2DC1A

Crystal structure of l-aspartate dehydrogenase from hyperthermophilic archaeon archaeoglobus fulgidus
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
236
structure length
236
Chain Sequence
MLVGLIGYGAIGKFLAEWLERNGFEIAAILDVRGEHEKMVRGIDEFLQREMDVAVEAASQQAVKDYAEKILKAGIDLIVLSTGAFADRDFLSRVREVCRKTGRRVYIASGAIGGLDAIFSASELIEEIVLTTRKNWRQFGRKGVIFEGSASEAAQKFPKNLNVAATLSIASGKDVKVRLVADEVEENIHEILVRGEFGEMEIRVRNRPMRENPKTSYLAALSVTRILRNLKEGLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal highly thermostable L-aspartate dehydrogenase/NAD/citrate ternary complex.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords L-aspartate dehydrogenase
total genus 71
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature ec 1.4.1.21: Aspartate dehydrogenase.
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01958 DUF108 Domain of unknown function DUF108
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2dc1A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dc1A01
2Y68A 4RF2A 1KY4A 1U8FO 2NWQA 3AK4A 2BLLA 1NASA 1FDUA 5F21A 2HCTA 3DAPA 2ZB7A 3NYWA 1Y9AA 4E32A 3M1AA 1TXGA 3E1KA 1W4ZA 4KP7A 1VSUA 2XF8A 1R6DA 4XD2A 1IB6A 2H63A 2GASA 1UAGA 4ND4A 1H5QA 1ZBQA 3U4IA 1RM4A 3AI1A 3W8EA 3KO8A 1A9YA 2HSDA 4A03A 2HKIA 1EBUA 3E82A 1R4NB 2RBEA 4E30A 4F45A 2WD7A 1XSEA 2E37A 4I1IA 3OSUA 4QQRA 3AUSA 4W7HA 4B4UA 5IZCC 5HS4A 3OQBA 3FF4A 4FN4A 3OIFA 1U2GA 1JAYA 3LF2A 4J9VA 3M2TA 3WYCA 1PJ3A 4NMHA 3RIHA 3UUWA 4J16A 3WNVA 4DBVO 2H5LA 4DVJA 1ZEMA 3PP8A 1QMGA 2PTGA 1I3NA 5DP2A 5BR7A 5JXWA 4DPMA 3ITKA 4CM7A 4CV1A 3B1JA 4JJGA 1I01A 1PJ4A 3D5QA 1C1DB 5T8KA 4D41A 1E6UA 1Y9EA 4KQWA 3DZIA 4IDAA 4TWRA 5BNIA 5KKCA 1RM0A 1HLPA 1HDGO 3NDJA 1BRMA 1K6XA 4BIIA 4RL6A 3I3OA 4WEQA 3EDMA 2DM6A 4E2YA 5H81A 1EUDA 2HMWA 1FDTA 5ENVA 2IE0A 3DWFA 1EUCA 4B8WA 4J1TA 1I3LA 4DIOA 3GQVA 3PGJA 2D5AA 3H5AA 1E1NA 4PG7A 1E5LA 3F1KA 1WDLA 2Y1CA 4CM5A 3NT4A 1D3AA 4FQ8A 1QLJA 4QSMA 4XCVA 1SNYA 3QA9A 1BDMA 2EERA 5C3MA 1ZMOA 1D1SA 4MIYA 4IZHA 4WNCA 1JTVA 1ADGA 1ZJYA 2B5VA 2JAPA 5CFZA 5CP8A 3U5TA 3HDYA 3AY6A 3WWZA 3PPIA 1HYHA 2BI8A 1XYGA 2J5KA 1H6DA 1PS8A 3FNFA 4TKLA 1OC4A 1I2CA 4XWYA 1IL0A 4DBZA 3KETA 1RM5A 1E7YA 1U3TA 3FWZA 4NJMA 1NFQA 4XGIA 2C29D 5TNXA 3W8FA 1FK8A 1IUKA 4YTEA 3O8QA 4IJVA 1JDJA 1M76A 4IQ8A 3K30A 2D4AA 2BFAA 2V6MA 1TVEA 1QG6A 4JROA 4XYEA 5A1TA 3DBLB 4G5HA 4LVCA 3T7EA 1DIRA 2B4QA 3L4BA 2NACA 3A1NA 1SB9A 4FCCA 4RPLA 3WQSB 1DHTA 1LNQA 3RCBA 4GX5A 3TZ6A 1E77A 2AQKA 3H9UA 1AE1A 2Q2QA 3VH2A 4DXHA 1CQJA 1B15A 1RYEA 2CDCA 3LVFO 2ZCUA 4FJ2A 2VHZA 4OSPA 4WJZA 2PNFA 4Z0PA 2ZCVA 4FDAA 3BHJA 1E7SA 2VOEA 3ZN2A 4MIEA 1PQPA 2X0JA 5TRTA 2QZ9A 3ETDA 3DBRB 4JBIA 4WK6A 2NU9A 1EUZA 4H3VA 2Q1WA 3QIVA 9LDTA 5CAEA 4XJTA 2W2LD 4IDBA 4CMEC 2X86A 3H5RA 2VT3A 3FTNA 1CERA 1TEHA 1HL3A 2OP0A 2SCUA 3RKUA 1HDOA 1IE3A 1F12A 4BNKA 1LLCA 2CVOA 3BMCA 2O4UX 1T1RA 4LGVA 3D4NA 1GYRA 3PJGA 4GMFA 3HFSA 1B3RA 1TB4A 3ZGYA 3D4OA 4OJNA 2WJPA 4DC0A 3RC9A 4FOSA 2V65A 3VH3A 5T6BA 2PWZA 3TOXA 3VHRA 4KTTE 3JYQA 1C0IA 4XIYA 1Q0HA 3SC6A 3V2UA 3R0IA 3GMDA 4YJGB 3HADA 3TSCA 2C0CA 3JQ8B 2RAFA 5I9NA 3OJEA 3GNTA 1WZIA 3WGZA 1WZEA 3GGPA 4XDZA 1LSSA 1I36A 1P9LA 2ZB4A 3SLGA 1E3WA 4XQ9A 2Y05A 3VVBA 4PN3A 3O38A 4NIMA 1GPJA 4TRJA 4MKZA 3PRJA 2C5EA 1Z7BA 2Y0EA 2AEFA 5G4KA 3I9MA 1YB5A 5ILGA 4YJHA 4UVIA 4D79A 1C1XB 3F5SA 4R51A 4RCVA 4BQPA 1M2WA 1E1KA 4J2HA 2G0TA 3PDJA 1ZNQO 1GEEA 1U28A 3AUTA 3TZQA 2JCXA 1Q7CA 3E8XA 1PR3A 3IIEA 5KJCA 4P38A 1GEGA 2FPIA 5GY7A 4BO2A 4L74A 4NPCA 3GZNB 2PY6A 5JFOA 3S8MA 1KYQA 3L9WA 1Z82A 3IC5A 4CMAA 5TSDA 3F4LA 3IAHA 4DLAA 4IXTA 1Z45A 1HEUA 3KVOA 4NZ9A 1P1IA 2VNSA 2BGKA 3PHIA 3OBBA 5F1KA 4MINA 2DUUA 1B16A 2WTBA 4R4JA 5J9GA 2PGLA 2CDBA 3O4RA 5FF9A 3WTBA 1H9AA 2HDHA 3OFSA 1WP4A 2EGHA 1DFHA 3RUIA 2BELA 4BNVA 1DAPA 1S7CA 1ENZA 1KEUA 4DWVA 5L7TA 3AWDA 1PS9A 2VN8A 3ZWNA 1A4IA 4EEZA 1DLJA 1O0SA 3NV9A 4L76A 3WQRA 4NG5A 3IDSA 4HFNA 4PLTA 1NWCA 4U8GA 1BG6A 1IYZA 1I2ZA 3GPIA 3WJ7A 5CEFA 4E3ZA 1NVMB 4BO3A 4WCFB 3KYDA 3ULKA 1ENPA 5AXDA 4H7PA 1SB8A 4QT0A 2J3HA 4BNXA 4L4RA 2P5UA 4HFRA 1U4SA 4Z9FA 2IEDA 2RH4A 3V1YA 1E1LA 1UXGA 1NHWA 1JVSA 3ZHZA 1ZK3A 4M89A 5GZ6A 4U7WA 4GX1A 3ZNPA 3NTQA 1NQAO 4JGBA 4CQLB 5JAMA 2A94A 1CWUA 3ON5A 1E6EA 3W4JA 3QY9A 3OQ6A 3A14A 4ND3A 3EZYA 4AJIA 1Y1PA 1GV0A 1AHHA 2PZLA 4UAGA 3LSYA 4ZA2A 3WQQA 2GDZA 3LLSA 1ISGA 4EEXA 1NPDA 1ONPA 2BF7A 1OZAA 5BSHA 3GRKA 5A05A 2NTJA 3EC7A 4KQXA 3NJ4A 2GERA 1LDYA 3K92A 4BO8A 5EQFA 4UEKA 1YJ8A 3H5NA 3OMLA 4ALMA 5JC8A 3BZUA 3DFZA 1SZJG 2Y1OA 1R66A 2ZJ1A 3GMSA 4RGBA 3Q6IA 3VPHA 4YDRA 3KHUA 1H2HA 3NDRA 2EJWA 2AE1A 3VPGA 2EJVA 1XCBA 3MWDB 1AHIA 2YV3A 1DJNA 1V6AA 3GVCA 1SC6A 3WX0A 5T5QA 4DC1A 2Q46A 3KZVA 2NTVA 3WGOA 3S55A 2FY8A 1EMDA 1F17A 4PLVA 3HDJA 3H9EO 3UN1A 5HBRA 3PXXA 2W2KA 4M87A 2OFPA 4RVDA 2BGMA 3OJ0A 2Q4EA 5EMHA 3WWYA 5KIAA 1ZXLA 4Q9NA 5DDIP 3TOZA 3DQPA 1R4NA 2BRUA 3PJEA 3WICA 2Z1NA 3GGGA 1BW9A 4J4TA 1DC5A 1U7HA 3C1OA 2PKRA 2BMAA 2NSDA 2Q1UA 4Y6PA 5JW6A 2C2XA 1QYWA 1EVZA 1R0KA 4B7UA 3OICA 4Z0TA 1G0OA 4X54A 2WMDA 4L0QA 4YRDA 1EQUA 1LLQA 3K6JA 4RDIA 4OQYA 3QWBA 1N9GA 1Y7TA 1LC3A 2YW9A 3ROPA 4MDHA 4RF4A 2CVZA 3GFGA 