1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
b'MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydrodipicolinate reductase
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
3WFIA 1UZLA 1DC6A 5DP1A 1SCUA 4KUHA 3ROQA 3STHA 4Q3NA 1VSUA 2FHSA 3KYDA 2HLPA 2H63A 1DC4A 4OOEA 5COQA 4RF4A 5COAA 3WQSB 3LC7O 4JBHA 1HE5A 3TL3A 3K9QO 1EBFA 1ISJA 2Y67A 3WBFA 4PZCA 2OL4A 2PR2A 1PGPA 1BMDA 1F8FA 1EVIA 1M76A 2GPTA 4I1IA 4UEKA 3DC2A 1AUPA 4IMRA 4J1QA 1ZK3A 1I36A 2H5LA 5JCXA 3A4VA 3GVIA 1E3LA 4TMFA 1A71A 3H9QA 3PEFA 3ANNA 4CL3A 4RVHA 4IIVA 3WYEA 2DBRA 4JJFA 1P45A 4GAEA 2YDXA 4B4WA 1ENYA 3VZPA 4AJ4A 4BV8A 2F00A 4ZGWA 2DQ4A 1QP8A 3I23A 4U7WA 2CF6A 3GFBA 1F0YA 5KVVA 5L45A 1K0UA 3JQ6A 4BO9A 3DAGA 4TKMA 1HE2A 3TF5A 4II3A 4RF2A 1NR1A 1XKQA 1KYQA 3UICA 1KEVA 1MG0A 4OXKA 4RPKA 3TL2A 2CF5A 2VHYA 4JBIA 4YQYA 1GYPA 5A9SB 3GRKA 3AUAA 3P2OA 1DHTA 3GF4A 3HWRA 3TN7A 3KZVA 1R4NA 3B20A 1TXGA 1ADFA 2JHFA 3JQFC 4E0BA 1EFLA 2EV9A 4BNYA 4EJ0A 3OIDA 4NFSA 4D46A 4EZBA 5JAMA 4RPGA 4CM5A 4MVJF 4XB2A 3D3EA 8ADHA 4PLHA 4DBZA 2YHUA 3V2GA 5KKCA 3JQ7B 3ZWOA 5L53A 4PIVA 3OQ6A 2EXXA 1DXYA 2GN8A 4A10A 3GOHA 4KWHA 2PGLA 3C8MA 1E5QA 3Q2IA 1A72A 1ADGA 2BLLA 2HRZA 3G0OA 3MCVA 1TLTA 1I2BA 3S2GA 4A03A 3E9QA 2UUPA 1IULA 3H2ZA 2A4KA 1K3TA 1FDWA 1EQ2A 1G1AA 4YJHB 3RUFA 2ZQZA 2NNLD 5L3ZA 2PWZA 1ML3A 5U4QA 2AEFA 2QYTA 5IDXA 4GMGA 3W4IA 3KTDA 4I5FA 1ZK4A 3GRPA 1U3VA 3DOJA 3ZWCA 2VRCA 2UV8A 4B3HA 2PD4A 3MZ0A 1YBVA 1ZXLA 5ER9A 5IXYA 3OH8A 1ULUA 2QX7A 4E5PA 3ZN2A 4L75A 4DL9A 2HK7A 4QO8A 3WBBA 1HXHA 4GH5A 3VZSA 2XF8A 5JO0A 2DTDA 3ABIA 3BTUA 3NT4A 3PWSA 4YJFA 3ZNPA 5K6AA 5DF1A 3TZQA 3WNVA 4CR6A 3SXPA 4MVJA 1H0KA 2BFMA 3IP3A 4M89A 1A4UA 3KLPX 1DIHA 2P4HX 1MUUA 9LDBA 2J5RA 4XQ9A 2BGMA 2B5WA 2RCYA 5HTOA 1NVGA 1MXHA 3L9XA 2AEJA 1NQOA 3ZNNA 2NACA 2GN9A 5KTKA 4J4BA 1Z74A 4YT5A 1U7TA 3JQ8A 3QWIA 