3V1YA

Crystal structures of glyceraldehyde-3-phosphate dehydrogenase complexes with nad
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis
pubmed doi rcsb
source organism Oryza sativa japonica group
total genus 120
structure length 335
sequence length 335
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2011-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v1yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v1yA01
3SC4A 2R2GA 3F6YA 4BNJA 1I8TA 4TQGA 5JO9A 5TS3A 1DPGA 3UGKA 1N1GA 2ZB7A 3KBOA 1ONNA 3U9LA 1YBMA 3Q2KA 3LQFA 3ZH2A 1EE2A 1NVGA 2BI7A 3UW3A 2RIRA 1P0FA 3W8DA 4A10A 2EKLA 1DC4A 1F12A 4BNVA 4CV2A 5BR7A 3EUWA 1N7HA 2DPGA 3WNVA 2ZTMA 4R5HA 5A04A 5KVSA 3ZV4A 3DOOA 5AQ1A 1R15A 3F4LA 4XD2A 3M2PA 4YJDA 3VC7A 1SEVA 4XYMA 2C29D 4BNUA 4CMCA 4ND4A 3GDFA 1Y9EA 2B5VA 2Q2VA 3SJ7A 1E6UA 1PR3A 5I7VA 3ZNOA 3OIGA 1CEQA 3H5RA 3H9QA 5F1OA 1TA4A 1BG6A 3ZWCA 1EVYA 5BT9A 4CM9D 2PWZA 2B36A 3LSYA 1O6ZA 1A4IA 2ZKLA 3LU1A 2X6TA 2Y1DA 3GRPA 4IJVA 1E1NA 2G76A 3Q9NA 2DFDA 4XB1A 1R16A 4FJ1A 7ADHA 2EGGA 4J2OA 1TB4A 2VNSA 1YBAA 4AJ1A 4D43A 1ADCA 3WX0A 1KC1A 2CD9A 3ZWOA 5L9AA 2DKNA 2VQ3A 4YJHB 4CUJA 2DBQA 4FOSA 2NTVA 3ZNPA 4CV3A 4E2XA 2VOJA 3OA2A 2O3SA 4IIVA 1UXIA 1IPFA 2ZB8A 3RC1A 1BSVA 3KHUA 3LC1O 1QYCA 3MJCA 5U1PA 5JAMA 1CQIA 4GBJA 5I9LA 2HK8A 2V6FA 3QWBA 4YRAA 4WASA 2QRLA 4UUNA 1GL3A 3GH3A 1MUUA 4JQCA 3ROKA 5L4NA 4Z3DA 4YB8A 4TKMA 5DP1A 1C1DA 3T4EA 1ZSYA 4BUCA 5F3RA 5B12A 2J3KA 1LQUA 4FR5A 5CP8A 4XKJA 4NR0A 4E33A 1BHSA 1HSOA 1Q7BA 3PHJA 4JP2A 3X2FA 4UEKA 4A27A 3FRJA 4JGBA 4D41A 4D42A 4DBZA 4JP3A 4DIBA 3O4RA 3PXXA 2YFHA 5KVCA 1SO8A 1I3KA 4L9RA 1ZZEA 4RVUA 1KVUA 3RJ5A 3NT5A 2RH8A 5BQFA 2QQ5A 1XSEA 4ZRMA 4YJGB 3WQRA 3F1KA 2HO5A 4XIYA 3EZLA 1GZ3A 4BNKA 3ZWYA 2ZATA 4KMSA 3WTCA 1E92A 4UVIA 1C0LA 5I8WA 1GU7A 1LEHA 4HWKA 5KKAA 5EL0A 4BNXA 4F6LA 1C3VA 3C24A 3NYWA 1I01A 2PH5A 3PHGA 4BKQA 1ZW1A 3G1UA 3ZWVA 5LCXA 5TIIA 3TN7A 1NHGA 3JQEA 1DFIA 3K30A 3RFTA 2VNAA 5IFLA 4YT8A 2O7QA 2GN4A 2FSSA 2I9PA 5KNLA 3TFOA 3RCBA 3U09A 4BO2A 3CTMA 4KP7A 5DP2A 5B37A 1V3VA 1EDOA 5TRTA 4MVJE 2J5QA 4M87A 4DGSA 3PGXA 2R00A 4L4XA 3ZWBA 4BNIA 3AW9A 2OBYA 3W4JA 3PPIA 3EW7A 1F8GA 4GVLA 5C5IA 2JD2A 2VCYA 4RV9A 1KBZA 2FPGA 3JQAA 4J4HA 4P4LA 5KTKA 5AXBA 2CVOA 1E7YA 2HMWA 1I24A 1UAYA 4NJMB 3VTZA 5THKA 2AA3A 3GUYA 2ZK7A 4BGVA 4MKZA 4J1QA 4HP8A 4MIYA 4DQUA 3A28A 2GR9A 4RF4A 3AM5A 1P74A 2DUUA 4R1SA 1B8VA 4Y98A 1FXSA 4WUVA 4CMHA 3M1LA 4CMJA 1FK8A 3F9IA 3ITDA 3WLFA 4CLOB 4OH1A 5J9GA 5KIAA 4BHTA 3IIEA 3AY7A 1A9YA 3KYCB 1OC2A 4PN3A 3EZYA 3AI2A 3EVNA 3NAQA 1A4UA 3RC9A 4Z0PA 1Y8RA 2EWMA 2FR0A 1ONPA 1B3RA 2B37A 5T57A 2D4AA 5KJFA 1TT7A 1EFKA 1IPEA 3I6IA 4YAJA 1LU9A 2GN6A 5JYDA 4RPJA 2VHZA 3OSUA 4W7HA 1R6DA 3CZRA 4DUPA 2JFGA 1OOEA 2UV8A 5JAIA 3KXDA 1I2ZA 3ETGA 4LMPA 4II2A 3IUSA 1I0ZA 5J23A 3VPFA 3W4KA 5TJ9A 2Y1EA 3HG7A 3FNHA 1MX3A 4PRKA 4OO3A 4I1IA 2BMAA 4E32A 3NGLA 4JK3A 2PKQO 3EMKA 4ESOA 3ETDA 3AFMA 4RORA 4F3YA 3ZV5A 3RI3A 5A03A 3TPCA 2BELA 1A7AA 4R68A 2VOEA 3AWDA 1JAXA 1QRRA 3PTZA 2D8AA 2Q1TA 5CFZA 2B83A 2VZ8A 2G82A 3ZW8A 1SAYA 1EBFA 4CR8A 1UDCA 1LDYA 1T25A 3RSHA 4GGPA 1YBVA 4HFNA 1BRMA 1SBYA 1Z6ZA 4BS9A 4XEHA 1SMKA 3AFNA 1VJ0A 2X9NA 4J4BA 4K6FA 2E4AA 4ZQEA 3UF0A 1HDZA 4CLDA 3GZ4A 1DRUA 3DBHB 3ZHXA 1BXGA 3NX4A 5F1PA 4H3VA 2NACA 1JVBA 1WPQA 3HB4X 2Y68A 4MP6A 1GTMA 3RAJA 1D4FA 4RPKA 3BIOA 1P1HA 4ZU3A 2H9IA 5DOVA 1M6WA 1UXHA 1L7DA 2TMGA 4PVDA 4Q9NA 1KVTA 3RU9A 1TT5B 4BV8A 3H4VA 2AEMA 2NVBA 5JY1A 1PWZA 2OBNA 3JQGB 3DXFA 4YAGA 1B26A 4FQ8A 4J49A 3DQPA 2JFHA 3KSDO 4NBTA 3D3EA 3I9JA 4F46A 2VT2A 4JIGA 3DHNA 1RJWA 2C5AA 4QO8A 3I9OA 1GYQA 4K28A 1GZ6A 1Z82A 3SLKA 5DDIP 2D0IA 2YDXA 2H5LA 4TWRA 1DJNA 3H7AA 5A5EA 4DLAA 1A71A 4LK3A 4F6CA 3I9KA 3ZWMA 4DC0A 4FC7A 3V2GA 3SJUA 1BW9B 1U8FO 1ZIDA 2AHRA 3P2YA 3X2EA 4H15A 4GMFA 3VZQA 1HEUA 2ZJ1A 3GMDA 1NXQA 1N9GA 4R51A 1DIRA 4A03A 2EW2A 5L7WA 3COSA 3GAFA 1I10A 2NM0A 3INGA 5EN4A 1H9BA 1X7DA 4AJJA 3NUGA 4YA6A 3VHRA 4IBOA 3BTSA 1D7OA 4CMEC 2EJVA 1HDRA 3SC6A 1F8FA 5DCYA 1JTVA 1JQBA 4ND1A 3FHLA 3ONFA 3E5RA 4GGOA 4N5NA 3QVXA 3S55A 2NV6A 3UICA 4EDFA 4J91A 3RFXA 1U5AA 1EQ2A 1R0LA 4OGWA 2NQ8A 4CLEA 3ZHZA 4E5MA 1E7SA 3L6DA 5GY7A 1CWUA 1YGYA 2VN8A 3DC2A 1EUDA 4FS3A 5I7EA 1LLCA 5MGBA 3H6KA 4BNYA 2PNFA 1MXHA 3DAFA 4NFSA 4UVHA 1VJ1A 2YYYA 1DIBA 2FR8A 5CAEA 4M1QA 4UEOA 2IODA 2VUTA 2GRAA 3CIFA 1KERA 1HYEA 4ZD6A 4XRGA 2V65A 2P68A 3O38A 4GX2A 3RVDA 3ZN2A 5EMHA 5G4KA 3STHA 1MC5A 1H6BA 5L3ZA 2VTDA 4M86A 3MZ0A 3PJDA 3LVFO 1M2WA 1L1FA 4XR9A 1GYPA 4IQ8A 1EEHA 2V7PA 4IUYA 4I8XA 5CDUA 4KQWA 1HYHA 3CSDA 3IP1A 1PJ4A 5BSEA 2JD1A 1E3EA 4N54A 3Q6IA 1GUZA 5BNFA 3WMXA 5K0ZA 1R12A 3TRIA 1SB8A 3DAGA 4Q39A 3KLPX 2YHIA 1PQUA 1U8XX 2X58A 2I3GA 3QHAA 2CNBA 4RLHA 4ND2A 4WKGA 2PGLA 2O23A 2O2YA 3GGPA 2VRCD 5TGDA 1UUFA 5A9TA 5JDIA 1PJCA 3QW2A 2AG8A 1H6CA 2Q99A 3WGYA 4WGGA 2BH9A 1ADBA 3P2OA 2HCTA 2B4RO 3H9JA 4R1TA 3I52A 1IOLA 1U2DA 1VKNA 1GFSA 3Q3CA 4OAQA 1E3SA 1B2LA 1VM6A 4DBVO 4NNJA 5T8KA 4PG4A 4R41A 3OICA 4NU5A 1XCBA 1QP8A 4R1NA 3SEFA 3DFUA 2DQ4A 1DJQA 1EK5A 3MCVA 4DL9A 1DLIA 