5EESA

Crystal strcuture of dapb in complex with nadp+ from corynebacterium glutamicum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
247
Chain Sequence
GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVVVDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGVLIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQGIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVIFGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-tetrahydrodipicolinate reductase
publication title Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Oxidoreductase
total genus 70
structure length 247
sequence length 247
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2015-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 5eesA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5eesA01
2HAEA 5JY6A 3BHJA 1BXZA 1MGOA 3AOEC 3GN2A 3JQFC 1E92A 3TRIA 4D3FA 1JAYA 1A4IA 1P33A 2HJRA 4RF5A 4L74A 3JYNA 3C1TA 1PX0A 4O0LA 1QRRA 4ZU3A 3KYDA 2YFQA 4GLLA 2FR1A 3E8XA 3P2OA 1MC4A 2VTDA 3ZH2A 1WP4A 3H9GA 4EEZA 4DQUA 1GYPA 4R68A 4Z3DA 3HN7A 1X15A 3H9JA 5HA5A 4F6CA 2IEBA 2YHIB 2PTGA 2AA3A 4ESOA 4IDDA 2X4GA 1CYDA 1SEPA 4NQZA 1P1JA 4DBVO 2W2LA 4GX5A 3L07A 1LX6A 4DRYA 2AEJA 4ZJUA 4CMEA 1X0XA 3TF5A 2VWPA 2X5OA 4GWKA 1A7AA 2ZQZA 5T8KC 2RIRA 3QWAA 4CM4A 5IDQA 4ZGWA 1BDMA 1LRLA 2EERA 4DUPA 2VYNA 2EW8A 3I9JA 1EQUA 2C54A 3ZV3A 3C85A 1XU9A 4MKXA 1BHSA 3JD0A 4N5LA 5L40A 1UDBA 2TMGA 4FBGA 2X0JA 2O4CA 2NVWA 4OOFA 2VNAA 1BVRA 4E2WA 4CLXA 1GUYA 1QV6A 1A27A 3I6QA 4I5EA 4O6VA 2X1HA 3GGPA 1DIAA 1YB4A 5HS6A 1YGYA 5HRUA 1NM5A 4C4OA 4HWKA 5CDGA 1PWZA 1P1RA 3DHYA 3GPIA 2NTVA 4BNZA 1YOVA 3DZKA 3NAQA 1ISIA 1SB9A 2DU8A 4JBHA 3LF1A 3HDJA 4PZCA 1F12A 3HJAA 3ZU5A 4BQRA 4P38A 1A72A 1OAAA 1B8UA 4TROA 4DWVA 3PLRA 2HDHA 1WLYA 1YL6A 2ZYAA 1QYVA 3ZWXA 3JTMA 1T4BA 4IS3A 2B4RO 2ZB3A 4LW8A 3ZWBA 1NPTO 3HHPA 3KEOA 3WG9A 4E30A 1LJ8A 3PZRA 1P1KA 4WLFA 1PR9A 4QEDA 4XQGA 1I36A 2R00C 3EUWA 3B70A 2GYYA 4E2YA 1E7RA 5KJCA 3LT0A 2ET6A 2B37A 3AOGA 1GCUA 5G0WA 2B83A 3ZV4A 3ZWAA 4CQLA 2G82A 3I83A 3RUCA 2CF6A 2OGUA 5A3VA 1EUDA 1ONOA 3HDYA 4TRRA 1JWAB 5L45A 3DBRB 2Q2VA 3IQDB 1KVUA 3QWIA 2GERA 4IM7A 3VPFA 2VZ8A 2CDAA 4ZVVA 2IZ0A 3ZWYA 4CUZA 1IZ9A 4DVJA 3WGYA 3HB5X 4OL9A 2DBZA 3AWDA 4BKRA 1Y5RA 4BMSA 1UDCA 5KJ6A 3D3EA 5DNAA 3ZW8A 1G1AA 4UVDA 1T2DA 3Q0EA 1KS9A 1Z74A 2O7QA 1UH5A 4BNWA 4YR9A 1NHGA 1VL6A 3K2BA 4XQ9A 3DDNA 3WBBA 2W2KA 1VI2A 4YEDA 5I8WA 1U9JA 2O4UX 4MVJI 4CMEC 4D46A 3W6ZA 1V3UA 4RZIA 2AG8A 3NDIA 5B4VA 5C37A 5L4SA 8LDHA 1FK8A 1GV1A 2Y93A 3NUGA 2FHSA 2R2GA 3DBLA 4PLPA 4YVFA 4B7CA 4E13A 4QFDA 3RUAA 3JQAD 3NTQA 3MOGA 2WD7A 5BQFA 1PL6A 4DIOA 1E6EA 1MFZA 3G1TA 4YWJA 1Q7CA 1X13A 5DBGA 2W8ZA 4NIMA 1BDBA 1NWCA 1MG0A 3AFMA 5A9SB 4FJ0A 3G17A 4YAIA 1BGVA 4RVHA 1UP4A 5HTOA 4WCDA 3KUXA 1DC3A 1X7DA 3U62A 3UUWA 2YHUA 5BSFA 2JJYA 2YDYA 3EZLA 3SBOA 3A4VA 1ONPA 1RPNA 3PGJA 3FTNA 1GUFA 1HYGA 4G2NA 3VDQA 1YBAA 1A4UA 4JP2A 4U7WA 2PZMA 2YHIA 4TKLA 1ARZA 5JDCA 2VYVD 3D4OA 5L3ZA 3UH1A 3LC2O 3WGIA 4W6ZA 4WGGA 3WWZA 4GWGA 5F5LA 3E9MA 1HZZA 4GSLA 3TZHA 3UOGA 2C5AA 3QWFA 2RCYA 3S2FA 3C1OA 3GAZA 2GN8A 4TZTA 3ZV6A 4BV8A 4LSWA 4E32A 4YCAA 5JSFA 3UCFA 3FBTA 1AHIA 1HDYA 4U6SA 2DBRA 3LQFA 5CHEA 5IDXA 2E49A 4M8SA 1ORRA 4RVDA 1PGPA 3WYEA 1D1TA 3N74A 4FW8A 2CY0A 1XIVA 1M6HA 4BKUA 4BKPA 4CLDA 2RH4A 4KUGA 4ALJA 3SEFA 3ZHXA 2CF5A 2PK3A 3L6EA 1UDAA 5JCJA 1WZIA 1GV0A 3JQ8B 4AJHA 3TWOA 5C7IO 3ITKA 1PEDA 4NFYA 5I9MA 1CRWG 4UUMA 1M2WA 3RSHA 3LSYA 2AMFA 3DONA 3PDUA 3D4NA 1X0VA 4EITA 1AHHA 4O1MA 2GDZA 2HSDA 5AXBA 4H3VA 1LEHA 4Q3AA 1D7OA 3FRJA 4E3ZA 1O94A 2GGSA 2WMDA 1A71A 1H2BA 3JQAB 4OYRA 3F1LA 3DFUA 4IMRA 2W4QA 1JWBB 3DBHB 5A05A 3GA0A 3MJ4A 3SJUA 1BWSA 2H6EA 4R9SA 4IUYA 4JX8A 5JYEA 4IJUA 2J3JA 3HADA 4KQWA 4QECA 3GG2A 1E3LA 4MVJP 2WSBA 3ROKA 4YACA 1YB1A 3OJFA 3VVBA 5IG2A 3TNLA 3LT4A 2PGDA 1GFSA 1PGNA 4XWYA 3BTSA 5JW6A 4A7PA 2BI8A 2GF2A 3PZBA 2EW2A 4RVGA 4CPDA 5F21A 4XJSA 5GZ1A 3GUCA 4GL4A 1SB8A 4J16A 4PZEA 3AUUA 3QWHA 2P5UA 3F9IA 3OSUA 1QP8A 4LVUA 1D1SA 4BOYA 1KEUA 1SCUA 1WDKA 5B37A 4KDFA 5JYFA 5F1OA 4R54A 4QO8A 4ITUA 1YVEI 1ZXBA 1CIVA 3PLNA 4BUCA 3BA1A 4B7UA 3SC4A 3BIOA 2FMUA 4KWHA 2F1KA 1ZNQO 3BMCB 1YL5A 2Y99A 3UAGA 3UF0A 2QYSA 4URFA 1A9ZA 4ZHSA 1V8BA 1F8GA 2ZYGA 4NBRA 2O3JA 4I9NA 1UZMA 5A03A 5THKA 3MZ0A 1PSDA 5DN9A 3AM5A 1O89A 3I3OA 4CR7A 5L53A 4YB8A 2NM0A 3ASUA 4GGOA 5U4QA 1HDOA 4H16A 4I5GA 3KETA 1R16A 1DC6A 4IIUA 5A9SA 3I9OA 4L8VA 3K2EA 1GPDG 5L51A 3EGOA 1HYEA 2ZKLA 3BMOB 4FFRA 4AJEA 4OO3A 3WYCA 3B1JA 2Q3EA 3C7AA 1PJ3A 1PQUA 4XYMA 1CQJA 4ZA2A 4EW6A 4JGBA 2VT3A 1D4FA 2BFPA 4B79A 3KRTA 2QHXA 1PZHA 2DUUA 3A9WA 3DQPA 3JQDA 4Z9FA 1B14A 5TLSA 3U09A 4BNGA 1U2GA 4FFNA 3WJ7A 1ZSNA 4TWRA 3ASVA 3DXFA 1GL3A 3K92A 3WJAA 3NKLA 2FPIA 4EZBA 2FN7A 4PVDA 4R9RA 1PS9A 3DTTA 5AYVA 3GRKA 1U5CA 2RAFA 4M54A 1A7KA 3OECA 4BL5A 4CLHA 4TQGA 2RHRA 3RQSA 4YT5A 4XJTA 3GDGA 5EINA 1RM5A 1K6IA 3I4CA 4P22A 1NVGA 3VZQA 1I24A 3B1FA 4UVGA 4XB2A 3DAPA 1HDRA 2DAPA 1YKFA 1P1HA 2GN4A 4CMAA 3G49A 4QT0A 1OMOA 3GOHA 4AJJA 3JQ8A 4BNMA 3GMDA 5A9TA 1KYQA 1XDWA 1EUZA 4FQ8A 4KOAA 4QQRA 4CM8A 2BRUA 2DLDA 3QV1A 