1LC3A

Crystal structure of a biliverdin reductase enzyme-cofactor complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
292
structure length
292
Chain Sequence
b'MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLCHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biliverdin Reductase A
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 96
structure length 292
sequence length 292
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc3A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc3A01
4BQPA 1M6WA 3GZNB 4KOAA 3NDJA 3Q0EA 4F3YA 3V5NA 1LDMA 1F06A 1C14A 5AYVA 5DT9A 3D1LA 4BO7A 5L7TA 5AXBA 1R4MA 3S1LA 2Y1DA 1YXMA 4UVEA 1CJCA 3LSYA 2NADA 3KSDO 4CODB 1NP3A 1Y8RA 3AI3A 3UAGA 4PN3A 4BO8A 3KEOA 1AN9A 3HUDA 3KYCA 4HX5A 1RYDA 1FK8A 1WLYA 4J4BA 5T64A 1AGNA 3DAGA 4XJSA 1TB4A 3DZIA 3GNSA 4J4TA 1E92A 4RZHA 4CJXA 2HCTA 2IDZA 1M66A 3C8MA 5JY1A 4KWHA 4CM5A 1JKFA 1DIBA 5F1KA 5CDTA 1ZMOA 4NQZA 1LI4A 3ZU3A 3I9JA 2X0NA 3UCXA 3AOEA 4RQUA 3JQ9A 4LCEA 2X8LA 3F3SA 1GYPA 3KSUA 4XRRA 5TC4A 4J9VA 4YEDA 4MPDA 1NAIA 4GVLA 1GCUA 4Q9NA 1BXGB 4IDEA 2H1SA 4YDRA 1J6UA 2DTEA 1PGOA 4R69A 2QRKA 3A1NA 3SJ7A 4OM8A 2O2YA 8LDHA 1LRLA 1X1EA 4R1NA 4R01A 1YJQA 1ZK4A 3G1UA 4RDIA 4OXNA 1LSSA 2PY6A 3ITDA 1PZEA 1R0KA 3OETA 1O8CA 3HB4X 4IZIA 3MJCA 1MC4A 3VH4A 5KJ1A 1Q0LA 3ZNPA 3IP3A 4OGWA 5EERA 2FR0A 3FR7A 1QLHA 1O94A 3PI7A 3T7EA 3JV7A 1C0LA 3QY9A 1NFFA 1GZ6A 4BV9A 3CZMA 1E7MA 5IN5A 2J5QA 5CFZA 3H9UA 4FD3A 1SB8A 2A9FA 2C2YA 2I3AA 3NRCA 1R6DA 3FN4A 3H9JA 4OSPA 1ZNQO 3WOHA 5JCJD 1PSDA 1PWZA 1G6KA 3LYLA 4LK3A 2VWPA 4PZDA 2ZYGA 3LK7A 3QA9A 5TF4A 2VTDA 4CM1A 4WUVA 5F1OA 5BSGA 4PLVA 1GAEO 3GVXA 1YVEI 3INTA 4U0JA 2GR9A 1H9AA 1LLUA 3QWHA 1PS0A 4CM9D 5B4UA 1CIVA 3GUCA 3DO5A 1PR9A 1YE3A 3CSDA 5EJ2A 2O7SA 3TZ6A 4JP3A 4R9RA 1PU2A 1GYQA 1DO8A 1Y5MA 1Z82A 4KZPA 1A72A 4R9SA 3E82A 4IJKA 2CY0A 4UEJA 3HFSA 2PA3A 4Y6PA 2GN8A 2NU8A 1V9LA 2O7QA 1KEVA 4GGOA 1YOVA 4C7KA 1E3WA 3ZW8A 5ITVA 2AQKA 4ND4A 3HG7A 3IKVA 3FSRA 4UREA 4RVSA 3ZU2A 4FBGA 3X2EA 4W9NC 1HE4A 3TDKA 3HN2A 3PPIA 4D0RA 3IMFA 4E5YA 1BSVA 1H94A 5IF3A 4DLLA 3DL2A 5G2OA 4DMLA 4GX0A 1DIHA 1MC5A 3AUUA 1ZK1A 3PFWO 3JQGA 4YJHB 1VRWA 2WWRA 4FN4A 1ISHA 5C7OO 1P1JA 4W6ZA 4G81A 1WVGA 4J91A 3KO8A 3C24A 4URFA 2O4CA 3LC1O 3UW3A 4L4RA 1PQPA 1DSSG 4II3A 1A4IA 3PFFA 5CPFA 1J5PA 2GN9A 2DBRA 5L51A 5A5EA 3PDJA 3ZWYA 3O26A 1OC2A 2I3GA 2Q49A 1OAAA 2P9CA 4RVHA 4GL4A 1YDEA 2UVDA 2R00C 4R1SA 1U5CA 3SBOA 1I36A 2GDZA 2ZYDA 4JBIA 3QE3A 1Y7TA 2GLXA 2EKQA 4PLGA 2AW5A 2Q1UA 4HFMA 3RKRA 5JYFA 4WK6A 1B8UA 3LLVA 4N7RA 4UEOA 4N5NA 3IKTA 4NNJA 2GNAA 4P22A 2GZ1A 3A9WA 1GL3A 1C0IA 3U4IA 5JAMA 1HDXA 3OIFA 4I5FA 3ZDFA 2QIOA 2RIRA 3JD3A 3CINA 4DIBA 3EVTA 3EZYA 3N7UA 4RF5A 3WLFA 3KETA 5T6BA 5JXWA 3U4DA 3TF5A 2JD2A 5TGDA 3WQSB 4TKLA 3DHEA 1GD1O 3Q9NA 4IIVA 3P2OA 1G1AA 1JAYA 5JDIC 1Q1NA 3PHLA 3ANMA 2BH9A 2XXJA 4CQMA 4LSWA 3TZKA 5ER6A 4N5LA 4CR8A 4QXMA 4IS2A 2AG8A 4MKZA 3QIVA 4RCVA 1YH3A 3INRA 3NT2A 4NPCA 4RV9A 1AHHA 2X9GA 4BGUA 5DP1A 3ZWVA 3GGGA 4YRDA 1R0SA 3WX0A 4EW6A 1UAYA 4GH5A 4OOFA 2V6GA 4TVOA 2CDAA 4YJGA 1PTJA 4DVJA 4OKNA 1T2FA 3ADOA 4Z6KA 3LC7O 3PZBA 1J4AA 2NUAA 1VJTA 2Q2VA 3NDIA 5TT0A 3GVHA 3TFQA 1UP7A 3AW9A 4GAEA 4HFJA 4Z9XA 5COQA 1JKJA 1YBAA 5A9SB 1VM6A 1U3WA 3NJ8A 2JKVA 1Y81A 4CM6A 1LSUA 2FWMX 2UV8A 3OQBA 4I9NA 2HQ1A 3TZQA 3A06A 5U1PA 1KVQA 2Y66A 2ZTUA 2QYSA 3HZZA 1JU9A 3L07A 5JC8A 2RBEA 3O8QA 1A7KA 3NTOA 4ZRMA 5ER9A 1HL3A 2NWQA 3UUWA 3DC2A 4IY1A 4AJOA 1GU7A 4Z3KA 4CM8A 5L9AA 1BXKA 1DAPA 2GZ3A 4B8WA 2O50A 3Q6IA 3GHHA 4Y6SA 1UUFA 4ZJUA 5KVQA 1A71A 3KUXA 1B15A 1E5QA 1IPFA 1BVUA 3TZCA 5F21A 5TNXA 4WKGA 3C7DB 4K9DA 4MVJG 3KLPX 4LCJA 4G65A 1ONNA 1QMGA 2NNLD 4QO8A 5LDGA 2PD4A 2X5OA 2XOXA 4ALJA 2VQ3A 2Y05A 4NJMA 3JYPA 3AY7A 5A06A 2H5LA 4D46A 1D4FA 2BLLA 3FWZA 3WS7A 4BHTA 3NT4A 2OBYA 3RBXA 1R4NB 3ZV4A 1ADFA 3HADA 3H6KA 4FS3A 5L3ZA 1E1LA 2V6MA 1N8KA 2NLOA 2Y67A 1MX3A 1P0FA 4YCAA 4HFNA 5JLAA 2VN8A 4J4HA 4PVCA 2EWMA 3NGLA 3RUAA 4NBVA 4CM3A 2DPGA 5I8ZA 2E37A 3GRKA 5IXSA 2B0JA 2OBNA 1M67A 1M75A 3PTZA 3WGHA 4DYDA 3RROA 4BKRA 2RCYA 1VL8A 3PDUA 5JPIA 1HYHA 1PS9A 3JQCA 3WYBA 3WWYA 4GGPA 1HT0A 4DQXA 3DBLA 3PVZA 2C82A 2WDZA 1EE2A 2QRJA 5JY6A 3P19A 4H7PA 4KTVE 4S3MA 2GO1A 4RVUA 2CNBA 3MJSA 4HY3A 1FXSA 3UXYA 1XQ1A 2G82A 2VZ8A 4FOOA 4J1TA 3H4VA 2PGLA 2W2KB 3DTTA 5U4QA 1XELA 4MIYA 2AHRA 1QR6A 2C07A 4WE3A 1YRLA 3ETGA 2D8AA 4YT4A 4CV2A 4JLWA 5FEUA 1KC1A 1U7HA 3WYEA 2LDXA 2PZKA 3E5MA 4UUNA 2ZCUA 1R37A 4QQRA 1U1IA 2IYOA 3ZHYA 3A28A 2BMAA 1EVJA 4YAIA 5A3VA 4B8ZA 1LBEA 2EXXA 1L7EA 4NIMA 1T26A 3JTMA 1Z45A 1NVMB 3ZNQA 4FIZA 2DLDA 1B8PA 2YJZA 2ZTLA 4HADA 1EFLA 5I9NA 4M87A 3I52A 2C59A 1WW8A 4FJ2A 1HKUA 2GASA 4Q39A 2DM6A 3CIFA 1FDWA 4OQYA 3RUCA 1L7DA 2SCUA 4CQMD 2R6JA 1MXFA 5I9MA 5KJFA 1TI7A 2BELA 5DBFA 1ZEMA 4MP8A 4UUPA 4F45A 1NM5A 4OSOA 3DQPA 5JAIA 4QFCA 2ET6A 5F5LA 1D3AA 2JHFA 4OIMA 1ARZA 1T24A 3V2HA 2EW2A 1CQIA 1JA9A 3VH3A 1QXSA 4E2YA 4XYGA 1N7HA 4IXTA 3HWRA 3PGJA 4Y67A 4YVFA 1ENYA 3S2EA 2J5RA 1VJ1A 5K6AC 5L40A 1GY8A 3U09A 1WMBA 1I8TA 2B4RO 1AE1A 4DBVO 3PLNA 5IJZA 3M2TA 