5EESA

Crystal strcuture of dapb in complex with nadp+ from corynebacterium glutamicum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
247
Chain Sequence
b'GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Oxidoreductase
total genus 70
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eesA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eesA01
3KV3O 4EITA 3S55A 2ET6A 3H9GA 4JNKA 4HBGA 4BNTA 2EJWA 3GPIA 4RF2A 4BO7A 4YAEA 2ZQZA 3FPCA 1AHIA 4XGIA 1BSVA 5M6DA 4QO8A 5KWEA 1QYVA 2J5KA 1T2EA 4NHEA 4LMRA 4RLSA 1DFGA 1QSGA 1DHRA 2C20A 4Q3EA 3S2EA 3UCFA 3CMMA 1BW9A 2CMDA 3PYLA 2CUKA 2VYVD 2UUOA 1U2DA 2CDCA 1GV1A 1B2LA 2LDBA 4ZQGA 3BTSA 4YRAA 2FPIA 2H6EA 1K3TA 4G65A 1H6CA 2JFFA 4BV8A 4XYLA 4RVSA 1R66A 5BSEA 1UDBA 5IG2A 4A10A 1LU9A 1ARZA 1RM4A 3IDSA 3FPLA 1V8BA 4OQZA 4Q39A 2Y66A 4R5MA 1LX6A 1B8PA 1KIFA 3DHEA 3WWYA 4GSKA 4W9NA 1NVMB 2A92A 2X5OA 4R1NA 3F1LA 1UXIA 4R9SA 3PIDA 4IJWA 4ALMA 3BXXA 1D8AA 2JCVA 1SAYA 2VRCA 5A9SA 3JQ7B 1ISMA 3L9WA 1CF2O 2BH9A 2C2YA 5BNFA 5THKA 3BMOA 3TPCA 3Q3CA 1GPJA 3ANMA 4JN6B 1N7HA 4ESOA 1E3LA 3WXBA 2C07A 4LISA 5EMHA 1Z7EA 3EVNA 3ZW8A 2JKVA 4J1SA 3DB2A 4YT4A 3MTGA 4TKLA 4PG7A 1KVTA 1PL6A 4WOJA 4GX5A 2B4TO 1F8FA 3DTYA 5KJ1A 4WLUA 4CV1A 5TF4A 4CMAA 5BNIA 3RC2A 2X9GA 3HQ4O 2NUAA 5LC1A 3ZNPA 3SVTA 3B1KA 3H5NA 3IOYA 3TF5A 4WPGA 4DC1A 3C3XA 3AY3A 4LRTB 1GYPA 3OMLA 1ENOA 2FP4A 4R16A 5JAZA 4FFNA 1CYDA 1F12A 5ITVA 5CDGA 1LLQA 1WDKA 4WJZA 2DFDA 1MFPA 5AQ1A 2BRUA 2P2SA 1HDCA 2DBRA 2W2LA 3L6OO 5JO0A 4YCAA 1M76A 2DLDA 3PJFA 4Q3AA 2NV6A 4HFMA 1O8CA 2FPGA 1HXHA 1GU7A 3ZZNA 4PGFA 2HU2A 4WLEA 4NFYA 4PLFA 3ASUA 1H9AA 3U9LA 4E21A 5AVOA 4TVOA 4S3MA 2NVUB 1I0ZA 3WBBA 1LXCA 4DBVO 1E3IA 1OAAA 1HDGO 3L6DA 4OKNA 1Z6ZA 4WCFA 4JGBA 5LDHA 2PA3A 2PH3A 2YQ4A 1IZ0A 3E6AA 3WBFA 2X9VA 4WNIA 3NEPX 3ETDA 4BNZA 4CLDA 4E3ZA 3EW7A 4R54A 3LF1A 4J6FA 3SLKA 5TT0A 3H3FA 3FNEA 2JHFA 1X15A 4TROA 1HZJA 4NJMA 1ONOA 1ZXLA 2VTEA 3N7UA 4TSKA 3GDFA 1LTHR 3WFJA 3W8FA 3RAJA 2C54A 2CDBA 4MKZA 4CM8A 2I9PA 4P8RA 2G76A 1IULA 4B8WA 4FFRA 1HEUA 4RVFA 4ZQFA 2PZKA 3FBGA 3L0DA 1HE5A 2D8AA 2V6MA 4R3NA 1FK8A 3OJLA 3KVOA 4FFOA 4RJTA 4MVJG 4ND1A 2WD7B 1XWFA 2X22A 1EBUA 1K0UA 3ASVA 3W6ZA 2I66A 4IPTA 4BKOA 7ADHA 3BMCA 3PRJA 1Q0LA 1C0KA 1VL8A 4Y6RA 2FRDA 4PLWA 3ZHZA 2FR1A 2W2LD 4NNJA 1E7MA 4ALJA 2FZEA 3ZU4A 4BGIA 4U0JA 1KEWA 3CIFA 3RSHA 1EDOA 5G4KA 3QLJA 4CQLB 1PJ4A 2O3RA 1O94A 3LSYA 4DQXA 3MWEB 4BNNA 1B3BA 3C85A 1PZFA 2BGLA 3RUCA 2RIRA 4UVGA 5L53A 2ZCVA 4JJFA 3B6ZA 5C3MA 1NPYA 1KEUA 4EJ6A 1ISJA 4LCJA 3V5NA 5DNAA 1K2WA 2CF5A 1WP4A 1QKIA 1K5HA 2HMTA 3C7CB 2HJRA 5B4VA 1N8KA 3WTCA 5IZCC 3E03A 2EP5A 3W4JA 2Q99A 3ITKA 4IXWA 2ZIZA 1ZCJA 4L4SA 4II2A 2FPPA 3RC1A 3NT5A 3F9IA 3K31A 1AN9A 3DZIA 4FB5A 1E3JA 2OP0A 4EEXA 1HDRA 3VH3A 5KVCA 2VQ3A 3H9JA 3VKUA 1S6YA 2Z1NA 1O6ZA 2E37A 2G17A 2I3AA 1TLTA 4TRMA 2AMFA 4BL5A 4MOWA 3OETA 1LDEA 4AL4A 1IPEA 1BVUA 1BTOA 5CEEA 4IDEA 4IXTA 5C7OO 1LDBA 5ES3A 3A06A 3ROQA 4PLZA 5EERA 1CQJA 5IZ4A 4UVDA 1LUAA 5U4QA 4UAGA 3UOGA 1YQXA 3GG2A 1WDLA 1HF3A 3WYBA 1UR5A 4E13A 3NTRA 4BNHA 1KVRA 3JQBC 4PZDA 2VT3A 4KMSA 4Q3CA 3DAGA 2DTXA 2X6TA 2Y93A 3P2YA 2B5WA 3I23A 3I1JA 4UUMA 2Q46A 3O8QA 1ZO8A 3HFGA 4XKJA 5A9SB 1V3VA 1J4AA 1HYHA 3GVHA 4MVJM 5F21A 4MP8A 5JCXA 4F6CA 3VHRA 4FOSA 1SNYA 4OL9A 1J0XO 3GLQA 3OJFA 4D79A 3CE6A 3AU8A 1HRDA 2C7VA 3SXPA 3GQVA 3CINA 3DO5A 1I24A 2E49A 5BQFA 1E6UA 2P5UA 4J43A 1RWBA 2DPHA 4DMMA 1PJSA 4J9UE 3KYDA 2Y0EA 1ZKMA 4RPLA 1DC5A 1H9BA 3I9KA 3IUPA 3EZYA 1EE2A 1LQTA 5LDGA 1U2GA 4JBHA 1E7QA 1P1RA 1GFSA 4B4UA 4ZJUA 4NIMA 1QLHA 2PGLA 3CPSA 3NT4A 2Q4EA 1CIVA 3UVEA 1IL0A 1P1HA 1ZK3A 5CDTA 2YZ7A 4CQMD 1NAIA 3H5AA 3JD3A 4OKIA 2RBEA 3TQHA 4NK5A 4DGSA 2G82A 2DC1A 2X86A 1I3KA 3S1LA 4GBJA 4XQEA 2Q50A 2B69A 4M89A 4UVHA 3KEQA 3CZMA 3ZDFA 1BGVA 3MJVA 5DN9A 4NBTA 4B7XA 2B0JA 4CMIB 3ETEA 3WGYA 4NBRA 4JCOA 3K92A 4ZRMA 1CERA 1RYDA 1TI7A 3ZWXA 4CM4A 1PJ2A 4DXHA 4NDNE 5C5IA 4IZHA 1PWXA 3KO8A 1MX3A 3DL2A 3IAHA 4KDEA 3ROMA 4G81A 3U49A 3S2IA 4R1UA 4R5HA 4DIOA 5I9LA 1T2CA 1X14A 3C1OA 2WD8A 4A0SA 3DBLB 1RM5A 1JAXA 1XIVA 4BMNA 5BSGA 3HN7A 2Y1CA 3HNPA 3GUCA 5IDWA 4OM8A 1RJWA 1BXGA 5CPBA 1ENZA 1LNQA 2JFHA 1JQBA 2FR8A 3TFQA 4MVJI 4GH5A 3JQ8B 5KCZA 4B3IA 3D5TA 2W4QA 3WG9A 3WMWA 4BO4A 2QYSA 3BMCB 3VPGA 4HV4A 5JMWA 1NQTA 4PLVA 4IDBA 3QJ5A 2GCGA 1WDMA 4JK3A 3QW2A 4GMFA 2HK9A 3NJ8A 3QE3A 2ZYGA 4HFJA 2FHSA 1NFRA 3OEYA 1IOLA 4YJHB 3LF2A 4J4HA 1LRJA 4J7UA 4QFCA 1EUDA 4YT5A 2EW2A 1L7EA 5JLAA 4D3FA 2Y1OA 3DOOA 3JYPA 1JVSA 4FC6A 1FDSA 1B3RA 1HL3A 3I52A 3TJRA 1G1AA 1N92A 3KHUA 1XGKA 3B20A 5BSFA 1PWZA 3L6EA 3DONA 4WEOA 1LSOA 1NAHA 5JSFA 2ZTVA 3T4XA 2BKAA 4BNVA 4Y6PA 2P68A 3WGHA 4HX5A 2VYNA 1AGNA 1V6AA 2RHCA 4L75A 3HZZA 4Q3DA 2P4QA 1HSOA 2Y1EA 2GD1O 2O48X 3OEWA 5CEFA 1BDBA 1NFQA 5TJ9A 2GZ1A 4R01A 3AU9A 5L45A 1F14A 2O7QA 3GN2A 3LT1A 3RU9A 1RPNA 4N7RA 3JD4A 5GZ3A 3PLRA 3DOCA 4M87A 3KSZO 1AXEA 2YHIA 3UGKA 4CQMB 1NHGA 4CLHA 1BHSA 5T6BA 5JYDA 3VDQA 4ZVVA 4BNKA 3ICCA 1H5QA 5HWSA 3JQ9A 1YONA 2GN8A 1ZBQA 3DEYX 3ENKA 5CHEA 1OI7A 3JQAA 3M2PA 3RC7A 2AG5A 2BF7A 