1JKIA 4J43A 5JCXA 1LC0A 3VZSA 3INGA 2WJPA 2GLXA 3OIDA 3M1LA 1GQYA 4BS9A 1DDOA 1VL8A 2EKLA 3JQAA 4XIYA 3H2SA 2I6TA 5F3RA 2BF7A 3R3SA 4J4TA 4E12A 3PYXA 4QXMA 2EWMA 1EE2A 3DBHA 1LDYA 3ZWPA 4D41A 2NLOA 1ZSYA 2PR2A 2VUUA 1X1EA 3PWKA 4NJOA 1T2FA 4HP8A 2BMAA 5G0UA 3HG7A 4BNKA 4HV4A 1LLUA 3D3WB 3WOHA 4HFRA 4QSMA 4ZQFA 5AXDA 1KERA 4BNTA 5B4TA 3VH2A 3RASA 4B4OA 4J3FA 4Q9NA 2P4QA 4FD3A 5JYDA 3OHSX 4RF2A 1WW8A 2HUNA 1NNUA 4I8XA 3GH3A 3ZWVA 4MDHA 2YZ7A 2VYVA 4IJVA 3C7DB 3VDRA 2XOXA 1W6UA 2IZ1A 2V6GA 1XGKA 3WBFA 3WXBA 2J5QA 7MDHA 4JCOA 4BO7A 4HBGA 3NX4A 4CM9D 3QWBA 1OFGA 1U5AA 4JBIA 1GEEA 4MKRA 1YJ8A 1MXHA 4ID9A 4NBVA 5IFLA 4AJPA 2IRWA 4MP6A 3RROA 2HO5A 3IS3A 3S1LA 5H83A 2QRLA 1OZAA 4CUKA 3ZU3A 3GK3A 3IP1A 3V1TC 3VKVA 1AN9A 2V6BA 4YT2A 5JFOA 1C0PA 2C59A 1PJBA 3DC2A 2GR9A 4IDEA 4UEJA 2HMVA 3OP4A 5JAIA 3BAZA 3UGKA 2BGLA 3NGXA 1EVYA 4B8WA 1LLQA 3IKVA 3EC7A 2ZCVA 3JV7A 1E0DA 2OZPA 3O38A 3IJRA 2CVZA 3LT1A 5T67A 3UN1A 3FNEA 1IL0A 1L7EA 3L9WA 5ITVA 3BMQB 3VPSA 4IY1A 5ICSA 3GDOA 2D1YA 3DZGA 3BMOA 1VRWA 5H82A 1HF3A 1DC4A 2YV2A 1KVSA 1SAYA 2PNFA 3QHAA 1DFGA 5EPOA 3S8MA 4A27A 1K89A 4A2CA 4BNIA 2VHZA 4FC7A 4II2A 4ALIA 3U4DA 1KEVA 3NJ8A 4J7CA 4Y67A 1N9GB 1GCOA 4IJWA 3GRPA 3SC6A 3V8BA 1NPDA 5COAA 3PJGA 2GCGA 2J5RA 1HDGO 4IINA 2JFGA 1P1FA 4RDIA 1B2LA 4IPTA 4KMSA 2ZTMA 5BSGA 4DPKA 2GN9A 2HK7A 4YXFA 4PLCA 5KKAA 4Z9XA 1WDMA 2E37A 4GX0A 1M75A 5KJ1A 3AU8A 1DBVO 3GUYA 2C20A 3K73O 2Q99A 3E1KA 4MVJD 1PZEA 1O6ZA 1VKOA 1ENPA 2FR8A 2X0RA 3C3XA 3GAFA 4CQMD 2NADA 3R0IA 4YJDA 2O3TA 3FNGA 1U8XX 3V2GA 3PVZA 2WDZA 3PFFA 1WVGA 3B6ZA 2VTEA 2GASA 5C7OO 3EHEA 3LDHA 2IZZA 3MJVA 4XGIA 5LCXA 4KTTE 4HUJA 1KIFA 2PY6A 1Q0HA 5DT9A 1E5QA 2NQTA 1GADO 1O95A 1V0JA 4TVBA 3WTCA 3TZCA 2JAPA 1GEGA 4J0FA 1ISHA 1WWKA 5KVCA 3K9QO 2ZJ0A 1U2DA 4GH5A 3DO5A 3EVTA 4ZQGA 1NXQA 3AY3A 4LGVA 2OORA 3GVIA 2I76A 3D3WA 3RI3A 4CLEA 3KM0A 1ISGA 5CEJA 1NR7A 4RCVA 5C3MA 1NBOA 1S7CA 2HMUA 5L9AA 3HUDA 2JD0A 4IDCA 3HSKA 3PFWO 1LQUA 3RC2A 1BW9B 4IGEA 1N7HA 1JKJA 4NR0A 1Z7BA 5TT1A 4Z3KA 5KJFA 1UJMA 4LCEA 1RYEA 3CH6A 1SOVA 4PRKA 1V3VA 4NH4A 2VHYA 2GD1O 3QSGA 1U3WA 4IDGA 1TVEA 1VC2A 3CEAA 3KZVA 1NVTA 3ONDA 5ER9A 1ZK2A 1L1FA 3HN2A 4GVXA 1GPJA 1C3VA 4BKQA 1NAHA 2H1SA 4S3MA 4BO5A 1PU2A 3OIGA 3Q9NA 3BZUA 2PZKA 4R5HA 1DXYA 5DULA 1ZMOA 2GO1A 3QVOA 3DR3A 1Q0LA 2V6FA 5K6AA 1P0FA 2O3SA 2VHXA 2RBEA 3MCVA 3DOJA 1KBZA 3GC6A 4U5QA 3W4IA 4LISA 5I8ZA 1A9YA 2UUOA 3T7EA 4AL4A 1LUAA 5TF4A 3WIEA 3JYQA 1P44A 3L4SO 3DZFA 3JQBA 4B8ZA 1UAYA 4CQMB 2DBQA 2DVMA 4MVJF 5C5IA 4FFOA 3ZWMA 1HDXA 3H9UA 4I08A 1B0AA 1YO6A 4WPGA 2GZ2A 5TRTA 4CL3A 2A94A 4JLWA 4PFJA 3W8FA 1DSSG 2ZTVA 3U49A 2ZYDA 2O23A 4OH1A 5EMHA 4FS3A 4J1SA 1XCBA 3HDHA 5IN5A 2FWMX 4KDEA 3OM9A 4PGFA 4BNNA 3D1LA 1Y5MA 3BMQA 2Q1WA 3WSWA 1DPGA 1FDSA 3WQSB 4JIGA 4JK3A 3W4KA 6LDHA 4R3NA 1E7WA 3JD4A 2JFHA 4YJFB 1EMDA 3JQEA 4DQVA 3OA0A 4BO8A 1TT5A 3FR7A 1H6DA 2XXBA 3LLVA 1N9GA 5KKCA 4GLOA 2VOJA 4NZ9A 1ZO8A 1NPYA 1ZCJA 3GEGA 2HQ1A 3M2PA 4YAJA 4BNJA 1HE4A 5CG1A 5T73A 1I3NA 2I67A 1AE1A 1KEPA 5ICMA 3FCOA 3NJ4A 3STHA 1I2ZA 4BMNA 2X0IA 4FPXA 1U4SA 1QYDA 4OKNA 3P5SA 2IXBA 3K96A 3D7LA 4JNKA 1BXGB 4J91A 5IDYA 1HLDA 1ISMA 4XD2A 4E2ZA 4H15A 4JJFA 3AUTA 3KHUA 1V9LA 4G65A 4E5NA 2VHVA 1HETA 3F1KA 1NFFA 5FEUA 1VJ1A 3WS7A 3GDFA 3ORFA 4UUNA 4CMIB 3MTGA 1MB4A 2BFOA 4CM9A 4EUHA 1ZMTA 2YQ4A 2O3RA 3C24A 1Z45A 3GNSA 1OOEA 2A9FA 4XIJA 2EGGA 4BNFA 3SVTA 1QORA 5H81A 3I5MA 3IUSA 4RGBA 4ZD6A 2VNSA 4YRBA 2DPHA 1DO8A 1KVTA 3ONEA 4PVCA 1IHYA 2P91A 5G0SA 4FDAA 4I5FA 5B1YA 1B7GO 3UKOA 3PHLA 3PK0A 1FJHA 4YDRA 1TXGA 1IE3A 4BNYA 1DAOA 4R5MA 2YQ5A 1ZK1A 3KXDA 1EVIA 2O3UA 4AJKA 1SMKA 4RZHA 4FR5A 4C7KA 5K6AC 3E82A 2GSDA 3BMNB 3U9LA 1DIBA 3PI7A 1T1SA 1R0KA 1VSVA 5A06A 3DOOA 3JQBC 4IJKA 4ZQHA 5TC4A 1GTMA 4W7HA 2Y0CA 1PJLA 2B0JA 3KYCB 3JYOA 1KY4A 4D44A 2EG9A 2OP0A 1QG6A 4J6FA 3LYLA 1LNQA 2Q46A 1H9BA 3KV3O 1U7HA 4GKVA 2CVOA 1BW9A 4GX1A 4WLUA 5IZ4A 4RLHA 1HXHA 3FHLA 4XB1A 1ZBQA 4WLVA 3FPCA 1PGOA 4AJIA 2PD3A 5TNXA 4RPJA 4M55A 3MWEB 1GUZA 4DIFA 3S2GA 1LA2A 5BNIA 3B20A 3PGXA 4B3JA 3UCEA 5JPIA 4EGFA 4UUPA 1U1IA 1YQDA 4UVIA 2PV7A 3U4HA 2P9GA 1MX3A 4E5MA 3M2TA 4DMLA 4YAKA 1QYCA 3QVXA 1EEHA 2FY8A 4NPCA 3MTJA 1K6JA 2I5PO 2NNLD 1W8DA 3RBXA 1N1EA 4UREA 4YQZA 3X2FA 4EDFA 4CM6A 1QLJA 1HT0A 5CDSA 2P5YA 3F5QA 3PJDA 3ENKA 3TJRA 1EE9A 4F3YA 2W90A 3JQ7B 3WLFA 5CG2A 1DOHA 3DWFA 4MVJA 3CSDA 3ULKA 3ZNQA 1NQTA 4PZDA 3H6KA 3DTYA 4CLRB 4BNLA 2BELA 4CQMA 3EZYA 1MXFA 3MEQA 1CF2O 4Z0PA 2UUPA 5IJZA 2AHRA 3GT0A 2FPGA 1SPXA 4BGUA 3MWDB 2O7SA 2C82A 3CMMA 4LRSB 5JMPA 2VRCA 3WFJA 1XELA 4WNCA 3A28A 3ADPA 3ROMA 4YAGA 1RWBA 1TEHA 1LDEA 4BV9A 5CDUA 4A03A 3ZZNA 1E3WB 2CDCA 3AU9A 4W99A 1ZKMA 3RCBA 2GZ1A 1HSOA 2Z5LA 1ZUD1 4QUKA 3KVOA 3Q6IA 5TS3A 3ETDA 4W7IA 3UICA 2BGMA 2DC1A 3AI2A 4YJFA 1HRDA 4LVCA 1C14A 1T25A 3GLQA 3WGTA 5KCZA 5CPBA 1IUKA 1C1DB 1X1TA 2TMDA 1MG5A 4ZQEA 3RUFA 3V2HA 1T1RA 2VWHA 1AXGA 2EP5A 4CM8B 5CAEA 4MIEA 2QW8A 2DM6A 4CM3A 1CQIA 2BI7A 3BHIA 3U3XA 3QIVA 5T5QA 3P2YA 1E77A 4K6CA 4E5YA 1BXGA 4L9RA 5JBIA 4XDZA 2X9GA 4NBTA 1BVUA 1IHXA 2D0IA 1C1XB 3OQ1A 3NTOA 3E03A 3RAJA 2C2YA 4MVJG 1SOWA 1WAMA 