2H63A

Crystal structure of human biliverdin reductase a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
284
Chain Sequence
MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Biliverdin reductase A
publication title Crystal Structure of Human Biliverdin Reductase A
rcsb
source organism Homo sapiens
total genus 89
structure length 284
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2h63A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2h63A01
3ZHYA 2O48X 3U62A 3DZGA 4EEZA 4DVJA 2Y1CA 4G81A 1HZJA 4KOAA 5TNXA 5KJCA 1CRWG 4GWGA 4GMFA 5CAEA 3QWFA 2HQ1A 4CL3A 4OHUA 4BNZA 2X6TA 4DTIA 1TT5B 5JO9A 1B0AA 4ZD6A 1BSVA 5A9SB 3RUAA 4NFYA 3FWZA 4WK6A 1DFGA 3RVDA 4GI2A 1YJ8A 2E82A 2X58A 1UZNA 3K31A 1T2FA 4PVDA 1X7HA 3P2YA 2HU2A 2FSSA 2CY0A 3N58A 3VDRA 2FMUA 5T57A 3RUDA 4NH4A 3F47A 3ZI0A 4BKQA 4BO9A 2PKQO 4L76A 4ND2A 4B8ZA 1R4NA 2Y05A 1JU9A 1VSVA 3L4BC 3GF4A 3GGPA 1P45A 4HV4A 1C0KA 1GZ4A 1R66A 1HTBA 5A3JA 4F6LA 3ZWVA 1NWHA 1QYVA 4MVJM 1Q0QA 4JP2A 3ENNA 3GDFA 3KLPX 4WCFA 1E7MA 2PTGA 4EBFA 1H5QA 2Y1DA 2AXQA 2DPHA 2BHLA 4YCAA 1G0NA 5CPFA 3UF0A 3FI9A 1PIWA 3GLQA 3DAPA 4DRYA 5BSHA 3AK4A 3UFXA 4BMNA 5JXWA 3GC6A 3H9GA 2UVDA 1AN9A 1H9AA 1Q7BA 1BWSA 3PHLA 3S1LA 4CQMD 3E1KA 4EUHA 3WWYA 1R6DA 5CDTA 2OZPA 5AXAA 1NFFA 3PJFA 5A5FA 1LC3A 4NU5A 1RM5A 5ILOA 1P33A 1N9GB 5TF4A 1DC3A 2GLXA 5JYEA 3VVCA 1PR9A 2VHVA 3GNSA 4AVYA 5B37A 4RDIA 2GASA 1E3WA 4FOOA 3A4VA 1ZK0A 4ALNA 4ID9A 4BV9A 2BFMA 2VHYA 4IDDA 4WGGA 4WEQA 3Q2IA 4RVFA 3JQ7B 4WJZA 1K3TA 1KEUA 3L4SO 1GYRA 3GVCA 2HK9A 3CZRA 4A03A 1E77A 1I3NA 1XEAA 4MKXA 4E5MA 4BNMA 2CDCA 1BW9A 1PEDA 4NBRA 3A06A 4HNHA 3U49A 4IINA 3OJ0A 3ABIA 2AEFA 2EEZA 5FFFA 2PWZA 2JCXA 2RH8A 3H7AA 2LDXA 5J9GA 4U0KA 1PWZA 1XR3A 1T2DA 4IUYA 5A05A 4FJ2A 4JQCA 5TS3A 1I0ZA 4UVDA 2Q22A 3WNVA 1DIHA 1UP7A 1J5PA 1SBYA 1T26A 2YHIB 2A4KA 1HDGO 3EHEA 2I9PA 1I8TA 4FJ0A 4ALMA 5JAIA 5L53A 1F12A 4YJHA 3DOCA 2W8ZA 4YAIA 4PLZA 5EL0A 5AXBA 4MVJG 4GVXA 1XG5A 1YH3A 3Q3CA 2EW8A 2G5CA 3Q6IA 4XQEA 2PGJA 1VKOA 4XGKA 4OYRA 3ZH2A 4E21A 3ZW9A 2CUKA 1Z45A 3IJPA 2HMSA 3GMDA 1PZEA 4N7RA 1AUPA 1B8PA 3HE3A 4JJGA 2D0IA 4E5PA 3GNTA 5IFLA 4ZGWA 1NBOA 3N7UA 1QXSA 3W4IA 1KETA 4QUKA 4YT8A 1XELA 3GAZA 1Z82A 3GAFA 4OKIA 1DXYA 1TT5A 1VKNA 1MC5A 5A9SA 2OO5A 4EYEA 2GCGA 1UDBA 3K92A 4RPKA 3AFMA 3N74A 4YB8A 3GZNB 4GSKA 4XJSA 3TN7A 1DRUA 4BGUA 1Z74A 1LBEA 2P4HX 5JW6A 3O26A 5A4DA 1J6UA 4U7WA 4GWKA 1HSZA 2C2YA 2PZKA 3OJEA 4QT0A 2O2SA 2P5UA 1PWXA 3QWIA 3B1FA 3O8QB 3S2GA 3SLGA 2GYYA 2GN6A 4B7XA 3NAQA 1O89A 1MUUA 2RHRA 1ISIA 2PA3A 1XSEA 4MJLA 1PJTA 5KJFA 3JD4A 4JLWA 5JO0A 1PQWA 4MKRA 1EFLA 1LUAA 4IJKA 4A26A 4N5LA 3VH4A 4LVUA 1AE1A 4XGNA 3FPCA 2J8ZA 2WDZA 2XAAA 3WMWA 5A9TA 4JBHA 3ZN2A 2TMDA 1ULUA 1ENZA 5KVSA 1YQDA 5U1PA 2X22A 1GU7A 3GPDG 3UAGA 4BB6A 2XF8A 1IZ9A 2J5KA 5I7SA 1AGNA 4E6PA 1NNUA 3A9WA 3JQ8A 1W6UA 4WLOA 4YJGA 5K6AA 1CEQA 4ITUA 4G65A 1EBFA 3F46A 3EGOA 1Q7GA 2NTVA 1DBVO 2RHCA 4DQVA 1I36A 4BO6A 3V8BA 2Q2WA 3IKTA 4J49A 3RFTA 2FR0A 5L51A 3TFOA 2X5JO 3JYOA 1R15A 1LSOA 2CMDA 5TX7A 2Y0DA 3LK7A 4JK3A 3AUAA 1DRVA 4CMKA 1GTMA 1WMBA 4OAQA 2FRDA 3DBHB 2ZYDA 3D3WB 4ND5A 5JLAA 3ZHZA 2D59A 1JWAB 3JQ7A 4ZQFA 4DYDA 3DZIA 4Z6KA 1NFQA 4HNGA 5B1YA 3GEDA 2RIRA 5IDXA 3WBFA 1GCOA 2I3GA 5JDIA 4PG6A 1XQ6A 1ENPA 1LDBA 3OIFA 1I2CA 4B3JA 1N1EA 2IZ1A 1A4UA 3GRPA 3JD3A 3ZDFA 1Y8RA 4NIMA 3RUFA 4K28A 3PQFA 1ZSYA 2SCUA 3B70A 3F5QA 1ZK1A 4L74A 5CEEA 4HKTA 3VHRA 2X9VA 3UCEA 2J5QA 1PGOA 2QYSA 4XR9A 2H6EA 2GUGA 1KIFA 4HP8A 3PJDA 4GVLA 1DLJA 4WLUA 2Q1WA 5IDWA 2FSVA 4QO8A 5JC1A 1R37A 3MTGA 4FFMA 1KVSA 3RIHA 2QQ5A 4DPMA 3EAGA 1P1KA 1D7OA 2JAHA 3BA1A 1KVTA 5I9LA 4X54A 1AXGA 1Q0LA 2G1UA 3H2SA 3PFFA 5IF3A 1NQTA 3KOUA 4H7PA 4NBUA 1DB3A 4PLVA 2Q49A 2VUTA 3PJGA 4E2WA 2OP1A 1GY8A 3T4XA 4NR0A 3JD0A 2WD7B 4GLOA 2VZ0A 1HL3A 3JCZA 4W4TA 2NACA 1EQ2A 3H2ZA 3MJVA 4FN4A 3WDSA 4UVIA 1D1SA 3B20A 1I10A 3I6IA 3V1UA 4U0JA 3GUYA 3MWDB 4I5DA 2DVMA 1Z7BA 4HFRA 2D5CA 1WAMA 4CLHA 1DC6A 1B8VA 3GZNA 2P2SA 3RU9A 1U3VA 5G4KA 2X86A 3LDHA 3DQPA 3K8ZA 4DIBA 3C3XA 4BO1A 4CM9A 2ZIZA 2PD3A 4M55A 4BO4A 3WJ7A 1NASA 2NTNA 2Q1SA 1ZXLA 3DXFA 4IZIA 2B0JA 2DT5A 3WIEA 4D3DA 3ZCXA 1PGPA 3I9MA 1C0PA 4ZRMA 2ZB8A 4GKBA 4A0SA 2LDBA 4YPOA 4LMPA 4CV3A 4RLHA 5KJEA 2X5KO 2GZ2A 5U9CA 2P9CA 4MINA 3VC7A 3HG7A 4J43A 1U4SA 3RCBA 2EKLA 4CODB 1NPTO 2NVUB 2Y99A 1OC2A 4URFA 2R2GA 1ISHA 4D3FA 5F3RA 2VWGA 3FRJA 4GKVA 1DPGA 2JJYA 4BGVA 1B15A 3AUUA 1B3RA 3EDMA 3GEMA 5JAQA 3OICA 3F4BA 3ITDA 5H81A 5L7TA 4RDHA 1HDYA 2P91A 2DUUA 4Q3EA 4TKLA 2GDZA 2HRBA 2RAFA 2QX7A 1ADFA 1LDGA 3HFGA 3KHUA 3ADOA 4QX6A 3F1KA 2AQ8A 1EDOA 1ENOA 2WD8A 3DAFA 3PK0A 1W0CA 5TC4A 5IAAA 4CM1A 2NUAA 1H0KA 3LLSA 4IIUA 2I67A 3SC6A 1CERA 3ETGA 4PG5A 1JDJA 4RVGA 5GZ6A 3WGIA 3LT1A 3OA2A 4WCFC 1GQYA 2Q2QA 3D3WA 1YL7A 1T1SA 8LDHA 1YWGO 5EERA 4CMGA 2WWRA 1DFHA 2A9FA 2HMVA 3ZWMA 3I5MA 4HBGA 4J91A 1NM5A 3DC2A 1FF9A 2W2LA 1WVGA 2Y66A 4BO3A 5B4UA 4Z0PA 1P77A 4O5OA 4E30A 2DAPA 1ZCJA 2WSBA 1N5DA 5C37A 4BNJA 3INRA 3WB9A 5DCWA 1XQ1A 1IHXA 4WLNA 5FI5A 1CWUA 1QP8A 1LSUA 2YZ7A 3GN1A 1DRWA 4R69A 4YTEA 2O3SA 