3V1YA

Crystal structures of glyceraldehyde-3-phosphate dehydrogenase complexes with nad
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
publication title Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
total genus 120
structure length 335
sequence length 335
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2011-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v1yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v1yA01
4RVDA 1T2CA 5CDTA 2UV8A 4I08A 1U8FO 1B3BA 2QYSA 4W99A 3PIIA 4GVXA 3VPHA 4R68A 4XJTA 4IS3A 1H6CA 1ISMA 4FJ1A 3WB9A 3F46A 3WWZA 1A9YA 2Q99A 3W4IA 3VH1A 3HQ4O 3IJRA 4DQUA 3HE3A 4W9NC 4JGBA 3QQPA 2EV9A 4LSWA 5CEFA 1R12A 1GPDG 2JJYA 3IUPA 4GH5A 4B4WA 4CQLA 3C8MA 3EHEA 4FSHA 4GMFA 3TZKA 1N9GA 1HZJA 1I24A 4NBUA 1HDZA 3JSAA 1EVJA 3T7EA 4KUEA 5TSDA 1NQTA 3VKVA 1KEUA 4N54A 2GLXA 1J4AA 4J4BA 1K89A 3BHMA 3VZSA 1R4MB 1U5CA 2DM6A 3OECA 3GZNA 4C4OA 3BMQB 2GF2A 4RCVA 2C5AA 4A7PA 5L4NA 3IDSA 4NIMA 2B4TO 4BNJA 5F5NA 3PJGA 4YJHB 3TRIA 3BYZA 3OF2A 4PLHA 3GFGA 3DMTC 1RYEA 3Q0EA 4YAIA 3JYQA 4KDEA 2C2XA 3RC7A 1O89A 4I5FA 4CUKA 4NK4A 4PZDA 3ZU5A 1I8TA 2AMFA 1MC4A 4CM4B 3LT0A 1SC6A 3U62A 3CMMA 4ALJA 1JKIA 1I3NA 1P1JA 2YYYA 4M89A 5I9LA 4G81A 1TLTA 4QX6A 2AA3A 1IZ0A 4OAQA 3K2EA 3DAPA 4E6PA 3K8ZA 4GLLA 2O23A 2P4HX 4NR0A 4CV1A 1H6AA 1IE3A 1SEPA 4GX1A 3PHHA 5IG2A 3E82A 4YWJA 1NQ5A 4JN6B 3HG7A 5DBIA 2GRAA 3GGOA 1ISHA 3I5MA 1U2GA 4ESOA 4DQXA 2B36A 2Y93A 3ZHYA 4B4OA 1GEGA 4CMGA 3TZ6A 5FI5A 2A9FA 1E7YA 1YOVA 1E7RA 2HK9A 2WYWA 4U8GA 1VI2A 4KTTE 2IZZA 4Q3NA 3KV3O 5T57A 1E0DA 1V3UA 4D46A 3JQAB 5I7SA 3DAFA 1T25A 1F17A 1E7SA 3GY0A 3F4LA 4MIYA 1DHRA 1QRRA 1E7MA 2FMUA 2QG4A 2YDXA 2Q1TA 1GYQA 1VPDA 1TB4A 5TC4A 5G0TA 4G2NA 4HP8A 2ZB7A 2AE2A 1AXEA 2HO5A 1GQQA 4YPOA 3WG9A 5HM8A 1VC2A 2VT2A 5DZSA 3PGJA 5LDHA 3GNTA 1GZ3A 4E4YA 2ZTLA 3WX0A 3ITKA 4E3ZA 4L4RA 3T7CA 2ZQZA 4XZ3A 1Q0LA 2WMDA 5MDHA 2IXBA 3FNGA 2R00C 4IMPA 3WJAA 4XJSA 1C1DB 1PJQA 1H9BA 4XGNA 1B7GO 1ULSA 4D79A 1KEPA 4NH4A 3U9LA 4OHUA 3TOXA 1SBYA 4WUVA 3KHUA 4Y9DA 4ALKA 5CEJA 2JFHA 1DC5A 1HDRA 4IDFA 2JAHA 2BFAA 1ZK3A 3C24A 3P5SA 2NU8A 3SJ7A 1PGQA 3W6UA 4Y6SA 1ADBA 2QX7A 1KEWA 3E8XA 3LT2A 4UUMA 4XYGA 4Q9NA 2DKNA 2G5CA 4MP8A 4NDNE 1G0NA 2DPHA 4IGEA 3LZ6A 3TDKA 3IP3A 5EIOA 1SAYA 4ZD6A 3K6JA 1DJQA 4EBFA 2X0JA 2YFQA 2AQKA 1P0FA 4RPLA 4UAGA 4PLYA 4DUPA 2PD6A 2Y0CA 3FNEA 5ILGA 4UUOA 2NU9A 4Z9FA 1ZW1A 4K6FA 3O26A 2FHSA 4M8SA 2PWZA 3BMCA 5DCYA 2WTBA 1GYRA 3FBTA 4OSOA 1QYCA 1ZJZA 2VHVA 4PG6A 4UREA 3U0BA 4MO2A 5C7IO 4XYLA 1B8PA 2DLDA 1DRWA 2GR9A 1HE2A 1KIFA 1UAYA 5L4SA 1HYGA 4IY1A 3GT0A 3QW2A 4U0KA 4AJHA 4J7XA 3I83A 3AUSA 3RC9A 1LNQA 1Z45A 2C29D 2UDPA 4E5YA 1UZNA 2CVQA 1Y9AA 1EVIA 1Q7BA 3AY3A 1XELA 4BNYA 1P1KA 3I9JA 5DOVA 1YQGA 3PRJA 1QLJA 3WIDA 3Q2IA 1AHHA 4PN3A 2XXBA 1PJ4A 4J9UE 3GHHA 1VKNA 1QP8A 2ILTA 2OORA 2VWGA 5KJFA 3MJ4A 4OXKA 3SLKA 2EP7A 1FDWA 3O4RA 3WSWA 1UDBA 1UP4A 1PTJA 1B8VA 1ZCJA 5ENVA 3INRA 5IZCA 5AQ1A 4IGFA 1DRUA 2EGHA 2JCXA 2P68A 2P9GA 2WJPA 3KYDA 3WJ7A 1B15A 3VDQA 1P44A 1XYGA 1U1IA 1KVQA 2NTJA 3F5QA 2Y1FA 2P5YA 4TKLA 5AXCA 3OA0A 4YRBA 3CXRA 1YKFA 3HDYA 1UXJA 5JYEA 2HJSA 4NG5A 1PJSA 5F3RA 1F8FA 1DO8A 4XGIA 4EGFA 4H16A 1U7HA 2GZ1A 5JY1A 1WVGA 1UUFA 4RJTA 3QY9A 2JD1A 4NPCA 1CDOA 3ZHBA 2Y05A 4ZGWA 1BWSA 2QHXA 4N5MA 4FGSA 4XYMA 2YQ4A 3QRWA 2HMVA 4AL4A 4D42A 4IQ8A 1K6IA 2BFMA 3JQ7B 4J90A 2IYPA 3HB5X 1W6UA 3FSRA 1VRWA 4WK6A 4BKUA 5KIAA 2X1HA 3JQ8A 1X15A 3KUXA 3NV9A 2GN8A 4XR9A 4XB1A 3FWZA 1DFGA 5A3VA 4J7CA 1FDVA 2OP0A 3L4BC 1QG6A 4JNKA 3GEGA 3PLRA 1TVEA 3UW3A 3W1VA 3D4NA 1B16A 2PZLA 2RHRA 3EVNA 4OMUA 3F5SA 3PQEA 4XGKA 5EJ2A 3KO8A 1K0UA 4W6ZA 3DXFA 1WLYA 4ZHSA 4WNCA 4E2XA 2WYUA 1HDOA 4CUZA 1EE9A 4I9HA 1GCUA 4MVJP 4L73A 3ZWYA 4W82A 5HTOA 1UXKA 1YQXA 3IS3A 1PX0A 4PG7A 2O7QA 3H9JA 3AOEC 4Q39A 5JFOA 1I30A 1ZIDA 1B3RA 1CEQA 1T26A 3VZPA 3WOHA 5JPIA 1P45A 4C7KA 3RBVA 3S1LA 4IS2A 5A9SB 3DZBA 2ZK7A 5FI3A 4NQZA 4XIYA 4IDCA 4BKRA 3BTVA 4XB2A 4WOJA 2V7PA 1Y5MA 3HDJA 1PZGA 5L40A 3M2PA 4BNVA 2WD7B 2H6EA 3IL2A 1I5RA 1TT7A 2NADA 1P3DA 2G1UA 4IUYA 4XRRA 1E77A 4QQRA 1YB1A 5H81A 1O6ZA 4BNNA 4W7IA 2WD8A 1UJMA 4RF5A 4BMNA 3TNLA 5K6AC 3F4BA 2X9GA 3GUCA 2ZJ0A 1CRWG 3ZWAA 1PJTA 4J0EA 4AFNA 5HRUA 1GQYA 4M87A 4FGWA 4UVHA 1SNYA 3PLNA 5G0UA 3OHSX 3H9GA 1AUPA 3RC2A 1BXGA 2PZKA 3H5AA 4CMHA 3E6AA 2ZYGA 4DPMA 3RROA 4IDAA 1YDEA 2ZB8A 1YGYA 3TPCA 1PU2A 1YBMA 1RPNA 3AW9A 5JY6A 3JQDA 1KVTA 2BLLA 3ZV4A 4CR7A 3B70A 4F46A 1VJTA 5CDYA 1W73A 4J0FA 2X0RA 2BH9A 4BVAA 3H5NA 1PSDA 5DCUA 1RM5A 2Q49A 3IJPA 2YHIB 1U2DA 2ET6A 1X0VA 5HA5A 1R4NA 4NBRA 5F1PA 1X7HA 4E2YA 4O5OA 4MVJD 1I3LA 4WGGA 2GYYA 1R66A 4BKPA 4PRLA 2HU2A 1PIWA 5AXDA 6ADHA 2P9CA 1JTVA 2AW5A 2PH3A 5B1YA 3B20A 1XA0A 2D4AA 2VTDA 4BO7A 4FS3A 1U7TA 3VDRA 3AU9A 3PP8A 3RKUA 1PR9A 1DLJA 5AVOA 4RDIA 3VOSA 4WKGA 1QV7A 2FP4A 1CQIA 3SBOA 1JQBA 3JQBC 4NJMA 3RASA 2B4QA 4Z9XA 4B3HA 1RM4A 3NJ4A 3WS7A 4NFSA 1AN9A 3EUWA 5HS4A 3FRJA 1SOVA 1IZ9A 2F1KA 1B0AA 2X8LA 1DXYA 4YAJA 4GSKA 4GMGA 4WLEA 3X2EA 5IFLA 5I7VA 2DBRA 2JFFA 1TEHA 4R5HA 3ZCXA 1EUDA 5A1TA 3AY6A 3I4CA 