2OFPA 4ZU3A 3MJEA 1U3WA 3G1UA 3WX0A 3DR3A 1UZNA 2GR9A 1ONNA 2QQ5A 2I5PO 1P9LA 1LDYA 1T25A 2D4AA 2BGKA 1JTVA 1PJBA 4NBUA 5JW6A 3E9NA 4YAJA 3ITDA 2PTGA 3SC4A 3TL3A 4URFA 1EUCA 3GZ4A 4UUOA 1ZK0A 3EYWA 3I9LA 4RPJA 5TLSA 2R00C 2RAFA 2X9NA 3RKUA 2DFVA 2CZCA 3GHYA 2IZ0A 1TT5B 4H7PA 3AI3A 3BTVA 3E9MA 3K73O 1MA0A 3BAZA 3LLVA 4CV2A 5AXDA 2NU9A 3DBHA 3I83A 2PKQP 1CEQA 5BT9A 2PH5A 2C2XA 3PPIA 5KJFA 5ER6A 3PYXA 2NQ8A 2IDZA 4BV9A 2Q2QA 1LEHA 4QTZA 4BKPA 1YBVA 5L95A 4FIZA 2W98A 2B4QA 2JFGA 5BR7A 2HCTA 2R2GA 5FWNA 2BGMA 2OL4A 2I67A 2QYTA 5G0WA 2EG9A 4CLOB 4JLWA 2ILTA 2FN7A 4O59O 1Y81A 2CF6A 2NM0A 3CKYA 3AUTA 3JYOA 4M1QA 4M54A 4XWYA 5AYVA 3R3JA 1BG6A 2PK3A 4TVBA 5I8WA 3GDOA 4MVJD 1U5CA 3KEOA 1DJQA 1J6UA 2HSDA 4XD2A 4ZQEA 4KUHA 4DA9A 1XHLA 2OGUA 4PLYA 1NBOA 1MXFA 3NKLA 1I5RA 3JQ7A 3WMXA 3PHHA 1WNTA 3JQAD 1SO8A 4XJSA 4AJPA 1V3UA 4ID9A 4CMCA 3MZ0A 3M1LA 3D3EA 3KTDA 3HB4X 1NQAO 1LA2A 3PGXA 4UEOA 3WLFA 3DFUA 3I6IA 3D5QA 2J5QA 2E6UX 1LC0A 5DDIP 1F8GA 1I2BA 3V2HA 5EN4A 1A7AA 4KDFA 5IDQA 1ADGA 4XR4A 1UXHA 4UUPA 1YDWA 5A5EA 4KOAA 4W7IA 2HMVA 4UVIA 3PFFA 5IDYA 4H16A 5H81A 4P22A 3U4CA 2FMUA 1VJ1A 4J9VA 5FEUA 4U0KA 3V1TC 1PGPA 4BNJA 1RM0A 3IIEA 3QVSA 2UVDA 2PNFA 1PTJA 1UP4A 4FGWA 4MP3A 4L4XA 1CQIA 3ZU2A 5BSHA 2YHUA 1BXGB 2WYVA 3WDSA 1UP7A 2EW8A 2GN6A 1JAYA 4CMBA 2EJVA 4DQUA 1BVRA 4I9NA 4CV3A 3PHGA 3ZWYA 2EP7A 2JD0A 3PP8A 5DBGA 4NPCA 4I8XA 4R9RA 2YV1A 2YDXA 4XIYA 2AXQA 2B5VA 5L7WA 1U1IA 2NVUA 2J3IA 2EF1A 1QV6A 4YDRA 3FCOA 1K6XA 3TZ6A 2P9CA 1ZZEA 3E48A 1V35A 4QT0A 8LDHA 3U3XA 1DC4A 3LC1O 4BOYA 2WEKA 5GZ6A 1QXSA 1DIRA 1JDJA 1MFZA 1SMKA 1WXDA 3UAGA 3V1UA 1P77A 1XEAA 2ZATA 3OIFA 1KVSA 1U7TA 3W8DA 1P31A 2VYVA 1BXKA 4C7KA 4YTEA 5IXSA 1NNUA 4RV9A 3C7DB 4U6QA 3WQSB 4HUJA 3TZKA 4EJMA 3VZSA 3GFBA 1KERA 3OICA 1ZJZA 3K5PA 3ADOA 1U28A 4WUVA 3AI2A 5HM8A 5FI3A 4B3JA 1PGNA 3I6QA 1P0FA 2WD7A 4FFMA 4CM7A 5KKCA 2WE7A 5K6AA 1E3WB 3IJPA 1IHYA 5HRUA 3INTA 2VOJA 5F1PA 1DC6A 2NTVA 3ON5A 4PCVA 3KB6A 1HDYA 3WGTA 1FF9A 2WJPA 3OM9A 2AQ8A 2Q2WA 4H15A 4BS9A 3GGPA 3PJDA 1QRRA 3NGLA 4WEQA 2Q3EA 3TWOA 5J9GA 3GUYA 4CQLA 3JYQA 1C0IA 4OIMA 4RO0A 1DFHA 4TRRA 4BMVA 3JQAB 4DWVA 5A1TA 2E48A 4MVJP 5I7FA 5CG2A 2UYYA 1T1RA 4BO2A 3L4BC 4BHTA 3ZCXA 5CPFA 3E18A 1P44A 4EBFA 5G0UA 1I30A 3HG7A 3U0BA 4DLLA 1KEVA 1E7RA 1ZK2A 4CODB 2NU8A 1LC3A 3ZHXA 1EVJA 4J1QA 4CJXA 1E1NA 2AHRA 4XYBA 4CUKA 1ZVMA 3OECA 4QECA 3WQQA 1YJQA 3WGGA 1XR3A 3AI1A 2BD0A 2BI8A 1PEDA 3KYCB 4Y8VA 4DLAA 3DBHB 3LLSA 4L8VA 4E5KA 4MVJH 2GO1A 1VKOA 4O1MA 4FR5A 3NYWA 3TZQA 2WSBA 3H9QA 5A05A 4TRJA 1Z82A 1GEEA 1DIBA 4W99A 5F5LA 3AUAA 1PGOA 1FDWA 4RVGA 4JX8A 3W4IA 4YT2A 2Q22A 1EBFA 4XCVA 4D7AA 4NFSA 1OZAA 3EC7A 4INAA 1P1IA 2X58A 1XG5A 3AOEA 3LYLA 1W0CA 5JDIC 1YBMA 4KTTE 5EPOA 5JS6A 3PXXA 3CZRA 3FWNA 4DREA 4NFHA 1DRUA 5A04A 4WOKA 4D0SA 2HQ1A 2DAPA 3H2SA 2EEZA 4EYEA 2AQIA 3DHYA 3IQDB 3LC7O 1F06A 1Q7BA 3LU1A 4PZCA 3X2EA 4A03A 3FTPA 2HDHA 3FNGA 1UXGA 1D1SA 4H3VA 1T1SA 2GZ3A 4E5MA 3S8MA 4CM6A 4UVEA 3JYNA 1HE2A 3DBRB 3HDQA 1R16A 3ZWCA 2GN4A 3MWDB 3RCBA 1YL5A 1ZMOA 4OOEA 1U7HA 2P9EA 3GHHA 4IDFA 2BLLA 1C0PA 1NXQA 2Z5LA 4IDAA 2A9FA 4FC7A 1Y6JA 2CD9A 4GVLA 4RPKA 4HP8A 3G79A 2ZQYA 1B8VA 3BMNB 4Y6SA 5IFLA 3DFZA 3FI9A 3C1TA 3JD0A 4L0QA 2ZB4A 2X5KO 4PLCA 1NPDA 4AJNA 4JJIA 5A4DA 2IXAA 2QG4A 2ZKLA 4WASA 4IQ0A 2JCYA 3AUSA 5HBRA 3CXRA 3T7CA 3W1VA 1C1DB 3ANNA 1JLLA 3WIEA 3AW9A 4BUCA 3OBBA 1U3VA 1NWCA 1KBZA 4NH4A 6ADHA 2PFGA 5G2OA 5JO9A 4O63O 3GDGA 4K28A 1T4DA 3EVTA 4II3A 4CMIA 3JD2A 2WWRA 4D45A 1A4UA 2VN8A 4DBZA 5GY7A 3WGQA 1OC2A 3UCXA 1SEPA 4DUPA 1YWGO 3LK7A 2Y99A 1A7KA 4ND4A 3ABIA 1B8UA 2XOXA 2PZJA 1WMAA 5AXBA 2W2KA 5JDCA 1PJLA 4DIBA 3MJCA 2DKNA 3OA0A 4BB5A 4E2ZA 4B8ZA 1A5ZA 1ZEMA 4AJEA 5F1OA 3KBOA 3TOXA 2RHRA 3FNFA 4CR7A 2PKRA 3LVFO 3DBLA 2VHZA 1YH3A 4XQCA 2HO5A 4D0RA 5ITWA 3OP4A 3RBVA 3Q2KA 4XGNA 1LLCA 1HSZA 1DIAA 1YB4A 3F5SA 3NGXA 5TSDA 9LDTA 1UDAA 1ISGA 1QYDA 2OO5A 3RROA 4OQYA 3SJUA 2YJZA 2BFMA 1I36A 2DU8A 3P2OA 4TKMA 3COSA 3QVOA 5JCJA 1O89A 3GMDA 3NRCA 4YRDA 1PS0A 3IP3A 4I5GA 3JQ8A 1DO8A 2IYPA 5CEJA 3LT2A 1PJCA 3VVBA 4EZBA 4IS3A 3DZHA 4ILKA 5KJ6A 3K9QO 1HETA 1R0SA 2VZ9A 4YJHA 1S7CA 1QYCA 2O50A 3DZBA 2IODA 1N9GB 1SBYA 2D1YA 3H4VA 5I7EA 4ALIA 1Q2XA 1LBEA 1UP6A 3GMSA 2BI7A 2HMUA 4IY1A 4PIVA 1E77A 1VPDA 2ZTMA 2OMEA 2AG8A 1GQQA 4BNIA 5A9TA 4TQGA 4J16A 4O6VA 4OYRA 3ZV4A 1E0DA 1E1KA 4XDZA 2C5EA 4CM9A 1U5AA 4B7CA 1Z7BA 4MKXA 3I4CA 5F5NA 4CMEC 5GMOA 4IIVA 1PZEA 5B12A 2NU7A 3OJEA 2OORA 1UUFA 2NLOA 3FRJA 1DJNA 2QIOA 4R3WA 4B7UA 1X7DA 2QRLA 3KRTA 3IUSA 3PTZA 3VC7A 1MB4A 4FBGA 4YACA 2G5CA 2J3HA 5L4SA 4YAIA 1GZ6A 1H93A 4CQMA 3H8VA 3EGOA 1KOLA 2Z95A 4CR8A 2V6GA 4XYGA 2WYWA 1VRWA 1X0VA 4IQGA 3QVXA 3ZHYA 4BVAA 3KM0A 1U4SA 4XEHA 5FFFA 3OSUA 1NPTO 1NR1A 4JP2A 3RUAA 5JCJD 1NASA 1U4OA 1DSSG 5EQFA 4YRBA 4D41A 4GWKA 1O5IA 3GVXA 3QV1A 3ZV6A 1C1XB 1GR0A 4FJ0A 4M55A 1LDGA 4DYVA 1FDTA 5JY6A 1SOWA 3WYCA 4R41A 1T2DA 3MJSA 1VLLA 5IN5A 4B4WA 1ULSA 1I2ZA 2VUSA 3G17A 4MINA 3D3WB 4XA8A 3PGJA 4IMRA 3UUWA 3A9WA 3SX2A 3L9XA 5DBIA 5CDYA 4ONEA 4E4YA 2O3UA 1MLDA 5COAA 1DAOA 