2DC1A

Crystal structure of l-aspartate dehydrogenase from hyperthermophilic archaeon archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
236
Chain Sequence
MLVGLIGYGAIGKFLAEWLERNGFEIAAILDVRGEHEKMVRGIDEFLQREMDVAVEAASQQAVKDYAEKILKAGIDLIVLSTGAFADRDFLSRVREVCRKTGRRVYIASGAIGGLDAIFSASELIEEIVLTTRKNWRQFGRKGVIFEGSASEAAQKFPKNLNVAATLSIASGKDVKVRLVADEVEENIHEILVRGEFGEMEIRVRNRPMRENPKTSYLAALSVTRILRNLKEGLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-aspartate dehydrogenase
publication title Crystal structure of archaeal highly thermostable L-aspartate dehydrogenase/NAD/citrate ternary complex.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 71
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 1.4.1.21: Aspartate dehydrogenase.
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01958 DUF108 Domain of unknown function DUF108
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2dc1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dc1A01
1T26A 4K28A 3EC7A 1M66A 5KVSA 4CV2A 1GYQA 2GZ2A 4ZQHA 4PRLA 2VUSA 1W8DA 3U5TA 2IZ0A 3PZBA 3KLMX 2GGSA 3JQCA 4RV9A 4QT0A 3VZRA 4Z9YA 3GK3A 1ZIDA 3GZ4A 3AU8A 1EVYA 4J1TA 1ZNQO 4K9DA 1Q7GA 3VTFA 1LI4A 1I2CA 3DOCA 4LW8A 2BFMA 3PDUA 2CZCA 3JQ7A 4J1SA 1N92A 2Y1EA 4JLWA 2XF8A 2OL4A 3PK0A 1MGOA 2AA3A 3T4EA 3ZNOA 4W82A 4BO3A 1B7GO 3IKTA 2DFVA 3BMOA 4N5MA 3ROKA 5KIAA 2X6TA 3ZWPA 5DT9A 5H81A 4XD2A 4GH5A 3NDJA 4XDYA 3PQFA 2Z1MA 4PZEA 3UOGA 5JAQA 3FD8A 1HSOA 3VDRA 1IB6A 2D4AA 4GMFA 1LSOA 3E5MA 4JN6B 4CMIA 1E3EA 2UVDA 1E3WA 3GPIA 1UAGA 4AJLA 4CM9A 5CP8A 1R0LA 1K89A 5IJZA 2AQ8A 1PQWA 4EEZA 5ILOA 2PZKA 2X0RA 1FDSA 3M2PA 5DULA 2NLOA 5KJ6A 5I9NA 4P4NA 1KY5A 1IY8A 1VRWA 4TSKA 4HADA 4MP3A 5TC4A 2OZPA 5JCJA 3L4BA 2W2LA 2ZCUA 4OQZA 3CKYA 3OHSX 2J8ZA 5A06A 1RWBA 4Y6PA 4Y9DA 1KOLA 1FXSA 3AOEA 3H9QA 2YFHA 4UEOA 3GOHA 2GZ1A 2JJYA 3HG7A 4R1UA 5CDSA 4M49A 5L7TA 3LC1O 3EMKA 4D41A 1ZK4A 3L4SO 3ASUA 2XPCA 5DP2A 4ZRMA 2PKQP 4I5EA 2PLAA 2W98A 4BV8A 2I66A 2P68A 1EBUA 1EE2A 4AJNA 3GZNA 4CR8A 5JO0A 1YDWA 2Q1TA 3WX0A 3VH4A 5CFZA 3D4NA 3ZZNA 3ZWMA 3GFBA 4DIBA 2XOXA 2AG5A 3F6YA 3GNSA 4E2XA 3B20A 3ITDA 4CJXA 4NU5A 2IYOA 1BXZA 5COBA 5DN9A 4B4UA 3EUWA 3GPDG 5KKAA 1VLLA 3PXXA 1XHLA 3LLVA 3M2TA 4H3VA 2WM3A 4BS9A 2FPIA 3RFVA 5THKA 1UZLA 3FR8A 1U4OA 1ADBA 3QWIA 1ONOA 1VM6A 3DFUA 2W2KA 1QV6A 1F8FA 3BHJA 5AVOA 1KVUA 3LDHA 4AL4A 1KYQA 5CAEA 5TLSA 4TRJA 4PLTA 4BVAA 4BOYA 1DIHA 1JKFA 3NDRA 4YT8A 1I01A 4NQZA 1YWGO 1IYZA 1QLJA 3JQ9A 2FOIA 4ND4A 4BNLA 4DLBA 5JBIA 1UXHA 3SBOA 2R00C 3RI3A 4DIFA 1GQ2A 1U8XX 3T7CA 3DZBA 4GSLA 3QWAA 5L7WA 2FWMX 4A26A 5EQFA 3HDJA 4FFMA 2I65A 4WCFA 2VHZA 5A5EA 3UKOA 3ZWYA 3RAJA 4E33A 3ANNA 1U3VA 4FIZA 3TZQA 1TLTA 1VC2A 1PJ2A 5JMPA 4CM4B 4IGFA 1LRJA 3VTZA 2R2GA 3A9WA 4RF2A 3PJEA 1JVSA 4MVJD 2GRAA 2J5KA 3E5RA 4IXWA 5JYAA 1P1RA 3O03A 3WJAA 4BNGA 4W4TA 4BO0A 4ZJUA 3I9NA 4Q3EA 5GY7A 2C7VA 1HYGA 2NVBA 1CWUA 2PD6A 2UYYA 2X0JA 1VI2A 5AOVA 1VPDA 3VH2A 3PEFA 3QVOA 3TF5A 2HJSA 1ARZA 2BF7A 4IQ8A 1ZUD1 3EDMA 5ENDA 2A92A 3U49A 1SC6A 2P5UA 5L3ZA 1V0JA 4Z0HO 3RVDA 2VOJA 5JDCC 1BVUA 1PJSA 5IN4A 2CF6A 3GVCA 1XELA 2ZQZA 4QSMA 5DZSA 3RC7A 1M75A 4BO2A 3GEMA 3RASA 2O23A 1A71A 1PJTA 2GNAA 2Y05A 4Q39A 3NX4A 1KBZA 3DO5A 3E18A 2NM0A 4E2WA 3DBHB 5H83A 4IDFA 4GBJA 3C1TA 3L07A 3NV9A 1X1TA 2PV7A 3IKVA 2BI8A 2CVQA 4YA6A 4YJGB 4BNVA 2VRCD 2VT3A 1PGOA 3VZPA 5B12A 4OYRA 1N8KA 2ZATA 2CFCA 4PG7A 2D1YA 1TB4A 1E1NA 3PFWO 2GN9A 3OM9A 1MG5A 2P5YA 4MKZA 4RF4A 1YVEI 5JNLA 3WGTA 2J6IA 4D7AA 2D8AA 2VCYA 4YT2A 1HDCA 3GMSA 4CM8B 5IDWA 1BG6A 2QX7A 1JU9A 4GVXA 3I9LA 4DLAA 1OZAA 4FB5A 5JXWA 3QWBA 4YT4A 2WMDA 4YDRA 4MOWA 4MVJM 3GF4A 4PVCA 2J5QA 2C07A 3BMQB 3L0DA 4LSWA 5K9ZA 2O3SA 3LQFA 5FYDA 3JD2A 4CV1A 1P9LA 1B8VA 5G0WA 4MVJG 2GASA 3IUPA 5F3RA 5JAIA 1HDZA 3HDHA 4HP8A 4I9HA 5L95A 4TWRA 4CM1A 1KVRA 1LDEA 3TZ6A 3RKRA 4HWKA 3BAZA 3GMDA 3V1TC 4LCJA 3JYNA 3UAGA 3GRPA 1R6DA 4B3IA 1LDBA 4BV9A 5HS6A 2DKNA 3EYWA 3O26A 3GDFA 5B4TA 4NPCA 3GRKA 3QVWA 3L9XA 4B7XA 3K2BA 3GNTA 1AE1A 2ZB3A 1LLCA 5CG2A 1C0IA 3NAQA 2EW8A 1TVEA 5IZCA 4FFOA 1PL7A 2Q50A 3DL2A 2NWQA 5DOZA 3ONDA 1HE5A 4IDGA 1I30A 3KYCA 1CYDA 4DMMA 3Q2KA 1Y8RA 1ZFNA 3K31A 2WWRA 5DBGA 3KYDB 5DNAA 4GMGA 4CM5A 3KUXA 4NBRA 3IJPA 1J4AA 2AQHA 3FPLA 3GUCA 4IJUA 4OOFA 1XG5A 2CMDA 1RM4A 3O4RA 4ALKA 2DC1A 2PNFA 3OIFA 1WZIA 2BGKA 1A9ZA 1ZK1A 2IYPA 3U4IA 4IJWA 3UICA 3EZLA 3JQFC 3VVBA 3SVTA 3HN2A 1PGJA 1FF9A 4UVHA 3BMCB 4XYBA 3H65A 4OMUA 4PG5A 2CDAA 3ONFA 5JC8A 4GQAA 4F3YA 1J0XO 1LU9A 1U5AA 4XQ9A 3LC7O 1C0LA 4BNYA 3H5AA 3WFIA 4CM4A 1T25A 4E30A 5MDHA 3NT5A 2I3GA 4J2HA 4QTZA 4C7JA 1TA4A 1LDYA 3SLGA 2GPTA 3ZWXA 4R5MA 4J9UE 1GCUA 1HL3A 4OSOA 3GGGA 3WYCA 1HTBA 1NQAO 3F46A 1A5ZA 1YBVA 4R16A 4AJKA 2OHXA 3K2EA 2VRBA 3S2IA 1YOVB 4FJ2A 1I24A 4A2CA 5KKCA 2EKLA 3G1TA 3ZCXA 1JN0A 2J3HA 2LDBA 4ONEA 4YB8A 3JQ8B 5G0UA 1BSVA 4EUHA 4QEDA 3TPCA 4BGVA 5ITWA 2X0NA 1JQBA 4J4BA 4PZDA 3HZZA 2AG8A 1YQGA 1WMBA 5A03A 4J4TA 4PIVA 3RUFA 1U5CA 4PG8A 1DB3A 2DUWA 1E7MA 1DRUA 1GCOA 2C0CA 1M76A 4MKRA 1H6CA 5I8ZA 3ZNNA 2ZJ0A 2D0IA 1BDBA 3DBHA 1R0SA 2OP1A 1LRKA 4EITA 3I9MA 1MV8A 2C54A 3C7DB 2P9CA 3QHAA 3K5PA 3B1KA 