5A06A 2D4AA 3WSVA 2I99A 5ER6A 3ZHBA 3DZGA 3GNTA 4CMIA 4BOYA 4Z9XA 2GGSA 5G2OA 4TRMA 1X14A 4L74A 3W6ZA 5TF4A 2BI7A 3OF2A 3VDRA 3K5PA 4I5DA 5JMWA 1EDOA 4O63O 1EMDA 1Y81A 1TEHA 3BTOA 3JD3A 1PZEA 3PIIA 1FK8A 5T6BA 4XIYA 3C1AA 3P2YA 4I8XA 1A7AA 3GA0A 1MV8A 2DPHA 2HCTA 2X0NA 5DBFA 2PKRA 1OOEA 4ND4A 4XQGA 3TFOA 3DMTC 3C7CB 4DIOA 1NP3A 3OJOA 4C7JA 3ORFA 3PPIA 1BTOA 4EJ6A 2JKVA 5I9NA 4FFRA 2FY8A 3I5MA 4H7PA 1QSGA 5TQVA 1SEVA 3KV3O 2JCXA 5JYAA 3AI3A 2P9EA 4E5YA 5G0WA 3A06A 3HQ4O 1BVRA 4BUCA 3JQAA 4C4OA 5JO9A 1F17A 3Q11A 4JCOA 2QZ9A 1ZFNA 5EESA 2G76A 3EYWA 2Q1WA 3ZWAA 2VUUA 5G0UA 4BB5A 4FS3A 1ISIA 2O3TA 3VPFA 3OP4A 3VAZA 1B14A 3WICA 1PQPA 4XD2A 5B37A 3Q3CA 4IINA 2JD1A 4ZHSA 2Y1GA 2NTVA 4AJIA 3I9LA 1MFZA 3L4BA 4DYDA 1C0LA 3IKTA 5EINA 2ZCVA 3FD8A 1QYXA 5DCUA 1GL3A 2EJVA 4NU6A 1JWBB 1EUZA 1U2GA 1PX0A 1J4AA 3OBBA 3F9IA 1T26A 2ZCUA 1X7DA 1GY8A 4EUFA 3I4CA 1EDZA 4E5KA 3M1AA 3C7AA 2BGKA 3NTOA 2Q45A 1ONPA 1HL3A 1OMOA 5JYFA 5HM8A 3UGKA 5K6AC 5KCZA 4DTIA 2AQKA 1O0SA 1U5AA 2I5PO 4ALLA 4XEHA 3U09A 3U9LA 3PDUA 2AXQA 3JQ9C 3ZI0A 1LSSA 2V65A 1CYDA 1LQUA 3D0OA 2WMDA 2X5OA 1HLPA 1FDUA 3BMNA 1FDSA 3MWEB 1ISFA 3GDFA 4KOAA 3RJ5A 4HFMA 3U3XA 4JJIA 4YRBA 2BFPA 4PLWA 4WASA 3QVWA 1P77A 5C7LO 4FW8A 2HJRA 3K2BA 1JWAB 4D0SA 1F12A 1NX6A 1B16A 5BNTA 5EQDA 2PD3A 3LK7A 4E3ZA 3LC2O 2A9FA 4QXMA 2VZ9A 4R3WA 2B0JA 4GBJA 4L4RA 1BWSA 3B1FA 3WWYA 1AE1A 1S6YA 1E7MA 1G0OA 4RPLA 4AJNA 1U3TA 3I3OA 3GC6A 3DZIA 3AUTA 3FWNA 3OA2A 5EERA 1YB5A 2JAPA 4RDHA 2OHXA 3DFZA 3TSCA 1O94A 5TT1A 4YAGA 4BNNA 3AJRA 1T25A 1ZVMA 1N92A 3PTZA 5I9LA 1DRUA 4J1TA 2WEKA 4UEOA 5A1TA 4UVGA 3SX2A 1HYGA 1WW8A 5G0TA 5M6DA 2G17A 3DBRA 3L6OO 4YT4A 3ZWMA 4YT2A 3GY0A 4DMMA 4OXYA 1ENOA 1NXQA 1YBMA 2Q1SA 1N7GA 3ADOA 2Q2WA 3TZCA 1AHHA 3JQ8B 4Y98A 4KTVE 3JTMA 4W99A 4HV4A 1W73A 4Q3AA 2X9NA 5IF3A 3DB2A 2IZZA 4AG3A 1ZNQO 1GZ3A 5CEEA 