3QVWA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k278a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSADKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 152
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvwA01
5EJ2A 2DFDA 4CV1A 2HSDA 2P9GA 2VCYA 3O8QA 4IXTA 4EZBA 4L76A 3DHNA 3KLMX 1SBYA 2O3SA 3ZWCA 5IDQA 3DBRB 5DOVA 3UUWA 2PD3A 2ZB4A 3WLEA 5A1TA 4UEOA 4OXKA 1EE9A 1TXGA 2IEBA 3JQ6A 3ROPA 2WWRA 2Z1MA 3PFWO 1LNQA 5AXDA 1LDGA 4RCVA 5FI3A 5KKCA 3I5MA 2GGSA 3H2SA 2CVQA 1RM5A 2I3AA 4PLPA 1M67A 4Y8VA 5EIOA 3K92A 3PFFA 3E9NA 3JTMA 4AJOA 3VKVA 5F5LA 5H81A 2Q99A 4KTVE 5F3RA 5T8KC 1FDTA 1M6WA 5CG1A 3EAGA 1QG6A 2GCGA 5IN4A 2DTEA 2PD6A 2CD9A 2OP0A 5CDSA 4IDGA 4R4JA 3VVBA 1D3AA 2WM3A 1TI7A 2OORA 1ZCJA 1PGJA 3CE6A 3M1LA 4QECA 4N5NA 4XWYA 4BNKA 2AQKA 2QRKA 1IL0A 4BMNA 1MXHA 1Z75A 4UVHA 2X0RA 3LT1A 2Y1EA 1NNUA 2C29D 2QRJA 4B4OA 5I9LA 4CQLB 3ZDFA 1MC5A 5KKAA 1SCUA 1R12A 2X7HA 3GPIA 3M6IA 3L07A 3PZBA 2YW9A 4LCJA 5JDIA 3BHIA 1YO6A 4LSWA 3DMTC 3QE3A 3RROA 4CR7A 2PZKA 4GKBA 1C3VA 1N5DA 1W8DA 2DTDA 3QVOA 5L53A 1G0OA 1Y9EA 3GMSA 3ZCXA 4AFNA 5CDYA 4TRNA 2HKIA 4NPCA 3PDJA 3UFXA 3I9JA 1NTOA 2NUAA 3ETDA 5ER6A 3OJOA 4J2OA 2HUNA 4AJ2A 4S1VA 1QXSA 3WTCA 3FNHA 4MO2A 2X58A 1ARZA 4J90A 4OXNA 1OFGA 1MG5A 3AOEA 3D4PA 1VM6A 3IKVA 4JLWA 4RF5A 1UAGA 3SVTA 1LC0A 3RUAA 2VOJA 1LLUA 2Q1TA 1SO8A 2NVUB 2RHCA 5B4VA 4GX5A 4Y9DA 2Y1FA 3TDKA 3TOXA 5KVSA 1WMAA 5ES3A 1LSSA 3NJ4A 4EDFA 1ONNA 4I5EA 4R5HA 1DDOA 4MIEA 2VWPA 4OGWA 4W6ZA 2FP4A 3VZPA 2JAPA 1LRLA 2CF5A 2PKQP 2H9IA 4U5QA 2X1HA 2Q3EA 1YRLA 4DQVA 4XYLA 3H4VA 1DJQA 1A7KA 3F6YA 4A0SA 5CAEA 3WMWA 2HRZA 3U49A 1F8FA 4RZIA 4E2ZA 2I66A 4KDFA 1NR1A 4GWGA 1T2CA 4MKZA 3OFSA 3JQFA 3MWEB 5GZ3A 1TT5B 1WMBA 1EDZA 2B5VA 2NVWA 2PNFA 3IS3A 3ZWYA 5IFLA 4MVJG 4BNFA 1CERA 3I3OA 1ORRA 1D4FA 4LRSB 2QQ5A 3NGXA 5KVCA 1DBVO 2QYTA 4J3FA 1VKNA 3PHIA 4OYRA 2JD2A 1UXGA 4LMRA 4YB8A 4M89A 5L51A 3DXFA 3INRA 1Q7GA 1H6DA 2RHRA 2JCVA 2CDAA 3RUFA 2BFMA 3BTOA 4CPDA 1BTOA 1LQTA 4FN4A 4IJUA 1ISGA 3FN4A 2NTVA 4K9DA 1XIVA 3WGTA 5KWEA 5CG2A 3UCEA 2BFOA 4A5OA 1YBVA 2Y68A 1NAIA 1H0KA 5GZ6A 1LXCA 4GI2A 2B0JA 3PVZA 4OKNA 5CDTA 3G1TA 3U4CA 1T25A 1XA0A 2HK8A 3IC5A 4FGSA 3PYMA 5B4UA 1B3BA 2YHIA 4MKXA 3VC7A 2AG5A 3VDQA 1Z7EA 3BTSA 8LDHA 3BMCA 2NU7A 4CMBA 1IHYA 5DBFA 1AN9A 1PJLA 3WQSB 1O89A 4CMGA 1D8AA 4UVEA 2DQ4A 2X9GA 2NTJA 5JYAA 2ZIZA 4YR9A 4J4TA 3B20A 4JP2A 1BMDA 1D7OA 3O9ZA 1E3SA 2Q46A 4H7PA 3Q2IA 5BSGA 3JQ7B 3U9LA 1E7WA 5DCWA 4BNYA 5G4KB 2CMDA 3WB9A 1E1LA 4J7UA 2G76A 3QRWA 1C0IA 3H3FA 1EEHA 1GTMA 1UP7A 2WD7B 4PLTA 2O7SA 3EMKA 1C0PA 3ONEA 1JLLA 1ZSNA 2RIRA 3ZWOA 1U4SA 4UUNA 2CY0A 3WG9A 1ADCA 2PGDA 5ITWA 1XHLA 2YV3A 3JCZA 1ZIDA 3CTMA 1BXKA 3RC7A 3H9QA 1HXHA 2Y1OA 3JYPA 2G82A 3DC2A 1U8FO 3OJFA 3TL3A 3VVCA 4RPKA 3C7DB 3C1AA 4BNNA 1HKUA 1A71A 3NYWA 2NSDA 4N5LA 4Q3NA 4R1TA 5FEUA 2WDZA 1GL3A 3FSRA 4J1QA 3QWBA 1LDYA 9LDTA 5K9ZA 3A4VA 5THQA 1E5LA 1JKFA 4NBRA 2VHZA 4TKMA 3LLSA 3W8EA 1KVSA 2TMGA 4NIMA 3I9MA 4IDBA 1V35A 1XU9A 5C3MA 1JWBB 2B83A 3GNTA 2GNAA 4DYVA 1KVQA 4L4SA 4CMCA 5J9GA 1PJTA 3TPCA 1JN0A 1WZEA 3UF0A 2R2GA 3CMMA 3RCBA 3KYDA 3L4BC 5DT9A 1HE4A 3SEFA 4II2A 1LRJA 4YJGB 2VTDA 3ICCA 1NBOA 1U7HA 1ENZA 3G79A 3NUGA 1R0LA 5A5FA 1R4MB 3D64A 4ZD6A 4W9NA 3IIEA 4BB6A 4BO4A 3BMNB 3I9NA 4HY3A 3H65A 2W2KA 2HO5A 4RF2A 1TA4A 3DZGA 3E5RA 3JD4A 2R00C 4L75A 2RH8A 5CDUA 2AXQA 2PR2A 4XGNA 2Q4EA 3H7AA 2DU8A 1IB6A 3SLKA 2PH3A 2B36A 4E5MA 4HFRA 4CLXA 3H6KA 4RORA 3PHJA 4XB2A 1MFPA 1PR9A 2VT3A 4FFMA 4NH4A 2RBEA 4NU6A 1PS0A 5G4KA 3S55A 1RM0A 3I9KA 1YXMA 2D59A 2Y66A 1DC3A 3D4OA 3NJ8A 4WECA 4RVGA 3HDQA 3OJ0A 3RVDA 2Y05A 3GMDA 4NHEA 4BB5A 4P8RA 4N7RA 3KUXA 1KC1A 2UVDA 3KSDO 1XR3A 2ZTVA 3PJDA 4E33A 4HNHA 4AJ1A 3LK7A 2FR8A 2GZ1A 2O2YA 3P5SA 2VN8A 3PJGA 4XX0A 1H93A 2UYYA 3VOSA 1DSSG 3IUSA 4IQGA 4NI5A 2VZ9A 2DUWA 5IAAA 5L95A 4Z9XA 3HNPA 1GPDG 5TT1A 4YJFB 4NJOA 3ANLA 3GC6A 1GEGA 1ISMA 3B6ZA 3JQBC 4ND5A 1XYGA 2WTBA 3A14A 3BHMA 4GGOA 3A28A 1F17A 1MC4A 1Y7TA 4FD3A 3V2HA 4YAGA 1R4NA 4PLZA 3OF2A 3ZNPA 1LSUA 2HMTA 1G1AA 1B8PA 1Z73A 4DTIA 2PZJA 4MKRA 3RUCA 4R9SA 1J6UA 2GERA 3MJ4A 3MJTA 1P74A 4WK6A 4HFMA 5C7OO 3BA1A 2O48X 4KMSA 4WCFC 3GUCA 1FDUA 3AK4A 4BO3A 2X5KO 5A9TA 4GLOA 3VPSA 4BNLA 2E49A 4LW8A 1C1XA 4KQWA 4YJGA 1VI2A 2JHGA 4YAJA 4RVFA 4ROSA 1ISJA 1ZXLA 4L74A 1M2WA 1NQOA 4YPOA 4WKGA 2GO1A 4QO7A 1A9ZA 2AEFA 1UDCA 3AM4A 3ASUA 4BNWA 4MVJI 1B8UA 1NX6A 3FR8A 3ONDA 1CQIA 3C8MA 1SOWA 4XQEA 1E92A 3DBHB 3GVHA 3H5AA 4WE3A 1ZZEA 1KY5A 5HS6A 1LDBA 3JYNA 3ZV5A 1GPJA 4WCFB 5KJFA 5TIIA 2VOEA 3QWIA 4IPTA 1GQ2A 1C1DA 1O94A 3H8VA 1FK8A 1GCUA 1V9LA 1GUFA 2Q4BA 4G2NA 2DLDA 1S7CA 1HF3A 2P4QA 4Q3CA 1EBFA 3WYBA 3G17A 2HK7A 1OI7A 4TVOA 2JD0A 3C85A 2FPIA 3NKLA 5DZSA 2X8LA 4LGVA 1VL8A 4AG3A 1GEEA 3OETA 2O3TA 4GAEA 3LU1A 4IINA 1OAAA 1Y1PA 1DIBA 3FNGA 5BNIA 1ZKMA 5A9RA 4PZEA 3C7AA 1ZFNA 1W0CA 4E30A 4TRJA 4O0LA 4U8GA 2AW5A 2GZ2A 2AG8A 4QO8A 5I7VA 4CMAA 3TFQA 2QRLA 1PSDA 3COSA 5HBRA 1BXGB 2ZYDA 4E5YA 5KVQA 1EE2A 1NQ5A 2VNAA 3GAFA 4YJFA 3EW7A 4BO0A 5TLSA 2YYYA 5H82A 4R1SA 