3QVWA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k278a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
392
structure length
392
Chain Sequence
MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSADKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
total genus 152
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvwA01
1MC4A 2Y0EA 2C59A 2HRBA 5I9MA 1K6IA 4NG5A 1SO8A 2WYVA 5I7SA 4PRLA 3RBXA 4A10A 4R3NA 3VZQA 1EFLA 3FPLA 4N5NA 2DT5A 5JDCC 1YXMA 3RBVA 4IZHA 4BNKA 4J7UA 3PTZA 1VJ0A 2HSDA 2X5OA 4QFCA 4OMUA 5IZCA 1F8FA 2BKAA 3WWZA 3DEYX 4BOYA 3UCFA 3WQSB 5HTOA 2EJWA 3DAGA 3KTDA 1DSSG 2POQX 4XWYA 4PZCA 4Z0TA 3EK2A 4GSLA 4NPCA 5DP1A 1YDEA 3WNVA 3JQ7A 3KUXA 5DCWA 4LCJA 1YQGA 4WLOA 1IL0A 3HDHA 4CR8A 4GQAA 2TMGA 3AI2A 2EJVA 3OJ0A 2YUTA 2D5CA 4WUVA 3TWOA 4M54A 3FI9A 3JQAB 3RC7A 1EQ2A 4ALIA 3HHPA 3C1OA 2YQ4A 1P0FA 2DFDA 4LRSB 3MWDB 3PQEA 4YT8A 5IFLA 4NMHA 1DEHA 1NASA 4WLVA 4KUGA 3O8QA 3U4CA 1XGKA 1LLCA 5IAAA 4N7RA 5ER6A 1JA9A 1E7YA 3DTYA 5JSFA 3GT0A 1JTVA 4NBTA 3JQEA 4TZTA 1E3WA 1AE1A 4JK3A 4KWIA 4RPKA 4OQZA 3LT1A 4A5OA 3TOZA 4YTEA 4KQWA 4B79A 3HSKA 3LK7A 3GFBA 5A4DA 2O4CA 2HAEA 2ZJ0A 1YOVA 1ORRA 4TSKA 3G1UA 4YT2A 2ZYDA 3O4RA 4TQGA 5L4LA 4CR6A 3VZRA 2PWZA 3GDOA 1VL8A 3P5SA 4YJDA 4J0EA 3PQFA 4AJEA 2GN4A 1HDGO 3F46A 3QVWA 5FI5A 3FD8A 1T24A 4N18A 2ZTLA 3E1KA 5EIOA 1PEDA 3GUCA 3A4VA 4AJHA 4F6CA 1L7EA 4GVXA 4ZQHA 2NACA 4BNLA 4J16A 4TZKA 3KEQA 1FDSA 2CF6A 3ON5A 3GUYA 3MWEB 5LDGA 3EVNA 1ZW1A 1DFHA 1VE9A 4YJGB 4URFA 1LU9A 3PIDA 3OECA 4AJKA 3JYPA 4BO6A 1F0YA 1IHYA 1ADGA 2Q4BA 4DIOA 3TDKA 3UFXA 3VDQA 3C7CB 2OBYA 3QE3A 1DHTA 1ZUD1 4BV8A 3EMKA 1B14A 1HEUA 1WDMA 2D8AA 2WWRA 3PYXA 4XDYA 4BO9A 2G1UA 1WZIA 2BMAA 4ND4A 3JQFC 4L74A 1I30A 2O3SA 3ZWCA 3SEFA 2GR9A 1B8PA 5IF3A 3TZKA 5KKCA 3QIVA 3RVDA 4M55A 5CFZA 1U9JA 4EEXA 2G82A 2OOSA 3UAGA 2C29D 2EV9A 4FC6A 3HFGA 3S1LA 4W99A 3RUDA 3PYMA 2CUKA 4BMVA 2JD1A 4QQRA 4CL8A 1YONA 1KEWA 1B26A 1HSOA 1EVIA 3R0IA 1PJLA 3V1YA 4OKIA 1QV7A 3O38A 1PQWA 3VPGA 1Y8QA 1R15A 1DIGA 3JD2A 3DAPA 3PZBA 1WMBA 4EDFA 4R1SA 3ASUA 2VHXA 1GTMA 1HDCA 4INAA 3HE3A 3WXBA 1NVGA 3DWFA 3GHYA 2FZEA 1T4DA 4AG3A 1ULSA 2H6EA 2NSDA 4H15A 1DFIA 3HZZA 2O23A 4YDRA 4HP8A 5JS6A 1LDGA 1PJ2A 5I8ZA 1I3MA 4LCEA 4RQTA 1SEPA 4MVJM 3BZUA 1GUYA 1GYRA 4PLVA 1I24A 5COAA 4BVAA 1U3WA 5KVQA 5TC4A 3RUEA 1TXGA 1NP3A 4WASA 3RKUA 5JYEA 1OMOA 4ZJUA 1ZXLA 3K9QO 1E3SA 3TZ6A 3AY7A 3RASA 3PLNA 2ZK7A 4JCOA 3OQBA 3DC2A 1T2FA 5THQA 1ENPA 3K73O 1V0JA 3PDJA 4AJOA 1BTOA 1CERA 3ANMA 3D4OA 5KJ1A 1BDBA 5TX7A 2QQ5A 2HMSA 4KTVE 3ZN2A 3OMLA 3QVXA 4Z9YA 3O9ZA 2EKQA 1PWXA 3OSUA 3PVZA 2NV6A 4J49A 4IDFA 2A35A 1A7KA 2O3QA 1IPEA 1P1JA 2Q2VA 4OGWA 2DKNA 1DLIA 3F9IA 1M6HA 4JXKA 4CMIA 2DAPA 4MVJP 3BXXA 4LMPA 4GX0A 2PD4A 2J6IA 2B37A 4AJIA 1NX6A 5C37A 4EEZA 4YAGA 5T6BA 5IXSA 3E9QA 4PN3A 3C8MA 2RAFA 4JBIA 3Q2KA 4E2YA 5IDXA 1QLJA 3AUTA 2FN7A 1BRMA 3QVOA 2GRAA 3PP8A 4IGFA 2AG5A 4XRRA 5EMHA 4XCVA 1H2HA 1UAGA 1V35A 1FMCA 1Q0LA 3HN7A 3SC4A 5BNTA 1K2WA 4R41A 4FCCA 2IXAA 5TSDA 5I9LA 1NAIA 3ENKA 4W6ZA 4PLWA 4WJZA 1XDWA 4MIOA 2QX7A 2IRWA 4FGSA 4Z6KA 2Q99A 4YWJA 3RU9A 2W8ZA 7ADHA 4FB5A 4IQ8A 1E1KA 4NFSA 1WW8A 1N92A 3E82A 3W4JA 4YRAA 4YQZA 4R54A 1A9YA 1C1DB 5COQA 3JD0A 3WG9A 1ONPA 2R2GA 2RCYA 1U5CA 1V3VA 3DFZA 4DLAA 4KDEA 4JROA 3JTMA 3AUSA 2OL4A 4OJNA 4DQUA 3IJPA 4CM9A 4FOOA 3UCEA 4U6QA 1B3BA 4J1QA 3TL2A 4CM6A 4ZN6A 2A92A 5KJFA 1DPGA 3GGOA 3HWRA 1Z7EA 5KCZA 4BNTA 4BO7A 4R69A 1LSUA 1EQUA 4EUHA 5ITWA 1CQJA 1P74A 4ZU3A 2J3IA 3FN4A 4FGWA 3T4XA 4L4SA 3NKLA 1BXGB 3K5PA 5TRTA 5JCXA 4YR9A 3ZW8A 4CUKA 2JFFA 1ZK2A 1JVSA 1NQTA 3LF1A 3D64A 1ZBQA 3OF2A 4QEDA 1VI2A 4U8GA 4ND3A 2V6MA 3OIDA 5EPOA 1QG6A 2VRBA 1CQIA 2AQKA 3NDRA 2FR0A 1E0DA 4E32A 5JAIA 4MKXA 1D4FA 4IJUA 1N7GA 3RC1A 2WMDA 2FRDA 4CMIB 4Y8VA 1H94A 1UZLA 1FXSA 4J0FA 5TNXA 3ZDFA 3KYCA 4R5HA 1PGQA 5T8KA 1KS9A 4BNIA 2OMEA 5DN9A 1MB4A 2A9FA 3TQHA 3H9JA 2PD3A 1W0CA 1P1FA 2RIRA 2VWHA 5KKAA 5TT1A 3ZHYA 4BKQA 2PNFA 1AHIA 1C0KA 2WJPA 3EAGA 4Y67A 4MIYA 1JKJA 1KVUA 1H6AA 4FJ1A 4RVHA 4R16A 2Y05A 4CV1A 1PGNA 4G5HA 3ZWYA 3ASVA 3ZW9A 1Y5MA 3DZKA 4IDGA 1GU7A 1RM4A 2WM3A 4FDAA 4GMFA 4B3IA 5JC8A 4ZVVA 3ANNA 1MG5A 3BMQA 1F06A 4NJMB 3RCBA 1E6WA 3WTBA 1AHHA 3AFNA 2IZZA 4G2NA 4BNMA 1B0AA 4ZHSA 1J49A 4ALKA 1W8DA 4HV4A 2VUTA 4IY1A 1N9GA 1ZNQO 3LYLA 4JLWA 4E6PA 4EJ0A 2BH9A 1OBFO 2C82A 1EK5A 1M67A 2X5JO 1C0PA 4HWKA 4E31A 3KHUA 5ILOA 1JU9A 1M6WA 3D4NA 4I8XA 1PWZA 3H2SA 3PRJA 1O0SA 1HZZA 3WBBA 4DL9A 3KSDO 5L7WA 5CDGA 5A02A 5JAZA 3KLPX 3KOUA 3FTPA 1FF9A 4M87A 1X0XA 1P1KA 4IPTA 1SB8A 1UXJA 1Q0QA 2FR8A 4JX8A 4PCVA 5KIAA 3JYOA 3HNPA 5I7FA 4KP7A 3I52A 5L3ZA 4LVCA 4QTZA 4U7WA 1GV1A 4YRBA 2DBRA 3RUAA 1UH5A 3RUFA 1PZFA 3O8QB 3PGJA 1B2LA 4TRRA 3ITKA 3LDHA 1Q7CA 4PRKA 4RPJA 3TL3A 3COSA 1LTHR 3KB6A 1LDYA 2P9GA 1NM5A 3GNTA 3PJDA 1I33A 4HNGA 4B7XA 4R5MA 1KETA 4NHEA 1C14A 4W7HA 5K6AC 5DBGA 1KBZA 2Q1WA 4XX0A 4E4YA 3HQ4O 1DOHA 3RJ9A 5TF4A 3S2EA 3WDSA 2NU7A 3KM0A 1HYEA 4NNJA 2FPGA 3HFSA 2A94A 3DZJA 1AXEA 1PU2A 1ZH8A 1D1TA 3E48A 4PLCA 1GDHA 3U4DA 4B3JA 4BNGA 3JD1A 