2A4KA 3I4FA 2VNSA 3JQAA 4HNGA 1TVEA 4CV0A 3BZUA 3NT5A 1PZFA 4WNCA 1E7YA 3VHRA 4BNFA 4MVJH 3IQDB 3JCZA 3OJ0A 2UUOA 1Y6JA 3WGZA 4Z0PA 1VE9A 4QFDA 1HF3A 4MOWA 1B16A 5HRUA 3JQFA 3LQFA 1KEWA 1LLQA 4MP6A 2AQ8A 4Y6RA 5IFLA 3ZWXA 4J0EA 4BO5A 2VZ9A 4XB1A 1U4SA 2NV6A 2WMDA 4MDHA 3RCBA 4XKJA 1I3MA 3WWZA 2HAEA 4DPKA 3GVPA 2HO5A 3I9OA 2UDPA 3GVIA 2D5AA 1KETA 3H2ZA 3EY4A 2VHVA 2ZB3A 3ZI0A 5JYAA 3WGIA 5JDCA 4WNIA 4CLOB 3RBVA 3VZQA 4CMJA 4ONEA 1Y1PA 1K89A 3F6YA 4KUHA 3RUDA 1C1DA 3QLJA 4FCCA 2BD0A 3DZFA 2X86A 3NJ4A 1PJTA 3JD2A 3JQ7B 1K0UA 5KJ6A 3JD1A 3CE6A 1Z74A 2F00A 1KYQA 4FFOA 1NQAO 5L53A 1ENZA 2E4AA 3PZRA 2C2XA 3HHPA 3W8FA 5H81A 1MFZA 3I23A 4JIGA 4G5HA 2GD1O 1P33A 3GZNA 1HWYA 1E7QA 2F1KA 5KOIA 4TZKA 3KYDA 5CAEA 1PJSA 4A2CA 4XDYA 5DF1A 1E6EA 4DIOA 1DIGA 4U6QA 4ZQEA 1FDUA 1QP8A 2XPCA 2QG4A 1C0KA 4RVGA 4CL3A 2JD1A 5TJ9A 4GWKA 3GH3A 3ZGYA 2O3RA 2Z1MA 3RD5A 3RFVA 4KMSA 1VKNA 1K3TA 2EG9A 1NQTA 2J3IA 5L95A 1P1KA 5AVOA 2C0CA 3K2BA 3E6AA 3PWKA 2QHXA 5TRTA 1C3VA 1JWBB 2FRDA 1DFHA 2DC1A 2FSVA 3F9IA 2Y1CA 1I01A 5JSFA 2O2SA 5I8WA 2PGDA 1WDMA 4OO3A 4F6LA 4B3JA 5A1TA 2O3SA 4II2A 1R15A 4XCVA 4GQAA 3I83A 2B4TO 4R5MA 3GFGA 3RBZA 1FDTA 2Y1OA 1BXGA 4E32A 3PGXA 1LDYA 1XQ6A 4J1NA 4ITUA 1P1HA 1MGOA 1PGQA 3H5NA 2D59A 1Z6ZA 2X5JO 2PZMA 2FZEA 3OEWA 4IJVA 1PZHA 4BNJA 1Z75A 1WDKA 1QLJA 1UP6A 2Z95A 4YQZA 1IE3A 4A10A 2OUIA 1KIFA 1FDSA 3NGXA 4DLAA 5JBIA 1MUUA 3P7MA 1CRWG 3KBOA 3GT0A 4D43A 4ZVVA 1TT5B 8ADHA 3DONA 3KHUA 3T4XA 4GMFA 1LX6A 2YFQA 2AA3A 2ZJ1A 4FFPA 3H7AA 3F5SA 5A05A 3AFNA 1ZMTA 4JX8A 1PGJA 1HDCA 1EZ4A 2Q22A 2DKNA 1PJCA 1U8XX 4QSMA 4MVJP 2WYVA 4CLRB 3LDHA 3MJEA 3IDSA 2D3TA 4RO0A 4LVUA 1HZZA 3I5MA 2NVUB 1DDOA 3SLKA 1B3BA 4X54A 4XYMA 2Y1FA 3IUSA 3RKUA 4GMGA 1EDZA 1HEUA 1RKXA 2Y0CA 1IZ0A 3E9MA 4CQLB 2JCYA 2OO5A 4J7XA 5T8KC 3WR5A 5IZCC 3E5RA 3I9MA 3I1JA 5BNIA 4D79A 3VTZA 2IZ1A 5GY7A 3DZBA 3F1KA 2X7HA 4YRBA 5A3JA 3VAZA 3GPIA 4CL8A 4ID9A 2Q4BA 3CKYA 3WNQA 2YDYA 3H9QA 3RJ5A 3QW2A 2DFDA 4IMRA 4R5HA 3NV9A 1PX0A 3L4SO 1X7DA 4PLHA 3H3JA 4BO6A 1HZJA 2VYNA 4FC6A 4YJHA 5LCXA 1ZSYA 4R68A 3HNPA 3ETDA 3JQBC 1P3DA 3D7LA 1H5QA 1BW9B 1N1EA 3DEYX 1JVSA 1YQDA 3WFIA 1GTMA 3WSVA 4W9NA 3TSCA 1H9BA 5LC1A 4CMKA 2ZTVA 4I9UA 1XCBA 2QRLA 3H5RA 2YHIB 3JSAA 3OH8A 2NTVA 3WG9A 3LT0A 1XSEA 3ICPA 5AOVA 3ROMA 3ZV3A 3D3EA 5KIAA 1GR0A 5CEEA 2FR1A 4LVCA 3GGOA 1PJ3A 1HTBA 4WCFC 3BTOA 3ANNA 4PLZA 4W7HA 4WCDA 3AWDA 3MTJA 4DL9A 1H6CA 1RWBA 3UH1A 4A7PA 3OA2A 2HMSA 4ND3A 2YV1A 3KEQA 4O5OA 3DZJA 3TFOA 4WOKA 4DXHA 3WDSA 4TROA 1EDOA 3QWBA 1YWGO 3LF2A 3LC2O 2BRUA 2GN4A 3LLSA 5CPBA 4BOYA 3AI2A 3K2EA 1U28A 2EJWA 1P9LA 3IS3A 5L4LA 4WCFB 2C54A 4E31A 2R00A 3HFGA 1SOWA 3GDFA 4GVXA 5ICMA 2GYYA 3CH6A 4BKOA 1P1RA 5JO9A 2NU7A 3D4PA 4DLBA 3COSA 3EDMA 1RPNA 1KVSA 1WPQA 3O9ZA 4DMMA 1P31A 4TKMA 2XAAA 4RPJA 1NYTA 2IEDA 3DDNA 3WQQA 3D0OA 1EQ2A 2P9EA 3H5AA 4TRNA 3WB9A 3CTMA 1QSGA 2VWQA 2X9NA 3BYZA 1CF2O 4XQGA 1W0CA 4EJ0A 4RF4A 4O59O 3F46A 3R6DA 5CDSA 5JO0A 1SCUA 3IIEA 5H83A 1NQ5A 4UVIA 1DFIA 2BFPA 2VT3A 1H2BA 2JCVA 3PLRA 3AK4A 2W4QA 1TT7A 1F8FA 2B35A 1X13A 3PHJA 3OSUA 5DDIP 1DB3A 3FNHA 4BGIA 3NUGA 1ISJA 4AJEA 2D2IA 4DPMA 5F5NA 3UICA 3ZNNA 4HV4A 2HLPA 1PJ2A 5JDIA 1QV7A 5C7IO 1HDZA 3DWFA 4L4SA 4UVGA 1QORA 5KCZA 3EAGA 1W4ZA 3P5SA 3BIOA 4M86A 1P0CA 1UAGA 3MZ0A 5G4KB 3VOSA 3F1LA 4GLOA 3PEFA 1HDRA 4LRSB 4E4YA 3ZHZA 4D45A 1JVBA 3X2FA 1ZK2A 3ABIA 5AQ1A 1QG6A 5AXAA 3TRIA 2QX7A 3GN1A 2P5YA 1L1FA 4FPXA 3IL2A 1UXHA 4EUFA 1LJ8A 5C7LO 4A03A 3RIHA 4JCOA 3R3SA 3RU7A 5TSDA 4E13A 3CZRA 3H8VA 5F3RA 4YT8A 4E0BA 3OJEA 2RAFA 3GUYA 3EHEA 4YRAA 3EYWA 5B4VA 4D41A 1BTOA 3F5QA 3ZZNA 4WLEA 3RC9A 1P1FA 1E6WA 3JYNA 2BFMA 4XQCA 3W4IA 4CLHA 3SVTA 3FF4A 3EMKA 1A9YA 1H6DA 4B4OA 3AUTA 3GHYA 1PL7A 5I7FA 1ZK0A 4I5DA 5DZSA 2VYVA 2J5KA 4BNHA 4L8VA 1QYWA 1YO6A 3BA1A 5DNAA 1R12A 1DHRA 4IDDA 1QYXA 4FFNA 4DPLA 4DUPA 4Z9YA 4IJUA 1KOLA 3U3XA 3V2GA 4RLHA 1V0JA 1I24A 4FFLA 1CDOA 3G3EA 1UJMA 4K28A 1DAOA 1R4NA 1PL6A 1ZZEA 5L7WA 1E6UA 5HM8A 3DAFA 4YA6A 1CERA 3W4KA 1HYEA 1U3TA 4BNKA 2ZTMA 3QVOA 3DMTC 1LLDA 3B20A 1T2CA 2FP4A 5CP8A 3WQRA 1R66A 1OBFO 3NKLA 3OJLA 4AG3A 4FOSA 4EZBA 1D1TA 2VYND 2JFGA 4JK3A 3WGGA 4N18A 1O0SA 4R3WA 4I8XA 5DCWA 1LRJA 1RM0A 1Q7CA 1DRUA 4XYLA 5CDUA 3L6OO 2J8ZA 2EV9A 2YY7A 3WICA 4O1MA 4BNWA 4XRGA 4YB8A 4QECA 4NBWA 3ZU4A 4I08A 4Z3DA 3WGOA 3A4VA 4CMEC 1YL7A 1HDOA 1KBZA 1A27A 2RH4A 2Y93A 3IOYA 4BGEA 1DLJA 3ZWCA 2GPTA 3B70A 2VHWA 4MO2A 1WP4A 3L4BC 1AXEA 4CMHA 4CMAA 2W2KA 1ML3A 1XR3A 1ZJZA 2RHRA 3MJVA 1YBMA 3DBRB 3W8EA 1LDNA 2C7GA 1UDAA 2EGHA 2JFHA 1NWCA 1KY4A 3V1TC 1I10A 2PWZA 3PHGA 4ZD6A 3K5PA 2EHDA 1I2CA 2PD3A 3NTQA 1GEEA 4KDEA 5K0ZA 1F0YA 1LDEA 5M6DA 4IZHA 4PCVA 4O0LA 4H16A 4Q3AA 1GUYA 2IZ0A 4B3HA 1NVGA 4BUCA 4GKVA 1O89A 4ZQHA 2EJVA 1QYCA 3D4NA 3WBFA 2I6TA 2V65A 4ZQBA 4ALLA 3DR3A 1BDBA 1UXIA 2Y0DA 4NDNE 1PJLA 1DFGA 4QEDA 1E7WA 1X1TA 2D0IA 1VPDA 1HSZA 2ZJ0A 3OIDA 3UVEA 2GN6A 4P8RA 4S1VA 3BMCB 1M6HA 3PYLA 1YOVB 3RASA 3B1KA 4D3SA 1T1RA 1X7GA 2FMUA 4PG6A 5B4TA 2X9VA 3UGKA 3QWAA 2AE2A 4HKTA 5EINA 1UDCA 1GZ3A 5JC1A 3R0IA 3G0OA 1V35A 3HDQA 4Q3EA 1ISIA 5BSHA 