1ARZA

Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase in complex with NADH and the inhibitor 2,6-pyridinedicarboxylate.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1arzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1arzA01
1N7GA 1R4MA 3HWRA 4Y6PA 1DIAA 5MGBA 3V1YA 3M1LA 4WUVA 4WLNA 3MOIA 1ISGA 2G0TA 4L0QA 3PWKA 1Z45A 1MC5A 4Y9DA 1BGVA 4OH1A 4P4LA 1KY4A 5TQVA 3TZQA 3T7CA 1LNQA 4KDFA 4ND5A 3EZYA 1TEHA 4HV4A 3OECA 3MZ0A 4IM7A 4A7PA 3PQEA 5JMPA 3VKUA 5A5FA 1J0XO 4Z3DA 2Y68A 4PVCA 3PJEA 4CQLB 1L7EA 3WJAA 2W2LD 4I9NA 3UHAA 1EQ2A 3TL3A 4UUOA 4BNZA 2YDXA 1IZ9A 2X86A 1Z6ZA 2AQIA 3PHHA 5BSHA 4IDBA 3U0BA 4XQ9A 5KVCA 2AMFA 2GN8A 3H3FA 1QYCA 3RC1A 3QV1A 1GQYA 2AEFA 3HZZA 4P4GA 1UR5A 3QJ5A 3DAFA 1P1KA 2FSVA 2YQ4A 1ONPA 4KDEA 1Y9EA 3X2FA 4GGOA 4LMPA 4RDHA 3Q0EA 4BNIA 1N1EA 2IE0A 4O63O 2D5CA 2I5PO 3R3SA 4WCDA 3RC2A 4XR4A 4M49A 3FPCA 2PD4A 3NTOA 3MJVA 1SZJG 1ZXLA 3V5NA 1M75A 1SC6A 2X22A 5DBFA 3TDKA 3ROQA 3HUDA 3MWDB 3VPGA 4RCVA 3WQSB 4DIOA 3K2EA 4AJIA 4PG5A 1C3VA 1Y8QA 4AICA 1QG6A 1UDCA 1SPXA 3R6DA 4IJWA 2R00A 4XJSA 1WPQA 2VWPA 3S2FA 2EKLA 2P4QA 3OMLA 1VM6A 2I99A 3KBOA 3DTTA 4RPHA 2GERA 4UVEA 1P44A 4XKJA 1J4AA 3OQBA 2V6FA 1ISFA 4BO3A 4D46A 3OA0A 3F1LA 4R16A 1B8PA 4O6VA 3RWBA 5A9SA 1FXSA 4NU6A 1N9GB 2YQ5A 4EEXA 3GPIA 4IY1A 3SXPA 5ICSA 4R9RA 4OL9A 1LDEA 1GZ4A 2VYVA 3VZRA 2ZTVA 3JCZA 2ZJ1A 4DC1A 2ET6A 3CEAA 1N8KA 1NR7A 3QVTA 1DIRA 4NMHA 5CEFA 1DFGA 2O50A 3PHGA 3U49A 2ZB3A 3CUKA 3IS3A 3TN7A 1NPYA 4GVXA 3VPHA 1K2WA 5JMWA 1MX3A 4ZJUA 4CQMD 1IB6A 1LJ8A 3UAGA 5IDXA 2AQKA 1JN0A 3N7UA 2HRBA 3KSUA 4BMVA 1X15A 3WBFA 5KKAA 4Y8VA 3G79A 5AQ1A 3I9KA 1XQ1A 4OXYA 3PVZA 2DBRA 3I52A 5EL0A 4IS2A 2O2YA 3AOEC 4XGNA 3BMQB 1Z74A 1C0IA 2O3QA 2GRAA 1Q0LA 3E18A 4ZICA 1ADCA 5CDSA 2X0IA 3KTDA 1LQUA 4MVJF 1FDUA 4OQZA 3VHRA 1HDGO 2ZTLA 4BO8A 5JXWA 1VE9A 3UGKA 1B7GO 1DIBA 2JKVA 5ENVA 5CPBA 2GR9A 2IZZA 5JDIA 2O3TA 4CMIA 1LLCA 4MVJE 3H5NA 1MC4A 5T6BA 1I2ZA 2PTGA 3QVWA 1QR6A 2C07A 2Y67A 3VDRA 3HDHA 3KXDA 4FJ2A 4DA9A 1FDVA 5HBRA 1CJCA 3ZV4A 1LXCA 1E7QA 3TZKA 4DYVA 3D4NA 1B3BA 1NHWA 3KYDB 5G0VA 3JQGA 2HO5A 4U6QA 3PHJA 2ILTA 3IIEA 3CINA 2WM3A 1IY8A 4Z0TA 4HWKA 3Q2IA 4K9DA 1GQQA 1NQTA 1OAAA 3H9UA 2WSBA 4BKPA 3A1NA 4O59O 2A94A 2W90A 3AU9A 1XDWA 2FZWA 2YV2A 4PFJA 4GLLA 3JQFC 2OO5A 5COAA 5BNTA 5A05A 3E03A 4CM6A 4H7PA 5T64A 4FFMA 3AM4A 3ANLA 3KVOA 1O0SA 5F1KA 3ZWMA 3ZWNA 2C0CA 1ISHA 4J7UA 5FYDA 4FFRA 2NVUA 3PJFA 1QORA 2GN9A 3SLKA 5L40A 3FRJA 3LT4A 5JPIA 4FFNA 4GWGA 3QHAA 4E32A 2NU6A 1IHXA 1UDBA 3KO8A 4MDHA 4XCVA 1B16A 4GSLA 4J49A 2AE1A 3VKVA 4RZHA 4ONEA 3PRJA 4KQXA 1SEPA 3GFGA 1F06A 3GZ4A 4GBJA 2W2LA 3WGIA 1ZJZA 3NAQA 3OM9A 4M55A 3P2YA 4G5HA 2QHXA 5L4NA 1P1IA 4LVUA 3W8DA 4EUHA 2Q2WA 3AM3A 4JQCA 4CM3A 1G6KA 5ADHA 5KJFA 4LK3A 5C7OO 1RWBA 2OP1A 3E48A 3WGGA 4BNVA 2ZB8A 5KJEA 1HEUA 3G3EA 1EBUA 1Z82A 4N5LA 3DC2A 2OBNA 2VOEA 4XDYA 3ZHYA 2J3IA 5JAZA 1QYWA 4J43A 4WLUA 5IZCA 3NV9A 4BNYA 2CDCA 4ND3A 2EIHA 4ZA2A 3D7LA 5AXBA 5C37A 3A14A 1NVTA 1RJWA 1WDLA 1K6JA 3L6DA 1AGNA 1ZXBA 3LK7A 3A06A 1U3UA 3I9JA 4YEDA 1YWGO 3FHLA 3DBRA 1Y6JA 1KETA 1NQOA 2PGDA 3I9OA 2QYTA 3I9LA 2BELA 2P5YA 5T67A 2XXBA 4PIVA 2FN7A 5AOVA 5EIOA 4W9NC 4CM1A 2P9EA 4K1LA 4BOYA 3BMNA 3JQ8A 4CMEC 1KERA 2VWGA 4MKRA 1I2BA 1IE3A 3IUSA 4BGVA 3L0DA 3LU1A 4NBRA 1P45A 4JJGA 4YJHB 4QX6A 5F5LA 2B69A 1UUFA 1Y9AA 3GEGA 4B4UA 2OGUA 1WW8A 4Q3BA 1B14A 3ZHZA 4DRYA 1NQAO 3IOYA 4WK6A 3DMTC 1PZFA 5JE8A 4LN1A 1VKNA 1LSUA 1R12A 1KVUA 3JQ9C 5L7TA 3JD3A 1A5ZA 3D5QA 3JQ7A 5HS4A 3D1LA 1NR1A 4JBGA 5F3RA 2WYWA 4L73A 1PWXA 4YTEA 3ZNOA 1CRWG 4DBZA 1B0AA 1M76A 2D3TA 5JC1A 5THQA 3QWFA 1KYQA 1BVRA 1DLIA 3ZU5A 4CQMA 1PL6A 2EEZA 1PGQA 3AU8A 4N7RA 3BA1A 1NFFA 4Y98A 5H82A 3VPFA 4XYLA 1I8TA 4IJVA 1C14A 3GY0A 3PJGA 4L4XA 3NKLA 3FR8A 4JK3A 1PQPA 1ZZEA 4R9SA 5DBGA 3CH6A 3W8EA 2Y1EA 1IYZA 2O3UA 3W6ZA 1KS9A 1F0YA 1K6XA 2VYND 1GPDG 3RCBA 2Q99A 4KWHA 3O8QB 2OHXA 2D4AA 3OH8A 2AG5A 2X5OA 3FBTA 1I3KA 4OGWA 5JS6A 2JD1A 1GCOA 5L3ZA 3ZWBA 2B0JA 5HM8A 4GAEA 4XZ3A 3DWFA 3FBGA 1RYEA 4CL3A 2Z95A 3H7AA 2X23A 5TSDA 5KKCA 1ONOA 3UN1A 2YJZA 3C3XA 3DBLA 4QEDA 3E9NA 1YS4A 4XRRA 3WFJA 1ZVMA 2CDAA 5JYAA 2I6TA 1KY5A 1H93A 3NT5A 3NGLA 1BTOA 3ZNQA 3WGOA 1PEDA 1E0DA 1GV0A 5T57A 5ITWA 4IZIA 4R4JA 4R69A 1GQ2A 3EW7A 4K26A 1W6UA 1XGKA 4R1TA 4B79A 1WMBA 4E6PA 5CG2A 1WZIA 3WFIA 2RIRA 5JYEA 1JQBA 2FR8A 3VZQA 2JD2A 3RUEA 3GFBA 4GWKA 3UXYA 2ZQZA 4LCJA 3ZW8A 1E92A 4CR7A 4KQWA 4BUCA 3EHEA 4TVOA 4BS9A 2X1HA 1F17A 1PIWA 2FPIA 1AHIA 2EXXA 3JSAA 1GZ6A 5H83A 4YJFA 2Y66A 5DN9A 4BGUA 3LT1A 1V6AA 4W99A 3QVXA 3T4XA 4M87A 5TS3A 1QP8A 3KEQA 2YW9A 2BI7A 4PRLA 3VC7A 3WGQA 3PDUA 3ZV5A 1OOEA 2W4QA 4BNMA 3C1AA 1LBEA 4WPGA 3AW9A 2EP5A 4OAQA 2V65A 3WJ7A 1MFZA 1WDMA 3TNLA 1P9LA 4DIFA 4WEQA 1G0OA 1LEHA 1S7CA 5DOVA 1I5RA 3WS7A 4D3DA 3EC7A 1K3TA 1EVIA 3RVDA 5CAEA 1E6EA 4OYRA 5ICMA 4FJ0A 3RJ9A 3FWNA 3AUSA 1KEWA 1T2DA 1PL8A 3LSYA 1LSOA 4ZGWA 4FIZA 1ZK2A 2EV9A 3GA0A 3HDYA 1FF9A 4R1UA 2NTNA 5TIIA 1DB3A 3RFTA 4RPJA 3AOGA 2NQ8A 4JGBA 2V6MA 3STHA 1DRUA 3JQFA 1PJ3A 4E2XA 