1H9AA

Complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from l. mesenteroides with coenzyme nadp
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9aA01
2FRDA 2OHXA 4N5NA 4UREA 1FK8A 3MEQA 5T8KC 5JLAA 5JAIA 4WOJA 1UJMA 4I9UA 4IDBA 1GZ4A 2C59A 1RM0A 3GDGA 3AM5A 5DCYA 4BO0A 2HLPA 2X5JO 3CE6A 3V2UA 3FRJA 4W82A 3COSA 3F1KA 4D45A 4R3NA 1OOEA 2VUSA 4HNGA 4Z0PA 4AJJA 5COBA 3EC7A 5IF3A 1LQUA 1Q7GA 1C0LA 4KDEA 4A10A 4OIMA 1A9YA 2JAPA 3C7AA 3QA9A 4EGFA 3AUUA 3PJFA 2X5KO 3P19A 3PRJA 3RFVA 3ZHYA 1T2FA 4EJ0A 3JQ7B 3L4SO 5JMWA 2YFHA 1DLIA 1B15A 3RIHA 1PJ2A 4PGFA 4R1NA 1QSGA 1DC6A 5G4LA 4HFRA 2Q1WA 3ZN2A 5TLSA 3IL2A 1HSZA 3FTNA 3FNEA 3W4IA 3DB2A 3KYDB 1DJQA 1XQ6A 2TMGA 3JQAD 3HDHA 3GEDA 4R41A 2YDXA 3RKRA 2P4QA 4NU6A 4XJTA 4CMBA 4D42A 1JKJA 4CLOA 2HDHA 4WE3A 1GUZA 1NFQA 3VOSA 2CF5A 1V0JA 4DWVA 1NHGA 2PV7A 4DBVO 3MOGA 4O5OA 4CQMD 1E7SA 4P8RA 4IJUA 4J6FA 3JYNA 3IQDB 3JQAA 2FY8A 3CZMA 3GA0A 3V1YA 4DGSA 5A3JA 3OQ1A 2Y1CA 5KJEA 2GO1A 5JY1A 3GZNA 2XXBA 1Z75A 4FFPA 1NQ5A 2Q1UA 3H4VA 2VYVA 4FGSA 2J3JA 3D4NA 3PZRA 1B0AA 2Q45A 2C07A 3AI3A 3TDKA 3GRKA 1RPNA 3DZBA 3LDHA 5HWSA 4U6SA 1NPYA 3E48A 3FR8A 3M1AA 4JN6B 4NK4A 3WLFA 4IQGA 4PVDA 4UEOA 4FDAA 1X0XA 4BKPA 4KDFA 3ZU5A 5AOVA 4A2CA 1KVTA 4IQ8A 3WJ7A 1RM5A 5KVVA 2C5EA 3LYLA 3HFGA 3L9WA 3ANNA 4J16A 2B5VA 5JDCA 4DQXA 2B0JA 1CJCA 3AFNA 4XCVA 4XDZA 1B8VA 1UDCA 2FHSA 1LBEA 5JC8A 1IPEA 4E6PA 2OORA 1NNUA 5DBIA 1HETA 4WKGA 3WDSA 2DKNA 4FJ0A 3TF5A 1H6AA 3WYCA 1I2CA 3Q0EA 2NTNA 3NUGA 4RZHA 1T2EA 3FNHA 1WPQA 5L4LA 3D4PA 3GZ4A 2X1HA 2YJZA 4BS9A 2PKQO 4J4HA 4UAGA 4BNZA 3AK4A 3R6DA 3FWZA 4OOEA 3ASUA 4U7WA 4WK6A 5F21A 4CLRA 3BMCA 1I8TA 1IL0A 1YB4A 1ZSYA 2FR1A 3Q9UA 1CQJA 2H5LA 1KETA 3HDYA 3M1LA 4E32A 5CFZA 4OXNA 4WLUA 4XIJA 2JL1A 2P5YA 5C3MA 3DMTC 6LDHA 1Q2XA 3ENKA 2G82A 1DEHA 3PJDA 3GK3A 5GZ1A 4J43A 3I23A 1YBMA 4GH5A 1M75A 1JU9A 2VOJA 1DOHA 1NBOA 3DAGA 4K1LA 4Z9XA 1GYQA 1ZMTA 4PIVA 3WJAA 1A27A 1X0VA 3L6OO 1YONA 2VZ8A 3MOIA 2V6MA 3GVPA 3VPSA 3FCOA 3VPFA 5CAEA 1TT5A 4OL9A 3D7LA 5JFOA 4YJHB 3DWFA 2VUUA 5L7YA 4J91A 6ADHA 3CUKA 4PZEA 4CM7A 1ISFA 2FR0A 1GAEO 1E3WA 1ZK3A 4OMUA 1K89A 3MJCA 2Q2VA 5A4DA 1PEDA 2FR8A 4YAJA 3OHSX 3FHLA 4J9VA 2QHXA 3QVSA 5JE8A 2VRCA 4IS3A 2Q50A 1QYCA 1NVTA 3AOEA 3Q11A 1CYDA 3FD8A 5ER6A 1EUZA 4W7HA 2RIRA 2WE8A 4IUYA 1D1TA 4YJDA 2QRKA 1VKOA 3DAFA 2BFOA 3PHLA 4P4GA 1H5QA 2NWQA 5L53A 4F46A 4YQZA 1PZEA 1SCUA 4EUFA 2EIHA 4LISA 1A5ZA 4D3SA 3GY0A 3P2OA 2ZB3A 1LDEA 2VNAA 5ES3A 5BR7A 1HDCA 5DNAA 3TZKA 1QLHA 2IXBA 1CEQA 3U4CA 3WGQA 3WGIA 5IDXA 4FBGA 5L51A 3FBGA 3PIIA 4Q3CA 2BH9A 1HYEA 1QG6A 1NVGA 3JYPA 5IDQA 5KKCA 4ND2A 1LSOA 4MVJM 4CR6A 3HDJA 2JFFA 5A5EA 5T67A 3HHPA 2GR9A 4WEQA 2JJYA 2HMTA 5HA5A 1EDOA 5THKA 4CM1A 3QWFA 5TRTA 2G17A 3DBRA 3D64A 3OJLA 2O4UX 4RV9A 2I5PO 1R0SA 1T2AA 4RVDA 1VL0A 1O89A 1PGOA 3IUSA 4LN1A 4ZA2A 3WQSB 4K28A 1Q0LA 5JDIC 3QVOA 3DZFA 3UUWA 3NX4A 4NQZA 5TT0A 5I7VA 4UVDA 2HQ1A 3WFIA 3JSAA 1PSDA 1DIRA 1R6DA 1C1DB 3BMNB 4W6ZA 3RI3A 3W8EA 1I3MA 4FPXA 5L7TA 4JBGA 1GL3A 1EUDA 1YQXA 3WYBA 4CM4A 4F6LA 1NYTA 5B4UA 4WECA 1I33A 1PL8A 1PJLA 1ZVMA 4D0SA 3EVTA 2VZ9A 1QMGA 1JQBA 1EQUA 4OAQA 4RCVA 5BNTA 3VZQA 1CERA 1ADCA 2WMDA 3GT0A 3CH6A 3UCFA 4OYRA 4L4RA 3AUTA 1QV7A 4BNXA 4N18A 4CV0A 2WTBA 1MP0A 4WNCA 2RH4A 2C2YA 1E6UA 3A06A 4BHTA 4YEDA 5I9LA 2FPGA 4NJMA 1C0PA 4CM8A 5A9SA 4K9DA 1MV8A 3AM3A 4ALNA 3ZWAA 1P1KA 3ROQA 2GZ2A 2YV2A 4TRJA 3ADOA 3RJ9A 3H9QA 5GZ3A 1KEVA 4HUJA 3VZSA 2Q22A 3ZGYA 1OI7A 3MJ4A 4M87A 4BL5A 3R1IA 2O23A 5ITVA 4PLZA 1SAYA 3PPIA 3KYCA 3JQGA 3S1LA 3AY7A 3IP3A 2R00C 1DC3A 5T73A 3T7EA 1C1XB 5GMOA 1ZEJA 8LDHA 1QRRA 2BMAA 1LLDA 3JQDA 1P44A 4FOOA 5AXBA 3GNQA 4ZJUA 1GCOA 1R37A 2O3SA 4B3IA 2YW9A 1ISGA 1GV1A 4UUMA 4R51A 1P1RA 1Z7BA 3H6KA 4O6VA 3O9ZA 3JCZA 3I9LA 2RCYA 4MP6A 1E1LA 3DHEA 3SC6A 5JYFA 3SC4A 3SEFA 4FR5A 1HLDA 4MDHA 3QY9A 4NJOA 4YT2A 4CMIB 3GEGA 4KOAA 4S3MA 3QW2A 5DN9A 4KZPA 4WLVA 5CEEA 3MZ0A 5CHEA 1VPDA 3QVTA 2D59A 4DPLA 5I8WA 4GPD1 3RUHA 1N92A 3H7AA 1Q0QA 5B4VA 3AI2A 3GGGA 1YQDA 4FB5A 2CDCA 1ZNQO 5J23A 4ZICA 3UCEA 3PK0A 3OICA 5G4KA 4IMRA 4FGWA 2JAHA 4YB8A 5EN4A 1KVQA 3ZU3A 5A02A 1MX3A 2CVQA 2D4AA 2YDYA 2CMDA 1XCBA 2O2SA 3VKVA 4YAGA 1NWCA 2NVUA 4QXMA 4I5EA 1PR9A 3JQ9C 1A4UA 3WG9A 3HB5X 2EGHA 2I67A 1Z74A 3GDOA 2ILTA 2QRJA 2NU7A 1GY8A 2PK3A 4Y98A 4BGEA 4DUPA 2SCUA 3IKVA 3EMKA 3EW7A 3Q2IA 4AICA 1PZFA 3OECA 1I36A 1LRJA 1PQWA 1YJQA 1ZK1A 3KB6A 4BGVA 1JLLA 1H2BA 4IMPA 2PGDA 3AOGA 1HTBA 5JMPA 2P68A 1I3NA 2Y0EA 2P4HX 5DP2A 1UXHA 3RUAA 3OQBA 1YDEA 3K96A 1B16A 3TFQA 7ADHA 2HJSA 3ZCXA 4TVBA 3VC7A 1KVSA 4QT0A 5IDYA 5F1OA 4XQCA 2Y66A 3PEFA 3R3SA 1CQIA 1FDUA 1SB9A 4MVJA 4K6FA 4OQYA 2XF8A 5HS6A 4QECA 2HK8A 3DTYA 3PHJA 7MDHA 5JPIA 3RU9A 4IDDA 3TFOA 1W6UA 1P3DA 4BO1A 1LDMA 3K8ZA 4D79A 1ZK2A 4MVJP 2C7GA 2TMDA 1PTJA 2WYWA 3ENNA 3DR3A 3RKUA 1Y9AA 1WXDA 4HV4A 1E6WA 5EQFA 3RASA 3RUIA 4BNKA 2O3JA 3DZIA 3VHRA 1YQGA 2EP7A 4A7PA 4ALMA 2NSDA 3OIFA 3INTA 3K73O 1LDGA 5JYDA 2AXQA 5KVQA 3GVCA 1H93A 1V35A 1DDOA 1GEEA 1D3AA 4QUKA 4BMSA 5T57A 3MTGA 3WFJA 1Q7CA 3K2EA 