4DPKA

Structure of malonyl-coenzyme a reductase from crenarchaeota
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
354
structure length
354
Chain Sequence
b'RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPKLMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKGFIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIFRILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAPSKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKGYIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl-CoA/succinyl-CoA reductase
publication title Structural Basis for a Bispecific NADP+ and CoA Binding Site in an Archaeal Malonyl-Coenzyme A Reductase.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Oxidoreductase
total genus 122
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.75: Malonyl CoA reductase (malonate semialdehyde-forming).
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4dpkA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4dpkA01
1P45A 4L73A 3ZWXA 4NHEA 2VQ3A 2FN7A 4QX6A 2Q2WA 2EEZA 1ADGA 5I7EA 3L6OO 4BUCA 4N5NA 3EUWA 4CMGA 4J9VA 3FN4A 3JQGB 2NU7A 1MGOA 3AWDA 4P8RA 3A06A 4L76A 2VTDA 3NUGA 3AUTA 3VDQA 4MP6A 3OBBA 4FQ8A 1BRMA 2WSBA 4KQXA 4N7RA 4QFDA 2V65A 4TVBA 1P74A 2Q45A 3ADPA 3JQAD 3VPFA 4ZU3A 1P3DA 1RJWA 2X8LA 3S55A 4BO7A 2NVUA 3E5MA 2Z1NA 5F5NA 2J3JA 2VHYA 3ZWBA 3Q2KA 2BD0A 4HFNA 3R3JA 4RO0A 2NADA 2Y66A 3MEQA 3OJ0A 5J23A 3HE3A 4W7IA 4CJXA 5F5LA 4BMNA 3UAGA 4MPDA 3UICA 4GX5A 1ISJA 4MVJM 1V0JA 4AJLA 5IDXA 1LLQA 4U8GA 1NX6A 3F9IA 4UULA 3GK3A 3KYBA 5JBIA 4P4GA 3RUEA 1VL6A 2DPHA 4YT2A 4CUZA 1YOVB 3EMKA 3V8BA 2PR2A 3QE3A 1JA9A 2J3KA 1E3JA 2AEFA 4GH5A 3HB4X 4O63O 2OORA 2RAFA 5DBIA 3LLVA 3ST7A 3INTA 2VN8A 4CLOA 1Q2XA 2DUUA 3ZN2A 1Y8RA 5CG1A 3KXDA 3WGZA 1D1TA 1EVZA 1GD1O 4Q9NA 2OBNA 2Y0CA 2E82A 1XYGA 3JQGA 4XYGA 3DOOA 3OIFA 2NTJA 4JIGA 1YVEI 1BXGB 4NJOA 2UVDA 5EN4A 4R3WA 3FCOA 2E6UX 1HE4A 3WYEA 4GI2A 5K9ZA 1L7EA 1SNYA 4HFJA 4DIBA 1HETA 3UUWA 4BKRA 4BNJA 2VOEA 3GAZA 2RHRA 4IDEA 4NPCA 1HDXA 3UN1A 3H3JA 2DT5A 3AY3A 2GGSA 2OMEA 3EK2A 1GTMA 1I8TA 2Y0EA 4YQZA 1PJQA 4DL9A 5ITWA 4AICA 3BHJA 3ZGYA 1VKNA 5K6AA 4RF5A 4WOJA 3R6DA 4UVDA 5JAQA 1W73A 1Q7CA 1ORRA 4AJPA 2X9GA 1EEHA 1KYQA 2Q4EA 3QJ5A 2BMAA 2HJRA 2GN9A 1J6UA 4BO9A 4BOYA 1MXFA 1HDRA 4Y6PA 5COBA 3WGIA 3RC1A 3HADA 7ADHA 1PIWA 4TKLA 2HMTA 2PH5A 2Y1CA 3KYDA 1E77A 3U09A 2YQ4A 1K6JA 4NU5A 1IPFA 3D5TA 3O4RA 2A9FA 2YHIB 3DO5A 2I66A 1SAYA 4JJFA 3C8MA 2IYOA 3WYBA 3E9MA 3MJVA 1A72A 2W90A 3KSUA 3C85A 4LSWA 3TOZA 4KMSA 3WIEA 4ALIA 4BKUA 4DTIA 3AY6A 4YJFB 1XEAA 3BA1A 4DVJA 1D8AA 3WR5A 3AU9A 3AI1A 2BI8A 3KEOA 4C7JA 1GAEO 5CEFA 1KVTA 2DLDA 1MUUA 4D44A 3OA0A 4OH1A 3NTRA 1UDBA 1U9JA 1P1RA 3IIEA 4K26A 3WBBA 4WPGA 4OOEA 1B3BA 3WLFA 1MV8A 1C1XA 4TVOA 2Q49A 4F6LA 4K6FA 2D1YA 1U8XX 1EK6A 3F4BA 1X1TA 4UUMA 4XRRA 2VZ8A 3RJ9A 2QIOA 1T1RA 2JKVA 3B1JA 1BMDA 2EF1A 2X23A 1LDMA 5JXWA 3AOEC 3U4DA 4OSOA 4D45A 4OXKA 4PLCA 5ILOA 1H93A 2O3RA 4KTTE 1PJ4A 2PTGA 5BSEA 5EJ2A 1PZGA 2NTVA 3WXBA 1Z73A 4XQ9A 4BNFA 1LSUA 5CFZA 1AHHA 4F46A 2CD9A 4WNIA 1ZEJA 1LSOA 5F21A 4NBWA 4CV0A 5LDGA 2ET6A 1WDMA 4K9DA 1E7WA 3G0OA 4A0SA 3RWBA 2GN4A 4PLZA 4JBGA 2DTEA 2JFFA 1GADO 1UXHA 1B2LA 3A9WA 3DOJA 5G0WA 2C07A 5AXAA 4TROA 4QUKA 1AE1A 4WNCA 1ZW1A 3AUUA 2CDAA 2YHIA 2VYVA 1ZK2A 1PR3A 2O7SA 2BELA 4MOWA 2NUAA 1PQPA 1V3VA 4XR4A 4RORA 3JQFA 1P9LA 3NKLA 3ZDFA 3TZKA 1PTJA 4YJFA 4E13A 4ALKA 1ZKMA 1JDJA 4JGBA 2AE1A 4F45A 5HWSA 1B16A 3B20A 2EWMA 3JQ8B 4BV8A 1C0LA 2YZ7A 1HDZA 4MVJG 1PGJA 3ZWOA 4R41A 2JL1A 1NPDA 1ML3A 2VCYA 3I9JA 4A10A 3R0IA 1PZEA 4RZIA 5A9RA 4E32A 5I9LA 2AQ8A 3GZ4A 2FSVA 4QQRA 3DTTA 4FR5A 3RBXA 4O0LA 3I9OA 1CETA 4GL4A 3WGTA 4ZN6A 1ZBQA 1PGQA 1MFPA 4I5EA 3AI3A 3GHHA 1UP4A 1UZNA 5MGBA 4ND4A 1JU9A 3HDQA 4IBOA 4IS2A 4PGFA 3WDSA 3GMDA 5KKCA 3LT1A 2RH8A 3H9EO 2YFQA 3ICPA 2WWRA 1LNQA 1EBUA 2PGDA 3JCZA 2XOXA 1HL3A 2DFVA 2NWQA 3H5AA 1GQ2A 4E2WA 2G17A 4BO6A 1EFKA 4U0KA 3WICA 4BO3A 1VM6A 2Q1UA 3U62A 3DHYA 4RQUA 5EQFA 1XKQA 3S1LA 1GZ3A 3CMCO 3EYWA 3UXYA 1H6DA 2GZ1A 3N74A 1W4ZA 4AL4A 3FD8A 3GGPA 4Q3AA 1NHGA 4GWKA 1I32A 3GR6A 4PG5A 1N9GB 5JSFA 1UDAA 3OF2A 5ER6A 2P4QA 3HDYA 1JW9B 1LU9A 5IG2A 2XXJA 2IRWA 3AFNA 4RVUA 3E1KA 3NT4A 1XIVA 2P91A 1J4AA 5JLAA 3JQ8A 3PHGA 4YACA 4DIOA 5JYDA 2ZB7A 4PZEA 4DWVA 3IKVA 3PLNA 3RFXA 4MVJP 3JD3A 4J1NA 4EDFA 5JFOA 3KHUA 3EVTA 4O5OA 1QLJA 4II2A 4OJNA 5H82A 2FPIA 4PG7A 1GY8A 3GNSA 4RVSA 1UAGA 5DOZA 2X58A 2JFGA 3Q3CA 4LRSB 2IDZA 1ONPA 1MG0A 2G76A 5BQFA 2C54A 1SO8A 2X0JA 3GUCA 2P4HX 4J0EA 3D4OA 4DREA 3VH1A 1NAHA 3VOSA 2GCGA 4LCJA 1Z7EA 1GYRA 3B1KA 4XIJA 2GERA 1NR7A 5U4QA 3ZWMA 3SC6A 2HMWA 4FDAA 1Z74A 1WZIA 5COAA 4Q3NA 3IP3A 3AUAA 3SJUA 3HNPA 1YJ8A 2CVZA 1P1FA 1QKIA 1G0OA 1V35A 5M6DA 4KDEA 4BNGA 4G2NA 3KZVA 5T67A 1E1MA 1C3VA 1HDYA 2PD6A 3DBLA 3PXXA 2W4QA 2YDYA 4Y6SA 3R1IA 2ZYDA 3TDKA 4Z9XA 4J91A 1FDVA 1WDLA 3MJEA 3PGJA 1QP8A 3FI9A 3KV3O 5CDGA 1X7HA 1SOWA 2VRBA 4YT4A 5L95A 1E6UA 1N92A 3DZFA 1RM4A 3Q9UA 4LK3A 3BTOA 4ALJA 1K3TA 4E5MA 4AJKA 1DC6A 1T2DA 3UF0A 1TT5B 3AM3A 1H6AA 1TB4A 4J3FA 1N9GA 4YYZA 1I24A 2ZCUA 4ND1A 2V6FA 4OXNA 1YL6A 1NVTA 4XJSA 3GVHA 