4DPKA

Structure of malonyl-coenzyme a reductase from crenarchaeota
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
354
structure length
354
Chain Sequence
RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
molecule keywords Malonyl-CoA/succinyl-CoA reductase
total genus 122
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dpkA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dpkA01
4S1VA 2OUIA 4XQ9A 3R3JA 2HMVA 1Y9AA 4HWKA 1YBAA 3LSYA 3GK3A 4GL4A 1U3TA 1X13A 5KVVA 4FFRA 4WLFA 5JAQA 3H2ZA 3DXFA 4R3NA 2EG9A 3KHUA 3PRJA 2C7VA 1LTHR 4HFNA 5L45A 5BSGA 3FR7A 1PS0A 4L74A 1B26A 4DPMA 2VZ0A 1R0LA 1PJSA 3GVHA 5FI3A 3G1TA 4GSLA 2E82A 1OMOA 3JQBA 4R9RA 2G82A 2Q2WA 3ITKA 4A73A 2XXBA 4JBHA 4DL9A 4OMUA 1YQDA 5A9SB 3H9JA 4WEOA 3GMDA 3QJ5A 4Y8VA 1JWAB 2VRCA 4A10A 1E3SA 3EMKA 5B12A 1WAMA 3HG7A 2DBRA 4I5EA 3L77A 4Z9YA 4L4RA 3QV1A 1SC6A 1ONOA 1T2CA 1E7WA 4BS9A 2UYYA 3ZNPA 3ROKA 1OBFO 1D1SA 4M55A 4Q3CA 4IGFA 3V1YA 2G1UA 1BGVA 3EGOA 3FF4A 4WCDA 1ZMOA 2VWHA 2ZB8A 3C24A 5KVSA 1WMAA 4N54A 4WOJA 2CY0A 2HQ1A 1F06A 1LRLA 3QY9A 3KLPX 3PJDA 3QWBA 4G81A 4OSOA 1SZJG 4BNZA 3T7CA 1KERA 3K31A 4PLPA 2YV2A 2ZKLA 2Q99A 2Y93A 3WWZA 3A1NA 4U6QA 4CQLB 3ZV4A 1LDNA 3GPIA 3HB4X 3TRIA 4EITA 1X1EA 5F5LA 2X23A 3EUWA 3TZHA 1ISMA 5KJCA 2I3GA 1LA2A 1FDTA 2B69A 4BNNA 1C1XB 4ILKA 2W2LD 4N7RA 3GHYA 4XYEA 3WQQA 2C29D 2P5YA 4J90A 4WLUA 4FFNA 3VTFA 2Q22A 3F6YA 3WQSB 1C0KA 4FD3A 3AM3A 3SC6A 4RF3A 4JJIA 2JCXA 4DWVA 1PZGA 1ZEJA 4KUGA 1E92A 1PJTA 3KBOA 1ISHA 1C0LA 3LT1A 4XYLA 3IKVA 1V9LA 4N5MA 1KS9A 1MFPA 2SCUA 3PI7A 1FDWA 2O3QA 2ZK7A 5BSHA 5JO0A 5FI5A 1M67A 4HNGA 4CLEA 4FIZA 3DZIA 3VPSA 2JL1A 5F5NA 2NADA 3CTMA 3TFQA 4PLWA 2FSSA 1ZO8A 2QW8A 3L4BA 3MJ4A 4II2A 4WCFC 2E37A 4D46A 5EIOA 2HMUA 4TWRA 5AXBA 5IF3A 4BMVA 3UFXA 3D7LA 3ETDA 3HN2A 1OFGA 5FYDA 3VVCA 3RU7A 1GADO 5K6AC 3BAZA 3MJCA 1J6UA 2EW8A 4IM7A 4F3YA 3IUSA 4B4OA 4A7PA 4H3VA 1K5HA 2H1SA 4AVYA 3TL3A 4JCOA 3UN1A 1LC0A 4INAA 3D4OA 3RIHA 4UVGA 3RBXA 5I8ZA 3I6IA 5JDIC 4CQMB 2ZYDA 4B3IA 1UXKA 4QEDA 2Y67A 5JDIA 4BGIA 4J0FA 5AYVA 4PN3A 3DBLB 4PLYA 4WCFA 3C7AA 3JQ8A 1VJTA 3LLVA 4DLLA 4GPD1 3WB9A 3U0BA 5JY1A 1EQ2A 4OKNA 3DB2A 1DJQA 2EKLA 4IDAA 1B2LA 1OZAA 3E9NA 2R2GA 4ND1A 2HJSA 2ZIZA 1DJNA 4LW8A 4KTTE 2W98A 2DBVO 3ADOA 1P31A 2B4RO 3KRTA 1LLQA 1M66A 2AQIA 4QFDA 4TVBA 4ZRNA 3ZI0A 2NUAA 3UHAA 1MFZA 2AEJA 2WM3A 3ONDA 4YJFB 2AQHA 4R5MA 5L7YA 3S1LA 1MG0A 5U1PA 2FR1A 3U49A 3W8EA 1WZEA 1PSDA 4ESOA 5CPFA 5CP8A 5CPBA 3KEQA 3V8BA 4BNTA 4DUPA 1BSVA 4WE3A 3FNEA 4U8GA 1VL0A 3RKUA 4LSMA 1F14A 2DTEA 4HY3A 4PIVA 3ASUA 4UUPA 1U8FO 1C1DB 1I8TA 4QSMA 4CL8A 5B4VA 2HDHA 4OOEA 1FDUA 1GTMA 1BDMA 3DHEA 4LCJA 4YA6A 3PQDA 3Q3CA 1YH3A 2XPCA 1EK5A 3TWOA 2W2KB 4IIUA 5GMOA 5H82A 3ROPA 4Q3AA 2AW5A 4W9NC 1ZXBA 3AOEA 1HEUA 2V6MA 5G4KA 4KOAA 2BGMA 5A5EA 3BTOA 1SAYA 1P33A 1V8BA 1K89A 3DBHB 4DIOA 5BSEA 1M76A 2GN4A 8ADHA 2OL4A 3ZHZA 4NBRA 4FDAA 1IUKA 4PGFA 1UZNA 5I9NA 1E7YA 1G0NA 4LCEA 2Q3EA 2BELA 1EDZA 1U2GA 3H6KA 3LVFO 3JD2A 4PLVA 2IODA 2NU7A 2YHIA 3NYWA 3Q9NA 1MA0A 1TEHA 1MXFA 3CEAA 1E6WA 2VRCD 1WVGA 2OP0A 4WPGA 2DPGA 3WBBA 2VHZA 1G0OA 1WDKA 5DT9A 1EE2A 4CLOB 2IYPA 1UAYA 2Q4BA 1Q7GA 3W8FA 2R00C 3PFWO 3JYNA 4YVFA 4ZD6A 1XG5A 2JHGA 2VNSA 5B4UA 2DQ4A 1YVEI 2DAPA 2RCYA 4YCAA 4DQXA 3OA0A 1Z45A 1MLDA 4W7HA 3ZWOA 3RC2A 1N7GA 3P5SA 4WLVA 1ENYA 1BW9B 4WNCA 4DPLA 5C7IO 2HMWA 1DSSG 4B4UA 4CQLA 4OOFA 3ZWCA 5EINA 1WP4A 1KVSA 3KXDA 5IXSA 4FJ0A 5JPIA 2Q1SA 1A7KA 2Y68A 2PZLA 1O5IA 3LC7O 1WDMA 4E32A 3QWIA 2PZKA 4GWKA 4J2OA 1GFSA 4WJZA 3ON5A 4CR7A 4F6LA 3NTOA 1GQ2A 3SLKA 3GDFA 1VL8A 2GSDA 4KMSA 5L40A 3ZU2A 4CLDA 2DFVA 1V35A 3PHJA 1I5RA 5BNTA 3PPIA 4CMBA 4GGOA 3F9IA 2CDBA 3D5QA 4Q9NA 2PZJA 3UICA 1J0XO 2GN9A 2JKVA 3LT4A 1NX6A 1UP4A 4RGBA 1FF9A 1ULSA 1PZFA 2IZZA 1ZK4A 1PWXA 4R1NA 4FFOA 4ONEA 1ID1A 5TJHA 5JYEA 1WZIA 9LDBA 4BNKA 4RVSA 2GLXA 1HXHA 4OYRA 2PNFA 1ZMTA 1E3LA 2WE8A 1V3TA 4RO0A 4JN6B 2FZWA 1E5QA 3OH8A 3PYMA 1WPQA 3OIFA 3WGHA 3GNQA 2X9NA 1NP3A 3GVPA 4CM8A 1LUAA 2CVZA 1TA4A 3ONFA 3RASA 1YJ8A 4IMPA 1YRLA 4TSKA 3ETEA 3HFSA 4DMLA 1QYCA 3IP3A 2RH4A 4YBZA 5IFLA 1KYQA 3TOZA 3VPHA 3FI9A 2VTEA 5H81A 1W4ZA 1A71A 2UDPA 4AJNA 2NU6A 3TJRA 4F6CA 4YT5A 3TZKA 3L9XA 3UCFA 4ALLA 5ADHA 1I32A 4NBTA 2V7PA 3F1LA 2BGKA 4CMGA 5T6BA 3R1IA 1ADFA 1JW9B 4JP2A 4M86A 3DAFA 4E5NA 4LRTB 2I3AA 3DFZA 2BRUA 1JKFA 2X8LA 4XQGA 3A28A 3GG2A 2DFDA 1T26A 1NWHA 2YV1A 3SC4A 5AOVA 2PFGA 1NNUA 3ZWWA 1E1KA 2F1KA 4GWGA 4J2HA 3A9WA 1U3UA 3ASVA 2OGUA 3VC7A 5L7TA 4D3FA 3Q0EA 3E6AA 5L4SA 1E3EA 1U7TA 4MVJF 1GUFA 2WJPA 5ES3A 3SEFA 3OF2A 3KYBA 1KBZA 1NQTA 3ZWBA 3ZW9A 4XQCA 4IDCA 4IJKA 1YL7A 2VYNA 2D0IA 3T4EA 4NG5A 3RKRA 1ENZA 4MIEA 1Y8QA 4XB2A 2PZMA 2QG4A 3VOSA 3Q6IA 2XAAA 1UDCA 4E5PA 1BTOA 3BMOB 4D41A 3TSCA 2EF1A 2P2SA 4GX0A 1DIBA 3CSDA 5AXDA 3PGJA 2Y1OA 1PTJA 4ZVVA 1PJ4A 2FR8A 1UZMA 4K26A 2V6GA 3UVEA 1T2EA 5TIIA 4CMHA 3KETA 3JQDA 3QVXA 1ZSVA 3WX0A 1PR3A 3SJUA 1YBVA 3AY7A 4NBWA 3O38A 1X7HA 3TDKA 4O5OA 3WIEA 1LI4A 1NVTA 3PHHA 4HADA 2X0RA 4XGKA 1T1RA 4R1SA 5DCUA 2LDXA 2IXAA 1UUFA 2AEFA 4IJUA 3D4PA 4M1QA 