3F1KA 3RUIA 5JYDA 1SCUA 2QW8A 3RUCA 1NXQA 2JFGA 3MJEA 3WSVA 3RC2A 1E3IA 1T2CA 5L40A 3TZQA 2X4GA 4ID9A 4CLDA 1E6EA 1O8CA 4CODB 3WS7A 1U2GA 4CLRB 4C4OA 2P9EA 5COBA 5JAMA 3M1AA 1DC4A 1GCUA 4ROSA 4NDNE 2WDZA 3QA9A 1FDVA 1EDZA 4RF5A 1BMDA 5IJZA 4O6VA 4XYLA 1GZ4A 4RF2A 3OIFA 4PIVA 4RL6A 1SPXA 1X7GA 1NWCA 4CQLB 4G81A 4ILKA 4UEOA 4XD2A 4BO5A 3KYDA 4XQ9A 3DBVO 4DC0A 4E5MA 1BG6A 3D0OA 5HRUA 4MO2A 5TJHA 1Y8RB 2VT3A 3AM4A 3L07A 2R00A 3H3JA 4DRYA 4YVFA 1NQAO 1BXKA 2UYYA 3H9GA 1XU9A 1NR1A 2IEDA 3QQPA 3D4PA 4RQUA 1ZEJA 2Y93A 4TRMA 1HE2A 5DULA 5I8WA 2ZB4A 3L4BC 2BGMA 1BDMA 4PFJA 3DB2A 2I99A 1HF3A 2VTEA 1X1TA 1SC6A 3JQGB 3ZNQA 3WBFA 1HETA 1PTJA 4UEKA 1OC4A 5L45A 3Q6IA 1V3UA 5ADHA 1A71A 2D1YA 1WAMA 4RLSA 2NU9A 4YJFA 2EF1A 4D3DA 2C20A 1X7DA 3VKUA 4CM4B 5FI3A 1XQ1A 4R9SA 3PI7A 4DA9A 1IZ0A 4MVJI 1OZAA 3CZRA 4E5YA 4E3ZA 1PGOA 4CL3A 1GUZA 1HYGA 1QR6A 3QY9A 3AOGA 2JJYA 3ZU2A 1MP0A 2I3GA 1BGVA 1D7OA 2PZKA 4Q3AA 1QMGA 4KMSA 2HMWA 4J6FA 1LEHA 3NT4A 1TEHA 3ST7A 2Y99A 1DIAA 1P44A 4UVEA 5JPIA 3A28A 2D59A 2IXBA 5T73A 1O89A 1I32A 1PR9A 4L4XA 1QORA 5A9TA 4E2XA 3U3XA 3K6JA 1J4AA 2NQTA 3EC7A 2EW2A 4RVUA 2W98A 3KO8A 1EUCA 4UUPA 5BSGA 3PPIA 1R0LA 4DPKA 1EBFA 2UAGA 4HXYA 5J23A 1KEPA 1QYWA 4OXNA 1T2AA 2ET6A 5U1PA 3Q1LA 2QG4A 3Q2IA 3PHGA 3NTOA 3F47A 2YJZA 1UZMA 3GRKA 3FF4A 2JL1A 2CY0A 1MV8A 3JQ9A 1P1HA 1YL5A 1BW9A 3JQ6A 5AOVA 8LDHA 1LSSA 2NTVA 2X9GA 1PJ3A 3T7CA 2PH5A 4MKRA 2VYVA 5DBFA 2SCUA 3AM3A 3GQVA 3WICA 4E2WA 1CJCA 3JD3A 3RFVA 1ARZA 1E3EA 4NZ9A 2NU6A 4UULA 4PGFA 5G0WA 3RIHA 3DTTA 1L7DA 3W6UA 4D44A 2NVBA 5A5EA 2EHDA 5GZ6A 3R6DA 4EGFA 5K9ZA 3OM9A 1BSVA 3VC7A 3RD5A 2DPGA 3WSWA 4UAGA 2VHVA 4IJKA 5CDSA 4RDHA 4PZDA 3N74A 3MJSA 3UH1A 4MDHA 2EGGA 4EJMA 2E49A 4XB2A 5MGBA 1IOLA 3PGXA 3AI3A 5GY7A 5MDHA 4ALNA 3GN1A 3GVPA 3EGOA 3PEFA 4Y6PA 5FF9A 4P22A 4N5LA 3E5RA 1E3WB 4TKMA 1YQDA 2NNLD 4CUJA 2WEKA 3GHHA 1LX6A 2Q2WA 4P4NA 2DU8A 2HUNA 5DNAA 4B4VA 4FR5A 1NVTA 1D8AA 3E6AA 4Z3DA 5DDIP 5EESA 4R51A 4WGGA 4CV3A 2FHSA 3U4IA 3NTRA 2AQHA 1KVRA 3E9MA 3I6QA 2X0NA 2VWPA 2X0JA 4CMCA 3QWBA 1ID1A 4J90A 4NBWA 4ZQGA 3NX4A 3N7UA 3PWZA 3V1UA 4EUFA 5JDIA 4ZGWA 3BMCA 1MGOA 4NJMA 1C3VA 2GN9A 3JCZA 1K89A 5HBRA 3ZWBA 4QO7A 1BXGA 2J3JA 2OFPA 3DONA 3NTQA 3TF5A 2PV7A 3ANLA 3BMNA 1E3JA 1HE3A 3P2OA 3DHYA 2A4KA 5CPFA 3P7MA 4EZBA 4Y6SA 1OAAA 4K28A 4CPDA 5A9RA 1R0KA 2YYYA 3JQBC 4I5FA 3NGLA 1X14A 3KYBA 4I9HA 1ZSVA 2D2IA 1QV6A 3QWFA 3CXRA 3MJ4A 4YB8A 3SBOA 3PLRA 2LDXA 4BUCA 4GX1A 2BFPA 3ZV4A 5CDTA 1XHLA 3GVXA 1HZJA 1ZJYA 3O26A 5L4NA 5B12A 1NR7A 1VJ1A 1LC3A 3D3EA 4BNVA 2YHIB 2V6FA 5AXDA 1LDBA 4XEHA 2YZ7A 2B5VA 2P5UA 4H16A 4TVOA 3UW3A 2HO5A 2VNSA 3VKVA 2EEZA 4QSMA 3JQ8A 3BMOB 4DGSA 2HMVA 1MXHA 1T26A 2BF7A 2O7SA 5A06A 3FWZA 3GG2A 3SLKA 3LQFA 5JNLA 2UV8A 2YV3A 4WE3A 1P33A 2BELA 3MJCA 3I4CA 5F5NA 4DYVA 3PWSA 1GYQA 5H82A 3JQ7B 3LLVA 1DO8A 3VVBA 4E5PA 1LUAA 2LDBA 3K30A 4DYDA 2B69A 5EINA 3LZ6A 1PZEA 4BL5A 3KSZO 1O6ZA 2X58A 5DF1A 2VTDA 3JV7A 3JQBA 4XYEA 2Q2QA 3H8VA 4QX6A 3E18A 3ZCXA 4IIVA 1UP7A 4TWRA 3AUUA 2VHWA 3VH2A 1J5PA 1ML3A 2Y0CA 4II3A 3A9WA 4AFNA 4O63O 3CUKA 5KJCA 4DREA 3I9MA 4QXMA 4B4WA 3NGXA 3HADA 3IUSA 3A1NA 3BMNB 4YJGA 1H9BA 1IB6A 3IDSA 1T25A 4YCAA 5IDYA 1UZNA 1U5AA 5H83A 3UN1A 4IINA 1EUZA 1IZ9A 2JCYA 4ALJA 4GPD1 4BS9A 4Q39A 3DDNA 4JNKA 2UUOA 4CV2A 5JW6A 5IZ4A 3OA2A 5C7OO 4BQPA 2PY6A 4CLOB 4FD3A 3L9XA 4FSHA 4YAKA 3L6EA 1LXCA 4J7CA 1SMKA 2AW5A 5EQDA 4BO4A 4AJ4A 2DTEA 3PZRA 1Z74A 4Q3DA 3DO5A 4XJSA 3S2GA 4C7KA 4WOJA 5HA5A 1EZ4A 4UREA 2YHIA 3QWAA 1DJQA 3ZU5A 4CQMD 5FFFA 2I6TA 4GI2A 2VRCD 3RKRA 4BO1A 1H6BA 3VH4A 2VHYA 5A1TA 2Y1OA 4KWHA 3AY3A 2Q22A 1A7AA 3UOGA 5DBIA 4MP6A 2GDZA 1LRJA 1I3KA 1OOEA 4OXKA 1U3UA 1LJ8A 4UUMA 4GX5A 1HT0A 2Y0DA 1YBVA 4BNXA 3INRA 1DHRA 1NVMB 4A73A 2YDYA 1IUKA 1KVTA 1KEVA 1E1NA 4CM8A 1CF2O 1ZK0A 1YS4A 2H63A 1R0SA 2HMTA 5ICMA 4J43A 3NYWA 3C3XA 1I10A 3GAZA 4WLEA 1Y5RA 4IDEA 4U0KA 1N1GA 5T67A 3WGGA 1T4BA 2NQ8A 3TSCA 4R3WA 1WLYA 4DBZA 3KSUA 1CETA 1K6XA 2BI8A 1UP4A 4RORA 3KETA 1PGPA 1ZIDA 2Y1EA 1F14A 3DHNA 3S2IA 3CZMA 4FFOA 3T7EA 4YEDA 1TT5A 2CMDA 3W8DA 4A03A 1VL6A 3L6OO 3MTGA 4PG7A 4CR7A 2AHRA 2GO1A 2F1KA 4WEQA 3BTVA 3D7LA 2H5LA 3L0DA 3GVIA 5EJ2A 2EKLA 1I8TA 3BMQB 1LSOA 4J9VA 2Q49A 3U09A 1U1IA 1S7CA 3P2YA 1DBVO 4RLHA 2I3AA 3M6IA 3NT2A 4Q3BA 1HL3A 2PR2A 3H3FA 1JKIA 2X0IA 3D1LA 1Y1PA 4ZRNA 1ZVMA 3CKYA 3FCOA 5BSFA 5HWSA 3JYQA 1ZK1A 3VHRA 3ZI0A 1GFSA 1DRWA 1TVEA 1JWBB 4J2OA 1VKNA 3U0BA 3WTCA 2DTXA 4R68A 1UXKA 4PVDA 1U8XX 3GEMA 4BNFA 1ZCJA 3AM5A 2PZJA 3AOEA 1F17A 3G3EA 4MP8A 5KVCA 3DMTA 2TMDA 1YB4A 4GVLA 3LC7O 2C5EA 5KVVA 5F3RA 1UXGA 5A05A 3MTJA 1VKOA 3I9OA 2I65A 4NBRA 4JIGA 3K31A 3GPIA 4WCFB 4KOAA 4MPDA 2PTGA 4B8ZA 3TFOA 2IYPA 4GGPA 3AW9A 4UUOA 1SZJG 1G0NA 4ESOA 3SJUA 4A2CA 3QP9A 1YDWA 3ZWXA 4IDDA 2IYOA 2X7HA 3FNFA 4U6SA 2Z5LA 3PHIA 4OYRA 4M89A 4JGBA 3JYNA 1Y8QB 1ZXBA 2Z1NA 2P5YA 4PLGA 2Q1SA 4XKJA 2BGKA 1AGNA 1MX3A 4O59O 1H93A 3HUDA 1DIRA 4PLZA 4UUNA 5GZ1A 1OFGA 2ZTUA 1MLDA 1YKFA 3GRPA 5KNLA 1UJMA 3FBTA 4CV0A 1VSVA 3A14A 1X13A 3OQ6A 3K2BA 5F1PA 2ZQYA 2JCXA 3EDMA 4OIMA 