3V1YA

Crystal structures of glyceraldehyde-3-phosphate dehydrogenase complexes with nad
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
335
structure length
335
Chain Sequence
KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of rice (Oryza sativa) glyceraldehyde-3-phosphate dehydrogenase complexes with NAD and sulfate suggest involvement of Phe37 in NAD binding for catalysis
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Oxidoreductase
molecule keywords Glyceraldehyde-3-phosphate dehydrogenase, cytosolic
total genus 120
structure length 335
sequence length 335
chains with identical sequence B, C, O
ec nomenclature ec 1.2.1.12: Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
pdb deposition date 2011-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain
A PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v1yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v1yA01
1VL8A 2J3HA 3HDJA 4BGEA 1SBYA 1QP8A 2OL4A 5T5QA 1BXZA 1YDEA 2I67A 4ALJA 5F1PA 1T1RA 5KJEA 1I24A 4L73A 4EJMA 3WGTA 2NADA 2ET6A 4YWJA 3AUAA 5JDIC 3HN7A 2NQTA 3L9XA 1F06A 5IDYA 1VL6A 2B37A 3F1KA 3EAGA 1U7HA 5B4VA 4FOOA 2HUNA 5TF4A 5EQFA 1A72A 3RD5A 4I8XA 1GEEA 1Q7GA 4O5OA 3CKYA 5BSHA 1JN0A 2VCYA 4FC6A 3WGIA 1VRWA 2J5KA 5A02A 4XKJA 1KVQA 1UXHA 4W6ZA 3ZNNA 4NK5A 4RPGA 4CMIB 1TXGA 2NUAA 5DNAA 1MUUA 3I5MA 3GG2A 3Q2KA 5TJ9A 3PZBA 3TNLA 1YKFA 4B8WA 4TQGA 1B7GO 3BMCB 3H9UA 1MV8A 3T4XA 3E48A 1PJQA 3ZWBA 5A9SB 3WGYA 1LSOA 4J43A 4Q3EA 2QZZA 3TL3A 1MG0A 1IOLA 1PJCA 5C7IO 4KUHA 4U6QA 1J4AA 5A9SA 2AEJA 4FFLA 4A27A 5CDTA 4PG7A 4J0FA 4UUPA 1U4SA 4PLYA 4IUYA 5DT9A 3T4EA 1F8FA 4CM7A 3DHNA 1DPGA 1UAYA 4Q39A 1ZK2A 5U4QA 2VOJA 2DU8A 2GSDA 1C0IA 1DEHA 1UJMA 2YFHA 5LC1A 3GUCA 3LVFO 4IDEA 2SCUA 3F6YA 5HTOA 1U8FO 4ND4A 4D44A 3C1AA 4QFDA 4E12A 1KEUA 1ULUA 2B4QA 1HZJA 1P1HA 1DOHA 3N7UA 2Q4BA 2IRWA 1H0KA 1RM0A 1SPXA 2PTGA 5G4KA 3LLSA 4D45A 1K6XA 3S1LA 1KEVA 3DFZA 4FFMA 3OQ6A 5DULA 1C0KA 2D4AA 4OIMA 4RCVA 3L0DA 2QRLA 2EP5A 5JMPA 4D41A 1BW9B 1QYWA 2BF7A 2ZYAA 4JBIA 4ZA2A 2QZ9A 3U4IA 2Q1TA 2DUWA 3OJFA 4DA9A 1E3WA 1HYEA 5F5NA 3TL2A 1DSSG 2GO1A 3BMOA 1D1SA 5DDIP 2AA3A 2JJYA 4KMSA 4P4NA 3R1IA 4IDGA 3I9NA 1DFGA 1KVTA 1UUFA 2NSDA 3WG9A 1JU9A 1QSGA 4DC1A 2IODA 3ON5A 4J16A 1HE4A 3WBFA 4WLUA 5HS4A 1RJWA 2HMVA 5K6AC 5CG2A 3BMNB 3VDRA 5M6DA 4M49A 4CV2A 1ENZA 3QVXA 4ID9A 3JQFA 3TZ6A 1PU2A 4BB6A 4K1LA 1ZMOA 2D8AA 3JD2A 2P5YA 2ZTLA 3UXYA 3VTZA 3D7LA 1NNUA 2EHDA 1OOEA 2FP4A 3ZNPA 3FPCA 4OH1A 2DTXA 4L4RA 5JC1A 4L4XA 4BNUA 4L8VA 3HFSA 5TT1A 3WQQA 3VH3A 4LSMA 4B7UA 2UVDA 2NLOA 1UZLA 3DMYA 3VPGA 1WNTA 2ZB7A 3AI2A 3PYLA 3WGZA 2GN9A 1H94A 3JQ7B 3CINA 3R6DA 4YAIA 4BOYA 1EQ2A 5JDCA 3HFGA 5JCJA 3WNVA 2EEZA 2NU8A 1EK6A 2D3TA 3B1KA 1H6AA 5TS3A 3L4SO 3UFXA 1DC5A 2A4KA 1XHLA 1XIVA 3VPFA 5BSGA 3KOUA 2D5AA 2AQ8A 3G0OA 5CP8A 4H15A 4GH5A 4PLHA 1S6YA 3LT1A 5CDGA 1LLQA 3DDNA 1K89A 2OO5A 4YR9A 3IP1A 2NVBA 3NJ8A 4D3SA 1E7MA 3RFTA 1J6UA 1GV0A 5K6AA 1HLPA 4K26A 3PFFA 1C14A 4OL9A 1BXGB 1TI7A 2JD0A 4DUPA 5I7FA 1V3UA 1E1LA 2EKPA 4HNHA 4I9UA 3PK0A 4OAQA 5CEFA 3ZHYA 2HK9A 3WGQA 1Y9AA 1NVMB 3NKLA 1X7GA 3H9EO 1SB9A 2IE0A 2GZ3A 2GNAA 1XDWA 1Q1NA 3SBOA 1K3TA 4MP3A 2D0IA 4BNNA 2Y1GA 2YY7A 2Y1FA 4F6CA 1EDOA 4CM4A 4CV1A 4HFNA 1PEDA 4ZICA 3NUGA 4R3WA 1FDSA 1WMAA 1ZMTA 3RU9A 4CM6A 3RUCA 1AE1A 2D5CA 4FBGA 2GN6A 3MCVA 4A26A 5KOIA 4DBVO 4GL4A 4LCEA 3BIOA 4PVCA 4J0EA 2VNAA 1EDZA 1Z45A 1ZVMA 2NVWA 3C8MA 4BQPA 3RKRA 2GN8A 4E5KA 1CERA 3RUFA 3KYDA 2QIOA 3JYLA 1E77A 2W2LA 3F5QA 1KEWA 5EQDA 1SEPA 5T57A 5IN4A 4WLOA 4IMRA 3L4BC 5ITWA 1UP4A 4FIZA 4UREA 4UULA 2NVUB 4DMMA 4Q3NA 1YRLA 2PZLA 3W4JA 3DEYX 3KVOA 1VKOA 5I9NA 3QVOA 4W7IA 4PZDA 5IZ4A 3N74A 2BFAA 4RVFA 2IEBA 1WAMA 3VPSA 3LSYA 5BSEA 3I9MA 1I33A 3ZWXA 2O3JA 1MXHA 3RI3A 3M1AA 2E4AA 3DXFA 5TNXA 1SCUA 2VWPA 4R16A 3FTNA 2C29D 4UAGA 1QV6A 2EIHA 1SOVA 3VOSA 1FXSA 1HDXA 5ER6A 3DAFA 2PH5A 3OMLA 4MINA 1EUDA 1LBEA 2ZJ1A 4J9VA 2UDPA 4P4GA 1IUKA 1IE3A 2AG8A 3O8QB 4WCFC 3WFIA 2RBEA 4RVSA 5DN9A 4YAGA 4E2ZA 4XGIA 5KVSA 3K2BA 3O8QA 4IDBA 2P5UA 1XKQA 2P91A 5KVCA 4MIEA 4XCVA 3SJUA 3O26A 1KY5A 1NM5A 2ZTUA 4QT0A 1M6HA 4MKRA 1DB3A 3W8DA 3W4KA 2Q1SA 5C3MA 4FB5A 2FWMX 3QRWA 5KKCA 3GZ4A 4TZKA 2OBNA 5EERA 3PDJA 3ENKA 5HA5A 4YRAA 1ZUD1 4PIVA 3EMKA 2VT2A 4NR0A 3DBLB 3EC7A 2C20A 4FFRA 2VQ3A 3OIFA 3UOGA 1EVJA 4X54A 4NHEA 4DBZA 1BSVA 5DCUA 4UUOA 4YCAA 3TFOA 5GZ6A 1QMGA 9LDTA 2QRJA 4R9RA 4INAA 2W2LD 3OEYA 4NBVA 1JWBB 1LSSA 3PTZA 3U09A 1VKNA 4E2XA 4BV9A 3OJ0A 4I9NA 4TRNA 4H7PA 4YAEA 3VVBA 3L4BA 3GVXA 4XWYA 1BHSA 3RBZA 3JSAA 4EW6A 4QXMA 4XA8A 3K30A 1ZJYA 3MTJA 5TRTA 3BTUA 1SNYA 5KVVA 5KIAA 2OOSA 2ZKLA 5JS6A 3ZNQA 4OO3A 4NMHA 4NJMA 2O23A 4YQZA 1Y7TA 4CMIA 3Q1LA 3I83A 1NXQA 4PLTA 1W6UA 4PG6A 3ZGYA 1ZK1A 2ZIZA 2X6TA 1HYGA 3BHMA 2O48X 4WGGA 3V2GA 2YHUA 2VRCD 2Q22A 1QXSA 1VM6A 3DBHA 2O2YA 2X4GA 3ZU3A 4B8ZA 3E82A 2Q1WA 3HG7A 4BO4A 4RV9A 2YYYA 3B70A 1O9BA 3IQDB 3NAQA 3BXXA 4NZ9A 1MP0A 4OQZA 4E31A 3KBOA 3LDHA 3C7AA 1DIBA 4JLWA 1JTVA 3CTMA 3K9QO 1MX3A 2X0NA 2FR1A 3E8XA 4BO0A 1EVZA 4CV3A 4R1TA 4IIUA 4BKRA 2JCXA 4BO8A 2NACA 5G4LA 2I76A 3ETDA 1N1GA 1LQUA 1WMBA 