2PGJA 2QRJA 3S2IA 5M6DA 1BW9A 2Y0EA 4UUNA 4DRYA 1X15A 4JLWA 3P2YA 4NQZA 3H9EO 2IZ0A 4RJTA 4IJVA 4J6FA 1YO6A 3TZQA 3LYLA 2G17A 3RVDA 1ZUD1 2IZ1A 4ZQEA 3T4XA 4OXKA 4IBOA 2GZ3A 4XIYA 4DTIA 4HV4A 1QORA 3QLJA 1L7EA 2JFHA 1RYDA 1NQOA 3OHSX 2Y1EA 1ZSYA 4X54A 3WDSA 3EZYA 4DMMA 2Y66A 4EEZA 1GYQA 2Z1NA 1R6DA 5CDUA 3EAGA 3VKVA 1RM4A 4RPKA 4CMAA 4HKTA 4ITUA 1XA0A 3DMTC 4ZN6A 4UVEA 5HA5A 1JKIA 3NT5A 2GUGA 4R3WA 3RFTA 3X2EA 3EVNA 1SNYA 4CMJA 1PS8A 1RWBA 2QX7A 4EUEA 1BXKA 4ALJA 1DXYA 3TF5A 4MP6A 3UXYA 5JXWA 4XGIA 4D7AA 3Q2KA 1I3NA 1I2CA 1UDBA 2X0IA 4B79A 2Q1TA 1ZW1A 5ER6A 1GAEO 1XQ1A 2EXXA 1DIGA 4OXNA 1EEHA 2VZ8A 3KSZO 1ORRA 3GDOA 1XLTA 3JQ7A 4KZPA 5A3VA 4PRLA 4W82A 4E0BA 1PQPA 4D3DA 5AVOA 1AE1A 5L7WA 4PFJA 4XA8A 5EESA 5KVQA 1V0JA 4FJ1A 1GYRA 1NFQA 2BF7A 1N5DA 1P3DA 2CNBA 3RJ5A 1AHHA 1DB3A 3HE3A 1JDJA 4HXYA 5HRUA 2D59A 4ZQFA 4R41A 3JYQA 4M49A 3ULKA 3WGGA 1LSJA 2YQ5A 4CM9A 4XYGA 1OAAA 3ZDFA 1C0IA 3DZJA 3GVIA 3K92A 4XB1A 3GAZA 1HDRA 1DC4A 3CXRA 5TF4A 4CR6A 1Q7BA 4DBZA 4J49A 3MWEB 3BHIA 3WSWA 2QZ9A 2DPHA 1CYDA 4L73A 4IZIA 4UULA 4BKUA 3ZN2A 1KEWA 2IEDA 3SJ7A 4BIIA 2C0CA 4CJXA 1CDOA 1KEUA 3I3OA 3HZZA 4NI5A 1P1RA 3H9UA 3H5RA 5F21A 3NDIA 5TS3A 5JNLA 4J0EA 1S6YA 3FN4A 4XRGA 1M75A 4O59O 2O2SA 3AM4A 3OETA 5DULA 2EGHA 3SVTA 2BMAA 2X0NA 3PZRA 2B37A 3UH1A 2E4AA 5T73A 1CETA 3JQ8B 1HE4A 5CHEA 1DPGA 2FP4A 4IXWA 3HHPA 2IE0A 4LN1A 5HBRA 4IS2A 3TOXA 2J5QA 1LC3A 4RF2A 1A7AA 4ND3A 3WS7A 1ZKMA 4QT0A 4TKMA 3WYEA 3ZV6A 3NUGA 4CQMA 2FWMX 2X9VA 5DP2A 2Q1WA 4AJKA 1UXJA 4GH5A 5CDYA 4OAQA 3S2FA 1Z7BA 5JMWA 4YEDA 1T24A 4XGNA 3EHEA 5L4LA 4HP8A 2NTNA 3ZWYA 2UUOA 4JIGA 1HE5A 2WTBA 1Q0QA 3INTA 2DLDA 2BD0A 1HDYA 4OQYA 4E21A 2VWPA 4RDIA 2DC1A 1PQUA 2O4CA 1N8KA 2ZQZA 2GNAA 4NFSA 3DONA 3PIIA 4BKOA 3ZNQA 3LU1A 2FRDA 4NIMA 1GQQA 4CODB 4JGBA 3FD8A 2J6IA 4MIYA 4BKPA 2NSDA 2YY7A 2JD1A 2PR2A 4UEJA 1O0SA 1HRDA 4BNVA 1EFKA 4YRAA 2JCVA 2AHRA 3CINA 4RQTA 1MC4A 2Y1CA 4N5NA 4NZ9A 1ZZEA 4URFA 1LU9A 2P9CA 4I8XA 4L0QA 1KVTA 3M1AA 5U4QA 3AUUA 3I6QA 4AJIA 4J1TA 4GMGA 3V1TC 2Q2QA 3HDQA 1R4MA 2NU8A 3JD4A 3H8VA 3PJFA 1Y7TA 4IQ8A 4UEKA 3ZGYA 3PWKA 3WGIA 1JA9A 4BMNA 1LQTA 3E9MA 1XU9A 3ICPA 3UOGA 1BDBA 1P1HA 2XOXA 4R4JA 3L9WA 2IDZA 4W9NA 3QWHA 1YS4A 1CJCA 3R6DA 5B37A 3R3SA 5GZ1A 1LEHA 1LQUA 1SPXA 2PGLA 2Y99A 3PXXA 1G6KA 1AGNA 2FPIA 2GN6A 4JJFA 4U0KA 5TC4A 5JS6A 5KKCA 1IB6A 1PJ2A 4Z0TA 3P2OA 3K8ZA 1RM5A 5K6AA 4I5FA 1WNTA 1XR3A 2RIRA 3I52A 3KB6A 1ISGA 4RVFA 4PZDA 3JTMA 3OQBA 4H15A 2EKQA 5A05A 3CMCO 1Z6ZA 1PZEA 3I4FA 2B0JA 1SEVA 2UUPA 3E03A 2EJVA 3FCOA 3WGZA 4A0SA 3M1LA 3WLEA 2DUUA 1PR9A 2WD8A 6LDHA 2DTDA 4K6CA 3E1KA 2CF5A 2GD1O 2DBZA 3GNSA 3PJEA 4OM8A 2NVUA 1HZJA 3KOUA 2WYWA 2QYSA 2AXQA 2J3KA 4E33A 1HKUA 1I36A 2F00A 2V6BA 1NBOA 1AN9A 2Y1FA 3C85A 1M6HA 1LRJA 3G79A 3CKYA 4H7PA 4N18A 4Z9FA 4CUKA 2NM0A 2AE2A 5C7OO 1MXHA 5B4TA 4MVJG 5BSFA 4CPDA 5FEUA 3AI3A 1I3MA 5A02A 3V2UA 1QXSA 1N1GA 3O8QA 4CM1A 2PK3A 1HF3A 5A9TA 3S2EA 1A4UA 3AI2A 4XJTA 1PGPA 2C82A 4XYMA 4YJHB 2BFAA 1BVUA 3ROMA 1OC4A 1R4NA 3GVXA 1K6XA 5B1YA 5A4DA 1P0FA 1NQ5A 2POQX 1UXGA 2PD3A 2AQ8A 2HJRA 3KV3O 5BR7A 4RQUA 1IPEA 4CMIA 3IJPA 4O0LA 2ZJ1A 2C54A 4PG4A 5DBGA 4P4NA 1PL6A 4JX8A 1B3RA 2D5CA 3UCEA 3RQSA 3PFFA 4ND5A 5ITWA 1W73A 1VRWA 5ILGA 2WD7A 3FPLA 3B20A 1I01A 2H5LA 4XKJA 1Y6JA 4MVJD 4GBJA 3AM5A 4HNHA 4OKIA 2B83A 4FW8A 4NBUA 2C5EA 8LDHA 3PYXA 4TRJA 3Q1LA 1UR5A 3EY4A 3ST7A 3WTBA 2O50A 1ZEMA 3SX2A 4OJNA 3D1LA 1A5ZA 3G49A 4MO2A 2VRBA 5HM8A 1WLYA 1XKQA 4L9RA 3GEDA 3D64A 4WEQA 3JQGB 2BH9A 1PEDA 2DVMA 4KTVE 3PDUA 5EPOA 5TGDA 5TSDA 4P38A 1C14A 3OQ1A 1KY5A 3U9LA 5KKAA 1EK6A 3DOJA 3QWAA 4Y9DA 3RU9A 4IDDA 2DT5A 4AJLA 4AJOA 1T1SA 4LVCA 3GMSA 4BO8A 1I2BA 1GPDG 4RVHA 3CMMA 3JD3A 3H65A 1QSGA 2Y1GA 2YFHA 3JCZA 3LT2A 3U62A 3AFMA 4TKLA 5ER9A 2GPTA 4GKVA 4NFHA 1ZBQA 3DO5A 1K0UA 4YYZA 5LDHA 1NR7A 4GX2A 1M6WA 2A4KA 3WGTA 3MJVA 1HDXA 4YACA 5I9LA 4K28A 1LBEA 5EMHA 5JCJD 3EVTA 4UVIA 4WLOA 1KOLA 1F8FA 1S7CA 5I7SA 3L6EA 2VZ9A 5A9RA 4J1QA 1V6AA 5DN9A 4YRBA 3OM9A 1KIFA 5HWSA 2VUTA 3BMOA 4PVCA 3O4RA 1P0CA 3DFUA 3HN7A 3KTDA 3AWDA 2AEMA 1I3LA 4FSHA 5G0WA 1DLJA 2B4TO 3OBBA 1T2DA 3UF0A 1Z75A 3DR3A 3IOYA 2XF8A 4B8WA 1C3VA 1U1IA 2NWQA 3CE6A 2O48X 1X14A 1TB4A 1R37A 1Y81A 3N58A 4NU6A 4TRRA 2YDXA 3QP9A 3VZRA 4BNGA 2GERA 1SB8A 3U4CA 4BL5A 5KIAA 2VUSA 4NHEA 4E2YA 4FC7A 5TT0A 3KYCA 3GT0A 3DQPA 3QVWA 4CMEC 4YAIA 2YYYA 3ENNA 3FTNA 3RUIA 4XDYA 2B4QA 3DEYX 3DWFA 5I7VA 3NT2A 7MDHA 3GZNB 3DHYA 5JCXA 4BO7A 2HMTA 2CZCA 3GY0A 3JQBC 2CFCA 3L0DA 3QSGA 1TVEA 1QV6A 1DAOA 1CF2O 4QUKA 3V2HA 1B8UA 4CM6A 3DL2A 2ET6A 4AJHA 4R1UA 1B15A 1DIRA 5JAMA 1NFFA 3ITDA 1WWKA 4XQEA 4Q3EA 3WXBA 1LRKA 1BXGA 1E1NA 2X9GA 5IXYA 4DA9A 1EBFA 4CM8B 1R66A 3JD0A 1K6IA 4R01A 2JD0A 2EP5A 3FPCA 1IPFA 4YAEA 3L6DA 4I9UA 1KVUA 3KEOA 2I76A 1E0DA 1TI7A 3INGA 5TQVA 3ZWMA 3GF4A 1E7RA 2PTGA 3JYPA 4KUEA 3OEWA 3GGPA 1DFIA 4CV3A 4XX0A 4DLBA 4R5HA 2RBEA 4YJGB 3V1UA 4CMKA 1EZ4A 1D1TA 4D43A 1Y5MA 3EC7A 5KCZA 3EYWA 1O95A 5F3RA 3GUYA 3DBRB 5DOZA 4D42A 4Q3NA 5BNIA 2BI8A 2CVOA 4YT4A 3LT0A 4Q3DA 2QYTA 4JP3A 4OXYA 1BRMA 5ICMA 