3C7DB 5BSHA 1QYDA 4I5DA 1B8UA 4PZCA 3UH1A 3ANLA 2EV9A 4G81A 4R16A 4CQLA 4E31A 4WLNA 1BGVA 2EF1A 5IXYA 2CF6A 2EKQA 3FNGA 5JAQA 2VYND 3ZWVA 5AXCA 3PFFA 2FSVA 4E2WA 3V2GA 1KC3A 3W1VA 1J0XO 1N9GA 4NK5A 2CUKA 3PIDA 3GQVA 3S2GA 3OSUA 2IYOA 5IG2A 1GQQA 5KOIA 2RHRA 1PJCA 1UXIA 4J1SA 4RLSA 3NYWA 1MC4A 4EUEA 1WDLA 3S8MA 4JP3A 1AHIA 3IJPA 2QX7A 2B69A 4AJLA 1IB6A 4XYGA 2NQTA 3WMXA 4E0BA 2ZCVA 4E5YA 3CMCO 2HRZA 3H2ZA 1LSJA 3GUCA 1JWAB 1PR3A 2CFCA 2HMWA 3UXYA 2GZ1A 1BVUA 4XGNA 3ICCA 3JQAB 3GFBA 3JQ8A 1L7DA 2CDAA 1VKNA 2RH8A 4H3VA 2JKVA 4L0QA 4EEZA 2DPHA 2NUAA 5G0SA 1J6UA 3U4DA 1ENOA 3TNLA 4CLDA 2OGUA 3RVDA 5U4QA 1ZFNA 4AJEA 3PJGA 2NVWA 4MVJE 2AE1A 5IDWA 2EP5A 1A71A 2I65A 2UUPA 4QSMA 3LK7A 4I5FA 4CQMB 1ADGA 1LU9A 3JQ6A 4NBTA 3RC7A 1XIVA 4EDFA 3I9KA 1H6BA 4RQUA 4TROA 4IINA 5EQDA 2CVZA 4BV8A 4BB6A 3MCVA 3BXXA 4YA6A 3KXDA 1AGNA 1CF2O 2V7PA 1XEAA 3EK2A 1Z82A 3NT5A 2ZJ0A 4AJ4A 3RC2A 2VWGA 4TWRA 3O38A 3MJEA 4DIBA 4FOSA 2AQ8A 3TZ6A 3K9QO 4GMFA 4DMMA 3PGJA 2GUGA 4XYMA 4NI5A 3S2IA 3QWIA 4M49A 1Q7BA 2AEMA 5FF9A 4CMHA 2JCYA 5C7IO 2I76A 1DFIA 3VPHA 1MGOA 1Y8RA 4P38A 4DPKA 1B3RA 4YJGB 1I2ZA 4GGPA 2D0IA 4DYVA 2V6GA 4RVSA 3VH1A 3RFTA 2VCYA 2PZMA 4I9HA 3C85A 4CMAA 3KUXA 5HM8A 1OBFO 3N58A 1U3VA 3C1OA 4D3FA 3F1LA 2J3HA 5JCJA 4Z0HO 1ZCJA 2DBQA 1N1EA 1ARZA 2NACA 1K3TA 2Q4EA 1NQAO 4Y8VA 1FDSA 1TI7A 4RJTA 1ZK4A 2DUUA 3RBZA 4J90A 3BTUA 4LMRA 1I2BA 2YQ4A 5TJ9A 2H1SA 5T6BA 3C8MA 2YY7A 4J1NA 4WCFA 1M2WA 2WD7A 2GYYA 3D4OA 5L4NA 1I0ZA 1OC4A 3IKTA 3R3JA 3U5TA 4CV1A 3WOHA 1LLQA 2HK7A 2DTEA 1R66A 4GKBA 3UCXA 3SXPA 3O8QA 4M54A 2W2LD 4DQVA 3DBHB 4GX2A 3KTDA 3H5RA 3I9OA 3TOZA 1E3WB 2LDXA 3WWYA 4RPKA 4BNVA 1QKIA 5DBGA 3JQBA 1GUFA 1PZHA 1BRMA 1H0KA 9LDBA 3QLJA 1X7DA 3DFUA 1KY5A 3RFXA 4RVFA 3ZWXA 5TF4A 3E9NA 4HX5A 3ONEA 1XKQA 3QSGA 5TT1A 3V1UA 5JDCC 1XYGA 2QIOA 1MXHA 1HE3A 1K6JA 4AVYA 1YE3A 3NJ8A 4NHEA 1RYDA 3HZZA 2Q1TA 2R2GA 1YS4A 5EESA 4CM3A 2Q46A 4R69A 4XZ3A 3UF0A 3ZU2A 4TZTA 1IZ0A 2PFGA 2Y93A 4MO2A 4O0LA 5C7LO 2VNSA 4EJ6A 1WDKA 3ONFA 1QV6A 1SZJG 1V9LA 3JQFA 1Y6JA 1R4MA 2GRAA 2BF7A 5HTOA 2J5QA 5CDSA 2C2XA 1ZEMA 3ASVA 4N5LA 2Q1SA 1G1AA 1WLYA 1HL3A 4YRDA 4JROA 1B14A 1KIFA 1U3UA 1ZUD1 1TB4A 3A14A 1SO8A 3C1AA 4WGGA 5ICSA 3PYLA 1YH3A 1T26A 4Q9NA 2YHIB 4OO3A 2ZB8A 2W98A 1JAXA 3GH3A 1W73A 3IAHA 3RQSA 3NGXA 2Q2QA 1KEPA 3RJ5A 3SLGA 1W0CA 3ZV6A 4RVUA 5U1PA 3WQRA 4MVJG 4QO8A 1PL6A 1B7GO 2W8ZA 3PQFA 3WNQA 1M66A 4II2A 1UR5A 1Q0HA 2ZKLA 2J6IA 3HADA 4RF4A 3ROPA 1PWZA 3TPCA 4CUJA 5L9AA 2W90A 3WIDA 3KSZO 4GGOA 1OZAA 4YJFA 3LC1O 5TC4A 2Q2WA 4ID9A 4AJKA 4OSPA 1KBZA 4PLVA 4Y6SA 1DRWA 1A4IA 2BGLA 4NZ9A 1JVSA 1P9LA 1GFSA 3VKUA 4BO5A 2VYVD 4CM4B 1PS0A 1O0SA 1SBYA 3T4EA 2DBRA 5G0UA 1PL7A 2BFAA 1Y81A 4YRAA 3KVOA 4AG3A 4BO3A 3AOEC 3RU7A 3BZUA 2ZTLA 1T1RA 4RVGA 2HMVA 1X1TA 3IS3A 4QQRA 1U4SA 1VSUA 4PLHA 1ZXBA 3P5SA 3CPSA 2AQHA 1GUYA 4ALLA 5KJ1A 2DFDA 1ZK0A 4KMSA 4CR8A 5KJ6A 3ICPA 1K6IA 1ONPA 3OP4A 1LA2A 3LF1A 3H9GA 2CNBA 4BNMA 3HUDA 1IYZA 1CIVA 1FMCA 4J3FA 1BXKA 1BXGA 2BKAA 1CWUA 3KOUA 3OMLA 4FJ2A 1ZJZA 1UDAA 1ISMA 3JTMA 3NTQA 1W8DA 4N54A 4XQGA 4I1IA 4FSHA 2X0NA 2VHZA 5C37A 2VWPA 4W99A 3KYCB 3NDRA 4Z9YA 1XHLA 2ZJ1A 4BNFA 3KETA 4XB1A 1VL8A 2NLOA 4HNHA 1V3UA 3T4XA 1HDOA 4BNJA 3ZWNA 3A28A 4L9RA 4C7KA 4EEXA 5JAZA 3UFXA 4BOYA 3OEYA 4II3A 3ETGA 2AA3A 3NV9A 4HADA 1ZMOA 4J0EA 1G0OA 2HCTA 2W2KA 5B1YA 1U8FO 1UP6A 3AY3A 2YHUA 5DOVA 4CLXA 1ID1A 4QO7A 4LSWA 1P0CA 4R5MA 3PDJA 1DHTA 4LMPA 2UVDA 4JXKA 3WBFA 3DC2A 5JYAA 4RF3A 2BGKA 3WICA 1U4OA 4BNUA 4PZDA 3GVXA 3C24A 3EZYA 3CEAA 2GNAA 4LGVA 4GAEA 3DHYA 4R1UA 1XG5A 5JNLA 3SX2A 1DLJA 2W4QA 4YRBA 5I8ZA 4I08A 3HJAA 3D5QA 3AUAA 4DA9A 3F4BA 4IDFA 1U2DA 4BIIA 1E77A 1YL7A 3AW9A 3PWSA 3RBXA 3H8VA 2OFPA 5G4KB 1W4ZA 2ZK7A 4J2HA 1YL5A 4XJSA 4K6CA 1LX6A 1J49A 4MIOA 3PHHA 1HDGO 2NVUB 1WP4A 1I30A 1FDVA 3QRWA 2VRCD 4D0RA 4LRTB 4AJPA 1UAYA 2C0CA 4BKQA 4XWYA 1X15A 3BMQA 1S6YA 3HN2A 3DO5A 4GWGA 1PZGA 2Z5LA 4D44A 1UZNA 1ULUA 3C7CB 1I24A 4KQXA 4F45A 4GLLA 3LQFA 3KM0A 2DAPA 2JD0A 2RHCA 1WWKA 1OAAA 1BW9A 2PNFA 4OKIA 4AJ2A 2AHRA 4IGFA 3KEQA 5EIOA 3I4CA 1LDNA 4XGKA 4DTIA 2VTDA 4XRGA 2FPPA 3F5QA 5JW6A 2PZKA 4FFRA 5FI5A 1N7HA 2GLXA 1R0LA 1F06A 5JC1A 3DEYX 3UVEA 1Z73A 2NU9A 3O03A 4BQRA 1U2GA 5M6DA 1V3VA 2AEFA 4WPGA 4R54A 2EHDA 1TA4A 1YOVA 4ZD6A 2JFGA 1RM4A 4JBIA 3K30A 3L4BA 4Z9FA 3CXRA 4KQWA 2EG9A 3LC7O 1GQYA 3IMFA 5A9RA 2NQ8A 1YBVA 1M67A 3PGXA 4ND1A 1PJ4A 4TRRA 3F3SA 1HF3A 2QQ5A 4PVCA 1M76A 3K2BA 1JA9A 4O63O 3U09A 2PZLA 1VJ0A 1Z6ZA 3H65A 5ER9A 3GVHA 4ZRNA 4OHUA 3ABIA 4E5NA 2E82A 8ADHA 1OMOA 1U7TA 3FR7A 4HP8A 4O59O 1O8CA 1Y7TA 4AJ1A 1JW9B 4ZQFA 4CLEA 2I9PA 2O4CA 4O1MA 3PVZA 1ZIDA 4RDIA 2Y1OA 4CV3A 1HYHA 4BKOA 4CV2A 2J5RA 1U3WA 3G79A 4I5GA 5TQVA 1LDYA 4CM9A 2EGGA 4J7UA 2G76A 1E1MA 2I6TA 2E37A 2X0IA 3IIEA 2HAEA 4JJIA 2VRBA 4Y6PA 2O3QA 4EITA 4BKUA 3ZWCA 3GFGA 1VLLA 1O5IA 2UUOA 1B3BA 3LSYA 1DHRA 4XGIA 5CPBA 1X7GA 4JCOA 2DUWA 3H5NA 4AJHA 4X54A 3ZV4A 3FPCA 4MVJF 3JQ7A 3NRCA 3GMDA 3GLQA 1AHHA 1FF9A 3JYOA 4L76A 5LDGA 3GN1A 4A27A 3KHUA 3GHHA 3FNFA 3CIFA 3GOHA 4JLWA 