3DHNA 4BO1A 3E9QA 4K1LA 2Q2QA 1NFQA 3WGZA 5GMOA 3C7CB 4CMIA 1SNYA 4CV0A 1E3IA 4HY3A 2PH5A 5KVVA 4INAA 5GY7A 5I9LA 1HYHA 1YQXA 2VN8A 1QSGA 3AJRA 4XDYA 5COBA 5T6BA 4UVHA 2NQ8A 1R6DA 3VZPA 3CZRA 2OP1A 4N5NA 4OM8A 2JD1A 3INTA 2X9NA 4OXKA 1UZLA 2C07A 4J7UA 4QFCA 1ENOA 2QX7A 4XYLA 2EHDA 5IAAA 1PR3A 2IYPA 3PQDA 4ZRNA 3VKUA 3PIIA 2AXQA 3SX2A 5G0TA 1I8TA 4TRMA 4E2XA 1XQ1A 4UEKA 3LU1A 1WXDA 1L7DA 1T2EA 3QY9A 3NT2A 3BMNA 2PLAA 4A0SA 4BNUA 2D8AA 1PJTA 3GEDA 4S1VA 4O5OA 4GBJA 3JQGB 4YBZA 4HXYA 4BO6A 4PLGA 4WJZA 2FZEA 3ZNNA 1JQBA 4K26A 4EBFA 1G0OA 1Z75A 4F45A 3AI3A 2PD4A 4D3DA 3KYCA 7ADHA 1U3TA 3JD1A 3WMWA 4RF4A 6ADHA 1T2CA 2G76A 5IXYA 3I6IA 4ZRMA 5TJ9A 4M89A 4RPHA 4RJTA 2IXAA 1GZ3A 4Z0TA 5JXWA 4B3HA 1LDBA 3NT4A 2H9IA 2PD6A 4W9NA 4EJMA 4BNHA 3EMKA 2BFAA 1YRLA 4J2HA 4NI5A 1DIHA 2DPGA 4RPLA 4R4JA 2VWQA 4YA6A 4CR8A 5L4NA 5KVSA 2OFPA 2YY7A 1BXKA 4LN1A 4ONEA 5KJEA 4OMUA 3QQPA 2X86A 1HTBA 3I9LA 5L4LA 1EK5A 5TGDA 2FSSA 3GN1A 3Q9UA 3KO8A 2PKRA 2P68A 3GQVA 4XZ3A 4WASA 4A5OA 5I7EA 2ZB8A 2I99A 1GZ6A 3BTVA 1U4OA 2X22A 3WNQA 3JQ7A 2Q1TA 4CR6A 2I3AA 5L7WA 3INRA 3CMCO 1X7HA 4GAEA 4JN6B 1O8CA 4EUEA 3S55A 4CLRA 3QJ5A 3DL2A 4A10A 3JCZA 4PLYA 1N2SA 2BGKA 1LLDA 2UYYA 2Y1OA 2Q22A 1Y8RB 3RC9A 2V65A 3CTMA 2PKQP 1E6UA 3HE3A 3E6AA 1Z6ZA 4I5DA 5B12A 4J2OA 3WICA 1Q2XA 5AXCA 3U5TA 2Y68A 5L95A 1ZZEA 4MP3A 1O9BA 1MP0A 3ZU4A 1WMBA 3DEYX 1JA9A 4WK6A 1I30A 2BFMA 3PRJA 1LDGA 3ZW9A 4LSMA 2DFDA 3V5NA 3LT2A 1T24A 1BTOA 2QZ9A 2IDZA 1KVRA 3RKUA 1E3WA 1EDOA 2WM3A 4EUFA 3VZRA 4L4RA 4HFMA 1EVJA 2ZTLA 3G0OA 3TFOA 1Z7EA 3DZBA 1FDVA 1FF9A 1JTVA 1U8FO 3ICPA 4MJLA 3IDSA 1KY5A 1MFPA 4XR4A 3OJOA 3WB9A 4RQUA 4XYEA 3TL3A 1JN0A 1C1DA 4MVJM 1PL8A 1PZFA 4DMMA 2EKQA 2Q4BA 3VPXA 3BYZA 2OOSA 1I3KA 5A1TA 4CM1A 4JJIA 4MOWA 3QLJA 4RV9A 1P31A 4XRRA 1XR3A 1ULSA 1X14A 1RYDA 3EW7A 1DHTA 1NTOA 1OC4A 3I4FA 1C1XA 1K2WA 2I66A 1EBFA 2BLLA 3QRWA 4E5PA 1S6YA 3B1KA 1F0YA 3RUDA 2WYWA 1SC6A 3ONFA 2CMDA 3OEWA 4W9NC 3PQEA 3WFIA 2Y05A 2PGLA 3FWZA 4DLAA 4R51A 3M6IA 1ENYA 3UXYA 3RVDA 3BTOA 5THQA 1HZJA 3LC1O 1W0CA 2J3KA 2UVDA 2HMSA 3BHMA 4C7JA 2Z1MA 3ZNOA 1PJ2A 1SBYA 1KEWA 2X5KO 2Y1CA 2IE0A 4FGWA 3ST7A 1JLLA 5HBRA 3ROQA 4OIMA 3T4XA 1GDHA 3PEFA 1LDMA 2NUAA 4FB5A 3G1UA 1ZIDA 4B3IA 4E0BA 4PIVA 3LK7A 1P0CA 4YJGB 1NQAO 2AQKA 4IDAA 4NK5A 3V2UA 4NNJA 3W8DA 2OBNA 4YTEA 2QG4A 2H63A 3OMLA 4EI2A 2J3IA 3AW9A 3LZ6A 3JQGA 3MJCA 3OETA 1F14A 4A73A 4KUHA 4CLOA 1CEQA 4RORA 4JROA 1NWHA 1IPEA 4PLTA 1KVQA 1OI7A 1D3AA 1Y1PA 2NWQA 3RBZA 5CPFA 1UR5A 3N58A 5DOZA 2Y1EA 4TRNA 1MC5A 1V35A 2DFVA 4UULA 5U1PA 3ANNA 4FFPA 4YQYA 3NTRA 5TSDA 1NR1A 3LF2A 1RM3A 5GZ3A 1DJQA 4FOSA 2AE2A 4NK4A 4RVFA 2PKQO 4BNVA 3COSA 5AXAA 2PH3A 4MIYA 5L7YA 3PJEA 4GQAA 5I7VA 1O5IA 3I23A 4IQ8A 1QR6A 2I65A 3OJEA 4U0JA 2OXIA 3ZU2A 5JE8A 4ZN6A 5EJ2A 4HNGA 1I01A 1TLTA 4FGSA 5ES3A 2J6IA 3ZN2A 1CWUA 4AJ2A 1PTJA 1QYWA 1E7SA 3NEPX 3F47A 3NV9A 2O2SA 3ZWNA 1LTHR 2YUTA 1FDTA 5DF1A 2WWRA 3KLPX 4QX6A 2AEMA 2V7PA 3GF4A 1PIWA 2HMTA 5K0ZA 5B4UA 3WLEA 3KBOA 1TT5B 4PG8A 3AI1A 3E5MA 4WLEA 2JHGA 4IXTA 4ZQBA 1ISFA 1P1IA 3E18A 1WDLA 2B35A 4U8GA 1B8VA 3G79A 1DEHA 3Q2IA 5F1KA 3QA9A 4TMFA 5JNLA 2X9VA 3OH8A 4JP3A 4Q3CA 4Z0HO 1Y8RA 1YDEA 1H94A 4RDHA 2AW5A 4AJNA 1Y8QA 3PWZA 1Q7GA 2NTJA 4BO0A 5DP2A 4Y6SA 4IXWA 2NU7A 3H5RA 3HWRA 4X54A 4K28A 1DRWA 5AVOA 1E3SA 3H8VA 3WR5A 4R1NA 1ZK0A 2NU9A 2ZB4A 1I33A 4PCVA 5BR7A 1J0XO 3S2EA 2Q50A 2GNAA 1TA4A 2GRAA 1E1KA 1JKFA 4DC0A 1Q7BA 3IIEA 3GVHA 4B4WA 2YFHA 1QV7A 1VSUA 1UXJA 4RPKA 1NAIA 1P74A 4PG5A 2X8LA 2JCVA 4NU5A 3ETGA 2GPTA 1CJCA 5G2OA 1ML3A 3F5SA 1M66A 4CV3A 2VRCD 2HRZA 2LDXA 3VVCA 3PIDA 2BHLA 3NYWA 4NBWA 3G3EA 2BKAA 3AM4A 4LK3A 4WOKA 4CMCA 1MA0A 3EAGA 3ADOA 4FN4A 2R6JA 2JKVA 3AFNA 2J3HA 1XHLA 3L9XA 3VH4A 1OC2A 3WIDA 5FI3A 4J4HA 5EQDA 1O0SA 2Y67A 2I3GA 1VM6A 2O48X 1ZW1A 3I9KA 3GHYA 4W82A 3HZZA 2G0TA 1ENZA 5A02A 1PQWA 4RLSA 4XQEA 3SJ7A 5IDWA 3ANLA 4BKOA 1DC5A 1J4AA 3GFBA 4TKMA 1YJQA 4XYBA 1YBMA 2HK8A 3DB2A 3K6JA 1ADCA 4WCFB 1YDWA 5JAMA 5KTKA 3I1JA 4L73A 1P77A 1T2AA 4IMPA 1KC1A 1IPFA 4YT4A 5CDYA 3IL2A 5TX7A 2X5JO 1HSZA 4Z6KA 3TOXA 4NU6A 4JXKA 3GMSA 1J49A 1VE9A 2ZK7A 4II3A 4B4VA 4WE3A 1R0LA 5C7LO 4D42A 1P3DA 5DBFA 1N1GA 4RO0A 1C0IA 3FPLA 5DOVA 5LDGA 3LVFO 2VT2A 4WLNA 3RUIA 2DT5A 3WSVA 2D59A 3L0DA 5DCUA 4P4LA 2ZB7A 2CDBA 4YJGA 4MINA 2D5CA 3V1YA 3CXRA 2YV3A 4KZPA 3UVEA 4Z9YA 4Y6RA 2E6UX 1WNTA 1J6UA 1DAPA 2QZZA 2HK9A 4NJMB 3IJPA 1JDJA 3QVWA 4JQCA 4HKTA 2JL1A 3AY6A 4DL9A 1ZEJA 4OXNA 1LQTA 3RD5A 1YB5A 1HDZA 1LSOA 2PWZA 4BGVA 4CMKA 2B4TO 2A92A 3IMFA 3KTDA 4CMBA 3E48A 4XX0A 4ND4A 4PG7A 1EDZA 4MVJH 4FC6A 4EEXA 2IODA 2ZQYA 2FSVA 1EFLA 1XKQA 2F00A 1PJQA 4BB6A 3OJLA 2FR0A 4RPGA 4OSOA 3OBBA 3FSRA 2NSDA 4BB5A 1TB4A 1IYZA 2ZJ1A 3KEQA 5G4KB 4ZICA 4O63O 4L75A 1ZXLA 5BT9A 1E7YA 4PRLA 5HS4A 1B15A 1ZK3A 3FNFA 3RC1A 3AM3A 3PHIA 2NTNA 4OAQA 3RWBA 1T26A 4R1SA 4CV1A 2Q1SA 4O59O 4IGFA 1H9AA 2O2YA 3MJEA 1H0KA 4BQPA 4DLBA 4GMFA 2E4AA 4L4XA 3VTZA 1FDUA 1GR0A 1LBEA 3H65A 3C8MA 2J5KA 3GVXA 4CJXA 3RBVA 1LU9A 4Q3DA 3JSAA 4MP8A 3VAZA 4ALNA 1SZJG 4FOOA 3I9MA 1LC3A 5DZSA 2X0NA 1J5PA 3TZKA 2EJVA 4RQTA 5ENVA 2Y0DA 5MDHA 5J23A 