1ZUD1 2IZZA 4FGWA 3FR8A 3WSWA 9LDBA 2GRAA 2X6TA 1V3UA 2AG5A 3K92A 2BFAA 5JCXA 4ZHSA 2H6EA 1B14A 3P2YA 4JNKA 4EGFA 4GBJA 2NU9A 4IQ8A 2CSUA 5FI3A 4C4OA 1O95A 3D5TA 3JYOA 4UUOA 3G1TA 2EW8A 3V1YA 1JDJA 4PLWA 5JE8A 4BQRA 3L9WA 3N58A 4D3FA 3UOGA 2V7PA 3ROKA 1D1SA 5K9ZA 4PIVA 5HS4A 3UF0A 1U2GA 2NSDA 4Y8VA 1EMDA 3TNLA 1E3JA 4GX2A 4AJ2A 2LDBA 1NX6A 4PLCA 4PLTA 1IPEA 1B7GO 2RH8A 2EKPA 3FRJA 4J16A 4J3FA 1I33A 2CVOA 3SC6A 5K6AA 3C3XA 3H65A 2O3JA 2Q46A 3MOGA 1YKFA 3GC6A 2ZK7A 1H6BA 1AHIA 1KEPA 4DBZA 4YWJA 5H82A 4NR0A 2Y0EA 3VTFA 1XGKA 1U7TA 4LN1A 1NFRA 3QHAA 4E30A 4MVJI 2W98A 2YQ4A 3VPGA 2P91A 4WPGA 1F14A 3QWFA 3RUIA 2VYVD 4ND5A 1Y8QB 3UKOA 4WLNA 4O63O 1NNUA 2UYYA 4ND2A 3GAZA 3PJDA 5U9CA 2X4GA 4RPLA 4XGIA 3DBVO 1GQ2A 3Q1LA 3QJ5A 4J1QA 4JJFA 5KVCA 1TA4A 2HMWA 2C20A 2VCYA 3E1KA 1NTOA 3F4BA 3PHIA 4RJTA 4K1LA 4CLOA 2EP5A 4RORA 1PWXA 3DOJA 3JQDA 3BHMA 2JAPA 5DOZA 4Z0TA 1LXCA 3JQ7A 4F46A 3I9LA 4Y9DA 4E2ZA 3KZVA 3W6UA 1I3LA 4ZQGA 4M1QA 3KRTA 2X23A 4KQXA 4TWRA 5T57A 3U5TA 3U4HA 4JP2A 4AJLA 2WJPA 4IDFA 1GQYA 3RFXA 2Z1NA 3DHYA 1T4DA 1EVZA 4HXYA 4YT5A 2J3JA 2WD8A 3ZWBA 4BB5A 4NZ9A 2CUKA 4G2NA 3S2GA 3HB5X 4R3NA 4M89A 2FZWA 3HN7A 4E5MA 3DBHA 1O9BA 1LSJA 3OEYA 1MXHA 1O6ZA 2X0JA 1G0OA 2O3UA 2YV2A 4FGSA 4FJ0A 2D4AA 1MB4A 2DUWA 4YAKA 3PJFA 1IY8A 1HLPA 4DRYA 5HTOA 1AXGA 1BHSA 1WAMA 3BMOA 2Q2QA 4MVJE 5EQDA 1UZLA 1EBFA 4YT2A 5C5IA 4IQ0A 1T1SA 2GSDA 4L4XA 5JMWA 5EL0A 2OOSA 1V8BA 2C7VA 4PLFA 7MDHA 1ZIDA 3WNVA 1WMAA 1ZEJA 2C5EA 5MGBA 1ULUA 3G49A 1QYDA 3OJFA 3Q2IA 3BMNB 3C1TA 1VSUA 3C1OA 1YL6A 2E48A 2EERA 1EQUA 3HSKA 1B2LA 3KLMX 2TMGA 4FSHA 3VVCA 1A5ZA 1JTVA 1SOVA 2WD7B 4I1IA 3BTSA 2B5VA 3KB6A 4XQEA 3GVCA 1A7AA 2E6UX 5AXDA 2DPHA 2YDXA 4LSMA 1XA0A 3GEGA 4FR5A 4PG8A 3KOUA 4XYBA 3ZNOA 1DRWA 1LQUA 4IS3A 3MJ4A 1OMOA 3B1FA 3D3WA 1RM5A 2P5UA 3QQPA 1HETA 1XHLA 3ZWMA 5KTKA 1LSOA 3RFTA 4BV8A 5TS3A 1DBVO 2O4UX 1SC6A 3W6ZA 1LC3A 1T25A 4NK4A 1DC6A 2X58A 3TQHA 2HK8A 3JQ8B 2VRCA 3VDQA 1HDYA 1TT5A 2YZ7A 3L6DA 4HP8A 4DC0A 3TWOA 1RYEA 5L4NA 1HE2A 1MFPA 1ZSNA 3WXBA 5G0TA 5A9TA 5IAAA 4E6PA 2PKQP 4WEOA 2NM0A 2WYWA 4CLRA 4NI5A 4CUJA 1VSVA 2HUNA 1KERA 4XZ3A 2NVUA 3WTCA 2X5KO 3H2SA 1CETA 3R3JA 5KJEA 3VPHA 1JQBA 1DC3A 1PGPA 3NEPX 1IL0A 2OXIA 2O48X 2FPPA 3PJGA 4K6FA 4YYZA 2BGMA 1H6AA 4DGSA 4EDFA 3DBLB 4IIUA 5ENDA 3WMXA 4WOJA 2HRBA 1LU9A 4CQLA 4QO7A 3F4LA 4D0SA 2AEFA 4GWGA 3FCOA 4EI2A 3GA0A 5IN4A 2OHXA 4TSKA 4FFRA 2BKAA 4XYEA 5KNLA 4MVJA 5KVVA 5C37A 3TZHA 5DP2A 3ROQA 1OOEA 4IINA 2P2SA 4WLOA 4RGBA 1LNQA 2CD9A 1TEHA 2Y99A 5JYDA 2DBVO 4BS9A 4M54A 4DQVA 4HFRA 4TRJA 5T8KA 4FW8A 5B1YA 5IZCA 4DREA 1NXQA 5JAQA 1SB9A 5JYEA 3PIDA 4E33A 1NR1A 4YJFB 4CM4B 1U5AA 4LMPA 4LRTB 1NFQA 1BW9A 1EUDA 4UAGA 5KJCA 4IGFA 2VRBA 1GDHA 4H15A 4FFMA 3UN1A 1T2EA 1DPGA 1ONOA 4M55A 2BI7A 4EEXA 1E7RA 2Q45A 3VKUA 1IB6A 4YACA 4PG7A 2YHIA 3TL3A 5IG2A 5TX7A 4E5NA 2ZYAA 4KDFA 4J2HA 3Q3CA 5J9GA 1KS9A 3UFXA 2UUPA 3G79A 4AICA 3JQBA 1PJ4A 4AJ4A 2Z5LA 3UCEA 2DVMA 1TLTA 3U49A 1T2AA 3QVSA 4FQ8A 4CMIB 1ULSA 4RF3A 3R1IA 1DJQA 3OFSA 4IXWA 3RU9A 1X7HA 4RPGA 4PG4A 3TPCA 3C7AA 3RC7A 1IHXA 5HBRA 3UCFA 4DTIA 4EUHA 4L75A 4DA9A 5ICSA 3KV3O 1N9GB 4WCFA 3TOZA 4OKIA 3GRPA 4K6CA 2VUTA 2YV3A 1JAXA 3VZRA 1VKOA 1NWHA 2HDHA 2ZB4A 2PLAA 1U9JA 1Y5RA 1XWFA 4AL4A 1ID1A 3M1LA 3QRWA 3CEAA 4W99A 4MIOA 3CXRA 3GR6A 1GV0A 4U8GA 2EGGA 3V1UA 1SO8A 1WDLA 1MG5A 4P4NA 2HU2A 4BMSA 3INGA 2PNFA 3SJUA 2VWHA 1X0VA 5A03A 5CG1A 4E5PA 2AQHA 2O3TA 4BNXA 4RL6A 2BI8A 1GADO 3IC5A 3KXDA 3LVFO 4CM7A 4LGVA 1DIRA 1N5DA 4ILKA 4CV1A 1C1XB 2PKQO 1KY5A 3GPDG 3FPCA 2A94A 4B7UA 2HJRA 5IDQA 1UH5A 1VL6A 3RC2A 1EEHA 3JQAD 3KM0A 4IDBA 2XF8A 3DFZA 1FDVA 1GYRA 3OIGA 5G4KA 1J0XO 4B3IA 5IDXA 4Z0HO 3EGOA 4I5GA 1I32A 1ZKMA 4RVFA 4XD2A 3SEFA 3ETEA 5TT1A 2VUUA 4ALMA 1OC4A 1SZJG 4JN6B 4J7UA 1ZW1A 2HMTA 3K30A 2VRCD 3AY3A 3GQVA 5CHEA 3C1AA 2ZQZA 5KVSA 2G1UA 3N74A 2RHCA 3LF1A 4CLDA 5IXYA 1EBUA 5IZ4A 4AJ1A 4KUEA 1G0NA 4BO0A 3E9QA 1Q0QA 4EJ6A 3E03A 1UXGA 2VHZA 2PH5A 1OI7A 4JBGA 4ROSA 1YB4A 4BO1A 2I5PO 4UULA 4HNHA 1Y9AA 1BDMA 3HDYA 3RSHA 3KYDB 1SAYA 3ITKA 4BNIA 2C29D 4B7CA 4KUGA 2WE8A 2B4QA 4RZIA 3S8MA 4ZICA 1LTHR 4BKUA 3VZPA 2I76A 4PFJA 4JXKA 1EE9A 1NR7A 1E1NA 1PJBA 3GG9A 3I4CA 3EVNA 2CF6A 3F47A 1U3VA 2OP1A 3C7CB 4D42A 1LQTA 1ZO8A 3GY0A 4NFHA 2Q3EA 3HDHA 4XA8A 3AUAA 3L0DA 1E7SA 2X1HA 3G17A 4OYRA 3RI3A 3ROPA 4MVJD 1PS8A 1E77A 2UAGA 5G0UA 5B37A 1I5RA 1RJWA 3I3OA 4XIYA 5COBA 3IJPA 3ZCXA 4J49A 5CEJA 1DC5A 4BNTA 1YGYA 1DHTA 5HS6A 5JFOA 1E3LA 2JD0A 5FYDA 1NVTA 1DEHA 2ILTA 4DIFA 1WWKA 2EIHA 2AEMA 3BMQB 1NPDA 4GI2A 4YPOA 3KYBA 3ZWPA 5JW6A 3MTGA 4TMFA 3WIDA 4CLEA 3GG2A 1EUCA 1WNTA 5G0VA 1BVRA 3BTUA 3DMTA 1PQWA 2IE0A 1N2SA 1Q7BA 2CFCA 2WTBA 5I7EA 1UZNA 4DQUA 4J0FA 1YS4A 4XB2A 4E2WA 5CDYA 4B4VA 3B1JA 4F6CA 4J1SA 4OL9A 3ZW9A 1HE5A 5KKCA 1QYVA 4U7WA 1DC4A 5JNLA 4M8SA 2GUGA 3I9KA 1F8GA 2CZCA 4NJOA 3DBRA 1KVUA 3L6EA 3JD4A 3VC7A 3VVBA 2B69A 2X0IA 2Q99A 4CMEA 4IDAA 4A73A 2QZ9A 5A4DA 3GN2A 2QYTA 1DRVA 2B37A 1E1MA 2DQ4A 2J3KA 2NU6A 4AVYA 3FBGA 4UEKA 3WFJA 3L4BA 3EZLA 4R51A 3JYQA 3WGTA 1C0PA 5JS6A 4J90A 1Y9EA 5A9SA 