4DPKA

Structure of malonyl-coenzyme a reductase from crenarchaeota
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
354
structure length
354
Chain Sequence
RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malonyl-CoA/succinyl-CoA reductase
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 122
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dpkA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dpkA01
1FDTA 4NFHA 3RFXA 4R41A 3ZWCA 1IOLA 2FMUA 3JV7A 3A28A 1NTOA 3GNSA 2FY8A 4HY3A 4BKOA 1LQTA 4NDNE 2O3QA 1OOEA 1GEEA 1LDYA 3HWRA 2BLLA 4WJZA 5JY6A 4R1NA 1RPNA 1GAEO 1HDXA 2JKVA 2Y1DA 3FCOA 5CDSA 1SOWA 2VOJA 2VNSA 3L77A 4W4TA 2HCTA 4DWVA 3GC6A 5KNLA 5ES3A 4TZKA 1YO6A 3ZWMA 1U2GA 4AJPA 5ENVA 2O3RA 4CMCA 4YJHB 3RKRA 1LRJA 1ONNA 2GRAA 3CH6A 1TT5B 3PTZA 3DEYX 4M54A 3JQ8A 5CEJA 2P4HX 4MVJF 3G0OA 3TOXA 4A7PA 3FWNA 3I83A 1YB5A 1DPGA 2EHDA 1F8GA 2ZB7A 1QYXA 3S8MA 4CLXA 2AXQA 3PDUA 1JN0A 3CE6A 1QP8A 2P4QA 3GFGA 2X5JO 4FFMA 5TT0A 3WICA 3V2UA 2NLOA 3UCXA 4GWKA 5KWEA 4CMIA 3FNEA 4NFYA 4IBOA 3DO5A 3A1NA 4UUPA 5B4UA 3GPDG 1YQDA 1Y8RA 4XYGA 2J5QA 2DU8A 2YZ7A 1XKQA 3F1LA 1GD1O 5JYFA 1E6UA 4BMNA 4B7UA 3BHMA 1ENOA 1Z82A 4GGPA 4DUPA 4BO2A 3OJLA 3RVDA 5EINA 4XQCA 3BHIA 1B3BA 3WSVA 2WSBA 4RPHA 3GH3A 3CSDA 4U7WA 2WE8A 4QFCA 3RC1A 1UR5A 3U4CA 3DTYA 2YUTA 4RQTA 2EV9A 4U5QA 1DIRA 1WPQA 2UDPA 3E9MA 4CQLA 1QLJA 4OHUA 1EZ4A 3TWOA 5DDIP 4GLOA 4RV9A 4J1SA 1O8CA 1MP0A 4PLTA 1GPDG 1EEHA 5JCXA 3PYXA 3UOGA 3K6JA 3COSA 1NX6A 3SXPA 2AW5A 2YHIA 4IINA 4IDGA 4RORA 3AUUA 1GTMA 1DXYA 2HAEA 1UXIA 4J49A 4XD2A 4PG8A 3RWBA 5LC1A 2OP0A 1PJTA 1DOHA 1GV0A 5DULA 8ADHA 2P9GA 5L3ZA 3C3XA 4WCDA 1TXGA 5GZ6A 4N7RA 4P4LA 1CYDA 3F1KA 5G0WA 4YDRA 3TL2A 3WMWA 2Y0DA 3AU9A 4I9UA 1Y8QB 3R3JA 4HKTA 1IZ0A 3TZKA 3R6DA 3OEWA 1D7OA 3GHYA 5TRTA 1ARZA 3UUWA 1EQ2A 1Z73A 1HZZA 3DZIA 4GKBA 4L4SA 1IB6A 4NBVA 4FC7A 1HSZA 4QUKA 3MJSA 5IDXA 5EESA 4RVFA 2VT3A 3DWFA 3G3EA 4EITA 1K3TA 4NBTA 1N92A 5TF4A 1UP7A 3DBHB 4YWJA 2RCYA 2VHYA 3UHAA 1DIHA 4GPD1 3WNVA 3P19A 3KETA 2D2IA 1IPFA 5TIIA 1BSVA 4CLRB 1DDOA 4BNFA 4HFJA 3V8BA 5BSEA 3FBTA 5A4DA 3EVTA 4E2WA 1I01A 3WFJA 1UH5A 4YAEA 5TT1A 1Y1PA 2NU9A 3ICPA 2VT2A 4KUHA 4BO5A 4DLLA 4MKZA 1P1RA 7MDHA 4F6LA 4AJNA 3FBGA 5KVCA 1LC0A 4CPDA 4OM8A 2E82A 4Y6RA 1PGPA 1Z6ZA 3DBLB 1ZNQO 3OQBA 3AUSA 4LCJA 4BNVA 1V0JA 1RYEA 5TS3A 1SBYA 3ZV6A 4AJOA 4B8WA 3B20A 3QWIA 4TRJA 4BO4A 1YOVB 5EIOA 4I5GA 4Z0PA 4RF3A 2Q99A 4R4JA 1S7CA 1E1KA 5MDHA 5LDHA 4DLBA 1IYZA 2ZCUA 1PJ4A 2GZ1A 3ZH2A 3WG9A 2RHCA 4A27A 4ZHSA 1M2WA 1U5CA 3AI3A 4RDIA 3WWYA 1XELA 4CM4A 2B83A 3PP8A 4E5NA 2JHGA 2NVUB 3QP9A 2NSDA 3KSUA 1JW9B 1DBVO 4YR9A 1LDBA 1UAYA 5L4NA 2DAPA 4WLVA 4JROA 2AG5A 1NNUA 2C7VA 2WYVA 3U09A 1O0SA 1B16A 3KRTA 1ZK3A 3P2YA 4II2A 1Q0QA 3TOZA 1DLJA 1I3LA 1QYDA 5IN5A 5L7TA 4S1VA 4YRBA 1UDAA 2CD9A 2O2YA 5JY1A 4BO7A 2E37A 4PLPA 4EGFA 3A06A 3VTFA 4WASA 3NJ8A 1QYVA 4GSKA 4L75A 4NFSA 4ALIA 4B4WA 1YKFA 4E30A 5IZCC 3PGJA 3DZHA 2EKLA 1PJBA 2ZYDA 4I9NA 1KEPA 3O9ZA 1QV6A 2OBYA 1H9AA 1JQBA 2W90A 1ISFA 3OECA 3WGHA 5COBA 4BO1A 4P38A 3WYCA 2AQHA 3E03A 4CQMA 4FFLA 4BO8A 4BMSA 5G0VA 4INAA 3MWDB 1I10A 1R66A 3VOSA 3ZV4A 1I8TA 3VPFA 3PJEA 3IJRA 3L6DA 1FMCA 4W7HA 1RYDA 4ZQHA 1T2FA 4WECA 1TT7A 3RFVA 2Q1TA 3AOEA 4HUJA 4CLOA 1EBUA 1X1TA 4FD3A 4HP8A 4YQYA 5JE8A 2DFDA 3WGIA 2C82A 3ZCXA 4CMEC 4JNKA 1NAIA 4IDEA 1RM0A 1JVBA 3Q9UA 3VH1A 3HJAA 2EIHA 1I32A 3ANNA 5EPOA 3B1KA 3FNFA 2GCGA 2I5PO 1NR7A 2AG8A 1MXHA 3LZ6A 3VZRA 4YT4A 1JKJA 3AY7A 4CM1A 3PLNA 2PA3A 4PLYA 4JBHA 4KUEA 4WLNA 4PZCA 3QA9A 2RHRA 3ZHXA 1WZEA 3QWAA 1NQTA 4CMGA 4YVFA 3FNGA 2OHXA 3NTRA 3FD8A 4P4GA 2AMFA 5DT9A 5B4VA 1ZFNA 4IQ8A 3ZWYA 4GMGA 1U3UA 1X15A 1ENYA 2CF6A 4JIGA 1PJQA 1VL6A 3M1LA 3MZ0A 3ULKA 2V6FA 2HU2A 4S3MA 4AJLA 4Z9FA 2FR0A 1HSOA 1BW9B 2Q2WA 2XOXA 1C1XA 3GGOA 3BTSA 3PPIA 4A2CA 2V6MA 4ALMA 4BGEA 5AYVA 1H2HA 4J1TA 1R6DA 3VZSA 4YQZA 2DT5A 2G0TA 3U9LA 3WJ7A 3SJUA 4AL4A 3PHIA 2TMDA 1K6JA 1WVGA 3ASUA 3JYPA 4TVBA 4CM5A 1GCUA 3K31A 4PLZA 1VKOA 2AQ8A 4CMEA 3RD5A 3O4RA 4OSOA 2YFHA 3FNHA 4OQZA 2CY0A 1HYEA 1QYWA 5T6BA 3PYLA 4D42A 1IY8A 2GD1O 3WGZA 4WNCA 4D79A 1U9JA 1KVUA 5F21A 4BGVA 1MUUA 2JCVA 1BHSA 1E1LA 3GY0A 4P4NA 2PD3A 5JO0A 3QVSA 1NPTO 2Y93A 5DCUA 3GAFA 3A9WA 4R16A 1PWXA 3LDHA 3HUDA 4FDAA 5TNXA 2VUSA 1X0XA 3IUSA 3KO8A 2Q45A 1KIFA 1ZKMA 3JD0A 3MJVA 4QSMA 3CEAA 1A4IA 1QYCA 2C54A 2BGLA 3HQ4O 1R16A 3NKLA 3R3SA 5CP8A 4J4BA 5HM8A 4HNGA 2VCYA 1MX3A 1LC3A 4WK6A 2B0JA 3B70A 3AM3A 1SCUA 4CMKA 1VL8A 2NTVA 2Y68A 2VZ9A 2XF8A 1SB8A 4E2XA 1T1RA 1ZSNA 2BI8A 2QYTA 1VSUA 2ZTUA 5EERA 2WD7A 3OICA 1XU7A 3GDGA 4ITUA 2HDHA 5GMOA 2VHZA 1AHHA 1E7WA 2Y1GA 1JKIA 2Q1UA 4H15A 1PZEA 1Q7BA 1B14A 1HRDA 5GZ3A 2CSUA 4GAEA 2PZKA 5H83A 5DN9A 2NU8A 5IG2A 1CQJA 3OMLA 2BFMA 2JCYA 1PJSA 3TZHA 3D4PA 2GGSA 5ER9A 4HADA 2HSDA 1R4NA 4RL6A 1PL6A 2JAPA 2NU6A 5I7FA 5K9ZA 3KSZO 1P77A 4PN3A 4A5OA 2Y1EA 4A10A 4IPTA 5JFOA 3GDOA 3M1AA 3GMDA 4R3WA 3CIFA 3DFZA 3N58A 4YCAA 1QG6A 4HNHA 5THQA 5T67A 5G4KA 4D3FA 3ZWNA 4DVJA 1PIWA 3PFWO 2C5EA 2OOSA 1E7RA 1KVTA 2XXBA 3NEPX 1ZMOA 1LRKA 2HRZA 