4RJTA 2P5YA 1HLPA 1W8DA 1WZEA 1ZW1A 4FS3A 2FHSA 2NU7A 1MP0A 1MA0A 3FNFA 2BF7A 4N5NA 4S3MA 1IY8A 2RCYA 1P1RA 5F1KA 3D3EA 3WYEA 4A2CA 5JNLA 1DAPA 4NMHA 3GG2A 3RROA 4RCVA 1E6UA 1FDSA 4YACA 1R0SA 2J3HA 3MWEB 3ZV6A 4R3WA 3GVHA 1H9BA 4F6CA 3QSGA 1NPDA 3I6QA 1LJ8A 1ZMTA 4J7XA 4D45A 3MJ4A 1VL6A 1X7DA 3F9IA 4CMIB 3QVTA 4LRSB 4JP3A 5LCXA 3M2TA 3KM0A 5A5EA 2ZATA 3R6DA 1A7AA 3I4CA 4OM8A 4J7CA 3BAZA 4D46A 4MVJD 4B3HA 5T8KA 2AHRA 1IULA 1QV6A 5ICMA 4C4OA 1T25A 2Y67A 1IPEA 5JAMA 2BI8A 4XCVA 1X1EA 3OIDA 1OMOA 3WGQA 3SJ7A 1HZZA 1U3TA 1IZ0A 3GVXA 3WXBA 1ISMA 2PD6A 4KWHA 1BXGB 5HS4A 4B79A 3WWZA 2O23A 2GNAA 4J4BA 2VUSA 4W9NC 1H6CA 4XZ3A 4IQGA 5J23A 5HWSA 4ALKA 3E82A 4DMMA 1ZK2A 5EINA 1XA0A 1SCUA 3NDIA 3ENKA 4IDFA 2EV9A 4Y67A 1YQGA 3VDQA 5AXDA 2F1KA 2VRCD 2P9EA 4II3A 1R12A 2C2XA 1PR3A 1VL8A 3GUCA 1XU7A 3PGJA 3ASUA 3JTMA 3Q1LA 4YQYA 2NVUA 3UICA 1ZBQA 4PLFA 1LA2A 4Q3NA 2GO1A 1TVEA 1VM6A 1ZO8A 3EMKA 4AJ1A 1P44A 1GCUA 4CL8A 2I99A 5I7VA 4DL9A 3WGYA 1OBFO 1CJCA 3L0DA 1PZHA 1U28A 2X5OA 1V3VA 1QORA 4A5OA 4BGIA 4L8VA 1C0IA 3AM5A 2WYVA 3IUSA 3ZU4A 2HMWA 1ZZEA 4I5EA 4L0QA 3JQAD 4UAGA 4NDNE 5LC1A 9LDBA 3JYQA 3COSA 2YYYA 1PZFA 4BIIA 4IQ0A 1E7QA 1E7YA 5GY7A 1L1FA 1EDZA 3NT4A 3ZNNA 3WFJA 3GHYA 9LDTA 1JWBB 1YQXA 3KETA 1PU2A 3MEQA 4OH1A 5BQFA 2VHWA 3CZMA 3VAZA 1YDEA 4J6FA 4D0RA 5ENVA 3PLNA 4ZVVA 4Z0TA 1VSUA 1I32A 3F1LA 5IZ4A 4FB5A 4FPXA 3QVWA 3GN2A 5A06A 4WCDA 4BUCA 3K73O 1RJWA 2EG9A 5BSFA 4EUEA 1VPDA 4ZQHA 1F17A 4L75A 1WLYA 4OOEA 4WPGA 2PNFA 5ER6A 2Q1UA 3TQHA 4CQMB 5A9RA 3DFUA 4YDRA 1R0KA 2NM0A 3TDKA 3DOOA 3VOSA 3INTA 3R1IA 3ETDA 3FNHA 8ADHA 4RPLA 1ISGA 4CM4A 3IP1A 4BNUA 3ZWPA 1RM3A 3Q11A 1X0XA 2BGLA 2NWQA 4RQTA 1GZ6A 5CHEA 1DIRA 1V6AA 4BNKA 1U7TA 5DBFA 4JROA 3Q9UA 4DWVA 3GFBA 4Q3DA 3RWBA 1EE2A 2YY7A 3MOIA 1M67A 3AM3A 5JDIC 1M76A 3AOEA 4XDZA 1PJCA 4O63O 2QW8A 5EQFA 1Y9EA 4WEOA 3G1TA 3JQBA 4E13A 2VYND 1JVSA 3G49A 1WP4A 3U4HA 3V2GA 5JMPA 1YS4A 3M2PA 2O50A 2VWQA 3HWRA 4CMBA 4OJNA 4CM5A 1R4MB 3BMNA 2QHXA 1MB4A 4O1MA 3HUDA 4NNJA 3BZUA 2EIHA 3VTFA 4J1TA 1E3SA 1V3UA 3L6DA 5A04A 1RYDA 5KTKA 1V35A 3ZWNA 4DC0A 4E4YA 4RPJA 3ZWOA 2DTDA 1VJTA 3VZRA 4OXKA 3LF2A 1MG5A 1ADGA 1HE5A 2JKVA 3DBLA 4ZRNA 3A14A 4D42A 4DUPA 3UUWA 2WEKA 1A72A 3CH6A 4RF3A 1BVRA 2NQTA 2O3UA 1O5IA 3BHJA 4KP7A 2D1YA 4XQGA 4GX5A 1E1KA 4GGOA 3WGTA 3BYZA 1LDYA 2VNAA 3PWKA 3V5NA 2CFCA 2Z1NA 4BMSA 4YAGA 2OFPA 4FOSA 1P31A 4E3ZA 3EY4A 3RI3A 3GZ4A 4XB1A 3WGOA 1KEPA 3ICPA 4AJHA 1XLTA 1XIVA 1I33A 4MP8A 3HN7A 2Q3EA 4AJEA 1OAAA 2ZTMA 4K9DA 3U5TA 2EP5A 3DR3A 4R54A 4EW6A 4MIEA 4ZU3A 5IZCA 5DOZA 3ONEA 3P5SA 1PTJA 1GDHA 3W8DA 4EITA 3F5SA 2X23A 3ZNQA 3B6ZA 3H9QA 3KB6A 2G0TA 2GZ3A 5I7EA 2PD4A 2OMEA 1KEVA 1OFGA 4RL6A 3H65A 2EWMA 3ANLA 2VT2A 3FR8A 3F3SA 2BFOA 4RPHA 2X9GA 4JJIA 4IJUA 1KC1A 5T73A 4YBZA 4FSHA 1CYDA 5U4QA 3AUTA 4CMCA 3AM4A 1C1DA 5COAA 1Q2XA 1X7GA 5CDSA 4R1TA 3FTNA 4YR9A 4WASA 2HLPA 3KZVA 4BS9A 1EBUA 3H3FA 1BXKA 3IOYA 4BKUA 2CVQA 1VL0A 4HFNA 4MVJP 2E6UX 1FDVA 2DQ4A 3VPSA 2V65A 4BNYA 3ONDA 3GGOA 3GY0A 4YVFA 3FWNA 1TB4A 1ZJYA 2HMUA 4IY1A 3WICA 2NU9A 1K6XA 2OORA 4B8WA 3INGA 3UW3A 3PTZA 1HDRA 1J0XO 1HDXA 2FR8A 2CVOA 3DZFA 3QQPA 2ZCUA 4EI2A 3CSDA 1YBVA 1ZSVA 3T7EA 2P68A 1DEHA 4EJ0A 4LN1A 4RORA 5T67A 2A94A 4F46A 4N54A 3PHJA 4PLYA 5KWEA 4D0SA 1CQJA 4KDFA 3GMSA 1HYEA 4GX0A 1I01A 4M87A 1JAYA 1MV8A 2UYYA 3BMQA 3ITKA 4GL4A 1HYHA 3TL2A 4DGSA 2ZTLA 1PJLA 4BGEA 4UEJA 2X7HA 2O7QA 1KY5A 1LLQA 1KY4A 2NLOA 3OJOA 1PS8A 5M6DA 4RO0A 1ID1A 1YJQA 1J4AA 4J2OA 4QFCA 2W4QA 1E5QA 1EE9A 3ZGYA 1PJ3A 2WJPA 2QRLA 3QW2A 4M54A 3MTJA 5JCJA 4Y6RA 3NJ4A 1NAHA 4OMUA 3E5MA 4RLSA 1HE4A 1A71A 1DIAA 1Y5RA 1CIVA 1KERA 3FTPA 5HA5A 5EIOA 4R1NA 4YRBA 4TROA 3PZRA 3HZZA 2IZZA 2FN7A 5G2OA 3NTRA 1LDNA 2VT3A 2CZCA 2O3RA 2D2IA 1T2EA 1EEHA 1U1IA 4NHEA 4KTTE 3IQDB 2VWHA 4E0BA 1YE3A 1BHSA 4GAEA 1HDCA 3BMOB 2O4UX 3RKUA 1GYQA 1E7WA 3GPIA 3LSYA 2NU6A 4YA6A 3P2OA 3EYWA 4W9NA 2CDAA 4CMAA 2VOEA 4I9UA 4DA9A 3LLVA 1T2AA 4NFSA 3V1YA 2HRZA 5TT1A 1DOHA 3WQQA 2GRAA 2E48A 3HDQA 3K9QO 4E5YA 4FGWA 5F21A 5TSDA 2JFHA 1EUCA 2WMDA 5T8KC 3GGGA 4FJ1A 2Z5LA 3QY9A 4KWIA 1K2WA 3H4VA 1HSOA 4NBWA 1A4IA 5L7WA 5GMOA 2GSDA 2OXIA 4M8SA 2HO5A 3FD8A 4MVJI 3VZPA 3RC2A 1HT0A 1LI4A 2ZJ1A 4E5KA 2CSUA 1TEHA 4UUNA 3IIEA 5JC8A 4CMHA 1QV7A 5BNTA 4NK5A 3DONA 1E7SA 4MPDA 3ROPA 4IXWA 2J3KA 3ZWBA 3RUCA 1QG6A 1NX6A 4PLTA 1BDBA 5KKAA 3SC4A 1E6WA 1HXHA 5JBIA 3GOHA 5AOVA 2PH3A 5TT0A 1Q7CA 4FGSA 5JAZA 3H9EO 4M89A 2JL1A 4QO7A 4UVHA 1NVMB 1YGYA 3GEGA 5TJ9A 3U3XA 1LQTA 3LT0A 3NGLA 4JBIA 3GR6A 2AG5A 2X1HA 1G0OA 4M86A 2G17A 1KC3A 4L4RA 3ZV3A 5L45A 5JY1A 1M66A 3BXXA 3DDNA 5COBA 3DB2A 3PDUA 1N7HA 2FP4A 4BQRA 1MC4A 1PJSA 4AJJA 3D5TA 4CM8B 5JSFA 2YFHA 5T5QA 3W8FA 3LF1A 3FPLA 3OQ1A 2HMTA 5K6AC 3G3EA 3FNEA 4F3YA 3AUSA 3WJAA 4J1NA 5L4NA 5G0WA 3WSWA 4PG7A 1ORRA 3DMYA 4QFDA 1N9GA 2GF2A 3WFIA 5A1TA 1BDMA 4BNGA 1UP4A 4O6VA 4BO0A 3A1NA 3FCOA 3VZSA 3E8XA 4J2HA 4NJMB 4BKOA 4J1SA 1LRKA 5DN9A 1R0LA 4NJOA 5CEJA 1NWCA 2DBRA 1YXMA 2W90A 2CNBA 4CV1A 1KVQA 3GNQA 3RD5A 2C0CA 4PVCA 5B12A 5KVCA 2HJSA 3BMCB 4EGFA 3QA9A 2VCYA 3ZNOA 3VZQA 