1PR3A 1NHGA 3KTDA 4L76A 2DT5A 2OZPA 1AUPA 4JQCA 4L74A 2AQIA 3GEMA 3AM4A 4YAGA 3D5QA 1HXHA 2WYUA 4P4GA 2JL1A 1HE3A 3BMCA 3OF2A 1DXYA 1ENOA 2GERA 2O23A 4NBRA 3E48A 3GFBA 4BNUA 4IM7A 4EUEA 1EVIA 2VHYA 4NFYA 3WMWA 5GZ6A 3QSGA 1FMCA 2G17A 4QX6A 2CVZA 2QQ5A 4NBUA 4A26A 6ADHA 1GV1A 4KQWA 3NAQA 3B6ZA 2Q1WA 4JJIA 1V3TA 1Q2XA 2VWGA 3DFUA 1I30A 3PWSA 3CMCO 3ORFA 3OHSX 2FHSA 3PP8A 4B4UA 2IEBA 4L73A 5MDHA 3LT4A 4A27A 1OZAA 3FD8A 1R4MB 2PK3A 2HMUA 1WXDA 3SX2A 4TVBA 3GF4A 4ZRNA 3AOEC 4E2XA 3JQ9C 1NPYA 4BNGA 2ZKLA 1VC2A 2VOJA 1K2WA 1Y8RB 4K26A 5HA5A 2G76A 3KYCB 2DBQA 2E49A 2HRZA 1GFSA 2IODA 3D64A 2CVQA 5DBIA 1I2ZA 3DHNA 2POQX 2B5WA 3IUPA 1DJNA 2OP0A 2ZQYA 3PK0A 4W7IA 3M1AA 1IULA 2JFFA 4UUMA 1NPTO 1E3SA 2PFGA 3GGPA 3GK3A 2VHXA 3RJ9A 1P74A 4GSKA 4JJGA 3GZ4A 2P68A 3MOIA 4E21A 4TZTA 4YAEA 2PH3A 2NVBA 4OOEA 5DOVA 3VKVA 3GLQA 4CLXA 2AXQA 2VUSA 3FNFA 2FOIA 4BO2A 4J7CA 3WIEA 3GNTA 1LA2A 1GPJA 1PL8A 5TQVA 1LC0A 1EFKA 1ZCJA 2GF2A 4XWYA 4Q3CA 4NH4A 3AU8A 1YL5A 3CMMA 5G0WA 3AY6A 3FTPA 1R16A 4NU5A 4J9UE 2QW8A 4YR9A 5C3MA 4P38A 3V8BA 3ONEA 2BFOA 1Y8QA 4BNYA 1LLCA 1UXKA 1HDGO 3K73O 1ZXBA 3RUEA 4KWIA 5FF9A 4ZQFA 4NU6A 3HQ4O 1NQOA 2Y1EA 3RUFA 3ZWOA 3MEQA 2GGSA 3S2FA 1NBOA 2W2LA 4MIEA 2AEJA 3ENNA 5BNTA 1JWAB 4OXKA 4YTEA 4EEZA 3ZV5A 2PD6A 2PKRA 2DUUA 4P4LA 4B79A 1HLDA 2DBZA 3IAHA 1M2WA 1D8AA 1NHWA 1N7GA 1KVTA 1B26A 3FBTA 4M49A 5COAA 4GSLA 1BG6A 3ANLA 3H9GA 5A04A 2YQ5A 4Q3NA 3ST7A 1W8DA 2YUTA 2DTDA 4GKBA 5BT9A 4PLYA 5A02A 4IBOA 3NTRA 1E0DA 4YAJA 1X0XA 1VJ0A 2BGLA 3I6IA 1V3VA 4WASA 3O4RA 1YB5A 3ZH2A 4AJJA 4XR9A 5IDYA 3ZHXA 1TXGA 4PRKA 2HKIA 4EITA 2X22A 4JGBA 4QT0A 5CEFA 1MV8A 1LUAA 1E3WB 4BGVA 1Z7EA 2PR2A 7ADHA 2P4QA 1ISGA 2AE1A 5DCYA 5L45A 2V6FA 2VT2A 3WYCA 3GDGA 3AJRA 3EW7A 2NQ8A 1I3NA 3VDRA 3DMYA 2IRWA 4O6VA 4QTZA 4TRRA 2WSBA 1BRMA 1BXZA 3DAPA 3AM3A 4BVAA 3Q9UA 1CWUA 4AJKA 1X15A 4D7AA 3FHLA 2O3QA 4B4WA 4ALNA 5TLSA 1GZ4A 3JQGB 3MWDB 4GPD1 2EF1A 3IP1A 5G0SA 1LEHA 3OMLA 3TOXA 1ZFNA 5BQFA 1K6JA 1KVRA 5ES3A 1O5IA 3BMNA 3I9NA 2VTEA 1JN0A 4WJZA 4U0KA 4AJIA 5ADHA 1ZSVA 3ASUA 3PYMA 2GZ2A 1E3EA 5TIIA 2WE7A 3U4CA 2WD7A 3AI1A 4RF2A 4XIJA 3OA0A 2I67A 3ADPA 1LDGA 3FNEA 3MJTA 2W8ZA 3KSZO 4DYVA 5EN4A 2EEZA 3ZWWA 4YQYA 1UDBA 4NK5A 3FI9A 4ALIA 1GPDG 1YDWA 1SPXA 3DOOA 1FF9A 2V6BA 1XU7A 1H93A 4OQZA 3GAFA 4NMHA 2J6IA 3JQ8A 2CF5A 1S7CA 3GMDA 4R16A 4BNZA 1XEAA 2D1YA 1PGNA 2CDCA 2E82A 3QVTA 4PRLA 4RLSA 9LDTA 6LDHA 3W1VA 3NDRA 3PRJA 1I2BA 1J49A 4CR7A 1ADCA 3O03A 2NQTA 3WBBA 4Y98A 1T2DA 2FR8A 1N92A 2C5AA 3WGQA 4H3VA 3HE3A 1LDBA 4OHUA 2Q1TA 3DTYA 5L7YA 3T4EA 3OICA 5I7VA 2PZLA 5T5QA 3K8ZA 5ILGA 2OMEA 3ZHBA 2PTGA 4DC1A 4R41A 2NVWA 1DLIA 1VL0A 3PYXA 4CQMB 1U4OA 4OMUA 3OBBA 1XU9A 4FDAA 1JKIA 3PQDA 2ZCVA 1Z7BA 3PQFA 1JLLA 5BSFA 4HWKA 1PIWA 3U9LA 2IXBA 1UR5A 3ZWAA 2Y68A 3GEDA 3E18A 3AUSA 3D4OA 3WGYA 5BNFA 1LRKA 3DZGA 4I9HA 1PZGA 4YJGB 2JJYA 3AOGA 2CDBA 5GZ1A 1ONPA 1A9ZA 2JAHA 4EYEA 1EK6A 4IGEA 4ALKA 4ND1A 4Q3DA 5B12A 5KKAA 2BF7A 2VOEA 3HDJA 4YJFA 4CM4A 2PGJA 4PGFA 2A35A 3H3FA 5DULA 1XLTA 5EQFA 1BGVA 3QWIA 1IYZA 4Q3BA 2DAPA 1YBVA 2IYPA 4LISA 4IDCA 1ENPA 3O8QB 4D3DA 1GUFA 2W2LD 2ZIZA 5AXCA 1HRDA 4INAA 1SEVA 1FJHA 3L77A 4NBTA 1QRRA 1ZBQA 1EVYA 3FPLA 3OECA 4OJNA 4MVJM 5JAZA 1B8VA 4CM8B 4IMPA 4WGGA 3H9EO 4BNNA 3V2UA 2G0TA 3U0BA 4BL5A 4CPDA 2HSDA 2J3HA 2I9PA 1XKQA 1YQXA 3I6QA 3OJOA 5BSEA 4J2OA 3LZ6A 4J43A 2BGKA 2HK9A 3M6IA 4BKQA 3ZN2A 4CMIA 3CPSA 1JW9B 4XX0A 2FPIA 4BO4A 4LMRA 4R1UA 5G4LA 5ITWA 4HBGA 2YYYA 3BXXA 4FC7A 4GX5A 3DB2A 3E9NA 4RDHA 2XXBA 4A0SA 3ENKA 4XDZA 1N9GA 2B36A 1ISFA 2HK7A 4CR6A 4C7JA 4L9RA 4MKRA 2DTXA 1W73A 4NJMB 4XGNA 3QV1A 3O38A 3ON5A 4RQTA 3VPXA 3VZSA 3WJAA 2OGUA 3S2IA 2Q50A 2PZJA 1XIVA 5TJHA 4NG5A 3DXFA 3U62A 4AFNA 4CMGA 2G5CA 5BR7A 3L9XA 3OQ6A 3A14A 4GLLA 4BB6A 3GDOA 1ADBA 5DN9A 1QV6A 1GCOA 5THQA 3SXPA 3DOCA 3BHJA 3TN7A 5ENVA 3AM5A 4OH1A 4BKPA 3FWNA 4N5MA 5CG2A 1MP0A 3LT1A 3UHAA 3TL2A 3W8DA 3ZU5A 3PXXA 3VPSA 4AJPA 3K9QO 2Q4EA 2WEKA 5L4SA 1X14A 4XJTA 4XEHA 3BAZA 4R4JA 4I5EA 2EP7A 1CYDA 2I99A 1SBYA 1YB1A 3RAJA 5IDWA 4HUJA 4DWVA 1MG0A 1V6AA 1C1XA 5EMHA 4IJWA 2Q2WA 1I3KA 1IHYA 5GZ3A 5ILOA 4ZGWA 2BHLA 1I0ZA 4WLFA 1P45A 4AJHA 3ICCA 1UZMA 4RVDA 5LDHA 3T7CA 1ZVMA 1D7OA 2WM3A 1WZEA 5FFFA 5A5FA 4MVJF 5J23A 2I65A 1ADGA 1PJQA 4YJDA 3S55A 4BO9A 3MWEB 4LW8A 3PQEA 3TJRA 5EPOA 1W6UA 3QVXA 3VPFA 4IDGA 5GMOA 4CUZA 4CUKA 2B83A 1IOLA 2ZATA 3QP9A 3GOHA 2Y1GA 2Q1SA 4PLPA 3ONFA 3EC7A 1P44A 4MP3A 4RPKA 3W4JA 2CMDA 3NX4A 1IZ9A 3JYLA 1ZJYA 3FNGA 1YJ8A 2R2GA 1B3RA 1PQUA 3ASVA 3OM9A 4E3ZA 1CEQA 1HYGA 4Z9FA 3ZV6A 3FTNA 1ZK3A 1WZIA 4WLUA 2QZZA 1M76A 1H2HA 3C85A 4BMNA 2TMDA 1T4BA 2ZB7A 5I7SA 1K5HA 1R0LA 2FY8A 3OQ1A 3VH1A 4YBZA 3SLGA 3WLEA 1P1IA 4ZA2A 2D5CA 2FSSA 2OL4A 1ORRA 3RVDA 2VZ0A 4RPHA 1CQJA 1IUKA 4E12A 3ZWNA 4FJ1A 5T67A 2H9IA 3GNQA 1SMKA 1ZXLA 2AMFA 3DBHB 4PZEA 4FB5A 1SNYA 4WLVA 4WEQA 4NFSA 4XR4A 1Q7GA 5F1PA 4R1TA 3K96A 4NHEA 2P4HX 2W90A 3PIIA 3QVWA 1MLDA 1YQGA 2JCXA 3BMOB 4BIIA 4BNVA 1Z73A 5JCJA 2A92A 1RM3A 3MCVA 3PHHA 2NTJA 1E5LA 1BMDA 3WTBA 5EIOA 5EESA 4BNLA 4BO3A 3LU1A 1K6XA 3KVOA 4W4TA 1EK5A 