4W7IA 1UAGA 2UV8A 4KTTE 4RZIA 1H6DA 3PWZA 1PIWA 3NDIA 4LCEA 2JCXA 4J2OA 4RO0A 1DIBA 4KUEA 1YVEI 2Q49A 3I6IA 4IXWA 2G5CA 3D0OA 4JP2A 5CDTA 1U8XX 4C7JA 3GUYA 1HLPA 3PLNA 1DAOA 4DIOA 1BWSA 1Q1NA 2IYPA 2UAGA 5JXWA 1ULSA 4J4BA 1EK6A 3FF4A 1OFGA 2BD0A 3HB4X 1VSVA 3I6QA 2P9EA 3IP1A 1HWYA 2OOSA 2F00A 2OUIA 3KBOA 3GG9A 1S7CA 1DXYA 3LT1A 1VL6A 5KVSA 3ROMA 1N5DA 1V8BA 2YQ5A 2IZ0A 1WVGA 5A9TA 4ZU3A 3ST7A 3PZBA 2ZQZA 3ZNNA 4Z3KA 1E5QA 3B1KA 3FBTA 4FJ1A 4IZIA 3ETDA 2P5UA 3DMYA 2GGSA 4BO2A 2J5KA 1XELA 4GL4A 3B6ZA 3DTTA 2POQX 2WWRA 4GVXA 4ESOA 2ET6A 1P1JA 3W4JA 3PHGA 2NU8A 1MG5A 4CMCA 4BO4A 1GYPA 2Y05A 2B36A 3KSUA 1TLTA 4GI2A 4IZHA 4BNLA 2QZ9A 1NQOA 1U5CA 2C29D 1F8FA 4IDGA 5L40A 2I3AA 4OXKA 4XR4A 4ZN6A 1BHSA 5A5FA 1DRUA 5CG2A 3NT4A 4MKXA 3G0OA 3D5TA 3OA2A 5DCUA 4RPHA 3KLPX 3WMWA 3I9MA 1MXFA 5TIIA 1KVUA 2QYSA 3DBLA 3O26A 2PD3A 1ZSVA 4WCFB 2EW2A 2LDBA 4QFDA 3ITKA 3RAJA 1LJ8A 3VTFA 1F17A 1GV0A 2IEBA 4NNJA 4FFLA 2J8ZA 3VH4A 4B79A 4YAIA 4UULA 1XQ1A 3H3JA 3BTVA 3GHYA 3BMOA 3JD3A 1EQ2A 4B3JA 4MVJD 4GX1A 2XOXA 5THQA 2Y0CA 2GSDA 4FCCA 5JBIA 2FOIA 1TVEA 3IDSA 1H94A 2EW8A 2X0JA 5IN4A 2B37A 5G0WA 3PHIA 4FC7A 1YBAA 2VHXA 4IPTA 3ZWYA 3GEMA 3SLKA 3WTBA 3S2EA 3U0BA 1R4NB 2HRBA 3CSDA 3PDUA 3BYZA 3DZHA 4CUZA 1B8PA 2DPGA 4W4TA 2PH3A 5ENDA 3W4KA 4YJHA 3GR6A 3CTMA 5C7OO 1LDBA 2C5AA 1BG6A 4PFJA 3ZW9A 2NU6A 1DJNA 4ALJA 4TRNA 4IM7A 2EKPA 2DBZA 1DIAA 3AI1A 4MP3A 1JWBB 2CD9A 1O9BA 2RBEA 2X7HA 3ZZNA 4E12A 4ONEA 3HG7A 1PGJA 1ISIA 1SPXA 4Q3EA 5TS3A 2ZYDA 1KOLA 2NNLD 3IUPA 3F5SA 2DQ4A 1PJQA 4HXYA 3WS7A 1DBVO 1XWFA 4CMKA 1DC5A 2EXXA 3NKLA 4R1TA 2ZTVA 1P45A 2CDBA 1RJWA 2JD1A 3VDQA 3WSWA 3NJ4A 3AWDA 4CMGA 2EKLA 4R01A 3QVXA 4PG6A 2Y1GA 1ADFA 4PG4A 4AJOA 4R4JA 4CMJA 4BNYA 4RDHA 3TZCA 3WGHA 1JVBA 1MLDA 4I9NA 5G0VA 1P1HA 4MKZA 4XDYA 5JAMA 2BI7A 1LQTA 4D7AA 4FW8A 5BSFA 1PJ3A 2GPTA 2YFQA 4WCFC 4E33A 3VZPA 3RC9A 4U5QA 4G2NA 1GD1O 5EL0A 1MFPA 1I3LA 1LUAA 3OH8A 1EFLA 3S55A 4L8VA 2P91A 3BA1A 4XIYA 4UVIA 5ENVA 1LC0A 5CDYA 3H9EO 4BUCA 2A92A 2AG5A 3KLMX 4YAEA 1PGPA 4GVLA 4KUHA 4PLFA 4TKLA 3ON5A 3ZDFA 3JQBC 4CLOB 3JV7A 1ML3A 1D8AA 2DVMA 4LK3A 4B4VA 2F1KA 1AUPA 2VZ0A 4D41A 4NPCA 5L4SA 1HKUA 1IUKA 5C5IA 2IE0A 3EZLA 1N1GA 1WW8A 2Y1DA 3TOXA 2ZYAA 3OIGA 4S1VA 5CPFA 1QYXA 2BHLA 1YGYA 3GZNB 3BMNA 4KWIA 3WBBA 4IS2A 3E5RA 4M86A 3JD4A 2DFVA 1XDWA 3JD0A 3KO8A 3E18A 1T2DA 3PXXA 3SVTA 3DOJA 3B1FA 2EEZA 3JQFC 3WSVA 4XR9A 1N7GA 1QORA 2X9NA 4XQ9A 3JD1A 4B7XA 4E3ZA 4J9UE 4A0SA 4D46A 4DIFA 2ZQYA 4H16A 3KV3O 1GZ3A 2ZB7A 3T7CA 2A94A 2Q3EA 4XD2A 5F1PA 1P33A 4HWKA 3GPDG 3E03A 3G1TA 2O3RA 4IXTA 2G0TA 3NGLA 4Z0TA 4DMLA 4E2XA 3LVFO 1PS9A 4H7PA 1XU7A 1GU7A 2QYTA 1NPDA 3DXFA 4NBWA 5FI3A 1L1FA 5KIAA 4GQAA 2JD2A 3EY4A 1NWHA 4WOKA 1VJTA 3NTOA 1HE5A 4RPGA 3PP8A 1QYWA 3V1TC 4B4UA 1VRWA 2NTVA 4ZQEA 4U0KA 1E3IA 4YTEA 5JCJD 4W9NA 4GLOA 1ONNA 2IDZA 3TZHA 4EYEA 3NEPX 3ZWOA 5ADHA 2WM3A 3ONDA 3PI7A 3UGKA 2WSBA 2O3UA 4LVUA 5I9NA 2P2SA 1YB1A 3ORFA 1HDRA 1P77A 1C1XA 4L75A 4CLRB 3BMCB 1GTMA 3RUCA 3UN1A 2ZTMA 1TXGA 3HN7A 3IOYA 2E6UX 4D43A 4Y6RA 1A72A 1VJ1A 1HXHA 3QWBA 1Z45A 3F47A 1HDYA 3G49A 3OJFA 2JHGA 4ITUA 4Q39A 4AFNA 4B4WA 4CR7A 1VC2A 3PWKA 1BSVA 3AFMA 1WDMA 1LTHR 4CMIA 3HQ4O 3DBVO 3E1KA 3HSKA 1TEHA 2OP0A 2XAAA 5B4TA 3NAQA 1BDMA 4DRYA 4HY3A 1TT5B 1EBUA 2YUTA 3H2SA 4OH1A 3I5MA 3RD5A 4N5MA 2V65A 3Q1LA 3BTOA 1O95A 3DHNA 1SEVA 3D1LA 5KCZA 3AM4A 4YPOA 1HDXA 3DL2A 4LSMA 3P2YA 5BSEA 1L7EA 1T1SA 2X5OA 1U3TA 4YT4A 1Y5MA 2VHVA 4PLGA 1NX6A 2P9GA 4BVAA 4PRLA 1KERA 3L77A 1NR1A 1YXMA 1P1FA 5F5NA 1BW9B 2Z1NA 5IN5A 2ZCUA 1X13A 2C54A 2RAFA 3KSDO 1GEGA 1KS9A 4A03A 3GDFA 4LCJA 2Y99A 3GVIA 2IRWA 3U4IA 4IJKA 4L4XA 4LRSB 4K26A 1M6WA 4JJFA 4U8GA 2HK9A 4QFCA 4P4LA 1K6XA 3I52A 5H81A 4CM5A 1I3KA 2FMUA 1ZO8A 4BO7A 2WEKA 1B26A 1M6HA 5AYVA 2C7VA 2HJRA 4A26A 1KVRA 3RC1A 2HMSA 1D7OA 3CKYA 3LT2A 2VOEA 1EBFA 2HUNA 2PLAA 4QTZA 3VAZA 4AL4A 5DDIP 4TSKA 3I9NA 4FS3A 1NQTA 5CDUA 1K2WA 1E7YA 3LC2O 4R5HA 5A04A 5I7FA 3C3XA 2GF2A 2ZATA 3GF4A 1E3EA 1GYRA 4IDCA 2IODA 2WE7A 4GMGA 4XYEA 1JKFA 3SJ7A 3DBRB 4JGBA 2E49A 3VPGA 3U4HA 2NADA 4YACA 5DZSA 5COAA 2D5AA 4BMNA 3Q9NA 3B20A 1YO6A 4YVFA 4E4YA 3ZV3A 1LEHA 5BSGA 2HKIA 3UW3A 2FSSA 2OBYA 2VHYA 3W6ZA 3MJVA 1ENZA 1DC4A 2H9IA 5AXAA 3WGTA 3VPXA 2DTDA 5BNIA 1AE1A 1ISJA 1E0DA 4L74A 3O4RA 4R1SA 4OQZA 3JQCA 1C0KA 4URFA 1E3SA 3ZH2A 3ZV5A 1GPDG 4R9SA 1DRVA 1IHYA 5HS4A 2JCVA 3E5MA 4PG5A 3I4FA 3HE3A 4MKRA 2Z95A 3OQ6A 3LT4A 1LSSA 4R3WA 4TVOA 1GDHA 4E2ZA 4DREA 3OEWA 2A35A 3AU9A 1P1IA 2A4KA 3TL3A 4WLFA 5FYDA 4PCVA 4MVJI 4GBJA 1UH5A 2X9VA 2BLLA 4OXYA 4XX0A 3KEOA 4N7RA 1ZSNA 4YQYA 3N74A 4BNIA 3Q3CA 4NJMB 1ONOA 4CM8B 1V3TA 1WMAA 4DLLA 5A9SB 3AJRA 5K6AA 4HFNA 5T5QA 5KWEA 3PQEA 3L4BC 4KWHA 4UEJA 5AQ1A 3LLVA 4JK3A 5HRUA 4YT8A 3JD2A 1NHWA 1I32A 4IIVA 1ZJYA 1UDBA 2CY0A 4GX0A 4XRRA 4MPDA 1R0KA 2O3TA 1X14A 3JQGB 4HFMA 1WMBA 2E48A 3E9MA 2OBNA 4CMEA 2IZZA 1VI2A 4CODB 4NG5A 1YWGO 1LI4A 2Y1EA 3LZ6A 1NR7A 4ILKA 4RGBA 5IZCA 1NPTO 3OBBA 2OMEA 4DBZA 1I01A 2GN9A 2C20A 1LLCA 5IZ4A 2FP4A 5A05A 5TX7A 2X22A 3RUEA 4E13A 3D3EA 