4HFNA 2C82A 3QE3A 5K9ZA 1B8UA 4NH4A 2Y1FA 1HF3A 3N74A 1CJCA 3H5AA 4JP2A 2AEMA 4WLOA 3ICPA 2D59A 2IE0A 5ENDA 1PL6A 1GZ6A 1HEUA 4LMRA 4W82A 4HX5A 3QWAA 5BT9A 4BVAA 4N5LA 1VLLA 3AOEC 3HN2A 1QXSA 4NQZA 3S1LA 4IJKA 4E13A 2QW8A 3GGPA 1Q1NA 5F1KA 6LDHA 1LX6A 2YFHA 1Y8RA 2EEZA 1XSEA 3BMCA 1P3DA 3GHYA 1PQUA 1X0XA 5A3VA 3WR5A 4EI2A 3RASA 4HP8A 1C0IA 4P4LA 5TJ9A 2C7GA 2B4TO 2J5KA 1X1TA 2GASA 3SLKA 3ZWVA 5CDUA 3GAFA 3IL2A 1DSSG 3VOSA 3C3XA 4FBGA 3A14A 5JMPA 4OJNA 4YQZA 1GYRA 2WE8A 2V7PA 5BSHA 1WMBA 4N5NA 4BNJA 4RDIA 4L76A 1E7YA 3NJ8A 1WNTA 3GT0A 3QWHA 4OSPA 1T2EA 2A35A 1PSDA 4CMEC 4PFJA 1BVUA 1VRWA 3PHLA 5EMHA 3JQBA 2BMAA 5HS4A 4QTZA 2O50A 1RM0A 3PVZA 4G2NA 3RROA 1EUCA 2QRLA 1GCOA 2TMDA 4R9SA 3CH6A 4XGKA 2X5KO 1PJ3A 3WFJA 3AUSA 2EHDA 2BRUA 2X58A 3VZRA 2EW2A 1TT5B 4CL8A 4KP7A 2NU7A 4GL4A 4OGWA 1PZHA 3TDKA 4E4YA 5KNLA 2QIOA 2I76A 4MDHA 1DAOA 4FGSA 1EBUA 3ZCXA 1EUDA 2X5JO 3OFSA 4B7UA 2FRDA 3WNQA 3WWZA 5CG1A 3U0BA 2IZ0A 1DFHA 3IS3A 3KSUA 5CDTA 1R16A 1P1HA 4NU5A 3OQBA 4R68A 3IQDB 4OL9A 2P9GA 3PGXA 3H9UA 2W98A 1GPDG 4G5HA 4FPXA 4CMJA 5B4VA 1E1MA 1U28A 2TMGA 3LF2A 4RPJA 2OXIA 2C2YA 1C1XB 1LEHA 1BW9A 5I7FA 2W2KB 1KERA 4EITA 2Y93A 1UXKA 2HAEA 1ENPA 4IZIA 1WP4A 1G6KA 1QYVA 4J4HA 5G0SA 3PJDA 3QRWA 2VYND 4J1SA 4R4JA 1YJ8A 3AU9A 4D41A 4N7RA 5JAZA 4CJXA 3HDQA 1BDMA 2E37A 2OFPA 2BKAA 1LLQA 4J6FA 4R1SA 3DOCA 4DGSA 3AU8A 4FJ1A 1UP7A 4XR4A 3ZZNA 4EUHA 1HYHA 2IZ1A 3EUWA 1WDLA 4YBZA 3WLFA 1D7OA 2NADA 3K92A 4KMSA 4ND1A 3RWBA 4D3DA 1KVRA 4ZQHA 2DUUA 4S3MA 5H82A 1V35A 3P7MA 3IDSA 2D5CA 4BQPA 1K6IA 3QQPA 3VZQA 1HDRA 2CVQA 4BO4A 1Y8QA 1YQXA 2Y05A 3ZV4A 5F1OA 1V3VA 3H9GA 2C59A 1DIGA 2Y1DA 3KEQA 2HK9A 3V1UA 4CQMA 4R1TA 3WS7A 1SBYA 2BI8A 1B2LA 1NYTA 3AI2A 5B1YA 1ZSNA 1DC3A 4GSKA 4F6CA 1GZ4A 3SJUA 4ZQBA 1NQ5A 2G1UA 3L77A 2ZJ1A 3IKVA 4D79A 3FNHA 4TSKA 2EP5A 1IZ9A 1XCBA 2VHXA 2GD1O 