2IZ0A 1FXSA 2DTXA 1NVMB 3DMYA 1U28A 4BO9A 3ZHYA 5L4LA 1LLQA 1HE2A 3BTUA 5IN5A 2UUOA 2Q22A 4ZU3A 1EK5A 3I52A 2XOXA 4XKJA 1YOVA 4FQ8A 3ZNNA 1I33A 2IZ1A 1IOLA 4M54A 1E3LA 1B2LA 1LTHR 1JKJA 1LLDA 3WYCA 1GZ4A 4D42A 1QV7A 1R16A 2C2XA 3LT2A 4XDYA 3ZWNA 3IOYA 1SC6A 4CM7A 4N54A 4ZN6A 3JQBA 5BT9A 2RH4A 2VWGA 3FD8A 4CL3A 1SAYA 4GKVA 1DC4A 4A03A 1JAXA 1DXYA 4IY1A 3TF5A 1Q7BA 2W4QA 4U7WA 5DP2A 1J5PA 4B4WA 3GHHA 2C20A 4YRBA 4CQMD 4ONEA 2CUKA 4OQYA 5HWSA 5G0TA 4KWHA 1Q0HA 4B7CA 1Z45A 3PIDA 2C7VA 1PGNA 5JLAA 1U3WA 3EVTA 4FBGA 5AXCA 3BZUA 1XG5A 3TZCA 2I67A 4TZKA 4G65A 2AA3A 4WCFA 3QVSA 3L9WA 1HDOA 3R3JA 2H5LA 4M49A 4GX0A 1X14A 3QVXA 1MV8A 4KZPA 2X22A 1SB9A 3AY6A 2PKQO 4XR9A 2X0JA 5DBIA 4DREA 3PK0A 4F46A 1G6KA 1YB4A 1EUCA 2X9VA 1V3VA 1MUUA 3ZGYA 5K6AC 2E48A 4NBVA 5TGDA 1YJQA 3KO8A 5L4SA 3WNQA 2EGHA 4Q39A 1YWGO 4NNJA 3BMQA 3WICA 1BVUA 3MTGA 4I5FA 2GZ3A 2C0CA 3HB4X 1T4BA 1DIHA 3KLPX 3GGOA 1I3LA 1P1FA 1B8VA 1TB4A 2OMEA 1DC5A 1V3TA 4EGFA 2POQX 4UREA 2YV2A 5EESA 1PQWA 3E5MA 5L3ZA 5F5NA 2V6BA 2Q49A 4Z9YA 3O26A 3WSWA 4BS9A 2NM0A 1KEUA 5CEJA 2DPHA 3OA0A 1M6HA 1FJHA 1DHRA 5A02A 3JV7A 1UR5A 5T73A 4L9RA 4XJTA 2I65A 1WDKA 3GNSA 3O8QB 4KP7A 4WUVA 3H9EO 1OC2A 3DR3A 2P68A 5T64A 4Z0PA 1E77A 3ZW8A 2A4KA 3U5TA 1H9AA 3KVOA 4ALIA 3T7CA 4JBGA 3TJRA 5A05A 2B4TO 1L1FA 1P1RA 1UH5A 1I3MA 4HXYA 4PCVA 4CUKA 3RUDA 2GDZA 3LC1O 1U9JA 3I83A 1XLTA 5L7WA 2CVZA 4WNIA 4CLHA 1HZJA 2CVOA 1PL8A 2EJVA 3KXDA 4BV9A 4DWVA 4WLEA 4TVBA 2CDCA 4PVDA 1VJTA 1B0AA 1EFLA 1T2DA 4DBZA 2D1YA 4XR4A 5JDIC 1R66A 4H16A 3DONA 3GDFA 4NDNE 4XQ9A 2PTGA 3VH1A 1I36A 3ROQA 2D0IA 1LQUA 2X0NA 3WJAA 1X7GA 1LRKA 2ILTA 5KOIA 1WWKA 4B7UA 1DHTA 2DT5A 3VH3A 2I6TA 2QW8A 3B1KA 3L6EA 1G0NA 3RFXA 1LJ8A 2EIHA 1PS8A 3W1VA 3RASA 2OP1A 3AOEC 4JP3A 1S6YA 3JQGA 4NBTA 1PS9A 1LI4A 3ZWMA 4J4HA 3JD1A 4AVYA 5ILOA 4ILKA 3ZNQA 2PZMA 3OQBA 4CUZA 2C82A 4MVJE 4DYDA 1ID1A 2DM6A 3DB2A 4A2CA 3ZV3A 1H6AA 1U2DA 1NAHA 4U0JA 4IQ0A 3QW2A 2FZEA 2A92A 3QP9A 2CFCA 2Q1WA 3VKUA 1CDOA 2DUUA 3ZHZA 2OFPA 2BFPA 3JQAD 1QR6A 4DPKA 1P1KA 2B37A 4CM5A 5K6AA 1VRWA 3WQQA 1HDCA 4NFYA 1W73A 3ANMA 4CM8A 3DHYA 2D4AA 1VL6A 3VH2A 1PTJA 4B4UA 5LCXA 4QT0A 1M76A 4KQXA 2W2LD 4TKLA 1T2AA 3PHLA 4GQAA 5HTOA 4TQGA 4H15A 4BV8A 3W4IA 2PV7A 3JQFC 4CM6A 3FBGA 5CHEA 4RF4A 4B3HA 1Y5RA 4I1IA 2IYOA 4LRTB 3N58A 5AXBA 1TVEA 1YQGA 3FWZA 3NEPX 3QJ5A 3OP4A 4XRGA 2SCUA 5TJ9A 3WOHA 1NWCA 3PQDA 5IJZA 1PL6A 1EK6A 1AHHA 1LDEA 4CMHA 1UDAA 1ISIA 3CKYA 4IDDA 1YL6A 1N8KA 1R0SA 3ITKA 2J3IA 3HB5X 4KOAA 3NRCA 3LC2O 4EEXA 4L0QA 4E2WA 1B16A 2RAFA 4PLVA 3TFOA 1Y8QA 2WD8A 4DIBA 3GEGA 3ROKA 2H1SA 4E6PA 3GK3A 4W7HA 4RVSA 5L7TA 1P0FA 3SJ7A 3OICA 1EFKA 5DCYA 3GOHA 1DRVA 4FOOA 4TWRA 5JCXA 2J8ZA 2ZB8A 1ZJYA 1ZK1A 3SJUA 5DDIP 2Q2WA 4WLNA 2Y0CA 2IYPA 3UH1A 3E6AA 3INTA 3HN7A 3FI9A 4D79A 4L4RA 1GV0A 2P91A 3GN2A 3L4SO 4ZA2A 4IM7A 4BNIA 2OL4A 3TNLA 2EWMA 3RUIA 3GVIA 3PGXA 4D3SA 2I5PO 2YHIB 3D3EA 1CRWG 4CL8A 1PU2A 4R16A 4Y67A 3BMCB 3MZ0A 4IQ8A 3F1KA 4XQGA 1LBEA 3GEMA 1NHGA 1LSOA 2QIOA 3TZQA 4FR5A 4BGIA 3S2FA 2IZZA 1QLHA 4HFJA 4INAA 4YT2A 4A10A 3LC7O 4DVJA 4PG5A 4XA8A 2J5QA 3F1LA 3LZ6A 4UVDA 4Y98A 2QZ9A 1P1JA 2H63A 2IEDA 3QWAA 4LCEA 4QQRA 2HMUA 3CXRA 3LDHA 3P7MA 1KEVA 1SMKA 1ZMTA 5FWNA 1PJ2A 3PGJA 3ZU4A 3ZHXA 5C37A 4ZICA 5JC1A 1I5RA 3H2ZA 3W8DA 3PWSA 2WJPA 3NDIA 2Z5LA 4XGIA 1FMCA 3JQ9C 4BNHA 3JQDA 4FFNA 1A5ZA 1JAYA 2QYSA 1RYDA 1WDMA 1VC2A 4EEZA 3AOGA 4MJLA 1SZJG 5HM8A 4ZVVA 3JQEA 3WFJA 1GZ3A 2F1KA 1I3KA 1J4AA 3VZSA 3E48A 1MB4A 2A9FA 1A4IA 4PG8A 2EHDA 1ZUD1 2IRWA 4YAKA 4FW8A 3PYXA 4HV4A 1X1TA 2FPPA 2NQTA 4K6FA 4E4YA 4BIIA 2O7QA 5A4DA 1YBMA 2GYYA 1KC3A 2YQ4A 4DUPA 1HYEA 3ZH2A 1CYDA 2GN4A 3RQSA 4CV0A 2FN7A 5BSFA 3OH8A 2D5CA 3AY7A 1VSVA 1IZ0A 3WGGA 4W9NC 1U1IA 3PTZA 1M75A 3TN7A 3PEFA 2ZJ1A 3CEAA 3WGHA 1E5QA 3MEQA 1XDWA 3TRIA 5EMHA 3C1OA 1KETA 3FWNA 5KJCA 4PZCA 1H6CA 4CM9D 1KS9A 1GU7A 4URFA 2HQ1A 3KYDB 4BGEA 4S3MA 4J2HA 3ZN2A 1XU7A 4HKTA 4B3IA 5F21A 4E2YA 4C4OA 1R15A 5JCJD 3GFBA 4HWKA 2J5KA 1O5IA 4MP3A 1EQ2A 1PZEA 3TL2A 4J1NA 3GVXA 3VTFA 4PGFA 3DZFA 2GRAA 3KZVA 4QX6A 3U4HA 1E3WA 4OL9A 2W2KB 5TJHA 4FC6A 5KIAA 3DZIA 4ZRNA 3AUTA 1HLDA 1BW9A 2DBQA 4JJFA 1K6JA 2AEJA 2NQ8A 4IDFA 3BHJA 1UAYA 1NQAO 1UJMA 3GG9A 3MJEA 4Z9FA 4BO7A 3TZKA 1I30A 2DC1A 4ZJUA 3RC2A 4BKPA 3BMOB 2FPGA 1DPGA 2Q2QA 3G1UA 4NJMA 4FOSA 3HDYA 3M1AA 3WFIA 5FI5A 5C7IO 4CMJA 4A27A 4J43A 3AI3A 2PWZA 1QP8A 3MJSA 4CLEA 1YQXA 1DOHA 4R01A 5K0ZA 5KVVA 1XKQA 2ZKLA 1HEUA 2VUSA 3PHGA 4J0FA 1ZK3A 4GBJA 5JY6A 4YRAA 3D3WA 1H6BA 2GR9A 3PJFA 4J0EA 1EVZA 2Q50A 2V6FA 4ND3A 1BWSA 2W8ZA 3HHPA 5CPBA 3S2IA 2CNBA 2Q2VA 1I10A 3JQ8A 3BAZA 3ADOA 2PLAA 1LEHA 1E1KA 1VJ0A 3A06A 5JW6A 3KM0A 3CZMA 1QYCA 3JQ9A 4IGFA 3UKOA 2JAHA 3VPFA 5JSFA 2JKVA 1M66A 4IJKA 2X5OA 3F47A 3JD0A 1I8TA 1GYQA 1R4NB 1XCBA 4GGPA 4OMUA 3PQEA 2DPGA 1GV1A 4OAQA 1XSEA 3MOIA 4CQMA 2EKPA 1JVSA 4DMMA 1J49A 4E31A 5CFZA 3UN1A 4DC1A 2Y0EA 3PLRA 4ZQHA 4YJHA 4RVDA 1C1XB 2NWQA 4G81A 3R0IA 2VRBA 3GDGA 1OBFO 4XEHA 4HFNA 5EQFA 4AJLA 5FF9A 3GR6A 1SOVA 1WZIA 2FR1A 3UHAA 4IJWA 2J3JA 1Y81A 3GA0A 