3QVWA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k278a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSADKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
total genus 152
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvwA01
5JDIC 3RASA 2RCYA 1OFGA 4HKTA 4U8GA 4PG8A 4R5HA 3FD8A 2DTDA 2P9EA 4L75A 3RUCA 2FR1A 1BGVA 3F6YA 1WNTA 2ZKLA 3GRKA 4PLWA 1DRWA 5F1OA 3WXBA 4WNCA 4NG5A 1LLDA 2UUOA 5JC1A 4JP2A 5TQVA 1PZGA 4NDNE 5EESA 1J0XO 2FRDA 4BNKA 3UW3A 4LK3A 3FR8A 4R1NA 1LDYA 1PWZA 3MJCA 4OYRA 1UJMA 4YXFA 3OICA 1D4FA 4NIMA 4A2CA 3DZKA 4TVBA 4QTZA 3GZNA 3OP4A 2DM6A 4D44A 5IZ4A 3UCEA 3EY4A 1YGYA 2HK9A 3I9JA 4NI5A 4UUNA 2UV8A 5A5FA 1XKQA 4ILKA 4ZD6A 1E3JA 2XOXA 2XF8A 5JY1A 2P9GA 1O94A 1KC1A 3KBOA 3JD1A 1TXGA 2X22A 3CZMA 3RBVA 2O3UA 4BNFA 3H2SA 2O7QA 4RDHA 2C0CA 3TZHA 1NFQA 1X7DA 4FW8A 5TC4A 4PLCA 1B8UA 5B4VA 4U0KA 1U1IA 2D2IA 1PL7A 1TT5A 1LDMA 4P8RA 1PR3A 3G0OA 4II2A 4W6ZA 1WDLA 4J9UE 1H93A 1YDWA 4EYEA 4XYBA 2GRAA 1RM5A 4B79A 1FXSA 4CMAA 3M1LA 4BVAA 1PJLA 5T8KC 1CIVA 1G0NA 2FY8A 3DFZA 2P4HX 4JQCA 3PZBA 4OMUA 5JC8A 4FJ1A 4CV1A 2Q2VA 4MP8A 5F5LA 4BGEA 4OM8A 4E5KA 1YQGA 3NJ8A 1SEVA 3GDGA 1H94A 3TL3A 5DCYA 1WZIA 4J2OA 5JYEA 3LVFO 3AM4A 1HZJA 2D5AA 1Z6ZA 3QVSA 1XCBA 2NM0A 3OJFA 1EBFA 5JW6A 4R68A 4Z6KA 5HS6A 3OJLA 2I6TA 4ND5A 4XX0A 3GLQA 1L7DA 3ZW9A 3DBLB 4J6FA 4OOFA 3A1NA 4J1SA 4D41A 2X0NA 3DR3A 4FGWA 5KVQA 3S2GA 4YCAA 4FB5A 1EDZA 3ADPA 3DXFA 3JQBA 4W82A 3RFTA 2FSVA 1U5AA 1YONA 2PNFA 4NFHA 5L95A 4GVXA 3I4FA 1V6AA 1CQJA 2FPIA 2WYWA 4TRRA 2EV9A 2BHLA 2AW5A 4IBOA 2OFPA 3V1UA 1ZK3A 2EKQA 4BO8A 1P1KA 5TT0A 4ZN6A 3F1LA 2G82A 1H6BA 4IZIA 2P2SA 2IEDA 2NACA 3FNGA 1HDXA 1KERA 2GCGA 1SZJG 3BAZA 4R9SA 4ZQFA 1X0VA 3PP8A 5L7TA 3DBVO 2PWZA 5TT1A 2ZB4A 3W4KA 3DOCA 3SJUA 1QSGA 1EQ2A 1EVJA 2V6FA 3DBHB 3FWZA 1LDBA 4YJGB 3CIFA 1XU7A 3S2FA 4BNXA 3GPIA 4PFJA 4N5MA 2F1KA 3JQAA 1IZ0A 3FRJA 4FD3A 4NH4A 3PGJA 3C1AA 2C20A 3L4SO 2VUTA 1LSOA 1PQWA 5JO9A 3UH1A 3DZBA 2HRZA 5T57A 1XG5A 2AE2A 2AQKA 1D7OA 1TLTA 4AL4A 4XB1A 4K1LA 4FFMA 4GQAA 5DF1A 4L4SA 1I10A 5C37A 3BXXA 4M86A 4MJLA 3HFGA 1YKFA 3FI9A 5AYVA 2Q2WA 5CG2A 2ZQYA 2IXAA 5I9MA 3Q0EA 3PFFA 1DBVO 4R01A 4RLSA 1NM5A 4CMIA 1ZCJA 1ZSVA 5BT9A 3K5PA 3ZHXA 2YYYA 2GZ2A 1SB8A 3JD3A 4WPGA 4J91A 4HNHA 1ZH8A 2H6EA 3O38A 3ENNA 2EEZA 3IKTA 1IPFA 2ZYGA 3ZZNA 4XKJA 5TNXA 1U7HA 3BHJA 5THKA 2X0JA 2VZ0A 4Y67A 2GASA 2DPHA 3JYPA 4XA8A 2ZCVA 4HFRA 1DJQA 3T4EA 1VL8A 4WGGA 3ADOA 3TNLA 2JJYA 3BHMA 4J90A 3VPXA 1W8DA 1HDCA 1QKIA 1U28A 1JKFA 4MVJM 3BMOB 3NRCA 1HSZA 1DIBA 4BGVA 2EKPA 2QYSA 1A9ZA 4DPKA 1P33A 1KETA 3VVBA 2NTVA 3QWAA 5I9NA 4RL6A 3RUDA 3Q11A 3X2EA 2JD1A 1PL8A 2OZPA 4GGPA 4DLAA 4BO7A 2O23A 2GN4A 3OMLA 3S8MA 3NTRA 3DWFA 1TVEA 1DDOA 1EVYA 5KNLA 2GDZA 1RKXA 1UP4A 5JO0A 1AXGA 2X9GA 4M1QA 2FPGA 3L9XA 4D3SA 4BNMA 3ZWBA 4YQZA 4S3MA 1W73A 1XA0A 5A9SB 3VH1A 4PZCA 1Z45A 3F5QA 4FCCA 4PIVA 4QO7A 4AVYA 4AJ4A 2IODA 4IINA 5I7VA 3QHAA 1SMKA 3UCXA 2YJZA 4OOEA 4RQTA 4BNLA 4A5OA 2J5RA 1NHGA 2H9IA 3EC7A 2J3IA 5U1PA 2Z1NA 1Y9AA 4LMRA 1EMDA 4ID9A 2PY6A 3DEYX 3GQVA 2RAFA 1F8FA 3RD5A 1A4IA 3GF4A 3NT4A 4OKIA 2Z5LA 2ZK7A 2V6GA 3IS3A 4DWVA 5DCWA 4OIMA 2RHRA 5JCXA 2C2YA 3HG7A 1H2HA 6LDHA 1ORRA 4YJFA 4AJ1A 3WQRA 3RQSA 4E5MA 3OSUA 3QJ5A 1AGNA 1IYZA 2LDXA 3ULKA 4OL9A 4WCFC 2GF2A 5JDIA 1NQOA 3D3WA 5JBIA 2OHXA 4PZEA 5HWSA 1NP3A 4GMFA 3MOGA 3RI3A 5T64A 2G1UA 3WB9A 3ANMA 4MVJP 1JWAB 5JY6A 4HP8A 4IS3A 1KVRA 4WCDA 4CM4A 4R5MA 1HDOA 2HDHA 3ZI0A 4BGIA 3B70A 5AXCA 2I3AA 1M75A 1BDMA 1QYVA 5L4NA 2EW2A 1ZZEA 3D0OA 3VZSA 1BHSA 1WP4A 2VT3A 1HE4A 4I08A 3RUAA 2UDPA 2FN7A 3FSRA 3HDYA 3UAGA 4JCOA 1EVZA 3GY0A 3UN1A 4DQVA 3MJEA 2VOJA 5CP8A 1KVTA 4JJFA 2FR8A 2FP4A 3WYBA 3GZ4A 4WCFB 5B4TA 4CM1A 3AY7A 3I9LA 5CHEA 3NDIA 5I7EA 5JYFA 1KY5A 2QRKA 1HDYA 3ICCA 3VDRA 4YR9A 2HJSA 2PV7A 2HMVA 3NGXA 4JNKA 3HZZA 2X86A 4NBVA 1NXQA 2DKNA 4WLUA 1YBMA 4RDIA 2JCXA 2VOEA 5CDTA 1C1DA 4E4YA 4HNGA 1Y6JA 5GY7A 1HEUA 2CVQA 3AU9A 1KEUA 4DGSA 3GGOA 3PWSA 5T5QA 3NT2A 3DTTA 1I8TA 2O3TA 4II3A 1NASA 4Z9XA 4MVJF 3K8ZA 3OIGA 4LN1A 2YHIB 5LCXA 2VYND 5T8KA 4KMSA 4WOKA 1LRJA 3RBXA 5B4UA 2ZB8A 3DL2A 1UAYA 1IE3A 5A06A 1Y8RB 4DLLA 1PS9A 2GSDA 1K5HA 2WTBA 5IG2A 6ADHA 4XQCA 3GDOA 3B6ZA 2AEMA 4NBUA 5A04A 3PQEA 4M8SA 1MFZA 4BOYA 2FHSA 3NDJA 1UXKA 5A02A 2J3JA 3KVOA 3JQ9C 4JK3A 2X1HA 3WIDA 2AQ8A 3M2PA 2C2XA 3VVCA 1PS0A 2BGKA 3TOZA 1N2SA 4CQMB 2VWQA 4FJ0A 3SC4A 3GUCA 3RIHA 4QFDA 3SX2A 3P2YA 3PLNA 5G4KA 3TJRA 1PGNA 5CDUA 4U7WA 1SAYA 2GZ3A 1ZW1A 3QWIA 2Z1MA 4TZKA 5IFLA 4GL4A 1EVIA 4EZBA 2J3KA 4J1QA 1R0LA 2B37A 7MDHA 1UZMA 4ZRNA 1BXGA 2A4KA 1NQ5A 5F1PA 5A3JA 4QX6A 1A7AA 4BKUA 1X1TA 1ADFA 4CV2A 1GYQA 4ROSA 5U4QA 1SOVA 2BI8A 2LDBA 3ZN2A 4TKMA 4ZGWA 3ZWYA 3GDFA 4TRMA 2GERA 3PQFA 4XD2A 2VHWA 1C1XA 2HQ1A 3AU8A 3PEFA 2Y1FA 1H9AA 4PRKA 1QG6A 1T4BA 3KZVA 1OOEA 3RU9A 3TPCA 1E6WA 4EUFA 1E1NA 3BIOA 1WZEA 2HRBA 3JSAA 3VTZA 1C14A 4XEHA 1Q0QA 1OC2A 3GGGA 4BKPA 1LU9A 2J5QA 2DFVA 4LSWA 5M6DA 1A9YA 3ICPA 1W0CA 1WW8A 3AY6A 3AI1A 3CE6A 3HJAA 3EW7A 2HO5A 1KY4A 2EF1A 3U4IA 3D64A 3H9JA 1CF2O 1PQPA 