5G4KB 4XWYA 3V8BA 3GEDA 1HLDA 3NDJA 1JW9B 4W6ZA 3JQBC 4MIEA 1V6AA 2B35A 4E6PA 2AHRA 4OMUA 1KS9A 4PZDA 4CMBA 3U5TA 1PJTA 3QWFA 2V6MA 1Q0LA 4DVJA 2NV6A 1LC0A 1RM5A 2QRKA 1NVTA 3UH1A 3FSRA 1O95A 1SAYA 1UP6A 4J9VA 3Q2KA 4MOWA 4XYEA 2QYSA 3MOGA 2F1KA 3RQSA 3KYCB 3PK0A 4DLBA 2FZWA 2AQIA 3PQDA 3GVCA 1N9GB 1SO8A 1PGNA 1KC1A 5ITVA 3TOZA 3Q9NA 4ITUA 5KJFA 4GGPA 3ON5A 3BMCB 4PVDA 5JYDA 4FOOA 5TSDA 1PS0A 1UP4A 3PQFA 3NV9A 4CV3A 1LRKA 2VOJA 2CDCA 4J91A 1BGVA 1XWFA 1SEPA 2FSSA 1FMCA 4BMVA 3AFMA 1HRDA 2RH4A 3ROMA 3S2FA 1J6UA 5DT9A 4YRAA 3ZWWA 3R0IA 2C0CA 3QVXA 4NFYA 4GKVA 1JVBA 4J2HA 3Q6IA 1EZ4A 5ITWA 1AXGA 3ENNA 4CV2A 4XYGA 3GHHA 4IJUA 2NQ8A 2B36A 1VM6A 2YZ7A 1HDCA 1GFSA 1JTVA 1PZFA 3BMQA 4FIZA 1R4MA 3IJPA 4CLXA 1Y7TA 4BO5A 1TA4A 2BFAA 2O3JA 4YR9A 3GK3A 4M49A 2W4QA 3E1KA 1NR7A 5CDYA 3O8QB 4ALMA 1DBVO 1PJSA 4CQLB 5F5NA 4HNHA 1E1NA 3PZRA 5DOZA 2VHVA 4BNKA 5JBIA 2UDPA 1UR5A 1YB4A 2VRCD 1I33A 2HRBA 4ONEA 2VYNA 4WLVA 5IDYA 3G17A 1E6WA 5L4SA 1U8FO 4DPLA 1U4OA 1LU9A 2DBQA 2P4QA 3BIOA 2O3RA 2YHIA 3D1LA 4A26A 5I7EA 3TFQA 3AK4A 2DUWA 3DBHB 3H3JA 5FYDA 1CF2O 3JD4A 4O1MA 3ZU4A 1T2FA 1HT0A 3NEPX 3O9ZA 4EYEA 1M6HA 1Z82A 2D3TA 2JCYA 2ILTA 3D5TA 3KSDO 3KSZO 4Z3DA 4A2CA 4F6LA 4CM8B 4BKOA 3CSDA 4HWKA 1ZMTA 2ZKLA 1PS9A 2IXBA 3ITDA 1PJQA 4MVJD 4DRYA 1PR3A 2VTDA 5EIOA 1PZGA 2E49A 4J7CA 4XQCA 3NTQA 4B4OA 1KVSA 1Q7BA 4R9RA 4S1VA 1KIFA 2FR1A 3FCOA 1YE3A 4ZVVA 2V6GA 3WX0A 1QG6A 2YQ5A 2HO5A 1XELA 4M8SA 1HDOA 1JA9A 1ZEMA 3CZRA 4P4NA 1IHXA 4NMHA 4UEJA 5HA5A 4CV0A 4E2YA 4HY3A 1PL8A 1TT7A 4TRJA 3WGQA 2UAGA 2VYVD 3KEOA 1XU7A 4OQZA 3HB5X 3ANLA 4RGBA 3RUEA 3GUYA 1B7GO 4WNCA 3MTJA 1HSOA 3H9JA 3F47A 3MWDB 2P5UA 1DB3A 1VKNA 4QQRA 2O23A 4TWRA 2O48X 3UOGA 3ONEA 4FQ8A 4QEDA 3RIHA 1ID1A 2R2GA 1PQWA 2YY7A 5TT0A 2RHCA 1A9YA 4DBVO 3W8FA 2FPPA 1LLDA 4J90A 4Y6RA 4E12A 2PFGA 3PIDA 3GEMA 3DDNA 4ALIA 4D3SA 