1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydrodipicolinate reductase
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
4U7WA 2H63A 2D8AA 2WE8A 3BHIA 2BRUA 5J9GA 3AOEA 1PZFA 1NQ5A 3PHIA 4FSHA 1GD1O 4RGBA 2X9NA 2J5RA 4UEJA 4DIBA 4NR0A 1NR7A 3TZKA 1L7DA 4UEKA 3O8QB 3TL2A 1X1TA 3BMCA 3ROPA 3L6OO 4OQZA 5CPFA 4AJ1A 4BO1A 3W4JA 4CQLB 2PR2A 3AOGA 2GN8A 4TMFA 5A4DA 4LGVA 5L4SA 3ZU2A 4DGSA 5EJ2A 3RAJA 3V1UA 3DFUA 1DAPA 4I8XA 4IJWA 4CMEA 4CPDA 4MIEA 5A05A 2A92A 3KM0A 2EJWA 4PLWA 3RC1A 2VRCA 3UF0A 1A5ZA 4YRBA 2NTVA 1I32A 2VWGA 2X5OA 4J43A 5HA5A 5LCXA 3ROMA 2IODA 1FDSA 3HQ4O 4DQXA 5HBRA 1FK8A 1QV7A 1K2WA 5TS3A 4MVJI 2X6TA 1CERA 5JYFA 3VH3A 4AJOA 3DOOA 4D0RA 3E03A 2X7HA 3INTA 2VNAA 2CNBA 1C3VA 1KERA 3PK0A 4E21A 4F6LA 2PZKA 4Q3DA 3ZV4A 4PLZA 1K6JA 3TZHA 1QYWA 2WEKA 1RYDA 1ZH8A 3OJLA 4GGPA 4M1QA 3A4VA 4PRKA 2G17A 2J3IA 4Q3BA 3K5PA 1UP6A 3WMXA 2NNLD 1PZGA 3F4LA 1Z45A 1IL0A 2GYYA 1U3WA 4BV9A 4ALMA 3NX4A 4XGIA 1KY4A 1I36A 4IJKA 1GEGA 2P9GA 3O4RA 2CY0A 4D43A 1C0PA 3BHMA 1KOLA 4LCJA 2O3QA 3GN2A 3L9WA 5I7SA 4J1TA 3VOSA 4HBGA 5A04A 4HUJA 5H83A 3ZWVA 1T4DA 3QJ5A 4OKIA 4IDFA 1UXGA 4TWRA 3U9LA 3PQFA 2ZYDA 3KTDA 2FR8A 4E31A 2XXJA 3CXRA 3IUPA 3W1VA 3MOIA 5KOIA 2WJPA 1H6CA 3NTRA 5C7LO 1M66A 2Q50A 1I8TA 3NV9A 3H4VA 3TSCA 3EZLA 4XQEA 3KLPX 3JQ7A 2YV3A 5EMHA 3ONFA 3PHJA 5TJ9A 1X15A 1IUKA 2HMUA 3GAFA 4D0SA 3ZU4A 1U8FO 1X7GA 3PEFA 4HFRA 3I9NA 4BO9A 1ISMA 1R4MB 2VCYA 4B7UA 4D42A 1TB4A 3RUHA 1GUFA 3E5RA 3BTSA 1E3LA 3NUGA 5JC8A 4A03A 4CV0A 3NAQA 1I30A 3SXPA 4CM9A 1CIVA 3DOJA 2EW8A 2PNFA 5KKAA 1KVSA 4WEQA 1VKOA 4EBFA 1MUUA 4D3FA 2AE2A 1LJ8A 5GY7A 5ILGA 4LCEA 3ASUA 4M55A 5KVSA 4A10A 5FYDA 3L9XA 3VPHA 1X0XA 3P7MA 1H93A 3PFWO 1GQYA 3BTVA 1NNUA 4MVJG 4RPKA 3WJ7A 3WLFA 2DPHA 2NV6A 4CM5A 2UUPA 2Q3EA 1J49A 3NGXA 3KUXA 1R4NB 3HHPA 2YZ7A 4ILKA 2CVOA 1R66A 3NKLA 4I5GA 4XJSA 1V8BA 3MJSA 3W6UA 4DLLA 2ZK7A 2C7VA 1YL6A 3LT1A 2AG8A 4IGEA 2NVUB 2JFHA 1YVEI 4URFA 3PLRA 4A5OA 4O59O 3GEGA 4R1SA 1YBAA 2AHRA 1GUYA 2HDHA 1HDRA 3OEWA 1LQUA 4OJNA 3MJTA 2IXAA 4Z0HO 3S55A 4W7HA 2HMVA 1ENPA 4FOOA 5T64A 1NPDA 4L73A 2NADA 1I2ZA 1UXKA 1E1MA 4YT2A 1WPQA 2PFGA 2O3UA 3VZQA 3FR7A 5K6AA 4GMFA 1BXGB 1RWBA 4CQLA 5H81A 1K3TA 5KJ1A 3QLJA 3D7LA 5TQVA 3DXFA 3DZHA 1B8UA 4YPOA 2Q2VA 2PY6A 1PR3A 2PLAA 4BV8A 1I3MA 2D5CA 2CF5A 4NG5A 1GV0A 2Q49A 4DBZA 1FDVA 1Z75A 3KXDA 5FI5A 3KRTA 4R5MA 1LI4A 4TZKA 3STHA 1X7DA 3VVBA 4ALKA 4L0QA 1G0OA 4N5NA 3C8MA 4GLOA 3WXBA 3M6IA 5EERA 3I4CA 2D4AA 3OA0A 2DKNA 1J0XO 1JKIA 1XA0A 2AQKA 3OIGA 3ZNNA 4MVJE 3SC6A 1IHXA 1UP7A 5BR7A 3ZHBA 1O0SA 2OZPA 4K6FA 3OH8A 2FZEA 1HE4A 3PFFA 4XD2A 3RJ5A 3HNPA 3JQ9C 4JJIA 1HDCA 3IMFA 1LLDA 1ENOA 3F1KA 4HX5A 4PLPA 3F6YA 4HFNA 2BMAA 3HDYA 3KLMX 1E77A 3QW2A 1R0LA 4ND1A 2B4TO 4NPCA 3LLSA 3LSYA 4XYBA 4J0EA 4RDHA 4AFNA 1ZSNA 3CTMA 4W9NC 1JWAB 1E6EA 2Z1MA 3CKYA 4I5FA 4N7RA 3WSWA 4WCFC 1SCUA 3PVZA 3PGXA 4X54A 5FFFA 1GYPA 1QORA 5ITVA 1V35A 1EE9A 2Q45A 1F06A 3WB9A 5JW6A 3JQEA 3DBLB 4M87A 3RU9A 3DZFA 1YQGA 2PD6A 4B7XA 5TC4A 1ZMOA 2GNAA 1M2WA 4FD3A 3K31A 1NTOA 3IJPA 4NJMB 4YJFA 4LK3A 1O6ZA 3Q9NA 3F5QA 4C7KA 3KEQA 4CMCA 1UAGA 2GZ1A 2HQ1A 1VSVA 1QP8A 2AQIA 3PJFA 3IAHA 1WDKA 1ZEJA 3EVNA 4J9VA 4NMHA 4OSPA 1ZO8A 2ZKLA 2G0TA 5I9MA 4GMGA 5L4NA 2YHIA 4H16A 3ENKA 4CQMB 2GRAA 5U4QA 5JC1A 4FFLA 3GY0A 4OMUA 6ADHA 4EUHA 2PWZA 1UDCA 4I5DA 4RORA 4B8ZA 3OIFA 2CVQA 3IP1A 3VKVA 4PZCA 2XPCA 1EUDA 3I9OA 1Q7CA 2R2GA 3JQGA 2HJRA 2GR9A 2ZATA 1D3AA 1EDOA 1NPYA 1N1EA 3JQFA 5F21A 5L7YA 5TT0A 4IDAA 3GUCA 3HFSA 2EW2A 4ZQGA 1E5QA 1IPFA 1OC4A 2ZQZA 4B3JA 1BW9A 4S1VA 4R54A 2GO1A 1NHGA 1F0YA 4WJZA 1U3UA 5F3RA 1UUFA 3JQDA 3U4DA 1PJSA 5AXBA 2IYOA 2O3TA 5I8WA 3UW3A 4YRAA 3K92A 2EKPA 3IDSA 2P5UA 1PL6A 3ONEA 4IGFA 1JKJA 4IDDA 2E48A 3DEYX 3DMTA 3H5RA 3KYDB 1LTHR 3SLGA 1PSDA 3WBFA 3MCVA 5TGDA 3R0IA 5M6DA 2GLXA 4WECA 3AI3A 4K9DA 2DFDA 2JKVA 3H9QA 1Y9AA 3UFXA 4AICA 1OBFO 3NTOA 3HG7A 1J5PA 4UUMA 3ENNA 4UUPA 3ZV3A 3DBHA 3JYNA 3WGIA 2DTXA 4WOJA 2YQ5A 3GK3A 1GL3A 2VQ3A 4GLLA 1W8DA 5A9RA 1YQXA 3CE6A 1W0CA 1ONOA 3TL3A 1UH5A 1E92A 3FR8A 1Z82A 4ZQHA 3ZW8A 1UZNA 4BMNA 4J1QA 4BS9A 1G0NA 2DQ4A 1KVTA 1O89A 3DZJA 4BKPA 2OGUA 1JW9B 3SX2A 2QW8A 1KEVA 3SLKA 4R9RA 1SBYA 2GCGA 3ULKA 5IN5A 4NBRA 2VZ0A 3VTFA 4BO4A 4YCAA 3RFXA 1V6AA 3BMOB 2O4UX 4CLOA 3GHHA 3OQ1A 3ZCXA 2QZZA 4M54A 4ZICA 1PGPA 2I65A 4ZRMA 4CQMD 2VHXA 1NQOA 2IXBA 2VWQA 4IIVA 4KWIA 5ICSA 4EITA 1EBFA 2WYWA 3ZZNA 5HS4A 1JLLA 5ER6A 3CMCO 2CDCA 3DQPA 5COQA 4HKTA 4E2YA 4AVYA 5BSFA 3WMWA 4BO8A 3RROA 4NBVA 1UXHA 2ZIZA 5KJEA 5KJ6A 3WYBA 2DTEA 1EVJA 4XDZA 4DMMA 3QWHA 1TA4A 2EHDA 4NJOA 4O0LA 2Y66A 5GZ6A 1VM6A 3ZWNA 4PGFA 3K73O 3A14A 1P0FA 7ADHA 3TQHA 1Y5MA 2HMTA 4YXFA 4WCFB 3MZ0A 4GPD1 2GN9A 4NFHA 4QFDA 5FWNA 3JD3A 2GPTA 3ETEA 1JAXA 4B8WA 4JN6B 5I7EA 3AI1A 1KETA 4CM8A 4L8VA 2NTNA 2X1HA 1KIFA 1UZLA 5C5IA 2FR0A 4RZHA 2Y0DA 2C20A 5IDQA 3F4BA 1Y8RB 3AY3A 3ZWMA 4BNNA 1ULUA 3AU8A 1V3UA 2VWHA 4I08A 1T2AA 4CLRB 5JYAA 1HTBA 2FRDA 1WNTA 1H6BA 1N1GA 4CV3A 4GKBA 5BSGA 5JCXA 5MDHA 3PLNA 4BNGA 3EGOA 4DQVA 1DO8A 