3NAQA 3WS7A 2ZTMA 3L6OO 1NPTO 4PVCA 1EVYA 1WVGA 3KB6A 1UZNA 3QSGA 4R1UA 2LDBA 1QV6A 2ZK7A 4XD2A 4XYBA 1BG6A 3EGOA 3LYLA 4DL9A 2JFGA 5MGBA 5CEFA 1C1DB 3OIGA 1B14A 2X23A 1Y5MA 1X7DA 4K26A 3AU8A 3BMOA 1DAPA 4W99A 3C1TA 3AUAA 4K28A 4RQTA 3KETA 2X5JO 3WMXA 1VPDA 4FFLA 2VZ0A 4CR6A 4BNMA 4RDHA 1HETA 3IJPA 1MP0A 1NASA 5JXWA 2VYND 2AQIA 3K73O 5TX7A 4AJJA 4J7XA 3HSKA 2VHWA 1T2FA 5F1OA 4M8SA 1U3UA 3ST7A 3GNQA 4CV3A 4YCAA 5ADHA 3MTJA 1W6UA 2VUTA 4AJPA 1JWAB 3I23A 2P9EA 4YT8A 1ZMOA 3INGA 5L45A 3K2EA 1U5AA 1PZHA 1BRMA 1QMGA 3PWZA 1PJ3A 5M6DA 4BUCA 4RPGA 4E5NA 1X7HA 2FR0A 4FCCA 3QQPA 1ZSVA 4BNJA 1YKFA 1A7AA 4B8WA 5JO0A 1N9GB 3HG7A 1MLDA 4B7XA 3RJ5A 3TZHA 4ITUA 4FB5A 1YOVB 2YUTA 3PHHA 4UVIA 2AHRA 4ALJA 1JA9A 4NMHA 3V1UA 4B3JA 4Z3KA 1IY8A 3EDMA 3QA9A 4IUYA 4CV2A 1F12A 2B4QA 4EI2A 1QSGA 4BNGA 5A06A 2JD1A 5B37A 5JPIA 3R3SA 2X9NA 4R3NA 1I2ZA 4UUPA 2VRCD 5U1PA 3PLNA 3MWDB 4KDEA 1Q7CA 2B35A 2CSUA 4JIGA 3ZV4A 3HWRA 3GFGA 1PZGA 3GY0A 3RU7A 3WQRA 4D7AA 1T26A 2YHUA 3K5PA 4XYEA 2E4AA 3AWDA 2J3HA 3ETEA 5A9SA 3K30A 2Y67A 4GVLA 3ZNOA 4L8VA 4BNTA 3S8MA 2UDPA 4JXKA 4L4XA 2PY6A 3E9QA 3EUWA 3Q9UA 3E1KA 1T4DA 1K5HA 4FJ2A 3WBBA 1ADGA 3ZWWA 1WW8A 4J91A 3D7LA 3H9GA 2YFQA 1E1MA 2PGJA 3QY9A 1NYTA 4PFJA 1NVGA 3RBVA 2O4UX 2VHYA 1U7TA 3F5QA 5C5IA 3JQAA 3TOZA 3OHSX 5I8ZA 3ZU5A 2V6GA 1A27A 1TEHA 3BMQB 5BSEA 3GZNA 3SXPA 1FDSA 5ICSA 1QORA 3ZWXA 4EJ0A 5JDCA 1DIAA 2W2LA 3PIIA 4NFHA 4LSMA 3ITDA 1PL7A 3GHYA 1C0LA 4O5OA 2DKNA 3U4IA 1GQQA 4YA6A 5T6BA 4D43A 2UAGA 1XQ1A 4RQUA 4Q3AA 1E7YA 1ENPA 3Q3CA 2IE0A 1V3UA 1ZXBA 2ZYGA 2J3KA 4K1LA 1XEAA 1I24A 4RLSA 4X54A 3C7CB 2NU9A 4JBHA 2VT2A 1N9GA 4BMSA 4I9NA 3GVCA 3K6JA 3OIDA 3WGIA 4WLVA 1DRUA 1JDJA 1XWFA 1GY8A 1B15A 5TS3A 4BQRA 3DDNA 4KUEA 5T57A 4BO2A 3D4NA 1IYZA 3KYCB 5ER9A 4J1SA 5JNLA 4ZQBA 4NFSA 3AY3A 4WNCA 4UUMA 4E5KA 1VL0A 5AQ1A 2CF6A 4OM8A 4YAEA 2ZCUA 1LLCA 3OSUA 4ID9A 3PP8A 4U6QA 2JL1A 4LK3A 5JBIA 4Q3DA 3FF4A 1JVBA 1KVRA 1U4OA 2C7GA 1IE3A 1KERA 5F1PA 1U3VA 4CM4A 4DIFA 1PJQA 4J7CA 2EP7A 4PG4A 5I7FA 2P4HX 5FFFA 4DC0A 3IP1A 4CMIB 1NHWA 1BSVA 1IPEA 2ZCVA 3LLVA 3GF4A 4W7IA 3WWZA 5CPFA 3CUKA 5EINA 4LMPA 2NVBA 4ALMA 1P1IA 3E03A 1QYXA 1ZVMA 3OJEA 1T24A 3PDUA 5U4QA 1X1EA 2VYVD 4WOKA 1R0KA 4ZQFA 1YL7A 3RBZA 3KV3O 2E6UX 3JQGB 4HUJA 4JNKA 2VQ3A 5AVOA 4BO5A 2D8AA 1ZH8A 2PGLA 4CLOA 2V6MA 3U0BA 1AGNA 5BR7A 3FNEA 1X15A 1BDBA 5BSHA 2W90A 1SEPA 2FHSA 4I9UA 4R9RA 4U0KA 4YYZA 3DBLA 2YV1A 5IF3A 4EUHA 3AFNA 4I08A 3E9MA 1PGPA 1DIRA 1UZMA 4CM8B 3VHRA 2X86A 4OXYA 1HYGA 3QIVA 2PD4A 3W4KA 3NT2A 3FPCA 2XF8A 4GX2A 1HZZA 4TSKA 4Q3BA 4H3VA 4BHTA 4YXFA 3KYCA 1ONOA 1PJSA 3ASVA 5G4LA 4J6FA 3ULKA 1N1EA 1YL5A 1GYPA 3DZKA 3L0DA 2YZ7A 3M2TA 5L4NA 3IP3A 1MGOA 4PLFA 3PJEA 2JJYA 2QHXA 4UAGA 1T1RA 2WYVA 3TSCA 4D0RA 4EUFA 4FC7A 4I9HA 1P31A 3RUHA 4PRLA 3RU9A 4DLLA 5F1KA 4NK5A 2HDHA 2LDXA 2YFHA 1Y8QB 4CMIA 1NFQA 3BTVA 1ZW1A 5JFOA 3L77A 4CM9A 3GDOA 2FRDA 3GN1A 4M87A 1AXGA 1AHIA 3DFZA 4J1TA 3I6IA 3QWHA 4ZQEA 5JCJA 1A4UA 3GQVA 4IMRA 2YQ5A 4E32A 1FDWA 2OXIA 4D44A 2OZPA 3HE3A 5JMPA 3OQ6A 4FS3A 4YQYA 3OIFA 3LVFO 1N7GA 1Y8RA 3EZLA 2NU8A 4NQZA 3QWFA 4TZTA 3E82A 1CETA 4IXWA 4II3A 4DMLA 4WCDA 3WTBA 2OHXA 2VNSA 2C5EA 4EJ6A 3KSZO 3E18A 1N1GA 3EZYA 1L7EA 3RI3A 1D1SA 3DHEA 4W4TA 4BQPA 1Q0LA 2EGGA 1Y9AA 2DBVO 3RC1A 2Y93A 3I1JA 4YJDA 3VAZA 5A03A 1ENOA 4DPLA 1AUPA 1VE9A 1WXDA 3GG2A 2PZLA 2I76A 2HK9A 1KOLA 3OBBA 2I9PA 4WGGA 4PLYA 4EJMA 3H5NA 4PLHA 1NPYA 2EERA 3AM3A 1DO8A 2BLLA 3HFSA 1ZNQO 2Y1GA 4PZDA 4JN6B 2D5AA 2ZTLA 3C24A 4IDEA 3QVTA 4GVXA 1E1NA 2BI8A 5DCUA 1DFIA 3VZRA 4FJ0A 4ALLA 5DP1A 1KYQA 3SLGA 1OC4A 3WSVA 1H2HA 4F6CA 5ITVA 3WIEA 5JC8A 2RCYA 4OOFA 1YGYA 3HUDA 3NT4A 1LDNA 5A04A 3I4CA 1HTBA 4YACA 3MJCA 1JTVA 2Q1UA 3K9QO 2ZYAA 3H3JA 1FF9A 1Q1NA 3I4FA 3ZU2A 5I8WA 1Z7BA 5IZCC 4DPMA 3HDJA 2G0TA 3EC7A 4RL6A 2HCTA 5A3VA 1E7QA 1KEWA 1NFRA 4UVGA 1YQDA 1PWXA 4CODB 2FWMX 4GMFA 1IZ9A 3ZW9A 5ICMA 3CPSA 2O50A 5U9CA 2C54A 3IKTA 1R6DA 1HSZA 3CH6A 1RYEA 1E7SA 1DIGA 1GYRA 2AMFA 3AUUA 5JY1A 2GLXA 2HJSA 5COQA 1UXHA 2C07A 4YVFA 5EN4A 3PYLA 1A72A 3MCVA 1YB1A 5ENDA 1P9LA 2EP5A 1JW9B 1NWHA 3RD5A 4CM1A 1GDHA 3O4RA 3ETGA 4YDRA 4BO1A 1GD1O 4YRDA 1VLLA 3AM5A 2BGKA 5THKA 4W82A 4CLRA 2E37A 5JAQA 2ZQZA 3BYZA 3DAPA 1PQUA 2QG4A 5JE8A 3G49A 4FFOA 3RWBA 5H83A 3T4EA 3WYEA 1YJ8A 3WWYA 1YBAA 1PEDA 2HLPA 1NQTA 3WGQA 4BL5A 1DRWA 3LSYA 5KJ1A 3V1YA 8ADHA 2FSVA 3ZI0A 1E3WB 1L7DA 2HMSA 4RZHA 4TRRA 1P0CA 4Y6PA 2NV6A 3V2UA 4MDHA 4Z0TA 2X4GA 9LDBA 2VUUA 1P45A 4WASA 5BNFA 1O9BA 4MOWA 2VWQA 4XB1A 1BW9B 3AUSA 2VYNA 2BRUA 4HX5A 3S1LA 2GASA 2O3QA 5A5EA 4FSHA 3IAHA 3NDRA 3V2GA 2Q45A 1W4ZA 1QYDA 1I3NA 2FSSA 1HDGO 4Q3EA 3N7UA 3Q9NA 3VPHA 4IIUA 3WR5A 2YDXA 2OUIA 1K6IA 4R54A 3RAJA 4NJMB 4DLAA 4RPJA 4D0SA 4F45A 4YBZA 4IJVA 5GMOA 1HDZA 5T67A 1Z6ZA 4GMGA 4WEQA 3LF2A 4KTTE 4KWIA 2Y0DA 4AJHA 1CF2O 1UZLA 1KBZA 1PIWA 1YDEA 1GAEO 5JMWA 1YE3A 5B12A 4RO0A 4DA9A 3KEQA 4OH1A 4DGSA 3HQ4O 2AE1A 3D3WB 3P2OA 3DBRA 3O38A 4PG6A 4IDAA 4FFPA 3IL2A 2ZATA 4RJTA 2OOSA 2ZQYA 2C59A 3V1TC 3RIHA 4XZ3A 1TLTA 3DZJA 4GSLA 3JQ8B 4GL4A 