5ILGA 3HFSA 2WMDA 4FS3A 3OBBA 5EQDA 5A05A 3H5AA 5JDCC 2PK3A 5KJ1A 1N9GA 4M55A 4FCCA 4HV4A 2B4QA 3OQ6A 3LT4A 2CVOA 1LTHR 4QQRA 4YJGB 4AFNA 3NTQA 4CM9A 3WYBA 4HBGA 2VUUA 2EW8A 4OXKA 1KEUA 1ZSYA 2J3KA 4DMLA 4XQGA 1ULUA 4RGBA 4U6SA 1B7GO 4A0SA 2BFOA 3RUIA 1U3WA 2J5KA 4KWHA 2GLXA 2JHFA 4UEKA 4XZ3A 1JKFA 1V3UA 3H5RA 4C4OA 3RUCA 5CFZA 4GBJA 4MVJG 1EUCA 3HZZA 2VYND 4LRSB 4RJTA 5JLAA 1Y8RB 5GZ1A 4XWYA 1Q1NA 3W6ZA 4B4UA 2DUWA 3MJEA 2YYYA 5F1KA 3BIOA 4N5MA 1GY8A 4RLSA 3R1IA 2FR8A 4CUZA 5JCJD 4YYZA 3IC5A 3DB2A 3AI2A 3NAQA 3IP3A 1I33A 1H94A 4J6FA 3RCBA 2Y1FA 4E5PA 4KOAA 4XYEA 1AGNA 3BMCA 5AOVA 3HE3A 3KVOA 4BB5A 1PQWA 4Q3AA 3Q11A 3EK2A 2UYYA 3ZU4A 3E8XA 5A03A 2X86A 2ZB8A 3QJ5A 1Z45A 4EEXA 2C07A 2I67A 3S1LA 3KTDA 4CV3A 3GK3A 5T64A 1JLLA 2ZTVA 5KCZA 2ZQZA 2V6GA 3NJ4A 4PG4A 3GA0A 4WKGA 3K9QO 4PLCA 4O63O 5U9CA 4HXYA 2YHIB 4GX2A 3LC1O 3KM0A 2P2SA 4CUJA 2OMEA 2UVDA 4MVJA 5JDCA 5F1OA 4DC0A 3Q6IA 2P9CA 2IE0A 5L95A 3L6EA 3VH4A 4BB6A 1AE1A 2TMGA 2A92A 3LVFO 2POQX 2ET6A 2QRKA 1I2ZA 3O03A 1YQXA 1BG6A 2EEZA 2Y1OA 4FFPA 1PZGA 3RI3A 2VRCD 4OAQA 1T2AA 1FK8A 1NPYA 3OETA 5GY7A 1GUFA 4W6ZA 5C37A 1YE3A 1J0XO 1VM6A 1T4BA 1ZUD1 1KY4A 1ADCA 4WGGA 1PR3A 3QW2A 3NV9A 1PGQA 4GLLA 1CF2O 4OXNA 3SBOA 4L0QA 1YL5A 4BQRA 4KWIA 3MTJA 5KJ6A 2GSDA 4OQYA 5A5FA 4RLHA 2VYVA 4NG5A 1LNQA 2VUTA 4R69A 4PIVA 3WMXA 3PIDA 3QIVA 1LDNA 1LU9A 3KHUA 3O38A 4L4RA 1UAGA 1PWZA 5IDYA 4FW8A 3VZQA 4AVYA 1C1DB 3HN2A 2IYPA 4BKQA 3GZ4A 1P0FA 4ILKA 2HKIA 4K6FA 1CEQA 3Q2KA 4YBZA 3KZVA 3INRA 2Q4EA 2F1KA 1MGOA 3PJDA 4B3HA 1RWBA 1PGJA 2QQ5A 4JCOA 4GL4A 1DC6A 3LLVA 1NWCA 2O4UX 4I5FA 2P5YA 2X9GA 4DA9A 5TSDA 2NQ8A 3PXXA 1BGVA 4YPOA 1ADBA 3TSCA 3EDMA 1T2DA 4BHTA 3JQBA 3T4EA 4J7CA 3ZWOA 1R37A 2C20A 2OBNA 1A72A 2HMTA 4NU6A 3ZNQA 1E7YA 3KYCA 2DPGA 3H9EO 2I3GA 3AM5A 2VWQA 3FPLA 5F1PA 4Z0TA 3AU8A 3VKVA 1V35A 2YV2A 5FF9A 2B4TO 2FWMX 1QLHA 3AM4A 4PLHA 4DQXA 5L4SA 1FDVA 4AJIA 3KB6A 1KY5A 3P2OA 4BNYA 2YHUA 5BQFA 3I23A 2EP5A 3JYLA 4YB8A 2WM3A 4CM4B 1Y81A 3G1UA 1TEHA 1EVZA 2E48A 2FR1A 2YV3A 1ZK4A 4IMRA 2FRDA 2Q3EA 3QE3A 3WYEA 3CMMA 4YRAA 3CINA 5J23A 1WLYA 5K0ZA 4E4YA 1NBOA 4O59O 2EGHA 4E13A 2QRLA 2VOEA 4BNUA 3K2EA 5A5EA 4PCVA 3ANLA 4IS3A 3WBFA 3GEDA 2RAFA 2WDZA 3SEFA 2IZ0A 4RF4A 1DO8A 5TX7A 2Y1CA 4PVDA 2C5AA 1DFGA 6LDHA 1HXHA 2BGMA 5AXAA 4TWRA 4D45A 3GZNB 1UDCA 4XA8A 3GGGA 2ZYAA 2UV8A 3K73O 1HDZA 1WAMA 3ONEA 3K5PA 3EY4A 1DRVA 3WLEA 3IIEA 1T2EA 4XJTA 1CDOA 1ZCJA 4CUKA 1J4AA 4XKJA 1V3TA 1YS4A 1GYQA 3GUYA 4L73A 5JAMA 5G0UA 4N54A 3RC2A 1ZVMA 1BDMA 3W6UA 3OHSX 4ND2A 1C0KA 1NVMB 1H6DA 1ZK1A 1SEPA 1OMOA 2QHXA 3CZMA 1YXMA 4J4HA 3QQPA 2BFAA 3PLRA 4EI2A 3C1AA 4IXTA 5BNTA 2JL1A 5CPBA 1X7GA 2X9NA 2ZB3A 4MP6A 1PSDA 4CLOB 4FIZA 4KUGA 3DZJA 1R15A 4JQCA 4URFA 5IJZA 1G0NA 4E5YA 3DL2A 4PFJA 3PHHA 3Q9NA 3ITKA 4YAGA 4L74A 4E32A 2CF5A 2X23A 3H2ZA 3KBOA 4E6PA 2IRWA 3JQGA 2Q22A 4AG3A 4QO8A 1I3NA 3OFSA 3S55A 5C7IO 2PD6A 2AEMA 2AE1A 2DFVA 1CETA 4FR5A 4G81A 1JAXA 1JAYA 3OSUA 4BNNA 2ZQYA 2Z5LA 4B79A 3VDQA 4DMMA 3ZHYA 5A06A 3HB5X 2IODA 3F5QA 1E77A 4RVGA 3PYMA 4UVGA 2ZJ0A 3AK4A 1YWGO 3CTMA 1Y7TA 1UDBA 1YQGA 2PNFA 2HLPA 3DAPA 3RROA 3BA1A 4ZQBA 4ROSA 3ZZNA 4M49A 1WDKA 4R9RA 4TMFA 2OP1A 5DF1A 1H2BA 3H2SA 4BV8A 4IS2A 2B69A 3BMOA 3DBVO 4FGWA 5JDIA 3TFQA 3RASA 5B12A 1IHYA 4GQAA 1M76A 1YB4A 1MB4A 2E6UX 3DR3A 1VJ0A 5DP1A 3ZWVA 1U3VA 2B5VA 3W8FA 2Q1SA 1LLDA 1HE2A 1Y5RA 1SEVA 4YEDA 3DOJA 4BIIA 2FPGA 3E1KA 1I30A 3MEQA 3ETEA 3JQAB 3VVCA 4Q3EA 1OC2A 1I0ZA 3RUDA 1YVEI 2D1YA 4N5NA 3GVXA 4R1UA 3V2HA 4YJFA 2DLDA 3L9WA 1UUFA 3WQQA 1LRLA 3SC4A 3TQHA 3ROKA 2NQTA 3SLKA 2O48X 2Q2VA 1N1GA 1ISHA 3U5TA 1S6YA 4H16A 3FSRA 5L7WA 3E82A 2DUUA 2FP4A 4J2OA 5I7EA 1EMDA 1GQYA 1M75A 3OA2A 1W0CA 2PGLA 2I76A 4NK4A 1MC4A 3KUXA 3PWKA 5I8WA 1ZJZA 1GL3A 4D3DA 2VZ0A 1NXQA 3BTUA 4ND1A 1E0DA 1PJ2A 3HADA 5LCXA 5FEUA 2C7GA 1P1FA 1GCOA 2BF7A 3E5MA 3HDJA 1NHGA 4XQEA 3ADPA 3FN4A 5C3MA 3I6QA 1E3IA 1JTVA 1HE5A 3S2EA 1AUPA 3I9LA 3SJ7A 2HMWA 2UUPA 3F46A 2WD7B 5G4LA 1HTBA 3AOGA 1I5RA 3UCFA 2GF2A 2P68A 3UH1A 3WIEA 2PZLA 4MIYA 2A4KA 3TPCA 3DTTA 1VLLA 2C29D 3LSYA 3NRCA 4EUHA 2EKQA 3L07A 3UXYA 2DTEA 1OI7A 9LDTA 4H3VA 1LX6A 4HFRA 3WJAA 2H6EA 3H3FA 3TZQA 2OFPA 1E3JA 5DNAA 2B36A 4ZQGA 2J3HA 1F0YA 4K6CA 4UUMA 4MVJM 2JCXA 4E5KA 2D8AA 4AJJA 1KETA 2Y05A 2FZWA 1E3EA 4UVIA 3PQFA 4FQ8A 5TGDA 1I3KA 4FFOA 1U4OA 3VPHA 3PI7A 4FJ2A 1XIVA 4R1SA 1LJ8A 2PKRA 2NM0A 4DGSA 3V1UA 2W8ZA 2I3AA 1RKXA 1E3SA 2A94A 1I2CA 1EK6A 3K30A 3NGXA 3BHJA 3W4KA 2V65A 4GI2A 5FWNA 2VHVA 3TZ6A 5G4KB 4J0EA 4KMSA 4IDAA 3DMYA 1AXEA 3AOEC 1BMDA 3EC7A 1BXKA 2LDBA 5LDGA 1EUZA 4E21A 4IZHA 1I2BA 4ZD6A 1PU2A 4NBUA 1P9LA 2WTBA 3D0OA 1A27A 1E92A 4TROA 2CDCA 1SB9A 2AQKA 4O0LA 3B1JA 4RVUA 4D46A 1HYHA 2JFHA 1TVEA 3PJFA 4NPCA 3UICA 3UGKA 4BNTA 3UCEA 3ORFA 1P3DA 2CMDA 2ILTA 4E12A 4M86A 3EAGA 5JMPA 3BAZA 2C2YA 1LDEA 3Q1LA 3OM9A 2EW2A 4UVHA 3UW3A 4DIFA 3ZGYA 6ADHA 5EN4A 2GN8A 2P91A 3LLSA 2PLAA 1G6KA 2EF1A 4CODB 3HDYA 3H4VA 4PLWA 3R0IA 4IQ0A 3I4FA 1Q0HA 2VHXA 1CJCA 3F9IA 3WXBA 3BMCB 5L4LA 2QX7A 3C8MA 1J49A 4IUYA 3CKYA 3WS7A 4U0JA 3UKOA 4XDZA 1H6CA 