1ARZA

Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase in complex with NADH and the inhibitor 2,6-pyridinedicarboxylate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
total genus 69
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1arzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1arzA01
3HUDA 3JQDA 2D5AA 5DCUA 3U0BA 1HDXA 3RUDA 5G0TA 1G0OA 3JQAD 4CLRB 4Y6PA 4E5NA 5B37A 4RVFA 1HWYA 4JQCA 3OHSX 2Y1OA 3KXDA 3ZWYA 1WLYA 1GAEO 2CVZA 3V1TC 4LSMA 1ARZA 4K26A 2BI8A 2O50A 1BXZA 1DFGA 1E7YA 3PZRA 3EUWA 4ZA2A 1YOVA 1D3AA 1HSZA 2VRCD 3SLGA 1RKXA 3JQ6A 3N7UA 1M75A 3RU9A 2E82A 1NPYA 4GBJA 3T7CA 1WMAA 4R54A 1ONNA 2G0TA 1NVTA 4WOKA 3DFUA 1T2CA 3L4SO 4INAA 3M1LA 3RD5A 1ADGA 4RPLA 5HA5A 3RU7A 3KV3O 4XIJA 2J5RA 2Q1UA 3RSHA 3D5TA 3DHEA 1VJTA 3UF0A 2NVUB 1K6IA 1LSJA 1EQ2A 4GMGA 1ULSA 1VJ1A 2AE1A 4CL8A 2POQX 2BFMA 4U6QA 3S1LA 1E3EA 2AG5A 3R1IA 3VC7A 3D64A 1HRDA 3IUPA 1N1EA 2X58A 2OOSA 2AEFA 4BNJA 3SXPA 1Y1PA 1BRMA 2NVUA 3GNQA 2ILTA 5EERA 4OXNA 3WFIA 5KKAA 4C7JA 3A06A 3F4BA 4FB5A 1QV6A 4WUVA 1M2WA 1GUFA 1LUAA 4RLHA 2JFHA 3AM5A 2X23A 2PKQO 3EVTA 4WLVA 1P31A 3ICCA 2Y99A 3ZV6A 2PA3A 1ZVMA 1QLHA 3GR6A 3VZQA 1T4BA 1BTOA 4DL9A 1JLLA 3I9JA 1NAIA 3F4LA 3VVBA 3L6DA 3CH6A 1V3UA 3LT1A 4UUMA 5JMPA 5AXCA 1WP4A 1LDEA 5F1PA 3CKYA 4XRRA 3O38A 3X2FA 3JYQA 2FMUA 3KEOA 4A26A 4ZRMA 3BMCA 4Q39A 4MDHA 5BT9A 2FPPA 4PLGA 1FK8A 2Y67A 3H5NA 3N74A 4J7UA 1YQDA 4DREA 4RV9A 1YJ8A 2UDPA 5CFZA 3I23A 3FRJA 4E31A 4I8XA 2CZCA 2Y66A 2PZLA 5JAMA 4AJKA 4R4JA 3PWZA 2R6JA 5K6AC 5DBIA 2C29D 2IDZA 4WCFA 1K3TA 5TQVA 4DBZA 4JN6B 1EUCA 3P2OA 4OIMA 1MG5A 4RVUA 1VC2A 4ZGWA 4O63O 1L7EA 1YL6A 1ZUD1 5DP2A 1SCUA 4H7PA 4B4UA 5A4DA 2C2XA 4DLLA 5FYDA 3WFJA 1YB5A 4MKZA 3UKOA 1LJ8A 1OZAA 2DAPA 1GQ2A 1Z45A 3HN7A 4IMRA 3E18A 1I01A 1X7GA 2G5CA 1ISMA 2HMVA 2VWGA 4FD3A 3DMTA 4CV2A 2FWMX 1IYZA 2G1UA 4HFMA 3TRIA 4BNGA 4XIYA 4ALNA 3KSZO 1LDBA 2WDZA 4GAEA 3RUFA 4F3YA 1WDMA 4IDGA 3W8EA 5JDCA 3K30A 3BTOA 3I9MA 3BZUA 5I9NA 4J1SA 1N1GA 1F14A 3NKLA 4BNHA 3IJRA 1CQIA 4E32A 1MA0A 1C0KA 4R5MA 3CEAA 2VWHA 4BKOA 5U9CA 1KVQA 4CM7A 3I83A 1YQGA 3BMQA 3VOSA 3FPLA 2GZ2A 1QORA 3PDUA 2C54A 4YT5A 1VSUA 1B0AA 3F5SA 4DMLA 2DUWA 1U5CA 2RAFA 4XQGA 3TQHA 4E0BA 1JVSA 4OGWA 4DIBA 3LT4A 4BNKA 3OEYA 4JP2A 3KYDB 3PHHA 4FIZA 4RZHA 5BSFA 4M87A 4DMMA 2Q4BA 1HDRA 4L4XA 1UH5A 1H2BA 4A5OA 5TX7A 5KJCA 4OYRA 2YFHA 1VL8A 5KVQA 1NQOA 4MOWA 4L8VA 1I24A 3ASVA 2PKQP 3FTPA 4TKMA 4XDZA 3EVNA 1Z74A 3EDMA 2DQ4A 4BV9A 5KJ6A 1UDCA 4F46A 4J91A 4L76A 4LRSB 1PGOA 3A1NA 3QWHA 3UXYA 3K73O 3UGKA 3GHYA 3NAQA 3PHIA 1ENYA 3FNHA 1AHIA 3NGXA 2Z95A 3PGJA 4KP7A 5JMWA 1I3MA 3I9OA 2QG4A 2P9CA 3ETGA 4DIFA 3GG9A 2PZJA 1G6KA 2W2KB 3MJTA 3EW7A 4IZIA 4UVIA 1ZBQA 5JYFA 2ZATA 4D45A 5CEFA 1SEVA 4BIIA 4IIUA 4N7RA 2ZB3A 2YHUA 2BRUA 4JK3A 1H5QA 1JVBA 4J43A 1Q7CA 3VDQA 4CLEA 1TEHA 3W4IA 2OBNA 3H9JA 1VL6A 1EUDA 4BL5A 3ZWWA 1I2ZA 4NDNE 3W4KA 4LSWA 4RL6A 1YBAA 3KVOA 2VN8A 1PS8A 1ML3A 2OFPA 4R16A 4D44A 1H6AA 1GTMA 3WR5A 5BQFA 2PR2A 4AJNA 5TJ9A 5A06A 3GAFA 5IZ4A 3CTMA 2R00A 3A28A 3QWFA 4RF3A 3OQ1A 1NWHA 4IDBA 1M67A 3GZ4A 4BQRA 4UAGA 2Y1CA 2B0JA 1ZXBA 1NFRA 3ZGYA 2PGDA 2SCUA 4IM7A 4BO9A 2B69A 3TSCA 4YCAA 4CM9D 4N5MA 1XELA 2CNBA 4R41A 3F6YA 1IY8A 3S2GA 1NFFA 3ZWXA 4J9VA 1DC4A 2P91A 1DC3A 4MVJA 2X6TA 2Y68A 2OGUA 3GUYA 4MP8A 5HM8A 2VCYA 4J0FA 4UUOA 2EW8A 1ENOA 3OBBA 4M55A 3JSAA 3GAZA 2NWQA 1UP7A 4H16A 4AJ2A 1U1IA 2D59A 4FC7A 3GY0A 2YHIB 4UEKA 5M6DA 4ZN6A 3ZW9A 4J1QA 2BH9A 3C7AA 3JQ9C 1H9AA 1N9GA 2YZ7A 3EYWA 3ZHXA 5L51A 4Q3EA 5L3ZA 2O48X 1F8FA 3MWEB 4IDCA 1E92A 2QHXA 4R1SA 5IG2A 2X4GA 3H9UA 3PLNA 3TNLA 3DEYX 1HSOA 3LQFA 4BHTA 1U7TA 4BVAA 3LF2A 2IEBA 3H9EO 2C5AA 3GGGA 2D3TA 1N8KA 2I99A 4D7AA 2AG8A 3PLRA 1GEEA 1ZEMA 3TDKA 1KC1A 1P77A 4TZKA 3WX0A 2VYVA 4XGNA 4CUKA 1WPQA 3Q2IA 3MOIA 4NMHA 3NYWA 2VQ3A 4E13A 4Z6KA 4RLSA 5BSEA 4BMVA 1HE2A 4DPKA 3ZH2A 5A3VA 1A27A 4XX0A 3ZCXA 1NVMB 3ABIA 1GU7A 3ZWAA 1JQBA 3IQDB 3QVSA 2W2LD 3VTZA 3JTMA 1QP8A 1U7HA 3JD2A 5A5EA 5ITWA 4TKLA 5EL0A 1DC6A 4XEHA 2WYUA 5JO9A 4CMJA 4YYZA 1F12A 3KOUA 4JBGA 1MG0A 2DT5A 4ND2A 5L4LA 3S2EA 3ENNA 5KIAA 1VSVA 4WK6A 5C3MA 2BD0A 4FQ8A 4WNIA 3COSA 2DBQA 3ZI0A 4UUNA 1GEGA 4CMAA 4CMEA 3IS3A 4I9NA 4M49A 1YVEI 4HY3A 5IZCA 3GFGA 3V1YA 1XQ6A 2XPCA 2EJVA 1KEPA 5IXSA 4CODB 3H8VA 4OOFA 2X9GA 3ZWPA 3C7DB 3DC2A 4Y67A 2PK3A 4RPKA 3KSDO 3V2UA 2IYPA 2ZB4A 1VPDA 2HDHA 3DBRB 3JYLA 4F6CA 1ONOA 4U0KA 1S6YA 4CM1A 5EPOA 5DNAA 2Q3EA 2GRAA 4D41A 1YH3A 1D1TA 4FW8A 5G2OA 2WTBA 1R4NB 3DBRA 4ZD6A 1SOWA 5I8ZA 3W4JA 3C8MA 2NU9A 2VUSA 1PZGA 4EJMA 3RBVA 1LDMA 4GX0A 1LSSA 4XYLA 2B5VA 1K6JA 1NM5A 1H2HA 2R00C 1DBVO 1Q2XA 1U3TA 4W7IA 3L9WA 1DSSG 3H3FA 4QFCA 3EK2A 1P1IA 4I5GA 4BNXA 5A03A 2RIRA 5A5FA 3E9QA 4XR4A 1S7CA 3GH3A 1SEPA 4PZCA 5T67A 5IDQA 5C7LO 1LNQA 2JD2A 4MIOA 2B36A 3EZLA 3KYCB 3ROKA 1C14A 3CUKA 4Z0TA 3ZWMA 4CJXA 5FI3A 1YKFA 1B16A 5L7WA 1Y9AA 4B4WA 1DPGA 4RDHA 2JCXA 3VAZA 2DC1A 3GVHA 3UCFA 3D3WB 1U2DA 1ISHA 1XYGA 5JBIA 1LRJA 3DAGA 4Y9DA 1LLCA 2IXBA 3UW3A 4KWHA 3DMYA 3AI1A 3GRPA 1PTJA 4IY1A 1WMBA 2JJYA 2W8ZA 