5EESA

Crystal strcuture of dapb in complex with nadp+ from corynebacterium glutamicum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
247
Chain Sequence
GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
total genus 70
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eesA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eesA01
1Y8RA 2GPTA 1MG0A 3H3FA 1EVIA 1CDOA 2EXXA 3O8QA 1DRUA 3QIVA 3A28A 3C1TA 1ULSA 4IQ0A 3JQGB 3WB9A 1U9JA 4Q3CA 3Q9NA 2OBNA 4MKZA 2DQ4A 4B8ZA 3DBHB 3K6JA 1ISMA 4U6SA 3ZU4A 2CF6A 3F4BA 4GSKA 2RH4A 3IKVA 5T67A 2JCXA 3EK2A 3FPCA 3WQQA 4A0SA 3PIDA 1VL0A 2PKQO 2PWZA 5L95A 4RVHA 2CMDA 4QQRA 3P7MA 3G49A 3O26A 5JDCC 3VZPA 3ZHBA 5A9SB 4LW8A 4OM8A 3ORFA 3RIHA 2B69A 2Y1OA 4CUZA 1OC4A 2D4AA 5A1TA 4YA6A 3KUXA 2HK7A 3JQ7B 4RLSA 3OHSX 1QORA 4PLZA 4DVJA 4ILKA 4OIMA 2YV2A 3HUDA 5IZCC 3KETA 2FZWA 3V2UA 1ZVMA 1DHTA 2C20A 3GVIA 1PTJA 1LXCA 1P1KA 1QRRA 3BTSA 1YBVA 3WLEA 3Q0EA 3RC1A 2OFPA 2B5VA 2YW9A 2ZTMA 2W4QA 4GQAA 5G0VA 3ZNOA 2J6IA 1DFGA 3PJEA 1WWKA 3BMQA 4B4VA 1GUYA 1E92A 5A02A 1OI7A 2IEBA 3FR7A 3G0OA 4E32A 4MO2A 2BFOA 2DBQA 3C24A 3JQAD 2ZCUA 3LT4A 2QZZA 1NVTA 1XYGA 1UDCA 3O38A 2EERA 3GFBA 4RZIA 1MUUA 4DMMA 1GY8A 3WGZA 2PZMA 4ZHSA 4Q3DA 1TT7A 1XU9A 1QV7A 4AJEA 4D79A 4HADA 3OIFA 4BNJA 4BNXA 1E5QA 1LX6A 2OO5A 4YRDA 1RM0A 2Y67A 3ULKA 3WMWA 4O63O 2J5RA 2GN8A 4K6CA 4LMPA 4OKNA 2BI8A 2DU8A 3ETGA 3KLMX 4JX8A 1PJ3A 1N5DA 1YXMA 1WMAA 2EJVA 3LK7A 4MVJM 3O03A 2J5KA 4XB1A 4BB6A 1LBEA 4DPLA 4QTZA 4NPCA 1IUKA 4RF3A 4S3MA 4MINA 2HKIA 2GCGA 1P1HA 1X7HA 5CPFA 3CMCO 4GAEA 2AQHA 2QW8A 5G4LA 4UUOA 4N5MA 3T7CA 4XIJA 2QYSA 1U8FO 1CRWG 1E7MA 3U3XA 3WBFA 4R16A 1KY4A 4OXYA 1TT5A 2IZ0A 3MWEB 3GF4A 1HE3A 3SJUA 3WQRA 1NFQA 5IDYA 3TJRA 4NU5A 1D4FA 2PTGA 4S1VA 3PQFA 5C3MA 4HV4A 3D4OA 3PIIA 3DMYA 4GX5A 1U3VA 1H6CA 4ZD6A 4J2OA 4CMIA 2A92A 4IIVA 2QRJA 1SMKA 1EUCA 3IMFA 3RUDA 4UUPA 3X2EA 1DC5A 4UUNA 3WSVA 4DC1A 2QQ5A 1H5QA 4XA8A 4B4WA 5KCZA 4U0JA 4N7RA 1CETA 3PWSA 3GOHA 1ISJA 2D8AA 5IDQA 4XYEA 2BMAA 4BV9A 1EDZA 4W9NC 3KSZO 2O2YA 1T24A 5L7WA 3P5SA 3D3EA 4EYEA 4LRSB 4PLYA 4DRYA 1LEHA 2VN8A 3ETDA 3NX4A 2B36A 3PP8A 3EGOA 3QY9A 4Z9FA 1VSUA 1GEGA 5EN4A 3TZHA 2FMUA 5C5IA 4HWKA 5ITWA 2GLXA 1PGJA 1AUPA 5TRTA 3KYCB 1PEDA 2W90A 5JC8A 4I5EA 4PLHA 1OOEA 4XZ3A 4MVJF 1BVRA 5JPIA 3B70A 1HDYA 3RUCA 1QLHA 3FSRA 4PVDA 1HYHA 4B4OA 1LLUA 3AY3A 2J3HA 1Y7TA 3FWZA 4BKUA 3SC4A 3GEGA 4GLLA 1FMCA 3K92A 4MP3A 3PTZA 4Z0PA 1P1FA 5KVVA 3CUKA 3NDRA 1I33A 1HLPA 2J8ZA 1WDLA 2PD6A 1U2DA 1W6UA 3BAZA 3GVPA 3P19A 5JYEA 3AM5A 2UYYA 1R16A 2H6EA 4BUCA 4HY3A 1OBFO 4PLFA 5ER9A 1B15A 5TIIA 3S2IA 1PWXA 3A4VA 2Q50A 1N7GA 3NT4A 3ZU5A 4XGNA 3DL2A 3AY6A 3F6YA 3ENNA 2CSUA 3TNLA 4IJVA 1MXHA 2C5AA 1PJQA 2OOSA 3AUTA 2AW5A 4NK5A 3TSCA 4BNTA 1YOVA 3PEFA 2H1SA 2ZIZA 4KUEA 4MVJD 2IODA 4J7XA 2DLDA 1U3UA 2FPIA 1ZMOA 2FHSA 4FFMA 3CINA 4TKLA 4R5HA 4MVJG 1QSGA 3OJOA 1Z73A 1YGYA 4D3SA 1HZJA 3FD8A 3TPCA 3ANNA 1W4ZA 3V8BA 1QXSA 4MVJH 1J5PA 3QWHA 1HDRA 3WR5A 3ICPA 1QLJA 4MIEA 2Q1UA 5EERA 3DTYA 3SBOA 1LTHR 2VYVD 4FOSA 5JO9A 3ZU3A 4FW8A 4CQMD 1NTOA 4MVJE 2IZ1A 2V7PA 1GL3A 3W8DA 1PJSA 1FXSA 4XQEA 2RIRA 3GDOA 4TZTA 1EVJA 4BO2A 3QVSA 1JKJA 3JYPA 4IUYA 1B2LA 4KUGA 3RC2A 4XEHA 4OAQA 1EK5A 5L7YA 2ZKLA 3I5MA 4JQCA 4ZQGA 4MP6A 3B6ZA 3TN7A 2O7QA 3SX2A 1GR0A 1HF3A 3ZNPA 1F0YA 3W6UA 1MA0A 2JKVA 4BL5A 3D4NA 3DHEA 2GASA 2QRKA 3BMQB 3T7EA 2DBRA 5G0TA 3S1LA 3NEPX 4ZN6A 2RH8A 5JAMA 1TLTA 4XIYA 3GNTA 1M66A 1IHYA 3PFWO 5ICMA 2NVUB 5CDGA 5IXYA 3RUAA 4DLLA 2OHXA 2WWRA 4Z3DA 3PHJA 1CWUA 4EJMA 1PJ4A 1Q0QA 2UUOA 4BNUA 1YBMA 1H0KA 1C3VA 3QV1A 3ZWXA 3CXRA 4EJ6A 1AN9A 1PQPA 4YEDA 3D5TA 2IRWA 1P31A 1J0XO 1PIWA 4WUVA 3ITKA 2X4GA 3X2FA 1ZSYA 3Q1LA 1ZK0A 4FIZA 1VJ0A 1B3RA 1YVEI 2O7SA 6LDHA 5JO0A 5DT9A 2AG5A 3NAQA 3WX0A 2OL4A 3IUPA 4EEZA 1E6UA 4MKXA 4JBHA 2ZTUA 3P2YA 4W99A 3IJRA 1B8VA 5JNLA 3FBTA 8LDHA 5JAIA 3DOOA 4E33A 5HS4A 1QYVA 4NFYA 4TRNA 1NQ5A 1VKOA 2FSVA 4E6PA 2Y93A 2Y0CA 5F5NA 3HQ4O 1KEVA 4B4UA 5JYAA 2G5CA 1UZMA 7ADHA 4WJZA 4W6ZA 3JQEA 1JWAB 3EHEA 1N7HA 3W4IA 2OP1A 3AU9A 2X5JO 4ESOA 3PJFA 2POQX 3JQAB 1SEPA 1SEVA 1ZK3A 5FEUA 3K9QO 1NYTA 4DYDA 3RUEA 1H9BA 1NNUA 4RPGA 2WSBA 4NBRA 3BMNA 5DNAA 1PQUA 1P3DA 4TRJA 3DBRA 2VRBA 4YJFA 3SJ7A 1ZEMA 3DAFA 3MJTA 1VM6A 1E77A 3BMOA 3LC7O 4FS3A 4CR8A 1GFSA 4XQCA 3E5MA 1HDGO 3KOUA 1HXHA 2IYPA 4Y98A 3TOXA 3QLJA 2BGMA 4WECA 5L4LA 4EDFA 2O4CA 4DLAA 1Q2XA 4OMUA 1XQ1A 3CH6A 3ZGYA 1KERA 3FTPA 4E3ZA 5TS3A 2C54A 2O3TA 4RPHA 2PKQP 3M2PA 2VUTA 5ES3A 3JYOA 1JAYA 3QA9A 3HB4X 2HRBA 3VKUA 2NVUA 4BNYA 4CV2A 1LNQA 1A71A 1Y81A 4WLNA 5JS6A 2NTNA 3GPDG 3D4PA 1GAEO 4J4BA 2C5EA 2DTXA 3GGGA 2C2YA 1U7HA 3Q9UA 4X54A 4CUJA 4NQZA 4ALKA 1D3AA 2BD0A 4YTEA 3C3XA 4LK3A 1H9AA 3LQFA 1G0OA 1XEAA 4RVSA 1SAYA 3WGIA 2YY7A 5F3RA 5HTOA 4JK3A 1KVUA 4D0RA 5EQFA 4A27A 3I9JA 4IDFA 2QHXA 2FZEA 1LQUA 3PHIA 4P38A 1HDXA 4AICA 5C37A 2EKLA 3I52A 4NBUA 2EW8A 1R6DA 2JHFA 3BA1A 1X15A 3GDFA 3RAJA 5T73A 1OAAA 3MTGA 1BTOA 4IGFA 4WLFA 2D2IA 1PSDA 2VZ0A 1E3SA 4L74A 4MIOA 4OHUA 1T2CA 3PPIA 2ZTLA 3WWZA 1SOVA 4IDBA 4URFA 2JCVA 