1AXEA 2JFGA 4L76A 5TJHA 4CMCA 4URFA 5ADHA 5ILOA 4MIOA 4K6CA 3NTQA 1E1MA 4DQXA 1XWFA 1ZK0A 4FGSA 3TZQA 1F17A 4J4HA 4R4JA 1V3UA 1U2DA 3EZYA 4CLRB 3OEWA 3FPCA 1I5RA 3R1IA 1O9BA 3ZV5A 1GYRA 4PCVA 1PZFA 1GV1A 4H3VA 4B7UA 1PQUA 4NK4A 4XYMA 4B4UA 3LLVA 4MIEA 1ID1A 1T2DA 5FFFA 1Y7TA 1YBVA 3RUHA 1KOLA 3SC6A 4FFLA 4EJ6A 4MKRA 4O6VA 1A5ZA 1E3IA 1E3SA 4OAQA 5A9SA 3E1KA 1ZEJA 3QWBA 3L6OO 4YJHA 2GD1O 4E5PA 1DFIA 3AW9A 2EXXA 4P38A 4CLXA 7ADHA 2YHUA 4FPXA 4A7PA 4LVCA 4AJLA 4O59O 4XGIA 2IZ0A 4CLEA 2VHZA 2PLAA 1P44A 5TLSA 2Y1OA 3QE3A 5HBRA 3FN4A 4JGBA 3OETA 1PJSA 3U3XA 1M76A 3I9MA 1ZSYA 4NHEA 1QMGA 1PGQA 2BMAA 1SOWA 1BVUA 2JD0A 3VPSA 1GR0A 1IY8A 3Q9UA 4A26A 3C7AA 1U5CA 1LXCA 1IULA 2FZWA 2JHFA 3QVWA 2VZ9A 1PX0A 4F3YA 3NEPX 5EN4A 4GH5A 4CM6A 1UZLA 2JCYA 3H2ZA 5C7LO 2R00C 3FBGA 1V9LA 1PJ3A 4XYEA 2OMEA 4E6PA 1GAEO 3U09A 1MX3A 1GEGA 3JQ7B 1MB4A 3TFQA 1CWUA 1JVSA 2X23A 3U4DA 4CM3A 5B1YA 3LDHA 3QWFA 4S1VA 1KC3A 2DVMA 2PZKA 4M87A 1RM3A 4BIIA 5A9RA 4N5NA 3PHJA 2R6JA 2WWRA 3Q1LA 4M89A 1JVBA 4D7AA 1U8XX 1ADBA 3I52A 3K96A 4WOJA 4PG4A 2QQ5A 3DBRB 4WCFA 1WLYA 3E82A 4R69A 1LLCA 2BD0A 2ILTA 1JQBA 1Q2XA 3O4RA 4RPJA 5DBFA 4BMNA 4IDBA 4CQLA 1HWYA 3LK7A 1PU2A 3HUDA 3H8VA 1U4OA 2VWHA 1P45A 3LZ6A 1J4AA 2JHGA 3OECA 1KIFA 3FNEA 4IIUA 4XGKA 5EQFA 3GGPA 1O95A 2EKLA 3R3JA 2X9NA 2W8ZA 4FSHA 3WJ7A 3RFXA 5KJFA 2NQTA 3JYLA 5EMHA 4J4BA 2I9PA 3OIFA 3WSWA 1R4NB 4I9HA 1GZ6A 2DC1A 1I3NA 3KXDA 4OQYA 4A03A 1X0XA 3LLSA 3P5SA 2YHIA 1IOLA 3UHAA 4JROA 3KM0A 4MP3A 3NDRA 2F00A 4DA9A 2BGMA 4O1MA 2HK8A 4B3HA 3EMKA 2Q46A 1MXFA 4FFPA 3PYMA 1YH3A 5ITWA 3WMXA 3GVPA 1ISMA 2OXIA 5JXWA 4I5EA 2QYTA 4YT4A 4IQ8A 1P1RA 4RF3A 3NJ4A 1DB3A 3NX4A 3GFGA 3CZRA 1CYDA 1E1LA 3KOUA 1IHYA 2IRWA 3U5TA 2WD7B 5EINA 1VC2A 1RPNA 2Q2QA 1X14A 3I3OA 4RF4A 4W7HA 1ULUA 2YV1A 4H16A 4J2HA 5ES3A 1IB6A 3WFIA 3SLKA 4ZVVA 1N92A 1JW9B 4NPCA 4YQYA 3ZWOA 1EE2A 3G49A 3HFSA 3ZHZA 4AJPA 1JWBB 4JJGA 1W4ZA 3DHNA 1DFGA 4RJTA 1JDJA 1QP8A 1PGJA 1YE3A 2X6TA 4FC6A 1BMDA 1DIRA 4YEDA 1FDWA 2C7GA 4CR8A 1HYEA 3JQ9A 3UCFA 4C7JA 3ASVA 3DZIA 2CFCA 3KB6A 3U9LA 2X5KO 3MTGA 3WNQA 4LVUA 4CMEC 5LDGA 3R6DA 5G2OA 4R54A 1LJ8A 3ABIA 4GMGA 3ZDFA 2WYUA 5BNTA 4BNTA 1HXHA 4DQUA 4CV0A 3O26A 5L53A 1D1SA 1DIGA 3MOIA 3RUFA 1DEHA 2QRJA 2XAAA 3EDMA 4MVJE 1LDGA 1N1EA 3BTOA 1YL6A 1ZJYA 3GVIA 4BO3A 1ZKMA 3H6KA 3IKVA 5BSHA 3KHUA 1SBYA 3H5NA 3RJ9A 3C3XA 5KCZA 1OC4A 5KKAA 1F0YA 3SVTA 4P4GA 1VKOA 1R15A 5G0VA 4CM8A 4JIGA 3U0BA 4B8ZA 3HSKA 4ND2A 4E2XA 3C1TA 4NBTA 8ADHA 1HL3A 3DHYA 2E48A 1CQIA 5JYDA 2Q1WA 5COAA 3PWZA 3ST7A 5FI3A 3WOHA 2GN8A 5CDSA 1R0SA 1VM6A 5A5EA 5AXAA 3CEAA 4GAEA 5EL0A 3WLFA 5ICSA 1XELA 4EDFA 3PFWO 1CDOA 4RF5A 4H7PA 3UICA 4B3JA 4CLOB 1NAIA 4E21A 3FTNA 1BWSA 2QHXA 1HETA 4O63O 4CM5A 4E3ZA 3W8FA 3MJVA 4RVGA 3O8QA 3U4HA 4KWHA 5F3RA 4B4WA 2C54A 1NWHA 5C5IA 3GVXA 2CMDA 5DP1A 3F4LA 2NVWA 1DSSG 2IZ1A 3MWEB 1TEHA 3F1KA 2Y0EA 3HB5X 4PG6A 1PGOA 5TJ9A 4ALMA 1QRRA 3W4IA 4BO1A 1BW9B 4KDFA 1EBUA 3OQ6A 4J1NA 4Z0TA 3LT2A 2FR0A 1T1SA 3VTFA 1WPQA 3KYBA 1R4MB 2CD9A 2HKIA 2PGLA 4B7CA 3LU1A 1I32A 4IJUA 4E13A 2D8AA 1NVTA 3JCZA 3KEQA 3QLJA 2GUGA 1EUDA 3FNHA 1K3TA 3PRJA 2A35A 3WJAA 3CH6A 4PLGA 2GYYA 1V0JA 2NTJA 3E5RA 2CY0A 1BXZA 2I3GA 5AXBA 1K2WA 3DONA 4CMGA 1E7SA 1YDEA 2IE0A 2J5KA 4N54A 3DQPA 4GBJA 1X13A 4XZ3A 1VRWA 1YB1A 3H65A 3ORFA 4Z0HO 1ENZA 4TZTA 4KQWA 2PD4A 3KO8A 3IL2A 3CPSA 4ALKA 3VKVA 1QYXA 4RPKA 4D79A 1PWXA 1YO6A 1ZFNA 3E48A 4I9NA 3RC1A 1IL0A 2O3JA 2W90A 2XPCA 3AM3A 3KEOA 3SEFA 3WG9A 5KIAA 4MPDA 1UZNA 4C7KA 3RC2A 3DZFA 2BFAA 2PFGA 1HE5A 3BZUA 3JQ7A 4A10A 1Y8QB 2TMGA 5DBGA 3Q9NA 5HTOA 1BG6A 1GUZA 5C7OO 3GMDA 1NYTA 2UUPA 3RJ5A 4EGFA 3KYDB 4BL5A 4GGOA 1YJ8A 1LRLA 3ZWAA 1FF9A 1HYGA 2CVOA 3V1YA 1OMOA 3ENKA 1PIWA 3DZJA 3P19A 4XJTA 1PEDA 1PJ2A 3PYXA 4NJMB 2EW8A 5BSEA 5GZ1A 2W2LA 3GMSA 3GH3A 3FCOA 2VYNA 4UUMA 3DBRA 3GA0A 1JLLA 4OKNA 1DHTA 2E82A 4CQMD 5KJCA 3HDQA 5JAMA 4PRLA 2HCTA 5T67A 4YWJA 4JX8A 1DC3A 1GUYA 1JN0A 2B83A 3B1FA 1T2EA 4UVGA 5DDIP 5F5NA 2Q1UA 1PR9A 4I1IA 3PJDA 4QFCA 1A27A 2PGJA 3JQFA 4BO2A 2O4UX 4DIOA 2D0IA 5B12A 4AJKA 1EEHA 4FQ8A 1AE1A 2DLDA 3GN2A 1LQUA 4BKOA 1R4NA 1HE3A 1NPTO 3I6IA 4NQZA 4RO0A 3IJPA 4TQGA 5ER6A 4CODB 4L9RA 3F3SA 3BMQB 4GVLA 2CDAA 4YVFA 2H5LA 1N1GA 5AXDA 3ROMA 4K6FA 1F06A 4DTIA 1LRKA 2ZTVA 3GEGA 1CETA 5DOZA 4FN4A 2CSUA 2G76A 2VTEA 2QZ9A 2B35A 1C0LA 5LDHA 1C0KA 5IN5A 4ZQHA 4RVHA 4GSKA 1MP0A 3GEDA 4FOSA 4PLPA 4RCVA 2QW8A 2X58A 3H5AA 4UVIA 2WD7A 4CPDA 2PTGA 1NQAO 4W7IA 4CL8A 3EZLA 4YACA 5IDXA 3AUUA 3UKOA 2CDCA 4XCVA 1O0SA 1DAOA 5U9CA 1FDVA 3GRPA 3I9KA 3W1VA 1AHHA 1NVGA 3WQSB 3WBFA 3DDNA 4CMJA 1RM4A 3C7CB 3H9EO 5IZCC 4D0RA 4YA6A 1GCOA 1YOVA 5JMWA 4Q9NA 5IJZA 3PPIA 2HLPA 2P9CA 3PK0A 4FOOA 4NZ9A 3OH8A 4FC7A 3DTYA 1Z74A 1ONNA 1H2BA 1XU9A 2V65A 4PVCA 4BV8A 4G65A 2DBRA 3AK4A 4ZQGA 2VN8A 4F6LA 5ENVA 1HDGO 1DOHA 1MC5A 3A06A 3WSVA 3A14A 4WNIA 2A92A 4TMFA 1U3TA 1JAYA 3KSZO 4XYLA 3A28A 4E2YA 2W2KB 1I3MA 3ROKA 1C3VA 3ONDA 1Z75A 3W6ZA 1VL0A 2O3QA 3U4CA 1IPEA 4CMEA 4MVJI 4CUZA 1LLUA 2NSDA 2I5PO 3RUEA 4B4VA 3L4BC 1J5PA 3IOYA 