1ARZA

Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
270
structure length
270
Chain Sequence
ANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase in complex with NADH and the inhibitor 2,6-pyridinedicarboxylate.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
total genus 69
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1arzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1arzA01
3JQ7B 3DZJA 2HU2A 1LUAA 1HT0A 3DEYX 4RVSA 2PD4A 3U09A 3CMCO 2CFCA 2ZB4A 5U4QA 3BTOA 4PZEA 5JAZA 3R3JA 1U4SA 3WWYA 3GHYA 4WPGA 3GNSA 3RFVA 2NM0A 2X5OA 4BNFA 1SC6A 4YAJA 1R4NA 2I3GA 4F46A 1DB3A 5G4KB 4ND2A 2O3SA 1E77A 2XF8A 1GU7A 1HYHA 4MVJA 3K8ZA 2NU7A 3ZI0A 3W8EA 1DC4A 1ZK2A 3RUAA 3RUCA 3TN7A 3DBVO 4N54A 3OSUA 2AHRA 3DZIA 4JBHA 1NVMB 5B1YA 5B4VA 3AFNA 4CMIA 2B4RO 4II3A 1QYCA 1KC1A 3RFXA 4ZQEA 5KNLA 4IDFA 3H5RA 4AJJA 4OH1A 5L40A 3WGGA 2Q2VA 4IMPA 2HCTA 4YJFA 1MLDA 5IXSA 1DC3A 2VUSA 3WYBA 1B0AA 4IY1A 2ZTMA 1OAAA 1PZFA 1JU9A 4R68A 1E1KA 2DBZA 2WTBA 3EW7A 4HBGA 1F12A 5AXCA 1PJ2A 2PR2A 4YA6A 3UFXA 1E7SA 3ZWBA 2NVWA 3JD0A 1WAMA 4INAA 1V6AA 1W0CA 1J5PA 2GSDA 1DEHA 4RCVA 5DCWA 4U8GA 1A7KA 3JQFC 1C1DB 2BFPA 2Y0DA 1V35A 4HX5A 3W8FA 3AOGA 5A9SA 2Q4BA 3O8QA 5GZ6A 5T73A 3JQ8B 1Q7CA 4XKJA 3LQFA 3ROKA 2AMFA 2EXXA 3RKUA 4JJFA 4I5EA 4GVLA 5I8WA 1OZAA 4FD3A 2UV8A 2SCUA 3UKOA 3ZHZA 3D0OA 4J43A 2OP0A 3A1NA 3IQDB 5F1OA 3L9WA 1SBYA 1LXCA 4HFMA 1CERA 4FBGA 9LDTA 4BGEA 2O23A 2EIHA 3F5QA 3PJGA 4CMHA 4ESOA 1AE1A 3E1KA 4FJ1A 4IMRA 3ADPA 4XB1A 1I24A 4CLEA 1WZEA 4BO7A 2GYYA 2OL4A 2AQIA 4FCCA 4O0LA 2QHXA 3M2PA 4E33A 1XSEA 1KETA 3COSA 3DZKA 2AEMA 1T1SA 3E82A 4W9NC 5JCJA 3DHYA 4Z6KA 7MDHA 4CR7A 3GFBA 1TEHA 5JS6A 3ZNPA 2VZ0A 1Y5MA 4QXMA 4EITA 2O50A 5KIAA 4EUHA 2J5KA 5CAEA 5L4LA 1XQ6A 4BNMA 2V7PA 1YQGA 1QORA 1T2FA 4B8WA 1I3NA 3LLVA 2HRZA 4A03A 5DBFA 2X8LA 3DAGA 3Q2IA 4I9HA 3UHAA 3GRPA 5TSDA 1E3WA 1PL8A 1HDYA 1XGKA 1Z73A 2DTXA 2H5LA 4JP2A 4Q3CA 3S2FA 1NASA 3Q9UA 1O95A 3TNLA 3W4KA 2YY7A 4E0BA 1DRWA 4A26A 1HYEA 1BVUA 2CSUA 4RPGA 1ISJA 1QRRA 3K31A 3G79A 1DIBA 3UF0A 4O5OA 3U4DA 3DHNA 4Y8VA 4CMEC 3A4VA 3BXXA 3EVTA 1P31A 2BFAA 2PNFA 4AICA 3RC9A 3WGYA 1JAXA 1VJTA 3LC7O 1UAYA 4NFYA 2DUUA 1B3BA 4K6FA 3WQRA 1PGJA 3ICCA 1IL0A 4PVDA 3C1OA 4M8SA 4PLPA 1E6UA 1X7HA 3RUHA 4CM4A 5B12A 1NYTA 1TXGA 1HSOA 3VH4A 4PZCA 3PYLA 4R51A 1VC2A 3KTDA 2QZZA 1T2DA 1EFKA 1EUDA 3ENNA 2ZATA 1ZJYA 1YL6A 3DAFA 1J49A 3ANMA 4NQZA 1ZK3A 1MC5A 4Y6PA 2OXIA 5IDQA 5DULA 1O9BA 2I3AA 4WNCA 1B14A 4OXYA 4FDAA 2FSVA 1E3EA 2X7HA 2EJWA 1NFRA 3ZWCA 4IJWA 1TI7A 3ABIA 1IYZA 2RHRA 5KTKA 1OC2A 1BRMA 3NDIA 4OL9A 1YQXA 5KKAA 2HMSA 3WNVA 1WP4A 3Q11A 1BG6A 1PJ4A 4YBZA 4CM4B 3FBGA 1IUKA 4NHEA 1VM6A 5L7WA 1NR1A 1R4MB 2Q50A 4CLOB 4OAQA 3A14A 1GQYA 1FDWA 1UXHA 4BIIA 4BKRA 3FPLA 3JYNA 4JJIA 1B3RA 4NK5A 4B7CA 4ZGWA 3CTMA 3P2OA 1IZ0A 4AJIA 1WDMA 1YOVB 1EQ2A 2OOSA 2CF5A 1P33A 2RCYA 3C24A 3D5QA 3MJSA 4F6LA 1V3UA 1GADO 1Q7GA 1HRDA 2J3HA 3L6OO 5EQDA 1CETA 1UR5A 3A28A 3VH1A 3WR5A 4BV8A 4F6CA 3JQBC 3KOUA 1D3AA 1W4ZA 3V1TC 4ND4A 4NBTA 2NQTA 4EI2A 3ZV5A 1GAEO 2OBNA 2PD6A 1LRLA 2C59A 1T2EA 3NDRA 3CZRA 3IAHA 3VPSA 4AJHA 1Y8RB 2DM6A 5JYAA 4YJHA 1ISMA 5I7EA 2DPHA 5BNTA 5ER6A 1PEDA 2J3KA 5IXYA 4OOEA 5K0ZA 3RAJA 4JJGA 3VPFA 2NVBA 4I5GA 5BSEA 3RC1A 1VSUA 1O6ZA 1I0ZA 2GO1A 1EE2A 2JJYA 3WSWA 3OM9A 5F3RA 1XG5A 4NIMA 4LN1A 3GF4A 4BOYA 1YH3A 1DIGA 3MJEA 4KQXA 3GR6A 1PQPA 3AUUA 4GVXA 4I5DA 4KMSA 4L9RA 1Q7BA 4FFLA 2HJSA 4XB2A 3DHEA 2LDBA 1UUFA 5DBIA 3F1LA 2Y66A 4CM3A 2A94A 4K28A 4UUNA 5KWEA 2C29D 3OJOA 4GX5A 2WWRA 4XDYA 3WNQA 3I83A 1PWZA 4WNIA 4Q3BA 4DWVA 3W8DA 2H63A 3PFWO 2XOXA 3HB4X 3JQEA 3KRTA 3D3EA 4NDNE 3X2FA 2FZEA 3I3OA 2EGHA 4MVJG 2DFVA 3A9WA 2IEDA 4UREA 1ONPA 2AEFA 4FC6A 2O7QA 3I6IA 4PLVA 1I32A 3ZV4A 3V8BA 1DO8A 3ZHXA 5C7OO 3O38A 5JMWA 3IC5A 2E4AA 1AN9A 3DB2A 3GC6A 3DAPA 3Q3CA 3AW9A 5G0VA 5IF3A 2OP1A 3GAZA 3DQPA 3VZQA 3ZWVA 4XJSA 5I8ZA 1E3LA 1YDEA 4PLGA 3LC1O 3DDNA 5JDIC 1GFSA 4YT2A 1DJNA 3TDKA 3NT2A 3K30A 4GBJA 5F1PA 3VZPA 4FN4A 2FRDA 3U62A 3U5TA 3L4BC 5THKA 2GLXA 4I8XA 5JY6A 4P38A 4PLHA 1XR3A 4YJDA 2Q1WA 3DBRB 3OH8A 1TB4A 4HFJA 4C7JA 1LLQA 1E3IA 5TNXA 1VLLA 3RIHA 1T2CA 2Y0CA 4BNUA 3VKVA 5HRUA 2FPPA 4IQGA 4XGKA 2Q1UA 4J1QA 1I2BA 2H9IA 4JCOA 3OBBA 2YV3A 4LSWA 4I1IA 3WGQA 1T24A 1GDHA 4DQXA 2EP7A 5EMHA 3S2GA 3GOHA 5C37A 2HO5A 4BO6A 5KJ6A 1E1LA 4QSMA 4GH5A 1FF9A 4AJ1A 1EBUA 1NPTO 4O6VA 1GZ3A 5JNLA 5A9RA 1GCUA 1ZK4A 3RU9A 3NT4A 2GN4A 4U0KA 3MJ4A 3ZW8A 2VUTA 4PGFA 2VRCD 1E1NA 4J9UE 1ISIA 1P45A 4GI2A 1DHRA 2J3JA 1R66A 3WB9A 4Y67A 3I52A 4CR8A 4XRGA 1ADFA 4R41A 3NJ8A 4JGBA 2HMUA 1C1XA 3F3SA 3QLJA 1U7TA 3JQ8A 3RWBA 4M87A 4RGBA 1UZNA 2VOJA 4X54A 3GG9A 3GDFA 3JCZA 2VHVA 1GEGA 2B5WA 2IZ0A 1P74A 1PR9A 2J5QA 3LF1A 4IDEA 1KY4A 1IPEA 2IE0A 3FR7A 3F46A 4HV4A 1N8KA 4DRYA 2PTGA 4XQEA 5CDGA 3PP8A 2WYUA 1PU2A 4J4HA 4Q3AA 1TA4A 1YB5A 3RSHA 5JYFA 4BV9A 4G5HA 3KEQA 1HYGA 4IJVA 3H9UA 3DZFA 1CF2O 1BSVA 7ADHA 5JDCC 1ZK1A 4FGWA 3NX4A 3G17A 2Q22A 1HZJA 1K6JA 3H65A 1QP8A 1A71A 1YBVA 3W1VA 2CVQA 5A04A 3PEFA 4UAGA 5L51A 1BWSA 2BMAA 3IKVA 2C5AA 