1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords dihydrodipicolinate reductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
3WBBA 4YJFA 3V1TC 4P8RA 1HDYA 2PGJA 5T8KC 4BNUA 3TRIA 2PV7A 1RM0A 3RROA 4UVHA 3ZGYA 3DWFA 3TSCA 5KVSA 1EEHA 1XIVA 4CJXA 2Y66A 4Y9DA 3WQSB 5TSDA 3RAJA 1PJ3A 1X7HA 4BQPA 2D5CA 2ZCVA 4HUJA 3OECA 4JQCA 4NMHA 1V35A 4P4LA 1H0KA 1EQ2A 3GAFA 4J90A 2AW5A 4QFDA 2NU8A 3F47A 4FGSA 4A03A 3S2FA 2P9CA 1ZXLA 5I8WA 1W6UA 1EE2A 4XR4A 4ESOA 1O6ZA 4MVJM 3NTQA 3I9MA 4XKJA 3WSVA 1H6DA 1BGVA 1FMCA 3PTZA 3QVSA 2GPTA 3IQDB 4PZCA 4HFMA 4Z9FA 2WEKA 4A26A 2Y1DA 5EJ2A 1QV6A 1YBAA 4BKOA 5FWNA 3NDRA 2VZ8A 3PZRA 4IMRA 4U7WA 4ILKA 1DIRA 3SBOA 4E2XA 2HK9A 4PG4A 4JROA 1M75A 3ZNOA 1MXFA 4E30A 1MB4A 3SC4A 5KNLA 2X4GA 5B12A 1Y5RA 2D1YA 4QEDA 2NM0A 3GPIA 1EVJA 4RVHA 3LSYA 3EZLA 3CTMA 3DBHB 4Y6PA 1ULUA 1PU2A 3LQFA 4PRLA 3WGZA 1PZGA 3KRTA 4YBZA 5H81A 3VH3A 4QTZA 4Q3NA 2AHRA 1P0CA 1LU9A 3ULKA 1YONA 2JHGA 4GH5A 1M6HA 4MOWA 4PLWA 2VRBA 3OIGA 1V3UA 2JKVA 3K96A 4QX6A 3H5RA 1U2DA 4IXWA 2IXAA 3W6ZA 3W8EA 3F4BA 3VH2A 4GX0A 1NPDA 4BV9A 4MIEA 1RM5A 4IXTA 5KTKA 4NNJA 3WG9A 4E32A 5AVOA 1XKQA 3WTBA 1R16A 5CAEA 2C59A 3WMWA 2VHYA 3F4LA 3HNPA 2HCTA 3JQ9C 2G1UA 3F1KA 3DZFA 1R4MB 1NVMB 3DZKA 3WNVA 2HAEA 2DUWA 4O0LA 1AGNA 3GFBA 5TGDA 5LCXA 4XGNA 4R1SA 1A72A 9LDBA 4OXKA 1P31A 5CFZA 5G0SA 4OSOA 1HETA 1AXGA 5DZSA 4WLFA 3QHAA 5C3MA 1GQ2A 3WYCA 1ZZEA 1HDOA 1LRKA 3AW9A 4G65A 4J9VA 3PHGA 5ADHA 1I3NA 3WX0A 3ORFA 5DNAA 5G4KA 2VRCD 4L8VA 1WZEA 2GCGA 3VDQA 2ZB3A 3NX4A 1I2BA 1TT7A 8ADHA 1YOVB 1GY8A 3ZW8A 4YRAA 4MVJE 1JA9A 1V3VA 3SC6A 1AXEA 4BNIA 2X58A 3UCFA 5EL0A 3VH1A 4EEZA 3JQAD 4PLCA 3R6DA 4S3MA 4BO6A 2Z95A 2DM6A 1P44A 1Y8QA 4Z3KA 5JW6A 5C7LO 4RPHA 4R16A 1JQBA 3ANLA 3KYDA 2D5AA 5L51A 4Z3DA 1JDJA 4EUHA 1ONPA 2B4RO 4OSPA 4XIJA 4XWYA 5DCUA 4CMAA 2PZMA 3E5RA 1C1DA 2EJVA 3T7CA 4G5HA 1GUFA 1B8PA 3ZWPA 1IOLA 3QVXA 2P4HX 1ENPA 3NTOA 2QW8A 4DMMA 3UAGA 3B1FA 1AE1A 1LSJA 4YT8A 5DP2A 4RF3A 3U0BA 4GKBA 2QRKA 2X7HA 3FTNA 4ZD6A 4KMSA 2P2SA 2HQ1A 3UCXA 1UDCA 3SLGA 3IMFA 4Y8VA 1EUDA 1R4NA 1ENOA 2ZYAA 4ONEA 4TRMA 4CLOB 3GN1A 1QYCA 4DRYA 3KBOA 1EUCA 2CSUA 4ZQFA 3H8VA 2WD7B 4UUPA 1HWYA 4K6FA 4WCFC 5EPOA 4XQ9A 5B4UA 4CM8B 3E6AA 2B36A 1A5ZA 1G6KA 1PL7A 2PFGA 5DP1A 1NAIA 4WECA 5AXCA 5CDSA 5KVQA 1ZCJA 3KEOA 3U5TA 2GN9A 2ZB7A 5TT1A 3B70A 2W2LD 3BZUA 1ZK1A 3R1IA 1ORRA 4PZEA 3RUEA 5G2OA 3HDHA 2EWMA 1WDLA 4FCCA 4PLZA 1IY8A 2E37A 4DYVA 4QO8A 1HRDA 2J3JA 3PWKA 1M67A 5HRUA 1GZ6A 4FDAA 3COSA 1EDZA 3Q3CA 2H5LA 2JJYA 4ND3A 1Z7EA 2NACA 2LDXA 3OICA 3RC1A 4ND4A 3GVCA 3NRCA 4FJ0A 2HRBA 4HFNA 1EMDA 4WLOA 4GX1A 4BNYA 5CDGA 1QP8A 3GNSA 1Z73A 3MJSA 3JQFA 4NQZA 4PLTA 1QYWA 3PZBA 1O5IA 1Y9EA 4K28A 5AYVA 4JJFA 2H9IA 3VAZA 3L4SO 2WDZA 3JQGA 4OYRA 4D0RA 3TFOA 2X6TA 3MZ0A 2DUUA 1QG6A 1I33A 4IBOA 4P22A 3TZHA 3EZYA 2XF8A 1PJBA 5AOVA 1GPJA 3RBVA 4BGVA 1J49A 1A9YA 3TZKA 2IZZA 2QG4A 4HFRA 4R69A 3F9IA 5A03A 4I9NA 1HE5A 2V6GA 3E48A 4PLVA 1C14A 4AG3A 3PXXA 2F00A 2RH4A 1P3DA 3AY7A 3TZ6A 3Q6IA 4KWHA 5ITWA 3WDSA 3CZMA 1FJHA 1E5LA 4FIZA 4GX5A 2PGLA 2GASA 1RYDA 3BMOB 3L6OO 3GOHA 2RH8A 4P4NA 2EP5A 1N92A 4W9NA 5CEEA 4HX5A 1PR9A 4ALLA 4Q3EA 1PJTA 1ID1A 1XSEA 2EG9A 1T2EA 4FB5A 4EJMA 5JC1A 4MJLA 1OMOA 4CMKA 3BAZA 1UZNA 4CMJA 3GHYA 1IULA 1PX0A 1MXHA 1DC5A 3IDSA 4DBVO 2DTXA 2NVWA 3RUAA 2B5WA 3KZVA 4MIYA 4IQGA 3CEAA 1YRLA 1DIAA 3I6QA 5JMWA 4YRBA 2I66A 2X86A 4YAEA 2G82A 4FQ8A 4NU6A 3QVOA 3NT2A 1DJQA 1R6DA 3TZQA 3PP8A 3IJPA 2O3RA 4AICA 5EQFA 2C07A 3ITDA 3Q9UA 5A9RA 1QRRA 1Y8RA 2GZ2A 2Q22A 3K6JA 4DYDA 3AY6A 2DAPA 4BNHA 3TOXA 2ZB4A 3A28A 3R3SA 4UUOA 3G1UA 4AJIA 1C0PA 3GZ4A 3GR6A 4M86A 5GZ6A 1B8UA 2GSDA 2P4QA 3HQ4O 2Q99A 3SEFA 3JV7A 3S8MA 4ZICA 4R54A 3WICA 2CDAA 3MJEA 1Q7CA 4CUJA 3WGGA 1X0VA 1P0FA 2GN4A 4IZIA 4AJ2A 2XOXA 4R9SA 4XJTA 5HTOA 1PGPA 2VYVD 5JO0A 1BWSA 4Y6SA 3ONFA 4NHEA 2NVUA 1NBOA 3DHYA 3CH6A 5ICMA 1GCUA 2X9GA 4JJGA 5L7WA 4WUVA 5T57A 4DLLA 3VOSA 3GMSA 4A0SA 1KS9A 1PJCA 4AJ1A 3F6YA 2O3UA 3GAZA 3MOIA 3C1OA 1TT5A 1XA0A 5A5EA 1K3TA 1VKOA 2DC1A 4XYEA 1CYDA 2F1KA 2UAGA 5C5IA 4ZQBA 4XQCA 3RUDA 4O59O 4WKGA 3HN2A 3DOCA 4YT4A 4YTEA 3ZW9A 5IN5A 4MP6A 2Y68A 5A02A 2UYYA 3WMXA 4NU5A 3HSKA 1LBEA 4YQZA 4B7UA 2BFPA 2FRDA 4BO5A 2CDCA 3AM3A 1GV1A 3PK0A 3W8FA 3IIEA 3STHA 4O63O 3L6DA 2FZEA 3A1NA 5F1OA 1ZVMA 3PQDA 3DMTC 2CMDA 4I9HA 3EHEA 4NBRA 3D1LA 3M2PA 2AQHA 1ARZA 2C54A 4BNWA 3I4FA 1NR1A 4NJOA 1TXGA 5B37A 2HJRA 3JD2A 1H9AA 4DBZA 1KEUA 4U5QA 4W7HA 3BTUA 1WDMA 2EW2A 3ICPA 4FJ2A 3HG7A 1LLQA 1YBMA 1RM3A 4UVDA 1UH5A 3KUXA 4AJ4A 2Q1SA 1GUYA 3K73O 3PWZA 4D7AA 2W98A 4CV2A 4II2A 4Z0HO 4D46A 1GADO 3AFNA 4MVJP 3M1AA 2DFVA 4AJKA 5C7OO 1IE3A 1P45A 3D5QA 4J4HA 5F1PA 1PJSA 3L6EA 4FOOA 3WLEA 1MG5A 1EK5A 3AI3A 3NEPX 2G17A 5EQDA 2O4CA 1HE4A 1GFSA 5DOZA 3ZV4A 3B1KA 4Z9XA 3NT4A 4GX2A 1ZNQO 5IN4A 4LISA 4W4TA 3FPLA 3L77A 4YJFB 1EFKA 3H2ZA 2J5QA 4NPCA 2JD2A 3U09A 1HDCA 3I9OA 3JQGB 1K89A 1R0KA 2OORA 2WM3A 4WLVA 4OL9A 3WSWA 2VWQA 1HDGO 4WK6A 5ER6A 1EBUA 1PWXA 2JFHA 3HUDA 2J6IA 4WEQA 2BLLA 3Q11A 3GQVA 2VTEA 