3EMKA 3BMQA 5TT1A 4DPLA 1C14A 3MOGA 1NVTA 4Z0TA 4BKOA 4DRYA 1HYEA 1ZSVA 4Q39A 1U1IA 3M2PA 4B3HA 3FRJA 4HNHA 1AHHA 3D3WB 4LW8A 4CV1A 1LDNA 1LEHA 3I23A 1IZ0A 1YDWA 4J1SA 3KV3O 2UV8A 1GCOA 3R3SA 4LRTB 2ZTUA 2AQ8A 4N54A 3NT2A 1SPXA 1WDLA 3PRJA 3OP4A 1N9GB 1YB1A 2PGLA 2B69A 5T8KC 5B4VA 1DJQA 1F17A 1E7QA 4R4JA 4C7JA 1DOHA 3PTZA 2XXBA 2NU6A 4W4TA 2WWRA 1YBMA 2B5VA 4J91A 4PVCA 4EW6A 3E8XA 1X7HA 2FPGA 1UR5A 1E7MA 1F14A 1VSUA 3F46A 4OYRA 4CM4B 1JTVA 1X13A 3WYCA 2E49A 3COSA 2F00A 5G0TA 4MIOA 3OF2A 2DT5A 3HADA 3F1LA 5IDYA 2VHZA 1YH3A 4RV9A 4DVJA 4GWKA 1PS0A 2AG5A 2Q4BA 3WQRA 2CD9A 1J6UA 3QSGA 3OHSX 1H6AA 3RASA 1QKIA 1YQDA 2VUTA 1PR9A 3CSDA 4L4XA 1IOLA 4YT5A 3RKUA 1R6DA 3BA1A 4O1MA 4BO6A 4P4GA 1TXGA 4D41A 2X22A 3DBVO 4Q3NA 1LSSA 2CMDA 2Y93A 5JS6A 4RO0A 1LLUA 1Y7TA 1WLYA 1PQPA 4MKXA 3LLVA 2LDXA 4YQYA 4IINA 3LC1O 2G76A 1JN0A 2EV9A 4IQGA 1IB6A 3F3SA 3B1JA 2HRZA 3B1KA 3L4SO 1MA0A 4AJ4A 3HZZA 3I9KA 1P31A 2RIRA 4K28A 2AXQA 1R16A 2W2KA 1R0SA 5EESA 5F5LA 4RPLA 1Z73A 4RZIA 1NYTA 5G4KB 2I76A 3O38A 2DBZA 4MJLA 5G0VA 2JJYA 5L7TA 3RUAA 1GQQA 4BB5A 1AXEA 5T5QA 4TROA 3HSKA 1Q2XA 4KDFA 4TVBA 2V6MA 3DONA 5IXYA 1XSEA 1JU9A 4E33A 3O03A 4EJMA 4EI2A 3FNGA 1E3WA 1BXKA 4R1UA 1F8FA 2GN4A 4WLFA 4NI5A 1U8XX 2HMWA 2DC1A 2EJVA 3B20A 5L4LA 2FR1A 4Z3KA 1VL0A 2WSBA 2ZCUA 5T73A 1K6IA 4PG6A 2DUWA 4E5KA 3PI7A 1I0ZA 3AM4A 1ADCA 2Q1UA 3JYPA 2IDZA 2RAFA 3OQ6A 4C4OA 2VHWA 2AEFA 3PDJA 3MJEA 1ULSA 2CF6A 3DHEA 4LN1A 2Q99A 3QVSA 2BD0A 4FC7A 3ZN2A 1T2CA 3S1LA 4ZU3A 2VN8A 1Y8RA 1YL5A 1LDYA 4DBVO 1MFPA 3ZU5A 1E7WA 1VC2A 4W99A 2IE0A 1BHSA 2G1UA 4ROSA 4MKRA 5JNLA 1D1TA 5COBA 1MLDA 4YEDA 3UCFA 5KJCA 3Q6IA 3E82A 3LF2A 1HE2A 1N8KA 4EYEA 3GQVA 1ZFNA 2E6UX 1C0IA 1PWXA 3K9QO 1BWSA 3V5NA 3V1TC 1LX6A 4XEHA 4NU5A 3L4BC 4YAGA 1EFLA 3QV1A 1Q0HA 1V9LA 1GPJA 3FBTA 1GQ2A 2YQ4A 4JJGA 1PJLA 2NACA 2J3HA 1LRJA 2PD4A 1X14A 3D64A 1R0KA 3PPIA 1QYXA 2PK3A 4OSOA 3PQDA 4ALIA 1T26A 2P9CA 1KEWA 3DL2A 2O3RA 4TZTA 4ND2A 1U5CA 5IZ4A 4PCVA 3GPIA 4XWYA 2CDAA 4NNJA 4FR5A 3M1AA 1NFQA 2EEZA 4CM4A 1Y1PA 3HB4X 4NFYA 2HK8A 1XG5A 4J9UE 4Q3EA 2C82A 4YBZA 2X8LA 1UJMA 3FF4A 3Q11A 4BNWA 2HRBA 2P2SA 5I8ZA 3I4FA 3TF5A 4MIYA 2Q1TA 3VPXA 2PH3A 2EP7A 2FZWA 1HWYA 1VKNA 1PIWA 2NU7A 4I1IA 4DL9A 4KOAA 2WD7A 1NVMB 4HV4A 3FSRA 1SOWA 1P1KA 1G6KA 3MTJA 2XF8A 4PLVA 4XCVA 4YJGA 4ALJA 4TRRA 5CDSA 2Y1CA 1T2EA 3VTZA 3RI3A 4GVXA 1M6HA 2HK7A 3JYOA 3TNLA 2W8ZA 4GL4A 4B4OA 4WLUA 4XYEA 5FEUA 2HU2A 5A9SB 5A1TA 1AUPA 4L76A 3LVFO 1HZJA 4W6ZA 2JHGA 1QYVA 5H82A 2V7PA 1XIVA 1ZK3A 3QWBA 5ITWA 1GZ3A 4MDHA 4BB6A 3ZHZA 5G4KA 3RUFA 2JCXA 3Q9UA 4P22A 4P4LA 1FMCA 2E82A 3WGHA 1PTJA 3FD8A 2BFOA 2VT2A 1D4FA 1E1NA 2O4CA 5LDGA 5COAA 4Y8VA 3U5TA 1Q0LA 4D3SA 5JCJD 2DUUA 4QTZA 4QQRA 1EUCA 3D3EA 5IN4A 1OI7A 3L6DA 4OIMA 1YOVB 4GKVA 3FN4A 4ZD6A 1D1SA 5DT9A 4UVHA 1G1AA 4I9NA 4WOKA 1KS9A 3V2GA 1UP4A 1O9BA 5ADHA 3FTNA 3X2EA 1E3SA 4KUEA 4Y9DA 4XDYA 4ZHSA 5ENVA 1T2FA 4RVDA 4XRGA 1B8VA 1E5LA 4D44A 1LDEA 4GBJA 2O2SA 4GWGA 1K89A 2CVZA 5U9CA 2Q2QA 5JDCC 3GGOA 4UVGA 4WCDA 4BMVA 5B4TA 4Y6PA 5G2OA 3W4IA 1MC5A 3K96A 3PWZA 3UUWA 1RYEA 1X1EA 2D0IA 2P5YA 5ER9A 1HRDA 3GNQA 3KB6A 1ZEMA 1LRKA 5L7WA 4NQZA 4UVIA 4DMLA 1PJBA 1U7HA 3WNQA 5DBIA 5I9NA 5G0WA 1XEAA 3D5TA 4ZGWA 4H3VA 2R00A 3QIVA 1A7KA 4BVAA 1C1XB 1CYDA 3SVTA 1LA2A 4YAKA 4UAGA 1I2BA 3GDFA 3H5AA 4BNHA 3ETDA 3T7EA 1XKQA 2PZMA 1WW8A 4RF2A 4RQTA 1RM3A 3GNSA 4QSMA 4PIVA 4BIIA 5CAEA 5L51A 1YWGO 5JCJA 1M6WA 3UVEA 5KNLA 2V6GA 4RVUA 2NU9A 1BMDA 2BFAA 2D5AA 5K9ZA 2DVMA 1Y5RA 4K26A 2H9IA 5IZCA 4XR9A 1A27A 4D45A 2DU8A 3I9JA 3S8MA 4IPTA 2I99A 3WBBA 2G82A 1KC3A 4GGOA 4EJ0A 1Q7BA 4L74A 3VZRA 3AY7A 3ZDFA 3A28A 3ICCA 3V2UA 3UOGA 4LVUA 3VPGA 9LDBA 5AXAA 1NM5A 3ROKA 1GAEO 1EUZA 1ENZA 1EVYA 4FC6A 1QYCA 4AJKA 3KYCB 4CM3A 4E2XA 3BHJA 3K6JA 3OM9A 1NAIA 2D2IA 4YTEA 1N7HA 3U09A 5EQDA 4F45A 3O8QA 3GFBA 1ZNQO 1ZCJA 2VHYA 3D4OA 1IYZA 3RCBA 5JAMA 5KVQA 5CEEA 4PZDA 3NJ8A 4EJ6A 3I6IA 1KVQA 3IQDB 3TOXA 5JBIA 1GTMA 2YUTA 3IOYA 2C7GA 3FNEA 1DIBA 4AJNA 4NU6A 2B0JA 5EIOA 1CQIA 3EW7A 4NZ9A 2IZ1A 5L3ZA 3ZNPA 1E1LA 4D79A 2PGJA 3FNHA 5AXCA 5JSFA 1P3DA 3H9UA 1A9YA 4OO3A 4QEDA 4R69A 2QRLA 1JAYA 4BQPA 4YJHB 1RKXA 3RUCA 3MJVA 2O3JA 2PKQO 2Y0CA 2VWPA 2Z5LA 3JD2A 4YAEA 2UYYA 3HFGA 3ADOA 1BTOA 1QLHA 2FWMX 4RVFA 4TRNA 4BNIA 1GZ6A 5L40A 3WG9A 4INAA 4OAQA 2WYVA 1V3VA 1DPGA 4BNVA 1VLLA 3OIDA 4XB1A 1A72A 3ZV6A 1PS9A 3NYWA 2WTBA 3D0OA 2C54A 4UULA 4CMKA 1VJ1A 4OXYA 3HDJA 3RU7A 4DXHA 5MGBA 4XRRA 4NBTA 2O23A 3CZMA 4UVEA 4OH1A 4FIZA 1DIGA 1SC6A 4BNLA 1DXYA 4DUPA 1Z6ZA 1JA9A 4N5LA 2CUKA 3U3XA 2CDBA 2QRJA 1JDJA 1PZHA 2BFMA 1DLJA 1Y8QB 3FTPA 4GVLA 2Y99A 4A73A 1MP0A 1YOVA 2AA3A 2WD8A 3OEYA 4DA9A 1BDBA 2Q22A 3GVHA 3TWOA 4GSKA 4MPDA 2P4HX 1C1DB 1QR6A 4BUCA 3ON5A 2I5PO 1LDGA 3GHYA 3L77A 1MXFA 3VPSA 4G65A 3WGOA 2AQHA 3RC7A 3FWZA 3OJOA 2ET6A 2O7SA 2NLOA 5G0SA 1NPTO 4CUKA 1PGNA 1XELA 3JTMA 1KEUA 1LC3A 5KJFA 1PL8A 2FN7A 1NXQA 3ONDA 3VHRA 2Y67A 3X2FA 3RWBA 2FPIA 2E4AA 4R3NA 1ZVMA 2FSSA 4GI2A 4XIYA 1QV6A 2HCTA 3I52A 1M75A 4BKUA 3GN1A 2NQTA 4FDAA 