4BNWA 4E5MA 1UXHA 4ND4A 4G81A 5TS3A 2GO1A 2DBZA 3B1KA 2W2LA 4BGIA 3GLQA 2EJWA 3MZ0A 3KM0A 4OH1A 4PLHA 4FS3A 4X54A 5BNFA 5FEUA 4MVJF 5DF1A 4YJFB 2P9EA 3H9GA 4YVFA 1PJ3A 3AY6A 3D4NA 4I9HA 4ZVVA 1R0KA 2I67A 3QHAA 4NFSA 3AM4A 4KTVE 4EYEA 3TZHA 1UP6A 3OF2A 4YJHA 2ZQZA 3H3JA 2O7QA 1EFLA 1OAAA 1B14A 1KVRA 2WSBA 3WLEA 3F46A 4MVJE 1A9YA 1E5QA 3OJEA 3CMCO 4Z9FA 5AXBA 3UN1A 5IN4A 1U4OA 3FWZA 3ZNNA 4R68A 3PRJA 4JROA 4P8RA 4OXKA 3TWOA 1H0KA 1DOHA 3IL2A 1NP3A 2J3HA 3EZYA 4PRKA 4TVOA 2H9IA 4FSHA 4NJMB 5JCJD 4XYGA 5L7YA 2OORA 4CM8A 3GPIA 1E1KA 2EXXA 5ENDA 1EEHA 1X7DA 3B70A 4KZPA 5LC1A 2BGKA 2PZKA 1ZFNA 5K9ZA 4HFRA 1NHWA 1R4MB 2Q1WA 5EQDA 3PJFA 4MIEA 3RUAA 1J4AA 4W6ZA 4WCDA 2X7HA 2X0JA 1H6DA 3IAHA 5CPBA 4Q3NA 5J9GA 1ZSYA 3MWDB 3WYCA 5T8KC 3Q9UA 1R4MA 3ITDA 3K8ZA 3QE3A 2QZ9A 5C5IA 1TB4A 1GYRA 1DHTA 2TMGA 2Y93A 1R0SA 4J4HA 1HZJA 1UP4A 4WNCA 5C7OO 1B26A 5L7TA 3AOEA 5H81A 3VZRA 3K6JA 3HHPA 2RBEA 3GUCA 3KZVA 4FGWA 2J6IA 4P22A 5IAAA 1I32A 5IXYA 1NPDA 3DB2A 1LXCA 1OC2A 3WS7A 4DQVA 4L9RA 4S1VA 4A27A 4IMPA 5J23A 2GGSA 2C7GA 3CINA 2FHSA 2VNAA 4TRJA 2B4QA 2JCVA 1KEUA 3MEQA 5L9AA 1W6UA 1MX3A 1TVEA 4IGFA 2HAEA 4NBVA 3V2GA 3WJ7A 1J49A 3ADOA 4EW6A 1GV0A 2VZ0A 2ZB8A 4TRRA 5DOZA 3BXXA 4NFYA 2JCYA 4CL3A 4CLRA 3PFWO 4QX6A 3OP4A 2ZTLA 3M2TA 4TROA 3ROQA 1ZEJA 4NQZA 2FOIA 1ZIDA 4BO8A 1KVSA 2D0IA 2D4AA 4YA6A 5K6AA 3JV7A 3AUTA 2Q49A 2IZZA 3WJAA 3ONEA 3JQEA 1ZH8A 4IUYA 4YACA 3AK4A 3JYOA 3O4RA 3PEFA 1YL5A 4NK4A 4PLFA 4XD2A 4A03A 5U1PA 1P0FA 5DCYA 1U2GA 2EKQA 3D0OA 3TPCA 1PJTA 1PZEA 2O7SA 3Q2KA 2EKPA 4BO2A 3C3XA 1R6DA 3GDGA 5IZCC 5A05A 1E7SA 1LRLA 3HNPA 4KDFA 1PR9A 2YDXA 3FWNA 1E3JA 2X0IA 2BI7A 1KEWA 1QXSA 4DLAA 1C1DB 3LC7O 3CSDA 2WEKA 4D3FA 3DTTA 3UH1A 4BNNA 3L9XA 1B2LA 4HNHA 3ZU3A 1A72A 4IXTA 3VPGA 2PLAA 3I9NA 4IS2A 3ZWCA 2AQKA 2RH4A 1DEHA 1PJCA 1N2SA 4YRAA 2GPTA 2EKLA 3L6EA 4NZ9A 4RO0A 1IPEA 2GN9A 2QZZA 4QXMA 2OZPA 1AE1A 4CMIA 5F3RA 1WWKA 2YDYA 2ZCUA 3P19A 3TF5A 1E6UA 1CQJA 3QJ5A 4IXWA 5AVOA 1T1SA 2ZJ1A 2VWQA 1J6UA 1Y8QB 1WAMA 2QYSA 2Y1EA 1JWBB 4JX8A 3TL3A 4DRYA 1P33A 4HBGA 1PQUA 3W1VA 2VZ8A 4GGPA 1H6CA 1SAYA 4BO7A 2D5CA 4Z3DA 8ADHA 2IEDA 1B7GO 2C59A 3Q3CA 2CDCA 3CMMA 3OMLA 5T6BA 3GA0A 3TOXA 4WOJA 2PGLA 1RYDA 2CY0A 1MFZA 4B8WA 3DR3A 3O9ZA 3MJVA 5HWSA 2HUNA 4IZHA 1VLLA 3JQFC 1HDCA 2VTDA 3BHIA 2LDXA 1ENZA 2DFDA 3D5QA 2JFFA 1KS9A 3FNGA 3RFTA 2DBVO 4TZTA 3QV1A 4XYBA 1T2DA 3PI7A 1MXFA 3GEMA 1PGQA 3QIVA 4FCCA 3WGIA 1D4FA 5EJ2A 1PL7A 1P45A 3E9NA 3U4CA 2O3JA 4NH4A 3EY4A 5IF3A 3DAFA 4W82A 1PL6A 1NX6A 4AJJA 1MFPA 3AUSA 3WOHA 1MLDA 4L73A 1JW9B 3UHAA 3RBXA 4JGBA 4OL9A 5KWEA 2C82A 3EMKA 1C1XB 2I9PA 1VRWA 3UFXA 4ZQFA 1VJ0A 1C0PA 5KVSA 2YY7A 4CLXA 2J3KA 4DIOA 5KCZA 4QSMA 1NYTA 5L53A 3F3SA 4BS9A 4B7CA 3FN4A 3DFZA 4M54A 3GZNA 3UCXA 4FFPA 1C1XA 4IQ8A 3ZWOA 2WD8A 4YR9A 3OECA 3EAGA 4Z9XA 1E5LA 5JSFA 3GF4A 3FD8A 4QUKA 4YDRA 1OOEA 3OIGA 4BNLA 2AXQA 3ICPA 2NU8A 2EERA 1V3VA 3NJ8A 4H3VA 5L40A 2V7PA 3B20A 1YXMA 4KQWA 1LRKA 1R0LA 2D1YA 1YBVA 1I10A 4Z0HO 3AUAA 1AGNA 3VPFA 5F1KA 5I7FA 1ORRA 4UEOA 4BNVA 1DRUA 2X86A 4BNUA 1U3UA 3SX2A 3HADA 1O0SA 3AFNA 1Y5MA 3GN1A 2WYWA 5H83A 4KWIA 5JDIA 3TZ6A 3F1KA 3WQSB 1GD1O 2OO5A 2VOJA 4BO3A 1ADCA 4I5FA 1NQTA 3WDSA 3N58A 1EE9A 5ENVA 1QYCA 3HJAA 5DCWA 3TJRA 4K1LA 3FPCA 1E3LA 2NLOA 3AOEC 4ILKA 2H63A 5JAIA 5A9TA 4AJPA 1PJQA 3R6DA 5TRTA 4AJHA 1EZ4A 3O03A 5T8KA 4QT0A 2NVWA 3ADPA 3JQ7B 4N18A 2J8ZA 1UDAA 4A0SA 2Y0CA 4GQAA 3OA2A 4MVJM 3H5RA 4HKTA 5MDHA 3TOZA 5CAEA 4ROSA 1UZLA 4MP6A 2V65A 4AJOA 1GUZA 4RQUA 4YBZA 3ETEA 3O8QB 5A04A 3G0OA 3OJ0A 3JQ7A 4AG3A 4DA9A 3I4CA 4KUHA 5COBA 4EGFA 4NK5A 2XAAA 4B7UA 5T57A 3RC9A 1XDWA 1M6HA 1DFIA 4CM4B 5F1OA 1W0CA 3WIEA 2RHCA 5THKA 3JQGB 4A10A 4Y8VA 2X5OA 2NTVA 3O8QA 1I5RA 2HQ1A 2JD0A 1YONA 4FJ1A 1EBFA 5JPIA 2V6FA 4OOEA 5A9RA 5B12A 5G4KA 4B3JA 2AHRA 4ZQGA 1O6ZA 3JQ8B 3WIDA 1JTVA 3FCOA 3H4VA 1MP0A 2EWMA 1Y5RA 3DBLB 4RVDA 5BR7A 4E5PA 2IRWA 1X15A 5HRUA 3ITKA 4G2NA 1SB8A 1V6AA 4XQ9A 3TFOA 4HWKA 5G4KB 1DIBA 5TNXA 4UVEA 2PGJA 3WXBA 3ANLA 2OXIA 1MC5A 1MV8A 3WG9A 3TL2A 3AU8A 5GZ1A 1GZ6A 4BO1A 1VL0A 4BO5A 4EITA 2HKIA 4R51A 3I3OA 3S2FA 3I1JA 1K2WA 4XR9A 3WB9A 3HFSA 4XJTA 4AJ4A 1OMOA 1L7DA 2CDBA 1BWSA 4NJOA 4E2XA 1YS4A 3E1KA 5TSDA 3WTCA 3WBBA 4I5DA 4GH5A 2HMSA 3PVZA 4Z3KA 1QR6A 3S8MA 1CRWG 3X2EA 2PZMA 5T73A 1NBOA 4ZQHA 1JN0A 1R4NA 3NV9A 5IDYA 5KOIA 4CQMB 2FZWA 3OM9A 1NNUA 2IZ0A 3SC4A 1XU7A 1IHYA 4PIVA 1MGOA 2VRBA 3ULKA 4BB6A 3ZWNA 3GT0A 3VKUA 4E30A 2QX7A 1N5DA 4MVJH 1HTBA 3I6QA 2EG9A 2WE7A 3PYLA 1Z6ZA 3G17A 1LDYA 1PS0A 2ZTUA 5B4VA 1U3WA 3RJ9A 3GQVA 4CV0A 1E0DA 2FN7A 2W98A 1XGKA 4LCJA 3U4HA 5A1TA 3DHYA 1QMGA 4IQGA 3RBZA 3ZV5A 1Q0LA 1ZNQO 4KDEA 3QVXA 1PZFA 2P5UA 3L6OO 3OICA 3OSUA 3KHUA 2E49A 1JKIA 2GCGA 2GERA 2PY6A 1LX6A 3VTFA 3QY9A 3U3XA 5JYEA 1W73A 1YQXA 4MP3A 4KTTE 1D7OA 1E3IA 1A4IA 1NFQA 3G49A 4WEOA 4YAEA 1EDZA 2VUUA 3PWSA 1GCOA 1PIWA 1N7HA 4A2CA 3AOGA 4IDEA 5EMHA 2GDZA 3BAZA 4YAJA 1E3SA 3VH3A 2XOXA 4C4OA 3WMXA 3NEPX 3RROA 1SPXA 3C1OA 1ENPA 3QQPA 5L45A 2DPHA 1EK6A 3FSRA 5CPFA 3GGPA 3SJUA 4YJFA 3EC7A 3B6ZA 4XGIA 