2H63A

Crystal structure of human biliverdin reductase a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
284
Chain Sequence
MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Biliverdin Reductase A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Biliverdin reductase A
total genus 89
structure length 284
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2h63A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2h63A01
3K2BA 1HDCA 1HSOA 2CVQA 1MXHA 1SZJG 4A27A 4BO0A 2G76A 1S6YA 4XIJA 2B83A 4FJ1A 1L1FA 2ET6A 1M67A 4FFNA 5BNFA 4QFCA 4IQ8A 4BO1A 1YL6A 1A72A 1ZK1A 5C3MA 3R0IA 1HRDA 4WKGA 3PRJA 1TT7A 1Z7BA 3QV1A 1LC0A 1VSUA 5IDYA 4RLSA 2W2LA 4D0RA 1ML3A 1HE2A 4QECA 3RC1A 1LDNA 2G17A 3EAGA 4XYLA 2PA3A 4OL9A 3IKTA 3CEAA 4FOSA 3ZHZA 2QHXA 4LN1A 1Z74A 3ETEA 3RSHA 1YQXA 1MG5A 4ND4A 4PG6A 3TZQA 3ANNA 5TJHA 4D43A 3RJ9A 5DOZA 5A04A 1HE3A 4E3ZA 2ZJ0A 1CETA 3KO8A 5JCJA 5JFOA 2FPGA 2VYND 2G82A 1ENPA 2VWQA 3RIHA 4D0SA 2JHGA 4OH1A 4CR7A 1DRWA 3U4IA 1I3LA 2OXIA 4W7IA 2Y1OA 4ZQFA 3GGPA 3LZ6A 3V2HA 1NHWA 1P1FA 4E5YA 4XZ3A 1BRMA 4BNNA 3DBVO 1PGNA 4NNJA 1R12A 1WDMA 3DFUA 2O2YA 3M6IA 5THKA 1Q0QA 2EWMA 3M1LA 1ZJYA 3JYQA 4BO3A 1Z82A 2P68A 3F4BA 3AUSA 1QRRA 4N18A 3RKRA 2B5VA 2DM6A 3UN1A 1H5QA 4J90A 4XQ9A 4J4TA 4J2OA 5DBGA 3UGKA 1IOLA 4BV9A 5JC1A 4G5HA 4E30A 3U09A 3H9GA 3M2PA 3DXFA 4LRSB 4NI5A 3X2EA 1LDMA 4R1SA 2AXQA 3TL3A 3FF4A 1ZK3A 5JS6A 3TWOA 3LF1A 1C1DA 4U8GA 1GZ4A 2PGDA 1ORRA 3DZHA 4I5GA 4ND5A 5ICMA 2IRWA 2YDXA 1I01A 3QW2A 5F5LA 4W4TA 2C07A 4KTVE 1V3UA 3QVSA 3D5QA 1HTBA 5A06A 3E1KA 1BXKA 1MFPA 1ZXLA 1TVEA 3HJAA 2AA3A 5IDXA 4WNIA 3NV9A 2EP7A 1D8AA 2WJPA 3HDJA 3SEFA 2ILTA 2JCYA 2YW9A 1CERA 2PWZA 4P4GA 3FTNA 1MC4A 5B4TA 2DFVA 4Z9FA 3GG2A 4BNTA 4AJPA 1RJWA 1UXKA 5DOVA 4JNKA 2HMUA 4NJMA 2JL1A 1DIGA 4WCDA 2BH9A 4LSWA 3C8MA 1F0YA 3NTOA 2VUSA 1NVMB 4BNIA 1PS9A 4QSMA 4TVOA 4CPDA 1VC2A 2PR2A 1NBOA 2CDAA 3FCOA 3OQ6A 3VZSA 1JU9A 2PV7A 4FD3A 3KLPX 4TRJA 5EPOA 4NBWA 1PGOA 2E48A 3ANLA 4ND1A 1I8TA 1VLLA 4IZHA 3Q0EA 4YT5A 1XQ6A 2F00A 3DHYA 4IIUA 4BB5A 1SAYA 1W73A 2XPCA 2JFFA 2GYYA 4XKJA 3CXRA 2P4QA 1QORA 4DWVA 3NT5A 3L4BC 3JYNA 1FXSA 4D3SA 1LRKA 4AJ2A 2WD8A 3L4BA 3ENNA 1D1TA 1V9LA 4MINA 2YUTA 2HK8A 3WYCA 4YJGA 3MWEB 3VZRA 4I5FA 3VDQA 1Y5RA 3TRIA 3BMNB 3WYBA 2O2SA 4RDHA 4DPLA 1QLJA 3GDFA 1P1KA 1VRWA 2GERA 3W8DA 2JKVA 5TRTA 3ZV5A 3PFWO 3RC7A 2OGUA 3F4LA 2PGJA 3E9NA 1WZEA 3RWBA 3LSYA 2AE2A 4WK6A 3ZZNA 2HKIA 3COSA 5ER6A 3CPSA 2CMDA 2PLAA 3OECA 5IXYA 2R2GA 5TSDA 2UAGA 1WAMA 1AHIA 1I3MA 2EV9A 3ITKA 4IINA 4ZRMA 3TZHA 4AJLA 5TLSA 3WWZA 1AXEA 2IEBA 2NVUA 1ZK0A 3KRTA 4RF4A 3TOXA 4KWIA 4BVAA 4MVJE 2CSUA 1PEDA 2YHUA 2IXAA 4YRAA 4M87A 5JNLA 3GVCA 2FR0A 1Y81A 4W99A 4EITA 4Z9YA 2GZ1A 1GV1A 3AY7A 2CD9A 3TZKA 3OJLA 2YHIB 5JAMA 3KSDO 2VT3A 2GN6A 3HHPA 3BMOA 5B12A 4W82A 1CDOA 1EK5A 3UOGA 5JAZA 1P1JA 1M6WA 3AJRA 4EJMA 2BGLA 1DC6A 1ZSNA 4IGEA 4GWKA 4K1LA 4KWHA 3CZMA 3U4DA 4D44A 4TRRA 1CWUA 3BHMA 4FJ0A 1LTHR 4RPJA 5BNTA 1ADFA 2O3TA 4UVDA 5LC1A 3BMQA 1BWSA 3ABIA 3VKUA 1QYDA 3GRKA 1GYPA 4YJFB 5IN5A 4CM3A 4PLHA 4R5HA 4YBZA 1MP0A 2Q1SA 3AY3A 2WEKA 2VOJA 1KC3A 4Y8VA 2O3RA 2PD3A 4U6SA 4BKPA 4IM7A 2NM0A 4CQMA 5CHEA 4Q3EA 1W6UA 1E3SA 3ADPA 4U6QA 3WFIA 3OA2A 3JQ7B 1I2CA 2PGLA 2DBRA 2VRCD 4CM6A 4Y9DA 1LSSA 3S55A 2VHZA 5J23A 1QYWA 4YEDA 1HDOA 4WLOA 2BFOA 4QO7A 4UEKA 3HB5X 1LX6A 4O59O 2AE1A 2NNLD 2VZ8A 3KETA 5BR7A 4E31A 4I5DA 1DO8A 1NP3A 3JQBC 4E0BA 2EKLA 3LT1A 5DCWA 2GASA 2Z5LA 3RROA 1LU9A 3PTZA 2PH5A 4GX5A 5DBIA 1R37A 4BO7A 1GZ3A 4CMJA 1PQPA 1T1RA 1OBFO 1GZ6A 4ZQHA 4U7WA 3IC5A 3C3XA 3DBRA 4IS2A 1KBZA 4I9HA 4CM7A 1JLLA 1X1TA 5EIOA 1DIBA 4F6CA 4UULA 4RF5A 1J4AA 4CL3A 1ONPA 4MJLA 5A3VA 2X0RA 4YQZA 5T8KA 2W4QA 2AEMA 5KJFA 1KERA 2FZEA 1WVGA 3JQ9C 4BOYA 3O03A 4E2ZA 4M54A 5BSEA 1BVUA 1EUZA 4GKBA 7ADHA 1IHYA 2O3SA 5C7LO 3FBTA 3GAZA 3FNFA 4IDFA 4YAKA 1TI7A 2ZYAA 5JMWA 3K30A 4DYVA 4HX5A 1P0FA 3IOYA 3KM0A 3DOCA 5TIIA 5AVOA 1IYZA 2QQ5A 1NWHA 2ZYDA 4R68A 5IZCC 1R4MA 4EJ6A 1CQIA 1NVTA 2IEDA 3JD3A 4RJTA 4MP6A 3S2GA 3DZKA 1VE9A 3LLSA 3WXBA 1UH5A 4OSPA 2QW8A 3TFOA 2GSDA 5EERA 3RUAA 3ZWAA 2J3JA 1ENZA 1E7WA 4R5MA 4YCAA 3TPCA 3JD1A 1T2CA 4AJIA 2YV2A 2VRCA 4JIGA 5AXCA 5L4SA 3PGJA 1M2WA 3I9MA 1R6DA 1R0KA 5KTKA 1GY8A 3AY6A 3RUFA 3PWSA 3ROMA 3GMSA 5ENDA 2B5WA 4PG7A 2GN9A 1DC4A 4DPKA 4L73A 2O3QA 5JYEA 2BFAA 4W7HA 4OSOA 4EDFA 4YT2A 3EZYA 1P77A 5JDCA 3OJEA 4FR5A 4YR9A 2AHRA 3B1FA 2Y0EA 1WP4A 2LDXA 4DRYA 2UDPA 2O7QA 3BHJA 3LT2A 3NTQA 2Y1CA 3EYWA 3TDKA 4Y6RA 1UUFA 2GO1A 1SOVA 3OP4A 1I30A 1UJMA 3K2EA 4L4XA 4BNVA 2PD6A 2O4UX 2D2IA 1KEVA 3DHEA 4YB8A 1PWXA 2AQ8A 3GT0A 4BMSA 4RLHA 5F1PA 4XYMA 3ZU4A 2W2KA 1NR7A 1TLTA 4OXYA 1WXDA 3OEYA 3JV7A 4RVSA 1WPQA 5JCXA 4CMKA 1BW9B 4UVHA 4P38A 4D7AA 5A02A 1B3BA 3ONDA 2GUGA 4LISA 4PLZA 4E5PA 5I7SA 3ICPA 3KHUA 5KJCA 1LDYA 1QYCA 4MO2A 2IDZA 3GFGA 1NXQA 2X1HA 4PLGA 3F3SA 5JAIA 1VI2A 1PZHA 3JYPA 3PDUA 1JKJA 3L77A 4BV8A 1SNYA 4KUGA 5I7EA 5I7FA 2QRLA 4MP3A 2OBYA 3WLFA 4DBZA 4D46A 1IB6A 2YHIA 1K6IA 3ZWWA 1ZBQA 3WGTA 4EW6A 4DQXA 5IDQA 5JDIA 4F46A 3AUUA 1AN9A 3K73O 4GGPA 