3V1YA

Crystal structures of glyceraldehyde-3-phosphate dehydrogenase complexes with nad
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
b'KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
total genus 120
structure length 335
sequence length 335
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2011-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v1yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v1yA01
3ORFA 2NQTA 2B0JA 2EJWA 4LVCA 1LDMA 4AL4A 4YAGA 2O7QA 2D5CA 3V8BA 2PD3A 1Q7CA 4DLLA 5ICMA 2RH4A 1LDEA 3PYXA 3TDKA 1FF9A 3PDJA 2I5PO 4IZHA 4LMPA 3VC7A 5CDSA 5GZ1A 2PD4A 1HSZA 4JCOA 4OAQA 4AJEA 3R0IA 3MWDB 1XU7A 2NUAA 3T7CA 3I6IA 1LDNA 3S2GA 2NADA 1X1TA 2EGGA 1GY8A 2PGJA 3GT0A 2ZB4A 4R9SA 4MP8A 2EERA 3MOGA 2YHUA 3GY0A 4R68A 4HADA 4B4OA 4A73A 4DMLA 4MDHA 4MVJD 4EJ0A 1WDKA 4OSOA 4A03A 2Q2VA 4GX1A 2GNAA 2IXBA 3DDNA 1RJWA 1JU9A 2DVMA 3HG7A 5A9RA 3P7MA 2Q1WA 3BHJA 3N58A 4J4HA 1WP4A 4WJZA 2CDBA 1I30A 1PJTA 3ITKA 3FWNA 2H63A 1IULA 4Z0HO 3EGOA 1PGNA 4IS3A 3GDGA 5U1PA 4DRYA 5EERA 1YB4A 3B70A 1ZK2A 5CG2A 2HK8A 2YQ5A 1WDLA 1S7CA 1VL0A 1VRWA 4IBOA 4ZRNA 2OOSA 4MVJM 5JY6A 3OIDA 2HJSA 4QSMA 4XEHA 2O2YA 1E6UA 1R4NA 3JQAA 2OBYA 3DBRA 4D46A 1V8BA 3ADOA 4NJMB 4ZQBA 2JFFA 1NFQA 2WMDA 1P31A 1K0UA 4Q3AA 1U7TA 3JQ7A 1KC3A 1OFGA 3DZIA 1ONPA 3MJVA 4M89A 3Q9NA 1F8FA 3AOGA 4J90A 5ITVA 2R6JA 4HFNA 3VHRA 1ONOA 4AJNA 3D64A 2RHCA 2VHXA 4PIVA 2EV9A 2ZTLA 1DAOA 5TIIA 3HB4X 4YAIA 4AVYA 1DRVA 2QZZA 5EQDA 5U9CA 5HRUA 4IXWA 4R41A 4ZN6A 4CMEC 2AXQA 2VHWA 4PCVA 1ZEJA 4BO0A 5KJ6A 1S6YA 4GBJA 4DUPA 3M1LA 2X58A 4OIMA 5DT9A 3RCBA 4J3FA 1CEQA 4J49A 3RUEA 2I67A 4XGNA 3GVCA 3GEDA 4Q9NA 3OMLA 3EW7A 3P19A 4TRRA 1TA4A 2E82A 1B8UA 4RQTA 3RBZA 1B8VA 4UVHA 4GVLA 3ZW9A 3L6DA 1TI7A 1BXKA 5F5LA 1OI7A 2VTEA 3FTNA 3AK4A 4EGFA 3BMOB 4FS3A 1K6XA 2E48A 1B14A 3PDUA 1CJCA 3EAGA 4U7WA 4ZQEA 3RC9A 2J5QA 1P1IA 4D41A 1FDTA 4ZHSA 3K96A 3C7DB 3FWZA 2XPCA 4FOOA 1EBFA 5DDIP 3RJ9A 5F1KA 2PTGA 2PWZA 1Z82A 4E2WA 5JMPA 2F00A 3V2HA 3RC1A 1OC2A 1YGYA 2H9IA 4EZBA 1YJ8A 4PN3A 3JYQA 2DBVO 3NV9A 2P9EA 4Q39A 5T67A 2PLAA 1SAYA 2O3UA 4A2CA 4E5KA 2FWMX 1DFIA 4N5MA 4XR9A 1Z6ZA 4XDYA 4AJIA 3CSDA 3ZNPA 4BNTA 5C7IO 1UXKA 1P0CA 3GLQA 5KIAA 5F3RA 3HFGA 4X54A 1ISMA 3WGGA 4D42A 4NJMA 1U5CA 3PFWO 4KQWA 1XEAA 4CLOB 1T26A 5KCZA 3UICA 4P4NA 2DBRA 4OYRA 2XAAA 4URFA 2R00C 1FK8A 4YXFA 5K9ZA 4XWYA 3H5NA 3U4CA 1PZHA 1N7GA 3ENNA 2A4KA 4LCJA 5LCXA 4KTVE 3ZV6A 1SNYA 1KVRA 2HMUA 3TZ6A 4E5YA 1PWZA 3GRPA 1WWKA 4QFCA 4B3IA 3DONA 3ZV4A 1ADBA 4DLBA 3ROPA 1XSEA 1DO8A 1Q1NA 2X9NA 2Y1DA 3JQ9C 3WR5A 4R3NA 1GYQA 3I9JA 1ZJYA 1I3KA 1O95A 4TKLA 1YBMA 2Q1TA 5H82A 1HE2A 4AJKA 1I8TA 4GWKA 1AHIA 2Q1UA 2C0CA 1GCOA 2YDXA 1YWGO 1DBVO 1CQIA 3PI7A 5TJ9A 1F8GA 2HK9A 2RIRA 5IZCC 2Y99A 4IUYA 5AXAA 1YQGA 4WLFA 3UCFA 3LT1A 3OIGA 2NTNA 1MGOA 4CMGA 4NPCA 4R5HA 5HS6A 4J4TA 3IP1A 4IZIA 4BNZA 3ZWVA 3GDOA 4OL9A 1MUUA 3TPCA 3C8MA 1QP8A 1NHWA 1V6AA 1QXSA 6ADHA 4ZVVA 1U4OA 1ULSA 4D3DA 1NASA 1HRDA 4TVOA 3OF2A 3WFIA 1AXGA 3BMOA 1EVYA 2EP7A 4B7UA 3LQFA 1QG6A 2I3GA 1QYXA 5FI3A 1E3IA 3P2OA 3SX2A 1EQUA 2HO5A 4AJ1A 1BTOA 4OMUA 4ALLA 3SJ7A 4M8SA 3U9LA 3G3EA 3OJ0A 4J7UA 5B1YA 4XQCA 1DAPA 2GZ1A 4JLWA 1VJTA 2SCUA 4RLSA 1QSGA 2WDZA 3PFFA 1DOHA 1T2DA 5TT1A 3D4OA 4BO4A 3BA1A 3I9MA 3KO8A 4NI5A 1P74A 2BLLA 4M55A 4W82A 4CLRB 3MCVA 2Y1CA 3SEFA 2J5RA 3U4DA 1AUPA 1DXYA 4U6QA 4XB1A 5JW6A 2EKQA 1KY5A 2NM0A 1I0ZA 2HAEA 1IZ0A 4YR9A 1XQ6A 5L40A 3QSGA 4CLOA 1I24A 1U7HA 2IRWA 4XJSA 3CMCO 4F6LA 3DZKA 1NQAO 4Q3DA 4IXTA 1GD1O 4LSMA 1C1DB 4YT8A 5IZ4A 3GVHA 1YQXA 2VHYA 1VJ0A 4A26A 1R16A 5B4VA 1N5DA 2GO1A 2C2XA 1XCBA 3HQ4O 1DC3A 4BNMA 2AQ8A 3NYWA 4TKMA 5T8KA 2J3JA 2DUUA 3ZWOA 4BNGA 1ISHA 3ZWMA 4L76A 4P22A 3QVSA 2W4QA 3WSWA 4Z9FA 7ADHA 2EP5A 2ZK7A 3F4LA 1G1AA 2QHXA 1A9ZA 1ADGA 4DBZA 1MXHA 1PTJA 4MJLA 1GZ4A 2IEDA 5L7YA 4WLVA 1QORA 4Y6RA 1HTBA 1XR3A 3FNFA 3KVOA 1UZNA 1UP6A 3IMFA 3IS3A 4BGUA 2QQ5A 4XCVA 4Z3KA 3RFXA 4R1NA 3PLRA 2DFVA 1XGKA 1DLJA 5JDCC 2FR1A 3W4JA 4YT4A 4E2YA 5CFZA 1ZSYA 4BUCA 3ZZNA 1MB4A 1ADFA 1X14A 3ETDA 1V3TA 1QRRA 2JCVA 2OXIA 1H94A 3G79A 3QVXA 2Q50A 4FFNA 3ROMA 3RROA 3ZWNA 4FSHA 3QVTA 1ZMTA 1NQTA 3TZKA 1ISIA 1M76A 2Q49A 1BVRA 1LI4A 3TZQA 1G0OA 4G5HA 1CRWG 2GR9A 4MKRA 1HYEA 4DYDA 3ZV3A 1LC0A 4BIIA 4K26A 3PQDA 3PHJA 5L51A 4D43A 5IXYA 1Q0HA 1GZ3A 3V1TC 4KQXA 1HF3A 3FCOA 4WLUA 1JTVA 4DPLA 3DAGA 4ZU3A 3F46A 2E4AA 4IDEA 3FNEA 3K31A 3UVEA 3OQ1A 3ZGYA 1WLYA 3W8DA 3VTFA 1E3SA 2P9CA 3FD8A 3I9LA 3OECA 4E13A 2NVBA 3JD2A 1E5LA 3W6ZA 3RJ5A 3GK3A 4PG5A 1HDZA 4RPKA 3OA2A 3GUYA 4EBFA 5ENVA 4Q3CA 1KIFA 2O3TA 1RYEA 2FSVA 3G1TA 3NDJA 5ILOA 3SLKA 4PRKA 4NBRA 3EUWA 3WBFA 3WGHA 1GFSA 3TJRA 4PZCA 3IOYA 1C1DA 3MTJA 1GUFA 1KY4A 4RF4A 3WWZA 3IIEA 2P5UA 2FRDA 1XYGA 1QYCA 4BO5A 5T6BA 1ZCJA 1U3TA 1LTHR 2VN8A 3QQPA 3UN1A 4BHTA 4A27A 2HLPA 3FSRA 4NFYA 3WGQA 1F12A 2JAPA 3PHLA 1I2CA 4MKZA 4HFMA 1ZFNA 2ZJ0A 4CODB 3DZGA 5J23A 3PGJA 4PLCA 3O8QA 2Y1OA 2D5AA 3B1FA 5I9NA 1T2FA 1D4FA 2ZYGA 4BO6A 4ALIA 4CMHA 4QXMA 1K6JA 3ZWWA 3R3SA 5JYFA 4KMSA 2BFMA 1LRKA 4DPMA 4MPDA 2JCXA 4WCFC 4W9NA 