3QVWA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k278a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
392
structure length
392
Chain Sequence
b'MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSADKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
source organism Archaeoglobus fulgidus
molecule tags Isomerase
total genus 152
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvwA01
2OMEA 1XR3A 3L9WA 1GYPA 5I9NA 5DZSA 4CM6A 4M86A 4DYDA 4B3HA 1U28A 2PZMA 4CR8A 2C7VA 2W8ZA 4I5EA 1O8CA 2H5LA 1CDOA 1OBFO 2VT3A 4NJMA 3PXXA 3DXFA 2NQTA 3ZDFA 4CMHA 1U4SA 2X23A 4J7XA 1O95A 2I76A 2Q99A 4HFJA 4TMFA 5JYAA 5KOIA 4FFPA 5BSHA 3HWRA 3GC6A 2BF7A 4WOJA 4QFCA 4BMSA 1L7EA 3DWFA 2HK8A 5DNAA 4E30A 4QX6A 2NVBA 2FSVA 3K9QO 4P22A 4R54A 3KVOA 1I01A 4ND4A 4IZIA 2WJPA 4XZ3A 3HADA 2PD6A 1K6XA 3R0IA 4R1TA 3VPFA 3VZQA 5JYEA 3OEWA 3TJRA 5JS6A 5LCXA 4CV0A 1U8FO 4XCVA 3RC7A 3I6QA 3NUGA 2IZ0A 3ZWAA 3ZV3A 1T25A 3KHUA 2ET6A 3WJAA 1ZO8A 2OGUA 3DB2A 1EVIA 2DBVO 1DFIA 3M2PA 5JXWA 2X9GA 3CZRA 2BFMA 4L8VA 1GPDG 4WLEA 3E48A 3RUEA 4RORA 4AJIA 3PDJA 3JYNA 5CFZA 4S3MA 4FD3A 4NNJA 4I9HA 3LYLA 3S8MA 4MVJI 1HZZA 2IE0A 3WSWA 4R1UA 3ZWOA 2FZWA 1GFSA 5G0TA 5EQFA 1HDGO 4HUJA 4EEXA 1VKOA 3H9EO 1NX6A 1EVYA 2PFGA 3QP9A 1N7HA 3EGOA 4U6QA 4RF2A 3PFWO 5TS3A 3VPGA 1UDCA 2BI7A 3PP8A 3WG9A 4JIGA 3HQ4O 4NZ9A 1OFGA 1CERA 1N2SA 3DR3A 2GRAA 1IPFA 4KWIA 2JCVA 1NQTA 4DQUA 4YAJA 5IFLA 1KVQA 2B4RO 1R4NA 3JQ7B 4Z3KA 1IULA 4JBGA 4ZQHA 2Z95A 2YYYA 2ZJ1A 2X8LA 4HY3A 4XYEA 3GOHA 5U4QA 3UGKA 1V0JA 2UUOA 3BHMA 4J1NA 2Q1WA 1VSUA 3WMXA 3DOCA 3PTZA 1M75A 4E5YA 1GPJA 3BIOA 1B15A 4CMCA 4BNYA 3RCBA 1PGOA 3ROPA 4BMNA 2GZ3A 3H4VA 4ID9A 3HDYA 4CM3A 3CMCO 3I23A 2PZJA 1BWSA 4UAGA 4E3ZA 1TXGA 3PWZA 3OSUA 3VPXA 5JC8A 1PS9A 4HFMA 4HADA 4ESOA 4XIYA 5IXSA 5GZ3A 4D0RA 5C7LO 5H81A 3BA1A 1YKFA 3E5RA 1YOVB 4BO8A 1Y8RB 1PL7A 1NPTO 2EV9A 3UCFA 2OHXA 4MVJD 3GG2A 2X86A 3RROA 2BGKA 2B5VA 5I9LA 1WAMA 4R01A 3IP3A 4DLLA 5C37A 2IXAA 1BMDA 1I0ZA 2XAAA 4R1SA 4U7WA 2Q3EA 1A27A 4GQAA 2EP5A 4GMFA 2Q2QA 3JD3A 5KWEA 3C1TA 1OMOA 4IBOA 4MKRA 1VE9A 1A72A 4CMEA 1FDUA 3I52A 2DC1A 4YACA 5M6DA 1LLUA 2Q22A 2FSSA 2VRCD 1V35A 4IUYA 2V6BA 3D3WB 2J5RA 2NUAA 5GZ1A 4ZQFA 1GUZA 2FWMX 4EJMA 3QVXA 5L4SA 4NQZA 4XRRA 2GZ2A 1VLLA 4CV1A 3GFGA 4E5KA 3ON5A 1Q0LA 3KEQA 4QO7A 2Q2WA 2R2GA 4GX2A 4TRMA 1N9GB 3K6JA 1Q7GA 4YR9A 3VDRA 4PLHA 4KTTE 5IZCC 3QVOA 1OC4A 3AJRA 1XGKA 4GX1A 1O94A 5G0SA 1ARZA 2GYYA 1Q7BA 1UP6A 4E2YA 3F4BA 5G4KA 1R4MA 3UHAA 4D3SA 2JKVA 3QLJA 4YAIA 4TKLA 2J6IA 3K8ZA 1CEQA 4G65A 2HDHA 4KTVE 3K30A 2I3GA 1HKUA 2GASA 3RSHA 1EQ2A 3MOGA 1H9AA 4J9VA 4EW6A 1FMCA 3CKYA 3UCEA 3O38A 1WZIA 1PEDA 1ISIA 2B36A 5EL0A 3H2SA 2H1SA 5LDGA 3FN4A 1IPEA 1PZEA 3L6OO 1LDEA 1AN9A 2P91A 4IPTA 5HWSA 2HKIA 3ZGYA 5F1PA 1O6ZA 2OBNA 3GAZA 1D1SA 1Z82A 2O2YA 3ETDA 1NHGA 2EKPA 4DRYA 1XYGA 1SB9A 4J90A 4CQMB 1IUKA 1V8BA 3P7MA 4J7CA 4DQXA 3LC1O 3ANLA 1LNQA 4BNNA 2GLXA 4BNWA 2V7PA 4EYEA 1I30A 3BZUA 3GR6A 4HNGA 1BXZA 3WICA 3DZIA 1V3VA 4CMEC 4MIEA 4J1QA 3MWEB 1LI4A 4LISA 3WIEA 5EN4A 3NTRA 4RPJA 2QX7A 4BO6A 1ENPA 3JQ9A 3SC4A 1E92A 4ZQBA 2O4CA 3FR8A 3ZCXA 1MXHA 3GUCA 2WMDA 3OJLA 2FRDA 4AVYA 4BNUA 1K3TA 1JW9B 2A35A 4CR6A 3WYCA 3OP4A 3QWHA 4BUCA 2FOIA 2C59A 2Q45A 4II3A 5B4TA 4DREA 4BKUA 3OA0A 3ITDA 3GEGA 1Z7BA 3BYZA 5JBIA 4RCVA 4RJTA 3TZKA 1PTJA 1IHXA 2DAPA 3TOZA 1V6AA 1ZJZA 5JAIA 3M1AA 5DP1A 3QW2A 2ZTMA 3H7AA 3KBOA 1Y5MA 5JCJD 5EPOA 4CL3A 1X15A 5K6AA 3KUXA 1BXGA 3DFUA 4ALKA 4WLNA 3QWAA 3S2FA 3EY4A 2GGSA 3N74A 4YJDA 3UAGA 1G1AA 5KVSA 1OZAA 4WUVA 3WSVA 1A7AA 3QVWA 1JQBA 1ISGA 1WPQA 1DAOA 4FPXA 5G4LA 4BO4A 4QO8A 3LT0A 1NM5A 1SEPA 3STHA 1AHHA 1H2HA 4A7PA 2WDZA 4TWRA 2QZZA 4YTEA 3ZZNA 5AYVA 4FC6A 2JD0A 1UDAA 3NDRA 3ENKA 3GG9A 1DEHA 1SB8A 4KUEA 1E6UA 2NADA 2VZ9A 3O8QA 4CLDA 2EHDA 2FPIA 1PJLA 1D8AA 1YRLA 4KWHA 1GCOA 2ZKLA 1NVMB 1DC6A 1VPDA 4R68A 4CQMD 3GZNA 4OYRA 1BW9B 2AHRA 3EHEA 3H65A 4BQPA 1JWBB 3FNGA 1GEEA 1K89A 4X54A 5H83A 1KIFA 2HCTA 3UUWA 1DIAA 4DPMA 1EE9A 3C1AA 4R69A 4IIUA 1DJQA 4WLUA 3GVHA 3I9KA 2XPCA 3JQAB 3IUPA 5DDIP 2POQX 3TFOA 5CEFA 4CV2A 5GY7A 1XA0A 2EF1A 3ORFA 3DAGA 4BOYA 1SPXA 1DBVO 1NVGA 1ZNQO 1LLDA 4B8WA 3F1KA 5DCWA 3MZ0A 5K6AC 3EUWA 3ADOA 5GMOA 1E3WB 3U49A 2I65A 3VH2A 4OSPA 1PS0A 3IIEA 2ZCUA 3I9NA 2W4QA 3N58A 2EP7A 4BO5A 2Y05A 2HRBA 1MG5A 3KOUA 1KBZA 1UJMA 3I4CA 2ZTVA 4ZRMA 3VTZA 3IL2A 1JN0A 3VDQA 2OORA 4GVXA 1FXSA 2J5KA 2OL4A 1NP3A 1O5IA 4XX0A 1LUAA 1JVSA 2PWZA 4JP2A 4IXTA 3U4DA 3OJ0A 1YH3A 3R3JA 5DCUA 2BD0A 1RWBA 3LT4A 1M67A 5TJ9A 3UOGA 5A5FA 5ICSA 3VKUA 2D1YA 2FN7A 3WNQA 1PJBA 2VNAA 3OMLA 5JO0A 2W90A 2WM3A 1JDJA 3HDJA 4OO3A 5TNXA 1ZMOA 1NAIA 4ZU3A 2QIOA 4B7UA 4O1MA 5L4LA 5HRUA 1DJNA 2HJRA 2WD8A 3AI2A 2X5OA 3AU8A 4G2NA 3H5RA 3DAPA 3U9LA 1EZ4A 3FCOA 4CM1A 4YRAA 7ADHA 1EEHA 1YBVA 2I5PO 1ENYA 3G1TA 3OECA 2EWMA 4MVJA 3VZRA 2ZTUA 4D44A 3WQQA 1KVTA 1UUFA 4GSKA 4YPOA 2A92A 4AJJA 4NIMA 3SJ7A 4MIOA 3JQAD 1Y8QB 5EESA 4IY1A 3MEQA 2F00A 2Y68A 3ETEA 5A3JA 4BNJA 1PJTA 4YAEA 3RWBA 2O4UX 1SNYA 2R6JA 3V2HA 5A05A 3WLEA 1E1NA 3ROKA 3CXRA 3VZSA 3PJDA 