3QVWA

L-myo-inositol 1-phosphate synthase from archaeoglobus fulgidus mutant k278a
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
392
structure length
392
Chain Sequence
b'MKVWLVGAYGIVSTTAMVGARAIERGIAPKIGLVSELPHFEGIEKYAPFSFEFGGHEIRLLSNAYEAAKEHWELNRHFDREILEAVKSDLEGIVARKGTALNCGSGIKELGDIKTLEGEGLSLAEMVSRIEEDIKSFADDETVVINVASTEPLPNYSEEYHGSLEGFERMIDEDRKEYASASMLYAYAALKLGLPYANFTPSPGSAIPALKELAEKKGVPHAGNDGKTGETLVKTTLAPMFAYRNMEVVGWMSYNILGDYDGKVLSARDNKESKVLSADKVLEKMLGYSPYSITEIQYFPSLVDNKTAFDFVHFKGFLGKLMKFYFIWDAIDAIVAAPLILDIARFLLFAKKKGVKGVVKEMAFFFKSPMDTNVINTHEQFVVLKEWYSNLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol-1-phosphate synthase (Ino1)
molecule tags Isomerase
source organism Archaeoglobus fulgidus
publication title Atomic crowding drives the catalysis of myo-inositol phosphate synthase, as deduced from a crystal structure of a trapped catalytic intermediate
rcsb
total genus 152
structure length 392
sequence length 392
ec nomenclature ec 5.5.1.4: Inositol-3-phosphate synthase.
pdb deposition date 2011-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01658 Inos-1-P_synth Myo-inositol-1-phosphate synthase
A PF07994 NAD_binding_5 Myo-inositol-1-phosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3qvwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3qvwA01
5JC8A 1YH3A 5CDTA 3NJ4A 2AW5A 3R0IA 3KXDA 3ZWXA 3NTQA 3AU8A 1PQWA 1U7HA 4C4OA 3AM5A 3HUDA 3EMKA 4XX0A 4B4WA 4DMMA 3OICA 5L7YA 3UCEA 3QLJA 2HMUA 3OJEA 4NBVA 4QXMA 2UYYA 1ZH8A 2H1SA 4P38A 1ZZEA 1E3IA 4ALNA 3ZWCA 4D79A 5THQA 1RWBA 3VVBA 3PPIA 2BMAA 2XOXA 3LZ6A 4IMPA 4NIMA 4OSPA 1I33A 1D3AA 3M2PA 2NV6A 3NT4A 4Z9XA 4I1IA 4K26A 4Z0PA 3TZCA 1E7YA 2IZ0A 3INGA 2X1HA 4MIOA 5COQA 1WP4A 2D1YA 2W2LD 1XIVA 3FBTA 4O59O 3JSAA 4HY3A 2YZ7A 3PEFA 3DBRB 3H9JA 2RHRA 4IS3A 1B8VA 4RZIA 5KJCA 4PLZA 4FOOA 1U9JA 1LXCA 2PH5A 5MDHA 5F1OA 5JLAA 1JAYA 5T8KC 1VI2A 3OJ0A 1IYZA 4XR4A 1WWKA 4AL4A 3CZRA 4JIGA 5TQVA 1AE1A 1ISJA 4E33A 1Y9AA 4H16A 1MC5A 1QYWA 3RKUA 3Q0EA 1Q0LA 2EW8A 3BTOA 3C1TA 4MPDA 3JYNA 1R16A 2ZK7A 3MWEB 1YL5A 3G79A 2VUUA 4BKUA 3LT4A 4YPOA 1QYVA 1ZSVA 1KEUA 5L95A 2VHZA 1DIRA 3B1KA 5I8ZA 4FJ0A 3OIDA 1R37A 4HP8A 3ASVA 1MX3A 4J2HA 1SMKA 5JY1A 2VCYA 3AW9A 4XQ9A 3Q1LA 1U7TA 4UAGA 2NLOA 4OKNA 4S3MA 1UZLA 4OKIA 4DIOA 4GWKA 2ET6A 1H94A 3QRWA 3HZZA 4Y6SA 2AQHA 3TZKA 3WWYA 1F14A 1DAPA 2J6IA 3E6AA 3WGYA 1HSOA 1ZJYA 4BMSA 3TRIA 3GZNB 1T4DA 1N1GA 4NNJA 1KYQA 4Y6RA 4J1QA 3WTBA 2X9NA 4RPKA 4D0RA 3IL2A 1IPFA 1W73A 4ID9A 3I6QA 3ZWNA 2HK9A 1HDRA 1KVTA 2YDXA 3HDYA 1BWSA 1FJHA 2E49A 2CF6A 2YQ4A 3ZU3A 3FN4A 2WWRA 4I8XA 1YQDA 5C7OO 4MVJG 1HDYA 5B4TA 3GZ4A 4CR7A 1EVIA 2EP7A 1ZK4A 2O3RA 5KTKA 4IUYA 5TT0A 2G82A 1XLTA 1PX0A 2BHLA 1G0NA 3F4BA 5JYDA 4E5MA 4DQXA 2JD2A 3AWDA 3H9QA 4W9NC 2PZJA 5GZ1A 3ANMA 1CEQA 3GFBA 3B1FA 2O50A 3H5NA 1LRKA 2NADA 2HAEA 3AU9A 3GVHA 5DCUA 2PFGA 5TSDA 4NBRA 3TZ6A 3BMOB 2E4AA 2RH8A 3H3JA 3ZWOA 2EKQA 2FSSA 3K2BA 3PGXA 3Q2KA 2OMEA 2FRDA 4OM8A 1PGJA 1LUAA 2PGLA 2O3QA 2OOSA 4WGGA 3IKTA 4K28A 4E2WA 1QV6A 3KYCA 5EMHA 2HMVA 3L0DA 1YRLA 2O3TA 2AE1A 1CDOA 3WGTA 3WBFA 4ND4A 1P9LA 3CXRA 4Z0TA 5C5IA 1FDVA 1HE5A 3TL3A 8ADHA 1IOLA 3AY3A 3WS7A 1P3DA 1DC6A 3LT0A 4M49A 4Z0HO 2I66A 2AXQA 1ZK3A 4U0JA 4DYVA 3KYDB 2RIRA 2HJSA 1N9GB 3FI9A 1YOVA 1K6JA 3JYQA 1Q7CA 3C1OA 1IHXA 1HYGA 1YVEI 4U6QA 3TSCA 3DWFA 5DP2A 2EJVA 1X1EA 2VZ0A 4YRDA 1EZ4A 2DKNA 1PS0A 3HFSA 1T2DA 4JGBA 1PJ2A 3UGKA 5GZ3A 4Z3DA 4XD2A 5JYFA 2Y0CA 3UN1A 4XGNA 1E5LA 2NVWA 2Y68A 4PFJA 3E5RA 4MKRA 5HA5A 3ZWAA 4RJTA 5KJ6A 3JCZA 2X86A 4BHTA 1PJLA 4YRBA 5FI5A 3KEQA 3ZWYA 2CDCA 3RFXA 3WLEA 3MTGA 1AGNA 3ONDA 3A4VA 3ZI0A 4CODB 5ILOA 1MFZA 5CPFA 3SX2A 3VZPA 1AXGA 2X0IA 3SBOA 2QG4A 3QV1A 4WNIA 3V2HA 4WLOA 4IJVA 3MCVA 4P4GA 3BMCA 3QJ5A 4RVGA 4WUVA 4ZD6A 3I9NA 1UXHA 1CQJA 1E6UA 4R1NA 4J1TA 2WDZA 5CEFA 1DO8A 3S2GA 4NZ9A 2Y66A 4EGFA 4FS3A 4O63O 1EEHA 4BNJA 2X23A 3JD3A 2CDAA 3BMQB 4BO5A 3D5TA 2O48X 2QX7A 4J43A 4UEOA 4E5NA 4CM4B 1XELA 3LK7A 1XQ1A 3EC7A 3KBOA 1DB3A 1F17A 2UUPA 3JV7A 1YOVB 1XU7A 4Q3DA 1Y8QB 2VYND 4IGEA 5I7EA 4R51A 1LDBA 2VHXA 1E5QA 3JD1A 4W7IA 4DXHA 3ZHBA 2Z5LA 2HSDA 2OORA 3F5SA 4CM9A 1HZJA 3M1AA 5CAEA 2HRBA 3QP9A 1NQ5A 4R41A 4HKTA 2DBVO 4RVDA 9LDBA 1PZGA 4JJFA 2P4QA 2B36A 3VZQA 2J5KA 1J4AA 4Z6KA 1VL8A 5T67A 3Q9UA 3L9XA 4YJFA 3KOUA 1ENOA 1Y7TA 4FB5A 1ADGA 2AMFA 3QE3A 5FFFA 5IN5A 1YE3A 3DHYA 3KSZO 1BMDA 3JQ8A 4GMFA 3M2TA 3GLQA 3BTSA 4KZPA 2EW2A 3ZHZA 4QO8A 2HQ1A 2Y0EA 3S1LA 3GVCA 3ST7A 2GD1O 3IIEA 1ADCA 3DOCA 2C54A 2G0TA 3RQSA 1X0XA 1N92A 1SO8A 4O5OA 2SCUA 4CMEA 1OAAA 3VTFA 1LQTA 5IF3A 4FJ1A 5G0TA 4PG4A 1AHIA 1UXIA 3L77A 3GPDG 3GAFA 3BTUA 3RCBA 2O7SA 3VDQA 2A35A 2UUOA 3I52A 4KWIA 5A05A 2PGJA 1NHGA 3EAGA 1IY8A 1KC1A 2O3JA 1DFIA 4IXWA 4JCOA 3WDSA 5I7FA 3PIIA 4G65A 3HE3A 3RROA 5DBGA 3ORFA 3WNVA 4MOWA 4TMFA 4GSKA 5JNLA 5KVCA 5JBIA 2E6UX 3ZHXA 1XQ6A 1IL0A 2AG8A 1RKXA 3EZYA 2E82A 4ZICA 3LVFO 3DMTA 1Z45A 3AY7A 4HWKA 2FN7A 2HDHA 3JQ8B 1B26A 5JY6A 5DBFA 2PR2A 1IZ0A 2JKVA 1O5IA 3L6DA 3OP4A 3WIEA 3GGOA 3PQEA 1E1LA 1LDEA 1E3LA 4NFHA 3IJPA 1A71A 2F1KA 3IKVA 3H8VA 3D64A 1VL0A 3GRKA 1A7KA 4BB6A 3NRCA 2ZB4A 3PXXA 4M55A 4CQMB 3V1TC 4KMSA 2R6JA 