2EKQA 2YDYA 1PL7A 4J9VA 3A9WA 5EPOA 3C7DB 4UEKA 3BTSA 1A4IA 1UP4A 4D0SA 1X14A 1YJQA 4MVJD 1D1TA 4Y6SA 5A04A 1N1GA 2HKIA 1R6DA 5GMOA 1LX6A 4RPGA 1X7DA 1NM5A 2Y0EA 3I6IA 3RUAA 3KLMX 4NJMB 4W7IA 3HNPA 1Q7CA 5CG1A 4BO9A 1T2CA 3KB6A 4IPTA 2X9VA 2PD6A 4UVDA 2O2SA 1DSSG 4ILKA 3HJAA 3GPDG 3CZMA 5B1YA 2GZ1A 3BTUA 3HQ4O 4PLWA 4S3MA 3GUYA 1VLLA 2B4RO 2IEBA 1UP6A 2BRUA 2UYYA 4PLZA 5A1TA 4J3FA 4OXNA 3WB9A 2OP0A 1Y81A 2TMDA 3ZZNA 4EJ6A 1BDBA 1ZUD1 2IZ1A 2V6BA 4Z0HO 3NDIA 1MG0A 3ROPA 3AI2A 3WNQA 2F1KA 4W4TA 3KYCA 2RBEA 1ISIA 5B4UA 4I9UA 4ZD6A 1E3JA 3W4JA 4YAKA 3HN7A 3IKTA 3ULKA 3NX4A 1GU7A 2X9GA 3T4EA 5I9NA 1FDWA 1JTVA 1C1XB 4P22A 4IMRA 3OQ1A 1ENPA 5ILGA 2WJPA 2QIOA 1TVEA 4A73A 3TRIA 5KJCA 1BXGB 1U8FO 1MA0A 3R3JA 1E3LA 1NAIA 2DM6A 3GAZA 1TT5B 4D0RA 3JYPA 3B6ZA 3RBZA 1H0KA 4A0SA 4Q3AA 4CLOB 1E5QA 1NFQA 2P68A 1O95A 5TF4A 2I66A 4FC6A 1GPJA 3PJDA 4XEHA 4ITUA 4FC7A 3KHUA 1BRMA 1EE9A 5IXYA 3KV3O 4YRDA 5L53A 3ZN2A 2DFVA 5L51A 3FWZA 3DQPA 4XYGA 4W6ZA 2X8LA 5B12A 1HE2A 3D64A 4XIJA 4L4RA 4IJUA 3OJFA 4MVJM 2D1YA 3WICA 1WWKA 1XYGA 5IZ4A 1M6HA 1ZK4A 5JFOA 4RV9A 2O3SA 1BXKA 3RUIA 4CMEA 2P5UA 3WTBA 1ZKMA 3LYLA 3DOCA 4MIOA 3FN4A 1X0VA 4EEZA 1JKJA 3RI3A 3JQAB 4YVFA 2NTJA 5ENDA 4MIYA 3FD8A 2C54A 5LCXA 5BR7A 2VYNA 1V9LA 1W0CA 2WD7B 2DFDA 4CUJA 1GYPA 2FR1A 5G0SA 2RAFA 1NASA 4J7XA 2AHRA 4UVHA 2BGMA 3QRWA 4WGGA 4BL5A 4CMHA 1R15A 3DXFA 3DMTA 4YB8A 4FFLA 3WGZA 2BKAA 2JHFA 2HDHA 4B7CA 1HKUA 1HDYA 3GLQA 2NUAA 2Y1OA 3MJ4A 4XX0A 4GH5A 3IUPA 4K28A 3RFVA 3W4IA 3F47A 4L75A 5I8WA 1DIHA 4R54A 4WKGA 4QFDA 4J7CA 3Q11A 1GTMA 1R16A 2J3JA 3ZWYA 1MP0A 4JCOA 4Q3EA 1VSVA 1EMDA 1DC6A 4NBWA 2Q2QA 1Y5MA 1SEVA 5HTOA 3DZGA 4BGEA 4XB1A 1JWAB 2W8ZA 3N74A 4J4TA 4BMNA 3UOGA 1AXGA 2W98A 1ZW1A 2QX7A 5K6AC 1KEUA 2B5WA 2Y05A 3PP8A 4G65A 4RO0A 1YB5A 4KUEA 4ND4A 3MJTA 4H16A 5L45A 3VH2A 2XOXA 4D79A 4IJKA 3F4BA 4U0JA 3GG2A 4HFNA 4XIYA 3PTZA 1OC4A 4NBTA 3RKRA 4U5QA 1KVTA 1LI4A 1PJLA 1X13A 3FSRA 1DC5A 3QA9A 4C7JA 1U3VA 4YPOA 1ML3A 4PRKA 4I8XA 1YOVB 5JAIA 2V6GA 4UREA 1A9ZA 2C7GA 4ZQGA 3COSA 4NPCA 4BMSA 1OI7A 1XLTA 3UVEA 4IMPA 2A9FA 3TFOA 4X54A 1SOVA 2CY0A 3WDSA 3L6EA 4ZQHA 3MTGA 1E7WA 3ZWVA 4NIMA 2DBQA 3O26A 1DJQA 4ZQEA 4LRSB 4UEOA 4IS3A 4GI2A 1FDSA 3O4RA 3WQRA 1VL8A 4D41A 1U3WA 2JFGA 3GUCA 1T25A 3ITKA 4G2NA 4R1NA 1XKQA 4EUEA 1DRWA 2D2IA 4Z6KA 5LDGA 1KVQA 4IGFA 1UP7A 3DZKA 2AQHA 3KETA 1U5CA 1U8XX 1NX6A 2YZ7A 1H9BA 3RU9A 1ISJA 1YL7A 2Q3EA 3W6UA 4HKTA 1ENZA 1E1NA 3PWZA 4CMCA 4M89A 4YQYA 2C20A 2WE8A 3D3WB 4NK4A 4OOFA 3I6QA 3UH1A 5F21A 4URFA 4MVJA 1IHYA 2JCVA 2BI8A 2G76A 2PKRA 1BVUA 4YA6A 4MVJG 3TQHA 4EITA 1HDXA 4FBGA 1QSGA 4N5MA 3GT0A 2QRLA 1YL5A 1C1DA 1B26A 3D4PA 4QT0A 3PZRA 4U0KA 1EVZA 2AXQA 3E5RA 1ZFNA 5TC4A 4DIBA 4OQYA 1IOLA 1VKOA 2ZATA 1VL0A 5DULA 3JQBC 2EF1A 2X5KO 2WWRA 5CHEA 1EVYA 3RJ5A 4J6FA 4BO1A 3FR7A 4J2OA 5B4VA 3SJ7A 1QV7A 5A02A 3PYXA 4WJZA 4ALJA 5LC1A 5KIAA 1CQJA 4JP3A 2EHDA 5AXAA 2LDXA 3RIHA 4QQRA 2BFOA 4PG7A 2I9PA 1N2SA 3LDHA 3I9NA 4FR5A 1CERA 1DAOA 5BQFA 4FOOA 3BMCB 4DMMA 5TNXA 4J2HA 4ID9A 1I2CA 5JCJD 3KYDA 2VHYA 4UVIA 3IP1A 1PJTA 2NWQA 4HNGA 4JJFA 4OM8A 4Q9NA 4QUKA 3ZWOA 3H4VA 3LC7O 4AJJA 5AYVA 1PTJA 4J1TA 3S8MA 3WLFA 2DUWA 3EZLA 4QFCA 5A5EA 1R4NA 1A71A 1P77A 2I65A 1VRWA 3HN2A 2WD8A 3S1LA 3E5MA 2C2XA 1E7SA 3HB4X 3MEQA 1UZNA 3DZBA 3FTNA 1HWYA 3ABIA 1NXQA 3C8MA 1ZK1A 1E1MA 1Y8RB 3K9QO 2VRCD 1H6CA 3GGOA 4BO5A 1R4MB 1SBYA 4NJOA 4WASA 2VWHA 1CF2O 3NUGA 4IQ8A 1TT7A 1XELA 4DLBA 3EVNA 1N92A 2W2KB 3IL2A 1O94A 2BF7A 5G2OA 2I67A 4NG5A 3EGOA 2E82A 1ZEMA 1KEPA 3DBVO 1YXMA 5TGDA 1MFPA 3SBOA 4E5KA 1NQ5A 3K73O 1K0UA 2X0JA 2Q1WA 3ADPA 1KVSA 3ZHBA 4FGWA 3ICCA 1GFSA 1I32A 1QYVA 3DFZA 2O23A 3GF4A 1Q7GA 4E5MA 1YBMA 3FI9A 1XIVA 3DOOA 3DHEA 2VQ3A 1ZEJA 3C1OA 3PQFA 4DC0A 5JC8A 3H5RA 3GZNB 4IDAA 3VPXA 2EG9A 3OETA 2JD0A 3ITDA 4NFYA 3NT2A 4RF2A 4MKXA 2O48X 4WCFC 1UXHA 1NPTO 2BGLA 1O6ZA 3VZSA 3TZ6A 2IEDA 2H6EA 2Q4BA 2ZQYA 3OEWA 1UZMA 2FHSA 4BB5A 1EFKA 1MUUA 5HWSA 4RPKA 3BMOA 4D42A 4OSPA 1BG6A 4GSKA 4ZN6A 3QWBA 5B37A 1LRLA 4GX5A 4GKVA 2AA3A 1F8GA 2NV6A 2JAHA 1Y8QB 3A4VA 3M2TA 3ROKA 1JKIA 3GG9A 4YAGA 3KOUA 2PFGA 2Q46A 4RF5A 4YT4A 2TMGA 4Z0PA 3GH3A 2ZCVA 2IDZA 4BNKA 1IUKA 1XU7A 4NFSA 1KC3A 1UJMA 5A9SB 1AXEA 4E3ZA 2FPPA 4I5EA 3GEDA 4J90A 1GADO 1A4UA 1Z75A 3FNGA 3GR6A 1RPNA 3MJSA 4E30A 4FB5A 3G1TA 2VZ0A 4QSMA 2GN4A 5ITVA 2NVWA 4Q3NA 1UH5A 1JVBA 3UF0A 5K6AA 3DHNA 1V0JA 1X1TA 3H9GA 1GUZA 4HFRA 5KVSA 4TRMA 4ZRNA 4K6CA 3K96A 5TJ9A 2R2GA 4XD2A 1GUYA 4Q3CA 4XYEA 5JY6A 3CKYA 3PXXA 2OUIA 3U4IA 2VTDA 2NVBA 4TRRA 3W1VA 3AY3A 5FFFA 1A72A 1RKXA 1U7HA 4QO7A 5BT9A 2YV3A 1VJ1A 3GVPA 2QZZA 4HP8A 2H1SA 3AI1A 5LDHA 4HX5A 2BD0A 1FK8A 4O1MA 4ZQFA 1Q2XA 1JA9A 4ZHSA 2J5RA 3ZV3A 1HDRA 3BAZA 1UDAA 1WNTA 5L7WA 3F5SA 1DJNA 3GDFA 1EE2A 1MGOA 4UUPA 4INAA 1KVRA 4A26A 4P8RA 1PSDA 3GDGA 4BKRA 3ZU4A 4A03A 3BXXA 4RLHA 1E5LA 3V1TC 1IZ0A 3GMSA 1I01A 2IODA 4A2CA 3GGPA 3P19A 4B4VA 2X9NA 5TX7A 1YQGA 1KEVA 1DAPA 5F1OA 1BW9A 4PG8A 2UVDA 5C7LO 3FCOA 4CMIB 4U7WA 4J0FA 5G4KA 3GHHA 1HDOA 1HE4A 4DQXA 1YE3A 3BTOA 3OIFA 1RM5A 