3D5QA 4JJFA 2TMDA 3GF4A 4RVHA 4WOKA 2RBEA 1T2EA 4UVGA 2RAFA 1DOHA 3F9IA 3RFXA 3K5PA 2X22A 4PZEA 3L0DA 1LEHA 2VQ3A 4L4SA 4NBWA 4CM7A 4RF5A 1PZFA 4YDRA 5CPBA 4WLFA 3CEAA 3B1JA 2DKNA 4RF3A 2Q49A 3UCXA 2HK7A 3WJ7A 4PFJA 4LW8A 2OBYA 4NDNE 2BFPA 2NNLD 2O50A 4KUGA 4RPKA 4B3IA 2Y1CA 9LDTA 3Q0EA 3I9OA 3UN1A 1HLDA 3AOGA 4PRLA 5CPFA 4QQRA 2JD1A 1T1SA 3JQ7A 2J3JA 1A71A 4HX5A 2ZATA 3PYXA 4Y98A 1BXKA 2BHLA 5G2OA 3GQVA 1B8PA 3I4FA 3WWYA 4FJ2A 2HMVA 4GX0A 2EGHA 3IKVA 3WR5A 3PIIA 1O89A 3QSGA 4R9SA 2P4QA 1XU7A 2QRKA 3E9NA 2CVZA 4FOSA 4YJGA 4CLEA 1N8KA 2Y66A 4Z0PA 1ZK2A 2AE1A 4DL9A 2I67A 3PLNA 1SOVA 1IOLA 4Q39A 4CMJA 1E7SA 1JVBA 2AE2A 4FJ1A 1RYEA 3L4BA 2OP0A 4KMSA 2GF2A 4DLAA 4P8RA 5JDIA 3P5SA 1YOVA 4IJVA 3TOXA 4UVEA 4AJ1A 1Y8RA 3H3FA 4RVSA 3RI3A 4FFLA 1LJ8A 4NBVA 3K2BA 4LRTB 2WE8A 2V6FA 1H5QA 1GZ3A 4FGWA 4J2HA 3NDJA 4PG5A 5ENDA 3DONA 3EC7A 4A03A 4CPDA 2DT5A 2RHCA 3NGXA 3D3WA 2QQ5A 4OQYA 4PLVA 5CDYA 3HJAA 1QKIA 1FK8A 2C0CA 2JD2A 4OGWA 1UR5A 1GQ2A 2C20A 1XCBA 3IDSA 1EUDA 3DZBA 4Q9NA 4RGBA 4XR4A 1MB4A 1B8UA 4Z9FA 1HWYA 2W2KB 1PSDA 3VPSA 4XIJA 1PGQA 2HMTA 5JCJA 4CM8B 5CHEA 3PVZA 3W6UA 4TRJA 5I9MA 1U2GA 2AEJA 3FSRA 3O03A 3PPIA 3R1IA 4BNGA 4NFYA 2E82A 4GSLA 5A5EA 3JQCA 1IL0A 1TLTA 5J23A 2O3UA 1QLJA 3DBLB 2FZEA 3QQPA 2FR1A 4KDFA 3W4JA 4IMRA 1HZJA 4CLXA 2VOEA 3P2OA 3IMFA 1QXSA 3U4CA 3DTTA 4OKNA 4XRGA 2GO1A 4NH4A 3I9MA 4TQGA 4XR9A 4NBUA 4ROSA 3V2GA 3F3SA 5G0UA 3ZNPA 4W7IA 5A02A 3Q2KA 2Y0EA 4WEQA 1P1FA 1PJ3A 4HFRA 5ITVA 1VKNA 4ND1A 1EQUA 1CRWG 5JDIC 5JCXA 4BS9A 2YY7A 3DZGA 2I99A 3JYPA 4WCFC 3DTYA 5KVCA 4XGKA 2ILTA 5L53A 5EERA 3WGOA 4RQUA 3ASVA 3HZZA 7MDHA 4E2ZA 1Z45A 4L0QA 3WFIA 3GVXA 5F21A 5HS4A 3GEMA 4IDGA 1LSJA 3RUDA 4CJXA 5IZ4A 4CV3A 3UKOA 3JQDA 1PGNA 4UVIA 3EZYA 4H7PA 4JLWA 4MIYA 1QYDA 1ISHA 1UXHA 3ZW9A 3AFNA 4Y9DA 5DULA 2AG8A 5T8KA 3T7EA 4E4YA 3L4SO 3RKRA 2FR0A 4DIFA 4DUPA 4Y6SA 5JAZA 2AEMA 5I7EA 3ZW8A 5B12A 1E0DA 1WXDA 4KQWA 1CQJA 1LLCA 4FGSA 3DEYX 2D2IA 4JQCA 3NJ8A 4L76A 4W4TA 3W1VA 1RM3A 4M89A 1HL3A 5A04A 3G3EA 2I6TA 4HBGA 4JNKA 1GR0A 4M55A 2R00A 2QRLA 3DQPA 3JD4A 4B4UA 4J2OA 5HTOA 3H5AA 4XA8A 5AOVA 2FR8A 2YV3A 1JKFA 3UW3A 2AG5A 2W2LD 3K2EA 4MOWA 4NMHA 4UREA 4L9RA 5TSDA 1OI7A 5BNFA 1YDEA 1EK5A 4RPHA 3V8BA 4NG5A 1U3VA 4I5FA 1C0LA 4FDAA 2VCYA 1K0UA 2NSDA 1EBUA 2ZYDA 1JAXA 3C24A 3JQFC 3INGA 5T5QA 2NWQA 1NFRA 4RZHA 1SMKA 3WQRA 1HYGA 3G1UA 4RV9A 4W7HA 2PH3A 1QR6A 1CWUA 3FPLA 2AXQA 5T57A 1VI2A 3ZWVA 3LZ6A 4I8XA 1P0CA 2DQ4A 1HE3A 3BHIA 2GPTA 3F5QA 5THKA 4RVDA 4F6LA 5JYDA 1HE5A 2PH5A 3GLQA 5ICMA 3L07A 5A4DA 1F8GA 3IP1A 3JV7A 4RLSA 1T2DA 2NM0A 5FYDA 1BW9A 3KEOA 3KRTA 1HDCA 2GSDA 3FF4A 3QA9A 4IDEA 4R9RA 1R15A 4BO9A 5F3RA 3GMDA 5T8KC 2PKRA 3MTGA 3ZNNA 1CETA 4NJOA 1E3LA 5F5NA 3PZBA 3HG7A 4ZA2A 2Y67A 4WLVA 3JQAA 2O3QA 5FI5A 5EQDA 3TPCA 1HRDA 4UEJA 2PKQP 4PLTA 1DIGA 4JXKA 3LF1A 4XQGA 4MVJE 1JAYA 1U7HA 4ND5A 1BHSA 4INAA 1SAYA 4CUKA 4WNCA 3GAFA 1RYDA 2R00C 3PZRA 1TB4A 3CH6A 3ZU3A 4P4GA 1NWHA 1ENZA 1Q1NA 1VRWA 4W82A 2VWHA 1A4UA 1SO8A 2QW8A 1EE2A 4CLRB 1P33A 2Y0DA 4BGIA 5HM8A 5TIIA 5BSGA 4ZHSA 1E3WA 2EIHA 1LU9A 4DIOA 3AU9A 5JE8A 4OXNA 4FR5A 5IN4A 1BG6A 4D42A 1P44A 4N18A 2X5KO 4CM9D 1QSGA 3UFXA 1RM5A 4BMVA 5L45A 3ZWNA 1ML3A 4K1LA 4TRRA 3ZWWA 3Q3CA 5T67A 2B4QA 1NR7A 2VRBA 4EBFA 3SXPA 5JDCC 4J3FA 3F46A 4E0BA 3E1KA 2YHIB 3SVTA 4BL5A 3BTUA 5LDHA 1NQOA 1O0SA 3QVSA 3OIDA 5IZCA 5FFFA 1LX6A 3D64A 2Q1SA 3DZJA 1E5QA 1J5PA 2BFOA 1X13A 3VKVA 3LK7A 3DO5A 3L77A 4BO1A 3DL2A 4BNLA 4E32A 2G0TA 2VUUA 5B4UA 2JFHA 4M87A 5DCYA 2HO5A 4I1IA 4QSMA 4EZBA 1EUCA 2WTBA 3ZWBA 4FBGA 1E7YA 3WFJA 2PR2A 3HDHA 3MJEA 3ZV6A 3V1TC 1WZEA 1EUZA 4DVJA 1C1DB 2O7SA 4MP8A 2UV8A 1Q7CA 2QG4A 4DBVO 2O23A 4FB5A 3ZHXA 3C1OA 5JAQA 1Y8QA 1KERA 3BTSA 4WCFB 4YJFB 1X0VA 4PLPA 4IQ8A 3RBXA 3VH3A 2Y0CA 1YVEI 4RL6A 1F17A 2P2SA 2DTDA 5L3ZA 5MDHA 2X9NA 1E3EA 3AOEC 1R6DA 4D79A 5CDGA 4A27A 4BIIA 3E5MA 4A10A 5KJCA 3G17A 1XIVA 4PIVA 4PG6A 1M6HA 2AQ8A 4AJEA 2D0IA 2PY6A 1SBYA 3ZNQA 4K9DA 4PG8A 2GNAA 1GV1A 1T2FA 4M1QA 1DO8A 3QY9A 3LLSA 4E2XA 1U3TA 1B26A 3B20A 2X0JA 3OICA 3MJSA 1ZK4A 5L95A 3QV1A 1ZFNA 3OH8A 1ULSA 4FCCA 2LDXA 1PJSA 3C7DB 2E6UX 2UVDA 1MGOA 2EERA 3QRWA 2Y1FA 3GHYA 4NBTA 4J49A 4Q3EA 1R37A 2ZB3A 4D7AA 2JL1A 4YT5A 3ABIA 4ZVVA 3DBRB 1VL6A 4ALJA 4TROA 1UP7A 3WGTA 1E3SA 4LVCA 2VTDA 4CM5A 3DHNA 2BMAA 2G76A 4Y67A 1LDNA 4IS3A 2O7QA 5JYFA 1PJQA 4PLYA 3F6YA 1EDZA 8ADHA 1HETA 4GL4A 3ASUA 3D1LA 3DOOA 2JJYA 1NAHA 1DB3A 4DLBA 4GPD1 1PQPA 3KSUA 2Y1OA 3WXBA 3ZWYA 5JSFA 1B3RA 1MUUA 5TQVA 3KXDA 5A9TA 4OH1A 2I9PA 1HDXA 3WGYA 2NLOA 3PHHA 1NYTA 3X2FA 1ISJA 4IXWA 3PJEA 1W6UA 1PGJA 2NU6A 4E6PA 2G82A 4OXKA 3GMSA 4GLLA 4BKRA 3QJ5A 4MVJM 4NPCA 4AJOA 1XQ6A 4YCAA 3RJ5A 2IXBA 3FWZA 3I83A 4LRSB 3JD2A 1UAYA 3C7CB 2YQ4A 5JC1A 3D4PA 4TVBA 3A9WA 5TF4A 4UULA 5DP2A 3DOJA 1X7GA 1V9LA 1LQUA 2W2KA 4XB2A 4B7XA 4CM8A 1ZEMA 4L4RA 5C3MA 3RJ9A 1I3LA 5KIAA 1Y1PA 4PVDA 4XYGA 2W2LA 2HLPA 1QYXA 1DHTA 5DBIA 2ZTLA 1LRJA 1PGPA 2VYVD 1UXIA 3BMOB 1LBEA 1FDVA 3A06A 3DBLA 1U5CA 3OQ6A 1GADO 4WJZA 4OMUA 3R6DA 4XYMA 3JQEA 4MKZA 2X7HA 3WYEA 4AFNA 4TZTA 4AJLA 