5CDTA 1CJCA 4GX1A 3RU9A 5EESA 1ZO8A 1UP4A 3GNSA 3NRCA 3WOHA 4RO0A 2NTVA 4XWYA 4DGSA 2P9EA 2GO1A 1QKIA 4EW6A 2VOJA 3F1LA 4FFRA 4EJ0A 1YDEA 5IDXA 1Y9AA 1WPQA 4WLUA 4YQYA 3KYBA 5EL0A 3C7AA 1Z45A 1VPDA 4EITA 2BFMA 5KVSA 4OSPA 4CMAA 5COQA 3H5AA 3NYWA 4ZVVA 1T4DA 3NDIA 3ZHXA 4W9NA 2P91A 5AOVA 4K6FA 1ONOA 3Q11A 2PFGA 3GC6A 1MB4A 3NV9A 1GD1O 3BMOB 4A7PA 4BVAA 3MJSA 2QYTA 3D3WA 3GMDA 3GHHA 3DTTA 5L51A 3GZNB 4L75A 4RORA 2BHLA 3K31A 4U8GA 3PHHA 5A05A 1DBVO 4D7AA 4OL9A 3DC2A 4HUJA 1IOLA 2BGKA 3ANMA 2OGUA 2GR9A 4TKMA 4J4HA 4CR7A 4J1TA 1A9ZA 1LDEA 2ZCVA 1ZK4A 5JBIA 4Y67A 3L4SO 3ONFA 7MDHA 5JCXA 2E82A 3FCOA 2J3KA 4BKOA 1CF2O 3COSA 1BXKA 4DPMA 1PZGA 3LLVA 3G1UA 3QW2A 3NJ4A 2ILTA 3HWRA 3INTA 1AXGA 3KYCA 1P44A 3PFFA 4CMKA 2Y66A 5BSEA 3S2GA 2EG9A 1HE2A 5IZCA 2IDZA 2YV3A 2Q1TA 5KVQA 1O8CA 1WDMA 3VPHA 3OFSA 1C1XA 3U49A 3MEQA 2WD8A 4BQPA 3LLSA 3E1KA 1GPDG 4F6CA 1JLLA 4DBZA 4BO7A 1Q7GA 2C59A 2Z5LA 4GGPA 4JIGA 4WKGA 2Z1NA 2O2SA 1JW9B 3PHLA 3L6DA 5ENVA 4A26A 1IZ9A 1JDJA 2AQKA 4RQTA 1RM4A 1OZAA 4CLHA 2BELA 1DRVA 1D7OA 2VHYA 2LDBA 3HDQA 5C7LO 4WEOA 4CR6A 3I9LA 1Y9EA 5THKA 1R15A 3ZCXA 2LDXA 1E7RA 1ZJZA 4IDGA 3GVXA 5T8KC 2HK8A 1QYCA 5L45A 4YT5A 1EVZA 1N9GA 4LVUA 3ADOA 3VH1A 4NZ9A 5JMPA 3FBGA 3PQDA 4P4LA 3U4DA 4BNZA 4WOKA 3WGQA 3I6IA 4IQ8A 4CQMB 4GGOA 1Z7BA 3EVNA 3VKVA 1GZ4A 1B26A 2E4AA 1DC3A 1NHGA 4M89A 2CF5A 5GMOA 1LA2A 2DPHA 1U5AA 2PKRA 4P22A 5TX7A 4CM8A 5BR7A 3VVBA 3VTFA 4UEOA 2VHWA 5AXAA 3KXDA 3NUGA 4IIUA 4E30A 4NBTA 1CEQA 3AY7A 1MFZA 2GN9A 3C7CB 3E8XA 2NU6A 2OMEA 3ZNNA 4PG6A 1T2AA 1NQOA 1LJ8A 1P45A 1PJTA 4MPDA 3JQ6A 3E9NA 5HA5A 3WGOA 5KOIA 4AL4A 4WASA 2FRDA 4L73A 1SO8A 4XJSA 5JC1A 5CEFA 1EZ4A 2PNFA 4R69A 2Q49A 2P4QA 2X23A 3DXFA 3E9QA 5AYVA 5EINA 3RVDA 2PA3A 3NKLA 4ND4A 4GVLA 5L7TA 2NM0A 1GZ3A 3KTDA 1P1RA 4RQUA 1B0AA 3EY4A 5IDWA 3QQPA 2FPGA 3EUWA 1ZH8A 3FHLA 1EVYA 4HFMA 1HSZA 1Q7CA 2IYOA 3ROQA 5JY6A 2EKPA 1YB4A 1GYPA 1U3WA 4IDCA 3JQGA 1B16A 2A4KA 1E1LA 3L0DA 5T8KA 5CHEA 1H93A 3GDGA 2AE2A 2Q22A 4KUHA 4AJ4A 5FFFA 3WWYA 3L07A 2DBVO 1HKUA 4PZDA 2XXBA 1GV1A 4E21A 1SB9A 1K2WA 2PGJA 4PZCA 2EGHA 3JD1A 4CLEA 4J0EA 4E2WA 2W2LD 3DZKA 3JV7A 2VNSA 4Y6RA 1K89A 3WGTA 1DXYA 3D7LA 3AU8A 4O5OA 3ZV4A 4KTTE 2O3JA 4ZJUA 2YUTA 4D3DA 2GDZA 2XOXA 3DZBA 3Q3CA 4I8XA 5F21A 4AJ2A 1R4NA 4H7PA 1F17A 1G6KA 1UR5A 1Z74A 1HSOA 4BO4A 1J6UA 3UH1A 3DBLB 2HMSA 2X0RA 4J16A 4RVUA 5A9SA 1P1JA 4YBZA 1GEEA 2X9GA 4JGBA 1EBUA 5CDSA 2GN6A 2EJWA 4IDDA 1CYDA 4KQXA 4GPD1 1PQWA 2VNAA 2PGDA 2FSSA 1GADO 4XKJA 3P2OA 4YYZA 4GL4A 3IS3A 4TZKA 2WTBA 4EZBA 3E03A 5BSFA 3KSUA 3WLFA 2ZB4A 3DEYX 1I32A 1NQTA 2I6TA 3M2TA 3NJ8A 4LGVA 1DIBA 1DLIA 2RAFA 4E2ZA 4EBFA 1Z6ZA 3TDKA 4M1QA 1LLQA 4NJOA 1Q0HA 4JJIA 4F6LA 1I36A 4I5GA 3H65A 1E6WA 1ENYA 2RHCA 2Z1MA 4BO3A 5KJCA 3OM9A 5DOVA 5BT9A 3NTQA 5FI3A 2UVDA 1XKQA 4YDRA 4RVGA 5K9ZA 4P4GA 5CP8A 3D64A 3UICA 1ADGA 4FGSA 5ICSA 2GZ1A 2GRAA 3WQSB 5I7FA 4E5KA 4RPJA 3U4HA 1NPTO 3GA0A 3RJ5A 3UGKA 4Z9XA 3DQPA 5DOZA 4J49A 3LT0A 3CE6A 2V6FA 2X5OA 4QUKA 1HRDA 1YOVB 3V2HA 4W82A 1GPJA 3UXYA 1BXGB 2BF7A 1P74A 1XQ6A 1VJ1A 4ND3A 1BXGA 1KS9A 4QT0A 1CIVA 4PZEA 2BLLA 4XYMA 1X0VA 1N92A 1PL6A 2HMTA 2QX7A 2YHIA 3H3JA 4BO5A 2EGGA 3QVXA 5BNTA 3RC7A 2OBYA 1R37A 1DJQA 2PH5A 4UEJA 1NM5A 2X9VA 4QSMA 1YL7A 4LISA 2JFFA 4I1IA 4BV8A 3BTUA 3KEQA 2E49A 1K3TA 5CDYA 3OA0A 4B79A 2VYVA 1LQTA 3OIGA 4DREA 4R1NA 1PR3A 3OP4A 3ZDFA 1A4UA 3ENKA 1HEUA 1XELA 4IBOA 4RZHA 4OKIA 4IZHA 4IMRA 2B37A 1KVQA 1PGNA 4GMGA 3N7UA 4CLRA 1JTVA 2X22A 3A14A 3GLQA 1PGQA 4MOWA 1K5HA 4OYRA 4FOOA 4D42A 3RCBA 4PG8A 2PY6A 4CLDA 3ITDA 4A73A 5HWSA 2UUPA 2C07A 4KZPA 3WNVA 5TJ9A 3KB6A 3HNPA 1XA0A 1U5CA 2FR8A 3VZSA 2W2KA 2YFHA 3L77A 1PS8A 1XLTA 4RVFA 4YAKA 2ZYDA 3IAHA 5IAAA 4IXTA 3FWNA 3ZWAA 3OH8A 1UDAA 1I2BA 5DF1A 3WXBA 4CQLA 3WGYA 1K6XA 3N58A 1X14A 4XRRA 3ZW9A 4IDEA 1R66A 2UDPA 2AEMA 3B1FA 5GZ1A 3IP3A 1L1FA 1BDBA 1HETA 2HRZA 1U1IA 1LDNA 3K2EA 3VPFA 1QR6A 4MDHA 2B4RO 3GEMA 3IIEA 2CDBA 1H94A 2NLOA 5I9LA 5IFLA 2IXAA 3BMCA 2ZJ0A 1ENOA 2O3SA 3QRWA 1PWZA 3NGLA 4K9DA 2Q2VA 2Q2QA 1A72A 3L6EA 4E5PA 2NV6A 3H8VA 5IXSA 4NNJA 1ISIA 4HFRA 3FPLA 3GHYA 4H3VA 1DFHA 4I5DA 1U3TA 3INGA 1O6ZA 1SNYA 1RPNA 2J3IA 2P9CA 4U7WA 4BKPA 1HZZA 2Q46A 5G4KA 2D0IA 4NR0A 4DIOA 4Q3BA 3D0OA 4AJHA 2J5QA 5A5FA 1DSSG 4CM8B 2VWQA 1PJBA 1GTMA 2ZB8A 2A35A 3F3SA 5KTKA 4RPLA 5I9MA 1T4BA 1U4OA 3CMMA 2VRCD 4PLGA 2YQ5A 4XD2A 1F8GA 3GZNA 3OIDA 5KVCA 3NTRA 2GNAA 4HP8A 4R1SA 4D46A 3GK3A 1U7TA 4H16A 4IY1A 4ZRNA 3E6AA 1M75A 3UUWA 4BNGA 4WE3A 1NR7A 5TT0A 1E3LA 3M1AA 5B4UA 1K0UA 2NWQA 2EW2A 1PJ2A 3HFGA 1NR1A 3CZMA 4TMFA 4AJLA 1FJHA 3G1TA 2WE8A 4CPDA 1HYGA 2WD7A 4XQ9A 4CQMA 4R9SA 4FCCA 4RLHA 1GUZA 3N74A 4ND2A 4RGBA 4UULA 4D43A 4EUFA 1SPXA 2HQ1A 4NI5A 5AQ1A 3HN7A 3I1JA 3E18A 3MJ4A 1BRMA 1ZXLA 4YXFA 1A9YA 4FGWA 2VTDA 4CM4B 3PJDA 1H6DA 5LCXA 4K1LA 1YH3A 4BOYA 1EDOA 2CY0A 1VL6A 2O3UA 3H9GA 4U6QA 1PZEA 2O3QA 3JQ8B 4QX6A 2BFAA 1LRKA 2R6JA 3QWIA 3QHAA 5I9NA 2XF8A 3AOEA 1NPDA 5K6AC 5B1YA 4R5MA 4O1MA 4CM3A 5BNFA 3ABIA 4NK4A 2EF1A 1BW9B 1KVSA 3AI2A 3R1IA 5EPOA 2WMDA 3LF1A 3D1LA 2CZCA 1LLDA 