4BNWA 4Z9FA 3RWBA 2V6GA 3FI9A 1I32A 3QVTA 2PK3A 3NKLA 3PJGA 4XQ9A 4ZQFA 3WWZA 4CM8B 5JDCA 4WPGA 1PWXA 4E2YA 1HTBA 5JLAA 4EI2A 3DZIA 3S2FA 3VDQA 4KWHA 3QLJA 1NAIA 1F0YA 5A05A 3FWNA 4IDDA 1QV6A 1CRWG 2O4UX 1BDMA 3JQ7B 2O7SA 4J1NA 4W9NC 1P33A 5AYVA 5EPOA 3WIDA 5A9SB 2CZCA 2Z5LA 3T4XA 3A4VA 1E3JA 2GZ1A 3CZMA 4ITUA 3AOEA 3FR8A 4J1TA 5A5FA 3AJRA 4BV9A 2E48A 3DBLA 3NDJA 4PLVA 3DBRB 1ZVMA 4CM4B 3RFVA 3V1UA 2AQIA 2CDBA 3H5AA 3JQ8A 4B7UA 5TLSA 4PCVA 2CDCA 4RF5A 1PJQA 1YOVA 4RVDA 4B8ZA 4PG8A 4YJFB 1U7TA 3C1TA 1H6AA 3P19A 4J7XA 5JCJA 2OHXA 4B3HA 2O3UA 1DSSG 5HS6A 4P22A 4BB6A 5JBIA 5T64A 2NNLD 5G4LA 2EXXA 4WOKA 5L7YA 1K5HA 5FWNA 3D4PA 2H6EA 4FBGA 1HDYA 3OP4A 3RKUA 2AE2A 2BFAA 2QYSA 2Y0EA 2NVUA 4NJOA 1C1XA 4BO6A 4CUKA 3PVZA 1HXHA 1GR0A 4AJHA 3DZGA 1VL8A 3JQ6A 4UREA 5FF9A 1CDOA 2QZZA 4CMBA 4RVGA 3KLMX 3LT2A 2DM6A 1VKOA 4RPLA 2FSVA 1VSUA 1DFHA 3EK2A 4NBVA 4IJKA 3BMNB 1A9ZA 3QY9A 2Q1UA 4U0KA 3L77A 2HLPA 4XR4A 5IDYA 2G5CA 1ISJA 4B8WA 4WEOA 5ENVA 5AVOA 3N7UA 3VKUA 1YDEA 1E1LA 1EMDA 1R4MA 4WCFC 3AOGA 5CDYA 1N1EA 2X0NA 4U8GA 2IXAA 1S7CA 1PZFA 3VPGA 2FZWA 1XU7A 4YT5A 3OIFA 5LDGA 3PYXA 4XGKA 4XA8A 3L9WA 2C2YA 1M6HA 4OQZA 1XHLA 2CVQA 2QW8A 3PHHA 3GG2A 3KEOA 4YCAA 3ZHBA 1K6JA 2VZ9A 3OECA 4WNIA 1B8UA 2ZYAA 1HWYA 5JYFA 3OEYA 4AFNA 1JVSA 3JQCA 2D59A 4NBRA 5KWEA 1TXGA 3U3XA 4MVJF 4MVJM 3GEMA 1XR3A 3C1AA 1U9JA 5DN9A 4IQGA 3GNQA 4GSLA 4U6SA 3OJLA 2UVDA 3IC5A 4MJLA 3E9QA 4B7CA 5GZ1A 1K89A 3MOGA 1NR1A 2FRDA 1SOVA 1VJTA 2FR1A 2RAFA 3AM4A 5JAZA 1ZJYA 3RD5A 3I1JA 3QWAA 4IDEA 2ET6A 4R9SA 1KY4A 4BO7A 3NEPX 3OJFA 5JXWA 3WGOA 1Q0HA 2XPCA 4OOEA 5IF3A 1Z7BA 1Y5MA 2JAPA 2EF1A 3VKVA 4UEJA 3ANLA 4BO4A 2J3HA 3RUEA 3JQBA 3WG9A 4EUFA 3CINA 3BXXA 5L53A 4WLVA 3VZPA 3WS7A 4PLWA 3GDOA 1X14A 5A3JA 3LC2O 2ZCUA 3BTOA 2PZMA 4OOFA 4CR6A 1ZFNA 3M1AA 1G6KA 3G0OA 2CDAA 5F1KA 4GL4A 1GUYA 2X23A 4II3A 4WE3A 3VZRA 4K6CA 3DTYA 3EYWA 3ROMA 3ETEA 1ZK3A 1XG5A 3UH1A 4JLWA 4ONEA 2O3JA 3D7LA 5TX7A 2DC1A 2BKAA 1X15A 1UJMA 4Z3KA 3KTDA 5COBA 4E4YA 1W73A 3L07A 3ZWPA 4IDGA 2UAGA 3QVSA 3HN7A 1H5QA 3DDNA 4IY1A 4AJPA 5BSFA 2Q2QA 1NQTA 1JAYA 3ZZNA 1KEUA 4TZKA 1R4NA 3P7MA 3E5MA 4P38A 2ZTUA 3H9UA 2PA3A 2RHCA 3E18A 4HBGA 4IDCA 4CM1A 3V2HA 4X54A 2CFCA 2WJPA 3PHLA 5CDGA 2P5UA 1QMGA 4XJTA 4OJNA 4K9DA 3H9GA 4NDNE 3UUWA 2VT3A 1HZZA 3WLEA 1HLPA 2B4QA 2C0CA 1YB5A 3TOZA 4J6FA 3IS3A 2XAAA 3F46A 3WYBA 3U0BA 4N5LA 4HFRA 4CM9A 3B20A 4MVJG 2AE1A 2R00C 4ZN6A 9LDTA 2AQKA 2EGHA 2IXBA 4ALNA 2VRBA 2GERA 5IXSA 4MIOA 2D3TA 2E49A 1ZSNA 3HSKA 5I8ZA 5ADHA 2FPIA 2P5YA 1J5PA 3VPSA 1YB1A 3JQDA 5I9NA 4NBUA 3WGTA 4MO2A 1T2AA 2VYVD 3FN4A 4XYEA 5AXDA 5K6AA 3OJOA 1BXKA 3S2IA 3W4IA 3FCOA 3L4BA 1WLYA 3LF1A 3WICA 3C85A 1LLQA 1T4DA 4AJIA 1M75A 1DXYA 1E7MA 4EUEA 1LDGA 1ZEMA 1NVMB 3LF2A 3K92A 4PLTA 5DT9A 5F5NA 5IDXA 2P9CA 2QRKA 3VH2A 4FFPA 3QWIA 4GKBA 1VE9A 5BNIA 4NJMA 5FI3A 5EQFA 4WLNA 2B0JA 1M66A 5CEFA 3ADPA 3BMCB 2HRBA 1KVRA 2NVWA 3D5QA 5KCZA 5THQA 5DNAA 2OFPA 1PGNA 3R0IA 1MGOA 1PJBA 4CLOA 1NPYA 4MOWA 2I76A 3QQPA 4RLSA 1SZJG 1NP3A 3KYCA 5HBRA 4I5DA 3JD3A 1YH3A 4KWIA 2NUAA 1EQUA 1Y8QA 3GA0A 2X9VA 1FDSA 1Q7CA 3PWSA 5KKCA 4WLOA 3BMQB 4IGFA 1HE5A 4EEXA 1XU9A 4BNLA 1OZAA 4N7RA 3BA1A 4BO1A 5CEJA 3BAZA 4BKUA 4CPDA 5G0UA 4RCVA 3RC7A 3QE3A 1Q0LA 3K9QO 1RYEA 4YEDA 1OMOA 2F00A 4HUJA 4I9NA 5C37A 2GLXA 2CF5A 5TQVA 2O3RA 3F4BA 3LYLA 2QRJA 1ZMTA 4KUHA 4HADA 4E12A 3GFGA 2B35A 3ZV3A 5JFOA 4CL3A 1E7WA 2EEZA 3TZ6A 4LGVA 2Y99A 4EEZA 2CY0A 4L0QA 1S6YA 5CHEA 3GHHA 1B14A 4EW6A 4JXKA 4TRRA 2HSDA 2G17A 2ZB4A 3UVEA 2C2XA 2X9GA 2DBRA 3VH1A 1AXEA 2YV2A 4DREA 1ISMA 3ITKA 4P4NA 1HDOA 2WEKA 1K6IA 3D0OA 4U7WA 1EDZA 5FEUA 3CMMA 3RJ9A 2LDBA 1PEDA 1RM5A 1AN9A 3KUXA 1A7KA 3PIIA 4BGEA 2I66A 4ZQHA 4FJ2A 3ZCXA 2PZKA 4FFNA 3NTRA 3BHMA 4FIZA 4J43A 4R01A 4CMGA 1U7HA 4D3FA 3ZWWA 3WFIA 4LW8A 4MKXA 3HADA 1H0KA 2C7VA 3E6AA 1TT5A 4O6VA 3FD8A 2PTGA 3DTTA 3WGIA 3JQGA 4CUZA 4UVGA 1HE2A 5KJ1A 2BD0A 3IMFA 3FNEA 2CUKA 4UUMA 2DTXA 2OOSA 3D4OA 2GNAA 2Q46A 3BTVA 3UCEA 3HDYA 1YKFA 5CPFA 3KOUA 4JJIA 3ZU4A 3GNSA 4MVJD 1LLDA 4JBIA 3PDUA 3EVTA 3ROPA 1PGPA 4GMGA 4O5OA 1HE3A 4K1LA 2VWPA 3DFZA 5L95A 3HZZA 2Y0DA 2V6BA 3MWEB 2JL1A 2QIOA 5BNTA 3OIDA 4XB2A 5KVQA 4GSKA 5HS4A 3E9MA 1N5DA 3NT2A 1U3TA 1M67A 2NTNA 3ENKA 3F5SA 3JQAD 4FFMA 4WECA 1KOLA 3UOGA 1QLJA 3PIDA 1X1TA 2PD3A 1Y9AA 1XYGA 2IEBA 1LTHR 1E3IA 2TMDA 4GWKA 3VTFA 1GV0A 3JTMA 3E8XA 4A7PA 5A06A 1W0CA 3JYNA 3LLVA 3K2EA 4OSPA 1WAMA 4WJZA 5IN5A 4DLBA 3KVOA 4Q3NA 4PG5A 3VAZA 1P1KA 1B3BA 4D45A 1KYQA 3H2ZA 5HTOA 2P4QA 2JHGA 3KETA 5HRUA 4BOYA 1WZIA 3ANNA 5ENDA 1KEWA 3Q11A 1WDLA 1D8AA 2YJZA 2NU6A 4ALJA 2QX7A 3OEWA 1V35A 4WK6A 1O0SA 3AUAA 3C8MA 4YAKA 4CQLA 3O03A 1P44A 5IDQA 1T2CA 3P5SA 4TSKA 1IZ0A 4E13A 3N58A 4JX8A 3WNQA 3WWYA 1LNQA 2RH4A 4E2ZA 4YYZA 1V9LA 4IQ0A 4MKRA 2IYPA 4DQXA 3NDRA 4RF3A 1N8KA 3I83A 1AE1A 2D1YA 1CIVA 3R6DA 3UXYA 3DMYA 1ZNQO 5L45A 4IMRA 1GCOA 3BYZA 4FFLA 1GDHA 5IJZA 2RHRA 2YDYA 5TSDA 1P31A 2CSUA 3DZBA 2WD7A 1ONOA 3I9LA 1LDMA 3PQDA 4OIMA 2ZQZA 4AJ2A 4UAGA 1ENOA 2YY7A 1RM4A 5L4LA 3ANMA 3WGQA 3WR5A 1NWCA 2W2KB 2GASA 1XQ6A 