3DHEA 4OGWA 4JP3A 3R0IA 4MVJD 5F1KA 1P1HA 4RPJA 4JN6B 3BHIA 4R9RA 5G0WA 4TRRA 2X0NA 3IAHA 1QSGA 1P1IA 4JJIA 2O50A 3RU7A 5A3VA 1NR7A 1PQWA 1T4DA 1U5AA 3I4CA 3QA9A 2B83A 1I3MA 2A9FA 2JFFA 5TC4A 3IKVA 1XDWA 2NTJA 4M49A 5A06A 2NTVA 3S1LA 2WD8A 2DFDA 3JQAA 3WWYA 5TIIA 1LA2A 1XYGA 5AXBA 2D4AA 3OQBA 1F06A 1GDHA 4J2HA 1N8KA 4EGFA 4WCDA 1SEPA 4J7UA 5T73A 2I6TA 2WD7A 4F46A 2CZCA 1D1TA 5IDQA 4L75A 1GTMA 3WXBA 2AMFA 4CM5A 2AE1A 3QWBA 2Q46A 2ZJ0A 4Z9YA 3AI1A 3FR7A 1BXGA 1V9LA 3RSHA 4DIFA 5KJCA 1ISMA 3GRPA 1S6YA 4YACA 1VSUA 3IS3A 2GN8A 3O26A 3EK2A 5TT0A 1BW9B 3WGIA 2YQ4A 3OFSA 3SJ7A 2JFGA 2YYYA 4WCFA 3OIFA 4CM4B 5HM8A 5I7EA 2PA3A 1PS0A 4N7RA 3NDIA 3FSRA 4BKRA 2EP7A 2BI8A 2GUGA 3I9KA 4N5NA 4ZQGA 3O03A 5DCYA 2E49A 2HJSA 1DO8A 4J16A 4CV1A 5KKAA 3M6IA 2GZ1A 3LF2A 3D0OA 7MDHA 4EUEA 4ZRNA 3BXXA 3E8XA 4BNTA 1WW8A 3DZBA 2HMSA 4HNHA 2AEJA 3T4EA 3I9NA 1NFRA 4BNGA 5L40A 1HYEA 1QR6A 2RAFA 1I8TA 1R12A 3FBGA 3W4IA 3WR5A 3CINA 2QRLA 4WLEA 3H4VA 5JY1A 1CQJA 4OKIA 3EVTA 2FR8A 4MVJA 4ITUA 2H63A 3O9ZA 1PGNA 4I5GA 4NFHA 1DB3A 4YEDA 1WXDA 2IEBA 2D8AA 5K6AA 1E5QA 2NU9A 4IGFA 3HDJA 1E0DA 3UW3A 5BNTA 1QYVA 4TZKA 2C7GA 3ZN2A 4CM3A 4CODB 2NV6A 3I23A 3DB2A 2OFPA 1DDOA 2OHXA 4CM4A 3MJTA 1NHWA 2X9NA 2FSSA 1HT0A 3GG9A 1HXHA 3TQHA 3IL2A 4IQ0A 3N58A 4IDDA 4YPOA 2CVOA 3PGJA 4BNZA 4S1VA 5L7TA 5DBFA 3PPIA 5ER9A 1E7MA 3VPSA 5JXWA 1ISHA 2YHIB 1H9BA 4CR8A 2J8ZA 2R6JA 3NUGA 4XDZA 1UZMA 2HK7A 3FNEA 1ISIA 4H7PA 4QXMA 2QZZA 4IY1A 3U9LA 4IDGA 5CPFA 2BFOA 4XB1A 1CETA 1OI7A 2JCYA 1NX6A 1NWCA 1CIVA 2JAHA 3INGA 4U6SA 1U9JA 4BHTA 5IDXA 1YDEA 3JYLA 1VJTA 5CP8A 4IIVA 1ZEMA 2UV8A 3ZWNA 4AVYA 1I2CA 1H6BA 1K2WA 1UR5A 3DC2A 3H9GA 3FHLA 3MTJA 1RPNA 4K9DA 3AUAA 3PLRA 3GGPA 1NASA 3E9MA 4MKZA 3S55A 5A9SA 1OZAA 3QWAA 4KQWA 3KYCB 3KSDO 3CKYA 4L76A 1DPGA 1RKXA 4WNIA 1E3WA 2GO1A 4XQEA 1PL8A 4ZGWA 3PJGA 2ZK7A 1L1FA 4DC0A 5JFOA 3DBHA 1UZLA 4IUYA 4IDFA 4B4UA 4YRDA 3OM9A 1X7DA 1I2ZA 1LSOA 4D3FA 5G4KB 4PG6A 1ZUD1 4I1IA 3NKLA 3GY0A 3O8QB 2P9GA 5TF4A 1E92A 1E1LA 4RDHA 4BO4A 3BA1A 1BXKA 1CJCA 2JL1A 2XXBA 3QWIA 4J3FA 1W73A 1U8FO 2YY7A 2C2XA 1ZBQA 3FWNA 2EXXA 2YW9A 3GVXA 3SXPA 4AL4A 1ZK0A 4RVUA 2Y0DA 3K2BA 2BRUA 4BNVA 4CLXA 4IJVA 1B8VA 3ETGA 3ZH2A 1UXIA 4PVCA 1GCOA 4GI2A 4LRTB 3GLQA 4BIIA 2RCYA 4BL5A 4XEHA 2O23A 3ZU2A 1EQUA 2I9PA 5IZCC 3MWEB 4DREA 4RVSA 4HXYA 4KDFA 3JD3A 2YZ7A 2OL4A 4KQXA 3NDJA 4H16A 1AHHA 1U28A 1R15A 5T67A 4CLOA 3TWOA 2WMDA 4A10A 4I08A 1H2BA 1NFQA 1PEDA 6LDHA 1DAOA 2D59A 3ZDFA 5BQFA 5JCJD 5G0TA 1QV7A 2W2KA 5KVCA 4P4GA 4R41A 1B3RA 4IINA 4RF4A 3L4BC 4RVFA 3VPFA 1EVZA 1WZIA 4YJGB 3VPXA 4DIBA 1MP0A 3IUSA 4XZ3A 3AM5A 3ZWYA 3JQ8B 3QLJA 1U3TA 2GR9A 3DL2A 4J1SA 4C4OA 3JQ7B 3NGXA 3V2GA 1CF2O 1YXMA 3W6UA 2JCXA 1FF9A 1IZ0A 4XD2A 2GGSA 2C5EA 4NH4A 5B4VA 2POQX 1E7RA 5GZ3A 3VKVA 1ML3A 3WFJA 4TKLA 1E7QA 1GYPA 2FPIA 3PJEA 3QSGA 4FC6A 5DBIA 3DOJA 2QX7A 3HFSA 2RHCA 1WMAA 3A14A 2Z1MA 3UHAA 4E12A 3UOGA 1Q2XA 3FD8A 3H5NA 4EYEA 3GUCA 4N54A 3ZWWA 5G0UA 4PRKA 1E77A 5F5LA 5LC1A 4YJHB 5EINA 4LW8A 1CEQA 2CF6A 4GVLA 5I9MA 4B4OA 2IRWA 1X15A 1LXCA 1VSVA 2BKAA 3WQRA 3BMCB 1XWFA 1JN0A 1KETA 4FN4A 2J3IA 3ABIA 6ADHA 1T26A 3GEGA 4CM9D 3D4NA 1B2LA 2NTNA 3CIFA 1UXKA 4KP7A 3MCVA 1I3KA 1NQ5A 2EGHA 3ZU3A 2ZJ1A 3GZNB 4BVAA 2Y1GA 3P2YA 1C1XA 2VZ9A 3PQEA 1DIHA 3GZNA 3K31A 3V8BA 1A7AA 1LJ8A 2HU2A 2PD4A 5IDYA 2HDHA 3GRKA 4C7KA 1YL6A 4B3JA 3UICA 3U4IA 3I3OA 3TZCA 3C24A 3JD1A 5C7IO 4BO2A 3JYOA 1LC0A 3TN7A 1RWBA 3PQFA 5B1YA 4QSMA 2ZCUA 3VH4A 3QW2A 1PS9A 2PKQP 1Q7GA 5JYAA 4HFJA 4BUCA 4E13A 1GR0A 2W90A 4BGUA 4Z0TA 4NJMA 5JE8A 3LZ6A 1R37A 3OEYA 2NU7A 1X7GA 1FXSA 4NR0A 1ZJYA 3E9QA 2Y0EA 4BO8A 3VVBA 8LDHA 3INTA 1DIBA 2FZWA 3JCZA 4BKUA 3DTYA 2YV2A 4Y6RA 1JU9A 2Y67A 1M66A 1C1XB 2OO5A 3JQ7A 2DVMA 3W1VA 3H9QA 1NHGA 1H93A 1H5QA 3I1JA 1ISJA 3A06A 4KUHA 1MFPA 1AHIA 3IKTA 4OMUA 4I5EA 1JKJA 5KCZA 2G5CA 3HHPA 3DR3A 3HDYA 4LCEA 1HTBA 5HS4A 4RPGA 2QRJA 1T24A 4YJDA 2GN6A 4TMFA 3ONEA 4HWKA 1TA4A 4QECA 2DBVO 4Q3BA 2DT5A 1OC4A 3E9NA 3DO5A 1FDVA 4BMVA 1R4MA 1LDBA 5TX7A 3X2EA 4D45A 3DEYX 3NJ4A 1WVGA 3QWFA 2WYUA 1IPEA 2X5OA 4RVDA 4CL8A 1F14A 1WMBA 1DEHA 3RC9A 4XGIA 3Q2KA 2B5VA 4OIMA 3E18A 1LNQA 1JVSA 4MP3A 5U9CA 3RUHA 3H9EO 1T2DA 1Z74A 4W9NC 2OMEA 1NYTA 3QE3A 3BMQA 4E5KA 4AJPA 4E3ZA 1VPDA 2GNAA 4OKNA 1B7GO 2Q2QA 2Y05A 3MJCA 1BG6A 3PGXA 4ND1A 1BRMA 4AJLA 2PGDA 2XPCA 2I65A 3KB6A 1GEEA 1HYHA 3DMTA 4FOSA 5HS6A 3UXYA 2PZLA 5L9AA 4CLRB 2YDYA 3I52A 3KXDA 4ZU3A 2EJWA 4BNJA 3PHJA 3H2SA 3B1JA 3TL3A 4I5DA 3T4XA 1A9ZA 4CR6A 4JGBA 1X13A 3S2GA 3GNTA 1PJLA 3I9JA 4IPTA 4CQLB 2EF1A 4TSKA 5DDIP 3K2EA 1AUPA 4EZBA 3LYLA 1WPQA 4FFRA 4DPLA 2P5YA 3D3WA 3W8DA 5A9TA 1DJNA 1O94A 3VZSA 4E4YA 4FFLA 4TQGA 1GU7A 3VPGA 1IUKA 4PN3A 1YWGO 1I32A 2PH3A 1E6WA 1KVTA 1ADBA 1LSSA 2Q45A 4GMFA 1F12A 1KC3A 5AXDA 1B14A 4CQMD 3WIEA 4YAJA 3RUIA 5THKA 1G0NA 2DU8A 3JYNA 4P38A 3GMDA 2AEFA 2AG8A 5TJ9A 1B0AA 3H5AA 3PLNA 1DFIA 3DBLB 5IF3A 4BNNA 5B4TA 4AJEA 4E21A 3LF1A 2HRZA 2Y93A 3KO8A 4CV0A 4DQVA 1BXGB 3EW7A 2C20A 2VN8A 1Y8RB 4ZRMA 5L3ZA 1PZHA 4YT5A 5LDHA 3RFVA 