4DPKA

Structure of malonyl-coenzyme a reductase from crenarchaeota
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
354
structure length
354
Chain Sequence
RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
molecule keywords Malonyl-CoA/succinyl-CoA reductase
total genus 122
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dpkA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dpkA01
3RFVA 4OM8A 4DRYA 2VQ3A 1NPTO 1NWHA 2RBEA 1LNQA 3ONEA 4WEOA 1PZEA 4YYZA 3Q1LA 5ICMA 5B4TA 3ZWVA 4TMFA 1NQAO 4J0FA 4KWHA 5CEEA 4A2CA 2V7PA 1C0IA 3DAGA 3JQ7A 3F5QA 1KBZA 3ULKA 4LVUA 2GRAA 4HNGA 3RBZA 2P4QA 3MCVA 2X86A 4LVCA 4DREA 2PZKA 2ZJ1A 2PFGA 3O8QB 3VH2A 1H2BA 1O89A 2C29D 4BNTA 4BNZA 1LLCA 4GKBA 1NVMB 5IF3A 4GMFA 2P5YA 1HDZA 3H5AA 5I7VA 4AJEA 5F1PA 3PGXA 3DR3A 1NPDA 1PZFA 3DZBA 4KUHA 4L9RA 3QE3A 3R1IA 2VRBA 3G0OA 5A4DA 4IQ8A 5JAZA 5HWSA 3VC7A 4CM4B 3RC1A 3WWYA 1VJ1A 5COQA 1KEVA 1VL0A 4BNKA 2Z1MA 1JKIA 2CF6A 4OHUA 5THKA 4LSWA 4CV1A 1X14A 1QXSA 4DIOA 3PJFA 3VOSA 4EGFA 1BSVA 1DJQA 3C85A 1RJWA 4B4WA 3IDSA 1O0SA 3L6EA 3M1LA 2BMAA 1U3WA 4DQVA 3Q9NA 4HFMA 2HAEA 3B1KA 1L7EA 3G3EA 3UVEA 2YW9A 4J7CA 2YDYA 8LDHA 5IFLA 4IJWA 1KETA 3UHAA 3GNTA 1PGQA 2TMDA 1SMKA 3P5SA 1YQDA 2FP4A 1F8FA 1Q7CA 4CL3A 4OOEA 5IZCA 3ZZNA 1ZW1A 1E1KA 3GDFA 3GA0A 1ULUA 4JXKA 4YQYA 4AG3A 4D45A 5KKAA 4RZHA 4DQUA 3GGGA 3WLEA 3H6KA 4JX8A 1G1AA 4BKUA 3QVXA 2GN8A 2PV7A 4K1LA 2IZ0A 2I9PA 2PD3A 2PZMA 3NAQA 3ZNNA 3PLRA 2Y0DA 2B69A 3KYDA 4GL4A 3VZRA 2FMUA 1V9LA 1PJTA 3E48A 1A7AA 3DO5A 3FTPA 3HFGA 4WLOA 2HMSA 4E5PA 2CVZA 3O8QA 4PG5A 4GMGA 4LRTB 3PFWO 4GX5A 1I3MA 3STHA 4HY3A 2EKQA 1LU9A 4FC6A 4ZICA 2C59A 3P19A 5TF4A 1H6CA 3AM4A 1GR0A 4FFNA 3VTZA 4CQMA 1WMAA 4OMUA 5K6AC 4Q9NA 3H9GA 4FCCA 1LQUA 2ZJ0A 2HRBA 4J0EA 4UUOA 3SVTA 2VRCA 3JQAA 4KMSA 3EDMA 1P77A 3WJ7A 3DBLA 4YR9A 4NMHA 3WGZA 5JDIC 2UV8A 4GPD1 1E3LA 4YAJA 1Y8RA 4CMKA 3DZFA 1B16A 1P44A 5KJ1A 4DPLA 1GADO 1U7HA 4KTVE 1GUFA 4GX2A 1FDWA 4M54A 1D7OA 4CLOA 4OGWA 2Y67A 4RDHA 2AXQA 3SXPA 4RCVA 1EVJA 1J5PA 1UXIA 3CE6A 1DB3A 1R4MA 4RVDA 4ZQBA 1RKXA 3L4BC 5L9AA 4FSHA 4D41A 1N1GA 4EUFA 4ALIA 5BSFA 3QWHA 3DAPA 3TZ6A 1AGNA 2DC1A 3GFGA 2Y1EA 2QYSA 1JA9A 2VWPA 3I9MA 5KVSA 3P2OA 4TSKA 1GV0A 3RUFA 2IDZA 3AU8A 4E5KA 2EJWA 4R51A 4CV3A 1ZSYA 4TWRA 2G0TA 3EGOA 4L8VA 4ZN6A 3MJSA 5KKCA 3JD1A 3NRCA 2JHFA 2CZCA 2GN4A 4NBRA 2PKQP 2X6TA 1NP3A 3CZRA 3C8MA 2YQ4A 3NDJA 3WSVA 4WPGA 5IJZA 1HDGO 2DFDA 1T4BA 4I9UA 1U3VA 4IXTA 1E3IA 2A35A 3AI3A 1I3KA 1VE9A 4DQXA 1SO8A 4MKRA 4M1QA 3EW7A 5JAIA 4FW8A 3MWEB 4LRSB 3ZNOA 4XB1A 4WLEA 3ZWOA 4CV2A 5JYEA 1M6HA 3BHIA 4AVYA 1H6BA 1IOLA 4AJ4A 3H7AA 4XQEA 4U0KA 1V3VA 4AJLA 4EJ6A 1IULA 3LQFA 4D0RA 3ZDFA 1PZGA 1FDSA 3NTRA 2QIOA 1XSEA 4GSKA 3OSUA 1TVEA 3UUWA 5JXWA 1IUKA 4WOKA 2WWRA 2FZEA 3HN7A 1ADGA 4D79A 1WNTA 2ILTA 4Z6KA 4M8SA 2GASA 1R0LA 5CP8A 3V2UA 1YQXA 2NUAA 3DXFA 4EDFA 3W8EA 1T25A 2Y99A 3SC4A 4C7JA 1BXGA 4BMNA 4YDRA 1E7MA 4JQCA 4KDEA 3WYBA 3D0OA 3Q11A 5TGDA 4GSLA 2Q2VA 4UVIA 5CDTA 3I4CA 5JCJA 3G49A 2CUKA 5L7WA 3M2PA 1DIGA 2AEMA 2PGLA 5TS3A 3W4JA 3PIDA 1EMDA 5TRTA 4RVGA 4R9RA 5L40A 1U1IA 5AXCA 5EPOA 3DHYA 4BNJA 2EGHA 2Z95A 1DIRA 3E9MA 5A06A 1D1TA 4W9NC 1R0SA 2C82A 3WDSA 4OQYA 3A06A 1GY8A 1FDUA 4WK6A 3JQCA 1M66A 1Z7EA 3FF4A 4R01A 3H3FA 1M6WA 4GKVA 3JQFA 4JGBA 1P0FA 3KLMX 4BO5A 3GVXA 4ALMA 3AI1A 1DEHA 2UUOA 5THQA 2CSUA 4P38A 4J91A 3HE3A 4MP8A 1O8CA 2VZ9A 1U5AA 3ZWXA 1A27A 1ZK1A 2EERA 3K2EA 1PEDA 3PHJA 3E5MA 4FJ1A 3MJVA 2Y66A 4BKPA 2PZJA 3KSUA 3NT2A 1ZFNA 1LRLA 5JO0A 1GDHA 3TZKA 1HZJA 3PQDA 4HFRA 2X7HA 3IUSA 4IQGA 4ZQFA 3AOGA 5IDYA 4NI5A 4UUMA 1VJ0A 4CM6A 3D4OA 1LSUA 4PIVA 2BLLA 2XOXA 3SBOA 1X7HA 2VZ8A 3U4CA 2WE8A 1OOEA 3ROQA 1KVSA 4Q3CA 1CDOA 2GZ3A 3GT0A 3HZZA 4OXYA 1Z73A 1RM0A 1VSVA 5U4QA 1ML3A 2YZ7A 3I5MA 3QVTA 3ADPA 4Z0TA 4E0BA 1IL0A 2IZZA 2OUIA 2J5QA 4YJFA 4Z0PA 4FB5A 4ZRMA 1M75A 1UP7A 3BTVA 2P68A 4U8GA 5JYAA 4M86A 1YGYA 4QQRA 2B4TO 3WGIA 2JKVA 2BFAA 2EKPA 2JAHA 3RUIA 4BKQA 2CVOA 1B7GO 4ID9A 4XR4A 3AW9A 2O4UX 2X9VA 4UULA 2V6BA 3F4LA 5J9GA 1DFIA 1JVBA 1PZHA 2I76A 5FEUA 3D4NA 3H2ZA 5DDIP 1KC3A 5T6BA 2BGLA 3UW3A 1ZSVA 1DDOA 3WICA 1NWCA 4Y8VA 3CPSA 3TDKA 1P1KA 5I9NA 3H8VA 4XB2A 1HYGA 4HKTA 1MA0A 1A5ZA 4L4SA 4II2A 2FSSA 5G0SA 1NFQA 4WCDA 1NXQA 3HNPA 1AXGA 1DC3A 4AJIA 2Y1FA 2WD7B 2E37A 3H2SA 3VHRA 2VUTA 3JV7A 2BI8A 4DVJA 1K6JA 5TJ9A 5EQDA 4E5MA 1BHSA 1E6WA 3WWZA 4YCAA 4CLDA 5L45A 1EE9A 1UH5A 2B37A 5CEJA 3FPLA 3TJRA 4MIEA 4GX1A 4XGIA 5KWEA 3MTGA 5DP1A 4YTEA 4ND2A 3FNFA 4XA8A 3RC9A 3G17A 5JLAA 1F8GA 3JTMA 1E6UA 1GQ2A 1I8TA 3R0IA 1P1FA 3VPXA 3ZHXA 1TT7A 2C20A 3I6QA 4E4YA 4EI2A 1DIBA 1N2SA 3I9OA 3RUDA 5GZ3A 4XYBA 4F46A 3IQDB 4M87A 5ER6A 2A92A 1KEPA 3NTOA 3DBHA 3BTOA 3RIHA 4CMEC 4INAA 1Q0LA 4QSMA 2AA3A 3F6YA 4LCJA 3WTBA 4BKRA 3GFBA 1HDXA 4W9NA 2LDBA 1B14A 2CD9A 2OOSA 1DLJA 3PJEA 3JD4A 2EP7A 2NVBA 1G0NA 1O9BA 1ZH8A 2AEJA 3RUEA 3HDYA 3IS3A 3QWAA 4AJJA 4C7KA 1HSOA 3RCBA 2EP5A 1HT0A 4NBWA 2AE2A 4RO0A 2PNFA 5B37A 3SJUA 3DMTC 1XHLA 2PA3A 2HCTA 3WQQA 3V5NA 3VAZA 3JYNA 5M6DA 4OL9A 4J7XA 3EZYA 1X15A 2FOIA 4RF4A 3HADA 