1M6WA 3JSAA 4N5NA 3S2EA 4DMLA 5CDTA 8LDHA 4PLCA 4K26A 2HMWA 4Z9YA 3O9ZA 4WEOA 3RU9A 3H2ZA 4LGVA 4QT0A 4BV8A 2YJZA 4YEDA 3WIDA 1FDWA 4RO0A 3OJFA 3UH1A 4CMKA 6LDHA 3Q2IA 1KC1A 3TNLA 3EZLA 5BT9A 3IOYA 2YFHA 3K31A 1DIBA 4FFMA 4YVFA 1C0PA 4U6SA 3JQ8B 3PDUA 3CMMA 2OO5A 2FY8A 2Y99A 1ZVMA 3FR7A 3GGGA 3ZH2A 5KVQA 2E49A 3GDFA 1I2ZA 3PIDA 3GVIA 1WP4A 4XDYA 2C7GA 4PG7A 4TSKA 2AMFA 4B7CA 2V6GA 3WGHA 1LDMA 3HDQA 2EG9A 4RPGA 2IYOA 2X4GA 2EJVA 1QLHA 3NX4A 1NFQA 4R3WA 2PLAA 3JD1A 3U5TA 2ZIZA 4CUJA 1E3JA 2XF8A 2GN8A 3BMCB 3GN2A 4WNIA 3VC7A 4IZHA 2Q4BA 4IDCA 4IDAA 4BNVA 4O0LA 3GN1A 2WSBA 4PZDA 5JO9A 4AJKA 1YQXA 3BMQB 4GH5A 3LC2O 2J3KA 4AJHA 1BTOA 2DUWA 3GH3A 1QP8A 1ORRA 3A1NA 3NTOA 2O3RA 2Z1NA 5ER9A 2P68A 1P45A 2HRZA 4FIZA 2WYVA 3GK3A 4L74A 1QYCA 3Q9NA 4UEOA 5CG1A 3HFGA 4AJ4A 1KEVA 4EEZA 1DAPA 1R16A 2ZQZA 1Y6JA 4J4BA 4OOFA 5JMPA 4II2A 3BMNB 1FDTA 3MJTA 3TN7A 4MP3A 3WOHA 3GNTA 4I5DA 3GPIA 3TZ6A 3WTCA 1KEWA 3O26A 3KV3O 3A4VA 3KYBA 3V1YA 1IE3A 3UICA 3Q11A 4GLOA 1B3BA 4HKTA 1P1RA 4HNHA 3JYQA 4I9NA 4RQTA 1MV8A 1HSZA 4YBZA 3HN7A 1XG5A 1J0XO 3PHJA 4TKMA 3SEFA 2B69A 2EEZA 1PQUA 2D3TA 3AUTA 2BRUA 3JD0A 4ZQGA 3ZV4A 3KYDB 5JNLA 4MDHA 1CIVA 3SC6A 4F6CA 2CF5A 1XQ1A 3D4OA 5J9GA 1YJ8A 4DPKA 3OIGA 4W9NA 2HMSA 4UUOA 4WE3A 2HJSA 3FPCA 2F1KA 2A94A 3C85A 3DZFA 3U4HA 5KNLA 2ZB4A 1FJHA 1HT0A 1GQYA 4A0SA 3E9MA 3MTJA 1U7TA 2NACA 3TZCA 4FQ8A 2VNSA 3ICCA 4YXFA 1AHIA 1GTMA 1XU9A 3KM0A 5H82A 1DFHA 3AM3A 1NXQA 2X9VA 2JHFA 4RVUA 1ONPA 3PEFA 1WWKA 4YT4A 1VC2A 1KVUA 4KP7A 1TT5B 4LN1A 4RPLA 3MCVA 2VRCA 4P4LA 4CLRA 2HK9A 3OFSA 1P74A 4XGIA 4Q3BA 1V3TA 2VHXA 1MLDA 5JLAA 3BTOA 4DYVA 2OP1A 4DIBA 5ITWA 1HTBA 1H6BA 1EMDA 4C7KA 1X7DA 4WASA 2EW2A 3LLVA 3ST7A 4XGNA 4O59O 1ZSNA 3OA2A 3BHJA 3CE6A 4E12A 5KKCA 3SX2A 4TRNA 3RC1A 3S2IA 2NU7A 3GDGA 2YHIA 3FNFA 4OKIA 3Q9UA 1AGNA 1BVRA 3IUSA 3ULKA 1KVRA 5A03A 5I8ZA 2Y93A 1P77A 2BFAA 4N7RA 2QYTA 4BNHA 5FWNA 1O9BA 2DBQA 4FFRA 4NFHA 4OIMA 1L1FA 2VWQA 4LCJA 5JFOA 4H15A 4XKJA 1PL8A 3OIFA 3C7AA 4BO7A 1H93A 4E21A 4GKVA 4EJ6A 4BO3A 4W9NC 4JP3A 1LDGA 2P9CA 3I1JA 4EUFA 1DDOA 1UAGA 3ANNA 4LSMA 3D4NA 3M2TA 3OETA 5G4KB 2OUIA 5CDSA 4NK5A 3PGXA 3DFZA 4IM7A 3ZHZA 1LSSA 4U8GA 1CYDA 1C1DA 2WD7B 2ZK7A 3HUDA 1QORA 3MJ4A 1IZ9A 1PJCA 4F46A 2CDCA 1DSSG 4H3VA 4IJUA 4D3FA 1ADBA 1KY5A 3AI3A 5JW6A 3B1KA 4D3DA 1W8DA 4RLHA 4WCFA 4BKPA 5AXCA 1R0KA 4CQLB 3WGZA 5A1TA 1C3VA 1Z73A 4DQVA 4MVJH 2GR9A 1QMGA 4JK3A 1D7OA 2O3SA 2IEDA 1P3DA 4BNMA 4UVDA 1YS4A 4IGFA 1N1GA 1TEHA 1IHYA 2BELA 4AJPA 1PR3A 3E6AA 1NTOA 4NI5A 4LVUA 4ALNA 4E2WA 3C3XA 4R1NA 4IGEA 1C0IA 3OBBA 2QZ9A 2FPGA 4N54A 4R5MA 2YV2A 3M6IA 2NU8A 5L4NA 5I7VA 1GEGA 2AEFA 2H63A 4EGFA 5JPIA 1WMBA 2NV6A 1RJWA 1MFZA 1EK6A 1N9GA 3LDHA 1HE2A 2GCGA 5IN5A 2YZ7A 4WGGA 2VYVA 1ZCJA 3AUAA 3L6EA 1P1IA 2NTVA 1CJCA 1TT7A 1KS9A 1NR1A 1KOLA 2FP4A 2Q46A 4OSOA 5C7IO 2VZ8A 3SLKA 2Q4EA 1LA2A 5L7YA 1H94A 3GGPA 1ENOA 4M8SA 2RHRA 4U0JA 1UH5A 4QXMA 1T4DA 2D5CA 3AI1A 4XYLA 1WLYA 3DBRA 2D59A 5IF3A 1B8VA 4RVGA 2O2SA 2VOJA 2ZB8A 1G0OA 3JQFA 4PLZA 2PK3A 3BTVA 1PL6A 1E3IA 1ONOA 3OQBA 3I9LA 1BXGB 3VVCA 1PWXA 2LDBA 1TA4A 3P2YA 4CQMA 1K2WA 5KVVA 2X0IA 2AQKA 2VHYA 4OL9A 2I3AA 4KOAA 1T4BA 4CR7A 5CG2A 1MG0A 4MKXA 4AJNA 3KETA 1K6IA 1BDBA 2YFQA 4D45A 1I2BA 3WMWA 1BGVA 2PZKA 1RPNA 4J0FA 1TI7A 5EMHA 1B2LA 3V2UA 2X0RA 3RUIA 4YRBA 1YB1A 5AXBA 1GAEO 4PLFA 1X1TA 4Z6KA 3N7UA 3JQ6A 4JROA 3NJ4A 3ZWXA 5TJHA 2B0JA 3MJCA 3LU1A 1E7RA 3L9XA 2WYUA 3UF0A 1HYHA 3MWDB 3E03A 3GUYA 3AY3A 2Z5LA 4JBHA 3FTNA 3ANMA 4XQCA 1P1KA 3ETGA 3JQBC 2CVOA 3I3OA 1YJQA 4Q3CA 3EAGA 4WPGA 4IDFA 3CINA 3S55A 1LC0A 1R0SA 2A4KA 1YBMA 3GVCA 3SJUA 4B4WA 4AG3A 3PQFA 4TVOA 3ZHBA 3WGQA 1F8FA 1PQWA 5EJ2A 5L9AA 2BH9A 1F0YA 1ZZEA 5TT0A 1P1HA 3NGLA 5F1OA 1ZK1A 3DZHA 1N92A 1ADCA 2AQIA 3DC2A 4PGFA 2PTGA 1GYQA 1YONA 2YUTA 4NFSA 1LC3A 5B37A 2O3TA 4NU5A 5IAAA 4ONEA 5TRTA 1Y7TA 5TGDA 4HP8A 2CZCA 3QHAA 3E9QA 4S1VA 4OJNA 2CMDA 4D46A 4FSHA 2C5EA 4IJKA 4ND2A 4ZQEA 1YQGA 3HFSA 5JDCA 3KSZO 4BNIA 2CVQA 4YWJA 4YQZA 1LDYA 2VYND 4CMGA 1YB5A 3A28A 4B4VA 1HXHA 2ZQYA 1NQAO 5G0VA 2NVUB 3JQ8A 1UXGA 4YJHB 3NV9A 1LTHR 4K28A 2DBZA 3QWBA 1B14A 2ZYGA 3ONEA 3VOSA 1MC5A 2EGGA 4TZKA 4DMMA 4CMAA 3JYOA 1VSVA 1Z7EA 1YO6A 1QYWA 3RVDA 3GRKA 3IS3A 5C5IA 1ZEJA 4UEKA 5I7FA 5A9SB 2DTEA 1ULUA 2CD9A 1AXEA 2DFVA 4CUZA 4XDZA 3SBOA 4A73A 1DRVA 1GD1O 4UVHA 4GMGA 4Z9XA 1ZSVA 1A9YA 3BMCA 3H9QA 5BR7A 3EMKA 2Q1UA 4A5OA 3QVTA 4J9UE 2NTJA 3PHIA 3ZI0A 3BMQA 4C4OA 4YT2A 1EFLA 5BSFA 4KZPA 4CMIB 3DBVO 4BVAA 3RC2A 3AUSA 3FWNA 1Q0HA 4GBJA 3AOEA 2D5AA 1DIHA 1ZXLA 3A14A 1PZHA 4MO2A 5COQA 3TZQA 3RIHA 3RD5A 4B8ZA 1YB4A 5CEEA 3VAZA 1DIRA 4DGSA 3G49A 3QIVA 3LQFA 1FF9A 4BKQA 5DOVA 2VUTA 4PN3A 1C1XB 3COSA 1GYRA 5B4VA 1IYZA 3BMNA 1KEUA 3B1FA 4Z3DA 5T6BA 2PGDA 3DMYA 4BB6A 4R41A 4JBIA 3DHYA 4B79A 5JY6A 3ZWMA 4IS2A 2PA3A 2JCYA 3CSDA 1XDWA 1Y9EA 2DLDA 3KTDA 3GA0A 1WNTA 5COAA 5IXYA 1NPYA 4NBRA 1M66A 4ALLA 1JLLA 3KYDA 2RH8A 4URFA 1W4ZA 1EDOA 2BKAA 4J4TA 4Y8VA 3RU7A 1R0LA 1VJ0A 3F4LA 1LXCA 3E82A 3VPHA 1PR9A 1N5DA 2NU9A 3WBFA 3MOIA 2JFFA 2XXBA 1ZJYA 4I08A 3H9UA 2QRJA 4BB5A 