4M87A 3AW9A 3DOOA 4KP7A 5JO9A 4W4TA 3LC2O 2ZCVA 5ICSA 2BFMA 2NACA 1MG5A 5AXCA 2ZTUA 3RAJA 1JTVA 5JMPA 3FNHA 2R00A 1GDHA 1TLTA 4MP3A 1GCOA 3H5AA 4GX5A 5DOVA 4BNMA 1ADCA 2ZB7A 1VKOA 3QVOA 4CL3A 4DLAA 4AG3A 3D3EA 5JC1A 2PV7A 2JFFA 3AUSA 2WMDA 2BI7A 3VKUA 1XGKA 1H2HA 2DBQA 5AQ1A 4MVJI 2FOIA 2XXJA 4A2CA 1EE9A 1NASA 2JFGA 4RLSA 1GV0A 2JAHA 1VE9A 3F46A 2EGGA 4C4OA 3IDSA 2Z1MA 4WOKA 3CUKA 4QTZA 5JYAA 5FF9A 1HDCA 4FC6A 1I33A 4LGVA 3WGYA 1B3BA 1HZZA 4I9NA 1ZXLA 3GGGA 3WFJA 2Z5LA 2NU9A 1EMDA 4CM3A 3K73O 1MV8A 2YHIB 1T2AA 3DTYA 4AICA 3OJ0A 5G2OA 1PJCA 4RPGA 2EHDA 3ROQA 3ENKA 4HFMA 4IQ0A 4AFNA 2E6UX 3WFIA 2VYND 5KJFA 3PTZA 2EEZA 1PQWA 1YB5A 3PDJA 2A35A 4PLGA 3DBHA 5JAIA 1DAPA 4Z9XA 3WLFA 4E31A 1GUZA 2O3RA 2ZTLA 5CDSA 3IUPA 2GASA 4YJHA 4FR5A 4IDBA 3LK7A 4XDZA 1YL6A 3BMQB 1H9AA 3AY3A 3PVZA 4YQZA 5DNAA 4Z3KA 3U5TA 3GN1A 4CLRB 3OJLA 1U4SA 3WGOA 1T2FA 1VL6A 5MGBA 3WTCA 1ARZA 2X5OA 3GAFA 1PJBA 4DC0A 4BNIA 4KUHA 4OQZA 4ZICA 3KM0A 4NFYA 3VZPA 1NHWA 2ZATA 3OSUA 1JQBA 3ZV5A 4RVUA 5K0ZA 4S3MA 1P44A 4IIVA 2EJWA 2QIOA 1HYEA 2NLOA 2VCYA 4L76A 3WSVA 4BNFA 1DIHA 1JAXA 1Z7EA 4FGSA 3SBOA 3RUEA 4TRMA 4NJMB 1PJ3A 2ZTMA 1LDGA 1XIVA 3GFBA 1UP6A 3B1KA 3ICCA 4YJGA 5IDWA 3AJRA 2YUTA 4BKRA 2RH8A 2B36A 4TZTA 3K2EA 3PQEA 2VOEA 1QG6A 4LISA 4ZQHA 3HQ4O 3VZQA 5CG2A 1XWFA 5CEEA 3BTUA 3GC6A 4BKQA 3CZMA 3QVSA 4IPTA 4RZHA 2O7SA 1YOVA 1Q1NA 2EW2A 4II3A 4DGSA 1P1FA 4J3FA 1JVBA 2Q46A 3RUCA 3ZWNA 1SCUA 2X1HA 1H0KA 3WG9A 4DQVA 1BXGB 2Z95A 3NRCA 4KQXA 4BO6A 3RCBA 1AXEA 3JYLA 4UUOA 2BHLA 4C7KA 1NAIA 1SEPA 2VN8A 3D0OA 3I83A 2I67A 1K3TA 4BB6A 1VKNA 3IP1A 2WD7B 3WR5A 1R15A 2WE7A 3GG9A 2I6TA 2X0JA 3E9QA 3RUAA 2J3HA 2QQ5A 5F1OA 3ZWAA 1N7HA 4UVDA 1DRWA 1R12A 2O23A 1PX0A 2PKQO 1E5LA 1Q7CA 4KWHA 5THKA 5TT1A 4L8VA 5T8KC 1GL3A 3GOHA 4DIBA 4PG5A 3UKOA 1U28A 1ONPA 1QV7A 1YKFA 4IMRA 2OBYA 1JAYA 1VJ1A 2Q4EA 1UDAA 1KEPA 6ADHA 4LSWA 5T67A 4FGWA 2O4UX 2YV3A 3DBVO 4J9VA 3VH3A 2PD4A 1JVSA 3JQAD 2P4HX 4NR0A 4FN4A 1DLIA 2FSVA 4E4YA 9LDTA 3VVBA 2WSBA 3E82A 1B14A 3RBVA 1EVJA 1IHYA 2FY8A 4EBFA 4LMPA 1RJWA 1A4IA 1DRVA 4IUYA 1ZK3A 3V5NA 4CM7A 4FFLA 5HTOA 2WDZA 2ZTVA 4XZ3A 5THQA 3WMWA 3AK4A 2CDCA 3QRWA 4EGFA 3N74A 4RLHA 4D0RA 1B7GO 1E1LA 3ORFA 3S2GA 3AOEC 1DOHA 4CM9D 2EIHA 1ISJA 1O6ZA 1E7MA 4WNIA 1I2ZA 4Y67A 3UUWA 3JV7A 4YDRA 1LSUA 2OFPA 1PU2A 2NTJA 5C37A 2I65A 3BMCA 4W99A 2P9EA 4ALKA 1NPTO 4BO0A 4YJFA 3GRKA 3STHA 1YOVB 1YJQA 2YW9A 4R69A 4EUFA 3GZ4A 3ZZNA 1H6CA 3NTRA 3BXXA 1DRUA 1ZFNA 1N92A 1E77A 3BA1A 3EK2A 1EDOA 1V3VA 1SO8A 3W4IA 4RVGA 4DVJA 2X86A 3VDQA 4FOOA 4MPDA 2HKIA 4P8RA 2JJYA 3AI1A 3ZV3A 4GQAA 2EV9A 4B3JA 2Q49A 4R68A 1QYXA 1P1IA 1DC3A 4YT8A 2QHXA 2FMUA 3UW3A 1JLLA 5JDCC 1AHIA 2P4QA 1EUZA 5KJ1A 3B6ZA 3GFGA 1EQUA 4IDGA 2DKNA 3T7EA 1B0AA 3SLGA 3W6UA 3R0IA 4AL4A 2BFOA 5JC8A 1GPJA 1JN0A 1HSOA 3GDGA 4JNKA 3NDJA 4YAGA 1ZK0A 4WUVA 7ADHA 3H5NA 4HFJA 1XYGA 3K30A 4CUZA 1E7QA 2I9PA 4GMFA 4ND2A 4BO1A 1Y8QB 1CQIA 2UVDA 3ZNNA 4MKRA 1P1KA 4XD2A 1B8PA 3GUCA 5AXAA 2C2YA 4A03A 3L6OO 1GY8A 3GHHA 3AFNA 2WWRA 4MIOA 3OP4A 3AU9A 4NNJA 1CWUA 1KVRA 5A1TA 1Z74A 4XJSA 1W8DA 3QW2A 3RROA 4GKBA 3GGOA 4K9DA 1OC2A 5A06A 3HWRA 1A72A 3WGQA 5T64A 3CZRA 5L53A 4PRKA 3DZBA 1ENPA 3C1OA 2ZCUA 3OMLA 1C1DA 4W7IA 4EZBA 3WYBA 2HMSA 3E8XA 4RORA 2B5WA 1N9GA 5JAZA 4R1TA 2NVBA 3I9NA 3Q11A 4P4LA 4F45A 4CM4A 1U9JA 2AMFA 1UZLA 4FJ2A 5I8WA 1WW8A 5T57A 3RBZA 4J4BA 2O7QA 4B4VA 3ANLA 2EERA 1H93A 3WJAA 1UAGA 2R6JA 1XCBA 3JSAA 2HRZA 1E3WB 5JSFA 4EYEA 2Q1UA 4D45A 4HUJA 3BZUA 1C1XA 3ONEA 3U4HA 2C20A 4UAGA 4EDFA 2GGSA 3PWSA 1A27A 2A92A 1YXMA 2HSDA 4ALNA 3OICA 4I9HA 2EP7A 3RC7A 4BUCA 3GH3A 1H6DA 4ALMA 3QWFA 5L9AA 3I1JA 1HTBA 1QRRA 1DC5A 1EBUA 4XYBA 3W6ZA 4U6SA 2O3UA 3EZLA 2O3SA 3WQRA 1KC3A 3DMTA 2OXIA 4E2WA 5DCWA 4N5LA 3OA2A 3LLSA 5DDIP 1A9ZA 3E5MA 3FBGA 4I5DA 1XHLA 3SXPA 3WJ7A 3ZW8A 1MX3A 2WEKA 3A06A 3QVTA 1X0VA 3FWZA 1GQYA 3DTTA 2GO1A 2VTDA 4FFPA 1U4OA 1EVZA 3ANMA 4PZEA 1HT0A 4RPHA 2HCTA 1WMBA 3LF1A 3M2PA 4A5OA 3RWBA 4CR8A 2VQ3A 3IKTA 5TRTA 1W6UA 4BO4A 1NVMB 2HUNA 3PYLA 2TMGA 4E6PA 3KVOA 3A4VA 4PLTA 2AG8A 4TROA 2OORA 2D4AA 3UGKA 3D3WA 4HFRA 2PD6A 4CLRA 3TPCA 2NVWA 2VUUA 5A9SA 3V2GA 2TMDA 3JQCA 1B8VA 4AJPA 1J5PA 2A94A 2VYVA 4GLLA 4XIJA 4B3HA 1X7DA 1D8AA 1H94A 1P77A 3G0OA 1YB1A 1T25A 2CVQA 3N7UA 4IDFA 4PLZA 2C7GA 1X0XA 1F17A 4FB5A 4GI2A 3W1VA 2IXBA 2W8ZA 4Y6PA 4XWYA 3MJSA 1SB9A 3ABIA 4BO5A 1MGOA 4J1NA 4J7UA 4JBIA 1Y9EA 4J91A 3AUTA 3MJTA 1BMDA 1YB4A 5FFFA 3AU8A 3F47A 1R0SA 3U3XA 3LZ6A 3CPSA 1XELA 2PGDA 1EUCA 3JQFA 3JQ9A 4ZGWA 1ISFA 1NPYA 1F12A 4EJ0A 4YWJA 2I5PO 4MJLA 4OGWA 1YDWA 3I9OA 4Y6RA 2Q50A 3PP8A 5GZ6A 4EJ6A 1D7OA 1JWBB 5L3ZA 2DM6A 2VOJA 2CDAA 2P5UA 1D4FA 5TLSA 5LCXA 3FHLA 4MDHA 2ZQYA 3RD5A 2PWZA 4BNWA 3KYCB 3O9ZA 4BNJA 2O2YA 5A3JA 4HX5A 4JJGA 4TZKA 1RM3A 3Q2IA 4E5YA 4D0SA 2OHXA 5ITVA 3A14A 2FHSA 3KLMX 3TQHA 4P22A 3FTPA 4RF4A 4YR9A 1GV1A 3M6IA 3VAZA 1DEHA 1Q0LA 2ILTA 5C5IA 5U9CA 1HE3A 3TN7A 3KSDO 3RFVA 5EERA 5F1PA 4QX6A 5LC1A 4O63O 4AJ2A 2PKRA 3HJAA 1PJQA 1VI2A 5IDYA 2HO5A 1U8XX 1QKIA 2RHCA 4O1MA 5G0UA 1KVQA 3P7MA 4J16A 3ZWVA 3GLQA 