2H63A

Crystal structure of human biliverdin reductase a
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
284
Chain Sequence
MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biliverdin reductase A
publication title Crystal Structure of Human Biliverdin Reductase A
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 284
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2h63A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2h63A01
2NVBA 4M1QA 1LDEA 4ZQBA 1LSJA 4XGKA 1JVBA 2FR1A 3IC5A 2ZATA 1GEEA 1C1DA 3Q9NA 1E77A 2E49A 1XU7A 2ZB7A 4MDHA 3RAJA 3HNPA 3RFTA 1T24A 2O4UX 2EKLA 3MJCA 4RVDA 3AY7A 3G1UA 4Q3EA 3INRA 1KVUA 5IFLA 2R00C 2C7VA 5FI3A 4QFCA 3RUHA 4ZRNA 4RF2A 2PNFA 2JCVA 3IJPA 3K2EA 5DBIA 5I9MA 5L7WA 3E9NA 3FNHA 1S7CA 1QYXA 3F46A 1ADCA 4HFMA 1J6UA 5L51A 1B26A 1XKQA 3HUDA 4BB6A 2HK9A 2YQ4A 4TRRA 4OMUA 3DB2A 3ZWAA 3I9OA 3PDJA 4WLNA 2VYNA 3WQSB 1W0CA 1AE1A 3BYZA 4BNNA 4JBIA 4HFNA 2YUTA 3S2EA 2VOEA 4RLHA 4W82A 1EE9A 4MVJP 3WFIA 4YAIA 1IUKA 5TJHA 1DC3A 2I5PO 3AUUA 8ADHA 1M6HA 3H5AA 1T26A 4BO9A 7ADHA 2DT5A 2VT2A 4DYVA 4YAJA 3DZJA 2EW2A 4CLHA 4EEZA 2JHGA 3H2SA 3S2IA 5A3JA 1WDMA 2NACA 3OEYA 2C54A 1RM0A 4OQZA 3H8VA 3T4EA 4XIJA 3T7CA 2DUUA 4YACA 6LDHA 2UV8A 2R00A 1YDEA 4YAGA 1PZFA 1N7GA 2CVQA 3D4PA 3CE6A 4RPHA 3KB6A 3WX0A 4PG5A 3DBHA 3KYBA 4IDDA 4UAGA 9LDTA 4S1VA 1DAPA 2OO5A 4E12A 4XEHA 4YT8A 4W7IA 1I10A 4NU6A 4R5MA 2EERA 4L76A 1WZEA 3DHNA 2V6FA 2P4HX 4CLRB 1I32A 4R9RA 1EZ4A 2X9VA 4YDRA 3SJ7A 2E48A 2H63A 3L0DA 2EKPA 3ON5A 5LDGA 3ZU2A 1XDWA 4EZBA 5AXAA 1OFGA 3WBFA 3RUIA 3GVXA 2CMDA 3QWBA 2C2XA 1VL0A 4TWRA 4RVFA 3FWNA 3OJEA 2GDZA 4CQMB 1KEVA 4EUEA 3FTNA 4F45A 5AXDA 4ALNA 2WSBA 1D1SA 2H6EA 5AVOA 3RKUA 4MINA 2AXQA 1BMDA 2Q49A 2DQ4A 2RH8A 4Y9DA 1Q0HA 1P1FA 3U4DA 4ZJUA 4INAA 5B37A 1IE3A 1ZKMA 1BRMA 3NJ4A 2WE8A 5AOVA 5CP8A 4XCVA 1F17A 4IDAA 4NMHA 1XHLA 4RDHA 1P0FA 3P19A 4Q3DA 4WCDA 1K3TA 1X13A 3PJDA 1E7WA 4PLPA 4IS3A 1Y7TA 2HSDA 2DKNA 4R1NA 4JBGA 3JCZA 1Z82A 2PH3A 2C2YA 2XXJA 1O8CA 1MFZA 3IQDB 4CMBA 3IKTA 1YXMA 3B70A 5L4SA 4DIOA 4YJFA 3V8BA 1WP4A 2G1UA 1D4FA 1I8TA 4AJLA 1KOLA 4P4LA 1P9LA 3GC6A 3TPCA 1YGYA 3CUKA 1QSGA 1GDHA 4MP6A 3QW2A 1UAYA 1YH3A 2AG8A 2X9GA 4HNHA 5DBFA 3KYCB 3U0BA 1A72A 3DZFA 3V2UA 3ANLA 1MV8A 4BL5A 3ZW8A 3I9KA 3P2OA 4HUJA 1GCOA 5T73A 3PJFA 3GOHA 4D3FA 1NHGA 1R4MA 2ZIZA 4II3A 2PD4A 4XGIA 2POQX 1NFQA 1YB4A 1LUAA 3DBLB 1MFPA 4PCVA 3OMLA 1LRLA 1DC6A 2HDHA 3U4HA 2PKQO 3VH4A 2GD1O 4AL4A 5CDYA 2AQ8A 3LT0A 4BV9A 2UUPA 4D41A 3QP9A 1TXGA 5KJ1A 4HKTA 2JCXA 1GUFA 2BFOA 3VDQA 5DOVA 1JKJA 1GADO 1YQDA 3D7LA 2A35A 1HE2A 3K92A 4EBFA 4YR9A 3ICPA 1UH5A 5F5LA 4R41A 1UP6A 1R0KA 4BQRA 5GY7A 3GFGA 3MJTA 3FNFA 3GHYA 3RASA 2YZ7A 3H7AA 3FBGA 4YPOA 3OF2A 4PLVA 2LDXA 2Y1CA 2YHIA 4IBOA 3AI1A 5CDGA 1DOHA 2C5EA 4CPDA 4EJ6A 4IDFA 4U8GA 4QFDA 2Z95A 1M2WA 1DEHA 2HMTA 1DAOA 3QE3A 5HTOA 2HO5A 2FPPA 3NUGA 1SB9A 1U9JA 1I0ZA 3L4SO 1U3VA 3OJFA 1I3MA 3RBXA 1ONOA 3DQPA 5A9TA 4WEQA 3JQGB 4PG4A 3JQDA 1U5AA 4BNYA 3C7AA 4GSLA 4OKIA 1TI7A 1X15A 4GWKA 4Y6SA 4RVSA 2BI8A 1VJTA 2W2LA 3EVNA 4GMGA 5KCZA 3F9IA 3IDSA 3SXPA 1T2DA 3SC6A 1YL6A 3WGHA 4IJUA 1ZEMA 4UUPA 5TT1A 4MKZA 1X0XA 2Q2QA 3H9QA 1R15A 1KEUA 5ILOA 3VPHA 2IDZA 1KEWA 4OJNA 1DLIA 2XXBA 1WZIA 4NR0A 4GMFA 3BZUA 2PA3A 4N5LA 3WWYA 1PZEA 5JDIC 4CUJA 1JQBA 2QZ9A 4HWKA 4OSPA 5EN4A 3R0IA 4ALMA 1K6JA 3LC2O 1FDTA 2IXAA 3M1LA 2BHLA 1LRKA 4L73A 1CRWG 3HDHA 1XEAA 5JCJA 2JL1A 2BGLA 2X0JA 4RVHA 4O63O 1X7HA 2PD6A 1BDMA 1SNYA 1NM5A 4JGBA 3F4BA 1UZMA 4P38A 5THKA 2WEKA 3WYEA 4UVHA 2HMWA 1TEHA 3A28A 4XB2A 1U7TA 5CEEA 4TZKA 3PDUA 4UVDA 5TGDA 4XKJA 1LDBA 4C7KA 4BNHA 3TQHA 4FIZA 4MKXA 4CR8A 4CQLA 3MJSA 2Q3EA 5BR7A 1E5QA 1HRDA 3PRJA 3DOCA 4B4UA 3QVSA 3DTTA 4CLEA 3INGA 3OQ1A 5L45A 2ZTUA 3ZV3A 2UDPA 3L6DA 1OZAA 2ZTMA 4G81A 3S55A 3AOEC 1A4IA 1XIVA 4WOJA 4BV8A 3ENKA 5GZ3A 9LDBA 3GZNB 1DFIA 1P45A 5ICSA 3NAQA 4A0SA 4PZCA 4FB5A 3BHMA 4J1QA 2Y1EA 1JWAB 2J5KA 2OHXA 3UW3A 1XA0A 1OOEA 1PJLA 3AW9A 2AEFA 4DIFA 3ROPA 5DCYA 1YJQA 2ZYDA 4NZ9A 4BQPA 4DQUA 5JDIA 1DLJA 4I5DA 2UVDA 1ZSVA 2ZTVA 1ENZA 1NWCA 2VUSA 2VTEA 5JMWA 1UP4A 4Z6KA 4MPDA 4OXYA 1V3UA 1Q0QA 5THQA 3I5MA 3D1LA 5G2OA 5A5EA 4GGOA 2IODA 3ZWCA 4BGVA 1A4UA 1X14A 1HT0A 4XB1A 4L4RA 2VYND 3RQSA 2JFFA 4XDZA 2J5RA 5C5IA 3E9QA 4BMSA 3HHPA 1NQ5A 4ID9A 1XQ1A 3JQAA 3BMQB 3WIDA 3HJAA 3BTOA 3FTPA 3LLSA 1YONA 1R4NA 5KJFA 1LDMA 3ZHBA 3S2FA 4AFNA 4JP2A 4ZICA 3ADPA 3WJ7A 3MZ0A 4KZPA 3DL2A 1C1DB 2PTGA 3OETA 4C7JA 4YEDA 3ROQA 4BNVA 3VTZA 2I6TA 4O5OA 3CZRA 1GEGA 1EEHA 5F1PA 4EEXA 2FWMX 4CM3A 5IF3A 2X0IA 3ZH2A 2Q50A 3VVBA 3MOIA 4FC7A 2BELA 4K6CA 2GCGA 2CDCA 1VM6A 3HZZA 3NDIA 2DVMA 1WNTA 2EG9A 2YY7A 1U2DA 1ZXBA 3AI3A 4Z9FA 4B8WA 4FS3A 4Y6PA 3EC7A 2ZYGA 3LF1A 1XWFA 3JQFC 3ZWWA 1Q7GA 1DHRA 4WNCA 2UUOA 3UCEA 2ZKLA 1EVIA 3PIDA 1RM3A 3M2TA 1KY4A 5TQVA 4B4OA 4M89A 3C85A 1UXIA 2DTEA 4IXWA 3DHEA 3GA0A 2XPCA 4KTVE 2G76A 5K0ZA 4E4YA 3A14A 4JJIA 4WK6A 4IXTA 2D4AA 4KDEA 1F8GA 2GF2A 3H4VA 4CLOA 1Z73A 2AQHA 5IG2A 1G1AA 1WVGA 5DCUA 1M76A 4PFJA 5JAQA 3NGLA 4IDGA 4AJNA 1OC4A 1GZ3A 4E0BA 4FR5A 1J5PA 2Y0EA 