2EW2A 3FBTA 2PK3A 4R1NA 1D1TA 2GUGA 2EJWA 2A35A 5IZCA 2VRCA 4XRRA 1O6ZA 2GF2A 4WLFA 4YT5A 1LUAA 1DC6A 3B70A 5C7LO 1ML3A 1GADO 3LQFA 4CQMB 1E6EA 3UOGA 3PWKA 1VKOA 3JSAA 1ZK2A 3HFGA 2AEMA 1K89A 3U09A 2NACA 1BVRA 1P33A 4MVJP 3VPGA 4ZHSA 2O23A 3JQCA 5LDHA 1X0XA 4E3ZA 4E13A 1GCOA 4YEDA 1ZBQA 1GUYA 4R41A 4D41A 1ZSYA 4YJHB 3AJRA 4IZIA 5L9AA 3CIFA 1B3RA 2PA3A 3QLJA 3HDHA 3LT4A 4DXHA 2EF1A 3WIDA 1FDVA 2HAEA 3VH4A 1HL3A 4LVCA 2C2YA 4BMVA 3WNVA 4TMFA 4CQLA 1KVUA 4JCOA 5T8KA 1DLIA 1GUZA 3GEDA 2UUPA 3I6QA 3EVNA 3SBOA 3MJVA 4G5HA 4MVJD 2BELA 1O0SA 1V6AA 4Y6SA 1Q0QA 4N18A 1IULA 2I3GA 3I9OA 3RC9A 1KY4A 4R51A 3D0OA 1DFGA 1B7GO 3Q1LA 1SEVA 1Y6JA 2I99A 3DQPA 3F4BA 3FR7A 3GAZA 3UCFA 3X2EA 3K96A 4HNGA 1LA2A 3U3XA 3KTDA 2E82A 3GLQA 3NTRA 4PN3A 3AFMA 2J6IA 3DAFA 4WLUA 4ESOA 1E3JA 3STHA 5LDGA 5JAMA 3H9JA 1RKXA 1NFFA 3OJLA 3DTTA 3V8BA 4GLLA 2G1UA 3ZWVA 5JAZA 1J0XO 1P1HA 1PJCA 3RKRA 1IHXA 2NVUA 2JCYA 3DMTA 4XIYA 1E6UA 3W6ZA 4JJIA 2P5UA 2OBYA 3G3EA 3H5RA 4PLGA 4PLCA 4WLOA 3UICA 2O3JA 3AU9A 4C7KA 5KTKA 2BGMA 2B4RO 1RPNA 4LN1A 2EEZA 3HN2A 4XDZA 4U6SA 5ILGA 2FOIA 4YT4A 5G0WA 1Z82A 3PI7A 5COBA 1BHSA 2DBZA 2GPTA 1RM4A 1HE5A 4QFDA 4QEDA 4M55A 3WXBA 3GH3A 2IDZA 4CMKA 3PZRA 4AJ4A 1MFZA 5L7YA 2P2SA 3JYLA 5HA5A 3IQDB 3GGPA 2XAAA 3P19A 5B4TA 1TT7A 4RPHA 4AJIA 1O95A 2FZWA 1TT5A 3JYQA 4WOJA 2BFAA 1ZEMA 4NK4A 3L9XA 4MVJH 4P4LA 4PG7A 2QZZA 1N2SA 1IPFA 1MX3A 3V5NA 1EVJA 4MVJM 4O1MA 4P22A 3UXYA 1PR3A 4L73A 1GFSA 1NVTA 4EW6A 1H9BA 1N92A 1NXQA 1VSUA 4QFCA 3TZ6A 3HADA 1DEHA 2EKQA 2G5CA 3ORFA 2JFFA 4DLBA 1F14A 1EQUA 1EMDA 4CUJA 1JU9A 4B8ZA 2VYVA 1PZFA 5EQDA 4RF3A 3WDSA 3PRJA 4A26A 3M2PA 1WLYA 1ZJZA 4GH5A 4DRYA 4FFRA 1PQPA 1BXZA 2JFHA 3U4DA 5A9SB 1NM5A 1UUFA 4ZGWA 3EY4A 5JDCC 1T1SA 4P4GA 2BD0A 3LF1A 1HSOA 3WGZA 2VHVA 4OJNA 1NP3A 1ZK0A 2YY7A 3ZU3A 4C7JA 5DULA 1I2BA 5CP8A 1C14A 4YAIA 4ALNA 3FPLA 4MINA 4BOYA 4XJSA 3VTZA 3A1NA 4BKQA 3FTPA 1YS4A 1QKIA 1RM3A 3NV9A 4IZHA 4E21A 6LDHA 3WJ7A 3PXXA 1OOEA 3JQAB 1E7MA 4B4VA 2BH9A 4NU5A 5IZ4A 4Z0HO 2HJRA 4GPD1 4N5MA 4OQZA 2O2SA 1E0DA 3GZNB 1PX0A 1GR0A 1HDYA 1PJ4A 4JBIA 3OQ1A 4UULA 4CMEC 4QTZA 2D3TA 4BO6A 4D46A 3ZWBA 2W98A 1HDXA 1HDRA 3EHEA 3BXXA 3JQ7A 1KEPA 1RWBA 3OEYA 3Q2KA 3A9WA 5GZ1A 1HT0A 4OHUA 1K3TA 4QUKA 1MG0A 2WD7A 1E3IA 2GN6A 2J5RA 4JJGA 1MXFA 1O8CA 4BKOA 4WPGA 4BKUA 2NNLD 1A9YA 2DBRA 2EV9A 3WLFA 4IIVA 3ANNA 5EPOA 3TQHA 2D2IA 1QYWA 4NBWA 1ULSA 4KUHA 2CZCA 1EDOA 4D3DA 1U5CA 2QX7A 1LC3A 3RSHA 4AICA 4CLDA 2WSBA 1H94A 4IDCA 4AJNA 1JQBA 4BGVA 3R6DA 3F9IA 1ENYA 1GQYA 1SNYA 2G17A 1ISFA 3FNFA 2OBNA 4OO3A 4ND4A 3WBFA 4Y6RA 4CM3A 1DFHA 4O63O 2O3UA 4MIOA 4BNUA 4BVAA 1BDMA 1YVEI 1E7RA 3GUYA 5COAA 5I9MA 2BHLA 1CQJA 3EYWA 2NLOA 4A7PA 3ZHBA 5GY7A 5IDYA 3W6UA 1EBUA 2VTEA 4RVUA 5TC4A 2F00A 5ENVA 3DOOA 3B1JA 4CM4B 4J9VA 3P2YA 4Z3DA 3AI2A 4GSKA 1I32A 1WAMA 2ZB7A 3KOUA 4CJXA 3ON5A 4YWJA 2A94A 4J4BA 4ND2A 4K6CA 2GSDA 3UCXA 1ADFA 5DNAA 4BO8A 5KJEA 1EUZA 1UXIA 3DOCA 3DWFA 2B5WA 3NTQA 1N7HA 3S2GA 4PLWA 1EZ4A 5KJ6A 1PJBA 1XGKA 1R4MA 4E5PA 3I9LA 2O3RA 4FPXA 3IJRA 3BMNA 3WX0A 3NT5A 5HRUA 4NR0A 3C3XA 1ISHA 5AYVA 1I0ZA 1QLJA 1K2WA 4MP6A 1ZK4A 2ZB3A 3H9UA 3OEWA 3F46A 3F3SA 3JD2A 3VPXA 4CR8A 2FMUA 1AXEA 3L4BA 3ZZNA 2H6EA 3GRPA 4CLOB 3QVWA 5I9NA 2HRBA 5IDXA 4FDAA 5I7EA 3ROMA 1AE1A 2AQHA 4BNXA 3U62A 5J23A 1UDBA 3O03A 3BIOA 2EXXA 3UW3A 3G0OA 5DF1A 3KBOA 2WMDA 4UUOA 3JYOA 4BNZA 3OA2A 3DBLB 7ADHA 2R6JA 4XIJA 3UVEA 3CSDA 3Q6IA 3SC4A 1X0VA 5I7SA 4IMPA 2DVMA 4I5DA 1U3TA 4R69A 2R00A 2VWHA 1F8GA 3OMLA 4FIZA 4DQXA 3HJAA 3KYBA 3B1FA 4CMEA 1U2GA 3VZQA 2EG9A 1ADBA 1K6XA 1UP4A 1WP4A 2Z1NA 4OSPA 4I8XA 5AOVA 1HLPA 3IMFA 4IS2A 1MA0A 2Y1DA 4ZQGA 2EKLA 1I01A 2P5YA 3DZHA 4ALKA 3T7EA 3RFTA 2AE2A 5JAIA 2C5AA 5IG2A 1UP6A 2JHFA 2NTNA 4E0BA 5TQVA 1DJNA 1SPXA 5JO9A 3NX4A 3QHAA 4XYMA 4OSOA 3LT0A 1XQ6A 1F06A 2B69A 4E2XA 1RJWA 2ZTUA 3D5TA 3VDRA 5G0UA 2PFGA 4DIOA 4DQUA 2TMDA 3Q0EA 1QYVA 5DOZA 2AQ8A 1LX6A 2CDBA 5TT0A 2PKRA 1DLJA 1EVIA 2DAPA 4QSMA 2WE8A 2NADA 4FJ1A 1WPQA 4XYGA 3K2BA 4BNVA 5JYDA 1GZ6A 4OOEA 2BMAA 2UV8A 2Y1CA 1P77A 1VJ1A 4BKRA 5G2OA 5L40A 3GVPA 4MP8A 1WNTA 4F3YA 3ZWAA 1Y8RB 5DBGA 4OIMA 5KCZA 1EUDA 1OMOA 3DEYX 1ONPA 3RKUA 1BGVA 3RFVA 3ENNA 5B1YA 1X13A 1C0KA 3KHUA 3DBHA 4Z6KA 1F0YA 3GZ4A 1DB3A 3KSUA 2WYUA 3MOGA 5IXSA 6ADHA 5JS6A 4LISA 4BGUA 3IDSA 5BNTA 3GRKA 1YDWA 5AXAA 3UGKA 5TSDA 4J9UE 1HWYA 1Q2XA 3DAGA 2FY8A 2IXBA 3ZWPA 4EUEA 3D1LA 1YB5A 2HU2A 1PWZA 1YONA 4HBGA 5LC1A 4EITA 1YH3A 1V8BA 3K31A 1B26A 1LSJA 5G0VA 1KIFA 5EERA 2IODA 2X0IA 4JQCA 4Q9NA 3PQFA 4NZ9A 2V65A 4JROA 5EL0A 5TNXA 2ET6A 3DL2A 4MIYA 2VZ8A 3JD3A 4JGBA 4WJZA 1E6WA 4YTEA 3ONFA 4E12A 2BKAA 7MDHA 3FCOA 4JK3A 1OZAA 3ABIA 2IXAA 2O4CA 1BXGA 4IBOA 5KNLA 5G0SA 2BI7A 3DZBA 1UXKA 2EW8A 4XQCA 3N74A 4P38A 2BGLA 4LVUA 1CJCA 3TWOA 2DFVA 4IGEA 4UEKA 3W4JA 3OM9A 3W8FA 2OGUA 3AW9A 5MDHA 3NGLA 4B79A 3DOJA 3RUEA 2GD1O 2Y99A 1UXJA 3FRJA 4NG5A 1XELA 1SB8A 3S2EA 2Q1SA 3DBVO 3PPIA 4D3FA 2HMVA 3WGYA 4ZRMA 2XXBA 3KEOA 4F6LA 2GN8A 1DAOA 1IUKA 4TRMA 5TF4A 3CMCO 3ENKA 4ND1A 4A73A 4XCVA 4O6VA 4J49A 3X2FA 