4YT5A 4UUNA 1NXQA 4CLOA 3M1LA 3CH6A 5EL0A 1HEUA 2AG8A 4TSKA 3Q9NA 4QECA 3DWFA 5L7WA 4R1SA 4GAEA 3ZZNA 4IDEA 5JAIA 4BGIA 1LC0A 5K9ZA 2JHFA 4OQZA 5JBIA 2Z95A 1QR6A 2P91A 4DVJA 3NKLA 4P4LA 3T4XA 4WCFA 4DLAA 3E18A 1U9JA 3BMOB 2DU8A 1F14A 3N7UA 3CUKA 3MZ0A 3D5TA 4GI2A 1T4BA 1B8UA 1BHSA 4DLLA 5IN4A 3RUIA 1MG5A 1T24A 4CODB 1P74A 3NDRA 2HMWA 1NP3A 3V1TC 4AJJA 4YBZA 2O3JA 4IZIA 5U1PA 3IP1A 5JW6A 4Z3DA 1N7GA 3DBRA 1ISGA 3JD2A 2CF5A 5TJ9A 4JP3A 4I8XA 4LVCA 1I2CA 2CMDA 2DTXA 3BZUA 3ANLA 1ID1A 4Z0HO 1O9BA 1WNTA 4K1LA 2E49A 4XIJA 3PZBA 1PWXA 1LSUA 2AEJA 2SCUA 4IDBA 4WLUA 2CSUA 3LLSA 5IJZA 4LCEA 2BHLA 1N2SA 3I9LA 4F6LA 5KVQA 3N74A 2BD0A 1DLIA 4DTIA 4QFDA 1IHYA 2EG9A 4E5KA 1N1EA 2VYVA 3JQ9A 4BNXA 5TF4A 2DT5A 2VQ3A 1YONA 2XOXA 3V1UA 5DBFA 3RJ5A 3OJOA 3NRCA 2NQ8A 1VE9A 3C1AA 1EQUA 2JKVA 4BNHA 3KSZO 3OETA 4J4HA 2FOIA 1YDWA 1SMKA 1VM6A 4E5NA 1JDJA 4E12A 1CYDA 3H8VA 3EC7A 3F47A 1W8DA 4HV4A 2C0CA 5T6BA 3QLJA 1H94A 4BO8A 4ZQEA 3PVZA 4TRMA 5C3MA 5JO9A 1GV1A 3TFOA 4B79A 1MG0A 3G0OA 2AQHA 3QWHA 4RGBA 3AM5A 3UICA 4MKZA 1T2AA 1MX3A 3HB4X 4E2WA 4XRGA 5IXYA 2P5UA 3CPSA 3EMKA 4YQZA 2PZJA 4BNWA 3AFMA 4R16A 3SLGA 3ANMA 4M49A 2EKLA 4RV9A 3CE6A 4L4XA 5IDWA 4BOYA 1FK8A 3OJ0A 2I5PO 2V6GA 4CV0A 1ML3A 1HDCA 4R41A 4D45A 4EUHA 4ALNA 3DFZA 3V8BA 4D0SA 2CNBA 4Z3KA 1PGPA 2JAPA 2NLOA 4CM9A 2DQ4A 1O94A 3ZV3A 1LLDA 2Q2WA 2Q46A 5JDCA 5MGBA 1I01A 3G1UA 3R3JA 4XCVA 1Z7BA 2I3AA 1LU9A 3JQGB 5I9NA 5L45A 4LW8A 3B1JA 4PLCA 5CP8A 2PKRA 1HLPA 3WYBA 3IUSA 4MVJI 1GR0A 1T2DA 3WSVA 3WYCA 3LT4A 4H7PA 2W2KB 4J43A 4KWIA 1BRMA 1ENPA 4YJDA 3ZNQA 1JVBA 5KVCA 2OO5A 2C59A 3VC7A 5JYAA 2QRJA 4IDDA 4GL4A 4RPKA 4XYEA 3UXYA 1G6KA 2XAAA 4L75A 3M1AA 4ZVVA 3SX2A 3S2FA 2Q1WA 2UVDA 4RF3A 3RQSA 1Q2XA 1EK6A 3NDIA 1P9LA 1GTMA 1PWZA 3ZWWA 4ITUA 4BO1A 1A27A 2HRZA 2RIRA 1LDGA 1LX6A 4B7XA 3GA0A 1IPEA 1U3UA 3G79A 3O38A 4FBGA 3TN7A 2CVOA 1EE2A 4CLXA 1HYEA 1PL8A 1VJ1A 1HDGO 1IY8A 5TNXA 2Q22A 2VHWA 2BGLA 2DBZA 4L4SA 1NVGA 2VYVD 1Y9EA 3RWBA 1M75A 1AE1A 2Y1GA 1XIVA 4RVFA 4FIZA 4QEDA 4ZU3A 1B26A 3C7DB 3IOYA 3MCVA 4XKJA 3MJTA 4DC0A 3KYBA 4P22A 4XDYA 4E32A 1NFFA 1O0SA 2GGSA 3JYLA 4II3A 4YT8A 3U4CA 3ENKA 1KC3A 1Y8QA 1YBVA 2CD9A 3V2UA 2JFGA 3NAQA 5JAQA 5TX7A 5BSEA 5TLSA 4MIOA 4UVIA 4YT2A 2AQIA 2DAPA 4LCJA 3TJRA 2DPGA 5BSFA 2OFPA 2Q3EA 1PJBA 1PJCA 1BW9A 2GN4A 1ISFA 3JV7A 3UN1A 2CVZA 1A5ZA 2B5VA 3GDGA 1CIVA 1LEHA 5BSHA 3PQFA 1WZIA 5T67A 1P31A 3WTCA 1A9ZA 2X22A 1XLTA 4TRJA 2EP5A 1K6JA 2OP1A 3VH4A 1PZEA 3EYWA 3PWKA 2EW8A 3ZH2A 1N1GA 4ZQFA 1B2LA 2VHXA 2FSVA 3WR5A 5AXAA 2E82A 2YY7A 1WDKA 4RQTA 5L3ZA 2D59A 1C1XA 4UULA 2VHZA 4J7UA 4OJNA 1QYXA 3RUCA 4YYZA 5CFZA 4N7RA 1EDOA 4WLFA 5CG1A 4CM9D 4GX2A 4Q3EA 1NVTA 1PGOA 2PGDA 3RU7A 1L7DA 2GSDA 4XR4A 2QQ5A 4DIOA 4MP3A 4OH1A 1P33A 1E1KA 5G4KB 4HNGA 4BNTA 1KVUA 4R1TA 2Q4EA 1HT0A 4A73A 3VZRA 2DTDA 3DBLB 1YB5A 9LDTA 3DO5A 2PR2A 1HE4A 2I66A 1PZHA 2HRBA 4QO8A 4CQMA 2DFVA 4BB5A 1TT5A 2B0JA 4HX5A 2Q4BA 4U6QA 3VPGA 4Z0TA 3GGPA 2D8AA 3IQDB 3QVXA 1EQ2A 4RF2A 1HETA 4BNMA 1EZ4A 3U09A 1DHTA 1BSVA 2VNAA 2BFPA 4GVLA 4EJ6A 5JYDA 1HDYA 1IL0A 3A9WA 5IXSA 2NV6A 1RYDA 5IDXA 1H0KA 1PQUA 4ND2A 4CV2A 1A71A 1JAYA 3LT1A 4CMBA 5KJEA 3OQBA 4S3MA 3LSYA 3QIVA 4A03A 2UAGA 1KVSA 4AJ1A 3FHLA 3AM4A 3ITDA 1QYWA 2CFCA 3TZCA 1I3KA 4BNFA 1V0JA 4DMMA 4TVOA 2X86A 5CAEA 1HXHA 1UDAA 2YUTA 4AJNA 5LCXA 2BELA 2HMSA 3WGQA 3SJUA 3QVSA 2YDYA 1D3AA 4M1QA 4WLNA 4BGVA 3KEOA 2O4UX 2JCVA 4KQWA 1U3WA 3BXXA 4FW8A 1PJ2A 3E03A 2EEZA 3BMNB 3MJEA 4CLEA 4LN1A 2IDZA 4GGPA 4HFMA 4FQ8A 3RIHA 3OJEA 2HSDA 2HUNA 3ROKA 4BO2A 1YRLA 2BI8A 3QWIA 5COQA 3H5RA 3Q3CA 4XDZA 5U9CA 1ZK4A 2IEBA 3ZWPA 3HZZA 3CINA 2I65A 1DAOA 4U0JA 2GUGA 5FEUA 7ADHA 1NAHA 2I76A 2E48A 2UUPA 1DBVO 1DIHA 1ZXBA 4CMAA 4YR9A 4YXFA 3BTSA 3O8QB 2QZ9A 2OUIA 4FFPA 1X7GA 3AUTA 1H93A 1Q7GA 3DBHB 4ND5A 1PQWA 5FF9A 2RBEA 3MJVA 1NPYA 1ZEJA 3DFUA 3PYXA 4IIVA 1XR3A 3G3EA 1Z6ZA 4GWGA 5T8KA 3NX4A 4BHTA 5KJCA 2FR1A 5CDUA 2W2LA 3M2TA 4CMEC 2Q1UA 2D2IA 3JQFA 3DOJA 4RVGA 1M66A 4B8ZA 1NBOA 2Y67A 4ILKA 4BS9A 4FOSA 4EITA 2VT3A 1E7WA 3D7LA 2G17A 3L6EA 4JX8A 4P4NA 2P2SA 4CMIB 4TRRA 3VH2A 4XQ9A 3GHYA 5GZ6A 2FPGA 3RVDA 1NYTA 1LQUA 2XXJA 4CQMD 1OZAA 3ZW9A 2X5OA 3GZ4A 3WDSA 4J1TA 3DONA 1Y8RA 3DZJA 3I9MA 3PHIA 4CLDA 5JAMA 4NU6A 1I32A 4D43A 1E3EA 2NVUA 3ROQA 1P1RA 4N18A 3L9WA 4CLRB 3IIEA 4B7CA 4O6VA 2QW8A 4AJEA 3PFFA 4CR6A 2E37A 4DYDA 1HDXA 1UZMA 1GCOA 3TSCA 4IINA 1IPFA 4DIBA 4Q3DA 3RUAA 3L6DA 4D3DA 4IBOA 4IM7A 5KCZA 5DN9A 5CG2A 3D3WA 1MC5A 4FC6A 2X9NA 1N7HA 1NX6A 2GCGA 2J6IA 3PYMA 1Z73A 3F1LA 4HFNA 5AOVA 3ZU4A 3QVTA 5G0WA 2NQTA 4F3YA 5B12A 1D1TA 3ZNNA 1T2FA 4PLZA 1ARZA 3U4DA 3JQCA 3FD8A 4BO5A 1KC1A 3ETDA 3ZW8A 2PK3A 3EVTA 3NUGA 4PLPA 3GK3A 3JTMA 5B4TA 4YJGA 1OMOA 4NBVA 5BT9A 5KVSA 1FF9A 4TQGA 4AJ4A 3ZV6A 2VZ8A 3OQ1A 4Y6PA 4YJFB 3QWAA 5TS3A 4J1SA 4Z9YA 4J2HA 3O9ZA 4CM1A 1M67A 3D0OA 1HE5A 4BKOA 3V5NA 4NNJA 5JCJD 3DZHA 1HWYA 1DOHA 1JA9A 2LDXA 3KVOA 4LMPA 2E4AA 3PPIA 5THQA 4BO9A 1MFPA 4INAA 1CWUA 1V8BA 5JMWA 4ALLA 4MVJM 2ZJ1A 2DC1A 1WP4A 3GPIA 4EUEA 5C37A 4CM3A 2W2LD 3AWDA 2FPPA 5KOIA 3D4OA 3H3JA 2NU6A 