4A26A 3AWDA 2VUSA 4CLOB 4D0SA 2RH4A 4ILKA 5IJZA 1JKJA 2CDBA 1J4AA 3U09A 4Y6PA 3RUCA 4MVJP 1JA9A 4M54A 2IZ1A 2IODA 1YXMA 2VHZA 4CM4B 2WEKA 4YJGB 3U62A 3ZU4A 1NNUA 3OF2A 1Y5RA 1WW8A 1KETA 1TT5A 1X0XA 3EK2A 1UZNA 4IDDA 3FBGA 2HQ1A 3RUFA 4EDFA 1VL8A 3TL2A 2QHXA 1E7MA 1WDMA 3NT4A 1RKXA 2BLLA 4YA6A 3H5NA 3RQSA 3VVBA 1N7GA 4K6FA 4KDEA 3NT5A 1U5AA 1ZBQA 3ONDA 1SOWA 4EI2A 2YQ5A 4AL4A 3FD8A 2X0NA 3DBHB 3T4XA 1N1EA 3INTA 2CNBA 2J5QA 3H9GA 1DFGA 3PJFA 1UXJA 2DM6A 1EVZA 4GVLA 1H0KA 1A9ZA 1EBFA 3K92A 5F1KA 3RKUA 3CIFA 4IDBA 3QE3A 2P4HX 2W98A 1DC3A 1YBAA 3KYCB 2AA3A 2YW9A 9LDBA 1MFPA 4LK3A 3CPSA 3GEDA 4XQ9A 5KJEA 4RVFA 3E8XA 3D7LA 4QEDA 4P4NA 3DMTA 5TC4A 1ZK3A 3ITKA 4BGVA 1NASA 3M1LA 3ROQA 1PS8A 2GD1O 4RZIA 5A9RA 1H6CA 1F06A 3IAHA 1R12A 1LRKA 2DUUA 3HB4X 3VH1A 3HB5X 3HHPA 4J1SA 2JHGA 3FTPA 2CSUA 4CMBA 1DLJA 3U0BA 1ZH8A 4MVJF 1MP0A 1IY8A 5T64A 4ZJUA 1IB6A 3H3JA 2C5AA 4BGUA 2ZJ0A 2WD7A 3ZWPA 4BQRA 4XWYA 4YQYA 3CZMA 1NQ5A 1UZLA 2DBRA 3FBTA 4DC1A 3P19A 2WE7A 1HSOA 4BO0A 2VWPA 3JQGB 2DPHA 3PGJA 3AM4A 5GZ6A 3FRJA 4CQLA 3HN2A 2GZ1A 4FFOA 2IZZA 4Q3DA 5KJ1A 4ALMA 1I10A 5EINA 2I66A 5A06A 5HS6A 2JAHA 5BQFA 1I3MA 3OQ1A 4QUKA 3WYBA 5CP8A 5TLSA 4OAQA 4ZN6A 4JX8A 1C14A 2J3IA 2NQ8A 3ADPA 3C8MA 3OM9A 3EVNA 4RF4A 1E7QA 3NYWA 1ZKMA 2VWGA 1X14A 4FN4A 1E77A 2JFGA 3RFTA 1JTVA 1E6EA 3I9JA 5L7TA 1U3WA 5B1YA 2JAPA 2DFDA 3OEYA 4PLGA 1R66A 3H9JA 3SLGA 4A2CA 4CODB 3WNVA 2HMUA 3GZ4A 1JWAB 4G81A 3DMTC 3INRA 2HSDA 4B3JA 4QECA 3ICPA 3D0OA 1Q2XA 4Y6RA 1WDLA 1XKQA 4UUMA 1VL0A 3IJPA 2VZ0A 3TRIA 3PRJA 4J6FA 4GGPA 4PZCA 3PWKA 4Q3AA 4MPDA 5DBFA 5AXAA 2V6MA 2VN8A 3IJRA 5IDXA 2DTXA 4UUNA 3ENNA 4ND3A 1ZW1A 4R3NA 2VYNA 2ZB7A 4FOOA 1S7CA 4J0EA 1YL7A 5DBGA 1SC6A 1E6WA 4O63O 3F47A 3JYLA 1OAAA 2O3JA 1H6AA 5AQ1A 1C0KA 1XSEA 3RUHA 2Z1MA 4BHTA 4J4HA 2G5CA 1D1TA 2PKQO 1YE3A 4Q3NA 3B6ZA 1I3KA 3F5SA 2EKLA 2OZPA 4GKBA 3VH4A 2C07A 3NDIA 3EW7A 2YDXA 3RASA 3LT2A 4E13A 2PD3A 1ISFA 1I36A 2WWRA 4N5MA 4DTIA 3GFBA 3PYLA 1NHWA 4I5GA 2GDZA 1Z74A 3K73O 1QYVA 3G0OA 3TWOA 3FHLA 4GGOA 4ZICA 5U9CA 3FNEA 3JCZA 4GX5A 2EXXA 4BNKA 4MVJG 1T2CA 2D8AA 3WWZA 5CDUA 3AY7A 3WS7A 4E5NA 1QG6A 4GWKA 1K5HA 4GAEA 1G0NA 1HDOA 3WBBA 4M49A 4NJMB 3LSYA 2GN9A 2XXJA 4JJGA 3PQDA 3TFQA 1AUPA 3I6IA 1DLIA 3WLFA 1GCUA 1XLTA 4KUHA 4J7UA 3JQ9C 1UP4A 2O48X 4BNFA 4DWVA 1E1KA 2G1UA 1JKIA 1DC4A 4MJLA 4HWKA 1B7GO 1PZGA 4L4XA 1HDRA 1ADGA 4QFDA 3DZKA 2C2YA 1G6KA 2NTNA 4HFNA 4LMRA 5AXDA 3PK0A 4CM9A 1YWGO 1X7HA 5ENVA 3VHRA 4FW8A 3EVTA 3PQEA 2HU2A 1LQTA 3NRCA 1X1EA 4QTZA 1MC4A 2RIRA 3NT2A 5HA5A 1T2AA 4IJWA 4DC0A 5BNIA 1Y81A 3T4EA 1ZUD1 1ZMTA 2UYYA 3WGGA 3WQSB 2NVWA 4DBZA 1PJ2A 3ZV5A 4DA9A 1LRLA 3GVPA 1CQIA 1U8XX 2XOXA 1ISMA 1SZJG 3PI7A 4XQEA 2PZLA 4WKGA 2VHVA 1DPGA 3GHHA 3QWFA 4AICA 1DC5A 1ZSYA 2NVUA 3NAQA 4YJHA 2EJWA 4XJSA 4YT8A 1U2DA 2Q50A 4J91A 4EUHA 4WLOA 2E37A 1BRMA 4DPLA 4E5MA 5LC1A 3TZHA 3V1UA 2CFCA 5DN9A 3W8DA 4F3YA 3IC5A 1H2BA 3MJVA 1M76A 5KKAA 1K6JA 1BDMA 1BVUA 4K6CA 4WECA 5IDQA 1GZ4A 5A9SA 1H6DA 2YHUA 2X5JO 1PX0A 2AQHA 4ITUA 5ES3A 5BSEA 4W6ZA 1VM6A 4IQ0A 4J16A 1R4NB 4AJ2A 1ZK0A 3TDKA 3GRPA 4D43A 4XB1A 1KC3A 3O4RA 1VJTA 1A7KA 2JCXA 3OHSX 4Z0TA 3Q1LA 2DPGA 5IDWA 5ILGA 2B4TO 3OJEA 1YL5A 2IEBA 4UUPA 4FC7A 5MGBA 3KLPX 4YRDA 2CDAA 4CL8A 5ILOA 3RC9A 3B70A 1A4IA 4FJ0A 1YQDA 3ROMA 2OFPA 4CMIA 1I24A 2UAGA 1P1JA 3T7CA 3NTQA 1E1LA 2X1HA 2C2XA 4E5PA 3PFFA 4P38A 3ZU2A 1XEAA 1GZ6A 3RBZA 1OC2A 3U4IA 4IINA 1W0CA 1D4FA 4R16A 2B5WA 4PG4A 5G0WA 1Z6ZA 2A9FA 1I5RA 1C1XA 4YAKA 3ONFA 1MXFA 1MX3A 1HE4A 4MINA 3FI9A 1M2WA 1YL6A 1NVTA 4BGEA 2ZYAA 5K0ZA 2V65A 4FFNA 3DAFA 4NR0A 1S6YA 5DOZA 1E7WA 5DT9A 2E48A 3RAJA 3CUKA 1GY8A 2SCUA 3D5TA 4XYBA 1VJ1A 1ADFA 2C29D 3VTFA 3ZU5A 4G5HA 1Z75A 2P5YA 4MP6A 4YB8A 2P5UA 4GWGA 1L7DA 1I8TA 3GNSA 4H16A 2J8ZA 3PJGA 1HF3A 2PV7A 4EUEA 1LLQA 2GN4A 3PWSA 3WB9A 2Q1TA 1DRWA 5CEJA 2VT2A 3KLMX 3U3XA 2UUPA 1LSOA 2YV1A 1QV7A 1PU2A 3HSKA 1R4MB 3H8VA 6ADHA 3CTMA 4ZD6A 1QRRA 4O5OA 4PCVA 4FS3A 5FF9A 4D41A 4CLOA 3E18A 5HBRA 3UVEA 4PRKA 2Y1GA 1EVJA 5I7SA 5FI3A 3AFMA 3TL3A 1FDSA 3X2EA 5ADHA 2Y1EA 2UDPA 2Y1DA 3PLRA 3AW9A 5CAEA 5KCZA 3ZN2A 4J43A 4YJFA 4OHUA 3LT1A 4CM4A 3L6DA 5JY1A 1HYEA 2B35A 3PHLA 1GUYA 2PD4A 4W99A 3GDOA 3VZPA 2VTEA 3KSDO 1H9BA 1WDKA 3UXYA 1B0AA 1DHRA 3W4KA 4BNTA 5L40A 3EDMA 4Z0HO 1PIWA 4JCOA 2H9IA 2EW8A 2PGJA 1I2CA 1T24A 4RDIA 1E5LA 5ER6A 3TF5A 1HEUA 1J6UA 3FNHA 4RDHA 1B16A 1KYQA 4HXYA 4BO2A 2G17A 3DBHA 3PHGA 1XHLA 2J3HA 4R51A 5JAMA 2B37A 2CY0A 4NHEA 1P9LA 1HDZA 3W6ZA 4EJ0A 2GUGA 3JQBA 1UZMA 2HUNA 1ZXBA 3DHEA 3OJOA 3W4IA 3GY0A 2VHWA 1I3NA 1JU9A 1T1RA 4OXYA 5L7WA 1A5ZA 2CF6A 2X6TA 3KYCA 4R4JA 3H6KA 2TMGA 5A3VA 1J49A 1Q0QA 4XEHA 3V5NA 4IIVA 1AE1A 2GN6A 4LCEA 5COBA 4IQGA 4IMPA 2E4AA 4PVCA 3F1LA 5L51A 4PLWA 1P31A 3GGOA 4EITA 4GI2A 3JTMA 5FEUA 4XJTA 4BKOA 1SCUA 3HE3A 1UDBA 5TT1A 3LF2A 2FHSA 1W73A 4ZGWA 2PGLA 1I32A 5DF1A 3EYWA 5TX7A 3RUAA 4ZRNA 3BXXA 4BNXA 1QV6A 3KZVA 1I33A 5IG2A 2OOSA 3WGIA 1D3AA 1NFFA 3TSCA 3DDNA 4I9UA 1U9JA 1WMAA 3ZNOA 3W8FA 3AUUA 3I5MA 1GDHA 3KO8A 2IRWA 2RCYA 3RBVA 3LVFO 2CUKA 1F12A 4BV9A 4HV4A 