5EESA

Crystal strcuture of dapb in complex with nadp+ from corynebacterium glutamicum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
247
Chain Sequence
GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
total genus 70
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eesA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eesA01
1PS0A 2X23A 1E3IA 4TKLA 1A4IA 1IZ9A 4E6PA 3ETDA 1LI4A 5DZSA 3KVOA 1NX6A 2WSBA 1ENOA 3WYBA 4FJ1A 1DFIA 2Q99A 1QYXA 3WMXA 3K9QO 1U3VA 1GZ3A 4ZICA 4MKXA 4BQRA 3EC7A 1B0AA 1D3AA 1N9GB 2VHVA 1KYQA 3NRCA 2JKVA 3JD3A 1WMAA 4I5GA 1LC3A 4OQYA 4WLOA 1ZEMA 3E9QA 1ID1A 2ZIZA 4QUKA 2NV6A 4MP3A 4EI2A 4CMIB 3TNLA 2ZCUA 4AFNA 5CFZA 2YJZA 1VKNA 4XQGA 4CL8A 4LSMA 5KWEA 1A7AA 1BVRA 3PHIA 2FP4A 1TI7A 5KJEA 4R54A 3RCBA 5A02A 3DEYX 1IPEA 2FN7A 4M1QA 2I67A 5DT9A 3JD1A 4FN4A 4TRRA 5IDXA 2HMUA 2PR2A 1B8VA 3ETEA 4PLHA 3ZV6A 4HUJA 2VT3A 4ALJA 4EBFA 3M1AA 4JGBA 5HS4A 4YT2A 1LLQA 3GC6A 4NQZA 3WJAA 3UGKA 1N92A 5CDSA 5KNLA 4R4JA 2XAAA 5JAQA 3OA2A 2Y66A 1NQTA 3MEQA 3ZU2A 1GDHA 4H3VA 3WB9A 3MCVA 2FPPA 1FDVA 1E0DA 3KBOA 2OBYA 4EDFA 3WNVA 2IYOA 4G2NA 1HZZA 1N2SA 2Y0EA 2PZJA 3ENKA 2IZ0A 1FF9A 1KETA 1O89A 3QWFA 3X2EA 3NT4A 1HE2A 1LBEA 4CMAA 2I5PO 4HFNA 4EGFA 2IZZA 1DHRA 3O4RA 5MGBA 2LDXA 4CQMB 3WQSB 2V6MA 3GNSA 4DYDA 3PQFA 2VYND 1P3DA 4MP8A 1Z6ZA 1DC6A 3ITDA 1PEDA 4GGPA 3VH2A 2AG8A 1BXKA 6ADHA 1PJBA 3KO8A 5IZCC 4EJ0A 1Q7BA 2X5OA 4BNUA 1KC3A 5L51A 1SEVA 2EEZA 1AN9A 1MUUA 3C1TA 4FOOA 4I9HA 2O23A 4RQTA 2QYTA 4W7IA 4BV8A 3GA0A 5ITVA 3OF2A 3QY9A 3ADPA 5COAA 1GYQA 4INAA 3GUCA 5JDIC 1G0NA 7MDHA 2GCGA 1GTMA 4HNGA 3V1TC 4RDHA 5T5QA 1JWBB 2AHRA 3BHMA 1I2ZA 1PL6A 1X0XA 3BMCA 1PX0A 1SNYA 3I4CA 2JHGA 2H6EA 3NUGA 3ZWPA 2AW5A 5IDQA 2WYWA 3GG9A 5AXAA 4HXYA 3W1VA 3RC9A 1C0KA 2DBVO 1ZSNA 5EERA 2JCYA 2VWGA 4DLBA 2P4QA 3F47A 4I8XA 3S8MA 2AXQA 2NWQA 4RV9A 3WGOA 3SC4A 3DC2A 4FFMA 1DJQA 3UKOA 1MFZA 1ZXBA 4PZEA 4MKZA 5T73A 3DFUA 2GRAA 5JDCC 3WXBA 4MVJF 4YJHA 3RUDA 3ZWYA 3KB6A 5GZ1A 4IQGA 3DTTA 2NU9A 3PHLA 2ZYDA 4CV0A 4GX5A 3SJUA 2Q1TA 3FD8A 5TIIA 3VPSA 1M66A 4AJOA 3PZBA 2Q49A 4HWKA 1QP8A 4HP8A 1AGNA 1B8PA 4RVSA 4BQPA 4PG5A 4RVDA 5J23A 4Z6KA 1QXSA 1EVIA 2H1SA 2QRJA 1I5RA 3L6DA 3PQEA 3QWBA 3WICA 2DUWA 4CMEA 4KWIA 1ZO8A 3RFTA 2PKQP 4CM3A 4CLOA 4NH4A 1Z73A 1GCOA 1PJ3A 4FC7A 4OYRA 4XGKA 4CM4B 1LSOA 3RJ5A 3GAFA 3KYDA 3OICA 3ONDA 3W4IA 4JIGA 2V6FA 1U3WA 2P68A 2ZTVA 3TZKA 2JD1A 4K26A 2JAPA 2DBQA 3L9WA 4DQUA 2RBEA 5HWSA 2EKQA 1HE4A 3EAGA 3ZWVA 1QRRA 4BO4A 1XLTA 1LRKA 3RUIA 4BB5A 2FPIA 5KKAA 2BGLA 1GADO 4I9UA 3UVEA 2F1KA 3GRKA 2PZLA 1E92A 5G0WA 2VWHA 2YFHA 3AM4A 1NPYA 3DXFA 1PJTA 3LLVA 1PGPA 1WZIA 1TT7A 2DVMA 5COQA 4PLWA 3VZRA 2QX7A 4FGWA 3L77A 1UXJA 1LDBA 1WLYA 2ZB3A 5B4VA 2W4QA 4XGNA 1EUDA 3LYLA 1I33A 2HLPA 1GAEO 5ER9A 3MWEB 4O1MA 2ZTLA 1IYZA 4XEHA 3C24A 2VRBA 1M76A 3GFBA 4NFSA 3VHRA 1OI7A 5EN4A 2POQX 2X6TA 1GZ4A 1LXCA 1HF3A 4ZQGA 2GO1A 3FTNA 2X9GA 2ZCVA 2PH5A 1WWKA 4M87A 1N9GA 4CM9D 4WOJA 2A9FA 2C20A 4GVLA 4CR6A 2XOXA 4D42A 4XQCA 4KTVE 4E30A 4JXKA 4CMIA 2YYYA 3R3JA 4IZIA 4NFYA 4J1NA 4XIJA 4TWRA 5F3RA 5JYFA 5BNIA 2EJVA 1T25A 2HCTA 5AOVA 5TX7A 5LC1A 1Q7CA 3MJSA 2IDZA 4DIBA 3HDJA 4RLHA 3RSHA 3U3XA 1LC0A 3WTCA 4GSKA 1PZFA 4I5DA 5EL0A 4PG8A 1HSOA 5IZCA 1VJ1A 1YONA 5KIAA 4Y8VA 1LDMA 4NDNE 5I9MA 4DPKA 4BMNA 4ZN6A 1PL8A 4FD3A 5HRUA 2CY0A 5L45A 1D1SA 3L6EA 1UXHA 2XXJA 1LUAA 5JLAA 1JU9A 4GX1A 5ES3A 3CXRA 1E6UA 4RL6A 3QVSA 4LK3A 1DIGA 4H16A 1I0ZA 3R6DA 5JDIA 4GX2A 2Y0DA 3AI2A 3R3SA 5HS6A 2X86A 2Y67A 1RWBA 2GNAA 4BO6A 1A9YA 5H82A 1U2DA 4UVIA 2PKQO 3E5MA 3F4LA 4IJVA 4L4RA 5ENVA 4CUKA 1JQBA 1E3EA 1T1SA 3QE3A 3BXXA 4GH5A 5B12A 4WECA 1MC4A 4TMFA 4IZHA 3S2IA 1Y7TA 3Q9UA 5GZ3A 4MPDA 3E6AA 2C59A 4RCVA 4CR8A 1E3WB 1SEPA 1RPNA 4D7AA 1DAOA 3T4XA 3AUUA 3ANMA 4UEJA 5DOVA 1UZLA 3DZFA 3DR3A 4KZPA 3C1OA 1R15A 1M75A 3LT0A 4ONEA 1R4MB 4DYVA 1YO6A 1PU2A 1UZNA 4XCVA 3WYCA 5C7LO 5I8WA 1BG6A 1DXYA 3MJCA 1JTVA 4D3SA 3KSUA 3WG9A 5JDCA 1G6KA 3OM9A 4IJWA 3PJFA 3SVTA 1X14A 2Y1EA 3E5RA 4PZCA 5T6BA 3BTSA 3E82A 3PLNA 4Y67A 3FNGA 4E5NA 2O3SA 5C3MA 2PFGA 4CM7A 3GY0A 2Z95A 2BGMA 2EWMA 4BNXA 1QYWA 1WPQA 2JCVA 4ALNA 4GBJA 3QWIA 2AMFA 1IZ0A 3QRWA 2PLAA 3FBGA 1KEVA 3BMNB 2HMWA 4WNIA 1XCBA 2PGDA 2P2SA 1RM3A 3RFVA 3TFOA 3D4OA 1Y5MA 4I9NA 3AUTA 2JHFA 1M6HA 4JBIA 1LJ8A 1NVTA 2BF7A 3DHEA 3ZHZA 3K6JA 5CEFA 2IODA 3WS7A 1C0PA 3DTYA 1H0KA 2VHYA 4WLEA 3GR6A 4NU5A 2Y1FA 4PVCA 3ROQA 4UREA 1DEHA 5T67A 1ULUA 3GF4A 4CM5A 3KETA 4XR9A 2EW2A 4IGEA 3K96A 1N8KA 3JYPA 2GDZA 5A3JA 3RUEA 4YB8A 2VZ0A 4GWGA 4IJUA 3OA0A 2VOEA 1KVTA 3E9NA 3HZZA 4NNJA 2C07A 2G82A 2UAGA 4KQXA 4DVJA 3QLJA 1PGOA 4CM4A 1J4AA 1KEUA 3O26A 3LZ6A 4RZIA 4LVUA 2O7QA 4MVJA 3GEMA 3H2ZA 4ND3A 4Z0TA 2NU8A 4GMGA 1H9BA 2HK9A 3IDSA 1C1XA 3GFGA 4LVCA 2EP7A 1LSJA 1R4NB 4WOKA 5GY7A 3JTMA 5JAIA 5A1TA 4AJIA 3TZCA 2PY6A 3H5NA 2B5VA 1Z75A 2VN8A 4A26A 9LDTA 5EIOA 1N5DA 1LDEA 3WGYA 2YQ5A 4HADA 4XX0A 3RUCA 5AXBA 1ENPA 1QLJA 4J7CA 1VSVA 4DIFA 3GH3A 5ICSA 1IULA 3JQAB 4NJOA 3GNTA 1O0SA 3PWSA 1Z7BA 4LCEA 4M54A 4WLVA 5JCJA 3RU7A 3ROPA 3TL3A 4BL5A 