3TFOA 4BOYA 5JYEA 5C3MA 2JAHA 5B37A 3DZBA 1GEEA 1ZK2A 1R4MA 2VZ9A 5I7FA 2LDBA 2JL1A 1V0JA 3UCXA 1LUAA 2V6BA 1E7YA 1LSJA 2YV1A 4TKMA 1B3BA 3RFVA 1Z74A 3H8VA 2QYSA 1BDMA 2PGDA 4PG5A 3AWDA 2IEDA 1S6YA 3CIFA 3ASVA 3WWYA 1XLTA 4WASA 2HAEA 4FJ2A 1VI2A 3WR5A 1WWKA 3E9MA 4LRSB 3JV7A 1LDBA 1L7EA 2X5JO 3D1LA 3GF4A 3O9ZA 1Y6JA 1WZIA 2J3KA 3ITDA 3CPSA 1NHWA 5T67A 1HE3A 2DM6A 1R15A 3L4BA 3IUSA 1R4NA 3DHNA 3DMYA 3TRIA 1AXGA 2VOJA 4IQ0A 4LVCA 4BNXA 5GZ3A 3RUDA 1PJ2A 3EAGA 4OQYA 2FOIA 2ZTLA 4BGVA 4XGNA 2Y1EA 5JY6A 2C0CA 2NVUA 2X58A 3TJRA 3AOEC 1LXCA 4OHUA 5DCWA 3ZWYA 3PYLA 1CETA 3BAZA 3LZ6A 1DIAA 4MVJP 3IP3A 1CF2O 3OA2A 2TMDA 4A27A 1NAHA 4LISA 2Q1SA 3G49A 3QVXA 1QLJA 2IYPA 3K2EA 3C7DB 4CLHA 4H15A 1MB4A 3C3XA 1DRWA 1XGKA 3ST7A 2A94A 1OOEA 4Z3DA 4WLVA 1BXGA 4XQCA 4CMEC 2NTJA 4RJTA 4Y6SA 1A71A 3JYLA 1ZZEA 1I10A 2Q4EA 2H6EA 3H9EO 1VJTA 2B5WA 4JLWA 1JWBB 1A9ZA 2ZB4A 1AN9A 2PV7A 2VZ8A 3AK4A 3BTOA 3OSUA 3WTBA 4IS3A 1XCBA 4BNZA 4E32A 4Y98A 4P38A 2C59A 4PG8A 4IUYA 4W82A 3C24A 4DYVA 1YE3A 5A03A 3JQ8B 3F9IA 1LNQA 1B0AA 3GZ4A 2OXIA 1U4OA 1T2DA 1A4UA 1AHIA 4BO7A 1H6DA 2J5QA 4CL8A 2ILTA 5TLSA 3GG2A 5FI3A 1DJNA 3OJ0A 4B4VA 4TVOA 4BO5A 2PKQP 4JGBA 1YL7A 2NVWA 3N7UA 5KCZA 3INGA 1W73A 5CDGA 3AUUA 3HN2A 5IDWA 1E1KA 4JROA 3H9GA 4J7CA 4CMIB 3GEMA 5B4UA 3EHEA 3QVTA 5DF1A 4IJVA 1EBUA 3S2FA 3ZHYA 4Y67A 1IULA 3PIIA 4L9RA 2NVBA 1DFGA 3GRPA 4JK3A 4Y6RA 3TZQA 3GFGA 1I2CA 2OMEA 1B8PA 1WMAA 3KBOA 3NEPX 4AJEA 1IE3A 1P1JA 4QT0A 1UAYA 4HY3A 1H2HA 1JVSA 1SAYA 2FP4A 2PTGA 3PDUA 2ZB7A 4J1NA 3DBLA 4QO8A 3RJ9A 2UVDA 5DOZA 3ZWAA 1FF9A 1XU9A 3KSDO 5JYDA 1UXIA 3DHYA 5CG1A 4RVSA 3ZNQA 5CDYA 3OICA 4NJMA 3LT2A 3DBRB 2PKRA 3JQCA 2EXXA 1YXMA 3ZH2A 3GVIA 3PJGA 1YS4A 3CINA 3SJ7A 5JDCA 3AFNA 1NWCA 2B36A 4QO7A 1TT5B 4CQMA 4OXKA 4RQUA 1JKFA 1ML3A 1CEQA 2J5KA 2W4QA 2OBYA 3WIEA 2W2LD 4I9HA 4IDCA 3CMMA 3EK2A 1PQWA 4BKQA 4K1LA 4QECA 1BGVA 4A0SA 4JBHA 5IDXA 2P91A 5LDHA 2GF2A 2FSVA 3JQBC 3R3JA 4YT4A 3IJRA 2AEJA 2WE7A 1ISJA 3U4IA 1PGJA 3U62A 3GDGA 3WOHA 1N7GA 4R9SA 4IIUA 1IHYA 1ZUD1 3KHUA 5BSHA 3DAPA 4QUKA 2YHUA 3G17A 4FFPA 3GGGA 4AJJA 4IBOA 1O95A 3FPLA 1PQUA 4WLEA 5IJZA 5JXWA 4J4HA 2X9GA 2R6JA 3LDHA 1HEUA 4FBGA 5ICMA 4IMPA 3QE3A 4KMSA 3FHLA 1P45A 2D59A 3JD0A 3KYDA 4NBUA 5EINA 2JFGA 3TN7A 1QMGA 3TZ6A 1E0DA 3WFIA 4U5QA 2YFHA 2J8ZA 1PZEA 3FCOA 4CM7A 2JFFA 1HDGO 2W90A 4TRJA 1KC1A 4UUOA 3DOCA 4PLCA 2O48X 3N74A 3I5MA 3IL2A 2X9VA 3I83A 1U5AA 2B4QA 4IQ8A 1ZJZA 4QFCA 1HDYA 3DR3A 2B37A 5K6AC 2IZZA 4EDFA 2DAPA 1XU7A 3DB2A 3ZWWA 4JBGA 3PXXA 3UAGA 4AL4A 1B16A 5LC1A 1VJ0A 2ZTMA 3GGPA 4HWKA 4FCCA 3CZRA 4XA8A 2X86A 3T4EA 2W2LA 1ID1A 4CJXA 4UREA 2YDYA 5DBFA 2HUNA 1T4BA 3JQAB 1ISGA 2DTDA 5BNIA 1DFIA 4CLDA 1C0KA 4RL6A 2OFPA 3M2TA 3BMOA 5I7VA 1H5QA 3NT5A 5A5EA 3KOUA 3P2OA 1DC5A 3JQ8A 4OM8A 3I3OA 5ES3A 1UDBA 1U7TA 2C07A 2YDXA 3AM5A 3C1OA 5ENDA 3WQQA 5JMWA 3MJCA 4RVHA 2V6FA 3GVCA 2JD1A 3D4NA 2VTEA 4NIMA 3TDKA 3ZGYA 3H5NA 4BNYA 1OZAA 3WFJA 3JQ9A 1SZJG 4OGWA 5JDIC 1ISIA 3NJ4A 2W98A 3K2BA 4Z9XA 3IKTA 2VYVD 5F5NA 3WLEA 1OC2A 1ZJYA 4DYDA 4FJ0A 2GERA 1U3VA 3RUIA 4GSLA 1J4AA 2AE1A 1OMOA 4W9NA 4PVDA 3ETGA 4E13A 4WCFA 3W4KA 4RPGA 2Y1GA 1WXDA 1ZMTA 2YFQA 4BO2A 1RM4A 4XZ3A 2ZYGA 1B3RA 4WPGA 3M1LA 3OQBA 3VH4A 3PP8A 2OOSA 4TQGA 1XHLA 1HSOA 4W7IA 1L1FA 3D4PA 4G2NA 2P9EA 3LC2O 1HDOA 5KIAA 1YONA 5JAQA 2EP5A 5DP1A 4U0KA 5GZ1A 3WS7A 1SB8A 4UVDA 4DLBA 4FQ8A 5F1OA 4XYLA 4TKLA 4CLRA 2RH4A 4CMJA 1WAMA 4Q3AA 2VYND 1TEHA 4YVFA 1H2BA 4CV2A 4M86A 8ADHA 1LDMA 4G5HA 3A1NA 1DB3A 4FN4A 4TRMA 1LBEA 5BT9A 2QYTA 3BMNB 4PRLA 2H1SA 3WSVA 1U9JA 3BTUA 4R5HA 4F6CA 3E6AA 3TOZA 4CR6A 8LDHA 1LU9A 4FFMA 4JP3A 3D3WA 1A4IA 1E3EA 3GA0A 2ZB3A 3HE3A 3JQFC 4HXYA 3CEAA 4ND3A 3RUEA 1CRWG 1DRVA 3JQAD 3VVCA 2NQ8A 3WICA 4YYZA 4E0BA 1YBVA 2RCYA 3PYMA 1HLDA 1N9GA 3RSHA 2BGKA 2VYVA 2EGGA 1EDZA 3JD1A 3DTTA 1LSOA 1QYDA 5DOVA 2ZYAA 1EQUA 2EERA 3VC7A 1YB4A 4XQ9A 1KBZA 3U0BA 3BXXA 3DZIA 3C7AA 3GC6A 3H2ZA 1MFZA 1K5HA 5JAIA 3ABIA 1PU2A 2XOXA 4KTTE 5TF4A 1E3JA 3DWFA 2HO5A 3PHGA 2D1YA 3I1JA 4YB8A 4E4YA 4IS2A 2Y68A 4GAEA 2B83A 2OO5A 2PA3A 1UXJA 4RCVA 4BNKA 1PWZA 4U0JA 1QG6A 1XWFA 1GR0A 4MVJD 3PHLA 4WK6A 4YACA 2VYNA 1MV8A 2EKQA 3F47A 1B14A 1E6UA 4ALLA 3PYXA 1XQ1A 2X5KO 1HYGA 3PJDA 1CWUA 5HS6A 3G79A 1PGOA 3LT0A 4JX8A 2P68A 4WE3A 3CUKA 3JSAA 4OOFA 5DCYA 1YB5A 2EKLA 1MG0A 5DN9A 4B3IA 5A3VA 2WYUA 3JQAA 4KP7A 3RFTA 1BRMA 2NSDA 1OAAA 4D46A 2ZCVA 1DFHA 2HMSA 4R01A 3WTCA 3A06A 3C7CB 3OBBA 4BGEA 4BNTA 1P74A 3AUTA 3EYWA 2WM3A 1GDHA 1DSSG 1SB9A 3DC2A 4OKNA 2PH5A 3KSZO 5F1KA 1HL3A 4AJLA 2AEMA 1GUZA 1GYQA 1GYRA 4O5OA 1LQTA 1EEHA 5A06A 3NDIA 4IMRA 1C0LA 5L9AA 4CM9D 1IZ9A 4WLOA 3AJRA 3GEDA 3PJEA 2BH9A 4J3FA 4YAJA 3KO8A 4RLHA 5A02A 1EVZA 3Q0EA 1PJQA 2DBQA 4PLHA 3PIDA 4BMSA 2EIHA 4OXNA 2FY8A 4CM1A 1DEHA 1DIHA 3ORFA 5CDTA 3Q2IA 4XYGA 2OP1A 4KWHA 1I01A 1VRWA 3DAGA 1PJ4A 1U28A 3H2SA 4FGWA 1QRRA 5I9LA 3EY4A 4MVJA 1GFSA 4XR4A 4RLSA 1GV1A 5IFLA 3V2HA 1M67A 3RKRA 4BGIA 1GCUA 1I5RA 2ZJ0A 4UEOA 4EEXA 3Q3CA 5HWSA 3WGYA 3KVOA 1H9BA 3QWAA 4DC1A 4RF3A 5BNFA 