2H63A

Crystal structure of human biliverdin reductase a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
284
Chain Sequence
b'MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biliverdin reductase A
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of Human Biliverdin Reductase A
rcsb
total genus 89
structure length 284
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2h63A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2h63A01
1LSJA 1H6CA 5GZ6A 3U0BA 2X58A 3GHYA 3HB4X 1PZEA 3C7CB 1I10A 3JQGB 1F14A 5TJHA 4PG4A 4L74A 4Z3DA 3PPIA 1C0PA 2QZ9A 3BMNA 3JQFC 5A5FA 4W9NA 3EW7A 4CM3A 1BXGB 3TJRA 3JYPA 3AM3A 1C0KA 1RYDA 1DC6A 3PIDA 2E6UX 3TOZA 3TL2A 1QV6A 2IXAA 4ZHSA 5A02A 1NASA 3C24A 1V9LA 4AJHA 1D7OA 4JP2A 5EPOA 3FTNA 4KDEA 2HRBA 2POQX 4CMIB 1LJ8A 2VN8A 3JYQA 2PZMA 5HTOA 2VTEA 5ICSA 3ETDA 1D4FA 3I5MA 1VPDA 4D0SA 1H9BA 2VRBA 2WTBA 3E8XA 2BKAA 1E5QA 3KEQA 1HT0A 1HYGA 1AUPA 4R41A 3KV3O 2P5YA 2PH5A 1V8BA 4ZQFA 1LC0A 1YBVA 4LN1A 3WWYA 1R37A 1P1HA 2BI7A 3BHIA 3F5QA 1E1NA 4IY1A 4DGSA 2VQ3A 3OF2A 4XR4A 1Y9AA 1ONPA 3NDJA 1VL0A 1PJTA 3S2EA 4FFLA 2FMUA 5DP2A 2OFPA 1R4NB 4UEKA 4WASA 3VHRA 1PZFA 1UP7A 5CP8A 5DP1A 1NQTA 1I0ZA 1ISMA 1YONA 1GADO 1GV1A 4XGNA 1YS4A 3UN1A 2JD2A 1RKXA 2OOSA 2P5UA 3LSYA 1PGQA 4AVYA 2GZ3A 1EUZA 4R16A 2PZKA 2BELA 4IPTA 3ANMA 5LDHA 1K6IA 4II2A 1NX6A 3MJTA 4YCAA 2DAPA 4NU6A 4AFNA 1PQUA 2CDAA 3VOSA 3ENNA 1MC5A 1UZLA 3A28A 4G81A 4DIOA 3TZHA 1Q7CA 1Z73A 2GN4A 2PR2A 3OJ0A 4BNGA 4CL8A 4E30A 3GEMA 3L4BA 4Z9YA 5EMHA 1PWXA 1PS9A 4QQRA 4AJPA 3NX4A 4CMCA 5A3VA 1E92A 1NYTA 2VWHA 2UAGA 1LDGA 1PGNA 2ZK7A 1LNQA 3JQ9A 1BMDA 2JFGA 1G6KA 4BO9A 2NU9A 3NJ4A 5K9ZA 2C5EA 4U0KA 2X23A 4PLVA 4YA6A 1V3TA 3RFVA 5KJ6A 1R66A 1DJNA 1BW9A 4JJGA 1EQUA 3C8MA 1NVTA 1K0UA 1M66A 3KVOA 4AJ2A 2YHIB 1O89A 1IB6A 2G82A 3L6EA 4RF2A 4EI2A 2D0IA 4Z9XA 4Z0PA 2QHXA 2YHIA 1ZK2A 3QIVA 5AQ1A 2FPGA 4P8RA 5JDCC 4JQCA 1B8PA 2IZ1A 1CDOA 3PEFA 3JQ6A 1LI4A 2LDXA 3K8ZA 3EHEA 1YO6A 2VUSA 4BHTA 5CG2A 2PD4A 2W2LD 2Y67A 3OH8A 3EMKA 1JVSA 3ZWVA 1F06A 2VZ8A 1HZJA 1LLDA 4J2OA 4NQZA 1ZK1A 3M2PA 4EGFA 2I3AA 3WSWA 4BKOA 6ADHA 2WWRA 1D3AA 2ET6A 1X14A 3I9LA 3G49A 4WCFA 1UH5A 4ND3A 1Z82A 2WSBA 3ABIA 1XR3A 2CVQA 2OXIA 4BIIA 4DC1A 8ADHA 2DPGA 2YV2A 2ZCVA 3AM5A 3WGOA 1KYQA 3OFSA 3RC2A 3OJEA 5CDTA 1E3EA 3RBVA 4R1SA 4B4UA 1U3TA 4ZVVA 4BNZA 2BHLA 1LU9A 3MZ0A 4WNCA 4B79A 4WLNA 2OBNA 3ZU4A 3E03A 4WUVA 1UR5A 3LT0A 4GBJA 1XSEA 1X13A 3WQSB 2AEMA 3ANLA 1EE2A 4CLRB 2AW5A 3AY7A 4UAGA 2Y0EA 3KSUA 4BKRA 4IMPA 4YAKA 2QRLA 5T5QA 2HCTA 4ALKA 2VZ0A 2YJZA 1IYZA 2WD7A 5THKA 2GUGA 3K31A 2EIHA 2PY6A 3QQPA 4MPDA 5DF1A 5B37A 2AQ8A 5JLAA 4UUMA 1K2WA 1ZVMA 5A05A 3P7MA 4J90A 5IXSA 2I3GA 2D3TA 2VHVA 1WVGA 5JYFA 2PWZA 1KEWA 5U1PA 1EFLA 4N7RA 1IZ9A 2GLXA 3PQEA 3RASA 3QHAA 3LU1A 3QVTA 1ZSNA 1VI2A 5KJEA 3ST7A 3FPCA 4BGUA 4PZDA 3TF5A 3AI1A 3Q6IA 3FWNA 1DOHA 2G0TA 4A2CA 3GGOA 5BSEA 4OSOA 5ITWA 4YRDA 3VTFA 2C29D 3ZI0A 1PS8A 1BHSA 1P1JA 1W4ZA 1XELA 2BFAA 5DNAA 1LEHA 1BVUA 3F4LA 1E6WA 4RVDA 5CEEA 3C1TA 1VSUA 2X0RA 3NKLA 4FGSA 2B36A 2V65A 3HDHA 2CD9A 2GPTA 4XIJA 3AOEA 1ISJA 4FBGA 2FSSA 4Z0HO 1C1XA 4CLHA 4Q3AA 2PGDA 2IYOA 3Q9NA 2O4CA 1QYDA 1X15A 2DPHA 3GVIA 2LDBA 3DWFA 5L3ZA 5J9GA 1IUKA 1T2FA 1NAHA 1H9AA 3G17A 3TZCA 4B3HA 3JYNA 5I7VA 1BG6A 1JLLA 2Q2QA 3VH4A 3CINA 3LC1O 3RFTA 3I1JA 1GQYA 4BGEA 1EK6A 3BZUA 1U7HA 3MOIA 1I2BA 1UP4A 2Q46A 1Y1PA 2HQ1A 3WS7A 3JQCA 4AJOA 4DIBA 3BAZA 3JQ7A 4NR0A 3UKOA 1LC3A 4FFPA 3RIHA 2WEKA 2DC1A 1A9YA 4YJDA 1M76A 3RUHA 4W9NC 3OA2A 1ZZEA 5ILGA 1PJ4A 2ZB3A 4XYMA 4RL6A 2B4RO 4JLWA 4IXWA 4JN6B 1SOWA 2V7PA 1JA9A 4KWIA 3VPXA 1R0SA 1WP4A 3HDYA 1X7HA 4P38A 5CHEA 1LQUA 3K2BA 3H65A 4O5OA 4YXFA 2FY8A 2WMDA 3QP9A 4CMBA 1YQDA 1VM6A 5IZCC 4JBGA 3GMDA 3JCZA 4OXYA 4E2YA 3CZMA 3SLKA 1EUDA 1HTBA 4QT0A 4IJUA 3S8MA 2DM6A 4H3VA 1FMCA 1B15A 4FN4A 1JKIA 2IRWA 4OL9A 1XLTA 1HKUA 1T26A 3KBOA 4YT4A 4YT2A 4DTIA 1YQXA 1ENYA 9LDBA 3JD1A 4J1SA 1Z7EA 3RUDA 2A9FA 1U4OA 3R1IA 2FR0A 3GAFA 3NDRA 5IG2A 1PQWA 2I66A 4D3DA 5BNTA 4BNXA 5L7WA 4QECA 1RYEA 4OYRA 2HUNA 3H9EO 4JROA 2AHRA 3OIFA 4IDFA 1HDYA 2IYPA 2BRUA 4XYGA 3I9JA 3ZV3A 5T57A 4TRMA 4WPGA 4YT5A 4MP3A 3ZV5A 1C1DB 1W6UA 1HL3A 1NNUA 5TRTA 3AW9A 2EJVA 3IAHA 4W7IA 3SC6A 1LBEA 1UUFA 1PJCA 1JN0A 1PZGA 4E5KA 4ONEA 3F5SA 1I3NA 4CQMB 3B6ZA 1NQ5A 3PDUA 4A7PA 5EQDA 1I32A 5GZ3A 2UVDA 3S2FA 1ZW1A 4YJFA 2HAEA 1ARZA 1DIBA 4CLRA 5KJ1A 4NHEA 3HB5X 3UH1A 4QUKA 1P31A 3DZBA 4E3ZA 3GH3A 1BDBA 2VWPA 2UV8A 2CY0A 4FJ1A 3FBTA 4YRBA 4Q3DA 2C82A 1HDRA 1JKJA 2WD7B 3M1AA 4M87A 1OAAA 5G4KA 4OOEA 3KUXA 3P5SA 4E5NA 3WMXA 2PKQP 2Q22A 1BW9B 4I9HA 5L51A 2RAFA 4FFMA 5F5NA 4W6ZA 4QTZA 3KTDA 1MX3A 4BMVA 1ZK4A 1I3MA 4IGFA 3R6DA 1QYCA 1EDZA 2DKNA 4DYVA 3R3SA 2Z5LA 2C2YA 4A73A 2H5LA 4KTVE 2PGJA 2DTXA 5H82A 3PYXA 4BNUA 2J3IA 5T73A 1UXHA 5IDWA 1CERA 4CV0A 1KY5A 3DO5A 2UUOA 4Y67A 2PKQO 4Q3BA 3AY6A 3QWHA 3ZU5A 3A06A 1U3VA 3SC4A 3ZNOA 4BNVA 3EZLA 1C3VA 4HP8A 2VYVD 1JQBA 1N2SA 1LX6A 1LLQA 1R4MB 1M6WA 5JBIA 4FB5A 5KJFA 2IDZA 3EDMA 5JO9A 3TRIA 3HJAA 2EERA 4FR5A 4R54A 5CFZA 3AY3A 3GVPA 1FDTA 1U7TA 1LLUA 