1KC3A 3PWKA 1JA9A 1WZEA 4DIBA 1MP0A 1DJNA 5F1KA 2X0NA 1KEUA 5JY1A 2DTDA 5I8ZA 5KJFA 3A1NA 3U4IA 1V9LA 3JQFC 1LSSA 3KZVA 1DPGA 1DOHA 2VTEA 3KYDA 3HZZA 2FP4A 1NWCA 1HDCA 3VZRA 2ZYGA 5M6DA 5DCWA 4E0BA 5LDGA 3GNQA 1IY8A 3JQ7A 2X5KO 2NU9A 4E2XA 1EUZA 4BO6A 4YWJA 4XCVA 3JQDA 4O0LA 4L9RA 1KVTA 4YCAA 5DP2A 3HJAA 1D1TA 3HADA 3BHIA 3BMNB 3PWZA 4G65A 3OBBA 3LT1A 1TXGA 5G0SA 3H5NA 5U9CA 3LSYA 1UP6A 1DIRA 2VOEA 3GPIA 3V1YA 3ONEA 3EYWA 3HN2A 5DCUA 5T64A 3HDYA 3LU1A 4I5FA 5K6AA 3KBOA 3DO5A 1WAMA 1C1DA 1I2ZA 2EIHA 2CD9A 1B8UA 4XYBA 1F8FA 3A06A 4FFOA 2IE0A 1YQDA 4D3FA 3E5RA 2HUNA 5FI5A 1E1NA 4FSHA 3VDQA 4FFPA 2HMWA 3GUYA 3FNEA 2D5AA 1ISFA 3I9KA 4LRTB 2GZ2A 1XG5A 1N8KA 5TSDA 3SXPA 3C85A 4JNKA 4UVEA 2R00C 3JQFA 2RBEA 2WEKA 3QWAA 4G2NA 1Q1NA 3DWFA 1Y8QA 1N1GA 4YR9A 2CDAA 3FR8A 3V2GA 5MGBA 1I3LA 1ML3A 3DDNA 4J3FA 1LRJA 4E5MA 4AG3A 5DP1A 2OZPA 1YRLA 3TL3A 2ZB3A 2AEJA 3VPSA 2P5UA 4JBGA 4J43A 3CEAA 1KYQA 4BNHA 3IKTA 1K6IA 1ZJYA 3U4CA 4NHEA 1QYDA 2YYYA 1IYZA 4J1QA 4YJDA 2YHIB 1GZ6A 2G17A 1IHXA 4AJ1A 4AJPA 4WCFC 4CJXA 3CSDA 4I08A 3V1TC 2P4HX 2FY8A 1EUDA 1LSUA 3VPXA 4EGFA 1AHIA 4QO7A 4JP2A 4FB5A 4E5YA 4GBJA 4YAGA 2BRUA 4M55A 4CM5A 4MVJP 1LLCA 3E9MA 2HMUA 3JQ9A 4Z0TA 5H83A 1YONA 3OQ6A 3JQCA 1M76A 4CM1A 2W98A 4CM7A 2AMFA 2QZ9A 3MTJA 4XDZA 3ROKA 1ISHA 3F5SA 2P68A 3UF0A 3DAPA 2QG4A 2WYUA 2X7HA 3OMLA 3BXXA 2FR0A 5KJEA 1GDHA 2CVOA 4ROSA 2R00A 2JFGA 4XRGA 1XHLA 4IS2A 1LDBA 1PJCA 4WCFB 3SLKA 1C0PA 2HMVA 4RVDA 1T1RA 3IOYA 2YZ7A 1PU2A 2AQ8A 5TNXA 3ZWNA 3O8QB 1IPFA 4A5OA 1X13A 3AW9A 3HDHA 4F45A 1I0ZA 4LCJA 3JD0A 4F46A 3T4XA 4J1NA 1SC6A 3GH3A 4NJMB 5LC1A 1KIFA 1FDUA 3LC2O 4O6VA 4YT4A 5L9AA 1IPEA 3A9WA 3TFOA 4CM9D 4BNFA 1JVBA 3LT2A 1UH5A 5G4KB 1E7WA 1FK8A 4PG5A 5U4QA 3ZV6A 2NSDA 3ZW8A 3ROPA 4I9NA 4JJFA 1ZFNA 4ZQHA 1R12A 1MLDA 2HSDA 4JJGA 5BQFA 2B35A 2I9PA 1PGOA 2VZ8A 4LSWA 4OSOA 3OQ1A 4CMEC 3MCVA 1ZNQO 4EI2A 3VTZA 3VC7A 4KOAA 1FDSA 3KYDB 2PZKA 2HJSA 2UV8A 4MP8A 4M86A 1ULUA 5C7IO 5MDHA 2OP0A 3Q6IA 3L4BA 4IMPA 1Q0LA 3WGHA 4DQUA 4QFCA 2QRLA 1PL7A 4Z0HO 3VH2A 5GZ3A 4Y8VA 4YJHB 2G82A 1PX0A 2AHRA 1ZK2A 3H7AA 4PLWA 2OUIA 1HL3A 2DPGA 3QJ5A 3KVOA 4E13A 4MVJA 3JQAA 4TROA 5A9TA 5DZSA 1QYXA 1G1AA 3JYLA 4BIIA 3FNFA 4GWGA 2Y99A 1A4IA 3QSGA 3VDRA 3RUHA 4AJIA 2X58A 1WNTA 4ITUA 4BMVA 4O59O 4Z9YA 4DC0A 3WJ7A 1UAYA 2O4UX 3F46A 1B3BA 1FDVA 3B1KA 3VZQA 3F9IA 4CMBA 4A03A 1UJMA 4FDAA 3CZRA 1EK6A 3U9LA 3KEOA 1M67A 1Y8RB 3WTCA 2UAGA 3CKYA 3FI9A 3MJEA 2X9NA 4NU6A 4DTIA 4F3YA 1BDMA 1CQIA 1R4NB 5JYFA 1LC0A 2BI7A 2RHRA 5FWNA 5GZ6A 3ST7A 3BIOA 3NT5A 5BNIA 1Y8QB 4INAA 3QWFA 3ZWPA 3I23A 3BHMA 1I24A 1HT0A 3DZHA 4QEDA 3W1VA 1I2CA 1B8PA 1HYEA 4PN3A 3L4BC 2YDYA 1W73A 4DYVA 2DVMA 4WLEA 1UAGA 1UXIA 3RSHA 4P4NA 5COAA 4BO1A 4NBWA 4RDHA 3L9WA 4D0SA 1YQGA 2C2XA 2ZYAA 3DBVO 1UDBA 1BGVA 1XCBA 3EDMA 5IN5A 2EP7A 2X8LA 3DBHA 1NFRA 2ZK7A 3D5QA 3MOGA 1CERA 3OA2A 3AOEC 3KRTA 2J3JA 5BSHA 1RM5A 4CMEA 3M1LA 4CMHA 4R9RA 3RQSA 1NXQA 5B12A 4RDIA 4PLCA 3DOJA 2JAPA 2PGLA 1PGPA 3PI7A 4Y6PA 2WYVA 1Y1PA 4FQ8A 4XGKA 4CLRB 1EE2A 2Y0DA 3K5PA 4UVDA 4IPTA 1BG6A 4B7XA 5I7VA 2IXBA 1K6JA 4ONEA 3UN1A 2DFDA 2V6BA 4YJGB 4TVBA 3QVWA 4M8SA 4BO9A 2H5LA 2VRCA 3I4FA 2B5WA 2CNBA 4CMJA 3PYXA 5DCYA 4QXMA 4PVCA 5U1PA 4CLXA 4PG4A 3ZH2A 1N2SA 4RCVA 2AEFA 2PLAA 4MKRA 5A06A 4Y9DA 1BVUA 1DAPA 2VHVA 2EWMA 4BGVA 3R3JA 1Z75A 1F14A 2X86A 1YE3A 3MJCA 3PDJA 4LMRA 3H9UA 4YAEA 5DBIA 2AG8A 8ADHA 3TL2A 1V6AA 2ZTVA 3TZKA 1WP4A 1N9GB 3IC5A 4DQXA 2WM3A 3DZFA 1EBFA 3ZWCA 1GU7A 1GQQA 1O94A 2NACA 3ZWWA 1IB6A 1W0CA 5EMHA 3PGJA 5IF3A 4HFNA 1SZJG 3GN2A 3NTOA 2PH3A 4CM6A 4UEKA 3K2BA 3GQVA 4PGFA 4JXKA 3RFVA 5K0ZA 4N5NA 2ZJ1A 1LI4A 4FD3A 1I3MA 4Y6SA 4KMSA 3H5RA 4CM4A 4N54A 4L76A 3DZIA 4UVHA 4CM9A 4YACA 5TQVA 3I4CA 1RYDA 5AXBA 2BGLA 5A3JA 2JD1A 3PVZA 5JCJA 5GY7A 3GY0A 3W4KA 1RKXA 3C1AA 3VOSA 1LSOA 2OORA 5F5LA 5HM8A 2NTJA 2BH9A 1LDMA 4R4JA 3UKOA 1TT5B 3IP1A 4WPGA 2VUSA 3OSUA 4TRRA 4GKVA 3ZHYA 2VYND 4R54A 4H15A 1XR3A 2XAAA 1ONNA 4AJKA 2D5CA 5JDCA 3PRJA 3F47A 5JSFA 3R6DA 1LDYA 3H2ZA 3ZWOA 2JD0A 3AI1A 4J7CA 4CL8A 5JDIC 3PZRA 4R41A 3UCEA 4NJMA 4YT2A 5ADHA 4AVYA 5A04A 1TI7A 1OMOA 1NAIA 5EIOA 5TF4A 3RKRA 3AFMA 3WSWA 4YT8A 4BB5A 1E3EA 2CVQA 3H6KA 5F1OA 1VKNA 1NVMB 2B4QA 3DHYA 4D44A 4Q9NA 2WJPA 3O9ZA 4Q39A 3PGXA 3RBVA 4KDEA 2TMDA 3GRKA 1EEHA 4D41A 4WCFA 4PFJA 2HU2A 1IL0A 3WTBA 3FRJA 4XYLA 1J49A 1NVGA 1VE9A 3WJAA 3DZGA 1C0KA 3PLNA 5FF9A 2VT3A 4HFJA 4U5QA 4GLOA 1YJ8A 1ADBA 3IUSA 1ZUD1 4CL3A 2NU7A 2AE1A 2SCUA 2PD4A 4ALIA 1PJLA 4EUHA 5DBFA 4Z3KA 3TWOA 9LDBA 4YB8A 4IJWA 2PR2A 3JQBA 1ZMTA 5ITVA 2C7GA 2Y1DA 3AJRA 3JD4A 4KTVE 3RBXA 1KEPA 4B3IA 1LDGA 1GYRA 2NQTA 1JU9A 3MOIA 5JYDA 4XR4A 5HRUA 3GEDA 1P0CA 2Y1EA 1QP8A 3NDJA 4WEQA 1PS0A 5T5QA 1GQYA 3GVHA 3QE3A 3PYMA 5A03A 1TEHA 2BKAA 2O3RA 3BMCB 1VSVA 4M87A 4BNMA 4DQVA 5JDIA 3ZHZA 4R1TA 2FN7A 1P77A 5CFZA 3HB5X 4YRAA 4CV0A 3GN1A 5EJ2A 1ZW1A 4OQZA 5ENDA 5JXWA 3K30A 3EZYA 3CIFA 2BFPA 3GUCA 2JJYA 4DIFA 4E12A 1ZKMA 4U0KA 3IJPA 1QG6A 1LC3A 4BMSA 4NIMA 2I99A 1M2WA 5KKCA 2PK3A 2EV9A 4FJ0A 3U0BA 2VT2A 4DLBA 4QO8A 5JE8A 3WFJA 