4OL9A 4CUJA 4U0JA 1DC6A 1U1IA 2CDBA 3GFGA 3KSDO 4ZHSA 1N1EA 3QWHA 2CF5A 2RHRA 3FI9A 4XYEA 3QVSA 1CQJA 5G4KA 3QQPA 4MVJF 1A72A 2AEFA 3PFFA 4EDFA 3AY3A 3GAZA 3FWZA 1HDOA 4M86A 3DR3A 3JYLA 1GZ3A 4Q3NA 2FR1A 4ALLA 4BNZA 2CVOA 3OICA 1L7DA 5T64A 2RAFA 1V8BA 4KP7A 3TSCA 3OJFA 5AQ1A 1B3RA 4B8ZA 4RCVA 3VKUA 4PVDA 1GQYA 1DO8A 3ZV6A 4YRAA 1PL8A 5GZ3A 1ZSNA 1E7YA 3DBRB 3I3OA 3UFXA 3WGHA 1V9LA 1FDUA 4W9NC 3CZMA 1VKNA 3NGLA 3OETA 1D4FA 2BHLA 4KWHA 2OGUA 2F00A 3PJFA 2X9VA 3OBBA 3R6DA 2R00A 1IZ9A 3D0OA 3I5MA 3LT2A 5CHEA 5CDUA 1LUAA 1D7OA 4ZQFA 3KV3O 2OMEA 2X58A 4R51A 1NAIA 4DBZA 2BGLA 2PD3A 3GEGA 3WGIA 4XGIA 4NJMA 2PWZA 4UAGA 3UF0A 3UH1A 2NVUB 2O3UA 3KO8A 1BXGB 4MP8A 5TX7A 3H9GA 4AJIA 1SAYA 3ZI0A 1BW9B 2O4CA 2B83A 2Q46A 3AW9A 3QA9A 1IHYA 2EF1A 4J4HA 3BIOA 3CEAA 3PWSA 3AJRA 4CUKA 4NK5A 4ROSA 4MVJI 1Q7BA 1WMAA 4J7CA 4NBTA 2CD9A 2JD0A 3JV7A 5JE8A 3RJ5A 2GR9A 4R41A 2Y1GA 2Q2VA 5KOIA 3MTJA 1GL3A 1YL5A 3KHUA 3WQQA 4CL3A 3LF2A 3PP8A 3KYDA 3EVTA 5GMOA 3VH3A 1Y1PA 1RPNA 1EDOA 5L45A 3CXRA 3K92A 1CIVA 1UR5A 3T7EA 2ZB7A 3OJLA 3BXXA 5G0TA 5IDYA 1PR3A 4MIOA 1DXYA 2FRDA 4LK3A 1JKJA 4ZICA 1F8GA 1X7GA 5U1PA 4CUZA 3WLEA 4WEQA 3RROA 3NTOA 2C2YA 2A35A 3MJSA 2PD4A 1R37A 4B8WA 2WE7A 5C7OO 1T2EA 3WBFA 5CEEA 5FF9A 9LDTA 4HNHA 3H2SA 3EW7A 2FMUA 4D0RA 4O5OA 4RF5A 1GPDG 3L77A 2I67A 3CPSA 2EJVA 2XAAA 1GV0A 1Y5RA 3PHHA 3FR7A 3G1UA 4GL4A 1QYWA 5G0SA 4CMHA 1SOWA 1N9GA 4IDEA 2GSDA 5K0ZA 1E7SA 3Q2IA 5JDIC 4Z9FA 2CY0A 3WDSA 2NUAA 4BQRA 1ISGA 3RSHA 1SEVA 5JCJD 1S7CA 2YW9A 3P2YA 3QW2A 4XQEA 1IHXA 5KWEA 4YR9A 2WTBA 1UXIA 3AM3A 1HT0A 3MJ4A 1UXJA 1BRMA 1Y5MA 2WEKA 3AFNA 4P4LA 4UEJA 3IDSA 1QP8A 1PJ4A 2FZWA 4NMHA 3E82A 4CM3A 5A3JA 2AQIA 1HYHA 4D44A 4D3SA 2DUUA 2OBNA 1GADO 3TWOA 3NT4A 1XU7A 3AI3A 4RPJA 4H16A 5CPBA 3INTA 1O89A 1U7TA 4Q3AA 1QYCA 4L4SA 1Q2XA 4I08A 3D1LA 4R1SA 3KZVA 3NJ4A 3S8MA 3TN7A 3K8ZA 1GUYA 3H9UA 1ISJA 2Q2WA 1RJWA 4QFDA 1A27A 1YRLA 4EJ6A 6ADHA 3B70A 2Y1DA 4N18A 4G2NA 4MKXA 1E7QA 1EBFA 2J5RA 3WOHA 1IUKA 1N5DA 3B6ZA 4NZ9A 4KTVE 3JCZA 3IIEA 5KTKA 2E37A 3ZWVA 1JDJA 4U6QA 1QV7A 3Q9NA 5IDXA 4YJDA 2NQTA 1EVZA 1GPJA 4DRYA 1DC5A 3WSWA 2B0JA 1JA9A 1LA2A 1RM3A 3DBRA 2VZ8A 4ALMA 3ADPA 5A05A 4JQCA 4JNKA 1DHRA 3SJUA 1QRRA 3JQ6A 2NV6A 4FCCA 2Q1UA 1I2ZA 3GA0A 2F1KA 3D3EA 3OH8A 4MVJP 3LSYA 5LDHA 4XDZA 3JQFA 3OJEA 1GTMA 4O63O 1UP6A 4GX2A 5JMWA 1QKIA 4B79A 1NXQA 3DEYX 2NVUA 3UUWA 2JFFA 1BXGA 4BNNA 2G0TA 1XGKA 4A7PA 1BW9A 1DIAA 1KS9A 2XXBA 2PR2A 3CH6A 4Y98A 4L8VA 1Q0QA 1E3IA 1HXHA 4I1IA 3WIDA 4IXTA 1T2CA 1Q0HA 2PKRA 4NDNE 4A73A 1HLDA 4D0SA 5A5FA 3RFTA 1NNUA 1YL7A 2ZK7A 1KVQA 4RL6A 1FDWA 2Q4EA 3V2UA 1HZZA 2HAEA 3ZDFA 5THQA 3D5TA 4II2A 4KMSA 1X0XA 2DBQA 1NYTA 1ZMTA 1QSGA 2FPPA 4BNMA 1HRDA 3DWFA 4I5DA 3JQDA 4IQ0A 3LK7A 3BMNB 5T67A 1A4IA 2HRBA 2GF2A 4J90A 4BO5A 1F14A 4UUOA 4NHEA 1NFRA 4OM8A 3TZHA 4CQLA 4N54A 3RBZA 1GDHA 2V6FA 5TNXA 4ZN6A 4ALJA 5DDIP 4J7UA 1YO6A 2VHVA 2VWGA 4IGEA 4OIMA 4WJZA 2HSDA 5HM8A 5JS6A 1Z82A 2C5EA 3PIDA 4JK3A 3E9MA 1P74A 3I4CA 3L9WA 3M6IA 4L4XA 2OORA 4N7RA 5JW6A 3ZNPA 4BNJA 2HRZA 2Z1NA 2X7HA 2ZTLA 3QVTA 5IXYA 1E92A 1EEHA 4ZRNA 3UVEA 4GGOA 4BO4A 2O7SA 4GX5A 3WB9A 4WUVA 5BNIA 1ADCA 2EWMA 4D45A 3CINA 1EVJA 1NBOA 3WMWA 4BMVA 1A7AA 2RHCA 3U4CA 3AUAA 3H9JA 3A28A 4CMBA 4XWYA 4B3HA 1P3DA 1AGNA 2X22A 1WDLA 3ZGYA 4WPGA 3MCVA 3TZCA 5M6DA 1G0OA 2BLLA 4N5NA 5KJCA 3NDIA 3Q9UA 6LDHA 1BHSA 1C1DB 3D64A 3WG9A 1H9BA 4BMSA 4J3FA 3ZWNA 4EUFA 3WICA 4OHUA 2P4QA 1NP3A 3DHYA 3PZRA 1XQ6A 1IE3A 4CQMB 3SX2A 2Y1FA 1KC3A 1M67A 4XGKA 2HLPA 1J49A 4E5NA 2DQ4A 3KLPX 2X9GA 3C7AA 4XYMA 1HZJA 1KEWA 1Z74A 2PZJA 1VJTA 4E3ZA 3KRTA 3VHRA 1SB9A 3LT1A 1M6HA 1XEAA 2DLDA 1J6UA 4CMEC 3M1LA 3ANLA 1R4NB 3V8BA 1LSJA 3INRA 1LDMA 2GERA 3GT0A 3OIGA 3HE3A 3G17A 1O8CA 5GZ6A 4CMAA 3MJTA 1NR1A 4E2YA 1PZGA 1E1LA 1FDTA 2VYVD 5ER9A 5TT1A 1X0VA 4ID9A 1BTOA 3LF1A 5IZ4A 3SJ7A 1PQUA 3W4IA 3FHLA 2IEBA 3E1KA 2VOEA 3JQGB 1P1KA 1GR0A 2Q1WA 4ZD6A 3JD0A 1E6WA 3CTMA 2DTDA 1PZEA 3DFZA 2QZZA 1E1MA 5GZ1A 4XR4A 5A02A 5TJ9A 5F21A 3ITKA 5TT0A 1F17A 4TKMA 2NQ8A 4BNUA 1O95A 3GUYA 3ON5A 4MVJE 4RDHA 3JD4A 1NPTO 4AJHA 8ADHA 3GH3A 1Q1NA 1PS0A 1UH5A 1GYRA 3BHMA 5A9TA 1MFPA 1ZKMA 2JCVA 2Y0EA 2NVWA 3FPCA 3DZFA 4ALIA 1JW9B 1KIFA 4QFCA 4R9RA 3OA2A 1PWZA 3QWFA 2WD7B 4RZHA 1LLQA 5TS3A 3ZH2A 4DQUA 4E31A 1YH3A 4BHTA 1UAYA 4CLXA 3DOJA 3X2EA 4LSMA 4B4OA 1PS9A 4XYGA 3VPFA 1K6JA 1ZZEA 4BKQA 2EGGA 1LEHA 4BNIA 3GHHA 4CLRB 1XCBA 3EZYA 4FJ1A 2RH8A 1P1HA 4CLDA 1I33A 4BO9A 3DZJA 3HDYA 4FFNA 1BMDA 1ZMOA 3QV1A 1KEUA 3ASVA 1LQUA 1LSUA 4ZQBA 4NIMA 3OEWA 1ZVMA 3ETDA 4IMPA 3KETA 3X2FA 1SZJG 1TEHA 3HNPA 2YFQA 4K1LA 1B8UA 3ZWBA 5ADHA 2Y1CA 5BNFA 3SC6A 3WJ7A 5EJ2A 1EUZA 1PGQA 3NGXA 3RQSA 1ENOA 1LDGA 1E6UA 1Z75A 2TMGA 2FY8A 4AJJA 3BZUA 3AY7A 2HDHA 2DTXA 4URFA 2A94A 4GVLA 1O9BA 4DUPA 3OQBA 1SEPA 4J91A 3JTMA 1ZO8A 3F4BA 5C3MA 4E5KA 1PTJA 3H5RA 4KWIA 5IDQA 5A04A 3DHNA 1TT5B 2QRLA 3DTTA 3DAPA 5ER6A 2JFHA 3FF4A 2X86A 3DXFA 2ZYGA 2NNLD 4IIVA 2DAPA 3SEFA 3VH1A 2HO5A 1QYVA 1HETA 3LYLA 1NM5A 2H1SA 1LC3A 3JQAB 3JD3A 2HCTA 1WZEA 4L4RA 3R1IA 4R68A 5KVQA 1YL6A 1O5IA 2DBZA 4OO3A 3C1OA 3ZWWA 2CDCA 3S55A 4RPGA 3GQVA 4DQXA 3MZ0A 3ZW9A 