3VH2A 3LC7O 2OL4A 3NGLA 3V1YA 1SNYA 3H7AA 5KWEA 2BFPA 2NU8A 4YJFB 2QQ5A 2UAGA 2JCVA 4KQXA 4CR8A 3GRKA 4WEOA 3SC4A 4R68A 2HK9A 2BELA 3GPDG 4J7XA 3OMLA 2A9FA 2OUIA 3GLQA 1Y81A 4CL3A 3GMDA 2YHIB 1N92A 1HF3A 5CDUA 1HE5A 3C1AA 4QXMA 4XJTA 4Z0PA 3WJAA 2Z95A 2BI7A 4ND5A 3GVXA 3BMNA 4YJDA 3A9WA 4JBIA 4L4RA 4ALNA 3E48A 4BNMA 3EUWA 1HLPA 1ZW1A 3Q1LA 3JQGB 2Q46A 4JJFA 3KZVA 2E37A 3P2YA 3TZCA 5IG2A 5JAZA 3GR6A 1ENYA 2VT3A 5IF3A 4CUZA 4MKZA 1I3NA 2X0NA 3WGQA 1UZMA 1YKFA 2IEBA 3LK7A 4Q9NA 3UGKA 1P1HA 1BW9B 3RIHA 2TMGA 5JMPA 1ZK4A 3JQBA 4BQRA 3PQEA 3P19A 5T8KA 4E12A 1U4SA 3E5MA 1SOVA 3GNTA 1IY8A 5L45A 2OBNA 2CSUA 4M49A 3B1FA 1S7CA 3ZWXA 4BNJA 4YWJA 3HWRA 1E7RA 1PJTA 3ANLA 3ANNA 1N2SA 1TI7A 4ID9A 1NBOA 1O94A 1DC4A 1F12A 3GH3A 4J6FA 3KEOA 4AJIA 3MWDB 5DZSA 3ZU3A 4PG4A 4B79A 2P4QA 6LDHA 1WDMA 1SO8A 4E5PA 3FPCA 4N5MA 1Y9EA 1P1RA 1R12A 1ZBQA 5JE8A 4AJ2A 4ZJUA 3DBHB 3GAZA 4FGSA 3T4XA 1D7OA 3ZWPA 1T24A 2I9PA 4P8RA 3RC9A 5IXSA 1LLQA 2A35A 2JAPA 4MP6A 3IKVA 1P33A 4XYMA 3RQSA 5JO0A 2GGSA 4GX0A 1MXHA 1DHRA 4FFOA 3G0OA 3H3FA 2BHLA 1HDXA 1EK6A 3R1IA 4HP8A 5CEJA 1MGOA 4J7UA 5A9SA 1WP4A 4GX2A 4IDEA 2DBRA 3C85A 4RF4A 1TLTA 3WGGA 3GZNB 5BNTA 2OP0A 3OFSA 1VL8A 4CLOB 1DAOA 4KTVE 4ZQBA 2C2XA 2HSDA 3KSUA 5CPBA 3MEQA 4WNCA 3BZUA 4E5YA 4NK4A 2YYYA 3L0DA 3NRCA 2QHXA 4ZVVA 2AW5A 4YAIA 3MTGA 4F46A 3WGZA 4ZQFA 3VAZA 3ZHXA 1GADO 2PD3A 1BSVA 4DWVA 1ZXBA 1D8AA 1A7AA 4XX0A 1ISHA 4IZIA 2H5LA 4XB2A 4WNIA 3DAFA 4R3WA 1I24A 5C7IO 1NFRA 2Y1FA 4J2HA 2GUGA 1UDAA 5HM8A 1E3IA 4WKGA 2O7QA 3QA9A 3G1UA 4H7PA 3L6EA 1JVBA 4XQGA 5TNXA 5JDIA 3GG9A 4KZPA 3AM3A 1H94A 3IS3A 1NQAO 4HFJA 1ORRA 2JCYA 3K8ZA 4AJPA 1LRLA 2BGLA 1O5IA 3HDHA 4R41A 2I6TA 5U1PA 5A3JA 1RJWA 1OFGA 3W8DA 1EE2A 2DFVA 2Y0EA 1E7SA 3I6QA 4HADA 3QWIA 3LU1A 4I5EA 1GPDG 1U2DA 4CM8B 3RD5A 4NFSA 2JD0A 4FPXA 5T6BA 4RVGA 4IY1A 4WLNA 2POQX 4LMRA 4BGUA 3AFMA 1XDWA 1DRUA 2GZ3A 3O26A 3ROQA 2Y05A 4U6SA 1MG5A 1KVRA 4EZBA 3U4CA 2EWMA 3NDRA 1ZK0A 1P1FA 3JD4A 4MOWA 1PS8A 1RM5A 1C1XA 4PN3A 2C29D 4NK5A 1DC3A 3ZV5A 4BNFA 4YRDA 2C5AA 2I3AA 3BMQB 3FWNA 4FFRA 4E5NA 1HDZA 1ADGA 1YDEA 1SMKA 5HRUA 3DZGA 3K30A 2WDZA 3PGJA 5TRTA 2GN6A 1Q0QA 4J0FA 3BIOA 1NR1A 2CFCA 5A5FA 4YT8A 5B12A 4J4BA 2I3GA 3JCZA 4MVJM 5THKA 3ZW9A 1IPEA 2BGMA 4KUHA 2B4RO 4MVJH 4GQAA 1DDOA 4FOSA 3E18A 3QY9A 5BSEA 3I9MA 2B35A 3IC5A 1CQJA 1NASA 1F8GA 2HLPA 3W8EA 2O50A 4FS3A 5G0UA 5DDIP 5KVVA 5FF9A 4DTIA 3KYCA 3OJEA 4DPKA 4EEZA 1EZ4A 1HZZA 4BO3A 5KKCA 5TIIA 2GSDA 2QZ9A 3KYBA 1SEPA 4HNGA 1YJQA 3NT4A 2BI8A 4QX6A 3QHAA 1GZ4A 1WMBA 1ONNA 3EDMA 4RPJA 3TPCA 1DC6A 4E2ZA 5TJHA 3DDNA 4GX5A 4EUEA 4MVJF 1P9LA 5CFZA 4II3A 1ISFA 3CH6A 1ZIDA 1WVGA 2PZJA 4IDBA 4E30A 2ZB8A 1NWHA 4N18A 4S3MA 1ZSYA 3G3EA 4E3ZA 2QRKA 4FFNA 1EQ2A 4HFMA 1B7GO 3HJAA 3C1TA 4U6QA 4K6CA 2Q2WA 3NDJA 2RH8A 2WMDA 3GUYA 2QX7A 4GX1A 3FNFA 4P4NA 4CMGA 3DTYA 1DIRA 1N5DA 3R6DA 4JIGA 2JD2A 3D5QA 4YJHA 1AGNA 4BNUA 1GU7A 3LF1A 1CJCA 3PHHA 2BLLA 1Q7GA 1CDOA 1B2LA 1Z7EA 1NX6A 4R51A 4ZRNA 4CLXA 2W2KB 3GZNA 2FPPA 4DIOA 4J90A 2GZ2A 5CG2A 1QXSA 1ARZA 2DLDA 1ADFA 1T1RA 2FMUA 1JQBA 2Y1OA 3GT0A 1X0VA 5L95A 5CHEA 3QVOA 2CZCA 1FDWA 4PLTA 2X4GA 4II2A 4IXTA 2ZQYA 1B15A 4TSKA 1KYQA 2X0RA 2YV2A 1E3WB 1Y8QA 1AE1A 3ANMA 3AUAA 3ZWOA 1TVEA 2QG4A 3PZRA 3UXYA 2O2YA 4BHTA 1C1DA 4LSMA 3ZWCA 3E9QA 5JO9A 1ADBA 3JYQA 4L75A 4XGKA 2UDPA 5EPOA 4ZN6A 1P1IA 3NTQA 1RPNA 3SEFA 4B4WA 2DPGA 2C2YA 4A2CA 4M8SA 4KQWA 1BVUA 4DPMA 5AQ1A 3WGTA 3WYEA 3RVDA 5IAAA 4YQZA 2BKAA 1HKUA 4E5MA 4Z9YA 4ESOA 1NQTA 1EVIA 5ILOA 3GDOA 3B6ZA 4G81A 3RBVA 4OOEA 1VL6A 3VKUA 1WZEA 2VHVA 3AUSA 2SCUA 1KEPA 3ICPA 5EQFA 1P0CA 4PLYA 2R00C 4UUNA 1M76A 5A9TA 2IRWA 3LT4A 3N58A 2X0IA 1ZXLA 2EG9A 1W4ZA 5T57A 3H3JA 3QP9A 5CEFA 5JY1A 1LC0A 4L4SA 3QRWA 2A4KA 5DNAA 3E1KA 1SEVA 2C5EA 4CLEA 4GH5A 7MDHA 2VOEA 1NP3A 4JP2A 1P44A 2I66A 1LSUA 2O3SA 4J2OA 4Z6KA 3RC2A 3UHAA 3U4HA 1ZKMA 3SBOA 1W6UA 2HKIA 1DBVO 1HYHA 2Q1WA 3ADPA 4KUGA 3W8FA 2HJSA 5IZCC 4O63O 4NH4A 3DFZA 4YR9A 1H0KA 4J16A 3OETA 1YO6A 4IDGA 5AVOA 3ZI0A 5C7OO 1BXZA 1EFKA 2BF7A 1XQ6A 4JQCA 1FDUA 4CMAA 5TX7A 2RHCA 2J3JA 3WDSA 4AG3A 5F1PA 3ZWBA 3RBZA 3BYZA 2GASA 5AXDA 4RDIA 2VTDA 5EN4A 4XKJA 4NHEA 3W6ZA 2QIOA 3QWFA 3WNVA 2Y1DA 2NWQA 1V3TA 2NUAA 5JFOA 1R37A 1PEDA 3PWSA 1LLCA 1K6XA 1B26A 4R16A 2GD1O 2JHFA 2OHXA 4BL5A 1YGYA 3H65A 2VUSA 5AOVA 3LQFA 3BMCB 5GMOA 2XAAA 2VUUA 1O8CA 3IIEA 3OJFA 4FJ1A 5C37A 2AMFA 1E6WA 3VPFA 4D7AA 3MWEB 1PL7A 2V65A 2X0JA 4DIFA 3UKOA 3TFQA 4BKRA 5G4LA 5KTKA 2WD7B 5TSDA 2D3TA 1MX3A 4OL9A 3EVTA 1BVRA 4YJGB 5DBGA 2YJZA 4MP3A 4CM6A 3MJ4A 4YA6A 1NFFA 4R1TA 3E9NA 1HT0A 5AYVA 1MC4A 4B7CA 3WIDA 9LDTA 1PGQA 1NVGA 4Z9FA 4CODB 5HTOA 3DO5A 1K0UA 1QSGA 1PX0A 3ITKA 3S2IA 3VDQA 3QQPA 4I9UA 4DC0A 3WWZA 4CR7A 4IZHA 1XR3A 4NDNE 5DULA 5JPIA 3UH1A 4NBWA 3LYLA 3OECA 3PWKA 1EMDA 3ZNOA 3WQSB 3G1TA 2G5CA 4DREA 3EC7A 2I67A 4AJHA 1DHTA 3AI2A 3H9JA 1FXSA 2Z1NA 2ZJ1A 4MO2A 3PZBA 3VZSA 1PJCA 1H9AA 3GVPA 1VPDA 3FI9A 1T25A 4PG7A 3U49A 1ZK1A 3QVWA 4PFJA 4CMIA 4CMBA 4D3DA 4A7PA 4B4UA 3VDRA 4LMPA 3HDQA 4IXWA 4BO0A 4RPHA 