1DC5A 2OGUA 4BKQA 3NEPX 4TRRA 4IGEA 4AJ4A 3UH1A 5ENVA 4TWRA 1C1DB 2VYND 1BVUA 2GO1A 3DBRB 2JHFA 4DQXA 3C24A 3SLGA 4YJGB 3CPSA 3DONA 3E5RA 1ZSYA 3DL2A 1SB8A 1EVYA 1SC6A 4HV4A 4BO8A 4D0RA 3DAFA 3I9MA 4CMKA 5JAZA 3GVCA 4IJKA 4B4WA 2E48A 5JAIA 4FC6A 1ZIDA 3ENKA 3FTNA 1HXHA 1FDUA 4J2HA 3PZBA 4GMGA 1VLLA 2UYYA 3R3SA 1LSSA 3FNEA 3VH4A 3VKVA 4EI2A 2J5KA 1ISIA 4WLNA 3RC9A 3A1NA 3VC7A 4DA9A 3IKTA 3OSUA 5U1PA 5MDHA 3S2EA 3WFJA 2B4TO 3FBGA 3TFQA 2EIHA 4M87A 2AE2A 3WNQA 2AHRA 3E82A 1OAAA 2NVBA 5GZ1A 4PLYA 3RD5A 1ZK0A 1LDBA 2X9VA 4ND5A 1X7GA 2PFGA 3PHLA 5A1TA 5CG2A 1DIAA 4C4OA 1DHRA 3W4JA 3INGA 2WD7B 1SCUA 1F14A 5DULA 4R69A 3GVXA 1VPDA 1V3TA 3VPGA 3P2YA 3ZHXA 4QXMA 1V6AA 1P1JA 3RUCA 3F1LA 5DT9A 1RM5A 1Q7BA 3ICCA 4JCOA 3GDOA 2X86A 1MFZA 1TT5A 2I67A 5JCJD 1PU2A 2FZWA 3JQ6A 3GVPA 4U6QA 3SEFA 3WGOA 3UKOA 5CEEA 3KUXA 4AJEA 5TIIA 1ZEMA 4JBHA 3K73O 1O89A 1M66A 4L75A 1C1DA 1KBZA 4GWGA 3DBRA 1HSZA 1H94A 2BHLA 1MA0A 3DHEA 4L4XA 5T8KC 4YJGA 1LJ8A 2O50A 4YEDA 3INRA 4RVDA 3SLKA 2WDZA 5I9NA 3ZNNA 2OP1A 4UEKA 4LCEA 4AJIA 4CLEA 1DIRA 4FN4A 3DMYA 8LDHA 5IJZA 1EE2A 3E18A 3GGOA 2EW2A 2XF8A 2W2LD 2HUNA 3RVDA 1RYDA 1XQ6A 1KY4A 4GVXA 3D5QA 3AOEA 2VUTA 2Q2VA 2X0RA 5ER9A 4W9NC 1ENYA 1DFHA 1H2HA 3ITDA 1H5QA 3ABIA 2ZB4A 3A4VA 1E3LA 3H9GA 3QV1A 4E33A 1WMAA 2IZ0A 3BYZA 3L4SO 5KVSA 4QO7A 2J3IA 4EUEA 3TZHA 4OAQA 1T24A 2F00A 2BF7A 4BHTA 4R68A 1I3NA 2H6EA 3V2GA 4M55A 3KSDO 2WD7A 3PP8A 1MC5A 3A14A 4CR6A 4FFMA 4ZVVA 1GZ4A 1O94A 3HDHA 5TJ9A 1X7DA 1WXDA 3GMSA 4QEDA 5FWNA 4GLLA 3GEMA 1ZMTA 5JCXA 4EW6A 4YJHB 1EZ4A 2C29D 2C2XA 4OQYA 1LRJA 4R1UA 5AXDA 3DTYA 3HDJA 2UUOA 2OXIA 5DDIP 3LT0A 1MP0A 2B5WA 3GPIA 3T4EA 4D3DA 2Y99A 3WGQA 2X0IA 4OXYA 3TZ6A 2VOJA 2NQ8A 2GASA 2Q4BA 1I01A 4WLUA 1L7DA 1W8DA 3ANLA 3JD4A 3ZHYA 3UCFA 2B0JA 2GSDA 1O95A 4MP8A 4UREA 5B12A 3VVBA 5JYFA 1UP7A 1E0DA 4M54A 5DBFA 1BG6A 3E6AA 1Y9EA 4PZCA 5KVQA 4ZGWA 1WP4A 3PIIA 2PZMA 5H83A 4YAJA 1R37A 1BWSA 4B7XA 1NQ5A 1SZJG 3M2PA 5EMHA 3GFBA 4ZRMA 1JWBB 1KEUA 5JC8A 1GU7A 1ZMOA 4NK4A 1UR5A 4I5DA 4DC0A 3GA0A 2C2YA 3LU1A 2O4CA 1ZVMA 5GMOA 4BNVA 5KOIA 2CUKA 3H2SA 2I76A 3I52A 8ADHA 3GDFA 5JAMA 5F3RA 3P5SA 4CL3A 4D46A 2WEKA 3K92A 1LX6A 4WASA 4E31A 3GEDA 1DC4A 5HBRA 1YDEA 2D4AA 4IDBA 2FMUA 1H9AA 5EESA 2CSUA 3JQFC 3MJTA 3OETA 4JXKA 4GVLA 2OL4A 5A04A 4LW8A 2R00C 5DCWA 2LDBA 2VWPA 4UUOA 4UVIA 1YE3A 4YAGA 1XR3A 1KEWA 4YJHA 1E3WB 3UOGA 5CDUA 1ZJZA 4P4LA 3E48A 3UHAA 3CXRA 3HQ4O 1SOVA 4BQRA 4ALLA 4XYBA 1NVGA 2C5AA 3QIVA 5ADHA 1GUYA 4ND3A 2EGHA 4GKVA 2VUSA 2UV8A 5G0SA 4IDDA 2XAAA 4Y8VA 4RGBA 4ITUA 4N5MA 5EQDA 2VRCA 5IZCC 1XA0A 3WB9A 3RQSA 5I8ZA 1HDOA 1B0AA 1M2WA 4BNZA 1LQUA 1QYWA 5DF1A 1OFGA 4D3FA 1I10A 1QYXA 2AMFA 3NJ8A 1H2BA 2F1KA 4CQMD 1UAYA 2Y68A 1ARZA 4Q3BA 4YT5A 5KJ6A 4EITA 2UDPA 1OC4A 3EHEA 3ZNOA 1I0ZA 4IDGA 1NFRA 5THQA 2YJZA 2AG5A 1UH5A 4J2OA 1DXYA 4MKXA 2C5EA 1E1KA 3LDHA 3WSWA 1XU7A 4XDYA 4ZICA 4HNHA 1I3LA 2EP7A 1ONOA 1PJTA 2HRBA 4PG8A 1PS8A 3IJPA 2EJVA 2D8AA 2GUGA 4FOOA 3CEAA 4IS3A 2FPGA 2DU8A 1W6UA 2G0TA 3M6IA 3PVZA 5IF3A 4GBJA 3L4BC 4MIYA 3KM0A 1X13A 1TEHA 3W4IA 1E7QA 1Y1PA 3JD0A 4Q39A 3W1VA 4WLFA 1P0CA 5JY1A 3OJOA 3I3OA 5L7WA 5TSDA 2I3AA 1CEQA 1E3WA 3F47A 3PRJA 4B4OA 1ADBA 3DR3A 2PNFA 2WJPA 1P44A 3F5SA 4BMSA 3HHPA 1DFIA 2PZLA 2WE8A 5JYAA 3QA9A 2AA3A 3O26A 4U0JA 3LC1O 3C7CB 1O6ZA 4CM1A 2JFHA 1IZ9A 1IHXA 4A73A 3AU8A 4B4UA 1B26A 1NFQA 1FDSA 4PLWA 4RCVA 5IAAA 3RUAA 3ADOA 4I8XA 5C7LO 4QTZA 3JQ7B 4JLWA 5DP1A 5ILGA 3GFGA 2VTEA 4DPMA 5L7TA 3L6EA 5KWEA 3LC7O 3IMFA 4IJUA 1RPNA 3ZWNA 1YGYA 1FXSA 3ETDA 3I6IA 2JCXA 3FNGA 4OM8A 2ZTUA 3SBOA 1I3KA 3NAQA 5A9SB 3DBVO 4WUVA 2BH9A 3CUKA 3E9QA 2X0NA 3WQQA 2EKPA 4WE3A 4E5PA 4RL6A 4BGUA 1IB6A 4YWJA 4XQEA 1EQUA 3ONFA 4PG4A 1YO6A 2VHWA 4A26A 2ZKLA 4E3ZA 2QG4A 4PCVA 1HKUA 3PGXA 4XGKA 2E4AA 3BMCB 1DAOA 2YV2A 4ALMA 2EGGA 3QWBA 3QVTA 3EC7A 2WYUA 4XKJA 2YV3A 2V6MA 3RUFA 4BV9A 5B4VA 3BXXA 3WWYA 3QVOA 3IC5A 1P1IA 5A5FA 4HXYA 1YXMA 4BIIA 1ZNQO 1DHTA 1O0SA 1QYDA 4D3SA 3WBFA 2PD4A 1E1LA 4ILKA 3T4XA 3WWZA 2IXBA 2O48X 2C7VA 2Z1MA 3HUDA 5DCUA 4R54A 4OSPA 1R0KA 4F3YA 1DLIA 3QWFA 2YHUA 4QECA 3RFVA 1AGNA 5A4DA 4QT0A 4E5KA 4PIVA 2H1SA 5T8KA 3GT0A 4BO1A 2PD3A 4II3A 3OIGA 5T73A 5CDYA 1A27A 3JQ7A 1N1EA 5AOVA 1LSJA 4AFNA 2OOSA 5DZSA 3KYCB 3VPSA 1XU9A 3SC4A 1GEGA 1BXKA 3MWEB 1E92A 3JSAA 3AUSA 2VHVA 4MDHA 4RPKA 1LRLA 2P5UA 3JYLA 3ZV5A 4W6ZA 4OKNA 2Q46A 3ETEA 3RBZA 1YOVA 2OBYA 2WD8A 4W9NA 4NFHA 4YBZA 1K6IA 4JP2A 2X6TA 2QYTA 5C7IO 3H6KA 1CWUA 4FOSA 4XQCA 2Y1EA 2ZATA 1UDCA 3ZV3A 2PKRA 4PVCA 3IUPA 2EW8A 3QY9A 2OZPA 3BMCA 4XGNA 3NRCA 3G1UA 1AUPA 3QVWA 1U5AA 5A3VA 4GKBA 5BNIA 3H4VA 2Q2QA 1R4MB 4BNIA 1K89A 4L74A 4URFA 3GG9A 4JBIA 4R1TA 1BXGA 4I9HA 3WJAA 4YB8A 1D1SA 1PS0A 3DXFA 4KP7A 1KS9A 2ZQYA 3UFXA 3LT4A 4MVJE 5L4NA 1IL0A 1ULUA 1JWAB 1HYEA 4UEOA 3PQDA 3ANNA 2TMDA 1QV7A 1E1NA 4YRBA 4EJ0A 5L7YA 4XD2A 5A03A 2FPPA 2X5JO 2CVOA 3MJ4A 1B8UA 5A3JA 3AFMA 1WW8A 3ORFA 3Q9NA 4K28A 4I1IA 1E6WA 4YR9A 4ALNA 3KB6A 3JQDA 1GL3A 3L07A 3KYCA 4L0QA 4YRAA 1YQXA 1ENOA 1H6CA 1H0KA 2OP0A 1ISHA 3ZWWA 4CM7A 4DYVA 1FJHA 4IIUA 3DEYX 1R66A 2HJSA 3DFUA 4FBGA 1Y8QB 4NQZA 3M1LA 4IIVA 2NV6A 4CMAA 4DGSA 