5A5FA 4BNGA 2V65A 4FGSA 4KUHA 3AY3A 5JMPA 5IAAA 4NBUA 4IINA 4JN6B 3KSZO 4GQAA 2WD7B 3AUSA 1GYRA 3GZNB 3NEPX 3G1TA 4PLCA 1F8GA 4B8ZA 4ONEA 2QRLA 1JQBA 1SNYA 3GEGA 3FBTA 3WG9A 1WNTA 1M67A 3B70A 4QECA 3PJEA 3UH1A 2G5CA 1TT5A 5I9MA 3ZGYA 4Z0TA 1O0SA 3RASA 1DBVO 1B8VA 2JCYA 4AJ2A 1YS4A 2XAAA 3T7EA 3WBFA 1PL6A 3GK3A 2H6EA 5H82A 4D0SA 4MO2A 1R15A 3S2EA 2WD7A 4R1NA 1NFQA 4CUZA 3LYLA 4KQWA 1UXGA 1FXSA 3NV9A 3OJ0A 1XHLA 2ET6A 5GZ3A 1K5HA 1U28A 2PZMA 4L73A 4CM5A 4MVJH 2CDAA 4M1QA 4BKUA 1U7HA 1HDGO 1PL7A 3L4BA 3RKRA 3QVOA 2GRAA 2Y93A 3E18A 3MOIA 4DIOA 2PKQO 1G6KA 3VPGA 1WMBA 3GA0A 4EYEA 1DAOA 1H93A 4R3NA 1QYVA 3WTBA 5IJZA 2NQ8A 2ZIZA 5TQVA 5LDGA 1PTJA 2GERA 4XJTA 1YL7A 3QVXA 1RM4A 1KVQA 3ZHYA 4TWRA 4EEXA 3CEAA 2P5UA 4FQ8A 1HWYA 4KTTE 5K9ZA 2DTDA 1NM5A 2FR8A 2R6JA 2GR9A 1ZXLA 4PLZA 4R54A 1NR7A 4B79A 1NHGA 3I9JA 2ZB7A 4PG4A 2BFOA 4MIOA 5B4UA 3ANNA 5AXAA 1KVRA 1A27A 1E5QA 1R12A 1PS8A 3GGPA 4CM9D 4R5MA 1DOHA 4R3WA 9LDBA 3AM4A 1P44A 2P68A 2X9GA 3JSAA 1SOVA 1H9BA 2Y1GA 1U9JA 4XQ9A 4B4VA 4D45A 3RQSA 2NVUA 3FN4A 1YE3A 3QJ5A 3QIVA 2V6MA 1B8PA 4DA9A 1H9AA 1I2CA 3H6KA 4E2ZA 4CV2A 1CRWG 2OGUA 3ZNOA 3JYPA 1K6IA 5HTOA 1X0VA 1E7MA 3GGGA 4LSMA 5DCUA 3VOSA 4IDBA 4P4GA 3IUSA 2O3QA 1DRVA 1EK5A 1DXYA 4IBOA 4M89A 1GV1A 4WLOA 2VNAA 3QWFA 1TT7A 5CPFA 3IUPA 3OQBA 3EHEA 4A73A 4GWGA 5KCZA 3TF5A 2W4QA 1ZUD1 4CQMA 4CQLA 3G1UA 4DUPA 2VHZA 2RIRA 3S2IA 3PIIA 1NPYA 2CF6A 2RHCA 2VYND 2JL1A 1XQ1A 3C85A 4DLBA 4KUEA 3CINA 3TZHA 1AGNA 4R5HA 5CEFA 3MJVA 4G2NA 3HG7A 2FP4A 4U6QA 2DQ4A 4XDZA 4ALKA 4W82A 1ULUA 1V8BA 1ZSYA 2JKVA 2B37A 1GEEA 1QG6A 2AE1A 1R4NB 3EK2A 2JD0A 1N5DA 5KJFA 4YDRA 3C7AA 4TRRA 5IG2A 1XA0A 2PLAA 2WD8A 3VDRA 1O8CA 3RFTA 3IJPA 2OZPA 2CDBA 2FR1A 2VUUA 5EERA 4XGNA 4OHUA 4RF3A 2ZCVA 5JO9A 4NZ9A 1WLYA 1CQIA 5CG1A 4D43A 3WDSA 5TX7A 3EGOA 3H9EO 4J1TA 1NWHA 4YQZA 4MVJE 3K96A 4QO8A 3BMQB 2OHXA 1SB8A 3LZ6A 2NTJA 3MOGA 2F00A 1FDSA 5I9LA 3DFZA 1PZEA 5EN4A 1MC4A 1E3WB 4IJUA 1VRWA 1YJ8A 4CMAA 3HN7A 5A02A 4UVEA 1B16A 3JQGB 3NKLA 4RL6A 1YJQA 2B35A 3G49A 4J2HA 2IEBA 4TRJA 3KBOA 5MGBA 1CDOA 1I8TA 1NTOA 4TSKA 4IUYA 4K9DA 1CJCA 3PXXA 3DMTC 1YB1A 4XR9A 1PGNA 1I3LA 4MINA 1ZNQO 2ZK7A 3GH3A 4Z9YA 4FW8A 1PJLA 1EUZA 4EJMA 1AXEA 4QO7A 4TRMA 2Y1FA 1ENYA 3EVNA 4UVDA 2PA3A 4BNIA 2QW8A 4HY3A 1RPNA 4WLNA 3ZWAA 1D8AA 2BD0A 1RYEA 3E9MA 2CUKA 4FS3A 5FFFA 4CJXA 5A4DA 5ER9A 2RAFA 3I6QA 2D2IA 4BMSA 4BB6A 1E7WA 3HDQA 3ZU4A 4TRNA 1TLTA 2OUIA 1A9ZA 1P0FA 2A4KA 5JBIA 2X22A 4OM8A 3H9QA 4BQPA 3BMOB 1D7OA 3BMNA 3WFIA 1RWBA 1UZLA 4YAGA 3ROMA 3ETGA 3M2TA 4R1TA 4CL8A 2ZB3A 3BIOA 2UVDA 2O7SA 3SLGA 1ONNA 1GD1O 4HP8A 1XCBA 1ISHA 3VPHA 1Q2XA 4E30A 1GYPA 3DR3A 2Y67A 3JQAB 4QUKA 1Y1PA 4J1SA 1V3TA 4MOWA 5COBA 3F5SA 1JWAB 3NUGA 4XQGA 5L9AA 1UDAA 1YDWA 1BXGA 4I08A 3U0BA 3TFQA 4IPTA 3U9LA 3OJEA 3RJ5A 3LSYA 1MFZA 4A7PA 2FOIA 3OA2A 1D1TA 5KVSA 2PH3A 3IL2A 1O89A 4E21A 4AG3A 1X14A 3UXYA 5EINA 5CEEA 1A5ZA 4DIFA 2AQKA 4IQ0A 5U9CA 4ZVVA 1HKUA 1W6UA 1ZZEA 4K6CA 1JWBB 3UUWA 4TMFA 5F5LA 2Q1TA 2JFGA 1RYDA 4MDHA 2Y05A 5G0WA 4EW6A 1PJQA 4FFRA 1IHXA 2EKLA 4BNVA 5B37A 5TJ9A 4Y6SA 1UH5A 5DT9A 2PGLA 4ILKA 5AYVA 2AW5A 3D7LA 1GV0A 3KO8A 3NGLA 1V3VA 3CPSA 2JCVA 5DNAA 4BUCA 3UW3A 1B2LA 4R01A 3AI2A 4RPJA 4FFNA 3UAGA 3PFFA 1X0XA 2QX7A 1SZJG 3EZLA 3GPDG 4TKMA 1R37A 2FHSA 4DYVA 3BMCA 2IZZA 4K26A 1EVJA 2UUOA 1MGOA 2D5CA 4RVGA 2NWQA 5JAQA 1PJTA 3HB5X 5BSGA 3DWFA 4GKVA 1JKIA 4LVUA 4AJ4A 1MP0A 4LRTB 2Y1OA 2YV2A 3AOEA 3DONA 2WMDA 1C0LA 4B3IA 4U0JA 3F47A 3Q2KA 1K0UA 4W9NA 2HK7A 1HE4A 4AVYA 5C5IA 3DZGA 3GAFA 3GDGA 3LVFO 3FNGA 4WUVA 1NFFA 4YAIA 1F17A 2OORA 4JBIA 4WCDA 2VN8A 4B7UA 4OQZA 1A72A 3NYWA 4Q3NA 3PHGA 4P22A 3GVPA 1U3VA 3H5NA 4UULA 2YHIA 4L76A 3S8MA 3JV7A 2X0RA 3HSKA 2BGKA 4BMNA 1DIRA 2AG8A 4L0QA 4JX8A 3WOHA 3K6JA 5F1KA 3JQ7A 1QV6A 2YQ4A 3HDYA 1I36A 4R1UA 1Y8RA 1E7YA 5A06A 3GG2A 4B4UA 2O4UX 2VTDA 1P1KA 1N9GB 1N92A 3MTGA 4QTZA 4TVOA 2BFMA 1XLTA 4RJTA 1ZIDA 3PHIA 4DL9A 4CLDA 4WLUA 3UCFA 2B5VA 1T4DA 4CMEA 5KJ1A 2JD1A 3PGXA 3TSCA 4CM1A 4PLYA 4DQUA 1DFHA 4D3DA 4J3FA 2PH5A 4OKNA 4AFNA 4PG7A 3OIFA 2X9NA 3PYMA 1YKFA 4WEOA 3O9ZA 1N7HA 3F9IA 3I9MA 2NACA 2JFFA 4YB8A 2DKNA 1Z7EA 3OMLA 1PX0A 1EEHA 3ROPA 2Z5LA 3GMSA 4EUEA 4ZRMA 1SPXA 4N5MA 4CMKA 4Z3KA 3NJ4A 2EERA 4XR4A 3DBLA 3AUTA 2JFHA 1M2WA 3QVSA 1GUZA 4NMHA 4BVAA 3MWEB 1T25A 4BNHA 3LLSA 3PHLA 4KP7A 1KYQA 5HS6A 1JTVA 4QX6A 3PLRA 3H3JA 4ALIA 1ADBA 4N7RA 3KHUA 2J6IA 1R0KA 4DLLA 2DAPA 1T1RA 1R0LA 3D4OA 3AU8A 4J0FA 4CV1A 4L75A 3WGOA 5CDTA 2EF1A 1VL8A 1F06A 1NXQA 5TT1A 3SJ7A 4WLVA 4RQUA 1QYWA 4M49A 3KM0A 4Y9DA 1BW9A 3GN2A 3LF2A 2NU9A 3AM3A 3H9GA 1MXHA 3I9LA 3QVWA 3AM5A 1HLPA 3ANLA 4RPKA 4RV9A 3QP9A 1U5CA 4AJKA 3GNTA 4IS2A 3SXPA 4U6SA 2Y1CA 3I4CA 1SEPA 4XYBA 4Q39A 1LNQA 1XELA 2VCYA 3FWZA 4C7KA 4HNHA 1BXZA 1UDBA 2OO5A 2V6GA 2VRBA 4A5OA 5BSHA 5GMOA 2O4CA 5BT9A 5KOIA 1VJ1A 1Z45A 2WJPA 1QKIA 4LW8A 3NTRA 4JQCA 1Y6JA 5ILOA 4GSLA 2OBYA 1SEVA 1S7CA 1OC4A 3C8MA 2QZ9A 4HUJA 5ES3A 2W8ZA 1UJMA 3GNQA 3TL3A 4WCFB 4JROA 3L0DA 3G0OA 4GX1A 3AI1A 2ZTUA 3JD3A 4ND5A 3V5NA 4N5LA 3GDOA 1MUUA 3DO5A 2WE8A 3ASVA 1M66A 