4YT8A 5TNXA 5F1PA 3NUGA 1LA2A 2VRCA 2Y68A 4GX0A 1Y5MA 2GRAA 4J1NA 5F3RA 1SC6A 1T24A 4LVCA 3Q2IA 4KMSA 4KQWA 4WCFC 4MIYA 3X2EA 3GZNA 4PG6A 5ADHA 1QKIA 4O63O 2AG5A 3W8DA 2PFGA 1ZSVA 3HN7A 1B7GO 5EN4A 5JAIA 1H6BA 5JNLA 1N8KA 3AI2A 3TOXA 2B35A 3LT4A 4C7JA 4EDFA 4EJ0A 1X7DA 1JDJA 3DTYA 3RC9A 2VTDA 3WGHA 2J5RA 4L4XA 5CEFA 4IINA 2QRKA 3BMNB 3C1OA 4GI2A 2W2LA 2JHFA 1IHYA 4QEDA 1F0YA 1GZ6A 1KERA 3WXBA 1VKNA 4RPKA 4CM8A 1CYDA 4CMKA 1QSGA 4CR6A 3K73O 4BO1A 4ZRNA 1VE9A 4XJTA 4EEZA 3NJ8A 5I7EA 2AQHA 5TQVA 3H8VA 3BMCA 2JL1A 4CMIA 3IL2A 1NFRA 5AXAA 4CUZA 1W0CA 3H2SA 1GCOA 4BGIA 4BQPA 2A92A 4ITUA 4M89A 4CQLB 2X5KO 4H7PA 4XEHA 3UICA 4MVJA 1SOVA 1E3SA 1E7RA 2AEJA 1PR3A 4WJZA 2HU2A 3EUWA 3FRJA 3WOHA 1C14A 2YQ5A 4JBHA 5G0WA 1VJTA 5C5IA 3V2UA 2O3TA 2EW8A 1YL7A 3WX0A 3C3XA 4NH4A 1H6AA 1U28A 4QO8A 4XB1A 3U09A 3KETA 3GPIA 1LLCA 1VRWA 4BO7A 1YVEI 1DO8A 3UFXA 3BA1A 5I9NA 2YW9A 1E3WA 5GY7A 5KCZA 2P4QA 4ALIA 4TVOA 2OMEA 3TDKA 3AUAA 4INAA 4D3SA 1IE3A 5KKCA 4JP3A 3TSCA 2QIOA 5U9CA 3K30A 1GQ2A 4Q39A 4XDZA 1DFIA 1P1FA 4FFOA 4RPLA 3D4PA 1WWKA 4FDAA 1R16A 2VHZA 2Y0CA 4XCVA 4YQYA 3DAGA 4GX1A 2HKIA 4PLPA 3DAFA 3GVCA 3M6IA 4I5GA 3WB9A 1Q2XA 1X1TA 1NFQA 1ZJZA 3DR3A 1ISGA 2J3JA 2C2XA 1ZIDA 1UDAA 3VAZA 1CETA 3TZQA 3O4RA 3PJDA 3W8FA 3N7UA 5JE8A 2X9GA 1SEPA 3G1UA 3K92A 3H9UA 4LCJA 4XRRA 1AHIA 2TMDA 4PLGA 2YDYA 2WE8A 4G5HA 3OQ1A 4W99A 2Q4EA 3CE6A 5JPIA 2BF7A 3RD5A 4E6PA 1D1TA 4IBOA 4RVFA 5EQFA 2NVUB 3LZ6A 3H7AA 3OJOA 5FWNA 3U62A 3DZHA 1YBAA 1B3RA 2ZYDA 4O59O 3ENKA 4RDIA 4AJEA 3MOGA 3OIDA 5CAEA 1P1RA 2QW8A 5AXCA 3PLNA 4ZD6A 3PGJA 1KVQA 1PZHA 2VT3A 3R0IA 3GAZA 2J3KA 1EQ2A 4CMHA 4PLYA 1H2BA 3ITKA 4LMPA 1P0CA 1I30A 1ADBA 2EXXA 2O7SA 5EERA 4DREA 4JJFA 3M2TA 3RU9A 4MVJP 2W8ZA 5TX7A 1WZIA 3AUUA 2Y1GA 2Y1OA 2GD1O 2V6GA 5B12A 4KTTE 3I9OA 3DBHA 5TT1A 5JDIC 4CLDA 2ZTLA 1JWAB 4N54A 1UP6A 3F9IA 1A7KA 4M54A 2Y66A 3QWIA 4Q9NA 1V3UA 4KQXA 2EP5A 3WBBA 1HSOA 3HDJA 3C1AA 3I83A 4LRTB 4FC6A 2ZYAA 2EGGA 2O4UX 1ZEMA 5JY1A 1PEDA 4WK6A 1NM5A 1W8DA 3F1KA 4XRGA 2FN7A 3DQPA 3QWBA 4R9SA 5FI5A 2DFDA 1MV8A 5C7IO 3OP4A 4RVGA 4K9DA 3KLPX 4OKNA 1DAPA 3JD4A 1YBMA 2Q4BA 4N5LA 4R3WA 3L6OO 1CQJA 1TVEA 2EKQA 2Q2WA 3WLEA 1HE5A 3IS3A 3GT0A 5A4DA 1U8XX 2GN8A 3PI7A 3BTSA 4WLVA 1YL6A 3RSHA 2WYWA 3FNEA 4IQGA 1ENPA 1TLTA 1T1RA 1ZXLA 3CSDA 5G0TA 1ADCA 3CMCO 2EKLA 2ILTA 3E18A 1GYRA 3L9XA 3I6QA 4RF5A 2ZIZA 1PJLA 1OZAA 3ANNA 2Z1MA 2PTGA 4GGPA 2OBYA 1HDXA 1G0OA 5U4QA 3JQ9C 1GUZA 4FPXA 1PJBA 1L7DA 1FJHA 5HS4A 5JCJA 3T7EA 3HN2A 1RM0A 4YWJA 4RZIA 2RIRA 4HADA 1E7QA 2HSDA 1WLYA 4NDNE 4PVDA 3IP1A 2DQ4A 3VPGA 4KZPA 4ID9A 2B5WA 2E48A 3Q9UA 3QRWA 1HE2A 2JAPA 3O9ZA 2Y1DA 3LYLA 4CV1A 4J91A 1Y8RB 1P0FA 3OECA 4D3FA 4MDHA 1U2DA 3ETGA 4B7XA 1AXEA 4E2WA 1T2EA 4LSMA 3AOEC 2B0JA 1E3WB 1ZNQO 1YB1A 5IDXA 3CIFA 4YAJA 3K9QO 1P44A 3IUPA 5L40A 3WDSA 1KEUA 4DXHA 4IGEA 4U7WA 5BQFA 1H94A 3OIGA 1CRWG 3M1LA 2OL4A 3D1LA 1XA0A 2HRZA 4EUEA 4IIVA 4BNFA 2J5QA 5LC1A 1FF9A 1EUCA 2Y99A 2FWMX 3GNQA 1T4DA 1JTVA 1ZO8A 4UEJA 3WBFA 4HFMA 4YTEA 4NBRA 3PJFA 2D5CA 1ENOA 4NBTA 1DDOA 1N92A 4IMRA 1QLHA 1V6AA 4K26A 2Q3EA 4ND2A 1YB4A 1DIRA 1PL8A 4KWHA 3GY0A 4CMGA 1ULUA 3JQAB 1GFSA 1XQ1A 3CTMA 4H15A 3JQ7B 4W7HA 3GDOA 2RBEA 2SCUA 3UGKA 4J16A 2CNBA 3IJPA 1QR6A 2B4QA 4IUYA 3ZDFA 1XIVA 2C20A 3KSDO 1U1IA 3JV7A 3WICA 4YQZA 1R6DA 2EJWA 3BIOA 4O0LA 5ENDA 5JC8A 1YDWA 1XKQA 3GG9A 4Y98A 3S55A 1I2CA 1N1EA 1PJ2A 2AQKA 4BV8A 4XQGA 5ENVA 2RH4A 5JMPA 1I36A 3UCEA 3PZBA 4P4GA 1EEHA 5MDHA 2H1SA 4QO7A 1A7AA 1ADGA 1HE3A 1GYPA 3E82A 4Y8VA 2G17A 4CM7A 5KTKA 4K1LA 1R0LA 1PL7A 4URFA 3KYDA 5KWEA 2NVBA 4NFYA 4I9NA 4RCVA 5A9SB 2GYYA 2PD6A 1F8FA 5BSHA 1PJ3A 4B8WA 4BO3A 1R12A 5M6DA 1VL8A 2JAHA 1MFPA 4PLWA 4ESOA 4FS3A 3WGQA 3ULKA 1YOVB 3JYOA 1I3LA 1OC4A 4PLZA 3WTCA 4BQRA 4E2XA 4MVJG 2JFHA 3JYLA 4BO8A 5BSGA 3RVDA 1ZK0A 3VKVA 3PLRA 3E5RA 4IQ0A 1MFZA 3RWBA 3V1YA 3ICPA 3ITDA 1FDSA 2NQ8A 2P2SA 1LQTA 4HKTA 1VKOA 3F3SA 3CUKA 1EE9A 1ZEJA 3H5RA 1D8AA 5JC1A 2BD0A 3HG7A 3KYCA 4P22A 4I9UA 4A10A 3DBLA 1I8TA 2ZYGA 3ORFA 4R1UA 3KO8A 2JCYA 5KOIA 4OQZA 4YVFA 4JIGA 5JAQA 2EV9A 3RJ9A 4OXKA 4FFNA 3SJ7A 4E12A 1YH3A 1ZJYA 1NQOA 3VZPA 2PZJA 1WDMA 1LDNA 5FI3A 2HK7A 4K28A 4WEOA 1LDBA 2WYUA 2HMSA 1P1KA 3QWFA 2F00A 1YJQA 1E3JA 2WDZA 5MGBA 3OM9A 3AJRA 3VPHA 1DXYA 4R1NA 2I67A 5IXYA 3BMQA 4EW6A 4RV9A 1B3BA 3NT5A 4FGWA 4ILKA 4ALMA 1LTHR 1E7WA 2Y93A 4CM9D 2EKPA 4U6QA 4J0FA 1AE1A 1ZSYA 2QX7A 4CLOA 3V1TC 4GPD1 1PJSA 3JTMA 3ONDA 4GL4A 4O1MA 1DPGA 1B8VA 1YJ8A 4KDFA 3I9NA 3H5AA 4UUNA 5JAMA 3RCBA 5JAZA 3W6ZA 4BUCA 4KOAA 1HDCA 2QG4A 1AHHA 3I52A 4DLBA 4U8GA 4N18A 2NM0A 5I8ZA 4DPKA 1X1EA 5JDIA 3HADA 4TRRA 3GA0A 3VH3A 1BXZA 1ZKMA 4D46A 1R4NA 3INGA 1OBFO 1AN9A 1WW8A 2AE1A 2DVMA 1NVGA 2UDPA 1KBZA 3GUYA 5AXBA 3ZW9A 4RLHA 3NTQA 3W8EA 1E1LA 3OEWA 4Y6SA 3ZWBA 3QV1A 3D7LA 4G2NA 3D5QA 1P3DA 1E1KA 4RO0A 4J7UA 3IJRA 4CMAA 4ZGWA 3H4VA 1LDEA 2A4KA 4J2HA 1KOLA 3MCVA 5F21A 3GLQA 3GFBA 3K2EA 5HS6A 1DIGA 3C85A 5COBA 1YKFA 4Q3CA 3TZKA 4DQVA 3PQDA 3OQ6A 4RVHA 2R2GA 3RUFA 5I9LA 4EBFA 2Q1UA 4ROSA 2I9PA 1ENZA 1XU7A 2CMDA 3VPSA 4S1VA 4BNKA 2V6BA 