5BR7A 3MOGA 5FYDA 3TJRA 4ZQHA 1BGVA 3ZU5A 2QYSA 3Q2IA 5K0ZA 3IAHA 4CM3A 3PTZA 4DQUA 1M76A 1UXGA 1R0SA 4U5QA 1Y9AA 2GN8A 3KLPX 3L77A 2HK8A 1EMDA 3OP4A 1OMOA 2AEMA 3EY4A 1GV1A 3ZZNA 1R4MA 2Y05A 3DZKA 3QVSA 3VH2A 3WLEA 5A5EA 2R00A 1GZ6A 4N5LA 3PWKA 2PLAA 2NQTA 1U28A 3HB5X 3PIDA 4P4NA 1T4BA 3PJEA 2VWQA 1LA2A 4XB1A 2X4GA 2C20A 3BMQB 3I1JA 4JP3A 2NU8A 5ITVA 3EZLA 2QZ9A 2ZIZA 1IZ0A 3NDIA 2VYVD 4L8VA 3MWDB 3D4NA 1KEPA 3JYNA 3IQDB 1N8KA 5FF9A 3C1AA 4CMBA 1P1KA 3OEYA 4GX1A 2RHCA 1AN9A 2HRZA 1Z7BA 4J7CA 1HE5A 2PV7A 4BNHA 3DZBA 2QX7A 1WMBA 4DUPA 4YXFA 4UEJA 5DP2A 1Y7TA 1E5QA 4IXTA 3NGXA 3AY7A 5IZCA 2W8ZA 4IQGA 3TL2A 2AQHA 3H8VA 3V5NA 5IN5A 1EDZA 2J6IA 4CM8B 5I8WA 1D7OA 4W99A 5JDIC 3PPIA 1KEVA 3IL2A 4NR0A 2QZZA 3S2FA 3ITKA 5KTKA 4NBUA 4OGWA 4IJVA 3RFTA 2Y1GA 1QLHA 1HYGA 2Q99A 5AVOA 3QSGA 3ZV6A 2AW5A 4MVJH 4J7XA 3AOGA 2X5KO 2V6GA 2IEBA 2DBRA 5G4KB 3VKUA 4B3JA 2B4QA 1JAYA 1Z82A 3TFOA 3HN7A 3JD1A 2J5RA 4IM7A 1LUAA 3L0DA 4Z6KA 3OEWA 1U3WA 1RM3A 4TZTA 4CM5A 2B5VA 2OO5A 1HDGO 1XG5A 3L4BA 5JYEA 2I65A 3OMLA 1YKFA 2JJYA 5JDCC 1IULA 4YVFA 4D79A 1XWFA 3BMQA 4KWHA 3AW9A 3ROPA 3WG9A 2ZQZA 1R16A 4IGFA 4IINA 4FGWA 1ISMA 3F4LA 5CPFA 3TRIA 2EHDA 1U3TA 2B36A 3NGLA 4GLOA 3U4CA 3GNTA 5TJHA 4B3HA 2CFCA 4OMUA 1I2BA 3V1YA 2YV1A 3WGHA 4DIFA 2EJWA 1EK5A 3CH6A 1YB1A 5DOVA 4PFJA 3LF1A 4INAA 5BNTA 5C3MA 4WLVA 5B37A 3ZHBA 4CM8A 3PI7A 1P77A 1OBFO 4E30A 3OECA 2O3JA 4M1QA 1CQIA 3GZNB 1KC3A 4O1MA 1I2ZA 4CLRB 4PLGA 3DMTC 5H81A 3QW2A 3RJ5A 4ZJUA 4OL9A 2IODA 4FJ2A 4OIMA 5JY6A 5ENDA 1DIHA 2VNSA 1QMGA 3RUIA 4HX5A 1VRWA 5A9TA 4BO0A 1LQTA 4KDFA 3QVXA 1D4FA 1GUFA 3RC2A 3L9WA 1FDTA 4P22A 3NTOA 5DBGA 1DC3A 2GDZA 1T26A 4R51A 1PL7A 3GN1A 1RYEA 1WDKA 3IP1A 4XIYA 3E8XA 2D2IA 4WEQA 1VSUA 1P33A 2E37A 4J9UE 5T6BA 1KETA 3DAPA 1O8CA 1WNTA 4MKZA 2EV9A 4YQYA 4OOFA 4CM4B 3O38A 1KVSA 4GSLA 4XGIA 2D5AA 1YWGO 4H3VA 4GAEA 1UXJA 1ZJYA 2FR8A 5GZ6A 3EDMA 4EUFA 4RDHA 1RM0A 1YBVA 2A92A 3PHJA 3X2FA 3CKYA 2DVMA 4EBFA 3N7UA 5KCZA 1N5DA 4IMRA 1EDOA 4MVJA 4S1VA 4BVAA 4GSKA 5BSHA 4E2XA 4BNYA 4Y6RA 4Q3CA 1GCOA 3UW3A 3ANMA 1PR9A 5HM8A 5DCYA 4DPKA 3D3WB 4AJ1A 1U7TA 2Y0DA 4BNXA 1QXSA 4GX2A 3RKRA 4HP8A 1LC3A 1PGOA 5KVVA 1SMKA 3G49A 4MO2A 4RPLA 2WM3A 5A06A 4FSHA 2JD2A 3NDRA 4R4JA 1GFSA 3AM5A 3GZNA 1QV6A 4YAIA 3PYLA 4PLHA 4CM9A 4FS3A 1IE3A 2CNBA 1PWXA 4CLRA 1QRRA 4BQPA 2FP4A 4KQWA 2HKIA 3QWHA 4TKMA 4CV2A 1QORA 3ZWVA 4DPLA 1ZFNA 1NASA 4AJNA 4A03A 2X5OA 2GLXA 4N18A 5KIAA 4D42A 2CY0A 2GN6A 4FFOA 3S2IA 4CQLB 2GZ3A 3ZCXA 1XQ1A 4TRNA 3LYLA 4B8ZA 5LC1A 2HAEA 3X2EA 5BSGA 1K2WA 2UAGA 4FFNA 4CMJA 1LEHA 4OO3A 4JK3A 1UUFA 1WVGA 1NYTA 5C5IA 4QO8A 1E6EA 2NM0A 4KZPA 3UGKA 1BTOA 3GAFA 3P2OA 3VAZA 2BKAA 1A7KA 2B37A 1IYZA 3QWAA 1B3RA 5HA5A 2HQ1A 1GEEA 5JC1A 3FR8A 2RIRA 3H9JA 4B8WA 2JD1A 5G2OA 3GEGA 3TSCA 1FK8A 2HK9A 3JYOA 1F0YA 4TMFA 4BNMA 2BFPA 2BGLA 4NBVA 4R1NA 1L1FA 2GZ2A 4LRTB 3OJLA 1JQBA 2O3SA 4IXWA 3V2HA 3L9XA 3D3WA 3NJ4A 4ESOA 3U4HA 1XELA 1YL5A 1JLLA 4FPXA 1EUDA 1BW9B 1HE3A 3ZWAA 3K31A 2O2SA 1XLTA 3HZZA 2YFHA 4YJDA 1HWYA 3JTMA 2PWZA 2DBZA 5J9GA 4B3IA 3Q0EA 1PWZA 2V6BA 4CLXA 6LDHA 2J3HA 4IZHA 3EAGA 2VT2A 2EXXA 4KUGA 1E7SA 3WYCA 3RCBA 3GF4A 1VSVA 2R2GA 3DZJA 4FFPA 4ZQGA 1E3SA 4R3NA 3WX0A 4RVFA 3H9UA 4EYEA 1TA4A 2FSSA 5ICMA 5IZ4A 1VL0A 3FF4A 1KC1A 3GQVA 1TXGA 5TT0A 5ICSA 4NFSA 1U3UA 2HMVA 1PJSA 5BNFA 1GR0A 4CQLA 2DBQA 4E12A 2WYVA 3TF5A 1GQQA 3JYQA 4FJ0A 2HO5A 1CIVA 1NTOA 4M8SA 1VI2A 3F46A 5CAEA 2PKQP 2Q50A 1BDMA 3W6UA 3I6QA 4R1SA 4YRDA 2B35A 4HFMA 5CDSA 3AK4A 3QQPA 3NT5A 1ZXLA 4YA6A 1E7YA 4M89A 4GX0A 4FGSA 3WS7A 1QR6A 3RBVA 3IDSA 1E7MA 3VPHA 3RUDA 5COQA 4J0FA 4YTEA 3VH3A 3OJEA 3COSA 3FR7A 3U0BA 4R5MA 1YJQA 3I83A 1YS4A 3H7AA 1NXQA 3ZWPA 2POQX 1YONA 5KJFA 1NR1A 4WECA 4XX0A 2D3TA 1BW9A 1EUZA 4EJMA 1FF9A 2P5YA 3GLQA 4RZHA 4NG5A 4MJLA 4WOKA 4IJWA 5JDIA 1PGPA 1PJ2A 4DYDA 4B7UA 4BNWA 3BMOB 1D3AA 1X0XA 4XDZA 1E3EA 5JO9A 4M86A 4OKIA 1DEHA 2W2KB 2DTDA 1XGKA 3Q6IA 4J4BA 5L51A 2FHSA 4DXHA 2I3GA 1VL8A 3JQ9C 3FRJA 3DQPA 1LC0A 1JTVA 2R6JA 1X15A 3C7AA 4UUPA 1DAPA 1YB5A 2A35A 4WKGA 3AM4A 5GY7A 4A27A 4PRLA 1VC2A 1GYPA 3HN2A 3OFSA 4GMFA 2G5CA 3JQAB 1I36A 4E2ZA 3ETGA 1WWKA 3C1OA 1PQWA 4P38A 1DDOA 4NDNE 1X1EA 1PGNA 5JDCA 2DPGA 1NBOA 3M2TA 3GVIA 1M6WA 3K2BA 5CHEA 2PZKA 2QQ5A 4L4RA 3DBHB 3PWSA 3TL3A 5L4LA 3PYMA 1DRVA 1WPQA 4L4SA 4ZD6A 3VVCA 3D3EA 3PFFA 4CMHA 4BO4A 3OQ1A 2OUIA 3WNVA 2EKQA 3TZCA 1HLPA 4BNLA 3RI3A 3SVTA 3OQ6A 1T2CA 4W4TA 2VWGA 2BGKA 3IOYA 1DIGA 4MVJF 2HCTA 3U4IA 2NVUB 3O9ZA 2AXQA 4RV9A 3BHIA 4RDIA 4CPDA 2A94A 3G79A 1EE9A 2GD1O 4XJTA 3KRTA 4WLOA 1IHYA 3WTCA 1F06A 3TQHA 3TZQA 5TT1A 4KUEA 1GYQA 4LVUA 1U4SA 5DNAA 1Q7GA 3S2GA 2VRCD 5EINA 1TLTA 2DC1A 3GPDG 1YB4A 5B4TA 3HFSA 1HSOA 3PHHA 1C0PA 2CDCA 1U7HA 3VDRA 1LDYA 3DMTA 5TLSA 5FFFA 2W2KA 3H65A 4FFLA 3K6JA 1Y6JA 1MB4A 1HEUA 1IOLA 1ISFA 4B7CA 1GPJA 4YCAA 4NK5A 3RIHA 3NT2A 4GQAA 3KLMX 1CRWG 4BO2A 4BGIA 1P1HA 2ZCVA 1I33A 4CMEC 5DN9A 3NTQA 4HADA 1YQGA 2G1UA 3WQRA 1Y8RB 3JQAA 3C3XA 1HZZA 1P31A 4AG3A 2C82A 2Z5LA 3W8EA 4E5YA 5BSFA 1H9BA 2X9NA 3JQBC 3I4FA 5ES3A 4DC1A 3DBHA 1AHIA 1LLDA 3ROMA 1YH3A 3U3XA 3S8MA 5EIOA 1JN0A 1C14A 5KNLA 4CODB 4Y9DA 3K30A 