1T2CA 4A5OA 4J9VA 3V5NA 2NV6A 2YYYA 1VPDA 3SXPA 4D44A 1P1HA 1JVBA 3R1IA 1N1GA 4BNJA 3NX4A 4R69A 2C2YA 3WMWA 5K6AC 1MFZA 4QX6A 3SBOA 3TL3A 4NFHA 1LXCA 2P9GA 3ANMA 2QZ9A 1E1MA 4WECA 3RBVA 3DTYA 2CVQA 1K5HA 3PIIA 4Z9YA 3DOCA 2F1KA 3KOUA 4Y6SA 2HCTA 3TOXA 3TZHA 1SOVA 2C5EA 2E37A 1ZH8A 4ZRMA 3L77A 3TWOA 5EPOA 4BMNA 1H0KA 4CM8B 2CSUA 1N1EA 4OXKA 3VPHA 3JQ6A 4KUGA 4LK3A 4GLOA 1LLDA 5F1OA 1CWUA 4II3A 4CM9A 4DGSA 3SLGA 2O7SA 2DQ4A 4DPKA 3ZCXA 3AY3A 3LT0A 4DC1A 1HXHA 2ZCUA 3NGXA 4GKBA 1YXMA 3CTMA 3EHEA 5BNFA 5IDQA 3KYDB 3ZW8A 4K9DA 1XQ1A 3E82A 1T4DA 4CM1A 4W4TA 3KM0A 1A4UA 1MG5A 4KWIA 5LC1A 4IY1A 1T2AA 1YO6A 4PLYA 3DWFA 3GA0A 3AUSA 3AWDA 3VDRA 3DBLB 1PL7A 5H83A 1M6WA 1R4MB 1J49A 2O23A 1I10A 3O26A 3VDQA 1UP4A 1YJQA 4XA8A 2AQKA 5G2OA 1I3LA 4YRDA 3IP3A 3AI2A 4I08A 4JJGA 2ZQYA 2EF1A 5L9AA 4BNVA 3N7UA 4IPTA 1IHYA 3EZLA 5DCYA 3VPGA 1N92A 1R0SA 5KOIA 4R1TA 2P4QA 3ZHZA 1DLIA 4L73A 4R3WA 1LDBA 4J1NA 4CM6A 5T73A 1JWAB 4FFMA 1E7QA 2WEKA 5JE8A 3NDIA 2DAPA 4EW6A 4FGWA 4L4RA 2GZ2A 3JV7A 4YJFB 1PZGA 3HB5X 1YKFA 1PJLA 2AQIA 1C0LA 1SZJG 4TMFA 5JAMA 3DHEA 4S1VA 5JS6A 2DTXA 3H3FA 3F1KA 3AFNA 1WZEA 4EI2A 2BGLA 4E31A 2PR2A 1D7OA 1Q0QA 1QV7A 2CF6A 2VZ8A 4LMRA 1GAEO 5A5FA 1EVZA 5A06A 4RF3A 2X9GA 1YL5A 2GF2A 3C7AA 1YQDA 1U5AA 2Y0CA 4FB5A 1VL8A 3I1JA 2P5YA 2J6IA 2C7VA 2YY7A 3DOOA 2XXBA 3FTPA 3PHIA 1ENOA 3W4IA 4DC0A 1HDYA 3A1NA 1U3WA 5DN9A 3FNGA 2Q99A 1V3VA 2FMUA 4U5QA 2OP1A 4CM8A 1RWBA 3TFQA 3JYOA 3PQEA 4CPDA 1XWFA 4O63O 1YH3A 3AUUA 4FC6A 1HEUA 3ZU2A 4BKRA 1P33A 3GG2A 1Y6JA 2Y93A 1Q0LA 1HETA 2FPGA 1SOWA 1V9LA 3ZWXA 1X0XA 3W6UA 4M86A 4JGBA 4YRAA 4QO7A 5ADHA 1C0PA 3GNTA 2PGDA 3W4KA 1IHXA 1NHGA 3KYDA 4Y67A 2YV1A 4QT0A 5JDIC 1EUZA 1LNQA 2E49A 3GZNB 4CR7A 1LLUA 3PVZA 5JYEA 3AW9A 3VAZA 2UYYA 1O94A 2PY6A 4W6ZA 1FDSA 1YBAA 3RUFA 1ZUD1 3UF0A 3KETA 2CF5A 3DBLA 2IZ0A 3H5AA 8ADHA 1R4MA 2OORA 2GCGA 2CUKA 3H9QA 2FR8A 1E3JA 1U8XX 4D3SA 1VLLA 2AQHA 1VI2A 1U9JA 4FQ8A 3EVNA 3OHSX 3DC2A 1RYDA 3LVFO 1Y7TA 2D1YA 4XD2A 5THQA 5KVVA 3WYCA 1IYZA 2FPPA 1KOLA 4JROA 3QE3A 1V3UA 2JHGA 3ZHXA 3C1AA 3S2FA 2YW9A 3JQDA 3VOSA 2IEBA 1TVEA 4FW8A 5F5NA 2X1HA 2BMAA 3CUKA 3IJRA 5I9MA 4ID9A 1U2GA 4R5MA 5A1TA 4YJFA 3KSUA 3IKTA 1YRLA 2ZYAA 1V35A 1NQ5A 1E7SA 4EYEA 1HDCA 1JW9B 2JL1A 1Y5MA 5KTKA 1H6CA 2H1SA 4MIYA 4BNYA 3RC2A 1CIVA 3A14A 3GR6A 3UHAA 3FF4A 4GLLA 4QUKA 4Q3EA 1SPXA 1PJ3A 1EZ4A 1GYPA 4YEDA 4OH1A 1HT0A 3KB6A 4E32A 3C24A 1P1RA 5FYDA 1EE9A 1NP3A 3G0OA 3LSYA 1R15A 4OQYA 4CQLB 4NH4A 1GUYA 4U0JA 1DSSG 3RASA 2Q22A 1E92A 2VWQA 4UVDA 5T5QA 1PX0A 4NJOA 1NTOA 3D7LA 2B5WA 1SB9A 2EGHA 4DLAA 3UXYA 1G0NA 5JO0A 1GEGA 3ZHYA 2BFAA 3HUDA 5COAA 2PH5A 3I83A 3ROKA 2BF7A 4BV9A 4DQUA 1BGVA 1VL6A 4NFSA 3L4SO 2VZ0A 3WFJA 2GGSA 5KJEA 2VWGA 1B26A 4HUJA 2OP0A 2ET6A 5CHEA 2X6TA 3EMKA 3TZCA 2WYWA 3GZNA 2NSDA 1OZAA 5IG2A 1ZO8A 2WWRA 2DT5A 4I9NA 3GVIA 1NVGA 1FJHA 2XXJA 2ZTMA 3PXXA 5FI5A 4HP8A 3IC5A 3Q11A 4FD3A 4UAGA 1C3VA 3VPSA 3AOEC 1P0FA 4E5NA 2VOJA 3CZRA 4YAJA 4HBGA 4HKTA 5JSFA 2X0JA 3OIFA 2CDAA 4JJIA 3QJ5A 5TQVA 3RU9A 3WYEA 3AY6A 5CDUA 3H9UA 3KTDA 2FZEA 2EW8A 2J3IA 2QYSA 3RQSA 5KKAA 2W2KB 1E77A 4JBHA 1NPTO 2C82A 3MJEA 1EVJA 4RL6A 2EIHA 1ZJZA 3C85A 3GEMA 4CM5A 3CINA 3CE6A 4XYLA 2Z95A 3GVXA 2OGUA 3U4IA 4FR5A 3WSVA 3DO5A 1BDBA 2VRCD 4UULA 5BT9A 4GWGA 2C59A 2A35A 3KUXA 4KOAA 1I33A 3EZYA 1HL3A 3A28A 3ANNA 4IDBA 2GN4A 1YONA 5B4TA 3GMSA 1YS4A 2BGKA 4MO2A 1CYDA 1ZKMA 3HDYA 3JQ8B 1P45A 3PP8A 1MXFA 3O9ZA 4J1QA 3NAQA 2G1UA 2OO5A 1HE3A 3K73O 3X2EA 1OBFO 4XIJA 1KS9A 4OKNA 2X5OA 3WGZA 1ZEMA 4XDZA 4Z6KA 2GUGA 2RBEA 3PWKA 5FEUA 3Q2KA 4PLPA 4S3MA 1KEUA 4HFRA 1TB4A 5TLSA 3U09A 4BNWA 4LVUA 3GGGA 3PLNA 4UUOA 1IB6A 5G4LA 4CQLA 4Z0PA 2FR0A 3ZWCA 2W98A 5JPIA 1C0IA 4U0KA 4ROSA 1QV6A 3K92A 3WTBA 2NVUB 5G0UA 3G49A 5A9TA 1F14A 2UVDA 4NQZA 4PLWA 2PGLA 3I52A 4UUPA 3WOHA 5C3MA 3OICA 1ISGA 1QR6A 4W99A 2C29D 4D79A 5EIOA 4PG6A 3I5MA 3VKVA 4KDFA 2V6GA 4M54A 1H6AA 4E33A 3I3OA 4GH5A 1KBZA 4YYZA 3TF5A 3A06A 3A4VA 4E12A 1YB5A 1WMBA 4UUMA 4AG3A 2I9PA 3DZFA 2D2IA 2G76A 1UDAA 3QP9A 4N5NA 4WPGA 1ZNQO 1U3UA 3GHHA 3INTA 4C4OA 1A71A 5THKA 1EK6A 9LDBA 3EK2A 1DJNA 3TNLA 4CQMD 3WBBA 3ENKA 4WASA 1DB3A 1DRWA 2B37A 3D4NA 1E1LA 5TX7A 2JAHA 2ZIZA 4IQGA 4BNLA 2O3QA 1O89A 1B16A 1IZ9A 3RFVA 1ENZA 2C07A 2NACA 1DFHA 3TQHA 2NWQA 2VNAA 2DM6A 4YJHB 5DP2A 2WD8A 3JYNA 4A7PA 1ZIDA 1MX3A 3W8FA 2PKQP 4J1TA 1ID1A 4RF2A 4IJVA 3DBVO 2GERA 2OL4A 2QRJA 1ZMOA 1PQUA 1U3VA 2Q45A 2W2KA 3KBOA 4KWHA 4DIBA 2AW5A 1KYQA 1PJQA 3UW3A 4E5MA 4RZHA 1A7KA 2CDCA 4E6PA 2QG4A 3RIHA 2UAGA 2Y1EA 4J7CA 3SC6A 3M1AA 2DBZA 5IXSA 4RO0A 1LLQA 2DTDA 1T4BA 4K28A 4WOKA 3VZRA 3FN4A 3LC7O 3WGOA 2PKRA 3CEAA 2Q46A 4LISA 3RSHA 4DQXA 4BNFA 4KZPA 1YVEI 3JQ8A 5L3ZA 5CPFA 1R12A 1L7DA 3JSAA 1XG5A 1ZK1A 3OSUA 3KRTA 2Y1GA 4GGPA 1HDOA 4M49A 1NWHA 1U4SA 2VUUA 3FRJA 3Q3CA 1EQ2A 4WGGA 3M2TA 4F6CA 1I32A 4N18A 5G0WA 5HS4A 4BO8A 4E2ZA 2HMVA 1T24A 1RM3A 2EHDA 3LZ6A 3PTZA 4BO7A 2WD7B 1HWYA 4KDEA 3KZVA 3VPFA 4IMPA 4OJNA 5KJ1A 2PZLA 3O03A 3WJAA 3MEQA 2O4UX 3AUTA 4G2NA 4PLGA 3ZI0A 2NVUA 2P91A 1UP7A 3OH8A 3PJGA 1N2SA 1DJQA 