1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords dihydrodipicolinate reductase
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
4F6CA 2C07A 2B83A 5I9MA 4AJOA 4HWKA 3ZNQA 2DC1A 1G0OA 1NVGA 1L7EA 1T2EA 1R4NA 1Z45A 3FNFA 2E48A 1DC3A 1N9GA 3MEQA 4Q3DA 1GEGA 3LT2A 4J1SA 4E13A 1KS9A 4K1LA 4J2HA 1BMDA 2Y93A 4KUHA 4NBTA 3WXBA 4BNHA 1T26A 4DLBA 1GQ2A 1GCOA 2GNAA 1OC4A 3HDJA 3UOGA 4WASA 5JDIA 3EC7A 2CDAA 2O3SA 1B2LA 3VOSA 5G0WA 1LU9A 4OSPA 4PZEA 1E0DA 3DAFA 5CP8A 5DP2A 3AJRA 4OSOA 5A02A 1J5PA 1XELA 4CR8A 4UEJA 5BNIA 4CMEA 4YT4A 1TI7A 3VTZA 3FI9A 4NH4A 1H9AA 1ZXLA 4HBGA 1ADFA 5J23A 4QX6A 3GAZA 4NNJA 2UYYA 3JYOA 4LRTB 1DLIA 1XYGA 3ZCXA 1HE5A 3ITKA 4MP3A 3VPGA 3PRJA 4WLEA 1EBFA 4BOYA 4E32A 2B5VA 5IXYA 3DZJA 2A35A 1NQ5A 1GU7A 2NLOA 1M2WA 1PR3A 4NK4A 3EW7A 4ZJUA 4WKGA 3LYLA 1BSVA 1U5CA 3RUCA 2FOIA 4XYEA 2CMDA 1PJ3A 3JQAD 4GX5A 4NPCA 5CDTA 2A94A 4LISA 5IDYA 4CR7A 1ISIA 1O0SA 5IXSA 1DO8A 4MP8A 4RVDA 3C8MA 1EFLA 2HMWA 4PG6A 2Q46A 3KTDA 1K6XA 3WJ7A 4Z9XA 1WP4A 3K31A 4E31A 4XYBA 4KUEA 3RAJA 4BO4A 1JKIA 4II2A 5I7EA 3VPHA 3FPLA 3WIDA 3V8BA 1K2WA 4WLVA 4ZU3A 3CIFA 5DZSA 5IZ4A 3DO5A 1O89A 3D5QA 5L40A 3VDQA 3GG9A 3QWAA 3GG2A 4GSKA 1XU9A 3S2EA 3R3JA 3EYWA 5BSGA 4Q3AA 1T2DA 1PGOA 3GUYA 4RL6A 3O8QA 3NT4A 4R5HA 1DHRA 2VHYA 4HXYA 3DTYA 2BFAA 4MINA 3U0BA 1GDHA 3JQCA 4D42A 3K92A 3L6OO 4NI5A 3W4JA 3RC1A 1V3VA 2YW9A 3RUEA 5A4DA 4C7KA 1A7KA 1AHHA 1EMDA 1XDWA 5G4KB 5JMWA 2EV9A 3QW2A 1BTOA 1M76A 1UXGA 3ENKA 5TJHA 4YAKA 1E92A 4JP3A 4A26A 3AOEA 3PYLA 4KZPA 1EE2A 5BSFA 4AVYA 1GL3A 1AXGA 3ETDA 3RU7A 4ZD6A 3MTJA 3GN2A 4BNKA 3M2TA 3UF0A 1ML3A 4ZHSA 1PZGA 5HRUA 4QTZA 4IDFA 3LSYA 1VJ0A 2PR2A 2P5UA 1YOVA 4B4VA 5T6BA 2ZTUA 3Q0EA 2PZKA 4ALIA 1ZK2A 4W7IA 4FPXA 4E0BA 5U4QA 3IJRA 2OZPA 4TKLA 4E2ZA 1XQ6A 1LUAA 3P19A 4WEQA 1DJNA 2ZB8A 1V3UA 4XCVA 1J6UA 5JDCC 1A9ZA 2ZYAA 1JVBA 1GR0A 3E5RA 2BI7A 3ASUA 2VYND 3CXRA 2FWMX 3X2FA 1Y1PA 3W4IA 3BMOB 3LZ6A 4HFMA 5JSFA 3BIOA 3JQFC 5F1OA 1PS0A 2AA3A 5DN9A 1YH3A 4J43A 4B7UA 1ZW1A 2V6FA 3OJLA 5TC4A 3UGKA 4OM8A 4PCVA 4ZQHA 1F17A 4UUNA 4BNGA 1E1LA 1HLPA 1LSJA 5MDHA 4Z0PA 1FDVA 4E5NA 2W4QA 4K26A 4BO2A 3OH8A 3ZHBA 1RWBA 1RYEA 4C7JA 3JYPA 5BSHA 2Q4EA 2VYVD 4BNWA 3FBGA 3P2OA 3Q3CA 5C7OO 3KOUA 5IAAA 5KVQA 4CMGA 1FDUA 1R4MB 5JDIC 4B7XA 4YCAA 4TVOA 3OFSA 2C82A 4OAQA 3EDMA 5ADHA 1WAMA 2O2SA 2A9FA 4RVUA 1ISGA 3ZH2A 2B4RO 1LDNA 1M75A 3A4VA 1E3EA 4WOJA 1ENZA 2X5OA 4QSMA 5JO9A 5HS6A 4FFOA 1NFRA 4DPLA 4DWVA 2WTBA 4CM3A 4LK3A 3DB2A 4W7HA 2DPHA 4FGWA 1EBUA 5B1YA 2PKRA 3M6IA 4JBHA 5AVOA 3AU9A 3G3EA 4DQXA 2ZB7A 3OECA 1IB6A 5G2OA 1E7QA 2O4CA 4PLHA 4BNYA 4TRNA 4R16A 2PLAA 1N1GA 5C3MA 4J91A 1JWAB 3RBXA 4BQPA 1ZFNA 5L51A 3BMQB 2CFCA 4FCCA 5ICMA 1ZCJA 4TMFA 4Z9YA 4ZRMA 3JV7A 2DAPA 3AY3A 1R0LA 1JKJA 2DTEA 4CLOB 3TL3A 2VWQA 4M87A 3GVPA 5I8ZA 1OBFO 4EJMA 1YONA 4KWHA 4K9DA 2VTEA 2YFHA 1WWKA 1G6KA 4S1VA 1C0PA 2OXIA 3HADA 4M1QA 2QRJA 4CMKA 4PVCA 4IPTA 5FYDA 3KYCA 1MFPA 1DB3A 1MV8A 3RVDA 4E5PA 1ZJYA 1DAPA 1I2CA 1NYTA 1MG5A 2D0IA 3QA9A 3FNGA 3W4KA 3D64A 1YDWA 1NQAO 3W8FA 4MIEA 4Q3NA 3ETGA 4BNVA 3C1AA 2FPGA 4I9HA 3WMWA 4GI2A 1B8VA 4AJ4A 2DVMA 4JJGA 1NWCA 4J9VA 1GPJA 2EGGA 2D5AA 1D3AA 4ND3A 1NX6A 4A2CA 3NJ8A 4XIYA 1EQ2A 1DC6A 3D4OA 1UZLA 2HO5A 1LSOA 5A03A 4XQ9A 4DIOA 5JAMA 1CETA 2NQ8A 2AQKA 3DZHA 5H82A 2J6IA 1PJCA 3ROQA 1T1SA 3AFMA 3AOEC 1NASA 4BB5A 3DL2A 3DZKA 4MO2A 2BFMA 2GYYA 1LX6A 1H0KA 1RYDA 1PGJA 5C5IA 1P1JA 4HNGA 2G82A 1Z73A 1X0VA 3ZWBA 3OJFA 4A5OA 4B4OA 4ND4A 3EY4A 1P45A 3CTMA 4IJUA 2P2SA 3ON5A 4G2NA 4FJ2A 4OXKA 4JCOA 1A72A 4Y67A 2EJWA 1FK8A 3OQBA 3GVXA 3UXYA 4CLXA 2V6MA 4RDIA 3JQ7B 1MC4A 2BH9A 2YFQA 4BL5A 2ZJ1A 1WZIA 2G76A 3CE6A 2VCYA 1JAYA 5B12A 4O1MA 1SAYA 3KM0A 1R6DA 2W2KB 3GEGA 4YVFA 5K0ZA 3OQ6A 1V8BA 5EINA 2X7HA 5ICSA 2EP5A 3UVEA 1Q7BA 2XXBA 4J16A 2AEFA 2Y0DA 3IOYA 5FFFA 1IPEA 1GZ6A 3LDHA 1KEPA 4RVGA 5FI3A 4HUJA 3WNVA 1A4UA 5I8WA 1K5HA 2UV8A 4QXMA 2H1SA 1NQTA 1CERA 1VJ1A 4XZ3A 3AM5A 2WE8A 2AHRA 3U62A 5DBGA 1DIAA 2CDBA 3I4FA 4MIOA 5CFZA 3I9OA 5IZCA 1T24A 4L4RA 3GVIA 4YR9A 3KVOA 1IZ9A 1F8FA 3TOZA 2ZYDA 4EJ6A 3ZWAA 1HEUA 4J4BA 4Y6SA 5HWSA 3Q2KA 1JVSA 1DRWA 1U7TA 4Q3BA 1I24A 1WPQA 5KVVA 3G1UA 1YBVA 3P5SA 3WQQA 4CQMB 2H6EA 2O2YA 4BO3A 3Q11A 1QYWA 1ZSYA 4JLWA 3F5SA 3Q9UA 4KWIA 1P74A 5I7SA 2X0RA 2GN9A 4J49A 4CM7A 4FGSA 4J90A 3WQRA 3QIVA 1KEWA 2BLLA 3ZWWA 1EQUA 1XA0A 3CH6A 4JXKA 4IJVA 3FF4A 5DP1A 3SLKA 4E2WA 1VL8A 2ZTMA 3LQFA 4PRLA 4B4WA 4YRAA 2IYOA 1IZ0A 3B6ZA 4G5HA 3QQPA 3TDKA 2WDZA 4B7CA 4Y8VA 3OHSX 5A9SB 3PQEA 4DYVA 4RZIA 1WNTA 2VWHA 3L9WA 3W6UA 3DBLA 4BKOA 3WWYA 2XF8A 3DBVO 5HS4A 1VC2A 3CPSA 1KEUA 3F6YA 5BT9A 1ZKMA 3L77A 1IYZA 1H6CA 2PZMA 1UXJA 2E82A 4CV0A 1TEHA 1DBVO 1KC3A 3PTZA 1DPGA 2IZ1A 1ADBA 1SEPA 1BW9A 3U4HA 1R0SA 4BMNA 5CEJA 3ROKA 3LF2A 4IM7A 4P4LA 3ZU2A 3WOHA 4XYMA 3GQVA 3VZQA 3BZUA 4HADA 3HB5X 1QV6A 3IIEA 4R01A 2Q1SA 3RFVA 1ZH8A 4DLLA 2X5JO 2JAHA 1JA9A 5G4LA 2VRCD 3TNLA 1U2DA 1XHLA 2PFGA 2B69A 1I3LA 3H3JA 1ZK0A 1X7HA 4R3NA 2EF1A 2BMAA 3BHMA 4G81A 4BMVA 4DA9A 4KUGA 4DL9A 3EZLA 4LSWA 4EUFA 