3LSYA 4B79A 5JO0A 5G4LA 5L9AA 2V7PA 3QWIA 4NU6A 3BMNB 3PDJA 3U5TA 4Z0HO 1ENZA 1ZH8A 4ND2A 3CZMA 4XB2A 1B8VA 4W82A 5TF4A 2RH4A 3V1TC 1T1SA 2H63A 1HF3A 4D0SA 5KKAA 1CJCA 5AYVA 3GRKA 4X54A 3PQEA 2PGJA 4J90A 1Q0LA 1JVBA 3D0OA 1PL8A 3ZHZA 4CLDA 1NNUA 1FDWA 2VHZA 3U9LA 4WEOA 3QHAA 4M49A 3PK0A 1IPEA 1HTBA 1S7CA 1A7AA 1KVUA 1KVQA 1H6BA 1R12A 1DJNA 4FCCA 5HRUA 4XYLA 5T57A 3TOXA 2I9PA 1HZJA 3I4CA 5TNXA 2B4RO 1HLDA 4EUHA 4YAKA 3D7LA 1A4IA 1PL6A 2HMUA 1PEDA 3FPLA 4U7WA 5TRTA 1UXIA 1YBMA 2YDXA 3LT2A 1GQYA 3VTZA 3KYDB 1J49A 1FMCA 1DRWA 1ID1A 1KOLA 1F12A 2UUPA 2IZ1A 3V1UA 3FHLA 3ZWCA 2ILTA 1ISGA 2DTXA 1G1AA 3KEQA 5I7FA 2Y93A 5THKA 3VPXA 3VHRA 4PVDA 1CERA 2YW9A 2Q1SA 2Q1WA 3JD2A 2WE7A 1A5ZA 3AI2A 1PX0A 3F3SA 3JQCA 1GCUA 4J16A 9LDTA 3K96A 4FIZA 1Q0HA 2JD0A 1B15A 3PEFA 4J1SA 3EGOA 3GN2A 2PH3A 1F17A 4RQTA 3WGGA 3WJ7A 3KETA 3F1KA 5HS4A 3L6DA 5I7SA 5EERA 3IJRA 4RVHA 3BMNA 1GPDG 4PLTA 2EKLA 4XZ3A 3RROA 4NJMB 1Q1NA 3FSRA 4FJ1A 1C1XB 5BT9A 5A9SA 1O5IA 4QFCA 3RUHA 2PK3A 1T25A 2Y1DA 3ROQA 1EQ2A 4WCDA 1ZSNA 1CDOA 2ZTLA 1LDGA 4DLLA 2ZJ0A 3GUYA 5F1OA 4BNTA 5JE8A 2DAPA 1KVRA 3MTGA 2NLOA 1WLYA 1UXKA 5FI3A 5L3ZA 1GUZA 3I9LA 4EZBA 1I30A 1MC4A 5C7OO 1ZCJA 1VE9A 2D59A 4H15A 3FWNA 3O8QB 3PJDA 3D4PA 5TX7A 4J1QA 4BNKA 4CR8A 3ZNPA 3A28A 3ZW9A 2YUTA 3RU9A 4JROA 3KBOA 1PJBA 4DLBA 3ENNA 7MDHA 1CF2O 1PJ3A 3HJAA 1SPXA 3GG2A 2HK7A 4TSKA 4RVGA 3WMWA 3ZU3A 1V3UA 1Y5RA 4QSMA 3Q11A 5I9MA 2RBEA 2GF2A 3HWRA 3MJCA 3T7EA 2VZ0A 3CMMA 4MIOA 5FEUA 2QHXA 4IUYA 2P9GA 4I08A 4JN6B 4E21A 5F1KA 4DRYA 2X22A 1QYCA 5IDYA 5JNLA 1NP3A 1KERA 2HMSA 3DFZA 5JMPA 2ZYGA 1SEPA 1K5HA 2DFDA 3VZQA 4IQ0A 5B4UA 1DBVO 2OFPA 4XYEA 1DJQA 3DC2A 1SEVA 5C37A 3ON5A 4JNKA 3VZRA 3D64A 4IDFA 3LVFO 4WJZA 5G0UA 1X0VA 4E4YA 3PFWO 4NJMA 5IDQA 4ZQBA 2DKNA 1LLUA 1N1GA 2O3UA 4JQCA 3VTFA 3PLRA 3UCEA 4EJ6A 5T5QA 3HFGA 3RKUA 4WCFC 1NHWA 3HG7A 5FI5A 1JVSA 2NNLD 5A02A 3P7MA 3LC2O 1LBEA 3F6YA 4HKTA 3OICA 3W6ZA 4ZHSA 3CZRA 1HE2A 2X7HA 1MLDA 4MP3A 1R6DA 3VZSA 2QW8A 3WMXA 3ZU4A 2J5QA 1HRDA 1S6YA 1YQDA 2PA3A 2AQIA 1BVRA 3CINA 4WK6A 1DLJA 2H5LA 3QRWA 4J4HA 1R0LA 4KUHA 3O8QA 1PQUA 1AXGA 3JQ9A 3RAJA 4MINA 4RF4A 1LI4A 1BXZA 3E03A 4KOAA 1WAMA 4G5HA 2DBVO 4FD3A 2NVWA 2SCUA 3JV7A 1CQJA 1XDWA 3B1FA 4OYRA 4BNNA 1DO8A 5CDTA 3ULKA 4IDCA 4HWKA 4A7PA 2GNAA 4TRJA 3M1AA 4HUJA 4Z0TA 4LMRA 3TNLA 2JAHA 4J43A 3T7CA 4DBVO 5GZ3A 2PZJA 1OZAA 1Q0QA 3I9NA 1DRUA 2PGLA 3G3EA 1ULSA 2O3TA 1T4DA 2QRJA 5KJEA 3WIDA 1A9YA 3CE6A 4ID9A 1A71A 3PHIA 4Z9YA 3LF2A 4NI5A 3ASVA 4J7UA 3SX2A 2VWHA 2FOIA 1Y8QA 1IY8A 1AXEA 4FC7A 4Y67A 1LRKA 3SJ7A 4BB6A 3GC6A 2Q22A 2WYWA 2EERA 2NTNA 1R4NB 1UZLA 4LSMA 2DUWA 3P19A 4IDAA 1IUKA 3TN7A 5LDHA 2C0CA 2GPTA 1ZSVA 1DB3A 1EUCA 2AQKA 4PLVA 3ZNQA 1NVMB 3E9NA 4EEXA 2CZCA 1PZFA 3K8ZA 4AJHA 3SXPA 2B83A 4AJ2A 1YDWA 3ZI0A 3DBLB 4S3MA 4I9NA 2VZ9A 4KWIA 4Z3KA 3Q1LA 4LISA 2BLLA 3W8DA 2NU6A 2W98A 5AXBA 3KO8A 4CMEA 3WQSB 1TT7A 3JQEA 2Z95A 4K6CA 4N54A 3K9QO 2EG9A 4YDRA 3N58A 2HSDA 3JQBA 4TQGA 3BHMA 1UJMA 3QP9A 4KTVE 4D43A 1BDBA 2WMDA 1JKFA 3FNHA 4UVEA 3ZV4A 3ZU2A 1W0CA 4FFRA 4E0BA 5TQVA 2ZTMA 1N7HA 5HTOA 2DQ4A 1VKOA 3ROKA 3RC7A 4TRMA 1J0XO 3RU7A 2CF5A 4CV3A 1DOHA 1NQTA 1UP6A 5AXCA 1VJTA 4WLEA 4I5FA 2CF6A 2WTBA 1B14A 2YYYA 3CSDA 2JAPA 3GOHA 3GRPA 3B6ZA 1T2FA 4R9SA 5T64A 2IEDA 1J5PA 2IE0A 4GGOA 4NNJA 4XRGA 1QG6A 4G65A 4NH4A 1R4NA 3H5RA 1JAXA 4MKRA 2DM6A 4CL8A 4XR9A 1YBAA 4UVGA 2ZB3A 5G4KA 3KVOA 4RPJA 2TMGA 2XPCA 5CP8A 1Y5MA 3WSVA 4IZIA 1N2SA 4BKPA 3STHA 3OJFA 4R5HA 4U6SA 2FR1A 4XCVA 2FWMX 1Z6ZA 3OA2A 2C7GA 1U5CA 4ZQFA 3FNFA 3TPCA 4NBTA 5HS6A 1MG5A 1Z75A 3LQFA 3RSHA 2VYNA 3WGYA 3MCVA 2P9CA 2J8ZA 3WOHA 3KSZO 5IFLA 2IXAA 3EZYA 1XCBA 1ONNA 4HBGA 1LTHR 2G82A 1NQOA 1UZMA 2NU9A 5KJCA 3MZ0A 1V8BA 4MVJI 3I9KA 1C0IA 2IZZA 4PLFA 1M6HA 4UVHA 4R9RA 1I2CA 4CUKA 1ADFA 2Q1TA 2JHGA 5JPIA 1VJ1A 4I9UA 4XA8A 4FB5A 2FY8A 3W8FA 3B70A 4G81A 2JCVA 3O03A 3ZW8A 3GHYA 4R01A 2H9IA 9LDBA 3ASUA 5JW6A 4IPTA 4UAGA 2ZK7A 3BTUA 5IN4A 4HFRA 5A05A 4RPHA 4BMVA 2X1HA 1ZK1A 1PJLA 4ONEA 4FW8A 5JS6A 4CUJA 4MVJD 3BTSA 3JYPA 3BZUA 1A9ZA 4ZQEA 2PKQO 5U9CA 4BGVA 4L9RA 2GR9A 3DAGA 1O9BA 4WCFB 4Y98A 3BAZA 4XYMA 2P2SA 3D1LA 5TS3A 5IXYA 1E3IA 2LDXA 2O3QA 2ZYAA 4EGFA 4LMPA 1PJCA 1PS9A 3DOCA 1ZZEA 4A5OA 2JCYA 4XWYA 5TGDA 3PJGA 4PZDA 3EVNA 4CR7A 5JCJA 4C7KA 1GDHA 2A4KA 3DWFA 4AVYA 4O59O 4E2YA 1GV0A 2I99A 4CM9D 3IS3A 1U1IA 4YPOA 1K0UA 1LDEA 2OHXA 3G17A 4CM4A 5IDWA 2HU2A 3H5NA 4OQZA 4RLSA 4IQ8A 4JJGA 4BNUA 3GNQA 3FTPA 3IUSA 4I5GA 4W7HA 3G1TA 1VJ0A 1M67A 2QRLA 3DHNA 1RKXA 3RASA 1V9LA 1A4UA 1MX3A 2O23A 3W4KA 6ADHA 5F1PA 5L40A 2W2LA 4UUNA 1I5RA 4BL5A 1EVJA 1KIFA 5TC4A 1G6KA 1DSSG 2C59A 5LCXA 1XHLA 1CYDA 3H9QA 3ZWYA 4BO5A 3OHSX 2VHXA 2BGMA 5G0TA 1TI7A 4JX8A 4B4VA 3C1TA 4WGGA 5G0VA 1PZHA 1F8GA 3I5MA 1NWHA 2O4UX 4BS9A 4DMMA 4RJTA 3OIDA 5K6AC 3BTVA 2BFMA 4ZRNA 1QYVA 4EEZA 3PDUA 1NPTO 1NQAO 4WCFA 2NACA 1ADCA 3AJRA 1HDCA 1P0FA 2QRKA 4J6FA 4CMCA 3PZRA 2O7QA 4Q3EA 3CTMA 3GGGA 5EPOA 3KTDA 3K5PA 4NIMA 1KY5A 2BI7A 3DZIA 4IY1A 3VZPA 3LLSA 2YQ5A 4BGEA 3DB2A 5CEJA 1NAIA 2EP5A 1U3VA 5I7VA 3EW7A 5KJ1A 1QSGA 3BIOA 4NZ9A 4CV1A 1F8FA 2XXBA 2FR0A 1PSDA 1G0NA 3GY0A 3H3FA 2D5CA 