1LDGA 4R9SA 4W7HA 3IP1A 4YVFA 4YT8A 1X15A 2EWMA 2GF2A 4Q3DA 4WLFA 4DREA 1EZ4A 4E32A 1K2WA 3RD5A 1YBMA 4B3HA 2R00C 4YRDA 4A0SA 4D3FA 1LEHA 4GKBA 5IZCC 5ICMA 3PJFA 3IOYA 2ZB8A 4B4OA 3TZQA 3FRJA 1J4AA 1NNUA 2QRJA 5LDHA 1C0PA 3ONEA 3VC7A 2PKQP 3BYZA 5L53A 3RCBA 1DJQA 5I7FA 2IYPA 1X1TA 1JA9A 2I5PO 3V1YA 2C7VA 4BO5A 3AUAA 1BXKA 4Q3EA 4G65A 4RQTA 2QRKA 4KUGA 4ZU3A 4OGWA 3RC2A 3JQFA 2DUWA 5JYEA 4NU5A 4XCVA 4TVBA 3HDJA 2R00A 1E7RA 3EC7A 4LGVA 1WVGA 2DPGA 2HMWA 1AUPA 3FR8A 4ZN6A 3G3EA 4DTIA 1JDJA 1N9GA 3H5AA 4Z0PA 2R2GA 1DIAA 2VHXA 2Y99A 2TMDA 3B1FA 4JP3A 2NADA 3HFGA 1DSSG 4WOKA 1KOLA 2EGGA 3ZU3A 3KXDA 1LX6A 3D1LA 4FJ0A 2Y1EA 3R1IA 4S1VA 2X0IA 1MB4A 1CQJA 3MEQA 5DZSA 5CP8A 4XYLA 1JKFA 5G0TA 5JW6A 1KBZA 2VYVA 5F5NA 1QYDA 3VH2A 1MXFA 4YT4A 4BQRA 2FR0A 1H2HA 3INGA 3R3SA 3PPIA 3E9QA 2BGMA 2W2KA 1U2DA 3ADOA 1ZEMA 4QQRA 1PS0A 4U7WA 2G76A 1LSUA 3KV3O 1DAPA 3DBHA 3DMYA 1B7GO 2ZKLA 3CIFA 4RZIA 4DVJA 1I33A 4FFMA 5U1PA 1IULA 3WJ7A 2A92A 1H6AA 3OJFA 1N2SA 1LI4A 1LBEA 1EMDA 3TZKA 4I5FA 3RBXA 3QWBA 4KOAA 1GUYA 3LC2O 5ITWA 2O3RA 5AOVA 1QYXA 4XD2A 3MCVA 3F4LA 2DU8A 3PDUA 4DBZA 4GSKA 5A1TA 3Q9NA 1OMOA 1Q1NA 4FOSA 4M55A 3VH3A 1LSOA 3IJRA 2YFHA 3AFMA 3OECA 1NHWA 4ROSA 3CE6A 4E13A 1PZGA 2HK8A 3E48A 1X1EA 1X13A 4ALMA 4CR6A 5T5QA 4D0RA 4WASA 1HE2A 5C3MA 4CQMB 4GGOA 1ADGA 1KS9A 1NAIA 3L77A 4MVJD 3ORFA 5IZCA 2G17A 4W6ZA 4PG8A 3KETA 3CMMA 1JVSA 2PZKA 5ITVA 2IYOA 3ONDA 4FSHA 4MIEA 1EDZA 3FF4A 4CODB 3PVZA 4DGSA 4BL5A 2WSBA 3W6ZA 3TQHA 2B83A 4R1SA 4YAEA 5BR7A 2YYYA 3ST7A 4PRLA 2O3UA 3FNFA 3SC4A 4BO8A 4A2CA 4IQ8A 3DBLB 3HZZA 4ZQFA 1HETA 2GPTA 2GN8A 3ZCXA 2HQ1A 3C1AA 4KWHA 4DIBA 1M76A 5KJEA 1UAGA 3ASUA 5F21A 1QV7A 3N74A 2YQ5A 3KUXA 4A10A 2NNLD 2EKQA 1DDOA 3SVTA 1B26A 3P5SA 1NQOA 4AJPA 1BDMA 3O03A 2HK9A 3E5MA 5JCXA 1E6EA 5L4NA 5L7YA 3KLMX 3GRKA 4LRSB 1R6DA 3QA9A 4CMBA 5JCJD 2X1HA 2TMGA 1BXGB 5KVQA 4YR9A 4PLFA 4IGFA 1XIVA 1MFPA 4E4YA 2C0CA 2JHFA 5MDHA 1FMCA 3WX0A 5KVCA 2NTNA 1XKQA 1ML3A 1YGYA 3VVBA 3D5TA 4P8RA 3PZRA 1I2ZA 3ZU5A 1MV8A 1LSSA 2Y0EA 4NK4A 2WYWA 4KTVE 4CPDA 2VWHA 1EE9A 3GZ4A 4BMVA 1YO6A 3PHHA 3UN1A 4M86A 5I7SA 3QY9A 4HFRA 2AEJA 4RPLA 2HSDA 1PJSA 2QG4A 3QRWA 4FB5A 2EHDA 2ZJ1A 3OEYA 2ZYAA 1ZVMA 1EVZA 3V1UA 4CM7A 2B4QA 3LDHA 3SLKA 1WZIA 4MVJF 3N58A 5C7IO 3DL2A 3QWAA 3I9NA 5J23A 3EYWA 1ZO8A 1G0NA 3U3XA 1LLUA 2O2YA 4JNKA 3OIGA 3WQQA 5M6DA 5BQFA 1ZCJA 4BNXA 1TT5B 4E2WA 1OOEA 1UXJA 4D79A 1X7DA 5JAIA 3P7MA 4XYMA 3OICA 1KEUA 1RM0A 3VZSA 2GN9A 1XU7A 2QQ5A 2GNAA 3HFSA 5EL0A 1VKOA 1EVYA 1FDUA 1M6HA 4D46A 4BHTA 3MWDB 1MG5A 1XDWA 2JHGA 4ZHSA 2OFPA 3HN2A 3ZWPA 8ADHA 4GPD1 4RO0A 4DLAA 3W6UA 3MTJA 3UICA 1F14A 4CL3A 4PIVA 1ENOA 3OETA 4YJGA 5GY7A 1U8FO 3SEFA 3TOXA 3ZV3A 4R69A 3AU9A 4RVFA 5JC1A 2B4TO 2DBVO 3WGTA 3CH6A 3U4HA 5EQFA 4MVJI 3K9QO 3JQGA 2D8AA 4MIYA 3GLQA 4Z0HO 1U2GA 1SMKA 2X5KO 3AJRA 4C4OA 4H3VA 5BSFA 4EZBA 5TT0A 2D3TA 5KKCA 1YVEI 4OJNA 1X7GA 4ALJA 2PV7A 4NH4A 1QSGA 3S55A 4EEZA 3B20A 4TQGA 5L7TA 3C3XA 1LA2A 1IOLA 4NBWA 4L74A 2PY6A 2C2YA 5J9GA 3C7DB 3R0IA 2X6TA 3FPCA 2D5AA 2O3JA 2Q2QA 2X0JA 4R9RA 1R0SA 3PGJA 3JQCA 3JQ6A 2UYYA 2ZTLA 5DP1A 2VZ9A 4CLRA 4BO2A 5TJHA 4YJHB 3WBBA 4W4TA 3PI7A 5FYDA 4CUJA 4MKRA 1EFLA 2C07A 1YONA 3NDJA 5ILGA 3SX2A 2PK3A 2DTEA 3OF2A 3PWKA 1EVIA 1GCOA 2BF7A 4BS9A 1BHSA 1JAYA 1KVSA 5IFLA 2HKIA 3TZCA 1QXSA 3WJAA 5TIIA 2YDXA 1I30A 4PG5A 3EUWA 3L6DA 3DC2A 2VNSA 2VWQA 3GVHA 3H2ZA 4ZJUA 4NFHA 3L4SO 4XZ3A 3QWIA 1UP4A 3H7AA 5T8KA 3GZNA 3BHJA 4ZRNA 3GUYA 4BNKA 3I1JA 3K5PA 1LC0A 1GZ4A 2Q1SA 1SAYA 4RVHA 2HLPA 5TLSA 1ZXBA 4YJFB 1I3KA 1NQAO 3TL2A 2GUGA 3H9JA 4DC1A 2JAPA 3HNPA 3MJTA 1CIVA 4MJLA 6ADHA 1GUFA 2EW8A 3IKTA 5FF9A 1C3VA 1LDNA 4IZHA 5IDXA 4MKZA 2W98A 4H7PA 2P4QA 1HLDA 3QW2A 2WM3A 3HHPA 3L07A 3AK4A 4DQVA 3BTUA 3JQ9C 5AXBA 2G1UA 2G82A 4WLEA 1J0XO 1B8UA 1RM3A 2E82A 4FIZA 2ZTVA 1HDRA 1LQTA 1HZZA 1UZMA 2OMEA 3TZ6A 1SB9A 3OP4A 3U4IA 3JQAD 3ON5A 3DOOA 4L4RA 1VL0A 2BKAA 2FWMX 4YEDA 3WTCA 2VOEA 2AQ8A 4YYZA 4ZICA 4ZA2A 1VKNA 3FTPA 5JXWA 4RDHA 3KYCA 1VJ0A 2C5EA 3C7CB 3NT5A 1RKXA 4I9UA 3TWOA 1EDOA 2W90A 4E5PA 1DLIA 2RH4A 4YXFA 3RROA 4IJKA 1W8DA 3WS7A 3BHMA 3QQPA 3M1LA 2A9FA 4FOOA 1UDCA 4TKLA 2W2KB 4NJMB 5A9TA 4J4TA 1ID1A 2YHIB 3DTTA 3ZV6A 1P3DA 2VYVD 2VTEA 3BTSA 5A3JA 2BGLA 1Z82A 4JLWA 4EGFA 1KVTA 4YCAA 2EJVA 3LT1A 2FSSA 2J8ZA 1QLJA 3DZHA 1ORRA 3EAGA 5BNFA 3NRCA 3TOZA 4GX2A 1HF3A 3QHAA 4CLHA 5KJCA 3RI3A 3KYDB 3ZH2A 3OHSX 4CM8B 4CMCA 4ZD6A 1HSZA 4WJZA 1H6DA 2YJZA 3ETEA 4D41A 1TVEA 4OKIA 4LISA 3L6EA 4W99A 3IMFA 3JD2A 3RUEA 2E49A 1G1AA 1T2AA 4E2YA 3PWSA 3OIDA 3GFGA 2GASA 2Q45A 2DVMA 4J90A 2D0IA 5CHEA 4D42A 2PGJA 4G81A 4J7XA 1J6UA 4BNWA 1SOWA 3JQDA 2Q3EA 1YOVA 3EY4A 3W4IA 5DN9A 1GPDG 5T64A 2C2XA 1MG0A 4FJ2A 3GEDA 1A4IA 3GHHA 1L7DA 2JAHA 5JLAA 1Y81A 5EJ2A 2IXBA 3O26A 2GZ3A 1IZ9A 1SO8A 4IDGA 2ZCUA 3GMDA 2DT5A 4QFCA 4WECA 1LJ8A 2WE7A 1NBOA 2P5YA 2PKRA 1VL6A 5T8KC 5A03A 5TGDA 1A9YA 1N7GA 4ZQGA 2GCGA 4J4BA 4O59O 3PYXA 4XGIA 4OXKA 2ILTA 1HE3A 3GEMA 5G0UA 1AHHA 5JDIA 1Y7TA 1P1RA 4D7AA 4B7XA 4AJOA 1A7AA 1K3TA 1JVBA 1XU9A 2DBRA 2X86A 1JW9B 2BRUA 2EV9A 