2X0RA 2YFHA 3EUWA 3OP4A 3Q11A 4R54A 1N1GA 2NACA 4CM9A 1SEPA 4BNMA 4N54A 3K31A 1P77A 5FWNA 4CV3A 4IPTA 1KEUA 4B7XA 1GQQA 3BMQA 1ISMA 3STHA 1HSOA 1UP4A 3K6JA 1NASA 4WECA 5KWEA 3PWZA 4E5KA 2H63A 5THKA 4IQGA 4MKXA 4A5OA 4ESOA 4OAQA 5CDGA 3JQFC 1RM4A 3AFMA 2GCGA 1DIAA 3JQAB 4EBFA 2FPGA 1VLLA 3PJEA 4EJMA 3E8XA 1F12A 3CUKA 1GUZA 1QKIA 4JROA 4D44A 1BWSA 4L0QA 4QUKA 1MA0A 4KTTE 1XDWA 5FI5A 3ULKA 4AJNA 4TQGA 1B0AA 2I66A 3D3WB 4PG5A 3GMSA 3RQSA 1H0KA 1XG5A 3HJAA 5HWSA 1XYGA 3NYWA 1YONA 4ZN6A 4PZCA 4IUYA 2OFPA 3EK2A 3LT2A 5DBGA 4JBHA 3Q2KA 4CMCA 2HJSA 4W82A 1EUZA 4GX1A 5T73A 2P9GA 3RC1A 1F17A 5JDCC 1U8FO 3AU9A 1VI2A 3BHIA 1GEGA 4CMBA 1E3IA 1A4UA 1U3UA 3ONDA 1UXJA 5I9LA 5JMPA 5DCUA 1NAHA 2DU8A 4MJLA 2YW9A 2DFVA 3SC4A 3JQ6A 1U2DA 4U5QA 1Q0HA 3BTVA 4U6SA 1KC3A 4YXFA 4MINA 3RWBA 4UVHA 1OFGA 4BMVA 4XQ9A 4TRMA 2ZB8A 1E1KA 1C1DB 4OXYA 2IXAA 2EKLA 3RUHA 3VH2A 3JD0A 4UVDA 4KP7A 3DZKA 4PVDA 4XGKA 3DZHA 2FN7A 2HMVA 4J6FA 3M2PA 2JHGA 3WJ7A 2PV7A 2VNAA 3IJRA 4ZU3A 3JQEA 1DOHA 1S6YA 5A9RA 2NTNA 2YHUA 2OORA 1ZH8A 1PEDA 1K6IA
chains in the Genus database with same CATH superfamily
1E8NA 3HWWA 3VR2D 1IATA 2EATA 3GZNB 2J5BA 2QW1A 4DQDA 1AIPA 3Q0EA 3G5TA 3LC0A 4FCVA 2G6TA 4MVYA 2YIDA 3L7KA 3S27A 1F06A 1L6IA 1QGAA 1N6NA 2J7KA 3EF1A 3IBYA 2WQ7A 2ZCJA 2C4HA 2GZDA 5LQCA 4CKEA 5ED4A 4E5VA 4LGYA 2IW3A 3WWDA 3S1LA 2HF8A 2DZDA 4PM4A 1BX1A 4N3AA 3EGXB 3LSYA 3GT4A 1XXHE 3HB9A 1JH8A 1GLGA 2R85A 2REQB 3AKEA 4RE5A 1Y8RA 3AI3A 3HWX1 3UAGA 1ZS9A 1G2OA 4C1NA 4IQ4A 4PN3A 5CCXA 2HT1A 2FB9A 1HNNA 2R87A 2JZNA 3NONA 1FK8A 1WLYA 3QM1A 4KSBA 5AQEA 5T64A 4RK6A 1MDFA 5D3ZA 3KAPA 1WP9A 2LIPA 4RZHA 3ZBPA 4BC1A 1UDRA 1M66A 3ZYCA 2PDAA 4CM5A 1JKFA 2RC5A 1KP9A 3BFPA 3LKDA 4BATA 4NQZA 2MYNA 4Q1FA 3W0LB 5C51B 1W30A 1R0XA 4Y6QA 3IESA 1JDBB 3RYIA 3RSQA 3UQYS 1JZSA 4CF3A 1GYPA 3IP5A 2CDRA 5CYPA 2QSYA 1SUAA 4XRRA 3TE7A 1YI8A 3KT0A 3UWKA 1XF9A 2C5BA 2ID4A 1GCUA 4IDEA 4J2TA 4LSZA 4NZNA 3ZXYA 1P2SA 2JEYA 3B51X 3R5KA 1W5BA 5K09A 1D9XA 1J00A 3NM5A 4R69A 3R76A 4M7RA 2BCJQ 4F4UA 4P2GA 1E2KA 1FY2A 1XQWA 4JD5A 4R1NA 4R01A 2B7BA 2AMVA 2FF7A 1ZK4A 2JKZA 4PQRA 5BUCA 3ZD8A 2PY6A 1LBQA 1NQUA 2BM0A 4OEHA 4YRIA 1YQEA 4UXIA 2VYCA 1K2VN 1MDBA 1UEIA 2I4TA 2VHQA 3DYVA 3HB4X 3HCRA 1SHJA 2K7ZA 3MJCA 2H3HA 3N2GA 1Q0LA 3VH4A 3ZNPA 1W5FA 3N05A 4B1FA 3V4ZA 4OGWA 3IB3A 4UUAA 2WIKA 4D8WA 4P7FA 3WE7A 1OX4A 1GZ6A 2WNHA 3PCXA 4KPEC 2J9FA 4IIYA 3KC2A 4TYNA 3CZMA 2O7VA 3QNUA 1RYHA 1K7EB 3FVVA 4IR7A 2A88A 1MIOB 2G9ZA 2J5QA 4XM0A 1IJBA 5J63A 4RFSA 2VR1A 2C2YA 2FMTA 2PXHA 2I3AA 4N5HX 5EWLA 4DW8A 5CIYA 3FN4A 3TTSA 1AKVA 1GPBA 1FZTA 1PT9A 1VP9A 5JCJD 1YMVA 2RIPA 3CX4A 3EQ6A 3LYLA 4LK3A 4MAAA 1CR4A 1RYZA 2FWPA 4RA6B 3ZIAA 5K8JB 1OWOA 1KJNA 2O2JA 2ZYGA 4JLAA 4WUVA 2OXCA 2YBDA 5BSGA 3I6BA 3ZCPA 1S2GA 4MW4A 1NXOA 1MNQA 1YVEI 3INTA 4IIXA 3S1SA 2QN3A 1VSQA 3QWHA 1ACJA 1GGKA 5B4UA 3GUCA 2QTAA 1BWRA 1TAHA 3DO5A 1YE3A 2RGCA 1JDTA 3OZEA 5BPFA 3JAMA 2O7SA 4QGGA 3WIBA 2PJDA 3O3NB 1B74A 4RAOA 4UHBA 4JP3A 4YX9A 2ZZMA 1RMYA 3LLMA 3Q8XB 1Z82A 1QYRA 2VG8A 3SIWA 3E82A 2EIXA 2RG1A 2V3WA 2ZJ3A 3E8MA 2WHRA 4D4HA 5LLDA 1WBDA 2FZLA 2GN8A 2WB2A 3D8HA 2LD4A 3KYJB 3NVKI 5K8TA 1V37A 1YOVA 2YJTD 5K3DA 3BQ9A 3ZW8A 2O2IA 4PX9A 4QYIA 3RTCA 4PHCA 1W75A 1PJRA 2V59A 2Y71A 3IVMA 3QLTA 4Z1MD 3FSRA 5I4BA 4UREA 1SBCA 2CVHA 4FBGA 1Z0ZA 4ZDKA 2RKBA 4D4JA 3W90A 3VKGA 2BCEA 2JJMA 1WQ4A 3RJTA 4DV4B 1G8SA 3VJKA 1YB6A 3ZZTA 2WVGA 1C7RA 1AS2A 1CY6A 3GFFA 2IW1A 2W2XA 3UMJA 4MV0A 1Z22A 3C4JA 3VBEA 1K3FA 3K53A 1DIHA 1MC5A 1BEEA 4GX0A 1NXWA 3CUYA 4DMLA 3UGJA 3G13A 4WAUA 4NYJQ 4YJHB 2YV4A 2WWRA 3N0XA 1XPUA 1FS5A 1ISHA 4K6OA 4YRCA 3CH5A 1KXZA 1V5IA 1HR0B 3DF9A 3AM1A 3O4IA 4J91A 2BKEA 5H5JA 3G0CA 2WQZA 3BD8A 2O0JA 3AQIA 3FWKA 4JT8A 5DW3A 3UW3A 4TXNA 1PQPA 1DSSG 2J6HA 1A4IA 3A3KA 3PFFA 2RGRA 5EE1A 2NO9A 1J5PA 4ZT5A 2GF0A 2B20A 1A4XA 3ZBUA 3EP3B 5GTDA 1R6XA 1DNPA 3I4LA 4DHEA 3ROXA 1NUSA 3ED5A 3UMSA 2XCOA 2I3GA 1G6OA 1OAAA 3D7MA 3CNHA 2DRIA 1CVLA 2P9CA 2G4LA 1CNEA 2HD4A 2JIDA 3L0ZA 4KKVA 5EZQA 1GTVA 4QUGA 2CJFA 2UVDA 4DB4A 1CEYA 3T5BA 2R00C 4IHJB 4MQBA 1Z2OX 3HYCA 4GC9A 2CXUA 4R1SA 1D8TA 4A3SA 2XCIA 3CUUA 3EPRA 4JBIA 3FYSA 2AW5A 4HQLA 2C7OA 3H86A 2Q4DA 3SF8A 3RSGA 3W2TA 1XZIA 2HWXA 2H1WA 4BLQA 4BEJA 4AI6A 1TYEB 1XAJA 2P0AA 3QXGA 4A1FA 1XZLA 3LLVA 4N7RA 3UWPA 4N5NA 1OGJA 3FPEA 3NOXA 4WQMA 3OX4A 5C52B 3AF2A 1T8TA 3ENZA 2JIQA 3OIFA 5KQGA 1QNLA 3AVOA 1DKUA 2GJAA 3P4XA 4I5FA 4MI3A 4QUIA 3SVZA 2NPOA 3ZDFA 3OBIA 3UJAA 2RIRA 1CJUC 5L8VA 3CX3A 2OBFA 4DIBA 2P65A 3RT1A 3U7HB 2NU7B 1Y0BA 2OHIA 2JS7A 4X8OA 3RVQA 4QTUB 3PI6A 3RO7A 3I9V6 3SS9X 3U4DA 2JD2A 3WQSB 4TKLA 1LZLA 1Y7LA 5LKRA 3DHEA 3UEOA 2YIJA 4WINA 2WJZB 5BOVA 5FUWA 4IIVA 5LZ7A 1G1AA 2WUWE 1A4RA 2JJ2D 3CF6R 1RP1A 2ECOA 3PHLA 2WYHA 2OBMA 3N0TA 2BH9A 1SCUB 3EBOA 3M4JA 1Y3HA 2XUKA 3P9RA 4HPXB 4LSWA 2KJQA 4MIKA 4Z1OA 5ER6A 4BTEA 3HYTA 5C4IA 3EIUA 3KQKA 2ODTX 2ICAA 5ALPA 1YH3A 1JEQA 3CSSA 2D2EA 3BAFA 4H27A 4QAJA 2N9UA 4KFSA 1Q7TA 4B32A 4C01A 1OSNA 1XRLA 3IWBB 3VJMA 2V0GA 1SXJC 3SFZA 4IXDA 4FSXA 2VTVA 4GPAA 4L8LA 2A8YA 4QQ8A 2G4CA 3M6XA 