1CEQA 2OO5A 2WE7A 4RV9A 3R1IA 3K8ZA 3FHLA 1P3DA 4M1QA 5A3JA 5CEEA 3L6DA 1LU9A 1P44A 5TRTA 3GPDG 2Z95A 3Q11A 4PIVA 4RLHA 3RBXA 3UAGA 4R5MA 3F4LA 2WEKA 4I5GA 4EBFA 2GN9A 5DN9A 1ZO8A 4NBUA 5T5QA 5FYDA 3SC6A 1JKIA 4P4NA 3NTOA 4MVJF 3SX2A 5HS4A 4CLRB 1NR7A 4KUGA 2ZJ0A 4GWKA 1ULUA 1WDLA 4AJEA 4WEOA 1R37A 1I2CA 4RVHA 1CWUA 3IUPA 4XGKA 5IDWA 3DO5A 2YDYA 4MVJA 1H2BA 3QV1A 3RJ9A 1T2EA 4AJKA 1H5QA 3WGOA 1LDMA 3ZV6A 5JYEA 2PH5A 4RGBA 3AI1A 4PRKA 3CINA 2HMWA 3EK2A 1CIVA 1HRDA 2P9CA 4IS3A 2X6TA 4DBVO 1ZEJA 1U8XX 3OECA 3F5SA 4D45A 4R68A 4GX1A 2BF7A 4TROA 3DTYA 1K0UA 4FGWA 1HE3A 4HADA 2WYWA 5JYFA 2XXJA 2JCXA 3FTNA 3D5QA 4HP8A 4YQZA 5IXYA 4OKIA 4RPLA 1PGQA 1Z74A 3DFUA 4R3WA 3CZRA 3NDJA 3KRTA 4RDIA 1V0JA 2YJZA 3E8XA 1QRRA 1PGOA 3HZZA 4QXMA 4UEJA 3ICPA 5CDGA 1KVTA 3ADPA 2V7PA 4M86A 2VHXA 3GT0A 4JX8A 4MPDA 4O59O 1E3EA 2XPCA 2NU6A 4J16A 3T4XA 5BQFA 1HYHA 3GGGA 4AL4A 1NPDA 4EYEA
chains in the Genus database with same CATH superfamily
1SZCA 1VXRA 5C8DA 4RSRA 1YZLA 2J4FA 1JG7A 2Q5CA 2VCYA 4FHGA 3JR3A 4K9SA 1UKYA 3LW7A 1V26A 5FUWA 4EZBA 3QBJA 3KR9A 3KLMX 1RAAA 3IAFA 4IJQA 3FXAA 3FMIA 2G5PA 1CSEE 2ZB4A 2O8FB 4GMHA 3DVAA 1ZH4A 3PDCA 3V4SA 5A1TA 5ARBA 1EE9A 1OLUB 4GXQA 2CNLA 2IEBA 3NVDA 3S3TA 3SHVA 4C04A 3OT5A 3S99A 3FZNA 3B3FA 2PT5A 3DWIA 5AXDA 3ZVMA 2O20A 5FBHA 4GPZA 3CZ9A 5KKCA 3I5MA 1X9GA 1JSRA 4L3OA 1PAUA 4YQEA 2R6CA 1M67A 2BZSA 4Y8VA 1KI6A 3K92A 1E2FA 5FOTA 1WMFA 5H81A 3LG2A 2VYQA 4ZI7A 3BFPA 1QE5A 1XFDA 1Z7YA 1M6WA 4MGIR 3ILYA 3W04A 4ARZA 3S81A 3H16A 3PC4A 3WL4A 2V7QD 3OF5A 4B3FX 1RPZA 3A26A 2AZMA 2YKGA 1BE6A 3U4AA 2QR2A 4O0MA 4C2UA 1P7PA 1P6XA 1UQTA 3M1LA 1QV9A 1FQOA 4M1OA 1E32A 1S0UA 3EH2A 5FTKA 3HZHA 1TLLA 2AQKA 1FVFA 3ND7A 1IL0A 1JDBC 3BRQA 5DM60 1MXHA 1DX9A 5KNDD 3K71B 4W9MC 2CSXA 1FE8A 2O0LA 2R85A 3ME5A 4H0CA 3TM5A 2G4LA 1NMYA 5IWCA 1MNQA 3JSXA 3Q4GA 3DVLA 2XBLA 2MYPA 3IE0A 1KP2A 4N4AA 3W0LB 1OBVA 1Z0SA 4KYUA 3SK0A 4B4OA 4CVNA 1WDTA 5I9LA 2WZBA 5TQ0B 1LTQA 3M5DA 4IVQA 4RJIA 5AVXA 1X86B 1MC5A 2VDLB 5FI0B 3SXUA 2J4CA 1R12A 1C8LA 3PZBA 4WJKB 4NEHB 1AUQA 1G20B 2DQSA 3ZH9B 4Z7JA 5JDIA 3TKYA 4LSWA 2J87A 1PFGA 4IGIA 3ZCTA 1YU6A 1G8PA 3X1ZA 3QVOA 1W8DA 2DTDA 1GLVA 3U56A 3NBUA 4ZC8A 3T3IA 1WB5A 1ZNZA 3ZCXA 2RHTA 4F3NA 5CDYA 3UMCA 2X15A 5JHGB 1FFBA 2Q8PA 3PDJA 1EXNA 5J3JA 3CEHA 2MCFA 4GKJB 3ETDA 3OU2A 3WL6A 4AB1A 2WPNA 2NXJA 2YL2A 4S1VA 3ICVA 5FPHA 4RU1A 1F2DA 1NR5A 2NU7B 5J5CA 3OZSA 3RS7A 3FNHA 1EX1A 3TKAA 2BMFA 2X58A 3A2NA 3LGSA 4OXNA 1Y8AA 5I3CA 4I2VA 4DLTA 5EJEA 3F78A 5GV8A 5CUQA 4UDOA 2QVGA 4PW0A 1LC0A 3VAYA 3IEVA 3WYGA 1E5XA 1BA3A 1LLUA 4E5DA 3AFGA 1CJUC 2BY4A 2PA0A 1KSGA 2YXNA 4A6EA 5IVPA 1T1GA 3TOXA 3II6X 5KVSA 3I04M 4HQ0A 1E5VA 5ECGC 4FN5A 3A1CA 4HDAA 1X38A 3NJ4A 5ES3A 3X1JA 5KBYA 1XZGA 3L0BA 4O2BA 4PFQA 1U3GA 4ZXFA 1K63A 2NT4A 4OGWA 1XZLA 4N5HX 4UM5A 4BFTA 1CUVA 1SUFA 4I1PA 2IDKA 3CZ5A 5AK6A 5BW5A 5CB4B 3GXBA 3QLTA 5KNDH 4M60A 3AF4A 3CF4A 1RPTA 2ZXUA 2IUEA 3H4VA 1VHJA 3IBCA 3CGGA 4L9SA 4LYDA 4TM7A 2DRIA 4U2KA 1M8JA 4A0SA 1PLKA 5CFMA 1VE6A 1F8FA 2HJGA 1NN5A 5BN3A 5AVYA 1YFLA 1FDIA 2C4MA 4UASA 4H7HA 5TQJA 2IYUA 3OZRA 1NXWA 2Q21A 1QRTA 3EN0A 4BQQA 1U7UA 1Q7RA 2ZFUA 3EE6A 3I8XA 1FS4A 1TT5B 3HFRA 2NVWA 2XYQA 1K97A 3VX3A 3ZWYA 3KWJA 2V9ZA 2FWRA 3QELB 5BN1A 2C7QA 3T95A 2PYDA 3P26A 4Y3UA 2O0MA 2HSJA 3NGXA 1P5FA 4Q4CA 1D1PA 1RMYA 2QYTA 3E22B 4KV9A 1AGYA 4F38A 4DDTA 2JD2A 1D2NA 4BZWA 4LMRA 3P94A 4GNKA 4XWTA 5A2QA 2HNBA 4AM8A 4JY7A 4Y1RA 2HLHA 3W2EA 4BRSA 2BF4A 2CDAA 2ZTHA 2OTCA 4YV0A 4CPDA 2IEYA 1EFCA 4H7EA 4BC1A 1E0SA 1BTOA 2BBWA 4FN4A 1I7CB 1U3FA 1H8HA 1L5GB 2NTVA 3ZLJA 2PZGA 2YHBA 2OOKA 1ZZGA 2IVFA 1KAOA 3NBXX 4RK4A 2Y68A 3DL4A 3A7EA 1NAIA 4TVSA 3KZXA 3R6TA 5GZ6A 4Y9UA 1G64A 2QVLA 2B0JA 1J2YA 3CNQS 5J43A 5K0JA 2ZRPA 3PUYA 5KOJB 2NG1A 5B4UA 1B3BA 3TDNA 4LJ9A 2VK2A 3TLXA 3VC7A 5CBPA 1ULTA 1XL1A 1Z7EA 2DZDA 3V9AA 1K1EA 3MWFA 2P90A 4ZT6A 3IT1A 1B8OA 2JBWA 2NU7A 2HU8A 4JLKA 5JQGB 1QB8A 1JFRA 2E3JA 1AN9A 2D7CA 3P4UA 2CW5A 1TD9A 3UBMA 3Q3IA 4BMDA 4C89A 2CNOA 3BULA 8GPBA 2H1RA 3IB3A 3F7NA 4EK9A 4IKEA 2J08A 2XD9A 1DJOA 4MRRA 4LXUA 1FLVA 3HUEA 3QYFA 4J4TA 3CZAA 4POAA 4WFKA 3B20A 2H59A 3VR2D 1RHKA 1BMDA 3NETA 4DSOA 1E3SA 4F5YA 5BSGA 5MFPA 1E7WA 2ZWOA 3GLUA 3LPDA 1FMFA 1V5GA 3EQ7A 4EABA 1IHDA 1EK0A 2CMDA 4PSCA 1L4BA 1BH6A 3TBFA 4B76A 2ZJ4A 2G76A 2JH3A 3QRWA 4WSOA 4K2HA 2HT6A 4JENA 1EEHA 1UP7A 2CLEB 2W2TA 3PTAA 2V7BA 4OP2A 1QVZA 1C0PA 1JLLA 4URUR 1V43A 1ZSNA 2P27A 2W6ZA 4YRJA 4UUNA 1NJ6A 5AVRA 3AUYA 3KXIA 1T3ZA 4Q18A 5CA0B 3AT1A 4N0MA 4PPFA 3ROFA 2YXDA 5F78A 3VNBA 5CLQA 1U1EA 1RBMA 3V8RA 3B3GA 3WB2A 3HXKA 4OA5A 1O96B 4EBBA 3IR5A 5EXTA 1BWRA 1NUTA 4LF8B 4FIDA 1THMA 1CJKC 1HKUA 4FZ5A 1KPGA 3QELA 3L8GA 1ITZA 2V8OA 4ER5A 1TF5A 1U0NA 1AVTA 2RGBA 4L50A 4Q3NA 3D8UA 4R1LA 4G4SP 4BZQA 4PO3X 1NRXA 2WDZA 1DC7A 3DUWA 3TQIA 3V8MA 4D0LB 4CXMA 3PQVA 1LDYA 3EP8B 5FWXB 5THQA 3CWCA 2O8DA 1XDDA 1D5WA 3CE9A 3OLVA 5IK2D 2WP0A 3P9ZA 5LKRA 4RDCA 2IIQA 4UFOA 1KH2A 4QULA 3F5MA 2VP3A 5TR9A 1AH2A 5C3MA 4W63A 4GI3A 5EIHA 3FKQA 1XMXA 2FX5A 3JPYA 3BEOA 