5IAAA 4L4RA 2E4AA 1NQTA 1ONOA 3PHGA 3SJ7A 4D43A 3V8BA 3D5TA 3E9QA 3TZCA 1YB4A 3V2UA 4HFMA 1I0ZA 4WECA 2D5CA 3DOOA 3GG9A 1HKUA 4OJNA 4J0FA 1KEPA 1R6DA 1Q1NA 5IDQA 4I5GA 3KRTA 1KEVA 1ZEMA 4I5FA 1ENYA 4KOAA 3INRA 2OP0A 5MGBA 2BF7A 2PD6A 3ZHBA 2NWQA 3IMFA 5LC1A 5KVCA 3RKRA 4M55A 2O3SA 3X2FA 1XR3A 2Q4BA 1RYEA 1M6WA 1RM0A 4L74A 5TS3A 1I2BA 2JKVA 1DLIA 3NUGA 4MO2A 1R37A 3GNTA 4MINA 5IXYA 4U6QA 4EUEA 4TSKA 2NUAA 3K31A 4AJHA 3MCVA 3NT5A 1R4MA 4PLZA 3EUWA 5EIOA 4XRRA 8LDHA 4QUKA 4A27A 1B0AA 4R1SA 2J8ZA 4LCJA 2DT5A 5DNAA 4M49A 2W2LD 3A9WA 3DBLA 1B14A 3HN7A 4BO5A 4QO8A 5ENDA 4YRDA 3GVHA 1SB9A 3L07A 1G6KA 3BMCB 2AG5A 2X0RA 1XSEA 4YT2A 2JFFA 1ZK4A 1NBOA 5K6AC 4CJXA 3EK2A 5DN9A 5KWEA 3ZNNA 1UXGA 2Q99A 4OXKA 2HAEA 1PJBA 4RORA 1LEHA 1T2CA 1V3TA 3G3EA 2AEJA 2W98A 4QSMA 3T7EA 4B7XA 1R16A 1O89A 1T4DA 4N7RA 3QSGA 1NHWA 1ZXLA 1FMCA 4IDFA 1Z73A 3DZHA 3WGZA 2X7HA 1Y8QA 3S2IA 1E5QA 3ROPA 1WMBA 1X7GA 3LT0A 3HDJA 3PJGA 2C82A 3COSA 2NADA 4PVDA 4CMBA 4KUGA 4AJOA 3W8DA 1J6UA 4R41A 4ONEA 5IDYA 3DBHA 4YJGA 3VZRA 3T4XA 3E18A 3V2GA 3WTBA 3GFBA 1ZVMA 2NQ8A 3JQGB 4WK6A 4UAGA 3STHA 1LI4A 2Y1EA 4NJMA 5KJEA 2QRLA 3WR5A 3DAPA 3D1LA 2UAGA 2HUNA 3N7UA 3WX0A 2H1SA 1H6DA 3M2TA 1LTHR 1MV8A 4E5NA 5L4SA 2Y68A 3GOHA 5EPOA 4LRTB 2ZIZA 1LC0A 1M67A 3PYLA 3TL2A 1DRUA 1VPDA 4YDRA 1SEPA 4BHTA 5K0ZA 2VTDA 1I2CA 4DIFA 3WMWA 1LSUA 3VAZA 5I7FA 1YWGO 3EYWA 3W8EA 4ZRMA 3WS7A 3JQCA 2AEFA 4BNNA 4CL3A 1JKJA 1GY8A 3VPGA 1MC4A 2X5JO 1ISFA 3PHIA 1ZSNA 1FDUA 3DC2A 4OXNA 4R1UA 5JCJA 4BQRA 4XQGA 1Q7CA 5G0UA 4BNHA 3OQBA 3FBTA 3ZCXA 3HE3A 1L1FA 3ZWMA 1MG5A 1WMAA 3ROQA 5GMOA 4CUKA 3P7MA 5GZ3A 1OI7A 3OEYA 1E1KA 4YAJA 1H5QA 2B4RO 3HWRA 4XDYA 2D1YA 3OBBA 1B15A 2VYVD 1Y9EA 2UVDA 5HA5A 1KVQA 5JDCC 4A73A 3BMOA 2YQ5A 4BNJA 3ETGA 1DO8A 2ZB3A 3GZNB 4Y6SA 1RWBA 2B36A 1B3BA 5CPBA 1R12A 4GWKA 4BKRA 4GPD1 5KKCA 1HRDA 3I23A 5BNIA 1YS4A 3QIVA 4HUJA 4XRGA 4MKZA 2AQHA 4DYDA 2YV2A 3D4NA 5I7SA 4BO9A 1ZUD1 5BQFA 2WE7A 1EZ4A 1PJCA 2YDYA 2Y93A 1A72A 5J23A 3HNPA 2HMSA 1KS9A 3H3JA 3IIEA 2PK3A 4U6SA 1QYCA 5C3MA 3F9IA 2AQIA 2VNAA 4GI2A 4KWIA 1DIHA 1TT5B 1KBZA 1O5IA 2NU6A 5T73A 4NBWA 5DCUA 4DVJA 5KJ1A 1UUFA 3O9ZA 1BTOA 4BQPA 4ZHSA 3IP1A 2TMDA 2DTEA 4GX5A 3IDSA 3I6QA 3NAQA 4MP6A 2PGDA 3IP3A 3F5SA 4DMLA 1LC3A 1SC6A 1TI7A 3VOSA 3RVDA 4BUCA 5BSGA 4LGVA 2SCUA 3VPHA 4JBGA 4ITUA 3AUAA 3LC1O 4R16A 3UXYA 4D46A 3G79A 2AMFA 3EVNA 4I8XA 4IDEA 1NR1A 4WLNA 3RCBA 3K30A 4Q3NA 1QORA 5IZCA 1C0PA 2CF5A 2DUUA 2EJWA 3Q3CA 3R3SA 3TQHA 1LSSA 3MJ4A 2VHYA 1ZIDA 3PIIA 4BNIA 4YRAA 3E9MA 3E03A 4CLDA 4UEOA 3PDUA 1QLJA 3OF2A 4W9NC 5DOVA 4JBHA 5JSFA 2C29D 4RVSA 4WASA 4TROA 5A1TA 1K89A 2FPPA 2GPTA 3ONFA 4Y98A 3ZV4A 2E49A 4MDHA 1YXMA 2CF6A 4YAIA 3TOXA 3IJRA 1LUAA 1Y5RA 4J4TA 2C5AA 4DRYA 2BH9A 4OO3A 2EIHA 1O6ZA 3M6IA 4NBRA 1GADO 1A71A 3AJRA 1UAGA 2DUWA 5DP2A 4BNWA 3AUSA 2VHVA 4DYVA 3GHYA 1GZ3A 1W6UA 3ZH2A 5A9TA 3VH2A 5FYDA 3Q2KA 1UDAA 2Q22A 3NTOA 1OAAA 1KYQA 1P77A 2VUUA 4YT5A 5JAQA 3ZWCA 5KJ6A 1XGKA 2OP1A 5A3VA 1FK8A 2PKQP 2JL1A 4UVDA 1FDTA 2VQ3A 3JQAB 3PJFA 2J6IA 4QQRA 4PZDA 1EE9A 3UUWA 2ZTUA 4PLVA 2ZTLA 4Q3DA 2VRCD 4Y6PA 1HSOA 3SBOA 1E77A 1GTMA 5H81A 4DMMA 1G1AA 1N5DA 2B4QA 2RHCA 4PLFA 3HDHA 2VWPA 3G1TA 4N18A 1JU9A 4Z9FA 1N9GB 2POQX 1CJCA 2D4AA 1D1TA 4BS9A 3UVEA 1GDHA 1Y8RA 4IUYA 2ZJ0A 3TWOA 3L6EA 4E2WA 1DLJA 5L3ZA 4M54A 1T25A 3LT1A 2X0IA 1P9LA 1ZJZA 1JAXA 1BSVA 5JNLA 3TDKA 2OBYA 3L9WA 4XDZA 4E0BA 4CMIB 4NMHA 2AG8A 2B0JA 1B7GO 2AE1A 1T2AA 2O2SA 3VPFA 4RPGA 4GX2A 4CQMA 1BVRA 2B5VA 2Y67A 5JCJD 5KVSA 4A0SA 1U4SA 1WXDA 3AOEC 3C1OA 2YQ4A 3WGIA 1YBAA 1YVEI 3MTJA 1ZNQO 2FSSA 2WM3A 3QA9A 3LC7O 2PZJA 3BMNB 3PLRA 3JYOA 4HV4A 1E6UA 4XJSA 4EJMA 4D0SA 5K6AA 3C7DB 1ADCA 2QZZA 3JQ8B 4G81A 3SLGA 1IUKA 4KDEA 1F14A 4DPMA 3H5RA 4YB8A 4BNUA 4CM9D 5DZSA 1G0OA 1O8CA 5H83A 1I2ZA 1PJTA 4K26A 3ZNPA 4D45A 4P4LA 4K28A 4KZPA 2DPGA 4IGFA 1WDMA 4CM7A 1QLHA 1B16A 1SCUA 4PLTA 1XEAA 3ANNA 4UEKA 4EITA 5G0WA 4Q3CA 5ILGA 5ER9A 5HRUA 2G17A 3WYEA 4YAGA 1QR6A 2Y1DA 5JE8A 2HSDA 2Y99A 4J9VA 3F47A 1WWKA 1NPDA 5FF9A 1GD1O 4OQZA 1LA2A 3W4JA 3WGOA 4OGWA 2FZEA 1K0UA 1UXHA 2IYPA 2PR2A 2PZLA 1DAPA 3D3EA 4IJWA 2WSBA 3B1JA 5KOIA 3LC2O 3FF4A 2V7PA 2P91A 2IEBA 1CERA 4HWKA 5I8ZA 4Q3BA 1ZK1A 3NV9A 1JKIA 3INGA 5B37A 4XB2A 4HBGA 3WGQA 3H4VA 3I83A 3ZWXA 4E12A 3GK3A 3EHEA 2WYVA 3A4VA 3PDJA 4YJFB 1MA0A 1VJ0A 4ZA2A 4KTTE 2DFDA 4CLRA 2P68A 3IC5A 1NFRA 4AJNA 4UUPA 5EQDA 3D3WB 3VH4A 2GGSA 1ZK2A 2X5OA 3H3FA 3S1LA 4IGEA 5G0TA 1H9BA 4F6CA 4WKGA 1LBEA 3O03A 3KLPX 3QY9A 4CM4B 1FJHA 4RPLA 3C8MA 1T1RA 1GYPA 3CMCO 3ZWWA 4MVJH 3EGOA 4IJKA 3I1JA 5JDCA 5F1KA 2WD8A 2YFQA 4L8VA 5L7YA 2J3HA 2A9FA 3GT0A 2GR9A 4HFNA 3K2EA 1ISJA 1GZ4A 4DBVO 3WWYA 5DT9A 2Y66A 5HM8A 4U5QA 1PZEA 5A03A 4IDAA 2V6BA 1TA4A 3RC7A 2BI7A 2GLXA 2EG9A 3QVOA 4UREA 5DULA 1P0CA 2PA3A 3T7CA 3WNVA 1ZMTA 3IQDB 1VSVA 3TSCA 3PJEA 3AM5A 3AFNA 2HMTA 1ISGA 1C1DB 3N58A 4FIZA 3N74A 1SO8A 3HQ4O 5TRTA 4PGFA 3KTDA 3GEMA 2VT2A 3DO5A 4RQUA 1EK6A 1NAHA 3OIDA 3OJ0A 4GLLA 3ZV6A 2X4GA 1EFKA 1HLPA 1DHRA 3QQPA 3WGHA 4Q3AA 1WAMA 4DUPA 1ZBQA 1Z82A 