1AGNA 4OHUA 3PK0A 3FI9A 3WTCA 3AM3A 4RVDA 4AJNA 4ZQEA 5F1OA 5U1PA 4XGKA 2EF1A 2Q4BA 4M1QA 1ISHA 1ADCA 1GCOA 1H94A 2W8ZA 5K6AC 5EQDA 3D3EA 3GNSA 4E6PA 3IUSA 2X8LA 3ENKA 4BGIA 1E0DA 3UVEA 5KOIA 4PGFA 1N7GA 2DQ4A 4WEQA 4JLWA 1KEWA 3PIIA 1CRWG 1ONOA 5A5FA 1A27A 1B15A 1JQBA 1H6AA 1R0LA 3U3XA 1C0KA 3PHJA 4BNHA 1SO8A 2Y1EA 3OQ1A 4JBIA 4BO2A 5EN4A 3JTMA 1C0IA 1H2BA 3DC2A 2Y68A 3GFBA 5A9RA 1DFIA 1DFHA 4OM8A 4ZD6A 1SC6A 5L7WA 2GLXA 1HDZA 1ID1A 2NQ8A 1E5LA 5CEJA 4AJHA 2WTBA 4RZIA 1WDLA 1H6BA 3DMYA 1BXZA 3KSZO 3EY4A 4BS9A 3BMCA 3QLJA 4H3VA 3GGOA 4WECA 1XR3A 5IZCA 1XLTA 3DZJA 4IJUA 2QZ9A 1YL5A 1E7MA 3ZU3A 2X5KO 4MVJG 3H5NA 4CLEA 5CDSA 4IY1A 1GYQA 3GRPA 3KOUA 4UUOA 3K31A 4ZRNA 3CH6A 5H81A 1BGVA 4Z0PA 1R4MB 2PZKA 4BQRA 1H0KA 3GUYA 4IDBA 3TJRA 4DQVA 1YRLA 3W6UA 3GN1A 3F47A 2VZ0A 1DLJA 4B79A 2C20A 3CSDA 4NK5A 5EINA 3NX4A 1RYEA 3CMCO 1OFGA 3SBOA 4R1UA 4GQAA 1YDEA 2FR1A 1P0CA 2ZTLA 3PYLA 2DUUA 1Q7CA 3A4VA 3INGA 4ZJUA 3HNPA 1A71A 1SOWA 3GG9A 4FFPA 2NU6A 4AJEA 1YWGO 3PJGA 4NBRA 2HUNA 2O48X 4I8XA 4RO0A 3M2TA 2C29D 4R01A 1NPTO 4IXWA 4U5QA 4CLDA 3NDRA 4QUKA 5A1TA 4HNHA 1PZEA 1K6JA 4Z3DA 1A4UA 3FD8A 4J9VA 2O7SA 1V6AA 1TEHA 1HZJA 3SXPA 4GVXA 1ZMTA 5BNIA 4CV3A 4AICA 4N5NA 3H4VA 4EUEA 3WMXA 3E5RA 2P5UA 4LCEA 3HFSA 4D45A 2HO5A 1Q1NA 5KVCA 3HN2A 2JD2A 3PP8A 2RAFA 1LUAA 1SCUA 2A35A 4XB1A 4L4SA 4Z3KA 5ILOA 4N54A 2YV3A 1YBVA 4BHTA 1RM4A 1EDOA 1K89A 1E3JA 1SMKA 4OQYA 3WX0A 4OXNA 1UDAA 4YDRA 2Y05A 3UAGA 3IJPA 1MX3A 3OJ0A 4GMGA 4IJKA 4XR9A 1PR3A 2RBEA 5B37A 4CQLA 4J2HA 2G5CA 4B8ZA 3VAZA 3DOOA 4B4OA 2WM3A 1K2WA 2P9EA 3EZLA 4LMRA 4U0JA 3H9EO 5TX7A 3WIDA 3GEDA 3PGXA 3TNLA 2CZCA 4B4VA 1B8VA 1D4FA 1HLPA 4IDCA 4OKNA 4YRDA 1RPNA 2AQKA 3DZFA 3PJEA 3SC6A 3Q2IA 1JW9B 2W2KB 2EEZA 3OETA 2DVMA 5BSFA 4GL4A 2C54A 1DFGA 2VNSA 3U62A 3NTRA 1Q2XA 5HBRA 4ALNA 5HM8A 3WLEA 1ZK4A 2A9FA 3TZCA 3P7MA 4EGFA 5JPIA 3FTPA 2P5YA 1PX0A 2PKRA 4RPKA 3GAFA 3ONFA 2VYNA 3VTFA 1KC1A 3JYLA 4Y6PA 4Q3BA 4AJ1A 1XGKA 1YB4A 1A4IA 2UVDA 4WLEA 1K5HA 3BXXA 4J43A 1LDGA 2CUKA 2AG5A 1PJLA 4HFMA 4M89A 4BNWA 4E2WA 3JD0A 4DC0A 2HK7A 3JQ8A 1C1XB 3WBFA 1YBMA 3QWFA 5AOVA 4WEOA 2JFGA 3EDMA 3DBHB 3F6YA 1QV6A 2IYOA 1BVRA 2WYUA 1NYTA 4IDGA 2BGKA 1U3UA 5DP1A 4ALMA 2OOSA 5L9AA 3BTSA 5C7IO 1IZ9A 1PL6A 4H16A 4RVFA 4JK3A 3GVIA 4XWYA 4B7UA 4B3IA 3WQQA 1ZZEA 5H83A 5JMPA 3GEMA 4DMMA 1N5DA 2NVWA 2CFCA 4HV4A 4P4NA 1EVYA 1EZ4A 3AUTA 1GUYA 3WNQA 3PJDA 1E1NA 3DR3A 3KSUA 3EGOA 4K6CA 1GQ2A 3ZDFA 4WCFB 4M55A 4I9NA 4EUFA 1DJQA 2CF5A 2WD7A 2RCYA 4CM9D 1ZUD1 4YQYA 3ANMA 1NQ5A 2FRDA 2P9GA 2XXBA 2YY7A 1GU7A 3OMLA 5FFFA 1U3TA 3RFTA 3RC9A 3ZV3A 4DL9A 1DRUA 1VL8A 2P91A 1LLQA 2O50A 1I36A 1TA4A 1QYXA 2V6FA 5T64A 1DC3A 4DTIA 3LT0A 1AUPA 4BNLA 4A26A 2Q50A 3V8BA 1OMOA 1XCBA 4KDEA 1P33A 4XYBA 2C7VA 3DEYX 3L9WA 1ISFA 5DNAA 4D42A 3GHHA 1U9JA 1JKIA 3GZNA 1ZEMA 2OZPA 3ZWOA 4DA9A 2GDZA 5A9SB 4EEXA 2JCVA 2DPHA 2ZTMA 3ZCXA 3DTTA 3I5MA 3IKVA 4XQEA 3WS7A 5A5EA 1PQWA 5AXAA 4L4RA 3QWIA 4LK3A 2EG9A 3F1KA 1B16A 4GMFA 3P2YA 3ZWXA 4E5NA 4L8VA 4TKMA 4PLTA 4CMHA 2V6BA 1NAHA 3T4EA 4ZQGA 2O23A 1U2GA 3MZ0A 2ZK7A 3OJFA 4JROA 2YQ4A 3GOHA 1GCUA 3LYLA 4JX8A 2D59A 3BTOA 3H5AA 1V35A 4YAGA 2GF2A 5EQFA 3I83A 3TSCA 3WR5A 3WSWA 4FC6A 5IJZA 1XEAA 3PZRA 1DLIA 1TT5A 2HMTA 2XAAA 1HKUA 4NU5A 2H5LA 3CKYA 5JYAA 1PZFA 4NG5A 3P19A 4IQ0A 1KYQA 3S8MA 3TN7A 3PYMA 2X0JA 3JQDA 3D0OA 3ROPA 4CQMB 1H6DA 1PJSA 4Z0HO 4UUNA 1SBYA 3P5SA 2GD1O 3RC2A 5HS6A 3ASVA 3ZWNA 4J49A 2UV8A 4M49A 3Q3CA 1WWKA 3GGGA 3UH1A 1E6WA 1CEQA 4CV2A 4BKUA 5CDYA 1J49A 4HXYA 2E6UX 5BSGA 1DAPA 2YFHA 3AM5A 2PNFA 1HT0A 4CM5A 4KOAA 1I10A 1GADO 4R1NA 4XIYA 1QG6A 5GZ6A 2PD4A 4UUPA 5CPFA 2YQ5A 4Q3NA 3ZU5A 4WOJA 5TS3A 5ENVA 3KBOA 4JP3A 2ZTUA 3ROQA 5IF3A 5JY6A 4AL4A 2I3AA 2J5KA 3GVHA 3VDRA 4DXHA 4MIEA 1M75A 1P74A 5CDUA 2QG4A 1W0CA 4GLLA 2D1YA 3C1OA 3MJVA 1P9LA 3AOEA 5EJ2A 2OMEA 2Y1FA 4ZHSA 4O1MA 3PIDA 1Z45A 4IDDA 3AOEC 3GEGA 1GEGA 4J0FA 3FWZA 3UCFA 1A7AA 4PCVA 1U5AA 3KTDA 3PWZA 1V0JA 2X0IA 1JDJA 1FDTA 2E49A 1YOVB 4FSHA 1PJ4A 4BIIA 1E3WB 3HADA 1E5QA 3GN2A 3ASUA 4TSKA 3W1VA 4YYZA 3WDSA 3DONA 4PLCA 3O8QA 1NFFA 1RM0A 3I9LA 2WWRA 3RBVA 3DTYA 1HETA 4YT8A 1T2AA 2BGMA 2PTGA 3I4CA 2QRKA 2BKAA 3NEPX 1C0PA 3QA9A 1N7HA 5B4VA 3EVNA 1GPDG 2I6TA 4KQXA 2FSVA 1NNUA 1QLHA 2C5EA 1U7HA 1YB5A 2WE7A 1OC2A 2A94A 1KVUA 4BNFA 3G1UA 2POQX 3D4NA 3WIEA 2P4HX 1T4DA 2GGSA 4E32A 3LF2A 1DXYA 2HAEA 3UCEA 3UUWA 2CDBA 1D1SA 3AOGA 1E7SA 3AI1A 1U8FO 1VKOA 3NJ4A 1HF3A 1R66A 1U7TA 3FR8A 4XR4A 4CV1A 3LQFA 1GAEO 3EW7A 4Z6KA 3E9MA 1S7CA 1F14A 4NFYA 2Q99A 1PR9A 1UAGA 5FF9A 5T5QA 2X22A 1YB1A 2DBQA 3KXDA 4R1TA 2PKQP 3E8XA 4ILKA 2PK3A 4BKOA 1R4NB 3TOZA 1GQYA 2HK9A 3EK2A 2VCYA 1ISIA 3QRWA 4J91A 3MOIA 1D3AA 3OIDA 4MOWA 1B8UA 4FPXA 4AJJA 1QP8A 4YJDA 4J1QA 6ADHA 4WASA 5JYDA 1X15A 3RASA 3PZBA 1P1RA 1UXJA 1LJ8A 3DBRB 4XD2A 1LLUA 1XWFA 2ZB3A 4Q9NA 3AU8A 4KUEA 2I3GA 2CF6A 5DZSA 1K0UA 1IHXA 1KEUA 3WBBA 3GDGA 5L4NA 3OF2A 3ZU2A 1B26A 4QTZA 5TNXA 4RPHA 1RKXA 3AFMA 3IJRA 1Q7BA 1HEUA 1VM6A 3JD2A 4HFRA 4PRKA 1Y8QA 2Q46A 4LVCA 5A9SA 1G0NA 5ICSA 2C7GA 1SEVA 3D4OA 3QVOA 7MDHA 5ITVA 1X0VA 