4GH5A 4JYAB 4DVJA 2CDAA 1PTJA 2C9OA 2H5IA 3PNOA 1T2FA 5AJHA 4BVLA 4MPTA 3T9DA 1Q6YA 1O03A 3ITNA 4KRXA 2QTVA 3U4MA 5ERXA 1IBLB 5HMMA 4EO4A 4WGFA 3GVHA 2IOFK 1PW5A 2ZYSA 4HJRA 4FM9A 4GAEA 4Z9XA 3A8TA 4C3UA 2VLBA 2H2AA 5AJVB 1YBAA 2AN3A 3LI2A 4LCBA 4NCXA 2PMEA 5A9SB 1Y81A 4ZI7F 2GQ0A 2OESA 3OQBA 4I9NA 4TS4A 5BW6B 3TZQA 2DUNA 1JU9A 3L07A 1R8YA 4AB1A 5JC8A 1MH1A 1A88A 2ZFUA 3NTOA 2PMWB 3O47A 1HL3A 1IHUA 3R3WA 4AG6A 1D0IA 3TJMA 3VVMA 3NTUA 2RHBA 2C00A 4KOEC 4C7XA 4IH1A 3H9BA 3WK8A 2IPXA 5TDHA 5K5EA 4MHSA 5L9AA 3MTEA 1NMXA 4AKTA 4RIEA 1X38A 4LSGA 4Q7LA 2Y1LA 1UUFA 1UK7A 3NJRA 1E5QA 3K5HA 1Z12A 2RARA 4NS1A 3SWWA 4QU0A 4XB6B 3GJ5A 3LCMA 2AB0A 5CU7A 1BVUA 1PHPA 2BGGA 2O2CA 4J7AA 1OBHA 2DFPA 4KRFA 4DA4A 1LK0A 4YUXA 5HIAA 5CA0B 1R4ZA 5EY5B 2D13A 4FW9A 4LCJA 4ZOLA 4QO8A 1QMGA 3RSSA 4E08A 3OZXA 4G9GA 3ZDRA 4H17A 4N7MA 1N3LA 2XOXA 3MWKA 4RVCA 4P3OA 3KR9A 4YO7A 4ALJA 4TTAA 3S0JA 4DVGA 2BONA 2QT1A 2GEDA 2H5LA 3F67A 3QFCA 4KSCA 1TTHA 3FWZA 3O2SB 4BHTA 2YIMA 3ZV4A 1GDDA 1I7DA 1AZSC 3H6KA 5KO2A 3G5LA 2M32A 2O6LA 3A9TA 3EG9B 4M1KA 5L3ZA 2JG3A 1HFKA 5EG5A 2ONJA 2A0KA 4OHKA 2Y67A 1MX3A 5CM9C 3RAPR 4F3NA 2FPXA 4HFNA 5JLAA 2EFGA 5I9SA 3OWHA 1XHFA 1VHLA 4RTOA 3BD6A 3VNSA 2FZGA 5MFPA 1UT5A 1VHTA 2OBBA 5LUBA 1RXYA 2DPGA 1XZAA 2E37A 4XFDA 3L6CA 1A95A 4JL5A 4MHTA 5KNBH 3G9UA 2J3LA 3KKZA 1M75A 1BMQA 2QYHA 2V03A 3PXGA 2VF2A 3WGHA 5I01A 1FLVA 3M5DA 1NVKA 4DYDA 4F86A 1XZJA 3GLIA 4TLMB 2Y76A 1RD4A 2RCYA 1VL8A 1DPFA 3LTEA 3NIWA 3RFFA 1FFXB 1PS9A 4U2EA 1QIFA 1QH1A 3WWOA 3ZGXA 3THXB 3WWYA 1CRQA 1YUBA 3KJIA 3UMVA 4EFDA 4MV4A 2EKZA 3I9FA 3LWZA 5I4KA 5DGCA 2GBCA 1EE2A 2WDZA 1FQOA 5JY6A 4KTVE 5KWIA 2WV9A 5CFMA 4LOKA 4U3JA 2RFLA 1H3NA 2AX3A 1XTPA 2CNBA 3GJ7A 3D8BA 4HY3A 1UADA 1JFLA 4I4CA 1EFHA 5FPHA 1XQ1A 2FDRA 1MF7A 2EU8A 3F7TA 2J0SA 2WWIA 1RXEA 2I7VA 1E1QD 3DTTA 1XNGA 4BFTA 1IVYA 1IAVA 4OM7A 5CR9A 3COVA 2D8AA 2O52A 4ZVSA 3FYUA 3L3BA 4HPWA 4MTLA 2HY7A 1AHNA 3NUQA 4JLWA 1KC1A 4FT2A 2GPNA 1WCIA 3HWSA 1K97A 3PGMA 3WYEA 4PZ0A 1KP3A 1AKRA 2P2CA 3O3OB 3DMGA 3O3CA 3P45A 4G1FA 5LXTF 4KR3A 1QOZA 1TZ2A 3EUAA 4UUNA 2DY1A 5FBWB 1MX5A 1T8PA 4C3VA 1RR6A 3A28A 4YHBA 2DYKA 4G36A 4H6WA 4IMJB 5TE9A 4B8ZA 4EPYA 3B48A 4MO9A 5JQGA 5LMZA 1YTLA 2QUHA 3AG5A 2VFAA 1UMDB 1EJ2A 1NVMB 1D2RA 1E89A 1OXXK 1XZBA 2H57A 3DLIA 4FIZA 4OB7A 1P4JA 4LJLA 1E32A 5KNBA 5IKOA 1OJLA 2YN0A 4H1WA 5I9NA 2WJ4A 1RPJA 2ZUDA 4QLAA 1GFZA 2C59A 4WZ6A 3SIRA 3SZMA 4JA0A 1XMQB 4JYMA 1AQLA 2ST1A 1PWYE 3BWXA 2UUAB 3OPNA 1NW9B 3ETCA 3P9SA 1IUOA 2FJUA 3T1QA 4CQMD 4G0XA 4L7VA 2J46A 3MGAA 1P9OA 1V6SA 1B76A 1QZXA 2GYWA 3MGCA 5AI5A 5KJFA 2BELA 2OFXA 2BHNA 3C5CA 3I9V1 4M4SA 5DBFA 3S2UA 1J90A 4M1YA 3ABQB 1L4MA 1JQAA 2Z9CA 4BN0A 4MCIA 2F4NA 3J7AC 2A7XA 3DQPA 4DUZB 4J03A 3M81A 2HA5A 3V2HA 3C39A 2GLTA 3QPBA 4WVFA 3REGA 2QM3A 3UW1A 2IYVA 4DIMA 4F96A 3NM6B 3J81k 4BMCA 1MR3F 4F5DA 2R8ZA 2CEKA 2H0QA 4QNMA 2YWRA 1N7HA 4BE4A 2PT9A 1Z28A 2W58A 3GFRA 3ZLJA 3PGJA 3DMFA 3TBKA 2QORA 3RRBA 1I3OA 5TF0A 3COYA 1X7XA 2EL7A 4I1RA 1ORTA 2FYTA 4MV7A 1W0JA 4R83A 1NXPA 1WMBA 4NG4A 4TV9B 3SZLA 1YS9A 3D3JA 4ER5A 4RTQA 1K98A 3E9RA 4HNGA 5KTSA 1LBSA 3F96A 1F2UA 4KI7A 3SJBA 2XLCA 1MHMB 721PA 1J2UA 1PZFA 2WIJA 1QVAA 4MNTA 3IMCA 4Q4JA 5D1NA 5B3AA 4B2IA 5GADl 5EZSA 4WXYB 3VHRA 1GWNA 3S8EA 4ZVKA 3WL8A 2FKNA 1MZPA 3EEIA 5IJWA 5LLTA 3ZDYB 2F62A 4QM7A 3RLFA 1U99A 4MRPA 2PBRA 3S1AA 1VE9A 1HF3A 3EYAA 3OCZA 5G1OA 3E22B 1XZPA 1CUSA 3NWEA 3LQFA 3JR7A 4PINA 4MP6A 2I7XA 3D3KA 2ONZA 4O4LF 3FNIA 4J0EA 1MO2A 1P4AA 2P0EA 4ND8A 1YZTA 2WMDA 5IT5A 4G1UC 1FP4A 3FIUA 3PQVA 1G21B 3WWZA 3G5UA 2PSSA 3HI6A 1QPZA 4UARA 2HO5A 1TM4E 2XKAA 2RGDA 2FXVA 4KQ1A 3QENA 4PGMA 5JWRA 5G02A 2UDPA 4ZVNA 1QR2A 4WZBB 5I9TA 2XD4A 2DSTA 2BGRA 1PFUA 2WYOA 3QF7A 2BEVA 5JYAA 1N1DA 4N0MA 4AY4A 1QK3A 1WSAA 3WGIA 2AFHB 2GHRA 1M2JA 4KXYA 5FV7A 2WWHA 1BEZA 3KP1A 1AKTA 3IEVA 3QLJA 4FZJA 3EGDB 1T0JB 3CE9A 2X86A 3DZFA 3A3OA 3FAZA 3JD2A 5E1BA 1K0UA 4IIGA 2ZRBA 3NBUA 3H17A 2DWPA 3IEMA 2NYRA 3PV0A 1Z5OA 1KFCB 3V42A 1KYQA 2V6IA 3FPFA 3ZE1B 2ZQ5A 3B78A 5FDFA 2C2XA 1CUXA 3N6VA 1YI0A 1L7RA 1WXEA 4TPKA 2ZKIA 5AK0A 3WYNA 3C6BA 5LMNB 4G5HA 2GD1O 1TQ6A 3WLMA 5H4HA 1E1CA 3DFMA 4TZKA 3TQCA 1VLZA 3KYDA 3A9RA 3UIEA 1QP0A 5A6SB 1PJSA 2NZVG 2VH5R 4A2CA 5DF1A 4C05A 3RVNA 1T5DX 2Z5GA 1GTSA 3ZIUA 3JYHA 1QJCA 1QP8A 5DN6D 4F4JA 3HBLA 3A32A 1K7SN 2WINI 3D4LA 2QG4A 3HR8A 5TS2A 3T1VA 4RVGA 1X1AA 4RESA 16PKA 1BJRE 2EEPA 3CZPA 1KI3A 3P96A 5TJ9A 2CJWA 4CL3A 1Z39A 4ENQA 3AILA 3GH3A 2GKSA 1COWD 3F3MA 1RW4A 3R8CA 3RFVA 1ONBA 1EXMA 1H66A 1JHPA 2MWMA 1VKNA 3O1IC 4N01A 5LXTB 1W6RA 5E7IA 1NQTA 4WI1A 3RSLA 5HUJA 1WUKS 3JQPA 4LS3A 4DCNA 1P1KA 2FCRA 5LZ5A 5CVJA 5CCEA 3V3KA 1JFRA 2C0CA 1J24A 3OOHA 3QEMB 3E6AA 1GKYA 3LYUA 3CH7A 3N8HA 1C3VA 2FRDA 3HFRA 1QC5A 4OK3A 5IBRA 2Y1CA 3MN1A 1JHQA 4N82A 1GLVA 2P41A 1MEOA 2B6HA 1UBOS 2X2PA 4PIPA 1VJRA 1A7UA 5CD1A 3SIXA 2CMKA 2O3SA 3RG8A 4CCWA 3OUUA 2ZUEA 2BT4A 1C3OB 2G40A 3I83A 4D82A 3RLIA 1OJ7A 4G6ZA 3R24A 1XYYA 2YKGA 4GOOD 2XYRA 1BXGA 1NBEA 4DCUA 1CX9B 4E32A 2C4NA 1LDYA 2B3TA 2BZ1A 4FCTA 3WHLA 2WM9B 4TL8A 1WDTA 