2BH9A 3DOOA 1B2LA 3OSUA 1Z7EA 1D1TA 1EVYA 4WPGA 4NHEA 2PKQP 1I3KA 4AJHA 3DBLA 1O0SA 4TZTA 3NGXA 3RUEA 3K31A 2BGMA 1PJ2A 3HN7A 5GZ6A 5KWEA 1K6IA 2H5LA 3DBHB 2QRJA 1CQIA 1E7QA 4GVXA 3GDOA 1ID1A 2ZB8A 2IXBA 2ZJ1A 4IJWA 1I33A 4XZ3A 1VI2A 4RJTA 3DONA 1SOVA 3RD5A 3WYCA 5IAAA 2GRAA 3D3EA 3U49A 4G2NA 3HB5X 2EKQA 1BXGA 1P1IA 1W73A 3ENNA 3KZVA 4MIEA 3ASVA 3QWAA 1HDOA 3NDRA 1U1IA 3FPCA 4IGFA 3W4IA 1XSEA 1ZMOA 4YQYA 5I9NA 3B6ZA 1I5RA 4DMLA 5IXSA 2VYVA 4I9NA 4BNLA 4M86A 4WLFA 3RKRA 4KWIA 1C0LA 1EQUA 1YQGA 4KQXA 3OJOA 4W6ZA 4BKPA 1UXGA 2NWQA 3H9JA 4CLXA 5ITWA 4JBHA 2CF5A 1PWXA 3MTGA 3DZIA 4NBUA 3I9NA 4PZDA 4EUFA 2X0NA 3FN4A 4IY1A 1PL7A 3KV3O 2QHXA 4OH1A 4AJEA 4PG8A 4CM6A 1CDOA 3I83A 5G0UA 2R6JA 1ZSYA 2WWRA 4IGEA 4E5YA 5KIAA 4CMHA 1ZH8A 3PWKA 2JD1A 3TZHA 2J3JA 2YFQA 3ONFA 3WJAA 4NBRA 3JQGA 3RFVA 4L74A 4IQ0A 5ER6A 3PHIA 4PG6A 4GPD1 2Q1WA 1U7HA 4L4XA 3RUFA 3UICA 1DIHA 2HU2A 4ZVVA 3ETEA 1DXYA 4ZQFA 2DBVO 4J9UE 3HFSA 4W99A 1PQPA 4NNJA 3Q3CA 2BFMA 1PS9A 2ZK7A 3WQQA 4AJ1A 5JFOA 3E03A 1UR5A 5BNTA 3PQFA 3VZSA 4AJ2A 5ICMA 3DDNA 3FF4A 5L7TA 3KEQA 4UVGA 2V6BA 4I9UA 5G4KA 1U3UA 1SAYA 1NNUA 1YL7A 4TSKA 1PS8A 2Y05A 4IIUA 1JKIA 3D5TA 1Y8RA 4O59O 3KSZO 2NLOA 4RGBA 4CJXA 2D3TA 1YJ8A 4N18A 3H3FA 1U4SA 2EIHA 3RC2A 1BW9A 3C24A 3WMXA 4I5FA 5F3RA 1R0SA 2FZWA 3GGGA 2ZCVA 4HXYA 1R4MB 1PJSA 4UREA 2O23A 4OXKA 4WEOA 3IKVA 4E33A 1YKFA 3VPFA 4OYRA 4YBZA 1TT5A 1NTOA 2P5YA 4II2A 4AG3A 5I7VA 2PV7A 3JYNA 3L4BA 3E6AA 4Y8VA 4XQEA 4Q39A 5BNIA 2OORA 4O1MA 4WE3A 4BHTA 4PIVA 2GGSA 3PGXA 2PGLA 1WLYA 1I2BA 3IAHA 1ONNA 1N7HA 5TJ9A 1EUDA 3JQ7A 4D0RA 2BFAA 3JV7A 3GY0A 4LK3A 1MLDA 5I8ZA 1LDNA 3GZNA 3PPIA 4MOWA 3PZRA 4TRMA 4MJLA 3GQVA 3TL2A 3ZWMA 4E2ZA 4BO0A 1TLTA 3WGOA 1WXDA 3WB9A 2C59A 5IN4A 1C0IA 3ICCA 4DVJA 2YW9A 3QV1A 1K2WA 4JCOA 5A9SA 2C20A 2JFHA 2NADA 3QVOA 3PFFA 3PJGA 4YJGA 1NPDA 2GASA 4YJDA 2GZ3A 4Y6RA 4EGFA 3WGTA 4TVBA 1GZ6A 2OL4A 4M49A 3ZWOA 3QWIA 1HZZA 1PJBA 5JCJD 1IULA 1ISGA 4FD3A 2AE1A 1DC5A 5HWSA 1M67A 3OECA 2B69A 2CFCA 2PZLA 1U2GA 1EBFA 2EXXA 3X2FA 3QA9A 2FZEA 5EESA 4OQYA 3ZV6A 3NV9A 5U4QA 2W98A 2O3QA 3AFMA 4FQ8A 4FOSA 3P5SA 3GUYA 3S8MA 4R16A 2PK3A 3Q9UA 5DCWA 5I7EA 3M6IA 3ZDFA 4DLLA 1DJQA 5EMHA 1QKIA 1BHSA 1F14A 3TZCA 4BKUA 1Y5RA 3PYXA 3DAFA 5JYFA 3GEGA 3ZNQA 1U8FO 1CQJA 3CZMA 4NBVA 5L4LA 2XF8A 1WPQA 3MJEA 3VPXA 1O6ZA 1K89A 2JD2A 5TX7A 2NUAA 1GU7A 3SLGA 2YQ5A 3RI3A 4YT2A 1HLDA 1E1MA 2VHWA 4WASA 1B8UA 4HY3A 4O0LA 1ISJA 4GLOA 5B4UA 1QORA 1WDKA 4B7UA 2TMGA 3QJ5A 4AJIA 5JDCC 2E4AA 3R1IA 3QLJA 5TLSA 1C14A 4ROSA 4XD2A 2A4KA 4QEDA 2FPGA 3GUCA 4AJOA 4IIVA 4NBTA 5TC4A 5L95A 5KKCA 1I3NA 3Q0EA 1Z74A 2VWPA 5HS4A 3TNLA 4NI5A 4XQCA 3LF2A 5T67A 4ZHSA 1DIBA 2Y1OA 4WLVA 4CQLB 2IZ1A 1ZMTA 4R1UA 4OM8A 5IDQA 4U6QA 2WYVA 3BA1A 3LQFA 5J23A 4IDBA 2DBQA 2X7HA 1JAYA 1UXJA 1E3LA 3O4RA 4QXMA 2VWHA 3OP4A 4YA6A 2BKAA 4E3ZA 5JAZA 3L6EA 4RCVA 4ZQGA 1DB3A 5FFFA 1X0VA 5GMOA 4XYBA 1HEUA 5JCXA 4CQMD 1FDUA 5EERA 1ONPA 4CM4A 3IUSA 1PEDA 4Z9XA 3DAGA 4N5NA 3DR3A 1UDAA 1V8BA 3AM5A 3VH2A 3PQDA 1Y1PA 2B35A 5J9GA 1AXGA 4L4SA 3PP8A 4P8RA 3DZBA 3LC1O 1GQQA 1G6KA 3HDYA 4P4NA 3IP3A 1PR3A 3K5PA 3TOXA 4WLEA 3GF4A 1M75A 4MVJA 2C82A 3E18A 4LCEA 5DF1A 4M54A 2VZ8A 1BXZA 5JDCA 2WJPA 4ZRMA 5EIOA 4DBZA 1MG0A 2JD0A 2PH5A 4I1IA 3DZGA 3GN1A 2PFGA 3JQAB 3DBRB 2I9PA 4FFRA 3HSKA 1KVTA 5EINA 2B5VA 4BS9A 1R4NB 2CDAA 2B37A 3EDMA 3AFNA 3KEOA 2CSUA 1AN9A 1Z7BA 1R6DA 1E7MA 4CMJA 4MIOA 1RJWA 1H2HA 4Z9YA 3OHSX 3QVXA 3F6YA 2RAFA 4J0EA 5I9LA 2Z1MA 2Q1UA 5I7FA 1IZ0A 4CM9A 4Z3DA 3MJVA 2Y1GA 1G0NA 3K2BA 4E2YA 1NP3A 4P22A 1MB4A 4ZD6A 2AG5A 4IINA 3A06A 3LT1A 5JS6A 4ALIA 4NFHA 4H3VA 1B0AA 3PWSA 1VKOA 2P2SA 3JQBC 1PJTA 2DFDA 5L3ZA 4XWYA 2NV6A 4FFNA 1OC2A 4A27A 4BNIA 3QIVA 1K6XA 2RH4A 3L9XA 2F00A 3TRIA 3WLEA 3CH6A 5IDXA 1HF3A 3LSYA 2V6GA 1LQUA 2P4QA 4DREA 1MC4A 4CV1A 3TSCA 1NPYA 3OIGA 3GHHA 2TMDA 2HQ1A 4CLOB 5TIIA 3TZQA 3E48A 2NU7A 3ZGYA 4YAKA 4XDYA 1GV1A 1JLLA 1A9YA 3H6KA 4GH5A 2IYOA 5BNFA 2W2KA 1ZEJA 2HJSA 3OQ6A 4J16A 4RVUA 3UHAA 3TF5A 3O03A 3FI9A 4ILKA 2C7GA 1A71A 3LU1A 4J4BA 3WICA 3FRJA 5IDYA 3COSA 4BO5A 3DMYA 5CPFA 5EL0A 1L1FA 5JY1A 2DM6A 1EDOA 3CKYA 5G0VA 5T8KC 3GH3A 3VPGA 5L7YA 1RWBA 3V1YA 2Y66A 1V0JA 3IL2A 4CR7A 4NPCA 4EUHA 5JNLA 3H9UA 4N5MA 4XR9A 2UAGA 4W4TA 1P31A 5HRUA 4UUMA 5T64A 4JN6B 1B8VA 4TRNA 3RROA 1E1NA 2FOIA 2W4QA 3X2EA 4YYZA 3JQBA 5FF9A 5G0WA 4BNFA 1YB1A 1JKFA 1P1JA 3WS7A 2PZMA 4TKMA 3PHHA 1YO6A 2Y0DA 2X8LA 1BXGB 3UN1A 1H9BA 2DBRA 4WLOA 2CZCA 4I08A 2DUWA 1B8PA 2WE7A 3UXYA 1QXSA 4WKGA 3ITKA 5A03A 2WD7A 3JD0A 4FJ0A 4DGSA 3RUAA 2PZJA 1EUCA 1QYWA 2QRKA 7MDHA 2BLLA 1JW9B 4M8SA 3WOHA 3ZWYA 3SC4A 1QYDA 3O9ZA 5A1TA 2HK8A 3JD2A 4GKVA 1PTJA 5G0SA 4D44A 5FWNA 1ADBA 3NTRA 4DQXA 3RU9A 1T2AA 4YWJA 2NNLD 3I4CA 4RORA 2PR2A 1H94A 2PLAA 1E5LA 1GAEO 4B7CA 3B1KA 4C4OA 5KTKA 5CEFA 1AHHA 5KVQA 3F3SA 2UYYA 4J3FA 3DWFA 5T8KA 1ISMA 4OL9A 3ORFA 1FK8A 2X4GA 4BB5A 1PR9A 1KERA 1T4DA 1HTBA 4JXKA 5CAEA 3KSDO 3CTMA 3BMCA 4D3SA 4HNGA 1OAAA 1V3TA 2AHRA 3GEMA 4FBGA 4KUEA 1YL5A 3CXRA 2NTVA 4EDFA 3QWHA 2PD3A 3W8EA 4B7XA 4ZN6A 5B1YA 3GG9A 3PYLA 2CVZA 