1Y5NA 5J9GA 5C4MA 4K9RA 2G70A 4EB3A 4LJSA 1WZEA 4LQ4A 2VHCA 3VO9A 3CMMA 2VNKA 3L4BC 4LHSA 3TW8A 3RIEA 3B53X 3RS8A 3I0ZA 3ICCA 1NBOA 2J0EA 4IOLA 3QLUC 4QXRA 1ENZA 1KMHB 2JLCA 3G79A 3N2NA 1R0LA 3NUGA 3TZBA 4KRGA 1P2FA 5A5FA 1UC5B 2AOTB 2P9FA 2QY6A 4KFUA 3RYCA 1QU2A 2G67A 3AESB 1QJCA 3BXOA 2XR1A 3UV7A 3GLVA 4RLFA 5JQGA 1G4HA 3R5TA 4KWEA 4D96A 2HO5A 4RF2A 3O1JC 3T54A 4F91B 2R00C 5CDUA 1Z7GA 3OI7A 4XGNA 5A6VA 2Q4EA 5IEJA 2DU8A 1YAHA 4MHSA 1PBNA 2B36A 2AUTA 2ECQA 4L7QA 2Z2JA 3OFND 1A82A 3DEIA 1Z5VA 2MINA 3FSGA 3H6KA 4D6XA 4NXMB 4BV3A 3R8CA 3KPJA 4NH4A 4ENRA 2R87A 2RBEA 3R3VA 4R7ZA 4DQKA 5EXPA 2OZVA 3L7OA 2PZEA 2IHYA 3W1EA 5JLJA 4DR4B 2NNWB 3WA6A 4UNSA 5DMXA 5REQB 2RE8A 1XKTA 2E87A 3EIQA 2C9OA 2H31A 2IY9A 3NJ8A 2NV2B 3O4IA 1JLHA 4WECA 2JG3A 1ZONA 1DU4A 3OJ0A 5DLDA 3HLTA 2KBEA 2BE7A 3RVDA 4BB5A 2Z6UA 4NHEA 4TLAA 4HC4A 4N7RA 4JUCA 2JIRA 3DEFA 2XRMA 1N3BA 1FA9A 1STOA 2UVDA 3L92A 3PJDA 3W3AD 1W9HA 1I7PA 4E33A 4QYIA 3Q7TA 4EUNA 1KFCB 3ITNA 2GZ1A 2FI1A 2O2YA 4ZV7A 3ZKWA 4EHAA 4XUCA 2CCKA 2O19A 4FYHA 3PJGA 4QTUB 3LUCA 3WI7A 1EFHA 1J97A 2LTAA 3IUSA 3VR5A 1GUBA 1B4DA 1XCOA 5IAAA 5KNBA 2TS1A 4FWTA 3HNPA 4BU1A 4FKMA 4YJFB 1W19A 3ANLA 3ZXYA 1BFDA 3GC6A 1MAHA 2XT9A 3MHPA 1MX5A 4M98A 2WTBA 2XQGA 1TVKB 4GGOA 3A28A 4MX8A 1F17A 4C7XA 1GOTA 5C34B 2BIFA 2GN1A 4H4EA 4YAGA 2XWPA 3Q0TA 3ROTA 1OLSB 1KAQA 1LSUA 3CZQA 3HEAA 1JFSA 4BTVA 1GL6A 4N9QA 1JIXA 5CA1F 1F6DA 1FOEB 1Q50A 3OAAD 1UMDA 5LXTF 1QCYA 1DWQA 4FR2A 1PRYA 2QAGB 1GSOA 1P6UA 3H5LA 3MJ4A 4BVFA 1XL0A 3W2GA 3BA1A 3C3WA 4S2EA 1FDUA 4Q9IA 3PQ4A 2JI8A 2G9RA 4GLOA 1DQYA 2ADFA 4MUJA 2IZ5A 4S1TA 1SHJA 4DQDA 3U19A 2JHGA 4G6ZA 3H5TA 1NNI1 1TCBA 1W75A 5CW1A 1OT3A 5IT9A 2YOGA 3IVCA 1V1MB 2R1TB 2RI6A 4M0UA 4WKGA 5EXDA 3UWSA 3B13B 4A36A 2WJHA 1JJVA 4MVXA 3HUTA 3QBTA 5H9VA 2WAXA 2YNMA 5CNKA 4FYYA 3E58A 1B8UA 4YCSA 1M1UA 2PUGA 1UM9B 3WLRA 2FWPA 3GVHA 4WE3A 2I2FA 1ZZEA 3L0IB 4FMDB 1KJ8A 4TT3A 4XD7A 1LDBA 3JYNA 5ALKA 5HS6A 1GPJA 3WJ1A 2ZR9A 3E8MA 3V55A 2IOHA 3NHYA 2CZGA 3D59A 1UOOA 1O94A 4AZVA 1TM3E 4DDHA 5A4KA 5C81A 4I46A 1WG8A 4KXWA 4XTCS 2ZRNA 5LQAA 1GUFA 3LWNA 5KDLA 5ICFA 4B6RA 1EGVB 1FP1D 1EBFA 1Z47A 3WDLA 3WYBA 1A9TA 2R8ZA 4WZZA 5FT9A 4IJ5A 5KYXB 1WABA 3RSSA 1EXDA 4JT4A 4LG1A 5FA5A 1LLFA 3NKLA 2FF7A 2FN8A 5DZSA 4X1IB 4IZOA 1P2GA 3JARB 4BMYA 1WB9A 4ASUA 1E63A 2O3TA 3D8HA 4NC9A 1CW2B 2AFIE 3DZDA 3EIWA 2ERXA 3ZE2B 4RTKA 1NBWB 1UT6A 1Z26A 3L8YA 5KTMA 1WS6A 1ZD9A 2M32A 1V4BA 2Q9AA 4JB8A 3DE4X 4X84A 1XN1A 3T5CA 4C7BA 1IN7A 1FPMA 2JDIA 3AHHA 1XCPA 1GFWA 3IMEA 3FGZA 1S8OA 1T0BA 2GZ2A 2AW5A 2ONJA 4EHFA 4EB6B 5I7VA 4CMAA 1JH8A 2AJTA 3TR6A 3BJIC 3TFQA 1TUIA 1SG9A 2SKEA 3M5PA 4XWAA 5C8YA 3W7VA 5HBRA 1RI4A 2RHHA 1DBPA 3P9IA 5KVQA 1EE2A 4YJFA 2BMVA 2OO5C 2HA4A 1YC2A 4GPBA 1JZSA 1FXSA 1K7FB 1G4AE 1U28A 3D6FA 3KIPA 4IG9A 5CJJA 3LUGA 5JEEA 2B8EA 2PUTA 2Q6KA 2DEUA 3BTUA 2Y4OA 1NJFA 3H11A 3I39X 5FBLB 4G1VA 2W43A 2CLSA 2ZRHA 3RH0A 4FQ8A 1CDDA 1PD1A 2I4NA 5JAPA 1I33A 2ATIA 4EAQA 2WSMA 3HXPA 3EXG2 2Q0QA 5I4KA 5C46F 1L5SA 1B2LA 2WPDA 3QBVA 3ZWKA 1SU4A 2NO5A 4EPYA 5JJCA 1LLDA 4UNPA 5HJ7A 5HZHA 4A1FA 3NUZA 3WLLA 2BP7B 4BVLA 4GXNA 3IOYA 1SC6A 4IWXA 3QOWA 4JT8A 5CLHA 4PIPA 4B3TB 1LZKA 5GONF 2RH4A 3DD1A 2XAUA 3P2MA 4L0DA 1OZFA 1Z8HA 3DLCA 1DC4A 2ZI5A 1BKYA 1JH9A 1JAXA 2PKCA 3ZYZA 3MWDA 1ND6A 3MQ2A 1AKNA 4YCMA 3HWX1 3UNXA 3R9XA 4E5UA 1JXMA 4ONEA 1AJEA 3L8HA 4AQYB 2YMPA 4KWHA 3D8TA 4HLNA 1Q0HA 1NVBA 1QOZA 4KPYA 1NF9A 2XNHA 3IOMA 2G3YA 1PGNA 4ZRDA 2PSEA 3I30X 5AXCA 4E09A 3H8SA 1XG5A 3PB3A 3Q5GA 4TZKA 5EZYA 1TMKA 3ZK8A 4F9FA 3SIRA 4ZVOA 3OPYB 3CZCA 2HIHA 5EJFA 1K7EB 3KOYA 1VCIA 2JJ1D 2FSPA 4DR5B 3QVXA 1MV8A 1O6CA 2JZNA 4KZPA 4UM9B 1SB9A 1OJLA 3A0RB 1OAOA 4BMOB 1DBWA 4UDNA 1Y6ZA 5DBIA 4YP7A 2AT1A 1F4PA 1IBRA 4KVGA 3THYB 1MUUA 2QN3A 1K8YB 1P2UA 2FK8A 3N2KA 1WZCA 2E48A 5TGDA 1YJQA 3KO8A 3PD0A 1P62B 4RGVA 2GBPA 2JAUA 2PX5A 3EFOA 2I6FA 4KLZA 2V1UA 3RJTA 2QL6A 3MTGA 2J7PD 5ARDA 1DAGA 4Z0NA 1A5TA 1ZGAA 2JNWA 2GZ3A 4RQAA 2C0CA 1XROA 2X8WA 2H52A 3KLPX 4CEJB 2CFRA 4GLFA 4JJAA 4TQAA 1NV8A 3E84A 3C3KA 4HGQA 2FOLA 4TL6A 1E94E 1XLVA 3DNFA 5DTEA 2BR3A 3IT3A 5LPNA 4QOIA 2LCIA 3MTAA 2POQX 1XK6A 2GXSA 3C2QA 2YV2A 4FE7A 3V00A 4EB6A 5C5DA 1LK7A 3H5WA 5L3ZA 3IJEB 5F5NA 1YCHA 1FU4A 4V0ME 2JARA 4DN6A 1HTWA 3DZCA 2PE5A 3RSLA 3ZE9A 2ZUCA 2JCGA 2QA5A 3H2GA 5FI1B 2LR0A 1DHRA 5A02A 4NNOA 1BAPA 3SVLA 2WB2A 2WHPB 3ZCPA 3DMGA 2XB4A 2I65A 4KP7A 4DW8A 3O8QB 3DMRA 4B82A 3AH8A 3IHKA 1O03A 2IHZA 3FNRA 3VM6A 3DR3A 3GBVA 5LQJA 3MG9A 4Z0PA 5LFAA 1BN6A 3ZW8A 3MHTA 1KR5A 3EPAB 2HBQA 3KVOA 4HAVA 3UB3A 1XVLA 4YRRA 3WK9A 2CV0A 3TJRA 5A05A 2B4TO 4RHYA 4RW0A 4N65A 5TDHA 3A9RA 4DCCA 2X40A 3PUJA 4HXYA 4U7GA 5BP7A 1V16A 2ZT7A 4KO2S 4C4ZA 3W6NA 1NVVQ 1L7VC 2GDZA 4AKTA 2PZ8A 1W9MA 2HNAA 5AK0A 4N39A 4DGQA 1N6KA 3K9LA 3A25A 4P3OA 2RGGA 1XK7A 3OKAA 3UT5A 5IKEA 1XJWA 1Z5OA 1HZJA 5TF0A 2X76A 1D2MA 2H16A 4PCAA 3KXDA 3LBYA 3MINA 4DWVA 1ZCFA 3K1JA 2A8YA 1G7CA 5FLEX 2EAUA 2FQXA 1QNLA 4YCNA 5JZBA 4AKIA 3JQPA 1EDEA 3P20A 4MW4A 4NZYA 1TYAE 3RLIA 1YT5A 1IIRA 4B43A 