4TKMA 2RAFA 1R4MB 4E21A 4BNVA 4BNIA 3DBVO 4RPHA 5ITWA 4PN3A 2GN4A 1HTBA 3ZH2A 2V7PA 3A14A 3AJRA 3PHLA 3C24A 2VWGA 2Q3EA 4IPTA 3VTZA 1KVRA 3E9NA 3PZRA 5TRTA 2C07A 1PL6A 2ZYDA 1JU9A 3SLKA 3UFXA 2H9IA 1DDOA 2GASA 2PD6A 3QVTA 4IINA 4UUMA 3H5RA 4F6LA 4ESOA 2LDXA 3HHPA 4DA9A 3CEAA 4FGSA 1Z75A 1UAYA 3ZV5A 4D43A 3UW3A 1U2GA 1VJTA 2HRZA 4PLTA 4B7XA 2DTXA 1N9GA 2Y1FA 4J0EA 4CMGA 4HUJA 4CMAA 3LT1A 6ADHA 3AM3A 4A2CA 1EMDA 4QO7A 3ZV4A 3ZWWA 2XPCA 4MO2A 1YKFA 1I8TA 1EVYA 1JWAB 4LW8A 1HT0A 3NUGA 3FPLA 2BLLA 1IULA 1J0XO 1KEVA 3CIFA 3WOHA 1ISFA 1I10A 4EDFA 4NBWA 4ILKA 5TLSA 3OQ1A 4I5DA 5JDIA 3QWIA 3WB9A 1LBEA 4H7PA 4KP7A 4U0KA 2A94A 5H81A 3WYEA 1QYXA 3VH4A 3TJRA 1TT5A 1HYHA 3SLGA 1PZFA 4R4JA 3IOYA 1QP8A 3ETGA 3DDNA 2VNAA 1LTHR 4WEOA 3N74A 4XA8A 4CLOB 2NVUB 5B37A 2A4KA 2HMWA 3I6IA 1M76A 2AQKA 3RBXA 4L76A 4CMEC 4IDGA 3TF5A 2YFHA 2EEZA 2C82A 2G5CA 3O03A 5JPIA 4J9UE 4MP6A 2OUIA 1FF9A 2GNAA 1WAMA 3DONA 1GADO 2EXXA 4DL9A 3WXBA 4R5MA 2WSBA 2VZ9A 2QZZA 1K6XA 5B4UA 5I8WA 4BNTA 4OXYA 2IZZA 1DFGA 5BNFA 4ZQEA 2C20A 1Q2XA 5ES3A 4PLGA 4FQ8A 5JCXA 2AEJA 2DBZA 4B79A 3RC1A 3KYDA 4DQUA 3OHSX 2YDYA 3NDIA 4RVSA 4AJ4A 1UP6A 2GSDA 3QVSA 3BYZA 2VNSA 3OM9A 2D0IA 4OQZA 3RKRA 2PY6A 2P5YA 1NWCA 1ONNA 4BV9A 3STHA 4XYEA 1GDHA 3NDJA 4ZHSA 1KY5A 5JS6A 3A9WA 1H0KA 4XQEA 2TMGA 5J23A 5TT1A 3EY4A 1C1XA 4YJHB 3RJ5A 4IQ8A 4URFA 4A03A 3R3SA 4EITA 2X4GA 4OHUA 1I5RA 3JQFC 3MWDB 1WMAA 4NFYA 4Z9FA 5GMOA 4XDZA 1K0UA 3U62A 1KEPA 4A5OA 5EINA 2ZATA 4JN6B 2ILTA 5JDCC 2X5KO 4XZ3A 4WOJA 4RPJA 3JQ7A 1LJ8A 4CV2A 1BXGB 3C1AA 3MEQA 3E48A 5MGBA 2EP5A 1YONA 4NDNE 3WYBA 5J9GA 4DGSA 3E9QA 4G5HA 4IQGA 3HG7A 4CM6A 1P1IA 1E6EA 3DZJA 3TFQA 4BIIA 4XCVA 4BNUA 5BSHA 2I99A 1BHSA 3AI2A 1Y5RA 4W99A 3D4OA 3W6UA 4DMLA 1NVTA 4IDDA 2BGKA 3OQ6A 2PH3A 3MJCA 3RC9A 1P1FA 4CQMD 1WZEA 1BDMA 5AYVA 5G2OA 1SOVA 2P68A 4LVUA 2CSUA 1J6UA 1KETA 1I3NA 2VTEA 1A4IA 4QEDA 1B3RA 3I9JA 1MB4A 1XA0A 4FFLA 3P19A 3ETEA 2VOJA 4FJ2A 3W6ZA 4JNKA 4FFRA 1DPGA 1QSGA 2E37A 4MVJI 4LVCA 2IXAA 2PZLA 1HE2A 3QWAA 2FP4A 2EF1A 2FZEA 1C0KA 1W4ZA 4W7HA 1O8CA 1PJQA 2FR8A 2OGUA 1MXHA 1A7AA 3Q9NA 4NPCA 4FOSA 2RCYA 2DBQA 4F3YA 3SVTA 4LCEA 2A92A 3LLVA 1DRWA 1Y8RB 2OO5A 3RBVA 4B4OA 1RPNA 5G0UA 2BD0A 3RFVA 1LRLA 1WDMA 1DFHA 1GZ4A 1TXGA 3FR8A 4I5GA 5DF1A 4PVCA 1Z6ZA 2NTNA 3JQ6A 4NJMA 1ONPA 2DUUA 1YL7A 5L51A 5TF4A 2EHDA 2NNLD 3IUSA 5KVQA 4J7UA 3WGIA 4WKGA 5IZCA 1TI7A 2QIOA 4A26A 1RJWA 4DRYA 4Y8VA 5DDIP 1ISMA 5AXCA 5L3ZA 3TN7A 1SEVA 1EDZA 2CVOA 4GKVA 2CVZA 4HFNA 3W1VA 1NPYA 4H3VA 3QWFA 3LSYA 1BGVA 3PJDA 3T7EA 3ONEA 1QLJA 1E1MA 3PYMA 4FC7A 1HZZA 4L4XA 4D45A 4CV1A 5DN9A 1GAEO 1BW9B 3RUAA 5JFOA 1C1DA 4GH5A 4YB8A 4BNXA 1VSVA 2YW9A 2PV7A 5T6BA 3GZNA 2D5AA 4ALJA 2DC1A 2JFGA 4KDEA 1GQ2A 1VPDA 3WJ7A 4GSLA 2Q4EA 4O6VA 4QFDA 3G17A 4D7AA 1YBAA 4CM8A 5F1PA 3U4HA 4KOAA 4E2ZA 4I9NA 2H6EA 4E0BA 3GDGA 3VHRA 3FBGA 4IS2A 4B8ZA 2FMUA 1LC0A 1A27A 4Y98A 3RASA 3UH1A 4WCFA 4CQLA 3IP1A 3U49A 1NAHA 3H3FA 3GQVA 4YJDA 5CFZA 1N8KA 3QSGA 1NQAO 3WWZA 5A9SA 4CLHA 4IDBA 2ZJ0A 4DREA 1HSZA 2Y1OA 4LSMA 2AE2A 3F5QA 3W8EA 1LSOA 3UXYA 4J2OA 3I5MA 3JQBC 2X58A 4UVEA 3ICCA 2WJPA 4L8VA 3T4EA 1DHTA 4HADA 1NPTO 1P44A 3PK0A 3ZW8A 1KVSA 1XCBA 5JCJD 4JBGA 4LRTB 1OMOA 4LSWA 3M1LA 1N5DA 1PR3A 4KTTE 4Q3NA 3GMDA 4AICA 4Q3CA 2DVMA 4Z3KA 5A1TA 3FWZA 2ZTLA 3KYCB 4I9HA 4PG5A 4AJIA 1ENZA 3VPXA 2NU8A 3DQPA 1O94A 1U4SA 2WTBA 1MA0A 1EE9A 1P33A 4QSMA 4MVJM 4ND5A 4JP2A 2Y0DA 1GTMA 2DBRA 5B1YA 2BFPA 2X8LA 4HBGA 4E30A 2ZJ1A 1N7HA 4R1UA 3E82A 2JHGA 3UF0A 4PRLA 3QWHA 4W82A 4H15A 3W4KA 4CV0A 4IJWA 1BSVA 3PIDA 3H9EO 3DFZA 4OOFA 1DIBA 5G0SA 1Q7BA 1X0VA 1M66A 1JKJA 2YYYA 1LI4A 5TC4A 3ZN2A 2VWQA 1YL6A 3NT2A 5COBA 2JHFA 1H6CA 5EPOA 2ZB3A 1P1RA 1DLJA 4GX5A 4E5PA 2A9FA 3A1NA 3BTVA 1Q7GA 1AXEA 3DB2A 4XYGA 2TMDA 2I65A 4OMUA 1SEPA 1G0OA 4BNZA 5IN4A 4MVJH 1S7CA 4PLFA 1HDGO 3O4RA 3IJRA 4LCJA 3GVXA 1V3TA 1IE3A 3DAFA 4AJNA 5LDGA 4YTEA 1QG6A 4YT5A 4YQZA 1OOEA 5AXBA 2HU2A 1N2SA 1L1FA 5T5QA 5A3JA 1SOWA 4J3FA 5JYAA 4R68A 1ZNQO 1ZO8A 2I5PO 4C7KA 3GNSA 4MVJD 4HFRA 3EVNA 1EUCA 1GV1A 3NX4A 4HNGA 1A9ZA 4ZGWA 2O2YA 2IYPA 1E6WA 3FNEA 1D4FA 1VE9A 3ROMA 4C7JA 2G76A 4LN1A 1UZNA 1ARZA 1H6BA 4DIBA 1UUFA 4NJMB 3DHEA 1NXQA 1ENYA 3RUCA 1AUPA 4CLEA 4CPDA 3AFMA 4MKZA 1QXSA 3OETA 4XQGA 1PEDA 1HRDA 2HCTA 3HB5X 2O7QA 2Q2WA 2HLPA 1QMGA 2UVDA 5LC1A 4BO1A 3BMNB 5F5LA 1ULUA 4BO6A 1U3WA 1KEWA 3OEWA 1C1XB 1R66A 3PQFA 4N7RA 3I9KA 3S55A 4R16A 3H2ZA 4K6FA 3ZWVA 3LC2O 3LDHA 2ZQZA 4QUKA 4EJ0A 4JX8A 4RF2A 4O1MA 2Q4BA 3FRJA 1UAGA 2RH4A 3L6OO 2C7VA 3IS3A 3OFSA 3DZFA 3OF2A 1A9YA 3I23A 1GYPA 1KERA 4R54A 2NVUA 3PLRA 3FTPA 2WMDA 3O9ZA 4L9RA 3KEOA 3QQPA 4IZHA 1H2BA 5A5FA 3K2EA 1RM0A 1L7DA 3WBBA 1KBZA 1P77A 3C85A 4MKXA 3C3XA 1U5AA 4CQMA 1OC4A 1BRMA 3NAQA 3WGHA 2PWZA 5JO9A 2OHXA 5CEJA 2JAPA 5LDHA 3BIOA 4ZRNA 4BNFA 2HMTA 2CZCA 3MTJA 1VC2A 2Y05A 5C7IO 1YDEA 5KNLA 4EW6A 4N18A 1FDTA 1PWXA 2W98A 4OYRA 5FWNA 4QX6A 4J7XA 1T2EA 1B8UA 1PL7A 5ENVA 4L73A 1UXJA 4XQCA 5JDCA 2GLXA 5DP1A 5THKA 4ZN6A 2ZB7A 3GT0A 1HDCA 4RQUA 3JQFA 4OL9A 1B14A 4GGPA 1GY8A 4WCFC 5ER9A 1H6DA 3RU7A 3WFIA 3FSRA 1TEHA 2QW8A 2NACA 3OJFA 5AXAA 3GMSA 4FGWA 1PS9A 1Y81A 3DZGA 5GZ6A 1BVUA 4YYZA 5JAIA 4OSOA 1FDWA 2V65A 