2G1UA 2Q2VA 3VH2A 4YJGA 5CEFA 1NPTO 3H9QA 4KOAA 2HCTA 3H65A 3U5TA 1HTBA 3WGTA 1DIBA 1NFQA 2A4KA 4YXFA 4WCFC 3D0OA 5DULA 1YB1A 2VNSA 3ZWOA 4CR6A 1Y5MA 3GPDG 2DBZA 1UDBA 3ABIA 2Y1OA 4CV2A 3QSGA 5KJCA 1MXHA 5G0UA 2O3UA 1WLYA 3D3WB 4BGEA 2HSDA 4R54A 4MOWA 1LDGA 2CZCA 4XD2A 3Q6IA 3DHNA 5CAEA 3GMDA 1HZZA 4BNUA 5HA5A 4BO0A 2EW8A 5ER9A 3V2UA 4D7AA 4BO1A 4GPD1 4TRJA 4JQCA 2BRUA 1ZSVA 2AEMA 4XRRA 3MWEB 1DXYA 4M89A 1E77A 2I9PA 2X5KO 2Q50A 1M6HA 3HFSA 4GX2A 2Y1DA 1PWXA 1ISFA 1NPDA 1P1HA 1GEEA 3NYWA 3RI3A 4AJPA 1ONOA 2DLDA 3GR6A 3CMCO 2DTDA 2WD7B 3PIIA 3PLRA 2JHFA 3GGOA 3AUUA 4XDYA 1Z75A 2DKNA 3G17A 3DBRA 1C0LA 4E33A 3MJEA 1BRMA 1N2SA 4O59O 4A7PA 4Z6KA 2P4QA 5C37A 3QWFA 2JD1A 3H9GA 2BF7A 3NAQA 2C5AA 3TZKA 4LCJA 3JYNA 3IQDB 4DTIA 1OZAA 1UXIA 4CUZA 5IN5A 3RBVA 1DIRA 2IDZA 4TRRA 5COBA 3UCXA 1KC1A 1VSVA 3WSWA 4BKRA 5A3JA 4WNCA 1DFHA 1P44A 1HXHA 2RHCA 1SB8A 3IP1A 3OEWA 4EYEA 3ZWYA 5KJ6A 2O3JA 1FDTA 4JJIA 1HE2A 5C7LO 4ND5A 3DDNA 3TSCA 5GMOA 4P38A 4MVJA 1Q0QA 4ROSA 3I52A 4PVDA 2O50A 5CDUA 5KWEA 1GAEO 3KLMX 4IDAA 3E6AA 4CUKA 3BAZA 4PIVA 3T7CA 1QYDA 1Z74A 1JDJA 2ZB3A 1ZJZA 3C7DB 4E2YA 5T67A 2OGUA 4RVFA 4QECA 2NADA 2P4HX 3OIDA 5ENDA 9LDTA 1B7GO 3DR3A 1Y8QA 2Y68A 3I9JA 4BNZA 5JPIA 3N7UA 3I9MA 4CUJA 3ZZNA 1N1EA 1A5ZA 5J9GA 2PKQP 3GH3A 1VKNA 4E3ZA 1PSDA 3C85A 2PGJA 4JIGA 4RPKA 3JQ9A 1EUCA 4OOFA 4BKPA 1E7SA 3WIEA 3IJPA 3EGOA 1KETA 1YDEA 3TOXA 1HDGO 4IS2A 3DMTA 4B3JA 2OO5A 2AEJA 2NWQA 4BO6A 1MC5A 4QO8A 2F1KA 4U6QA 4ALLA 3QV1A 1PQWA 3U9LA 3GFGA 2NQTA 3ZN2A 4YJFB 3O4RA 3GFBA 4MVJM 1MXFA 3KZVA 2FR8A 2QG4A 3GAFA 4W6ZA 8ADHA 1PL8A 4DLAA 2YV1A 3C24A 4DBZA 4ILKA 4N5NA 3E48A 1JU9A 2W2LA 3W8EA 3I9KA 2NU8A 2GZ2A 1ZXBA 1I32A 1LRJA 2VOJA 4YJHB 6LDHA 3I6QA 3HNPA 2JKVA 3GK3A 4FC7A 1TLTA 3ZV4A 4AJJA 4ZQEA 3U4IA 2DUUA 2YV2A 3AW9A 4IQ0A 1R66A 3DOJA 3Q1LA 4BGIA 5KIAA 3ZWNA 4MVJP 5AXCA 1DEHA 3PYMA 3RQSA 1E6WA 5K9ZA 3BHJA 1P33A 1LDMA 3DBHA 1N7HA 4IDEA 1QV7A 3KBOA 1H5QA 2Z5LA 2FRDA 1E1KA 2E49A 2JHGA 4XQCA 4E2XA 4NJMB 5JC8A 5JO0A 3CMMA 2P5YA 5B4TA 5TT1A 1H6BA 4K6FA 1PGNA 5EPOA 4D43A 1GYPA 1E1NA 3UAGA 5B4UA 1JQBA 4TZKA 4NBRA 4BIIA 1Y81A 3H3FA 4LCEA 3ZW8A 4M86A 4EDFA 4NQZA 3MOGA 2B4TO 3UH1A 1LXCA 3L07A 1BXKA 1YL6A 3VVCA 5G4KA 5T8KA 5JYDA 1I3NA 2Q45A 4LW8A 1X15A 2OUIA 3LC1O 2LDXA 3SJ7A 4D3DA 1I3KA 4ITUA 3UN1A 2XPCA 2NTJA 3RCBA 3AY7A 3KHUA 1ULSA 4TROA 1P0CA 1HE3A 2GN6A 5DBIA 1BGVA 4O5OA 5A9RA 4CLRB 1P1IA 4FJ1A 4GVLA 3HDQA 1N92A 3BMNB 2I99A 5KCZA 2Z1NA 4R1SA 4DMLA 4M55A 4R41A 2CUKA 2DU8A 5DCWA 3S8MA 1W8DA 5F1PA 3G79A 5DNAA 3PPIA 2X0NA 3L6EA 2B5WA 3BXXA 3JQ8B 3LT0A 2YHUA 2JAPA 3WFJA 1SCUA 4CM4B 1YL7A 3JD3A 3I9LA 2BHLA 4WE3A 3VC7A 4OHUA 3AK4A 3MJTA 1A71A 2YHIB 1MFZA 2D4AA 2FR0A 2I3AA 3TF5A 3COSA 1LQTA 1UH5A 4IINA 4GSLA 1UXKA 2GGSA 2XOXA 4W99A 2EJVA 1NFFA 4XEHA 3ZWPA 4DPKA 3NUGA 3NT5A 1CJCA 4HFRA 3ST7A 1Y9EA 1JWBB 4ZVVA 4MVJG 3JQGB 3D7LA 5CDGA 1PR9A 3SVTA 3QY9A 3BHIA 5T73A 3JD0A 2VHXA 3ANLA 1R4NB 5HBRA 1RM0A 1U5AA 3AUSA 3U4DA 5AOVA 3AI2A 4NBVA 4HFJA 3DZIA 1PL6A 4CMCA 3RSHA 2ZTLA 4EEXA 5JYEA 2BFOA 1U8XX 3DC2A 1Y5RA 4D41A 4J7UA 2O3QA 4DYDA 3CEAA 3PP8A 4GGOA 3OBBA 2RBEA 3DEYX 1GCUA 4IZHA 3KLPX 1WZEA 1R4MA 4HNHA 4FQ8A 1NTOA 2CVQA 4CLHA 1B26A 3L4BC 1ISJA 3LVFO 4DUPA 2CY0A 5M6DA 4EUHA 1RM5A 1SC6A 1S6YA 1KY5A 2J3HA 3ZW9A 2OOSA 3JQDA 3WTBA 2CF5A 4QO7A 3FWNA 4L0QA 4L76A 4OGWA 1E5LA 3QWIA 4NFYA 2OMEA 4IJKA 3A28A 3HFGA 2RAFA 4FJ0A 3CKYA 4LMPA 4U5QA 3BTVA 3GEMA 1AN9A 5H81A 4L74A 2O4UX 1PS8A 1W4ZA 2LDBA 3BMQA 3E9QA 1NAHA 3H7AA 3HB4X 4IMRA 3ADPA 4BNJA 4CMJA 3LU1A 1EK6A 4OIMA 2W90A 3IUSA 5CDYA 4FFMA 5B4VA 4BNNA 3PWSA 2E4AA 2AQHA 1D4FA 1HL3A 2X0IA 3F5QA 4UAGA 3W6ZA 2FR1A 4DIBA 3MJ4A 2GO1A 4RPGA 2QYSA 4MKXA 2W8ZA 3KSUA 1Y7TA 1Y9AA 3ROPA 4X54A 4D0RA 3GUCA 1N5DA 1D7OA 1E3JA 3DOCA 3QWHA 4DGSA 1MX3A 4P4GA 4MPDA 1YQGA 3M2PA 3ICPA 2J5RA 1IPFA 3HWRA 1BHSA 3UCEA 1LDYA 4XX0A 3KSZO 1RKXA 4UULA 2ZCVA 2I3GA 2VZ9A 5LCXA 5GY7A 3UFXA 4BS9A 3E9NA 3GZ4A 1M67A 2VUUA 4BO9A 8LDHA 2PH5A 4RVSA 1I5RA 4N5MA 2B35A 3PQFA 4A10A 2J3JA 2O7SA 3FPCA 3NTQA 3PHGA 1YS4A 3GZNA 4LRSB 3H2SA 5A9TA 2VZ8A 5FWNA 3BA1A 1QMGA 4GVXA 4F3YA 3ZI0A 5KJEA 2O48X 1VL0A 3BMCA 1E7WA 2DBVO 2AMFA 2CSUA 4IJWA 4RLSA 4BVAA 3WGIA 3ZU5A 3FSRA 2NVBA 4RDHA 4CMEC 5IN4A 5ILGA 1VI2A 3EK2A 1E3WB 3GMSA 3WMXA 1IULA 1F12A 1IHXA 2ZQZA 2NVUB 2YQ4A 3D1LA 4CV1A 1DSSG 1I36A 1QYXA 2GCGA 5DDIP 2GUGA 4GMGA 3KUXA 1YVEI 3GN1A 4OXYA 3S2GA 4CM9A 4FFLA 5GZ3A 2X8LA 1HE4A 1U2GA 4MVJH 2E37A 2NU7A 4EBFA 2FZEA 1HDZA 1B15A 5DOVA 5TIIA 5BR7A 1TT5B 2B4QA 4E30A 2BFPA 2C5EA 5TSDA 5L4LA 1YOVB 3OSUA 4NBWA 4MVJF 4KMSA 5IFLA 1Z6ZA 4E5KA 2UDPA 3RWBA 5A04A 2BD0A 1HDXA 1GQQA 2JCYA 2VHVA 4R1UA 3K9QO 1LBEA 1WDMA 4GL4A 1SBYA 4IXWA 3GNTA 1U3UA 2I76A 3HDYA 1CDOA 2IEDA 4WGGA 3VKUA 4CM6A 5JY6A 3LF1A 5CPBA 4R5MA 3KEQA 4BGUA 5K6AA 1YBAA 4J0EA 3Q9NA 3OIFA 4J1TA 3NTOA 2C20A 4JBIA 1QLHA 4M8SA 1NR1A 4QFDA 1YJQA 3R0IA 3VPXA 4UVEA 2WE7A 2HRZA 1Q0LA 3DAGA 4FOSA 4DQUA 1LRLA 1PJLA 3S2IA 3ZNPA 4I5FA 4OYRA 2GLXA 2IZ0A 2JFGA 2AQIA 5JMPA 4XQEA 1ARZA 2AXQA 3DAPA 