4IEFB 1VCHA 2CMKA 5JDIC 2XUQA 1C7FA 1R66A 1ZPDA 4F4JA 4XQ9A 2MT9A 2WF7A 3IXQA 4GUAA 1I36A 2Q5FA 4LQLA 3ROQA 3RJZA 1LRKA 3NBAA 5E6RA 4BX2A 2DT5A 2WWWA 4RBNA 2IV7A 4BLUA 3VH3A 3GPLA 4F4FA 1I4TD 4JD5A 4F92B 4P82A 1JSCA 3QG1A 3M34A 3S44A 5CCEA 3BVPA 3BBLA 3B1KA 3DUFB 3LQKA 2G06A 1RXEA 2CXSA 2QTFA 1MB2A 2WUWE 3AHFA 3H8WA 4Y9SA 1LJ8A 4NDAA 2EIHA 1PP4A 2YCLA 3W1VA 2IU3A 2WIAA 3KJHA 4PZ9A 3PRKE 2OP1A 3BL8A 4M4SA 5EWLB 1S6YA 1YVUA 5TXGA 4H3SA 4EHBA 3IEIA 4GXRA 5DI3A 2IUUA 1AMNA 5NLLA 2EBWA 2WHEA 5ILOA 1WV1A 3OZTA 1ANKA 1OROA 4ILKA 5CCBA 3Q3VA 2BC9A 2XKJE 4KXMA 1RYBA 2W6CX 3KZOA 1V41E 1ID1A 1V8PA 3VISA 4PYOA 1ZL0A 2FFHA 3ZV3A 1UEIA 1U2DA 4ZOLA 3RE1A 3E5HA 1DOZA 3AL3A 3MWKA 2NUAB 1ULZA 2C84A 3VUFA 3K53A 4HLQB 4MWDA 3QP9A 3I2JA 1FDRA 4G4SO 4ETIA 3BZBA 3CS3A 3G8CA 4OPMA 4K03A 4MYSA 3I5AA 1GGMA 2Q3CA 3ZHZA 3K70D 2AFHB 1XDUA 3SEQA 1QR6A 5F98A 1P1KA 1W1UA 2B37A 1XRJA 3WQQA 3HP4A 4CI9A 3EIXA 4NFYA 3DHYA 1Z06A 4B4KA 1NN1A 3NS7A 4NRDA 2ACVA 3VH2A 4B4UA 2W2LD 1T2AA 2ZR0A 1V1RB 1EM8A 2WC1A 3A2LA 2EVWX 3K9CA 4KLAA 4WBNA 1IATA 2VLBA 2WLSA 4RA9B 4A2WA 4AP6A 4EA9A 1YOBA 3PCXA 4OLBA 2PV7A 4I4CA 4CM6A 3FSJX 5CHEA 5JNVA 3R5XA 4B3HA 2V3CC 1P7ZA 2VT7A 4I1IA 3RQIA 3PJRA 3A4MA 4CEHB 1GTZA 1TVEA 1XLWA 3IQZA 4ZAZA 1YQGA 3QJ5A 1CZHA 3DDZX 4G89A 4R0MA 1N2HA 1V25A 1W59A 3HV0A 3PQDA 3WLJA 1EK6A 1NN0A 3WMEA 4HSGA 4OHRA 1ISIA 3AUFA 5CM9C 5EHGA 5KYYB 4IMIB 4QU5A 3K1ZA 1R0SA 2EDCA 3UTDA 2QLMA 4LYJA 1IN5A 4HK4A 4Q15A 4FEEA 4L0QA 1Z6TA 3ETCA 4BQNA 4F5DA 4E2WA 1C7IA 5D85A 2RAFA 4AD8A 3LL7A 2V7GA 4TMKA 3TFOA 1M2VB 3SX0A 3FAZA 1OCEA 1MQ9A 3EBOA 1KOFA 1II8A 4PSKA 1DUSA 1NT2A 4DIBA 1Y89A 2ZTSA 1WKCA 2FMFA 3F98A 3HR7A 3K2IA 3N7AA 2IYAA 3OPQA 5EIBC 1UF9A 1JIJA 3BJZA 4RVSA 2O2DA 3NHFA 3G8BA 4BUJA 4M21A 1BZYA 1E1CB 1JQ5A 1EFKA 1U2TA 2P41A 4LXGA 5K09A 2KX7A 3R0JA 4QUDA 4DE5A 4C1NA 4G23A 4IUDS 1YCDA 4G26A 1E9VA 4PYRA 2ODTX 5DDIP 2ZUBA 1FIUA 2Q2WA 3IEXA 3U5ZB 1EFTA 4X1YA 2IYPA 1PZMA 2H4YA 3EY9A 2HRQA 2CNDA 3FI9A 2VHTA 1J0EA 1BS2A 1K3FA 4TKVA 4K05A 4EX6A 5F23A 5JPCA 1G19A 3B12A 1GV0A 3LY9A 3GN2A 4GDMA 4ZDIA 2JK0A 1HDEA 5EZ6B 4KI7A 2E1RA 4AWBA 4Y1EA 3TNLA 3I32A 2EWMA 3MGCA 4L6CA 3RUIA 1BFKA 1TMYA 2G09A 2RH5A 3TTYA 2YHIB 3P45A 3D3EA 3I12A 4QELA 4ID3A 3CR3C 4WD3A 2P1RA 4Y67A 3ZPXA 3BMCB 1MRSA 3NC0C 5F3DA 5JNRA 3HO1A 1DDGA 2H1LA 3DLAA 3TTSA 3HCCA 3S68A 4FR5A 4R8SA 4BGIA 2GLTA 4GR9A 5DYTA 2EZ9A 4HNAB 4HH0A 3G0IA 1NYRA 1MGPA 2P0AA 5KYWA 3JRNA 4R31A 1AUXA 4F12A 2J5QA 3F1LA 1JIIA 1VXOA 2VNHA 3DCIA 3H5IA 2ZIFA 1DG1G 1V1RA 2X5NA 3ETHA 4QQRA 4ZOCA 3DV2A 2HMUA 1VIVA 3FOFC 2BUBA 3KCNA 4Z4HA 3ORQA 4JLVA 2F8MA 4I7EA 4D4GA 2PX6A 4DEXA 3CYFA 3HCFA 3MUNA 4C76A 2ODBA 4ZICA 4GGMX 2QRNA 4M8LA 3N39C 1I5RA 1CG6A 4M0KA 3W8DA 2QN6A 3HJNA 3O4JA 2OA0A 1JT2A 2QTZA 2WJPA 2EARA 3EIHA 2Z5LA 1Z2EA 3EZGA 1GJRA 3NDIA 1UBGA 4H18A 2ON6A 1PBTA 4N7JA 5ALJA 2J33A 4D3ZA 5KAMA 4JT9A 3MF4A 3O8DA 1CR1A 3SICE 2VQDA 1Q44A 1VLVA 3WFJA 2DWUA 1Z62A 1W8IA 1N5KA 1SCKA 2BFWA 2WHRA 1ZU4A 3QTBA 3E48A 3RYIA 3TOVA 1PYDA 1P4GA 1A4IA 1BXRB 2EHDA 3L04A 4KK4A 3RHZA 4DJTA 4V0NA 2GHQA 1X7ZB 3KV1A 2RKWA 1X1TA 3I1FA 4KACA 2X8JA 5IVIA 4QM7A 3KDSE 4GZLA 4OXQA 1TM1E 4IICA 3ICQB 3JASB 1YBMA 2GYYA 1GTVA 1OF1A 5A4DA 4OYLA 1HYEA 3RQSA 5J2UF 3MT0A 4CV0A 2HNKA 3PT9A 2FN7A 5BSFA 4DJEC 1ZJ5A 3W9UA 1NBAA 3OH8A 2D5CA 3WIUA 3WGGA 1IZ0A 4MQMA 1ZGBA 1O9HA 5GIPE 1RBZA 3ISTA 4OJTA 1CBUA 3PTZA 2ODAA 3AG5A 3PEFA 1KORA 3KWLA 1KKUA 2FSHA 1TM2A 2QGZA 2BEWB 3IIIA 3DCNA 3MEQA 1IQ0A 3R7AA 1I6WA 4FD2A 5C1BA 1IQRA 3E7PA 3DFKA 3N8GA 2VIIA 3OEHA 1JI3A 2OCBA 3H0EA 4FDUA 1PFYA 5HE9A 4W8GA 1REQA 5CU7A 1NJGA 3SC2B 1SC9A 3IA7A 3UJCA 2ZVQX 3TPFA 6ABPA 4BGEA 4YFYA 3L6CA 1XU7A 2QOEA 4HKTA 5F21A 4O89A 3CRW1 4C4OA 2O2EA 1MV5A 2C7OA 4HWKA 3VTFA 1PZEA 4GWLA 2QMOA 4PGFA 1E2NA 3PEYA 3PFIA 3N0XA 2JGMA 4NOMA 2GARA 4K9OA 1JBKA 1SUBA 1E3WA 4FR0A 1RYZA 1I79B 2F3RA 5KIAA 3CG4A 5EJ7A 1MABB 1WPGA 2DBQA 1UMKA 2AEJA 1PUIA 5ESWA 4CKWA 4DAEA 2A9KA 2NQ8A 1BGXT 4IDFA 5AJUA 1ZM9A 3DS8A 1OREA 3ZIDA 2CUZA 1XZAA 4Z9FA 2O9JA 3MJEA 3PQCA 1VDZA 4WVFA 4BO7A 3WRYC 4ZYWA 3OKFA 4C0SA 3F7TA 1IMOA 1E79A 4LA4A 1Q57A 2AJ8A 2Q2QA 3G1UA 3M1AA 1Y48E 2G0AA 3WFIA 5C7IO 2WFMA 3KBBA 4TXJA 4A27A 2WOJA 4U7HA 1T15A 1F3OA 4ZT2A 5LIRA 2XUAA 4J43A 4ZXPA 2UXDB 1O1YA 2DJ5A 2GPAA 3MJSA 2R0QC 1SXJD 3BGSA 1EVQA 1YQXA 1ZWKA 2HJHA 3UQZA 3AKDA 2WZQA 2OQRA 3TEMA 2CD7A 3P9CA 2EKZA 4KE8A 3ZGOA 3ETNA 3BGWA 2ACEA 3FIJA 4D8YA 5CFNA 5IAOA 1Z36A 3N28A 2MMGA 3ZV7A 3C3YA 2H2HA 3DMDA 1UZAA 3DCJA 4JYZA 3LBFA 4ZV4A 3COYA 3MD0A 4LMBA 3UIEA 4GZ5A 4BLRA 5BV0A 4JI2B 2Q50A 4JXXA 2V6FA 1TO1E 2W8ZA 3DT8A 4JLJA 3R8FA 4HPJB 1G7RA 4A8JB 3JASA 3NTUA 1I10A 1W5FA 2FV8A 4Z7OB 1FQJA 3ADOA 3ELWA 3R5HA 4NPHA 1E99A 3HYSA 3K9GA 3AV3A 3A06A 4JITA 5JW6A 4LQDA 3QXCA 4B71A 4DNPA 3TTVA 2GCOA 3KE8A 3ZBPA 1DARA 2BBTA 2QMHA 2FZ5A 2X2FA 2K4MA 1CFJA 3V33A 4IJKA 3GP3A 1PG0A 1YMVA 2X5OA 4REQB 2XOEA 3JD0A 1QR2A 1Y3DE 3KTAA 1T34A 4R2XA 4AN4A 2YNMC 5TQ2A 4D74A 3OQMA 3MOIA 1NI3A 1NUHA 4CG3A 2EKPA 3UJ8A 4C0HA 3N2GB 3PE6A 1UK7A 2VP9A 1JVSA 4ROTA 