3WOHA 2CDAA 3EDMA 1XR3A 3OMLA 2TMDA 4MVJI 4H7PA 5M6DA 1ULSA 1VL0A 1FXSA 3NGLA 3LT4A 1U8FO 3AI1A 3VPHA 4RGBA 3TJRA 4RDIA 3ZNQA 5ILOA 1O94A 1GQ2A 4PG7A 3SC6A 3V1UA 1RKXA 1EBUA 4M49A 3OEWA 3WSVA 4L75A 2EP5A 1AXGA 1ZCJA 2GN6A 5FF9A 3P7MA 2HDHA 3OEYA 1ZK4A 4W99A 1R16A 3SJ7A 3ZDFA 2W2KB 2ZK7A 2RCYA 4S3MA 1SOWA 3G17A 1LSUA 3RJ9A 3NJ4A 1EK5A 3NDRA 1HZJA 3DBRB 4FDAA 4OH1A 1GYRA 4NMHA 1VE9A 1XKQA 4EJ6A 1MX3A 2HRBA 3AY7A 4BKRA 1DIAA 4DUPA 4PLGA 1N7GA 3OETA 1CRWG 3UUWA 1P1RA 2CVQA 3PHJA 3T4EA 3UHAA 1WZEA 2HJSA 4NJMB 4AG3A 2J3KA 3GK3A 4U6QA 3IAHA 4EUEA 3E1KA 4BO8A 4B4OA 1XA0A 2C7GA 2I3GA 4GGOA 3MJTA 1YOVB 3FI9A 4CLDA 2D2IA 1PJQA 3ZWXA 3UICA 5I7VA 2QIOA 4PRKA 5CDUA 5KKCA 3OJ0A 3D3EA 3IUPA 4FQ8A 4XQEA 5KJCA 2CF6A 2OOSA 3H3JA 3KTDA 2HJRA 3Q11A 4RORA 5JPIA 3HDHA 3INRA 4RF2A 1FMCA 4BNYA 4YT8A 1EEHA 1E77A 4Y6SA 1UDAA 1E3WA 5JC8A 1GEGA 1QYVA 3OFSA 4Q3NA 2X58A 1MP0A 5KJFA 1EMDA 2ZKLA 4NG5A 4FFOA 3HQ4O 3DZGA 4BNKA 4B8ZA 1PIWA 2OMEA 1NPDA 1T2EA 1TXGA 2UUPA 1LDYA 1Z74A 3GHYA 5JMPA 4TRMA 2D4AA 2QHXA 1GEEA 4C7JA 5I7FA 2VHXA 5KOIA 5L4NA 3M2TA 4YAIA 1ISHA 4J0EA 3TSCA 1NTOA 4N7RA 6LDHA 4BO2A 1KC1A 4R69A 5DNAA 4P4GA 4E2WA 3C7CB 3QVTA 1OC2A 4WCFB 5ER6A 3PFFA 3AWDA 3QW2A 5DP2A 2W2LD 1U28A 1YVEI 2BMAA 4JK3A 3RAJA 5TRTA 1PJCA 1ZSVA 2PZMA 2NSDA 4AVYA 1NNUA 4IDEA 4YJHB 4U5QA 1PQWA 3PPIA 4IDGA 3CZRA 1EFLA 4CMKA 5JFOA 1NXQA 3DO5A 1KS9A 1WAMA 3JSAA 4DPLA 3O38A 1ONPA 3DZHA 4CQMD 2EJWA 1YBMA 4FFNA 5FI5A 3VZPA 4NK5A 3GUYA 2J3HA 2AG5A 4HV4A 1QV7A 2E82A 3WTBA 4D41A 2Q46A 3BMQA 3GGGA 3PIIA 2ZB7A 3Q3CA 5TQVA 1K6JA 4ZJUA 3HB4X 3EZLA 3JYNA 4RF5A 5KTKA 3QQPA 4IY1A 5MDHA 2BFMA 3KXDA 1ZBQA 3I83A 2WJPA 5T64A 3F3SA 1WNTA 4WCFC 1UR5A 4LMPA 3Q1LA 3STHA 1B26A 1R0LA 2CD9A 2SCUA 3PYXA 4KUHA 1YQDA 4IDCA 2IXAA 4AJHA 4QFDA 4IS2A 3FRJA 2DTXA 4DQVA 4RQUA 1XELA 3JYLA 2D5CA 2UDPA 4MIYA 2WEKA 2I9PA 5TS3A 1U4SA 2LDBA 5IN4A 1CYDA 3OJEA 4DBVO 4BIIA 4BVAA 4XRGA 5TSDA 3BTVA 1R4NA 4MVJG 2JFHA 3GOHA 3JQGB 1HWYA 1HDCA 3I6IA 1WVGA 4I08A 4CMEC 4CUZA 4E3ZA 4TVBA 4LISA 4F46A 1PTJA 4E33A 2WM3A 5A9TA 3TDKA 1JWAB 1IHYA 2Q3EA 3I4FA 4LN1A 4ZQEA 4BO1A 4JJIA 5GMOA 1VL6A 3JQAA 4GKVA 4CV2A 1KVUA 4FGSA 3TOXA 1GPJA 2B36A 2PTGA 2D0IA 4MP6A 2IXBA 2GASA 2ZB4A 3UAGA 1IL0A 1YB5A 4KUGA 4XRRA 3N58A 1U3UA 1X7DA 3K31A 3EW7A 4BNMA 3H5AA 4J7UA 3BZUA 2HO5A 1P33A 1DFGA 4BMSA 3IP3A 1LRJA 1NFFA 2X1HA 4MINA 8LDHA 3ZNOA 2D5AA 3H2SA 1BRMA 2DU8A 2DM6A 3DAPA 1K3TA 3QWHA 2BELA 4Q39A 3W4KA 1R0KA 4HBGA 3JQ6A 5TLSA 2FZEA 1EK6A 3D1LA 4XYGA 5AXCA 4EZBA 3VZQA 2AE2A 4YDRA 1O6ZA 3TN7A 3P19A 3I9LA 3NTRA 1NAHA 2RHRA 5U9CA 1CERA 1H2HA 4MVJD 1KY4A 3VKVA 3WFIA 2RH8A 2W2KA 3Q6IA 1H6AA 4N5MA 2NQ8A 3RU9A 1P1IA 1ISJA 2BI8A 2Y05A 2BFAA 3AM3A 3LLSA 4JJGA 2JD2A 2OFPA 1V9LA 4P38A 3SLGA 4B8WA 4DC1A 2X0JA 4GLLA 3DBRA 4D0RA 4ZQHA 1BWSA 4PCVA 3T7CA 4YT4A 4AJKA 3NEPX 5JS6A 4R3WA 4E5MA 4GMFA 3U9LA 2GSDA 3NTOA 1DRVA 3X2FA 4UUPA 4G81A 1W0CA 4LMRA 1EE9A 1ZJYA 2PZKA 3KUXA 1QLHA 4NJMA 2GUGA 1LX6A 3F4BA 3PEFA 4G5HA 4R1UA 4TRJA 3VC7A 1NFRA 1HYHA 3JQ8B 3ABIA 1DB3A 1NR1A 4K6FA 4URFA 5U1PA 4E32A 4WCDA 4IXWA 3KM0A 4WLUA 4KDFA 3RKUA 3KYCA 2X0RA 3I5MA 4B7UA 4XDYA 1GUYA 1YOVA 4BNJA 4PFJA 1GPDG 2P9EA 3FBTA 1JLLA 3A28A 4WEQA 3PZRA 2EF1A 4YR9A 2DFVA 5G0SA 4BNFA 3PJEA 1VKOA 1N7HA 2G0TA 1AHIA 1Z7EA 1H93A 1I2CA 3W8DA 1HLDA 3I9OA 3HFGA 4L73A 1WW8A 3F46A 5DN9A 1JVBA 4DLAA 1IE3A 1QR6A 1I30A 1JVSA 3WMWA 4FB5A 2YDXA 3V8BA 3JQ9C 1C3VA 1JDJA 4ZHSA 3QJ5A 4JBHA 3E8XA 1UP6A 3VTZA 4IDFA 5ICMA 5B4UA 1YBVA 1AXEA 3HUDA 5L40A 3V2GA 3PK0A 2FMUA 1J49A 3BA1A 4IXTA 3DZBA 3F5QA 5C7IO 4W82A 3WIEA 3MWDB 4BO3A 4R68A 4RPHA 4YBZA 5F5NA 4RPGA 3C3XA 4CQLB 3ZWBA 4EEZA 2OORA 4R3NA 2XPCA 1BHSA 4ITUA 4J90A 4WCFA 1M6WA 1EQUA 5J9GA 4CMJA 2NQTA 1CF2O 1LA2A 2PH3A 2VTEA 1L1FA 4DXHA 4E2YA 2YV1A 2BFPA 1E7RA 2NTJA 1E6EA 1PS8A 3SBOA 4K28A 4GX0A 1CETA 4B4VA 4RF3A 3ZWAA 2C54A 1E1KA 4DA9A 2AQIA 1TEHA 4ROSA 4IQ0A 3I9KA 3JCZA 4Z9FA 3HN2A 3JYQA 1H9AA 2YV2A 3AK4A 4WNCA 2DT5A 2DTEA 3JD0A 3H9QA 4JQCA 4IINA 2WD8A 4WUVA 1ZK1A 1NR7A 1U3TA 2WE8A 3P2YA 2CMDA 1TA4A 2O3RA 3LC1O 4ND5A 4L4XA 3PDUA 1LQTA 4D3FA 3U0BA 4N18A 3NJ8A 1JKJA 3NT2A 1E1LA 1K0UA 3GZNB 1VC2A 1C1XB 2VZ9A 4HX5A 3ZZNA 2WD7B 3BIOA 4QTZA 2X0NA 5L3ZA 3D64A 5BNFA 5JAMA 3CINA 1I3MA 4YEDA 2I76A 1UUFA 4PLYA 4TZKA 1DO8A 1U9JA 3OBBA 3ZU4A 3DZIA 5TGDA 5EMHA 1I36A 1NYTA 4AJ1A 1XQ1A 4R9RA 1P9LA 1GFSA 2VWQA 5BQFA 3NV9A 3RFXA 2GF2A 3M6IA 3HADA 1JW9B 1IB6A 3OJLA 3JQGA 4R9SA 2OGUA 5F1OA 3H9EO 1X7HA 2NVUA 3GAZA 3LVFO 2WMDA 4Y9DA 2YZ7A 1PWZA 1P74A 1XDWA 4B4WA 1X0VA 3K73O 3OP4A 2YDYA 3PHGA 2DFDA 5G0TA 3HWRA 1KVSA 2J3IA 2B69A 3U49A 5IAAA 2YW9A 1DC3A 3AU8A 5F21A 4PG4A 4J1TA 1DBVO 2FRDA 2PV7A 3QP9A 4RPKA 3ZU5A 2J8ZA 3WGZA 4O59O 3DDNA 4RVUA 3WSWA 1MG0A 1ZZEA 2Q1UA 1Y8RB 2CNBA 2BFOA 3ETGA 1ZK0A 1ZFNA 1WDMA 5L9AA 3PFWO 1HL3A 1DPGA 4PLTA 4YPOA 4R01A 3ZW9A 4FW8A 3DB2A 1P31A 4L74A 3SEFA 1EE2A 2VQ3A 3KEOA 2AEMA 3AOGA 4WE3A 4HNHA 1HLPA 1YL5A 2NM0A 3P2OA 4QXMA 1LSSA 3WQQA 3HDQA 4W9NA 1C1DA 3PWZA 2P9CA 1YL6A 3WGIA 3N74A 1ARZA 3HSKA 2OUIA 2C5EA 1JN0A 1ADGA 3H9GA 3PRJA 1DSSG 3B20A 