1M6WA 2DUUA 2CVOA 5EIOA 1I3NA 1WDLA 3W8DA 2VT3A 4FDAA 4HNGA 2R2GA 1K89A 2J5KA 1Y8RB 4BNZA 4NNJA 3DBVO 4PLYA 6ADHA 1BMDA 5HS6A 4N54A 1ULUA 3IP1A 4YQYA 3HDJA 4TRNA 4AJEA 2OBYA 4CMCA 4GLOA 3D3EA 5G0VA 2CF5A 4PRLA 4EBFA 4BNIA 3GVXA 3OJOA 3RUIA 1JKJA 4PGFA 2FSVA 4OMUA 3DZBA 3K9QO 2JD1A 2HLPA 2ZYGA 1TT5A 2C0CA 4TMFA 4XQCA 4PG7A 5HBRA 1RJWA 4GKBA 1MUUA 5BSGA 1TLTA 3WGQA 1E7WA 3R0IA 1YGYA 2B35A 5KJ1A 3RUCA 3W8FA 3IKTA 1Q7GA 1UR5A 1JA9A 2I65A 3UUWA 3GN2A 2GN6A 1G0NA 3K2BA 1SOVA 3HB5X 2O2SA 4WASA 4W9NA 4E33A 3WWYA 3WQQA 4IJUA 1UUFA 2UUPA 1EMDA 3BMOB 1T25A 1B8UA 1E3WB 1BHSA 1IE3A 9LDBA 3R3SA 3E6AA 4MVJD 4ALLA 1ADFA 4YRDA 1E6EA 1T2FA 3L07A 4FFLA 3AFMA 4R3WA 4B79A 4YEDA 3IP3A 4R69A 4G5HA 2B5WA 2HCTA 4ALIA 4PFJA 4CMHA 4B8ZA 1ZK2A 2VHZA 1I3KA 1X13A 3HDQA 5HS4A 5K0ZA 4RF5A 3V1UA 1OFGA 5DDIP 2TMDA 1F8GA 1E6WA 3VPXA 1NTOA 1YOVB 2Q2QA 2J3JA 5DT9A 5B4UA 1ZK4A 3AW9A 1HE5A 2FP4A 3SLKA 4Z0PA 5CDYA 3DO5A 2ZTMA 5AXAA 4R9RA 4BMNA 2FSSA 1VKNA 1IZ9A 2NU7A 3H5AA 4E2WA 5ADHA 3RC7A 4QO7A 3IDSA 1PWZA 4XRGA 1NASA 1M76A 3WSWA 5AYVA 5JC8A 2F1KA 4J1NA 5L95A 5ICSA 1P74A 4CLDA 5KKCA 5CEEA 1NQAO 3H2ZA 4B3HA 2PD3A 2O4UX 1P9LA 2HRBA 1HL3A 5TF4A 1G1AA 4CMGA 2GSDA 1WVGA 4CMKA 4EJ6A 2WM3A 1V35A 4EEXA 5L4SA 1C1DA 3ZHZA 4GWKA 4R5HA 3RC1A 4YJHB 3BHMA 4DC1A 4DVJA 3FBGA 4Q3AA 1PJLA 4M89A 3KETA 3ANNA 2HMWA 3M6IA 5ER6A 2WE8A 4JNKA 5IDWA 1GUYA 2PD4A 1W4ZA 1CYDA 1OC4A 4OO3A 1FF9A 4FJ0A 5JCJA 1HDYA 3GG2A 1SO8A 2O2YA 3C7CB 4BUCA 1Z75A 1P1RA 1X1TA 1RM0A 3JQAB 3ZV4A 5COQA 5KJFA 4RVSA 2HJSA 4BKPA 3JCZA 4WGGA 4YXFA 1H9BA 3EGOA 1KEVA 2CVQA 3E5MA 1ZJZA 3MJCA 2PKRA 4BGVA 1I8TA 1EQUA 1GFSA 3JQAA 3HQ4O 4IBOA 4FGSA 4D3SA 1GPDG 5B4TA 3HG7A 3VPHA 1EBUA 2ZQYA 2E6UX 3IKVA 4J9UE 3CXRA 1P3DA 2QRJA 5TGDA 3LVFO 1DIGA 2BFOA 2DVMA 5JYAA 4FR5A 4ZRNA 3K96A 3Q0EA 3OJFA 3U62A 4M8SA 5C7IO 4WCFB 4DYVA 3V5NA 1K0UA 1ZMOA 1E1NA 1PGJA 1YWGO 1PJ4A 2X9NA 2DTXA 5T5QA 3FHLA 3ETDA 1EDOA 1PSDA 4IQ0A 5MGBA 4DXHA 2XF8A 1H94A 1IZ0A 3R3JA 4TRMA 4FOOA 4CM9A 3MJSA 1XEAA 1XKQA 1K5HA 4O1MA 1U5AA 1P1FA 5DBFA 3DOCA 2HJRA 2H5LA 3QRWA 4WLEA 3NT4A 5AOVA 1LLQA 3GPDG 3KRTA 3CZMA 1LI4A 2OHXA 4NPCA 3HN2A 3I9KA 3D7LA 3JD0A 4W4TA 3PQEA 4OAQA 1MC4A 2UV8A 3FNFA 2X0NA 2Q99A 3WSVA 2NTJA 1H93A 1ZMTA 4LK3A 3RWBA 2VYND 4WCFC 5F21A 1EUZA 1ADBA 2QQ5A 1U8XX 3QP9A 5IFLA 1PZHA 4RORA 3GMDA 1ISJA 2IZ1A 1DC5A 1IPFA 3DZFA 3LYLA 4J4BA 3NTOA 2I76A 1RM3A 4RPGA 1LLDA 2Y1FA 4GX2A 4JJFA 3DBHA 4NBWA 5ES3A 3DMTC 2Q1SA 4YJGB 3LT0A 4G65A 2NU6A 2PV7A 5I9LA 1LC0A 4RVHA 1QRRA 4E4YA 4JCOA 3UOGA 2VWPA 4BNMA 4JXKA 4N5LA 1NAHA 4XZ3A 2O3UA 3T4EA 2CDAA 1C0LA 3IC5A 2FPIA 1I30A 3ONFA 1YBMA 5I7SA 2GN8A 1I0ZA 3GNTA 4YJDA 6LDHA 1HF3A 4P4GA 4PLPA 1U9JA 1YB1A 2DU8A 1KVTA 2YW9A 3OEWA 4C7KA 4D43A 2WMDA 2I3GA 2A92A 3PYMA 3RAJA 3BIOA 1DRWA 4XJSA 4PLWA 4CMIB 2GF2A 1L1FA 1ZO8A 2FR0A 2AQ8A 1QSGA 4AFNA 2B4RO 4ZJUA 3A14A 4ZHSA 4EDFA 5JFOA 1BVRA 1F17A 2OMEA 4WLFA 4WEQA 2PWZA 4HV4A 1CIVA 2QIOA 4OKNA 3AY7A 4J1TA 2DTDA 1BXGA 4IINA 4FFMA 4XDYA 1BG6A 2W2KA 3RUEA 2NADA 1LEHA 2O3RA 1GL3A 4CM5A 3CIFA 3T4XA 3CZRA 1WZIA 3DOJA 1HYHA 4IDDA 4RPJA 4CLHA 4CQMD 2G76A 4PG6A 4B4VA 2Q45A 2ZCVA 4IIVA 3VPSA 4E2ZA 1ISFA 4BNYA 1PR3A 4P38A 3RQSA 4DTIA 2CD9A 1DJQA 1X1EA 2Z1MA 3I6IA 4CQLA 3JD1A 4GX1A 2HK9A 1P1JA 4F6LA 4CM4A 1DLJA 1DXYA 3CE6A 1XCBA 3V8BA 1HYGA 4DBVO 3NX4A 4IJVA 4XCVA 2ZIZA 3QVOA 1X7HA 3V2HA 3JQ8A 5CEJA 5GZ3A 2FR8A 1ZK0A 3KTDA 4NBTA 1GPJA 2GLXA 2ET6A 4KUGA 1O9BA 2UAGA 3VDRA 4E6PA 1KY5A 3T7EA 1CJCA 3HDHA 3JD4A 4HUJA 4XWYA 4HXYA 3DZJA 1WXDA 7MDHA 4U0JA 3BTVA 3STHA 2O4CA 3DL2A 2ZB7A 4PLVA 1YO6A 2YV2A 3GZNB 2P5YA 4XKJA 1QG6A 3ZU4A 4FFRA 5TT0A 3WWZA 1KVUA 2BMAA 1V0JA 4BKRA 4AJLA 1LSUA 5JY1A 3TZCA 2YHIA 4WJZA 2PTGA 3Q1LA 2B83A 4XQEA 1JAYA 3ST7A 4BKUA 4YT4A 3L77A 1D8AA 1OI7A 4DPMA 1BXKA 4MO2A 4R01A 1XG5A 1RM5A 5KNLA 4HFNA 3QWBA 3GMSA 1B3RA 2Y0EA 2GZ1A 3GDOA 3DHNA 5DOVA 1A71A 1NHGA 4PLTA 3PIDA 1QYDA 2CFCA 1DFHA 4N5NA 1Q7BA 1QV7A 2JL1A 4IJWA 3ZN2A 4CLOA 5ILGA 1J0XO 2JFGA 5ILOA 3WQRA 1PGPA 4PG4A 1Z7BA 3KLPX 5DBGA 1DB3A 3BA1A 3U4IA 5F5LA 4U6SA 3AUUA 4B3IA 2FRDA 3SJ7A 2Y0DA 3G79A 4WKGA 1H6BA 4GVLA 5COAA 3CPSA 3MOGA 2WD7B 3AWDA 1LC3A 3DAPA 4ND1A 3DONA 1DRVA 1GCUA 4HADA 1YB4A 2X9VA 3FF4A 2I3AA 4DPLA 2ZJ0A 1UZMA 4J2HA 9LDTA 2NNLD 3NDJA 2VHWA 2BHLA 5LCXA 4CV3A 4M86A 5BNTA 2X5JO 1FDSA 4GSKA 1DHRA 4J90A 1LQTA 3QW2A 2YQ5A 3F5QA 4E21A 3WGZA 1XWFA 4ALKA 3RC2A 1WZEA 5THQA 5JAQA 3BTSA 1E1LA 2W90A 1I33A 1AUPA 3FTNA 4J7XA 3JQGA 1XU9A 5EQFA 2X1HA 3FBTA 3KSUA 3DTYA 4RF4A 1FDWA 4LRTB 2I5PO 5JO0A 4R1NA 2VYNA 2GASA 3O26A 4L4SA 3GVIA 3ON5A 4IDFA 3DBLA 1B3BA 2Q2VA 4OSPA 3PIIA 4I08A 5JLAA 3HZZA 3PJEA 4UVHA 1UXIA 1EE2A 5CDTA 4QECA 5DULA 5GY7A 1CETA 2W4QA 4YAGA 1N92A 4LMPA 2DFVA 4ALJA 1V3TA 1GY8A 2X5KO 2P9GA 3VZPA 3QWAA 3W6ZA 1ISIA 2DKNA 4NU6A 1CEQA 3WGTA 5BSHA 4UEJA 4Y6SA 2Z5LA 3L4BC 5LDGA 3GOHA 3E8XA 2P2SA 3ONDA 2VT2A 3LLVA 4TWRA 1I3LA 1Q0HA 2GD1O 5CG2A 4BOYA 3GFBA 5CDGA 3LC2O 4CM3A 3B1JA 3WICA 5JS6A 5B1YA 1KETA 1UXGA 3H9QA 2NVBA 4XA8A 5A9SA 1E77A 4YQZA 2FPGA 3H6KA 1PJBA 2ZKLA 1HLPA 1T4DA 4L0QA 