3RBZA 1DIGA 1UXKA 3L6OO 1PS9A 2VHXA 1PZHA 3DFZA 4UVIA 2V6MA 4ND1A 1X7DA 1ISGA 4FFNA 2NVWA 2EKQA 4R3WA 3JYQA 5B4VA 1VRWA 3OJEA 3DB2A 3H9JA 4BKQA 4BNKA 4HNHA 1TB4A 5C7OO 2ET6A 3STHA 2W8ZA 4B8WA 2JCYA 1EFKA 5CG1A 3DFUA 3INRA 3TZQA 3GG9A 2GUGA 1YS4A 2NUAA 4BGIA 3DOCA 4J9VA 2GF2A 5ILGA 3RFXA 2RCYA 4E5NA 3RJ9A 4MJLA 1WXDA 5H82A 4ALMA 1E0DA 1V35A 4MVJI 1JVSA 5CEJA 4J9UE 3W6ZA 2WE7A 3I3OA 2FR1A 3ASVA 2JAHA 4ZRMA 3ZV3A 3CTMA 3QWBA 4J2HA 4YJHA 3WS7A 4BGEA 1XSEA 2O48X 4R1UA 5A3VA 4OXNA 1VJTA 4BNIA 4B3JA 1MFPA 1E6EA 3TFQA 1I30A 1ZEJA 4CLOA 2F1KA 2VWPA 4ZU3A 2VHZA 1SCUA 2A9FA 5AXDA 3EC7A 1H6AA 4Q3AA 5G2OA 1GV0A 2Q45A 4DWVA 2Q99A 4FBGA 1IULA 1F12A 2E6UX 1ARZA 3L9XA 5TGDA 1T2EA 2DT5A 1ADFA 1BMDA 1DAOA 1NPYA 3VPGA 3T4EA 3G17A 2VYNA 2HLPA 4FFLA 5EQDA 5B37A 3KSDO 1S6YA 4TWRA 3F4LA 3PDUA 1FDWA 2C7VA 2QIOA 3GR6A 2WDZA 1DLJA 2ZQZA 2PD3A 1L7EA 3WMXA 1U28A 1Z82A 3U62A 5COBA 2I3AA 2O50A 2ZB7A 2JFHA 2NVBA 4LVCA 4D45A 1WLYA 1EFLA 3FTNA 1KY5A 2Y05A 1HE4A 5KJ1A 3EAGA 5AVOA 4FJ2A 3VHRA 3U5TA 1X1TA 2NQ8A 1V3TA 5DN9A 5T6BA 3SEFA 3ON5A 3G79A 3JQ9C 4BS9A 5G0WA 1I10A 1I3KA 4NMHA 4WNCA 4PRLA 5L4NA 3OEWA 9LDTA 5A9RA 4II2A 4BO0A 3PJGA 4Z6KA 2I3GA 4FN4A 5L3ZA 1JKFA 1ZSNA 3QP9A 1ORRA 4ALLA 4B7CA 2VUUA 2O23A 2EEZA 3GGOA 1H6BA 3AM4A 1X7GA 3RASA 1XGKA 3ZWVA 2GD1O 3GFGA 4GVXA 2I5PO 4OO3A 4BQRA 1E3WB 3TOZA 3R0IA 3BZUA 4PIVA 1DB3A 4ZQEA 1G0NA 2HJRA 5DULA 1MG5A 3ANLA 1E1MA 2F00A 3ZWBA 3AK4A 1EE9A 1P0FA 4TSKA 1A5ZA 3HFSA 1RWBA 5TC4A 3SVTA 3JD3A 3W4JA 3WFIA 3B20A 3PXXA 1DC6A 1LU9A 1NP3A 2GERA 4JBIA 1I5RA 4UAGA 1HE5A 3RFTA 3BTOA 4PLTA 3PLRA 5F1PA 1W8DA 2IEDA 3DHNA 3I9OA 1PZFA 1O95A 4GMFA 1WZIA 3R3SA 3QVOA 1UXJA 4WGGA 1GCUA 2HO5A 2HCTA 4IZIA 1NBOA 3E82A 2CFCA 4DBVO 2G76A 4GKBA 5T57A 1ZBQA 1V0JA 3E48A 4C4OA 3PHGA 3F5QA 4J4TA 4FJ1A 3DBRB 4L0QA 5KKAA 1MC5A 2NNLD 5IG2A 1NQAO 1L7DA 1WW8A 4BGUA 4DMLA 1DIAA 1HDZA 4KWIA 3Q2IA 1T25A 3AUSA 3GGPA 5A5EA 1X1EA 3TZCA 5KJ6A 1JKIA 4XJTA 3LYLA 5CDUA 1XU7A 1JQBA 2I76A 4ID9A 4NH4A 4ALJA 2FOIA 5JFOA 2V6GA 4B7UA 4K26A 4II3A 1FDTA 1YJQA 5JMWA 1EQUA 1NFFA 2G1UA 2X0JA 4IJKA 4RJTA 1ZXBA 5KIAA 1DEHA 4OJNA 4I9HA 2DUWA 5JW6A 5CAEA 3M6IA 3RU7A 1DO8A 3W8EA 3TQHA 1DC4A 4L8VA 3KV3O 4IJUA 5THQA 3KO8A 2FWMX 1R4MB 2DTEA 3JTMA 1E3IA 4ND5A 3S2FA 3UOGA 3I9NA 1U2GA 4WCDA 5I7EA 3W8FA 4LCEA 4BNVA 5J23A 2YHUA 5HS6A 3U09A 4FC6A 4XR9A 1ZZEA 3CPSA 1M6WA 1MV8A 1N1EA 4BNNA 1TVEA 4IQGA 2A94A 2OXIA 3GRPA 2X1HA 1YB5A 4P8RA 3LZ6A 3ONDA 1ZIDA 3HSKA 1OFGA 2I67A 4AJJA 2P2SA 3O4RA 5LDHA 1D1SA 3G3EA 2R2GA 3ZU2A 4E2YA 3RROA 3LDHA 4IS3A 2WD7B 4GX0A 4ALNA 2B83A 2Q4BA 1YWGO 1MC4A 2NADA 4UUMA 2NU8A 5CG2A 5ILOA 4K28A 1BWSA 4HNGA 4BO8A 3H9EO 3K8ZA 3JQBC 2E37A 3RUFA 4EEXA 1QV6A 1C14A 3WIEA 3C7DB 3IDSA 1AXEA 1MXFA 1T26A 3PK0A 3ZWMA 2JD2A 4R68A 4XQGA 4DUPA 4DA9A 4ZGWA 1O89A 4GI2A 1Y6JA 4NG5A 2Q4EA 4RPKA 2W2KB 1B14A 5JCJD 1WMBA 4QFDA 3OICA 1VL8A 2PZJA 4JP3A 1E5LA 4QECA 4IXWA 2VWHA 4YQZA 4OQYA 3FN4A 3RI3A 1C1DB 3HG7A 3HE3A 2VQ3A 2B4TO 3RWBA 4JN6B 1T2DA 3C8MA 4LN1A 2VWGA 2Q2WA 3ROMA 3MJVA 4WK6A 4BNWA 4CMCA 5BSGA 2FPPA 1EQ2A 2Y1CA 3DR3A 2YDXA 3AI3A 5IJZA 3VVCA 3I9MA 2YQ4A 3FNGA 2Q3EA 2TMGA 5KNLA 4FC7A 4M49A 4N5LA 1AGNA 3AWDA 1X0XA 3F1KA 4YAJA 3UCFA 1ENZA 3WNQA 4JLWA 3PYLA 1XDWA 2ZATA 3OJ0A 4XDYA 2DAPA 2AXQA 3NT2A 1KVRA 3K96A 1PL8A 1BHSA 1V3UA 1YDWA 3GAZA 2D3TA 3TRIA 1P33A 3GAFA 3H9QA 4NFHA 4R51A 4EUEA 5B4TA 1YKFA 1F06A 1I8TA 1I01A 2V65A 3VAZA 2YV1A 3UCXA 3RUIA 1NASA 5TJHA 3AM3A 4Q3EA 1GUFA 1E3WA 1UXGA 1P9LA 1MGOA 4R01A 1KC1A 4BMNA 3LF2A 2B0JA 3PQEA 1IE3A 1DHRA 2Y0EA 2Y68A 5KWEA 4ZA2A 2VCYA 4Q3NA 1GQ2A 3C1OA 3EZLA 4OH1A 3UHAA 3DMTC 1E1KA 5JAQA 1ADCA 4G5HA 3AFNA 3DBLA 4CMIB 3AOGA 3OEYA 4GX2A 3JYNA 1U4SA 1GYQA 4NDNE 2HK9A 4TVOA 4ZQFA 1J4AA 3WBBA 4UREA 2PV7A 4W4TA 3B1JA 5FYDA 1RM3A 2D59A 1LSJA 5TT1A 4DXHA 4OGWA 2D1YA 1B7GO 3BTVA 1QYWA 3Q2KA 1SOWA 2JL1A 3WIDA 3MZ0A 1HLDA 1LUAA 4E4YA 3DONA 4FPXA 5H81A 3ZNQA 1E7SA 1ZCJA 3UFXA 5TLSA 2YJZA 1TA4A 1YO6A 3KLPX 3WG9A 3PZBA 4HKTA 2CDCA 1P1IA 1Y5RA 4J7UA 3V5NA 1FF9A 1A27A 4IDAA 1BXZA 3WDSA 1NWHA 1ZSVA 4KWHA 3BYZA 4WLVA 1V8BA 1RJWA 3UVEA 5DDIP 1YBAA 3ZI0A 4PRKA 2W2LA 3JQ8A 3NGXA 1YB1A 1R0SA 3ETEA 1NX6A 1WVGA 3ICCA 3OJFA 2XPCA 4YJFB 5I8WA 3JD2A 2C0CA 2E48A 2WYWA 4W7IA 4CUKA 4UVGA 4RF4A 1BW9A 1LRLA 4N18A 4PLVA 3UAGA 1RYEA 2YFQA 3OJLA 4IM7A 3BHJA 4BHTA 1XIVA 1Y5MA 5IZ4A 5DBGA 2Q1WA 4ZQBA 3ZZNA 1UXHA 2C82A 4BNLA 3RC9A 4L4RA 1S7CA 4OOFA 3V1UA 1AHHA 5L40A 4B3HA 2GZ3A 4J1SA 4CV3A 1JWBB 4RF2A 1VLLA 2EP5A 3ZV5A 2Q1SA 4HBGA 4NBVA 2JHGA 1EMDA 4OOEA 1KETA 4PCVA 2GGSA 1YL6A 2H63A 2GN4A 3OECA 6ADHA 4XX0A 3EW7A 3HDJA 1DFIA 3DMTA 4WOJA 4C7JA 4L4SA 3WICA 3IL2A 4TRMA 1JAXA 3MWDB 1E7QA 4YRBA 2PZLA 3IQDB 2DC1A 2XXJA 4M54A 3OF2A 3ASUA 3FF4A 2DUUA 4YVFA 4YPOA 3RKUA 1OC2A 1JN0A 1HWYA 1HTBA 4KDFA 3EVTA 4OXKA 3K73O 3WYBA 4HXYA 3ADPA 4PG7A 1T1SA 1VI2A 4A2CA 4RF5A 1KBZA 5J9GA 3DZJA 1VC2A 5CPBA 5IN4A 2P9GA 5HBRA 1CQJA 2GYYA 3H2SA 2C29D 4CQLB 4ZICA 3SLGA 2H9IA 2DFVA 1QMGA 3LVFO 1UUFA 4AJNA 4RL6A 1O0SA 3ZN2A 1SB8A 2DKNA 3H4VA 4GH5A 1H2BA 3I83A 5A4DA 1ID1A 2EHDA 