1TT5A 4JXKA 1EZ4A 5H83A 2GLXA 4I9UA 5KVVA 1CDOA 2C29D 3D1LA 1NQ5A 1BXZA 2IEBA 1L7DA 4RCVA 3N74A 2DBQA 2VUUA 4Z3DA 4CM9D 5COQA 1WLYA 2NQTA 1IPFA 3AY7A 1R15A 4KWIA 3OQBA 4AJKA 3H3JA 2RCYA 3U09A 2SCUA 3F6YA 2Q4BA 4N5NA 3E1KA 2OBNA 2C7GA 4N18A 3D4NA 1YOVB 2XPCA 3F4LA 4CLOA 3VZPA 5GZ1A 2HLPA 3GVIA 2AQKA 1HWYA 2J6IA 1H6AA 2JD2A 3ZWWA 5T8KA 1MP0A 1MGOA 3JQGB 1TB4A 5JNLA 1R4MA 3VPFA 3PWKA 3JCZA 3RFTA 5L51A 5ICSA 4FFLA 3ZI0A 1IZ9A 3ONFA 3RUFA 2VZ0A 4RL6A 2VNSA 3OH8A 3EDMA 2E4AA 1VI2A 4YA6A 3FWZA 3G49A 4IM7A 4E5NA 1K6IA 4YJGB 3JQBA 4AJJA 2W90A 1CRWG 1VSVA 3HN2A 5A03A 1HE4A 2Q1WA 4PLPA 1YQDA 1VL0A 2D5AA 2J3JA 3EK2A 5BNTA 2PY6A 4PVCA 1LLUA 4GSLA 4JJGA 5DCYA 3E9QA 4LVUA 4RDHA 5C37A 1CWUA 2VWQA 2W2KB 5DBFA 3FBTA 5IXYA 5L4LA 1UXKA 3VVCA 3D0OA 4LCEA 1EVIA 3KUXA 1NP3A 1E3SA 2W8ZA 3VH4A 4MIYA 3WJAA 3H6KA 4D3SA 4RVUA 5B4UA 1EE9A 1JKFA 4PRKA 2AA3A 3WGIA 4FDAA 1A9YA 1B14A 1ZUD1 1P0CA 4A26A 4B3HA 1A71A 3KETA 4JROA 1P1KA 4DTIA 4YYZA 2GN9A 2GSDA 1UZLA 3C7AA 5DP1A 4GMGA 2DPGA 4YB8A 3SC6A 1ZIDA 1GCUA 1J49A 3S2GA 1P1JA 4ALKA 2QX7A 1T4BA 3TN7A 1Y5RA 3WTBA 2XXBA 3QVTA 3ANLA 3HUDA 2P91A 1DFIA 2NWQA 1D1TA 1M75A 1O0SA 1YDEA 4IZIA 4W7HA 4FJ1A 3H5RA 1EQ2A 3PHJA 5FI5A 3SLGA 4OSOA 2O3JA 1DHTA 4IDGA 1PR3A 1I10A 1Y8QB 3WQRA 5C7IO 3NX4A 4Z9YA 3L07A 4MDHA 1R4NB 1PL7A 3WB9A 2DUWA 1ZW1A 4MPDA 3IL2A 1A72A 1PS9A 2VWPA 5JAIA 3UF0A 2O3TA 3V8BA 4ZGWA 4B4OA 4KP7A 4EEZA 1Q1NA 2I6TA 3UHAA 1ZMTA 3PQEA 3P7MA 4BIIA 8ADHA 2BFAA 1T2FA 3INGA 2EIHA 4HFNA 1B7GO 1NYTA 4M8SA 4YJFA 3RJ9A 1LI4A 1E3WA 5JYAA 4MVJF 3TL2A 4MVJA 4R1SA 4UEKA 4F46A 1I8TA 4KUEA 1DB3A 1IE3A 1LQUA 2YFHA 4FCCA 3B1FA 3BMQB 2J8ZA 2LDXA 3AM4A 3ZU3A 1GUYA 4BO0A 3EZLA 1YKFA 2PLAA 3MOIA 4LVCA 2EWMA 3VAZA 4K6CA 1GV0A 1H94A 2FZWA 2VOEA 3F3SA 3ZH2A 3BYZA 2WE8A 1N2SA 1LRLA 3QWFA 1XU9A 1I3LA 3HHPA 3TZHA 2TMGA 1RYEA 3JQFC 2QZ9A 1W6UA 3A1NA 4NK4A 1GQ2A 1Z45A 3AUUA 4PLTA 2ZK7A 2TMDA 4GPD1 1YQGA 4KTVE 1ISIA 3I5MA 5T64A 5CDUA 2X4GA 2I99A 1IB6A 4LGVA 1KVQA 3ONDA 4IGEA 4BKRA 1X13A 3C24A 3I9JA 2CSUA 1YL6A 4F45A 1HTBA 4GWGA 4E32A 4W4TA 1GY8A 4JIGA 1QP8A 4A2CA 3WOHA 3PHLA 3IP1A 3KYCA 2XAAA 1MXHA 1Q0HA 4E12A 3BHJA 4OO3A 2AE1A 2BHLA 4J90A 4WK6A 4J1NA 5EL0A 2EKLA 4G2NA 5ILGA 1EVZA 1YE3A 5ER9A 3KZVA 2UV8A 3M2TA 3AWDA 1T24A 1KC3A 4Z0TA 2OXIA 3TFOA 4E2XA 3RIHA 2C5AA 4J1TA 4Z3KA 2D2IA 4CUZA 4RVHA 1V3TA 2NVWA 2BELA 3JD1A 4I5EA 4XYEA 1R4MB 3D4PA 2OHXA 1DIGA 1UAGA 1QMGA 3D64A 4JP3A 1X1EA 5JC1A 3NJ4A 4PRLA 4IUYA 1MUUA 3WIDA 4RF3A 1DIHA 4Z9XA 2IYOA 4J91A 4IBOA 4IINA 1Z75A 1ZEJA 3EAGA 4WNCA 4LSWA 4TZKA 2DTEA 4IDDA 1ZXBA 4FW8A 1PSDA 4I08A 3SBOA 2IEDA 2CVOA 4RDIA 1PJ3A 4EJ0A 1GPDG 3LT0A 1J5PA 3OQ1A 5JPIA 3QWIA 6LDHA 3HDHA 3PDJA 3DBRA 2PGJA 2YFQA 5A3VA 1E92A 2R00A 1NFFA 2Q1UA 1IYZA 4QEDA 4CR6A 3JQEA 1AUPA 1U8FO 1FDVA 1MC5A 1B26A 1IHXA 3QSGA 3E8XA 3DZKA 4OGWA 3NDJA 3CH6A 3DMTC 4PLHA 1GAEO 1EVYA 4ZQHA 4YBZA 3NAQA 2I76A 3GZNB 1DLIA 4WKGA 2V6BA 4XQ9A 3BMNA 3Q11A 4Y98A 1VL6A 5ADHA 5T73A 3QWBA 3DC2A 3C1AA 1GTMA 4HY3A 4EUFA 2ZJ1A 1GYRA 1BRMA 4AJLA 1LLDA 1C1DA 3HADA 3K2EA 4LN1A 4CM3A 4PLGA 1ULUA 3RBXA 4NZ9A 3QWAA 2NACA 4YAGA 2PZLA 5K6AC 4N5LA 1P1FA 3WJ7A 3KLMX 4NBWA 3UW3A 1D3AA 1E6WA 3QVWA 4U6SA 1MC4A 4DYDA 4FJ2A 1W73A 5B37A 4BO3A 2JJYA 4A7PA 1R6DA 4EUEA 4J4BA 5A5FA 4BO5A 3GGGA 1UDCA 5DOZA 4CM5A 4CMHA 1QV7A 3GOHA 1KY4A 5G0VA 1WWKA 2AQHA 5K9ZA 2DUUA 3OJ0A 4TZTA 3AFMA 1HDXA 1OMOA 2BFPA 3JQ6A 2ZB3A 5DCWA 5I7SA 1NWHA 4J2HA 1E5LA 1PU2A 5EJ2A 3WYEA 3FHLA 2Y05A 3QWHA 3K6JA 4FOOA 4Y67A 4BGEA 5COBA 5TJHA 3WS7A 4OOFA 3RWBA 3ZWVA 1UAYA 2FR0A 3Q1LA 2EKQA 5L7YA 1XA0A 1Z73A 4YJFB 1ZNQO 3PZBA 5TX7A 3W8EA 1C14A 4G5HA 1H2HA 3UICA 4NU5A 4XIJA 2X8LA 4Z0HO 1EMDA 4I5DA 1PQUA 3W4KA 3AFNA 3B1JA 1Q7CA 5ENVA 3D4OA 1DC3A 3VPXA 1GQYA 1VJTA 3H65A 5DULA 2PWZA 3BHMA 1XCBA 4D46A 3VZRA 2ZYDA 4CLXA 2BMAA 3JQCA 3W6UA 1I3NA 1YB1A 5KKAA 3GNQA 4RZHA 3KLPX 1N9GA 2YY7A 5TIIA 2VNAA 4CL3A 1KYQA 4ND3A 5JYEA 3A28A 3DAPA 1JKJA 1JKIA 5I8ZA 3INRA 3RUHA 3V2UA 1WW8A 5THQA 4ZD6A 4RZIA 3RVDA 3QIVA 1FXSA 5U1PA 4R51A 2OBYA 2A35A 5A02A 2UAGA 3QRWA 1OFGA 2GGSA 4HNGA 1PJQA 4W9NC 1PQPA 1EFLA 1DEHA 4FSHA 3E5MA 4YT8A 4MO2A 4GKVA 1JN0A 4WCDA 4CLRB 5JMPA 4E5PA 4PN3A 2C59A 5TGDA 4AJOA 1FJHA 3GRKA 2PV7A 2H63A 4K1LA 3HFSA 2JAPA 1H6DA 5KVSA 1KS9A 1U9JA 2RH8A 1E3EA 4DLBA 4OHUA 4ITUA 3KSDO 4K6FA 4OSPA 1H2BA 4AJ2A 4HWKA 3V1YA 3OFSA 1U3UA 1ZH8A 4AJHA 1DRWA 3GT0A 3MOGA 3ZWPA 2G1UA 5DP2A 4YXFA 3LDHA 4GLLA 5ENDA 4GQAA 4ZQBA 3A4VA 3PQDA 3U62A 2JHGA 1HKUA 2OZPA 4ALNA 5HS6A 3HB5X 1C1XA 4CMKA 4ZICA 2VCYA 3K2BA 4CLEA 3G1TA 4BO6A 3LZ6A 4PG4A 3PDUA 5KIAA 5A06A 3NDIA 2C0CA 4EW6A 3GA0A 2R6JA 4J0FA 3Q9UA 4DL9A 1Y9AA 4FD3A 4FN4A 3D3WA 4D42A 4HKTA 1ISHA 2AEMA 5JE8A 2X5JO 4BQRA 1T2AA 3R0IA 3GR6A 4NQZA 5DZSA 2OOSA 5IN4A 3E5RA 3UCEA 3L4BA 5TQVA 4DC0A 4E2YA 3DBVO 3NDRA 2JAHA 3ZWOA 2H9IA 2Q2VA 5EQDA 5C7LO 1E1MA 1SPXA 1PZHA 2DM6A 3O26A 1ZFNA 3DMYA 3RBZA 2HJSA 3FR7A 2VHXA 2B4RO 5T67A 4BNLA 4WCFC 5L7TA 2FWMX 4DRYA 5I7VA 2VUTA 3KXDA 1EQUA 3VOSA 5CAEA 4J49A 5JDCC 1QLJA 4BNUA 1O95A 1YOVA 2FSSA 3GNSA 4MP6A 4BB6A 3NUGA 4GLOA 