2QQ5A 4IDAA 3A28A 2CMDA 4FN4A 3F6YA 3RBZA 3BTSA 1GD1O 2HQ1A 4FC7A 4E2ZA 1PJBA 4EUEA 5A5EA 3WDSA 3DBVO 4QECA 1MC4A 1HDZA 4RV9A 2NQTA 5DN9A 4BNGA 3WMWA 2WD7B 4BNMA 3COSA 4DWVA 4ESOA 4BNTA 3F1KA 4PLCA 1QR6A 5L9AA 1PJCA 1FDVA 2EW8A 1H2BA 2DTXA 1QYDA 1QLJA 1RJWA 1VSVA 4DIBA 1V3UA 1C0KA 2V6FA 3GVXA 3UKOA 4WECA 4ZD6A 4A7PA 4D42A 3JQAD 3ST7A 3KHUA 5EN4A 1KEUA 5IDWA 4GX1A 1LC3A 2WM3A 3OSUA 4RJTA 1WWKA 2Y1CA 3CEAA 3ZNOA 1CRWG 1NFQA 4WEOA 4XRRA 1NFFA 3F5SA 4W7IA 5JFOA 3PZBA 3LVFO 4BO8A 3L6DA 2JJYA 5FI5A 3JV7A 3QV1A 1U2DA 4DXHA 3QIVA 4BKRA 1PWXA 2ZYAA 1B0AA 4KQWA 3FPLA 2GO1A 2ZJ0A 1FDTA 3D3WA 1W6UA 1CQJA 3GZNA 4QSMA 3VH3A 4YJGA 3BYZA 3N58A 4PLFA 2EF1A 2CNBA 1ZEJA 3PHHA 4D43A 3VTZA 1TI7A 3IOYA 1A4IA 2VOEA 2Y66A 4RQTA 4KQXA 3MJCA 4BNLA 1EQUA 4XJTA 2B5VA 4CMCA 3FBTA 1L1FA 3EC7A 4IIUA 4Z0TA 2JFHA 1O9BA 3I9OA 2WYVA 1XEAA 2VWPA 4WEQA 1LDMA 1LSUA 3RD5A 5B4UA 3BHMA 5B4TA 4RVDA 4I9UA 1MC5A 2PH5A 3KM0A 5I7VA 3G3EA 4F3YA 1ZK0A 3GR6A 4PN3A 1R4MB 2VRBA 5LDGA 4L4SA 4GLLA 3DTTA 1E7WA 3EVTA 1BXGB 2XOXA 1R37A 1XDWA 3ZWXA 3BXXA 2I66A 3WYBA 1B3RA 3MJVA 4BGIA 5JY6A 3GQVA 4W9NA 5F1PA 3VKUA 2JFFA 4N54A 2A94A 1XGKA 1I0ZA 4YWJA 1CERA 2PKQO 1E1LA 1KBZA 2IODA 3ZDFA 4NBUA 4U0KA 1QV6A 4CUKA 4IS3A 4WNIA 3V1TC 1DIBA 4E2XA 5BNIA 3E18A 4YAIA 5JS6A 3F4BA 1VJ0A 2VYVA 3R1IA 1I2ZA 3JQDA 2HJSA 1CWUA 3VTFA 1B8PA 4HFRA 2AQHA 2OP0A 5IDQA 4IDEA 3GMDA 4Q3EA 2RAFA 2RBEA 4UVHA 1OZAA 4A73A 1VL0A 4FJ2A 4MO2A 4YEDA 4QO7A 4DREA 2DM6A 3SC6A 4J0EA 5CFZA 2AE2A 1UDCA 1NQTA 4OM8A 2OBYA 4IQGA 3CINA 2VT3A 3TNLA 4NBWA 5T73A 2ZYDA 2FZEA 3KYDB 1KVUA 1PJ2A 5JC8A 2Y1EA 1V0JA 3G79A 4M86A 2Y1OA 3PP8A 3SLGA 4RZHA 2E82A 1PU2A 4Q3CA 2DPGA 4KUEA 1ZH8A 2X22A 3INGA 1Z73A 4OXNA 1Z45A 1N8KA 3NTRA 3NX4A 5TX7A 1BXKA 4XYMA 5DP2A 3KO8A 5AXDA 2XAAA 8LDHA 1YJQA 3DOOA 4LRSB 4X54A 4FSHA 1WDMA 5LCXA 4HFJA 2GCGA 3EK2A 4MPDA 1DEHA 