1E77A 1E3WB 3X2EA 3GEMA 1H6DA 2VZ9A 5ER9A 1K6IA 4K6FA 2HJSA 2NM0A 4GX0A 3HB5X 2GZ2A 1EEHA 1YQDA 4MOWA 2YV1A 3UKOA 2PH3A 1HZJA 3BYZA 5JCJA 4YQZA 1SNYA 3E8XA 4ESOA 3JQGB 3RQSA 4DLAA 1LLDA 1J49A 1DEHA 3ZWXA 1MXFA 5TT0A 1X7GA 1P33A 1VPDA 3PGXA 3QP9A 5GY7A 3RBVA 3OJOA 1VJ0A 1PS0A 5A9RA 3JQEA 3R0IA 3RUCA 3OIDA 3F4LA 1C0KA 2A4KA 4O5OA 3A28A 5L4SA 2CVQA 3JQBA 2Q1UA 4FSHA 3ZV6A 1JAYA 5FI3A 4AL4A 5IG2A 1GDHA 3JD1A 2VRCA 3AUTA 5I7VA 1NAHA 4UAGA 1W4ZA 1R0LA 1R0KA 2NVUB 4YR9A 4WEOA 1C0LA 4QECA 1M66A 3RUDA 3RKUA 4JBIA 3Q1LA 3DEYX 2DC1A 1NTOA 3OSUA 3KM0A 4QXMA 1I24A 4YAIA 2EP7A 3U5TA 5A9TA 4B4WA 3VH1A 2NQTA 3IKVA 2PZLA 1OC2A 1Y1PA 3I3OA 1ZMTA 4IDEA 3I4CA 1TXGA 1V3VA 2CMDA 2J8ZA 4YACA 4DPKA 1HLDA 4IDFA 2UV8A 4RF4A 2E49A 4MINA 1EUCA 2FZEA 3L77A 1NYTA 3JV7A 2XAAA 4RVHA 4YAJA 1H6BA 4YCAA 2POQX 2GN6A 3EK2A 3CSDA 5G0TA 3OQ6A 4M86A 4KOAA 2VHWA 1GZ3A 1EBFA 2Y1DA 3PI7A 3JYNA 1K89A 1PWZA 4CM9D 4EYEA 4L74A 1DC4A 5ILOA 1WVGA 3IC5A 4B3IA 1PU2A 3TF5A 1NHGA 3UCEA 2G17A 4P38A 3TJRA 3ANMA 1ZMOA 4B8ZA 3UW3A 4PG6A 4CR8A 4AFNA 1LC0A 4RPLA 4DQUA 1G1AA 3CPSA 3IDSA 2OBYA 4AJ4A 1NPDA 1A27A 1ORRA 2X5JO 2HJRA 1JW9B 3DBRB 3AOEA 3GRPA 1KC1A 4IIUA 3LZ6A 5L9AA 4YT2A 4CM4A 3O38A 5JO9A 2PGJA 4EDFA 3W8FA 1QYXA 3QE3A 1CETA 4Z9XA 5BNFA 4J91A 3LVFO 2Y93A 3VZPA 4LCEA 1JU9A 4NDNE 4ND1A 4W82A 4CUKA 3BMNB 1I0ZA 3JQ8B 3OBBA 4OKNA 4KUGA 4C4OA 2NU8A 3LQFA 2Y0CA 3C24A 2GD1O 4CM5A 2ZB7A 2X6TA 5I9LA 3TSCA 3DBHA 1C1XA 3Q9UA 4AJKA 2Y1FA 3KYBA 3WGHA 3KRTA 2VT3A 4MP6A 4WCFA 3DFUA 1BXGA 1IULA 1MXHA 4OOEA 3DZHA 3I5MA 4D7AA 3LC2O 4LGVA 3QLJA 3TOXA 3U9LA 4EUFA 1TT5A 1HYGA 5IN4A 2JL1A 3KSZO 2QW8A 5A3VA 4CL8A 1VL6A 1HDZA 3ZWCA 2EGGA 4N5NA 1Q0QA 3QIVA 4B7XA 4H3VA 4UUNA 1Z73A 2YYYA 1WMAA 1E1KA 3AJRA 1Y7TA 4CMJA 4CQMB 1TI7A 3WR5A 5CEJA 4E0BA 2FRDA 4I5DA 2J6IA 1DFHA 3HDQA 4AG3A 3PZBA 8LDHA 3ETDA 4BNWA 1LLQA 3F9IA 4AJ1A 2Z1MA 3LT0A 2FP4A 4ND2A 4DGSA 3HFSA 1HSOA 3WGTA 4RJTA 3OICA 1P1HA 2UUPA 5HA5A 5F1PA 3S2IA 1YQXA 5L4LA 4CMBA 4LVCA 3EMKA 3ZDFA 4MP8A 2YHIA 1ONNA 4BHTA 4HFJA 2AG8A 1WZEA 4YJGB 3B20A 3AFNA 3U62A 4IINA 3OJLA 1H2BA 1I33A 3ANNA 3K2BA 3V1UA 3SX2A 1GUFA 1RM3A 1SB9A 3D4OA 2BFAA 3DBLB 4XRGA 3HFGA 1LA2A 4BNNA 5AXCA 2GSDA 3AY6A 1ZIDA 2GDZA 4WOKA 5FEUA 2HK8A 5T8KC 2FY8A 3NTRA 2IYOA 3V8BA 4PN3A 3ROMA 3ZNNA 1AE1A 4G81A 4RF3A 3WIEA 2RHCA 3DL2A 2X4GA 1YDEA 4XB2A 1C0PA 2AEMA 3ZW9A 3C1TA 3CMMA 4HFMA 1I36A 1P31A 2O4UX 4CLEA 1UAGA 2EJVA 4QTZA 3SLGA 1X1EA 4XGKA 4E12A 4GVLA 2O7SA 1PJCA 3I4FA 2DAPA 3DHYA 5CFZA 4FS3A 4E5PA 1DOHA 1GL3A 3DR3A 4GMFA 3HHPA 3SC6A 4E2ZA 4WLFA 2GYYA 1D7OA 2PLAA 4R5MA 3GVXA 3F46A 3FNEA 1MG5A 2OL4A 1YONA 2VWQA 1YOVA 3RAJA 2B37A 3GQVA 4M1QA 4AJPA 2OXIA 3RUFA 5A4DA 3ICPA 1O89A 1YBAA 4FW8A 4CUZA 4YXFA 4AJHA 3NYWA 4W9NA 3TPCA 4IUYA 5TRTA 4CM7A 2VUTA 3UCXA 1NBOA 1EDOA 3QVOA 4R41A 5GZ3A 4LSWA 2ZYDA 4GQAA 4L9RA 1U2DA 1PJBA 3R1IA 3PFWO 1ENYA 4B4OA 1GCUA 4J9UE 5CPFA 5KVVA 1PX0A 3QQPA 2PZKA 5L95A 1B15A 1U2GA 3ETGA 5DF1A 1DHRA 3VVBA 4BO4A 1DDOA 3PDJA 1ZSVA 4FFOA 1T4DA 1A7AA 4PLCA 4CQLA 1SO8A 1PR9A 1YRLA 2HCTA 4XJTA 5A06A 1T2AA 3JYLA 2ZYAA 1PGOA 2PKQP 4CM9A 1G0NA 1KIFA 2O3JA 2Y0DA 1GYQA 3JQ9A 4R68A 4BV8A 4PLVA 2FPGA 4LSMA 3L9WA 4YT5A 3P7MA 4F45A 2YUTA 4L76A 1QXSA 3G0OA 1ID1A 4UVGA 3L07A 2CFCA 6ADHA 4A27A 5BSEA 4CLXA 4CM8B 4BNHA 3E82A 3B1FA 5C7IO 1N5DA 4ZU3A 2F00A 1A9YA 4DPLA 3V2GA 1KBZA 2QQ5A 4B3JA 1U3TA 4NU5A 4J0EA 3CE6A 3QSGA 1PQWA 4NBUA 2SCUA 3QVSA 3DZJA 3VOSA 1QYDA 5G0UA 4A5OA 1DPGA 1IPEA 1VJTA 5DZSA 2PNFA 3PWSA 1BDMA 1WP4A 3CZRA 2VHZA 1MB4A 2OFPA 3FTPA 3KYCB 1UZLA 1U4SA 5JYDA 3AUUA 3PQDA 4Q39A 1U5AA 2AEJA 4AJEA 3HSKA 4TRJA 4R3NA 3JD2A 3U4CA 1ZJYA 1E6WA 3D0OA 1OBFO 3H2ZA 4DYDA 3E9MA 4II3A 1DIGA 3CIFA 4JLWA 4PGFA 3DOJA 1YL6A 3OJ0A 4HBGA 2HAEA 5IXSA 3W4KA 2HMVA 1N9GA 3LF2A 4TQGA 1JWBB 2H9IA 2IXBA 5HRUA 2HSDA 1YVEI 1XG5A 1HF3A 1GD1O 3VH4A 4CLRB 4CR6A 2QG4A 5T73A 4RQUA 2R6JA 1T2FA 5DCUA 2D8AA 2NTVA 3S2GA 1DC3A 1P0FA 2C59A 2YHUA 3JQDA 4YWJA 4DTIA 1SOWA 2J5KA 3JD0A 2X7HA 1YJ8A 4CMAA 1PGJA 5IZCC 2HMWA 4E21A 4YYZA 3F1KA 3ZU2A 4EZBA 1CWUA 3NT4A 3BIOA 3BHJA 1V3TA 3FNHA 5G0WA 2W2KA 1HL3A 2E4AA 2HK9A 3IP3A 4WE3A 1SB8A 1O8CA 1LDMA 2BH9A 5DP1A 4R1SA 4RVDA 3BMQA 1CYDA 3K8ZA 4BVAA 1QMGA 5DT9A 1YO6A 4L8VA 2GLXA 4R01A 4E5YA 2C29D 2ZJ0A 3IAHA 3WOHA 3U3XA 4BO2A 4U8GA 5JDCC 3H3JA 3NDRA 5H81A 5EN4A 4F46A 2YFHA 4IXTA 5M6DA 2WYVA 4ALLA 3B1JA 4CODB 2D5AA 4MIEA 3VDQA 3DAPA 1RM4A 3K92A 4KP7A 4NZ9A 3AY7A 3FF4A 3GZNA 1T4BA 4RVGA 1J6UA 1L1FA 4MPDA 1XWFA 1FDTA 3H9EO 3K6JA 5DBIA 1GEGA 2GF2A 1ISMA 4EBFA 1H94A 4M54A 4DLLA 4GL4A 1PR3A 3ST7A 5DP2A 2RCYA 2YFQA 3BHIA 3OIGA 4D3FA 1GAEO 1P74A 4BO0A 4HY3A 5IN5A 3INRA 2JFHA 3ETEA 3JTMA 3QWHA 1ULUA 4Z3KA 5J9GA 1E6UA 4E13A 5T5QA 1MV8A 4D43A 4IZHA 3OP4A 3PYMA 3GN1A 2FWMX 5MDHA 3GVHA 4LW8A 2ZK7A 3ZNPA 2ZTUA 4IBOA 3MWEB 1LTHR 4J16A 3F5QA 3GNQA 2JJYA 4DXHA 1GR0A 2PD3A 2Q22A 1ZK3A 3M1AA 4I9HA 3GRKA 2CVOA 2DUUA 2VRBA 4WLEA 4NHEA 1HE5A 5FI5A 5JCXA 4CLDA 1WXDA 1OFGA 1FJHA 5U1PA 1NNUA 2B35A 1HE3A 3JQ6A 1BSVA 4OXKA 2C5EA 5T8KA 2E6UX 3H8VA 4E2WA 4CJXA 2PGLA 