2YDYA 4R1UA 1DSSG 2O3JA 3WIDA 1Y8QB 4E2YA 2ET6A 5AXCA 2PZLA 1I2ZA 4ESOA 1E6EA 4PZDA 4I8XA 5DZSA 3CKYA 2D8AA 3W4JA 1VLLA 3QE3A 1UXHA 1VJ0A 4BO8A 4DLLA 4WOJA 1XWFA 2OUIA 2YHIA 4XX0A 4Q3AA 2ZQYA 4N18A 3OM9A 3ZU3A 2DBQA 3O38A 1K6IA 1HKUA 4AJOA 2O3QA 4UVGA 1PQPA 4XR4A 5CDUA 4BHTA 5CEFA 1KVUA 3K6JA 4GGPA 5JE8A 3TRIA 4R5MA 2I76A 2WYWA 3ZU5A 4N5MA 3E9NA 1TLTA 3AOEC 3LU1A 2FR1A 2Y0EA 5ILGA 4CV0A 4INAA 5FI3A 3GDOA 2VYVA 4WNCA 3JQBC 1C1XB 4RVHA 2IEBA 2JD2A 4W6ZA 1O94A 1U2GA 3CUKA 2NVWA 1JN0A 2ZTUA 4I1IA 3TFQA 3WLEA 2ZB3A 2VUUA 2Z95A 4JGBA 4MP6A 4XWYA 5DT9A 3ROMA 2I65A 3JSAA 4KUHA 5G0UA 4FBGA 1JKFA 2VHZA 2BI7A 4XKJA 4BO2A 2X9NA 3RASA 2Y1GA 4XYMA 5I8ZA 4D43A 1U8XX 4GX2A 4DXHA 1KYQA 4NPCA 1NVTA 1H94A 3TZKA 3WQSB 3WG9A 1GPJA 4U5QA 1H2BA 5CG1A 4J4TA 2EGGA 3EZLA 1XU9A 4IGFA 3H8VA 4IJWA 3OSUA 3O8QA 4CR6A 3KSZO 4O59O 1T24A 3BTOA 4DYVA 4RF2A 3PDJA 1Y9AA 4UVEA 3ROKA 3BIOA 1H93A 1MXFA 2BFAA 3DL2A 2PKRA 3DOJA 3TNLA 3QV1A 4CM9D 1Q0HA 3I9LA 1O0SA 4CMEA 1EZ4A 3ASVA 1FJHA 1W4ZA 2XPCA 3JD2A 4G5HA 2O2YA 5DF1A 3KTDA 5F5LA 5AYVA 1S6YA 1YB4A 1EVYA 2GR9A 2H9IA 4RF5A 3M1AA 1DIGA 4JJFA 4XEHA 4XRRA 5JPIA 4K6CA 4KMSA 4KZPA 1GL3A 1E7RA 1FK8A 1PJQA 5IZCC 4DPLA 5ADHA 1PJ4A 3CINA 2C59A 3RJ9A 3UH1A 3UHAA 3V2HA 3NTOA 2FOIA 4ND4A 4R1SA 4LSMA 3ZWAA 3ANNA 3AWDA 3DAGA 1I24A 4IS2A 4Z9XA 1H6DA 4TRJA 2B5VA 5DOVA 3JQAB 1QYCA 3LZ6A 4BNIA 3JQGB 1KS9A 2O3TA 4GSLA 4J0FA 3NKLA 3HDYA 4OOFA 3DZHA 3EZYA 2NVBA 2QYTA 5L7YA 4QSMA 5GZ1A 4MOWA 3QLJA 5H83A 3VPHA 3ST7A 1P3DA 4HUJA 5KNLA 3DBHA 4EUFA 3PHHA 1ZIDA 5T64A 2ZB7A 2J3IA 3I9OA 3DO5A 1I3KA 1YOVB 2YDXA 2RBEA 4OSOA 4D7AA 3E9QA 4TVBA 1JTVA 2JCYA 1AXEA 2VN8A 3BMCA 3OP4A 3ZWYA 5DCUA 5CFZA 2AQKA 2YUTA 4Q9NA 3EVTA 3MZ0A 5HS6A 2C5AA 4UUMA 2W2LD 1M75A 2H5LA 4L9RA 3CMMA 2Q46A 5IG2A 1YB1A 3H9UA 4P8RA 2Q4EA 2HCTA 4J16A 4Y6PA 1J49A 3TZQA 4AJKA 4R9SA 1ULSA 4S1VA 4NK4A 1N7GA 4YAJA 3UOGA 1YO6A 1E1LA 3L9XA 3K2EA 4LW8A 2AA3A 1V0JA 4RVUA 2AMFA 2DC1A 5KOIA 1DAOA 4O0LA 1A9ZA 1U5AA 4CQLB 4QXMA 1BRMA 1ISFA 4ND1A 3NRCA 2NU8A 1JKJA 4ZICA 4MKZA 1EFKA 2O4CA 3KO8A 2WD7A 5G4LA 4Q39A 3NTQA 2XOXA 4CLOB 4XQ9A 1VI2A 1MFZA 2PFGA 4XDYA 5CDYA 3DEYX 4EJ6A 4I5GA 1FMCA 1GV1A 4IDEA 4MVJH 2X8LA 3JYNA 1ML3A 1UUFA 1GAEO 2Z1MA 3DHEA 1QRRA 3AI1A 2X0RA 4Z3DA 2DTEA 1GD1O 4HFJA 1WDMA 2GGSA 5CDGA 4R4JA 2C5EA 1TT7A 1ZUD1 3PZBA 1PQUA 3WOHA 4D79A 7MDHA 4FFPA 1NR1A 3P19A 1LEHA 4PLHA 1Y5MA 4NBTA 4OGWA 5KJ6A 5KJ1A 1NQOA 4EZBA 4TSKA 3KYDB 3UCXA 5L9AA 3NGXA 1XYGA 4GPD1 3KRTA 3OBBA 2AG8A 1GEEA 3OHSX 1V3TA 4P4LA 1P0FA 1GYPA 1GEGA 3R3JA 5K9ZA 4IBOA 3HDHA 1LSJA 5T6BA 5JMWA 4ZN6A 3IUPA 1EK6A 1XGKA 4WLFA 1V9LA 3WGZA 2PGDA 2HKIA 1KVRA 3RU7A 4BVAA 2CDBA 4QQRA 4I9HA 1KBZA 3NDJA 1HRDA 4J0EA 4XYEA 1A27A 1ZFNA 4J1QA 2WM3A 4LRTB 2Q2VA 4YWJA 2V7PA 5IJZA 2EF1A 1BMDA 4MVJE 4BOYA 4NU6A 5F5NA 1HLDA 3LC7O 1P1IA 1QYDA 1YONA 1MGOA 3IMFA 4ONEA 4YT5A 2QRJA 1FDTA 1JW9B 5EPOA 3HADA 2NNLD 5FYDA 2POQX 3VTZA 1RWBA 4FC6A 3QP9A 4ZQBA 5C7IO 4ZQGA 4MO2A 1LX6A 4A10A 3KVOA 2P4QA 3GH3A 4GQAA 3F6YA 4PRLA 2OL4A 2HAEA 3WX0A 1ZKMA 1GQQA 4PLPA 1UAGA 2DPGA 1B2LA 3DHYA 5L95A 5MDHA 1Y1PA 2F00A 1SEVA 4NFHA 4FFLA 1M2WA 1SPXA 3GK3A 3ONFA 2AE1A 3IDSA 1PS9A 1M6HA 1YL5A 2PV7A 4IM7A 3GG9A 2C20A 3AI3A 1JVBA 5TRTA 1UP6A 2EHDA 5JY6A 4GMGA 4EDFA 3RC7A 4AJ2A 4WCFB 3WQRA 5JFOA 3PXXA 3PPIA 2DFDA 2YQ4A 3WSVA 1Z75A 2IRWA 1PZGA 5EN4A 3D64A 4Y98A 5KVVA 4UUOA 3GDGA 2P9GA 4TMFA 3ULKA 2NADA 3DBRB 5ITVA 1YL6A 3CEAA 2I6TA 1ADBA 1PL8A 2DBZA 4IGEA 4IZHA 2R00C 4FIZA 1NP3A 4MIYA 3KV3O 3I83A 5EQDA 2WE7A 4XIYA 3SLKA 1X1TA 1CF2O 4XB2A 4Y8VA 3SX2A 4CMIA 1SB8A 4CLXA 1ZK4A 1ZXBA 4CLOA 1UZLA 3IS3A 2AQIA 5C7LO 3PI7A 2UUPA 2VHXA 2EGHA 3TWOA 2EKPA 2C7VA 1YDWA 1MG0A 2J3JA 4H15A 3IAHA 4L4SA 1OZAA 3EC7A 3ETEA 4ZQEA 1P1FA 2CD9A 4AJNA 3AJRA 3ZW8A 3OF2A 3QVOA 1ISJA 3QIVA 2J5RA 4WOKA 4M49A 2Y93A 2HK8A 3IC5A 4A7PA 2JCVA 4A27A 4BKRA 5FWNA 1BXGA 2ZCVA 1CETA 1U9JA 4LMRA 3KYDA 4ZA2A 1P1JA 1D8AA 2NSDA 2H63A 1XDWA 5KKCA 3CMCO 3LC1O 4UEKA 3TJRA 5I8WA 2B37A 4J7UA 5BNFA 3B1KA 4HWKA 3KBOA 2DU8A 4BB5A 4AFNA 5I7FA 3I4FA 3TF5A 3E5RA 3FSRA 3IP3A 2QG4A 4GX1A 4IJVA 4J9UE 1C0LA 2FWMX 5BR7A 4TRNA 2E4AA 1SO8A 5F1OA 3VKUA 3PJEA 1IPFA 4LK3A 3RBXA 1U8FO 4RZHA 1U4OA 2XXJA 3GVIA 1PL6A 3QVSA 3C7CB 4WLEA 1SOVA 3IKVA 4PLWA 3U4CA 5K0ZA 2CVZA 4NQZA 3KYCB 5BSEA 3I52A 2C54A 5TJHA 3S8MA 2B4TO 2DFVA 3OETA 2EP7A 1B8UA 3TPCA 3JYPA 4CMEC 1GUZA 4CUKA 4I9NA 3SVTA 4A73A 3WYBA 3WBBA 3JQ6A 4DIOA 3CXRA 4W99A 3OIGA 4BL5A 1NQ5A 3E6AA 4MDHA 2JFGA 2PZMA 3E03A 2UDPA 1E3LA 3SBOA 1R16A 4OO3A 4NZ9A 2ZQZA 3PGXA 3FR7A 4W7HA 5AVOA 2VZ8A 1KEWA 4H16A 4YYZA 3LVFO 5DP1A 1GV0A 1HDZA 1PGJA 3NUGA 4XA8A 4CQMA 1X0VA 5BNIA 1BXZA 3G79A 4RV9A 1X14A 4R51A 1F0YA 3PLRA 2IODA 2YW9A 4OL9A 4B7UA 3AY6A 4CLRB 4HADA 4CR7A 1LRLA 2ILTA 2VZ9A 5IDQA 4L73A 5EJ2A 3HNPA 5TGDA 3PEFA 1E0DA 2JD1A 1A9YA 1EVJA 3I9JA 3F4LA 2BGMA 4E2ZA 1H6BA 3DBRA 4TRMA 2BKAA 4R41A 3JQ8B 4YJGB 4YRAA 1DIBA 3HB4X 4Q3BA 1VE9A 3E9MA 1E1MA 1PJBA 2V6GA 1RYEA 3OMLA 1VC2A 3KXDA 3DTYA 1NQAO 3MCVA 5LDGA 1ZH8A 1U5CA 2NQ8A 4K6FA 3VH3A 3JQFA 5CG2A 3PQDA 1X15A 3TL3A 3WR5A 2RH4A 