3PQFA 1QYVA 4BVAA 1BHSA 5F1KA 1ZIDA 1J4AA 4CMEA 4WASA 3KSUA 2GZ2A 4GVLA 1BWSA 2AE1A 3GR6A 4AJJA 5JYFA 1E6EA 1GZ6A 1CIVA 1MUUA 3QE3A 4GSKA 5A5FA 1IYZA 2AA3A 4MVJH 2ZB3A 3IAHA 3VPFA 4R16A 4NPCA 4QO8A 2AG5A 4EI2A 1HE2A 4NJOA 1Z82A 1ZVMA 3MZ0A 5IJZA 3JQ7B 3GA0A 1XSEA 4K6FA 4OIMA 1GZ4A 1KETA 4TQGA 4B4WA 1QLJA 2YJZA 3OFSA 4CV1A 3U4DA 1GCUA 2B5VA 4LRSB 2RHRA 4NMHA 3BIOA 3BHMA 4FQ8A 3H9GA 5G4LA 4L4SA 3L07A 1ZNQO 1ENOA 3H9QA 4XRRA 2YZ7A 4BNYA 1ZK2A 3B1JA 5CEJA 3JQAB 4U7WA 3HFGA 4MOWA 2JD2A 3JQ6A 4E2XA 1MB4A 3DZHA 3I5MA 4MKZA 1PL7A 4YQYA 1HWYA 3HSKA 3CH6A 1QR6A 4IS3A 4J9UE 3NAQA 3LC1O 1UH5A 3AY6A 3JD1A 1SOWA 3PJGA 3H3FA 4DYVA 1GYPA 4L75A 4BNXA 3OJOA 1N2SA 5T5QA 1LX6A 1LSSA 1PS9A 2GRAA 1ADBA 5DF1A 1UXIA 2CD9A 3UAGA 5L4NA 3HB5X 3KYDB 4TRNA 2CUKA 1VSUA 4GLOA 3F4LA 3DZKA 1M2WA 1CEQA 2HRBA 3E48A 1HYGA 3P19A 1J49A 4OL9A 2VT2A 2GYYA 2D8AA 4DC1A 3JQFC 1E6UA 4MKXA 2W2KA 4ND4A 2A9FA 3ZCXA 3WMXA 2VT3A 3I23A 5EN4A 4PG6A 2V6FA 4C7JA 1EFLA 4HBGA 2C5AA 5IN4A 1TT7A 3WNQA 2HK8A 4JK3A 4AJEA 1BG6A 5HS6A 2H9IA 3RUDA 1SBYA 3TFOA 3CIFA 2VHWA 5EQDA 3C1TA 2X6TA 3U4IA 1U5AA 4ZA2A 2VHXA 1PGOA 2DUWA 1U5CA 4PLHA 3IL2A 4FBGA 1TXGA 4XCVA 4FOSA 4KWIA 3IC5A 2W90A 4E12A 3OIDA 5KJEA 3MTJA 3RJ9A 1GR0A 2PH3A 3B70A 3QIVA 1P9LA 5IZCC 3U09A 2J3IA 1EUDA 1Y1PA 3KZVA 1KY4A 3MEQA 4WLEA 4YTEA 4OO3A 3PZBA 3INRA 5CAEA 4BHTA 5G0SA 2VYVD 3IMFA 3MTGA 3ZHXA 2NTVA 2PA3A 3PK0A 1PZHA 2X22A 5TJ9A 1YE3A 3KO8A 1YGYA 1H2BA 3IS3A 3RFXA 3JQEA 1H6BA 3DHNA 1IULA 3F5SA 2GDZA 4IZHA 1RPNA 2E48A 1U2DA 2HLPA 3H2SA 4D44A 4IINA 3I9MA 4MP8A 3MWDB 1P1JA 4D3SA 1VSVA 4NJMA 4F46A 1DO8A 5CFZA 5L51A 1QYDA 3C7CB 4WCFB 1NM5A 1OI7A 3F1KA 3VDRA 3TZ6A 4ALIA 4FS3A 4BV9A 3D5TA 5COQA 5MDHA 3PEFA 4IGEA 1XQ6A 1IE3A 1X7GA 4RPJA 1HL3A 2QRKA 4LVUA 1SMKA 1JU9A 3ANNA 1ONNA 1N9GB 4Q3BA 4BV8A 2X58A 1OOEA 2GN8A 1H5QA 2FZEA 1R16A 4NH4A 1QP8A 4U0JA 5COBA 4EUHA 4KQWA 1Q2XA 1D3AA 2BLLA 1B16A 4FFMA 5IG2A 3GQVA 1C0PA 2YDYA 4PLFA 3W4KA 4TMFA 5JDCA 4MINA 4EEXA 3G17A 4BNHA 1I3KA 4CMIB 4BO9A 1HDZA 3QA9A 3WOHA 3PIDA 4L4XA 4NU5A 4MVJM 2BKAA 2W2LA 4CV0A 1RYEA 1Y5RA 5JYDA 3DZGA 4H16A 4Z6KA 1YWGO 2EWMA 1R4NB 5HS4A 3GNTA 3W8DA 5EL0A 2FPGA 2X5KO 1IOLA 5G4KB 3HDJA 4FPXA 1BVRA 2WYVA 3L4SO 5JW6A 3HADA 3ZU4A 3GPDG 1W0CA 1YBMA 4RF5A 1Z73A 4D79A 3H3JA 3D3WB 3GN2A 4J4TA 3BTSA 2Q45A 1BXZA 2UAGA 3NT4A 3BYZA 4G2NA 3MOIA 1K6JA 2DU8A 2ZJ0A 1EVIA 3COSA 3OEYA 4CUJA 4J7XA 1PL8A 3JYOA 1RM0A 3ZHBA 3ZWXA 2YQ4A 1UXHA 3RC9A 4G65A 3S55A 1AXGA 2G76A 4M54A 3VPXA 1CQJA 3AUAA 5H83A 5IN5A 3GEMA 3O03A 2YFQA 1ZJYA 1Y8RA 5CDGA 5IZCA 4W6ZA 2PKQP 4BGEA 3L4BC 1NVGA 3C3XA 3OECA 1HLPA 2FN7A 2NQ8A 2O3TA 5BT9A 4DYDA 2QRLA 4JXKA 4E5KA 1ZJZA 4PG7A 1MP0A 2JAPA 4GX1A 3ZU5A 4BGVA 1F8GA 1FJHA 1YQGA 2BFPA 4MVJE 4DBVO 1H9BA 1I10A 5JCJA 5CG1A 4A26A 3DAGA 5C7LO 1GZ3A 3B1FA 4YT2A 2J5KA 1NFRA 1ZK1A 2YHUA 5DP1A 4GGPA 3W4JA 2Y1DA 1PGQA 1FK8A 1E3WA 1LLCA 3DBLA 3TL2A 4E5MA 3BTVA 2H6EA 1Y8RB 4LK3A 1E3JA 1ZSNA 3VZSA 5JBIA 5FWNA 2JHFA 1WXDA 3C8MA 3FR8A 3WBFA 1VPDA 1MC5A 4PG8A 1XDWA 4QECA 3ZNOA 3EDMA 4Z0HO 1E7SA 4CM4B 4E3ZA 5IDXA 2CF6A 3BMNB 2G0TA 2I66A 1LDYA 3K5PA 3O26A 5JLAA 3WIDA 5JFOA 2GZ1A 3OIGA 1R4MB 4WKGA 3PWZA 3NKLA 1IZ0A 2X4GA 1FDSA 4BOYA 1E1MA 3TNLA 1NTOA 2IRWA 1ZH8A 4UUMA 4QXMA 2X7HA 3HDHA 4YRDA 4CLHA 1CERA 2P68A 2VHYA 3HDYA 1P74A 4BNUA 5KVCA 1ULUA 2CMDA 3QHAA 4FCCA 4RPLA 1FMCA 3UCXA 3FBTA 3ZHYA 5IZ4A 4O6VA 3NX4A 1NWCA 1ADGA 1U7HA 2EKPA 4ZQBA 5KNLA 1X1TA 2NV6A 1IHXA 1NQAO 2JCYA 4GVXA 2GR9A 4I1IA 4YAJA 5KWEA 4RL6A 2Y0DA 5L95A 1LXCA 2PY6A 5C3MA 2I99A 1LLUA 2OP1A 4U5QA 3FWNA 5DCYA 4ZQGA 5KJ6A 1HDOA 2IYOA 3IQDB 1L1FA 4BNLA 1PWZA 1FDVA 4RCVA 3PLNA 4IDEA 4RZIA 4DPKA 3G3EA 2G5CA 3C1AA 4WK6A 4UVHA 3RUHA 1YONA 3JQAA 5T8KA 1LDBA 1AUPA 4G5HA 4B8ZA 1DBVO 4J1SA 4QO7A 3MCVA 3F3SA 2J5RA 1LDEA 1LSOA 5IDQA 1DDOA 4NBVA 1G1AA 1GEGA 3X2FA 2RAFA 3NJ4A 4IXTA 1XU7A 1P45A 4I5GA 4ID9A 4BMSA 3DAPA 2NNLD 3LF2A 1A9YA 4J4HA 5ENDA 1WDLA 4WECA 4Y6SA 1YDEA 1HSZA 1ISIA 2VHVA 4AJ4A 1XEAA 1PGNA 4OH1A 2C07A 3I9LA 1CRWG 3VPGA 5A03A 4YAKA 3RUFA 4JROA 4EW6A 3BHJA 4CLXA 1UP7A 1DHRA 4YXFA 2ZYAA 3HUDA 1UJMA 3GRPA 5GZ3A 4BB5A 3FNFA 4NK4A 4B7CA 4IY1A 4R51A 4DQUA 4IJWA 5TX7A 1K2WA 5TNXA 2H63A 1YQXA 3ZWPA 4PCVA 3I9KA 3LDHA 4XR9A 2V65A 4M89A 5I9MA 4BQPA 3K6JA 3H7AA 3H4VA 3K9QO 4R9SA 4KDEA 4AJ1A 4DREA 4JBGA 2OBNA 2D1YA 4ZHSA 5EJ2A 1Q0HA 4QFCA 4RV9A 1PIWA 2HK9A 2P9GA 1NHGA 3NJ8A 4Y98A 4PVDA 5G0TA 1DHTA 1NR1A 1O9BA 1H6AA 3FNGA 4JQCA 2Y05A 4J7CA 1N1EA 1DFHA 3K2BA 1VC2A 1LDMA 4GAEA 4DIFA 2FPPA 1I30A 2D5AA 4UREA 2ZYGA 4R54A 3GVCA 3I9JA 4P4GA 3VHRA 3NDRA 3MJEA 3JQ9C 4UEOA 2OMEA 3VH1A 3RSHA 1T4BA 2D3TA 2J3JA 4IQGA 1HLDA 1VLLA 1ZCJA 4YJDA 4QQRA 1EVYA 3M2TA 1IL0A 3VTZA 3JQGA 4YPOA 1PJLA 4ZU3A 5BNFA 1JKJA 2BGLA 2IEBA 2QZZA 3DZFA 3FSRA 3NTQA 4XEHA 4CLOA 1NPDA 3DMYA 2CSUA 3D4NA 5DZSA 1FXSA 2D2IA 2OZPA 1SOVA 5ENVA 2NQTA 3QQPA 5COAA 4B7UA 4ROSA 4E13A 3ETGA 3OQ6A 5KTKA 2VWQA 2DTXA 3NGXA 1E3IA 3TZCA 4A27A 5JE8A 1GU7A 3FRJA 4ZRMA 1GD1O 2OO5A 1VM6A 3KUXA 1TT5B 1NYTA 1O8CA 1V3UA 4RVDA 2Q2VA 3E18A 3GZNA 3VH4A 3RC1A 4NDNE 4OHUA 