2PZMA 1BXZA 5K9ZA 4IGEA 4XYMA 2NLOA 1DBVO 3O9ZA 5A03A 4Y6RA 4C7KA 1ZSYA 2GCGA 3H5AA 2JCYA 4ALMA 1E7RA 2UDPA 5KTKA 4FDAA 4EGFA 3IJRA 2P9GA 4N18A 3RC9A 4B7UA 4BO7A 2G1UA 4OKIA 1OMOA 4XDZA 2QRJA 4J4BA 4PZEA 4RVUA 4E5NA 4FQ8A 4BNXA 3ADOA 4WOJA 4PLGA 3TZCA 1SCUA 2DBZA 3IQDB 4BQPA 5JNLA 1JLLA 2B36A 2PKQO 4TMFA 5DNAA 1I10A 3O03A 1PJSA 2Z1NA 3RUHA 1R0SA 3PPIA 1JKFA 2P4HX 1U9JA 2HMSA 3EY4A 1YDWA 5EQDA 3C7CB 3ZHXA 1C1DB 6LDHA 5DOZA 4J1NA 1UXGA 2Q1TA 5CP8A 4AJOA 1SMKA 2X0RA 3GOHA 3WX0A 3RD5A 4J4HA 5I7FA 3WIDA 3LF1A 2GGSA 3Q6IA 1JAXA 3UCFA 4BNTA 4XWYA 2PV7A 4BNJA 1H5QA 4E33A 1HRDA 2ZCUA 4MO2A 5U9CA 3Q9NA 3HE3A 4BQRA 1O5IA 5KJ6A 2IXAA 3DTYA 3KLPX 1A7KA 2HU2A 3NTQA 1E3WA 3JQCA 4TRNA 4XYBA 2FR0A 5HS6A 3JYOA 4TKMA 1RYDA 4BNLA 3MOGA 4TKLA 5KJ1A 1H2HA 1EVJA 2GNAA 1PZHA 5BNIA 1LDGA 1V8BA 1EUDA 2UAGA 3AWDA 3ENNA 3DMYA 2DVMA 2VHVA 3C85A 4OIMA 1HLPA 1OZAA 1T1SA 4IQGA 1PS8A 3WXBA 4B3HA 2I3AA 5KWEA 3QWAA 2NADA 3F3SA 5FWNA 2BFMA 1AUPA 4YJHA 3GC6A 3WYEA 1E7MA 2Y1GA 4AJ2A 1R4NB 1Z7BA 4OJNA 1T1RA 3UICA 3G1UA 2Y99A 1YB1A 4JROA 1T2EA 3KUXA 1XSEA 3PHLA 1PJ4A 3PEFA 3PHIA 4GX2A 3TOZA 4Z9FA 3NEPX 3PK0A 5TJHA 3ZWWA 1AHHA 4AJNA 4NBVA 1LRJA 2RHRA 1N7HA 2X58A 4LMRA 3LLSA 1HXHA 4EJ0A 3DDNA 3HG7A 4FCCA 3WWYA 1ADGA 3WTCA 1I30A 1E7YA 1YB4A 4MP3A 4CLHA 2AW5A 1JDJA 4IIVA 5EESA 2GUGA 3ENKA 4GGPA 1QV6A 2JFFA 2QZ9A 3WBBA 1F12A 2FOIA 3OEYA 4I5FA 1S6YA 4KMSA 3INGA 2PWZA 2H5LA 4IDCA 4ALIA 4WLOA 1CIVA 4ALNA 4BB6A 2PK3A 3H2SA 1D3AA 2HRZA 3JQAD 5BSGA 1E3SA 1PZGA 1GV1A 2B83A 1T26A 3PYLA 1ENOA 3O8QA 5I8ZA 3PLRA 5THKA 1EK6A 3IMFA 4HNHA 4IDGA 3JYQA 3ON5A 4FD3A 4NNJA 1KOLA 4YT8A 1VSUA 4P4NA 5A3JA 1CDOA 4ALKA 1E1LA 3ZWAA 1U7TA 1CQIA 2CF5A 5EMHA 2HMTA 1NP3A 2BHLA 2HUNA 4XR9A 2NU9A 2VNAA 3WMXA 3PIDA 3SC4A 4TZKA 4FFPA 4Q3DA 2C7VA 7MDHA 3EYWA 3JD4A 4RZIA 3SVTA 5JAQA 4OSOA 1ADFA 5GZ1A 1L7DA 4KTVE 5IFLA 2C5AA 2BFPA 4RVFA 3WLEA 3WSWA 3OA2A 4KUHA 3I23A 1PS9A 3WG9A 3ONEA 3BMOB 4LISA 1ZCJA 3ZI0A 3RC7A 1K5HA 1YGYA 3CMCO 5GZ6A 3CXRA 4EW6A 3F6YA 3H9QA 5G4LA 4JP2A 5I7EA 1DRVA 4RL6A 1DLJA 4XQGA 3AK4A 2VHXA 4DQVA 5JDCA 3GHYA 7ADHA 3T7EA 3VTZA 1UXJA 4PLHA 3WSVA 4EJMA 2WE7A 2J3HA 5EJ2A 2O4CA 3L6OO 3RU7A 2VOJA 4I08A 2IZ0A 1GY8A 3DB2A 4UULA 2QYSA 4A10A 3GGGA 3BTVA 4I5GA 2CVZA 2JHGA 4KZPA 2VT2A 2CDBA 4BIIA 2WMDA 4MVJI 5B4TA 1X0XA 2DPGA 2WDZA 2DT5A 5ER6A 3KEOA 1NWCA 4D45A 2Q2VA 2DKNA 3AI3A 3E9QA 3ZGYA 5EERA 2EW8A 1HTBA 1BMDA 1LU9A 5KNLA 4XQEA 4GLOA 1WAMA 3VH3A 1HZZA 5COBA 1PQUA 3INTA 1P1FA 3GN2A 2DPHA 4WECA 5JBIA 3PLNA 2P2SA 1HETA 3GMDA 4CV0A 3MJCA 5CDUA 4XA8A 4PCVA 5EINA 2Q49A 3DONA 3M2PA 1W8DA 2DLDA 5IF3A 2DTEA 4KWIA 3Q3CA 2RH8A 1VI2A 4JN6B 4LRTB 1IL0A 3WYBA 3UUWA 2AE2A 2CZCA 2E37A 5CDYA 1IPFA 3U4DA 3L4BC 3HDJA 1EUZA 5ES3A 4DBVO 5JW6A 1V35A 2B4QA 1UAYA 2E48A 2EERA 1V3UA 2HMUA 1ULSA 4YJGA 4BNUA 4NJMA 2VNSA 2AQ8A 3WGYA 3QWIA 3OF2A 4J1QA 3WYCA 1BW9B 4FPXA 4IDDA 5G4KB 3VVCA 2EGHA 4NR0A 1CEQA 3PGJA 2UUOA 1ZSNA 1TB4A 1ZNQO 4WNCA 4FOSA 5C3MA 4II2A 1XEAA 2JAPA 4PZDA 4GMGA 5IDWA 3LT2A 3RROA 2XPCA 1HSZA 4YAEA 4UEJA 3S55A 3L9XA 4OO3A 1LSJA 2NU7A 4R3WA 1P0CA 2GZ3A 1P1JA 2C2YA 2CSUA 3SEFA 2X0NA 4ZVVA 1XA0A 4IQ0A 1EDZA 4RVSA 2EKPA 1B2LA 3D3EA 4JJIA 4GKBA 4HADA 4YRAA 5CDTA 2PZJA 1EK5A 3FNFA 3GVCA 4CV1A 5DCYA 2H63A 1LQTA 1HYEA 1Q0HA 3WMWA 1DHTA 2RH4A 3LC1O 3VPSA 5AVOA 4HUJA 4PVDA 1P1RA 4F3YA 2BGKA 2FSSA 3GNSA 2VUSA 1Q7BA 2Q45A 2Z5LA 3L4SO 1U28A 3AM5A 3D5TA 2B4TO 3ONDA 3DZIA 2D0IA 1X7HA 3ONFA 3TZHA 1R66A 2ZIZA 3NJ8A 4CLOA 1EQUA 1AN9A 2IRWA 3JQ7B 1I3NA 4N54A 3NDJA 4NI5A 4NH4A 4B8WA 4GX1A 3EAGA 3S2EA 2HK7A 1UXKA 4ROSA 1QKIA 2V7PA 3DZFA 2O7QA 3E6AA 3AFMA 1PGNA 3GVIA 3GNTA 2GASA 4D3SA 3K5PA 4PZCA 3B1KA 2YY7A 2GO1A 9LDTA 5IAAA 4JBHA 3BZUA 3EDMA 4FJ1A 4R5HA 3WWZA 4BV9A 2HLPA 3M6IA 2CD9A 2Y1CA 4NFHA 1H6AA 2PH5A 3EVTA 1WDKA 4PLYA 3ZH2A 1XHLA 1NWHA 4MVJH 3RASA 3ORFA 3HADA 3BHMA 3JQAA 4DWVA 1XR3A 3H9JA 4YRBA 5JO0A 4YDRA 4PG4A 2I76A 2WD7A 2OORA 1E3EA 3OFSA 4FN4A 2QRKA 4HXYA 4RQTA 3ZWPA 4YBZA 1LDYA 3MCVA 1UXIA 1ZH8A 4DUPA 5CEEA 2XF8A 1XU9A 4XGIA 3VTFA 2R00C 1M67A 4JXKA 1LDBA 4UUMA 2NACA 4F6CA 3I9MA 3RBXA 4BKUA 1RM0A 9LDBA 4WLVA 5AXDA 4AVYA 1FMCA 4DREA 2C82A 3DAGA 3NJ4A 1PGPA 4CV3A 2DBVO 3GK3A 2Q50A 1EZ4A 1F8FA 1LUAA 4J1SA 4R51A 4CM8A 1D8AA 2EW2A 2WTBA 4QO8A 3TWOA 2J3KA 4ZRMA 3NGXA 5L7YA 4Y67A 5IDQA 1W73A 2VUUA 1E3IA 3KSDO 1LSSA 1D4FA 3I1JA 1M6WA 1J5PA 4RORA 3C7AA 2DU8A 2DTXA 2D59A 5I7SA 5C5IA 2DQ4A 5IDYA 3PIIA 4PLFA 4U6SA 3B70A 5TT1A 1YKFA 4CM4B 1ARZA 4F6LA 2FMUA 2HQ1A 2OOSA 3LLVA 3P2OA 4AJLA 4EI2A 3IJPA 5JLAA 5J23A 1Y5RA 4YJFB 3ASUA 2A35A 5I9MA 3NRCA 4MKZA 3ZCXA 1I3LA 1GEEA 4TVBA 3TFQA 1HDCA 2J5QA 1HYHA 2EWMA 2NNLD 1ZK0A 3G17A 4CMGA 1ADBA 3GDOA 3DBHB 1MLDA 1XCBA 5K0ZA 5F5NA 2XXJA 1R37A 3P5SA 4DMLA 4I1IA 1QLJA 4WCFB 4E4YA 2IYPA 2ZTMA 3QY9A 4S1VA 3H65A 3I83A 3E1KA 3VAZA 5IJZA 4KTTE 1SAYA 3U4HA 3UFXA 2BLLA 1NFRA 4CLRA 2VYVD 4DVJA 5JDIC 2CUKA 2G5CA 3WNVA 4TWRA 2B5VA 3FPLA 4M8SA 4L4SA 4IXWA 2ZYGA 1Z7EA 1ZO8A 5KVQA 1LC3A 4OHUA 4OMUA 2LDBA 1Q1NA 3GAFA 3OJEA 3DO5A 3WQQA 2G82A 4BGIA 3Q2KA 5DCWA 