4CLRA 2EHDA 3MJ4A 3SX2A 2JAPA 3UVEA 3ADOA 3C1AA 5COBA 4BNMA 3I9LA 1XQ6A 5ENDA 3OQ6A 5JY6A 3QV1A 2W8ZA 2NQTA 1N7GA 4CQMA 9LDTA 3PHHA 3ZHBA 1LDGA 5JBIA 4PG8A 3RC2A 1QKIA 5CEFA 3EGOA 3DFZA 2JD1A 5L4SA 2AQ8A 3ZCXA 4XR9A 5FFFA 4RQUA 1EVYA 3F46A 4R1NA 4PG7A 3FNFA 5J23A 1IYZA 1M76A 3DQPA 4K26A 4DMLA 1VRWA 2NLOA 1P33A 2FSVA 3N74A 1P9LA 2NQ8A 3FWZA 2SCUA 1H6CA 2GYYA 3A4VA 1VE9A 3ROMA 1KVRA 2GF2A 3H7AA 4ZQEA 5ICSA 1MG0A 2UUOA 3TJRA 4R5HA 3D3EA 4GPD1 3JSAA 4NBWA 3GPDG 3WGHA 1XU7A 3HWRA 1VL0A 1HLPA 5TNXA 1MA0A 3MTGA 4XYLA 1LQUA 3IC5A 3VVCA 4ALNA 3LT1A 2WE7A 2ILTA 1YL7A 2YHIA 3ZWCA 5TLSA 3OJ0A 1GD1O 3ZV3A 2ZQZA 1GPDG 1GQQA 4RORA 4FGWA 3L9WA 2VCYA 3WWZA 2J3HA 4Q9NA 4J1QA 5JAIA 1T2CA 2B4QA 3V5NA 3ZWBA 1D1SA 2VYND 2HO5A 4E2ZA 4PIVA 1VL8A 4FFNA 2NSDA 5ILGA 2E6UX 3SVTA 5GY7A 4A7PA 3WYBA 4IS3A 3T7EA 3AUSA 1Q7BA 3TFQA 2EV9A 5JYEA 4J1NA 1OAAA 3FI9A 4NK4A 1LC3A 4YR9A 4NJMB 3KETA 1Q0LA 4CMHA 1KC1A 1ZFNA 2CUKA 1UXHA 4J49A 4CLEA 5EESA 4MDHA 4EEXA 1EE9A 4HY3A 4LMRA 4D3DA 3DDNA 1EFLA 3HFGA 4M1QA 1O8CA 1PTJA 3DBRB 3JTMA 1ZW1A 2O7QA 1P1KA 2XAAA 1D8AA 5KJFA 4J7CA 2Y1EA 2XXJA 3U49A 5JSFA 1DLJA 1NFFA 1PZEA 1G0OA 2FOIA 3C7CB 1E1MA 4CMEC 2O3QA 1KEWA 1DC6A 3AU8A 1UJMA 2O2YA 3KV3O 1T2AA 1NQOA 1T25A 3GEDA 3PFFA 5ITVA 4LMPA 1YOVA 2X0IA 3AM4A 4TRNA 2BGMA 2VYVA 4ZA2A 4ND5A 3FCOA 3PHIA 4FD3A 1W0CA 2DTDA 2D3TA 2JD0A 3P2OA 3RJ9A 4NZ9A 5KVVA 1UDAA 1P1JA 1GV0A 2W2KB 2V6FA 3V1YA 4UUMA 3KLMX 2IXBA 1ADGA 1M2WA 2PZJA 1JVBA 3ZHYA 3QJ5A 4WJZA 1YL5A 1QYXA 1ZK4A 2NWQA 3KEQA 4ND2A 4CPDA 1E3JA 4NFSA 4GGOA 2EGGA 3IP3A 1BSVA 4RLSA 3K5PA 1JAXA 1C3VA 1ULSA 1DC4A 3U4DA 2UVDA 2EW8A 4B8WA 1XU9A 4IDEA 2I99A 4XYGA 5JNLA 1Y1PA 1YKFA 3LC7O 1LTHR 3AOEC 1SPXA 4E6PA 2B37A 1MFZA 3ZWAA 2V6MA 2QYSA 4FC7A 4U8GA 3GDOA 4JX8A 1KY5A 4ALKA 1I01A 3HN7A 1UXGA 4BV8A 2J5KA 2P9EA 1GZ3A 3GDFA 2Q2WA 5JS6A 2VUUA 4W6ZA 1LRJA 4GLLA 1DFGA 2FY8A 2HMWA 3DZHA 4W7IA 5A5FA 4TKMA 1LLCA 2PD6A 4HBGA 4YDRA 4B8ZA 4DPMA 2J5RA 2YHUA 4UVGA 4R3NA 2DPGA 4WNCA 4B3IA 2Q4BA 4XYBA 1T4BA 3GGOA 4Q3CA 5JYDA 3BMNB 3LLVA 5IZ4A 1ZK2A 3FBTA 1I30A 4WOKA 4YA6A 3KLPX 4O5OA 5HBRA 4TRJA 1NVGA 1DXYA 3LT4A 3Q2IA 1T1SA 2AQIA 4BB6A 3H6KA 4F6LA 5A9SB 1PWZA 4WPGA 4OO3A 3OBBA 1JKFA 3JYQA 1E3WB 3PVZA 4R5MA 3AJRA 4DPKA 4R51A 1IPFA 3QQPA 5MDHA 2Y1OA 2X23A 4PCVA 1S7CA 3DAFA 2YFQA 3UFXA 2B69A 4II3A 4OOFA 2C82A 1YBVA 5L53A 2D2IA 2G76A 3S2IA 4CLHA 5L95A 1XELA 4LK3A 4PLFA 1YQGA 4DLBA 1BDBA 5A3JA 2FPPA 4TZTA 5TRTA 1CRWG 5KIAA 2FHSA 3E82A 2B4TO 1SOVA 4HKTA 1J6UA 2ZKLA 3IUPA 2VZ0A 4A73A 4K6CA 4UVEA 3F1LA 1YVEI 4JXKA 1NPTO 1PL6A 1F8FA 1PQPA 1Z6ZA 3BIOA 1DHRA 3WGOA 4YVFA 4QT0A 2OP0A 2FPGA 4WCFB 3BHJA 1HF3A 4ALIA 1E3SA 4DTIA 3RVDA 1Q0HA 3QY9A 4I9UA 4E5MA 2OZPA 3BMNA 3ASVA 3I5MA 1ONOA 5EMHA 1W8DA 3E5MA 1GAEO 4WASA 3ANNA 3OJEA 1R0LA 4A5OA 5BSFA 1JAYA 4YT2A 2VNSA 4FFPA 2R00C 2DQ4A 4JBIA 4JLWA 5JDIA 3ZWXA 4XRRA 3MEQA 1HYGA 1LLDA 4Y98A 5FI5A 5IDWA 1ZSNA 4BKPA 1YQXA 3VDRA 3BTVA 5DT9A 5TS3A 4IDAA 5C37A 4DL9A 1J4AA 1NNUA 4AJNA 1NQTA 4CMBA 2Q49A 1OOEA 3JQ9A 2AQKA 4BGEA 1UXJA 4J0FA 4WE3A 2X0RA 1DIGA 4U0KA 4KDEA 5HA5A 1VL6A 4LGVA 7ADHA 2P91A 3P19A 1B16A 4ZN6A 2PH5A 3O38A 1NM5A 1PZFA 3GT0A 3ENKA 1CWUA 4XYMA 1SB9A 2TMDA 2BFMA 4CQLA 5AXAA 4AJOA 3OP4A 3BHMA 3RI3A 3JQDA 5GZ1A 1KIFA 3NJ8A 4XRGA 1SBYA 2QQ5A 4DVJA 3JQ8A 3UH1A 3ETDA 2GD1O 2X5KO 1RYEA 1P77A 3PHLA 1VJ0A 4HV4A 4YWJA 3W4JA 5KJEA 3FPCA 3NAQA 5F5NA 2ZYDA 3ADPA 1Y7TA 2EERA 4RZHA 2EKPA 4D0SA 2V7PA 3HB4X 5U1PA 1B3BA 2ZQYA 3LT0A 3WTCA 4MO2A 3NGLA 3VZQA 4BQRA 1MGOA 3OIDA 1SO8A 2ZTLA 3PJDA 5F21A 1CDOA 3RASA 2NVUB 5I7FA 1LI4A 4M87A 3DZGA 1LUAA 4IQ8A 1QLHA 3LLSA 3MWDB 4QUKA 5JAMA 4K1LA 2VHVA 1C1DB 4PG5A 1VM6A 3ASUA 1YB1A 3PEFA 4J7XA 1P1FA 2QYTA 2IZ1A 3UUWA 1EDOA 3GN2A 5JCXA 3PRJA 4F6CA 1U1IA 3OJOA 1X14A 3WLFA 2DKNA 1EUZA 3QIVA 1XCBA 4ZQHA 2E4AA 1Y9AA 2PR2A 1GUZA 3WOHA 3K8ZA 3EC7A 1DRVA 2C2YA 3X2FA 5DF1A 4YCAA 1LDMA 3VZPA 4CMIB 4RPLA 2X5JO 1HSOA 3MOGA 1ADFA 5M6DA 4E2WA 4XDYA 4CR7A 2JHFA 1TI7A 3EYWA 4QFCA 5JAQA 3H9JA 2VYNA 2P68A 1O9BA 4A27A 3KTDA 4B4VA 4EITA 1HDRA 3DONA 3KM0A 3GVHA 4NDNE 5THQA 3KSZO 3RFTA 3AOGA 3WJ7A 4R68A 4OQZA 5ES3A 4GQAA 1X1TA 2O3SA 1U7TA 3EAGA 2HUNA 3JQ6A 3PIDA 4FR5A 4B4WA 4FW8A 2RHRA 4JIGA 3ROKA 1ZK3A 2C0CA 2TMGA 3EY4A 3GA0A 1SMKA 2Q1WA 3V2UA 4NG5A 4OH1A 3TF5A 5CG2A 1K6JA 4YAGA 3NT5A 2Q4EA 1HDZA 1L7DA 2DPHA 1D3AA 1U3WA 3QWHA 1UP4A 2DBZA 1HDXA 2VT2A 3DAGA 2HMTA 1I3LA 4GWGA 1ZSYA 3VTZA 2OUIA 3S2EA 2Y0CA 1YS4A 3RUFA 2FR0A 5HWSA 4KUGA 1QMGA 3ZNNA 1RM4A 5IJZA 3LT2A 1I5RA 2AEMA 4BGIA 4CM8A 4CMEA 1YQDA 1BDMA 1DC3A 5CPBA 3DBVO 2PLAA 2PNFA 3G0OA 3RJ5A 2VT3A 3BTOA 4HADA 4R4JA 3CZRA 4IS2A 3W4KA 2ZATA 3DFUA 4DA9A 2NNLD 4YJGA 1HE2A 5F3RA 4D79A 2W2LA 4FBGA 1JWAB 4YB8A 1T2FA 2W4QA 1XQ1A 4MVJG 4XA8A 5ILOA 3SJUA 1KEPA 4GWKA 5ENVA 4WGGA 2UUPA 2I3GA 1P1RA 2VUSA 3ZU5A 3KYCA 3L9XA 4NBTA 5EERA 2OBNA 4OQYA 2DLDA 4R1TA 3GEMA 4PLYA 2O2SA 2NVBA 5K9ZA 1SEVA 3VTFA 4FFOA 4FS3A 1PR3A 1E7WA 1FDSA 1YB4A 3BMQB 3GK3A 1J0XO 1PIWA 5MGBA 3EUWA 3C8MA 5JYFA 2R2GA 3OJLA 2Y1FA 2CVZA 1B15A 1ENZA 