3QWHA 5F3RA 2VUUA 2I3GA 4E0BA 1VLLA 4A10A 4NBTA 3OJOA 4BO1A 4C4OA 3RC2A 3KETA 1UXIA 3H5RA 4J1SA 3JD4A 5IF3A 4NQZA 5DP2A 4IZIA 3WYCA 1NVTA 3H9JA 4FGWA 4GX0A 1EBUA 5L7TA 2HJSA 3CSDA 4ONEA 1T24A 1MLDA 3DZGA 1PL6A 4QQRA 4B4OA 1O89A 2DAPA 2JL1A 4LGVA 2NM0A 4BNLA 3VH1A 4GX1A 3UHAA 1BW9A 2JD2A 5HS6A 4C7JA 3MJVA 1U1IA 2TMDA 1H6CA 5I9MA 4P8RA 3BMOB 4TMFA 5IDQA 3RUDA 3TJRA 3WIDA 4XZ3A 2WYWA 2Q45A 5JYEA 1YL6A 3L6DA 4RL6A 4XGNA 2DBRA 1X15A 3IKVA 4DWVA 3ADPA 4GVLA 3KSDO 1B15A 1EVIA 1O5IA 2V6BA 2J3KA 3TRIA 4E5YA 4NU5A 5F1KA 3KO8A 4CMAA 1JAXA 1PGOA 1PQUA 2WD7A 3ZV4A 4R5HA 5FWNA 4BNIA 5A1TA 2WD7B 4AJEA 4ZQEA 4ALKA 1X7DA 2A94A 4AJ4A 3PQEA 4JROA 5AXBA 1BDMA 4U0JA 3PIIA 3WTBA 5BSFA 4TVBA 1UDCA 3SVTA 2DLDA 4TWRA 1KOLA 2NWQA 3IIEA 2C54A 1IZ9A 2ZYGA 1QLJA 3VKVA 5FEUA 4UVIA 1BVUA 3IJPA 3PPIA 3KXDA 2AEMA 3A4VA 1Y8QA 4FJ0A 4RVDA 4AJPA 3FR8A 2DFVA 3ULKA 5JAQA 1PJ3A 2ZB8A 1U5AA 4P4LA 4YDRA 4YACA 5AOVA 1AXEA 3WNQA 1E7YA 3TZKA 1YONA 1YH3A 4H16A 3SX2A 4WLNA 1TA4A 4R9SA 1PTJA 4O0LA 4D0SA 3PIDA 1F8GA 1BWSA 2EP7A 1WVGA 4BNWA 1AGNA 3BMCA 1P1IA 2VYVA 1W4ZA 2P9CA 1LSJA 3H9GA 5CDUA 1PZFA 3ITDA 4E21A 4D42A 2O4CA 1K0UA 3HZZA 1Y1PA 5EN4A 4Z9FA 1XLTA 2AHRA 1DLJA 1ADBA 2PZMA 5DBIA 4KP7A 2PKQP 1GUYA 1PR9A 5KCZA 1Q0LA 1H9AA 2OP0A 4M87A 3D1LA 2JHGA 1L1FA 4Y67A 1PZHA 4B7XA 1ZH8A 1PJ4A 5A05A 5KVQA 3ZW8A 1I3LA 3DQPA 4TKLA 3LF2A 2P4QA 4B4VA 3OM9A 2C5EA 2CY0A 4J2HA 1O8CA 3T7EA 3PLRA 5DF1A 3W4IA 3RFXA 3MWEB 4OXKA 2Q50A 3U4HA 1YL5A 5CPBA 3Q11A 2QRKA 1ZSVA 1FF9A 3PLNA 4QSMA 3K6JA 2AEFA 1AHHA 4B7CA 4E30A 4IQ0A 5TSDA 2VWQA 4I08A 3VPXA 3MJ4A 2ZJ0A 2VRCA 1O0SA 1HLDA 2BKAA 2Q3EA 1HETA 3PHGA 1PS8A 3PXXA 4FFPA 1CF2O 5JCXA 2DQ4A 4OSOA 1X13A 5AXAA 3ASUA 4JBHA 3AY6A 3K2EA 1U3VA 1TT7A 1ORRA 2ZB4A 3HNPA 2XAAA 4IINA 4KOAA 4J9UE 3U5TA 3AUSA 1HDOA 5IG2A 3ASVA 2VOEA 3A14A 3O03A 3GMDA 4MO2A 4ZN6A 3AM3A 4MOWA 3CE6A 1Q0HA 1GQYA 3GY0A 3TOZA 2H5LA 1LEHA 4L9RA 4AFNA 1PR3A 4NK4A 3DHEA 3KLMX 5IXYA 2WSBA 4GX2A 4YXFA 4EUEA 2O3UA 1RM3A 5KWEA 2DM6A 2H63A 1H6BA 3KEQA 2EJVA 3I9KA 1FDUA 2O7QA 4Z3DA 2EF1A 4DPKA 2CSUA 4QECA 4D3FA 2B4TO 1U4OA 3B1FA 3UCFA 4RLSA 3PVZA 3DZHA 4EUFA 3PFWO 1N7HA 1U9JA 3C1OA 4EZBA 1R66A 4BGIA 2NNLD 3JYPA 4Q3BA 1E3EA 1DJNA 1E3JA 4KUEA 3W6ZA 2FHSA 1ZSYA 4DLAA 2VNSA 3O38A 3D3WA 3PQDA 2X7HA 3C7CB 3FF4A 2X1HA 3QLJA 2X0JA 3NDIA 4IJUA 4XYGA 3GT0A 4ZGWA 2JCYA 3GLQA 1HSZA 3E5RA 2OGUA 3S2EA 1N2SA 1RWBA 4NFYA 3JD1A 3U4DA 3KEOA 5JFOA 3KV3O 4RGBA 4BUCA 5T67A 4CLRA 1FJHA 2D59A 2XF8A 3DAGA 2CMDA 3GOHA 3JQAD 4J6FA 5J23A 1OC2A 4GPD1 2O3RA 4CLRB 1WWKA 4HX5A 2FY8A 4RDHA 2NV6A 1HEUA 3A06A 2O50A 5CDYA 5MDHA 1GL3A 2VWHA 3UCEA 3DL2A 2DFDA 1PS9A 4M89A 5TX7A 4FOSA 1NQ5A 1ONPA 4CM8A 1YWGO 1LRJA 5COQA 3M1LA 3ANNA 2O2SA 5T64A 1DRWA 4AJ2A 1ZFNA 5FYDA 4D0RA 1QYDA 2VZ0A 5DCYA 2ZCVA 5G0VA 4BKPA 3H3FA 3OIDA 4YT8A 5L40A 2HK7A 1U3UA 4DXHA 2PA3A 1XWFA 3GEGA 3GVPA 5B4TA 1LDBA 2FR8A 2JD1A 1BTOA 4LW8A 3K73O 3PYXA 4CM9D 2HMTA 3ZN2A 4DIFA 4JGBA 1H6DA 2PY6A 5H82A 1X0VA 1AUPA 1NASA 1M67A 1MXFA 3BHJA 5L3ZA 3OQ1A 5JE8A 1GYQA 5JMWA 5F1OA 1CYDA 1GAEO 4UEKA 1HKUA 3VC7A 1I3NA 1MC5A 3KTDA 2GGSA 1PJ2A 3ZI0A 4YT4A 1E1MA 2VHZA 3QV1A 1ML3A 4GWGA 5AXDA 3WWZA 1OFGA 3WLFA 3JQBA 4NJOA 2NU9A 4ZQGA 2QX7A 3SEFA 4Z3KA 2HK8A 4RZIA 4GSKA 4UVDA 4UVGA 1T4BA 3H5AA 4M54A 4A03A 2R2GA 3ZWCA 3R0IA 3LT4A 1O95A 1E92A 2J5RA 4GKVA 3SLGA 4ZQHA 2CF6A 4Y9DA 5L4SA 4YT5A 2VYND 4BNHA 2A9FA 4P38A 5G0SA 3OIGA 3U9LA 1W73A 1ZW1A 3WGGA 4FW8A 3DONA 2IEDA 3KZVA 3ZWWA 3GRKA 4BGUA 5ENDA 1GADO 2HMWA 3QSGA 5MGBA 3DHYA 3PI7A 2E82A 4GGPA 4LCJA 3FNHA 4W82A 4DYDA 3KHUA 3HSKA 2NU7A 1PGPA 3PWZA 4GX5A 1RYEA 4E5PA 2ILTA 2IXAA 3ZDFA 1ENOA 2EW2A 4Z0TA 5L45A 3Q3CA 1WDMA 2BGLA 2VZ8A 5F5LA 2CVOA 4DVJA 1QYXA 2Y66A 3AWDA 2NTVA 4YBZA 1Q7CA 1XEAA 1T26A 1A7AA 2A35A 3V1TC 5I9LA 1E7WA 4OYRA 2BI8A 5H83A 3UAGA 4HADA 2P68A 4URFA 5AQ1A 1L7DA 2BRUA 3T7CA 4WEOA 3WTCA 3EYWA 3ZZNA 4DLLA 1GZ6A 3I23A 2HMUA 4XQEA 2HCTA 1LRLA 4CLXA 5L51A 2YW9A 5I7SA 1B26A 4N54A 2V7PA 1XG5A 2Y1CA 2DT5A 3AOEA 2J3JA 2GRAA 3FCOA 1D4FA 4JX8A 2CZCA 1PWXA 3JQ9A 2DPGA 3KYCA 4J49A 4JBGA 3H2SA 4KDFA 3P7MA 2V6MA 3ROKA 3ANMA 3KYBA 4R1NA 4BMVA 1KVSA 2C2XA 1C1DB 4CLOB 4G81A 2Y1EA 2RIRA 3AUTA 3MWDB 4EJ0A 3SC4A 3TSCA 3OEWA 1XR3A 3L77A 2H9IA 3W8EA 3Q2IA 1I3KA 5JAMA 2VTEA 4ROSA 4PRLA 1ZBQA 1SMKA 2GD1O 1EUZA 4E2WA 3ZV6A 1R6DA 1T2DA 1A7KA 3QVSA 1UZNA 1OAAA 1DAOA 3L9WA 3BZUA 3WOHA 4AJNA 3WYEA 4AJ1A 4XB1A 4NNJA 3RIHA 5K0ZA 1U2DA 1XU9A 2Y0CA 1I2BA 2ZTMA 1JDJA 2PGJA 1TT5B 4XYEA 1G0NA 2X9NA 3DZBA 9LDBA 1C3VA 3LT0A 1CIVA 3E18A 3U62A 4U7WA 1ENPA 2VUSA 1PWZA 4RJTA 4NFHA 1EVYA 4IJVA 1HYHA 4I5FA 4TRJA 3STHA 4B79A 3HE3A 3JQBC 2IYPA 3GGGA 4EGFA 4JQCA 4UEOA 1LX6A 3JQ9C 3TDKA 5JBIA 4CMKA 2FSSA 1WPQA 1NYTA 3VDQA 1D7OA 1V8BA 2J5QA 4JNKA 3TFQA 4RZHA 1DFIA 3FWNA 2QG4A 2I99A 2IYOA 1I2ZA 3PHJA 1NQOA 3IAHA 1ADGA 3G1TA 4IY1A 2NQ8A 3ABIA 3CEAA 1R12A 2UYYA 2W4QA 1E3SA 1K2WA 1FDTA 4RPKA 1MC4A 1B3RA 2Y93A 1PGJA 1LSUA 3VZSA 1LDGA 1ZEJA 1VE9A 2RHRA 4JCOA 4CL3A 2FN7A 3PYMA 1LLCA 3WGOA 4WCFB 3WLEA 5HRUA 3PHIA 1LLUA 5ICMA 3M2TA 1P1FA 2IZZA 1NX6A 1Z82A 1DIHA 3G49A 3INRA 3OECA 3JYNA 4YJFA 3WGHA 1A9ZA 2FRDA 1UAGA 