2YW9A 1Y5RA 3I4FA 4FFOA 4BNZA 1A4UA 1KY5A 3JD1A 4II2A 5G4KA 1OI7A 2YFQA 4BKPA 1C1XB 5EPOA 2NV6A 1IE3A 1V0JA 3GN1A 5DOZA 3O8QB 4J7UA 3ROQA 3DBRA 3AI3A 3NGXA 5CDSA 4OOFA 3RJ9A 4E5MA 2EW2A 1O94A 3V2UA 1GL3A 3RUIA 4GGPA 1P1HA 1B15A 4HFNA 3TRIA 3CKYA 2FPGA 3NTQA 4IDAA 4EDFA 2HMVA 1ISFA 4F3YA 8LDHA 1UXKA 1F8FA 3M6IA 1PSDA 1DHTA 2YDYA 5TC4A 5ENDA 1PR3A 3GUCA 3WIDA 4PFJA 4CQLB 1Y8QB 3KEOA 1ZH8A 2EEZA 5JC8A 1H5QA 1LDYA 4GWKA 1U8XX 2E48A 4HADA 3BTVA 1LTHR 3OA0A 2VHWA 3FNEA 5G2OA 3WWZA 5EESA 1ENZA 3B1KA 3GY0A 1H2BA 2VT2A 2J5RA 4UEOA 3KB6A 3E6AA 4P4NA 3WLFA 3X2EA 4XWYA 4ZQBA 1LSJA 2NTVA 1GTMA 2P9EA 4J1NA 1PZHA 4PRKA 4I9NA 2X58A 4GX0A 1GR0A 2YUTA 2Z1NA 5IDYA 1CWUA 3WGHA 2YZ7A 2FZWA 2DFDA 3I9OA 4RLSA 3ZNQA 5L45A 2FPIA 3H2SA 3K92A 5JDCA 1NPDA 1IY8A 1QR6A 3WSVA 3M1AA 4OSOA 5HS4A 4QFDA 4AL4A 1PGPA 3WYEA 2WDZA 4LMRA 1EUCA 3P2YA 3I23A 4J16A 1MX3A 5CDYA 3LU1A 4Z9XA 4UVIA 4BKOA 5ADHA 4GLLA 3DFUA 4AJEA 3IIEA 4R16A 3ULKA 3D4PA 2CVOA 4QT0A 1GQ2A 4YRBA 1OFGA 1NX6A 3R6DA 4NJOA 2C20A 3PLNA 4MP3A 4PN3A 2B0JA 1DIHA 4FR5A 4MVJM 1L1FA 5AVOA 3LT2A 1EQUA 2AE2A 1H0KA 2AA3A 4PG6A 3KLPX 5COQA 4N5NA 2GZ2A 3JTMA 4DPMA 4IDDA 4KDEA 1XYGA 3U49A 4IDCA 1HEUA 1PJ3A 4NBRA 4JXKA 3H4VA 2WEKA 2EP5A 2XPCA 1Z75A 5K6AC 5IN5A 2LDXA 1LDMA 3L9XA 1F0YA 3S1LA 3CZMA 1I5RA 2V6BA 4ALLA 3IDSA 3DMTA 4CV0A 3ZWNA 4XA8A 2X9VA 1YB4A 3WMWA 4BGVA 2CY0A 3ZWYA 2D1YA 4B4WA 4RVDA 3A06A 2PWZA 3WYCA 2ZJ0A 1HDOA 4YJGB 5A9SB 4DPLA 3E03A 3PQEA 1ZSVA 4O1MA 3DTYA 3ZHBA 4HNGA 4J9VA 3V2HA 1E3JA 4KWIA 1HDCA 4LK3A 3ZN2A 4D3SA 5T6BA 5L95A 3ITKA 3FTNA 4J7CA 3WXBA 4XIYA 1ZMTA 5FI5A 5C7LO 1BW9B 5JSFA 3K73O 3OQ6A 4NPCA 2BH9A 1DLJA 1P0CA 2AXQA 4HWKA 4E5YA 6LDHA 2J3IA 4Q9NA 1Z7BA 4LMPA 4XYGA 4WK6A 3FWNA 3PDJA 5BNIA 4RORA 2Z95A 5TF4A 3STHA 3V2GA 1FDVA 3ENKA 1ZKMA 5L3ZA 2I99A 2VQ3A 1V9LA 2AG5A 4Y6RA 3QVTA 2EKPA 4IIVA 1XWFA 4UUPA 3KYCB 1WWKA 5DOVA 4AJLA 1KERA 5DDIP 2P9CA 2GN6A 1Z6ZA 4CQMD 2POQX 3SC6A 3OEWA 4RF2A 1GZ6A 1QMGA 4GMFA 1O5IA 4TZTA 1UP6A 3I9KA 2XXBA 4H16A 4NR0A 2O2SA 2VWGA 3PWZA 4JBGA 1YWGO 3PK0A 4NFSA 1ARZA 4PLWA 2IXAA 1PJBA 4XIJA 3WICA 1ISGA 3AWDA 4JK3A 1IHYA 2ZYDA 3T4XA 1M75A 4J91A 2QYSA 1JN0A 1L7EA 2W2LA 2PGDA 1MA0A 1R16A 4J6FA 1HE5A 1PGOA 2O3TA 2C54A 4HXYA 1FK8A 1N1GA 1ZK0A 4ITUA 1VSVA 2X4GA 4XEHA 1AHIA 3ZU2A 3WIEA 2GD1O 2VHYA 4OQYA 1HXHA 3INTA 5JY1A 3BAZA 2P91A 1OBFO 2CD9A 4L4SA 2RH8A 4CUKA 3DOJA 3KSDO 2CZCA 3QSGA 1P1JA 3WMXA 4EUFA 5KVVA 2IRWA 2XXJA 5G0SA 4BO0A 1LLDA 1Q0HA 3HDHA 4WE3A 1R4MA 3NAQA 4IGEA 4FFPA 4WCFC 3F6YA 3ITDA 3VDQA 3QWHA 4E5KA 3HADA 3RUFA 5CG2A 1P77A 1Y8QA 3HE3A 3RBZA 4RF5A 2Q4EA 2F1KA 2ZQZA 1H94A 5JFOA 2Q2WA 2X5JO 3BMQA 3AY6A 1ZMOA 4ID9A 3U4CA 3SJUA 4UUMA 4BNNA 2DLDA 1PWXA 3ETDA 4AJNA 3VTZA 1G0OA 1FDTA 3BHIA 2I76A 1ONOA 2QYTA 5L4SA 4IXWA 3K2EA 4FPXA 3ZWMA 1U1IA 4IIUA 4MP8A 5DF1A 4WOJA 3W4JA 2DC1A 4RF4A 4LVCA 4KZPA 3WGIA 2X23A 2Q46A 3UGKA 2GDZA 4O63O 1NVTA 4GL4A 4RLHA 1WXDA 3VAZA 5HBRA 1T26A 1C0IA 1PQUA 3VKUA 1P1FA 3ZWXA 4CLXA 5IN4A 1PIWA 5CEJA 3MZ0A 3ONFA 3GQVA 3IP3A 1LLCA 4QEDA 4DYDA 3WGZA 1ZJZA 1NQTA 4E6PA 4K1LA 3ZWOA 2A35A 4P4LA 4WEQA 1LU9A 2C7GA 4OSPA 5JAMA 1NAHA 1U3WA 4YACA 1PS9A 2AQHA 3UCXA 5CDUA 3RVDA 4A27A 3Q0EA 4E12A 1U5AA 4BKQA 4URFA 1NWCA 1JLLA 3C1TA 2JD2A 1N1EA 2C82A 4NNJA 1AXGA 1E0DA 1LDEA 3ZNNA 5COAA 4UUOA 2CNBA 2I6TA 2D4AA 4RPHA 5FWNA 2HAEA 4YTEA 1BMDA 1D4FA 4MKXA 5THQA 4Z9FA 4DC0A 5ENVA 5ICSA 3E5RA 1K6XA 1GY8A 1GQQA 3K2BA 2FN7A 4KDFA 5TS3A 2NVUB 1DPGA 3F1KA 3ZWWA 3PJDA 4XYEA 1U3TA 3I5MA 3PQDA 4IXTA 3D64A 3OJLA 3NTOA 5LC1A 1Q0QA 5CFZA 1I01A 5I7VA 1NVGA 3Q6IA 4PVCA 4J2OA 2VT3A 3H8VA 2PZJA 1H6BA 2NSDA 1CYDA 3BMNB 3BMOA 3DXFA 2W2LD 4NBVA 4PCVA 4UVHA 4BNLA 2EG9A 2VZ8A 1IPFA 3D3WA 4DXHA 1QLHA 2IZ1A 1C0KA 2IDZA 4CLOA 2UDPA 1YRLA 1YQDA 1JKJA 5K6AA 4ZQHA 3BA1A 5EIOA 2CDCA 5T57A 3FSRA 4PZDA 3PRJA 1XEAA 3B1JA 3PZBA 1U4OA 4UEKA 4Y98A 1NQ5A 5JO0A 3TJRA 2X0NA 4N18A 4EJ6A 1D1SA 3E8XA 4OXNA 4J49A 3QE3A 2HJRA 3KZVA 1W73A 1E6WA 4OIMA 4EBFA 4M54A 4WGGA 1HL3A 3GVXA 5FI3A 3GPIA 5GZ1A 4FC7A 4MP6A 2NU8A 4TROA 2P9GA 4RZHA 3GT0A 3FNHA 2Z1MA 1ZW1A 4GMGA 2YHUA 4EJ0A 1KEPA 4ALNA 1T4BA 2HRBA 3UVEA 2HUNA 1WMAA 4DMMA 4W7IA 5AXDA 3ZZNA 3F4BA 3ICPA 3EZYA 1YXMA 1KEVA 3B6ZA 3LK7A 5IDWA 2NLOA 1S6YA 2Y1DA 4BNTA 3EMKA 2BLLA 1WW8A 2PZLA 4MVJP 3E9NA 3PTZA 1CEQA 3DOCA 1DFGA 4YPOA 4CMJA 1H6CA 3RU7A 3LT0A 4LCJA 5HA5A 5JPIA 4DPKA 3D3WB 1K89A 5HWSA 1KIFA 2JCXA 2I65A 3PIDA 3PHJA 1BVRA 4YRAA 1GPJA 4UEJA 3INRA 3FCOA 2E6UX 1ZBQA 1GYQA 4DBVO 1EBFA 3HJAA 1IB6A 2CMDA 4OMUA 5DCYA 2VRCA 1Q0LA 4JIGA 3VVCA 4BO4A 1WPQA 3WQSB 5HM8A 4L8VA 1ZFNA 4L4XA 4RVUA 1Z74A 3JYQA 3ZDFA 3O4RA 3WLEA 1UXIA 4S3MA 4IS3A 2UAGA 2Y68A 3HQ4O 4U5QA 3BMCB 5I9NA 3ZW9A 3DZBA 4E5NA 3HUDA 3OFSA 1BGVA 2IODA 3KYDA 4CM9A 1BDBA 1FJHA 2BI7A 3JYLA 4HKTA 4BO1A 4IZIA 4H15A 2Q49A 4BGUA 2O48X 3EDMA 1YBAA 3GVIA 4J0EA 4Z3DA 4XRRA 5H81A 4PLTA 1E92A 2BHLA 3Q1LA 3RUDA 5DBGA 1YL5A 2PFGA 3VPXA 5H83A 4CMIB 4ND3A 4BO3A 2I67A 4WKGA 2NU6A 5CPBA 4B3JA 2PD3A 2GGSA 3AOEC 4CLRB 3PQFA 3FD8A 1DC6A 1SCUA 2UUPA 2I9PA 5G4LA 1ZSNA 4BB5A 3VHRA 5JYDA 5FEUA 1P1IA 