4GBJA 4MVJG 2X9VA 4OOFA 3VTZA 4JN6B 3RUEA 4E5YA 3AOEA 1NFFA 4KTVE 4S3MA 1UP7A 2BD0A 5JE8A 4H16A 1PZFA 4BV9A 4DLLA 4NDNE 3ETGA 2PD4A 3VZRA 3FR8A 1PJTA 3MJTA 4BV8A 1HE2A 3W1VA 4JJIA 3PWSA 3WMXA 4NU6A 1KEVA 1GQQA 1N1EA 2EHDA 2YDYA 3CH6A 3FCOA 3LT2A 1U4OA 3MJVA 4QTZA 4TRRA 4WE3A 5G0VA 5IAAA 1GD1O 2X5KO 1PL6A 1N2SA 1WPQA 4CM6A 3DHEA 2DBZA 1T2DA 2DTXA 3GAZA 4MP3A 4FSHA 4JBGA 2CF6A 3UKOA 3ADPA 5CDYA 1VM6A 4FFLA 4CL8A 4M55A 5BNFA 4PLCA 1Y5RA 5EIOA 1A9ZA 4IMRA 5ICMA 4Y67A 2OO5A 3LC2O 1DRUA 4PLPA 4GAEA 4D7AA 3DONA 1MV8A 2ZTVA 4P22A 4LVUA 3INTA 4ALLA 4CM8B 3PWKA 3HB5X 4WCFC 1EQ2A 5BSFA 3ZWPA 2AG5A 1N92A 3VPXA 3A28A 5J23A 1HE4A 1N9GB 2EIHA 3ETEA 4D0RA 2NUAA 3GGOA 1BVRA 4RV9A 2LDBA 4YT4A 4WUVA 1XKQA 4WCFA 2PA3A 2FWMX 3KBOA 5HRUA 4A73A 4UUOA 4D46A 1U3WA 3MTGA 2X23A 4C4OA 2Q50A 3ZV5A 3VH1A 1X14A 4AJNA 3GDOA 1KVRA 4LMRA 4II3A 4BNHA 2IXBA 1BHSA 3F6YA 1J6UA 4OM8A 1TT5A 4KUEA 1KVTA 4PVDA 4XYMA 1GQYA 1YJQA 2E49A 2JD1A 2O7QA 3NTRA 3I5MA 4AVYA 1EBFA 1A7KA 4U5QA 3W6UA 4AJJA 3KLMX 3KSDO 2DBRA 3LZ6A 1ZXBA 4B3IA 3E5RA 2VUUA 4I5GA 1LSJA 5JYEA 1X7GA 2FR8A 3RI3A 5IXSA 5TC4A 2PKQP 4CMKA 5FEUA 2E6UX 4EW6A 4YCAA 1B3BA 1DDOA 1JU9A 1FF9A 4JK3A 4CMIA 3DL2A 1HKUA 3G17A 4F3YA 1UDBA 4ZQBA 2A92A 2PLAA 2EW8A 2G17A 3BMOB 3ZU3A 3JQ7A 1E3JA 1LRKA 1ISMA 1E3SA 3H2ZA 5G4KB 1ZK1A 4CMEA 4F46A 3EY4A 4CM4B 5JNLA 1UAYA 4OKNA 1E3WB 1K89A 4R16A 2NQ8A 3UOGA 5I7VA 3ENNA 2NV6A 1J5PA 3A4VA 3JQFA 3UVEA 4CQMD 4BUCA 4GVXA 4R41A 3UW3A 1NR7A 5AYVA 5L95A 1EDZA 1I10A 4CL3A 4FR5A 5GZ3A 1LLUA 3LK7A 2EGGA 4GLLA 4TVOA 5F1OA 4RVSA 5C5IA 4YQZA 3CPSA 3QQPA 4RF5A 1EVIA 3ZU2A 4Q3BA 4RVHA 5A03A 3E9NA 3KOUA 5JPIA 3I83A 3AUAA 4UVEA 1M6HA 2C82A 3Q3CA 4L4XA 5JAIA 1DIGA 3H9JA 3C24A 2VQ3A 4FJ1A 4Q3NA 2AEJA 2GN4A 4O6VA 3D4PA 2R00C 5FWNA 4JIGA 3ZI0A 9LDBA 3C7DB 4MP6A 5KVVA 1OOEA 1LA2A 2ZB8A 4IDDA 4O63O 1ZSNA 3ROMA 6ADHA 1PWZA 3H8VA 4Q3AA 3F47A 4ITUA 1I30A 3BTSA 1HF3A 1XQ6A 5JCJD 1JW9B 3PHJA 2Q1TA 3G1UA 1C1DA 4BB5A 3PYMA 3GEMA 4B79A 1ONNA 3TQHA 4ND2A 3WBFA 3FI9A 3PQFA 3JYOA 4WECA 3RFTA 2YFHA 5KJ1A 1MUUA 4XRGA 2HMSA 1DRWA 5KKAA 1NVGA 3DBVO 1LSOA 1P3DA 1RYDA 3GDFA 1O5IA 4E33A 1HYEA 2GD1O 4BGIA 1PGJA 2C7GA 4CR8A 4FGWA 5AOVA 3U3XA 5JDCA 3D0OA 4TZTA 2PD6A 4QX6A 3GN2A 5IG2A 1PEDA 4XEHA 2Q1SA 3L6EA 3VKVA 5JBIA 2HLPA 3OM9A 3ONDA 2H9IA 1LXCA 2VWHA 3JD0A 4UVHA 2NM0A 1QYCA 4XGNA 4J7CA 4U6SA 4BNMA 3FR7A 1BXZA 5JMPA 1BXKA 4GSLA 1R37A 4GH5A 2OBYA 4AG3A 4OXKA 4AJ2A 4E4YA 3W6ZA 3IL2A 5TT1A 3TN7A 3IJPA 4URFA 3F4BA 4BMSA 1KC3A 4DIBA 3UFXA 2FZWA 3RU7A 4Y6SA 1H6BA 2B4TO 4J3FA 1GCOA 1JWAB 4PLHA 1FDWA 4CQMB 3CXRA 1MG0A 1SMKA 3E18A 3ZWVA 4YAGA 5IN4A 1PJ2A 4WOJA 5TGDA 2JL1A 3S2FA 3AM3A 3OIDA 4J90A 4WNIA 3I9LA 1K0UA 3JYLA 4XJSA 3CMMA 4WGGA 2YZ7A 5IDXA 3H9QA 2CUKA 3MOGA 1QLHA 3LYLA 2W8ZA 4I5EA 2PZMA 2OP1A 4R01A 2BFOA 1PGQA 4GL4A 5IF3A 4BNGA 1YL5A 3Q2KA 1ARZA 2I6TA 4I5DA 4BQRA 4CQMA 3D3EA 4R1TA 3JQCA 5L51A 5TS3A 1E3EA 3WXBA 1A5ZA 1Y8RA 2IRWA 5COAA 3SVTA 3A06A 2Y93A 3JQAB 1AGNA 2R6JA 2VRCA 1I33A 1PR9A 2VYND 5IZCA 4E12A 1NNUA 2IZ0A 2WEKA 3HWRA 4FFRA 2Q49A 5ILOA 3UH1A 4YJFB 4XQEA 1N5DA 1GDHA 4C7KA 2GN8A 2C59A 2OOSA 2EG9A 2HMVA 2CD9A 2DQ4A 2RHRA 4GWKA 3WTCA 5CHEA 5HM8A 2P4HX 3GRPA 4J1QA 4B7CA 3DOOA 3T7CA 3ZWCA 5DZSA 1B0AA 4ESOA 3FNEA 3E9MA 2CMDA 4YJFA 1KS9A 1PL7A 3VC7A 1GCUA 4ZU3A 3RKRA 2YHIB 3F3SA 4WEOA 2CF5A 3CINA 1WLYA 5JCJA 4CUJA 4J1SA 1E1MA 1O8CA 2DPGA 4JX8A 2QYTA 3DFUA 1ONOA 3EAGA 2ET6A 3LT0A 3TPCA 5DT9A 3UXYA 5DCYA 1HRDA 3VZPA 3IS3A 4QFDA 2FRDA 2DPHA 4I9NA 1LQTA 2I99A 3K2BA 3IOYA 1X1TA 3DHNA 3JQEA 2GNAA 4G2NA 2ZQZA 4J2OA 3JQAA 4KDFA 3UCFA 4K1LA 3I52A 4Y9DA 1NBOA 2VWQA 4NQZA 1WDKA 1I8TA 4PVCA 3NUGA 3D7LA 1MXHA 1ZSVA 5FYDA 1GUYA 3GOHA 1QORA 3R3SA 4NFYA 4WLFA 4MVJM 3LC1O 4IGFA 1V3TA 4N5NA 1KVSA 1M6WA 3KM0A 4XYLA 1R0LA 3NEPX 3BTUA 4RVGA 1MB4A 5FFFA 3PIDA 3P19A 3QJ5A 1T2AA 5U9CA 1Y8QA 1E5QA 4ZN6A 4CM3A 1U7TA 5TX7A 3DMYA 3U4DA 5EQDA 1ZCJA 4GKVA 5CDSA 3ENKA 3GVHA 3RJ9A 1P1KA 4L75A 3WGGA 1HSZA 3ICCA 3GDGA 3I6QA 4XX0A 3HG7A 4IS3A 2OZPA 2CZCA 3LU1A 2OBNA 2O48X 4CM1A 4J91A 2HK9A 2G76A 5G0TA 1VE9A 3SJ7A 3S1LA 1QR6A 1KEWA 3GG9A 4PCVA 4U0JA 3MJ4A 3RASA 5A3JA 1U8XX 5K6AA 1NWHA 3P2YA 5COQA 5I9MA 4YEDA 3HSKA 1PSDA 5I7FA 2GZ1A 5L45A 4HKTA 1X0XA 4TKMA 1LJ8A 1VLLA 2ZTUA 2VZ8A 3OA2A 1HDRA 1LU9A 3PLRA 4CLEA 4RJTA 1YL6A 1XQ1A 1T2CA 1T25A 1KVQA 3NTOA 5DCUA 1B26A 1MGOA 1Q7BA 1KERA 1Q0QA 2X4GA 3I6IA 3N7UA 4MP8A 1HSOA 1YBMA 3JCZA 4CQLA 1DC4A 3X2FA 2Q3EA 3RSHA 5DF1A 1P77A 4B4WA 1CDOA 1E0DA 1LDGA 1QRRA 1PJLA 2OUIA 1H2BA 4M86A 1U1IA 1CEQA 1B2LA 4FJ0A 2UDPA 4PLWA 3FNGA 3KYDB 3MZ0A 1PQUA 1R16A 2EV9A 4FPXA 4CUKA 2D1YA 5ITWA 5JSFA 3WG9A 1P1FA 3V1UA 3DTYA 4MO2A 4IQGA 1SEVA 3IKTA 4BNJA 4IQ0A 1LDMA 3BTOA 1EK5A 4R9RA 5JO0A 1NAIA 5AXBA 4DLBA 1V0JA 2Z1MA 2OGUA 2BI7A 1N7GA 2AQ8A 3IUPA 5B4TA 2AQHA 2O2YA 3ZNOA 3SJUA 5FI3A 3KYCA 3ANNA 5JCXA 1C0PA 1R4MA 4OIMA 3C7CB 3QP9A 4MVJH 3BXXA 1HE3A 4J4HA 1P44A 4GX0A 5A9SA 5G0UA 4PG5A 4YVFA 3RUDA 3AI3A 1DXYA 1ULSA 2E4AA 2RHCA 4LCJA 2YDXA 3JV7A 5HS6A 1IHXA 3CTMA 2ZYGA 3SXPA 2X0NA 1B8VA 4JJFA 5KJEA 2TMGA 2B69A 3VOSA 4E31A 1P1JA 2WYWA 4HX5A 5L53A 3TWOA 1J4AA 3PIIA 3FNHA 1MLDA 2C7VA 3HQ4O 