4J4TA 2IZ0A 3GOHA 4F3YA 4JCOA 4LSWA 4YDRA 2J6IA 3EZYA 3S2EA 4FB5A 1HSZA 2EF1A 2VRBA 4DQUA 3UICA 4DLAA 4R1NA 1FJHA 3AW9A 2NM0A 5DP2A 4U8GA 4A26A 1Z7BA 3AU9A 3JQ6A 4IJUA 4FW8A 3HUDA 3UN1A 4KDEA 3JQ7B 3DBRA 1U2GA 4XIJA 4J49A 3VH1A 3SJUA 4M89A 4O6VA 1P77A 1Q1NA 1TT7A 2VNSA 5DCUA 4ITUA 4ND4A 2GDZA 1BG6A 2OORA 5EL0A 3Q2KA 5KVCA 5CP8A 1TT5A 1I3KA 3RBXA 2F1KA 3HN7A 3I9LA 5B1YA 5L53A 2YW9A 1T1SA 2EGHA 2RBEA 2FHSA 1GY8A 4ONEA 2ZTVA 4E2WA 1I3LA 3L07A 3VZPA 4EGFA 5J23A 2PZLA 4EUFA 2VRCD 1XYGA 3UCEA 3AY6A 5BQFA 3INRA 4JNKA 3KETA 3P5SA 4WUVA 1I33A 1HXHA 4ZQEA 1PJ3A 1EK5A 4WGGA 3T7CA 4CUJA 3HB5X 1KY5A 1RM0A 1HETA 1VE9A 3F5SA 4PLGA 3S2GA 4E6PA 1U3TA 4RF5A 2X23A 3WX0A 1KVUA 2UUOA 2DBVO 3GMSA 1DLIA 3FBGA 3DZKA 3V8BA 2YY7A 4MINA 5K0ZA 4ZA2A 4PLFA 3H6KA 4Q3CA 4JXKA 5THQA 4CMHA 3B70A 3DMTC 1YRLA 4PZEA 4MP8A 5JLAA 1ONPA 4IM7A 1FDTA 1YJ8A 2RHRA
chains in the Genus database with same CATH superfamily
5K0NA 4U7WA 3FXAA 3H97A 4QARA 2YW2A 5K03A 2W2MA 3KKQA 3JARA 1TQDA 1NN1A 4J0DA 3R20A 4BTEA 2QRVA 2IF0A 1PO7A 3MK31 4G5QA 4O02B 4WH0A 1R74A 2DP4E 3RT7A 4WXHA 4UEJA 5LUBA 2X8AA 1C3OB 2EATA 1G5PA 4MPJA 2H52A 1HH4A 1E6CA 1KZ4A 1T43A 2MR6A 3C8ZA 3BMCA 3R5FA 1KJNA 1O03A 4OQQA 5CPFA 1GNQA 5J4HA 3C74A 3EH2A 4XI9A 3D2LA 5F78A 1XEXB 2HSWA 1THGA 2DY1A 3AOGA 4A23A 3Q8KA 2YZNA 3TE7A 5L4SA 4MAAA 1TJPB 3RAJA 4B76A 2RCNA 1DAPA 4CMEA 5JAHA 4HSEA 2PV0A 1L4FA 3CLTD 2VYFA 2PXXA 5A62A 4JOBA 3I1YA 5BQPA 1A5ZA 2PZ8A 4LDJA 4EGAA 2ZQ5A 4YFYA 5LCXA 3AX6A 1A69A 2RGUA 5ALPA 3TLYA 3ZIUA 5D1HA 4BQSA 3FBWA 1FK8A 3R8FA 1K9SA 3PF8A 2CWDA 1O57A 4PBTA 3H4IA 4KSCA 5AKYA 1CERA 3PGVA 3VH3A 1Z4MA 4CFZA 3TL6A 4XLLA 2PGXA 3GMIA 2VNAA 4A9AA 2FEMA 3ND9A 1PVVA 4OQFA 3PRHA 3VSAA 1CXZA 3T9CA 3PK0A 4C3UA 1SBHA 3C1UA 3EIOA 1MVOA 2JFUA 3CXUA 3OOYA 1K6JA 3MXTA 4FDMA 3E9CA 4I55A 4L5YA 3TZHA 4C7VA 1FUKA 4JUBA 4GGPA 1NVWQ 4QEKA 3IDQA 3NUQA 1BQEA 3BXEA 1GVNB 3L04A 5LR6A 2G17A 1KNQA 2PMEA 4KNYA 3IE2A 5E3JA 3WB0A 3WMXA 2CXUA 2ZI5A 1ZG3A 1Y34E 1RDFA 2A9QA 1ISPA 2ACEA 2HDWA 3G8CA 4Q47A 4X64B 1IL0A 5HBGA 4O4IF 3K35A 4DCVA 1ZU5A 2HTFA 4FE4A 1I36A 4IJKA 4D4JA 5K45A 1GEGA 5EZ5A 2P9GA 4AI6A 2ZR7A 3NHUA 2H2IA 1NONA 3NIFB 3QVVA 5AESA 5KQSA 1LQ2A 2E21A 3BHMA 4LCJA 4PZ0A 4F5ZA 3HEBA 5BSVA 2CNOA 3GN2A 2UYHA 3DL4A 4J1TA 3VOSA 4YJKA 5D2CA 2XUHA 4HBGA 4FGJA 4FDLA 4BLPA 4HUJA 1FMTA 5H83A 3GXOA 3SZLA 1NRJB 4Z2YA 4JJAA 1DZIA 1GL7A 3FSEA 2HRDA 4OKIA 4PANA 3QVUA 4W1SA 4WKPA 3UMBA 1OW3B 5DXJA 4V3CA 2IHVA 4OQDA 2ADMA 4DUZB 4E31A 2XXJA 3MOIA 1GTVA 3DZCA 3CLVA 4WFKA 3R76A 4OHCA 2O0HA 2IYXA 1H6CA 3NTRA 4ZCSA 1I8TA 3RU3A 4AIIA 3WGMA 1BHJA 4EHIA 1KAHA 3TSCA 5CNKA 4XQEA 5EMHA 3ONFA 1GTRA 1CZLA 4P53A 5IAOA 1RQ2A 3RQIA 2HLNA 5AK4A 3SZGA 4DEVA 5B2EA 4ZT5A 4F7DA 3TD9A 2C9ZA 2FFAA 4DG9A 1PG5A 2XA1A 3DOUA 3ZV7A 5BSKA 1OH5A 2PUAA 3S7ZA 4HFRA 4X8OA 3A9UA 2H59A 2ZDHA 4HGOA 3TTVA 3E05A 4AMVA 2VCYA 3IVCA 3QKSB 1FSGA 3E5RA 1GUFA 3NUGA 4Q9JA 4XE5A 3RUHA 5JXGA 4L5JA 3NAQA 2ZE6A 1RKQA 1J8YF 5NLLA 3DOJA 3FUVA 1YRHA 3DEKA 3L02A 3OURA 1VKOA 3TKLA 4YAUA 3NWOA 1IZZA 3HJCA 4D3FA 1QH1A 4ZYUA 5IVDA 4ZTUB 5GY7A 5ILGA 2EBUA 5SZKB 1X1CA 3CNQS 3QFTA 1VIDA 2H3HA 2CHUA 4ZODA 4WESA 4RHYA 2BEVA 4AZSA 5CFLA 1XVIA 1TUIA 1NNUA 4MVJG 1DU4A 4CM5A 1C1YA 2DPHA 1NDUA 3F49S 5DXFA 5TQJA 1A9TA 1J49A 3E2MA 3KUXA 2NZJA 1D4OA 1USWA 4EQZA 4A5SA 3TDNA 2WHPA 4ILKA 5IDVA 4ZT7A 4D97A 3G9TA 3NWPA 4HMQA 3R24A 1HQCA 3OIWA 3U7EB 3DHVA 2C7VA 2V7QD 1MB2A 4OV6B 4EP1A 1RKUA 5LJLA 2GYVA 2AG8A 3LFHA 5EZSA 4C6SA 3DL7A 5BSRA 3ZJ5A 1XZDA 1Q17A 2HBQA 4DUGA 2JFHA 3DE6X 1ZQ9A 4A5OA 3GB9A 1JXAA 4R1SA 5AM5A 4W8HA 5HJ2A 3WJ2A 4I2NA 1W9MA 3KNZA 3MJTA 5JS1A 2O7NA 4OD0A 4W7HA 4Q34A 1GPBA 1KDZA 2J7PD 2NADA 5EE3A 1UXKA 4CIWA 3CNBA 3VVMA 4C1NA 4YT2A 1WPQA 3NQ41 2PFGA 3SC2B 1XVAA 3MERA 1LZLA 2GAAA 5DJ5A 4U8HA 2HPHA 4O2AB 1V5WA 4GMFA 3KUDA 3A6LA 4KI7A 4NMMA 5HRCA 1W25A 4F86A 5H81A 3HWX1 1QFSA 3NXSA 3D7LA 2B8JA 3D7KA 3IURA 5TPWB 3FGPA 3P71T 1CJTC 6REQB 5D7NA 4BV8A 1D6MA 1VLQA 1PR1A 1YS1X 4EW2A 4LRQA 1QAOA 5KAPA 2EBHX 3VRHA 3X2SA 3PICA 3CZ5A 4N12A 4ALKA 4UQLA 2JH9A 1W1WA 2BCJQ 3UHFA 5JH7B 5EYPB 3C8MA 1MVLA 4GLOA 3G82C 3MAJA 3LBYA 3M6IA 6CHYA 3YASA 2QQEA 3TTYA 3PR2B 4TN5A 1UJCA 2I55A 1XA0A 2NPFA 3GRRA 4MVJE 3OZAA 5J47A 3O7WA 2PH1A 4F92B 3HKCA 2EQBA 1VJGA 1FFHA 3HBAA 2VUHB 2IEZA 3ZOZA 5HMLA 3PFFA 4XD2A 4OP2A 5AVWA 4Y9TA 2C9OA 2ZWVA 2NYAA 2FN8A 1VLVA 2V7QA 3KOXA 2VXOA 4PLPA 1IU9A 1SUCA 3N2EA 1ORWA 1B8OA 3NZEA 4MIKA 4UPEA 2B4TO 3JWIA 4IUCS 4NS1A 4XYBA 1EFRD 4P4SA 4TWJA 3VFDA 1Y48E 2XWJI 2G07A 3N39C 3CTMA 4AFNA 1EK2A 1ZRMA 4UFOA 3WLJA 4B4KA 1TUBB 3PC3A 1MAHA 2X8JB 1KMCA 3BQNB 3MGCA 4QHTA 2ZT6A 2J7PA 2ZJ7A 4NKRA 4QD3A 3M83A 1T9CA 1Z2DA 4GT1A 1V35A 1MPXA 2FP4B 3WB9A 1U5BA 2FZKA 3DBLB 1LS6A 1YQGA 4U2EA 4UU8A 5LP6A 4RLQA 1O0BA 1U3GA 4RJLA 2NQ2C 2G09A 2ODTX 4JDUA 4NJMB 3W2FA 4I3FA 1TF2A 3TSOA 2D4HA 3C3KA 1C7JA 2RG7A 3AFIA 3HYLA 1VI6A 5DEOA 3PJFA 4G5SA 5C9ZA 3AEQA 5CLFA 2QRPA 1ZEJA 3QXSA 2C00A 2Q5JA 1AH2A 3EVNA 4J9VA 4DCPA 2G0TA 2R5NA 1ZY2A 2PJDA 2IGBA 2PL1A 4F84A 4EY7A 