4ND4A 3PZRA 4E5YA 2JAPA 1E7MA 1DC5A 1YQXA 3ITKA 1OBFO 1Z7BA 3TRIA 5COQA 3ZWNA 3M1AA 3ZU2A 4DPLA 1MGOA 1YB5A 3KLMX 3QWHA 4J0EA 3FR7A 2NNLD 4PLHA 1V3VA 3PI7A 1YJQA 2O2YA 3FTPA 3JQDA 3JYNA 1LQTA 3Q2IA 3C24A 4FFNA 4KUHA 9LDTA 4GX1A 2O4CA 3LSYA 2R00A 1MUUA 1MXHA 1ML3A 4GSLA 4OSPA 4RLHA 1M2WA 5EERA 3AWDA 5G4KB 4BO6A 4BV9A 1BXKA 4ND3A 5JLAA 2Q4EA 5CEJA 4W9NA 1NNUA 4N5LA 2RIRA 4BMVA 5K9ZA 3H7AA 1N8KA 1I24A 4IY1A 4O0LA 3MJTA 3V2HA 3LF2A 1U3WA 4D3FA 1EDOA 3PIDA 1GL3A 5L4LA 2PD3A 2EP7A 3B20A 1U8FO 3GHHA 4ALNA 4KTVE 1P1FA 4LRSB 1BXGB 3ETDA 4IDCA 2BFMA 1N7GA 1AN9A 2YV3A 1ZO8A 2I76A 4J7XA 5CPFA 4BNGA 1KVUA 3DMYA 3MWDB 4ZQEA 3NYWA 3ITDA 1MFPA 1N9GA 4WJZA 4Z3DA 3WYCA 5JMPA 4ALJA 4BNYA 4IXTA 4TRNA 3QVTA 1E3WB 4XQ9A 1Q7BA 4IDDA 2Y0CA 4YRBA 3E8XA 3MJSA 2WJPA 3RAJA 3E5MA 1P1IA 1H6AA 1C1XB 3DMTC 1LLQA 3G17A 4FJ2A 4Y8VA 1HDZA 2OGUA 1T26A 3WGYA 4FDAA 5ITVA 1GFSA 3DAFA 2OL4A 2PH5A 3GN1A 4I5DA 3ON5A 2WMDA 2GNAA 3PQDA 4DL9A 3BA1A 1H6CA 4MVJA 1XQ6A 4UEJA 4YT8A 3H9GA 3KUXA 4PN3A 1YL5A 4L4XA 3UOGA 2VHXA 4FBGA 5I9LA 2BFPA 3TZ6A 5AQ1A 3TFOA 2Q50A 3BMNA 3WDSA 4G2NA 5F21A 2HU2A 2I66A 2ZCUA 3GG2A 2I67A 4KUEA 4Q39A 5COBA 4BB6A 3PXXA 4LW8A 3JQ8A 3NGLA 2RH4A 3WFJA 4FR5A 3GNSA 1NWCA 2D3TA 2ZATA 2EJVA 2UYYA 3LYLA 4R9RA 1HTBA 2E6UX 1PGPA 5CAEA 2CDBA 4I9UA 1HE2A 2NU9A 1NPYA 4EEZA 1I3LA 2OUIA 2YY7A 4YBZA 2BELA 2EP5A 1UR5A 2GO1A 4CUJA 3AOEA 1LSJA 4XYGA 3W6UA 1IZ9A 5AOVA 4NJOA 4DXHA 5BR7A 1ENPA 2DBVO 3GVCA 5C7IO 2GN6A 2VYVA 1LDNA 3D7LA 2DU8A 3IUPA 4PLYA 1ONPA 4QECA 1S7CA 2VNSA 5TGDA 2Y1CA 1A4UA 4EW6A 4BKQA 3GC6A 4WEQA 1EUZA 1B26A 4IS2A 4BNZA 4F45A 4LCEA 4YJHB 1AUPA 3MEQA 4GWGA 3DB2A 4IIVA 3RFVA 3CXRA 4W4TA 1FDSA 4MVJG 1XYGA 1NR7A 2QIOA 1E5LA 4WLVA 4CLHA 4NU5A 1Y1PA 3KYCB 1UXIA 2JAHA 1F12A 2CNBA 4MIYA 4R3NA 1YL7A 2OORA 4CMKA 4INAA 4E30A 2H63A 4WLFA 2JFHA 1CRWG 1RYDA 4CLOA 1PSDA 1XQ1A 3MZ0A 2O48X 4NU6A 4BB5A 2EGHA 3QW2A 2DQ4A 2YFHA 4RVUA 3WQQA 2CZCA 4Y9DA 3RKUA 1ZMOA 3ZU3A 1QV7A 4CR6A 9LDBA 2IXBA 2NLOA 2B5WA 5AVOA 4RV9A 2R2GA 2G0TA 4X54A 4HXYA 1PZHA 1DXYA 1NVMB 5TIIA 2YW9A 3JQ6A 4DLBA 2GN9A 3LF1A 3ZNOA 2AA3A 4WUVA 4Z0PA 1BW9A 3S2EA 4XWYA 3AY3A 5CDGA 3WIEA 3BTSA 3CTMA 4AJEA 1B8VA 3D4PA 2VCYA 1Q0HA 1P31A 3DFUA 4J49A 2W4QA 4B8WA 2ZB7A 1XDWA 2NU7A 4OXYA 4YYZA 4R51A 2QX7A 4ESOA 4RPHA 5H82A 3AFMA 3WICA 2RBEA 1DC4A 2HJRA 3TZKA 5IF3A 2Q45A 3HADA 4L73A 4EJ0A 4RVDA 4AJIA 3JD4A 4CQLB 1BRMA 5A4DA 1EUCA 1MLDA 5TSDA 1Y81A 3I4CA 1ARZA 1T2FA 4NR0A 1GQ2A 5J9GA 4IXWA 2X9VA 3ONEA 4BMSA 3KSUA 1A7KA 4U0JA 3JQAD 2Y1GA 2JD2A 1HDRA 4JLWA 2VRBA 3QVXA 1JTVA 4BGUA 5CEFA 2ZYDA 4RGBA 4F46A 3WTCA 5L9AA 5IN4A 3R0IA 1CEQA 1NX6A 4K9DA 3WGTA 2X8LA 3INTA 2AHRA 2I99A 2YZ7A 5L7WA 3K73O 1V35A 3U62A 2FWMX 5KVVA 4G5HA 1VSUA 2GZ1A 3KYDA 5FEUA 2Q1TA 1DPGA 4ZICA 2DBZA 4ALLA 4ZJUA 3QP9A 1U3UA 2B4TO 3FHLA 1H0KA 4GX0A 4P22A 2NVUB 2I65A 2VRCA 3CMMA 1D3AA 1PL6A 1GQYA 1VKNA 2Q3EA 3KSDO 1AHIA 1KEWA 3RC9A 3HHPA 2PKQO 4IDGA 1ENOA 1P1HA 1QXSA 1V8BA 1ULSA 3F4BA 3HN2A 3ZWPA 3Q6IA 3V1TC 2G5CA 4UVEA 4B4OA 1X15A 3DHEA 3VDQA 3HB4X 1EK5A 5CEEA 3DAGA 2QG4A 4WLOA 3ZW8A 4MVJD 4P4NA 3PWKA 4IM7A 2NU8A 4IPTA 3WWZA 2WEKA 1R0KA 2C59A 4R1TA 4J43A 4RF2A 4MOWA 4AICA 2CVZA 2FMUA 4RZHA 3UFXA 3SXPA 3JTMA 3K6JA 4KP7A 4OSOA 1K6IA 5BSFA 3QRWA 3PHLA 5G4LA 1E3LA 1HF3A 2WDZA 4IMPA 4E32A 5IXSA 3GPDG 3OA0A 3BMQA 4NNJA 1DC6A 3RUIA 4BNVA 2Y05A 4PG5A 3FPLA 4YPOA 1QYDA 3VZPA 3RSHA 2OO5A 5FWNA 1E3WA 3BTUA 3RBZA 2C7VA 3RROA 3OJOA 3KV3O 1VJ1A 4WEOA 1R66A 2B69A 1XLTA 1I36A 5I8WA 1HZZA 3L77A 3E6AA 2E37A 2NVBA 2ZQZA 2O3RA 1P0FA 1GPDG 4DC0A 4HY3A 4CM9A 1LX6A 3P2OA 3TN7A 5CFZA 2IDZA 4BO0A 4AJJA 3LT4A 1UDCA 1X1EA 1UH5A 1NFFA 2V6MA 4TKLA 5L51A 1KVSA 4W99A 1OZAA 5A05A 4D3DA 4J7UA 5TX7A 3GR6A 1J49A 1LDEA 4CM8B 1T24A 3F46A 2HMUA 4FFOA 5JAIA 4PG7A 4JP3A 3JD2A 4NFYA 1GQQA 5ICMA 2C5EA 5JS6A 3ZWVA 1B3RA 2OBNA 5CDYA 3CINA 1U3VA 2ZTMA 2CUKA 4QEDA 1U9JA 5DBIA 4TWRA 1QYWA 2IZZA 5TF4A 1Z7EA 2P5UA 3I5MA 4WLEA 3DMTA 4AFNA 1HYHA 2HMWA 3CKYA 2OOSA 1X7HA 1C0IA 1LNQA 3GAFA 4GKVA 4E2ZA 3OJEA 4QXMA 4XGNA 3ZV3A 2EERA 3ETEA 1PJ4A 1PS8A 4WE3A 5L45A 3O8QB 4Y6RA 3ANLA 4J7CA 4CR7A 4TVOA 4NFSA 4DC1A 3ZU4A 3BTVA 1N7HA 3IAHA 1EQUA 3JYQA 4LISA 3JQBC 4EBFA 3RU7A 3VH3A 2BGLA 3AI3A 5BNFA 1WVGA 5JYAA 1Y5MA 1E3EA 3CSDA 4CV3A 4YAKA 4Q3EA 3FWNA 4IZHA 4AJ2A 2C07A 3GNQA 1GEEA 1VL6A 2W2KA 3H9QA 1Q0LA 3VC7A 4JJIA 1F8GA 4NK5A 3UF0A 1UP6A 4HFJA 2YUTA 4ND1A 1S6YA 2Q49A 1E6EA 1M6HA 1UDBA 1P74A 4D42A 4QT0A 1GPJA 1TT7A 2WE8A 1PJQA 2JCVA 4ZQBA 4HX5A 2VUSA 1VJTA 3KYCA 1D8AA 1DFHA 1E7WA 4B3IA 4DREA 4XIYA 1L7EA 3LQFA 4KQXA 5GZ6A 3D5QA 2Y0DA 3I9OA 2AXQA 4LSMA 3DOJA 5JFOA 3I9NA 3AI2A 4Z3KA 4GLOA 4GKBA 1BDBA 2PZMA 1HLDA 5L40A 2P5YA 3OQ1A 1GV0A 2BLLA 4FFRA 3KETA 4OHUA 4O5OA 2EHDA 4UULA 2O7SA 2IYOA 4H15A 2A94A 4MKXA 3VKUA 1I01A 3OFSA 3TF5A 1NTOA 4AG3A 5KTKA 3NKLA 4EUHA 5MDHA 4EEXA 3ZHYA 4Z9YA 2D59A 3L4BA 4R3WA 1E92A 1YQDA 4JN6B 3L6DA 2DAPA 3JQFC 1EFLA 1E7RA 4HADA 2FOIA 3EVTA 1E7QA 3PTZA 4IQGA 3RWBA 1QV6A 4XR4A 1UP7A 1WDKA 3OA2A 4L0QA 3WLEA 4J16A 4JBIA 2PH3A 3C85A 3EAGA 1VI2A 4FS3A 5THQA 