4M86A 3GEDA 3JQ9A 5I9LA 4NZ9A 1T4DA 2AQHA 1EQ2A 2FR1A 4J0FA 3UCXA 3OQBA 3SXPA 3K2EA 1NP3A 5LDGA 2BH9A 2R2GA 1NWCA 3RROA 1UXGA 2OHXA 3K5PA 4E13A 3JQAD 2X7HA 4P22A 3TZ6A 4YA6A 3JQ8A 3SX2A 4BO7A 2Q2QA 1YB1A 3B70A 3QSGA 4E4YA 1HYEA 3VOSA 1SBYA 1P1KA 3QVXA 3WBFA 1GQYA 5IDWA 4O0LA 3RWBA 4HFRA 4U0KA 3ZI0A 4UUMA 2ZQZA 4BNHA 4UEKA 1H5QA 2X9NA 2JCXA 4CMCA 1MLDA 2VNSA 1A9ZA 4PLZA 2O3UA 4OM8A 3OQ1A 2PK3A 2PGJA 1HDYA 3DOOA 3ZWCA 4BNGA 3PHHA 1W4ZA 3B6ZA 2UV8A 3HNPA 4GQAA 4L8VA 2W8ZA 1A7KA 4MKRA 3NKLA 4CM8B 4JJFA 4XYLA 2DPHA 1DRWA 4NFHA 4NK4A 1IOLA 2BKAA 3F9IA 3IOYA 1N1GA 4B79A 1GY8A 1OFGA 2ZJ0A 5JSFA 5G2OA 2W98A 4IDBA 4H15A 2RHCA 3JQDA 5KVVA 1YJQA 2VZ8A 2BD0A 2I66A 4OAQA 1Y9EA 3BMOB 2IE0A 2ILTA 3OECA 4OO3A 5CPBA 3ROKA 1ZKMA 1HDXA 3TPCA 2H9IA 4RZHA 5C7OO 2FSVA 1TB4A 3OIFA 2UVDA 2GD1O 4OXYA 5ENDA 4J16A 1ZVMA 3A06A 1KOLA 4ALLA 3I9JA 4CQLA 5CP8A 3H9JA 1QV6A 3RUAA 3Q0EA 1PL7A 4FS3A 1PQUA 2Q1SA 2GERA 1GR0A 2HKIA 2J5KA 4J9VA 1GL3A 3BTUA 4YRDA 4OSOA 3BTOA 3NTQA 4NBWA 1ENYA 1PWXA 1E3LA 1RM4A 1W8DA 1HSZA 3BMQB 4MVJH 1P77A 3EVTA 4OJNA 1NWHA 1JA9A 1XEAA 4YJGB 3LT1A 1CWUA 4DWVA 3ANLA 3ZHYA 1OAAA 4B7XA 3PQDA 4RVGA 4E0BA 3RVDA 1NVGA 3QVWA 3PP8A 1T2CA 3INTA 5EINA 2Y93A 1B3BA 1I3NA 3M1LA 2WYUA 3EHEA 1J6UA 3EYWA 2GLXA 1H6BA 2CFCA 4JROA 2BI7A 2EXXA 4B3IA 1Q1NA 1KEWA 4R1TA 2WDZA 5U4QA 2OZPA 4NBRA 3ZV3A 3NAQA 4L76A 1LNQA 3F1KA 3O9ZA 1NQ5A 4CLHA 1E3JA 5IG2A 2E4AA 3FSRA 2FY8A 5CEJA 4F6LA 2OO5A 1GCUA 3D0OA 4OSPA 2J5QA 1T1RA 3H65A 3HE3A 4JCOA 3RD5A 2Y0CA 3GZNA 4B4UA 3DMTC 3AI3A 5JBIA 2WD7A 2EW8A 2WE7A 4UUOA 3GQVA 4IUYA 3QVOA 2B35A 4U6SA 1B7GO 1U1IA 2CDCA 3EGOA 5L53A 4A03A 5IFLA 3QIVA 1YE3A 4Z9XA 2HMVA 4CMHA 5C37A 1M67A 2QRKA 2DUUA 5JC1A 5G0VA 3R0IA 2NLOA 4KQWA 5IDYA 3MOGA 2E6UX 4YQYA 1F8FA 3I1JA 4F3YA 3VH1A 3L4SO 1NHWA 1SCUA 1Z82A 4OHUA 3PGXA 1JKIA 4JBGA 2HMTA 4D3DA 2EERA 4QSMA 5EPOA 4DGSA 1PR9A 3WGHA 4UULA 4RVHA 3DBLB 1BSVA 4YACA 3WQRA 1YB4A 1CJCA 2NTVA 3GHHA 3IC5A 1ZJZA 3Q2IA 7ADHA 4IDAA 1MFPA 2DLDA 3ICCA 4TRNA 2Q50A 1P1JA 3V2HA 4YYZA 2NUAA 1ZUD1 5A03A 2VYNA 4ZU3A 4AL4A 3M2PA 3D7LA 4JP3A 1AUPA 4MOWA 3GG2A 4JN6B 2A4KA 3D4NA 4R16A 2Q4EA 2X0IA 1FJHA 2GZ2A 4IMPA 4X54A 1I01A 2P5YA 4B3HA 3KLPX 3GNQA 2FWMX 4NPCA 4Z9YA 4CMBA 2P5UA 4NIMA 1Y8RA 1C0IA 2C7VA 1DIBA 4BGIA 2EGGA 5A9SA 3VPGA 5A5EA 4W7HA 4IMRA 1EVYA 1BW9B 5F1KA 5L7TA 1XWFA 2VTDA 4EUHA 5DCWA 1P1HA 2OP0A 1NM5A 3E9MA 1K5HA 2FOIA 3C7DB 3ADOA 4Q3BA 5A4DA 5BSGA 1V8BA 4D46A 4KTTE 3PI7A 3O8QB 3TRIA 4EITA 3KOUA 2FHSA 3LF2A 4FIZA 4R1SA 1V6AA 2YUTA 1MG5A 3KYCB 4L9RA 2O4CA 1T26A 4JNKA 4WKGA 4YXFA 1E7QA 3U5TA 2NVBA 3GVHA 4UVDA 1OZAA 4WK6A 4BKOA 1U7TA 2FSSA 1ADCA 4BNTA 3LF1A 4DL9A 4BO9A 4DMMA 2YY7A 1H94A 2PKRA 1UDBA 4WGGA 1NFQA 3C1AA 2Z1MA 3LDHA 3OIGA 4CLRB 5BSFA 1AE1A 4NBUA 3PDJA 3G49A 1PJ2A 1EUZA 3T7EA 1EVJA 4DPMA 1PZEA 1X1EA 3PXXA 4QFCA 2C0CA 3F5SA 3C85A 3CKYA 1XGKA 2IZ1A 4FOSA 5TF4A 2NU6A 3ZV5A 4D79A 3UCEA 3GEGA 5EQFA 5KVCA 3GRPA 3G3EA 4Q3CA 4ZRMA 4AJNA 4D45A 1KBZA 4E5KA 3COSA 3GPDG 1BDBA 3KHUA 2GGSA 4CM8A 4XB2A 4BV9A 1DFHA 4YQZA 3L07A 3GLQA 4FBGA 5DCUA 3RC1A 3KZVA 3TFQA 5A9RA 5CDYA 3CH6A 5CDGA 3L4BC 3ZWMA 1GZ6A 3PVZA 1UH5A 2EGHA 4UVGA 3GN1A 5K6AA 3BMOA 5ILGA 4BNZA 4RLSA 5H81A 3TZHA 3ZNNA 4KWHA 2CF5A 3ZCXA 2D3TA 3W4JA 4FFRA 5THQA 4P8RA 4ZD6A 4II3A 2EG9A 3G79A 2DQ4A 5IN5A 4L4SA 1SB8A 4A7PA 1C14A 3A9WA 2CSUA 5KJ6A 3VZSA 2G1UA 1R0SA 3DMTA 3FNHA 3BYZA 3RBXA 1R66A 3A14A 4JP2A 1ISMA 1T2DA 5FI3A 5JNLA 1E3SA 1UJMA 3S2FA 4MO2A 4CODB 3FF4A 4YJGA 5JY1A 2O2SA 3JQCA 1Q7GA 2Y99A 1D8AA 1SAYA 4A73A 4DC0A 3JYOA 1TT5A 4PRLA 1WXDA 1PZHA 4J2HA 3DFZA 1YWGO 4MIOA 1QKIA 3DBVO 1CQIA 2GR9A 3GVIA 4K6CA 3ANNA 3AU9A 2VOJA 3WNQA 1U5CA 1YGYA 4IJKA 4MVJM 2I6TA 3ZV4A 3S55A 3AOEC 4WJZA 1X13A 3EMKA 5DF1A 1JKFA 3RBZA 3H4VA 4IBOA 4GSLA 3GVPA 3G1TA 1P0CA 1SZJG 5EESA 4CUJA 4EYEA 4ILKA 3PTZA 3IUSA 2QZ9A 5JY6A 1ADBA 1V35A 2YHUA 4J4TA 1JAXA 2OL4A 4PLPA 3KLMX 3W6UA 1XU7A 4CM6A 1E7YA 4BB6A 1T24A 4BOYA 1SO8A 1ZMOA 2D1YA 3H3FA 4D44A 4XYEA 3IKTA 3WGQA 2VUUA 1EBFA 2Z1NA 3D3WB 1PZGA 1VJTA 2NVUB 2Y1CA 5AYVA 1BDMA 5L7YA 3C8MA 5G4LA 4S1VA 3PYMA 4YAJA 4E5PA 1KVRA 1ZK3A 4NBVA 3U4DA 4DLLA 1CQJA 3FPCA 5TT0A 4FFLA 4YWJA 1VLLA 3FR7A 4ZQBA 1F8GA 1VRWA 2NNLD 4BGEA 4BO0A 4YAKA 1VM6A 2PA3A 4IS3A 4OIMA 3WR5A 5DBIA 3DBLA 4LGVA 5JYDA 1U5AA 4ZQFA 1E6WA 1HETA 1LLUA 4P4LA 3WWYA 2F00A 2Y68A 5I8ZA 4KMSA 4RVFA 1B14A 2NVWA 1DLJA 3FTPA 3W8EA 1RJWA 3RI3A 1ORRA 2O7SA 4UAGA 5JYAA 4Y98A 2RIRA 4MIEA 2DPGA 1XIVA 4EW6A 4J49A 1MA0A 2YFQA 4Y6PA 5AVOA 3D5TA 3DAFA 1YQXA 2ZJ1A 2OBNA 3IIEA 4QECA 5G4KA 4ALIA 5BSHA 3JV7A 5TJHA 1C1DB 1GUFA 4XIYA 4KOAA 1T2AA 1LTHR 2QYSA 3VDRA 4AJJA 2A92A 5HA5A 3GVCA 3DOJA 2ZTMA 2JL1A 2A94A 2G76A 1WDLA 1BW9A 3GDFA 4MDHA 3DHYA 4OKIA 3U09A 1DRUA 4N54A 1C0LA 1O95A 2XF8A 1B8UA 1YDEA 4K9DA 1FDTA 1NHGA 3ZWWA 1HTBA 5JAZA 2HK8A 2ZQYA 4KUEA 1AHHA 4BGVA 4I5EA 3NT5A 4A0SA 1R37A 1Y8QB 1KIFA 4TKMA 2E37A 1PR3A 1P1FA 5I9NA 1E7SA 3RC2A 3O8QA 2O3QA 2OXIA 3BHJA 2GN4A 5JCJD 1XHLA 1YJ8A 3IL2A 2ZYAA 3OIDA 3HJAA 1ZIDA 1ZSYA 2FR8A 1RM0A 4DMLA 1ISGA 3L4BA 4BNWA 4YT5A 1HE5A 