5COQA 5CDGA 1U1IA 4ZQBA 4TROA 5KCZA 1P3DA 1PJ2A 2O3RA 3D3WA 4CPDA 2VTEA 3TL2A 1QLHA 4BNGA 1T24A 4JNKA 1TA4A 2Q4EA 5KOIA 5BSFA 3K30A 1LLUA 4BKOA 1NVMB 2EJWA 1DFIA 2YHIB 2ZB4A 4RGBA 5JYFA 4JIGA 2VZ8A 2PR2A 2ZKLA 8ADHA 2WEKA 3AUAA 4NK5A 1YBVA 4Z9YA 4E31A 3U09A 5FF9A 1PJQA 1JVSA 1DXYA 2P9CA 3G49A 1VC2A 5JY1A 1QRRA 2CNBA 4YJDA 3CTMA 1ZBQA 1TLTA 4O0LA 2PY6A 5U4QA 4MJLA 3ASVA 1I3MA 1EFLA 4BKQA 1B8UA 1O9BA 2P91A 1PZEA 2I3GA 4D44A 4TSKA 2PA3A 3N58A 4H15A 4JX8A 3KZVA 3V2UA 1LDNA 1BWSA 2VCYA 4NQZA 4DL9A 5EQFA 5JAMA 4XQCA 1F14A 4FGSA 3RSHA 3V2HA 2WYUA 5TLSA 3OHSX 1M2WA 3BMCA 4RDIA 5DDIP 4DPMA 2NSDA 3QW2A 1B8VA 4CV2A 3L4BA 4WNIA 1WLYA 3K31A 4BO6A 2Q1SA 5JSFA 1LRKA 1HT0A 1BHSA 1XQ6A 1H9AA 1U4OA 2JCXA 4PLPA 4TZTA 2A92A 4GPD1 2BMAA 4W7HA 2CF6A 4CMKA 2OZPA 1GYRA 2DTDA 3MJEA 3SJUA 2OMEA 3H6KA 1B3RA 4RLSA 3EUWA 3RFXA 4E2YA 3ZU3A 1DO8A 1NVGA 1D1SA 4MVJP 1YH3A 2GPTA 2VN8A 3PFFA 3MTJA 4PLTA 4BNFA 1Y8RA
chains in the Genus database with same CATH superfamily
2V0CA 1PSZA 1MX1A 3HWRA 5C8YA 4Y6PA 3O2QB 1DIAA 1ZU5A 3OQMA 5FB3A 2VLIA 2F9LA 4MI9A 1ISGA 3FB4A 4KC0A 3C1UA 4L0QA 1ZJWA 4Z53A 1QAQA 1C3EA 3AR3A 3RE1A 4UW9A 3W8RA 1PF7E 1Y48E 2FEMA 5AFSA 5TQVA 4OV6B 2CLOB 4YJ3B 3EPHA 3EZYA 2PBLA 1TEHA 1R6AA 3B1ZA 3HL0A 2C4KA 4PZ0A 5CCDA 3VC1A 4ARUA 1T6XA 1FYFA 1U0OC 5EJMA 3OT4A 5JMPA 3USCS 5E1MA 5DTIA 4Z3DA 4OD0A 5HPYB 4MQUA 4LRWA 4PVCA 2I80A 4CQLB 1MIOA 1L7EA 3U80A 3PCXA 5GP1A 1XKTA 2IZ6A 1EQ2A 2GAOA 4OG2A 4IYJA 4QIHA 3UWOA 1I5OA 3A3YA 5DK4A 1XCGB 4F2WA 2B21A 2P41A 3BF7A 3GWZA 3DKPA 2HPZA 4P9NA 2AQIA 5JZVA 3P9IA 4XAQA 5BSHA 3U0BA 4O2BF 1RC1A 1JA0A 2RI1A 3V48A 2EYUA 1O4WA 2ACKA 2ZYVX 3OURA 2IHKA 1E2UA 1YKSA 2HYDA 4F9FA 1R0ZA 4DSTA 2W8BA 3IEUA 3ZDEA 2I8CA 1M2FA 2JIOA 1IWOA 5KYVA 3LOPA 1ONPA 3ZTWA 1GXSA 4G41A 4MJ3A 5FUWA 3X2FA 4IP0A 2EX0A 5FWAA 3AHGA 4Q93A 3EMBA 2Y3IA 1SURA 5A7HA 3ACDA 3OOSA 1QQ5A 1PK7A 1TM4E 4Q1FA 4PY2A 3C3CA 1P2FA 3EXHC 1N6OA 1ZNWA 1OLUB 4U9HS 4WN3A 1Z28A 2V8BA 2YWGA 3V7YA 3DSRA 1IATA 1Q1AA 4L4ZA 2G6TA 1Q95A 3V5NA 2H1RA 4WZAA 2BEWB 2HC9A 5DBFA 4D3YA 3ROQA 5B2ZA 3A4TA 3ONVA 2A7QA 2I4RA 3K2EA 4AJIA 4DIOA 4ENQA 3Q1KA 2WJ4A 4PNPA 4DM4A 1C3VA 3WJ2A 4V1CB 4AICA 1QG6A 4NWIA 2CB9A 3Q7IA 1MABA 2R00A 1H3EA 1B8OA 3DDCA 1WPQA 1LBTA 3K0KA 3QJYA 4EDHA 1YFLA 1TMOA 1AJEA 1VM6A 2I99A 2VHJA 2PUVA 3TH5A 1M1UA 3KAPA 2DWPA 3GEBA 1WD5A 2V6FA 4GEGA 1ISFA 1WB6A 2XTMA 1KYYA 4MCJA 4KODA 4BP3A 1XK7A 1Y5LA 3ESQA 5SV2A 1UBSB 4GKKB 4QAJA 3STUA 4EEXA 4DV1B 5EVJA 1ECGA 1VMEA 3WMRA 4IY1A 4KXNA 2ASVA 3Q7QA 1HR0B 1B8NA 2LE0A 2VYVA 4MQ5A 1RVDA 2QMEA 1KO4A 5FBWB 4WI1A 2PQ6A 3GAAA 3L7DA 3OZUA 5JD4A 4AMUA 3BF8A 2ET6A 2X3UA 1P6XA 2C84A 3L7YA 3QVVA 3WI7A 2UZ4A 3A9SA 3UTDA 4B6GA 4E5DA 1DIRA 4KI7A 1VXRA 3K9LA 4UFPA 6PFKA 2MSCB 3ND5A 5TVKA 4G5XA 1T9GR 2I2DA 3H11A 3OFVA 4GVXA 2E18A 3ZTTA 5K4HA 4O4JB 1SVMA 2NSYA 5JPDA 2C0PA 1KXZA 2GARA 2I7TA 2VDWA 4M9ZA 1GUDA 2O7VA 4IUDS 2F67A 3IQXA 4R84A 3KSUA 4YMSA 1A50B 1CJKC 1C7FA 1U2PA 3PR2B 1XQ1A 5G40A 5JSZB 3QG1A 4Z7NB 1E64A 5EL0A 4XGNA 2HQOA 2QLJA 1VL1A 1IEXA 3AOEC 4O4JF 2KLHA 2EDCA 4ZICA 1ADCA 3ILHA 1QWOA 3EUAA 3A7EA 3KTDA 1KQFA 2IK8A 2FKAA 4LDJA 3DEAA 3ANXA 1FDUA 2CL0X 4OA5A 4Q9KA 3V7FA 3WYGA 4JYCA 1UBRS 2ZTLA 3RBAA 1P75A 2HNKA 3MBOA 4YLEA 4R1PA 5EWJB 1MO4A 3H1PA 5CPBA 1A8SA 2Y71A 4PFQA 2VYFA 1R9JA 1M0SA 1X8XA 2IZZA 3HFRA 3JZMA 4DIKA 5JDIA 1O96A 5LZ5A 3AHDA 3H5NA 1BHO1 1YC2A 1MC4A 1V47A 5EQJB 3N8DA 4AURA 1KFEB 4CCSA 4WY8A 4LJLA 1OYYA 2Z5VA 4HDNA 1E1QA 4LJ9A 4UZEA 3QVWA 5C80A 1L5SA 1ODTC 2C9ZA 2C07A 1EI9A 2HIAA 2ZJ6A 2G9NA 4DIDA 1KO5A 3EP4B 4KPEC 4DYHA 5HF9A 3KXDA 4DA9A 1FDVA 4OY3A 2B92A 1VSTA 3HMKA 1PUIA 1AUVA 4Q3LA 3ZV4A 3R6GA 4QNNA 3TCNA 3TZKA 4DYVA 5HUJA 4EVQA 1KR2A 3D4NA 3S81A 3QXSA 1E59A 5DXAA 3UXMA 4MUEA 5KWSA 5D3MB 1GZHB 1W0KD 3TJMA 3IIEA 3CINA 1UODA 1D4OA 4Z0TA 2C88A 2RHLA 3FAKA 1I6KA 4K9DA 3WLQA 3QTLA 4V3BA 2EKBA 4BKPA 3CT6A 3C3MA 3GRUA 3H8WA 3A10A 5LMNB 2XWSA 3UOWA 1F2UB 1C7RA 1W2WB 1IB0A 2DT8A 5HHTA 4GRDA 1ZN8A 1KAOA 2B6NA 2ZYUX 3JQFC 2IEIA 2VPIA 5K0BA 3L84A 3N8GA 4B3CA 1QE0A 5A05A 2QS9A 3E03A 4CM6A 1LB1B 3GLGE 5C3UA 2J6CA 3LXXA 3AM4A 3E3MA 4TLMB 2IKSA 4UHBA 5FWXA 2V0GA 2C0CA 1ISHA 1R27A 4WT7A 4Y9UA 1KORA 3MELA 3TXXA 3PJFA 1BS9A 3RVRA 1FDRA 1TVKA 3IJEB 1G2IA 1G20E 2XYVA 3LP6A 3SLKA 3T7RA 3FRJA 1SBHA 4RFSB 2Q7XA 4KMMA 3GW8A 4BJ1A 1RWNA 3QHAA 4GWGA 4NU8X 1S2LA 2W42A 1IN6A 2FZCA 2R0QC 4U3JA 3LYUA 4N40A 1AZSC 3KO8A 4MDHA 5I5EA 4KBFA 3W04A 2QRZA 4J49A 3QA3E 4HAVA 4XW2A 4R3UC 1U7ZA 1TFRA 4B40A 5LZ2A 1O77A 3PRJA 4RA9B 4EQZA 5FHRA 1PLLA 2VDOB 2WQZA 3IAM6 4PF1A 3ER8A 2BJWA 4EB0A 3GZ4A 4HQKA 2W9XA 3ZCUA 4CDGA 5B58C 4W5QA 1P29A 2E0IA 5DU2A 1E9FA 4LFBB 2PZ8A 1RBZA 4C1NA 3KZNA 2IYLD 5AMXA 1AGXA 1MB9A 1MT3A 3ACCA 3MCUA 2CXSA 4G5HA 3W8DA 4EUHA 5L4NA 4P34A 4M7OA 1RHRA 2FSIA 2XE8A 5JH7A 2H1CA 3SCZA 3A25A 2CMGA 2NSLA 4JQCA 2BM8A 3WZ2A 3FRIA 4B73A 3TK1A 1J1UA 3N7TA 4IW3B 2WAXA 3NAZA 1ID8A 1BH6A 2OP1A 2ZUVA 3E48A 5E4JA 3CYFA 5AH0A 2A8YA 2JIZD 2O1XA 5KJEA 3TR0A 4BNVA 1NR5A 1JMYA 3DE0X 3HP7A 4LI0A 2HF2A 4EQ6A 3ZHYA 4MQ4A 