2P9GA 3GMSA 4NK5A 4FJ1A 3GRPA 1RYDA 2XOXA 1PU2A 4Q3CA 3EGOA 2HUNA 1KVRA 1PJ4A 2Q4BA 5COAA 4BNXA 3HG7A 5G4KB 5K6AC 1GYPA 4A2CA 4IS2A 4ZU3A 1UXHA 1J0XO 4OSOA 5TSDA 1BVUA 1FF9A 4WNIA 1T2FA 1Y8RB 1LDGA 3H9EO 4ITUA 4BMNA 1PGQA 3GDGA 4TVOA 4XIYA 3U4IA 3QVWA 4RQTA 4BMVA 4A03A 3E82A 1BGVA 1BW9B 5IXYA 2D8AA 5KVCA 3I9LA 1N8KA 4H16A 2HK7A 2VNSA 3WTCA 1GPJA 2EGHA 2GZ1A 4R3WA 3W4KA 4E5PA 1QMGA 3QHAA 2X0RA 4OOEA 2B0JA 1TT5B 2EJWA 3GR6A 4BO6A 2RCYA 5IDWA 2OMEA 4DC0A 2O3UA 3AUTA 4JP3A 4YB8A 5JPIA 3ZWVA 1PZGA 1A9ZA 1NFRA 2ET6A 1HDGO 1CIVA 3WGZA 3KM0A 5EJ2A 1ZK4A 1MXFA 5JE8A 3JQ7B 3ABIA 3LVFO 3LT2A 1XYGA 3K6JA 4EJ0A 5JYEA 2O3JA 3ZW9A 3ASUA 2X23A 5A3VA 3I4FA 2PY6A 2FHSA 1PIWA 4PLHA 2DPGA 5COBA 4HV4A 3QWFA 4MVJF 4GWGA 2WM3A 3GK3A 1T2CA 3SJUA 5B12A 2EP7A 3S2GA 4AJ4A 3KRTA 5A9SB 4KDFA 2BF7A 4PLZA 4GL4A 1WMBA 4HFRA 1IHYA 2DC1A 3EVTA 4YJGB 2Q2VA 2VUUA 3JQCA 1LLUA 2YV2A 4J90A 2DPHA 1E0DA 3TJRA 4GBJA 2RIRA 2GN8A 5GZ1A 4PLTA 3NTOA 4OIMA 4RVGA 3WBBA 3QQPA 3KSUA 5KVSA 2H9IA 3I1JA 3TFOA 2O2YA 3AM4A 3C3XA 2QZZA 3PLRA 2OBYA 4KUGA 5FI5A 1SOWA 1I2CA 1C0KA 5TNXA 1FDVA 4HP8A 4MVJI 4BO2A 1AXEA 4LVCA 2AA3A 3V1UA 4MVJG 2IE0A 1QV6A 4QO8A 2WDZA 3DBRA 1XU9A 1W6UA 2O7SA 2Q1SA 3ITDA 2ZCUA 3GDFA 1ENPA 4DIBA 2YDYA 4WGGA 1FXSA 2JFGA 1QYVA 3TN7A 2VNAA 3S1LA 1I01A 2EEZA 3GVHA 3GEDA 3GLQA 3NTQA 3KUXA 2AMFA 4BO7A 3F5QA 1RKXA 3GT0A 4YT4A 1X7GA 3AOEA 3RIHA 1Z6ZA 3P7MA 2GN6A 3VH3A 3ZWBA 1CWUA 1PSDA 3KBOA 2HMSA 4HBGA 1HKUA 2PZKA 5BT9A 2FR0A 3NT4A 5L53A 2YHUA 1GL3A 1H6CA 4FGWA 1IZ9A 4JJFA 4D45A 5CDUA 1YOVB 3GVPA 4GVLA 4FW8A 3PHGA 1NQTA 2DTDA 3MWEB 4XQ9A 1GUYA 3WFJA 4MVJD 1A27A 1PJ3A 4IMRA 4UEJA 4D79A 1PL8A 4NJOA 3B1FA 4PLFA 1MC5A 2DAPA 1L7DA 3RUDA 1R66A 1JDJA 5ADHA 5L40A 4I9HA 4FCCA 1KVSA 2BMAA 5TT0A 1PX0A 3DZKA 3ZCXA 1DIAA 5ENDA 1E3IA 5HBRA 3UCXA 3UOGA 5C7OO 5ER9A 2JAHA 1ZK1A 1E7YA 1HXHA 1R12A 4DYDA 1DSSG 1LQTA 3AM3A 1GCUA 3I6QA 3K30A 5KOIA 3IS3A 1TB4A 3DC2A 1MG5A 2X58A 4PLWA 4CV2A 4CR6A 4U6SA 3PQEA 4DPLA 1TVEA 5JSFA 5BSFA 1DRVA 4D42A 4CM4B 1Y9EA 4MVJH 1Y81A 2EHDA 1GD1O 2PGDA 4JNKA 4ZGWA 4ALKA 3GNSA 3Q1LA 4BGUA 1PGNA 3WGIA 2ZB3A 4DQVA 1GQ2A 3KVOA 5AYVA 2D0IA 1LDYA 1U8XX 1DFHA 1VJ0A 3BMNA 3JQFA 4PLCA 1HE5A 1U28A 5ILGA 2OFPA 1HDXA 1SEPA 5CPBA 2QRLA 4KMSA 4KWHA 4U0KA 3VHRA 4ZA2A 3JD4A 1PQUA 3ETGA 3BMOA 2J3IA 1IOLA 3G3EA 4MP8A 4Q3BA 2JCYA 1VKNA 3B20A 4J4TA 4JROA 3RVDA 4A7PA 2VRBA 3OJLA 1T1RA 2VZ9A 4RPLA 5JAMA 1Y9AA 2WD8A 4BNTA 1H6BA 3NDJA 4DLAA 5F21A 3JYQA 4BGEA 3GNQA 1VE9A 5ITVA 3OA0A 1O89A 1Q0LA 1XGKA 3D64A 4YVFA 3LDHA 5A04A 5COQA 1B3RA 2AE2A 1LJ8A 1P77A 4CM1A 4BO1A 1EVZA 1XLTA 1LSOA 5A02A 3HN2A 2AQKA 2GR9A 3V1TC 4D46A 4YTEA 1GYQA 5C37A 5AXCA 5CHEA 2X5JO 2NVUA 1MX3A 4B8ZA 1I2ZA 3A1NA 1EDZA 4K26A 2X6TA 4WJZA 2X22A 2YDXA 1YRLA 1RYEA 1UUFA 2J5QA 2ZQZA 4DWVA 4F46A 3BIOA 3RUCA 4LRTB 2ZJ0A 4NU5A 2X86A 4BO3A 4NIMA 1GQYA 2ZTLA 5A05A 4MO2A 3ZU4A 2P9CA 3KETA 2ZYAA 4NDNE 4Z3KA 1XG5A 2FMUA 1N1EA 3ZWPA 2BRUA 4IMPA 3F1KA 3T7EA 1G0OA 3TWOA 4XA8A 5CEJA 4DC1A 3VDRA 3VZRA 3QY9A 1NPTO 2VWQA 3AU9A 4MP3A 4WECA 2JKVA 3AY3A 4NK4A 3KLMX 3W1VA 2BGKA 1VL8A 5K9ZA 1SO8A 2EGGA 2FR8A 3HDJA 3WQRA 1VRWA 3PHLA 4UVEA 5JYDA 1QRRA 3E1KA 2W2KB 2O2SA 1ZJYA 2DLDA 4YQZA 1H5QA 4BNKA 2PGJA 3VC7A 2VHZA 3KHUA 1DO8A 3H65A 3MCVA 2PKRA 1QLHA 4WOKA 4E2XA 5I7SA 4MVJM 2DFVA 4OKNA 2J3HA 4KP7A 4WLUA 4IPTA 1HDZA 3RWBA 1QLJA 3GMDA 4Q3AA 1R0LA 1X7DA 1Y5MA 1QR6A 4XYEA 3JQEA 5IZCC 2B4RO 1PGOA 4J0FA 2DBZA 2QIOA 3RU7A 2Q4EA 3DAPA 3GZ4A 1SEVA 1LXCA 2P68A 2W2LD 3FCOA 1YBAA 1NXQA 3G79A 5FYDA 1OI7A 3BTUA 4R54A 3ULKA 1B3BA 1AUPA 1T2EA 1LEHA 5B4VA 1VSVA 3I3OA 3JQ9C 5U9CA 4R1SA 3IP1A 2OZPA 4B79A 5JLAA 1XR3A 3C1AA 3FNGA 2WD7B 4XRGA 4H7PA 1JWBB 4B4WA 3U3XA 1IYZA 1N5DA 2EF1A 2GUGA 1E1KA 1LC0A 2EW8A 1DRUA 4R51A 3SBOA 4IZHA 1HDYA 1BVRA 3PVZA 3ZV4A 3N74A 2CF6A 5CDTA 4RQUA 3JQ6A 1MGOA 2GN4A 5EQFA 3SEFA 4CL3A 3Q2IA 3GFBA 3RC1A 5IJZA 1E3WA 2AW5A 1VSUA 3AJRA 1UZLA 3PHJA 3WGYA 2H1SA 1FDSA 2G17A 4LCJA 4BO8A 1LTHR 1KC3A 1PGPA 4J91A 1H93A 3FR8A 3BMCB 1TA4A 5AXBA 2VOJA 5JAIA 1C0PA 1N9GA 4BGIA 3U09A 4I5EA 4D43A 2V65A 1GZ4A 3KO8A 2J6IA 2F1KA 4BUCA 4E5MA 3GRKA 3JQ9A 3EK2A 4E32A 3ZU5A 2G82A 4YJHA 1YOVA 1E7RA 3RFXA 2J8ZA 3WIEA 4CMCA 1ISHA 2JHFA 4BNGA 1SCUA 5JMPA 1E7SA 5LC1A 4DA9A 1A7AA 5F5NA 4J1NA 1MXHA 5T57A 4EW6A 5LDHA 3ZV5A 3F5SA 3TZKA 3CPSA 2C29D 4JX8A 1NR7A 3KYDB 5HM8A 3GGPA 1HDCA 3H5NA 5H81A 4NJMB 3JYLA 5A4DA 1EUZA 4IUYA 2VTDA 3V5NA 1EQ2A 2NTNA 1GR0A 1EFKA 4GGPA 4LSMA 2EJVA 4K9DA 1ULUA 3JQAD 3JD3A 1ZBQA 1T25A 3N58A 1E6UA 2HJRA 1P1KA 3IJRA 3Q6IA 4IDCA 2OP1A 4E5KA 3RJ9A 2D5AA 4OOFA 1Z75A 3PIIA 1DIRA 3VPSA 1MP0A 5M6DA 3MOGA 3ZI0A 4IZIA 2BI7A 1HYHA 4A73A 3ZN2A 1FJHA 1ZK2A 2WYWA 5KVVA 1PJCA 3E8XA 4DUPA 2B4QA 1CYDA 1WMAA 2BFPA 2NQ8A 5CDSA 1R16A 1RM4A 3I6IA 3RBZA 5IZ4A 2GSDA 2WMDA 1DDOA 1ZNQO 2YV1A 3W4JA 1LU9A 1ADFA 4CM8A 4KOAA 2Q1TA 4CLDA 5CG2A 1UJMA 4FPXA 4IQGA 4R01A 3ZHYA 5BSGA 1D7OA 3EW7A 3D3WA 2Y93A 4PLYA 1S6YA 1YBMA 1HETA 3E9MA 1B7GO 4FFPA 3AU8A 2W90A 3UF0A 1LLDA 4W7HA 1MUUA 4S3MA 1NFFA 3IOYA 4I8XA 2NSDA 3DOJA 1NHWA 2FRDA 1IHXA 2C0CA 3NT5A 1ZJZA 1ENOA 