5C7LO 4N18A 4WCFA 2NUAA 3PHLA 2AE2A 1KS9A 4HFNA 4MJLA 4KTTE 4MKRA 1YRLA 1A5ZA 1B8UA 2JAHA 1U8FO 4J7UA 2YY7A 4CL3A 3ETDA 4NH4A 5HA5A 5KIAA 4EW6A 4DLAA 1Y5MA 2Z95A 3GHHA 2X8LA 2BD0A 1C0PA 4DPKA 3EZYA 3ZN2A 2OO5A 5HTOA 4CR8A 5L51A 4XR9A 2Y0CA 1M6WA 1HWYA 4XIJA 3BMNA 4I8XA 4NJMA 4YJHA 5EQFA 3TJRA 3GF4A 3D3WB 3I4CA 4MIEA 4Q3DA 4B3JA 4B8ZA 5EJ2A 5L40A 3O26A 4BNGA 1ISMA 3Q2IA 3LK7A 3IP1A 1P33A 2Y66A 4K1LA 1E1NA 4FB5A 4FPXA 2VTEA 2X1HA 3ITDA 1K89A 4FOSA 3WB9A 3W4IA 4LGVA 4RF2A 4KQXA 2OORA 3GAZA 2O4CA 2FOIA 3PRJA 1E5QA 1W8DA 5B4TA 1E7MA 1ADGA 2QRJA 2WYWA 1E6EA 1XLTA 3A14A 3OH8A 4UREA 5IN4A 2EJWA 1C14A 5JYDA 1BXGA 2VWGA 3PHGA 1CWUA 1A9ZA 1DJNA 2HJRA 2JFFA 2VTDA 2W98A 2X0JA 1P74A 3F5SA 1LBEA 2DC1A 4GWGA 4MPDA 1T4DA 3VC7A 2I99A 3WSWA 5JYEA 3E6AA 4R5MA 4GH5A 4BGIA 1IZ9A 3OIGA 4B7XA 3D64A 2PKQP 5IFLA 4RVDA 1A9YA 5AXCA 1Q2XA 4XGKA 2DM6A 5HBRA 4AJEA 3OEYA 1KVQA 1WMAA 1YDEA 2HMSA 1TI7A 4Y9DA 4F46A 3JD4A 5IZ4A 4O1MA 4ESOA 2ZCVA 2GR9A 3H8VA 4IDBA 3WOHA 3IKTA 1ISJA 1Q0LA 1AN9A 3GR6A 3H65A 4IJUA 4TRRA 3AY6A 3DZBA 1R0LA 3F47A 3PDJA 4ZRNA 1VRWA 5AQ1A 3GFBA 1P0CA 3DZKA 3L9XA 1UXJA 2J8ZA 1VI2A 1E7SA 1XDWA 2AEJA 4BO9A 4BO0A 1A7KA 1SPXA 4OOFA 5F5LA 1P1JA 2AHRA 5COAA 2BMAA 3DXFA 3L0DA 3T7EA 4I9HA 4HFMA 1P1IA 2X9VA 5ER6A 2W2LD 3G49A 2FPPA 4ZA2A 2QIOA 5JO9A 1KERA 4XR4A 1PX0A 1DC5A 4GVLA 3LF2A 1D1TA 2DTXA 3CXRA 1LA2A 1A7AA 3AJRA 4XB1A 1E6WA 1X7DA 3DAFA 1NQOA 3RKUA 1SNYA 2AEFA 1GFSA 1PJCA 5TC4A 1EVIA 3X2EA 4Z9YA 2O2SA 3MCVA 4DPLA 3JQ9C 2PGJA 4LRTB 5B37A 3JQAD 3L6OO 1NAHA 5CHEA 4PZDA 3I1JA 4BNZA 3DBHA 2OZPA 2NADA 1O89A 4RQUA 2HO5A 4CLEA 5G0TA 5ITVA 1EBFA 3DHYA 5KKAA 2VYNA 3MOIA 3K92A 3WGTA 1EE9A 1PJLA 3AUTA 4FBGA 1HZJA 3IS3A 3RBVA 3PWSA 1YH3A 1RM3A 2CFCA 3GVCA 4X54A 3JQ7A 3WFIA 3JQ8B 1F17A 2HK7A 4BOYA 1ZEMA 1ZXLA 3UF0A 2HUNA 3TNLA 4FC6A 1K2WA 2ZTMA 4WEQA 3Q0EA 4ZJUA 4ZICA 1PS0A 2NV6A 2JD2A 1D8AA 1O94A 3WX0A 1X1EA 1DRUA 3CMCO 1QR6A 1IPEA 3QSGA 3ZW9A 1WMBA 4DL9A 3ENNA 3W8DA 3JYQA 3ZHBA 4CMIB 3DONA 1PS8A 4M1QA 4YAKA 4CMAA 1JVSA 2YV1A 3ZWPA 1N7HA 4L76A 4TZTA 1F8FA 1PQUA 1DHTA 4DTIA 4ALKA 3VTZA 1GR0A 2CVQA 4RPJA 4XEHA 4PG6A 3JQ9A 2Q1WA 4UUOA 5L53A 2VRCA 1I24A 2GN6A 3PQDA 1TLTA 4M87A 1U8XX 1UZMA 2BFPA 3N74A 2W2KA 1EVYA 2IXAA 4R51A 4XYMA 4YAIA 3GPIA 2BI7A 5T5QA 3GRPA 3JQEA 1E3WA 1ML3A 2GPTA 4IGEA 4IDFA 1AHIA 4XCVA 5A9RA 4Y67A 4CQLB 1PS9A 1M6HA 3DBRA 4JX8A 3C85A 1Z75A 2DBRA 3SX2A 3MJ4A 2CVZA 1T1SA 4OH1A 1O6ZA 4W9NC 1P1KA 3FRJA 2X58A 4CV2A 4KDFA 2Z1MA 2PGDA 5CG1A 1PL7A 3LC7O 2IXBA 2CZCA 1GZ4A 3PVZA 1CERA 4CM9D 4LK3A 4CM3A 2Q2QA 1U3TA 3JQBC 3AY3A 4WEOA 1HETA 3K8ZA 4MINA 4YJFB 4DPMA 2O50A 4IIVA 4YRDA 4D3SA 3PQEA 4K26A 1ZIDA 1U5AA 1KEWA 1LDGA 4RCVA 4I1IA 4IDCA 1H5QA 4IJKA 4ID9A 1CRWG 3W8EA 1EDOA 3I9NA 1PGNA 1XQ6A 4D44A 2BH9A 1ENPA 3ICCA 4RPGA 4WE3A 4DREA 4R5HA 1UP6A 1BVUA 5DZSA 4IMPA 3E18A 4KTVE 3DC2A 4CJXA 1XWFA 3Q3CA 1PJ3A 5DCYA 1DSSG 4OKIA 4PLGA 2W4QA 5IAAA 4DIBA 3OP4A 4BNXA 5BR7A 1SZJG 1KYQA 2B37A 2JFGA 3LQFA 2EERA 4IY1A 3GRKA 1YBVA 1D4FA 2VN8A 4FJ1A 3X2FA 3W4JA 2CUKA 4P22A 1PL8A 4H7PA 2YDYA 1ZK0A 3KEOA 4UULA 1A71A 2J6IA 4CM8A 4CLDA 1N5DA 4LISA 4JJIA 4BMVA 2WE7A 4NR0A 1L7DA 5A3VA 1GYPA 2XPCA 4QO7A 4JP3A 1UZNA 5JAZA 3C7AA 5I7VA 4OYRA 1EK5A 1GV1A 5KJCA 4W9NA 1NVGA 4MVJD 3GVIA 1UZLA 3OIFA 5A9SA 5TLSA 1P31A 4EJ0A 3NDRA 4LVUA 1B8PA 1FJHA 3RC9A 3GQVA 4D0SA 2FSSA 2RBEA 1C0IA 4QECA 2YJZA 1LI4A 3ZWXA 3GOHA 3E5RA 4IIUA 1R4MA 4XGIA 3MJCA 4E0BA 1U28A 1FDUA 3WDSA 3P5SA 3ZNOA 5FYDA 4OOEA 3NDJA 4BNLA 4BO6A 3GEGA 3FI9A 1WP4A 4CR6A 4MIOA 2YQ5A 4E3ZA 4GVXA 5F5NA 2VYVD 2GYYA 4IJWA 2OXIA 2HMUA 2QW8A 3ZHZA 3GG9A 1WNTA 3MOGA 3JYOA 1DHRA 1JDJA 1C0LA 4IQGA 2JJYA 4FJ0A 2G82A 3WBBA 1PTJA 1IULA 5EMHA 3KOUA 5T8KC 3JTMA 4NIMA 4TSKA 4QX6A 5C5IA 4YAJA 1VC2A 3QVOA 2D3TA 4YT2A 3PFFA 3LT1A 2D59A 4A26A 3JCZA 3WQSB 3JQCA 1ZK2A 7ADHA 2H63A 1K6IA 3ZWWA 3RU9A 1KVSA 5A04A 3JYNA 3NDIA 4J9UE 3BTVA 2EJVA 5I9MA 2ZB4A 5JDIC 2NTNA 4NMHA 2YDXA 3U4IA 1NVTA 2BELA 3WGQA 3FPCA 4CQMB 2GDZA 5L45A 1YONA 3V2GA 4Q3CA 4EDFA 3NX4A 5U4QA 2C59A 5K6AA 4BGUA 4E2YA 2IEBA 3BTOA 5HWSA 5BT9A 1H6AA 4GKVA 4XJSA 2VZ8A 1QORA 1LDMA 5BSHA 3MWEB 3IJPA 4LMPA 3RUFA 4W99A 4II3A 3BZUA 5CG2A 1V6AA 1XQ1A 4AICA 1DFIA 2NNLD 4XRRA 4XYLA 4RDHA 4ZVVA 4BQPA 3GG2A 1Z7BA 2O23A 2H9IA 1OAAA 1PGOA 2EWMA 4DC1A 4LSMA 1YB1A 1R12A 1KVRA 5A9TA 1CQIA 1ORRA 2CDAA 4OSPA 1FDWA 4B7CA 1B2LA 4Y6PA 3BMNB 2J3JA 4NJMB 4ONEA 3B6ZA 3LT2A 3KYDA 4Y6SA 5COQA 4EUFA 4CMBA 1FDSA 4I5EA 2DBVO 1GEGA 4Z6KA 2X5OA 4ZN6A 3F3SA 4R01A 5T8KA 3UAGA 1ZW1A 4E31A 1K6XA 3M2TA 1X13A 4OJNA 4QT0A 3WTBA 3OA0A 2I66A 4YJGA 3ROMA 1UP4A 3G17A 2DBZA 3GUCA 3NTOA 3RUAA 1ONPA 1WXDA 4MVJH 3O8QA 3DDNA 3ST7A 1E3LA 2X5KO 3EMKA 3OJFA 5JW6A 2ZYGA 1NM5A 4PG5A 1JWBB 1Q7GA 1YJ8A 2ZIZA 4JLWA 3VH3A 1N1EA 4LMRA 4U8GA 3A4VA 5HRUA 2ZKLA 2X22A 4PG7A 3PJGA 1C1XB 4YT8A 2Q50A 1O5IA 4EUEA 3WIDA 4YACA 3GNQA 1BXGB 3OIDA 1DLIA 1BDBA 1X0VA 5ICSA 3DMTC 1NASA 3GN1A 4YXFA 2G17A 5ICMA 1HDRA 1VE9A 3ASVA 3JD1A 4OL9A 5AXDA 3GMSA 1GADO 4FSHA 1WWKA 1L7EA 4WLFA 3KSDO 5A1TA 2O3SA 1TA4A 3PZRA 1EQUA 1YGYA 1P1HA 4AJ1A 