1GUFA 3JQGA 2IDZA 3Q6IA 3IQDB 5KJ6A 3R3SA 4E31A 3GT0A 1ZIDA 4U5QA 3W8EA 1GU7A 5IDYA 1GL3A 1RM0A 1SEVA 2P9GA 1NWCA 4N5LA 5F5LA 4OQZA 3BAZA 3L4BC 2B83A 2BGMA 1KEPA 1WVGA 3WTBA 4C7JA 1IZ0A 5I8WA 4WCDA 3S2GA 2ZCVA 4B4OA 4E33A 5C7OO 3RFVA 2AW5A 3O8QB 3AK4A 3AM5A 2FMUA 3ZWCA 1GV0A 5T73A 1BSVA 4XD2A 2EKQA 1U3UA 1NBOA 4J1TA 4BNZA 1PWZA 2X58A 3GZNB 2QYSA 3HNPA 1CF2O 5JMWA 1YGYA 1HDYA 2OXIA 1U4OA 2GERA 4NK4A 3K96A 4WK6A 4U0KA 3NKLA 3GNQA 3IKTA 4CLHA 1U1IA 5KJFA 2C54A 3D3EA 4NU6A 3BMOA 1LSUA 4ALIA 3S1LA 5KTKA 5U1PA 3ZHYA 3PYMA 2D4AA 4YYZA 5K9ZA 4L73A 1HLPA 3KB6A 4LMPA 1PJ4A 1UXKA 1V3UA 1LDBA 1YDWA 1Y9AA 3QWIA 1XWFA 1NPDA 2DVMA 2IYPA 4JN6B 1DRUA 2FPPA 4KQXA 2C82A 3TQHA 2H6EA 3G79A 4L75A 1P0FA 5AVOA 2BGLA 3GPDG 3LC7O 3WDSA 2HAEA 1XELA 2YDYA 4JGBA 4OM8A 2DU8A 1EFKA 2PNFA 1OOEA 1TVEA 4O6VA 4F45A 2WYWA 1GQQA 1T26A 3AY6A 2P9EA 1ONNA 1ID1A 4LSWA 4R5HA 5EIOA 5THQA 2BI8A 1DXYA 1KVSA 5BNTA 4YAGA 2Q2VA 1F14A 3NEPX 1RM4A 1AXGA 1MA0A 3WX0A 1KY4A 4JJIA 1E1MA 4OOEA 4DXHA
chains in the Genus database with same CATH superfamily
1BO6A 3RR2A 1X3LA 3L9WA 1GYPA 5JD3A 3GYGA 5DZSA 3KV1A 2F8LA 2O2HA 3ZLBA 4DYDA 2V0NA 1K4KA 2OXCA 5A2GA 2W8ZA 4BN4A 2GCNA 5CT5A 2OV4A 1DKPA 4F0JA 1N78A 2QR2A 3K70C 3MVEA 2QPTA 1C9KA 1SKYB 2BISA 2JANA 3JVUA 4J1TC 4EELA 1CR0A 3BSSA 1I72B 3PXXA 5A4AA 2WIJA 2NQTA 3EZFA 2PYDA 1Q11A 4RVOA 3ZDFA 3L0BA 4RHEA 3WNBA 4YR7A 5IXJA 4MS1A 4QDOA 1N8SA 1GRNA 2I76A 4FU0A 1EINA 4RAOA 4ZOLF 4DE5A 1YZ3A 5KOIA 4FFPA 2GN2A 4HWTA 5EKSA 2AI3A 1R0ZA 1XYVA 3QGMA 3GC6A 3KUCA 4A1FA 2WV9A 4BMSA 2WJIA 4P22A 5DW0A 2C0QA 2FSVA 5EE9A 1X7WB 5EP3A 4R54A 2ZIUB 1I01A 1CRQA 3KVOA 4IZIA 3TI7A 3HADA 1CZLA 3ZGNA 3NH9A 1Z8HA 1RQ2A 2R11A 1L8AA 1AN0A 4BQFA 1WL8A 2OFWA 5B1EA 2AMYA 3OEWA 1K6EA 2ZBQA 3KK0A 1RHRA 4J76A 4CV0A 4XCVA 3RSZA 3EEBA 3T95A 5EKTA 3NUGA 4M1ZA 3ZWAA 4DLZA 3ZV3A 3A6LA 3VSEA 2H2FA 1EP3B 3DVRX 5KX5A 4FDLA 1PNRA 3CNQS 2ET6A 5DGDA 2R6HA 1D6NA 1LI7A 1EVIA 1ZVVA 5FNZA 3DOEA 4M0MA 5JXWA 3PL5A 3CZRA 4M0CA 4W1RA 4TV8F 4L8VA 4CEIB 3MT0A 3SBEA 2K5UA 1YZFA 4BAGA 3HR4A 1H3EA 2IDJA 1JQJC 3FNQA 3PDJA 2VDOB 3VZBA 3JYNA 3A6KA 2WWFA 1JG2A 2PUHA 3KCQA 3D6HA 3OVMA 1BNCA 4MVJI 1HZZA 1HT2E 1A3CA 2IE0A 3L7CA 4G26A 1TJ5A 3SZRA 1XNGA 1LK7A 1YI0A 3P9PA 1C4WA 2G5PA 4H1UA 4C0HA 1VPVA 1SKQA 1KK1A 3F6SA 5G0TA 1M2FA 1HDGO 5KAPA 2FW6A 4EEXA 4TKVA 5JRZA 5H4HA 4G5YA 5HKLA 3G2IA 1VKOA 1EVYA 2PFGA 4PU0A 3T9BA 5C1OA 4RMHA 3EGOA 3KALA 1PR4A 3CB4A 3KEGA 3KUDA 4RF2A 3PFWO 1MRSA 4C6HA 3SU8A 4EUKA 2G7ZA 1M33A 1ZGHA 3QLEA 4KFUA 4B5LA 1OYYA 4MCJA 3HQ4O 4NZ9A 1V26A 4QIHA 1DQSA 4HGNA 4Q7JB 4LVNA 1FNDA 4DQUA 5IFLA 2H3HA 5D8DA 1ZOLA 4URWR 3JQ7B 4D92A 2F3TA 4NOLA 1IULA 2ZJ1A 2ZSEA 3PGLA 2VJMA 3IFSA 1TPZA 1Z18A 3TTYA 3WLLA 2OCLA 4CF7A 5HQ3B 3SNHA 2PTHA 3GOHA 3KJHA 3GLGB 2DETA 1WZNA 1BEEA 2BAGA 3BHMA 4DDHA 2VF5X 1VSUA 2MSKA 3WMXA 3DOCA 3CFYA 2FUNB 3PTZA 2F55A 221PA 1ZICA 3BIOA 5IAOA 1YDMA 1XI2A 2Y3IA 3GH1A 5GM2A 1ELOA 4I5IA 4LRXA 4MUXA 4OGFA 2H57A 3NHLA 2VAWA 5EMNA 5M04A 4QHTA 5LZ7A 1RAFA 4OQLA 4DXAA 2EWVA 2GH1A 3FFBA 4UAGA 4E3ZA 3PWZA 3ZTWA 1TKAA 4Q5IA 4RGYA 1EFVB 4ESOA 1WBJB 2HQBA 5GZ3A 4YV7A 2RD2A 2GTIA 1GPBA 3IRUA 4UU7A 2A7XA 4HZGA 4BO8A 3E5RA 3BWBA 1DJOA 3FRIA 1Y8RB 2QDXA 1NPTO 3OZ7A 2OHXA 4MVJD 2X1LA 1AUOA 3GG2A 4UAUA 1E2BA 5AIAA 2G9UA 3DJFA 3EGDB 2XAAA 4M0FA 2ZB2A 4MICA 2Q3EA 4PSKA 4GMFA 2OHFA 5CLGA 4X61A 4TL8A 5LU8A 4CMEA 2WU8A 2D1RA 1J8FA 1LLUA 4M8LA 4CKCB 2VNKA 2VRCD 2Z04A 4IUYA 3QUSA 3M5PA 1FFEA 4ETMA 5TVKA 2WYHA 4EG8A 5GZ1A 1W9MA 1GUZA 4EJMA 7AT1A 1VYVA 4YP0A 2GAAA 5BQ5A 4NQZA 2G4CA 4QAJA 3GFGA 1NBIA 1JAZA 1Q1EA 2PVPA 3ON5A 4YP1A 4ER6A 1Q0LA 3ND7A 4G5XA 4QO7A 2P2NA 3QNMA 4TRMA 1N9GB 4JUIA 5AOCA 1O0CA 1HX7A 5C8VA 4V1CA 2H9YA 2E5LB 2ETXA 4UXJA 4Q03A 4JT2A 3WLKX 2QW0X 3AHHA 5FHRA 5FAXA 5G0SA 4FWIB 1BYUA 5J63A 4URUR 1Z2OX 4I50B 3I0ZA 3H75A 2P41A 2QL9A 3QLJA 1DBQA 1JT9A 2J6IA 5E1BA 5BUZA 2HDHA 1Q3HA 3DZCA 4XGRA 3HJNA 1KI2A 1CR2A 3DUFB 2QI9F 3KL2A 1OVMA 3CZPA 3PC2A 3LK6A 3TDMA 3WWPA 1RXUA 4BVLA 5ABPA 3HM9A 1XMSA 3EIWA 2PEYA 1WZIA 4L5IA 3L6BA 1ISIA 2B36A 2X5NA 4IXDA 4KH1A 4L95C 3RT1A 3J81A 4IPTA 5HWSA 5KDDA 3OIYA 4HAOA 4RXMA 2HKIA 5EYPA 1AGYA 5KTTA 2JA1A 1O6ZA 3DXXA 4JAVC 2WYIA 1SXJA 1TX4B 2PZBA 3IOBA 2ZBEA 2IEYA 3GAZA 1IN5A 3L1UA 3TPFA 8MHTA 2CL7X 1NHGA 2EFHB 3ZIAA 1U8UA 1O5TA 1VBNA 2I55A 2IP1A 2ODEA 2W4MA 4DRYA 1XYGA 2PMDA 4CQMB 3U48A 1NU6A 4HAWA 4XCQA 1R6TA 5A9SA 1YFJA 1DO0A 3IUJA 2WZQA 2OSBA 1ONSA 4UHJA 4DF3A 2CFRA 2AIRA 4J3JA 3A3YA 5HJ7A 1EFRD 4BNNA 2GLXA 1W94A 2GPYA 2IQIA 5I7HA 2QR5A 5KNDH 2H2WA 2CL5A 3BZUA 1BXZA 1P1BA 3DZIA 4H2DA 4TUYB 4CMEC 4MIEA 1RYHA 1PZNA 2QQ0A 3U3ZA 1DUVG 1BEZA 5IJWA 1FVOA 3EQZA 4H4EA 3IV7A 4P2GA 4PYMA 1ENPA 2CHFA 1JU3A 4BDTA 7YASA 5HNKA 1WEKA 3OTOB 3OP1A 2YOFA 2IC5A 3LUCA 3OO0A 5EEHA 4RK0A 3KWJA 3ZCXA 3FETA 4S1TA 1QIKA 2OWDA 4AZTA 5FLXA 1GHTA 2ZS9A 4ZODA 3M1IA 3LJKA 1XZJA 3H4MA 3K20A 4CR6A 3RM3A 3QWHA 4BUCA 2FOIA 2Q45A 4II3A 4DREA 3OA0A 2B98A 2BM9A 2Q3JA 3H18A 4LDQA 4HAIA 1GA1A 1TRKA 4LKRA 3WBKA 3OQOA 3R44A 2DB3A 1PTJA 1WXIA 4JYMA 1QQBA 2IEIA 3TOZA 2P4UA 3AONB 