5KJ1A 3G0OA 3D5QA 1WPQA 1P45A 4E6PA 4RDIA 1EQ2A 3C7AA 3B6ZA 3F4LA 5AXDA 3ENKA 2EKLA 1JLLA 3GK3A 3KSUA 1JVSA 2PNFA 2NQTA 3BMQA 1UDBA 2GN8A 3P2OA 5K6AA 1PR9A 1LDGA 3A06A 5IZ4A 1PJSA 1JN0A 1NQOA 1M2WA 2JCXA 5IFLA 1DHRA 2D2IA 2C59A 4U8GA 4U6SA 3U3XA 1N7GA 3H4VA 4OJNA 3ADPA 3MJVA 3PQDA 2G17A 1DC3A 3U4IA 4ND3A 4YA6A 2R00A 2BRUA 1PJ3A 4P4NA 5H82A 4IMRA 4PG6A 3V1UA 1NFFA 5JXWA 3W8FA 4DPMA 5A03A 4D3FA 4UVHA 1NTOA 1V3VA 4UULA 2Q50A 5I9LA 5K6AC 1XKQA 1RM5A 3NEPX 5KJFA 3DAGA 5I7VA 3H2SA 3JQEA 4PLYA 2X5JO 2JJYA 4ITUA 1PS8A 3LLSA 1E0DA 3NTRA 1BW9A 4CM7A 3OBBA 2I67A 4IY1A 1CETA 1GR0A 5F5NA 1PIWA 3UAGA 4Q3AA 1MGOA 4CMIA 1D1SA 4KUGA 2EIHA 3GG2A 3L07A 1ZCJA 3LT2A 4GL4A 4AVYA 4CM8B 2B4RO 1H93A 2PKQP 3FCOA 3TPCA 4I5EA 2NUAA 4GKBA 1I30A 1G1AA 3FNFA 3WIDA 4EUHA 2GDZA 3JD2A 4ZA2A 2Z1NA 3K6JA 3Q11A 4AJEA 1BXZA 4CMJA 1I2ZA 4XB1A 3I9OA 3I9LA 1ULSA 2PKRA 1H2HA 4J4TA 4RLSA 3ZGYA 4M8SA 2BI8A 1A5ZA 4E31A 3LQFA 1UR5A 1W8DA 1PQUA 3JYOA 3RWBA 5KWEA 4DLAA 3VAZA 2AG5A 3F3SA 1EFLA 1GEGA 4J91A 3WGOA 1HXHA 3D3WA 3WYCA 4F6CA 4NJOA 4LRSB 2GN6A 1I2BA 2EJWA 1NASA 1Y1PA 4W6ZA 1H6AA 2FHSA 2JCVA 5BSEA 5HBRA 3V5NA 5AOVA 1A72A 4FD3A 4ONEA 8LDHA 4WASA 1T2AA 2P5UA 3JQGA 2FOIA 3GR6A 5DBIA 2H5LA 4FFNA 3Q2IA 3WTCA 4UVDA 3V2GA 3PYXA 5I9NA 4GI2A 4EJMA 1YO6A 2YHUA 1E3EA 2CY0A 1C14A 2DT5A 4MP8A 4AFNA 5K9ZA 1HE3A 2OZPA 4YT4A 2YY7A 1CYDA 5C7LO 4CM3A 4PLPA 4BB5A 5TNXA 4BO4A 4D46A 5IAAA 2PLAA 1ENPA 1NYTA 1HYEA 3ZWMA 1K6IA 3T7CA 1X13A 1JA9A 1DEHA 1F8FA 3I9MA 3PHHA 2RBEA 1N1EA 2O4CA 1V9LA 3EYWA 3LC7O 1YQXA 4F45A 3RI3A 2NVBA 1SZJG 4CUJA 3HQ4O 1HF3A 4IIVA 1EUDA 1SBYA 1UXKA 4U7WA 4QFCA 5EJ2A 3OEYA 3ZV6A 3QVOA 5A02A 1B16A 2CD9A 3EK2A 5FEUA 5DCWA 5DOZA 2X6TA 5JW6A 1JW9B 4D41A 1CWUA 2GUGA 3QW2A 2EERA 2J3HA 4IGFA 4DC1A 4JLWA 2I3GA 3GFGA 4WLUA 4XIYA 1M67A 2WYUA 4G81A 2FR0A 2JD1A 2AA3A 2ZKLA 7MDHA 3MJ4A 1U5CA 4J6FA 3IUPA 1BVRA 5A9TA 4BO0A 4PG7A 4CR8A 1UDAA 2EGHA 4J7CA 3WMWA 4XKJA 4GVXA 1BTOA 5L53A 3OIGA 3RIHA 2W4QA 1T1SA 3V1YA 2F00A 3SJ7A 4RPGA 3VDRA 2ZB8A 3P2YA 2VWHA 1WNTA 4EYEA 5ER6A 5T73A 1HE4A 1PSDA 3OIFA 4N5NA 1YXMA 4PGFA 1B2LA 4BKOA 1SB8A 3PLNA 4IQ0A 3CKYA 4IJKA 2HO5A 4DUPA 3N58A 3H9GA 1NVMB 1WW8A 2IRWA 1ZSNA 1DSSG 3CMMA 4CM4A 3AY6A 5DT9A 3MJEA 3K9QO 1B7GO 3FNGA 3DBHA 3RUFA 4IIUA 3NV9A 1WVGA 3KRTA 3BHMA 4TRRA 3RFTA 1Z82A 3ROKA 3CH6A 4R1SA 4WLFA 3TOXA 2HK7A 3WSWA 5G4KA 2Q99A 4PRKA 1R6DA 1K3TA 3E03A 1VKOA 2JFFA 3B20A 1LDMA 1X15A 1E3SA 1ZK1A 3JYLA 3PJFA 3RBZA 3BZUA 1OZAA 1NPDA 3GHYA 3KETA 2ZTMA 3RUDA 5T57A 2P91A 2P9EA 2YFQA 4NHEA 3KTDA 2VUTA 1X7DA 4EBFA 4TROA 1PJTA 4O0LA 4E5YA 1LC3A 1L7EA 4M1QA 3GVPA 2VZ8A 3H5AA 4BNYA 1ZK0A 5CP8A 3TZHA 4PZCA 1PZEA 4GGOA 3DAPA 4YWJA 2NWQA 1GUFA 1JVBA 3F1LA 2J8ZA 3FR7A 3PI7A 3TOZA 1E7WA 2JFHA 3KLPX 1CERA 3HN2A 4TRJA 2V6MA 1IPEA 3ZNPA 4UVGA 4GMGA 3TDKA 5IDWA 2Q1TA 1I36A 3ZNOA 5TIIA 2GZ1A 3CMCO 3DZIA 3LF1A 3RD5A 4JJIA 4W4TA 2O4UX 3DL2A 4JQCA 3OA2A 3GEDA 1NR1A 4XJTA 3O8QB 3GY0A 5I9MA 4NK4A 4EJ6A 3ABIA 4TSKA 4DBVO 3H9UA 4PZEA 2J3JA 1NX6A 1R0SA 2Q1UA 3AK4A 3PHIA 4AJKA 3GC6A 4CLDA 4BGUA 4CLXA 4CJXA 3KB6A 1F06A 5BNTA 1RM4A 3JQ9C 3K5PA 4AJ1A 3DBLA 4X54A 2X7HA 2OFPA 3TQHA 1YWGO 1UXGA 4E4YA 4BKRA 3GG9A 2C0CA 3PWSA 4IZIA 4E3ZA 5M6DA 1UP4A 4I9UA 3F1KA 5FF9A 5JYEA 1SNYA 1XU9A 4IM7A 4YT8A 1NBOA 1ISHA 3WLFA 4WCFB 4BO7A 5U4QA 4D3DA 3NT5A 1V35A 2FPGA 4N54A 3VPGA 1PJ4A 5KIAA 4GPD1 4WECA 3AOEC 4DBZA 1YS4A 2YJZA 3HDQA 1LDYA 4BVAA 3P7MA 3PYLA 3QWBA 3UVEA 4CR6A 3OECA 5CG1A 1U4OA 5L9AA 2AEFA 3D3EA 4R9RA 1PWZA 1TT5B 3AI1A 1EK5A 4L4SA 2DTDA 4TVBA 2X9GA 2PTGA 5H83A 3RUEA 3GDFA 2BH9A 3AOGA 2P9CA 1MC4A 4PLVA 3S2FA 1GQQA 5BSGA 1ORRA 4IDFA 3AOEA 3IAHA 2POQX 4NK5A 4JXKA 1B8PA 1Z7BA 3MJSA 3WGZA 1DRUA 4NR0A 3B1JA 3KO8A 2WEKA 5A9RA 2C2YA 4AJJA 5U1PA 4E2YA 4UUOA 3MOIA 1BXGA 2RHCA 4J1NA 4CMIB 3JQ7B 1M6HA 1HL3A 3X2FA 1TB4A 4CMKA 1VLLA 1MV8A 2Y93A 1KS9A 4ZJUA 1VRWA 4E32A 5JMWA 1PTJA 1V6AA 1SAYA 4BKPA 1XYGA 5CDGA 2I76A 1T4BA 4DC0A 3FHLA 1TT7A 1GV0A 1KY4A 2GPTA 3DMYA 4FC6A 1X1TA 2D4AA 4FR5A 4BQPA 2CDBA 4I5FA 5TX7A 4B3IA 3PDJA 1K89A 4KTVE 1OI7A 2B69A 4XIJA 2W2KB 1NNUA 3GF4A 1WDKA 1ADBA 1E1KA 4FSHA 5U9CA 1U3UA 4J9VA 3C8MA 5KVVA 1EK6A 5TJ9A 4MVJF 2X0RA 4L75A 1HKUA 5ICMA 4GWGA 1KIFA 1U3VA 2C2XA 2PD3A 4KQXA 1V8BA 5T64A 3KLMX 4II2A 4GX0A 4L0QA 3EHEA 4PCVA 5GY7A 1V3UA 1P1HA 5JCJA 4B8WA 1GEEA 3U9LA 4S1VA 1KVUA 4GVLA 1C0LA 4FCCA 1ZXBA 4TWRA 3EGOA 3E5MA 3WJAA 1DC4A 1E7QA 2CVQA 1WLYA 3COSA 4OAQA 1DIHA 1OC2A 4XYBA 3KSDO 4GAEA 5LCXA 4GX1A 3JQGB 5IZCC 2UDPA 4XR9A 3CZMA 4ZVVA 1NWHA 4BMVA 2DQ4A 4PG8A 4WEQA 3F6YA 3HFGA 3VC7A 4XYMA 3P5SA 4DQVA 1GYQA 2Y99A 3ZDFA 4FFOA 3WICA 4LMRA 2J3IA 2Q22A 1EVZA 2JL1A 3GAZA 4A10A 1DXYA 3NTOA 3L4BC 2GCGA 1ZKMA 1ZFNA 4PZDA 1YJ8A 2R00C 5TGDA 1PGNA 4OIMA 1Y8QA 2BF7A 4J0FA 2VTDA 2X22A 3L6EA 4NMHA 3BMOA 2W2KA 4M87A 4WLEA 2VN8A 2VQ3A 4YJGB 4YJGA 7ADHA 1MG0A 2ZQYA 4OXKA 4UREA 6LDHA 1P0FA 1DRVA 1U3TA 3JQ9A 3OMLA 5KOIA 1JKIA 2XXJA 2BFAA 4L4RA 3WX0A 2DFVA 5A06A 1I32A 1ONOA 2V6GA 2VT3A 3PHJA 4IDEA 3W4JA 1U2DA 1LA2A 4TRNA 3DTYA 3I4FA 2B5WA 4XDYA 2EWMA 3S2EA 3IQDB 1ZXLA 1GQYA 3JYPA 2Q49A 5L4LA 3QY9A 2O3UA 1TA4A 1XGKA 3AUUA 3OSUA 4Q39A 3HDJA 2NTJA 2P2SA 3BAZA 1UJMA 1Q0HA 3FWNA 5HM8A 2BFOA 