4AJKA 1VJTA 1Y8RB 1O8CA 4RGBA 4ZQGA 4BO8A 1YQXA 2V6BA 3EUWA 3P2YA 4INAA 5C7IO 1ZK3A 4IXTA 1FDSA 2HMUA 1WVGA 2ILTA 4ZQFA 1BVRA 1FXSA 4NR0A 2O3RA 1D1SA 4YRBA 5THKA 3GLQA 3A06A 1Q7CA 1V3TA 3DWFA 2QW8A 4PG4A 1EVZA 3P7MA 1PJTA 3JQAB 4BKQA 3IKTA 1HF3A 3WB9A 1GZ3A 1T1RA 1Q7GA 5L45A 1AXEA 4GLOA 3AUTA 1FMCA 2NUAA 3L0DA 2Q3EA 5H83A 2GRAA 1XGKA 3FTPA 4GWGA 3W8DA 4CQMA 4Q3CA 1EFKA 3AM3A 1UXHA 4W4TA 2WYUA 4DIFA 4NZ9A 2DQ4A 1W0CA 2IEBA 4FFNA 4OJNA 1EK5A 4CL3A 1E7RA 1KVUA 4MDHA 1JAXA 4BV9A 2I6TA 1VM6A 4YRDA 2QZ9A 1FDWA 2NNLD 1I30A 1O9BA 1ZIDA 1EDOA 1PJ4A 4XRGA 3EVTA 2FPIA 1H94A 2PA3A 4YYZA 1H93A 3JQEA 3NEPX 3V1UA 1JW9B 2V65A 3GDGA 2CF6A 3HE3A 4Z3DA 3NTRA 2PWZA 1N8KA 4S3MA 1WDKA 4P4NA 1UP7A 5JLAA 5LDHA 2C7GA 1IL0A 1PS9A 5JNLA 3FRJA 5EQFA 2PK3A 1YO6A 3DQPA 3UUWA 1QYVA 4CM8A 3WQSB 4EGFA 5KVSA 1F8GA 4NU6A 4OQZA 1DOHA 2YZ7A 3GRKA 4NIMA 4YB8A 2HK8A 1LLUA 3FR8A 1OI7A 1KBZA 4JK3A 1KEVA 3HG7A 4FN4A 1I2ZA 4ZA2A 2Q2QA 3ONEA 2EWMA 4FSHA 4WEOA 1WXDA 1Q0HA 3H8VA 3I9NA 3ORFA 2NTNA 4XIJA 1O6ZA 3HZZA 4GQAA 1B3RA 4OOEA 2RIRA 4PLFA 2PD4A 4ZRNA 3AWDA 1ONPA 3KYDA 4XJTA 4YAGA 3K2BA 2ZK7A 1I2BA 1XU7A 2OFPA 4XGKA 2Q49A 2Y99A 4CMIA 3I83A 4ESOA 1ZEMA 5ITVA 5JCJA 1DLJA 1QKIA 2NVWA 2HMSA 4IIVA 4CV3A 3HQ4O 3PZBA 2Y1FA 1D8AA 4AL4A 1G1AA 2FSVA 3KO8A 2ZIZA 4WPGA 1KVRA 1NNUA 2FPPA 4YWJA 3RUFA 3FN4A 2QQ5A 4RQTA 3WS7A 1HDRA 1I8TA 1PX0A 4KTVE 4WCFB 1VKOA 4BNTA 4IS3A 5A06A 1LDBA 1PJSA 7MDHA 4MKRA 1C1DB 3C7AA 4LN1A 3OA2A 2ZYGA 4RPLA 3GEDA 3D3WA 3E82A 3NGXA 5FI5A 4XB1A 4GGPA 3RASA 4MVJD 4IUYA 2QZZA 2PZJA 2X22A 4II3A 2YY7A 4MP6A 4D79A 1GZ4A 1GV1A 3L6DA 2D1YA 1HT0A 4MIYA 1PU2A 2O7QA 4U7WA 3IUPA 3LLSA 2HK9A 1T4DA 5U1PA 3RJ5A 4Z0TA 3RC9A 3PJGA 1ISMA 4J3FA 4XQGA 4BQRA 3JQBA 4NU5A 4EUEA 2BGKA 2GN8A 3GNQA 4TWRA 4UVIA 4BNLA 2WD7A 2JFFA 1R37A 4AJ2A 2HU2A 1M66A 1V9LA 2QIOA 3TZCA 1G0NA 3C3XA 3PHJA 3UICA 1DHTA 2YDYA 3OJ0A 4AJ1A 1A7AA 1ENYA 1ID1A 1BXGB 1PZHA 3PWZA 1ONNA 1HSZA 1TXGA 4FC6A 2C2XA 3A1NA 4YPOA 3UW3A 4RF4A 1LA2A 2Q99A 4FIZA 3FWZA 4IQGA 4E4YA 4GAEA 1ISHA 5TJ9A 3RC7A 4D0SA 3FNEA 5ER6A 3INRA 5JS6A 5THQA 2W2LD 4RF5A 3INGA 2WM3A 3IS3A 3B1FA 1GY8A 1YWGO 4FFPA 3QVOA 2VZ0A 1H6DA 1U3WA 2ZTVA 3PDUA 2VWGA 1EUZA 1R12A 3FNHA 4Y6PA 3A9WA 3A14A 2C2YA 1NPYA 2DFDA 3PWKA 1TT7A 3VHRA 4PLZA 4JBGA 3KEOA 2TMDA 4IDGA 4ZICA 2QRKA 3PGXA 4ZGWA 4UVHA 5MGBA 1OAAA 2IRWA 2GSDA 3BTSA 1QR6A 3ZV5A 4DPMA 3WICA 4TRMA 4Y9DA 1E3LA 2Q1UA 1PJBA 4GLLA 4RF3A 1GQYA 3OICA 5CHEA 3VDRA 3FBTA 1O95A 2UAGA 1ZZEA 1C14A 1LSSA 2VUTA 1E3IA 4FFRA 3S2FA 1SZJG 2X9VA 4J2OA 3V1YA 4KQWA 1YB4A 3RBZA 3AUAA 1DIGA 1KIFA 1UZNA 1HYHA 2HKIA 1F14A 3F4LA 1PZFA 2Z1MA 2WEKA 3QVSA 2JD0A 3GGPA 3H6KA 4GWKA 4YJFA 5EQDA 2X9GA 3TPCA 1GUZA 3GDOA 1V6AA 1WMBA 3QVXA 2EKQA 4YJDA 5T64A 2XXJA 4L4XA 2P91A 4XDZA 4HV4A 1CWUA 4YJHA 3MZ0A 3WJAA 2IE0A 1JTVA 3RIHA 3F9IA 4FBGA 1NM5A 5TLSA 3TJRA 2Y0CA 4XR4A 2Q22A 3E1KA 4URFA 2HJSA 2X6TA 2DPGA 1J0XO 2D3TA 1VRWA 2FZWA 5IZCC 4RORA 4AICA 4CLEA 1C1XB 1A9YA 5JAIA 4RQUA 4NJMA 3SX2A 5KOIA 2PZLA 2OP1A 4B8ZA 1LLQA 3QVWA 3INTA 4XYLA 1SO8A 4AJIA 3H2ZA 3NX4A 4IZIA 4Q9NA 3TZQA 3SBOA 1LNQA 2RHRA 4CM1A 2YV3A 3EHEA 3PEFA 4KQXA 1OOEA 3GVCA 3H9JA 1E1MA 3MWDB 1QXSA 1SMKA 1UP6A 2D8AA 3RC2A 4L9RA 5JW6A 3ZNNA 3DXFA 5TT0A 5T57A 3WGZA 4KDFA 5F5NA 4UEKA 1TVEA 3WFIA 4L8VA 4RO0A 3TZ6A 4XWYA 4R4JA 3WYCA 1LI4A 5EERA 4ID9A 3GGGA 3K30A 4IDCA 3ZV3A 1DDOA 4J7XA 1FJHA 5TQVA 4BUCA 4R3WA 4W9NA 2FSSA 3JYQA 4I5GA 1W73A 4J4TA 2VT2A 1XQ1A 2HAEA 2QRLA 4U0JA 3RJ9A 3OETA 1O5IA 3PHLA 4OL9A 4OQYA 3BMNA 5EMHA 1IUKA 1JKFA 3ONFA 3EZYA 5G0SA 3NJ4A 5JAQA 2FHSA 4NBUA 5KVCA 3WLFA 5KTKA 1J4AA 1R16A 3PJEA 4CQLB 1LC0A 5FEUA 2DTXA 1MLDA 2J3IA 4GH5A 4CL8A 3UHAA 2NU9A 4CM4A 4G65A 1F06A 2GZ3A 4Z9FA 2ET6A 3RD5A 4E6PA 2VOEA 1A4IA 4PLTA 2X0JA 5CDSA 1H6AA 5COQA 1X1TA 3GDFA 5JDCA 5B37A 1C0IA 3SJUA 3EAGA 2YHIA 2O3TA 5EIOA 1HWYA 4Q3EA 4U0KA 3KYBA 5GZ1A 4NJOA 3OQ1A 2DM6A 3TFOA 1X7GA 2Y1CA 2Y0EA 1U3VA 2HRBA 5T5QA 1KVQA 4CJXA 5A05A 3RKUA 4F45A 5L4SA 3JQGA 4ALJA 1XCBA 5L53A 1PGPA 1T4BA 3PFWO 1LQUA 2E6UX 2J8ZA 1LTHR 4ALMA 4AJEA 2YDXA 5BNFA 4A27A 4GKBA 2AE1A 4M49A 3B70A 3VAZA 1F0YA 4WLFA 4HKTA 1R15A 1UUFA 5CG2A 3DTTA 3KB6A 2AQ8A 4J0FA 1HDCA 3PYXA 3LLVA 3ZU3A 3NT2A 5JXWA 1LLCA 2FY8A 5A5FA 2NV6A 3WNQA 4DXHA 2JD2A 4EW6A 1U1IA 4K28A 3JSAA 1N7GA 3U09A 1Y8QB 3T4EA 2JL1A 1Y6JA 2IYPA 3M1AA 4JJFA 3PXXA 1GUFA 1BG6A 2C59A 2Q2WA 4XA8A 1HSOA 3UCFA 3PJDA 3WYBA 4BHTA 4U8GA 3NRCA 1PQUA 4I9NA 4JN6B 4UEOA 1AUPA 3G49A 2VRBA 1SOWA 4N5LA 3GC6A 3ZWVA 1YXMA 4DMMA 1WW8A 3GRPA 1X14A 3STHA 1MG0A 5F3RA 3KRTA 2P9EA 4YDRA 2X58A 1HYGA 4M54A 3I1JA 4WLOA 3DFUA 4C4OA 1Q1NA 1SNYA 5AQ1A 1X7DA 5DT9A 1LSUA 5L3ZA 4RCVA 1Q2XA 1ZK1A 3S1LA 5A5EA 2H5LA 3NGLA 5JYFA 4NHEA 2HUNA 1MP0A 4AJLA 4CM9D 3TN7A 4CPDA 3BMOA 1U28A 2ZATA 1I0ZA 3C7CB 3QJ5A 4PFJA 1UP4A 4CMBA 5I9NA 4CLDA 3K96A 4UVDA 3GOHA 4IGFA 4MVJI 3TQHA 5CPFA 3D3EA 4IDDA 1BDBA 1UDAA 4OO3A 4PLWA 1B8PA 4L73A 4YTEA 3DBHB 4FR5A 2EEZA 1N9GB 3KV3O 3DMYA 5EL0A 4NFSA 5EN4A 4BNFA 5JBIA 3WGGA 2WJPA 4UUMA 4BB6A 4EZBA 4YACA 1OMOA 5IF3A 3IL2A 