3E5RA 1RKXA 2VNAA 5CDTA 2PLAA 4YB8A 5J23A 3EW7A 4PZCA 5G0VA 3LQFA 3PGXA 3ZH2A 3IIEA 3OJFA 5ILOA 1DC6A 2GCGA 5JY6A 4ZJUA 1YL5A 1KC1A 4RDHA 3IJRA 2W4QA 5J9GA 3GEGA 5DBIA 2GF2A 4WGGA 1GEEA 4CQMD 4K1LA 3DC2A 3O8QB 1KEVA 4Z0PA 1HDGO 3F5QA 3HNPA 3WWYA 1T4DA 4J43A 5DBFA 1U3VA 3K96A 1O89A 1O94A 3I4CA 1QYWA 5IAAA 2C2XA 1R0KA 5I7EA 2HAEA 4CMCA 2P91A 4WLNA 2X5JO 4M8SA 3DDNA 2FR0A 3BMNA 3NEPX 5GY7A 2Y0CA 3AOGA 2UV8A 3PHLA 4BGUA 3ADPA 1IY8A 4KDFA 2PH5A 5BQFA 2WYUA 4E30A 1QMGA 3WNVA 4EJMA 4E2ZA 4OSPA 2OOSA 4TVOA 2VWGA 3NGLA 1LJ8A 3DBRA 4CV2A 1DIAA 4NK5A 2NVUB 4I08A 3C7DB 1VJ0A 2C59A 1NXQA 1QLHA 4B7XA 3RI3A 4MVJP 1HETA 3F4BA 4PLCA 2ZB4A 4XR4A 3PHGA 3PHIA 1F0YA 2AQKA 1DFGA 3MOGA 4Z3DA 3G1UA 2LDBA 3BMQA 4BO3A 4MVJA 1ML3A 1HYHA 1L7DA 3OJEA 1NAHA 3VH2A 2O3JA 2J8ZA 3DOCA 2HU2A 5EQFA 1U3WA 4DXHA 4LMRA 3WICA 1LNQA 3Q9UA 5CEFA 5LDGA 3BMCB 4CM5A 1PGJA 3KYDA 4BO2A 5I7FA 2B35A 3NV9A 2HK7A 2E49A 3WYCA 1I24A 3ZU3A 3PLRA 5A04A 1LLDA 1GUYA 4BQRA 1I0ZA 1IZ9A 3S8MA 4Q39A 5KOIA 1TT5A 5K9ZA
chains in the Genus database with same CATH superfamily
1CUWA 4S1VA 2A14A 2RGCA 5HF8A 1HMYA 2F4VB 2DYKA 1NVXQ 1JAZA 4JEMA 4LF6B 2YJTD 3UMGA 1TCBA 2WU1A 3K9WA 4GL4A 2RC6A 2N42A 4RETA 1AK9A 3S6JA 4QTYA 1L5WA 1SXJE 1OF1A 5EHZA 2XA1A 2WUGA 3KSAC 3O82A 3TRJA 2IIQA 2J59A 3UT5A 2IX3A 3PRJA 2C7VA 3GRFA 1CZLA 4HFNA 2FEXA 3QV2A 5DWDA 3DFMA 4RVCA 4C7OB 3QE2A 5AKKA 3FZYA 1WF3A 2GAJA 1EVKA 1N0HA 2VJOA 2W7TA 2YWRA 1RQRA 4L74A 1R0LA 4DCOA 3GVHA 3S2ZA 3UWDA 2P9QA 3QKTA 3HP7A 3WLTA 1OA0A 4A92A 5JJCA 1VMIA 2E82A 4RHUA 5G3ZA 3AV3A 1DZ3A 2X6RA 1OH7A 2G82A 121PA 4M36A 4ZO4A 4XJXA 4FOTA 5EUBA 1OX6A 1QO0D 5B2ZA 3MW8A 4UBOA 1SR8A 1GWNA 2MSLA 4URWR 1L7PA 3OFNA 4OBBA 4UM7A 3R9WA 2XMPA 4O8ZA 3W5DA 3RS4A 3I04M 2C4NA 2OO3A 2R85A 2ZJBA 5IYZA 3QV1A 4JELA 4YRNA 1ONOA 2O8BB 2B21A 4YAOA 1DKMA 1XXHA 2Q0HA 1X86B 2UYYA 3U7JA 1MBZA 3ZD7A 3BUSA 4IJMA 3EIUA 3O7MA 1D7AA 4IGFA 2IH2A 1XMSA 3U1VA 2G1UA 3J81k 4AY2A 4FMPA 1RPAA 1K1EA 1WV0A 1Y42X 4P7FA 3ZCUA 1M9NA 1UM8A 3U4QA 1AB6A 4IKPA 3AHCA 1F06A 4OJQA 1LRLA 3QY9A 1JDTA 3TEJA 4AP5A 4GLBA 5K0GA 1ZHOA 1OYOA 4BNZA 1TW2A 3FUVA 3UB3A 5BR8B 3PB3A 1K63A 4D8TA 2CV2A 3FWPA 3A6FA 5BWLA 5GVRA 4PC3A 5JARA 2AYXA 3WDKA 2HNAA 5F7XA 1WP9A 1RQ7A 3HB4X 1JIUA 4ARBA 3TRIA 3JXEA 4YH1A 1B4DA 2A86A 2YXDA 4J0QA 4KVFA 3WAGA 4W1QA 3HI6A 3KTAA 5ECYA 3UHPA 4EO4A 2C1EA 1EB8A 2EP8A 2I3GA 1FDTA 2I03A 4Y0AA 4BVKA 3H83A 4GU5A 1C1XB 1EVQA 1N2XA 2CLKB 3KR9A 4ILKA 5IP5A 5JQGA 4LF9B 1T5HX 3WQQA 4PZLA 3R4CA 2WZBA 4ZT2A 3TLMA 4LOAA 2DH5A 2Z2KA 1NQWA 2E87A 3E5NA 2GN2A 1QNLA 3VTFA 2ID8A 5AI4A 4ZVNA 2EATA 2GZDA 1ADYA 3A9RA 3VSCA 4G4IA 2AFIB 3T1OA 2IEIA 3FJ1A 1QK4A 1SRQA 1L4UA 2YOHA 4KUGA 1E92A 4FYXA 2FW1A 3NNDA 1G64A 5AW5A 4O2BF 1C0LA 3LT1A 2OZEA 2AXNA 3FOBA 4XYLA 4QUEA 4EHNA 3TG8A 4ZODA 4HWOA 1KS9A 2VDWA 4UQPA 1ZIOA 1MFPA 2Y4OA 5EG5A 3G6KA 4CG2A 2OECA 4BLUA 3GV0A 1ONBA 1Z56C 2BMFA 2JBAB 2PO5A 5AUQA 2CK3A 5JO0A 5JU6A 5HRCA 3ORQA 3Q8MA 3VC3A 1GPAA 1JH9A 1DQNA 2NOAA 1L7XA 1S3GA 4KIFA 3ZYZA 5CDHA 1P7VA 1X6VA 1B73A 5EY5B 1Z39A 4FIZA 3GCXA 4M0FA 3TE6A 3WLNA 2JL1A 5F5NA 2HTFA 2ISCA 4XOUA 3N8GA 3ILVA 3P9KA 1BMFA 4PLWA 1QU2A 2PSFA 3MWLA 2QW8A 1G3UA 2PQ0A 1EJ2A 4Q02A 4II2A 4MW9A 4Q19A 1AC5A 4WCFC 3SBXA 3V33A 1ZOOA 1MRSA 5EIOA 1OLSB 2HMUA 4JI2B 2HW8A 4OLAA 2W43A 4TPKA 1NUTA 3UMBA 2IHKA 2V7WA 2HEGA 2PMKA 2UKDA 1CE8B 3MJCA 5I5GA 1ORHA 1ZJ6A 4C0WA 2E89A 5CYOA 3TNFA 3C98A 5KWVA 3I2HA 4LGMA 4NZYA 4JCOA 2LXNA 4Q21A 4Q3LA 3D4OA 3RIHA 4M9XA 3RBXA 5EIBC 3UV3A 5JDIC 4CQMB 2B7LA 2ZYDA 5HZGA 1ESNA 4L50A 4IH1A 4INZA 3H9CA 2HV9A 1PNQA 4ND6A 4QEDA 1CDEA 2Y67A 5JDIA 5MGNA 4BGIA 3ZV7A 3EC1A 3IAM6 3VR6D 4ZEMA 4RUKA 5LMZA 5LU9A 5IAJA 2BUCA 1H2XA 3WKBA 1U2TA 3RU2A 3DM5A 4OQPA 4PO9A 3I53A 3NTVA 3BORA 3HJTA 1L4GA 1JFFA 2QKYA 2WF8A 3G59A 2REQB 3BB3A 3GFVA 3GRZA 3ZUGA 1C4OA 2B99A 1DJQA 4LJ8A 1M2OB 1O9HA 3FPHA 4AROA 3X1KA 2I2BA 2OWDA 4PC1A 3E0QA 1E2PA 1K8ZB 3A6KA 5EOVA 1AA6A 2CJPA 2R2GA 2P6RA 2HJSA 3LBYA 3R8CA 3WXMA 4X8OA 3MG9A 4Q34A 3BGIA 4FIDA 5FV4A 1K8QA 5JNUA 4NABA 3TI9A 2OXCA 3JVDA 3NBFA 4BNDB 3JS5A 2JJQA 3OEHD 1MFZA 1AM4D 3A25A 3CZPA 4QYWA 2PQMA 4OXRA 2I87A 5LOVB 2UYOA 1NC1A 3O4GA 1U0GA 3IH5A 1Z28A 1R2QA 1XAHA 5U1PA 2LBPA 2PJDA 3SIXA 3DTVD 4FGJA 1I14A 2PMCA 3AFIA 2AFHA 3FMOB 1J9EA 3H11B 4D74A 1TECE 4ESOA 3FNRA 1YB7A 1DG3A 4G23A 4R0MA 2GEDA 1BSVA 1QIEA 3AM1A 4CG1A 3FNEA 4WERA 4DBZA 3H4TA 3NALA 1DRKA 1N9ZA 2H8GA 2BSAA 3G0DA 3QMVA 4PIVA 1C1DB 1I8TA 5B53A 4CL8A 5HF6A 5B4VA 1IZ8A 4EJ2A 3IUMA 4NXMB 2R1VA 3IVAA 2HDHA 5EZYA 1D4AA 1PSWA 1SHTX 3WLQA 2WNSA 1Z63A 5K0NA 2XPCA 1EK5A 2FOXA 1C7JA 4F84A 4ER0A 4D4KA 4RGQA 1QB8A 2PO7A 4IIUA 1N25A 3GOQA 4KYUA 4Q82A 1ZOLA 1S2IA 4DJFC 5LFAA 5LOVF 4EKEA 3R7FA 2HCJB 2AW5A 4W9NC 5HTKA 1RRMA 1HEUA 2V6MA 2Z2YA 3N3BC 2PTHA 1DTWA 4LRQA 4L9SA 2ORYA 5A5EA 5KCMA 3BTOA 3Q9LA 3TZBA 4AMBA 4FHFA 4YRGA 5ICFA 2VJAA 4DIOA 3K9CA 4FINA 1AVTA 2C9CA 3H1TA 3ZDAA 1SXJD 8ADHA 2OL4A 4TS3A 3ZHZA 3LW8A 4AMVA 5EQJB 3CX4A 3DNPA 3NATA 1LPBB 1E1QA 3GX1A 2ZBVA 4FP9A 3LX5A 4KKVA 1OTYA 5DEOA 1E7YA 3QXGA 2BELA 3KR0A 1F5SA 