2VOEA 1T5SA 2MMCA 5C2JB 2F55A 1O6CA 3T38A 1KAGA 1Z7GA 1FFHA 1S2MA 3FUCA 1I51A 4GM4A 2CDCA 2XECA 5C37A 1WULS 3LO5A 4BB9A 5K8TA 4NS1A 1O95C 2GQ0A 3IALA 5HDBB 4DJFC 4DV4B 3LK7A 4ENPA 2B6HA 5EPEA 1C1YA 3QU2A 3LS2A 5ARDA 3ZD9A 1TF5A 3B9RA 4Q7MB 3O3CA 1JYEA 1KWKA 1NQOA 3I9OA 4FDUA 4B82A 4MRSA 1QS0A 2GJ4A 3COVA 3I9LA 1FSZA 2MIIA 2RIPA 4BBPA 4MEBA 2L69A 4PIVA 3GDWA 2REQB 3FBWA 5EE3A 2PX5A 1OF1A 4W9NC 1ZH4A 2A88A 1W88A 4DR1B 2VJMA 4BOYA 4UEQA 1E1YA 1KERA 2Z30A 3LXRA 1PBNA 3OPYA 4LNHA 4MKRA 3AHEA 4NCKA 1I2BA 1RADA 3JU3A 4PO1A 4BJ5A 5C4MA 5D5PA 3IUSA 4ZVQA 5DGDA 3OHPA 3TLKA 3L0DA 4M1OA 3VRHA 4L8WB 4CIXA 5A4MS 3I72A 2C2WA 4QUEA 2MWMA 2XRZA 1BS1A 1P45A 1U0SY 2GBLC 3O90A 1BA3A 3TTYA 4QX6A 3ISTA 4H7HA 4F9GA 5HKBA 4B4UA 2DR3A 2JK1A 2OGUA 3EPRA 4O0MA 1B14A 3LUFA 4DRYA 1NQAO 3NVAA 3OU2A 4Q9DA 4RIIA 2RAUA 3WO0A 4Z51A 3OQNA 4WK6A 5JE8A 4YRJA 1P3Y1 4LN1A 2FWIA 1LSUA 2QB5A 3ZQKA 3THXB 2AOTB 2Y9PB 4U7JA 1A5ZA 3EXHA 3AR5A 3NWBA 1O95D 1VCHA 3BRCA 2QAGB 2ZUCA 4L73A 3I01A 1RLJA 1WRBA 2WWYA 1RRMA 1P72A 1A9XB 3KTAB 4TKUB 3IURA 1B0AA 1M76A 2P62A 1UFKA 5JC1A 2MSDB 4PEVA 4URZR 1CS0B 1KYQA 3ZU5A 1DLIA 1PL6A 3E7XA 5AW9A 1PGQA 1WXEA 3AU8A 1OFUA 4QJ4A 3UJBA 1AMUA 3U4GA 5AI8A 4XYLA 2F8TA 3IQGX 1KDYA 4J2TA 1C14A 1K8QA 3GY0A 3WSTA 2Z6QA 4MTLA 4K3VA 2XNCA 1C9MA 1FYWA 1IBCA 5DBGA 4E22A 3NWOA 2CMFA 5BSWA 5J43A 2QUAA 1J42A 2X8BA 1KOJA 2CCKA 2GJ8A 1ADYA 3DCNA 2GLUA 2BT4A 2VYND 1GPDG 3ECCA 5D01A 2Q99A 3PX7A 1P7YA 2DUMA 2OHXA 2X5OA 1ZUIA 3FBTA 3J80A 1I3KA 5JECA 1KKLA 3FH0A 2CK3D 3NETA 3ZWBA 4X97A 3FBGA 2H7CA 1DARA 2WW8A 3TAUA 1W581 5KTYA 2FUEA 2QTRA 2KW5A 3H7AA 4CL3A 2Y8EA 3IJ5A 1ONOA 2H4HA 3E9NA 3WFJA 2ZSJA 4FDVA 4RK5A 1DQNA 3FHJA 1EK1A 4I8IA 1ZJJA 1KY5A 1M9NA 1QGOA 2F64A 2EX4A 3VYUB 1V5WA 2L19A 4U7DA 3ICEA 1BTOA 3JAMA 3DT9A 4D6PA 1E0DA 1EZ1A 3C4QA 4R4JA 2Q4DA 1ULBA 1KQOA 2PKEA 1FNMA 3KLNA 4K26A 4E6PA 1BKYA 2BLNA 2YV5A 4B79A 1W0KA 1WZIA 4Y2RA 1Q44A 3QVMA 2RIRA 1HYBA 1JQBA 1ZI8A 3HPRA 2FR8A 1UBFA 2JD2A 3VZQA 5FBQB 5IAJA 3UXYA 3GEHA 3FVWA 4JJ4A 3ESAA 4LCJA 5AVKA 2A9RA 3FMPB 2G88A 2IUFA 4KBYA 5DKFA 1E92A 5FNVB 4HDSA 4EYQA 3V4FA 4KPYA 3PDWA 4NAVA 4N48A 3AG5A 1VP9A 4YALA 3ETLA 4BS9A 1RZUA 4RLQA 3OLXA 5HDQA 5LBTA 3CG4A 1DBQA 4JC0A 3EQ6A 1PAUA 2BFEB 4XM0A 4UU0A 1RC0A 1CR1A 5H83A 1FNSA 1KH2A 2Y66A 4XE5A 3PE6A 2PX8A 1MOPA 2IIQA 3D2BA 4BGUA 1E2HA 1T0PA 3LT1A 1V6AA 3ZGLA 1DEXA 2EWVA 4Z5XA 4PC3A 2VTKA 5JZBA 4YPFA 2O8FA 1NVXQ 4HXGA 4MQFA 1KZ9A 2PFSA 4JFAA 3LP8A 2JGDB 3EDQA 1RXCA 3LW8A 2VNKA 1PFKA 1IEVA 1WF6A 2E4VA 3B2EA 2YVUA 3KEMA 3PDUA 4IYRA 2W4QA 5PGMA 3AUYA 3RF6A 2B2NA 4KGXA 3UKJA 4XWOA 3C1AA 4AROA 2R86A 5JZSA 2H9YA 3ZVNA 4WPGA 2EP5A 4GXNA 1L6RA 2F3RA 2FA9A 1P9LA 3V42A 3LRPA 1FPQA 4DIFA 4X7BA 3GA5A 4ND6A 1I5RA 3T1QA 2D1RA 5TB5A 1YI1A 5J4KA 4AS1A 1NY6A 3AFGA 3H75A 3GNLA 4YJ2B 4EA7A 3FHCB 2C61A 2PJZA 4KAXA 5ICMA 3DFMA 3NFYA 2O2CA 3RJ9A 1EJ6A 3KT6A 1DUSA 3IULA 4L9SA 1PL8A 1QQ7A 3LSYA 3L4EA 1JXOA 4RHTA 4RABA 3GO4A 5TQJA 4M0MA 3HDYA 1XQWA 2BEJA 1F0NA 3DLHA 2AJTA 4A0FA 2X6RA 3OOJA 1YZHA 1LPSA 1P6QA 4XFDA 3KUCA 3STHA 1QH0A 2C5GA 3JQFA 3OJWA 4AD8A 3U3ZA 3DFIA 1PJ3A 3T4PA 4E2XA 4GXRA 2CVPA 2D06A 5EPOA 1EAYA 1OIWA 3A9WA 4LJYA 4NEGA 4UEKA 3BTSA 2ZBRA 1EE1A 2JIZA 2LXNA 4HLUA 4QBGB 2PLNA 2DOKA 2ID7A 3IQZA 3T5AA 3NMUF 2QSZA 1NV9A 3FFTA 1DAGA 3AJAA 3IAAA 5AI5A 1I7QB 2ZIEA 1N1GA 4IV8A 4M1YA 4MWZA 3U1VA 4GOOD 2L42A 4Q9AA 4L78A 1G21B 4ER3A 4RPGA 2IIVA 5JHGB 3A4LA 3I04M 4J1TC 5ALLA 4QQKA 3TEJA 2QN9A 3I6IA 4YUWA 2LPMA 1BHJA 2I2WA 1BHQ1 1H9CA 2GRUA 5CXUA 2FW0A 4ES6A 4IPTA 2A5GA 3IP7A 3U1TA 4JI6B 2BMVA 2DHQA 2QRNA 3MBKA 1KYVA 4MW9A 5EHZA 1YE5A 3DVSX 2GZ1A 5LU9A 1RHQA 1V4BA 3PU6A 2CXQA 4PLWA 1VLLA 6Q21A 1GFIA 2H4FA 2IEBA 4JVMA 3FCCA 2I2XB 4RETA 1XKLA 1RS0A 1WBBA 1K6EA 1C8VB 2QN7A 4KIFA 1STOA 2OP0A 1SBIA 4DRXB 1T9AA 2Q6KA 3ZCSA 1BDBA 2IZ1A 2CKMA 2I03A 1SIBE 1MG0A 2VTVA 4HH1A 1JHMA 2IITA 3AI2A 3DAYA 3FFWA 3L06A 3KYCA 1UJ5A 4PNHA 5CCBA 4ZD6A 2XXAB 3IXQA 3W4JA 4K6GA 4XCQA 3ULKA 3C8ZA 2AWNA 4OK6A 1FDWA 1IMJA 4LY3A 2A59A 1C1XB 2XH8A 5LZ4A 2GJAA 2L17A 2Q29A 4QU5A 4OJYA 5HM6A 4IMRA 3ER6A 3PI6A 2DSTA 1ORIA 2QIOA 3R0ZA 2YY6A 4TWBA 4F91B 4D9JA 1ZM4A 4EH1A 5SY4A 3AWIA 1P7CA 5LP6B 1A9XA 5LMUB 2EU8A 1QH9A 4LRQA 1JS1X 2QDXA 1E3LA 2IEAA 1TT5B 1QK5A 2QD1A 3JYPA 1KNXA 3OCWA 1YZ3A 5L6LB 2C3UA 1H0KA 4A0SA 5KOJA 1EBBA 3WGKA 2P68A 5GGYA 5SYMA 1O95A 2H0QA 2DRIA 2BBTA 4IIBA 2I66A 4FC6A 4RIFA 4MB6A 5IXJA 4FC7A 1ULAA 3VXKA 1BRMA 1EE9A 2JA1A 3KV3O 3EIUA 5J59A 4RWEA 2JAUA 2HLDD 3RSGA 1EFTA 1ZJ5A 2BMEA 2UZ1B 1OFIA 4PV7A 2XZDA 2Q3MA 2DFVA 2WIDA 3KQVA 4BAUA 1VZ3A 4W6ZA 1T9HA 4JYZA 2VPWA 2FW9A 4AZ3A 4GPTA 1G63A 1HE2A 3D64A 1KK0A 3L6UA 2XE7A 4IJUA 4F7DA 1ODKA 2FP4B 4DNQA 2J4DA 4DMKA 1XYGA 5EKSA 5IZ4A 2IXTA 1ZK4A 1PSWA 5JFOA 1VE5A 2H7YA 1ZAKA 1T5LA 1ZKMA 4RK7A 3LYLA 1PV1A 4V02A 4II7A 1N8SA 3RHFA 2Z1DA 4FIDA 1X0VA 4KRXA 1Z2OX 4YCMA 2G1JA 4UE3S 5JWOA 2FMKA 1IBLB 3M6XA 4R8VA 3FD8A 3T5PA 1S01A 2VYNA 1WCV1 1T2UA 1LJLA 1GN8A 1XZKA 1GGNA 3D8HA 4KFSA 2GBLA 2GO7A 5CDTA 1I13A 3E4CA 3IPRA 3G13A 4D74A 