3S2EA 5IAAA 4CM4A 2FN7A 4LGVA 1NAHA 1CIVA 1V3UA 2I67A 5HRUA 2Q50A 2BH9A 4S3MA 4R69A 3TRIA 1T26A 4E13A 4EJ0A 4IINA 5B12A 4AJOA 2GNAA 2O3RA 4UEOA 5ES3A 4DIFA 4DIBA 1DO8A 3DFZA 4D3FA 1P0CA 3S2IA 4U0JA 4CMCA 3U5TA 1OC4A 3GY0A 5A02A 2X58A 3ANMA 3GF4A 4PZEA 1F06A 1CEQA 4N5LA 5IDWA 4WLUA 2J3IA 1Z7BA 2YV2A 3WMXA 2X5OA 2TMGA 1VM6A 3UCFA 4CUJA 1I3LA 5EERA 2ZCUA 4IDAA 2G82A 2J3KA 2ZTUA 1EUDA 4N7RA 1EVIA 2P9CA 2VUUA 4YRAA 1OMOA 4OXKA 2GSDA 4HWKA 2J3JA 2P9EA 2ZYDA 2D5CA 4QFDA 3ZWNA 5K6AA 3K92A 2ZB8A 4H15A 1DRUA 1C1XB 4DPKA 3I9NA 4IM7A 2YFQA 3CZMA 1QP8A 4XKJA 3OA0A 4LMPA 4R41A 2X0JA 4K9DA 1FJHA 1M2WA 1WPQA 4XGKA 1QV7A 3QP9A 3FRJA 4J9VA 5C5IA 3JQ8B 1IPFA 3QVSA 3PLNA 3AUAA 1V0JA 2OO5A 2HSDA 3WBBA 3FWZA 1QLJA 2GPTA 3HG7A 2Q1TA 4BGVA 4BO8A 2AQHA 3F4BA 4O5OA 4MIOA 1HEUA 3KM0A 1EUCA 4YA6A 2DAPA 4BOYA 2BGMA 1NQOA 4I08A 4CM8B 4N5MA 1C0LA 4J90A 3H9QA 1QYDA 4YRDA 2CDBA 5DBGA 1YKFA 4WCFA 4LW8A 4BV8A 1I5RA 1LSJA 4R5HA 3BMQA 5JDIA 3EAGA 3LT1A 2OHXA 1DXYA 2P9GA 1ISJA 4DYDA 1PJ4A 3NT4A 1KEWA 2O3QA 5G0VA 3WNVA 4O63O 3ICPA 3S55A 1ORRA 2VOEA 4I5FA 4NNJA 5DCWA 3H9EO 4KWIA 3QWBA 4YJHA 5COAA 3V1YA 3PYLA 2EGGA 5A9TA 1R4NA 1ZJYA 4GWGA 1FDTA 4YPOA 3WJAA 4CLOB 5JC1A 1LC3A 4W7HA 3L9WA 2OZPA 4BNYA 2NSDA 1KVQA 2EHDA 2VTDA 3BMCB 3IAHA 4FOSA 4M49A 2YQ5A 1XA0A 3E5RA 3FN4A 3JQBA 3X2FA 2I99A 1TI7A 2PR2A 1BDBA 4BS9A 5KVQA 2VWQA 1B0AA 2C5EA 1SAYA 2VOJA 3WX0A 4YBZA 3RKUA 2VNSA 5I8WA 3D64A 5JDCC 3IUPA 2ZQZA 2I6TA 4CMIA 2NTNA 2O7QA 1UDAA 1WDMA 3RAJA 3EC7A 1OBFO 3DBVO 1P45A 3ADOA 1ZSNA 2HJSA 3I3OA 4N18A 1KY5A 2OORA 3U49A 1P9LA 5JW6A 1E3EA 1T2FA 3K73O 3C7DB 4JJFA 4U6SA 4CL8A 4ZGWA 5DCYA 1OFGA 1N92A 3GH3A 1GEEA 5HS6A 4QECA 2EW8A 4RQUA 5L4LA 2Q4BA 4L0QA 5TC4A 1X7GA 2E49A 4ZJUA 4UVEA 3RBVA 3TSCA 3AK4A 3FPCA 1ZXLA 2DBVO 1A9ZA 3IKVA 4OAQA 4P4NA 1BTOA 1LDBA 2ZTVA 1G0OA 5TT0A 4RPLA 2V6GA 3LSYA 2E82A 4TRMA 4YJGA 2B5VA 3OEYA 4PZDA 1LRJA 4IGFA 5MDHA 3EYWA 3GRKA 4E6PA 3ITKA 4PZCA 3MOIA 3UFXA 2WYWA 5TT1A 4IDDA 3O03A 4B7CA 3A1NA 4CLXA 2NVWA 1B3RA 3E6AA 5LC1A 2AG5A 4AJKA 5JMWA 1BXGB 4BL5A 4CUKA 2JFGA 4FBGA 1C3VA 5I8ZA 4K6FA 3TFQA 3VPFA 3VVCA 3JD0A 3ZW9A 3VPSA 3IJRA 5ITWA 3C1OA 3DOOA 1ZEMA 4TKMA 1B8UA 3U4DA 3RD5A 4XEHA 1XR3A 2UDPA 3OH8A 5HM8A 2EJVA 4LCEA 4F6CA 4B8WA 3GG9A 3NDIA 1E0DA 5TSDA 1EZ4A 3JQGA 4E2ZA 1PJCA 4FD3A 1LDMA 2R2GA 1GV1A 1TT5A 2GUGA 2JCVA 1Y7TA 2WSBA 1RM4A 1QORA 3D5TA 3KB6A 2H5LA 1PGOA 4GVXA 3OEWA 3ENKA 1GYRA 2PD6A 3ROPA 3VZPA 5KJ6A 2OP0A 4BV9A 2A4KA 2GN6A 3GDGA 2C2XA 4GBJA 1PTJA 1QSGA 2VHZA 3PWSA 5JYDA 2IXBA 3T7EA 2E4AA 4GLLA 4AFNA 3KVOA 2I66A 1YL6A 3TQHA 1D8AA 1Q1NA 3E8XA 2JD0A 5JFOA 1BRMA 1UXJA 4GGPA 2GD1O 5EL0A 4B4UA 4J1SA 1DRWA 2VHWA 1I10A 2PGJA 5IN5A 5HBRA 2X9NA 4YT2A 3U09A 1R6DA 2B5WA 5DT9A 2A9FA 3HN2A 5JAQA 3L4BA 4E5NA 3DZHA 3NX4A 3NV9A 3Q6IA 4FQ8A 3V8BA 4RF3A 1B8VA 4BO7A 4NR0A 3LT2A 1UDBA 4D42A 4QO8A 4DLLA 4PGFA 1GZ6A 4QX6A 1GEGA 1MFPA 3ANNA 3PEFA 4IPTA 1UZMA 3TZCA 1IB6A 2W8ZA 4BO2A 5A5FA 1E5QA 1PS9A 4BNUA 3FD8A 4Q3BA 4AJ1A 3GHHA 1PGJA 1NVGA 3OM9A 4ROSA 4CLRB 1VKNA 5F1KA 2VTEA 5L51A 1LBEA 3FSRA 4BKOA 2HUNA 4NG5A 4ND3A 4GI2A 2B4RO 3VPGA 5JCXA 4MVJF 1NBOA 4JNKA 1LDNA 2Y1DA 1M67A 4OIMA 3DEYX 5AYVA 1EVZA 3P2YA 3BA1A 1KOLA 5JY1A 3HQ4O 1SB9A 4NJMA 4F3YA 1UP4A 4Q3AA 5A03A 1FF9A 1ONPA 3AJRA 1U4SA 2J6IA 3FR7A 1YJQA 1P1JA 2ZIZA 3OECA 4FIZA 1AN9A 2J3HA 3QHAA 4MVJA 3QJ5A 4BIIA 5EESA 1HDYA 4JP2A 1T4DA 3VH3A 3Q0EA 4RV9A 5KVVA 4W6ZA 3VDRA 4XIJA 5T64A 5DOZA 4A7PA 4MJLA 4DC1A 3GZNB 1Y9AA 4UVHA 4D44A 1S7CA 3CMMA 3ITDA 2FR1A 2WYVA 4W82A 5TJHA 5G0TA 5FF9A 1UAYA 4ND1A 5TNXA 1AE1A 1MP0A 1R12A 5J23A 1ISIA 1ZXBA 3OQ1A 3MTJA 4RLHA 2OP1A 4QUKA 1NYTA 4HV4A 3LC2O 4ZA2A 1LTHR 4N5NA 1F0YA 1WWKA 3DZJA 2HMVA 3V1TC 2X5JO 1I32A 1KVRA 1OAAA 2Z5LA 2X8LA 3OJFA 3OJ0A 3QV1A 1I3NA 5DNAA 1XG5A 3AUSA 3BMNB 4IDGA 2EF1A 1YJ8A 4LK3A 5U9CA 1SOWA 4FFLA 4XQCA 4TRJA 3V2HA 3WGGA 4PG6A 4E12A 3M6IA 1UP6A 1HWYA 1EK5A 3QQPA 2BFPA 2B36A 3LLSA 4J4TA 1OI7A 1ONNA 4UREA 3DMTA 1NQTA 4DXHA 4DBZA 4PRLA 3K9QO 1KC1A 3ZU2A 1NNUA 3ZWYA 3NTQA 4MOWA 4EYEA 4OKNA 1LEHA 3AM5A 2OMEA 3TFOA 3R6DA 6LDHA 3GZ4A 1FDVA 4N54A 1HZZA 3PYMA 2JJYA 1WAMA 2IXAA 3DOCA 3TL2A 1DFGA 2VNAA 3FCOA 3FBTA 1YOVA 2B4QA 5I7SA 1Y5MA 3TF5A 3BTUA 3O4RA 2AHRA 1N8KA 4AJNA 4FDAA 2BFMA 3KBOA 4R1TA 3C1AA 2WYUA 4PCVA 3MJTA 4Z9FA 2XPCA 4OSPA 4ND5A 1KY4A 3E1KA 4HX5A 1QYWA 3QWFA 4OKIA 3BTSA 3F3SA 4HXYA 3TPCA 1GFSA 3TN7A 1LLQA 2Y1GA 3UGKA 1IPEA 1NFFA 5HTOA 1ULSA 4EBFA 2FPGA 2VT2A 3DZKA 3R3JA 2NU9A 3RFXA 3GVHA 4WECA 4RVHA 2AMFA 3EMKA 2W2LD 4OXNA 1VJTA 1PL7A 2VZ0A 1Z6ZA 1NTOA 2P91A 2EEZA 3QSGA 3ANLA 1YS4A 2GN9A 4ZD6A 4B8ZA 4CUZA 3ZGYA 1ENPA 3RWBA 2I5PO 3AM3A 2C7GA 1JQBA 5KNLA 3DOJA 5GZ1A 5T8KA 4DPMA 4H3VA 5ITVA 4P4LA 4BNLA 3GVPA 2X0IA 1QKIA 4BNXA 4FFRA 4CR7A 2AW5A 1RYEA 1VI2A 1ENYA 1WP4A 4M55A 4L74A 4F45A 4JP3A 3WTCA 7ADHA 1YDWA 3QA9A 1GUYA 4QTZA 4IS3A 1HDRA 4J43A 1OZAA 1H9BA 4RGBA 5FI3A 2BFOA 1JWAB 3GPIA 2ZTLA 4MVJH 1UZNA 1ZO8A 3GVIA 3PVZA 4MPDA 1HLPA 3GGOA 3ETDA 4XR9A 2GO1A 1QLHA 2Q1SA 1MG5A 3ASUA 4UUNA 4YACA 4KZPA 3F9IA 1U5CA 3I83A 3K8ZA 3WNQA 5AXAA 5JYFA 