1H9AA

Complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from l. mesenteroides with coenzyme nadp
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEACEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nadp+ and Nad+ Binding to the Dual Coenzyme Specific Enzyme Leuconostoc Mesenteroides Glucose 6-Phosphate Dehydrogenase: Different Interdomain Hinge Angles are Seen in Different Binary and Ternary Complexes
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE 1-DEHYDROGENASE
total genus 175
structure length 485
sequence length 485
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 2001-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1h9aA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1h9aA01
3DHYA 4NFHA 4NBRA 4U6QA 5DP2A 1K0UA 4R68A 3X2EA 1JLLA 4TZTA 5CDYA 1H0KA 3AU9A 5HBRA 5JAQA 4OO3A 2ZQZA 2IXBA 3EC7A 2FWMX 3GEDA 4FCCA 2EP7A 2O3SA 4DQUA 5L9AA 5JAMA 2VTEA 2WSBA 5AXBA 2AW5A 4IDGA 1R4NB 3LC1O 1DRVA 1UXKA 1VRWA 4A0SA 1ZMOA 1PS9A 4IDEA 4BNXA 3QWIA 4WLUA 4CQLA 2NM0A 1C3VA 3PI7A 2FN7A 2BLLA 1N5DA 1YBMA 2ILTA 4CM7A 1IULA 4W99A 5BSGA 3CINA 3H3FA 4U0KA 3AJRA 1YL6A 1VI2A 2IODA 1E0DA 3TSCA 1R66A 2HU2A 2Q3EA 1CRWG 3GDOA 4CR8A 1PJSA 5IJZA 4MVJA 1JTVA 2NTVA 3GUYA 5AOVA 3AY3A 4XIYA 3GVHA 4DC0A 4M1QA 3V1YA 5B1YA 2AG5A 2O3QA 1O94A 4LSMA 4PZEA 3K2EA 1AXEA 1X7HA 4J4TA 4ZRMA 2RBEA 3GG2A 1GCOA 4A73A 1H93A 2DPGA 1OOEA 3L6DA 1AE1A 4PZDA 3WNVA 1RYDA 4MP3A 3G79A 5CEFA 1V3TA 3H9UA 1EDOA 3ZV3A 1HZZA 4WLNA 3QWFA 2D4AA 2VQ3A 4E33A 4CMIA 2GO1A 1E1MA 1YQXA 1LBEA 1TT5A 1R4MB 4KTTE 3PJFA 4BV9A 2IRWA 1S6YA 1UXHA 3F1LA 2J8ZA 3L9XA 1H6CA 5L4LA 4RDHA 2F00A 2EKQA 2OFPA 2FRDA 2ZB3A 1MX3A 1LLQA 3PEFA 4YCAA 4CMJA 4RF4A 4IGFA 1SCUA 3L0DA 3RBVA 4UUNA 3R1IA 2IXAA 3OETA 4GI2A 5FWNA 1FDVA 3A9WA 3LT0A 1IHYA 3TZ6A 3MJSA 4QXMA 3UAGA 2NQTA 3F47A 9LDBA 4BGEA 3BHIA 3BMQA 3LZ6A 1Q0QA 2A92A 2CDAA 2VN8A 5U1PA 1AN9A 4L73A 2Y1EA 3D7LA 1X7DA 4FS3A 3T4XA 3JYNA 3DZFA 1U4OA 5IXYA 1VJ1A 3H65A 4AJPA 1WPQA 3IUSA 2P4HX 2GN9A 2I9PA 2QW8A 1YOVA 3JYQA 3I4CA 3GF4A 2VHWA 3O4RA 4RL6A 3Q9NA 3HN2A 3B6ZA 2O2YA 5BNFA 1NTOA 1GZ4A 3PLNA 2UUPA 1T25A 5JXWA 4MKZA 3PYXA 1YXMA 3WQRA 3UVEA 2HMVA 1UXJA 1VKNA 1GZ6A 2VCYA 3UXYA 2CDCA 3ZWWA 1T1SA 1UP6A 3DBLB 3CPSA 3NTRA 1A9ZA 1B7GO 2V6BA 1JKIA 2R6JA 5T64A 1BW9A 4J0FA 3RAJA 4BNJA 5KCZA 1WWKA 4LW8A 4UVHA 4B7XA 1XGKA 3KYCB 2BD0A 1VPDA 1X0VA 4L9RA 3Q6IA 3RIHA 2DBRA 4CR7A 2GDZA 3LLVA 4PLTA 1L7DA 4ZVVA 1ARZA 1BG6A 1YQDA 1UR5A 3H5NA 1I01A 5HWSA 1EUCA 3JQBC 2WD8A 3EAGA 4WK6A 4X54A 1PJLA 1T2FA 3CXRA 2CVOA 3RI3A 1OAAA 1XG5A 1NR7A 5B37A 1E3LA 4YAEA 1KVQA 5I9NA 5DCWA 1WDMA 4XQ9A 2CD9A 5BT9A 1GQQA 5BSEA 1ZBQA 1OMOA 1V8BA 3UKOA 2HCTA 1E3IA 4BL5A 3JQGA 4XGKA 1ZW1A 1UJMA 3IC5A 2ZK7A 4CV3A 4O63O 5LC1A 4BO6A 2HKIA 1ULUA 3C3XA 3TZKA 1D4FA 3AWDA 3UCEA 4QT0A 3C24A 5AQ1A 1RWBA 2QHXA 1B3BA 4YJFA 1IL0A 5I7EA 1R12A 3DDNA 2JCYA 1YBVA 3ONDA 3RKRA 5KVCA 3N7UA 1PGOA 1LC0A 4YDRA 1BGVA 5JMPA 2XF8A 4BKRA 7ADHA 3CSDA 4PG5A 3CKYA 1BTOA 1XKQA 2EKLA 3PXXA 4G5HA 4KOAA 5KJCA 5ITWA 2D5CA 2EJVA 3VAZA 2G5CA 3E82A 1FXSA 2YQ4A 2XOXA 1QLJA 1SB9A 1ONPA 1NPYA 2EIHA 3TZQA 4ROSA 4BNLA 1KEPA 3CEAA 1H9BA 3I9MA 4KUGA 3M1LA 1RM0A 3PDJA 3VVCA 5J23A 2DT5A 2FPPA 4NBTA 4YWJA 3OBBA 4W82A 1JWAB 3T7CA 2AQIA 3ICPA 4OXKA 2X0NA 1QMGA 2GPTA 3GC6A 1LI4A 1WZIA 2PD6A 3KYDA 1SOVA 2X7HA 1RKXA 3OP4A 1H9AA 3GH3A 4D45A 3K5PA 5A1TA 1O95A 5F5NA 3C1TA 5G4KA 1E1LA 1PX0A 1JWBB 2X58A 1OFGA 1KVUA 3P5SA 4CQMA 1NYTA 4R5MA 3GZNA 3QVWA 3ZWAA 2Y1OA 4HADA 4AICA 5JDCC 1NFRA 4O6VA 2B69A 3KVOA 5C37A 3AY7A 4MVJG 2V6GA 3W4JA 4CMGA 1PL8A 2ZQYA 3RFVA 4B3IA 1DAOA 4P8RA 4AL4A 3ZCXA 2Q1WA 2HMSA 4MIYA 2B0JA 1U3UA 2IZZA 3FSRA 1EVJA 4XEHA 4L76A 3FPLA 4Z6KA 3ZV6A 4F45A 4XZ3A 4YRBA 5KJFA 1Q1NA 1ULSA 3DO5A 3ZGYA 5A9TA 3K8ZA 4GQAA 4NPCA 1ADCA 3ST7A 3JYPA 3I9JA 1XR3A 5ER9A 5G4LA 3W1VA 5EESA 1C0LA 3H5RA 3TPCA 4A27A 1DC6A 1KVRA 2TMDA 4WLFA 3K9QO 2OO5A 3A14A 3GVPA 4OH1A 5CPBA 1ZEJA 5F1KA 1Z73A 1IPEA 3E9NA 4NFSA 1C1DA 5KKAA 1VSVA 4N5MA 4OIMA 2FSSA 1D3AA 4CLDA 4D43A 1B8UA 2QIOA 3JQ8B 4UVDA 5G0VA 3KSZO 4JX8A 1HSZA 3VKVA 1O9BA 1PJ2A 3KM0A 5COQA 2W2KA 4DXHA 3GG9A 1R4NA 1G6KA 2VHXA 4PLCA 5F5LA 1L1FA 4E2ZA 4RPKA 3DOCA 4NQZA 1LSSA 4LK3A 3UW3A 2I76A 5JY6A 2VWPA 3JQGB 3JQ6A 4MIOA 2WEKA 5DZSA 3TFQA 3JQDA 2G82A 3QHAA 4OHUA 4TRNA 4XQEA 3ZU4A 4H7PA 3OJLA 2B4QA 3BMNB 1I8TA 4TRJA 4EGFA 1BXZA 5TS3A 1VSUA 4Z3KA 4RCVA 4FJ1A 5AYVA 4XB1A 2VT3A 3BZUA 3R3JA 4ND2A 3D4PA 3KEOA 4BMVA 5A9SB 2DUWA 2E37A 3D0OA 1EE9A 4E5YA 4D3FA 2NU9A 4ALNA 3ONEA 3QY9A 1SEPA 4PLYA 3RBXA 4P22A 1HDYA 4DBVO 4J1SA 1EUZA 4UEOA 4ZQFA 5JYFA 1NM5A 1ZVMA 2FMUA 2PD4A 4ZN6A 1QP8A 2RH4A 5GY7A 1XU7A 2GLXA 3I9LA 4JLWA 2VUUA 3VDRA 4EJ0A 2OUIA 4BHTA 4PG4A 3TFOA 1GDHA 4ESOA 4L8VA 4DREA 4CMKA 2NLOA 3LK7A 4D79A 3JQAA 4HX5A 5DT9A 4BO9A 5EN4A 2Z1MA 1IUKA 4HXYA 1YE3A 2BMAA 1U8XX 3EK2A 2R00C 4YT8A 3T4EA 4J91A 2ZJ0A 2JFGA 4E2YA 4GWKA 1PQWA 4DPLA 1ZXBA 1Q7CA 3BXXA 3UN1A 4BQRA 3VKUA 3V2GA 1BVUA 4GBJA 4YJDA 1C0IA 3TJRA 4GSKA 3JQAD 4MVJE 3KYDB 2VZ0A 1FF9A 1ZO8A 3Q2IA 1E1NA 3ZNPA 4K9DA 2JCXA 1JU9A 1TT5B 1T2AA 2C5EA 3KYBA 5JS6A 3RUHA 2PY6A 