3ULKA 3JD1A 5C3MA 2BRUA 1YVEI 4YACA 3DB2A 4CODB 1AUPA 3Q9UA 1XA0A 3FTPA 5U4QA 3SLGA 1NPTO 2PFGA 3NDIA 1QKIA 3FBGA 4XYLA 5ITVA 3JQAB 3UHAA 5JDIC 1DB3A 1R66A 4IZIA 5L7TA 1V6AA 3DMTA 3NGXA 1NVTA 2BFMA 3INTA 3DBVO 4ZICA 1NFQA 4LMRA 5COQA 1R0SA 4R3WA 2YFQA 3E9NA 4QFDA 4TRJA 1ZBQA 4QFCA 5T8KC 2DVMA 5KOIA 3H65A 2WTBA 1ADGA 4FOOA 4NFHA 5TC4A 3PEFA 1UXGA 3DZFA 3PI7A 1LRKA 1B7GO 1YQXA 2B5WA 4TZTA 2NTJA 4H16A 4FC6A 2CMDA 2ZB3A 4EBFA 3DZHA 3S1LA 4JBHA 4RQTA 1AGNA 3GN1A 5IAAA 2EKQA 3EY4A 2VTEA 1GEGA 2PD4A 1HT0A 1R0KA 2WE7A 5JDCC 4YQZA 1C0KA 1U4SA 4IGEA 4Y6RA 1PJ2A 5TJHA 3OHSX 2IRWA 1ZK4A 3Q2IA 3WFJA 4PLPA 3KO8A 3AY6A 3AOEC 1X0XA 1EBUA 1FDVA 2X0IA 1P1IA 4GWGA 3AI1A 4ZQGA 2A92A 3CEAA 2XF8A 4ND5A 5I9MA 4CLRB 1WMAA 1I36A 4FD3A 1J4AA 4EJ0A 3JQFA 1SOWA 1PZEA 4ROSA 3DO5A 3KB6A 3O26A 3TOXA 5BSHA 2BGMA 2YZ7A 3C7AA 1DDOA 2HUNA 1OFGA 2CF6A 2YV1A 3ENNA 1V8BA 4Y9DA 4N5MA 3SBOA 3WJAA 3D3WB 1GQYA 2F1KA 2ZQYA 4Y67A 4AJNA 4A73A 1DOHA 3ZHYA 3BMOB 3IKVA 5JC8A 1A72A 4ILKA 2VZ0A 3JD4A 3PQEA 4CM4A 3QVWA 2FOIA 3KYBA 2VYND 2H63A 1E1KA 1JKFA 1GQ2A 4MP3A 4XJSA 1UXKA 4B4VA 1TEHA 5COAA 3K8ZA 2GZ2A 5IZCA 3AUTA 4XQEA 3WYCA 4YRDA 2VRCA 4E31A 4J7UA 1ENPA 1WDKA 4UUPA 4DTIA 5JYAA 5DULA 1I3NA 2Z1MA 4XDZA 4BMNA 4C7JA 4OMUA 4XCVA 1YE3A 1SEPA 3PHIA 1DC6A 3MJ4A 4YBZA 1Z74A 3AUSA 1XWFA 1O89A 5ILGA 1IB6A 4QSMA 1SPXA 1NFRA 5IG2A 4A26A 1T26A 4HV4A 3WOHA 3ICPA 1DHRA 4RPHA 3DHEA 3JYQA 5DBGA 1Y6JA 3ZDFA 1IHYA 4CR7A 4HKTA 1TI7A 4RGBA 1U3UA 2Y1FA 4IJWA 1I2CA 4WNCA 1KVSA 1NX6A 4YR9A 2QYTA 1U1IA 4OYRA 1ISIA 3LC7O 1T1SA 5LDHA 4L73A 1CETA 3OQ6A 3BMNA 4BMVA 4LSMA 2GF2A 2NSDA 2UUOA 4NQZA 4AVYA 3VVCA 1WNTA 3GEGA 3OM9A 2AMFA 3GMSA 4JCOA 1IL0A 3BZUA 4KDEA 1WWKA 3I9MA 2UDPA 2VHWA 3O8QB 4J9UE 4IS2A 3TFQA 1GADO 4FCCA 1E77A 3IJRA 3RU7A 5H81A 3QVOA 1W4ZA 2VUSA 3PP8A 4QQRA 4M54A 3DAPA 1YDWA 5JMWA 2PGDA 1VPDA 3JQ9A 1LDNA 3SVTA 4AJEA 1NYTA 1ZXBA 2WYUA 3R3SA 1PJ3A 4LRSB 4BKPA 1E3WA 1LSSA 4ZQBA 4ZVVA 3B1FA 1YS4A 2GSDA 4AG3A 2EW8A 1UDBA 4BNGA 5IZ4A 1ZJZA 4Q3BA 2IZZA 3E03A 4A2CA 4ALIA 4QT0A 2IZ0A 1JN0A 4I9UA 4CJXA 1PS9A 5EJ2A 3RUAA 4AICA 3PZRA 1IUKA 4J0EA 1YL7A 2HMVA 3JQBC 1O5IA 5MDHA 4O0LA 3VDRA 3C7CB 4J3FA 1LC0A 1E5QA 4YWJA 1U28A 3DOJA 4O59O 5H82A 1WVGA 3EHEA 2FY8A 4W7IA 3WQSB 2Y66A 4J16A 3ST7A 2Q1SA 4OHUA 2Q49A 3PJFA 4R54A 2RCYA 2C82A 4OM8A 3WXBA 3C3XA 4B79A 1VI2A 1PGQA 4Y8VA 4BVAA 4G65A 1H2HA 3DWFA 1ISFA 3JD0A 4QTZA 4Q3DA 3PK0A 4J1SA 4ND3A 3DOCA 1L7EA 4NMHA 4XWYA 3QP9A 1MFZA 3JV7A 3SX2A 2OZPA 3O9ZA 3UCFA 4LCJA 4OXKA 2YHIB 5DF1A 3GZNB 4CMIA 3RIHA 2LDXA 2E37A 3KYDA 1DBVO 5B1YA 3HNPA 3I23A 4B7XA 1G1AA 3T7CA 5CDSA 2NADA 4MDHA 8ADHA 2A35A 2D5AA 1HETA 3WGHA 4PRLA 4JN6B 2Q50A 3UKOA 3TL2A 1LSUA 1MG5A 4E5NA 1W6UA 3B1JA 1P45A 3OA0A 2JCVA 1CF2O 2FP4A 5EERA 1H6DA 2W2LD 4FN4A 3E48A 2PZLA 1ID1A 4IPTA 4YAIA 5IXYA 1GUFA 4J2HA 1DC5A 1SNYA 4MVJI 4Q3CA 4B3IA 2IE0A 3G1TA 4CMAA 1BTOA 1JWBB 1GCUA 1YWGO 3OBBA 3TF5A 3IDSA 1Q2XA 1JA9A 2DBZA 1GAEO 4MP8A 1F17A 1NQOA 3BTUA 4U6QA 5KJEA 4NU6A 2OUIA 1OBFO 3KZVA 5L51A 4R3NA 1EUZA 3WIEA 4L4SA 4EUHA 2OP0A 4GX1A 5K6AC 4FGWA 1U3WA 2AEFA 3L4BC 4YPOA 3NJ4A 2OGUA 3DBLB 3GN2A 1UDAA 4PIVA 3FPLA 3RBXA 3OQBA 2Y0CA 3JQ8B 4AL4A 2FN7A 4GKVA 2AXQA 4DIFA 2BHLA 1ULUA 4PVCA 1NWHA 4I5EA 3TZKA 1PZGA 3NT4A 4KOAA 5GZ6A 3R3JA 2P2SA 4H7PA 1B0AA 3R1IA 3HWRA 1K0UA 2X5JO 3KV3O 5C7LO 3GEDA 1Z7EA 1R37A 2VHYA 4CV0A 2X0JA 1ML3A 1IULA 4LSWA 4EJ6A 4L75A 1NNUA 2EP7A 4PLYA 3GG9A 1YQDA 2EG9A 3ADOA 4BB5A 1LQTA 3GPIA 1MV8A 4YJHA 2NVUB 4BO9A 4ZHSA 2WE8A 1C1XB 1I3LA 3FF4A 1J49A 4BNNA 4QECA 2DPHA 2WD8A 4BKRA 2SCUA 4LRTB 2BFOA 3WDSA 4TVOA 1P1RA 2BGLA 1XDWA 3VOSA 3Q0EA 1AHIA 4NK5A 4YT2A 1QLHA 2HQ1A 4TRMA 2HMUA 1I30A 4CM6A 1U5CA 2ZIZA 3FNGA 2EIHA 4KUEA 5JYEA 1G0NA 1GQQA 4A0SA 4BKOA 4DPKA 2YUTA 2POQX 1NM5A 1BGVA 3CKYA 3ASVA 3UN1A 5T5QA 1MFPA 1FJHA 3W8FA 2D2IA 5AOVA 1XKQA 3BMQA 2RBEA 4D0RA 1D1SA 1HSZA 2VHXA 2XOXA 4BNHA 3K96A 5L4SA 3MJEA 2W98A 4E2WA 4YXFA 4TRNA 1Y7TA 1LSOA 4FFRA 4IINA 1HZJA 3V8BA 3K31A 1DIAA 1NR7A 1Z75A 2I65A 3OMLA 2PLAA 1K2WA 3AY3A 4YJGA 5T67A 3I6QA 4WLUA 1KY5A 4CQMD 1DFGA 1ENZA 1WZEA 4XGNA 2YV3A 4DPLA 1PU2A 1GV1A 3VPXA 4WEQA 4FB5A 2WM3A 3TSCA 4JBGA 3V1YA 1V0JA 5C7OO 3AU9A 1EVIA 2VHVA 3MJVA 4GI2A 1UAGA 5ITWA 3DONA 3GLQA 5HM8A 1E5LA 1GPDG 4RZIA 4PFJA 3M2TA 1PQWA 4DA9A 4YRBA 4UVEA 2HJRA 3I4FA 5G0SA 1EVJA 1ZXLA 2GN9A 2PR2A 4GX0A 3F3SA 4WLEA 3A1NA 3FNFA 3GVPA 4JJFA 1YQGA 4B4OA 4PZCA 3ZNNA 5FI5A 4EGFA 1KEVA 3SXPA 4GLLA 1XLTA 5EQDA 1RM3A 2GYYA 3IQDB 3ZWXA 4DMLA 1ZSVA 3D64A 4QEDA 2O48X 1N92A 1SCUA 5CDTA 2GDZA 4CLHA 1IYZA 2HU2A 1LJ8A 3KSZO 1O94A 3AK4A 4NHEA 1EK6A 4HNGA 3HUDA 3U4IA 4I5GA 4Y6SA 4Z6KA 3KEQA 3ASUA 5EINA 3GT0A 3GQVA 5CEEA 1BWSA 1WP4A 3S2EA 3GVIA 4Z9YA 3TWOA 1YB4A 2PY6A 4DRYA 4E0BA 4ZGWA 3EDMA 3MTGA 4XYBA 2HJSA 3B1KA 4PG6A 3K2BA 3PLNA 1HDCA 2X86A 4XZ3A 3RUDA 4XIJA 3WQQA 2C59A 3V1TC 5U9CA 4BIIA 4TROA 1QSGA 3CH6A 1GY8A 4E21A 4PLFA 4TMFA 3E1KA 9LDBA 3QWHA 4Q3EA 2OXIA 2Y67A 1UR5A 3F1LA 4CQMB 4RF2A 3ON5A 4BO8A 1NHWA 5DCWA 4PZDA 2WYVA 5ER9A 1RKXA 3QV1A 3FBTA 3U5TA 3LT0A 2J3JA 4OXYA 4GAEA 4IDFA 3NTQA 