4DPMA 1R15A 1YGYA 2CUKA 4IGEA 4WECA 3A9WA 4UEJA 3VVCA 3F46A 4PG4A 1GFSA 2EKQA 4CLHA 7ADHA 3VPHA 4IGFA 3ZWVA 1V6AA 4PCVA 4NPCA 5DOZA 1HSOA 4AL4A 4I5EA 3GNQA 4RDIA 4LMRA 5ER9A 4R51A 3UCXA 1Q7BA 4GLLA 3WQRA 1H2HA 2NTNA 5IJZA 1HDGO 5KJCA 3L6OO 3IOYA 2Y67A 4IMPA 3OJEA 4CQMB 5KNLA 4RQTA 1GZ4A 4GBJA 4IDCA 1T1SA 4WOKA 1LTHR 2Y1OA 5CEJA 3OBBA 5JCJD 2C2YA 1HF3A 3DAPA 2DVMA 2VYVD 4XB2A 5A3JA 3L07A 2IXBA 1NAHA 4D43A 2YHIA 4XQ9A 2G17A 2Z1MA 1GD1O 2VHWA 4WJZA 2GN4A 2UUOA 3JYQA 3RASA 2YZ7A 4XEHA 1XU7A 4Y6PA 1QRRA 1BVRA 1YDWA 4BNXA 4KUGA 4EI2A 2DTEA 4OKNA 1QKIA 3FNGA 3FI9A 1YQXA 1NQTA 2DPHA 1I5RA 3N58A 1DHRA 4WLVA 2O3TA 3FD8A 1NPYA 4Z6KA 2W2KA 5AYVA 1NHGA 3OJLA 3FPLA 3GZNB 2G76A 3ZV3A 3JQ6A 4PLCA 4CM4B 4MP8A 3OA2A 1IPEA 2EXXA 3LYLA 2CD9A 3AUUA 1KEPA 2I5PO 1PQWA 3AW9A 3DOCA 1FDWA 3WICA 1N5DA 4EEXA 4QO7A 5DBGA 4WCDA 2DC1A 3DWFA 4WNIA 4FCCA 4E32A 4XR4A 5FI5A 4YQYA 4DQXA 3E9QA 3FWZA 4IDDA 3WWYA 5L4NA 1XYGA 2XXJA 4HP8A 1I8TA 3I6IA 4O59O 5K9ZA 1Z7BA 3FN4A 1JKIA 2VHYA 5H81A 3GFGA 4CMEA 4HFJA 4CMGA 4TVOA 3MZ0A 4B3HA 1P9LA 4LN1A 3ZU5A 2V6FA 5JSFA 3GEMA 3ST7A 4ZRMA 2BI7A 4R01A 4BKUA 1V9LA 1SZJG 4AJHA 4WASA 1UH5A 4UUMA 1B8PA 2X58A 4N18A 1LU9A 4WCFA 3SLKA 3F4BA 2W98A 1D1TA 2I9PA 5BNTA 1B8VA 3NRCA 5KJ1A 4OHUA 4E3ZA 4EJ6A 3CMCO 1F12A 4IJWA 4BO5A 5AVOA 1JKFA 3C7DB 4LSWA 3E6AA 1Q0QA 1H93A 4CUJA 1PQPA 4PVDA 1PZGA 4RVUA 3ZWAA 3H7AA 1VSUA 1P1JA 2Q99A 3AOGA 1Z74A 3OP4A 1ONOA 3GDFA 4L76A 2Y99A 2AXQA 3GN1A 3I4CA 3KRTA 3ZWMA 4O6VA 1HDRA 4JP2A 1E1KA 3HJAA 4J7XA 2P4HX 4RVGA 3GAZA 3GRPA 1AN9A 2F1KA 2JAPA 1Z73A 5TLSA 3D3WB 4R3NA 4ALNA 5IFLA 1R4NB 4EYEA 3BTVA 1ULSA 1WLYA 3HB5X 3GH3A 4EBFA 3LQFA 4KWHA 3LT2A 4M55A 3NGLA 1IL0A 2HRBA 3S2IA 2EKLA 4DGSA 4BGVA 1OI7A 4ND1A 4KQWA 1LNQA 1N7GA 4D3DA 4IDFA 2E48A 2Z5LA 2OORA 3D4PA 2XOXA 5DCWA 2YHIB 3BTOA 4CMEC 3DB2A 2EERA 4OKIA 4AVYA 3WJAA 4JJGA 1NP3A 3OH8A 3RBXA 3ETEA 4N5MA 1M66A 1XSEA 5JYAA 4AICA 4FDAA 4XQGA 3VKUA 4AJKA 3OA0A 5THQA 3WXBA 5ILOA 4Z0HO 1WDLA 4YTEA 3V1UA 5HM8A 1NVGA 3ZNOA 1C1DA 4CLOA 5FI3A 3KYCB 2B5VA 4FR5A 2BFMA 2X22A 2PLAA 2BFPA 1XCBA 4LVUA 1LJ8A 4A0SA 5JNLA 2Q4EA 1PJSA 2PH3A 4PFJA 3H65A 1XQ6A 4CLDA 3OICA 1F17A 3GNSA 2GCGA 2FSVA 2QHXA 2X5JO 2RH8A 5ADHA 1CQIA 2VHXA 2ZYDA 4DTIA 5ICSA 5ILGA 3SJ7A 3IUSA 1HT0A 3GVIA 2DKNA 3TPCA 4S1VA 2YFQA 2EGGA 1Y5RA 4R4JA 2WJPA 4CUZA 2GYYA 4J4TA 3NT4A 4XJSA 1GCOA 3GC6A 3WSWA 4BMSA 1G6KA 3WFJA 3FSRA 3UN1A 3LLVA 3GHYA 3RUHA 1DIAA 3AI1A 4MKZA 2FPIA 1KETA 1EQUA 3X2FA 3U3XA 5A4DA 4HXYA 4YB8A 1T2FA 3E1KA 1R16A 4F3YA 1TT5A 1O94A 4HFMA 2E37A 4NBWA 5IDXA 1E3LA 4DQVA 1NPTO 3K5PA 2O4UX 1YS4A 1DBVO 4BHTA 4FS3A 4HNGA 3KUXA 2HRZA 4GSLA 4CJXA 1ISJA 4BNFA 4LK3A 4YAJA 5KJFA 1R0SA 3A28A 3JQDA 4HKTA 4CM1A 3PJFA 1NR7A 3Q0EA 3P2YA 1D3AA 2EWMA 4QEDA 3AY7A 2Q46A 1U28A 3RJ5A 3M2PA 4FSHA 1HDYA 2HJRA 2C82A 3ZU4A 1BDBA 1PS0A 3AM4A 3AY3A 3WMWA 3GN2A 5CEEA 3DTYA 3WSVA 1LRKA 2WTBA 2LDXA 1IYZA 5C37A 2DBZA 3RSHA 3S55A 3B1JA 4R41A 1D8AA 4CR8A 3AFMA 2DBQA 1W0CA 1I36A 2HKIA 3OFSA 3G3EA 3GGOA 4YJFB 2OBYA 4NH4A 1R0KA 1SC6A 1M2WA 3EW7A 4M86A 4WLEA 4N7RA 3CZMA 3DZKA 1A71A 4OXYA 3DZJA 3I6QA 2GASA 1C1XB 3DO5A 3WMXA 3ZWNA 4ZQBA 3C85A 1PJLA 2PGLA 3DBRA 3PJDA 4OGWA 4YVFA 5JPIA 4A2CA 5TGDA 3NTQA 3GPIA 3PHHA 3D5TA 2E6UX 4AJIA 3F3SA 1UXJA 3PEFA 4WPGA 2I65A 4RLHA 4DIBA 2WEKA 1RM5A 4PLGA 1U3WA 3HDYA 1XQ1A 1ZCJA 2AQHA 3ICCA 1ZO8A 5DBFA 2EG9A 4OMUA 3RBVA 3GQVA 4FPXA 5HWSA 1E6WA 3GDOA 1I2CA 1ZK3A 2DTDA 4ND5A 1UZMA 3JTMA 4XYBA 3TN7A 1X7HA 2X9VA 4WKGA 3RUEA 3UH1A 1UXGA 2WE8A 1QV7A 4FFOA 1PX0A 1R4MB 4L4SA 4LVCA 3VAZA 1OC4A 2GR9A 2NTJA 1R4MA 1GDHA 1NPDA 3QWAA 1BXGA 4ILKA 5I7EA 5B4UA 4TRRA 2CFCA 1QORA 1QYCA 1U3TA 2G1UA 4XRRA 4AG3A 1KC1A 2W8ZA 1DIGA 4CM8B 3U0BA 4BNGA 3F4LA 1IULA 2X8LA 1CWUA 3PDUA 1BRMA 1WDKA 4BO2A 4MIYA 4ZVVA 3EZYA 5IDWA 1M75A 1BXKA 4XDZA 4WE3A 4XYLA 1EUCA 3WQSB 2XXBA 5B37A 2B0JA 3RKUA 2O3SA 5B1YA 3ROPA 4W9NC 4E33A 4UVHA 1S7CA 1ZIDA 3WR5A 3D4OA 3E9NA 3MEQA 4TKMA 4F6LA 3H4VA 4MDHA 1X0XA 1RYDA 3GVCA 3NJ4A 1ZSNA 1YB4A 3GEDA 4BO3A 3GMSA 3QW2A 4J3FA 1V35A 4RF2A 1CEQA 5JY6A 2B36A 3RWBA 2NU6A 2PWZA 2CDBA 1AXGA 2RH4A 4A5OA 1J0XO 2C7GA 1EFLA 4OQYA 1MGOA 2AQIA 2JFHA 4R5MA 3RCBA 2ZTVA 1NWHA 2NVUA 3PQFA 4EEZA 3FR7A 5F21A 4NBUA 3R3JA 4OXNA 4YPOA 5L4LA 3E03A 3ADOA 4S3MA 4DYVA 4FJ1A 3BAZA 3ONFA 1JAYA 2R00C 1V3VA 2HQ1A 4O1MA 4U6SA 4WUVA 4CL8A 3JQCA 3LZ6A 1P77A 7MDHA 3DZIA 1ZEMA 4IZHA 1Y9EA 5DZSA 3KM0A 2AQKA 4JK3A 1E7QA 5C5IA 4OJNA 5BNFA 5JW6A 5THKA 3UVEA 2C59A 4MVJE 1LUAA 2AE2A 1ISGA 1G1AA 3BHIA 2V6GA 3QP9A 4UUNA 5T8KA 1A5ZA 4W9NA 3PGJA 4DC0A 1PJTA 5A5EA 1E6EA 4J7UA 4J2OA 3QWIA 1MFPA 5JAIA 1NQAO 4GKBA 3OETA 4K9DA 1GR0A 1R4NA 4LISA 3ZWYA 5JO9A 3MJSA 1YOVA 2YJZA 3H6KA 1KYQA 2GF2A 4BO9A 4NI5A 2JFGA 1K5HA 5A5FA 4CQMA 1YOVB 3ENNA 3OQBA 3IDSA 3IL2A 1WW8A 4J4BA 4KQXA 1YL7A 3D0OA 5FF9A 4I1IA 3S2GA 3DTTA 4ZHSA 3KSZO 3AU9A 1BMDA 3UICA 4CMBA 1YQGA 3NT2A 1LLDA 4E2YA 4MVJM 5TC4A 4BNJA 2JKVA 2D2IA 4XR9A 1X1EA 3C24A 3G17A 3DFUA 3K8ZA 4CPDA 1MG5A 1HL3A 2FZWA 3G79A 5U9CA 2G5CA 1ONNA 3WS7A 1E6UA 1IHXA 4Z0PA 2QQ5A 5U1PA 1MFZA 2GZ1A 8LDHA 1JQBA 1WZEA 2PD6A 3AU8A 4GVXA 4BNTA 1YJ8A 2Q1UA 4JJFA 4RF4A 4XX0A 