4W9NC 2JHGA 1PJSA 3SEFA 1OBFO 2E4AA 3WLFA 4AVYA 2GNAA 3P2YA 1KIFA 4J2OA 3NT5A 5FFFA 1ZCJA 4II2A 3ZHBA 3LDHA 3H7AA 4QO8A 1DAOA 3U5TA 2Q1TA 2JKVA 2C20A 1HDOA 4K6FA 2BGLA 3E5RA 3DQPA 4DC0A 3QVTA 1NXQA 5CDUA 4EUEA 4D3DA 3INRA 4BO6A 2HK7A 1XQ1A 3LF1A 3M2PA 3UICA 8LDHA 1PU2A 4L74A 3TZQA 2HRZA 3KYCA 2GZ3A 2X8LA 3VH4A 4YRBA 2HMUA 2EW2A 1ZW1A 4J4TA 3BTUA 3MTGA 1E1MA 1QYVA 2IYOA 2B37A 3U49A 4DYDA 2Q46A 3AJRA 5KJEA 3D3WA 2VHYA 3GDFA 2IODA 4RGBA 2DBRA 5JE8A 4B7XA 1KY4A 2O3TA 3S2IA 2YJZA 4ITUA 1AN9A 5CG1A 3I9LA 3P5SA 3K5PA 4J7CA 3AU9A 4FN4A 5G4LA 4P4NA 2HO5A 1HDGO 1Z7EA 5JXWA 4NJMA 2Q4EA 5C37A 3WGYA 1FXSA 5U4QA 5DZSA 1C3VA 1T2AA 1ZXLA 1QYWA 4E5YA 4EZBA 1R15A 3PPIA 3RFVA 1HE3A 1U8FO 4LGVA 1NR7A 3WYEA 1FDTA 1U28A 4W99A 4MKXA 2C7VA 2VYVD 1KERA 4ID9A 4O59O 4ZICA 3PHJA 3IJPA 4CR7A 2O3SA 3FR7A 4YT8A 4YTEA 4DQXA 1Q0QA 3LK7A 4RZIA 3EHEA 5JDIC 1XA0A 1AXEA 2NQ8A 1JKFA 4NBRA 4IDAA 4D0SA 3INTA 4HFJA 4ZU3A 3RKUA 4CM8B 1WDKA 1SNYA 1HETA 4FJ2A 5JW6A 3D4PA 3GC6A 2BFPA 2RH8A 3VH2A 1R16A 4A73A 2G17A 3DXFA 4CUJA 5A3JA 3K2EA 4K28A 4DQUA 2AW5A 2DPGA 1Y7TA 3BMCB 3GHHA 4IGEA 2EHDA 3C1TA 1GADO 1XHLA 1EVZA 3S55A 5I8WA 5KVCA 1O89A 3DWFA 5BNIA 4HP8A 1XIVA 3OQ6A 5KTKA 4I5EA 3U4DA 2VRCA 3OQBA 3SBOA 1PWXA 2J3IA 3BYZA 1F06A 3GRKA 4MINA 3OH8A 1ZK3A 3DZKA 4CV1A 1LDGA 2FY8A 3LLSA 1E7MA 1UDBA 1Z73A 1LLUA 1GDHA 3AY3A 1VM6A 4LVCA 4U7WA 3L4BA 3LU1A 3P7MA 1KYQA 5CHEA 2HSDA 4RQTA 3GGOA 2A4KA 4J0EA 3ZNOA 3GVPA 2AEMA 3LC1O 1V9LA 3H65A 3JD3A 3KLMX 4A7PA 4OHUA 2X22A 4JBIA 2VOEA 4NI5A 5ICMA 4R3NA 1HXHA 5JAZA 3ZZNA 4DLBA 4DUPA 2C07A 3OIDA 4Q3CA 4PN3A 3U09A 4J3FA 1T24A 3IIEA 4WLNA 4GX5A 1UXJA 5DN9A 4OXYA 3DBHB 3PYXA 1WW8A 4GMFA 2EEZA 3TZKA 4BGEA 4D46A 3M1AA 1R12A 3JQFA 1NVGA 4PVCA 4NHEA 1KOLA 1GYQA 4YT2A 4XB1A 1KC3A 4YPOA 3JYPA 3I4FA 1CWUA 1XSEA 3I52A 4B4OA 1PS9A 1Z82A 2VHVA 1PJ2A 2AMFA 3Q9NA 3H2SA 3VVCA 3BMQB 4MVJP 1IHXA 3RVDA 4PVDA 3RI3A 4BQPA 3D4OA 1PL8A 2BELA 4MPDA 1DAPA 2PH5A 5I7VA 5T64A 4XYEA 4EJ0A 3A9WA 2O3QA 2A94A 3GEDA 4PCVA 3NTQA 3NDIA 4FBGA 3TN7A 1LQUA 5IJZA 3PQDA 3NT2A 2ZK7A 5IDXA 1EFKA 5FI5A 1DDOA 1BDMA 4GWGA 4RVGA 1GZ3A 2CMDA 3PJDA 3ZNPA 3LSYA 3JQBC 3PJGA 1HKUA 2GUGA 1R66A 2BLLA 3E82A 4UVGA 1T1RA 1UAGA 2OL4A 4XGKA 4BNTA 1UXKA 1YDWA 1HZZA 2NSDA 1ZSVA 4E3ZA 3G1UA 2UYYA 3ORFA 4PLCA 1ZZEA 2CF6A 1BXGB 3VZSA 2H6EA 1VKOA 3HSKA 2EP7A 2Q22A 3ZDFA 2DTEA 1IUKA 2OUIA 4J49A 3WNQA 4D79A 5L4NA 4CM6A 1YE3A 4PLZA 1Y8QA 4R9SA 4Q3DA 3VKVA 3RASA 3SVTA 1TI7A 4PG5A 3UVEA 5JY6A 3BMNB 5AXDA 4H15A 4OSOA 1DIRA 3ZWVA 4NIMA 1HT0A 4BO4A 1ZK1A 2G82A 3DDNA 4JLWA 4CPDA 4LW8A 3IMFA 1TXGA 1BVUA 4NR0A 5G0UA 2QRLA 4LMRA 2CUKA 2WYVA 1Y6JA 1PX0A 3WGOA 2DM6A 2YQ4A 3BMNA 4GL4A 1GQQA 4IS3A 2VUTA 3DZGA 1X0VA 4E12A 4FFNA 1QYXA 7ADHA 3NDRA 1T2EA 5JCXA 2Z1NA 2EGGA 1R37A 1GQYA 2OP1A 2Y1GA 4K6CA 2VTEA 3A4VA 3QWIA 1O5IA 4JJIA 2UVDA 1E7RA 5I7EA 1FDVA 3BHJA 2VNSA 1PQWA 1HLDA 1P1HA 5JC1A 2V6GA 1XR3A 1WNTA 2X0RA 5G0SA 5EINA 4CR6A 2RHRA 2Q50A 4MVJG 1XLTA 1AHHA 5TLSA 5A02A 5F5NA 4GPD1 4YJGA 4GGOA 2HU2A 1EVIA 2CSUA 5I9MA 2P4QA 3SC6A 3WMWA 1P44A 1NQ5A 2LDBA 2WWRA 2EF1A 2NUAA 2C2YA 2AA3A 3I5MA 1A9ZA 3PQFA 4UUPA 1YL7A 4BKQA 1SMKA 2BF7A 3ROMA 4LISA 2QYTA 3LZ6A 4J6FA 4QEDA 3FNEA 4O0LA 4YAIA 2EIHA 3K92A 3NJ4A 2VZ9A 1GV1A 3ZNQA 5FWNA 4BB5A 2Q2WA 4BMSA 4FOSA 1NWCA 4OQZA 2HK8A 3MJEA 2B4TO 1BW9A 3HB4X 3KO8A 4NFHA 3DOOA 3KYDA 4MJLA 3NGLA 1BDBA 2J5QA 1Y9EA 3KB6A 3E9MA 3LT2A 1P0CA 1RYEA 4RDIA 3WYBA 4O6VA 1VE9A 1TA4A 1LSOA 4JJGA 3OFSA 5EESA 5KVVA 1BW9B 2O23A 5CP8A 4MVJI 5GZ6A 2QW8A 3JQBA 4PZDA 4ND3A 4JIGA 3QLJA 5TJHA 2F00A 2FZEA 3DZIA 2NACA 3MJ4A 2WD7A 1RWBA 1Y81A 3HFGA 4KUEA 1CERA 3RIHA 4L4RA 4MIYA 3WBFA 4R1UA 1X0XA 2I66A 4EUFA 1UAYA 4PG8A 1GYPA 2PH3A 1TT7A 4RPHA 3RCBA 3UAGA 2GR9A 3GK3A 4Z9YA 3ENKA 4I9UA 4NBUA 2EP5A 2AQIA 3C85A 3FI9A 4J16A 4ZQEA 3WNVA 2I6TA 4NU5A 4I1IA 1I2BA 2YV3A 1IB6A 3PXXA 3Q6IA 1LDNA 1ZJYA 4U8GA 4UREA 1ONPA 4WE3A 4CQLB 2UUOA 4CUZA 4KOAA 2ZTVA 3UCEA 3PDJA 3WTBA 3AI3A 4E2YA 1FDUA 3MCVA 1F0YA 4KQXA 2YYYA 3QVWA 1EVJA 2E37A 3Q11A 5ER9A 4Y98A 1ZKMA 2PNFA 3PHLA 1V8BA 5JYDA 3HDYA 4FPXA 1GZ4A 3ZU5A 1BGVA 3DZHA 4TVBA 2IE0A 4AJ1A 4WLUA 4DGSA 4DWVA 3VHRA 1LA2A 4JBHA 4L75A 4QFDA 5JDCC 1SC6A 1P1KA 5TC4A 4HX5A 4LVUA 3MTJA 1RPNA 1ZSNA 2AQHA 1M66A 4GLLA 5TT1A 3WGGA 4BV8A 1LTHR 5CDSA 2XXBA 1VI2A 3F9IA 2Y1DA 4Q9NA 4WPGA 4RJTA 3QSGA 1MB4A 3NTRA 4WECA 4EUHA 2E48A 2V6MA 2YV1A 4OKIA 3K31A 4U5QA 3RKRA 1DIAA 2FR1A 4M1QA 1YDEA 1QLJA 4MKRA 3U9LA 4YAKA 2AE2A 2XXJA 1DLIA 1LBEA 1A5ZA 1CF2O 4Q3BA 3E03A 2A9FA 4URFA 4ZQBA 4D0RA 4R1TA 1PQPA 2YFQA 3GVCA 1O8CA 3G1TA 1AXGA 1KBZA 1IL0A 4UVDA 2GN4A 5A9SB 4NG5A 1MXHA 3KBOA 3INGA 1ID1A 1SBYA 4CQMA 1N9GB 5GMOA 1B8VA 2HMTA 1HYEA 4PZEA 5HTOA 5TIIA 4CLOB 4II3A 4P4LA 1C0IA 5ITVA 3QA9A 4IJKA 2IXAA 1I36A 1CDOA 1O94A 1K6XA 2PD6A 3ZV3A 3NRCA 3HWRA 4TQGA 3RJ5A 3NUGA 1FMCA 4F45A 3PHGA 5LDHA 1A7AA 4GKVA 2NQTA 4ND5A 2BGMA 1DO8A 1GR0A 4CMEC 1PEDA 2NM0A 3B1FA 1YRLA 3KUXA 2BFAA 2DLDA 2ZYDA 1IOLA 4JP3A 4EEZA 2JHFA 1B8PA 2H1SA 5EN4A 5DP1A 3IUSA 4GSLA 3ROPA 2ZYAA 1EK5A 5FF9A 4AICA 4IPTA 5IN5A 