2GD1O 3TL2A 5JC1A 2OL4A 3V5NA 1E6EA 3AY6A 1X0XA 1YRLA 5L4NA 4IY1A 3WBBA 3PJFA 1VSUA 1BXZA 1UAGA 2SCUA 4GX0A 2WD8A 4NG5A 2C29D 4KTTE 5IDXA 5L9AA 1DC5A 1TA4A 4ZN6A 3NKLA 1AHIA 3JQ9C 1P1FA 3NDJA 2C7VA 5AXAA 2G5CA 3WTCA 1E3WA 4YA6A 2TMGA 2BELA 3DMTC 2NVUA 1NAIA 3ZU4A 3DOOA 1QORA 3FD8A 1BVUA 5TX7A 4OKIA 4B79A 3PQDA 3R3SA 4PZDA 4W9NC 3K5PA 3SXPA 4YAJA 1YGYA 4LSMA 5DCYA 1L1FA 1CYDA 3RFXA 1LC3A 3B20A 1TT5A 3HSKA 4CLOA 1CQJA 1EVIA 2Z95A 2JCVA 3PGJA 3E8XA 2AG5A 4PLGA 1P31A 3DZFA 1J49A 3OIGA 3HN2A 2OP0A 5ILOA 4B3IA 4CQMD 2OBNA 3F46A 3B1KA 3W1VA 5I7VA 1UDCA 2JJYA 4N7RA 2ZB4A 4YAIA 4ND1A 2B36A 4TSKA 4L75A 1CRWG 2HMVA 4RPHA 4I1IA 4YQYA 3X2EA 4TQGA 3KSDO 3F1KA 3QLJA 3K8ZA 1ZEJA 4GBJA 3IP3A 3O26A 3SC4A 1GPDG 3JD1A 3C1OA 4PG5A 1LRKA 2XAAA 2GPTA 3HHPA 2J5KA 4I5EA 3MJCA 4D44A 3O8QB 1U3TA 4H7PA 5AYVA 1Y8RA 3PIDA 2AE2A 2F00A 2W98A 3N74A 1U4SA 3JTMA 2PD3A 4R68A 1PL7A 3PVZA 1P9LA 3PI7A 4DRYA 3L4SO 2DUWA 2PH3A 1U8FO 2PV7A 1C3VA 4EEZA 2EW2A 1QRRA 5T8KC 1GTMA 3ROMA 4EI2A 1ULUA 5DOZA 3WR5A 4AJNA 4XJSA 4RPJA 2YQ5A 1DAOA 4OMUA 3VVBA 4DC0A 3GT0A 3PFFA 3WGOA 1YBMA 2I65A 2RH8A 1PEDA 1T25A 2OBYA 2X23A 1NVTA 3JQAA 4HP8A 4A73A 4AJHA 3RKRA 2WWRA 3S55A 3HUDA 4WLUA 2EGHA 1XKQA 3AM4A 1UZMA 4RF2A 3AU8A 1HYEA 4P22A 4ND2A 1BWSA 4XGNA 3I6IA 3ZHXA 3PLNA 1YL5A 2WSBA 5GZ6A 4PLPA 4D45A 4FDAA 4EJ0A 3OJOA 3U49A 4CMAA 1MUUA 1ZNQO 3CINA 1KERA 5JCJD 2X4GA 2VNAA 1AGNA 2RH4A 2YUTA 4R9RA 2Q1WA 4UUOA 3QVTA 4LMRA 3I23A 3GF4A 5KJ1A 3JQ7A 4J7CA 2VUSA 4E5MA 4JX8A 5TGDA 3T4XA 2HJRA 3Q2IA 1XR3A 3TZHA 1BDMA 3MJSA 1P3DA 1GYRA 4OKNA 2R00A 1B3BA 4B4UA 2CDCA 5EJ2A 4BNMA 2D59A 1SEVA 2ZCUA 3D5TA 2W2KA 4ZQBA 2DT5A 3LT4A 3WGYA 2C54A 5F5LA 4IBOA 4YT2A 3QP9A 3DHEA 3EVNA 2DBQA 1PZEA 1NWHA 1EVJA 1I01A 3OP4A 3KXDA 3ANNA 2VTDA 5ENVA 5EESA 2NM0A 3HN7A 3E9MA 5IJZA 1ZK4A 2H63A 2POQX 4O63O 3HDHA 1QYCA 2HK7A 2VHWA 1ENOA 1PJQA 5IDWA 4QT0A 3IDSA 4N54A 2HDHA 4H3VA 2CVOA 1HETA 1Z7EA 3VH3A 1E3SA 1NHGA 4I08A 4RLHA 1XG5A 1GFSA 2PGLA 1PQPA 3F4BA 5JY1A 3E18A 3I4CA 3DHYA 4U6SA 1YJ8A 5ITWA 2ZJ0A 4QUKA 3R1IA 5L95A 3IMFA 1I33A 3SC6A 1HLDA 3GZNB 1B14A 3CSDA 3IAHA 1ZSNA 4E12A 4UREA 1XWFA 4YBZA 3WWZA 4K6CA 4WLNA 1C0KA 1ZMOA 5A3VA 4Y6RA 2Y66A 3BMCB 1EUDA 4WOKA 4Z0HO 3WX0A 4XB2A 3ADOA 2OHXA 2HLPA 4J1NA 1QSGA 4A0SA 2BGLA 1YKFA 4D3FA 3ZHYA 2B37A 2CD9A 2DFVA 6ADHA 4I5DA 3ANMA 5DF1A 4WCFA 1UJMA 4BMSA 2VYNA 3OMLA 4J6FA 5IDQA 4NMHA 1C1DA 2FN7A 3QE3A 4L4SA 1V0JA 4PG7A 1VPDA 4YT8A 1GD1O 3JD4A 4IGEA 3TRIA 4UUPA 4CODB 2GF2A 3D4NA 5A9SA 1DFGA 2PKQO 4R9SA 4Y98A 2FP4A 4E5YA 1GV0A 3CZRA 4XR9A 5KKAA 1H2HA 1HKUA 5TRTA 1HDOA 3ZV6A 1NHWA 4DVJA 4J9UE 1T2FA 4QQRA 1DFIA 1DIHA 4CMHA 1EVYA 4TZTA 2VYVA 1P0FA 4IIUA 1P77A 3BTOA 3KYCB 3V2HA 4GMFA 2B0JA 2VN8A 3KETA 1T2AA 1AE1A 3VH1A 1MA0A 5F1KA 2GN4A 3GHHA 1K89A 3ULKA 3PK0A 3WSVA 3G1TA 2PGDA 3FTNA 4KDEA 4BV8A 1BXGA 4GKVA 2UUOA 4WECA 1GYQA 1CF2O 1HDYA 4UVGA 2G17A 4HFNA 1GADO 3OEYA 3F3SA 2NU6A 3D4PA 3QWBA 4HX5A 4DBVO 2GASA 4YT5A 3WBFA 2PTGA 3WYEA 4WCDA 1ENPA 3LK7A 4D3SA 3ICCA 2P68A 4W82A 2PD6A 3ITDA 2ZKLA 3QHAA 3ZHZA 4FS3A 4HY3A 4RJTA 4PN3A 3DONA 5ES3A 2Y67A 1EZ4A 3RUHA 1B16A 4RV9A 4A03A 1QP8A 3ZNOA 4AG3A 1KVSA 2EHDA 4R51A 1K6IA 3I3OA 3R6DA 4PLVA 5FF9A 3UKOA 2BI8A 2BKAA 1KVTA 3H5NA 2AW5A 1ADCA 1OFGA 1P1RA 1VL6A 4JP2A 3ASVA 1NQOA 1KYQA 1ZBQA 2UUPA 3ZGYA 2CVZA 4BKUA 4B3HA 2Q1TA 4PG8A 2BGMA 4BNXA 5LC1A 3CZMA 4PLYA 5TS3A 1RM4A 1EDZA 3WGQA 3NDIA 3O38A 5CEEA 3MJVA 2VT3A 4H16A 4QFCA 1E7MA 1PJ2A 2PY6A 5JYAA 1VLLA 5TF4A 1CQIA 1Z7BA 1KY4A 3NV9A 2QX7A 2Y05A 3ONDA 3OJEA 2IXAA 1CEQA 2R00C 1DRUA 5TNXA 3O9ZA 5I7FA 3B1JA 3AOGA 1QLJA 5K6AC 1NXQA 3VPFA 4PLCA 3ZWCA 4PGFA 5L7TA 4NDNE 3CUKA 2EP7A 1X13A 4J4HA 3DZGA 4FB5A 3QRWA 5L7YA 2WYWA 1JN0A 4CM8B 3JD2A 3GVHA 2GERA 3VKVA 2NTVA 5JAZA 1MB4A 3VPSA 1I3MA 3PZRA 3AFNA 1SB9A 4I8XA 4YEDA 2X1HA 1M6WA 1KOLA 4FD3A 3MOIA 2H9IA 2GDZA 1D1TA 3E5MA 3F1LA 3LT1A 4BGVA 4YAEA 3KYDB 5COAA 3SEFA 1K0UA 5BQFA 1NP3A 3WLEA 3BTUA 5HM8A 4RVHA 1A27A 1C1XA 3VZPA 4CMIB 2EG9A 4IDBA 3ENNA 2A92A 2QHXA 4LGVA 4BO5A 3WG9A 3C1TA 1YB5A 3H9UA 3OF2A 3WGHA 4NK5A 1O94A 5AXBA 1EE9A 1OC2A 4PZCA 2FMUA 1SPXA 3BYZA 3MCVA 1UR5A 2J3KA 1YQDA 4Z3KA 1E5QA 2Y1EA 1I10A 4Q39A 3K6JA 3K73O 5AXDA 1K6JA 3JCZA 5LDGA 5JE8A 4JNKA 1T2CA 1X1EA 1V35A 1ORRA 2HQ1A 4QEDA 3FCOA 1LEHA 3GHYA 3JYLA 5JFOA 4BNIA 2D5CA 3VZSA 2P9GA 4WUVA 2IZZA 3RU9A 3K2EA 2VWPA 3PHHA 2V6GA 3LC7O 1K3TA 3FHLA 1XIVA 4N18A 1RJWA 1XLTA 1Z82A 3AI1A 2D2IA 1H2BA 3PDJA 3ZWMA 3DBLB 1PGQA 1QG6A 5DBFA 5A1TA 4O6VA 1NR7A 4D46A 4ALKA 2O23A 4XKJA 3RUAA 4FOOA 1IE3A 2ZQYA 2VHZA 2GR9A 2EIHA 1U7HA 3H4VA 4CQLA 4IQ8A 5KKCA 3LC2O 1VE9A 2WMDA 1R0KA 5G0TA 1EEHA 2AG8A 1BW9B 2C0CA 3TFQA 4DC1A 3N58A 3I5MA 4O0LA 1ADGA 3H5AA 1ZVMA 4DREA 4YQZA 4B8WA 1LLDA 2GZ1A 3WDSA 2RCYA 3O03A 3FR7A 4OXNA 1LJ8A 3L9XA 1E6UA 4MJLA 5L7WA 4LVCA 1WDLA 2Q4BA 4I9UA 5DCUA 3ZWXA 2IODA 5HTOA 4NFHA 1CIVA 3IC5A 4ALNA 3DFZA 3RROA 2EXXA 4TKMA 4XGIA 2I66A 3PHIA 3ETEA 1P1KA 4MKZA 4ONEA 5BSEA 2YJZA 1U9JA 4WJZA 9LDBA 4BO7A 5U9CA 1PIWA 3VTFA 2R6JA 4PRKA 1DC4A 4YJGB 2QYTA 