4NG5A 3F9IA 2EKPA 1LSJA 2VHWA 2FPPA 4ALLA 3U09A 2B0JA 4B3HA 4J49A 4BGIA 3UHAA 4CM5A 3VKUA 1O9BA 1DLIA 1C0IA 4RQTA 4XJSA 2J3KA 4Q3BA 3LC1O 3ZW9A 4ZQHA 4RZHA 5L7TA 4II3A 2X9VA 1T24A 1YB4A 1ZMTA 5EESA 2WD8A 2ZTVA 3IDSA 3MOGA 4G2NA 5KKAA 4FDAA 3DTTA 1UH5A 4IJUA 1IB6A 3BHJA 1OFGA 4MINA 3UCXA 1GYRA 4CMHA 2Y67A 5F3RA 5DCYA 2VT2A 2XF8A 3UUWA 3ZHYA 1DJQA 2OXIA 2GO1A 3ICPA 1X7GA 4J90A 1R0KA 3VH1A 1LSSA 1MFPA 5ITVA 3GUYA 2AEMA 2B83A 4R9SA 1DIGA 2Y1GA 4MJLA 1X14A 1UDCA 3CTMA 3W8DA 2VRCA 2O3SA 5KCZA 3D7LA 4JROA 4FBGA 3VVCA 2CMDA 2P4HX 3PGJA 4N5MA 1XDWA 4RLHA 5CPBA 9LDTA 1ZMOA 3ASUA 2C7GA 2GZ3A 5JAQA 5TJHA 4PIVA 1SCUA 1EBFA 4RV9A 2HMSA 3WQRA 3JD4A 4UEJA 5BSFA 2OP0A 2B4TO 4BO3A 2P9GA 4DYDA 3K31A 4YAKA 1XEAA 1I3MA 3ROPA 1ZEJA 1M6WA 4MVJA 4L74A 5L4SA 1CF2O 1QYDA 2DUWA 3GHHA 4CUKA 1ZSYA 3PJEA 3SJUA 3KHUA 2GERA 1YBMA 1E7MA 3QVWA 4MVJP 4LISA 1ADFA 1O0SA 1NP3A 2WD7B 3HSKA 4MIEA 3DC2A 4BV8A 5DOVA 1E3WA 5EQDA 4YJHA 2ZTUA 5JC1A 2I9PA 2D5CA 5ILGA 2B5VA 4CL3A 3TNLA 1VM6A 1XG5A 1GZ3A 1GFSA 3RAJA 5EERA 3GEGA 2YV3A 3SC4A 4EEXA 1C1DB 3VZSA 1Y5MA 1T1RA 4XRGA 4NU6A 4RF5A 3IC5A 4B7UA 3I1JA 3WR5A 3KM0A 1IZ9A 4Q9NA 1PGPA 2I6TA 2EG9A 4R69A 3NKLA 2WE8A 3ZV3A 2G1UA 1CIVA 3D4PA 4RVUA 4ZQFA 3DZHA 4RO0A 2HUNA 2NU9A 2B4QA 5CDUA 3H7AA 1O89A 1PJBA 4TZTA 4BKQA 1MXFA 1YB5A 3ADOA 1M75A 3DHNA 4PLHA 4KWHA 2R2GA 3JQAD 1I24A 1I2CA 1E3JA 2ZIZA 2CUKA 3HB4X 4FN4A 2PK3A 4CMCA 2LDBA 3R1IA 4J1SA 3ULKA 3EDMA 3TFOA 2GF2A 2NTVA 1U1IA 2NM0A 2ZCVA 3GN2A 2FPIA 1MLDA 3O8QA 5A9SB 1BXKA 1UP7A 1PGOA 4FFMA 3L4SO 4MVJE 1YB1A 4AJLA 1VL6A 2Q1WA 3VPFA 3CPSA 3B70A 1GCOA 2QRJA 4EEZA 2O2SA 3D3WB 2NU6A 1P1JA 4WCDA 4E12A 4EUFA 1Y6JA 3WGQA 3EZLA 3MJTA 4BO2A 1I01A 4AJ2A 3INRA 1NR7A 3D0OA 2FY8A 3E8XA 5CDYA 1JQBA 3LU1A 2BI7A 4HFMA 3KZVA 2UV8A 4INAA 3VPSA 3U5TA 5G0VA 3K8ZA 1SPXA 3EVTA 1T2CA 4RDHA 3TZQA 3EW7A 1V0JA 3ROQA 5G4LA 3VKVA 3C7CB 1WMBA 4GQAA 5IDYA 3RUHA 2IZ1A 5JE8A 4IBOA 3PP8A 2NSDA 3LF2A 1PQPA 3E18A 4R1TA 4RL6A 2ZYAA 3FPCA 4AJPA 1MUUA 5CG2A 1C3VA 2Z1MA 1JKFA 5KJEA 3RVDA 3RU9A 3IP3A 3GGGA 2IEDA 4GLOA 4BNKA 1RYDA 3BA1A 3U4DA 5JO0A 1PJCA 3RC2A 1HDOA 4ZQBA 2JD0A 1OBFO 1LLCA 2Q2QA 3S8MA 2ZYGA 2QRKA 4OQYA 3K73O 1O95A 4XRRA 3PDUA 1Y9EA 5FI3A 5G4KB 2BGLA 1JAXA 2GR9A 1ML3A 1JWBB 5IG2A 1F8GA 5L7WA 1NFRA 3FNHA 2VRCD 5IXYA 3ZU2A 3S2IA 4YAGA 3RUIA 4XGIA 3JQDA 1ZK2A 3TL2A 2OP1A 5I7SA 4DPLA 3GOHA 2OL4A 4YCAA 5HS4A 5HTOA 1QLHA 4YR9A 4BUCA 4IDCA 4F46A 4BNLA 4YEDA 2GGSA 1ZJZA 3WQSB 5C3MA 4CV3A 1U28A 1YBVA 1R4MA 2QQ5A 4E2XA 2XXBA 1MP0A 2VWPA 5BQFA 4DVJA 1GPDG 2W2LA 2E48A 1E77A 4N5LA 3FD8A 1FXSA 3D1LA 1FDSA 1QR6A 1CJCA 2EV9A 1LLUA 2OBNA 3CUKA 3UCFA 1NFQA 1HLPA 1VJ0A 5AVOA 1XSEA 2VYNA 3PZBA 4R3WA 2IODA 3DEYX 3FF4A 3HNPA 1XHLA 1F0YA 1AN9A 3DFUA 4FIZA 3ZU5A 3AFNA 3DOJA 3K96A 4ND1A 4XGKA 5T8KA 3PFWO 2BGMA 3RJ9A 4R3NA 2X0NA 1DAOA 2HK8A 1ISIA 1U8XX 3ONFA 4B4VA 3GPIA 4YQYA 1B0AA 3HWRA 2B35A 4A0SA 3HDHA 3SEFA 4OO3A 5IDXA 2YHIB 4A27A 2D3TA 4KDFA 1O6ZA 2W8ZA 3RSHA 3ZWPA 3E1KA 4WJZA 3GNTA 4DTIA 1R4NA 3R6DA 1HETA 2PZMA 4ZU3A 1JDJA 3ANNA 4M89A 4YVFA 4MP3A 4CQLB 1MG5A 2HJRA 3Q6IA 1YDWA 2BKAA 1NQTA 3GEMA 1ZW1A 1LRJA 4ND2A 4RF3A 1T26A 4FFPA 4RGBA 1ID1A 3D4NA 5A04A 4RCVA 3ANLA 1TVEA 1GUZA 5AQ1A 3JQCA 1EE2A 1T25A 4Y9DA 1NAIA 4YRAA 4TVOA 5CDSA 4NQZA 4P22A 2DLDA 1PU2A 3WNQA 1GCUA 5EN4A 1IHYA 4RVHA 5CEEA 4WK6A 3SXPA 4XEHA 2BELA 4QECA 4RPLA 3W4IA 5HRUA 1WDLA 1B3BA 5L45A 1SC6A 1Z74A 1Q1NA 3VPHA 4JBHA 3UICA 2QYSA 3AUSA 1R12A 2Y1DA 4R5HA 3WSVA 1AHHA 1XWFA 3GDOA 2O23A 4NI5A 4PVDA 2VYVA 1VSUA 1LDNA 1NVGA 2WE7A 3NYWA 1QKIA 1W6UA 2NQ8A 4AJOA 3L9WA 5F21A 1NM5A 4BMNA 5A4DA 1FMCA 2Y1EA 3V8BA 4M86A 2JCYA 3DOOA 3TWOA 3OJLA 3DZKA 2X0JA 2IXBA 4UUPA 3AUAA 5EQFA 4XWYA 5DNAA 4PLCA 5DZSA 2AQ8A 4UVIA 4BNWA 4TQGA 3WFJA 3ZNNA 1T2FA 5L4NA 2D8AA 2Q45A 1F12A 4P8RA 4EUEA 3JQAB 1PL8A 3HN7A 1EUZA 3RC7A 4JK3A 4ALIA 4BNMA 4YAIA 5HWSA 2B37A 5KKCA 2GYYA 4IXTA 4ZQGA 5B12A 4B3JA 2V6FA 1Z73A 3G49A 3ITDA 3F47A 4RVFA 3X2EA 1LU9A 2H63A 4RF4A 1WZIA 4RORA 5IDQA 1I3KA 4YXFA 4J4HA 1D8AA 1J5PA 3DMTC 3O26A 3PWZA 4KQWA 5KVSA 4ALMA 2D59A 4CL8A 3PJGA 5IXSA 1FK8A 2Q46A 4WLVA 1ZVMA 1ISGA 3UKOA 4BL5A 4CUZA 5EIOA 3GUCA 5ADHA 1P74A 3INTA 3DBHB 1I0ZA 3R3JA 2DPGA 4EZBA 1GPJA 2YHIA 1DJNA 4DPKA 4OXNA 2IE0A 5IJZA 1LQUA 4FPXA 1QRRA 1H5QA 2YV1A 3VH2A 3GVIA 1E3WB 1XR3A 3PFFA 3K92A 1ZBQA 1SB9A 1VJ1A 4BO8A 4JP3A 1E7RA 4DLBA 4BOYA 3IMFA 3PHGA 4NU5A 2WYWA 3G1UA 1D7OA 1GU7A 2J5RA 3JD0A 3FTNA 1P31A 3HADA 3PRJA 4NFSA 4W9NA 4K6CA 4BQRA 4B7CA 2Z95A 2PD4A 2VOEA 1GZ6A 1QYCA 1R0LA 4YAJA 2DM6A 4D42A 3NJ8A 5COAA 4E5KA 3VOSA 3EUWA 3WQQA 1BG6A 3BHIA 1DIAA 4A7PA 2PGDA 1W0CA 2QHXA 3DBLB 1E92A 3OH8A 4FW8A 2YUTA 5HS6A 4AG3A 2C29D 2QRLA 1NHWA 4TZKA 3BMCB 2Q1SA 3T4XA 1QORA 3F46A 1B15A 3H65A 2VHVA 2WM3A 4ROSA 2FR1A 2IDZA 2IYOA 4U5QA 4HX5A 4BS9A 5JAMA 5JMPA 2GZ2A 2FWMX 3G1TA 5G0WA 1P0CA 2YV2A 1KC3A 1YGYA 4JJGA 3U0BA 4DWVA 3PTZA 2JAHA 4TRMA 2Y1CA 4DIFA 4R01A 1P1KA 2W90A 3VZRA 4KUHA 3NDRA 4D44A 5BT9A 3ON5A 4A73A 1R4NB 4J16A 1GD1O 3GH3A 3M6IA 2PKQO 1EDOA 2VUSA 1Z7EA 4WNCA 4HFJA 2BFMA 2FSVA 4BGEA 5JAZA 1U8FO 1LSUA 2I3AA 3LYLA 4BNGA 2QYTA 2VHYA 1LEHA 3ZNQA 4E13A 5C37A 3KVOA 1K2WA 1ZIDA 3DO5A 3QA9A 3GGPA 4BGVA 3JQBA 4YBZA 