2OGUA 2B35A 1QYDA 1B8VA 4RO0A 2PNFA 5JO9A 5JDIA 4CM4A 4B3HA 1PQPA 5HTOA 5IXSA 1Y1PA 4H3VA 4FOSA 1IZ9A 3GOHA 3ZV5A 2EERA 4RVSA 1PZFA 3GN1A 3RFXA 2UAGA 4A7PA 1LA2A 3G49A 4EZBA 4NU6A 5ICSA 1KEVA 1N9GA 2D8AA 5TT1A 1DHRA 2QRKA 2YDXA 4F6CA 4WLOA 2FP4A 1NQAO 2I66A 5IDQA 2NWQA 3CMMA 1HXHA 1ZJZA 5DBIA 1AUPA 5KOIA 3HADA 4J49A 1P45A 5G0SA 3DC2A 3IDSA 3GT0A 5B4VA 1DFIA 2YDYA 1SO8A 2TMGA 2Y67A 3B70A 3TWOA 4N7RA 3RUCA 3DHNA 3IP3A 3WX0A 2PH5A 2DTEA 5CG1A 2P9CA 4YBZA 5JMWA 4BGUA 1EK6A 4NJMB 3JD2A 5TT0A 3G0OA 3AI1A 3AY6A 3WGHA 3F5SA 3FTPA 5L45A 2GCGA 2ZYGA 1O89A 2JFHA 1ISGA 3B20A 1CQIA 1ONOA 4LN1A 4RVUA 5IZ4A 4NDNE 4BNHA 2ZYDA 1QLHA 3DZJA 4DVJA 4PLVA 5EQDA 4G2NA 2BF7A 2RAFA 3FF4A 4G81A 4KMSA 3GMDA 2DPHA 4IQ8A 1H5QA 3GDGA 3ZW8A 3CE6A 3BMOA 1ZCJA 3KV3O 3AOEA 3CZMA 4R01A 2CZCA 2BELA 2C2XA 4JGBA 3PDUA 5K6AC 3EVNA 4GLLA 1TA4A 3C7DB 4I5GA 1SB8A 3GHHA 4J90A 3RU9A 2AMFA 3IP1A 3CUKA 3SLKA 2WD7A 5CDUA 4WEOA 4E5KA 4J1TA 5EQFA 1U3VA 1R16A 4EJMA 5I8ZA 4TZKA 3HDYA 1ID1A 5JDIC 2HSDA 3A1NA 3MJTA 1F0YA 3WSWA 1MXFA 3TNLA 4D3SA 1KETA 3W8FA 3MJCA 2DU8A 4E21A 1O5IA 2VUTA 3ZWBA 4RPGA 5IG2A 1F12A 1YDWA 5JC8A 5JYAA 1VM6A 1BXGA 4B4UA 2V6MA 3FPCA 4MIEA 2J3IA 3WSVA 3BAZA 1WXDA 2XPCA 3ZN2A 3RJ9A 3ZWVA 1RM4A 1QRRA 1LRJA 2GASA 4BUCA 1GYPA 1X0XA 4EI2A 4ZJUA 1E7QA 3PP8A 2X0JA 4CM4B 4MPDA 4QFCA 1WW8A 4UUOA 2WE7A 2WJPA 2Y0DA 4XDYA 2W8ZA 2P2SA 3DMTA 1WP4A 3DOJA 3PVZA 2DKNA 4PG8A 4XKJA 1T24A 1WZEA 4CM6A 5B4TA 2HJRA 3D4OA 5TSDA 3VTZA 1UUFA 3I3OA 2CSUA 3UH1A 4PG6A 5JCXA 4MDHA 3PRJA 3HB5X 3DFUA 4IMRA 4I8XA 1GTMA 2YW9A 3ZHXA 3W8EA 1G1AA 3H3JA 3KUXA 1DRWA 4NH4A 3NTOA 5G4KB 3RU7A 3NKLA 4CL8A 2GYYA 5T8KA 3WJ7A 1E3JA 2DBZA 2DLDA 1UXIA 4WGGA 1M6HA 4CODB 3NV9A 4A2CA 1EVZA 3PFWO 1DC4A 2IZ1A 4PLFA 4WJZA 2NV6A 3OEYA 2B37A 3JQ9C 4FFPA 3UOGA 2GF2A 3DZKA 3EMKA 3EW7A 4ONEA 4J2HA 4E5NA 3EZLA 2NVUA 3PYMA 1PGNA 1I0ZA 4XQGA 4BMSA 4D0RA 2IEBA 1ZK3A 3Q11A 3HFGA 4YJHB 4C7KA 5I7SA 1GZ3A 2R2GA 8LDHA 3CH6A 4GKVA 4ALJA 5EIOA 2NU8A 3KHUA 2OP1A 2RHRA 1BHSA 1GUZA 2NU7A 4IDAA 3GVIA 5MGBA 2Q46A 1ADGA 3FWZA 4YAIA 1J49A 1EQUA 4OXNA 1I2ZA 2P91A 4JQCA 2WYUA 2OMEA 3DOOA 1FJHA 3IS3A 2PK3A 2QYTA 2VTDA 4FFRA 3BYZA 3JQ8A 1HE2A 3JD0A 4GX5A 3FBTA 1HRDA 1HYGA 2P5UA 2IYOA 3PLRA 3IKVA 1GEGA 3FN4A 4E0BA 3F5QA 3SC6A 4YAKA 1G0OA 4BO0A 3SJUA 1HSOA 4F46A 5IN4A 3OH8A 3LVFO 5A9RA 3VC7A 3VH3A 3NT2A 3VPXA 2BH9A 3G1UA 3BMQB 2O3UA 5COAA 2BFPA 1U1IA 2CNBA 1DAPA 1OC2A 5GMOA 5B12A 4NHEA 4FB5A 2DAPA 1YO6A 3GR6A 4CLXA 5FFFA 4NU5A 1EK5A 3WTCA 5ENVA 9LDTA 4KWIA 5TQVA 3RC2A 3PJGA 2C20A 1P1KA 5A04A 2FR1A 3JD4A 2BGMA 1E7MA 3TF5A 1CIVA 1PS0A 3PHHA 4CLRA 4PCVA 4BNVA 1ZKMA 3KBOA 2JD2A 3RC7A 2H9IA 4LVUA 1HF3A 5C5IA 3ZU5A 1TLTA 1H6AA 3GGGA 4OKNA 3WXBA 3WGYA 4WPGA 4BKQA 4MOWA 5HM8A 2X0IA 1P1JA 4B4WA 1Y8RB 4P4NA 1V6AA 2X86A 3GY0A 3QIVA 4BO7A 1BWSA 1PSDA 4QFDA 3LYLA 4WLEA 4XDZA 1QYCA 2E6UX 1YL7A 4IIUA 2E48A 1P1RA 4IY1A 3RUDA 4R16A 3VDQA 5EPOA 1K6IA 1HDGO 4D46A 3ZWCA 1CEQA 4P38A 3ZWPA 2Q45A 2ZCUA 3NEPX 2VYNA 4WASA 1GPJA 4QO7A 3DZGA 2Y68A 3UUWA 3DBHB 2C0CA 4N5LA 5JBIA 3MJ4A 1Z82A 2IZ0A 2UYYA 4IMPA 3S2FA 5JAZA 3LC7O 3BHJA 2JCVA 4Q3DA 4II3A 1WAMA 2EEZA 1K2WA 5A06A 1LU9A 2X23A 4H15A 4AVYA 1F06A 5T6BA 2PKRA 3DEYX 2J5QA 1R15A 3D4NA 3OQ6A 4L4SA 4XGIA 4YACA 4BNIA 1FDSA 3E5MA 2D0IA 5K0ZA 4WCFB 3DQPA 3X2FA 3SBOA 3DXFA 3H9QA 3PHLA 4ALKA 3ZHBA 3U5TA 4M8SA 2C7GA 2UUOA 1WDLA 4TQGA 4EW6A 1T2CA 2J3KA 1P1HA 4J9VA 4CV2A 3LT1A 1PJQA 1UDBA 3F4LA 4TSKA 4R54A 4ZGWA 2C7VA 3K30A 1QSGA 1GADO 4GMFA 2GZ2A 1DIGA 2P9GA 4IXTA 2Y1DA 2ZTLA 5G0UA 3DMTC 3AI2A 3JYLA 4J4HA 2O3TA 1GQ2A 2UVDA 4RLHA 3WTBA 5BQFA 5THKA 3K2BA 3AFNA 1YVEI 3A06A 4KWHA 4AJOA 4BNYA 5HS4A 3OICA 3GFGA 3EYWA 3HSKA 2Q1UA 2WD7B 5G0WA 3TZHA 3VPFA 3DHEA 4R1UA 4LISA 3KOUA 3ZV4A 5K9ZA 1P31A 4NJMA 3WLEA 1DFGA 3C1OA 3IUPA 1DPGA 1QV6A 4KP7A 2WM3A 3PGXA 1AHHA 1PZHA 3VPHA 1RM3A 2HMUA 2DFDA 3CZRA 3JD3A 4YRAA 2W90A 3BMOB 3AUAA 1X14A 3I83A 1YB1A 1XELA 1LUAA 2RHCA 3DBVO 4II2A 5F1OA 2NADA 3KRTA 4ZD6A 4XYEA 3VPGA 4MKXA 5GZ6A 5IDYA 2GZ3A 3L6OO 1I2BA 1W8DA 4NZ9A 3DB2A 4WLVA 5TJHA 3ZWOA 4BVAA 4E31A 5C7IO 3RC1A 1C1DB 1YKFA 1U2GA 1LEHA 3I1JA 3RCBA 2JD0A 3QJ5A 1WMBA 2HMWA 1A71A 4J1NA 5JSFA 5ILOA 2Q1TA 5CEJA 1I10A 5L51A 2BGKA 4E2WA 2J3JA 3LQFA 1NAHA 1ML3A 4OOEA 3E18A 3SXPA 5ITVA 3VHRA 4JJGA 3VOSA 4DMLA 3LSYA 1DO8A 5L4SA 4INAA 1SPXA 1EE2A 4Q9NA 2POQX 4MVJH 5C7LO 1HDZA 4IJWA 5J9GA 3F4BA 2CDBA 2FSVA 4TRMA 1W4ZA 1Y8QB 3AM3A 4IS3A 4XIJA 4JROA 4ND5A 3DL2A 4AJIA 1QKIA 1H2HA 5IN5A 4CLEA 4DIFA 2PD3A 4M87A 3AUUA 4FFMA 4JK3A 1LDNA 3ITDA 3D5TA 5KJEA 1MFPA 4RF3A 1DBVO 1QR6A 1P33A 4QSMA 4EYEA 1N9GB 1C1XA 2VYVD 4QQRA 4LVCA 2JAHA 4RVDA 5GZ1A 1I2CA 1OC4A 3A28A 4WE3A 3FHLA 2YY7A 4JCOA 1LQUA 4MVJM 3OQ1A 5F21A 4CPDA 1IZ0A 1Y81A 2J5KA 5IZCC 4GX1A 3HWRA 5DN9A 4W9NC 5H81A 1W73A 4YAGA 4CM9A 4E5PA 4DTIA 2YFQA 1CWUA 4IS2A 2VOEA 4DLLA 3KETA 4NJOA 2OHXA 4MVJP 4BB5A 4FJ2A 3D5QA 4XYBA 4BIIA 3S55A 3BMCB 3KLPX 2GSDA 3L6EA 5KJ1A 2AHRA 4Z9YA 4RVFA 2OBNA 1I30A 1CETA 1XLTA 4UUPA 1UZLA 1GV0A 2X5OA 3QVSA 1IB6A 3LLSA 3OJEA 3HE3A 2ZB4A 3MTJA 1HE4A 4DWVA 4R3NA 1YB4A 5JC1A 2EXXA 3NGLA 4L0QA 2ZKLA 3HHPA 4AJEA 