2DBRA 3H9EO 4DQVA 1FF9A 1SOVA 2CNBA 5KNLA 4MVJE 3VZRA 1ZUD1 7ADHA 1WMAA 2EKLA 2WYVA 1RPNA 3V2GA 2EKPA 2JCXA 4RZHA 3NDRA 1PTJA 3IKVA 5CG1A 1XSEA 1RM3A 3AI3A 3EMKA 3RUDA 3M1LA 4XYGA 3TWOA 2P9CA 4WK6A 3V1TC 2X9NA 4H15A 3U3XA 1IY8A 5KJFA 1ZMTA 4F6LA 1H9BA 5IG2A 3DZBA 1ZO8A 2V7PA 2YYYA 3OM9A 4IMPA 3OA0A 2JFHA 1L7DA 3L4BA 3T7EA 4KP7A 2EERA 2G0TA 2Y1GA 1U4OA 1MGOA 4CLRA 1HZJA 1UAYA 4OH1A 3MTGA 5G0VA 5BNTA 1HRDA 2HMTA 2I67A 4JROA 5JCXA 2J5QA 1W6UA 1PWZA 2UVDA 2OORA 3F47A 3HJAA 3JQ6A 1DRVA 4R69A 3GY0A 1B8UA 3JQ8A 4R1NA 1IOLA 1JLLA 3JQBC 1B0AA 1DJQA 1NVMB 3SLGA 4AFNA 1NBOA 4GX1A 3GA0A 2VQ3A 2VRCA 3DBRB 3U4CA 4FW8A 2I5PO 4F46A 3GNSA 3H5RA 2X86A 4J1QA 4EITA 1IHYA 2NACA 3VH4A 4P8RA 4E21A 1LDEA 3GPIA 4R1TA 5F21A 5I9LA 4TVBA 1S7CA 2IXBA 2PNFA 2NSDA 4JGBA 4LVUA 2R2GA 3G0OA 3ZDFA 1XEAA 1YE3A 3JQFA 3RFTA 3RUIA 4CM5A 3E03A 1GUYA 1TB4A 1E7YA 4WNIA
chains in the Genus database with same CATH superfamily
1Z6TA 1QP0A 5H80A 1L4EA 4JLOA 3KCQA 4F6CA 3Q7RA 3Q7QA 3N70A 3W2HA 1MAWA 3ROZA 2IBSA 1H9CA 3ZNQA 3QEBZ 2P5TB 3QYAA 3WAGA 2DC1A 3GUZA 4LBVA 1NVGA 4G07A 4GXTA 1L4NA 1Z45A 2A1UB 2CNLA 4Q3DA 1DC3A 4MS4A 2AR7A 4ZALA 5FUVA 4KBGA 1U7PA 4H6PA 4J1SA 5IJ0B 1MO2A 1P5FA 3VHXB 4PM4A 2WVGA 2I6GA 2ZFUA 3UKJA 1ZI8A 3P2IA 3TXXA 3U3MA 3UMFA 3C4VA 2PVCA 1GCOA 2GNAA 1OC4A 2HTEA 3HDJA 1WXXA 1ONSA 3UOGA 1FFEA 2K6GA 2FB9A 1P2GA 1BVHA 4K6MA 1V1RA 4QOGA 3ZQ4A 1B2LA 1T9DA 3VOSA 3NWBA 4KFTA 4OSPA 4WNAA 2N75A 4PZEA 4RZUA 4RVNA 3KQQA 2Q9BA 2VH5R 5CP8A 5DP2A 2AOTB 3UAYA 3N6VA 1M1NB 1I1QB 3SF8B 5KNDH 1PUJA 4CNQA 3RVMA 1JJBA 1F5SA 3LMKA 4HDOB 4HGZA 4UEJA 4CR8A 4NE9A 3PXDA 4MUAA 5AVSA 4F1KA 3FI9A 4P92A 4OUDA 5CT9A 5ITZA 1IJKA 2DULA 4IILA 3GAZA 2UYYA 1Z25A 4TYMA 3S1AB 5B64A 1LKZA 4UMEA 4EKNB 5AO9A 1UOPA 4WESA 2ILVA 3Q7PA 3ZCXA 2WIGA 5CITA 1DTSA 2W0MA 3DM5A 5IJ9B 2FJUA 5BVGB 4C2BA 5KPJA 3PNOA 2B5VA 3B2EA 2H1LA 4QDTA 4YI3A 4HGPA 4UCWA 3SY8A 1H69A 4OGKA 5GAJA 1GU7A 3F3KA 5JJLA 2A9JA 3LG2A 5HF9A 4BBAA 4G6ZA 2MDTA 5D3ZA 3R7NA 1Q7TA 1C8VB 2FOIA 5EYPA 4XYEA 4FHZA 3Q6MA 4MJ3A 4RC9A 3SE7A 3U5ZB 4F3TA 3AY0A 2A94A 1G2OA 4LISA 2E4ZA 4ZDWA 3WKAA 4P32A 1ISIA 1UDXA 4QM6A 4GRAA 5E3JA 4BLRA 4RD4A 5CD1A 3HV2A 3ZVLA 1N5OX 3KTDA 1K6XA 1DS6A 4DS3A 3U31A 3WJ7A 1IN7A 5LZ2A 1NYRA 5BUSA 4OHKA 1MABA 3QOFA 2AZMA 1JH8A 5GJVC 5LB2A 3RAJA 1I6LA 4II2A 1WCV1 1ZCBA 2YUIA 3IERA 4ZVSA 4F96A 3FPLA 4I8IA 1QAQA 4WLVA 4TYQA 4PYLA 2HHJA 5AW9A 3UNXA 1UFVA 4TOIA 4G5QA 5DZSA 1ZC3A 1Y6RA 1ZINA 5E95A 2HBYA 4LXUA 2G1AA 4PYNA 5AJYA 1KAGA 3EPAB 1PYGA 2NUBA 2VC2B 4O8ZA 2Y1LA 4Z49A 1S3SA 2YW2A 4C0JA 4B9AA 3CRVA 3EYWA 4Q3AA 1T2DA 4NHOA 1RS0A 4WFJA 3NT4A 3EJWA 2VTVA 2WKWA 4R1QA 3SXJA 3RPEA 1Z2NX 4HXYA 3T9DA 4LTMA 5GVSA 3JVIA 3CURA 5DO9A 2BFAA 1W9MA 4R40A 1GTL1 4DJ5X 3DXZA 4MPPA 1GT6A 3H5WA 4NL4H 2WYIA 1GILA 4NI5A 5F7JA 1I4TD 2P0AA 1RABA 3R3HA 4S24A 4G4SP 2E5FA 3TEMA 1AHHA 2JGLA 4H6XA 5D87A 5KYYB 2X19A 1L5WA 3MM4A 4A0QA 5JMWA 1RT9A 3P9XA 1IN6A 4RFSB 3CH5A 4RXMA 1M76A 2EHJA 4NKRA 5IH7A 5IBCA 3OWOA 2XYVA 1SXQA 3RDPA 3PYLA 4KZPA 2NZWA 3K09C 1ZIXA 3IALA 2DUJA 4ZT4A 5LQAA 2JA2A 2VJOA 3ETDA 4ZD6A 3GN2A 4WKNA 5H3CA 1ACMA 2PLNA 4ENVA 2CXHA 3CF2A 4JJ8A 5AK3A 3DCYA 1TYEB 3VV2A 4G5OA 2R79A 3P0FA 3AINA 1PK9A 1ML3A 4ZHSA 1PZGA 1QE0A 1BX0A 2A9KA 4KC0A 3LX8A 1H8ED 3V4ZA 1AO0A 3GLVA 1VJ0A 3AGPA 1FQKA 3GNLA 4S1WA 3N2IA 2H08A 4BMPB 2RHWA 1QFJA 4B4VA 4MV0A 4OK5A 2ZCJA 2OZEA 3K8YA 5T6BA 2ZTUA 3Q0EA 3OLZA 4H4CA 3ZIAA 1Z8FA 1ZK2A 3HJNA 4C89A 3PR3A 4FNOA 4G36A 2ZSDA 2QTRA 3PX2A 3SNHA 1WZ2A 3NHRA 5C80A 3E8MA 1KL7A 3P9KA 1K06A 3A1FA 5M2QA 1DINA 3EY9A 3HRHA 4YECA 5DHAA 5F9FA 3FZNA 2AWOA 3QLVA 3WLJA 1DEXA 1M34B 5DM60 3VPCA 2R97A 1GR0A 4QDOA 1U80A 4BN0A 2QW1A 4OLFA 3CXRA 2FWMX 4CV1A 3WXMA 3K15A 1KHHA 3VU3A 1GRCA 2EF0A 3W4IA 2SKEA 3BMOB 1PQ4A 5JSFA 4OXRA 3JQFC 4L08A 5F1OA 2BUAA 2AA3A 4M9ZA 5DN9A 1RLOA 2G71A 1R6VA 1ZW1A 1P81A 2HHCA 2Z57A 3LJKA 3QBDA 1E9SA 3OZVA 3H97A 1YA4A 1JFLA 4OM8A 3TNDA 2QP4A 2KLBA 5JJ5A 1LSJA 5MDHA 4Z0PA 1FDVA 1YS2X 2A7XA 3LYUA 4J0GA 4QOIA 3T61A 4BO2A 1L6RA 3ABOB 2YZNA 1FLAA 2ZITA 4IDNA 4ZCLA 1M6EX 2C00A 2ETVA 3JYPA 3ZHBA 2R6CA 1Q1QA 1K5DA 2I6UA 1WSBA 2Q4EA 2VYVD 2WFLB 3FBGA 4LPSA 8ATCA 3N6XA 4MRPA 2O2IA 1X7WA 3VR3A 2A78A 3M3HA 3P9PA 2XDAA 1GPAA 4TT8A 3KKPA 2PKWA 3R24A 5D00A 4CMGA 1Z07A 4YCAA 2V7XA 4MHOA 4XUGB 5FOXA 3EP7B 4CIAA 1NMSA 1UC8A 2X6RA 3OX2A 1ISGA 3ZH2A 3L5OA 4L9AA 3VKGA 1LVUA 1E3EA 4WOJA 1ENZA 4NEQA 5CBKA 1DX9A 4IRXA 1JHRA 5HS6A 4NAHA 5JO9A 1MC8A 5TB5A 3ES9A 1D9XA 4P4SA 1YS7A 1NOIA 2EDAA 2WTBA 3PUWA 3DB2A 2JBHA 1PT6A 3A10A 3FCXA 4W7HA 4BAUA 1EBUA 2Y4NA 3G3EA 4FM9A 5C1OA 4OQLA 2HDWA 1E7QA 2O4CA 4YH1A 2WU4A 3HHEA 1U2EA 4MR9B 2O5CA 4OQXA 2PJDA 2PLAA 1U9YA 5MN4A 4GMHA 5KEIA 3HRIA 3C8HA 5C3MA 4J91A 1JWAB 2B2CA 1U3CA 3LX4A 1L9KA 1WF3A 3OTGA 1A50B 4QD3A 1FTWA 4A91A 2F1JA 3MUEA 4C6SA 2OGSA 2CFCA 3E7XA 2ZI6A 3Q9SA 5ICMA 4X6YA 3RAEC 2GFQA 4TMFA 4Y2TA 5TGTA 1S3IA 1YDGA 3CQ9A 3L46A 5ALZA 2DTEA 2IEGA 3KYJB 3ZE2B 3DYBA 3LI2A 3IQXA 2RC5A 1ESDA 4QHTA 1OBFO 1VHTA 2J45A 2E6KA 1YONA 4EJMA 3CZPA 