5JAZA 4XR9A 1DJNA 1GUFA 3ZGYA 4XQEA 3K9QO 2P4QA 1VLLA 1ZXBA 2XXJA 2NTNA 3G1UA 3GAZA 4J3FA 3BMCA 4UUOA 1HT0A 4BO4A 3AOGA 1XHLA 4XIJA 1XIVA 3IUSA 4CMHA 1E7YA 2VWGA 1U2GA 3H9UA 1B2LA 1ISIA 3GUYA 1B8PA 4DBZA 3PVZA 3ASUA 3BYZA 4C4OA 1P3DA 2VZ8A 3OM9A 4UVHA 1I33A 3ZU5A 1YRLA 3BHIA 4RZIA 1K6JA 1IHXA 2HK7A 2DBQA 1I3KA 4YTEA 4YJDA 3K2BA 3FNFA 3PHHA 5IDWA 4DIBA 3WGGA 3S55A 3AUTA 3UGKA 4RVFA 2NV6A 2PKRA 1VE9A 1GCUA 1DIAA 2NVUA 3JQGA 1P1JA 1ADGA 1K6XA 3ZNQA 1Q7GA 4JXKA 3VHRA 5CG1A 1UXJA 2ZJ1A 4IQ0A 1TB4A 1U7TA 1E0DA 4OH1A 1SNYA 3CUKA 1M66A 2XXBA 2ZYAA 2BKAA 2RH8A 1I30A 1PTJA 2BRUA 2BFOA 2Z95A 2YDXA 3JV7A 3U49A 4TRJA 3V5NA 3WBBA 3VZQA 3QV1A 3K92A 2EWMA 2DTXA 4IJVA 5T6BA 5EJ2A 2Q1SA 3OHSX 1JA9A 4LMPA 4YAEA 2O50A 4E33A 3PGXA 1RJWA 4E31A 4EI2A 4J1TA 3JQEA 1ISHA 1SPXA 3JD0A 5JPIA 3B1KA 1GU7A 4ZU3A 4IMRA 2EGGA 1MG0A 3E9NA 3L0DA 1DRVA 3DZGA 1YOVB 3D4OA 5G0SA 4ALIA 5HS4A 2ET6A 5FI5A
chains in the Genus database with same CATH superfamily
1OPRA 5EJFA 1L4MA 3PEEA 1E2KA 4K3UA 4MI1A 1G8SA 1WXIA 3UMSA 5JDIC 4HKTA 4RESA 3SYLA 1DIOB 4PG8A 1S9DA 3RUCA 4KE9A 1DRKA 3F6YA 2XTZA 3WXBA 4WK4B 3QBEA 5JC1A 1U1EA 2VDPB 4OF4A 4QUJA 2SNIE 4YYEA 3K15A 2INGX 4X45A 1PZGA 4UE2A 1E59A 1ILEA 1E3MA 1NR5A 1W5TA 2QUAA 3OUTA 1FXUA 5CH3A 1Q20A 1ZZGA 1VRCA 3MD0A 1KDTA 1A50B 3MJCA 3CTPA 3QNUA 4EHHA 3LD9A 4JENA 3AVQA 2Z4TA 1D4FA 1HRKA 1NRWA 3E3NA 2G28A 4RHXA 4A2CA 2IIQA 3L0BA 4QTZA 2DM6A 5IZ4A 5KYUA 3EY4A 3HEBA 1YGYA 4NI5A 4Y2PA 4NH0A 1FFGA 2CFOA 3OY2A 1ZICA 1O96A 1VL1A 3P9NA 1QTRA 1YCFA 2QORA 2P9GA 3DAHA 4JX9A 4RTNA 1ECBA 1H2FA 1DJLA 2J41A 1E0AA 3E0QA 3DV0A 1F5NA 1EINA 3AHHA 5BUZA 2O3UA 1LBIA 2Z98A 1GJRA 4GZMA 3H2SA 2O7QA 5T4HA 5FLYA 2FFAA 2C0CA 1V4BA 3UUEA 2WIDA 4D8TA 4FW8A 4BU1A 1KRWA 2XA1A 3SZ3A 1GRCA 1K5GA 3JAKB 2D2IA 4Z5XA 4I8DA 2W43A 2ZS7A 4QXRA 4BRUA 4G23A 4P8RA 1PR3A 2ZR0A 1MPTA 4KFRA 2JF0A 3VBCA 5C53B 1H93A 3FJYA 3GRVA 1CZHA 3RVJA 5HF9A 3AC0A 3T3MB 3HB7A 3B82A 3DWGA 5NULA 1Q3KA 3V2IA 3H18A 5G3YA 3TPFA 3ILYA 1MO3A 1TZKA 2C42A 3QX3A 3QMWA 1KJQA 1THZA 3G2JA 3DZ5B 4JLNA 2X2PA 4M0MA 2JIOA 4F12A 1J9GA 5BNWA 3HJUA 1OASA 5JC8A 3BWVA 4LHZA 4V0SA 2WJAA 5D85A 4MP8A 1I4TD 3TV1A 5F5LA 5LU9A 4QWWA 1JLHA 5FUBA 3VV3A 1YQGA 1FLAA 4E5KA 2QTMA 2HWYA 4D4HA 4P98A 1H94A 2P79A 2AKAB 3GAAA 5JYEA 1LGYA 4HDCA 3I62A 3AM4A 2W37A 2XEXA 2D5AA 1Z6ZA 1XCBA 2QPAA 2ZQ5A 4GD3Q 4PTLA 1VYVA 3OJFA 5AVUA 5JW6A 1GFZA 2HLDA 3LYHA 3UJAA 3HKBB 4IUBS 1J21A 4QAJA 3GLQA 4FYIA 2F9MA 1XZBA 3HZRA 1ESNA 3A1NA 5CRIA 4BDTA 5BORA 2J59A 3NHJA 3DA8A 4FGWA 1X77A 4LXYA 3IBYA 3NRBA 3OPYI 3O82A 4YRPA 2G0NA 5E7IA 5J4HA 4ILEA 3RFTA 2H2AA 5AJZA 1YONA 1IDOA 2NXEA 1B0ZA 3D9QX 2FW7A 3H9CA 4GVXA 4RSHA 5K8LA 4U2DA 2DPYA 3H0WB 2AT1A 3EP9B 1Z4LA 2C4MA 3LUJA 2X7JA 1H69A 3S5UA 3UWKA 5CLIA 1Y48E 2HCBA 3E2PA 2E18A 1XD9A 2FLVA 1IG0A 4IZIA 2P2SA 1KERA 1O54A 1YZNA 2XA2A 2ZWPA 3BAZA 2NXWA 3D6HA 4R9SA 1LZLA 4RBNA 3FMIA 3PP8A 3DBVO 1T9CA 1OLSA 3CF2A 3UMGA 2BEWA 3BJIC 5C9ZA 3DE5X 5E6SB 2VDLB 1XJ5A 3W4KA 3MCAA 4Z1OA 3KR0A 1FRNA 3SJUA 1QSGA 1EQ2A 3RYHA 3AR5A 1XF9A 5BSWA 4P3PA 2DY1A 1ESMA 4YJGB 3U13A 2V3CC 1XV5A 3S2FA 1KO4A 4ACBA 1JVNA 4N5IX 3V4FA 3JQAA 5F51A 3NWEA 3K6KA 2OA0A 1VPVA 4LQCA 4ARBA 3AEKA 5B7PA 4B44A 4R8RA 2JIZD 2OZLB 2P69A 3D8RA 4Y2HA 1KIMA 4GL2A 3SAJA 3VHXA 1DXQA 8AT1A 4TV9A 4AZVA 4R05A 3L4SO 3FSJX 1RBZA 5AJVB 5ALJA 1KPGA 3RW9A 4PWYA 1WB9A 5JO9A 2FEAA 2IOFA 3TKLA 1QRDA 1VMDA 3LO8A 1TLTA 2OB1A 4FFSA 5KNBA 4TKVB 3SFTA 4C0BA 5DF1A 3DT8A 4HXEB 3DZCA 5FPQA 3U39A 1IJFA 3P0HA 1SULA 5C37A 4JC0A 3GCWA 3UB2A 3WWZA 1X7WA 3PC2A 4M86A 3M4YA 4MJLA 4CIBA 4FOTA 3ZJTA 3HFGA 1YKFA 3HY6A 1NTRA 1TKAA 4C30A 2A5GA 4FT4A 3BCSA 1DBVO 3H1PA 2VBGA 3MAJA 4RLSA 3KSMA 3TBKA 3UYKA 3VZCA 3K5PA 1EDEA 1BEZA 4YMTA 2XR1A 4MYCA 4EGQA 1FZQA 1EGVB 1FP4A 3AR8A 1FSFA 5BN5B 3K9FC 1X7YB 4NZZA 1SB8A 1HE1C 1RMQA 4PHGA 4HNHA 4Y2QA 3ZZ0A 1ZH8A 2XKJE 4RXTA 3HU5A 4HN4B 5KQSA 3ENNA 4CRWB 1U2SA 4ISCA 3ZKAA 3IKTA 2HQOA 4HT3B 3IBSA 3UMFA 3PNOA 2BMJA 1U7HA 4TV8F 5FOUA 5THKA 1OLUB 5FADA 1DELA 2OG2A 4EW1A 4IZ6A 3ELDA 5FWXB 2DPHA 4LFAB 5J4KA 3A70A 4HFRA 4AXXA 2XOKD 2H2GA 3OFND 1HFWA 3PX3A 3H4TA 3PGLA 4IV8A 2HBRA 2QRHA 2VDMB 3CRMA 4J90A 2G9ZA 1J1ZA 2GCNA 2Q5LA 6NULA 2WA2A 1QNLA 2PAFA 1Z07A 3BMOB 3SQMA 4KQ6A 3MCZA 5EYPA 2QYSA 1M34B 1OYOA 2NX2A 1J33A 2NTVA 2OT3B 2QB5A 3QWAA 4MYHA 5B1HA 4BVBA 5HF8A 1C30B 1JDNA 5L3SB 4XUEA 1PL8A 1RPZA 1ZUNA 2NGRA 1VIVA 4EB0A 2O23A 2WQZA 5EQTA 5SV2A 3S8MA 5C8VA 5LVAA 3NTRA 1VLHA 2FSIA 3KKLA 4E46A 1JG6A 3ZDBA 1YHNA 2FX2A 4CKCB 1LTKA 3OCJA 3DEIA 1I7MB 1JLKA 1UKZA 1PNVA 1P7YA 2VPTA 1Z8HA 1WVMA 1Y5LA 4PRYA 4WUTA 1FFXB 4D3SA 2PKEA 1XYYA 1DWOA 2H17A 1O9GA 5CNIA 4JUFA 3ZWBA 3DULA 5A9SB 2NU6B 2PYIA 4U2EA 4PZCA 3RIYA 4ENSA 1LBQA 2QV0A 4FCCA 1Y3BE 4AJ4A 1KFKB 1XQXA 2RSLA 4LZWA 3WJ1A 4F4HA 3LUDA 3QHAA 4FS8A 4MPPA 3EPJA 1SWVA 1NN1A 4OOEA 4Q9KA 4A5OA 1A0OA 3O4GA 3PFNA 3TLZA 5U1PA 4BATA 2Z1NA 1Y9AA 5K7SA 3NOOA 3EZNA 2E4WA 1NVVQ 1XDBA 2KPOA 3I53A 3OEED 3S4YA 3PQ5A 1A4IA 4R8LA 3MT7A 3QKRA 4F96A 4RH3A 1J0DA 5B1DA 5CFRA 4D4MA 4OKIA 1ZIYA 3PVSA 