2Y2VA 4KFRA 5FWDA 2GRAA 3OT4A 1RJFA 3RAPR 4BZWA 2VHQA 3LFUA 4XUCA 2YS7A 2QR3A 1QYIA 2ZBVA 3OIFA 5AJXA 3H0KA 3ZZ0A 2XPCA 2GPWA 1E1YA 1SZCA 3ZBPA 3M49A 2QWXA 1UFKA 5BWMA 4DAOA 5AWFC 2ECKA 3JQGA 4E46A 2EKZA 1NXTA 2B0CA 4OHBA 1NPYA 1P7PA 5ITZB 4IVRA 4LOHA 2ZI6A 5L7YA 3SJAA 1KI1A 4IDAA 4X3OA 4GR9A 5HEKA 2WB2A 3B12A 3LIPA 4ABTA 1OC4A 2ZQZA 3G9QA 2OV1A 3WKAA 4MYHA 2FWJA 2GO1A 1IQRA 3FPEA 1EFRA 1T0UA 1NHGA 1F0YA 1Y3IA 3CWCA 4H6WA 5E7QA 4IFTA 5FBRB 3OC6A 1PJSA 1D4AA 1EESA 2PIDA 3A1UA 2ZRDA 3FRIA 2I8CA 3E2PA 1GNLA 2E5FA 4G86A 4GG1A 5ERXA 5JNTA 2X5XA 3JQPA 3K92A 5FA6A 4B32A 1GZSA 4HC4A 1SRRA 1PNQA 4IGFA 4XWKA 5KNBA 1D0SA 4LJ5A 3WLAA 1VBNA 5E8JA 2E48A 4UM5A 3H5RA 2Z4RA 4ZU1X 1LTHR 4K05A 1FZQA 1L7PA 5LOVF 3MCVA 3I5UA 3PNYA 2OO5C 5JZBA 2GLXA 2JKVA 1ZWLA 3DVSX 1Y9AA 2BMDA 3CUYA 3E7PA 3HP4A 1J06A 4GZ5A 4QDOA 3BWBA 3NTOA 1E60A 3GFQA 5D01A 5JG7A 1BXRA 2QQFA 3PI6A 4UE6A 1XXHB 3DTNA 2Q3LA 1ZH6A 3PQ8A 2ANCA 4N3GA 4LV5B 4N7BA 1TU0A 3DM9B 2JK1A 4O25A 1AMNA 2YQ5A 5IT5A 1UQRA 1OWPA 4WBXC 4F7WA 3KGDA 4AF7A 2O8NA 1YQXA 3CE6A 2QI9C 4RULA 1ONOA 4QJBA 1UH5A 3T4PA 3FR8A 1BH2A 3QVMA 5GTDA 4JQOA 1ATIA 3HBMA 3TJMA 1EEXB 2DPYA 1VKHA 3LQKA 4J1QA 5T41A 4UDOA 3T5AA 1AGRA 1NTRA 1OVGA 2FTKE 1JALA 4FHCA 3ZI4A 1ZLYA 1RVV1 1JW9B 3SX2A 3SLKA 2AK3A 2WTXA 1W87A 2PMBA 2ZUWA 1WXXA 3BG5A 5IN5A 4NBRA 1L5GB 3BPSA 4MULA 3VTFA 1RXEA 2YKGA 2ZUSA 4UZEA 3OLXA 1V6AA 4K5QA 4LXTA 4R8RA 3BMOB 4YCCA 5KOJB 3GHHA 2WA2A 1KFJB 3G8AA 3MWYW 3ZGZA 4M54A 1XMPA 1L5YA 1MAAA 3EHDA 3L6RA 2ZIUB 4Y9SA 4E2FA 1RWMA 2VAPA 3I6ZA 2HCRA 4Y1RA 3M1IA 3KG2A 3ETLA 3VDMA 3W5VA 2BKEA 4KWIA 3TGPA 4Q66C 1CTQA 4I14A 2RHTA 4PHTA 1JLLA 5BV2P 4RZ3A 3P0RA 1X80A 2WUVA 5TPZD 1T9GR 2CDCA 5BSFA 4HKTA 3ZVMA 4L08A 2VA8A 1RLJA 3TRDA 4URUR 2ZIZA 1KFBB 3U31A 3WYBA 2BBOA 2O19A 3D6JA 4DMMA 3EXHC 2X76A 2FMHA 4I4IA 2Z8XA 5EXEA 3V8QA 1ZD5A 3I58A 2OHFA 3KL4A 4NJOA 1GRNA 1Q0TA 1RXCA 3HBNA 5GZ6A 2BCEA 4RVOA 3ZWNA 3ESYA 4I0WB 3K73O 4NZZA 5J2TA 1I6MA 3DMNA 4LZWA 3OESA 4B85A 1OE0A 3EP7B 1WV1A 3IAUA 7ADHA 4QFMA 3GAAA 3KZKA 5E3IA 1CEXA 3A11A 1E4EB 4LOJA 5EE5B 3MZ0A 5E7MA 4GPD1 5FWNA 3ESDA 2YWJA 4NBTA 4QQKA 2P6PA 2GPTA 4XDGA 5I6DA 3PFCA 4BWGA 1NBEA 1JAXA 2FVXA 4FS8A 4DB4A 1SKUA 1HBJA 2XOKD 2XDYA 4GXNA 3HYRA 2C7QA 1KRWA 2NTNA 1G16A 1A4XA 1U9IA 1NRXA 1JQ3A 2F48A 2RDMA 3C15C 3OZ7A 4KPEC 2QTRA 3CO0S 4MW0A 3F4BA 3IQXA 4RTQA 1Y8RB 3F6SA 3PU6A 2Q4TA 3AY3A 3ZWMA 3PLAE 1W4LA 1T2NA 3L7NA 2R8RA 4RD0A 2XQJA 4FEGA 4OAPA 1S3IA 2PT5A 1ZH4A 1T2AA 2JW5A 1ZJ6A 3EQ2A 4CLRB 4EPRA 3TG8A 1C0EA 3PUKA 4MUJA 2OFWA 1IHUA 1ZUWA 1N1GA 1NW7A 4J0KA 3UJ7A 5BSGA 1IWBB 2G9NA 1I94B 4LGMA 5BNZA 2W2QA 2A33A 2HFKA 3CLKA 3EXEB 3WLOA 4DQVA 3EMKA 5JXHA 5LKRA 2I80A 3BMQA 1C4OA 1LK0A 3IVAA 4LWZA 5DKFA 3Q8WA 2CNNA 3OJCA 1V1RA 4DRYA 5LLDA 3MQ4A 5CDFA 2V8OA 5LYYA 4EGCB 3M2PA 4LW8A 1AHHA 1IN6A 1VDZA 2YINC 3FW1A 1W34A 3ER6A 3KC2A 3M4ZA 5CH5A 5TPZA 4CG0A 1LEHA 2AW3A 5CT4A 1YDWA 2UV8A 4WVFA 2CJWB 4NCBA 4LRTB 1O6BA 3AH8A 3N7AA 4G4IA 3Q1KA 2E85A 4R9VA 3LWDA 5AI8A 1G3MA 2B34A 3U7HB 2C4VA 4MR9B 4W8GA 5EXTA 5B4VA 3AP1A 3QXXA 2CYCA 3VAYA 1DJQA 2YVUA 2RGDA 4AKTA 4D5GA 3T0GA 3WB2A 3WL5A 3GT3A 4HN2A 1LBQA 1HT1E 3O73A 4C7JA 3FSJX 3B13B 2I4RA 3DGEC 4HPXB 2OZKA 5FO0A 3EDOA 2DCUA 5KQPA 2EYUA 2GZMA 4EW6A 3K3PA 1X7HA 2FPGA 2D1FA 3EEQA 3FUCA 5EJ6A 4DARA 3COSA 3WYCA 1N6KA 1Q0SA 3MRVA 2F00A 3BK1A 3MTIA 5ILQA 1V25A 4XW2A 3DB1A 4Z2AA 2DT5A 1YZ3A 1ILWA 1I1NA 4CVNA 1JG6A 3LCVB 5IKOA 3TX2A 1YC2A 2XOKA 3WK5A 2VHZA 4DVJA 4TTAA 4GWKA 1SUEA 1U1GA 3BDAA 5EFZA 4JIMA 4JBYA 3NIDB 3SGLA 4DLKA 1MOPA 3TMAA 2Y9PB 4NBSA 2HCFA 1QIDA 3OHSX 4UUMA 4DLNA 2P4SA 1H2XA 2C7RA 2ERYA 2OYRA 2XT0A 3DDCA 4X1IB 3U7RA 1CHDA 1O9GA 1LI5A 1V7CA 2VUTA 3LHFA 3CSDA 4YT5A 4A0QA 2FPWA 2GRUA 2Q8PA 2GPBA 2GF9A 1R6DA 3BA1A 2NT3A 3GJ8A 4EFDA 1TXGA 4KC0A 2ZBUA 3VC2A 2FXVA 3GO4A 3RR2A 1JIKA 1RP7A 2WOJA 1GTG1 2OAEA 4G1VA 5LIPA 3NTXA 1Y7TA 4US0R 4F04A 3DO6A 5JATA 2GFIA 1PQPA 4MKXA 2EFHB 3NHFA 3PXEA 4UAUA 3TLXA 1RMTA 1L7AA 3ZGLA 4X1YA 4LC1A 1SIWA 2HRZA 3OY7A 2RGAA 1QFXA 2UZ1A 5AI0A 4EW3A 1MA0A 2WNHA 1S96A 4RKEA 3PNPA 4XM0A 2G9ZA 1NW4A 3I9KA 4TTSA 3HRKA 2NGRA 2NSYA 2RIRA 4OY3A 1THZA 4Z1MD 1R0SA 5EESA 2VF5X 3T9DA 3QSYA 1OUMA 1HURA 2A14A 4RZIA 5G4KB 1NYTA 5C46F 2I76A 5CBPB 1J8MF 3IUJA 4XB6B 3ROFA 5CXSA 2JJYA 1ZGJA 1TAHA 3IMGA 4QXAA 2WM9B 4LQDA 3CV3A 4WADA 1KMHB 2JGNA 2YXEA 2F17A 4TROA 2IX9A 4NRDA 4LF8B 4TVBA 4ENWA 5IXYA 3MAAC 3A6GA 2XVYA 1JU9A 4IKPA 5P8WA 2NN3C 4OQEA 3UK0A 1KS2A 2VJNA 1E3WA 1BXKA 3FOAA 1F8FA 1FSSA 1G5FA 2BSXA 4KLRA 4KMMA 1F7UA 1W4CA 3PC2A 1XVTA 4RX1A 3W9SA 1U8XX 2DC1A 3UH0A 5CT6A 1UQTA 2VIIA 4Z3KA 2OFFA 1TK2A 2H2AA 2ZCUA 3A6JA 5T73A 4FKBA 1YTUA 3I2HA 1NVDA 5A2GA 2QG6A 4ENPA 2MYUA 3GGDA 1Z5OA 1DBRA 1I0ZA 3JWEA 3CRNA 1XDSA 3BJRA 1PR4A 1ZOLA 2CYBA 3VKFA 2G9RA 2P3OA 4R9NA 2HU8A 5L3QA 2XT9A 2RAFA 3I8XA 1UBCA 2BBSA 3OCJA 1BKSB 5K3DA 2IWRA 4OGLA 2ZITA 3CJTA 3Q7EA 1X8KA 4NCIA 5D6NA 4LN1A 1B6GA 1FP6A 1K7SN 3ED5A 2BD0A 3B3JA 3M3HA 2P79A 3NW9A 4I5IA 1XE3A 3VR6H 4CKBA 3CZPA 3EPBB 3A1CA 1ZIYA 1J97A 