5TJHA 4AJ4A 4BGIA 4M87A 4CMEA 1LSOA 3VVBA 3R6DA 2EKPA 3MJSA 4FPXA 3WNVA 3KLMX 3S2EA 4GSLA 4CQMB 1HZZA 4CV1A 5M6DA 4HNGA 3ONEA 2DU8A 1U28A 2Q2WA 3GGOA 4ZJUA 3I23A 3RD5A 5A03A 1JVSA 2JD0A 3LU1A 1M66A 4I9UA 2FSSA 3PK0A 5JCJD 4KUHA 1ZSVA 3L0DA 4PZEA 1BW9B 4QQRA 5JLAA 4AFNA 1NAHA 4CM9D 4RQUA 4MVJE 3FBGA 3LLVA 2B4RO 2Y05A 3FPLA 4ONEA 1KEWA 3G17A 1X1EA 3CMMA 5KVCA 3CZMA 3MJ4A 3FBTA 1KVTA 5CDTA 1ORRA 4AJJA 4I1IA 4XKJA 4I5GA 4OSPA 1QYDA 4YJHA 3KEQA 1A72A 1DFGA 1GL3A 1LSUA 1E1NA 4GKVA 1OAAA 2VRCA 5EN4A 5A04A 1JAYA 3DZBA 2PA3A 2X86A 3HDHA 1KETA 4MIOA 4PG7A 2HMTA 3H9GA 5EJ2A 3Q6IA 4D0RA 4NG5A 3KHUA 4F3YA 3VPXA 3DMTA 3DFUA 3JD3A 4YJDA 5JYAA 3QWIA 4B7XA 4BMVA 3B20A 3O8QB 4DREA 3OEYA 3UKOA 3WGTA 1TLTA 1HE4A 1EUCA 1A5ZA 1SMKA 5DULA 4GSKA 1NBOA 4TSKA 4ZD6A 3DHNA 2P2SA 1WXDA 3BHIA 5IN4A 3FNHA 4ND3A 2YV3A 3BTSA 1XELA 4UEJA 3CKYA 3ASUA 1Y1PA 5L4NA 1NWCA 3DAPA 4CV0A 4FOSA 4J0FA 2R00A 1FMCA 3HADA 3H5RA 5I7SA 5DBFA 4QFDA 4TZTA 3C3XA 3ROQA 4FC7A 3W8EA 8LDHA 2WD7A 1HLDA 5IFLA 1LBEA 5FF9A 2YHIB 3MTGA 3GUCA 1NQOA 2IYPA 1JLLA 4OOFA 1UXIA 3NTQA 1DIHA 1M67A 1Y8RB 2GD1O 4WUVA 5A05A 1DEHA 2LDBA 3UCXA 4B8ZA 1HDXA 4II2A 1E5QA 1Y9EA 2IYOA 1RM4A 4BNUA 3DBHB 1Z75A 5KNLA 2Z1MA 3DEYX 1PJCA 2O3JA 4CQMA 1UUFA 1W4ZA 1Z73A 3D3WB 5C7OO 4UVIA 2NU9A 3I4FA 1YOVB 4HXYA 3U62A 3MJCA 3IKVA 5TNXA 1DHTA 5IZCA 3FI9A 3JQBA 3JD0A 4JQCA 1CERA 1MP0A 5A5EA 4CV3A 1LUAA 1BW9A 1HZJA 1MA0A 4XB2A 1O8CA 2I76A 4U6SA 2GDZA 4F45A 4FFRA 3NT2A 3ONDA 4FIZA 3X2FA 1H2HA 5KKCA 4AJLA 4A0SA 3U4HA 4IJUA 1Z7EA 4B79A 3AM3A 3UCEA 4J16A 3H7AA 4YQZA 4AICA 3JQCA 3L4BC 3BMCB 5TC4A 5BSGA 1NR7A 5A02A 1PJSA 5A9SB 5MGBA 4RVUA 5JAQA 3T4XA 1UXHA 3PIDA 2GN8A 4BNIA 2PKQO 4OXYA 2NU8A 4RF5A 1WNTA 3NDRA 4BV8A 2A92A 1NFRA 2B5VA 4B3JA 4YVFA 4RVHA 2AMFA 4E30A 2OHXA 2VUSA 3IJPA 1Q7BA 3HHPA 2VT2A 3V2UA 2FY8A 1B7GO 1U2DA 4GX5A 4ZQHA 5AOVA 1Z45A 4H7PA 3FHLA 5KVQA 3ZH2A 2EWMA 4JNKA 4TRMA 4RPJA 3VZPA 1ZK4A 3GDFA 3TSCA 3A9WA 1RPNA 5ICSA 2WM3A 2AG5A 4FDAA 3NTRA 3E1KA 1HE5A 1VJ1A 2X7HA 3HWRA 4FFPA 4MINA 4XRGA 1A4IA 2G0TA 3JQFA 4OHUA 3GHYA 4DIFA 3PYLA 1NPYA 3GQVA 2E6UX 4ND4A 4YTEA 4MIEA 1HSOA 2D0IA 1BDMA 2YHIA 3AUAA 4FFOA 3BZUA 2BHLA 1W0CA 3HDJA 4R51A 1Y8RA 2GN9A 2X4GA 5BR7A 2O2SA 4JK3A 1F0YA 1H9BA 1Y8QB 1LSSA 3DBHA 4RVSA 2NU7A 3S2IA 5IAAA 3AI3A 3DFZA 5JCJA 1LLCA 2GRAA 4WE3A 4HNHA 3BIOA 1W73A 1I01A 2DUWA 4ZA2A 5EINA 1E3EA 1PZEA 2G17A 4I9HA 3D3WA 5TT0A 4YAKA 4CLEA 2ZB7A 5ENDA 5JY1A 1HYGA 4J43A 1YOVA 5COQA 4RGBA 3ZNOA 4BGVA 3ETGA 2X8LA 1UR5A 4NU6A 4ZQFA 1GTMA 4B4UA 1HKUA 4XX0A 3EC7A 3H2SA 2RAFA 4A10A 5JDCA 4NBTA 4WCDA 5HA5A 1ZW1A 3OA0A 3ETEA 3ZU3A 3RUDA 2I3AA 4XQGA 5L53A 4GMFA 3T7EA 2YQ4A 4RPGA 5CG1A 3K30A 1JKIA 3EDMA 2JJYA 2NU6A 1PL8A 2HUNA 4LCEA 4RJTA 1FDVA 5IDWA 1PQPA 2D3TA 2EKLA 1GR0A 3KV3O 3LF1A 5CEFA 4PZDA 1NX6A 4E5PA 3BMCA 1B0AA 2ZYDA 4L9RA 4GQAA 1IPEA 2FPIA 1J4AA 4RORA 3SC4A 4BB6A 5A9SA 1YBVA 1MFPA 4EITA 4XGIA 3BTUA 4ND5A 5KJCA 4YT2A 4J6FA 4TRNA 3WNQA 1BVUA 2B83A 3PJEA 5DOVA 2O50A 1YL7A 1NYTA 3WIEA 3F5SA 1CQJA 1FXSA 1FDWA 4J2HA 4UEKA 4CV2A 5T57A 2H5LA 2RCYA 5L4SA 5JNLA 3ZHBA 3RUIA 2EEZA 2BGMA 4CLDA 2VCYA 4L8VA 5KVSA 4FN4A 4RZIA 5DF1A 1O9BA 4B3HA 3AU8A 1DDOA 2AG8A 3B1KA 1Z74A 2W90A 3GAZA 3NUGA 3LT4A 2NTJA 4P8RA 3AM4A 2WE7A 3U0BA 4PGFA 4MKXA 2QIOA 4B7CA 4DL9A 1UDBA 4LRSB 2UUPA 2XF8A 3OM9A 4DYVA 1PGJA 5JMWA 4LSWA 2BH9A 1SB8A 5CDYA 3PZBA 5A3VA 1QLJA 1ZSNA 4IDFA 4KUEA 4OGWA 4INAA 5JAZA 1YL6A 3C1OA 2NNLD 1LEHA 3D1LA 5G0SA 4XJTA 1Y8QA 4UVGA 1DHRA 4OO3A 2BFPA 3H2ZA 4N7RA 4IJKA 4ND2A 2GN6A 3GOHA 4WKGA 5G0TA 3QVWA 3COSA 3L9XA 4EUEA 3E03A 4EUFA 3PQFA 4C7JA 5BQFA 4BNKA 3BTVA 4J2OA 1TEHA 1U1IA 3JQEA 4P4GA 3K8ZA 4GAEA 1LRLA 1IPFA 3WLEA 3ABIA 1SCUA 2TMGA 2J5KA 1PJ2A 5T64A 4FJ1A 2HDHA 3RI3A 3QWHA 1E3WB 4PVDA 2JFHA 5HWSA 2DFDA 2X23A 3LC2O 1JWBB 3GRKA 1B8PA 2QW8A 5TRTA 4DMMA 3OQ6A 4Z0TA 1GV1A 1AXEA 5AXDA 2ZKLA 5K6AA 1E7MA 1KEVA 1WVGA 3HZZA 5I7VA 4FJ0A 1A9YA 4OM8A 1RKXA 1N9GB 3H65A 3R3JA 4K6CA 4D0SA 3DTTA 3BYZA 1P1KA 2BRUA 3JYLA 4HX5A 2PFGA 4TROA 3GGPA 1QYWA 4IQ0A 1EUDA 1XA0A 2G5CA 5DP1A 3ZU4A 3GH3A 2VZ9A 3P2YA 4Y6PA 3S8MA 4DQVA 1PGPA 2FZWA 1ZXBA 3O4RA 5BNTA 1NPDA 4BGEA 3DR3A 1BHSA 2V6BA 3F6YA 4E0BA 1GCUA 1K3TA 2QX7A 2GYYA 4BKPA 3KSZO 1IOLA 3GN2A 1XDWA 2YDYA 5I7FA 4WNCA 4K1LA 3OJOA 4JXKA 2BKAA 3INRA 3PEFA 4NU5A 5TF4A 4XQ9A 4BKQA 2Q4BA 4BQPA 3OBBA 1KVUA 4WLOA 1M2WA 2EXXA 2QYTA 1P9LA 2JHFA 2BD0A 3GC6A 4NBWA 3QRWA 1KERA 2CMDA 3LT2A 4PG8A 5JYDA 1PS9A 1V0JA 3GNQA 1BRMA 1UAGA 3E8XA 3GAFA 3HN7A 3VKUA 1J0XO 2VHVA 4ZQGA 3GVPA 4BO3A 2VYNA 3AU9A 5J9GA 3KYCB 4L4XA 2B69A 1ONNA 1X13A 3E9QA 3GFBA 4HWKA 3RU7A 3U49A 3HSKA 3GMDA 1K6IA 4CM3A 2RH8A 5ER6A 7MDHA 3OQBA 4YACA 3BAZA 4RDIA 1OOEA 4JBGA 1FDUA 3UAGA 1PL6A 1H6BA 4E4YA 2IZZA 3WXBA 4LW8A 1DIGA 1ZK3A 4GX0A 4IMRA 4J0EA 1X15A 1DIAA 3C7CB 4DXHA 4TWRA 4IDAA 4H15A 3I9KA 4N54A 4XYEA 5LDGA 3CIFA 1AGNA 3DAFA 1H5QA 3B1JA 1E3WA 1LC3A 2DBQA 5JXWA 1EMDA 2ZTUA 5B4UA 3MJTA 4XYGA 2FHSA 3CXRA 2PK3A 3HN2A 4PG4A 5JC1A 3F47A 1A27A 3F1LA 1E6WA 2I65A 1CDOA 5DZSA 3INGA 5I8ZA 4MVJF 2WSBA 4BS9A 5C7LO 5L95A 1BG6A 