4PFJA 4FGSA 2GN4A 5A3VA 1JVBA 1QG6A 1PZFA 4LN1A 1SOVA 1IOLA 5TRTA 3AU9A 5LC1A 1C1DA 5F1KA 4YAIA 3TFOA 3WBBA 3OP4A 3GLQA 4UULA 1U3UA 4HFRA 3W1VA 3SC4A 4M89A 2I9PA 3S1LA 1E0DA 2Q4BA 4JROA 1FK8A 2YV2A 3SLKA 2VTDA 4J1QA 4B7CA 2HUNA 5DCYA 1OC4A 2EP5A 2PGDA 1SMKA 3PGJA 2Z95A 4FR5A 4GSKA 1GU7A 1E5LA 4XR9A 4YWJA 1ZXLA 1OFGA 3O9ZA 2HK9A 5EL0A 5JYFA 4ZA2A 1NQOA 3WIEA 1H6BA 4GKVA 2Q49A 3U4HA 1U7HA 4R3NA 5DCUA 4S3MA 2Y1OA 2GDZA 5L53A 2VHWA 2J3JA 3VDQA 4IQGA 1H93A 4J7XA 1T1RA 1YB4A 4N5LA 1VL8A 4OKNA 4DBVO 2VUUA 3UCEA 4F46A 2C29D 2VYND 5T8KC 1PJQA 1K2WA 3KM0A 5T5QA 4WLFA 2O7QA 5B4VA 4MIEA 3G79A 1HDGO 1MB4A 2D59A 4Y6RA 5DBIA 3WQSB 1ZSVA 3NTRA 5BNTA 1LTHR 4U5QA 1P1JA 2VYVA 5CDGA 4IIUA 4LRTB 4DPMA 2VNAA 2RH4A 2JKVA 2B4TO 1DLJA 4KDEA 2I76A 4AJEA 5L7YA 4WNCA 2E48A 4IPTA 2B5WA 5A1TA 2D5AA 3U09A 1GYPA 3C24A 4GX1A 1ADGA 2WD7A 4CR7A 2IZZA 4I5FA 4B7UA 4IDCA 3QIVA 1ISFA 5EQDA 3PHLA 1WNTA 1WAMA 3RFXA 5TSDA 1UDBA 1IL0A 4W7IA 4YACA 4E5YA 3I83A 1QYXA 3ZV4A 1OC2A 2NU7A 1PR9A 1O6ZA 2X4GA 4RVDA 2QW8A 4GWKA 3AUTA 1NWHA 1DBVO 3DBLB 4QX6A 2YV1A 3E8XA 5JAMA 4ITUA 3UXYA 4IINA 1YBAA 4A10A 4Z6KA 2EHDA 4WCDA 3WMXA 3K73O 1P33A 5FFFA 4D3DA 5DCWA 2GCGA 1X1EA 1EK6A 2E49A 2BKAA 5BSEA 3B1JA 3WYEA 3ANMA 3WTBA 3GVIA 4J16A 2JFGA 2VWPA 2NU9A 4NNJA 2DVMA 3GN1A 1DC3A 1SO8A 3WGZA 1SBYA 4F6LA 2IXBA 1KEPA 1IPEA 4TKLA 4B4VA 2FN7A 2NTJA 4IY1A 2B69A 4TRMA 4AJPA 3PYMA 1A9YA 3OA0A 4HFNA 3IP3A 3QVXA 1EFLA 4WOKA 1TT5A 4WEOA 3MTGA 3N58A 3KOUA 4YQYA 3DMTC 3RU7A 5J23A 2QYTA 4PGFA 3RD5A 2FSVA 4IDBA 4JGBA 4Z0TA 1QMGA 3WWYA 4BNHA 1UZMA 1HSZA 3DZHA 3E9NA 4BO7A 2YY7A 4IZIA 4LVCA 1ONNA 4YJGA 4MDHA 2WDZA 3SXPA 1V3UA 5TJHA 2O3QA 2PGLA 1ZBQA 2POQX 1XU9A 4WK6A 1WPQA 3MOGA 4CM8A 3ROQA 1W0CA 2G76A 2DPHA 2P2SA 1Y9AA 2A9FA 3PQEA 3ADOA 4BNKA 1RM5A 3INGA 3EVNA 1B14A 1HE4A 1Y9EA 1JAYA 2PH5A 1UZNA 3DMYA 4GPD1 3FWNA 4R1NA 1PU2A 3FNGA 5IXSA 3BMQA 3DAFA 1ZCJA 1DJNA 3P19A 3GR6A 2VHXA 3GVXA 1P31A 4U0KA 3RKUA 4RJTA 5BSHA 4CMCA 3CIFA 4IM7A 1V3VA 4HKTA 1GY8A 3W8FA 2GN8A 3BYZA 1H9AA 2AEMA 2X9NA 4Y67A 4GAEA 3RUIA 3WGGA 3S2GA 1IZ0A 1I36A 2HMTA 3ABIA 1YJQA 4MP6A 4OJNA 4YCAA 1W6UA 1B26A 3UW3A 2GLXA 1ORRA 4MJLA 1I5RA 3FTPA 4QQRA 1NAHA 1YQXA 3L4BC 4M1QA 5EMHA 3VKVA 3I9JA 3LT0A 2YZ7A 2W90A 2BFAA 3AY6A 2YUTA 2UV8A 4J1NA 2V6MA 1JAXA 2DFDA 3PVZA 3IS3A 2G1UA 4BKRA 1H5QA 1C3VA 3V2GA 2PH3A 2ZCVA 3RJ9A 3ZHBA 2GYYA 2VYNA 3ZWAA 3BTVA 4WLOA 5KJ1A 3WWZA 1XKQA 4CLEA 1CQIA 1EUDA 1RKXA 4UVIA 4RLHA 1N7GA 4YAJA 2NTVA 3ZWOA 2AW5A 4YYZA 4KTTE 5IN5A 5JDCA 4HX5A 4DA9A 4QO8A 3U9LA 1VSVA 3NJ8A 3ETGA 4OXYA 3BMCA 2Q2QA 4ND3A 2JAPA 3TJRA 4CLOB 3GGOA 4WLNA 4IMRA 1L1FA 1NHWA 1ULUA 2B37A 4R4JA 1MUUA 3HFSA 2FP4A 1EVIA 2CUKA 1XR3A 3MOIA 3K9QO 2IXAA 4G5HA 1B2LA 3WQRA 3ZN2A 3GNQA 1TXGA 3LC2O 3DBLA 1E3SA 1ENZA 1V3TA 2HMSA 2NADA 2O3JA 4FQ8A 3HFGA 2XXJA 1DPGA 1EQ2A 1HLPA 1N1GA 3C7CB 1CJCA 4RF3A 3IQDB 1PJLA 4IS2A 2IODA 2WJPA 3JQ9C 4QXMA 4HV4A 1YOVA 3GVHA 1MC5A 3ICCA 3A4VA 3S2EA 3PPIA 1RM0A 1A4UA 2AHRA 1WLYA 1UP7A 3HDQA 1D8AA 1N7HA 3WTCA 1PZHA 2VZ0A 3PGXA 3JQ8A 4RVGA 5I9MA 3V2HA 5KNLA 3KSZO 1PJCA 3AUUA 1HDYA 1PX0A 1R15A 1NHGA 3QRWA 1EK5A 2BI7A 4NFSA 3VPGA 3H2ZA 4BQPA 3D4PA 4CLHA 4WCFC 3BMOB 3ULKA 3DQPA 1SNYA 1YKFA 3ZW8A 2YQ5A 3CMCO 4DLLA 4FOSA 4XYLA 3I9KA 4RVHA 3RC9A 1LXCA 5JO9A 1H6AA 1XIVA 2AE1A 4ESOA 1E3WB 2G17A 1AHHA 4E5MA 1FMCA 3UHAA 3H7AA 4DREA 2Q22A 2D5CA 4WKGA 4IS3A 3QP9A 1C14A 5U4QA 4YT5A 5CPFA 1BDMA 1KVTA 5T8KA 2H5LA 1T24A 3CE6A 4FC7A 1HWYA 2X0IA 5BR7A 2E82A 3PI7A 3TZKA 2FPGA 3OQ1A 4P22A 1P1FA 5BSGA 1X7DA 2Q99A 1ID1A 4DPKA 4RLSA 2PZMA 2BH9A 1NQ5A 1PQPA 2GUGA 2E4AA 3ZU2A 4BNTA 3CUKA 4D46A 2FSSA 2YJZA 3B1FA 5IF3A 2GN6A 1VSUA 3BA1A 5IFLA 4F45A 3GZNB 3ZV3A 3NYWA 1GQQA 4WNIA 2JCYA 3BTUA 3C1AA 2YV3A 4JJFA 4EI2A 3V1YA 3FNHA 2UAGA 1EUCA 1SPXA 4E21A 3IOYA 1A7KA 2V65A 1GEEA 5IG2A 1M2WA 3E9QA 2X23A 5I7SA 1ENPA 2DBVO 4PLFA 3EY4A 1DIRA 2HK8A 1K0UA 3PJDA 2EERA 3DAGA 1CEQA 4DQVA 5FI5A 2JD1A 4RO0A 1C1XB 1LJ8A 4A5OA 3RWBA 4LGVA 3EK2A 2D2IA 2Q1SA 2W2KB 5EN4A 4DVJA 1E7RA 2QQ5A 3DZIA 4J43A 3AUSA 4JBIA 2I3AA 1Z7BA 4D43A 5DP1A 3W4JA 4BIIA 5HA5A 3RBXA 1EE9A 1NFFA 1U2DA 1CERA 2DTEA 4PG6A 1MC4A 1R4MB 5T6BA 3GAFA 1Y7TA 3VOSA 3U0BA 3UN1A 4DMLA 1H94A 3I52A 3KEOA 4QUKA 1I32A 1LDNA 1Z73A 5HWSA 3DHEA 2VZ9A 4AICA 2I5PO 3PWKA 4IJVA 5C37A 2AQKA 2ZYDA 4WASA 2FHSA 4ZQEA 1YDEA 2JCXA 1XSEA 5JYEA 4AJ1A 3Q11A 5KVVA 1I3LA 1Y81A 1NWCA 1NTOA 3H8VA 3KBOA 2WSBA 3U62A 4PG4A 4IDDA 5F5NA 3ROPA 3CMMA 1T2FA 1YBMA 3F5QA 4WCFB 1U28A 3AM4A 3HSKA 3JQBC 2HMWA 3C8MA 2ZTMA 3ZU3A 2CSUA 4II3A 3T4XA 4NI5A 2W4QA 4CLOA 3FNEA 4INAA 3HQ4O 1DOHA 4RGBA 2OBYA 5IZCC 3JQEA 3HADA 3VVCA 4IUYA 3WGYA 3WR5A 5LCXA 5L4LA 1E3LA 4OSPA 3PHGA 4AG3A 3KSUA 4YAGA 5B37A 4G81A 3WNQA 3WGOA 4A03A 4XB2A 4TZTA 3Q0EA 1WXDA 4UUMA 1KETA 2WE8A 4Z9XA 1T2DA 2OOSA 3TOZA 4DTIA 5CG1A 1QXSA 1X13A 1ENYA 5COAA 3VPHA 1L7EA 4S1VA 3H9EO 1GV1A 3OJ0A 1YS4A 1PGPA 4DPLA 1D1SA 2V6GA 4CQMD 3WSVA 4XEHA 2FR0A 5AYVA 2GZ3A 2P9GA 3P2OA 4KDFA 1BWSA 4JBGA 3WLFA 4W9NA 4YVFA 2EP7A 3A1NA 3F1LA 2H9IA 4BO6A 2ZTVA 2I6TA 1CETA 2VWQA 4RZIA 1P44A 4JJIA 2PY6A 4I8XA 1BXKA 1U2GA 4AVYA 1EFKA 4YXFA 3NKLA 1H2HA 3W6UA 2OUIA 4YRDA 