3L77A 4YAKA 2Q2VA 4EI2A 4KWHA 4MVJA 1I2BA 1PQPA 1S7CA 2Z5LA 4ALMA 3PIDA 4BIIA 3LC2O 2B35A 4E2ZA 1ZKMA 4DLBA 2GASA 4OIMA 2TMGA 2GD1O 3N58A 1MFZA 3EAGA 3GPDG 1Z82A 5ENDA 4A0SA 3UKOA 3G1TA 4JBHA 2J5QA 3R3SA 1U5AA 4FFMA 5GMOA 2GPTA 2O4CA 1A4IA 1GZ4A 1X0XA 1IOLA 1U3TA 2R6JA 1R4MA 4WE3A 5JS6A 2FY8A 2VZ9A 1ZSVA 3E9NA 3BMQA 4FOOA 3E48A 3IC5A 4PLVA 2Q1SA 3RBZA 3UGKA 1ONOA 3A4VA 1AHIA 3QE3A 3LF2A 1AXGA 4CMJA 4YJHA 1QKIA 1FMCA 3F9IA 2Y0DA 4A26A 2B37A 1Z74A 5FYDA 2ZB3A 3RUDA 3I4FA 2J3KA 4HWKA 4W9NA 3Q6IA 3VVBA 2WDZA 1E3WB 3KSUA 1N92A 3JYNA 4D3SA 5JDIC 1LSSA 2W8ZA 3WQSB 3PHGA 4WLOA 4CM4A 3ZGYA 3RI3A 3GAZA 2VUUA 3RBXA 1WWKA 3RFVA 4IJVA 5DBGA 2VZ0A 2PTGA 2R2GA 4BV8A 3DHNA 3NTOA 3GEMA 2QIOA 1LLCA 1VKOA 1LDMA 3ZWBA 4NFHA 5IDYA 4Y8VA 3K2BA 1IB6A 4PZCA 3W8FA 5JC8A 1NQAO 2AXQA 3DMTA 5K0ZA 5KNLA 2DVMA 4R4JA 1C0KA 4RPHA 3DHEA 2Y0EA 5HS6A 4RVUA 3W8EA 2Q2QA 4N5NA 4ZRMA 4CM8B 1RM0A 3MWEB 3ZDFA 4I5DA 4FJ0A 5TJHA 3D64A 4W4TA 3KSDO 1DFHA 1KY4A 1EUCA 2XPCA 3OEWA 1ADGA 3HDHA 3LDHA 4KDFA 4CMKA 3NYWA 3ASVA 5DDIP 2PNFA 3DR3A 3I6IA 2D5CA 4XQGA 5I9MA 4WEQA 4BB6A 1UR5A 3JQAA 4IJKA 4RORA 3RUFA 5EINA 5L9AA 1GL3A 3FTNA 1CQJA 3TL3A 1MA0A 2Q45A 3ZWOA 3ONFA 5EERA 3KEQA 2QYTA 2D3TA 1UXGA 2NM0A 3AY7A 3HDQA 3HN2A 5B37A 1ONPA 5DULA 1HF3A 3OBBA 3DTYA 2EERA 3W4KA 1K6XA 2V6MA 3KYCB 1E3IA 3OSUA 2GN9A 1ADCA 3ZWNA 4RPJA 5H82A 5KJ6A 4FB5A 5DNAA 1LI4A 3PGXA 2VYNA 5CDGA 3GNQA 1WXDA 4KP7A 4IXWA 2YHUA 5KJ1A 2HQ1A 1C1DA 8ADHA 3OMLA 3GMDA 3PWSA 4NK5A 4M86A 1E5LA 4L76A 2I3GA 1E6UA 1NHWA 4HKTA 3P2OA 4S1VA 3DB2A 4AG3A 3CSDA 4OKNA 1EDZA 4FJ2A 1Y6JA 1BXKA 3ADOA 1AGNA 1GADO 1A7AA 1ENYA 4Z6KA 4XX0A 5H83A 4BO4A 5JC1A 3EY4A 1XQ6A 5C5IA 5G4LA 4OXYA 1L7EA 4BGEA 4E33A 2ZIZA 1VL6A 1LDBA 4PG8A 4IXTA 4JCOA 3H2ZA 1QSGA 2PGJA 2J3HA 5A06A 5IF3A 4MVJH 1R0KA 4UVEA 3H9QA 5DP2A 2HLPA 2C2YA 5BNTA 4D44A 4CQLB 4FN4A 1GUZA 4O0LA 2OHXA 2VTEA 1N9GB 5CEEA 1V3VA 2R00A 4AICA 2NUAA 2JCYA 4R51A 3K5PA 4CM7A 5F5LA 3GVPA 3KOUA 1XQ1A 1E1LA 4KQXA 3S55A 3GZNB 1HKUA 2VOEA 3NGLA 4B4VA 2IODA 4HFRA 3WIEA 1HYHA 5GZ3A 1DIGA 3O03A 4RL6A 3G17A 3Q2KA 1QLHA 3L9XA 3PXXA 4II2A 2YJZA 3FTPA 3PI7A 1LSOA 4YEDA 4A10A 1LBEA 3QVOA 4DQVA 4QSMA 4GQAA 4H15A 2ZCUA 1XU9A 3NGXA 3AU8A 4JJIA 4U6SA 4A27A 4I5EA 3WWYA 5J9GA 5M6DA 1DC6A 2H9IA 2IE0A 1J0XO 1KY5A 2EKPA 1KEVA 1JWAB 3AK4A 1O5IA 1UXIA 1GFSA 2O3UA 2W4QA 3IKVA 4XEHA 1YJQA 4AJLA 5CPBA 4M54A 1E3JA 3KXDA 4RF4A 3TZHA 3TL2A 5GY7A 1YH3A 2IXAA 1CJCA 1YB4A 4QTZA 1ZH8A 3JQAD 2OOSA 1EEHA 5IN5A 3WQRA 3K31A 2DBVO 4DA9A 5CPFA 3FN4A 3AUUA 3MJCA 3R1IA 4ZQGA 4D3FA 3H7AA 5FWNA 1Q0QA 1H5QA 2ZCVA 1IYZA 1ZVMA 3W4JA 4CV3A 3WGIA 5JE8A 4FFLA 3VPXA 3GVIA 2X6TA 4KMSA 1YL5A 3TFQA 3QHAA 5CHEA 2W98A 4J91A 1PS0A 2VYND 2O48X 4GX0A 4R01A 3TOZA 1YWGO 3ETEA 3JD4A 1RJWA 1YOVB 3SEFA 1I36A 4ZRNA 4DPKA 1HTBA 5L7YA 1R16A 2CF6A 1PL6A 4KUGA 3ZV5A 3EGOA 3WFIA 1OI7A 3BIOA 4JJGA 4WJZA 5T64A 3E5RA 3JQ7A 5B4UA 1EMDA 1PEDA 3JYOA 3ETGA 4TVBA 5U4QA 4FDAA 1Y81A 4JP2A 3ANNA 1JVSA 2Z1MA 1GAEO 3IMFA 4HXYA 4KTVE 1SEVA 3I3OA 3WQQA 4ALIA 5JAZA 2NTVA 1X14A 1DEHA 2HCTA 1MLDA 2I6TA 1UAGA 5L7TA 3I23A 2NSDA 1CERA 4WASA 5A4DA 1ZZEA 1NNUA 1NM5A 4YA6A 3PDJA 5KWEA 3GVXA 1YJ8A 1LLQA 2G82A 1EFKA 1GQ2A 2RH4A 3I9OA 5A9RA 2ZTVA 4JROA 4WNIA 4CUJA 1ZNQO 2AE1A 3ASUA 1HSOA 3PDUA 4K9DA 3HWRA 4TZTA 4Q3BA 4NHEA 2PH5A 1IUKA 4R54A 1C0LA 4D0RA 1ENOA 3JQEA 1UXHA 2NACA 3DTTA 2BRUA 4RVHA 3UCEA 1DC3A 4R69A 1ISJA 3C7CB 1OOEA 3DAGA 4DC1A 1JN0A 4GWKA 1EK5A 4NJOA 5A9SA 1WMBA 4B3IA 5JO0A 3H6KA 5BSGA 2OXIA 3RC1A 2O2YA 5A3JA 3L4BA 2EF1A 1ZSYA 3GQVA 3MWDB 4B3JA 1L1FA 1I33A 2FN7A 5JMPA 1BVUA 2WD7A 2Y66A 1ZBQA 3VKUA 5ER9A 1ADFA 2CDCA 3ZWMA 3BMCB 5IZCC 3P19A 1U8XX 2HDHA 4NFYA 3S2IA 4EYEA 3BHJA 4PCVA 4RLHA 4WCDA 2OBNA 4FFNA 5C7OO 3SC4A 2I9PA 4MINA 3ULKA 5ITVA 3AOEA 3QJ5A 1SO8A 4FC7A 3WTBA 1D1SA 5COAA 3WYEA 4RZHA 4YAEA 3W8DA 4IZHA 4IJWA 4YB8A 1BTOA 4QT0A 4P38A 2YHIA 4BMSA 1RM3A 3FPLA 2HMTA 5BNFA 5C7LO 1K2WA 5L95A 2X5JO 2J3JA 4OOEA 1OC2A 2B83A 1T4DA 1XG5A 2X0IA 3E9MA 3DEYX 5K6AA 3WGZA 5G0VA 5BR7A 3GG2A 4AJIA 4DBZA 3INGA 4FPXA 3UH1A 7MDHA 3LYLA 3KYDB 3HFSA 3QP9A 1C3VA 4JBIA 1F06A 3WGGA 3RAJA 5ITWA 4DBVO 3GMSA 4R9RA 3ZU2A 3VZQA 5THKA 3D3EA 3OIDA 4LRSB 5TGDA 1P77A 2C07A 1G1AA 4NBWA 3ZU3A 3H65A 2HMUA 4HFJA 2WEKA 3DZGA 3I9KA 1JKJA 1Z7EA 3QV1A 4MVJF 3UHAA 5BNIA 3B6ZA 1M6WA 2C82A 6LDHA 4MDHA 3T4EA 1T1RA 4KUHA 1XKQA 2B69A 4PLWA 3CKYA 2P4QA 2Y99A 3RUEA 1DJNA 3FF4A 4ZQBA 1LSJA 3CZRA 2H5LA 3FBGA 4J3FA 4UEJA 1UP6A 3WXBA 3ROPA 1ENZA 1LUAA 1B14A 3FWNA 1PZFA 3RJ9A 4BGUA 3RUHA 1PGNA 4J2OA 5COBA 1SB8A 4AJKA 4R3NA 5ICMA 2XF8A 1QMGA 2FPIA 2PGLA 2AG5A 4QXMA 4R3WA 2VUTA 4GLOA 4LMRA 4ND3A 4CR8A 4CLHA 3VAZA 1P1HA 1TI7A 4C7JA 3JQ8B 1QORA 3LC7O 1K3TA 2IZ1A 3D4PA 3GVCA 3PWZA 2VOJA 1DB3A 5A05A 4NZ9A 3FCOA 2GNAA 3D1LA 3JQBA 4GGOA 4F45A 3KRTA 3RFTA 1HSZA 1A72A 5A02A 4FFRA 1ZXLA 3MTGA 4L0QA 2PA3A 3GNSA 2RCYA 1KYQA 1UZLA 3E1KA 2CY0A 3WMWA 1U28A 3CTMA 1E5QA 4DYVA 2ZB4A 1FDTA 3BMOA 4J16A 1PGJA 1SOWA 3COSA 3RD5A 4E5MA 4OYRA 2NU7A 1C0PA 5IAAA 2YV3A 1ZEMA 4HBGA 3GGGA 1R37A 4PVDA 1HE3A 3B1FA 3PJFA 4AVYA 3PK0A 