1HYGA 4WNIA 4FDAA 3HDJA 5TLSA 2ZTVA 2YV3A 1IL0A 1IUKA 3TZHA 3AU9A 1UXIA 2X0IA 2HDHA 3ZZNA 5KVQA 3RQSA 4UULA 1GADO 1R4MA 4P38A 2C29D 1O9BA 3R3SA 2GN9A 3CPSA 1SB9A 3RFXA 3VPFA 2FZWA 1Y81A 3QWBA 2OHXA 3ZWCA 1VRWA 1CQIA 4R5HA 1JLLA 5JCJD 1ZK3A 2W2KB 2BFPA 1HF3A 2IXBA 1I3MA 2E49A 1Y8RB 4IIVA 4PZCA 1N1GA 4E5NA 3D7LA 3S2FA 2OP0A 2DLDA 1LDEA 4LGVA 4ILKA 4TRRA 2AEJA 3ROQA 1Z7EA 3PIDA 4H3VA 1QR6A 2NTJA 3GHHA 5EMHA 4YJFB 1E1NA 1D3AA 3HB5X 3RBZA 1DLIA 4AJIA 1Y6JA 3HFSA 4FD3A 4U6SA 4M1QA 3WTBA 3ON5A 3C85A 1D4FA 1RM0A 1WNTA 1OC4A 1PX0A 2HK7A 1HEUA 1DJNA 3PYMA 4U8GA 2Y0CA 1F8GA 2ZYAA 1K0UA 4JBGA 2ZYGA 4GH5A 1P74A 4XIJA 5I9MA 2WTBA 2OGUA 2GN4A 1L7DA 2C82A 2C07A 3O4RA 4XRGA 5HM8A 5EESA 1SC6A 4MVJF 1NYTA 1A5ZA 2C7GA 3DZKA 3KYCA 1LSSA 4AJ4A 4CJXA 3C24A 3MJSA 4E32A 2NV6A 3CTMA 1NR7A 4QECA 1ZMOA 1K6JA 3FBGA 2JD0A 3T7CA 4YEDA 2W98A 4HXYA 4C7KA 2BELA 3KEQA 5DP2A 1FXSA 3GVPA 3K96A 4Y6SA 4DMLA 4IXTA 5A03A 4KQWA 5HTOA 4PRKA 5B4VA 1XCBA 3C7AA 1UXGA 3H9JA 5G4KB 1DJQA 4R68A 5DNAA 4BMVA 4FFRA 3SXPA 2BD0A 4BV8A 4W7IA 4CM3A 3BTUA 2I5PO 2IDZA 1BG6A 1ONNA 2IZ0A 4BKPA 5IXYA 3CE6A 5HRUA 4OQYA 2DUWA 2H1SA 3AOGA 5THQA 3WS7A 3QJ5A 1SNYA 4PLCA 2FY8A 3DZBA 4HFMA 4PLGA 3UVEA 2BMAA 2YFQA 4ALLA 4HX5A 2IYOA 4DLBA 3LC2O 4WUVA 4DQUA 4PZEA 4RPGA 4BNWA 3NYWA 1O95A 3AW9A 3RUHA 4R01A 3NT2A 4ROSA 3AU8A 4KDEA 5DDIP 4PG8A 2HJRA 2A35A 3FN4A 4CLRA 3O9ZA 3NEPX 4R16A 2HSDA 1T4DA 3JD1A 4E2XA 5C7OO 4NG5A 2GN8A 1YBAA 3DZJA 4IDCA 4XJTA 3OH8A 4ND3A 2BLLA 2BH9A 1E3IA 2PH5A 3W1VA 1XKQA 2FPIA 3PHGA 2R00A 2QZ9A 1SAYA 4J90A 5LDHA 4TWRA 5IN5A 2JHGA 5L40A 1RKXA 1QYXA 1NHGA 3GQVA 5L4LA 2WYUA 1LNQA 3RKRA 5HBRA 2EKQA 2G82A 3BHMA 3ZNPA 4BNLA 1ENYA 3HJAA 1K5HA 1Z6ZA 5G0TA 3WMXA 1IB6A 3S2EA 4MIOA 3VH2A 1WMAA 3OJLA 3DTTA 3OEWA 3TOXA 3W4KA 3JYLA 3GFGA 2I66A 3OECA 4XGIA 1JAXA 1PGNA 4B7CA 4IQ8A 4IDAA 3OQ6A 5A02A 4CM7A 6LDHA 3JV7A 4TQGA 4D41A 1YRLA 2R6JA 2OOSA 2W2KA 3BMOA 4BNTA 1SZJG 4BO5A 3H5AA 4BNNA 4II2A 1T4BA 1GPDG 2VWPA 1PJ2A 1LDMA 3OJFA 5BSGA 5DULA 4F45A 2VOJA 3WGHA 4B4WA 5A3VA 2B83A 5JDCA 1B16A 4YT4A 4FC7A 1LLCA 3JQDA 3JQ9C 2PZJA 3MJTA 4OIMA 1GR0A 1E3JA 1NTOA 1BVUA 4YJFA 1TI7A 4KUEA 1WXDA 3KLMX 2PR2A 1GZ3A 3RC9A 4G2NA 3QWAA 3EVNA 3HN2A 3HSKA 5JCXA 1MX3A 4CPDA 5DBGA 2IYPA 3OQBA 1JQBA 3X2FA 2Y1OA 4C7JA 4CUJA 1QKIA 4DQXA 5ER9A 5THKA 4TVOA 4K1LA 2VYVD 4U6QA 4JX8A 3RC1A 1SOWA 1UR5A 3BHIA 3QHAA 1A7KA 1EK5A 4RZIA 1EVZA 3FHLA 1GUYA 3UKOA 1O6ZA 3PIIA 4P22A 1UZMA 1B7GO 3HQ4O 2TMGA 4IS3A 4YAEA 4E31A 5B4TA 2AE2A 2G76A 4OXNA 2GPTA 1N92A 1E92A 3O03A 4LSWA 1EVIA 1WDKA 4NI5A 3LYLA 2Q4BA 3FNGA 3DMTC 4LISA 5CPBA 4J9VA 2GD1O 5I9NA 1NHWA 4LVCA 5FEUA 2V6MA 4PCVA 5DBIA 4AL4A 3T4EA 3K2BA 5JYFA 3H6KA 2X4GA 3MOGA 3MJEA 1UDCA 2HUNA 1ZNQO 3AI2A 3H5RA 4R9RA 4CV2A 2YV1A 3PP8A 3HHPA 3DBVO 1M6WA 2VTDA 3OFSA 4IMRA 2DTXA 3S2IA 1Q1NA 3BTVA 4YAKA 3EK2A 2XXBA 3AY3A 5FF9A 3L4BA 1DO8A 5BT9A 2VTEA 4DBVO 1N8KA 1U3UA 1KOLA 2YQ5A 4CM8A 3Q9NA 1B14A 3E18A 3G1UA 5AQ1A 1ZSNA 2DM6A 1JA9A 1DHRA 3P7MA 4Y9DA 1TXGA 3I9NA 5G0VA 4AICA 4BNFA 3VH1A 4DREA 3PWSA 4JIGA 1UXJA 3C1OA 1WZIA 3GT0A 3VKVA 2PGLA 1V8BA 3U4DA 1HETA 3NT5A 1SEPA 3RAJA 3B1JA 3KUXA 1F8FA 1DC4A 3OA0A 1GUFA 4FCCA 3ANMA 1PS0A 2EJVA 4PN3A 2IEDA 4BQPA 2VNSA 4DPKA 4NJMA 3WYCA 4ZJUA 1K89A 3L9WA 3D4OA 3NDRA 3SJUA 3KSUA 1EUDA 4UUPA 3QVXA 2VRBA 2YJZA 2PK3A 2Y1EA 1IYZA 5C5IA 2A92A 3TOZA 3WLFA 4TZKA 5L3ZA 1E5LA 4AJPA 2CF6A 1NPYA 3IJRA 5TQVA 2UUOA 2EJWA 1N2SA 2B36A 2O7SA 3E48A 4JCOA 3I1JA 1QSGA 1Y8QA 3STHA 1BTOA 5COQA 1I5RA 3IL2A 3RFVA 1I3LA 3I3OA 4JNKA 2D3TA 2V6BA 3AFNA 1UJMA 2YV2A 3ZHBA 3K30A 3KYBA 3TZ6A 1MFPA 1IOLA 3DWFA 1LLUA 1ZEMA 1BGVA 3H3JA 1NAIA 4ALJA 4FFNA 1IHYA 1UDAA 3C1AA 1EQUA 3NJ8A 2J6IA 3UN1A 3C8MA 2PKQP 2GERA 3ICCA 3QRWA 1NVGA 3GRKA 1E3EA 2B4QA 1TA4A 3FBTA 1B3BA 1CDOA 4R3NA 3JQFC 4K26A 1ONOA 1DHTA 1C1XA 1HWYA 1OI7A 2EW2A 2DKNA 4CM4B 1YB5A 2ZK7A 3K5PA 4PIVA 5F1PA 4GLLA 3WGGA 3PRJA 4XYBA 5KIAA 4DLAA 3M6IA 1LTHR 1HDOA 2AEMA 3NX4A 1G1AA 4B3IA 3JQCA 4GBJA 3U9LA 2EERA 3MJCA 2BRUA 1EUZA 1LLDA 3C1TA 3ZV5A 3LT2A 4OKNA 2QIOA 1UAYA 1ZVMA 4WE3A 5IDYA 3ZWXA 3D4PA 4MVJA 1QMGA 2AQHA 3D1LA 3A28A 5KCZA 1LU9A 3EUWA 4AJLA 4B4UA 4LCEA 4DC1A 4QTZA 3RUEA 5JS6A 2DBVO 3L6OO 1DC5A 2Q1TA 4FR5A 3KSDO 5ENDA 3ZWWA 1SMKA 4I08A 1LRJA 3TSCA 1I2BA 4XYGA 3RSHA 4YJDA 5H82A 2Y1FA 2Q50A 3BMNB 2OBYA 4AG3A 2Q99A 3C7DB 1F06A 3PQEA 4BNXA 2B69A 4CM6A 4JN6B 4KUGA 3X2EA 3ADPA 4CUZA 3I23A 1RPNA 7ADHA 1U3WA 1MXHA 3U4IA 4P4NA 4BNHA 1NXQA 2B5WA 3Q0EA 2VRCA 4W82A 1QYWA 4XQCA 4UEOA 5GZ3A 4OSPA 1GFSA 3DBLB 2D5AA 3VPXA 5DCYA 4L4XA 4J4HA 3ZV4A 3S55A 5L4SA 3BTSA 4HY3A 1YKFA 2OBNA 5JYAA 3R0IA 4WECA 5IN4A 2ZB4A 2VQ3A 5MGBA 1HE3A 1RM4A 1F14A 2JAPA 3JQEA 3LT4A 3CIFA 4TZTA 4OQZA 2QZZA 4LCJA 1WW8A 1T1RA 3JQAA 4RGBA 3JQGA 3W8EA 2D4AA 2FPPA 3LQFA 1G6KA 1XHLA 2JFFA 4Q3CA 1ZJZA 4YRDA 2CF5A 2PLAA 4XD2A 1AHIA 5CP8A 4EEXA 3DHNA 6ADHA 1I30A 3G17A 3D5QA 3L77A 4KQXA 4RVDA 1PL7A 2I3AA 3PWZA 3D4NA 2IXAA 3PFWO 1ADCA 1JKIA 3NV9A 4EJMA 4Z9YA 3ZU2A 4IMPA 4PGFA 3U09A 3EW7A 4Z9FA 1YOVA 1PGQA 3PYLA 1R4NB 2BGKA 2PY6A 4WLVA 3RJ5A 5ITWA 1IE3A 2UAGA 1P0CA 