2ZYAA 3IAHA 1J5PA 2VN8A 4WOJA 4XKJA 1YONA 1WWKA 1ZSYA 3AI1A 4D3FA 2Y93A 5FWNA 3R3JA 2X5KO 4Y6SA 4K26A 1W4ZA 3RUAA 1DIGA 2RBEA 3AWDA 3N74A 4GLLA 4HXYA 7MDHA 3Q3CA 2JAHA 2FZEA 5JPIA 4UVDA 5ES3A 2BD0A 3O8QB 3S2FA 5I8WA 4M87A 4XIJA 1HDXA 4XIYA 4BO8A 1EDZA 3CZRA 4X54A 4RPKA 3LT4A 2J3KA 4Q3CA 4E12A 4YJFB 1I3KA 4YRBA 2C20A 1Y6JA 4XGNA 5J9GA 1P77A 3C3XA 4WGGA 1DAPA 4G65A 3ETEA 4EGFA 5TQVA 5L4SA 3LVFO 4O59O 3NUGA 3KTDA 4PLHA 4R54A 5A9SB 5ITVA 1K5HA 4J0EA 4XX0A 3DZGA 2I99A 4NU6A 1G6KA 1PL6A 4WLEA 4AFNA 2YHIB 5BQFA 3TL3A 4E2ZA 4FW8A 5HRUA 1B16A 1C1XA 4M54A 4UVGA 3H3FA 4CM6A 4YTEA 4MPDA 3IJRA 3HHPA 4TVOA 3WS7A 1PWXA 2PK3A 5T73A 5CEJA 1CF2O 3KYCB 1GUFA 1ISHA 1Y8RB 3GN2A 3OECA 1DFIA 5CDTA 1U4SA 1BVRA 3IC5A 1VL0A 3PLRA 5IAAA 1R4MA 4FBGA 4I5GA 3D5QA 1YGYA 1S6YA 4HNGA 4J49A 2DM6A 3WNVA 1ML3A 3JYQA 4C4OA 3DBVO 3NRCA 4KZPA 4BNFA 5JDIA 4UEKA 4BUCA 3M1AA 3FN4A 2ZTUA 4OGWA 5B1YA 4AJ2A 3NTQA 2P9EA 4JP2A 3TNLA 3PYXA 2P91A 2SCUA 1I2BA 1M6WA 3C85A 2GD1O 1C0KA 3BMNA 1E77A 1MG0A 4BGIA 4TROA 2PTGA 1ZJZA 4R01A 4TRRA 2OFPA 3RUCA 3TL2A 1DLIA 1PIWA 2DU8A 2O3RA 3PTZA 4AJOA 4CM7A 5MGBA 3EGOA 4P38A 3E03A 2DBRA 5EERA 1IULA 1LNQA 4EZBA 1PEDA 3F3SA 1X15A 3JQAD 4CV3A 2WYWA 1CRWG 3PRJA 3G3EA 1XA0A 2PZLA 2WYUA 3ZV5A 4IDAA 3QSGA 4JCOA 4M55A 2X5JO 1O94A 4Q3BA 4BKUA 4PLYA 2Z5LA 4TRNA 4RQUA 2NACA 4PLGA 3GHYA 3OJOA 3OMLA 2C7GA 4DYDA 4ZGWA 2BELA 2X1HA 3COSA 2B4QA 2O50A 2QZ9A 3I6QA 3TRIA 3W6ZA 4CMGA 3DONA 5JSFA 3LU1A 5AXBA 4E6PA 4HBGA 1GD1O 4WE3A 4Z3KA 5TIIA 2D3TA 4KUHA 3D4OA 1ZH8A 1VJ1A 1XQ1A 2E6UX 4XCVA 4BMNA 3D7LA 4NG5A 5HBRA 3W8DA 1NFQA 3H6KA 4P8RA 1ZJYA 2O3TA 5H82A 3L6EA 1ADFA 1Z6ZA 2HMUA 2YDYA 3RUDA 4NFYA 2LDXA 4EW6A 2Y66A 5AXDA 4LVUA 3HUDA 2Y68A 3UCXA 3VC7A 4DL9A 4W7HA 1N2SA 3K30A 1ZXBA 4U8GA 4CQMA 5HS4A 1YB1A 4E4YA 5CDYA 3ST7A 5G4KB 2YDXA 4ZU3A 3FTNA 2VT2A 3VAZA 1LLDA 2EKPA 4IJKA 4RVUA 4XQCA 3F5SA 4BB5A 9LDBA 3P5SA 4U6SA 2EW2A 2H6EA 2PGJA 1PSDA 1EQUA 3LLSA 1R4NA 1T1SA 1UXGA 3PIIA 4HY3A 1WDMA 2EGHA 2JHGA 1LSSA 3K6JA 3PDJA 4DC1A 3RCBA 5I7FA 2NSDA 4TZKA 4BB6A 5JAZA 1U3TA 2BMAA 2V7PA 4FD3A 1QR6A 1Z7EA 4BGUA 3O8QA 3RUEA 3EHEA 1MX3A 1HE3A 3ICPA 1DEHA 4EEXA 4L76A 2ET6A 1T4BA 2EKQA 1NQTA 3ONEA 2IDZA 4DWVA 1JLLA 4RQTA 4W6ZA 4YJFA 4NFHA 1VE9A 5C7LO 1DJQA 4HFMA 4KUEA 3JQGA 2EJWA 4CPDA 4EYEA 1AXGA 4XRGA 1UJMA 2PFGA 3PYLA 3GY0A 5B4UA 1H6DA 2B36A 2EG9A 2BRUA 4MINA 1VKOA 3VPSA 3ZNQA 2G5CA 5A9SA 1O0SA 1FDVA 3P7MA 1I0ZA 3I1JA 3JQBA 4NJMB 4DC0A 1XLTA 4LISA 3OEYA 1I8TA 2YHIA 4FN4A 2BFOA 2ZB8A 1U3WA 3A06A 4GWGA 4L74A 5JC1A 2YQ4A 3ENNA 2DPGA 2VWHA 4TMFA 4YAKA 1VL6A 1QORA 4NJOA 4IBOA 4KUGA 4R3WA 1Q0LA 2OP0A 4LCEA 4EJ0A 3JYOA 1F0YA 2JL1A 4GX0A 4C7KA 4PLWA 3GC6A 3FNFA 5F1OA 4Y8VA 4DGSA 5A4DA 4D79A 5JYDA 4GI2A 3QY9A 1E3JA 1E7WA 1IPFA 1ULSA 1PS8A 3TDKA 5DF1A 4CLRA 3WYBA 2ZIZA 5JCXA 1QLHA 4GKBA 3RC1A 5FI3A 4DXHA 1NPYA 3W8EA 3W4KA 2IEDA 1PJBA 3AK4A 4ZVVA 2Y99A 5JY6A 2UUOA 1OBFO 3E6AA 2BFPA 4BGEA 2QYSA 2HMVA 4TVBA 3R3SA 1DFHA 1UDCA 5TF4A 4Q3DA 3U4DA 3AOGA 1P1IA 1F12A 1GEGA 2W8ZA 5L9AA 5I7EA 4ND1A 2DT5A 4JIGA 2O2SA 2AEJA 4FS3A 1GZ4A 1ONPA 1R0KA 4OOEA 5G0VA 1Z45A 2X8LA 3G0OA 2NTNA 3L6OO 3MJVA 3OFSA 4CR6A 4FJ0A 4OXNA 4CMJA 1D3AA 4JP3A 4PLZA 4UUNA 2V6BA 1DAOA 3WGQA 4PZCA 4K6CA 3GG2A 1AN9A 3DB2A 1Y8QB 1NX6A 4PRKA 1N9GB 3I6IA 5K6AC 5CEFA 1NASA 4B4WA 2QIOA 2ZQYA 4CMEA 2ZB4A 2HQ1A 5EPOA 4UVEA 3IUSA 2J3IA 1UDAA 4MVJA 4O6VA 3STHA 5G2OA 5AXAA 4FSHA 1U8FO 3JQAA 4JXKA 4PCVA 3QLJA 1SCUA 4YBZA 4OAQA 1BGVA 4WECA 1V35A 4FFPA 1HEUA 1ZK2A 1KY4A 3PLNA 3MJCA 4ND2A 4OKIA 4YPOA 1OI7A 5F5LA 2IE0A 1E1KA 2B5VA 4RORA 4HUJA 1AHIA 3FBTA 3WFJA 3UCFA 4ZQGA 3AM5A 4BNWA 4K6FA 3I23A 4O0LA 1DDOA 4R1TA 1ZEMA 4TQGA 4Z3DA 4BL5A 1E6EA 2ILTA 3KEQA 4FOOA 1UUFA 4RPLA 5L4NA 5KJFA 1C0PA 1WP4A 1NR7A 4AJ4A 1TI7A 3BTSA 4WLUA 2H63A 4CL8A 5I9LA 3ORFA 5KCZA 1LX6A 4PLPA 1RYEA 1MFZA 2PKQO 4RVSA 1T2AA 5BT9A 4F6CA 1ZW1A 4HFJA 4E13A 4H15A 3V5NA 2VRCA 1T4DA 3F1KA 3NT2A 3WXBA 1KVSA 3ROMA 4CV0A 1NPDA 5JY1A 1ZEJA 2YHUA 1SB8A 4BO1A 2YYYA 1ISIA 1JTVA 3D3WB 1ISMA 4KOAA 3H3JA 4FFRA 1R16A 4I9UA 4IZHA 2RCYA 3OF2A 2BGMA 2IZ1A 4YEDA 3TOXA 4BKOA 2Y67A 2WYVA 5G4LA 1GUZA 2CVZA 3DOOA 1CDOA 1B3BA 1I3MA 3NEPX 4RDIA 1VJ0A 3KXDA 3AOEC 1H0KA 1HKUA 3F47A 5ENVA 3U3XA 3HJAA 1JWAB 2UDPA 1F06A 4EJMA 2C82A 3R0IA 2EV9A 2TMDA 1H2BA 3UGKA 2NU6A 4RVFA 1E5QA 3QE3A 4NH4A 5COQA 2QG4A 4LMPA 2UUPA 1AUPA 4MO2A 3KYBA 1R12A 1NVGA 1D1TA 2EIHA 2QRKA 1XDWA 5ICSA 1PGNA 4XJTA 5T57A 5JFOA 3CSDA 3ZU4A 4U7WA 5I7VA 2B35A 3G49A 1WVGA 4XB1A 5EINA 3KB6A 4CMKA 4E0BA 7ADHA 1U9JA 4L73A 4YJHB 3GDOA 3QJ5A 1YB5A 2X5OA 5F1PA 3JSAA 4I9NA 3ZHXA 4A27A 5DOVA 1KERA 3OIDA 1KC1A 4O1MA 4R5HA 1I10A 1X7HA 2O48X 1HF3A 2C2XA 4OQYA 3VZSA 1ZK3A 2AE2A 3Q6IA 3RU9A 3GDGA 2VNSA 2O4UX 3DZKA 2VQ3A 1ZK0A 4XA8A 2ZKLA 1AXEA 4DYVA 4E5PA 4Q9NA 2C5AA 1MXFA 2HJRA 4OH1A 4XJSA 1G1AA 3H4VA 4CQLB 4RPHA 3GG9A 1WW8A 3I4FA 3PQDA 4YAEA 5KJEA 5KVCA 4PN3A 3JQ7B 3FSRA 5FEUA 1MP0A 1XYGA 1LRLA 2JHFA 4D42A 3PJGA 4UREA 1MLDA 4H7PA 1X14A 4GLOA 2JD2A 2ZJ1A 2AXQA 1R66A 3AFMA 3PWZA 5LDGA 3ZHYA 1B8PA 1OOEA 4JJGA 1DC4A 4BNXA 4A0SA 4CM9D 4B3JA 3F9IA 4L9RA 1Y8QA 3TFQA 3HN7A 1K6XA 4L75A 3DTYA 2Y0DA 