1U2GA 3ASVA 3AU8A 5JCXA 2JCXA 3JD2A 4J1QA 3ZV4A 3OQBA 1Q0QA 2VYVA 3L77A 1WPQA 1Z6ZA 4IXTA 3I3OA 3PQFA 5KVCA 5DBGA 3S1LA 1N9GA 1TB4A 1KC3A 4FCCA 3HHPA 4BL5A 3FNGA 3WG9A 4BO2A 3VVBA 3U9LA 2GGSA 5C7LO 3IDSA 4GGOA 1MB4A 3MTGA 4PG8A 3GK3A 4UEOA 3W4KA 2J6IA 1KY4A 2HDHA 4BV9A 3QE3A 2EG9A 3D3WB 3VVCA 5EL0A 2X5OA 4CQLA 1NFFA 2B4TO 1NBOA 5HRUA 3VZSA 3MTJA 3D4NA 4UVDA 1Y6JA 3T4EA 4G65A 1C0LA 3WYEA 4NJMB 4ALNA 3WIEA 3EYWA 2ZATA 3JQEA 2PK3A 3I6IA 1UXKA 1M67A 2ZQYA 4PG7A 4HV4A 1V3VA 3ZZNA 4PLCA 2D8AA 1ONOA 3FNFA 5EINA 5ITVA 1KEVA 2AMFA 2DLDA 4ZQHA 4CM4A 1EMDA 1R0KA 3FR7A 5FFFA 4IDGA 5JCJD 4LMRA 1O9BA 4BNTA 3DZJA 2E49A 1JKFA 4MVJD 3ZW8A 4NU5A 1EBFA 1HETA 1T2AA 2C7VA 2O23A 2VZ9A 2WD8A 2NU6A 4GWKA 4KUGA 4DL9A 3LDHA 3B20A 3WR5A 4IZIA 3WYCA 4GKVA 4UREA 1SPXA 2JJYA 3I23A 2YDXA 1GDHA 1KC1A 3GF4A 3HUDA 4CLXA 4EUFA 1GD1O 3U5TA 2Q2VA 1A27A 1T2CA 3GEGA 2GCGA 4GWGA 3WGGA 1VC2A 1SEVA 3KYBA 1N7HA 1UXJA 3H5NA 1YRLA 3JQ8A 4GSKA 3L0DA 3PP8A 1P9LA 4BOYA 2I99A 5T6BA 5JYAA 4CUJA 2Q49A 2FPPA 3O38A 3KB6A 1BDMA 4I5EA 1PJQA 4YJFB 1NWHA 1N5DA 5GZ1A 3SVTA 3V8BA 3A1NA 3H3JA 4YBZA 1BVRA 5DN9A 1Q7BA 1C1XB 4M55A 5BR7A 1PU2A 2OHXA 4R69A 1SB8A 3ZNPA 4C7KA 3ZU2A 3H9GA 1XEAA 1LDMA 1GUFA 1EVYA 2AXQA 2JD0A 2XXBA 2Y0DA 3DXFA 4OIMA 4AL4A 3PJGA 1JU9A 4PLTA 2BFMA 2QYSA 1Y9EA 4Z0TA 3IKVA 4WCFB 3ZU3A 2W4QA 2BI8A 1WDKA 4J4BA 1NR1A 5K6AA 4J4TA 2G76A 2BGMA 4AJJA 1BSVA 3TPCA 2EHDA 3GN1A 4MVJH 4TZKA 2CDCA 1DHTA 2X86A 4DQXA 4OM8A 3KYDB 3ZNQA 2DFVA 5EJ2A 4OJNA 5DT9A 4HXYA 4IDAA 1P1IA 3Q11A 3FWZA 4CQMA 2O2YA 3DHNA 1LSOA 2NNLD 2NV6A 2GR9A 2NACA 3EAGA 1U3WA 1Z74A 5IN5A 4A5OA 4AJ4A 4OKIA 2AG8A 4YJGB 5CDGA 3UXYA 4OHUA 1PGJA 4ZU3A 2ZB4A 2NU8A 3R3JA 4I8XA 2C0CA 2R00A 1CIVA 2H9IA 1PX0A 4NFSA 5L9AA 2OO5A 3B1KA 2FRDA 1M6HA 4XWYA 3PZRA 3QW2A 1NTOA 1Q7GA 3KSZO 1GEEA 4HFJA 4WLOA 1NPDA 1DFHA 3PHHA 2J3HA 2FR8A 4OH1A 5L4NA 4JNKA 3ICCA 4BO4A 1JAYA 2VHYA 2IODA 3UF0A 2H63A 2CFCA 1PS0A 1KVRA 4BNLA 2C5AA 3AWDA 4YAGA 1DIHA 1ONNA 1TT5B 2FSVA 3H6KA 4U5QA 1NP3A 3IOYA 1DBVO 4GLLA 3ROMA 2WM3A 3DB2A 4OXNA 5L45A 1OI7A 2HO5A 2ZCUA 4N5NA 4DLAA 2Q1SA 2Y1FA 1GL3A 1ULSA 2VUUA 3PHJA 2P9CA 4JCOA 1K89A 5IDYA 4F3YA 3QVWA 4CMJA 1Q0HA 3UAGA 1Z75A 4BMSA 1Y81A 3JQAD 1VL6A 4HNHA 5DCUA 4BB6A 3TL3A 3HNPA 4RQTA 4KUHA 5KKAA 3ROQA 2VNSA 2HJSA 3ZWAA 4AJIA 2EEZA 5DBIA 1QP8A 2JHGA 4IQ8A 4IM7A 5H81A 1P74A 5JO0A 2EP7A 2P91A 4I08A 5A9RA 3D64A 3ZCXA 4ZQEA 4R5HA 3NT2A 2NVWA 4JGBA 1U5AA 4BNJA 3GVXA 1IL0A 4NPCA 2XAAA 1EZ4A 4YYZA 1H93A 3P2YA 3JD3A 4ZQBA 3C7DB 1O94A 3GN2A 3LF2A 4UUPA 2X0IA 1NHWA 5COQA 4L73A 3GRPA 4QFCA 3FNHA 3JD0A 4BKQA 1X0XA 1WZEA 4NJMA 2ZJ0A 3NV9A 4DRYA 5G0SA 3FD8A 1E7MA 1ZCJA 1SB9A 4JXKA 3N58A 3RUEA 5KVVA 3JQBC 4Z6KA 3DOOA 4S3MA 3ZWXA 1CQIA 4U0JA 1DC4A 3NTRA 3I9MA 1GV0A 7ADHA 2B37A 2NQTA 3ASUA 5JDCA 4RPHA 2YFHA 3BMOA 3U4CA 1LXCA 3DZKA 3JQDA 1JAXA 4XX0A 1EK5A 4OO3A 4CM9A 5B1YA 3U49A 4HFNA 2PNFA 2Y1CA 3QVOA 3EC7A 4J4HA 4L75A 1C1DA 1PQPA 2D1YA 4NI5A 3TFQA 1O0SA 4J43A 4GMFA 4K6FA 3MJCA 3WSVA 4F6LA 1K5HA 3WFJA 1QV7A 2CVOA 1NHGA 1V35A 2CF5A 4D41A 1R15A 3F46A 4RPGA 5FEUA 4GVXA 4BS9A 4WKGA 5TC4A 4TWRA 1DHRA 4RGBA 4PZEA 5BT9A 4DIFA 2C07A 1PR9A 1UXGA 2DBQA 5JYDA 3IC5A 4E31A 3E9MA 5CDYA 3B70A 1HDZA 2NVUA 4DQUA 3E9NA 5A03A 2VWQA 3PHGA 2O3SA 3GNTA 2DTEA 3HZZA 1MC4A 1KIFA 4TRJA 3VKUA 4XR9A 2HLPA 1MP0A 3DONA 3D3WA 3ZN2A 1TEHA 4GH5A 3RUIA 1F8GA 2VOEA 4BNIA 4DMLA 1XYGA 3P19A 3H9JA 5CPFA 1FK8A 4ND5A 3QY9A 5AVOA 5ILOA 1P33A 1NAIA 1SCUA 2NADA 3BHMA 1HLPA 3NDIA 4RVSA 2PD3A 3ONEA 4IJWA 1X0VA 2Q1TA 1QYVA 3GDFA 3IQDB 4ND1A 3IUSA 4CMEA 1E7SA 1ISHA 4TRNA 4B4WA 3VTZA 5IN4A 1A4IA 4RORA 4OGWA 3WGYA 4XYBA 1SO8A 1A72A 1SBYA 3OA0A 1O5IA 5L4SA 1N9GB 4RPJA 4BMNA 3K5PA 4OMUA 2BGLA 3FSRA 3PK0A 4LISA 3TN7A 2NWQA 3D3EA 4D43A 4BNHA 3GFGA 4XGIA 3ZGYA 5LDGA 1E3IA 1GAEO 3JSAA 4DBZA 2Y05A 2E37A 2VHXA 5DCWA 5KNLA 2OORA 3JQ8B 3DBLB 2I65A 4ALJA 2XOXA 2BFOA 4AJ1A 5BNIA 1TT5A 3L4BC 1O6ZA 4QXMA 5A1TA 5IZCA 3SJUA 3WMWA 1GEGA 2C59A 3WGIA 2CUKA 1GUYA 2I76A 3FCOA 1DB3A 3L6DA 4LSWA 5I7FA 1X7GA 5A3JA 2ZJ1A 1GPJA 4L9RA 2IZ0A 2RHRA 4PVCA 5C7OO 4UUOA 4WLFA 5FYDA 1NXQA 1WNTA 2QYTA 4E0BA 1LSUA 3E48A 4RVUA 4PIVA 5T67A 1E7YA 2BLLA 1BRMA 5B4TA 4B3IA 1Y8QB 4LGVA 4MVJE 1IZ0A 5C37A 1M2WA 3WLFA 4B7UA 1BGVA 3EZYA 1J4AA 1FDUA 1U4SA 3B1FA 4OSPA 1XDWA 1RM5A 5ER9A 4MVJM 3DC2A 1EVIA 2V6FA 3WTBA 1QYXA 1QMGA 1KS9A 1A71A 1PTJA 4MINA 3V5NA 3UUWA 2O7QA 1Z7BA 5G0VA 4GX2A 2X8LA 1F17A 4JBIA 4EJMA 2D59A 3DBRA 3A14A 4C4OA 3PVZA 2UYYA 4Z9FA 4UVEA 2O48X 1MA0A 1GCUA 3PTZA 1GY8A 2O3QA 1VLLA 5I9MA 4R1TA 3JQGA 1H0KA 3PHLA 2A35A 2DT5A 3S2IA 3W4JA 3DEYX 5L7YA 3D0OA 4MKXA 5I8WA 1HEUA 1PSDA 1RM3A 3PWZA 1BXGA 4XQEA 5C3MA 4CV3A 4FJ0A 4DLLA 4XQCA 3S2GA 2RHCA 1RJWA 2W98A 4NK5A 3E1KA 2D2IA 2YYYA 1E5LA 2J5KA 4E4YA 1A4UA 1MXFA 1JVBA 1WMAA 1MG5A 3V1UA 1J6UA 1DC3A 3Q1LA 4JX8A 3F1LA 3UCFA 1XCBA 3EK2A 3RU7A 1MGOA 3DDNA 4E33A 2AA3A 4YPOA 4Q3EA 1CJCA 5DDIP 2IZZA 1OFGA 1LRLA 1DLJA 1UDBA 3AFMA 3K6JA 1GTMA 1HYHA 4Q3NA 4CODB 2DBVO 2JFFA 1GZ3A 2ZB8A 2QQ5A 4U6SA 1Z45A 3ON5A 1E1MA 4J9UE 5IFLA 4H16A 3A9WA 4ND4A 1KEPA 3G1TA 1ZUD1 