4K1LA 4CM1A 1ZEMA 1H9BA 1DBVO 3L4BA 3UOGA 3JTMA 4YT2A 4HV4A 2C5EA 3AUTA 4DLLA 4XB2A 2VRBA 1DC5A 4GBJA 3DBRA 4NBUA 2DFDA 4UEKA 1CRWG 1Q0QA 4PLWA 3C7DB 3OA0A 3I83A 5JSFA 1LX6A 3E9MA 2GRAA 3NGLA 3JQAA 3BXXA 3ZZNA 1KVQA 3O38A 1LLQA 2IEBA 3ENNA 4WE3A 4ZRMA 3V2UA 4D0SA 2CFCA 2DU8A 2WD7A 3I3OA 5A5EA 3PWKA 1JTVA 4CLRB 4CLRA 1PZHA 2QZ9A 5ENDA 3N7UA 4MDHA 4QQRA 4Z9YA 3WMXA 5BR7A 1HDXA 5DULA 2GN9A 1YJQA 3QHAA 4M54A 2FZWA 5BNIA 3DZBA 2DPHA 3A28A 3H6KA 3OQBA 5EL0A 1CQIA 4I08A 1D1TA 5K0ZA 4WPGA 2XAAA 1PGQA 1R15A 5FYDA 2CNBA 4IDAA 1EFKA 4NH4A 1HWYA 2AQIA 5A3VA 3ZWBA 4GLLA 4YJFB 1EBUA 2DAPA 2Q2VA 1H9AA 2DTEA 4K9DA 1HEUA 1ZUD1 3QIVA 3ZCXA 4LMPA 4TKLA 2EGGA 5ICSA 1X7HA 1WXDA 5CHEA 1J49A 1E7SA 1I3LA 2AHRA 3NGXA 3G3EA 4Q3EA 3I4CA 2VYVD 4KUEA 3VH3A 1S6YA 3KUXA 4EI2A 1LNQA 2OBYA 1EVJA 4MIYA 3ETDA 1TLTA 1Y8RA 4HNHA 3DR3A 4BNHA 4QTZA 1HLDA 2WYVA 2ZCUA 3CE6A 3SC6A 2UAGA 4LK3A 3K30A 1KOLA 3PVZA 4OH1A 1UZMA 3KV3O 3KYBA 3GRPA 3HJAA 1A4UA 3WG9A 3DXFA 5L40A 2J5QA 1BDBA 1YQGA 4ALKA 5JDIC 3QVXA 4BNNA 4HXYA 5TS3A 3OJOA 5F1KA 4OOEA 1LLDA 1QV7A 3GA0A 4J4BA 4WOKA 3CSDA 4NBTA 1HDZA 4YDRA 3GNQA 2V6BA 4Y6PA 4QT0A 4CLOA 4XYLA 3GN1A 1VKNA 3BMNA 4LGVA 1FDUA 4CM9D 1RM3A 4UUNA 1C0PA 2C5AA 4Y67A 3MZ0A 2CF5A 4GX2A 2PA3A 3ZU4A 4P4LA 4OGWA 4YACA 1E1NA 1RYEA 3AM4A 2X5OA 4AJHA 1DOHA 4YAEA 3Q3CA 1GL3A 2PZKA 1GUYA 4JBIA 3U4CA 1EQUA 1G6KA 3CINA 4CMBA 1IUKA 4WLNA 2NU7A 3WGGA 4BO9A 1K5HA 2YQ5A 2HKIA 5B4VA 3ITKA 4D3SA 4B4UA 3AI3A
chains in the Genus database with same CATH superfamily
2NU9B 1Z8NA 3DVAA 1SQFA 1YH3A 1ZW6A 2QG9A 2CHFA 1RPTA 1JIUA 2Y4NA 4HS9A 4Q3OA 3UT6A 1OT5A 1FFDA 4IVRA 2ZZNA 1LFDB 1CT9A 1A9XB 1Q2UA 5J1SB 1MZVA 1U7HA 2QU8A 4XX0A 4B4WA 3OICA 1PDOA 3U7QA 2MSLA 4XWOA 3G2JA 3QLJA 2HMUA 3TM4A 2R4QA 1JEQA 1O6GA 1P7WA 2I1VB 3TKAA 3B6MA 4P38A 2YWBA 4EMBA 5KEIA 1IY2A 2IYZA 2W7TA 2X2OA 3DUFB 2A9VA 2BMAA 2LCFA 2XOXA 3LZ6A 4DG5A 2VAPA 2FUG1 4M98A 3ORRA 4HUTA 2FJ0A 5FBHA 2P9JA 1KZ9A 4Z9XA 2A78A 3AB3A 1H2AS 1L5RA 3TZCA 1X8XA 1W19A 5COQA 3COWA 4KR9A 3SFZA 2OUKA 2C9YA 4JLSA 3OP1A 1RQRA 3P27A 2QI9F 4HY3A 2J45A 5FTJA 1TVCA 2RHRA 1G8KA 4IS3A 4W9MC 4RZ2A 3KPYA 4NSNA 1UXOA 2WHRA 2RFLA 2PH5A 2BWJA 2JLWA 1Y9JA 4RJ2A 4C0BA 2I4OA 5T8KC 4YWHA 5MN4A 1IYZA 1S7GA 4XR4A 2ZIXB 3GGCA 1WWKA 3ZI7A 3ZXIA 3STXA 4I4TF 3DYIA 1DOZA 5TQVA 1ISJA 4Q1VA 4JVMA 2XRFA 3H5TA 3N6VA 1AK9A 1YBHA 1XNQB 5EIAA 5TGZA 3OQVA 1Q0LA 3E22B 1M1UA 4KLAA 4DDMA 2EW8A 2FF5A 2MHCA 3C1TA 4FTWA 5HJ5A 3LY5A 1WP9A 4B4KA 3KSBC 3G79A 4QZVA 3HVRA 3GJ3A 3LXMA 4B5LA 2VK1A 4ENPA 1X7XA 3AUXA 4YPOA 1WXGA 1E5TA 1ZSVA 1VG0B 2CV1A 4HF7A 1CNMA 1JECA 2VHZA 1JJFA 1D6NA 2Q3CA 1OR8A 3K8OE 3NEJA 3NBMA 1O96B 1G5RA 1P8AA 4FJ0A 3TLAA 3OIDA 3M0EA 5FULA 1RC0A 4HP8A 3ASVA 4KXXA 2VUIB 1KBQA 3N2KB 4BNDB 3KKMA 3CF4G 2QUJA 2VJKA 2VQSA 5JY1A 3QU9A 4H3HB 4TTVA 2ZP1A 3Q1LA 4V3BA 5HG0A 1AGPA 3KQPA 1KR2A 3QVMA 1ZJ5A 4MR9A 2ES4A 4AYWA 2NLOA 4E4RA 4OKIA 4DIOA 5KCMA 5B58T 1AKEA 4G23A 2IKQA 2CNNA 1SHKA 3IA2A 4LWZA 3QRWA 4W5RA 4Z4QA 2WQ7A 4OMCA 3T6KA 2UZ1A 2RGCA 3NWBA 4JITA 2QTNA 2R84A 2VRNA 4P3XA 3EDRA 2M6RA 4CCSA 2K87A 3ZI4A 3FZEA 5ED0A 3FZGA 1PKXA 2UYGA 3K1AB 2BJWA 4O25A 4YLEA 1WMEA 3O4IA 3UYKA 3ZLUA 4RM3A 5G41A 2IU3A 2GILA 4QUGA 1QDUA 3UG7A 4JUIA 2HK9A 1HDRA 3QNMA 3UB3A 1DAHA 1CY1A 4EPRA 4L57A 5LKAA 2DCUA 2O8DA 2ZT5A 3QLUC 4F04A 3C6QA 4F1JA 2PRKA 4GDMA 5BWNA 1JEEA 5C7OO 4MVXA 2BJVA 1F8UA 1X8KA 3B5JA 3U44A 2G4LA 2BR4A 1ZK4A 9MHTA 2O3RA 1JKJB 5KTKA 3BQMB 1TKBA 2FZ4A 1XLTA 2WJYA 4PX2A 3LP8A 4FZJA 4ME6A 1G0NA 3GH1A 1V11B 1A2QA 3LPCA 4JI6B 1E63A 2D2VA 5DBEX 3H9QA 5AO9A 4DMRA 4W9NC 5JYBA 1TIBA 2RKBA 2I2XB 4I4CA 3ZK9A 2IEZA 2QQFA 2QV7A 3M4YA 3SHTA 2HAEA 1MRSA 2PFGA 3C6XA 3I37X 3SAJA 1VFPA 4ZZ3A 5CB0A 1FUYB 1NMQA 4K2AA 3U7EB 3ZWOA 2FPSA 2FSSA 2JBHA 3PGXA 3Q2KA 3D6JA 2ZVQX 3IAFA 4NCBA 3Q8LA 3LBHA 1PGJA 2XWSA 2PGLA 4K9NA 1DBQA 4DCJA 2BN4A 3U4AA 2IQIA 2EDAA 2OOSA 4D92A 3EXIA 3LX4A 4YUAA 4TS3A 4JC8A 2HMVA 3L0DA 1YRLA 5EMHA 3WGTA 3WBFA 2VDMB 4K1XA 4KJZA 3OEED 8ADHA 4F21A 1QWSA 2G4CA 4EHHA 1E9VA 3CRRA 5AVYA 3LT0A 4M49A 2WVJA 1L5HA 1Y9ZA 1QO9A 1JPJA 3HR4A 1GQFA 4OTZA 4QSHA 4R2WA 5D51S 3VPAA 2J0SA 2ECQA 3QUTA 5K3FB 4C2AA 4DYVA 3U0VA 5JCOC 1XMPA 5KUTA 3EPAB 2RIRA 4XUCA 1EFVB 2IPLA 2ZBGA 4IIJA 4PBSA 1NUPA 1YOVA 1JPNA 3JYQA 1IHXA 1HYGA 1RZRD 5ECWA 4M37A 5E6RB 3EEIA 1PG5A 5DP2A 2EJVA 2VYQA 2DKNA 1WKCA 4I3FA 1PJ2A 4X94A 2HXGA 2XCLA 4EFDA 1LV8A 4ARCA 1FJ2A 1YDMA 2HA7A 2IHVA 3A7EA 4PFJA 4XSVA 4QDOA 2BBSA 2YC4C 3K6SB 4EHLA 4GR9A 5TR9A 5JRJA 3NH9A 3HVIA 3LFHA 2BDEA 3ETJA 4KQ9A 3MTGA 2CJFA 1J2UA 1KQPA 3BGOS 3MM4A 4CODB 1K7YA 1NUUA 1X1SA 2DUJA 1EFTA 1WE2A 1GGNA 1U0EA 3K9HA 1QC5A 2D0PB 2OLEA 3SBOA 2JG3A 3PHBE 4WNIA 4C7BA 1KOGA 1U2ZA 1YAJA 3TB6A 3ZY5A 1HLGA 3C70A 1RSZA 3PFBA 3V2HA 3AKEA 1NF9A 3WNDA 3QF4A 4IJVA 3EG5A 1B0UA 2VXOA 5IPFA 2QD5A 5KC9A 3UPUA 1CE8A 3MCVA 3ZOZA 2L19A 2XMRA 4C1NA 1OPXA 5CB4F 1N0HA 2ZI7A 4WOPA 4LY6A 4WUVA 4LJLA 4ZD6A 1IVNA 3SP1A 1GKYA 4NZOA 3L5OA 4OKSA 3I9NA 3EQ9A 1CS0A 2VDOB 3A0UA 4FMCF 4R1NA 4J1TA 1N1DA 1SVUA 1W0JD 1Z5OA 4KE6A 1QH1A 2YHSA 1ZGGA 3AZPA 1DO8A 3UATA 3HPRA 3C0KA 1QQ7A 4BNJA 5K0LA 2ZRJA 4FYJA 1M0TA 2Z3VA 1QRAA 4R7TA 1FTNA 4B6RA 3JWEA 4QELA 2XZTA 