1P4HA 3PJRA 3NOQA 2BTQB 1DE0A 1MEOA 3SHQA 2QSYA 3BIWA 4PLVA 4YRZA 1UK7A 2YHIA 4C76A 3NHSA 1K97A 2JANA 1AB5A 4D9CA 5IHPA 4JUDX 1IY2A 3B2QA 3VDXA 1ZNZA 1E0AA 3CEAA 1XVVA 2RGAA 3EIEA 4ZMRA 1CCWA 2DQZA 3OFND 2VJMB 4KXUA 1RQXA 2INGX 2OP0A 2ZJZA 3R41A 3VPDA 4DR3B 4WPGA 1TMOA 2DPGA 1CTQA 3A7EA 4ENSA 4YFYA 3WBBA 2VHZA 1G0OA 3M4XA 4Q7LA 4GL2A 1JENB 4F2GA 1IQPA 1XTUA 4BC0A 2Q4BA 1CD5A 4HWSA 3RHTA 3EEQA 4EY3A 3SFVA 4KREA 2KLHA 2VDQB 4YVFA 2ZE5A 4QELA 5IPFA 2JHGA 3UAYA 4L5BA 1DC7A 3NLLA 2FZGA 2DQ4A 5CTAA 3H4MA 1QLWA 4PU0A 2RCYA 4KRGA 5EWLA 1K75A 2GJSA 4KH0A 3OQHA 1C2TA 4UNRA 2WSLA 3RC2A 3KXPA 5EQTA 3CLSD 4B0OA 1N7GA 3DZ4B 1Q0PA 3SY8A 1ENYA 4EARA 4YDQA 3K72B 2B98A 2GQ0A 5KHLB 4CQLA 1UBJS 1RAAA 2NZVG 1MF7A 2BONA 2X3YA 4FDUA 4WZBB 5JAPA 1N32B 4RTPA 4M7RA 3GWZA 3KXDA 1YJBA 1CQPA 2FMFA 3EISA 2OO7A 4FYPA 4L5AA 2FPIB 3Q98A 3I6BA 3VU8A 1YZQA 3LC7O 1WDMA 1NW8A 3GCZA 3H2KA 4H7HA 4CIVA 3AGQA 4IIJA 2BFFA 1GFSA 3HYRA 3ON5A 3WMRA 2Z4RA 1H85A 2IPOA 4HCJA 2QU8A 3MBIA 4HNRA 3GPCA 2HF7A 4B6EA 1G9TA 2ECOA 2ZAYA 3CHYA 3SLKA 3GDFA 3QUCA 1RRPA 4CCWA 2KPOA 4KMSA 3UJ9A 2ZQ5A 3ZU2A 2C3PA 3JZMA 5A6VA 4K9NA 4O4HF 3PHJA 5BNTA 2D0PB 4GGOA 3F9IA 4Q9NA 3VJLA 3UK6A 2XKAA 1J0XO 3PUJA 3EPLA 1O5OA 3LT4A 3U4GA 4P92A 2Q5FA 4J0GA 2FN8A 3RUIA 1V8DA 2BFDA 2F17A 2VBGA 1WZIA 3E27A 9LDBA 3W1EA 1H05A 4RVSA 3HZHA 5CT5A 5F2NA 4EG8A 1UMDA 4OYRA 1C8LA 2UXCB 1ZMTA 1E3LA 1OLXB 1N3IA 4ND8B 4RO0A 2PMFA 5CCEA 1JR3E 5LU8A 1YZGA 2PRKA 5BQ3A 3HO1A 1A76A 3OH8A 3RYHB 3B1XA 1HNNA 3WGHA 1S2OA 2GJ8A 4FCTA 4XUCA 4BLPA 4UXHA 5LMCA 2E85A 5EVCA 3MBKA 4ZYLA 1ZVQA 5FR1A 2XQKA 2CVZA 1TA4A 4EX7A 2JA1A 3QFTA 3RS0A 1TK9A 1ZDMA 5EUCA 4DMHA 5A4JA 4KBGA 4LEIA 1QYCA 2E6KA 3C3KA 2WIGA 4TS9A 3VPHA 4ZU1X 3GEEA 3T3IA 3FI9A 5F9HA 3NH6A 5I5EA 1TJPB 1Y1TA 2J30A 5EEGA 2XDYA 2B4YA 1TYAE 3TD6A 2NU6A 3TNJA 5KNDD 5C8YF 2ZVDA 3C3PA 5FP0A 3UCFA 1OBHA 5KWSA 3NHFA 1HMPA 1VHWA 2KS6A 4NCIA 1I32A 2V7PA 3F1LA 1R5NA 4TTPA 1ZOPA 4MI1A 1P4JA 5FOUA 1QFMA 2DWCA 4RK1A 4LE2A 2DKOA 3MRSA 3MLAA 1DMSA 2B9VA 3OSZA 3PXEA 1JW9B 4PPQA 4WNYA 4E5NA 4LRTB 4NTZA 4QREA 2BRUA 1JKFA 1P29A 1EXNA 2X7XA 1JJBA 1UQUA 3GG2A 3TRKA 1E32A 1E9FA 2CXXA 4OD0A 4Q1EA 3PCRB 4WVFA 1C4WA 2YV1A 4W5NA 4O2AA 3ZWWA 1HURA 1UODA 2Z8YM 2F1KA 4IUDS 5JQGB 4F56A 1VDMA 4Q00A 4UOEA 3A9WA 4MR9A 4WA8A 3ASVA 1G7CA 2OGUA 1XF9A 3AF3A 3VC7A 1MO4A 3ABRB 4AJ9A 1A2BA 3FWYA 4D3FA 3E6AA 4BU0A 1OKKA 4MVJF 1GUFA 1U7TA 2VRNA 4WN9A 1SU6A 3BSWA 1MHPA 3GMTA 4AXBA 5H80A 3IFSA 5SYAA 1YKSA 3MIIA 1NQTA 3PRYA 4EJSC 3NRJA 4XQCA 1SOUA 3R6TA 1VHTA 5DK4A 1X7ZA 1N5IA 2D0IA 1KYIA 4Z4CA 4NG5A 5HR5A 1Y8QA 2OHJA 3ND5A 2PZMA 1CZHA 2JCBA 4CI0B 4LFBB 2YY6A 3HS3A 3Q6IA 1XHEA 5EJ4A 4K3UA 4ZC8A 4E5PA 2XUHA 4TLEA 4UAUA 2D62A 3TSCA 4AG6A 2C9MA 2EF1A 2P2SA 3AVYA 3CSDA 2GM9A 3Q9SA 4S35A 1OBVA 4C3UA 1PTJA 2GBFA 2V4MA 1T8SA 2C4VA 4ZVVA 5BMVB 4JT4A 3VU1A 1T2EA 4P2GA 4UU7A 5TIIA 1DX9A 3KETA 4R2WA 3TD2A 2XLBA 5EPUA 2Q1XA 3L93A 4PHHA 3PRHA 2D2FA 2YX1A 4N0EA 2D5LA 3O38A 2GD6A 3E22A 3F78A 3PXUA 3TDKA 4C04A 4Z4FA 1LI4A 3OQJA 2CLIB 5GM1A 5JSHA 1PVDA 3PHHA 3U19A 4JCCA 1TJ4A 3V8PA 3RGWS 4FR2A 521PA 4DNPA 2CFSA 2J32A 1NN0A 1MJFA 3UJ3X 4ECAA 2IOFA 1POXA 1Q15A 2WC1A 1QCYA 3TSWA 1UUFA 2AEFA 2QN7A 3AR5A 5CGQB 4E46A 4KVZA 3AKEA 3SHVA 5IJ0A 4DRYA 3LUHA 5M6DA 3OY2A 1X15A 3O91A 1Y7PA 4YP1A 2FK8A 4X90A 4ZVTA 4JKIA 2FSIA 3OCXA 4UM9D 2QX6A 4NCJA 3OOJA 1W94A 1E2LA 5DHSA 3S29A 4D82A 2YWCA 4RJTA 2FVXA 4IJVA 4F85A 3BAFA 4B43A 2FW7A 4IRUB 4MQUA 4YONB 5A3SA 3TZQA 4DLTA 3RVDA 1ZUD1 2GAFA 3D6VA 4KG7A 3PKZA 4CZ2A 4M9RA 4C7OA 4OXKA 4UZEA 2XNSA 4PSAA 2QT1A 1R0BA 1XZJA 4HV4A 2R7KA 5M29A 4A23A 4LHZA 1NQOA 4X8MA 2P2GA 1ZSYA 3BB4A 5GWXA 3WDSA 4NYJR 4MPPA 3PUXA 2QR5A 1OHHD 2OZLB 2WWFA 3L18A 1SBNE 3E84A 1ST3A 2R66A 2Z1NA 1QRAA 1R6DA 2IK8A 2O8FB 2P6MA 1E3MA 2XZLA 3DKPA 1J5EB 1E8DA 3KT8A 1QH1B 3DMTC 4ZN6A 1EGMB 1E2KA 1PLJA 3SNHA 2RHDA 2V45A 4IHQA 5MHTA 1JKIA 3NT5A 3KQQA 3I34X 4ECEA 4R3WA 2Y92A 3KJXA 3IDOA 2GA9A 3IBYA 3FG9A 3NYQA 3I61A 2B7BA 4GPAA 3L8ZA 1P18A 1PO7A 3IT1A 4L6IA 4QUBA 4F9FA 3EVNA 2ZVQX 4XWGA 1ESDA 1SNYA 1ZU4A 4PIMA 4RQBA 5IJAA 3I9FA 3LQQA 4CMJA 2QX7A 1NMZA 3O5AA 4CQJA 4UTOA 1MT0A 1E60A 1YR3A 1I0IA 1VIAA 2G0AA 5E3IA 2PL5A 3MSXA 5KTTA 2X0IA 1I2CA 2BMJA 1XVIA 3RB8A 1ZW1A 2I7XA 3AGPA 1O96B 4GMKA 3OKCA 1KU0A 5ER6A 5JJIA 1I79B 2OAP1 2VTVA 4LDAA 1MTOA 3NHMA 4OXNA 3WQBA 5K03A 1EEHA 1TDJA 1RJEA 3NV7A 4PHGA 1RBYA 5A3VA 4W82A 4UTRA 3FHOA 2JRLA 5AVOA 3QEAZ 4AS3A 5L7WA 1JG7A 1YIDA 1Q1AA 2HADA 4PFJA 5EESA 4BEWA 5KVQA 1B93A 4L0MA 1PKEA 1C50A 2VQFB 1GYRA 2C8JA 4I6EA 2QAJA 1P3DA 1Z7GA 2CNBA 3RRBA 1AHHA 1E63A 3VTAA 4EMSA 3VR4A 5BPHA 1PR0A 1UMCA 4Q66C 3EQ8A 1CUEA 2CJYA 4R2MA 5HRUA 2D59A 4R41A 3JYQA 4RE6A 3VUFA 3W2GA 4EW1A 5H02A 2YC2C 3WLSA 4XYGA 1OAAA 1XRRA 1C0IA 2WLSA 4QQ8A 4OHZA 4XB1A 1RI5A 3GAZA 1DC4A 4R7GA 4X66B 1SXPA 4QAQA 4BY9E 2NSJA 1P3JA 3GH1A 4QQNA 1AX9A 3M3PA 3PC8A 1F9AA 1Q7BA 3M1YA 1NJFA 4JENA 3HWWA 3HDGA 3LX6A 2DPHA 1VMEA 2HA4A 1L3BA 1YU6A 2QRPA 2WZQA 1FPQA 2ZWIA 4G41A 4UULA 4BKUA 1UFKA 2HPVA 5FKJA 5JHGB 1KEWA 3BFPA 3NCTA 4YV0A 2ENWA 