3K6JA 3KRTA 2GDZA 3QQPA 5TNXA 3OF2A 4CQMA 3EHEA 3W6UA 3BHMA 4B4OA 3FN4A 4QX6A 1V6AA 1DFGA 4OJNA 3ITDA 2C82A 4BGIA 5T64A 1X7HA 1WZEA 2D2IA 3WGOA 3EVNA 4J7XA 4DQUA 4MVJH 3L0DA 4LW8A 3RUDA 1QR6A 3M2PA 3TJRA 2R6JA 4B8WA 1NFRA 1IOLA 3U9LA 1ZZEA 3FI9A 3ETEA 5B12A 4PG8A 1IHXA 1YDWA 2H6EA 3P7MA 2X4GA 1MUUA 3MWDB 4YR9A 2GERA 1EUCA 1I5RA 2GN8A 5A1TA 1HZZA 5T8KA 3V8BA 1JKIA 1GQ2A 3QWHA 3W8FA 4CL8A 4E5PA 1ADBA 2O50A 1E7MA 5DBFA 1YRLA 3DAPA 2Y1FA 2OL4A 1O94A 3PJEA 4NH4A 5U9CA 4YJGA 3OJEA 1RYEA 3DBLB 2AQIA 1IULA 3E6AA 3VVCA 3RBVA 4EZBA 3QVWA 4PLTA 4WNIA 1JDJA 3I3OA 2PD4A 5L3ZA 2XXJA 3BMOB 2VT2A 4DVJA 1E7WA 4MINA 1Y5RA 2Q4BA 4XEHA 1H6CA 4EBFA 1FDWA 5FWNA 3DQPA 1ZW1A 2Y0DA 5I7SA 5GY7A 2BI8A 1ISHA 5CEJA 2IZ1A 4E5KA 2I3GA 1DIHA 3BTSA 3OJOA 3JYQA 3Q2KA 5HBRA 3C1TA 1Y8QA 4B7CA 4PN3A 4BB5A 5KJFA 1DPGA 2IEDA 4ROSA 5LC1A 5KVCA 3U62A 1CRWG 5DOZA 5EINA 4J1TA 3RWBA 4GKVA 3OJ0A 1IE3A 1WZIA 4BNTA 3MJTA 4RF5A 1MFZA 5IAAA 4NIMA 5DT9A 4FFNA 3DBHA 3WXBA 1DIGA 3GG2A 5B37A 3CMMA 2A9FA 4ZQGA 5A3VA 3WIEA 1J5PA 3DOCA 3AY6A 3D3WA 4PG7A 4ZRMA 1J4AA 4FFOA 1E1NA 4DXHA 1NXQA 2DTXA 4XQEA 4CPDA 1CETA 4Q3NA 4WJZA 4KP7A 2E4AA 3VH2A 3LLSA 4B7UA 3TQHA 2Y67A 2UYYA 3LT0A 4G65A 1EVJA 4NDNE 4Z6KA 4KTVE 1NTOA 2V6FA 2DLDA 3DOOA 3M6IA 3V2HA 4CM9D 1U28A 4E2YA 3AU8A 1GCUA 1GZ6A 4NFSA 1U5AA 2B4QA 2FZWA 3VZRA 2VQ3A 3EAGA 2CZCA 5FFFA 1I10A 1OC2A 3AUSA 2GN6A 3GPIA 4WASA 1EDZA 2AE2A 3GNTA 3UAGA 1NP3A 1WAMA 1PU2A 2JHFA 4CQLB 2B35A 3L6DA 4EUHA 5EJ2A 1D4FA 4YXFA 1C3VA 4CL3A 5K0ZA 3GN2A 4CLHA 1N9GB 3B70A 1F14A 2YHIA 3DONA 3OETA 4GSKA 1EE9A 3K92A 2DT5A 1AN9A 2I99A 4DLAA 1RKXA 1HEUA 3HFSA 4QEDA 4J49A 3WNVA 5A03A 4H15A 2NM0A 4P22A 5JSFA 1HSOA 5KNLA 2ZB4A 4TZKA 3CZRA 1K5HA 4TKMA 3BAZA 3EUWA 1NAHA 2FZEA 3WWZA 3OM9A 1NM5A 3F4LA 4L4SA 2CVOA 2XPCA 2G1UA 2PZJA 1Y1PA 4D3DA 1P0FA 5JYEA 3JQ8B 2VHWA 3KYDA 4Y67A 4FIZA 4HKTA 3WLEA 4IDEA 4RPLA 3FWNA 4BKRA 4NBRA 2DBVO 1F8GA 4RLHA 3VTZA 4ALKA 1ENYA 1E7QA 5EMHA 4E21A 4EI2A 4F6CA 5MGBA 3KZVA 2BFMA 1BMDA 3MJSA 3DMTA 1B2LA 5L95A 4JIGA 2EJWA 1XSEA 2O7QA 4MP8A 2PA3A 4NR0A 3ZNOA 4YWJA 3S2FA 4IBOA 4RQTA 3FPLA 4F3YA 2FN7A 1UZMA 1QYVA 3EDMA 4P4NA 1EE2A 1UXGA 5IXSA 4DLBA 4JBHA 2GZ3A 3L07A 5ICMA 4UVHA 3ADPA 3GNSA 1NVMB 3WGGA 3WYEA 2EWMA 1DSSG 5F3RA 3B1JA 4BO6A 3KYBA 2X23A 3TWOA 3E9QA 2YZ7A 2PKQP 4YDRA 1IZ9A 1IY8A 3DZGA 1PGQA 1EVIA 3ZHBA 2PY6A 1DAPA 1BDBA 3IC5A 2WD8A 2HMUA 5CG1A 3L9XA 9LDTA 1R12A 1FJHA 5DULA 5KJCA 1PGNA 1ZKMA 4U0JA 4PLWA 3GMSA 4WLOA 1SOWA 2BGMA 1Y8RB 1GPJA 4FFMA 3K31A 2QRLA 2PD6A 2WJPA 1EK5A 2JFHA 4NU5A 1ZBQA 4A5OA 4XKJA 3PYXA 1U9JA 1E7RA 4BNNA 2Q99A 3UKOA 4JNKA 1LNQA 2DM6A 2ZYGA 1RM3A 1UP7A 2VWQA 2WDZA 3VVBA 4BQPA 5G0TA 3WQQA 1U1IA 2VWHA 3NT2A 3QWAA 2NTJA 1BTOA 1FXSA 4JJGA 1A7AA 3SJUA 4DC1A 3ZW8A 1GR0A 1F12A 5EERA 5BT9A 4EJMA 5BQFA 2H63A 1PS8A 4UVGA 1HT0A 4OSOA 4C4OA 3JQEA 1MB4A 4DYDA 4DPMA 2X9GA 2FPIA 3R0IA 4J1QA 2UDPA 4PRKA 2WD7B 1ZXLA 5K9ZA 1H9AA 1UXJA 3U49A 3FTPA 4RVHA 3PQDA 4PLPA 2PH5A 2YV3A 4NBVA 2EJVA 2NVBA 4YBZA 1EEHA 3MWEB 3O8QB 3WX0A 2J3IA 3ZI0A 2HU2A 3M2TA 3W8DA 1E3LA 1PJSA 2AW5A 4WEOA 2QG4A 1XLTA 4MIYA 3SBOA 1HE2A 1AXGA 2AG8A 3K5PA 4ZVVA 3ZNPA 3IJRA 1ZH8A 3G17A 2VUTA 1E92A 4BGUA 4E5MA 1WNTA 5KKAA 3GRPA 4U6QA 3GAFA 1UP4A 4DC0A 1H2HA 5JDIA 4M8SA 4B8ZA 3E82A 3HNPA 1N2SA 4RPJA 5JCXA 2B83A 4UUOA 1FDTA 2WYUA 4TMFA 5L45A 4ZHSA 1MA0A 1DFHA 1SB8A 2PTGA 2AQKA 4W9NC 2PKRA 1EMDA 1UUFA 5LCXA 4YYZA 4IQ0A 1R4MB 2OO5A 1HDZA 4IIUA 2OZPA 5TJHA 5EPOA 2NV6A 3RUFA 1SOVA 2D8AA 1G0NA 2BELA 2B4TO 4IDAA 1K0UA 3L6EA 2OXIA 3NTRA 5JO0A 4OOFA 4FD3A 4RF2A 3ZWWA 4ALIA 4CM6A 1PWXA 4YT5A 5KTKA 3LF2A 4HFJA 1QLJA 5GZ6A 2HSDA 3ROKA 3ULKA 2D1YA 4L73A 2ZIZA 1SC6A 3BHIA 4PLYA 3BIOA 2EERA 1LXCA 1EZ4A 2X6TA 2CSUA 2VN8A 4M1QA 1HRDA 4XA8A 1Z7EA 3V5NA 1BVRA 3TZQA 4ZQHA 4CJXA 1DO8A 1PX0A 4ND5A 2IXAA 1KYQA 1TT7A 2Z1MA 4IY1A 4R68A 4YJFB 1R16A 2R00A 1G6KA 5ILGA 1F0YA 3HWRA 1XA0A 2HO5A 3F46A 1KC1A 1SEPA 2X8LA 4JQCA 3OIDA 5BNFA 3DZKA 3ZU4A 3TRIA 3QIVA 4WCDA 1C14A 1YKFA 2D3TA 3RCBA 1KEUA 4KUGA 1LC3A 1LRKA 3EGOA 4ND3A 3H5AA 3GC6A 2GASA 3DZJA 2P9CA 2O48X 1LRLA 4FQ8A 3TSCA 1E1KA 1MC5A 3QE3A 4BNWA 4XYLA 2O2YA 1EFKA 4UEKA 1SNYA 2DC1A 1U7HA 1C1DA 5L7WA 4AJIA 4UUNA 4UUPA 1P74A 1GADO 3WR5A 4MOWA 4LVCA 2VYNA 4R9RA 1BXGB 2AMFA 4FN4A 3RROA 1PQUA 4OGWA 5TSDA 3DDNA 5COQA 3INRA 3N7UA 4TQGA 1N8KA 4WLEA 5DF1A 3RSHA 5IFLA 2QW8A 5AVOA 1H9BA 3PTZA 5G2OA 4XB2A 3G1UA 2WYVA 4JX8A 3JQ9A 1PQPA 4Q3BA 4B3HA 3WTCA 5I7EA 3X2FA 2BFPA 1T25A 1LSUA 3Q6IA 3MTJA 4AJNA 5CP8A 4J0FA 4G5HA 5DP1A 1LLUA 1BXZA 5H82A 3UOGA 1O6ZA 3QV1A 1EVZA 1P31A 3U3XA 4NFYA 5I9MA 1DB3A 3A1NA 2B4RO 4J7CA 2W2KB 4Q3AA 4E30A 1E3JA 1UZLA 2X0RA 2PWZA 2QZZA 3I83A 4J4TA 3WGZA 3A9WA 1XU9A 2BRUA 4TRMA 2X86A 5H83A 3ZWPA 2X58A 1XR3A 5FEUA 3TL2A 3EYWA 3ZHZA 3QHAA 3FSRA 4M89A 1CDOA 3WGYA 4IJVA 4ND4A 2O7SA 3A4VA 5TGDA 4GWKA 5AXDA 1R15A 4ZGWA 1T4BA 2J3KA 1PJBA 3ZHXA 4DL9A 2GCGA 4UVEA 4BMVA 2AEJA 5DCWA 5ILOA 4Q3DA 3ANMA 1HYGA 1HE4A 2I66A 3OA0A 1QXSA 1C0IA 4WUVA 3GGPA 1IPFA 3QJ5A 1JTVA 4OM8A 4BO8A 3WB9A 1QP8A 4GX5A 2ZTUA 