4CMGA 1RM5A 3HWRA 1EBUA 1MV8A 3DHNA 5BT9A 2ZQYA 4FS3A 3E82A 3G79A 1ZXBA 1LA2A 1HYGA 4PG5A 4UVGA 2VWGA 2X6TA 3ZHXA 1GYRA 1YO6A 2PY6A 5ES3A 4XX0A 3BHIA 2WYWA 1R4NA 5CDGA 2Q2VA 1LNQA 1ZSVA 2HCTA 2YFQA 1EVIA 1EDZA 1LDBA 4MVJP 4EEZA 4BKQA 4DPMA 4CJXA 3ROKA 4PG8A 3GLQA 1XYGA 3WGGA 1ZKMA 3MJ4A 1AE1A 3F9IA 3JQBA 4JQCA 4FIZA 2D5CA 5EL0A 5JDCC 3ETDA 2FN7A 4O5OA 5C7OO 3V1UA 5G4KB 3E5MA 3DBLB 5I9MA 1LBEA 2D0IA 1U5CA 4K6FA 2EERA 2E37A 3R1IA 4IJVA 2DBVO 1NM5A 3DAGA 3H7AA 4IXTA 5CEFA 4GX2A 3ORFA 4W6ZA 1EEHA 1NASA 3N74A 2X5OA 2Q1TA 1DPGA 2V6GA 5A03A 4JP2A 4ZGWA 4IDEA 1GEEA 1T2FA 2AQHA 2CDCA 4CMBA 1T4BA 4DLBA 3MWDB 1XELA 1JWBB 2HJRA 4UUMA 3WOHA 2PZMA 5I7VA 2D5AA 4TRNA 5JBIA 2Q4EA 4HUJA 1GR0A 1Y8RA 4NZ9A 4XYGA 3E9QA 1ZMOA 3S2EA 2PKQO 2HU2A 4II3A 2EGGA 1Q0LA 2JJYA 1P44A 1ZNQO 4KP7A 1JAXA 1I24A 4B3JA 1RM3A 4BL5A 3QSGA 1NTOA 1ZEJA 1EE9A 2NTJA 4KZPA 3RU7A 3W8EA 3ZNQA 2ZB7A 3IP1A 2Q45A 3QIVA 4R16A 4R9SA 2OP1A 1UXIA 5COAA 3GK3A 5COQA 2ZJ1A 5I9NA 1PGJA 2HQ1A 3ZV6A 1P45A 2X5JO 2DT5A 5JLAA 3VPSA 3VPFA 2EHDA 1XU9A 1PJ2A 2W2LD 4UREA 3GNTA 1E1LA 1IY8A 3H3JA 5AQ1A 3JQ8B 3BAZA 1N2SA 5EMHA 2UYYA 3KEQA 1HE5A 4NK4A 4BO4A 3CTMA 5K6AA 2X0NA 3JCZA 2G1UA 2Q3EA 4CQLB 2Z1MA 4WGGA 4K28A 3OFSA 1HZZA 4UEJA 3I23A 1J6UA 2IZ0A 1PGPA 2GRAA 4PFJA 5F3RA 1R16A 4FC7A 3ZWMA 3DZBA 5F21A 1KVSA 2Q1UA 3NRCA 3DOJA 1E3WA 1E3EA 1Y6JA 4JN6B 4W9NA 4YACA 1T26A 3S2IA 3MOGA 3A28A 3MTGA 4URFA 4HBGA 4J4BA 1NWCA 4WLNA 3DMTA 1L7DA 2Q1WA 4MVJA 2BFMA 3PJFA 4K9DA 5U4QA 1LXCA 4DREA 4RVUA 4YJHB 1EBFA 4O0LA 4R51A 4H15A 4M8SA 3CZRA 1UP7A 4GSLA 2JD0A 4OQZA 4C7KA 2NTNA 3N58A 3T7CA 1Z6ZA 3CUKA 3VZQA 4FFMA 4RQTA 3NT2A 1BDBA 3INRA 1Q7GA 2IODA 3C1TA 4G2NA 2H63A 2P2SA 2FR8A 2VTEA 3MJSA 2DBZA 3BTUA 9LDTA 5JY1A 3QHAA 1W8DA 1FDSA 4FGSA 5G4KA 2ZYGA 1XSEA 3VHRA 4RZHA 3VH2A 2A92A 1UXHA 2FMUA 2TMDA 3EVTA 1Y8QB 3C7AA 1X7HA 4AJKA 1OZAA 1VL6A 3U4CA 3ZWBA 3AFNA 3RBXA 1V8BA 4MDHA 1ZFNA 1ZSYA 4PZCA 2Z1NA 1J5PA 3LC2O 3NJ8A 4DYDA 5KJ1A 2Y0CA 4Q3DA 1T1SA 1DDOA 1QV7A 2GR9A 2HJSA 2BD0A 4OXKA 2FP4A 3JQAB 3DAPA 1OOEA 3VC7A 4RCVA 4LVUA 4A5OA 4ZA2A 4BMVA 3ON5A 4EI2A 5KJ6A 1EK6A 2VNAA 3BZUA 3JQAD 4S3MA 3DL2A 3HDQA 2H9IA 3OA0A 5G0SA 1HDGO 4J9UE 3PHIA 3FBGA 2QRJA 3AK4A 4IZIA 3A14A 2JHFA 3D64A 4FB5A 3VH3A 3IMFA 3WTBA 4WE3A 1NAIA 2FPPA 2WD7B 4L75A 5KWEA 1SEPA 1U3WA 1BDMA 4ROSA 1LSUA 3TZ6A 2NU9A 1NFQA 3Q9UA 2YV1A 4G81A 5DCYA 5TJ9A 3KZVA 3MJTA 2OBNA 2CVOA 4DC1A 1G1AA 2HRBA 4CLRB 2NWQA 4B4UA 4IUYA 3ITDA 1E7YA 1CIVA 3L0DA 1YH3A 4GVLA 1ONNA 1B7GO 2BF7A 3TQHA 3UKOA 2C0CA 3PQEA 4RORA 3IUPA 3E6AA 1U8XX 5KVSA 5A9TA 3DBHA 1XDWA 3KYBA 4OJNA 3L9XA 5G0WA 4QEDA 4ALIA 5FI5A 1C1XA 3C24A 2JCXA 2ZKLA 3SLGA 4CODB 3ZH2A 2VN8A 1JKFA 4BNYA 2J3HA 3GA0A 3RFVA 2BLLA 1JVBA 3Q1LA 3ZWCA 1UP6A 2EP5A 3CMMA 3RFXA 3WQSB 4BNXA 2NTVA 3PYXA 1NFRA 2R6JA 1LDEA 3PLNA 3R3SA 3WJAA 3F1LA 2FZWA 4CM4A 1ISJA 3WJ7A 2VYVA 3B20A 4J1SA 2RHCA 3VVCA 4QX6A 4B8WA 3K5PA 1O5IA 3C1AA 4BGEA 1LSJA 3AWDA 3MEQA 3JQ7A 4IBOA 4OGWA 4XJTA 3OEWA 3VVBA 5IN4A 4XEHA 5JO0A 4GLOA 2C2XA 3D4PA 4YVFA 2B69A 1I2ZA 2VZ9A 3O4RA 4LW8A 5CG2A 1Q0HA 3G3EA 5ILGA 3VKVA 3K9QO 5AYVA 2XF8A 3UHAA 5G2OA 1DSSG 4RF2A 3ZW8A 1A5ZA 4XB2A 2VOEA 3OQBA 2NVBA 4H7PA 5KIAA 1A7KA 2D8AA 1K3TA 2B4QA 3BMQB 3DZIA 3GPIA 3GQVA 3KYCB 3NUGA 3JQEA 3SVTA 3KEOA 3RBZA 2VHXA 2EIHA 2JFHA 1ZVMA 3VZPA 3EHEA 2RIRA 3GUCA 4ZICA 1I33A 4YT4A 1YOVA 2DTXA 4J1NA 4XJSA 3KYCA 1O89A 3QE3A 4E4YA 1WLYA 5JE8A 1BTOA 1XG5A 2NV6A 1NPDA 8ADHA 3FSRA 1HWYA 1X7DA 3DZGA 1CJCA 3PEFA 3B6ZA 5DCUA 4AVYA 1U3VA 4PLFA 2GZ3A 1PJQA 3B1KA 1K6XA 1XKQA 4LCJA 4OOFA 1NQTA 1PGQA 3HZZA 3QWHA 3UF0A 4NIMA 4BB6A 1LLCA 4LSMA 1UDBA 4AFNA 1HLDA 3WNVA 4BNGA 4PLPA 4OAQA 4LGVA 1MA0A 4FFLA 5I8ZA 3T7EA 4XRRA 4LRTB 1U1IA 4U0KA 4GGOA 1FDVA 2OO5A 5L7YA 1NHGA 2D4AA 1KETA 3DAFA 5KVQA 1X7GA 4WUVA 4QFDA 4ZVVA 4XRGA 5TC4A 3NKLA 2ZB8A 1E6UA 2UUPA 3FN4A 3KYDA 5KJEA 3JQ9A 1KS9A 4MVJF 1E92A 2YJZA 4TKLA 1F06A 3BYZA 3IP3A 3RU9A 4OIMA 4Q39A 1B8PA 4XQCA 4UVIA 1QKIA 1O8CA 1P31A 4EJ0A 1UDCA 3G1TA 5G0VA 1MB4A 3PWKA 1Y9AA 4B7CA 5CEEA 2Z95A 4R4JA 1P3DA 2NU7A 4MPDA 4CR6A 4IMRA 3KV3O 4IQGA 2Q49A 5F5NA 3U0BA 1ZO8A 3ETGA 4L9RA 3NGLA 4P22A 5GY7A 3PHGA 5HRUA 2DFDA 3GDOA 4J3FA 2PFGA 3A06A 3QY9A 2EKQA 3ST7A 4DIOA 2FOIA 4BO5A 1U4SA 4TRMA 4C4OA 4NHEA 1RYDA 3E18A 1U28A 1ZW1A 3RCBA 1BXGB 4Z0TA 3OSUA 2BELA 5IXSA 3D3WB 5GMOA 1GV0A 2G0TA 1FMCA 2IE0A 5KKCA 1KVTA 1LRLA 2I66A 3KB6A 2BI7A 4MVJH 3PHHA 2B0JA 3HB4X 1NQAO 5T73A 4K26A 3W4IA 1PL8A 3RUHA 5TF4A 5DN9A 3MTJA 4J4HA 5J9GA 3OHSX 4GKVA 2AEFA 2AQIA 2EJVA 5TGDA 2I9PA 4YRBA 3JSAA 3MJCA 2J3IA 1X0XA 4J6FA 2Y67A 9LDBA 1F17A 2VHWA 2SCUA 3WYEA 4J0EA 3KYDB 3MJEA 2J8ZA 2JAHA 4YAEA 1MG0A 1EQUA 4NFHA 1VJ1A 3LU1A 3TFQA 2NQTA 1O94A 3WGYA 2R00C 1NQOA 3CE6A 4CL8A 3LC1O 4HP8A 4IIVA 4TZKA 5K0ZA 3HUDA 4HNGA 4UVEA 3ZNNA 5L53A 3BA1A 3EUWA 1JVSA 4ALKA 2O3JA 4INAA 4GI2A 4MKRA 2HLPA 4IPTA 4QO8A 2VHYA 3I4FA 2X7HA 2V65A 4GWGA 4JBHA 3DMTC 3RUIA 2WMDA 1MUUA 4MKXA 2AG8A 2TMGA 4MIOA 3OH8A 4NMHA 1BW9A 4DUPA 2OL4A 4TVBA 2NUAA 4DMLA 4GH5A 2NU8A 1DIHA 1F8GA 1VL0A 5FYDA 4PIVA 3RI3A 2B35A 2B4RO 2LDBA 