1ADCA 3RBVA 2P4HX 4WCFA 1WDKA 2VWPA 3MJCA 1PJCA 1I10A 4DMLA 4BGIA 1DRUA 3JQBA 3FHLA 1VPDA 2Q99A 2H1SA 4MPDA 4ND1A 1HTBA 2QIOA 3BZUA 2DBQA 2HMTA 2RBEA 1E1MA 3T7CA 1M6WA 1HDZA 5AQ1A 3H3FA 5IZ4A 1E3SA 1EK6A 4UVGA 3VTFA 3JQ9A 3KSUA 4XQCA 3AY7A 4YQYA 4YT5A 3SBOA 4R4JA 2D59A 4LCEA 1DC5A 1PGQA 4IM7A 4CM8A 4BO9A 2ZQYA 5B4TA 2V6FA 4NG5A 2BELA 1E5LA 1E7QA 3FI9A 2WYVA 3LT4A 5JE8A 1ENPA 1I3MA 4CM6A 1WDLA 2P2SA 1LQUA 3GGOA 4CMGA 4YWJA 3CUKA 1BTOA 4E31A 3KYBA 1NP3A 1LRJA 5LCXA 1ULSA 3VZRA 3D4NA 4YAKA 4F45A 2FY8A 4GLOA 3JYOA 1HDXA 3T4EA 3OQ1A 3TPCA 4D44A 4BNJA 1C14A 2ZYGA 5A3VA 4NU6A 4OYRA 2B36A 2G0TA 2E37A 5A05A 2VYNA 4E3ZA 1LC3A 1PQWA 1Y9AA 1ZEJA 4XX0A 1LRKA 4TZKA 5T67A 3TFOA 2YV1A 1DFIA 1P9LA 1VI2A 3IS3A 2GZ1A 1KEWA 3HWRA 1VE9A 5DP2A 4CV3A 1UP7A 2FMUA 5A5EA 1RJWA 5TRTA 4NI5A 1LDBA 3GVCA 3CSDA 3N7UA 2NUAA 2CVZA 4NJMA 3UCEA 3UOGA 4BNYA 2B69A 1RM5A 2HDHA 3QV1A 4OO3A 1U3UA 3P19A 3CXRA 3DBHB 1Y9EA 4GAEA 3WFJA 1KVUA 3JD4A 3KVOA 2BI8A 3JQAA 1C1DA 4E2XA 4RDIA 2I66A 3RC7A 1KC3A
chains in the Genus database with same CATH superfamily
3WK4A 2P6RA 3DZJA 1LVHA 4JC5A 2H4HA 2PD4A 4JUDX 3W9UA 5C2JB 2ZB4A 3SMQA 4D4KA 4PZEA 2JVKA 3MIIA 1GQFA 3AGQA 1HTWA 2PMWB 3P2KA 1U0TA 2VAVA 1LPPA 1U4SA 3PEWA 4DKXA 3FLEA 2BEVA 3GNSA 1SC6A 2XNSA 1CUBA 2F8LA 1DB3A 2HF7A 4KVAA 4EK9A 421PA 3G5MA 2O3SA 3HV0A 1PK7A 3RAFC 4AJ9A 1ECJA 4CBVA 3GJ0A 4HS9A 3K8ZA 4WN9A 3EGXA 1NOIA 3VZBA 4YUWA 1RWOA 3ABSB 3VO2A 3RUCA 3GFFA 4N49A 2QVBA 3OVMA 3UHOA 3OSUA 1A95A 2RHJA 2AHRA 2VQDA 2XQIA 5B1YA 3VDMA 3AFNA 1ZC3A 1YFZA 2X77A 5IC6A 2ZI3A 3HHEA 4KITB 3AG6A 1D6SA 1DELA 2OM2A 2Q8NA 3ACBA 3BQ9A 4PWZA 3VGJA 4YK7A 3W9YA 5SYAA 5IT4A 3DCJA 4IDFA 4WKPA 2ZRJA 4X1YB 4IYRA 1DQSA 3O0TA 3EZ6A 3WGGA 3KE8A 3F9RA 1BS1A 2Q2VA 3NV7A 3PR1A 4M7OA 5KYNA 4B3SB 1JFLA 1UBGA 4BCCA 1J2TA 1QIKA 1VYTA 3GARA 3MT8A 2X4DA 1B0AA 1QCZA 1JF8A 1PZFA 1UADA 3I2HA 3G5TA 2Y2VA 4PSCA 3PUIA 1F12A 1RQLA 5EXXA 1PJ2A 4F06A 2ZRPA 1QCYA 5LQUA 1RZRD 1E7SA 3IUMA 1GGVA 3FRIA 4E5SA 3C8HA 1EHYA 1V6AA 3CRRA 4IVQA 4TS4A 3D6HA 3ZHSA 4F7WA 2J0UA 4HCJA 2O2DA 4CTOA 2VH1A 2CXUA 2ZJBA 4U8GA 5FD8A 4QOFA 1J25A 2BFPA 5ICCA 2DLNA 1MCZA 1PE0A 5AWFC 5FOSA 3M6AA 2WTUA 3NBUA 4I2NA 1V35A 4A1FA 5BN3A 1M34E 3T9BA 4UC0A 5AKHA 4U2BA 1FS5A 2ECQA 5GZ6A 2AYZA 3I5UA 1Q7CA 3AB3A 1OILA 1JDNA 3KUDA 2ZPUA 1KDOA 3ROKA 2EXXA 1V11B 1C1YA 4IFTA 2GD0A 4JJFA 4GVLA 4A23A 5I8WA 1I7SB 2UV8A 1Y5IA 1QQAA 1U6KA 3D0OA 5FOXA 3IO5A 1CBUA 2OP0A 3IQDB 2QJFA 1DUVG 1SBYA 4B2YA 3EZNA 4HFMA 1ZMXA 1IUOA 3CVOA 5F76A 5GONA 3H1FA 1OYWA 3F5QA 2EIHA 3PJGA 4KO2S 5CB0A 4AF8A 2V97A 3B13B 1DCMA 3T99A 1BVYF 3KGDA 3OZEA 3RIMA 3RR2A 1ZD2P 2DY0A 1TTQB 2HLNA 4BO7A 2GYYA 2BISA 2DULA 5AVVA 3FOFC 3Q6MA 4KR6A 2QHXA 3ZTYA 4E33A 5FRDA 2JEOA 1N6KA 2AEMA 3MF4A 2IOQA 2FEMA 3WWCA 4G0VA 1NVEA 4P0QB 7MDHA 3UK1A 3ZBPA 4X6UA 3RYFB 3FSGA 1OPRA 3A1DA 3ZNPA 1VE6A 2VZ0A 2VHJA 5EJMA 1XTZA 4JDUA 1KPHA 4P35A 2OA0A 5FJJA 1KI3A 1M0WA 2PU5A 5FKJA 4BNMA 1X7WB 2VG8A 4C29A 3CN7A 3KPVA 1IWPB 1QORA 2GD2A 2O19A 3JZFA 2HRZA 2X5NA 1A96A 4Y2HA 5J59A 3WNDA 1NRIA 1NL3A 5LQSA 1FX0A 3AVVA 2EFJA 1S2OA 3ITNA 5AKZA 1WD5A 1E3WA 1I3OA 1PL8A 2Q5JA 4CW7A 1AKRA 4OHMA 1MJFA 1DV2A 1X86B 2JIMA 2WFAA 1XQYA 3L7MA 4NCIA 1NASA 5ILQA 1QBGA 3W4KA 1DCTA 2G5PA 2ODNA 4B43A 3TD6A 2JJMA 1RRGA 4JA0A 1BGXT 4PV7A 3TBFA 5CXQA 1GFZA 1TMYA 1A8QA 4U39A 4TYWA 1DZ3A 1LJLA 3BWMA 1XZEA 3IO3A 4FQ7A 4HVCA 3VZCA 5IM4A 4L9AA 4JT9A 3T4PA 2ZUBA 3G79A 1DIBA 3L6BA 3UF0A 4B7ZA 1YDFA 4C6TB 4O5OA 3AUYA 3U4DA 1N33B 1ZRHA 5IYZB 3T34A 1V1RB 2H8GA 2ZIUB 3DLHA 1KMMA 1VJTA 5EFZA 4CQNA 2R86A 3WBJA 3GOQA 2H2WA 4Z8YA 1B3BA 3U31A 3UGQA 3WQRA 3WWDA 4C1NA 5JH7B 4EKIA 1IL0A 3C1OA 4M21A 4M8SA 3GUVA 1XPUA 4L51A 2WIFA 1J09A 3O31A 4BX3A 1PFUA 3KQWA 2RBGA 2RGCA 3RM3A 3N0XA 5D5QA 3JALA 3DDOA 5CYGA 4PZCA 4R51A 5AW4A 3N3BC 3PNYA 4H3SA 2QZZA 5DYNA 2QXUA 1T2DA 2H1RA 2YJGA 2G77B 2IKQA 3CF4A 2BV3A 4ZYYA 3E2PA 4IIXA 4TXNA 5MF6A 3H13A 1N6IA 2MSWA 4MR7B 3I2GA 3ZIAD 3ANMA 1ORWA 4NQZA 1SXPA 3M89A 4KJXA 4TTQA 1BHQ1 5IDQA 5DULA 2O8EB 1V1MA 4J16C 1OKKA 3BM5A 4UEQA 2VNHA 3QOYA 3RRZA 2AC4A 3QVVA 4FDAA 2I78A 3G6WA 1T91A 3RAEC 2IE8A 3PE4A 3ZWCA 4MZDA 5M29A 2RHRA 4UHBA 4MDEA 2R6GA 4KIFA 3M82A 2E5FA 1OC2A 2H5EA 4RKWA 5TEVA 4CKZA 5KTKA 4Q1AA 2A78A 3KOXA 5KKAA 1FUEA 1TUIA 3U7HB 2B30A 3Q11A 2H0RA 4DOMA 3R8CA 4MV5A 1UEJA 2IGTA 3KE9A 3FBGA 5A0TA 4NHEA 2HIAA 3LW8A 1VM6A 5L7WA 3BX1A 3OQNA 1R4MB 2PL5A 3T1TA 1Z62A 1DTSA 1Y1TA 1ZJ6A 2PM8A 1Y3HA 2HA2A 4HHEA 3VVMA 1DC7A 2FSIA 3ISTA 4ZGWA 1Z47A 3P2OA 2R8BA 3BRSA 3CKLA 3H5OA 2X5XA 2MSCB 2WP0A 1YOVB 1EQ2A 1JEQA 5C4MA 1BE0A 4L6AA 5LZ9A 1JMYA 2DR0A 1P33A 2WU1A 2QMYA 3C24A 1TE2A 4KQ2A 5DYIA 1V3UA 1I9GA 3CJRA 4IMJB 2YASA 1Q7GA 3G9QA 2PUFA 1Z5VA 5EQDA 4AKEA 1I1OA 1E2MA 1UR5A 3A28A 3WR5A 3U3MA 1OYOA 1B6TA 1R0RE 1XAGA 3JQBC 4TV9B 3U37A 3UPTA 1HNXB 5GOZA 1D3AA 1V4NA 2DWCA 1W4ZA 4RSMA 4EG7A 4C7OA 1H2EA 3CLHA 4EI2A 4NBTA 1QZZA 5FTJA 3W9BA 1LRLA 4N9QA 2XCLA 2WUVA 2GBIA 3NDRA 4FDLA 3S44A 4AJHA 3LDGA 4CXMA 3MAGA 1PSZA 1L4UA 3L0OA 4KL8S 1ZG3A 2P62A 1TL7C 3QEOA 5BNTA 2IW1A 3TQRA 5LR6A 