1N9GA 4W7IA 3WWYA 2RHRA 2NLOA 5TSDA 3HFSA 3W1VA 4IGEA 4L75A 1PS8A 1B3RA 1GZ6A 1N8KA 1ZBQA 2PZMA 4XQEA 2VYVD 1IE3A 3NJ4A 5CAEA 4BO9A 3OEWA 2WE8A 4GPD1 4RPHA 2PZKA 2CD9A 2PNFA 4LN1A 1HLPA 5ITWA 1MLDA 4DVJA 1X0VA 4YAEA 3D5TA 2JD2A 1M75A 4L4SA 3LLSA 2VWHA 4YBZA 3QW2A 2OBNA 2X9VA 1H9AA 3N74A 5CP8A 5I9LA 6LDHA 5JDIA 3SVTA 2HMSA 1J6UA 3JYPA 5L4LA 2EW2A 3I9OA 1P44A 2D4AA 3L9WA 4HY3A 1SBYA 4L74A 3SJUA 3ANLA 3S1LA 1I36A 1F17A 1BMDA 1O0SA 2HU2A 3ON5A 4J4BA 2Z1NA 3NTOA 4R1UA 4WLEA 1JAXA 2BFOA 4KTTE 5JAIA 2D8AA 3UFXA 1WW8A 1CF2O 4LGVA 4ZICA 4IDCA 1ML3A 1A7AA 3KYCA 3K9QO 4NBUA 3WGYA 5A4DA 2CZCA 4NK4A 2HK7A 3I4CA 1R0LA 2NTVA 1U8FO 3OJEA 3U5TA 1EFLA 2HMWA 2W2LD 1D1TA 3LF2A 1DPGA 4IQ8A 2P68A 3GPDG 4WLNA 4CMIB 5CEJA 2DC1A 1P1FA 2X0RA 5T8KC 1E1KA 2YJZA 4MVJI 2X5JO 1X7HA 1P77A 4JBIA 9LDTA 4CMJA 3LK7A 3RAJA 2JKVA 2ZB8A 2X0NA 4AJ2A 1PZFA 2O48X 1ISJA 1HDGO 2QRLA 3ZV5A 3QWFA 3MZ0A 5HTOA 1B3BA 4O59O 1PJBA 3HJAA 4JN6B 3DMTC 4MVJH 3VVCA 3EY4A 5DCUA 1O5IA 1E7WA 2DLDA 5AXCA 1UDCA 1AHHA 2YFHA 2ZCVA 3WDSA 2IXAA 1EVIA 4Q3BA 1JDJA 3S55A 3IDSA 5IDXA 2PV7A 3NRCA 2AE2A 1VSUA 4JP3A 1K89A 3DOJA 2ZJ1A 3HE3A 3MOIA 5IF3A 3EYWA 3PJDA 1PJ4A 4DWVA 1DIRA 4CM4B 3I9NA 1TT7A 3QVOA 5EQFA 1Q7GA 4YCAA 1C0KA 4ZGWA 5EL0A 5A3JA 4ALMA 1C14A 3ADPA 4FBGA 1XLTA 4OKIA 4B4VA 3C1TA 1T2EA 4UEOA 2C7GA 2OZPA 2J3KA 4MP6A 1DIBA 3UUWA 4WEQA 1Y5RA 3GEGA 4FFLA 2I66A 5DBIA 5EESA 2UUOA 2Y1FA 1BXGB 1YB1A 5ILGA 1C1XB 4IDDA 4YWJA 1UJMA 3PGXA 4BNNA 2WJPA 1UAYA 4M1QA 5K0ZA 2VQ3A 4NMHA 3NJ8A 4TVBA 3AOEA 3WYBA 3KYBA 5AVOA 4BO2A 4GI2A 1JA9A 1TXGA 3GN1A 3BHMA 2Y68A 3JQBC 2B4QA 1MC4A 4P4LA 3H9EO 2AE1A 2R2GA 2YZ7A 3WICA 3WQQA 4YB8A 2Q3EA 3ZN2A 3KLPX 3E5RA 4MVJA 5TS3A 4NR0A 1JN0A 4CL3A 2POQX 3BMNB 1NM5A 2ZATA 4J1SA 5FFFA 1D1SA 3DB2A 2Q1SA 5G4KB 4L0QA 2B36A 5DOZA 3DZHA 4QECA 3LC1O 3NT4A 5IJZA 3QIVA 2HQ1A 2ILTA 4NDNE 3Q0EA 5DBGA 4CMIA 2BI7A 5CEEA 1I2BA 2DPGA 4GVXA 2OFPA 1OMOA 2TMDA 4E21A 1MV8A 2IZ1A 3NT5A 1MG0A 1GU7A 2DTEA 2JCYA 5BNIA 4D7AA 4IJWA 4NK5A 4RCVA 1T25A 1YDEA 5IN5A 4AJHA 3OP4A 3RUAA 3BXXA 4RVGA 4YPOA 5I8WA 4JX8A 1X7DA 4J9UE 1ENPA 2GLXA 2EJVA 5GY7A 1DRUA 4MVJP 2VNSA 1EE2A 1UXJA 1TT5B 4O6VA 1JQBA 2J3HA 2VYVA 4R01A 1VM6A 1MC5A 4Y98A 3DXFA 1NVMB 5L7TA 1KEPA 4J91A 1W8DA 3E48A 4ITUA 3H6KA 4W9NC 3ZNQA 3BMQB 2WYVA 2GASA 4Z3DA 4YA6A 3IUSA 1OC4A 1T1SA 1NVTA 1GPJA 2YUTA 2HRZA 4CM4A 5BSFA 4NIMA 3QY9A 4XYMA 5COBA 4PLHA 4D45A 1M6HA 4WOJA 4I8XA 3JQFC 2AEJA 4UUNA 2VHZA 4YJGB 4Z9XA 3IUPA 4CR6A 5L7WA 1VC2A 4O5OA 1PR3A 3ZNNA 3L6EA 1JKFA 2UDPA 2G82A 1UXGA 2IDZA 1XU9A 3DL2A 2DPHA 4EJMA 1KVQA 1GADO 2A94A 1LA2A 4EUHA 4OQZA 1WDMA 1BXGA 5F21A 3ZU5A 3GPIA 3WMXA 4B4WA 1C1XA 5I7EA 2X22A 1BSVA 3JQGB 3QV1A 5FWNA 3D0OA 1LDGA 1ZK0A 1PR9A 1H2BA 1NR1A 4PLFA 2W2LA 2ZB3A 1SC6A 4P38A 1EK5A 3ICPA 4CUKA 1N7HA 3WTCA 4U8GA 3AFMA 1ISFA 1K2WA 3OETA 1ULUA 4N5LA 4YRBA 2NVWA 4JIGA 4JP2A 1HYHA 1WAMA 3BMNA 3JQ9A 3RWBA 2ZQZA 3TN7A 1Y9AA 1B15A 4G65A 1KVSA 2QRKA 2Z5LA 1ZXLA 4JJFA 1L7EA 1XIVA 3H8VA 5G4KA 3ITDA 5DNAA 1R0KA 3PJFA 4CMCA 4RV9A 5GMOA 3F9IA 2AEFA 1P1JA 1G6KA 2AEMA 3VZQA 1LU9A 2JFGA 4PLVA 5DCWA 1D3AA 5IDYA 2AA3A 4GL4A 3D5QA 4I5DA 1EBUA 4Y8VA 3TL2A 2UV8A 3K2EA 3QA9A 3VZSA 3O38A 4TQGA 4NBVA 1GPDG 1Y81A 5HM8A 1IY8A 4XGKA 3OFSA 3VH3A 3Q2IA 4ALKA 4R9RA 2XOXA 1CETA 3RC7A 4TRJA 3D3EA 4E3ZA 1R37A 4QTZA 3RVDA 5MDHA 1WMAA 1TT5A 3H3JA 5AXBA 3GZ4A 3M2PA 4CLRA 4IM7A 3H9JA 1ZVMA 5C5IA 1GUZA 4UREA 1Q2XA 5ES3A 4OXNA 3BMQA 5JO9A 1GQQA 2PZJA 5AYVA 4YT5A 2YV2A 1LRJA 4CMKA 3D4PA 3WJ7A 4ESOA 3PZRA 3Q9UA 1WPQA 3CPSA 4R4JA 5F1PA 2FN7A 4J7XA 1UH5A 3GG9A 4PVCA 2W8ZA 4BL5A 4FJ2A 2X5KO 1E3LA 4YJGA 2D59A 3WQSB 3RUHA 3UH1A 3VH1A 1LDYA 4DBVO 5KWEA 3ZWBA 1O6ZA 1QKIA 1ARZA 2C54A 5GZ6A 3PRJA 3QHAA 4I5FA 1GV0A 4Q3NA 3KSDO 5BSHA 3IQDB 3WGIA 4R1SA 4Y9DA 4R54A 4NZ9A 2FOIA 3AM5A 4BKOA 2BELA 4FGSA 3JQGA 4IINA 1YDWA 3BTOA 1D8AA 1E7RA 4XIYA 2OMEA 3I6QA 2Q2QA 2B4TO 4RLHA 4OOEA 4IGFA 3TRIA 4CMAA 3F5QA 2J8ZA 5BSEA 3K2BA 2V65A 4I5EA 1VE9A 5JCXA 1SEVA 1NFFA 2C5AA 3LDHA 1BXZA 2Y66A 1I3NA 3UGKA 4PFJA 5HBRA 1AE1A 1R66A 5AQ1A 5JC8A 5L45A 1E7YA 1SO8A 3GF4A 1IUKA 4GGOA 4BKUA 4E2XA 1VKNA 4B8WA 3PHGA 2VRBA 3NGLA 3P5SA 1YE3A 3G1UA 2O3RA 4CL8A 4ALNA 4O0LA 3RUCA 2HJRA 4ND1A 2VYND 4XYBA 3WS7A 1QMGA 3MWEB 5U4QA 3PWSA 3ST7A 4IDGA 3ULKA 3T4EA 2CVZA 3WIDA 1ADCA 1GQYA 4W7HA 1PQWA 5EMHA 2GZ3A 1GYRA 1AN9A 1HDRA 5LDHA 4WCFB 2VT3A 4CJXA 3JCZA 2CVOA 4XR4A 2V7PA 3U3XA 2WTBA 2VOEA 4IIUA 3RKRA 2P4HX 1PGOA 1VSVA 1NXQA 3QLJA 3JTMA 4RPLA 2PD6A 4BNHA 1EDZA 1DC5A 3E9NA 4RVFA 1B2LA 3V1UA 4GMGA 3JD1A 3F3SA 4RDHA 1PSDA 1E6EA 4R16A 3PPIA 1NAIA 4IS2A 3VH2A 4PLZA 4AJPA 3VTZA 4DTIA 3CH6A 3M6IA 3IL2A 2CY0A 4WNIA 3ICCA 3E18A 5H81A 4CLXA 3AJRA 2IODA 3DZJA 5KJFA 3PYMA 3JQAD 5CPBA 3ZWAA 3FR7A 2Q4EA 2O4CA 1I5RA 4YDRA 4ALJA 4LRTB 3WQRA 2NQ8A 1PIWA 4NNJA 1GDHA 2V6MA 2X0IA 4GX2A 1BWSA 1LX6A 3L07A 3RFTA 4WK6A 4PLTA 4CLHA 3L6OO 1E0DA 4BB5A 4BVAA 2VTDA 4D3FA 1LQUA 2FP4A 2Y0DA 2C20A 3PWZA 2Y67A 3E5MA 1PU2A 5B12A 1EFKA 4O1MA 4NHEA 1IL0A 2I99A 1EDOA 1LQTA 2PH3A 1R6DA 3K5PA 1L1FA 3RKUA 4MP3A 5TGDA 4BOYA 2JD1A 3LYLA 2DKNA 