3TZQA 3I4CA 1T24A 3PGJA 2AW5A 4UVDA 2X5KO 3GFBA 5DZSA 3JYOA 4EYEA 3CUKA 3IJPA 3HQ4O 5TT0A 4KDFA 1R4NB 5BSGA 1JU9A 4L74A 2HMTA 1GPJA 2Q1WA 2G0TA 3N74A 5JS6A 1K3TA 1HL3A 1XELA 4WCFB 1HYGA 4AJKA 4CMKA 1PJTA 1QXSA 2C54A 2ILTA 4IDAA 2J6IA 2HRZA 1HDGO 1I33A 5IDWA 1QYDA 1HDXA 2VWGA 4G2NA 3HJAA 5GMOA 3JYLA 4Q3AA 2O3QA 3U4HA 2VUUA 4L76A 3LT4A 1QORA 1OAAA 4KQXA 5HA5A 1LXCA 2HAEA 4DYVA 1EE9A 2BF7A 4HNHA 3W1VA 1PGOA 4NIMA 1VRWA 2JJYA 4C7KA 4MIEA 2FHSA 4P4GA 2Q4EA 1C14A 1ISHA 1QG6A 4FSHA 5L40A 1ADFA 2GD1O 3VPHA 4QUKA 3DBHA 1PX0A 3GVHA 3HN2A 2EKPA 2J5RA 1K6XA 3W6ZA 4FFOA 5ILOA 2A9FA 1Z73A 4IXTA 3CMCO 4XDYA 1QYVA 3DMTC 1ZK1A 1DRWA 2YQ5A 2ZYDA 1DIHA 1AXGA 4MVJA 2E6UX 1T2EA 1UP7A 3OFSA 1PSDA 3W6UA 5ICMA 3PYMA 4LVUA 2GZ3A 4YTEA 1ARZA 1BXZA 2PZJA 1B8PA 2IZ1A 1JKJA 2W2KA 3IUPA 3G79A 3HB5X 4DXHA 3DL2A 3S8MA 2X8LA 4MPDA 2Q45A 3GHYA 2Q4BA 1T2FA 2C20A 4BO0A 3PZBA 2Y1OA 3ONDA 4RO0A 1GD1O 1GYRA 3LLSA 5F21A 1A27A 3WBBA 4PLZA 5TF4A 1LDBA 4J4TA 4KTVE 4DIOA 4JNKA 1H93A 2PKQP 5GZ3A 4LVCA 1ZK2A 5T6BA 1JW9B 3EAGA 1WXDA 4LISA 1CYDA 3L0DA 1YJQA 4ALMA 4IM7A 3H9EO 1VSVA 1JDJA 1BW9A 4EITA 2BFPA 2QHXA 3D1LA 4G5HA 5IN4A 1U2GA 1C1DB 1W8DA 2VWHA 4GLOA 3HFSA 1O95A 1Y8QB 1UZMA 4B4WA 1F06A 4BNFA 1HF3A 4KTTE 4I9HA 4L4RA 1Z45A 4WLFA 2JFFA 2J3IA 4CV1A 3L6OO 2JAHA 1EUCA 3NRCA 4BMSA 1ZKMA 3JQFC 1E7RA 1NASA 5JSFA 5G2OA 2Y1CA 4RVHA 4BO5A 4NH4A 6LDHA 5A02A 3U4CA 2PKRA 1VLLA 4M49A 2C7GA 3OF2A 5TT1A 4OL9A 1FDUA 1E0DA 3G17A 3PFWO 1NAHA 1RPNA 3H5NA 3PRJA 3MJSA 4CLRA 2NWQA 2W8ZA 3BHIA 1DAOA 3WTBA 4J90A 5JPIA 2NLOA 1HRDA 3HDHA 3I9NA 1IZ9A 5IZCC 3I5MA 4K26A 4YT4A 3GVCA 5JW6A 4E5YA 3PFFA 1LLUA 4DPMA 3D3WA 3Q1LA 1SB9A 3TL3A 1LI4A 3ROQA 4O1MA 2Z1NA 4BO3A 5A4DA 2WSBA 2DBVO 5I7SA 2I67A 3CE6A 3BMOA 1QYWA 4YAEA 3WMWA 4IZHA 3WB9A 2A94A 1B15A 2WWRA 3QA9A 2J5KA 4CLXA 3FR7A 2A4KA 4IS3A 2AEJA 4RZHA 1YL5A 1UH5A 1P1FA 2H1SA 4XRRA 4NI5A 2OL4A 3U49A 1PS0A 4Z0HO 1RYDA 3GPDG 3RQSA 3U62A 5KJ6A 1ZH8A 1U4OA 2QG4A 5T73A 4BL5A 2BLLA 4DQVA 4ID9A 2P4HX 4XYGA 1YL6A 1X7GA 1YXMA 1FDTA 3LZ6A 2I99A 2ZYGA 3GUCA 3HFGA 2EV9A 4URFA 4EZBA 3TDKA 4ZRNA 2B69A 2O4CA 4EJMA 3GR6A 3CXRA 3PWZA 3TJRA 4D3SA 4S3MA 5A9RA 1FMCA 1X13A 1U3VA 1PS8A 3JD2A 2X4GA 2E82A 2P9EA 3AM3A 3HDJA 4UULA 4S1VA 3UCXA 1Y8RB 1ZUD1 2FPPA 2O2SA 4R16A 3WSVA 4AJOA 4RQUA 4N18A 3OJ0A 2OP1A 3C1OA 5JO0A 2YW9A 1ZEJA 1T4BA 1EVZA 1MB4A 4NZ9A 5ES3A 4C4OA 4OQYA 3G49A 1LUAA 3JQ9C 4W6ZA 5FYDA 3RC2A 3JCZA 2AG5A 4M55A 1T2DA 2O3TA 3AU8A 2QZ9A 1PIWA 1G0OA 1EFLA 3ONEA 2DTEA 2IDZA 2X0RA 3RKRA 4BNMA 4W4TA 2HDHA 3O8QA 4NFYA 1QV7A 4E5PA 4DC1A 4OKIA 4CM8A 1T1RA 1DIGA 4IMPA 2DTDA 3RUHA 3UAGA 5B4UA 5KJCA 3B70A 4TKLA 1M76A 2J8ZA 2VYNA 1I5RA 1NFFA 4B4UA 3L4SO 4MVJP 1VL6A 3UFXA 3JQ7A 3LK7A 4E30A 3QSGA 5B4VA 4RDHA 4E5KA 5A9SA 4W99A 3IAHA 1P9LA 4FDAA 3WGZA 3HHPA 4XX0A 2GCGA 3K6JA 5JCXA 1MA0A 3RUFA 4RL6A 3VH3A 5HWSA 1XGKA 1E3LA 5JAQA 4CQLB 3OH8A 4INAA 1O8CA 4XQCA 1NPDA 3DBRA 1DO8A 1XIVA 1HLDA 3V2UA 2BGKA 3V5NA 3WSWA 2EP5A 1C0PA 1E6WA 3ICCA 4HFMA 5EIOA 3PWKA 4QX6A 1BXGB 4E6PA 1RWBA 3JSAA 3DEYX 2AQHA 5EESA 4D79A 1FDWA 1ZMOA 4YJFA 3QWFA 4U0JA 1Y5RA 3IP3A 7MDHA 3ABIA 2WD7B 3GVXA 3OETA 3QRWA 3W8EA 2WDZA 4DVJA 1V3UA 2PD6A 2I5PO 3PDJA 3PQFA 1YO6A 1PJSA 1GZ4A 2XXBA 1UZNA 5F5LA 3RBZA 3K5PA 4JJGA 1V3TA 4ALLA 4HY3A 5ICSA 3KM0A 4J7CA 1YRLA 4Y6PA 4IXWA 4RJTA 4PLCA 4BQPA 4BGIA 3OJEA 1MXFA 4Z0TA 1YJ8A 1HE4A 1ZO8A 1IY8A 1HKUA 1UZLA 2GN8A 5ER6A 4E3ZA 5LC1A 3CPSA 1XQ1A 1E6EA 2G1UA 2X1HA 1TLTA 4ZA2A 4RDIA 3ZW9A 1Q0QA 2JHFA 2VWQA 3MEQA 4O63O 4R4JA 3GAZA 3GZNA 3WJ7A 1EZ4A 4XGIA 4D3DA 1PQPA 1F14A 1KVQA 3GNTA 4W82A 2JCXA 5DBFA 2XXJA 4HFJA 2ZTLA 3L9XA 4YQYA 3M6IA 1H9AA 1D1TA 4FW8A 1JKIA 1AHHA 4DWVA 2P91A 2PH3A 5C7IO 3TZCA 4MINA 1P0CA 1N9GB 3NTOA 2GUGA 3H3FA 3ZNQA 2O50A 1WW8A 1LX6A 1KIFA 1I3MA 2OORA 3AI3A 3IKTA 3AUUA 1TVEA 2OO5A 2X22A 1BMDA 4NBWA 3H3JA 4JROA 1E7QA 4RPGA 2IYOA 1E1MA 2GPTA 2PV7A 4HX5A 3F47A 3E82A 4BGUA 2FWMX 4ZJUA 1H94A 5FFFA 2OMEA 4J9VA 2CVZA 3F5QA 8LDHA 2GO1A 1CQJA 4CMEA 2R6JA 3GC6A 4NPCA 1ZK0A 3NV9A 1MLDA 2C07A 4I5FA 4LN1A 3GY0A 2ZTVA 4NG5A 2ZJ0A 4RVSA 3TNLA 2Y93A 5JC1A 3NJ8A 1LDEA 3WBFA 1X0VA 3LDHA 1LRLA 1ULSA 2UUPA 5KVVA 3KSUA 4GQAA 1WMBA 3T7EA 4UUOA 5JE8A 3D5TA 1GEEA 5G4KB 3GF4A 1LRJA 5A1TA 5CG2A 1QYXA 5H83A 3K73O 5JY6A 3INRA 1MG0A 3ZWAA 1SC6A 3GGOA 4FPXA 3ZU2A 4D46A 1KC3A 4BNTA 1NQAO 4BQRA 4R69A 4WCDA 4MVJH 4DYDA 3LT1A 5A3VA 2Y1GA 2ZCVA 4R1UA 1J0XO 4R5MA 3VVBA 5DCUA 2WYWA 2AQ8A 4AJLA 1D3AA 3MOIA 3ZWNA 4AJ4A 4GPD1 2C5EA 3TZHA 2IEDA 1MP0A 2PGJA 1PTJA 2DFVA 4P8RA 1JLLA 3FWZA 4YDRA 4HXYA 1Y1PA 4QXMA 4GH5A 5AXAA 1ISGA 1ENYA 1WDMA 3RASA 3MWDB 3S2GA 2W2LA 4OXNA 3QIVA 4FJ0A 5JCJD 1J6UA 4CM3A 4CL8A 4PLGA 1PGJA 4M89A 2JKVA 3GK3A 1DC3A 3JYPA 1JWAB 2Q22A 2JD0A 1XEAA 1UXJA 1DRVA 1PL6A 2I6TA 4I08A 4YVFA 4IDBA 2HKIA 2HK9A 2FZEA 4CM7A 1KETA 2HK7A 2EJWA 1LC3A 4PG7A 1KEPA 3KRTA 3ZGYA 3L6EA 1UP6A 2JCYA 3D4NA 1NBOA 2NU7A 1Q7GA 1PL7A 4IJUA 5G0WA 2P9GA 1IHXA 3DR3A 3ZV6A 3H8VA 4A5OA 3MTJA 4R9RA 2X7HA 1DHTA 4OKNA 1NQ5A 1BVUA 5JMPA 4B3JA 3OQ1A 2UYYA 3GGGA 1I2BA 4BNZA 4PLHA 2W90A 3RROA 2W4QA 