2Q99A 2OZPA 1ZIDA 1HWYA 4PZCA 5LDGA 1HE5A 2I99A 4CLRB 4PG7A 4UVIA 4JBGA 3I9OA 3QWBA 4O5OA 2D5AA 3DR3A 2GN6A 5JCJA 4BKUA 3PQFA 1WMAA 1DC5A 4L4XA 2VZ9A 2PKQP 3K96A 1BVRA 1LRLA 1QYWA 5L40A 2PTGA 4HUJA 3RD5A 1CJCA 4J4BA 3PWKA 2Y05A 1P1IA 5THQA 2EGHA 3RUEA 2Z5LA 4IJUA 2X9NA 4RGBA 2WDZA 1CERA 2EGGA 3VZSA 4ZQGA 1JVBA 1E7YA 5L7TA 1IPFA 2OBYA 3WWYA 1U3TA 4DYDA 1N1GA 1VL0A 4E30A 6LDHA 2NQ8A 1MGOA 1NWCA 3CIFA 2YHIA 4HNGA 1B3RA 3ZNQA 2AA3A 1T1RA 3E6AA 4I5FA 1DFHA 4C7JA 2HO5A 2O4UX 2RH8A 2Q2QA 2VRBA 1YRLA 2VZ8A 4HY3A 2ZIZA 3ADOA 3H2ZA 4JIGA 1DOHA 1V35A 1E7WA 1HDCA 4J7XA 4W7HA 4B8WA 3WGOA 4HFNA 3PZBA 3GZ4A 3WDSA 1ZSNA 4Q3BA 3U4IA 4U0JA 5F3RA 1ENYA 1P44A 4AJLA 4CJXA 1Q2XA 2Q1SA 1I3NA 1RJWA 2C59A 4MINA 4IUYA 5CDGA 3OA2A 4K1LA 3HNPA 2JKVA 3I23A 1BMDA 2ZTUA 3FWNA 4YVFA 1NFFA 4R1SA 3ROMA 5JE8A 4WECA 4GVXA 3C8MA 5DULA 1Q7GA 5A02A 5IDWA 1GQYA 3R3SA 4XJTA 4PVDA 1YONA 1JN0A 4UAGA 2B5VA 4KQXA 2FHSA 2VNSA 2G0TA 3U4CA 4I5EA 5M6DA 2B4TO 4R1NA 3B1KA 5ADHA 5KJ6A 3T7EA 1LLCA 3HZZA 3E8XA 1XHLA 4JP2A 3NGXA 3TDKA 1E1KA 1NVGA 4XQCA 5COBA 4DUPA 2D2IA 3HUDA 4Q39A 3MCVA 3HDJA 2JFFA 2X9GA 4RZIA 4BNGA 2AQKA 3WLFA 3WYBA 3ANLA 3PK0A 1RPNA 4BGIA 5BSFA 3RSHA 2W2LA 4FFLA 3NYWA 2V7PA 1XYGA 5EL0A 3V1UA 2NVUB 3KSUA 3I4FA 4DMMA 4RVGA 3B1JA 3B1FA 2YZ7A 4EJ6A 4RDIA 3RBZA 4IDDA 4IZHA 1LJ8A 4W9NA 2O50A 1V0JA 1YGYA 4OOFA 2YUTA 5BSHA 1KY5A 1HYEA 4YEDA 4XA8A 2VWGA 3PGJA 3IOYA 2NSDA 4KUHA 1JKFA 3DTTA 2O2SA 2B36A 1X1EA 3KZVA 1LDYA 4DPKA 2O3JA 4BO2A 3JQAB 2J5RA 2OXIA 1T4DA 3O8QB 2PR2A 3QVXA 2FPGA 3V1TC 3SJ7A 4B4OA 4ALMA 1R6DA 3H7AA 4RZHA 5LDHA 1NQTA 3E03A 3UF0A 1MA0A 3DZHA 1E7SA 4KZPA 1V3VA 4QEDA 3ZHZA 4IJKA 1B0AA 2Q50A 3JQCA 1KIFA 1IE3A 1R0SA 3DZIA 4IQGA 5JW6A 2Q4BA 4FW8A 2QQ5A 4I08A 3ABIA 1SC6A 1BXGB 1MG0A 4PFJA 1Y9EA 1S7CA 3JD1A 3TL2A 2QRJA 3GDFA 2WTBA 2XAAA 1N7GA 4CM9D 2P9EA 4DGSA 1P9LA 2ZJ1A 4GMGA 1H6BA 2HUNA 1DRUA 4BQPA 5JNLA 1LX6A 4UVEA 2WWRA 3INRA 1LSOA 5T57A 3EZYA 2YHIB 5JPIA 3UHAA 2PKQO 1B2LA 5CG2A 4XR9A 4FFOA 2PA3A 4GGPA 1BXKA 2GNAA 2FR8A 1SEVA 3ZWYA 5T8KC 4YJFB 3PIIA 3FD8A 4MJLA 2WE8A 4J9UE 3GNQA 2YV3A 3E9QA 2V65A 3FTNA 3KTDA 2J6IA 2X1HA 4YB8A 4IM7A 3WQQA 3VH1A 4CM1A 1E6WA 1LSJA 1Z75A 3PTZA 2VOJA 3EY4A 4NK5A 3ZU3A 1SOWA 2DQ4A 4YT2A 1XEAA 5AXCA 3BMNA 4MP8A 4TKLA 4XRRA 1O6ZA 4DA9A 5G2OA 3D3WB 3GZNB 1A9YA 1GY8A 4ZQEA 5JYEA 3NTQA 4NBUA 3NJ8A 3ENKA 4YJGB 4F6LA 4L4RA 3U0BA 5ILGA 3FRJA 3ETEA 1U3WA 2BRUA 4E3ZA 3QQPA 5A3VA 1Q7BA 3UCXA 1G0NA 3AU8A 4O1MA 3BA1A 1PJTA 5ENDA 1AXGA 4WOJA 1XU9A 5AXAA 1M67A 1VE9A 4OQYA 4AJKA 2JHGA 3E9MA 2PV7A 2Y99A 1F14A 4I5DA 3QVTA 2NNLD 3OSUA 2X22A 1TI7A 2BI8A 4XX0A 3GGPA 3AM4A 1SAYA 1X13A 3PHIA 4CM8B 4E32A 5FYDA 1OI7A 4J2OA 1HZJA 1N92A 3U9LA 2BFOA 3TN7A 4RPHA 3O8QA 3TL3A 3W6UA 1NWHA 1KVTA 3HDHA 1VJ0A 4Z9XA 4YRDA 1NR1A 4FPXA 2D59A 1DB3A 3HG7A 1EZ4A 2QG4A 1MV8A 4NFYA 4Y67A 5H82A 3ZWXA 1C1XB 1PL6A 2X8LA 1ISHA 4HNHA 4IINA 3PJDA 4RQTA 1Z45A 3DWFA 5IF3A 2FZWA 3GNSA 3BIOA 3HQ4O 3VZPA 2CUKA 1MP0A 4I9UA 4IDCA 4J0EA 1PEDA 3KO8A 5JCJD 1GV1A 2X6TA 1XWFA 1B15A 1PR9A 2GGSA 3U09A 4IJVA 5TF4A 1DJQA 1KOLA 4Q3CA 3BHMA 1PGQA 3ZWNA 2C54A 3AUSA 4K6FA 1K89A 3GUCA 3DAGA 4GL4A 3ASUA 2Z1NA 1PWZA 3NX4A 1DLJA 4OKIA 2GRAA 5CHEA 4Q3NA 3LT2A 1Y5RA 1P3DA 3WGGA 4BNMA 1T2EA 4J43A 2ZYAA 3RASA 4CLHA 3HB4X 2C82A 1UDAA 2HRZA 3F3SA 4W7IA 4QO8A 2ZB7A 5F1PA 2VHYA 4FDAA 1K5HA 2GERA 2DM6A 3PQDA 2R00A 5A03A 3F9IA 3OFSA 5FF9A 3DAFA 3HN7A 2H63A 4CMIB 2H1SA 1M76A 3TQHA 1GL3A 4NBVA 3O38A 4KDFA 2YQ5A 3GPDG 1XCBA 1Z7BA 3P7MA 1Y8RA 3UICA 2J3HA 3G3EA 3PJEA 3Q3CA 2PGDA 1ZFNA 5JLAA 1X15A 4WCFC 5IFLA 1NPDA 4JJFA 3GRPA 4URFA 3WS7A 1MLDA 4B79A 1TT7A 4Y6RA 3UFXA 5BR7A 3HJAA 3WB9A 1U7TA 2QZ9A 4FC6A 2G1UA 1HDXA 3INGA 1EQ2A 2FR0A 3MEQA 5LCXA 2C29D 2YJZA 1E5LA 2FOIA 1ISFA 3VVBA 4BKPA 4F3YA 3ZW9A 5EJ2A 1MUUA 4CUKA 3H5AA 1XQ6A 2Y93A 2ZTMA 3OF2A 2I6TA 3GVCA 3MTGA 4EUFA 5I7FA 5I8WA 2EP5A 2Q4EA 1JA9A 3GPIA 3KXDA 4GH5A 4O59O 4YPOA 3ITKA 3F1KA 1TEHA 4YJHA 3ICCA 4BNWA 4E12A 2ZCVA 2DTXA 1J5PA 2NU6A 1EVYA 3FNEA 3FNFA 2G76A 1KYQA 2VHZA 4UUMA 1BSVA 1ZK4A 2P68A 1KC1A 3U62A 3WICA 4L74A 1WNTA 2VHVA 3H9GA 5CDTA 2W2KB 3D64A 2PZLA 4S3MA 1GAEO 4DC1A 4MKRA 1E3EA 2X4GA 3QP9A 1XQ1A 4R9SA 1UAGA 4CMEC 2A4KA 4U5QA 3JQEA 4BS9A 3M1AA 3QVOA 2I5PO 4OM8A 3DZBA 1SMKA 1E3WA 2GN4A 3QA9A 3QLJA 1Z6ZA 4GGOA 4HFRA 1BDMA 4M89A 1GR0A 4BO4A 3ZI0A 1ISIA 3WBFA 4R9RA 4HFJA 4CMHA 2Y1GA 4XYLA 1ZEMA 4YYZA 3GA0A 4CMEA 3EUWA 4NNJA 5KVSA 2PZJA 1KERA 2QYSA 2W2LD 3ETGA 5A3JA 4N54A 3NDRA 3S2IA 4D41A 3MOIA 3GRKA 4Q3AA 2NVBA 1DHTA 1ENOA 2YV2A 3PQEA 1J0XO 3W8DA 3DAPA 5A05A 2EV9A 1NASA 3WIDA 5GZ3A 3IQDB 3RVDA 4TKMA 1JVSA 5JDCA 1GPDG 2P4QA 5DP1A 1AHIA 4FQ8A 2Y1FA 4RJTA 1UZMA 1SNYA 1EDZA 1Y8QA 3ETDA 2BFMA 5JAIA 2EW8A 4CL3A 1E77A 1R37A 3RKUA 3FBGA 1D7OA 3H6KA 1I33A 3QWAA 4DPMA 3OA0A 5C3MA 4QTZA 3V5NA 4PRKA 3WR5A 3OIDA 1IHXA 2VNAA 3ZNNA 4OJNA 1A7KA 3HFSA 3GQVA 1NVMB 4Z0TA 2C07A 4GAEA 3P2OA 1A27A 4P4GA 4BOYA 2VRCD 2WYVA 3ASVA 5U9CA 2PGLA 1EMDA 4E4YA 2W4QA 1HYHA 3C7AA 1KC3A 2O48X 1NBOA 3L07A 4ND3A 4XWYA 3TZCA 3WGIA 3SC4A 1Q0HA 1GCUA 4JN6B 4ZQBA 4BO3A 2VYND 3CMCO 2JAPA 3V8BA 1GUFA 4XD2A 1DIAA 2HMTA 4J16A 