2O3TA 1FDWA 3ZHXA 2ZTUA 3ZWNA 5K0ZA 1UDCA 3GMSA 3V1YA 1EDZA 4KP7A 4TZTA 1A72A 5TC4A 2O4UX 1RYDA 1O9BA 4OMUA 4W9NC 4BKUA 4ESOA 1Q0HA 1X7GA 4I1IA 2BRUA 1T4BA 2O50A 1LDGA 3I9MA 4CLRA 3LSYA 5B1YA 1YBAA 3JQ7B 4IGFA 1I24A 3WJ7A 2HMSA 3EZYA 1R6DA 1ZK2A 2V65A 1CEQA 2CZCA 2AEFA 3WIDA 3H9UA 3NGXA 4CLXA 2G17A 4IM7A 1WDKA 1VI2A 2TMGA 1PQPA 1TVEA 1MV8A 1OOEA 4HFMA 5CG1A 2R6JA 5FWNA 3FWZA 4J2OA 3RUHA 3TWOA 1Y9AA 1YRLA 1VSUA 3DZJA 4FPXA 1H6CA 5A5FA 1E1MA 5CEEA 2HK7A 3KRTA 4U8GA 4OL9A 2IRWA 1HKUA 3U4HA 5JMWA 4Y6RA 2CVOA 3VH4A 5ITWA 5JXWA 3BHIA 3CPSA 3ULKA 2I99A 3U4IA 3AOEA 1M2WA 4R51A 3AJRA 5IF3A 3LK7A 1S7CA 1Q0LA 3MOIA 4M55A 1L7EA 4HY3A 2E48A 3HDYA 2AE1A 3MJEA 4CJXA 1E5LA 3AFMA 1G0OA 4C7KA 4WEOA 4PIVA 3S2GA 4C4OA 4GLOA 5TT1A 2Q1WA 3NYWA 4CLEA 3GN2A 4MJLA 5CHEA 4N5NA 4FSHA 3DL2A 4DIOA 1DHTA 3MTJA 3WWZA 2DTDA 5JW6A 2B83A 1P45A 3UXYA 3TF5A 4II2A 4QEDA 3OQ6A 4J1SA 1ISIA 4UVEA 2V6BA 5TNXA 4PGFA 1V3TA 2JAHA 1IUKA 3PJDA 4RPLA 1BMDA 2DC1A 3OHSX 2ZYGA 4EUFA 1GU7A 1VJ0A 4DRYA 3WLFA 1J0XO 3QV1A 1EUCA 1DC5A 3MZ0A 1P44A 4ND2A 4YRAA 1O5IA 1XG5A 3P5SA 2PD3A 3WGGA 1VPDA 3GDGA 2WWRA 2X22A 3VVBA 3EK2A 3W8FA 3G1UA 2JFFA 1W73A 1U8XX 3TOZA 2BGKA 1QG6A 4AJ2A 3DHNA 2HU2A 1DJNA 1YH3A 2J3JA 2V6GA 1I32A 4EJMA 1GQQA 3E18A 3I6QA 2IEBA 1DLIA 2DKNA 4QX6A 1ZW1A 4OGWA 4ALMA 4XR4A 4L0QA 2X9VA 4RPJA 4XJTA 2RH4A 3D3WA 1KVQA 4OKNA 1MB4A 4BGUA 1LRLA 3TL2A 3TZQA 5EJ2A 4LRSB 4Z0HO 3K2BA 1ZMTA 1U2GA 2Y1DA 3F6YA 3ST7A 2QQ5A 3WBBA 5I7SA 1E7MA 1UXIA 4R41A 3QWAA 4M8SA 2P9GA 4PLCA 4O5OA 3VTFA 1KY5A 4YJFA 5BR7A 3WDSA 4CV1A 1B15A 3LT2A 4M89A 4XYMA 4QQRA 3KSZO 3LU1A 1XSEA 1OMOA 2H5LA 1D4FA 3V2UA 1EVZA 1QMGA 3W6ZA 5EQDA 1G1AA 4BNNA 2C82A 1U4OA 4OXNA 3R1IA 5A9SB 5CPFA 2DAPA 2VRCA 3KYBA 2QZZA 4W4TA 4J91A 5B4TA 1B16A 5L95A 3HFSA 1XYGA 1HEUA 2B4RO 2C2XA 1O8CA 1UAGA 1LU9A 1ONNA 3MTGA 2W90A 1Q0QA 3JQBC 1KERA 3AY6A 2O48X 1MXHA 3GZ4A 4F45A 3JQFC 2YHIB 2WYVA 1XQ6A 4E31A 2VT2A 1Y6JA 2NACA 5FYDA 1J5PA 1GD1O 2Q4BA 1CIVA 1PJLA 5IJZA 4R5MA 4PG6A 1Y1PA 1Y8QA 2VCYA 4XDZA 5B37A 1PJ4A 1NBOA 2RAFA 5DCYA 1ZEJA 5HTOA 2VYVA 1FK8A 2W2LA 4PN3A 1PS9A 1YL7A 4WASA 3UH1A 1EZ4A 1UP7A 3GPIA 3NDJA 5HM8A 4ZGWA 2V7PA 4J7XA 1V3VA 4CL3A 2Q45A 4GVXA 3OSUA 2GN8A 3EY4A 3RASA 2H63A 5AQ1A 4R1NA 4CMGA 1P0FA 1LQUA 2HAEA 1ZNQO 2X4GA 2I65A 1LEHA 1GV1A 2BLLA 1NASA 3I52A 4JLWA 5T8KC 4CQMA 2B4QA 4J3FA 3B1KA 4XD2A 4WPGA 4RJTA 1NPTO 1D7OA 2DBZA 1SPXA 3D5QA 4FC6A 4BNIA 2Z5LA 3H8VA 3JQ7A 2GZ1A 3VH3A 4AJEA 4OOEA 1F0YA 3KV3O 2PNFA 3IS3A 2Y1OA 3UOGA 1RM5A 3L0DA 4ZA2A 2I3AA 4OQZA 4BHTA 5CDTA 2ET6A 1I3LA 5KJ1A 3VPXA 5HBRA 3FNEA 4NHEA 4OXKA 4FJ2A 1F12A 3WYEA 4IIUA 2P4HX 3ONFA 4XQ9A 2PWZA 3WX0A 4YAGA 3H5RA 4B3JA 1K2WA 4ZVVA 1NQOA 5JYEA 3ORFA 3Q2KA 1OBFO 1D1TA 4EEXA 5BSEA 5KVQA 2B4TO 2AEJA 3PIDA 4A27A 4AJPA 2QG4A 3B1JA 1BVUA 3OJOA 4FFPA 4YAEA 4FJ0A 4BMVA 3DAGA 4IPTA 1S6YA 2A35A 3DWFA 4FCCA 3ZW8A 3IJRA 1NVMB 1BXGB 1TT5B 4CM1A 3CMMA 2FZWA 2CUKA 2HQ1A 5L4SA 2R00C 1F14A 3GGOA 2C29D 2VUTA 2AQ8A 3VAZA 4A5OA 1W6UA 2XXBA 1LDNA 2X5KO 4NU6A 2B37A 3PWKA 4Q3DA 1Z45A 3QA9A 3DQPA 4IQ8A 3CIFA 5K6AC 1SC6A 4DTIA 4F6CA 2DBRA 5IXSA 4GI2A 3ITKA 4Z3DA 3GVXA 3ZH2A 1A27A 3RKRA 1FDUA 3ASVA 1B2LA 1SB9A 2GPTA 1UXKA 1L7DA 1YQGA 2OP1A 5FFFA 1HT0A 1FDSA 3V5NA 4XKJA 1I10A 1PJSA 2HSDA 4UEOA 2VNAA 3BAZA 4GAEA 4Q3EA 4XWYA 2HRZA 4TVOA 4R5HA 3DBHB 5TJ9A 4QO8A 2GN9A 3H6KA 4J4HA 4ALKA 3TQHA 1DIRA 1LLCA 2IYPA 5THKA 3VVCA 3U4CA 3SLKA 2JD0A 4E12A 9LDBA 1MGOA 1MXFA 4PZDA 1PGQA 2PD4A 5CG2A 2Q2WA 5BT9A 4AJLA 4GWKA 3MJ4A 1QSGA 1E7WA 4LCJA 4HKTA 4UVHA 3IP1A 1DIHA 1HDZA 3FWNA 4DQXA 3GDOA 3A4VA 5JCXA 4YTEA 4AICA 3AM5A 4O6VA 5C5IA 3LC7O 4P4NA 3PYLA 2D8AA 3CE6A 5JE8A 3JQBA 3ZN2A 1K89A 1PSDA 4XYBA 1R12A 3GT0A 4FR5A 2G5CA 2PD6A 3I23A 1GUZA 1E5QA 3D4PA 4XJSA 5JO0A 1V0JA 2EIHA 3HG7A 3JQFA 4GPD1 1F17A 3DONA 1H6DA 2VHZA 4LRTB 5ADHA 3ZGYA 4PLVA 3HB5X 1DC4A 2C2YA 3K30A 5K9ZA 4NR0A 5IXYA 3I3OA 2GZ3A 2NU7A 4NBTA 3FPLA 3L9XA 3CEAA 3UN1A 3UCFA 3UF0A 1OC4A 1IPFA 5G4KB 4J43A 1GV0A 2QRLA 1NAIA 1N1EA 4J6FA 1HXHA 2EKPA 1HDOA 4BNLA 2YQ4A 3MJVA 2BHLA 3DMYA 4LSWA 4CPDA 4XB1A 5L7WA 3CUKA 4RO0A 1HRDA 1I8TA 3ON5A 2VHWA 3A1NA 1SOVA 3INGA 1QYDA 3ZNPA 3VDQA 4HFJA 3UFXA 3N7UA 4BKQA 5T8KA 4RF4A 4J4BA 1UP4A 2B5WA 3DOCA 3AUAA 1LLDA 3AY3A 2J5RA 1WMBA 1Y81A 4UUNA 5AXDA 5A05A 4U0JA 3JD2A 4WLNA 8ADHA 1UZMA 3ZWOA 4BNVA 5A3VA 3ONEA 1I3KA 4Z3KA 4U7WA 2YHIA 2NTNA 1HDRA 4K1LA 5KCZA 2EKLA 4QT0A 4A2CA 3G0OA 2YV3A 4I5FA 3KEQA 3PGJA 3VPFA 2X5JO 3KSDO 3FNFA 3Q9NA 3PJGA 2AQKA 3CZMA 1X15A 2X8LA 3EVNA 2EHDA 5JO9A 4KDEA 3FHLA 2Q2VA 4XA8A 4IIVA 5T57A 2O2YA 5DBGA 1PGJA 4G65A 4ID9A 3ZU3A 3UW3A 4ZRNA 3ROMA 5F5LA 2QW8A 3S1LA 4ND4A 4N5LA 2VUSA 5L4LA 2C5AA 1ML3A 3O03A 3VKUA 5A06A 1EDOA 5IZ4A 4AJ4A 4BO5A 5DBFA 4LW8A 4ND1A 2VRCD 5F1PA 1HYGA 4Q9NA 4WLFA 1F06A 4JX8A 2R00A 1DAPA 2WTBA 3FR8A 1BXZA 5G0UA 3CTMA 1YKFA 2ZB8A 4IDDA 5DOZA 3F1LA 2CVZA 1KEPA 4J9UE 4D43A 3DZKA 1R4MA 5FEUA 2Q22A 5LDHA 1ENZA 2VWPA 3JQEA 3NDIA 3C7AA 1A71A 2P91A 4O63O 5LCXA 4D0SA 5DULA 3BMCB 3ZHBA 4GL4A 1ISFA 1X1TA 2PGLA 2HUNA 1IHXA 1U7HA 1Q2XA 1IY8A 4YCAA 