3KYBA 2AEJA 4KMSA 3PTZA 3VH1A 2NTNA 4OJNA 3ANMA 1X14A 2VHXA 4EI2A 2RCYA 3PZBA 3PP8A 4O5OA 4FFOA 4WLOA 3PGXA 5JNLA 1HDZA 3D1LA 1W8DA 3F1LA 4XYMA 1ISGA 1SB9A 4BNFA 1QKIA 4RF2A 1Y8RA 3OA0A 1D1SA 4ALMA 2C5EA 1A4UA 2P68A 2YUTA 2NV6A 3OJLA 1DIHA 4K9DA 1EVYA 4AL4A 3AI2A 3PK0A 4YB8A 1I2CA 2V6BA 2QRKA 3GEGA 3C24A 3OETA 2Y05A 3L0DA 3F47A 2D2IA 2JAHA 4S3MA 1U3VA 4GI2A 3E48A 1HEUA 3PFFA 4FC6A 4OM8A 4LN1A 4XB2A 1A7KA 4ESOA 2D8AA 2GYYA 3HE3A 3JQCA 3RUHA 3TFQA 4GVXA 3JYNA 3W6UA 2EGHA 1UZNA 4CMBA 3PWKA 3AM3A 3C1AA 1PGNA 3OIFA 4YWJA 1O95A 1YJQA 3WGHA 1U4SA 5G0WA 1E3WA 5H82A 2BKAA 4W7HA 4E5KA 1NPTO 3ASUA 1TT5B 3ZWBA 1FJHA 1JU9A 1LU9A 2WJPA 2A35A 3RFXA 3ZHYA 4RCVA 3G3EA 3ZW8A 1E7QA 4Y6RA 1BSVA 1IULA 4LCEA 4ONEA 1HE4A 1JAXA 1Q1NA 1T26A 2EV9A 4OQYA 4BO0A 1N7GA 4CR8A 3FR8A 1JWAB 3KEQA 1B15A 5AQ1A 3IOYA 3GNSA 1UJMA 4QTZA 4AJIA 4D42A 2OP0A 1RM4A 4QQRA 1SZJG 2P4HX 1DJNA 1NR1A 3BMOA 4UULA 2PFGA 2JAPA 4BGUA 4TSKA 3ZU2A 3JQ9A 1J5PA 1JDJA
chains in the Genus database with same CATH superfamily
2R6HA 3FUVA 1XXHA 3U0BA 2ZWOA 5LKRA 1M2VB 5IM4F 3RUDA 2ZM6B 3JQAD 3RS3A 1K5DA 2NG1A 3LVQE 1QHGA 1WXQA 2FK8A 2WYIA 4Y6PA 2X0DA 2HJGA 4J03A 5B37A 1CUVA 2EFDB 1Y63A 3AKEA 4L5YA 4OUKX 3H6HA 3PWTA 1HWYA 3THOA 4MVWA 1GL9B 3KXDA 4UBKA 5EPUA 4ZTBA 2ZZNA 3ESCA 4B3RB 2W6ZA 4LSMA 1ARZA 4HS4A 1F0NA 3LQRA 1II9A 4K26A 2O50A 5CLLA 2PMWB 1A4RA 1IFXA 2G5PA 1DG3A 3TTXA 3PZRA 3EUWA 1A2QA 1XKLA 2F59A 3AZPA 3C5HA 4JBXA 4JCCA 1D3AA 1I3OA 4N8EA 3SYMA 4CG2A 1EFAA 3JQ6A 1JE1A 1LTKA 5JMOA 1KAEA 1OHHD 4JI4B 4GBJA 4IH4A 3P2IA 5ECYA 4S1WA 4R54A 4L3WA 4RSMA 1NVTA 5HUJA 1ZA2A 3DFUA 1GSIA 1C30B 3IP5A 3L4SO 4INAA 4LZZA 5AKIA 3L4EA 2UZ3A 1EGVB 3E9YA 4O1HA 5HA5A 3RJTA 4XIJA 3D3QA 3RU7A 3FOEC 5AVQA 4G01B 2H17A 4MPPA 5GONA 4HNTA 1KQ3A 3EZXA 1G3IA 5DBHX 4DC9A 5CXQA 1KI8A 4CL8A 4U6QA 3MMXA 2X19A 2D8MA 2V4UA 1SVMA 3R1IA 3GQBA 3D64A 3N8NA 4Y2JA 5DMHA 5BW8A 2X58A 5K8CA 3EGIA 2Y8EA 5JCZA 2XA2A 4YRRA 3NH6A 1SM4A 3LZDA 3SXPA 4CGZA 1Y1PA 2FWRA 1JZQA 4KKXB 4K9OA 3FMGA 4UE3S 3RIEA 5BV0A 3FHTA 4OXNA 2VCEA 4BU1A 4HL6A 3A06A 3F4BA 1P2FA 4WUVA 3NBUA 5D5PA 4CDMA 2WIBA 3F0TA 5JEDA 4MMZB 4RLHA 2TECE 3FYDA 3TQSA 3ZCRA 2VDOB 3WBKA 4C4ZA 2WG2A 2PKQO 3P9XA 4QDTA 3T5AA 3O84A 2ZIFA 1CY8A 1F5SA 3OZCA 1P31A 2BM9A 2G9ZA 4ML3A 2GTPA 4WLVA 4ZO6A 1C8BA 1T3SA 2AJCA 1E96A 3D6JA 4TKZA 3THYA 2CNNA 5DE3A 3GR6A 3ZEAA 2VPZA 1OT3A 2DE0X 4P83A 4DL9A 2B8TA 2ZYVX 3F4LA 4JC5A 1M5RA 5T4FA 3LO5A 1KTIA 3VR4A 3V7NA 3AF1A 5EXTA 1TKAA 1I79B 1IMOA 5AXCA 3EB9A 2FDRA 5F1PA 4RC9A 1FMJA 2HHHB 1C2YA 4LHVA 3I8XA 3K0BA 1QNLA 2P11A 1S4MA 2FMUA 3E7PA 2ZT7A 4A26A 5ESXA 1DJLA 1L1QA 2PBRA 5AHKA 4Q39A 4N0DA 5LQCA 4JQSA 1TCBA 1X80B 1FK8A 1TUBB 2Y67A 3EVAA 3N74A 4H7HA 3RIGA 2FQXA 1QK3A 3SBEA 1YQDA 2IHBA 3GFOA 3PEVA 4DREA 5JZ9A 3SF8B 3OF3A 3MLEA 3L01A 3EBPA 3EXG2 1A8HA 4I8XA 2CZCA 3M6MD 5WRFA 2Z9BA 5JAMA 4AJKA 1NA5A 3PWZA 1TJ3A 2C3UA 4XUDA 3D6UA 5DBIA 5KQMA 3BICA 2RCNA 1GARA 1K3TA 4AKGA 3V7FA 2NZ2A 4V0SA 1JUDA 4BGDA 5E95A 1YL6A 4BMCA 1ZUD1 5DP2A 4H7PA 4JT9A 3MUNA 5IUJC 3IVAA 5DYTA 4KXQA 1AB5A 2ZJ8A 1EIZA 4C07A 4G0YA 1G5FA 1GKIA 1CEYA 2EFJA 3CFYA 5AICA 3FCAA 1LJ8A 4V0RA 3D0KA 5DWQA 1OZAA 5KSZA 3HXOA 1GQ2A 1Z45A 2H5JA 3HBAA 1E20A 2DFTA 3KFLA 2HMVA 1ISMA 2VWGA 4FMDF 3JVUA 4YAFA 3RHTA 3LKBA 2OA0A 3TRIA 5NLLA 1TEVA 4WOBA 3PS9A 3IP9A 1L7OA 1LBTA 3BBLA 5CH3A 5JDCA 1NE2A 1WDWB 3BAFA 1H2YA 3UTDA 3BZUA 5I9NA 3KCQA 1N1GA 4AK1A 2NV2B 1O03A 2ANCA 3EQ9A 3L43A 3BXZA 3QOYA 4K8RB 4AKTA 5KX5A 1IJKA 2VWHA 3BMXA 3ZJXA 4GR9A 1G17A 1RZ3A 3TXXA 2CL5A 2DFKB 1KJIA 3S68A 3MHTA 1QORA 2NU6B 1P6UA 1RXUA 2PXHA 4WCVA 1JQ3A 4YT5A 4OMCA 4DMLA 2YWGA 1E98A 2RAFA 4O2BA 4E0BA 2XMPA 3CJQA 4NARA 4NYJR 3A27A 1ZVQA 4ZO9A 3OEYA 4JP2A 4BNKA 2VXOA 4DDTA 4U2CA 1EX6A 5FKJA 2FUNB 1W4BA 3ZKWB 5LSAA 2X9LA 4M87A 4TT3D 4BMXA 1RYMA 4YHBA 1UDXA 1UH5A 4CTNA 1QB8A 3IRVA 4PE5B 4A5OA 3I72A 2BEWA 1AUQA 2YFHA 3EZFA 5KVQA 1SCAA 4MOWA 1PWEA 1VYTA 4NENA 2OSBA 2DECA 2ETVA 4RH1A 5DLEA 4A2WA 2PKQP 5BT8A 4K2AA 1MX1A 1RI1A 3UANA 4XDZA 1HMYA 4F5DA 4ZI3A 1VLVA 2R8BA 3T0FA 5D3ZA 1W4RA 3EDMA 1H8HA 1CRLA 4LI3X 2QG6A 1UDCA 2C9BA 2E5FA 2YWFA 1LJLA 2OM6A 4PY2A 3THXA 1CUFA 1K3FA 3O75A 4CDRA 4F46A 1JT2A 4O8ZA 5LIPA 1PGOA 3QWHA 4AZ3A 3PNLA 1BEEA 2FEWB 4CEHB 4F5EA 1EM8B 2JJ2D 2WJZB 2IV7A 3GHYA 1W2HA 1BS2A 3IWDB 1B73A 4MQUA 4TUYB 4U4AA 1E99A 2ZYTX 3U6KA 4B40A 5L3QB 4G9EA 2Z95A 1P4GA 3PGJA 4JSTA 3KU4A 1NONA 2VYCA 5EJ7A 2ZUFA 4XD7D 2LKCA 2J32A 4X8MA 1UFQA 2OFXA 3GG9A 1QUFA 2PZJA 2IUYA 3AUFA 3VJMA 2CLLB 3C3MA 2WWHA 5AVWA 5KNBH 2ZATA 1HI9A 1NBEA 1N6HA 1TAUA 5B58T 5ALGA 5CT8A 3W2HA 2UYHA 1H3NA 3O8NA 2YHUA 1CP2A 1HEIA 1ZXXA 2BRUA 1OVMA 2ZG6A 1P3Y1 2CUTA 2NO9A 3O90A 4OREX 1BXRA 2PS9A 4JLVA 4K9NA 1EVQA 1TEHA 2HF2A 4DGQA 2OBNA 4ESEA 1SQFA 1VL6A 3IHWA 4LOJA 4UHBA 1KWGA 1N5LA 1T1JA 2A3NA 3ZWWA 4GE0A 5IBCA 2ATIA 4JKIA 3I39X 5E0OA 1JHVA 1J23A 2QSYA 2DFPA 2VN8A 1PS8A 2WFAA 4ESHA 5KOYA 4DJDC 1NLMA 3G0DA 3L2OB 1GVNB 1GTMA 1IRXA 1XQWA 3SYRA 2GESA 1DG9A 3N0WA 5CDFE 3PGKA 2XT9A 5BRJA 4TLEA 4AULA 3A28A 3U37A 4D9JA 4RF3A 2QLLA 2FEPA 