1TXGA 4GX0A 4AFNA 3QW2A 3FI9A 2CY0A 1ZK0A 5FEUA 4B8ZA 2D3TA 4UULA 2DUUA 5DOZA 2GR9A 3W6ZA 1B14A 2HQ1A 3EHEA 3GN2A 8ADHA 5KVVA 1E92A 1K3TA 4LGVA 5C7OO 2Y1CA 4K26A 4M86A 2AQ8A 1DLIA 4J3FA 4DL9A 1ISJA 2BI7A 4D42A 4OYRA 1LNQA 4LRSB 2WYWA 1PGPA 4OMUA 3WYEA 1RM5A 3D3WA 2JHFA 1X1TA 3O26A 4IQ0A 1VLLA 4IIVA 2F1KA 5DDIP 5IZCA 4AJ2A 1HDRA 2NACA 4LSWA 1J4AA 1HKUA 1YOVB 2RCYA 1FDUA 5HRUA 2NUAA 3DBLA 3GHYA 3GVXA 5TIIA 1BRMA 2HDHA 3ORFA 2A94A 2D1YA 3IL2A 4B7CA 2VUSA 1C14A 4CR6A 4FOOA 1T26A 3H4VA 4IPTA 4DIBA 4AJ1A 4Y98A 2DVMA 1NVTA 3L4BC 3G17A 1EFKA 2DBQA 1CDOA 1WLYA 3FNGA 1XSEA 1BDBA 4PIVA 4PGFA 3H9JA 4QX6A 4Z9FA 4ZRNA 1PJ3A 3NT5A 3L77A 5DOVA 1PR3A 3ZU2A 4ND1A 3NJ4A 4ND4A 1D1SA 1U2DA 1SZJG 4HBGA 4U7WA 5DF1A 3Q2KA 1ENPA 3VPSA 1U4SA 1M75A 1UP4A 3WGQA 3W4KA 1MG5A 4FGWA 4E2XA 4FFNA 4TVOA 5CPFA 3N74A 3KB6A 4QUKA 1QG6A 4KTVE 2E82A 5DBFA 5FI5A 1CQJA 5AXDA 3WGZA 4R4JA 3MZ0A 5U4QA 1DSSG 2EHDA 1O8CA 3GK3A 4WCFA 2VYVA 3IJRA 1A5ZA 1GFSA 5B4UA 1DEHA 3SLGA 1U5CA 2AEMA 1TB4A 1A4IA 3EVTA 1U7HA 4LMPA 4CQMD 4S1VA 3OM9A 1D1TA 3AOGA 4BNNA 4C4OA 5H83A 5JY1A 1T2DA 3K73O 2O4CA 1EBUA 2IE0A 4UEJA 5TC4A 4CM8A 5EERA 3DBHA 3BTSA 1VC2A 1I3KA 1LC3A 1P0FA 4WOKA 4R69A 5T67A 4G65A 4XYMA 4UREA 1LDGA 1F17A 2EF1A 4WNCA 3QE3A 4CUJA 3L4SO 3PHJA 4UEKA 2LDXA 1H2BA 4A26A 4NIMA 1I32A 1EFLA 1QV7A 1U28A 4OSPA 4EITA 4EUEA 1E7RA 3JTMA 3VZRA 3DBRA 4HFMA 3E1KA 5L3ZA 4QECA 5DBGA 4FBGA 2PH3A 1XDWA 3RWBA 4AJHA 2HAEA 2ZB8A 2GN8A 2Y66A 3MOGA 4H16A 4FD3A 1EVIA 1NNUA 3SVTA 1F8FA 1ZSYA 3PFFA 4L75A 1O0SA 3ANNA 2H6EA 4BV8A 1NX6A 2PLAA 2QX7A 4KDEA 5EMHA 2HK9A 4RPLA 4D0SA 3R6DA 2PGJA 2Y0CA 2Q49A 1HETA 5L7YA 3ON5A 5A5EA 2A9FA 4WUVA 4NG5A 4DQXA 2DTDA 4K28A 4ID9A 3L9WA 1P0CA 1YH3A 4EBFA 4IZIA 3WIEA 4BKOA 5L4NA 2DBVO 4YQZA 2UDPA 3UGKA 5CEEA 5HS6A 3ONFA 3RQSA 3LC2O 2BFAA 1ZJYA 3JYOA 2H5LA 2XXJA 1LDMA 3NDIA 4CMCA 1DJNA 2OP0A 2HRBA 3OMLA 2YFHA 3SX2A 1B16A 4NI5A 3A4VA 2X0RA 3MWDB 2OOSA 4GLOA 1Z74A 3OIFA 1YWGO 2HK8A 3PZRA 4R41A 2I65A 1HT0A 1KVSA 3ENNA 2VRCA 4B7UA 1VL6A 4KQWA 2Q2WA 2B5WA 4CQMB 4DBZA 3BMCA 1MB4A 4JP3A 4CV0A 3KYCA 3S8MA 1QYVA 1N1EA 4LCJA 2PZMA 3BTOA 4M49A 3P2YA 4OSOA 1KS9A 1E3SA 1D8AA 5K6AA 2EG9A 4Y6SA 1EBFA 1LRKA 3WBBA 1YBAA 1M6WA 4XJSA 3JQ9A 3EDMA 3NT4A 4BNUA 1UP7A 4IGEA 1ONNA 3WGTA 4CMBA 1GYQA 4DRYA 4WEQA 4CM5A 2VT2A 4PLHA 3N58A 5JFOA 4CMAA 3IKTA 1OZAA 5A4DA 5AVOA 1UZNA 4DLBA 4TRRA 1M66A 4GX2A 4WNIA 4J6FA 1PJBA 2FY8A 4J7UA 1P74A 1Y9AA 3RC9A 5IAAA 4EUHA 1E6EA 1I3MA 4HV4A 2IDZA 4ZICA 2HK7A 5KWEA 5I7VA 4MO2A 1LDBA 4R3WA 3V2UA 1P1FA 4TVBA 1QXSA 4BMNA 1PJCA 4EEZA 1DIRA 2O7QA 4RF5A 2JL1A 4AJNA 1SBYA 2X5KO 3JQ7B 3ROPA 1VL8A 2X9VA 4YTEA 4PRLA 3BTUA 3GAFA 2PWZA 4JBIA 3WMWA 3TRIA 1Y5MA 2GZ1A 4I9NA 4ITUA 3VH2A 2GUGA 4YJGA 3NAQA 2HJSA 4FGSA 1Z7EA 5I9MA 4B4VA 4BB6A 1Q0LA 4E5MA 2AE1A 2E4AA 2EWMA 4RF2A 3E5RA 2Y0EA 5BNTA 1GD1O 4D3DA 4FN4A 1ADBA 4R5HA 1WDKA 3KSDO 5CP8A 1NQOA 1PJ4A 4ZQHA 4TWRA 3PIDA 4CV1A 5FI3A 3WQSB 4BNZA 3JQFC 2FPIA 3INTA 1LXCA 4FSHA 4YA6A 1J6UA 4ALIA 4GSLA 4I9HA 1LLUA 4Y9DA 4A10A 2NTJA 1I5RA 3ZHYA 1ZZEA 1U5AA 3S2EA 3UCFA 1XIVA 1H6DA 1BW9B 4WCDA 2I67A 5G0TA 3TOZA 5JYDA 1ZH8A 1NFQA 5TLSA 3AFMA 3STHA 1P77A 4FIZA 1UH5A 3JSAA 3JQFA 4M55A 3GEMA 1PTJA 1AGNA 3NDJA 1LQTA 1JAXA 2AQHA 3NUGA 2YHUA 3D3EA 3Q1LA 4R51A 2I3GA 5EINA 3R0IA 1A4UA 3JV7A 1NAIA 4XYGA 3S1LA 3V2HA 4AG3A 5KVQA 3M2PA 4M54A 2WMDA 3ROQA 2CFCA 1PWXA 3O03A 1ZSVA 2W98A 4CQLB 4XB2A 2A35A 3RUIA 3G1TA 3VH4A 4XGNA 2EKPA 4BNTA 4DIOA 2VWQA 3Q9UA 1HLPA 1A72A 4OQZA 3OJ0A 1HL3A 3K92A 4A5OA 4EDFA 2AG8A 4OL9A 1C0KA 3GLQA 4Q3EA 4JJIA 1YS4A 4FJ0A 3ADPA 4EEXA 1LTHR 1QYXA 2O23A 5CDSA 4IDFA 3FR8A 4YR9A 2BKAA 4PLPA 3AK4A 5KNLA 1HE3A 6ADHA 1T4BA 2YV1A 1N7HA 2CF6A 1ZMTA 1YJ8A 4Z3DA 1DXYA 3WOHA 4ZU3A 2BHLA 1ENZA 4LMRA 4W4TA 1W0CA 1PS8A 3KLMX 1RYEA 1MC4A 3TOXA 4TROA 1YB5A 3AM5A 3AUTA 3ZDFA 4CM3A 5ICMA 1YJQA 2BGLA 2IYPA 5KIAA 2LDBA 2I3AA 4N18A 3S2GA 4RPJA 3VTFA 4XCVA 4YXFA 2P5YA 3OECA 4IBOA 2NVWA 3F6YA 1TVEA 2C2YA 2AE2A 3WG9A 2AEJA 1K6JA 1PIWA 3K31A 1ZUD1 3LDHA 3QWHA 1KY4A 3PPIA 4RORA 2CVZA 3WFJA 4NMHA 3I52A 1JAYA 1MXHA 3C1AA 2OL4A 1OBFO 3AOEC 3LF1A 3WWZA 1NHGA 3DTYA 4NK4A 5JO0A 1Y6JA 4NBWA 4DQVA 5L7WA 4BO8A 1QORA 1IOLA 1E3WB 1WVGA 3IJPA 3RJ5A 1C0PA 4MVJF 3DMYA 4I1IA 2V6FA 1H94A 3IMFA 5TNXA 4CUZA 5TGDA 1JDJA 3COSA 3KEQA 5DCUA 5KKCA 3I9KA 1KEUA 3GGOA 4LRTB 2JD1A 2Q22A 1XA0A 2Z95A 2X5JO 3K6JA 2ET6A 3QV1A 1HEUA 4CLOA 5I9LA 4OAQA 4J1QA 2AEFA 4AJJA 2CMDA 1LSUA 2NTNA 4W6ZA 5TJ9A 4TMFA 3U4HA 3PYLA 4RQUA 2PZKA 1GYRA 3WNQA 3U49A 5CAEA 2B4RO 1R4MA 3VZQA 3RROA 4D44A 4HP8A 1U8FO 1KEWA 3D1LA 4XR4A 4D7AA 1IY8A 1V9LA 1YQGA 3ANMA 3FCOA 1DDOA 3H8VA 2FZEA 3P19A 3IIEA 1ORRA 2O3RA 4K6CA 2AXQA 3PWSA 2UV8A 1A7AA 2VWHA 2DC1A 1DIHA 4PVCA 3EGOA 3JQBA 4ALLA 5A9SA 1GEEA 4E13A 1W6UA 1YDEA 2ZATA 2HLPA 1HLDA 2B83A 3U4DA 4Y6PA 1HTBA 4BGVA 3DFZA 2EJWA 3GMSA 4MVJD 1UXGA 2JJYA 4MP6A 1PZEA 1ZNQO 3RUAA 3I5MA 1U9JA 3PHGA 4PN3A 3GEGA 5KTKA 3DBRB 4LCEA 3OJOA 1I36A 1JW9B 3Q0EA 1K6XA 4RVHA 1EEHA 3RFTA 4A03A 4JBHA 5BNIA 2CF5A 1FDWA 5TX7A 1N8KA 3DONA 3WFIA 3NRCA 4ILKA 3I6QA 4KUEA 4B3JA 1JQBA 4JXKA 2YYYA 3L4BA 3H2SA 3FNHA 3U3XA 