5KWEA 2ZIZA 1HDXA 3W4IA 4J4HA 4CLRA 2P4HX 3AUAA 1C1DA 5BNFA 3MJVA 1YWGO 2GZ3A 1D3AA 3QWIA 2ZCUA 1DFGA 1NFFA 1CYDA 3IL2A 5K6AA 1EDOA 2NVUA 2W2KB 4AVYA 1B7GO 8ADHA 1GPJA 4FOSA 3BIOA 2DBZA 4DPLA 2PH3A 3B6ZA 1Y81A 4RJTA 4KUHA 2IZ0A 4K9DA 1SNYA 1BVUA 5F1OA 2X1HA 3AK4A 3QHAA 4DBVO 1E7WA 5DOVA 3VPFA 4J1SA 1T2EA 3EW7A 1NYTA 4YAIA 1Y8RA 4ZA2A 3WIDA 1TI7A 2GYYA 1MUUA 5BT9A 1HDRA 4CM7A 1KVSA 4FW8A 2GD1O 3UUWA 4BNZA 2IE0A 3MOIA 3EZYA 1N1EA 1P45A 1PJSA 4N5MA 2EWMA 3BMCB 1YB5A 4TKLA 3KXDA 4L76A 1KYQA 5CEEA 1A9ZA 5TLSA 2B4TO 4E13A 1WP4A 4A27A 4NJOA 4IDCA 4DLLA 4YT5A 1J6UA 3DOOA 4RPLA 4Q3CA 1ENYA 2Y1FA 4FPXA 4FFLA 4OOFA 4BGUA 1DC6A 3QSGA 3KVOA 4PLPA 1LA2A 1WMAA 2OUIA 1WPQA 4U0JA 2FSSA 3M2TA 4OSPA 4W9NA 2C2YA 4GL4A 2VYNA 4E0BA 1G6KA 4IS3A 5G2OA 2C54A 4XIJA 3D3WB 1L1FA 1SOVA 3FBGA 2QRKA 3PIIA 1FJHA 4Y6RA 1LC0A 4WNIA 5A9SB 4D43A 1LSJA 3ROMA 3WGIA 4B3HA 1BWSA 2JFHA 1O5IA 4BNHA 5KJEA 5IN4A 4IXWA 3JQ8B 2WD8A 3I6IA 5CDUA 4CLOA 4NK4A 4BO8A 5TT0A 1JN0A 3ICCA 1NHGA 1ENOA 2ZB8A 3OICA 2F00A 2W2KA 2NVUB 3WMXA 3SX2A 5T8KC 2VT2A 4WLNA 4YT4A 2CDBA 3NRCA 1YO6A 3K8ZA 3OEWA 4MVJE 1U8FO 1E7RA 2CZCA 1N8KA 4JQCA 5T5QA 2B0JA 4Z3KA 2HDHA 4MVJA 1QP8A 1XKQA 1A72A 3KYCB 1QYVA 3RFTA 5JFOA 3HN2A 4J1TA 2EXXA 4Z0HO 1JLLA 3F3SA 2Q1TA 1H5QA 3VH3A 1QXSA 2QRJA 3QW2A 1RJWA 3VTFA 3GDFA 1DXYA 4CMHA 1YJQA 2NU8A 3V2UA 1DLJA 2NWQA 3TJRA 4GH5A 5CG1A 1TA4A 1IULA 1PQUA 2WD7B 3C7DB 3DZHA 5A3VA 2J3HA 1PL7A 4R01A 1V6AA 2I5PO 4W82A 4XYGA 2O48X 1W73A 2DVMA 3NV9A 1ZJZA 2JCVA 3U9LA 1TB4A 2FY8A 3WMWA 2C7GA 3S55A 2NADA 1NQ5A 2JHGA 3QRWA 2PKQO 5H81A 1BHSA 3X2EA 3CTMA 4IMPA 3CSDA 4NI5A 5AQ1A 5C7IO 1LQTA 3LF2A 2BHLA 1U3VA 4TMFA 4WCDA 3ZV3A 2CVOA 4Z9FA 4OXYA 1E5LA 1YL6A 3AU9A 3PJEA 2DC1A 4A26A 1CDOA 2Q50A 3V2HA 1GUFA 1U7HA 1ZSNA 1U3TA 1K6JA 2J3KA 4DTIA 2C7VA 1SBYA 5I9NA 2H1SA 3UXYA 4CMEA 4IDAA 3GGPA 3WQRA 1P1RA 3I9LA 3LC2O 1RM5A 3IKVA 4NIMA 4GWGA 4IZIA 5C5IA 4BB5A 3CEAA 2DBVO 4B4OA 2FZWA 2E37A 3NJ4A 4WCFC 1KY4A 2YV2A 4HBGA 4YACA 5AXAA 1DB3A 1K0UA 3E8XA 4Y9DA 2JD2A 4RZHA 2GPTA 2AG8A 3JYLA 3H5NA 4YPOA 4CM8B 1X1EA 3W1VA 4L8VA 1GQQA 4QO8A 4CM1A 4LK3A 2HK9A 2W4QA 3G79A 4A0SA 4GWKA 4BKUA 2GUGA 4DLBA 2XF8A 3JQAA 4RCVA 4B8WA 3G0OA 3N58A 2UUPA 1U28A 3ZWWA 4JJIA 3FTNA 4UVIA 2Y1GA 4WCFA 1R37A 1Z45A 2WD7A 1GZ3A 5G0VA 1TT5B 1DC5A 1HE4A 4ZICA 2FPPA 3WIEA 4GKVA 3VPHA 3NDJA 1PS8A 1JVBA 4ONEA 1NQOA 4CMEC 3OH8A 1PGJA 9LDTA 2IDZA 2PK3A 3G49A 1ISJA 1X7HA 4J4BA 3ZWMA 4CMAA 3ONDA 4WPGA 4KZPA 3CIFA 1HDYA 1GZ6A 1XU7A 4XR9A 4CQMB 3TZHA 1EMDA 3OIGA 2RHCA 2EKPA 3CE6A 3WLFA 1A27A 3QWHA 3RJ5A 3FNHA 5JCJA 1PSDA 3AI1A 2PZMA 3C1AA 1XG5A 1PZGA 4EW6A 2VN8A 2X6TA 1C0IA 2OBNA 3Q11A 4AJLA 5ITVA 1DJNA 3C24A 3PDUA 1XELA 1ZO8A 3FR7A 4FFPA 1Z82A 3GZNA 2QZ9A 3VVCA 1G0OA 1A4UA 2O3JA 1DRVA 4D3SA 1IYZA 4TRJA 2AEMA 5TGDA 4DVJA 2R6JA 3Q9UA 5DCYA 4YYZA 5EERA 2GN6A 4ALMA 4E5KA 4LSMA 4XGIA 3WYBA 2DUUA 5KJ6A 3BMOA 3MOGA 4MVJH 4WLUA 5C3MA 4CM9D 5JO9A 2X8LA 4NR0A 4UVDA 3ZU4A 3ZWVA 1C0LA 1HDZA 1FDWA 3GF4A 5DCUA 4MIEA 3R3SA 4GSKA 5U9CA 4ZQBA 1IPFA 1YBAA 4YAEA 3FWNA 4C7JA 6LDHA 3D5TA 7MDHA 5JY6A 1P77A 4HFMA 2CDAA 4YJHB 1LBEA 5JDIC 1H0KA 4WNCA 4NK5A 1YH3A 1YBMA 1PR3A 1IE3A 1ZK3A 3DAFA 3G17A 4GX2A 1R4MA 4O5OA 4YJFB 4Z9XA 3JD4A 3D5QA 1ISMA 3F4BA 4GGOA 4BNNA 3DMYA 2XXJA 5K0ZA 4YRDA 3WFIA 1Z75A 3LU1A 3U5TA 1X0VA 4IGEA 3O03A 5CP8A 1W4ZA 5ILGA 4DQVA 1E77A 3RFXA 3MCVA 4BGIA 4IJVA 4NU5A 3UKOA 4L9RA 1NFQA 3C85A 3RAJA 3GA0A 4F45A 1JAXA 4HFRA 4D3FA 5ENVA 3DHEA 1Q7BA 4D42A 2GLXA 5B37A 2O50A 4P4LA 2HK8A 1KOLA 1DAOA 2WYUA 2JHFA 3S2FA 4XQCA 4IMRA 1GQ2A 2OORA 1GADO 3QV1A 2BI7A 3GG9A 2P9CA 1RPNA 3TFQA 3GC6A 2Y1DA 4D0SA 1GR0A 3W8FA 2Y68A 4DQXA 1N9GB 4HFJA 3AFMA 4LW8A 2EGHA 2JAHA 1WVGA 4OHUA 1H9AA 2WE8A 1BW9B 2B5WA 1C1XB 2DFVA 3Q3CA 2JKVA 5C7LO 4OSOA 1GD1O 3OETA 3MJTA 4LISA 2IZ1A 4XQEA 2HJRA 1ENZA 5ICSA 3DBRB 3WOHA 1E7MA 5JYFA 1H6CA 3FHLA 1I2CA 3ZHXA 2Y1CA 1ZZEA 2PZLA 2AE2A 2O3TA 3B70A 4Q9NA 1EE9A 4WECA 1HKUA 3TOXA 3OJOA 1LQUA 3ETGA 1Y6JA 4Q3EA 3UHAA 3ZWAA 3FNEA 4IDBA 4OOEA 1YL7A 1GV0A 2OP0A 4I5DA 1NHWA 2UVDA 2ZATA 5F1KA 3GK3A 4IXTA 2VYND 3I9KA 4XB1A 5IZCC 1PZHA 2P91A 1S6YA 2VOJA 3RQSA 3HG7A 2NTNA 4WOKA 3NT5A 5L9AA 4LSWA 4HX5A 5KVSA 1R6DA 4AJNA 5B4TA 3H9UA 4GBJA 2GZ1A 3IOYA 2QZZA 1ZFNA 2X22A 1AXGA 4XZ3A 2FP4A 4HADA 2J8ZA 5THKA 4BB6A 5JDCA 1Y9AA 3FRJA 3GOHA 3TZCA 1OI7A 4UVGA 3ZGYA 1KEUA 3PFFA 3DOCA 2CVZA 5A9SA 1Q1NA 5AXBA 4MKZA 2VWGA 5JMPA 3BYZA 2PGJA 2G76A 5KTKA 2AXQA 4N54A 3HB5X 1DIHA 4E21A 1M66A 3GGGA 4NH4A 2P4QA 5KOIA 3KEOA 3DBLA 3FPCA 4E2ZA 4PLYA 2GZ2A 2VQ3A 3L4BA 4HKTA 2ZTMA 1RM0A 2YY7A 2YFHA 3HDYA 4E12A 2AE1A 2ZYAA 4ND2A 2D3TA 5EQFA 4FFRA 3EVTA 2YDXA 3PXXA 1M76A 1BVRA 4R1UA 4Z0PA 4F6LA 4FJ0A 1XCBA 1GYPA 3UVEA 4B7CA 4AJ2A 4LVUA 2CD9A 1RWBA 2GN8A 4DPMA 2NM0A 1YB1A 4I5GA 3ULKA 3V5NA 2QRLA 3M2PA 1I3NA 3RWBA 4A7PA 2GGSA 3EUWA 3CMMA 3SJ7A 1R12A 2HK7A 5CHEA 4BO2A 1MG0A 2ZB3A 1PS0A 4WEOA 1Q2XA 1QYXA 3I5MA 1EEHA 1X15A 3KBOA 3U4HA 3IP3A 3F6YA 3F4LA 3I83A 5IG2A 3FR8A 2E4AA 3INTA 4J3FA 1UR5A 1YJ8A 1MC5A 1ZMTA 2ZQZA 1WZEA 3NUGA 4QT0A 1R4NB 4CUZA 3DZBA 1CIVA 