1WCWA 3GZ4A 4YP5A 3E3NA 4LVOA 3WL3A 2AXEA 1Y7LA 2B0JA 2JFYA 3FAKA 5CJ2A 1YVDA 2GCEA 1NFRA 3CNHA 4HNAA 4CBVA 2SCUA 3PC2A 2QF7A 3LHDA 2EC5A 2OZLA 2QTNA 4IM7A 4BBZA 4MKFA 4DSTA 1ZJWA 2ZJFA 3BOSA 4CM9D 4N5MA 3KYJB 3O7MA 1ZVVA 1L7RA 2B30A 1XAIA 5BR8B 2MDTA 2QN2A 3TOCA 4D4KA 1H0RA 4O4IF 4MVJA 2X6TA 3A4YA 3GUYA 2OGUA 2DZDA 3NVDA 4PPYA 5HM8A 4Q02A 1NZDA 3EDRA 1NY6A 4J0FA 4OK5A 3TGLA 3U7FB 3IX7A 4UUOA 1O6FA 2J45A 2QX4A 3H7IA 1XO1A 4R2XA 4CI9A 1G60A 1ZP6A 4FZ3A 1TQHA 3RU2A 3A1WA 3PQCA 3ZE7A 4UEKA 5M6DA 1N57A 5MF6A 4YPFA 5HF9A 2DHDA 4AYTA 1PNTA 3E4CA 3S3TA 2R3SA 2XTAA 2B5OA 3C7AA 4LGCA 4PS0A 3REGA 5EJMA 4EZEA 3SZOA 3HU5A 5JSZA 5FUWA 4OHBA 4CLQA 4MITA 2GM3A 4IDCA 1E92A 4YS6A 2EFEB 4YHHB 2QGZA 3MGAA 1YCHA 1XU4A 3MAGA 1F6WA 3EJWA 4TMXA 3PXGA 3VKWA 3ZD6A 3HBFA 3ITNA 1ZWKA 2GJ9A 1CD5A 4ZT3A 2WKSA 4BFLA 4BVAA 5ITSA 5LYJA 2PU7A 1CUEA 2IEBA 1NBME 2I6GA 3R77A 4H1UA 2NUBA 1N8KA 2I99A 3KX2A 3D81A 2AG8A 4Z8YA 2H1CA 1HM5A 5CB4A 2Q5LA 1JR6A 2KW5A 2C9DA 2COUA 4Q4AA 3K6SB 4TZKA 5LQDA 3QMWA 2QN6A 4KO2S 4XGNA 3WGLA 1I7BB 1ECCA 3MOIA 3ID6C 5AIAA 5AK4A 2NTYC 2XZOA 4I4NA 2QM7A 3L8DA 3U5ZB 1J5XA 3ZDZB 2W43A 3I0ZA 3IT1A 3NLLA 3BL5A 4UMEA 2C03A 3ZCXA 1Q44A 5C4IA 3IVGA 1S1MA 2B8WA 5C18A 2W2LD 4UC0A 1U7HA 1SUFA 3B78A 3O4JA 5A5EA 3PGLA 4TKLA 3LUHA 5EL0A 3I92A 3WA7A 3MM4A 3OLQA 3GFSA 3W0LB 2QNIA 1WTCA 1YDFA 4WZ6A 3LVRE 1P0MA 4R1PA 1YRAA 1E9CA 3A9CA 2Y1KA 3FE2A 1DKMA 3ENNA 3L6CA 5IABA 1VSVA 1V9SA 2XNKA 4UCXA 3OX1A 1KFEB 1JJVA 1RJDA 4UUNA 1GEGA 4Y2RA 3TLXA 3ZU6A 5IVPA 3PQVA 1P0IA 3LWZA 3IS3A 4HX2A 4TLLB 2QLNA 3NWPA 4HY3A 1QU3A 4CIDA 4S05A 1SXJD 4Q21A 3TR0A 3ZBTA 5IZCA 3GFGA 1F1BA 4L6AA 2AV6A 2W6NA 4EO7A 1FRFS 3KWLA 5JXHA 2QEQA 5BN4A 3V1YA 3RV4A 1FRQA 1Z8FA 2XPCA 3NXKA 1KEPA 1SUWA 5DNDA 3H8VA 4CODB 4D6YA 5IXSA 2BCJQ 1YMQA 3GJYA 1HTWA 3HZOA 1A4XA 4ED9A 4Y67A 3CBGA 1NC1A 1JR2A 4RPKA 2R84A 1UXOA 4M1MA 5F7ZA 1F4VA 1XZ8A 4BEJA 2G6TA 1G8YA 4MSUA 2IEAA 1I4WA 2ZB4A 3B51X 1SG6A 2ATXA 4TN5A 5AM4A 5KU7A 1H8ED 1FNMA 4JLKA 5DHPA 1NVBA 1LX7A 1YQQA 5FAKA 1MRZA 1GZUA 3MBIA 5DNAA 3V80A 1Z0JA 2Q3EA 1RPAA 1FFXA 3R3UA 4L16A 1CR4A 3I5YA 4FW8A 5G2OA 4B82A 4V0NA 1G20B 5E0KB 2O0KA 4IIYA 3UENA 5JRJA 3C8MA 2AGVA 2LIPA 5B2ZA 5TMEA 5IULC 3H2KA 1ZCZA 4I4CA 1QH0A 3CW9A 2ERYA 3KT3A 1H8EA 3E5NA 3FNQA 4UHCA 1NRJB 1C9JA 1G8AA 1Y7PA 1K6JA 1H2HA 5D84A 3SJBA 1T8WA 1Q2XA 4B9EA 3L9WA 4RZSA 1J90A 1DVRA 3F6SA 1FRVA 1D07A 2GBLA 4TMWA 4G8DA 2ZS8A 4IR7A 4LHEA 1GKUB 1P1IA 3VR4H 4QWWA 5JVDA 2DMRA 2P6NA 2RIRA 2Z8YA 3E9QA 4XR4A 4I81A 1TKBA 2YRWA 3H11B 3WK6A 3HY3A 1SR8A 4RSGA 4B6RA 3K70C 5IDQA 2C2ZA 1W5BA 1Z17A 1C14A 3CUKA 2A67A 5TPZA 2I33A 1SULA 4TMVA 4AG6A 1T13A 3IVRA 3WK4A 1DPGA 1TTQB 2A0KA 2REXB 1M1YE 1BCSB 1FC0A 1Q1GA 3IPCA 1SWWA 1YZYA 4PC3A 1CR1A 1K2VN 4EOGA 5E6RA 1U2DA 1JFTA 1KMHA 1XYGA 1HYBA 2WF5A 3EAFA 3N0TA 4ZT2A 1LRJA 3DAGA 4JVLA 3DEAA 4ID3A 3TLZA 1E6CA 3VOAA 1A98A 1OASA 2FE1A 4BEVA 4LECA 1TU3A 2VAXA 1FU4A 2YW2A 3O82A 2A33A 1PTJA 2PSEA 3R7FA 1JG1A 2Y2UA 3I45A 2G06A 2JIPA 3SYNA 3I2KA 5J4LA 4LHXA 1QIHA 4PBRA 2IU6A 2D2FA 3HC7A 2GO1A 1OA1A 3KM0A 2EJWA 4OH1A 2GDJA 1JG4A 3LHIA 1WCIB 1K92A 5DF1A 1ODCA 3MBKA 3QKWA 3ZV7A 4CKBB 3H9GA 3WL4A 4EYEA 1FVFA 1R0KA 2Z5FA 2WILA 4NFSA 4KTVE 1ODTC 1XHEA 3SDBA 3TZHA 3ZQ4A 1U9IC 3H8SA 4R0MA 1IHOA 3CRRA 3DMPA 1UP6A 1DX9A 5TEVA 5FNVA 5JYBA 3OF2A 2FU5C 2ZQZA 3ND6A 4KC0A 1WXXA 1XTUA 2GXAA 5ALTA 2O7QA 1K3UB 3CRNA 5KYKA 3WLEA 4KR6A 1Z5WA 3SZ3A 4MVJE 4KW7A 3TLJA 2PZ8A 4PZZA 4ZCLA 2IS1A 5A1JA 1U4OA 1GU0A 3O21A 5KQLA 1N5IA 4UU1A 3UA4A 1H0KA 2ID8A 4FYXA 4ZI7A 1FA9A 4KIJA 4NJMB 5A3QA 5JCJD 5KOJA 5L7YA 1NGSA 3VR6D 2IPMA 3KEMA 1W4AA 2J48A 5SY4A 3RAGA 2WT8A 1TD1A 2OGWA 3GPIA 2EXXA 5DLPA 2VJAA 3SSAA 4OM7A 4L2IA 4BAUA 1MMFB 1UKZA 3TGPA 4FW9A 4U8HA 2VH2A 3T7SA 3BF8A 4HFRA 1NJ8A 5EQDA 3LUAA 4M9UA 1UBJS 2MR6A 3PJFA 4EB8A 4GDMA 1PW7A 2P3LA 2YMLA 4ARCA 2B7LA 3RUAA 5I47A 2PSFA 1U63A 1RHQA 1TFRA 2X0JA 1H6DA 2X7JA 2BUCA 2R1ZA 1RXSA 2PJZA 3IAHA 5CPBA 1IG3A 2J6CA 1RADA 1VLZA 1YRHA 2H65A 2J0EA 3MWDB 4OVKA 4R8MA 1T5LA 3K8ZA 3SE0A 3BWDD 2F2TA 3QE3A 2LZ0A 3VR2D 3T3OA 4JYAB 1GYRA 3SKXA 5KAPA 4E3WA 4EG6A 4WNCA 1I7SB 1UJCA 5C1OA 3BGVA 4ZPJA 4AS1A 4OFBA 5H8WA 3K6JA 5IAAA 3GUCA 2R4TA 2O7NA 3F6CA 2HRDA 4B0PA 3AKCA 4PWZA 4F4FA 2JZOA 3DB2A 1LXCA 5ISMA 3L7CA 2B9VA 5C8YA 5CBPB 2WB4A 5J23A 2XB8A 3F98A 4HQRA 1TK2A 3CINA 3MJFA 2A5LA 1NF8A 3QEMB 3B13B 1KEUA 4G0QA 4TL9A 4TWBA 4OK3A 5DNWA 3MEQA 3PF8A 4IOKA 4F6RB 1NKTA 3DJFA 4RMIA 2X76A 3RBAA 3TRKA 1O95D 2HAEA 1K97A 3M6AA 1J49A 3K5IA 3ADOA 1G2QA 4Q5IA 4CT0A 4EW6A 2I4TA 1SBIA 2ZB8A 3OQIB 2HLDA 4R9UC 5DOZA 1SHLA 4P7BA 4DXAA 6ABPA 2JCYA 4JVNA 2WU4A 2F55A 2EQAA 4XARA 3BIFA 1XF9A 2F62A 4NQZA 3Q40A 1KWKA 2OO7A 1KVSA 3L7MA 2D0IA 1SU4A 2O2HA 3A1DA 1UBEA 3HCRA 2V0NA 3DYIA 3AUTA 3ZBUA 2IZZA 1MH1A 2E55A 3JQEA 4LNUB 4YACA 3AK4A 3O4RA 4NK4A 4BV3A 1PD0A 4GYJA 5H3HA 3OEED 2ZZKA 1UJNA 1IJEA 1OR8A 2WQ6A 2HQOA 1L5ZA 2PTHA 4GI3A 1CHNA 1W48A 1PZEA 3RF6A 3Q2KA 4DB2A 3HBJA 2JGDB 1G64A 3VHXB 3C3XA 3KUKA 2PL1A 1Y9DA 4HNRA 4R2IA 3HUTA 5IZCC 1LRLA 4M46A 2H08A 1YZ3A 