2QRLA 3MJEA 5IDXA 4N5NA 4DYVA 1GU7A 1FDTA 1MFZA 3LU1A 3LT4A 5HA5A 5T5QA 1LLDA 3C85A 1UAYA 1R0KA 4XRGA 4ZA2A 1B26A 4J7CA 3ZNOA 4JNKA 3WMXA 1V3UA 3WJAA 4BO1A 4GWGA 5MDHA 3CTMA 4BNFA 2XXBA 1YL5A 4RV9A 4GVLA 4UVGA 1VKOA 1X7GA 3GNTA 5L95A 4YT5A 5T73A 3OJFA 3MJVA 2O7SA 3OHSX 4MVJI 4GKBA 4U6SA 3QSGA 1NPTO 4PLGA 4ZHSA 1ADFA 1CYDA 3ZWMA 1NQ5A 3ROKA 2CVQA 3HDQA 4WKGA 1KBZA 2SCUA 3JQ7A 5CFZA 1Y7TA 3AW9A 3OEWA 3M2TA 7MDHA 1UDCA 3GFBA 1R0LA 1CF2O 3W4IA 1LDEA 2PFGA 5DNAA 3I6IA 4YQYA 1HDOA 1N2SA 4GPD1 3GAZA 3PWZA 4RLSA 3O9ZA 5DCYA 3LF2A 4OGWA 4CLOB 1EUDA 4E6PA 2GD1O 5A5FA 3SEFA 3ULKA 4U8GA 4Y8VA 3FR7A 1ZXLA 3OQBA 1M2WA 2OORA 4Z0PA 4IXWA 4IDBA 4FR5A 2C5AA 1PU2A 2E49A 3IAHA 2QZZA 1B8PA 1FMCA 1NXQA 3AI3A 4P4LA 1ZK2A 3JCZA 3C7CB 3QRWA 1ISMA 1L7EA 2DFVA 4PLWA 3ZZNA 4R1TA 3RUFA 4BO5A 4AJ4A 3H9EO 1PGJA 1NHWA 1MC5A 5ES3A 1ZK1A 5L53A 2ZTVA 1PQUA 3E48A 3MWEB 3BTVA 1E6UA 4HKTA 3ZH2A 5ER6A 1DIBA 1I3LA 3OIGA 4Z0HO 1GUYA 1PZGA 2RIRA 2EW2A 1IYZA 4HWKA 4PLZA 1FK8A 4BNKA 2Q2VA 4OXYA 3M6IA 2IEDA 3I9NA 4YAJA 4DLAA 1VJTA 4O0LA 1DC3A 4FC7A 4NR0A 1JKJA 3WYCA 1NP3A 1F8GA 1I24A 3F46A 1E5QA 5TRTA 1PL7A 2G17A 4YT4A
chains in the Genus database with same CATH superfamily
3DHYA 1RYHA 1S7GA 1P72A 5DP2A 3UBMA 3X2EA 1B8OA 2CVPA 2C57A 4TZTA 3DR5A 4PGMA 4QBHA 3W1EA 3AU9A 5HBRA 4OO3A 2E4ZA 4IIGA 5AM4A 5IUNC 2XUFA 4QPJC 3ZCVA 3GEDA 3UKDA 1BYIA 3EXAA 3DKVA 5J3JA 3WIUA 1VPWA 1TNDA 1IB0A 2ZAGA 4U2FA 3RREA 4BMZA 4U7PB 5TQ0A 2Z2IA 5JAMA 5L9AA 3I92A 2IDKA 1CXZA 4Y0NA 4XPZA 2AW5A 3WLRA 4EI7A 4MUKA 5ULLA 1T3GA 5K8VA 2VZLA 2ZROA 3QKRB 2WIKA 4IDEA 4WLUA 2FFRA 4Y9RA 2GH1A 1OF1A 2H4ZA 2AC7A 2J9ZB 4BPRA 5AJTA 1W4AA 5HJ2A 4Q93A 4CM7A 1IULA 4G1CA 3KQLA 1Z4QA 3ONWA 4NMLA 4OL0A 2OG1A 3H3FA 2BGJA 3FLEA 4YI3A 1NI5A 1R0XA 1YL6A 3EVDA 1ZM2A 2QX9A 3TJMA 1Q57A 3U3OA 1GILA 1V1RB 3TSCA 1D0SA 1R66A 3ADDA 2O07A 4U7FA 2GHQA 1B1AA 1R4ZA 2Z83A 4CR8A 2GZSA 3O95A 2HX1A 3TTSA 3WDLA 2G40A 5M29A 5IC4A 5CW2A 3ZUGA 4XIYA 1SVLA 1EINA 2XW6A 5JWRA 4KIFA 4TSRA 2PXXA 1BKYA 2IYYA 4YJ3F 2IU4A 3T7DA 3U80A 4A2QA 4AXBA 5B1YA 5KHAA 4TVSA 4LSMA 5JLJA 1AXEA 2IW3A 5KSOA 4HC4A 4J4TA 1CZKA 1OLOA 1AS0A 1BHJA 2B6NA 2QAIA 3NDPA 2IWHA 2RJNA 3AERA 4GMHA 4A73A 4HCJA 3Q3HA 5IVDA 3ZDAA 1V45E 3L6DA 5IHPA 1I6WA 2HDNB 3GZTB 4B4KA 2VJCA 2XA1A 3FOBA 3QNWA 4I50F 1SCIA 3NATA 4P0PB 4OFXA 5M5BA 3DDHA 1EDOA 2AZ4A 3FDFA 5LOVA 3D3NA 3W5SA 1R0WA 1QIIA 2V5VA 1VBMA 3OZRA 5FOWA 3SXUB 4WAUA 3TUJC 4E33A 2BBOA 3VR0A 1XE3A 4CMIA 1E1MA 1LBEA 2JBWA 4RTKA 1TT5A 4K88A 1OBOA 4ZODA 2XECA 2IRWA 1O2DA 3PNVA 3RT7A 2REOA 1IXZA 5JHHB 1LVHA 3F1LA 1Y8CA 1UOOA 1ZWKA 5HPYB 5DISB 4LY0A 1H6CA 2GX6A 3PC7A 2RHLA 4KKXB 4RDHA 1OPRA 5EWLB 3P26A 5CT9A 1B0ZA 3PEFA 5SYAA 1GPH1 3UAXA 4HLNA 4KC0A 3O94A 4CMJA 3NYQA 4UUNA 3UANA 2IXAA 3BD6A 1MORA 4I9FA 2GYWA 1S2OA 4RZUA 1TC2A 3BHIA 3UJAA 1WE2A 3LZ6A 1KBOA 2A92A 2VN8A 2XUHA 1AN9A 5U1PA 2L18A 5F98A 3DTNA 5E95A 1TDJA 2COUA 2DR0A 4KQ9A 4A8HA 1IH8A 2WUEA 3Q7IA 2F1OA 2ZJAA 2FMXA 2QW8A 4OP1A 3AYZB 1J00A 4RENA 4Z1OA 1YOVA 3JYQA 3D6UA 1EK0A 4N39A 1Q22A 4BJ3A 5BRJA 3GF4A 2VHWA 3V8VA 4DF3A 5JCZA 1L8XA 3EDYA 1E4EB 1CUCA 3QVMA 3WK7A 1GZ4A 1I1QB 4JVNA 5HIJA 5JXWA 4MKZA 3PYXA 3ZIAA 2I9KA 1LK7A 1VB3A 2QD1A 2HY7A 2QRNA 3TZEA 1KZ4A 1GZ6A 3FYSA 3H6GA 3MWLA 4N7MA 1FSZA 1P2GA 3T4PA 1L5NA 2OAGA 1V43A 5T64A 4E11A 1WW3A 4N1AA 4HUTA 1BW9A 1CK4A 2C5HA 2I1LA 3GGSA 4HMOA 1XCPA 4PSKA 4YCJA 4BNJA 4BJ5A 4NCIA 4PQFA 4LW8A 3V34A 4HVLA 4UTRA 1USVA 4UFPA 4YV1A 5D86A 4P7GA 1PSWA 1XGKA 3KYCB 4TYNA 3KJZA 1CJVC 5E3HA 2WVJA 1VE3A 2JLSA 3WGUA 4WFIA 5CR9A 3C4VA 2P30A 3OWHA 2REBA 1BNCA 2DBRA 5K0BA 1M72A 2VHJA 5KCMA 4N5IX 1BG6A 2ZZMA 3HKBA 5HWSA 3H5NA 2JHAA 3PENA 3THYB 1EUCA 5AHRA 4A6PA 3OQVA 4CT4B 3WK4A 4HUQA 1CR1A 3ENQA 4MRMB 4WK6A 4LEIA 2IYEA 3UGQA 4FKZA 2F48A 3N8DA 5K01A 3RI3A 3UZUA 2DETA 4DQDA 1OAAA 1QHHB 1NX9A 3DGEC 4YAEA 1CQIB 3M1YA 4A8TA 2YXNA 4EP1A 1WDMA 3OPYI 4XQ9A 3K15A 3ZEAA 2VKTA 1KH3A 1Q15A 5BSEA 4FE3A 1V8BA 2HCTA 3KYIB 3MT8A 2YICA 2IBSA 3AFIA 3GYBA 4KDRA 5AK3A 4LXIA 4M1SA 5AH0A 1NP6A 3FWYA 4TQAA 3DZ4B 4O63O 4BEVA 1HR0B 4BV2A 4N9WA 2BGGA 2HKIA 1ULUA 1C3JA 3C3XA 3MF4A 4C07A 5K51A 3UJ9A 1D4FA 1FP7A 4RJKA 4C4ZA 3G8BA 5AQ1A 4FILA 2IYFA 2QHXA 1B3BA 2BGIA 2ZS7A 3K2QA 4HLUA 1GG8A 4NU0A 4Y30A 4YJFA 4B47A 4HRAA 1IL0A 1UKCA 1M54A 1UBFA 2O2DA 1RHKA 2IKSA 3ONDA 3RKRA 5KKNB 4FYMA 2AG6A 1TM4E 1PGOA 3I8OA 4YDRA 3ZLUA 2CUZA 1BGVA 3HJTA 4LTNA 5JMPA 1NC3A 4C7XA 4RTSA 2XF8A 2MHCA 3C6XA 5JFTA 4Y6OA 4PG5A 1RVDA 2EQBA 3CKYA 4D9GA 3B1XA 4JT4A 1JFLA 1RZUA 4G0ZA 4GU5A 4AO7A 1VXOA 4KOAA 3INYA 5KJCA 1E89A 1ISSA 2QORA 1FL9A 3ESRA 1T5BA 3DDZX 1ZONA 4HYTA 3LVQE 3PNQA 4UAVA 3AF5A 1QLJA 4RS3A 4KYTA 5ALHA 1U28C 3K6SA 3SDSA 4L9WA 2J7PA 3C0KA 4R6XA 4C01A 1JQ3A 3CEAA 3I9MA 4KQCA 4Q7EA 5EZQA 1N57A 4LXQA 4P36A 2DT5A 1DQSA 2FPPA 1RR6A 1GL6A 3F8WA 3VA7A 3BDVA 3HSYA 3ZVLA 4HDCA 2AQIA 1RAIA 1QMGA 2GJAA 2F9MA 3CM0A 1LI4A 2PD6A 1ZICA 2ZWAA 1SOVA 3KYDA 4CF4A 1RKXA 5HRCA 1FFYA 2ORYA 3M81A 4I6JA 3GH3A 2JEZA 3CLRC 2QSZA 4UTOA 2FKNA 1ZN2A 4B40A 3NCHA 1CUWA 1GGJA 2GBFA 1U02A 3CRZA 1OFGA 3VR2A 1SXPA 1E66A 1F4LA 1NYTA 4OHKA 1GSHA 1EWVA 4G2TA 2Y1OA 