1E3SA 4GX5A 5I8WA 4EJ0A 3IKTA 2JD2A 2NWQA 4IPTA 1LJ8A 4EEZA 2HAEA 5LDGA 3AI3A 4ZQHA 3BA1A 3WBBA 4TWRA 4W7HA 1WMAA 3UF0A 5DCWA 2V6FA 4YACA 1BXZA 4NBTA 1NHGA 3PTZA 4DXHA 4CM6A 1ZK2A 4IQ0A 3HHPA 1I2ZA 1VL8A 3OICA 3ICCA 3GR6A 4HY3A 1NWHA 5ADHA 1MP0A 2C7GA 1H9AA 2V65A 4MKRA 2PKQO 4KZPA 3L4SO 1E7QA 2AQ8A 1JWBB 3HFGA 1JU9A 1XWFA 5L4LA 1BXGB 4DWVA 1QYDA 4CL3A 3INTA 4FCCA 1X13A 3OA2A 2VCYA 3AFNA 4OXNA 1YVEI 5JCJA 3KETA 1KS9A 3DBVO 5EN4A 1H6BA 1E6WA 1NPTO 3C1OA 1NR7A 2VUSA 3H3FA 2TMDA 3ZHXA 4MVJE 3UAGA 1LXCA 1TA4A 1ZMOA 4J49A 3AI2A 3PZRA 1WAMA 2YFHA 4EZBA 1R4NB 3L07A 1MV8A 1O8CA 4BO3A 1KERA 3DDNA 1U4SA 2HKIA 2J5KA 1J6UA 4BUCA 4E0BA 2LDBA 3MTJA 1BDBA 4EW6A 2GDZA 4DMLA 4E21A 5B4VA 3WBFA 4AJ2A 2EJWA 3SC6A 5A5FA 8LDHA 4MJLA 1UDCA 4PGFA 4XYBA 4RDHA 2UUOA 4ID9A 4O1MA 2ZTMA 3C1TA 1V6AA 3JD3A 2BFOA 1DPGA 4E31A 2W90A 3ZNPA 4D7AA 2PD4A 4NJMB 1Y5RA 5L51A 1C14A 3AM3A 1JAXA 1R15A 3JQ6A 4P4GA 3E9QA 2WE7A 3JQGA 4R9SA 3SXPA 3ON5A 5I7EA 3EDMA 3F3SA 5GZ1A 4WCFC 5JCXA 5TT1A 2EHDA 3ABIA 2B5WA 5JLAA 1EBUA 2W2KA 3A14A 4BV9A 4E13A 4GSLA 3HADA 4DREA 3R6DA 2OBYA 4LISA 3NTQA 4CLOB 5FFFA 5DT9A 1M6HA 4I1IA 4O59O 3DOCA 4Z0PA 3UCXA 2VRBA 1P1FA 4XA8A 3QWBA 3GC6A 4YQYA 3ORFA 2Z1NA 4OGWA 4QUKA 3ZN2A 5KKCA 3QA9A 4A5OA 3JCZA 5BQFA 5AYVA 1P1IA 4R1NA 1SPXA 1BGVA 3FR7A 1F12A 3ICPA 4NI5A 4E30A 1JW9B 1YO6A 3PHJA 1UP7A 1W0CA 3RCBA 3WMXA 2I99A 4RZIA 3S8MA 4WCFB 2QZZA 3GDFA 1HRDA 3JQ9C 4J1QA 3G49A 4I9UA 1WZEA 1PL7A 4RPGA 5JXWA 5A04A 1PS9A 3FNFA 2X7HA 3GLQA 3UVEA 2QRLA 3ZNOA 1DIBA 3DZFA 2RHCA 2BGKA 1X1EA 3DBRB 2O3RA 4ND1A 1TXGA 1YE3A 1QXSA 4UEKA 2X4GA 1GDHA 3VPFA 4OOFA 1G0OA 1U4OA 2DFDA 3ONEA 1X1TA 3NTRA 4P8RA 4UVDA 4KOAA 4EJMA 1ZSNA 1XGKA 3BTOA 1WDMA 3U4HA 1ZJYA 2FWMX 1S6YA 1IULA 4YAGA 1V3TA 1H6DA 3BHIA 3P2YA 1CF2O 1M2WA 4DRYA 1C0IA 1MGOA 3AUAA 3H2SA 4TMFA 3GUYA 2PLAA 4BMVA 3LF1A 4ZA2A 5F1OA 1LDYA 2OZPA 5F1KA 2D0IA 2EW2A 2E6UX 4JIGA 3GFBA 3NDJA 1KETA 2HK7A 3RFXA 5J23A 1JLLA 4PRKA 3DL2A 1M76A 3ADPA 4YRDA 3NT5A 5KTKA 3WGHA 1LRKA 2V6BA 2X23A 4WECA 4ZJUA 1FDSA 5JDCC 1VLLA 1YL6A 2WSBA 4HNHA 1E1NA 4YVFA 1BDMA 5JNLA 4AJPA 5G4KA 4LVUA 5ILOA 3TZQA 2Y1OA 2PZMA 4BL5A 3PJEA 2GERA 3BAZA 4X54A 1NR1A 1OC4A 3DBLA 2ZTUA 3I9NA 1LRLA 4J1NA 3GOHA 2D1YA 1R0SA 5EMHA 4GBJA 4RQUA 1WDLA 2F00A 4Q3AA 4TZKA 1FXSA 1GY8A 3Q11A 1HL3A 4RLSA 1NFRA 4FR5A 1R0LA 4BNZA 1Y1PA 2WYVA 2Y1DA 4L9RA 4TRNA 4Y98A 3MEQA 1CETA 3K30A 1DRVA 4Y67A 1EBFA 1IHXA 3ZHZA 3OEYA 3H9UA 2VHYA 3KM0A 2PY6A 3LQFA 2A35A 3CEAA 2DUWA 1FDUA 1NPDA 3HUDA 1NQOA 1I10A 3PQDA 5IDQA 1E1MA 1V35A 5IZ4A 4IIUA 3C85A 1YS4A 1LC3A 3H9EO 3ZWCA 4LRTB 1DFIA 3GRKA 4MVJG 1NTOA 1XCBA 3WLFA 3QVWA 3AJRA 4UVGA 4MKXA 4XQEA 3R0IA 1LQTA 3CMCO 3VHRA 3SVTA 1ZK1A 4PZEA 2HK8A 2Y1CA 1ISIA 2VNSA 3OFSA 4HADA 4URFA 4OL9A 3L0DA 2VWQA 3GN2A 2P9EA 3UFXA 2QRKA 3WICA 3JYPA 4OO3A 3WFJA 3A28A 2OL4A 1LTHR 4WEOA 2FR8A 1T1SA 3BMNA 3DMYA 2C5EA 2C54A 3V1YA 3AI1A 1XU7A 4YCAA 2O50A 3P7MA 2GN6A 1NWCA 1MXFA 1PJ3A 4G5HA 1Y7TA 4JBGA 1T2EA 2GO1A 2BI7A 3QWFA 4PLFA 4UEOA 5EQDA 5A03A 4LGVA 1GUFA 1KOLA 1D4FA 1QYVA 1J5PA 3O8QA 1XDWA 1OFGA 1E6EA 1EVYA 4JK3A 2AHRA 1ULUA 3DBHA 4JXKA 1YL7A 1D7OA 3ST7A 2H63A 3LC1O 4J9VA 5CDSA 5HWSA 3JD0A 5L53A 3NT4A 3M6IA 4IJUA 1Y8QB 4PG4A 2EKQA 4PIVA 1BMDA 1LDEA 4I5GA 3UOGA 1OBFO 1LLUA 3ONDA 1XSEA 4K6CA 4B4UA 2RH8A 2GZ3A 4E5PA 1GZ6A 2YV1A 2JL1A 4BO6A 2I67A 1GV0A 3ENNA 3S2EA 3ROMA 2UYYA 4PLGA 1BW9B 5ER6A 4CMIA 2G76A 2X5KO 4G65A 4Y6RA 3UUWA 2DTEA 3ZWXA 5LC1A 4CL8A 4DGSA 3K96A 2NVWA 4ND4A 1LDNA 1JKFA 2BGMA 4R5MA 5TRTA 4QO7A 3U49A 3WGYA 5G2OA 5F21A 4LK3A 1NASA 3E5MA 1RKXA 4MIEA 5EQFA 1GU7A 3WNQA 5JYFA 3S2GA 2POQX 1YXMA 3EZYA 1VSUA 3HNPA 1C1XB 1EVZA 3KLPX 3D5QA 3PJDA 3K73O 3EZLA 3B1KA 5I8ZA 4CMEA 4CPDA 4CLRA 4M55A 4EUFA 1ZUD1 2Q50A 3HJAA 1F8GA 3EW7A 4BQPA 3TQHA 4J6FA 2RAFA 4IMRA 2IEDA 3GG9A 4Q3CA 4NMHA 2BF7A 4IDGA 4AJOA 1GYPA 2O3QA 1SB9A 3U5TA 9LDBA 2O7SA 4PFJA 1WPQA 4R1UA 4YT4A 3OIFA 1N8KA 3U3XA 1NAIA 5G0SA 5T73A 1DIRA 2AEFA 4XQCA 1DAPA 4MOWA 2CZCA 3PEFA 4CQMB 1XEAA 1BG6A 1TT5B 2CDAA 2O2SA 4FD3A 4FFOA 3WGOA 1DIAA 1D8AA 2YW9A 1MB4A 2PV7A 2D5AA 3I52A 2YQ5A 4GPD1 2JD0A 1PJLA 1ZFNA 3QSGA 2EGGA 1DSSG 1E3LA 1SCUA 1ZO8A 4ONEA 2PFGA 2BKAA 3I6QA 5KVVA 3FPCA 5DF1A 2IRWA 3DHYA 2OMEA 4CJXA 4O63O 3KBOA 4HUJA 2A94A 2HJRA 5KKAA 2PKQP 4H3VA 3K92A 4JLWA 4YJFA 3KLMX 4QFCA 1NFQA 1GEEA 1KBZA 1YBAA 1R6DA 1A4UA 4I9NA 5A5EA 1Q1NA 1YQDA 4D41A 2J3IA 3FI9A 3NJ8A 4WPGA 2DBQA 5T8KC 4BKQA 4BNKA 4BNIA 4J4TA 1V9LA 4BNLA 2J8ZA 2X9VA 3JQFC 3L6OO 3MJSA 4OSPA 3VTFA 4OM8A 1LA2A 1ZK0A 4PLTA 1LRJA 2IYOA 4K28A 2IZ0A 4LSMA 4CM5A 3Q9UA 2YZ7A 2X58A 3LU1A 4A2CA 3STHA 4TROA 1HZZA 4YTEA 1VL0A 1X7DA 3A06A 3MOIA 2A4KA 3F6YA 1GD1O 1P0CA 3MOGA 3V2GA 5DOZA 4NU5A 3PFWO 3WLEA 5A9TA 1N5DA 2G0TA 4MPDA 3FNHA 3GRPA 2VRCA 1UH5A 3DZIA 3GEDA 4N5LA 3OP4A 2EXXA 2B4RO 1I3MA 2FZEA 5HBRA 1FJHA 1Q0HA 1Z75A 3KZVA 4WOKA 1KVRA 2O3SA 4XWYA 5T5QA 4PVCA 2FZWA 1QV6A 3V2HA 3RU9A 1A7KA 2WWRA 1DC4A 4L8VA 4JQCA 3TWOA 3LLVA 3OIGA 3LK7A 1E3WA 2FSSA 5EESA 2ZYDA 2JHGA 1K5HA 4U7WA 3VTZA 4ROSA 5ICSA 3W6ZA 3IAHA 5TIIA 4F6CA 4UUPA 3PYLA 