4G81A 4BNXA 2VWPA 4DA9A 4F46A 1WZIA 3V2GA 1H93A 3DHYA 2VUTA 3L4BA 5C37A 1PS0A 1DC6A 1GEEA 4RVDA 1RM5A 3H4VA 4MVJG 1PEDA 2EG9A 1QYVA 3JD4A 3OJLA 2Y0EA 4XZ3A 4K6FA 4AJOA 4PRLA 3WLFA 3GFGA 1JKJA 1H6DA 4EEZA 2WYUA 4CR8A 1X7GA 2CNBA 1XKQA 4UVEA 3DMYA 1LSJA 3FPCA 4DIOA 3WX0A 2HSDA 3TFOA 1ENYA 1I2ZA 4ILKA 3ASVA 5JFOA 2V6FA 5B37A 3IAHA 4BMSA 3E6AA 4HV4A 1P3DA 4BQRA 2I6TA 3DQPA 2GSDA 3EVTA 1RM0A 1KC1A 3ZWPA 3VH4A 4WCFA 2ZTVA 3V1YA 3AY7A 2AHRA 4FCCA 1PGQA 1UZMA 3KEOA 5GZ3A 4BO1A 3HNPA 1Z7BA 3E9MA 1SEPA 3FR8A 3OJFA 4CUJA 1UZLA 2LDXA 2OUIA 3ZWYA 1LJ8A 3Q1LA 5ER9A 1W6UA 2A9FA 4CMBA 4QEDA 1VKOA 3QWAA 5CDGA 2BI8A 4H3VA 4CUZA 3B6ZA 1R4NB 3JQAB 4XRRA 3DBRB 1DC4A 2HRBA 3GNSA 3ONFA 3ZDFA 4TZKA 1F06A 4EEXA 4IIVA 3K6JA 3F4BA 3KXDA 4EJ6A 5JBIA 3JQ7B 5G0VA 2YFQA 4H16A 4CM7A 3WB9A 3PHHA 1I3MA 4YQYA 3AI1A 4C7KA 2O3SA 2B35A 4MOWA 4QO8A 2GPTA 3NKLA 2CFCA 1T1RA 1NNUA 3NEPX 1J5PA 4WEOA 3TOZA 2HKIA 2H6EA 1PWXA 1EEHA 3UOGA 1XHLA 3WG9A 1ZZEA 3HDQA 3QWBA 4HFJA 2IE0A 3STHA 4KP7A 4EDFA 1QLHA 3RBXA 1GQ2A
chains in the Genus database with same CATH superfamily
4D6YA 1BS9A 2Z2KA 3B5EA 2EJWA 1FY2A 4QU0A 4YN3A 4YAGA 3LUAA 4NU0A 1BIFA 2PD3A 5AK3A 4Z4HA 2OT3B 3OF5A 1FF9A 4BVBA 3OD1A 1W44A 4FMDB 2I5PO 2P3LA 4BUZA 2HF2A 1U8YA 3LKBA 5CDSA 3T3HA 1P9WA 3EMVA 4AC9A 4C07A 4Y0NA 5C5DA 2IH4A 4G1BA 3MWDB 3OPVA 2BDTA 3RVSA 5K0SA 1YJXA 1XU7A 3T7CA 2A5DA 4D4LA 2CL0X 1BMQA 1TCBA 3LIIA 4DBLE 4KAJA 1XKTA 2BMDA 3GJ8A 3NC1C 2GAOA 2J0EA 2PXXA 2OWEA 2ZB4A 2F2TA 5AJXA 2QVYX 3L02A 3LFUA 4HYQA 1STOA 2FMIA 3E2IA 5AVRA 2UZAA 5CK5A 3IMKA 3T9DA 4LC0A 1U0JA 2HZBA 2WUDA 2DY1A 3GY0A 3M9LA 4HADA 1U8EA 4DLNA 2FN9A 1ZICA 2Z8YM 4MVJD 1QTIA 4JLAA 2X7JA 1JIXA 3M83A 2VDWA 3LDGA 3NBXX 4GX1A 1MQ9A 2GNAA 5F73A 4D9GA 3DDNA 1RJWA 3LBHA 2HJGA 1PF7E 1N2OA 3LBYA 5A6SA 3NXKA 2A5LA 3QMVA 4LYFA 4LYAA 1I30A 1PJTA 3ZQKA 1DKOA 3A4LA 1ATIA 3DTVB 3EPPA 1KJQA 1IULA 4FLFA 4X7MA 4GRDA 2JLWA 1A9QA 5HVNA 3RW9A 2H52A 1YS1X 4KKXB 2VHCA 4WY8A 4FT4A 1UKVY 4Y2PA 2E9SA 1NUPA 2XNHA 4Y2UA 3ZCTA 5CG2A 2VHJA 5BQPA 3SJCA 5BR4A 2YYZA 2HFKA 4NZPA 2WVJA 5B1EA 2OOSA 3ORRA 2ATCA 4MVJM 4KO4S 4MYTA 3BWDD 2DH6A 3M9XA 4N12A 2O2YA 4YRPA 3GMIA 5LB2A 4KFSA 4DUYB 3DBRA 3DOFA 3F6SA 1P4JA 2VP4A 4ARZB 3N0VA 4RCYA 1MNQA 5F76A 1NFQA 2GFHA 2WMDA 4ROTA 2IKQA 4EFMA 1U7TA 3DAHA 3JQ7A 2CXUA 3ETCA 2QZ4A 2QJWA 1ONPA 2ZRQA 3QK7A 4QVGA 2VPPA 4WKNA 1CLUA 5E6UB 4HFNA 5A7HA 4B87A 1DWOA 5FUXA 2RSLA 3IH5A 1JYEA 4IXDA 4HEJA 5CBKA 2ZWAA 1V16A 3LKZA 4GO1A 4ZIRB 1RHMA 1BDHA 4AJNA 2P67A 3HJGA 2RHCA 2VJOA 3KUKA 1VMEA 2EV9A 2PL9A 3TLJA 2ZTLA 1DAOA 1LPOA 2VJBA 3HB4X 5DV9A 5TIIA 1W88A 3QTLA 2PH1A 4UMEA 5ESDA 2ZUBA 1U7WA 2AOVA 3B2NA 3QE2A 3R5JA 4N1AA 1LD3A 3A3OA 4MPPA 3RYCB 4R41A 1F8UA 5EJ8A 3NHZA 2AXQA 2WW8A 1NVVR 4O3FA 3WKCA 1QX4A 2QL7A 4KBGA 1BGXT 2PUWA 3GRRA 1AKVA 3CC8A 1RTTA 1IXSB 1HZZC 1ZPDA 3NKVA 4BO0A 4R2KA 1NF8A 4DUGD 3Q2OA 4U7GA 5J3JA 3QU2A 3IRVA 4OIMA 5JSZB 3RCBA 4J3FA 5EYPA 1CEQA 3AF1A 1OASA 4J49A 4XGNA 3SAJA 3WADA 4DLXA 4AKIA 3GEDA 4P7BA 4Q9NA 3OMLA 4IP0A 3OPYB 3REOA 1MU0A 4TRRA 4CKCA 2DR3A 2JFNA 4LV8B 4RQTA 3RBZA 1Y9ZA 4FDLA 4GVLA 3CUWA 1KU0A 4IEEA 3WZMA 5EE1A 4OTZA 1WV1A 4D8XA 5J4VA 3I9V6 4R8VA 1RWOA 4HDSA 1OI7A 2N1MA 3ZLJA 4CKYA 5EEGA 4DG5A 2VXYA 4FS3A 4TTRA 3NH9A 4R8RA 1B14A 2RBKA 5LL6P 2FPWA 5JASA 1Z7YA 3RC9A 1PLLA 1TUBB 1FDTA 3K96A 4A6XA 2CJWB 3Q5EA 2XPCA 4JLVA 5ADWA 2IOFK 1CR4A 1F8YA 3GNLA 3RSOA 3OESA 4AS2A 4UFPA 5EIXA 2PWZA 4KLNA 3PX7A 1W29A 4B6PA 2IW3A 1DARA 1XCPA 3PEEA 1U7DA 4YCSA 2BI4A 3JYQA 1P7PA 3D81A 3NV9A 5H9VA 4Q39A 3SN6A 1C7JA 1T8SA 3FOCA 1PK9A 4BU1A 5KQLA 3FCEA 3KZCA 4BVGA 4CTOA 1DBQA 4PYIA 2IHBA 3C16C 2X2FA 2RGAA 4MI9A 1DFIA 4N5MA 3EF1A 1X74A 3LO8A 4HNSA 4HAZA 4XR9A 2K7FA 2QUBA 2R84A 4GXQA 1AMUA 3RHFA 2DWQA 1F0PA 3ESAA 1XVLA 4MUHA 3FA2A 1P0CA 5CCXA 3WLJA 4F6RA 1SIUA 3GLQA 1RACA 1DJPA 2HSZA 2YJTD 4X54A 2OBFA 1ISMA 1D1QA 3PT5A 3WGGA 4DILA 2QTMA 3ZY2A 1RYYA 3IERA 3WB2A 1F9AA 1XEAA 1QX3A 3NR2A 5J1TB 4ZDKA 1WCWA 1HG0A 1Z0DA 4WZZA 5GGYA 4LVOA 3UK2A 1NBIA 3GFOA 2C42A 4H59A 1FK8A 5JCOA 2VP2A 3WC4A 1TL7C 5K9ZA 4XWYA 3IILA 3B9QA 4DIUA 4WJLA 1DGQA 721PA 3C6BA 2C4NA 2PDAA 4LOIA 1CT9A 5FT9A 2VK8A 3MILA 4GWLA 3HRIA 4EECA 3ZV6A 1R1DA 5EXSA 3RWMB 1JQ3A 1T91A 2GBGA 5DTJA 1S8NA 3HL0A 1PWZA 3GRPA 2Z04A 2GRJA 1NF2A 3DONA 3G5MA 3TLEA 4ZVQA 3ROPA 1J2YA 1Q1NA 5CFOA 1GQRA 2Y1DA 3RH0A 2BFFA 1B74A 1PN3A 3ECCA 5HZMA 1DXHA 4BAUA 2GVNA 2IPOA 3DE4X 3G9QA 1JV2B 1O95A 4JSTA 4KWTA 4NBSA 4RGYA 5MFZA 3MTAA 1YBMA 2COUA 2Q1TA 3AJ9A 2VK2A 3WLLA 2VXOA 1I8TA 1XTIA 2FWNA 2OFXA 4GWKA 5FA8A 2VTKA 2AG1A 3L4JA 1TTQB 2Q1UA 2NTYC 1ODCA 4ZOAA 4LRYA 2VF8A 1DBVO 1CQIA 4EKEA 3RYCA 2H3EA 5IFKA 4ZYTA 1VJ5A 5JVDA 1F8GA 3W5SA 2CXSA 2XTNA 5IZCC 3COJA 5EMNA 4IUYA 1YQGA 3UCFA 2JRLA 3IXLA 3FCSB 1EDDA 1EGHA 3OIGA 4PSCA 1JPVA 2NUBA 3QF4A 1MGOA 1YOBA 4NPCA 5CFNA 3QH4A 2AK3A 4JSRA 3O3CA 1JFVA 1JDBC 5C18A 1YRBA 3IP1A 4IZIA 4BNZA 2ACVA 3GDOA 3ZWVA 4DJEC 2GCOB 1RMQA 4OVKA 4KSCA 1QXSA 4MQMA 3I73A 1EIWA 5JANA 1JB9A 1ULSA 1GNLA 1RQ7A 1HRDA 4TVOA 3WFIA 1OHHA 3LDUA 4LJ5A 2C3UA 5BN5B 4L4YA 3UV6A 