1UXKA 1GFSA 3GEDA 4FFLA 5HTOA 4MIYA 5L51A 2C59A 3FRJA 1EMDA 3PHIA 4NBWA 2W2LD 4Z0PA 4CMIB 4J9VA 4W99A 2FR8A 1DRWA 3ENKA 3EAGA 4NBUA 5DBFA 3LZ6A 3PHJA 2VUTA 4FGWA 1QYDA 1JWBB 3HB4X 1Q7CA 3RIHA 3AI2A 3MWDB 4DIOA 5AXCA 4EBFA 5ICMA 4KQXA 2Y0CA 5EIOA 1K3TA 1MXHA 2PA3A 3JD1A 4BKPA 3MEQA 5C7IO 2HK7A 2Q45A 3GGPA 1XWFA 3E48A 3HB5X 2NU8A 4ALNA 4XQGA 4PLCA 2HKIA 4J2OA 1GZ6A 3I9OA 3ZHZA 3ZU5A 3IP1A 1LLUA 3F4LA 1P0FA 1DSSG 2CNBA 3V1UA 3OSUA 4FC6A 4UUPA 2WD8A 3K96A 5A9RA 1WDKA 4OXKA 1JKIA 4EUEA 1FJHA 4M8SA 4YQZA 1UP4A 3OQ6A 4QO7A 5L40A 3HWRA 1LC0A 4JX8A 4JBHA 3A14A 4ND5A 2GO1A 1K6IA 3GVPA 2OO5A 5C5IA 2EEZA 1W73A 3H5NA 1OMOA 4P4GA 4J6FA 2G82A 1EZ4A 2Q3EA 4LMRA 1P45A 4KQWA 1YQDA 4R69A 2P4HX 1OAAA 4QECA 5BSFA 1NVTA 3RBVA 3VPXA 2RIRA 1HYEA 3Q1LA 3D3WA 4FDAA 2R6JA 1YE3A 3IMFA 1DIBA 4L0QA 1I3NA 2O2YA 3ZWCA 2HU2A 2QHXA 2AMFA 3VZQA 3FBGA 2EXXA 4NK4A 3BTOA 5JLAA 3IL2A 1G0NA 1YJ8A 3FCOA 1YXMA 4GGPA 4LRSB 1DHTA 1HDRA 4XRRA 1B15A 3TQHA 1P0CA 3L6DA 1NVMB 2QRJA 1RYDA 1DRVA 5EESA 4E32A 4NBVA 3MWEB 5TGDA 4XZ3A 2B4RO 3RUHA 4ILKA 1HE2A 4J0FA 1TT7A 5ILGA 5U9CA 4MVJH 3O38A 3BHIA 1LQTA 4PLVA 1B0AA 2VTEA 2VHYA 3DDNA 4WLVA 2OXIA 2IRWA 1MA0A 1PJ3A 1DFGA 4YJHA 4R9SA 1GAEO 1LBEA 3KVOA 3MJEA 5K6AA 3DMTA 3N7UA 2A4KA 3RC2A 1V6AA 4FPXA 3DC2A 4NR0A 4CODB 3JYPA 1KEVA 8LDHA
chains in the Genus database with same CATH superfamily
3MFYA 1C7IA 2IGTA 3OC0A 4IIEA 3EC7A 1YS9A 5KVSA 2ZU6A 1GYQA 1MAHA 1QB8A 1BEEA 2KE5A 1W8DA 2QTAA 2YFKA 3GL9A 1ACJA 2J9YB 5A3QA 3SIRA 3MBOA 1IHDA 1E66A 5F7ZA 1GKIA 2ISCA 2ZYWX 1ZIDA 2PVCA 3PICA 4HDCA 1Z47A 5JSZB 2O0JA 5ERYA 1PEAA 2ZYTX 3AU8A 3HJNA 3KJXA 3LCJA 4J1TA 1ZNQO 4MI6A 1RR6A 1RCTE 1Q7GA 1IH8A 3VTFA 3DOCA 3MRSA 2ZRPA 3UAZA 4KQ1A 3PDUA 3H3XA 4AY2A 1QLWA 3NBKA 5AI0A 5FADA 5K3DA 2BDUA 2OC4A 4BBAA 5CFLA 2F8LA 1QQTA 2CHFA 1SKYB 2IKQA 4W82A 3GJ5A 1CFZA 1ZJ6A 1KWGA 3L7MA 2FMFA 3C97A 1X8LA 4MW6A 5ADUS 5AW8A 2HDWA 3DAYA 1FNNA 2NX2A 5AK3A 3ROKA 4DNXA 1J7JA 3HU3A 1BWRA 4Q4JB 5H81A 1Q44A 2JW5A 5AHRA 2IA5A 2JHAA 1ORIA 3FUWA 5IHXA 2Z1MA 3K8QA 2W6ZA 3KWLA 3L0OA 1T43A 4R2WA 3UOGA 3UWOA 4MR9A 1HSOA 2J6HA 3F73A 3L5KA 4AI6A 2ATIA 1WD5A 3E5MA 4AULA 1MO3A 2XSZA 4CMIA 1RS0A 4ZARA 3M9XA 1GT6A 1UAGA 2FN8A 4AJLA 4OHYA 2CXPA 3H1AA 4K87A 5ILOA 1JFFA 1KARA 2VDUE 3BH6A 3F5FA 3IV6A 3TEMA 3PXAA 2QUIA 5ARCA 4BLWA 4CIVA 2IYXA 1KHTA 2EJTA 2NLOA 2OUKA 3N6XA 3LQ1A 4RHUA 5FXMA 3OQJA 3CLRD 1L5SA 1QHHB 4HADA 3A3NA 4MP3A 3O9VA 1E2UA 3WB2A 1U9IC 3KZMA 3L4BA 1RHJA 4NFLA 5AKKA 4QFBA 4Y2JA 4OQZA 4RA6B 2CFOA 1B42A 2B5OA 1KOLA 4DV0B 4Y6PA 2Z9CA 3H13A 4Q15A 3H9QA 4C0BA 5FAXA 5H7XA 1WMDA 3T95A 4R1UA 5FUQA 5JANA 1T8SA 3LC1O 1L4UA 3DVAB 4BN4A 1VZ2A 4D41A 3UK0A 3LOUA 4IEIA 4CKEA 1KSGA 2DQZA 4WAUA 3HYCA 821PA 1KEKA 1ZOOA 2P35A 2OO3A 2P68A 3M9LA 1EWTA 1X2BA 3GZNA 3PUJA 3D4IA 2Q1TA 3EY9A 4DWWA 1VCIA 3O9MA 5CYFA 3VH4A 1RAEA 2REXB 4TTQA 3QX8A 3GFBA 3RNLA 2XOXA 3F6YA 2QLNA 4TV9F 3GNSA 3DS8A 3B20A 4URUR 4NH0A 2C94A 1IJFA 2V55B 3FUCA 2P2NA 3EUWA 3GWZA 3GPDG 2ZEJA 4B4UA 5IVDA 1GLVA 2ISQA 3GRUA 5KYYB 3UTDA 1CJMA 5AI5A 1XHEA 2AK3A 1I2DA 4HZUA 3M2TA 1IOVA 1R27A 2WM3A 4MV8A 2P8SA 1L5MA 4F9EA 4X85A 1OXTA 2FPIA 3NORA 4BS9A 3ICQB 1ADBA 1L5WA 1UL1X 4C0JA 1VM6A 1ESZA 1PFQA 1DAEA 2R6AA 1Z06A 1PDVA 2GBLC 3RS0A 3ZBPA 5SZHB 5FH9A 4OQPA 2X1MA 3BHJA 5AJWA 5AVOA 1KVUA 1R00A 4BLSA 1JIIA 3HEMA 4G6ZA 4Z7NB 2MIIA 4LZOA 4BVAA 3AW8A 3QXJA 2CNWD 1NJFA 3B9QA 3T1TA 6REQA 2WUGA 4IH1A 2Z6AA 3CNLA 2ZWVA 3CWQA 3OF5A 1G55A 2HSZA 4ND4A 5JARA 5LL6P 1YQQA 3AR4A 3E0QA 1FUEA 3EYAA 2W6ID 4QBTA 3FGPA 1L7PA 2WTXA 3QF4B 3E3NA 4YGYA 1U8XX 4DIFA 4PC3A 3SBEA 1EFUA 4QU8A 4N3NA 4JWTA 2FG7C 4AXBA 2FWMX 4ZC1A 4W8OA 2QNRA 2H9YA 1EZZA 2GXSA 4XSVA 4FFMA 4N8EA 1O6FA 4IEFB 4WCFA 3A1FA 2WAAA 4N76A 1AGRA 2SNIE 3TB4A 3ZUPA 1HEIA 4E33A 2PG3A 2FK7A 3ANNA 5IAEA 2IITA 4FIZA 3TZQA 1KQ3A 5C80A 1USIA 1VC2A 5CYGA 1PJ2A 2VBFA 3K0KA 2I4OA 4M9CA 1GFIA 3A9WA 4DSTA 2E85A 1KI1A 4GI5A 5IJ0A 3MTQA 3AJ8A 3E5RA 3KVRA 5JYAA 3O03A 2YWRA 3W8EA 4BNGA 4NJEB 4LYFA 3IBTA 1D6NA 1K5DA 3D02A 4IJMA 4F56A 4ZJUA 4MS4B 4TT3A 2NMVA 4Q3EA 2JLYA 3THXB 1HYGA 3U7RA 3P0IA 3T5MA 1KORA 2DPXA 4K9SA 4RMHA 2OBMA 4I9FA 4YCJA 5JT1A 5JSZA 3GDWA 2UYYA 1EB9A 3GJYA 5AOVA 3VI3B 1JG6A 2CEAA 2AFRA 3ACDA 1WHSB 4DV2B 3TF5A 3SK0A 1R8XA 2OD9A 2HJSA 3BH0A 4FEYA 5J3JA 4GT1A 2WQ7A 1SD5A 2A92A 3PX3A 4KXVA 3U49A 1NULA 4KPUB 1Q5PA 5LB4A 2E0IA 2RJOA 2W7TA 1GNPA 1V0JA 3KWMA 5CK4A 5LQCA 4NCBA 2VOJA 4QUEA 2JGEA 2OO7A 4UE2A 4CIAA 1XELA 2ZQZA 4QSMA 3H84A 1BX3A 1FFBA 5EC8A 4DG5A 4BO2A 1AMNA 1K8RA 2O23A 3I9FA 4JHXA 3RASA 2VYFA 5FL7D 4Z4EA 2W2PA 3TUJC 3A4MA 1KBZA 3E18A 1PJRA 1OLSB 2W6JD 3E15A 1ECFA 1JXMA 1P80A 2JFBA 4I50F 3V4ZA 1KDTA 3DBHB 3W9SA 4M0LA 2YXPX 3UNXA 2ZAIA 3U7IA 4DLTA 3OQMA 4Q4JA 3EIOA 3UAXA 3KXPA 4TUYF 2OPBA 1X1TA 2R48A 3NV9A 5D8DA 3U1TA 1JXAA 5K3EA 3VKWA 2P1DA 1WSDA 2E6KA 2V5AA 3SIPA 3T7JA 3A2LA 3QQ5A 3SI7A 4BFLA 4ER6A 2B25A 1WD7A 5JU6A 2VRCD 2VT3A 3LCMA 4HJRA 3D8SA 4GZLA 4D8XA 4EUNA 1XUOA 2KS6A 5JSKA 3JR3A 1ZCBA 3B7GA 3NAMA 2ZATA 3ZZ1A 5JLJA 2TSYB 4PG7A 2ZJ8A 2YIJA 1TB4A 2GN9A 3OM9A 5KOHA 1NW7A 3HCWA 4UDNA 1RTKA 1LZKA 1P17A 2IYYA 5K3CA 4AZ0B 1PFGA 1QQ5A 