1HE1C 1YL5A 1LDYA 5JPCA 1P8AA 5KYKA 1MFPA 2AOXA 3ZU5A 1E7WA 2FCAA 2XIJA 3HCFA 1BHSA 3COWA 3E9ZA 3DFIA 4Z1MA 3BBLA 4TL8A 4DCJA 2JIBA 3DL0A 4R40A 1PT8A 3H9BA 5KJCA 1FEZA 3NBKA 1HE2A 3QFSA 4GKAA 1K0FA 2QAJA 4POAA 2GJ9A 4O2AF 3QLUC 2EWVA 2Z08A 1RXIA 1PZMA 2BMFA 3PDIB 2IQIA 2A1UA 2E6UX 2W5UA 4WBNB 2I33A 2R6FA 3C4JA 4G4SO 3DO8A 4R71A 1LX6A 3F67A 1E58A 3TKYA 3L4BC 3MFYA 4HTFB 3QV1A 3TM4A 2HREA 4ZO6A 4R2IA 2HZBA 3DNMA 4CQJA 4TVSA 1VL5A 3T7DA 3NNDA 2GBLC 1SXJC 2PE5A 2BMJA 2M1ZA 4FLEA 4NH0A 2H5EA 1ORDA 4OXIA 4HUTA 4DNXA 3CVYA 3PPIA 2WTUA 3I05A 1VG8A 3K2QA 4QJ5A 1JEOA 4JB0A 1UAAA 5KHLB 5KI6A 3CLUC 4ALIA 1FS5A 1MO2A 2GJAA 1T26A 3JWGA 4UARA 1AKUA 2CLCX 2P9CA 5E2BA 1PTKA 4M0PA 4PBSA 2GKSA 4N01A 1U5CA 4TZTA 4N9WA 5AHRA 5HNKA 2YJ4A 4IJ5A 5HDQA 5I48A 4AO6A 1IJEA 5KO2A 5C1BA 1MO6A 4RU1A 1GSHA 4L2IA 3RHTA 4I6JA 4A1FA 3EZFA 1WRBA 1DKUA 3D6UA 4NFYA 3IXLA 1T5BA 3RYTC 4O2RA 1AS2A 4FMDB 2C82A 3EDCA 3MSXA 4OHFA 5L3SB 1KOGA 3Q11A 1YKGA 4IIHA 2HRBA 3E0XA 3RV3A 3I4FA 1USVA 4DL9A 2OXFA 5CX1A 1VKNA 4QGBA 4O08A 2A0UA 4K9OA 5MGNA 3D8TA 1EXVA 4HV4A 1W7AA 3FSRA 1IEXA 3QEOA 2ZR0A 1FDRA 2VSNA 1DKPA 2VDWB 4WKNA 4TRRA 1BKYA 2A67A 2JLRA 2WFLB 3IHTA 1BMTA 3T54A 4GHWA 3WYDA 1M6HA 2WPNA 4IDPA 3OLQA 1REQA 4M1MA 4L16A 2IUTA 3W7VA 2HK7A 3JYOA 3TNLA 1QX4A 3TQTA 4YXWD 1M10A 1CJKC 5IT0A 3MD9A 2HA2A 1HFJA 4KQGA 2W83A 1PK9A 3M1YA 5A1TA 1JZSA 4CETA 1AUPA 1ZA1A 3ND6A 4ENVA 4L76A 1XRMA 1DAFA 3FI0A 1K6EA 3O92A 4ZEOA 3S99A 3A7DA 2FSFA 2H1RA 4G0UA 5ITWA 4QU5A 2P9YA 4KSYA 3PVSA 3UPDA 2RGNA 5FP0A 3QPBA 3FTFA 2JCXA 2E0IA 5KQGA 2E82A 2I9KA 2I6UA 2BFOA 1P8JA 2VT2A 4Q05A 2X2EA 3T3DA 4GMHA 3L7BA 5LDGA 1V5IA 5ELMA 2ZJYA 2CHQA 2ON6A 5I7OA 1J39A 4QQRA 4J0JA 4TS1A 2BFCA 2FN9A 2IX3A 3L7DA 4HS4A 1QB7A 1ND6A 1YOVB 1U0HC 3FN4A 4GKVA 1D1SA 5DT9A 3LMKA 3Q3GE 4I9NA 5CYOA 5FBWB 5JNSA 1WR8A 2A7XA 3BIJA 3NPAA 4YP7A 1O9BA 3UWSA 5I3CA 5ADHA 5BOSA 4UMDA 3X2EA 1TADA 1GG8A 1A7UA 1M8FA 3A7EA 3EG5A 4QTXA 1PEYA 4R0NA 4RVDA 421PA 1UC5B 2C31A 1R6UA 3F6BX 3LQYA 1IVNA 2XD4A 2TMYA 1WHTB 3B6MA 3VAAA 4GBJA 1MHMB 4HDSB 2O2SA 1EFUA 1TQ2A 3AEXA 3E27A 1AKMA 3GELA 3STXA 3U0VA 3EGDB 1K89A 4OVKA 4CGYA 2Q2QA 5JDCC 4WCDA 4BMVA 3AYZB 5AM2A 3IWBB 3A9TA 1DBWA 4JI1B 1NMZA 4B3GA 1EJBA 2UZAA 3KCNA 1HG0A 1Q7RA 3U1BA 3IQEA 1F48A 3K96A 3PWZA 3R7DA 4K8OA 3IEMA 2H48A 2WWGA 4YXWA 4QQNA 1J9ZA 2P5YA 3E9EA 4UXHA 1FYWA 2A9RA 1E98A 4UUBA 5CJPA 2RGCA 3KB6A 4TMXA 1JG3A 4I3HA 4DV7B 3IP8A 4WVLA 1U7HA 5HK8A 3SSOA 5I9NA 2VSYA 3DFMA 1M6VB 4ZGWA 2I87A 4BVHA 4H3VA 1VLHA 2YN4A 1JGTA 1I7DA 4WTOA 1WULS 1YR3A 4BFVA 4IXNA 2FSVC 4V38A 1SU7A 2ZUDA 1S7GA 5K8TA 1MQSA 2K5UA 3T7SA 4PGHA 1IY0A 3LJKA 4NBKA 1OWMA 1YIDA 3T7EA 1CUDA 1JEQB 1WX1A 2FFBA 1WW8A 3LVQE 4RF2A 4EA6A 1SXQA 3Q7IA 4P5PA 5DNEA 1XMOB 1V45E 5L51A 1FNNA 1M8KA 1O96A 4LE1A 2VT7A 4JS0A 4WY5A 5AMXA 2IP1A 1Z29A 1D2MA 3OCCA 1FTNA 3EP8B 1BMDA 1SHUX 2BFAA 2NU9A 3MJDA 5J40A 5K9ZA 2MMGA 2ONZA 4X41A 1M0EA 4A8JC 2H9IA 3RODA 5IZCA 1L2TA 4E5VA 1U04A 1QTNA 2DU8A 3I9JA 3M9LA 2R7KA 4NVRA 4C4PA 2SICE 3RPEA 2B4KA 2I7CA 2G82A 3G0GA 4GGOA 2XJ9A 4CKEB 4IICA 3OIYA 3AVQA 3VZRA 3DBOB 2R6AA 3A28A 1IVSA 4MLDA 3V97A 3L1HA 3FMPB 3TNJA 3UOGA 1SZPA 3MMNA 4B7AA 3THXA 4MI1A 1GAEO 4WZZA 1IN5A 2HSJA 3BHJA 4E2XA 1KORA 4IYRA 4EVQA 4RTNA 2PEZA 3IO5A 3NWEA 1JFFA 3CZ4A 2OLKA 3O3NB 4YTEA 4BN0A 1N7HA 1Z47A 5LQUA 4DA7A 4RXUA 2BBTA 4KXWA 3GFBA 2CMKA 3KJNA 1IYZA 2ARKA 2DGDA 3JAWA 4WAUA 4F71A 3RCBA 2VNIA 1TAQA 3W2HA 5KVQA 1QPGA 3DAOA 1XMJA 3H5WA 1A4RA 5AJHA 4PZDA 3P1JA 3WDKA 5AKHA 1H4SA 2QAGC 1XN4A 4HNTA 3NOOA 2WYOA 3HM9A 4QGAA 1Q3HA 2VFAA 1WXGA 1GTMA 4ZZ3A 5LZ8A 3FNEA 3DOIA 5LKAA 1BFUA 3CR7A 4QOJA 1D2EA 2QSUA 4NU6A 1CQIA 4NZ9A 5KDDA 1GKUB 1II8B 1W88A 2IZ1A 3O1JC 1ZMRA 3ZNPA 3A3KA 5HE8A 2HCBA 4R7GA 1PQ4A 1ZNWA 2Z4TA 4GIBA 1J7JA 2W6QA 3B1ZA 1F2TA 2VDKB 3QU5A 2VK1A 4GUDA 4HZUA 1M2VA 2QMZA 4MAFA 4R69A 1QDLB 2FV8A 1JAYA 1DEOA 3N8GA 4JB3A 4LJ6A 4TXJA 1RKXA 1PBTA 2O3JA 2PSSA 2G0AA 2Y0CA 2DHCA 4YAEA 3HFGA 1E6MA 4LNUB 3CJRA 2AYZA 4LJYA 5CNJA 4TRNA 5ALEA 1GZ6A 2OCBA 2H1HA 3MMPA 3QNMA 4H3SA 4JQSA 2HH9A 3QE0A 5E6RA 5EXXA 1DWUA 1V3VA 2WYVA 3FPKA 4OYLA 1ORHA 1K98A 1A72A 4U7HA 4Q48A 2VA9A 2V96A 1J0DA 2J4CA 1NXXA 2C54A 3CWZA 4I1YA 1AQYA 2WSLA 3A0UA 3EGIA 4URYR 5K2MA 3W6NA 1X9IA 3EFEA 4KHZA 3RU7A 4DXHA 5MGBA 5FPTA 4QNMA 2XSZD 4M7PA 2CKDA 4BRSA 1XPJA 3CZMA 3FLMA 4MB6A 1P4GA 1C7EA 2EX4A 1SC6A 4N0MA 1DXYA 3U3XA 1QHEA 1JDJA 1H2FA 2BFMA 4N0QA 4UU1A 3VR5D 2Q6OA 1N5OX 1NW9B 4HMOA 3VI4B 3V7NA 1TNDA 1OTYA 3CUWA 4DA9A 2Q22A 3IQWA 3WLIA 1JU4A 3A58B 4GSKA 4H35A 8OHMA 1SXJD 1ANKA 4M1EA 1QR6A 3RWOA 3GLGB 4ZYWA 4LDZA 3GHYA 1MXFA 4RHEA 5IX8A 3HYCA 4PHFA 3BWVA 1ZC4A 1XMSA 1E2UA 5E4JA 3RG2A 4CFSA 1WQ3A 3FWZA 1VMIA 2NXJA 3CLUD 4S1PA 2NLOA 4IAOA 3PXAA 1EFVB 1FUUA 5C8VA 4R6XA 5G0SA 2R7AA 3V8NA 1NZDA 3AMVA 3ACDA 2FJPA 1PL8A 1NXQA 1P6UA 2Y67A 2XMDA 5CHYA 5LD2B 3RAFC 4K9PA 2E4AA 2QROA 4XIYA 4ZPXA 2O8DA 1QV6A 4QG3A 1UBTS 3SLRA 1CDZA 4F4UA 4ZC8A 3G2HA 1G6OA 1M34A 4XSVA 3GN1A 2NQTA 1LK7A 4O1HA 1Y4ZA 3ORSA 4FFBB 3X1YA 5JYEA 4HEJA 