3H7AA 1Y7TA 2G5CA 1YOVB 1V9LA 4K26A 1NAHA 3ROKA 2I76A 1K5HA 1UDBA 2HCTA 4O1MA 3ZWOA 1DAPA 3SXPA 3GMDA 2DBQA 4IS2A 2W2LD 2B83A 4RZIA 4CMGA 2W90A 4RO0A 3RU7A 2ZJ1A 4M86A 5JC1A 3I9JA 2O3UA 3CH6A 1VM6A 3NEPX 4L4RA 5AYVA 4R4JA 5AVOA 2EERA 2OP1A 1ZSYA 2CDCA 3DBLB 1DC3A 3IC5A 3VTZA 3ZNPA 3H5RA 2R00C 2QYSA 1CWUA 3PFWO 3EZLA 3L77A 1PQPA 3P19A 1GL3A 2BLLA 2GSDA 3JQAD 4W7IA 3WYEA 1Q7GA 3SLGA 1FDTA 2V6BA 4D7AA 2AEJA 3GN2A 2WSBA 1GAEO 1IY8A 3ZWPA 4Q3NA 3Q0EA 4BGVA 3WB9A 3OA0A 1QKIA 2QIOA 4IIUA 2CVQA 2ZYGA 4DC1A 4L73A 5ENDA 3I4FA 3WLEA 1F8GA 4BKOA 2C2XA 3D3WA 3GNQA 5HS6A 2WTBA 1WDKA 5F21A 3IS3A 5LCXA 4BNYA 3HJAA 1PS9A 1XA0A 4BNWA 4MP3A 3KV3O 2YW9A 4E33A 3F5SA 4AJ1A 4DUPA 1RYDA 3UCXA 1ISIA 3TRIA 1CEQA 3I23A 3GDGA 2VYVD 4PG4A 2P68A 3OP4A 4EI2A 5JCJD 2GASA 3H2ZA 2X23A 3GNSA 3MZ0A 3M1LA 3DZFA 4RV9A 3L6DA 1LLUA 1T1RA 2CFCA 3ADOA 2PKQP 3ITDA 3RI3A 4K1LA 3UF0A 5B4UA 1GQYA 4PLHA 1KERA 4OQYA 2RBEA 5JMWA 1PX0A 4IBOA 3PQDA 3U62A 4I5EA 5BR7A 1QYDA 3DXFA 3GFGA 1EE2A 2HJSA 2ZKLA 2RHRA 4FFNA 1PJ4A 3JSAA 2ZCVA 1ZMOA 2JAPA 4YXFA 1EBUA 2RH8A 3PJFA 3T4EA 4TVBA 1E3LA 3BHIA 4BIIA 5JXWA 1R16A 1ADBA 1VRWA 3BA1A 1VSUA 4GAEA 3GAFA 4J91A 2H9IA 4QUKA 4J1NA 1U4SA 1G1AA 3OJEA 1I2ZA 5G4KB 3PK0A 3IAHA 5ES3A 1TLTA 2Q46A 3R3JA 1PJBA 3ZH2A 4FS3A 1V3TA 4P8RA 4M8SA 5L95A 3ZZNA 3WYCA 4TRNA 1I01A 2XPCA 4M49A 3F1LA 4WLFA 4DWVA 4OL9A 4F46A 2OO5A 4CLEA 1XWFA 2XOXA 2X5KO 4EUEA 2OZPA 5CPBA 1VL0A 2V65A 3BHMA 3E03A 1I5RA 2AQ8A 3UGKA 1EVYA 1U7TA 3OHSX 1EVJA 1Q0HA 1QSGA 2NLOA 2EP7A 1P1IA 3JQCA 3C1TA 2BD0A 4RF3A 4DXHA 4BO3A 4EBFA 3ETEA 4OH1A 3ZV6A 3KZVA 3X2FA 4BNUA 3PJGA 2DPHA 4K6CA 4CMKA 1HXHA 4NU6A 1NPYA 4KUEA 4MINA 5BSEA 4CM4A 1H6DA 1HRDA 1E1LA 5G4LA 4P4GA 5CDYA 1M75A 1SOWA 2VNAA 4M1QA 4W4TA 5TJ9A 1HYHA 5JBIA 3OEYA 4RDIA 1SEVA 2VZ8A 3IQDB 3ONEA 1HDOA 2HU2A 4IM7A 4UVHA 2AEFA 1GPDG 1ISHA 1E7SA 2VWQA 3ZNOA 4EJ6A 1B3RA 1EK6A 4RVGA 4BHTA 3DL2A 1VC2A 1KIFA 1V8BA 4JP2A 1MFZA 3ZHBA 3CPSA 1KC1A 2C07A 1VJTA 3WGHA 4R1TA 2DLDA 2AQIA 5CG2A 4D41A 1XLTA 3H6KA 1U2DA 2VUUA 3DZIA 5L7TA 5LDHA 3AWDA 1B8UA 5G0TA 1NPDA 5TIIA 1I36A 4E5NA 3NAQA 3GY0A 4J7XA 4ZQEA 3V2GA 4JJFA 3TNLA 4YA6A 1UXIA 5GZ3A 5M6DA 2E82A 1KC3A 2I67A 3ADPA 3NJ8A 2XAAA 5FEUA 3DQPA 3WGYA 1T2DA 4MOWA 5T64A 2PKRA 1LDMA 3PWKA 4JBGA 3V8BA 5CEJA 5I7VA 3L9WA 3NDIA 1MA0A 5G0SA 3IP1A 2GCGA 3STHA 2E6UX 3H9EO 1PL8A 1NPTO 1JDJA 5TQVA 4J4TA 4Y98A 2ILTA 2ZTVA 1OC2A 1FDUA 4I08A 3B20A 3GZNB 3VH1A 5B4VA 1KY5A 4FFMA 1RM3A 1ADFA 1DDOA 4CMJA 3INGA 4JN6B 1I3LA 1Z7BA 4LMRA 4O0LA 4YQYA 1AUPA 1P0CA 3LT0A 3TPCA 1R66A 1Z6ZA 2DM6A 5A3JA 1NWHA 4IQ0A 4FQ8A 4RPGA 3RBZA 3WX0A 4B7UA 4X54A 3VZSA 4PZEA 1ISFA 3ENNA 3PHHA 5A04A 3I3OA 2HRZA 1JW9B 1NFRA 1WWKA 3VPXA 1IHXA 2PFGA 2NVWA 2HKIA 2EW8A 2WE7A 4YBZA 1K3TA 2Z95A 4HY3A 3BTUA 2BFOA 1UDCA 4CQMA 4II2A 1R4NA 3FNGA 4RGBA 2YQ5A 1U4OA 2VRCA 3RROA 3RUHA 2O2SA 1P9LA 2O4UX 1LNQA 4MJLA 3OJLA 1CRWG 2QHXA 4XA8A 2G17A 3H9QA 1O95A 3RSHA 2UDPA 4I9NA 4PVCA 1O94A 2PGDA 4BKRA 1YGYA 3L4SO 4PG6A 1EVZA 3W6ZA 5BQFA 3VZPA 5L4SA 1BXZA 1ONOA 1I2BA 4JP3A 2OGUA 3C7AA 4FN4A 5CAEA 3LVFO 3AU8A 1UDAA 1DIBA 3QVTA 4YAJA 3GH3A 3DZGA 3ZHZA 3EYWA 2VUSA 3OJFA 4XGNA 3QVSA 1UUFA 3DBHA 2JD0A 2YFQA 3PHLA 3ZWNA 2DTDA 1HWYA 4PLFA 1ADCA 2FOIA 2PD6A 5ER9A 3OFSA 3WGQA 2FPIA 1JAYA 3WNQA 4L0QA 3W4KA 2IODA 3GVHA 2EP5A 3GLQA 4FBGA 4BNJA 1JWAB 2W2LA 3WJ7A 1YVEI 5IXYA 5JAQA 1PL6A 1NNUA 2E48A 4K6FA 1C1XA 1R4MB 2CSUA 3HDQA 1F12A 2NTJA 4JBHA 1FK8A 1XIVA 2V7PA 3HDJA 3I1JA 4EITA 4W9NC 3ORFA 2X9NA 1YRLA 4ND1A 3JQGA 4NBVA 3E5MA 4XRGA 1D1SA 2NUAA 3E9NA 5DZSA 3LLSA 4BMSA 1N2SA 1B15A 2AA3A 1XSEA 3KLMX 4OAQA 1LRLA 4LRTB 4NFHA 1M2WA 1VLLA 5L7YA 3B1JA 3F5QA 4XDZA 4XIYA 1LDEA 2RH4A 2PA3A 4GLOA 2D4AA 1A5ZA 2BFAA 1JQBA 3JQFA 2IEBA 2FMUA 1HSZA 3CINA 4XQGA 1NTOA 2FR1A 4KTTE 2X9VA 1QYCA 1N7HA 3EHEA 4IJWA 4D0RA 5JO0A 2GNAA 2O3RA 3U49A 1DRUA 3KYDB 4DIBA 3IUPA 5T57A 3WJAA 3ETDA 1P31A 2CF5A 5U4QA 2VHZA 5GMOA 2HLPA 5B1YA 4ALLA 1HLDA 2O2YA 5G4KA 1PJCA 4AICA 3GEGA 5AXCA 4I9UA 2VZ9A 3ZU3A 4HUJA 3I9NA 2AMFA 2BRUA 5A03A 3Q9NA 3IIEA 2Y67A 2PGLA 5L53A 1QLHA 4AJJA 2ZB7A 5I7EA 4L75A 3DR3A 4MVJG 2O7QA 3ONFA 3ROQA 4S3MA 1RKXA 3ROPA 3LSYA 3VDRA 3V1TC 1RYEA 2B36A 1KVQA 2X0RA 5BNIA 4HFNA 4R9RA 4FJ2A 2X86A 4CLHA 1N5DA 5JY1A 2V6GA 3K92A 4BGEA 1XR3A 4OM8A 1XYGA 2D0IA 2J5KA 2B35A 4J9UE 5F5LA 5L51A 5DT9A 3OBBA 1P3DA 1UXHA 4ND5A 4GMGA 3PYLA 1LLDA 3WQQA 1NBOA 4RVDA 2VZ0A 2XXBA 1ZK4A 3H5AA 4ZD6A 3VAZA 1JKFA 4DIFA 1ZEMA 3DFUA 3LC1O 5J9GA 1QRRA 2Q4EA 4PG8A 4KQXA 3CMCO 3JQ9C 5DOZA 3WGOA 4NQZA 4BQRA 6ADHA 3GPDG 3GZ4A 4H7PA 1PJQA 3WGZA 2J5QA 1TT7A 1VPDA 3LT4A 5FWNA 1E5QA 3H65A 3ABIA 1W6UA 4YJHA 5EL0A 4XYMA 3ICPA 3GR6A 1XEAA 3IKTA 3QJ5A 4XR4A 2GERA 3B1FA 4I1IA 1J0XO 4F3YA 2I66A 4E30A 3OQ1A 2Y66A 3DMTC 2D5AA 1HTBA 2FWMX 4R1NA 4WK6A 3B1KA 3AY6A 3A06A 2I9PA 2Q45A 3GMSA 2FSVA 4OO3A 1LI4A 4LGVA 1E7QA 2BFMA 1UP6A 3JQDA 4FC7A 1A4IA 4NFYA 4XGKA 1B8VA 2HMUA 1AN9A 4LN1A 3BAZA 2EG9A 5JLAA 3SC6A 1E92A 4GLLA 4CJXA 5G0UA 4NBUA 1O9BA 4BO0A 4QFDA 4AL4A 4S1VA 4HNHA 5IDWA 1EUDA 3ZV5A 3H4VA 3DOJA 3WFJA 3R1IA 1SB9A 