1J4AA 1O5IA 2VWGA 4IJKA 4J2OA 4WCFC 3H9GA 5H82A 5KJCA 5AQ1A 1ISFA 2OOSA 4J43A 4YRAA 4PVCA 1ZK0A 3QSGA 4R4JA 1GYRA 4KTTE 1E6WA 3TDKA 1LSUA 3EHEA 1C1XA 3WSWA 3C7DB 4CM5A 4L8VA 4KQWA 4MIYA 5EPOA 1W8DA 1KY5A 3WR5A 4CL8A 4B4VA 5JYAA 4QECA 2AEJA 3ZNPA 1BSVA 3C7CB 3UAGA 4B3JA 1L7EA 2D2IA 1DJNA 5KJEA 4UEKA 4YRDA 4B3IA 1VJ1A 1ZXLA 1YVEI 1A7KA 3BAZA 1PJQA 1NBOA 4LSWA 1H0KA 3U62A 4A5OA 4HX5A 3L77A 2NVWA 2Q46A 4FFOA 3G17A 1N2SA 1HZJA 1Q7CA 3E5RA 5C7IO 5DN9A 3GGOA 4URFA 3F1LA 2Z1NA 1H6DA 5C3MA 1FDWA 1HDRA 4FSHA 3NJ8A 1E3EA 3W8DA 1RM5A 2X9NA 2X1HA 3K8ZA 3JSAA 1D3AA 1O95A 4DLBA 3SVTA 1MA0A 4F6CA 3CIFA 2QG4A 4BKQA 3OA2A 3DXFA 2G5CA 4WCFA 4UULA 4PRKA 2GPTA 3HQ4O 3EZLA 4RF4A 2VYVD 3EAGA 4DRYA 4LGVA 2SCUA 1ZW1A 5F1OA 4DPKA 4RF5A 3TL3A 1XELA 2Q45A 4GI2A 5EQDA 3WDSA 4A10A 2GERA 3DO5A 4IJVA 4J4HA 3R3JA 3KXDA 2BD0A 1Y6JA 2GO1A 4J9VA 2OGUA 1BWSA 4PRLA 1WDLA 1DRWA 1LNQA 1F06A 3ZNOA 4GX0A 2GYYA 1NYTA 1WW8A 1PZHA 4ND3A 1VL6A 3BTSA 4CMIA 4CODB 3VAZA 2RHRA 4FFLA 1F0YA 4BNUA 2O50A 3EY4A 4XJTA 4FFMA 3G49A 2HKIA 2EWMA 1TT7A 5JC8A 3O8QB 3OFSA 2FN7A 4BIIA 3BMNB 2V7PA 3AY6A 4XJSA 3VOSA 4RF3A 5TS3A 1ZSNA 3AK4A 2Y68A 4AJPA 1KS9A 1E6EA 2P9EA 3DEYX 1JTVA 3MTJA 4NBWA 3RC7A 1O9BA 3JQ8A 2NU8A 3LT4A 3TOZA 3BMOB 3JYPA 4G65A 2RBEA 4UUOA 3W8FA 2ZQYA 3ZHXA 3Q2KA 4FJ2A 4XQGA 1WAMA 1HE4A 3L9WA 3IIEA 3UVEA 4ALLA 4F6LA 1I30A 1UZNA 1PQWA 2YFHA 3LC7O 3ZWNA 3O26A 3IUPA 4Y67A 4RPKA 3ONEA 4YXFA 3OEWA 1HWYA 3SLKA 1QYCA 1PWZA 1BDBA 4XYGA 3WXBA 6ADHA 4Z0TA 2FP4A 1D8AA 1UDBA 3PK0A 1ZFNA 1HSZA 2NVUB 1V35A 4XR4A 3DHYA 5JO0A 5CG1A 1XCBA 4O6VA 2WYUA 1LA2A 3RBVA 3H3JA 3OIFA 3C8MA 2QX7A 2X5KO 3HB4X 3BTVA 1NQAO 1LX6A 2D59A 1GFSA 1Z45A 1Q2XA 3BHIA 3R6DA 4GSKA 4F3YA 2CDBA 1JAXA 4ND2A 5HA5A 1IPFA 4JK3A 1EK5A 3F4LA 4A26A 1C3VA 3WNQA 4BVAA 1E92A 2GN9A 1ZO8A 4H15A 2P91A 5MGBA 4DL9A 3RSHA 3WGGA 1B14A 2O48X 1E1LA 1I36A 1R37A 2IEDA 4GX5A 3WMWA 2VZ0A 3WWZA 1V9LA 2NU6A 3AI2A 5LCXA 5DP1A 3EYWA 3V2GA 2Q99A 1KETA 3OM9A 4RO0A 1SC6A 4Q9NA 1UDCA 4BNMA 5H83A 4XGNA 4Y98A 3G1TA 4XRRA 3LZ6A 1OMOA 1SZJG 3KYDA 3FSRA 1QG6A 3CSDA 5T5QA 1X1TA 1FMCA 4TMFA 3RCBA 4NJMA 4YAEA 4TRJA 2I3GA 1YWGO 2CY0A 5JBIA 4R68A 3D0OA 3ZWXA 1P74A 4J2HA 4JJGA 4B3HA 3HE3A 2GZ2A 5DOZA 3T4XA 3IMFA 2VRCA 3R3SA 5KKAA 3UH1A 1O94A 2QYSA 4QX6A 1ZCJA 3EZYA 1GV0A 1KEPA 2FY8A 2RHCA 5DNAA 2CVOA 4CMAA 3ANMA 1Y8QB 2O4CA 3TZ6A 2P5UA 1F12A 3HDQA 4U7WA 4DMMA 2VHXA 3NKLA 3AWDA 1HYGA 1LBEA 3PLNA 3VZPA 4OXNA 2O3RA 4YT5A 1OBFO 4ND5A 3K9QO 1GY8A 1LSSA 3FBTA 4ND1A 5A06A 1IPEA 2YV3A 1JVSA 3HWRA 4TKLA 4NG5A 1AGNA 3DFUA 5K6AA 4EITA 3GN2A 4M87A 1YE3A 1QP8A 4ND4A 3D4NA 4YRBA 1CF2O 3OIDA 1GPDG 4Z0PA 4E30A 3H2ZA 3WSVA 3E5MA 2PWZA 1V6AA 3MEQA 4UEOA 3AUSA 2B83A 4Z0HO 4UVIA 5B4TA 4FC6A 4J7XA 3CMCO 2NM0A 3F47A 5I8WA 4KUHA 3CMMA 1GTMA 2CNBA 3TFQA 4IDEA 1E3WB 1NWHA 3DMTC 3FPLA 4LMPA 4XX0A 1H9AA 4TQGA 4K1LA 2I76A 4LMRA 4N7RA 3WYBA 1HE3A 1I3LA 1V3VA 2OP0A 4QTZA 4U0JA 2IEBA 3L6OO 1QV7A 4AICA 4J7UA 1EFLA 4ESOA 3I9MA 1N9GB 2XAAA 2OBNA 2E37A 1K0UA 3U9LA 5TRTA 3WG9A 4PG7A 3PYMA 4R3NA 1ZIDA 5DP2A 3UCFA 3OBBA 5DDIP 1T1SA 1U5CA 4YCAA 3JYOA 3NYWA 2NQTA 2HMVA 1SBYA 4YJHB 4NFYA 3ST7A 4CLRA 2I65A 1KYQA 1P3DA 3N7UA 4P4GA 3WTBA 2Y1DA 1Q1NA 1ULSA 1DFGA 1HLPA 2D1YA 4RPGA 4J1SA 2NU9A 2Y1FA 1B15A 3GVIA 3QVTA 4Q3NA 2I99A 2O3SA 4QT0A 2O3TA 1BG6A 5BQFA 4J1TA 4L0QA 2DTXA 1SPXA 4CQMA 4EI2A 4OGWA 5DZSA 4WUVA 1BXKA 1EMDA 1EK6A 1EVJA 4U5QA 5G4LA 4GKBA 3KOUA 1I24A 1NR1A 3P2YA 4R5HA 1J49A 2CUKA 4UUNA 5DT9A 4BKOA 3VKVA 3M1AA 1N1GA 3KLPX 3DMTA 4L9RA 1DPGA 1ISIA 1F8FA 1KC1A 3GPDG 3JTMA 1NX6A 4W9NC 3DBVO 1BTOA 1NVTA 4J7CA 4E2WA 3ADOA 3PJEA 3A9WA 8LDHA 4R9SA 1IL0A 1NASA 4OAQA 1ENYA 1UAGA 2JAPA 1IB6A 3UUWA 3EMKA 4D3DA 1DC4A 4QUKA 2QYTA 3I23A 4DBVO 3GAFA 4PGFA 1DHTA 5FEUA 2O7QA 4CM9D 5JY6A 1T4BA 2FSSA 4ZQHA 3EUWA 4M55A 4LRSB 1PL6A 2DU8A 4GAEA 3VH1A 5L9AA 4EYEA 4LW8A 2YJZA 4J6FA 4CM8B 4BKRA 1E3SA 2GNAA 4NFSA 2VT3A 2ILTA 1JA9A 2HAEA 2Q22A 3NRCA 3A4VA 4GX2A 3PZBA 4LN1A 4ZQEA 4E13A 3KYCA 1HL3A 2I3AA 3D5QA 1JU9A 3DZHA 3ETDA 1ZK3A 5DULA 3D3WB 1UP7A 1YBVA 1PS0A 2A92A 5ES3A 2CD9A 4ALJA 4ONEA 3ZU3A 1KBZA 3O8QA 1ARZA 3GG2A 4MKRA 1P0CA 2VCYA 4BNZA 3RC9A 1AHIA 5G0TA 3ROMA 3ZZNA 2OUIA 1P44A 4NQZA 1EBUA 2HMUA 1UXKA 1ORRA 1NAHA 3AUAA 2B5WA 4N54A 4IM7A 3W6UA 3MJ4A 5MDHA 1IY8A 5BSHA 3KTDA 3GPIA 1HSOA 4EJMA 4DPMA 2AQIA 4J49A 3FR7A 3H5RA 1GUZA 1X1EA 1SMKA 4RV9A 4W9NA 2Y0CA 1C1XB 3HFGA 2IZZA 4PZEA 2Z5LA 1E3JA 5CFZA 5KJ6A 3C1TA 2VUTA 1NQOA 3QRWA 1LRJA 3UFXA 4DTIA 3PFWO 4RZIA 5KNLA 2NTJA 1DBVO 4D0SA 4TROA 4RDIA 1U3WA 1YDWA 1NVGA 3WGQA 4IQ8A 3PEFA 1CJCA 5DBGA 1YB5A 4XYLA 2I67A 2JJYA 1H2BA 1P1RA 1U4OA 1B16A 5TF4A 2VN8A 3WNVA 3M2PA 2HLPA 1VLLA 5JXWA 4E21A 1ZUD1 1VPDA 2HRBA 1N92A 4OHUA 3GNTA 5ENVA 4E31A 3ROKA 3GAZA 4GX1A 3U4CA 2EP5A 3PTZA 3L4BC 4HADA 4DXHA 1XQ6A 1M66A 3HADA 1M6WA 3STHA 4RLSA 4WCFB 2VQ3A 3RJ5A 4K28A 4BO4A 3FD8A 4L75A 2B36A 1ZZEA 4QO7A 4CV0A 5HS6A 3VKUA 4QQRA 1YQXA 4RZHA 1KVQA 1LC3A 3OJ0A 4CUKA 1PGJA 3U5TA 3JD1A 3Q11A 2HRZA 3I52A 4BNJA 1RPNA 3LK7A 1CERA 3CINA 1U3TA 2HCTA 3NX4A 3PXXA 4CMEC 2QW8A 4YJFB 1ML3A 