1VL0A 2D8AA 1KBZA 4BGVA 2GF2A 5CDTA 2NU6A 1ZIDA 1U5AA 4BNTA 3MWEB 3HJAA 1DC3A 1QYDA 4QFCA 1H6AA 3VPSA 4G81A 2VYVA 4AICA 4RZHA 1A72A 4XDYA 3FPCA 3TNLA 4OOEA 3GVXA 1E7WA 3GNQA 1GUFA 2AQIA 3L07A 4HFMA 5C37A 3NJ8A 2GYYA 4NHEA 4XB1A 1ISFA 2HRBA 4PZCA 4DYDA 4GX2A 3GPDG 4IIVA 5G0WA 2JJYA 3IP3A 1HXHA 4ALJA 2PV7A 3FSRA 4J43A 4P4NA 4W9NC 2HUNA 4ZQFA 5THKA 2EW2A 3RVDA 5JY6A 4MJLA 5L7WA 1OC2A 1QV7A 2C20A 4BS9A 2X22A 3ASVA 1YL7A 2I67A 1UZNA 4YJHB 2P9CA 4N7RA 4KWHA 1K2WA 1A7AA 1NAHA 1EK6A 1UZLA 1YH3A 3NDIA 4FC6A 5T64A 4BNNA 4KWIA 3UGKA 4GSKA 3CKYA 4J7UA 5A04A 5GZ1A 3H6KA 1A27A 1YE3A 2Q99A 3HFGA 2DAPA 3AOEC 3NT5A 1ZEJA 5U4QA 5BQFA 5MDHA 3NX4A 3R3JA 2GLXA 4IJKA 4BNFA 4JBHA 3GA0A 3K73O 3VZSA 1T2FA 2HQ1A 5DULA 2DU8A 2JHGA 3M6IA 2HU2A 3JSAA 4QEDA 3FBTA 4AJPA 2IYPA 2DVMA 3H65A 4PLYA 4AJEA 1EVJA 2QZZA 1YS4A 1M66A 4M49A 4NBVA 3B20A 3TJRA 3TZCA 1ZMTA 3ADOA 1NHGA 4CLXA 4MVJF 1UUFA 3ZHYA 3ZCXA 1P74A 1X15A 1PJSA 1UP4A 3RFVA 3VZQA 4A2CA 2GUGA 1F06A 5DCWA 1LTHR 4LISA 3V8BA 4XR4A 4J9UE 1UXKA 4TMFA 4Y98A 3ZZNA 4YRAA 5A06A 1NFRA 3D64A 1HT0A 4RVUA 1AN9A 4EBFA 1K5HA 5KVSA 4UEOA 4XQGA 2GZ2A 4OXYA 4BB6A 2WD8A 4ZQHA 1CRWG 1LDNA 3SLKA 4UVDA 3A9WA 3I9KA 4BO1A 5A9SB 5L40A 2D3TA 3P7MA 1IZ9A 2IDZA 2Z5LA 2EKQA 5L3ZA 3DR3A 1QP8A 3QV1A 3BTVA 4E21A 1I0ZA 1X1EA 3JQBC 5KVQA 1Y81A 4HUJA 4DL9A 2PD3A 1BVUA 3L9XA 3ZU5A 4BNWA 1L7DA 1SAYA 3PDUA 2DLDA 1EDOA 1MX3A 4ZD6A 3M2PA 2OHXA 5LC1A 3COSA 4IBOA 1ZH8A 5EJ2A 4D0SA 1NQOA 3NKLA 4JLWA 3GNSA 5L4NA 2VHYA 2BGLA 3LQFA 2E48A 3WLFA 3BAZA 4TVBA 4J1NA 4R9SA 4HWKA 4Q3EA 4B4OA 4RLHA 7MDHA 5IJZA 4CV2A 4D44A 2D2IA 1B8UA 2UVDA 1CF2O 4JQCA 4DPLA 3OJLA 2XAAA 3GZNA 3CUKA 3H3JA 4NFHA 4PG4A 1EZ4A 1YDWA 1GFSA 5ER9A 3K2EA 3DBRA 3ZWWA 3ZW8A 4JP3A 4W9NA 2V6BA 2JFFA 1DFGA 1OFGA 4XQCA 3NT2A 4YAIA 3AU9A 2CY0A 3JQ7B 1XHLA 2J8ZA 3JD4A 4E5KA 3EZLA 2A35A 5I7SA 4W6ZA 1PIWA 3Q9NA 1D8AA 4M8SA 4N54A 2C54A 1JAXA 3AU8A 3PYXA 2O3UA 3LDHA 4YJDA 3ZHXA 1NQ5A 4AJHA 1GQ2A 1Q1NA 3B1KA 1KC1A 3F9IA 4ID9A 1YVEI 1K3TA 3PYLA 3TL2A 2O3TA 4WASA 4K6FA 3H9GA 2O2SA 3Q11A 1OAAA 2QQ5A 4N18A 4MVJP 1YQXA 2ZYDA 3QWIA 1BSVA 1O94A 3DB2A 4A0SA 2RCYA 5IDYA 3FTPA 3EVNA 4R3NA 1G0NA 1P33A 4PLZA 3DZHA 3ROQA 1ZZEA 2YQ4A 5K9ZA 2UYYA 4BMNA 5C7IO 4L73A 4R3WA 3RUFA 2JCYA 4IM7A 5JDCC 1F8FA 5CDUA 4I5FA 3WJAA 1YWGO 4W4TA 1LDEA 4R5MA 4OKIA 3QHAA 4AJ4A 1C14A 2O3SA 3ITDA 2GN9A 3DZBA 3GT0A 1QKIA 3NGXA 4B4VA 2IXAA 2Q2VA 2WWRA 1X7HA 1GL3A 3UHAA 1CQIA 1P45A 3AM5A 3OF2A 4LRTB 3OEYA 4D3FA 4QUKA 1RKXA 4EJ0A 3JQ6A 3RUAA 3FWNA 2ZIZA 2B37A 4IIUA 3O9ZA 3AFMA 3QLJA 4JNKA 1U2DA 2Y1EA 3IP1A 3JYNA 4YQYA 2R00A 4HFJA 4FFNA 1HDYA 5EL0A 4E5MA 2TMDA 4QO8A 3OHSX 1YO6A 4I9UA 1PZHA 4XYBA 1PGOA 5JYAA 4DIFA 5KOIA 3I9OA 3EHEA 2C5AA 3QWFA 3WFJA 3H7AA 1Z75A 2QW8A 2ZQYA 3PHHA 4UEJA 3F46A 3RBVA 1C1XA 1WWKA 2QRLA 4NFSA 4IJWA 1LDBA 3KV3O 4Z9XA 3PEFA 3RC2A 1WAMA 4FW8A 3K9QO 1H9BA 3WNQA 1PWXA 1ZJZA 4U0KA 5IFLA 2W98A 2YQ5A 1DJQA 3RD5A 4MIOA 3RUCA 4JCOA 1DPGA 4RPGA 3V5NA 4IS2A 1IY8A 4Z0HO 1YB1A 2E82A 2QIOA 1O9BA 3EK2A 5KCZA 1JLLA 2X5JO 1ZFNA 3GEDA 5L9AA 1WMAA 2JD2A 1R4MB 1XEAA 4YWJA 1A4UA 3PFFA 1H0KA 4OYRA 3CEAA 3G49A 3VDQA 1YDEA 3UICA 2EWMA 3JQFC 1W0CA 1F0YA 3BMNB 1RWBA 3D5TA 3OH8A 3O26A 3OP4A 4IDCA 5BT9A 5DBIA 3N58A 2IEBA 3MEQA 2XXJA 2VYVD 1CYDA 2P9EA 3MJSA 1GU7A 1TT7A 1V35A 3R1IA 2O7SA 4ROSA 5TT0A 5KJFA 1YBVA 2YUTA 3DAFA 3BHMA 3LT1A 4I9HA 1SCUA 2JKVA 4KUHA 4W99A 3I9NA 4NH4A 1KETA 1B8PA 5JLAA 1IZ0A 3S2EA 3IMFA 1E3IA 5G2OA 4LCEA 2HMTA 3L4SO 1PJBA 2UUPA 3WIEA 4BGEA 2WE7A 1PZGA 3UCEA 4CMIB 3PVZA 4OHUA 3WMWA 2WSBA 3D3WB 5F5NA 4HXYA 4DQUA 4XIJA 3KXDA 1E7QA 2W4QA 4CLDA 1M75A 4HY3A 1YB4A 2NVWA 3M1LA 4L8VA 4AJOA 5B37A 5F3RA 1J49A 2PGJA 1ZO8A 5L4SA 5ES3A 1WW8A 4UUNA 4D3SA 1T4DA 5A9TA 3HDQA 1LUAA 2NQTA 2QX7A 4NBWA 1ISJA 4FFPA 4N5LA 4CMHA 4YB8A 1EE2A 2EKPA 3K5PA 3EGOA 3STHA 3KSUA 2B83A 3KEOA 2BH9A 1XLTA 5DBFA 4MVJA 1WMBA 3DBLA 4A5OA 1H93A 5B1YA 1I2BA 4IGEA 1H6CA 2W2LA 3GVIA 4WLEA 3HN2A 3UF0A 4B7XA 5T8KC 1Q2XA 3AW9A 4IINA 3G3EA 1BW9B 2Z95A 4WLNA 1IULA 3P5SA 4BOYA 2X58A 4MVJE 2P5YA 3ZWYA 3JQ8A 4BNZA 4ND5A 2F1KA 2YHUA 3DXFA 5EERA 1LRJA 2NNLD 3B70A 1I3MA 4GWGA 4MKRA 4PZDA 2OXIA 1QYVA 1GAEO 5DOZA 5IZ4A 1ADBA 4B3JA 2VTEA 1E7MA 3VPFA 3EUWA 2H1SA 4GPD1 1QV6A 3SEFA 3JQGB 3NRCA 2I65A 2YJZA 5EINA 2PH3A 4ONEA 1E92A 4E6PA 4I08A 5ENDA 4IZIA 4YPOA 3MJEA 1BWSA 1JKFA 4BKRA 4LSWA 3ZV3A 4DTIA 2P2SA 3OETA 4BNLA 2JCVA 2FSSA 1BGVA 5A4DA 3S2GA 4RDHA 3GY0A 4HNHA 1ZK4A 4QO7A 2Q4BA 1L1FA 5COBA 5JS6A 3W8DA 4KOAA 4P4GA 1V9LA 3RC7A 1UR5A 4WOKA 2EP7A 4OGWA 4UUPA 3QE3A 3V2HA 4E2WA 7ADHA 5TIIA 1MC4A 3BMQB 3ONFA 4W7IA 4BL5A 1PGNA 1CETA 1JVBA 1VKOA 4A10A 4ZQGA 3IJRA 1ZK0A 1D1TA 1Z74A 3PHLA 4CUZA 3ORFA 4A27A 4BKQA 4ALIA 2JFGA 1GADO 4Q3CA 3PHGA 4R69A 5KNLA 3WIDA 3HNPA 2O4CA 5KVCA 3WFIA 2GO1A 3O8QB 2NTNA 1HZZA 4BKPA 1RJWA 1YOVB 2G1UA 1GZ4A 5GMOA 3H3FA 2X1HA 1IHYA 1EVYA 1ZUD1 4PZEA 5JDIA 2V7PA 4YACA 1QSGA 1E6WA 2IYOA 2YFQA 3DZFA 5BSGA 4OAQA 4RPJA 3FBGA 4UVGA 3SBOA 5A3VA 2VRCD 4PG6A 3DO5A 2I5PO 2VYNA 4BO0A 1IPFA 4EJMA 3IQDB 1T24A 2HJSA 4XZ3A 5JO9A 4CR6A 4UULA 4BKUA 5I8WA 3ABIA 4DRYA 3C85A 1KEPA 4NU5A 4ZRNA 1LSUA 2X5OA 3WYEA 4CV3A 2WYUA 