1N34B 4W1SA 1HI9A 5ER6A 1PEDA 2J3KA 1V7QA 3C8DA 3GEEA 5IXYA 5KINB 4JJGA 4HH4A 2Q5IA 4L28A 2DWQA 3JWEA 1S3SA 1U9YA 5E4YA 3FCEA 3TTTA 1CSEE 5BSEA 3RC1A 2C8LA 1VSUA 1JHAA 3K1YA 4QPCA 4XH9B 3ND8A 4ISCA 3R5KA 4M1MA 1I0ZA 3J7TA 1EE2A 2JJYA 2CHUA 4C3VA 1GT6A 3QBTA 1T36B 5F3RA 1XG5A 1YZFA 4LN1A 1EUCB 1Z37A 3E05A 1O3YA 2H2DA 1DIGA 3MJEA 4OHBA 1LKZA 3KEGA 4MAMA 5CJPA 4BN5A 4EJSA 5CB4A 5JRJA 4R7ZA 1VYVA 3CISA 5SY6A 1KK1A 1MQ9A 3OU6A 1KYYA 5KTYA 1WHTA 4XB2A 5DBIA 5BSUA 2PRJA 2ZI5A 3HCEA 4G8CA 4I50B 1XNRB 4EABA 1XEWY 2C7RA 1J9ZA 3U4AA 3ZCSA 2BHSA 5KWEA 1J7JA 4X8OA 4MWZA 1Y7IA 1ZX1A 1U8ZA 3HJGA 2NOAA 3GCDA 3LSTA 3N8DA 3R0VA 3WNQA 2RCNA 1ZOOA 3I83A 4JKYA 3T3PB 2WM2A 2OK7A 2R7KA 3PFWO 4BO9A 2C9MA 4FK8A 4KYTA 3G0DA 1RRCA 1ULTA 2CLIB 3OPYA 1J2EA 2R8PA 3HPRA 2YS7A 1SKMA 3FPHA 1ONPA 2QD2A 4LPKA 3NHBA 5E2AA 3TQTA 3ZV4A 3ZLUA 4MUGA 3V8BA 1WSAA 1L8LA 1CZNA 3EC2A 3M6WA 2O8NA 1PHRA 4LY6A 1BJRE 5C7OO 1V45E 1OB2A 2I4RA 4JFAA 4Y6OA 1LBIA 3JZAA 3PC6A 3VNQA 1O9HA 7REQB 3DAPA 2DQKA 2PMCA 2VBFA 2PQ2A 4P82A 3SIPA 4INOA 5EKUA 3AFHA 5K0TA 3CZCA 4P54A 4B48A 1FDOA 3ZWVA 2YYZA 2GLUA 3DLCA 2P2DA 3B60A 5CVVA 1F8UA 1LNZA 1NLUA 2G80A 1JR3E 3N5CA 4WN9B 3WLIA 1KRWA 5J4LA 4GBJA 5F1PA 4EA7A 4FN4A 2FRDA 1SFRA 1ZESA 1M1NB 1DP4A 2GLXA 1L7BA 1KFKB 2PMBA 4P38A 1VB5A 4EG0A 3TLGB 2XUDA 3KV1A 2W6QA 2OBMA 4HNQA 4QQ8A 3PFBA 4JR1A 4IHJF 5TNXA 3RIHA 1KJ8A 9ATCA 5ENZA 4JI3B 1SKUA 5HRUA 4KNYA 2QX9A 1TX4B 2IUFA 2CLCX 4FFVA 4HQ6A 4AG6A 4E7PA 1DRJA 1WB4A 3I34X 2JEZA 4KKXB 4NDZA 1UODA 2JJ2A 4I3FA 4JCOA 1YCDA 3VPDA 1NUQA 2YV3A 1EX9A 3HGMA 4DLSA 4LSWA 1A2KC 3CBGA 4I1IA 4DQXA 2EP7A 5EMHA 3GOHA 3LUAA 1V41E 1IXRC 3IUBA 3ELBA 1YZYA 4P4SB 3LYHA 3QFTA 4W8OA 4BPRA 2AOUA 3HYCA 1KKMA 2Y6VA 4O6VA 2JDIA 1GZ3A 3N5KA 4X44A 2PPVA 5A9RA 5BUZA 5JNLA 5J4HA 2E4VA 2VUIB 3KJXA 4Q7LA 4U0KA 4V3BA 1EA5A 2VR1A 5KSPA 5BWOA 5KTNA 2NUAB 2VRCD 3QYPA 4LNAA 1M5UA 1E1NA 1GQOA 4J9UE 1Z34A 1P45A 2P65A 2QZJA 4V0LA 4WZAE 4DCGA 5C52B 4L7VA 4GI2A 1X9GA 4HMQA 4OJTA 2J3JA 1PSWA 1R66A 3OT1A 4HN9A 3I52A 3AKZA 4CR8A 4XRGA 4BQFA 3UJNA 4R41A 3B6IA 3MBIA 3NJ8A 4Z7NB 5CFMA 4DB4A 2GBGA 1L5YA 5HKBA 3QLJA 3JAWA 4RS3A 3TR6A 4P80A 5EZQA 4U9HS 1SGWA 3IXQA 4M87A 1KO1A 3OF5A 1NSFA 5E1MA 1KE2A 1UZNA 2VOJA 2WSLA 3T06B 4D74A 1V6CA 2J5QA 3LF1A 1PR9A 2EC5A 4PYMA 3L93A 4WXHA 3FFXA 3AP1A 4CNQA 3L0SA 3TSAA 1IPEA 2IE0A 5AVTA 1R6AA 4DRYA 2PTGA 4Z49A 1I5OA 3C6MA 4ASUD 4RTLA 4I81A 3T3NA 1RW4A 4PXAA 1DCFA 3BVPA 3W2IA 1NOJA 1PU2A 1CFJA 2ZREA 1Z5ZA 3EG5A 3E8SA 3H9UA 4EG8A 5JDCC 2R0QC 1ZK1A 2RAVA 5C1OA 3GRFA 3M6UA 3HO1A 2IHTA 2Q22A 1HZJA 2HEGA 4DLPA 1A71A 2HSEA 4ER5A 2PKWA 2CVQA 3HYLA 4BTVA 1V1RA 4UAGA 1BWSA 4YLGA 3ELWA 1C81A 4RY0A 5A5FA 4BNGA 1MENA 4EHKA 2V65A 4FGSA 2IP2A 4QYXA 3UJPA 5BPHA 1PR0A 2YHAA 3AY3A 3DP7A 1P4HA 4G5XA 5JMPA 5TPWA 1T5SA 5IAAA 2QMEA 1T0BA 3BRQA 2WD7B 3GZNB 1GYRA 2V8OA 4EPWA 4MW6A 4QPZA 3NEPX 4B87A 2FLVA 1F8GA 5CK4A 1MDFA 3RYFA 1SNYA 2R1VB 1T5LA 5HNKA 3NQ41 1PUIA 4M6WB 3E3AA 2F3UA 2R11A 3G2LA 3WHLA 2PMFA 2VP9A 3MA0A 1UMDB 2HBRA 2FWJA 2JFYA 1CZHA 2JIZD 3NBFA 4B3XA 4Z0TA 4BLUA 3GPLA 1FX0B 2IS6A 1O0SA 1VIAA 3G7UA 3RASA 3Q8KA 3FDFA 2IPXA 4DDWA 2G1JA 1E9EA 1Z3IX 1N57A 1SN7A 2H6EA 2Z30A 3HEMA 3KT8A 5AM0A 4JU9A 4HYQA 5DLYA 3RV3A 2FSVC 5K6TA 3EUEA 4KQWA 5FPHA 2EJBA 3NV9A 5K8TA 3NO4A 2BKUA 2QW1A 1SRRA 3AY0A 4GUAA 3A9SA 5B1IA 3U1VA 1K5HA 3WNBA 2VT7A 2CDAA 4BKUA 2C2HA 2KPOA 1NBWB 4M8KA 1VG0B 3JQPA 1NDQA 2I80A 4TMYA 5SYMA 2CEAA 4UE2A 5KKNB 4XAQA 2IUEA 3KFXA 3E18A 4DIOA 2J3MA 3NBYC 3VPGA 2QRVA 2ZBDA 1Z08A 1Q0RA 4G0ZA 1N2IA 1P0QA 4R8SA 2R6FA 3W90A 4GOMD 1IBKB 3WIOA 3WTBA 5IJZA 1NJ8A 2DXIA 2GERA 1AV7A 3R5HA 1EVQA 3NGMA 2X8JB 1TYAE 1EG7A 4TWRA 5DIFA 3MTQA 3ZHYA 4D4IA 4EEXA 5KSOA 4LWOA 5BWMA 3H84A 1Q17A 2KYRA 2WIJA 3OZIA 4RHTA 1NM5A 3QEMB 2FQ1A 3TMAA 2QDXA 1NSTA 1WXHA 2GR9A 4PLZA 3AIKA 4R54A 1NR7A 5DNUA 1KZYC 3HFJA 4JAVC 4B75A 3ROTA 1JYSA 1YTUA 3ZD7A 1QRDA 2JJ8A 3AONB 3CU5A 3LPAA 4E2FA 2L17A 5H68A 5B2ZA 1BN7A 1KZ1A 2PT9A 1E5QA 1ZL2A 2HGSA 4R5MA 2AT1A 4EY4A 2X9GA 2KSQA 4JYMA 1OFTA 3ZD8A 2BI4A 1OVGA 2Y1GA 3GEBA 1T5HX 3HCCA 5EXDA 3RS8A 4XQ9A 4D45A 1PTJC 2GEKA 4B3MB 5IM5A 1CUDA 4RMGA 1MJNA 2OYSA 2NVUA 1S2LA 1WPXA 2QSYA 3AV3A 3N28A 3R7NA 2RG1A 5KTTA 2YWGA 3QJ5A 2IYQA 3QIVA 1UC8A 5JS7A 5E38A 1IG0A 2XODA 2NT4A 2C2KA 2HHLA 1CRWG 3ZNOA 5JRZA 3PITA 1U8AA 1X0VA 2VDUE 1TO2E 3OCZA 4YJKA 1YCGA 4MYUA 2QV0A 4PIPA 1U0GA 4P4GA 1QVWA 2R7AA 2C5GA 4NU8X 3IUSA 4EPRA 3EMDA 5GV8A 3ZHTA 2J9GA 2B2NA 3L40A 1O03A 4IBOA 1M6NA 1Q6YA 2ZYVX 4LJYA 3VU9B 4CGZA 4Y0AA 1C4XA 3IUPA 3S2ZA 5JROA 1Q77A 4A73A 4GWGA 3T94A 5KCZA 3ZVMA 1E2BA 3X43A 4ZFNA 5ALWA 3KIPA 1F0KA 3A9TA 4X61A 2BH2A 2UKDA 4HEJA 3AB8A 4HVTA 1IN8A 3S2IA 3C85A 3QX3A 4BEVA 4TYNA 3KU4A 1SM4A 2BGNA 3UUFA 5LKAA 5KYKA 4JZKA 2TS1A 3CINA 2DSNA 3TZHA 4BIMA 1DADA 2I4LA 4CI9A 1GTSA 4R5HA 4KRFA 5CNKA 2I54A 2OBBA 1BD4A 2GEUA 4GBMA 3JATA 3KTAA 2GJSA 2HC9A 3ONWA 1UFKA 2VEDA 3QKIA 1GA4A 1V8BA 3FDJA 4JHXA 4LRYA 3ZBTA 1GEEA 1QG6A 5E7JA 4C20A 3IE2A 4C14A 3NEYA 5KJFA 4TRRA 4YCLA 1XA0A 1XO1A 1P5HA 4EW1A 4ENSA 3EYAA 1O8CA 2D2EA 