1T24A 1T2CA 1UXKA 1X1EA 2GN4A 4BNHA 1XGKA 1EVYA 3UICA 4MIEA 1NFFA 2PR2A 5F1KA 5JS6A 3I1JA 3OFSA 1KY4A 2V6BA 3CINA 3BMQB 4IJWA 1A7KA 1JN0A 1YJ8A 5CEFA 4NFHA 5K6AC 1ENPA 5CDGA 3STHA 1SMKA 3I9JA 5JY6A 3H3FA 3LU1A 1T4DA 1Y9EA 2VTEA 4I8XA 3ZWBA 1RWBA 1Y8QB 3GGOA 5JO9A 5F5LA 3GAZA 3NDJA 1MG0A 3PFWO 4FC6A 4GSLA 4CUKA 5LDHA 4BV9A 2DU8A 4NMHA 1E6EA 4CMEC 3H9UA 1AXEA 3TN7A 3ZNQA 1A9ZA 1KEWA 2PGLA 4EW6A 4YCAA 5A06A 5IZCC 1E5LA 4RL6A 3F6YA 3PLRA 1YL6A 4MJLA 1PJTA 1JAYA 3INGA 2B5WA 4IGEA 5MDHA 4Y9DA 3E8XA 4OKNA 4PLCA 4YAKA 3H9JA 1NASA 3D3WB 4Z3DA 3DFZA 4RORA 2Y68A 1VE9A 1HZJA 1YOVB 5J9GA 3PYMA 2YV1A 2PGJA 4NBUA 2D5CA 2GD1O 2OP1A 1R4NA 4XYBA 3VDRA 3JYLA 2VT3A 1D1SA 2W2LA 3HDQA 2FWMX 4HBGA 4ZQBA 3VH3A 3X2EA 3ZWMA 5ITWA 1NAIA 3G3EA 3F9IA 1YB5A 4INAA 3BHJA 4M55A 1VM6A 4BO9A 4BNGA 4A73A 3QP9A 3UHAA 5IJZA 1ORRA 2YYYA
chains in the Genus database with same CATH superfamily
5IT9A 3CF6R 2WJ4A 1DBRA 4N5NA 4UREA 5LJLA 4PHTA 1GARA 5JLAA 4WOJA 4RPCA 3VX3A 4IDBA 3CONA 3R24A 1UADA 2C59A 4DB4A 1MRZA 4FYWA 1TZCA 5FBHA 1J8YF 3SBEA 1QGZA 1P4RA 5AHRA 3F1KA 4EECA 2V45A 2ZRKA 4UHEA 4Z0PA 3RSFA 5BR4A 1TGYA 5AKYA 2VDRB 1JPUA 4BPBA 4L5CA 3LXXA 3P9SA 1XZBA 4FLEA 4D4IA 4Z7OB 1LQUA 1C0LA 4MARA 3M81A 1I1OA 4A10A 1IY1A 1P9OA 3A04A 4GC5A 3M6WA 2I80A 4D8XA 2ZLBA 1OU4A 1A9YA 4Y2VA 3ZWQA 3C7AA 1QTQA 1LPBB 2XKKA 1TJ5A 3QFHA 1DAIA 3AUUA 3PJFA 1V1JA 1SR8A 1ZKDA 3R5TA 3GAAA 4EPTA 1XMQB 3PRJA 1DJLA 1E2IA 2P3LA 2IHNA 3U44B 2JEOA 5TQ0B 4CCYB 1C7IA 2FEWB 1OKKD 1KI1A 3ZGXA 2XTJA 4ZI5A 1R6BX 2M1ZA 3RIHA 1M2HA 1QKJA 4R1NA 2JLUA 1DC6A 2H65A 1E0AA 1XALA 2ZJYA 3HZRA 1LD3A 4EB6B 3BWBA 3FTNA 2AC7A 2B4AA 4IGKA 3W4IA 2R96A 4H0NA 2WUVA 1IK6A 1TM2A 1P0IA 1JDPA 2AKAB 3BBLA 4OQMA 5GM1A 4XJTA 2OYCA 4ENUA 1TK2A 4UHHA 5KNDA 4CMBA 1AUVA 2OLKA 3PKZA 5A4AA 2JLVA 1YULA 3DZ5B 1XN4A 4ZVLA 4PYOA 2EATA 1H22A 3G23A 3N2ZB 4MWDA 1NHGA 2PV7A 1E2EA 3LJKA 5E3JA 1E20A 3U7JA 3UJAA 1LY1A 1M72A 3HI4A 2AN5A 3DTVA 4MPTA 3A1EA 1E7SA 5EP4A 4D6XA 2C3YA 5AJXA 1J2RA 2CE7A 2RSLA 3V1YA 5BPHA 3DS8A 2QT0A 1U28C 2ZR0A 1XROA 3PE4A 1ZJJA 2GO1A 1E2KA 1JZQA 2EYUA 1IEVA 4PONA 5KJEA 3FDZA 6REQA 2XXBA 3LCJA 2IS4A 3TCXB 4DXAA 3H4VA 1G60A 3IEMA 5AJYA 3DOIA 5KSZA 2R4UA 3TW3A 3D4NA 3PZRA 2Q45A 3TDKA 2AIRA 5I7UA 4LQ4A 1YACA 3OE5A 3VDMA 5LYJF 2V7XA 3LDHA 3TAHA 5HWSA 4NOJA 2FPOA 4JN6B 3EULA 3QX7A 3T99A 1K6MA 1RCTE 1ZGBA 1HQYE 4FDAA 4UEOA 3WLFA 4ZI7A 1JEEA 1Y5NA 4KDFA 3WLJA 4JLOA 4NSNA 4WFKA 4PYMA 1CIJA 2EFEB 4IQ8A 3D6FA 4NAHA 2GWRA 4ZU6X 1RM5A 4AZ3B 2NIPA 1QH9A 4D9BA 3LYLA 3HFGA 1Z4MA 2P30A 3ANNA 5BOSA 2B5VA 4LGCA 4DQXA 4YMLA 1O94D 2NU8B 4KIFA 2XQIA 4C0JA 3OPVA 2NO0A 1N8TA 4YJ3B 1L5HA 3T9DA 1PWHA 3TX2A 5KBYA 1RXVA 4B87A 5FTLA 4E6PA 5DBIA 1HETA 2R60A 3E22A 1KA9H 1SOMA 2FW7A 4ZXFA 1I2CA 3DBOB 5DNYB 3ZZ1A 1T2EA 2JAWA 2DYKA 2JDIA 3E9DA 2X1HA 3F2VA 2QN8A 1PR0A 2H4XA 5DM4A 1ECJA 1GFIA 4MCAA 4UAGA 1YR7A 2HSJA 4X9XA 5IAEA 4Y1RB 2XMPA 4OOEA 4U7WA 1Z5ZA 4WK6A 5TDHA 1TMGE 2PRSA 2QPAA 1UM8A 2ZSUA 3A25A 2O8DB 4UOEA 5AJTA 4PFSA 3WLIA 4Q21A 3M1LA 4WY8A 4I4IA 4D9GA 2Q8QA 4XIJA 4XWWA 2Q6IA 2P5YA 4EG7A 3DMTC 2R8YA 3V4SA 3QVUA 3N2KB 3EEQA 5BYBA 4EVSA 1DEHA 5JY1A 3NBYC 3EN0A 3GK3A 4IKEA 1M75A 1QZUA 1DOHA 4K9RA 3DAGA 1ZOLA 4IIJB 4HXFB 4K1LA 1EFRD 3I2YX 4QNMA 1WL8A 3THSA 1CLUA 1MAVA 1ZMTA 2XUIA 3I0NA 3UEOA 1I9GA 3L6OO 4RENA 1R6UA 3IA2A 3MOIA 2V6MA 4RJJA 3MC1A 4EVQA 2SNIE 1HOXA 1EM8A 3ETNA 4WAUA 2J9FA 2QTWB 3ROTA 5CAEA 1TT5A 1XMOB 4OL9A 3DQZA 2GK7A 4JASB 3SPXA 1U9IC 4MV3A 1A9XB 2PZBA 2Z5VA 3HYSA 1IVNA 3DWFA 3BN3A 3MIIA 3EJWA 4JOSA 3F6SA 3IQGX 1VE5A 4CFYA 2A1TS 1XEXA 3OUZA 5EJ9A 1Y98A 3CUKA 3K0CA 3LXUX 1QP7A 4CM7A 4DJFC 5GIPE 3FPAA 3WGLA 2QSZA 1U04A 4N1AA 4E22A 1BHO1 3IQFA 3T5BA 2AI1A 4OMUA 3BGWA 1BWQA 1UMBB 1QIJA 3NH9A 4HTAA 2GBLC 3OHSX 3FHLA 4J9VA 2BAGA 4MB0A 5JASA 1AGPA 4BY9E 3QVSA 3EGWA 5JE8A 2VRCA 4JLVA 4FGUA 5EE9A 6AT1A 1L5OA 4C05A 2X4DA 1G8AA 4QREA 3QF4A 1CYDA 1NLFA 2G1JA 3Q3VA 1KNQA 5ECYA 2JZOA 3ND5A 5HKKD 1RTTA 1K9VF 1J09A 5ER6A 2JBWA 3VISA 4W7HA 4E94A 2GJSA 4PQYA 3QM1A 4IUYA 4LYDA 4RCZA 4JYZA 3MAAC 4H7JA 1QIDA 1WPGA 3AEKB 3AVOA 1MKYA 4RMGA 2HW8A 1Y6GA 3DAFA 4FBMA 2J1LA 2O1SA 4MLCA 3HLTA 3PHLA 3SNHA 5JTTA 1P19A 2J45A 4WKCA 1LK0A 4RSGA 2X14A 3AP2A 1GCIA 1WABA 3SF8A 2PPVA 4A0QA 2ZRGA 4JT4A 5IHXA 3E3LA 5HK8A 1SCUA 2GEDA 3HVRA 3DL7A 3O4FA 4LISA 1T3HA 1EHIA 3CF4A 3UYKA 2ZGVA 2HA2A 2ZB3A 3E15A 3NIBA 5ES3A 2C3OA 3LXMA 5DNAA 2G25A 3DLHA 3OCVA 3U4CA 2JLRA 1BFKA 3WGQA 3LY5A 4LE0A 5KSYA 1V7ZA 2VEOA 4JAVC 1HTTA 5J2UB 3FBGA 3PIIA 5T41A 2M6KA 3JYPA 5IDQA 2I2WA 2QX4A 4ND2A 4CR6A 1NGSA 5DNEA 5T67A 5ALDA 2GR9A 2YWXA 2P2LA 3N5KA 4MRSA 2BOVA 4OVKA 4BTVA 3GJ7A 3DF7A 3ZHVA 2G17A 1M6YA 2C4HA 4WACA 3FHCB 4WSOA 1HM5A 1KMHB 4RV9A 1KPGA 4ZT3A 3TTTA 4HJXA 1PGOA 4BE7B 1RYNA 5AICA 5JWRA 1IUNA 3IUSA 4ZA2A 3NUZA 1HL7A 4DR2B 1BNCA 3JR7A 2OV2A 4H6WA 4K28A 1KDOA 3DZFA 3FPKA 3VR3A 2J3MA 1SVIA 4FGKA 4L16A 2J4CA 2NZXA 1V8OA 4NQZA 3X1MA 1ZGZA 1ZXXA 2HQ1A 1G8GA 1KI3A 1PSDA 1DIRA 1E9SA 3BMNB 3DKIA 3E7PA 3VTAA 4YRTA 4CKWA 1RP1A 3L4EA 1EUDA 4B3MB 2O9JA 1RJDA 