4GLOA 4GVXA 3FR8A 3GGGA 4NFYA 4E5YA 1Y8QB 1U3VA 1A7KA 2DTEA 1MLDA 4C7JA 5BSHA 3G17A 3GH3A 1WWKA 4BMNA 4U6QA 5J9GA 4B7CA 4CMCA 1KVSA 1DRWA 5KOIA 2Y99A 3KYDB 4Z0PA 1LSUA 1PGQA 4ID9A 4JK3A 1A4UA 1DAPA 1N7HA 3C7DB 1BW9A 2GRAA 2X1HA 3RQSA 2JCVA 1XR3A 4J6FA 2UDPA 1EK6A 4I5FA 4NBVA 5CDUA 5IXSA 3ZNPA 2I67A 1EBFA 2FR1A 1CQIA 4O6VA 3ROPA 3EDMA 3E03A 1JWBB 3OSUA 4AJJA 4G2NA 3RKUA 2GERA 5KJ6A 4RF5A 3D64A 2BFAA 4EJ0A 3KOUA 2R00A 5JDIC 4E5PA 2IEDA 3IJRA 1FK8A 4ALJA 2BI7A 1PSDA 1BVUA 4KUEA 4RVGA 1ADCA 4OM8A 3BTSA 3H65A 4O1MA 4RF2A 4D43A 1IB6A 4M55A 5FEUA 3IOYA 4MP8A 1GZ4A 4PFJA 3AK4A 4MVJI 4M89A 4CM9A 5LDGA 4UEJA 1SNYA 3QVTA 3OMLA 4OXYA 1K6IA 1PQUA 2X8LA 1N2SA 4X54A 4L4XA 4D42A 2YV3A 1YH3A 1MC4A 4UEOA 2Q1TA 2AE2A 4BNFA 4EUFA 3UGKA 3D4OA 4BNKA 4IIUA 2VOJA 2RIRA 5IG2A 1LX6A 4IJWA 5I9NA 1N9GA 1T1RA 1YB5A 3ZNQA 2WYWA 3MJVA 2IZ0A 4EI2A 3LK7A 3K9QO 5EN4A 3RIHA 3CMMA 1BHSA 3PJFA 2ET6A 3DXFA 2DBRA 3PFWO 4DWVA 1BXZA 1R66A 3AUTA 1GYQA 3KSUA 3ZV6A 1IL0A 3ZHZA 5CEJA 2GLXA 1D7OA 4XQGA 1FDTA 4LVUA 4CM1A 1YJQA 3RFXA 3WNQA 3VKUA 2BD0A 2Q3EA 3UCEA 1LQTA 2HKIA 1NPYA 4QQRA 4DQUA 4GL4A 1ZEJA 2CY0A 3F5SA 1GEGA 4XCVA 4Y67A 2HMUA 3L0DA 1PGOA 3ZI0A 1Y5MA 2YV1A 4KZPA 1DLIA 4UULA 1DBVO 2E82A 2VWPA 1VI2A 3OQ1A 5BNFA 1LEHA 3BMCA 3CSDA 3AI2A 4LSMA 3PI7A 4L74A 3ZU4A 3ROQA 2PD3A 3INRA 1F0YA 1ENYA 4F3YA 4M54A 3RBZA 3I6IA 4ZJUA 2WE8A 3U62A 2H6EA 2V6BA 5BSGA 3DAPA 3JD0A 4NIMA 5L4LA 3OF2A 1QXSA 3D5TA 1UP7A 4GSKA 3DZJA 4M8SA 1NP3A 5COQA 2FWMX 1UAYA 4MKRA 1C0KA 2IE0A 3F3SA 4BNXA 2I3AA 3NTRA 2ZTVA 5IFLA 4PZDA 4GMGA 1Z82A 5KKCA 3GVPA 5L7YA 1B26A 3FNGA 3NV9A 4IDCA 2FN7A 2BGKA 2NADA 1TEHA 2C5AA 1EVIA 3KYBA 1I10A 3P5SA 4IM7A 4KWIA 4MINA 1C0IA 4NK5A 1A4IA 5BR7A 4EJ6A 3LDHA 5IXYA 1MX3A 5FYDA 1U4SA 2D0IA 2VWGA 2PWZA 1O95A 3EMKA 4J1TA 4LCJA 2O3JA 1E7SA 3HZZA 1YE3A 4CL3A 2IYOA 3TOZA 3DZIA 4BKQA 4R01A 4WLNA 1A27A 2VNAA 1XG5A 3FRJA 3PIIA 1VKNA 1KYQA 2A94A 2X0JA 1DRUA 3U3XA 4MKXA 1SAYA 1H94A 3OA2A 2I76A 2OBYA 4OHUA 3RBXA 3M2TA 3D7LA 3DTTA 5JDCA 1J5PA 3ITKA 2WTBA 4URFA 4FSHA 1HZJA 1ZMTA 4GSLA 2BHLA 1KEVA 3ICCA 2Q1UA 5FF9A 3QRWA 2ZYGA 4L73A 5TQVA 2HMVA 3DHNA 1WNTA 5T5QA 2NU6A 3ZWOA 4DGSA 3AWDA 3ZWVA 3GFGA 2CVQA 2V65A 4KTTE 4RGBA 2B35A 1GL3A 3PYLA 1IHXA 1WP4A 4LRSB 1V6AA 4HP8A 2EKQA 3UF0A 5BSEA 3AU9A 1N1GA 4E2YA 3C7AA 3TL2A 3RCBA 5A4DA 4R1UA 4GAEA 2BGLA 5KWEA 2EIHA 4J2OA 4BOYA 5KJ1A 2O3TA 1U4OA 4WOJA 1LRLA 4D3SA 4EW6A 4YAKA 3GNQA 1LDEA 5CHEA 2YQ5A 2CD9A 4CUZA 1I36A 1ZH8A 4EBFA 3OETA 4N5MA 5CG1A 4RJTA 3PYMA 4CMIA 2BH9A 1KVUA 5JCJA 1E7YA 4J4BA 4XGKA 4CV3A 2GZ3A 1V0JA 2WYVA 1OFGA 4IDBA 2WJPA 1BVRA 1SZJG 1PJ2A 2IDZA 1UUFA 1TLTA 4J0EA 5U4QA 4JCOA 1N5DA 2OGUA 1Z7BA 4PVDA 3AFMA 3WQQA 4B7XA 4BMSA 4R3WA 5H82A 3RD5A 1F17A 5T6BA 1BMDA 1A71A 5JPIA 4DXHA 4UVIA 3CUKA 2HK8A 5I9LA 2LDBA 3JQFC 3BMOA 3FN4A 5A05A 1VJ1A 1I24A 3KVOA 3D3WB 3FF4A 1ZMOA 5CDYA 4CQMB 3OHSX 3RUCA 4DIOA 2IYPA 4IJKA 3QVWA 4BO3A 2VUTA 2P5UA 3G79A 1HEUA 4PLHA 5AQ1A 1I0ZA 1JTVA 1ZXBA 2A92A 2J3KA 3C3XA 1DHTA 4H15A 2ZTUA 4FFMA 1K0UA 3LC1O 5DBGA 1MUUA 3K92A 4CM6A 1H6AA 1E3LA 4E31A 2RBEA 3PDUA 2PTGA 4DC1A 5JC8A 5COAA 1E1KA 2IODA 4YXFA 1K6XA 1VC2A 4YYZA 2YUTA 3ANMA 4XJSA 2PKRA 3L07A 1WLYA 4IJUA 2VWHA 4RCVA 3L4BA 4KTVE 5H83A 2A35A 2EKLA 4MVJF 2A4KA 4RL6A 3KHUA 1ZJZA 3JQBA 5DCWA 4D41A 1FDWA 1E3IA 1G1AA 1SOWA 2C7VA 3DBRA 3V2HA 2B0JA 4OOEA 5A1TA 3C85A 3F5QA 5L45A 3FTPA 1C0LA 3I83A 1K5HA 2BELA 5JAZA 3ONDA 4IZHA 2YJZA 1WAMA 3PDJA 2VRCA 4LVCA 4CM7A 1N1EA 5K6AC 4RDIA 3PWSA 1R0SA 2CNBA 5IZCA 5CDTA 1U5CA 3OJFA 1EZ4A 4E33A 3GVIA 5DULA 2PY6A 3U4HA 2OOSA 3O4RA 3A9WA 4A2CA 4D44A 3ST7A 2QIOA 2QZ9A 3HB5X 4YQYA 1U2GA 4BO0A 4BNLA 2O4UX 1NXQA 1UDBA 2Q50A 2ZTMA 2VTDA 2FMUA 4WLUA 1GQYA 2CFCA 1HL3A 3DMYA 2AA3A 1LDNA 1HLDA 1XHLA 3G3EA 3TDKA 4JP2A 1ZIDA 2H1SA 5I7SA 1TT5B 1U8XX 2YFHA 3UKOA 3LVFO 1Q0QA 2Z1NA 2BMAA 3RWBA 2GDZA 4TWRA 1O0SA 1SCUA 1VLLA 3V1UA 3Q1LA 1IHYA 1M6WA 1HSZA 1YGYA 1Y6JA 2WSBA 1LLUA 2AXQA 3FNHA 2I5PO 2C29D 3HE3A 2CDBA 1SC6A 4JNKA 2PK3A 5DOVA 1NQAO 4INAA 1IZ9A 3Q9NA 2X9VA 3WGYA 4E0BA 3K30A 1ZKMA 1NVTA 2O7SA 4Q3AA 4L4SA 1W4ZA 1XLTA 4L9RA 1ISGA 4OAQA 2Z5LA 4MIOA 4EDFA 2YDXA 4F45A 1KERA 1FDUA 4J9UE 2CF5A 3GF4A 1E6EA 4TVBA 2OXIA 4BB5A 2ZB8A 4ALMA 5JMPA 5IAAA 1KOLA 4ROSA 4DUPA 1PGJA 1KVQA 1CERA 3H9UA 3PYXA 1ISFA 3ON5A 3WJAA 2PKQO 4UAGA 2O48X 4CMGA 1NAHA 4PLPA 2X22A 4B79A 5BT9A 4UEKA 5G0VA 4PLGA 3G1TA 3CMCO 3H3JA 2WWRA 1HZZA 4ZHSA 3GDGA 4QO7A 3JQCA 3CXRA 1GYRA 1HKUA 2VQ3A 3LU1A 4IMPA 1XGKA 1YO6A 1ZSVA 3R3JA 3RC7A 4JBGA 4TVOA 1Z75A 2VHZA 3RU9A 3ZHXA 3GC6A 3QP9A 4NI5A 2DBQA 4YAIA 3ENNA 1WDKA 3SLKA 4BS9A 4B3HA 5T64A 3JQBC 1N9GB 2Q2VA 4W99A 5JDCC 2G0TA 1UP6A 5JLAA 3B20A 3TPCA 1AN9A 1BTOA 3M1LA 4GBJA 4WEOA 4XIYA 1QORA 1HE3A 1MV8A 2ZIZA 4J4TA 3C1TA 4RPKA 5TJHA 4Q39A 3WFIA 2AG5A 3EVNA 4BO1A 3JQEA 4LSWA 4Q3DA 3RKRA 3WIDA 1ZO8A 3CE6A 4RLHA 1PS8A 3LC2O 5L4NA 3HDQA 4NBUA 4TROA 1DOHA 1Q1NA 5G4LA 1U7HA 5FI3A 1Z45A 1V3TA 3ZZNA 3ZWMA 4BO9A 3Q0EA 4UUNA 4J43A 4DQXA 5JO9A 4GKVA 4N5LA 4I8XA 1E1NA 1PJQA 3WGQA 2HSDA 1OC2A 