1H5QA 2CMDA 4ZVVA 5C37A 4RF2A 3K6JA 5IN4A 4I9NA 1D4FA 3IL2A 4CJXA 3OJLA 4Y6RA 5L95A 4TRNA 3GPDG 3VZQA 1K6XA 1LDGA 3K5PA 1NVTA 2GZ2A 4QEDA 4CQLB 4ITUA 3OIFA 3DTTA 5C7OO 1PJSA 4CM9D 5JAMA 7MDHA 3LF2A 1QYVA 2QW8A 4PLGA 3OMLA 3ZW8A 2YYYA 4GH5A 1H93A 5FWNA 2JFHA 2Q45A 2YHIA 4XQ9A 1YB4A 2BKAA 3WXBA 3JQAB 2W98A 3KOUA 5EJ2A 3TNLA 3L77A 3SJ7A 4YT8A 5KTKA 1Q0QA 3BMOA 3H9UA 3NT5A 3AY3A 2O50A 5G2OA 1Y8RB 1U3UA 1D1SA 1VKOA 5L7YA 1HTBA 4U6QA 1XKQA 2OFPA 2XXBA 3JYLA 4ZQEA 4Y6PA 1H6DA 2FR0A 2HKIA 1I33A 2JCXA 1JN0A 2HU2A 1T2CA 5L4NA 4J1TA 3KLPX 2QG4A 1VPDA 5F5LA 4GWKA 3S8MA 3DBLB 3CIFA 1GCOA 2WEKA 3QW2A 1XGKA 4AJHA 4GAEA 3PGJA 3H4VA 1ID1A 3ZNQA 1T1SA 3TZQA 3ZU3A 3RUCA 4YWJA 3ONDA 1AUPA 3QVWA 4I5GA 5G4KA 4EEZA 5IZ4A 4MIYA 4U7WA 4JJGA 4PLZA 3FBGA 5CPBA 1HDOA 1F17A 2O3SA 1L7DA 3KHUA 4FS3A 2QZZA 2PGDA 5BSHA 3RI3A 3AY6A 3OFSA 3INGA 2RHRA 3F1LA 2AQ8A 1PJ3A 4IZHA 4J7UA 4O0LA 1U2DA 5DBFA 5KCZA 4J2OA 4PVDA 1HL3A 4BNWA 1E77A 1HDCA 5BSEA 3CXRA 4CV0A 4A26A 3GAZA 4WGGA 3WQRA 2ET6A 4UEKA 5DN9A 5KJFA 1GZ3A 4MO2A 4ESOA 2ZCVA 1J49A 4QO7A 2Y68A 1BG6A 1LX6A 3LC1O 4IQ0A 1W8DA 5F3RA 5KJEA 5K0ZA 3ZWBA 4Y9DA 4RZIA 1P3DA 2YHIB 4NPCA 3TL3A 4E30A 2H63A 3IC5A 4BNFA 5TQVA 4FJ0A 1N9GB 1R16A 3INTA 1C0PA 1MXFA 4YJDA 4BO3A 5DP2A 5JPIA 1OC2A 1PL6A 3WIEA 1DC4A 4NBVA 5AXBA 4IMRA 4DLBA 4FFOA 2FHSA 1ISGA 4GQAA 1BWSA 4TZTA 2VYNA 3QVOA 1MC4A 1EQ2A 3U4IA 1E7RA 3GHYA 2D1YA 1YVEI 2GR9A 2NU8A 1N7GA 3JCZA 2VYVD 1PS0A 4EEXA 3KYBA 3S2FA 3ETEA 2NLOA 1A7KA 3L0DA 2VT3A 4W99A 2PH5A 3W4KA 1LSOA 2AE1A 3RBXA 5AQ1A 1YO6A 2RH8A 5L53A 4NIMA 1KYQA 1GYPA 1QV6A 3HWRA 4H7PA 1Y8QA 4RVSA 1Z75A 1DAPA 5G4KB 4QXMA 2X0RA 3HSKA 3ZV3A 3AI2A 2ZATA 2AQIA 1YB5A 3WFJA 4BMSA 3L4SO 2RCYA 2NQ8A 2G1UA 2EKLA 2YHUA 4HP8A 3I9LA 1U8FO 3GUYA 5B4VA 3QRWA 2BRUA 4HFNA 2IYOA 3DAFA 3HJAA 1B15A 4PLPA 2V6FA 1NAIA 1NM5A 2DUUA 3I9KA 3IKTA 2YV1A 2H9IA 3IIEA 3SLKA 5C3MA 1Q7BA 1E7YA 4A0SA 1WMBA 4YT4A 4MVJG 2NU7A 4IDEA 1Y1PA 4AJ2A 3FI9A 4KUGA 4FFPA 4WKGA 3MEQA 3U4HA 4CM1A 1JW9B 2HK7A 2W2KB 3OIDA 4UUPA 2C54A 4K28A 3ZV5A 4J9UE 4KQXA 2J8ZA 1DFHA 3NDRA 3UOGA 4E3ZA 2YFHA 3QLJA 2W2LA 4Q3DA 5CFZA 1SC6A 1ZMTA 5DOVA 1FMCA 4NJMB 4Z3DA 2F1KA 4BUCA 5A5EA 4BVAA 3I9JA 4JROA 4NBTA 1E5LA 5G4LA 1BW9A 4R68A 4XWYA 4OJNA 4A03A 1ENZA 3KTDA 1Y5RA 3EUWA 2W90A 3F46A 4I1IA 2O3JA 4BNNA 4CM3A 5IXSA 1R0KA 1K2WA 2RAFA 4PG8A 4LN1A 2G76A 1DHTA 1LQTA 3VVBA 1LC0A 5H81A 4LMRA 1DJNA 3Q2IA 4JIGA 3UXYA 3W8FA 3LC7O 1A71A 5ADHA 3ZV4A 1D3AA 3S2GA 3INRA 3DHEA 3O9ZA 2ZB3A 3BHMA 5IG2A 4JBIA 3GR6A 4XGNA 1E92A 3IJPA 3UN1A 2OGUA 1E3WB 3HHPA 3WGHA 1LSSA 1HETA 4P22A 2WM3A 3BMNA 4CQMD 1WZIA 2V65A 3PHLA 5C7LO 5C7IO 3H5RA 3KEQA 1NHWA 2NM0A 4RPJA 4E21A 3BAZA 2BI7A 3AWDA 2PY6A 3GDOA 2QRJA 4EZBA 1C1DB 4CMGA 1ADCA 3GGPA 4RORA 1HKUA 3NJ8A 1JAXA 2DTXA 1H6AA 2XAAA 4WLNA 2JD1A 4MINA 1YE3A 2DPGA 4XDZA 3T4EA 3OQ6A 1WZEA 1QR6A 5ILOA 1QMGA 1B2LA 3WOHA 1DIHA 3L6OO 3ONFA 3O26A 2EV9A 3OHSX 4DL9A 3DTYA 3GMDA 3AFNA 1ZNQO 5JO9A 1KEUA 1YH3A 4R1UA 4CPDA 1T2AA 2G5CA 4BNGA 3T4XA 1V6AA 3X2EA 3PPIA 1UUFA 3PQFA 4JBGA 4IDFA 2Q49A 2RHCA 1HXHA 3UH1A 4Z9XA 4CR6A 3H65A 3JQBC 4OO3A 2O7SA 4PLCA 3UF0A 5I7FA 3WYEA 1ISHA 5IXYA 3W4IA 1EE2A 2JD2A 3C7AA 3OF2A 4Z9YA 4EUHA 4NFHA 5EQFA 2DBRA 3WS7A 4BGIA 2W4QA 1ZVMA 3AOEC 3DBHB 3VZSA 1IHYA 2I65A 1ZMOA 4BB6A 5GZ6A 3I52A 4R16A 4Q3EA 4YAIA 1BXKA 3DZGA 3QIVA 1ISFA 3JQAD 3VKVA 1XU9A 4D46A 5TIIA 2NVUA 4WNCA 3WGQA 1Z74A 3NGLA 1BVRA 3FNGA 1BMDA 4O59O 4H16A 2GF2A 3T7CA 1VRWA 2X23A 3RC7A 2Y05A 1ADFA 1XYGA 3JYQA 4TROA 4CM9A 4MVJD 4BQRA 4CQMB 4NFSA 5A1TA 1GD1O 1HLDA 5CG2A 3VH1A 1Y81A 2R00C 3F1KA 4RDIA 3WLFA 4B7UA 2IE0A 4J1NA 3ZNPA 5JDCA 2QHXA 3GAFA 4RPHA 4NU5A 1R4MB 3OETA 1GQQA 4S1VA 3UCXA 3KUXA 1MXHA 4TVOA 4D3SA 1RWBA 4J4HA 4DGSA 5I7EA 1W73A 1F14A 4YAGA 1MFZA 3UCEA 3WGTA 4HFJA 4JCOA 1B8PA 4B79A 3L9XA 4XZ3A 5K9ZA 1P1IA 3E82A 1EFKA 3ZHZA 1C1XA 4XD2A 3RU9A 1MG0A 4MVJP 4U5QA 5U1PA 3ASVA 4CMHA 3ROKA 5BNTA 4GLOA 1XWFA 3JYOA 5FI5A 1A4UA 4O1MA 3WR5A 6ADHA 4KOAA 2FZWA 2Q4EA 1W4ZA 2LDXA 3DFUA 5EINA 2E48A 4MP3A 2VN8A 1LDYA 2HDHA 3GG2A 4UAGA 1E1MA 4E5YA 3W6ZA 4G2NA 4PG7A 1PQWA 4TQGA 3B20A 4K6CA 3RU7A 3RKRA 2BHLA 3K2BA 3COSA 1XCBA 3KEOA 5ENVA 4I5EA 4BNVA 3Q2KA 2X0NA 4R5MA 1U28A 2EWMA 1PWZA 3SEFA 1RYDA 9LDBA 3GC6A 4TRRA 1GCUA 1N5DA 2NVUB 2XXJA 2J5KA 1YL5A 3FNEA 3GNSA 3D5QA 4ILKA 3BMOB 3DDNA 5CPFA 1EDZA 1PR9A 1UAGA 3DB2A 3BYZA 3OQBA 1Q2XA 2DQ4A 1PGNA 2GERA 4B3JA 4E33A 3ABIA 3DZIA 4RQTA 4Y67A 3ZWCA 1HRDA 1JU9A 1VSUA 3OP4A 4CODB 2CY0A 2YV3A 3PFFA 4IS2A 1MLDA 1GL3A 3QWIA 4XJSA 4PRKA 2X1HA 1LA2A 5A05A 5JCJD 2D5AA 2CNBA 4CLHA 3WG9A 1WXDA 1V3TA 2WD8A 3GN1A 3LF1A 3UICA 4E31A 1PQUA 5CG1A 1VL6A 3GOHA 3PWZA 3TOZA 1E6EA 4YJHB 3MOGA 5KIAA 2ZB7A 2NTVA 1U4OA 2SCUA 4E2WA 2UAGA 1GTMA 1X13A 2PKRA 1MUUA 1K89A 4D0SA 3H5NA 5H82A 4FN4A 3RUAA 4XIYA 3BIOA 2EIHA 1GYQA 3LZ6A 3TZHA 4CMBA 1UXGA 3UKOA 3E18A 4WLFA 4PLWA 3AOEA 3JQ9C 1B26A 2H1SA 1CWUA 2WMDA 4IDBA 4EITA 1SBYA 2PK3A 2NWQA 2ZK7A 2JHGA 2OBYA 1KS9A 4R4JA 1XQ1A 3NYWA 4Y6SA 5JMPA 2B83A 3SC6A 1X7DA 4CMIB 2C2YA 4QT0A 1IE3A 2VHXA 2ZB4A 2Q22A 4I8XA 1NQ5A 