1TT5B 1N1GA 1ORRA 3CE6A 2P4QA 2DC1A 2YV2A 1T2EA 4YAJA 3DBHA 3RUHA 1WXDA 5KWEA 2VUSA 4HADA 1PJCA 1MP0A 2FPPA 4TQGA 4OQZA 4NBRA 4AJLA 3DOCA 4AL4A 3OJOA 3DMTC 3GHYA 4DMMA 3E03A 4DUPA 5DNAA 1ZKMA 2F00A 1UDAA 1XG5A 3G1TA 5G0SA 1IPEA 4ZJUA 3ZU4A 4NJMB 2O3QA 1PL8A 4D43A 4KMSA 5TQVA 4IPTA 1HTBA 3HDHA 4HNGA 1A71A 1R15A 4O5OA 2X7HA 1JQBA 2H6EA 4QXMA 1WDMA 5EESA 2X9GA 1XDWA 4E13A 2JFHA 3PJFA 2IZZA 4YJGA 2Y1GA 2ZTMA 3HHPA 5CEEA 3GH3A 2CVQA 2VHXA 2CNBA 4MVJI 3DDNA 4B8ZA 3FD8A 3RJ5A 1ADCA 3DHYA 5K0ZA 5IN5A 4LN1A 1FDSA 1HE5A 1C0KA 2FMUA 3EYWA 4NNJA 2YV1A 1NPYA 3JYPA 4BNUA 5IDQA 4RLSA 1DIAA 3B6ZA 4CMJA 1HETA 2BHLA 4M1QA 2BFPA 1Q7GA 5ADHA 1DOHA 2VOJA 3QVXA 1KIFA 1HDXA 4BO6A 1U3UA 1O89A 6LDHA 4ZGWA 4IY1A 3ZWBA 3CMCO 5EN4A 2FSVA 2O3JA 4R68A 3PQDA 3E48A 3DZGA 3OA0A 1NR1A 3L6OO 5DOVA 4FGSA 2UAGA 4EUEA 1XR3A 3MCVA 5L4LA 3DOJA 5LCXA 3HE3A 4IMPA 3QWAA 4L9RA 1PGPA 4QECA 4XGKA 1G1AA 3GAFA 2Q22A 4EUFA 4FIZA 4UUMA 3TZKA 3GLQA 3L0DA 1W6UA 5TJHA 1P1HA 4CLOB 4EUHA 1VC2A 3VAZA 2JHFA 2VWGA 2WE8A 3F5QA 1ENYA 4J0EA 1VJ0A 1GY8A 1KY5A 4PFJA 3ZWAA 2QRJA 1YONA 2WYVA 1V3VA 3DAGA 2NVUA 4XYGA 2P91A 3OEWA 5ER6A 4YAKA 2QHXA 4R1NA 1ZW1A 3JQGA 4TSKA 2IZ1A 3U49A 4RO0A 3BMQA 3OECA 2FR0A 3PTZA 4U6QA 3NAQA 3MOIA 4G65A 1F14A 2EP5A 3I1JA 1LRLA 3JQDA 1LX6A 1XWFA 2JAHA 4KUGA 1UXHA 1GV1A 3AUUA 1Z73A 3VDRA 3GR6A 3ZNQA 5KTKA 3TFOA 2G5CA 1MXFA 1YXMA 4DMLA 1BXGB 1HZJA 3G79A 1OBFO 1YQGA 2WD7B 3WLEA 1CJCA 5LDHA 2HJRA 1MFZA 3GEGA 4BGUA 2W90A 1Y8QB 2OMEA 1KOLA 1LC0A 2VZ0A 2FPGA 3BHIA 1TI7A 5T57A 3F1LA 4CV0A 1O95A 1Y6JA 4CLRA 3QWHA 4AFNA 4IDGA 4WCDA 5CPBA 1C0LA 3KEQA 5T67A 3ANLA 4LMPA 4DREA 4EYEA 2ZTLA 5F1PA 2HMUA 2Y1DA 4INAA 1XGKA 3E6AA 4GMGA 3DTTA 2QG4A 4J4BA 1VJ1A 3U4CA 3AJRA 4J0FA 4K26A 5G4LA 1YRLA 3KLPX 5JY1A 4GQAA 4MVJD 5M6DA 3AY7A 2CDAA 2GGSA 4XKJA 1J0XO 4RPKA 5DP1A 1W8DA 5I7EA 2DFVA 1YKFA 3ANMA 4OO3A 4BNYA 4ALKA 2VHVA 2XOXA 4FS3A 4YRBA 1DO8A 3CZRA 2ZJ0A 3ZWOA 4GLOA 4CJXA 3U9LA 1EFKA 3EVTA 1UJMA 2X9NA 3DMTA 2GN6A 4R1SA 2PZKA 3GK3A 1NX6A 1Y5MA 2I76A 2FR1A 4CMGA 4YT5A 3VH4A 1VI2A 4ZRMA 4BHTA 5A5FA 5CG1A 4FD3A 1K6IA 5CG2A 4ALNA 1P1RA 1MG5A 4F6LA 2CSUA 2NVUB 2FZEA 2QRKA 2J3JA 4M54A 4EI2A 5TLSA 3L4BC 4EJ6A 3CZMA 4ZICA 3IUSA 1SBYA 3S2IA 2VZ9A 3GHHA 4O1MA 3DZJA 4S1VA 5HA5A 3FHLA 2A4KA 4E5NA 3OQ1A 1HLDA 2PGDA 3GG2A 5TJ9A 2R2GA 2VRBA 3JQAD 3WGQA 3PZBA 2B0JA 1L7EA 4XRRA 4E5PA 4AJ1A 1KVUA 4TRNA 4YT8A 4L4SA 2RH8A 4HV4A 4CR7A 1DIBA 4TZKA 1I3KA 2DFDA 3ZWMA 2B4RO 3Q2IA 2V6FA 3QVTA 5C7OO 1ID1A 4R1UA 4E0BA 8LDHA 4LSMA 1NQTA 2FOIA 3WR5A 3ICPA 1O6ZA 3WSVA 2G82A 3PFWO 1AXGA 4CM9A 5JYDA 3EW7A 3RFXA 3H2SA 1G6KA 1ZK2A 5BSEA 1XELA 2AMFA 3RAJA 2HK8A 1Y8RB 3BIOA 3ZHBA 4ZQEA 1FDVA 5A02A 2OL4A 1MC5A 4WLUA 3RWBA 3ZV6A 1PZEA 3JTMA 2WDZA 4YAEA 3WOHA 2Q45A 3BMCB 1SOWA 5C7LO 2VCYA 2X0IA 5TF4A 3C1TA 1SPXA 3AOGA 4Y8VA 3P2OA 3PI7A 4D42A 3KUXA 3RBXA 3V1TC 4HBGA 5CPFA 1ZVMA 2ZATA 2HAEA 4RVFA 5LDGA 1NXQA 3C7AA 3WGYA 4FFOA 4GI2A 4EZBA 2O3RA 3ZH2A 4BO7A 5T73A 4ZHSA 3C8MA 2NADA 2RIRA 3PJDA 4PRLA 4WKGA 4E2XA 1QXSA 2WM3A 2NLOA 1RM3A 1T26A 2Y0DA 2CFCA 5HTOA 4N5MA 5BNTA 4D45A 1OI7A 2PKQO 4XR9A 2I3AA 3KYCB 4KDEA 2J5RA 3CSDA 2EXXA 1M67A 1X13A 3EMKA 1IOLA 1DLIA 3ROKA 2VTDA 1SEPA 1WNTA 3I4FA 3C3XA 4CODB 4OH1A 2EKLA 1N8KA 1UXIA 5HWSA 4BNIA 5H82A 3VKUA 3ST7A 1SOVA 3SC4A 1B7GO 4YBZA 2PZJA 3Q1LA 3WBBA 5AQ1A 2C2YA 2FHSA 3HB4X 2GZ3A 3R6DA 4Y6RA 3RU9A 1GPDG 3KTDA 5ICSA 3NGLA 3L6DA 3TZHA 4Z6KA 4NBUA 4O59O 1DAOA 2DTEA 1XU7A 3BMOA 3LT4A 5MGBA 1DB3A 5F5LA 4GVLA 4XA8A 4D3DA 3INRA 3D1LA 8ADHA 3AI2A 1GTMA 1B14A 4YXFA 2UV8A 1UZMA 2NU7A 2DBVO 2PK3A 5A9RA 3TDKA 1DBVO 2GSDA 1DSSG 3QVSA 1HWYA 3O03A 3INGA 1C3VA 3OJFA 5EPOA 4J7XA 3PK0A 3ZWXA 4BMVA 3FRJA 2J6IA 1R12A 4CLRB 1YGYA 3N74A 2LDXA 1SO8A 3G0OA 3RC1A 3V2GA 2AEMA 1ULUA 4ILKA 2BKAA 1GZ6A 2V6GA 1PX0A 3WB9A 3GVPA 3T4XA 5IXYA 4PGFA 1MA0A 4DQVA 1VL8A 3PZRA 1PJQA 1W73A 4IXWA 3UAGA 3KB6A 3GN1A 4AJKA 3PLNA 2ZKLA 2DBQA 1X7DA 4IDEA 3MTJA 4J49A 4CMCA 3MJCA 5IDWA 1XIVA 4WLOA 4BO4A 4BVAA 2Y1FA 2UUOA 1VJTA 1ML3A 3I23A 5AVOA 2FN7A 3FPLA 1V3UA 1ZSYA 3ONEA 1S6YA 4MKXA 1I5RA 1FMCA 4CM8A 1UH5A 2VT2A 2I3GA 1DHRA 2O23A 2I66A 2AG8A 4MOWA 1OMOA 2P9GA 1P0FA 2QYSA 4JXKA 3GFBA 1NM5A 3JQ9A 3C1AA 1UDCA 3WS7A 4RPHA 3TRIA 4K6CA 4JP2A 2PH5A 2OORA 1LI4A 1DC6A 5JAQA 3GUYA 3OIGA 3LF1A 1ENOA 4RQTA 4DYVA 3GC6A 4E2ZA 2GR9A 1EE9A 4GGOA 3GF4A 3JQ9C 4YA6A 4NI5A 4MPDA 2I9PA 2B5WA 2VHWA 3W4IA 4CM9D 2B36A 3VTFA 2AW5A 2O50A 3U09A 1HYGA 4OL9A 2Y0CA 2A9FA 1F8GA 3E5MA 3WGIA 2FP4A 2YY7A 3PGXA 1EEHA 3AM4A 2Y66A 4FFMA 4EDFA 3KRTA 5CDGA 3QRWA 1PS0A 2J5QA 4DGSA 3ASUA 3QVOA 1UXJA 2DT5A 2PFGA 2EEZA 3KSZO 4RORA 1GYPA 2HO5A 1GUZA 1PU2A 1NYTA 2X0RA 3H4VA 3SX2A 2C07A 2Y99A 3B1FA 4NJOA 5AXAA 1DFIA 4LRSB 2BFMA 2D5CA 2VWPA 1JKJA 4PG8A 1VRWA 4NBTA 4BO5A 1GZ3A 4EITA 5JYFA 2GPTA 1YOVA 1VSVA 1P0CA 3AY3A 2GRAA 5JC1A 1AUPA 4H15A 1LLDA 2Q2WA 5DN9A 4PIVA 2JD0A 4BKOA 5KJ6A 1JN0A 4WPGA 1UP6A 2D59A 2ZK7A 2DUWA 5B12A 3DC2A 4Q3DA 3K8ZA 5JAZA 4CPDA 3LC7O 1X0VA 4LK3A 4OSOA 4O0LA 3U0BA 1T1SA 4Z3KA 4NK4A 5H83A 4PRKA 1FJHA 5B4UA 4CMBA 3BYZA 1D4FA 4PLGA 2NVBA 4PLFA 5I8ZA 4YT2A 4R5HA 1VPDA 2GCGA 2PR2A 3TL3A 1I24A 2D0IA 1JKIA 