5MGBA 1PGQA 1DAPA 1E6EA 2IRWA 2HRZA 3JQGA 1H6BA 3AK4A 3JV7A 4BNWA 1JW9B 2Q45A 1XLTA 1X7HA 1E5QA 2Y68A 4N5MA 4RORA 2IXBA 5CFZA 4YQYA 4RF5A 4NG5A 3ZWBA 4MJLA 1PL8A 2P5YA 1DLJA 4IS2A 4OXNA 1EK5A 3I9OA 1EK6A 5JDIA 4YJGA 1GADO 1JWAB 3Q9NA 4BGUA 4OH1A 3R6DA 1SC6A 4ND5A 4K9DA 2F1KA 2HKIA 1H0KA 4J7CA 4NR0A 2FY8A 1XSEA 2O7SA 1U3TA 2ZB8A 1M66A 2Z1MA 1NVGA 1ADFA 3MJ4A 3MTJA 4WLNA 4XQGA 1EUZA 3DTTA 3GEDA 1QG6A 1TVEA 3RC9A 1I32A 4UEJA 3U5TA 4J0EA 2GZ2A 1PJTA 1U8XX 2EXXA 1YO6A 1X0XA 3ZU5A 1R12A 3NV9A 3NTOA 2ZCUA 1PR9A 3FTNA 3ZWNA 2CFCA 4J4TA 1R0LA 4P4LA 3GAFA 1WZEA 4IGFA 2A4KA 3CTMA 3IC5A 2GERA 3IKVA 4P4NA 3UFXA 1XDWA 4PG8A 2X0IA 5ICMA 4FFPA 2VRCD 1B15A 2E82A 3K96A 2C82A 1XKQA 3BTOA 4KQWA 4ALLA 3EUWA 1R37A 4F3YA 4TMFA 2Q49A 9LDBA 1YBAA 3GVCA 2NADA 4HXYA 1HE3A 3V2GA 3ZN2A 5B1YA 3PWZA 3ZV3A 4BNGA 3UKOA 4TRNA 4Z9FA 3RQSA 3ULKA 1D7OA 3Q0EA 2O2SA 3OF2A 4D44A 4XDYA 3OQ6A 5JFOA 3PLNA 4GGPA 2Q1SA 4ZN6A 3ZNQA 1E7YA 1HDOA 3TZCA 4NI5A 1LDNA 1Y8RB 3RUDA 2YYYA 4E5YA 3C8MA 1TXGA 1XU7A 5JBIA 1Y8QA 3DZGA 7MDHA 4S1VA 3H9EO 1R4NA 1XQ1A 1NVTA 1A27A 4RF4A 3N58A 3JYLA 3O38A 3VPHA 4IIUA 4E6PA 3ZW9A 3OA2A 4MIEA 4RGBA 4CMGA 3LT4A 1X7GA 4AJ4A 5MDHA 2GF2A 1IUKA 4ROSA 1E7SA 4W6ZA 1DDOA 3ZHBA 1E7WA 1P74A 1MV8A 3RD5A 1GZ3A 1KVUA 3JTMA 1AXGA 3SJ7A 3KSUA 4XZ3A 3PHIA 2G0TA 3HJAA 2OP1A 2X1HA 3GC6A 4RPHA 1GEGA 4QFDA 3I4FA 2WDZA 1M6WA 5CDSA 2X0RA 4EGFA 1KY5A 5KOIA 2PGDA 4RPGA 3BMQA 2NVBA 3OJOA 5CG1A 1NR7A 5L4NA 4KWHA 3FR8A 5TRTA 2PR2A 4IMPA 2Q1TA 4PFJA 3QY9A 1GUZA 3RFXA 3RASA 3ORFA 2NTNA 2IZ1A 2B35A 1BW9B 4UREA 5EINA 1P3DA 3BIOA 2I65A 3QA9A 5A9RA 1VKNA 1ADBA 3QQPA 5T8KC 4J3FA 4LK3A 2GRAA 3T7EA 3WWZA 1SB8A 4JBIA 1E1LA 1DRVA 1NTOA 1ORRA 2O2YA 1BMDA 2FOIA 2O3QA 4TWRA 2DBZA 4WGGA 2GASA 1RM3A 3D7LA 4M86A 4ZRNA 1CETA 1YJ8A 2O23A 4AFNA 2YQ5A 2H1SA 1AE1A 3BTUA 4O0LA 3DDNA 5IZCA 2HK7A 4YR9A 4DPLA 5TS3A 2HK8A 4FS3A 2NTJA 1QYWA 1SOVA 2DVMA 1Y7TA 3EMKA 4CMJA 4DPKA 4CMEA 2DT5A 4YVFA 1LJ8A 5TT1A 5JY1A 3BMOB 1IY8A 3VPSA 5L9AA 1LDMA 3ZV5A 2WMDA 1PZGA 2DQ4A 1F0YA 3UH1A 1W8DA 2ZYAA 2JCXA 3DXFA 3F1KA 2YUTA 4UULA 4XRRA 4GL4A 4ND2A 4XB2A 4WLOA 4RQTA 3DAFA 4NJOA 1JU9A 4J7XA 1N1EA 2DBVO 2FSVA 3F47A 5I9MA 1YXMA 4BQPA 1GYQA 1PIWA 3QHAA 5H82A 1HLDA 1AHHA 4JBGA 4C4OA 2VRBA 3ADPA 4R68A 1RKXA 5EESA 2YDYA 3VH1A 2P9GA 2XXJA 1JVBA 4YWJA 1DXYA 1KEPA 2HAEA 4LRSB 1PX0A 2EGHA 2WM3A 3ROPA 3FD8A 3WFIA 3ICPA 2PD4A 1NX6A 3VTFA 4F6LA 1V0JA 4PG5A 1Q7GA 2ZJ0A 4M49A 4AICA 1WVGA 4IJKA 2V6FA 1DOHA 3TSCA 4CPDA 4RVDA 1ZSYA 3M1AA 4PZEA 4C7JA 5G0TA 2ZB7A 3I9NA 2A94A 1ONPA 2O4CA 2Y1DA 4R69A 1Y9EA 1HLPA 3GG9A 3GZNA 1I2CA 3H7AA 3I3OA 1ID1A 4WCFB 4A5OA 3G0OA 5HTOA 3MCVA 3VH2A 1VJ0A 4YPOA 4HNHA 2X0NA 1I01A 1BDMA 3PEFA 3PI7A 3GFGA 4GGOA 2PZMA 3GY0A 2EV9A 4LSMA 2X23A 2D3TA 4NJMB 4YAKA 5KVQA 4QXMA 4U5QA 1EFKA 2D0IA 2Y67A 3ROKA 1BWSA 5I9NA 4DPMA 1N1GA 4XRGA 2PD6A 3CUKA 4E31A 2IZZA 4XB1A 5JYFA 3PJGA 4CM8B 3PK0A 1HYGA 4IJVA 1SZJG 1K89A 3NTQA 1M67A 4P38A 5G0SA 3TNLA 2GDZA 4D43A 3MJTA 2X0JA 3HWRA 3TDKA 3RU7A 1G0OA 1O9BA 3WR5A 4NMHA 1UZMA 4OAQA 3DWFA 1GD1O 3JQ9C 4GX1A 3PFWO 3F4BA 3K8ZA 1T26A 2EERA 1UJMA 3OIDA 4R4JA 2ZTLA 4A27A 1VM6A 1OBFO 3EHEA 3HSKA 4GX0A 3RI3A 2CVZA 1FMCA 3PVZA 2NSDA 1ZK4A 2Y1GA 2V65A 3AM3A 2JD1A 2V7PA 2POQX 2AW5A 2O4UX 2EGGA 5G4KB 3U4HA 3GN1A 4L73A 4E2WA 3CEAA 5AXCA 1PGJA 1EDZA 3FNHA 4IQ8A 1ENYA 4EI2A 3DOJA 3FN4A 4L74A 2UDPA 2QW8A 4A73A 3EY4A 4OJNA 1DPGA 1A4IA 3LQFA 3SEFA 3AM5A 4HADA 4AJIA 4BKUA 4Z6KA 2IE0A 3R1IA 1TA4A 3GF4A 4P4GA 4U7WA 4HFRA 3UXYA 2P4HX 2B37A 2QRJA 3LC2O 3HE3A 4PG6A 4ZA2A 5ILOA 4XJTA 5IDXA 4QX6A 3A14A 4MIOA 1NM5A 3FSRA 2GNAA 1JWBB 3VKVA 4R1TA 4E33A 4L9RA 3ST7A 3WNVA 3WSVA 4XR9A 3ZNOA 1NHWA 4XX0A 1YRLA 3PZRA 3VZQA 3AOGA 4DIFA 3JSAA 1ADCA 1Y1PA 4CV0A 1QR6A 5HS4A 3O03A 4YEDA 3PQFA 4BO8A 4AG3A 2Y0DA 3ZNNA 1ENPA 4E0BA 3DHNA 3RKRA 5L40A 1GL3A 3PYMA 3K30A 2VHWA 5U9CA 4L4RA 3B70A 4CLRA 2OUIA 4LMPA 3U4IA 4X54A 3RUIA 1G0NA 3STHA 4GX2A 4WECA 5T57A 3DQPA 3ETGA 5LCXA 5J23A 1W4ZA 5JXWA 1LSSA 4YQZA 4QO7A 3L77A 1WMBA 3O8QB 1HYEA 4Q9NA 4RQUA 3RJ5A 1XELA 5DF1A 4DVJA 3WICA 2I3GA 1HT0A 1VSUA 4Z0PA 5FYDA 3AJRA 3ZGYA 2VWHA 2WYUA 1B0AA 1A9ZA 2NU6A 2HMSA 4DQVA 1P33A 2O3SA 4MVJE 1XYGA 3JQDA 4Y9DA 4O5OA 1B16A 3MEQA 1DBVO 2VHYA 3BA1A 2D5CA 4BMSA 3ZWMA 4CM1A 5A3JA 1VC2A 1FDUA 2GYYA 1GDHA 2VYND 3O4RA 3S2FA 1TT7A 3GRPA 4ZHSA 1PS8A 5JAQA 1WAMA 3KYDB 5EIOA 1F17A 1YVEI 1YB5A 4NBVA 4RLHA 4N54A 1HZZA 1C3VA 3ONEA 5AOVA 3GAZA 2NNLD 1WPQA 4KUGA 1N5DA 4W82A 3X2FA 3H9UA 3JQFA 2XF8A 4DMLA 3PJEA 2F00A 1P45A 4KQXA 5IF3A 3E82A 3Q2IA 2VTDA 2B36A 4OXKA 4B4VA 4CUJA 2PKQO 1GUFA 1UXJA 1SCUA 2AEJA 3I9MA 4U8GA 1OC4A 2VWGA 4CL8A 1WZIA 2J5RA 5AXAA 3IJRA 4BNFA 1C0LA 2HUNA 2QRKA 3HDJA 1ISFA 2AEFA 1JA9A 4IJUA 2Y0CA 4OXYA 4GVXA 1G6KA 2YW9A 3GH3A 4OMUA 4BO9A 1LSJA 1I3MA 4B79A 1YS4A 2GPTA 3IS3A 4Q3BA 2J3KA 4CM4B 3CMCO 3PWSA 1TEHA 5G4LA 5JAMA 3KOUA 1LRKA 1MG5A 3WNQA 1KETA 4NU6A 4Q3NA 4L76A 4MKRA 5L3ZA 1GCOA 5IJZA 5CP8A 3ZWAA 4JQCA 1UH5A 3GNTA 4AVYA 3IKTA 1XQ6A 5F3RA 5K0ZA 1HDZA 2VZ8A 2CY0A 5DT9A 1PQWA 4BNMA 3GPDG 4GAEA 2YV3A 3P5SA 