1HBJA 5IAKA 4OP1A 4WXEA 3RVOA 4E1BA 3HR4A 3GJ4A 4J7XA 4O2BA 2AHRA 2CK3A 2BGMA 2JCBA 2FWNA 5DASA 1OY1A 2FPOA 3G2LA 2C98A 4HJRA 1RWWA 3C39A 1OU4A 4YB8A 4EENA 1LBIA 4QM7A 4FFLA 1JBQA 2E87A 1SVNA 3CWZA 4A23A 3BJZA 2NUAA 2OCXA 4GH5A 4K28A 3RFVA 5KU1A 2GXUA 4L75A 5F33A 5HEKA 4CFYA 5I8WA 2JK0A 1HQCA 4J7CA 3ED1A 5BOSA 1GTMA 4BX8A 2WWHA 1MP0A 1NT4A 4NOKA 2ZYHA 2FEXA 4NBWA 1RRVA 1ZGJA 1SEVA 1ZGCA 4ZDWA 1T3LA 4XB1A 3EQZA 1QCDA 4US1R 3TQIA 2I91A 4BMNA 2B99A 3F2VA 3UOGA 3ZDAA 3BWMA 5B2FA 1ECBA 1KEUA 3NHFA 4RM3A 5HFNA 2Z3WA 5EFZA 1LWOA 3OZEA 1YB5A 3QI7A 4FNOA 2H2AA 2OZLA 4ISBA 5DHRA 2QAGC 2ZE6A 2GSWA 4H16A 4BAGA 4CIWA 2BEWA 5I6DA 2VF2A 4RC9A 3HM9A 5J63A 3F4BA 1NUQA 3NBMA 1YS9A 4HFNA 3TYXA 4QU9A 2WU3A 4WN9B 2B8EA 3FZGA 1AY0A 2P27A 3PT5A 5HQ3B 5I48A 2WU4A 3OLWA 4U5QA 1SUPA 2FDRA 1KVTA 1PJLA 3LUGA 3FSRA 5U4XA 1DC5A 5AM1A 1QB7A 5ICEA 1U3VA 5A6VA 1DBIA 4OATA 1MOSA 1GPAA 3BWBA 2ST1A 3FMVA 3EXEA 3PFNA 4I8XA 5DGTA 3UG7A 4C6TA 3CPEA 1OI3A 2IGBA 4WZBA 1A9ZA 3QXXA 5HQJA 3ZCVA 4ZWNA 3SQDA 5K3DA 3IO5A 4CKYA 3HZHA 3VU0A 4BE4A 3I6YA 2PUBA 4IMPA 2A9FA 2YYSA 3DV2A 5GOZA 3ZS9A 4FLFA 1SOVA 1K7YA 1PNQA 2CY0A 1WX1A 3MTGA 1PVDA 1I4DD 4BECA 3HKCA 3ZWVA 2DBQA 2FMIA 2ZSUA 2ZUDA 4OQFA 4U7HA 1DJQA 4ZQIA 3A3PA 4LDAA 1NVEA 3KALA 4GI2A 3UFXB 4JQOA 1HK7A 2JFGA 3MOSA 3PXDA 3R24A 3AVVA 3UMFA 4FYVA 3GUCA 1RYYA 3C6YA 3KVYA 3H0CA 1VPTA 1XKQA 3G59A 3VHXA 2G9QA 2WSSD 1GSIA 4IH4A 1XPOA 4Z6KA 2AOXA 3GGJA 3O8OB 1ZX1A 2ZITA 1UBLS 3DZKA 4C04A 2BSQA 3G9XA 4QYMA 1LBQA 3O1JC 1H9BA 1YTLA 2WMNB 2B1GA 2WSMA 2JBWA 3VKFA 4OJKA 3IPAA 1C3XA 2W6JD 4GM1A 4PAWA 4HKTA 4E15A 3N0VA 3PWZA 2NUPB 1DCKA 2NO4A 4O4JA 3DZCA 4S04A 4M89A 1U2QA 2WE8A 1M2NA 3DP7A 4NK4A 5FTLA 4X7PA 3I6QA 2CC2A 3CEPB 3REOA 1SQ0A 3HCEA 2QN2A 3BUSA 4RAOA 3ZVMA 1P1CA 1JIVA 1IHYA 1NL3A 4TYYA 1FRQA 1RMTA 3QX8A 2OC9A 4G4JA 1DRKA 2YRFA 4EITA 5JSZA 2HJGA 4LRUA 4MNTA 4JP8A 6REQB 2QRLA 2YYAA 1MF7A 1YL5A 1DKLA 3URKA 3D4PA 3KWMA 3TQHA 4MHSA 3PZRA 1XTPA 1YJAA 2BM9A 3W2EA 1Z15A 5AM5A 4MMZB 1EVZA 4ZAZA 2CL7X 3WWOA 3E5RA 3OU6A 5TC4A 2C1XA 4DIBA 2C95A 3H0EA 1WOYA 1U8CB 1XP8A 2HQSA 2ENWA 2ZATA 3DUWA 1CY8A 1JHXA 1VL0A 3JQBC 3L0ZA 1E2NA 5EFOA 3F8WA 5EWJA 4DV2B 2EF1A 2SCUB 3STVA 1KJJA 3K1TA 3KSAC 3B5IA 3RJ5A 4J6FA 4BO1A 2ZXEA 1QJCA 2HL6A 5B4VA 5DNVA 3PRYA 2QP9X 5HZMA 1Q6YA 3HRHA 1PZMA 1GRVA 2BGUA 3D31A 5KNDH 1CQJA 2JI8A 2HA4A 3MA0A 4BVGA 4ZIRB 4RJLA 3LSTA 5L3SA 1TD9A 3GLGA 1CERA 2JVIA 2XYRA 1VMIA 5ITSA 1ZD8A 4LX8A 4J2HA 3R3HA 1KYZA 1I2CA 4RE6A 4ZT6A 3JWHA 1XD8A 3W5AA 2PNJA 5D3MA 1PJTA 3REGA 4E3WA 1DCFA 2K7FA 4YO8A 2VF7A 1G20A 1SPBS 4OAPA 4XVCA 3LC7O 1E1RD 4AJJA 4BQFA 1PTJA 4J1TA 4WBNA 5KPJA 3JZAA 3U61B 1CZUA 3O4GA 2DUWA 4HEJA 3K5IA 3PUIA 1WZNA 3C5HA 3EFBA 4HRYA 3UH0A 1C81A 1D1QA 1IBSA 4GL2A 1A71A 4RBNA 3DF9A 4DRZA 4UOEA 4RNCA 4QOGA 2F8LA 2XDQB 3PVCA 3HEAA 2HLDA 2FQQA 4GOXA 2LNDA 5KC9A 1I9CA 1VA4A 3HB4X 2YIMA 4XGQA 1DEOA 3MEQA 4OHYA 3KAQA 2YIJA 2O6HA 4KIJA 2J7PD 4RAQA 4NCAA 3C8MA 3T8YA 4ECAA 4G9BA 3AL2A 3AUJB 1H6CA 4R2MA 3I45A 2IL1A 4ANFA 4NJOA 2QQFA 2R6FA 5FWYB 2OD9A 3X43A 4YUXA 2CLKB 1O8BA 3QYJA 1CF2O 4LKRA 4IQ8A 2HI0A 3DP9A 3GT4A 2VSFA 4PYLA 4F5DA 4UAVA 4QHYA 4FSDA 3QELA 2GWRA 3VOAA 2P3LA 2BF7A 1DKNA 4NG5A 2YASA 2WZCA 1MD9A 3ZK9A 3CX7A 1MJGA 3EGOA 5J9FA 1XRQA 2C42A 5L6MB 1SZDA 4TTRA 3WV4A 4FYPA 5ECDA 2HZ7A 5ETJA 2A0XA 3UJ7A 4RA9A 2MHCA 1T8TA 4UXHA 1CF4A 3AF6A 2QY6A 4D4LA 1G4AE 1BCRB 2VSOA 1EB8A 1J39A 2W37A 1GFWA 2X0JA 3ADPA 3DVAB 2E9SA 3DEZA 3FM9A 3L7AA 4LHVA 4Q82A 2J48A 4MIKA 1I72B 4W63A 4I9FA 4MLZA 1DTWB 1KDVA 1I32A 1U31A 4AU1A 4BVBA 4CKEB 4AKHA 3NV7A 5CYPA 1FTQA 2N42A 4O3MA 1ODSA 4N0QA 1XUOA 2VQ3A 2X15A 4YN3A 1BEUB 1MVLA 3L18A 3PQFA 4GUAA 2D5LA 2QM3A 5JSUA 3IHLA 3H5RA 2CEKA 3BH0A 4IDAA 4X71A 3VPXA 3OETA 1MO3A 2ZJ5A 2I29A 4DEVA 6GPBA 4ZT4A 5JVDB 3MJRA 1FNCA 2WB2A 4JS0A 4RHEA 2VH2A 1FX1A 2IOHA 2ZP1A 5I47A 4PHTA 2IEDA 2OCYC 3LBNA 3IR5A 2HEIA 1RMQA 5P8WA 1KJNA 1R0BA 5DSTA 3ENVA 4P5DA 4C30A 1N6IA 4FYJA 2VSXA 1P1BA 5HWSA 4D9EA 2Z5GA 2C1EA 1EAMA 1W5FA 2G80A 3QWBA 3OFKA 4O1HA 4NOJA 5B37A 4YRZA 4ZAXA 1U0BB 4GX5A 4Q01A 3SM3A 3KDPA 2AA3A 1ACLA 2JAHA 1CW2B 1Y8QB 3WRYC 1YR3A 2Q5CA 1JFTA 2C3OA 1OPXA 4ND8B 4PSAA 2Y77A 5CJJA 3TIFA 1JJFA 2XEDA 1JIQA 1XTJA 1I2MA 4FBMA 2BHTA 4RF5A 1IBKB 2A78A 1LPBB 1OBCA 4Z0PA 3BG5A 2ZCVA 3RRYA 3GIDA 3W3AD 2WUGA 1NRXA 4TV8B 4JEHA 1WKCA 4B2IA 4BIMA 3TUXA 2CZQA 1UJMA 4C78A 3R75A 5A9SB 1QVWA 2H00A 4UHJA 3WDMA 2J0SA 4NTZA 3IEMA 3SHFA 3GEDA 3PFGA 1GADO 1U9CA 4FXPA 5EE0A 2GXSA 4NZOA 3U81A 4K46A 3HXLA 4FB5A 5H3CA 3FHTA 2PXAA 1T9CA 2GN4A 3TI7A 2NVWA 3ME5A 5ITVA 4Q3NA 4TV8F 1UH5A 2QRUA 1JVBA 2WSSA 2VRWA 3OHMA 3SKXA 4NENA 1PR5A 3NHKA 1E6MA 3H9GA 3SX4A 5TJ9A 4GNKA 1BXRA 4ZRNA 5JATA 4Q5IA 4L6AA 1TM5E 2GMWA 3MQ4A 4QJIA 4B4DA 4U2KA 1G8HA 3CKYA 2WUDA 3I8SA 1J00A 1CNEA 2VTDA 2W6JA 2WF7A 1JSXA 1M8GA 1NJFA 3EZ2A 1RKXA 4LX0A 2BW0A 4TKUA 4Y0AA 3WL3A 1VJ1A 2NO7A 1CS0A 3GVPA 3LX6A 3ZHTA 2H1SA 4XB6B 3AI1A 3IAFA 3I9FA 5I9IA 2BD0A 5CTAA 2H4ZA 1RSZA 3VYWA 3DOUA 1IN4A 1Q6ZA 2F48A 1JH8A 3W2IA 1SOMA 1Z0UA 2IHYA 4KVGA 