4W82A 1RJWA 4PGFA 3HADA 3ETEA 5A04A 2NUAA 3G49A 4RZIA 1V8BA 2VHWA 1QYDA 2HLPA 3JQAB 3OEWA 3IP1A 4BO7A 5K0ZA 2VOEA 5DN9A 3WGTA 4LN1A 2EEZA 5BNIA 1TB4A 1OBFO 3P7MA 3U4CA 3ZV5A 3NYWA 4RO0A 1DSSG 1TVEA 4L0QA 4RV9A 3WYEA 2Y1CA 5I7VA 1L7EA 1JLLA 3WB9A 4CLDA 3E1KA 4G81A 1R4NB 4MPDA 4MVJH 3H3FA 3JD4A 1KY4A 4YJHA 5GMOA 1MC5A 3VHRA 1SB8A 2FP4A 3TNLA 4XB2A 2PZKA 3B6ZA 3OA0A 3DBLA 1F8GA 4FJ1A 1QLJA 4CUKA 2QHXA 4UREA 3UN1A 2OP1A 1JW9B 4E5NA 4OXNA 4HNGA 4JBHA 1UAGA 4J91A 3VC7A 3BYZA 5T8KA 4RQTA 5EIOA 1YJ8A 3AUUA 4AFNA 1E3EA 3GHHA 4FPXA 4L4RA 3AOEA 1NWHA 3GG2A 2E48A 3GUYA 3VZRA 3AY3A 4AJHA 1LDYA 1KBZA 1Y81A 4XX0A 1X0XA 5I8ZA 1X1EA 1ONNA 3WBFA 4H3VA 4KOAA 1YDWA 4N18A 3DOOA 3WS7A 4GGPA 3VPHA 4U0JA 3CPSA 4Z6KA 2VHXA 1E6UA 1P74A 3N7UA 1U3UA 1JKIA 2BF7A 1PJ4A 4IGEA 3JYPA 1D4FA 1O89A 4DLAA 1DFHA 3OH8A 1NTOA 3O8QA 3D4PA 1XEAA 4ZVVA 4OJNA 1H2HA 3HJAA
chains in the Genus database with same CATH superfamily
2QMOA 4DSOA 4LEIA 2ICAA 3DE5X 2WU4A 4P8RA 1E2GA 5LQDA 5FR2A 2PGJA 1KMQA 1U1FA 2D62A 5JD5A 2PV7A 1RM0A 3ZGYA 4UVHA 2V96A 4QBFA 2SBTA 4I2VA 5KVSA 3G0BA 1O95D 2ZS9A 5G40A 5HKLA 4C22A 4Y9DA 3S2YA 3DEKA 3WQSB 1Z8FA 4EAAA 2OB2A 5G1NA 4NYMR 1OFUA 1G1MA 3RAJA 3OOSA 3CSSA 5BN4B 4JQCA 1D2HA 4HUJA 3UJ6A 4D57A 4JKOA 5KNDH 4BFTA 4HVAA 1ECFA 3V1LA 2XCRB 5LOVA 2GLUA 3ASZA 4A03A 5CITA 2CLHB 2P9CA 5I8WA 1W6UA 4J29A 5KSPA 4XR4A 1WP9A 4RABA 4MVJM 3I9MA 4Q01A 4JV5B 1ISSA 1FMCA 3ESAA 2R1VB 4HLCA 1J8YF 3K35A 2Y1DA 4RELA 1QV6A 1YBAA 2W2NA 1N3YA 4BKOA 5FWNA 5IWCA 3COZA 1H1LB 3CN9A 4D81A 1YFKA 1F1BA 2Y4NA 3TZBA 3IIJA 1IG3A 4U7WA 1YJBA 4ILKA 1DIRA 4S1WA 5BSTA 1CR1A 1H3FA 2DR3A 5EMNA 1T0IA 4LHEA 1M75A 2JFZA 2ANCA 2ATCA 4ENQA 1DKPA 4E30A 1NU8A 3SC4A 5TVOB 5KNLA 3LUPA 3THOA 4EY8A 2D54A 1NP7A 2XJ9A 5B12A 4LZLA 3QFSA 2NM0A 3LWDA 4GNKA 3PNVA 3GJ3A 3QA3E 3F5FA 1XJ0A 3LPMA 4TWIA 4XLTA 5G53C 1ULUA 1XLVA 2QN6A 1Z8NA 1SIBE 3LQFA 1QZZA 2HD4A 4JEUA 4YBZA 3VH3A 2H3HA 2VAXA 3LKZA 4KPUB 3OZTA 4Q3NA 2AHRA 3ZGOA 2R7KA 3W3AH 3VBCA 1YONA 4GH5A 2JFNA 2BLNA 4MROA 4ZAYA 3FBWA 4LTNA 2VRBA 2XQJA 3LC0A 4MOWA 4OPMA 4BMXA 5JJKA 3AEUB 2HADA 3K96A 3H5RA 4B47A 5KMGB 3TTWA 1RWNA 2A9PA 1TF7A 5HHTA 4RACA 2ZW9A 5K03A 4IDQA 4BFYA 2O9JA 3DW1X 1TIPA 2V7QA 1RM5A 2H7XA 3ANTA 4IXTA 3UAOA 4V0SA 2H1VA 2WFLB 5AVOA 1R16A 2XVAA 2Z98A 4M8KA 2W6CX 1ORIA 1O1YA 3AEXA 3O3CA 1W6RA 4WZZA 3V4PB 4DSTA 2G1UA 1PK7A 3A1DA 3F1KA 1Z0KA 1YQ9A 3RVSA 4YY3B 5JTTA 2QMEA 1SCAA 4ZOBA 4F2PA 4YMUA 3K0SA 4ZCTA 1JHPA 1HEYA 1RRFA 2EL7A 3GFBA 5JRJA 2CLLB 2WWFA 2FSIA 5LCXA 3HVIA 5L6LB 4NCIA 2HX1A 3F8SA 4D9FA 2I0FA 4Z5XA 9LDBA 2OECA 3DZ6B 2Y1LA 5G0SA 4OSOA 4FMBB 3MBKA 3PEWA 1BFUA 1CIJA 1PWHA 1U0TA 2FKNA 3A6EA 4HZUA 2WA1A 4OFXA 5DZSA 1ZM3A 4C0WA 1A88A 5BVHB 2C7PA 1IY0A 1UMBA 1I7PA 1WXIA 3KJEA 4ECEA 1Z5OA 4KYIB 3QX7A 2I8CA 1ZZEA 1HDOA 2VF5X 4J9VA 2WYIA 4JI3B 4OQPA 4MITA 1DXQA 4MLPA 4MUIA 4WGFA 3ORFA 2HXGA 5DNAA 3WX0A 4CG1A 3L1VA 3E1SA 2GCGA 3H2JA 1I6LA 2P1DA 4FINA 2ZB3A 3AQ4A 4FDTA 1AKRA 1L5FA 3ZW8A 2KI5A 1Z22A 3ILHA 3B1XA 3HU3A 5JMOA 4RM2A 3UCFA 5EL0A 3VH1A 4A9AA 2IVFA 3JQAD 4PLCA 2OQIA 3MHPA 3N0RA 1JDPA 5INTA 1YKSA 4X6YA 3IXLA 1P44A 1Y8QA 2W11A 4Z3KA 2I7CA 4EA8A 1PR2A 3HR4A 4RPHA 4YMLA 4ZI7A 5JADA 1YQQA 2D1RA 3ANLA 2DKFA 1C3JA 3EMBA 4BASA 4RFVA 1JHZA 1R6XA 2DUMA 3H0VB 4EUHA 1D1QA 1KK3A 5JSUA 3DLTA 1OASA 4XIJA 1H4SA 3SZOA 2GVZC 4OVKA 1RWMA 5HNKA 5HE8A 3TVTA 2ZITA 2IK8A 5DK4A 4ZMBA 1ZKDA 3DDUA 3EPBB 1GUFA 4Q18A 5DGCA 1IOLA 3QVXA 3QITA 1TEXA 3WE7A 4S35A 2ZREA 5AW7A 1ENPA 2QW8A 3FDXA 2I1LA 3KZOA 2O20A 1OWPA 3L7KA 4V0NA 4DDVA 3OC6A 4YT8A 4QBIA 2FMHA 4DSNA 5C9ZA 1QJ4A 3ER6A 1E1CA 2IYEA 1GZHB 3RSFA 3WO1A 2BMEA 2QRKA 2UZ3A 5MGNA 3AJAA 2G9RA 1L3BA 3IUQA 3UGQA 1U0SY 2OCGA 1TQ4A 3WIVA 5JSHA 5B57C 1AJEA 1JA0A 3IEXA 2FF5A 3FUVA 4JQSA 3FHOA 4KPEC 1ZHOA 3IMFA 4Y8VA 3TMAA 2C97A 1DTEA 3AG6A 1Y34E 4MQMA 1ENOA 2ZYAA 3F74A 1KRHA 3VO8A 5EJ9A 3MTBA 5CB4A 3RH0A 5KHOC 2CSUA 4NOJA 2WD7B 4UUPA 1UJ5A 1IB0A 5KQSA 3JATB 2QAIA 4W1RA 1IRXA 2BW0A 2HWXA 2QTBA 3ITEA 1C3OA 2B36A 1PL7A 2BPOA 3FWPA 3U7QB 4OQFA 3EAQA 3EZ9A 4Q15A 1NAIA 5AXCA 1TQ8A 3RUPA 5FUBA 3L4KA 1ZCJA 1YQWA 1Z4MA 2GN9A 1IY2A 4PF1A 1TCCA 4CTOA 3BZUA 5HXAA 4H6WA 3R7WB 5F2NA 4LQ4A 2FRVA 1W4RA 2EWMA 4PLZA 1Y7PA 2VIIA 4MV6A 4WKNA 1IY8A 5DTJA 2E37A 1Q50A 1FFDA 4KN8A 5IVPA 3WAGA 2V3VA 3R4VA 3KUKA 1WDWB 2C7QA 1M67A 3ORHA 1GZ6A 3M5CA 3FFTA 2VDLB 4Y6GB 4RTOA 4L5CA 2JJYA 4F3RA 5CA1B 2OBXA 2YIJA 2BAGA 1KMNA 1L4YA 1V8DA 3PQ8A 5B58T 5AI4A 3FLEA 3BBPA 1DKQA 1VBKA 4CFYA 2AG6A 3I37X 2EP8A 2FW9A 3EZ2A 4BNYA 4LJRA 3JRNA 1PR0A 1PKXA 2WAAA 2PH1A 2Z2KA 1Z73A 4LBYA 1XPUA 1PT6A 1VRCA 1P62B 2DPXA 1PHPA 3IX7A 2HIHA 5DXAA 3W1EA 3W34A 3WQBA 5BW5A 3WB1A 5DYTA 1Y9EA 4K28A 4RIFA 1CJSA 5AYVA 4EA7A 3JQGA 1ISPA 2CCGA 4EVQA 3UQZA 4RULA 2X6TA 4LAFA 2FLVA 2G88A 2OM2A 1Y0BA 1DCKA 4P22A 3EZYA 4GOLD 4EW1A 1J49A 1ZUNA 4H17A 4YUZA 2CZQA 1XP8A 2KSQA 1YULA 2Q6IA 3TZKA 4Y2PA 4EYGA 2QG4A 4UTPA 3CW9A 2VDUE 4HYEA 4R69A 1WETA 1TAQA 4L72A 4C1NA 1HE5A 2WNIA 5FB3A 4BWYA 1ID8A 3D7NA 1KJQA 2FPXA 3J81A 5FOUA 2QRGA 3TZ6A 