4ITUA 4IUYA 1WNTA 3IJRA 5DP2A 1H2BA 5EN4A 1ULUA 1WXDA 3W8EA 2Q1UA 4KDFA 5HS4A 5TS3A 3IMFA 4CLXA 4QECA 1UAYA 3VPSA 2Q3EA 1YQXA 9LDBA 2C5AA 4XYBA 1Y9EA 4IQGA 2B4QA 1Z73A 4P38A 5IN5A 5A5FA 2PLAA 4B4UA 3QLJA 3RC9A 1PJTA 4GKBA 4DMLA 2OXIA 4EYEA 3BTOA 3SVTA 3WWYA 2YV1A 2Z1MA 2DUWA 1ISGA 3EY4A 2B4RO 2QYTA 1ZKMA 2BGLA 3ZNNA 2G0TA 2VOEA 5FYDA 4PG5A 5JE8A 3DBRA 3FSRA 4ZQFA 1MFPA 4BKPA 5BSHA 2YHUA 3TN7A 1GEGA 1LDNA 3BTSA 3GEDA 4G65A 3KRTA 4TROA 2HQ1A 2VCYA 3PHJA 5HM8A 4XJTA 1SAYA 2GF2A 2DQ4A 3MEQA 3UICA 3G1TA 4D46A 1EFKA 1MXFA 5CEFA 4PLTA 2J5RA 3AJRA 4MVJD 4MVJF 5JYAA 1WDLA 3HB4X 4D45A 4FIZA 1E1MA 4CM3A 1HLPA 4U5QA 4D79A 3LT2A 1GCOA 3AOEC 4WKGA 3WGTA 5IDQA 1HE5A 4CMBA 1YE3A 1GEEA 3S8MA 1GY8A 2EIHA 3BHJA 4J2HA 1LRKA 2CNBA 2OHXA 1B16A 1LLQA 3VOSA 4RVSA 4RPHA 4RVFA 3GVCA 4OKNA 4CQLA 4CM5A 2C0CA 4AJPA 4BV9A 1E6UA 2WYWA 4UEJA 4RF4A 4JJGA 5LC1A 3K96A 3K2EA 4ZRMA 1PIWA 1XQ6A 3WR5A 4BMNA 1I0ZA 1ONNA 4DMMA 2P2SA 4H3VA 3DBHB 1T1SA
chains in the Genus database with same CATH superfamily
4P0TA 1R5NA 2C59A 4LOJA 2QVBA 4PSCA 1GRVA 1QVAA 3NDPA 3SU8A 4A10A 3G8AA 4R3NA 2FRXA 3C3JA 4TLMB 5ARCA 3ZE9A 4N5NA 2DT5A 1ZNXA 1NW5A 1YXMA 2R8EA 3TZEA 5A6VA 5F52A 2GO7A 3PXCX 4IZHA 4BNKA 3PTZA 1XA4A 1VJ0A 2GXQA 4KSYA 2CCJA 4KYVA 4P58A 4QFCA 5AMXA 1GA1A 4IDPA 4AY6A 1RMTA 5HTOA 1T4CA 1KI6B 1SIBE 4CIDA 3KQLA 1D2CA 4X1KA 4Q0MA 3EK2A 4UCXA 4BVFA 3B8HA 3K0FA 5T3UA 3RFUA 5EEGA 3MTBA 3L43A 4RMGA 4RJIA 3GLIA 2QKYA 1P5RA 1OXVA 3O73A 4DADA 4EQZA 4LCJA 1Y4UA 2FG7C 4WLOA 3IWDB 1SKAA 4GW3A 4CHTA 2ZWPA 1Q0ZA 5IANA 3E9ZA 4MW1A 1T0UA 3BSYA 4J94A 2YVKA 5AKGA 4JAVC 4AIIA 4GQAA 7ADHA 3VYWA 3LBHA 5DE3A 3L6BA 3OJ0A 3D5EA 4QOGA 4WUVA 1RE1A 1E63A 3GU3A 4W9MC 3FI9A 4PQFA 3TW8A 1EWTA 3M49A 5JADA 1TFRA 1XL1A 4EFKA 4XWGA 4EMSA 4MR9B 2IEIA 4PGAA 1V47A 4M3NA 2YMQA 5CB6A 1HV8A 1FFCA 1XGKA 4J2TA 3RDPA 2WF7A 3TINA 3MAAC 1LLCA 5IAAA 3GAAA 3D8TA 2NV0A 4WUTA 1JA9A 4QGFA 4F6RA 3LVBA 1XF9A 1E7YA 4JDPA 3GA5A 4XUDA 1NBAA 4WDRA 3REQB 3UAOA 2G5TA 4FOTA 5FHQA 4HRVA 4JK3A 4KWIA 2CUNA 2PV0A 3OJCA 3QUQA 3KEGA 1W44A 1SVLA 4QUEA 3BFPA 5EXTA 2OCYC 1HG0A 2XODA 4NV0A 2ZIGA 4HTFA 3N70A 1G8YA 1SUDA 4H59A 3RVLA 2XUAA 4TSKA 1RZUA 4XX0B 3GA7A 4BAGA 5B3KA 5A5VA 1E9FA 2ZYDA 4YT2A 3EMDA 4N1AA 3ZDCA 3WYGA 1J8QA 1LH0A 1P17A 1OXUA 4D3ZA 2D3WA 3RTGA 5L4LA 2OESA 3AUFA 1W5FA 1UQUA 3VZRA 3GDOA 1QAOA 1BFKA 3FZGA 3P5SA 4UM5A 5CNKA 3I62A 3ZDDA 3PQFA 3QEOA 4EUSA 4EKGA 1HDGO 1OUMA 1L3CA 3M6XA 2V6IA 1YNOA 2QXUA 2QTAA 1GNLA 2QU7A 3ZTWA 3R8XA 1CDZA 1NW3A 1I0LA 2X8WA 3H5OA 4GOKA 3A4VA 4HAVA 4ZCPA 4DLVA 4F6CA 3AYXB 2AXNA 4GVXA 2C31A 1UOEA 1BVYF 4JFRA 1GPKA 2NACA 1D0IA 4TZKA 1FDSA 2CF6A 2JJ2D 2QTRA 4F92B 5KNDH 2P6RA 2VXBA 3ON5A 1EG7A 3HEAA 2HEGA 3IUNA 3EVNA 2J3DA 4GI3A 4KXNA 4L15A 1VE9A 4LCBA 4WERA 2W6ZA 4BQQA 1AIPA 5F2KA 4AI6A 3GLIB 4ZU6X 4EJSA 3JYPA 4A4DA 3EN0A 1F0YA 3H05A 3C4JA 1FFXB 1ONBA 1ZOPA 5A4IS 3ICQB 1DP4A 4YUYA 3X0DA 2K87A 3C7CB 2HM7A 2OBYA 3AG5A 5JWRA 1YA6A 1DHTA 4BV8A 1ECJA 4B6JA 3HLYA 2AXEA 3MJRA 1QGUA 3D6UA 2GPWA 4HAXA 4ND4A 3B7PA 4B6GA 2Q28A 1I30A 2A0UA 2O3SA 4AO7A 4EHBA 5IPFA 1GTRA 2PDAA 3UQYS 4HB4A 1PV4A 1ZMXA 3VHXB 2ONYA 3N2EA 4RHUA 1L7QA 2G6TA 4LV6A 5ENZA 1U9JA 3G2MA 4HH3C 3H11B 4I7EA 4EHLA 3UAGA 2YQZA 5AM4A 4XLLA 1OGYA 1IIRA 3GPLA 5KYGA 3P0RA 1ZM3A 3RUDA 3DC7A 5C18A 1TGVA 2CUKA 2QE6A 1V9SA 2FEXA 3ZHTA 4CL8A 1YONA 4MS4A 5LZ4A 3ZQUA 1WHTA 1B26A 1Q1AA 3A26A 1EVIA 4N47A 1E69A 4URYR 3LP5A 1OX4A 5BV8A 1PQWA 4F4FA 1Y8QA 2IU6A 3IH5A 4BV3A 4P35A 3DAPA 1SJ9A 2AFHB 3AQIA 1SKUA 3D31A 2AFIA 2GJ9A 1UBOS 5D7NA 1GTMA 4FKMA 1DG1G 1NJ8A 4IX1A 4YRRA 4INAA 3HE3A 4ZZ0A 5BV1A 4N41A 1IRXA 3D3KA 1NVGA 4XD7A 3IAM1 3GHYA 4RIHA 5DM0A 5JEDA 4AG3A 2H6EA 2GFHA 3HZZA 5GJCA 3VYRB 3WJ2A 4YDRA 1P60A 4M8IA 4EHIA 1PJ2A 4QSHA 3DP9A 5IJ9B 4R9VA 3Q0TA 3SJAA 3I6BA 1QRAA 1VTKA 2GEVA 3TQTA 5HKAA 5ALLA 2UYOA 1G38A 1DKPA 1WF6A 4ZTBA 3EF1A 4RULA 1JR2A 1MNQA 3NAGA 4WASA 5BPHA 5JYEA 1OMOA 1OPRA 2D06A 4X1IA 3AY7A 1GSIA 3NBFA 4Q18A 1KQ3A 4M0LA 1C3XA 2PZFA 5K4GA 5THQA 4DUZB 2J7KA 1ENPA 2CNDA 3FJOA 4P54A 1BTOA 2C88A 2ZAIA 4AKGA 3TQIA 5TX7A 2AZTA 2HMSA 3HP4A 4JKOA 2BEJA 4Z9YA 3V8EA 4C4RA 1XEXA 2K2QB 3WK6A 5J63A 16PKA 1XWIA 2KMLA 4J49A 2FPIB 4IDFA 5F3DA 5FBKA 3U4QB 2M32A 3L7NA 1L5GB 1IPEA 4JDUA 4X8HA 4OGWA 2DKNA 4D0LB 4L7QA 1SCBA 2SCUB 2D6FA 1M6HA 4JXKA 4QDXA 3ZX4A 4LMPA 5TPWB 4L5AA 4GX0A 4OVKA 2PD4A 1ND5A 2GBLC 1XRQA 4DA0A 2R6FA 2FN8A 2R9VA 5C37A 5EVJA 3KP1A 1USIA 2NXWA 2YNMD 1CV2A 4B9AA 1EWVA 1GLNA 1JQDA 4I2NA 5T6BA 2WUEA 3E9QA 4LXIA 3C8MA 1S01A 4C6TB 1O6CA 4JBIA 2GN2A 3ECAA 1Z3CA 2PKCA 2FN7A 1BRMA 1DBIA 1QTRA 2E21A 4RACA 1JKJB 5JRJA 4EG3A 1RYNA 1WXGA 1H2HA 1GSHA 4FOLA 5E9WA 1FMCA 1U0RA 4IIHA 3SC4A 3VZBA 4I14A 3ZEAA 5J1SB 1WKBA 4OJMX 3ENKA 5DVZA 1XQVA 3PL5A 4CF5A 4YREA 2O5CA 2PT6A 1XJQA 2QX7A 4MIOA 5EUMA 4FGSA 1Z5NA 3V4SA 4BP1A 4YWJA 3PGMA 1FRZA 2QENA 2OV6A 1WG8A 1E1RA 1P18A 2W8ZA 3E1GA 3V3KA 1EUCB 4GR4A 1FYXA 4ZVNA 4NEGA 3NIFB 2NVOA 4V2UA 2QX4A 5COQA 2FUKA 1E79A 1E59A 1ONPA 3C3DA 4E46A 1TYZA 4PSDA 5H3LA 1G8KA 4QULA 2WT4A 3JTMA 4F84A 3L1VA 2OL4A 