1SZJG 2D0IA 4FFMA 5BR7A 1PS8A 4CMAA 3RQSA 4BGUA 1E1NA 4IMPA 5BT9A 1N9GA 1YONA 5F5NA 1EQUA 2O4CA 4Z3KA 2GGSA 3FHLA 1X1TA 1U7TA 4B3HA 1ONOA 3SX2A 1C14A 1IZ0A 1DOHA 2CVQA 3PJGA 1H0KA 1HSZA 3F47A 4BO0A 4E2XA 3GEMA 3JD2A 4BNMA 5EIOA 4LSMA 2X9GA 3DL2A 4NBUA 3KO8A 1EVYA 1UJMA 2FR8A 3WSWA 5H83A 4YJGB 2DM6A 1CQIA 3WQSB 3CEAA 1UXKA 4IXWA 1ZK0A 4FGSA 1HYEA 1J4AA 2DT5A 4ALLA 3ZHBA 4BB5A 1NR7A 5JY6A 1EEHA 4D43A 3RROA 1ZK4A 2C5AA 3AFMA 2CFCA 2JL1A 1K5HA 3PDUA 4RPKA 4GX0A 2HLPA 1EBFA 2HQ1A 3CTMA 4PFJA 4YJFB 3DC2A 2GZ1A 1T1RA 2XF8A 1JAYA 2D8AA 3WB9A 3JQGB 1GQYA 2HK9A 3KRTA 3OIGA 4NDNE 5TLSA 1DAOA 1PSDA 2Y1OA 4WEQA 4G5HA 1NHGA 2IEDA 4PG4A 1E7WA 2ZQYA 3MJCA 3A4VA 4WOJA 4R9SA 1T2EA 4MVJI 1ISMA 4XYEA 1A72A 1ZUD1 3JQDA 4XDYA 1R15A 4XX0A 1N1EA 1DC6A 4LISA 3RVDA 2WD7A 1EUZA 2FWMX 1IHXA 3KYCA 1UR5A 5BSGA 3OJEA 3V1UA 1MB4A 1S6YA 3VPHA 2W2KA 1JKFA 1ENOA 3PZBA 4YAKA 5T57A 2O3TA 4IJKA 3ZWPA 2DTEA 3ZWAA 1A9YA 4XYLA 5CDGA 3RUHA 2VHYA 2ZKLA 1QRRA 5BNFA 4RF5A 5EMHA 1O6ZA 1LLDA 4F6LA 4CM7A 1I0ZA 1Z82A 1K6IA 3S1LA 1HF3A 3IP1A 4Q3NA 5JS6A 5ICSA 1TXGA 1O5IA 3PJDA 4ND4A 5A9SB 1W6UA 4CLEA 4HBGA 4EUEA 5JBIA 4RVUA 3KZVA 4BHTA 1E3SA 5KVCA 1DSSG 4NK4A 4WNIA 3I23A 3WGOA 1LJ8A 2BELA 4A10A 1UDCA 3DQPA 4J6FA 4D7AA 1WDKA 2FSVA 4B4VA 2DFVA 3C7CB 4YAEA 3RASA 3A28A 2HO5A 4MKZA 4PN3A 1JDJA 3PP8A 2VUSA 2HMTA 4XRRA 5KJCA 4JJIA 4WE3A 1I01A 4L76A 2C07A 4KTTE 2FY8A 2D4AA 2IZ1A 2WTBA 3OJOA 1I36A 4JBHA 3OA2A 1L1FA 1TB4A 3AUUA 1YXMA 3GN2A 5A3JA 3GEGA 5CEFA 3JQ6A 1E1LA 1KVTA 5DULA 5DZSA 2VCYA 3D3WB 4BNHA 1V35A 1DBVO 1E3WA 3B1FA 3HDJA 3HDQA 3O38A 4BO4A 1HE5A 2AEFA 2P4HX 3NJ4A 2V6MA 5IDQA 1V8BA 1GZ4A 2P5UA 3B6ZA 1RPNA 5LDGA 1ARZA 1O95A 4NK5A 3KV3O 2RIRA 3JD3A 5CAEA 4OYRA 2JAPA 2DVMA 4R1SA 2DUWA 2D2IA 1RM5A 3NEPX 3LT0A 1C1DA 3F5SA 4UVDA 3KYCB 1LXCA 1GPJA 1YBVA 1I2BA 4C4OA 2NACA 2ZYAA 4ZU3A 4IUYA 3IOYA 5L3ZA 3KSZO 1KIFA 2NTJA 4FR5A 1P1HA 4HUJA 4J1QA 2QRLA 4NJOA 1YQGA 3P7MA 5TX7A 3FR8A 3ZWMA 1GU7A 4CMJA 3E9QA 2I3GA 1W0CA 3IMFA 3CUKA 4IY1A 3A9WA 5CHEA 1PR3A 2D59A 3PHHA 3I1JA 5CDYA 1M76A 3N7UA 3PDJA 3PIIA 4K26A 5B1YA 3JQ7B 3ZU5A 3WFIA 2R6JA 5A9SA 3WBFA 1XELA 2EG9A 3OBBA 4DTIA 2UYYA 4BO6A 3ICCA 4FPXA 4ZQHA 1NPYA 3JQ8A 2DLDA 1UXHA 2RH4A 4RPGA 5FFFA 2Q2QA 1R37A 1Y9EA 2DKNA 2PLAA 1LLUA 2VHVA 1HE3A 1KERA 4NQZA 3VDQA 3GMSA 1YRLA 1SOVA 1XU7A 2Y1CA 2A94A 4CM8A 2CDAA 4J49A 1E7SA 3GEDA 2YUTA 2HMWA 3ZH2A 1YWGO 4DC0A 1PJQA 8ADHA 3G1UA 4L75A 1BVUA 4R54A 3KETA 4CMEA 1EK6A 1U3TA 1PQPA 4I5DA 1A4IA 3BMQB 4OSOA 3RJ9A 1DLIA 4J3FA 1ZEJA 3D3WA 2F00A 3PQEA 5DBIA 3CSDA 2X22A 4L4XA 4BO1A 1LDEA 3R3SA 2ZYGA 4DYVA 2FPPA 3K30A 4CM5A 1ZBQA 3M1AA 2NU6A 4IZIA 4XJTA 4EW6A 4TVBA 2X5KO 4EJMA 3WMWA 4E2YA 4HADA 1YOVB 1T2DA 4WCFB 1DIAA 1R4NB 2BGKA 4G65A 4W7IA 1Y6JA 3D7LA 2H6EA 2JFFA 3AUTA 4OH1A 4FGWA 2QZ9A 2J5RA 3L6DA 4L73A 4KP7A 2WJPA 1U9JA 4UEJA 3V2GA 2CF5A 4MVJM 4II3A 3HB4X 2CDCA 3W1VA 4TKLA 3MJEA 4IIUA 4GVLA 1DHRA 1QYXA 1ZZEA 3U62A 1O94A 5MGBA 4WCFC 1X0VA 1WW8A 1SCUA 2PH3A 5CDSA 4PLTA 3PTZA 2GLXA 1EDOA 3BMCA 5JE8A 2O2SA 3KYDB 4DMLA 5I9LA 2NV6A 2P2SA 4YB8A 1G6KA 4YQZA 4D3DA 9LDTA 4KQWA 1ZK3A 3B1JA 3GQVA 4JLWA 5ENDA 2I3AA 3WIDA 5LCXA 5KOIA 1P74A 4B7XA 3RC2A 1SNYA 2IEBA 1XIVA 1AXEA 3MWDB 3HDHA 4FJ2A 3W8DA 2VRCD 3ST7A 4M89A 1AHHA 2O2YA 1GUZA 4G81A 2EW2A 4BGEA 1E3JA 5F1OA 4BMVA 4AL4A 3BXXA 3BZUA 3PHIA 4MKXA 4IDCA 3LT4A 5T5QA 5T67A 4DWVA 3LDHA 4ZRNA 5BNIA 1H9AA 4PVCA 4XYGA 4BQPA 3LU1A 4L4RA 1SEVA 1NX6A 1AHIA 3A14A 1CQJA 4TZKA 4WJZA 3AU9A 2Q46A 1PJLA 4DLAA 4ALNA 3N74A 3NUGA 3B70A 3EK2A 5LDHA 1VL8A 4PLVA 5JNLA 4MP6A 4P4GA 2NQTA 5AXDA 4DMMA 1P1RA 4NH4A 5G0WA 2Y0CA 4OQZA 1IZ9A 1ZCJA 3VKUA 3ROMA 4NZ9A 2E6UX 1J6UA 4CQLA 4Z0HO 3KXDA 4NU6A 3U0BA 2WDZA 4YEDA 4XQGA 4R3WA 1ZIDA 1ZKMA 3C24A 3ZWWA 3TWOA 3GNQA 1FXSA 5ILGA 3GUCA 1K3TA 3U3XA 4RLSA 3PXXA 3ZN2A 4YRBA 4XRGA 2VWHA 4R3NA 2EXXA 2YY7A 1P31A 4A73A 1TT5B 2ZTMA 1CETA 3KSDO 3JQEA 5DF1A 1BDMA 2PZLA 2C0CA 1HYHA 3D4PA 1PU2A 4KDFA 3G79A 5COBA 1HE4A 1I2ZA 1LI4A 2FRDA 4X54A 1I24A 3GVCA 2OXIA 5HS4A 4P8RA 1NR1A 3RSHA 5B4UA 4Y98A 4RVFA 2OL4A 2Z1NA 4DUPA 4HNHA 1RM3A 4BNIA 4ZQGA 3FNHA 2GCGA 4Q39A 3HUDA 5HA5A 4PLFA 3JQ9A 4NHEA 3C3XA 3EVTA 3N58A 4JK3A 3ON5A 4J2HA 1PX0A 3I4FA 2BD0A 1P33A 4FC7A 3E03A 1X0XA 1CERA 4URFA 2B0JA 5A9RA 1FK8A 2Q1WA 2PD4A 1PGPA 1MGOA 4MDHA 2HMUA 1CF2O 3RFTA 1I30A 1XLTA 2GYYA 3EY4A 3FTNA 4CR8A 4AJPA 1Z45A 1WLYA 5GY7A 5L7TA 1ADBA 4E32A 2PWZA 2O48X 1IY8A 3BHJA 3L07A 3Q3CA 2VYND 1N7HA 3CINA 4UVGA 1R66A 1YB1A 1MC5A 1DPGA 1PWXA 2AQKA 3GLQA 4DA9A 5BQFA 2B35A 4A27A 2Q99A 2QRKA 1XQ6A 4ALJA 1IYZA 2GDZA 2O3UA 1PJBA 4WLVA 2QX7A 1ZJZA 4MVJE 3ENNA 2NNLD 1CYDA 3VH4A 5L4SA 3D1LA 2HRZA 1TEHA 3DBRA 3DONA 3TOXA 1XEAA 1NFRA 2DBZA 3PYXA 5T73A 4J16A 1EFLA 1EBUA 2QQ5A 3EZLA 4CLRA 3E9NA 3WYCA 4J4BA 3U9LA 1H2HA 3ZCXA 1TLTA 4GGOA 4ONEA 3CH6A 5A04A 3PK0A 5G0UA 3W6UA 1PL8A 3ZHYA 2POQX 2IRWA 1JKJA 1JLLA 3MZ0A 2VYVA 5ER9A 4AICA 2X4GA 3PI7A 2NADA 4KUEA 3IP3A 1JVSA 3ZU4A 5A3VA 2YDXA 2Y93A 2DPHA 3CKYA 5AOVA 4B4OA 3SLGA 4RL6A 1YBMA 4BO9A 4IJVA 2FPIA 1GAEO 1MV8A 2C7VA 1WVGA 2D3TA 2R00A 