2IUFA 3P27A 2FMTA 1AHNA 1M83A 2Q3CA 3EWAA 1R4MA 2J6CA 2VZ9A 2VYQA 3QG1A 3THWB 1S9DA 2LDBA 2JL1A 4WBSA 5D3MB 3S28A 3QU2A 1FQKA 1N34B 3MWFA 4N41A 1LBHA 2BFEB 2V6BA 3NTLA 3WJ1A 1LSJA 2BOVA 4D9JA 4B17A 2B2NA 1B3BA 1N2BA 1HDEA 1Z74A 3RFVA 2BEJA 4COOA 1BDMA 2V5UA 1ITZA 1CY2A 2NO5A 3K0AB 3LDUA 1YZKA 4ZC1A 4MV6A 1FMFA 1NNLA 3PQ2A 2W2XA 2DJ5A 3I61A 3WWYA 1WKVA 2XSZA 1E2EA 3D6NB 3ICVA 2H17A 4JOSA 1BZYA 4FJ2A 3TDMA 3UV7A 1WWKA 4JI7B 3QLUA 3RVBA 1LDBA 4NX2A 3W5JA 2LE0A 2V4ZA 2Z1DA 3GF4A 2QLTA 3QYPA 3AINA 1O6CA 1E9BA 4LI3X 3UT6A 1Z7WA 1SD5A 2QW0X 5T67A 1LV8A 2DM6A 3ANYB 3BICA 3RS8A 1FYFA 4RM3A 3L4BA 2C8JA 3EXIB 4I4TA 3ZD8A 1R4NA 1ML4A 4MVCA 2BM8A 4IQ0A 3GUHA 2VF2A 3L8YA 3RTEA 2GBLA 1SXJA 5GZ3A 4MAMA 1XTZA 2NSHA 2ZTLA 2A0XA 1PX2A 4XGNA 2FDRA 4GLBA 2WJAA 2Y1EA 1VPTA 4C6TA 3AOEC 1LXCA 4OHUA 2NUAB 3GRAA 1L6RA 5D85A 3ILSA 5B1IA 2O2HA 3H0WB 1CETA 1D9ZA 4BVKA 1WQ4A 2JIDA 1G20E 4OLBA 3OCWA 5DCLA 4A27A 5CMLA 1CUHA 5LZ9A 2I91A 2J9ZB 4KRGA 4LISA 4WRRA 1X19A 4L5AA 1K4YA 5CK4A 3BXOA 1S4MA 1JUDA 1DRWA 2R8EA 1G8SA 5K0TA 4HQKA 4ER5A 1R8JA 3RTDA 3VZDA 3K32A 5CVUA 1IZYA 3FF1A 4OXXA 1GQRA 3UYLA 5IHXA 5K7SA 1ZISA 3PFGA 4BQEA 1OBVA 4P7KA 4DSAA 1A71A 5GWXA 5BUZA 1JDZA 4OJKA 2WKQA 2H6EA 2X0EA 3H9EO 1M8PA 1XVVA 2H00A 3CR3C 4JU9A 5AJTA 4HRVA 1S1CA 2IF2A 2X6RA 2JFPA 1EVLA 2A0FA 2Q8NA 2WDPA 2VZ8A 3ZY5A 3BTOA 4I4NA 1Z56C 2FMFA 5LBTA 3KKMA 4L5BA 4X45A 3WTBA 4C6HA 4P38A 2V0GA 4HQFA 2W6ID 4HAUA 4W82A 3PRKE 4JLOA 1TD9A 3D3QA 2ATXA 4KQ1A 1TZMA 5DGDA 1CY0A 1NU8A 1T2DA 3FYUB 1Q0RA 1YZFA 1I0LA 4YNBA 4L5IA 2OC4A 3ETCA 1IEWA 3ACCA 3K0CA 5DHRA 5HE9A 4FQ7A 2JLCA 4NAUA 5CA0A 4BO7A 4YV2A 3COJA 1WETA 1A1VA 3F6RA 1DBIA 2XXAA 5FI3A 4PYKA 1DJNA 3GT7A 5BXQC 1APBA 4FEYA 4S2UA 1M54A 4WSOA 2KSQA 5H7XA 4DHWA 3WRYA 4L78A 4ENUA 3QLVC 4GICA 2V7XA 1FNCA 2E6KA 3HCOA 3BBPA 2RJ3A 3N7UA 5JQGA 4WBNF 1VKRA 1OXKB 1YB7A 3IQGX 4QBTA 5KCZA 2I6XA 3K4HA 3KJXA 2UZ0A 5AKZA 1MW9X 1IN4A 1P4JA 1X7YB 3IKJA 2AV6A 5BURA 5CB4B 4JLUA 3HR4A 5JIBA 3SF8B 521PA 3WNCA 3T3HA 4BC0A 4JK3A 2H2HA 2VHTA 2WWFA 2Z9CA 4XVUA 2JLVA 5DM1A 1R00A 3PKZA 1IBLB 3DDZX 3OWOA 1PNVA 4BNJA 1RZUA 2FWRA 4J1NA 1YU6A 3PDUA 4QUJA 1RWWA 5DOZA 5JEEA 3PNLA 4QREA 5JBNA 2P41A 1FF9A 3L7YA 2I1QA 1DUIA 4OHYA 1UXIA 3PQ4A 5CG1A 2FE1A 4GYJA 5CDYA 3PEYA 1KH1A 3OICA 5ALYA 3IULA 1VL2A 1LBTA 1XZHA 2C8KA 4A91A 1FQOA 1PT6A 2G4LA 2BFBA 2PPLA 3GT4A 3GVIA 3G0CA 3PJGA 3LBHA 3SJ7A 5JDCA 4K7JA 3JALA 4FMDF 1X9HA 2HJGA 5GPBA 1NWCA 3WV5A 2VF7A 2W6IA 3C0KA 1SR8A 3W2TA 3ETJA 1TX4B 1T5TA 2HF2A 2REXB 2ZIVB 3L8EA 5B36A 4CQMA 2UXCB 1G1MA 1FXUA 1H4VB 1OX5A 2IHZA 4FZ3A 5HG0A 1HEIA 2YX1A 3WIEA 3AVWA 3CQ9A 3ENWA 4N3BA 2XUAA 4FCVA 4QYTA 1O5TA 1ZRSA 4L8LA 5DGTA 3NHWA 4NOLA 3SS9X 3NORA 4IOMA 4EQ6B 5KPDA 1UJ6A 1QTQA 3LXXA 4BKQA 4NOJA 3NYQA 1Z2OX 3F7NA 1XX6A 2P91A 4HUQA 3UOAB 5KYNA 3T3NA 1K92A 5ALWA 1VLMA 3PQ3A 5JLJA 4PONA 2FSVA 4Z4FA 2FG6C 4GOJA 1RC0A 4F9EA 3GRZA 5EJIA 3VO2A 1UXOA 3QI2A 1S89A 1ISRA 1SQ5A 2J5BA 3U4IA 4K2HA 4UDXX 1YBHA 3U62A 3WOHA 2GXQA 4R9SA 4BFUA 4OKSA 1UKZA 1WCWA 4IIUA 2VDVE 1ZUD1 3EFOA 3C98A 5FYQA 4A6PA 2IBMA 1HOXA 2C3PA 2AMJA 2BL4A 2GDJA 3EPRA 3MYRA 3N6RA 3ONVA 4WL0A 3ZHCA 5YASA 4IBOA 1TYAE 5KYXB 1KWKA 2BGTA 1U0SY 4Z4EA 3FPLA 2GZSA 4WLEA 1QWSA 5IJZA 4Y30A 4PFQA 7MHTA 2P11A 1FS6A 2R6JA 2X9GA 5IJ9A 4FBGA 4KW7A 4QBIA 3IV7A 5DW0A 1T36A 4AM8A 4KMSA 3FHLA 2JCBA 2VP0A 1PUXA 4DNQA 5EINA 2JFGA 4F9TA 1E0DA 4XJVA 1Y6RA 4Q6BA 3JARB 2FSGA 2JVJA 3LUDA 1X70A 3SC3A 2QRVB 3FCOA 2YIMA 4GRDA 1OFTA 1W2WB 2JFFA 2W90A 3WIUA 1RRFA 3KOYA 4U2FA 2C61A 4B6SA 1YFKA 1Z36A 3JWHA 1AKRA 2O48X 3IL2A 2RHGB 2XUOA 2B4QA 5LMUB 4O33A 1T9BA 2PRKA 3F5FA 1XNRB 3DR3A 2B37A 1A96A 3UWMA 5JRZA 4ARVA 2R1VA 2C88A 1W6RA 2LUOA 3KELA 2ZTMA 5KQMA 4C06A 1ZJJA 3NYIA 4JSRA 4DLSA 1YA6A 1FFSA 1BCRA 1X2BA 2AMLA 1PLLA 2DFPA 3K0BA 4H0CA 3LPCA 1ID1A 4JLBA 1BJKA 4GPEA 4UREA 4CJXA 3VNQA 1RLUA 2HUNA 4B47A 5K0BA 5BNIA 1DFIA 2QMUA 5H3HA 4S04A 2B6HA 3WWOA 1WCYA 3EJWA 1Z08A 4XVRA 3M6MD 4AMBA 2E87A 3OT1A 5G1PA 3E4CA 2JBAB 1CLUA 3IIIA 1KI4A 3P2OA 2PX4A 1T1GA 1IOVA 2OYSA 1R5JA 3QY0A 2QUBA 4RAQA 4RIEA 4NABA 1L4BA 4M1TA 4DCNA 4Q7QA 4AQDA 2QGFA 1U7TA 1MEEA 5ENDA 5CA1A 1FFCA 2C5FA 5LQCA 2J3MA 2UZ4A 1TVKA 4D9MA 2D54A 4NIMA 2VTEA 2O8BA 3N87A 4ERXA 5JS7A 3GFSA 5BWNA 3WFJA 2Y76A 4EY3A 2AJ8A 1TEZA 4EL5A 3WYNA 4LS3A 4GBED 4OGWA 4LEIA 3LOUA 1ISIA 3N6VA 2MSWA 4JL8A 2VYVD 5F5NA 2OBMA 3WLEA 4PQFA 1DO2A 1MDBA 1P0QA 3NUZA 4PIPA 1MVNA 3S2ZA 4B81A 1U99A 2V4MA 4CCSA 1J24A 1OMOA 3MGKA 4PVDA 4P84A 1KHTA 3W5CA 3HCAA 1J9EA 1L5QA 4WCFA 4AJ9A 1KO7A 4RPGA 1L8QA 4JXZA 3P0EA 4ZCIA 2TYSB 1G5QA 2WU8A 4WPGA 4ZEVA 1UOOA 1ZGAA 2HPVA 4QLAA 4KOEC 3HVJA 3DCNA 3OZXA 5KSOA 3TVDA 1W52X 1XHLA 1L1FA 1ZZGA 3DV9A 3ISTA 5F9FA 1JZTA 2HN9A 4G2NA 2W6OA 3OJWA 4GXRA 4MUHA 4UHFA 3LC2O 4AY6A 1JDPA 2ZRMA 2IIBA 4YQEA 4H9GA 1EM8A 4QUAA 4UVDA 3DPIA 1JDBC 1YASA 4FQ8A 5F1OA 4XYLA 5H9WA 2P1ZA 2RH4A 3ABOB 2XEXA 4B6EA 2JEZA 4CHTA 3HLKA 4YVFA 3USES 5IEJA 4WOCA 1LDMA 4TXMA 4IHQA 4UBNA 8AT1A 4D98A 1M9NA 2QTMA 1LBEA 5JU6A 5BT9A 4C76A 2NZUG 3UQZA