1EEHA 3TRIA 3WSWA 3HDYA 5F1KA 1YL7A 3GEMA 2DTDA 2GUGA 3FF4A 4BNYA 4E30A 2HMWA 2ZTUA 3R3SA 4PVDA 4IDCA 3QP9A 3VTZA 4BO1A 3AY6A 4WLVA 1QYXA 1SB9A 3WLEA 1M2WA 4GKBA 1V9LA 4EDFA 5KJCA 2JL1A 1M6HA 1Y5MA 1Q0QA 2X7HA 3GEGA 3WGOA 2CDAA 3M6IA 3T4EA 3OIGA 2PD3A 3L4SO 3RFVA 4D3DA 1D4FA 4WE3A 3GK3A 4BNXA 5JC8A 1Z74A 3BHIA 1GZ4A 1ZSVA 3F5QA 5TC4A 3BZUA 2Y1FA 2D59A 3DMTA 3WGZA 4AJ1A 1KC1A 2EKPA 3P19A 3DZJA 1QORA 5T5QA 4FQ8A 1ZSNA 3U4DA 4QUKA 4EUHA 2HRBA 1I33A 1MG0A 4K26A 1OOEA 3VDRA 2BFOA 3IMFA 4J2OA 2CNBA 4UUNA 4BKQA 3KYBA 2VHVA 3F46A 1LSUA 3GVPA 4BGVA 4I1IA 1K6JA 1Y8RA 4XGKA 5IAAA 1L1FA 4QSMA 4WLFA 3ENNA 5DCUA 2RH4A 2B83A 3UN1A 4I9HA 5FF9A 5KJEA 5KTKA 4YJDA 2H5LA 4GI2A 3DZFA 1ZK1A 3AOEC 5B4TA 2WTBA 4LW8A 5TNXA 1N7GA 2YHIB 2AE2A 3RUEA 3O9ZA 1VE9A 2EHDA 3G3EA 2VT2A 1ML3A 3CSDA 3PIIA 4KZPA 3GGOA 3TOZA 5KNLA 3NT2A 2QHXA 4I5FA 4FPXA 1R0KA 4QQRA 1X1TA 4XYMA 5HA5A 1NQOA 2CVQA 5DOVA 4FGSA 3Q6IA 2YV2A 1CJCA 3OHSX 1YGYA 1ZJYA 2UUPA 2QZZA 1SEVA 3H2ZA
chains in the Genus database with same CATH superfamily
2OG2A 2QTVA 2HLDD 2VP2A 1GUDA 1WCYA 3BWCA 1SXJC 3O4FA 4TL8A 4NABA 4BNTA 2J0UA 4KACA 4EGAA 3KJNA 4HNAA 4RF2A 4BMXA 1F6DA 1OHHD 1QF7A 4FUQA 2ZQZA 5TQ0B 5BXYA 1EUCB 2JHCA 4NZMA 2H1VA 3M81A 4KBYA 4RZ2A 3C3EA 4X63A 2XDAA 5KWEA 2OCKA 2J5KA 4NHEA 1SOUA 4EJFA 1ZIOA 2HYIC 5IHPA 4EZEA 4UM9D 2H4ZA 1QUEA 3P2EA 2XUQA 2D5IA 2I6XA 3ESDA 3PYLA 2E3JA 3JRWA 5CX4A 3GROA 2WNHA 4WXEA 4ZTZB 1JIKA 1O96B 4N3NA 1MIOB 1SOAA 3AB8A 3DC7A 3O0TA 4WKOA 4WK2B 2J6CA 4V1CA 4ZT7A 1OXSC 4B3MB 1P6XA 2VJMB 4RA6A 1K8ZB 3V6MA 1H6CA 2D8MA 4LYAA 3ZIAD 4BX3A 3AKYA 5LJIA 1R9JA 4IGAA 1UDBA 1V1MB 2WV9A 1AT1A 3HFJA 3EGCA 1ZRHA 4JJEA 4A10A 2NPFA 1PUXA 3R9IA 1IATA 1VIDA 3LQQA 4D6PA 3IDSA 1RE1A 2CHFA 4LJ8A 4KK4A 1TZKA 4HGZA 2PSJA 1QIDA 2Y66A 2Z0MA 4HDOB 2I2AA 2AZ4A 2IXGA 3IQFA 4BXOA 1WOYA 4P0TA 2VNKA 3VM6A 1B8PA 4P2BA 3ZS8A 2DMRA 3HM2A 4YRZA 3W78A 2ONZA 1N3IA 3G88A 4OHVA 1QE3A 4QUEA 1JHUA 4GSKA 3OPYI 4W9NA 3VO1A 2WSMA 1JPJA 3Q8MA 1JAZA 2BCGY 1XTKA 2LCFA 3F1LA 1UXIA 1TYZA 3SQNA 4EKIA 4EYQA 3V80A 4L5CA 2YJGA 3KZ1E 5A9SA 4TTPA 2XRFA 1ISMA 3RSSA 4YUZA 5THKA 3HP1A 3PTLA 5CH5A 3Q3CA 5HM6A 3ANMA 1M6VA 3C15C 4BEVA 2XSZD 1E3LA 2Z56A 1KBQA 3EZNA 3GXBA 4G8BA 7ADHA 4LISA 4XM0A 5KINB 3LS2A 3ZW8A 1GGHA 4J1SA 4RWZA 3ACDA 3QPDA 3DB2A 5FI1B 2J9FA 3WLTA 2QXTA 1TIBA 4L5YA 1KVTA 4OHPA 4WOJA 3OCZA 1ABFA 1CVIA 1E9BA 2CJPA 2BW0A 5KJ1A 4CV1A 5TF4A 3SVTA 3RC2A 4PY2A 3TNFA 1TC1A 3LDGA 5CURA 5BXQC 2ZCJA 5DPMA 1VE7A 2IIVA 3PHBE 2FEOA 3P97A 3EB9A 1XRSB 3FJ1A 2CNOA 1CK4A 2WTXA 3OMLA 2WWFA 3E8MA 4KN8A 5ALWA 2FP4A 3TKAA 4C6HA 4DLVA 4M6WB 4I4IA 4R16A 3BX1A 1M34B 3H1GA 3Q8XB 1CYDA 4IHJF 5ITVA 4ZFNA 2Q1YA 2XEDA 1IVYA 3E05A 1KU6A 5ALUA 1QR2A 1N2OA 3UWOA 5ADVA 5KMGB 4FFBB 1MFPA 3ZR4B 5BVHB 3EMVA 1HDCA 3ID6C 4Z4QA 3UK2A 4JD5A 1PLJA 1M76A 3KLBA 1LWOA 1AH2A 2NUPB 3BIWA 2NV6A 4HFMA 1O8CA 3A8TA 2I4RA 2R48A 4MRNA 1ZJ5A 2RJ3A 2JC3A 1RKQA 2FPGA 2VDVE 1GU7A 2ZRAA 4CW7A 5KOJA 2HU2A 2QVZX 4D56A 3EXIB 2QR2A 2WJAA 4IRUB 1LBTA 3P8ZA 4KK3A 4NFYA 5BWMA 1SRQA 1H9AA 3L6CA 4FMCB 4M36A 4O3FA 5IBRA 5ESDA 5K3FB 1MJHA 3U81A 4E21A 4Q4CA 2Z5FA 2GK7A 2NVUB 1XRQA 4DBVO 2IBSA 4YCJA 1PK8A 3DUWA 5FUVA 1IZ0A 4ZOCA 5ARCA 3OM0A 4E3ZA 4HT3B 4Z1MD 4Z4HA 3SS7X 3MUEA 3EW7A 4MQFA 2GI4A 5FPSA 3LF1A 4HR7A 4ZMSA 2Q5CA 3FNEA 4ZZ3A 2JHFA 4KPYA 3SVLA 2RHOA 2JFYA 4FEYA 3KAPA 2GO7A 4TROA 5CTJA 3ROGA 1HZJA 3IT2A 4HS4A 4Q19A 2J9RA 4QO7A 5AK6A 4CYMA 3K1TA 3MGBA 2NZUG 4V2IA 2HA2A 1RYYA 2WIBA 3NBUA 1GAQA 5CVCA 1JV2B 1K7YA 4DDTA 1WSBA 1T4MA 2EX4A 1UQRA 3CKLA 2AZTA 2ISQA 4P8RA 4B3SB 2G76A 3D3NA 1YZNA 2QM3A 3K0CC 4MDYA 4FFRA 4WDRA 5K6TA 3JVEA 5E6RB 4R6WA 4NOJA 5FPQA 2NO9A 4MCIA 2ALJA 3NAGA 1HE5A 2V6MA 1FK8A 1W25A 3U9TA 3KVOA 1EWRA 2ZIXA 4RJTA 2XKBA 2BBSA 4WT7A 1T0UA 2MSDB 3G9UA 4H7IA 3ZEAA 1K0UA 3EBOA 1HM5A 4HAVA 3K6KA 4BZPA 3VX3A 3AY0A 2XWQA 4RY9A 521PA 2FRDA 3BJMA 2AXNA 3PUIA 4PLWA 2FR1A 1PNQA 3GFOA 4W7SA 5KNDD 3ZU4A 4RTPA 4BB6A 2J87A 3RSHA 3CIFA 4DMKA 1ZH6A 5G4KA 4IG4A 1PJ4A 2NUBA 4FFSA 1Z2EA 2QRNA 4UHEA 4BNNA 2PH1A 2ZE7A 3IV6A 4KO2S 3WWOA 3BRCA 4CTOA 1U2PA 5L53A 2WICA 3RNOA 4JJFA 3LPDA 1IM8A 3PD7A 2Q5IA 3R0QA 4BVHA 2Z5VA 1NPYA 1KEUA 1Q0RA 3DP7A 3OKAA 4EJ6A 3EFBA 1K2WA 2V8BA 4UCQA 3O9MA 5CA0F 4ZI5A 3CLTC 1WVIA 1Z18A 2HJRA 2PEZA 4G5SA 4MWBA 1YVRA 3B51X 5EXPA 4QLOA 3W4JA 5IZCC 1GL9B 4ZV7A 3P9XA 1L5OA 1PHPA 4ZO4A 2ZIZA 4UTOA 1ZCJA 5KHAA 4HS9A 1H69A 4II2A 4E09A 5DYWA 1L3IA 2IUUA 2HIGA 3DZIA 2OR3A 2OP0A 1UEXC 1M7GA 3T94A 5GADl 1G66A 2WVAA 3H9JA 1S6YA 5IWCA 4Q18A 2E37A 1UM9B 2E5WA 2I2DA 2VK4A 1ZKDA 2R4UA 2AMFA 5DTMA 4MOWA 2UZ1A 5CT6A 2QMZA 2YZGA 2ZZMA 5DGIA 2C4HA 4AWBA 1H5UA 1SJ9A 4D8WA 4IXTA 5KU7A 4AO8A 4OK6A 4B34A 2VH1A 5DTJA 1RAEA 2XVZA 1PKEA 3ROQA 2JANA 4MEJA 3ZCQA 3JZIA 1CQJA 1G3RA 1OAKA 4GBED 4MK4A 4UVDA 2HX1A 3UOGA 5JBNA 2HBQA 1AK2A 2QN2A 1WDLA 2ZT5A 4E08A 2CFSA 3GPBA 1C3LA 2CCKA 3FPKA 4YRCA 5FLYA 4BNHA 5BWBA 1QLWA 1Q1GA 1U1FA 4HZUB 4KMSA 4QOIA 4PZYA 1H2AS 3DAGA 1J2TA 2X6TA 4G85A 2JI7A 3SEQA 2VJPA 3I1JA 4N48A 2R25B 2GM3A 1E2GA 4ENRA 4HWGA 2C2BA 3B3AA 2PG3A 5FLEX 