4ZVQA 1UKBA 3H5NA 1RWWA 1E61A 2GN1A 1UFRA 2NZWA 3O90A 1FNNA 1JBEA 1H22A 1RQLA 3CONA 4JCCA 2AOVA 5DGIA 3HL0A 1PZHA 3CCBA 1Y3AA 4Z0NA 4K46A 2N3ZA 4V38A 4ADSG 4DUGD 1NI4A 1MD9A 4YQZA 5K3FA 4LE2A 1QHNA 1U94A 3N5KA 4M9CA 621PA 3CEHA 3P7MA 2VVTA 3SS7X 1DEXA 3GT0A 4YP9A 4KKXB 3O75A 1XPRA 1LPPA 2TS1A 1TT5B 8ADHA 2XT6A 3DONA 1DC7A 3K9BA 4JC5A 1XZFA 1LX6A 1JR3A 3GGSA 3VYTB 4M0EA 1ZX1A 4JENA 3H0WB 2X8JB 3GT7A 3MD0A 3REFA 3ZLVA 5JROA 2DB3A 3I53A 5A3QA 3NZEA 4OHVA 3T3EA 4RIGA 2PMDA 1GPLA 1BE8A 2DKNA 2FZ4A 1PJCA 2RK4A 1XRRA 3RANA 4CLRB 3LDHA 1M2OB 3IDSA 2CXSA 2D3TA 1JFSA 4QUBA 4RO0A 1BWPA 2NVUB 1XNHA 4F2GA 3FNQA 3PDIB 2XE4A 2IUTA 4HMQA 1V16B 5IT0A 3P9ZA 2MYPA 1OZ0A 4E70A 5GVSA 1IN1A 5KYVA 2WIDA 2YVKA 5I7RA 1MZVA 1RKXA 5CITA 2V1UA 3E9MA 1PYDA 2QXTA 1JMYA 1Z68A 1U98A 4LWPA 4UZEA 2ZUTA 3WR5A 2C4MA 3I9MA 4CN9A 4O4LB 3D59A 4KXLA 5IZCC 1N34B 1VLJA 1GZDA 1RJ9B 2FSHA 1TYDE 2H1RA 3HM2A 3I1JA 4PXYA 2NGRA 1QKKA 4XARA 3VTZA 4D79A 3OPYB 5GY7A 2H3EA 1RZVA 2ODNA 3DR5A 3TBFA 2QTWB 4BU0A 4DLRA 1TVKA 3KOYA 4QBKA 5KEIA 2QTHA 3F1KA 1Y3BE 1E3QA 2X7HA 4KPUA 5A3JA 1DKQA 1JQJC 1RHUA 3F5DA 2ZIAA 4CL8A 1GAXA 3BEOA 4EKIA 1THGA 2F3TA 2JGIA 3WNQA 2BDEA 2G8NA 4OMFG 3H9QA 4FQ5A 1SOMA 2VYFA 2HNKA 1JIQA 1M7HA 2YN2A 3QW2A 2DFDA 5KNDD 4R5HA 1PX0A 4EECA 4NQRA 1T3LA 3D2BA 2LR0A 4RMGA 3EFOB 2JK1A 2XDWA 2E4XA 1PV1A 4KBYA 1EFVA 1EXWA 2QP3A 4WIAA 1H05A 1WCYA 4GMDA 4X7BA 1H5QA 1VMEA 1B6RA 3K15A 4G85A 1RVDA 4D6YA 2VDWA 3ZBTA 4MGYR 3TGLA 1H9BA 1VG1A 4HMOA 4OH7A 3LBYA 2BMWA 1XCBA 3EIHA 4QREA 1HA3A 1QH0A 3ZWQA 2P1RA 1W29A 3JSAA 1SXJE 1X8XA 1BHJA 3OH8A 5AOVA 4EK9A 5K0FA 2QRVA 1N8SA 5DH9A 4DLKA 1ACLA 2H1FA 1PL0A 4HUQA 4WXHA 3GLFA 1PJ3A 5C18A 2VRNA 3QX7A 5EZ6B 3BTOA 3DEZA 4F84A 3EVEA 4JI1B 4DL9A 1CDEA 2A1IA 1DO0A 5D3QA 5JAUA 2C4KA 1VA4A 2AXNA 2CMFA 2HMSA 3G7UA 4O2AA 2YV1A 5SZJA 3TDNA 3SQDA 4WOBA 2W7TA 4O5OA 3BSYA 2PGIA 3X3HA 3NCHA 4Y2HA 2VDVE 2D6FA 3OCYA 1EDOA 1JF8A 1UYJA 1UBHS 4G8CA 4JUIA 5F76A 1YWGO 3HKCB 5KU7A 1ZDMA 4IW3B 4DIDA 4EKYA 2FUCA 2HNAA 3K2EA 5CLHA 5CXXA 4JOCA 3T3PB 4QOHA 5HEKA 2Y6UA 4UQLA 4E31A 2R7MA 2AD1A 1SRRA 3FUVA 3A6GA 3H13A 4R0VA 1K5PA 2ONYA 3CH6A 2QSUA 3EVDA 4C2UA 5DYIA 2R25B 3D4PA 1E1RD 3OFNA 1P31A 1ULTA 3NTVA 1WHSB 4TKMA 1K08A 1DDIA 4MQ4A 1USWA 1E6LA 1ZWKA 4GI5A 3RS8A 3WQQA 4BMYA 2JFZA 1UM9A 5FPYA 5DNYB 4EFMA 4OSEA 4JUDX 1G5RA 2NP6A 1H5NA 2ZYIA 4EJ0A 2DERA 1YHZA 4O59O 1P5HA 1CJBA 3IWDB 2BV3A 3PUWA 3T1TA 2BFPA 5EIBD 3PLRA 2JCVA 4L95C 2W4QA 1O54A 1L7QA 2OMKA 2R96A 2VHCA 2PIDA 1KSGA 3OSUA 4AS2A 1ZNXA 3B1ZA 1UBLS 5ITSA 1YVPA 1ZJ4A 5DDIP 1DB3A 1ZJJA 2QRHA 2O8BB 3PC7A 4AJEA 2PFSA 2D2IA 1VDMA 1Q84A 1A9XB 1W36C 3UICA 5YASA 3ZNNA 3KVYA 4BLOA 2QLMA 1RXUA 2BJWA 4PYLA 2OXFA 3OFVA 3O8DA 1AKQA 1DRJA 2AVDA 2ERYA 3RHFA 2XDQA 2ZRQA 4F4FA 2QPTA 5D3KA 4FNGA 3Q5EA 4YLGA 3ESDA 1W4ZA 3KXIA 4AULA 2Y4OA 1Y6QA 2JGAA 2CCJA 4Q21A 5FBRB 2G67A 3VZDA 3UYLA 3D5EA 5BQ5A 3OZWA 4ECEA 2H06A 4MV8A 1GG9A 1TK9A 5JV5A 4TLAA 1V25A 1AUXA 4ZANA 5IVKA 3GN1A 4X97A 3GCXA 3IV7A 3QHQA 3W1EA 5BXYA 4TM7A 4P4TA 1L1FA 1S0UA 3CLRD 3KLOA 2P6UA 5CFNA 9LDTA 1TFRA 3NP7A 5C7LO 6ABPA 3RIHA 1LBIA 1WV1A 2QLNA 3QU2A 4MYRA 1I4WA 3N53A 3AF1A 3L0OA 3RKSA 3T61A 2PUFA 2P8SA 1EFRD 3EWIA 5JCOA 4JI8B 1P5ZB 3GUYA 3EHEA 5B4VA 2GBLC 3GJ4A 4LF4B 4O2RA 2IXDA 4KWCA 5FTKA 1FNMA 4XQCA 1E6WA 4QNNA 2BFMA 4HEQA 3QEJA 4K03A 3W4IA 1PT5A 3RU2A 2O2XA 4ZIRB 4YJ2F 1SKQA 5G3ZA 2IUEA 4JVLA 4TXLA 4IL5A 5AJWA 3MINA 2V7GA 4KGXA 3SEZA 2Q6LA 4DJJA 4FXOA 3O3MB 4TMZA 3H1GA 1PL7A 2FEAA 2XCLA 3MT9A 3LUAA 4CKEB 5LVAA 3LHFA 4EW1A 2A1UA 1YO6A 4KR6A 2GCPA 4XSVA 5DLPA 2VHTA 3TIVA 3SEAA 1JG3A 2LNDA 2PH1A 1PG5A 2P35A 3S40A 4DPLA 4EYGA 4LC1A 1KOLA 2M1ZA 1N5IA 3QMPA 1COZA 5DPMA 4TZ0A 1DBIA 3RHZA 1G9TA 3U3XA 3FSJX 5E9AA 2ORYA 1JFVA 1K6MA 2QLJA 1XDBA 2IXEA 5GVRA 3PD1A 4HRXA 1G59A 1DAOA 1PL6A 1ZZEA 2XJ4A 3VR4A 3DAFA 3KTAA 4MR8A 4YA6A 1CERA 3WYDA 1DQRA 3FZGA 1U3TA 4BNKA 1LLDA 3B20A 1T2CA 1EJ6A 5CP8A 3RYIB 3WNZA 4BBAA 3QG5A 2WJHA 3BIFA 3BULA 3NKLA 4X8LA 2H16A 3HUUA 2GZRA 3A7DA 3I76A 3OY7A 3Q10A 1ATZA 1OVMA 1WXWA 3M70A 1OHHD 3WGGA 2O2HA 1RLTA 4N18A 2AG6A 1SVKA 1MABB 1DRUA 4MUGA 2EV9A 5CNMA 3IH5A 2X7XA 4NBWA 4QECA 4UOZA 3VHXA 3CLSD 3UPDA 1RI5A 3OE7D 1T36A 2O5VA 4CMEC 2XCUA 4PNEA 1VJDA 4KXMA 5FOXA 2QM0A 3QJYA 4CKCA 2QY6A 4RC9A 4RTRA 1KBZA 1HDOA 1B8OA 2G80A 2XUFA 1DLJA 4OV6B 3RE1A 4G0ZA 3W5IA 2VHWA 3FAKA 5EJAA 1NF2A 5F7ZA 2JGKA 1AXEA 1J33A 1X3LA 3K9CA 4M0MA 1M1YB 1XR3A 1ZJZA 1O6GA 2RHRA 3MT7A 1YBMA 2HLDD 2BHSA 3WISA 2PT7A 5GAJA 2C7GA 2F17A 1CK4A 2AMJA 2Z4RA 1ZGGA 4OXXA 2WHYA 2JFHA 1XDSA 1P5FA 2P3QA 4MUXA 2QL9A 3T9EA 4B2LA 1KY4A 3FETA 3BICA 3LW8A 4C6HA 3OU6A 4ZOEA 3FBWA 4HXFB 2J09A 2W6ZA 4LY9A 2PD3A 3G8DA 2RSLA 1V8OA 3NTQA 3BFVA 5JCOC 1W4LA 4ESHA 5A3RA 1C41A 5M6DA 1OWMA 3OT1B 4IZHA 4PCVA 4S1TA 1AK9A 1UJCA 1XZHA 5DNCA 2A86A 4HQNA 2IZ0A 1U0FA 3WVNA 3HMQA 5E4JA 4CF7A 1PZXA 2OHOA 5EFOA 3SBEA 2BTQA 3W9BA 1CRLA 3DR3A 2D06A 2Y0DA 1H85A 2ZIUB 3T99A 4EX7A 1PJLA 2ZJFA 4BTVA 3WGUA 3C98A 4QEDA 2V3CC 3QPVA 5C1BA 1B43A 2ZJ0A 2Y2VA 3MRXA 4LIPD 1PF7E 3T41A 4S1VA 1G5IA 3JAWA 4R71A 1YB7A 