2O7SA 3I3OA 3VZQA 2C5AA 3KSUA 3QQPA 2EV9A 1K6IA 1V3TA 2WYVA 2HSDA 5HBRA 4IQ8A 3H3JA 1HRDA 4CR6A 3ZCXA 3GFBA 4HFRA 4QFCA 4Y6SA 2HU2A 4ALMA 2Y05A 4BO6A 4TROA 3I9OA 4U8GA 2PKQO 1I3MA 4GAEA 5GZ3A 5EPOA 4ZU3A 2AMFA 3V1YA 4O63O 5BQFA 5A03A 3PWSA 2VWGA 1ISIA 3Q6IA 2QW8A 4ND2A 4CMHA 3CIFA 3GPDG 1I0ZA 4WLFA 4EDFA 3FRJA 3QVTA 2Q49A 3B6ZA 4Y98A 3PJGA 4BNZA 1EEHA 2A92A 4LMPA 1LDNA 1EE9A 1HE3A 2PNFA 1EFKA 5IXSA 4E5NA 3ZW9A 4G65A 3MTGA 4QTZA 5BT9A 4MP6A 3RVDA 1B8UA 4RPJA 2OMEA 4WNCA 2FPGA 4PZEA 4RVHA 2BMAA 4CLEA 4W99A 4B4UA 1T4DA 3TZQA 4E6PA 4MVJF 4UVEA 2AE1A 4DQUA 1R37A 2PGDA 2WDZA 5I8ZA 2FZEA 4J91A 4KTTE 3AM5A 3GDGA 5I8WA 3D64A 1PZEA 1B2LA 2CDAA 1GTMA 4I9HA 1DFHA 1K6JA 3AI3A 1G0OA 2AG5A 2E49A 3ANLA 4YJHA 1N8KA 2HDHA 4YYZA 1J5PA 3F1LA 3ROQA 1BG6A 3AJRA 4YJHB 5ES3A 1KBZA 4DPLA 4CM9A 2GPTA 4PLPA 1NHWA 2UAGA 5CFZA 2G82A 2JAHA 2QYSA 1T25A 1RPNA 5JC8A 1SEVA 3TF5A 3IC5A 4YAKA 2Z1NA 3HHPA 1U8XX 4NU6A 2QYTA 3PHLA 5C7OO 2GDZA 3KB6A 2YV3A 1GYRA 3GHHA 3QJ5A 4J1TA 5A3VA 4CQLB 3B20A 1A4IA 5A04A 3JD0A 3LC7O 4OM8A 4IIVA 3PGXA 2Q2VA 4ZJUA 4KTVE 4BS9A 1C1XA 4LRTB 3WYBA 1EE2A 5L7YA 4FFNA 2PD3A 4R1UA 1GEGA 2R00A 4H3VA 3GAFA 3HDHA 3JD3A 3X2EA 3H8VA 3JQ8A 3EUWA 2YQ5A 4U0KA 4ALLA 4TSKA 3INGA 3H5NA 1PSDA 2I66A 4RORA 1ZJZA 2B35A 1NBOA 3E9MA 1GU7A 1U7TA 2CVZA 3NDJA 4MIOA 3OHSX 2ZQYA 1KS9A 2ZQZA 1KVUA 1NFFA 2OUIA 4E5MA 4FN4A 1Y8QB 5IAAA 4PLFA 1JVBA 1U2GA 4EITA 3HQ4O 1B3BA 3ZWOA 5T8KC 3ETGA 3GGPA 1P0FA 2H1SA 1TB4A 4MJLA 2ZK7A 3BYZA 2X0IA 3LC2O 4XQCA 3RQSA 1PIWA 5LDGA 1BGVA 4OOFA 5IN5A 4GLOA 4J1QA 3NT5A 5C7LO 2WMDA 2CDCA 4Z9YA 3JQGB 1PGQA 5CHEA 2X5OA 2GUGA 5A9TA 3GA0A 2LDBA 2P2SA 1VJTA 2CF5A 5CAEA 1R0LA 4NIMA 4PLZA 4KDEA 1P31A 4QUKA 4TZTA 3QWBA 4BNMA 3S2FA 4Y8VA 4Q9NA 6ADHA 4RF5A 4BB5A 1A4UA 1O6ZA 2W90A 3PRJA 3BMQA 4DREA 2AW5A 5CPFA 3CZRA 2X9GA 4Q3AA 1DXYA 3U4CA 3PZRA 1IY8A 4FJ2A 1HE5A 1W8DA 1YE3A 1YO6A 5AXCA 3R3SA 1JA9A 1YB1A 4K6FA 3ZV5A 1E5QA 1UR5A 2Y68A 4R54A 3H9QA 1TLTA 4MVJD 5EL0A 1DC4A 1OZAA 3JQAB 3ZU2A 3DOJA 5L53A 3L6EA 1ARZA 2B4RO 4IDAA 1Z6ZA 3DR3A 4XYMA 4MVJI 1GYPA 4RPLA 1DC6A 1GQ2A 1HXHA 4E4YA 3RFVA 5EESA 5G0WA 3NGXA 3CMMA 4KWIA 2EW8A 2FMUA 2VZ9A 1N9GA 4A7PA 2XPCA 2GLXA 1IZ0A 2VUTA 1X14A 5LCXA 3F9IA 3W8FA 4PZCA 4L0QA 1CJCA 5G0TA 4WK6A 1PGNA 3TOXA 2R6JA 4HUJA 3IS3A 3SXPA 3S8MA 3A1NA 3AK4A 1GCUA 1LQTA 2WM3A 5IZCC 1CDOA 1FK8A 4I5GA 1NR1A 1B0AA 1Z7EA 3DZFA 4R68A 4MVJP 5J9GA 3F5SA 4J1NA 2PKRA 1SAYA 4CQLA 2X86A 4MVJA 1T2EA 3NYWA 2BH9A 1WZIA 1HE2A 3QVWA 2VYNA 3HADA 5T6BA 4FGSA 2V65A 3QA9A 2B83A 3DMTC 3UUWA 1SOWA 2RCYA 2ZCUA 1DLIA 3PP8A 3Q9UA 1JWAB 3Q9NA 1YBVA 1FDVA 3UW3A 1H9BA 2VRBA 4C7KA 3IP3A 3MOIA 1PJBA 2VT3A 4YEDA 3FNFA 3E5MA 1E5LA 1SB8A 4XDYA 4II3A 1GY8A 3O9ZA 2IZ1A 3AOEC 2P9GA 3ICPA 3TZCA 1DC3A 2OHXA 2OZPA 2Y0EA 1WXDA 3GG9A 4NG5A 1ISHA 3VH2A 1P45A 3JYOA 1E1NA 3UKOA 5BNIA 1IHYA 3EHEA 4BIIA 1GV1A 1I30A 3IKTA 4MVJH 4JXKA 2X0RA 1ENYA 3H2ZA 3WX0A 1UP7A 2RAFA 1RKXA 4CR7A 1VJ1A 4DL9A 1Y8RA 4R1SA 1M6WA 4JIGA 2J8ZA 1Y8RB 2BD0A 2CVQA 2HMSA 2FOIA 3ONDA 2JHFA 4W4TA 1MA0A 5G0UA 5BR7A 5TQVA 5L95A 4JJIA 1ZK4A 4B4WA 1DJQA 1A9YA 5GZ1A 1IPFA 1LDMA 4BKQA 2X23A 3ZHXA 2IDZA 1Y5MA 2WWRA 1QR6A 1YBMA 1LI4A 3ZHBA 3DOOA 3JQ7A 3V2HA 1GQQA 3EY4A 2Q2QA 3WBBA 2UUPA 3JQEA 3UGKA 4EUHA 1X1TA 4GI2A 5IZCA 1XELA 2W2KB 3I9JA 2OXIA 4YA6A 3EZLA 2PR2A 3GZNA 3LF1A 3NEPX 3V2UA 5GMOA 4CQMD 8ADHA 5JAZA 2WYUA 1QLHA 1Y6JA 4XD2A 3QWFA 4CV0A 1NWCA 4R69A 3ITKA 4M1QA 1LA2A 1J49A 4YT2A 3WB9A 3BMQB 3HB4X 4CMJA 3WIEA 3V8BA 1NTOA 1OBFO 1EK5A 3MOGA 1LXCA 2HLPA 4BMNA 1I32A 3FNEA 2H6EA 4NJMB 3COSA 3V5NA 2C0CA 4HWKA 4HY3A 5JY1A 1JW9B 2VHVA 3P19A 3JQAA 3QE3A 1VI2A 3D3EA 1EMDA 2WE7A 4BV8A 1YQDA 5G2OA 3NTOA 3VZPA 2B69A 3GF4A 1GUZA 4B3JA 1KC3A 3MJCA 4ALIA 1AHIA 1VSVA 1B14A 3DBHB 3RUIA 4AJJA 2C07A 3NDRA 3QIVA 1ISFA 4N5LA 1HWYA 1A27A 1OMOA 3HDQA 3EGOA 2OFPA 4PGFA 5JYFA 2I3AA 3RUAA 3OSUA 4IM7A 2JCVA 4IPTA 3U49A 1SO8A 4GWKA 2BGKA 1PL8A 3NV9A 4FD3A 4BVAA 5TJHA 3NTRA 3EK2A 4XIJA 1ZXLA 2FR0A 4WEQA 5JLAA 5EINA 1F14A 4DRYA 4GQAA 2Y0DA 5I7VA 4D7AA 3DC2A 2GZ2A 5JDIA 5KTKA 5CDSA 4F45A 4TRMA 3K31A 1RM4A 1M76A 4XIYA 4DMLA 3INTA 1UDAA 5EJ2A 2D1YA 1CETA 4PG8A 3I1JA 1Y81A 3KYDB 2PZJA 3ONEA 2POQX 4BNVA 4PLVA 1F0YA 3CH6A 5TIIA 4FQ8A 2F00A 2JFFA 4OSPA 2RHCA 1E3WB 2EJWA 4W7HA 1HDCA 5JO0A 1GPJA 3DBVO 1ZK0A 4JP3A 1QG6A 3D4NA 3TQHA 2YDXA 1EZ4A 3RROA 4DLBA 4FC7A 5COBA 4IS3A 4IJKA 4ZQFA 1XA0A 3MJTA 1KVRA 1CRWG 4II2A 3IUPA 1UP6A 1KY4A 5A9RA 1DDOA 2CNBA 1GUFA 3CUKA 2WD8A 5KJ6A 3GUYA 4CUKA 1I10A 2GERA 3TWOA 1HDZA 3D5QA 4ZRNA 4BNYA 3RC7A 1EBFA 2PFGA 1TVEA 3BMNA 3JQ8B 2VTDA 4J7CA 4L75A 4CODB 3K96A 2P9EA 1HTBA 1N1EA 2BLLA 1CQJA 3LC1O 1HZZA 1PL7A 1VC2A 3EVTA 3MJEA 5CG1A 4Q3DA 4MKXA 2PV7A 3I52A 4RF3A 4XGKA 4AJLA 5ITVA 4G2NA 3JV7A 3C1TA 4PLWA 3CXRA 1U5CA 2B5WA 1ISMA 3AFNA 3RAJA 3SC6A 3W1VA 4RPHA 1E7RA 1DRUA 4P22A 1P1KA 3NX4A 2UV8A 3PJEA 1VPDA 1ADFA 4ITUA 4ZD6A 1YJQA 2FPPA 4IS2A 4PRKA 5GY7A 4J90A 1L7EA 1DRVA 3EVNA 1UDBA 3I9LA 3WJ7A 1TEHA 4CM3A 3CPSA 4IXTA 5JYDA 5TT0A 3O4RA 1GZ3A 1P44A 1GPDG 3F47A 4B3IA 5LDHA 5EIOA 1NAIA 3JQGA 1JKJA 4PG5A 2O3QA 1LC3A 3JCZA 2J6IA 1YB5A 1N92A 3FBTA 4CM5A 4YJDA 