1QYXA 1HDZA 3WYBA 3D3WA 1AXEA 4RF3A 1XU9A 4OXNA 1ISHA 5CEJA 5DBGA 5THQA 4FB5A 3U62A 4CM4A 4K9DA 4Q39A 1NTOA 4F6CA 4J6FA 4ND1A 3I9JA 3GZ4A 3BA1A 2VNAA 1XA0A 4XB2A 3AFNA 3HUDA 4R54A 5A5EA 1NVTA 1WVGA 2DTDA 3Q9UA 5JDIC 1Z6ZA 2ZB3A 4FOOA 3L77A 1E7RA 5I9LA 4HP8A 3CIFA 3X2EA 3JD2A 2XXBA 4RQUA 1VL6A 4I8XA 1DEHA 3E9QA 4A7PA 2P68A 1TLTA 1GR0A 2EF1A 5JMWA 4YR9A 4K28A 1YBAA 3T4EA 4P8RA 3UCXA 1HDCA 4TROA 2J3IA 3JD1A 3BMNA 3HN7A 1U5CA 1U3VA 1DIHA 3DZKA 4P4LA 4FBGA 4CLHA 3WDSA 1YQDA 1ISIA 5K6AC 3QW2A 2B35A 4IUYA 1U9JA 2J3KA 4OMUA 4EGFA 1GYQA 3DEYX 4W82A 4YYZA 3Q0EA 1NP3A 5FI5A 3JD3A 2YHIA 4RZIA 4KZPA 3ZW9A 1LEHA 1BMDA 3PWZA 1P31A 4Z3DA 1RPNA 4GKBA 4A26A 3RROA 1LBEA 1NPTO 1JWBB 2ZYAA 1BXGA 1I32A 3ZV4A 4GGPA 4ZVVA 1DRVA 1VKNA 2W2KB 4FC7A 3VVCA 3WGTA 4DA9A 1PTJA 5B4VA 3HZZA 2YYYA 3K96A 1CIVA 1T4BA 2XPCA 1LQUA 4NR0A 4TRMA 3I4CA 4DQXA 2ILTA 3K31A 5L7YA 2NU8A 1D7OA 3TF5A 5AXCA 3FN4A 4WLVA 2AHRA 4B3HA 1N7HA 1TA4A 1BDBA 3TFQA 4DPKA 4LW8A 3U4HA 1ADFA 3IKVA 1FXSA 3PQEA 4UREA 3DBHB 4BO9A 2Y67A 2X6TA 3KYBA 4IJUA 4C7JA 2HRZA 1EFLA 2IODA 3GUCA 3QSGA 1E3LA 3ZNNA 1V8BA 4CLOA 2AXQA 3WGHA 2AA3A 2AE2A 2VUTA 4NK5A 5ITVA 3WSWA 2POQX 2X8LA 4Z9YA 1MFPA 1BTOA 1PQWA 1Z7EA 3RBZA 3LLVA 4IDFA 3QVWA 1R0SA 3JQBA 1K6JA 1Q0LA 2HK7A 1JA9A 3ZDFA 5U1PA 1H94A 3RQSA 4II2A 2DKNA 3W4KA
chains in the Genus database with same CATH superfamily
4RF2A 5KNCH 4I1YA 3FWYA 5E7IA 2NWQA 3AK4A 4S0XA 1JFSA 2HBZA 2Q7OE 2V96A 1Q16A 2PL5A 2HCTA 3DAPA 3PNLA 4DANA 2IS2A 2PUTA 1W4ZA 2DFTA 2WHYA 3INYA 4XD2A 3LW7A 1IB6A 1S8OA 1L0BA 1QHXA 1T34A 4TYNA 1CR2A 2JIMA 3NBKA 4FR0A 4XIFA 1GAWA 4Y2PA 1LZLA 2KX7A 3AI1A 3E05A 4MRMB 4OXQA 5HIMA 2OM2A 3SYLA 3W5AA 1KI6B 2ZBDA 4YJKA 4RFLA 2UUCB 1YR2A 3E82A 4RJLA 4B46A 4E30A 4F45A 3CVVA 2WD7A 4L07A 2MR5A 5IZCC 4QQRA 4RETA 1MHPA 4NE7A 1IEQA 1U2GA 4EF4A 3MN1A 3O8NA 4DR3B 4GP9A 2LVBA 4MVYA 1DUIA 3O2SB 3S7ZA 1XJWA 3TBHA 1XLUA 3LBAA 1FSSA 3PD7A 4MULA 3WNVA 2Z6QA 4DBVO 4DVJA 1ZEMA 4MYHA 4LJYA 4P33A 1QWSA 3W04A 4AU1A 5KPDA 2BSAA 1I3NA 1KMIY 2PIDA 2EJUA 3K0FB 5DP2A 2QDXA 5CLLA 5JXWA 4KPEC 1M7HA 1V25A 4JUIA 3PC2A 3WZ2A 2ID4A 2VK1A 4CM7A 3PTAA 1UWCA 3H2HA 4TS9A 3UWKA 3K0SA 5EIXA 3D5QA 2X8WA 4ON9A 4X61A 2J41A 4G86A 3K32A 2ZIVB 4A92A 3EUEA 4FHFA 4K8RB 1L7QA 1EVQA 4LVNA 1D09A 5K8CA 1GUAA 5F2EA 1WKCA 3EG9B 3U3DA 2Q3MA 4WEQA 1UCFA 3BGOS 1GPNA 1FDTA 3U7RA 2IE0A 1U9YA 4AN4A 2P9JA 1SH7A 4O1IA 3NVKI 4DQDA 4AQYB 5CDTA 4Q82A 1T0IA 3AHCA 3EF1A 1E1NA 2BFCB 1E5LA 3F1KA 3NGMA 3P5BA 3A0RB 1E99A 2PYDA 3G0CA 3HA2A 1O4WA 1RD4A 1STOA 2JI8A 4HYEA 1QLJA 2PT7A 4QSMA 5ESRA 1H2FA 2EGUA 2JRLA 2IUTA 1LS6A 3UB3A 1AD2A 1T0UA 4HRAA 5IJ9A 1ZMOA 2F1HA 4ZYUA 3KDSE 3A6FA 4MIYA 2OK8A 3MM4A 3DVLA 5HSGA 1ZJYA 2ID7A 5CFZA 3HDYA 4R84A 5CBPA 3R7NA 1I7BB 3V6MA 4ACAA 2VR1A 1T15A 4TKLA 5AKKA 1U0EA 4PHGA 1ZIXA 4PSUA 3CVYA 1NL3A 2IGTA 3B6KA 1WHTB 3VZDA 3CNBA 3W3AA 2YV5A 2F4VB 4IIYA 1U3TA 2WIAA 4NJMA 3GBPA 3SIRA 4DQ0A 5JJBA 1T9GR 1M1NB 4BFSA 4YCJA 4S05A 2HCRA 3A9RA 4NEHB 1VKJA 3K30A 3U60B 4FMDB 4ADSG 3MHTA 1TVEA 1IRIA 4JROA 4BBJA 3T4UA 5AVUA 2AK2A 3F9RA 4G5HA 5JAPA 1MDFA 3FLAA 4MS3A 1YZVA 1WZ2A 2OG2A 4QOEA 2FI1A 3L4BA 4CTNA 1KI6A 4QPDA 3A1NA 4Z4HA 5IC4A 5BMVA 3WQSB 3TB6A 1DHTA 1UBCA 1JR3D 2EX4A 1VJGA 1LNQA 1ZJ5A 1E77A 1T9DA 4DA9A 3CX4A 4H2DA 5HKOA 3JASA 4YI5A 2XNDD 3AGPA 5HIIA 1NXPA 1DG1G 1CQJA 1B15A 1RYEA 4DXHA 4P86A 5BOSA 2XZPA 2OCDA 2CDCA 1AZTA 1GN9A 1NUUA 4AKHA 1W9MA 1D2CA 1F20A 1KYZA 4IOMA 4L08A 2PAFA 1JLHA 2TS1A 4RTSA 4MIEA 4I46A 1U8AA 3F6RA 1Q1AA 1Y3IA 1DUVG 4GYKA 2QZ9A 3IPCA 1RJ9B 4Z3OA 4U7PB 3WGLA 4ARSA 2NU9A 3O8OA 4C04A 1O95C 1BS2A 3QIVA 2ZUBA 3D7RA 2G83A 3DGEC 3OT1A 3ABOB 4WZ6A 2XRZA 4ZVRA 1UMBA 3EASA 4JJ8A 1O97D 4IDBA 1XP5A 4KSBA 1VHQA 2ZJFA 1WHSB 4A2PA 1KK0A 2VT3A 5LU8A 3ICEA 1MVOA 5KWJA 2L2QA 4G1UC 1H1DA 4ZC8A 3T34A 5JI2E 1T2VA 2ISQA 2SCUA 3RKUA 4NF2A 1F12A 4BNKA 1VPWA 5JISA 2CVOA 1Z2DA 2O4UX 2P1RA 5JWHA 5BSKA 3UBTA 3PJGA 1ZCAA 2UZAA 1EP2B 3HFSA 2WU3A 1RJGA 2AMVA 4HRVA 4LC0A 3BDAA 4OJNA 3U0VA 2WJPA 1FFBA 3ICVA 2NV2B 3RC9A 2QTHA 2V65A 3UA4A 3VH3A 3HZHA 4D5EA 2PWZA 3HO1A 3RRBA 4KTTE 2RI6A 4ZYTA 4GBGA 4P3OA 1C0IA 1Z7WA 1Q0HA 3V2UA 3AKZA 2VPYA 1DL5A 4YJGB 1N33B 3TSCA 2A1TS 1NJ5A 2C0CA 3JQ8B 2RAFA 4G4IA 4XASA 3HRHA 1JNYA 1U7WA 1S2LA 3A3YA 3JQQA 3VU9A 4HEJA 3V7YA 1W52X 4XDZA 5JADA 3SLGA 2QD1A 2YXDA 3C5EA 2OB1A 2Y77A 4JXJA 4ESHA 1YFLA 5CB6A 3VVBA 1V16B 1EGQA 5KNBA 4MKZA 2H2HA 3PE4A 3PRJA 1Y1QA 2IHBA 4WX2B 5BXQC 5G4KA 4JEIA 1BWRA 1QIFA 1YB5A 4BLOA 4D79A 3B3GA 3F5SA 3EVBA 4J16C 4JEHA 5GONF 2PDAA 3SS9X 1EB8A 1U0LA 4BZZA 1XTJA 1XVTA 1F8YA 2O6HA 1U28A 1COZA 1TO1E 3HMQA 3LQKA 4BVKA 1N34B 2PFKA 4K86A 4QDUA 2V4UA 1PR3A 2HK6A 2FZ5A 4P38A 1WV1A 2WU0A 4EQ6B 4EELA 4M0FA 4RSHA 3T61A 1AMUA 4D8WA 2NYUA 4R2XA 4MR9B 4ND7A 3N5CA 3S8MA 2CBZA 1Z82A 3IC5A 4TMKA 4QDKA 5TSDA 3F4LA 3SXUA 4LHSA 3IKLA 4MQEA 4LDNA 3L18A 5C4MA 4MW1A 1HEUA 1OZHA 4I3GA 3KZMA 4KVZA 1X1QA 1YA4A 2YWHA 1RJ9A 2OBFA 3OBBA 2HBYA 1FUKA 4OQDA 3HPQA 2BHSA 4R4JA 3EBPA 1YASA 2XI4A 3L1UA 4MA0A 3WTBA 3SBDA 1H9AA 1OTYA 3P9XA 2IYXA 2WU4A 4GM1A 2HF8A 2HA3A 2WJJA 4BNVA 4A8HA 1ENZA 1O58A 1L1RA 4KWTA 3IO3A 1X19A 2C5GA 4GQBA 1GHTA 