5HM6A 2ZSAA 3ZIUA 5DSZA 3RHZA 4OHVA 4BFXA 1XELA 3HNRA 4D8TA 5JWHA 4DLWA 4MROA 4LFAB 2D7JA 4JL8A 2QYHA 2VDWA 3D2AA 3DLPX 3RYHA 3DD5A 4QT4A 4PY2A 3ZGNA 3PNQA 2FG5A 2HGZA 1P7ZA 1Y8QB 2CK3A 1C3JA 2VYND 2WHPB 2XITA 3CUYA 4R51A 4YMGA 1ELOA 4V1CI 5I48A 4DXHA 5TMEA 4ZDIA 4UXJA 1Y3FE 3ZHBA 2ZS7A 3OMXA 1G3RA 3FJ1A 1SBQA 2CMKA 4G0NA 3HFRA 1NYRA 1YR8A 1T15A 3L05A 3LQQA 1N2EA 3IUNA 3LCVB 3S1SA 3G9ZA 1R10A 1KPHA 3IA7A 2XB8A 4P86A 4HT3B 4ZK2A 3HXQA 4JJ7A 3AKCA 1CPYA 1SCBA 3FUUA 4O4HA 1U7ZA 3PL1A 5T67A 4EG6A 3Q9UA 2ZCJA 3HTXA 1E98A 3L9XA 4YJFA 3AILA 4LDPA 4GOLD 2WWGA 3V1MA 5KMGB 3RE1A 3Q7RA 5HIJA 2QL7A 4JLAA 5M29A 1E1QD 4WXYB 3VOBA 4KREA 3KSZO 4ZZ1A 1BMDA 5LIRA 4B09A 1QGYA 3JQ8A 3MWLA 4IIHA 3I05A 3PKJA 3HP7A 3IAM6 4O2LA 4PYRA 4Z49A 2QJFA 1IRXA 3PNSA 1ECLA 1ZCFA 2QP4A 2Y0EA 5E6RA 3ST7A 1XD2B 1E2EA 4QYWA 3PCXA 4ON9A 1I4EB 1LNZA 3ZD8A 1SZPA 1ITZA 2ZIAA 3RQSA 1GPBA 3HO8A 1N57A 2HSGA 4Q18A 5DHFA 3TW8A 1UC9A 4ENRA 3U7QB 5KYGA 1LQTA 1E2PA 1ACJA 2NXCA 5KYWA 2YMQA 1LD3A 4MA5A 2WB4A 5IF3A 4H3KB 4L78A 3LECA 3R09A 2WB2A 1Z56C 2HBZA 3WIVA 2W43A 3GAFA 5B2ZA 3VDQA 4NCNA 1V1MB 1JENB 3PUYA 4NE7A 4X20B 1C5KA 4EBBA 5BSKA 5H3CA 4ZYTA 1PRYA 3A1EA 3GRRA 5EJ7A 1JDTA 2X7JA 5A05A 2JKYA 3GJ4A 2XZOA 1ZQ1A 4UAJA 4UBOA 5JROA 1V1RA 4ND6A 4PX5A 4RD6A 4IXWA 3WKBA 2VQFB 4GQBA 2Q5OA 2WTXA 4H7IA 3EN0A 1ZC4A 3MC1A 4FFSA 1EFVA 2Q6TA 2YS6A 4BXOA 3L8GA 5DBGA 5FOVA 1FYFA 2A67A 3WNVA 4JV5B 2ZTSA 3IALA 4WXEA 5DM4A 5IARA 4YS6A 4CEIA 1R8YA 2GVZC 4DLVA 1XQ6A 3BSYA 1E1RD 1CUFA 1XJQA 1A7JA 4W8GA 2ZUTA 4F4JA 4ZICA 1X86B 2H5JA 4UU7A 3RTGA 3I0ZA 2NOAA 4G5RA 3CIOA 5K0BA 5L3QA 2ATXA 3ESXA 3AY7A 3ZLTA 4QDTA 4EZIA 1JQ3A 2I80A 3UKDA 3L6DA 4I9FA 3AP3A 1VBNA 4Q7LA 5IBCA 3PQEA 1E1LA 1XF1A 1C4XA 1E3LA 4NFHA 1A71A 1QE5A 1Q6ZA 1RLJA 4KAFA 2YZMA 3ENWA 4YPFA 4YHHB 2C5GA 1A7KA 3R3ZA 4GOMD 3ZE9A 5EHZA 1LBSA 3JXEA 3PXXA 4HDKA 2RAFA 1R4MB 4BFLA 3PEVA 4AG5A 1I7BB 4AQDA 3PEWA 3M3PA 4ZTUB 2OHHA 3K5IA 1WD5A 2GHQA 3HYCA 1UKVY 1YB2A 4MUHA 3VAAA 1PG0A 1M1XB 3PHLA 2AR9A 2PS1A 3REQA 621PA 4LZZA 4I4LA 4CFSA 4US2R 5TRTA 1EVEA 4BO7A 3QEAZ 1KAMA 4EJFA 2CFSA 4IDQA 2X1LA 3C4QA 1PL6A 1RZVA 2J08A 2N9UA 2ZYDA 3E0QA 4WFJA 2H9IA 1DDOA 2GASA 4HNSA 4UUMA 3UFXA 4MCJA 3H5RA 1PNTA 4KODA 5KSZA 2LDXA 3BL6A 4MZDA 1NMZA 4MO9A 5EP4A 4KQKA 1N5MA 1UAYA 3DE6X 1RR6A 1U2GA 4WKOA 3R5FA 4QBGB 3GLFA 5JH7A 1MOPA 4RQBA 1GOTA 2G28A 5GPBA 4IYJA 4IRUB 4UDOA 3OU2A 5KX5B 1ORWA 2H07A 3LS2A 3QUSA 1S2LA 2CXUA 1Y8CA 4GQIA 2UZ3A 4DAOA 3RR2A 2HT1A 1G2OA 4Y0NA 5AOBA 1EMDA 1L7QA 1LK7A 1AKTA 4AG6A 3CISA 3N8DA 5K5EA 1YKFA 1I8TA 2APJA 2H52A 3FPJA 4K6MA 3NUGA 3V46A 3FPLA 1IULA 1MB2A 1J0XO 1KEVA 3CIFA 1XRMA 1Y4UA 2BLLA 2YNMA 4PQGA 2I6XA 2Q8NA 5G40A 2V0GA 3MMSA 1JTFA 1WSAA 5TLSA 5LBTA 1RMQA 1NJGA 1T0IA 1WD7A 5JDIA 3EP4B 3WB9A 1LBEA 3KPWA 2GEUA 3RS3A 2LP4Y 5EE3A 3HBAA 2A94A 1C9MA 5H81A 1TAGA 1QYXA 3WISA 3VH4A 3HPQA 3FKSA 1TT5A 3KB2A 4DLUA 4X41A 4LI3X 3IOYA 5J59A 1O9HA 5DBHX 1XRQA 2WV9A 4E6EA 5ALGA 1Z3CA 2HRDA 4AKSA 5KOJB 4L8FA 5DN6D 1ZI6A 2RGDA 3D4BA 4Q9NA 3RBXA 3KGDA 2XEDA 4F3RA 3UJ9A 2YFHA 2RHHA 1PR1A 1CJUC 2R751 4UCXA 2H4HA 5JPIA 4MP6A 2CXRA 1J56A 2JGLA 2OUIA 4LXYA 1WAMA 2A9PA 3UQYS 1GADO 4LYHA 1AKNA 2I7DA 1J22A 3KELA 4OB8A 5REQB 5EE1A 3WXBA 2YR0A 1H5NA 1HTTA 3ZV7A 5IJ9B 5KKNB 2QZZA 2ZRLA 1K6XA 3ZJTA 2F9MA 3IXLA 5CU7A 1IATA 1J0CA 1B74A 1SBTA 1SXJD 1WF6A 1DFGA 2IDMA 2IZZA 4OXYA 5BNFA 1Q2XA 4BFUA 1PV4A 1XCPA 4BX8A 4TM7A 4FOPA 2JAWA 1CV2A 3EQ8A 4FQ8A 5TPZD 2AEJA 3OE7D 4G1BA 3RC1A 4KQCA 3TEJA 4G84A 4AJ4A 2BHRA 1UP6A 2GSDA 1ZY2A 4LXTA 2IXTA 5EYPA 4CF7A 1EIZA 2VNSA 2Y4OA 3OM9A 3AKZA 1ODTC 4MPTA 1W36B 2ZETA 2P30A 3F8SA 3M6XA 2PY6A 4PGGA 2BFBA 2MJLA 3LFTA 4ZIRB 4V1CB 3N2NA 1ZM4A 1ONNA 3OZGA 4UAUA 5DPMA 5B1HA 4BV9A 1Z0UA 3A9WA 1BX1A 1A97A 2AF4C 2O9JA 2X3FA 4YALA 3IUBA 2OPHA 1Z26A 1R6BX 5JJLA 4KBFA 4YX9A 3HK2A 5TT1A 4IYRA 4YJHB 2R1VB 2OAGA 5E2BA 3SDSA 3BA6A 4MSUA 3TGPA 3CUVA 2X4GA 4Z1MA 1FBTA 3EVZA 3SNKA 3VC2A 4CDGA 3OOYA 3E5NA 3U62A 1ZGAA 5EINA 1JHXA 2QE6A 1OHHD 3HO6A 2XNHA 1TJNA 2CL7X 2O0HA 4F8YA 4RTQA 5CNMA 3MEQA 3FRHA 5L8VA 3WP0A 3N0VA 5F7JA 4QOGA 3WL7A 5LYYA 1VSTA 2QN9A 1N5JA 4E22A 2QRGA 1R6AA 4EHBA 4CM6A 3M89A 2O8CA 3N0WA 4QGBA 4B6PA 2O1XA 5BSHA 3ZXUB 2P5SA 2V6JA 3NTUA 4EF6A 1Q7EA 4IHJF 4DMLA 3QZUA 5E8RA 1NVTA 3VR5A 1N8SA 1EA5A 1J1ZA 4NH0A 5ULLA 1P1FA 1K27A 3QK7A 3JWIA 2F3QA 3EVAA 1H3NA 1BDMA 4MW9A 4CKEA 4LC9A 5AYVA 1EINA 3MAJA 3STTA 3RIEA 3TMKA 5K0EA 1T9CA 2PBLA 3SF8A 1SOVA 2VP4A 1W9HA 4TXJA 4F0JA 2H4XA 5DX1A 2FAXA 3PEEA 2MSCB 3EPBB 3G9XA 3VU0A 4B9AA 1YCHA 1B3RA 1CJMA 3CZ9A 2G5PA 1OI2A 4Q9KA 4G25A 2OVBA 3RYTC 1VCOA 2B21A 2QD1A 4NMLA 1IBMB 5KQMA 2I1LA 2VOJA 3GRAA 1T6BY 4M1ZA 1X1QA 1YMVA 1DPGA 3S44A 3WLRA 5IU6A 1QJ4A 3G88A 4QUHA 3L7DA 2Z2KA 4JKOA 4B84A 5KYNA 3P2KA 2FWBA 1GM5A 3A2NA 3QWAA 1TK9A 3VJMA 2EF1A 1Y3IA 4X44A 2HPHA 3H6GA 1HLFA 4XX1A 3QKWA 1F51E 2OGUA 2OHGA 3M4ZA 1SHJA 5DO9A 3W04A 1YA8A 2VYCA 4Y6OA 4D8WA 2RCYA 4F3YA 1I7LA 1P2GA 2X8AA 3G2OA 3H2IA 3LLVA 4JSTA 4UMFA 2Q62A 5LP6F 1Z8FA 4DA6A 1CQWA 3HJHA 1Y8RB 4K86A 4MEJA 4N3AA 1PNOA 4G4SO 2V4UA 1WNFA 1RPNA 4DUGD 4NS1A 4L3OA 2HDNB 3K9WA 5JPCA 3AVXA 2BD0A 2YICA 3L0YA 1W5TA 2QLNA 1DFHA 5K8JB 2VNKA 4GGMX 4LF9B 1ZA2A 