3SVLA 3UB2A 5D6OA 1CE8A 3OQIB 4ID3A 4MLDA 3OE7A 2OXIA 3A6ZA 1D6SA 3CW2A 1IEQA 2QRJA 3V3TA 3LVRE 4D2IA 1HURA 1U3FA 4PVCA 5FYDA 1AK9A 1MFPA 1DB3A 4AECA 1MV8A 4E5PA 5KYKA 1NV9A 3G8BA 3QA9A 3W4KA 3D64A 1YDWA 1ORDA 1J21A 3W8FA 2GJAA 3SQMA 4NYMQ 4MIEA 3FA2A 3A6EA 2YINC 4OHZA 1ZGBA 3FVVA 2ZR7A 3LQRA 1FZTA 1P7VA 1A5TA 3WMWA 4QBGB 2EKZA 4KPGA 1G66A 1ML4A 4AJ4A 2J5BA 1T9HA 2E21A 1NWCA 2IHKA 4ZEOA 5BY2A 1TO2E 2EGGA 4B0PA 2Z2YA 5IF9A 1NX6A 4LOJA 2HL6A 3JAWB 3WL4A 4GE0A 3I2IA 3NJ8A 5A7FA 3R8FA 4RD6A 3D4OA 3RAPR 4DBLE 1UZLA 1LSOA 1YFZA 3EASA 5A03A 2F90A 4YWHA 2GF9A 4DIOA 3PRKE 4FZ5A 4DNQA 2AQKA 3IIIA 4EA7A 3RRXA 1NGSA 5HJ5A 3QFFA 1T9BA 3E2MA 4DJEC 4R2JA 2HWWA 3ROQA 5EZ6B 4HC4A 5IPFA 4N76A 1T1IA 1XWIA 2MR5A 2ZS8A 1W5EA 2ANBA 1DWQA 1UBOS 3T5GA 4C6HA 2GYYA 1KSGA 3TLCA 4UM9B 3QF4B 1LX6A 3RSOA 4BWYA 2WU1A 1H0KA 1ORHA 3FYSA 3K0CA 2XKAA 4LZLA 3UJCA 4ES6A 5JI2E 3O2SB 2HRCA 1GLVA 1EYZA 1JQJC 3GCDA 1Z73A 1DG9A 3ZWBA 4A5OA 4H7KA 1WM1A 5K2MA 4EMBA 2JFXA 3GJ0A 2A14A 1AG9A 4FJ2A 5EZQA 3NTXA 3TOCA 5JNUA 5K2OA 3G7UA 2HXYA 1T8RA 1WUHS 4Y67A 5CYGA 1FFWA 1WMEA 5HJEA 3GVXA 4KDRA 5DLPA 4CLXA 2OFFA 2QD2A 3GLFE 2BH9A 1YIDA 4BL5A 1IVYA 5HZKA 1W36B 1TAGA 1I4LD 2ASVA 2HRRA 1QS0B 3UYKA 5IEBA 1SD5A 1OXVA 4JSRA 2QLFA 1N34B 2JFPA 2QL6A 1B6SA 7GPBA 1USKA 3OPMA 5BN4B 3SQOA 1JAYA 1U8TA 1I6MA 4O1MA 3SFZA 1R6DA 3OWXA 4BJ1A 5GQSA 1H2ZA 1H0SA 3NDPA 5JS2A 2HC9A 2X7HA 3ZGXA 1LV8A 2PPVA 1V5IA 5KI6A 3ZTYA 2FUCA 5I51A 1PO7A 4JOBA 3SBEA 4AWBA 1EFCA 3IUBA 4QEZA 1CJBA 5IMSA 1PFYA 3AEQA 3EFOA 2DH6A 1PT7A 3W79A 3DTVA 2GCEA 4HUQA 4IXDA 3H86A 1OSNA 2X3FA 2IPOA 5AICA 3TCKA 3WNVA 3FUTA 4P35A 3LBFA 4QXMA 1QE5A 3IVRA 1LW7A 1VJ1A 1Z4JA 2DX7A 3IULA 4GKAA 1X1QA 3KEMA 5DNYB 2CDBA 2N9UA 1TA0A 1QPBA 2F43B 3TS1A 3VDXA 2XZLA 3D6FA 2JEYA 1T24A 1P7WA 4L4RA 1Q77A 2X1VA 4PXSA 4YMTA 2KM1A 3KVOA 3KNZA 1F8FA 4BPRA 2ZYDA 3MQ4A 4RK4A 4EJ6A 3ZWAA 3N75A 3JQRA 1KPGA 3KJXA 5HWSA 2XE4A 1US8B 4YIKA 3V32A 1DRWA 3A70A 4YHBA 4ZEMA 2DQKA 5ELXA 3QU9A 3JYHA 3R0XA 4HGYA 4EZIA 1ZAYA 2JANA 4HNQA 4JLPA 3WQQA 2O2YA 4BO3A 3D2BA 1CY4A 2OCAA 4FXOA 2QX6A 3W5VA 4EB3A 2OPBA 4QSHA 1ZSYA 3Q9UA 4D5EA 1Q2UA 2YY5A 1SVMA 4MYRA 4KWIA 4CGYA 2X0RA 4BZXA 3GD7A 5JAHA 4W5RA 1XVLA 1DV2A 4FGSA 2IQIA 3FGZA 3TTTA 1IOZA 1E8DA 1U5BB 3R3UA 4MDYA 3WQRA 4D0LB 4EY5A 4V0NA 1F4PA 4L7VA 1EZ1A 2EBFX 4YCCA 2C7PA 5K0BA 2VSFA 4JXKA 3RAFC 3AR7A 2F3UA 2ZS9A 5FXMA 2Q0SA 1JFFB 2FPIB 1WU7A 2IYOA 1IZ0A 1FUUA 3B6ZA 2B7CA 3V42A 5HUQA 5A6SB 1NURA 4P86A 1FTYA 1X80B 2V98A 5IVKA 2PWPA 3NHMA 1QH9A 3NHAA 1IJFA 5IAOA 4CYMA 1X1CA 2F3QA 3HR8A 4B7CA 4DLRA 1SQ0A 3CJRA 4LRQA 4NCHA 4ARAA 4CU5A 2Z6AA 4OFWA 4P3KA 3W6UA 1Q5PA 1RLIA 2RBKA 3HEAA 3AR4A 3CPSA 4KAJA 2BT4A 3HJFA 1ZKMA 2J1LA 1XVVA 1CULC 3Q7TA 4W9RA 1MAUA 4FYXA 2E82A 1JEQA 3E70C 5EJ7A 1KC3A 3MJRA 1DPGA 3MGBA 5KDLA 2DBYA 1BW9A 1VGRA 4YBRA 5TEVA 4LHXA 2NQ2C 1UDWA 1RHJA 3V8RA 4W5TA 3VX3A 2ES4A 4HGRA 2KPOA 4W9MC 3RFFA 4DV4B 2C2HA 4NNPA 2LKDA 3I4LA 3VSAA 2C3OA 3DSRA 2CW5A 3N2ZB 5KHAA 4H59A 3QMMA 1MEEA 4HX9A 1FQWA 1JEYB 1XX6A 3VYRB 4KFCA 3SF0A 2WTMA 3IIEA 4O4IB 1BD4A 1V11B 3OZ7A 4QPCA 4R01A 1L4HA 1JQLB 1Y0BA 4DSNA 4EI9A 1QFXA 1XF9A 2PX4A 4EB8A 3E3MA 4FFVA 1ZICA 2J87A 1IZYA 2QZJA 3FMOB 3C3EA 3MXTA 1ZU5A 3H3JA 4P98A 4YUXA 4S0XA 4Q4JB 4G81A 3OQJA 3BHMA 4BMVA 3PDIA 2XCOA 3MN1A 3I8XA 3OIVA 1NJ1A 4D6YA 1KDOA 4NC9A 2Q2VA 1R0RE 4O4JA 3IPYA 1WQ1R 2FPOA 2C2ZA 4YJGA 4QG3A 3DDCA 1KHTA 4GI3A 5BT8A 4HO1X 3K05A 3UGQA 2B1RA 2ONCA 4QGGA 3ILYA 5KDOA 3RW9A 4WCFC 2CL6X 2G9VA 2VNSA 2X8WA 3FCCA 2QN1A 5G3ZA 3ABIA 4UBLA 3ABRB 1UCFA 5FPYA 1HOTA 3RS5A 3AVYA 2OTCA 4LC0A 1T6YA 3A31A 4XVCA 4KYUA 4BGEA 4GM4A 4MOWA 1E9CA 4RKFA 2X0FA 1SOAA 4MCAA 4K3VA 1GFZA 1L7PA 3ED1A 3V2UA 4M0KA 1M8GA 1I4WA 3WA6A 1IWPB 5A71A 2CB9A 2R2AA 3IXMA 4AKIA 4JL6A 4DIEA 2BVNA 5LP6C 2BRUA 4GLBA 4LG1A 5DLDA 1O1YA 2AEMA 3ZCQA 4LFAB 4XRRA 2A86A 2QTHA 5F4BA 4BCBA 3IX7A 1SIBE 4BB6A 1AA9A 4P80A 2FRVA 2Z1DA 4HDAA 4Q1CA 3P0RA 3R7SA 3INNA 2XRMA 1ZA1A 3E4DA 3EWIA 3GZJA 4R3UC 4F97A 1OH8A 4AJPA 2MOKA 2PBRA 2W43A 2DLDA 1GNTA 5HOQA 2XOEA 4XDYA 4RY0A 2B8JA 2C3YA 3GGOA 4EABA 1SWWA 2I7CA 1GG8A 1C0LA 2W6IA 3G17A 4WT7A 3TUTA 3RTGA 5C9ZA 1BRMA 2JEOA 3B6JA 2DPYA 3LVBA 3SBDA 1K86A 1XB2A 3G9XA 3SR3A 3G13A 4OV6B 4NDZA 2JGDB 2P67A 3G2MA 4Z4CA 5F2NA 2AJDA 1Q91A 1ATZA 2PFKA 3OT1A 2BF7A 2Z98A 4U1RA 1UQRA 3JALB 1XNJA 1Z7GA 2R47A 4PC2A 4PO8A 1NBMA 2JK1A 2WT4A 4X85A 4LCJA 2FEMA 4ZCSA 4DTIA 2JVIA 1XDBA 1VECA 4MWDA 4QG7A 3PGKA 5IN5A 3I9FA 4IGIA 3HKBB 1DIRA 4JJEA 4TRRA 5COBA 1RPTA 2IEYA 1E1RD 3TLZA 2J9FB 3TSOA 3UCXA 4Q7JB 3FTEA 2PQ6A 3HWSA 4RA6A 4XW2A 3W6PA 4WNCA 2CVFA 3IIJA 1OXUA 1A5AB 1P91A 3OEWA 1SB8A 5CW2A 5D6NA 6Q21A 4LY3A 5EGSA 1UPXA 1N6KA 3VQTA 4JJIA 3I1IA 1HE2A 3OSZA 4FFDA 4GU5A 3NPAA 4HTAA 4MQLA 4ND5A 4NULA 4WWHA 1V7PC 2DHQA 5AM4A 4P38A 4MVJA 5DX1A 2QE6A 1CD5A 4FHGA 5GMOA 2O50A 5CDUA 2BONA 1M0EA 1WHSB 5U4XA 4XEUA 3T7CA 1KQPA 3VNQA 2HU5A 3D43A 4BUZA 4QQFA 4HTFA 3VUFA 1P0QA 2BSXA 5CGZA 1RE0A 3THXB 1M8KA 2OGUA 4QECA 2Y0BA 3OIDA 5JSKA 3MAAC 5ENDA 1GNPA 1B7GO 1BHJA 