3A6DA 4IZ6A 2XWJI 3S7ZA 5E9JA 2B9EA 3WDSA 3ZLTA 3CZMA 3ZZ0A 5DV9A 5SZIA 5ITWA 1AQ6A 3UBTA 2COKA 2HBRA 3WK6A 2XMGA 3L6OO 3F3KA 2JNWA 3T1OA 3AERB 2RH8A 4EHBA 2EP5A 2WVHA 3HB1A 4W9NA 4MUKA 1E3DA 2W0MA 4PNHA 5F9MA 1SFRA 4MR7B 3BFJA 3EQ7A 3P26A 5HIIA 5CDFA 1OMOA 5JC1A 1OLXB 4OI0A 4URVR 1UZNA 3OCYA 4L6IA 4LIPD 4A6DA 5LJIA 2R11A 3AVVA 1AD2A 3VX3A 4NV1A 1K3FA 4X1YA 5CNMA 4D4HA 3AETB 4C0QC 1UQRA 4Y7DA 3LSTA 4HNSA 3ZY6A 4A2WA 2CLMB 1AURA 2NO0A 4OJTA 3C0KA 2I66A 4ZJZA 5E6RA 3FMVA 4PSDA 5M04A 2XMPA 3EARA 1BVHA 4PSAA 1GTJ1 3CNEA 3WBKA 2QOEA 2HBZA 3TQCA 2O3RA 4B83A 4CCWA 4KDCA 1EFRA 3QEOA 3KIPA 1RRGA 3LHFA 4JL5A 4U39A 5H7XA 3QMWA 3DYIA 2GA9A 1KZ4A 5J2TA 3JARB 1XTSA 4DYDA 2BZ1A 5JD3A 2BM9A 4XM2A 4HDRA 2N1BA 4EFKA 3TOXA 3U4QB 4LJYA 4WBNA 3A28A 1YZNA 2OHVA 3G1UA 2OPHA 4AJIA 3RABA 2JVJA 3GR6A 4A6XA 1F7UA 3RG2A 5K0FA 3RFUA 3I8OA 1DS6A 2Q99A 2Q4OA 3IUMA 4ENSA 3DOFA 4YWHA 2LIVA 2BEVB 5GONF 1WBBA 4BUJA 3EIXA 2W6IA 1M0EA 5AICA 1XHEA 2GN4A 4DHEA 3G7NA 2DPYA 2XOXA 3H04A 4EGAA 3GLFB 5L3RA 3GUZA 4O4IA 1K2VN 1OU0A 4Y6SA 5BYKA 3DHYA 5LP6A 5FFMA 2X9GA 4PC7A 4WUVA 3T9EA 2C5SA 3A9TA 2B8TA 5BSKA 1T29A 7ABPA 1O6GA 1VSTA 2RH5A 4DLLA 3AMVA 3QEBZ 1KS9A 1R8XA 2QI9F 4KQ2A 4ABYA 2GRJA 3F6YA 1IWOA 4JJKA 4GF5A 4HS9A 1K8QA 5DLPA 3SQMA 3G13A 2D13A 4ZCPA 1XA0A 3AESB 1P5RA 5DNUA 4HH3C 2FEOA 2G0NA 5AIBA 4LBWA 3H11A 3BXFA 3VSBA 3KR1A 2UAGA 1PYOA 1BE6A 5JV5A 5K8JB 1L5KA 3U4QA 1TPYA 4E1AA 2H4YA 4RMJA 4OQXA 2WT9A 4O59O 1JXOA 1K66A 1QNLA 3I8XA 4WKGA 3RUDA 1AS3A 3JZFA 5EMKA 1DRKA 3I0NA 4QL3A 1OT3A 4BXOA 1KJYA 1NVAA 4KXYA 3KOZA 4IRUB 2G9QA 1U8EA 1ZM4A 1N2CB 2G7ZA 4F85A 1WXWA 2BFPA 2FRDA 2QTMA 2ODQA 2HR1A 1GGMA 3KL2A 1GV1A 3W8FA 1ZRNA 1OLUB 2FSHA 4O63O 5AH0A 3L6DA 5JAUA 3CX3A 3QNUA 3A1NA 1PHRA 2PSHA 3DDHA 2CMDA 2XNCA 3OM1A 4NBRA 1CUHA 1QRUA 3M2PA 3QBJA 2RJOA 3B89A 2AQHA 1J07A 2FPPB 4R0NA 3R74A 5KOJB 1AQJA 3R7BA 4N9WA 3FCAA 1II8B 2HJRA 2G3YA 1H9AA 4BFCA 2H07A 4DBZA 4E7OA 1PEYA 2ZYRA 4LPKA 4FYMA 4P81A 4YBRA 5JSYA 2VSOA 1SU8A 1Z0UA 1WDMA 2EW2A 4FJ2A 4GLBA 3UMCA 3HXLA 2MIIA 3ZS9A 6YASA 3K1TA 1RM3A 1UH5A 4WFKA 2FA9A 4YAFA 3CF4A 4DJAA 2RGYA 2BGGA 3HO6A 1N5MA 4ENPA 4CV2A 2J9XB 3K0AA 1RMTA 2NV2B 4Z0HO 3G6WA 3O93A 3Q1KA 2UZ4A 3LHIA 2DFVA 4AJKA 2X1VA 3WDKA 1UM8A 3A1VA 1P45A 4RA6A 4ARCA 4YMVA 3LNCA 1SR8A 4H6PA 2BKXA 2AFRA 4INPA 1MG5A 4JFRA 2BGUA 3AEUA 3E4DA 1HE4A 1GFSA 4HDKA 4HAIA 4N0EA 4DVGA 2NZWA 4IOLA 2BR3A 3O4VA 3V6LA 1ORVA 3M81A 1MU0A 4UBNA 4C78A 1X1BA 3IVXA 5TPWB 1JTFA 4DMHA 5HE9A 5IN4A 2DUJA 3FAKA 3L77A 2QD5A 3V7YA 1ZCAA 7YASA 2VRNA 1Y6ZA 1Z6PA 2JD2A 3MUOA 5FWXA 2OORA 2A5GA 1UC9A 2WM3A 3NP9A 2VJPA 2GF0A 3WSWA 2VWQA 5ER6A 5TV2A 2ZRKA 1WUJS 4RSHA 4XLLA 1L8QA 2NZYA 4XM1A 2J7PD 1K4YA 2J6IA 1XKXA 2G09A 1V16A 4I55B 3AF3A 2Q6LA 4J6EA 3M5PA 3WLSA 1UJCA 4JLOA 5JSQA 4MVJD 3Q3GE 4Y2VA 2DR0A 3L7AA 4RPJA 3LCMA 5G0WA 3WNZA 4ZT2A 1XKTA 2RI0A 1UWVA 1QSGA 5EJ5A 4IAOA 5DI3A 2JFUA 4I50A 3RU7A 4NEHB 1T36B 3AFGA 5A3VA 3GFTA 1QF7A 3PNLA 3DZ5B 2ZAOA 4OBEA 1PQWA 4Q9LA 4MX8A 2TMKA 4I3GA 3QA9A 4RXMA 3EJ6A 1V9CA 3UMMA 3L8ZA 1PZMA 2JHCA 3N7AA 3RYFA 2JFFA 2MSLA 2QUAA 3IKVA 1AKNA 1XDWA 1H1DA 4FX5A 4M1OA 4QD3A 3OF5A 3SICE 1MQ8B 1MW9X 1FOEB 4DCCA 1PO7A 1Z2AA 3NALA 3T7TA 4V0MA 5A4MS 3K71B 1A8HA 2NTVA 4HWPA 2Y3IA 1UPAA 4PHGA 3JQAA 3HFRA 3MCAA 4KN5A 2D4AA 3ND9A 1GDHA 4J2HA 5CT4A 1OFIA 1Z9BA 4JC4A 4XPIA 3ZDRA 1T3TA 2I6TA 2WD7A 2CZCA 2FMKA 2YWHA 5F5XA 1Q74A 2NYRA 4ZGBA 2ZJ0A 4Z9YA 2F43B 3BRWD 1W44A 1BXGA 1V9LA 3GRPA 1S6YA 4HL6A 3VR0A 4ESVA 2FLKA 1H8HD 2ACEA 2BE9A 4G0NA 4LYGA 3WZLA 3ZBPA 1BW9B 2B7BA 3WGIA 3A1CA 2I6UA 5JYCA 2MMGA 2BEWA 1PS0A 3AWIA 3U3MA 1XYYA 4N7RA 5FTJA 3FSRA 2P9YA 4RK0A 1XK6A 3E3OA 5HZGA 4EPYA 1JHQA 1OW3B 4O1IA 4KJXA 2OGWA 5TEWA 4TLAA 2GZ1A 1QHGA 2IQIA 3AV3A 3LF2A 3EOBI 4ZRNA 3U81A 7MDHA 3GD7A 2O8BB 3Q85A 2OD7A 2ZSDA 4Y9RA 1QFXA 3ZY2A 4IH9A 4WMLA 2ZJ4A 2AEJA 3KSRA 2R65A 3NIWA 3D0KA 1MENA 4Z2YA 3X1YA 4BNGA 2JDIA 1HYEA 2RAFA 2ZEJA 3COJA 1E3TA 1ESMA 1L4FA 4H4CA 3FMFA 1N7IA 5LA6F 3CINA 1URPA 2QN3A 4C30A 1T9BA 2HOQA 1WVIA 4LSGA 4WLEA 5JZVA 2JZOA 1CQJA 2R66A 4EVRA 2GKSA 3R0ZA 5JY1A 1UK9A 3O9ZA 3OEED 4IRXA 1PGNA 2FV8A 4HSEA 3OQOA 1E2JA 1PR5A 4MPPA 3ZLUA 1BC5A 1DB3A 4DABA 1JZSA 4B75A 3ML1A 1DKOA 5IT4A 2IEBA 3IR5A 1E5QA 4HNAB 3X1DA 1MOZA 4L51A 2NU9A 4R8LA 4IMIB 4IGFA 4AKIA 1CS0B 1PZNA 2JPDA 1FSGA 1QYVA 4Q4AB 2C7GA 1TNDA 1SKYE 4DDMA 4YXWA 3ZTTA 4CI0B 4NF2A 4DDTA 4OXQA 2NV6A 3ZZ1A 4TXLA 1BEEA 1DDOA 1ODKA 1E4YA 1I7NA 4XDGA 5FYQA 3MJTA 3KEGA 1NHWA 2X9NA 3ROZA 1G3MA 3V4ZA 2Q8QA 1QF9A 1CUEA 4KC0A 1U9YA 1CNMA 4IQ0A 1J2YA 4YPOA 3IDQA 4DV1B 3PGJA 4GXNA 5L3SB 5IW8A 1X2EA 2VXOA 5L7TA 1A7UA 5DBFA 3TLKA 5JXWA 1E7MA 1ZH6A 1ISHA 4X64B 1H9BA 4Q1BA 2R6JA 4RC9A 3FNEA 2DCUA 4H7PA 3FYSA 4INOA 1VA4A 3GGSA 4IY1A 5CYPA 5IBPA 5HR5A 1CJKC 4M88A 5IANA 3TNJA 3G2MA 1CRQA 1FLDA 2JCYA 2KS6A 1RHMA 4RTMA 3DE0X 1OLSB 1WSDA 3AO0B 2GJKA 3N2YA 4WKOA 3ZS8A 3INGA 2EKZA 2K6GA 5EKUA 1EGQA 3ABRB 5F77A 1I7DA 1GO2A 1CVIA 2Z56A 2UU9B 2ZVJA 2ISCA 3M83A 2ZYIA 2QWXA 4IIVA 1ZEMA 3UUFA 1QX4A 3Q87B 1BQEA 