4P53A 4EJSC 5K03A 4LZZA 3F5SA 3G2PA 1OTYA 3GBSA 4EATA 4UUPA 2ORWA 1KVRA 2BYTA 4WACA 4A26A 1BJTA 3KP1A 1SD2A 2CHQA 1E5TA 4Q3OA 1CJUC 2H4YA 3LWZA 3BERA 4RCYA 1KZHA 3EVBA 1GVNB 3BXXA 3D0RA 2BHSA 4PZAA 5P21A 3V1TC 4EUNA 3H1FA 2HU7A 2F3TA 2IV7A 4A2CA 1H4VB 1OV6A 2V7QD 3GGPA 3P19A 4YLGA 1IK6A 1YKGA 4BEVA 4F85A 1M1ZA 2QN6A 3AETA 4FOTA 3SG0A 2HQRA 2IU0A 1KEVA 1KARA 5JJCA 3U4QB 5C7LO 2JAQA 4E1AA 2PMDA 2IE8A 1WQ3A 5K4GA 1HE4A 3UMYA 1MX9A 2C57A 2II6A 3GFTA 3OQHA 1E3WB 1E94E 1WUYA 1GHTA 1OFVA 3LX4A 3GEMA 5BR8B 4NYJR 1KQNA 3WC4A 3ADDA 4K6FA 4HAYA 4RJ2A 1SGWA 2NM0A 4GX0A 1CZNA 5J1TB 3SFVA 4HZIA 3T5GA 1A5AB 5ALHA 1N6LA 4MRPA 5CJPA 1SVWA 3UKOA 4D9IA 1QUEA 5A4FS 4ND7A 4O8ZA 4P0PB 3VR2D 1YZTA 5DYNA 3RQSA 3OM1A 3G6WA 5FUBA 1WCIB 5A5DA 3EX7C 4D9BA 5DTJA 1U2DC 3GRYA 1LLDA 4MGHA 3D59A 1M0TA 2R25B 4YCDA 1E1RA 2Z0MA 3N70A 2R1TA 4IX1A 4TYNA 1FU8A 1DEHA 1U2GC 2DPXA 3V4LA 1MXFA 1P33A 1N78A 5GY7A 5AP9A 3OMWA 5L8VA 4G8CA 3RUCA 4LHZA 4D97A 3F4LA 1OU0A 3TMYA 2Q5HA 5I9BA 3JYHA 3P4YA 3A1FA 2FG6C 4D4KA 3G85A 3G2KA 1MO5A 2IYEA 4YRMA 3JQBA 5DI9A 2Q1UA 1DS6A 3CY6A 3NS7A 4UAUA 3LWNA 3UMCA 1U3GA 5I7VA 4GGMX 4HWRA 3VSCA 2JGDA 1A8HA 3P2EA 2Y6VA 1R0LA 1R0KA 2WJHA 4AB1A 2WDPA 1SU8A 4WWHA 3LX5A 1Y6QA 3ZX5A 4Z4IA 3Q1LA 4HYEA 3QEBZ 1HNZB 4M7RA 3OSZA 2R1UA 4DMUB 3RC8A 4NCIA 1L5MA 5EXXA 4FE7A 3TLGA 1JLRA 1L7NA 4FLMA 4YX9A 2G3YA 1WU8A 3KQMA 4LYYA 4MUJA 4YAIA 2RDMA 4JXZA 2VKTA 1VLQA 2HIGA 4B4WA 4B76A 2ID8A 3E1GA 2NQTA 2PIAA 3EIHA 3ZI7A 1A4XA 5B7NA 3CKKA 1W4AA 2WYHA 1ZMTA 3U0VA 1BWQA 5F12A 4CG1A 4KQ9A 4F71A 3T7DA 1WB4A 2CMDA 4C1BA 3EC2A 2UV8A 1PQYA 3EISA 6NULA 1MORA 4MINA 1JEDA 3AY0A 3CF0A 7REQB 2EWWA 5EE1A 5AK0A 1VCNA 4JWKA 2ZAOA 5HP4A 4QGBA 3N5CA 2ZBEA 4A16A 3PI7A 3JYNA 4C0KA 5TE9A 4XSGA 4QBFA 2I4NA 5IW8A 3GLSA 3SHQA 3A7DA 3PEYA 3PGA1 2RGDA 1BE0A 4ENUA 2HF9A 5FV7A 2XVZA 4MZDA 3QBDA 2Y2UA 2WWVD 2P78A 3CZ9A 2HRDA 2HJWA 5ALFA 2G5TA 1MAAA 2FW6A 4B8ZA 4DUZB 3AIMA 5AKEA 3TLBA 2WA1A 4AFNA 1XVTA 3HU1A 3BVPA 1PBTA 1OZGA 3KJZA 4DQUA 5BR1A 3I5YA 2OBYA 2P6NA 5FCDA 1SBTA 1NPDA 4K0KB 4A92A 5CH8A 3B7WA 3FUXA 4RH0A 3QG5A 3UY4A 1J99A 1K66A 3EFOA 3JR3A 1J2TA 1KC1A 3O7WA 5L9AA 3DXZA 2VF5X 4YT2A 4N7MA 4BLTA 2PGJA 3UWKA 3BRQA 1ZN7A 1QYXA 1XNHA 1CETA 3QE3A 4Z9XA 5IBQA 3LVFO 3W8FA 5AUPB 1RWXA 4EFKA 4JUBA 1GPKA 2OZEA 2O5EA 4F3RA 3BMNB 3MD9A 3GJ5A 3SSNA 2FQ1A 3OBBA 3GT7A 3I1IA 4KUGA 4OKNA 4C05A 5B53A 4J07A 5A5VA 2CVFA 2C2OA 3C24A 4H17A 2GD1O 5I9LA 3GUUA 1UANA 4JZYA 3FCXA 3W3AA 3TSCA 2D7DA 1SOAA 1NZJA 3DM9B 2FSPA 1C1XA 1AIPA 1EWYA 1CK4A 4AJKA 5LD2B 3WGMA 5IWAB 2P1DA 2BZ0A 2ERCA 2QY9A 1T1GA 3WGHA 3OTOB 4YRPA 3UYKA 1E9AA 3ZWKA 3DFUA 1SD5A 1M5UA 1WW3A 2ZSAA 3LC2O 3I5MA 4Y7DA 4W8HA 4D7AA 1QTRA 1VCOA 2FUNB 1TT5A 2PIDA 1RT9A 5BN5A 1HYGA 4GZMA 2IPNA 4P0TA 4PYNA 1H2AS 2ZR7A 2QLMA 2J59A 2QW8A 5A3VA 1A9OA 1G5QA 4DLVA 4GMKA 1UT6A 1XZDA 3UJ8A 4G1CA 2HBQA 1Q0QA 4N5NA 5CUQA 4B7XA 2XA2A 1CVRA 2NSHA 2A6PA 4JSTA 1WMAA 3GGSA 4W8OA 1VLZA 1X77A 3GEEA 4X8OA 3T9FA 1UJCA 5JARA 5K8CA 2Q41A 1E8MA 2FSVC 3EF3A 2HJVA 2E4XA 2X1MA 5CEJA 4E0BA 4OX9B 4R2WA 2J6IA 1DFHA 4HAIA 4V0KA 3PZBA 2OKCA 4G23A 4HC4A 5EGSA 3U3DA 4BNWA 5C18A 3AX6A 4D0GA 5HMLA 2FP4A 5D6OA 2BR5A 3H1BA 4MO9A 4NCXA 2PS1A 3OICA 4UPVA 3IT0A 2UUCB 2CHUA 2UUPA 1B43A 5F1PA 3HCBA 1J8YF 4MR7B 4LGMA 3K8YA 2UZ0A 4HNTA 1H5UA 1KYWA 2FRXA 421PA 4X8HA 2QVBA 5FXMA 4U4AA 3ROFA 1UOQA 2O2IA 2MINB 4XTCS 1ONNA 3KPVA 5KNCD 4TLDA 3VI4B 1L8XA 3BN3A 2XTAA 2V7QA 3AYZB 3AF3A 2YWBA 4HFJA 4R2LA 4WVLA 5FL3A 3STYA 4YJGB 2Q4RA 2C4NA 3OZSA 4GU5A 4MR8B 3VU9B 1UKEA 2FWRA 4IINA 4OLAA 4BC1A 3K2BA 4NECA 3RIYA 4CEJB 5AI0A 4QZVA 2QU7A 1M2VB 2EDAA 2C3YA 2VP3A 5D2CA 3D4OA 1XWWA 2BFAA 1IZYA 2B4YA 1LA2A 3O91A 1WXXA 3CUTA 3G7NA 2GSDA 5BWLA 3K9HA 2BFCB 2X4IA 2WQ6A 1Z47A 2JH8A 2J6HA 4G0XA 4I4NA 1MB3A 1L5QA 5E9QA 2GDZA 4WK4B 3SR3A 5T8KC 3ADKA 4GRAA 3SEZA 5G3YA 4EHKA 4M9QA 3VR2A 1EP1B 4A2WA 4EW2A 4PN3A 3ROMA 3PIRA 4CKZA 2XCUA 1YHNA 4EJSA 1AKTA 3WIEA 1IVSA 5E95A 4WOBA 2VNJA 3UXEA 4MUYA 3FNQA 2XKKA 4GZ6A 3KQHA 4XB2A 4GQBA 3C1TA 1D8TA 3ANSA 3GPCA 5DWQA 5EIWA 5BQ5A 1QGED 2XB6A 2O4UX 2N0SA 4QTZA 5DMXA 3SLGA 1X1EA 2GD6A 2XUZA 1NN0A 5WRFA 2R5FA 4UE6A 3TSOA 3I4FA 4N3BA 2OXFA 5ES4B 4FS3A 4WN9A 2C8VA 3DR3A 1LBSA 2HU5A 2O1SA 1Y3HA 1EFUA 4GMFA 4KL8S 4AWXA 3OC6A 2PL3A 4E2ZA 1OJ7A 3ZJUA 2GYYA 3IMEA 4QJBA 1A7JA 1TM1E 1EGAA 1RPJA 2X42A 3AZPA 1IXSB 4KLNA 4O5AA 3RT1A 3FNEA 1MG5A 1QDEA 4KQCA 1G8AA 3R77A 4F8YA 3G9QA 3TO5A 1KBQA 1Y1LA 2ILVA 4OXQA 4MS3A 2B37A 5K0GA 2CHFA 1HV8A 1S4QA 2QJFA 5EMNA 3IAM1 4IO1A 1ZIPA 2G63A 4RU1A 3ICPA 3UJNA 1B23P 2JFWA 1O89A 5CIQA 1FTNA 1MX5A 3KR2A 5HIJA 2PVPA 2WPNA 2X7JA 1EVKA 3DMRA 1AQJA 4IUYA 4PONA 2VUTA 3UCXA 1NBOA 2ZSIA 3KXLA 4L15A 2ESRA 1U2DA 2ATEA 4IWXA 3PFWO 4KW7A 4JUDX 3O8OA 3U19A 5EEGA 5IJ0A 5L95A 2FUG6 3LPLA 1CJSA 1U2GA 1DHRA 1VMKA 4LYFA 1FU4A 1ZSVA 1T4DA 4YONB 5JSYA 4Q02A 3UJ3X 3ZE2B 4Q1EA 4PLCA 3DV0B 3YASA 4JAVC 3CCFA 3W9UA 2HCTA 3E5NA 3K20A 3RYFB 5FO0A 2NUPA 1NNSA 4EAAA 1EFDN 4CQNA 3H84A 2O3JA 2Y0DA 2YJTD 4RMGA 1GYQA 1D1PA 1EIWA 1T9BA 5SY6A 1GL9B 2WKRA