5CM9C 3ZWNA 3R3HA 1O0SA 2YVLA 1MMFB 2VPQA 3ABZA 4D8VA 1U7UA 1XO1A 4M1YA 5AVTA 1QK5A 3AH8A 2IQIA 1M6EX 4WXMA 2J07A 4G36A 2VAWA 3H17A 3M8KA 1SC4A 2ZWVA 2QPOA 2G5TA 3FFBA 4FHCA 3OT5A 2HNKA 3K70C 1ZGJA 1BH2A 1UQUA 4JT4A 1C41A 2JBAA 3DMHA 2PZBA 3I28A 3AV0B 5D87A 1SB8A 3FOFC 4I36A 2QUKA 1KOJA 3SQWA 4L4RA 4QBKA 2IVZA 3WGMA 3RKSA 1P4GA 3IEVA 5F2KA 3BSSA 3C48A 5H3HA 2NZUG 3R5JA 4FCTA 2I4NA 2DCMA 1E1LA 3CWCA 2AUNA 2PRZA 1UXGA 3DYIA 4ZHQF 4C9BA 1S4MA 3QEBZ 2CHUA 2I2XB 2VQSA 1YRYE 3LCMA 4HB0A 3LP6A 3TINA 4D2IA 3GLIA 2I1WA 3FAZA 3N2YA 3TQCA 1CR1A 5JAMA 1W88B 4FEYA 2A94A 1UC5B 3ON5A 1BOFA 1N2IA 2A0FA 1Z5VA 2V9ZA 2I3BA 3WK7A 2REXB 1ZH0A 3KJQA 4DS3A 5EEHA 2Q3CA 3U7GA 4NWIA 1LLFA 1AHHA 1U65A 2AV6A 3WQQA 1YZLA 1A97A 5JJIA 5FADA 3UUEA 5SY9A 1ZU5A 4JSTA 4OUDB 4PE5B 5H9VA 4RKQA 1W93A 4EEXA 2GTHA 1NPDA 4I55F 4YONB 3E61A 1U0HC 4UAVA 4W5WA 5A05A 2NTJA 3V4FA 2NUBA 4KQXA 1YE8A 1IN8A 2AXNA 4G8CA 1M1YA 3NG1A 2GERA 2CL0X 4FYKA 3K92A 1Y6QA 5A6SB 2DPMA 2HJ9A 1YJ8A 3OMLA 3QEJA 4KX5A 4Q48A 4TXNA 4WOCA 4C88A 2N1MA 2ZJ1A 3GMSA 5KQRA 2C4NA 3Q6IA 3VPHA 2NXEA 5DB4A 4P58A 2EJWA 2AE1A 4P7FA 1Z6XA 4AULA 2XVMA 4ND6A 3MWDB 4P32A 2O7NA 1V6AA 5D3MB 4EYGA 5EKUA 1SC6A 3EVZA 3WLQA 3WX0A 5KNDA 5FWXB 2DSNA 2COEA 2R0QC 2X3FA 4O2BA 2CB9A 3HDJA 1N6PA 3OAAA 2XVZA 4IEIA 4YNBA 1KU0A 2RCNA 2W2KA 4K9KA 4M87A 3CEJA 4WSOA 1Q74A 2AEEA 3WWYA 2ZOSA 1OX6A 5DCLA 3N0WA 1GA1A 2X76A 3N28A 5KIAA 4RMIA 5DDIP 4DQKA 3W7VA 3G9ZA 4LYHA 2RKOA 4C4ZA 4MHOA 3WNDA 2Z1NA 3GGGA 2XTZA 4FVTA 3KQLA 4J4TA 3PX2A 2D4HA 2V55B 1SD1A 3I53A 5AHKA 3II6X 5JW6A 4NVRA 3PBKA 4D9GA 1T9BA 3W9UA 2A5DA 2PBRA 3LCVB 4U2CA 4X54A 4W5OA 4R40A 4YRDA 4L0QA 4KO8A 1EQUA 3Q0TA 4YP0A 3ZC3A 5BWBA 5IYZA 4O8JA 1EUQA 3L93A 1JSRA 1NOKA 3WGVA 1EAYA 1Y7TA 1LC3A 1LBSA 2YW9A 2H5EA 1RBYA 1G9XA 3BCHA 1H2RS 3P1JA 2CVZA 3GFGA 2QRPA 2YH2A 2VF8A 2O2ZA 4MVJG 4OOFA 1CJUC 1YZUA 2OO7A 3RUEA 5KTNA 1NFFA 2QG9A 2OT3B 2HA0A 1DKPA 3ODPA 2IVFA 5FWXA 4I50B 3SHTA 4EL0A 4Z4GA 5FBLB 4HNVA 3HYTA 3LBNA 4N65A 4HB4A 2MR6A 3AYZB 1MB2A 4H16A 4PYKA 2W2PA 4QU5A 3SVZA 3HA3A 5D5PA 5AD1A 5I4BA 2O54A 5E9AA 5JVDF 1HBJA 2WLTA 2ZYHA 4KFRA 4POOA 2W71A 3LX8A 5JSYA 2ASEA 4UTVA 1KEVA 3FCOA 3QKRB 4AYWA 1OKKD 1KTIA 4A2WA 4Q4DA 1TTQB 1C3JA 4CCYA 3IRVA 1PL6A 2FW6A 5CFPA 1D6SA 4AP9A 4REQA 2OLKA 4PS0A 1GQSA 1RHJA 2BL4A 5EIWA 3CLKA 4ZJPA 4PBRA 2CSXA 1D7AA 1BGWA 4MHTA 4JVOA 3H5WA 1IFXA 3EXG1 1WU7A 1VM6A 1PW7A 1UC4B 1X8LA 1XI2A 5AVSA 3D8NA 4L6AA 5BNFA 4TXJA 4Q3KA 3QNUA 1NVDA 5H3LA 3K0FA 4Y67A 3VKGA 3LC2O 3IT3A 5IAEA 2W0SA 3T7KA 1DRUA 3BSFA 4WKNA 4DWJA 3DONA 2YHBA 1F6BA 1G8PA 2CBGA 3PUYA 1U0SY 5K09A 4XLZA 2VBIA 2HIMA 5IBCA 1LF0A 1V9CA 1W4BA 3VHXB 4ALLA 1Z37A 4DMFA 5A0VA 2FSPA 1GT91 3LJKA 1S2IA 1J56A 4Q6BA 1N8SA 1E4YA 5B6IA 5BSFA 2C88A 3W8RA 1UINA 2QLJA 1N92A 3KQTA 3T1OA 4IIDA 4M53A 5J23A 1GRNA 3KKKA 4D0RA 4CF4A 4G67A 2QD5A 1A8IA 1T35A 1Z83A 4YT4A 4BBPA 2JBAB 4HEA1 1OLUB 2C00A 4J0IA 4UUOA 4P7KA 4EO4A 3LY9A 5BP7A 1VB3A 1RBQA 2X23A 4RFSA 4C4OA 4C1BA 1ZOOA 2CLEB 1Z0UA 1K63A 3Q3HA 4BNHA 1KVRA 2WWYA 1SOAA 4R7GA 2QVLA 1IN5A 4JCCA 4ARBA 5BQPA 1TT5A 2G4VA 3CPJB 1KVTA 4CG3A 1FS4A 4XOIA 1KAMA 2HRDA 3L7BA 1QHGA 1J8VA 1GU0A 2NSHA 1A7KA 4U5QA 4MYCA 4QL3A 4UFNA 4XXHA 4YPFA 5B5SA 1VLJA 2VHUA 3G2NA 5CBPB 3K9BA 4JYMA 1FP4B 1MTOA 4R8MA 1E1YA 1I4LD 2AG1A 2ZJ4A 3AF2A 2VUUA 2ZIAA 1H1LB 1LSJA 2FR8A 4I5GA 3ZK9A 5IXSA 4RMGA 4B32A 4DIKA 3HKCA 1D2HA 2O8DA 5FEUA 2E6UX 2FSFA 1NC1A 1YJAA 2FPKA 3ENVA 3NDBB 4EW6A 3EGVA 3QBDA 3CJTA 4AX8A 1JU9A 3N2NA 1LD3A 1XX6A 1L4BA 1F6DA 2OPHA 3TVTA 1CD5A 2V58A 4JK3A 3N07A 4M9CA 4NMLA 4CMIA 5ICMA 1HKUA 1VDZA 4BP8A 5J2TF 1XRPA 2CNDA 4HDMA 3V7FA 3WRWA 1QM5A 3ABQB 1CQWA 4DMHA 2G17A 3R74A 1XHFA 4Q02A 3GJ7A 4BPBA 3CG4A 1Z06A 2RGUA 3HLKA 3L02A 1VIAA 2AN5A 5D5HA 4A6DA 4QYTA 4MUFA 5AVKA 4E70A 4RM2A 3C97A 1UOPA 4RHYA 5G4KB 2B7BA 3RAGA 1OPXA 4WQMA 4CMEA 1QCZA 5LZ7A 3P9IA 3N6RA 2JFYA 4CM4B 5JNLA 3U26A 4TVSA 1E3WB 1E9SA 1TEXA 3MS2A 4R16A 4EKYA 1OF1A 4PQGA 2ZRPA 1LW7A 2V7EA 2V0CA 5I7VA 4FYXA 3JRNA 4JBXA 2NV6A 2MSCB 3A4VA 3GJRA 1V5FA 3M4XA 1WL8A 3HA5A 4HN4B 4R41A 1AS3A 1NR7A 2H3EA 4F4CA 3O21A 1AGYA 5L95A 1A9XA 3BPSA 2A14A 4KBGA 4TTJA 4CL3A 5GZ3A 1KJWA 1CS0B 2EGGA 5FWYA 4ABYA 1VCIA 3T0GA 3CPSA 1CNMA 3QQPA 4HDRA 2G28A 1V95A 5CTJA 4RF5A 4PGHA 3RNLA 1J5EB 2X0KA 4L0CA 4QBFA 2H4ZA 1OXMA 4AUKA 4CKCA 3ZTTA 3OCCA 4FYMA 1KF0A 1L7XA 4Q47A 3Q3CA 4Q7QA 4S2UA 3H9JA 2HWKA 2VQ3A 5CXQA 1REQA 2B8EA 1Y5LA 2GN4A 4QUIA 4X66B 1L1EA 3CSSA 2HFJA 9LDBA 4HDMB 4Q4CA 5EJIA 5KVVA 3PA6A 4MDYA 1UPCA 2AMLA 1NSTA 1SBQA 4O63O 2OLEA 2TYSB 3PE6A 4HDCA 5EG5A 3V55A 1TADA 2IP4A 1YFZA 1WXHA 5JT1A 5LLSA 1HF3A 1AQLA 1JIXA 3PXCX 1RI3A 3Q8LA 1VP9A 2X9QA 3KKZA 4EYQA 1H1LA 2G9UA 3W5VA 2WHEA 3HWWA 2HDOA 1LPSA 2VF5X 4DLNA 5BURA 1T5TA 3GXBA 4WCVA 3WOVA 3GP8A 4XRGA 1XQWA 4INOA 4KO2S 5JXIA 5K2MA 1LSOA 4L8WB 1Z47A 2P67A 2F64A 2JDIA 4BGIA 1DWOA 1PGJA 2ADOA 1BXRA 2C7GA 4UUBA 2VZLA 5GM1A 3U3XA 3WWDA 4D0SA 2G8LA 1JSCA 5JDCA 3OTHA 5JAHA 4AAYA 3IAEA 2ZFUA 2DPXA 1GPYA 1RRFA 4MTCA 4WINA 5IG2A 5FPQA 1CUVA 1PEDA 3Q0IA 4C6TB 4XEHA 4Z4CA 1KI8A 4K8OA 1OA1A 2FEPA 3OM9A 3OOEA 5BN5A 4TN5A 3TW6A 1LZKA 3AL0C 3EEFA 3I6BA 