1PR9A 2YDXA 1M1ZA 3HU3A 3OZSA 2A88A 4GSYA 3OU2A 1M1NA 3FKJA 5D01A 1E3JA 1OU0A 1EM6A 4KQJA 2YBEA 3AYZB 1IC6A 1HQKA 1FVOA 4QBIA 2VQDA 2YRFA 5EMMA 2J7PD 3NIGB 4M36A 3DTTA 2F3TA 3RIYA 1ZD8A 3GU3A 3HBMA 3RW9A 4HNHA 1HGXA 3DDHA 3AFOA 1K6EA 2JGIA 1SH7A 1R9MA 2PLAA 2WI8A 2ZYHA 3QYAA 3ZX4A 5B30A 1HDIA 2AQKA 2ZUSA 1MO4A 1MZVA 4GEGA 3MBOA 3U17A 1HZZC 3R7LA 5EZYA 2LIVA 3NBXX 1KK2A 4EAAA 2VHUA 3FLAA 3AZQA 4CKEB 4MQ5A 2BJVA 1F3OA 3P2EA 2GN9A 2YIDA 4EEKA 2ROQA 2AN1A 2OZPA 3HGQA 1VPWA 3SOPA 2GILA 1OWLA 3L7JA 4LVNA 4V0QA 3KPJA 1WWKA 2YDYA 2P2DA 2IIPA 1FYXA 5SZHB 1E6UA 4IXWA 3VX3A 2BP7A 5JMTA 1A69A 3E2MA 1T1SA 2D13A 2VWQA 1Y8QB 3A3PA 3QLVC 3TAUA 3VYSB 4RTMA 3SZLA 1ZD1A 3EQ8A 4DLXA 1G5PA 1XD2B 4OMFG 2FW8A 3KYIB 4LC9A 4DUYB 5BVHA 4HBGA 4J76A 2ADMA 4GO1A 3QLUC 3M0EA 1GPAA 3FPHA 4EVQA 3WLNA 4Q37A 3TW0A 2EBFX 2D5CA 5CT5A 2PYIA 1QONA 4RZ2A 2IEDA 4X1KB 4AU1A 4DIUA 1Y8ZA 1JLRA 2C59A 1EG7A 2CDCA 2ZJ2A 3Q3CA 3R5XA 1XTBA 4GZMA 5T6BA 3TOXA 4WOJA 1TQ2A 4NJEB 4YMUA 3MSCA 5HWSA 1RWQA 2ZI4A 2AFHB 1W1IA 3JQFC 4BDSA 1R10A 1ZIYA 2PGXA 4WA7A 3BFJA 1BMFD 2VF2A 2GWRA 3QV1A 4PPQA 1L5KA 3DTVD 4FNAA 5EQJB 1UEJA 5J58A 2CN1A 4PAQA 1JIKA 2ZBFA 4V0OA 3MS4A 4Y2XA 1I7DA 3QIVA 3KPVA 3UFXB 3FLMA 3U48A 1TGYA 3F5FA 1PL7A 1P45A 1OXUA 4JT4A 1PUJA 1T2NA 2YL2A 4F2WA 4DV3B 2YXEA 4W82A 1OXVA 1E2DA 2CXNA 2JGAA 3D7RA 3RWOA 5JI2E 1VBNA 3T9EA 2XB9A 2YZKA 2P8JA 3FPJA 1V25A 5CVJA 2JFXA 2FWBA 3EMKA 3ORHA 1KZYC 4KJZA 5EMKA 4PCUA 3HB0A 5EJEA 4EF5A 5TEWA 4KPFC 2J3KA 2GFHA 2GHTA 4JUFA 4EATA 1IVYA 2CUNA 2NTEA 2VP3A 3DFZA 3FROA 3K1ZA 4BPBA 1YR6A 1R9NA 2P1ZA 3CQ9A 5AJWA 1VJCA 3UCXA 3A1CA 4DIDA 3HKDB 1HA3A 4BFCA 4F8JA 2KBEA 1PI3A 4YR9A 5LIRA 5E9WA 4KXMA 3GT3A 5IT9A 2HLNA 4YPVA 1T43A 3FD8A 3AR3A 2ILVA 2BHNA 5EJAA 3KQSA 1R3DA 2HIMA 4P1ZA 4BNLA 2AXQA 5M34A 1JJAA 1JA1A 1CJUC 1SPBS 3NV7A 3FMOB 2N9UA 2P7IA 3B3QA 4GI7A 4Y2YA 2JCGA 2V7QA 2V7PA 2D2VA 4A15A 4UPEA 3I2IA 1R0LA 3UKDA 4NZOA 2ZGVA 4HDCA 1EFTA 1V3QE 3M9XA 4Z0HO 3R7BA 3UG6A 2QTBA 5C8ZA 5ALYA 2QVCA 1MO3A 4MYHA 4BNVA 1V7ZA 4BNUA 2VP5A 4PQEA 2BFDA 3SX2A 1FW8A 1N2HA 5AFSA 1U8UA 2H2DA 2AMLA 3A4IA 3NHAA 4KLZA 1DDIA 4IVQA 1O0SA 4OI4A 3AFNA 3PRYA 4RD0A 4UDYX 4F0JA 2J0QA 4Y2QA 4MXDA 4KWIA 1KK1A 1EFPB 3MWEA 3TZ6A 1JQEA 4Y6OA 4ZAGA 3EIFA 2C4HA 3WQSB 3FWKA 1U0OC 1YCGA 1BQEA 1HMPA 2YVQA 3BRCA 3N58A 4XUCA 3NTVA 2EFGA 5HQ3A 1SJ9A 1D04A 3SBDA 5BNWA 3MJRA 1QYCA 5LLDA 4PSUA 3FPCA 3L6RA 4HYQA 3TLKA 2NLOA 3R3ZA 1XEXA 5AUOB 2GCPA 3SXUA 5JAIA 3L18A 4AJPA 4ERXA 3CGWA 2CLKB 5TRTA 4AJHA 3DD5A 1QRSA 1FTNA 3O03A 4LJAA 4CKCA 5T8KA 2V7BA 3HCWA 4REQA 5JNVA 4UTZA 4N18A 4UU8A 5FPHA 1JEOA 2O8EA 1UDAA 3W78A 1UJBA 1Z18A 1VE3A 2E1RA 4MVJM 1AQLA 4IV8A 4HKTA 4MV4A 2PMDA 2VH1A 2NV0A 2FEOA 5KQPA 5MDHA 1AO0A 4EA6A 9MHTA 1CDZA 3HSSA 4MP6A 2QW0X 2V65A 5FTWA 1NXPA 3VFDA 2Z8YM 4CKWB 4Q66C 1SHUX 4RQUA 3HJNA 5A04A 3G0OA 3OJ0A 3JQ7A 4AG3A 3X1DA 1JECA 4KUHA 1KZGB 4EGFA 2R4UA 4ZVOA 4WY8A 2O8NA 3CLUC 5ALEA 4NATA 2OMKA 4EVIA 1SVWA 1UBTS 5JTTA 1DFIA 3HU2A 5F1OA 2RHHA 2K7ZA 4D9KA 2YKGA 1VPVA 3PG5A 3H19A 4H7IA 3EWIA 3PE3A 2X5OA 2J4FA 1G7TA 2XIQA 2HQ1A 3LHKA 4AF6A 5ITZA 2E3JA 1EBFA 2VDKB 4OOEA 5EP1A 5JPIA 4C0XA 2DWUA 1ZNXA 3I9V1 3DS8A 3KT6A 3LX6A 1IN5A 3N0RA 3A3KA 5DV9A 3DGEC 2X42A 5A6VA 2EWMA 1Y5RA 1FFYA 3OIWA 1RYNA 1TLFA 3DBLB 3ZI4A 4US0R 2IRWA 4QPZA 2VL7A 5IJ0A 1L9KA 1E2BA 1V41E 3SZGA 3I5XA 3VDMA 4Y6LA 4XQ9A 2HR1A 4C04A 1YRYE 4EJ2A 2I1LA 1IM8A 4H3HB 5G4KB 4M9CA 2BFCB 3IOEA 5DGXA 1AKRA 5JXGA 2XCSB 1MV8A 2BGIA 2Z4TA 4YUVA 4LHWA 3R7NA 1R6XA 1NG9A 1TIBA 3S2ZA 4HX9A 4BO5A 1JDSA 1UKCA 3ORSA 4AQDA 4OAPA 2H1HA 4DLVA 4I50A 2REBA 3DV0B 1ATZA 5AHRA 4E22A 3VNVA 2ACWA 2V45A 3NEYA 2CDBA 4CEIA 1ITZA 1QGZA 1BWSA 4X3OA 3WTCA 1NE7A 3WBBA 1JF8A 1TIPA 1NOKA 2PA0A 2QD4A 7REQB 4UFNA 2FPSA 1QR6A 2H8GA 1CRWG 2NZXA 4UHFA 2PZMA 4WT7A 5T73A 3PSAA 3S8MA 1Z4JA 1JN0A 1AQUA 3OZIA 1PZNA 2V0CA 3OZ7A 4IO0A 4PFQA 1F1JA 1Z56C 1NNUA 2Q9CA 1W5FA 3M6WA 4HWRA 3KJIA 2IZ0A 4H7JA 5EIEA 3STTA 1DO2A 1IHYA 1JSRA 1KRXA 3SEAA 1MGOA 2VNKA 3PKZA 5EKSA 5GAJA 4RTSA 5TARA 3A6PC 4RM2A 4TL8A 3WBJA 3LV8A 1CPYA 1PV1A 1KRWA 1PS0A 2JHPA 1K5PA 4L95C 4CV0A 2GJ4A 2W98A 1XGKA 4GOJA 4ZJZA 1QMGA 1PNQA 1UPAA 2I1VB 4GYWA 4KFUA 4V02A 1HY3A 5HQJA 1YZUA 3W9UA 1ZNQO 4DR4B 2XMDA 3L6OO 4Y1EA 3OICA 4FCTA 3KHUA 5A0FA 5CYGA 2E49A 2FHPA 5CCBA 4ZVNA 4IYRA 4BLOA 4YCNA 1T5IA 1M7GA 5AJVB 3X44A 4PRYA 5K51A 4Q24A 1C4KA 4HTAA 1XL0A 1OPRA 1W73A 2AIRA 4HCJA 4JS0A 2VHTA 1GGMA 1E3IA 1NFQA 3C3PA 4ZREA 1PTJC 1EDZA 2GFIA 2PO7A 3BGWA 3ZBQA 4KI0A 4Z2AA 4KWTA 4INOA 3HVRA 3EF0A 3CNOA 3PDHA 3BAZA 4KRGA 1U4NA 4O2RA 4G37A 4AM8A 4M1SA 2A9VA 2PUDA 3EFHA 3OFND 1KMMA 1XCGB 2P9HA 1AKVA 2C42A 1Q6ZA 1ENPA 1QHIA 3DXXA 3C8UA 4G4JA 1KFJB 1YOBA 3L46A 4XX0B 2ZZMA 2WINI 4AK9A 2WF8A 3FSRA 3NR2A 5CPFA 4LOHA 3SJUA 1DCTA 1OAOA 1QCYA 2I8AA 3EDOA 2WT9A 3W3AA 3RG2A 2Z0MA 3B6ZA 4OL0A 4B3XA 1M6WA 3K9BA 4M7PA 4X3CA 3SKYA 3F2IA 4WBNA 1OH6A 2R751 5J4YA 3RFCA 2VT3A 3UH0A 3C5EA 2R2GA 4XSVA 1JWLA 2M9MA 1V1RB 1ODLA 3LRXA 1BMDA 1X9HA 3QNUA 4G26A 1I4TD 2WUDA 4N7MA 4X90A 2Z3VA 5DI3B 5HS6A 2L82A 