1V41E 4CLQA 4JJ4A 2C9MA 1U0HC 2ATCA 4PCLA 1IEQA 4X90A 3H97A 3FDXA 4ABTA 4WKNA 5TY0A 1Y37A 3HB1A 3SZMA 1Q1ZA 2I2DA 3TL2A 1JHZA 4B3CA 4CM6A 3PPWA 1DPGA 2OG2A 4RK1A 3HWRA 5KJFA 2H7XA 1M6NA 1X70A 1Z7EA 3ICOA 1DQSA 1EQUA 2P1ZA 1P74A 2QGFA 2A30A 4ZU3A 2BR4A 1OE0A 3FN4A 3Q5EA 4H60A 3EA0A 3T4XA 4KO3S 3ZJYA 1VXRA 2OCXA 4Y7DA 5EKSA 1BXGB 1ESNA 2I87A 2W11A 1XZEA 3GMIA 5TRTA 3V46A 5JCXA 3NOQA 3ZW8A 4DQ0A 5FWXB 1JVSA 4C3VA 3PFGA 2OE2A 5ALDA 3SLRA 1GGJA 1N3BA 2G6BA 3T3GA 4DDTA 1OT3A 1O97C 4ND3A 5AI9A 4PQRA 2W6JD 2V6MA 1QG6A 3FLMA 4FILA 1ZXXA 2AN9A 2GAOA 4EPXA 2I4OA 2WOJA 2AQKA 2FR0A 1PD0A 3BAFA 4YP5A 3UMGA 3V55A 2P30A 3IEPA 4CMIB 2B99A 3L8MA 3M83A 1WXXA 2BMJA 2E4VA 4J0FA 1SUWA 4DV5B 3ZDFA 1KK2A 4OU5A 5IKMA 2BKUA 1VGQA 1PGQA 3N87A 4QQ8A 1KS9A 3IEUA 2OMEA 3SXUA 3UXMA 1MB4A 3UGJA 1SZCA 1CJTC 2OCAA 2VWHA 5KKAA 5EZ5A 5TT1A 1MAUA 5HE9A 3T9AA 3LP8A 4KX3A 5DRTA 3VSAA 2XH8A 1OXBB 2H92A 2PNFA 4ZEXA 2WJPA 2VPQA 4MIYA 4P9NA 1UBFA 4KXMA 3GLUA 4EKNB 1KL7A 1K2VN 3S2ZA 2Y05A 3HCPA 2FZ5A 3KWMA 3ASVA 2FHPA 3B6JA 4M8LA 2P0AA 3DGEC 5E4FA 2GARA 3O93A 2IDKA 4PF1A 3FOEC 1QIHA 2Y6UA 4KAXA 4QD3A 3WLPA 3RCBA 4Z6KA 5ALHA 1J49A 1S8OA 2F64A 2C84A 1SUEA 1TPYA 2FG5A 2Q3LA 4EPYA 1KO4A 3MQ2A 4G41A 3LYLA 2A84A 4E6PA 1PUJA 3RLFA 2G1JA 2F3UA 2YN4A 2X5JO 4DWOA 2ZM6B 3KJEA 1YJ5A 1JU9A 1M6WA 4BC0A 2DBYA 3ZX5A 3UA3A 3LA8A 4DMGA 3HBAA 4I8XA 1PWZA 3VZCA 1F6BA 1G7SA 2FZGA 3PRJA 3WBBA 2E4XA 3ERCA 3PE4A 4L4YA 2W0SA 4ZZIA 1PT7A 2B1RA 2QRVA 5IKXA 5EE5B 3ROXA 3EVCA 1SB8A 2IY7A 3LCUA 1Q0QA 2WJVA 4C29A 1W36B 3NIWA 1ZN2A 4Q4HB 1TK9A 5MHTA 3HNPA 2P6NA 3R0XA 4UCQA 8MHTA 1L7MA 3W2TA 3MRVA 2DBRA 4EQ6A 3NI2A 4KYIB 4YMSA 3KC2A 2VDJA 3O7WA 3R3HA 1NIJA 3OLVA 4L22A 3N6RA 3PC4A 1K8XB 3ILSA 4EY4A 5CA0B 1B93A 4TRRA 4F1WA 2VO1A 3LDHA 4KR0A 1BHJA 1VPTA 1RYYA 3NYQA 4OBEA 3L4JA 3PXBA 1U7WA 2FW1A 4PRKA 4MO9A 1NZFA 2I2FA 4QXAA 4RU1A 2OV8A 5TQ2A 2X6QA 1EJ0A 1H0RA 5EE3A 2FQWA 2ZBPA 1NM5A 3PUIA 3GNTA 1VSQA 3LQYA 4RAOA 4HNGA 1KDPA 1KETA 1WZNA 4M37A 2AOWA 1C14A 4M9SA 4ZOBA 4XVUA 3AKYA 5DBGA 2XDAA 1JQAA 1GAWA 1RRVA 2E5FA 2HN9A 3QLVC 1E2JA 2B34A 1UBMS 2F3TA 2FB9A 2JVKA 2BFEB 3H84A 3HA2A 3NNSA 2VF7A 2W2XA 2VBCA 3L6CA 4M46A 3DZJA 4NNJA 1PU2A 1TYAE 4PLCA 2BRUC 4RVNA 3HXQA 4QQKA 2X15A 4H4DA 4JVOA 4YGYA 2D2VA 1M72A 2F90A 2NO1A 4ZT5A 3R9XB 1XT6A 4MCJA 4E6EA 4PQEA 4MJXA 1GCAA 3BA6A 1T6BY 3F7NA 1E3IA 4FYIA 4Y2PA 1E2GA 2QTLA 3ROEA 2H2WA 2WIJA 1A3CA 4FNAA 1RLMA 4D4LA 5LNK6 4KLCA 1X7WB 2IBTA 4YV7A 3F96A 4CODB 2GM5A 2QTHA 5COBA 4HH4A 1N6OA 3THXB 3EVBA 2P41A 3O74A 2V7QD 3UJ9A 2KE5A 3LP6A 1L5LA 2ZSJA 3G0DA 1GZ4A 1FBNA 1ZD8A 2O20A 1ZONA 3KLOA 4RL6A 5EIBC 3LQ2A 4TXHA 3H4TA 4G81A 4GPAA 4JOBA 4MQ5A 3TUIC 4BO5A 1JJAA 2WG0A 3Q15C 1H3EA 3HU5A 3DBVO 2CHGA 2UXBB 4E5MA 1VG9B 2ZIXA 3COZA 4H31A 4QBIA 5DTRA 3RVBA 3TVYA 4MO2A 5JPDA 3QYJA 1XYVA 5TJHA 4MWSA 3V9AA 4KK3A 4AW9A 4NU8X 4YVFA 1DMSA 1YC5A 2WU3A 3U7GA 2EW1A 2OO3A 1EE1A 1NR1A 1GSOA 2QN8A 2W58A 3QQPA 3DE3X 3REGA 1ZEJA 4X62B 2FU5C 3K09C 1BDHA 4W9RA 5I5GA 5BURA 2Q1XA 4BCDA 3I1YA 4Q9DA 2VTEA 2I99A 1GTVA 1CIPA 4WXRA 1X1TA 3WLMA 1H4QA 2OXCA 2OHOA 4WDQA 4Z4EA 3SY8A 4O4HA 2DQYA 3ROTA 4O4JF 3T3NA 5AW3A 3IOBA 4AO6A 4LJ4A 3QEAZ 5ADHA 1J33A 3S5JA 4BZZA 1YB2A 4RGYA 1Z2EA 5LQJA 2ZUSA 3MD9A 1ZR2A 4TYYA 1PQYA 4ZJPA 2NU9A 3CF4A 3FYSA 2BSQA 2IPXA 5ADWA 1OQAA 1TJPB 1XAHA 1X7DA 2MYNA 4ABYA 1KZ6A 3WHKA 4AY3A 4D9CA 5AUPB 1VG1A 1X86B 3C6XA 3GT3A 3EF0A 4R9SA 3THYA 1M2OA 1OFHA 1TJYA 1TK2A 1P2GA 3AOGA 1PFUA 1QR6A 1NULA 2BKXA 1T2VA 2JJYA 4LBYA 3KWLA 4QJ4A 2HDWA 2I3GA 1GL9B 3AUYA 1C8VB 4H7IA 3U3OA 2PZKA 3KPWA 4Q3AA 4KMSA 2GX6A 1QJCA 2MOKA 1SK9A 1LEHA 1NLUA 4J6FA 5F9MA 1TEHA 3BE5A 1XTUA 3HXTA 3A28A 3BGIA 5IP5A 1F51E 1O89A 1JJ7A 1VHJA 3L8GA 2WWHA 1RC0A 4OHVA 2C77A 1PR9A 1Z4MA 2QWXA 5A9TA 1FSGA 1QORA 4QM6A 3Q5GA 2PL9A 4E2XA 1CKEA 1Z33A 2XCOA 4MGZR 1D0VA 2JGKA 4DJEC 1B73A 4FYXA 5CB4F 4LZOA 4BLOA 3M6LA 1VIYA 3GB9A 1WRBA 3OX3A 4OHBA 1RR6A 1EBFA 3GT4A 2WTEA 2QG9A 4HXYA 4NDZA 3MWJA 2JBHA 4BX9A 2AK2A 3U16A 3H04A 5DYYA 1H1LB 5U1PA 2P4SA 2D13A 1H1TA 4RZXA 3F47A 3WMGA 3GRKA 4G5YA 4C7OA 2JL1A 1MV8A 5CMLA 4LG1A 1TKBA 4ZT4A 2QVCA 5AOVA 1LSSA 3T7CA 2X9GA 1YHZA 1JE0A 1N2CA 2Z98A 1J5EB 1AKUA 1VSTA 4P4UA 3HCNA 3NOVA 1NZDA 5C0OE 4KXQA 2SCUA 5K8LA 4RX1A 5FPYA 4L0DA 2X76A 5J1TB 3JD3A 3TNJA 3ESRA 1ARZA 1SC1A 2X1LA 1E3EA 4LF4B 3NHKA 4NZ9A 2NU6A 4M1WA 2EQBA 1P9RA 1XRPA 2FZVA 1XMPA 5LBUA 5BYKA 3DUWA 2NVBA 4RIGA 4DLSA 1BWQA 3H1TA 4X92A 3TQOA 1QM5A 2F8TA 4GRAA 4B5KA 4EGFA 5HP4A 3OM9A 4MGIR 1N0WA 1SBNE 2FPXA 4PONA 1IMJA 3RB8A 3RD5A 2XMPA 3VC7A 3GELA 2ORED 3FUCA 4OYLA 3ZDBA 1POWA 2VHVA 1YFKA 3K6KA 3PKIA 2ZAMA 3GJ7A 3O3NB 2RK4A 4RKWA 2AUMA 5DW3A 5F4ZA 2NUTA 3KZMA 2E49A 4XB2A 4P4SB 1IOLA 5K0BA 3EP5B 1QWOA 2OO7A 3PGLA 3PGXA 1Q20A 4JQSA 1IG0A 5DWDA 1GPMA 3TX6A 3AP3A 1RYFA 4LUCA 1CY1A 1ODIA 1ZIPA 3HMQA 5EQJB 3TW0A 2VDNB 3ZBQA 4ALNA 5I5EA 4N5LA 1E3WB 1MH9A 3G6KA 4M88A 2CLOB 3A7DA 4R98A 4E5UA 3D9QX 4CUJA 1DOZA 1PD1A 4L2IB 3AW8A 3V4ZA 1ZESA 4P4NA 4EBBA 2HUNA 4A36A 4B4VA 4FR5A 5CDFA 2Y0PA 4K0KB 1KOJA 1NVTA 3IT2A 4K88A 4N3CA 