5I4IA 2GFIA 4X97A 1EX7A 1DKRA 2XX3A 3DPIA 1S5PA 1TMYA 2IP2A 4MR8A 4NI5A 5EMNA 5EJAA 3WKCA 3O4VA 2WTXA 4OLFA 1D0VA 4LJAA 4C0BA 3L40A 2EBHX 5JNLA 4GR5A 4DFDA 1TTTA 1TGVA 3FN4A 5KUTA 1PHPA 1JB9A 5AQEA 1UJ2A 3IUBA 3PRKE 2EGHA 5DULA 2ZW9A 3SVTA 5ED4A 2F90A 3EVEA 1ABFA 3MNFA 3OF3A 2OGSA 3EP6B 1HNWB 3LYHA 5JSZA 3AQIA 5T73A 1FBNA 1CETA 1DI0A 2CXSA 5T41A 4TKUB 4DV3B 3RT7A 4JEIA 1XTZA 2QRZA 3WGKA 1WX1A 4IS2A 2KX7A 1TC2A 2AKAB 1LC3A 4GKAA 1A7AA 3WS7A 3B1ZA 1PW5A 3K1ZA 3HLYA 3ZIUA 5BW8A 4QT0A 3QSYA 3WYEA 1WKVA 4CQMA 2NUBA 4B0PA 2YZMA 3LH5A 3NUZA 2Q1WA 1Q7TA 1D6SA 3K1TA 1CR1A 3LJKA 4LZJA 4GH5A 4YEDA 2ERXA 2ZUFA 3WWCA 4OATA 3PQ6A 2R11A 4ARSA 2C77A 3RSFA 2B8TA 4CKEB 1I4EB 2H16A 3TSOA 1DAFA 1HE5A 1HL7A 1U6IA 1RXEA 1Q0QA 1XJQA 3G89A 2G9UA 3P0IA 1JQKA 2AF4C 3L01A 1N8KA 2GNAA 1PG5A 2BIFA 1JHUA 2BM1A 3DONA 5ECWA 1V25A 1ZY2A 4BKOA 3JSXA 2GETA 3GLGB 2H4XA 1RBZA 4N3AA 1T3LA 4KV7A 3T1QA 1T4MA 2QBYA 2ODAA 4J76A 3SFZA 3BC1A 4BKPA 5C1IA 2XA9A 4A1FA 4KPUB 2AHRA 3PL1A 3CINA 3CVUA 2QUZA 4JYMA 1MC4A 3E8SA 4N5NA 3UK7A 1VSQA 2Q4RA 3JQRA 3ZYCA 1LU9A 2D74A 4V3CA 4ZYVA 4LJKA 1KVTA 1SVNA 1U0NA 1UBKS 4TWBA 5U4QA 3RYIB 4AJIA 1U98A 2B82A 8GPBA 3PL5A 4ZI2A 2Q2QA 5TVKA 3LUCA 4B6QA 3W5BA 4PN7A 2NU8A 2NU9B 3JD4A 1M8KA 3H8VA 3PJFA 2GCNA 4IQ8A 2VR1A 2VBIA 4XTRA 5F7JA 3MMXA 3NIFB 3PWKA 1NMYA 4P5EA 3A31A 4IZOA 4L51A 1JA9A 3CJTA 2GCPA 4U7PB 5SV2A 3C8UA 1P1HA 4W9NA 5ADVA 2F64A 2NTYC 1G5QA 3TJZA 3WV5A 4F5EA 2BFFB 3UYKA 2Q5LA 4ZDIA 5GZ1A 1OT5A 5BW6B 1SPXA 4U0KA 2Y99A 3PXXA 3WYAA 1U0OC 2FPIA 2R1UA 2YZNA 1I1QB 1E0JA 2B94A 4FN5A 1R1DA 4LHEA 4QE3A 5KKCA 2O14A 1RM5A 1OI4A 2RIPA 1RI1A 4BNDA 5IJXA 4F0JA 1XR3A 4O4HB 4YRTA 1Z6AA 1XCMA 3DCYA 1A1SA 1ISGA 4QOHA 4RYDA 2XT9A 1OX4B 1NYRA 4URUR 2I2XB 1Q1ZA 4LZWA 3E03A 3PF9A 4AY6A 2DWQA 5CURA 1LJUA 3WGZA 3KSBC 3SVZA 1TQHA 3UQYS 3O8DA 6LDHA 4I3GA 4CHGA 3I30X 1XYVA 2GZSA 3PJEA 4HTFA 3ZGNA 3A6EA 3A2NA 5CXQA 2LCFA 1SVSA 2VJYA 3HWSA 4B84A 1RQNA 2XCUA 2QYSA 3H2BA 4DSUA 3A1UA 3EJ6A 3KQTA 4OQEA 2ZUUA 3H9BA 3JR7A 5IBPA 1HKUA 1V7PC 1VLZA 2QZPA 4OHBA 1IBCA 1WMDA 2H9AA 4BXOB 1QHNA 2ODBA 3C85A 3NMUF 1E8MA 1M6HA 3G79A 3Q72A 2XKJE 4B5KA 4C14A 3R3XA 2CCJA 2GEUA 3EXIA 4QPDA 4CUKA 2AE2A 2HA3A 3BB1A 3AR4A 5KKNB 1YFJA 1E8NA 1Y89A 2R6CA 3LUGA 4MVJG 1CT9A 4CPDA 5AVVA 4G0VA 2XSZD 2VP3A 3MTDA 1G98A 5A02A 1GA4A 1XTJA 4QFBA 1MORA 2P90A 5BOVA 3WWOA 3T7RA 3KL4A 2VT6A 4OKSA 3S2EA 2JJ1A 1A4UA 2JAUA 3AI2A 4MV4A 4OYLA 2QQFA 4XFJA 4BVBA 4NZPA 4ZFNA 4YJHB 4DF3A 4XYMA 4FTWA 4HH0A 2VBFA 3DNFA 3ROMA 1YK1A 2ZYTX 1K6XA 4WK2B 2ABWA 4A6EA 1S02A 4JYPA 1W1IA 2H1VA 4ZCLA 4C7BA 5LYJF 2OLEA 3HJCA 2PD3A 4EZBA 5BR7A 1HK7A 4QYXA 2E5LB 2JZNA 2ZJ1A 3HR8A 5DTJA 3BG5A 2DQYA 1I2MA 1XMPA 2A5GA 2ZUWA 3R5SA 4N3CA 1I72B 1U7ZA 5DBGA 4HGPA 1P7ZA 3L4JA 3OIUA 1LH0A 2SCUB 4COKA 3KTOA 2J5XA 2ATCA 1ZS9A 3RQSA 5AKJA 2IHYA 1IIRA 3PFFA 4ND5A 4OA8A 4BU1A 3N0VA 5ITWA 1W73A 1AKMA 1P62B 1VRWA 4MQ5A 1YS7A 4MLDA 3URKA 3WIVA 4MQ4A 4IEEA 4MPJA 2H5LA 2E21A 4IV0A 2QLLA 2OZLA 4ESHA 3AM5A 2C5EA 3SQOA 5AVXA 3Q1LA 1UR5A 4ZT6A 4EGSA 5AUNB 4KITB 3GEHA 5JFTA 4BCDA 2GVDC 2WWHA 4XIFA 1VG0B 4J29A 4H7JA 4JI3B 4MYTA 2FN9A 3TXYA 3DLIA 2F1JA 3CW9A 3W05A 1C7IA 1SCJA 4WEQA 2Q41A 5A62A 5EPOA 4GGMX 2DVMA 3MS4A 4K86A 5TGDA 3L05A 1L7VC 4Q4AA 4QL3A 4AP9A 3U9LA 1M0SA 3R3HA 1EK6A 3QWAA 4Y9DA 1RRCA 5TEVA 3RYHA 4IDDA 1T1SA 4B7ZA 3X1DA 4D4IA 3CLSC 1E2BA 1PN3A 5F2KA 3I64A 4BO8A 4HR7A 5C0OE 4WCVA 5K0SA 1GPDG 4FHCA 1G8YA 1WF6A 4HXGA 3U17A 3CMMA 3JD3A 6ABPA 5L3QB 3QI2A 3U13A 2M6LA 3WRYC 3KJHA 3Q40A 4FI3C 4V03A 3R0QA 4FNAA 1V5WA 2QRMA 4TKLA 1RE0A 3LVQE 5E9QA 2QJTA 4BE4A 4CCAA 5L3SB 1YB6A 3LUKA 1HFKA 5F9MA 1SQSA 1XJ0A 2G08A 3DO5A 4A8JA 1CEYA 1M34E 1T8YA 4G89A 1Y7HA 4GX2A 2IIPA 2QP4A 3O3OB 2IYWA 3PWTA 1S1CA 3KZKA 4YJ3B 5CM8B 3MILA 2BM9A 1BOOA 2V3VA 2IY7A 3OD1A 4Y1GA 3EVTA 2IOQA 1P80A 3C6KA 4OQLA 2GB4A 3P96A 4YK7A 3L6EA 3U9TA 5AW9A 7ABPA 1Z4OA 5A9RA 5DCLA 2BFCB 1I0LA 5TS2A 2R3SA 3SDBA 5HWSA 2VUTA 1A5TA 2BEUA 4NBNA 4OBEA 2YMMA 1XMIA 1ZGZA 3KTDA 3WJ1A 4QBHA 1Y1LA 2JVIA 3FNQA 4YECA 4CTOA 2BV3A 2MSWA 1AQ6A 4FSHA 3W78A 4LNUA 4HS9A 3THOA 5BWBA 7YASA 2OBMA 1T2DA 2FP3A 2K5UA 4MMZB 4UXJA 3B7PA 4ENWA 3EWAA 1JPUA 2DR3A 5IH7A 1E2JA 5JFGA 4G1CA 2FUG1 2XZTA 2O48X 3ACDA 2VTBA 5SY6A 3MFQA 1Y6GA 2YDXA 4MUGA 1PFVA 3F5DA 4BL5A 4Y2VA 4Y9RA 4C2TA 2DY0A 3ZVLA 1H2ZA 2C97A 3BGVA 3PNOA 4PGHA 1XRJA 3EOZA 4ED9A 1Y34E 5PNTA 1U3CA 1LPSA 2GPJA 1GRVA 4KPYA 2IHNA 1I4LD 3UIEA 5BV0A 4QFMA 5J2TA 3QVWA 1B6SA 1JE0A 1HY3A 2PS1A 2PZBA 3QEMB 4OM7A 2B4QA 3DEYX 4EHFA 1WXWA 2PRIA 3ISVA 3WC4A 4H7EA 3NKFA 5JCXA 1QVZA 3B52X 5TGTA 3GY0A 5DM1A 4CKZA 3NVAA 3GT7A 3W6OA 3WLHA 4JQYA 1GSHA 1WSBA 1E9DA 4QUKA 1PD1A 2HCFA 1W0JA 2FG6C 3DL2A 2Y76A 1KZGB 1FP4B 1NFFA 2DCMA 4QOGA 4ASUD 4ZXPA 1CJKC 3ECCA 4XQEA 4Q3EA 4DM7A 3EPAB 1LRKA 2OZVA 1QX3A 3D81A 4DM4A 4RTKA 1N34B 4QUAA 1EDEA 3RTAA 2AV6A 5JYBA 4ISCA 5KQLA 3O8CA 4Q4CA 2C2OA 1QRUA 4OQFA 1ODCA 1P9WA 1EBFA 1KH1A 4MICA 5CJJA 1K6IA 1NSFA 1XTQA 2VDUE 2M2IA 1ODLA 1EZ1A 2HMAA 2FPWA 3EZ6A 3RS8A 2JD0A 4LSZA 4EO9A 3AVTA 4XD7A 3GRAA 1JQDA 4YCCA 3KQKA 