3ZWAA 4AP6A 1JEOA 1NFRA 1RABA 3A6ZA 4H7KA 4O6VA 5JDCC 3THSA 1Y9ZA 1YRYE 2K7FA 4PTZA 1WMSA 3AY7A 4KLNA 5C37A 2V6GA 3FKSA 5I9IA 2DUNA 2G09A 2ZQYA 5ERXA 1DAOA 4E4TA 3CLUD 4B9EA 2BR5A 2Q1WA 2ZRCA 2B0JA 1T8TA 3NTVA 2R1TB 5DHSA 1O77A 5E3IA 1CR4A 5I51A 4OVKA 3UYLA 4MWSA 1F6WA 2ZSDA 5DHQA 4EA9A 1XFDA 2ICAA 2VJYA 3DKPA 4X44A 1DTSA 1FFDA 2DUMA 4OY3A 4JOCA 4Q19A 4W5NA 4PN7A 5KJFA 1ZNYA 2W0SA 4OQPA 1FYFA 4KL8S 2V7XA 2WF6A 1J0DA 3EISA 2I29A 3K0FB 3K8ZA 1JRLA 4JDUA 4JT9A 3B53X 4MQFB 1L8LA 2VDNB 4L6CA 4L4UA 1TD9A 3E3NA 3O8DA 3I9JA 1XR3A 2IUEA 5G4LA 4ZDIA 1O0CA 3QVGA 3ADBA 3KT6A 2IYSA 1DC6A 4FHFA 2ERCA 2OO5A 4OH1A 2IF2A 1ZEJA 3KUCA 1BZYA 3C14C 4AU1A 3SQNA 1LBIA 4B09A 1IPEA 1YE5A 2A67A 3E9NA 1X1CA 5BV0A 2WWWA 4N5MA 2AN5A 4WBSA 3ZDRA 2YWRA 5HGXA 1WBDA 1QU2A 4CLDA 2NZ2A 4UVDA 2QAGB 2BZGA 3KSZO 2GDJA 4JX8A 3QOWA 3T1TA 4TLMB 3NOXA 4ZOAA 2Q6VA 2QG9A 3ZDXB 1EUCB 3TTWA 4BV3A 4F71A 2E5WA 4R9VA 1R4NA 4DXHA 2V03A 5A1JA 2VHXA 4LDNA 5F5LA 4E2ZA 2BHRA 3DOCA 2QAGC 4NQZA 3LHFA 2JANA 3AHEA 3HCAA 2WTEA 4O2LA 4QOIA 5JY6A 4DUGD 2C31A 4I1RA 5DK4A 3PIRA 1PVDA 1YI8A 2G82A 3QHAA 4OHUA 4TRNA 3TFQA 2GJ9A 4UNIA 4EY8A 2V7GA 1MT3A 5IWCA 5CM8B 2XQFA 3BMNB 1I8TA 4DQKA 2IS4A 5TS3A 4Z3KA 5BV2P 1CY2A 2HXYA 1TADA 3LDAA 5AYVA 4KO8A 1USKA 3CLTD 3R3JA 1XCLA 4BMPB 4RH0A 5HE9A 5KOJA 3TMYA 1VCHA 2C96A 4OIFA 1I4DD 4WINA 4B71A 2JARA 4DNPA 5JRZA 2B78A 5PGMA 1P2SA 2E37A 3D0OA 4E5YA 3A1WA 2R6R1 4D3FA 3JVUA 1LK5A 1N0IA 3QY9A 4EUSA 1BMFD 1YCHA 1GIAA 1HDYA 3G2JA 5BN5A 2GAOA 1XJWA 4JA2A 2R44A 4UEOA 5JHGB 5D6OA 1JHVA 3C6ZA 2FMUA 4CG1A 4ZN6A 4Q4HA 1T13A 2ZSEA 1UT5A 2RH4A 5DASA 2GETA 5GY7A 4ASUD 5JS8A 1JEYA 1MKYA 2XGMA 2CLFB 5JEEA 3DM5A 3NORA 2GAIA 4NNOA 1VE5A 4BHTA 1OH6A 5HIIA 2XQJA 1BHQ1 2H17A 3UMSA 1TO6A 1YUBA 1J1ZA 2DPLA 4BDTA 2ZBDA 5FLXA 4MQEB 1C80A 2NLOA 4D79A 4W6QA 4FEYA 3R7WB 1PDWA 1W6RA 2RK4A 4L8YA 4LYAA 5EN4A 3HXMA 4KWEA 1YE3A 2VP9A 1I3OA 2ID4A 3AF2A 1BFKA 3RYCA 4YRKA 4ZFNA 2NXCA 4DPLA 4MB6A 4MRPA 2IBMA 3VKUA 5K05A 13PKA 4LNUA 5BN3B 4CHTA 1BVUA 4GBJA 3LGXA 3TBHA 4D8TA 1UDWA 3KYDB 3W5JA 1T8SA 1FF9A 3MPOA 2RARA 5GAJA 3Q2IA 1E1NA 2DUJA 3HL4A 1GP2A 1YIOA 3FIJA 3OU7A 2NZ8A 3BEDA 4PYJA 2YWJA 2JRCA 4YRNA 4KO3S 1EVKA 1OIWA 1T1IA 2HCFA 5IM5A 5JS6A 1NUTA 3N2YA 1CUSA 2PY6A 4TUYB 3RIYA 3RUHA 3EYAA 5HNKA 1B8VA 1BX3A 1TKCA 1GFIA 1WXXA 3NONA 1KEEB 5DB4A 1A8SA 4TLDA 4YMIA 3U9TA 3P32A 3GGJA 1PQPA 4P3OA 2CLIB 2ZVPX 1L7RA 1Y1PA 3FE2A 3IAXA 4XUGB 5JH7B 3ZV5A 4ERXA 4IGAA 1PZFA 2DSNA 1N5OX 3CUEF 3GN1A 3RFXA 2UAGA 5J2UA 1AU9A 4H27A 3WA6A 4D0GA 5T3YA 4NU6A 1ZCAA 1HT1E 3MRSA 2JFZA 2VP6A 2K7ZA 1KMIY 4D4IA 1KGSA 1GFZA 3KJHA 2ONYA 3QX7A 2X2OA 1CUBA 1DHRA 2ZUDA 1NUSA 2P79A 3LIPA 2FP4A 3SSMA 1X6VA 1EZ1A 2I66A 2DR2A 2NWQA 4MHTA 3T1HB 5AXAA 1ULAA 2QYOA 3KVVA 3FUVA 3M4XA 5EIBC 1OW3B 1H1TA 3B82A 3HADA 2BFBA 3LIIA 2VTBA 3DC2A 1OI2A 4I50B 4Z4EA 1DFIA 1SO8A 2HMYB 1N5MA 4GP9A 2Z8YM 1JYFA 4W1PA 2ACKA 3SJCA 3PQ5A 1N6LA 3JVVA 4MQEA 1NI4A 3IP3A 1N2CB 4O4IF 4UDXX 3ABOB 3TBKA 2P9CA 4XIFA 5JRJA 3HCBA 1I6LA 4RVCA 2XY4A 3JD2A 5LXTA 5HMLA 1X38A 5IU6A 5K3OA 3WGHA 3D31A 3RTGA 4Z8YA 2GCGA 4UUQA 4EPRA 5L45A 1MEJA 2ZYGA 3DEFA 1DBSA 4KQMA 1SGWA 5EXDA 1Y3CE 2YHSA 3B20A 1AVTA 2FMFA 3K0KA 2M6SA 1ODFA 4DVJA 1XNGA 5EQDA 2MSKA 4TQUS 3S68A 2RAFA 3V8EA 1DO0A 4Q4AB 4BVBA 2G67A 1K7YA 2HJVA 3Q8XB 4IQ8A 1H5QA 3JQRA 3T5PA 4N6NA 3CE6A 3BAFA 4UJ5A 3WBKA 5IYZA 3DE0X 4MQMA 4DSOA 4F1WA 2BELA 3TTXA 3CRQA 2C2XA 4JGBA 2BHSA 3PDUA 4GBED 4OHZA 4RQBA 2IS6A 3PQ6A 1FUKA 1TRHA 4XASA 1QONA 4GLLA 1TA4A 2H0AA 1HLFA 2F1IA 3QIAA 3D8TA 2OHIA 1Z5VA 3Q7TA 1NR5A 5HDBB 3RVMA 3VU0A 4KWTA 2FF5A 3M34A 2H54A 4H1TA 1TEXA 2G71A 2L19A 4NESA 2CC2A 3HDYA 1ID1A 1U1EA 2N42A 2HSDA 2Q9UA 2YN0A 4TZKA 1QTNA 2WJZB 3EULA 2AI3A 4UE2A 2WF8A 3P9ZA 3WSWA 3EMVA 4D3SA 1KETA 2JGFA 2MIIA 2QQFA 3TSZA 3LWBA 4MWEA 4C30A 2A58A 2XUKA 1FTGA 2OK8A 1HE1C 2EX4A 2WTAA 3QENA 4RD2A 4E21A 4DCSA 2F64A 3OFKA 3OKAA 1KOJA 1QIJA 1IHDA 5JECA 1W5TA 4ZHQF 4RE5A 1KQNA 4KV7A 3FSJX 1GCAA 1P4SA 3OT1A 4MPJA 2X3UA 3WSVA 4YIHA 8MHTA 2PJDA 2J7PD 1WXDA 3BAZA 4KIGA 4XH9B 3ZN2A 2P11A 1QFSA 2B1GA 4LXXA 2A3RA 3C2QA 1LRJA 4LE1A 4I4IA 5TARA 1Q7EA 1TKBA 2OBXA 1E7QA 3OTIA 4DHWA 3OBIA 3PP8A 1NN1A 2X0JA 5HR5A 1FFCA 1T5IA 4MPDA 4JV5B 2XYRA 4UUOA 2WE7A 1D6JA 1F0NA 1MF7A 2FJ0A 2IIBA 3PRHA 3A1TA 5AMXA 1RRPA 2W8ZA 5GVRA 3B6JA 3DOJA 3GJ6A 3BM5A 3L7YA 5AW8A 3SIXA 4PG8A 3VVLA 1E1CB 1T24A 1KZ7B 3U3RA 2HJRA 3U6KA 1RRKA 5HF8A 2I33A 4FT2A 2SKCA 3MCWA 4LQ4A 2NXJA 4JSYA 1TQ8A 4ER5A 3DFUA 4IMRA 4I8XA 3TSAA 4YPFA 2YW9A 3W8EA 4EHAA 1Z2NX 4JC4A 3SAJA 3LUCA 2ZBQA 5KI6A 4C89A 5BMVF 2ZJFA 4IDNA 4EG0A 3EH1A 3OOEA 3HFRA 2W6NA 1RWWA 4ZEOA 1KPGA 2OOKA 4QKQA 1A8HA 4L5YA 3WY9A 2DBZA 1CFZA 1JEAA 1PDVA 1UKAA 1YV9A 2AD5A 2FMKA 3V00A 1M6HA 1II9A 2RI6A 1U7UA 4IW3B 3WLPA 1ECBA 3ECCA 1EVZA 4E5VA 1DC4A 1QHXA 1VFPA 1P17A 3M49A 1QB8A 1HK7A 2NV6A 4X1YB 3T7JA 4LSGA 3WWOA 2E5LB 3HJHA 4PBTA 4IVRA 3HDVA 3AKZA 1J8FA 5IKMA 2PH7A 3EMKA 3EW7A 4ONEA 4I8IA 3OZCA 4J2HA 2WSMA 4D02A 2EQAA 3EZLA 4XOIA 2WFAA 4QPPA 3T9CA 5ADWA 4XQGA 4ZP1A 4HB2A 2IEBA 2C42A 1ZK3A 2QV0A 2PANA 5D84A 4BFTA 1GZ3A 3KC2A 1RP7A 3WFZA 4I7EA 