1B16A 1P1JA 2B4TO 1OI7A 5G0TA 2YQ4A 4TVBA 3ZI0A 4DMMA 4NK4A 2BI8A 1E3WB 3EGOA 1LBEA 1Q1NA 3GDGA 3DZJA 2Z95A 5CPBA 5B4TA 3VH4A 1CJCA 1PZHA 3H2SA 4CM5A 5AXCA 3EC7A 3PYLA 4ALKA 3ZU3A 4KUGA 2DLDA 3GOHA 5DBIA 4D7AA 6ADHA 1VC2A 4W9NA 3HDQA 1PR9A 3DHYA 3U4DA 1YOVB 4RVFA 1P3DA 4DLLA 3GRKA 4GVXA 5CG1A 3A9WA 4G81A 4D0SA 2FMUA 4QO7A 1UP4A 5TNXA 5DOZA 3I3OA 1A5ZA 3RUIA 4FGSA 1PL8A 3PLRA 5K9ZA 1X7HA 3IOYA 3ZU5A 4F45A 1LA2A 1PJLA 5I7FA 2V6MA 3B6ZA 2DUWA 3BMCA 3BHJA 2NU8A 1O9BA 1YONA 4KZPA 2WMDA 3HE3A 1VL0A 1N7GA 3IL2A 1RM0A 2Q3EA 1LSJA 3FSRA 1BVRA 4GX5A 4CMIB 2NQTA 3G3EA 5JNLA 2EERA 2EHDA 3KYDB 4IIUA 1DAPA 3FTNA 1N2SA 2DT5A 4OSOA 1QR6A 3C7DB 4L8VA 4J0FA 5G0VA 2HMSA 1BDBA 4D44A 3A06A 3DZKA 2YHUA 1ORRA 4CQMA 4WOJA 2D5CA 1C0IA 3ORFA 1IE3A 1ZCJA 3RBVA 4Z9XA 2I3AA 1R4MB 1H2BA 4M8SA 3A14A 2NU9A 4XQGA 1FF9A 1CERA 1X1EA 1Y81A 3PJEA 1MC4A 4U5QA 3QJ5A 2Q2WA 3MJTA 4PZEA 3VZSA 2Y05A 5M6DA 1OC4A 3WGGA 2DU8A 1DLJA 2GGSA 1NTOA 3WYEA 2X5OA 1DEHA 2DAPA 2VYVA 4PGFA 1P77A 3TQHA 1KS9A 4WCFA 3RUCA 3FPCA 4LCEA
chains in the Genus database with same CATH superfamily
3F6YA 1Y1QA 2GAIA 2PMWB 3EEBA 1I8TA 3QG1A 4LV5B 2OYCA 3ONWA 4UU8A 1DPGA 4MUYA 1S7GA 3LQQA 2ZB7A 1ODIA 2FSPA 5KYTA 4TQUS 3KBOA 4M88A 1OXBB 3EEFA 3Q2KA 1U0EA 3DOUA 1A8SA 3W8DA 3UW3A 4ICIA 4R6XA 1FNDA 3GGJA 1A1SA 4ZVLA 4E94A 2UXBB 4IX9A 4RH3A 1OH7A 1VLQA 1RHUA 2WA1A 5KYXB 1RXEA 3CRNA 5CIYA 1AUQA 4ZJPA 2YWDA 4PR0A 4R5HA 1LB1B 1CVRA 1N9ZA 3FAKA 3V00A 4IKEA 3ZV4A 3LUDA 1VPWA 4QASA 1VHLA 4YJDA 3BCUA 4R9UC 3PC4A 3CVXA 1SEVA 3EB9A 4XYMA 2OG1A 2D2EA 4AN0A 3GDFA 4TV8B 4XFDA 2B5VA 2Q2VA 4BX8A 5EMMA 4RFSB 2LIPA 1E6UA 1VZ2A 2GJKA 3ZDXB 1PR3A 5I7VA 3WLLA 3ZNOA 1CEQA 4MEAA 3H5RA 2WWWA 4ZODA 1EVYA 4DLSA 1YVRA 3LSYA 3WJ1A 4RTSA 3V4OA 4JL6A 4Z4CA 1KPIA 5JAPA 4DHEA 3D81A 3OZDA 3OPXA 3GRPA 2VPXA 3OZAA 3F2VA 1N2CB 3GX1A 2G76A 3PXUA 1XAIA 4XB1A 3N8DA 1BMFA 4OQEA 1TB4A 2VNSA 1CE8A 4D43A 3ZBPA 1STOA 1QHFA 1R0RE 2CD9A 5H4GA 1TVCA 5L9AA 2R1UA 4IP0A 3EQ9A 1O95C 2W6PA 4YJHB 2DBQA 3HGTA 5EPUA 4CBVA 3W6OA 4E2XA 2WJGA 1TAUA 3TB6A 5LYJA 1XDBA 4OXXA 4DSOA 1UPFA 1KZYC 1P9NA 2WZDA 4QDOA 1UXIA 1IPFA 3DLAA 3NHPA 3TIFA 4ZZIA 3LC1O 5U1PA 5JAMA 1CQIA 5ALOA 4G97A 4JXJA 4QQ8A 3BH0A 4EGCB 4XSHA 5K8UA 2QLTA 2BFFB 4BWYA 4W9MC 5DYIA 4ARAA 5KNBD 4Q21A 1IC6A 1P3Y1 1UBHS 5L4NA 1DELA 1QVZA 2Z56A 4TKMA 3IDZA 5DP1A 1C1DA 2X8JA 1ZSYA 3CR7A 2PUGA 3HJUA 4LYFA 4EB6B 2J3KA 2V3WA 3F97A 4JLOA 4ZCMA 4XKJA 3VJRA 3K5HA 4E33A 1TVKB 2YYAA 4FU0A 1V5IA 2AR9A 1OYVA 1RWWA 4JP2A 3D6MA 4LJ6A 4Z1MD 2BFEB 3FIJA 1M9NA 4AKIA 3WK6A 3A27A 4D42A 1JT9A 1USIA 3G13A 1TQ8A 1XXLA 4JC8A 4KMMA 1KF0A 1DBSA 1SIUA 4UNPA 2E4XA 4UTNA 5ALZA 4JWTA 3RS3A 2WWFA 1ZUNA 3EF3A 2RC5A 4L9RA 1ZZEA 3UK0A 1KO8A 4BLOA 5BXQC 3P94A 1MOQA 1X8XA 3W2TA 2CXUA 4ZRMA 1KEZA 4MUEA 3WQRA 1JFTA 2FNAA 1WPXA 5HRCA 2FUG1 1B73A 1GZ3A 1E1CA 1TQ2A 3A6EA 3C6MA 3EZLA 3GU3A 1RWOA 3H1TA 5AVYA 3WP1B 1E92A 3Q6NA 1LEHA 4MUKA 3UB2A 4HWKA 2HU7A 3L01A 2JFXA 3M6VA 5BN4A 3C24A 1U5BB 1I01A 2PH5A 3KJNA 3Q5DA 3UWDA 4FKMA 4K8RB 1XQYA 4NHOA 4QYMA 1S3IA 3BJIC 2FWBA 2B8JA 3P9SA 5ENZA 3S44A 3JQEA 4NATA 5TIIA 3BD8A 4EB3A 1SZPA 2Z2JA 1GNQA 2ABWA 3FMGA 2FSSA 1P1BA 1LWNA 4Q6BA 3EGXB 4RESA 4N8SA 3VSEA 5K01A 1QQBA 1U0BB 3RCBA 2GBLC 1ZS9A 2ZRQA 3HLKA 4HXGA 4B40A 4BO2A 1SCBA 3KOXA 1CG6A 5FRDA 4AY4A 2QV7A 1EUQA 2PUCA 4KAAA 1YTUA 4H7JA 5DHRA 2ZBEA 5E1DA 2R00A 4OHFA 1YF3A 4NNPA 4U7GA 4ENQA 1MMFB 4GXRA 3W4JA 1F8GA 3IV6A 4G24A 1VE1A 2YZGA 2G0AA 3JPWA 2FPGA 1BCRB 1SJ9A 2IHVA 5IJ9A 2BGGA 1KRXA 2ISSD 3TQSA 1E7YA 4NCKA 1SK8A 1SVWA 2CVHA 4NJMB 5J4HA 4IOKA 3K0SA 3GI1A 2IDKA 3GUYA 1FRZA 1UK6A 2OD7A 4FT4A 4MIYA 4KN6A 2Q5LA 1I2MA 2YIMA 3ELUA 5C1OA 2DJ5A 2HC9A 3PC7A 3FUWA 1B8VA 2A1TS 4F86A 2Q8PA 4CMHA 2XB2A 1KJWA 1LI5A 4V0RA 5AOBA 4OIFA 2B1QA 4OH1A 2GK4A 5DLEA 4WUTA 5C46F 1GR1A 3EULA 2I9KA 3O4IA 3PI6A 4PHHA 1A9YA 2H3EA 5C35A 1UKEA 4MX8A 1ZX1A 5I4BA 3EP6B 2QG9A 4IJ6A 2EYQA 3B3FA 1A4UA 4UD2A 3N3AC 4EDHA 3EPPA 1JE1A 4LXYA 1O6CA 2XMQA 3O21A 5IS2A 3ISJA 5SY4A 1ONPA 2ISCA 3F90A 4I55F 4U7HA 3OQOA 2CVPA 3ZD9A 3DQQA 3HDTA 5EJMA 3WGMA 2HCJB 2EQ5A 2J6HA 1N33B 1Z5GA 3AP2A 1EFKA 1QG4A 4X6LA 3RIGA 4LX0A 3C5WP 2I8AA 1TYZA 1RPZA 1AUVA 2JKYA 4W7HA 3KVNA 2V9CA 1W46A 1I3CA 3L6RA 4YRMA 2C0QA 3E4DA 1X39A 3OZEA 3KXDA 1TU3A 4CRWB 3HYTA 2WJHA 3QLEA 1JQ3A 4II2A 2QWXA 3OY7A 1YHZA 4WKBA 3VPDA 1TO6A 5J23A 3W4KA 2R6GA 2ZUCA 2VNIA 3IA2A 5TJ9A 4FQ5A 3UW1A 4HLDA 3ZIDA 1RCUA 4E32A 3LHDA 2PKQO 3ABSB 4JK3A 4P4SA 3ME5A 5DT2A 4DM4A 4RORA 3GRUA 5JQGA 4DV0B 3KD3A 4BQNA 1CJBA 4PZ9A 3K6KA 1X87A 5A03A 1W581 3R6LA 4UPEA 2XRZA 4B75A 2H7VA 3CZCA 5EZSA 4FIDA 4R68A 3OFJA 1QLWA 2MSNA 5AI8A 3HBNA 3L7BA 4XTRA 5MN5A 1JAXA 5AUNB 1BVHA 2D8AA 2VZ8A 2PRZA 1SAYA 1UDCA 3Q8XB 3EIQA 1LDYA 4BLQA 1D2NA 3W04A 5CFQA 3RSHA 4FDTA 2I4MA 4TMTA 1P61B 5K3BA 2NZ2A 3ENQA 1TAGA 2FFBA 1FVFA 4X8HA 3REQA 1WSWA 4J4BA 3RDPA 1HDZA 1KWKA 1DRUA 1DQRA 3R3WA 5F1PA 3GROA 3PDCA 3DW1X 3HB4X 3PL5A 3T9BA 1R64A 3H1AA 2D2XA 5ALHA 4RPKA 1E8NA 3P52A 3KV1A 1P1HA 3AIKA 2IFTA 3IH5A 3ICEA 1CUVA 3HCRA 2WR8A 1QGDA 1M6WA 4XH9B 1NDQA 1UXHA 