3TW4A 2ZBFA 1MPXA 2GBIA 2FPRA 4P3KA 5IC6A 3SC2A 1MR3F 4FX2A 4LFBB 4KAXA 4KPUA 2XF2A 3NNSA 3GOQA 4DC1A 2MTBA 2Y0EA 3S4YA 5ALVA 1XNQB 3GT4A 4ZQHA 5CA1B 1H2XA 4G9BA 5LXTB 5K2OA 4CIAA 4Y2SA 2NWQA 4G81A 2ZDGA 2VO1A 3EEIA 2B2NA 3GDGA 2RK6A 5KYGA 4N3BA 5CMLA 2HHLA 1AKWA 3HGTA 1LH0A 1SOVA 1WZIA 2FR1A 2ZRFA 4DJFC 2J46A 2J3JA 1Y81A 5JH7F 1XQVA 4FLEA 3KTFA 5FUYA 3K4HA 3QU7A 4ZAFA 3V3TA 4BFCA 2GETA 1RP7A 3TQTA 1EVYA 4LNAA 4HVCA 1EP3B 4JOCA 1WVGA 3KB6A 3ZTWA 5AIAA 4DLWA 1UZNA 4R1UA 5AUNB 1X9IA 1YK0A 2ZBGA 3VBCA 3OE5A 2M1ZA 2R5FA 1QTIA 3ER6A 4XYBA 3U40A 1X7WB 4NBLA 4DL9A 1PFKA 5MGBA 4UJ3A 4R8LA 5K2MA 3HP1A 4MTLA 4B45A 1JDTA 4QC2A 3BL6A 2B8JA 4OJYA 1Y5MA 5KI6A 3DAHA 1XMSA 2H1FA 3BD7A 4K26A 4EYOA 4Z1MD 821PA 2RD2A 1KI8A 1XXHA 4RTMA 5BT8A 4ISCA 3KETA 5CLJA 4YP9A 3K4PA 1KF0A 4FFLA 3EP6B 2FPIB 1XRLA 1U28C 4UARA 2R3SA 2D3WA 1J5EB 4RDHA 1G2PA 3IJPA 1HETA 3D1JA 2VYND 2FPKA 3K73O 3GB9A 4IOMA 4B31A 4OK6A 1CQXA 2Q3FA 3HSKA 3RVLA 1T2FA 5F1OA 1L4GA 3ZTTA 1KK0A 1U3UA 2PR7A 4YJKA 4KFSA 4TOIA 3GNQA 1CY0A 3ZR4B 3KX2A 3MTJA 1RKUA 5F2NA 3UWDA 3NO4A 2VUTA 1MPTA 2F1RA 2P8JA 3I23A 1A1SA 2FZLA 1P75A 2H00A 2QJRA 1PR5A 2YVAA 4V24A 1E3TA 2Q8QA 4LHYA 2GUWA 2XB6A 1U5AA 5AH0A 3T9DA 1I13A 1CEYA 1BDJA 1QMGA 1U0JA 1UC9A 1PJ3A 2DHCA 5F1YA 4KGZA 3URMA 2VH5R 1Z5PA 3V4LA 2C2WA 3E0XA 4BUCA 2RGRA 3A6PC 5TARA 4OHMA 4MB0A 3LHFA 4G0YA 1GA6A 4GI5A 2OK8A 2MWMA 5C80A 4B34A 5JO0A 1SD2A 4JSYA 2VAVA 3SQNA 3LUAA 2RAUA 3V48A 1R4ZA 1DTSA 1YOVB 1KA9H 4LJKA 2AHRA 1XEWY 1U3CA 1DAEA 4B3JA 4NZOA 2CXQA 3N2GA 3ZJVA 2GCNA 1B0ZA 2O8EB 1OFUA 2ZUSA 1NIPA 4N82A 4OHWA 1F12A 2D1RA 4O2LA 3LCMA 2B4QA 4P53A 3TI7A 1CUAA 2PKXA 4MICA 3M6VA 3CLVA 1TPZA 3SOPA 5B37A 5DLEA 2R6R1 2PG3A 5LMCA 4HB4A 2EQAA 2R48A 4UUPA 3VYVA 2F55A 4JB3A 1AGXA 4HDSA 3PLNA 3T1OA 4DWWA 5HHTA 1EINA 1YV9A 2B35A 3ESAA 3ICEA 1CQWA 1Y1SA 4LYEA 3PEWA 3RU7A 5LP6A 1BC5A 1UJCA 5GONB 5TMDA 4BQFA 2RJ3A 5GJCA 3UMRA 3X2EA 4DNFA 1V3QE 3GW8A 3H2BA 2OYCA 5TV2A 5BQXA 3PR1A 2VAWA 1A4XA 1XMVA 5BY2A 5A9SA 3K30A 4YO8A 2NZVG 2I03A 1YRHA 2R6AA 4JH0A 4WNAB 3ZNOA 4BNTA 1AKRA 2NZWA 3S8MA 3ADDA 1VMIA 4WXHA 5DN6D 4L4XA 2AK2A 4MQUA 3R7BA 2X0EA 3Q9UA 4KNVA 3TR0A 2BLNA 3EZ7A 4C3ZA 4DARA 4MCIA 1NMQA 3TLMA 3KKKA 3K2QA 4YJ2F 3ZDXB 4J91A 3ZWWA 5GWXA 3ZY3A 4P98A 2DWPA 4BBZA 2RFLA 3C3CA 1NYTA 3RBVA 2JJ2D 2XQFA 2EFCB 5C5IA 5JVDA 4ZKEA 4G97A 3TOZA 2P4UA 1Y4SA 1JR3A 3ZZTA 4KQHA 4Y1GA 4ZHQF 2O8CB 1FDOA 3BMQB 5K3FB 1JHPA 3LRTA 1OHHA 2BMWA 2FPLA 3ZWXA 2LIPA 2AR7A 5TY0A 2NZ8A 1DIAA 4NFHA 1BN7A 2IYSA 1YVRA 3RO7A 2EFHB 4O5OA 3W90A 2OM6A 4EVIA 4UQLA 2DKNA 3RPEA 3O8CA 3EWIA 5GVSA 4D43A 3HZRA 2EL7A 2HV9A 1OGIA 1IPHA 1C30B 1D0IA 3SIXA 1LPAB 1JT9A 4MV6A 4JUAA 3I6YA 1K6MA 1ENPA 3Q3CA 1DOAA 4M1WA 5AM5A 4DLNA 3VYWA 2IPXA 5CCXA 1SWWA 2UYOA 3MWYW 4RLSA 5H02A 3AR4A 1U5BA 1JHVA 4BE7B 1L4KA 2VT2A 3G0CA 3PNBA 1FU7A 2IYLD 4LYGA 1SRQA 1RJDA 4I9NA 1ZCBA 2X6RA 221PA 5EY5B 3K6JA 5JRZA 3WGIA 4WLVA 3SFZA 3FYUA 2V98A 4OXXA 4MMYB 3L7IA 5LMUB 1DUIA 3DDNA 2ZRMA 3VZBA 4BO2A 4TLMB 4U9UA 1S8AA 2V3WA 4UKDA 5BVGA 2X1VA 3RSOA 5L6MB 2XODA 4I4TA 2FSFA 1U9IA 3BGIA 4C87A 1VL0A 4OM8A 3A9TA 3RNOA 1C80A 5A0VA 1MHMB 1J8VA 4ID9A 3OSUA 1T5LA 5HW0A 5JBIA 1JTFA 3CEJA 1ZD5A 4ZCTA 1M2OA 4K9NA 4R3UC 3PQ5A 1U4OA 3ET4A 1TTQB 2C7GA 5F1PA 1HY3A 2GFIA 1BQ3A 2HX1A 1RJ9B 3E3MA 4G84A 5EIFA 4DIFA 2ZJ8A 1Z4PX 5HPYB 5DEOA 1E62A 1O95D 4FILA 3OKPA 2WJGA 4Q9AA 5FFFA 4X64B 4AZSA 1V7QA 2HYIC 5J4KA 3GAMA 1IPEA 4DEVA 4L8WB 3FUWA 3UMYA 2ZCVA 2H85A 5CLLA 1N9ZA 1CZLA 3U48A 1U02A 4FGZA 4N8DA 1S4QA 3R6LA 1SUAA 1U2DC 2DPLA 4ALMA 4B83A 1P1IA 3ZOKA 4NCIA 4QDZA 4EHHA 2FJ0A 1IQPA 3LXRA 2AXNA 2OECA 4KXXA 3SIWA 2Q0XA 4HB2A 4Q48A 3GDHA 3WK8A 5U4QA 5HKKA 1X1EA 3U6BA 2QUKA 4ZQFA 3KV3O 1VYUA 2BGUA 4IHJB 3DTVB 2BEJA 4JNKA 4CTKA 3EF0A 3ELBA 5AVOA 2QUZA 2R1VB 4R1MA 2C9YA 2Q1XA 2XYPA 2XVMA 3P9YA 2D8AA 1ZH8A 3HCEA 4M83A 2PGLA 1M8GA 3CH5A 4LZZA 5DIFA 3U0BA 1E64A 1BQEA 1PE0A 3TBKA 5AKGA 4GUDA 3F9RA 3FNEA 3I0MA 4KKXB 1T3SA 1R74A 1BDBA 2ZWIA 4JJKA 5T6MA 5CX1A 2F43B 3E81A 3I8OA 1SJ9A 1G4UR 3IULA 2GS9A 4YYZA 3DBLA 4INOA 2HF7A 5EWMA 3BN3A 3S1AA 4P36A 2YN2A 3PFKA 1HFEL 2Z1DA 3KQMA 2YVUA 1PGPA 4MA5A 4RGYA 3CVOA 3GNLA 5CYGA 2X86A 1ZX1A 1UJ2A 2D1TA 4G5YA 4KXYA 3RSQA 1BFUA 4WBSA 4DKXA 2PD4A 3W4KA 1HYBA 2R60A 3NT2A 2QE6A 4MYDA 3U39A 4BAUA 2ZSDA 4GX2A 3SDSA 2I4TA 2C4NA 2PL9A 4KJXA 3DBIA 2A5JA 1QZXA 1V8DA 3GEIA 4MLCA 4Q3BA 5IAGA 4E5SA 1BCSB 2WWIA 1QDLB 1GPYA 2V0NA 1D03A 1ONOA 1PJSA 2Z2YA 3A36A 5BQPA 4YXFA 2YWJA 1NP6A 1YL5A 2B6NA 3DZKA 2GBCA 1L7OA 2SCUB 3EG9A 3FUTA 1S3SA 4UU0A 3V7NA 4ATNA 1TA9A 5BOSB 1MGOA 1OIWA 4OQMA 3EC1A 1E20A 2C99A 4MDEA 1E6CA 3TSCA 4D0RA 1QK3A 4N3NA 5BV1A 5IFKA 2ZROA 5K99A 3LTNC 5D3ZA 4ZVRA 5LYJB 3AYXB 3LUJA 1HGXA 3NIGB 3FYCA 1QYRA 3RU9A 4DLLA 1C8VB 1TMOA 5F1KA 4AX8A 2ODWA 3P52A 1BX1A 4O3MA 3GJYA 4GOOD 1JILA 1Y8QB 4KN9S 1ZW1A 4WN9A 4R1OA 4CM9A 3PL1A 3GDOA 2FRDA 3UJBA 5AOCA 3C98A 3AUXA 1RAGA 1K5DA 1AXGA 1AHIA 1ZIXA 1S5PA 3I6IA 1LK0A 1SURA 3QWHA 4MDYA 4TUYF 5FUBA 3NHWA 1R88A 5JCJA 1A4UA 1XEXB 3GQVA 3TMKA 4ZT4A 1NJ5A 2ZYRA