1H6BA 3WYBA 3MJTA 4YYZA 1K5HA 3TDKA 3RIHA 3JD2A 3O9ZA 1K0UA 3QW2A 2FPPA 3JQCA 2A35A 3WQRA 2YDXA 4DTIA 5BSHA 2LDBA 3EDMA 2AG5A 3HFSA 1UXGA 4UEOA 3ITDA 4R41A 5JAZA 1NQOA 4DPLA 1T4DA 3HQ4O 3DMTA 5EN4A 4D43A 1CDOA 3DZIA 3U4IA 3KYBA 3VPGA 1HWYA 2EXXA 1EUCA 4F46A 1XQ6A 3H3FA 1ZJYA 2Z95A 4J9VA 2UV8A 3MJSA 2G17A 4IBOA 4XRGA 3CPSA 2B4QA 3ANMA 1R4NA 3QVSA 5TIIA 1PGJA 4E6PA 3ZWOA 1AGNA 1YE3A 5AOVA 4MIOA 2PFGA 1I2BA 2JAHA 4OSPA 4BMVA 4W4TA 1GY8A 1UXIA 3ZHBA 3O8QA 1YS4A 3WX0A 1V6AA 3OQBA 3FF4A 2DTXA 1I32A 1NVMB 4D0RA 1HL3A 3S2IA 3RU7A 4I9HA 3OF2A 2OBYA 3TPCA 1DIGA 4KUEA 5HM8A 1BMDA 1I0ZA 2QRKA 2SCUA 4M1QA 3JYLA 3D5QA 4Y9DA 2NU8A 1DHRA 2VZ0A 3HDQA 4WCFA 2POQX 1QXSA 4ND5A 2C7VA 1EBUA 5I9NA 1AUPA 5CP8A 1UP6A 5FYDA 4AJLA 3U0BA 2QIOA 3ZWWA 5ILGA 1QYXA 1PQPA 1KOLA 2NVUB 3KSUA 3U4CA 4GX2A 1B8PA 2EEZA 3H5NA 2RH8A 4MO2A 1LRKA 4FJ2A 2DUWA 2WD8A 3ZHZA 4BHTA 1YWGO 4GI2A 4WECA 2CVQA 5ER6A 4Q3BA 2GZ3A 2IEDA 4YPOA 5TQVA 2OUIA 5FF9A 1E3JA 1D8AA 3TZ6A 3NGLA 4FCCA 3ZCXA 2ZTUA 3OICA 3D0OA 1QKIA 5I7FA 2Q2WA 1DIRA 2EF1A 3RFXA 4OJNA 4CMHA 1DFIA 2XF8A 3W8EA 5CEFA 1VL0A 2BH9A 4EJ6A 1YQGA 1I3LA 3VC7A 2AE1A 2YJZA 4NJMA 3W4JA 1NFRA 2B36A 1PWXA 1EK6A 3L4BA 1EZ4A 3IC5A 4XEHA 3WGHA 2EKPA 2XAAA 3PPIA 3JQ9A 3ZGYA 1UXHA 1PS8A 4OHUA 3FD8A 5M6DA 1HE5A 5FFFA 3VHRA 3DMTC 5MGBA 2B5VA 3RU9A 2FZWA 2P2SA 2V6MA 5IZCA 3NT5A 3HB4X 3K31A 3H2ZA 2Y66A 2O3QA 3E5RA 4WUVA 5G4KA 3RKRA 3PHJA 5TJHA 3RJ9A 5CDTA 3GZNB 4E21A 4NG5A 4MKZA 1JVSA 1ZFNA 2QQ5A 1FDWA 4IS2A 1JVBA 4IZIA 2WE8A 3OQ6A 3OA2A 3MOIA 1QLHA 2DKNA 2Y1GA 4HNHA 1VKNA 1LSUA 2A4KA 4BGEA 1RM0A 2C5EA 1GQ2A 2B69A 3K30A 4N5MA 1GYQA 2HCTA 2GN6A 2XXJA 1QMGA 3LLSA 3P7MA 4R1TA 3DHEA 9LDBA 5J9GA 3EY4A 3KSZO 3QVTA 2X23A 4M49A 3ZWCA 3CIFA 4DYVA 1HDCA 3D4PA 3R1IA 4TSKA 4IQGA 1DLJA 1G6KA 2WEKA 3GVCA 4WCFC 2O50A 4DGSA 3OFSA 5BNTA 4H7PA 4WKGA 2YV1A 4BIIA 4PLVA 1LSSA 1UAGA 2FRDA 4EJ0A 3GG9A 4E33A 2AQ8A 4UUOA 2UDPA 1I5RA 4J1TA 4YJHB 4P4NA 2HLPA 5ITWA 1LRJA 5JLAA 3PDJA 4ND1A 4XCVA 2D3TA 4FSHA 4YRAA 1B26A 4GKBA 3I9NA 3GVPA 1U28A 2CNBA 5T57A 5JMWA 4L76A 2AEFA 2WYUA 3RJ5A 4QTZA 1I3MA 5F5NA 1LXCA 3GEMA 5A3JA 3DBVO 4AVYA 2I9PA 2YYYA 4WLOA 1UZNA 3TZQA 3CZMA 4U0KA 2QRJA 4UAGA 1BRMA 2AQIA 3QE3A 4R16A 3L4BC 1E1MA 4TRJA 5L7TA 4XGNA 4LCJA 3PYMA 2HRBA 5TT0A 2P4HX 3JQ9C 3IAHA 4G5HA 1XEAA 2NU6A 2VCYA 2Y1DA 1NHWA 4BNXA 2VRBA 4CLOB 3DAFA 2NVBA 4K9DA 2OL4A 3DBRA 1GD1O 1ADBA 2EIHA 4E5KA 2PGJA 4PLFA 5HWSA 1Q1NA 4DYDA 5IZCC 2X7HA 4B4UA 2NVUA 1Y6JA 5JDCC 4BO3A 3BXXA 3R3JA 3RUEA 1YXMA 1NQ5A 3K8ZA 4RF3A 2J8ZA 1VJ0A 4M86A 1ULUA 4NDNE 3NRCA 3L6DA 1Y81A 4KP7A 4RL6A 1ADFA 1ZEMA 4TZKA 1A5ZA 4AFNA 2X58A 2PZLA 3EK2A 5DCYA 4M87A 2FP4A 1PZGA 1B16A 1XLTA 4UVEA 4WEOA 1ZJZA 3ZI0A 2DQ4A 3Q1LA 2P9EA 3VTFA 4RVSA 1RJWA 3ZDFA 1OBFO 1I10A 4ALKA 4JJGA 5KVQA 1E3EA 3DAGA 4EYEA 1P45A 1F8FA 2GUGA 3WWYA 2VOEA 4MPDA 2JD2A 4ALMA 4A26A 4CM5A 1YONA 5ILOA 3NDJA 1U7TA 4P8RA 5CFZA 1N7GA 3DZHA 1ZVMA 5EERA 4BVAA 3FN4A 1DFHA 1R4MB 2CSUA 1R15A 3JYPA 1JU9A 1Q0QA 5A9RA 3GGOA 1N92A 2OO5A 2HKIA 3PJFA 3AUAA 1NASA 1Y8QB 1SO8A 2ZIZA 5DBIA 5JDIA 2WYVA 4LRTB 3OIFA 5LDHA 4DXHA 1E7QA 2P9CA 3O03A 4ALLA 5KWEA 1XWFA 1JW9B 4HX5A 5A4DA 1WPQA 4XA8A 4P4GA 2DBVO 3FNHA 2JCXA 3AY7A 1ISJA 4D0SA 5FWNA 4KWIA 4CMGA 5A04A 3W1VA 1HEUA 3GZNA 3D5TA 5JC8A 3EVNA 4J0EA 2Q4EA 3TOZA 1H2HA 4PN3A 4N7RA 5BNFA 1U3VA 3H9EO 3ICCA 5JY1A 4K6FA 3H4VA 4NFSA 4QO7A 4NHEA 4DREA 4PG4A 4FFLA 4J4BA 3I52A 1IY8A 2FOIA 2B5WA 1DRUA 2X6TA 3CINA 1EVZA 4DBZA 1ONNA 2D4AA 4PG6A 3DOCA 3A1NA 1F17A 4DQXA 3KB6A 2C2XA 3WGGA 4CUJA 2CD9A 1KC3A 4BO4A 2H5LA 2JCYA 4ILKA 4J1NA 2VZ9A 4WNIA 1DJNA 3Q3CA 4AJOA 2W2LD 3ETEA 2Q49A 2JFFA 1GU7A 2DTEA 5KOIA 1RM4A 4Q3EA 2OMEA 5AQ1A 1WMAA 1GZ4A 4G81A 4Y98A 4J7XA 5KIAA 2HJSA 1N8KA 4OGWA 2BD0A 2VYND 1U3UA 4I1IA 4NBUA 4IDFA 2HU2A 3GGGA 3N7UA 4KTVE 4YJHA 4MVJE 4GGPA 2JHFA 3GY0A 1JAXA 1PGQA 2AQHA 2VUTA 3L77A 4R01A 3RFTA 3WQQA 5I7SA 4BO9A 4R69A 4N54A 1LI4A 4LMPA 4I9UA 1H93A 3O4RA 3Q2KA 4PLHA 3JD3A 5EIOA 1R0SA 2NACA 2UAGA 4PLZA 3WGOA 4OXYA 1H6CA 5G0VA 1GQQA 4ROSA 2CUKA 4BGIA 3HNPA 4L4SA 5COQA 4PLWA 5ENDA 1H6AA 4NFHA 1RKXA 2VWGA 4R1UA 3WDSA 2ILTA 2OHXA 4HFJA 1E1LA 3F6YA 1B3BA 4E31A 5JO9A 1E7MA 3ZV5A 2ZATA 1DLIA 4OOEA 3GPDG 1UXKA 2CZCA 1ID1A 3KOUA 5ADHA 1IZ0A 1MV8A 1PJSA 5A5EA 1M6WA 4B7XA 3C1AA 3AUSA 4JBGA 1WZEA 2EP7A 3GFGA 4TVOA 3GHHA 4CODB 5JDIC 1GAEO 3M1AA 1ZK4A 1I2CA 2C29D 3PP8A 1G0NA 4D45A 5CEEA 4DPMA 3UW3A 1Z73A 1ZSVA 3TQHA 2WE7A 5DP1A 5EL0A 1Y7TA 3KYDB 3VH3A 3K5PA 5F1PA 2ZCUA 5JC1A 4D79A 3CUKA 2WTBA 3TN7A 3BMCA 1MLDA 4GVLA 1VJTA 1VLLA 3TSCA 1F06A 2QYTA 3PQFA 3SLKA 3F46A 9LDTA 3ZNPA 2CFCA 5IN4A 3VH1A 3PYLA 5IF3A 2VHWA 5A5FA 4XGKA 4AG3A 4DA9A 4D3SA 4YRDA 3LC7O 3V1UA 3FWNA 1IULA 1TT7A 3H7AA 3AK4A 3PHHA 4XR9A 4CL8A 2YW9A 3ZHYA 1LLCA 4NMHA 3ABIA 3L6OO 1M67A 1PS0A 4HFNA 1YL7A 1R66A 4YAEA 3WTBA 4XKJA 3UFXA 4FFMA 2D2IA 4CM4B 1X7GA 1N5DA 3F3SA 3KSDO 4AJ4A 2HMWA 5LC1A 3RFVA 4WOJA 1H5QA 4XYGA 2Y0EA 1BG6A 3IP3A 1R4MA 3EYWA 4OQZA 4Q3NA 2Q1UA 3PWSA 3DFZA 1B3RA 3TL2A 2EJWA 2Y1FA 2EGHA 1GYRA 3GNTA 3IOYA 2VQ3A 3A06A 3D64A 1LSJA 3GR6A 5T64A 3X2EA 1YBVA 4CM7A 5G4LA 1HKUA 4GPD1 3F4LA 