3UGKA 2IZ0A 1CEQA 5JO9A 3WLFA 3OH8A 4BNWA 4CMIB 3ZHZA 3ANNA 5IN5A 1W4ZA 4JQCA 2E6UX 4NH4A 2J3KA 4FGSA 1KIFA 1P1HA 2IYPA 2D5CA 3V2HA 4PLGA 4GLLA 1H6AA 1A5ZA 2W8ZA 2E82A 3OQBA 1Y8QA 3PI7A 4LVUA 3FHLA 3K96A 3AOGA 2V6MA 4FDAA 3PGJA 2C5AA 4G5HA 4CMGA 1JN0A 4GQAA 2LDBA 5U1PA 2GLXA 3FWZA 3JQ8B 4R69A 1DIGA 1NAIA 4OO3A 4PVDA 5T6BA 5JC1A 5JW6A 4JIGA 3LLVA 4AJJA 1ZVMA 3SX2A 1HYEA 3K73O 4FN4A 1ADGA 1WWKA 2FSVA 2Y99A 4PN3A 4JLWA 1LI4A 3ZNNA 3B1JA 5F1KA 4FOOA 4CMKA 2IRWA 4HFJA 3O38A 2QQ5A 2B4TO 3VVCA 3G0OA 4RL6A 5A9RA 2VHYA 1CETA 3DTYA 4XYMA 4E6PA 4QSMA 3FNEA 1LLQA 3C1OA 4D7AA 4MVJE 1EE2A 4BOYA 3ONDA 4CMEA 2YYYA 3NT2A 2VHVA 2A9FA 4AJKA 3LYLA 2AEMA 3D4OA 2YHIB 2C07A 1NVMB 2WTBA 2G0TA 4I5GA 2VRCD 2FPIA 3UKOA 4K6FA 2EV9A 4R1TA 5IZCA 3W6ZA 3GVCA 1SB8A 3OICA 4X54A 3VZQA 2Y67A 3L07A 5L4NA 3INTA 3MWDB 4AVYA 3PWZA 4RPJA 4CV3A 1Q7BA 1LLCA 3BXXA 4CUZA 3I9JA 2I66A 3NEPX 2ZB4A 4LISA 2A94A 5BSEA 4CM7A 2R2GA 5C7LO 3DFZA 1K5HA 1YS4A 3BMQA 4E5NA 1P33A 5A5FA 2Q2WA 3CEAA 3BHJA 2X5OA 1VC2A 3VTFA 2OXIA
chains in the Genus database with same CATH superfamily
4DA6A 3FPAA 3D3NA 3I8SA 3PQ5A 3WHLA 2FR1A 2XB4A 1E2EA 1KI2A 2YJ5A 2ZATA 1GEEA 3L06A 3QKUA 4C5BA 4X45A 1UBFA 5LLSA 2E49A 2P69A 2KMLA 4I6JA 4H1VA 4F4DA 2PBLA 3FF1A 2EKLA 3AFIA 5EGSA 2I1WA 4QBTA 2Z5VA 3UMVA 2PPLA 4XVUA 4AD8A 3G1UA 1TW2A 4W5OA 2QSJA 2O20A 2WOOA 1TAHA 3QA3E 2AWOA 2FEPA 1WEKA 5IFLA 2R00C 1TZBA 3EHDA 4K9PA 4YI5A 1C8LA 1E5VA 4JLDA 2PBZA 1CJBA 1H1LB 5IAGA 1FL9A 4RF2A 1X9GA 3S6JA 4QLAA 3ICWA 1XFDA 4JI3B 2UUCB 1GXSB 1TRKA 2C04A 1J2JA 1G17A 1KJYA 1NRIA 1DAHA 3EIWA 3W06A 5KU7A 3OOJA 5TVGA 4HLDA 5L51A 3NMUF 2WA1A 2YQ4A 4RV5A 3QITA 3A9RA 4OMUA 5LZ7A 3OMXA 3I9OA 4Y18A 1J1ZA 3PDJA 3WGVA 3FCAA 3WQSB 4BC0A 2N9UA 1GQOA 3DEFA 1EEXB 2IIVA 1NZJA 1X6VA 2E4VA 3BYZA 3CLKA 4JBIA 4N0MA 4RJJA 2YUTA 3AP1A 5DTJA 5IM5A 2O8EA 2VOEA 2C2OA 1H65A 3UEOA 1ZAKA 2NG1A 5CT9A 3NPAA 4RAQA 5FO1A 4F04A 4LXXA 4XQ0A 1GRCA 2CL7X 5ALWA 1RHRA 4KJXA 5KEIA 4OK5A 3QX3A 2E0IA 4NPAA 4PF1A 1Q83A 1QH8B 2GPNA 4PC2A 1YS1X 4G5QA 3IWCB 4MAAA 4PBRA 5HFAA 4B81A 3ZUGA 4BMXA 4EG0A 2BFBB 2JHGA 5LOVB 2FW0A 4WFQA 1SZCA 1XRJA 4RWZA 5A3JA 3RNLA 2GZAA 4PYOA 3FWPA 4CTMA 1RM0A 3AR4A 4WVLA 4CEIB 3BSWA 4WZBA 3VKGA 3QSYA 4TMTA 5KYXB 3VKHA 2DUUA 2LKDA 4GOLD 4C22A 3GFQA 1MX9A 1GFWA 3W8RA 5A2GA 1YDEA 1BEEA 3BRSA 1G1MA 4EHFA 2DPMA 2JLSA 3HUUA 3QVLA 1Z0UA 2ZQ5A 3D4PA 4M1SA 3G7UA 2VJOA 5I9SA 3L84A 1C1YA 1CZRA 4C87A 3KB6A 4BU1A 4PG5A 1CUYA 1VMAA 4UU7A 2EJTA 5FNVA 3ZCRA 2QTLA 3C87A 3PC8A 2QTRA 4IDDA 2IP2A 2RHLA 3DDUA 1O9GA 2JS7A 2WHXA 2OB2A 3QYFA 4UAGA 5KDDA 3DS8A 4K81B 3AEQA 3R24A 3RVLA 4NCJA 2HJGA 2DY1A 2HWXA 2IHVA 3K9FC 1ORWA 2C8LA 4JR0A 4GC9A 4QGHA 1H69A 2XZDA 4LGCA 2P7IA 1XDUA 2G06A 2EERA 3DD1A 1M2NA 4F1WA 2P4HX 3FH0A 4C43A 2EC5A 1X77A 1Z6PA 4YJ2A 4ZZIA 1EZ4A 1XD8A 4LWPA 1CUWA 3ON5A 5LDGA 4EATA 5IRCD 2C98A 4IFIA 3GWGA 3BSSA 2WNHA 4OYHA 5AXAA 1OFGA 3WBFA 4HQRA 3RUIA 3C5EA 1RWKA 4OB8A 2FVYA 1MJHA 2YHBA 3FWNA 2WD9A 2WHPB 3EPLA 2NXNA 3RIYA 5I51A 3AL0C 2ID9A 4RC9A 3EOZA 3WMRA 5CT4A 4EUEA 2RMKA 1RWPA 1VSTA 4U2GA 3OKAA 1L5OA 4ALNA 1OLSB 3L46A 1D1SA 1BN6A 4M3NA 4PQGA 4Q7EA 4CCWA 3GJ3A 1BWQA 3K5IA 4YHHB 1N77A 3D6MA 5EYPA 2D54A 5KAPA 2DQ4A 2RH8A 1XXLA 3MUFA 4TSFD 4Y9DA 2BGWA 4W5JA 3TRKA 1P1FA 4NOLA 5GGYA 4ZJUA 5AI9A 4A2PA 1HRKA 5KAMA 2Q5LA 1I1HA 2OHVA 3BM5A 3OE1A 5HR5A 5LDDC 5J2UF 5AOVA 2DUNA 4U9HS 1F17A 3HCBA 3TZEA 1G4UR 1V8ZA 4RDHA 4TWIA 1A50B 2VF4X 3ILSA 3P19A 4WZAE 1V7PC 2HV9A 2Q6IA 3VYSB 2WTMA 3HO6A 4RZXA 4CKXA 1NW9B 4H7EA 4K9OA 4YP9A 3RTGA 2BKVA 3LCUA 4QJ5A 4A0RA 4UAVA 4R9VA 2R8RA 4KLAA 1NL3A 3JCZA 2PH3A 2C2YA 4MS4A 5AI8A 3THXA 2W6NA 1AU9A 4ILEA 1UKBA 1E94E 3TPZA 4YASA 3IEUA 3PNBA 4M99A 1I8TA 2WF5A 1JHRA 3LIIA 4JVMA 2JGKA 1KOLA 1U7XA 2VUHB 3GC6A 2FZKA 2XE8A 3BEOA 3CUKA 4FEEA 4LBZA 4MP6A 4OU4A 4PR0A 1UAYA 1UK8A 4P54A 3Q3GE 1TZ2A 4ECAA 2WT4A 3I92A 3PEUA 1DX6A 1MV8A 4IAOA 5CA1A 1CS4C 4LQDA 3PJFA 3ZHTA 1VG9B 1OLUA 121PA 2I4LA 4LBWA 4CIAA 2J0UB 4M1YA 1R4MA 1UODA 2ZUDA 3D6FA 1N2OA 2PUWA 4G41A 4NIMA 3DHWC 4BWVA 1SWWA 4XGIA 1SXJB 3B12A 3N6RA 2OV6A 4HRYA 5FKJA 4Z1OA 1WEHA 5KZMB 1LUAA 1XMJA 2VPTA 2VDUE 2FRXA 2XECA 3DBLB 1S02A 1OAOC 4NEGA 4PCVA 1DCTA 3F7TA 1LRLA 2JZNA 1JF8A 2O2XA 4NCXA 2IY7A 4MW9A 1DQZA 1XD2B 4M8KA 5FBRB 3IDFA 5E38A 4RVCA 5IH7A 2Q6VA 4FR0A 3BIFA 3CKMA 3T7TA 1DRJA 1SZPA 1FFYA 4D41A 1U7OA 4I1VA 2HW8A 3QP9A 1IK4A 3UV6A 5JARA 3P5BA 3UK6A 2DQKA 4C7OB 3EA5A 3WGJA 1M2GA 4HKTA 2JCXA 4QHSA 1VMEA 3FZQA 4TMXA 4PQRA 2Q1XA 3V7NA 2NUBA 5WRFA 4GE3A 1CB0A 1CEXA 3HKDA 5MF6A 2NW6A 2JARA 4BE4A 2CBXA 4DMGA 1NKVA 1MB3A 3DAHA 1QG2A 3ICPA 3S8YA 3CRMA 2ZPUA 5C0OE 2ZKIA 3TQRA 3W5IA 1JDZA 1QIIA 3MMZA 3NM4A 4BQRA 1LKZA 4GL2A 1FFWA 2H2IA 4Z4IA 2XWJI 2MYTA 2QORA 1FDOA 2YJ4A 3RT9A 2FI1A 4QUDA 1JJFA 1XNHA 3ZW8A 4IBOA 5HFJA 5CDGA 3SSOA 4BTLA 1DOHA 5JAUA 2C5EA 3ICEA 3WQHA 3ESRA 5HQTA 3NM5A 1P91A 3TLAA 3RF6A 3V4SA 1F3OA 3HABA 3MBOA 4C0LA 1DEHA 4KIUA 5BR1A 3E5HA 5JJIA 4BBZA 4DGQA 2ZE7A 1BA3A 2JLAA 2HO5A 4RHXA 3IXQA 3N39C 3GFVA 2J9RA 2JH9A 2Q5IA 5K8LA 4KAFA 1U9JA 4GM1A 4I1UA 3NP7A 1OA0A 