4I5GA 1F4LA 4LZPA 2NTNA 5EJMA 1G9TA 5A3QA 4X93A 3N6XA 3W9YA 3BE8A 2D4HA 3VUEA 1CVRA 3DOIA 4NDAA 4AY3A 1FC0A 4U9IS 2VR1A 1XDBA 2VK2A 2ZUDA 2NNLD 3CUSA 3FB4A 1R2QA 3WGIA 1TA9A 3HR8A 4GXRA 1Y3CE 1TI7A 2OBMA 2VK8A 4L9WA 4X3PA 5AKYA 5YASA 4Y8VA 5L3ZA 1SEVA 4OLFA 1EDZA 3TBFA 5HK8A 5H80A 1LF5A 1UADA 3O4HA 3ETHA 4CL2A 2C4WA 5FADA 3C6KA 4AW9A 4CW7A 3LH5A 3D8BA 3LSYA 1DADA 1QLJA 2WYIA 3SDZA 4Y9UA 3UZUA 3PYMA 5BYJA 4MQMA 1IBRA 4FC7A 1XL1A 3ESYA 3G2KA 4N7BA 1AQIA 2P2YA 2PUVA 4J07A 2YJNA 1GAEO 2OXTA 1NRIA 2BAGA 4L8WB 2PZFA 5JFOA 2QMUA 3IP7A 5CXUA 3DDHA 2BPOA 16PKA 1FFAA 3FNBA 2PV7A 2ZRAA 4A4DA 5C8VA 1MF7A 4DA8A 2BBWA 3KYJB 1KSGA 4KDEA 1VPDA 5AHXA 3VOTA 4FVTA 4GPTA 3U4HA 4GR5A 4O08A 1QP7A 2JFXA 4PC7A 3G0BA 4JVNA 1JHDA 4RABA 1HURA 4LWPA 4I9NA 1P2FA 2H6EA 2VJBA 1U0SY 2BR3A 4E0BA 2GO7A 5BSMA 4V03A 1ZM7A 3ZIAA 1ZN7A 1T5TA 4LE0A 5HF9A 5JBNA 4X64B 3MGBA 4B8ZA 4MV4A 3RASA 4Y98A 2WU4A 3UC5A 1ULTA 3BGIA 4BVLA 5IMSA 5LMNB 4YRSA 1Y42X 5EXDA 3IP1A 3LMKA 5I7AA 1NAHA 2JCBA 5KTNA 1Y80A 5JASA 4M1TA 2X14A 2ZIEA 5HZHA 1QF9A 1N8KA 3QSGA 4H6PA 1KYXA 1ZM9A 1OLUB 3O73A 4OHCA 1CLEA 1KKLA 5G53C 3DZ8A 5EHGA 5BUZA 1XNHA 2LW7A 2ZJ0A 2OBXA 1HSZA 2Y1OA 1JJVA 3OPYB 2KQUA 5CR9A 3OPNA 3W8EA 4YR7A 1LSOA 3UXYA 3FOEC 2JIQA 4G0PA 4JENA 4UVEA 4UMEA 3MMXA 3QKRA 1I2AA 4LRWA 3FTFA 4QJ5A 3DLTA 5JCJD 3H7IA 1KVSA 1XCBA 2O2JA 3U17A 2ID7A 4JBGA 1O4VA 3GA7A 4LRTB 1UK9A 1UM9B 3H0VB 4RHYA 2GLUA 3C15C 1HY3A 3HKEB 1V6SA 1VSQA 4KTTE 5FPTA 1NDUA 2YH2A 4M7OA 3TLMA 1PHPA 1O0BA 4X66B 1MB0A 4N5DA 5I5GA 4C3ZA 3GEBA 4BDSA 2O2DA 3UAVA 3PGLA 4TTRA 2ZTLA 4CIDA 2QM8A 3A2MA 3O74A 2FPLA 4ZAGA 1WPRA 4PG5A 3VPXA 1PR5A 1MB3A 1LPNA 4YP5A 1ISRA 4G1FA 2PT5A 4HPJB 3FE2A 3BD6A 3GCZA 1X3SA 1U4SA 3OOHA 4ICIA 4NCHA 4YMIA 5ERXA 1RRGA 1TADA 1MA0A 4NZNA 5DHTA 5CA0F 2Q28A 1H3EA 4RTJA 1P33A 1OJLA 4MVJM 2PRSA 4ND5A 4JP2A 5CD9A 1QHHB 1YBFA 4BV2A 1ZOLA 1GZVA 5DTRA 1U1EA 4E30A 1D2RA 1HUQA 2HLDD 2OAEA 3PQ2A 3NBUA 4FDUA 3BF7A 2JHGA 3DYVA 3LCJA 3AL3A 1TYBE 3G9TA 1YHYA 4XVUA 4Y1EA 1U9YA 2FRVA 2BBTA 1M6VB 1NV9A 2GFIA 3RVRA 2DFTA 1Y3HA 4KVAA 4OOFA 1AQJA 5G0SA 1X0VA 4H35A 4XOUA 3WJ2A 2YYYA 2NSHA 2OY0A 5TC4A 3CVUA 3NHBA 3OZTA 2MYPA 2OTCA 4N41A 2YXBA 2WF5A 2JHFA 3OQPA 5KNBD 4LS3A 1YQWA 2C3MA 3HZHA 1AHNA 1TTTA 2HADA 3DKPA 5ARCA 3NV7A 3OE5A 4OU4A 2LXNA 3E3NA 1CVLA 2OV4A 2QZSA 4U2BA 4K6OA 2WG0A 3VOAA 4YMTA 2ZYSA 5LA6A 1Q7GA 1GPUA 3DB2A 1TGVA 1E2GA 1QIIA 2TMDA 3PC8A 4OMUA 5F1YA 5TEWA 5AM1A 2JZOA 4MW5A 1Y7LA 4CNQA 5IN4A 1MO2A 3TDMA 3TS1A 3TUJC 3RU3A 1ZM3A 3O4RA 3IJRA 4LCJA 3GVXA 4PYMA 1CNEA 2LNDA 5A6SB 1QMIA 1IE3A 2ZW9A 3DAFA 5LDGA 3RS9A 4P7KA 4YT5A 2JH8A 1Y3BE 3UK2A 3A3KA 1RP1A 2O8NA 3A3YA 1JR3A 3R0JA 2V7QA 1PCXA 5T5QA 2XBMA 3U7JA 1A8QA 2RB5A 1ZVQA 1T5LA 1Q77A 1LKZA 2JI4A 1EFPA 1NBWB 4WOBA 1AU9A 3V7WA 1G64A 5HNKA 1PV2A 3SHQA 2YNMD 1SQSA 2QY6A 3DZ3B 1GV1A 3OPVA 5BYBA 1CCWA 4ZGWA 1KDOA 2FUKA 3IB3A 3CF2A 2IYPA 4DS3A 3NHRA 2ANBA 1BNCA 3AB8A 4KVZA 2AVDA 3ROMA 3SPXA 4PFSA 1XT6A 3OSZA 4WOCA 1CR6A 4XXHA 1ARZA 2O07A 5IVHA 2P67A 3TKYA 3DHEA 1XPUA 1UC8A 2Z0MA 1ENYA 3RUCA 3GLHB 4NQRA 3AFMA 4HXFB 2Z3ZA 1QR2A 1QKKA 4IVPA 2X19A 3HJCA 3COJA 2BUAA 4CVNA 1HRDA 4LFBB 2R62A 1KZ4A 4HUQB 1O6CA 2HT6A 5DHUA 1WY5A 2BF4A 3BMNB 1R0CA 3N7AA 5CH3A 4LYAA 4PIMA 1TO2E 2VPTA 3PQFA 4ER5A 4MTCA 4DR2B 3C3MA 1ODIA 4MUIA 3S55A 2WWHA 1ZPDA 2O6HA 3EMVA 1IBLB 3OF3A 3B8EA 1NP7A 3ZWVA 1DP4A 3LDHA 2J9FB 1S2DA 1SUFA 2ZQZA 3RSCA 4EJ0A 3BJRA 4NDZA 3SQOA 2Q4BA 3ONNA 4DXDA 2RH4A 2C7VA 3WDKA 1HOTA 4JNCA 1G5IA 1M5UA 1XP8A 4H1WA 5JLJA 1D07A 1AMNA 3AEQA 3LUAA 4LVOA 4WA8A 1Y33E 1OGYA 1N77A 2QBYB 4NONA 2IUYA 4RH0A 3SEAA 5T3YA 1FYXA 1XYVA 3TB4A 3VV3A 4L9RA 3KEOA 2XGOA 1XFDA 2WZBA 1JQDA 1THTA 1XZFA 1N2CB 3C85A 4EY5A 2QRZA 5GGYA 1N25A 2JI8A 1M2KA 5FFNA 2CD7A 4CQMA 1BRMA 4NHOA 4CEIB 5KVAA 5CEJA 4LZWA 1XTIA 3AUYA 2GCOB 5LDHA 2IDJA 3BWDD 4EUNA 1L3BA 5JSQA 1XXLA 2HMTA 3TO5A 1VC2A 1MCZA 2Y05A 5C7IO 3KQVA 1SK8A 3BXFA 4OAOA 2CXNA 1MGPA 1FNSA 3L0PA 3M6UA 4OYRA 2IV2X 4J7XA 5IXJA 4DNFA 3R7BA 3ZHVA 3RB8A 1R9MA 4MJXA 5ENVA 5GGXA 5DP1A 5LQAA 3VR3A 3PXAA 3TLCA 2WJHA 5DRYA 4L50A 3OZWA 1H5UA 1OKKD 1VCMA 2XTMA 4W5NA 1SIWA 4U02A 3WFIA 3FSRA 3F6RA 2RGXA 1RD4A 1DV2A 3PRHA 4PSCA 3UOAB 3V55A 3EDQA 5JEDA 5ICFA 3T61A 5FIUA 1DCMA 1YRYE 2PSJA 3TL6A 1KDZA 2Q3DA 1E2HA 2ADMA 1NULA 3EA0A 2ETVA 3ODPA 1XLVA 5CLQA 3WL6A 4EW1A 4YYZA 1WIWA 4RKFA 1L7NA 1FP1D 3OLZA 3EGXA 3CNHA 2V65A 5KJ1A 1KZ6A 3UT5A 4IWNA 4E07A 1YS9A 4QHSA 4WBXC 4TLLB 4UBNA 5TQ2A 2Q4RA 4E6PA 3ZD7A 1EQ2A 3VMFA 4YCDA 4JODA 5AXDA 2QM7A 2YZNA 3L1IA 2EKLA 4UMDA 1LY1A 3KSUA 1AB6A 3PQ7A 4FK8A 4B44A 2FQ1A 2GN8A 1GKLA 4JT4A 1PR9A 4Z4EA 4UBMA 4BPBA 5D1HA 3PT5A 4IFIA 3MT9A 5IZ4A 3GJSA 2GMWA 1DHRA 3K1ZA 2D7CA 4L6AA 4U6SA 5EG5A 1N7GA 2QTZA 4IDNA 4OJNA 3TLZA 5B1SA 5K3EA 1SU4A 3ROXA 2G17A 1V4BA 1V26A 1T5HX 2WR8A 4HH0A 2C7RA 4P4NA 5H82A 4ECAA 4TMWA 1GLGA 1XTZA 1ZVJA 3PNLA 4Y2JA 3KJNA 3SG0A 3W8FA 5IC4A 4DPMA 3IEIA 4A1OA 2QUKA 1K8XB 5JXJA 3J7AC 2XUDA 1X19A 2YWDA 2O57A 3PJRA 2XUOA 4PCLA 1VLQA 1XKQA 3EZXA 4ML3A 4EGSA 4KITB 5K6AC 3TFWA 1WEHA 4NOMA 2W22A 3JRWA 4R6WA 2WU0A 3NTRA 4ZVQA 1KJQA 1RTTA 2ZROA 3OBBA 4P3NA 4MDFA 4DOMA 1C4KA 1PR0A 2O5VA 2IYTA 3M33A 4LOLA 4O4LF 4Q3AA 