4C06A 1XZIA 2C4MA 4LPKA 4N39A 3LQFA 1L1EA 1I7MB 4Y1EA 3T1YB 2QW0X 1II8A 1Z8DA 4J16C 5FI3A 1Y1LA 4OLBA 4P86A 5FHQA 5IKEA 3P2OA 4YP1A 3SX2A 1EQUA 4D97A 1BTOA 5ESRA 3THOA 2YOFA 3B2QA 3FVTA 3PNMA 4P31A 5E95A 1EHCA 2YVLA 2ZRFA 4PYLA 2J9FB 1VSQA 3K72B 13PKA 2DPXA 1PG2A 4M8SA 3QNWA 5K3SA 2OKCA 3R8XA 3I6MA 3T15A 3L6RA 1XZFA 2BLNA 3MUOA 4XQCA 3TSAA 2Z6AA 2IEYA 4F4HA 4R0NA 1QSGA 4GUAA 4LCBA 2WDZA 4HQLA 4P4UA 1G291 4WD3A 4B3CA 1UKEA 1CG6A 3I9MA 3KO8A 4B45A 1JDUA 2P2CA 4EKNB 1JL3A 4Q7LA 4W82A 4CLRB 3GLGE 5KMGB 2N9UA 5BUZA 2QROA 2IHZA 3QBVA 1YGPA 3T38A 1DXYA 1PUIA 6GPBA 2R44A 4XB1A 2ZTSA 1W7AA 1KY5A 1I0ZA 2A1TR 1UDRA 2GLTA 1P8JA 1IZ0A 2AOUB 1XQ6A 2J33A 2I2CA 3H13A 3K1YA 1EB8A 4RWEA 5EJIA 4FD2A 3DNMA 3ILYA 4HWPA 4TV8A 1GTVA 4MUMA 4G36A 1Z0KA 3FMVA 4DLUA 1NTRA 2GNPA 2B0CA 2VJNA 1NQAO 1XL0A 4LSMA 2CVPA 3DDHA 4BATA 5BWCA 1U9YA 1XCBA 3OEEA 4WT7A 1DC3A 2RJNA 3JRXA 3KFXA 4I4TA 4O2AA 3ZQ6A 3IQGX 5FBVB 2ZSHA 1CQZA 2HA2A 5CX1B 1TJYA 5EHGA 4EG3A 4UU8A 1CVIA 1KKLA 4UCXA 4BNGA 3K09A 1U6IA 4KQHA 3X3HA 1NYRA 1WLSA 3K9WA 4ZO9A 4MUXA 2D5IA 1TPZA 3Q3HA 1NNLA 1NZJA 7ADHA 2EP5A 4HH0A 2X4LA 2D3WA 1IBLB 1NDQA 4O1IA 5HKKD 1A9ZA 4BZWA 3KQYA 4B82A 4QBFA 3PUJA 2EVWX 3NHRA 4IIJB 2EYQA 2PVSA 5DIFA 5KPDA 2QE7A 5L7YA 2WU4A 1QORA 4Y6RA 2RGCA 1ZD5A 2W71A 1SUDA 2AX3A 4INJA 4UE2A 5AW8A 5JNRA 1L3CA 4RA6A 4B34A 1TVMA 3P2MA 4P83A 3BE6A 3TIVA 1UP6A 2Z4SA 1GZ5A 1WSAA 1CU1A 1SHKA 4NXMB 4XCVA 3ERCA 1WMFA 2M6SA 1LNSA 2BZGA 1TE2A 5HF8A 1V1JA 1DLJA 2G0AA 2WVAA 2Z8XA 2ZUWA 5IC5A 2QORA 3A7DA 3LQ2A 3OQIA 4IDNA 1YZQA 4F3CA 2V6IA 4KLAA 4YI5A 1U9CA 3SU8A 1V3TA 1QOZA 2V59A 2OXIA 3T95A 2B20A 2FRXA 2WAYA 1E2FA 3QVTA 1ZMTA 3P26A 2IHJA 4NONA 4IFBA 3TOCA 3TZKA 2HRRA 2W83A 1BVRA 3UK7A 3HKDB 1A5SB 4G5HA 2GR9A 3ODPA 1BE1A 1ODSA 4HC4A 4QYTA 4S12A 2WSSA 4JC5A 3U7HB 4M1OA 4BIIA 2WWIA 3QVGB 4DR3B 1H9CA 4IYRA 5K1ZA 2IYXA 3F3MA 4O29A 2ZAGA 2PRYA 1UQTA 5BNWA 1GKUB 1HV8A 1Q0HA 3COWA 1SVUA 2B61A 3GCWA 1HF3A 2OYCA 5TMEA 4C89A 5E3JA 1JTVA 1NW5A 1ECLA 3UWKA 4ZU3A 5THXA 5DGDA 2E4AA 1SBIA 1I6WA 4GLBA 3ZGYA 2VSFA 4I1RA 1XRRA 3W8DA 4HGOA 4P08A 3VTFA 5A2QA 4ZT4A 2P9CA 3I72A 5HNKA 2PX2A 3OECA 4CDMA 4E13A 2NVBA 2IXTA 3N2IA 4C7OA 4MV0A 4FR2A 4QUGA 3NETA 3RJ5A 1DEOA 4F86A 3L5OA 1O1YA 3GK3A 3TLAA 3BE8A 4CZ2A 4BQEA 4DLTA 4NZZA 4ZV7A 2ZULA 2FSUA 1USWA 1YVRA 1VBMA 3GUYA 4PCUA 3G1TA 1FVHA 1IHOA 1UZUA 4YECA 3K1AB 1XFAA 4NBRA 3V3KA 2O14A 2XJ4A 5FLEX 3S2YA 1FYEA 5AVWA 4GLFA 3DTNA 4J0GA 1HA3A 1G6Q1 1UBSB 1P91A 1C9MA 1KY4A 4GPAA 3AFGA 2W11A 4S0ZA 1MV5A 1IDOA 2WLTA 3WWZA 1K7EB 3IIEA 2BM1A 2P5UA 4LY3A 4U39A 1ONSA 3B1VA 1YZNA 3ORYA 2HU8A 1QYCA 4IIXA 2JZNA 5AI4A 5F2KA 3S2SA 5T6BA 5JSQA 1QH8B 1WVIA 1XYYA 4PZAA 4RD1A 1AZSC 4HWSA 1EP3B 4GKJB 3I2HA 1PQYA 3IPXA 5FBZA 1OXBB 1XBTA 3QOXA 4A27A 2HLPA 2OB1A 4KVGA 3DMPA 4NFYA 1GGHA 1ESNA 3IEUA 3WGQA 4EUKA 1KEZA 3REQB 1NV9A 1I2CA 5AW0A 3KQNA 4HFMA 1JEQB 4ACBA 3P0IA 3CBGA 1XUOA 2PJUA 4JXXA 5AK0A 2H1RA 4NS1A 1VI5A 3DZGA 4M1WA 5J23A 4YJ3B 2XMRA 3HJRA 1T2FA 3K15A 3FCXA 1Q83A 4JI0B 2WOOA 2LW7A 1W25A 2VP3A 4UXHA 1EP2B 1L0BA 4YP6A 1K6JA 1JIIA 3IPCA 4KX5A 1M2OA 1CP2A 3VU9A 4IG9A 1FLAA 1XEXB 4EM6A 4KMSA 2RKOA 3TRHA 4MPDA 3EPBB 2JCXA 4QUIA 5K3OA 1IEVA 2JLAA 4W9NA 4EA8A 3DE3X 1OFIA 4KQKA 2WABA 3U3OA 1BQEA 3FYCA 1JEYA 2YYYA 4NX2A 3T3PB 2XYVA 1N33B 1VPDA 2X0FA 4D44A 1P1HA 2B25A 3FTCA 1JVBA 4A82A 2NTEA 2PEZA 3P5BA 4TV9A 1OYOA 2UUCB 1N1GA 2E0IA 5IBPA 2CN1A 4YAWA 4CBVA 3DNPA 4EW3A 1X7WB 4QX6A 3ZTWA 1SG6A 4N65A 4C14A 1XHFA 1V8DA 3PFHA 1Z5OA 1CS4C 2QZ9A 3W06A 4C0HA 3ODGA 3RBVA 4H6PA 2GAFA 1YVPA 3QVVA 4IMJB 2I7CA 3AV0B 2CVQA 1K5HA 3K4QA 4HWGA 5LYJF 3R3YA 4FKBA 2DUNA 5FR1A 1QF7A 3IR6A 4Q9HA 2C5EA 1GNQA 1XTTA 3B89A 2QG9A 4X8LA 4ZRMA 3SYRA 3ZCVA 5IWAB 1KFBB 4ILEA 4P80A 1H0KA 1KI8A 2G67A 3IUQA 4QLAA 5AW7A 1SKMA 4MRNA 1QFMA 1ZNXA 3KHKA 3T1HB 4KUGA 4RESA 2V7QA 3VAAA 1ND5A 1CWUA 3VSBA 4RSHA 5G41A 4CM9A 2AFHE 4RY9A 5KTOA 2DQ4A 4DPKA 3ZCXA 4KQMA 4DC1A 2CC2A 3MQ4A 5F78A 3EFOA 1ZMXA 4V0RA 4MRSA 1W4CA 4GKBA 1NY6A 3A58B 3EGXB 1YC5A 4TWAA 1F4PA 1YRHA 1FFYA 1XQ1A 1Z3CA 4GBED 3OFVA 5K0CA 4B3XA 1T4DA 1IWBB 2FF5A 3A0UA 4L5CA 2Z5GA 5CT8A 5AI5A 1A4UA 1MG5A 2ECPA 2FPSA 1FA9A 2ARKA 4P5DA 2P9JA 1POXA 3R09A 4IY1A 4PLYA 3WWOA 1ODFA 2ETXA 3SOPA 5LOVA 4X24A 1I5EA 4RD4A 4XOUA 3VDRA 2OHVA 3STXA 2F7SA 5JROA 5IWCA 3OCCA 1A8HA 3O26A 4U63A 4DYHA 3I6BA 4UUAA 1UP4A 1YJQA 2AQKA 5G2OA 1XAIA 1NBMA 4YRDA 5ELXA 2WTXA 3QUCA 3UAXA 1EPUA 1R3UA 2XDQA 5L9AA 5M04A 1FU8A 3CLRC 4QEKA 1CUEA 2Z5VA 4G1UC 3T8YA 3FFXA 4R1TA 2P4QA 1DLIA 4M37A 1NBWB 1LDBA 2QVLA 4C6SA 2BFWA 2J45A 4HAYA 3J81k 4QPJC 3L0BA 4TTPA 2X4IA 4PWYA 3NDIA 5FQOA 3LD9A 2Q6LA 2I62A 2WIJA 4BLPA 1VMIA 3AHDA 4YJFB 4KEAA 3AEQB 5JMOA 1PKEA 3ZGVA 4F1JA 1PJLA 5I7OA 1C0LA 3BH0A 3DV0A 4KIGA 5AUQA 5J47A 5JAMA 1ES9A 3THRA 3G13A 4P3YA 4RD3A 1I6LA 3H3FA 2JBAA 2G63A 1LGYA 2RDMA 4MMXB 4MV3A 2XTJA 1TTPB 3QITA 5IKXA 3VJLA 1QV7A 2XTZA 2CF6A 3HA5A 1GAEO 1MOSA 1ZUIA 5A5FA 4I50A 4RF3A 4BN4A 2X9GA 2Q0HA 1JIJA 3P52A 2OAGA 1WABA 2UXDB 4A4DA 3JALB 2P5YA 2EWWA 2J6IA 2C7VA 3MPOA 2PIAA 1IATA 2PJZA 4K6OA 