1X0VA 2X0JA 1LI4A 5IG2A 1PL7A 1UJMA 3FF4A 4YRDA 5EL0A 1EE2A 5T8KA 4B8WA 1GPJA 4WPGA 3IAHA 2P9CA 9LDTA 4MVJE 2X9VA 2PZKA 4AFNA 3UVEA 2VWQA 3FNFA 4IDGA 4B7CA 4AVYA 1R4NB 2Q2VA 3ROPA 4WJZA 1IZ0A 3GZ4A 4FDAA 3ZHYA 2X6TA 2BHLA 3V1YA 2R00A 1HE3A 4G81A 2SCUA 2BF7A 3C24A 3DAFA 3U62A 1VL8A 1Z7BA 1NNUA 3RBXA 1SNYA 3WGOA 1SOWA 1H9AA 1P1IA 2IXAA 4ZQFA 2JCVA 3AUUA 1XA0A 5AOVA 1H6AA 2HMVA 1RYEA 2B37A 4IDCA 3H4VA 1D1SA 3Q0EA 4MVJH 1JLLA 3G1UA 3H65A 4II2A 2O4CA 1PTJA 2P5YA 3B1KA 1XLTA 3O38A 1SPXA 5HS6A 1ONOA 1R0KA 1A27A 3RVDA 1IL0A 3DEYX 4IPTA 4YJGB 1H5QA 4WE3A 3OEWA 5KVCA 1GCUA 4RL6A 1DJNA 5BR7A 7MDHA 5I9MA 3O26A 3V5NA 5AYVA 3LC1O 3ZV3A 3E82A 1VC2A 4EW6A 1GEEA 4DIFA 5DZSA 5JDCA 1YL6A 1H94A 2BGLA 1WMAA 1I5RA 1SMKA 1DO8A 4DC1A 3ZV5A 4ZQGA 1Y9EA 2ZIZA 4R54A 2VUTA 4GX2A 3RU7A 3D64A 1M2WA 2B4RO 3LT2A 4QUKA 5COBA 3GN2A 2VQ3A 4JQCA 2VZ8A 4TQGA 3ZHZA 5AVOA 1X7GA 2FMUA 2NTNA 3Q1LA 5J9GA 4YJFB 2FR8A 4BGVA 5C37A 5FEUA 3T7EA 1H6BA 1U4SA 5BSGA 3RC1A 4EGFA 3ENKA 2OMEA 2W8ZA 4JGBA 5IZCA 1I24A 3DXFA 1O89A 2WYWA 3L6EA 4MINA 1E7RA 2BELA 1IPFA 4XX0A 4Z0PA 5ENVA 3DAPA 1VE9A 4XQEA 3U4CA 3ZH2A 2G0TA 3WJAA 4XRGA 1NASA 2O2SA 3JQGA 4TZKA 4B3JA 1I10A 4I9HA 4E5NA 3PJEA 3VKVA 5I7SA 2D1YA 1MGOA 4E21A 5B12A 2FPIA 5JE8A 2PZLA 4CM6A 1E5LA 4YDRA 3OIGA 3VPXA 4BV9A 4E32A 4RQUA 3ZHXA 4LK3A 5T67A 5T64A 1P44A 2ZATA 3GGGA 2Q4EA 3HFSA 3OETA 4MP3A 5JYEA 4OKIA 4BMNA 3TQHA 5LDHA 3WQQA 1GU7A 2G82A 1Y5MA 3QVSA 1LQTA 2Q1UA 4WCFA 4CMIB 1AGNA 5TRTA 4YCAA 4WLNA 4R51A 4ILKA 5JDIA 3L4BC 5KJ6A 2PV7A 3NKLA 5JSFA 2NVBA 1UZNA 4D0RA 4CQMD 4GWKA 4NBTA 3IUSA 2D2IA 1IYZA 1OBFO 3OHSX 1LRLA 1ZO8A 2HMUA 1P31A 2RIRA 4CM7A 2OO5A 1Z75A 1BSVA 1NHGA 2WTBA 3GDGA 4MP8A 1PEDA 5TNXA 5KVSA 1ZMOA 3U4HA 1R0SA 4ZJUA 1JDJA 3GG2A 3U4IA 4JROA 1KETA 1QMGA 2PY6A 2ZB4A 2PZMA 4YPOA 3LU1A 5L40A 3LYLA 4GQAA 1VJTA 5GMOA 4CLOA 1X15A 1I2CA 