3L4SO 1U3VA 3P1JA 2B7CA 4CW7A 2Z83A 1CC1S 3CLUD 2HTFA 3DQPA 3X2SA 4E5DA 5A9TA 5L8VA 3N8KA 2PZAA 3QBDA 1ES9A 4WEQA 2OG2A 4PG4A 4X66B 2QE7A 5AVZA 1KJZA 4BNYA 4GSLA 4Y6SA 1TI7A 1YACA 1U1DA 2GFQA 4J3NA 1H4TA 3CCCA 5EIBD 1RJ9A 4B76A 3FM9A 3NWOA 5IXJA 2OKGA 2IK8A 3IDSA 1DEXA 1M1NA 3BFPA 3NAZA 1KDRA 1T2DA 4WA7A 3SC6A 3SXPA 3WGHA 5DI3B 2O2IA 2ZBUA 3OX2A 1ULZA 3OX3A 2I7DA 3ZGOA 3WGNA 5LUAA 3H9QA 1KEUA 2I4RA 5FJIA 4GPIB 4MZXA 2IDZA 4OJNA 3T9EA 1Z83A 4EPYA 2XXBA 2RB5A 4RK4A 2CBZA 2IU0A 1FJXA 3DCJA 1TM3E 3BZUA 2R79A 1UFVA 1O1YA 2HPAA 1Q57A 2BEWB 2C9DA 1OZHA 4CUJA 5EN4A 3VOTA 5B6JA 3R0IA 1EDBA 2HEGA 3AEUB 1K6JA 4H7FA 4JJ8A 3EIXA 4BMYA 3NHAA 3O2QB 1JU4A 4L73A 1BYUA 1CRWG 1PUXA 1SG6A 3HDHA 4Q82A 3D7SA 2VHEA 3W2GA 1RYNA 1EJ2A 4MQEA 4BNNA 4JGBA 5EY5B 1BDMA 2M1XA 3ZW7A 1UZMA 4IOMA 4JBYA 1U1CA 4JWTA 4UUQA 4UVHA 2JZCA 3TINA 2A5LA 1U90A 1SC3A 2HWYA 1IBSA 1YRAA 3LUAA 4XB2A 4QOFA 1EFPB 1EWYA 1VYVA 2HU5A 4XKJA 4U02A 2Q3JA 1UPCA 1PR6A 4P4SA 4CR8A 4ZAWA 5BR7A 3NBZC 1GAWA 1HRDA 1IWPB 1S3GA 4CLEA 3INGA 3CYFA 1YAHA 3DTVA 2EOAA 1CP2A 3KS9A 2UDPA 4XFDA 5ALTA 1W75A 3GRRA 1CUSA 5EJ4A 2ZTMA 2PWAA 4R83A 5JFTA 3I64A 3UC5A 2AOTA 1R5OA 1A4IA 4B8YA 4WOJA 3BX1A 2NP7A 4AKEA 1Q22A 1GGJA 3ACDA 3E27A 1JECA 1DFIA 4AB1A 3V2IA 4QATA 1HX7A 1RPZA 4G01B 5ICSA 2CE2X 4HVTA 3ANSA 5KYWA 2HHJA 1RPTA 5GINE 3RSZA 3WA6A 1MN6A 1RKQA 3X1DA 3PDWA 3FKSD 3BZWA 3K9LA 3MRTA 5E6SA 3GGCA 2ZIUB 2MR6A 5DCYA 1N1MA 2ZYDA 4YPVA 2D0OB 2HXGA 5JDIA 4F2WA 2R0QC 1DLJA 4LIPD 1DAEA 4B6PA 1NN5A 1ECGA 1ENZA 1U8TA 3AJ9A 3CF2A 1K7YA 3LYAA 5EXXA 2C3MA 3CG4A 3DW3X 5CCDA 5ALPA 3TLGB 5I6DA 4MWZA 4GFDA 1C7ZA 2Y3IA 4LAFA 1JXMA 2IODA 1NN1A 2WKSA 4BGVA 1MVOA 4C4ZA 3V4RA 3BVPA 1HH4A 3KELA 4OTZA 4L4RA 4MLZA 2OYSA 2R2AA 3B6EA 3LW7A 3UXHA 2B8TA 1QGAA 2WWTA 4ERXA 3VDNB 4NHOA 1XQ1A 4YV7A 2ODBA 5IANA 1Y6FA 3IPLA 3DVRX 1Z6TA 5TY0A 4M8LA 4CYMA 2FPKA 2H54A 2X9QA 5BV2P 3SHFA 1BGXT 1R4NA 4GM4A 3AVXA 4DR1B 1SVKA 3AV3A 2J7KA 2EAUA 4Y9TA 2QLLA 2WSSA 3ZHBA 5MHTA 4YQEA 2QNRA 4JP2A 3G2LA 4JHXA 2R1VB 2NZJA 4JI0B 4MYTA 3DL2A 5HQ3A 3BRQA 3OETA 3ZY4A 2C0PA 4QUEA 4YEDA 2HHCA 3ROQA 1FJGB 3T5DA 1T2NA 4AYTA 4BNVA 2PXHA 2I6TA 4LXHA 4BWYA 4AN4A 1EEHA 1YCDA 5LP6A 1G2OA 4YJKA 4K6KA 4CM3A 1P8JA 5IF3A 2WT8A 4RFSB 2X0IA 1DKNA 2Z9CA 2IHKA 3L7LA 3MOIA 2YYSA 5AT1A 5LYYA 3VFDA 5A4IS 3B9QA 2VJMA 4M7WA 3ECSA 2Q4RA 4K6CA 2I4MA 3VR3D 1VRVA 2GCGA 4EECA 4XDGA 5DBEX 1N75A 2PKWA 2RK3A 4UXHA 2YY7A 4DCSA 3HWSA 1U2DA 1ZXBA 3AI3A 5JG7A 4P35A 4Y6PA 3EC7A 2RHGB 4RUKA 2GD0A 4L5IA 4Y6GB 4A6DA 6GPBA 2QBYB 1KKMA 2FUG1 1MNAA 2C9MA 2X2PA 4GBMA 5EE1A 2UUOA 3SEQA 3UCEA 5C8YA 4B1FA 1R8XA 1XTQA 2FUEA 3V1LA 4MPTA 1SIWA 4QNMA 3O0DA 1K97A 4M89A 2C7PA 1RLJA 5HKKA 1UXIA 4G4GA 4ZAVA 4DSTA 4PX9A 2BBSA 2E85A 3DHEA 4HRXA 1NLYA 4R2WA 4RD3A 3ZX4A 1SXHA 4E4YA 3HY4A 1EWVA 2OCKA 4Y1FA 1OFUX 4Q7LA 1GTG1 1MQ9A 4WK6A 421PA 2D4AA 1PV2A 1F8GA 2GF2A 3H4VA 5A0FA 2UXBB 1JFLA 4NDZA 1Z73A 4MRMB 2FSPA 2OFXA 4ZCLA 2GTIA 3NWJA 1WVGA 5DCUA 5FWDA 3K70B 2BP7B 1AV6A 3LBNA 3HV0A 4XASA 3VVLA 2J6CA 3Q7QA 5FOWA 5JXJA 4LZNA 3P9IA 4E0BA 3EFOA 4YP0A 1J5PA 1KBQA 3DOOA 2VAPA 3FOAA 1D1TA 3OZVA 4WPGA 4RQAA 1RXYA 4KG7A 1JT2A 4L4ZA 3PFNA 4TZTA 3W05A 2NO1A 4ODIA 1PJ2A 1K8RA 5B3JA 4JEUA 4BX3A 2ANBA 4F5DA 4DV0B 3ZCQA 5CCBA 1GPYA 3HGMA 3TI7A 3LY9A 3BN3A 3DBHB 4LJKA 5H70A 3BWMA 1V8FA 4OAPA 4OJTA 3GDOA 1ID1A 2ZJ1A 1QPBA 1EGAA 3HDGA 4DV1B 3RVRA 4ZGGA 1I33A 1W59A 1ZH2A 4XZ3A 3U60B 4MULA 3DONA 3KFLA 1QBKC 1NUAA 2YV4A 821PA 2VP6A 3PNYA 3WYCA 4MJXA 1FC0A 4PC1A 4G2NA 1N6IA 4FHEA 4ZALA 4NPHA 4JOCA 3ZCTA 2IGTA 1UMCA 1N2CA 1HDOA 3NDRA 1U1IA 2QV0A 3WL6A 1W2WB 2NAFA 2QJTA 1HC7A 3UAYA 5BUQA 3CPEA 2QVCA 1I5RA 1UBRS 5KNCH 3OZ7A 4BNLA 3RKRA 3OZRA 2XKBA 5EUQB 4BZZA 4WNAA 3U48A 1C0LA 1EQUA 1YQGA 5TEVA 4BKPA 3IOMA 3ZXXA 3TRDA 1VCMA 4L5CA 2IVFA 4DSUA 4JBHA 1ULAA 1JHYA 4AMYA 4UHFA 3BXZA 5ALSA 1NY6A 3KPYA 4EUFA 2XMSA 4MW5A 1AA9A 3DQQA 4UOEA 4IY1A 3I5XA 2B1IA 5IP5A 3UK7A 5FBVB 2QHXA 4FSDA 4KQFA 4CM6A 1WUJS 2EP8A 2Z08A 4E5YA 1M34A 5KIAA 3GDWA 2OORC 1CZNA 4R05A 1G4AE 1OLOA 2A0FA 2RG1A 4O2BA 3ZDXB 1TCAA 3A2NA 2J3JA 1RWMA 3ZJ4A 1DNPA 2CB9A 3NC1C 4L74A 1CJUC 3WADA 3PHIA 3Q5EA 3NS7A 4PG6A 3TSOA 5FWYA 2Q1WA 1UINA 3I39X 1C50A 1U7HA 4MS3A 3RUFA 3H1AA 3FI0A 1V43A 2PMBA 3SSMA 1L7OA 2FPUA 1IUNA 2QTVA 3T3EA 3TSAA 2I55A 2QRVB 2VDMB 5LMUB 3U3OA 5A5GA 1DKPA 3ZVNA 1OZFA 1WB9A 4QBKA 1PHPA 2RDMA 2H9AA 1IEVA 2F8TA 4KWTA 3Q3CA 2ZK7A 5ERGB 2BAGA 2K5UA 1XI2A 2ROQA 3CONA 3E03A 3FAKA 5L7TA 2G1KA 4UVGA 1A5SB 1U3UA 1IBCA 1SAYA 3HPQA 1VIDA 4TSKA 3PQCA 2O0MA 5B30A 2Y05A 4GMDA 2PSFA 5BN3B 3KQKA 2FWBA 2V5VA 2OPBA 2V03A 3QTLA 4GLFA 4F12A 4O59O 4C06A 3D4LA 4N18A 3DLIA 1HV8A 4UUBA 5IJ0B 4KO8A 3ZD7A 4D74A 1YU9A 2XLBA 3RC2A 3WMXA 4DR3B 2YXBA 5F3RA 2QZSA 3BULA 3W3AA 4ZEOA 1TMOA 4QYSA 4ZGBA 5AVSA 4HXYA 1RI3A 1PJSA 1VYUA 1XQYA 2IT1A 2QP4A 2ZIXB 2O23A 3AHFA 3F7MA 1CIPA 3BJEA 3LP5A 3HACA 4B09A 1PX2A 4OVKA 1NRWA 3UATA 2CMFA 1WMFA 2GA9A 2P5YA 5I7VA 2PV7A 1M2EA 3E6AA 2IV7A 1FQKA 2K4MA 4Q39A 3U4GA 4O1MA 1EK1A 4M1WA 5DW3A 4BQFA 1JHVA 2BM9A 4BHTA 1DRKA 3FZGA 4DCMA 4NJEA 1Q50A 3X0DA 