1WPQA 2X0JA 4PG4A 1FDWA 3RBVA 4E33A 1P9LA 3KEOA 3TZCA 4Z3KA 1O8CA 2UV8A 1AHHA 4CLEA 1C1DB 3PYXA 2FZEA 1Z73A 5ICSA 4YQZA 5C3MA 3UCFA 1H2HA 4CR8A 2Q45A 3DFZA 1UH5A 3U0BA 4IDBA 2B4RO 1NFRA 3WNQA 2FPGA 1LQUA 1PSDA 1YVEI 4WKGA 1QLHA 5TIIA 1ARZA 1S7CA 4FW8A 4PFJA 4ZHSA 1U2DA 4D3SA 1L7EA 4RF4A 1T2CA 1P1HA 2B35A 1YBMA 3FF4A 3M1LA 3PVZA 2EXXA 2IE0A 1Y7TA 2ZKLA 4CQLA 1DDOA 3L07A 3QWHA 1HE2A 2E37A 1OOEA 3W6ZA 1WWKA 2QRKA 3W6UA 4DBZA 1DFIA 3JQ9A 1EMDA 5IXSA 1ONPA 3PHIA 3VVBA 1E3WB 2VYNA 3UGKA 1B26A 2GZ1A 3RUIA 3WTCA 2V6FA 3AY7A 2AW5A 4TKMA 4J3FA 1UXKA 4Z0HO 3BMQB 4OXYA 4FQ8A 4DIFA 3UXYA 1VJ1A 3SEFA 1C14A 3ZHXA 1X13A 3I9KA 1W73A 4D44A 3V2UA 5ES3A 4ALIA 3ORFA 4I5FA 4QEDA 4IPTA 2JHFA 4B4VA 1BW9B 4MP3A 3H5NA 1LXCA 2ZJ0A 4NBVA 4BNVA 5G0SA 5JDCC 3V1TC 3G0OA 1FDUA 1QLJA 3D0OA 4E12A 1ZEJA 1H6AA 4P4GA 1WDLA 3DMTA 4RVSA 1LC0A 4RQUA 4BO7A 5JYDA 3OEYA 1D1TA 3GA0A 4KTVE 2WE8A 4CMJA 4CLDA 4FFOA 3Q2KA 4UREA 4YJHB 3L6EA 4IDGA 1GQ2A 1U7HA 1MLDA 4YXFA 2YHUA 4B4OA 3VPGA 2Y68A 4XYLA 1C3VA 2X0NA 4JXKA 4YT2A
chains in the Genus database with same CATH superfamily
2GJ8A 3HBNA 3DZGA 2VFAA 3T0IA 5KX5F 3JASA 2OQRA 2DPMA 4U63A 2ERCA 2Y1CA 1B1CA 3I8XA 3MS7A 4FU0A 5ALZA 3UHOA 3QLUC 3WNCA 4LOLA 4JI0B 3I53A 4WQMA 1X7XB 5TNXA 3ZZ1A 4KMMA 2WC1A 1JQAA 1NMYA 1Z2PX 1O77A 3QWFA 1XNRB 4XJXA 4N3CA 1UBMS 1O6CA 4PPQA 3TEJA 3TBFA 1OXTA 3FPSA 1DAFA 1TT5B 1B0AA 1TX4B 1BSVA 2AR9A 4QYWA 3FUCA 4XVRA 1RADA 4ZHQA 4I55B 1CUHA 2QQEA 4RQAA 2CXPA 4LJ7A 4RS3A 4JLUA 2E82A 5CM8B 2X58A 3OO0A 3P2YA 4HLDA 2HEIA 3LNCA 2EDCA 2ZUSA 3CRRA 4DMHA 1KIAA 2H2IA 3RUDA 1Q20A 2PKQO 1IVYA 2PSEA 4ND2A 1K8XB 2P9TA 2QLTA 5HKLA 5K3DA 4QUDA 3L4BC 4CF6A 1QRSA 2EFCB 3H0EA 1OROA 3GGPA 1JIKA 4CFSA 2CDNA 1M2VA 3VGPA 1RKVA 2LGJA 4MR9A 2F1RA 4DZTA 4YUYA 2XDWA 5KQLA 2QRVA 5DB4A 2PVPA 1W4RA 4LDRA 2ZRIA 4Z4HA 1Z2AA 3NOXA 3U7FB 4QWWA 4UNQA 2J3QA 3CPJB 5C52B 5NULA 2XJ9A 1DBRA 1O2DA 4GBGA 3GDFA 4FONA 2IP4A 3FJYA 3OQVA 5FTWA 2XHZA 2IV3A 2XLBA 2A7XA 1LGYA 4A0HA 2BHLA 1Z62A 2MSDB 1P2TA 5BN1A 1P6QA 2AOTA 1QH0A 3FI9A 3GJ5A 3EQ6A 5H0IA 1OPRA 2ADMA 3K4HA 3RGGA 3UFXA 4X3CA 4BMNA 3GC6A 5LXTA 1FFYA 5EY5B 1H9AA 2DEUA 1LPPA 1BWSA 3L7IA 1KAGA 3WGNA 3PHLA 4JJ7A 4NCHA 3E1KA 3RARA 4M22A 1YFKA 3Q0TA 5AXAA 5T4BA 3X3HA 3R7LA 5IWAB 3AR2A 4LXXA 4MX8A 2ZI9A 3IHLA 4NU5A 5ILOA 1P33A 1DNPA 1ZOLA 5BSTA 3N1UA 4CN8A 2JPDA 2QD5A 1MJHA 5FOTA 4RYLA 3VVCA 1HT3A 3H87A 4AVYA 2DKOA 5D2CA 1V5IA 5JSZA 9ABPA 1ZK0A 3BH7A 2B1QA 5BSRA 3QKUA 4IDDA 1DE0A 1V39A 3Q2IA 1OASA 1NM5C 2ID9A 4L8WB 1J8QA 4CW7A 1Y6FA 2ASEA 4YH1A 1GSAA 4P4SA 1QCYA 2WM2A 3S4YA 1C9NA 1ES9A 5B6PA 2HK9A 2J7KA 1OT3A 4A03A 1I3NA 3LMKA 3RVJA 4EYQA 2QD2A 4N8DA 1CQPA 5CW1A 2B2CA 4ZOAA 2J4CA 4PQYA 1SKAA 4D42A 2BPOA 4HNHA 3U49A 3V1KA 1XN1A 1GPH1 1T5IA 4B09A 4KC0A 3ABIA 1C8VB 1J22A 2AEFA 2BIFA 3DZ8A 3M4XA 3UWSA 5F7OA 3UUEA 4F8YA 3V42A 2C5GA 1EH5A 3P9ZA 2X1VA 4U0KA 3D8HA 4FEEA 5B7QA 3ET4A 3KHKA 4QG3A 4G1BA 4IFEA 1XR3A 1T2DA 2W6JD 1VOTA 4JQCA 1N0UA 1W0KA 4RHEA 4TTRA 1UFKA 5LB2A 1DIHA 1UP7A 1T26A 3BZBA 4OGKA 4AMZA 3EHEA 4FJ0A 4URHA 2I9PA 4ALMA 4F4DA 1LNZA 1KY3A 2WWGA 5L53A 2EYUA 1XRLA 3IP7A 3NTUA 4M8KA 4RHYA 5AI4A 1DKUA 4REMA 4PLZA 5EL0A 4KR0A 3GJ0A 1ZD9A 5AXBA 3WGKA 4EHHA 5IM4A 1Z06A 3GLHE 1XG5A 1YH3A 1CZKA 1E64A 2G5CA 2J4FA 2CCKA 2RDMA 3Q6IA 1VKOA 4J0DA 4E21A 5KREA 1ZPDA 4OA5A 3RANA 3ZW9A 3GMDA 2HMSA 5B7NA 1PZEA 1C9YA 1E4EB 2GJKA 6CHYA 2ZSJA 3HTXA 4HB2A 1UM9A 2OAQ1 2XGGA 5U4XA 3GNTA 3ZBTA 2JRLA 3ILSA 3O31A 4EG5A 3KFLA 4ZV4A 5IAOA 1WHSB 4HX9A 4E51A 2AK2A 1WB5A 4ZGWA 1QXSA 2EJCA 2X0KA 3QFCA 2G9ZA 3VNQA 1Z82A 4PX5A 1BDJA 4OKIA 2A4MA 5DNYB 4L4ZA 1EX9A 2UZ1B 4KVGA 1HH4A 1UPUA 4NF2A 1NC3A 1RZ3A 2AH5A 2X8AA 3EIOA 4KK3A 1HM5A 3DD1A 4XTRA 5CNMA 5EP1A 4R31A 1A95A 1RHQA 3AFMA 4RPKA 1Y7PA 2MINA 3NP7A 4MGZR 4Q05A 3SXUB 1D0SA 2W2OA 2P4HX 3Q98A 5ANRB 1W59A 4TKVB 4U3JA 5JSKA 4QT0A 1S8AA 5ALKA 1QVWA 4FHFA 5J1SB 4LC1A 2VDOB 1IM5A 1L5ZA 3B1FA 4BTLA 4CKXA 1Y6GA 2GYYA 4I2NA 1OGJA 3R7BA 3NAQA 5EUQB 5NLLA 2PA3A 1JZTA 1R6UA 2BF4A 4BZWA 1H2FA 1FMTA 3F6CA 4B3RB 1P7CA 2B4YA 3NUQA 4RYDA 4MKRA 3WWDA 5JO0A 1J5EB 2GLTA 1EFLA 4B3TB 4B46A 5SYAA 5JROA 3UWOA 2VDRB 1THTA 4XGNA 2J8ZA 2XAAA 3VX4A 5IEJA 3HJCA 4FHDA 1VSTA 2X15A 4M0MA 3U2QA 2UZ0A 3BGVA 4D9BA 2AG0A 5A9TA 2ZRLA 1PQ4A 2GO7A 4L8YA 1PKXA 1K8QA 1ULUA 4QVGA 2IF0A 5JSZB 3BCHA 5U1PA 3N2IA 3JQRA 5I47A 2X22A 1FLNA 3GPDG 1H8ED 4A0GA 3CR8A 4RZUA 2V7QA 1WF6A 1IZ9A 3Q9SA 1FIUA 2QZJA 1T9KA 1KH1A 4C88A 4RMNA 3IURA 4EFLA 1CEQA 4ITUA 1EBFA 1MVOA 2B3DA 2WYIA 2JGKA 3KUKA 2BSQA 4D6YA 1Q7GA 1OV6A 2NYVA 4WXYB 4LHYA 4OQLA 1UKVY 3HP1A 3SEAA 1VBFA 3U9SA 5CB4F 5LP6B 2QZ4A 2ODWA 3IKTA 1WD7A 1XA4A 2FR0A 3VPBA 3CO0S 4GOMD 3TFOA 2X5JO 1R15A 5HCUA 3MUEA 5TX7A 3EZNA 4ZMRA 4CKCB 3JPYA 3LK7A 3PDIB 2A78A 3AUAA 4EY3A 1SVKA 4CMKA 1ZNYA 4OAQA 3ZHZA 4ND5A 3L7MA 1TW2A 2PBFA 3WK4A 4A8PA 1JWAB 3TOCA 3JQ7A 1VLMA 1TK9A 2P67A 2R8XA 2ZPUA 1DX4A 5ALIA 3TTYA 4EYGA 1JR3E 3DZIA 2YNMD 1JEJA 1ZBDA 1PFYA 3JAKB 4XSHA 3WBFA 1PLJA 1UJCA 4PCAA 3EX7C 1ENPA 1LDBA 3AHHA 4DKJA 1CEEA 2QTZA 1BYIA 2WY2D 1VKJA 1O6GA 3G02A 4NPAA 3Q6MA 