3FTNA 3GGPA 4M89A 3IUPA 1DB3A 1ZH8A 4BNJA 4IXWA 5JAQA 2PH5A 3D1LA 3MTGA 1SMKA 3ONFA 1DRWA 3DZFA 2ZJ1A 5DBIA 2X0NA 5FI3A 1EFKA 3VVBA 3NYWA 1B26A 2DBQA 2DQ4A 4Q9NA 4RZIA 3JSAA 3JD3A 4UEOA 4F6CA 4WUVA 1SOVA 4E5MA 4WPGA 1E1MA 1NHWA 5IDWA 3QVXA 4Q39A 2WYUA 5I9LA 5ILOA 2OL4A 1XCBA 3TRIA 5I7SA 3ETGA 4IZIA 1GYRA 1EUDA 4ZQFA 1DIBA 4WNIA 2PFGA 4QXMA 5MGBA 4Q3BA 1DIAA 3NT4A 3DZGA 2YQ4A 1HEUA 5THKA 1YDWA 2A35A 2EG9A 5DBFA 2J3IA 8LDHA 3ANMA 2PZJA 2UUOA 4Z9XA 1DAOA 3KLMX 5U1PA 3L4BC 2GN4A 4KZPA 1BRMA 1WDMA 2Q46A 4NHEA 4TQGA 3KV3O 1OBFO 4MVJE 2BRUA 3DMTA 4ALNA 2VRBA 5J9GA 1U4SA 4KQWA 1VJTA 3OJOA 2H5LA 4PLFA 1MG5A 5G0SA 1PEDA 3GEMA 3LT0A 3ZU3A 1H0KA 1N2SA 4Z3DA 4YA6A 1R4NB 3SC6A 3FHLA 1NWHA 3QWBA 4XB2A 2D5AA 3B1FA 1C1DA 3C7CB 1LLQA 3GLQA 1I3MA 2CNBA 4PVCA 4QEDA 1RM5A 3RU7A 3N7UA 3ZU5A 1YBAA 2C2XA 1KC3A 4WCFC 5IXSA 2Y67A 1QRRA 4M8SA 1LSUA 3DOCA 4BKPA 3AFNA 4JBGA 4J2HA 3RC7A 1ZZEA 4JN6B 3I9OA 3HDQA 1DFHA 3JQ7B 1OZAA 2YW9A 5KJEA 4NK5A 1GUYA 1XR3A 2EP7A 2GNAA 1M66A 4DBZA 2FZEA 1N9GB 3P7MA 1LLUA 3FR7A 4UVEA 1DEHA 3BMQA 4JJFA 5DCWA 4NU5A 4IM7A 3ENKA 3ZNNA 1O9BA 4N5LA 4YT5A 5L7YA 4L8VA 1CIVA 3RBXA 3SLGA 4BKRA 4CMHA 3F4LA 1FXSA 3PWZA 2UAGA 4IDDA 4I08A 5HS4A 1MFPA 1Z74A 1H6BA 4CM7A 1Y9AA 1ONOA 2BKAA 3U4HA 5T73A 3WGOA 4BNIA 4MKXA 1NP3A 3DHEA 4KDEA 2NVWA 3D4OA 1MV8A 3ABIA 2X6TA 4P8RA 2VHWA 4IGFA 2G76A 4BKUA 2GZ3A 1HE3A 1ZMTA 2O3JA 3L4BA 5DOVA 5H81A 4DXHA 2DTDA 2RH8A 2FSVA 4EJMA 1U7HA 4OO3A 5T57A 3TZCA 1QSGA 3BYZA 3ZDFA 5JMWA 1B3RA 1XG5A 4BNWA 2O7SA 3LF1A 3AI1A 2HK9A 3I9JA 2W2KB 3I9MA 1DAPA 5JAIA 1MA0A 1ZJYA 3HG7A 2FPIA 5TJHA 1E3WB 2IZ1A 1K0UA 4UUNA 5TQVA 3SVTA 5JS6A 1V9LA 1DC4A 1XYGA 3C7DB 4GSLA 3GZNA 1IUKA 1OFGA 3D5TA 4AJ4A 3DBRB 5FI5A 1TB4A 1UXHA 1H9BA 2RH4A 4U0KA 3RBZA 4G2NA 3QV1A 3D5QA 1ZBQA 3UVEA 1F06A 2X7HA 4WLOA 5ENDA 5IDQA 3TL3A 3L4SO 3E48A 4MVJP 5JYAA 3NT5A 1J6UA 1K5HA 2PR2A 4OIMA 3EZLA 4RF5A 3PHJA 1N7GA 2VQ3A 4NZ9A 4BL5A 3E9NA 4B4VA 4DYDA 1HLDA 5C7OO 3ZWAA 1C3VA 1TT5A 1W73A 1HDCA 4OGWA 4WLUA 3D7LA 2HRBA 4NBWA 4ZU3A 3GNTA 1VSVA 4OKNA 4ZGWA 3PIIA 2IYOA 3IQDB 4EEZA 1DC3A 2CDBA 2LDXA 3DQPA 3JQFC 1EVJA 3IL2A 3I52A 3TFOA 2E4AA 1N8KA 1B15A 2ZK7A 4FFRA 4OXYA 1NR1A 4GX5A 4DYVA 1YBMA 5I9NA 4TRNA 3INGA 4RZHA 1LLCA 4FOOA 3VDRA 3QWFA 3TN7A 4CQMD 1EE2A 1LSJA 1J5PA 2R6JA 1L1FA 1Z7EA 2I6TA 4D43A 3V1TC 1GZ6A 3AUAA 3UN1A 4KP7A 4XIYA 5BNFA 5CDYA 2D4AA 1U1IA 4NNJA 4GGOA 2G1UA 3KEQA 4WOJA 3ZI0A 4CM8B 1O95A 5IZCA 4B3IA 4EBFA 3HDHA 3H7AA 1GZ3A 4MP3A 3WNQA 3FTPA 5KVQA 3UFXA 5A3JA 1XHLA 2Q4BA 4LVCA 4E2ZA 1KC1A 3G1TA 1ZEJA 2EKPA 2O7QA 1GU7A 2NWQA 3OJEA 5EL0A 5FFFA 3WQRA 1NQ5A 2W2LA 1XGKA 5A9SB 2NU7A 1HKUA 1P44A 3ZNPA 3HN7A 1LEHA 1VKNA 3KYCB 5A02A 3ZU2A 1R4MB 3GVHA 3VPXA 4ND5A 5JC8A 4WLEA 3CZRA 4LSWA 1ISIA 1NFFA 4Q3NA 2PZMA 4RO0A 4EYEA 4J90A 2WD8A 3JQAA 1R0KA 3EVNA 1HE4A 2P9EA 2DPHA 3HFGA 4O5OA 1WZIA 4DIOA 4CM6A 2G5CA 3JQFA 3IAHA 3ZW8A 3V5NA 2WJPA 2QZZA 3PK0A 1QMGA 1ENZA 5JSFA 2OUIA 4LCEA 4G65A 5BNIA 2PWZA 3RFTA 5CDGA 4NBRA 1Y8QA 1B8VA 1I36A 1ULSA 3GT0A 3I9KA 4Z0HO 3S2IA 4JBIA 2RIRA 5KJFA 1MG0A 4AJ2A 1LXCA 5L9AA 1T2CA 3H9QA 3PZBA 1NPDA 4EZBA 4G5HA 4C7KA 1HF3A 3U0BA 1RM4A 3PGXA 2B35A 3RSHA 2PH3A 3WLFA 4R68A 2DVMA 2IEDA 1W4ZA 1NFRA 3AFMA 4J4TA 1JWAB 1MFZA 4BNKA 1F12A 3U62A 1RJWA 1SC6A 2HK8A 4J0FA 3AWDA 2B4RO 2BGKA 4BV9A 2P5UA 3LC2O 3KXDA 4NJOA 3DHNA 4MVJI 4BO3A 2XXJA 4CLRA 1AXGA 5I8ZA 4CLHA 2VWHA 2FN7A 4BS9A 3HHPA 4UVDA 3M2PA 3ON5A 3CUKA 4PRLA 3EHEA 4RVHA 1T25A 4OMUA 4Z3KA 3VAZA 4TVOA 4CMJA 3IOYA 3EW7A 1DJQA 3HSKA 1X7HA 4RPLA 3NUGA 4XX0A 3H6KA 2A9FA 3DBLA 5G2OA 3OQ1A 5JCJA 2ZATA 3TF5A 4J91A 2E49A 4A73A 3CPSA 3BXXA 3MJTA 3RUEA 2HMVA 3T4XA 2JD1A 3JQGB 1LSSA 4Y98A 1YOVA 2QYSA 2I9PA 3D4NA 4R9SA 2QZ9A 3AW9A 3RAJA 5IXYA 3ZV3A 4AJKA 4BUCA 1F14A 4GX1A 4ALJA 4YJDA 5ADHA 3KYDB 1E5LA 2V6BA 1ZXBA 2PV7A 3PEFA 2R00C 1D1SA 4FGSA 4LW8A 5DP2A 2NVUA 3ONDA 2R2GA 3QRWA 1BWSA 1U2DA 1KOLA 3KLPX 3INTA 2I65A 4DBVO 3S2FA 3RIHA 4R3NA 3F4BA 3O8QB 2WWRA 2OGUA 2X0RA 4PGFA 3JQDA 3WTCA 5JBIA 1MLDA 1LQUA 3QWHA 2B5WA 1HDYA 4BNMA 1GQ2A 3BMOB 2YFQA 2V7PA 5CEFA 3RQSA 9LDBA 1G1AA 4XQ9A 4LN1A 3LU1A 4D0RA 1XEAA 1JA9A 1EDZA 1PZFA 4MO2A 4JK3A 4QTZA 4J7XA 2VNAA 2Y99A 1VPDA 3EUWA 3C24A 5AXBA 2NVBA 2NTJA 2AA3A 3H5NA 1SAYA 1FF9A 4IJVA 1P45A 2H1SA 3RJ5A 2F00A 5TJ9A 5CAEA 1G0OA 5JPIA 4XRGA 3C1TA 2PY6A 3F6YA 3IDSA 1MXFA 4CL8A 1GDHA 2D0IA 3U49A 1BTOA 3H9JA 3WWZA 2GO1A 1D3AA 3S2GA 1KBZA 1UXKA 1OC4A 2GERA 4TKMA 1YL6A 1SO8A 3C1OA 1R0SA 1B0AA 3VPSA 1A4UA 4HX5A 5F3RA 1HT0A 2IDZA 4DQVA 4YTEA 1PQPA 4PZEA 4C7JA 5ITWA 4PRKA 3V1YA 2PD4A 5H82A 1NFQA 1YJQA 2QG4A 3FR8A 4FFNA 2X0IA 1PZHA 3FF4A 2J5RA 4J16A 3H9UA 4PLVA 2R00A 1Y9EA 3H9GA 4J1NA 4UEJA 3RJ9A 3VHRA 1T24A 4J9VA 3U4DA 3OJ0A 1PR9A 5IF3A 1HLPA 4MP8A 1HDGO 3RUHA 3WR5A 4L9RA 1IHXA 3QVTA 1HYGA 1LSOA 3WGYA 2EXXA 1BXZA 1QV7A 4Y8VA 3G79A 4ND3A 4XGNA 3GVPA 3T7CA 1JU9A 3D3WA 3QHAA 5KVSA 3U3XA 4K9DA 2BHLA 4RVSA 3QVWA 2JD0A 3TDKA 1IL0A 4BNHA 3ROPA 5JXWA 3I6IA 3QLJA 2NACA 1T26A 2WEKA 3GN2A 4D7AA 4XYBA 1ID1A 1KEVA 3JD2A 3NGLA 4NQZA 4F45A 4J3FA 4DQUA 3ADOA 5JNLA 4D41A 