5KQRA 3RC3A 2V6GA 3LX5A 1CF9A 4OIMA 2QZJA 2QTWB 2BDEA 4KK3A 2XBMA 1N4AA 5EUCA 2NO1A 2PFKA 4UXHA 5CLQA 2JH3A 4A8HA 3WQRA 3CHYA 3RQSA 1T91A 2IHBA 3K1TA 4P84A 2WJ3A 4AK1A 4JI2B 2HI0A 4FX2A 2AYZA 5AHRA 5DBHX 1R6UA 4WCFC 3V8EA 2N1BA 4URZR 1HX7A 3PC7A 4LXIA 1CQZA 1XOIA 1XMVA 3HBNA 3I1IA 4UM5A 2RG7A 1M6VA 3QEKA 3A1WA 2MSKA 3T52A 5DTRA 3ZWQA 3BC1A 2GXUA 5LQDA 1XNRB 1K3FA 2ZSIA 2ZUUA 3CRNA 4FDLA 3H5LA 3D6MA 2X5XA 2HRRA 4RVNA 1QGED 3ANMA 1T2UA 1XLUA 1YRQA 1KVRA 2J9XB 2XWSA 4R5MA 1HDOA 2HDHA 3G9ZA 4BGIA 4JLSA 4D9KA 1BD3A 1QYVA 2H0QA 2I3ZA 3PQ8A 4BCBA 2GRJA 3IEKA 4FZRA 3EEOA 4I08A 5AKZA 1WG8A 2NT4A 2F2TA 3EVCA 2FN7A 3FSRA 3HDYA 3MAGA 4X8HA 1EVZA 3UAGA 3A6GA 4HVLA 3MJEA 2ZRNA 1KVTA 1JLMA 4GZLA 1H42A 1YCHA 2AR9A 4JJFA 5JZBA 3QKUA 2XMDA 1K4YA 4MS4A 4I5IA 1O6BA 3CSUA 4WCFB 3JASB 4CM1A 3TQOA 5B4TA 1XVLA 3AY7A 4R0VA 1U65A 4A8TA 3NDIA 3PR3A 1A2QA 2R2AA 3V8MA 3B6IA 1BCSB 2UYQA 4HBZA 4ERXA 3HSSA 2REQA 5JYFA 3EIUA 3VDRA 1HDYA 2W6QA 2XVMA 4L28A 2HJSA 1IQRA 3ME5A 4YR9A 2FLWA 1MABA 4ERNA 4PAMA 1FNNA 3FCUB 1X70A 1ONBA 4NBVA 4WCVA 4WLUA 1Y33E 4JP8A 3A26A 4KBFA 2JCXA 4C0KA 2V0GA 3MRVA 1C1DA 1W2WB 4E4YA 3OSZA 1R8YA 1RC0A 2ISQA 3KD3A 5GY7A 5FBLB 2QTBA 3LQ4A 4BMCA 4DGSA 3OUZA 4AIRA 1D2RA 3A6DA 2XGSA 1RI4A 1GTL1 3KAKA 1LTQA 1C7FA 1NASA 1PDOA 4II3A 3OIGA 4RD2A 3ZE1B 3ZE7A 5KOJB 2YHIB 2VYND 1DV1A 2RHTA 1YF3A 1IAVA 4KMSA 4TWJA 3PXBA 4XARA 1TZ2A 4LKRA 3NOQA 4HDSA 5FWDA 2CHGA 2ZB8A 1U90A 2Q0SA 3RBXA 5B4UA 5JNSA 3E22B 1IE3A 2D8MA 4M9SA 4PYNA 4DLLA 4EG7A 1DP4A 1OYYA 2GESA 3B6ZA 4W9MC 4BOYA 4JQSA 1XJ0A 3WO0A 3KCQA 5D7BA 4FYKA 2O8CA 4JK3A 4P53A 2B94A 3HV0A 2V54A 4MV4A 1OFVA 4L95C 3S1AA 2CC2A 2X1HA 1OFIA 3VVCA 4L22A 2H1LA 2PQMA 2QBYB 1Z4IA 3I8XA 8MHTA 1N2SA 4FJ0A 5HMMA 3IHWA 2GJKA 3HU2A 3USES 4HRVA 3C4VA 5FOTA 1G2IA 4HQRA 4XPIA 5HRCA 3P2YA 3R7AA 2G6TA 3PLNA 4QOEA 1OX4A 5EWMB 2GAJA 2H1OA 2FPOA 3MWKA 4HLQB 4L5JA 1SAYA 4TQAA 4HDRA 2REBA 3UGQA 1PZNA 3QWIA 2Z1MA 2FW8A 2VF4X 1CVIA 1S5PA 2XNSA 1RCUA 1KYTA 1PVDA 2RARA 2PIAA 3NNSA 4LOJA 2Q41A 1H4QA 1BDJA 5E4FA 7MDHA 4BMZA 4EAQA 3MTBA 4J0JA 2A4KA 3B9BA 3AL2A 3PUXA 1U0EA 3EJ6A 4L9SA 1RZVA 5BWOA 4OQMA 4M53A 4QA9A 4QXPA 5K0GA 3BA6A 4KI0A 4BKUA 4D2IA 1BDIA 3KUCA 1ADFA 1P61B 3Q5GA 1U0LA 5AW9A 2YVLA 1MRZA 1QO7A 3HUTA 4INZA 5CJPA 1JHDA 1FFDA 1V1RA 3D2AA 2HGSA 2E0IA 2GERA 3BE5A 1K7XB 3M3DA 5J1TB 3H1FA 2VHWA 5A7FA 2Q7DA 5CTAA 2HQ1A 4PC2A 4F56A 3PEFA 4TLCA 4P7FA 4PRKA 4MA4A 2BGUA 1OOEA 3F8WA 5BPHA 3RHFA 1M7GA 5FQNA 5KNDH 3VC7A 4FDVA 1Z2DA 3DDHA 2DWOA 1WZEA 2P78A 1U7XA 3FUTA 3HVKA 1ZNYA 3BRSA 2GPJA 4J0CA 3VTZA 1C14A 3ILXA 1Q0QA 3JR7A 4BKPA 1N0IA 1TCBA 1YZHA 2WUFA 4DLYA 2D54A 2PGOA 1WW8A 6Q21A 3CE6A 3K0KA 3MFQA 3IOMA 4L4ZA 5JWOA 3HJAA 5DB4A 2E2WA 1RAFA 1KY4A 3CZAA 3MJRA 3D64A 1BE1A 1CS4C 1TKBA 3FYUB 1Q14A 3M5CA 2OKCA 2E55A 3M9WA 4K6OA 4L76A 3PQCA 4CMCA 4ICIA 1CB0A 4URFA 4ZI7B 1K7YA 2Q0QA 1VGRA 4K6CA 5H68A 3NTQA 5CIWA 1F5SA 1CFJA 3TZQA 2PLNA 2J0VA 3LS2A 1QOQB 4MEJA 1JR2A 2H51A 1X2BA 3GJYA 1F2UB 4HVAA 1TW3A 1RHQA 1YKGA 2VLIA 1KMQA 2JCSA 1P9OA 2F64A 1HORA 2QUKA 3ODGA 3OEWA 1DEAA 4JEUA 3PX2A 1FMFA 4MRAA 2V1UA 1O9BA 1KH3A 3ZV5A 3ZYCA 2C4VA 1AKWA 1JQEA 1PZFA 1QMPA 2Z5VA 4PCVA 4QNRA 1GV1A 1SUPA 2W2NA 4UMEA 4NK4A 5KSOA 3UJ6A 3CKKA 3GRZA 4B4UA 4K3VA 1P39A 3G23A 3LLVA 4MIEA 1ID1A 1T2DA 1TK3A 1Y7TA 1YBVA 3QPCA 4TWZA 3R6LA 4FFLA 5FFFA 3SC6A 4CFYA 3RYIB 3D8HA 1GNVA 1QPBA 2JATA 2V9ZA 5K3OA 1E3IA 2R7AA 2XMQA 1E3SA 2XAUA 3LRTA 1Z56C 4IX1A 3EDOA 3F96A 4TMTA 1CUDA 3T94A 3ZLBA 3PBKA 1OV4A 1XXLA 3E1KA 5HQ3B 1H05A 1UMDB 1XCOA 1Z5PA 3A6FA 1E4VA 1BAPA 1FSSA 3QWBA 1JB1A 2R87A 3L6OO 2CGEA 4G4JA 5AW4A 4Z4GA 2EBHX 1DFIA 3FHCB 3HH8A 2HB6A 1OVMA 1RYYA 4KWEA 7ADHA 4LZAA 2YHUA 1ITZA 2QPOA 1JIQA 2ZIGA 3LCMA 1TVMA 2HA3A 4M0DA 4LVCA 1QGZA 4HAOA 4AJLA 4RDXA 5FNVA 4YMIA 2FSHA 2ZWAA 1WULS 1CJTC 3MSCA 4CLEA 2VHZA 2PLAA 2QN9A 4FB4A 1J8VA 4MYDA 1JR4A 4K88A 1KIAA 2I3BA 2DR0A 3MWYW 3FN4A 4MA5A 1LPSA 1LK5A 1Z5VA 2FN9A 3AILA 1V5GA 1QMGA 1PGQA 1OH5A 2BMAA 2QD3A 2WKQA 4YXWA 3L1KA 1IY8A 2GM3A 2XB2A 2CN1A 3ESXA 4G1MB 1PX0A 3UAWA 4F3YA 1DO0A 2BPOA 3NEPX 5EN4A 5K3SA 3ZH9B 4GH5A 1E2MA 1J00A 1YE5A 1ZN8A 3H2ZA 5KWVA 3FBGA 1V9LA 1WZ2A 4OFXA 3ZD8A 4XYEA 2VBIA 3DCIA 2M6LA 3WA6A 4DTCA 3WKCA 1MVOA 3IT1A 3V7WA 3L8HA 2FTKE 1MB4A 1PR1A 4NL4H 1RZUA 2A1UA 2LNDA 2X23A 1JENB 5EWLA 4CCSA 4MYUA 3C3AA 2I80A 4W5WA 2NYAA 3O9MA 1RBQA 4S1VA 2DVMA 4D74A 5G1OA 4WXEA 4M87A 2ESRA 2W6JA 1T9HA 1N75A 2EJUA 4XTRA 4YGXB 1IXYA 1CKEA 1T0PA 1WHTB 4LJSA 1E9CA 5EHIA 1AZSC 1QHEA 2H18A 4D97A 4DT1A 5A9RA 3GJ6A 4YCMA 1ZM3A 2IPLA 1EVKA 4YO7A 5EC8A 3U40A 3ZHTA 3Q1LA 1INLA 4D7AA 1PR4A 3ESDA 1VXRA 4DXDA 2WTMA 1ADBA 3I52A 1XKLA 2VJOA 4WOJA 2V96A 3A1VA 2VUHB 4E5UA 1PZMA 2LKDA 1Q2XA 3OEHA 4RK7A 3JY6A 4L7VA 2R85A 3I76A 4IDBA 4BMNA 3EISA 4F6RA 1GTRA 1NKSA 1DBPA 2JW5A 1VPLA 2FRXA 1PU2A 3BREA 3N05A 3HYNA 1RWKA 3TLXA 3BIWA 3F6BX 4MICA 5EQFA 3U44A 5DGDA 3DFKA 4IIUA 1DC8A 1QWOA 3M4JA 2O7RA 2XB4A 1MN6A 1SA0B 1Z8FA 3O83A 4FQ5A 5BYKA 3WJ7A 3ZG6A 5KJFA 3A2KA 1C8VB 5EMHA 1RQ7A 4X00A 3NATA 4I9HA 1GZ6A 1QH1B 