1KETA 3DZJA 3PXXA 3H5AA 3SLGA 4HADA 1NP3A 4GMGA 3AOEA 1PJCA 3F4BA 1M76A 3JQFA 1DRVA 3PHGA 4FIZA 4L0QA 4YT8A 3E9NA 3PTZA 1C0KA 4J49A 3UHAA 5JAQA 8ADHA 1PL7A 3IKTA 3O26A 3R6DA 4IZHA 1K3TA 1HE2A 4BO2A 5KNLA 4D7AA 3H9QA 5IXSA 4DIBA 2DTDA 5K9ZA 4R3WA 1TI7A 4ND2A 1P9LA 1YOVB 1FXSA 2RHCA 3FI9A 4IDBA 1E5LA 2XPCA 4Q39A 1UP7A 1AXEA 1XG5A 3GNQA 4OKIA 3SXPA 3FTPA 1SEVA 2NV6A 4F6LA 2E48A 4IIVA 1EFKA 1BSVA 1W73A 3HFGA 4OQYA 1R4NB 3VOSA 5JYAA 3UCXA 4WEQA 3DMYA 4DLLA 4XQCA 1Y9AA 1C0LA 3OJ0A 2C0CA 3QP9A 1R12A 3VPHA 5EESA 3O8QB 3NDRA 5T8KA 4RVUA 4IQ0A 2W98A 1NYTA 1UUFA 1YH3A 4CQLB 1MUUA 4KQXA 1LDNA 4LMRA 2Z1NA 3KLMX 2EV9A 5DDIP 4FJ1A 5DCWA 4J1QA 3OEYA 1XYGA 1ADGA 1Y9EA 4ND3A 5U9CA 4CMJA 1R37A 2C7GA 4DC1A 3T7CA 1HLPA 3WNVA 4AICA 1Z82A 3ENNA 3A14A 1E1NA 1FMCA 4U6QA 2IYOA 4J90A 1E6WA 2Q45A 5JS6A 3RC7A 3GZ4A 1K6XA 2G5CA 3CE6A 5JCJD 1CERA 4Y8VA 2D5AA 3FR8A 4J9UE 4Y6PA 1VPDA 1CETA 5EQFA 1ZH8A 3TFQA 3ROPA 1XA0A 2W2KB 1PJ4A 4N18A 5FI5A 4AJ1A 1IB6A 2PZJA 5BSEA 5JO0A 1HE3A 2E82A 2PA3A 4GSKA 3Q11A 1IOLA 4CV2A 1EQ2A 3ON5A 1W4ZA 1XSEA 3IUPA 3T4EA 2VUSA 3WMXA 3CKYA 3DBLB 1XU7A 3WGQA 1NX6A 3JQ6A 1V3TA 3BTUA 3RUHA 4E4YA 2WD7B 2R00A 1DB3A 3P19A 3FBGA 3H3JA 3W6UA 2G1UA 5GZ6A
chains in the Genus database with same CATH superfamily
5JY6A 3LRPA 1MGOA 4D25A 4DJTA 2ZRMA 1RAFA 3AOEC 1N7IA 4DLXA 1JWLA 1A9XB 3JQFC 2V3WA 5BN4B 1JAYA 3VKFA 1CUFA 1R18A 2XQFA 4KODA 3OKFA 1PNTA 3T3HA 4B1FA 5AJUA 1I80A 3SMQA 1SKYB 2C3YA 1QRRA 3QBVA 3L05A 3KYDA 4HB3A 4UATA 3KZCA 1CVRA 3E8XA 1MC4A 3O8OB 3PNYA 4Y2VA 2HWXA 3Q2OA 3GP3A 3ZH2A 3ZX5A 4X84A 1E0KA 1ORHA 2HA6A 3T5MA 2QORA 5JIBA 2JFXA 2IS6A 3INNA 1C7ZA 1NN1A 5HA5A 1VSBA 4I8IA 4D4MA 5KEIA 1DAHA 5EIBD 1W9MA 3WL8A 1WD5A 1JEJA 4IDDA 3MT7A 1IHOA 2X4GA 1CYDA 3MBIA 1SVKA 1LI5A 4TV9B 3IDZA 4HUQA 5D3ZA 4W5WA 2FKNA 4DRYA 1JU3A 2FG7C 2AEJA 3L6BA 4YAOA 5D5HA 3CGGA 5EI5A 5K0SA 2WAOA 4Q37A 3E23A 1D8TA 1ZGGA 2C04A 4WH0A 3SDBA 3ROEA 1KDZA 4K6GA 3DNMA 2MR5A 1XK7A 1TKRA 3H4IA 3B2QA 5IDQA 5BV2P 4BBZA 1IN4A 1MRNA 2F4VB 2O0HA 4MA4A 3I9JA 2WHXA 3BE5A 5D8DA 5HK8A 2UYQA 2C54A 2WUVA 4Z8XA 2X2OA 1V7PC 3DLIA 5AW8A 2YFYA 3ZNNA 1M33A 1KDVA 2QTHA 2AK2A 4I36A 4AWXA 2HT1A 3GJ5A 1TCUA 2VEOA 2Q07A 1TGYA 4I55B 4FCVA 4TN5A 5IEBA 2BSAA 2TMGA 3N5CA 5L40A 3REOA 2AK3A 1XZAA 3SAJA 1F7UA 5EJIA 2BMEA 1BKSB 3AR4A 4P53A 3U81A 4CLXA 4CDMA 2YHAA 4ZI7B 1GUYA 1QV6A 1A27A 3I6QA 4GWLA 4KQ9A 3SJCA 4AB1A 4GXQA 5SZJA 1XMIA 2H1CA 3THYB 2GPAA 4R1QA 1QZ3A 4REQA 1NLFA 1C9EA 2FN8A 2IYUA 3OD5A 1B0PA 4PW0A 1Z0JA 3CWZA 3N07A 3DHYA 4L95C 1U2DC 2CLKB 2C9OA 2E4ZA 1ZISA 3G5AA 4NH0A 4RV5A 1Y1QA 2PJRA 4ZI5A 4PC7A 4O4IA 4P32A 1TVKA 4PZCA 2FUG1 2VSOA 3B2EA 1F12A 4TUYF 4PQFA 5J2UA 3KUKA 4XUGB 4C08A 2CLLB 1A72A 1QQ7A 1VFPA 4MPJA 5IT5A 4JEHA 1OU0A 5KX5F 1QG4A 2HDHA 3QNUA 4Q03A 2EZ9A 3JTMA 4G5QA 2B3DA 4FZVA 1QGAA 1W46A 2W2MA 3HHPA 3WG9A 2GPSA 2AVDA 4L5IA 4TTVA 1LJ8A 4E30A 5HIAA 1ODFA 2Y8EA 3VZBA 4QEDA 2B4KA 3E70C 4FBLA 2R00C 2GYYA 4FE4A 1E32A 1W44A 4K05A 5GWXA 2B37A 3EPAB 4HDKA 4MRNA 3AX6A 2ZBPA 2GI4A 5G0WA 3UHOA 5B2EA 5CFRA 3ZV4A 1YZFA 4Q01A 2RAUA 3OE1A 2H5IA 3A6HA 3I83A 4RTKA 2OGUA 1BYUA 5TQ2A 3A6EA 3HDYA 1H2WA 1JWAB 2JGMA 3NUQA 3DBRB 3OO0A 2Q2VA 2QQFA 5FRDA 5HGJA 1R0WA 2NIPA 5FL7D 1I4EB 3A2NA 3MHPA 3KD3A 3VPFA 3GLVA 1MO4A 3I05A 4UTZA 4GYJA 3T7RA 5G40A 1XRMA 1UC4B 1G41A 3AL3A 1IZ9A 3WGYA 3E2MA 3HB5X 2DBZA 4H4CA 3RYTC 1GLNA 4BFYA 2ZAOA 1UDCA 5HJ5A 1G1AA 4R05A 1UADA 1AA6A 4U2CA 2WKPA 2HN9A 3Q0EA 1JQEA 1KS9A 3NJRA 1E0SA 2EEPA 2Z4SA 4X63A 1WV1A 5H59A 1QPGA 2GAOA 3JZDA 3LWDA 3QNWA 4YR9A 3EVCA 1A69A 1KH1A 3WBBA 3A4MA 1TQ2A 1VI2A 2X9QA 4RHYA 5T4BA 3WKBA 2O4UX 5JD5A 4KGDA 4Q18A 4MVJI 1IY1A 2IYSA 1F3OA 1JXMA 4R6WA 4YPFA 3W6ZA 4TTRA 3OZUA 4RZIA 4Z54A 2ZBUA 3NDIA 3STWA 1D9ZA 1GFWA 2JVKA 3NNDA 4L5JA 1K3FA 3HKBA 4Z5XA 8LDHA 4MWSA 3U37A 2Y93A 3OUTA 4Q9KA 1BS9A 2AG6A 1CJTC 3BS4A 3HJGA 2R2GA 5CLIA 1F2UB 3CBQA 3PGVA 4UD6A 2X8BA 4B6OA 4FMPA 2GPYA 3JQAD 3NTQA 2G9UA 4M9ZA 5FJIA 4NFLA 2WD7A 3KKEA 1PL6A 1W52X 4QTUB 3L2OB 4MGKR 5KYVA 3RF6A 3E9CA 4YWJA 4DZZA 1FTYA 4C2AA 2C5FA 3DD1A 4C2BA 5JZMA 2YVAA 1NW6A 4UQPA 2O59A 3K72B 3PQ6A 3IUJA 4FJ0A 4C3VA 2HV9A 3OZDA 2FEXA 2RDMA 2WKWA 2C8VA 5FAXA 3RVMA 3DC7A 1UP4A 5HTOA 4HD8A 4GL2A 3KUXA 1X7DA 3IVRA 4FUQA 4XWGA 5DBHX 5BOVA 3SHTA 3U62A 1E2IA 3GDWA 3KQOA 2PWPA 4N65A 3SBOA 2JGNA 1CQJB 3EZLA 3A4VA 5MFZA 1L1QA 3H9CA 4DJAA 4JP5A 5TDHA 2HQRA 3PGJA 4F4IA 1O4VA 3RADC 1A4UA 2PZMA 3R3YA 2VYVD 1QMPA 3WL6A 4BMYA 3O4HA 1N3LA 3P0FA 3WGIA 4ARIA 4UCFA 4FB4A 2AJCA 2ZULA 1P2TA 3HGQA 5AKLA 2D8MA 5FXMA 1YDGA 2EFCB 1ZHHA 1I79B 1A77A 1QKKA 1HZZA 4MGYR 3PXAA 1C7EA 3HCNA 3S2FA 3C1OA 3G6KA 4A36A 2GN8A 3DD5A 1QH8A 1VYUA 3EBOA 4E94A 2AMYA 5C8XA 3JALA 3EE6A 4E32A 5I48A 3AHDA 4LOLA 4CU2A 3M6LA 3EIEA 2DXIA 4M8SA 3UT6A 4G1CA 4Q9HA 1D1TA 3N74A 2Q6KA 1DQYA 3PUVA 1SXIA 2YZMA 4FW8A 2A2ZA 3HVUA 4WCVA 4BKUA 3SS8A 4NV1A 1IBCA 3WK6A 2CF5A 2ODNA 1I7BB 2OBFA 3L6EA 1UDAA 1CB7A 1GM5A 4AJHA 3TWOA 5C7IO 3B7GA 3AMVA 2VJMB 2YY6A 3E81A 1SELA 3EIQA 2MSDB 1LTKA 3RSHA 3DONA 3PDUA 2G9RA 2VF8A 3D4NA 2NUPA 4RW0A 3GPLA 5ALKA 1M6VB 4FHDA 2F3SA 5JMOA 2ZTSA 4O1MA 2GBLA 3KKNA 2Y27A 