3TPZA 1PJLA 3U3ZA 4BRUA 3BWYA 3FE2A 3T5AA 4LCBA 4TS4A 4M0KA 3EVTA 4N39A 1V7PC 4F85A 3KCNA 4OIFA 1E3MA 2PFKA 3PVSA 3A9SA 4G23A 5ERGB 1P7ZA 1RRMA 4OAQA 1NLMA 4S1TA 3C87A 2XT9A 2BUCA 2RGCA 1WV0A 2FVXA 3HLKA 3TNDA 2R751 4XAQA 2J33A 4OYRA 1VGVA 2YJNA 4KO4S 1SQ6A 4CV0A 3SBDA 2WTBA 3ACCA 2RH4A 3A9RA 3BD9A 1A98A 3EXHA 4U8HA 1G3UA 1WCXA 3FY4A 1HK7A 2PNJA 4ZCIA 3UJHA 2EU8A 5C7YA 2HA5A 4RSRA 3ROQA 2GZ2A 1J8DA 5TPZD 4EJSC 1E32A 2IV7A 3ADOA 1U9YA 4FQ5A 3L7KA 1U2EA 4QODA 2XMRA 3EPBB 3L8CA 3VZSA 2Q9AA 2TECE 2Q22A 1G9XA 5EYPB 3WL4A 5H70A 5JJ5A 4BL5A 4MYDA 3R1IA 2TYSB 1TAUA 1XE3A 1PUJA 2QX9A 1KARA 2HA4A 5B1HA 3X1KA 5K8IA 3N5CA 1TYBE 1QHFA 3S1LA 2R00C 1DC3A 4YMHA 1M2KA 3T7EA 3H86A 4A16A 5LPNA 1ZEJA 4P7KA 2O7VA 2PX0A 1LLDA 3A26A 3HKDB 3NP9A 2EL9A 1M9NA 3EIHA 3QMMA 1A8SA 4HPJB 2OAGA 1U0GA 5BW8A 5C32A 1GCOA 5FTMA 5LFAA 1YBFA 1Z17A 2O3SA 1ISGA 2YW9A 3CNBA 4R51A 3IEPA 4JUBA 1P1RA 4NV0A 4WJKB 2B8NA 4TN1A 2H1HA 2HBYA 3D6TB 3JCZA 3K0HA 4LF9B 3D2AA 4MJ7A 2W93A 1BS9A 2Q2NA 4YAFA 1OPRA 4F06A 4M0CA 4J7AA 4TMTA 3DHEA 2B3TA 3CO5A 3V4VB 2ODPA 2W22A 4C5AA 1CS0B 2P4EA 1FUIA 3SEQA 3ZDAA 1GZ7A 1FFEA 2YY5A 3FJOA 4HDSA 1JKMA 4KMMA 4WFIA 3MZ0A 4LDZA 5ARBA 3F4KA 3QVTA 1U80A 5KDDA 2OZVA 4KR6A 1R8QA 3OCJA 1SBCA 3P9PA 4TWIA 4OUDB 4DPLA 3ADKA 4GPD1 2VO1A 4JBXA 3RUHA 1LZLA 3WWOA 2O54A 3EZNA 1VFPA 5KKNB 3IYLW 2WWVD 3TSYA 2P1RA 1VJDA 3L18A 4DV0B 3W2HA 3L6UA 4CQJA 1FP6A 3I1FA 2GAFA 3IPLA 3ZJYA 2CNWA 4FYJA 5HBGA 4M1WA 5EN4A 2AL7A 1KVQA 2PX3A 3V8QA 4LY9A 2D4AA 3AEUA 4GZLA 3ZD9A 3MOSA 1XVVA 3A3KA 4DR1B 3GCWA 4ROTA 1A8IA 4YAGA 1KFEB 4G84A 4QXMA 4I5EA 1JDSA 1FFAA 1PR9A 1U1EA 2JI9A 1A4UA 5DI9A 2WHRA 1HFWA 3WG9A 5KDOA 1BHJA 2CXQA 2VJQA 4JP1A 4M8IA 4WTOA 1Z74A 2ILTA 4Y98A 1AM4D 3MK31 5E1MA 4DUPA 2SCUA 1PN3A 3EMKA 1HORA 4R2WA 4AICA 3EX7C 3PGA1 4K3UA 3UENA 3A32A 3KB6A 2JGIA 1H2BA 4QEZA 3DV0A 1HTBA 2QDXA 3FZQA 1USIA 2P68A 1EP2B 2Y0EA 2P4HX 1QB8A 4MV8A 4U2DA 2VDUE 3QLVA 2HLDD 5DP2A 5CA0A 4D02A 2J6CA 2HRCA 3TFQA 2BGTA 7ADHA 2HJSA 1H2EA 3LDFA 5EPUA 4GOMD 3UMBA 1E2NA 3EDRA 1RW4A 3I30X 1AT1A 1KVSA 4S1NA 3MS7A 1UQTA 1UIRA 2A5JA 2I29A 1Q16A 4TN5A 2CT8A 1FDUA 3NQ41 1SB9A 1E2QA 3ZLVA 1TOAA 3OFND 4K6FA 4JLBA 2OUKA 4QXAA 3BF8A 3T7KA 1R3UA 1ZLYA 2O8BB 2HK8A 3DTYA 2D7JA 2QSJA 3MVEA 1OA1A 4PCAA 7MDHA 4JLNA 3QTTA 4WBSA 3IR5A 3H0VB 4RACA 2V5AA 3MTEA 1ZZGA 2I4RA 4D79A 5JS8A 4X24A 1U0FA 1ZK2A 3CA8A 2W2QA 3PNSA 4R2IA 4YS6A 2H52A 1C4XA 3BJMA 3ZVRA 1JQKA 4EWLA 1K5GA 3IEXA 4V0KA 5J9FA 2OV1A 3LLUA 5FX2A 3AONB 5JYCA 5ARCA 3WIOA 3DR3A 3RKUA 3H5TA 1WSWA 5CCEA 5DTJA 1YA8A 1YR3A 3GBSA 3IKMB 4DCJA 2ZUTA 4ER0A 3SE0A 5K05A 2RGNA 3DEAA 2YNMC 3RASA 3RUIA 2LGJA 2IYSA 2O3JA 4WA8A 1F6BA 4M83A 3DZIA 3G5TA 2JIMA 3LFUA 4QLBA 2NSDA 1OJ7A 2FPKA 3FYHA 1Z68A 3INTA 3ITEA 3OSZA 3OT1B 5CVCA 3U3MA 4DYHA 3LQQA 1LDGA 1G5HA 2AXQA 2BGJA 5JYDA 2ISSD 1U2RA 4DZTA 1XJCA 4NZPA 2RHJA 1T10A 4YP0A 5AKLA 1WKCA 5T57A 3WFJA 3WP0A 1E9EA 3TNFA 5BSHA 4G9GA 4NL4H 1WM1A 2OENG 4X61A 1B8UA 1GKLA 3ANLA 4UAUA 5FO0A 4R16A 1KK3A 4CQLA 4JVOA 5A6SA 5IXYA 3FWHA 3SEZA 2EKQA 5CA1F 1QTNA 3RS4A 3FNGA 4MI6A 2VYND 3U7RA 3ZWVA 1BDHA 2CK3D 3PFFA 4KNWA 4E2WA 3G2HA 3PUYA 3FSGA 1JHZA 1KC3A 4NESA 4Q4CA 4H7KA 3ZY2A 3LOUA 4KO1S 5C52B 1N9GA 4X62B 3ID6C 1U81A 2WWTA 3SQXA 2CUKA 2CBXA 2Y9MB 4LXQA 5AW3A 1GQQA 2I78A 3IX7A 5KOIA 5YASA 5HDBB 1P6QA 1Z8FA 1AD2A 3M6FA 3OIWA 4HZGA 3R7DA 1WDLA 3CF4G 3D8SA 4XX0B 1GQOA 1N9KA 1AHIA 3IJPA 1N2EA 2FF7A 2ZTHA 3OTGA 1LBIA 4LNHA 4UPVA 4QBIA 4AJLA 5ISMA 1UDXA 3TW6A 1ECBA 1R9GA 4RSHA 3H2ZA 3FTFA 5BW4A 1I2DA 3NCHA 1FSFA 4OJYA 1FSSA 2HMWA 1BVUA 4ZFNA 2ANBA 4XGNA 2Y2UA 5M29A 1L7DA 2CDAA 4M9XA 4PAQA 5M2QA 6NULA 2RH8A 1H2FA 3W9BA 1RABA 4Y2QA 1FNCA 2DPHA 2IZ6A 3AW8A 3D8TA 3FDZB 4EEZA 1W5AA 4CLQA 3B1YA 4NOMA 3S8EA 4JFAA 1N1MA 1XHEA 2WJWA 1JAZA 4B4UA 3NIWA 1TM3E 4Q1BA 5H8WA 4Y9TA 4DS3A 3VVLA 2W6JD 2X5XA 1NBMA 3K1AA 2P62A 4MVJE 3FLEA 1EUYA 1KE2A 2R7MA 1EWTA 3IT0A 1KSJA 2AYZA 2IHTA 2FP4B 5HQ3B 1NJ1A 1J8FA 2ZR7A 4KWEA 5LZ7A 4B6GA 1QFXA 1OYVA 4NBTA 3UAXA 4ZI7B 2OQ2A 4RTRA 3P9CA 4RQUA 2GEJA 4FEEA 1RFLA 3H2BA 4K3VA 4F2WA 4KJZA 3QU4A 4KBFA 1AK1A 1OXVA 1GFZA 4BV8A 1VE3A 5AK4A 3KJQA 2I1LA 4UD2A 1Z82A 2V7BA 3NT5A 2ZJ0A 3C3DA 4FDTA 1W25A 4KXUA 4R2LA 3T95A 3VBCA 4A9AA 3ZIAA 5CFOA 2XB4A 5ED4A 2GM3A 5U4XA 5JZMA 2PSSA 3MJEA 4DIBA 2Q3DA 1HMPA 2VJPA 2AQ8A 2ZVDA 3CNLA 4EG6A 4DMMA 1ODKA 4EKIA 2GUGA 3QVGB 2CDNA 1RRVA 3CRNA 3QVMA 4HEA6 4V03A 1CHNA 3E22B 2ZAYA 3LXRA 4YHHB 2XSZD 3GX1A 2QG6A 1Q7BA 2ATCA 3OURA 2CFTA 5FF9A 5FV7A 3UJCA 5KOYA 2ZIAA 2JCYA 1SBIA 3H3XA 5C7IO 3E3AA 4HPWA 4PC2A 1DTWB 1Y8RA 1T2NA 3ED1A 4U39A 3VYVA 3CR8A 5AHWA 1I2ZA 1SVKA 2D0IA 2Q5FA 2WQZA 5TPWB 4KC0A 5TXGA 3E9ZA 4RDCA 5HM8A 3C85A 5E8JA 2VDWA 2XUHA 3OUUA 1SU4A 2HNKA 1K27A 4BDTA 4C4AA 1PHPA 2Z8YA 3N07A 5KO2A 1SHTX 4BVFA 5HTKA 3F1LA 9GPBA 1YR9A 4Z0HO 1N1EA 1ARZA 1J20A 3PWTA 1J7JA 4O2LA 4BBJA 1K3TA 4K9LA 4Y8VA 4D92A 2RGEA 3O74A 3ZQUA 5JZVA 1GRQA 1ZK4A 4G5GA 3A27A 4P81A 5AM3A 4BNDB 4LAFA 2AKEA 3RTBA 2JGKA 1OA0A 1USKA 4E1BA 4L6IA 3DEKA 1JZSA 4UBOA 1EM8B 3KQTA 3CLKA 