1TTHA 4WHMA 5FUQA 1I3NA 3KXDA 4A03A 2WTEA 2W2QA 3P5SA 3G82C 2OCIA 3AG5A 5JASA 1ZC3A 1MNAA 1WS6A 3QUSA 1C5KA 2BV3A 2GPAA 2EX0A 4FP9A 4RSGA 4DA9A 2HIMA 3EGXA 4G37A 3CZCA 1ISMA 2IYSA 2DKFA 3UJ7A 1DTSA 5AHWA 2V0NA 2W93A 1CY4A 5ALYA 5LZ9A 1WF3A 4X20B 3WRXC 1YMUA 1F20A 2QYTA 5FCDA 2OM6A 5F7JA 4ZO8A 1I6WA 1GAXA 1JJFA 4TMZA 1M1NB 2EF0A 2WJWA 4UW9A 3NX4A 1XLVA 1RRGA 1E1LA 3KOUA 3JRXA 1IHYA 3NIDB 4JKYA 2R4UA 1GNSA 3TIVA 1LB1B 3BB1A 5EJMA 3U5TA 1VE5A 4PZPA 4TTAA 3TX2A 1MGPA 2CBGA 2YVQA 1PUIA 4O29A 1TNDA 4H16A 2HHJA 3GBPA 4J2HA 5ES3A 2LCFA 3WLQA 4UNPA 5ICEA 4V02A 2WU1A 4YQYA 4F97A 3ZW7A 3AMVA 2XMSA 4NBLA 4P80A 4Y1EA 2EARA 3DHNA 1ZL2A 3O8OB 4HOYA 4ZOLB 3TEMA 4RJTA 2O59A 2GTIA 1ZQ9A 3L7OA 5LA6A 2RH9B 5JAUA 1QP8A 1E99A 4LE0A 4GP6A 1VSBA 2OG1A 1J9EA 4G07A 3JPWA 4OSEA 2FF5A 1DIRA 3TW4A 2GA8A 3T3NA 1DTWA 1HYEA 2HU5A 4ZT5A 4CR8A 1YFKA 3ID6C 4A2WA 2ZYHA 3LX8A 2YFKA 1V6SA 4X3OA 3MTGA 1N0UA 3CLSD 1FY2A 3DZ8A 3K9BA 2G08A 4LVUA 4M8NE 4X44A 3R6DA 3MGKA 3TECE 5GGYA 3ABIA 1R9MA 1JEJA 2Q6VA 3EXIA 3RO7A 2BZGA 4DQUA 4S04A 2UUAB 4MV0A 3RAGA 1DIGA 5BSTA 2CFTA 1E2DA 1YIOA 3NB0A 2VDWA 2JVKA 4P7GA 1R0CA 2X77A 3H84A 5TGTA 1N1EA 5TPZD 1Z12A 1PEAA 4N3GA 1ZJYA 3SR0A 1W5FA 4X63A 4CKWA 5KOHB 4EYGA 1GU0A 2Q3HA 1ULHA 3RSZA 3H5NA 2H2HA 3DTNA 4H3HB 5KCZA 3N5KA 5EZQA 4S05A 1Z6AA 5KKAA 1F0YA 3SVTA 5TVKA 1HA3A 3G9QA 3KKZA 4G0XA 4P4GA 1KI7A 1RJDA 4PNHA 4JIGA 1VB3A 5A5GA 2IYWA 4RS3A 4RL4A 3IO5A 5I4CA 1AZTA 1RJ9B 2Q1WA 1AO3A 4G5SA 5FI3A 4RJIA 3WOHA 4DIMA 1JJBA 5ADVA 2RONA 5JH7B 4Y2RA 3V4OA 3WLFA 5C8ZA 3GROA 5ICSA 1CDOA 3IVMA 1TO1E 1NAIA 2O1XA 4E21A 4TLBA 1OBHA 4TWAA 4TM7A 2HSZA 1JXQA 3QXXA 4X84A 4E3ZA 1R0ZA 1SVNA 1KRXA 4DSNA 3T3GA 2DERA 1A3CA 1RYFA 1GZDA 4KWHA 2C54A 3C6KA 5CUQA 3X1JA 1JHYA 4B71A 2IZ1A 3R3VA 4IF4A 1FU4A 2WJ6A 3HGMA 3F1KA 4YASA 2WOJA 3T99A 3HYSA 4PC1A 2MIIA 2H0RA 1PGOA 4KJXA 3TSZA 4WN3A 3LDAA 1PBNA 3TBHA 3EODA 3CYFA 4BO1A 1BW9B 2P90A 3PQ6A 2FAXA 2YXLA 4PSAA 1NVXQ 2FR0A 3WE7A 4Y2JA 1TEVA 8ABPA 4A0FA 4FNOA 4MKHA 4HMPA 5H8WA 1V5WA 1X39A 3RS4A 2H4YA 1R4MB 2CD9A 2OCKA 3TL6A 4B3GA 1ICEA 3LU1A 3O4IA 3KEQA 3OO1A 2IYLD 4AYXA 1H5NA 1GLNA 1G41A 2RAVA 4OATA 4DR1B 3I30X 3PRJA 2QU7A 5EZYA 2GYYA 3KHTA 1JFLA 4QYWA 3DTVD 1V0JA 2NTJA 3E5RA 3HL0A 3IBGA 5DM4A 4I50B 4YS6A 2ZUSA 1DGQA 2EQ5A 1ZVKA 1QOPB 3DONA 3Q8KA 3DQPA 1EUCB 2FPRA 4N54A 2J5KA 4GBJA 3HB1A 1QIHA 2AFHB 3ORFA 5KNDD 4YRNA 1ENZA 1PVVA 4TZTA 4XD7A 3WY9A 2AGVA 2QUZA 2G5PA 4LC9A 2A7XA 2H54A 4OXRA 2LCIA 3U3JA 4AMYA 1QYXA 1G3UA 2WF8A 2AV6A 4NSNA 5DYIA 3B51X 4JBXA 1YNSA 4N3CA 2XPCA 2XT6A 5A7GA 3LUFA 4D4KA 4MPDA 4C1BA 4F8EA 5LUBA 2GZHA 5IKXA 1PWYE 3B3AA 5LLSA 1ACLA 5A4IS 2BFAA 2PFGA 1SKMA 2BKUA 2HO4A 2QGNA 4JWKA 1CVLA 1GNLA 5IJ9A 4UHCA 4A10A 4EY8A 5JD5A 1WXFA 4P3YA 2TMGA 4DQKA 3I01M 4OB8A 1MV5A 3AB3A 3IKMB 2C9YA 3NFRA 1BG6A 2PRZA 2Q6OA 5DCLA 3VZBA 2UUPA 2H5IA 3RJ5A 2EZ9A 5KHOC 4BL5A 4M0CA 4K6KA 4Q1DA 4Z2YA 3SKYA 2QV7A 1LRLA 1KDRA 1R9JA 3Q4GA 1Z4QA 3ZWAA 3X1DA 4MI6A 1PIWA 1C7EA 4YCDA 4EGCB 3QE4A 1E9SA 1TTQB 1AZWA 3PYXA 1T43A 2EW8A 3QVUA 4XLLA 5T3YA 4PU0A 3OZVA 1IZ8A 4CKYA 1EUYA 1H0SA 1E9RA 3ZBTA 3GGJA 4LRQA 1DKOA 4BZPA 1XQVA 2CKMA 1CEEA 4CEHB 3DBRA 1EUQA 3F98A 4D6YA 1T4CA 4JYAB 3VR1A 4ZMRA 1M1ZA 3O1JC 5DX1A 5IABA 5JAMA 2JCGA 1WSBA 5T67A 3TRFA 5CYFA 5TPWB 1K7FB 1DC3A 1U8TA 1XLTC 3EWAA 5AK3A 4B17A 5F5NA 5DN6D 4RPCA 5DDIP 4F3CA 4PAOA 2YASA 4MHOA 3PNPA 4OMFG 3JQFA 1YDMA 3IERA 1UF9A 3MVEA 2D0IA 1IM8A 1G55A 3FCAA 3I8OA 3W3AA 5EP2A 3SHTA 1AE1A 4Y9TA 5BURA 2NO4A 1R4NA 1HE3A 5KYNA 4NQZA 3RJTA 4QVKA 4TQGA 4CODB 3SBXA 3GLHE 5AKGA 4L9RA 3SF8B 3E0XA 3EPRA 3OQPA 3GUVA 3FSEA 1P2SA 2PLRA 3NANA 4BIMA 5ELLA 4DMFA 3ROMA 1F06A 2W2XA 2VQSA 2FPKA 2OV1A 2VF5X 2X2OA 2QUJA 5DOZA 3H8SA 3UJHA 3LQRA 2G76A 2VTEA 3AIOA 4TZ6A 1EJ0A 1P5JA 5IYZA 1W2GA 5LDHA 1OBOA 4QAQA 4YRCA 2DT8A 4IHQA 3EGWA 1V71A 4BMPB 2QX8A 1C0KA 2BSAA 5IN5A 4RU1A 3FA2A 1MO6A 2PUAA 4ZQHA 4AM8A 5GJWC 4OKSA 1NV8A 1YKSA 1E0SA 5DYYA 4RCVA 3HLKA 3U1VA 2R47A 3ZDCA 4EVRA 1WMEA 2X58A 3H87A 4IDHA 4RQBA 3ZKWA 1NQAO 2CDRA 2FI1A 2N75A 3BJEA 1Q6ZA 4CL8A 2C9BA 1TUIA 1P8JA 5F64A 5IDXA 1TO6A 2HCFA 4F5YA 2ZUFA 4P3KA 4EB3A 2OVFA 2CDCA 2RJOA 2Z9DA 4MB0A 2XCIA 1LW7A 2DCUA 4ZAXA 1E2QA 1NI4B 5KYVA 3ZI4A 1RWPA 2C84A 1P8AA 2O2GA 4BQSA 2VSYA 3I9KA 3OQJA 1QRAA 2ZRMA 3W1VA 1AHHA 2ZGVA 3DJFA 1ZN7A 4Q7JB 1IIRA 1TK2A 4CMJA 4BEJA 2CKDA 2GZMA 1OTXA 2IYQA 2H5JA 3O4HA 3V7NA 2J3DA 4JYZA 4LDPA 5HZKA 4D0RA 3TIIA 1GCOA 4D6XA 3ESQA 4QDOA 2RGBA 2OZEA 2P3OA 3PPIA 2P9CA 1QCZA 4QUBA 2ERYA 2XD9A 3LOUA 4FOOA 1HMPA 1NSYA 1F2TA 2CMFA 5B2EA 1PYOA 4QNNA 1Z74A 2JFVA 3UB4A 3EOAI 4B35A 4Q9LA 2BEUB 2F43A 1SRRA 3GW8A 4INPA 2BUAA 3HJHA 1N6LA 4F6LA 1C9MA 1A8SA 1NURA 1WNFA 3A06A 2IPAB 1VBNA 5AM4A 1D09A 2FSPA 3A14A 3EMDA 4TMFA 4IW3B 4YQEA 1SELA 3KSZO 4Z4EA 1IWBB 4E2YA 4BUZA 4IP0A 4FEGA 5E0KB 3VFDA 2R0QC 3ROKA 3W5BA 1EBBA 4B73A 3C0KA 3IBFA 4JLVA 3W6ZA 1VL0A 2O3QA 4UBKA 1G8GA 2G3YA 1J2YA 3A6EA 4H4EA 1D7AA 3KKOA 4JC5A 4MVJI 1QKJA 4JA2A 2WPDD 3RUEA 3JVDA 3O74A 3P9PA 3L4BC 4Y1RB 3CG4A 4AP6A 4L4RA 1NQTA 1KR5A 1Z29A 