4ND3A 2YV1A 1P33A 4KZPA 4HV4A 2DBVO 1ID1A 3BTSA 3DMTA 3GK3A 3P2OA 1P0CA 1T2CA 4QX6A 1P74A 1WP4A 3LK7A 2YDYA 1DAPA 1DIRA 4Z9XA 5B12A 4D46A 1KIFA 3P5SA 2YUTA 4GGOA 4D79A 4I5DA 3FHLA 4A73A 3RC9A 4IQGA 3TZHA 4BO7A 3VTFA 3RU7A 5KKAA 2ZATA 1JLLA 1XGKA 4M8SA 4Q3CA 3HN2A 1V0JA 1NFQA 2Q2WA 2G0TA 3BA1A 3HWRA 2X5KO 4RQUA 4Y6RA 3HUDA 1T2AA 2HAEA 2BFOA 5T73A 5ENVA 4YRBA 1YBAA 1VJ0A 4NBRA 2PD4A 1YVEI 4YRDA 3KLPX 4RO0A 1ZXBA 3VH4A 2ZB3A 3OF2A 2Z95A 4E13A 1ZZEA 5DP1A 4N5NA 4LRSB 4MVJG 1N9GB 3C3XA 1JVSA 4K28A 2OP1A 1LC0A 3GNTA 4IXWA 4HBGA 3M6IA 3VHRA 1P3DA 4XJTA 2YQ4A 5L7WA 1FMCA 1DHTA 3I4FA 5EMHA 3FBGA 5G4KB 3FTPA 4U5QA 2I6TA 2IZ0A 2J3IA 3PWKA 1IB6A 3QHAA 2YV2A 3IMFA 1ADCA 3DBRB 1H2BA 3K92A 1LDEA 3W6UA 5L9AA 4AJOA 1C0PA 4NDNE 4GMFA 1NFRA 1LDYA 1E0DA 2EGHA 3IJRA 4JN6B 3UF0A 2HO5A 3ZHZA 1E7SA 4QO8A 1B16A 5COAA 4DIOA 4PN3A 3ZH2A 3ORFA 4CMCA 1P1RA 5JDCC 1ZNQO 4G5HA 3VZRA 4IBOA 4OOEA 1QYVA 6LDHA 2BHLA 1UXKA 2Y1DA 4GMGA 1KERA 5DOVA 4BQRA 2PZKA 3WDSA 4WOJA 4XRGA 3G1UA 3GR6A 2VN8A 5A06A 4ESOA 4L74A 3ROMA 4K6CA 3EDMA 4BKOA 3RJ9A 4J4HA 1MB4A 5FFFA 3LU1A 3JQFC 3ZWPA 4BNKA 1Z75A 1H5QA 1YXMA 2TMGA 4MPDA 4F46A 1E3IA 4YJGB 1ZKMA 3DBLA 1Q2XA 2BGMA 4NFSA 2PK3A 4YJGA 3GVHA 3QY9A 4BL5A 5JXWA 2DUUA 2C7VA 1DO8A 1VL0A 3RC1A 1I01A 2BELA 1C0LA
chains in the Genus database with same CATH superfamily
2UVQA 4DBLC 5I7OA 1P18A 2V1UA 2WMYA 4AN0A 1RRVA 2OL4A 4M9UA 1U6IA 4WBXC 1K86A 1YDEA 1Z4KA 4ALJA 1QB7A 1I24A 4L73A 1P81A 2XUQA 1WQ4A 2C92A 1VIAA 4YDHB 5DASA 2ET6A 5CIWA 1C9NA 1TJNA 2H7CA 4MRSA 2CCGA 4PFKA 5JDIC 2HI0A 3UMYA 1L7QA 1F06A 4TUYB 4OHFA 4IYRA 5CT5A 1RTKA 3NWOA 3OG9A 4IJ5A 1RHRA 5ALKA 5TF4A 3A8TA 4F4UA 4QOJA 1ND5A 4KFCA 1VL2A 4I8XA 3RD5A 4O5OA 2O2HA 3ZLJA 1RWXA 2WTEA 4V3BA 2VCYA 2QROA 3DMFA 4QU8A 5FUYA 3WGIA 1CB7A 4LMAA 4A8JC 3EG5A 3V3KA 4URHA 3ZVKA 2OYCA 4XKJA 1KVQA 1UXHA 2G1KA 3HBMA 3ZNNA 1X7YA 2P41A 4I4CA 1TXGA 1QIGA 2IIPA 1OTYA 1FDOA 1PQYA 2IVZA 2NUAA 1G5QA 1XD8A 1RAGA 2Q8QA 2IUYA 3KB8A 1QG2A 3BEOA 5D1HA 3TNLA 2G8NA 1R8JA 3R77A 3ZHQA 2YJ6A 1VE1A 2WR8A 4IGAA 3HUTA 3SS8A 4YJKA 3ZWBA 2REOA 3OKPA 6AT1A 3PQ3A 1WKBA 5A9SB 4Q3EA 3NOOA 1MG0A 1PJCA 3NDBB 5C7IO 1E2MA 2CJXA 4MICA 4U7JA 2R1VA 4Y9RA 5A9SA 5CDTA 3CHYA 3JRNA 3QBDA 2DUJA 1LPOA 5GONB 5DT9A 1IK4A 2EARA 1C3LA 3VDNB 2FN3A 3GBSA 3AKDA 3NEAA 3DHNA 5K8VA 3HA2A 5SV2A 2FHPA 4B3MB 3DC7A 5U4QA 1KDZA 2VAPA 4FWBA 1NRWA 1UJMA 2G07A 4HNSA 4M0MA 4B43A 2SCUA 3F6YA 1PL0A 4ND4A 2BRUC 4QFDA 4E12A 2I1VB 3S8YA 1ULUA 3C97A 1MX1A 4G0OA 4I4IA 3U7IA 3B48A 1DOHA 2OG1A 4JB0A 1WXXA 1RM0A 1SPXA 2VNKA 1CJMA 1IK6A 1GT91 1M1ZA 1NI5A 1K6XA 2W22A 4TYQA 5ALXA 4I55A 1W25A 3S1LA 4K9NA 3FIUA 3D6HA 2TYSB 4M8IA 5I5EA 1F38A 2IH5A 3AJDA 3EWIA 4MS4A 4FYKA 1L4GA 1TO2E 2QRLA 3OOEA 2EP5A 5JMPA 2JBAA 3ZGVA 1QYWA 1IXZA 2BF7A 2W6IA 3L3BA 1A8HA 4GDMA 4IAOA 4JJ4A 1RI4A 4MAAA 5HQ3A 3ZY6A 1O9HA 2Q1TA 3VV3A 1Q1BA 3GRZA 3OJFA 5D5PA 1HYEA 1LVHA 5F5NA 3TL2A 3EWAA 3I30X 3DO8A 4PWZA 1O77A 1NVBA 1UBRS 2XTJA 4JLKA 4LFAB 4FLEA 2PN1A 4MPPA 4P1ZA 3N2YA 2FGJA 1XNHA 5JISA 3T3OA 3AFGA 2E87A 3TMYA 2HSEA 2F7SA 2P2YA 3SSNA 1MW9X 2ORWA 1ZXXA 3F2IA 1WSBA 3QBEA 4B84A 1GA1A 1H8HD 2YJNA 2IZ7A 3CZAA 3ORQA 4J16A 3HXOA 3LHFA 4MYSA 2OZEA 4FFWA 1U8CB 1EXDA 4RMGA 3CCFA 3OTWA 4PPGA 5ALJA 5CG2A 1D2HA 5D7BA 3ZCRA 3VR0A 3R7SA 4CV2A 1D03A 2WSYB 1ZUWA 2IITA 2H1RA 3QVXA 2O6LA 2II6A 5FLXA 2C04A 2XMPA 2NU7B 1Z4MA 2IXEA 3EXFA 1I0IA 2AMVA 3IPRA 2G0NA 5I45A 3UXMA 2ZYIA 2ZTLA 3G5LA 4QGAA 2PZFA 3D7LA 4BPRA 3BCUA 1KMCA 1VBFA 2FP4A 4DG9A 2GOYA 1B2RA 3FPCA 2IK8A 4RZSA 2YMQA 4MEAA 4ENTA 5BRJA 4EB6B 1DKLA 2WLTA 1RI5A 2CEAA 4RS3A 5BOSB 5FUVA 3KFLA 1JLMA 4HGZA 4LXQA 5FAXA 5E7IA 2UVDA 3AZOA 1JVNA 2GTIA 3F71A 3QU9A 4TTAA 2XCRB 3VPGA 1VE5A 3OIWA 4JBNA 1MGPA 4X93A 3PYLA 1Y6ZA 2BTEA 2Q5OA 1H94A 1OFVA 2ZSFA 4H1TA 3H11A 4DS3A 5BSKA 2WB4A 2ZETA 2AXNA 4BOYA 4XUDA 4UZFA 4MI1A 4ZI2A 1QBKC 1SUAA 3WNVA 3EWSA 3FPAA 3QA3E 2NU8A 3ZPXA 3BRWA 4U7FA 2IY9A 2OZKA 4E07A 2IKSA 1REQA 3UFXA 1XQWA 1XHLA 2ZRGA 4KV7A 4C1BA 3WNCA 3KOUA 2R25B 2D5AA 3AF6A 1MV5A 2GJAA 2F3RA 2HCRA 4ZI7A 4EGJA 2H57A 3CWCA 3RAGA 4G8BA 3TL6A 2EYUA 2J32A 3T61A 3FOFC 5CM2Z 1UBEA 2GJKA 2YRFA 5CDGA 5EEGA 3CX8A 4F97A 3B2EA 4OPMA 3DDNA 2XEDA 2OO5A 4YR9A 2NVBA 1J6UA 3BDIA 1XL0A 3PFFA 4FMPA 4LOJA 4OL9A 4IV5A 1TI7A 2B2NA 4DWWA 3HPQA 1PLKA 3RSZA 4E08A 4DUPA 5HG0A 3GBPA 5U4XA 3ZLUA 2V9ZA 2VHTA 3TD9A 4EHIA 2HK9A 1Y9AA 3NKLA 3TAHA 5I4CA 1VCHA 5IANA 1HNZB 1YCFA 3CVWA 2GNAA 2IV3A 2QN8A 2JAXA 2QU7A 3WWCA 1RRPA 3QEMB 1EUCB 3D8RA 2GXUA 4QODA 3D6MA 4QXAA 4JUAA 3W9UA 5HPYB 1XTTA 2PT5A 5LMZA 2HIAA 2JAWA 3NP7A 5E4JA 3UQYS 1PEDA 4JJKA 4NE7A 5BXYA 2VAXA 5I9IA 4D9CA 1ZNWA 2PGOA 4FYWA 1NKTA 2C8LA 4ML3A 1WMAA 1C7EA 3DZ3B 2OV1A 2Q5IA 3IHKA 3HCDA 4PE5B 2D5CA 4H7DA 4BKMA 3MCVA 1IN6A 5DX1A 3MJDA 1QVWA 1OLUB 2APJA 1DTWA 2P75A 4ND6A 3ABRB 2HRQA 4PVCA 1KMQA 4JUFA 1BA3A 4L4ZA 3O73A 3C8MA 1MA3A 1JBKA 1WR8A 3GJSA 4Q1VA 2CNDA 2RONA 1XMQB 3IA7A 2ZWOA 4GKKB 4V0LA 3N53A 2QIOA 1LWNA 3I01A 3QV2A 4V1CI 4KIUA 4ZRDA 1P72A 1SEPA 1VP9A 5JH7F 4F96A 1DT3A 2PSEA 1AQUA 3HPRA 5KMGA 2X15A 2YYAA 4WCVA 5K2MA 1H3EA 4B6OA 3MTQA 4LYGA 1UPBA 1MB9A 1ABEA 1MO6A 