1WAMA 2X4GA 2VWGA 4TKLA 4YR9A 3INTA 4DYDA 3VDRA 2DUUA 2X9VA 4DBVO 4CM5A 3RBXA 4ZN6A 3Q0EA 1AGNA 4B8ZA 3F6YA 5GMOA 1Q0LA 2H6EA 2PLAA 3AK4A 1A9ZA 3GUCA 3OMLA 2AE2A 2AEFA 1J0XO 3FPLA 1OC2A 3G0OA 3RC7A 1ZH8A 4YRAA 4NK4A 5JMWA 5TT0A 3ZNNA 4B4VA 6LDHA 4RF4A 4RQUA 4WCDA 3D5TA 3IKTA 4MP6A 3PWSA 4UVHA 3LVFO 4W4TA 3LF1A 4UULA 1NPTO 1OOEA 3F4BA 1B16A 5BNFA 3AOGA 1JWBB 3U4IA 3ZH2A 3GDGA 4BNMA 2JCVA 3HWRA 2IEDA 1NWCA 2CF6A 3WQRA 1RM4A 3PFFA 2CVZA 3OJFA 4M86A 4BB5A 3CEAA 3DTTA 1QXSA 3W6UA 2DUWA 2IXBA 1W73A 4FQ8A 3RBZA 1B8UA 1UAGA 4EUHA 5L4LA 4WOKA 2C54A 4GMGA 2X5JO 3NT4A 4DMMA 5A5EA 1QORA 4BNYA 5DBFA 4CM1A 2YV3A 2GERA 2NLOA 4RZHA 5AOVA 4GQAA 4D44A 1UDCA 1E0DA 1JW9B 3E9QA 3FBGA 4HY3A 2PA3A 4FFRA 1G0NA 1T1SA 4J7CA 4R3NA 2VUTA 1VSVA 2G5CA 3MEQA 1XG5A 3DAPA 5G0UA 2BMAA 4CQMD 4GKBA 3OICA 4EYEA 4AICA 2D4AA 4D0RA 3CH6A 1B14A 3BTUA 1H2HA 3L4SO 3UOGA 5IZ4A 3G79A 4NBVA 3TQHA 4TMFA 4FD3A 2EF1A 4MJLA 4NFHA 3PGXA 1C0IA 1IPFA 3KEOA 4RJTA 3GMSA 3DMTA 3ZWWA 2OP1A 3P2OA 5ES3A 3PYLA 4M8SA 1E77A 3JQAA 4IJVA 5HBRA 3ZWCA 3HFGA 5I7SA 1NPYA 1PWZA 1CWUA 2DBRA 3Q3CA 2YZ7A 3VPFA 4KP7A 3FHLA 3U4HA 1ADFA 3FN4A 4CPDA 4OQYA 4PRKA 3MJ4A 4Y6PA 2NSDA 4E5YA 4PFJA 4AG3A 4EITA 3HE3A 5G4LA 1ORRA 1YXMA 3ZWYA 5IF3A 3MJEA 3CKYA 5FF9A 4P4NA 4CR8A 1H5QA 4PRLA 2ZTUA 4MO2A 5DOVA 1HXHA 3DZFA 3CPSA 2B5VA 4XZ3A 1Y5RA 5LCXA 3WJ7A 2JD1A 4MKRA 1I5RA 1KETA 5AXDA 1IY8A 1XWFA 3MWDB 4D79A 5CDUA 1GQQA 3UHAA 3LK7A 3DHEA 4J0EA 1PL6A 3OSUA 3I4CA 1EBUA 5IDQA 1UJMA 2GO1A 3CXRA 1NQAO 2FZEA 2NUAA 3TNLA 2NTJA 1NVMB 1UAYA 1HYEA 4TKMA 1IPEA 5TS3A 3TWOA 3PRJA 3VH2A 4WE3A 3TZ6A 1UZNA 5JS6A 1PGPA 2XXJA 4PN3A 1Y8RA 1ZMOA 1B0AA 3RAJA 3LC2O 1SAYA 5CG1A 1YOVA 1I24A 4NG5A 4YACA 1LRJA 3RROA 2O3JA 3W4IA 5JYEA 4TROA 5L95A 1IOLA 3ROKA 4MOWA 4ALLA 3HQ4O 1M75A 2GN9A 3PDJA 4XJSA 4LCEA 4EJ6A 5HA5A 4L0QA 1YQGA 3E5MA 1DAOA 1WXDA 3ZHXA 4LVUA 3MJVA 1MG0A 4CR7A 1CEQA 3V2HA 1IHXA 3O8QB 3DZGA 3VC7A 4CL3A 3RUCA 3LLVA 4XQ9A 3BMCB 1FDWA 5TGDA 3BTVA 3WQQA 1J49A 3PXXA 3GOHA 5JXWA 4FIZA 3EVTA 1V0JA 2V6MA 3GR6A 3ZHBA 4BNWA 4XGKA 1K3TA 4IS3A 4A27A 4E5MA 1HE4A 2PH3A 2PZLA 4PLFA 4BO0A 4CM8B 5F1OA 3DFZA 2Z1NA 3WFIA 1P77A 2O2SA 2PKRA 1T2DA 1DRUA 4WOJA 1U9JA 3GZ4A 4UVGA 1ZK3A 1SMKA 1GZ4A 2XF8A 1DFGA 2BGKA 3H3FA 3RC1A 1WMBA 4CLEA 3JQBA 5COAA 1XGKA 3PHIA 4BO5A 4I1IA 1MLDA 3WNVA 4Z3KA 4I5DA 4M1QA 1E3LA 1EVJA 4MKZA 1KVSA 3NGLA 5CPBA 5HM8A 2YUTA 2GSDA 1TT7A 1VJ1A 3BMOB 3HDQA 3KXDA 1XU9A 2EW2A 3WGZA 1TI7A 1U5CA 1ZMTA 3LT2A 3VDQA 4CLOB 5A9SA 5KVSA 5TJ9A 4EEXA 2GASA 3OETA 5JSFA 1LDYA 3VZRA 4IDDA 1DRVA 2VNAA 2OGUA 3E6AA 4MIOA 1P45A 3CZRA 4ZICA 5TF4A 1LSSA 3MJSA 1BXKA 2X0JA 4BVAA 4CV2A 3H9QA 3PJEA 4AJKA 3B1JA 2HMTA 2PGLA 2AQIA 3DZIA 3AI3A 3L9WA 3DBRB 4MP8A 2RH8A 1ZBQA 3KRTA 3O26A 5K6AC 1RWBA 4R51A 4O6VA 5DZSA 1XQ6A 3OBBA 3EGOA 2ZTVA 4FC7A 3OJLA 4RF3A 1HDGO 2X22A 3OEYA 5ER6A 4FW8A 1ZFNA 2BFPA 1PIWA 4XYEA 3NTOA 1SZJG 4NMHA 4F46A 1I3KA 3SXPA 3L07A 3JQFA 1N7GA 4MIEA 2OP0A 4WLUA 4IDCA 2DBZA 1EVZA 3ZWOA 1I33A 4CJXA 3I9KA 1TA4A 1A5ZA 3ZWNA 3INRA 3GRKA 2G1UA 3TFOA 1N1GA 1SNYA 5KVQA 2VHWA 2VT2A 4RLSA 4J9VA 4Y9DA 4B3JA 2JKVA 3WIDA 5IAAA 5TIIA 2W2KB 3NAQA 3Q2KA 2EGHA 4BKUA 5L53A 2OUIA 3SEFA 5EESA 5A06A 2HJRA 1D1SA 1L7EA 2RCYA 3KLMX 4CMEC 2QZZA 2FHSA 3GPDG 3BMQB 1MUUA 4BGVA 1K6XA 1J5PA 3C7AA 2X1HA 2GN6A 3GEDA 2DTDA 3BYZA 4IIUA 1DJQA 4TSKA 4E21A 4DA9A 4NNJA 3KHUA 5G4KB 4CUKA 2QRJA 1S6YA 1PGOA 1NR7A 3EVNA 3NGXA 3W1VA 4R5MA 1B2LA 5T8KC 4J49A 3GC6A 3ZHZA 3SLGA 4E2ZA 5J23A 3PIIA 3WYBA 4NZ9A 3AUSA 2GNAA 3AU9A 1G1AA 2FOIA 2D5AA 4WLEA 4LK3A 3DMTC 2J8ZA 4DPMA 2PV7A 2TMGA 5CDSA 5BSFA 4FSHA 4HWKA 2HMVA 3GG2A 4IDBA 4DUPA 1KVTA 4B7CA 3KM0A 3UW3A 1E6UA 1YWGO 4XKJA 5ICMA 1I01A 1RPNA 2YY7A 3HSKA 4YB8A 3ROPA 3ADPA 3WJAA 4BKPA 4N5MA 4YEDA 4E32A 1FXSA 3COSA 4YJGA 8LDHA 4NBUA 3AUTA 4J1TA 1B26A 4XA8A 3T4XA 3WWZA 5B4UA 1HLDA 4R01A 1OMOA 1FDVA 3DOJA 5T64A 3MWEB 1EDOA 4I5FA 1R4MA 3GGPA 4E13A 2CDBA 1DSSG 1QLJA 4XYLA 1DC5A 1UXIA 3DMYA 2OZPA 1HWYA 1YL5A 9LDTA 5A04A 4P4LA 3NYWA 4TZTA 2R6JA 1DEHA 3GGGA 2FP4A 3O8QA 3FR8A 1T4BA 4ZA2A 4L8VA 2NU7A 3RUAA 5KJCA 5JW6A 3RQSA 4A03A 3FF4A 2GF2A 1IULA 2IE0A 4YDRA 5THQA 2P9EA 1GR0A 1E6EA 1QG6A 2YFQA 2YV1A 3NRCA 3NEPX 2I6TA 3IP3A 1L1FA 1YE3A 5F1KA 2CSUA 1HF3A 3KOUA 1K6JA 3LT1A 4HUJA 4D42A 1I2ZA 4PCVA 2GZ1A 3UVEA 4YAIA 1U3UA 1ZXBA 2A94A 2Z95A 3DHYA 3DBHB 2CZCA 3UCXA 4AJNA 4NIMA 4Y6RA 4UVIA 1LRKA 2C7GA 1MXHA 4ZRMA 3BXXA 2VOJA 4GLOA 3IMFA 4RDHA 4WEQA 4WECA 3RJ5A 4YAEA 1DLIA 4BNNA 1DIAA 2DU8A 3ETEA 2VCYA 4ZQGA 3AFNA 5HWSA 4PZCA 3KZVA 3EY4A 1TXGA 4JK3A 3RKRA 1YGYA 4CM6A 1GYQA 1Y7TA 2WE7A 3VH1A 4BO6A 2Q50A 1HSZA 2WYVA 2FR1A 2HMWA 3F47A 2O3UA 4TVBA 2ZTMA 4NBWA 1F12A 1UZMA 3ZWPA 3QSGA 4GVLA 4DWVA 4WNIA 2WJPA 4GAEA 3A4VA 4II3A 2P4HX 3KYCB 4HFRA 2W90A 1S7CA 3SBOA 3ZWMA 5JFOA 4FOOA 3STHA 5L7TA 5KIAA 4R68A 1LUAA 2GZ2A 2Y1EA 1H6DA 2P9GA 2R00C 4NJOA 4J6FA 4QX6A 4XIYA 3QWAA 1YB5A 4PLHA 4QFDA 2Q99A 1QYWA 4XDYA 4XB2A 5DULA 2E4AA 4AJLA 3HFSA 3WNQA 2I5PO 1HRDA 3FTPA 4D45A 4M49A 2Q45A 2ZB7A 4F45A 5B4VA 2YQ4A 4A0SA 3GVHA 5DOZA 2ZQZA 3N74A 4TQGA 4L76A 1GU7A 