4H0NA 5L6MB 1FP4B 5K45A 4NIMA 1A9PA 3JARB 4YP5A 5JXJA 3D2CA 4K28A 2YZMA 3PQFA 4AZWA 3ZBUA 5AVKA 2FSFA 4NX2A 2AMVA 3DKVA 5IJ9A 3VHRA 2AN4A 5K0FA 1XZLA 3PFCA 1PGOA 2QYSA 1EVKA 4AO6A 4GRAA 2GUGA 3KQMA 4HP8A 5GVRA 5TEVA 5D1NA 3PJDA 2HDWA 2O8NA 2Q9BA 3CLSC 5B5SA 4MYUA 1O9HA 3OQIA 4GEKA 4B2IA 4BLUA 5E2AA 2WU8A 4QLBA 4BGDA 1XXHE 4EHLA 5JC1A 1R37A 3MTGA 3VBEA 3A4LA 4FFMA 1SCNE 3L7JA 4DPMA 2VJPA 1N1MA 3EAGA 1V8PA 3K0CA 1P1KA 3C1UA 1D7OA 2JAHA 1R8QA 1V4NA 3D6NB 3KR2A 1CUVA 4NTZA 4R2IA 1KVTA 3EVAA 3V7FA 5D3MB 4AC9A 4J75A 2NU8B 4IICA 5J4LA 1NQTA 2XDYA 3KOUA 4H7PA 3CLRD 4E2WA 2P9ZA 2OP1A 1GY8A 2KJQA 4I3GA 3OIVA 1F0PA 4LMBA 2WD7B 2VZ0A 3ELUA 4Y2HA 4F06A 3CNQS 2WBLC 5BWLA 1EQ2A 3MJVA 3S5UA 3NGMA 4PWZA 3EMVA 3UJAA 2QQFA 2MOKA 3DCNA 3Q4GA 2X7XA 5FNVB 2BKEA 1SC9A 4HJXA 1I10A 3I6IA 1YS2X 3SG0A 2BONA 3GUYA 3KVNA 3UT5B 1M1ZA 2HYDA 1DXQA 4A8JC 1PNVA 1OIWA 3O8DA 1MQ8B 1Z7BA 4K9NA 3BREA 1V4BA 3OU7A 2ZQ5A 4HFRA 4N41A 1DC6A 1RP1A 3ZXYA 5A7GA 4QYSA 1GN8A 2AJCA 4JUIA 4DIBA 2QPTA 4MR8B 4BO1A 5HZKA 1Z8NA 1OWOA 2YXEA 4LZNA 4ZWNA 5I4CA 1CC1S 1A3CA 2G08A 2HQBA 2VHEA 3A1SA 2DOKA 4DCPA 3L1UA 4M76B 4KSCA 1BKSB 4HN2A 2NTNA 3WJ7A 4IZIA 2JJ1A 3L6CA 2H1OA 2RH9B 4QJ5A 2CLMB 1JYEA 3GFRA 5DNDA 4YREA 1JHRA 1ODIA 2OGWA 2H1IA 4GKBA 2LDBA 2R9VA 1X19A 4M9XA 1NN1A 4MROA 1SKMA 1VPWA 5DH9A 2X5KO 3N2NA 3COZA 1KYZA 3CISA 5CFMA 1MO5A 1T1IA 2ZT6A 3R6LA 4M7RA 3VC7A 4V3CA 3VNAA 3PR3A 5CLLA 4IIEA 1NPTO 2NVUB 2RGDA 1GA4A 1ECJA 1K97A 1P17A 2JJQA 3ISTA 1KK0A 5F3RA 2VWGA 1L7VC 5BSMA 2PE5A 5YASA 4BGVA 1B15A 3LD9A 5B58C 3H9CA 4LDJA 4DT1A 5C8YA 3AO0B 2IHKA 5SZKB 4B6GA 1W4LA 2FPNA 1ISSA 2PFSA 4RDHA 1HDYA 1W1UA 2R7AA 3NHZA 3QE4A 3VNBA 3X1YA 1NVEA 1JHAA 2VPWA 3AHJA 3KHUA 3ADOA 4QX6A 5AJVB 1QIMA 4RTMA 1K27A 5AW4A 2I6GA 3AILA 3DAFA 4A8HA 1W0CA 3QEMA 3QGMA 5IAAA 3WL5A 5JSQA 3NKVA 3T5TA 4F38A 3SC6A 3T7SA 5IBPA 4RK6A 3ETGA 4TMZA 1PNQA 621PA 2ZIAA 4TKUB 2NT3A 2VNHA 4KGZA 4YRZA 5EHGA 4EGAA 3K3PA 1B8OA 5GZ6A 3H2YA 3OA2A 3R3XA 3VI4B 4CIWA 4HQRA 3CWQA 3OPNA 3QXHA 1ESCA 4UBOA 3LX4A 4KR3A 5WRFA 1DFHA 2HMVA 5IANA 3B89A 1A0OA 3ZWMA 5LVAA 2XE6A 3DC2A 1FF9A 2W2LA 3E2IA 3IMKA 2WP8J 4OPMA 3RTAA 5ERXA 2RD2A 2GZSA 3I01A 5E3HA 4YRQA 1UT5A 4E7OA 3BERA 2PFKA 1M1NB 3BILA 1ZONA 4ZO6A 4QM6A 2HLDA 3KQPA 3IIIA 2AFHE 1ZCJA 1DS6A 2OKGA 2WSBA 3TMKA 3VX3A 4M9QA 1FFBA 2I87A 5CT6A 5C4GB 4BP3A 5DCWA 4WXRA 5AM1A 1XQ1A 2F9LA 4TTTS 4WLNA 3NYIA 1P5FA 2LPMA 3QBEA 3F7NA 3H1TA 5FI5A 1L5KA 2O0LA 3HCEA 3QFSA 2TRSB 1GGEA 5LUAA 2FG6C 1EBBA 1P4JA 1H4VB 2Q28A 3KOZA 4HAXA 4YTEA 3ODGA 2FJ0A 1WZEA 1VHWA 3QNMA 4FS3A 3MT9A 5KVVA 1JKMA 2FHSA 2NU7A 2HMAA 4BV3A 1MA0A 1ZC3A 1KXJA 1SA0A 3FNFA 2GD2A 1Y37A 4FQ5A 4OHKA 4UBJA 2E89A 5D86A 3T1VA 5EHIA 3CY6A 4EARA 5IYZB 2C4UA 1EA7A 4PPFA 2AHOA 1XRRA 5F1KA 2KX7A 1Z6XA 2RKBA 1YQEA 3BFXA 3D3EA 4Q1AA 3V8EA 5FOXA 5AK6A 2ZBQA 2QD4A 1L5HA 1DAPA 1JTEA 4LXYA 2R7NA 3TLZA 1B93A 2GZRA 2RG1A 1BE8A 4U7JA 5F51A 4YACA 2R8EA 3UT6A 3IBFA 2FSUA 2MYNA 3I92A 1H9BA 4HK4A 4PEVA 4WNAA 4ZEXA 1VMDA 3I6QA 4NCAA 2CCGA 1ZMTA 4J7XA 2A0XA 4BLRA 5AVYA 3TTXA 2HFKA 4D8WA 2ATCA 2V8OA 3W2TA 4DIEA 2BKXA 3KM0A 1U2ZA 1WLSA 2BMJA 2ZATA 3I4CA 3R6DA 4OM8A 4IIJB 1FRQA 4YJ2F 2PUTA 3WOVA 1WUTA 2HCJB 4AUMA 4D46A 4MVJD 3K6SB 1Q0PA 3STXA 3GLUA 1F5SA 2AHRA 2CK3D 3FWYA 4W1SA 5F7JA 4RZ2A 4F4HA 2OPHA 3GJSA 4TS1A 3SS8A 1XE3A 2VO1A 1S9HA 5K3EA 5AIBA 4EG3A 5JAMA 4XCVA 1QWOA 3PNVA 1RFLA 1F4PA 4TYQA 1MHPA 1UBEA 4N6NA 5E3IA 1TUEA 3MMSA 5HS4A 2WTNA 1X1DA 1DT3A 3WWZA 3GJQA 2FZ4A 1NV9A 2QAGA 5DE3A 3WWOA 4TTPA 5J4KA 4XZ3A 4IQGA 4MDYA 1UODA 3VUFA 2QUHA 4NZOA 3A3KA 2NV0A 1RQRA 2VCHA 1UBLS 4PYMA 3BE5A 3ENKA 4Y67A 3AESA 4YXWA 3V8MA 4C9BA 4ZKDA 4MW1A 1D6NA 4II3A 4KPUA 1R12A 2OBLA 2C2XA 3LXRA 1XHEA 3BWEA 3ORYA 4QYIA 3GUCA 4QATA 3WK6A 5BN4A 4ZXPA 1V5WA 3ZBQA 3HJHA 2B9EA 3OPYA 1JR2A 1ZBQA 3ZGNA 2LNDA 3HCAA 4LJ4A 4PLFA 3W2EA 4WL0A 1S2MA 1KBQA 2ECQA 4Q3NA 3ISJA 5TPWA 1TVEA 3QELA 4KVFA 2EG5A 1P44A 1OX4B 3MVEA 5I7VA 1Z0KA 3O92A 3TXAA 4JITA 2ATEA 1BEZA 3QIAA 1V3VA 2W22A 1QTQA 4ZJYA 3D54D 1P2GA 5AK3A 4G5YA 3QTTA 3T34A 3I6ZA 3AM5A 2OLJA 3REFA 3EJ6A 1R0WA 3SNHA 5LC1A 4L0QA 3ZE9A 4NDNE 5EP3A 3U60B 3JYQA 5I48A 3COSA 2ZM5A 3H6GA 3K09A 4IQ0A 1E7QA 4AXBA 1TJ4A 4RMHA 2Q9AA 4PTLA 2NO0A 3NT4A 3CRZA 1H5NA 2WTXA 3CS3A 1DXHA 2PG3A 4DANA 2W9XA 1GFZA 1XNGA 3EXG2 2C7QA 3SHVA 3KSBC 1GXSA 4WFQA 3AR6A 4HPJB 2OYRA 1SVNA 5JG7A 5JUWA 3VAZA 1SOAA 5FV7A 4FUTA 1X80B 4J6FA 5KO2A 4KQKA 4ZVVA 4RK1A 3QV2A 1E60A 2OV1A 1ZJJA 5E2BA 1F48A 1QHIA 3F1LA 3IEUA 1J00A 3DVSX 3MGAA 1ICEA 5A06A 2PO5A 2XYQA 3AHEA 3EXEA 4WCDA 5TMEA 1WSBA 2BC9A 2M2IA 4BUCA 5F23A 3ENQA 4KPYA 1UF9A 2EF0A 3CM0A 2A30A 3AVOA 4EUEA 4RTKA 2H2DA 3U9TA 4ZCLA 4W9RA 3TX6A 2FZCA 2HRCA 2DWUA 3A1UA 3LTEA 4I36A 4M7OA 3GCXA 4PAMA 4WPGA 5CURA 5ER6A 2EYQA 3TQHA 4NDZA 2PUWA 1A9XB 3TB6A 4YDRA 2PAFA 4PZ0A 1J9ZA 2XSZD 2XUOA 3BFKA 4TL7A 3TDKA 3INTA 1EJ2A 1MT0A 4JJAA 2BCGY 2I1VB 1KEEB 4LGMA 4YRTA 4BP9A 1ISGA 3DTVA 3U39A 3AG5A 4BMXA 4ZVQA 2FGJA 4JU8A 3ZWPA 4RVCA 3WMFA 5I45A 3GLHB 1XD2B 2F64A 4BNKA 5DBFA 4D0GA 1IWOA 3AF2A 3TW8A 4EYOA 2C4NA 1HQYE 1I80A 1USGA 