4NFHA 5DBGA 3QJ5A 2AMFA 3JYLA 4RVFA 3RC9A 3EHEA 3VVCA 1YQDA 3PHIA 3JQAB 4J7XA 3CMCO 3SJ7A 1LDNA 2DT5A 2RHRA 2BH9A 2YFQA 2VTEA 4RF5A 4D3FA 1WAMA 1NWCA 4R69A 2NVUA 2FR0A 1LBEA 5A03A 5THQA 4M55A 2HU2A 5IJZA 3QHAA 1KC3A 1NPTO 2AG5A 4YTEA 3PDJA 3UCXA 1CIVA 3WLEA 4BNWA 3MOIA 4FFLA 5HRUA 4GVLA 1N5DA 2OBNA 3D4OA 3M2PA 4B3IA 2YYYA 2X23A 5BNFA 3KXDA 4PLVA 4TRRA 1ULSA 3ZWPA 3RU9A 1PGOA 2P91A 3EVNA 3DZBA 4IQ0A 2EKQA 5IZCC 1I3LA 1K89A 3PXXA 2DU8A 2FSVA 3DO5A 3PHJA 4HADA 3HDHA 3D5QA 3DHNA 1NTOA 1OFGA 2OZPA 2XXBA 3BMNB 4LN1A 1MXFA 1JVSA 2O7SA 4JLWA 1GAEO 4R5HA 4XZ3A 5GY7A 2GF2A 4YAJA 3I6QA 4CM4A 2CY0A 5KIAA 3GG9A 4IUYA 1CETA 2Y0DA 1TB4A 2DC1A 1R0LA 1HWYA 5G4LA 4AJHA 3RKRA 1T2DA 4JIGA 1O8CA 4ZU3A 5L4LA 1E3WA 1DLJA 1EEHA 1YDWA 5HWSA 1IPEA 4RLHA 1B26A 2CVOA 1BDBA 2Q22A 3K2EA 5DCYA 1GV0A 3EW7A 4HXYA 4U8GA 1F06A 2IDZA 4NJMA 1RWBA 1U7HA 2PH3A 2J3HA 3MJTA 4P38A 1I8TA 4NG5A 3DBLA 1U1IA 3K73O 2I6TA 3GFGA 3JD2A 3SVTA 2VNSA 3I9KA 2GR9A 3E48A 4L4XA 1SOVA 1T4BA 3GH3A 4BNHA 1WVGA 1D3AA 3DR3A 2JD0A 3AY3A 4I5EA 4IZHA 3ANMA 5H81A 3NAQA 1KEPA 3NRCA 4IDBA 1HSZA 3S2EA 3FR8A 2JD2A 5ILOA 3F4LA 5IAAA 4QFCA 3VPHA 3QWBA 1A7KA 2AQ8A 5L95A 4XJSA 3VVBA 3DBRB 1RPNA 4CM9D 2PKQP 5FI3A 5DULA 3B1JA 1PIWA 3IUPA 4BKUA 4GX5A 5CPBA 4E2WA 2IRWA 5A05A 2PTGA 4E30A 2J6IA 3VPGA 5DCWA 4L9RA 1D8AA 1DOHA 5LC1A 3VPSA 4UAGA 1KY5A 3GLQA 2P68A 4J2OA 1DFGA 1GQ2A 1LDGA 4QT0A 5A04A 4R5MA 1JKJA 4QX6A 5IZ4A 5U9CA 4IGFA 3UCEA 4ZRNA 1NHWA 4XCVA 2YW9A 3JYNA 4K6FA 3T4EA 1T24A 1QORA 3RBVA 5AXBA 2D8AA 2ZB8A 1QRRA 1UXJA 4XYBA 1R66A 4PG8A 4XDZA 1LTHR 1K6XA 3ZNQA 1B15A 4RZIA 3WIDA 1E3IA 1I3NA 1GQYA 3E5RA 1PGQA 1U5CA 4FD3A 3JYQA 1LRJA 5ES3A 5A9SA 1XIVA 3ICCA 4B7XA 5CDGA 2H6EA 1GDHA 3BTVA 3E9MA 1Y8RB 4PLZA 5A3JA 2EKPA 4EEXA 1NVMB 1BHSA 4AJ2A 4PG5A 3GAZA 1HDXA 1ORRA 3PFFA 4OHUA 2VWHA 3NDIA 2PGDA 4CPDA 4CLHA 3JQ7A 4AJLA 