2P4SA 4HQLA 2FR1A 3LDAA 2GM4A 4XGNA 1Z4OA 1C9DB 3E22A 4LPSA 2A9KA 3SQLA 1UPUA 5JD3A 4TTAA 5JO9A 4A8JC 1TUBB 3AEQB 4MYDA 5KAPA 1CQIA 4XDGA 1U0HC 1V5WA 3EGOA 1RAIA 3QH4A 1KOFA 5I9TA 1T3TA 1JA1A 3K96A 4Y2GA 4E22A 3IUNA 3LQQA 3SZMA 4BTEA 5CLIA 3JPYA 1SB8A 1R6TA 4XPIA 4XI9A 1DTWB 1T0HB 3DEKA 4QG7A 4ZC1A 3K0AA 4X65B 3F3YA 3OCUA 4ZYZA 5EN4A 2A9RA 1MC4A 1E3WB 1ZD9A 2B9VA 2O05A 1Q21A 3G9UA 3L05A 3NM5A 1G4AE 3HN7A 2AI3A 5AHXA 4DXAA 5F9MA 4CE6A 1YMQA 5IM4F 1B16A 4KK4A 4NOJA 5JFTA 2Z2ZA 5EQTA 1IOWA 4DCMA 4C0KA 3KS9A 2IEBA 4INJA 3K1AB 1E89A 3KBOA 4NE7A 5MGBA 3D4LA 1OB5A 1NTOA 3WO0A 4ER0A 1QOPB 4IUYA 1AHPA 2FXIA 3ZJXA 1TCVA 3K4QA 1KDRA 1SQ5A 3SIXA 1ZNQO 4HF7A 5ARBA 3GH3A 4KQIA 2HWXA 1S8FA 1UT8A 2B78A 1UMCB 2GH1A 3TJZA 4LDAA 1DBRA 4HGZA 4ZOLF 1P62B 2W2TA 4AP5A 2YWEA 3VHQA 4RTQA 4L57A 1SQFA 1ENYA 3ZCTA 5FAKA 2PA3A 1KYXA 1X94A 4HY3A 1G55A 4RIEA 5HIAA 2Q5OA 4YRIA 4LOJA 2BD0A 1X19A 2XI4A 5A4DA 4X63A 5ER9A 2OCBA 2QM0A 1AUXA 2D2IA 1JLHA 5JH7F 3ZDBA 3HDQA 4HG2A 1RJ9A 3IV7A 3I2YX 4W7SA 3NW9A 3ZTTA 2OUIA 2PZBA 1PCXA 2V7QA 3K1ZA 1QAQA 5FA5A 4BASA 2X22A 4DNQA 2VC2B 4NPAA 3GP3A 4X84A 1D7OA 1QH0A 3WFIA 4B2PA 5LU9A 4PGGA 4TKVB 2VP4A 1C3LA 3HUEA 3D8SA 3M2TA 3LHFA 5FNZA 4CL8A 1QH1A 3GBPA 1FU8A 2G4VA 3OLZA 4FEGA 4WK2B 1ZMRA 4ZQCB 5EJIA 3CUTA 1Q2UA 4H27A 5DXJA 4AT1A 1ONNA 2YMQA 2ZRLA 4HP8A 1PJZA 1XFDA 2EWWA 1RLMA 2Z3VA 3CS3A 1L5OA 1Q2XA 2A7QA 4E30A 1VZ2A 3JQAB 1Y1PA 3CGGA 5I8PA 1H0SA 3GLFA 4KXNA 4MOWA 4RSRA 4B6FA 1I7QB 2ARKA 1OW3B 4P4SA 1WB9A 3NUGA 3IP5A 3RVBA 5L9AA 2I3BA 4D99A 1P4RA 4X64B 3EIEA 3ICWA 3O1LA 4ZHQF 1J5EB 4QPJC 1TUBA 5E4JA 4I8DA 4O4HF 1KJWA 1YRHA 4DARA 3W5BA 3PX2A 4Z9BA 4A7PA 4MR8B 5K2OA 1CG6A 3OA2A 1D1TA 1TF7A 4M0LA 3RRNA 2PH3A 4DABA 3RSLA 2HF9A 1X14A 2AN1A 1TYDE 3AINA 5EINA 2PS0A 2CK3A 2YUIA 4TSRA 1A5ZA 1W49A 2X14A 4FE3A 4WCDA 2VP5A 3DLTA 3ABRB 4DLUA 4IGAA 1ZZEA 1J1IA 1W6UA 4K6CA 5LA6B 2C4VA 3EIOA 1OV6A 1JWBB 2E3JA 2YXPX 3FPEA 4TMFA 1IN1A 2GSWA 1Z15A 3R3HA 1K08A 1ZI6A 3CEJA 3IV6A 3WDMA 1XL0A 2NT3A 1N2EA 2VIIA 1MR3F 2ZM5A 3E7FA 4U2DA 3RC3A 3WLAA 5HFAA 4CIDA 4ZVPA 1KHTA 4ILKA 2WUEA 1KAHA 3D7LA 4EF6A 5FEMA 3NGLA 3JR7A 3TSYA 5DNAA 3NRJA 1HNWB 3R5FA 1G3UA 3QX8A 4IMIB 5AVSA 4C4AA 1B2LA 1TM4E 3WRYA 2V1UA 5LXTA 1OWMA 2D0OB 4D8YA 3PFFA 3TGPA 2GFIA 4H7HA 1SVNA 1FLNA 4FMPA 1R37A 4TKMA 1RVDA 4AO8A 2AWOA 2FHSA 1TEXA 4JWKA 2ZIXA 1PK8A 5BSRA 1EVJA 5JZVA 2D5CA 2NWQA 1A1VA 1JDVA 2YXNA 4CVNA 4G5QA 4I1UA 4CTJA 3DWFA 3R3VA 3IURA 2ZRKA 1NY6A 4DCJA 2FETA 3B6MA 4LRTB 1KQGA 1R0YA 2WNSA 3AOEA 3K9HA 3WISA 3NIBA 3O3MB 4RKEA 1YHNA 1C0LA 3EZ9A 3DOFA 1I1HA 1L6RA 1NATA 2QRUA 4B3IA 1GPKA 5L3SB 3D2BA 4N1AA 3SS8A 1DDIA 5PGMA 1S2GA 3LHKA 4PWYA 3I2KA 4JMPA 3LVFO 4F84A 3BFKA 4GQIA 4MV6A 2AXEA 3IBCA 4JBIA 1U1GA 1UL1X 4V02A 1E64A 2GLTA 2V7GA 1V8PA 1NKSA 3DW3X 2HPZA 3PHGA 3K5IA 4LMAA 5TEWA 1U4NA 4I1PA 4P34A 1EINA 1WM1A 1SCBA 4OXXA 2X2EA 3THRA 1FIUA 4F8YA 3HLTA 3A36A 3M0EA 3S8MA 4NCAA 2V4MA 3HSKA 3IR6A 2BGKA 5AM2A 3LUPA 2PTHA 4L0QA 1F3OA 5JARA 4FWBA 3VO9A 4OGFA 4QJBA 1B00A 3GCZA 5CA0F 1CF9A 3JQ7A 1UDXA 1QV6A 2YQ4A 3FFTA 3HXMA 2M6SA 4B4UA 2WUGA 1U8EA 2F8MA 2AZ4A 1N92A 4CT5A 2GZRA 2HJHA 2WICA 4JQSA 3FF1A 4TLEA 3MJDA 1M34A 1M2VB 2WJ4A 4WLUA 4EJ2A 3ZVLA 5EEGA 1VCHA 4IEIA 5KJ1A 3PGXA 3TSCA 4EM6A 4CM1A 1U2PA 4FEYA 2XB4A 5BVGA 3K0FA 4GYKA 1R6UA 3RYIA 4WXRA 4ICIA 2PH5A 1TVMA 4OKNA 4PG7A 3RRJA 1UPFA 5A3QA 1LTQA 3PYMA 1CUYA 3T3GA 4B9EA 5AKEA 3O9ZA 4UE6A 3F9IA 4KQGA 2NACA 3PQ2A 2JFFA 3DLPX 5KCMA 3G8BA 4Z9XA 4KXUA 3IQXA 3R2JA 2OQ2A 3DV0A 3X44A 2BMFA 4MAFA 5K01A 2CHGA 1SXHA 5IXJA 2HA0A 1Q0ZA 4PYRA 2W37A 3B6EA 4PYJA 4Y2QA 2CSXA 5B1DA 4K1XA 3ZQ6A 3HABA 4KXFB 1L7AA 3IALA 1CRPA 2OB1A 3DBLA 3EXEB 4BEWA 4RDXA 3AUTA 4CIVA 3L02A 1WSWA 1V43A 2DHCA 3OI7A 4BNHA 4DDTA 4EI7A 3V7UA 3LLSA 4A8JB 1CEYA 1HKHA 1RI1A 4N5IX 4OHPA 3SI7A 2BZ1A 3P9ZA 3IVGA 4UTOA 2H29A 4YXWD 1E1CA 5FNVA 3GXBA 3N75A 3H3JA 1HMPA 1OD6A 3PLRA 4ZEXA 4ALIA 4BMDA 2DAPA 4RNCA 4J0FA 1R0LA 3D4OA 1VHTA 1WXWA 1FDRA 3FHTA 1LJUA 2QTFA 3WGOA 4WVFA 5BQOA 2EF1A 4J1TC 5CDTA 5JUWA 4CCYB 1CEEA 5D51S 1KFEB 3ECSA 4KQFA 1GNSA 1QYWA 1WMDA 2BIFA 2XNKA 3L7NA 4Y9DA 1BW9A 5HOEA 3LF2A 2HDWA 4HGQA 2O8VA 3K0AB 2QL9A 3AM5A 4UE3S 5JFGA 4PAOA 1U5CA 2CKMA 4HXEB 4ENRA 3GNTA 3IT0A 2IIPA 3MBOA 3R6LA 2ZJ8A 4JT2A 4MV9A 3SMVA 2Y1CA 1SEPA 4XYBA 4Q39A 2EBWA 1AKTA 3VR5H 2ISSD 1YR1A 5FQNA 2VCYA 2Z4RA 3C3WA 3M34A 3OJCA 4G1VA 1NGSA 4I7EA 4MI9A 4REMA 5DM0A 3RRBA 2N42A 1S3IA 2JKYA 1U63A 5BT9A 2AX3A 3FOAA 4LHZA 1UFRA 4MQ5A 3CZAA 3GAMA 5DSXA 1Z12A 3G0GA 4JS0A 4RJKA 2QRQA 4LW8A 4JQCA 2V8BA 4NQRA 4RFSB 1SEVA 4JYZA 3LX4A 4RSHA 2QZ9A 5ES3A 3GNQA 1M5TA 1MB2A 2E4WA 3L0DA 4W6QA 1CZKA 1I0LA 1DQZA 3G0OA 2I2BA 4LQLA 2X2OA 3AI1A 4FKZA 4HUQB 5DM60 4HDQB 4EY6A 2OCKA 2HD4A 2CNOA 3GDOA 4QD3A 4EH1A 3MWJA 1MUUA 2WHPA 2B92A 1M66A 5A6VA 1II0A 3CWZA 2ZR8A 3IP1A 3L7BA 3Q1KA 4O4LB 1X15A 4Q3DA 1GGNA 4WLFA 1OLXB 4W5WA 1GGJA 3FAZA 2I0FA 4UOEA 4YUYA 3EPHA 2LCFA 5JAHA 2VJBA 4ZCLA 4CF3A 2R5WA 3F5MA 3C6QA 3EQ7A 2AK2A 2FPMA 1LEHA 1YS7A 4GKBA 1V7CA 5ICMA 2B6HA 4N3BA 4OG2A 5GQSA 4BDSA 5I7OA 2ZB8A 