3DC2A 2FR0A 3KB6A 5AXBA 3WNVA 4GKVA 3X2FA 3K9QO 2ZQYA 1H2HA 3GF4A 1Y8RB 2WE8A 1VSVA 1H2BA 2FRDA 3RKRA 3GVHA 1PS8A 1SZJG 4ZN6A 3I1JA 3OH8A 1E92A 4ZICA 3EK2A 3A1NA 4OQYA 4TKMA 4RVSA 2NVUB 3LVFO 4RO0A 4DL9A 1MXHA 4PG5A 2OGUA 1MUUA 3CIFA 3DOOA 3DQPA 1U3VA 2WM3A 2CUKA 3C7AA 3OJFA 3UCFA 3VPSA 2GZ2A 1GUYA 4GKBA 4IQGA 4JJFA 3H4VA 3GDOA 2EWMA 2VN8A 3C3XA 2O3TA 4L74A 3NT2A 4EDFA 4EEXA 1F0YA 3PHLA 4CM8A 5JDIA 5EPOA 3DZKA 1ORRA 5I7FA 1J49A 3D3WB 1ZMTA 4BNUA 3TF5A 2X0NA 4YRAA 4YDRA 4DIFA 4K26A 2BMAA 3HN7A 4WLVA 1OAAA 3BTUA 5TQVA 1GPJA 1XHLA 2AEMA 4OKIA 1O95A 2Y68A 3GH3A 1ONNA 2ZATA 3ZI0A 2DUUA 2NTNA 3OJLA 3OM9A 5JSFA 2Y1EA 1I0ZA 2NVBA 2C20A 2ZKLA 4DPLA 1W4ZA 2EIHA 1Q7CA 3CZMA 3GN1A 3NEPX 3WGTA 1RWBA 2PD3A 2J5RA 2VWPA 2H1SA 3Q1LA 4U5QA 3AOGA 3OQ6A 2CDBA 2VWHA 5ES3A 2C7VA 4XD2A 1WW8A 2NNLD 3VH3A 4YJGB 3KTDA 3KYCA 3JD1A 3ZWVA 4BO0A 4MP6A 4BNGA 4B7UA 4BQRA 3HSKA 3RSHA 1PR3A 1NVMB 3VVCA 1EUZA 2EJVA 5TT0A 3F1KA 4B8WA 1HLDA 4CMCA 2YV2A 1BVRA 3U4IA 2VRCD 3GAFA 5DP1A 2A92A 1DDOA 1EFLA 1VJ0A 2ZYAA 3FR8A
chains in the Genus database with same CATH superfamily
3W06A 1BE6A 4LXQA 2X3UA 4OFZA 4WD3A 4I08A 4ZAXA 4Q6WA 3ZU6A 2GXAA 2QYSA 1JP7A 5D84A 5IH3A 4XJTA 4X3OA 5KTRA 1CEEA 5C80A 1QS0A 4UFNA 5ITZB 1UJNA 1A9YA 2LD4A 2HLDD 4JJ7A 4LV8B 3WWZA 5KNDH 4WXRA 2I4NA 2Q99A 1JMVA 3IUMA 1TCAA 1VHWA 3I2KA 1I4DD 3ILHA 4PHHA 4X9XA 4HJRA 4ZAGA 3VH1A 4DQUA 3FHTA 4W9NC 4JGBA 3QQPA 4BP1A 1GKLA 3ZYZA 4LSWA 3KWFA 1N33B 4QBHA 2OYRA 3H17A 2FE4A 4CQLA 2ATVA 2F1JA 3IEUA 1N9GA 1HZJA 4ND8B 4A1OA 4C0JA 3MVEA 1QFYA 4IP0A 2QYOA 4RIFA 3P26A 2ZRKA 4F4FA 3SCZA 4XARA 1SC4A 4TYNA 3VZSA 1UWVA 1R4MB 1TU0A 4HB2A 3PUVA 2DM6A 2WWVD 3GZNA 1WVIA 1WCYA 2GD0A 3GO4A 1J8YF 3DAYA 2GF2A 4WA8A 4BWVA 3SIRA 1L5HA 4ZIRB 5JSQA 3NHKA 2FEOA 5TE9A 5K3FB 4NIMA 2B4TO 2CLDX 3A3NA 3GJXC 1GUDA 3CPHA 3FDJA 621PA 3PJGA 2VI5A 4GNRA 2A2ZA 3BYZA 5LLSA 3VNQA 3HV0A 1ISSA 1MAAA 2SHKA 4YAIA 3LTEA 1VE1A 2MOKA 2XQIA 3AC0A 2I6XA 1GPYA 3QVJA 4KXMA 1GGVA 3R9KA 4REMA 1D0VA 4CUKA 2AOXA 4ZT2A 1JEYA 2JVJA 2GYWA 2NTEA 1HE1C 1UKEA 1E4VA 4HLQB 3U62A 4CM4B 4TS4A 4A0GA 4RK4A 3ZY6A 6AT1A 3RODA 3BH7A 4ABYA 3CURA 4DLYA 1I3NA 3EW9A 1JIIA 4KYUA 5ICEA 1E20A 4G97A 2GD6A 4RZQA 4OAQA 4HRAA 4M0LA 5MHTA 4O1IA 5DCLA 3H8JA 1KY2A 2MYTA 1JHQA 5HKAA 1YUMA 4NAHA 4NR0A 4DKJA 1TKAA 4PZ0A 1FMTA 1E4YA 2C3YA 2QKYA 2Z9CA 2HDNB 3Q5GA 2GZMA 4MUEA 4QYWA 1QE3A 2APJA 3Q7QA 3QE9Y 2J0UA 3I5MA 1GGMA 5FLKA 1E5VA 3Q5EA 5CFQA 2WKPA 2YWGA 4FKBA 4LWQA 5ARDA 5HDQA 4FDUA 1JQAA 2CK3D 1SKAA 2P5TB 2WJIA 3GLRA 4PAQA 4QVIA 3GAAA 1P4HA 1YOVA 1E7RA 2BHTA 2YFYA 5KX5F 4XPIA 1NMYA 1MNQA 4KTTE 2AKEA 4NYIR 5JD4A 2FFAA 3KV3O 1Z07A 2YWEA 1UBEA 5T57A 3W6OA 1XT6A 3DM5A 3ETJA 1N3YA 4LPKA 2ZAOA 5IM4F 2GEBA 3SEQA 4QU5A 3GFVA 1QG2A 1RYNA 2QG4A 5HP4A 3C4VA 2ZZMA 1WY7A 5JJIA 5FL7A 1SBQA 3SBDA 2XUHA 4CTJA 2OBXA 3SZUA 3JPWA 1P2VA 3FCUB 4YAKA 5TC4A 4YMUA 1Z0ZA 3JVUA 2ZB7A 2QQEA 1D7AA 3EPAB 3LUPA 3WG9A 2VT2A 3EP3B 5ECWA 3PGJA 3T7DA 2WU4A 4YUZA 4BBPA 4DBLC 1YKGA 1S89A 1QF7A 1ZL2A 2ZTLA 3C43A 4E3ZA 3T7CA 3U3JA 4IJ5A 5MDHA 4YHHB 3PXGA 1EWRA 3TB6A 4K88A 2X8AA 2IJGX 4F9FA 1II8A 1H9BA 2OECA 1DI0A 5BWOA 2SBTA 4GMKA 1E9EA 1Z2OX 2IS2A 4BN0A 2EFCB 2CE2X 1EIWA 2CVPA 1XPRA 1RHJA 1T2VA 4KXNA 1PBTA 4CYMA 4J0DA 4OAPA 3QJGA 4JUFA 3IAUA 3OPYI 4H9GA 4Y9DA 1RYYA 2AG6A 1AS3A 1L4HA 2D7JA 3NONA 2JFHA 4IICA 4FOTA 5HIJA 1HDRA 5CEJA 4UTRA 5CMLA 3C6ZA 1C1HA 2BFAA 2C8JA 3C24A 1W44A 4F5EA 3FG9A 1NI5A 4C20A 4PICA 1ADBA 2PYDA 3E8XA 3FBWA 4UUMA 4ENWA 1NDUA 1Y5LA 121PA 1S3SA 1BEEA 1U8UA 1MRZA 2ZIFA 3NHPA 1OTXA 1ZZGA 1FS4A 3F5MA 3UWSA 4BFLA 3REGA 3QLUA 4IGEA 4DQ0A 4NV3A 3TDKA 1SAYA 4ZD6A 1II9A 1HOTA 4P0TA 1ZUWA 2WR8A 4C4ZA 1P0FA 3MWDA 1PNRA 4RPLA 3KGDA 1JG1A 4UAGA 4PLYA 1ZRHA 3A3KA 3PXUA 3GEPA 1BROA 5B3AA 5BVHA 4UUOA 4JL8A 2FJUA 3UAXA 4K6FA 3JRNA 2JEOA 5HR5A 1C7EA 5DCYA 5T4HA 2WTBA 1GYRA 3FBTA 1MMFB 1QYCA 2VHVA 4OSOA 3U0BA 1B8OA 4MQEA 5C7IO 3KJQA 3RTEA 3PNMA 5DTJA 4A15A 1RJDA 2ZSIA 4EQ6A 3EQ7A 1Z2NX 2GR9A 2O06A 4C4OA 5EZSA 3ZHCA 3CRMA 2IYFA 3QW2A 2BGJA 2QTHA 3NB0A 1OWMA 1INLA 2FJ0A 3TOSA 3WMRA 5JNVA 4F2GA 2GVDC 1SCAA 1E9FA 4XLZA 3HO6A 2ZZKA 3I2IA 4C76A 4DRXA 3RC9A 1LNQA 3PU6A 5LQAA 4OHBA 2H48A 2CBGA 4E5UA 2M32A 4RMJA 3RB8A 1ZD9A 3TLJA 1Y9AA 1O54A 1EVIA 2EW1A 1CCWA 2Y8EA 2M6KA 4BNYA 3JY6A 3EP8B 4DV1B 1W0KD 1YQGA 2QE6A 1QLJA 5DBEX 1U90A 1HQCA 1KP3A 4J9UE 4HEJA 4BVKA 1AY0A 2C88A 1SIUA 3SLKA 2EP7A 1JDVA 4E51A 3O4RA 4TXNA 2GHTA 3NVMB 4JEMA 4KBGA 2ZUVA 1PTJA 3DFMA 1ZCJA 2BW0A 2GOYA 4JDPA 4C21A 1J0EA 1OREA 1WZNA 5AQ1A 3N28A 3H7IA 4IGFA 3N7TA 4Y1GA 2P68A 4YJ3F 3V8NA 3ESCA 3WJ7A 1B15A 3U3MA 1Y3AA 2XNDD 2R96A 3K7EA 2C7RA 1M2FA 1U1IA 4E70A 4I9GA 5HZMA 2F2TA 5AXCA 4BEWA 3AJ8A 3KE8A 5GONA 1FQOA 4YRBA 3LCRA 3H19A 4GKJB 1R27A 2IPNA 1G21E 1G41A 4NG5A 5AT1A 3MELA 4L2IA 4XGIA 2VP5A 4EGFA 1E2KA 5K03A 1EEXB 1U7HA 3ZCPA 4ZYUA 5CCDA 4ZI3A 5EMLA 3TM4A 3ORSA 3QY9A 3GPBA 2JD1A 1SWWA 2UUAB 4ZVQA 4GR9A 3AVVA 3PQ8A 4G5YA 3LHSA 1R64A 3P2IA 2AK2A 3ID6C 4WZAA 2VF5X 5E6SA 4CXMA 5IH7A 1NV8A 3B5IA 3WLMA 3S29A 1J5EB 4FGSA 4XYMA 1WHTB 1ACJA 4HVAA 5AH0A 