4IMPA 3NV9A 2BRUA 2RCYA 2Y1FA 3H2ZA 4D41A 4ZA2A 4J1TA 2GYYA 3CIFA 4J49A 1OOEA 3ZH2A 4CM6A 4Q3DA 1WZEA 4CLHA 3PJFA 1HYHA 4PN3A 4AJOA 3GDGA 4DMLA 4RF2A 1OI7A 4PG6A 4CQMB 3OM9A 3PWZA 4BKOA 4ROSA 3ONEA 3HSKA 1YL7A 1T2AA 3DDNA 4YAEA 3FWZA 4TZKA 2CDBA 2GRAA 4A2CA 2I6TA 1BHSA 4J4TA 1EBFA 1DPGA 4E5NA 3C7DB 2AEJA 2ZJ1A 4DBZA 2PY6A 5JMWA 2Y1OA 4E6PA 2O2YA 2BFAA 5L45A 1ZK3A 5EL0A 4YT8A 4Z3DA 4HY3A 5IXSA 1NPYA 1Y81A 1JKJA 1X14A 4H7PA 4R16A 3MTJA 3U49A 2VUUA 3WFIA 2I5PO 2AG8A 3ONDA 1T2EA 2E49A 1B7GO 2HDHA 1ZK4A 4RLHA 4D7AA 2BFOA 4O6VA 4JJIA 1ENPA 4Z9FA 1ZXBA 3K2EA 3NYWA 3MOIA 4XEHA 1OC2A 2CMDA 4BB5A 4CMIB 2Q3EA 3V2UA 3TWOA 4PLPA 3NX4A 2IYPA 3UVEA 4MIEA 3PQFA 2P68A 2FZEA 3MJSA 5L4SA 1DFGA 2CVQA 3PYXA 1SBYA 4AJJA 2B69A 2Y67A 1U4OA 2NSDA 1NWCA 3QLJA 1E5LA 4LGVA 4LVCA 2FRDA 1EVIA 1E7RA 1M75A 3GH3A 1C0KA 1Z45A 3LZ6A 4OHUA 5L53A 4GGPA 1LLCA 2ZTVA 3NDJA 1R15A 1NM5A 3DZGA 2D0IA 3DZHA 2VT3A 1RWBA 1U2DA 3KOUA 4DLAA 4NFYA 4NBRA 1XSEA 4CQMA 1SB9A 1MXHA 4XQGA 5B1YA 2VNAA 4NMHA 4F6CA 3OQBA 4K1LA 1NFFA 3FBTA 1LDNA 1LXCA 3OH8A 4DQVA 5AQ1A 1K6XA 4LN1A 1TVEA 3I23A 4PRKA 1N7GA 3BMOA 1BSVA 5KVCA 1ZUD1 4HNGA 4RF3A 1U8FO 1I3MA 1ZO8A 1YRLA 4Z0PA 4RPGA 3F5QA 1B8PA 1EFLA 2YY7A 2ZB8A 4H16A 3UCXA 1U2GA 1JKIA 2HLPA 1DIBA 2P9EA 3LK7A 4GPD1 5CPBA 4CMIA 4CLOB 3WTBA 3FPCA 1HT0A
chains in the Genus database with same CATH superfamily
1P45A 4N49A 4ND6A 1J8VA 1Y4AE 1TCCA 4YCDA 2GBCA 2X7XA 4QX6A 2OCBA 3EIHA 1M7HA 3GBSA 1FMJA 3CISA 2MR5A 3FTCA 1AKNA 3UC5A 5I7EA 3ZLBA 3O8BA 4N5NA 4FHZA 4CMGA 1V1MB 3O91A 3H1EA 3T12A 2I2DA 3KB2A 4QBGB 4Y6LA 3W2FA 3TW0A 5KTYA 3GLGB 1LJLA 3FMPB 3MN1A 3NCTA 3A06A 4L76A 3MK31 2JDIA 2VTDA 3NUGA 3AUTA 3GJTA 5ABPA 1GA1A 5LA6A 4BMOB 4DR5B 3LOUA 4HL6A 5EP4A 3DQQA 1BRMA 1Z6XA 2AKYA 2WSBA 4EPTA 3T5AA 2XB4A 5IJ9A 4OHBA 4XM1A 3GLSA 1Z7WA 3DR5A 3IDFA 3QHQA 4ZC1A 5LXTF 3NBAA 2WJHA 2XB8A 2E9SA 1PR4A 4BEWA 3Q8KA 2H8KA 2TMYA 3NATA 1RJWA 2O8DB 3QKRA 1DQYA 2NVUA 1QC5A 3IVGA 2Z1NA 3UT6A 1QG0A 2VHYA 4EVQA 2BD0A 4IGAA 4EENA 4M1KA 5BY2A 2Y66A 3MEQA 4X6LA 1JYEA 3ZX4A 3EGXB 3HE3A 1L5QA 5BOVA 3UMMA 4HSGA 3CVXA 2FN4A 4WKPA 1P7ZA 4ITVA 4CJXA 4BMNA 4LJSA 1D6SA 3SFVA 4MI9A 3UAGA 4GX5A 4RKEA 4MVJM 2BPOA 4ZI3A 5IDXA 1NX6A 4C5CA 4DLWA 3ZIAD 2DJIA 5KU1A 2X13A 4RD0A 5CXSA 5CX1B 2VDKB 3L43A 2CD7A 1YJ5A 1SIBE 5LBTA 3RUEA 3V4SA 4AMVA 4B6QA 3TGLA 2VTVA 2Z9CA 2X3UA 4LYYA 1GAQA 3EMKA 4F7DA 3V8BA 4K9MA 2NPOA 1R6XA 4KQGA 5KQLA 3GW8A 2GK3A 4MVXA 4WZBB 4GH5A 2C4MA 1ETHA 3RU3A 5K8VA 1JQAA 5K8CA 4Y30A 2OORA 2IDKA 5DBIA 3INTA 2DUMA 4YJ2B 1BA2A 2DUUA 4E88A 5CG1A 1ZGJA 3KXDA 3WGZA 1D1TA 1EVZA 2F64A 4RHYA 2FX2A 2E82A 1W96A 2P2YA 1TU3A 2NZUG 3ESZA 3HXTA 3ZHRA 4C5BA 2R8ZA 3F8WA 4GGMX 2YXLA 3VGJA 3GJ3A 3DOOA 4Y2YA 3H16A 1KDTA 1YVEI 1BXGB 2R96A 2QE7D 2UVDA 3PSHA 1XPJA 1ZL2A 4N03A 1IVYA 1R9GA 2EFGA 4S1TA 4GMDA 5DM0A 1NXXA 4MQEB 2G70A 4YMWA 1AMNA 1VLHA 4L07A 5K9ZA 2IH2A 2R7KA 1RWWA 3HEAA 3NYQA 3AHGA 3GJ6A 3A6JA 4GZMA 4R83A 1O03A 2B6NA 4DIBA 4H2DA 3UUWA 3WL6A 4DM7A 5GONA 3EF1A 2WABA 1FJGB 1DG3A 1BXRB 2HFKA 4NPCA 5KSWB 1HDXA 2EJBA 4QYSA 2R4TA 4WSOA 3IPAA 3H1FA 3T1YB 2C03A 2CJYA 2GGSA 1I8TA 1DQNA 2HHLA 4QGFA 4PYLA 5IAEA 2JH9A 2IEIA 5ITWA 1O57A 4R2JA 4AICA 4CKWB 3C97A 1RPJA 3DT8A 3K0CC 3OFVA 1VHLA 2WWTA 3H5IA 4LZZA 3L7DA 2WUWE 1ZQ9A 5KNDD 1VKNA 4EW1A 1CUEA 1UM8A 2OAQ1 4IIDA 4Y2RA 1W73A 1Q7CA 2FSPA 2AFIE 4UBNA 4EOGA 2EWVA 4OFZA 4C3OB 2Q4EA 1L8LA 3QJ5A 1EA5A 4URVR 2VPTA 1KK1A 2GN9A 4KXMA 1WUHS 2DX7A 2H5JA 4DXDA 1U2ZA 5LU9A 1ZOSA 4TWIA 5COBA 5AUNB 3TDNA 1YDHA 5EJMA 4YRFA 3RC1A 1PIWA 3KE9A 1XWIA 3TIIA 2HMTA 2PH5A 2Y1CA 3VR4D 3KYDA 3FOBA 2C31A 2ZRQA 2IZ6A 1I4TD 1F2TB 2WP8J 4NU5A 4P93A 1HQYE 1DDGA 3D5TA 1JEQB 3O4RA 5AKXA 3R75A 3RIYA 4A0HA 5BN5A 1IRIA 1IXKA 5LUAA 4CIWA 4YDQA 3DO5A 4EY7A 2H7YA 4D3YA 4RFSA 3B9PA 3U17A 5CA0F 1VE5A 1W88A 4BKUA 3KSUA 3C85A 3MF4A 4LSWA 4KMSA 1AMOA 4ALIA 2KB0A 2GF0A 3ESXA 3JY6A 4TTRA 4EG6A 1RRCA 3U1BA 1GTRA 3HB7A 3OTQA 4DVJA 1D8AA 1RI1A 2XYGA 3HO6A 4JFRA 4G85A 4ZI7B 5AHWA 1X1CA 1C7JA 2PFSA 3AI1A 1R9JA 1JZQA 1EWVA 3EZNA 3QLVA 2PLNA 1KVTA 5DKFA 3FWPA 3D7MA 2CNKA 1MABB 2NU8B 1QZXA 1BIFA 4JYCA 5DHQA 3IPCA 2P9YA 4B1FA 5L6LB 3WYNA 1P1RA 1YKSA 4UUBA 4K26A 4II7A 3WLFA 1NT4A 2H1FA 1S96A 4M1TA 3TXAA 2QUIA 3UT5B 2D1YA 3HJBA 2FXIA 3DE1X 3ETNA 4IZOA 1JDTA 3GDHA 4BWVA 2VZ8A 1P9WA 1SXHA 3NUZA 1T1RA 4QJIA 5EKSA 2P3OA 1TM4E 3B1JA 4JJ8A 1BMDA 5JXWA 2X23A 5DK6A 1KK2A 2V9ZA 4M0MA 3KPUA 2NTEA 1ADYA 3GLVA 4L5YA 2ZYWX 3KJNA 1RMQA 4PLCA 4DV0B 4L7QA 4HAOA 4JL5A 2VF4X 1PWHA 2CK3D 1Q1EA 1TO6A 3DEFA 2UUAB 8MHTA 3AR6A 5ERXA 3ZHSA 1SQ5A 2NTVA 5EJ2A 1G20B 1BO6A 1Z73A 2IPAB 4M99A 1OV6A 3DLIA 5FOVA 1T34A 2OMKA 3P9KA 4EKDA 3U60B 2AI3A 1DELA 4J3JA 2XZDA 3BD6A 4F46A 1GGNA 2O8CB 2BBOA 2PMBA 1UC5B 2P9QA 4A0SA 4YMVA 3N28A 2DLNA 1UL1X 3GRYA 4H27A 4KPFC 2JFFA 1GADO 4GPTA 1FP1D 3A9WA 2JNWA 5AUOB 5IVHA 5JASA 4TROA 1KGSA 4QUKA 1R50A 2IUTA 2CDAA 2VFAA 2YHIA 4OXIA 1ZK2A 1QH1A 1PR3A 1YK0A 4TVKA 1A9TA 1RP1A 2NUAA 3EXIA 4RFLA 5HTKA 5J2UF 4XR4A 1V3VA 2Q5JA 5EEHA 1L3BA 1WABA 4HYEA 1LK0A 5LP6C 3HACA 3BKWA 1P9LA 1Q19A 3R41A 3TZKA 1PTJA 2I6SA 4YJFA 4YP0A 1D4OA 3A1UA 3U44B 4O1IA 5F3WB 