1CSEE 1YUNA 2P6MA 2Y68A 2YVAA 3EEIA 3DVQX 3HLYA 3I9JA 3SD7A 4RTNA 1NX9A 4IOLA 3N7UA 3L7JA 5K8IA 2CLKB 3I9MA 3HP7A 1U0BB 3BRQA 1L5HA 1QDUA 1IEXA 2VK4A 4YCBA 1MZVA 4IKOA 1XRJA 5BYKA 1VKNA 3KJQA 3L8CA 1PSDA 1VSBA 1ZS9A 2PGJA 1I7DA 1R9GA 4JIGA 2FOXA 3DFKA 2WJYA 1Z0IA 1E7SA 1PSZA 1U2SA 3IJPA 3TKAA 1MN6A 1SXJE 2EBUA 2GEFA 1YDEA 2Q5QA 1JA1A 2XA2A 3LHFA 1ZJ6A 1HDGO 3TOXA 1EFAA 1LI5A 2OO5A 1CJMA 2R1ZA 2C4TA 2XMGA 2B20A 4QO8A 3K8OE 2XGJA 5K4GA 4IRMA 4M9QA 3GFGA 1N2CB 1L6IA 3N2KB 4JLJA 1XZCA 3ZN2A 1SKUA 2GAAA 2BTQA 2H29A 2WPDA 3DGEC 4MVJM 1MXFA 3IUMA 4N40A 3DMDA 4ZI5A 3RRYA 2QG4A 4HF7A 1T2VA 3GLHA 5EIBC 4U3JA 5EE1A 1G8JA 2NPFA 3TEFA 4EG6A 1RQ7A 1Y9ZA 3C24A 2BN4A 2ZDGA 3F5FA 3CG0A 3L02A 5EXEA 4KR7A 2PKCA 2NG1A 2NU8A 4QM7A 1I32A 2VOJA 6LDHA 4RSGA 3MHPA 3II6X 5KINB 2R0QC 5AHWA 3NWEA 1ZI6A 2Q3CA 4UOEA 4ZQEA 1NYQA 1NLUA 3HUUA 3KK0A 4W1RA 4ZAWA 2REXB 2EG5A 1A2OA 3KGDA 4JL8A 4BGIA 3PLAE 3ZWNA 2BW0A 1M2GA 5JSQA 3PYMA 3ZE9A 1DX4A 4NCAA 2H7YA 1JF8A 5K0CA 3KBOA 4GO1A 5FBHA 1APBA 2QROA 4BEWA 1M6VA 4XQCA 4G0VA 3D7NA 3TVTA 3L18A 5AVUA 5AUQA 2V7VA 1H6BA 2DCMA 4QBIA 4MI6A 3EG9A 1GYPA 1NMQA 4EG5A 4Y6QA 1YSCA 1H05A 2BCEA 3H3FA 3ZOZA 2ZW9A 4P7GA 3BXFA 1MT0A 2J59A 1SWVA 4JI3B 5K01A 1J39A 1W7AA 3EIWA 3OAAA 4LAFA 3VR1A 4A4DA 4U00A 3CXUA 3AESA 1YL6A 1NZFA 4M0UA 5F4ZA 1WCXA 2CNOA 3UUFA 5G4KA 3T35A 4ABYA 2YWDA 3KIPA 3LCUA 1YI1A 1SQGA 2NYVA 4LW8A 4P81A 5F5XA 1X15A 1L4YA 1YRQA 2IOFK 3KUUA 3OQVA 2I1LA 3O4GA 2R1TB 2YS7A 3SJ7A 3CCBA 2PTHA 2X1LA 4M1EA 2R85A 2J9YB 2NTJA 5EQTA 2R4QA 4JASB 5IK2D 1A9PA 4DCGA 3KHUA 2P8SA 3NVDA 4DMUB 4YJ2A 4ZJPA 3FROA 3BXZA 4AQYB 5C5CA 2J6CA 3O0DA 2F7SA 5A4MS 4QELA 1TMOA 2GXUA 1NKTA 1C4WA 1M1YB 1L4LA 4CLRB 1TTHA 3PXGA 3HDQA 1UC9A 2I99A 1E1RA 2AK3A 3OZEA 1SQ6A 5F3DA 1KP3A 4QC2A 2H59A 2RKBA 1PG5A 2YVQA 4F4DA 4NAVA 1M8JA 1XJCA 3FUWA 2M32A 2HWXA 5F1PA 1OGJA 1IHUA 4L57A 3IVCA 2WLTA 3HP1A 2AS0A 3JQ8B 3E9RA 2YHUA 3WFJA 4K86A 2WTEA 3AF2A 3I9LA 3JD3A 5KNCD 2KBEA 3A1VA 1QBKC 4OHUA 3QUAA 3RK1A 1NU6A 3AIIA 3OPNA 4R9NA 4BFWA 4DN6A 2IF0A 5DI9A 4YNBA 2X9LA 2OYSA 2RH5A 3PENA 1I1NA 4MAFA 4L2IA 3I3SR 1J2TA 2ZIUB 2ZRBA 3PL1A 3STTA 4ZZ3A 5B7GA 3U44B 4ZVRA 2WF7A 4IIEA 4W99A 5EMLA 2OFXA 1NFFA 3ZWPA 5BW5A 2G4VA 3QVVA 3W3ZB 3NUGA 4XI9A 2E1RA 4R84A 3QENA 4HFRA 5EWJA 4GZ5A 1DJLA 2DLCX 4KFSA 4EJSB 1GSIA 4LJ7A 3HKDB 4HBZA 1RAAA 5BYAA 2COUA 5CDGA 1E3DA 3KAQA 3QK7A 3QOXA 1Y8ZA 5T73A 2XWQA 4FEYA 4PSKA 4DV5B 2BHNA 1Z0JA 3PNLA 4OKSA 4ZHQB 2OKCA 2QP3A 3L0BA 1R4NB 1OH5A 4YP6A 1RMTA 1U5AA 1P0PA 3HK2A 3AUSA 3M4ZA 2IY9A 3E53A 4MITA 1FNBA 1PL6A 4CMCA 3JWPA 1MTZA 3UMCA 1F7UA 1EHCA 4DYDA 5CCBA 1OLXB 1Y5RA 4J7UA 3VJRA 4NZNA 3PP8A 4S1OA 1GCUA 1GTG1 2QMOA 2GN0A 4IZHA 1WZEA 1R4MA 1IEWA 4HNHA 4CLHA 1KZ1A 3BEOA 3SDBA 1YRAA 2PPLA 3RTCA 5DM2A 4BFYA 1WTAA 3W8RA 2H1OA 4DUPA 5G1OA 5M6DA 4OGLA 1GUBA 1RM5A 4BYGA 4CEIB 1SC6A 3JW8A 3L2OB 1E9FA 2BBSA 1KY5A 1MORA 4QXOA 1V45E 2J3HA 2RB4A 3N8DA 4KB5A 3IEPA 1YBHA 1QO7A 3F6BX 1LS6A 2YZMA 4QU5A 4IH9A 4XPIB 5LA6A 1RMYA 4B43A 3JQDA 3WTBA 2CF5A 2R7KA 2YC4C 4L0QA 4QXAA 5TQ2A 1KI6A 3WYNA 2QQGA 4K9LA 1KAMA 5BORA 1C7ZA 1LPAB 1CXZA 2G0NA 2HIGA 1EPUA 2VBFA 3BJRA 3EDQA 4IJKA 4NFYA 3VNAA 5IFKA 3A28A 4JWKA 3DBIA 3NWPA 2AX3A 3PE4A 3WIUA 4HPWA 4LMPA 2B82A 3QY0A 1L5LA 4U5QA 5H81A 1IDN1 3TDNA 5JQGF 4RDHA 3ROGA 4QUAA 3BMQA 5LZ4A 2BP7A 1VKRA 3H7AA 1CP2A 1KQ3A 2ISQA 4PS0A 3T9AA 1XEWX 3LU1A 5K4AA 4BNJA 1EK6A 4KYVA 4CMJA 4DJDC 4BNNA 1D4FA 5DM0A 5NULA 4CKCB 4KWCA 2JARA 3LBAA 3THYB 2GO1A 3AO0B 2GILA 2V96A 1ZD5A 2WILA 2QYSA 3I2YX 4NVRA 4UTRA 4YJ3A 2W8ZA 2D0OB 3SIPA 3KSUA 4UM8B 3MERA 3I9V1 4D0RA 3FKJA 2CN1A 2JFNA 3QWHA 4YRRA 3SXUA 1LWNA 1OWNA 4DHEA 2P2NA 4DGSA 1PR6A 5BWLA 1FBTA 4Q00A 3IAXA 1T0PA 1S9DA 1YQGA 2XYHA 3W90A 2IH5A 1J07A 1RTKA 1MAAA 3CZ9A 4TYPA 1IPFA 3OZAA 2A8YA 1RKXA 2C84A 4UULA 2LCQA 2C61A 2BM0A 4N3BA 4OU5A 8OHMA 1E9EA 4YUWA 3C8ZA 3T41A 4R2WA 4BS9A 4OHOA 4FBMA 4U02A 2NYUA 3EP8B 2VUUA 3W0LB 1JR3D 1NOKA 4N5MA 4K6KA 4O2LA 3PQFA 3AQIA 5JNWA 3FPCA 4KXQA 3WRXA 5EWMA 3GZNA 3H2SA 4JLVA 4TUYB 4TT3D 2VZ8A 1T34A 1UPUA 1JE1A 2J5XA 2UVQA 4Z51A 5KJEA 2O48X 1AS3A 1VL0A 4PX3A 2B8NA 3BMCA 2DBVO 3GCZA 3DL4A 4MW1A 3L6UA 4RLSA 3DPIA 2FW6A 2GCNA 3PUXA 5CVUA 3FSRA 4M6WB 5IN4A 4C4XA 2I22A 1VI2A 5ILGA 1IULA 1F12A 1TF5A 2HUPA 4REMA 2VZEA 2YQ4A 1ULAA 3FRHA 5K3SA 1JR2A 4B2PA 3BD8A 1OX5A 3SHFA 3GA7A 4GMGA 1TZKA 2I6QA 4Y6OA 4ZOLA 2CXRA 1P3JA 2YV4A 4WRRA 1QBGA 4CM9A 2OYRA 2B8WA 2HF7A 2LWIA 1U2GA 2QAIA 3E9DA 4OHBA 5FBKA 4BWGA 2XW6A 3Q10A 3B13B 4YRIA 2FZEA 3ZJVA 2REQB 4X92A 5AI4A 3H87A 5TIIA 1V96A 2IW1A 2BFPA 5TSDA 3OM0A 3ZCVA 3FXAA 3FOEC 5L4LA 1DKPA 3NYIA 1YOVB 3OSUA 3HP4A 1CQJB 4BWVA 1DMRA 1L7QA 1KTIA 1FNNA 3L04A 4E5KA 4PYJA 5ISMA 2BD0A 1HDXA 3CO5A 1JNYA 1GRRA 1JDNA 1M7BA 3E61A 4R1UA 4RELA 1CRPA 3K8QA 1IOVA 3ESBA 1P1BA 1GZ5A 4IXWA 1GCAA 1SBYA 4AMVA 5K8CA 2ID8A 2XYPA 5KTPA 3V4SA 2JJ2A 5LPNA 3KZXA 2DFPA 2PRIA 2PUAA 1TYCA 2HRDA 3HDYA 3Q5GA 4C0LA 4S1PA 4CM6A 4CXMA 3T1YB 1DTWA 4J0EA 4Q1EA 3OIFA 4J1TA 3NTOA 3BB3A 4JBIA 3G59A 4MS1A 1PFQA 3FTDA 