4D56A 3PC6A 2GGSA 2XQJA 3NHMA 3PGXA 5LUBA 3WLLA 1WLYA 3N8IA 3Q7SA 4DRZA 2OV3A 1ONNA 2ADOA 4OY3A 1QQ7A 2BFFA 3SY8A 4KBFA 4D0RA 2BFAA 3CLVA 4EJSA 1OGJA 2NIPA 3VR2A 2B34A 1MQSA 3PQVA 2DR3A 3STUA 4TTTS 5I8ZA 1BE1A 4RTQA 2JLBA 1NRXA 3GZNA 3PZRA 4RSMA 3O21A 3SHWA 2QVZX 3TL2A 4H1WA 3ROXA 3DZ5B 2AFIA 1Q3HA 1SVLA 1WXDA 3WB9A 3DOUA 1K2WA 1ZVQA 3VMMA 4JCOA 2I6GA 1RZ3A 1GPBA 2A9VA 4MTLA 1SUAA 1UDXA 1Y48E 3VSDA 4D9CA 4NONA 3LYUA 4NLLA 1PL0A 5KYVA 1XHFA 3WGTA 3UK0A 1ONSA 4TVBA 1GZ6A 2OL4A 2YOHA 3A3KA 5IM4A 4QULA 1HZZA 1PJBA 2DZDA 5FO0A 2K87A 2SKDA 1ISGA 2GLUA 2AE1A 1A95A 1I4WA 4CKEA 1DC5A 2FZCA 4F84A 1Y1KE 4UCFA 5EWLA 1IY0A 3OECA 2PJUA 5FOTA 1A2OA 5D51S 4Q5IA 1P4JA 1EBFA 1U2GA 2J9GA 3U4QB 3QKRB 1ZVJA 2FZEA 4IG4A 3D59A 4JT9A 3RB8A 4KMMA 1SKAA 2DHDA 2W98A 2ZI6A 3AFMA 5U4QA 4O29A 5KNBD 1USIA 3P5SA 3QUQA 1DG3A 1RIIA 1JBKA 1OXBB 2JFNA 3BGIA 3Q9UA 4GHWA 3M6IA 3M9XA 3RR2A 3DTVD 4LYJA 3C7TA 1DJQA 3U3MA 3LOQA 1TYZA 1QKIA 2GBLC 1CY4A 3TG2A 3Q40A 2CYAA 2RBKA 2ZI3A 3AH8A 3W5DA 4PHCA 4HYEA 3PYXA 1W4LA 5JYFA 3DAFA 2P2LA 1X92A 3BSFA 2IZOA 2XF8A 4C9BA 1J5EB 3MJEA 1DEAA 4OFZA 1O6ZA 1PFWA 4YRMA 3SLGA 3RI3A 4YT2A 1HLDA 1E79D 1E1MA 4WASA 2AXNA 1B8UA 4HUQA 3NIGB 1Q95A 5BQ3A 3B2EA 4L9AA 5LZ5A 2A58A 4KFCA 1JHUA 2VATA 1RYYA 2GPSA 3MWEA 1QORA 3WL4A 2BGIA 3ELWA 5JDCC 4M46A 3QLJA 4JT8A 4E15A 1D6MA 4ROSA 1XTRA 4LKOA 2G4LA 2WUGA 3FXAA 1W0KA 2F9LA 4AJOA 4IIVA 1NOJA 1E96A 2QT9A 3ECCA 4NBTA 5TC4A 1P4RA 4ENUA 4EL0A 1Z74A 5HS4A 2XQVA 3AR6A 2VAWA 4NI5A 4OHOA 4OV6B 4NYMR 5EIHA 5EXTA 5L3RA 5H80A 4HPWA 1K92A 3KSRA 3PUIA 4O2AF 5HMMA 4CQLB 3UMMA 1VMIA 4LDQA 3F2VA 2QK4A 4LNUA 4XE5A 4DT1B 3EIFA 2CLCX 2WWXA 1Z2OX 2YYZA 3W7VA 4GYKA 4FYPA 4IDBA 4E1AA 3BWXA 1NI4A 3H5TA 1JAYA 3N5KA 3M6AA 2WSSD 2WWWA 3OP4A 2W71A 3P20A 5GOTA 5JAZA 2W22A 2D4HA 4RCVA 2XB2A 1FSSA 2VRNA 3LT5A 1IJKA 2Q3FA 3ELBA 4DZRA 3IJ5A 2X14A 1QRDA 3P4YA 1EFVB 4FYYA 5T4BA 4CQMD 5EERA 3NDPA 1ZM3A 4MV4A 4EA7A 1PEDA 2WLTA 3FVTA 4HWPA 3RS7A 3DR3A 3JRWA 3O73A 4LTNA 4ZDWA 3WOVA 1URPA 4TVSA 1JFFB 5AHOA 2MJLA 1L5FA 1QIDA 1WHTA 4RMHA 4X5OA 3KJXA 5JSZA 5J9GA 2JW5A 1AXGA 1Z3IX 3UAVA 3F3YA 1JENB 3NASA 1AGYA 3FVVA 3S5UA 4X7RA 5AW0A 4P8RA 1TL7C 2NZUG 4DLZA 1G6KA 4P4NA 2XCUA 1E9VA 3K5PA 4WLEA 3GF4A 2BBWA 1M75A 1A1VA 4G9GA 2C82A 2ZS7A 4F1KA 3E18A 2VDNB 3T6KA 5LYJF 2B1QA 3JW8A 3IAS6 4M54A 2G9NA 4IIEA 3NDBB 1UBHS 2WJPA 4ZRMA 3D6HA 5EIOA 1H85A 3GJ0A 1HT1E 4NZOA 4ZEXA 5JNRA 1RHUA 1KFKB 2VQDA 4KK4A 3TE7A 3VNBA 4EB0A 1XWWA 1VE3A 5ABPA 2ON6A 4IZ6A 5HJ5A 3G0CA 4TMWA 4WW0A 1RMYA 2X4DA 3GN1A 2J30A 1JHMA 2PFGA 2RAUA 4FZVA 5EI5A 5J4VA 5AH0A 4TXMA 5HKKD 5LB2A 1KVTA 3R5FA 2W6CX 3DKPA 3DT9A 4G0NA 1RACA 2QG6A 2DSTA 4ZI7F 4HN4B 5L3VA 3I5YA 2R7LA 1K9VF 3HBLA 3KEOA 3GJ4A 5C51B 4W5TA 1GTL1 2HZ7A 1W0JA 1XXHB 3BF7A 1Z7BA 3P96A 3WZLA 1D9ZA 2XUAA 4RMIA 3JZIA 4H1HA 4ZC8A 1E7MA 5K51A 4EY4A 2GKOA 3UAXA 3VOBA 4Z5XA 5JBNA 1PW5A 3R6WA 1RJWA 3VPAA 5REQA 1NDUA 3QVXA 3K05A 3BDIA 1DCFA 5CDHA 2C96A 3LBYA 5I9LA 2VA8A 3AIKA 2Q1UA 2GWRA 2RKOA 2YWJA 4PEVA 5GM1A 4BCDA 4EUNA 5I7FA 1UKEA 1BEUB 3QPCA 5CVDA 1V39A 1E2JA 1IZ0A 2ZJ5A 4BB9A 4LYEA 2YXEA 1P6XA 1VP3A 2A30A 5FA5A 3AJAA 2VS1A 4KEAA 2W2TA 3DPIA 5J1TB 1A8SA 3MJVA 1AHNA 1ML4A 4P7JA 3EP7B 5TPWA 1M8JA 3K2BA 3B38A 3SZLA 3T5MA 3AVUA 4BMPB 1K8ZB 3F90A 1BU5A 4EFLA 2AG5A 3IV9A 3LCVB 4NOKA 3OQMA 3NHRA 1OX4B 1N6KA 4NFHA 4H3VA 2ZYWX 5IT0A 4QQFA 2ODAA 5T41A 4NBLA 1KK1A 1N6LA 3SHVA 2G9VA 2Q5CA 2GCIA 4I4IA 2XRFA 4YP1A 5IT4A 4RIHA 2I2XB 3JPWA 1WSDA 3DE2X 3ND5A 1LZKA 1VKZA 1YC2A 1DTWB 5IAEA 5B58T 5KQMA 1K6XA 4Y1RA 1DAFA 4JSYA 2V6IA 1DWPA 4Q7QA 3IV7A 3EWSA 4JV5B 2ISQA 2VNHA 1QH1B 4CDGA 1HM5A 5DM70 1MC4A 2OZKA 3KJGA 3E48A 3V80A 1N78A 1V11A 1J2YA 2B9EA 3CRW1 2ZUUA 2FAXA 4XDYA 1GV1A 5CFQA 1TIPA 1MC1A 1JLLA 1I6WA 3PWTA 3V8RA 3ELDA 4J16A 2HJSA 1OBVA 3L7OA 3UHAA 3GEHA 1XP5A 2IHNA 3DL7A 4JJ7A 2C7GA 1VLMA 3EUEA 4J4BA 3WICA 2OV8A 3G8YA 3KXPA 2XDQB 1SVOA 3WLHA 4N0QA 5EL0A 5EHQA 1FTGA 1A2KC 1HI9A 1EDOA 1WD5A 3WO1A 4Z4CA 1NNI1 2PAAA 2YZ2A 3GLKA 1A2BA 3QIAA 5G0VA 1I9CA 2G9QA 1IEQA 4N40A 3H0VB 3BBPA 4MUJA 3DMGA 1VJCA 2OB1A 1XCOA 1SBTA 3A6EA 3CX7A 4NYJR 4YALA 1SKUA 1V0JA 2AF4C 2FVXA 5I9TA 4NPCA 4AXBA 4CR7A 4TYNA 3FPKA 3QVGB 3KE9A 1E59A 3OZTA 2JEOA 1P31A 2IPLA 4Y30A 4Q0MA 4V2IA 3RV4A 4JN6B 2X8JA 3MA0A 4TRNA 1E1NA 1L8XA 2FOIA 1BAPA 3RROA 3JQBA 4OQMA 5FF9A 4ZWNA 3AEKA 3RFCA 4CL0A 1JKFA 1XCMA 3KQQA 4PS1A 4JI6B 2WU8A 4TKMA 2KLBA 1OYVA 4XRRA 2IYEA 4ZANA 2Y0DA 3TUJC 1ACJA 1Z56C 4JI4B 2FDCA 4INZA 1H9BA 2C9OA 3N2KB 4DV6B 1B8PA 4H0NA 4WK4B 2FW8A 4DA8A 4P31A 5ALIA 4QZVA 4C0SA 3JWJA 2HC9A 4MEAA 5IS2A 3E2MA 4FJ0A 3RUAA 3ZQJA 2WU1A 1EUCA 4CIXA 2FFRA 2VTBA 4QEZA 3OE4A 2BLLA 1JW9B 1TCBA 3RTBA 5JEDA 1UFRA 3WOHA 5MFZA 2JLXA 1TECE 4M7OA 2AX4A 3ZWYA 3SC4A 1U9ZA 1LBSA 2CJPA 3WLTA 4E2FA 2HIHA 3GAMA 4ZI7B 2OHHA 3W3AD 1C2TA 1XEXA 4G56A 5KUTA 2W58A 1RZVA 2HK8A 2WVAA 4EG6A 1ADBA 3ELUA 3QKSB 1YDHA 4BFTA 2VJPA 3FUCA 2NNLD 3R8FA 1WMDA 3TUZC 4I50A 1TIKA 5IC4A 3OZIA 1S2IA 1SHUX 5BSKA 3H9BA 5KTKA 5CEFA 4J3FA 3FMGA 3FZNA 1T5TA 2AKEA 3Q8MA 2WUVA 3LGAA 4WFIA 2D00A 1O0CA 1QVZA 