1K6XA 1DOHA 3HN7A 3RQSA 4CR7A 3EUWA 3AFNA 3ASUA 4A10A 3JD4A 1WP4A 3CSDA 1H2BA 3FN4A 3E03A 2D59A 4TQGA 2VYVD 3AUSA 3IJPA 4YRBA 3L6OO 1XU9A 3CMCO 5DDIP 1VL8A 1NQAO 3HHPA 1BXGA 4TROA 3RC7A 3GGPA 3U62A 2UYYA 1A4UA 3S2EA 2EV9A 3NX4A 4CV3A 2JFGA 3RBVA 4DREA 5I7EA 3BMNA 2FPGA 3IMFA 4E2XA 3RUFA 4E21A 4XZ3A 5H83A 2NADA 4MVJE 4Z0PA 1GYPA 1RYEA 3B1FA 2Y1GA 4PLFA 4PVDA 1HE3A 3H7AA 3PLRA 2FR0A 2B0JA 1Y5RA 4CLOB 4CM9A 4Q3AA 1ZXLA 3I9NA 4TSKA 1HDGO 3IKVA 3WFJA 3WGTA 4J1QA 4BS9A 2ZATA 3KYDB 3LQFA 4NI5A 1B3RA 3ENNA 3K92A 5CAEA 1QYCA 3RIHA 4DBZA 1EFKA 1DDOA 1MC5A 3GMDA 2CDBA 1K6IA 3OJFA 4BUCA 1ADFA 3DBHA 1UAYA 1E1NA 1I2BA 3FCOA 5DP1A 3ICPA 4GKBA 4YJDA 1SMKA 4BKPA 4W6ZA 3LC2O 2IEDA 3AW9A 1YS4A 1QORA 3OH8A 4OOFA 4QO7A 3K8ZA 4E5YA 1ZH8A 2UUOA 1YDWA 1BGVA 1BTOA 2J6IA 1CDOA 4XGIA 1A5ZA 3E48A 1YXMA 4YVFA 4E2ZA 2AA3A 5COBA 2GYYA 2E49A 2O3JA 1V3UA 4MVJP 1ONOA 3IQDB 5BNTA 1T2FA 1PGNA 5GZ6A 4B7CA 1JAYA 3QHAA 2JJYA 4YJFB 1TLTA 3WLEA 5A04A 5KVSA
chains in the Genus database with same CATH superfamily
1U7WA 2ZJ3A 2OFWA 3PUJA 5AJYA 4AY6A 4C0QC 4R2MA 1IZ9A 3LHKA 4N3NA 5LZ8A 1OH5A 4ESHA 1KO4A 2VC2B 2XUOA 4YRMA 3PXBA 3SKVA 1PDOA 3ZK7A 2QL5A 2YCLA 2Z6AA 1QYXA 3K9QO 3QYFA 3EC7A 1N9GB 1N5RA 3ESDA 1KYQA 3AUKA 3QU5A 3DYBA 4YCDA 3UBTA 2QQGA 2XMGA 1J5EB 5CT6A 1WMAA 4AZ0B 3L7BA 1ZEMA 3O8NA 4KKVA 1ZRSA 1WHTB 2QUJA 2GX6A 2R5FA 2BGTA 4CMIB 1QRTA 2ZCUA 3CR8A 3S5UA 3ET5A 2AK2A 3C8DA 1SU7A 1PEKE 3G5AA 4MUYA 1F8YA 5H3LA 3E3AA 1N6HA 3QH4A 4QBGB 1TI7A 4WDRA 5KJEA 1VPVA 5JNWA 2H7YA 1XMVA 3PRYA 1UBSB 4OQPA 4AUMA 2Q5LA 2I67A 1NXPA 1QVVA 2RH9B 3NOQA 4HMOA 1YZTA 2PR2A 5KUTA 3PT9A 4PLHA 4JJ6A 1FS4A 3QHQA 4M7PA 4ALJA 1NLUA 3M1AA 4EBFA 3NBYC 5HS4A 3S6JA 4YT2A 2QN3A 1H4QA 2I4NA 3N3BC 5CLQA 4JYAB 3WJAA 5B53A 5JTTA 3AQIA 1MORA 3EDYA 3MJHA 4R4JA 1GA1A 2IUSA 2XAAA 3GLKA 4IFIA 4TM7A 5JAQA 2ZUTA 2P6MA 3IA7A 2W8BA 4XGQA 2X42A 3DE3X 3Q5DA 4HDAA 3R4VA 4L08A 4G1MB 1U8EA 3G0BA 4H3VA 3C5EA 5G53C 3WHKA 2GN2A 4V1CI 1FDVA 2LE0A 3J7AC 1E0DA 4OX9B 3H1TA 1D1QA 2IYOA 3V00A 1HZZA 2EBWA 1N2SA 1FC0A 1TO1E 1U98A 2XUKA 3P9SA 2Y0EA 1V8OA 3EXHC 5AKKA 3WLAA 2PZJA 2IZ0A 3IR7A 3X2EA 3OEED 1RPAA 3OKAA 1SKMA 5ICFA 3UPUA 3FETA 3QF4A 1DHRA 2Y1KA 3CVVA 1C29B 4QQNA 2FSGA 4C06A 1P17A 2VKQA 1ZJ5A 2XTMA 2AN5A 4MP8A 2OGZA 4LRXA 2QEQA 1QIHA 3QF7A 4D9KA 1U0EA 5FOWA 4MQ4A 1L3CA 4P2GA 2AG8A 3FRIA 2GFQA 1FL9A 3W9UA 3CB4A 1K97A 4EHBA 1FBNA 3TRHA 3M6FA 5L3SA 4WT7A 2Q3CA 4I8DA 4EJ0A 1MA3A 1NLZA 1Q7BA 2C96A 2G07A 4MUGA 5ALVA 5C18A 4N47A 1RYBA 1Z8DA 2P65A 4JUIA 4BNUA 2JLYA 1BE6A 2J59A 1OXKB 1T35A 2AUTA 3MYYA 4FOOA 4I9HA 1ONSA 4KYUA 3DF7A 4TQ9A 4B47A 2NNWB 4XPIB 3T35A 4BV8A 3VAAA 5ITVA 1QTRA 2AS0A 3FUCA 1EVQA 2WJJA 1EM6A 1NBAA 5KC8A 1NXWA 2LW7A 3M5CA 2RFLA 5D3KA 3SM9A 2RAPA 3M6LA 4EMSA 3BWYA 2B3DA 2WR8A 1V16A 1E2JA 5KDDA 2FNAA 4BEJA 2XVMA 4I36A 2X41A 2J3QA 4R81A 5ECYA 2XSZA 3PNVA 1JFSA 1PL6A 1QKJA 3C3EA 1L8QA 1X0XA 3AESA 4Y2JA 1NXTA 2QJOA 4UJ5A 2JHGA 1KY2A 1NVAA 2X8JA 3HCEA 4Q9HA 2RDMA 1XTVA 2UVPA 4F93B 3HXOA 3VJRA 1EFVB 4LZJA 5L6LB 4OVKA 1G41A 4FWIB 4HXYA 3DMRA 3HYRA 3QVVA 4CCYA 3VNUA 2FPNA 1CUWA 3IP9A 1AT1A 4MYCA 1JLMA 4TUYA 2OT3B 1SKUA 2WU4A 2DBVO 4B6FA 1I6WA 1Q1GA 2C83A 2V6JA 2VWGA 2N1MA 1ILWA 1YAHA 3F47A 4I8XA 2AXQA 2NWQA 4M1ZA 2CWDA 1ZOOA 2HGSA 2HD4A 4I50F 3WGOA 1BQEA 5A6SB 3SC4A 5CFMA 3FXAA 3H4TA 3DC2A 4XH9B 1O77A 4WXPA 2WK1A 3GA5A 4ZGBA 1JPVA 1P7WA 1FFSA 5TQ2A 4ZK2A 3WXBA 3RYCB 1IWOA 4CE6A 3N8HA 1CZLA 1BKDR 1NZFA 3PI6A 3PR1A 3PHLA 3KPVA 2BT4A 3K0HA 5FV7A 5HIIA 5BV1A 4MW6A 4EF5A 3SJUA 7YASA 4C4RA 3FD8A 5TIIA 3VPSA 3VHLB 2Q5OA 3QGMA 4X1IB 1M66A 4NNOA 6YASA 1ADJA 3PNMA 4HWKA 1AGNA 2JANA 3FLEA 1E2MA 2ZT8A 3OX1A 4BQPA 4RVDA 2D1QA 4Z6KA 1QXSA 2ZYUX 3MFYA 3QWBA 2OCDA 4Z4HA 3DMHA 1P4HA 5H4GA 3EJ6A 1JEQB 2R6CA 3F9CA 2JFVA 3G82C 3GJ3A 4CM3A 4FSDA 2WZQA 4NH4A 2VBFA 5CK5A 1GCOA 3C41J 4FC7A 4DA8A 2CLKB 1LSOA 3RJ5A 1BMTA 2NO4A 1VJCA 2V4ZA 3TQOA 5JZOA 1ZNXA 4J2TA 3OICA 3UT0A 4CIAA 3ONDA 1P4RA 5DTEA 3I5XA 4QICA 4JIGA 4X7RA 2JD1A 1H1LB 2DBQA 3L9WA 3TMAA 2GCIA 3EAGA 3ZWVA 4BO4A 3COVA 1FFWA 4P53A 2P0AA 4UDYX 3RUIA 4U2EA 3LUDA 3U4QA 4BJHB 3HLTA 3VKWA 5KKAA 1YMVA 3AZQA 4I9UA 3R3ZA 4G26A 4JB2A 4MQEB 5C5CA 4QUJA 1CF4A 2WNIA 4UOZA 1JFFB 1C3OB 1OXBB 1NMXA 4TN5A 2VWHA 3CRQA 2YFHA 1G7SA 2A67A 2BUBA 2WNHA 4MR7A 4A5SA 1FRFS 4C4TA 2I87A 3U6BA 1E63A 3LLVA 1SCAA 3TIIA 1WZIA 1TT7A 3OFVA 5COQA 1RAHA 3D0KA 4MLZA 4ZOLB 4AG5A 3AW8A 5KX5F 2VJOA 4WN3A 4IO1A 1QAOA 1EKXA 3D8RA 3COJA 1J9GA 4LRUA 1H22A 3P2IA 2Q7XA 2AJLI 2VDUE 2J0VA 1MN6A 4RFLA 1QCZA 1KDYA 3N1UA 4KGVA 3MWEB 3WLQA 2VP9A 4O1MA 1EFTA 2LV8A 2H65A 2ZTLA 1IYZA 3DMNA 4OQ4A 3WDLA 4AK1A 3K5WA 4BWFB 5LZ5A 2ZJ6A 3EGEA 4GECA 5BWOA 3UJBA 4HLUC 4NENA 2PKXA 1M76A 3A6FA 4NFSA 3VHRA 3LBNA 3SK0A 3PQ5A 5FTLA 2HSWA 2POQX 3L0IB 2W6JD 2HSZA 3ZVMA 3THXB 1KNQA 4LYYA 3N0XA 3ADCA 2ETVA 1E2NA 4RJ2A 2YYZA 3QFSA 1IJFA 1UDRA 3FTNA 3G8CA 3HYLA 4RZSA 2M32A 3UC9A 1C4KA 4M87A 1OFIA 3BGDA 2C20A 1HE8B 2C1EA 4I1SA 4WA8A 1CY6A 2D1RA 4KTVE 2RHLA 3IB3A 3KIPA 4NFYA 3TNJA 2Z8YA 3BGOS 2BSXA 4IGAA 1Y3HA 4PNHA 5BNIA 2HCTA 