8LDHA 5LA6F 3OZUA 3ZPXA 1XCGB 3GFOA 5EIOA 1Z83A 4LDQA 2NU8A 2QUZA 3KHUA 2DFNA 3UQZA 3W5UA 2XT6A 1BHSA 2FEPA 4LOAA 3L0YA 1F2TA 2Q46A 3L7KA 1SHUX 4PICA 5MGBA 2IC5A 1J49A 3D1VA 3PCXA 2ZSJA 2J9XB 4CIDA 2P35A 3AR9A 3HB9A 4ZTZB 3Q8KA 2C3PA 2YNMA 1FY2A 2PLNA 1FJHA 2VBFA 2C84A 3DOOA 4GMKA 2VTDA 3QV2A 2B5OA 5HJ5A 3BIFA 3EUAA 4BWYA 2Q2OA 1C4OA 4N8SA 1RWQA 3WIVA 3O3CA 3JQ8A 1HE2A 2V6IA 2GHTA 4M46A 5CYOA 3IILA 5CXQA 2PSFA 1ZH2A 4IAOA 2A9KA 1HYGA 4BE7B 2IYOA 3HNOA 3PLRA 2B6HA 1Z0UA 3ZIAD 3ZD6A 2Q9BA 1NVKA 2II6A 3F5QA 4NOMA 4WOPA 2QNIA 2DYKA 4IKOA 3SJUA 3UUEA 3HYRA 4F46A 4QDKA 2NSJA 3DP9A 5LZ8A 2O8BA 3LVFO 2RHTA 5A9RA 4DW8A 2ZSFA 1TMGE 3VH3A 2M6LA 3G1UA 1EP3B 1N4DA 2J0UA 3T99A 1DKRA 4IXDA 1AKYA 3VOBA 1KTVA 3FPGA 1U1IA 1FRZA 4DM7A 3G2KA 4WJLA 1ZWLA 2YW2A 4OYHA 3FH0A 1PLLA 1PUIA 4FHZA 1LTKA 4TKZA 4HGYA 5CX1A 1YO6A 3WV5A 4QHSA 4WTOA 2ZU6A 1GPAA 2RAVA 3WTCA 1PSZA 1BOFA 2DRIA 3IVCA 4KWIA 3PJGA 1X7YB 3IKJA 3HV2A 4H3SA 3EIOA 5EY5B 5I5EA 2BFDB 1D4OA 2EYUA 2ACVA 3LX4A 5A04A 2Z3ZA 4E09A 2HHJA 2NZYA 3JD4A 1E5XA 2E3JA 2C9YA 3ET5A 1OA0A 4F4UA 1IBSA 1LV7A 1CIVA 2GZDA 3DKIA 1K8ZB 1NW4A 3PHHA 1ZI9A 4KE6A 4OQFA 3GLGA 3MS2A 3U60B 1MVOA 2Z5FA 4PCVA 4QSHA 2VXYA 4BWFB 2QN7A 3M6MD 5F78A 1VPLA 3ED5A 1QS0B 3OVMA 3QMWA 5C5IA 2ZGVA 2NOAA 2QD5A 2BF4A 4OKNA 5BV8A 5KYTA 2XCQA 1WF6A 2ECPA 5HM8A 2X0IA 1REQA 3WDMA 3AHJA 3GFVA 1FDRA 1Y8RB 3ESZA 3M3HA 4ZYZA 2X86A 3K0EA 5M04A 2YL2A 3GY0A 3EP9B 1T8YA 4ZZ2A 1BWSA 1PSDA 5EHQA 3LYLA 4BX3A 3FI0A 1JIIA 4DTCA 2E6UX 1YL7A 1EHYA 2XV1A 3PV0A 4IIUA 5ARCA 5ISMA 4OLBA 3RUDA 1GA6A 1AZSC 4M8IA 3KGDA 3A58B 3EVFA 5EPOA 5JTUA 3KZKA 3O1LA 1H8EA 1YGPA 3LX5A 2QPOA 4OATA 4HATA 1RMQA 3GRCA 3KQWA 4U00A 2X40A 4CTOA 3KHTA 3KPWA 1BE6A 3NALA 4BMDA 3KQNA 5FADA 4FW9A 3IDFA 5JNUA 3LQYA 4P38A 2Q45A 2ZCUA 4FEGA 3ND6A 4XUDA 1EWTA 4BNDB 1GPJA 2XQVA 1QZTA 5LQRA 3DZGA 4NTZA 2Y68A 3UUWA 4GI7A 3DMPA 2UYGA 2XTMA 4IX1A 2J9FA 4QUJA 4V38A 4J6EA 4F1JA 1PG0A 4II3A 1WAMA 1K2WA 2I87A 2ODPA 4H15A 1JHXA 4N8DA 2W70A 4AVYA 4MUYA 2JBHA 3UC5A 3D4NA 3OQ6A 4PYNA 2B25A 1FDSA 1XD9A 5K3FA 4E46A 1SWVA 4QPDA 3CJTA 3SBOA 1H0RA 5HUQA 4CL0A 3DXFA 3H9QA 3G2HA 3PHLA 1WZ2A 3WADA 5D3MA 3GLHB 2D2EA 2PS1A 3E9EA 3QMVA 1WBBA 2DE0X 3NKVA 4M8SA 4MYSA 4U9UA 2B8TA 3KDPA 1OHHD 2UUOA 4BMXA 4CU5A 3A7EA 3S44A 3CA8A 1P1HA 3O1JC 4WWHA 4UARA 2IV3A 3OG9A 2W22A 4TSKA 1F6DA 2C7VA 1JHYA 4HBZA 5DI9A 3TINA 1QSGA 4GMFA 4KVZA 1KARA 1DBQA 2P9GA 1KR5A 1T0HB 4IXTA 3VR3D 3W3AA 3ZHSA 2A0FA 2QRPA 2ZTLA 3L8YA 3JYLA 3BL8A 2VTVA 1SXJE 3SZOA 2O3TA 1GQ2A 4QPZA 5KPJA 2WOJA 5THKA 4RTJA 3DZ5B 3AFNA 2WV9A 1ML4A 3NM5A 3IBGA 3EFOB 1XVUA 1MTOA 4YLEA 3TM4A 4A3SA 4KFUA 2PYDA 4FE4A 1JZTA 2BDTA 2QMUA 4HNTA 2XB4A 2RC6A 3PG5A 4FI3F 3WP1B 3KOUA 1ZGJA 1P31A 3OO0A 5GOZA 4E5SA 4J0JA 3C1OA 4ZIRA 2F1JA 4KP7A 3GIDA 4DANA 4E2XA 1AQUA 1BOOA 4UFNA 1CY0A 2V98A 4JI5B 3B9BA 4XW2A 1XF1A 4YRAA 4KE8A 1ODLA 3SBXA 5A4KA 4LYDA 2W90A 2NN3C 4N0EA 3SKVA 1XELA 1L7OA 4CIVA 1BJKA 1OWNA 2A5LA 1QKJA 3CJQA 2A0UA 4OA8A 4CVNA 1OWOA 1QHIA 2QP9X 3DNFA 1K9SA 4II2A 4LE0A 4V0SA 4CI9A 3OQIB 4XYEA 4QD3A 2DX7A 2JJQA 4P7KA 1KK2A 2AI1A 4AY2A 4EW1A 5GZ6A 4RVNA 2GRJA 2QXYA 1GARA 3LW7A 2V7VA 1J25A 3O91A 1LZLA 3M9LA 4E15A 5JADA 2VQFB 4JHXA 3TLXA 2AWOA 1YKFA 2GCIA 2CBZA 2GPYA 3I1JA 1PBNA 2FRXA 3SFZA 5KWJA 1WCV1 2HMWA 4IZ6A 3SD7A 5MN4A 1XZFA 1E8DA 2FEKA 2LIVA 2CFTA 4HI0E 1VE6A 2D54A 2DWQA 1EAYA 2C3UA 4MGIR 2WP0A 3Q3GE 4RHXA 2O2HA 1U8AA 2WIDA 4HVCA 3T3NA 3KTFA 1N3IA 2FPIB 2G0NA 3E18A 4DABA 5KB3A 3HTXA 4RD0A 4JJGA 3KIPA 4YQEA 2YKGA 2CWDA 2WHXA 2PFSA 4NAUA 1EE2A 4QDXA 3H84A 2POQX 1HDZA 1V6SA 4MLCA 4BLTA 4BFLA 3CEJA 3UJNA 1CY4A 4C3ZA 1I1OA 1W4ZA 4IS3A 4YC7A 5E38A 4Q5IA 2FLWA 3GDHA 3KP1A 4XIJA 3C3DA 2HZBA 1Q44A 1DG3A 2IYNA 3H2IA 1QKIA 4HYQA 1KDTA 3KOOA 3FB4A 2PD3A 3N39C 3KJEA 4KQEA 2PUCA 3MNFA 4FXOA 1P6UA 1LDNA 3LCJA 2FZCA 2HIMA 3WVNA 1XD2B 4GQBA 4PZZA 4XTCS 3D4BA 1FA9A 5AVSA 4AECA 4EYEA 2ORWA 1T3TA 1GCIA 4PCUA 3O90A 3T5TA 5CFQA 1JI3A 3FPSA 1JSXA 3JSXA 3MPUA 4HXGA 2DGDA 1XNHA 4Y2GA 2VAXA 2J48A 4WE3A 3BRWA 4J1TC 2B2CA 1IZ0A 4CPDA 2J5KA 1GRQA 3HWRA 3PD1A 4W9NC 5GJBA 4UE3S 5KNBD 1FLNA 4CM9A 2JEYA 3HLTA 1C9YA 4YHHB 2VOEA 4I6GA 3KETA 2OHXA 3HYSA 1Z0ZA 4TMZA 3PKJA 1DOAA 2A0XA 1H2ZA 2WG2A 3QZUA 4FJ2A 1T4MA 5IUKC 3S55A 2CHGA 4ZTBA 2H1RA 3L6EA 4MH0R 4Z9YA 5KJ1A 4ZOCA 1JIJA 2QUAA 3GJ0A 2NZUG 1XLTA 5JNSA 4RTLA 1RYMA 1UZLA 1GV0A 2QN8A 3EUFA 5H80A 2HHCA 3QVSA 3U7IA 3I12A 3OJEA 2HGSA 1Z9BA 1TM7E 3HXQA 1PFYA 4X60A 2TSYB 2C9MA 3T1QA 1A0OA 5CNIA 4PFSA 5B7QA 1YB4A 4XUCA 4JBYA 2BL4A 5JC1A 1I9GA 3NGLA 1NBMA 4P35A 4L0QA 3KZMA 4ZHQB 2ZKLA 2R68A 3UAYA 1ZOSA 2FZGA 3FMGA 2GA8A 4IIDA 2MR5A 1V39A 5FI0B 1XMJA 1XZQA 4UVIA 4JBGA 4XM1A 3I9OA 3QWBA 1T9DA 2CV0A 3O0TA 3DR3A 4O25A 3Q0IA 3PQFA 4W63A 1DC5A 1PE0A 2PKQP 5L40A 2J31A 2J85A 1GTL1 4LRXA 1D2HA 1KP9A 1P1IA 2VK8A 2Y05A 3MUEA 4MQUA 4TTIA 4XSVA 4ZCPA 3ZIUA 4MK4A 4LJSA 1MMFB 2I2CA 5I3ZA 3E70C 2FSVC 4DSAA 2GMWA 2WDZA 1CERA 3UAVA 3VZSA 3MGAA 1SCQA 1YR1A 3BZBA 1N1GA 3A05A 3CW8X 4Y1EA 1XDSA 3PWTA 6LDHA 3B1YA 3PICA 4K8RB 4A6DA 3RRNA 1EFVB 1R6VA 5HOEA 1JGTA 2HBRA 3H0WB 1UZAA 2AA3A 2PUFA 4IFIA 4I5FA 2WLTA 