2O5RA 1M6VB 3EFOB 3RTGA 2DF8A 1NDUA 4UREA 4RPCA 4UULA 2GLUA 4DMMA 3PRHA 1YRLA 3B5JA 3KVOA 1VKOA 2FPXA 4KXFB 4W7IA 5IZ4A 4ZZ2A 3CH4B 1SXJD 3KZCA 1UPTA 1WAMA 5CVCA 5FL7D 1R5JA 3L8HA 2KQUA 3KE8A 3LQ1A 2VWPA 4G4JA 4R16A 4TTJA 1U3DA 1YS9A 2C29D 3KWJA 3PXGA 2B6HA 1SOVA 2AZDA 4AO7A 3M6FA 5ER6A 2OO7A 2Z5FA 2PH5A 1XMSA 2B4AA 1XMXA 2CNWD 2FRVA 1ICEA 4LRUA 3PI6A 4EBBA 3LCVB 2TSYB 3FPEA 3ONVA 1M8FA 2HRDA 3P9NA 1IUKA 1RLOA 3O3NB 4HI0E 4KCGA 3TZBA 2P9TA 4K6OA 3WFIA 4DA6A 1PN3A 2RBEA 1NKVA 1UBGA 1XROA 1KXJA 4GR5A 3BAFA 4BP8A 4YAGA 4FBLA 1AV6A 3K2BA 4XFKA 3A6GA 2P5UA 3TGWA 1E2GA 1WHSB 2NPOA 1PJRA 1KY5A 1X1QA 4QT0A 4WL0A 3BGSA 3LYUA 2Q1SA 3GZ4A 2EW1A 4IHAA 1BD4A 3V4LA 5CB8A 2QRGA 2EIXA 1BWQA 2J87A 3K9HA 5LNK1 3RYFB 2NSHA 1ZUD1 2P5TB 5K3FB 3EMKA 1KKUA 2VT2A 4NR0A 3DBLB 4FFRA 5DTQA 3AB8A 2QNRA 1EVJA 1H2EA 4NHEA 1N6HA 3AETA 3NI2A 4LDZA 4Y2QA 1GQRA 3L8DA 4HQNA 5DCUA 2H08A 3NVDA 1UBOS 1MT0A 9LDTA 4FZVA 1I7SB 4HDMA 4R9RA 4INAA 3NYIA 2ACVA 1ZR4A 1E9FA 3OTQA 4TQAA 3TJZA 2P2LA 1TF5A 3EC2A 3VSCA 1UADA 1YR3A 1OXVA 2NTEA 2VSQA 4YJ2B 2NUTA 4TRNA 1JIUA 5FNVF 4RTMA 3AHIA 2ORED 2VK1A 3QY0A 4GLBA 1VTKA 1WXQA 4U2KA 2NUTB 4XWYA 5F3DA 5GGXA 1XQVA 2VJPA 3RBZA 2PFKA 4CHGA 3JSAA 4MKGA 4NCXA 3OSZA 4E3WA 1XJQA 1W75A 1ZJYA 2KM1A 2EX1A 3BTUA 1QHIA 3UK0A 1AG9A 2O2GA 1M2GA 4QNRA 3UWKA 4AYWA 2IS6A 4OBBA 1WEKA 2CFOA 2CUNA 2ZW9A 3A27A 2ZKLA 3VTAA 1KA9H 1TZCA 3E35A 3O9VA 4M22A 4NMHA 1U0HC 3SEAA 1X74A 4FMDB 4HN2A 3UQZA 1S9HA 2QX9A 4YQZA 3FPFA 1HA3A 2LCQA 5LP1A 2BCJQ 3Q1LA 3I83A 1TK9A 4S0ZA 4H1VA 4LI3X 1CHDA 3S2ZA 1ZK1A 4C6TA 5BOVA 3RVOA 2ZG6A 2XEXA 1U9IA 2G06A 1P4AA 4EUKA 5F12A 1X1DA 5JQGA 4EF5A 3AL3A 3DBHA 3GA5A 2X4GA 3GUUA 4AULA 4Z4IA 2H4YA 3IUBA 4BO4A 2YYYA 2GCEA 2JF0A 3IQDB 1N1MA 3NAQA 1KMIY 5L3VA 1G7CA 5TVOB 1TCUA 4L72A 4RTJA 1EE1A 2MYPA 3LDHA 3ESYA 2L82A 4C4PA 5KYXA 2HCJB 5KSWB 3K9QO 2XI4A 3SF8B 2W70A 1E18A 4X66B 2O9JA 2I4RA 5FH9A 2ZRDA 3ZDRA 4BO0A 5K3BA 3KZKA 5IKEA 4J0IA 3KALA 4BQFA 4EY7A 1BNCA 1TA9A 1N1GA 3HBAA 3W5JA 5F7XA 1BEUB 3QWHA 3CLSD 1ZGCA 3MBKA 4M8LA 1N3LA 1VLLA 4IKEA 3TIIA 2I54A 1L5QA 2G7ZA 2OHJA 3G2QA 4A10A 3OJOA 4BO1A 3VR2D 3HCWA 4GEGA 2UYOA 4ASUD 2IUUA 1DRKA 3TH5A 2OCKA 5AJWA 3CVVA 1P9NA 4MRMB 1UJBA 3WYCA 1DP4A 1R7RA 2OCDA 1NG1A 3HH8A 3HJCA 4GX0A 3G8AA 3PD7A 3CSDA 4LOLA 4ONEA 1MLDA 2AC4A 1Y1KE 2VEOA 2C99A 4OATA 1Y9DA 1ZGZA 2JL1A 5CHYA 4BNLA 1GPKA 2O2CA 2P6MA 3MMNA 1SUFA 1OI4A 4R8SA 5EQJB 1ZITA 5I3CA 3O74A 4PBRA 1BW9A 4L8FA 4C7JA 1VCNA 1TTHA 2CLEB 3AVPA 1JG7A 1H6CA 1J8MF 1S2MA 5JALA 1Z6QA 4P8RA 1N2GA 2OAQ1 1ZRMA 2SICE 2ZJ6A 4H1UA 4OGFA 4BZZA 2JKZA 1X1RA 1I13A 3RFCA 3ENQA 2D4HA 3WIDA 2XYRA 5C8DA 3LUDA 4GPTA 1YL6A 1VPLA 2VP9A 2H51A 2H9YA 5JATA 3AR7A 3VNRA 4P0PB 4BAUA 4A2PA 4EMSA 1I14A 4DMGA 4PR3A 4GVLA 1CIPA 4I6EA 2GO7A 4NAHA 2AIRA 3R7FA 1EVIA 4KV9A 1O5IA 3G0CA 2HPZA 3WDMA 4HDRA 4E5YA 2R60A 1WXEA 3O8CA 4Q4LA 2DPXA 2D7CA 1E1CA 1MO4A 5KNCA 1EXVA 4OX9Y 3ZKAA 4ZO6A 2Y0PA 1A8UA 2D1QA 5EUBA 2RGGA 3NHZA 4XOIA 3ZV4A 2N47A 4BC0A 3WHLA 1H0HA 3AHCA 2LVBA 2YH2A 5CLGA 1FC0A 5LSAA 3OE5A 1S2OA 2I2WA 4AJ4A 1UFKA 4Q3LA 3DO6A 3PQEA 3RNLA 1J0DA 3ZXIA 4XM1A 5JBNA 4U0JA 1VHLA 1Z25A 3PQ6A 4MI3A 4B6GA 3D2BA 2X14A 4K8RB 4L9SA 2YNMC 4N4AA 5ALOA 2WB2A 3VOBA 4TWRA 2A5FA 2QTZA 2QL6A 5DI9A 2IXFA 2JK0A 2NWQA 2YINC 3IIEA 3O4JA 3R5SA 3WKCA 4B2PA 5FV7A 1IZ9A 2ZYGA 3G82C 2RKWA 4P34A 4J29A 3S0JA 2VJNA 3UY4A 1QP0A 3KXDA 1EK2A 2PUBA 2QENA 4DUYB 5ELMA 4V2UA 5FB3A 3ZYCA 3ULKA 4RFVA 4US2R 2ZB8A 3LRXA 4MA4A 5DLYA 5THXA 5CNJA 4DLXA 4YDRA 1FBNA 1YR2A 2RGUA 4Q19A 4YACA 4B3CA 4F4IA 5TGTA 3RHSA 3WNQA 2HGZA 1B73A 1E7YA 3OZAA 4FGKA 4EKIA 3ECCA 2VTKA 4WLNA 1TA4A 3Q3EA 4CT5A 1F6BA 4QYIA 1DBIA 4O0LA 1IBSA 3I2YX 1BWSA 3PIDA 3RWMB 1P9OA 1V4NA 2IYWA 2XVMA 2AOXA 3ND8A 4OA8A 1IG3A 4CF5A 4QM7A 2C7QA 1OVMA 3MUFA 5ISMA 2C83A 2DP4E 2EAUA 3A6JA 1PG2A 2D0OB 3NXKA 2M9MA 4HX9A 3ZE0B 4ZEMA 3QFFA 2QN7A 1UBFA 1XEWX 3D8SA 4EAQA 1KFCB 4Z9FA 2ID9A 3CVOA 2AHRA 1DLJA 5KYGA 5CAEB 2PKQP 1G9TA 1PCXA 4OA5A 4F8YA 5IAGA 5KAPA 4L6AA 4FXOA 1NJGA 2XE4A 2VDNB 3E7XA 4JVMA 2P2GA 1Q0LA 1JIJA 4M87A 1J42A 3HM9A 1L1FA 4Y67A 3R7BA 1P17A 1GUBA 4G41A 3ZHRA 3ZK9A 5CITA 3ZW8A 2ZIWB 3S68A 5FI1B 3ZY5A 3K0FA 4ZI7F 3LF2A 3UNXA 4QJ4A 3M6VA 3MWEA 3OM9A 2C5EA 2Q5HA 1O8CA 3KFXA 1YZNA 3VQTA 3W4IA 3ZQJA 3MWEB 1NBMD 4KYVA 2BE9A 2EZUA 2Q50A 4D9BA 2QRKA 1RXEA 1ZSVA 1FF9A 2B8JA 2M98A 3HEBA 4RJJA 4OI1A 5ADVA 4XDHA 5LP6F 2Z04A 4B7CA 3KUUA 5GONF 5TSDA 3VKFA 1ZVKA 2VWQA 4O2LA 3WL6A 5DCLA 4BLQA 4PPFA 4R7TA 4DILA 4LY9A 4XVCA 2NZVG 2Y1XA 2W9XA 4KWCA 5FBKA 4D6YA 3HJTA 1ZN9A 1FEZA 2BKAA 3AVWA 3GLRA 3MOSA 1E5TA 5HIMA 3PHGA 3CJQA 1PS8A 1G3IA 3NKVA 5SY4A 2O8CA 2P4SA 4DSTA 4OSOA 2JJ1D 3DMNA 4JJ8A 5AXAA 5B57C 1VKZA 3OLYA 4JBHA 2QMUA 1U3VA 3VKHA 3CIOA 3GMIA 1ORRA 3DCYA 2ALJA 4V39A 4A6PA 3HNPA 5HVNA 3U5TA 1S8OA 4J9UE 2IJGX 5EMNA 2G88A 3J7AC 4TYWA 5NULA 4NEQA 3AUSA 1GZ7A 5B6JA 1Z2OX 5KOJA 1FPMA 2V1XA 1J00A 3A14A 2QJTA 2YY6A 3CEMA 3OX4A 4X6UA 4ZAXA 3UWMA 3EHDA 4C0JA 1VKHA 2H5IA 3AX6A 3SI7A 4L9RA 1RVDA 1HDEA 4NK4A 1D2NA 1JG3A 3DHEA 3ER9A 1E0JA 4GMXA 4GX2A 3WKDA 1KJQA 3HCPA 4XPIB 4EUEA 5KWEA 4D82A 2PRJA 4WW0A 2VDOB 5FTJA 