2Y1FA 4JCOA 4J91A 4CV1A 1SBYA 1UP7A 1DIHA 3TZ6A 4AFNA 1M6HA 3I6QA 4RV9A 3TF5A 2P5YA 3SC6A 4DL9A 5ER6A 2VZ9A 1NAHA 1U8XX 4TQGA 1C0IA 1AE1A 5L4SA 3HHPA 3RD5A 4XYGA 1IZ0A 1BSVA 4G81A 5CEEA 2HAEA 2Y1GA 1H2HA 4LSMA 1Q7BA 4KP7A 4C7KA 2X6TA 4GWKA 3LC1O 3KHUA 1ONPA 3GG2A 3S8MA 4WNIA 4DPKA 1PR9A 2X0IA 1E3JA 1C1XB 1R0LA 3DAGA 1R4MA 4CLOB 3FNHA 1C0LA 4NFSA 4XGIA 4YJGA 3WYCA 3GT0A 4GSLA 1O9BA 1O5IA 1MX3A 3OETA 1KEWA 3GZ4A 4J0FA 1UZLA 2G0TA 1DRWA 5JAZA 3KM0A 1D8AA 1T2FA 3VH4A 4AJOA 4CMGA 1Z7EA 3OQBA 2I65A 4E31A 4WLOA 5JLAA 3EMKA 4BKRA 2AA3A 4CODB 1HDOA 4XB2A 2Z95A 1A7AA 4FR5A 1E7YA 4PLPA 1UZNA 4W7HA 2DBZA 2ZQYA 1V3VA 3GMSA 3JSAA 1ZK1A 2CUKA 3JCZA 4I9UA 3ZWYA 1NHWA 5G0UA 5L53A 3S2EA 1R0KA 3WGGA 2AQIA 3S55A 2I66A 4IINA 4A10A 1ENPA 4YAIA 1GCOA 4IGEA 3AUUA 4J6FA 1KOLA 4L4XA 2DM6A 3WYEA 1WDKA 4HX5A 1YQXA 1YL5A 3GVCA 4J90A 5AXCA 3VH3A 4JROA 2CVZA 1XWFA 5I7SA 1A7KA 3QVTA 4MIYA 3AUAA 2IZZA 3UW3A 1DDOA 3D3WB 2GSDA 2HDHA 1I3NA 4R3NA 4KQWA
chains in the Genus database with same CATH superfamily
1Y8RA 1TTQB 4UNNA 1TAUA 3SEQA 3ZBPA 2EXXA 4JV5B 1OXVA 1OGIA 3JQGB 5CK4A 2QAGA 3LQ2A 3WB9A 5F23A 1U9JA 4DSZA 2ZAMA 1VIMA 1SUBA 4WA8A 1M6VB 2PX4A 3DBHB 5A71A 1GHTA 1QKKA 1LW7A 3IP6A 4Q4HB 2G28A 4GSKA 3G89A 5AM5A 4LKOA 1XZPA 4MQBA 1H4SA 4RK5A 5DM60 1XP8A 2NO4A 1VHDA 4A0SA 4RMGA 2GEBA 3PIDA 1VL0A 3T15A 3QVGA 4AX8A 4NU0A 1QU2A 3RHTA 4QQRA 3HB1A 3G49A 3MERA 2ZI3A 3DGFC 5JDCC 3T9CA 3ZHBA 3EULA 2B8JA 3WGVA 3FPHA 4K6OA 5FJIA 1C3LA 1UBRS 4Y6QA 5A9SB 3RIHA 2B69A 1O3YA 2Y1OA 1TRKA 5DXAA 4CUZA 4IXMA 2WQ7A 1Y1LA 2YWBA 3NBMA 1DOZA 3SFZA 2PUWA 2NX2A 4YA6A 4ZK2A 3KUXA 3AFHA 1KOFA 3LYAA 1JEYB 1Z26A 2GJ8A 4JS0A 2X14A 3LOPA 2HJHA 2XUOA 4S24A 1Q21A 3BH7A 1EHCA 1N6LA 1DHTA 1O6BA 2C20A 3GVIA 3PNKA 2QRNA 3P2MA 1XL0A 4O2BF 1WU7A 1P1KA 4YMLA 3RC8A 4MWDA 1EG7A 1SELA 3E5HA 3RC1A 1QHFA 5J59A 4W9MC 3FOFC 2G4CA 1A4XA 2ZTMA 3K8YA 1JLRA 5G0VA 4C4XA 2J6IA 4F04A 4ENUA 4IGAA 4B4VA 1WWKA 1BN7A 3KEMA 4P2GA 1XYYA 2IEBA 3OESA 4OHBA 1RE1A 3G0OA 5IWCA 1JHPA 4RUKA 3KJZA 5LVAA 3CLUD 3P9QA 3I58A 4IVNA 1NSTA 4YI3A 1Z6GA 3NIWA 3D6NB 2DBYA 3WNZA 1N6IA 3O38A 4JXJA 5MGNA 2EERA 4BUCA 4PFSA 1B23P 2EBHX 3KXKA 3HBLA 4B9AA 1E64A 1LPMA 4DMMA 5B30A 4MARA 4IGKA 3QVKA 1TT7A 1XU9A 1T8YA 1SXJA 4D97A 4DLYA 2KLBA 1QK3A 3ZE9A 3D8UA 3EB9A 4MZDA 4BNXA 5JNVA 1N77A 1JFFB 2OO5A 3DV9A 4YRDA 2Y67A 2H85A 1P5ZB 1O95D 4O63O 2J5RA 3FDIA 3QUSA 4G6ZA 5DMXA 3K0FA 2C2ZA 2VHCA 3I34X 4OKNA 2BI8A 3LNCA 3AXSA 3FHJA 4JX8A 4GUAA 3W5HA 2P27A 5AOBA 1VHQA 4FUQA 3GH1A 2NW6A 1O4WA 2G09A 4EKGA 4MR8A 1JBQA 1FOEB 4LWQA 3TS1A 3UHPA 2J5KA 4DCPA 1N0VC 1F48A 3HKCB 4FXPA 1SXIA 3UBTA 5IKPA 4C89A 4DPLA 3NTXA 1ES9A 2WSLA 3QELA 4NESA 1IUKA 4NPCA 2H92A 2P2ZA 4ITRC 4DJDC 2IHNA 4E4RA 1SG6A 1KYWA 2JI8A 2PKYX 3I37X 4ZVUA 1RLOA 3P32A 1KSFX 1X7HA 3EEQA 4FT2A 5B1DA 3KQUA 3K4HA 4UUOA 1RACA 4GHWA 5FUXA 1EE1A 1O95C 3N7TA 2QYSA 4HWTA 1SR8A 2YIMA 1F0PA 1KY4A 1W88B 3GCZA 4OGGA 4AJPA 1PAUA 5E3HA 4F97A 3V3TA 1E58A 1KQGA 3UGJA 3NHWA 2OY0A 3D0KA 2ZWIA 2BM8A 2YX1A 3O2JA 4UHEA 4UAVA 4S1VA 1FSSA 3PQFA 4KITB 1TE2A 1ZVQA 3D4OA 3DMYA 4KO2S 1CNFA 4FD2A 4GBMA 3LX6A 4ZD6A 1TZ2A 2P2DA 1SMKA 1EUCA 5ADVA 3FIUA 5A0FA 3IA2A 2GK7A 1NMXA 4R9UC 3CLUC 3AG6A 1DC5A 2OBXA 2WKWA 4UUNA 2OCAA 2QQ5A 1H5QA 4DC1A 3UC9A 3NB0A 1VZ3A 1MQ8B 2A57A 1P0IA 3BAFA 2ZYSA 4TLBA 4U0JA 2JGDB 1CETA 1OI2A 4KXVA 3ZE6A 5IDQA 4HYEA 4W5WA 2GEDA 1NIPA 1XLUA 4XYEA 1SVSA 1BWQA 1YAHA 3OE5A 5CXSA 3VSDA 1EDZA 1DCTA 3ROTA 5IH7A 2JBWA 4QVGA 2NTYC 1U1CA 2FWNA 4LV6A 4DQKA 1Z4OA 1R10A 2GEFA 2HR1A 2DHDA 4PZUA 1N3YA 4XM2A 2VTBB 4LRSB 4PLYA 3TUIC 1LEHA 4QPCA 3TTWA 2BSQA 4C08A 3G0HA 1U2SA 2H5JA 3CO0S 3M70A 4PZ0A 1YTLA 1N2BA 5EJ7A 4NZPA 3HJRA 5LP6B 3A2NA 2RGNC 2EJBA 4IIHA 4TV9B 5J9FA 1OXKB 1VIVA 2YZKA 3N2IA 2WV9A 4L4UA 4Q9JA 3TZHA 1CUSA 2FGJA 1G20B 1IXKA 2EEPA 3PNMA 1CY8A 4I4TF 5C5IA 5TRTA 5ITWA 3KYCB 1PEDA 3E15A 5FXMA 3ZGZA 3SF0A 1UFRA 2RHGB 4MMXB 4ZHQA 4MYRA 3E1SA 4GLBA 4JWKA 4DARA 2ZIVB 4I5EA 5JC8A 1OOEA 4CIAA 4LGMA 1P81A 4MVJF 4ZDIA 1M54A 3BZWA 3DKVA 2WA1A 4DAEA 4L2IB 3SKVA 3RUCA 4V3BA 4LHSA 4W5TA 1AN0A 1Y98A 2C0PA 2CFIA 2GWRA 3Q3EA 1QP7A 2P67A 1HYHA 5BRAA 5B1SA 4RA9B 1M0EA 4LWZA 3FWZA 1Y7TA 4BKUA 4OA5A 2JPDA 3SC4A 2B7LA 4KQIA 3K92A 4EGQA 4HEJA 4YUAA 4JUBA 4GBED 4X20B 4UD2A 3O6VA 4GYYA 5BMVB 4DV6B 1WHSA 4XFDA 4CG3A 4V0OA 3C4VA 4C7VA 2WSSA 4M9SA 3SKXA 4F11A 2ZJ5A 2GKOA 3BAZA 3KKMA 1W7AA 5JYEA 3AM5A 1GLNA 1TEXA 2H6EA 2QMOA 3GFOA 3OZIA 1MPTA 3M33A 1YU9A 3GEIA 4G85A 4WVFA 4ZJPA 3TB4A 5ER9A 1W2GA 5TIIA 3S2IA 4XGNA 1H4TA 2CWDA 1WX1A 4KXLA 5SZHB 1OJLA 3IXMA 4C3ZA 2EQ5A 2C00A 2ZP1A 5A6VA 1Z33A 3TNLA 3VZCA 1J42A 3I2IA 2HXGA 3W7BA 1CQXA 2PSDA 4NCAA 1TECE 4X3CA 1XVIA 1ZCAA 2AW5A 3BEDA 3PNQA 4G5FA 1BYIA 1R4AA 4XB6B 2H1SA 1DE0A 2QP9X 1QRSA 4NOMA 4REOA 3FKSD 4MVJD 3VDNB 2JRCA 1ZN7A 3GP8A 1MTOA 1ZMOA 3EXG2 4QIHA 3CINA 3OCXA 4LC1A 3DDHA 5CM8B 2PYDA 3IQEA 2YWRA 2VTVA 5EJIA 1PUJA 1FFDA 3H5IA 1Z73A 1GN8A 5IS2A 4D3SA 2EC5A 3I0ZA 3CWZA 4AQ7A 3K5HA 4O4HA 1J5PA 1HDRA 4XLLA 3FA2A 1BKDR 3ICPA 4N82A 4S0ZA 2PUFA 2R1VB 1JENB 4LE2A 2YOFA 