2HQ1A 1X14A 4WOKA 1UXGA 4J43A 3STHA 3VH2A 3D3EA 4W82A 3ZV5A 5JC1A 1GPJA 5CPFA 5K6AC 3M6IA 4A03A 1V3VA 2EGGA 1BW9A 1DIGA 2AQIA 1M67A 1WW8A 3VPGA 1LUAA 1U7TA 4QFDA 5M6DA 4F3YA 2O3TA 1H93A 3OF2A 5KOIA 4XDYA 3EGOA 1XSEA 3LYLA 4TRMA 1BVRA 1VL0A 3VKUA 4W7IA 5AVOA 4ND4A 3ZWBA 2HJSA 1QKIA 3IKVA 4TKLA 1YL7A 2SCUA 2Z1NA 3ROQA 4L4XA 4U6QA 4ZRMA 4DRYA 4I5DA 3E9QA 4EJ6A 5B1YA 1EFLA 1XU9A 3WGGA 3BMQB 4B4OA 2O3UA 2C0CA 2XAAA 1WDLA 4CV0A 3QY9A 5CDUA 5KKCA 2FHSA 4JGBA 4MOWA 3GDFA 3FWZA 2Q49A 3KYBA 1QXSA 1W6UA 3HNPA 2PTGA 4O6VA 5CEEA 2D5CA 3IMFA 4CR7A 2DKNA 1HDOA 1ZO8A 3DFUA 4AJHA 1IE3A 1UJMA 4GX0A 1XA0A 1ISGA 3I3OA 5DOZA 2Y0EA 1E7QA 3I5MA 3NT2A 4JXKA 3VZPA 5BSGA 5KTKA 2ZTLA 1Q7CA 3EYWA 1Y6JA 2IZZA 1GQQA 2VWPA 1ZSVA 5DBGA 4UAGA 3DAGA 4JP2A 4RPKA 4MDHA 4FN4A 2GZ2A 5BSFA 3W1VA 3H3JA 1ADFA 4ZQEA 4J1QA 4JJGA 4NI5A 2PKQO 5KVVA 2GUGA 1NYTA 2X4GA 1V8BA 5CDTA 3HB4X 4HWKA 4E33A 4K28A 4CV1A 3JQ6A 4R1TA 2GASA 4BVAA 4R54A 2GN9A 3K96A 1MC5A 4GMFA 1VJ1A 4ALLA 3K2BA 1GUZA 4WCFB 3DOOA 1HL3A 1NQAO 5HS6A
chains in the Genus database with same CATH superfamily
4OU4A 2JGLA 3C3JA 1OTXA 3NHFA 4B3SB 3STXA 3QMWA 2CXHA 4NFHA 1KO5A 1USKA 1GR1A 4UHFA 5BO5A 5E2IA 4BKOA 4W7SA 1LQTA 1CFZA 4Z1MA 2O3QA 3CHYA 3HWRA 4IHAA 3DKKA 2BLLA 3JW8A 5JY6A 1SXJB 4CXMA 2V9ZA 3U7GA 1QIEA 4WXHA 3H2JA 1L8LA 5JEEA 4DWVA 2HCTA 4Y1RA 1QQ7A 1C9DB 4O1IA 5G3YA 2B8EA 1UYJA 2O8EA 3ZWMA 4PNZA 5I7OA 5CFPA 1DGQA 4AJPA 2ZR0A 2B99A 1S2MA 3DP7A 2IOYA 1XA4A 4LSZA 3DUFA 1KMNA 5G1PA 3MB5A 2BGIA 2PUFA 2GRAA 3FCUB 3U3RA 4D9GA 3IX7A 3QU4A 1V5WA 1EHYA 1Z62A 4MVJF 5CEJA 4BU0A 1Y3IA 2I87A 2OD9A 3FWNA 5L3RA 4ZK2A 4IH4A 3I83A 2I8LA 3CGWA 3T95A 2JLXA 1FYFA 4EW1A 1OH8A 2Q3BA 3B8HA 4RAOA 5T3UA 3TKLA 1DO2A 1CUAA 1RBYA 2VG8A 3M6WA 2ZB7A 4FSXA 1KK1A 1QYXA 3NANA 3S8MA 3OKCA 1DTEA 1FPMA 1KQ3A 2BEUA 1TFUA 2KBEA 3P8ZA 4I6JA 5DGDA 3VZBA 2O0KA 2OHGA 3R0XA 2JJQA 3CE6A 3C16C 3T5CA 3GFGA 1XDDA 2J7PD 2X5JO 4TV9B 1A95A 1ECFA 2G83A 1T15A 3A1WA 3UCXA 1SVSA 2H16A 3L7NA 4H4EA 5E8RA 2FJ0A 2XA2A 1P81A 4CMIA 4PGHA 2YWRA 2BKUA 2I4RA 4MR8B 5BXQC 2I9KA 4IBOA 1XQYA 3EBLA 4EM6A 4UUPA 3K0AB 1P2FA 5B4UA 1E1CB 3IHLA 3LXRA 5IAOA 5FLXA 2J5QA 1TO2E 2DU8A 2YHSA 3USES 4QZVA 3JALB 3T7IA 4QDKA 4DLVA 2WYIA 4NZMA 1MAVA 1TUGA 4D98A 1TCBA 4DUPA 1Z82A 2B94A 2P30A 4AC9A 1DAHA 2VLBA 2OSBA 1L5KA 1USVA 2IU0A 5JNVA 4X66B 1NW8A 1U0RA 1HO3A 2A0WA 4Q9LA 5FB3A 3PX7A 1EGHA 3C6ZA 2PHZA 1OFHA 4H7JA 2IBMA 2QUKA 3WIUA 2J30A 4CTKA 4QFCA 4PZAA 4CKYA 1VLZA 4UU0A 3EUAA 4CF5A 3DTYA 5HKAA 4RQTA 1NLZA 3GL9A 4TN5A 3U13A 1R8QA 2GEKA 3DLTA 1T91A 5IK2D 1YMQA 3MYYA 3DMDA 1NXOA 2XMDA 2Y3IA 4BWFB 3TQSA 1S7GA 2AWOA 1EEHA 2CUZA 4IXDA 5JCXA 4P5PA 1PFQA 2ZYTX 5C2JB 1JHAA 3COSA 4A82A 2V8OA 4YV2A 2W2MA 4EPYA 2WWFA 4OK3A 4IINA 4MGZR 4I3GA 3WDLA 3SAJA 3J80A 1VJGA 3KUCA 4X84A 5EJ9A 3PD0A 1JQAA 3NEAA 3P0FA 3BOSA 4FMPA 4OHZA 1M2KA 2PS3A 3T7JA 3OEHA 2OCKA 1VJ5A 4MEJA 1O96A 3HSSA 4AW9A 1Y98A 3T3PB 3WYFA 5BWNA 1YFLA 1GPWB 1HY3A 2OP0A 4A91A 1PJTA 3IDOA 2GEJA 5L3ZA 1AZWA 9MHTA 4WCDA 4F3RA 5GZ6A 2C00A 4N7RA 3TD6A 3LWDA 3F1KA 2NZXA 4Q05A 4YDRA 1VHLA 2GXQA 3CNQS 4HSGA 2XBMA 3A1VA 4RH0A 2JGMA 4H6XA 4JOCA 3FUXA 3GQBA 1IZ0A 5J5VA 3RRZA 2AZ4A 4UU7A 4PAWA 2R85A 2ATIA 2V03A 3O1HB 1A4RA 1VCIA 3OPYI 2QGZA 3NTUA 4NPAA 4E7OA 1ARZA 1Z73A 5IT0A 1NGSA 5D2CA 5DM1A 1WU7A 3PPWA 4N48A 4ZV4A 2IYXA 1GKUB 1USUA 4INJA 1NN3A 2X15A 4Q9IA 2C3YA 3G3EA 1A9TA 5J2UF 1K3TA 3IAM6 3HB7A 4UAUA 1KYWA 1VMAA 1M33A 1CF4A 2Q6IA 1DE0A 3MPOA 4C6HA 3ZHCA 1KDRA 5G02A 5EP3A 3W78A 1A9PA 4FIDA 1JU3A 3V2IA 3OT4A 4ZVQA 3UO8B 1XKLA 4V0ME 4GPD1 4C89A 4ZYUA 3QJGA 3KETA 2D2IA 2TSYB 3CKLA 2JGFA 1BSVA 1DDOA 1WOMA 4BNFA 4Y2VA 4F4HA 2H4ZA 4H0FA 2YINC 4HFJA 1JZSA 1QIKA 3FBTA 3SC2B 3V8BA 3EVTA 5M3BA 1N77A 3UMBA 2COUA 1GQFA 1UH5A 1T8UA 4EENA 2YNMC 2VT2A 4ZTZB 3ED1A 4BO5A 2L42A 1NMYA 1P1RA 4JMPA 4TMWA 3OWOA 4DCSA 1Q1GA 1C8VB 5CYOA 3EXIB 1BWPA 4QQFA 5KVCA 1JFFB 3NM4A 1U80A 4OM8A 5F33A 4CPDA 4BJ3A 1JB9A 1T9AA 2D54A 2ZE6A 4AUEA 1NN5A 1R7RA 3AUSA 4LCJA 2JJ8A 2ZSKA 4NZPA 1SUSA 4BNVA 4KQMA 1AMUA 3OQNA 4GXRA 1D2GA 5TS3A 5A7HA 2BDEA 2JLQA 3WK6A 2RK4A 2BUCA 2WM2A 3AEKB 2E21A 5IPFA 1AZLA 4Z0PA 4RF3A 2QDKA 1S7CA 3EQ6A 2HADA 4Q18A 1SOUA 1SOMA 2XT6A 3CX3A 4KRYA 3UJDA 3ZH2A 1AKVA 3ZCTA 4IP0A 4ZHSA 2A9JA 1N6KA 1JXAA 2JLVA 1M2WA 3AI3A 4CM4A 1N9ZA 4FOTA 3PP8A 4KQIA 5IABA 3EEIA 3F6RA 3QP9A 4ARZA 1ODJA 1QIJA 1FP1D 3OCCA 1DBVO 1Z0IA 4JYPA 4YR9A 1LDBA 3G0BA 4X92A 1PUJA 2EKZA 3NOVA 4MW4A 1HA3A 5LA6B 3MHPA 3TX6A 5L4NA 3C39A 2C7VA 3RTGA 2WYVA 3WK8A 4BJ1A 4EW2A 3U09A 3AR9A 1O0SA 3I0MA 1EWQA 3ONWA 2MSNA 4EAAA 5IM5A 3O82A 3PU6A 4GEKA 1DLJA 3EDCA 2VJYA 3R8CA 3RTCA 1I3LA 1BJRE 4JUIA 5IYZF 4S1VA 3WB1A 3UTCA 3M9WA 2CD9A 5JY1A 4UJ3A 2RONA 2ZROA 4PLPA 4G0OA 2ZYVX 4K9OA 3U6BA 2AF4C 2GJ8A 3GLHB 3BF8A 1P8JA 1QYVA 1TM7E 3J7TA 4GSKA 4TTAA 4KXYA 4WASA 3AR6A 4GECA 5CJPA 3WLSA 3JAWA 3LVRE 3OZBA 1Z4KA 1AVTA 3DZHA 2EKLA 3LZDA 5CT4A 3QYJA 1IIBA 1YF3A 4FDVA 5JPDA 4IOJA 4NOJA 1NP6A 3ZEIA 5K3OA 2ES4A 4EFLA 2YNMA 5TPWB 2W90A 3JPYA 3P0JA 1GKYA 4ZANA 1S89A 2G9RA 3HI6A 4G0PA 5FUMA 1U8UA 3DUWA 