5IM5A 3SYRA 3WQHA 5K8IA 3ODPA 2J46A 4AL4A 1RT9A 1STOA 3T4PA 4DV2B 3SBEA 1YVDA 2IPXA 1K6IA 3PR2B 4HDQB 1JR2A 3QV2A 4UHHA 4IEIA 2FUG6 4LAFA 3JQ7B 1TZ2A 2W9XA 3TO5A 2Z4RA 4JLVA 2O5CA 3LP8A 2AOUB 2IYPA 3HB5X 3MPOA 1OY1A 2EARA 2IHJA 2OCPA 3V8EA 1VRWA 5BRJA 4DEVA 4BKUA 5KIAA 3P9KA 3ZCQA 1IN5A 2P35A 1P1BA 3ZGLA 1UOPA 1XZQA 4M38A 2ASEA 2GN8A 3A70A 3KEMA 4RNDB 4XFDA 1H05A 4KFCA 2DWQA 4OHKA 5E38A 4EKDA 4MPRA 1B00A 5H80A 4FNAA 5K6RA 3EIXA 3GEGA 1DPFA 2JH9A 2DFTA 3D2BA 3PLRA 3VFDA 5A6SA 1LPSA 5C1BA 1O08A 5FR2A 1YR1A 4LHVA 1KMIY 1M8FA 2P78A 1PLJA 5DIFA 5HG0A 1AM4D 3WC4A 5TPZA 4WBNF 1W9HA 4F7WA 3EVNA 1F6BA 1SHKA 5CFLA 2DECA 3VISA 1TW2A 2X1VA 4NZNA 3T5TA 1J8QA 3A6ZA 3URMA 4ZU6X 2PQ2A 4ZHSA 4E2XA 4BWFB 1CLEA 5EI5A 1RKVA 2OBMA 4CUZA 1P2SA 5HJEA 1EE9A 3DE6X 5KI6A 4LJKA 2Z57A 2NO6A 5DYTA 5HTOA 3WKAA 1UXKA 1I7CB 1RWWA 1Y1KE 2C3UA 2O7QA 3M4XA 4MR8A 1LGYA 5KSYA 5AK5A 3EZ7A 3ZQ4A 1P45A 3W5DA 4HLNA 1T8YA 4QGAA 4IS2A 4BMYA 1NRWA 1OBOA 2VPQA 1VPTA 3DZBA 4L50A 4P33A 1M74A 4G0OA 3EVAA 5FI3A 4Y1RB 3WRWA 1BZYA 3FGNA 5B3JA 4BKRA 2VQSA 1TECE 2Q9UA 3LL4A 1ZCAA 4XB2A 4DMRA 3K70B 4Z7NB 1Y5MA 2XHEA 1SCNE 2V96A 1FSSA 2XNKA 1DV1A 3LRTA 1QIFA 2BBSA 2G8NA 4L9AA 4MB2A 4M9ZA 3U37A 2JS7A 1ZIXA 1P3DA 2G1UA 3ICOA 1TEXA 4HQLA 4QQRA 5FDFA 5FWYA 1C4KA 2R84A 4PAGA 2C9YA 4W7IA 2GJKA 2WD8A 4X6YA 3SHOA 3UO8B 1XXHA 4JLSA 1Q74A 3F4BA 1K7XB 3PC3A 3LCCA 5K6AC 2W42A 3CF4A 1CS0A 1KFBB 1PJTA 3M3HA 4DA7A 4B3SB 4AFNA 3TW3A 1G16A 2NZ2A 2RHGB 4I50A 2K7FA 4CKWB 3OHSX 3H9GA 1T6NA 4CCAA 3KT8A 4RBNA 5H9VA 1M5RA 2ZYGA 3RROA 4IDAA 1TZBA 5HF5A 4NYMR 5GWXA 3ZCRA 2EJBA 4P92A 4NJEA 4RF2A 1ID8A 1FEZA 3STVA 2REXB 4KRFA 3JQDA 1KVTA 3N2GB 2NZVG 3ZV4A 4P9NA 2W43A 3TCXB 1JIQA 1VB3A 3W5UA 2GPWA 3H5NA 3JQRA 5DCUA 5K2OA 3H16A 1VA5A 4AZVA 4B3XA 4EG1A 3NHBA 1EINA 4N8SA 4KRXA 3H8WA 3E9CA 2IP1A 4LQCA 1C29B 1AS0A 2ET6A 2HREA 3FDIA 3P32A 4WZBB 1HKHA 5F1PA 1NBMD 1Z5VA 3BIFA 2V0GA 4MVJD 1I3LA 5HDBB 3MWLA 4FXOA 4RY9A 4WGGA 3RT1A 2VDJA 1P0MA 1ICIA 2XZTA 2R7KA 5FFNA 5AXDA 4G37A 1JTVA 3M6XA 1FUUA 3HRKA 2YMMA 1EFUA 1Z6YA 2ZULA 1T5SA 2GRUA 3B20A 5TQJA 1Q22A 1JJ7A 4HTFB 2WRZA 3KXKA 4KVAA 1U7TA 2KX7A 1RC8A 3RKUA 2X8JB 3ZHVA 3DZ2B 1C2TA 4E03A 4U9HS 5ECYA 3SGLA 2B4QA 4B3HA 3DLPX 1T3ZA 2BCGY 2QN7A 1RIFA 1BOOA 1YAJA 5IXJA 1AC5A 2K6GA 1N5LA 3QY0A 3HGTA 1ZJWA 3KLOA 5HKKA 2DJ5A 1AN9A 1KMHB 1S2NA 3EUWA 2PUVA 2Z58A 3BORA 3C7KA 2QTVA 3OHPA 4U3JA 5CXXA 1SOVA 2ZU0C 3VQTA 2F1KA 1E94E 3HPQA 2JIZA 4N03A 4EB0A 4GXRA 3TEJA 2BV3A 1WCIB 3A9RA 5CD1A 1UDWA 4UTVA 1J00A 3E1GA 4OEHA 2BH2A 2B7BA 4I1SA 5AM1A 5HM6A 5CD9A 2DBRA 5GADl 4D8WA 2MSWA 2VAPA 2B98A 2C9OA 3IESA 4YT5A 3I4CA 1NXQA 1E1RD 2I1WA 3HR4A 4CLOA 1YV9A 2QT1A 3ZHTA 4TSKA 3F7NA 1R4AA 1TFUA 4LDRA 5DGDA 4AX4A 3KPUA 1Y3FE 4QECA 3T7TA 2J7PD 2YWBA 1AMOA 1RJGA 3G2JA 3NR2A 4GOND 3TKYA 3COJA 1VLJA 3NYIA 3RWOA 2QLBA 4V2IA 4RJKA 4IDEA 5JAIA 2QTLA 3MLAA 3NHJA 2EZ4A 5JBIA 2BEJA 5A0VA 4IHJA 4JDUA 4K8RB 1U1CA 3GQBB 4X8HA 3MBIA 2WVHA 3V7WA 4BV2A 2VP6A 2WFAA 1R6BX 4GP6A 3T4XA 1WEHA 1IAVA 5CM2Z 1U9JA 3A9VA 3BMOB 2DU8A 2G09A 2C92A 1CX9B 3CUKA 3ZDDA 5B57C 4UTZA 1J9ZA 5JC1A 1HY3A 2XIJA 2C8VA 1EXMA 1BHSA 1IHDA 2GK3A 1RVV1 2CUZA 2NUPB 2VJMA 5IN4A 2P0EA 2G1PA 5FQOA 4CODB 4JQOA 5L6MB 3NDRA 1ZVVA 1QIEA 2IYQA 3OQMA 4AYWA 2O3JA 4IZIA 4YREA 3IP1A 4JMPA 4Z3DA 1N7GA 4COOA 2VPIA 4Z9AA 5IMBA 1QHFA 1X9IA 4Q21A 4RE5A 4GEGA 2CMDA 4IIGA 4U2EA 3V3TA 4EJFA 1RRGA 2DTXA 4CTMA 3BK2A 3ANLA 1ID1A 2PBZA 1WNTA 3BDAA 4DLUA 3L0PA 4TUYF 1IBKB 1N2JA 2B1IA 2V4ZA 3FFTA 2E49A 4B17A 5EJ6A 3B7GA 2W2OA 1N2EA 4GW3A 4LGCA 1L4LA 4HAWA 5G1PA 2BISA 1AKNA 4WLUA 3EYAA 3I01A 5DLDA 2EYQA 1LK7A 2CSUA 4MA5A 2XE7A 2YCLA 3B2EA 3I9LA 3L8YA 5KVQA 5F2NA 4FE7A 4J3JA 2GD2A 3FM9A 1IHYA 1IY2A 1B4DA 2EG9A 2RJ3A 3DTVB 3ESRA 3I2JA 3JQ9A 5TF4A 2JK0A 3HEBA 5HIIA 2VQ3A 1M10A 1YONA 2CNKA 2HQRA 2Z2KA 4B9AA 3QU4A 2JGRA 4GRDA 3QPUA 3ZH9B 3NRCA 3HDGA 4P3XA 3W90A 3C1AA 2VAVA 5IJ0B 1WL8A 3LBAA 3TQFA 4UTNA 2NZ8A 4KN8A 2FOIA 3EVZA 4NG4A 1SMKA 1GXSB 2DPXA 3DJFA 3LQ2A 1YZLA 4FE4A 4H4CA 3TVYA 1IVYA 4E12A 1JLKA 2BGIA 2N3ZA 2Q8PA 3C8HA 1TO1E 2P9BA 3HY4A 3QPAA 5F78A 1M2NA 2G4LA 3L7MA 5DGHA 3UV3A 4ETMA 4IMIB 4HV4A 1EM6A 2WNHA 4GC9A 1SK9A 2BMJA 4JC5A 4L6IA 2ADMA 3L43A 2HD4A 4R2LA 5JO9A 3TFOA 3X44A 2VTBA 1X70A 4RGBA 1P80A 2AG0A 3VR6A 1BO6A 4J0GA 2H1OA 5HJ2A 2WLTA 2C5BA 3QU2A 4N4AA 1PR0A 1YGPA 1CRQA 1ISPA 2FVYA 1UJBA 3O31A 2AC7A 3SSOA 4EFKA 3EDRA 4F4IA 4GRIA 5FUXA 4D4LA 4LDNA 1KZ9A 2HEIA 2GO7A 4KWTA 3CE6A 2C2HA 4RV9A 4W8HA 4WKCA 1JJVA 3O1JC 2XA9A 4JX9A 2CNNA 2V6GA 1XZNA 2DBYA 1Z0AA 1YZUA 2H1VA 4H7KA 5LA6A 1ZVQA 4IXMA 4ALNA 2QTNA 2Q5OA 5CK5A 1Y48E 1OAOC 4IRXA 1PGPA 2JAPA 3K8QA 4IF4A 4NLLA 5FPHA 2WBLC 2DQ4A 1YC5A 4Y1FA 1JJAA 2C9BA 2FQWA 4ZVMA 3ZV3A 5MGBA 4GOXA 5ESDA 5HFAA 1EHYA 3R3JA 3Q9SA 3WL3A 1WMFA 3R5HA 4XCVA 4EWLA 2HSZA 2PS9A 1U0BB 1Z7BA 1XDGA 3MHTA 4OPMA 2IS4A 4EO7A 1JECA 1GFWA 3K9FC 3EWAA 5FOSA 3RVSA 3VKFA 1T0PA 5IAOA 5L45A 4Q9AA 1UODA 5BN4A 2PKRA 1Q0PA 2O1WA 5DTMA 4Y2VA 4DCJA 1GR0A 2CXRA 3WYCA 2XJ4A 4KWIA 4YJDA 3NHMA 4HZUB 3UAYA 5CCEA 3WLAA 5CB8A 1PT6A 2CLHB 