1FF9A 1JTVA 2GZ2A 5C37A 3PHLA 3GR6A 1MFZA 5HTOA 4Q3AA 1I0ZA 4EYEA 3PLRA 1C14A 3Q9NA 4PVCA 1I32A 2DUWA 3ZHYA 2OUIA 1TB4A 1N1EA 4NR0A 1YJQA 3IDSA 2YDYA 1VPDA 4CMEC 4CM4B 4J1TA 2WE8A 4DLLA 2VYVD 4CMIA 3AI2A 1AHHA 4PN3A 4MVJI 3KVOA 3U9LA 4PLVA 2FY8A 2W90A 4E21A 2EW2A 3GPDG 1IZ0A 3WMWA 3ZN2A 4YPOA 3WSVA 3BIOA 3PQDA 3RUEA 1ZK2A 1P1HA 3HDYA 1EVJA 4B4WA 3OIGA 1V3VA 5TQVA 1MLDA 2NVUB 4E12A 2BHLA 2AW5A 3O26A 3JQFA 5CFZA 1M76A 2C82A 5A05A 3RVDA 3V1YA 1Y7TA 3MCVA 4N5LA 4XQGA 3SX2A 2DC1A 1A9YA 4HY3A 5B1YA 2HMWA 4O6VA 4D3FA 3H9JA 4JBGA 4DLAA 1IE3A 4BNJA 2IYPA 5COBA 3TL2A 2B37A 1YQGA 5JYFA 3G0OA 5EESA 2H1SA 1OI7A 1XU7A 2W98A 3WG9A 5CDTA 1HYEA 3ONEA 3SJUA 3H8VA 4IMPA 3OJOA 4ONEA 4A7PA 1NVGA 2DTDA 3GNQA 4FBGA 2WSBA 2XXJA 4RDIA 1I5RA 3NDIA 1PL7A 1N92A 1E6EA 3LDHA 1E1KA 2FHSA 3K92A 2Q2WA 3H65A 3RAJA 1ISMA 1DB3A 2E82A 2VRBA 4MIYA 1I2BA 3ZNPA 5IAAA 4CR8A 3GZNB 4D79A 2HMSA 4WLFA 1PSDA 2NSDA 1JAYA 2DKNA 4WNCA 4WLVA 3VPGA 4FJ2A 3U5TA 4YTEA 1O0SA 3QQPA 4DIFA 4HFJA 4Z9XA 4ALJA 1PJTA 1Z73A 3X2FA 4TROA 4BGVA 4CM8B 1LRJA 1UAYA 3G49A 5G0UA 3NYWA 3VTZA 3UCXA 3SC4A 1FK8A 3BMCB 3H6KA 1ULUA 4TMFA 2HSDA 3I9OA 4CM1A 3K96A 3D3WA 1LI4A 1HE4A 5I9LA 1N8KA 1NPYA 4NJMB 1YL7A 2NACA 1DC5A 2VTDA 5AXBA 3LLVA 3DB2A 4ALLA 4WPGA 2Y1GA 1JN0A 4W9NC 4ESOA 4R9RA 3FNGA 3PXXA 1IPFA 1DBVO 4C7JA 1HDRA 2PH3A 3F46A 3NDJA 5ITWA 4IDAA 1M66A 1E1MA 4BO8A 2Y1DA 3ZGYA 1PIWA 4DGSA 4IS3A 2RHRA 4S1VA 5IDWA 4BNUA 3E48A 3JQAA 2I65A 2VUUA 4L74A 3V2GA 2VUTA 4YA6A 2B36A 3L07A 3VPHA 5JW6A 4NBTA 1WDKA 4YJHA 3H3FA 4OOEA 5GZ1A 3JD4A 1MC5A 2GNAA 2I67A 2Q22A 4KTTE 5DP2A 4JJFA 1P1IA 3W6ZA 4CMCA 4R54A 4YXFA 4LMPA 4DQUA 3WB9A 4NBUA 1H6CA 1E3LA 4I5EA 4FQ8A 2CVZA 3DFZA 3PPIA 4GSKA 1CQJA 2EW8A 5LCXA 3FRJA 3AW9A 1QMGA 4RVHA 1I3KA 1KVQA 1Y1PA 4NH4A 1KY5A 1O95A 5MGBA 5LDGA 4OKIA 2QIOA 3OIFA 3HDHA 1T24A 1UZNA 4HWKA 1FJHA 3H2SA 4XCVA 1WNTA 3A1NA 2I5PO 3FNEA 3D1LA 5IFLA 3LVFO 4FOOA 4AJ4A 4RL6A 4WLUA 1FDWA 2VQ3A 5THQA 1HDYA 2Y0DA 4MVJM 1IL0A 3PVZA 2O3UA 4NU6A 1PJCA 3D7LA 1XHLA 3IIEA 2H6EA 3HN7A 5CPBA 1DOHA 2DU8A 3CINA 3HG7A 1EQ2A 5TT0A 1ARZA 3WGIA 2OORA 4GX1A 4BKRA 3AI3A 3IAHA 1EE2A 4FGWA 1C0LA 4I1IA 8LDHA 3QVXA 5JAQA 1O6ZA 4GX0A 1GPJA 3FR7A 4Y67A 3NT4A 3QVWA 3ZWPA 3UXYA 5T6BA 3AUAA 4OYRA 1NX6A 1E77A 3GVXA 3BMOB 3WICA 5L4LA 4AG3A 4KQWA 3M1AA 2J5QA 1HYHA 1MXFA 1KY4A 3STHA 2OFPA 5H82A 2BMAA 3K6JA 1PS8A 1ZCJA 1PJ3A 4QXMA 2X9VA 4BO9A 2PZJA 3B70A 2Q2QA 1ADBA 4BNZA 3OBBA 3RQSA 4KUHA 4IJWA 4XGNA 1A9ZA 2DPGA 2ZQZA 4NBVA 4CM9A 1EMDA 3OM9A 4WCFC 4XGIA 5JCJD 2A4KA 1YONA 2GN4A 5C5IA 1VJTA 3H9UA 3I1JA 2C59A 2BRUA 2X86A 2QX7A 4ITUA 3QJ5A 1QYVA 1Y8RB 2EJWA 3I9NA 4JGBA 4ND2A 5T57A 1LQTA 3ZHBA 4A2CA 3JQGB 1ADGA 3DBLA 1HDXA 5TT1A 4L0QA 1DIAA 4GBJA 1B0AA 4E2YA 1UR5A 2RH8A 3QWBA 1QR6A 4KDFA 4X54A 3BMNA 1WZIA 1HSZA 2I76A 1RWBA 5ER9A 5L95A 3SJ7A 3QWAA 1PS0A 2C5AA 3A9WA 5AXDA 4B3HA 4I9UA 4ZN6A 1ULSA 3VOSA 3VH1A 4XYEA 4BNMA 3ZWYA 2YZ7A 2I99A 2DLDA 4A10A 4CM8A 3NAQA 5JXWA 1GTMA 4BMNA 2VT2A 1BHSA 4OO3A 1HXHA 3R3JA 1PQUA 5GZ3A 4CLRA 5U9CA 4EZBA 1EVZA 1H2HA 3Q6IA 1N9GB 3I6QA 1E7RA 4NPCA 2WDZA 1U4OA 4AJOA 2F1KA 1TXGA 4A73A 2C2YA 4BO6A 5JC8A 1B2LA 3ZWVA 5IZ4A 1BXGA 1ZIDA 1DHTA 1B3RA 3AM4A 2AEJA 2BI8A 1KVRA 1DHRA 4II2A 3WGZA 4ND3A 4PZEA 4UAGA 5KKAA 3G17A 1Y5MA 1MGOA 2Y93A 2GPTA 2NADA 2IZ1A 3F5QA 2FSSA 5A3JA 1KIFA 2DTEA 4XDYA 4Y6SA 1TT5B 1YBAA 2QYTA 4QQRA 5L3ZA 1U2DA 3OICA 4JJIA 4B7XA 2HMVA 2ZCUA 5BQFA 2DAPA 4DBVO 3ADOA 4CLHA 3F5SA 3IL2A 1GUFA 2J5RA 5LDHA 3PQFA 4XA8A 2NLOA 1UXGA 2QZZA 1IULA 1VKNA 1X14A 3JQCA 2WYVA 2ZCVA 2PZLA 3B1JA 4HFNA 5KNLA 1SPXA 1EFLA 3H9QA 1UZMA 2VWHA 2JAPA 3GF4A 5K9ZA 3CIFA 3Q11A 3IQDB 4ZU3A 4ID9A 2X4GA 2V6MA 3FHLA 4YAJA 4UEOA 3BTVA 4R69A 5FEUA 1YDWA 5L45A 3ULKA 2X23A 2FWMX 3I9JA 1N9GA 4E2XA 4CMIB 4FN4A 1OC4A 4PLWA 4E5KA 3ICCA 3I52A 5JDIC 1V3TA 1UP4A 2AMFA 1Y9EA 1ENYA 4JXKA 3C7DB 3P2OA 4F3YA 5B4UA 3KUXA 4I08A 3H5RA 3VH4A 4JJGA 1PWZA 1M6HA 3GC6A 1JWAB 1N1GA 3LT4A 4J7XA 5M6DA 3GH3A 5HWSA 5MDHA 3ZW9A 4DVJA 2VHVA 4R41A 1YVEI 1WMBA 1F8FA 1R15A 3C7CB 5JO9A 4TWRA 3WGOA 3UFXA 3DDNA 1IPEA 3TF5A 1SB9A 1EUDA 2J6IA 4KMSA 3JQGA 5KVVA 4HKTA 1VJ0A 3O8QB 1GD1O 1ZH8A 5FI3A 2GCGA 3UICA 2ZTVA 4R3WA 2BFPA 1GFSA 1LLDA 1LEHA 3DWFA 3C85A 4FFRA 4J7CA 4BGUA 5JSFA 3W4KA 4HADA 4E5MA 3RUDA 4NFSA 1WW8A 2IZZA 3AU9A 1JA9A 3WFJA 3WGQA 1F12A 1X1EA 2E4AA 1I3NA 4FW8A 4L76A 3O9ZA 2J3KA 5DDIP 4FDAA 2R00A 1G6KA 4G65A 3FWNA 4QT0A 1DIRA 1IUKA 1YXMA 3PFFA 4YJGB 3RUCA 5HS4A 2V7PA 1PTJA 1KEPA 3DQPA 4PLYA 1CF2O 1UZLA 4PG4A 2FPIA 1T25A 3FNHA 1X13A 3I9KA 3RJ5A 3ZNOA 3WGHA 3V2UA 2IXBA 1J0XO 1T2DA 3WQRA 3VPXA 4R3NA 5F1KA 1PU2A 3D5TA 4WOKA 5L51A 2D3TA 3DO5A 4PVDA 1BSVA 4J16A 2HDHA 1WMAA 4RPLA 2X9NA 4RPGA 4EUHA 4YWJA 4F45A 4CLOB 5BSHA 2UUOA 3GVPA 3U49A 1YJ8A 2O4CA 3HE3A 3Q2KA 1EUCA 1W4ZA 3T4XA 3O38A 5A4DA 2CNBA 2ZIZA 2CY0A 3K8ZA 1GL3A 3S1LA 2P9CA 3QVTA 3S2FA 5CP8A 4CMEA 3JQFC 1DRVA 1PJBA 1GUZA 3RKUA 5CAEA 4WJZA 2EXXA 2ZATA 4NQZA 1Z7EA 4Y98A 4DIBA 1PZGA 4A03A 4CUJA 1ISGA 5KCZA 5G4LA 4BNKA 1LQUA 4RV9A 2X58A 3W8FA 1CYDA 4XDZA 4CV0A 6LDHA 4PZDA 2OHXA 5FWNA 4CUKA 