4OQ4A 3QX3A 3R3HA 3C43A 2GYYA 3D4OA 5L4NA 8GPBA 1TJPB 1V2HE 1W7AA 3EA5A 4CV1A 1N6NA 1OIWA 2GM5A 3M4JA 4IO0A 4NYMR 4XFJA 4RL4A 3ZCSA 4QUHA 5T4EA 1WNFA 3T5DA 3UCXA 3MWEA 2D13A 3K9GA 2H4HA 5DBHX 1KDZA 2XDWA 1E94E 3H5RA 3IIIA 1IY2A 3WWYA 1J0EA 2R5NA 2D6FA 4RPKA 1TDJA 2GD6A 2W48A 4BNVA 4OYYA 4BQNA 1QKIA 1Y3HA 4Y6LA 5DBGA 3Q7RA 3ZWAA 1S8FA 3QLJA 1CEXA 5EKXA 2A5GA 3W5BA 3EPRA 2H06A 4HX5A 3F5MA 4MS1B 4XDGA 4YWHA 3S1AA 4U9HS 3AF2A 2VPTA 2JIOA 1IN4A 1KFCB 1XYGA 3AFGA 3WWCA 1MXHA 1BXRA 4KQ2A 1O97D 4EKDA 5HNKA 1R27A 2V96A 1VSBA 1RYDA 1SVMA 3FOFC 3MINB 2DKFA 2R4TA 4GI1A 2Q7XA 5HQJA 1YS4A 3LPLA 3AF3A 2Q46A 4UMEA 4FSXA 5C7LO 3JR3A 2Q5QA 2ECOA 3EOAI 3V42A 3HYNA 1SZJG 1M34A 2C3MA 4JJZA 1ZM2A 3VR5H 3L0CA 3BJRA 1GM5A 3VNRA 5CDSA 3QEBZ 1H8HD 3V8MA 3KQNA 2C2XA 3NYIA 3WK8A 1ULTA 2I22A 4ZOAA 5AOAA 5LYYA 4N5LA 5BYKA 2Q1SA 4OU5A 4RKWA 4HYTA 121PA 2WPDD 1Z15A 4GE3A 4JROA 2JH9A 1U3UA 2VPXA 3R3YA 5B7NA 1VQ1A 1TB4A 3A14A 4MR8B 3LVBA 3C1AA 3N3BC 1QQ5A 1YH3A 2LRHA 3YASA 3NGMA 2I03A 2ZB8A 3V2IA 2P67A 2W98A 2CN1A 4UTNA 3K0SA 2FK7A 1XVTA 5HUJA 3AFHA 4HDKA 3RTAA 1KU6A 1NURA 2C5HA 2Q2QA 4U2GA 1OT5A 1QFJA 1TU4A 3RJ5A 1I4WA 1ZVKA 3MMXA 1Q7TA 5SZIA 5U1PA 3SVLA 1B1CA 2R8OA 2IPXA 1YDGA 2K7FA 1B7GO 2W8ZA 1Z7YA 3PQFA 3QUQA 4F91B 5G3YA 3UT5A 4CUJA 1UJBA 1WG8A 2CMFA 2J6IA 2QTLA 3HADA 1PWZA 4RF4A 5CM9C 1Y7HA 1EGMB 1XKLA 3Q8WA 4AJ9A 2BUBA 1TCVA 1GKIA 4YJFA 3KT0A 1JEJA 1UC9A 2K6GA 4KMOA 3F3MA 4I55B 3T61A 3WBJA 2IY8A 3VU9A 2BW0A 4ZEXA 1KBZA 3QE9Y 4ARZA 3SEAA 4R1PA 5HILA 1A4IA 2EG5A 2WJGA 2GZSA 2I4TA 1P9LA 2AOXA 5SZKB 4AROA 3MAJA 5TMEA 4CKWB 3ESAA 1EUDB 1XDSA 2VYVD 3C7KA 3OTQA 3RYIB 3NTUA 1O0SA 1G8MA 1LNSA 2ADMA 1XRSB 2QZJA 3SYKA 1IRIA 3T4EA 2VBCA 5HFJA 3T1TA 1BQ3A 4QPDA 5FOTA 3VV3A 2ZR9A 3T4UA 4AG3A 4EW1A 3CGWA 3QW4B 3RU7A 3BZUA 4J6EA 4RVGA 3LYHA 4IYJA 1X1TA 1YZTA 5DASA 1C7QA 3IS3A 1CUHA 3KOOA 3OEHD 5E4JA 3OTOB 4PLHA 4HEA1 1ZXBA 3CPSA 3JVEA 2AQHA 1SIWA 5EIFA 4Q00A 2YYAA 3V1MA 5HCNA 5KJ1A 3B3GA 1FFCA 3EXHB 4KMSA 3FWYA 2CYBA 3ICPA 1K6IA 2GA8A 1S8OA 3H9GA 4HTFB 3HYTA 2PU5A 2W6OA 3HUDA 1CIVA 1Z3IX 4EEKA 4ZCRA 1V4VA 3HACA 2F9MA 1PWYE 2H54A 3KOUA 1GA1A 3KWLA 5EIXA 1ZJZA 2QKYA 3B2EA 1ISMA 3JRWA 1W8DA 4JP8A 4XQGA 4IIYA 4M3NA 4FSHA 4X7PA 1ATZA 4N01A 1F48A 2Q5OA 3AO0B 4Q6BA 4QBGB 4I1YA 4Z99A 5F64A 4Z2YA 2VWPA 5JECA 1B0ZA 1JBKA 4P33A 1ZPDA 1YAJA 2H48A 2YMLA 4EJFA 1J0DA 4XB1A 4HB0A 4WK2B 2FFJA 2GPNA 4HNHA 4XD7D 5IKEA 4UHBA 1HDOA 5H3LA 2NMVA 5JI3E 3KFVA 3SNKA 3BGVA 3CFYA 2IIBA 4DCUA 3A28A 1USWA 1AV6A 1OAOC 2CNNA 1NVVQ 5KYWA 3ANTA 5JAZA 3UFXA 2QUJA 4II3A 3KJHA 1SU7A 2PXXA 4IV0A 4BVGA 1G8JA 4P3PA 1ZMOA 1JI3A 3QQ5A 4TXLA 5BXYA 3K5IA 4RM2A 3WHLA 3C5HA 3LIIA 3QG1A 4G63A 2ZSDA 3U7IA 2YHUA 4DSUA 4DR4B 4BN0A 2YCLA 4ZAFA 3O9VA 2WI8A 4LSWA 4DUZB 1G3IA 2DPLA 1P0CA 2QXTA 3B9PA 1DHTA 3GT7A 4LMPA 4N0DA 4RK7A 2VT6A 5DXAA 5LP1A 5JYAA 4C4YA 1U4OA 2FPIB 4QEKA 5CVTA 4NDZA 1DXHA 1R8JA 1SIUA 2D74A 3C24A 3GVXA 5KEIA 3GWGA 1W36D 4CI0B 1E4VA 1N57A 3E23A 1DKQA 4R1UA 3CEJA 3WZ2A 3T0GA 3IV7A 3KT6A 1DLJA 1G8YA 2I8LA 4B0PA 4FNOA 2R62A 3O47A 1Z62A 2YTZA 4I08A 2GAIA 2UYGA 4GNRA 5I8ZA 5LB4A 1B93A 2Q5LA 4DA9A 2LV8A 3D2LA 4IDFA 4E6EA 5IULC 1YL7A 2BMEA 1JHXA 1QZ3A 3H8VA 3RBXA 2OFPA 1W4ZA 4B9AA 4E08A 4J2HA 5CD1A 2MJLA 3H87A 1DC7A 3BSSA 3ET4A 4ENRA 3A9CA 1SC1A 4J0GA 4OP2A 3FJYA 4BJ5A 2HIGA 3PHHA 4Z0NA 1UC5B 3PPXA 2HL6A 3CRW1 5K5EA 3GJSA 4RUKA 1DG1G 3THXA 4EG1A 5AVRA 4ED9A 3WDMA 3T06B 1TZ2A 3DPUA 1A9SA 2E9SA 4D0RA 1EK0A 4GP9A 2XMCA 1UAYA 1BFUA 2C0CA 4US0R 4ECAA 1J1IA 1NXVA 3BMQA 5KYVA 4KE6A 1E2HA 5HMMA 4WHMA 1UZNA 1ULUA 3S29A 3C7CB 2XOKA 3CH7A 4KQXA 2SHKA 2A33A 3ZDYB 4JA0A 3DV0B 3GRFA 2YC4C 1C30B 4NATA 1G5PA 2XMBA 4KVZA 1ZGGA 2DAPA 2F43A 4W6QA 2RHCA 3FZYA 3M8KA 4XCQA 5AJHA 4BEWA 2PNFA 3O8LA 4QDUA 4R9NA 3SMVA 5EUMA 1M0TA 1TVCA 4IGFA 3CH5A 3KEQA 2RD2A 3E9CA 3TDMA 3QHPA 2R1TA 1U1DA 3P4YA 2ZZNA 1Y33E 1KAGA 4XRGA 4JBNA 3OOWA 3LMKA 1FU8A 4BC1A 2JJ8A 2Z3ZA 2PEYA 2FPPA 3UOAB 5JW6A 1Q20A 5EIHA 5LXTA 2GLXA 4JLKA 2RI6A 3DLCA 3CPHA 1W5FA 2EZ9A 3PNBA 2NU9A 4N3BA 2V7UA 3DL0A 3IT2A 3KZMA 5EMLA 3O03A 4DJTA 2GARA 1C8KA 1F6DA 1U2GA 2XNJA 4MRMA 1JSZA 3UJBA 2WYOA 4WPGA 4P4TA 1QJCA 1YOVA 1TECE 3A7DA 4L85A 4WN3A 1RXWA 2QLTA 1EPUA 4EJSB 2ZSEA 5KYUA 2JIZD 2OHOA 4Z9FA 2E0IA 3L92A 4IUCS 4KQWA 2QW1A 4NU8X 3G6WA 3IMFA 3SFVA 2NX2A 1C3JA 1NLZA 2IKQA 3VSBA 3G6KA 4IW3B 3A4TA 4ND1A 1PJ4A 2VXCA 4KNVA 1U6IA 1UMDA 1HF3A 2HHLA 4TRRA 1M76A 3PA8A 5DI3B 2PS0A 4O63O 2REBA 3G82C 3AG5A 2PZLA 1BVYF 2G72A 1Z6ZA 1ZDMA 4WBNA 6CHYA 5EUQB 2QK4A 3OEEA 4FW9A 4OHUA 1SN7A 1HI9A 3GJ5A 2X6RA 2VK2A 4E5NA 1U7TA 2Z08A 5CXXA 3NB0A 1O8CA 2HBRA 1Y7TA 4GW3A 1X74A 4KQGA 1JW9B 1JG4A 2PIAA 3DE1X 4C6HA 4CLEA 4GUDA 1C3LA 2O4CA 2ZVPX 4O1MA 3LOPA 1X9HA 3PVZA 5IYZA 2IGBA 2WJHA 1L4GA 3QXXA 1V1RA 2E5FA 1NBIA 4CV3A 3PQ4A 2XQFA 4CV2A 4I5GA 4DTCA 1LDYA 2VP3A 3FFXA 3TNYA 2G76A 5PGMA 1E1MA 4JJIA 3IIEA 2HAEA 4POOA 5JCOC 3LP8A 1L4UA 1SHLA 1Q91A 4HWRA 5DRYA 3ZWCA 1BGXT 3EGIA 4EITA 5CA0F 4ZOBA 3UYLA 2UUOA 1B3BA 2IOHA 1EX1A 1DHRA 4P54A 1JYFA 1X7GA 1T0PA 4OQEA 4EW3A 