1GR1A 2VCYA 3OD5A 5AJVB 1FY2A 1HDCA 1SWWA 2Q28A 3KD2A 3N1UA 4X1IB 4CM8B 2XZOA 3LWBA 2QX7A 4MRMA 2NUTB 2QF7A 2WJIA 3IPAA 5DHPA 1H4VB 2JJ8A 4QRHA 1TYZA 3F8WA 1PVDA 4KWTA 4RA6A 3RQIA 3ET5A 1VXOA 2WMDA 2I55A 2F62A 4YDRA 4F96A 2O2EA 4MOWA 2XA9A 1IHPA 2RJNA 2FX5A 1IN6A 1T8RA 2J5QA 2YFYA 3BMQB 4PVCA 4Y2XA 4YI5A 3C4VA 3DVAA 5DFAA 2RGNC 4LSWA 5FPHA 4WA7A 4D4JA 1H0HA 1QOPB 2AFHB 4GO1A 5HXAA 1CUYA 4UXHA 2P75A 3FZQA 1SC9A 4ARSA 4F8YA 1TM4E 6PFKA 5G0WA 2H5IA 3UWPA 5F3RA 1T8UA 1LPPA 2ZJ5A 1HDZA 3HDHA 3CISA 5JAIA 2X5NA 3IO5A 3I5XA 1P60A 4MROA 3OX3A 4A2QA 4OUKX 4YMVA 3U80A 5FYQA 1NE2A 1Z17A 3RKRA 4HWKA 3GMDA 4YUVA 1SKUA 2H92A 3JYNA 2YINC 4LCJA 4TZ6A 3GRPA 1R6DA 1CD5A 2F48A 1LDBA 4LBWA 3M89A 2WA2A 4ON9A 3EYWA 4A0RA 1YFLA 1FSFA 1KQOA 2PSFA 4JC8A 3T7RA 1FRFS 1T2UA 3GRKA 4TLBA 2DZDA 2FP3A 4ZO8A 5K51A 3S68A 4RHTA 4B7XA 2WPDD 1D0IA 3E27A 1OV6A 4HQ0A 4HMQA 2QG6A 3A4TA 1E63A 3GNTA 4BEVA 1CEYA 1FBNA 2AJ8A 5B1IA 1SBIA 3TV1A 2B99A 3NAQA 4ZT7A 5CG2A 4DR4B 2QJWA 3QMWA 2IY7A 3EEBA 3VYVA 4DY6A 3W2TA 2JK0A 3LRPA 4HWPA 4L8FA 2NWQA 5EY5B 1M7GA 1BOFA 1I30A 2P4UA 4DSNA 2P6RA 3CO5A 5JFGA 1S2MA 2LP4Y 1JDTA 4QYWA 1KMNA 2C4WA 5DBGA 5AUQA 2O8CB 3PGVA 4W7SA 1JEQB 1XDDA 1XWWA 1C81A 3IJPA 2EWWA 3EPPA 2J0SA 1VE6A 2CJFA 3SM9A 4O2BF 4IJUA 1AKYA 2V6IA 5AK0A 4ALKA 2OA0A 2DC1A 3LG2A 4YV0A 5I47A 4ZV7A 1A9ZA 2WHXA 1J70A 4HRVA 3VYUB 1OT3A 1TQDA 3UICA 3SVTA 4OHPA 3HN2A 1IWPB 3FDFA 1YFZA 2ZP1A 4B45A 3BMCB 4OMUA 4BB0A 4PG5A 5FUYA 2ZSJA 2VSOA 1EKXA 3G89A 4PRZA 3PS9A 1AQNA 3ONFA 1WY7A 4MQLA 3OM1A 4H0NA 4F3YA 4MULA 1U5AA 2GM9A 3HCBA 4AIIA 1C0LA 2GKGA 4G5OA 1AUXA 1JYEA 3H5AA 5ETJA 8ABPA 5KYXB 1JQDA 1G1MA 2GO7A 2AN9A 3Q88A 1A97A 4LMBA 4E30A 4GMXA 4C7JA 3AI7A 1TA4A 1LDYA 2JFQA 2V3CC 3ZWXA 1CULC 5L3SA 1ECCA 4AKEA 4J9UE 1GCUA 1IRXA 1CIPA 4FBLA 3GGGA 4YR7A 1HTBA 1NXWA 5AKZA 3SQOA 3AB7A 4WZAB 2GZMA 5I3CA 1H3EA 2G4CA 3THXA 3K2EA 4EB0A 1JHOA 3A3YA 3EMBA 4FGLA 1Z36A 5J59A 1YOVB 1ZGZA 4FJ2A 2DHDA 4KLNA 4TLMB 2EKLA 3EXHA 1WHSA 2POCA 5G0UA 1HQCA 3NALA 4EG4A 4HEA6 2J33A 4KCGA 2EDAA 4QEDA 1ZMBA 1L8AA 4B3BA 1GTG1 2VH5R 4KPUA 4J4BA 1L4EA 4FMDF 3WB0A 1K06A 1PR2A 1XAHA 1GNRA 2JFVA 1YC5A 3RUFA 5ADVA 3HB7A 4PG8A 1DB3A 1X77A 2RGXA 2R8BA 3W90A 4F06A 1KAMA 5EVJA 4RH0A 2W43A 1M76A 2E2WA 2BOVA 1H6CA 1NTRA 1OLSA 1VE5A 5I8ZA 2Q5HA 3DBHA 4IX9A 3CRNA 5CYOA 3AVWA 1AT1A 1KJJA 3GLTA 3HA7A 4H3SA 4MQMA 2P9CA 4OHBA 4DMCA 1LTKA 1XMJA 1Y3CE 3OU6A 1AS0A 1FW6A 5H9WA 3KSDO 3RU7A 2CN1A 1EWKA 2GJ8A 3FI9A 3DM5A 3QWHA 1CQJA 1JPVA 1A72A 2AEFA 4RGVA 5IU6A 4QVKA 5JCOA 1EDEA 3WI7A 5I48A 3D9QX 2FZCA 1RXWA 3E05A 3FWZA 1LX7A 4A9AA 4X1IA 2RK4A 3O4HA 4ALLA 4MDYA 2F2TA 3QELB 3UMBA 4JLOA 4JGGA 3NG1A 3DEKA 2HV9A 1A8QA 3AEUA 4W5WA 1VFNA 2EBFX 3C6YA 1VIDA 5CJPA 1S8AA 1S8OA 2XCSB 1OXMA 5BSKA 1OWMA 5JJIA 2O52A 1NG9A 1W9MA 4YRAA 3SE7A 3MW8A 1MOQA 3EVBA 1E7YA 1MB0A 2IEAA 3MS4A 4V03A 2B4AA 1KDZA 2AFHA 3NBAA 4KWHA 4MGEA 4MGZR 2R1VB 2PO5A 4Q3OA 4OBEA 2QWXA 1MTOA 2X9VA 3OBBA 1JJFA 4ZAXA 2WVJA 3I5MA 5B7PA 2I3BA 3CNBA 3HCOA 2Z98A 2ZIWB 4EO4A 3EPHA 4J0JA 2QGFA 3TBHA 1NUSA 4X71A 4F3RA 3GT7A 2DF8A 4UUAA 1JSLA 4DBZA 3HJTA 1B8OA 4N6GA 2BGLA 3V6MA 1I4DD 3OEHD 4HZIA 3GEGA 3BCSA 4NZYA 4NJMA 4PYQA 1V8PA 2PWZA 5YASA 3JALA 5HZHA 2NVUB 3KO8A 5HQ3A 4DZZA 1AMUA 4MP8A 1J8YF 2VTKA 5FUXA 3WIBA 3H9GA 1RJ9A 5FA8A 1BW9B 1ZINA 2DY0A 1I7LA 2HH9A 2O4CA 2YMLA 2B83A 3K3PA 4DLNA 1JWLA 5FCDA 1CZHA 4DRZA 4J4HA 4I9GA 1VDZA 3AJRA 2MJLA 2XOKD 5E1DA 5DLDA 3LVBA 1FCJA 1C7QA 3LBIA 4IILA 5AOCA 5H59A 2JD0A 4BP1A 4I14A 1JH9A 4MAAA 3FA2A 5JE8A 3UOAB 3TNJA 2GR9A 3R0VA 1V39A 2Q2VA 1RZVA 3RYFB 3MBIA 1YL5A 1E9AA 2HIGA 4IWNA 1SD2A 5IVKA 4MQBA 3LF2A 3UA3A 4AMZA 3O93A 2O8CA 4LVOA 3TQFA 1CNMA 3K9LA 3RHSA 1JEQA 2YUIA 4PX5A 4CZ2A 1P5FA 4B6EA 5L45A 1BCRB 3CXRA 4I55F 1LCIA 3AV3A 4KQIA 3BD8A 3E4CA 4AYXA 4JV5B 3T7EA 2ZB7A 3EGEA 4ED9A 2Z8YM 4WKBA 2OHJA 3I5YA 1ICEA 5G0TA 5IDYA 3GDHA 4MWCA 4EA8A 1EIWA 1EIZA 3BB3A 2WNSA 3CLUD 4UBMA 4KR0A 3GLUA 4URZR 3JPWA 4K6MA 1B00A 1LBSA 1EXVA 2A35A 3QPAA 4EB6B 4HQLA 4LWOA 4DCUA 5H5JA 3DGFC 3WKEA 3QMPA 4KXXA 5EIWA 3Q9SA 4B8WA 5B30A 1VPWA 3KX2A 3KEMA 5C7OO 1K3FA 1RP1A 1RYZA 3BDAA 3FPBA 1WUIS 4BRUA 2JLAA 2CXXA 3EJ6A 5KYXA 1GTSA 2JVKA 3FFXA 1UBNA 2MINB 3CEJA 3VHLB 2KLBA 1PR1A 1BJKA 3NDBB 5HX7A 3L77A 1V95A 4R6WA 5D3MB 2ZPTX 1S8NA 4L5AA 2EATA 1G17A 3E70C 4WZAA 1QYWA 4ZZ2A 4BCCA 1QHXA 1W44A 2HA7A 2Q3CA 4LJKA 3QFRA 1J9GA 1JILA 1MORA 1KYWA 3F6PA 4YP0A 3KJNA 3AG5A 4MLZA 2Y6UA 3WDSA 4D9CA 4GEKA 4ZYVA 1IY9A 1HYBA 1Q92A 1S8FA 3QW2A 2VDJA 2ZI4A 3P2YA 4GC9A 4HDAA 5KTMA 1POWA 3AM3A 1CK4A 3IUJA 1C9EA 1QVWA 1BRMA 2QI9F 4H0CA 1LV8A 4UEJA 4BEJA 4P4SB 1AQLA 3TW0A 1A1SA 3EVEA 2AQIA 1HYHA 3RAEC 4JWKA 4ZI7A 2EL9A 4DSZA 4HHEA 1JHYA 2DUUA 2O1SA 2ZSFA 3HR8A 4Q93A 3TWOA 4ZI2A 1UT6A 4YJKA 3WZLA 3AI3A 5CM9C 3TQRA 4LBZA 4H16A 2FHPA 4PHFA 3IUMA 4EKEA 621PA 4XSHA 1IMOA 3OP1A 3KPUA 3WV5A 2BYTA 1Q2XA 3W34A 5C1PA 5BQXA 3BERA 3PUIA 1OWPA 1ST3A 3D1LA 3SZOA 2Q9CA 1NN0A 1UQUA 4R1SA 4U2BA 1VLHA 2V4MA 3L49A 4W5JA 3K8ZA 3KPJA 2GVNA 5ESRA 3BWEA 2Q2WA 3TPFA 4QFDA 1EWYA 2YTZA 3NYQA 6ADHA 1AA9A 3B70A 4AMVA 2Y1DA 3BXOA 1UEXC 4F60A 4PZAA 3W5AA 4G2NA 2AZ4A 2ZU0C 1UBUS 