3ONFA 4GX5A 5IJZA 2W2KA 1GPDG 3OHSX 1BTOA 2B69A 3O03A 2NTNA 3BHJA 4FJ2A 3U3XA 3AM4A 1AXGA 1WDLA 4OAQA 4DC0A 2E82A 3DFUA 3VZQA 4B4OA 2F1KA 4PG5A 2GDZA 1BWSA 2HK9A 3IIEA 4GSLA 4MVJF 2HK8A 4R4JA 2FPIA 4KUEA 3PFWO 4JJIA 3QA9A 4OOFA 5A9TA 3U4DA 4E5PA 5DCYA 1EFKA 2FZWA 5H83A 3DL2A 4J7XA 4LW8A 2X9NA 3LQFA 3RKUA 5T8KA 2O50A 3X2FA 4XD2A 2IEBA 2P68A 4HX5A 3RFXA 1XHLA 5TLSA 2YHUA 2VRCD 3PWKA 7MDHA 3H2ZA 3LC7O 4DVJA 1YDEA 4YJHB 4D7AA 3ZV6A 4CM4B 1ML3A 4FOSA 3GHHA 3WGTA 2X7HA 1HZZA 3K96A 4YJHA 5CEJA 1DRWA 4IS2A 3CMMA 3V2GA 3PYMA 3QVSA 4L4RA 3GZNB 5AYVA 3D4OA 5G2OA 2UUPA 1QRRA 3T7CA 3GNSA 1ISIA 3BTOA 1HDOA 1CF2O 1U8FO 3QVXA 5JY6A 3LLSA 4HBGA 4IJKA 4IZHA 4ZJUA 3ADOA 4X54A 2EWMA 3DBVO 5K0ZA 4PGFA 4R9RA 4LRSB 3FI9A 5TSDA 4F6CA 1VJ0A 4DPLA 3RI3A 4MVJI 3GQVA 4A26A 2XPCA 4W82A 2O3RA 3QJ5A 2HMUA 2NTVA 1Y8QA 2Q1WA 1KVUA 3QLJA 3SX2A 2X6TA 1O8CA 3G3EA 4EZBA 1ID1A 1T25A 1O95A 1ISFA 4WGGA 4HNGA 3DOCA 2ZKLA 4K6CA 3I4FA 2VYNA 3ZHYA 4IDEA 4L4SA 2BH9A 2B83A 4J3FA 5F5LA 1Q1NA 4QSMA 2VYND 2X0NA 5EIOA
chains in the Genus database with same CATH superfamily
2ZRHA 3BK1A 1P4HA 1DWOA 4LWZA 3JASA 3QXHA 3U6BA 3KVYA 3L6CA 5ALEA 3VQTA 2R9VA 1Y1RA 1F14A 4PG4A 4BBZA 5I7RA 1C8KA 1KAHA 1NW6A 3AEUB 3PPIA 3FIJA 2QZ9A 5A5FA 1RWVA 2P78A 4ZI3A 2LNDA 3N7TA 3TLZA 5CVVA 3TBFA 4CM3A 2V54A 3S81A 4LHEA 2GZDA 4DHWA 1Y5IA 4E4TA 3JYPA 2D74A 1JXMA 1COWA 1L7BA 3C14C 3NHSA 3BSYA 2FEAA 2WJVA 3OIWA 4FYWA 1NXSA 4GLJA 1DC6A 1DMRA 4BMCA 4E7OA 4ZZIA 5FL7A 1SZPA 1DG9A 1WDWB 4AZ3A 2C31A 1J1UA 1V9LA 3OEHA 4AJHA 2H2IA 3I09A 4HC4A 3FTNA 3RADC 4KDEA 1G98A 2POQX 3TTXA 2AMYA 1LJ8A 2XEXA 1TGYA 5INTA 3F2VA 1SXIA 3HB9A 1N3LA 2VTEA 3FGOA 3RG8A 1Z6AA 4Q93A 4LBZA 3ETDA 5DJ5A 1D4FA 5F3WB 1AQLA 2YXBA 3LTNC 2O2HA 2GCOB 1MOSA 5AHRA 5B5SA 3E8XA 1FFCA 2BKAA 2AT1A 1OYOA 1BCRB 1HT0A 3OOYA 5MN6A 1CFJA 3BXOA 3UG6A 4ZQFA 3HB1A 1M54A 1TVMA 1YBVA 2MSLA 4LN1A 2DH6A 3Q5GA 3U3KA 3VR3A 5KUTA 5DX0A 3KG2A 4ARCA 4BRSA 4DGSA 3CT4A 2VQ3A 3OF2A 2CFIA 1RAHA 1Y9AA 3C3CA 3D0QA 5AKHA 3HTXA 3KDPA 4JLNA 5EMMA 5TQ0A 4G1VA 2PSDA 3NPMA 3CH7A 2OFPA 3WNZA 4P4TA 4WASA 2FPXA 2CC2A 5AVUA 3AIMA 1WQ4A 2GJKA 1BHO1 2FW8A 2FFJA 4MUGA 4X8LA 3ZJ5A 1EK1A 2X19A 5DP1A 3KTOA 4TXNA 2FDCA 3C6ZA 1ISMA 1GADO 1OFUA 1R5OA 2BPOA 3NQ41 1NBHA 1Z8NA 2WWIA 4JOBA 2OOSA 2P5UA 3FDXA 2PUDA 1F1JA 4NCJA 4WZAB 2R5WA 3ZZTA 2BVNA 2DR0A 3IMEA 5HOEA 2JZCA 5JS7A 2OGTA 2ZULA 1TYDE 4IWNA 1HOXA 2BELA 1YIDA 1XZFA 4M1WA 4YGYA 3K0AA 4RK7A 2WOJA 3S40A 4TTJA 4URYR 4RFSA 2D4HA 2CDAA 1JZTA 1U0OC 1YKSA 4IIYA 2QLMA 1UZLA 2C96A 3UMVA 2FWJA 4G81A 1LW7A 4MQUA 4ZYUA 4DIOA 3LS2A 2RJNA 2GN4A 5I7WA 1WXHA 3P9ZA 3IWDB 3OJ0A 4JODA 1CS4C 1FZQA 1PNTA 4BNGA 2V9ZA 4IDQA 4RW0A 1XAIA 1AZTA 4Z9YA 3NASA 3HA7A 4HAWA 4QQRA 3DFFA 3TW4A 3ZHQA 3WMGA 3EOZA 4Q02A 5FPTA 3K0FB 4Q4HA 1O0CA 2VJYA 5F9FA 3AP2A 4TT3D 1RKQA 4JYAB 4H6PA 1EUQA 3TXAA 4FT2A 1RYYA 2VQSA 1RRFA 2OGWA 2R7NA 4JKIA 5IH3A 4BO9A 5K9ZA 2YCBA 4U0KA 4O8JA 2FSFA 4EPTA 5JPDA 2WMNB 1XP5A 4DANA 3A3OA 1V3TA 5HEKA 1DBQA 1CKEA 1GNRA 1R66A 1OTYA 5B3LA 5F2OA 5LD2B 1PR6A 2MYPA 3SBXA 3C8MA 3STUA 2OHVA 4ZPXA 4ZIRB 2OCKA 1KY2A 1K5DA 1XV5A 4HRAA 1QVWA 3AHJA 3IUJA 3G82C 4ZYYA 4Q4LA 4LF5B 6Q21A 3ND7A 1ECGA 5FTWA 1W29A 1AQIA 1ZK2A 2BFCA 5AQ1A 2GD0A 4P8RA 1JIQA 1T4CB 2GT1A 2XJ9A 4UUBA 5DX8A 1RC8A 4AP6A 1EUDB 4HQKA 3KK0A 3WKCA 2LDXA 3CUTA 2QTMA 1L7MA 3GJ0A 1I9CA 3U3ZA 1SUPA 4UNIA 2O8DB 3EHEA 2IXTA 4C29A 1A5TA 1YO6A 2O2IA 2VUSA 3KE9A 1YAJA 4KXUA 4UE3S 2BR5A 2NPFA 4A0GA 1AO0A 2PD4A 1E9AA 4LE2A 2W2LD 3GW8A 1G8AA 1G7RA 4HEJA 4OB7A 4Y0NA 1NJSA 1JVSA 3EMKA 3HJBA 3ZWVA 2FWPA 4RD6A 2EZTA 4YRZA 1LLDA 1O9HA 4J2OA 4NQZA 3SS9X 3NAZA 2JFOA 2WTMA 5JOQA 2XCRB 2ET6A 3M5DA 4E03A 3OZCA 1UC4B 3G49A 4IIBA 3NHKA 3EUEA 1WQ3A 2ORVA 3W5BA 3LUJA 4ND3A 2IHNA 3ABIA 1YVUA 3EZFA 1AU9A 3ELDA 4QLOA 1NXPA 1UEJA 3ZHOA 3P8ZA 2QJRA 4HH4A 5HCIA 3T9EA 2JI8A 2EIXA 4XPIA 2OYRA 3VSEA 2A9OA 1GKUB 4DC1A 1JRLA 1DBWA 2YV2A 3PENA 3AM5A 4GZMA 3WGOA 1E2MA 1E9BA 1FE8A 2WHPB 3OFSA 3SZMA 2G5TA 3HBAA 4XI9A 3VR0A 4D9GA 3IOMA 5EHGA 4PPNA 3HY6A 1AS0A 3NYIA 3QLTA 4R1SA 5UKDA 4BNZA 2BHLA 4B79A 2GM9A 1OYWA 3H87A 4L15A 4MGZR 1AT1A 1XCPA 1U7ZA 2I29A 5TVGA 4F93B 2L18A 3H8WA 1GRCA 4GBJA 4ZDWA 3V9AA 3CA8A 2FW1A 3KJEA 4YN3A 1C7FA 3MSXA 4RSMA 5KTOA 2WOOA 2KMLA 3II6X 3PX3A 2VKQA 1TUGA 3GFTA 2Q6VA 3LQKA 2WJYA 3CB2A 4MJ7A 4MRAA 4MCJA 4DLSA 5T5QA 4DCUA 2J9XB 2HCTA 4ALKA 1CX9B 3VNRA 3ROGA 2VZ0A 4BVEA 3TNYA 4I1UA 1BFDA 4LNAA 4MNTA 3R3UA 1RPTA 4PC1A 5FULA 4NCHA 4S1WA 3VZCA 2FN3A 2GUGA 4WKCA 5CNJA 3KKQA 1RLTA 2B7LA 2VHCA 1Y8ZA 5AW7A 2INGX 1YS7A 1DQRA 2COKA 2DQYA 4KW7A 3V1KA 2I3GA 1GGFA 2DUJA 3KHKA 3F49S 1JX6A 4HHEA 1E2PA 2Q0XA 5JYFA 4HDKA 3WLQA 3ZDBA 4KXWA 2RKWA 3MM4A 1WM1A 3OU6A 4N7RA 5A7HA 1EWVA 3VBCA 2B78A 3PQEA 4PSDA 2B4AA 3RASA 3LU1A 4OFXA 1VI2A 3H99A 3ST7A 2X8AA 4BGUA 3ZE0B 2ODPA 2P6PA 2WM2A 3TF5A 3QSYA 3FWNA 2Q0HA 2XOKD 4PQGA 4WBNF 1BE8A 1OXXK 4X0EA 5BSEA 2JFBA 3ED5A 3VTFA 1XFDA 3ZI0A 2QTVA 1PS8A 1BO6A 1TYAE 4FI3C 3WIVA 4BE9A 4WFKA 2QTLA 1E4VA 1I0IA 2J9GA 1XRPA 4LOKA 2A7XA 1BVUA 2RGRA 4EGQA 2RGAA 4AMYA 1I4WA 2EWWA 4Q34A 