5DF1A 4CLXA 5T8KC 3GZ4A 4ZQBA 1YS4A 1GQQA 1H93A 1DEHA 3GHYA 2B4TO 2RH4A 3HSKA 1EFKA 1ENOA 4BUCA 4O63O 1XIVA 3GY0A 2X9GA 3PDJA 5L40A 5HA5A 1NR1A 4RVGA 4MVJD 2YYYA 1FDUA 1QXSA 1C1DB 2ZB4A 1DAOA 1DJNA 2EGHA 1Z75A 2GN8A 3ZI0A 3FPLA 1R0SA 4FFOA 3EC7A 4A0SA 4Q3CA 4FCCA 4TQGA 4D41A 3HFGA 3V5NA 1E7QA 5DBFA 5ADHA 3H2ZA 3NGXA 3RD5A 5CG1A 3L6OO 3INTA 1SB8A 4CMAA 4GPD1 4RGBA 3I3OA 1T2EA 3KLMX 2JD1A 5T67A 4CQMD 1B14A 1QSGA 4IGFA 1H9BA 3HQ4O 4GAEA 1L7EA 1LC3A 1LSOA 4EBFA 1XQ1A 4JCOA 3L4SO 3PI7A 4BQPA 4OMUA 4NDNE 3UW3A 4E33A 1H9AA 1AXGA 4CLOA 4RF3A 3ZV4A 4M86A 3IS3A 4YJFA 5G0TA 3L6DA 1GDHA 3WWYA 1YE3A 4NJOA 4P8RA 1D7OA 1O9BA 4WCFA 3L6EA 3LC7O 1YKFA 3EMKA 5IG2A 2VWPA 2Y99A 2EKPA 3LK7A 1E3IA 4F6LA 4D3DA 4J7UA 5DULA 1HL3A 2XOXA 4N7RA 2Y66A 5DT9A 1OAAA 3W4JA 4MKZA 4P4LA 4N5MA 4RQUA 3V1TC 1BG6A 4TZTA 4PRLA 5I8WA 1BMDA 3FPCA 3GMDA 1ZJZA 1YQDA 2QYSA 4MP8A 4YAIA 1C3VA 3QP9A 1XA0A 3JYOA 1VSVA 1G0OA 2HRZA 3SLKA 4CUZA 5L7TA 3U4HA 3E03A 3JQ6A 4E13A 3R6DA 3I6IA 3N7UA 1KOLA 2OP0A 1YGYA
chains in the Genus database with same CATH superfamily
1HDCA 1HSOA 4EG6A 4B82A 1SZJG 1P5ZB 5GJWC 4J16C 1FP4B 4XIJA 2B83A 4FJ1A 5SYNA 1Q11A 2AF4C 1H4QA 2P9JA 3FHTA 4J29A 5K2MA 3RYTC 5ELLA 1U1FA 1YL6A 1A72A 1K86A 1GL7A 1K5PA 1UZUA 3R0IA 1K7SN 5AOCA 2JS7A 2ZE7A 2C8VA 3CFYA 4QHTA 4EY4A 4C0JA 5GINE 5IDYA 3R75A 1RXSA 3EQ9A 4BGDA 1ML3A 1KH3A 4OQXA 2G17A 5LZ2A 3Q72A 2PA3A 4N0MA 3HA7A 3IKTA 3ET4A 2FXVA 1AH2A 4BIMA 5EHNA 3WGUA 4DLKA 2IPAB 1K92A 4HYYA 4LN1A 4WY5A 1Z74A 4ENSA 4BZWA 3AF0A 1ZGJA 2O7RA 1J0EA 4IX1A 3L4KA 1IXKA 1JJIA 4ND4A 1G42A 1S96A 3ANNA 2I6UA 4XGQA 5CYOA 1JIVA 2WTUA 1KPGA 5C80A 3IE0A 3LOPA 1R0WA 1HE3A 4C4YA 1T0PA 4E3ZA 3H6HA 5E9AA 3D8UA 4PCAA 2M98A 4F7DA 5JCJA 2VYND 2G82A 2Z2IA 1ENPA 3A04A 3AEYA 4BTVA 1MRZA 2JHGA 4J94A 4J0CA 4OH1A 4CR7A 1DRWA 1P8JA 3U4IA 3AIMA 2KPOA 3PNSA 4J07A 2FXIA 5KNBA 3IBFA 2G5PA 4P3YA 5E3IA 4QHSA 4ZQFA 3UT5A 3ZZTA 1P2SA 1RFLA 1U8TA 1VMKA 3E53A 5CLJA 2PLFA 4X6XA 1P1FA 4MQFB 1KI2A 4E5YA 1N2CA 3FSEA 1C2YA 1XL1A 3PGA1 3HKCA 4OI2A 2V7GA 4BNNA 2ZE6A 3Q1KA 3DBVO 1ICIA 4NNJA 1RPZA 2QN6A 1Z0DA 2AOWA 3IP7A 2ZRCA 3A6PC 4OB8A 3DFUA 2O2YA 3TB4A 4I8IA 1CJMA 5THKA 2HHAA 1M2VB 3JATB 3KKPA 3NETA 4M1MA 2NUTA 1BCSA 4GRIA 1GT6A 3JYQA 4MULA 4RK1A 1LK0A 3VO9A 1HMPA 3BQ9A 4G1UC 2P68A 3I62A 3IT0A 1N2IA 3AUSA 3C6KA 3RKRA 3RAFC 3WDMA 3LYUA 1M34A 1X38A 3UN1A 1H5QA 3U4MA 5DVZA 2R6ZA 2QUJA 1OE0A 3TD6A 3UGKA 4Q4JA 4YI5A 1SVMA 2HCRA 3R3HA 5JC1A 1XLTC 3TB6A 2NSLA 3U09A 3RWOA 2ZUWA 3TGWA 4BFUA 1GNPA 1KKUA 2BFFB 3DXFA 1JEQB 3O3CA 3DG9A 4QGSA 5FOXA 4DB4A 4B71A 1ZK3A 3TWOA 2HT6A 3LF1A 3DFFA 1XTJA 3DZHA 5IAEA 4I5GA 5IP5A 1WXQA 3KPVA 4ND5A 3I53A 5FBRB 2IRWA 3AESA 2C0QA 4LC1A 4URHA 5KTMA 4OP2A 5BWNA 1AUVA 1ZJ6A 2ANCA 2C07A 3KB1A 4KTVE 3UPDA 1EGQA 4ZARA 3WL3A 1MHTA 1P2TA 5A06A 3E1KA 1OVMA 3WBKA 5IM5A 3U7FB 1TVEA 2H7YA 2ZIFA 2PSHA 4MAAA 2C61A 4EL0A 1P0IA 2WJPA 1VBFA 3SJCA 2PL3A 1Z33A 3SEFA 4ZO4A 2ILTA 3N2KB 1USKA 2YW9A 4KQEA 1CERA 1XAGA 2PWZA 1ETUA 3FYUA 4LDRA 3Q7SA 1MC4A 3UTCA 2Q27A 2DFVA 1MOPA 3E58A 3GG2A 5IARA 3WK4A 4BNTA 1RJWA 4V0ME 1XQVA 3CURA 4D4KA 4IV5A 2JL1A 1R8QA 2BH9A 3NTOA 1W0JA 2VUSA 3LPDA 4FOLA 1NDQA 4XPIA 4OI0A 4GKJB 4CPDA 3I32A 4U7JA 3B5JA 1MORA 1V26A 2WIKA 4E1AA 2QQ0A 1AS3A 1S3IA 2XRYA 3FHOA 1J07A 2IIQA 2P2YA 1OLXA 2FWRA 1CVIA 1PGOA 2PV7A 3MT8A 1IPHA 1HKHA 2PT9A 2Z30A 3G13A 2Z6AA 1CRLA 3WLIA 1I8TA 1VLLA 3Q41A 1UM9A 4OGGA 4CIAA 5AQEA 1N6RA 1XTTA 3P26A 4YT5A 1I5EA 3RVOA 2GPWA 2DQKA 2F00A 3E4DA 3PC7A 3QQ5A 1SAYA 1QZZA 3F5MA 2UZ1A 4OM7A 2ZPUA 4OHCA 4OX9B 2X3YA 3G5MA 2QE6A 3N3AC 2XVYA 1OVGA 4HZGA 1R9GA 4KJXA 4RZSA 3RVBA 2Z4SA 3KTAA 5JAOA 5JSZA 3NT5A 1C8BA 1T6ZA 1LBIA 2GCIA 3L4BC 5EEGA 5BMOA 3ENNA 3ABQB 2AZXA 1X19A 3G0IA 1V9LA 2O0HA 2BMVA 1REQA 3BGDA 4PQFA 4PWYA 3VXKA 1FBNA 4RNCA 1ESDA 2UYHA 1I79B 3WYCA 3O2SB 3PFHA 2A84A 3AIIA 4GXQA 3VZRA 1B00A 5BVHA 5LMNB 1DAHA 1GLNA 3UK7A 3V1KA 1Y5RA 1RU3A 3LH5A 1W36D 4OYLA 1KP9A 4N3BA 3CISA 3PUYA 3W2HA 1T6XA 1VRWA 2OSVA 3O8OB 1FTWA 3MTIA 5CUQA 4LRUA 5ADVA 4LOLA 1X9GA 1H2AS 3N2NA 3O8BA 2OGUA 4RSMA 3BH6A 5CCBA 4X62B 1FP4A 1EFPA 3ZHQA 4C3OB 2BM8A 3A1VA 3NDPA 1VLMA 4RV4A 3URKA 5JJCA 1MTOA 3I8SA 2XMSA 3GIWA 3HUTA 4QOGA 2CMDA 2Q6TA 4IIDA 3R44A 1BFKA 3P32A 1S8FA 2WAYA 2F8LA 1JF8A 5DNEA 2ZAMA 2FZVA 4DSZA 1I3MA 4AJLA 2LKDA 2P4EA 4IINA 4OMFG 4Y9SA 4RMGA 2NVUA 3KRTA 1RQNA 3GJ4A 1FP7A 3Q3IA 3TOXA 3PUJA 3Q2OA 4B44A 2CSUA 1PEDA 1ID8A 2AOTB 4RSHA 4YRAA 2WOJA 4RA6B 2DFNA 4UD2A 4V2UA 3SAJA 5IVIA 4CF5A 3DYIA 2PR7A 3GLFB 2AFIA 1JBEA 2IU4A 4NCNA 4WDRA 3V4VB 2YWFA 2GZ1A 4X7PA 3AY7A 4B09A 5BUSA 3F6BX 4QG7A 2W00A 1O57A 2GN6A 3MCWA 3HHPA 4YO7A 5B12A 2DR0A 1JTFA 3W9UA 2XB2A 4LX0A 3IBCA 4JSRA 1M6YA 3RFFA 3UOGA 1Z7YA 2WJIA 3DDUA 1KR5A 3UB2A 3IVGA 2YTZA 1CJVC 2R8OA 3WSTA 3WMGA 3RV4A 4O25A 2BMWA 2E85A 5K0CA 4UVDA 1P9NA 1EUDB 4P34A 5LC1A 4UBLA 2SECE 1QHHA 3RRBA 2XZPA 1JPNA 3QKSA 5BOVA 1BHO1 1QYDA 5CA0B 1GYPA 2FA9A 4IIFA 4Y1RB 1L5SA 3KCNA 4PLHA 4TL6A 5F35A 4JJZA 1MP0A 3PRKE 1ZMRA 1ECBA 2XITA 2Q1SA 2P35A 3ASZA 3M33A 3FPJA 4U2DA 2VOJA 1KC3A 4RH1A 3N5KA 3HNOA 