2P9ZA 4JT2A 2ZXUA 5CFRA 5AW0A 5CAEB 4BEBA 5CVDA 2XCSB 3VQTA 1EFRA 4FMDB 3UHFA 4PO9A 1QZZA 3D6VA 4BO8A 4YV1A 5IVKA 3NHBA 4L4YA 4INAA 1FXUA 2RHLA 3ZDRA 3M3HA 1JPVA 1XZAA 3BCHA 4IF6A 5EGNA 3TW6A 1ZLYA 2EATA 2HRDA 1BJKA 1I7NA 3VPFA 3C14C 4LBYA 3C48A 2A33A 2QP3A 3SVLA 5FBQB 2IHNA 3C6KA 1V7ZA 1RYDA 1YZGA 2EX4A 3LRXA 3MWEA 5ICFA 3GDHA 4ZQHA 4C4ZA 2Q1TA 3L0CA 1KTIA 1HFKA 2DFDA 3DZDA 4JNKA 4X20A 3IUBA 1RM0A 2PUAA 3ZUPA 2XTMA 4DIMA 2GWHA 3HJAA 2EIHA 1V25A 3ANNA 3KXKA 1UKZA 2AN3A 3M0EA 4XH9B 4A8JB 4O4JF 1XTQA 3ELDA 2OB1A 3LZ6A 1ULBA 1Z5UA 5LB2A 4YT4A 4GP6A 5JVDB 2C5LA 5TMEA 3JARB 4G0QA 1X1BA 2DY0A 1ZITA 4TYNA 1I1QB 2C2HA 2FN4A 2NO1A 2Y0BA 3MXOA 3O90A 3QI2A 4PLYA 1G4AE 4L28A 4JBHA 4K88A 4OD0A 4PZCA 3ZJVA 1T6XA 2RHRA 4WERA 4OX9Y 3C5VA 5FBHA 2H57A 2HU8A 4L78A 5L8VA 4WZBB 1CJUC 3FJ1A 2O0JA 4CMGA 5JAPA 4HLQB 1FS4A 4NHOA 4P4GA 2AMFA 2CBZA 2C0QA 2PBLA 2HA3A 2BWJA 3PHBE 4TTQA 4AZ0A 1R5OA 3S2YA 1ZUIA 3TSAA 4C7VA 5HKKD 3O3NB 2L82A 1JHMA 1X15A 4RA9B 1ENYA 4RZUA 1PTKA 1VL6A 3M1LA 5SZKB 1K06A 2K5UA 1N6IA 4Y6GB 1WRBA 3W3AH 1IZ8A 2Q21A 2FE4A 4YC7A 2V6FA 3MCUA 4NY1A 1XN1A 4ZOAA 3B2EA 4RFSB 4Z9FA 2XOXA 1BW9B 3PPIA 2WY2D 1X2BA 2G9UA 2CCKA 4QYXA 4F84A 4ETMA 4PAOA 1PVOA 1Z2OX 1R6DA 3CPEA 1ZICA 3RDPA 1EFPB 3SJUA 4IV8A 2HV9A 3H99A 3PHIA 1K6JA 3LPDA 3JYPA 3V4VB 1NQVA 2AMJA 2X13A 1WMEA 3K70C 4JUAA 3UZUA 3W9SA 1QZUA 4PLZA 4JUDX 2XQJA 4N8DA 4E1BA 1BX1A 5AJWA 3HC7A 3WNZA 3S5UA 3RD5A 5FT9A 4OSOA 1W9MA 3F8SA 4G5GA 1BROA 4KKXB 4XARA 3ZY6A 2VBGA 1HYEA 3IGFA 3HB9A 3EIWA 1ITZA 1LNSA 1XTTA 2ERCA 2EWVA 3EQZA 2ZANA 3K9GA 3JZDA 1NNI1 4WNCA 1V9CA 1Z4QA 5EMJA 5F21A 3URMA 4BGVA 2JCVA 2IZ6A 4X0EA 1S9DA 1B93A 4YMLA 5JO9A 3OLQA 1TQ6A 3EMDA 3K1AB 3PDCA 4YCNA 1KMQA 1CHNA 5C5CA 6YASA 4UAJA 4MI1A 2X1LA 1QRSA 1CC1S 1QS0A 3K2IA 5DTJA 1G5RA 1CLEA 1BHO1 4G8BA 4KCGA 5TS2A 3MJVA 5BV0A 4V0RA 3HXQA 1HI9A 3UATA 3K1JA 1Z6PA 1KMMA 4NOLA 5C8YA 2YJ3A 1V1RB 1N8NA 2X6RA 1I9GA 3R3SA 4J4BA 5HM8A 1NN0A 4QYSA 1YIOA 5JD6A 5CVCA 1RLUA 1SCQA 2WP8J 3GMTA 4ZT2A 4UJ5A 2CNNA 1T9HA 1ZUWA 1PDWA 3FSGD 3I8XA 5HPYB 3TNDA 3LUKA 4B47A 3GDWA 4PTYA 2MSEB 3FNQA 1F3LA 4KR7A 5AUNB 1KWGA 3U44B 2HR1A 1T5BA 1DQZA 2GBLA 3ESAA 4I66A 4DT1A 3OICA 5EERA 2VJKA 2WD7A 2C31A 5GMOA 2VHZA 3IRVA 3RVMA 1BZYA 2JLAA 3LUDA 2JI7A 1E7WA 3NOQA 4MV5A 1NUQA 2H08A 1KH1A 5TVGA 2A88A 2BBOA 1MOSA 4H15A 3B6IA 1PVDA 5J47A 2HOQA 1B14A 1T29A 5H83A 5GZ3A 2IXFA 1Y6GA 1JR3D 4M98A 1CQJA 3HKBB 3OMLA 4AIIA 1DAMA 1P6QA 3TMYA 5F77A 1ISRA 1PJSA 1DTWA 1NMQA 3OPXA 3TZHA 2Z56A 5GINE 5T4EA 5ER9A 4B2IA 3H1TA 1W5EA 4RL6A 1NVXQ 2NU6A 1IXZA 3KSZO 1KPIA 2EZ9A 4L08A 4KG7A 4E5SA 4HWGA 5EIBD 2GHTA 4MCIA 5JFOA 2A14A 1PG0A 1TQ4A 3G2OA 3GMDA 4JQSA 1Z7GA 3KKQA 3DFZA 5B30A 1XMOB 1QG6A 2RCNA 5A5GA 3BIXA 2GZMA 5CB4A 2OBMA 3VYUB 2W2QA 4I14A 4D3FA 4JS0A 4DVJA 2C5EA 1YNOA 2A5DA 2YXBA 3M9XA 4TGLA 5IBQA 4FB4A 2WOOA 3TR5A 5AJUA 1JFRA 3WB2A 4BQOA 2ZCJA 4ZHQB 1UQRA 1MF7A 1N34B 1H2XA 3SR3A 1OZFA 5KB3A 5EYPA 1O6GA 2A84A 3H9CA 3D0RA 1A8HA 2PK3A 3V7NA 2C9MA 1ZGBA 4ZC1A 4I36A 2C84A 4HV4A 1U6JA 4TM8A 2QN6A 2CVOA 3LT4A 3O9VA 3N2GA 5H0IA 4CM9A 4I50F 3FB1A 1IZ7A 2Q5OA 2LP4Y 1HBJA 3LPAA 2HGZA 4AYXA 1KEUA 5K0CA 2GVNA 5F2EA 5EZ6B 3I8OA 3EDRA 4A8PA 2J0UB 2ODPA 2J5KA 2I33A 2ZI9A 2QV0A 3TQIA 2GBPA 1C3OA 4TWAA 1JKFA 1VDZA 4LRUA 4C4OA 1SA0A 2GKGA 4AQ7A 3HVJA 2XCRB 2VYND 4RJTA 5JS7A 4MKHA 4P54A 1SVIA 5GZ1A 3K6SA 1Q1NA 4CDMA 3CU5A 3V48A 3MJEA 1FYEA 1ESDA 1JH8A 2JBAB 2J6HA 3A7DA 1BCSB 1IG0A 3GRFA 3TE7A 3V00A 5IJ0B 3MLEA 4RLSA 2EQAA 2JIQA 3KS9A 3R1IA 1OAOC 4MTCA 4DCCA 3SX0A 1LNZA 1SKAA 2V7TA 1OTHA 3UANA 3HCCA 2J9FA 4R2HA 5C1BA 2Q4DA 2XNJA 2E1RA 2VSQA 1XXHA 2DFKB 2ZJ3A 3IP3A 3B3JA 1NJFA 4AY4A 1H94A 4J6FA 2Y1FA 3WHIA 1RXEA 1S3IA 3T1TA 3EWSA 4BB5A 4OUDA 1PQWA 2D2XA 3Q11A 1AF7A 3D2BA 4EY5A 4PNHA 4U7JA 4XW2A 3TI9A 3N3BC 5CLJA 1T0BA 2A86A 1UKBA 1K4KA 2YCBA 1I7SB 1O94D 2OK7A 3HGMA 1Z45A 4KXVA 2QD5A 2XYVA 3QHQA 1ZJ5A 2IHUA 1QF9A 4N5HX 1YRHA 2ZTVA 3LQYA 1OA1A 2GPSA 4ZO9A 2V6GA 5BN4A 3CVXA 2D6FA 5E2BA 4DSAA 2PSDA 2OQIA 4U6NA 4O63O 3UMJA 2AIRA 1VPWA 4GX2A 3LC1O 3KM0A 4MPTA 2UVDA 3IQWA 3IESA 4GE3A 1M0TA 4MVJA 4JP1A 4MI9A 5F1OA 9ATCA 3QUQA 2IE0A 4KH0A 4V1CA 5L95A 4MVWA 1Y1KE 3IE0A 2TMGA 1NYRA 5C51B 1YQXA 2EEZA 3MCZA 1P2DA 1PZGA 2ZWPA 2ZS8A 4OAQA 3RFCA 5DXAA 1MJNA 4EGJA 1T2AA 3C0KA 1NPYA 3LGAA 3OETA 2O5CA 1TIKA 1MKYA 1EVLA 3KQQA 1T4BA 3EODA 1FSZA 3IQGX 2L19A 3ES9A 4ZAWA 1D5CA 1WCWA 2PMEA 1TMGE 5EE9A 5TQ0A 1IMOA 2FRDC 1PGQA 4OXNA 1CF2O 4HDQB 1FCJA 4U7PB 5JLJA 1G98A 4Y2GA 4KWIA 5DYGA 5H3LA 4MAAA 2NUTA 3MTJA 1YR1A 2I6UA 2WB4A 1BGWA 1GFZA 1SY7A 2BMJA 3B6JA 4NG5A 3UQZA 2YXEA 1SXJE 1KR5A 1UT6A 2C58A 3NBUA 1OAOA 1TPZA 4YUZA 1G5TA 4RJKA 1A8PA 4DARA 2AH5A 3LWZA 3ZGLA 5EJFA 1PWZA 4D3YA 3DCJA 1JNYA 2EZ8A 1EP1B 2HTEA 4FW8A 1H8ED 3HN2A 1A2OA 1Z06A 4ICIA 1FVOA 3L82B 2O1WA 3KWFA 3TAHA 2HKIA 1T4CA 4K6FA 3U0VA 1OJ7A 3DWIA 3ESXA 1Z28A 3KZVA 1UWKA 4MSUA 2Q4EA 4Q16A 1PG5A 2HJHA 1KBOA 2ATVA 1MGOA 1U5BA 1L6IA 2QQ5A 1YR9A 5EMMA 1K7YA 1H65A 4Y2SA 3F5DA 1NXPA 5AUQA 1H2ZA 4I5FA 4YY3B 2X9GA 3TPZA 5GIPE 2V7VA 3G2JA 1GM5A 1QCYA 2HWWA 