1IB0A 4Z99A 3DKRA 3ITEA 4PFQA 5LZ8A 3WK4A 5I9SA 3GV0A 2O1EA 1KE2A 3DL7A 4FYPA 4CRWB 1XAHA 4FEEA 4PR0A 1Z33A 1KMHB 4RZSA 5ESXA 3G1WA 4JBXA 4KE9A 2M6LA 5LA6F 4E1AA 1XHFA 2P1DA 2VBCA 3OU2A 3Q9SA 5AM1A 4E32A 5A9RA 4OBXA 3EZ9A 4JLSA 4PX2A 4Q3KA 1VLQA 1E2MA 4LHYA 3RBXA 3HLKA 3BBPA 4GNKA 3R7WB 4O2AF 4OHRA 4C0KA 3SKXA 1ZBQA 1GIAA 4ASUA 3JU3A 3B89A 3AI3A 1NONA 3RG2A 3T3MB 1SXPA 1FU7A 4Q4AB 3RT7A 2NYAA 5K0FA 3IPLA 2NIPA 4ND4A 5MGBA 4IBOA 4NY1A 4RKQA 5LIPA 4B4DA 5D7NA 1W9HA 1OVGA 5KWVA 4HDKA 3ICPA 1BEEA 5C81A 4RDCA 1Y63A 2XOXA 2IY7A 3C8DA 2BEUA 3H2GA 4JSYA 4ENPA 2AJ8A 1IM8A 4ZO8A 4BFXA 4OFWA 2WWGA 4BO6A 4J29A 4U0KA 3STYA 5JJKA 2ZWPA 1VM6A 1WHSB 3W3ZB 4DJEC 1XKQA 3PNYA 3QNUA 5KHAA 5DM1A 1KBOA 3MTEA 3SS8A 3G2HA 3AEKA 5I5EA 2D6FA 4RENA 4LG1A 3CRMA 4DE5A 3KQUA 4G84A 4AF7A 5JISA 1W4ZA 3DV0B 1QVZA 2MSWA 1N3YA 1Z39A 2Y1KA 1GJRA 5CH8A 2YFYA 4NBLA 5IXJA 5C1PA 5JSFA 2ZE8A 2AKEA 4BVHA 2D2XA 3ZPXA 1T8RA 4D4MA 5IG2A 2CLFB 2IRWA 3DP7A 1J0EA 3AFNA 4LSZA 4RVUA 5THXA 5JNSA 2PX2A 5G1PA 3B3GA 3MNFA 4Q66C 2CLCX 4LJRA 1BROA 1OWLA 1W5BA 2QLLA 3JQ8A 3PHGA 4KBGA 4YACA 2ZB7A 3PLNA 3RFXA 1IK4A 4J1NA 3V8EA 1PV2A 1XU4A 3KHUA 1K7SN 4KO3S 5F2NA 5KC8A 4HQKA 4AQ7A 5H82A 1C9YA 3EEOA 3CZCA 4PG7A 1GY8A 1UAGA 3T41A 3IP6A 2P3SA 5D3KA 2CXHA 4CL2A 2P2GA 2IDZA 4NRDA 1X1SA 3AFHA 1MG0A 1N3IA 1SO8A 1DIOB 1WZNA 2P4HX 3CVJA 5HHTA 3VH1A 1NAHA 1YKGA 3VOSA 2ZDHA 3ZYCA 1XCGB 1Z7EA 3WHPA 1YR8A 3B1KA 3P32A 1NKTA 4W5RA 5FORA 3K70C 5GONF 2OBLA 2A86A 3NYRA 2QM3A 1XZMA 1V96A 1TKAA 1NW9B 1YB2A 3IIIA 3KTFA 4Q3NA 1KQOA 1K9VF 4O3FA 4OH7A 5C7YA 4BP8A 5J1SB 1XTJA 2WAMA 3HVRA 1G0OA 2R7MA 4KDEA 4X7MA 1J99A 1VBMA 2ISSD 5T67A 2PU5A 3R3YA 2DH5A 3DDUA 3DVSX 1TW2A 2FFBA 5HGJA 3CUVA 4MQFA 1N0VC 2FWIA 3QE0A 4ZXFA 5TDHA 3TDKA 4CTKA 1XJWA 1HNXB 4GS5A 1WDLA 2A9VA 1K8RA 3H1TA 4DIUA 3RREA 5K01A 3FI9A 3REFA 2JJ1A 2Q0SA 4CG3A 4PGMA 4JVLA 3AV0B 2VH2A 1NJGA 2VRBA 2QTHA 1E6UA 3AZOA 2QTNA 3JVEA 3WLRA 5A4IS 2FPOA 2NW6A 3PVCA 5M5BA 4LK3A 1JEYA 2ZRHA 2BDUA 2HA2A 1K3TA 3BSWA 4BRSA 1T2DA 1VECA 1S3GA 2FEXA 2CZGA 4Q4JA 5AVVA 2E1PA 5C31A 3O4JA 1TB4A 1IY2A 3C41J 1B42A 2MINB 3QF4B 5D87A 1X6VA 3BORA 1XTKA 3R2JA 4RK0A 4YYZA 1YL6A 1X7ZA 3ZD8A 4U7JA 2W0SA 4XJSA 2W6NA 1DC5A 3O95A 2O0MA 3UH1A 3GXOA 2GHQA 3EOZA 4HWPA 1HO3A 2VYND 1BVUA 2GO1A 3WKCA 4F1WA 2C3MA 2GTHA 4GP9A 1T15A 2QX6A 3KXPA 4LC1A 4LCBA 4LZLA 2IUFA 4M88A 1PSZA 1SXJA 1SB8A 1FNCA 2YMQA 3K16A 5ALRA 3P9QA 1G2IA 1CS0B 4RJLA 4RTJA 2GPAA 3NHUA 4CMKA 3FOZA 4H3SA 1RRMA 5JARA 4IJKA 1ML4A 1AXRA 2NAFA 5HQ3B 1TM7E 1U8TA 1SG6A 1RHRA 2BFFB 4CIBA 2DR0A 2OLEA 2LV8A 1AO0A 3IT2A 2Q5IA 3ZV7A 4GKKB 3LUDA 4HEQA 4FILA 2UYYA 3T5TA 3M6LA 1LSSA 3LD9A 4CHTA 3QXXA 3SBEA 3OX3A 1U5BB 4I99A 5EHXA 2H31A 3RC9A 2BCEA 4BFUA 3BIJA 3M89A 5LU8A 2V7BA 4EL5A 3GRCA 3K9NA 3VC7A 3ABRB 2ID8A 3W7VA 3Q7TA 2INGX 5MDHA 1U1EA 1WM1A 2FVXA 3WFJA 1ODCA 3KVNA 5FBHA 3HGTA 4M87A 2AE2A 3AF4A 2D8MA 2SKEA 4YALA 2NVBA 1O97D 5GZ1A 4TTQA 4RXMA 3RD5A 3ZS9A 2AL7A 2I6XA 4FGUA 3RWOA 2R1VA 2X9VA 3N8IA 3SC2A 4ND5A 2PFGA 3V97A 2ATVA 4IH1A 2O19A 1JG1A 1LWOA 1NKSA 3A36A 4UATA 2FN3A 1DIAA 1DHRA 3W4JA 5JJCA 4GUDA 1L7QA 2WD7B 1SCUA 1UBTS 3L8EA 1PFVA 3LIPA 5DULA 4FN5A 1O1YA 2XNJA 4OLBA 2RB4A 3GVXA 1VPDA 1PK9A 3J7TA 3RTAA 3DLAA 1N5MA 3NNNA 2ZUBA 5BPHA 4IL5A 1E1CB 3RUCA 2WZCA 3F1LA 3MSXA 1RM5A 4BZZA 3GDOA 2OZLB 1MFZA 1TT5A 2BYTA 2E4YA 4WTOA 2FZWA 1G5QA 4I1OA 1PHPA 1ZUHA 2XUJA 4G37A 5DGXA 1IHUA 4BLSA 2BE9A 2RIPA 2QM7A 3OD1A 1FFCA 4DEXA 4V0QA 5EJ7A 4D9JA 1M66A 4YR7A 2EBWA 1C1DA 1KBZA 4H4DA 1JENB 4KN6A 4QPCA 3F49S 3U1VA 4N3AA 5T8KC 3EZGA 4QD3A 4DR6B 1ND5A 1XMSA 2QRQA 3BH7A 3INRA 1UFOA 4YEDA 5D85A 4N47A 3LZCA 3ZNNA 2GCOB 1Z6GA 3IKMB 2QLNA 3CGWA 3ESBA 1JNXX 1P7VA 1ZPDA 4AJIA 4MWGA 1D2RA 5DNCA 3L8MA 2ZJ8A 3PWTA 1Z2OX 2DGDA 2W2XA 1HUQA 2XF8A 3QVMA 2QPLA 4WXHA 5IW8A 4CF3A 2W2LD 4CQJA 2HUNA 4Y0VA 5DLPA 4COKA 2YV4A 3OY7A 1MIOA 2YWCA 1XMXA 4DHEA 2PCJA 3EC2A 4GP6A 3ROEA 2Y1XA 4QAJA 3TLEA 1EX7A 2SBTA 3OKCA 2BGIA 2X0RA 4OX9Y 4BX9A 1BMTA 2ZI9A 5TQJA 3IDAA 1H2HA 1M1UA 1JQLB 3BN3A 1H5QA 2ZB4A 1E9AA 1TAGA 3TW8B 2Q0HA 2R44A 5JWOA 5GINE 1V45E 3MLBA 1XZHA 1U6JA 5TQ0B 2OILA 1TJ3A 3E2PA 2XXAA 1V9CA 2C3YA 5EUQB 1KHTA 4EUEA 1AQNA 1FYEA 1LB1B 2F00A 4D8XA 2DWQA 2WUEA 1YRBA 1I3NA 1QVWA 3KR2A 3C6XA 4M55A 1Z3CA 3KSDO 1E8MA 1ZXXA 1QGAA 4LF7B 1MC5A 3PNKA 3A14A 1EZZA 2B82A 1MB0A 5JS7A 2XY4A 4PO9A 1O94A 1WD5A 3I6MA 1G21E 4P1ZA 5EXPA 3UAWA 3ECSA 1UPCA 2YICA 1WXDA 5FWNA 4YO7A 2OBMA 2BTQB 3SXJA 2GEVA 2OOKA 2C2OA 1ZICA 3H84A 4GBED 4N3BA 1D5WA 1LRJA 3P20A 4FMCF 4TLLB 1EEXB 1M9NA 1U80A 5AXDA 2CJWA 2JHAA 3ENZA 2ECKA 3FKQA 2W11A 4W8OA 3GPIA 3HYSA 1XJ0A 4KIGA 4D3DA 3EXHC 3WKEA 1E59A 1OZ0A 2VAXA 1KMCA 2Y99A 1NXVA 4FD2A 1CZKA 5TMDA 4AI6A 1PDWA 3MCAA 4R2LA 5IKEA 2W2PA 4BWFB 3EP6B 1OWOA 2FMHA 4WGFA 4ZMBA 3O3NB 3PTLA 1ESEA 3L7OA 4HLUC 4HO1X 3JD4A 1XTPA 3DVRX 4Q03A 1ZVKA 3ZHYA 4FXPA 5AUPB 4WNYA 2NO9A 5CW2A 2Q5EA 2A0WA 1C9KA 1OFIA 4MP8A 4UREA 4C0JA 4F4UA 4WBXC 1E0DA 3B36A 1MAAA 3OAAD 3CT4A 4R6XA 2Q9CA 4PZCA 5KVQA 1UEJA 1A96A 3PIIA 5H83A 3KD3A 1BWSA 1ZGZA 2IYZA 2AR9A 2JFXA 4DDVA 2XR1A 1MB9A 5FHRA 1MJFA 3GFBA 3M82A 5EI5A 3TLMA 5JC8A 1Y6GA 4C04A 