4Z3DA 1WMFA 1S0UA 1OLUB 3EXEB 1OVMA 4WFQA 3T95A 5JUWA 2OV3A 5CTJA 4A2QA 2RKOA 3BBLA 5AVSA 1KVRA 4Y6LA 4OXQA 4DZTA 2PLNA 1V9CA 3FB1A 4HB2A 1V11A 1NVVR 4FR0A 3F71A 3SDSA 2I8CA 3ABRB 3HSYA 3L0ZA 4CEJB 2MINA 2HRQA 4DMRA 3JVDA 2I1LA 4ZGWA 5C8XA 4NJMA 2C7RA 1C3VA 1XZBA 2GN9A 3JCZA 2DEUA 1JE1A 3CB2A 1XNQB 3GLSA 3H4IA 3F6RA 2HYDA 3AB8A 3OQOA 2OFPA 5IMSA 5JJLA 4H7FA 1E1QA 1M3SA 4D92A 3OCVA 3ANLA 4I4LA 3BMNA 4ECAA 2QLMA 4DCVA 3W5BA 1FVFA 2VJKA 1HE3A 1DAFA 1C9EA 1OTYA 3DYIA 3MOSA 5CPFA 3X1DA 5FBRB 3LQRA 1QOQB 1OIVA 3V2IA 2YYYA 1UIRA 3PC2A 5HDQA 5IRCD 1OIXA 2AMJA 3DT6A 3EY9A 2NPOA 1C7ZA 1J8FA 2VSYA 3GARA 3KUDA 3MVEA 4I9HA 4ZEMA 3SBOA 3RYFA 4ZOLB 2FDCA 1X38A 1ZGCA 3HCOA 3I2FA 5IVIA 5BQPA 5EE0A 2LDXA 2XXAA 3NVDA 4U7PB 5EYPB 4FLEA 1G8FA 2DH6A 5DRYA 4UNSA 4BNUA 3VMMA 3SXUB 1QKJA 1ZU4A 1XHLA 2OBFA 5D3MB 1ATZA 4RD1A 2TMKA 1HZJA 3MTQA 4EFNA 4FFSA 1VJ1A 4MWBA 4BLWA 3B53X 1LDBA 2H31A 3ZU6A 3G7UA 4Y2GA 3UXEA 2VSNA 2B2CA 3FOWA 1Y5NA 1ZMRA 5DLPA 4YDHB 5KSWB 2LGJA 4JEUA 5LQKA 2EJBA 2EEZA 5FAXA 2ODEA 3CVWA 1E0JA 2GA9A 3FWZA 5AQEA 4UTZA 4BX0A 4NATA 3LQFA 5JNLA 2CLEB 1T4CB 4E07A 2CL0X 3K1TA 2WQ6A 4CCAA 3E1SA 3NC4A 2IOYA 4E5PA 4NBNA 3CX7A 1JSZA 3VJMA 1KEEB 1CEYA 1FNMA 1PZEA 3KSZO 4LHSA 1O6ZA 1OXSC 2YBEA 4ZALA 5HZGA 3FHTA 2C9BA 5EMKA 2NGRA 4BP8A 5EZYF 3U3DA 4DM4A 2CNLA 4MAMA 3F3MA 3BGSA 1G3QA 3T5GA 5LOVB 3FOAA 5AK5A 1E2IA 1L7VC 2FUEA 1PKXA 4X45A 3KD3A 3KB8A 3DDCA 1V5FA 1NQXA 1J5PA 4UM8B 2Y0CA 3QVUA 1M5TA 3IQFA 3AVTA 1IBRA 2MHCA 1JSXA 3GQBA 2X7XA 4MR9A 5FWDA 3VC2A 1GA4A 5KJCA 3Q4GA 4DREA 1JR3D 3I9MA 2C92A 3NHRA 4KAAA 1USWA 2P3QA 4IXNA 4PO1A 4E14A 4UOZA 4MDEA 5KREA 4P0QB 4YJGA 2CK3D 4AUEA 4ZV9A 3IDSA 1KXJA 3A6HA 1E0AA 3SFTA 3C41J 3KQWA 1T29A 1UK7A 1U5AA 1YR2A 3I72A 3T34A 4ALJA 2JCYA 1JFLA 5ALJA 4BS9A 3F6BX 1AS2A 4Q39A 1XCMA 4JNKA 3TEMA 4CV2A 4RL4A 5IZ4A 3AFHA 1SA0A 1ZZGA 4LK2A 2IH5A 3WRXC 1P4AA 4I2VA 2PY6A 4JEHA 1LI7A 1AQLA 4YAKA 4F7WA 2ILVA 1FLVA 1HL7A 2Q5IA 1JMKC 3BZBA 2A3RA 3JR3A 3L6EA 4MICA 3SS7X 4F91B 3GLGB 3IE2A 3OPNA 1XALA 1M0WA 2QW0X 5D00A 5KTMA 1Z74A 2ZUEA 4ZXFA 2F2TA 2J1LA 2PGNA 2H1OA 1RJEA 1NUSA 2EHJA 1E5XA 2FETA 2JGIA 2ZWIA 3AIKA 2ZTHA 2ERXA 3TRDA 5FV4A 4X6YA 3JVVA 2OAEA 5LA6B 4GMHA 2V4ZA 4CQMD 2ZS9A 2N9UA 3G0IA 4HYTA 2XYGA 1F1JA 3D59A 3FYHA 4UXHA 1E62A 1C4XA 4GI2A 4F2WA 3IEMA 1A5TA 2MSKA 3BULA 5ADUS 4G1BA 5KDOA 1V26A 1A7AA 1FSSA 1N5OX 2Q9BA 5DBIA 4MP6A 3U7FB 1I3KA 3KHSA 1W76A 2V3CC 3JW8A 2Y0DA 2OTCA 2P9YA 3L8FA 1YBVA 1JHOA 2JCGA 3H0WB 4X7RA 3HXLA 2YDYA 3S2YA 1AHNA 4ITRC 4NBKA 5K3CA 1X7WA 5LQUA 3KOXA 1CF2O 1N3YA 4G8BA 4C2TA 2ZXFA 4ZKEA 5ICMA 4PNHA 5JCPA 2HMTA 4J43A 5EXPA 4N49A 1UMBA 4DSZA 3CCCA 1RPJA 5JAHA 1Y5RA 1R6BX 1S2IA 2ZE5A 5T67A 1DJPA 1TADA 3RTCA 3TSCA 4KR6A 4WCVA 3KSUA 3T9CA 3B52X 4KXVA 5K4HA 3C6ZA 2Y1EA 1OWMA 2A5DA 1F14A 3HZOA 3DLBA 3CH7A 3HVJA 1KAQA 5DN6D 5F9FA 4TLCA 3TLCA 4A03A 2CMDA 1VL6A 2ZUUA 1CUJA 3PICA 3MTGA 4JYZA 2AHRA 2NXJA 1V7CA 1Z88A 1U4NA 1EGMB 4XPZA 3RYHB 2A1TS 5LIPA 2A88A 4L9AA 1YZTA 4RDCA 3BKXA 1G1MA 5EJ2A 3MSXA 2YINC 1WM1A 4AUKA 4LOHA 1UDRA 2YHBA 3RM3A 3PUKA 4TN5A 3QJYA 1TMGE 4D5EA 3BMQB 3EFOB 4C4PA 5HJ5A 4QL3A 4Y3UA 3C4VA 2A2ZA 1V95A 2ZSDA 4J9VA 5JRDS 3P2YA 3N8HA 4JENA 2AFHA 2OM6A 1E1DA 4ZYYA 2BGNA 3T15A 1WZUA 5D2CA 4B47A 5AW2A 3SGLA 4Q3BA 5EWLA 5CBPB 2GWHA 4N7JA 3IVCA 4S1TA 4QDZA 4W8HA 3HV2A 1O9HA 2WZQA 1UDWA 2JLQA 2O1SA 5CW1A 1DU4A 2J30A 4I5IA 1NRIA 1P6QA 1Y1PA 1ZVMA 2ERCA 2ZS8A 3CKYA 4KLAA 4UNNA 5BSFA 2PT5A 3OKPA 4ITVA 3ZI0A 4DCJA 2XI4A 1FJGB 2G7MC 4REMA 2RHGB 2EKBA 2OBXA 1IOVA 1UXKA 5CFQA 2Q3HA 4BNFA 1HT2E 1Z2DA 1ZCJA 4DCGA 3AOEA 2BHSA 1F17A 3NTUA 3Q98A 5KVCA 1JZQA 1TU3A 1XZGA 3KVNA 2EIXA 1V2GA 1O3YA 1QZUA 4N7MA 3LC7O 5HILA 5IU6A 1R5BA 2QAGB 1H8HA 3W2IA 2ZYWX 1UXGA 1FTGA 2DQKA 3QE9Y 4H0NA 4PAQA 1J8YF 2HF7A 4ZAXA 1GAXA 1MO4A 4TL8A 2OV1A 3DH0A 4H1HA 2QRGA 3IYLW 2RGRA 2PTGA 3IALA 4KXXA 3VKFA 1CE8B 1IN6A 3G2NA 2IYPA 1UFQA 2KI5A 2QTMA 4GGPA 3AW9A 2A1TR 1G0NA 5ISMA 2VSQA 5AO9A 3W1EA 4ZP1A 3SJUA 5TPZA 3QP9A 1DDGA 2WWIA 3ZWXA 3MUOA 1JEAA 3G02A 4IDDA 3SHTA 4DR7B 4IVQA 4ZOLF 4Q82A 1PVOA 4U6SA 2Z5LA 4QGSA 4OYRA 1FFBA 1MAWA 1BJKA 5TB5A 3LL7A 3AZQA 3P2KA 1RJ9A 3JYNA 2JGRA 4QUBA 1RXVA 3AR4A 1Y8QB 1U1GA 4MR7A 2P5YA 4PLGA 1N2CB 2C5GA 4NH0A 4KIUA 1MX3A 3CEPB 4D6YA 4CTKA 2C7OA 2O8FA 1U2GC 5GV7A 4EHNA 2P4EA 4TLEA 1O58A 2ZREA 5IEJA 3DCJA 1RLUA 2PXXA 2PUDA 2OR3A 4PLZA 4UUNA 3DHWC 4Q3OA 3LECA 5GZ1A 4RCZA 2ZTUA 1CZNA 4DN6A 1NW7A 1FFHA 3GRPA 4IG9A 5KQSA 5KNLA 4DG9A 3OI7A 3THRA 3D6HA 3WLOA 1V6SA 1DQNA 3SE0A 2RGAA 1X8XA 4C0XA 5IT0A 3D7NA 3R7BA 1N32B 3D6MA 1BC5A 3K2BA 3LKBA 3HEMA 5FPSA 1MEJA 3GJSA 4X84A 2SKEA 3NHAA 3EDMA 3SYNA 4I8DA 2EBUA 3PD1A 1QFJA 2W9XA 5BSWA 3TGPA 3PCTA 1XJ0A 1BX3A 5BVHA 1TU0A 4G5GA 4RV5A 1HDXA 3HY3A 2NW6A 4R1LA 2P4HX 3GCXA 5BNFA 3K5WA 3RTEA 5ELXA 3MJVA 5JNUA 3FZNA 2Q3JA 1JVNA 1T9KA 1ZGJA 1NFFA 2FX2A 1CYDA 3QWIA 3UC5A 2P3SA 4CVNA 5K6AA 3U61B 2BM0A 4V02A 3FOFC 2C2GA 2W2KB 4BFWA 1BMFA 3V1MA 4BB0A 5H3CA 1GPJA 4JOSA 1VB5A 2LCFA 3IV7A 3FYUC 4QYMA 4RJTA 1Y81A 4N5IX 1WUHS 3DV2A 1CJBA 4RKQA 4W5TA 2HRCA 5F1OA 