5B36A 2D5IA 5F4BA 2RH8A 4KE9A 1DEXA 2Q2QA 2VZ8A 4EJSC 2PYIA 1U0TA 2PRKA 3IRUA 4MQFA 4POAA 5LFAA 2HREA 3CNNA 4OI0A 2GXUA 4LC1A 1GSOA 4K2HA 1YD7A 2Q62A 2VYFA 4BUZA 5BR4A 2CLKB 4J7XA 3PNYA 2KBEA 3FBWA 3R09A 1QKKA 4TXJA 3P2EA 2OQVA 4B8WA 2AYYA 4RQAA 1U80A 5FORA 4AY4A 3GZ4A 2ZJOA 4ENSA 1SD1A 3U4IA 3S2UA 4LG1A 2IU3A 3UO8B 1P44A 2H2DA 1TAQA 1Q2XA 1WMDA 1FC0A 1SCUB 4MUFA 4C6HA 1QHYA 2GPJA 2JVKA 4EHFA 2IXFA 1X86B 2Z98A 3KPUA 3VO2A 1BD3A 4BFWA 2B1JA 1AA6A 2J07A 1G66A 3RO7A 2IHVA 4BU1A 5CDGA 4YVFA 3ZGNA 1M83A 2XE7A 5D5PA 4EMBA 1EK1A 2NUBA 3B7GA 3L79A 4WECA 5LM3A 4DV6B 4F5DA 1TJPB 1V48A 3N8HA 1HUQA 5REQB 4BFYA 5K0LA 1E4VA 2VCEA 3EEIA 3GJ8A 3P0RA 4NPHA 5A3RA 4DAOA 3GELA 3A37A 2ZR8A 2G4VA 2VF5X 2G0TA 3IBCA 5KJ6A 1WETA 2B4TO 1IVYA 1V9SA 2G5GX 4R1NA 5EGSA 4LDRA 5IFKA 3E4CA 5DN6D 1MRNA 4G3XA 1KIAA 1OGIA 3TDKA 4MCHA 4XQCA 1DE0A 3F71A 4MI9A 1C7FA 4Y6QA 4JSTA 3UATA 5HYVA 1KXZA 3UAZA 4Q39A 4B85A 1RCTE 5KSPA 4DEXA 1P2TA 2FPWA 3B3JA 2AQKA 4BNGA 3ANLA 3R9KA 1L4KA 5BSFA 4AS2A 4L3WA 1VJGA 1RXYA 2W2LA 4V0MA 5AUQA 2OO5C 4ER6A 3AEQA 3NYWA 3PEYA 4U63A 1MX5A 6PFKA 2PUGA 5J4LA 4U39A 1PKXA 4PHTA 1BE8A 2C4VA 1BWPA 2J6HA 1ORWA 4FKBA 4IVPA 4RVGA 1SG0A 3B1JA 2OV2A 2IX3A 3DWIA 3WB0A 4IDDA 4IZHA 1K7CA 1JYEA 1CUEA 2O50A 1YGYA 1VCNA 4W9NA 2VF7A 5MN5A 3A8TA 4Q1BA 5BSHA 1HYEA 1ECFA 5GQSA 4KUHA 2RIPA 3NRJA 1QAOA 3DTTA 3TTTA 4Q47A 2O7VA 2A4MA 3KZVA 1LDYA 5E1DA 4I66A 3DAOA 3C4JA 3FZEA 2D7JA 5I7UA 3MS7A 3X1YA 1QGUB 1F5NA 2IUTA 2Q28A 3O8QB 4RHUA 2FPGA 2UUBB 1WM1A 2YR0A 4Q34A 4LE2A 3BREA 3VC2A 4D4JA 5K99A 2BGNA 4RZHA 1CTQA 3IJEB 2EJCA 3UF0A 2VDMB 4H7DA 3D2LA 1P61B 1O96B 1MO4A 2JEOA 5FNZA 3JQCA 1GZ7A 2ZIEA 3QBTA 1KIFA 4A0QA 4IQGA 3H16A 4K9OA 4K9LA 4B7ZA 1Y48E 4HQ6A 3IAAA 4Y6LA 1JR3E 4Z0NA 4U9IS 1MG0A 2VI5A 3U4MA 1KO4A 4LYEA 4TV9F 3GDFA 5AR1A 1QF6A 1N7GA 4CM9D 3JPWA 1PEKE 3BFKA 4F91B 4C03A 1P9LA 2G25A 1AQ6A 1KMNA 1KJ9A 4LHYA 3QEOA 1UMDB 3ZCRA 5IKEA 1DRUA 1YQWA 4BQPA 3L7BA 5A4IS 5GP1A 3LUHA 5B6PA 4FNMA 1EVLA 1F8YA 1PBTA 3NHBA 4UVEA 5D51S 2WWRA 3INRA 4CHGA 1NG9A 1PQ4A 4H31A 1UPXA 2H7CA 2G1PA 4NOLA 2Z2YA 5C5EA 1C3OA 3EZYA 3ETCA 1RIFA 4J8PA 1YUNA 2PKQO 1B2LA 1G291 3GFRA 3PQ8A 1CR0A 4GGPA 4DCPA 1E9FA 3L7OA 3R7NA 3B52X 1SEVA 2IHUA 5T8KC 1JE1A 3THWA 2WE8A 5BSUA 1CUJA 2V3WA 5CK5A 3WWDA 2YV3A 3D8NA 2R8OA 4QE3A 3TKAA 3QFSA 3KTDA 2J6IA 3QYJA 4YB8A 4JI8B 4GC5A 3GAAA 1FFSA 1UQTA 3E9DA 3UB2A 3VH1A 1YJ5A 2VOJA 5K0SA 1XALA 5J4YA 3W5IA 5DBOA 2JATA 1QHSA 4D0NA 2AOUA 1U6KA 1OH5A 4TX1A 3A3NA 4OKSA 1A9YA 1X74A 3E7XA 4Q3KA 3A70A 1DKPA 4PRZA 1RKQA 1JQAA 3KJNA 4EGQA 2G80A 4YDHB 2XUOA 4PQGA 4QXAA 1AKEA 4F6LA 5FBVB 3PRKE 2ATVA 2DY0A 4PYLA 5TPZA 1U3WA 5G40A 4ME6A 2YRFA 3NMUF 1NDHA 2ZETA 4YXWA 1JQLB 1FNSA 1H1LA 3IE0A 4WKOA 4UAJA 5ESWA 3TL6A 3K9HA 4PHHA 4U2CA 4M0EA 4BLPA 4IGIA 1T0IA 5A3VA 4RZXA 1ZHFA 2ZIFA 1Q7BA 5ALOA 1GG2A 3KD2A 3AU8A 3TX2A 4BLOA 3CTPA 4DA8A 2HF8A 2WICA 3R77A 4QYTA 1G5PA 2ZI6A 4IG9A 4OQYA 3G7NA 2JHGA 3E9MA 3ELYA 4M1EA 4Q3OA 3G9TA 2NNLD 4QU8A 3UTCA 1AHNA 3OSUA 3NAMA 4D4MA 3DVQX 4EKEA 1NVVQ 1V3QE 2QTVB 4QT4A 4NCAA 1SAYA 2OV6A 3PHIA 4CM8B 4E32A 1JIXA 1SRQA 3KKOA 1EJBA 1N92A 3OJCA 4QUAA 3KL4A 2FXIA 4D56A 3RRJA 1EK2A 4FEAA 1WXHA 3C39A 3H11B 4YYEA 1Q20A 4C4SA 2A1TS 1OBCA 1G8YA 3EXFA 2D59A 3UK6A 1N6IA 4JMPA 4TXHA 3HG7A 1EZ4A 3QY0A 5E0OA 8GPBA 3I34X 2J46A 4B6RA 1MV8A 4Y67A 1JIVA 1ZD1A 3K1JA 4GKJB 1C1XB 1QGDA 3MSCA 1ZHHA 4J3NA 1B1CA 4DMHA 1EU1A 4RQTA 3OCYA 3OCWA 3ZOZA 4DJFC 3DWFA 5IF3A 1IRXA 2CCKA 2FZWA 3GNSA 1ZIYA 3L8MA 1RLOA 1UOQA 1FMTA 2YJ3A 3QXCA 3BIOA 3HQ4O 4IX9A 3UPTA 4C6TA 4DZRA 5BOSA 3U4QB 3N1UA 4N8EA 5NULA 1LZKA 4J0EA 1PEDA 2AJBA 2FE1A 1GV1A 2CMHA 2KWIA 3K32A 3LQ2A 5FHQA 5KQGA 4ITRC 1XWFA 5GV7A 1NVXQ 4IJVA 2OHFA 3QG1A 1CQJB 4Y1RB 2H57A 3UMGA 5IT5A 1DJQA 3EF3A 4ZAVA 1QQAA 2ROQA 4BATA 2IYVA 3BE8A 3U1VA 3ZWNA 1RYBA 3FYTA 1ESCA 5IUJC 1CRPA 3LYAA 1I0LA 4ZOQI 1K89A 3GUCA 3DAGA 2VPYA 2Z1NA 2ECFA 1ZD9A 4UBLA 3VNSA 4HJRA 4WADA 3ZE2B 1QGZA 1MJFA 4GDMA 3H8JA 4J43A 2FH5B 4FZ5A 4BN0A 5JG7A 3RASA 4F4DA 4H59A 4MULA 4BFCA 2WOOA 4NYMR 2D3WA 1W581 1XZPA 1JHDA 3DL0A 4F3RA 4QJ4A 4ZV9A 4W7IA 1PWHA 4MIKA 2ZB7A 2VHYA 2QRZA 4L1KA 5K8TA 4RD4A 2R00A 5A03A 3HUTA 2FG6C 2PMBA 2QGZA 3NEYA 5IKPA 5KTPA 5LD2C 4LWPA 1VXRA 2X4IA 3KJQA 4B8YA 5EXXA 5IM4F 2CFRA 4TL9A 3CO0S 1P1CA 2P3LA 2YQ5A 5CA0B 1W88B 2OMKA 1XCBA 5DSZA 1Z7BA 1MAVA 4JBXA 4M1KA 3W8NA 3P7MA 5HHTA 4GOLD 1DEAA 2OEPA 1WMFA 3CR3C 1O5TA 1ZC4A 3UICA 3G3EA 2CL7X 3Q3CA 1L7MA 1VP9A 2G5PA 2DT8A 2PGDA 4JLDA 5JLAA 2OCYC 4C3VA 4HGZA 4M7OA 1T8UA 1T35A 4YRIA 2KMLA 1Z6TA 3GRPA 4UNSA 3SZMA 2UZ0A 2Z2ZA 3KQSA 1J2EA 4Y6RA 3UFXA 3HJAA 3WB9A 2XDQB 3SX4A 2QZ9A 4MB2A 2G1UA 3FYDA 4XIGS 2K4MA 3M6WA 3INGA 2FR0A 2YHAA 3MEQA 3NETA 4FHCA 2M1XA 3NANA 4L6IA 3BVPA 3HYTA 4N65A 1FSSA 2BUBA 1Z6QA 4RBNA 4X6LA 1N1MA 1UJ4A 3D6VA 4F3YA 1C29B 3D59A 1FZQA 4LJ6A 4QBFA 2GQ0A 4Q37A 4CUKA 1IVSA 2CV2A 1UDXA 1KI2A 3SG0A 1IJKA 3H5AA 4HDAA 1XQ6A 4QXQA 3CLSD 2VT6A 2AR9A 2MOKA 3KKQA 2JIBA 2Z57A 4AJ9A 4EUFA 1JPNA 2EP5A 3GPIA 2H7VA 3RIGA 1NW8A 4NEHB 2AOVA 4JQOA 3RSQA 5PNTA 4EVSA 3IR5A 2NU6A 4UHEA 4NZOA 1EVYA 4NX2A 3A9UA 4BQSA 1RQNA 3HGQA <