1N2OA 2EW1A 5IMBA 5ALMA 5SYAA 3DV2A 4V03A 4ZVMA 5JO9A 2PBRA 2XRMA 1NTOA 4BLRA 4GM4A 2C9OA 1GL3A 1VE6A 3G2LA 1PJSA 4TWIA 1FXSA 4XQEA 1XUOA 5EZYB 3GDOA 1CU1A 3EXIB 3F78A 1QE0A 4TZTA 1Q1GA 4LXHA 3PEUA 1SURA 1JKJA 4KUGA 4LK2A 3ZCUA 5DYWA 1KA9H 4OAQA 2GT1A 2CLLB 3JPYA 3KBBA 4JQCA 3EIOA 4Z1MD 4MP6A 1L7RA 3IJ5A 2YJNA 2CV2A 2IEYA 2IKQA 2FQ1A 1Z0AA 4A8HA 2ZI5A 3SX2A 1GR0A 4ZCRA 1HF3A 3STUA 1F0YA 1N7IA 5AFSA 3H1TA 1JJAA 1C9JA 1CUFA 3DF7A 1JL3A 2AUTA 4NPHA 3VSCA 2DBRA 1JPVA 4OQXA 3NEPX 4YJ2B 3MUOA 4ZN6A 1SQFA 2Y27A 5EZSA 2E4UA 1CS4C 1KBQA 1HLGA 2QW0X 5EFOA 1IHYA 1PR5A 2NVUB 5CDGA 4DLLA 3KT6A 3H0EA 5GPBA 2OV1A 2ONJA 1NW6A 4EJMA 5B64A 4BNUA 4JEUA 2WY2D 1H23A 2RONA 1C3VA 3QV1A 4FBMA 3CXRA 4OEHA 5M3BA 1PW7A 2QAGC 4IEIA 1T4MA 2R85A 3KHKA 1Z6PA 2V96A 1CDEA 1E32A 1R9JA 2WQZA 2P3OA 3D5TA 4KGXA 2HU8A 3T7DA 1PIWA 3UK6A 1L7OA 3EWNA 3VFDA 4DC9A 4EB8A 1FRFS 3X2FA 3GQBB 3Q1LA 2WJJA 1IY9A 2J9FA 6LDHA 2ZI4A 3B13B 5DT9A 3NAQA 3WX0A 3FYUB 3IUPA 4HLNA 3S70A 4MKXA 1MRNA 2ZTUA 3P2YA 1YB6A 4UDNA 5JNLA 5P8WA 4E33A 1XMQB 4KFCA 3AYZB 3T3GA 4TYNA 1UBLS 4E5SA 4H1TA 1G8KA 4GI7A 1JHYA 2FSVA 5MFZA 1KZYC 2Y93A 5F5NA 1CUCA 2JFPA 1E9AA 1CULC 2NO9A 5J4VA 1QAOA 2C4MA 1GCAA 1MBZA 1E5DA 1UODA 2KBFA 1T6ZA 4JLSA 3GA5A 4UBJA 4WJZA 4B34A 3DE7X 1BEZA 4PAWA 4B6JA 3FOEC 3AU9A 1E3DA 4H6VA 2WIJA 4ESOA 3DPSA 3PJFA 4C3OB 2POQX 3GRYA 1TZMA 4C0KA 1CJSA 4R8VA 5A7GA 3L5KA 1RBYA 1SEPA 1SEVA 3DJYA 2VCHA 4RXMA 3A4IA 5FEUA 1U2QA 1QHGA 4UBLA 5LP6F 3WLRA 4DYDA 2G6BA 1VLZA 2ZRMA 4BFZA 3SX0A 3T1TA 1GO2A 1UFKA 1ULAA 3K9LA 3WV5A 4M1WA 3ZKAA 4F9TA 5BRJA 3LG2A 4JVNA 4RPGA 3WNDA 2WSBA 4NBRA 3HM2A 1P3DA 3R20A 3SZRA 3CHYA 2VRBA 3DE5X 1LBQA 2DXIA 3MJTA 3CN9A 1DBSA 7AT1A 1J8VA 1VM6A 1MAAA 2AK2A 1E77A 2E18A 1ZM4A 3FPEA 4MV4A 1IUOA 3M7IA 3A9CA 4XQCA 2P6PA 1J56A 2WP0A 3A4YA 3KOUA 4QQNA 2IYPA 3W9UA 5D8DA 5ERXA 3AFOA 2BGMA 1O6GA 4UHJA 4UHKA 4WECA 1WMFA 2B25A 3U3DA 3DLCA 1Q2XA 1JDBC 4OMUA 2IDJA 2WHRA 3FMGA 2PKQP 3QFSA 3M2PA 4BJ6A 1WF3A 4K86A 1NIJA 1EG2A 1E4YA 3FRHA 2AF4C 4JBNA 1LNQA 1A71A 1JFFA 2NZ2A 2RB4A 3HP1A 1FUYB 4XASA 1GAEO 1QBGA 3I1IA 4YMWA 2OXCA 5LOVF 3KIPA 2LUOA 1KZ1A 2Y9PB 5KTSA 5TQ0B 5FNZA 1GVHA 2XTMA 4NQZA 4A23A 1XZEA 1D4ZA 4NJEA 4P4SB 4IJ5A 5HJ7A 2OLEA 4HX2A 4EGJA 1V9CA 4EW1A 3H1AA 1U0RA 1TQ8A 5EJ4A 1XEAA 3HZOA 4RM2A 1SAYA 3OAAD 4RVSA 2ZVPX 1XDZA 2YY7A 2ZYVX 3LFHA 3GZJA 5K0FA 2JLVA 1LBSA 3I73A 1TFUA 1KVUA 3AHIA 3QEMA 5TR9A 3QY0A 1TJPB 2QHXA 1D2HA 2A78A 2FZEA 2PRSA 1CB7A 1GJRA 5KZMB 1FDOA 4P38A 3A8TA 4M0KA 3WDLA 1JI3A 3FJYA 5E1BA 3W5UA 1T8TA 5BNWA 1SWWA 3C0KA 4RYLA 1I9GA 4KN6A 2HWKA 2PU7A 3GDFA 3IULA 3MWYW 3DSRA 3KJFA 4M7OA 4RJJA 5T73A 1KI1A 1OAAA 3PVSA 5TQJA 1Z4QA 4ZCPA 2XH8A 4FEAA 3T1OA 3ORQA 3SHVA 1YFJA 4MS3B 1PSDA 1QC5A 4L74A 3K9BA 4OHUA 1RCTE 3TSZA 3DO6A 3MUFA 4IDBA 4B8YA 4FKMA 4DCVA 2IEGA 1V8OA 2PEYA 4GX1A 3KVNA 4TGLA 4JZKA 4E14A 4EG7A 3EPKA 1E8MA 3KQSA 2YY6A 4RL4A 4CW7A 3B78A 4TUYB 2XGJA 1IWPB 3QTLA 5K3DA 4OPMA 1Y33E 1JIVA 3S81A 2MR6A 1T9GR 2Z2IA 3F1LA 3G82C 3PNSA 4Y2TA 2ODBA 1D7AA 3GLIB 4WLUA 1B43A 1LX7A 1Y1RA 4FEGA 1KU0A 1D03A 2YINC 3FETA 2I4IA 1J9EA 1R6UA 4L6AA 3OZSA 2BFMA 5ALEA 4M8IA 1W36D 3SZOA 5KVSA 4F4IA 2P0AA 2Z8ZA 3MTQA 2I54A 4OSPA 5FLXA 4H7DA 3NYWA 1QZUA 2IF0A 1R9GA 2DLNA 3IWDB 1WCV1 4H7KA 4MV0A 4RPIA 3URMA 3KTFA 5K6RA 1C3OA 5JEEA 5AOVA 4B9EA 4KGVA 1GG8A 1F9EA 1ODFA 3SNKA 4HAIA 1N57A 1DADA 3GC6A 1D8TA 5MDHA 1VJCA 1ORTA 1J90A 4HNUA 3X1JA 2A7XA 3MBIA 4FNOA 1JIXA 3BSWA 3D3WA 3GMDA 2XWSA 4FNMA 2PUEA 4F7DA 1TIPA 2BHLA 3K31A 1CQZA 3BK1A 3LFTA 2GRJA 4JVMA 4U8GA 4QU0A 1U6IA 1J22A 4OL9A 3L6CA 4OREX 1IOLA 2BGKA 1TD1A 3B6MA 4C0QC 4CTOA 1YS7A 4XXHA 3NFRA 2JVJA 4GOND 4J4HA 2R96A 2D6FA 2A9VA 1OF1A 4J1TA 1A9ZA 4JGGA 3NI2A 3WWPA 1C29B 1NN3A 3VOBA 4QPDA 2VAMA 4Y67A 1ZN2A 1NLUA 1CS0A 3FCOA 4OHPA 5F9HA 2D00A 2D06A 4BKOA 4RLSA 1BXKA 5J4KA 3E23A 1WTCA 3NJ4A 3QW2A 1IXRC 2KHZA 1HKHA 3EDRA 1AXGA 3GX1A 3INTA 5F64A 3FLAA 1YFZA 3REGA 2GO7A 4IXNA 1H0HA 1HE2A 4TL7A 3ESQA 3UMGA 4OHWA 1OAKA 2I2CA 2YV3A 3C16C 5KVQA 1G7SA 3CRW1 3U3JA 1KI4A 3OFSA 3PRKE 5EJ5A 1SKYE 3RT7A 3G9UA 2F7SA 3NDPA 2V7WA 3D7MA 1GTZA 2GAJA 4XFJA 2PLWA 1Y1KE 2OHIA 3EPAB 2YNMC 4X71A 2VQ6A 3N2YA 4QTUB 1PDVA 5ALXA 4KAAA 2W70A 1Q7GA 1TF2A 2Z5LA 3A3PA 3INNA 1ZL2A 4FE7A 2LWIA 3PHLA 3L6DA 5ENVA 4A26A 1YRYE 1YE5A 4G1MB 2C9ZA 3U3OA 2AQKA 4KAXA 3DB1A 1MZVA 1DRVA 4WEOA 1YA4A 1V11A 2HIAA 1A9XA 3I9LA 2JLBA 4A2QA 1BGXT 1RNLA 1W5FA 2WT8A 3GJ6A 4PXYA 1QQTA 3VR1A 1QMIA 2ZR7A 3T3MB 3HU1A 1U2ZA 2L2QA 2Y1XA 3HEBA 1N2HA 2HK8A 4FMDB 5CBPA 1SCKA 1C7JA 3HPRA 2IHTA 4U7FA 3ADOA 2X1MA 4OQEA 4XPIB 3VH1A 4CDNA 1Z4KA 3MMPA 3PQDA 4P4LA 1TMKA 4PCUA 5ECWA 3DBOB 2YTZA 3U4DA 4BNZA 3EZ9A 4ZVOA 2WUGA 4IQ8A 4LV8B 4CQMB 4CNBA 1QIMA 3EVNA 3AR8A 2PNJA 4YP5A 4BNDA 1W0KD 3RKSA 1GZ4A 3GD5A 5IASA 1MOSA 1YDHA 1DC3A 2ID9A 2X9QA 1LZLA 1QH8B 2CF5A 3QOYA 4Q1VA 3EG9B 3VYRB 3EPJA 4P83A 2DPHA 1BU8A 1E9VA 2JZCA 1QPGA 4P22A 2APJA 3I6BA 5TX7A 3U44A 1E61A 2XLCA 5B3AA 5H7XA 3VR4H 3NUGA 1MJNA 3I2FA 1CEQA 4BDTA 3GPLA 4UFPA 1FVXA 1Y42X 2FX2A 2OQIA 3K53A 2ZBVA 1Z6YA 2DRIA 5E6SA 