1VHTA 3KTOA 1L1EA 4UNIA 3ZWNA 1UR5A 1YA4A 4AVYA 1QPZA 1V7CA 3U80A 5DSXA 1L5SA 1DC7A 4K9DA 1RPNA 3AUAA 5K3FB 2DR2A 3JZMA 3GGPA 4BWGA 4EX7A 2YKGA 3GYBA 3I1IA 2OGTA 2UUCB 4HYQA 3EDQA 4Y1EA 4RD6A 2BMJA 3IPRA 3QWAA 1DPGA 2A0WA 4WNIA 1E3WA 2GO1A 3F3MA 3KJQA 1PBTA 3OOJA 1JENB 2ZYSA 3PJGA 4DC0A 1UZLA 2IS6A 1FPQA 2J08A 4IDFA 1BZYA 2B8JA 3U4MA 2CZGA 2I62A 1I6WA 3GRVA 4XFKA 4D3FA 5JS8A 3O83A 2G8NA 3MRTA 4H18A 4I1IA 4ZEWA 5BXQC 4H0NA 1AKTA 1QP4A 3O75A 4INZA 3AHEA 3O8QB 2XT9A 2P9GA 2XGJA 1HRKA 5TF4A 1E92A 2ZRJA 4JOSA 4DEVA 2B30A 4MRPA 5CVDA 3DSRA 4RDHA 4BO4A 1GFWA 3LFHA 1V1RA 2HCJB 3F6BX 2JL1A 3ZCTA 2FN4A 3GJYA 4ZZ1A 1RVV1 3RLFA 1SK8A 1U8FO 2R79A 1AKYA 2C2XA 2FSFA 5LN1A 1KHTA 2HCBA 2JGDB 3RVPA 3FUWA 3GVXA 5LMNB 4QVGA 4G56A 4ME6A 2OCXA 3QENA 4OFBA 4TMKA 1SUSA 2Y0DA 2YX1A 3RB8A 3UAWA 4EX6A 3A9RA 2NUTB 3PXBA 4NJEA 1T5DX 1VDMA 1X7WA 2PDAA 2COEA 2YWEA 3ETGA 3D8NA 3O6VA 2IS4A 4QGSA 5LP6C 3H0KA 1TTTA 4XX1A 1VYTA 4KYTA 5DW3A 1U0GA 4XEHA 1J22A 4RH1A 2LBPA 2ZR9A 1LJLA 2GD6A 2OCIA 4HG2A 3UJPA 3P96A 1EQUA 4I50F 4CRWB 2Y9PB 1XA4A 2P9JA 3NI2A 2GTPA 4RVSA 4HXYA 5DSTA 5SZHB 2G4LA 2OL4A 4LWZA 1UBJS 4FNMA 5EMMA 2FZ5A 3A0UA 2XNKA 3AL0C 4KGZA 4N0DA 3FE2A 3T5PA 1R15A 3EGWA 3KL4A 3NRBA 5T67A 1SHUX 1XHFA 2CXQA 5CLHA 5THXA 4C6TB 1KAMA 1ZVJA 2FJUA 2WMDA 4HQ6A 1DCMA 4A10A 1U0LA 4F8JA 2SECE 1AV6A 1H2BA 1UWCA 2GPWA 2R4QA 5DMHA 3ND8A 3VNVA 2XI4A 1TUIA 3ZVLA 2ONKA 1KTIA 1QV7A 4KO3S 4ZI7F 3A4YA 1VJCA 2ZVDA 4KIFA 2W93A 4LE1A 4IINA 3K0HA 4RVFA 2IH4A 1BJRE 1EVZA 1U7XA 2OCYC 3DAYA 2FPOA 4RA9A 4RL4A 4DIBA 4YJGB 3VPXA 3ZK8A 2CL0X 2GR9A 4ZYLA 3KP1A 1B42A 1P5ZB 3CXUA 2ZWIA 2XTMA 1KJZA 2JCXA 1ZLYA 2IHJA 4MYHA 2C5EA 2HSJA 4NH4A 5LMZA 4NBNA 3F98A 2NU8B 3VKVA 4TKLA 3E81A 1ZL2A 3UO8B 1DTSA 2F62A 3ESDA 5BY2A 1JJIA 3SE7A 1QANA 2Z09A 5C4MA 3PJEA 1M1NA 4DBLE 5M34A 3QSGA 3DOJA 3QVGA 5REQA 4CWAA 5D00A 2EYQA 3I76A 1OYOA 1I7QB 3MS4A 1WMAA 4GU5A 1XMJA 4EFMA 3BJRA 4GD3Q 3TPFA 4DIKA 5K01A 2KB0A 3A6ZA 4B87A 3IEKA 3UT6A 3IPXA 4FOLA 5G0UA 1YZ3A 4UHDA 2H1IA 1NVDA 4LW8A 4IR7A 4MWDA 5EXXA 5I9MA 1X15A 1LXCA 2POCA 3KTAA 1BXRA 1B00A 3H83A 5FUYA 1JN0A 4LXXA 2WUDA 5IS2A 3OZVA 1T26A 5EP4A 4A0GA 1C7IA 1HQCA 3KDAA 3WL7A 1IHOA 1VBNA 3GEGA 3M6FA 3GX1A 4UFOA 3W7BA 1JA1A 3A10A 3MTIA 1RC0A 3BC1A 8ATCA 4R81A 1UXKA 5HJ5A 1CYEA 1I3KA 3MILA 3BE4A 1Y37A 3ZU3A 2ZJ1A 1JLRA 1JIUA 3GZNB 5J2UB 5K3OA 3E9YA 3P2YA 4EG3A 2X13A 5AI9A 4EKGA 4G37A 4JOQA 3K31A 3CZPA 3T3DA 5CLFA 2ZAIA 2XUPA 4AO6A 3AP1A 5I9IA 2J45A 4NAVA 4F4FA 2HDHA 3FSEA 1RPTA 1DQSA 2OEPA 4B3JA 1S89A 3U4IA 2Z9CA 4RA6B 3WB2A 3G8DA 4N6NA 5KTMA 2YVUA 1AGPA 4BO2A 4I4TB 5LP6B 2EBHX 5BN5A 3TN7A 4P33A 4XJVA 5JYBA 3FZNA 3KHTA 2GM9A 5DWQA 4QSMA 2ZCUA 3VH4A 2YC2C 2PBZA 5JYAA 1EHCA 1OVMA 4AXXA 4BUCA 1AHPA 2W90A 3L0OA 1NYQA 1K7XB 2BEKA 1U5BB 2FJPA 3H17A 3NHZA 3UJAA 2J7PA 1R37A 2ZUBA 3KAKA 1UT5A 1TC1A 3P45A 5EPEA 2Y4OA 2FLWA 3C5WP 2DG2A 4WCVA 1FXSA 2XWPA 4NR0A 1O77A 1SA0B 1BKDR 1KK2A 2C99A 4QFBA 4Q02A 1ZW6A 3DJYA 8LDHA 3INTA 1QE3A 2VL7A 2ENWA 3K3PA 1WUYA 3KTFA 3Q15C 4QUJA 3VR4A 1C9MA 3JCZA 3NHWA 4WFIA 2P9BA 1BGWA 4L4YA 5I5EA 1ODTC 3FDJA 4JYPA 1C1XB 1GL6A 1EDBA 2I7XA 5JVDA 1VG9B 2DVMA 2FRXA 4QQFA 1CFJA 1G66A 4R83A 3P0RA 4FIDA 4LNUA 4EP1A 1J0CA 5BT8A 3UMSA 4C4ZA 1AHIA 3Q7QA 3OUTA 4JVSB 3BWDD 4I5EA 3WKCA 2R1TA 2G5CA 5EJMA 3HHPA 3T5CA 1DMRA 2RHHA 3HDYA 3ZJYA 3ZY5A 2W8BB 2GMWA 2IU3A 3H5TA 4H7IA 3V8PA 1T24A 3B36A 2QLJA 1GTSA 4FZ3A 3L7LA 1TA4A 1CF9A 4QECA 3LOQA 2DT5A 1LBHA 1GN8A 3DKIA 1T5IA 4BMVA 1CLUA 5AKHA 2BVNA 4PQRA 4D4MA 4KRFA 1QZ3A 1RMYA 3N05A 1FFBA 1P1BA 4D96A 3QWFA 4UTVA 5JD6A 1CE8A 4CIWA 3FOEC 1OX4B 3PPWA 1A9PA 1F14A 2A67A 1DEHA 1TLLA 2LP4Y 2ZIFA 3I5XA 4EO9A 2GZSA 3E18A 4GZ3A 4ERXA 2QXYA 3NIGB 4QUIA 4Y6LA 1Z74A 1I7SB 4W9NC 4RK1A 4D9GA 4TL6A 1NVEA 3L7JA 5AI0A 1NF9A 2NO9A 4MW4A 3UC5A 4RKYA 1VPDA 4E3ZA 4WZBB 3S40A 4I19A 2XEDA 1A82A 2ZPUA 1EKXA 1VLVA 2VDKB 4B3CA 1H8EA 3MB5A 1GPWB 2BEVA 2D00A 3ROXA 3SBDA 3WGNA 3PC8A 2GETA 4EGJA 4I6EA 4NTZA 1ULAA 1IIRA 3GT7A 1IEXA 2XPCA 3VYTB 2I54A 3BJZA 1RHRA 4X1KA 2N47A 1MO5A 1SXJE 1CJVC 5I47A 3IAEA 4C20A 2WINI 3I52A 4F0JA 4YN3A 5EHNA 3WRXA 1G7RA 4I81A 3OTWA 2RBGA 2X5NA 4C04A 1QO0D 4EVSA 1K06A 4AZ0B 1LV8A 2XWBF 4DLSA 1U31A 3R0JA 4FR2A 2I6XA 1PJLA 4CQLB 2EF1A 3PU6A 4EJMA 3JVUA 3WGUA 4EZBA 5I4IA 1WPQA 2RGNA 3C3PA 2A0UA 3D3WA 3ACCA 1H0HA 1F6WA 3CRZA 1VKJA 3ETHA 4MZXA 2DP4E 2N75A 3IXMA 4JJ8A 3HB0A 1P5HA 4TV8F 2P6OA 1O94A 5KQMA 4PN3A 1T3LA 2B25A 2PH3A 2HZBA 1BWRA 1FVHA 1KVTA 1T8PA 4F56A 1CZUA 1LSSA 1S8FA 2Q45A 1C1YA 4GMFA 3PRKE 5CLGA 1RQ2A 1KC3A 3AX6A 1B14A 3FKSA 4KMRA 3T9AA 3RTDA 3WIEA 3RUIA 9GPBA 1A0OA 3TV1A 1JEAA 1G0NA 2IKSA 3JYNA 4UQLA 2AG8A 5IRCD 1TCBA 4GHWA 1RXSA 1E1RA 1CNFA 4HATA 4TZ6A 3JATA 1V11A 1QCCA 4EKIA 3J81k 3NEYA 1O0BA 5CYFA 3UA3A 3WK4A 3ZCRA 4E21A 2D1FA 3R23A 3HN6A 1PYDA 2W8BA 5IULC 2VSXA 2WILA 3OOEA 3PGKA 4EPVA 1LI7A 1AX9A 1OLOA 2FPMA 2FMXA 1D2GA 5ECGC 1ZUNB 2Z1DA 4HQ0A 1A9RA 5DRYA 1FSFA 1PZHA 3A6PC 2CBGA 3K53A 4JT8A 3EWIA 1Z18A 2GN0A 3CLVA 4AK9A 4LNAA 1IVSA 2QRNA 3L6BA 4JGGA 