3WOHA 1CBUA 4CLRB 4A6PA 1TECE 5FNVF 3F3MA 3WQHA 2ATCA 2M9MA 2QE7D 3QELA 1DAFA 4U6QA 1A8UA 4Q66C 3GH1A 4FYXA 4YJDA 4ZOLB 1T3HA 1RXEA 1WULS 4JCCA 4GI7A 1DC5A 3WSWA 4HVCA 3P32A 3QVLA 3O73A 2P2LA 3KPYA 3UJ7A 4D0GA 4UATA 4U9HS 3NTLA 1JA9A 3DT6A 5CR9A 4GL2A 1L7OA 1O95D 4JLJA 1GGNA 4J8PA 4U7TB 1TO1E 4IGIA 2IH2A 3G2JA 1CV2A 1DHRA 1PBTA 4JNKA 3AR3A 2W5UA 4OB6A 2R1VA 4R98A 3R40A 3FOAA 4OXIA 4XPIB 3S8YA 4Q82A 1M8PA 1FNCA 1DTEA 1G4UR 2JKYA 2Q8QA 3EVFA 3FNIA 1QRDA 5GWXA 4XVUA 1AS2A 2QTRA 2HOQA 1EJ2A 2C5SA 4XX1A 4WXHA 1QKIA 5JYBA 1Q2UA 3S8MA 1NXQA 2NVUA 3OKCA 4F5DA 5DNUA 3OWXA 3U61B 2GX6A 2G0TA 3TUTA 1BW9A 3NC4A 2YV4A 3M5WA 4J0CA 4KB5A 5AM2A 4NXNB 4FCWA 3RS3A 4KVFA 2CK3A 5PNTA 5J4KA 2JIRA 1OPXA 4A8JC 4IG4A 4TWIA 5CM2Z 1MDBA 1UK6A 4V39A 1PYOA 4C29A 3L05A 1J2JA 2NAPA 5JS2A 3FVTA 5DI3B 1LBIA 4YRPA 1B1AA 4RL6A 4F1KA 4I1OA 1HZZA 4ZCPA 4C14A 1T4CB 5DSXA 3ZGZA 2ZIEA 4R3UC 1U6JA 3P9QA 3D5TA 3BBPA 1ANKA 1OT5A 3GJQA 5DNWA 4TWJA 4Z4IA 1MO4A 5E0KB 2YX1A 3MRVA 3WRXA 1MEJA 3JW8A 2EFCB 3CKLA 4QGFA 1HRDA 2QE6A 4QXPA 3P2JA 1FYWA 1O9GA 3WJ2A 1DZ3A 2I2XB 3LK7A 3BMNB 4GZ6A 1NKSA 5T67A 2P6NA 2PL5A 1QO9A 4J75A 1IZYA 3FTDA 1PK8A 2CLKB 5AKYA 4G36A 4JB3A 5AHXA 4OM8A 4CQLA 3ER9A 5CVCA 3EMVA 3R5XA 4WV3A 3EDOA 3NHRA 4EB6A 3WO0A 1WSWA 3EASA 3GMTA 1GHTA 3K09A 1FTGA 4UW9A 2ZREA 1D8TA 1GIAA 2BBOA 2PKEA 4FMBB 4H1HA 1AOXA 3LECA 1CZNA 4TSFD 4TYMA 4FN5A 1E0AA 4RK7A 3IAFA 1UKZA 1KJ9A 1A9SA 4OIMA 2HSDA 4FS8A 2DSTA 1Z82A 3NNSA 2C5EA 4FW9A 3PIDA 4YFYA 4A0GA 5EVCA 2LKCA 2RAVA 2GTPA 2MINA 2HHAA 4LG1A 2OORA 2IYAA 5E7QA 1DQYA 1U1EA 5DW0A 1ZIPA 2OD2A 2M1XA 2RKOA 4HWOA 3HP4A 5D3MA 2X7HA 1JR2A 3QU5A 4WMLA 1HRKA 1E6KA 2KM1A 1E92A 1MH1A 3HZRA 5EUQB 4BO4A 4FSDA 3EEYA 2CXHA 2JGLA 4RM2A 3Q8MA 3WB9A 2ECFA 4OXRA 4DDVA 4TM8A 3SHOA 4D45A 1OTHA 1T5OA 2XCTB 3UPUA 3U37A 3EWIA 3EDCA 1W4AA 3KLOA 4BMVA 1IRIA 1A7AA 3QEJA 2D7JA 4Y1FA 1PT9A 4RXMA 1LNZA 2PL3A 2X22A 1WDLA 2WAOA 2AEEA 1L7NA 3JWPA 4P4SA 4PW0A 5M6DA 5DSTA 5BORA 4KXYA 4X6UA 2CEKA 4N5NA 2VO1A 2DULA 3HYLA 3VHQA 3WQBA 4NOMA 2RSLA 3QU4A 1FJ2A 1FP4A 3GJ7A 3Q0TA 4IIHA 3D64A 1T9DA 4ND8A 1YHZA 4NV0A 4O3MA 1OV4A 4XM2A 1QHSA 3WICA 1SVIA 3L8EA 3T1YB 2OBBA 4Q7LA 4E70A 4CKWB 3AVQA 3HI4A 2H4WA 2C5FA 3UA4A 3FSJX 1E3QA 3ETLA 1Y6FA 2K5UA 2H08A 4QKQA 4D2IA 4ZIRB 2DQ4A 1RHUA 4Q1DA 2OG2A 4XYMA 1TUIA 3GX1A 2VCHA 4KE7A 5BPHA 4N0DA 1HZJA 2GZAA 3HZOA 1VJTA 4TTJA 4R8MA 1J1IA 2FSVC 2EZ4A 3CONA 4G8CA 2LPMA 2DLDA 3EAFA 3S2YA 1GTRA 1NVAA 1C9DB 1R4NB 1M83A 3BC1A 3V8BA 3INRA 3HB0A 3K0BA 1TF7A 4C6RA 4PO1A 2OXEA 3HE3A 4TS4A 1UM8A 2H59A 4V3BA 3TAHA 5FOQA 4LJ5A 1Y5IA 5BRAA 1GRRA 2VP5A 3TCKA 1KHHA 4ZOLA 3EBOA 4ZCMA 1GPKA 1MAAA 3THSA 2E4VA 1E1LA 5IH7A 4XW2A 1X0VA 4ID9A 1MNAA 4I4TF 2O1WA 1PQUA 5FTMA 3W4IA 1ZD4A 1OX4B 1QTRA 1EFRA 2V7XA 4MUIA 1T1JA 3P94A 1PEYA 1YVPA 4W9RA 3JQGB 5D2CA 3GEIA 3L0YA 4P2GA 1GR0A 1E4YA 2YYAA 3FMIA 2Q1WA 4OF4A 1N5MA 4R84A 2QXTA 5BSMA 2W00A 5CA1B 3SR0A 1RWPA 4OLJA 1R0CA 2C58A 3JD0A 3T3PB 1E6WA 3UZUA 3YASA 4N8DA 3S2ZA 2HL6A 1PZEA 3N9IA 5I9TA 3ZVKA 4LE0A 3NJRA 4U9UA 2ODQA 5A02A 5DNEA 4DDTA 3R5JA 1XZFA 2P90A 2Q5CA 2OHOA 2QVBA 3FPSA 3RSQA 3GUYA 1WUTA 1YB7A 2GPBA 1NPTO 2YJGA 4G0YA 3P5BA 1GGHA 4F5YA 2UXCB 1WZUA 1Z8HA 1ZKMA 2Y0EA 1SKMA 3DMPA 4US1R 4HPWA 4R9RA 3UV6A 2FMTA 3GLSA 1Y1RA 4ZOAA 5EAIA 2VJLA 3FPKA 3TDMA 1M54A 3CSSA 2XMZA 3PENA 1IG3A 3KKLA 4CLXA 4ZCTA 4X7MA 3FHTA 3L8GA 3X2EA 3RC3A 2XB2A 1YR9A 2ZOSA 4BWFB 1GN8A 1QIKA 2IQ5A 4XYGA 4D4GA 2AD5A 1K6JA 4BNDA 3S1SA 1T5DX 3NYRA 3QYPA 4Z5XA 1RABA 3LKDA 3FHCB 3L1UA 4U8HA 3CR8A 4EKIA 1I4LD 1CB7A 4FFNA 2ZETA 1N0UA 4Q37A 1T4CA 3FLMA 3IBFA 3AF1A 2G6TA 3QV1A 1DX9A 1K7XB 1KEUA 2A0YA 4ZQBA 5FJIA 4AECA 2I7VA 1U7XA 1QBGA 1W46A 3LE8A 2VAVA 5K8TA 1SZJG 3KETA 4M7RA 5JZBA 4Z1OA 3HNPA 2YFQA 3IODA 2Y1CA 1BQ3A 3P0JA 5GV8A 3SC6A 1ZOSA 3FMPB 3AZQA 5HIMA 2C5GA 3HKCB 2GXUA 4V0RA 2FY8A 4C7OB 2HLNA 1YI1A 1Y80A 2JI8A 2R4QA 5LP6B 1M2EA 1O7JA 5A6SB 1WXIA 2OCPA 2CXSA 1XZPA 4KIFA 4MARA 3NMUF 4MLDA 1XYYA 1NLZA 3PPYA 2A0UA 1CUSA 2J6CA 4GVLA 1G6OA 4NYJQ 4DUPA 3A1EA 2ZUBA 4IJ5A 3WKBA 3N8DA 2CD7A 4KAFA 2HLDA 1NU8A 4MCHA 2A9JA 4P92A 4E5KA 2BJWA 2IYUA 3P9IA 2H3HA 1J0DA 4P7BA 2GESA 3DAPA 1VSBA 5AI6A 1O3YA 3AESB 3LLMA 2OC9A 5AQEA 2X86A 3C3JA 5LJLA 2O2ZA 2ZSDA 3ZCSA 5DM70 3LDFA 3SYKA 2ZYRA 3TBFA 4WK2B 1CRZA 1MQ9A 1UEJA 1ZCAA 4QD3A 2ZYGA 1C7RA 4D81A 2NSYA 3AQIA 3SEFA 1HETA 2VQEB 2BFBA 2PT9A 3LBHA 4IFEA 2DERA 1KTIA 1NM5A 3JQAB 4DR5B 3H8WA 4UAJA 1JDUA 3EF3A 4DLRA 3KOZA 2AX4A 3BEOA 1O5IA 2DBZA 4TTAA 1UPCA 3W3AA 3QX7A 2WJVA 2DHQA 3OURA 4YONB 5KNDH 2CDCA 3DWGA 2V03A 1YZYA 3CH5A 3GQVA 1AKVA 1Z6XA 5CVJA 4ZPXA 4DQXA 3ZW9A 5JD6A 4YHHB 4HQNA 4FGSA 5A3VA 3ZR4B 3MMXA 1M8KA 3MS2A 3CR3C 1QG6A 1YIOA 1QX3A 4RCZA 3DH0A 3P9XA 5GONF 5LC1A 4WFIA 1UJBA 3M5PA 5EXXA 4YAIA 2GJ4A 1YZGA 3GLQA 1U3UA 3JRXA 1JI3A 5AH0A 5LNK1 2I9PA 4JROA 4CKWA 5K8UA 2ZBUA 4RK6A 1FL9A 2H07A 2JI4A 3FOBA 4Y2GA 4F2HA 4Q9HA 1DIOB 1PNVA 1AKRA 1W88A 2OB1A 3ISTA 3P0FA 3S7TA 4AY4A 4MUXA 4ZIRA 5EWLB 3HM2A 3P52A 5DCYA 2I2FA 5CFRA 2OBLA 2MWMA 3ZCQA 1WPGA 1SMKA 3PGJA 4GSKA 4FR5A 4BJ1A 3MTAA 2AG6A 5DM2A 4CCSA 1E0SA 2VF8A 1ZXLA 5BN5B 5EL0A 1GL9B 2JIQA 1UWKA 