2VDWB 1IHDA 1K92A 2ACKA 2TMGA 4OQPA 4Q4DA 3K35A 4IHQA 4PXYA 2NVBA 4J3NA 5JY1A 1PWZA 3JQGB 4ITRC 4Q4HA 5D84A 1JKJB 3ZZ1A 4FQ8A 3N0RA 4ER3A 1JG1A 4YO8A 4REQB 1BC5A 2NXCA 4S1OA 4AIIA 1I7BB 2XNDD 5H1YA 4YMGA 3KPYA 2ZULA 7ABPA 3D3EA 3I9JA 1KXJA 3PEVA 1MF7A 4G63A 4JIGA 3GCWA 1RJWA 4MARA 1C5KA 3I9OA 1XVIA 1MO3A 1BE6A 2ZWPA 3LUBA 4K28A 5E3IA 4A2PA 1JSRA 1OT5A 5DDIP 4TM8A 3U1BA 2D0IA 3U7EB 2X4LA 2ZJ4A 3UJAA 2YZNA 2ODEA 1DJNA 3GL9A 3GP5A 1FFEA 1CK4A 3H7AA 5A5EA 1C7QA 3F7NA 1JALA 1LD3A 2ICAA 4LK3A 4C5BA 3JZDA 2XD4A 2XCUA 4F6CA 1YQUA 4OLFA 2IEIA 2A14A 5HIJA 1E3MA 4ZALA 3S68A 1O87A 4QGSA 1NZJA 5EKUA 2JFQA 1IZ7A 1V95A 3JASA 4TUYF 3ZKAA 1GUDA 3VZQA 2BP7A 1X1CA 4DUGD 4HRYA 2GFHA 4U5XA 4BYMA 1NXQA 4KGXA 2PZ8A 1DIRA 4A03A 2EW2A 1AKVA 3KDSE 2XB9A 4NS1A 3HK2A 1WMFA 2Q3BA 5EN4A 4AJJA 4DB4A 4DNQA 2L69A 1G2PA 2EJVA 3ZVKA 3TQRA 4Z8XA 3JZFA 2H18A 3OPYB 1TJNA 5DCYA 3FG9A 1KI7A 3BZBA 5KS2A 3CN9A 1Z8FA 4FZVA 2VQDA 2A6PA 4ZMSA 2JGAA 3MJRA 1NVFA 2IHZA 2EVWX 2MU1A 4GR4A 4Q18A 4XGQA 4N5NA 4X84A 3UICA 2AMLA 4L2IA 4EDFA 2ZDQA 1DBIA 1XTVA 1L4EA 4FHEA 2GH1A 1FBTA 1XD2B 5JSQA 2G1PA 2AKEA 4EPVA 5NLLA 1U5AA 2NQ8A 2QAGA 3SX0A 3ZHZA 4R81A 1RMYA 3DJFA 3EGDB 4IGKA 421PA 4W1RA 1E9RA 1ZD2P 2H4XA 3DC2A 1RMQA 4AX8A 4MW4A 3HZOA 1Q21A 2QKYA 3Q7QA 2ZRGA 2EDAA 5MGBA 4TLAA 3VR2D 3TR5A 4DMFA 1N2OA 1MXHA 4D3XA 1YZHA 4ZC1A 4EI2A 2YYYA 4IEIA 3L0BA 1TYDE 2FR8A 2I80A 4BFWA 4LBYA 4RTLA 2VUTA 3K0AB 3OHMA 2VKQA 2VSOA 1NE7A 4GOKA 4W1SA 5G53C 1BQ4A 2P68A 5J40A 1WMDA 1ZC4A 4YRSA 2F3PA 4ID3A 2CFTA 5HKOA 3MZ0A 3DXZA 1OTYA 4V38A 5E4FA 4MUFA 1L1FA 2HLDD 1OV6A 1QUEA 4WBNF 5CIQA 4PTZA 2I2AA 3C4VA 2OGTA 4KQWA 4A3SA 1IWOA 1MAAA 3WA6A 1L4LA 3VVMA 2JD1A 4G56A 2P2NA 4DR6B 4AK9A 2W7TA 3WMXA 1M6VA 5JMOA 3BA6A 1V5FA 1R12A 3NPAA 2GM3A 3IX7A 4F4IA 5KTYA 3DAGA 4Q39A 1VYHA 4MROA 4B76A 1REQB 3U0VA 4UQPA 5GIPE 3CNNA 1PQUA 1PNTA 3QHAA 4E3WA 1CQWA 3EIOA 1EE1A 1KOFA 1NYRA 2PGLA 3KAJA 3OZCA 3GGPA 2CMHA 3TTSA 2OZKA 2VRCD 1XN4A 2Q5QA 4KQ6A 3L7CA 4FZRA 4V2IA 1GT91 5M2QA 2IX9A 2A9RA 2AG8A 1NBHA 2HA3A 2Q99A 3WGYA 3WK8A 1D1PA 3GBSA 3FFXA 1C9MA 4WGGA 1SC9A 4HNQA 2HCTA 4ZC8A 2I91A 3H9JA 5DTMA 4R1TA 3CN7A 3F8TA 4FR2A 1VKNA 1GFSA 2XNHA 2FG6C 2O0MA 1VM6A 3LHKA 2VP5A 3N2NA 2I6GA 1NUAA 2MSKA 1CHNA 3IAS1 4PG4A 2QRVB 4P3XA 2I1VB 5T8KA 4DG9A 4LXGA 5JTUA 2UXDB 5DI9A 4DJJA 3O84A 4GW3A 4A8JA 2I4LA 1QP8A 1M1YB 2X0KA 5CR9A 4I36A 2QB5A 2ETVA 4S0XA 2QPLA 4DL9A 1NN0A 2PUBA 1FFDA 1J09A 1YE5A 3TQCA 5JFTA 4FFWA 4AF6A 2V6GA 3FI9A 4G0PA 3Q6MA 4DG8A 4DQKA 4C5AA 2G9VA 5AW7A 2R1TB 3AIOA 4ZQFA 2IIPA 2EGUA 3G7NA 4WPGA 1ZA2A 1P7YA 1VMKA 2BGIA 1GRCA 1FMLA 3D3KA 3VDQA 2B5OA 4KWHA 3HYLA 3ZXYA 4AKHA 3U40A 1QV6A 1D2GA 3JQ7B 3OE7D 4W9NC 2O7SA 1M2NA 4EARA 4E46A 3RFFA 3ZZMA 2CZCA 1QVVA 3A4VA 4NZPA 2W8BA 4P7KA 3VYSB 4ITUA 5A5FA 3FR8A 5EHIA 4Q01A 3VR1A 2O54A 2CHVA 3W77A 5FBWB 4YI3A 2NO7A 2E48A 2YWHA 1N2BA 3K4QA 3ROGA 4WN9B 3SZLA 3ANXA 3PRKE 1ZVMA 2ZIWB 1MJGM 1JDZA 1X92A 1Z22A 4A5SA 1GAWA 2VPIA 3U17A 2GYVA 4RKWA 2WMYA 1GGKA 3PGKA 1XNGA 2CDCA 3BL8A 4WZBA 3EGVA 4IXMA 1PJQA 4BRWA 5TPZD 4ZEVA 5T3YA 4RVDA 2M6RA 5DGCA 1L5NA 4PG8A 2JRLA 4YJFB 2QX9A 1U7TA 3P19A 3KVRA 1EP9A 3TSOA 4DC9A 2OHXA 3GJTA 3RVOA 1IBKB 2YYSA 1DSSG 1T3TA 1P8JA 4BB6A 5YASA 2NNLD 2VRWA 2ECFA 3PCXA 5G4LA 3DDUA 2C4KA 2I2BA 2EXXA 1PLLA 4KXUA 4PAMA 4UFOA 4ZEOA 2J3EA 1AKUA 3VU1A 4DDMA 3I3SR 4G0OA 3HCWA 1PQ4A 2VA9A 3G5AA 2Z6QA 2BM0A 3NHYA 4MQFA 3RKUA 2P1DA 4AZVA 1YK1A 1Z12A 2BFAA 2QYSA 3NBFA 4NJOA 4UBNA 1FVHA 1C1XA 1QS0A 2IPXA 4YRCA 4FBLA 5F7JA 5AVKA 1A9OA 1V8OA 2GYWA 3PKIA 4AJHA 3JQ6A 1TUBB 1TTHA 1Q11A 3PUYA 4UREA 3DWIA 2CXXA 2QZZA 4OBEA 1EM8B 5THXA 4F3NA 1C3JA 3FYUB 1DJMA 1QGYA 3UC5A 2AOVA 3AXTA 1JJVA 3DJYA 4EVIA 1T9HA 3FZNA 3LT2A 2ZE5A 4A0FA 1KI3A 4LJKA 1W0KD 1DV2A 1BVYF 2FSVA 2I2FA 2KM1A 4TSFD 3HXKA 1G19A 4HGOA 4NBVA 5CTAA 3BMNB 5FLYA 3VR4D 5HPYB 3QY9A 3QOWA 5LMCA 4TTRA 4RENA 4US2R 3TTWA 5FTLA 4I50A 2XCOA 3L0OA 2A5GA 4XR4A 4KE8A 5IDYA 2P2ZA 4OHOA 4ZWNA 4CIBA 2QTVB 2IXGA 4OV6B 1T5LA 1FFSA 2F1OA 1P2UA 3HWWA 4IFEA 3KQQA 1VGQA 4MICA 4OUDB 4W5WA 5DW3A 3E1SA 2F8SA 1SBHA 1EMDA 2CWDA 2C5GA 3UJBA 3AOGA 1N1EA 5BWCA 4C88A 3SJBA 1ND6A 3QKSA 1N0UA 2AMYA 4KXXA 4U8GA 3WYFA 2RI1A 1FDOA 9ATCA 3LVRE 2FZWA 3LGXA 3VPGA 1MW9X 4D96A 1NF9A 3IRVA 2PT6A 4I55B 3BIJA 1GP2A 1T5TA 1WUKS 5E95A 2J9FB 1DMSA 3L4EA 1B76A 4CTMA 2AXNA 4EP1A 2KPOA 3A4TA 2M1ZA 1K4YA 3V1NA 3KL2A 3ZHBA 5J2UF 5EXSA 1AKNA 1R10A 1U0LA 2WRZA 2JH8A 3PDIB 4BFLA 5ICEA 1Y8CA 3TLGB 2H07A 3ZIAD 1WV1A 3OEYA 2ZROA 3FNQA 2YWFA 4KGDA 4Q4LA 5D3KA 3PQ2A 3TM5A 5KWEA 1T35A 1TXGA 3H16A 3U3XA 4MVJM 1ZQ1A 1XJWA 1ZAKA 1Z25A 2PX3A 2RHHA 2Y4OA 5DN9A 4IQGA 3VX4A 4FMBB 3FMVA 2WFAA 3OJLA 2UVDA 4MJLA 1N1MA 3GCGA 4PYOA 4F4CA 4B7CA 5GZ1A 4C4RA 4JLJA 2QVZX 1K89A 5KCMA 4K9RA 4F4UA 4H7EA 3TTUA 1ODCA 2FRDA 4LAFA 1MO4A 3PNBA 5HYVA 2BHRA 1ZMXA 4MYHA 1X19A 3QWAA 2YVUA 1TK9A 2ET6A 4F1JA 3DT6A 1ZMBA 4R83A 2O2IA 3NEPX 1J8FA 1ZCZA 4O4LF 4MR8A 4OOEA 2G6BA 3HJCA 3C87A 2ST1A 1QX4A 1RP1A 4LZOA 3VKVA 4O8ZA 2Y6UA 2JBWA 3OM1A 4XWOA 1BJKA 1NVEA 1Q3HA 2J3HA 2RGCA 3G59A 1VJGA 3JQBA 1ZH6A 