2JCYA 3GK3A 4IIVA 3JYPA 4DBVO 1PIWA 5JC8A 3LVFO 5GMOA 4IBOA 3WGYA 2Q1UA 3G1TA 2HK8A 2O23A 1QG6A 2WE7A 3GZNA 3PHGA 3ZV6A 3VTFA 5EN4A 3DWFA 5AVOA 3K31A 4IJUA 1B3BA 1CJCA 4PLHA 1E7QA 3ZI0A 1YDEA 4XCVA 1MX3A 4YT5A 1JTVA 2BF7A 1PJ2A 4PLYA 5DCUA 2PTGA 1Y8QB 2IODA 2UVDA 1X1EA 2QYTA 4A5OA 3I6IA 2OBNA 5IDXA 3HFSA 2G17A 4FOOA 5T8KC 1SB8A 1YL7A 3EHEA 3PRJA 4JN6B 2HJRA 1JWBB 3GRPA 3MJ4A 3HB5X 3EVNA 2Y0EA 3DMYA 2Q3EA 1Q0HA 1BGVA 3PWKA 2UUPA 1LUAA 3DBRB 4YXFA 5CDUA 1HE2A 1J0XO 2IYPA 4W4TA 5F21A 3LYLA 4I9HA 4NFYA 4ZHSA 4QFCA 4ALKA 1H94A 3H9JA 1VLLA 1CRWG 3LK7A 1LRKA 3NKLA 4XYMA 3RJ5A 5IZCC 3JQFC 1VC2A 1F12A 1T24A 3CMCO 1K0UA 2PKQO 3FWNA 5JSFA 2VWGA 1XDWA 1Q7GA 1TA4A 1I2CA 4B3IA 2DBQA 4OOFA 1DC5A 3H3JA 3C1TA 3AY7A 3M2TA 5I9MA 3LLVA 1U2GA 3NGXA 1C0KA 1NASA 1BW9B 3PZRA 1BXZA 1QYCA 2DTDA 1GPDG 3ETGA 1U8XX 4YVFA 2Q2WA 4WUVA 3Q9UA 1ZK2A 4O6VA 2AG8A 1YBAA 1SEPA 2YJZA 4IGEA 1UZLA 3ORFA 3K96A 3DHNA 3OICA 4RJTA 5FYDA 3JSAA 1KVUA 1SPXA 4R1NA 3D3EA 3UAGA 2DU8A 4WASA 1DRVA 1WDLA 3QY9A
chains in the Genus database with same CATH superfamily
1LQ2A 4KYTA 3NALA 1NPTO 2IXEA 2Q28A 1XI2A 2RBEA 3ONEA 1PZEA 3D5EA 4KE6A 2Q8QA 4JJ7A 1M1UA 2D1FA 2H2HA 4UE2A 3SYNA 4KNVA 2Q1XA 1C0IA 3FOFC 3JQ7A 1I72B 3PITA 4EPWA 1RWOA 4LVUA 4WW0A 4CKXA 1ZCBA 1YZVA 2P4QA 3IP8A 3PDHA 3I2JA 1JIVA 1DKNA 5EXSA 3CH4B 2PZKA 4ITVA 1I4WA 1DPFA 3AR8A 2C29D 2WMNB 4EHAA 4UPEA 5IC5A 1G8AA 1LLCA 1RWWA 3G9XA 3HGQA 3IO5A 4DIEA 5FPYA 3AJ9A 2OCGA 4QXAA 5K8VA 5J4LA 1WSDA 2H4HA 3VMFA 5F1PA 1PUXA 2PZFA 3PGXA 3WGNA 1PZFA 4JYMA 4HNTA 5AVXA 4YRCA 4L9RA 1RJEA 2VRBA 1LK5A 3G0OA 5JAZA 2WJAA 3VC7A 3THWB 4JC5A 4JL6A 3WWYA 2XWJI 4KFSA 3A10A 4CI0B 2ZZKA 3G2IA 1QHHA 3F5MA 4I1VA 4BNKA 3H8JA 1QVAA 3SF8B 2Z1MA 2KI5A 3VNAA 1FSGA 2FZCA 3LO5A 3SX4A 1CRQA 4AROA 1OLXA 5H3LA 4ID3A 1G2IA 1GRVA 1A96A 4EGFA 1BSVA 1DJQA 2BTEA 1QOQB 3IDSA 1Q6ZA 1QO0A 3L05A 3KXPA 2BMAA 4AP6A 2MYNA 1Z4KA 3OC6A 4HFMA 4CF4A 3PPYA 5E2AA 3AL0C 3QTBA 3C6XA 2HA0A 4WKOA 1J8DA 3AW8A 2JI4A 4PYKA 5IMBA 5IFLA 2OA0A 1KETA 3UHAA 1SMKA 5F9FA 3I37X 4UMFA 4UCQA 5EXDA 1ZN9A 2JGDA 3E22B 5IUKC 5IUNC 1XDGA 2G06A 1V1MA 3ILHA 1AGXA 4CL3A 5EJ4A 5I45A 2IS4A 3QIAA 2ICAA 3GJ0A 4UPDA 3WP0A 1QH1B 3PB3A 3W9YA 5JCOC 2XT6A 3QELB 4DQUA 1JJ7A 4HNAA 4RZHA 3WNDA 4XIGS 5C1PA 3EMDA 4HDOB 4ZVUA 3H6KA 4MS3B 4UU8A 4FNGA 4JX8A 4MEJA 1TLLA 3VX4A 1A7JA 2PV7A 1W5FA 3OHMA 3PL5A 4K1LA 4RZSA 1JB1A 3NEYA 4DNPA 1K27A 3G9UA 4GP6A 2GBLC 1SVLA 3VZRA 3KOXA 1YZUA 4ZGGA 3E48A 1AVTA 3DO5A 3HFGA 2IDJA 4WLOA 5G1PA 3TEMA 1OAOA 3USES 1JALA 3V7UA 3SMQA 3E3MA 1GDTA 3LL4A 3OTWA 2O8DB 2SNIE 5IVIA 2X41A 2GH1A 3PFWO 1Q22A 5B55A 1QIMA 2XVYA 4TXJA 1JIQA 1ECPA 1LU9A 4ZICA 2PX2A 3CW2A 3EIHA 4LRUA 1H6CA 3AM4A 5TF4A 3VTZA 1WMAA 4ASUD 3DKIA 1P39A 5FO1A 5K6AC 4O02B 1JQ5A 2OHGA 3H2YA 2ID8A 3BD7A 2HRBA 1RQNA 5DGCA 1QRTA 4DA4A 4XM2A 3F9CA 3TDNA 1U3FA 3EDMA 3AONB 3WJ7A 1J8VA 1K7SN 2OPBA 2V59A 5DGTA 4Y2JA 4CFSA 2UV8A 4YV1A 3K70B 3PE3A 1D2HA 5DNCA 1MEEA 1KK0A 5KJ1A 1W36B 1GADO 1H85A 4PHTA 3KPUA 5KMGB 2JAWA 4GQIA 4LSZA 4RETA 1QFJA 3DJFA 2AFIE 4CLOA 1XALA 2P2DA 4ZV4A 1I14A 3BXEA 5IWAB 4KQEA 4COKA 1MJFA 4RCVA 5DIZA 2Z1DA 4GS5A 5KYKA 2H1LA 4BP3A 3GRVA 3CPJB 5KEIA 4RVOA 4UTZA 1F51E 5FQOA 5M3BA 4C1NA 1PFQA 2PQ2A 5LYJA 1SG0A 1N1GA 2MSCB 1E9AA 5C4GB 4ALIA 7GPBA 1ETUA 3AKCA 3NETA 2C99A 1DEXA 2QRHA 4H0NA 4ACAA 1LS1A 1KPGA 2A5JA 1N34B 2DQZA 2QRVA 1O9HA 1GV0A 1XL1A 1ZNYA 2P7HA 3NHAA 1ZGJA 1PEYA 4Q82A 4AQ7A 5E4YA 2EJWA 4G1CA 3TRHA 4LEIA 4HN9A 4E5KA 3WHKA 1E2BA 1JEOA 2H1HA 3HA3A 1X86B 3CY6A 1GPBA 2FZ5A 2GYWA 3QVGA 2AG0A 5E2BA 3AHDA 1OYYA 3MJSA 5KKCA 1TK2A 3NRCA 1U8CB 2CC2A 4ENVA 3ADBA 5F78A 1NP3A 3Q5DA 4ENSA 2V74B 4LX0A 4EM6A 3UC9A 2ZRGA 3DP7A 3PXAA 1RYNA 4DXDA 1VB5A 3THXA 3W5UA 4O0MA 2CXPA 1U3VA 1FZTA 3L7LA 4JC8A 2Z5FA 2A35A 3LMKA 1JI0A 2ECPA 4HB3A 1JDSA 4LV8B 4ZPJA 3FSEA 1SO8A 3BE6A 3NBYC 4MKRA 3HVJA 4A16A 3AVYA 3KR0A 3EW7A 3M6MD 4I4TB 4XDHA 4Z1OA 5BN5A 5AM2A 4FW8A 3MWEB 5A4JA 4XB1A 3JARA 4MVYA 1JQAA 2EX1A 2YR0A 3G2KA 1CE8A 3IE2A 1C9EA 1FFXA 3BWEA 4R05A 1H6BA 1IOLA 2VXBA 4LYGA 1UT8A 1A8QA 4RIHA 6Q21A 4EJ6A 3TV1A 1IULA 1NZFA 1VGQA 3NP9A 3RFCA 4AN4A 3ZDFA 2WG1A 3DOHA 1PZGA 5KWIA 3CZCA 4N12A 4NHOA 1KJIA 5AUQA 3FYUA 3BC1A 4L8GA 4MARA 4BMXA 4EA6A 4GSKA 4B83A 2I6UA 4YCMA 4OA5A 2FAXA 5JXWA 4D79A 2WWRA 3HACA 5JXGA 4Z6KA 1OASA 1XPJA 4M8SA 1TU4A 1R0LA 4J1TC 1Q0RA 5C80A 3V2UA 2NUAA 2YL2A 1OIWA 2A9VA 4K0KB 2ZIXA 5JNWA 3PE4A 1E7MA 3BK7A 4UHHA 3GFSA 3CPHA 3GCDA 3WYBA 4OHFA 3USCS 3W8RA 1FA9A 3HUUA 1Z5OA 1W36D 1CUIA 4GSLA 4MEAA 4Q3OA 5JROA 1FP2A 3SHOA 3W3ZB 2G7ZA 5TE9A 2I2XB 1NUTA 3M2PA 1DIGA 5TS3A 3FDZA 1SQGA 1N6IA 1ITZA 2ZG6A 4WKNA 1N2ZA 3WIOA 1Q17A 1ZXXA 1B93A 5L40A 4X6YA 1U1IA 2Q0QA 5IC6A 5HCUA 5EPOA 2Z95A 3DW3X 3OJXA 1DIRA 1S3FA 1II8B 3FW1A 5A06A 3HNRA 4ENPA 4NC9A 5JT1A 1J07A 3WDSA 3SZLA 1GY8A 1HO3A 3WLHA 4WZBA 1V6CA 3CVOA 4FMCF 1IB0A 1M6WA 2GHIA 2BMWA 3H1PA 3WLJA 5F9HA 1VDZA 5FPTA 3FVTA 3MTIA 2HN9A 3HR7A 1PZXA 1BN6A 2YRFA 5THQA 3ISJA 1SJ9A 5E4FA 4J91A 1G8FA 1AQ6A 3VVMA 2WSYB 4MP8A 3VAYA 1O8CA 2BZ0A 2LUOA 2VZ9A 4S1NA 3ZWXA 1ZK1A 