4IVNA 2QNIA 3WQHA 4EG8A 3D5TA 3E9QA 3L6CA 1EB9A 4CG1A 1NNI1 1UKAA 4QDTA 3TZCA 1T1JA 3V2UA 1YB4A 4CQMA 1SHJA 2F59A 2OC9A 3L5OA 1I0ZA 1QE5A 4WECA 4BASA 3GG9A 4J0FA 2NMVA 4M21A 5IDQA 4MR8A 2YBDA 4IKEA 4OUDA 2J6CA 1Y1RA 3VR0A 4I5GA 2Z08A 3C74A 4LPKA 4C0XA 4D9CA 3GLFA 1ENYA 4KOAA 3AV0B 2OP0A 4R8KA 4QG7A 3L0CA 3WK8A 3QJGA 3ZHBA 2IH2A 3FGNA 3IMFA 4QPCA 2I1WA 5IFKA 1ABFA 4FE4A 2DQYA 5KVCA 3KVYA 4R3UC 4OU5A 3DW3X 2O3SA 1FE8A 4PE5B 1T9GR 1US8B 1OILA 2V98A 5GONF 1QZTA 4NPAA 4CIDA 4M9CA 4HDMA 4H31A 5EJ6A 1P18A 3N8GA 2PLFA 1DLIA 3NUGA 1R37A 2OAP1 3SBEA 4MINA 2XX3A 5IXYA 2QNRA 4EUEA 1N5RA 5DLDA 2NUAA 1EZ1A 4AJHA 5KTNA 2Z6QA 4DMCA 3GJ3A 3NT5A 3MMXA 3K0FA 1IY9A 5AM5A 5BWMA 3STYA 1T5LA 1T3ZA 1EPUA 3U9TA 5EIOA 5H80A 4IXNA 8LDHA 2CLCX 1KMHB 1X1DA 3SIXA 3NBYC 3TLKA 4A27A 2PX4A 3EEBA 5DNAA 5G02A 1NNSA 3A9WA 3DBLA 3NIBA 2VRWA 2BI4A 1NMXA 3HN7A 3MWGA 3UG7A 4BVEA 2IHNA 2C1XA 4WFKA 4QOFA 3ICVA 3GVHA 1E2FA 4K6GA 2FEXA 3L07A 4DCJA 1R9GA 2V4ZA 5AKIA 2XGOA 5HCIA 5AD1A 4ETWA 5BWLA 1NBOA 2BE7A 2EW1A 2OQ2A 2PWYA 1GRVA 3AL3A 3T34A 3EK2A 5K6AC 1RYMA 4MKFA 2FK8A 1N78A 1NMYA 4UM9B 1KOGA 4OXKA 1Z2CA 2IDMA 3IJ5A 1V3TA 1QZXA 5K03A 4QSMA 3MOSA 4Q7KA 5DO9A 1A9PA 4BLPA 4LOHA 3KZCA 4N7RA 3TLAA 4GBED 3HY3A 3QLVA 4U6NA 1Q17A 4GI7A 5DM1A 1CYEA 1CUCA 4LX0A 2ODEA 3TGWA 1QOZA 3G5TA 4BBZA 4GMXA 3S2IA 4JBWA 3Q8MA 4N6OA 1EFUA 3LT0A 4A23A 2WF6A 3CB2A 5AKJA 1RAHA 5E2BA 3T38A 4ONEA 3DBHA 3VZRA 4C76A 3BDIA 2AG1A 1R10A 2QY9A 2B92A 2HRDA 1KZ6A 3AUJB 1TM1E 3E2IA 4RMHA 2Y1EA 4NJMA 1MOQA 3WR5A 4MR9A 3DAPA 1P7ZA 2UAGA 3N7UA 4JP5A 4DCSA 2E7ZA 5K51A 5A62A 1KK2A 1V8ZA 2IELA 1VLQA 4KN6A 1XRNA 3AEUA 3ZQJA 3QF4A 4V0OA 5I47A 5LU8A 3EQ8A 2Y68A 4QTXA 1YOBA 4LRTB 3W2HA 2WTAA 3DYBA 3TL2A 4KR9A 4KSBA 4CG0A 4JL8A 5B58T 5K0ZA 3NIGB 4R1OA 4F2PA 2QG9A 3BB3A 1JECA 2ZJ3A 2GBLA 1LSUA 3DDSA 3IP6A 5EE5B 4GPTA 4PS1A 5I7FA 3O1HB 4AP9A 4P92A 1K4MA 3WS7A 5BR4A 1IN8A 2OK8A 2VPPA 1IHDA 2GKGA 3JQCA 4KQ2A 3HCPA 4LBYA 2CE2X 1L5LA 4BNNA 2JZNA 1E79D 2TYSB 2TMYA 3JYHA 3UJ8A 3VPGA 3U19A 3USZA 4NCHA 1ISFA 1XRPA 3DYIA 2Z5FA 4OXNA 2WWTA 3IUJA 4QXOA 3B6EA 3EASA 5AVWA 4UTNA 1S4QA 4G85A 2I1VB 2UU9B 1BEUB 3PUWA 4LHEA 4G1VA 3VAYA 1AHPA 1YRWA 1QUEA 3FBTA 3JZFA 1V7QA 4C07A 4DN6A 2GJ8A 2H7CA 3SXJA 5LYJA 1T8PA 3HPRA 2SKEA 1VFPA 1CY2A 3PPVA 2C96A 3OE7A 4TL8A 3NWOA 3WZMA 2Z3VA 1MDBA 3RH0A 1Z2NX 1Z5OA 4C2BA 3AR9A 3U80A 5AVVA 4DEYA 3HXPA 2VS1A 3OEYA 2WPNA 3VTKA 4AKGA 3D2LA 4BEVA 4LF9B 3IP5A 4XDYA 3LQ1A 3OBBA 4HLNA 2FMXA 4Z1MD 1Y9EA 2UVDA 3LGSA 2JFXA 5H0IA 4OMCA 4OQPA 1IOVA 2YQ5A 4BNJA 5L8VA 1A04A 4MVXA 3PEYA 3HKDA 4G8BA 3E1GA 2B36A 1B3BA 3MJFA 4RNCA 3U7IA 1PLLA 2W6ID 5KKCA 1HRDA 1K92A 3CBGA 5ESXA 3I23A 2XE4A 2YC2C 2ZWMA 5EHNA 3II6X 1B76A 4HUJA 4UBOA 2ILVA 4B6PA 3D6UA 2R11A 2JJ2A 3RARA 4BX8A 1S8NA 5BQFA 4RXMA 5K05A 3T7DA 1PJCA 3S29A 1UDXA 3F3YA 5J23A 1YR7A 5DTQA 5EQJB 4OL0A 3X43A 2NZWA 2B9EA 3K70B 4U6SA 1QYCA 3K16A 1B8OA 4WBNA 1TJ4A 4GKJB 2JGRA 4BX9A 4LVOA 5AI8A 2PMBA 4DDUA 1IONA 2Z56A 2Q4OA 1BGXT 4FINA 1O5IA 4EMTA 3UWPA 4CKZA 4IIFA 5ALNA 3O9ZA 3WGLA 5T7BA 4PTYA 2AVDA 4ZHSA 3LHKA 3IP8A 4ITRC 3PD1A 4HQKA 3DS8A 3GGCA 1JFFB 2DTEA 5HG0A 3BK7A 1KJIA 4DMLA 4AWXA 3FVTA 4GM4A 1SC6A 2FJUA 2GM9A 1PI3A 1MRNA 1K8RA 1WBJB 3UAVA 3RVDA 4EHBA 1DCTA 5DMHA 4OP2A 5T4FA 2X8JB 3LC1O 1J24A 1FDIA 4KXUA 4X9XA 1C4KA 4HX2A 1BE8A 2JHAA 3PJRA 4EVIA 1XZPA 1UJNA 4IDEA 2GX6A 2RKWA 4RHCA 3RCBA 2MOKA 1ODJA 5C51B 4Q3NA 1QORA 5I4IA 1GUDA 2DUUA 3PUYA 2EJWA 1EK2A 3RR2A 4EF4A 2VDNB 3MJ4A 1CHNA 1A2OA 1N25A 3LBIA 3N39C 1F8XA 3PIIA 3AKYA 2PG3A 3N8KA 2C83A 3R75A 5JT1A 1YUBA 3RQIA 4L5CA 1FB5A 2YWJA 3OF2A 1XZMA 5H3HA 4FFVA 1H4TA 5AM0A 4JBHA 3GUHA 3EZFA 2MJLA 2QM7A 2NZ8A 4ON9A 3AJAA 2WVAA 4QOSA 5AVXA 4MZXA 3QHQA 4O8ZA 4AS1A 4JR1A 2HF9A 4FYHA 4MPRA 3ZV4A 5GV7A 2FPIB 2E49A 1YXMA 2XHEA 4K9PA 4F4UA 2AXEA 3VYRB 4HDNA 1O87A 1NSTA 3P9ZA 4ZHQA 5KWJA 1HYBA 2QSUA 5CTJA 3TX6A 5HUJA 5I48A 3GLIB 2BH9A 1X7XB 1UKVY 2HT1A 5KSWB 5J2UA 1HURA 3OC6A 5AVKA 3UT5A 1A71A 4U02A 4OLJA 3F3MA 3HCRA 3T1VA 1DUVG 2VHVA 1TYBE 1H1LB 3ZHUA 3GHYA 3JTEA 3ZH2A 1ZUWA 5FYDA 3I2GA 1UDAA 2VDQB 3SC3A 3TE6A 4L9AA 1P77A 1KYQA 1IY1A 3KELA 4K87A 3QBVA 1RADA 1W93A 4MWGA 4Z7NB 5KJ6A 5IVHA 2J31A 1DDGA 2IE8A 6REQA 2PKQP 4EL0A 2Z6UA 4UVDA 3U3DA 1FDTA 1R5BA 3ZBQA 2Y1XA 2J6IA 5B57C 2AI2A 1YJBA 3OWOA 4C03A 1G2OA 4PONA 3RFFA 3HO1A 1JPVA 2QLNA 3R9WA 2ZTLA 2VRCD 3IR5A 2H8KA 4K2HA 4TXMA 3LPLA 1LY1A 4XSVA 1C9DB 3VNQA 4NHOA 1GTMA 3RRMA 4YV1A 3EFBA 3MMSA 4A8JC 1N5DA 2X2FA 2DETA 2LXNA 3ZCPA 5HM6A 1KJ8A 3HRIA 4N18A 1UBCA 1XDSA 3PNKA 2XSZA 5CB0A 1VKJA 2POQX 1CJCA 2LR0A 3NXSA 1NJ6A 3BE6A 3HVJA 4BS9A 2H48A 1BHJA 3FWKA 1Z63A 2ZJ0A 4PNPA 1OXTA 4QLBA 1W96A 2JI7A 3L2OB 5H1YA 1Z37A 5L3ZA 4M54A 4LYHA 3OCCA 2ACWA 2UYHA 3L7NA 2X0IA 2ZR7A 4RWZA 1ZJZA 3MCTA 5ESRA 5JISA 2PUCA 1D07A 1AURA 2OHIA 2R6R1 3R76A 1ZRNA 2DYKA 3L9WA 5CB8A 5JNLA 3GEBA 4CMIB 1W94A 2HSWA 1RWQA 2ZJ6A 5JTUA 1I14A 1MBZA 4QUAA 1GTJ1 1TU3A 1T2AA 4I66A 1KMCA 1ULAA 3BXPA 5DNEA 5FPPA 2PZAA 3ZDQA 2GRUA 1KYYA 1TF5A 3ESRA 1M54A 2B5VA 4GX2A 4Y9SA 1YTLA 4B7ZA 5KVSA