4OJYA 1CP2A 1GU7A 1LTQA 1QV9A 4NK4A 3RYFB 2IZ5A 4DC0A 3O7WA 3GA0A 1MJGA 3JZAA 4E1BA 2O05A 2O4CA 2DLCX 4E5SA 1DCKA 1ZVMA 4BNVA 3JASA 1VKHA 3CB4A 1OAKA 3I52A 8ADHA 3ADCA 3LCUA 4PM4A 4UOEA 5H0IA 5F3RA 2OSVA 3R5FA 2H4ZA 4CL3A 2PAAA 1VBNA 3K92A 2AN5A 3L0SA 4BAUA 1YDEA 2XHZA 2D4AA 3B1XA 2HV9A 3OMXA 4O4LA 5LL6P 3AVYA 1ZY2A 2FPGB 4KPUB 1M1XB 3P0IA 3IO5A 1YIOA 3RNLA 1JU4A 2XSZD 3FDJA 2OL4A 4G4GA 4DEYA 2RHBA 4KGZA 4WD3A 3PB3A 1XDDA 3OWXA 4LW8A 3FW1A 1A97A 2AH5A 2VWPA 5BV0A 4TQAA 5F9HA 1PD1A 3ILYA 3IQFA 1YE3A 2C4TA 5CCDA 3S2UA 4YAGA 4P7KA 3FNRA 1T4CA 3H6GA 3DAOA 4ME6A 2B4AA 4U2EA 1AA9A 1UC9A 3P9IA 1H8HA 1ZJZA 4DABA 1OX4A 1YE8A 4PV7A 3ZDDA 4RK4A 3DMNA 3IB3A 1I1HA 3WXMA 1SOVA 1TFRA 1XROA 4BQRA 3RF7A 2K7FA 1P9OA 1OZGA 4Q37A 3CLUD 2C5AA 3W5BA 5I7OA 5ADHA 3C16C 4ND3A 4I4TA 1MCZA 2QD4A 1F0PA 2B1RA 5KYKA 1EUQA 4RX1A 1UINA 2ZUEA 1Y5NA 1Z2PX 4QRDA 2KLBA 2Q1XA 3K9HA 3GAMA 2OV6A 3AONB 4GZ5A 4I3FA 4JOSA 2R25B 1ZWKA 4IDDA 1C80A 1KMIY 2JIRA 4PC2A 4QG7A 4XM2A 3A7DA 4Y1FA 1W7AA 2YXDA 1QKKA 4C4TA 2DXIA 3WLHA 3EFBA 3P4XA 5EHIA 3T5GA 3LQYA 3SZ3A 2ZPUA 2F3UA 1I80A 2NZXA 2ZXUA 1HR0B 1LQUA 1OFGA 1EFPB 3QFFA 2HF2A 1KFKB 1H2BA 4CQMD 4FZ5A 4LXGA 4WERA 1WHTB 5AW6A 3HZOA 2O6LA 4EJSA 1NUHA 4RD4A 2DMRA 4JWTA 5KJ6A 4EITA 2RI0A 1L6IA 2QI9C 3ZNOA 1I0ZA 4IDGA 4KQIA 3WJ1A 3OIYA 4G9BA 2IIPA 5THQA 2YJZA 4RQBA 1J2UA 1N5JA 2G4LA 3WLNA 3N53A 1GG2A 1M10A 4JKYA 1A1SA 3QMMA 3D8SA 2WTMA 3LDHA 4P5DA 3K9GA 3WSWA 4H4CA 1XU7A 4XDYA 3J81k 1GPLA 1OT5A 2Q6LA 4OMCA 3EAFA 3QX7A 4ZIRA 1ONOA 1PJTA 1HEIA 2B6HA 3I9V6 9GPBA 2HF7A 3MWJA 3GJ8A 3QVKA 5FL3A 4D4KA 2YS7A 3OTHA 3TXXA 1C7QA 1GG9A 1PKEA 5JH7F 1QRAA 2AJBA 1X13A 1L4YA 2XJ4A 4I19A 3HY4A 1TIKA 3LH5A 3M70A 1UBHS 4JJ7A 4Q39A 1P0CA 1L7OA 1ZX1A 1XA4A 2YNMA 4IFIA 4WLFA 4DZRA 4QYIB 1M1YE 4HTFA 5TSDA 3ZE7A 4BVBA 4B4OA 3F47A 4R8KA 2O5EA 3DR3A 2WJPA 4KNVA 2BP7A 1J1UA 4KZKA 3IKLA 4TMZA 5EC8A 1R0YA 1WCIA 1JQ3A 3QA9A 1LJUA 5FWDA 4B6PA 1PDVA 4UM8B 3LYAA 3LC1O 3NJRA 2HLHA 2P4SA 1GXSA 1F5NA 1O6ZA 2XBLA 4RZUA 4TSKA 4CM1A 1HT1E 1BX1A 1SY7A 1Z36A 1UJ5A 5CW1A 1YJXA 1B26A 1NFQA 1FDSA 1VGRA 3AVPA 4RCVA 3T1HB 1I0LA 1WJGA 2JDID 3ADOA 3VTAA 2EDAA 5ERYA 3WWCA 4A6EA 3VC2A 2XMZA 3GZJA 3ES9A 5E9QA 5L7TA 2R8YA 2WSSD 4UE2A 4IJUA 1RPNA 2GPSA 2OV2A 3O7MA 3MRSA 1NG1A 1DO0A 2WBLC 5JI3E 3NHPA 3TKAA 4BC0A 2Q1YA 3AEUA 2ZTUA 4OM8A 1J42A 3SBOA 5GADl 2RGRA 2XKAA 4FHGA 1ECBA 2GCIA 1E9CA 1UKZA 2I9KA 2B9VA 4QOIA 1GPMA 3E9QA 2X0NA 1T9DA 2EKPA 1RLTA 2J9FA 1W25A 1H66A 5WRFA 4BGUA 2B7CA 4MGIR 4QXAA 2RG1A 3S27A 2IYAA 3LX6A 4XQEA 4YGYA 4Q7KA 3M33A 3RK1A 4EUSA 2NNWB 4RM2A 3PT5A 1AKMA 2WAAA 4RH0A 5LN1A 3DT6A 1OLOA 3P2JA 2ZKLA 4M8KA 2AUTA 4E3ZA 4PCVA 3ELWA 2RJNA 4PAOA 1E2GA 1WKCA 4XGKA 4ZAGA 2TSYB 1DEOA 1RD4A 1KP9A 2Z3ZA 1A2BA 1WBJB 4TXHA 4ZT2A 4P4SA 4XKJA 5BV8A 4DARA 1M72A 2W6IA 1HE8B 4O08A 1VYHA 2OO7A 2V6MA 3AF5A 4BV9A 5FTMA 3BXXA 4MTLA 5E9JA 2JAQA 1WVIA 3WWYA 3QVOA 2GNPA 1P1IA 5AVTA 3O1JC 1IQPA 2BHSA 1X94A 4TKVA 3F78A 3R0QA 1NXTA 3C48A 6NULA 3UFXB 3MHTA 1EZ1A 1ZNQO 3H7IA 5E4YA 2GILA 5FTKA 3UAOA 4DDUA 4YMGA 4LFCB 1HG1A 2JLWA 4HDRA 2FZGA 4R54A 2O7NA 4X00A 4WJKB 3RFVA 1NVEA 1AGNA 4WHMA 2R66A 3OE4A 5A4DA 3MTIA 1MV5A 4HYTA 3ZGLA 2PD3A 3RAEC 1LD3A 2PGOA 2OYCA 3VISA 4KWCA 3JQ7A 1JEEA 5CLFA 1XZBA 1LSJA 4PWZA 3TLGA 1W4BA 3PNQA 1NJ8A 2HDWA 5DZSA 5HFNA 3W5CA 2CCKA 2FQWA 5AKJA 3SC4A 1NSFA 4TZ6A 1FYWA 4JJ6A 1C8VB 1QPGA 3RVJA 4AYTA 4Y2VA 5LLTA 2IPMA 4MDHA 1XLVA 2P5UA 1Z0ZA 1LBQA 2JHCA 1ZW6A 2XRMA 3MIIA 1JLHA 1OLUB 3ETEA 1W1WA 4RY2A 1VKJA 1QU3A 2JVKA 2WICA 1Y8CA 4NFHA 3LY8A 4YBZA 1TIBA 1ZMXA 2VHTA 3QKWA 3IEKA 4HC4A 4QC2A 4JP2A 2X6TA 4G1EB 4K0KB 2QYTA 4NV0A 4OL0A 3B3JA 1CB7A 1FQOA 2B5OA 5F2KA 1AV6A 1XJ5A 1IK6A 1YS2X 2WHPA 3E5HA 5ANRB 1AK9A 4ZJPA 1WOYA 5IJWA 2OZPA 4XGNA 4AMZA 4ENSA 4DSAA 5IC4A 2ZYVX 2D62A 3A3NA 4O8JA 3DZ8A 2VEOA 3EW9A 2FEPA 2ZVPX 2Q2QA 1XLUA 1ODJA 3HCOA 4BNIA 3COZA 3U7QA 3GG9A 3B6EA 4JBIA 4R1TA 1BXGA 4UMDA 2H57A 3IV7A 2BR3A 3KKPA 4O4LF 5FADA 4E22A 3GFPA 4EPVA 1L4GA 5KYYA 3QI2A 1YZHA 1D1SA 1PQ4A 4CKYA 1PS0A 4KP7A 4CKZA 1XRLA 5F4BA 3OPNA 1MJNA 1I4EB 2WUVA 1YS6A 1IL0A 5L4NA 4I36A 4UEOA 2V1XA 4Y2HA 2B9EA 3PQDA 4PSVA 4DV7B 4BP1A 2B21A 2FEOA 3KHKA 1QV7A 3MIZA 4JB2A 1KRHA 4RPIA 4P83A 1MW8X 1XEFA 1Q1QA 4OHKA 2QTWB 4XD2A 5ILQA 5A03A 3QPDA 5TVOB 1P4JA 3IUNA 1A50B 1A7JA 3OCXA 4DC9A 4YBRA 2QTCA 4MS4A 3AFMA 5FA6A 4LJYA 1V11A 1BJRE 3Q9NA 1VE1A 1JIJA 2IL1A 2PUTA 1E6WA 3DDSA 4I4TF 4RHUA 4YR9A 3KB6A 4HAVA 3OOEA 2HUPA 2ZBPA 4Z3OA 3HYTA 2I6GA 2J4FA 1V8DA 2X7JA 3BJEA 4EG3A 3NHZA 1ABEA 4KL8S 2CV2A 3OWOA 5JSZA 4KXVA 1OBCA 4DYVA 4PQGA 3DEYX 1R66A 2HJSA 1Q83A 2YWHA 4FBGA 4GSYA 2GJ4A 2B3DA 1PVVA 3IP7A 4KQFA 5ESDA 5HILA 2PQ2A 4F91B 4QJ3A 4IIVA 1TMGE 2MYTA 2NV6A 4RY0A 4CMAA 1OBOA 4I6JA 3UJ7A 4Q9KA 3L5OA 5FYDA 3CCFA 2WWWA 4RTRA 4G3XA 3C43A 1N8TA 4PZYA 3K5IA 1TRKA 3IAHA 1PT5A 4DQUA 3VI4B 1PR2A 1F8YA 1UXGA 4F2PA 2R7LA 3VQTA 3BPSA 1N6LA 5DFAA 5A7HA 4BC1A 2Z2XA 2L19A 2VDMB 3I53A 2P3QA 5FPQA 1YACA 3TNDA 4UTVA 1OMOA 2AEMA 3JWHA 3RSGA 3ZZNA 4DKXA 3GBVA 2R1TA 1EYZA 4KKVA 1R4MA 2Y05A 4LJLA 3QVSA 4YFYA 5FNVA 3WLEA 2R00A 2LKCA 4C87A 3PR3A 1QFMA 3PWKA 4P4NA 4X8LA 2A4MA 4S1PA 