1N8TA 1PWEA 2NQ8A 3OO1A 1YU6A 3PXXA 4MUYA 5F2NA 4MV9A 3GLFA 2HM7A 1ADBA 1T3ZA 1P80A 1TKCA 1SQGA 3TSCA 5JISA 4ID3A 2X0DA 3JQBA 3H1PA 1R37A 4OHXA 1A72A 1N1DA 4NU6A 4XOUA 4C30A 7MHTA 4DLZA 3UMSA 7REQB 2DPGA 1W35A 2I3GA 2OGTA 5F1PA 3AU8A 2YV2A 5FF9A 5LIPA 3R5TA 4COKA 3SE7A 5L4SA 3HABA 3MW8A 4EF5A 4MWCA 2BCEA 3AF1A 1GKLA 2X42A 2LWIA 2YHUA 3CW2A 1FMTA 3CUWA 3P2OA 5BQFA 3JYLA 1R3DA 3CNHA 4EKNB 2CV1A 1DG9A 1Q77A 1DI0A 2G5TA 3A4LA 3COVA 1J90A 1UFOA 2AXPA 2YV3A 2FR1A 3AY0A 3PENA 2FRDA 1X1QA 2Q3EA 4IMRA 4KQGA 3V8MA 2B82A 4F97A 1PO7A 3GFFA 4EDHA 3CMMA 1I94B 3DYVA 1X7ZB 3PKZA 3OZGA 3WNCA 4RD0A 4DYHA 3DDSA 4ZDIA 3CVVA 2O5EA 1U7ZA 3KVNA 3TAXA 5AW4A 3YASA 3UMFA 4I4LA 2PT7A 2YWFA 5J2UA 2VOEA 4OGFA 4N5IX 3WWOA 1H3EA 3LCVB 5A5EA 4B3GA 1G8FA 4N7BA 3WBFA 2WDZA 4ZAFA 4MAMA 4RF4A 1DO8A 1A9SA 1J25A 3R41A 2Y1CA 2J48A 1T13A 4JSYA 5E7MA 1KY3A 1LJUA 6LDHA 2BGMA 5AXAA 1ESZA 1TQ2A 2B8TA 1RLJA 2ONCA 2WNHA 3GZNB 1YUBA 1ZOLA 1F8XA 3BXZA 2UV8A 4TKUA 4XA8A 2PNJA 3EP4B 1E9FA 3NU1A 5GGXA 1GTVA 2K7ZA 2PIAA 2XX3A 4AF6A 3NUQA 3EY4A 1DRVA 4LQDA 2GZAA 3C3BA 3GRRA 3HO8A 4OQ4A 3QVUA 5F2KA 1QCZA 2F43B 1XJWA 1PNTA 3BL6A 4XJTA 1RFGE 3O8DA 2Y27A 5KWSA 3EBOA 4XKJA 9ABPA 4P2BA 1UBEA 1I7BB 1GYQA 3GUYA 1E8MA 4L73A 4P86A 1GSAA 1QJCA 4TWBA 5DK4A 3O73A 5FOVA 4ASUD 2ZW9A 4NH0A 4I2VA 3FUWA 4ND2A 2WA1A 4U5XA 4A2PA 5MGNA 4IKOA 1ZK1A 1F9EA 1OMOA 2QHXA 2V7QD 1YXMA 2PRZA 3FCEA 2IXGA 5DIZA 3PLRA 1QV9A 4EI2A 3EP8B 3QLVC 3C1AA 3X44A 4Z4FA 5CPBA 1WD7A 2FB9A 2D00A 2X9NA 4Q9KA 5FV7A 3HP7A 5KSWB 3AFOA 4CLOB 4FIZA 4MW6A 1RP7A 4QFBA 1KU0A 2ZZNA 4MQUA 4E4TA 1J00A 3OIYA 4D9BA 3KGDA 3DL2A 4MGEA 2UU9B 2VSOA 4AZ3B 1Q1EA 3Q9NA 2ZSDA 4YAGA 4MUIA 2CF5A 3H2ZA 1CDEA 4GZ3A 4J94A 4NAHA 3JQGA 2X5XA 4CFSA 4AG3A 5ALSA 1I3NA 2ACEA 2F48A 2QRHA 3S55A 1S3GA 1UZUA 3QITA 4ENSA 4CTMA 1YS7A 1FLNA 3OZSA 1P3JA 2R8YA 2ZIWB 3NDBB 3I5YA 4N03A 3VDQA 3WJ2A 3G85A 4GMDA 3T9EA 3HB5X 2IODA 2PMFA 3KKEA 1W85A 3SD7A 3ZLTA 1E77A 1U2EA 3EIFA 3ZHTA 4UVGA 4ZZ0A 1OPRA 1XOIA 4EB6A 2MSWA 2C7RA 4S1NA 5FOSA 3ECCA 2WSIA 3TCNA 1DNPA 1I0LA 3FGPA 5EHQA 2ISQA 3O8OA 3EZ6A 1GU0A 1YQGA 1OXMA 4PZ0A 3LQ2A 5IF9A 4HN2A 4M60A 2P75A 1X7XB 2FE1A 2ZPUA 4ROSA 5KYWA 2AR0A 3ZZNA 2JEZA 1WDKA 3ZR4B 1G7TA 1MB2A 1PQ4A 1EIWA 1R5JA 2FEPA 2R84A 3FJYA 2XCIA 1GZSA 4BV8A 4Z1MD 3GGSA 1R2QA 2GJAA 2JFBA 2BE9A 2JS7A 3L1VA 3PC4A 2DCMA 4R1QA 4O25A 2OYCA 2NU7B 3Q3HA 1M8JA 4MWEA 1K88A 3EFHA 1IHYA 1K3FA 1M76A 1YB4A 1LF5A 1MB4A 4KQJA 4MUNA 3RLIA 1D6SA 1JMVA 4J07A 1X1DA 3DR3A 2E6UX 3I2GA 5AKGA 3HJFA 5SY4A 3E9RA 3GJ3A 2XGJA 4P58A 5JJLA 2WV9A 3GLRA 4Q9JA 1FMJA 5IBPA 5KDDA 3QFFA 3QLVA 3NHLA 4F3NA 1F3OA 1AGXA 2GHRA 3DOJA 4FXPA 4O4LF 3E1KA 5CNIA 1U7OA 3DVQX 3SZRA 3FH0A 1KFBB 1JBKA 3STVA 4JB3A 4Q3EA 1OC2A 1R0ZA 3IHWA 1OZGA 5LOVF 1AHPA 2ZYUX 4WN9B 4AMBA 2A1IA 1Z2AA 4MQBA 2QG6A 4NCHA 4RU1A 1VMEA 4U63A 3SIWA 1P4JA 5BYJA 3SMVA 3GLHE 1Z3IX 1IAQA 3VYRB 2NQTA 2O48X 1XMJA 2ECOA 4HEA1 1N1GA 4LRYA 4O4JA 1XROA 3VSBA 1KSJA 4B85A 1KXJA 1YTUA 5CIWA 4YRCA 1UQTA 1H1DA 2DUUA 2A58A 2FP4A 1CUZA 2V7EA 3GMIA 1C4XA 4J2OA 4Q01A 1EMDA 1GQYA 2F62A 3N07A 5I7EA 4QRHA 1WF6A 2PGLA 4JY7A 3P9ZA 1G9TA 4MV6A 2XT0A 4FEEA 4QPPA 5FULA 1GL3A 1F0KA 2O2HA 3ENQA 4CU5A 3QEKA 4M0KA 4WJLA 3STYA 4H4CA 4P9NA 4EL0A 1MAHA 2IX3A 1PJ2A 5BVHA 3Q5DA 3CB2A 3HADA 1FU8A 5LCXA 3U31A 5FEUA 5JSYA 1P1FA 2BF7A 1NJ2A 5BVGA 5JJIA 5JEDA 3GJ6A 1I72B 1I5OA 2GBGA 3ADPA 2IYSA 3FN4A 3S28A 4F7WA 4ED9A 1XN4A 3DLIA 4GE0A 2M6LA 4ENUA 1EB9A 2PUVA 3GARA 4AKEA 2DH6A 2M98A 1C8LA 4EKGA 5AJYA 1T9GR 4C0BA 2OHHA 1HTBA 2QA5A 3P4YA 3WIEA 1W6RA 4M1YA 4X8LA 4K05A 2AYXA 1VLLA 2C29D 3QFSA 4EUHA 3EX7C 4R1OA 2EKQA 2WF6A 1XD2B 1KARA 3M6MD 1LX6A 2IYLD 2OM6A 2YY5A 3LHDA 2XSZA 1SUCA 4HFRA 4IIXA 4XTRA 3UA4A 4ZQGA 2QLNA 2J3HA 1F0YA 4K6CA 4PC3A 2QN8A 4V0SA 4ER5A 2QLJA 3CVWA 4AJJA 3ZZUA 2Y05A 1E3EA 5GVRA 3PQFA 5B57C 3ZQUA 4L8YA 3VUFA 3QFCA 2R68A 3OEHD 3OPMA 4W1RA 2Z30A 4FFOA 3SXUB 1U4OA 3PI7A 4JLDA 3T9AA 2NM0A 4HNRA 5DO9A 5JNWA 1H2YA 1RKXA 2GD2A 2A94A 3A32A 4KL8S 2C5BA 4QJ5A 1I14A 1I1HA 1I2CA 2I6GA 5EJ5A 1W7AA 3NGXA 1SIUA 2Q3MA 2V65A 3NM6B 1MDBA 4GI2A 4WZBE 4BZWA 2XYRA 2AOWA 1ZXXA 2O1EA 1XLWA 4J0EA 4PYOA 3AHFA 5G4KB 5K20A 5KMGA 3H83A 1FY2A 3BXGA 3AOEC 5IANA 3KKNA 3H4IA 5TMBA 3TGWA 2XXAB 1U90A 3ZZMA 4LE1A 1PU2A 2B7LA 3H13A 1P9LA 2WTBA 2FA9A 3ADCA 4EG8A 2M32A 2EFGA 4OEHA 4B71A 1E92A 5GJBA 4XCQA 1WJGA 4HRAA 4HDSA 1DL5A 4O0LA 4P6VF 1YCDA 4Y2QA 2G1AA 2XW6A 3A1CA 1Y8ZA 1RIIA 5FNVB 2DB3A 1Y4AE 1IHDA 1L1EA 2ECKA 1PR5A 5BW6B 1C0EA 2AC4A 1DKMA 4C2BA 1E1QD 3ECSA 2WV7A 2Y4OA 3HJUA 1JDVA 3TIIA 1TM4E 1WXHA 1KDOA 3ORFA 1M7BA 3DV0A 4PGGA 1MQSA 1XZPA 3IBCA 2HSGA 2CLEB 5GONA 3IP5A 5JMPA 1TVMA 3BAZA 5C4MA 2IHZA 3T1YB 4CF6A 3EF3A 4ZARA 2C2YA 2BMWA 3ETLA 6REQA 3EEYA 3Q1LA 3OM9A 4PCUA 2K2WA 1SVKA 3UHJA 4UVHA 2J07A 5E6SB 5AOAA 3HNOA 2I4TA 1DELA 2P91A 3LLSA 5AKXA 6ADHA 1G6KA 4HUQA 1VE7A 2BFCA 5TMPA 2DMRA 4NYJQ 4HGOA 1L4YA 1X80B 4AU1A 2GBIA 4IO0A 1B42A 2RHDA 1Y4SA 1H2FA 3HKDB 1QQ5A 2HUPA 2ORVA 2VJPA 4FGZA 4G0MA 1Q0HA 4MX8A 3ZJ4A 4ITVA 5E9WA 5L4LA 5IDVA 2XE6A 5ERXA 1RRGA 3LYAA 2VL7A 