5CJ2A 2OC9A 1WM1A 3U17A 4F6CA 2P30A 2A0FA 5KOYA 3ZH9B 3O8LA 1SNYA 1FJGB 3A0RB 4BU0A 2AUMA 1BFUA 1INLA 1RHRA 2RJOA 3LOUA 4ZI3A 3VQTA 2C7VA 2ZE5A 4EDHA 1L4MA 1KO7A 2E49A 2HV8A 3HEMA 1E6UA 2P5UA 3HB9A 1Q1QA 3P45A 2DPHA 1Y6RA 1W88A 4J9UE 3G82C 5IJXA 2Y0EA 1J9EA 4K9LA 2FW9A 1H9BA 1PFWA 5FHQA 4QDOA 4AULA 5JWHA 5H9WA 4J3NA 2ZE8A 3GLGE 4B4UA 4G41A 2CHGA 2WHPB 4F2GA 3PNBA 2Q6OA 4ZJUA 2PGLA 1X3LA 2WU8A 1UPCA 5AJWA 4D2IA 4HYYA 2Q4EA 1J56A 3Q7IA 5A0FA 1LCIA 3F8TA 2WUGA 2H9AA 2P8SA 1M2FA 3U39A 1RVDA 4M7OA 1JEOA 3AIOA 3DOHA 2G82A 2AS0A 1NUAA 2X86A 3IJEB 2PJRA 4R84A 3FDFA 3FE2A 1EK1A 1FSPA 1VXRA 3S1LA 3LY5A 4UMFA 3G9QA 2QN6A 4UVHA 3KEQA 3CZMA 3ZDFA 5LMUB 4H0CA 1Y9DA 2ETXA 2J48A 4NBTA 3V7UA 1KJZA 3HN6A 4I1PA 2B0JA 1QS0B 2WHQA 3FFBA 2YVLA 1X8XA 3ETEA 4CMIB 5ISMA 4JCOA 1PUIA 3GCDA 1NV9A 3IWBB 4LGCA 1S02A 4NF2A 3G6WA 2ZUEA 1C7FA 4BYGA 4JGIA 3CVWA 1TI7A 3BWYA 4DHWA 4AC9A 3E81A 5HPYB 2A8YA 4M8IA 1ECBA 2GPNA 1HGXA 2R7LA 1W47A 2GVDC 2YXNA 2G06A 4M7WA 2QLBA 3IAHA 3N0RA 1K27A 1OX6A 3C3KA 4R1UA 4RJLA 3ZKWA 5I9LA 2ZB2A 3OJXA 1OXBB 4H1WA 3GYBA 3KEGA 1TMYA 1E32A 4N6OA 5B6IA 1JFVA 1JAXA 1XIVA 3OPNA 4KHZA 1DBQA 3SJCA 4NBLA 4JSTA 3UAWA 3HN7A 4ENWA 3D31A 2LNDA 2WMNB 4FK8A 5IDWA 2H2WA 2H2AA 3THXA 1PR6A 1Q22A 1TTTA 3FNBA 4OJQA 2POCA 3GJQA 3T0FA 3T5BA 2FJPA 3N2IA 1FS6A 1QHGA 3KEMA 4HYQA 3QUCA 4L9AA 4EGQA 3SR3A 4DLWA 1VYVA 1JQBA 1UM8A 2AXEA 3GYGA 5ALQA 2FR8A 1TFUA 3BFKA 4OI1A 4ASUA 4DC9A 1K86A 1S1MA 5FAXA 1EA5A 4L3WA 1WU8A 3D5TA 1VB3A 1P81A 3WG9A 2QD4A 4BO4A 5A3QA 3BMCB 2NO0A 4OB6A 1B1CA 3KTAB 3QJ5A 2BKXA 1KF0A 3QE3A 2ZYGA 2RGNA 1NFRA 3OEYA 1IOLA 1E1RD 3WADA 2PPLA 3KOOA 3DVSX 1F2UA 2WJWA 4WVFA 1DJPA 2RKWA 4ZOLF 4LNAA 5AJTA 2DQYA 1T8YA 4HL6A 4QFCA 3OZXA 1ECFA 4OG2A 4YT5A 5JLAA 1L7EA 4J0IA 2Y1OA 4D3FA 3P2KA 1FDSA 1B3RA 1U8ZA 3JVVA 5LYJB 1MR3F 1M2GA 4C05A 3SHVA 2IZ6A 2Q6IA 3AONB 5IT0A 3TJRA 1SWVA 5B7GA 3NOXA 3C8HA 1G1AA 3KHUA 1UYJA 1CUHA 2GPYA 1IAQA 4RCZA 4UM8B 3L6EA 4V39A 4TXHA 4DNPA 5B6PA 1LSOA 1NAHA 4PRYA 4LZJA 4CFSA 1KYZA 3IEUA 1G8PA 4Y6PA 2P68A 2Z30A 5AVTA 2YVAA 4PSKA 3ROZA 1BQ4A 5SZJA 1UBJS 3L1JA 2P4QA 3IIKA 4P5DA 4GXRA 1NU8A 3L4EA 1V25A 4Y2VA 5FOQA 4KGDA 2AFVA 3KSMA 3GFRA 1VE5A 2FEPA 4DE5A 4ER6A 3LUBA 5CEFA 1NFQA 2F3PA 3OEWA 1ZD9A 2Z9DA 4Y0VA 1BCRB 1X94A 3AU9A 4NAHA 5I3CA 1F14A 2O7QA 3NWEA 3DXYA 2XY4A 2HU8A 1CR1A 3ONVA 2E0IA 5GZ3A 3JD4A 4FKMA 4OEHA 4J1TC 5CA1F 4M87A 5JLJA 1JU4A 2R5FA 3KKEA 3UGKA 4CQMB 3CNNA 3VYUB 1JLRA 4G8CA 3EVAA 1BHSA 3EDQA 3FVWA 4HGYA 3WL3A 4PN7A 3KUKA 3VDQA 4MUIA 1P4HA 2AJ8A 1H5QA 2O2HA 3ICCA 4FYHA 5DM60 1YONA 1IBKB 4JI0B 3TLCA 2UXCB 3DEYX 3PWTA 3BC1A 3K15A 4WVLA 3ZCVA 3JQAA 3M2PA 3RC7A 5LU9A 1QO0A 2OFPA 3ILXA 3QKRB 1OQAA 5AI5A 3VYTB 3G1UA 3WX0A 5EPEA 3DR3A 1PZMA 4ZAVA 1Z0IA 4UDXX 1P9LA 1LDYA 5DT2A 1H2RS 2BGKA 3WK9A 1WDWB 1JTVA 1QPGA 2Y0BA 1DZIA 1PJBA 3C87A 4L78A 3ZI4A 4F5WA 3S27A 1XDSA 3UHJA 4D9IA 4OQPA 2PTGA 3SC4A 1N2CE 4TPKA 4URFA 5AJUA 1YA4A 3EYWA 1VIYA 5GOZA 1VCOA 2I4MA 4FOLA 1E2NA 1JZSA 2JGDA 2RAFA 2X9NA 3Q9LA 4XCQA 1WUJS 2PUCA 2Q6VA 3IBGA 4AI6A 1IUPA 2BCEA 4JOSA 4IIDA 4KQCA 1DS6A 3BTVA 5JZVA 3E9MA 3BAZA 1MA0A 2HCBA 2RB5A 1E1CB 2D2VA 2NU9A 1ZCZA 1L5ZA 3DBHA 3CNHA 3I83A 4TSRA 5AXDA 5BT9A 1USGA 3PPIA 2W2QA 3IB3A 3PDIA 4LOIA 5LXTF 3I2KA 4KKVA 1NJ5A 2Q2QA 1LEHA 5A4FS 1M2NA 3V7WA 1W6RA 2O07A 1HQKA 2XE8A 4L6IA 5L95A 1AV6A 2B4QA 2HCTA 2R2GA 3DCIA 3RSZA 1DX4A 5FWNA 2BGMA 4DM3A 3OY7A 2DRIA 2VH5R 4DV7B 1QONA 1MDBA 3A6HA 1XZAA 1W96A 3ETCA 4CLOB 3L8DA 4UFNA 2FN7A 2BZSA 3ZCSA 4BLUA 4M1QA 3CKYA 3NAZA 3RVQA 3AUTA 4ZVLA 3HVJA 2D1TA 3R3JA 9MHTA 1U5CA 4OAOA 3I6MA 3WSTA 3UOAB 1GGNA 1DJQA 1HPLA 2HSDA 4ZQEA 5K3SA 1R88A 1ZJ6A 2OAEA 4DA9A 4JOQA 4Q12A 2GPBA 3HB0A 1NBOA 3NKLA 4Q9AA 5DBHX 5EMMA 2AMJA 4RQAA 3JQAD 1SO8A 2AG6A 2M1ZA 4QD3A 3I6YA 3MZ0A 3RT1A 4DB2A 1E3QA 2NXCA 4G5XA 2FLVA 1SCJA 4NRDA 1AK9A 4LNHA 2NMVA 2IIPA 4BWFB 3P0FA 4S1WA 1Q92A 2FW1A 2V7UA 3I6IA 3KSBC 2GRJA 1Z62A 2MCFA 4BLVA 5FTMA 2A78A 4O4JF 3NXKA 3TNJA 9GPBA 5DDIP 2H4WA 3L0CA 4D4HA 3WC4A 4KDFA 4U7GA 4KR7A 3MWDA 4FGUA 5JBQA 4J6EA 2ZREA 4IH1A 4ETWA 4IIJA 4DCNA 4I2NA 4UUPA 4U6NA 4LGYA 5HF9A 1PAUA 1XT6A 4Q82A 4UVIA 1PYDA 3FDJA 1PX2A 3JAMA 2REOA 3KB8A 2H7XA 3E9ZA 4TTAA 4P22A 2D00A 2I03A 5CM8B 2FMUA 1RWQA 4BFTA 2P1RA 2CXPA 2RFLA 4DMRA 3E7WA 3QELA 3U4QB 4KYVA 2GXUA 3FNQA 4G4IA 4FXOA 3QVSA 4MS1A 4OU5A 3RVMA 1E3MA 4L4XA 4QU0A 4OBXA 2PSFA 2YHUA 2WYVA 1E1QA 3LUGA 1UCFA 2EW8A 2J32A 1F0PA 1ZGZA 2IF2A 1CC1S 1DQPA 2QAGB 2W93A 3DLIA 4HDMA 4JKOA 4ON9A 2I4LA 4QBIA 2EJVA 4X84A 4Q48A 1BVRA 4WXHA 4CV3A 4CF6A 2YFKA 1YTUA 1WBDA 4EA8A 2XZDA 5CNMA 5DBGA 1BKYA 2PKWA 1EM6A 1OXTA 1SC9A 1G4AE 1SUEA 2J46A 2YDXA 5E9WA 5J4KA 3KTOA 5JXGA 5L7WA 3M3DA 1MQSA 1QYIA 1Q83A 1Z6YA 3WRYA 4J0QA 1RHMA 2G7ZA 4HJRA 2IXFA 3ZVLA 1ANKA 3TZ6A 3DP9A 3JRXA 3M5CA 5HUJA 2HWUA 3PJRA 3E48A 4KX5A 4G1MB 3OEHA 5TMDA 1FP4B 1GVHA 2QTWB 5LUAA 3V97A 1EFDN 3QE9Y 3HU3A 3U3XA 1WCV1 4LHYA 1KR2A 4HAXA 4XXHA 4YRGA 1X2EA 1JDJA 1L4YA 1MFZA 3VC1A 1DCFA 3V1UA 1S4QA 3PDHA 1XEAA 3RDPA 3OIFA 1KVSA 1U7TA 3H5LA 4NZNA 5DVZA 2VYVA 2ANCA 1EB8A 