3PUHA 4W8GA 5FPHA 1AB6A 4U7DA 4HOYA 4UHBA 1PNTA 1QYCA 3IOBA 4MQ4A 4MV3A 4Y1RA 5CFLA 4B6OA 2WVGA 2QN3A 3CUUA 3IT0A 4LY0A 2YWJA 4K87A 1BXZA 4JLBA 4GSLA 4L3WA 1R37A 4E4YA 2VBFA 1L7PA 3GD7A 4MRSA 4FDTA 2Q62A 3AEQB 2Z04A 4I4CA 5TT1A 3TN7A 2ONZA 5IF9A 4DIBA 2FZWA 1K06A 4JA2A 3K6KA 1H6BA 1JQLB 1MC8A 3AF5A 4FGJA 4J3FA 4MWOA 4O1HA 1FCJA 5HUHA 1FDWA 3CXRA 2NZ8A 1MG0A 3CC8A 5KINB 2P2ZA 3E18A 4DV3B 4B34A 1PJ2A 4WOJA 1NBAA 4JL5A 5SZJA 4EG1A 1P2DA 4L9SA 1NXVA 4J90A 1I1NA 4WNIA 3FNBA 2AN4A 3JYLA 1B8OA 3PR2B 5LZ2A 1C3OA 1HZZC 5DBOA 5EHXA 1J8QA 2NX2A 2BC9A 4OA8A 1ESMA 4ZOBA 1VIDA 3RG8A 4R0NA 1NLYA 1P2VA 3F9CA 4R01A 2X0DA 5B7GA 1SVKA 1REQB 2O2CA 2X3UA 4M8IA 5IF3A 1OLXB 1ARZA 1P4SA 4ZAYA 4BQRA 2HEIA 2IOQA 5HKKA 4R1TA 1PJAA 5HE8A 5JNVA 1E3EA 4P3YA 5LPNA 4QWWA 5KOJA 1FPMA 1KJZA 2RC6A 1ZG3A 2QLLA 1VGRA 4UU0A 3LRPA 4MV0A 3L0SA 5B4TA 2XV1A 1U2GC 1DAHA 2F3PA 4LXXA 3ZDRA 1OH5A 2WA1A 5TGTA 4DLWA 1RZRA 1RLTA 4YGXB 4MDEA 5IZCA 4HAVA 4E12A 3T5PA 2E21A 1N77A 1J33A 4DY4A 4Q7JB 4AO7A 4FFRA 2CMHA 1ECPA 2HNBA 1OUMA 2XVXA 3GCWA 3HL0A 1M8PA 3PI6A 1HFWA 3PT9A 4YXWA 4XQEA 2Q9BA 1GDHA 5EP3A 2C59A 2FPSA 2GK7A 1IVYA 2QEQA 2RHRA 2CVPA 5K8UA 4R1OA 2AC7A 2EQBA 3CO0S 3RTCA 3V7WA 1JHZA 3A4YA 3IP5A 4OHBA 1SQFA 1TQ4A 4QVGA 4OMCA 4BXOB 1SIBE 2BUBA 3ELDA 3DOOA 4RHXA 3T7CA 5AHXA 3AR3A 1T3HA 1NW8A 4C6TA 3WRYA 2I2BA 4JOSA 1KS9A 4XVCA 1Z88A 1C8BA 2HUPA 3W6NA 5DNUA 4C2UA 2QX9A 5DM0A 4GBMA 4U2KA 3CRMA 3E22A 3RKRA 3TW4A 1P3Y1 3CF6R 2CF5A 3CINA 4FKMA 1UOEA 5F2OA 2P3SA 4JX8A 3A6LA 1I79B 1OYOA 2O0KA 2BM0A 3CLUC 2ZG6A 4XWWA 1FX0B 4IWXA 4E7PA 1UBOS 3FUCA 3TEMA 4MKHA 2XUDA 3IS3A 4X92A 4QFDA 2ATIA 3DL4A 4M21A 3GWGA 3BIXA 2WF8A 3CTPA 3CNQS 4DWWA 3M6FA 5JSHA 4KLZA 1MJFA 3EBLA 4JDPA 3FCYA 3MTDA 2GNAA 2Z98A 2ZQZA 5GOZA 3JQAA 3UCFA 5JAOA 4K1LA 4GICA 2HXYA 1E2DA 3AT1A 1Q50A 2I1VB 4IO0A 3VO9A 1WD5A 1NBOA 1Z15A 4TL7A 4FEAA 2VWQA 4NQZA 5B2ZA 1AH2A 1WDKA 3NUGA 2WW8A 1ZSVA 3URMA 4U7TB 2HADA 2FQXA 4NFYA 1H4SA 3CUEF 4MVJM 1QHEA 1V3TA 2JKZA 1VP3A 1FZQA 3AJDA 4GKJB 3CBQA 5G40A 1M6WA 2ZRKA 1GWNA 1U2EA 4HDSA 4HNAA 3BTUA 1KRWA 1BA2A 2YVQA 1AHNA 4ZVSA 821PA 3OPXA 1N5JA 5FFFA 1M34B 1CUJA 3V4LA 1XTIA 3FXAA 3NETA 3SMQA 5U9CA 1Y8QA 3FZQA 2F3SA 1E2HA 1TO6A 2YRWA 4B5KA 3PDWA 1PZNA 3CR8A 3DMYA 5TX7A 1NG9A 5EQDA 5AUOB 1XPJA 4GKVA 4F91B 4KVGA 1OHHA 4PSDA 1G291 4FONA 4AECA 2CLOB 3RJ9A 4ZPXA 1LPOA 4K3UA 5I7HA 1KYIA 2Z4SA 4NV1A 1J0DA 3P96A 4KK3A 4P3KA 2VH5R 4R2KA 1DDGA 3HG7A 1ZLXA 4XX0A 5CXXA 2YIVX 2A78A 1KAHA 3T35A 5BV1A 5EWJB 3RGGA 1QHNA 5E6SB 3W34A 3ABRB 1EVEA 3E0QA 3S1LA 3D6VA 3WB1A 1QR6A 1KEWA 5B7PA 1QPZA 1EJ6A 3GG9A 1UMDB 4PCVA 3VHLB 2R60A 2NNWB 3MJ4A 1ZJ4A 1GP2A 4HDAA 1P60A 4OHMA 3W5JA 5I9MA 2P6NA 1M2GA 1OXVA 2XR1A 3BGWA 3LHSA 5I7FA 1P72A 2GZ1A 1CUAA 1E1QD 2PUHA 1TX4B 2EKDA 4TKMA 3OQMA 2HM7A 2HJHA 2ZTUA 3PLRA 8AT1A 4INZA 1ORVA 4LHWA 3Q88A 9ATCA 5HKKD 4BU0A 1YT5A 3UPUA 4Y9TA 1YL6A 3UG6A 1RABA 1T25A 2N75A 5EIFA 3SYNA 2VVTA 4ZCLA 4UE3S 1Q7BA 1KERA 1A3CA 1YQTA 2C95A 3EA4A 1BFKA 3B36A 3JAWB 3T3IA 1AN0A 2GF9A 1W85A 3VO8A 2OFOA 4ZDJA 3UAVA 5I6DA 3C5CA 4JFRA 2DWUA 1EGVB 3JCZA 2Z2KA 3IQFA 2IXFA 2Q3EA 1UBMS 3EXHB 3RSHA 1CJVC 3HO6A 4ZIRA 1FSZA 2NV0A 1NJ8A 1U80A 3TSOA 1E0DA 1A1VA 2AYYA 4QQNA 4K9QA 1CP3A 3P9NA 3EE6A 4IH4A 4QPCA 1D5CA 4KQHA 3ZWKA 2ZJ5A 4IMIB 2OUIA 5BW8A 4WTOA 5KHAA 1H2BA 3A6PC 3ZYZA 1LTKA 1VRCA 1U1IA 2ODEA 1CEQA 2IWHA 2UDPA 2YIDA 5FH9A 3KYDB 3MZ0A 4ZU6X 2EV9A 2D1YA 1L5HB 1X9GA 1XTVA 4E07A 5JSFA 4V24A 5JQGA 4OBBA 4KOEC 4U00A 4BC0A 4YMGA 4YMSA 4HWGA 2JLYA 1WUHS 4C4SA 3OSZA 3IKTA 1LDMA 2PPLA 1X9IA 3QYPA 4X3OA 3BTOA 1VFPA 3O74A 3GROA 1NAIA 3F67A 5AXBA 4OFWA 4DLBA 2XYVA 4JUBA 4ENSA 1N7GA 1FJGB 5AVJA 2PVPA 3C4VA 1JFVA 5G3ZA 1OZFA 4XWKA 2Z9DA 3G2MA 5F9HA 1IG0A 4JR2A 3SJUA 4NRDA 4FI3F 2SICE 3ANNA 5FI3A 5JCXA 5KSZA 2BGWA 4AMUA 4D4JA 1CVIA 3BXXA 1AKMA 4J4HA 4GX0A 4LV8B 4UARA 4YJ3B 3VSEA 1I51A 2FPLA 1H2EA 3ZGOA 2ACEA 2YY5A 1E5TA 1VCNA 3ELYA 4BRZA 1XZKA 5LP6A 4OQLA 3CTMA 1CUBA 1RWKA 4QRDA 2YFYA 2ZYGA 2I6SA 1TA9A 3FMVA 5C5DA 2ENWA 1CUIA 1B8VA 2R6GA 1NSYA 1RQNA 3A2LA 3PPYA 4JJFA 3O47A 4WOBA 2FK7A 3IUYA 2XYPA 2PX2A 2XE8A 5K05A 2QOEA 3UTCA 1S4QA 4QREA 1C0EA 4IXMA 1SBIA 3LOUA 4D6PA 1MLDA 2BKLA 2EFDB 1VL0A 2D8AA 1IY9A 4Y6SA 3T54A 3C6ZA 3GLHA 3DDZX 3Q9LA 4ERNA 1VKZA 1XEWY 1N6NA 4ROTA 3EZFA 4NC9A 3ZDZB 3AL3A 4DDHA 4I9FA 4IGKA 1DC3A 2RH9B 4MUYA 1KMQA 4S12A 3NMUF 3H5VA 2EAUA 1IH8A 1UPTA 2ORED 2R4UA 4N40A 4RZHA 3DTNA 3QFTA 4HFMA 2VDNB 1MB3A 3L07A 4D0NA 2JHCA 2A5JA 2QIPA 2ZRJA 3GAMA 5C4IA 1ICEA 3JPYA 1XMQB 3GJ8A 4BVBA 2JJYA 1IIRA 1DJOA 1MN6A 3EP4B 1YI8A 4P4NA 4B45A 4H77A 3NHRA 1JA1A 1WZNA 3FGZA 2HUNA 4MPRA 5M29A 4JT9A 4F12A 3BK7A 4DR4B 3KWJA 3BH6A 3DT9A 3IEIA 4DRXB 2XEXA 4QNRA 1YL7A 1DADA 4BVLA 4P98A 5KOYA 4LK2A 2P9CA 3RIYA 2ZZMA 2VCHA 3R5TA 1RHUA 3MIIA 5C8DA 1QGUA 1TUGA 1E94E 1LI7A 3NHZA 1YE5A 1JJBA 1RW4A 4JLMA 3EIEA 3S2ZA 2LKDA 3STUA 1CKEA 3IERA 4JY7A 5EMMA 3UGKA 1J06A 1B1AA 2XZTA 3Q2OA 4J7UA 1I6WA 4BQEA 3EN0A 5HQJA 2Q99A 1W0JA 5M34A 1SQ6A 1S3GA 1Z7GA 4QVKA 4U02A 1FXWF 1XHEA 2AJDA 1XZMA 1T2FA 2HQ1A 4HYYA 4OLJA 4XPIA 1KYWA 4LRUA 3PGKA 4QEDA 4ZHQB 1R3DA 4DLKA 5C1IA 5F7ZA 3BF7A 4RHEA 