2XDWA 4GNKA 4XUGB 4KQIA 3AK4A 2RC5A 4G9EA 4S1PA 4RZ2A 2PYDA 5EIWA 3OF5A 3ZWKA 1NYTA 4KE9A 1Q95A 2X19A 4ON9A 4D4HA 4CG3A 1E1QD 2HHAA 3BF7A 1HR0B 1TI7A 2G3YA 3PXAA 1CRPA 1QHNA 5BT9A 2XF2A 2ATEA 3LKDA 4OATA 2Q3MA 1Y1QA 1UC4B 3G23A 3ISJA 1JYSA 3P8ZA 3MOIA 1OY1A 4N5MA 1PJSA 2WJAA 2P7IA 5SZJA 1J8VA 2C42A 3HKDB 1M7HA 4EG8A 1SG6A 2ZCJA 5TLSA 1OBCA 3WGKA 2B4TO 1MTZA 1ZRMA 2SICE 1EGAA 3M4XA 1Z7WA 5E2IA 5ANRB 3W78A 3R6TA 2I8AA 4DLLA 2L17A 4IIJA 5JJBA 3DOOA 3N2KB 1RBMA 4M1KA 2ADOA 3ZQ4A 1IHUA 3H6GA 1CQPA 4LE1A 2H1IA 1MIOA 1YS2X 1WPQA 2OUIA 1IJEA 2JFZA 4ZTZB 2FSSA 3OLWA 1VXOA 1CVRA 3DDHA 3SYRA 3UUFA 3Q41A 5AW0A 4ZYWA 3D3WB 2PRYA 4C6HA 4UE3S 1SOVA 2PRKA 2IHYA 2K5UA 2QTFA 3FPHA 2QRKA 4IICA 4ASUD 3KUKA 1NG9A 5ECWA 2QD1A 4C2UA 3OTHA 1FJHA 4D25A 1N57A 2OD7A 5JYCA 2YTZA 1UJ4A 1WEKA 4WZZA 3RJZA 4AIRA 4ZVOA 3WGIA 4B3HA 2Q9AA 3IODA 2XEXA 4ZO9A 5HTKA 1DKLA 2JI8A 4BBJA 1W2GA 2C97A 4V0OA 4Z7OB 3ILHA 5CDUA 2QOEA 4CLOA 1HQKA 3OZBA 2NIPA 3P27A 4K9PA 1KQNA 3A70A 1WSWA 3MINA 1UC8A 2R4QA 5HF5A 5ALQA 1ENOA 3V8RA 2F00A 3KB1A 4KH1A 5H59A 3NJRA 2C7BA 5IAGA 3HKBB 1P0QA 4EHDA 2VJCA 4YNBA 4YY3B 3BXGA 4UXIA 1CY0A 5CM9C 1UINA 2R8BA 3UBTA 2ID9A 1GTG1 3PUXA 4YT4A 5IULC 2CDBA 1PR5A 2WRZA 3DXZA 1YO6A 3NRCA 3OEWA 2BOVA 1U8FO 4LXQA 5T5QA 3W8RA 2GEDA 1TQDA 4HYYA 2NOAA 3L7LA 4RMNA 3EP8B 4IEEA 1E98A 4Q1DA 1VLZA 4FLMA 1W4RA 2X77A 3GPCA 3HGQA 1A72A 4WZBA 2MCFA 4ZVRA 3NAMA 1U8CB 5LLTA 2CK3A 4N6GA 1OWNA 4J1TA 2QUAA 2CFIA 1JLLA 2EXXA 4EHKA 4ZCRA 1M8GA 4U02A 1QXSA 3TSYA 3GCWA 1UMDB 3GDFA 4D8TA 1DXYA 1XN1A 3FJ1A 2XUHA 1YJQA 2ZIFA 3HRIA 1Q83A 3BGOS 3I42A 3M9LA 1X1CA 1DLJA 2NWQA 3GQBB 2VL7A 1EHCA 3MLEA 1TA4A 1IULA 1HYQA 1TE2A 3N1UA 4GH5A 1QIJA 4MAFA 4AG5A 4E4RA 5HQ3B 1MO2A 2OILA 1FP4A 4AZ0B 1V6AA 1TO1E 1SUIA 1LFAA 1FSFA 2HTFA 4JMPA 2YX1A 4YUXA 3VUEA 5AW1A 5K3FB 1R18A 3NV9A 5AW8A 1Y8ZA 2Y9MB 2EBWA 2BSXA 3UQZA 2GXSA 2G8NA 3U19A 2IYTA 1JG6A 4H6PA 4AK1A 3EHDA 1NLYA 3WMWA 4BE9A 5SZIA 2I55A 4EHJA 4UM9D 1TD9A 4DYVA 5EJAA 4C05A 5BWLA 1R6XA 1KGDA 2XGMA 4NF2A 2FSHA 3QRWA 3T41A 2PKQO 5GM1A 1H0SA 4TTIA 1RJFA 4RS4A 2PN1A 4FMDB 1NZJA 3RK4A 1QMHA 4JX9A 4RHCA 3UANA 2JFQA 3CSDA 3ZE1B 5AQ1A 2FLVA 4HNAA 4ACBA 4B40A 4EVRA 2R85A 1A95A 3GLTA 1N5IA 3SQDA 3EWIA 4DT1A 4MV3A 4ESHA 2ZSFA 2XWBF 2Q7XA 5LXTF 4LX0A 1TX4B 1TJ4A 5ARDA 4MWGA 1D2MA 3V4LA 2DC1A 4JV5B 1B8NA 5FTMA 3UMVA 5IAJA 5AESA 1O57A 3QUCA 5KWVA 3HUFA 1U7HA 4EYGA 1VCNA 4D9NA 5JROA 1K6JA 2J3KA 4ZVTA 4DTIA 2YMPA 4E4TA 1T8SA 3EFOA 1OR8A 2JKZA 4XSVA 2KJQA 4OHYA 2AMVA 3I9LA 4RFLA 2H4WA 2XBLA 3EIWA 4ZAGA 4GWGA 4IZIA 3GBVA 1NT2A 2DH5A 3MAGA 4MR8A 3DVAB 1Y89A 4NQRA 4UBLA 1E89A 4BB5A 3CEAA 4EABA 2ZI7A 1RP1A 3LTEA 1FFEA 4OU4A 4YACA 5AXAA 3E8XA 3MGBA 4MQEB 4F3KA 2M6KA 3HB7A 3OTQA 4JC4A 4EYKA 1GN8A 2V98A 3H5NA 3SJBA 2Y1LA 3GJ6A 4CM8B 1I6WA 3V48A 2YKGA 1NURA 4WNAA 1GQQA 2JAUA 2D7JA 4M7RA 4IVNA 3KZCA 1BDJA 1E9CA 4HDNB 2FW9A 5ALKA 2GUGA 1QYRA 4KIFA 1KA9H 2H0AA 3E5NA 5EIFA 3Q7PA 4ZVKA 1V1RA 3VU8A 4EX7A 1G2QA 2V74B 5K0CA 2CKMA 2PVPA 4D9KA 3FVTA 2AN3A 2IEZA 1KH1A 1QB8A 5BVGA 3ZJUA 4UE6A 3ILVA 1U28A 2VQDA 1JG2A 4FKBA 2GD0A 3KG2A 3UNXA 4ARVA 4B9EA 1R37A 1I4DD 1Z45A 2VHUA 4KDCA 2OYRA 1DC5A 3AETA 3M6MD 3PX2A 1A2KC 4HAOA 1U1CA 4GKVA 3TJZA 2QLBA 3DTVB 3OZUA 1JVBA 1WPXA 3THOA 9LDTA 1WXQA 1G5QA 3GP5A 3OLZA 2OB1A 1VCHA 4OF4A 4M99A 5DGDA 3MWFA 4GQBA 3B60A 1GL6A 3IPXA 3WLRA 1KO5A 1E5DA 1HDYA 1M8KA 4DLXA 5HUHA 2H4XA 2OKGA 3K1YA 5J5AA 3NFRA 4YRMA 4ENTA 4YQEA 5CFLA 2R1TB 1F48A 2C5SA 3IAXA 2QVLA 4V3CA 1K9VF 3R7FA 1AVTA 1Z2PX 2ZJFA 3AI1A 2PZMA 5FOVA 4FWTA 1XG5A 1JFFB 1PZGA 1YFJA 3NHZA 2R5FA 4X85A 3T52A 3NC1C 4AJLA 2F17A 5ITVA 5BUCA 1TTHA 4BFLA 4FFPA 3FR7A 2R97A 2A9RA 2AR0A 1F2TB 4RW0A 2QZ9A 3I9V6 4ZGBA 3DBOB 3UMYA 1MJGA 3VVCA 1JSCA 2WTUA 2WV7A 3CKLA 1MORA 3FLBA 3ISVA 1DRVA 4L6CA 4EI9A 1JB1A 5JG7A 2Y0BA 5C53B 3EDYA 1EDDA 5EERA 2GN6A 4Q37A 1Z36A 3LYAA 1CYEA 3DEJA 2J7PD 4FYPA 4LSMA 2H4FA 3ESCA 4NBSA 5F4BA 4MGHA 2C0QA 2DUUA 5KX5A 1M6VA 1WXWA 2J9RA 4RTKA 2VAVA 4JI7B 4FGKA 4IHAA 2CN1A 4MVJH 1JI0A 3MOGA 5CRIA 2H4HA 2JIMA 1BS2A 2CD7A 1ZA2A 2OAGA 3NB0A 5E9JA 1FDWA 3GF4A 3Q85A 4TMYA 5LWHA 3FCEA 5KNCA 2HC9A 4YAEA 4AX4A 4DCNA 1TNDA 4MWCA 3EDRA 5CCXA 2ST1A 4S0ZA 2F48A 2GN0A 3PR2B 4NK5A 4EP1A 1T5TA 4OFXA 2NSHA 2VPXA 3DAFA 4GX2A 3FUVA 4O2AF 4YJFB 3H2KA 3A3YA 4YASA 4L78A 4TX1A 2GAJA 3PX7A 4L02A 4GGOA 3TTXA 1Z37A 1RHQA 3CLSD 3DEIA 4RQBA 3LYUA 3O03A 1NC1A 1UAAA 2QW1A 5ILGA 3E9EA 1QGAA 2GSWA 2QYOA 3WO0A 2Z8YA 1PYDA 4IJVA 1P2TA 2HNKA 4EPWA 4A91A 1JDUA 2GK3A 3UOAB 5H5JA 3C85A 4X65B 1R9MA 4ROTA 4YCBA 5CXSA 4CTJA 3KKNA 9ATCA 1I2AA 3CSUA 4ACAA 4ZVUA 1F4PA 4L57A 1L6RA 4AB1A 5KVAA 4TTJA 2OT3B 5ENVA 3KWFA 4NULA 3ECCA 2IF0A 4D42A 4Y18A 1SBHA 1STOA 3GLKA 3N0WA 1NRXA 2BM9A 2IEAA 1EUDB 4JEIA 2WYUA 1GKKA 1XWWA 4RA6B 3ZIAA 1XRMA 3GG9A 3I34X 3QV1A 4L2IA 5E0OA 1HOTA 3EGEA 2P9CA 1XD2B 2P2DA 5DIFA 3ZS9A 2GVDC 4OREX 1LS1A 3BB3A 4QOHA 3PNYA 5DX1A 2WWXA 5JXGA 3HR7A 2J0SA 1HG1A 2ZE6A 4DIUA 1XXLA 3OZDA 2EGHA 1JALA 3GFTA 3CN9A 1GGNA 1P7PA 3S1AB 3UPDA 5C7LO 2ZYTX 4YCNA 4Q00A 3NRJA 1CUYA 1XUOA 4H7EA