3ESZA 3FCCA 1QGAA 4JX9A 3E4CA 3FRJA 4GF5A 1ZM7A 2GXQA 1S5PA 2REQB 4DLWA 4XEUA 2XWJI 1JQDA 3BJMA 2LKDA 3CH5A 3T5CA 2ID8A 4YCMA 4QUEA 3BYZA 4UDYX 3WK7A 1KMHA 2WYIA 3N6VA 4PNZA 4OCZA 4NP6A 4K81B 1V4VA 3OWHA 1LD3A 2IYPA 2YVUA 1X1TA 3QNMA 2C7VA 2QLNA 1RAFA 4ACBA 3G2IA 1NF9A 4X1YA 2HRDA 4RQTA 2QRKA 3BCHA 2CUTA 1II9A 3L8FA 2XYVA 2DUWA 3F8WA 2WJYA 2R00A 1CJBA 3EC7A 2AEEA 2WKRA 4FE7A 3P0HA 4IZ6A 3EPKA 3K7EA 2RHMA 2DPGA 1SBZA 2Z2YA 4F8EA 3AVXA 3CCCA 1ZISA 3H5AA 5DGIA 2PKEA 5I7AA 1SXJB 4Y7CA 1DIAA 2R96A 1SELA 2PANA 3B1FA 3FKQA 2NUTA 4KHZA 4X8LA 3RQIA 4UAJA 5LZ8A 2WWHA 4FILA 5ARCA 1ZCAA 4QLBA 1Z8DA 3HFGA 3T5MA 1EG2A 1DSSG 2WM9B 1DQPA 1FTNA 1XN4A 2IU3A 1C9KA 3AR2A 4UQPA 1OFIA 5KNDA 3F8TA 3R1IA 2X0IA 3U4QA 1CQJA 2EF0A 2ZYHA 5ALDA 5CP8A 2D1RA 2W83A 4JVLA 3I6BA 5JW6A 2D0DA 2PKXA 2QGZA 2ZAYA 3C41J 3MT9A 4JJ7A 5F5NA 5C80A 4KSBA 1GHTA 1UPTA 5B57C 4DUZB 3ZGNA 1B8OA 2OM6A 3INGA 2F2TA 3DT6A 1TCCA 3BL8A 1X42A 3PPIA 1CKEA 3GA5A 3JVIA 4UHCA 2W48A 5TR9A 2P30A 4S1NA 3ADOA 5FPKA 1KEZA 1ACLA 2ERCA 2YHBA 1AN0A 1XLWA 4KGVA 3C0KA 2IIBA 4D3ZA 3DMYA 2WWGA 4EGQA 4KRGA 1SQGA 4DVJA 4L6CA 3LAWA 4C03A 5JXGA 2Q9CA 4UNSA 1PV2A 2CD7A 1IULA 3JASB 2OCIA 1UQUA 1H6AA 5U1PA 2Z6UA 1JHZA 2XMDA 3TZKA 1E6LA 4OU4A 2VXOA 4I5FA 2QP4A 2O7RA 4EUKA 2QLLA 1U2RA 1OZGA 4KOAA 2QY9A 1XCMA 3LC2O 3FVRA 3DMRA 2P11A 1QRAA 3IV9A 1I79B 2KWIA 5AOVA 3QHQA 3MCVA 4GSKA 3FPKA 3HR7A 2II6A 4QUDA 4OU5A 1XA4A 4QUGA 2Z2IA 3KFLA 4LC9A 3W34A 1VGQA 2VHUA 1NVWQ 1TLFA 4HGRA 4UPDA 1LSOA 4ESEA 4JXZA 2GJ8A 4EY5A 1WBJB 2C3PA 1TZBA 1W34A 2OHFA 2ZE5A 2P5SA 4GSYA 4ROSA 4BFWA 5ADWA 1SCJA 2LBPA 2PU7A 3LPCA 1ODTC 3MFYA 1IRIA 1W2WB 3MNFA 1SOUA 4UUBA 3CPJB 2ZB2A 3FFWA 1EBBA 5T5QA 4WASA 4JLAA 5FOUA 3MCZA 4LWZA 5AKJA 3NKFA 4CQMB 5JZMA 5J5VA 3U44A 3L77A 4G0NA 1O96A 4UCXA 1XXHB 1IUNA 1MAUA 2ZBUA 3IH5A 1CR2A 3BFJA 5IT0A 5GADl 4O4IB 5EHIA 3MS2A 3P2IA 2OD9A 2OCGA 2G17A 1XNJA 4Y2JA 1EVKA 2VAWA 4EELA 2NXWA 3MXOA 2EFEB 3S8YA 5JSQA 1WJGA 3C7TA 5ITVA 3BGWA 4QDZA 4TSFD 4BJ6A 3RADC 2YVLA 3L8MA 4MR7A 5DCLA 2YZ2A 1EDZA 1QC5B 1S9HA 2YXBA 3GWZA 4RAOA 4CODB 1YVPA 1MAAA 4TKUA 4DGSA 3W6ZA 4CDRA 3TQHA 3OZDA 1KJ9A 1G98A 1JALA 4NV1A 3A8TA 2QM3A 2OE2A 3ST7A 2VSXA 4TT3A 2B99A 4N39A 4GR9A 1RHJA 5FTNA 4A2CA 1UKCA 1NULA 4DLTA 1H2RS 2FTKE 1DEKA 2OO3A 5ICEA 2GN8A 4LY9A 2GCOB 4NZZA 1IG3A 5EAIA 1UAGA 1WUIS 3ROFA 3ZHUA 3N74A 1OI2A 4DR5B 4FNAA 1PNVA 1NP7A 2X6RA 2D5LA 2Q7DA 1RXWA 2Q41A 4K9SA 2QPTA 5AK4A 5K8CA 5TQJA 1NQOA 4AJPA 3RFUA 1GZ5A 3HJTA 1UKBA 4GOLD 1W1WA 1E6EA 1T2UA 4UBLA 1IEQA 2Q5FA 2C94A 3HBMA 1Y5NA 3OAAA 5JECA 4LRSB 3DUFA 3L18A 2PVCA 5EWLB 2NV2B 4BEJA 4QOIA 4WTOA 4K2HA 2JGIA 1OBCA 1GNLA 4RYDA 5CRIA 3ZBUA 4ECAA 1TCBA 2C0CA 1ESEA 3BXOA 5MDHA 1F4PA 3QYJA 1YAHA 3DVSX 2YOFA 3KLBA 3P97A 3WX0A 2NTNA 3BK1A 3BXHA 1T9GS 4LJAA 3D5TA 121PA 2B1RA 1TC2A 1RTTA 1T5IA 2WM8A 2WUDA 4Q4HB 1JDBC 1O57A 4IEFB 3ELYA 3OZVA 1XDSA 4OP1A 1GRCA 1GZSA 3RS3A 2ZVPX 3GZ4A 3V4FA 1JDUA 1EM8B 2C3YA 3KU1A 3PHHA 4JVMA 4M86A 1C9NA 5CVUA 3SS9X 3UN1A 2ZWOA 2AEJA 3I73A 5HIKA 1JQ3A 2G9VA 4RPLA 1T4CB 4JYAB 1A50B 2QG4A 4GQBA 3QRWA 2HBZA 2P2ZA 4U8HA 2CFSA 4QUAA 4D96A 3CF0A 3WKEA 4EFLA 3V1UA 3RYCB 2B4QA 3H17A 3UAYA 5C8YB 2AJCA 5CM9C 5C7IO 1E1CB 2CXNA 1FNCA 1UBJS 3QWAA 4ON9A 5DLPA 3EE6A 5FNVB 3OBIA 2P2CA 2XSZA 3U2QA 3MPOA 4TQ9A 3C5WP 4LNUB 3ZDCA 2IKSA 3MWDA 3OZUA 3U7JA 3IDAA 1RQPA 1V5EA 1UJNA 3MUOA 1ZCJA 2IEAA 4N0PA 2AH5A 5LDDC 1P4SA 4DV2B 3EFBA 4GXTA 4DAOA 1F1JA 1GCGA 1RWNA 4BWGA 1BX0A 3CLUD 3SYNA 5IWCA 4F92B 2AJDA 4ZCRA 1AS0A 3U9SA 2G9ZA 4BQEA 3ZK9A 1JNYA 4RBNA 3HFSA 5AIAA 5J5CA 1VKOA 4Q02A 1M6HA 1AURA 2EAUA 1H1DA 4BHTA 2OESA 2Q6KA 1XDWA 2NO6A 1U11A 4FT2A 3RBAA 2AN9A 2PT5A 3HVKA 2NO4A 2ZBPA 4N3NA 2YXDA 4OUDB 2GAIA 4DRXB 4PIVA 2CW5A 4FT4A 4OF4A 2BE7A 2COKA 3T3IA 2VBCA 4MIKA 3WGTA 5BYBA 3ZEAA 4K6OA 3H5WA 3ILSA 3S29A 3CLUC 5EQFA 4MVJI 2GVNA 2BKEA 5HX7A 1VXOA 4Z0HO 4QHSA 2FKAA 1NVAA 3K71B 1DXOA 2PUTA 4C4OA 4HT3B 2UYHA 2POCA 4PPQA 4EZBA 5TT0A 3UT5B 2K5UA 5BSMA 2I8LA 2GARA 1AMNA 1YCHA 2D3TA 2VDWA 3A3YA 5KKCA 4EW3A 3NVKI 3NWBA 1BMTA 3PXGA 2FF5A 4MYHA 2OFFA 3C3XA 3SNKA 4CG1A 3EQ9A 4Y3UA 1MVOA 4HQ0A 5CD1A 3HCDA 3OU2A 2QUKA 1JIJA 1YA8A 1Q1EA 2MSDB 4GVPA 2H1CA 2C99A 4C9BA 4I46A 1SQ6A 2VJLA 2ZVQX 3X1ZA 4D1YA 4G5SA 4H1WA 1JIXA 1BOFA 2FUNB 1GLNA 2OCLA 2VBGA 3GELA 3OTOB 2RJOA 3JQ6A 2CB9A 5ITZA 5IS2A 4FLEA 1HYBA 2UYYA 4H1UA 1ZM4A 3L8ZA 3HMQA 4CLRA 1P2GA 4V0RA 2Y2UA 4W4TA 4URWR 4JZYA 1DKQA 2AZTA 2FE1A 5FPSA 3O4HA 5ILGA 1KS2A 1CY8A 2BAGA 3A1FA 3C5VA 4I3GA 2PJZA 1DAMA 4K9OA 3CO5A 5KSYA 4RULA 1EVIA 3TOCA 3UA4A 4BS9A 2WQ7A 3WIUA 1L9XA 4IH1A 2H5JA 1VHJA 1CJSA 2ZJYA 3FUWA 2ZVDA 3LNCA 5DN6D 2Q29A 3L6DA 4ZTZB 2GCIA 3CLKA 3SEZA 2XSZD 4TVSA 3GVHA 3OIVA 1YU6A 1Q0SA 5J40A 3EMBA 3L4SO 3K5WA 3V7FA 1NM5C 2XJ9A 3USCS 5T8KA 1G8YA 1V39A 1LC0A 1GZ4A 3EVFA 1WKBA 2F9FA 4ILEA 2F3QA 2HUPA 3OX3A 1ZXBA 4YJFB 1FYDA 1ABEA 10MHA 1ID8A 1YBHA 3TL2A 2GUGA 3H9JA 5E0KB 1RE1A 2NUBA 4BDTA 3FTFA 1TEVA 4PRYA 2W11A 3QXHA 1YI1A 1JTFA 4BGDA 5ALZA 4BFXA 4RVNA 2ILVA 3MGGA 4OHXA 5FF9A 1UCFA 4DFDA 1E60A 3TKLA 5E3JA 1EIWA 1LDNA