1NN0A 1JSLA 3BXOA 5AOVA 4MKHA 4EFMA 1L5LA 3GI1A 2IDZA 4Q4AB 4D8UA 3RSHA 1V5EA 4RHEA 5AKHA 1LC0A 2ZRFA 1NT4A 3OX3A 3PKIA 3SBEA 4EG3A 4KR2A 4I3GA 2ZJ5A 3HLYA 1VJ1A 1OVMA 4JNCA 4DV4B 1J8MF 1KORA 4MS4B 5I9MA 2GEBA 4TQUS 3O1HB 4WXRA 4DPKA 1PT5A 1IJKA 3LGAA 3LVQE 4BMNA 4ZN6A 4CQNA 1SJ9A 3ISVA 1QH8B 4ML3A 3SHTA 2CYBA 2E4VA 3IHWA 3KNZA 4O08A 4HQ0A 1Q7RA 1NXXA 1YIDA 1XK6A 3IKJA 3F3MA 2XXJA 3W6NA 1JTEA 2CLDX 2M2IA 4GX1A 2YVKA 1KA9H 2BGJA 3VUFA 1E9AA 1JHZA 1K88A 3AF2A 3KJNA 5JDIA 3FLMA 3AGPA 4EG6A 3RODA 5FJIA 1KIMA 1V3QE 1RWBA 4EYKA 1VP3A 4JR2A 2AZXA 3ZR4B 3TD6A 4GICA 2FUCA 3PF8A 1U2DA 4NG4A 1XRMA 1YZQA 3F4LA 4RTSA 4IJVA 4L4RA 4R1MA 5AO9A 4QRHA 3O84A 1T1SA 5ENVA 3VMFA 4GH5A 2IA5A 1QRUA 1DKPA 2QTMA 2H7VA 4YXWD 4HXEB 5EWLB 5GZ3A 2W6OA 3E6AA 2C59A 2PGOA 2AZMA 5MFPA 2WILA 3B78A 2ZLBA 4K7JA 5EJ5A 3C3PA 2QBYB 2QSUA 1DAOA 1G9SA 3D3JA 3AUUA 2O8FB 1UZLA 5HXAA 4KZPA 3C1OA 1R15A 2C5HA 4ONEA 4DYVA 4H1VA 3MJRA 2I33A 2WJZB 1UZNA 1PK9A 3OESA 2ZXFA 1GNQA 5L3QA 1RLMA 3T99A 2UU9B 1P9RA 2D00A 1ID8A 4X45A 2V0GA 3A9RA 3NHPA 3OM9A 4IOLA 1RVDA 4CDNA 5FWXB 2HFKA 2OV6A 1UFKA 3Q3JB 3A2NA 3BE4A 1QPBA 2Y1EA 1XZJA 4PZCA 4Q37A 3SDZA 2H92A 1AQ6A 1XQ9A 3BTSA 2C31A 2CCGA 5T6BA 4ZYYA 1KAQA 3FNGA 5JZ9A 4DSTA 1C7RA 3AR7A 3PNQA 2G1JA 2JI7A 4OBEA 2W48A 1ZL2A 3OCUA 3ZTYA 5HR5A 4M6WA 2BGMA 3CT6A 1DQRA 3AP3A 1SBTA 2W0MA 3BZWA 4Q9AA 5BSKA 2FEPA 1QYWA 1UT5A 3QUQA 4ALNA 4UASA 3IT2A 4HQLA 1QGOA 2AMFA 3QWIA 1KJWA 5BUCA 5C8ZA 3GJ0A 2IYSA 5EVCA 1TPYA 3QRWA 1MRNA 2JAWA 2PLAA 3A1DA 1ST2A 4PYKA 3IOCA 4XWTA 3Q7SA 2I55A 3A31A 2WJ3A 3M5PA 1FZQA 4AF6A 3BMNB 2C4WA 3CWZA 5C35A 5IJWA 2HMWA 1XCBA 3L7KA 1R88A 4LRYA 2P2SA 1O9GA 2WNSA 1UBCA 2W6ZA 2ZSKA 1OZHA 1XA4A 3LO8A 3FPAA 1OJLA 4I9NA 4RIFA 2MR6A 2ZSEA 3N8KA 4TV8A 1MB0A 3KG2A 5EC8A 1JVNA 1FNCA 4JR0A 1XRSB 3I64A 5A3RA 1KMHA 3J7TA 3IT1A 3I58A 2H2WA 2BF7A 5DLDA 5ADUS 1DKQA 1SQGA 3SMVA 3LDUA 3OZFA 4QXPA 1K2VN 1J00A 1C0PA 5TARA 1IBLB 2HJHA 1BE0A 1XCJA 1O0CA 2W6PA 1ZICA 4DRXA 3PEUA 1CY1A 3CF4A 3KVYA 3W90A 2CBXA 3ER6A 3QG1A 3R5JA 5DW3A 3C14C 1MENA 1YC2A 3ZS8A 4FYJA 3KETA 3KHTA 4UAUA 3OOWA 5BMOA 1P19A 2EW2A 4MTCA 3MTBA 1N8KA 5A3JA 4S12A 4GWGA 2PBLA 1MAHA 4KR7A 1UZUA 3A7DA 3OA0A 4GEGA 5EUBA 1O87A 2PA0A 2J9YB 3N8DA 4LV6A 4AUEA 3UAVA 1DTEA 3AR8A 3AH8A 2BCEA 3W77A 2G82A 2HUPA 4ZO9A 3QLJA 4OQQA 4CM4A 3QPCA 1J4AA 5DBEX 5HG0A 1EXWA 3R7SA 4RZIA 4LVUA 3VNVA 1ZVVA 1FFXA 4ND3A 1H9BA 1WP9A 1VYTA 2OCXA 5JSYA 4CTJA 2J33A 1OLSB 4HWGA 1LSJA 1SOUA 4LVCA 1QIGA 4WOKA 5GY7A 3QY0A 3UXMA 4B43A 4KXVA 4FNOA 1N3LA 3H5NA 3KQTA 3MHPA 4PYMA 3WK7A 3LHIA 3C3MA 4BECA 2WDPA 1AIPA 2HJVA 3WRYA 2BY4A 2ZBFA 2QDKA 2AT1A 1IEQA 2WIJA 5SY9A 2HWKA 2WB4A 2Z08A 2H5IA 2YQ5A 3QJGA 3UANA 1EWKA 5LB2A 4X71A 1MHMB 2QGFA 2RHHA 3NUZA 5K2MA 1NN1A 1E3QA 3H3XA 5BOSA 3CG4A 3GH3A 3F2VA 3ISTA 3P0FA 5SY4A 5LQNA 1TD9A 1IULA 4TS4A 2ABWA 1W5TA 2G83A 2PKYX 3GNTA 3QOWA 1O0SA 1U3GA 2HU7A 2DFLA 4PR3A 3QEBZ 3PQCA 1OFUX 3PFBA 3U81A 3KQSA 4WSOA 1XPOA 2QMYA 4LCEA 4M54A 5JCJA 2LXNA 4H4EA 3PE6A 4S0XA 3VNSA 5CXXA 3TL3A 3WWOA 1D04A 2CDAA 1DUVG 1FUYB 3EDMA 3OCCA 3VSCA 3W9BA 1DTWA 2JIZD 4MVJI 5M6DA 1ULSA 3U39A 3PCXA 4REMA 1Z16A 3NGLA 3LT4A 3QK7A 2XH8A 1ZITA 4R9NA 3AI1A 3VPHA 5LLTA 1Z17A 1FSPA 2VAPA 5ILOA 3B13B 4ESVA 2VJDA 1RP7A 1R9GA 4K2AA 2FZ4A 4XQ0A 2VO1A 2EKBA 3GRYA 3OEWA 4H6XA 2M6LA 3R7NA 3CXUA 4L75A 4D25A 1JU3A 1QP4A 1W5EA 4JH0A 3VYUB 4AMVA 2R751 2VRWA 4D9BA 3CQ9A 4D4JA 3JWJA 3PD0A 2IU4A 4RXTA 2GS9A 5F7ZA 1JU4A 1MAAA 4DA0A 3FZQA 1ZK4A 5KX5A 3PEYA 1N7IA 2O6LA 5J2UA 2Z98A 2V5AA 5ERXA 5C1DA 4RHFA 4K9PA 3LUFA 4IOKA 2RCYA 2PEYA 1KHHA 4LV8B 3EA0A 2ZJ7A 4YI3A 4Q1VA 5IXJA 3RJ9A 3NJ4A 1HZJA 3GUHA 3MCUA 1TC2A 5B1DA 1F2UB 3SS8A 3I9V1 3OZDA 4G8BA 4NMHA 3FJOA 4EJ6A 2JHPA 3DLHA 2HRBA 2OBLA 3ZY3A 2XLBA 2YVUA 1W5FA 5H5JA 2PZEA 3AIIA 1CRWG 3OCZA 4O8JA 2CVQA 3PHJA 1H4SA 1QIFA 4L72A 3UHAA 2O9JA 2QG6A 4NOMA 4URYR 4UU1A 3RK4A 5EZYF 1GN9A 2MSCB 1G5HA 5AI4A 2J3KA 2AKAB 2O1EA 5F52A 3UB4A 3GGSA 2PL5A 5HGJA 3WDMA 4XD7D 4EUEA 5IH7A 1LLFA 1UXOA 3LY5A 1E4OA 4MGKR 1STOA 1BE8A 3LTEA 4YREA 4CLDA 2P40A 3SY8A 1I5OA 2FPWA 1QGAA 2LNDA 2Z56A 3K0FB 4V0ME 5K3FA 2GCOB 1BMFD 2HNKA 5CDUA 3L79A 2ZZNA 2Y92A 3R3UA 1ZP6A 2XB9A 4G0ZA 3VQTA 3H3JA 1NZJA 1ELOA 4RTQA 5JRJA 3HVUA 3STUA 1YIOA 3BBLA 3G6WA 4RSHA 5JPIA 4BN0A 4M76B 5CH3A 4NAVA 1GGFA 2PMKA 4RF2A 5UKDA 3VSBA 4RK7A 3F5MA 4F2WA 2FE4A 1UDAA 1QDEA 2FW6A 1G3UA 2HDWA 1QGZA 2HO4A 2PH7A 3F49S 1ZY2A 3EYAA 4XPZA 1MC1A 1QZ3A 3EDCA 3OFSA 1L5KA 1W2GA 5DHQA 1EMDA 1H3NA 5KJFA 3QKTA 4FFOA 3HQ4O 1T5IA 2VDWB 2VJYA 1V9CA 3Q3IA 4Y2UA 5EWJA 2O2IA 3GHYA 4PZAA 2F3PA 2UUPA 5FHQA 1Z74A 1LY1A 2KE5A 3DOFA 4Y7DA 1B42A 3HJUA 2G40A 3G7UA 4A8JB 2IOFA 4DLRA 2IGTA 1GEEA 4C7JA 4K1XA 5L4NA 4YAIA 4D8WA 2F8SA 3LDGA 1NTOA 4N7RA 3W5JA 6LDHA 2GPSA 3D7RA 4LYJA 3E0QA 4FS8A 3KD3A 2LRHA 4MR8A 5ALSA 5GGXA 3P26A 1GGNA 1OROA 3QX9A 3TB6A 2Q0HA 5E4FA 5KHAA 4M88A 2H1RA 3IXLA 2Q0XA 2W2LD 1G98A 2P2YA 4DT1A 1QMHA 4YRSA 3DV9A 4KO8A 5A1JA 2H4WA 4NYJQ 1I1OA 1C9MA 1JHYA 1ZSVA 1R6BX 2DRIA 2NSDA 1NNUA 1X38A 3GJRA 3HS3A 4IHAA 2VHCA 2B7CA 2HMAA 