4Q3DA 3RWBA 2GAOA 2QP9X 5BSWA 4L9WA 1KTVA 1EK1A 3FSGA 2I9KA 1UC4B 2P3QA 5FD8A 3AOEA 5CLJA 2RB5A 4JI7B 4UNSA 4O63O 5EQFA 4EJSB 1AKMA 2IX3A 1OH6A 1UDRA 5JWRA 1QBKC 1KSFX 2OLEA 4LOHA 2VYND 2X3UA 1OQAA 4X66B 4J8PA 4AWBA 2AL7A 1O03A 3A6LA 1YS4A 5JMPA 1WEHA 3E1GA 3QLEA 1YJCA 3WHIA 4CMBA 4EB8A 4BYGA 4BX0A 2YJ6A 4UEQA 1EGMB 4ZYZA 3BMNA 2QHXA 3P0JA 4JVMA 3K9CA 5F5XA 2XBMA 2JCBA 3ONWA 4DDMA 3HUDA 4NNJA 3BJMA 2EIHA 4RUKA 3SZRA 4R0MA 1OFIA 1LJUA 2FHPA 3PF9A 4X7PA 3CEPB 1CQIB 3L6DA 1RYDA 1MO4A 2MWMA 2PX3A 3ZUGA 1Y1TA 1JFFB 1LCIA 2JI9A 3PQCA 5K0TA 3U16A 2Y3IA 5JQGB 1GL9B 3K0CC 2OHGA 5TQ2B 1Q50A 3R6GA 2CMKA 3DE3X 1Y4SA 2OZKA 2IP2A 3MS2A 3W5IA 2PZGA 4LQDA 4DLUA 3EY9A 4L5IA 5HJEA 1G64A 3EOBI 5H59A 2XA9A 4OQPA 4NYIQ 2HREA 1A72A 1W44A 2IT1A 4NQRA 3RYIA 1RHKA 3L06A 1U2PA 2O8VA 2W2NA 1PVVA 5F3DA 5C9ZA 4YCMA 1JBEA 1JDZA 1H66A 1QDEA 3M4NA 3OTIA 4AMUA 1XZGA 2OILA 1E1KA 4GX5A 5I7WA 2PU5A 4Z4GA 5AVRA 1JHZA 1K7XB 2VNAA 3EEOA 3C3KA 3I01M 4NDAA 2F9MA 1P31A 3NPAA 1R10A 3GZ4A 3WGOA 3E0QA 3ICPA 5CHYA 3FPAA 1XLTA 3RVBA 1TD9A 1TTPB 2CJXA 2EBFX 2ZSDA 3LWDA 3N2EA 2HWYA 1CTQA 1NSFA 2O1SA 3RM3A 1D07A 4HXEB 4LSGA 1OAAA 2ZTMA 5CJJA 2EL9A 3DR3A 4EW6A 2V7TA 3KP1A 3B1ZA 1KPHA 3HYTA 2H0AA 3A6ZA 3ONEA 4HTAA 4BAZA 5TDHA 3CJTA 5M34A 1JZSA 3VOTA 3W8DA 2JFXA 3ECAA 3F5SA 4HATA 1OLSB 2LRHA 2X23A 5FL3A 3C8HA 4GNRA 3KB6A 2GZ3A 5I7EA 3KDPA 2BEVB 1BN6A 3PUWA 1G4HA 5JSUA 1FCJA 3QKSB 3W6OA 4RL6A 2C4KA 4DMGA 4Q00A 3TTWA 5J47A 1GKYA 4H1VA 3ZEAA 1PD1A 1OFTA 1WJGA 4PYIA 4QDOA 2BFOA 5ARCA 2OXIA 3UQYS 4EUNA 1C4XA 4JJIA 2D1SA 5T73A 2B30A 3II6X 2B8EA 1KAOA 2NO5A 5U4QA 3OKPA 1YDMA 2P8JA 3SR3A 1F0KA 3DZ5B 1FSSA 2ZVJA 1J20A 1C1DA 3AM4A 4UZSA 3T7RA 4AS1A 1SC1A 3G23A 3G8BA 1NULA 1Q2XA 3UA3A 4F6RA 3F7OA 3ZY5A 5CDSA 2C42A 3DYIA 3FTNA 4WD3A 5G02A 4YR9A 3KKPA 1XVAA 4MUHA 3IXMA 1OU0A 1PYOA 1KO5A 1UMDB 3UAXA 3IBYA 1YZNA 1TM4E 1BXKA 2GAFA 1N6HA 1QVZA 5L3VA 2E6UX 2Z9CA 4JEUA 2V65A 4UZFA 4EGJA 4DA0A 3GGOA 2FFHA 2XT0A 3I04M 1C7RA 4A0QA 5C2JB 2HMUA 7REQB 2AEEA 4WKBA 1Q7TA 1AKQA 3QQ5A 3EYAA 1JFVA 3BF7A 4TL6A 4B8WA 1IN1A 3PTZA 1MABA 1YB2A 4UHCA 3DZFA 3HU2A 1W47A 5IAGA 5CFRA 4JI2B 2PLFA 1EUQA 5LQJA 1YBVA 3N39C 1EE1A 4Q21A 4WK2B 1DELA 3SOPA 2VT7A 4B2LA 3Q7PA 1QYIA 2ZBFA 1Y5IA 4G0OA 4HWSA 3SP1A 4RORA 1Y3HA 5M5BA 4MA5A 1X2BA 4L2IA 5T67A 2A94A 4O8JA 1OXXK 4F46A 4HVAA 4K9MA 5LP6F 1XCOA 2FOLA 1TGVA 2XNDD 1VG1A 3SBEA 4H6XA 3VR3A 5KNCA 3RLIA 1RT9A 4WZAA 3BRCA 4IZ6A 3ITKA 2HIAA 4OH7A 3TL2A 1USIA 2OBMA 4UEJA 2XZPA 4KO1S 4OTZA 5IKEA 1KY5A 1JHYA 1JHQA 2GCOA 2NLOA 1NUHA 2PJUA 1Y0BA 1PS8A 2H4JA 5M6DA 3G5LA 3HWWA 1NUQA 4RO0A 1L7PA 1P2UA 3CUUA 4RY9A 1Q57A 3DVQX 4D4KA 3RKSA 3DS8A 1EE9A 2E4WA 5E1DA 1PJ3A 4KO3S 2K5UA 3QW2A 2FK8A 3BT7A 4HYEA 1TIBA 3C6QA 1S1MA 1L4EA 1NAHA 3DO6A 1A71A 1DIAA 3FTPA 1Z37A 5HA5A 5DYYA 4F5EA 5EIOA 1UT8A 4YRBA 2WFMA 3ESZA 4X1KA 4YMUA 5H9WA 5LPNA 4J16C 1L3CA 4W5WA 4Q9AA 3RSOA 2WAYA 1DXOA 2HSGA 4HMOA 3T3GA 3HLYA 2CZCA 4JU9A 1XKXA 1GSIA 4C22A 1T0UA 4UZEA 5FI0B 2XOKA 5BUCA 3BGWA 1QAOA 3C3CA 3IQDB 4IXDA 3CUSA 1BS9A 3QE0A 4UATA 4QUHA 4UDNA 5EFZA 1PYGA 1XTVA 2Y9MB 4Q7MB 1AK2A 1KZ7B 4YA6A 3P2OA 2R751 2QJFA 1YACA 3RO7A 4BVFA 1KI6A 4BV2A 3MM4A 4JL6A 5HK8A 4CMAA 2VOEA 2A57A 1P60A 5F52A 4NFSA 3V1YA 2GN1A 1IH8A 2HRZA 5TT1A 3VJRA 2E48A 2PH1A 3DJYA 3KTFA 3T06B 5DNCA 4NCIA 3AZPA 1U8CB 4Z8YA 4FGWA 5F21A 1MKYA 1Q16A 1YSCA 3BWMA 1EUCA 5LZ7A 2XOEA 2CL6X 3VV2A 4BFUA 4QEKA 3RIMA 3DV0A 2IZ5A 1HSOA 1B6TA 1OYVA 3MT0A 2QENA 2GSDA 4TMXA 4TQUS 5FNVF 2JIQA 2QB5A 3A2MA 5HTKA 3DZ4B 1G8GA 2ANCA 2CN1A 3SF0A 5HKKA 2FPKA 4MVJI 1RHJA 2VPXA 4FGZA 4XH9B 2IOQA 3RC2A 3GD5A 5D5HA 2Q3HA 1LI4A 4E5KA 1K9VF 1J33A 3ZIAA 3ELWA 1YRYE 2VTBB 2ECPA 1ZD3A 2QAGC 4G0QA 4XXHA 4C7OB 2Q5CA 2W2QA 2YHSA 4MPDA 1WUJS 2MYTA 3CZ5A 4MUEA 5CLGA 2IF2A 1BDBA 3IPCA 1GNLA 3IPXA 5EXDA 3A36A 4ZEMA 4OHCA 5FWAA 2FFAA 5T4EA 4JUCA 2VA8A 3SOZA 1Y3CE 3G5TA 4F3NA 1FTNA 1M2OB 5AI8A 2IW3A 2JL1A 4IG4A 3O4JA 4QO7A 5TJ9A 3KZKA 3U3XA 2XZTA 4JBIA 3ZOZA 3GR6A 2AFVA 1XX6A 2AFHB 3F74A 1JP7A 4M86A 2G17A 1KC3A 4OLFA 5B3AA 3NIFB 3WL3A 5HOQA 1E58A 5JY1A 1CR6A 1R8XA 5K3SA 1I7DA 2N1BA 2GZAA 4JMPA 4IO1A 1WSWA 3DE5X 1MC4A 4WZBB 5DXAA 2EWVA 5T5QA 1RAGA 2E6KA 3LF1A 4BMOB 4RQBA 3FPLA 3W6NA 3PS9A 5ULLA 3QPWA 3K09C 4GZ5A 2X4LA 2XODA 2QTMA 3FNEA 5DHFA 4BRWA 1FYVA 4TWAA 4J1NA 4OMCA 1BS2A 1RI5A 3R9KA 3SM3A 3UY4A 1LPNA 3WSWA 4I8DA 2FVYA 3RRMA 5ED4A 3PU6A 4QFDA 4CZ2A 5KSYA 1NJSA 3OY7A 4PYJA 2BOVA 4WDQA 5A1TA 1NKSA 3HGTA 3I62A 1ZVKA 1QU3A 3B60A 4ZI7B 1XMOB 1F1BA 5LD2B 4ZXFA 2OEPA 1OKKD 2PT9A 1G5TA 1L7MA 1RQXA 3KTOA 5ADUS 4NJMB 3MQFA 4XPIB 4X97A 3REQA 3THWA 3QFHA 1MEOA 4FCTA 3R74A 1BJTA 3F2VA 4GOKA 5F7ZA 1W4BA 2NXCA 3KU4A 4UCQA 4FYPA 3ZH9B 4GP9A 3RYCB 5MF6A 2FUG1 4X92A 1MOSA 2W8BB 4CV1A 1KVQA 3DLPX 3FPKA 5KYXB 2D7CA 5IWCA 3IDQA 5JANA 5KVCA 1WB6A 3L49A 3L02A 4EGFA 1QLWA 3ZNOA 1KIMA 3VZQA 5FOVA 2RJ3A 3HFJA 2MSKA 3E8SA 5DMXA 3QUAA 3EQ8A 1EHYA 3PICA 2WINI 1KU6A 1E6EA 3ZIUA 4G85A 3GRAA 4AQ7A 3OMXA 2FLWA 2IUEA 2R6HA 3FMVA 2ZRNA 3JWGA 4QTUB 5DZSA 3NS7A 2V7WA 4CUKA 2H2AA 1BQ4A 1GZUA 1O6FA 5LYJA 4IJQA 