4K5QA 3SYLA 4QUBA 2RGRA 2XQFA 2G9RA 3UJBA 3BGIA 3QKWA 2NM0A 3GROA 1NN1A 2OCGA 2AXEA 2GF9A 4R0VA 1W6UA 3GYBA 3ADPA 4LFCB 1S4QA 4HVCA 3WFIA 1WEKA 3OA2A 3JQ7B 4GBMA 4RIFA 3CV3A 1M1UA 2DLNA 3ML1A 1O03A 4F3NA 5IT0A 1I80A 2VRCD 4DSTA 1MO5A 3LYHA 4Y9DA 4XLTA 5FNZA 3TDMA 4H7IA 5I9SA 1UBKS 2VHZA 4NLLA 1M10A 5AK3A 1RP7A 3O1IC 3WMFA 4WLOA 2BFOA 1FNMA 3HB5X 4IIBA 2AE1A 5I47A 4CW7A 3OQIA 5BR7A 4U1RA 3V8PA 2FRXA 1E9FA 3AKZA 1SCUB 2C2GA 4C76A 5FUVA 4TT3A 3B1VA 4DSNA 1JEEA 3O3MB 3RROA 3USCS 4US0R 4MPJA 3FPSA 1KRXA 4F92B 4CMJA 4FHZA 2QSJA 1LNZA 4NZOA 3CWZA 5FOSA 4UHCA 3H83A 2BL4A 3C3XA 4CIWA 1KBZA 3CLUD 4DT1B 4QDUA 1X1TA 2OBFA 2JGRA 3A1FA 5KAMA 5EIOA 5EXDA 1YMQA 1WQ1R 5LP6B 4NEGA 2HXGA 1R5OA 2DJIA 4CL3A 1G59A 5IAKA 4L28A 4Z2AA 3ELYA 3IPAA 4M0LA 1NRJB 2AEMA 4IXMA 3CT4A 3TSWA 2I29A 1SIBE 1Y7PA 1SURA 3VR4D 4OMDA 4QHYA 5AVUA 2FZEA 1H42A 2D1FA 5IYZB 3CTPA 1SHLA 3FWYA 2VSXA 3K35A 4I0WB 4OQMA 3GNLA 1T9CA 4GKBA 3SSNA 2Y9MB 1KZYC 2RHWA 3GAZA 1W87A 1ZOOA 3FNFA 4IDFA 4IJQA 5JMWA 4BXOA 1DEAA 3JR3A 3K30A 3ZBTA 4HX5A 4TM8A 3ICVA 1EWYA 4AY5A 4DYVA 3BC1A 1LVUA 3SEQA 1LVGA 5JWOA 1IH8A 3KM0A 4TV9F 1UDWA 1D2HA 3UFBA 3E8SA 1C9JA 2OD7A 1H2YA 5JRDS 1G21A 2FEKA 4EI7A 3K0AA 4KHPB 5AD1A 4OQFA 1VPLA 3DZKA 3NC4A 2ZR7A 2HTEA 1M8JA 2JLXA 3I9V6 5E4TA 3LHFA 4XDHA 5EQJB 3TLXA 1T8RA 3TFOA 1HO3A 2AOUB 2IGTA 1XYVA 2GXQA 3RW9A 3ZXXA 4BYGA 3B2EA 4R2KA 4W5JA 4YCAA 3T3HA 5LU8A 2ZROA 2GI4A 2NP7A 2QNBA 3FGPA 4DEVA 1UBJS 5FUMA 1D4ZA 3PKZA 2DY0A 2VRCA 1DKPA 3HU1A 1HFWA 1NMQA 2V1XA 3ZVKA 3NHAA 3B53X 2IWHA 3N6VA 2WSYB 2Z8YM 3AY6A 4CCSA 3JAWB 1J25A 2MINB 1VJCA 3ZK7A 4RHFA 3HL0A 4GE0A 5ENDA 4PG7A 5TGZA 2ACVA 3PGKA 4BEBA 3OBIA 4L73A 5IWAB 1YR2A 5LL6P 1SHZA 1I1OA 4RTRA 3SJBA 3HBLA 3FTFA 4K03A 1S2DA 2HV8A 4OBBA 2H52A 2O8FB 2Y6UA 1TAQA 2RJNA 2UYOA 4RPCA 4R0MA 1M6VB 2AJLI 3KL4A 3OJEA 4P93A 1XPJA 4FR5A 5JDCA 3KNZA 4YR9A 3UGQA 4DSUA 5A4IS 1GNQA 3GX1A 3W77A 2LDXA 4AG5A 4D9JA 2VDPB 4ZPXA 3OLQA 3K8OE 4KLNA 4FGUA 4Y6RA 2XKAA 5G1NA 1SOVA 1C81A 4S2EA 1I30A 4Z3OA 4L4XA 2KB0A 1LZLA 4O4JA 5LZ4A 1KEVA 1T5LA 2HD4A 2WFLA 5K6TA 3CNEA 3GT0A 3U7QA 3IURA 2DCUA 5UKDA 1NR7A 1FSFA 3DOUA 3QXSA 5B1SA 2HBZA 4YMSA 3A6EA 4DA6A 5DWDA 3R9XB 3HXPA 4FDVA 4RVSA 2GBCA 5JCXA 2BTQB 3DKRA 4CMKA 2W22A 4WI1A 1OH8A 3KOOA 3QI2A 4MW5A 2AMJA 5A02A 3EY9A 1F48A 3CUSA 4Z4HA 1EAMA 1H5NA 3L02A 2GUGA 4PLZA 4JB0A 1YKGA 5L6LB 1O95D 4C07A 1LDYA 1QYCA 1CUBA 5E95A 2Q5OA 1NBWB 4P3XA 2B1IA 2H1HA 2ZSFA 1G8JA 1Q0ZA 2FWNA 4G1CA 5CB0A 5MN4A 3I73A 4OHYA 4ZV9A 1MDFA 3CEPB 4RKWA 4G09A 4V0NA 3DL4A 2ZBRA 4WVLA 5I7EA 4TKVB 3CRQA 4PIMA 4KIFA 2I6QA 2OBYA 2WJVA 3WLFA 1DZ3A 4G5SA 4M9SA 1RWMA 2YHIA 5J4KA 1K6IA 4AZVA 1UPUA 2GYVA 2W2VA 3A27A 4HOYA 1PG5A 1QVWA 1DQZA 2FEOA 4YJ2F 3ZWWA 3WGTA 4EB6B 3EXIB 1TECE 2RC5A 3M3PA 3ROFA 2RKBA 3WGMA 5LZ9A 5ARBA 1NMSA 3AUUA 1IMJA 1C30B 2IOFK 3WTCA 4GGPA 3X1XA 3PK0A 3FI9A 2GXUA 2VO1A 3MM4A 2PL5A 4KWCA 3DE0X 4AJNA 3SFVA 3RRJA 4MVWA 1SQ6A 2H1OA 2EF1A 1JRLA 5J2TF 5I7HA 1GCOA 5JD3A 2O57A 2VDNB 1S2MA 4N48A 2XI4A 1QZ3A 4W5RA 4ZCQA 2HRRA 3IV9A 4X71A 2NT4A 3T4PA 3RC8A 4E6PA 3V4FA 3NAMA 1Q19A 4GBED 4ZO6A 1N7GA 5THXA 4ZQIA 4PBTA 1C7RA 5TQ2A 1KEWA 1CRWG 4Z4CA 1CP2A 4RD2A 1R0LA 1U0TA 4UZSA 1MAHA 3L1JA 2Z5VA 5CD1A 4RE6A 4M1TA 4YV1A 1D03A 2VDJA 4YJ3B 1GO2A 1U8EA 3TV1A 1YFKA 5ERXA 5E8RA 5C46F 1C0IA 1H2BA 4G9GA 4KMMA 3GFBA 5HCNA 3G6WA 4KO3S 2F4NA 5GM1A 1DFIA 4EW1A 1FNDA 4TTJA 2F1OA 2F3TA 3VKWA 2DKFA 3TIGA 4M7RA 2AR7A 2VF4X 4XTRA 1L5KA 2I3BA 2X7JA 4O2BB 1E5LA 4AKTA 3MPUA 4RUKA 3EXFA 3V00A 1OWNA 1M6EX 3EY4A 3KVRA 2PBFA 4FQ7A 5IS2A 4N6GA 3GGOA 4HT3B 5F3WB 4WXMA 1F7VA 3LKZA 2D3WA 1UIMA 2AFVA 1EEXB 1QONA 2P3SA 3TZLA 1CIPA 4IH9A 3AR7A 3OU7A 4PC1A 5TXGA 4LGCA 5IK2D 3F5DA 1V8DA 5E4JA 2ZGVA 3ZJUA 1QCYA 3QYFA 3S70A 1JEJA 2FSHA 3PDCA 3K0AB 3WXMA 1F38A 1YK1A 3IDFA 4BQRA 5DHRA 4DQVA 1YRLA 3GN1A 3IA2A 3F47A 2VZ0A 3K53A 2C20A 1Q1AA 2HIHA 3BIXA 2MSCB 3GQBA 1RYEA 1TIKA 4OB7A 5GM2A 1M9NA 1B2RA 2BI4A 1YDEA 1PLJA 2JHCA 2ZTLA 3A4VA 1KI9A 5EY5B 1CC1S 1ZU4A 2AL7A 5JSQA 3Q3GE 4RIHA 1CUEA 1AGPA 4FFPA 3OZUA 4YCJA 3DZDA 5A3SA 4ZVNA 2CHQA 1AKQA 1NJGA 3K0FA 3P0RA 4PM4A 2O48X 1KNQA 1P80A 3EHDA 5CURA 1B73A 4CG3A 4EHFA 2GNOA 4FQ5A 5FL3A 2A3NA 4KKXB 4RA9B 3NDRA 3UYLA 1ZPDA 3DMFA 3WLJA 3CNNA 1PZEA 1K6JA 2F59A 2LV8A 4KN8A 2GBLA 2QQGA 3VC3A 1P6XA 3Q98A 4QUEA 1I14A 2VS1A 2HBRA 4G67A 4OFZA 4ZI2A 4QBHA 5CIWA 1V39A 1P5JA 1JHOA 3UV7A 3MSXA 1Y33E 3L0CA 1WCV1 3KOYA 4AUMA 3D4LA 1T36A 3DKVA 5H7XA 4JLDA 4AICA 2ATIA 2EZUA 1U8YA 1EHYA 3C5VA 1LY1A 3HFSA 3W5AA 3HN2A 4G0NA 2K2WA 1Q0SA 2A35A 5KWJA 4MR7A 5AKYA 4Z3KA 2GYWA 4LI3X 5FOUA 3V7YA 5AESA 2R9VA 4BHTA 3W05A 3IP5A 1FFXB 3QXJA 1K89A 2ZI7A 3G7SA 3TTWA 1SBTA 4UNSA 2PT6A 3AY0A 1Y98A 3GYGA 2V7QD 4ZCTA 3L7CA 3T9EA 5JNVA 4QVIA 4EIWA 1VGRA 4DS3A 3IJPA 5JBNA 4GMGA 1D09A 4XR9A 3A6HA 4Q21A 4JQOA 1IUOA 3M4YA 5JVDB 1AKVA 1IK6A 1A5BB 2OV2A 3HA3A 4XIGS 4JYMA 4B4OA 5JPCA 1AGRA 1TUBA 2I6GA 3KHKA 4JLJA 1WHSB 4AXXA 4U0JA 3H9EO 3DLTA 1V1MB 5TX7A 3ZD6A 1C3EA 1T8YA 3EPKA 4ZYLA 1T5BA 1DAIA 5CT6A 1ODJA 3LIPA 2VPYA 1GA1A 3P9YA 2C3MA 3U3RA 3IPLA 2FZLA 