2XVZA 4MA0A 4KNWA 3RVMA 5LKRA 4BZPA 3EP8B 3U39A 3MJVA 1JHMA 1GLGA 4BKPA 2PZJA 2AX4A 3RREA 2F4NA 1KHTA 1NRIA 2VF5X 4F3CA 4D97A 1HEIA 1JR2A 2GJ4A 1FSFA 2P35A 1CDZA 3RC8A 1GSIA 3G2JA 5BV7A 4TTJA 5G3ZA 3ZGZA 3IUSA 5E1OA 3KQKA 3TRKA 3BCHA 4UC0A 4CM6A 1KQPA 1GDDA 4PIVA 3FYUB 4BMPB 3LZCA 2WWTA 3PT5A 5IASA 2XOXA 2PYZA 1ZOLA 2WE8A 3JATA 4RKWA 4F7DA 3UK1A 4Y2HA 4Q3CA 1CDOA 4ERNA 4OXYA 1C8KA 2PDAA 2EFJA 1VSVA 4H3HB 3I5MA 5U4QA 3C3PA 1ZYUA 4C0SA 4V1CA 3FX2A 3K4PA 3KAPA 5C1IA 1IL0A 5CA1B 3I8XA 4FB5A 3ANXA 4AKEA 2FW8A 5P8WA 2PZAA 3BTVA 2R1UA 5FUWA 4YMVA 4QQRA 5D2CA 1MJHA 2BFAA 4LOIA 5I5GA 3VBCA 1NNI1 2CL5A 5FUVA 5FOXA 3S81A 3EN0A 4XWTA 2AVDA 4ID9A 1AS0A 4XR4A 1W29A 1ZD4A 4EY6A 3UKDA 3VKFA 2XMPA 2B99A 2HD4A 2V6BA 4YROA 4QUHA 4PZZA 1P73A 4UD6A 2V0CA 1G41A 2UZ1A 1MABA 2VEOA 2I76A 4M1WA 2ZJFA 4FDUA 4TM7A 4JXXA 3IHTA 1KC3A 2OESA 3T3EA 4ASUA 2ENWA 4GW3A 3W34A 5KQPA 1DDOA 3V4VB 2LNDA 3NKVA 3BJMA 2G1JA 2GEDA 3P71T 4Y8VA 4BFXA 1VXRA 3UA4A 1XJ5A 3ZPXA 4CHTA 2BDEA 3BVPA 1VIAA 2NXEA 2ZWVA 2FSFA 1A5ZA 4TLLB 2F62A 4II2A 4WCDA 1WKBA 4QGHA 1RKVA 4HATA 5AIAA 3BUSA 4QPDA 3ITNA 4EB0A 4TMXA 2LW7A 2CZQA 1EWYA 1U63A 1RQ2A 2X5XA 3VHRA 1THMA 2WD7B 2ZPUA 1BVHA 2VUTA 1PVDA 1QGUB 1OV6A 4JP1A 3WIBA 3KJFA 3HXLA 2PUJA 4URVR 3TRFA 3EFOA 1P5RA 2B37A 1XPOA 3TJRA 4MIEA 1FYDA 4XGIA 4LJRA 3VXKA 2OCPA 4ND2A 3UNXA 2ZUEA 1RBZA 3G17A 4N5HX 1W5AA 1OKKD 5JLAA 1TTTA 5EP1A 1YJCA 5ALQA 1KI1A 1F8GA 2Z58A 1E6UA 3Q7SA 2IYSA 1XDDA 2CWWA 5CXUA 3KEMA 2IV7A 1RJGA 3EWAA 1MT3A 2O0MA 3I6QA 5CCBA 1UJ5A 4FM9A 5AMXA 4G8CA 3I9OA 5H3HA 1U4NA 5SZKB 5G53C 2HCFA 3IVXA 3NTOA 1NG9A 1E3QA 1Q0LA 4S1PA 3F6YA 4MQLA 4BKRA 4V0NA 3EISA 3GFBA 1XWWA 1JXAA 2F1JA 5D5HA 5TARA 4ZTZB 5IAGA 1HDXA 2DY1A 3RT7A 4DLTA 1OH7A 3S1SA 3ZY5A 3Q15C 2CD9A 3EVGA 4ZYVA 3JD4A 5ED4A 2R0QC 3UMBA 1WXGA 4IJ6A 4DJJA 1A9XA 1O9BA 3CRW1 4P80A 4KQJA 3P9SA 3QWAA 3RUEA 2ZS8A 4QJ5A 3V00A 4EHIA 2P6MA 3B36A 1AMUA 1OLOA 2DOKA 3ZDCA 2KWIA 4JL5A 4BB6A 4FE4A 2F4VB 1FBTA 5CLLA 4MRRA 2F43A 4NBWA 4CTMA 2AE2A 3SJUA 3BZBA 3DNFA 1QIEA 1XHLA 1IRIA 2PA3A 3BE4A 1FRFS 1MPTA 3IUJA 3G59A 4RJLA 3ZXXA 1W1IA 2QZPA 4BEBA 2BLNA 1X1AA 2YN0A 3EQ8A 3EZYA 1X15A 4OL9A 4RF4A 3S2EA 1SXPA 3THWA 3JXEA 1NSYA 1NAHA 2OLEA 2QAGA 3HMQA 1V3UA 4Y6LA 3KD2A 1PFKA 1SPBS 2FG7C 1I7LA 3EX7C 3KQWA 1UBFA 2F67A 5KOHB 1WBDA 2PG3A 1XHEA 1YZLA 4YC7A 4YN3A 4DLRA 4E13A 4EJ0A 3CNNA 3OG9A 1RMTA 1XMIA 4UEOA 5D7BA 4DIFA 1YAHA 4N9QA 2HWXA 3DFZA 3NPAA 3KBBA 4U0JA 4CF5A 2UVQA 2P65A 3MMNA 4CMCA 1W4LA 3RS2A 4YMHA 1ESZA 1CTQA 1GAJA 1ZRMA 2ZCJA 5A02A 2SECE 1ZD3A 3L8HA 3OF3A 1F06A 4IIHA 2RI6A 5FV7A 4DG8A 3Q87B 3T06B 5IDWA 1QFSA 1K63A 3BFKA 3IO3A 4JU9A 5CHYA 1VM6A 3UCFA 4WA8A 3B13B 4LYFA 2GXSA 4J6EA 1D6SA 4IDAA 5D00A 2I54A 1H69A 4ME6A 1OMOA 1YR3A 2OG2A 2GSDA 3L02A 1JG3A 4OXKA 4UTXA 2HLNA 3S2ZA 4DR5B 2P9EA 1WV1A 4GMKA 5KREA 3IIJA 4KL8S 1NQVA 3URKA 5K6AA 2VR1A 4TWAA 4UM7A 2P6RA 4QUDA 4DF3A 3EVZA 1EFTA 2P2NA 2YFQA 1I9GA 4ZCSA 3TOVA 4EFDA 4ZAYA 1OZGA 5FBVB 4X7BA 3LGXA 4K88A 2JI8A 4AN1A 1IN6A 1ZU4A 1M2WA 1X1SA 2PIDA 1QV7A 3B1WA 3DE1X 2JIDA 2EDCA 1XC7A 1HK7A 3H8WA 3M3HA 3NOQA 4HLUA 4PY2A 4YFYA 5FXMA 5C5IA 3Q88A 3OHPA 3LFUA 3LUCA 4A5OA 1JYSA 1REQA 1V0JA 3WBBA 1WLSA 2GM5A 2HSDA 3FWZA 2Q1TA 2R8YA 3RV4A 1QTRA 3THOA 4A8JB 5L6LB 2Q3FA 3G7NA 1KEEB 3I45A 1BXRA 4M9QA 2XB6A 4RKYA 4RSHA 3GWGA 4ZCLA 4F56A 4YV0A 4MIOA 1HEUA 3C97A 1WEHA 4J94A 1EHIA 1NQOA 5DNWA 2A1UA 1C0LA 1OAKA 1YRWA 3AWIA 2UXBB 3WWCA 4E46A 4GC9A 4JS0A 3WVNA 4EDHA 1SHJA 1SBQA 2DFKB 1WULS 2C3MA 3EVAA 3LV8A 4BV8A 5KNBA 1JH9A 3FTFA 5TGTA 2WG2A 3QFHA 1FP6A 2P6NA 5CT9A 1KYIA 3EAGA 3N6VA 4PQFA 3WA7A 2P9GA 2A9KA 2QTWB 2PGAA 2R8EA 4LHXA 1KBQA 4FNMA 1JLHA 2O3QA 4NBKA 4OHBA 4O63O 1AF7A 3H9EO 4P81A 4N03A 1U7PA 4XJVA 3K0HA 4YRMA 1SU7A 3ZBTA 1N8TA 5FL3A 3O1LA 1HQKA 1WMEA 3V1YA 1L5SA 1JUDA 3OOEA 5IK2A 3OCZA 1T4CB 4GWGA 5FD8A 4W7HA 4C87A 3FI0A 2NSDA 2HREA 2VTDA 3H97A 1TVMA 2XQIA 5BOSA 3BMCB 2QGNA 3ETHA 4JCCA 1W59A 5HEKA 2JIMA 3HKCA 2XB8A 3O8OA 5EJMA 3R7DA 3FN4A 2H3HA 1JMKC 1ZUIA 3BA6A 1Y8ZA 1I1OA 2R84A 2LZ0A 2YCLA 4TLBA 3EF0A 1BDBA 3ZIUA 3WAJA 1FYVA 3W5DA 2VWQA 3FPFA 3SBXA 4HAXA 4RENA 3FGPA 4M7WA 4BQEA 1SAYA 1X8JA 2PT9A 1OXXK 5AJXA 4YBZA 4ZT2A 5BQOA 1NI3A 1YE5A 2C9YA 1J33A 1W9MA 3D64A 2IYQA 2JJQA 2W0MA 2ZQZA 2I6TA 4QL3A 3T0FA 1R0RE 3RAJA 5IU6A 1L5HA 3VNSA 5E7IA 3ZZ0A 3DBVO 1P45A 1B0PA 1ZSNA 5G1NA 2O8CB 1XMSA 1HFWA 2QTTA 4N3CA 2PYDA 1JRLA 4UBNA 2AMVA 3HYSA 4NOKA 3R7AA 1EX6A 3R3UA 3U49A 1MOZA 2AG1A 2IJGX 1T2FA 2V96A 2WM2A 3NAZA 4U5XA 3QI7A 4U6SA 3TLEA 1TIPA 1B6SA 4ZGWA 2A57A 3EIEA 1N92A 2RAPA 1GEEA 2W6CX 2QBYB 2X8JA 4QECA 3UT0A 4K8OA 5L4LA 3P32A 2OTCA 3NCTA 3EBOA 2FEWB 2CV2A 3LBIA 1X7GA 2E49A 5FTLA 5JRDS 1QFYA 3B3QA 1MEJA 3AK4A 3U61B 3FPCA 1FW8A 2YWBA 1HUQA 1UADA 1O8BA 1N2JA 5FB3A 3HJUA 4OAQA 1ND6A 2J4FA 4M21A 1D0SA 4KQKA 1MO4A 2DPLA 5TT0A 1EZ1A 2WF8A 3IAM6 3LSYA 2DFLA 2KW5A 5AVJA 3SOPA 4U2FA 4Y0VA 3N3AC 5E38A 1DUIA 1MVLA 1P3JA 1DGQA 1CUWA 4GPBA 4E6PA 1EAMA 1CEXA 1NOKA 1Y80A 3ITKA 5J3JA 4XSVA 4YMUA 3F5DA 4AWAA 2EKBA 3LY5A 1D07A 4ML3A 4MKHA 2ODPA 4IDDA 1QFXA 