4M37A 3DW3X 1EEXB 4FHFA 4MUFA 5I6DA 2F7SA 3L8FA 3R8FA 1D2EA 2DWPA 1M0EA 3ZV4A 1D03A 3FPCA 4NVRA 4OLJA 3TLBA 2GXQA 4AF7A 3ESXA 3JQ7A 3MCTA 1G9SA 1AHHA 2GMWA 5ERYA 1FVHA 3DT8A 4QASA 5HIKA 1Q17A 2JFVA 3CZCA 4ACAA 3CIFA 1PZMA 1T5LA 4YONB 3L0IB 3D3JA 5CYOA 4E88A 3NTXA 5A6VA 5C5EA 4MWOA 4RZIA 1H6DA 3NDIA 2JCXA 3V6MA 2XB2A 4RO0A 1YVUA 3ETJA 1DIBA 4EG3A 4KUEA 3PTLA 2R6ZA 1YVEI 3I6IA 3EMBA 4IXWA 1TK9A 4JP2A 1M8FA 1PO7A 2OHFA 1IY0A 3KWJA 4DE5A 1HLPA 2A0WA 5UKDA 5KSWB 1Q1NA 5JXWA 3FPGA 1QDLB 1WMSA 1RPTA 3ZDXB 1BN7A 2I7VA 3JPYA 3FF4A 4XSGA 2ZULA 1OFGA 2Z5FA 1U8TA 5TGTA 1N3LA 2GB4A 2JGMA 2VA8A 3KD2A 3LLCA 2KLBA 4GS5A 4U3JB 2P9EA 1ILWA 2OUIA 1G5IA 1MTZA 3HO1A 2NAFA 1VCNA 2WVJA 3LT1A 1Q0PA 2HZ7A 2NPOA 4MR7A 1L4NA 5AKEA 3UB4A 3UKDA 4MEAA 5LQSA 2O19A 1C9NA 1L7BA 1DARA 2G06A 3N0XA 2IP1A 1ZI8A 3W7AA 3HV0A 3I32A 1OQAA 1RQ7A 1XKXA 2ZQZA 5BWOA 4D80A 3RDPA 2Y77A 4B6EA 3FBTA 1XCPA 4WL0A 1M8PA 3ETDA 3EQ9A 4JKOA 4PSVA 2L18A 2P9YA 3DMGA 4BO2A 2J5KA 3BQ9A 4GL4A 3B6ZA 2POQX 2WWRA 1VJCA 4GVXA 4LX8A 2BM1A 4P32A 4YFYA 3SYTA 3VNQA 2UUBB 4ESOA 3NUQA 3BK2A 4PC1A 1QQBA 1MG5A 5TEVA 4CMCA 4DABA 2QAGC 1L5WA 4HVCA 3I1IA 3F7MA 1MF7A 2P27A 3K0FB 4W1SA 5LNK1 1BVHA 1VLQA 5ECGC 4GI2A 4IZHA 3RREA 5LQDA 3ROXA 2I9KA 3HA7A 2OCXA 1CCWA 4AG6A 4ZN6A 2B4KA 3FHJA 1PK7A 3IXLA 5B58C 3NT4A 3EXEB 4OH7A 4RPIA 3D5TA 4LZWA 5DCUA 1FX1A 2WWFA 3GOQA 1FIUA 1MXFA 3NHFA 1KVUA 5DCLA 2QYSA 3C3WA 1H4TA 2PD3A 1FVFA 1KQOA 4EFKA 1ZSVA 2X0EA 1JR3A 4ITRC 2LDBA 5AUQA 1E5VA 3ITKA 3FZNA 1UT6A 3A3YA 1GV0A 3HVJA 4Q7LA 5K0SA 3DE0X 5LUBA 2J8ZA 4O0MA 1TX4B 4BV3A 2GEKA 3I6YA 5A4IS 1XZFA 4I3HA 1AKTA 4O3FA 4EMSA 3ELWA 2IPLA 3NEJA 1E1RD 2GSDA 2JGDA 1H1TA 4FCCA 4QFMA 4NNPA 1D09A 1XDUA 2A9KA 3IDSA 5E2AA 4DA7A 1TK3A 3DFIA 1YHZA 1K4MA 1MVNA 1T8PA 2EW8A 2ZWIA 4NDAA 4OLFA 4DR3B 3PHIA 4PZLA 4PZPA 1Z4IA 2OKGA 4RA9A 1G5QA 3ZWYA 3S2EA 2Z2XA 2LNDA 4GLJA 4RZQA 2G07A 4CUZA 3H97A 3NRBA 4MIKA 4TWBA 4YCBA 2PH3A 2W83A 1RWQA 1EJ6A 4BDSA 2DWUA 3EEFA 2V74B 5LUAA 3W77A 1G9TA 4M4SA 1BG6A 1FYWA 4R2HA 3IP6A 3KV1A 2J0QA 4NKRA 3R9KA 3GUZA 4JI4B 1YKGA 2ZE5A 1DIAA 3AI1A 2VHTA 1SD2A 3FOWA 4MP3A 2QVBA 1W85A 4G5OA 4ZO9A 3VO9A 3ZZNA 3CURA 3SDZA 4E12A 3NFYA 1FJGB 5I9BA 1HE8B 1XZKA 2RKBA 3I53A 2X76A 2ZIEA 5A4FS 1ISIA 2CXPA 4Q3EA 1RWKA 4OAOA 2NNLD 3IVXA 3IUPA 2IZ5A 3F5SA 2GCPA 4WINA 5BWMA 4RGVA 2DQ4A 4C4ZA 4UMDA 1JFSA 1D2MA 5CGZA 2HYDA 2J3EA 4TV9A 3D7MA 1FNSA 2EC5A 1DC5A 5LB2A 4BZPA 5ICGA 4BLTA 1Y8AA 2F90A 4UDOA 3RNLA 4E3WA 1QH1A 4HNQA 5AKHA 4DCSA 3EP8B 2JFNA 4LDAA 2YN4A 3PR3A 1D6NA 4JMPA 3L49A 5F98A 3EWAA 3N7TA 5DM0A 4CMGA 3QVXA 4FD2A 2Y1GA 2IU3A 3R7AA 3ZE1B 2C4WA 5CDFA 2IXFA 1LZKA 3QEKA 3GRZA 2GYVA 7YASA 3O75A 4WA7A 1J1ZA 4UZSA 4OQQA 4BNYA 4CMJA 4LRUA 1JVBA 3PXCX 2QYHA 4QE3A 4I9NA 5G0VA 4XDYA 3R7WB 3C41J 2MMCA 2WSMA 4V24A 3JAKB 4NZOA 3SZ3A 1KU0A 1YMQA 1YJXA 5KYTA 4G2NA 5ERXA 4JBWA 3V8NA 3KKKA 4J0HA 1LUAA 2OCPA 1EFLA 1NW5A 4L8VA 1Q11A 3BA1A 4YCNA 3U17A 1K66A 2G9QA 3O73A 3VOAA 4BUCA 2A92A 2AG5A 2QJWA 2D2VA 3JQPA 1L5LA 1CYEA 2Q1YA 4CQNA 1PGPA 4GVLA 3WP1B 4IHKA 5DM60 1JX6A 4TKLA 2XZLA 3I28A 1ZOIA 3ZHSA 3PX3A 2ZJAA 3PS9A 1UL1X 1Y34E 1JKJB 4K2HA 2HM7A 4FFBB 1MDBA 3JV7A 4ZVQA 4WK0B 3B5IA 5BY2A 4D41A 1FVXA 2XY4A 5L4SA 2H00A 1GGMA 1HKUA 2QZSA 1N7IA 2XV1A 3CN7A 1IUKA 3AJEA 2PUVA 5DN6A 5C5IA 3CW9A 5K0BA 4MRAA 1N1GA 2R1UA 2I4IA 1MPTA 1QZXA 2W8BB 2Y1DA 3B7PA 4IH1A 4S1VA 1MMFB 1G38A 3QVJA 5GQSA 1QYXA 2BHLA 3GZNB 1GIAA 3TOVA 3AUXA 5B57C 5A62A 3WBBA 4IS2A 4AYWA 1U5BA 2G9NA 4JI6B 4CNBA 2H9AA 4ERXA 4RTMA 2V0NA 2YYSA 3HUTA 3MCZA 3PRHA 3AVWA 1PJRA 1WHSB 5THXA 2DFLA 3PXXA 2B6NA 5ITZA 1FTQA 5GV8A 3JQFC 4YRPA 3VR4D 3WL5A 4EY5A 1ODSA 5FNVF 3PEUA 4IEIA 1GU0A 1SH7A 2XJ9A 3RTGA 1T3GA 1ZJ5A 3DAHA 3NW9A 4B7XA 4QBKA 3KVRA 4M7OA 1DAFA 4TVKA 3O2NA 1VCHA 2I87A 2VH1A 1JEDA 4HWKA 3AHEA 2QUIA 3CB2A 4IXTA 4JYMA 3NGLA 4Z0TA 3IGFA 5JHGB 4E2XA 3EVEA 4H7PA 3L7JA 2H0QA 2V7TA 3K9HA 1X1RA 1XU7A 4ZHQF 1NPDA 5K0JA 3I8OA 3AGQA 3PQ8A 3V6LA 4G5YA 1JSLA 4PHFA 2C5SA 3CKLA 2W2NA 5I9IA 1HE5A 3ITNA 1JHOA 2O6HA 3PP8A 3ZDQA 4COOA 1QYWA 3V1TC 3OTWA 2NTVA 3U4MA 4U0KA 1E3IA 5JCJD 4GLOA 1CPYA 3L40A 1NXPA 2JLQA 3M70A 3JALB 2ONJA 4AC9A 1LF5A 3TO5A 5H9WA 2W6IA 3A2NA 5D1HA 3ZEIA 1F4VA 2WM3A 2UUAB 1MX5A 5LP6F 2WSBA 3AVQA 3NNNA 1DCKA 1YB1A 1CDZA 3ORFA 2VJMA 5KZMB 1MB3A 3MPOA 4NF2A 5H02A 3QEAZ 3ZJ5A 4IFEA 1CQJB 3UGJA 2VDJA 4LMBA 2IYXA 4E14A 4EHJA 3TD9A 3W3AH 3W6NA 1E2GA 4LIPD 4RQAA 1RZUA 3CLRC 3F47A 4Q4HA 2VPPA 4A91A 4B4WA 4TYMA 4U7JA 4LBZA 3TRJA 1T0IA 2BM9A 1BSVA 1WDMA 1L1RA 1KPIA 2ONCA 3VFDA 1LTHR 1O1YA 4CMIA 3TMAA 4QFBA 4A8TA 1X7ZB 2OP0A 5NLLA 4DAOA 1W52X 5B4TA 3NAQA 1BDMA 2QN7A 2FQXA 3RBAA 4HC4A 4WXMA 1QVVA 4YPFA 3I5MA 1RRKA 1KORA 1UWKA 2VJLA 4H6VA 1O95A 4C29A 3DHNA 4JJ8A 4JLUA 1SEVA 3I5AA 5EXXA 1E2MA 3E2PA 3KS9A 3D1LA 1ULHA 4LZLA 4K5QA 4O25A 1AZTA 1HDXA 1WXFA 5KQPA 2DY1A 3DKKA 2XNCA 5EHGA 3P2YA 2XTNA 4UTXA 4XTRA 1T1SA 2X5OA 3BB1A 2QP9X 1EAMA 4HWOA 5LNK6 4L3VA 2VHVA 2QUHA 4NENB 1XNGA 4YV2A 2JG3A 3BAFA 4BVAA 1JH8A 3EG9A 1KERA 2C2OA 1NR1A 1YXMA 2AN1A 2RHWA 3L77A 4NLLA