2R60A 4BC0A 1IDN1 4GHWA 4U00A 2OO5A 1VCMA 4JBXA 4YJKA 5FIUA 5A3RA 1SD1A 4FR0A 1KYWA 1NMZA 4GL4A 1HLGA 4XYEA 5CYGA 1F60A 5EOVA 1GNLA 1BWPA 4EB3A 5C51B 2QE7D 2OFWA 2BEUB 3N2EA 5DTQA 2A7QA 1KP9A 5I8PA 3NRJA 1CF9A 4WINA 3HBLA 1Q2XA 2IHNA 1CUGA 1K88A 4GNKA 4CIYA 4D9BA 4D9EA 4NPAA 3AJ9A 1O57A 3RADC 4Z9BA 2JI6A 2PGIA 1LDGA 1QUFA 3TN7A 1DU4A 3EH1A 2CVOA 1EE2A 1KPGA 2ZTHA 1CUZA 2Q3DA 3F5DA 5ERYA 5KWIA 5U9CA 4KPYA 2GZAA 1HYEA 1E6KA 1IONA 2A3RA 2KMLA 4YRRA 1IY8A 4CRWB 5IKMA 4DV4B 2VHWA 2PH1A 4PYRA 4L6CA 5LBUA 4D8TA 4F3CA 2PRZA 1H4SA 4ES6A 4GRAA 3WKDA 1OR8A 4H1HA 4WY2A 2PLNA 3KOXA 3AR5A 2ZJ6A 1ZRMA 2WJAA 1NFFA 5EWLB 4QG7A 3ENKA 3IP8A 1BQ4A 2H4JA 3O2QB 3QENA 3V2UA 1QK4A 3NAQA 2JFYA 1G8PA 5TX7A 2JGDA 4MIOA 3N8DA 2DRIA 1Q5PA 1SZDA 2XBMA 4DZZA 3IXLA 3FPAA 1QH9A 2PCLA 4JOBA 4UVIA 2CJXA 3TAHA 4HLUC 4BTLA 5IK2A 1JZTA 2QZSA 4LCJA 3DAHA 1YS7A 5BSFA 3AP3A 5A4JA 1DZ3A 4P7BA 3WWOA 4A0FA 2C3MA 3UN1A 2XUIA 2CVZA 2QUHA 2B5VA 3UIEA 1NI4A 1B6SA 5BY2A 1WZIA 4NCJA 3BSFA 4WOPA 1C9MA 3QYAA 4YMLA 3ET5A 4I6GA 4ETWA 2P7HA 1UKCA 3WTCA 3JS5A 2X22A 1XLTA 3G0IA 4UOZA 1TTHA 5LOVA 3PWKA 5ALUA 2WU8A 2WUGA 4JJEA 1JR3D 4HN9A 3AINA 3O8LA 1QU3A 1GP2A 2FSVA 3WR5A 1LFAA 1QVRA 2EKZA 2W71A 2E82A 4P93A 1PEYA 4PPQA 5C1IA 1JLLB 2D59A 5JASA 5KSOA 3ZD7A 1RCUA 1UBHS 3MMNA 2P9HA 3FRIA 2VHZA 4RD4A 4UULA 4KFRA 1V5GA 5CFZA 1XVLA 3LPMA 3QPBA 4Y2TA 1EDOA 4WLFA 3UEOA 2A5DA 1WXXA 1W75A 2WJZB 2CZQA 1L7DA 3PFIA 3DUWA 2H1CA 3AF3A 1KI9A 2QQ5A 3KXLA 2CSXA 1IY1A 1W4AA 2ZJ7A 2ZBPA 1GGEA 1E1KA 4D6XA 4F5ZA 3I0NA 3T1VA 4BNTA 4IDNA 4LTDA 5B3KA 4R1TA 1K5GA 3KCNA 5LBTA 4X61A 3SEAA 1WPRA 1VHLA 4A73A 5I9IA 1N7JA 4ZOBA 5B3LA 1MVOA 1PD1A 3EGVA 5DNWA 5JQWA 3DO5A 3AXTA 4YMVA 1MJNA 1O97D 3AB7A 3RRJA 5DLEA 2XIQA 4CQMA 2DFVA 2OHVA 3D1VA 4LBZA 1VMDA 2Z04A 1G60A 4Q4HA 2FUG1 1ESDA 1JAHA 2NXJA 4LC1A 3OKFA 1XMSA 3HVUA 1Z08A 1EQ2A 1T9GS 1ZS9A 1MT3A 3IQDB 1IXZA 2VXBA 1CS4C 1K75A 1HETA 2EQBA 3F6CA 4A0RA 4BNMA 4DDTA 2QNIA 2J67A 3U09A 1R0ZA 5EZ6B 4ZU1X 2CLSA 1BSVA 1YI8A 2VNAA 3NCHA 4N0QA 3SSAA 5ED0A 2A88A 2NV6A 3L8ZA 6REQB 5JPCA 5IDXA 5E3JA 2V4MA 3T95A 1NJ2A 2W6CX 1N2HA 3TD9A 2W6JD 4D3XA 2I7VA 4RYLA 4PC2A 5KJEA 1XV5A 4BZPA 3KUCA 3OQBA 3LSYA 3QIVA 1KVSA 4F4CA 4BVFA 4AJ1A 3HM9A 3ITDA 5BWNA 1H5UA 1S8FA 1WBJB 1K4YA 4JMLA 4D0NA 2CFCA 4XEUA 2QMQA 1C1YA 2PXCA 4BNFA 2GH1A 4TVOA 4C2AA 4FVTA 2X86A 5CFMA 3F4KA 4G26A 4G8CA 1HXHA 1MJFA 1YASA 1ILEA 1DQRA 2EJUA 1L4YA 2HF9A 3S70A 3WLTA 8AT1A 4F8JA 1BDIA 1LBQA 4ZVLA 2ODBA 2FMXA 4MPTA 2PS1A 3WGQA 5H70A 3QVSA 3HTXA 4ARSA 2B30A 3AWIA 1U3WA 2XXAA 4ZZ0A 3IP5A 5HKOA 4CLEA 3A9TA 1XQYA 2Z5GA 4LN1A 4PC7A 3VTKA 1E4OA 2IDZA 3M4NA 4GGPA 4TS9A 3RYFA 3NORA 1J09A 3NBQA 4HGPA 4N3AA 5DSTA 5BWBA 1YRLA 2BI8A 3W6PA 4OUKX 5GIOE 5D7NA 2MR6A 2VZLA 3KQWA 3Q3CA 1BS9A 3UJ9A 4W63A 1ZK4A 4B34A 3RIMA 1X87A 5B36A 5KX5B 3L6CA 3QPDA 4TWJA 2UUPA 5C31A 3OFNA 1IEWA 3I30X 4YR9A 3LY8A 4HDKB 1G3RA 4IQ4A 3CFYA 3SQNA 4D92A 1UPXA 1Z12A 1GNSA 1H93A 1I6WA 2DE0X 2N75A 3DBHB 3FXAA 3L8FA 4O4JA 4UM7A 5CVJA 4QJ3A 1MIOA 1MR3F 4WZAE 4G0WA 4I3GA 1A8SA 4MW7A 4Q34A 2OXTA 2FLWA 1RLUA 3G3EA 4A0QA 4EB8A 5T8KA 3PGMA 2QVXX 4GWGA 1WZ2A 5KJCA 2FR1A 1JEEA 4CU2A 4H0NA 2BZSA 1JJBA 3MQ2A 3OI7A 4E11A 2H7CA 2JGIA 1NW4A 3DOJA 2HA4A 3EXHB 4JD5A 4ZO6A 3SI7A 1JA0A 1NNSA 2JAUA 4M21A 4V24A 1NBOA 4W5NA 4OQFA 2H18A 1ZM4A 2FN8A 3ILXA 4ILKA 3EFHA 4BS9A 4EITA 5GVSA 2VT3A 1XRJA 3RVRA 1E1QD 2P2SA 2V7GA 4C87A 4CMIB 2NMVA 1B0PA 1P4JA 2F43A 4WZ6A 3FLBA 2PSEA 3QBEA 4X1IB 2EKDA 3OFJA 2YZMA 4O0MA 1JHAA 1WD5A 1LQUA 1DQNA 2A30A 1OZAA 2XXJA 3IEKA 3QZUA 3TGPA 1FQKA 5LXTA 1TQDA 4K9QA 3I61A 3FI0A 4J1TA 5ALKA 1SR8A 1U63A 2IEAA 3PHIA 3NP9A 3KD2A 4FDVA 5JAMA 1DEAA 2OG1A 3KJZA 4DAOA 1CD5A 4X45A 2ZIEA 4MO9A 4KQFA 2I7XA 4F92B 1GHTA 3TUZC 4P86A 2JCSA 4GXTA 1KY3A 3H5IA 3RC8A 1AQIA 3KPWA 3TLEA 5KQRA 4OHWA 4RA6B 4WBXC 3VKHA 3TG2A 2QW8A 1KAEA 3DKPA 1JG3A 4EI7A 3AIMA 4EARA 5NLLA 3KYJB 4FZJA 1UDXA 3TSCA 2VSOA 1T0IA 2C61A 2ZRQA 2NW6A 5M5BA 2YJ5A 4UHKA 3NTLA 1GUAA 3CLTC 1G2QA 1XAIA 4C9BA 3ZHRA 4IM7A 1CJMA 3SDZA 4N40A 1I7SB 2UU9B 1TA0A 4LZOA 3RH0A 3WRXA 3ICVA 3MBKA 3E05A 4FC6A 1N7HA 4HGNA 4K9OA 3T3MB 4JI0B 4PZLA 1W36B 2J6IA 2VPTA 4BXOB 1JI0A 1U0NA 4OJTA 3WP0A 1I7QB 2ZSKA 1XP5A 1MEEA 1UYJA 1XXHE 1I80A 1XVVA 4PNPA 1HFKA 1QM5A 2HHLA 1VSTA 2E1RA 1W34A 1LQ2A 2B3DA 4X90A 3D7MA 2AZ4A 3NAZA 1WO8A 1DO0A 4KQ6A 2KS6A 4ML3A 5EJAA 1L0BA 3U7JA 3ZW8A 4IOJA 4IIJA 3EVTA 4ITRC 4MS1B 2OILA 3LQYA 3NIFB 4QZVA 5EIAA 3MIZA 4NAVA 2D7DA 2FWBA 4GMDA 4UDNA 1HZZC 4PLPA 2QRNA 2XB8A 5B4TA 3F7TA 3KB8A 3P0EA 5BT9A 5KVSA 4YDHB 5EMJA 1XMPA 2D62A 2VF8A 4UHFA 1WB4A 4AJ4A 3OQ1A 4QGSA 4Y6PA 1XD2A 1E66A 1FRZA 2C77A 4M9SA 4XWAA 1JSCA 1SVMA 1DKMA 3L1IA 4J1SA 3EVGA 5TS3A 3ZD9A 4CM1A 5BOSA 1CQZA 1C4WA 1HWYA 1DOHA 1JA9A 3DL4A 1DAHA 1WDWB 3ESYA 3KVOA 3IB3A 2Z3VA 3DFKA 2I34A 3A31A 4OHMA 5H68A 1CWUA 1EVLA 4YJ3B 4C7VA 4DJEC 2FEWB 2QUIA 5JCOC 2Y1LA 3QI2A 1WD7A 4O2AA 4LJSA 4PC1A 4ENVA 5KYWA 4RESA 2UZ4A 2Q3MA 3VU3A 5L6LB 2GXQA 4GLBA 4O4IA 3FSGA 5JXJA 2O2EA 1E6MA 1L7PA 1ZD4A 2RHJA 4B2PA 1G4AE 4J0CA 4MUYA 3DEZA 2Q4RA 4ZARA 3D4OA 