2XQGA 2EJVA 3KEQA 4LDQA 2QM0A 1VLQA 4MPTA 2EF1A 4DPKA 2CSUA 1EFPA 1OPXA 3QU5A 4LYYA 4QECA 1XVAA 1IWPB 1JECA 1PUJA 1FE8A 3ETLA 4RELA 2XVYA 2X2EA 3UCFA 2YJGA 3PVZA 4UBOA 1IC6A 2ZI5A 3GEHA 2VXBA 2FVYA 4Q9JA 2MU1A 4EUFA 1NP6A 3C1OA 4HL6A 4WZAA 3TOSA 4EZBA 4RADA 2QX8A 5CLHA 4ZT6A 1N77A 1C7RA 1DQYA 1S2IA 3JYPA 3QFCA 4ZO8A 1SVOA 2C61A 3B5IA 3W5HA 2YYZA 1S01A 1NMXA 1Z08A 1JQDA 1ZISA 1ZSYA 2Q5CA 3EDRA 3Q5EA 1QIIA 1VLHA 1ZIOA 4GBGA 5DTRA 3VHQA 2X1HA 1W34A 4HS9A 3LAWA 3S1SA 1CKEA 4Z7OB 2WTMA 2JGJA 3PC8C 4MYDA 1PK7A 3IQWA 3TINA 1LBSA 2HB6A 3SE7A 1N2SA 4NFYA 4R7GA 2WFAA 4G5YA 1OZFA 4ZYVA 1T6YA 2JIZA 2VS1A 4NV3A 3TOCA 4R0VA 4RGBA 3GFRA 3L43A 1E9BA 5T67A 4Z1MD 1FJHA 121PA 4BLPA 1G7TA 5J23A 3JQAD 4YI3A 3I58A 4GPD1 2O3RA 4HX5A 5FAKA 3FCSB 3HTXA 2XVXA 4RDHA 5C4GB 4DUGA 2GQ0A 3A06A 3RSGA 2ZRFA 1SELA 2IL1A 3NPMA 2GAIA 4REQA 5DLQC 1XRLA 3RS5A 5CA1F 2FDRA 2AX3A 1FFXA 1SCIA 5MDHA 2BJVA 3L8CA 3IPCA 1GL3A 2A9JA 2VWHA 3UCEA 3DL2A 4QBGB 1USKA 1ZGBA 2FAXA 2GS9A 3CKLA 3H83A 1I4WA 2XKJE 4YAWA 4JD5A 4TVKA 4FOSA 3K0EA 4OUDA 5EXXA 4V0RA 5KB3A 1YWGO 1LRJA 1UOPA 4M99A 3FOWA 4JLJA 3WWOA 1W1UA 3ANNA 3M1LA 1DOZA 1ZFNA 3BG5A 1J56A 4PCUA 1ZMBA 4FMCB 4BVJA 1QYDA 3HXMA 3U3ZA 1CD5A 3SE0A 4BKPA 1T0IA 4DXHA 2PA3A 2QVBA 1K27A 1M2EA 1RW4A 3ZR4B 1I7NA 5FWXA 2JD1A 5BMVB 1VI5A 1V8FA 1BTOA 1RZVA 3HJBA 3K73O 1N3YA 1TRHA 3Q12A 4HWTA 1N1DA 3H5OA 5AVJA 3BT7A 4N6NA 4CM9D 3HYRA 1KAQA 3ZN2A 4M0KA 1ODSA 2C5BA 2VFAA 3RTEA 4ZV7A 3OC0A 4UTNA 4OQDA 2R84A 5BQ5A 5I4KA 1MNAA 3JYHA 1U94A 1YULA 5AKJA 4MHOA 1NASA 1M67A 4R31A 1S3GA 1CNMA 3BREA 3OQ1A 1VG9B 2CHGA 5L3ZA 4CEHB 1Z47A 3W9SA 5EHXA 3FG9A 1GAEO 2FPSA 4LEIA 5AIAA 1YQUA 1I3NA 3I2HA 3BGVA 4D3XA 1OYVA 2A0KA 2EL7A 2WJHA 4B3BA 4Z4EA 1K06A 4YMIA 5IVPA 1PJ2A 5E0KB 3ZI0A 1E1MA 2VHZA 5AXDA 3TNDA 2FX5A 2JGLA 3WLFA 1Z7GA 1G2OA 4NJOA 4ZQGA 3B6JA 4O5AA 3CNBA 4YMVA 1YS7A 2Q41A 3HKEB 3K4PA 4UVDA 4W1RA 5DJ5A 1T4BA 1N5OX 2XB9A 3ROGA 1CZUA 1FFCA 1LGYA 3ZWCA 3CURA 1AKTA 5EQTA 5HFJA 3U3RA 5E4YA 2PZBA 5CFOA 3G5AA 1P19A 4FDTA 4JB8A 1SCUB 1Q3KA 2CNKA 3RAPR 3ZD6A 2OQIA 1NVAA 3KIPA 3W79A 1ZUHA 3QUCA 1T3GA 2E4WA 3TVTA 1YC2A 2PUWA 3KPUA 1RAFA 4PGGA 5DGDA 3SZLA 4XTRA 1E2EA 3N6XA 3UB4A 2X9LA 1GPBA 3H5IA 3ZXXA 5C8VA 4LKOA 2PRKA 3KZVA 1H22A 4P4SA 3UANA 3DMRA 2BUBA 4AS2A 2OXCA 3ETHA 5FOQA 4IYJA 4WVFA 1ZUNA 3F9RA 2H0QA 5H9VA 4ETNA 2CMHA 3DHYA 3PSHA 4KX5A 4ZYTA 2E82A 4HAIA 4OLJA 1KRHA 3HV0A 3FNHA 4CKCA 2QQ0A 3AINA 3B12A 4UUAA 3RF7A 4EYOA 2NU7A 1E58A 4E5PA 5AVYA 2IXAA 3ZDFA 2J9FA 2ZYHA 4NVRA 5FWAA 1C9EA 5LKAA 2HXGA 3IP7A 4OV6B 5AHXA 4DV5B 2BIFA 2HRRA 2J9FB 4HJRA 2CVOA 2CLIB 3R3WA 2JEYA 2FWIA 3ZW7A 4DVJA 5KTSA 3AWDA 1KWKA 1XEAA 2XE7A 1MENA 4K8OA 3ROEA 3V1TC 5I9LA 3LFUA 3LECA 5A4IS 2BI8A 4AM8A 4H17A 3ZU6A 4YJ2A 3H2KA 4RBNA 5AQ1A 3OFNA 2HWWA 4G63A 1WBDA 3OZ7A 1L7DA 4IVRA 2BRUA 3G2KA 4JLOA 2JEOA 3T7CA 3VXKA 2N46A 1GZ6A 3I23A 1JHMA 3IOBA 4QBIA 4P5DA 4DLLA 1LRLA 4ZT5A 2POCA 4M83A 1I4LD 2RBKA 4N54A 2V7PA 1XG5A 5JMTA 1O4VA 4UE6A 1X1AA 4TXJA 1D4FA 4R81A 1T2UA 4INOA 3JQ9A 2DPGA 4GI5A 3RGWS 3U7EB 2RI1A 4JAVC 2YIVX 2XA9A 3ANMA 3KYBA 4H0NA 4KSCA 5JD4A 2QMHA 3ZXYA 1FOEB 2ES4A 4NDZA 2JARA 3ODPA 1GO2A 3OCJA 3WISA 1C1DB 2X6RA 5REQB 1QQ7A 2G28A 3A9SA 4B3DA 4TV9A 1XLTC 2AFVA 2Z56A 5LVAA 3KUCA 3W2FA 3W8EA 3OEWA 1XR3A 3L77A 2H9IA 3MS2A 1S3IA 4TV9B 3TZLA 4JYMA 3HCRA 3OOWA 4ROSA 1QHXA 4MGIR 4PRLA 5AJUA 1ZBQA 3CLUC 5K4AA 5ESDA 3NAGA 2CV1A 2GEJA 4HH4A 4CQNA 3O1IC 2VJBA 1EUZA 3K8YA 2WU0A 1YQTA 1QC5A 4G09A 2RFLA 4GGOA 4QPNA 4TMXA 1Z39A 2YWFA 3N0VA 1GPMA 3K1YA 3QVSA 3DVSX 3OD1A 4S12A 4CF4A 2JCBA 3R40A 4DSUA 5KYUB 3L9WA 4AJNA 1AUQA 3C3MA 1NNLA 1VYUA 4N7MA 1MW8X 1JG4A 1NE7A 1U2DA 1XU9A 1I4EB 2Y0CA 2J59A 2IUTA 2ZTMA 3FHTA 3H75A 2G9QA 4P54A 2Q9CA 5CYFA 1UWCA 1MB0A 4OY3A 2Z2ZA 4JMLA 3VYRB 1G0NA 1MABA 2X9NA 1ETUA 3RSLA 2VJOA 1C3VA 3LT0A 3WGUA 2WABA 2NO7A 1LF0A 4DUGD 1CF4A 1W5BA 2V3CC 1XP5A 1JAZA 3IODA 2HF7A 5ETJA 1QG0A 1ZPDA 4IJVA 4A9AA 2YOFA 1DTWB 4BDTA 4JL6A 4TRJA 1V39A 3STHA 4B79A 1D6JA 2XYQA 4M1TA 4MR9B 4JQCA 4PZLA 4DJFC 4UEOA 4C4SA 5EUMA 3ZDYB 2VCHA 1DBWA 1NMZA 4O2BA 1G8KA 1RYYA 2ZPAA 3EUEA 3VDQA 4MDEA 5L3RA 3CO0S 1U7WA 3REGA 3TFQA 1Y7LA 4W9MC 3IAS6 1CZHA 5BN1A 5CFMA 1CE8B 4ZAVA 5HJEA 2CL5A 3H17A 3UJ7A 3AXSA 1NN3A 1S4QA 2QG4A 2GLTA 3B1ZA 4H6XA 1AGXA 1I2ZA 3HXLA 2KSQA 5C8XA 4BIMA 4LY3A 2ZSKA 3GT4A 4I5IA 4CG1A 1WPGA 1DUSA 4JA2A 4PHCA 5DHAA 1LPNA 3MBOA 1RP1A 3CZQA 3KPYA 2Y9MB 2V97A 1T13A 1A8QA 2XYHA 3IWCB 1TLLA 5T4EA 3TBHA 3WL5A 2YY5A 1D07A 1RE1A 1UBSB 2C95A 4JKYA 1KOJA 3PPXA 3DJYA 1P62B 1PGJA 1WM1A 1B93A 1EXWA 1P5JA 5DHRA 3QYFA 3EPHA 2RHRA 2FN7A 2W6PA 3ABOB 1E2KA 2OLEA 2I4NA 2B7BA 3WGOA 3IOCA 4LNUB 4WCFB 4X1YB 3WLEA 4YUXA 4C2UA 1IMJA 3BX1A 4RD3A 5AKKA 3RM3A 1LLUA 4HHEA 1O0CA 2HHHB 4PFSA 3M2TA 1P1FA 2BEWB 2VXOA 2IZZA 4RV5A 4AY3A 1DIHA 1GGJA 3G49A 3D7RA 4JDUA 4YJFA 5J63A 3UC5A 5F73A 3WGHA 4D9FA 1VCMA 1UAGA 3R0XA 2VSNA 1KBQA 1FS6A 1PV2A 2CYCA 2SHKA 2WV7A 4PYRA 3HLKA 4PYMA 4AT1A 4I2VA 4GVPA 5CT8A 3RWOA 2H1FA 2PBRA 3ZY3A 3KAJA 4DG8A 7ADHA 4BE7B 3VPHA 1CUAA 1LBTA 3ZWVA 4AUMA 2XNDD 1GM5A 1OZ0A 4AY2A 1KJJA 1TAHA 1O95D 1FYWA 1Q21A 1BGWA 1EYZA 4RDIA 2FXVA 