3PJEA 3GFFA 3UWKA 2VWQA 1OU0A 2NU6B 4ZI7A 5CDFA 4FDLA 1JXQA 5CFPA 3U6KA 4V24A 4BE9A 3NASA 1KF0A 3F0TA 3HBMA 1GG8A 3G9ZA 2PJRA 2NU8A 3C6MA 3EZLA 2ZIZA 3FFXA 4MCJA 3WLPA 3ZDEA 3RYHA 2X9LA 3NDIA 4L8VA 1HTWA 4DJFC 2C8LA 4D3XA 5CLJA 1P91A 3FLBA 3VHQA 1KEPA 3JYNA 2XWBF 3IQDB 5FF9A 3EARA 4JC5A 3TR5A 3WHIA 4ZXPA 2UYHA 4ZO9A 2EBHX 3BF7A 1AN9A 3SIWA 2J0EA 1UIRA 4KYIB 1Y89A 2IDJA 4A92A 4UNQA 4CDGA 4DUPA 5GVSA 2V0GA 5C4MA 4UEJA 4ZK6A 1CUAA 1I72B 1FQWA 3NGXA 3U7JA 3R40A 4IIYA 4GW3A 1KQPA 2C9YA 2UYQA 2O0JA 3M6VA 5IN5A 5BN4A 5FA8A 4ZCQA 1E20A 1DKUA 3PPIA 3VOTA 3K0AB 1KKUA 3IL2A 1FBNA 2J30A 4B76A 2G0AA 2G6TA 4QUBA 5E7QA 5K03A 5MFPA 3D0QA 2RD2A 2XUPA 2QVYX 3RFTA 1I4OA 2X8AA 2UXBB 2AW5A 4MVJH 2RHMA 2F43B 1XTRA 2PV0A 5E6SB 4QIHA 4ASUD 1ULZA 3GYGA 3TUXA 1G8JA 1VTKA 1R4ZA 1J7JA 1TM2A 2V5VA 3MINA 3VKUA 1T3HA 3H83A 4L5BA 4RABA 4BTVA 1VKZA 3LA8A 2JCGA 1JE0A 3AJ8A 4CFYA 4DBLC 4Z6KA 3ZY3A 2AK3A 3IBTA 5C5EA 1U3WA 4ERNA 4UUQA 2VJYA 1IVSA 5KSYA 3OMLA 5JYEA 3VR1A 2C94A 3V8NA 2PIAA 1DBIA 2YIJA 3GJRA 1IY1A 3VNVA 3U44A 3TFWA 2JJYA 3A1SA 1Z6TA 3O1HB 3SQMA 3BMQA 2XT9A 3SYMA 1TVKB 5F9MA 5A4AA 3TK1A 2YOGA 4LZWA 4EA8A 4DNFA 4HDNA 2FH5B 4UJ3A 5IASA 1GKLA 1I6LA 3WP0A 2EHDA 4MJXA 3MWDA 1U3TA 2NV2B 4BMZA 5B7GA 4I81A 3TX6A 2BKUA 4CTJA 4DQLA 1MA3A 5IHPA 1OYWA 4LPKA 3DE0X 1K8XB 4B7ZA 3A9VA 4D98A 2QN7A 3EWSA 2JLXA 3H0EA 1H1DA 1KO8A 3R7LA 2VRNA 5JSUA 1Q57A 2XMCA 1NVWQ 2C0PA 2QL7A 1DKRA 2WAYA 4Q4AA 1SURA 5AW2A 2I80A 4YCMA 4R7GA 3TO5A 1HX7A 4HGPA 4PN7A 2QD5A 3EH2A 4INAA 2Q9AA 4WLVA 3EIEA 3UK1A 3CTPA 1F6WA 4C3ZA 3ZHBA 4CM8A 1IUOA 4EUNA 5ALOA 2H2DA 1C30A 2O3JA 5HIJA 3QM1A 4XGRA 4O1MA 3R9XB 3RV3A 2GLUA 4KX3A 5HQJA 2VEDA 4NATA 4AO6A 5H81A 3UW1A 3RJ5A 4MS3B 4UM5A 1THTA 3Q10A 3PFGA 1ZM7A 2QV7A 3LIIA 1QP7A 1QMGA 3LVRE 3NNDA 1L9XA 2FSGA 1LQTA 1LZKA 3AR2A 2ZWVA 1O8BA 4UFOA 2H1RA 3ODGA 4NU8X 1IIBA 5AM4A 3NIGB 1XZGA 3TB4A 2OCAA 4TTPA 1NIJA 1ZNZA 2IYTA 2QTGA 5HKKD 5L6MB 5A7FA 4WNAB 4R51A 5E4FA 3EEBA 3UH0A 2O20A 2GPJA 1JFFA 4JB8A 3SD7A 4B40A 3CV3A 3E8XA 3N07A 4OXXA 4J9UE 1MTZA 2E37A 4DY4A 1B2RA 4JLVA 3DAPA 1O8CA 1WV0A 2GFHA 2OXEA 3OPYB 3MW8A 2V0NA 4KQKA 4D4LA 1WZCA 2EV9A 2LBPA 3PHCA 1EK2A 2B98A 3L0YA 3D8TA 4U9HS 4GSLA 3HBFA 1XTTA 3BFPA 3IVMA 1T2UA 4H3VA 4FONA 1UXJA 4GAEA 1ZJYA 1SBNE 1F4VA 3LPDA 1MKYA 4M1OA 4NCJA 1USIA 3G2PA 3TCKA 1OPXA 1RM0A 1YBVA 3L18A 3PHJA 3EEIA 3X2FA 2DVMA 4EUFA 2XMSA 4W9MC 1DOZA 3ZK9A 5KCZA 3D43A 3DZ6B 2F17A 2BM8A 5FI1B 1JEJA 3SS9X 4GSKA 4OI2A 1HTTA 5JQGA 5CTAA 1Q22A 1W1IA 3HLYA 2FUG1 2Z5VA 4BNYA 1SUEA 4Q3CA 3UW3A 3VAYA 1PR9A 4Q9AA 1X8JA 4JX9A 3HU3A 2PM8A 2AXPA 1Q92A 4PTYA 3A6KA 4TKUB 4LNAA 4WW0A 1ULTA 3E3NA 4GX2A 5KNCH 3RKRA 3HU1A 4YAUA 4RV4A 2IS2A 1SXJD 5CT5A 4AM8A 4DAOA 1LC3A 1SMKA 3L6BA 1J06A 3EXAA 4MO2A 2WM3A 4RPLA 4JDPA 4ZCIA 3ZE0B 1HA3A 3FVRA 2OLKA 2Q6IA 3MGBA 3GZNA 4Z51A 1QV6A 1Z4JA 4EGAA 2H7XA 4Y9SA 1O9HA 5IDVA 1IE3A 4TKMA 2HKIA 4MS1A 4Q1VA 3REQA 5A2QA 1GILA 2EWWA 5F76A 4DPLA 4X65B 4LYFA 3VYRB 4AJNA 4LFAB 3RARA 2N1BA 5FDFA 3CU5A 2VJCA 3N8DA 4EPYA 1UKAA 3BB1A 2IE8A 2GLXA 5JSHA 2FHPA 3AV3A 4DA4A 5DX0A 3M3PA 4AP6A 2CY0A 1Y9JA 4FKZA 4RV5A 2GBFA 3VU9B 3ZCXA 3OQMA 4QOEA 1PYOA 2PL5A 4WXEA 3T7IA 1J5EB 4PGHA 3D7KA 3F8TA 3X2EA 2UAGA 4UPDA 1NI3A 4H6PA 4JK3A 1UUFA 5ARCA 3PFBA 1G1MA 1WVGA 4XUGB 5CAEB 2ZVQX 3BXGA 1NYTA 1E6EA 2CWWA 3A9SA 4H7KA 4KZPA 4WFJA 1BTOA 2PRZA 1TUEA 2BKAA 3P2OA 3I58A 2C4HA 5AJXA 3RO7A 2WHQA 3BFKA 1IYZA 4WOPA 5FBWB 3GA7A 1Z0UA 3O74A 5FNVF 2Z6QA 3BSSA 3EPRA 3FR8A 2GPBA 3HJGA 1IHOA 2VKQA 5K4GA 2EW1A 1RWVA 4ZI7F 2PMKA 1F0YA 4EKNB 2ZTHA 3BH0A 2C99A 1L1FA 3ROGA 4B83A 2ESRA 5H4GA 1TQ8A 2CHQA 4RD1A 4X94A 2AB0A 3RVKA 1IBKB 5DX1A 1DKNA 3RGGA 4BFSA 1NOJA 5AW3A 2RGUA 1HFEL 1D07A 2O3SA 3ZKWA 4WKOA 4IXWA 4OQ4A 4B3MB 3V2HA 1E0JA 1NSYA 1U5BA 4Z7QB 4XX0B 3U4HA 1XELA 1YL5A 1EUDA 3K3PA 1Z62A 3ZWAA 4C4AA 1FNSA 3K31A 5JZMA 1XLTA 4ZU1X 2ZRLA 3Q3EA 4X63A 3GLHA 4C21A 5CLIA 4Z53A 2O8BB 3IVRA 5IMBA 3Q0EA 2NO0A 3K72B 1S8FA 5LKRA 2J6HA 1DXQA 1UM9B 2J3HA 3T99A 4P7JA 2VJKA 2VJPA 3U19A 1MHTA 2F9MA 2NZYA 4S0XA 4QDKA 5ADWA 3DUFB 4HGRA 3EQ7A 3BJRA 1E3SA 1MH1A 4TM8A 1YAHA 3N2EA 1GRCA 2Q7DA 5ICMA 1C2TA 1RI5A 2PX6A 3NS7A 4L7VA 4QUHA 5FTWA 1E98A 5BO5A 3GQVA 3LXUX 1TXGA 2GXUA 4DQ0A 5TT0A 2ZROA 4ZT5A 5ICSA 1GFIA 3CUSA 4MRPA 4I55A 4RTSA 2HPHA 3LV8A 4CQLA 2WYVA 4MLDA 3TEFA 4QT4A 5CA1B 3QEMA 3E58A 3VKFA 5KI6A 2R8BA 3PLAE 1CY6A 1NDUA 2J31A 5IBRA 2VAPA 1VI2A 2GKOA 5ECDA 2A5DA 3AVOA 5K0SA 3ICWA 5AO9A 3V4PB 3RS8A 1M34B 2YL2A 5AI8A 3LX8A 3D6HA 4HXEB 4MW0A 5HNKA 4JI3B 3AK4A 1MO3A 1ZXLA 5IYZB 1O94D 3HKCB 4MB6A 3NOXA 2C4WA 4TT3D 2W22A 4HXGA 3GJ0A 3RBVA 4TN1A 3CF4G 1E7MA 5JCOA 4JUDX 3RUDA 5CFOA 1ECCA 3R7SA 1F38A 1ODFA 2FN8A 3IPRA 4KJZA 4YTEA 3VGPA 1J00A 3WDLA 2Z3WA 1WEHA 3FR7A 1Z0JA 2FPUA 3OCUA 4RY8A 3LUHA 1YS4A 1RXUA 4C2AA 5EUMA 3IE1A 1EFDN 3P71T 3OZWA 3ZW7A 5JHHB 3ZWPA 5KS2A 1CJBA 3EPKA 4HMOA 4KEAA 4ZAXA 3DDWA 4RTKA 5TB5A 1HNWB 5K0GA 4UZFA 1VCHA 2P8JA 4NDAA 4WOCA 1W36D 1MDFA 4EA7A 2BFCA 3TRDA 4GI5A 3GLQA 4MJLA 2BFBA 4RA6A 4WOKA 3IURA 3EPAB 3X3HA 4IJWA 4O29A 1VJDA 5TQ0A 1TK9A 1LPNA 3I73A 4EGJA 2RGWA 4JV5B 1ONSA 3VHXB 4BVLA 1T2NA 1X0XA 4XDZA 2WUD