2NU9B 5B36A 4CT4B 3IRUA 1TQ8A 5JIBA 3DO5A 4PWZA 4JLSA 3AI7A 4K9MA 4DPLA 3IO5A 1R8QA 4HWOA 4C0LA 1H8ED 3IJEB 2GLUA 1DUIA 2FGJA 3VZPA 5K6TA 1U2ZA 5EVJA 1D6MA 2J3HA 3L8GA 1KYWA 3NHYA 4KRXA 2A5GA 3RS4A 4HV4A 3WLJA 4JKYA 4C20A 4F06A 2V96A 1Z0FA 3EZ7A 2Q46A 1GL9B 3BMQA 3DVAB 3Q3CA 3L7DA 2ZWPA 3QMMA 5BV8A 1K6JA 4JSYA 1W44A 2W2MA 4R40A 1YBHA 3HB4X 1JDNA 2IYYA 3NNDA 3PQ4A 2XEDA 4RD4A 3HV2A 3L1UA 4IY1A 4Q0MA 4JGIA 4WV3A 5KSPA 2CKDA 1JKJB 2J09A 4HDOB 1ZBQA 3I83A 3IRVA 4D26A 2WJPA 3CF2A 1XXHE 3KFVA 3TCXB 5C8YA 4B3CA 3DBIA 3NBKA 4WNYA 3T1TA 3DE5X 2EEPA 4RACA 3VO8A 4E1BA 2FG7C 2QAGB 1J70A 2XGJA 2ECFA 3WKBA 4AIIA 3MD9A 1JZQA 3PYXA 2ZUUA 2B9VA 3ROTA 4LA4A 2F43A 4X6LA 5K8IA 4P7BA 4LDAA 1Q77A 1SKYE 1ULBA 2QW0X 2BV3A 3FRJA 1GZ5A 1C3LA 4FWTA 1FS6A 5JI3E 1XELA 2I3BA 2WD9A 1XKTA 2UDPA 3P4UA 4GMHA 4JOCA 5PNTA 3FDJA 1VE6A 5BVGA 1ODLA 2LDBA 4WNAA 4IHJF 5P21A 3OJEA 4BV2A 1TGYA 2EBFX 4XRGA 1XQVA 4HGRA 4I4NA 3BTVA 2DQKA 3W2EA 4M36A 1KYZA 3GOHA 1FTGA 5D5PA 1EUDB 2I3ZA 5CCXA 1QGED 3IALA 3I6IA 2B3TA 4LGYA 2ZU6A 4XJSA 4CUZA 4Q3OA 3SHQA 1WEHA 4DMCA 1RT9A 2A9JA 2F1OA 4LISA 1IY2A 4F46A 4ODIA 5A9TA 4EB8A 3HA3A 2LCFA 2ZYIA 3S1SA 1CE8B 2XRMA 5AW1A 4KB5A 3HJCA 5GMOA 2XUQA 2C4HA 4CV2A 4ER3A 3EIWA 1CG6A 4ENSA 1UPCA 2B36A 1MF7A 3EVBA 3ICWA 2D0IA 4G5QA 4PO3X 1O5TA 2ZB4A 3GOQA 5ELLA 2NPIA 4C2BA 4DABA 4EGJA 5A4KA 5HZGA 1YB5A 4XRRA 3U9TA 1E9EA 1P9OA 3L0ZA 2OQRA 5A5GA 3DZCA 3P9CA 4WKCA 2WIFA 3OM1A 4BNMA 4QHSA 5IX8A 4D6PA 1WKCA 4UMEA 3O92A 1YKGA 2X1HA 2DU8A 2W93A 5FBQB 5DLQC 4RK4A 1HOTA 5SYMA 3W4KA 4O2BA 4NULA 3DKVA 3C3DA 2CCJA 5ADVA 3D1LA 3P9NA 5BUQA 4C89A 2LZ0A 3NFYA 1HC7A 2IEYA 4UE6A 3TN7A 3P19A 2R11A 2VDKB 5K8VA 1L6RA 1KKLA 3LUAA 2P67A 5U9CA 2EL9A 4Z9AA 3VKVA 2ZE7A 1I2DA 3WFIA 1V39A 4LF7B 2HBQA 1P1IA 1IQPA 1ISJA 4KQ9A 3V4SA 2BI8A 4JVMA 1WBDA 3AM3A 5BYKA 2OFPA 4IDQA 2X0JA 4N6GA 1NXOA 1CHNA 5CVEA 3HDGA 3UHFA 2XOKD 3FUUA 1S96A 2FEWB 3LX6A 4V39A 2DLCX 3AR2A 2NZ2A 4MUXA 2M6KA 3FI0A 3K0SA 4TZ6A 4RADA 3NEPX 4TMWA 3TTWA 3ZCQA 3THWA 3U9LA 2IU3A 3IUMA 2FH5B 2DR0A 3X2FA 1OBHA 4CIVA 2QLLA 2BH2A 4G81A 4DOMA 1SCNE 1W0CA 4IVQA 1T3HA 2ADOA 2WKQA 3FOAA 2ZGVA 2HY7A 2J0UA 1SIUA 2GUGA 3F4BA 2VDVE 4G5HA 3P27A 4NJMA 1FQOA 3FAZA 3VC7A 3J81A 1ORVA 1HYHA 4KIJA 5U1PA 2BTOA 1RQNA 3IEUA 1CTQA 1J24A 3RKUA 1KMIY 4PSVA 5KNCA 4RZQA 1YOVA 2CW5A 1PR6A 1RQRA 4XM0A 1J39A 3TI7A 1F7VA 5AJZA 1Z5VA 1GPDG 2P9EA 3ZHUA 3JZMA 1R2QA 3QFFA 1QAMA 1V2HE 1UPAA 4C6HA 4HEA6 4A6EA 1Z5PA 2EF1A 4YR9A 4K87A 5G0SA 3CW9A 4BNFA 2Q5JA 2VFAA 1N7HA 5G1PA 1AHIA 3E15A 3VR1A 1I2CA 5TY0A 2R8PA 1NUQA 2GEKA 3W8DA 1CZNA 3I9OA 2V3WA 3PC4A 4L73A 1GN8A 1IM5A 3ZQUA 4IV5A 4P3XA 1X39A 5JSQA 1MX1A 3ZD6A 3NUQA 3R0QA 4MS1B 3ANXA 4LY0A 4DLAA 5AVQA 1HX7A 2DETA 1QR6A 2A3RA 4M0FA 4FB5A 3V8BA 1PV4A 3DKKA 3AF6A 4XLZA 3VU9A 1C3VA 1G3MA 1JDJA 1T4CA 3ETHA 1COWD 4FZ3A 2KI5A 3FMVA 1AA9A 1G55A 4B6EA 3VTZA 2GVNA 4C04A 1W30A 3H99A 5ICMA 1IZ7A 2ZROA 3IDZA 5ETJA 5B4UA 1U2DC 4PGGA 2FMUA 1J49A 1O2DA 1ZD8A 4GZLA 2OKCA 3DZBA 3CLVA 2F90A 3CLUD 3SNKA 5C7IO 2A5DA 2QVLA 2ZBGA 1X7YB 2QTBA 3HKDA 2FN3A 1TMOA 1L7RA 1QE0A 4IAOA 3H0EA 3LUBA 5K1ZA 3FSJX 5F5NA 1K75A 2FPRA 2HIGA 4Q24A 1QYRA 1NU6A 4R7GA 5EQTA 3I2IA 1MZVA 2XPCA 3CR7A 3LIIA 1U2SA 1O03A 4WCFA 5CYOA 3P9KA 3WSTA 1YULA 3ZJ5A 5J9GA 1CF2O 1LA2A 2BP7A 2VUIB 3VYTB 1PLKA 4BJ6A 3FVVA 3IHKA 4HQRA 4ARZA 4ARIA 4LFAB 3IV6A 1LQ2A 4DV7B 4IIEA 3IP6A 2C54A 2QMZA 4JJ8A 4D8YA 1OXVA 4HH4A 4OFZA 1PCXA 1TEHA 4ROSA 2IJGX 1W0JD 3JCZA 521PA 4A8TA 2C8LA 4QVKA 5H80A 2VJPA 3VC2A 5FKJA 1VYHA 4RKEA 1MCZA 2QTVB 2VH2A 5BOVA 1PR5A 4F3TA 2DTEA 4Z53A 2LD4A 3DOEA 1UMDB 3FKSA 3H9QA 4H7FA 5BXQC 1X2EA 4YIKA 5EMMA 2GWRA 2X1LA 3VR5A 2WD8A 1XP8A 5E1OA 1M8FA 1UBMS 2XA2A 2NUPA 3WGLA 2WE8A 4MZDA 3M6MD 1GZDA 4X8MA 3LC1O 1FSZA 3H2KA 4ENRA 4L4XA 4Q02A 4D56A 4CCSA 1N3IA 4H3HB 4QFBA 3U0BA 4AC9A 2L42A 2R4TA 4MX8A 4NFLA 3SZOA 3R8CA 3GZNB 4JB8A 3WRXC 1E64A 3HJHA 4ZRDA 2WD7B 4DLNA 1BWRA 1J0DA 4QTZA 4M8LA 5A7GA 3SZ3A 4J0KA 4URHA 3CINA 3PUZA 1E79A 3I2FA 1E6LA 1YCDA 4OMCA 4TTTS 5BN3A 4EATA 1PQ4A 2XBLA 3CX6A 4TZKA 1U9JA 3OBBA 1ZN8A 4W1RA 3ZU4A 5ABPA 4FTWA 4CLQA 3R77A 3LBAA 4L6IA 3QELB 5DBHX 1D07A 4CCWA 3U2QA 5DTRA 3KS9A 1XQ1A 4AJ1A 1NUTA 4RVNA 2A7XA 1XXHB 1TEZA 2Y8EA 1PDVA 1PR0A 2P79A 1K0FA 3RFXA 4BQQA 3A9VA 1HFJA 1M73E 4OGFA 2WSSA 3VYRB 1AKVA 2HGZA 3HADA 3D1VA 3M6IA 1IB6A 2CVHA 2XGOA 2NYRA 1VE3A 2HZ7A 1HNXB 2QK4A 3OIYA 2GSWA 5AJUA 5ICCA 3AHGA 4QLAA 1SKYB 2NVUA 3CZPA 3VDMA 4EA6A 3JALA 1S2LA 3I92A 1AZLA 1CJTC 1R6AA 4FMDF 4DCGA 1U94A 4J3JA 1E1CA 2IYNA 2MINA 2Q3HA 3UK2A 3WZLA 2Q3MA 4D0GA 3ZZTA 3UUEA 3K73O 3OP4A 1MQSA 3P9RA 2AX3A 3FIUA 3FF1A 5CCEA 3HP4A 2B69A 2WWFA 3RHFA 4EZEA 2KB0A 2G72A 1E60A 3FPGA 4G0WA 3O3CA 1FLNA 3RVPA 4MAMA 4UPDA 4TKVA 2A9KA 3OCYA 3QP9A 4PHHA 5AM2A 4CTOA 3WRYC 1Z6QA 2J8ZA 1GTJ1 1I4WA 2DSNA 3OUUA 4MRMA 4B9EA 3OQMA 5TF0A 1NVVQ 1QWSA 2P9HA 3KQQA 4HL6A 4RVUA 3U1TA 3WSWA 2OLKA 5KSWB 4AQ7A 3IERA 3NVKI 4PNPA 5B5SA 2CNBA 4M1WA 1IY0A 1ZK0A 3KU4A 1S8OA 4GNKA 4M1YA 5KNBD 2Y27A 3C6MA 3A4YA 3ZQJA 4R01A 1GARA 4PX9A 1EGMB 3ZW9A 4FW8A 4GM0A 