2NU6A 2OMEA 2ZIUB 1QLWA 1NU6A 4JYCA 5WRFA 3TLAA 2O05A 4YIKA 1USUA 1MO5A 5HA5A 4E88A 5KOIA 3SZGA 4WASA 5JC1A 1Q1ZA 2JA1A 1X7YA 1M0WA 1AS0A 3LDFA 4R69A 5TVKA 3ZPXA 1ORDA 2PM8A 3EY9A 2GSWA 1C7QA 1L9XA 2PVPA 3B12A 3RVDA 3G8YA 5DCLA 1PR1A 4GVLA 5L7TA 3KC2A 1SBHA 1B0AA 3EY4A 2P0YA 5CB6A 3M9XA 3WK7A 3K7EA 3QQPA 4K2AA 1G6OA 4KQKA 2VSFA 1HSZA 1UFOA 2ERYA 1NONA 5B58T 4EJSB 5JY6A 1QDEA 1P7CA 3ZZ1A 5C31A 1QGOA 3DMPA 4IDCA 2FQYA 2PT7A 4Q01A 121PA 1PT5A 1VA5A 3D3QA 1OXXK 3KUCA 4EGAA 4HQ6A 13PKA 3U4QA 1CP2A 5CHEA 4BMOB 1I2MA 1H93A 2HQBA 1C8VB 3H1GA 5EG5A 2ZT5A 4L0DA 2Q3MA 5ETJA 5FFFA 3WWYA 3L07A 2JGJA 4HNSA 2J6BA 5LLSA 3R9XB 3TPFA 3ZGOA 3UTDA 3P45A 4E21A 1UMCA 1I6KA 5NLLA 3F7TA 2PGJA 2XZLA 4MUIA 4WNYA 3PEYA 3O9MA 3NVMB 3AXTA 1MVLA 3LK6A 3UJ8A 4B32A 3ENWA 3BL6A 4CLEA 3ZKWA 1T5LA 2WUWE 3BICA 2BDTA 2FEMA 4RHTA 3W90A 4PR3A 4ZDKA 4Q34A 4U9IS 3CG4A 4J29A 3TQRA 4MV3A 3ZV4A 4QWWA 3COJA 4KTTE 4LNUA 4I4TA 1Y4SA 3E58A 2QM7A 2QQGA 4CCAA 3ET4A 5CFPA 3DZBA 2YQZA 3Q3CA 4E08A 1R4NA 4H7PA 4BO4A 1I3OA 1L8XA 3OPXA 4O4IA 3W5JA 3TUXA 3V8NA 3W2HA 1MZPA 3B38A 1GVNB 4ZGGA 1P1JA 1Y4UA 4EF6A 2CLEB 3NXKA 2J0SA 2YS7A 4JGBA 3CUWA 2YIJA 2Q6TA 5KEIA 1SXJB 4IKPA 2NUPB 4HB3A 1KHHA 3K72B 3H42B 1BVHA 2VNAA 3TB6A 2F43A 1QE5A 4DEYA 3O8OB 3QH4A 1JV2B 1WMDA 1M34A 1HR0B 3P2OA 1H2AS 1SZCA 3C87A 3MRVA 4HWPA 3IS3A 2EFEB 5AICA 16PKA 1OPRA 4EL0A 1GNPA 2R9VA 3E03A 4I5IA 1FQJA 1KJYA 2AYXA 3SFVA 5D3MB 2I7CA 2ZB4A 3FOCA 1J8QA 4HWOA 1NQTA 2CJYA 2E4XA 1BWPA 1D2MA 4LGVA 1JJBA 2RAFA 4HAOA 4Q6BA 1XDBA 3OEHA 4O4IF 1G9XA 4O8JA 3DM9B 4JJZA 4C0JA 4E2ZA 2ZBDA 2DR2A 1COWA 2G8LA 3BGOS 5ECDA 5BWBA 4DR7B 1Z06A 4I5GA 1E4VA 1DQPA 3E70C 2PLRA 1OLUB 2G04A 4OQFA 4BQFA 1M2NA 1US8B 3O1JC 2XKBA 3OZAA 4LBWA 3K0EA 5FULA 5HE8A 3SIRA 2AOUA 2PRKA 2R8EA 4CIXA 4K3UA 5B6PA 3ZXUB 4CETA 3R6WA 5FI3A 3W3AD 5C1DA 2UVDA 4YY3B 3JQQA 1FTSA 2EBUA 4TWBA 2XSZD 3GUHA 3K94A 4JZYA 3CW9A 4P4GA 2ZRJA 5CP8A 5F5XA 5BUZA 5ICSA 4AY2A 2GZ1A 3WQSB 1SCUB 4RELA 4WFQA 3SICE 3G5UA 3ZDQA 5LLTA 2VQFB 2O2EA 2VJBA 4BBAA 4QPPA 1N3LA 3M9LA 3ZQKA 3K70D 4RPJA 3GA0A 1J0EA 2RGNA 3HR4A 1RYMA 2HQOA 1QK5A 1S2IA 3UENA 1GTL1 3ABSB 5P21A 3LTNC 3LT0A 2EKBA 4AMGA 5AJXA 3Q3VA 2X5OA 4QUKA 1YOVB 1TYEB 2A59A 2AV6A 2PMFA 1EZZA 2HXSA 2GYUA 1GPJA 2BHSA 3K0AB 5CH3A 5CXQA 3BVPA 1TKRA 3EXHB 3IA7A 4S1TA 5DHFA 1XQ6A 5EHZA 5FOXA 1TW3A 4QT0A 1L0BA 1GU0A 2BLLA 2Z30A 1GPLA 2HMTA 2OXFA 1X80A 4MUMA 4P7JA 3H3JA 4WZ6A 4BO5A 3EE6A 5CFQA 3QVXA 4JYMA 3HI4A 4B3CA 2Z8YA 4B2IA 3DDSA 2B8WA 1YL7A 1QOQB 5EUBA 1A4RA 2BOVA 4C2TA 4BV8A 1D2NA 2OMKA 2QR5A 2E49A 1GG2A 3HJGA 3N9IA 2IWRA 3DAYA 2HJVA 4L85A 2ZSEA 4C2AA 3P94A 4B79A 3NO4A 1LQTA 2J59A 1MQAA 3D7SA 3L6UA 3OIGA 1FFCA 5E2IA 3D6MA 2PCLA 3EQ7A 4IWYA 4MH0R 4KK4A 3OP4A 4R1NA 3RS2A 3ENKA 2HCRA 1HEUA 3CB4A 4EHDA 2C8LA 4X97A 5K0TA 2A1IA 4RZHA 5F7JA 3ZDRA 3DCNA 1DG9A 1V1RA 2C9CA 1RQLA 5I7UA 2G1JA 2YUIA 3UT5B 4MV9A 2CMFA 4RV5A 4MOWA 4LFAB 4RKYA 2ZRQA 3MAAC 1K5HA 3B1VA 1IPHA 1MVNA 3R5TA 4FOOA 3IE1A 2FN9A 4PG8A 1H2WA 3AVVA 3ITDA 4A73A 2RC5A 2MTBA 3DTVD 5L3SB 1U3GA 3CH5A 1GPMA 1NKTA 1JLSA 2I1QA 4PANA 3HNPA 1ZJ6A 3V32A 3WNVA 1UKAA 4AKTA 2HSEA 4NZMA 1AK9A 1KXJA 4LJRA 4JLOA 2WUEA 1OLOA 4IXTA 5KTOA 4X65B 1E5XA 4ZYTA 2B4AA 4W5OA 2Q7OE 1DU4A 3DZDA 3HO1A 4RSHA 3IR6A 1D9XA 1PFVA 3E8SA 3IP3A 1NY6A 1PT9A 1HETA 1H0RA 1WO8A 4D6PA 4KXUA 3QU5A 2HRZA 1T1GA 1LDNA 1US8A 2BZSA 2W7TA 2XKAA 1ORIA 5F73A 2NLOA 3IILA 4FLFA 5I9LA 1W94A 3QKRB 2IXAA 4I1SA 3IOMA 4UHCA 4XWAA 5EJGA 2PMEA 3W79A 3HKEA 3DEIA 3O8BA 4CL0A 1PBNA 1FFXB 3QRWA 3IMKA 4PHGA 1F8UA 3BERA 4KRFA 5KSZA 4O29A 1IVSA 2CK3A 1KDZA 2VJYA 3D6FA 5L8VA 5FOUA 5IXSA 1J9ZA 4NNJA 2PJDA 2NV2B 2QMYA 4M6WA 3MFYA 1IJFA 1XZJA 4EEKA 1DFHA 2BE7A 3SQOA 1TAQA 1YZLA 3RGWS 1E9DA 2XCRB 4NBNA 1EQAA 4IFBA 4F4CA 1X80B 2UZ4A 4BKPA 1BFUA 1PG5A 2OFOA 4JY7A 3ERCA 1O0CA 3GBPA 1NBME 2JLCA 3IP9A 2ZULA 2B8EA 1M74A 3THWA 3HRKA 4Q3BA 2J5QA 3G85A 3G7NA 1JEAA 4YAWA 2VWQA 1PJBA 4WAUA 2QNRA 1GTMA 3F3SA 2W37A 1SIOA 4XM1A 4EYQA 1QO0A 1S7GA 1PYOA 1UJ6A 3CMMA 3QHQA 2Z4RA 4Q9AA 4WRRA 4PLGA 4ZC8A 4F3RA 3P9ZA 5JH7A 2NZVG 5CYGA 1SULA 1VKHA 3H1EA 1VP9A 3GGDA 1OZGA 4ZP1A 3CU5A 4H16A 2G67A 2R60A 1L7PA 1PR6A 2IUFA 1GXSA 3UUWA 1YBHA 4BNGA 1UC8A 3JARB 1NR7A 5TT0A 5I7OA 4XOIA 5FHRA 3GLGA 3SQXA 5B4UA 2EFYA 4I9GA 2RKWA 3DTVB 5EHQA 2GILA 3HFGA 4UMVA 3GDWA 5CCXA 4ZZ0A 3CZMA 1ZH6A 3BBPA 4TMFA 3ZJUA 1KDVA 2ONYA 3PU6A 3UV3A 2I7XA 4UBIA 3ZCSA 3SJCA 4RH0A 3D2AA 2PS0A 3M6AA 5EZ6B 3AONB 2VJMA 5FT9A 4EUFA 2HQ1A 2YVUA 3I1JA 3Q85A 5GV8A 3CURA 1BRMA 3AESA 3CVVA 2RD2A 5BSUA 3AETB 5KYYA 4NENA 3RWMB 4BMXA 3OOWA 4FGWA 2VTDA 1ZGHA 3E9DA 4JEMA 2WF7A 3VO1A 3ZJ5A 6ABPA 3T1QA 5ELLA 1RHQA 2C4NA 3ED5A 5LCXA 3UJ3X 1RR6A 1T2VA 1SHUX 4CDMA 5HXAA 3ZVRA 1J8MF 4QOJA 2C3OA 4BIMA 1G291 2O3UA 2GZHA 3O84A 3JQ8B 3FPGA 2BFAA 2R6JA 2VATA 1AO0A 2GEUA 3MQ2A 1YZNA 3O2NA 4IVRA 5EE3A 4O1MA 1RMQA 4ZTZB 1XTJA 2C2OA 2A0XA 1QIEA 3I2GA 3KSMA 1CSEE 2G1AA 4MV7A 3UT0A 3BXEA 2OG1A 3L8ZA 5NULA 2FZKA 3R1IA 5EPOA 4ZV7A 2CCJA 3D1LA 4Q37A 3SSOA 3TL6A 1KC3A 3PWKA 3DHWC 4DG5A 3WYAA 1UFQA 1IRIA 1E5VA 