3HH8A 2WF7A 4FGSA 4CWAA 3OIYA 3ZJ4A 3LBYA 2GPTA 2ZJZA 4XIJA 4IXDA 5K0GA 4JL8A 2QNRA 4B0PA 2X5NA 2DQSA 2BSXA 5J2UF 1Z6QA 2M6RA 2F43A 4FBGA 4R7ZA 3HR7A 4Z0HO 2JJ2A 1FMTA 1Z2AA 2KJQA 4FX2A 1F7VA 2O4CA 1QYDA 1MDBA 1W5FA 3P45A 2DPHA 4ZPJA 4D26A 4J0CA 3DWFA 3Q7PA 4I81A 1OAKA 3HY4A 4MV5A 1T2FA 3WLIA 3QM1A 3OLZA 5BMVA 1L4MA 1MA3A 1Z3CA 2BCGY 4TLBA 3TZCA 4B3HA 4S04A 4DUYB 5I7VA 1JLLA 3F3YA 2QQFA 2EW1A 2H1CA 4B4KA 2RE8A 2ZXUA 1SCUB 1VMIA 1ZOIA 1ESMA 2FRXA 1ZJ4A 1LVHA 3HYCA 3IUYA 4KQEA 2HB6A 5FL7D 3RFTA 3BZUA 1U7HA 3CVYA 2Q46A 1UP4A 4GBGA 1ORHA 1Y1PA 4JUFA 4LTMA 3JQCA 3IPCA 1M6EX 4UFOA 4UDXX 4AJOA 1JE0A 3VYRB 2CNDA 2JVIA 2PS1A 3KV1A 4LDRA 3RIHA 3H1BA 2PKYX 4YJDA 1U31A 5B36A 3KT8A 1IB0A 2JGLA 9ABPA 1DCTA 1T5DX 4HQOA 2IYVA 4JUIA 3FNIA 3G0CA 5JMTA 2YYSA 2ZB3A 4KRYA 3P9CA 2EFCB 1KDYA 4HGRA 2B4RO 1A1SA 1OWPA 3ESYA 3IWBB 4JN6B 3I28A 1IWPB 4G07A 4IXWA 4EDHA 2V7PA 1JA9A 1L7PA 2H17A 3HKDB 4KWIA 4TGLA 3VPXA 2X2OA 5CGQB 3VC1A 5EJ5A 2AFHA 3WDKA 5CHEA 4QVKA 1LQUA 3ZEIA 1IWBB 1IY2A 1E4YA 3RRYA 4FOLA 4XQ0A 4DV6B 5LFAA 4Z5XA 4URXR 3A3PA 3HBNA 1H4SA 4W8HA 2FY8A 2GBIA 3LG2A 4JBGA 1M3SA 1N2OA 2CDNA 1GAJA 1S5PA 3M4XA 5CX1B 5CD9A 1JAHA 2IGTA 3CZMA 4E2YA 1FS5A 2EVWX 2IPMA 3DHWC 2BTOA 3H19A 1E5DA 1CR0A 1I9GA 4DIKA 2UUAB 2JPDA 1J8YF 4YQFA 3COVA 4H3VA 3P20A 1QAOA 4HYEA 4EY4A 1Y9ZA 2IRWA 4BFZA 1KZ9A 2IYUA 3D6VA 3DKKA 4WCVA 1XLTA 1SIWA 2NO4A 3R4VA 1HKUA 3KBOA 2PS0A 4G24A 5T4EA 4JJ6A 4DTIA 4E11A 4YT2A 6NULA 5SZHB 3VZDA 1MB9A 1YASA 1BE0A 9LDBA 1VE1A 3M3PA 4J1SA 1T4MA 2PO7A 2ZJ7A 2G9NA 3RUDA 2R25B 2YJ3A 3B82A 1W581 3I5UA 3FX2A 1R5JA 3ANXA 1J23A 4GNKA 4MUIA 5AO9A 2BP7A 5HQ3A 4BNXA 3PRKE 5L7WA 1GTJ1 5FIUA 1WXXA 4I1SA 2Q62A 3AZQA 4OHZA 3O8DA 4DRXB 1CVIA 1N3YA 5JI2E 4AKGA 2VYFA 4X97A 5CCBA 1D4AA 1S02A 2IYPA 3SEZA 3C4JA 1J5XA 4QNRA 2BRUA 4C0BA 4AKEA 4AO7A 4BMXA 1KSHA 3MWKA 1L5ZA 1VLVA 2XNSA 3FYHA 2QQ0A 4MP3A 4WPGA 5C8XA 1C1DB 2E85A 4V0KA 2J48A 2QVGA 1T43A 4LPSA 3TL6A 4C7XA 3IAHA 1VGQA 1TVCA 1UBOS 3DE5X 5EVJA 1LBEA 1R3DA 3SC6A 2IEIA 4DV4B 1UUFA 4ARIA 3K0HA 2P4SA 1Q7TA 1IN5A 4U2KA 3D3JA 3F5SA 2CLHB 1SCKA 1E2EA 3BCUA 3Q8XB 3B6ZA 1NQ5A 1T1GA 3PDUA 2G1JA 1KAEA 2AJTA 3S2SA 3COPA 3H2GA 2W2NA 1GWNA 3OX2A 5FT9A 3OCWA 2OG2A 2H4WA 1PK7A 1JEAA 2J4DA 1OQAA 3HB5X 3SNKA 4QUKA 3CUUA 1P31A 5KX5F 5LZ4A 3EDQA 1KI9A 2W7TA 4N1AA 3KFLA 1X8LA 2UV8A 4FJ1A 4PNEA 2YS6A 4XDGA 4KV7A 4YRGA 4RTSA 3VX4A 2ZUFA 1YZ3A 1VG9B 3U7FB 3KWMA 2RI0A 1T2NA 2YN0A 4BC1A 1YHYA 2IVFA 3TGLA 1GL9B 2JLZA 4OOEA 4E5NA 1Q50A 4L5AA 3W9BA 3WMXA 4MEAA 5B1HA 2I1QA 5F5NA 4QTZA 4LC0A 1OXSC 1MX3A 1WHSA 1Z2PX 2EFYA 4HH3C 5KYKA 3R6DA 5E6SB 1QYCA 3KLBA 3T3IA 2CL0X 2XA9A 1RXWA 2W6NA 2Z5LA 4OBWA 1W52X 1Q0RA 3OZVA 4ENVA 1QQTA 4A73A 2CMHA 2CKMA 2NYAA 3ZZ1A 2CLOB 3SDZA 1VE6A 8AT1A 2DTXA 5H5JA 5BW5A 1NNLA 4E1VA 3GFSA 1J24A 3LPMA 4TMYA 3T9FA 4S05A 2J3IA 4O1HA 5KX5B 5T73A 2KB0A 2R1TA 1KYIA 3H8SA 5IU6A 2RGUA 3PITA 3UHPA 3RTAA 2GJ9A 3N87A 4G1UC 1KY5A 2UUOA 4MQBA 4RHYA 4K6KA 4Y67A 3HRKA 3GCWA 3R0ZA 3K9FC 3O2SB 4KU4A 4BNVA 1E0SA 3HY3A 1VLMA 3TTSA 3ZNOA 5B7PA 5IWCA 1I7NA 1NONA 1ZJ6A 4ZAYA 3RS8A 3UT6A 1JQBA 2GXSA 3O94A 4B5KA 5F2NA 5K5EA 1M6WA 5EHNA 1LPNA 3G68A 3EP5B 2IDZA 2JI7A 4MCAA 3EDMA 2EJBA 5JO9A 3HJAA 4MW7A 3CG0A 1DT3A 1KWKA 4R54A 3PTAA 3C6QA 4HL6A 4QTXA 3OEED 4TX1A 3D43A 1LLUA 2G0NA 4XGQA 4EY3A 1RQNA 3MBOA 4CBVA 4G1FA 2VRCA 1G4AE 4EW1A 1BAPA 3KUKA 5SZJA 2GRAA 4U2BA 3LH5A 1NBMD 2FW7A 5BYAA 2B8JA 3O9MA 4O2AA 3CCFA 4LVCA 2A9PA 2QKYA 3WHKA 1CZLA 3GMTA 2GEVA 1QKIA 2V8BA 5ADHA 4EF6A 2A33A 2QN2A 3HN7A 4JL5A 2QSYA 3GJ7A 4I4LA 1H6BA 2VQ6A 4M7OA 1A69A 1N8KA 2IELA 2Y4OA 3TOXA 2CYCA 4EDFA 3LHSA 4EHDA 1ORTA 4RXMA 4PHHA 4E07A 4C6RA 1UK6A 3HBLA 5FV7A 5CEFA 1MABA 1FTWA 1OBOA 1T6BY 4GI2A 2W2LA 2X9LA 4Y6GB 4QEDA 3WZLA 2O07A 4O1IA 3Q8KA 3QMMA 2GNPA 4B40A 1DZ3A 1GZ6A 1KERA 1U8CB 4CM8A 1VKNA 1T9AA 3AHGA 3EXHA 4RPKA 2HT1A 1FXUA 1T8PA 1XE3A 2HBYA 2XIQA 2Z8XA 4NRDA 1K66A 4OK6A 4V2IA 3K73O 4BO1A 2J59A 4NC9A 2ZSUA 1P9WA 3D7MA 4HVTA 4NSNA 5CH3A 1QYIA 1HLFA 4XJTA 3V4FA 3Q6MA 3SYLA 1SHKA 5C53B 5FWYA 4C7OA 5JJIA 2IYWA 3BMCA 3GU3A 2JL1A 4MMXB 1NFRA 3I42A 1ZJ5A 5C4GB 2VH2A 5B58C 1UCFA 4F3NA 4X85A 5F51A 1E2DA 2JB9A 3DSRA 2GFIA 1HV8A 1TIBA 4QASA 4KN8A 3C5WP 3RIGA 4QZVA 3S68A 2J46A 3I62A 1DE0A 4Z4QA 1XTTA 1TU0A 2A92A 2DOKA 4B2LA 5FOXA 4BYGA 3K70D 4CQLB 5DW0A 1WHTB 4LDNA 1P75A 4RK1A 3FCSB 4GWLA 1ZRSA 4MVJA 4A91A 2FMTA 3QHPA 1SOVA 3UGTA 4OHWA 2AEJA 3ZX4A 1PR3A 2B8EA 1I7DA 1S3GA 3FRJA 4NOMA 2P35A 3T8YA 4F86A 2O59A 3ILSA 1OFTA 1ZH2A 2AI2A 2ODBA 3WWCA 3V2UA 3PFBA 3RK0A 5C46F 3C3XA 2F64A 2ZUSA 1FUYB 1OR8A 4ZT2A 3EXHC 1BOFA 2H5IA 5T4HA 2QJFA 2ONCA 3TJMA 1U2TA 2YW9A 5I9NA 5D00A 3PE4A 3EXEB 3DCJA 2BP7B 2JNWA 3UKDA 5HQ3B 2P4QA 4QFBA 4BWFB 1DWUA 3RU2A 3R3XA 3TGWA 3TVYA 3BWBA 4QC2A 5C0OE 4CKBA 3AUXA 1XI2A 2PV0A 1P1FA 4FFOA 4Z4IA 3D4PA 3TMKA 3W3AA 5K3CA 1OZFA 2JEOA 2XMBA 3IX7A 4FDAA 5P21A 221PA 2BFFB 2P3OA 1I2MA 2C0PA 4IMJB 3FFAA 1C5KA 4FFVA 4U7DA 4NCBA 2CHVA 4I5GA 3PCTA 3D2LA 3IOBA 1H0SA 1DDIA 1M7HA 3I73A 3J7TA 3HGTA 4MW5A 2AJ8A 3K32A 5TARA 2ZUEA 3QBDA 4GRDA 3S1AA 3C48A 3O4RA 