4N03A 4QFDA 1KJWA 3VPXA 4UVEA 3VGPA 1H23A 4DQUA 3DAGA 4XE5A 5JAOA 3WRYC 4L8LA 3HA2A 3ZNPA 4CKWB 3R6TA 1Z56C 2IGTA 2ZR9A 1EJBA 1RIIA 1NBHA 2BMDA 3C3WA 3M33A 4OYRA 1EXNA 5I6DA 3I42A 4CGZA 1YJAA 1K4KA 3HY3A 3F74A 4BFSA 2IYVA 2VDOB 3KKQA 1EQAA 4NENB 5KUTA 3L8YA 3L8HA 3M7IA 4N12A 2V6BA 5K8TA 3P2YA 2UYGA 2QNRA 2H2AA 1FDSA 2JF0A 2ZTSA 4ZQFA 3C3YA 1BE6A 1LPSA 5FI1B 3CPHA 1GAJA 4YRBA 4YASA 1TJYA 4XAQA 5THKA 2BFFA 1BXRA 1FLDA 4OBBA 4JQOA 4TL8A 3UK6A 3IODA 2CE2X 1RWPA 3K9FC 1QC5A 4NBNA 4U7TB 1HF3A 1GZ3A 1PZMA 5JRZA 1FU7A 1QTRA 3AFOA 1SKYB 4YC7A 5BSUA 2BSQA 3NRBA 4BFXA 1AXEA 1XJ0A 2PRYA 2JFWA 3AUTA 3P4XA 1E2EA 3Q4GA 4GLOA 5HBGA 3T3IA 2Q3EA 4MB0A 4ARZA 1QHFA 2OD9A 1XGKA 3FTPA 3IP8A 5H83A 2QM8A 4EZEA 1EFKA 3RT7A 3V80A 2I6FA 2ZYIA 3U7FB 5DEOA 2DQ4A 1VKHA 2B1GA 1XTVA 4EVSA 1NJ2A 3T0FA 4OJNA 3ZDRA 5TVOB 1TD1A 2I6TA 4DZTA 4ZGGA 3OFKA 4MYUA 4BX9A 4TLMB 1EXWA 3P94A 1FDWA 1NN3A 2A1TR 3MINB 3RG8A 3LBYA 1A4RA 3EGWA 2FW7A 1H94A 5C3UA 5FL7A 1NUUA 3JQEA 5KB3A 3V1UA 3PQ4A 1CY1A 3KDSE 3GDGA 2CF6A 3L5KA 2BFBB 2PWZA 1N8KA 4YRPA 5JLAA 4DG8A 3HVHA 5LDHA 3FDXA 2C7GA 3R3WA 3QE2A 5CMLA 1EIWA 2BJWA 3EF1A 1PS9A 2GNPA 2OM2A 5BWMA 1T0HB 2BKUA 5JNLA 3IA2A 1CZKA 4CL8A 3AHGA 2VSQA 1YO6A 3DQPA 3M6VA 3QLTA 4HEA6 3JWHA 4Y9UA 3GT4A 3LHDA 4EGFA 5IHXA 5EKTA 5KVSA 5HZHA 3IVAA 1OLSB 1AB6A 2CXPA 4NIMA 1M0WA 2FXIA 4KEAA 4X60A 3WO0A 5EIXA 1KBZA 2AXPA 4A82A 1KEVA 1GNSA 4GFDA 4KVGA 4IYRA 1I2ZA 4ZA2A 2Q2QA 2BOVA 2VYCA 1FVXA 2QN2A 2OSBA 1QIDA 1XDGA 4FSHA 1Q0HA 2A0WA 3M5PA 2C7QA 3H8VA 5P21A 3K53A 4FWIB 1XKXA 5JSZA 2NTNA 2Q2OA 2W7TA 2NXJA 3A6LA 4N49A 4XIJA 4EAAA 2CXQA 4GQAA 2E18A 2HIHA 2RIRA 3HZZA 3K1AA 4OOEA 1NDUA 1TM3E 3AWDA 3OJXA 3BWXA 1ONPA 1XO1A 2MT9A 3BKWA 3GLSA 5DM70 3ZU6A 1EGQA 1XZEA 1W4AA 2Z8ZA 4JEMA 2Q49A 1C4OA 2Y99A 1EM8A 1FP4A 3F49S 3PDCA 4CKEB 3W9BA 1KJJA 2CCJA 1VA4A 2TYSB 5IKXA 1DLJA 2WJ4A 3FMFA 2X5NA 1TVKA 1N2HA 2I8CA 5SICE 4QASA 1XF1A 5ALLA 3U6KA 3ZBQA 1EVQA 2TRSB 4B6QA 1G8YA 1Q95A 1D6NA 5KHLB 1XHEA 2XQVA 4X65B 2ZIZA 3Q0TA 2QUAA 1KVRA 2FPPA 3OY7A 3EXIB 2CNWA 2EU8A 4Q9DA 3LXRA 3RUFA 4O4LA 1QQBA 3N5CA 3GA5A 1FTQA 1I8TA 3WS7A 1KI9A 1VKOA 2FN3A 4G3XA 3DFFA 1M1ZA 1TUGA 4IS3A 1PJSA 5CFLA 7MDHA 5LL6P 4FFBA 4D82A 1Q20A 3AIKA 5AKLA 1U98A 3CX3A 4FN5A 2VPQA 1RLJA 3HV0A 4LN1A 5LQUA 5GP1A 4UXHA 4X8LA 1SQ5A 2NMVA 2RB5A 5A4AA 3AEXA 2YIDA 4RIHA 5H59A 4X0EA 3W77A 1A3CA 2I4NA 5FI5A 4NS1A 4JI5B 4RTPA 1H4QA 4GGPA 1SKMA 2NXWA 1VYVA 4JYBA 5GJBA 3GGDA 4Z53A 1TCBA 5ALJA 4D79A 3R7FA 4EPRA 2XH8A 3LPLA 4QDXA 3M49A 5KVAA 5K8UA 4U7WA 5FTMA 1ICIA 3DD5A 2F17A 3LLSA 1U3DA 4DA0A 1R6AA 4Z86A 4UEQA 1A97A 1ISMA 4J3FA 3EXEB 1C3OB 3ENVA 2YCLA 2RI0A 5H02A 1PCXA 2B6HA 2HNKA 4NU5A 5CK4A 1DWOA 3ANTA 5FR1A 2IV2X 3GNQA 2Y6UA 2VNHA 3PGLA 4BNLA 2FF5A 2OG1A 1M7GA 2NVOA 2ONJA 2O8BB 1JL3A 1P2TA 3WL8A 3R9KA 4AJ2A 2ODQA 5CFNA 2YDYA 1B00A 1I7LA 1CR0A 1A7AA 2C98A 3IV7A 4RA9A 5JATA 4KHZA 1G38A 1WSDA 1ZVKA 1ONNA 3GU3A 4WMLA 4B3MB 1HSZA 4FC6A 1QUEA 1NR5A 2Q0QA 1Z39A 1MQAA 2VHEA 3OEHD 4YPOA 4AY5A 2D0PB 4PTYA 3GRVA 2XTZA 2NU6B 4Q3OA 3SX0A 4EMSA 4JJAA 3KTAA 1JDTA 2ZSAA 1VI5A 3INRA 3NBAA 3COZA 4J6EA 4MEJA 5JS6A 3INGA 1U0OC 3IS3A 4QNRA 4DLKA 1GY8A 3BGWA 3EXFA 2GJ4A 2ANCA 3MJHA 3QVOA 1IIBA 1UFKA 1ZJ5A 5KSZA 3PX7A 2VZ0A 3F9CA 2JLBA 3GARA 4JELA 5CFQA 5LQRA 2PZFA 5DI3A 2PS1A 1R5OA 4MMZB 1G4AE 1NQUA 2BEVB 3IKMB 4X1KA 4XJXA 5F77A 1D4AA 2AWNA 1ODIA 1G98A 4TXHA 2J0QA 3FYUA 3L7LA 1FFAA 3PWKA 4KWEA 4ZMBA 3K0CC 4PPQA 3VHRA 2PGNA 4JBGA 3KEOA 2CDNA 4UD2A 4WA8A 4IDGA 1FBNA 3WNDA 3NIWA 5DIFA 2HQRA 3S0JA 4K9MA 5B2ZA 3O84A 1E2MA 4MULA 2FWJA 4HVTA 1W0JA 1QR6A 2GZRA 3L7DA 5CLIA 5BV8A 3BSFA 5HFNA 4O0MA 4EARA 4G4SO 1UBEA 4I8DA 1E3LA 4AC9A 3A04A 2AL7A 5EJIA 4G5YA 4RF3A 3U17A 3FKSA 4PONA 3FBTA 3TVDA 2AMYA 2UAGA 1U3GA 1ZZEA 3P2EA 1W34A 2OBFA 1MT3A 3ABZA 1N33B 2XUDA 4J2OA 3FHOA 4PTZA 2W6CX 4IIHA 3V4OA 5CVCA 1XNRB 4X5OA 1HYHA 1RXEA 4HOYA 3LUGA 3BCHA 2BEJA 4AX8A 1J25A 4YJFA 2KWIA 3DV0A 3NR2A 3SFVA 7MHTA 4KMRA 3ZGNA 2ZJYA 3B2QA 3PD1A 4R7TA 5EHXA 1UJ4A 3VUEA 5T64A 4MCJA 2J4CA 2GB4A 3CONA 2XXJA 3HVIA 5LB4A 3TQFA 3EN0A 1A95A 2BKXA 1SFRA 1CWUA 4TMVA 4HJRA 2WNSA 3MZ0A 2WF9A 3DVAB 3U48A 4BEVA 3UMGA 1ZVVA 1JTVA 1U8ZA 3QBJA 4YRMA 3T34A 2R5WA 3I1YA 5M3BA 3FLBA 3OP1A 2OQRA 3F9IA 4X20A 4BP3A 1NKSA 4N5DA 2QLBA 3TJRA 1M1UA 3DMFA 3L0OA 3LCCA 2Q22A 1SKBA 1ZGHA 3E1KA 1MNQA 3HY6A 2IY8A 3QV2A 4NABA 2DPGA 5CBPA 1VRWA 4KJXA 1RQRA 5TQJA 5DRYA 5KQGA 2FMKA 2Q7XA 3HM2A 1UODA 1D09A 1EK2A 2H16A 3D6JA 4F5WA 3L1HA 3VHXA 1N2IA 4NJMA 1JG6A 3N28A 1Z4KA 3A1SA 1LLQA 3N3BC 4PGMA 3NUZA 4J8PA 4AJIA 5M29A 3H2ZA 2ZT5A 4G0OA 5FOVA 1LNQA 2RHRA 3QQ5A 3MK31 1GUAA 1EVKA 1GR1A 6REQB 1GQFA 1ZKDA 4KBFA 1GQOA 4CHTA 3U60B 5HW0A 1DGQA 2ZPUA 4JXZA 2QOEA 3H9JA 1E1MA 4GEGA 5K3BA 5I7HA 1L4MA 2D8AA 3CC8A 4GDMA 1JJFA 1R5JA 1SUIA 3SF8A 2AXNA 3VXKA 1QMPA 3DXFA 2QL9A 5TT0A 3UKDA 1FFSA 4UEKA 4BN5A 1A0OA 3NNNA 1TVEA 2K2QB 2VF2A 1AF7A 4WD3A 2X8BA 4XJVA 3B38A 1OBCA 4RO0A 1IQ0A 1P3Y1 1U7UA 3HWX1 5IKPA 1EX9A 3S1AA 4RZQA 1VL2A 5CFMA 1M2NA 1TW2A 2F62A 3L1IA 1QAOA 4NBLA