5D51S 1K0FA 1SY7A 3EAQA 4HWSA 3WG9A 5DV9A 1H4TA 3GW8A 3NJRA 4EMTA 1CRPA 5EQTA 4YC7A 4EUFA 2HB6A 3M6UA 3BXXA 1U6IA 3Q88A 3SMVA 1I7PA 4WLVA 1NGSA 2XAUA 3D8TA 3WS7A 4PLWA 1H05A 1SC3A 3CLRD 5A3JA 1PJZA 3OX1A 3KZCA 3BTOA 2WG1A 1C29B 2YRFA 1YV9A 1QK3A 1ZFNA 4KQ9A 5JNVA 4C0AC 4PAWA 5TMBA 3A2MA 2CDAA 1G59A 4GL4A 1HX7A 4PNPA 2AZTA 1TQ6A 2OCIA 1DAEA 4WE3A 4NYMR 6YASA 5CD9A 3ETEA 3D3QA 1ZK3A 4ZT3A 1CSEE 1S2IA 2QDXA 2FMIA 4JLWA 1MAHA 5J5AA 3UH1A 5KTNA 3SFZA 1R9JA 16PKA 5TX7A 3NHLA 2PUWA 1S2LA 3OOWA 4WBXC 2DC1A 4EUSA 2BKAA 1GUBA 1EA5A 2JVJA 4DNOA 3D9QX 1F51E 4E4YA 3KXLA 5I7OA 1ITZA 1UF9A 4O2LA 1UMBA 3HN7A 3IOBA 1U0NA 3HVUA 4HMOA 2JFZA 3T5GA 3NHSA 5EHZA 1ZHHA 4K05A 5BN1A 2VJPA 3DDNA 4IY1A 1HBJA 1WSAA 4OHZA 2Q2QA 3SZGA 1XE3A 3ZZNA 1DARA 3DLHA 2I03A 2J9GA 1KPGA 4TZKA 3TL6A 3E5MA 2NU7B 3FWHA 1YR2A 1HA3A 2ZTUA 3H9UA 2PA3A 3G2LA 4LOJA 4DF3A 5HIAA 3D8NA 4RVCA 3SNKA 3ZD6A 5IM4A 2AFHB 4HBGA 1Z6YA 1RIIA 2IYXA 4IDCA 3V2HA 1HI9A 3EBOA 4ZOCA 1P6XA 1Y9DA 1E32A 2CFCA 2NG1A 3NALA 4X54A 4J6EA 3ROEA 1U90A 2E85A 4BEJA 3W5BA 3GLHE 1QMGA 2QORA 2O2XA 3A1DA 3EFHA 4FGZA 4K9DA 1GKLA 4WT7A 5EE5B 3UUWA 5FFMA 1RQ2A 2PM8A 4WIAA 1WCIA 4KAFA 4WXEA 5AI6A 2B4QA 4BRUA 2P9TA 3QFCA 4R2MA 3RIEA 4TVKA 1ODJA 4Q00A 4QBKA 3WVNA 1WHSA 4O5AA 4JR2A 4H2DA 2R1VB 3I34X 1K08A 3WYBA 3WLPA 3NBXX 3RE1A 4N5LA 4HFRA 1V7PC 4CM9A 3B20A 5DYYA 4A0HA 3EEOA 2XF2A 2WJVA 2OM6A 2R00C 4WXPA 2ORED 2AQKA 4P0PB 4G1BA 4OFXA 5FWYB 3X1ZA 2AZXA 4MIOA 1NY5A 3OQIB 4RJJA 5KMGA 1MABA 1NF2A 1RJEA 1ZSNA 3LBHA 5EXPA 2FPIA 2FV8A 2HA4A 3ZE0B 3VPSA 4ZYYA 3M4ZA 1PZXA 1WTCA 4LDQA 4XYEA 3COZA 2CYBA 4EYGA 1SH7A 4PAQA 1XJ0A 5ES4B 3W4IA 4C4SA 2VQ6A 4GPIB 3LF1A 2JLUA 1ECGA 3OKAA 4BATA 2RGDA 4L5YA 3DHVA 1T4DA 4AJIA 5DM70 5L3SB 1E7MA 4TYQA 3IPRA 2ZR7A 2RGUA 4IOLA 3LF2A 1JEAA 3EVGA 3SYLA 2YOGA 4EAAA 1K4KA 2P7HA 3TOSA 2GCOB 3KHKA 4BXOA 4K9MA 3VH2A 5BWNA 4W8GA 2D8MA 1VE9A 5ITSA 5BNIA 2GJ9A 1FA9A 4JFRA 2FQ1A 3G0GA 3L06A 3FLBA 3HY3A 3EW9A 4CW7A 2NU8B 3QPDA 3UB4A 2SCUB 5DGXA 5KCZA 3T3GA 4AUMA 2I8CA 5THQA 1R9GA 4QJ5A 5DNAA 4AMVA 5FHRA 2XRMA 3R0IA 1NURA 1EAMA 4NENB 4KXNA 3D6FA 4UUAA 3BRWD 2I76A 2XODA 4A6XA 1O94D 4GZ3A 4TV9A 5FL7A 1SZJG 2Q27A 3CGWA 4I5DA 2VCEA 2OV3A 4EG6A 1IDN1 5HF9A 1SUDA 2NUAA 1Y8QA 2WWIA 3GA0A 2VJMA 1FDSA 3PWSA 1W25A 1Q77A 3HBMA 1XUOA 1ABEA 3MWYW 3BMQB 4WLOA 4Z54A 1HE5A 5B7GA 2RE8A 1LWOA 1ICEA 1WHTB 2GKOA 3WRVA 4ESVA 5IVIA 4BQQA 3PUVA 1ESEA 3STVA 4N7RA 3BA1A 3GA7A 2DSNA 3KKZA 4QBFA 4RK1A 4A8PA 5BYKA 4BKUA 5AM1A 4RGQA 5G0UA 4K6GA 4KQ1A 1FJXA 3RC7A 3QE3A 3CLSD 3CLHA 3LW8A 4JSYA 1RACA 4JJ4A 3TAUA 2IHJA 3UAVA 2F00A 4N6OA 5C1BA 4I9NA 1R1DA 3AKYA 3BD9A 4FYWA 1AGPA 3IWCB 5C37A 3KT6A 3T99A 2P69A 1YS6A 5GM2A 3MGKA 4MI6A 1M2HA 1SWWA 1RWNA 4LFAB 2B35A 3LY7A 4P2BA 3F74A 2BN4A 4CL3A 1BDIA 5AKXA 2LWIA 4ZCQA 3BH6A 5BSTA 3TZ6A 3DWEX 3HKDB 5DE3A 1H65A 1VBNA 5EI5A 2Y99A 1OLOA 1Q1QA 4ZOAA 5REQA 3UJCA 4EEZA 5BNWA 1GA4A 3IJ5A 3RIXA 1B14A 1NF8A 1DE0A 1SCIA 4TRRA 2HSDA 3AVUA 1MRNA 3D7KA 1ISSA 2F8LA 3R7WB 2C2XA 3BJRA 1TJYA 3IUJA 2AGVA 2DBRA 5C2JB 2YV2A 3IT3A 4DREA 5I4IA 4MQEB 2H4FA 1HDOA 4P4NA 3ZCUA 5JH7A 1K6IA 3HA7A 2QVCA 3N5KA 3U5ZB 5G3ZA 4NZYA 4BAZA 5KYUB 2QZPA 3QUSA 3WLRA 4I1UA 4DRXB 1L5YA 4QELA 1RM5A 1AN9A 1BWQA 3PIIA 1OI4A 1GTZA 3I1IA 5IANA 1UOQA 1LVGA 4KPFC 3RVLA 4FJ2A 3FHOA 3ZCXA 5AKJA 1EA7A 4FFNA 4ZANA 3V8EA 4CMGA 2EFYA 5L3RA 2WTAA 3N70A 2I2CA 1ZA1A 3LFTA 5HQTA 1FMFA 1KK1A 2VEDA 4DM3A 1Y7HA 3VMMA 4MKXA 3HNOA 1QMIA 1DEOA 3NIGB 1TT5A 3FCCA 4HK4A 4N01A 3FD8A 2DFTA 3RO7A 5KWJA 3DTTA 2ASEA 4X1KA 3FNIA 4NYJQ 1K06A 3ZLUA 3IIKA 1Z5ZA 3VV2A 3CT4A 2ZS9A 4WMLA 5JXJA 2OA0A 2BD0A 3ORHA 5FTNA 3FNEA 1PYGA 4Y3UA 2OOSA 3PFNA 2GNAA 2OUKA 1B41A 2Q46A 1E2BA 2A1IA 5E6SA 4Q03A 3UCEA 1AZWA 3CCCA 3KOUA 4JB3A 4LV6A 3ZU4A 3CVVA 3LX4A 3N8NA 1BA3A 4X63A 3SPXA 1LLDA 2ZDHA 1JR3D 2RHWA 3EVTA 2YCLA 2WKWA 3C74A 1NY6A 1WABA 4I2VA 2OR3A 1YZGA 2IUUA 1T9KA 5LXTA 3R3YA 1RFGE 5FLEX 4KR2A 2E1PA 5CCEA 4B4KA 1KP9A 2FQQA 1P4GA 4IHAA 1TMKA 4DEYA 2JAWA 2JJ1A 4B3GA 1V8ZA 4DRZA 3DCIA 4YN3A 3TBKA 5BNTA 3C39A 2HBYA 4TN5A 3JQAD 5FP0A 2NTNA 1M74A 2OD2A 5FPQA 4KPUB 2ES4A 4B17A 4PYMA 2IY7A 3UH0A 4QJ4A 1GNSA 1Y9AA 2BTOA 1M7BA 3UT5B 1KTIA 2GZMA 2VHQA 3FBWA 1BKSB 2QAGC 1JU3A 3EP7B 5A06A 2ALJA 4LZWA 1F5NA 3LLVA 4O33A 3QEOA 2HIAA 2VDUE 4DLBA 4Q1BA 3E15A 1J7JA 4B7AA 3UAYA 4CN8A 1FUUA 1B3BA 1Z2CA 3CBGA 3QIAA 1ZUNB 3O1JC 1WZIA 1J1UA 3A8TA 4BZWA 2AB0A 2RI6A 4G4JA 2Q4OA 1E1QA 2FR8C 5IUJC 1VHDA 4B74A 1YS7A 2RONA 3BH7A 4D9HA 2GPBA 4TS9A 2R8YA 4ALJA 5HKKD 5IKOA 2DWQA 4ZI7F 1V35A 3AUAA 1V3QE 2IGTA 2YJGA 4NMWA 4YAKA 5IDQA 1IZ0A 2ZRBA 2W6OA 5BN4B 1CS4C 4KSCA 3SJCA 2W6ZA 2VLIA 3A32A 1AKQA 2P9FA 1OILA 3VHXA 4EPRA 1T34A 4YYZA 1TTPB 4JQOA 5DHUA 3NBKA 4QQKA 1N8KA 2K6GA 4RF3A 5G1OA 1ZM7A 1XCLA 3LRPA 2XGGA 5J2UB 4EW3A 3PC8A 5M34A 4HDMA 2P0EA 3MS2A 4R2WA 5EMKA 5IJ0A 4QJBA 1ZNQO 5EJ8A 4Y7CA 5KU1A 4FFLA 4X24A 3TG8A 1P31A 2CSUA 1HG0A 3ET5A 1ORTA 2CNWA 3I9LA 4OIMA 1NSYA 4NFLA 2PGXA 1NJGA 3WGQA 2PX5A 4KYUA 2FEMA 1JMKC 1NWCA 1YJAA 4QLAA 2GASA 4CEJA 4YECA 2DWUA 2BRUA 4BVGA 1C7EA 1XA0A 2JGDA 