2XUQA 5JAIA 3M1AA 4G0OA 3H7AA 4GZMA 1MZVA 1Y5MA 1LZLA 1YRAA 4P4SA 5JCJD 1EJ2A 3L0YA 1U0HC 3EFOB 4Q7LA 5EPOA 3W5SA 1QP0A 3PC3A 4DIDA 2WT9A 5AKGA 2LP4Y 4QLAA 4NV1A 4AY4A 1VGRA 4G5RA 5DO9A 3WBJA 2GVZC 4FHCA 1EX9A 1S2NA 2GGSA 3EY4A 3N74A 1G1AA 5KVSA 4PV7A 2I7VA 3QLUC 4ZMSA 4YIKA 5JHHB 3QVWA 1JQBA 1WPQA 3H87A 4DV0B 7MHTA 1DJLA 3W5DA 1G5RA 1TMGE 2CCGA 2HLDD 2Q3HA 3HYRA 4BO4A 4DR5B 4YJ3A 1NM5A 4JSYA 3L7KA 3PKJA 1H2HA 2XCQA 3IALA 4ZI7B 1KZYC 4I3FA 2MTBA 3ET4A 2MSCB 2BGTA 2GNOA 3AMVA 3ZZNA 2B1IA 2VP3A 3CLSD 5DMXA 1VP9A 3LV8A 2YWRA 5D2CA 2JD0A 2VDNB 1TM4E 4M46A 3FUVA 5AJUA 5I7WA 1DEKA 3IODA 1R6BX 4KQGA 2B7LA 4MR7B 3TIFA 3DHVA 2FPIA 4WWHA 3CVYA 2ZKLA 1NVMB 2Q27A 1E5VA 3PKIA 4TM8A 2Q6OA 3ENZA 4DR7B 4Q00A 4KWCA 2QJWA 1YA4A 4I4TA 1H4QA 3GZNA 1P8AA 5HDQA 3GXBA 2AHRA 2QLMA 3H65A 2ZXUA 1JWBB 2HBQA 2YMMA 3KPWA 3UB2A 3R3UA 3TOCA 4RPIA 3GJ6A 2ZSKA 5FX2A 4B6FA 3A1UA 1KO8A 3IQFA 1WQ1R 3PSHA 4IO0A 2OPBA 1QRTA 1X6VA 2CE2X 4DPMA 3C1AA 2VK2A 3PNBA 1DJQA 1O2DA 4C89A 4RIIA 4WLUA 4RTSA 3STUA 3IVGA 3PENA 4YI3A 5AVRA 3D8BA 5DDIP 4GI7A 3U3RA 1HO3A 2EEPA 5JAUA 4FK8A 3F9RA 3ENWA 1NYLA 4J0JA 5GY7A 1PTJC 2CCJA 1I80A 2EF1A 4BVBA 1WPXA 5LKAA 2NPFA 5LM3A 3UKDA 1Y3CE 5TPZD 3V9PA 1SVKA 3A3NA 2P5SA 1E4EB 1NVGA 2QUKA 2FSUA 5BUQA 2Y4OA 3IWBB 5HKAA 4TZ6A 4WNAA 1LLDA 1V47A 3HU3A 3NATA 1QTRA 3F1KA 3R6TA 3O1IC 3AR2A 4B8YA 1D6SA 3BGIA 1J90A 3IEVA 3ADOA 3LX5A 1Z0JA 4UASA 1E3WB 2R8YA 2I65A 3ED5A 4NCHA 3VH2A 1P7WA 1CUJA 4OSPA 3QEMB 3HM2A 4TL7A 3I9NA 1CFJA 1L5QA 1IH8A 2R2AA 4GPTA 1MG5A 1TM3E 3A6FA 2ZU6A 1KY3A 1UJMA 4PCUA 3RK4A 3L41A 3MGAA 4HNUA 3TUZC 1V96A 1N6HA 2ZTVA 3IL2A 2IHTA 4I9FA 3VDQA 3GW8A 2CXOA 1SUDA 5G3YA 3ZY2A 3KOZA 2K6GA 5BVHA 1LUAA 1JVSA 2EW1A 2YC2C 2JFYA 3HUEA 1GVNB 1FFBA 1O8BA 3GA5A 4IXTA 4TLEA 3T3GA 3C3CA 2BD0A 1E98A 1RWBA 3AF2A 3P94A 3W6OA 3KSBC 5K20A 1E6MA 1EJ6A 1W1UA 5ICSA 1I7DA 3QIAA 2QX6A 4JOQA 3MTEA 3RVLA 2D1YA 1ZP6A 2ZJ6A 3BJRA 4KQJA 3QXSA 2WHEA 4KREA 1PJBA 3OWXA 2IPMA 2P62A 5HXAA 2BGNA 1NW9B 1OU0A 2W90A 3H86A 2BGJA 5A7HA 4YRRA 4RKFA 2C3UA 1NAIA 4MJXA 2QIOA 1EUCB 4B2IA 5IHPA 1TAUA 4U2CA 3Q8KA 2ODBA 2H0QA 4L08A 1ZD8A 3RPEA 1JHRA 2RGNC 3WSTA 3HBAA 2X5OA 2P7IA 3AU8A 3WAJA 2VHEA 4G2NA 4QDXA 3UHOA 2P6RA 2HBZA 3DAPA 5LQAA 5FJIA 4CM1A 1X7WA 1T3TA 4GW3A 5CA0B 5K03A 1SIOA 4DDWA 3DXYA 3DZDA 3H05A 3UUGA 1NXVA 3PU6A 3DWGA 2JFPA 1Y7LA 3OECA 2EWMA 5AHWA 2NV2B 2V3CC 2ZTUA 3F3YA 4EHFA 4OX9Y 1FFGA 1KVTA 2PKYX 4GSKA 3VR6H 2WTNA 3GDWA 2CC2A 4CCAA 3ANXA 4UU8A 5EESA 5TV2A 4QASA 1QZXA 1J0DA 2Y68A 1FW8A 5ITSA 4RS4A 4BNJA 3PDIA 4JQOA 4U4AA 1ZLYA 1KJ8A 3RWBA 4CEIA 1SR8A 1THZA 1SNYA 2R6JA 1P8JA 4C22A 3CVVA 5A05A 1Y63A 5CLHA 4MV4A 4JP1A 2A9OA 5BN3B 2VUHB 3T4PA 4FINA 1EDDA 3DDHA 3ONNA 2GZHA 4V0QA 3GF4A 2J7PD 1KH1A 2GZSA 2IYZA 2FRXA 4HWOA 3T3HA 3DZ6B 1U90A 2RAFA 1DOHA 4UVGA 3F9IA 2RGBA 4EG7A 4PX5A 1WB6A 3ILHA 1EWTA 3EGVA 3GBSA 4NBWA 1DQNA 4P9NA 4C7MA 4CM7A 5BP7A 4YDRA 5CPBA 1FNSA 2XMDA 5JS1A 1UQRA 4O02B 4X5OA 2QMZA 4HLCA 4Y3UA 2WHQA 2V7UA 5HMLA 4AUNA 2YWFA 1IK6A 1OFTA 5PNTA 1MH9A 2WFLA 4M21A 3WJ7A 1UODA 1FW6A 4LW8A 3FOEC 2AZTA 1OTYA 1PDWA 1JDZA 2DPYA 2BFPA 4M89A 3KKQA 3W1EA 1CUHA 4KUGA 5SZKB 5DEIA 3LS2A 2BUAA 2QT1A 2XCIA 4QYMA 2X6RA 4KXLA 1LF5A 2Y1CA 3UBTA 4FGZA 4C6RA 4MGHA 3THOA 1W47A 2W4IA 3VX4A 3U9SA 2ISCA 3W06A 1BKYA 2BM1A 3LUPA 3JQ7A 3AKYA 4I4NA 1RC8A 4N6OA 1GNQA 3Q7PA 3GJ7A 2RG7A 3GQVA 1Z7GA 3I4FA 2V4MA 4Q1FA 3SXJA 3HYTA 3HR7A 4RV5A 4G0MA 4U39A 1KL7A 2H9AA 2ZR8A 5ESRA 3IKVA 2OCBA 3J80A 3CZQA 1NBWB 1O89A 3W7AA 2EIXA 1XU7A 4LECA 2QRKA 3E9NA 4YJGA 5B2ZA 4CLEA 4RMNA 5HKBA 3FKJA 2Y66A 3CUUA 3OU6A 2IYFA 4Z0PA 1I9GA 5CB4F 3VYSB 1ECCA 2ZSHA 5LA6A 3T7KA 1ZK2A 2AK2A 1WZUA 3LW7A 5LQRA 3OTGA 1POXA 1Q95A 1WIWA 3LY5A 1VIYA 1EFVA 4JKIA 3AHEA 1N5KA 1P2GA 4WXRA 1I51A 4IRUB 3H2HA 3U6KA 4N5IX 4AJ1A 1XB2A 3TOXA 1Y8RA 5JVDF 1V4NA 2AN3A 4IKPA 1RVDA 4S2UA 4AYTA 4GICA 2R25B 1FMTA 2HQOA 4FFLA 3VOAA 1UPUA 1GQFA 4NBVA 4LRTB 1VJRA 1XZFA 4KSYA 3EGDA 3B36A 3MQ2A 2XTZA 2JIMA 3AETB 1SCJA 3AQIA 3EY9A 3QEBZ 4J2HA 1RW4A 3I3SR 1AQNA 3NDJA 3RH0A 4E08A 5KTNA 1S4QA 4OHKA 3DONA 1JG7A 2IIBA 4GT1A 3CVOA 4CPDA 1DADA 1AB5A 4I7EA 4PLVA 3AZOA 4FKMA 2BFDB 4DZRA 5AW0A 1KJZA 2C0CA 2JD2A 5CCBA 4DMCA 3AR3A 3GLRA 1ODTC 1NJ2A 4I46A 1UR5A 2CFTA 4R6WA 2RHMA 3HCPA 3HR8A 4MUHA 3RFUA 3TLCA 4PBTA 1M2KA 1B8UA 3EDOA 1TA9A 3BHNA 2YJ5A 2CXRA 2VDKB 3HVKA 4CM8B 5LMUB 1OE0A 4ZEMA 3HV0A 4ZVUA 2ZSFA 4M0UA 4JLKA 1AGPA 1T2NA 1YHYA 4F2DA 1NKTA 3C7KA 5TS2A 4Z54A 3ER8A 4EI8A 1CY1A 3FSRA 3KQKA 1RWPA 2AG0A 4I50A 5FTKA 3CR8A 3K09A 4JEIA 4QJ5A 4NFYA 4XFKA 4GSLA 5BYBA 3ZE1B 4BNGA 4I81A 2GEVA 3WAGA 2HR1A 1H2YA 2B8WA 3S5JA 3O8BA 4QDKA 4Q3LA 5C1DA 3H9CA 2P2GA 4LYEA 2KJQA 1X1DA 1QIHA 1HZJA 4G0QA 5GVRA 1G5PA 3IMFA 4CLXA 2JIQA 4PYRA 4II7A 4Q24A 2BBSA 2GO1A 3TJMA 3I9MA 5BSKA 2BLNA 1KBQA 4N82A 1WE2A 2COKA 1EGVB 4W7IA 1OJLA 1S2MA 2I8AA 4D74A 1AX9A 5CH3A 1ZKDA 1P1FA 1JDVA 2WOOA 2X2OA 1FDIA 3DCNA 4JODA 4AROA 3JZFA 1TZJA 1GGEA 3ZDCA 1G55A 3A7EA 1EQUA 2F7SA 1YR7A 1CR1A 3DFIA 3I39X 5JCXA 1K7YA 2FQQA 5IS2A 5TDHA 2BFFB 4TT8A 1P2SA 2I99A 4HB2A 4Y2TA 