1W5SA 2IVZA 4AUNA 2XYHA 2ZJ5A 5HR5A 1AKUA 3N7UA 3HWWA 4DCCA 3BIXA 5KPJA 1MJ5A 1UJNA 3E9YA 3H9UA 3K92A 3KTAA 3L1JA 1VKRA 4LCJA 5KYYB 4HQ0A 2MYNA 2YDYA 4KIUA 2WE8A 1QAQA 4W99A 3C3PA 3GBPA 5GONA 3H9CA 3O73A 1JDNA 2ANCA 5FO1A 1CHDA 2R1VA 4E6PA 3DZDA 4ND8B 1U1DA 4RVFA 5EQFA 1LBQA 1YQTA 1W1WA 3H7AA 5LKAA 3HCOA 3NHMA 4JOSA 4KXMA 3DZHA 2C83A 1YBAA 3OX3A 2ZYDA 1QIMA 3ENKA 3K0EA 5K4HA 5ESXA 3OIDA 1NNSA 2G72A 4HAXA 4HEA1 4LK2A 4F5YA 4NZOA 3GLGE 1JI3A 1GN9A 2C3MA 5D85A 1U3FA 1QFXA 2P62A 2X0DA 4ZD6A 3PGJA 2HA2A 2P2DA 4FEAA 4EB6B 4TV9A 3DYIA 2VT3A 7ABPA 1MV5A 1A9PA 5L3SA 1GCAA 2QLBA 5DISB 2P11A 3PNVA 4BWYA 3LKZA 5BR4A 5CFLA 1WXEA 1I30A 2PUHA 1ADBA 3KT0A 2A1TR 2JLYA 2GF0A 3NHRA 2GQ0A 3PUWA 1L5HA 5TX7A 3WK9A 1JEQA 3ANSA 2NP6A 2IYLD 4MYCA 1P4AA 2V6GA 2JGAA 2XCLA 4B3GA 4LDQA 4CLDA 4UNPA 1RCUA 1SPBS 1TQ8A 1Z8FA 4OQFA 2AZMA 5BSKA 1JWAB 3Q88A 2H1HA 2W4MA 3D6TB 2WIGA 3EJ6A 3EWSA 3KPWA 1AUOA 3W05A 2Y66A 3I37X 3OOHA 4Q9NA 2V3CC 2FPRA 3CSUA 1V3UA 1CUIA 4KFTA 2Q5QA 3DGEC 1I14A 3GJ8A 2PX6A 4K0RA 4QFMA 3VAAA 3PEUA 4MQ5A 4TKVA 1ZWLA 1FYFA 3WLRA 4FC6A 2V7BA 1PO7A 1L9KA 2ZYAA 3D6JA 2O4UX 1M73E 3H5IA 3IXMA 3QJYA 1PEDA 3W7BA 3U7QB 2YJ4A 4R3UC 1NM5A 1JQ3A 1DDGA 4WD3A 1E9VA 3W1EA 3WKAA 4QWWA 2GH1A 4BUJA 4R9SA 1GAXA 5FI5A 4X00A 5FTNA 1Q0SA 4RK5A 3KQQA 2EFEB 4Q9AA 2B21A 5C7IO 1XJ0A 3JZDA 1EX1A 4RVGA 2W70A 3U13A 2HHAA 1DAPA 2WTUA 5EJ6A 1KOGA 3JD4A 1YBMA 2CB9A 3D8RA 3GLSA 4C7BA 1L5OA 3NBZC 4ARZB 3IRUA 2YN2A 4CG2A 1U8XX 3RSHA 3BCRA 5KTPA 4XWAA 4N9WA 3DCYA 1AV6A 4PGGA 5B3AA 1OBHA 1TAHA 3SYRA 3CWZA 3R6LA 4XWGA 4A1OA 5AIBA 2FE1A 2B0CA 1UJCA 5FBWB 3NBUA 3L9XA 1VG1A 2JGDB 1BWRA 3ESRA 4A2WA 3MRSA 2G1KA 2V7GA 3ANNA 1O95D 1EFPB 4GGPA 1HDXA 1G0OA 3R9IA 2PVSA 5U4QA 4A16A 3WL3A 5I9TA 4D80A 2C9DA 1CUVA 1IONA 4ZAZA 1L7DA 4DOMA 3X1MA 1AMOA 5FHRA 4YWJA 3IE0A 1Q3TA 2QRMA 4IGIA 3JQPA 4NABA 4WN3A 3MBIA 4HADA 1VIVA 1XEXB 2HSDA 4M21A 2AFVA 3CJQA 1WLYA 1W2HA 2JGIA 3L06A 3LBFA 2ID7A 4N0PA 3FHCB 3EZGA 2ZT5A 2BM8A 3TTVA 5AVVA 4MS1B 1N2BA 4BZQA 1GP2A 4HNTA 2QRQA 5EEGA 2VDNB 1U2PA 2XTZA 2O8BA 1JLMA 1RHJA 1XLVA 1Y37A 4P98A 2JKZA 2E48A 4I4TB 3RT9A 3QRWA 3PNSA 3LYLA 3RBAA 4CV1A 1SKAA 1A7UA 4KNVA 3GFOA 3ML1A 2UZ3A 5ICEA 2DXIA 3LUPA 3ETGA 4OF4A 2R6R1 4YCLA 3CWCA 5EIBC 1T2EA 4IFIA 3TLGA 4QRDA 3EHDA 2YWGA 1XJ5A 3UJDA 4EH1A 1ZNQO 4X94A 2QE7A 4L5CA 3G13A 2G28A 4DDVA 5KQSA 3IUPA 1LZKA 5L3QB 4O4IB 2BV3A 3UJPA 4K9OA 3QUTA 4IGEA 4KQIA 5BQFA 1KYWA 2NTEA 3DEAA 2OL4A 2ST1A 3D1LA 4EUEA 2HRZA 1SCNE 1EZZA 4PX5A 2ZT6A 3UJ7A 5LC1A 3HA2A 4FU0A 5LQJA 3UHOA 3MQFA 4OH7A 3GNQA 1JTVA 1OLSB 3F2IA 3C74A 3TOCA 4UEJA 3PUYA 3SQLA 3VC2A 4HFMA 1YR3A 4FHFA 4YTEA 5FBQB 1H69A 5FNVF 1MN6A 3TCXB 1XZMA 1G64A 4C06A 4DARA 1DDOA 4G63A 1QLHA 1S3FA 2Q3EA 2WY2D 3RF6A 4AT1A 1QPBA 4R8VA 1X8JA 4CMGA 4X6XA 2EDCA 2CJPA 3NBQA 1I7PA 3KR0A 4WZBE 1A9XA 2HJGA 4NFLA 1XQ1A 4TWBA 5K3EA 4W7HA 3BBLA 4OHVA 4DZRA 3H17A 1R8QA 2SCUA 3T5BA 2QENA 3NC0C 1QUEA 1EINA 1JQ5A 3LBIA 1NJFA 5FWAA 3SEQA 1NOKA 4IUYA 5HK9A 1U1IA 3K35A 1P4SA 4FDLA 2B99A 2Z98A 3V4VB 5J1TB 2Q5OA 5JC8A 4EPRA 1YDWA 1P7YA 1J7JA 3TLJA 4HUQB 1YVRA 3ZJYA 4XQGA 3AHCA 4IL5A 4YJKA 5DBOA 5JMPA 3UCEA 2LCQA 4RSGA 1EEHA 5KWVA 3IB6A 5MDHA 1X7ZB 3OHMA 5ISMA 1GPMA 3HXKA 1W19A 2LP4Y 3PC2A 2XX3A 1HE3A 4TL7A 4O3MA 3IDZA 1WSAA 1A88A 3K9NA 3GEBA 4HLCA 4Y8VA 1ZX1A 3MGGA 5KTKA 4K1LA 1BYUA 2AYZA 4V0QA 4W9RA 1ODIA 1WKBA 2VS1A 4PSCA 3KYDA 4MV3A 4ROTA 1SIBE 3A6DA 5IVIA 3BQ9A 2XKAA 1FMFA 2G4LA 1VPEA 3QNMA 3KPJA 1EFVB 5ESRA 1JPNA 4RCVA 2YNMC 1F51E 3DZCA 1S2GA 2OK8A 3EXHB 4IIXA 4PR0A 1ICIA 3IAS6 3RJMA 3CPJB 3WISA 4MRRA 3VGJA 3D8TA 2A5LA 3O2QB 4GW3A 1R12A 2A7QA 4RIHA 4UXHA 4TZ0A 3Q0TA 3VSDA 4ESOA 1CUWA 4KJZA 5BMOA 2YC2C 1TMKA 1YOVB 4RJKA 1RTTA 1U04A 3NC1C 1NBIA 3G89A 3WTCA 4E2XA 4BQRA 2IPLA 4HS9A 4GZ5A 1AO3A 1L5YA 4BO8A 1HEIA 1CJMA 4MUNA 3WNBA 4PTLA 1ZK0A 1SVKA 4HZGA 4HRXA 5G40A 4FFBB 3VKVA 5KB3A 3RC8A 1CQXA 2CK3A 1E4EA 1MFZA 3N8DA 3RWBA 4DMRA 1FDSA 2NQ8A 1B93A 3HN6A 2HOQA 5LZ2A 4UTPA 3GAMA 3CUKA 4HGOA 4Q16A 1EE9A 1EG2A 4MDFA 1ZEJA 1FBNA 3VJRA 2A30A 4P22A 5CVJA 2Q7OE 5ABPA 3P4XA 3L0ZA 3KJZA 4A10A 3DBLA 1I8TA 1M0TA 3ORFA 5J58A 1WS6A 3KSMA 4NE2A 4NZZA 1ZGBA 2WVGA 4YP0A 3UMRA 2XMGA 2VIIA 3PNKA 1TVKB 2VA9A 3ME5A 3LVRE 1QK4A 4FFNA 4RU1A 3SJ7A 4B6RA 1BJKA 4DSUA 1KJJA 1N6PA 1UPCA 1ZJYA 3CNLA 3ETJA 4MQEA 4ZVKA 3UBTA 1KK0A 4FNGA 2H1LA 3I92A 3VZPA 3EG5A 1JR4A 3K9BA 4KQ1A 4YCJA 2JIQA 3EVEA 2HK7A 1Z2OX 4WEOA 4YAFA 5FI3A 5LQDA 2QX4A 1KI2A 4K46A 2X7JA 4TQAA 5JV5A 1QF6A 1YJQA 2QVBA 2WDZA 4ZOBA 5IVHA 5TMDA 3H0WB 4OU4A 1MJGM 2QRZA 1GG8A 5JFTA 4I50A 3VPHA 4ASUA 1DXYA 2QRVB 4N03A 2I67A 2VDWB 4EW6A 4KFUA 2EFGA 4CLQA 1TD9A 3DWIA 3I9V6 3TSWA 5EHZA 1GM5A 4J0HA 4FGWA 3NANA 4WBSA 4Y7DA 3D0RA 3QYJA 1RXCA 1O54A 1WX1A 3I6BA 4BZXA 1LTHR 1G2OA 2O19A 4P6VF 4RZUA 3D6NB 2EKPA 1J0EA 1SC4A 3BH0A 4KK3A 4YMVA 4HLUA 4RMJA 3OZWA 4O1MA 1B0UA 2XV1A 2ZVJA 4KDFA 3I9NA 3H5AA 2A0YA 3IUQA 5JAZA 3DJFA 3OC0A 4PPQA 5CLLA 1HDCA 3RSFA 4REOA 2X2FA 2C7RA 3P9SA 4DLBA 5LIRA 1A9TA 2V6IA 1QS0A 1NNEA 5JDIA 4S24A 4LHZA 3KHTA 1T8TA 4L6AA 4TV8A 1AKTA 1JS1X 1FTNA 