3CKYA 2XGMA 3Q72A 3T6KA 1Z63A 4U0JA 2YWBA 2R79A 4WNAA 1Q95A 3DMRA 4QLAA 4XDZA 1H6CA 1XJQA 4N18A 4R8MA 2NUAA 3FJOA 1BN7A 3MUEA 4Z4QA 3PHLA 4HTFB 5SZHB 2Q6KA 1NRXA 2XRMA 4OHBA 4HMQA 1RU3A 2RB5A 1R74A 3CF2A 4HFNA 4MJLA 4MKRA 3ISJA 1B8UA 1R00A 4Q12A 2GM4A 2UUCB 3ETDA 3RTEA 2DT8A 4JB8A 1EX9A 1P6UA 1CF9A 3DXXA 3GHHA 1OXTA 2BD0A 3AB7A 1C0PA 3FCYA 4LSGA 1I4DD 4CFZA 3PC8C 3EZYA 2WU0A 1B43A 5T41A 5IKPA 4CR8A 1UZAA 3E3NA 3ONVA 4XIJA 1M6WA 1HWYA 3N0VA 4QBFA 4CKBA 1HTWA 1QHIA 1A2KC 5EI5A 4ZALA 4PS1A 1VIDA 4KDRA 1FFDA 2FXIA 1UEIA 3BSYA 3D3WB 3QBJA 4HO1X 3EBPA 4DJJA 4MIEA 1VLVA 2MU1A 3EC2A 4Q3DA 4B8ZA 4KN8A 3T38A 3WYDA 4F4CA 4Q4JB 1JLHA 2CNDA 2WK1A 4BNGA 1ISMA 2FZLA 2QVXX 2PYDA 3NDPA 3L84A 2J3QA 1APBA 1RVV1 2PRYA 3IV6A 4FQ5A 2YNMD 4FPXA 3UYKA 1AG9A 4ERNA 1Y9ZA 2AX4A 3U4GA 4ZGGA 1QOZA 2X1HA 2Z6AA 2OXRA 2WIBA 2ONKA 2G70A 2WFAA 4FOSA 3WB9A 3T7SA 4LHZA 4ZI3A 2VRNA 5JAOA 1WV1A 1Q20A 4KQXA 4DMRA 1ZHOA 1F60A 5CJJA 2O4CA 4AP9A 1W8DA 2BDUA 1CUVA 4G0VA 2ZREA 3CIOA 4IUDS 4G2TA 1A1VA 2PL5A 1GTJ1 5IVPA 3TQOA 5EQJB 1F5NA 3ZW7A 4NZYA 1Y3HA 3E5HA 3K0AA 5IN4A 3OE5A 4LYJA 2YV4A 2VHUA 1JZQA 1UF9A 3FMFA 4G1MB 4RH3A 4FHFA 3ZLBA 1EZ1A 5JYDA 4OLBA 4OLAA 1XZIA 3JALA 1IUNA 4O5AA 2JFFA 4OMFG 2X0JA 2CV2A 2ZUSA 4ZU1X 2QN1A 1SM4A 4X6UA 3N76A 1IWOA 2ZUVA 4WRRA 3QVJA 1K1EA 5DU2A 4GO1A 3LUAA 1DQNA 2GI4A 1D1PA 1T4DA 2REBA 3GX1A 3INNA 4CF3A 3G2PA 4ZVKA 1H4QA 4GH5A 1IZ9A 3UW1A 3KVRA 4B35A 3D64A 1P29A 5IFLA 3LDAA 1U2RA 4RVDA 1A9YA 4F9FA 4XWWA 3E8MA 4YJ2B 3IMCA 4BIMA 4XGKA 4UOEA 3WAGA 1YS2X 2DM6A 1V5GA 3OEYA 2HMSA 4Y9DA 4F46A 4OBEA 2VZLA 3LTEA 4PSDA 4Z4HA 2HREA 3OTIA 3ERCA 1S8FA 1FP6A 4AICA 4IJUA 4PCAA 4OHOA 4TRRA 1HR0B 2BEJA 3DZBA 4IX1A 4F2HA 4ZRNA 2OZKA 5K0JA 2IU6A 2DQZA 2RH5A 3I42A 3TEJA 4C6SA 1AV6A 2GEVA 2J8ZA 4W1SA 1XDWA 2AEJA 3OX3A 1F38A 4OOFA 2H7CA 3HXMA 2BYTA 2F8SA 2OECA 3NEYA 5H02A 3ZY5A 4BXOB 3T7EA 5EJMA 3FWKA 4GR5A 4WJKB 5ICMA 5HXAA 2GF9A 2YV5A 2WAOA 3TSWA 4D4KA 1BCRA 2ZYIA 4KZKA 4WDQA 4XR4A 1J2EA 2VKTA 2WINI 3U48A 3DPIA 4JQZA 2JH3A 2FMFA 4GNKA 5C81A 2ZBRA 3T52A 3ZE1B 1UJ2A 3LQRA 1N6LA 1KQGA 5CX1B 4LFBB 5FBRB 1X1CA 4MQFB 4XB1A 1G18A 1X7DA 4N3NA 5JCPA 1P91A 3E0QA 2NUPB 3RKUA 1MHTA 5A0TA 1SU7A 1PJCA 2W6JA 4OGKA 2H2IA 1J22A 4NABA 1EVIA 5FA8A 2FLWA 3X2EA 1KEKA 3R9KA 2V74B 2Y77A 3Q0TA 3G2HA 3DCIA 3JQ9C 5B37A 1U7DA 2H0QA 1NOIA 1NXTA 3L6OO 1YRQA 2QAGC 2JIMA 1B0PA 1G6OA 4MMZB 1BFKA 1O8BA 2I34A 4HNVA 4WESA 3TQFA 4OI0A 1MB9A 1O89A 1YR8A 2H2DA 4RQUA 2A1TS 3ECAA 4CLEA 2GMWA 3DE1X 4E07A 1UOEA 4IIEA 3SC2A 1S1MA 2Q27A 4BMCA 3BUSA 8ATCA 1EBFA 3DHYA 1T5DX 4J76A 2R6FA 5KPJA 1DQPA 4PX3A 2CFOA 5DWQA 5JJKA 1E5XA 1U9IC 3C5HA 2WU8A 3K92A 4WHMA 5JWHA 2C8JA 1PJLA 3AUTA 1RWXA 2DSNA 1HFJA 3CF0A 4CKCA 2RHGB 2VF4X 2ZRPA 4M21A 2XIQA 2PS1A 5FWYB 3Q1KA 1WY7A 3ROXA 4B80A 4CHTA 1ZHHA 3SFZA 3KDAA 4DCMA 1OTYA 3EJ6A 3JQ8B 4TTTS 2QTCA 4R0MA 1PUXA 1OLXB 5C7YA 3PA8A 3UAVA 3L7DA 3C3YA 1NVAA 2NNWB 4ENRA 4ZPJA 4R81A 4MB6A 4EO9A 4MYHA 4OK6A 3Q0EA 4ZJUA 1YJCA 1FTWA 2PBFA 4MJXA 2ZJ8A 4K0KB 1O3YA 2NV6A 3IKJA 4JYCA 1D8AA 1KJWA 4RXUA 1YTLA 1TD1A 2C5SA 5A0FA 4JI1B 3CMCO 1QR6A 5C46F 2Q6LA 1WMBA 3ACDA 3ZCUA 4DL9A 1IY9A 3QYFA 4DY4A 3A3NA 3Q9SA 4LC0A 4C2AA 5LQKA 2QJTA 4Z86A 3IQZA 3GFPA 2P2LA 3JTEA 1E2HA 1F4VA 2GPJA 3QFTA 2YV1A 1YUNA 3EE6A 3DDCA 2ZAOA 1JEOA 4Y7CA 4DTIA 4ENWA 1BA2A 3IOMA 4OI1A 2L69A 2OCDA 3IOCA 2OV2A 5KYKA 1V3QE 4LRWA 1IN8A 5L3VA 3LGSA 4XEHA 4ZZ2A 5TEWA 3JQ9A 2AFVA 4TS1A 4PBTA 4WUTA 4ZYWA 1DOZA 1OWOA 3AGPA 5KWJA 2VRCA 3KAJA 1I24A 4LJ4A 2QAGA 1AZSC 2PPVA 3UJ9A 3TGLA 4M87A 1UZMA 2BFPA 2ON6A 3HU5A 2W2KA 1EVYA 4OJTA 1L5LA 2FEWB 3THSA 3GPIA 3KSRA 5T5QA 3PX2A 3JQEA 1PNRA 2F4VB 4X63A 3QM1A 4HAOA 3F2VA 4OI4A 2WWWA 4LY9A 3ZC3A 5A9RA 4O4IF 2Q9CA 3AP2A 4Y67A 4ZT5A 4HAWA 1RE1A 1V8PA 1H42A 4C5CA 4XJVA 1QHGA 1TVKB 2ISCA 3CEJA 3ZU6A 4AQDA 3C85A 6ABPA 2WQ7A 1U9IA 2DBRA 2XDQB 1T4GA 4QOEA 5TPWA 3SX2A 1T9KA 1T1IA 2CVZA 2OILA 2H1RA 3O2JA 1T1SA 1XU4A 4ERXA 3DKVA 3VR4A 4UDXX 3I73A 3P9CA 2HV8A 2DQYA 1CJKC 2Z1MA 3KR9A 2FPGB 2LZ0A 4TYQA 1Z7YA 5DT2A 5EWJA 1UPAA 2JKYA 5AWFC 1AM4D 4HWTA 3WZ2A 1CERA 1IJEA 3DCNA 4LK3A 4CM9D 2VJOA 1U3TA 2WIAA 4DW8A 4WEOA 4X1IA 3RRBA 1HETA 1IVYA 1MH9A 2JVIA 3IAXA 2Y1KA 4JOQA 1DRKA 1ZIDA 4KFSA 1S2IA 1EJ2A 2EJCA 3FYCA 2OAEA 1AKUA 4RCVA 1GN9A 2BCJQ 1TO1E 1BE1A 1XYVA 4I1IA 3N59A 3FVVA 4ITRC 4YO8A 4LFAB 3AVTA 4E1AA 5JZSA 1MH1A 1EAYA 3AF5A 5P21A 1CSEE 2ZYRA 1JR6A 1PZNA 3IT1A 3BULA 4J3JA 1ENPA 1JWLA 2VRWA 4MYRA 1J2TA 4PX9A 4CEJB 2XZOA 3ZIDA 1QDUA 1PFVA 2HB6A 1E0KA 2IUTA 1O6CA 1R4ZA 3BGIA 1AK1A 4TWJA 2MSCB 4LYFA 5IBCA 4MKGA 1ZW6A 1C30B 1ZQ1A 1XF9A 4LWOA 3V7UA 1OD6A 1IRXA 2YKGA 3EIUA 4RY2A 1N5JA 5FBWB 1PJ3A 3U39A 3I30X 3O47A 1UOPA 1DSSG 3LS2A 3LA8A 2W4QA 3JARA 3OKPA 2VATA 5IAAA 5BR7A 2D4HA 1SZJG 2JFGA 4CDNA 2BFWA 4AY6A 1R9GA 2UZ1B 3CZQA 4X95A 2FCAA 1MOZA 2ZPTX 2W6MA 3KEOA 1FRQA 1AUQA 1W1IA 3FGNA 1TF7A 3IVXA 4JIMA 4QYTA 4S2UA 1SURA 4WZBA 4D8YA 3ZD8A 3LIIA 3AERB 1IAVA 4KXLA 4E14A 4BQEA 1KMCA 2QJFA 1CEYA 2WE7A 5DEIA 2Z5FA 1KXZA 2OHVA 3FUUA 3P2JA 5DHTA 3ZCSA 4B44A 2CL5A 3CJRA 4NYJR 3QX9A 4CYMA 2