3ZWQA 2JFZA 4Q9DA 3E0XA 3TW6A 3ASVA 7MDHA 5AVTA 2KMLA 1YC5A 4L0QA 3EZ2A 1ZITA 3B9RA 4YJ2B 3C3PA 2Q7OE 3S1AB 1JR2A 3N5KA 3T1HB 2PL9A 1KZ7B 4N03A 4G1EB 1QBGA 4I1OA 3UV3A 2RK3A 5IZ4A 1FNNA 5IWCA 2C7QA 3QENA 4PQYA 1PGNA 2N9UA 2H0AA 3BWVA 1LFAA 4M6WB 4M1KA 5JDIC 3GLIE 4MIYA 1JR3E 1ISHA 1JHVA 3ZW9A 3L7OA 1Q0TA 5DK6A 3DEIA 2UZ4A 4UM9D 3RKRA 1ZJJA 2ZG6A 1PV2A 4G36A 3U6BA 1MJ5A 1XCGB 4DUPA 4RQAA 2VSXA 4N5DA 1E99A 4Y6SA 1E60A 2MMGA 4HBZA 2J3MA 1ESDA 3G5UA 4NABA 4H59A 3ZW8A 1E0DA 1VMIA 4R2HA 4X6YA 1KSGA 1QMPA 1ZHOA 4WVLA 4KQWA 1LLCA 1L5HB 2FMXA 1ZM2A 1Q7TA 3NJ8A 1PJAA 3PPVA 3RSCA 3TINA 3W1VA 4HRAA 3TW0A 3GRFA 3WGMA 2I6TA 3L0PA 2P2DA 3G0BA 2ECKA 1JJVA 1NVVR 5E9WA 2F1IA 2R00A 3JD4A 3MCWA 2J3LA 4YCCA 3KHKA 2FR8A 4WFQA 5EZSA 5IYZF 1G63A 2AG5A 4PWZA 2PKCA 4L9RA 1XTIA 3OIUA 3OQJA 2X4DA 4FMDB 4ABYA 1UWVA 4B81A 1EK5A 5MGNA 3IH5A 2JARA 4HLQB 3I6MA 1G8SA 5JSHA 3L7JA 5AVKA 3N3BC 2NSDA 4X41A 4CIXA 3EEIA 4EP1A 3C24A 5D5HA 4BGUA 5CXQA 1D0VA 2NWQA 1NBEA 1HYGA 2AX4A 2YBEA 4M9XA 5HF6A 4RV9A 1ESMA 2I1LA 1YR9A 2HD4A 3DEFA 4IV8A 4P3OA 4BZQA 2CMFA 2ODWA 4XW2A 1XHFA 1L7AA 3A2LA 2WWYA 2JLQA 1XK7A 3PIRA 3U31A 3ZWVA 3LZ6A 4HH0A 4X8LA 2HYDA 3PQVA 4M9SA 3ZXSA 1HE3A 2O0HA 4QXOA 5F2OA 1FYWA 2XTMA 3E9EA 1SXGA 4N12A 2F3UA 3DXZA 1WDTA 4MR7A 4AWAA 1RQGA 1P18A 1OF1A 4MI6A 1MIHA 3KZCA 1BD3A 1DMRA 3IP1A 2C9YA 2AN5A 3PL1A 5TPWB 1USKA 2LIPA 1T4MA 3OCJA 4C20A 4NATA 2BR3A 4OBEA 4X3PA 1T2DA 2NM0A 2VSNA 5FYDA 1GGHA 3NYRA 1JSXA 1NVKA 2ECQA 5DGCA 2JGLA 2WB2A 4I6JA 4LUCA 3S28A 1XJQA 4F1KA 3CYFA 2QMQA 3FMGA 4R9RA 1GTSA 4BO9A 1YJAA 3QKIA 3EVAA 5HF9A 3ZNNA 1AURA 1F0KA 1T5HX 1Y5IA 2J5BA 2WZBA 3G0DA 5AQEA 3PZBA 4ZAVA 3VKFA 3VR2A 3X3HA 4EHLA 4UQLA 4ZA2A 2Y67A 3VXKA 5C7YA 2IIVA 1VCHA 3SQDA 2HHHB 1HT1E 1Q74A 5EQDA 1CJMA 1QFXA 1YS7A 1T2UA 3UMYA 1DIGA 1N9ZA 4JXKA 5MN6A 3T1QA 1XDBA 2CNLA 2WZCA 4L5YA 4CUKA 3ZCTA 1E6CA 4QOEA 3ISTA 4WNCA 3Q41A 1SXIA 2R00C 2GMWA 1CUIA 3PJRA 1E4EA 1E2KA 2O1XA 4G67A 5EVCA 4EENA 3RLIA 4QBKA 3W6NA 2VWHA 3O8LA 2FR8C 2XZDA 3FCSB 1XMXA 3IMKA 3G85A 1EGMB 3O6VA 4TYMA 1HI9A 4R1QA 3SX0A 4Z86A 5BSGA 4F06A 1XXHB 1E3WA 1PUJA 2EIHA 1LU9A 2F3SA 2P27A 4X1KB 1UJ5A 3PEUA 3RV3A 3UAXA 1IBKB 1CLUA 5LXTF 2HYIC 1BS9A 1MJGA 2VDMB 3QEMA 2IVFA 3R4VA 4GS5A 3NBKA 4Z4GA 1VYUA 8OHMA 4X62B 2YJ4A 3U3DA 3FGPA 1P0MA 2WSMA 4D42A 3WHPA 4D9KA 2GO7A 1A4XA 1ZM9A 4CM9D 4NZPA 4BMVA 1ML3A 3ZJ4A 4I19A 2IYRA 3PKZA 3M81A 2ZZNA 3HV2A 2WTXA 3FVRA 3FYUB 5T67A 4IOMA 3ZWWA 4EBFA 3F46A 4E0BA 4C5AA 1WM1A 1E9AA 1XALA 4TQ9A 2YHIB 1TC2A 1V6SA 2ZM5A 1G18A 4DLTA 3E5HA 1KGDA 3HP7A 3OIDA 4MRAA 2Q1SA 5CFMA 1EEXB 3AHCA 1W5TA 3QKWA 2H52A 1E5QA 1J5PA 1UJNA 2BFOA 3VKVA 1QIJA 3WLHA 1PW5A 1TQ6A 3DL2A 2KWIA 3RK1A 4KW7A 2G0TA 3O95A 1WS6A 2VDUE 1JLMA 2CXPA 2P6NA 1OX6A 3E3AA 3LA6A 4GOLD 1VJ5A 3MUEA 4ZZIA 1XT6A 3I32A 3WL5A 3P2KA 2CNOA 1EUCA 3BFPA 1T3SA 4BP8A 2BN4A 3JATB 1T10A 5JNVA 1DL5A 2YWCA 2I78A 4F3RA 1R8YA 4WA7A 3LQ4A 3FCEA 3L40A 1G41A 1XX6A 3BE4A 3TTTA 5DN6D 2E87A 3HDHA 3HYCA 3MJEA 3PQ4A 2NO9A 1SRRA 5T4EA 1WZEA 4TS1A 4FZ3A 1N4DA 2C8VA 3MTBA 5AK0A 2O7SA 4X65B 5DXAA 2XT0A 3CQ9A 3I8SA 1EWRA 3LGXA 3DTNA 3VV3A 4EY8A 3WO0A 3B6KA 1ZESA 3HJGA 2O23A 4Y2YA 3V80A 3A8TA 3ZHXA 3H4IA 2CLSA 4WCFB 4YJFB 2AFIE 4PLPA 1G9TA 3CRZA 3RBXA 4OPMA 3ZHQA 2HT6A 2ZUEA 2DTDA 1F17A 3H5IA 3SQWA 3LX8A 2WWVD 1E3EA 3AOEC 1PSZA 2X1MA 1P6QA 3TCKA 4D79A 5B57C 5BWCA 2WJ4A 5BN3A 1YZNA 4MLDA 2VZEA 3S3TA 4NYMQ 1DX4A 3Q6MA 5KJCA 1T1JA 3EZ9A 3SC3A 1F1JA 1JI3A 1XJ0A 4K9PA 2AQ8A 4NYJQ 2PY6A 4A2PA 1BC5A 4B40A 3LQKA 1LV7A 4PPGA 4MLZA 1T2FA 4WZ6A 3RRYA 3IMCA 1RXWA 1VLMA 2OK8A 3T7JA 4MKHA 4TXNA 2PBLA 1V37A 3B20A 3OICA 2ZQ5A 5D00A 1U2QA 1VHWA 4PSCA 3VR5H 3EXG1 1BX1A 1XTTA 2JFWA 3HLYA 3MJRA 3UK2A 1LI5A 3GI1A 2GKGA 4GZ6A 1E2NA 3PFNA 4G8CA 5JXGA 4B6SA 3AG5A 2I3BA 4FI3F 5FNVB 1X2BA 1PJSA 2W2PA 3FYDA 2QM8A 1IIRA 3MCUA 3E7WA 4YUVA 3QRWA 2EERA 1P19A 3NBYC 1ECLA 2QLLA 4N3AA 5J2TB 1JSCA 4LNUB 2O5CA 3RU3A 4IHQA 4KIWA 5BQOA 2HA6A 1Z5WA 4D7AA 2JL1A 3F73A 4BYGA 3D31A 2BKXA 2O2GA 4ZVVA 3R41A 3SYRA 4P7GA 4ALJA 3MG9A 2FOXA 2YZNA 3CPHA 4TROA 1MAHA 1IWBB 2XT6A 4LVCA 2QLFA 3BXHA 3DHNA 4BV2A 1XTZA 2G76A 4Y67A 2FEXA 4DDVA 2PSHA 3OTHA 5JYFA 3BILA 4DS3A 3L7LA 3SYTA 3LFUA 4DUYB 2Z2YA 8ADHA 3T9FA 1HETA 2WFAA 3D1LA 2JI4A 3IO3A 2GFIA 2NXCA 3KPYA 3KDAA 3UHPA 4ZOQI 2IIQA 1KS2A 4F84A 3FCYA 3KSUA 3NZEA 4KU4A 2QSUA 2Y1OA 1EPUA 2XUPA 5GONB 4C3ZA 1W59A 3I73A 5TQVA 2I71A 3BF8A 2P2ZA 3M70A 2I62A 2I9PA 4ZT6A 3WA6A 4EHIA 4F86A 2BEWA 5E6RB 4C6TB 5AJVB 4KLAA 2JVKA 3CJRA 1EX1A 3P0FA 4IW3B 4LWZA 3AETA 4WA8A 4ZAGA 3SS7X 3V1MA 3HCOA 1FSFA 1D09A 2BBOA 2FPSA 2FZKA 2GEFA 4IIEA 5AKKA 4DG9A 2XNDD 5JQGB 1NP6A 2NU6A 5AUQA 1TUIA 4ZT7A 2PJZA 3MHTA 1YCFA 3GJRA 1O58A 3QJ5A 3R3VA 4NPCA 1FZTA 2MHCA 4YCAA 4NYIQ 6PFKA 3GQBB 3RJ5A 2PCJA 2BFDA 3FWZA 4LRSB 3I83A 4RD2A 5DHFA 2YQ4A 4A0FA 3BE5A 4B4KA 3A9RA 5JC1A 4JWKA 2QUIA 5CVEA 3R09A 3LY7A 5H68A 2YN4A 1PR0A 1KFJB 4W8OA 1ZAYA 2GQ0A 1X7XB 3SR3A 4BFYA 3H5VA 4M60A 4MWTA 3TLAA 4B7XA 4CM8A 1KARA 2UKDA 1WU8A 3EGEA 4KN8A 3RJ9A 1N75A 1UPBA 3TXAA 3WGLA 1XDUA 2XMRA 3Q98A 4PVDA 2W2LA 