1TUBB 2IW3A 3BN3A 1XB2A 2HBQA 3O03A 5D7NA 4B7CA 1YVDA 1ZKDA 1USKA 2GRUA 3B3AA 3LTEA 2Q7OE 1B3RA 5I47A 3E6AA 3NKFA 4BB0A 1KPIA 2AG5A 2EKDA 1SKYB 5JMWA 2JLQA 1DV2A 4XVUA 1J97A 2H2IA 4UU0A 3MJHA 2QX8A 4R0MA 4HAWA 3OX4A 1N6RA 2OXCA 4YLGA 5ITWA 4YRGA 1FNCA 2A7QA 2Y9PB 5F52A 3IR7A 1JP7A 4FD2A 1K98A 3I0ZA 4LXUA 3C1OA 1BGWA 2A58A 3PUYA 1L5RA 2C97A 1VMDA 5TS2A 3RD5A 4RU1A 3S5UA 1J00A 1JWLA 3AG5A 3E27A 1QU2A 2FF5A 3N76A 3AIMA 3ZTYA 2WYIA 5DGDA 1FNDA 2RFLA 4R40A 2EJVA 4Q9KA 3GLFA 1NE7A 1UZUA 4F6CA 1V3QE 1L5HB 3GG9A 3NDIA 1E0DA 3FSGD 1GGJA 1EZ4A 1RXYA 1UOQA 4HRYA 1PJCA 2R79A 4MH0R 5FEMA 3GD7A 4Q01A 2WWXA 3PJRA 5EP2A 2G6TA 4GXNA 1JB9A 3U81A 5JNRA 1E1CA 5I6DA 1AZWA 3ENKA 3CLVA 4EIWA 1IDOA 2F3PA 4NCBA 3RS4A 2ZSBA 3GW8A 5KJ6A 5A6SB 4GQBA 5JATA 2A4KA 1P7YA 3DHVA 1Y1TA 1QSGA 3PWSA 5HUHA 4YJ2A 2MHCA 3T7EA 3SR4A 2E4AA 2YOGA 1S8OA 3D3NA 1XVAA 3WK6A 1GP2A 3O8BA 1GQSA 1E1YA 2PBFA 2I66A 2ZM5A 1D8AA 3GIDA 4MW0A 4L1KA 2UUCB 3ACBA 3TK1A 1UXJA 4KDCA 4EQZA 4J1SA 4MUBA 2FP3A 3VKHA 2GVDC 4GDFA 3R2JA 1I10A 4YI5A 3TTXA 3OCXA 1USVA 1K6EA 1RYHA 4YT2A 1RTKA 2QMEA 1T5LA 3UPUA 4RACA 4CQNA 3LX5A 3MBOA 3HN2A 5HGJA 4AMZA 4MYUA 2LBPA 3BBPA 3GXBA 1NULA 5DHSA 3WLQA 2GM9A 4CEJB 2X0KA 4V03A 4FQ8A 3T3PB 3V8BA 1HT3A 1T3HA 2H1CA 4GR9A 5HZKA 1B8VA 1U2EA 4ZK6A 1G20E 3H1AA 4Y0NA 2J3LA 2QVZX 4HDMB 1US8A 3OAAD 4QO8A 3P2KA 3EP5B 3DNMA 3Q85A 4QX6A 1TW2A 1EU1A 1OLSA 3ANNA 3H1FA 4HQKA 4IX9A 4CEIA 2W8ZA 4I1OA 1N5OX 3AR3A 2WFAA 4YJ3B 2CUNA 1H0RA 4AJ1A 2WU8A 3CKMA 4B2LA 1TO6A 2YN2A 1G2OA 2XVAA 3OM9A 5JHHB 2Y9MB 1U6IA 3GGCA 4AMGA 1Z5UA 5B7NA 2PUFA 4M0KA 4QNNA 2IVZA 1LBEA 3EA4A 4ZYZA 1UPTA 4L0MA 1HT2E 2PLNA 3NXSA 4MQUA 1LZLA 2RGWA 2E5LB 3H4TA 3ZEIA 3DS8A 1R9JA 1T9HA 3V4RA 2GARA 3IHKA 5AI9A 2ZETA 2GAIA 4HEA6 2W6MA 3FXAA 4W1QA 2Z57A 2HBZA 3ZCSA 4AWBA 4JNKA 4DM4A 1LDNA 1IMOA 4OIMA 1YZGA 3DEYX 1L7RA 1XTVA 1EVZA 2X2OA 3P2YA 4HDKA 3V8PA 4CTJA 1FLAA 5GGYA 3R3VA 1WUYA 2AXNA 5JY1A 1TUIA 3FMOB 4NV3A 4MZDA 1S01A 2EG5A 5D87A 1CJTC 2CCJA 2JCGA 1WCYA 2ZIZA 3DFMA 4WBXC 1VHLA 4FIZA 2DQKA 3KT6A 5D3MB 2J3HA 3LS2A 3QHAA 4DCPA 1F38A 1N5JA 2P62A 4BIIA 3J81k 3Q7QA 1N32B 4NOMA 3VH3A 4DUGD 2HL6A 3SFZA 4RH1A 5LB4A 3TS1A 5T64A 1E66A 3MA0A 4KFTA 1I2MA 1KMIY 4XQ0A 2DETA 1E62A 2Q5FA 4MI1A 2XVXA 1VBFA 1DAFA 4FSDA 1FTYA 1YRQA 2WYVA 5TJHA 1XQXA 5L3SA 5FF9A 1Z0KA 4WK4B 2P3SA 1C7RA 3AGQA 3BHNA 4F9EA 4W9MC 5D3ZA 1ISIA 3AETB 3R3YA 5IS2A 2ABWA 2ZANA 1KK1A 1ZXBA 1SUPA 3PD0A 4YP9A 2EFGA 2QTNA 3EXHA 3SF0A 3TIGA 4RLHA 4CEJA 3MTEA 1QNFA 1OI2A 2QUZA 2VAVA 2L17A 2ZW9A 4H7JA 1VPLA 2OP1A 1EFPA 3UZUA 4KQ2A 1N57A 3LC2O 4ZA2A 3AINA 4L08A 3UAVA 4HV4A 5IARA 4RAQA 1XN4A 2ILVA 4R0VA 3OUTA 2PUBA 2J6HA 3HGTA 5LOVA 4JB8A 1KVRA 1OAAA 3OJ0A 5DNAA 4QSHA 4W8OA 1XA3A 3TTWA 2EF1A 4WGFA 2LRHA 3SDBA 3BK1A 4LK3A 5U9CA 1FXUA 2GPYA 2F3QA 3KDSE 4WZBE 4FFLA 4ZT4A 3WGGA 7AT1A 5KQLA 4E12A 1UP6A 4S35A 1EK5A 1RE0A 5JNUA 1T5DX 1PDWA 2B36A 2FF7A 1F2VA 2V3CC 2Q27A 2QMYA 2X8WA 1M2OB 3LLSA 2BJHA 3KFVA 4J4TA 5FLEX 1CJSA 4K3UA 2CLIB 2Y0PA 4O4IF 4NZZA 4LGMA 4G97A 2FW0A 2AI3A 4TKZA 2AXPA 1QFZA 2VDKB 1NLMA 1KZ9A 1NNUA 5IJXA 3NTQA 3NGMA 3ZWYA 4MOWA 3WGLA 4EYEA 2DPYA 4Q34A 1LEHA 4LWZA 4LF9B 4DCTA 2OMEA 3TNFA 3TFOA 5CVUA 5ESXA 2EZ8A 3GJSA 4EF4A 3GZ4A 6LDHA 2IBTA 1EK0A 4YUYA 4UXJA 4A1FA 4O89A 4EVRA 1ANKA 1WXXA 2NXNA 1DKLA 1PSZA 2VNAA 1Y1SA 3IA2A 2GJSA 2ZYRA 4C0KA 2GKOA 4P3PA 3NIFB 4LBZA 2AFIA 1Y5MA 3T9EA 3W1WA 2ZE6A 3BTUA 1VHQA 3K1YA 1J56A 4R7ZA 4C4ZA 3FIJA 3GBVA 5ADWA 2XB2A 1U1CA 2ZRKA 2PVPA 5BYAA 4RMIA 4HB2A 4PQYA 3K0BA 1S2LA 4Z9FA 4BBJA 5BN3A 4OSPA 1U1DA 2YNMC 2Z83A 3E84A 4X1YA 5CGZA 3ILSA 3E1KA 4HX5A 3MWGA 3MWKA 5HRCA 1SBZA 3VUEA 5BXQC 3F3SA 4BATA 4RLQA 1QIKA 4L95C 1GFSA 5LNK6 1NJ8A 4JI3B 4C6TB 1ZIOA 4IWXA 1V7QA 1N3LA 2PO5A 1ULSA 2FPGA 3R3JA 3R0QA 4X92A 1DQYA 3GELA 4WECA 1T2UA 2AMFA 5BW4A 4HTFB 2VDNB 4M4SA 1P3Y1 4WZ6A 5FUXA 5T4HA 4D4MA 1BDJA 1VE7A 1NA5A 3TH5A 5IT4A 5H59A 3QSGA 4JI7B 3ANLA 4R1MA 2GN9A 5KUTA 4JOBA 4B8ZA 3CGGA 5EIWA 2WIBA 2XOEA 3E2PA 1L7VC 3LCJA 4L5IA 3W6OA 2VL7A 3UT5B 2VXYA 3CZPA 3QM1A 4S0ZA 4G4IA 3W90A 2Q5EA 3B85A 3AM3A 4J0JA 1M0WA 3FNRA 1JQBA 3GUHA 3QU2A 1T10A 1LBTA 3G89A 3CBQA 3PGVA 4QIHA 5T8KA 4J0QA 2I33A 2ZWPA 5ITVA 3HZOA 3VDMA 4D81A 5F35A 1U0TA 5HJ7A 2GBIA 1VHDA 2O0HA 3DDZX 3FFXA 3PI6A 4HYTA 1Z3IX 5AK6A 4S24A 1J2TA 1M34E 1OXSC 2X0IA 1RAEA 2A7XA 2QRUA 3HR4A 3PC4A 4FFRA 4R7GA 4BNXA 1VI2A 1ENYA 3B60A 3C6YA 4PGHA 1OSNA 3QPWA 4JP3A 2NYAA 5IT0A 7ADHA 1YDWA 2SHKA 4QDKA 4UJ3A 1ZJWA 1RFLA 2AT1A 1HDRA 3EB9A 4OP1A 4QE3A 3DOFA 1I1HA 4DLKA 1H9BA 1XEXB 2AK3A 3GDWA 1ZG3A 2BFOA 1FFBA 3FZYA 4I50B 5I9BA 4MVJH 1K2VN 1PG0A 1RVDA 2HO4A 5T3UA 3N8IA 4BQQA 4WCVA 3NOVA 1HLPA 3HU3A 3A6FA 1QH1A 2UXCB 1T2NA 3ASUA 4RMGA 1PYOA 1SC1A 1DKQA 1U5CA 1V7ZA 4YMWA 3UMFA 3KELA 5K4HA 3D1VA 1T34A 1H5QA 3EXFA 3NAMA 5KSOA 4ZDKA 4PX3A 5AKEA 3LXUX 2E4YA 3KQPA 1Y3IA 2V9CA 3CZQA 3EXEA 1D4FA 1M7BA 1ORIA 1L7NA 5B2EA 1B6TA 1ZX1A 3O3NB 2XY4A 3IL2A 4B84A 1WDWB 2CFIA 3FKSD 1KYXA 5FV4A 4KLNA 3OD1A 3KX2A 1LDGA 2GDJA 2GZ2A 4QEDA 1B0UA 1XAJA 1IN7A 4UHDA 2XQVA 5GINE 4ITUA 3E4CA 5F2NA 