1URPA 4TUYA 4ZXFA 1LEHA 4KI0A 4Q3AA 4PYJA 3S4YA 5J5AA 1BMFD 2A5YB 4R98A 5K45A 2QROA 5KX5A 1O0CA 2IKSA 1H2BA 3DFUA 5F4BA 4JYZA 5ALDA 4CCYB 5A62A 1NYQA 4EP1A 1JWBB 1OA1A 2O1XA 3DBHB 2H59A 2ON6A 1N2IA 5CBPB 3MJ4A 4R9SA 2JDIA 4JX8A 2W4IA 4IJUA 4EVIA 1FRVA 3KG2A 3NHFA 4X44A 2NPOA 4XI9A 4HT3B 5CT8A 4HYTA 1ZR2A 1E3LA 3RT1A 3VJKA 1DJMA 1JFLA 1Y5IA 5B7GA 1FJGB 1UPXA 4Z4FA 1MIOB 4QUGA 5B2FA 2GM3A 3QEAZ 1OX4B 3FKJA 3OEHD 7MHTA 4NQRA 2GQ0A 2FG5A 2QA5A 3M4NA 1EHCA 2PGDA 3M82A 1PGNA 3N2YA 4H7FA 3BTSA 2QXTA 4XCXA 4Q7JB 4XWYA 4YI3A 3ZIAA 1NA5A 4C89A 4A7PA 2F2TA 4DMUB 4G23A 1QIMA 5C1PA 2FOXA 4XSGA 5KQRA 2FZLA 4CPDA 4LF4B 4XJSA 5GZ1A 2YV5A 3TDNA 2FTKE 1GRCA 2GK4A 1OZHA 2TS1A 3M1YA 4J16A 1P6QA 1K4YA 1YULA 3AUUA 3QWHA 5HXAA 1SZCA 2N0SA 2VJDA 2W2OA 2UZAA 4LTNA 4LVUA 4OD0A 1N34B 3L7BA 3NWJA 1W4AA 3O1LA 1V8DA 5BOSA 2R68A 3WK5A 1LBTA 3QKSA 2F8TA 4D0NA 1VE7A 1US8B 4MEJA 1BDJA 1CIVA 3VO8A 1UWCA 3PLNA 1UFKA 4PC1A 3JPWA 3WKEA 3BIOA 1ZYUA 3F7OA 2F1KA 2I6XA 3Q15C 4IMIB 4IQFA 4H6WA 4OGKA 1VIVA 1L4MA 1HZZC 4NP6A 1ZVVA 1RR6A 1SQFA 1V9CA 1IWPB 3P26A 4LQLA 5CT4A 5IKPA 3OLQA 1N5RA 4GR9A 4L15A 4NBRA 4EGCB 3B89A 3ZJVA 2FE4A 1UZMA 3H84A 3EXHB 2FSUA 5KYWA 5E0KB 3AERB 3B12A 2JFWA 1R9NA 3C5WP 4GOXA 4PIPA 1FFHA 1E69A 1VPEA 3ZD9A 4AO8A 2PXCA 2BTEA 4BIMA 3OU7A 3C6XA 4IHJF 3KQKA 3TSAA 4CG3A 4GR4A 2NM0A 2PBRA 5FO1A 1NXXA 4UHFA 5U4QA 1MPTA 4Q7EA 3VISA 3LLMA 4MS3A 2Y92A 3NHBA 1YASA 2H92A 1R6UA 2R751 3G2QA 4KRXA 4QYIA 3WRXA 3KETA 1Z12A 2XR1A 1GDTA 1M0WA 2NG1A 1DC6A 1N8SA 3ZGZA 3K2EA 1CUAA 3A1FA 1HYEA 2FDRA 4V3BA 1RYBA 4FUTA 4PAMA 4OO3A 3WYCA 1FS6A 1TMOA 2GBLC 4JB0A 3C7AA 1PJ3A 1C7FA 1PQUA 2EQBA 2QV7A 1T4CA 2BEVB 2XB6A 1Z4NA 4HGQA 4AIRA 1RKBA 3UMFA 1VE6A 3SF8A 1OBOA 4IRUB 4YALA 1PZHA 4AM8A 3KWFA 3A9WA 2YWEA 1O0BA 1J00A 5JD6A 5B30A 3ANTA 2Z43A 1T9DA 3HY6A 2I2XB 3JQDA 3QKRA 5TMPA 4B81A 2XCRB 3K70B 3DE5X 1FE8A 1N2HA 3A1EA 3NFRA 4KHZA 3ASVA 2CJWA 2IUFA 3G9XA 3ZDYB 1W5BA 2ZXFA 1MVLA 3K92A 3W34A 2FPIA 2XD9A 3IIJA 1UJ4A 1YRWA 5E8RA 4PVDA 5GAJA 3GLGA 5AYVA 3SM3A 1I7MB 4KE6A 3KQWA 4UU0A 4DC9A 4M54A 1KZYC 1L5FA 1LV7A 1PK8A 1Z0IA 3JZIA 1M2GA 3PE3A 1E6LA 2E87A 4JSRA 1E1CB 2RHRA 3RQSA 3K1ZA 1QFYA 4YT5A 2QVCA 4Q1CA 1K6IA 1DKNA 1FC0A 2OHJA 2XGOA 5DLQC 1R0BA 3STTA 5A0TA 2R96A 3TLBA 3UATA 4XB2A 2BFDB 3WL3A 4PYOA 1HDRA 2BEUA 4DG9A 2DAPA 1IMJA 2O8DB 1RP1A 2GN4A 2RIPA 4J16C 4G36A 2ASEA 2HF9A 4QT0A 4H18A 1UKVY 4B73A 2ATXA 1TU3A 2G4CA 3HKCA 4E7PA 3S81A 1PN3A 4YP9A 4BNMA 4QWWA 1E2BA 2CYBA 3DMGA 3LIPA 3KFLA 2ALJA 3IMGA 4DSNA 1MO5A 4LFAB 1YUBA 1YKSA 3IEKA 2GK3A 4RK6A 4CM8A 4Q7KA 5BQ3A 4BP3A 4BRWA 1CUXA 2GD0A 1AOXA 5C5CA 3IAS1 3M6FA 1AHNA 5B55A 3INGA 2GLXA 1FNCA 4QPNA 4QYTA 4RZQA 4DLPA 5I4CA 1TF5A 3N53A 1I94B 1Y3HA 3EIHA 1ABFA 4J0KA 1DDOA 1VL8A 4NXNB 3ABSB 4XIYA 4MULA 4DILA 3R3SA 4E12A 4ENTA 3PYXA 4QXMA 3FVRA 1EE2A 1XZNA 4RD3A 2AWNA 4OVKA 5ANRB 1RHRA 1A96A 1ZW6A 3BIWA 4KH0A 3H2IA 4D41A 1UDXA 2BEWA 3HJFA 2VUUA 4NJOA 3V6LA 1QGDA 2GJ9A 3GFTA 4HP8A 1JQKA 2BMAA 2BP7A 4LHXA 3EVAA 5G0UA 1H4VB 2OA0A 3WGMA 4NNPA 2TYSB 4FOTA 3WOHA 3N2EA 4EB0A 4Z4EA 1PK7A 1SURA 1WHSA 2G0AA 1P2GA 4HFRA 4QSMA 4ZQFA 5FBWB 5AXDA 5IJAA 2MSEB 3RASA 1PRYA 2QMOA 3M83A 5CVVA 3TE6A 3WYAA 4MW5A 2BHRA 1YRQA 3U3MA 5KOHA 1O6GA 4Z49A 3CKMA 2I62A 2JASA 4LUCA 5BRNA 3C16C 2LTAA 3WRXC 3BEOA 1JKJB 5LQNA 5KYUB 1P4GA 4PINA 2GK6A 1YCGA 3OLWA 1YDMA 3B7PA 4RF2A 5FUWA 2IYAA 1CRPA 1QC5B 1ORWA 2HUNA 3DEKA 1P61B 3H0KA 2P2YA 2WJAA 4I8XA 5HQJA 3WL5A 4EY4A 1E61A 5TQ0B 4B6QA 4JFAA 4LMBA 3WBFA 2QPOA 4IKEA 1SQGA 5IXJA 4C2TA 2J5QA 4P34A 4JCOA 2ZE6A 5FPTA 3PQ2A 2J0UB 4BLPA 2C98A 5HKOA 5HVNA 3QEBZ 5A4IS 1A8HA 3AJ8A 3C4JA 1GP2A 3AESB 2IRWA 4ZV7A 4MP6A 2GPWA 2FWPA 1J21A 3H18A 3NYRA 4UTOA 4OLFA 2OHGA 2QGNA 1F2DA 1J2UA 1EAYA 1RPJA 3G9QA 3JWGA 4QHYA 4O4LF 3C5HA 5DTRA 1E2PA 4P86A 1XKXA 4QNRA 4KGVA 3L8EA 4HNTA 4L4UA 3E61A 3EZ7A 1E9CA 4F56A 1CY7A 4DDUA 1KI4A 2JB9A 1KKLA 2C1EA 1MH1A 2V6BA 3JPYA 4ACBA 5JFOA 3HYSA 1G6HA 3DC2A 4MA5A 3R7NA 2CXQA 2GR9A 3FM9A 1YVUA 4IHJA 4HUQB 2RGCA 4AYTA 1Z2OX 1VHDA 2HMVA 1M6EX 1DNPA 2IPLA 1IVYA 3B60A 1DBSA 3ECSA 7GPBA 1GPNA 5IASA 2CT8A 2ZT5A 1E2HA 4EYKA 3NNSA 2XQJA 1SG9A 1RU3A 3IKVA 1KI8A 4PNZA 4UNPA 4RTQA 1ZOOA 1LVGA 3HU2A 4RIFA 2OZPA 3LHSA 1MO2A 2WG0A 1CEEA 2ZAGA 3G7NA 5LJLA 2CVZA 1WHTA 4JDPA 1JB9A 3KVNA 1RBYA 1L7EA 1NF2A 5DYIA 4G9GA 3CUWA 1ACMA 1T9AA 4YCBA 3OT4A 5A7GA 2JLUA 1AD2A 3TRKA 4WQMA 1DIOB 2QG6A 3PHCA 2HPZA 1XMQB 1RLOA 3FPBA 5H82A 4BUZA 1BHQ1 3SQDA 1X8XA 3TQRA 1C8BA 2JEZA 2JKZA 4II2A 3NJ8A 1G8HA 1BVHA 1XT6A 1QYIA 1GCOA 2GESA 4F9GA 2J7KA 3GUHA 2FK8A 3PUZA 4X24A 4G5YA 4IF4A 2OGTA 1NPDA 2WV7A 4IWNA 3EPRA 5COAA 3DVAA 1OI2A 2GCGA 2ISCA 3CLSD 2V6IA 3C7TA 1L6IA 3CG4A 4G8CA 4IHAA 4IINA 4UDYX 2IDMA 1MIHA 3PXDA 1P1FA 3WK7A 2WFAA 1X87A 2D1SA 1BKYA 2I80A 2GBGA 4M0UA 2RH9B 4P08A 5BSGA 1QB7A 4B4KA 1L5WA 1Q95A 1KU6A 2HK7A 1TVKB 3TOSA 4YXFA 4F93B 5D00A 1HC7A 3O0TA 3RARA 1HK7A 4GX0A 4RK7A 4DUGD 5JS8A 4OFBA 1T0PA 3AU8A 4D9HA 1U5BB 2ZSUA 3N9IA 5F51A 4LJLA 3QUTA 1R88A 2R1ZA 2FV8A 4H2DA 2CVFA 2X19A 3COPA 3DM9B 3OVMA 3EXG2 1PZEA 1O6ZA 1VKOA 1YC2A 2V9ZA 2J0VA 2X0RA 3EEYA 3IOCA 3O2SB 