4FU0A 3B85A 2HSWA 1OBVA 4Q4DA 4Y1RA 1KDTA 1G1MA 3NUZA 5H68A 3HEBA 2EEZA 3UBMA 4F11A 4GL4A 1THGA 3LZCA 3D7SA 2VNSA 2EJCA 1Q2XA 5FQOA 5HBRA 1PFQA 3AX6A 3WLEA 4R1QA 1IG3A 3ELWA 2ZWPA 4EGFA 1OX4A 3V2IA 3MGKA 4TV8A 1H5UA 2P5YA 4RPKA 2XCLA 3LUPA 4Q3BA 1I7QB 5IFKA 1A4IA 4N0EA 2YMQA 1I7MB 5CNIA 2FR8C 2CXPA 1OBCA 1T4CB 3SZGA 2DUNA 4XLLA 1AKMA 2CUKA 2E4WA 4MUIA 2HRQA 4DC0A 4ED9A 3JQ8A 1MJHA 5DJ5A 2HXSA 4YRNA 2GM5A 4O08A 3QWFA 4B3BA 2P2ZA 2QLMA 3QXHA 1GU1A 2WYUA 1GDTA 5CXXA 2QGFA 4F5YA 1NLYA 2BGKA 2W6JD 1PZMA 1KORA 4ALMA 5JD6A 1L5OA 2OOSA 3BTSA 3ILYA 4B3IA 4B7UA 3FHCB 4BE4A 3D5EA 4ARVA 3WQQA 3ETHA 5JMPA 1TIPA 2Y1LA 3EXHA 2NVWA 1EM8B 1UK7A 5H3HA 3DBOB 1EH5A 5JH7B 4ODIA 3AUTA 5KPJA 3PR3A 4O2RA 4UC0A 1E1NA 3G5UA 2V7EA 2VF8A 3MD9A 3KSUA 3EGOA 4YGYA 5JZBA 4K6CA 2HZBA 3ZDFA 3QPBA 5CDFE 1M6VA 4RY0A 1XQ9A 4I9NA 5GV8A 2AFRA 2P7IA 5WRFA 4D0GA 4ENPA 5BWOA 2YWEA 3DF7A 1PFKA 1G21B 4RZUA 1Z4LA 3ANMA 5HGJA 2XXBA 1W85B 1TYCA 4D2IA 2YZ2A 1JKMA 1GU7A 3IXMA 5FFFA 1J56A 3F3YA 4FDLA 3RKSA 4ANFA 1EVEA 4D8WA 3QLEA 2HV9A 2HA2A 4DL9A 1T0IA 2MYTA 2P91A 5DK6A 2I4MA 1CNMA 2FOXA 4S0XA 2QR2A 4ZP1A 4W5QA 1QWSA 5D6OA 2EVWX 1WUYA 4C4SA 5BR1A 1W4AA 1G8KA 1TA4A 4FYMA 4ARZA 1NUUA 1WU8A 3LT0A 5C3UA 1AUPA 3ZY4A 1XTRA 5LWHA 3CLUC 3QOWA 2QDXA 3H2GA 5EE5B 3V8BA 3PICA 2PCJA 3GD7A 4KDEA 4LWOA 2H3EA 4ARCA 1I6MA 2CUZA 3I12A 5DNAA 4D42A 5BRNA 4EFKA 3KZNA 3E5HA 1JKIA 1UBCA 4YHBA 1ZEMA 2OZPA 1CQIB 3ETLA 4DA9A 1KI7A 2JCVA 3IKVA 3ZCXA 5KJ6A 1AV7A 1NG1A 3V8MA 2J09A 2CB0A 5LOVB 4L4RA 5FBKA 2B78A 2O2DA 3P2YA 5CB4A 3TG8A 1M1NB 2MMCA 4HDNB 4JLVA 4PLTA 3H19A 4B6FA 3C3CA 2FUKA 3D6FA 3HU5A 1X94A 4IEFB 5EIFA 3ZU6A 4DXAA 1UJBA 1DEKA 3PXEA 3MZ0A 1VKJA 3OJFA 3SC2B 3NBMA 3Q3EA 4JROA 5BWCA 2YQ4A 4WBNA 4KGVA 1H1LB 4F3KA 3LYLA 2D59A 4CKCB 4OKSA 1V3QE 2DWUA 3DDWA 2GF2A 5G3ZA 2RHOA 3LHIA 3WSWA 4TYWA 2FFQA 5IJZA 4LYDA 4FYVA 1WXHA 3S68A 3P2IA 4B0PA 4WZBE 3M6FA 3GRYA 2Q4TA 1U94A 3SSMA 2CWDA 1FFEA 3HO8A 2JZOA 4AX8A 1TKRA 2QRVA 3AR6A 3A2KA 3A58B 4B85A 1CUUA 2QLLA 3R5XA 2ISQA 1JHPA 1GUDA 3D0OA 4CQMB 1H6DA 1CYEA 1R8JA 3HDGA 3CW2A 2GSWA 1SBYA 1PBNA 4UUNA 2C3OA 4HZUA 4L8GA 3V4LA 2YWGA 5BQXA 3ASVA 2I9KA 4TS3A 4ZK2A 2AT1A 5BUQA 3FOZA 4C03A 2O5RA 4LOIA 1E6WA 1CEQA 2HWKA 1QF7A 4BKUA 3HWSA 5SY9A 1O77A 3JWHA 4HXYA 4WIAA 5BSGA 2CLEB 2LKCA 3EA5A 3PX7A 5K0EA 3K5IA 1DXHA 1NVFA 4QUJA 4NFLA 4D98A 4F4HA 2RI0A 5A6VA 4Q9DA 4QM7A 3VNAA 2BOVA 5GZ6A 4X92A 1KI6A 1QC5A 3QVKA 2YQ5A 3O95A 3ZU5A 4WOJA 1JR3A 1FS5A 3A05A 3EP5B 3QFCA 2BFEB 5TS3A 4INPA 2VHCA 3RT1A 2AUTA 2I62A 2P65A 1RBZA 2BMFA 3L1UA 3C6XA 3ROQA 3W90A 1XRRA 3OPYA 4ARZB 1HNZB 4C21A 1UC5B 3MYYA 4RK5A 1P74A 4DXHA 1XZMA 2A58A 3U61B 2N46A 1MGPA 3PBKA 2IP1A 4XWWA 1BN6A 1E3TA 5FWXB 2Y1FA 1TU0A 5IC5A 4J0FA 2H2FA 2PL9A 1NOJA 3QNWA 4Y2QA 3FWZA 5AVVA 1XQXA 4HZIA 4ACAA 2AB0A 4RZXA 2NUBA 3IMEA 4PCVA 1RE1A 3EZGA 4C5AA 3L93A 3KVYA 1J8VA 1J9ZA 2X0IA 1XROA 1FYVA 4UW9A 4WSOA 3V1LA 4G6ZA 3D4BA 3OZIA 1FRVA 2OCAA 4FHDA 4ZCSA 1F2VA 1Y7HA 5BWMA 2ZVPX 1X1DA 3OOJA 2VT6A 3C3DA 4QODA 5DHSA 4EG3A 3ASUA 4YYZA 5BSVA 4QXOA 2C97A 3DONA 3KK0A 1MO2A 1DAKA 2QU7A 1YFZA 5GVSA 1X8LA 1KQ3A 2Z2ZA 1RM0A 2WWRA 2YZKA 3WKAA 1RLTA 1JFRA 2XB4A 4IHJB 4OQ4A 1GZHB 1GGEA 2QRKA 5F9FA 4YRKA 2BKAA 1OLSB 1T2VA 2DFKB 1C0PA 3QA9A 4BRWA 1OILA 4EHIA 3HCDA 3TOSA 5P8WA 3H1FA 2R1TA 4N8EA 5CW1A 3CQ9A 2IE8A 2MINA 3P9XA 2VXCA 5DIFA 3I37X 3TW8A 4B6EA 1REQB 4U9IS 3CKLA 1OC2A 1HK7A 1KVUA 2A94A 3F90A 3PUHA 4BNFA 3GFPA 3H2HA 1Z28A 3H2IA 4KGDA 1DXYA 1FDIA 3OM8A 4J2TA 3FPKA 2EZ8A 2VK2A 2Z43A 3FYTA 3F4KA 1TA9A 1MTZA 3LS2A 1KAOA 2LPMA 4HJRA 3L0IB 3LXRA 3AQIA 1VKOA 1Z8DA 1PR5A 1R64A 5ARDA 1D2CA 4WINA 4X9XA 4PYOA 4NC9A 5CBKA 2YN4A 3LQFA 1GAEO 1IONA 2XVAA 3EW7A 3QX9A 1T2UA 4QBFA 4O4JF 1F14A 2EIXA 4NNOA 4WDQA 5IANA 1PR9A 1J06A 2ZSIA 4H1TA 4I3HA 2X22A 5CCEA 4KX3A 5GAJA 2FW0A 1XD2A 4R1TA 4XDGA 2PKQP 4KYTA 5AJZA 3E8XA 4G9BA 2VQEB 3NQ41 4HWSA 1RWOA 2P27A 4UMDA 2PK3A 3LBIA 4KR3A 5ES4B 3CR3C 2GK6A 2Q5HA 2HK9A 2I2WA 4MHTA 3QRWA 2XXAB 4D9CA 1RKVA 1MW9X 2V8BA 1D3AA 5GV7A 4F5DA 2BR3A 1NVKA 4MOWA 3PQCA 1AVTA 1F9EA 5AVTA 1FYEA 1MMFB 5IH7A 5CXSA 1QH1B 4NEQA 4YJDA 1Z13A 6ADHA 5JYDA 1TMYA 3LQYA 3U17A 4L4UA 1L8OA 1V7QA 3LBHA 1UPFA 2PG3A 1KTIA 2DY1A 3T5AA 1VFNA 1KA9H 1P1RA 2A5JA 1O9GA 3FFTA 4KGXA 2ONYA 4R1LA 4RK7A 4UASA 2ZJBA 1YK0A 4AQYB 2ZB3A 1QUEA 2YWDA 4YMGA 3G2KA 2CF6A 3V8RA 3LK6A 2ON6A 2K4MA 1YTUA 1DL5A 2QF7A 4WRRA 3LUAA 4YFYA 4BUJA 4TXHA 5J4YA 3UQZA 3HMQA 4FONA 4D1YA 4OIFA 3T7SA 1RWWA 2JBAB 2O2IA 4CNQA 1Q7BA 1VM6A 2VPXA 3JD2A 4RQBA 2AXPA 3MHTA 4K6HA 4HFRA 2PSFA 1SD1A 4LVCA 5D00A 5A9SA 1AV6A 2QM8A 4LZZA 4PSDA 5IF9A 2OZLA 3FJ1A 3QVOA 1NP7A 2H1WA 4I9FA 4XSGA 2MSWA 1Y82A 4IIGA 4MO9A 4CMGA 1QQ5A 2IVZA 3OZTA 3V8EA 3IYLW 4MUFA 4FS3A 4EABA 3OT4A 4FZ5A 5KYUB 2YVLA 4HPJB 1A8IA 2GBGA 3L49A 5I9TA 3RSLA 2VP2A 3OX4A 4JGIA 4C3ZA 4GECA 5E2BA 1LA2A 5C1DA 3QU5A 2J31A 2XCQA 3U56A 1GYRA 4XX0A 3P4XA 5LYJF 1IQRA 2CHUA 2BFCA 1RI4A 1CUVA 2VJKA 1M2VA 3IHWA 2Q2VA 4JB3A 4MQBA 1LNQA 4TLDA 5ABPA 4YCCA 2ZI9A 4BFTA 3LUCA 3ZDDA 4RABA 1LDBA 1Q50A 4MVJP 2F67A 3B48A 1SVOA 4DPMA 