4BAGA 3I53A 4D4HA 1HTBA 3Q7IA 2FEAA 4B5LA 2RSLA 2VC2B 3KSDO 1ILWA 4GMXA 4BJ5A 1QGUA 4HNGA 4I6GA 3K53A 2AHRA 3SSNA 1H1DA 1RBMA 3CXRA 2NTVA 2PD3A 1WQ4A 5B1YA 2YYAA 3PYLA 3FLBA 5C34B 1MH1A 2Q6KA 4YP5A 4Z7JA 2HUNA 3HSYA 2Q4BA 2BC9A 1K8YB 3GJ8A 4DMHA 2GB4A 1JYEA 5G4KB 2GS9A 1GYPA 1CKEA 3VU8A 4IS2A 1TF5A 1Y80A 2X8BA 1I7PA 3EP3B 3T0FA 1M7GA 1LWOA 3MQ4A 3OC6A 2HV8A 1PW7A 2QRPA 5CBKA 5IUKC 1LDGA 4ITUA 1VYHA 1TJ5A 4IIHA 1UJ2A 4CTOA 3H1BA 3QVWA 1YK1A 4F3RA 5IXYA 1BGVA 1BW9B 3FB4A 2D8AA 2PVPA 3K5WA 4OH7A 3V00A 3H5VA 4J0CA 1GPJA 1W34A 3BCRA 1ATIA 1LI5A 2R60A 3K16A 3WHPA 1RYBA 2DMRA 2BF4A 3I61A 3W4KA 3DFKA 1P3JA 5FL3A 4OOEA 4TMKA 2Z9BA 3PC2A 2I4TA 1GA4A 2RGBA 1ECBA 1JAIA 2EJWA 2G3YA 4XD7A 1SVIA 2OOKA 5EMJA 4TKUB 4BO6A 3I0ZA 4EGFA 5H9WA 3DEZA 4JP3A 4XTRA 4Y0AA 4DC0A 3A2MA 4YB8A 5CXQA 4J29A 4OI0A 3GLTA 3USZA 2VR1A 1YNSA 3ZWVA 3R9XB 1YR9A 2Q5HA 2G8LA 1XJCA 1A9ZA 1NFRA 2QD4A 2OK8A 3GO4A 1W8IA 4F2PA 5C1BA 3TGPA 4B45A 5IJXA 2IVZA 3B6MA 2B92A 2A59A 3M4XA 3KM0A 1FRFS 3W90A 1OREA 2ZT5A 3BGDA 5G53C 2O2ZA 1Y1RA 2QRGA 3LVFO 4B6RA 3LT2A 1ZGGA 3K6JA 3AKCA 2QWXA 3MXTA 3N7TA 3OPVA 4HWRA 5FA6A 3G0HA 3ADDA 3GJ6A 1F2UB 3UYLA 1DUIA 3I4FA 4FX2A 4US2R 1Y7LA 2DPGA 3OKPA 4HV4A 2J45A 1E6KA 4D6XA 4MVJF 3ZJYA 4GNRA 2XWBF 3GK3A 4Z1MA 5B12A 2EP7A 4PAWA 3DV9A 4EHAA 4AK1A 2I7VA 1WMBA 4GL4A 4HFRA 4MMXB 1IHYA 1EPUA 1W52X 2A7XA 4OSEA 4DM3A 1SXJE 2Q2VA 2VUUA 2XE6A 4D9EA 3ADCA 4M4SA 3M34A 2R6CA 5G1PA 3LFTA 3DLCA 1H3NA 5GZ1A 4PLTA 1TDJA 3NTOA 1L5YA 2NXJA 2PBFA 2E6KA 3W04A 3U7HB 1XWIA 3KSUA 5KVSA 4GUAA 4BN5A 2IX3A 3C3XA 1IK6A 3IAM6 2OBYA 3PLRA 4KUGA 1Z22A 2AW3A 2QZPA 4C0HA 4XB6B 1NQWA 3E2PA 4WXEA 5TNXA 4HP8A 4MVJI 4BO2A 1AXEA 5D1NA 5DH9A 3H2YA 1Y1SA 3O8RA 2AA3A 2ADMA 1IAQA 3WGMA 2O2DA 5F9MA 4DNPA 4QO8A 1MIOB 3ZZMA 1W6UA 2O7SA 2JGAA 4P34A 1H5NA 3GDFA 3KTAB 3K35A 4N6NA 2HLHA 4DIBA 1KZ4A 2YDYA 1FXSA 4NF2A 5FYQA 4YRQA 3CVJA 4HDSA 4G5FA 2CNKA 2H1CA 3HDTA 4HDRB 3QJGA 4X3PA 5LXTA 4DVGA 3O8NA 4PAGA 5G02A 1SFRA 4P3KA 3S1LA 1MVLA 3GLQA 1N3YA 3E3AA 3TVYA 1BD4A 3F5QA 4LY6A 4LBVA 2COKA 1W35A 1K4YA 3T3DA 1S8OA 1QDUA 1JR4A 2Z57A 1F7UA 2Q6LA 1Z8HA 2R6HA 3EF0A 4RTSA 2P3OA 1QM5A 3KEMA 1M2KA 1A7JA 1L7RA 5L53A 4DM4A 5F76A 3O2SB 4FGWA 4JJFA 1F0KA 1VCHA 1YOVB 1FU7A 1Z8DA 3GVPA 3PUHA 4BLRA 5J1SB 1W2GA 2F2TA 3MT8A 3P97A 2UYQA 4FW8A 5BUCA 1BWPA 1PE0A 4AS1A 1J25A 4OQXA 3T5GA 1KH1A 1G5PA 1RHQA 1UMBB 2AVNA 2C8VA 2I2CA 1RAIA 2VFAA 1W36B 1T8RA 2F4VB 2C3YA 8ABPA 4WA8A 4UHKA 5CCXA 2WV9A 4X91A 1GUYA 3DMHA 4NMWA 2WHYA 3DGEC 4E88A 4U2CA 4YIHA 1PJ3A 3H5IA 4OJYA 4DA4A 3FSGA 1PL8A 1ZVVA 1DELA 4NJOA 3B1FA 4C2TA 1E2HA 1H0RA 1RZUA 3LCRA 4D5GA 5JWOA 3W5BA 3RHTA 2ERYA 3BUSA 2WTUA 3ANTA 1R66A 4B0OA 2WI8A 2OD7A 3ZXIA 2EG5A 1UPTA 5CFMA 1SXGA 1YS7A 1RXCA 3G6WA 4JEHA 2BMAA 1WIWA 2O0JA 4JLNA 2IH2A 3DXZA 3PCTA 1HQKA 2J33A 3OE7D 1CEYA 1MNQA 2JIRA 1C9KA 4RPCA 4TXJA 1G9SA 1AZLA 1JG2A 3SZOA 5C7OO 2QLNA 3M70A 5TGTA 5KWIA 1KY2A 3E8MA 1AS2A 2ORVA 5JT1A 3KPVA 3GPLA 1MZVA 1GCUA 1FP7A 2R5WA 3O1LA 1SC4A 5EJFA 3KWFA 2IS2A 3Q88A 5FDFA 4Q9JA 1ECCA 4D9HA 3LPCA 4HVCA 2PTHA 2BHRA 4D9IA 3A9SA 2VDPB 3IR5A 3PQEA 1GGKA 2CNOA 1TVEA 2Q2NA 4QJ3A 5ICGA 1JWLA 3EGXB 2GETA 3W9SA 1XT6A 3DYBA 1E18A 2DCUA 3BFVA 4RZSA 2QTFA 4MW4A 5LQNA 1MRZA 4ZMSA 2UVQA 2EFEB 5IEJA 4PIMA 1QV9A 4IDOA 3WBKA 4C1NA 3BGWA 3L8MA 3WRYC 3RK1A 5LPNA 2PGDA 2RHHA 3OWOA 4ZGWA 2ZSJA 4RMGA 3JAKB 2JVJA 3G2QA 1GM5A 3WYNA 5CCEA 2PMFA 4DQVA 1OZ0A 1CRZA 1CHDA 2WQ6A 2QRHA 1J07A 1U8XX 4MVWA 1DFHA 2DT8A 2Q3BA 4UE3S 4E03A 3WLMA 3ROZA 1W30A 1RMQA 3F8SA 4PLCA 7REQB 3WHKA 1NNSA 3D8RA 5K5EA 2CCJA 2QQ0A 2BRUC 4Q02A 4CDNA 4GQBA 2QRLA 2Y0PA 2ID8A 3QG1A 4QVGA 1N6HA 3JD4A 1Z62A 2ZI9A 3WLOA 4YCMA 4YXWA 2J9FA 3I05A 4N6GA 2J3IA 3TXXA 2O5EA 3IB6A 2PV0A 4X62B 4BVGA 1FFEA 1O2DA 4Q3BA 1BMFD 4A7PA 2VRBA 1CR6A 4LVOA 1DBWA 4BNTA 3MM4A 2CHEA 5DTRA 1UQRA 3C5VA 5F21A 3FYHA 2PX0A 3BDVA 2F9MA 3OA0A 2JJ1A 4YVFA 5BYBA 1LI7A 2N75A 4RTLA 5COQA 2JK0A 2ONKA 1BH6A 4FDLA 1XF1A 1DIOB 4C6TB 3AHJA 3V1KA 1ISSA 1G55A 5H59A 1D2NA 4MPPA 2H0AA 3LXRA 4JJ4A 3TX6A 1KP2A 1ZVKA 3TW8B 3V1TC 2C61A 2WSYB 4M60A 1CF9A 1ST3A 1SHZA 2BTQB 4XOIA 5C37A 1PT9A 5E3HA 5AJZA 2NVUA 1MX3A 2H2GA 4B6JA 2XCRB 1I2ZA 3E9ZA 1BXRA 1MW8X 2FKAA 3WKBA 2ZWIA 2X22A 1ZNYA 3QNMA 3FTFA 4I4TA 3U44A 5C8DA 2PRSA 1UUFA 5H3HA 4DWVA 4F46A 3RUCA 2ZYVX 3DKRA 5HP4A 1KMMA 2AOUB 4LRTB 2ZJ0A 4R0VA 1N36B 4FYIA 3IALA 2R84A 1F9EA 1E64A 3SC2B 2E5FA 1Z7GA 4D9GA 5CVTA 4OHKA 4HYYA 4E70A 1Y7PA 1R6BX 1WXFA 4LHSA 1KP9A 3VVMA 3N9IA 2BH2A 4U4AA 5LM3A 1IY9A 4HUTA 1G0OA 4NSNA 3ZIDA 1BFDA 5HIMA 5CEJA 2ZR7A 1T6XA 1TUGA 1C3XA 1D0VA 4L5BA 3AU9A 4A8JC 1KI7A 2VWQA 4PO1A 5DT2A 1FE8A 2FZ4A 2BGKA 2SCUB 4PX3A 2W4MA 3GJZA 2VHUA 3RWOA 1REQB 5JISA 1SO8A 3CO5A 1IJEA 2RGUA 4HAWA 1VRWA 3SJAA 2QR5A 4KBGA 5JVDF 5DJ5A 5A0VA 2O2SA 2VXOA 2ALJA 2DLDA 3QOWA 4F97A 4BFVA 1H5QA 1S2LA 4EPXA 3AB7A 3KHUA 4EI7A 3SP1A 3MCVA 4UMFA 1QLHA 4DLSA 2ZW9A 3HCDA 4RGVA 3AY0A 2O8NA 4KP7A 3VM6A 4YUWA 4TZ0A 1R18A 2I8AA 4ENWA 1XDDA 1WNFA 4MCAA 1HDZA 5T3YA 5DKFA 3V4VB 2ZP1A 1XYVA 4C3VA 2EEPA 2OFWA 4BB0A 4IILA 1L5SA 2KI5A 4M1EA 3JAS