3NB0A 1GTJ1 5D7NA 3WIEA 4D9FA 1H6BA 2FN3A 5DTIA 1C3EA 4GKVA 4OHFA 2JDIA 2P1ZA 2P9TA 2Q2NA 4FZVA 4JY7A 7AT1A 5L53A 2IPOA 4G56A 1IM5A 2C9MA 3R0ZA 1M7HA 3VDQA 4D8UA 4IQGA 1H93A 2IOHA 1C3XA 2WJ6A 3ESAA 3HCRA 1MQSA 1YB4A 2PYIA 1CDZA 3EXG2 5BYBA 4F46A 3B5EA 2C29D 2VYND 5T8KC 4F7DA 1RLIA 1K2WA 2VVTA 4HDRB 3AM1A 3CUWA 5B57C 3FVWA 1FUIA 5D3KA 5DM4A 4QQFA 2DWQA 4POAA 1WS6A 3LA6A 1MB4A 1BAPA 1YZ3A 2D59A 1OZHA 4Y6RA 2ZIGA 1ZSVA 1GNTA 4EI8A 1KMMA 5TPZA 3FYUB 3CKMA 2WM2A 1D2CA 2LGJA 3N39C 1UKVY 2R68A 1E5DA 2VYVA 2W22A 2LNDA 3CU5A 5EE3A 4LRTB 1G20E 2CKMA 2P9JA 4DA0A 1WG8A 4BFSA 1DLJA 3A2NA 3ROZA 4C7XA 2FK8A 1NI4A 5IFKA 2ZWIA 4W1SA 5EWJB 3WL4A 1ZDMA 2YWHA 4AJEA 4AS1A 2E48A 3ZHQA 2JIZA 3EXIB 2B5WA 4P2BA 1S1CA 2XUIA 2GSWA 4KYUA 5T6MA 1R6UA 3F2VA 1C1HA 4AJ9A 4EHAA 1GYPA 1IY0A 3C24A 5AJUA 1ADGA 1SKBA 3G9QA 4AKTA 4PR3A 3TNYA 3MMZA 3D2CA 4UQLA 4OLBA 1FDIA 4MQ4A 1Q77A 4YP9A 1NVXQ 1T9AA 3GRFA 1J06A 1WNTA 3PFCA 2A7QA 5EQDA 3RFXA 1M1UA 2NYUA 3RK4A 3B52X 4DBLE 1I7NA 3WKAA 2FXIA 2IYFA 1XK6A 1P2UA 2YQZA 3R7WB 2IEZA 1OC2A 2F67A 2X4GA 1T9GR 1LFDB 1TJ4A 4HWTA 5F4ZA 2QW8A 4D92A 1KQNA 1CUBA 3DBLB 4PX2A 3VU0A 5DX8A 3E8XA 2JIPA 3UK1A 4BFUA 5A5DA 3JVEA 2VK1A 4A10A 3HK2A 1OIWA 5JSUA 1Z18A 1O4VA 4FDVA 2ZRHA 3KUCA 4N65A 1FYFA 1NI5A 2C3OA 2VXBA 2GRJA 1X1EA 1EK6A 2J7PD 2FDRA 3D6UA 2XQVA 2Y0PA 2I80A 1J00A 3HKCA 3FDJA 1OA1A 4JJKA 4C7OA 3ANMA 3EGWA 1L5ZA 2IU4A 1NX9A 2JFGA 2YXEA 3D6MA 4HS9A 4IUBS 4J16A 1RDFA 2AUTA 4MGHA 3WGVA 4YPVA 1JHQA 3HLKA 3MUFA 1WZCA 3WGZA 3IVGA 4F6LA 5E4FA 1KEPA 1X7XB 1JQAA 2FN7A 4TKLA 1FS6A 2NTJA 4TRMA 2V5UA 1Z29A 3N2IA 3QHPA 4AJPA 1NUAA 2V0CA 3C1UA 4IIXA 1RJDA 1ZRSA 3KXLA 4QBKA 5D85A 2FEMA 2Q8PA 2ZJ4A 3IP3A 5DYNA 4EKNB 4FYPA 4XSGA 3U13A 4KGZA 1YBFA 4WOKA 4P3KA 2GF9A 3N58A 4YQYA 3DJYA 3DMTC 2BEKA 3OZGA 4MRSA 1GAQA 1RI2A 5HNKA 2ZS8A 1P73A 4JODA 3P1JA 4IDBA 2F43B 1G38A 3A1UA 1UZMA 1HSZA 3DZHA 3E9NA 3QOWA 4KLZA 1K97A 2ORYA 2YY7A 4L0MA 3KG2A 4IZIA 3ZJYA 4DLSA 3U3RA 1BOOA 4LVCA 4N48A 2AI1A 2WDZA 4MDHA 4FQ7A 3S40A 1D6SA 3KSAC 3ZZTA 4DARA 3VOBA 2SHKA 1ZBQA 4ITVA 3V80A 4J1TC 2YJ4A 4L85A 4PSKA 2HQOA 3U40A 3BT7A 3OLVA 4FHCA 2AVDA 4ZI3A 1L9XA 2J0VA 4NEQA 1THZA 1QWOA 5DNDA 3GFFA 2DPHA 2PGAA 4WNAB 3RT7A 5ABPA 1X7ZA 2PZAA 3IE0A 4BNKA 1ZU4A 1HDEA 5LZ2A 3EVNA 5AKJA 3KUKA 5FT9A 3RSOA 3CH4B 4C0WA 1Z3IX 5IK2A 3L8HA 5FBHA 4GPD1 1Q1GA 2DY1A 1SVOA 1JDVA 1O5TA 4PY2A 4QOHA 5DMHA 1TU0A 3C6QA 2A8YA 5HCNA 3P19A 3Q5DA 3H18A 3GR6A 1RLOA 4WINA 3B1VA 4C9BA 2VHXA 3DNPA 3OMWA 4MWOA 1FVFA 4BN0A 4YCMA 3LGXA 3B82A 4MUNA 4U0KA 3RKUA 1DKQA 4IM7A 5BN5A 1U2GC 2JLWA 2R7KA 1PT8A 1GY8A 3N8NA 2JJ1D 2QB5A 1CDEA 1XLUA 1HTTA 1W49A 4Y67A 3C8ZA 5HILA 3RUIA 1GFZA 3AFGA 2EJBA 3S2GA 2M6RA 1Q17A 1MRZA 1XVUA 1U65A 4C08A 4IIJF 2O07A 4NWIA 1TKBA 1ORRA 3A58B 2WWWA 3CEHA 3DJFA 3ELYA 4C0LA 1X9HA 3X1MA 5BSVA 3UMRA 4TTPA 2YJ3A 3ZY5A 1I5RA 1C29B 3FTPA 3KBBA 4KOEC 4EB3A 1WB5A 2BAGA 3BQMB 3LY5A 4BLVA 1NQXA 1YQXA 1IOZA 2JFWA 1H2FA 3L4BC 3I37X 3I9JA 1N8SA 3HUUA 4MR8B 2SBTA 1ORTA 2W90A 5FI1B 4EZEA 4ZO9A 4XTCS 3ZOKA 2DECA 1HFJA 2G1UA 2I8AA 4HRYA 2FEXA 2CYBA 2NOAA 5FLXA 4GWLA 1C3VA 4M7PA 4P34A 2GYYA 5JPDA 3CCFA 3QMVA 5IC6A 1P81A 1TYCA 2O2XA 2WAMA 5AM1A 3SXJA 2HT1A 3JVIA 4FOLA 1L6IA 3VV2A 1VKZA 1XKQA 2H2WA 3WWZA 4C5CA 5KMGB 4WZBE 1RKXA 4HDOB 3EXIA 2BVNA 2JZNA 1YNOA 2NTVA 4RLHA 4OY3A 4BAUA 4AAYA 4YMLA 2OHHA 3JARB 3CEPB 3QXHA 5FTLA 3RTAA 3GPLA 1W87A 4UCXA 1VIYA 2GLUA 1NDHA 2FV8A 3OOHA 1N5OX 2O59A 1VSVA 5EJAA 1XZHA 4QDJA 3V8MA 1XMVA 2WPNA 5AOAA 5DNYB 1D9XA 2OLKA 4ND3A 1R0ZA 5K0SA 4KFSA 4WLNA 4O4JF 3F3YA 4PWZA 4X8MA 3R9KA 4D02A 1W0KD 1L5GB 1SBQA 4R4JA 1MUUA 2B37A 3O8OB 2FW1A 3EQZA 4OHOA 2CUKA 2BCGY 1XR3A 1YDFA 2EBWA 1F6DA 2PE5A 2IXAA 1B2LA 2COKA 2IUTA 4KR2A 3LC2O 4LOLA 3DBLA 4Y6GB 3SX4A 1TGVA 2WKRA 3TECE 4AD8A 2O3JA 4B3MB 5DWQA 2OPHA 2G9VA 4QM7A 2XXJA 1QPGA 3CW8X 2VHTA 1VSQA 3OFJA 3BGWA 3QBDA 1EQ2A 1G7TA 4WFQA 5H3LA 1FX1A 1HLPA 3KT3A 3FB4A 1N1GA 3F6SA 1II0A 1U0NA 2QL9A 3WRYC 3RTGA 2BGGA 2CLMB 3V4VB 1DEOA 4QXMA 1WUKS 2FEOA 2WJPA 1MRSA 2AMVA 2XE4A 3IEIA 3ROXA 3GVHA 3Q3JB 1BMTA 4UHCA 1WLYA 2DKOA 4HN2A 4JR0A 1PZHA 1DX4A 1DEXA 1PV1A 1VP9A 5AO9A 1DBRA 4RVGA 2C0QA 5KNLA 4DUGA 1ONSA 4AY5A 1X7XA 4ADSG 2D3WA 4RSRA 1DC7A 3D4PA 3IQXA 4WCFC 3BMOB 3OCVA 4DAEA 2OXTA 2ZCJA 3DCNA 4TWAA 5AW9A 1CEEA 3GJRA 1EFVA 3V1LA 1YA6A 2ONJA 3B2QA 3QVUA 1QHEA 1DKLA 4FOSA 4KI0A 1JIXA 4K6KA 3NKVA 3IBSA 3RC9A 4X90A 1UJ6A 3KCQA 3DE4X 4Q18A 1WMFA 2F43A 5JO9A 3WIUA 3RC8A 3GBSA 2P6MA 2ZTSA 3O0TA 4OI2A 4J07A 4B2PA 4ESOA 2QTHA 5B2FA 3F90A 2NVOA 2G17A 4GRDA 3HY4A 4R9UC 4KO4S 5AM3A 3G7SA 4TV9B 4CDMA 4RJ2A 4Q1FA 5D86A 2CXUA 2Z08A 3QP9A 4JB0A 3A27A 3PIRA 1T8YA 3RTCA 2QBYB 1YQEA 5C8XA 4FI3C 4PINA 3ZX4A 3VR2D 4G89A 1HWYA 3LUGA 2OCDA 3I64A 4LY9A 4QRDA 4P22A 3OQ1A 3TZKA 2C95A 4WNAA 1V1RA 2QOEA 3AR6A 2WNHA 1KWKA 3HGMA 2P9QA 4V0NA 2O14A 2GUGA 2JFPA 1VFPA 1WXWA 1I7QB 3CUKA 2HU7A 5H0IA 1MKYA 1BJTA 2IV7A 4URHA 4AC9A 4E1BA 2I91A 3KKNA 3NH6A 4EA6A 5KWJA 2W58A 3AR7A 3K9NA 3QK7A 4F45A 1FSPA 1OASA 2HTFA 3BTUA 2QZSA 4NS1A 4P32A 2VS1A 2VDPB 2WFAA 3B6MA 3V1YA 4Q21A 3U3KA 4NKRA 1A7KA 1XZDA 4KZKA 4ZODA 2ODNA 1GEEA 2VRNA 1RXUA 3ND8A