3LWDA 4L78A 1YVPA 1G19A 3HACA 3GLQA 1R10A 1NBEA 3VVMA 2D1TA 2D5CA 4YRQA 1RRCA 3R5FA 3KAJA 5JDCC 4YPVA 1A9PA 2XMPA 3IA7A 1L4EA 4DV5B 2Z8ZA 3H86A 5I7WA 3V1UA 5G4KB 1L8AA 2FV8A 2Q4RA 3HPRA 1CJSA 3DKKA 1KBQA 3MRVA 5AVZA 3FUUA 3DTVB 1N6IA 3R1IA 2DBVO 1NM5A 1SHKA 1QHSA 3RS8A 1L7OA 4BUZA 3BXEA 1OLOA 1S4MA 4XFJA 3WKCA 3NWOA 3ECCA 3MS2A 2GTPA 4NF2A 1WXIA 5ESXA 2Q7OE 2RHGB 3YASA 2Q1TA 3TRHA 1VYHA 1DPGA 1NI5A 1YZNA 3I05A 3IUEA 4M8KA 3GGCA 4UAVA 2I8LA 4DLUA 4JP2A 4ZEOA 4HN9A 4F5WA 1D6JA 3ZHTA 4DEYA 1GEEA 4N7MA 5ALSA 3K0SA 1UJ2A 2V96A 2FN4A 3OFVA 1N0HA 4MJ3A 1SJ9A 4LV8B 1DRJA 1HE1C 1GKIA 2E4ZA 4FFDA 1XYYA 2PZMA 3HXMA 2AGVA 4KSBA 4G8DA 2Q4EA 2HQOA 4RXTA 5K4GA 1XEWY 4INOA 2BHSA 4HUJA 4GIBA 4NZ9A 4Q16A 3E9QA 3OE7A 4M8IA 4M22A 4JCCA 2HU2A 721PA 4RW0A 3CN9A 4Q6WA 1T8UA 3X1ZA 1NOIA 3BMXA 4E11A 3H97A 4P0TA 3LOUA 3VBCA 1OH6A 4Z53A 3A26A 1MZPA 1ZEJA 3WYFA 1VMDA 2CXXA 5B36A 1KQOA 3PF9A 1W2HA 2Q45A 1J33A 4R16A 2ZSUA 4PX5A 5IJ0A 2O8BB 4CQJA 1W4RA 1DTWB 1UXIA 1CR4A 5COAA 5COQA 3BQMB 3WY9A 1QJCA 3NONA 2IY8A 4MV1A 2X5JO 5JNWA 2EHDA 1XU9A 3LQ1A 2W2LD 3IOMA 3BXPA 3KB2A 3JASA 3ZDRA 3L01A 5AQ1A 3JQ8B 3SE7A 4HVAA 2PUDA 1FNNA 1N2SA 3ABSB 5DWVA 1SUWA 4M38A 3ZC3A 3L43A 3JVIA 4HB3A 4H27A 4M60A 3GLIA 2CE2X 5K6AA 1DXOA 4GZLA 2G1UA 1XCMA 4RHXA 5DGXA 4C4AA 2GBLC 3PNKA 2AS0A 3ODGA 4EQZA 4WGGA 4K28A 5B6PA 1VB5A 1E64A 2HU8A 3OFSA 4U3JB 4BMXA 2DZDA 4UEJA 4LJYA 2IZ0A 1U7OA 2V7TA 4BMCA 4NHOA 2QUHA 1SXHA 5F3RA 3DLBA 3GJ5A 3L18A 1QMIA 4FC7A 3DZBA 1TYDE 5B1IA 4MGIR 1VIDA 3OFKA 1WQ3A 2Q1UA 3NRCA 4EA7A 3LLMA 4KEAA 3EF3A 5MF6A 4LBWA 1S8OA 1YZHA 1ZI9A 5CVJA 5ALRA 2F55A 4YIHA 2YRFA 3SS9X 1PDVA 1V1MA 2PAAA 3CC8A 1GAJA 3R6LA 1F4VA 2HOQA 3BCUA 2H2HA 1L7DA 3M82A 1IJBA 1F1BA 4MVJA 1I7NA 3UK0A 1X1QA 4DREA 1V47A 3WKDA 1VHDA 4O0LA 1EGHA 2C8KA 1Z08A 2ERXA 3WK7A 4OQZA 1Z29A 3EXAA 3ZE2B 2NTNA 3COVA 2BMDA 2CMHA 3LPNA 2IHKA 3B9BA 1JMVA 3N58A 1TC2A 2IZ6A 3SIWA 3T7CA 3VZQA 2O8DA 3G2OA 4EA9A 4LNUA 2FDXA 4U2GA 4RQTA 1KO8A 1WB5A 2B30A 4BX2A 1Q7GA 2IY7A 1UKAA 1JIIA 3EIWA 4G2NA 3UWPA 4AQ7A 2XZTA 4BLPA 5JMOA 1JZQA 4B6SA 2ZR9A 5K4AA 1QFYA 2XJ9A 2Q62A 3QHAA 3UK2A 2ONKA 5BMVB 3TMAA 3TLMA 1VXOA 3VH2A 5LNK6 3G8YA 4A92A 1SU6A 4KWEA 5DLQC 1UXHA 1LPMA 4UBMA 1OIWA 1OZAA 2EJTA 4QOHA 5EAIA 4G63A 1TNDA 4JEIA 1V8BA 4PZCA 4NONA 2BGTA 1Y0BA 2Q1YA 4IWYA 4RHEA 3NJ8A 4DG5A 2YV5A 1IG0A 1XTQA 3EE6A 4YGXB 3QHQA 5KJ1A 1Q1BA 2YZNA 3U3OA 2VH1A 1T1SA 2W2OA 3WB2A 3HXQA 1FUEA 2XVZA 2HJSA 2BD0A 2EZ4A 1EYZA 1IN8A 2P9YA 3L7BA 4Q19A 3T0GA 2ZPTX 1H8HD 4RKYA 1PR1A 4QRHA 2O1SA 4KQIA 5MHTA 4GMDA 1PYGA 4XB6B 4BMVA 3VU1A 1HT3A 3TD2A 4EI2A 2BKLA 1W0KA 3BZUA 4S3MA 5HYVA 5HW0A 3EWSA 2R47A 4H7JA 3GRCA 2H9IA 3HDQA 4Z5XA 1Y5LA 4FFSA 1YCHA 4A23A 3TIFA 3AK4A 1E69A 4CI9A 2FDRA 1ST2A 2Q2OA 3D64A 2GHRA 3VH3A 3CWQA 3LY7A 1NAIA 1DUSA 4B83A 3TJMA 3N2LA 4BVKA 1UADA 2XE8A 1PQ4A 4HLCA 2ZWIA 4JLOA 2FZKA 3HM2A 4K9LA 5CB4F 1C9EA 2WZBA 3ZHRA 2LR0A 3OEHA 4HDSB 3Q0TA 1NFQA 1FB5A 2BEKA 5DCYA 4M37A 5TJ9A 1U5BA 3MJDA 3ZZUA 4ZMBA 2JJMA 3FOAA 4X8HA 4EUSA 4NRDA 4PHGA 2D0DA 1D9XA 4CLRB 2NWQA 2JFUA 4Y2HA 3SF8B 3ITDA 1YVUA 2PSSA 3PNLA 3T7IA 2VJPA 3L0DA 4GVLA 4N6OA 4RY9A 1B7GO 1T1EA 5FLEX 5C31A 3BD8A 1TTQB 3M81A 4JASB 4XIIA 2C0CA 4CT0A 2HWYA 3O84A 3FZEA 3W6OA 2XJ4A 4EF6A 5A9TA 1VBNA 2J30A 2ZRJA 5JS8A 3DBHA 1I7DA 4HWGA 1WQ4A 2R96A 4GNRA 3J7AC 3B6KA 1C1XA 3C24A 3X2SA 3CVVA 2B25A 4J75A 4AT1A 4JI5B 3HN6A 4YCDA 2Q3CA 3PU6A 4URWR 1FPMA 3ZH2A 2VN8A 3SQWA 5JMTA 1JKFA 2V7WA 3H04A 2BLLA 4UHDA 4ZAYA 3Q1LA 2QPOA 1GKUB 2CHEA 1DTSA 5FTJA 3CG0A 4K2AA 6REQA 1NFRA 5LFAA 3PLNA 3W3AA 3CW9A 2DYKA 5F76A 4MB0A 4Z4IA 1KJNA 1SXJD 1UOEA 2QM7A 3HDTA 5TPWA 4TWZA 2J7PA 1OCEA 2PE5A 2OTCA 3FMPB 4YCSA 4QX6A 1FX0B 1ZESA 4B8WA 4AK9A 1EA5A 3C1AA 2BRUC 1FQKA 1TVCA 2QXYA 3MEQA 3JQ7A 4IBOA 1D2EA 4F3CA 1PDOA 4Z4FA 2AG1A 4XEHA 1Q7EA 4RKFA 4OHKA 4G8JA 3TAHA 3I6YA 3GI1A 2C2XA 1NW8A 1H1DA 1EU1A 1CUZA 2ODAA 5CG2A 1JI0A 4X8LA 2J9YB 4LF9B 1JP7A 2OGTA 5AJTA 2FX5A 4YJKA 3V33A 5BW4A 3R9XA 1Y8ZA 5BNZA 4RZQA 1NR5A 4LDQA 2CFIA 3ZW8A 4XB2A 5HMMA 2NVBA 3DFIA 3COZA 2D8AA 1W29A 4G8CA 3NUGA 1WUIS 5JCOC 4UNIA 3NHFA 3SVTA 1I2AA 2BZSA 4FD2A 2XLCA 3TBFA 2GN2A 2C3UA 1F1JA 2OY0A 4E70A 3GUCA 4ZICA 1I33A 2QD5A 4UUBA 4V0LA 5J5CA 4G5FA 1O3YA 4K40A 1XNJA 4BNDA 1YOVA 1SCQA 2DTXA 3VYSB 3KB8A 1O89A 6PFKA 1RBMA 1DV1A 2YWRA 3O9VA 1WLYA 1Z0IA 4WWHA 1X7WA 4CDNA 1WIWA 1UK9A 3BVPA 3DHVA 3U9TA 2J5XA 5NULA 1X7DA 4HGPA 1K0FA 1I7LA 1K4MA 5ICFA 3WK8A 3AV3A 2FDCA 2GZ3A 5HIKA 3ABOB 2B20A 2Q8QA 3CF0A 2XODA 5A7GA 1KNXA 2UYQA 2WUEA 1P7YA 1PEKE 2LP4Y 2XOKA 3H2BA 3SHWA 3GV0A 1NQTA 3T5TA 3TQQA 4GOLD 3RODA 2I03A 5D3MB 5B1HA 4BB6A 4N9QA 3PDIB 4CHGA 4MRPA 3X1MA 1IJKA 2ZUDA 4LE0A 4MJXA 4S1OA 5K05A 4PLPA 1CUDA 2WB4A 1I3OA 4LGVA 3FCXA 3KZOA 3T7EA 2NO6A 3QTTA 1FC0A 1XHFA 1CTQA 2R62A 5ALHA 1EFPB 3A6FA 3ORYA 3WLMA 1EGMB 3K2IA 4GGOA 1FDVA 4HAZA 4RTJA 1FZQA 1KETA 3DAFA 1VTKA 4K9KA 1FVXA 5KVQA 4OHRA 1DBSA 4X6YA 4WUVA 4ZANA 3TQSA 2V6IA 3G6KA 4MV7A 2J0SA 2J9XB 4I55A 2XGGA 2UUPA 1OKKA 3C87A 5KJEA 2NAFA 2PX3A 2IC5A 1KS9A 1M6NA 3BWYA 4MVJF 3HY6A 2YJZA 4MW6A