1T6XA 3UVEA 3QX9A 1NLYA 1P3JA 4MYDA 4LXUA 4AY4A 2VPYA 2QU8A 3MS7A 4OX9B 2CVPA 2DQZA 3LUCA 1Z0IA 4DR3B 4NCKA 3QV1A 1QDEA 3I53A 4HLUA 4IOJA 1Y6GA 2F4VB 1N7GA 4OK6A 5E3IA 3IQFA 9ATCA 2Z8ZA 3A3NA 4EYQA 3PHHA 4ZOEA 2DE0X 4CIYA 3WLRA 2O7RA 1PT9A 1IXKA 3EBOA 3PFHA 5JFGA 3K5IA 3P9XA 5FIUA 5IX8A 2IXTA 5MFPA 2V1UA 5LDDC 1YS6A 5HVNA 4EHDA 3ZCXA 1ITZA 1BKYA 1UBUS 2J48A 1N6OA 4RXUA 3GLRA 2QQ0A 4LXGA 1IYZA 3U3DA 5GQSA 5I5GA 4B43A 4K26A 1IK4A 4DMLA 3DYBA 3QQ5A 4P82A 3IQIX 3N74A 4ZANA 1TKCA 2AFHE 1PT7A 5ERXA 3ZHTA 2SCUA 3AL3A 2QLTA 3ROMA 3BWCA 3COWA 4B9AA 5ICSA 2UYCA 2UUOA 1O9GA 4H08A 3O4FA 4X94A 5BMVB 3ILXA 4KG7A 4NZOA 4KFSA 2PXCA 3GPDG 4TV9B 4E07A 4RVNA 4V0LA 2D1TA 5F35A 2Q3FA 4JLVA 4FUQA 3RK1A 3RT7A 3HYCA 1MDFA 4ALNA 4B0OA 1KZ1A 2DLNA 1QC5B 2ILTA 2XA1A 3A9SA 4BCDA 2YHIA 2GOYA 3DE2X 2ORWA 3G88A 3T54A 3R3HA 3HL0A 5J4YA 4JUBA 3IA2A 1GD1O 2ZSBA 5HKAA 3DPSA 3P9CA 1U2ZA 3AR4A 3CO5A 2QG6A 3WZMA 4GKKB 1H3EA 1P39A 3QXXA 1EUQA 1KI4A 3F90A 3WWZA 4AP5A 5FH9A 2J3HA 4Q9NA 5HP4A 3ZJXA 5TVKA 5JAIA 1XQVA 1AMNA 4JCCA 1HX7A 4L02A 2HPZA 4BBJA 4Z4CA 4NESA 1ILWA 1UBFA 4PSCA 4RJLA 1X74A 5MFZA 2NSDA 3SVTA 2BUAA 2ZRBA 3UFXB 5BUCA 3O8OA 1CY7A 3DP9A 3L0IB 1Q7BA 4DMKA 4LJ7A 4F86A 2EV9A 2FDXA 1OAAA 4UU0A 3DD5A 3PFKA 1TGYA 1OGIA 4LRXA 1XZJA 4LYFA 3THWB 2PL1A 1N25A 1ZPDA 2YRFA 3VU9B 4YR9A 4G5YA 2ZJ6A 4O2RA 1Q0LA 4WL0A 1DKMA 1KC1A 1ZFNA 4MA5A 3Q7SA 1DBPA 3HWWA 1R9NA 5EESA 1VG1A 1KI6B 3HCAA 1Y3CE 3LO5A 4Q66C 4BFUA 1Q20A 2R6FA 3HFGA 3WOVA 4M1QA 1YFJA 4F06A 4BLPA 1C0EA 2V3CC 2BMFA 5B7NA 1MT0A 2A59A 2MMCA 2YBEA 3AYZB 1IWPB 2XAAA 1D8AA 4JR0A 5JSFA 1RDFA 3BZWA 4G8BA 2HU7A 3OWOA 5LD2B 1NFFA 4L4UA 2AB0A 3PXGA 2O3QA 4GYYA 1SOUA 2X0EA 4F12A 1NVVQ 3L0ZA 1T2AA 1NQOA 3GEDA 5AHXA 2RH9B 3H42B 1K6MA 4QGGA 5ITVA 4CV3A 4TRNA 3Q8MA 4M1ZA 2W0SA 4ZA2A 1NBIA 1R0YA 4ND5A 3NVKI 4BAUA 1RLTA 2R97A 3H8JA 1W0CA 3QX3A 5JQGB 4OBXA 4LHXA 2W6MA 3DQZA 4EJ2A 5EJ8A 5LMCA 2O19A 1C1HA 1EAYA 2IXBA 1NXPA 4R2LA 5KDLA 4DDUA 1M2WA 2PZJA 1JVBA 2D6FA 2JLZA 4QLOA 1YL5A 1G5TA 1QYXA 1RHUA 3B9PA 3HEBA 3HU5A 3N7TA 3Q0IA 3QG1A 4HDSA 4I99A 4KQ6A 4RYLA 2C8LA 2YJGA 2EX0A 4IUBS 3V9AA 2L42A 4BN4A 1PFVA 2IYWA 5AUNB 2YXLA 3C74A 5C5DA 1JAXA 2GPBA 1F6BA 1T5HX 4F21A 2LKCA 1GG2A 1PF7E 4OHFA 4NU0A 1I0IA 4KQMA 3ETLA 1XTKA 2QN9A 5JNLA 4ZPXA 4K9RA 4GXTA 2WWHA 5EIWA 1MEEA 1DP4A 1LTHR 3QPCA 1WOYA 4NMMA 3A4IA 3NZEA 3RU2A 2QYSA 2RHJA 3T9BA 2WTEA 5EWLB 4ALKA 3HO8A 4B48A 1YS2X 4KLNA 1UXGA 4H2DA 4X61A 3R7LA 1P19A 4V3BA 2HRDA 3RTAA 1I7LA 2J5KA 1FIUA 1JDBC 2CNNA 2HXYA 3RIEA 3GDFA 3VPAA 2J5BA 4ERNA 2QD3A 1G60A 2FP4B 2W2MA 1BKSB 3LPCA 1NY6A 4DSZA 2GNPA 3EXAA 1W1WA 4EMUA 4GLLA 2G72A 1X3SA 1A7JA 2OHOA 4W7IA 2CXHA 2VDRB 3T8YA 2A1TS 4YDRA 3SQOA 2WJWA 3LBNA 3V1NA 2Q6VA 3FF1A 5LA6A 2QV0A 4B17A 1XDDA 1JF8A 4FWIB 4B8ZA 4DPMA 4OYHA 3UWSA 1I51A 1Z38A 4PZYA 4UE2A 5SV2A 2J5RA 4B84A 3H1FA 4I9FA 2M2IA 4CZ2A 1R7RA 3KPWA 2R2AA 4Q3CA 3VAYA 1WUIS 1Z83A 1SIWA 2PMDA 4WIAA 3FBTA 2DT8A 5LFAA 1NF8A 2AUMA 1CUVA 1K4KA 4R8VA 3SQNA 1FXUA 1NNSA 3LT4A 2V0CA 5EGSA 2R8YA 4MQEA 5AJXA 1BMFD 2BL4A 1X7XB 4O4HF 1ADYA 5M3BA 4PNPA 5ALMA 1PWZA 4G4SO 4WPGA 4ZREA 5H4HA 5JI2E 3VV3A 3NHBA 3OY7A 2PLFA 1E3WB 3JYQA 2WF9A 1IBSA 5CJJA 3AJRA 2OV8A 4EG1A 1TJ3A 5LZ4A 1ESDA 4M8NE 1U6IA 2C9DA 2JI8A 2VF4X 2CDNA 2Y1OA 1MZVA 2ZS8A 2X23A 5BQ5A 1WHSB 2O5RA 1BVYF 3HZRA 4K0KB 3TOSA 2OG2A 3HO1A 4B6OA 4QXPA 1R0CA 3PDIB 1E2MA 1QBKC 2QY6A 4OOFA 3UKJA 2C82A 5KHAA 2H85A 1IXZA 4IZOA 2NT3A 4BDTA 1ZY2A 4I1OA 4Q7MB 3U1VA 4D8XA 5IABA 1XELA 1AMOA 3W6NA 2CV2A 1GAQA 4JLAA 4W5OA 4BMZA 3CQ9A 4IFBA 3MTDA 4NCJA 1R5OA 1YBFA 4K9PA 1OLSA 3WQHA 1S02A 3A1UA 1SOVA 5BYJA 4IFTA 1AQYA 1OWMA 5DH9A 2QY9A 4K6CA 4RA9B 3UG6A 1KSGA 1YVEI 4QA9A 1NPTO 1IATA 3MWFA 1F8FA 4NV0A 4TTTS 1PQPA 4MQBA 3GZTB 1CR4A 3BIOA 3SSMA 1DHRA 1P9NA 3R5FA 4RHCA 4QT0A 2FPGA 3AR8A 2H7YA 1E3SA 4O4LF 5A7HA 2SKCA 2PPVA 1N4AA 4I9UA 3RE1A 3WIBA 3ASVA 1AF4A 1POXA 4BN5A 3KGDA 4O89A 1LZKA 1XTTA 3ANNA 4L9SA 1NX9A 4OMDA 5FPHA 3O2QB 3M6XA 3PFIA 4R2MA 4RKRA 1GNPA 4LDRA 3FKJA 2JJ1D 1JHVA 4FFPA 5IKMA 3K70B 4FT2A 1EU1A 4U7TB 3TW4A 3KQUA 5D8DA 3JAKA 3HJHA 4L2IA 4PFSA 4O1HA 3CFYA 5AM1A 1LLDA 3N8GA 1WHSA 5FA8A 4IJ5A 3V97A 3IVGA 4BKPA 4RK4A 3COPA 4BEJA 4DG9A 1OH8A 1NG1A 3BTVA 2XECA 3R7DA 3ZXSA 4P3PA 4IDAA 1GFIA 3G2KA 4AX4A 1KDYA 1J4AA 1ZXXA 2KE5A 2W2TA 2C2WA 5D1NA 4AJNA 2Q49A 3NHAA 4F5EA 1OOEA 3B9RA 6ABPA 1XXHE 5HG0A 3TD9A 1GGJA 1MJHA 3AH8A 4HAYA 3CKKA 4N0MA 5GONB 4DAEA 4DRXB 5C8DA 4WE3A 4IUDS 4PQEA 3TEJA 3EP3B 1Q6ZA 3GDHA 3NTLA 4KH0A 4CEJA 1ZN8A 4KDEA 1VL6A 1A8SA 1KO7A 2XT0A 3P19A 1CXZA 4CFZA 2Q5QA 1RLUA 4II7A 1RJDA 1PJAA 3H0WB 3A3PA 5I9TA 5J4LA 1FE8A 2COUA 1QF6A 1NT2A 3O8RA 5U4XA 5AXAA 4WDRA 3OP4A 1OA0A 3RI3A 2BEWB 1YNSA 1OSNA 1KU6A 3EODA 1PKEA 1RWXA 3R6WA 4U7DA 1V9SA 1M6YA 2Q5HA 3TPZA 4JUDX 4EMTA 5B64A 3FYCA 3TTSA 4BVKA 1S1MA 2VJAA 4DYHA 3KAJA 2GD1O 1E61A 1X7XA 1RYEA 3ROFA 3CIOA 1VJ0A 3C43A 4NECA 4ZRDA 3VJKA 1TZMA 4A1FA 1YRHA 3ICOA 4NYMQ 5JQGA 2EFCB 3FPCA 4JLDA 5F5NA 2ZYDA 2PRSA 4W5NA 2EERA 1OXSC 2JIRA 4D0SA 2V7PA 3DHWC 2LD4A