3SYLA 3UMVA 3GT7A 3MCTA 3NTXA 1ENOA 3K6RA 3W4IA 3EQ2A 4MRAA 2C03A 4OHRA 3D8HA 1HDYA 3A1NA 4P0TA 1U3WA 3A1WA 3E3MA 4L8WB 3SZLA 3WYNA 3KB2A 1IVYA 1IUNA 3TTSA 2YWJA 3C3DA 5LD2C 5EC8A 4CM8A 2ILVA 2HT6A 3ICWA 3NUQA 2VP5A 1FTWA 1UWVA 1L4KA 4UATA 5AM1A 1N9KA 1ZVKA 2IIBA 3KJNA 3ZU2A 1HEUA 5AKJA 1P33A 4F3NA 3PC4A 4ARVA 1Q0LA 4M9XA 4ESHA 1SOWA 1V9LA 3ESRA 1X0XA 3B7WA 3ZWXA 2IH5A 2ZPAA 4M86A 1OLOA 4KFCA 4DM4A 5DNDA 1AQJA 2VTVA 4QO7A 5ADHA 1C0PA 1NUHA 2D6FA 1PG5A 5AUOB 4HQ0A 4NCHA 4GNRA 4L22A 4EPWA 1MOZA 1SVIA 2CFSA 3I34X 3UG6A 3C5WP 1NUSA 3G9UA 5HIMA 5IJ9B 1OX5A 4PBTA 2I6SA 2PY6A 2Y76A 3NEYA 1FDSA 2EGUA 2WP8J 1ZUD1 3CR7A 3QNMA 1V4VA 3BSFA 2CXHA 3DBLA 4BLTA 1XEFA 4GECA 1HOXA 8ADHA 5IKPA 3PD0A 4DJFC 1A82A 2CUKA 2GCGA 3PKIA 1W93A 1MOQA 2FR8A 5HHTA 1JH8A 1V16B 3R77A 4Q4AA 1ETHA 4TXHA 1U9JA 2AZMA 5KNBA 3EPHA 3K70B 4Q7JB 3N1UA 1QCDA 1R6AA 3D8BA 4FQ8A 4A92A 1Z5WA 2QK4A 1G2OA 1PZNA 1YI0A 2JC3A 3ZY4A 1A9XA 5KBYA 3VA7A 5KVVA 1IYZA 1FU4A 3V7UA 5B3AA 4CI9A 4JZYA 4HUQA 4KPUB 1G20B 4MGZR 5LR6A 4ND8B 2GNOA 3NIDB 2ODPA 1KYIA 1KDRA 1GAJA 1JR3E 3ZI7A 1U1EA 3RHSA 2G72A 4FW8A 3UJPA 16PKA 2HQRA 4G4JA 2BMAA 1XVVA 1I0IA 2HTFA 4ZDWA 1U81A 4ID9A 2UYGA 3HCWA 2JIRA 5AHOA 4NXNB 4DNFA 3VHXB 1YRLA 3IKTA 1NQ5A 2IEIA 4R2IA 3SHOA 1HDCA 1JW9B 2JL1A 1E63A 2JW5A 1Y5MA 5T41A 1Z15A 4L0CA 4EA6A 4ZT3A 4PEVA 2ZSIA 4E88A 5JFGA 5M7EA 4MWTA 4MIYA 3HLTA 5BSTA 2OFFA 1CIVA 1VHQA 2V6JA 2O0KA 1QIFA 2LWIA 4C87A 4F97A 2FFAA 4B6GA 1Y5NA 4YEDA 2IQIA 5FL7A 3OOJA 5F7XA 5ECGC 5IVKA 1AQ6A 5JU6A 1J24A 1EE9A 1EM6A 2H08A 1J06A 3O2QB 3T52A 2UZ0A 3OX4A 2ZXEA 1EQAA 4NH4A 3ZQ4A 5K8IA 2P9TA 3KYIB 2A88A 2VWQA 1GPUA 3MBKA 4KYUA 1ZLXA 4EJFA 2WJHA 1G21E 3SM3A 4UE6A 2GJAA 2H16A 2QTHA 2EGHA 2IXGA 4DLAA 3UXYA 1ZOSA 1JTFA 4EIWA 3PLAE 5JWRA 3HJUA 3IBFA 3I83A 3SDSA 1BGVA 2QPTA 3L4SO 2VZ0A 1BGWA 4NE9A 3WFJA 3TTYA 4ZEWA 4ME6A 4PNZA 1G8JA 4LV5B 3UEOA 4B2PA 2PQ0A 4KH0A 1X7YA 4UE3S 2PS3A 2ZE5A 5ARDA 5B36A 2X41A 4GMXA 1NW9B 4PC3A 1UBNA 1WCXA 4ARAA 4HN2A 5EZYF 4HZIA 1UWCA 2D74A 3GZNA 4O2RA 4L7QA 1U7PA 4CCSA 1NUQA 1WZNA 4I9NA 4NMXB 5F7OA 3GVIA 1FJHA 1T0IA 3PXXA 1L4HA 2A3NA 3A6GA 3Q11A 4C3UA 3OZIA 1C3VA 4E5NA 1OVMA 4P7JA 3R23A 7MHTA 3CZRA 3EZ7A 2IV7A 4YAJA 3Q3EA 1PNRA 1YZFA 4HKTA 1Y4SA 5JSFA 3NHKA 3OIFA 1S2NA 2TYSB 1H66A 3RU9A 3SJBA 3UXHA 4C6HA 1RMTA 4D9BA 3E8SA 5KHAA 2CYCA 3VI4B 5IM4F 2VDLB 1XCMA 3MTQA 1PVVA 1OTHA 2QYSA 4KLCA 1NI3A 5KKAA 1W4AA 2LCFA 2E5FA 3V3TA 1JBEA 4JBHA 1EU1A 3GBSA 1ESZA 4QXAA 2C82A 4JU9A 1EVJA 4E6EA 3A2KA 2AN5A 2XA2A 2A6PA 4W5WA 5BT8A 4XYLA 1BJRE 1LW6E 2MYNA 3WSVA 5HIJA 2W9XA 1BDBA 1UT8A 1QDUA 1V8FA 1IQRA 2H29A 1A2OA 2H0RA 1QGOA 5KTRA 2O0MA 4M8KA 3Q41A 4KOAA 1I33A 3EZYA 4HR7A 5K0TA 3KLOA 2HIGA 3HYCA 3PUZA 5ILQA 2DWCA 1QMHA 2GN4A 1DC7A 1YONA 2QPOA 4EPYA 2E5WA 4MO2A 4V38A 4XSVA 3HDYA 1JHZA 4CEIA 3PP8A 3R2JA 1AV7A 4J1QA 1UK7A 4MW4A 5AUNB 3NAQA 5JALA 2G1UA 5FNVB 4R6XA 3GJRA 1EFRA 1OBFO 3FSEA 3X2EA 5LQNA 2XT0A 4OKNA 4KYIB 1Y7LA 1ZEMA 3ZE0B 1A8UA 4Q66C 1TAQA 3VV2A 4I19A 3ZDZB 4EARA 3V2IA 5BUCA 4PLPA 1S02A 2LNDA 3M4JA 5B6IA 4JVNA 2QTCA 1Z4KA 1GFIA 4LVUA 3PLNA 2RK6A 4UUOA 3OURA 5CIYA 1IB6A 4WVLA 5G4LA 1R0RE 3R0QA 2DT8A 3EIWA 3K0HA 4PS0A 2WJGA 4RSRA 3VGPA 2I8AA 4G9GA 1DQNA 3R3HA 1IM8A 1R0CA 1T5OA 3DVQX 3K92A 4ROSA 3VR6D 3WTBA 4GKKB 4BTVA 5G0UA 4HDOB 3VYUB 5IJ0B 4PLWA 1OFVA 1CJSA 1E4EA 3WE7A 2TMYA 2NZJA 2ZETA 3D1JA 5EIOA 2NPIA 5TPWB 2DY0A 1H6AA 5JTTA 3TUZC 1KBZA 2PO5A 3OCWA 2IYZA 3LJKA 2Q3LA 4OEHA 4E12A 3O9VA 4QFBA 2DCUA 2QMQA 4BMXA 3DZFA 3P4UA 4IQFA 3HDTA 2GEBA 3JVIA 1M2HA 2FPXA 2D2IA 2FPOA 5CYOA 3W9BA 4ZO7A 1W85B 1OXVA 4CKZA 3NM6B 2A1IA 4MV5A 4BBAA 1Q3HA 3EK2A 1Y98A 4KO1S 4YJ2F 2FK8A 3D4NA 4PXSA 1C8LA 2REXB 1L5KA 3U7QB 2C9MA 3ZGOA 5BRAA 2H8GA 5LA6B 3RS8A 1O89A 2BY4A 2Y2VA 2DEUA 1IZ9A 3T4PA 5MHTA 2VKQA 4X8HA 4ZTZB 1CS0A 1UM9B 3G8BA 4UTXA 1L7QA 2VNAA 4F84A 4YJHB 2IYRA 2WD8A 1E3MA 2XE8A 4EY6A 2RB4A 4MLPA 3QFHA 2EHJA 4CHGA 3GA5A 3QFFA 2VDUE 4IJVA 4WXPA 1Y0BA 1U3VA 2Q45A 5H59A 4OPMA 1AKYA 3UW3A 5LMNB 4KXVA 4E5MA 3ENWA 1JKMA 1U4NA 2C96A 2CDCA 1OU4A 3SC6A 5BO5A 3WNZA 5AVYA 3I76A 4D9KA 2CZGA 3N0TA 5KDLA 2B3TA 4E94A 3ZS8A 5GVSA 3TQSA 2YTZA 1XU4A 1R0WA 1QH0A 1XCJA 2CJYA 5AVKA 4K28A 4XQ0A 5DISB 3FN4A 3LC7O 4OQDA 3WGOA 4ATNA 5D3ZA 3V97A 3EZ6A 2IIQA 1VBNA 1T2NA 5KQSA 4JOCA 4EB6B 4MUGA 5L3ZA 2HWXA 4Q1BA 3CVXA 1VOTA 1R12A 1RQLA 5CLHA 3COVA 1KQ3A 1P6XA 3JSAA 1ZK1A 3QKTA 4FOPA 5ALEA 1UIRA 2Y1GA 3V00A 4W5QA 2ZIGA 3WIUA 3FRJA 1EQ2A 1SRQA 2ODBA 2PL3A 4P35A 4P93A 2H2WA 5GOZA 5HS4A 4RTJA 2H2HA 1YQ9A 3B6MA 2HMVA 4HLQB 3LZ6A 3WDLA 1UDWA 4ED9A 3IPYA 2WD7B 2YWDA 3BFXA 3KZVA 1FFDA 5DLQC 1E32A 2P8JA 3JAWA 1W5FA 3VPFA 1U0OC 3N5KA 3KQPA 4QHTA 3PC6A 3WJAA 1IJBA 4HL6A 4X7PA 4HNQA 4G2NA 3ZI0A 4DDTA 5IT4A 2P91A 3SR0A 5F3WB 3D3JA 3TRDA 2WVGA 2QTNA 4IJ6A 3STVA 2GA9A 2A4MA 2QL9A 1N2SA 1BX1A 1NOJA 4LE2A 4LYHA 5BWLA 4LZWA 4M87A 2QN1A 1U7XA 3R6DA 2OZLB 5AW4A 3GJ5A 4KH1A 3KLMX 1NKSA 3KKEA 4KGZA 3WO0A 3S2EA 3O8BA 4G86A 4RELA 1HZZA 4TOIA 1S2DA 2EZTA 4ODIA 4HNGA 2OQIA 3ONEA 5LLTA 3A4TA 1U28A 1Q7RA 2E4VA 3GGOA 3RABA 3I23A 1AS3A 5A03A 