3VAAA 3PYLA 2CFSA 1YOVB 3B1KA 1G5PA 3MMSA 4OBEA 3EXHB 3GJQA 5TQ2B 3IO5A 1BVHA 1K5GA 2X9VA 3E70C 4QYIB 3UGKA 5EINA 3PENA 1GZ3A 1UL1X 3GLGB 3DG9A 3AF4A 1V35A 3M6MD 5LQUA 4C43A 4KVZA 2EVWX 4N3NA 3K9GA 6AT1A 4Q3EA 3ZBQA 5J58A 5FXMA 4KYVA 4ZOLF 3I34X 4FGWA 4CHGA 3HGTA 3IVCA 1XZ8A 2OM6A 3KUDA 3GCDA 2PV0A 3K92A 4HLNA 4DQ0A 1B14A 2OCGA 3R0XA 1YRQA 1DCKA 4Z4IA 1L9KA 5EJ8A 2IF0A 2WD9A 3GFOA 5EWMA 2NU9A 2QK4A 2CUTA 4PO9A 5FIUA 2CSUA 1HUQA 2F8LA 5IH3A 5EHXA 1YFLA 2PUWA 3VFDA 2OZLA 4PLWA 5JE8A 3V1YA 1JDJA 4DQLA 5IRCD 1QOPB 3NG1A 1FFCA 4D3FA 3O7MA 4MI6A 3EZNA 1KHTA 4L9SA 4BVEA 3QJGA 4KH0A 3S7ZA 4CDMA 3T3GA 3F6RA 3MHPA 1U2GA 4IILA 1H3EA 4Y8VA 3IX7A 1W52X 2DR0A 1ZG3A 2ZRAA 5FWAA 1DWPA 4BWVA 2JATA 2VT6A 1NX6A 1BU5A 2BFCA 4PLTA 3TRDA 4BZZA 4F92B 1O6FA 3DDWA 1SVWA 1T0HB 4GR4A 4N5DA 1B0UA 1PD1A 4QYMA 4PNPA 1A9QA 2GNOA 4AWBA 3BM5A 3FA2A 4K9NA 4JT4A 5K6AA 5HXAA 3R7WB 4RFLA 5IULC 2Q46A 2E1PA 3SJCA 5FI0B 3ER8A 2J0EA 2ZK7A 1ZP6A 1KEPA 3E15A 3HKEA 4MJ7A 4YCBA 5D2CA 2Y0EA 2WLTA 4V0SA 1GKUB 3SQMA 1IQRA 3U7QB 4BZXA 5H16A 1N6RA 2PSFA 1S3IA 4IEFB 2X3YA 2FTKE 1L4BA 4HDKA 4MVJI 2YQ4A 1XA3A 1JHRA 3LUKA 4I50A 4JI4B 1ZHHA 4WPGA 1F14A 1IXZA 3IKJA 3MRTA 3QWFA 4R8SA 2OV2A 3L7JA 1OFUX 1MO4A 2BFEB 2G9RA 5CB0A 2CV0A 4GWLA 1NNUA 4RBNA 4QHYA 3V7WA 3HUFA 2PM8A 3ONNA 4ZT2A 3U56A 2ZSBA 3H1AA 5KDOA 2X4GA 4MK4A 3FFBA 4RPLA 4XGIA 3NBKA 5IM5A 1GQ2A 3QJ5A 2YXNA 4PAOA 2O54A 2X3FA 2CE7A 1NTOA 2WP8J 4RJTA 3AT1A 4KH1A 3IE2A 1G64A 1QRAA 3TVYA 1MB2A 1G8KA 4JSYA 1VFPA 3LA8A 4MWTA 1XVAA 5BRJA 3AHCA 3GELA 1ZC4A 1Y63A 3BHMA 4K86A 4KLNA 2JPDA 5AI4A 4Z0TA 2C58A 3RG2A 1LXCA 1Q21A 4FWIB 5JQGF 3FMPB 1Z0JA 2R48A 1P7YA 2HA6A 1KZ6A 2YFKA 4Q82A 3KRTA 3GCGA 4L0MA 1J20A 1B93A 1XTIA 1WPGA 2HXYA 4TWRA 4UMVA 5E9WA 4ZT4A 3UHPA 1O6BA 2FW1A 1QK5A 5JYCA 1KJJA 4ETMA 2G72A 1QHHA 3BJIC 5KB3A 4H6PA 1YDMA 4GS5A 5DM70 1T4DA 1J56A 5ECDA 5JALA 1GNSA 3EARA 2JFWA 5DTQA 5FOUA 2PR7A 4OAPA 1FEZA 4BB5A 3L06A 4KLAA 1DEAA 2CUKA 4G2NA 4R0MA 3WA7A 4L5CA 4R3NA 4M89A 2IKSA 2WABA 4DOMA 3FXAA 1JMVA 2XGMA 3AEXA 4PSCA 1PLKA 4QXOA 4DNQA 1AO0A 4EY4A 1HFWA 1O9BA 1RCFA 2YC2C 3MYRA 5CH8A 4D92A 3NHUA 3OEYA 4MMXB 4O2BB 4TTTS 2A59A 3BE6A 3N2LA 4ARVA 4YAKA 1N57A 1RKVA 2UZ4A 1IY8A 5CH3A 5FLYA 3F7OA 1YK1A 4INOA 2HRRA 2Q9BA 5GONB 4ATNA 4ZI3A 1BHSA 5HTOA 3KQVA 1F51E 3MBOA 1KQOA 4YT2A 3C6MA 4ZGGA 5C5IA 8MHTA 4PYMA 5ALIA 3CVJA 2YHSA 3D7NA 2CUZA 3BXFA 3FCSB 5JMWA 5JADA 4YDQA 1P6QA 5JJ5A 1XZMA 3X1DA 1QJ4A 2CYAA 2J9ZB 5IJ9A 2WDPA 5ERGB 3T35A 1WMAA 3BQMB 3QA3E 1YE5A 1RYFA 2P3LA 2OZVA 1EZ1A 1YZGA 1O2DA 1ULUA 4BJ3A 1QYDA 1WXXA 3BMNB 3CRMA 3DYIA 1VSUA 4JLNA 3ZG6A 4PPFA 4ARCA 1Z5ZA 5J40A 1P18A 3QUCA 4RKWA 1J25A 1EQUA 4OYLA 5TPZD 1B2LA 2HCBA 2IZ6A 4Y1EA 4UD6A 1M8JA 4AKSA 1BS2A 1JTVA 5EXPA 5CT5A 4TWIA 3GQBA 5F1YA 1S1CA 3O9VA 2E6UX 2DPHA 4GRIA 2JGNA 4JKOA 4LSMA 3GBPA 3GEGA 3AHFA 5E6RB 3LUHA 3OQIA 4F85A 1TO1E 1P1BA 3ZNOA 1ZH0A 4DWJA 3CZ5A 1LQUA 4IS3A 4ZOLB 2NUPA 2EFHB 3GJZA 3BVPA 4UE3S 1RM5A 2NXWA 1HETA 3RFTA 4P3KA 4BV8A 2ID7A 2XQJA 1DBVO 5ESRA 2JI9A 3B9RA 3W6ZA 1W2GA 3JSXA 1Z7WA 1BX3A 1T0UA 3ELDA 1AMOA 1CJTC 5JH7F 4I5IA 1S9HA 1HDYA 3VDQA 4HP8A 2FSPA 5E8JA 4U2GA 2EBFX 3O8OB 2AZDA 1HDIA 1MFPA 1TUEA 2ENWA 3EG5A 1D1PA 4BRSA 4R7TA 3H05A 3KHTA 1RYYA 1NVWQ 3WXBA 5IABA 5BUSA 1QCZA 4HZGA 4RKEA 4Z9BA 3QEBZ 2H9YA 1E5VA 3KWFA 4ZQIA 3OTHA 3IHWA 1XRMA 3O4JA 2AK3A 3BH0A 4XXHA 3T7KA 4BP3A 2VUHB 1N2XA 2WYWA 1VYHA 3IELA 4OFBA 1I1OA 5FD8A 4N8DA 3MS2A 1J2TA 1YR9A 2VO1A 2X5KO 2B4YA 1Z33A 4C7OB 1E64A 1CETA 1O95D 4QG3A 1JQBA 2ZIGA 2OXRA 4K3UA 2H2HA 2PQMA 1VYVA 1QH1B 2FPPA 3GB9A 4TGLA 2IH5A 4RY8A 4KXXA 4MW1A 1T0IA 3IUBA 4C4RA 1A1VA 4IIUA 1HEYA 3D4BA 1P2BA 3GJ6A 4JVSB 1RWOA 3WNBA 4CQLA 3F4LA 4PFSA 3H3XA 1WB4A 2MSNA 3KT8A 2Q4RA 4ZCSA 4DG8A 2IZOA 5MFZA 1BMFD 1KAEA 3GFTA 3UAXA 3TKAA 1KF0A 2OHXA 1CJKC 1RIFA 4RJLA 2BKAA 5EJ6A 3AL0C 1ZOIA 4MVJA 1FX0A 4Q15A 3FKJA 1DBQA 1HG1A 3TZHA 3GMIA 3HV0A 4WLOA 1C9MA 1H9CA 2WVHA 4RGBA 3ND8A 3EHDA 3OZUA 3PPYA 4DLXA 3NRJA 3OUZA 1GQFA 5T8KA 5B1YA 3FGNA 1J1ZA 5GJWC 5KMGB 3M1YA 3PIDA 2A33A 2LCFA 4A2QA 2KQUA 2HSEA 4MVWA 4NICA 1NFQA 4RD0A 1BW9A 3B2NA 3BBPA 4OA5A 4UFNA 1UJ2A 3LUPA 3WRXA 5AM3A 5KJCA 5KYYB 1XZGA 2G08A 4M53A 5CT6A 1T2EA 3PUVA 4BN4A 1YMQA 1LPAB 2BI7A 4EEXA 1E7RA 2Q45A 1L5OA 2R751 3HCBA 1PK7A 3NBQA 4PG7A 1RDFA 2Q1XA 2YHIA 1E5TA 3QQ5A 4NXNB 4LGMA 1D5CA 1IEQA 1M6EX 3TL3A 5IG2A 1JFFA 1KBQA 3X44A 4E5NA 2ZYAA 1MOQA 1T8SA 3UFBA 4DV5B 2G70A 1EDEA 4ZK6A 3RRNA 2GPAA 3QSYA 3HCAA 4EARA 1A50B 1U81A 3ZGLA 1L9XA 4GZLA 3IMEA 3Q1KA 3TLGA 5F78A 1M8KA 7MHTA 3UY4A 3PNSA 3IAAA 5BN3B 4YRMA 3U49A 2BF4A 3BORA 2JDIA 3PRHA 4CETA 3QVSA 1XMXA 2QE7D 4FQ8A 4L22A 4FBLA 4Q1EA 4HDMB 4XX0B 3OFSA 1AHPA 2E55A 3T94A 4MGHA 2JLZA 3PFCA 4HQ6A 5HBRA 4QLBA 2VJNA 2HGZA 1SCJA 3DCIA 3AV3A 3KWLA 4JFAA 2YR0A 3QH4A 4P4SA 1TQDA 5FEMA 2XQVA 3TOZA 5HQTA 1M1UA 1JBKA 4ZYZA 1JAXA 1YIDA 2HDHA 3MW8A 1V8ZA 1U9JA 1Y5RA 4YAWA 4AL4A 4BMZA 1U0JA 4JJ8A 1X7XB 4GOXA 3A6FA 1MNAA 1ZMRA 3F6CA 4LGCA 4W99A 3U61B 5ALYA 3GJ0A 2IU6A 2QRQA 4NH0A 4JITA 2IP1A 4S0XA 1NBMA 5IARA 1SO8A 3Q9LA 3RV4A 4CI0B 4ZFNA 1MG5A