1CJTC 2XXAB 3LLCA 4DIBA 1CDDA 3RSOA 1BCRB 1J99A 1DJNA 5F1KA 2GA8A 2X0NA 5JY1A 2XZOA 1G55A 3WGJA 1NVEA 1Y1TA 1RIIA 3U4IA 1YB7A 3RF7A 3DEZA 3JQFC 5JZMA 4MWTA 3KZVA 1DPGA 3BXOA 2OOKA 1N2JA 1XZAA 2NUTB 1CR0A 2JZOA 3HZZA 1C4KA 1HDCA 3Q7EA 3F74A 4DE5A 5EXDA 2JAQA 4E0BA 5LDGA 1I7PA 3GNQA 4I7EA 5TPZD 2X5KO 2FJ0A 1UMCB 4E2XA 2LIVA 1MO4A 4LNHA 1RP7A 3KQTA 3MIZA 4IVQA 1A96A 3VRHA 5C4MA 4MWGA 5LMZA 4O0LA 4RESA 3RTCA 3BHNA 4GYWA 4DG8A 1QRAA 1A1SA 2OAGA 2WWFA 5JYCA 2XMZA 2Y2VA 4N76A 4FR2A 1K4KA 5EIWA 3I04M 3K35A 3QLVA 3CVYA 3TLYA 4P84A 3BMNB 4JKYA 3R7SA 1SCDA 3OBBA 5G0SA 4ZVNA 1DIRA 2MR5A 4DV4B 1R0CA 4TX1A 4BLQA 5E6UA 3GPIA 3V1YA 1W0JA 5K45A 2ID7A 3HN2A 5DCUA 5T4HA 4FYKA 3HDYA 3X1YA 3JATB 2YYSA 1EPUA 3HDTA 5CURA 4EENA 3Q0TA 4R2HA 1I2ZA 4WJLA 1L8LA 2CD9A 3IPRA 4K8RB 3ZJYA 1QU3A 4XARA 4XWOA 3A06A 2RE8A 5CM2Z 1E6MA 4QUHA 1J2UA 2XDWA 2PH7A 4CEJB 5E0OA 3E5RA 3DAOA 2PUDA 2AC7A 4QQKA 3VDQA 2HMWA 4OK5A 4OLFA 2F8LA 4FU0A 4MW0A 4N48A 3QTBA 4P34A 2FPLA 4G36A 4L8FA 1B0UA 4D99A 2WWYA 4ZMRA 1XTRA 2VDMB 4IV0A 3N75A 5HK8A 1AJEA 3EXAA 5F77A 3ZDEA 2BM1A 5BWNA 4C78A 4LQ4A 4IO0A 4RDXA 4LYYA 3BWVA 3BCHA 3LBFA 3UAZA 3L0CA 5DM0A 2WEKA 3NTUA 1XWWA 1BE1A 1I5OA 1K27A 2XTAA 1QAQA 2XNHA 3WB2A 2I4OA 2INGX 1BDJA 3NFYA 3Q2OA 5E4JA 1OU4A 4LY3A 3MB8A 2IOFK 3FDXA 1N1GA 3HYLA 3NPAA 3WK5A 4FE4A 1GRQA 2CDAA 2FSVC 2P9FA 2QV7A 3FR8A 5JD3A 4B84A 2IX9A 1ML3A 5JS1A 1XLWA 1KK3A 4G4IA 1WABA 1LRJA 3MT9A 3RVQA 4OX9B 3KJEA 5CTAA 4F0JA 3EA0A 3MCZA 1IN7A 1ZAKA 2Q5FA 1KGSA 3E2PA 4Z4HA 5ICEA 2X7XA 5EKUA 4C43A 2VEOA 4LJSA 1T1EA 3Q10A 4YFVA 2O20A 4J43A 4JBGA 3CEAA 2AF3C 1A69A 3VPSA 4AMYA 4BNHA 1JSZA 4Q9KA 4BQSA 4DMKA 4TUYA 1A1VA 5HJ2A 3N07A 1IJKA 1V25A 5CLHA 1QYDA 1DELA 5J5CA 1UOOA 1IK4A 2IOQA 3A7EA 3GLIA 1SIUA 1G5FA 4P93A 4CJXA 3CSDA 2C61A 4GMKA 3VBEA 1GAQA 2FY8A 2P4HX 5JV5A 3QX3A 4JJAA 2PX0A 3EOAI 2PE5A 4BFVA 1UADA 1OLXB 1TAHA 3VDXA 4FB5A 1QTIA 3MD0A 2ERCA 4H3SA 2BHNA 2P65A 1MHMB 1AVTA 1U0TA 3RV3A 4MVJP 2QY6A 4CM5A 3E9MA 4Z0TA 5IU6A 4C6RA 1L5YA 3AJ9A 3I9FA 5C3UA 1YONA 3R7WA 1WB9A 4C87A 3WMFA 1KZ6A 4MPPA 5K2OA 2JGAA 2SNIE 4PAMA 3D3JA 4OP2A 4OI4A 4CM7A 5JTUA 2AMFA 2VUIB 3UPUA 1WB6A 3CZQA 4WXMA 3IH5A 4FEYA 3RRYA 3DWIA 4OKSA 5KJEA 2A0KA 4B3BA 4CI0B 4MTLA 1GNLA 4Q16A 1UCFA 1HT2E 2JGIA 3MQ4A 2CW5A 2GM3A 1EU1A 1SCBA 3ACCA 4IS2A 4L0CA 5ADWA 3FTEA 4WCFB 4A8PA 1NXTA 1KYVA 2CT8A 2JIBA 3M34A 1DJOA 4ZOAA 5KBYA 2GEVA 3TUZC 1KYIA 3QGMA 4FDVA 5JCOA 3AESB 5HILA 5TNXA 3O8QB 4RIEA 4A5OA 2ZDQA 4COKA 4NCNA 3AW9A 3UGTA 1DMSA 2FEXA 1WHSB 1X9GA 3MS7A 4F45A 1EWVA 1XHFA 2ES4A 2H7XA 5D3MA 3T4XA 3V1NA 721PA 2DEUA 3E7XA 1SC6A 4NJEB 4P4SA 2P4EA 1KIFA 2ZREA 1FDUA 3BXZA 3E3MA 1SD2A 3EIUA 3ILYA 4PX3A 5JASA 2VK8A 4UU1A 5DHPA 5K8VA 1QYIA 1B1CA 5ALYA 2OBLA 5ICGA 4MVWA 3KLOA 3HGMA 4MCAA 1U99A 2NXCA 4S1WA 4N01A 3MUNA 4W1RA 1C9KA 4QXPA 5EC8A 1JVBA 3BJIC 2DF8A 3ZV6A 6CHYA 4LHVA 2NSDA 1OROA 1MB0A 4JU8A 2G77B 1B6TA 1JNYA 3G2KA 3VNRA 4D26A 4B3RB 4I9NA 2CLCX 2FMTA 4N0DA 5EKTA 1MLDA 3MTIA 4RMHA 4HJXA 1PGOA 4GP7A 1ELOA 4HEHA 4LSWA 5JQWA 3OQOA 2E5WA 3MCVA 4QYTA 1ZNQO 5TV2A 4ZYXA 4CEHB 2FPUA 1L4YA 3DA8A 2H1LA 3M6VA 4HEA1 3Q8XB 1FP6A 3STYA 3J7TA 4KBYA 1G5PA 3CZ4A 2HJSA 2UV8A 4MS3A 1S5PA 2DYKA 1JIUA 1K6MA 3MT0A 2OP0A 4K2HA 4MEBA 3L4BA 4O8CA 4OV6B 1Q0LA 4WACA 3ZCTA 4EMBA 2MINA 4ZC1A 5EAIA 2CXRA 4QFCA 3F5FA 5GZ3A 3N70A 4LYDA 2IIQA 1D0VA 4D4KA 2CJWA 4PLWA 5F12A 4REQB 3SAJA 5CDFA 4MTCA 1E69A 2IYQA 2O8NA 3PEVA 1P8JA 5EA2A 3KAJA 2BP7A 3R4VA 6AT1A 1E2GA 2X4IA 3V46A 1WS6A 3W1WA 5K8UA 4J2TA 1GPUA 3OZ7A 2WYOA 4AJIA 4OF4A 1WNTA 4ND6A 1R6BX 2AIRA 1MOPA 5TMEA 3UJHA 4LZLA 5CDHA 4Z9YA 3H8WA 3KPYA 5H4HA 2BZ1A 2A86A 5KOJB 3B1KA 2EYUA 3KD3A 3JVUA 1M8PA 5IC5A 1E2IA 1H5UA 3FKJA 4NTZA 5FBQB 4E7OA 2BWJA 1UJMA 2PG3A 5H70A 5E0KB 2XVXA 3THSA 1I1HA 3DFKA 3NVKI 2F9FA 2X0FA 3L8YA 4YCJA 1MW8X 4JLAA 2HHLA 5J40A 1DJLA 2X9NA 3E3NA 1SC4A 1C30A 5DFAA 1CQIA 2E89A 5EIBC 1JAIA 3ZHRA 3DLTA 4N40A 2UUBB 1FFWA 4J0CA 2EJTA 2Q6LA 4BX2A 4QE3A 3AF4A 3GJ4A 2QN2A 3QX9A 1CBUA 3BIOA 4FN5A 1B00A 4C7MA 1M8GA 1CUZA 3I23A 1Q19A 2J46A 3BHMA 1HT0A 1KFJB 5JXHA 3DZHA 1I2CA 4N49A 3VO9A 3LQ1A 3I04A 2Q5OA 3N86A 5G1PA 3RF6A 3OT1B 3KZKA 4RMIA 1II8A 3ELDA 1VE3A 4GUDA 4DYVA 2Z3WA 1SY7A 4Y1EA 2HBYA 2M98A 2ZWVA 4P4NA 1SOAA 5COAA 1I6WA 2XUFA 3BCRA 3JALA 4RDHA 5K3CA 1UDBA 3H16A 3PPVA 1XCBA 4KQ2A 3EDMA 4G0YA 3AL3A 1KK1A 5CD1A 2Z6UA 3DBHA 2ZK7A 3B3AA 1CRLA 1CERA 3NEYA 4AG6A 2V7VA 3UJ6A 2OZVA 2AKAB 5ALIA 5AM4A 1KYYA 5JWOA 2Q3BA 4CMHA 3RQSA 2DJIA 3BD6A 4RDIA 4PX5A 2PGLA 2XB9A 1DTEA 4YBRA 4GPZA 3KWMA 3HS3A 4JR1A 2DQYA 5KOHB 4JD5A 4FQ8A 1EP1B 1BMQA 3A6DA 1ZMRA 4BTVA 1FNDA 2GX6A 3HKEB 1BG6A 3JQPA 4KOEC 1HFEL 1GKUB 4DRXB 5JU6A 3VR0A 1UK6A 2IXBA 1ZOOA 2FEPA 3AL2A 4IICA 4ONEA 1DT5A 2FKAA 3MGKA 1EJ2A 2KX7A 1GDDA 2ANBA 2FRVA 1G21E 1XPRA 1QZXA 1Z8HA 2H5LA 1U9IC 2JIRA 2QTVB 4EHNA 2E6KA 3PFNA 2B5WA 2WHYA 3TXAA 4YRKA 1E98A 2YCBA 4QA9A 3GFRA 1I0LA 2ONKA 1TU0A 1X7XA 1FP4B 1Y3BE 2A0WA 4MKRA 1Z2NX 3X3HA 1BVUA 4OHKA 1KAQA 4Z4EA 3X0DA 2E21A 4CE6A 1F14A 1HOXA 3PDJA 1FMTA 1U04A 3GJTA 1CRQA 2ZTVA 4UE3S