1QH9A 4AJEA 4X92A 3SDSA 1QKKA 2I54A 2W4MA 5FOVA 2ZRIA 3N75A 2DSTA 2W0MA 3IGFA 4EBFA 1PBNA 3SCZA 4Y7DA 4BQEA 2QRZA 2HWUA 3ISVA 4XDGA 1JKJA 1OFUX 2CWDA 1AKQA 2XOEA 3NHKA 3PB3A 4PGFA 3RVMA 4D5GA 4JLPA 2ZYGA 1PCXA 4OGFA 3R7WB 1YC2A 4LXQA 1RHRA 1J7JA 3OE7A 4YX9A 5G3YA 5JJ5A 3CR7A 3JARB 2V7WA 5BSGA 3F3KA 1TLTA 3WGQA 3L1HA 3R0IA 1KA9H 1YGYA 5BYAA 3I6BA 2IKSA 5EE0A 5CB0A 1G20E 1C29B 2JHCA 2WNHA 4QBFA 3TNFA 1G0NA 3HB5X 2IP1A 1HH4A 2EJUA 3EQZA 1TM2A 1Z8HA 4TTRA 4E33A 3PQ4A 4EL5A 3A2NA 3CLRD 3HB7A 2GO7A 4N1AA 2C2HA 3GRZA 3RS8A 3LYHA 2VZLA 3WQQA 1FX0B 2REQB 2UUPA 5CA0A 1NMSA 1TZ2A 2GHIA 1FVXA 2OAGA 3BMOB 4ETNA 5LMCA 1FP7A 2YYAA 2IPAB 1BHSA 1IE3A 1XLTC 4QOGA 4ASUA 2XTNA 2AZDA 3QTBA 4TS3A 1N3LA 4MVJD 3NI2A 1Y6GA 3CTPA 5DX1A 5KYWA 3UHFA 1EWRA 1W0KA 4G67A 3GJ7A 2N47A 1HNNA 3L07A 3QUAA 2XSZD 4LHSA 2BIFA 2R60A 4R3WA 2P6UA 1XVLA 3CCCA 4N5DA 3NRJA 3O4FA 4H1HA 4ZVKA 1WCYA 3I9FA 3PD1A 3AL2A 3QU9A 5CFOA 1M9NA 2B2XA 2XITA 3C6KA 4LQLA 2GAJA 4KH0A 1QOZA 1NYQA 1XZFA 2N75A 4KN8A 1ZK2A 1L5QA 2AMJA 2NO5A 3ET4A 5F73A 3T5PA 4JLNA 2GAIA 4RF5A 3BXPA 2OQRA 3IULA 3R5SA 4X63A 4CW7A 4FFVA 4GU5A 1F8GA 3AP2A 4JA0A 1CRZA 4F92B 3VPXA 2Q2QA 2J3JA 2R66A 3Q7TA 5B57C 4OGLA 3L8ZA 1RLMA 1XEWY 1XE3A 2KM1A 3JW8A 4ZAZA 4ZI2A 4WN9A 2JGRA 2FPNA 1YA4A 3BGIA 4HSEA 6Q21A 1Z2DA 2GXUA 1PYOA 3H5TA 1YFJA 1TPZA 2FSSA 3G9UA 1ZCFA 5AOBA 4AC9A 5KOHB 1VKNA 2D06A 1J9ZA 2ZWVA 1WPXA 3G2QA 3OTHA 3IDSA 1XZBA 2J85A 3PU6A 3VYTB 4XRGA 3LGSA 1GTVA 4CU5A 1EX1A 1I5OA 2MIIA 4MIKA 1J8YF 1NI5A 5JC8A 4IDHA 3GP8A 2BRUC 3ZQUA 4QGBA 3OZXA 4ABTA 4RK4A 1E9VA 3BIXA 4ACBA 3U26A 4B3HA 2ISCA 2O4UX 3W6NA 2WWYA 3IILA 2JLWA 3AHDA 2Q2NA 1HL3A 1JQJC 1TW2A 2QI9F 2ZETA 5TF4A 4EY6A 4D8WA 1CZOA 3IP7A 3AVWA 1WVGA 2GSDA 1E1DA 2OUKA 4DNOA 1V35A 2H2HA 3EZ2A 3FH0A 3KDPA 2BGRA 1O77A 1VBFA 2I7DA 3ABSB 1RLIA 4GWKA 4YJHB 3C14C 4NBLA 5BRNA 3K2IA 3BHMA 1KZ4A 1RQLA 3WNZA 1QNFA 3I09A 3IURA 2H1OA 1A1VA 3KETA 2ZRCA 4JI8B 4FDMA 2FSFA 5TV2A 3CG0A 2XGSA 3NWOA 5EP2A 5C5DA 1H2AS 5BMVA 5KINB 3THYB 2WE8A 2ODAA 2FKAA 1A2KC 1GUYA 1LWOA 3DLIA 3ZZMA 4ZVMA 1E6KA 2MMCA 1GRQA 5B36A 2RHOA 1G6OA 4FWTA 1YUMA 3LFTA 3RYHB 2OFOA 3GJ3A 5JCJA 4WADA 3VTKA 3TPFA 4DDKA 2UZ4A 4BFXA 5KEIA 1RM0A 4GOLD 2NO1A 3IIIA 2BZ1A 3IODA 4D1YA 4RVSA 4FEAA 2HJSA 1T8TA 3IVCA 4OHMA 2X5XA 2X8JA 4JASB 4BKPA 2NO0A 1UBFA 3HVUA 4O2BF 1VJGA 2DHEA 3RUPA 1TAGA 1TUBA 5FOSA 1A9TA 4QFBA 3EA0A 2GJKA 1PR0A 2WVHA 2PKRA 2VAVA 3MJCA 3AJAA 1F9AA 3KQWA 1P5JA 1X1CA 4DLUA 1Y33E 2RGAA 3QHPA 4D3SA 1JNYA 1GTRA 1JJ7A 2QN9A 4MUJA 1EBUA 2PWBA 1A7JA 3NQ41 2ZQYA 4FFBB 3HJCA 3VPHA 4OJYA 4N5HX 4G8CA 1KI4A 4KXXA 4Z9AA 3WHPA 1P3DA 2NUTA 3LVFO 2DVMA 2QX9A 4Y2VA 2AKAB 1BE0A 4FR5A 2R8PA 5KYUA 2ZJ7A 3RLFA 5BW5A 3K96A 3BIWA 2HZ7A 3OJFA 3Q8WA 1J06A 4ZMBA 3TR6A 3ZHOA 1Z5PA 3OEHD 2YS6A 1R0WA 4WNAA 4GXTA 2NO6A 1F48A 4D97A 1AD2A 1D7AA 1PJ4A 3SG0A 4TZ0A 4BVKA 2AOTB 4GZ5A 3CVOA 4C0LA 5MGBA 3AVVA 4DXHA 5HKOA 3BWXA 2BJWA 2PANA 2QN8A 3R3JA 1WBBA 2C8KA 1E9BA 1KI7A 1NQXA 1X2BA 1NF3A 2HWWA 2FN4A 1XEAA 1AK2A 3GNLA 4HB3A 4O1MA 1U5AA 4W6QA 5DBOA 1P1FA 2Q3CA 1YFKA 4L15A 1ND5A 4DDWA 1Z28A 5DCLA 3HXKA 5JIBA 4EG5A 4WLEA 1Z0ZA 1LLQA 3ANXA 5ED4A 2YJGA 2QM0A 4GM4A 1LI4A 4NPCA 3HN2A 1LF5A 3ZJTA 2JLZA 2I6SA 2JH3A 1KYZA 1X9GA 1JPJA 2UV8A 2Q99A 3FNFA 4JLSA 4OAQA 1KEEA 5LMUB 3WSVA 4QSHA 3AWIA 4GLFA 5CBPA 4PC2A 3SHWA 4LK3A 4PAMA 3DDOA 1SCUB 3LQKA 1ADBA 2JFPA 2QQ5A 3S7ZA 1QRUA 6YASA 3N3BC 1RU3A 1ISJA 4B31A 2OHOA 2CBXA 4J4BA 5E8JA 5KAMA 2WIDA 3RU3A 4IHJB 2OLEA 4RPGA 3IAS1 3PUVA 1QVAA 4PPGA 3DBHA 1N77A 4NBWA 2XCQA 4GPEA 3DMTC 2CFRA 2NU6A 4LAFA 5I9LA 2VO1A 5F4BA 3G82C 1SZDA 1CSEE 4ZVQA 4IXNA 2OCDA 1EFDN 4JCOA 1N3IA 3COZA 2VWPA 4LMBA 3U4QA 4LZAA 4OY3A 4NX2A 1VLQA 1XVAA 5HEKA 4F56A 4N5LA 5EZSA 1NAHA 3BJZA 3ESXA 1OB5A 3UJBA 4JZKA 3T4EA 4WFIA 1XMQB 2CDAA 3A6HA 1XTVA 2IUTA 1Q3HA 4Q7KA 2LCQA 1AXRA 4C4YA 4IEEA 5J1SB 1NU8A 1OBHA 4O3MA 4X9XA 1HF3A 4P4GA 3RRZA 3UAZA 1U9JA 2DU8A 5J40A 3I04A 4E4TA 5IC6A 4EHAA 1GA6A 4DAOA 4D43A 2QJOA 4JBLA 2Q21A 3S40A 1SELA 2GPBA 2QUKA 4Q01A 3A6JA 4D9EA 1N4AA 3QI2A 3PYMA 2FPIB 2C7BA 3BIOA 2Q9UA 3RAJA 4DHWA 5AOAA 4IGKA 4IICA 1JLHA 2WTNA 2ZEJA 4IF4A 5CNJA 4ZGGA 1OI3A 2NZYA 3QVGB 4G4SO 4AN4A 4YR7A 2B4RO 3BD9A 4GW3A 4RENA 2JH8A 5E4TA 4KK3A 4EDFA 1IK4A 1POWA 4TTQA 4TUYA 5BYJA 1GVHA 2ACKA 3LY7A 2KMLA 3UJ3X 4CF4A 1I13A 4NWIA 3U7GA 3HJRA 4OKNA 3QX3A 1B0PA 3D1JA 3V6MA 1JHUA 3AY7A 4ZYVA 2IEYA 5CH5A 5TGTA 2DTDA 1KXJA 1T4CA 4IINA 1CY1A 2RGBA 1XNRB 3ELBA 3RUEA 3V8EA 2NADA 1LEHA 2JRLA 2Z08A 3DMRA 1ZD5A 3CIFA 2ZULA 3R6GA 3IERA 2H4HA 4RAQA 4IDDA 4JLBA 4G1EB 3L7IA 2Q45A 3WSTA 3GJTA 3A4TA 4PAGA 1RIIA 2JGLA 4LJ9A 1T5HX 1U3CA 4MUIA 3E9EA 4C4SA 5AI9A 4D9IA 4HVAA 2CD9A 1X1EA 1NVWQ 2CE7A 2Z1MA 3I6IA 2Z57A 5LL6P 5BORA 4F5WA 2HK9A 1P1JA 1RWNA 3LRTA 1DLJA 3Q1KA 2VJCA 3CE6A 2AFIA 3O8DA 4L4ZA 4NE7A 3IR5A 2JFQA 1WMEA 3WFZA 2DKFA 2DQSA 4IJVA 3FOCA 4XCVA 5CW2A 5B7QA 1D6SA 1Z33A 2PJRA 1VL1A 1Q1QA 3MW8A 3QVOA 4JQYA 3T3HA 3V2HA 2G1JA 2WYHA 4JYCA 4X97A 2GNPA 2RG1A 3IUQA 3ETNA 2FR8A 2AUNA 1YZNA 5ALHA 5GVSA 1CB7A 3ZHQA 3KTDA 3V7UA