1JVSA 3RD5A 1YE8A 1VZ3A 2XNDD 5HG0A 4MZXA 3N76A 5IU6A 3RYTC 1YTUA 2AXEA 3ABOB 1N2CA 3L0DA 2CEKA 3NBFA 5ESXA 1NAHA 1P7ZA 2RAPA 4E22A 5HQ3A 1FS5A 1DRJA 1G5FA 3LLVA 3DFKA 4ONEA 1XD8A 2HPHA 3G17A 1X1EA 1KZYC 3UJ3X 5CJ2A 1XDUA 4EHDA 2WM2A 4LDZA 1BFUA 3Q1KA 2NX2A 2Q5HA 4RVCA 3NFYA 4E70A 4I5GA 1F3LA 1QYDA 3K94A 2YJGA 1ZVQA 1VGQA 1AQLA 2WF9A 1N2EA 2HSWA 4Q4JB 2XTAA 2OXFA 1BVHA 2VRCA 5I4IA 2EFHB 3FWHA 2I2BA 2PA3A 1KOJA 3DP9A 5HDBB 4N0PA 3M1YA 3Q6IA 1NMQA 1W4BA 4D0RA 3SYNA 1N1MA 4W5JA 2W6OA 3FMPB 3O3NB 4PCLA 1FXUA 3DM5A 3DMTA 5BYAA 2WLSA 3KJHA 3JD3A 4B7XA 3EEIA 3RTAA 4ER5A 1D0SA 1YA4A 4E3WA 1KEEB 5EA2A 3DYBA 4ZVKA 3EISA 1JJIA 1T15A 2X42A 2IX9A 1WXDA 1Z6AA 1UBOS 3FUUA 4FDVA 1O03A 3BHIA 2DX7A 3ZGZA 5IN4A 4L6CA 2YV3A 5HR5A 3HM9A 1JHPA 3MS4A 2RGEA 1NJ2A 2CLMB 2OQ2A 3BSWA 1T9KA 1VLVA 3CKYA 1L4YA 4GT1A 3CG4A 4WIAA 3ASUA 1Y1PA 2OG2A 5DM60 5L4NA 3ND8A 4I3GA 3AH8A 1M3SA 5ED0A 2XMBA 3FHJA 1W48A 4J0FA 1YJBA 3CG0A 1XMQB 5FUQA 1L7OA 2NXWA 2V0CA 5DI9A 4MNTA 1BHO1 5DBFA 3IKLA 4KBYA 4Z9BA 4L50A 5AOAA 5SV2A 2CXOA 3W8EA 8LDHA 1GXSA 1HLDA 1SURA 4EYGA 3DZ8A 4GOXA 2YHIB 5D01A 5IFLA 4G0VA 2EKDA 5G3YA 2UXBB 1NQOA 2IYPA 1JLLA 2A57A 3EDOA 2XE4A 1DIHA 4PC2A 1VRCA 3WWCA 2XVMA 1KI9A 5JRJA 2GD1O 1PDVA 2BV3A 2HOQA 4S1OA 5A05A 3LBIA 2CDRA 2LDBA 2JH9A 1LJLA 2AYYA 3OEHD 1XJ0A 3C3AA 1W87A 1E5QA 2FPMA 4IIFA 5EE5B 4BNUA 3DBHB 1FW6A 2NU7B 1DIOB 1G9XA 2P6OA 2ZRBA 2Z1MA 3DEYX 3QJGA 2L69A 4BLOA 3U6BA 1DC8A 1NBHA 2WBLC 3P20A 5AT1A 1DMRA 4I81A 2C7QA 4TSFA 2O3JA 1KMCA 1I7LA 1EVKA 5E6SB 1J39A 1UUFA 3GLHE 3U48A 1UBUS 2ES4A 3D3WB 3ZDDA 4GBGA 3EXIB 4UVIA 1W4LA 4CKWA 2NU9A 4Z2AA 1M34B 3I4FA 1YOVB 2FPKA 3D7SA 4HXYA 1YHYA 3MJCA 1T34A 4LRXA 4WI1A 1U0EA 5HE8A 1R9MA 1VGVA 3HR7A 3TRJA 5IZCA 3JD0A 2H11A 5A5EA 4I55F 1FVXA 1LUAA 4CV3A 1J9ZA 1L8QA 4FNAA 3EJ6A 4DV6B 2XE7A 4HRXA 4MW0A 4UM8B 1MA0A 1O8CA 4BTEA 2NSYA 4U6SA 5LXTB 1N0HA 1G19A 3CPEA 1ZNYA 3VJRA 4HOYA 4K9QA 1H2HA 1X87A 2Q21A 4G25A 5KKCA 3KXLA 3K32A 5AK6A 4AJLA 4R9UC 1O0BA 1V8ZA 2R5FA 3HXLA 2JJ8A 3AEUB 1KNXA 2MDTA 4ID3A 5BUQA 4J16A 3EP5B 4YQZA 1O94D 2WOJA 2DP4E 2UZ1A 4O2BF 5B1DA 1RBYA 3ZGLA 5TC4A 1ZP6A 3E9ZA 1E9EA 4X44A 1JHXA 4LC9A 5A02A 1G8YA 4QHYA 1O5OA 5BSGA 1IIBA 1R6TA 2LV8A 2N46A 3TXYA 3S8EA 3QLTA 5FOVA 3KCNA 5EE3A 3T4XA 3E9YA 3BCHA 3EIUA 2GN8A 4WKBA 4BNIA 5KU7A 3ZDCA 2MR6A 2WHRA 2XOKD 1WD5A 2P1DA 1ABEA 4FSDA 4RF5A 5CK4A 3A8TA 3G7NA 4PTZA 3WISA 1PR4A 4QWMA 1N8TA 2B5VA 4I9FA 5DT2A 3AVYA 4AZVA 4RDCA 2Z9BA 2OHXA 2IP2A 3IJPA 1Q7BA 3HHPA 2OAQ1 3V2UA 2EJCA 2FY8A 1B7GO 1D03A 4GX5A 4D0GA 3TW3A 4YRTA 4EAAA 1A3CA 4C0WA 4ZT7A 4Y1RA 4NKRA 1Z45A 4H7PA 3HSYA 5AOVA 3W6OA 4HVCA 5K03A 1YS2X 2L2QA 5EHZA 1NW6A 2PFKA 4F2WA 3HK2A 3GRZA 3GAMA 3GDFA 3UOAB 2R86A 5TF0A 4FDAA 3NTRA 2JLBA 7ABPA 2ZUSA 4LFBB 3EEYA 1YB7A 1VJ1A 1GGVA 4XRGA 5HXAA 3JQFA 3NNSA 3PNQA 4OHUA 4DIFA 3PYLA 1NPYA 1UKBA 4FT2A 4DNPA 2PT6A 4ND4A 1GM5A 3W9YA 3AUAA 1BDMA 2GMWA 4KIWA 5GQSA 5JR3A 3SE0A 5LWHA 2PT9A 2ECOA 1YBHA 2GM9A 4FQ7A 4R51A 2VP9A 2XUPA 2P65A 2IUTA 3TAHA 1G4AE 3T1NA 4ZK2A 1NN1A 1FMTA 1H9BA 3TBHA 4JLKA 1FQOA 5LVAA 4TKUB 4DADA 1BMTA 3SDZA 2GRAA 4PY2A 3C6QA 4WE3A 1MH9A 3GEHA 3BIOA 1K7SN 3Q9SA 2WPDA 3H0CA 4Y9RA 1D2NA 2G17A 1SHJA 2RHTA 3KE9A 1PBTA 3FY4A 2CWDA 3N3AC 2YXPX 5JY1A 1XJWA 1T8WA 1YT5A 4FYVA 4QDXA 1O9GA 3H2YA 5DTRA 5COQA 5ENDA 2R8PA 4RPCA 3RKSA 2WHPA 1QIJA 1GIAA 1YR3A 3ZNOA 1E8MA 1G8PA 1UR5A 1VCOA 1Z2AA 4NU6A 3DEKA 3H0KA 2BJWA 5GV8A 5DHQA 3W9UA 4NBTA 1PFVA 5HA5A 1OZGA 4QQKA 3OA0A 3SIPA 1A9TA 1CJVC 3VBCA 3K71B 4MS4B 3RUDA 2I3AA 3CQ9A 1ONBA 1XT6A 2XEDA 3BVPA 2PMEA 1MDFA 3RS0A 3T7EA 5HRCA 3CU5A 4C2UA 2YW2A 8AT1A 1JBKA 1Q0SA 1PL8A 2HUNA 4LCEA 4NYMQ 4AM8A 1VE6A 5LKAA 4Q4AB 3AEKB 2PA0A 5CEFA 2WU3A 4AZ3B 5JJ5A 4HDCA 1CNMA 1US8A 1IPEA 4GQAA 1XTUA 1JGTA 1SCKA 1ZGBA 3D0QA 2L42A 3FZNA 4H7DA 2PBLA 4QOHA 3WK8A 5JJKA 1TQHA 1RFGE 2QS9A 5CB6A 1J0EA 2HA4A 4ND5A 2P1RA 4J6FA 1PQ4A 3QPUA 4R98A 3PPWA 2X3UA 2B83A 4BPBA 3RQIA 3L6UA 4XIIA 3MAGA 4QPCA 1MMFB 1Y42X 1JEEA 2FP3A 1MB3A 3EZNA 1G41A 2PUVA 3ZXSA 5IULC 5T57A 1ATZA 2RCYA 4A1FA 3THSA 3UM9A 2ATEA 5L4SA 1KIMA 2DKFA 3RSSA 2N47A 2X7XA 3I0MA 3IPLA 4HGQA 4HN9A 1U8AA 5DVZA 2OKGA 4ER6A 2BGMA 3L4KA 3FTQA 2QAIA 3LY7A 1L5LA 2YMPA 4FN4A 1DEXA 4QAQA 4IVRA 1MX1A 4CF3A 4B3HA 2VF5X 2AG8A 2BN4A 3FPHA 2ID7A 4WX2B 1Y8ZA 3U1BA 3VV3A 3LT4A 3W05A 2NPOA 4P8RA 3QFSA 3LL7A 3PDIA 2JGDA 1P18A 4PGFA 5JADA 3EXHC 2VQEB 4PAMA 2A9KA 1V5WA 3JX9A 4PC7A 4B7CA 4DL9A 1UDBA 4QSHA 1JG1A 1SUBA 2UUPA 2VA8A 1VKJA 3C5EA 4KN9S 3TOSA 5DPMA 1PGJA 1T1JA 2BH9A 3R41A 1WSWA 4RTOA 4MUKA 1SC4A 1SKQA 3ER6A 3KQQA 1QLJA 4OGWA 4ERNA 3P9CA 3SMQA 4UNRA 5K5EA 4OB6A 1W1IA 4Y9UA 5J5VA 1U3DA 2NNLD 4CTNA 1LEHA 1A69A 3RVRA 5T3UA 5KDDA 1NKTA 3D1LA 5HQJA 3AVVA 3A6ZA 2ZT8A 1KHTA 5KNCH 3CTPA 3ZX4A 3Q7RA 1WRBA 4JH0A 4L6AA 2BFPA 2XGSA 4RXTA 2RG7A 3QYFA 1T1IA 3UFBA 1YMVA 1DTWB 2GN6A 3VO8A 3HLYA 1KJIA 3SR3A 2Q29A 3O83A 4NCXA 2ZSDA 4WKGA 1PO7A 5FJJA 5G0TA 4L2IA 1KZ7B 3THYB 4UHFA 4EUFA 6Q21A 3PQFA 3K1JA 4PQEA 2IDJA 4MRRA 4TZ6A 1AKNA 3AO0B 3P9SA 3BJZA 1O6FA 3GT4A 4IOLA 1U1IA 2B2XA 3K8ZA 1GSAA <