5ES4B 3DB2A 1TW3A 2YZGA 1EE2A 2OCKA 3IT0A 2AEMA 4LJ8A 3AOGA 3BCRA 3KQOA 5THXA 4XVRA 2WTNA 3MT7A 3OLCX 1GT91 4QXMA 4YRLA 4EHDA 1LSSA 1NUUA 3SF0A 3C74A 1VHQA 3C3WA 5D86A 3WQQA 3U7RA 3OIWA 4W9NA 4GPBA 3W1EA 1M10A 1SHKA 1YL6A 4CG1A 4ZEWA 2RMKA 1V7CA 5BQ5A 4OK5A 4XSHA 1JN0A 2FF5A 2JAQA 2JFQA 3F5FA 3B20A 2BC9A 2Q5QA 4M86A 3VHXB 3WRVA 5I9LA 2XW6A 3GL9A 3OQHA 1T4DA 2WLSA 4CEHA 5FOQA 4M46A 4BVGA 3R23A 3SXPA 4M7OA 3AM1A 2UVQA 4NCKA 5FH9A 1E89A 3IHLA 3R76A 1NP3A 2EQ5A 3RPEA 1FYXA 4N3BA 2Z6QA 4Z8YA 5DE3A 4BVHA 2WIAA 1W36B 1CP2A 5KYWB 1GTZA 2H1LA 5FQNA 2OA0A 1Z8FA 4BU0A 1VE7A 3ITNA 2YVQA 4MJXA 2H57A 5DYWA 3TZ6A 1A96A 3QEAZ 2AZTA 4H4DA 2YMMA 3JQ8A 1F6BA 4UBLA 5H4HA 1FCJA 3B70A 2P2NA 2RKBA 2EHJA 4WOCA 2DWOA 2I0FA 4AG6A 4CTKA 1OZFA 1XZ8A 3QKSA 4HMQA 3OWXA 2XX3A 3AUXA 1TADA 1FFHA 3GU3A 1NJGA 1JG4A 4E51A 1HM5A 5BR1A 2QP9X 1A7UA 3EEFA 4QUIA 4UEKA 1NM5C 1L5GB 3BB4A 1WXWA 2NU6B 3O3NB 3LY9A 4UDNA 3H2BA 3PNBA 3DEIA 2PK3A 4GSYA 4PPFA 3DO6A 1TUBB 4ZU1X 3TRFA 3PICA 2YWGA 1LPSA 2PJZA 1Y34E 3HNPA 4BN5A 4L8VA 1GZSA 1MTOA 2P4UA 1A7KA 2UYGA 1PT6A 1WXIA 2VAVA 4M9XA 4ND7A 1WQ3A 1P2GA 2J9ZB 4DCOA 1QQAA 2W2XA 4KI0A 1M6VA 2BKAA 2BM0A 2CZGA 4K9QA 4Q4JB 4DF3A 3ONWA 5JYCA 3KQNA 2GEDA 4B79A 1F2TA 3KT0A 1AA6A 1HMYA 3N2GA 5JSFA 2QAJA 4IDBA 5J5AA 4H15A 4M8KA 2BFEB 2RHCA 3DDCA 3JQDA 3NIGB 2HEIA 2ZETA 4M98A 4G6ZA 3Q85A 2BD0A 2I66A 3G88A 4PRYA 4QYMA 3ZQKA 4EPYA 2DFNA 3IIIA 4GYKA 2OKGA 1GRNA 4LZZA 5AOBA 2R8BA 1ZKMA 1EWYA 5CUQA 1OQAA 1LPNA 1A9QA 1MVLA 4JFRA 4MV1A 1EHCA 4RZHA 3T5BA 1E6MA 3FKJA 1TB4A 2BTQB 2DULA 4FR2A 1A1VA 4GF5A 1XDUA 4CN9A 1SD2A 3I9JA 3EMDA 3ANTA 4EY8A 1QP0A 2F48A 1QV6A 3TLGB 2Q1SA 4I4IA 4YMUA 3CEJA 2ZI9A 3H9BA 3IPYA 3BE6A 3VR4A 3L92A 1GL3A 3D6NB 1BGXT 3WMEA 1XLWA 3C4QA 3L0OA 1ENYA 4OGLA 1W8DA 3DPUA 1IM2A 3LUPA 4MVJH 4WZBA 3LT1A 5DXJA 1CWUA 3BKWA 4DWVA 5HOEA 2WF6A 3PQDA 1UBHS 2WHQA 2FYTA 3AEYA 5KWVA 3BE5A 1T2CA 1GVNB 2OXCA 3INTA 5EINA 1F4VA 1Z35A 2HXGA 4XUDA 2Z04A 1Q0RA 3RAPR 1M5TA 4C88A 1J6UA 1S3IA 1WMSA 2WUWE 3CEPB 4DV0B 3WLLA 2B8NA 1EZ1A 1IQUA 1LB1B 1ORIA 2ZUSA 3HYTA 2ANBA 2EXXA 4JROA 1EWRA 1M1NA 1Q1NA 1KEWA 4R1TA 2QN7A 3V1LA 4Z4CA 3CUUA 5CBPA 2B2CA 1CUAA 4NBRA 4QUAA 5LU8A 2SCUB 4R8MA 2HA2A 5HSGA 2DQSA 1GPLA 3RS3A 1I0IA 1TYEB 3O9ZA 1FFCA 3FUWA 5REQB 4HNTA 3PNOA 5L8VA 4B8YA 5HCNA 4F6LA 5DYIA 1W93A 1E2EA 3W8NA 3HE3A 1UFRA 3G6KA 1LNSA 4KI7A 1KZHA 4DMUB 5EE3A 2HJGA 1ZCBA 2EZTA 3LBYA 1U5BA 2CJWB 2CBGA 4PPNA 2REXB 2WE7A 1YZNA 1D2NA 3GQVA 3OE1A 1ETHA 4U6SA 3QFCA 5L53A 3B1YA 1BX0A 3X44A 4EVSA 5A4FS 4GI3A 4DMFA 1CLEA 3HXKA 2QS9A 4S1OA 4F9GA 4DFDA 2DUUA 4QXQA 3T34A 2I2BA 1RTTA 2NLOA 4KQWA 2ZI7A 3OT1B 4LNUB 4LGMA 5IDYA 3SEQA 1LH0A 3CVJA 3REOA 1VYVA 3NM5A 4KV7A 1M33A 4L57A 5CB6A 1JMKC 4OI1A 2ZREA 1NHWA 1SPBS 1R0XA 1ZGBA 1JIVA 1UBTS 3CUYA 4OHUA 5FL7D 5GVRA 5GWXA 5DHAA 2OPBA 1XO1A 5IVKA 2I6UA 2EERA 2Q4RA 2RI6A 2ZBRA 3ADBA 4LOJA 1W581 5JPCA 3DCYA 1T0PA 3D4BA 3KP1A 2R1UA 3KWMA 1QJ4A 2YFKA 4I55A 4MUBA 4Q1EA 2IYVA 4QNRA 3K70B 4HWSA 1T5DX 1SXJC 1YB4A 4U9HS 2BKXA 2RHJA 4D4HA 1CJCA 1ZJZA 1FJ2A 5E8JA 4ABYA 1EWTA 5ECWA 2Y1LA 2Z8YM 3OEEA 4AJ9A 3C6BA 1MDFA 1V8DA 1NONA 2J3EA 5FUMA 2DLDA 1XRNA 1PLLA 1P1JA 3VNRA 3HSSA 3HGMA 1ZUD1 2VSQA 4G4GA 4L0MA 5D5HA 3ZG6A 1ISRA 4DQ0A 4HDCA 1NBWB 1L5RA 1T0UA 5C1BA 4JP3A 4MOWA 3O91A 4EI8A 1DUSA 3D4NA 2FQYA 3JVDA 3QOYA 2Q4EA 4LV5B 4YV7A 4TTVA 1FJHA 4FT2A 1AB5A 4IMPA 2FSIA 4K9SA 1P18A 1RIIA 4NPCA 1F5NA 2GMWA 4CMBA 1DAHA 1Y8RA 4EMUA 3DE4X 1XNQB 1WX1A 4FFWA 2XRYA 2ZRNA 4PW0A 4DIKA 5KPDA 2CHQA 1ZJJA 1EZZA 1QFYA 4IJQA 5H3HA 5LUAA 2A0FA 4LDPA 3SVZA 3GV0A 1IVSA 1XWFA 4JAVC 4P7KA 4CKYA 2YHSA 4OXRA 2OP0A 5FTKA 3BJIC 1KO8A 1A88A 1KMMA 1PK7A 2XD9A 3WADA 1AKRA 1EVLA 1V8BA 4D46A 2JPDA 2PRKA 3WBJA 1A2QA 1LV8A 3RARA 4E22A 3L5KA 5JQGB 3KOUA 3BJMA 4US1R 1FP1D 2FHSA 1R8YA 2JHAA 3TLMA 4R1SA 2GYVA 1I79B 1V6AA 3Q88A 4FFBB 5E0OA 2O4CA 3A27A 4IFEA 4EPTA 1Q20A 3OOSA 4WKGA 3A3PA 1UJ2A 3LW7A 1KY3A 5ALYA 1QVRA 2OBFA 2XVYA 1OZAA 1JENB 3LQQA 1MIHA 3L49A 3CUEF 1ADCA 4AUKA 4GU5A 2AR9A 4LWZA 5CDFA 2HIMA 2JCBA 2HWWA 2Q07A 2YWJA 1Q21A 1IWBB 4G23A 4KV9A 4O2LA 2H8KA 2IYUA 4DMMA 4ZZIA 4WGGA 1NFQA 4MYTA 3LDHA 3W7VA 1XVIA 3HNRA 4O4HB 4O4LF 1E59A 4OFWA 4P3PA 4ZI7B 2A59A 1XK7A 2QN9A 3CNQS 4YCSA 5LQRA 1CR2A 1KEEA 1PJ2A 2VSOA 1XFAA 4Y7CA 5AHRA 2MWMA 4IGKA 3RS2A 3PUXA 5K0TA 2IPMA 4QFCA 3DM9B 2IOHA 2G6BA 2HA0A 2V9ZA 3C85A 3V4FA 1XVVA 2IT1A 5TF4A 2UZ0A 3UCEA 5EQFA 3A26A 4YV0A 2JRCA 3GRPA 1KQPA 1X1CA 2B2XA 3IIMA 4Q3CA 1US8B 4KAJA 4DLTA 1KBZA 2FJ0A 4JJ7A 4RV4A 5KI6A 2D2XA 3OLXA 1SUWA 2IHTA 4QJIA 4F4UA 1G64A 4U9UA 4XB2A 1FQWA 2GJ9A 2IXDA 2GPYA 3DUFA 1G6HA 2LVBA 3LQ4A 4GMKA 4BV9A 4EY5A 4XWOA 4IEEA 5A0TA 3PKJA 2GZSA 1U1FA 3CX8A 4MA0A 5AQEA 3EP5B 1YQEA 3CH6A 1TCUA 2UZ1B 1C2YA 1J06A 3A1FA 3TEMA 3N2EA 3UMBA 3D1JA 4B5KA 3ZWMA 3C39A 4QU5A 2EGHA 2EGUA 3WLIA 5CA1F 3OPYB 1PT9A 1JEJA 3BMOA 3OWOA 4BNZA 5HZKA 2VF8A 3TZHA 4FYXA 3ILYA 1T8YA 1OX5A 3GLTA 1QU2A 2CF5A 4QC2A 1JXQA 5AJVB 3KB2A 1P5FA 5D2CA 1GCAA 3A4LA 4B87A 4II3A 2EG9A 2ZJFA 4YC7A 1C14A 1PZMA 1R0SA 3H42B 3M70A 2M6SA 3DMTA