DD1A 3AR2A 4I50F 4TSKA 2UYQA 2ZB4A 2IZ0A 2BT4A 4UBOA 3T3OA 3A3OA 1F4VA 2V3VA 1KGSA 2VDLB 4LE2A 1SXQA 5DCWA 1TKCA 4LZWA 4Q3BA 5DI3B 5JMPA 4IEIA 4LV5B 1VGRA 3C98A 3KAJA 3QRWA 4QICA 2BHSA 2CVOA 2PRKA 3O1JC 4HEJA 4XTCS 3ZW7A 3VU9B 4BGEA 3GLQA 4BGVA 4RACA 4ABYA 4RIGA 1F14A 4RSHA 5H83A 1GKKA 5L9AA 2L18A 4V03A 1D2RA 3WGGA 4BWYA 2GPWA 3KT8A 3SZUA 4TTQA 1Y1KE 4WY8A 2W6MA 3U62A 2XCOA 3GVCA 3NONA 1JMKC 2WP8J 2AXNA 3TIIA 5IJ9B 4EUNA 3PXUA 3R7BA 4ZDKA 1ZZGA 4GMFA 1NF2A 1OI3A 5HJEA 1OBOA 3MUEA 3OFND 3KVYA 4O1HA 4E2YA 4EAAA 4XQCA 4D9NA 5JDIC 4FGSA 1BDJA 1D0VA 3EP9B 4MDFA 2WJGA 5T6BA 3HLKA 1QAMA 1R9GA 3AKEA 3DW1X 5KNBH 4HWSA 1CEEA 2ZYWX 4K6KA 5F9MA 1JEAA 3AG5A 3EG9B 1Q7EA 4CDGA 2OLEA 3TDKA 2WM3A 1RIIA 3JAKB 4UU0A 3STXA 3CIFA 1ZCAA 2WHXA 3GI1A 1K7XB 1Z34A 1G64A 3M6LA 3DKIA 3QKSA 4MS3A 4NK4A 3WLIA 5AKIA 4BQIA 3LLSA 5ES4B 2BKUA 1K2VN 4OPMA 3M6AA 2I71A 3KKNA 3URMA 4DIKA 3TYXA 2C58A 3EXIB 3GLVA 1HORA 4LVCA 4AY5A 1FZQA 2PUVA 1B7GO 2JKZA 3DZ6B 4GOXA 3U49A 3IUYA 1QH1B 4BNYA 3P9PA 1SUAA 2Y68A 3ZK7A 1A72A 3R77A 3IDZA 1FFYA 1NXWA 5D51S 1V37A 4Z0TA 1PW7A 3VR1A 2OGWA 4YRQA 3UJBA 1Z0AA 4DHWA 4XM0A 1F17A 3FUWA 3C7AA 4BVHA 4CLRB 3UWMA 1NW4A 3Q11A 2A0XA 5FNVB 4WNAA 1QYIA 2ZE5A 3IBSA 2JCSA 4AMGA 1KI4A 1RAHA 1J7JA 1Q74A 1P4JA 3K0AA 2WF9A 4HLCA 4RCVA 4HB0A 4DLBA 4HQLA 1IIRA 3VNRA 2BKLA 4PN7A 1IQUA 5BV8A 4DSZA 2C9CA 4C06A 4D57A 1X2EA 2XRYA 1CVLA 1QYWA 4NH4A 3UAOA 4YT5A 2PXHA 1RPTA 1CZRA 1RD4A 4HNAB 5ICSA 3VKHA 4MMXB 2JJ8A 2PWPA 4D9EA 2XNJA 1SG9A 4Q3LA 1I79B 4PLHA 4Q6WA 3D4BA 1K06A 3RLIA 3HB9A 4P4LA 1IEQA 4G0UA 1E2FA 5CIYA 1ZBQA 5UKDA 1VMIA 2OD7A 2H3HA 2V97A 2QVGA 2VA9A 3EEBA 2AOWA 1X7YB 3CEJA 3CEAA 2ZBRA 4UEOA 4W6ZA 3ZLTA 4EJSA 2AEFA 4NVRA 1NG1A 1X80B 2V7UA 3QPAA 4FYWA 5K2MA 3HXMA 3A3KA 4WZBA 1I6WA 1OXTA 3T7DA 1P7CA 4Q66C 4KN9S 1FXUA 2FZLA 2Q5FA 2ZOSA 4HX9A 3PDJA 3RIEA 5KX5F 2FFBA 2OUIA 3NBFA 3UGTA 1JYEA 5KDDA 2B99A 2VCEA 3GLIB 1NAIA 2XMPA 1ZESA 2BGTA 3VUFA 2O2XA 3MD0A 1FS5A