3LX6A 3GJYA 3HP7A 1IVNA 1QGOA 2C4VA 2OUIA 2YHIA 4NV3A 4XX0A 2A1UA 5CCXA 2ZQYA 1BFDA 3GROA 4N18A 3OM9A 3RAEC 3O38A 3DDOA 3TIXB 4PYNA 3DMHA 4RJIA 4D8VA 1BO6A 4XR4A 4PQFA 1O96B 4D3XA 4GGPA 4OUDA 4HPWA 4R5MA 4PYQA 1DAIA 3WBKA 4N5MA 2CBGA 3AOEC 1GPMA 2FR1A 2J32A 5BY2A 4TYNA 2VHCA 3DZ6B 5FI3A 1NBWB 5LA6A 2VDJA 1RTKA 1Y98A 3AERA 2KB0A 1E9EA 3L1KA 4JR2A 1TCVA 4UMVA 2QWXA 1O94A 4W6ZA 4AMGA 4B7UA 1JN0A 1V1RB 2ZTUA 3OOYA 4MV3A 2ZYIA 4YQFA 5HF6A 1LFDB 3AHIA 2RCNA 2I65A 3HJGA 5G0UA 4FBGA 1JKFA 3OTQA 5J2UF 4XKJA 2WIBA 2X9NA 4IV8A 2Q21A 4EVRA 1G5IA 2Y1GA 3WLKX 1GTG1 1Y89A 3PR1A 4S0XA 4O89A 1AUVA 1PN3A 4F9FA 1C4KA 4IIJF 4KR2A 4PCUA 2R7LA 2EBUA 3OJWA 4NPCA 1NVTA 3Q1KA 3TZKA 1M34B 2I7XA 3MBIA 2J41A 1GPJA 4U5QA 1H2BA 3KZCA 3THYA 2XAUA 5FTNA 5LR6A 1ZJ4A 2EGGA 5H7XA 1SUPA 1ZKDA 4P98A 2KHZA 4IGFA 4IJWA 5TV2A 3N0TA 3GRRA 1B73A 4C0BA 4URYR 2CVHA 1KJWA 1UKZA 3DKIA 4JBXA 4DBLE 1DBQA 1DG3A 3NWBA 3PDJA 4GXQA 3U4GA 1CBUA 3F8WA 2FQWA 2Z04A 3QEJA 3TNLA 3H99A 4AS3A 5ICFA 1QQBA 4KYIB 4YPFA 1E4VA 3AH8A 5E38A 1JE0A 1O0SA 1N0WA 1QK4A 2PIDA 2YV4A 5DWQA 4ML3A 4NJEA 3KTDA 5DF1A 2CNDA 1YB4A 2Z98A 2ZVPX 1Z6TA 1L5VA 2V97A 5IRCD 2H9IA 3D6HA 4XEHA 2F3RA 2ODPA 5JPIA 4DMFA 4LRUA 1RAHA 3VSBA 1PJQA 5JFGA 2GKSA 1CJUC 2C59A 5BUQA 2FH5B 1QHHA 2XMRA 3GRCA 1EXWA 3P2MA 4MAMA 4R1SA 2BFBB 4OHOA 2O2IA 4MMXB 1AH2A 4ZAZA 3AWDA 3JR3A 3A3YA 4KQMA 1I24A 3NUZA 5CT8A 2HT6A 5CCBA 2HSWA 1H6DA 1WP9A 1SFRA 2B5VA 2X13A 3JQAB 4IHAA 4TRJA 3BGDA 1J7KA 4MW7A 5DOVA 3PUVA 1QMPA 3D8NA 3B5JA 3JQGB 4EW1A 5EJEA 3TQIA 4WKCA 4GSLA 4X1YA 5I5EA 1HNXB 1W46A 1WBJB 2H11A 2NVBA 3OY2A 4YO8A 4NS4A 2WWFA 3DEFA 3UBTA 4JT9A 4LA4A 4MOWA 2IHVA 4V3BA 4Y1RA 5EIHA 4C3ZA 1JBKA 4PIMA 4KB5A 3ST7A 4HUJA 3DEJA 2QLFA 5BORA 4DM3A 5JZSA 4EUFA 3PHHA 1ZIDA 3MLAA 3MGKA 1D2MA 1TGYA 2O07A 3KX2A 3R9IA 1KO4A 2ZB7A 2FETA 3CPEA 3DHVA 3N5KA 3I9OA 5EZYA 2AMLA 2DFKB 1I3KA 1OYYA 1YOVB 3QG5A 4JD5A 3SKYA 4OSOA 3RV3A 2P3OA 4P32A 4TVBA 1P19A 1DOZA 2W6MA 1QH9A 4IKOA 4ITVA 2ZPTX 2VTVA 2JCYA 2QVLA 3D6UA 4ASUA 4EB6B 3IVCA 2VN8A 3BMCA 3GWGA 3ZWYA 4YRAA 5CFZA 2JEOA 3OCUA 4Q9NA 4DLVA 5SY4A 4I4LA 4JOSA 3N07A 1SBZA 4P83A 4ZVPA 3V4SA 4QYMA 1M75A 1L3BA 2X8JB 1EIWA 2V7EA 2Q46A 4GPAA 2SNIE 3UENA 1CUFA 1B8NA 1DKRA 2B1RA 1O9GA 1DT5A 1A1VA 1JEEA 2P90A 3H9UA 4ROTA 3DAYA 4GF5A 3TD9A 5K99A 4ID3A 3OX2A 4AJKA 1O4WA 4R9SA 4PNZA 1JEOA 1P4HA 1PK8A 2YV5A 4GR9A 1TEZA 1OH8A 1JIQA 1YO6A 1Z4NA 2OCKA 2QROA 3LDFA 4MI1A 2WF8A 4P08A 3MD0A 3E2PA 1S02A 1JDBC 3D2AA 4QLOA 4NEGA 1TYBE 4RVUA 3ZDYB 2DC1A 4D5GA 5KOIA 4QPJC 2J59A 4MDFA 4G0MA 1U0JA 1IEVA 3QU9A 4BNDA 4CQLB 1BRMA 1ISFA 4ND1A 3NRCA 3BF8A 4EY7A 3VR5D 1T5HX 4ZICA 3JALA 2EKZA 1JEAA 1J09A 3SFZA 1V43A 1DWUA 2AMYA 1DTWA 5AK5A 3LXUX 4TKZA 4YMWA 3CN7A 1KKLA 5G4LA 3KSAC 1QKJA 4RIEA 4WOCA 1I0IA 2P6NA 1TM1E 5J9FA 4CLOB 1VG8A 2YZGA 1U0EA 5HQ3B 1VI2A 4KQ2A 1EFVB 4B6QA 1MFZA 4B3SB 1PR0A 1AUXA 4B76A 2JI6A 3MWDA 4B7AA 1Y1SA 1CRPA 3B5EA 1GV1A 1E0SA 1Q84A 4IDEA 1PSZA 1C8BA 3CNOA 1TKAA 3F96A 5BNZA 4BUJA 2H9YA 3TTUA 3DVRX 5IHXA 3QMVA 1GAEO 4DR5B 3AEYA 3AI1A 4N1AA 3TTTA 4AK1A 4Z3DA 4QYTA 3NBUA 1GD1O 4MHOA 3W2GA 2IU6A 5CDGA 3QE9Y 2OM2A 4R4JA 2KM1A 1PQUA 2R1VB 2Q7XA 1W48A 1K8RA 2G7ZA 3KB1A 1IOWA 4OK6A 5A0TA 3FOCA 4GU5A 3HGMA 2CBZA 5FADA 4HQ6A 4Q9KA 4RNDB 2VR1A 4UBIA 4EZBA 2QV7A 5JQGF 3DPUA 3VTAA 4A0FA 5C8VA 2WG2A 3W2FA 1CUXA 5AUOB 1YZVA 4R2JA 4A8JB 3PGVA 2AG8A 1PZMA 4YP1A 1CVIA 1J9EA 1UK9A 3A9RA 5DVZA 2XLCA 3GARA 4DG9A 1P0FA 3OC6A 2GOYA 1NG9A 1GEGA 3R3JA 4L5CA 1M72A 2G28A 2ZRKA 2OYSA 1ZITA 1EWVA 4IBOA 1LSJA 2LE0A 2XY4A 2YHBA 2CJWA 1NVFA 2NGRA 1EP9A 4RMGA 4X84A 3ERCA 4HYTA 5T6BA 2JCGA 4PGAA 5ERYA 5C31A 4WFIA 1N2CA 3KB2A 2HKIA 4RM3A 3QEBZ 4BN5A 5C1OA 3BCRA 1L1EA 1I14A 1YQ9A 1PWHA 1EYZA 4QQRA 2WJYA 3TB4A 3ZXUB 4J0EA 4ZDJA 3JASB 4X71A 2OFOA 4XYEA 4I3HA 3U4MA 3ZC3A 4GYYA 2HA7A 1H3FA 1NSYA 4L3WA 1Y7LA 1F8UA 1OUMA 1BMDA 1OVMA 4RSRA 2C5SA 4BOYA 1SUDA 5DWDA 3U3MA 1Q0TA 2J0QA 3ZHSA 4FLFA 3EPHA 3T9EA 3UPTA 2XCIA 4DQKA 3S1SA 1MGOA 2BGUA 3DFKA 3OEHA 3NVDA 1FDTA 3MBKA 3QE2A 3ZHQA 5IT4A 3EFHA 3UJDA 2QG6A 1RWBA 1ONSA 2RONA 2H57A 2ANBA 3L84A 3NHUA 3Q3VA 1ZX1A 3P26A 4MO2A 4ZQBA 1ZDMA 1JSXA 3CLKA 3CEHA 4E07A 3KVOA 4FNMA 3FUUA 3WLNA 1C41A 3OOSA 2BGIA 1YBHA 2Z6VA 2C7OA 5ALMA 4W6QA 4GQAA 1XC7A 2FZGA 3FPFA 3RR2A 4B74A 2HAEA 2HHAA 2IE8A 2NTEA 2QLLA 1JG2A 1ZKMA 1N8NA 3D0RA 1UAGA 3LPCA 1B2LA 2OD7A 3ZZMA 2G25A 1V9SA 2F00A 2XMDA 1SEVA 4NFHA 4CFZA 4FFLA 2R1TB 2E7ZA 1AQLA 4GKKB 1WCIA 2FK7A 3M6AA 4Y2QA 1Z8FA 4ERNA 2PTHA 4Q5IA 3R0VA 3TQOA 3B38A 2WQ7A 2VQ6A 3ND7A 4PHTA 2IOFA 1ZM4A 1BZYA 1ZWLA 2NSHA 2OV6A 4WZZA 4MR9B 3KUDA 1YL5A 1KZHA 2B1JA 4I4NA 1RRPA 1P2SA 5TRTA 1PZNA 5JY6A 1XROA 3UMMA 3KAKA 4B45A 3L3BA 1R3DA 1VFNA 2H48A 5ECGC 2I4RA 2CZQA 3RC7A 3T7DA 4AJ2A 2Q41A 3WQRA 4D99A 3KR0A 1Z5NA 1I3CA 2XMSA 3PPIA 3LQRA 3PXXA 2DFDA 4FUQA 4HSEA 4Z2AA 4WERA 1PZGA 2PX6A 3O75A 5AICA 5E2IA 2AOTB 3E58A 1EFDN 1YI0A 2G09A 3OM8A 3Q7EA 3UFXB 5LXTB 3MHTA 5C5CA 3PQ8A 1AZLA 4FGJA 1XPUA 5KOJA 1DBIA 5ITVA 2ZRPA 4CCYA 3CEAA 2I6TA 1ADBA 1XALA 2LR0A 4X62B 3IALA 2J3MA 4IZHA 1DAHA 2L0XA 5KNBH 2PWPA