2OGWA 5FPYA 4JJ4A 1NNUA 4WH0A 1VI5A 2HCRA 3C6MA 3H1PA 4GIBA 2YX1A 4W1SA 4WXMA 4WNAB 3I2GA 2XCLA 3IDQA 3RRJA 4B84A 4EJMA 4B3GA 1E6CA 4OX9Y 2R8XA 2MMGA 3ADOA 4Z4EA 2VAMA 3EGEA 4ETMA 3HA5A 2W48A 4WUVA 3T1HB 1DTSA 4DA0A 3TTSA 5ALNA 2IH2A 3BH0A 3DZDA 4MYHA 4RDCA 4CM7A 2WE7A 2FX3A 5FCDA 5JEEA 2DQSA 5FTNA 5K6AA 2VOJA 2CXQA 1P80A 1LTQA 4G37A 3KR9A 3KB6A 3NHSA 3E27A 2WJPA 3UJPA 1SIWA 2Q2WA 2PBRA 2WHYA 4BS9A 1E1QD 3BWEA 5K0FA 1X77A 3LTNC 4LDPA 2CB0A 4WEQA 4YASA 1REQB 4XWGA 1ZN8A 3MQ2A 4CQLA 3JYQA 5B7NA 1YS9A 4FFVA 3MWEA 1AGRA 1DFHA 4JENA 4D26A 4P54A 4DWVA 2YJNA 3T4UA 4LOHA 3LW7A 2VT7A 1AHNA 4JSRA 3T0IA 3ZK8A 3EIHA 4BO2A 1SZCA 1QVZA 1C80A 2QQFA 4IUCS 4HC4A 4FHCA 1UWVA 2IHBA 3ZCXA 4EBFA 5ELLA 4MV6A 3ZLBA 3C3MA 4QBTA 3T5GA 4H4CA 1KEVA 3OEHD 3OOJA 3WWPA 4H2DA 4S0ZA 4CODB 2NU8A 1RJDA 4DDWA 1QWSA 2V98A 2XNSA 5TMBA 3DVRX 4Q47A 5CDHA 3KCQA 2PHZA 3TV1A 4ETIA 3GQBA 4G1UC 3TPZA 3WQQA 4L85A 1I7PA 1DX6A 3KEFA 1RRMA 1YCFA 1JAHA 3CRNA 3OF3A 3VYRB 4YJ3B 1CZHA 1S5PA 4EJ2A 2I8LA 3QQ5A 5F2NA 1XFAA 4YMSA 5BWNA 1F7VA 3UJHA 1X70A 1SUPA 1QHHA 3BRWA 4O1MA 5JS2A 2H1IA 4FR5A 2WWVD 3ED1A 3M6UA 4O4LA 3TZQA 2WSBA 3UPTA 1NRWA 3AUAA 3OU6A 1XZFA 4DR5B 2Z6VA 3D8TA 3IA2A 1FDWA 3P0IA 4RVGA 4AZVA 1MGPA 3DZ4B 1W5BA 3PB3A 4D7AA 4MCJA 4E5DA 2V9PA 3EC7A 2IY8A 4INAA 4YCCA 4PX9A 1NF2A 4KQ1A 1BA3A 3OJCA 1YBMA 3C3WA 3BDIA 2Q6LA 4Y2HA 5EPOA 1Z0SA 2IDJA 2L19A 4MZXA 4EO4A 5CFNA 1CZNA 3EGDA 5L8VA 1K9VF 5JVDF 1EHIA 4XM2A 3K6SB 1HFJA 1EGMB 5BV7A 2ZRLA 4D0SA 1VIAA 2HQ1A 3FKJA 3S70A 2X1LA 4TS3A 3TEMA 4UTRA 4RHYA 1JQLB 1QGOA 3KBBA 1SBQA 3WO0A 5IT4A 3IULA 4GXNA 2EEZA 3ZHQA 4KFSA 3DHYA 3IQDB 3LC7O 1F06A 1Q7BA 4A03A 1WS6A 5JROA 3EIFA 3FTPA 2R8BA 4NYMR 1G7RA 1DKNA 3OZCA 3I6ZA 4H3VA 1T1SA 5EMLA 1M1NA 4FLFA 1ZNWA 3A3PA 3GCWA 5DM4A 3Q6MA 4OMDA 4QTTB 2VAVA 3B2NA 3R77A 2EOAA 4G0ZA 2HA0A 4BVKA 1NL3A 3CY6A 3EXHB 5A4AA 3GHHA 2ZQ5A 1KO8A 1ETUA 3HBLA 3U4GA 3LUJA 3ZK9A 1LQ2A 1PCXA 1XDZA 4B6SA 4EPTA 2ZSKA 2P2ZA 2WVGA 2YH2A 4MR8A 4TLBA 1QO9A 1T8RA 4GP9A 4FC7A 1Y6JA 3G0BA 4EKDA 2UUBB 1DBSA 4HDNA 1YBHA 4H31A 3CO5A 1LB1B 4P92A 2ZRIA 3G79A 4DQDA 1DWOA 1B8VA 2Q3MA 2WF7A 3FMFA 1JDBC 3I0MA 2OBMA 3BMNB 4Y6SA 3SC2B 4BWGA 1A9OA 5DBEX 2AVNA 3DFZA 3SICE 2V1UA 2X5KO 3B1WA 1MAAA 4JQSA 4PF1A 5JCPA 2QG4A 3O75A 2JCYA 2D2EA 1AC5A 2O2JA 2BEJA 3DE4X 2GJ4A 5DHQA 3WMFA 3T7CA 3W0LB 4TYQA 1VGRA 2JG3A 1JLLA 4O2AF 4B4DA 1JFLA 3OBBA 1U3VA 4HDAA 3L01A 2REXB 3MTEA 4DMUB 4RIGA 1Z2CA 6ADHA 4O63O 3GDGA 3T7KA 3I4LA 4C4PA 1QC5A 3D0RA 1EJ0A 2BSAA 2C3PA 4WBNA 3DPSA 3L02A 1Z25A 3N8HA 3NBFA 4FDLA 3T61A 4BDSA 3MT7A 3UCXA 1KYXA 1YS7A 1HOXA 1YWGO 1TQ4A 2FRDC 1A7KA 1BQEA 1Z12A 2CEAA 3AEXA 3GLHE 4NCJA 4P5PA 2EFCB 3NDPA 1B8UA 3HVRA 2PZJA 5I8PA 1FQOA 4OLFA 3C1UA 3EQ2A 3DYIA 5J4HA 1IOVA 1P4SA 2DKNA 4RHTA 4X1KB 2W9XA 4XUEA 4B8ZA 1A5ZA 3G8DA 2M9MA 3A4LA 5K3DA 4D5GA 4R1PA 4G5YA 2RHRA 4MIKA 1KYVA 3DBLA 2NXWA 4O5AA 2ICAA 1HR0B 4CNBA 2ZPUA 1P2SA 4I19A 3F8WA 3K1AB 1LLCA 3KC2A 1FDOA 3MSXA 1DIAA 2BZ0A 1YB4A 3LOQA 1DCKA 2ASEA 2C95A 2FWAA 2Q3HA 3G2NA 4HDKA 2IWRA 5CBKA 4UEWA 3AETB 2ZJOA 1W44A 2W4IA 3IQEA 4D98A 4Y9TA 3EPJA 5AUPB 3AEUA 2ZM5A 1I36A 2DU8A 2GK4A 5BMVB 1Y7PA 3P2OA 4W8OA 3KE9A 1O95D 2AOTB 1PS0A 3A6FA 3JQ8A 1OAOA 3FUWA 4KXUA 2X5XA 3QEOA 3AVTA 3LT2A 3NATA 3N0TA 3LXRA 5JS8A 3DZ8A 1RCTE 3I6BA 4ILKA 4ZXFA 4FWIB 1J9ZA 1ZOLA 4QXAA 1X9GA 3HH8A 1HETA 5KYXB 1EUQA 1Q0PA 5CB4A 2VLIA 3U5ZB 2CLHB 1DTWA 4RL4A 1N9GB 5I7EA 3R5KA 4EG3A 1FIUA 3OIUA 4W1QA 4F0JA 2JJ2A 2NTEA 1QRAA 4JBYA 2AZMA 4AF6A 2BI7A 3WLHA 3VDMA 5KTNA 2FJ0A 2HMUA 3G2IA 5ICFA 4PIVA 2KLHA 1VPDA 2WUFA 1JDVA 4IUDS 1NVEA 1D2RA 2ZUUA 2ZETA 3OKPA 1L4HA 4OHBA 4RADA 821PA 3A6GA 4TQGA 4J16A 2CLEB 3TUIC 4QUJA 2W2PA 2V54A 4YV7A 5E9JA 4WRRA 1Z7BA 4DBLC 3ZG6A 1DAKA 1P61B 2CMGA 2G9QA 3I4CA 1G8KA 3T6KA 1ZJWA 3FTDA 2DE0X 2GEDA 4XE5A 2FMKA 5DM2A 1U63A 4IIVA 4OVKA 4DA7A 2QI9C 4PHFA 5H3LA 2HPAA 1BE8A 3LQ1A 1J2RA 2AN9A 1MB0A 3EIQA 2WOJA 5HKKD 4NMLA 2XTAA 4LE1A 5CB8A 2R4QA 5AUNB 1JEYB 2XKJE 1MB4A 4IRMA 1CY4A 3IVGA 4YACA 1Z47A 3ET5A 4EYKA 5C51B 4DJ5X 4YAIA 2WWTA 2YZ2A 4DN6A 1R74A 3SYTA 1MABA 2JATA 5J40A 4O3MA 1CCWA 2FEWB 1VRWA 4O4HB 1X0VA 4IQGA 3KQVA 3SXUB 4X1OA 1PR0A 1JHPA 3KR0A 4RFSA 3M1YA 3T9DA 4EY7A 4CU2A 1EFAA 1OT5A 4RHEA 1U4SA 2DFKB 4FT4A 3OSUA 4XEHA 2H1RA 1O2DA 2ZM6B 2B3TA 2C2OA 3GUVA 1IK4A 1SZDA 3O4IA 2HLNA 3OPQA 4KSCA 2NUTB 1D7AA 5E1DA 5EJFA 3ZBPA 3LY8A 1U6JA 4M1TA 3DMHA 2DCMA 1GR0A 4IGIA 2C7RA 4DYVA 3L7AA 1FDTA 1G6OA 3P9ZA 3WYCA 2QD1A 2ZAGA 1VLLA 5ECWA 3S6JA 1ULSA 4B4WA 5B36A 4EABA 4LOAA 4ZTUB 2WV7A 1HO3A 3TSAA 5IULC 4FEAA 3D3WB 4Q21A 5M5BA 1HEYA 3HO8A 4XA8A 3T1QA 2R7KA 1ZG3A 1KXJA 3A9WA 3E1GA 3TGPA 5DBIA 1WTAA 5EEGA 4CIBA 4EVSA 2AN5A 2C03A 3NIGB 5COAA 4U2KA 4ZAZA 1MQ8B 1OV6A 1IY2A 1V4BA 1ZWLA 3ICEA 5AK5A 2XT6A 1MOPA 3FPHA 3MG9A 1EZ4A 4C30A 2GLXA 3T3HA 4PYJA 1X8LA 1HQYE 2JJQA 4I9UA 1CDOA 1YUNA 2D1FA 3OFKA 5JJ5A 2C8VA 3OZEA 1GXSA 1DC8A 5F9MA 3DFIA 1FFXA 2CXRA 3FJYA 3KR2A 1NRXA 5IUNC 1N5JA 1XE3A 1D0SA 3C6BA 3RAGA 1IPFA 3WOVA 3OQBA 3AB7A 2IPXA 3NIDB 1DTEA 1WB4A 4GLJA 2V4UA 2RCYA 3U09A 3EG5A 