4NJEA 5F5NA 1KORA 4PTLA 5CVJA 1MGOA 1VXRA 3AJAA 1D1SA 4LDRA 5LZ5A 3EG9B 4UHEA 2A6PA 1PFQA 3DFFA 4R8SA 1G20E 2GRUA 4N3BA 1FW6A 3O95A 4WACA 5E3JA 1VMKA 1KJIA 5IVKA 1AKUA 2W58A 4HLUA 2PKQP 1PEKE 4RGQA 1W96A 2HSWA 2AR0A 3TPCA 1FUKA 3D0RA 3EP6B 1G1AA 2NSLA 1WSDA 2CEKA 3E1GA 3O1JC 1O95C 1WVMA 4MB0A 1Y37A 1CJSA 1FFHA 1HE1C 4CEHB 2GDZA 2XWJI 2X8BA 3JD2A 4ECEA 4IF4A 3ER6A 3E70C 4QOFA 3K6JA 4PN7A 3CURA 3R5HA 1IC6A 3QELA 3V6MA 1I2ZA 2V7TA 4I8IA 4DLZA 3RGGA 2Z8XA 2J9YB 1MJGA 3M5DA 1H2HA 4RLSA 1OWPA 3LJKA 3ZGYA 2BI8A 2MTBA 5CFLA 1LBTA 2JHAA 1NRJB 3K70C 1ZIOA 1K92A 1SKYB 1VA5A 3DV0A 3GAAA 4G3XA 4MRRA 4PFKA 1GKKA 2MSEB 3OPYA 3AHDA 3MTQA 3O1IC 4DLAA 3VAZA 3RHSA 2W2NA 1EFLA 4J91A 1V1JA 4IEEA 1UJ5A 4LXQA 3WGNA 2VFAA 3WYCA 3BS4A 3Q7EA 4F6CA 3CT4A 1KYZA 4PYJA 1I2BA 1Y1PA 4G6ZA 3LHSA 2JCVA 2FPXA 3WGMA 2QTVA 3LL4A 3GPLA 3TCKA 2F4NA 4H7KA 5LMUB 2VSXA 5BMVF 1ZAYA 4BRUA 5AI8A 8LDHA 1J06A 1E8NA 2XCQA 1TMYA 4KLZA 1T2AA 2QP9X 3A1FA 3JQGA 2FOIA 3IBSA 3FZNA 5DBIA 1ESMA 3T54A 1IM5A 3CW2A 3GYBA 3L1VA 4FFNA 4DR4B 3TJMA 3ZQJA 3Q3JB 4FDMA 4B3TB 3CVXA 1CKEA 3AM1A 3UJBA 1E3EA 2DT5A 1A0OA 1CP2A 4TL6A 2YY7A 2PEZA 1N5RA 2ZPAA 4G4GA 4UU8A 4PLPA 4BB5A 1KEKA 3PX3A 1P4AA 4BO4A 2PS0A 3CJRA 1CY8A 1ENPA 2ZBFA 1VECA 3FIUA 4XJVA 1E4OA 3RT7A 5FWXA 1O1YA 5B5SA 2IBSA 1F8FA 1EJ6A 1K8QA 1M8FA 2IDKA 4LRUA 2AS0A 4R9UC 2ZWAA 1BE6A 1ZWLA 1FQKA 4HXGA 3WB1A 4DYHA 2Q5EA 3LC7O 3KCQA 4C0QC 4ITRC 4C6RA 4YRZA 3U3DA 2OO3A 4ZQIA 5EHQA 1M6VA 1XHEA 3UJNA 1XRRA 2BDTA 1U3GA 5J9FA 1ECPA 3LBFA 1QE0A 3L3BA 3L93A 1PEYA 2CYAA 1EUDA 5LNK6 2WFLB 4WN9A 3QVOA 5A02A 2VA8A 3GA5A 2X6TA 3JPYA 2O5RA 5AIBA 4PSDA 1U31A 2IA5A 3M1IA 1SUDA 3UY4A 4IGFA 5FL3A 2F4VB 2RJNA 2I3GA 2PDAA 3H18A 3NPMA 2FR0A 3JW8A 4QD3A 4B33A 1Q57A 3RC8A 2QBYA 1IMJA 4AS3A 1ADYA 7MDHA 3HU5A 1U5CA 1ZUIA 4DMGA 3DEAA 3GB9A 3MCWA 1IEVA 2FZ5A 3IUPA 1PX2A 1BVRA 4H17A 2IUTA 3OQHA 2EGHA 3TCNA 2ZRFA 3OZDA 3V8MA 3WMWA 4Y2QA 2AFIA 3ZCSA 5L53A 2W4QA 3OLVA 3WBKA 3V1YA 1LW6E 3DHWC 2FZCA 4CU5A 1YA4A 2HX1A 1TCVA 3IE2A 3KKQA 3MXOA 3OKPA 2JJ8A 3ESZA 3TZBA 3UWDA 4B71A 3H9BA 2FXVA 2OT3B 2AD1A 1XVAA 3AEXA 3NCHA 1NSTA 4BX0A 2NP7A 4HNAB 4EYEA 1CS4C 5T73A 1HE4A 1DWQA 4M1EA 5BQPA 4AN0A 5CFRA 2XA2A 4A6PA 5L6MB 3H5VA 1B2LA 2H57A 4IJKA 3CKYA 1S5PA 3PQVA 1UWLA 3MNFA 2SNIE 3FJYA 1QCDA 2PIAA 5AW6A 3CVVA 1ZSNA 5JVDA 2JIPA 3AY6A 4EEKA 2P35A 4B2IA 4EW2A 1WVGA 2QLFA 4AY5A 2BFCB 1PDWA 2GZSA 3BHMA 4FEEA 4TRRA 1Q1BA 1Z82A 3NOQA 3PUZA 4Y1RA 3T5PA 2P75A 2VS1A 2H3EA 2F3UA 4JX9A 1FE8A 5F9MA 1PJRA 3A6DA 3KQYA 4RA6A 5G4KA 4JBWA 1MVNA 3VSDA 2J4FA 3C3EA 2R6GA 4PRKA 2QAIA 1K3TA 4JLJA 1VKOA 3B20A 4OFWA 4POAA 3V9AA 2QRVA 1N6OA 1FSPA 2AJCA 4OLJA 4E11A 1OZAA 4FMBB 1YZNA 4Q37A 4P7JA 4RJJA 2JKZA 3SC2B 5IJWA 5EJGA 2B8JA 3K3PA 2P91A 1T3ZA 2LD4A 5FLXA 4EB8A 4EHFA 2C4HA 4NHEA 4L3VA 4LJ6A 2VUTA 1U3CA 1UDWA 2ZR7A 6PFKA 2HF9A 2AUTA 5B1IA 1XEFA 4OJTA 4EJSA 3HO1A 1ZQ9A 2E21A 4O0LA 3IJ5A 1TUBB 2ZZMA 4M46A 3MN1A 2K2QB 4GXTA 4M1QA 4MYTA 3RFUA 3GVPA 2YWCA 2VZ8A 4D74A 1G4UR 4BNYA 5CGZA 1LPMA 4RTRA 1E58A 2A9QA 1EX9A 2XYGA 1SVOA 4F72A 3DAPA 1N36B 1SQ0A 3ZY4A 1M7BA 3VZCA 3F1LA 4M9XA 3Q41A 1UPFA 1QMHA 3FR7A 1U63A 3DMHA 3U61B 3FCXA 4UHCA 3PGA1 3HN2A 4KLCA 4YCBA 1IPEA 4X1YA 2GZDA 2I3DA 2IUEA 2Z2ZA 5CUQA 3UENA 2OXFA 1NUHA 3IVAA 2P8JA 3MTIA 1M0SA 2GZ1A 3DZIA 3W90A 2AH5A 1D2HA 5AWFC 5B30A 5TIIA 1E61A 1S3SA 3GJYA 2XNCA 3WL3A 1BCSA 1N3BA 1P3JA 1TQ6A 3DKVA 4EMUA 5HYVA 3DL2A 5AK0A 2OESA 3OA2A 3MT7A 3PDIA 3GEDA 1NR1A 1DAIA 4UDXX 1JHMA 5FLYA 5GV7A 2PSHA 1OYWA 1WBBA 1BHQ1 3OFJA 1JXMA 4MMYB 3ABIA 4NK4A 5JXHA 1BMTA 5GONA 2J3JA 5WRFA 4Q05A 1NNLA 3AK4A 1R8SA 1R9JA 1PK7A 3P4UA 4UC0A 1YJAA 3FOCA 3IX7A 3LGSA 3LFUA 5FRDA 4JS0A 1CEEA 5BNTA 5JH7B 2ONCA 4UHHA 4JBXA 4X54A 2GF0A 2X7HA 2OFPA 5FBVB 2XYHA 3EWSA 2NQ2C 1UXGA 4ZO7A 4E4YA 1WDWB 3ZLJA 2C7OA 2WW8A 1KP3A 1ZJWA 3Q3VA 2E55A 2XQVA 4EG3A 3U4QA 4IZIA 3DM9B 1UP4A 1H22A 1QAOA 2YCBA 4ZOLB 4ER3A 5JYEA 4YT8A 1QONA 5U4QA 5BSVA 5HUQA 3BKXA 1V35A 4N54A 2FPGB 4NF2A 4GPD1 1HKHA 4YRJA 4W5WA 4BAZA 5LYJF 2I4NA 5HZKA 2YJZA 1T1EA 1LDYA 1PBNA 1VYUA 2XJ9A 3HDQA 4BVAA 3RAFC 1Z4OA 3UVEA 4CR6A 3P0HA 4F1WA 1UKEA 4JL5A 3L02A 5L9AA 3L7KA 1HQKA 1TT5B 2YQZA 2X1VA 1CDZA 4MV0A 5T4BA 4FYHA 2AD5A 3ADCA 4TVBA 4WHMA 2X9GA 4Z8YA 2C9ZA 2PTGA 3OC0A 4LTDA 3T5MA 2BH9A 3UJ8A 2P9CA 4GI3A 2PRZA 1GRQA 2BEWB 2J9RA 4PLVA 1AA9A 2C4VA 2HJHA 4RY8A 4XSGA 5EY5B 4ZYZA 4DILA 5BSGA 2YXDA 4OI4A 5F2OA 3JQQA 4KRYA 1XPRA 5AVQA 3IAHA 3ABRB 4W1RA 4YJ2F 3ESBA 1Z7BA 3M7IA 3T94A 3P4YA 1G8SA 2GYUA 1II8A 4ZI5A 2O5EA 2JGMA 2R5WA 3WGZA 2D1RA 2OO7A 3LHDA 5JANA 2Q6IA 3KO8A 4AURA 3AF0A 3ZU6A 1NZJA 2C2YA 1D2CA 3GLRA 4QFMA 4QLOA 4L16A 3UFXB 3U16A 5JZOA 2HF2A 4UUOA 4D9HA 2HL6A 3EWNA 1CZLA 1TL7C 1KI2A 4WJLA 5AUNB 4CIAA 4NMXB 2B3DA 4O2RA 1DBRA 3SIPA 4M7RA 3B85A 8ABPA 2Y93A 1KSFX 1VRWA 3KJHA 1H1TA 2ZGVA 2Y3IA 1AGYA 5HQ3A 3CHYA 4BLTA 2G07A 3CNNA 2JGRA 1T4BA 4FW9A 4BKPA 2X5XA 1WPGA 2OZVA 2Z6AA 1KY4A 5E4YA 4DG8A 2O2GA 1CUAA 4BQPA 2CDBA 1Z2DA 5FTWA 1WL8A 2ZJAA 3PDJA 4XIJA 3WKCA 4CF6A 2VJAA 3WZ2A 1MT3A 3GF4A 4DCNA 4RZ3A 2AJ8A 5AI6A 1AK1A 1E96A 1ODFA 2OGZA 4FSHA 2QD2A 4IIEA 5KVVA 2QRVB 3OMWA 2B7CA 2PL5A 3GUVA 5GQSA 3FM9A 4YV2A 4O2BA 3CX3A 5BYKA 1TM7E