3IQEA 5IAGA 2HLPA 3BREA 3F8TA 4CXMA 3VAYA 2XD4A 4IIGA 3HWSA 2ZTLA 1LRJA 3FZQA 3TD6A 1BWQA 5JJIA 2X0DA 3LM8A 3IUQA 1W4BA 4NNOA 4W5OA 3BBPA 3OQ6A 1R5OA 4MWZA 3DBOB 4OMUA 3AJDA 4MMZB 1OH8A 2X7HA 2D62A 4I1VA 3WYEA 2E4WA 1P39A 4QUHA 3GGSA 3JSAA 4DMLA 4EL0A 5CDTA 1YZUA 2VQ6A 4Z9YA 2NTEA 4R83A 3H2BA 4BV8A 2FZ4A 4AXBA 1ACJA 3WIDA 2A9KA 3SPXA 5EUCA 1WVIA 2JLZA 1NRWA 2WIAA 3NC1C 4YIHA 3H13A 5YASA 3CSUA 4RO0A 3ZK8A 3Q2IA 1FX1A 1KC1A 3EWAA 4LXTA 5FA5A 1QO7A 1YNSA 3N2ZB 1CUGA 4KGXA 2YFHA 3K31A 5TXGA 4KGZA 4MUIA 4FFMA 4QBTA 2BFFA 4YVFA 3V7FA 4E09A 1QRSA 3GROA 1DDIA 1C0PA 5KU1A 4RVCA 5C3UA 3PDUA 2O05A 3CMMA 3T7AA 1OKKD 5FO0A 2OO5A 2FY8A 4OHMA 3WZ2A 3B2QA 3GGGA 4C43A 4QUDA 4EVSA 2XZPA 4UBLA 4A8PA 2CBZA 2E49A 4YJ2A 1ES9A 5D7NA 4C5BA 1SUEA 1DAIA 1JQEA 1VQ1A 1JPJA 1UT6A 4PG7A 1WP4A 2BE7A 2C96A 2FEKA 2G6BA 4XDYA 5JJBA 2EL7A 1I1QB 3A1TA 3GP3A 3WGHA 1JR3A 5ITZB 2F67A 3O3CA 2EG9A 4ZK2A 2ZJ3A 4QRIA 4RPGA 1KMQA 2X4GA 4LC0A 2OCDA 1G42A 3FDXA 3NX4A 2TECE 4R3WA 4B44A 3GLHB 2XD9A 2ZIZA 5E6UA 3CX8A 5F64A 5DLDA 3AB8A 2XF8A 4IX9A 2HRQA 3WO1A 5CDFE 3ZJTA 4WNIA 3CTPA 1UFRA 3VC7A 3SI7A 1COWA 3WLRA 4BNVA 2WSBA 3A0RB 1L5HA 5EJAA 4NXMB 1UK9A 10MHA 1NZFA 1X1CA 4QXRA 4BFSA 1OVGA 3COVA 3V9AA 4QVIA 4GH5A 2IHNA 4CIWA 2XMBA 5I48A 2DUWA 4IH9A 4OSEA 4ZV4A 1YKGA 1QYIA 4JR2A 1V8DA 2O3RA 3NTXA 4LQLA 2FCAA 4O2BB 3V4RA 2AKYA 2KBFA 4QVKA 1J9ZA 3MD9A 2P68A 2CLHB 2HRZA 1T1GA 1NDUA 1AHNA 3NVKI 4B2YA 1ZXXA 1SCIA 1JJIA 3DZ5B 1W25A 2UVPB 4XSGA 1XEFA 1KEVA 3TNFA 3WLJA 1GLNA 3IUMA 1TLFA 2Z30A 1T5TA 2XB9A 5JMPA 4ZEVA 3BMNB 2NGRA 4GUAA 3UWSA 1FUUA 4YQEA 2XXAB 3WOHA 3NNDA 2OBBA 3GD7A 4ZKDA 4I5DA 1AA9A 1KEWA 1JA1A 3O26A 3KV3O 4KITB 1XAIA 3PQ2A 5I7RA 2HXSA 4HC4A 4HS4A 1IE3A 3UICA 4H4DA 3HLKA 4JC8A 4HKTA 3OWHA 1P1RA 4MW0A 4EABA 4RQTA 1XZNA 2AUTA 3CM0A 3HN7A 4TKMA 1J0XO 2O52A 3PHJA 3UXHA 1IY2A 3D7RA 1F6WA 4LJYA 2EEZA 3ZV4A 2D3TA 1L5OA 4KPFC 1N3IA 1YCGA 4AF6A 1SU4A 1D07A 3ZCUA 4F6CA 1NLMA 2CF5A 2QMHA 3MTAA 1YJ8A 1FS5A 2JCBA 2W6PA 4M1SA 1U7PA 2OXFA 3FPJA 3X1KA 2ZYRA 4D25A 4FYHA 1WLSA 3N3AC 3ANYB 1RZUA 1FFHA 3PFKA 2F1KA 1MC1A 3DZFA 1TU3A 3FA2A 3KZ1E 5ARBA 3NXSA 1H5UA 1RJDA 4WXHA 5KNLA 4CEHB 2JK0A 2ZB4A 3RRZA 3H99A 4U63A 4AIRA 3R3HA 3QH4A 4FQ8A 4WTOA 3ICCA 2JJ2D 1GTMA 3R7BA 4WAUA 2NXWA 5H82A 4ARAA 4OFWA 5EXTA 3GUHA 1NXQA 2GEBA 2JHFA 2J0VA 4BN5A 3H16A 1ONPA 1D8TA 3GZJA 1WWKA 4QLOA 1BMFA 1U7DA 4XXHA 2GZAA 3MCVA 3LD9A 3MLEA 1G3QA 3Q3GE 4CEJB 1XXHA 4Q3BA 1IN1A 3ZS8A 1T0HB 3FROA 3EEQA 1AUXA 1WF3A 1MLDA 3N2KB 2YR0A 3PI6A 4DYVA 1IZZA 1O6CA 1AF4A 3CCFA 2OP1A 3QZUA 5DTRA 1WHSB 2OOKA 1G5HA 1HTBA 3R76A 5DNYB 5SY4A 4MHTA 3F8WA 4YLEA 3ST7A 4W5TA 1ZSNA 4PZUA 1E1DA 1A8QA 2P6OA 4LCBA 2UXBB 3FYUA 3CE6A 1AK2A 1K86A 2W58A 2YXBA 2PVCA 3BGVA 5SYMA 3A58B 4LFCB 4TRNA 3SX2A 5CXXA 3K71B 4B74A 3TLXA 3L18A 2YHIA 3NDPA 4F5ZA 1VDZA 5FTLA 1AGNA 3IUSA 3TFWA 3ULKA 2DWUA 2R84A 3D43A 4G97A 2ZIAA 5A03A 3HCAA 2E4VA 4QG3A 5I45A 3BCUA 4Y9RA 1P77A 2XGMA 4Y2QA 4N7RA 4FFBB 4BNHA 4U7GA 1O9BA 5FWNA 1KPIA 1QP4A 4P3YA 1P2VA 1QF6A 4MWGA 1DZ3A 5JFOA 3NOXA 4WNYA 1C3XA 3OIFA 3C7AA 4FILA 3GP5A 3VR4D 4KFRA 4E21A 3M34A 4EJ6A 4BO3A 3VU9B 2UUBB 1WY7A 5A6SB 1U0RA 1IG3A 3JATA 3REOA 1D7AA 3SMVA 4BQSA 5DM1A 4BQEA 4QOSA 2BSAA 3IA2A 1CY0A 2FPRA 1JNXX 3TAXA 4ENTA 5G4KB 2IGBA 2PMKA 2IBMA 2YWDA 1XQWA 3ESCA 3QELB 1LSSA 3N5CA 1G2OA 5DHAA 4BBZA 1QU3A 3KKPA 2OENG 5JBQA 4L0MA 5KX5F 1IEVA 3BM5A 4UCQA 4MNTA 1LW7A 2ZRFA 2ZUUA 4JB0A 4TL6A 3TAUA 2BZGA 1U0GA 5JW6A 3B1KA 4R8VA 4D3DA 3UQZA 2PJRA 5JD4A 3C3DA 3RYIB 2C1EA 4JYPA 4WCFA 4BKPA 2CK3D 3OZBA 1J8YF 1R0KA 5EHIA 4LJ8A 5F7JA 2Q4OA 1C3VA 4XUGB 1A9SA 2JW5A 5MFZA 5EHXA 1P3DA 3UO8B 4HNVA 4BNMA 5ALKA 1RLIA 4KPUB 2Q41A 5BSTA 3SDBA 1G8PA 3MAJA 3UMVA 3VI4B 2BELA 3CLTD 1NTOA 3JRWA 4XLTA 4QJIA 1WF6A 4LVUA 1C7JA 1AO3A 4M1MA 3F67A 4R1NA 2GF0A 3SF8B 3THRA 3OC6A 2AOWA 5TVGA 1GSHA 1I7LA 4IOKA 2ES4A 2KI5A 2QVZX 3QU9A 3S40A 2A9QA 5I7VA 3KDSE 2BL4A 2H63A 1Y3DE 2IXFA 1JIJA 2BJWA 1XWIA 2WF5A 4ZT3A 5JPIA 2PSDA 1Q0UA 5J47A 1XEXB 4B43A 1EK6A 2NNWB 4F6RA 3LDHA 1N77A 2ZUFA 4RZUA 2J46A 2FI1A 1Z4IA 1CRLA 1XU4A 1CUYA 2JJ8A 2R85A 4LYDA 1SBCA 2VYVA 4WGGA 1DBWA 1W76A 1CJCA 1TT7A 2K7FA 4ERXA 1CDEA 2VI5A 4LPKA 4U8HA 1R9JA 1RWNA 3H2GA 1YDFA 5FNVA 3HGMA 3QXCA 3OY7A 4HMOA 4NZYA 5C7IO 4FVTA 1F6BA 1ODSA 4Q21A 2DR0A 2WFZA 3SLKA 3W3AA 4PQEA 1T8RA 3SOZA 5J2TA 1VG8A 4LNUA 2CDRA 2Q3FA 3NEAA 1ENOA 4H0NA 4ARUA 5GOZA 4DUGA 4YUAA 2KQUA 1UH5A 3U7QB 4DLNA 1L8OA 4Y2UA 4HGOA 4RAQA 2Q3CA 4MRMB 4IQ4A 4X3CA 3AI1A 4QGHA 3P26A 4K2AA 4DFDA 3R7NA 1WRBA 4RVGA 2O2SA 2ZB8A 4TL9A 5K0TA 3THYB 4JYCA 4BVHA 2OV8A 5HILA 1FL9A 3GFOA 2GM5A 4K87A 4KBYA 4M2LA 4QTYA 4HDRB 5FRDA 1DX9A 3BTVA 1JGTA 4R1PA 5KNDA 5AJHA 3UV6A 2R9VA 3Q8WA 3DZ7B 2C2GA 4DNPA 5JWOA 3OQBA 1TOAA 2WAYA 3I9LA 4JS0A 4RA6B 4P08A 5B1SA 5F2NA 3QPAA 2WZDA 4PGHA 4Q34A 3F97A 3C3AA 3OCUA 4E03A 2BFWA 2A33A 2R87A 3IDAA 3P2YA 4I2VA 4Q1BA 5EY5B 5KVVA 1W0JD 3WA7A 3GLFB 5GONA 1Q20A 1MG0A 1E0SA 2ZUBA 3KETA 2YFQA 2KPOA 4LBVA 5E6RA 2Y6UA 1P73A 2W6JD 4DIMA 5DRTA 2XWSA 3FAKA 1TI7A 2OD9A 2WJGA 3OY2A 5EMHA 3RVBA 1U7XA 5JZVA