3IAM6 4UMEA 3ZVMA 3IDQA 3P27A 1CRLA 2D13A 5ER9A 1MIOA 3SZOA 2K7ZA 4GLLA 1AKEA 2IEAA 3G2IA 3NVAA 4MJ7A 5JD5A 2L0XA 4O2BF 4B44A 2AN1A 3ONWA 1HDIA 2BR5A 5JNSA 1XCLA 3CR3C 4IMPA 5JTTA 3U4MA 2PQMA 1NVVQ 1JFFB 2QIPA 3EODA 3IOMA 2Z6AA 1GZ4A 1R6XA 2PAFA 1IN7A 4IDCA 1YS2X 1KQ3A 2B7LA 3KE9A 3Q6NA 4A15A 1RXSA 2ZJ3A 4WNYA 1NBWB 3PNYA 3EF1A 1GUAA 4IFIA 1HF3A 1P2SA 2NO0A 2VQSA 1TQ2A 2DVMA 2X5XA 4I0WB 3REOA 2DWCA 2R5FA 3DHWC 2H1WA 2QP9X 2WK1A 3GIWA 5LZ7A 3NXSA 3SCZA 3ZHOA 4A1OA 5BWOA 4OL0A 3LW8A 4XQ9A 2B8WA 2F55A 1E2DA 1H2WA 5LNK6 2GCPA 1JKJB 2BGIA 4LMBA 3TLGA 2GN4A 2VT6A 1DZIA 2FKAA 3DDUA 4DEXA 2D7JA 1XU7A 4M9XA 2E4UA 2IXGA 3SKYA 2WNHA 5AI0A 4D9GA 4KK3A 4H2DA 3IWBB 4DVGA 3NM5A 4KUGA 5AUOB 1YQXA 2DCUA 4DSNA 2C5FA 1WP9A 5JHGB 4WK2B 3WLPA 3VMMA 3TG2A 2I7DA 5MN4A 2YZKA 3FD8A 3WYAA 4HO1X 4F7DA 2QBYA 2W2KA 1PE0A 4HEA6 4DARA 5HIKA 2OR3A 1RJ9A 1G19A 3LWNA 5LN1A 1FQOA 1NVVR 2QV7A 1RXIA 2BR3A 1YD7A 3BERA 1IPEA 2BWJA 2EXXA 2CD9A 2O8FB 2FDCA 2QXYA 3LCCA 2XUJA 5IKXA 3L79A 2QTVB 2I7XA 1KE2A 4WVLA 4AAYA 1G6OA 4KH0A 1R10A 4EEXA 1QGAA 1OX4B 1IHPA 3I73A 4OSEA 4BEVA 4W1SA 4YMLA 2QJFA 3FOAA 1TYCA 3L1VA 1TF7A 1NW8A 4WNIA 4E32A 2ZYUX 3KKMA 5FI5A 2O8DA 4C4RA 4LWZA 4YQYA 3IURA 4YONB 3PX2A 4KEAA 5JD3A 3TE7A 1G17A 9ATCA 4OXQA 5L4NA 4R2LA 5TXGA 4DDKA 1I8TA 2WG1A 2RHBA 4REOA 3AYXB 1E2LA 3N0XA 1X19A 2H92A 4FONA 4EGAA 5K9ZA 3CNEA 4DL9A 1NXTA 5CM8B 3B3QA 4BRSA 3PKIA 1QHEA 3HY6A 3MIIA 2FW0A 3KVVA 3RRBA 4GZMA 3R0VA 5ES4B 4HFJA 3ILYA 4CMGA 3R3UA 3A10A 1Y4SA 4JC0A 4AY4A 4B3HA 5IJ0B 1WV1A 4JFRA 4NNPA 3ST7A 3A3PA 2FFRA 3UJ6A 1OW3B 3GRAA 4R01A 1V9LA 4P7JA 1SZJG 1DBSA 1KMHB 4ZARA 3UJ3X 1N2ZA 1YOBA 2BGGA 1B8PA 1GN8A 2X58A 3AUKA 4GXQA 4EG3A 3E9RA 2BFFB 5KTTA 3TXAA 4PV7A 2W93A 3F4BA 4HYYA 5CA0F 1F9EA 2I9PA 3NRCA 2J0UA 4NMXB 1AH2A 4Z9BA 3L8ZA 3LX6A 2QLJA 5FJJA 3WFJA 4KR2A 1TJ4A 3B1YA 5EWJB 3D9QX 1FUYB 1N2OA 3CMCO 4Q1CA 3KR1A 1IY2A 3U6KA 3V1NA 1JKFA 1Q0QA 4DV0B 3ZTYA 1VGQA 3ZWAA 1PT6A 1VSUA 3LX8A 3DVQX 5DLPA 3AOGA 4GBMA 1Z74A 3H0CA 4EPWA 3UIEA 3QHPA 3DR5A 4HGRA 3I4CA 3ECSA 3Q8LA 4REMA 1QVRA 2QZSA 3MWYW 3PR1A 5CR9A 4EELA 3GLIA 4B81A 4LNHA 4YP7A 4JP2A 1E1KA 1R88A 4Q37A 1FFHA 3MGBA 5CIQA 5NLLA 2YXNA 4J7AA 1WXWA 2A14A 2PBZA 5DO9A 4DR4B 1ZP6A 2JAPA 2RBGA 4GC5A 5TLSA 2Z3ZA 4R3NA 1YDGA 3I6YA 1SIWA 3RYFA 5KTMA 2FCRA 5IFLA 2BGUA 2O5VA 4EYEA 4HWSA 4I3FA 4DYHA 1ULSA 3P9XA 4ZO4A 1WLYA 3CFYA 3HB5X 4BE4A 2LE0A 3LQFA 3FZNA 3Q7EA 1QWOA 4JVNA 4WOCA 3S2IA 1IL0A 1PV1A 4A3SA 2EKLA 4BGVA 1OI7A 2QD3A 4HAWA 4D9HA 1C3JA 1UBCA 4J76A 4X1KA 3K09C 4Y6LA 2HQSA 5EKTA 1N7GA 4H1WA 1WMFA 4D3DA 3OWHA 2AN4A 4UC0A 1EK1A 2B1QA 5JH7A 2GXQA 4D2IA 5J40A 3D4PA 5HJ2A 2XOXA 1F2DA 1TW3A 2C4NA 2OZLA 2W6ZA 4NRDA 5DCWA 5E6SB 5BO5A 2ZWMA 2XMRA 4JJGA 3UBMA 3DAOA 1M1YB 3RBXA 1AF4A 3VC3A 3N8KA 1NLFA 1GZSA 3ETEA 3NHKA 4N5MA 1XSEA 4ILEA 4EF4A 3I6ZA 4AZWA 5BUSA 3CC8A 4JLPA 2I6FA 4IUBS 1AO3A 1G3MA 1Q1ZA 3L0ZA 5KWVA 2P35A 4MUYA 1A5SB 5HM8A 1NVGA 4JLUA 1JSRA 1SG0A 5EFOA 1Q1EA 4EG7A 1RJEA 3FGOA 4CLOA 3KYCB 2B5VA 4FR5A 2JBHA 2PKWA 1LJ8A 3ABZA 4I4LA 1JQJC 4PO8A 4A0SA 4BB0A 1SCAA 2B6NA 1WZ2A 1OX6A 1RRCA 2XECA 2QK4A 3JAMA 4C6TB 1MZVA 1RJ9B 2FSVA 3QEKA 4JVOA 2RH8A 3NFRA 2VHXA 3TD2A 2ZYDA 3PUIA 1AKUA 5ILGA 3NC1C 1HT0A 3GVIA 5D01A 3O93A 5BYJA 4ENUA 3I09A 2YFQA 2QSZA 2EGGA 2AWNA 3E81A 4OFBA 3L5KA 4CE6A 1Y5RA 2VNJA 2WJPA 1E66A 4CUZA 1YGPA 1GHTA 1GCOA 4JWTA 3Q7RA 3GC6A 4BMSA 3LCJA 5AM2A 2ZCJA 4LDNA 3T95A 3LA8A 5IBQA 2IW1A 1OX4A 3T3HA 5IVKA 1UZAA 5KNDH 3RRJA 2QRUA 4IRUB 3ANYB 3BJMA 2HBRA 3V8EA 5F4ZA 5HF9A 3G5TA 4ERXA 2GPYA 3G2PA 4YB8A 4QARA 2QTNA 1RKUA 4NMWA 4F3YA 3BGOS 4JBWA 4YAUA 3EPJA 5EHNA 1VB5A 1H1LB 2OD2A 3ZCVA 2IYSA 4BKQA 3VYSB 3R8FA 1Z5VA 1Z5NA 2WILA 5KTNA 1E6LA 3A9VA 3JZMA 1CEYA 2JFYA 4BHTA 3U19A 1FCJA 4R1QA 3AWIA 5BSUA 1CUGA 1IBRA 4MRVA 4PCLA 1XDGA 2HRZA 5T3UA 3VR6H 3X1ZA 3CX6A 5BWNA 1RRKA 2NU9B 3OPVA 1JIVA 5TQ2B 1R0SA 3A28A 3AF1A 3E7DA 3VVMA 3PNSA 5HUHA 3OJXA 1P0PA 3D59A 2X42A 2Z2YA 1NR7A 1Q3TA 4RTRA 3BIWA 3Q0EA 4LYDA 5AT1A 4MX8A 4QEDA 3W7VA 3AY7A 4WKPA 1XXHA 4I4TF 1JNXX 2CUTA 2FX2A 1U28A 3RJ5A 1C7IA 3CSSA 3IHWA 9GPBA 1AS2A 3M2PA 4PYJA 1ZRNA 2HJRA 2QR2A 1R9NA 1V9SA 3AM4A 4MEBA 3D4IA 4KVAA 5CEEA 3OZRA 5SY9A 1Z17A 3DTYA 1WJGA 3VOTA 5I6DA 1LRKA 2WTBA 3STVA 4JLAA 1P60A 4F56A 5IJZA 3S55A 5C34B 3WK9A 4DKJA 3R9XB 1CULC 4QUGA 2IUEA 4X8MA 3ZJ5A 2VK2A 3H4IA 1JE0A 1FTGA 3H6GA 1K6MA 1CLUA 1GKYA 1QOQB 3D0QA 4K1XA 4XSVA 5IHPA 5ALZA 3L05A 1Y4DE 3KG2A 1RQGA 4BLTA 3PUXA 3HO1A 1OD6A 3FCYA 1U1DA 4NH4A 4UNIA 1M2WA 2XZDA 2V98A 1G55A 2R7LA 4DCNA 2YWHA 4OXYA 5ULLA 2ETXA 3KAKA 5EAIA 3T1NA 3UB2A 3I6QA 3UEOA 3DO5A 3ZWNA 3QYAA 2W42A 2AC7A 1JYEA 1P7WA 3A6HA 4FBMA 4IIHA 2I1WA 3BSYA 3SD7A 4A2CA 4C4ZA 4E88A 5KU7A 4B4DA 3N8HA 3EXHC 3NTQA 1YMVA 4FFDA 5GM1A 2VQFB 5K3EA 1I2DA 4AJIA 4FHEA 2HSJA 3WO0A 2W6CX 1L4HA 4OD0A 1UXJA 2D0DA 3HR7A 4EW1A 3Q72A 1AT1A 4JLNA 5E6SA 4DIBA 5AI8A 3J80A 4WMLA 3N0RA 1U3WA 1XQ1A 1ZCJA 2C4KA 1ZO8A 4D99A 3E5NA 4WN3A 3T9BA 1G6Q1 3GQVA 3JS5A 1DKQA 1ESNA 5JYBA 1YR6A 1WHSA 3JSXA 3AHJA 2B9EA 3GDOA 1H4VB 3LPAA 5ALUA 5K0GA 2XR1A 2ODTX 4UU8A 3JTMA 3CF4A 2DLCX 2W6NA 2ZSEA 2GK7A 3TN7A 4WKGA 1B0UA