1E79D 1RXUA 2YW2A 4QJIA 4Y1RB 5K05A 2VRNA 3AG6A 4XWOA 4MITA 5JAOA 2PX0A 3DTTA 3H2GA 2ZT8A 5K6TA 3R0ZA 3TOSA 1USWA 3IGFA 5JAMA 1JHUA 3MWFA 5F2KA 1YC2A 7MDHA 3SC2B 4XTCS 2XE4A 3FTCA 3UUGA 2DBYA 3LW7A 5GJVC 5LD2B 1H93A 2JFHA 4O4JB 2BZGA 3SVZA 4B73A 4XQ9A 2OM6A 1MHMB 1D8TA 1I0IA 2QPAA 3I76A 4E03A 1L8AA 2H4YA 5SYMA 5EJ2A 1Z08A 2J41A 3QVVA 4YT8A 3KDPA 4MGZR 4P33A 4FT2A 4O4HB 2O50A 1GTG1 1Y8RB 2B2XA 2EBWA 4H59A 4WD3A 4AQYB 1MB3A 1GIAA 3UV6A 1FTGA 4RIGA 2DR3A 4Y6PA 1T9DA 4ZZ0A 2FR0A 2HKIA 2O2GA 4PAMA 5GJBA 4PYOA 4N7BA 3O94A 1TLFA 2HU2A 3EVFA 1U90A 3H83A 4JDUA 2B25A 5ALZA 3RSZA 3W1EA 4D96A 1VPDA 2XRMA 2OB1A 2A9OA 4GWKA 4M1EA 5F5LA 3SIXA 3SZ3A 3LWZA 2Y92A 2WEKA 4FEYA 2XDQB 1XGKA 2KQUA 3EVEA 4GAEA 1V39A 3D4BA 3OZVA 1C3XA 4FXPA 2DFPA 4RXUA 1GNVA 2ZIFA 4WDRA 4EI8A 4CGZA 4NQRA 1W0KD 5HZHA 1J2EA 1LVHA 2JRCA 4JKIA 3H84A 4RJ2A 1X9HA 1Q11A 2A6PA 3QJYA 1KQ3A 4MIYA 4XWAA 4EENA 4RM2A 4DY6A 4DLNA 2I2DA 3FBGA 3FCEA 2AS0A 1DBQA 2D0OB 1AKWA 1N5LA 2QZZA 2OLJA 4WZZA 5CDFA 3OFSA 4EMSA 2RHRA 2XT9A 3F1LA 1B1CA 1GLNA 3LUPA 3CWQA 2AQ8A 1PJ3A 3AIKA 3DT8A 4J7UA 2PN1A 1Z6AA 4PVDA 1HL3A 1K7YA 4Z4EA 5C53B 2CNOA 5F3WB 2P2YA 1QCCA 1UK7A 4MWBA 3G2PA 1HDCA 1NLUA 3CXRA 1G4UR 2QM7A 3W9UA 4A26A 5KHOC 4BX0A 3B51X 3GAZA 4WGGA 2ET6A 3C3YA 4UEKA 4CN9A 2F2TA 4I4TA 2A4MA 3A1SA 1RBMA 2ZCVA 1JSXA 4AZ0B 3T4PA 3MPUA 1LX6A 4IQ0A 3JX9A 1W8DA 1N1MA 1LBSA 2IYNA 4D9HA 4S04A 1RZRA 3E7FA 2ORED 3FVWA 1P3DA 1VCOA 2JJ8A 3WL3A 4Q47A 1GJRA 1U1GA 3BX1A 4PR3A 1GZ7A 5JVDB 4B4KA 4ZVSA 4ABYA 1R16A 3ZS8A 1C0PA 1MXFA 3VA7A 3QBTA 2N42A 1XUOA 1RHQA 3B1ZA 1B00A 1PL6A 2HLHA 1DC4A 1E9CA 1RI1A 3QNMA 4FZJA 4CCSA 2VP2A 3W5AA 4DLBA 5E1BA 2XGSA 1Z5ZA 3W06A 1ISGA 1HY3A 3BEOA 4DQLA 1PVVA 3FTEA 4LY0A 2GPWA 5DBOA 3S8YA 3KKLA 3CYFA 1MT0A 2C2ZA 2Z4TA 1UJCA 4Y9SA 4YNBA 1XFDA 2ZIXB 2D1YA 3UMGA 1G8YA 1OZHA 5LUBA 1N7GA 2ZS9A 2NU8A 2NSLA 2VQ6A 3QG1A 5KNDD 1YUBA 2FUNB 3ESDA 4FOPA 1O87A 4ZCQA 1ATZA 4OHXA 4DV1B 1XK7A 2WWFA 3GB9A 4QYMA 3VO2A 4ATNA 4DV0B 3W4KA 2DLNA 3RBXA 5AQ1A 3RIGA 2J9RA 3RG2A 3AR4A 4EVQA 3LPMA 2NSYA 3EA0A 1Z17A 3IOCA 3K70C 4NIMA 1KYQA 1XRRA 1JILA 3LWNA 1KP3A 3CNLA 2LVBA 2VQSA 2Q0HA 2VUIB 1U0JA 5DXAA 2RC6A 2C4HA 4MCIA 4DUYB 1S5PA 4CCWA 3DWGA 4B71A 2ID7A 2X0RA 3TW8B 1W0JD 3UJAA 3GLKA 1SKUA 2G1PA 4PO9A 4JHLA 3EJWA 5EMMA 5FX2A 3L4SO 3IODA 5EHNA 4X1KA 5MGNA 2I03A 2G1UA 3BB4A 5EWJB 1U8FO 3GUYA 3HJNA 4G5QA 5TMBA 1NC1A 2UZ0A 4ZQCB 1G38A 3R7WB 3R76A 4PLPA 2J4CA 1X7YA 2QA5A 2GA8A 3EHDA 4HYEA 4YCDA 1NAIA 1NM5A 2DUUA 2H0QA 2WD9A 3I9KA 5B6JA 2I4LA 5DTEA 3IKTA 4LMAA 4KACA 4XLLA 3SLKA 2IYTA 5CFLA 4QPJC 1HG1A 2NQ2C 1CP3A 4JA2A 4MVJG 1ZI6A 4F1WA 4YT4A 5HKKA 2HHLA 1KRHA 4KUGA 4FFPA 1FEZA 1K8RA 3QKTA 5A2QA 5CRIA 2HK7A 2RB5A 3M6WA 4PIMA 2JGEA 3HWX1 1H9CA 4JI4B 2C54A 4KQXA 4NMXB 3VRHA 1QX3A 3V8RA 4MNTA 5AVYA 2ZBDA 2NAFA 4RK5A 4UNNA 3E7WA 3TG8A 2WT9A 2BUCA 1ES9A 1L4HA 1VZ3A 4RPCA 1PTKA 4LYDA 3R7BA 4EJSB 2W2LA 2D5IA 3DO6A 4V38A 2JBAB 4KXNA 3T5BA 5J2TA 1ZMTA 5DOVA 1H8ED 3F6CA 4IDNA 5H02A 1L4MA 5H1YA 2F1KA 5JSKA 5HIIA 5FBZA 2NPFA 4OG2A 3ZLVA 5KQSA 3DUFB 2A78A 3I9JA 4WWHA 1DMSA 2BMFA 3LXRA 4FYIA 1NBMA 1CX9B 4R68A 5BYKA 3NASA 2EZ4A 2AOUA 1Y5RA 3F46A 3FZQA 3NC4A 1KMHB 2GS9A 4WERA 5KNCD 4Z53A 3HP7A 2AWOA 3P9IA 4CVNA 1XEWY 2APJA 5FPHA 1SRQA 1FP7A 4LN1A 3QI2A 1A77A 1XLVA 1LQTA 1SHKA 2ZDGA 4E7PA 3RF7A 4BMOB 3ZLJA 3W8FA 4OQ4A 1A71A 3WRWA 4C0JA 4HDNB 5ADHA 3NC1C 3ZV4A 1XRLA 2QTVA 4D4KA 3HEBA 1MOPA 3ERCA 1JHVA 3U7HB 1UKEA 1Z2EA 1DJMA 5IG2A 1AT1A 2BFDB 3DE5X 3NWOA 2FXVA 2W2VA 1ZJ5A 3HJFA 1JQJC 3AI7A 4MTCA 1E92A 2ZU0C 3UN1A 1JJIA 4B81A 4YV2A 1KK3A 2NZVG 1EM8A 1YKSA 4YP5A 1N2BA 3NBZC 4P4SB 1CZHA 2R8BA 2ETVA 2WM3A 3CB2A 1UXOA 1UOEA 1WZIA 3A7DA 3QPAA 3T1NA 2IELA 4FKZA 3IX7A 3ET4A 1TMKA 1X6VA 3H5RA 3D2CA 1EXNA 3CX3A 4X66B 4RPJA 3IULA 4E5SA 4HGZA 3CX7A 1XNHA 1UOOA 4G23A 3NTVA 3S7TA 1CULC 3GDOA 1PK9A 3V1MA 1C1DB 3CKKA 3RHZA 2CHGA 3G2NA 3GGPA 1NOJA 3EGWA 1MAHA 4RORA 4IGKA 1HKUA 1FFSA 4ARCA 1OGIA 3NJ8A 1CF4A 1X8XA 3PGMA 1RHKA 3LNTA 1MQ9A 4MINA 1V41E 2EBHX 3AP1A 2DERA 3QW4B 1AKYA 4TUYF 4LF8B 4X20B 1Z4QA 4W1SA 1QR6A 3X1YA 2XUIA 2JGDB 2ZYVX 3L1KA 3T99A 3WOHA 3IPXA 3R8XA 3ASYA 3MD0A 3OHSX 4DRZA 3HY4A 2OEPA 4FMCB 2WSLA 1M7GA 1DXOA 4L51A 2JJ2D 3VGJA 5EKDA 1SG6A 1T2AA 2G5CA 1PWHA 2XTAA 4HQFA 3T4XA 2HXYA 3LSTA 1L4NA 3TO5A 1XZMA 3VDXA 4TV8A 3PQFA 4JBGA 3IR5A 1QJCA 3LP8A 4G89A 2VPXA 4Z9XA 3AB3A 1P0QA 5G1OA 2Q2OA 1OHHA 1YIDA 2AWNA 2O7SA 3A7EA 3H65A 3O4FA 4PLCA 1ISHA 2O0LA 3IQXA 2FPSA 2WU0A 4ZC1A 3RRJA 4URUR 5BVGB 1KWKA 2J0VA 3G23A 4E94A 3OF2A 4Z9YA 1N75A 3AIOA 1XXLA 3HDTA 1QHNA 1UDWA 1SHZA 3ZC3A 4BGIA 1GA6A 2W4QA 4LXIA 1ZVMA 3H8SA 5AO9A 2A9QA 4GR5A 2H7XA 4KVFA 3O2JA 3JWGA 4AP5A 4C6TA 1IK6A 2A86A 5JQGB 2JDIA 4PICA 4ARAA 1PZNA 1YVRA 1ND5A 4YAIA 3QIVA 1ISFA 2EOAA 4HTFA 1AZTA 3H2HA 4V0OA 1K06A 1NYLA 2OGWA 1JLKA 3NGLA 3FNGA 1K97A 1RAFA 1RZ3A 1T15A 4O59O 1HFJA 2NZWA 3TCXB 3GFRA 2FEPA 4PN7A 5BXYA 1YJ5A 3DXZA 2HWKA 1S9DA 3DVAA 2Z8XA 3OCCA 2QN1A 3F67A 2X23A 1M2KA 4IUBS 4DWOA 1I7MB 3L4KA 1ADFA 3JYQA 4CM9A 2X14A 2YZNA 4JJZA 4RY9A 5A1TA 1CHNA 1GD1O