4KWCA 2OAEA 2ZBDA 2BIFA 3NDIA 2O0LA 3MAGA 4M8LA 2ACWA 3UHAA 3L05A 4L4ZA 2W43A 3V32A 1V6AA 3DMTA 2CNKA 5EP1A 3Q7TA 4L3VA 3TRDA 4N0DA 2V98A 3K5IA 2BFMA 3LX6A 5H70A 4DLKA 5BQXA 4RTMA 3QXGA 4IIJA 4AMBA 3CHYA 3M3HA 4EF6A 5ADWA 1S2DA 1E60A 1ST3A 2J0VA 2HJVA 2ZR0A 4LRYA 2OOKA 4QFCA 5EJ7A 1MB9A 4X6XA 3VM6A 1JLKA 2AW3A 2D4HA 4JT8A 5T8KC 1Q3TA 3BK7A 3NM4A 4NFHA 1FNCA 4TLCA 3SX4A 2JJ2A 4L3OA 3BWVA 1VSQA 4A8JC 3MTBA 3IQIX 3LPLA 4A36A 2NTJA 3LTEA 1LY1A 4O4JF 2PLNA 3I1YA 4IUCS 3FETA 3EASA 4WVFA 1SIOA 1WUIS 3ZOZA 1JAZA 3EP4B 2EKQA 3X1KA 2DT8A 4AZ0A 4JL5A 4QPDA 3JWPA 1KO7A 2ZANA 1HT0A 4YQZA 5DGTA 1W29A 1EUCB 3AJAA 2CJWA 4IGEA 3GRVA 5ICCA 3ENWA 4L9WA 4Y6RA 1PJ2A 2QENA 5TJHA 1F4LA 3ESRA 1UOPA 3GJ4A 2WOJA 4PLPA 2APJA 1R3UA 3KPVA 1K98A 1NW3A 3G2KA 1X0XA 2HWYA 4OF4A 3M34A 3S40A 2GLTA 5AIBA 2FW9A 4BO9A 1WO8A 2BKVA 3HCDA 4YJKA 2EKZA 2C9MA 3IBCA 1MQ9A 1S01A 2CLFB 2GBCA 4MTCA 3K9FC 3TCKA 1LPMA 5K05A 5L3QA 4JC0A 5ALEA 5AVVA 4RE5A 2QVLA 4P4SB 4FD3A 1OFTA 4CKZA 5F7XA 1X1BA 2RB5A 3TKYA 4EJ0A 4RMGA 5D85A 4ROSA 3N2KB 3VISA 2J9XB 3IE0A 3TOXA 4AUNA 4EBBA 3QYFA 3RODA 2C4NA 2J9YB 1OFGA 4D9KA 5KYKA 5F4BA 3ZYZA 1PW7A 1Y3BE 3NTUA 3Q5GA 4EA6A 2XNKA 2H4YA 2JIZA 3AESB 2F1KA 3A7EA 3R44A 1TPZA 4Y67A 5HUHA 4OP3A 1DOHA 4FN5A 3B12A 1GGFA 3IKVA 5JC8A 2IUYA 4I3FA 1A72A 4L85A 5GTDA 2Q3DA 2VZ0A 4WOPA 3UK2A 4JUCA 3REQB 5A3RA 4XIFA 2FOIA 3KYBA 5K5EA 5T7BA 4LF6B 3O47A 5BRNA 2A9JA 2OHVA 4N3BA 1C4WA 4XJSA 5AK5A 2NYVA 3VC2A 4UTOA 1L5MA 2CDNA 5KQGA 3AKDA 1S3GA 4C4ZA 2YHAA 1IUPA 1YBHA 4QHSA 3NWPA 4LZAA 3VAAA 1MD9A 5FBHA 1S8NA 2AC4A 3PNOA 1AV7A 3UAZA 4UUPA 4L3WA 3GLFE 1G7TA 5GV8A 2Z1MA 2JGRA 4LZJA 4LXHA 3B6IA 4XCVA 3W7AA 4C7JA 1SEPA 1GGVA 5LSAA 1GGJA 1FXWA 3LYUA 1QCYA 5SYNA 2PSJA 1Z74A 2Q29A 2QW1A 2W6IA 4G5FA 1G60A 4Q4HB 5D5HA 5TQ0B 1KHTA 1SPXA 3CVUA 2FSVC 3KZOA 4HV4A 2W2MA 1DHRA 1M73E 5IMSA 4RPHA 2IU3A 1NDUA 2YWRA 5KI6A 3R0VA 2DWPA 3P0RA 3UJ9A 3ZJVA 5LBIA 5M29A 1N7JA 1DKPA 1OBCA 3D4IA 3O8BA 4BMOB 3OWHA 4GBGA 1G3RA 1TI7A 3WGVA 5C18A 1O8BA 2J0UA 5K3AA 1CLEA 4DCNA 5JALA 3HXPA 3M3DA 1J8MF 1UBNA 5KSZA 3CNBA 3LKZA 5JSYA 3ENZA 1ZHOA 4WNCA 1LBHA 5KQLA 1HFJA 2Q5OA 4BX9A 3WDLA 4FSDA 3OPQA 1C50A 1SUCA 2O7NA 2ZWMA 1CUJA 3L8ZA 2HQOA 2PH7A 4QKQA 2QTNA 5J4KA 4BMVA 1S3SA 4PXAA 3RC3A 3VVCA 2UUOA 2QRGA 3X1MA 4AJ9A 4AVYA 2KYRA 1WNTA 2CZGA 2WYOA 1IEXA 3IQWA 1U0HC 1KIMA 3QF4B 4HQRA 2YWGA 4INJA 3KKNA 1IL0A 2COUA 2SKEA 2P1ZA 4HN9A 4Z9BA 2WPDA 3N6VA 5FAXA 2DE0X 1CUUA 3VGJA 1W7AA 3I2KA 4MYUA 1XEFA 4FCCA 1OX6A 3IJRA 3UJ6A 4C7OA 4G5QA 3V8NA 4QA9A 2VHJA 3TDMA 3IPXA 3DAPA 4F04A 5DYWA 4HAVA 3Q0IA 1CC1S 4Q12A 3FUUA 4NRDA 4YBRA 1CNEA 2COKA 2VYQA 1R8JA 4ZVOA 2AMJA 3RYTC 4CCYA 3D0KA 3IE2A 3U7GA 2XSZD 4ZQBA 2PMDA 1UJ6A 2FRDC 3MELA 1K27A 2FQWA 3QX8A 3F96A 4QTUB 2HF7A 3OE4A 2EW8A 3JVVA 3ZS9A 5EGSA 5HTKA 1RJ9A 1EH5A 4Q3BA 1T3HA 1QIJA 2QAGB 4UXHA 5IZ4A 4ALIA 1ZM3A 4DWOA 4OHVA 5BVHB 2OFOA 4B1FA 3LVBA 4G5SA 4QT0A 1Q5PA 1JN0A 2IKQA 1CNFA 7GPBA 1PZMA 4O1HA 1CUDA 5DYTA 2V3VA 5EJ2A 3RUAA 5FAKA 3RVBA 5CM9C 1IUKA 3S1AA 2Q9CA 2QJRA 1YL7A 1PLKA 1ISPA 5JWRA 2QI9F 1CXZA 2C2HA 3JQBC 2IZ6A 2GZAA 4HG2A 1RZVA 3VDRA 4EFNA 4ME6A 3U80A 1SQFA 1XNJA 4LF8B 2C2KA 3A05A 4PQFA 2C57A 5HFJA 1JB9A 2I4IA 5F2OA 2G70A 2Y66A 2ZP1A 3MCTA 1TEZA 3UJPA 1NN1A 3QQ5A 1BEUB 1UKZA 2FFJA 1E8MA 1ZCFA 2OCBA 4JBLA 4UPVA 5FYQA 2Q49A 3PJFA 5CFNA 3LS2A 3C3XA 1J1IA 1FDRA 1VI2A 2YOHA 4FHFA 4JUAA 1ZI8A 2IS2A 2AX4A 3PQVA 3MXTA 4DJEC 2N75A 1ISFA 2GTIA 2QJOA 2J1LA 4FXOA 3JD0A 2R751 4MRNA 2P3LA 1QP4A 3DZDA 3PK0A 4J1SA 5HG0A 4F8JA 2I34A 3AHJA 4CHTA 1Z2AA 5CRIA 5CB8A 5FA5A 2A0FA 2GOYA 4A0RA 1T36B 3AW8A 4GPEA 2EF0A 3UCFA 3VBEA 5BW6B 1IQRA 2VPPA 1GNPA 4C06A 1GARA 1K6EA 2LDXA 1DAHA 2CHUA 2E37A 2VTKA 1E98A 3T5BA 2QE7A 4HVAA 5AESA 1XJQA 4FEGA 3IBSA 4NONA 4MQUA 1XAGA 3CLUC 5HHTA 5KSOA 2PWAA 2IYQA 3AEUA 4B6SA 4MA0A 4L8FA 1FFXB 4IIFA 5ALUA 5ARDA 3VPCA 1CUIA 1RXVA 3WGHA 5DLPA 2W5UA 4JN6B 4ZI2A 2IYUA 3Q5EA 4EKGA 4G8CA 1JEQB 4BDSA 1EFCA 4UASA 3TL2A 4XXHA 1MG5A 4E5NA 4GMDA 1JZTA 1MGPA 3AKZA 1W6UA 1XMIA 1X86B 3CS3A 4EPTA 3T3IA 3R20A 2FP4A 2Z2ZA 2O5RA 2W2LD 1O5TA 3C43A 1QH8A 2C2GA 4W63A 4OJQA 1QIMA 4EW1A 3D0RA 3UMYA 2PZLA 1ID1A 4HX2A 5AI4A 3VOBA 5EJ4A 2F3UA 4Q7QA 3TEJA 2WAAA 5AVTA 2BDTA 3KJFA 2G9NA 4J2HA 4WBSA 1GPAA 4AWXA 4YHBA 3GLGB 4Q3CA 5LU9A 3OLCX 1T2VA 4MB2A 2FDCA 3THXA 1HM5A 2AHOA 3C48A 4KV7A 4C04A 5B2EA 3JAKA 1LPNA 2C3OA 3WWOA 1JWBB 5IU6A 4PINA 3TF5A 4RACA 4AG6A 3BFXA 2XIJA 1F17A 5HDBB 2OV4A 3TQTA 4F60A 4U6QA 2ORYA 5KJEA 4ZK6A 3CRW1 3C8HA 4NU6A 2OUIA 1EUZA 1KH3A 1UCFA 1VP9A 4GI1A 2BTQB 3EWNA 3L7JA 4AYTA 2DQKA 5C4GB 2WIBA 4NOKA 4RTRA 5BV2P 4WACA 4LDRA 5A7HA 1J33A 1SBCA 4A6DA 4FGWA 5JS7A 1Q0SA 3W6NA 4K6OA 5AW6A 4YASA 5DEIA 4TKVA 5EEGA 1OW3B 3DE1X 3GN2A 4YYEA 4HDRB 1FSFA 4PIVA 4UE6A 1RPTA 2WUVA 5KB3A 3BFVA 4AL4A 3BT7A 2ZR9A 3MIIA 4N65A 4DIFA 2P62A 2BHLA 1ULUA 4WZBB 3P26A 1NYQA 2HXGA 4I5EA 1PZGA 4P93A 1U0TA 3AYZB 4KOAA 4LTMA 5AFSA 5GZ6A 1Z37A 2VJBA 3R3JA 2Y4NA 3LM8A 4QT4A 1BQ3A 2YASA 2B2CA 3MOSA 2W2XA 4DAEA 3L0IB 1N6NA 1KFEB 1XTUA 3HWRA 2CEAA 3R1IA 3R6TA 4M7OA 3FGZA 1G6Q1