4LHEA 2SCUA 1H8ED 4FDMA 2Q4BA 1V9CA 1CB7A 4GLFA 3E1KA 2OBNA 1KAMA 2VHCA 3FI0A 4UXJA 4N18A 1DI0A 3LWNA 5IU6A 2C9ZA 3PPXA 4F8YA 1MW8X 2A88A 5DLDA 5GZ1A 4FYWA 1WKCA 3ZY4A 3ZHTA 2P2NA 1Y3DE 1O03A 1OR8A 2J6IA 2WG0A 3BFJA 4ZCPA 1PJ8A 4U8HA 4HPWA 3LWBA 1MGOA 1VBNA 3C39A 4Y2PA 4L5AA 4M9CA 2R62A 1MZVA 1ZNZA 4RXMA 2X7XA 3A6JA 3JCZA 3RFTA 3WLLA 5ICSA 1NF3A 4IRXA 2J3EA 4NCXA 3RUFA 2VZ0A 4RL6A 2VNSA 4AZ3B 3ELDA 3CB2A 3K0HA 1KYIA 3FYUC 3UMFA 4PAWA 2RCNA 1K7XB 3CUTA 4IM7A 4YA6A 1Y98A 3FPFA 2B21A 4L28A 5ALEA 5HMMA 5HX7A 3W5UA 1E18A 4AJJA 2P5TB 2W90A 5FNVF 4AO7A 4DIMA 1TYCA 2QZPA 4BX8A 1PP4A 1YQTA 1CRWG 3IPYA 1NOJA 3RRZA 2Q1WA 5DM70 4HDRA 1A8QA 3NM5A 1CUXA 2PY6A 3GEHA 1A7UA 2AKAB 1N6NA 2K7ZA 2R1TB 2WUEA 4MWTA 1Y9JA 1XK7A 3EAQA 1W36C 1I7LA 2AF4C 3CLRC 4RDHA 2OK7A 3HLTA 4EMBA 3QNMA 3LRTA 4QG3A 2PX5A 1LS1A 2VWQA 2W2KB 3K9LA 4X65B 3VVCA 1XD8A 1PFYA 1NP3A 1NBMA 1R6BX 2AN4A 2CBZA 1NMXA 2HN9A 2I8CA 3PPVA 1Y7LA 2W2OA 3STUA 3TTWA 2GS9A 1EE9A 3D4BA 4MYSA 2BM0A 2RG7A 2VAWA 1UMKA 3BCUA 5H59A 1N0IA 5G40A 2AA3A 3K0AA 2ODNA 4FDAA 1UBNA 1SBCA 2E9SA 3UFXB 1RLOA 4B3HA 3TGLA 5FUBA 4S05A 2ZJ4A 4JROA 5I5GA 4DTIA 1UFRA 5IC4A 2MOKA 4LZZA 4JOCA 1RNLA 1X7ZB 3RYFA 2DPGA 4CEHA 3O2JA 4YB8A 3SC6A 2F1RA 4QT4A 2REBA 5HF6A 3PRKE 5FBVB 4TL7A 3JU3A 4REQA 4PE5B 3SDZA 3LW8A 4PO1A 3TN7A 1EB9A 1EFVA 1Y5RA 4FYVA 5E8RA 2XDQB 3LT5A 3RRFA 1B73A 1GPNA 1DFIA 1DEKA 1D1TA 1M75A 1O0SA 5AVWA 2D06A 4C0QC 4W7HA 3WLIA 3UT5A 1N6OA 2FF5A 1MIHA 2VDPB 4J29A 3ZCTA 4KWTA 4HH0A 3VSEA 2W22A 2V7VA 1NW7A 4Q7MB 2O3JA 2RGCA 1QCZA 5LQNA 4EB0A 4DGQA 1PR3A 1Z4KA 1KDZA 4Z9YA 1XD2B 2CFOA 4WK0B 2F6RA 4Q4LA 1Z7WA 4LPSA 1ZW1A 1TQDA 2A9KA 2YTZA 3E70C 1A72A 3RHZA 2QZSA 5B2EA 5CLJA 5KYTA 2P9ZA 3ZHVA 2HSGA 1JALA 1AD2A 1AZSC 2Z08A 2QPTA 3B3QA 3JWGA 3MAGA 3UF0A 3V8BA 4KR2A 4XVUA 1IQRA 4ZGWA 1ZM9A 4OCZA 4B4OA 1FTGA 1JPNA 4KP7A 1EGQA 2PUWA 3ZDQA 5K5EA 1YB7A 4B45A 3UHAA 1QYRA 1TO2E 4LVNA 2MINA 3P7MA 4FCVA 4P7JA 3MT9A 4RGVA 2EZ9A 3EGWA 3LPNA 5C1DA 1D2MA 4PGMA 3KJEA 1B7GO 4JJZA 1QGZA 2Q5FA 1UBKS 3R7SA 4B7ZA 3FMGA 1SXIA 4KN6A 5D5PA 4BMPB 1J5XA 1E3WA 3HYNA 4JU8A 2WSLA 1QIMA 3Q85A 3EVZA 3IP5A 4R1SA 4X92A 3BCRA 4F46A 1DB3A 1NNI1 3HWX1 3KCNA 3ZDYB 3BMQB 1LTKA 1XEXA 2J8ZA 3AM4A 1OBCA 2OZKA 3DE3X 3EZLA 4K6OA 1V5IA 1XJQA 2E4WA 1LJUA 5HKBA 2X8JA 2REQA 4K6CA 1E5TA 4CN9A 3ILSA 1H94A 2VOEA 1GZ7A 3BYZA 4BJ3A 2WE8A 3FUVA 3CU5A 3Q1KA 5FWXA 3HHPA 4HDSA 1TKCA 3AMVA 3P9IA 4QPDA 5TARA 3ICVA 4UE3S 4ZZ2A 4L4ZA 4BX2A 1W6UA 4ZO6A 5IDVA 1GQ2A 1DMRA 3UWPA 3GT4A 2AHOA 4Q3OA 4QRIA 4PLTA 2ZK7A 2TMDA 4E94A 1YQGA 3GX1A 1ISIA 4KV9A 1E94E 1Q7EA 1PLLA 2OC4A 4G1CA 5C80A 1GIAA 4YLEA 1A1VA 4TYMA 1LPMA 3KDAA 3TSZA 4IGEA 1J33A 3Q2OA 4BKRA 3SNKA 5TGTA 2WJJA 2QUJA 4F6RA 1QHNA 2CSUA 1YR7A 2KJQA 1XTRA 1X86B 4W4TA 4E32A 1GY8A 5EJ4A 4G5OA 1QP8A 4A2CA 1U2EA 4RM2A 1KY3A 3LIIA 4XAQA 5FOTA 1F60A 4H7EA 4BFZA 3AFGA 3L1VA 4OO3A 5LPNA 4QPNA 4AX4A 5C9ZA 1CIPA 1R8YA 2YICA 4BRUA 4RUKA 2WWXA 1O58A 3HKDA 5EL0A 3EP7B 1VE1A 3OBIA 2IOYA 2A9RA 3GOQA 3R6GA 5K20A 3D3JA 1NUUA 2AFIE 3HL4A 1P0QA 3OZDA 4OFXA 1Z2OX 3KZVA 3C8ZA 2OHGA 2UV8A 3M2TA 5FUYA 1NZDA 3KXIA 4J75A 3DMDA 5KQPA 3FGNA 3T9CA 5JQWA 2JFOA 1KC3A 4X1YB 4E2XA 2AKYA 3TFOA 1P2VA 3ISTA 3BFVA 2J6BA 3NHKA 1NXTA 4WHMA 4Z3KA 1V3TA 4EY8A 3E9RA 1KJJA 1N33B 2WJ3A 4XYEA 2XBMA 2R4TA 1Z6TA 4J7AA 4LMAA 4TKVA 3VR6D 3D64A 2XDWA 1O5OA 3X2SA 4WOBA 2XADA 3AR5A 3GJ4A 3NJ4A 4PRLA 1W52X 4TT3D 1NG1A 1MUUA 5EKXA 4C0XA 1DIHA 4DS3A 2HGSA 2J5BA 4J91A 4LV8B 4R1MA 4ZCSA 4MW9A 2O8DB 3HEAA 1Y89A 2HZBA 2PU7A 3E3AA 1S9DA 4LSWA 3O3OB 1T6NA 2WHXA 2B61A 3GUHA 1BX0A 5M3BA 3VUEA 2IS1A 2GD0A 1Y7IA 3CZPA 3N9IA 4FT2A 3KQTA 1Q15A 2HBYA 4F1JA 5AR1A 4N0MA 3CRZA 4XTCS 4I08A 3SBOA 1TQ8A 2XMBA 4QOHA 4CI0B 3OZSA 6GPBA 721PA 1SM4A 3K0BA 4CBVA 3QWIA 3PDJA 1TAUA 1IUNA 3DBRA 3G0CA 2V3VA 2PGJA 1Q3TA 2YFQA 2VAPA 4G01B 4C43A 1NFFA 1T1GA 3AZPA 2Q1UA 1Z7GA 3IEKA 1LK0A 2Y8EA 4GP6A 1JKXA 1RP1A 4CR6A 4DSAA 1UKVY 4I1RA 4TWBA 5CLFA 2D7DA 4R8KA 4KEAA 3HC7A 1VFNA 4NCAA 4OGWA 2D0DA 1ODSA 2FAXA 2Q0SA 1FSFA 4PLHA 2GWHA 4NENB 2C5HA 2UYCA 2F3SA 4BFXA 3GZNB 4WFQA 2F3QA 1AQ6A 4OB8A 5AW4A 5FPKA 2M6LA 3Q72A 4BUJA 3M89A 3TMKA 3O1HB 4LA4A 4M76B 3RTEA 5T73A 1F0NA 2OFWA 1WKBA 3C1AA 1AKRA 1PFGA 5LLSA 2NVOA 3CH4B 1BRMA 1Y7HA 2OV3A 3K1ZA 1XXLA 1YZUA 2ZI6A 4I50B 3GWZA 5IJ9A 4AJLA 3AERB 3P2JA 3J7TA 4LN1A 1NVKA 4EG4A 4KR6A 2ENUA 3M83A 4CM3A 5HCNA 2E5FA 2NP7A 2RAVA 2Z2ZA 7REQA 1QX4A 2WF8A 4HVCA 5BN5A 2NACA 3EA4A 2AB0A 2WSSD 5K6AC 3OCWA 1P1FA 4H59A 3WJ7A 1GTL1 3M3HA 1NKSA 2PZFA 1JT9A 3INNA 1RC1A 3QVWA 2XMSA 1MC4A 4UMVA 4DYDA 2FFBA 1NBHA 3C3CA 1TK2A 4A9AA 3FYUB 4FJ2A 1T6YA 4RJJA 2PE5A 2OECA 2JJYA 4EUEA 3REQB 4J4BA 4NECA 2X3UA 4BN4A 1LPAB 1Z6QA 2FK8A 3N3BC 1R9MA 1YI1A 1VBFA 4YC7A 4IR7A 3MD9A 1KY4A 5G0VA 3VR2A 5BRAA 1WWKA 5KQSA 3ROFA 2OZEA 3ZU2A 2V6IA 3OJ0A 4MI1A 1E6LA 3LLCA 3C74A 3O73A 4N0EA 3JQ6A 4Y30A 3SJBA 1AU9A 5I7SA 1NWHA 4J2HA 2EFDB 3V55A 3FHLA 5LP6F 2Y05A 1W36B 5HEKA 2AR9A 4JZKA 3WL8A 1A8PA 3KOYA 1CS0A 1K4MA 5COBA 3UAOA 2P0YA 4F56A 1U94A 3WS7A 3GUZA 4XI9A 5DYYA 3CX4A 5BYJA 2GKOA 3BD8A