4REQA 4I7EA 5DSTA 5CB4B 2IFTA 1GPMA 2C61A 4J94A 2J7PA 3EQ6A 3HO8A 4DVGA 1RHMA 4EKGA 3MGAA 4MZXA 3GF4A 4O4IF 4XD7D 3AL0C 3VR5D 3JYPA 4KUEA 2C4MA 3K09C 4OHCA 2HFKA 3DWGA 2F43A 4CV3A 4XX0A 2H1FA 3PC7A 2M9MA 3MD0A 2FFQA 2FPUA 3V1UA 2IH5A 1IEVA 4D43A 3EC7A 4GKJB 2I78A 4IV5A 4HEHA 2QE7D 2QRGA 3CO5A 3GLTA 3QU5A 4OB8A 1Q0SA 5DOZA 3SR4A 2F55A 1PF7E 3HYNA 4LF7B 2YIMA 1OPRA 4MO9A 4YT4A 3LBFA 4BE9A 4QJ3A 2RKBA 2G72A 3LT0A 4QBFA 4OQQA 2QYTA 4JP3A 4OXYA 1YE8A 4M87A 4TLAA 3EWNA 1PWHA 1NSTA 4MAMA 4W4TA 4WX2B 1EWRA 5AHXA 5JO9A 4YO8A 4KH1A 3TVDA 3C8HA 1G4UR 4PIPA 4MS4B 1XO1A 1MAAA 1JTVA 1Y4SA 2HIMA 2NUTB 2ONZA 3D6HA 4FQ5A 4PINA 4QLOA 1TLTA 4YJ2B 5EP4A 1Q5PA 4GX5A 4O4IB 5FOXA 3EP5B 4BNMA 2PCJA 1ADCA 2ZB7A 1XK7A 2XKKA 3BSFA 1V11A 4DLAA 3D3EA 1QGYA 3R76A 1NXXA 3ML1A 1H2HA 1E5XA 1VCIA 3N39C 1AGXA 5F35A 5CX4A 1KZYC 4MVJI 3ZKWA 1WKBA 4FNOA 4A2CA 3IQHX 4B34A 2BM8A 3H5OA 1NASA 2JFGA 2W5UA 3HB0A 2Z2IA 2VSQA 4M0CA 5EWLB 2ZS7A 4A5SA 1VE9A 4MHTA 3I12A 3F46A 3UMFA 2H54A 4C4OA 3OZAA 4LVNA 4MUJA 4WOKA 3U7EB 3UG7A 3CUKA 3V80A 1WKCA 4QTZA 2JG3A 5AI8A 5JD6A 2X4IA 1AURA 1GZ5A 5JYAA 3MWFA 3ZJ5A 3BPSA 5CFQA 2WIAA 4FFSA 3GQBB 2PWPA 5IS2A 1L4FA 1TIBA 1I33A 1CQWA 5BNZA 3INYA 4BAGA 3L0OA 3ZY5A 2VJMA 1ZXLA 3OWHA 3GGGA 5HE8A 3QU4A 4KXYA 1AKEA 2P1DA 1J0AA 4MRMA 2GBCA 3WFJA 1XRLA 4EB6B 4GP9A 3Q8LA 1EMDA 1P17A 2JGFA 4CM3A 2OQ2A 1CIPA 4M7OA 4NRDA 2YHIB 1Y1QA 3GFQA 3PNPA 3DTYA 3B53X 3C7TA 1MB3A 3CKLA 3OJ0A 4L1KA 3ZE8A 2FW0A 3RRFA 4OHWA 3ROQA 4B3FX 4HFMA 4AFNA 2XOKA 2E6UX 2ICAA 2VYND 1JHDA 2B9EA 2BGUA 1NJ8A 2WAMA 3BH0A 5F64A 5T4HA 3RRMA 3UG6A 1KP2A 2H57A 1JDBB 4HNSA 1CY0A 1R6VA 4ETWA 2UU9B 2UYGA 2WJHA 4XUEA 3VX4A 2JFXA 3NXKA 1M7GA 3PDJA 2BSQA 2A35A 2X77A 2GPSA 2GT1A 1AZLA 3LVBA 4Z9XA 4E7OA 3SX0A 2Z58A 1DTWB 1JIIA 2V7BA 4FEGA 2ZTLA 5KC8A 1HKHA 3KAJA 3SQLA 5AVUA 2FH5B 1QM5A 3P9PA 4RSHA 1AMNA 1H3EA 3O4HA 3BMQB 1H9AA 2QROA 5DNAA 2W6JD 4S2EA 3RSZA 1C9EA 3GN1A 3FYHA 1SUPA 3V3KA 2B4AA 1WSAA 2QQGA 3FUCA 3LUFA 4HF7A 3NP7A 1IXYA 2ZR7A 2WMYA 2I34A 3CN9A 4HGQA 4H1UA 1HM5A 2X5OA 4YP0A 2XNJA 2YXLA 1PJBA 1MNAA 1T15A 3B2NA 4QIHA 5C1BA 4KO1S 3WL6A 4DMFA 1N7IA 3WGVA 1NURA 1JA1A 2ZUSA 3J7AC 3OSUA 5EZSA 4I1YA 3E81A 4EP1A 1Q50A 2CBGA 2NZXA 4C1NA 3AESB 3T52A 5C53B 2PZEA 3L6RA 4X95A 3KOXA 1U02A 2D6FA 2VIIA 3B89A 3QM1A 3QXJA 4XWTA 3ZCSA 1Z7EA 4FGSA 4MCHA 3E3MA 3F71A 2XNDD 3RUEA 4GMHA 1WZNA 4YRQA 4NJMB 4YXWD 1LDGA 5JASA 3LFTA 3RVLA 1MPTA 4RFLA 1G2OA 4MWTA 4M0EA 1GSAA 4HLNA 3ZBTA 1JBEA 2C2GA 2QSUA 4B48A 4B3GA 3D7RA 3L8FA 5ALVA 1S9DA 2RH8A 8OHMA 3E7WA 4PSUA 2MTBA 4TZTA 2ZSJA 4NS4A 5GP1A 1QG6A 3RODA 1NXWA 3HQ4O 4X6UA 3VZQA 1VA4A 1EM8A 3BTUA 3GC6A 5EUMA 4CU5A 2RGBA 4IPTA 4RZHA 1QE5A 2O7SA 3K0FA 4LJ9A 4NENA 5JR3A 2QX8A 2P2DA 2VSNA 3GGSA 4PSCA 2Z9BA 3HCAA 3UHJA 1LPAB 4PNHA 1UJ4A 1KQ3A 3DCIA 3NRCA 3MQFA 4LX8A 4N40A 4DUYB 3RCBA 721PA 2FHPA 1FUEA 4ZOAA 1SEPA 5IUJC 2XDWA 4I8DA 3V3TA 5GOTA 3L7CA 4OJKA 5EWMB 3D0OA 1W76A 2GXUA 2X42A 4KMOA 1VKNA 1T8UA 4YN3A 2P9FA 4I6JA 1R15A 4WY8A 3L7KA 2X0JA 1M2HA 2I3DA 3RUAA 1H1LA 3HH8A 4WMLA 1QVWA 4OREX 4OY3A 4BYGA 2WT9A 4X20A 2VKTA 3OF5A 4LWZA 3HM2A 2NVOA 1BZYA 2WILA 5EWJB 3QOYA 2CLLB 2PKQO 4P2BA 1R10A 1C3XA 1NJ5A 3JAWB 4JB8A 4JL5A 5FLEX 5LLSA 5T8KC 3RS9A 1NKSA 3AVOA 1L8QA 3DAYA 1LD3A 1QK3A 4AT1A 2MMGA 1X2BA 2A5DA 2X1MA 4UU8A 1BH2A 2XYPA 1NLZA 3Q7QA 3DLTA 2A3NA 1SVOA 1U1FA 3OOHA 2VKQA 4IEFB 4OU4A 3COPA 1YA8A 1EJBA 3HKBA 2UVPA 4FGWA 2O4UX 3PUKA 1ZISA 3HCOA 2OR3A 3G1WA 2C7RA 1L4NA 1VGQA 4UD6A 3D7KA 1J2RA 2R60A 4NF2A 1C7FA 3OZUA 4KE6A 1ANKA 4FN4A 4A1OA 5DX0A 5ETJA 3SQXA 4E4YA 1SK8A 4GVPA 4M0PA 4N9QA 1RNLA 2FX2A 5EXSA 2IYTA 3VVBA 2WSBA 3SZLA 5AW2A 1RLUA 1PSZA 4NAHA 1DRVA 1OXTA 3VU9A 1ZK3A 3V5NA 3N5CA 1X1SA 2WDZA 4XZ3A 3VTKA 2R7NA 2TECE 3WMWA 3RTBA 1B7GO 4ZCRA 5SZHB 1TVKB 3ORFA 1V1MA 4J0JA 1AD2A 1E6KA 3AOEC 4RU1A 3S2GA 3SIWA 4ARCA 2AN9A 4DIUA 4ENQA 1SGWA 1I2ZA 5EKSA 3H5IA 1UMBB 2DR2A 1UBRS 1XEWY 3JV7A 2OFPA 4A8JB 1Y4AE 3RAPR 1JG6A 2QXUA 4ZVLA 2ZUBA 2P9EA 4ALKA 2VHTA 3Q3GE 3LL7A 3OTHA 3GRKA 1CUJA 3STHA 3BS4A 4P1ZA 3DEHA 1FVHA 3GZ4A 5D86A 2ZJYA 1H6CA 3NTRA 3BXXA 4EF5A 3DLHA 1UPCA 3FOWA 3QPCA 4IILA 3W4IA 5HKLA 4PYJA 3DS8A 4ZZ0A 2QI9C 3OLWA 1J06A 1G1MA 3HO6A 3IDAA 2A0UA 1JLKA 5CNJA 4P8RA 2DOKA 3FDFA 5KTOA 4W9RA 3T3GA 5F4BA 3ZV3A 4P08A 3SG0A 1F8XA 2HHLA 3AVWA 4KNVA 3R7LA 4MUXA 2E4YA 2QHXA 2FMUA 1UMBA 3UW3A 4ER3A 2PUTA 5BXYA 1QHIA 3A4MA 3B6ZA 4EMBA 5KJ1A 1XTVA 1Z6XA 3IULA 5K2MA 5IX8A 1DXHA 3QYAA 4IDGA 4LYAA 2IZ7A 1QYIA 1B0AA 2E0IA 3DTVA 4D8VA 2C00A 3UNXA 4AL4A 2BFOA 1Y1KE 4FKZA 4KR3A 5F51A 4BJ3A 3W5AA 1HSOA 2JCSA 4JNKA 2PE5A 3K8QA 4XPIB 1JYSA 1G21A 3FUWA 4P5PA 4WUVA 1EWKA 2HA7A 2CBZA 2A5LA 4OAOA 3CONA 4N8EA 4KIJA 4CUZA 2GHQA 3V32A 1Z0SA 1PR6A 4GYKA 1SHLA 1CQIA 2VJLA 4XW2A 3UFBA 3VI3B 2WSYB 1ZRSA 4B3SB 3C3AA 2PSSA 4QQKA 2AJDA 5AXAA 2WY2D 1IQUA 3QUQA 3QNMA 4LHYA 1O57A 3AV0B 5FFMA 1UYJA 4FW9A 3X1JA 3ZH9B 4DJEC 4Y6QA 4RTMA 1WETA 3L6OO 1Q0ZA 2PVSA 3LKZA 1YZ3A 3HBFA 3IX7A 3CIOA 3TLYA 1GGFA 4E94A 4GNKA 4LC1A 3T7IA 4CIBA 2OWEA 4PXSA 4XWWA 3EZFA 1V95A 3OE7D 3TLKA 4PRYA 1FTSA