1I7DA 1FSPA 5BYBA 3DVAB 4EI2A 3H13A 5C5CA 1VG9B 3L7YA 3LIPA 2Z5LA 4BIIA 3LC2O 3CNHA 3LDAA 2Q62A 1N5MA 4QQ8A 3DEAA 1ZKMA 1XA4A 2QD3A 3HU2A 3KR2A 3VR5A 4CI0B 2GASA 1Z4KA 3MYRA 5FNZA 3UK2A 2H1IA 1C9DB 3EAGA 3GPDG 2RGAA 3WYFA 4DA0A 5ENDA 2ZPTX 4GS5A 3WGKA 2W93A 3A6GA 3BN3A 2JBHA 3TSAA 1JHZA 5BRNA 1U11A 4TTPA 5GMOA 2QN1A 4JODA 3KPVA 1U3TA 1EFVA 1OLSB 3R6GA 5BPHA 1R3UA 3H1FA 2VZ9A 3W9SA 3E9NA 3SE7A 4FOOA 5KYTA 3CVXA 2F8TA 1FU4A 3IC5A 4HDNB 4HB0A 3UGKA 1RBZA 1COWA 4IWXA 5TPWB 5TMBA 5KNBD 3BD6A 2FLKA 1CUUA 1C3EA 3OTHA 3F9IA 1PUJA 4CKEA 4J8PA 3IAFA 1RXVA 5K3BA 2X19A 5C8YB 2BBOA 1UBSB 1MOSA 2I2DA 1E69A 1H3EA 1H4TA 1N75A 1NQUA 1E3WB 3EVFA 3N05A 3U9SA 5JFGA 5JDIC 4PV7A 4OB7A 1LSSA 3ITNA 1QGUA 4EW2A 3HYSA 4R3UC 2PKXA 3SHTA 1IM5A 2O8DB 1CRPA 4BY9E 3AIIA 4Q1VA 4RHXA 4Z7OB 4Y9TA 1JFRA 2FMHA 2KBEA 1NNI1 1L3IA 3QU7A 1T1IA 1PEAA 2AYXA 3BREA 3BG5A 3AGPA 3R3ZA 1UBFA 4IDQA 3ROGA 2PTGA 4LY9A 2C7QA 4BV8A 3NW9A 3HL4A 4H1TA 1DKNA 1X7XB 2IYXA 3OLZA 5EE1A 3GEMA 1LLCA 4KPGA 1VKOA 3SYMA 1U8TA 4MIKA 3K2BA 1IB6A 2G5PA 1ND6A 3H05A 4LYJA 1RYZA 2ERCA 1IC6A 3KSMA 3W8FA 1AQYA 3ZQKA 1D6SA 4JJAA 1NQAO 4ETIA 5KNBH 4M36A 1G8YA 2AXQA 2QUKA 3NG1A 4ROTA 4A91A 1YAHA 3IALA 3MINB 4IUBS 3O4FA 4C2BA 1SXJA 4C3VA 1ZHHA 4EUKA 1EJ2A 3ZDBA 4TWAA 2QX8A 1CUFA 1D2EA 3RKSA 5CNJA 2VATA 3ZE7A 3BFPA 4ZVNA 3KPYA 3MWEB 4TTSA 1SCKA 1TM5E 2A86A 1LPMA 1DFHA 3A7EA 1A2KC 3KVRA 5DNUA 2CMFA 1EZ1A 3FCCA 5KHOC 5LSAA 2AJCA 1RZVA 5H0IA 4B44A 3ASVA 1KF0A 3DR3A 2R5NA 3I76A 3K6SB 1NQVA 1DT5A 3A3PA 3I6IA 4YONB 5I9MA 3WL6A 4WEQA 4TXJA 2Z83A 5IPFA 3HVJA 2OCYC 4IJKA 2PRJA 4EY5A 1QRUA 2R6FA 2WNSA 4C2TA 3R3YA 4B3GA 4Q3KA 3QE4A 1NKSA 3DLCA 1VG1A 3RTAA 4AKHA 1CQJA 1MA0A 4OQNA 4H77A 5EERA 2YV4A 5LYJB 4MRRA 3CVYA 1UXGA 2Y6VA 4ZDWA 4V0SA 1ONPA 3U4QB 5F7JA 1YVPA 2W2QA 3EN0A 2AN3A 3OBBA 3MT7A 4BRSA 3EP9B 2JA2A 3KYCB 4NS4A 3HCAA 4EHLA 5C32A 1DAEA 3TE7A 3LH5A 5JAUA 3OCZA 5JRZA 5KOJB 1ADCA 3CLKA 2AFRA 4FB5A 5DNAA 2PZGA 4DW8A 4IDPA 1RVDA 2J6CA 3PGXA 4EKGA 4LRUA 5HGXA 3FCSB 2HQ1A 3FPSA 1GL6A 3C6QA 8ADHA 2G80A 2Q2NA 3IKJA 1TADA 3GMDA 4V2UA 2V54A 3U2QA 2PUWA 3KSAC 1VZ2A 3A58B 4HKTA 3LPLA 2WWFA 1YRWA 3FHOA 4NKRA 1NVDA 1SUPA 2CEKA 1BE8A 3EXEA 4Q7MB 3WLQA 2VXOA 1BXKA 2BMFA 4B6EA 1ENYA 1A7AA 4UZSA 4CDRA 1OLOA 3OCVA 4BO4A 2I03A 2YZNA 3EY4A 3LVRE 4IIXA 4AU1A 4YUAA 1UBLS 1ISRA 2JFVA 2B4KA 1NVUQ 2BFNA 5G4LA 3W2FA 3I64A 4BGEA 1QP7A 1P9NA 4PG8A 2GHQA 4FN5A 4IXTA 2Y77A 1FYVA 1QSGA 5JZMA 1BWRA 2PGJA 2UXDB 4BRWA 2QR3A 3E3LA 1R0KA 4UVEA 4ESVA 1U0TA 2Z4SA 1YJCA 3MWYW 1E60A 1N1DA 3FHCB 4YN3A 1JWLA 1JBQA 1JMKC 2C2YA 2QTTA 3WKCA 1J9EA 3HUUA 2QTWB 4OK5A 4AJ9A 4AZ3B 4LF8B 4OY3A 4YWHA 1AKEA 1Z6PA 2CLOB 3IVGA 4Z2AA 4RTJA 2QU7A 3NM5A 4KO1S 1RHKA 3IPAA 4IVRA 2R00A 3EGXB 4AICA 4FEYA 1QZUA 5J2UA 2AJTA 4R51A 4EQZA 2J9FB 1U81A 3PSAA 1XTZA 2Q5HA 3P9QA 3PLAE 3DE7X 1E1LA 4KQXA 4G1EB 1AKVA 1HKUA 2A84A 2VOEA 3NGLA 1W94A 3CPJB 3MSCA 4I2NA 5CH5A 1OYVA 3O8OA 3TLAA 4CKCA 3O03A 1JT9A 2WQZA 1VRVA 1II0A 1CUCA 2R8XA 3L9XA 3PUKA 1X2EA 3K15A 3PXXA 5GGYA 1R9NA 3ZV7A 3TDMA 5LD2C 4B35A 2LXNA 2IYTA 2I62A 4EOGA 3SIWA 3GLIA 3CN7A 3FLEA 3RVOA 4XW2A 2Y4NA 4IILA 3NGXA 2I1LA 2DQSA 1WMSA 1MJGM 2AI1A 2BDUA 2GEUA 4HXFB 4WX2B 1LBSA 4KH0A 3GIWA 4NNOA 1SUAA 2VDUE 3EC2A 4I5EA 1XD9A 4G1BA 1I9CA 4F72A 1TJYA 3GPCA 3K4PA 1KY5A 2R86A 3IOCA 2ODNA 1TW3A 5ALYA 3QRWA 3AK4A 3UAWA 2WUEA 3FPHA 3M9WA 4AX8A 3QPWA 4HRXA 1YJQA 4MS4B 1IMOA 4XEHA 5EVJA 4M54A 3VI4B 3SVZA 3AVOA 2RHHA 2TS1A 3EEIA 1E3JA 3W8NA 4F4HA 3GLKA 4RF4A 4PAWA 3TL2A 2LW7A 1YB4A 2ZS8A 3ZY4A 1ZGGA 4U7PB 4GICA 3OO1A 4FWIB 1JE1A 4LJ7A 2I6QA 1QFJA 1JDZA 1I2DA 3CZCA 1GA6A 4IG4A 3K31A 5AW5A 4EYQA 4EG3A 4TX1A 2COEA 4G85A 4MRMA 5L3SA 3MJCA 4KKVA 4FDLA 1QUEA 5KTOA 1W5FA 3RS8A 4TUYB 3UM9A 2G28A 1H5QA 4A8HA 1HI9A 1WPXA 3ELWA 1U2QA 2OCGA 3N2KB 4HB3A 3THWB 2G70A 1BGXT 1RXYA 5JE8A 4FFLA 4E08A 2BLNA 2ZSEA 1CY4A 3OIUA 3FUVA 1YL5A 2XRMA 2MDTA 4OI0A 1FXUA 4DNXA 3RU2A 2ILVA 1UBGA 4C06A 2VYND 5ESXA 2O48X 4R01A 1TEZA 4LMAA 1BKYA 4KAFA 3W3AD 1EP3B 1NQXA 4KN5A 1TTPB 2CHUA 2J9GA 2RK3A 1Q7EA 3HP1A 4ZRNA 2EVWX 2WWYA 2GEJA 1D09A 1MABB 3URKA 3WDMA 1C3OB 1GFZA 3KNZA 5KINB 3EGOA 2B8NA 3HL0A 1OI7A 2JRCA 2QAGB 2PT9A 2XNJA 1AHPA 3DUFA 5ALQA 2FZVA 1EMDA 3ASYA 4G84A 4IDOA 1QFSA 2ZJ8A 2EX1A 5U4QA 4WCVA 3ZDYB 5IW8A 3VO1A 2HCFA 2WSYB 2Z1MA 1C8LA 1CUYA 3LA6A 1SEVA 4HNVA 3WQQA 5TF0A 4IKPA 3T3GA 1Z28A 3TW8A 3QKRA 3UJ7A 4ALIA 1LZKA 3MMZA 1YDHA 5AVWA 3QLUC 2HCTA 4IF6A 4J7AA 5CM9C 4EJSC 3E27A 3T9AA 4A16A 3LO5A 3HDTA 4PSKA 5LZ4A 4F21A 1Y3DE 2ZSJA 4WASA 2HX1A 4L57A 4QPPA 1HG0A 4QDUA 1DOAA 3PDJA 3I0ZA 1QLWA 4LWOA 5E0KB 3T06B 4HXEB 3RF7A 1LLQA 4TV9F 2PXAA 1Z0KA 3VSDA 1GZDA 2G82A 1EFKA 1GQ2A 4ENTA 4N7MA 1WB9A 2HIAA 2OQVA 5A9RA 3MAAC 3TLCA 2WHEA 4QPCA 1A5BB 4IXDA 2R97A 3RS5A 5DHRA 5EP1A 2OXRA 4KQIA 3PDUA 4UE6A 3SKYA 1C8VB 1P73A 3HWRA 5BN1A 2BVNA 1KMMA 2XDQA 4HATA 4V38A 3T9EA 4U39A 2ZI3A 4R54A 4RGQA 2M9MA 5IRCD 1Q6ZA 3CSSA 1A9PA 3JQEA 3MN1A 4UU7A 2OXFA 3CG4A 1CUJA 3VSEA 3LGXA 4QD3A 3G7NA 4FU0A 3AFIA 2QW1A 2B8EA 3MIIA 1EWTA 2OCAA 3IAS6 2JLXA 2V98A 3V6LA 3MCTA 1HTWA