4ZKDA 1W0JA 2FUNB 5EXSA 4RD0A 1FDRA 1ZD5A 3G8YA 4YO7A 3UMBA 4CQMD 5F76A 3PQ8A 2A88A 3R0IA 3E1GA 4UHCA 5FOXA 1BXRA 1U8XX 1X3LA 2IX9A 3FNGA 4R9UC 4TMZA 1D6JA 2BMDA 4NARA 1XTQA 5EQJB 1NOJA 3LE8A 4L50A 3I2GA 4IG9A 2QY9A 3CR3C 5TR9A 3PFFA 2G1AA 3KD2A 5E8JA 3N8IA 2O7VA 4W6QA 4RA9A 2ZUBA 3B6ZA 2VTEA 3L6RA 4MGEA 4JA2A 1Z0DA 3A7DA 4LYJA 5C7OO 4J76A 3EHEA 4MQ6A 1YFKA 2VNJA 3RV4A 2QTAA 3UWDA 2ZDHA 1CDZA 2K7ZA 5LCXA 5TGTA 2ZJ8A 3L0YA 4BZQA 1KIFA 1CQPA 3WLHA 1NBMA 3R24A 1Q0HA 2YHBA 4EHLA 3TX2A 4N3BA 3N28A 1E2QA 3OU2A 1EAMA 4UE2A 2VTBB 5L6LB 1DE0A 3ANXA 1JDSA 1P1CA 4I66A 2ST1A 3DOHA 2OWDA 2P65A 3OTWA 5FUMA 1ONSA 1WWKA 4MQBA 2ZJ0A 3LW7A 4HRAA 4ZQGA 1K5GA 2R25B 4BX9A 1FS5A 2XJ4A 2OORA 1QAQA 3GVIA 2A33A 1UBFA 3D3WA 5DU2A 4KE9A 5J3JA 4BAZA 1NR7A 3CCFA 3FJOA 4BEVA 3WGLA 4HGZA 1NBOA 1HE8B 2BR5A 3H5OA 2HMUA 4NAVA 3HUDA 1SCKA 3IP8A 4MUAA 4E2FA 3PR3A 4IDCA 3URMA 1I6LA 2RJOA 3U7GA 4MW0A 3RC2A 1EK0A 3ISJA 3E84A 4GOLD 1FX0B 1QH1A 1K7SN 2DRIA 3CH6A 3FIJA 3GFRA 4RJ2A 1GNRA 3F71A 3WWEA 5JRDS 4N76A 4K3UA 1V3VA 3VX3A 2A3RA 2JAQA 5H80A 4NCHA 5GJVC 1VC2A 3CEAA 3ONDA 1NVTA 3V34A 4ENVA 1F4VA 2J6CA 1E6KA 5ER9A 4ZGGA 2Q41A 2Y1WA 4GKJB 1Q3KA 3HA7A 2CUNA 2G63A 3EPBB 3UG6A 1AZSC 4DBLC 1GPJA 4AS2A 1NAHA 3HCCA 1S8NA 4MW4A 1W0KA 4ZAZA 1CLUA 1JH9A 2NZ2A 3Q9NA 3BZUA 3RVKA 2PZKA 2V1XA 4M22A 5ECWA 2PMEA 2SKDA 3H42B 3I9FA 1WSWA 3LBYA 1DJPA 3IAUA 4IOLA 2D13A 4UPDA 1Q0LA 3QBJA 5LP6F 3G1WA 2W6CX 2VZEA 4QARA 5D3QA 2VHXA 2UZ0A 4BVKA 1TD1A 3DGFC 4FINA 5TVKA 1R6TA 1SXJA 1QS0B 5I8ZA 5IWAB 2HMYB 3BKXA 4UAJA 1E66A 3L4SO 1R27A 3D6JA 2HBZA 1W2GA 1UAYA 2R1VB 2XUPA 2YWDA 4FP9A 1UWVA 1FBNA 4HR7A 5A0FA 4WY8A 5KDOA 3MMZA 1Z6PA 4LHWA 1L4EA 1A04A 1M83A 2PLWA 4H4EA 3SNKA 3W90A 3ZWMA 4B43A 4ZZIA 1ECBA 3JZMA 4P3NA 4WUTA 5FQNA 1BEZA 2H2FA 4TV9F 3O8BA 2A94A 5HUQA 4JLWA 3VI3B 2W6ID 1HR0B 1VRCA 4QUJA 1YZTA 4URZR 1U0SY 8ABPA 3U49A 4INPA 4ERXA 5EMHA 1HBJA 1RWQA 2VF2A 2A57A 4J1SA 1ZITA 2ZJFA 4QPDA 3WQBA 4EHNA 3OM9A 1W8IA 1CJMA 4IV8A 1JUDA 4N0QA 4PGFA 5DHQA 5FWYA 4PZ9A 2PQ0A 5GONF 1TC2A 3C87A 3D1LA 4TYNA 3IIMA 2WG1A 2FEPA 2GXSA 2X8AA 4HATA 1HQKA 1RQ7A 5FT9A 5KOJB 1IBKB 1PZXA 5AW1A 1E7WA 3WO0A 1UWLA 1DARA 1UDRA 1I9CA 2JFHA 3O73A 1BGXT 5AQEA 4AX8A 1MN6A 1UMCA 1E4EA 3S44A 4FM9A 1KA9H 1T15A 2OM2A 2XXBA 3LLVA 5KKCA 4UBJA 4GLOA 5BW8A 1ZO8A 3V4FA 3ELUA 3QVLA 3SQWA 5LLTA 1THMA 2ZSDA 3M49A 3ZHVA 3L01A 5FL3A 4M3NA 1WSDA 1QP7A 2CB0A 3A1TA 4JGIA 2NO4A 3D0KA 1JDTA 1G3RA 4IUCS 4MVXA 2I67A 2BFNA 4MUBA 4PZLA 3T12A 2WHEA 5IVDA 5ICMA 1CQIB 1RJFA 4BYGA 2RC6A 4G26A 1RXSA 4BMNA 2XEXA 3RS9A 4KR7A 4R8KA 1ORIA 1LK7A 1R6AA 1PR6A 2OORC 3D7LA 4JNKA 4LYAA 4O33A 2KB0A 2EBWA 1QFMA 3X43A 1ISMA 221PA 4XD2A 3UAVA 3G8CA 3VTAA 3BDAA 1P0MA 3AUTA 4JJFA 3GEHA 1WUTA 2O19A 3AM1A 5HFNA 4E5NA 4NCJA 4V0OA 5JMTA 1NFFA 3FSJX 5I6DA 3QXCA 3MVEA 2PJDA 2LWIA 3MTGA 4HZIA 4BBJA 2VK2A 3N2NA 4M0DA 3LP8A 3GFQA 4LFBB 1QQ6A 3ZDCA 2A9FA 4CQJA 2EGGA 3L41A 3GGSA 1LPAB 1QORA 4QPJC 4RGBA 4AO6A 3GARA 3A6ZA 5C8YB 3HSYA 1FFBA 2DOKA 4Z7JA 1FJXA 3H11A 3QMVA 3KQPA 1IHYA 2OWEA 2P91A 4O4HF 3V8VA 2P7IA 3VAYA 4C6HA 2W48A 4E88A 3RTEA 1ZN8A 1NJ8A 4RSGA 3MS7A 1DAOA 3QYFA 3RSOA 3VNUA 1ZK1A 2A14A 3HCRA 1SN7A 2O3UA 5FPPA 1TVCA 4GVPA 1SCNE 1UIMA 4LVOA 2QLBA 1E4VA 1SXPA 3OUUA 2P2CA 4CKXA 3TD9A 1Y33E 3TV1A 1HFKA 2GSDA 2POCA 2WI8A 3BMNB 4WK2B 4YONB 3VSDA 3FHCB 4IIYA 4AZWA 1L7RA 3E7FA 1SCBA 1OIWA 5C46F 5DTQA 3E1SA 3GJ7A 2A0KA 2PKEA 4X90A 5AP9A 1FTGA 1Y3CE 3IHLA 5TC4A 2J87A 5LNK1 4ERNA 1GTMA 3MT8A 5D51S 3RYHB 1FVXA 1P18A 7REQB 3V4VB 4D8TA 7ABPA 4RTPA 2QN6A 1VE5A 1SKQA 3NM6B 4LGYA 1DG3A 3IBTA 4WN9A 1G20B 1HLGA 2ZWPA 3JYOA 1KY4A 3G0IA 4I4TB 2EG9A 4IZOA 4TMKA 3RREA 5JJCA 3REFA 1NG1A 2Q46A 3FUCA 5EWLA 2FLKA 1U7HA 4QDJA 5E1BA 5E1MA 3OPVA 2XSZD 2CVOA 1QAOA 4D0GA 1TTPB 1HXHA 3PX2A 5IKXA 3FPCA 3PFGA 4AJIA 4C3UA 3RLFA 4DLZA 3I2JA 4DIFA 5BNIA 3ZYCA 4IIJF 4RZUA 2Z2XA 4RTJA 3I0ZA 5JPIA 1Y3BE 4GP7A 4RY8A 4UUPA 1U1IA 2EKBA 2PV7A 1THTA 1LPPA 3JQRA 4L5CA 3U4HA 1VZ3A 3M2TA 4DMLA 4M9UA 3KPJA 2DERA 1QYCA 2QRNA 1TIBA 3B53X 1J24A 1LY1A 5HF9A 3Q8WA 5F3DA 2R86A 2DB3A 3LUJA 1QGZA 4EDFA 1BCRB 3OOYA 1O1YA 1VI6A 1RMYA 2WZDA 1IUPA 1SCAA 1GSAA 1HT0A 2YW2A 3D81A 4Y6OA 5CDSA 1XLVA 3OAAD 1HMPA 5LUBA 1T5TA 3B9QA 3PJDA 4PAWA 3TJRA 4ZJZA 1JHAA 5BV0A 1DOHA 2HK6A 3FDIA 3CSDA 5FP0A 3ULKA 1R74A 1KGSA 1Z5UA 3CU5A 4PZDA 3H6KA 3QKRB 4CLRB 3SVLA 4QASA 2V6JA 4DR3B 4BNLA 2J33A 3C8DA 3MGAA 4QRIA 2C31A 1ACLA 3O90A 3TI7A 3WLJA 3K35A 5I01A 1N3IA 3OD1A 4NBSA 1Z68A 3GT0A 4ZAXA 2JGAA 1S3GA 4PSVA 4YHBA 1BU5A 4FFDA 5GONA 3LS2A 3MWDB 1R8JA 2O7SA 3M9WA 3Q7RA 3DE4X 4NPAA 4LRSB 4IUBS 5ERXA 5T4HA 3ADPA 3OEED 2D0PB 4OJKA 3ROMA 3OT1B 1EK2A 3AKYA 4A0GA 1FP4A 1RWBA 4QU9A 3FFAA 3MINA 1LDEA 4IV0A 4BV9A 2F3UA 2XRYA 3ZZNA 3Q10A 1TOAA 3Q87B 2NVOA 3V7FA 4Q7MB 4XM0A 3Q40A 5JASA 3AP1A 2IGBA 2O2GA 3KVOA 3Q6IA 5TS3A 4C4AA 5CA0F 1JRLA 4W7IA 3UHJA 1KDPA 5FR2A 4BFTA 3USCS 1HRDA 4EGAA 2NSJA 5L3SA 1M2EA 4WDRA 5AVKA 5EIEA 1I4TD 1NVVR 1C14A 1T25A 3A9CA 4FNGA 2ID9A 5D6NA 1Y9ZA 5CPBA 2Z2ZA 1NDQA 2IOQA 2YMLA 3SG0A 1XTSA 4TTQA 2HW8A 3ZHOA 2HLNA 3TKLA 4E03A 4ZQEA 1C1DB 1X1TA 3RUFA 3FLEA 3SMVA 