1WW8A 3N0WA 2D1SA 2DVMA 4R8SA 4TN1A 2HPZA 3RAGA 1M2VB 3ROTA 4RLHA 2O14A 1RZRA 3CM0A 3IOCA 3ESCA 2GVDC 3LUDA 3OEWA 3R5TA 4Y6SA 3V6LA 2I22A 4PPYA 2XRFA 3D7LA 3TUTA 2FGJA 1P3DA 1SUEA 2IH5A 5IC5A 3F90A 1QKJA 4PYMA 4A8JC 1GFIA 1X1BA 3FUUA 3MCZA 1KO1A 1MRZA 3UJBA 4BFWA 4RIFA 2XCSB 2ADFA 3CZ5A 3DV0B 2A4KA 4GM0A 1SM4A 1KOLA 4B48A 5F21A 5HJ7A 1ZOLA 3QEBZ 3K2EA 2C94A 3BRSA 2GCOA 1W0KA 3H6HA 5COBA 3AVPA 2WKRA 1A2OA 1CEXA 5AP9A 2BM1A 3OQ6A 1U8ZA 3H05A 3PFKA 5IJWA 1Y3BE 2H51A 2I87A 5I9LA 2Q1UA 2KE5A 1XZAA 2PMKA 3HUUA 4IV8A 2RHGB 4IKEA 4AS2A 2OHHA 2OHJA 2LUOA 3I34X 4DJ5X 5D7NA 5A3RA 3VPSA 4NXMB 4BNKA 1U2GA 3AU8A 5DM70 2CHGA 3NBAA 1FYVA 2OT3B 4J1QA 3RIMA 3ZV4A 1U0NA 3UJ8A 4H6XA 5DNWA 3R74A 3F6RA 1YNOA 5ETJA 3BWVA 4CT0A 4DKXA 3STYA 4DWJA 1GZUA 1JSLA 4G0QA 3I3OA 3GAAA 4C04A 5DBGA 1RPZA 1N9GA 1PVDA 4F38A 4MA4A 4CYMA 4BQIA 3L0IB 4ND8A 2PGAA 3FNGA 5A4JA 3L41A 4BO2A 2MSDB 4ZYWA 5C7LO 4I2NA 4PG8A 1HKHA 1PFKA 3W4KA 2HDHA 4PC3A 3EEBA 1D2CA 1LZLA 4IHKA 3CW8X 3OCYA 1CUCA 1R6BX 2X5OA 1KO4A 3ZCPA 4CQLA 4D6PA 1FFWA 4BLVA 1X80B 4QU5A 5TDHA 3D4NA 2D5LA 2H3HA 4R8MA 1GVHA 4GQBA 3RTGA 4UM7A 2C58A 2FMFA 4CIYA 3FMFA 4KYVA 4HJRA 3JQEA 3LDFA 5C7YA 1W9HA 3E7XA 1WCIA 2C9YA 1PV2A 1UXKA 3HYNA 3I6IA 5EE0A 3T9DA 1PR0A 2GESA 1G38A 2D8AA 5ITVA 2XQVA 2DJ5A 4DJDC 2AMFA 4K2HA 4NU0A 4XB6B 4ZQHA 5DPMA 2LE0A 1VFPA 2NZYA 3EUFA 1QGUB 2H54A 3FWYA 3FR7A 5FFFA 2OFOA 1RXEA 5E7MA 4JI7B 2QZSA 2WKWA 4QOFA 1JIJA 2PUGA 3P9PA 5C5DA 1N0IA 3UT5A 5EJ7A 4DG9A 1Z4KA 2ZAMA 4PNZA 5CA1F 4OHYA 1Z13A 4Y1EA 4RTOA 4A23A 2QXUA 2CXOA 2WILA 2E49A 1J2YA 1JKFA 2AD5A 1CJVC 4MVJD 3LDAA 4NU5A 4WWHA 1UAAA 3QOYA 1U9YA 2WD8A 2NU6A 5IULC 1E1YA 4TS3A 4KUGA 5JADA 1SXGA 4JQZA 4KODA 4JLUA 2FG7C 2HPVA 3WV4A 1CPYA 4MR7B 5EXXA 4IZIA 1E69A 2WJIA 5IP5A 1AM4D 2DMRA 3KSAC 4UREA 5EGSA 3E3MA 2YDXA 4NJEB 3KWFA 1KC1A 2FXVA 3GROA 1LNZA 1GD1O 2IOHA 2W6MA 4R8RA 2GCGA 5J4VA 3GYGA 1SEVA 2XI4A 3L8DA 4OQQA 1UXJA 2C9BA 2PL5A 4GSKA 3FAZA 1TQ6A 1HT2E 2I99A 2O0JA 3GMIA 3IGFA 5T6BA 3TE6A 4B6EA 5BSTA 5BN4A 3NBMA 2FPPA 2VBGA 4HTAA 1SOAA 4V1CB 5KTYA 4YJFB 4YP6A 5HDQA 3ZXXA 3LI2A 2G70A 4G5GA 3V8BA 3H5WA 4UPEA 3A1NA 3H3JA 1CLEA 4QDTA 3L93A 1T0JB 1SOMA 4UDOA 1WW2A 2ZS7A 1QU2A 3K6RA 4R69A 2C3OA 3RV3A 4GI3A 3ZNPA 4FMPA 5H70A 5PNTA 1F8YA 3AF0A 3WY9A 1GUFA 1ADJA 3DXFA 3UOAB 4F3CA 4CEIB 3PJGA 3OE5A 5FBHA 1ZN7A 4WCFB 4KE7A 2PO5A 4H1WA 1WDKA 2BI8A 3PGLA 4HYTA 1KNQA 3DYVA 3KOYA 3OIUA 4YCSA 2BGMA 1AV7A 3F0TA 5A1JA 1PHPA 3M81A 4X8MA 1RCFA 3MUNA 3OVMA 4TZKA 1DHTA 1JIXA 3DE1X 4DQXA 2B4YA 4F7WA 4RTLA 3FA2A 3KPVA 3KYDB 5MHTA 5EJ2A 1CDZA 1OX6A 1YUBA 3QPUA 3WIBA 2RONA 1UWVA 4LDJA 4NCAA 3DOHA 1XXHE 3F4KA 4HXEB 4BVFA 4HZIA 2NV6A 2BEKA 1VLHA 2NACA 2PNJA 1UMCB 5CFPA 1QVRA 5IBCA 1U3WA 1FSFA 1RLMA 1Z74A 2A58A 1TQHA 3D0KA 1KXJA 4PS1A 2E4ZA 4O2BF 1XKTA 4OKIA 4AJ4A 4GC9A 2R97A 1SKBA 2AI1A 2X1MA 4OHUA 4YRRA 3DE7X 4ZU3A 2D2EA 1KFCB 5IYZF 3ZVRA 3MD9A 3THWB 2RB5A 2H9IA 2M1ZA 2RG7A 3R5SA 4NFSA 1GFWA 4ZI7B 3AF5A 1FW6A 3SQMA 3B1KA 4XWYA 5DGXA 4C7MA 4W5NA 1O4VA 3M6XA 3Q3HA 3GWGA 5BWLA 1RHKA 4M98A 4TTSA 5L3QA 3T7SA 1IXRC 1NPDA 1QIKA 3MINB 1DJMA 3S5JA 2OYSA 4OH1A 4JNKA 4Z1OA 4B3BA 1KJZA 3L7DA 1M2NA 2W8BA 4N3GA 3M70A 2H63A 2CFCA 3G2OA 1KVRA 4BNLA 4YAGA 1J1IA 3D6MA 3FFXA 4TYWA 1TZBA 1P9OA 1XZCA 1R0YA 3H6KA 2WUWE 3PCXA 3RNLA 3CNBA 2AMVA 6GPBA 2WJAA 2Z3WA 3IOYA 3NWPA 5F52A 2EZUA 2DRIA 2ZB2A 3BE4A 4M38A 1OI7A 4OXNA 1SWVA 2Y1FA 1ZL2A 1GL3A 4NYIQ 3B7GA 4PF1A 4EA9A 2UU9B 3QVWA 1DUVG 1PNOA 1Q0HA 3BORA 1X38A 1Y81A 3JQAD 4DIMA 1S0UA 1VL6A 4F5EA 4HNHA 4KE6A 5EKSA 4M7WA 3TSOA 1J2JA 1Z16A 1GKIA 1W30A 2VNHA 1SU8A 4KUHA 3C7TA 2XTMA 3N2GA 3ZWAA 4C0AC 3AFOA 2DULA 2EP8A 4LRUA 2JHGA 1JTFA 1FYWA 1S2NA 3NCHA 1W6RA 2RSLA 3N6RA 4PU0A 5H81A 2QMHA 3KU4A 2P91A 4CETA 1LBSA 2AVNA 1N2CE 2NSJA 3D64A 3QI2A 2XT6A 4ME6A 5A9RA 5IASA 4QKQA 1F60A 3JWHA 2ZANA 2G9VA 4JGBA 3CZPA 1U5AA 1NBWB 3KT6A 3QEMB 4AX8A 4BNJA 2WJZB 1N77A 3GVXA 4HUQA 2XAAA 4YYZA 3MG9A 2IFTA 1H93A 3P2YA 4ZQBA 3RVMA 4BAGA 4DY6A 3GN2A 3R3YA 2NU7B 1VCHA 4GIBA 1JJ7A 2ZYHA 3ZXYA 3U7GA 1NHWA 3CXUA 4Y2SA 4YECA 1DBIA 3FNHA 3JD0A 4G9GA 4MS4A 2RK6A 1IG3A 2HD4A 1NMXA 4DV3B 1OTHA 3OURA 1UBUS 3UGJA 5G0SA 3L7BA 2CB0A 1K86A 1GSOA 3LXRA 4YMUA 3OFND 4ABYA 4EHJA 5DN6A 2IP4A 4L5JA 5KVVA 5I3CA 2BC9A 1NZJA 3Q0IA 4AMZA 2NIPA 3DOOA 4QEKA 3QKTA 4U0JA 4R1LA 1UK8A 1XNGA 5LMUB 3OFVA 1CZNA 1JH8A 3FPBA 3P9NA 1GV0A 1XTKA 1IHDA 2QRVA 4DDUA 4RPHA 1OIWA 4EYGA 2C9CA 3GO4A 3LOUA 3U4CA 1UMBA 2I55A 2VK1A 2IHJA 3ZY2A 1CU1A 1R0CA 5NULA 5DTJA 5ALRA 3W8RA 1NVXQ 4OO3A 4I36A 4ZJPA 2E18A 3FCUB 2G8LA 5THXA 4ZAFA 3EC7A 2OZVA 2FI1A 3G0IA 1I1NA 1R0XA 3FOEC 2QMZA 1C9MA 5HJ5A 4L75A 1C1DA 1CY1A 3IEXA 5IVDA 1ABEA 4JC0A 4F6LA 1K5HA 1L8LA 2CVOA 1V35A 2CF5A 3CJRA 4FYIA 1FVOA 4HZUB 5JAOA 2QXYA 3BK7A 4KQJA 1VHQA 5IDVA 3EE6A 8OHMA 2GOYA 1M7GA 3QU9A 3D6AA 4RPGA 4DA0A 4R2IA 1FXWF 3AEQA 4P7JA 4RJ2A 2YWXA 2X41A 1O9GA 3EZXA 3OJCA 4G86A 4OEHA 1DHRA 4DIFA 1OBCA 2FKNA 5JYDA 1PR9A 4UUAA 4S1TA 4U2EA 3HCCA 4E31A 5CB4F 2FKAA 5KNBA 3T5AA 1NMQA 4BVBA 2XGGA 3BXPA 2WG1A 3DP7A 3PHGA 2VWQA 1JIUA 2O1SA 2E9SA </