4CIVA 4PLYA 1KI2A 1ULHA 3PRKE 3U16A 4UBMA 1EVJA 2QZZA 3D8TA 4L5AA 1M66A 5EUBA 5DWQA 1BHQ1 3QU9A 5H9WA 3NFYA 2WB4A 3KELA 5D3QA 3N5KA 2QJFA 2G80A 3MWDA 1BD4A 1JAZA 4Y2GA 4P6VF 4DSOA 1UUFA 2NZVG 1U5BA 3EYAA 1WMFA 4JVNA 3ZHYA 1AUOA 2HA2A 3ZCXA 121PA 1QO7A 1YULA 2NO0A 3DEIA 4O4IB 1DCMA 4YRQA 4I4TB 4NXMB 4GKKB 1Z4KA 1QQ7A 2C2WA 2CCKA 3HCOA 3OZDA 4BO4A 3TSAA 2OHHA 2OC4A 1F9EA 4BP9A 1S5PA 2WF9A 2R7LA 3KTAB 1YCHA 1QAQA 3GFRA 3NOVA 2J9YB 4LISA 4PC1A 4X1YA 5KI6A 5JCZA 1B6GA 4G37A 5HZGA 3K71B 1S2NA 4RKYA 2HU8A 5DSTA 1V96A 3AJ8A 4RAOA 4KE9A 4EBFA 4XQGA 4UEOA 5TPZA 3LQ2A 1X39A 4YDSA 1CRWG 1V5GA 3NHMA 1ZIYA 4MJXA 5D5QA 3IE1A 1QKKA 1G20A 2AD5A 3G85A 5IBQA 1K86A 4BVGA 3A9WA 3I9KA 1DOAA 1TCUA 2QTVA 3ZQ6A 1AGXA 2G1AA 4N7BA 4BO1A 3STVA 1H9CA 2APJA 3EPAB 4CEJA 4CIWA 3CNLA 3OT4A 5DJ5A 1I0ZA 3NQ41 2R8RA 4ZXFA 1UWVA 2REOA 1Y81A 2VDVE 4J94A 1AKUA 2ZUUA 3BT7A 1CJMA 1YU9A 2LCIA 3IDFA 1L7DA 4CIAA 1W47A 1DX6A 2C9OA 5D1HA 5BUZA 4ZD6A 2QA5A 1CPYA 1SG6A 2OHXA 4QPJC 4AP6A 2G1KA 1MENA 1L4GA 3BKXA 3D9QX 3O1HB 3T15A 2FSHA 3G8AA 3MPOA 5EJ2A 3TAUA 1ZICA 4G5QA 3WRYC 3N8IA 3VR6H 3K1AB 3CO5A 3DCJA 5LD2B 1FXWA 2BGLA 2JGDA 3DOIA 4WBSA 3N2ZB 2FPMA 2HJVA 2RGEA 4NESA 3UW1A 3EPRA 3EGCA 2O5RA 1RC1A 3EZ2A 1WSWA 3GGSA 4HWKA 1JTFA 1GLNA 2FCAA 4B4OA 5IT0A 1S7GA 1TKCA 3FOCA 4OATA 4RVCA 5C0OE 2LIPA 3AFGA 4A0GA 1TM1E 4AWBA 1Y9DA 4CV2A 1NNSA 1FDOA 4ZT2A 3A2KA 2UVDA 1OWNA 4UQLA 1IC6A 4DR2B 3IVRA 4ZT7A 3B48A 4UDXX 4O2RA 3U37A 1RWXA 2VA8A 1OXXK 1G2QA 3H3JA 3KUCA 3UYLA 5FV7A 1E5VA 1NXTA 5TVGA 3H9CA 3H2BA 3GZJA 1KZ7B 1YQUA 4BWFB 4E46A 4J3JA 1JMKC 5D8DA 1DFGA 5EIAA 2WJWA 3A31A 3VOAA 1ELOA 4N6NA 4YAIA 2CY0A 4HHEA 4IUBS 3JQ7B 5JCPA 3FKJA 1E9DA 4B3RB 1YS1X 3GCZA 3OZFA 5LMCA 1HK7A 4KQMA 1E2GA 3L7DA 2DKFA 1T1EA 3A3PA 3VNUA 1D8AA 1WE2A 3T3NA 1CQJB 2ILVA 4M8SA 5NLLA 4DCCA 2C54A 1E6LA 1JAXA 2XUZA 4NX2A 4S1WA 4TYMA 3L4EA 2Q07A 3B1KA 1WTAA 1UEXC 4KRGA 5EUCA 2C2ZA 1H4TA 2TRSB 3TL2A 3EOBI 2R6R1 4K6FA 1I3CA 5AW8A 3GJYA 1WEKA 4G5RA 1ZL2A 2ZYDA 1M2HA 3W5UA 5HQ3B 1Y7PA 1ZA2A 2UXCB 1FTQA 1NV9A 1P81A 4Y1EA 3PUWA 4CLRB 1WBJB 1MF7A 2I87A 3FCSB 4EBBA 1J5XA 2AWNA 1IWBB 1XAHA 1ZD3A 3ROQA 1HQKA 3IESA 1YJXA 3ZOZA 5K9ZA 1QRDA 5IVKA 5EEGA 5C7IO 3TSYA 2VSOA 2XB8A 4PCAA 2H29A 2V74B 2VP2A 4MSUA 4ZI5A 5AKZA 3O84A 1F8FA 1SJ9A 1UBJS 1L5KA 4I14A 4K9SA 3D7KA 3C3MA 1JR3A 4L02A 5SYAA 4BAZA 5CDUA 1S9HA 4KACA 4W4TA 5JU6A 4R5MA 1W34A 2AOTA 1UK6A 3B51X 3BICA 3NM4A 3QHAA 4WZZA 3SKYA 2O3SA 4EATA 3VU8A 1EXNA 5HOQA 2GM3A 1XDGA 4G5OA 2JIDA 2G07A 2PV0A 3FZEA 4LUCA 4DR1B 4TN1A 4NS1A 3OLYA 4IXNA 1GL3A 1YU6A 3UHAA 3SYMA 1QB8A 3M6AA 2UZ0A 3UWDA 1CQIA 1T4CA 4OREX 2RGRA 1EUCB 5LA6F 2AFRA 2HHLA 3OEYA 4FX2A 2ZR0A 4QUKA 3TM5A 2BCGY 2UZIR 3JQ6A 3RUAA 4QJ4A 3BRCA 4HXEB 2YC4C 4DUZB 1XRMA 2B37A 1X6VA 3TIFA 2QLFA 3QLJA 4OQFA 5K6TA 2O8FB 3IP1A 4RHFA 3SWWA 2JI6A 1WD7A 2R00A 2ETVA 2IF2A 4I55A 3ZIDA 1EXDA 2HPHA 4CT5A 2BGJA 1PT8A 2YZMA 3I42A 3LWBA 3Q10A 2QZPA 3BEOA 4GFDA 3W7BA 4JT2A 5KOIA 1LVGA 2W00A 2WU1A 3VKWA 1I80A 4QFBA 1IHDA 3BE4A 4G9EA 2IYVA 3RBVA 2QWXA 4E6EA 4HSEA 4OP2A 1LDBA 4KMOA 3ZHUA 1OROA 3LL4A 7MHTA 1ZUIA 3KV3O 5FO0A 2DERA 1B0ZA 1YD7A 4Q16A 2ZSDA 1F4LA 2P40A 3A9VA 5BSMA 1H9BA 1OCEA 4EMSA 3WNQA 3KAKA 4RTQA 1DO0A 4BVEA 4ZCSA 4FNAA 4U0KA 5B58T 4C5CA 4BLSA 1RKQA 4MKIA 3H8SA 5BQOA 4BE7B 5IFLA 3Q9SA 5LP6F 4MIOA 5BMVB 3GRVA 2PSHA 2V3WA 1DPGA 4CEIB 1O5TA 2Y0PA 5BYKA 4HGRA 4LXIA 2AL7A 1TMYA 2G71A 3CR3C 3H8JA 1O0CA 4LEIA 1FSPA 1KSGA 2QTZA 1BA3A 3HYLA 4L85A 2X5JO 4LJ4A 4AO6A 1KEZA 3QXJA 1ANKA 3UK1A 4PXAA 5L9AA 1IVSA 1ORIA 2WFAA 3H6HA 5C80A 3CQ9A 1YR6A 3TBKA 2H4HA 2W2QA 4O2BB 3CEAA 4OGGA 3G49A 1WLSA 4YUYA 5FHQA 4ZCMA 1ECGA 1YDEA 3IUQA 3BD9A 2V9PA 3BREA 3G8CA 1Z38A 2MSWA 4QRIA 5HYVA 1WY7A 1S01A 5CVVA 3RNOA 1YC2A 3K4QA 4LYJA 2HPZA 3QKWA 3OH8A 2ID9A 7REQB 4OYLA 3T3DA 4IDCA 1CEEA 4ZYYA 2JJ2D 2BY4A 1L5HA 3MJSA 1TT7A 4AD8A 3OM0A 2HLDD 3R1IA 5ISMA 2ZSUA 4KSCA 3K0HA 1C80A 2YUTA 3CNHA 5SZHB 1RXWA 2R1UA 1M5UA 4NH4A 2PSJA 3M9WA 2W6ID 1IZ0A 5E9JA 4XVRA 4LCEA 2G8NA 3IB3A 2V1UA 4LAFA 4U8HA 4BQQA 3HCBA 3DCNA 4CG1A 3PF8A 3PL5A 3BJEA 4KYIB 2UUPA 3G0GA 3WIEA 4BGEA 1BN7A 4WNAB 3UHFA 4L72A 1PZGA 4D6XA 3ZY6A 3UPDA 1Q1GA 2XB4A 1T8SA 1G2OA 1Z6AA 3CN7A 2DQYA 1SK9A 2XTMA 3ZWDA 4HXYA 3K6SA 4DQUA 4KAJA 3TCKA 3RF6A 3WLKX 1U2QA 2NO1A 3CISA 5HNKA 4YRMA 2GN2A 2DRIA 4L8VA 1KR2A 5B37A 5F3RA 2PGJA 3X1ZA 2YWFA 1ZO8A 4ZEVA 5B3KA 5DIZA 5ES3A 3L5OA 1O57A 1PBNA 3M1YA 5AJZA 3V4SA 3BEDA 3HDQA 2QX7A 4ENVA 4TT8A 4NBWA 1ISJA 3H16A 4FFPA 3B5JA 5D6NA 3P2KA 3T3PB 4KRFA 4DT1A 3D6FA 2RGWA 4GOOD 3HA7A 4LZLA 1QH1A 2PS0A 4FUTA 4OGFA 4MVJA 5DBFA 3W9BA 1G5HA 4ZOEA 1V1RA 2XBMA 3RGWS 4KIWA 2CWWA 2B8WA 4ES6A 4B7XA 1E3MA 2GXSA 1P39A 1DV1A 5DLDA 3C39A 1BW9B 1EM8B 2Z95A 2H0QA 3WL7A 2J0QA 1XWWA 1KZ1A 3CLVA 3P5SA 1K98A 3RT1A 3KQKA 4WACA 5ERXA 4L2IB 3DV2A 3MNFA 4KEAA 2IOFK 3JQ8A 4PW0A 1JIUA 5DEIA 4BNZA 4I19A 4BNDB 1GGKA 2F1KA 2OQIA 3QUCA 4DEXA 1FA9A 3W5SA 1UT8A 5ARBA 2NNLD 3B70A 4JB2A 1SKYB 2RB5A 4ZALA 1WMSA 4ZARA 4MKRA 3B3AA 3U4GA 3NKVA 3HP7A 2PH1A 3PC8A 2Q9UA 2ZXUA 3GT7A 5EUMA 4F3KA 4H6WA 3AF4A 3OY7A 3PFGA 4QJIA 4GPD1 2JANA 1R0RE 3SF8B 4JLOA 3PUJA 2FMXA 3GFVA