4CIVA 2OMKA 5F23A 3G2OA 5AJYA 3UK7A 4CM8B 1JHYA 1SPBS 2QW8A 2QUBA 2YYSA 3KVYA 1IN5A 3NHSA 4IGKA 4Y1EA 3RSQA 3ZD8A 1CU1A 3HCOA 3PCRB 1RT9A 4I1YA 2P3LA 4D4IA 5A5VA 2IQ5A 5FTKA 5IJ9A 3ZW7A 1E77A 1AS2A 1TL7C 2CHUA 1TUBB 3FH0A 1BXGA 4L9RA 4MPRA 1DRJA 2CB9A 3WBKA 4GE3A 1ZXXA 4NBTA 3NMUF 3U44A 4Q15A 2D0IA 3GLTA 4G1VA 5BWBA 1X7XB 2C2YA 1WXXA 1YZVA 3DHNA 2WT8A 4BO1A 3E9QA 1NFQA 3KAKA 3FB4A 2Z6AA 3EXEA 1SNYA 3GJTA 4I4IA 1S01A 4V0QA 5JAPA 1SXQA 4HY3A 2PH5A 1N2CB 1Q84A 3GRRA 1IEVA 3V4OA 4RGVA 2IU4A 2H48A 5I9LA 2PPLA 1HYHA 2VN8A 4O4HA 1QSGA 2XWJI 5GQSA 2DHCA 4MWCA 3T3PB 1Y7HA 1UQUA 3D8UA 2X3FA 3VZPA 4N5NA 1PHPA 5KAMA 3IURA 4RK0A 5FUYA 4YP6A 3INTA 1FRNA 1EWVA 3PWTA 1YQQA 4V0ME 1UZLA 2ZRIA 1NVXQ 4MUJA 4IDNA 4ZJYA 3K9BA 4AKTA 2FEWB 3PQDA 3G59A 1KFKB 1RQRA 2XODA 2DR3A 4DFDA 5TVGA 3I4LA 3LU1A 3I37X 1L7DA 2PLAA 1PNQA 1L5MA 2FW7A 5H3HA 2Q3MA 3BXPA 4RZSA 4A0SA 4UW9A 4JQOA 1V39A 4HAOA 4JLJA 4YBZA 1CB0A 5DHRA 1E0AA 4BO6A 1L7NA 5MN5A 5HP4A 1U1EA 1O6FA 1VL2A 2F4NA 1XDUA 4F45A 4RQAA 4DS3A 2PD4A 4D3DA 4A0HA 1YHNA 4F4DA 2C2KA 3QU9A 2PUHA 7ADHA 4QATA 1A97A 4B46A 6ADHA 5DX1A 3KNZA 1NZDA 2G76A 3COYA 5IXYA 3OWXA 4AF8A 3BFPA 3DVLA 5C9ZA 4M89A 1KZ6A 4U2DA 5CGZA 1PCXA 2WB4A 2HTFA 4LPKA 2IJGX 1ESDA 1ZOLA 4EJMA 2ZJYA 3W05A 1BOOA 4EJ2A 1KJQA 2XNKA 4NI5A 4GP9A 2X4LA 4RPLA 4YA6A 4CR8A 5LZ8A 3C8HA 1RFLA 3PNOA 4JLMA 4ZREA 2YY7A 5KJEA 5C81A 4EO4A 3BH7A 3D5EA 3DMNA 2X86A 1S3FA 4G0XA 5TGDA 2O07A 2Q5FA 4LDPA 4MLDA 3FYUA 4FVTA 3EGCA 2X7XA 4O1HA 2D0OB 1UCFA 1QRAA 1UPCA 3EZNA 1NT4A 2ZUUA 2XNSA 3OIVA 4A5OA 3GQVA 4XZ3A 3GLFA 2DETA 3CVYA 1KFCB 4UARA 4CDGA 1W30A 2C92A 3F7NA 1A88A 1KJNA 3TLEA 4LZNA 4K6OA 4PTLA 5F9FA 3UJ3X 4RM3A 1M54A 1UMDB 3JQ7A 1T43A 3F96A 4HZUB 4Q3OA 2I3AA 1U2ZA 4ETNA 4EVSA 1RYNA 3INRA 3CMCO 1DZIA 4GAEA 5EEGA 1O8CA 2A0WA 1ZD2P 4Z86A 1XZLA 3JCZA 5I4KA 3H1AA 4PLYA 3G5MA 1LLDA 1VRVA 1PG2A 2Y1OA 1Y8RB 3KLOA 5JXJA 2PKQP 4R1LA 3AEKA 5D5QA 3E6AA 4QYMA 3NHLA 1FMTA 3RRFA 4I5DA 5B12A 4GR5A 1A9SA 4J2OA 2HEIA 1H1LA 1Q2XA 5AXCA 3U5TA 4L4YA 3UB2A 2D00A 2P2NA 2Y68A 3VVMA 5CDFE 5TMEA 1KOGA 3BGDA 2G77B 1ZZEA 2QENA 1MP0A 1QGED 2KE5A 2QS9A 2WA1A 3DEYX 3OE7A 4WK6A 1DBRA 2FSHA 1Z5WA 2BFFB 2BFMA 3ZW9A 5CA0A 5BQ5A 2CLOB 3I9V1 4H1VA 1TMYA 4U7FA 4ZYTA 4O89A 1VPWA 2O06A 3BDIA 4DLUA 3RKUA 2WF6A 4Q6BA 1ZGJA 4Z53A 3R9XB 4WT7A 4C6SA 3HK2A 1Q3HA 3DLTA 5JHGB 1J5EB 2BONA 2RBGA 4AS1A 3E3LA 3KPWA 4DCSA 1A5SB 1T3GA 1TZ2A 2OZEA 1G3MA 1JTVA 1U8FO 5E6RB 4MJLA 1Z5GA 1KY5A 3HYCA 4E22A 3BF8A 3Q9LA 4RPCA 5JQGA 4JI5B 1HYQA 3CW2A 3I04A 3RPEA 2ZCJA 2PBFA 3LVQE 4U2FA 4EYGA 4ZOLF 1FYXA 1P9WA 1KSGA 3I2KA 4RHEA 1PZFA 4U7DA 3BYZA 3PFHA 1I3KA 1I6KA 1T5SA 3A58B 3QF4B 4PCLA 5ELXA 4P4TA 3QY0A 3VU3A 3IYLW 2CE7A 1EWKA 2YXNA 4RCYA 1UT8A 2BKXA 4ZDIA 1RYDA 1W2WB 3QE0A 2IOHA 4K8OA 2OV4A 3AFOA 4L02A 5KYTA 4UHHA 3I4FA 3A4YA 2WB2A 3HMKA 1EP9A 1G2PA 1KI6A 2I66A 5JRZA 3M5WA 1YIOA 5D7NA 2GZHA 1NXPA 2QN7A 3BF7A 1GRQA 2NPIA 3HN6A 1FNMA 3LUKA 2ZW9A 4DTCA 5CIYA 4B6RA 5FFMA 1WM1A 3QZUA 2FP3A 4DLAA 2REQB 2Z6QA 1NP6A 4BV2A 4EUKA 3VJLA 2HIGA 4TXLA 4DV1B 1WEHA 1KO5A 4ARUA 1TTTA 1SQ6A 3I01A 1ENYA 3UXYA 4Z1OA 4B3SB 4LBWA 3BTOA 3KOWA 5FAKA 1HZJA 2C5GA 3T54A 1R4AA 3MW8A 3R7LA 3DHWC 1U63A 2UVDA 4KPUB 4U2GA 3FYUC 2JFVA 3KQVA 4C7JA 2Z1MA 1HMYA 2FSIA 1DRKA 1SBYA 1U6KA 3R8FA 2X5KO 2Y1CA 2LVBA 2QDXA 1GU0A 3I42A 3GIWA 3T3DA 4AZ0A 5IVPA 1DXQA 3KDAA 4HDRA 1USIA 4L3WA 4QEZA 5E95A 2MCFA 5HBRA 2PZBA 2QZSA 4NHOA 4X6YA 4HQ6A 4R31A 4CW7A 1LDMA 4OXIA 3G1UA 1A50B 2CFRA 4B3IA 3ZY5A 2PYDA 4PIVA 1YRBA 4H59A 1ZH0A 2FPNA 5LWQA 1IWBB 2A9KA 4UZFA 4YJGB 1NQAO 4DLSA 2R4QA 2QG4A 4EI2A 3OMLA 1FLDA 1ULTA 1EIWA 4BC0A 2JGJA 4QXOA 3JQGA 1ESCA 3OETA 1ETUA 2Q0XA 4ZV9A 2O8VA 4GBMA 5BORA 4B0OA 3ZE0B 5ADWA 3W8RA 4PLTA 1E9SA 3E8SA 3VU9B 1EM8A 2R44A 1Y1PA 2NWQA 4JR1A 1ODKA 3LYUA 1UR5A 3N58A 5CPFA 1D0IA 1QQ5A 5F64A 4D1YA 1FQJA 1W19A 3W06A 1QF6A 2A1UA 1I5OA 2FGKA 2AZTA 4FOPA 3F73A 2R5FA 3NTRA 4RZXA 2GEDA 1NOKA 1RM3A 5GZ3A 4FOSA 4RVFA 2AE2A 4TTSA 3U39A 2PKQO 2C3PA 3K5WA 1L8QA 2GRUA 3COSA 4MGIR 3FOZA 5F35A 1RC0A 2AOTA 5I7VA 4YUAA 1LPOA 2VH2A 1O5IA 2PL1A 4IQ8A 2I65A 4HH0A 1B8OA 3OJEA 4DDVA 4MHSA 4AMBA 3ZU2A 1DKOA 1KGDA 2HD4A 2QTBA 2AVNA 4F0JA 5LZ4A 4CEHA 1J0DA 1G5IA 2C9YA 1E3DA 5KWIA 3OY2A 1GVNB 1V4NA 1KJYA 1RAIA 3TKYA 4CEIA 2QRVB 4JVOA 1DPFA 1YRHA 4W7SA 1QYWA 5JTUA 2BH2A 3LHIA 2VBCA 3L1JA 2R9VA 1J23A 5CLLA 4MRPA 1OHHA 3I8OA 3KLPX 4TM7A 4QX6A 1TD9A 1O87A 5EP4A 2HMTA 1AKMA 1OTHA 4BWFB 4EMBA 1E4EB 3KBOA 1WOYA 2P78A 3AI1A 4I3GA 1KEEB 3CPHA 3GP8A 4MW1A 3KCNA 2O2IA 3HDVA 1QK3A 3R4VA 1Z13A 3E18A 1M0EA 5DK4A 2SKCA 1WKCA 5LOVB 3Q2IA 3JWPA 3K1AB 4EATA 5J4YA 1JLKA 4Z0HO 3ZTWA 4JY7A 1YHZA 4QVKA 5CNKA 1H94A 2GJSA 4D4LA 4RDHA 3ROTA 2MINA 4BB9A 1Z6GA 2Q9AA 1Y8QA 2V98A 3QFRA 3W5SA 3L0CA 1V16A 3INYA 5DP2A 1EE1A 2WA2A 2ZRPA 5K5EA 4R40A 3HEMA 3N2ZB 2JGRA 3U7EB 3IMEA 3Q8MA 1G38A 1F1BA 5KQLA 1EP3B 4C06A 1YA4A 2BMFA 3ZGXA 3K5IA 3DBOB 2C9CA 5EGNA 4C4XA 3H8VA 5C2JB 3RWMB 5INTA 3G0CA 4N5HX 3ZWKA 1DX6A 5FBRB 4CKEB 1KQFA 1J0XO 1KMHB 3NS7A 1NRIA 5HJEA 4DC0A 1VHLA 1Q7BA 3B5JA 4ZOLA 4LY6A 1ML4A 1Q44A 4N12A 3W9UA 1ZD1A 1A2KC 3PDWA 2ICAA 1C1HA