2DFVA 1E77A 4NPCA 2ZQYA 1L7DA 5KKAA 5JAQA 4UULA 3INRA 1EK6A 2GERA 3FRJA 3PGJA 4LVUA 4OO3A 2C5AA 1H9BA 3MJ4A 5A02A 4N18A 1IY8A 4OYRA 3ROKA 4EEZA 1LDEA 7ADHA 1EE9A 3RC7A 3CPSA 4YJHA 3ZGYA 1LDBA 1JU9A 3D4NA 3JQEA 2JAHA 5TLSA 3EAGA 1VI2A 1Y5RA 3W8EA 3ITKA 3G1TA 3KOUA 4MIYA 3QVTA 4PLGA 4GSLA 3FNGA 4WOJA 3ULKA 4O59O 1IHYA 1AHIA 1P33A 3ZWNA 4D7AA 1SB9A 4KTTE 1YB1A 3S2IA 1FXSA 2CZCA 3JQFA 4BKPA 1Q2XA 1F14A 5AXAA 3F1LA 4BNZA 3OIFA 1ZZEA 5TS3A 4W4TA 1DAPA 1GADO 1YS4A 3NGXA 3VHRA 4FFMA 3WSWA 1UH5A 4NK4A 1I30A 5EQFA 6ADHA 4R1UA 2JHGA 4IGEA 2VZ0A 5CEFA 3DZHA 1J49A 1RYDA 1EVJA 5I8ZA 1B3BA 1LLUA 1U3WA 1UAGA 2PD6A 2X0RA 3HDYA 4IMPA 1BW9B 3ZW8A 4LVCA 1XR3A 2GZ1A 3WGZA 1EFKA 3IJRA 1J0XO 4K9DA 4TKLA 3HJAA 3EMKA 1LJ8A 1E3WB 1H93A 2J3JA 2Z95A 2E48A 1X13A 1BXZA 2Y0EA 4J43A 3RUAA 1S7CA 1HYEA 3VDQA 2B69A 3GPDG 4CM9A 4NJMB 1R12A 1QKIA 3UW3A 3I9NA 4GMFA 1ADBA 2V6BA 4L0QA 4LSWA 4YVFA 2FPGA 4Z9YA 4BQRA 2J3KA 5JC1A 1T1RA 1ZW1A 4KUGA 3DBLB 5G0VA 2O7QA 3I9MA 4INAA 4DLLA 5KWEA 2FOIA 2I3GA 2Q4BA 3FNEA 5EPOA 3EDMA 3FBGA 4P4GA 4CLRA 1DHRA 2VUSA 4DPMA 4PG6A 4O5OA 5JNLA 1KEWA 2YUTA 4XDYA 3RFXA 4GKBA 2C20A 2I9PA 4Y6PA 1Y8QB 1I32A 3KETA 1E7SA 4KDFA 2EGHA 1D4FA 5JPIA 1R6DA 4OQYA 4CQMB 4U0JA 5KOIA 3WYCA 4HNGA 3H3FA 1YVEI 1ARZA 4WCDA 5IXSA 5IN5A 1JKFA 2GN4A 3OEYA 5MDHA 5KJEA 3VH1A 2GDZA 1KOLA 2NM0A 4FR5A 3D4PA 2GNAA 4C7KA 2NTJA 2AW5A 2Y99A 1RM4A 3X2FA 4BO1A 2UYYA 3JYPA 1N2SA 4OAQA 1DIAA 2OORA 3DZFA 3WXBA 4URFA 4YT8A 4R01A 2AE1A 3AM5A 4NR0A 3UF0A 3NT2A 1P0FA 3ETDA 2VN8A 2NU8A 5BQFA 3AFNA 1M66A 4Z0HO 5CPFA 3HSKA 1P0CA 3HE3A 1JN0A 1I3MA 4PRKA 4DC0A 3HZZA 2YV2A 5FF9A 3I9JA 4BMSA 1E3SA 4BHTA 5IN4A 4I9NA 3GDOA 4GLOA 3VH2A 1WXDA 2Y68A 3UXYA 1ZXBA 2I3AA 4KDEA 1ZJYA 4ZA2A 4BKQA 1KVQA 3WOHA 1OI7A 4D44A 3ZV6A 3HFGA 1GEGA 2VCYA 1ZK2A 4FOSA 4CUZA 4TROA 4CMAA 4CV1A 2C07A 2RH8A 3RC2A 3AOGA 3S55A 2WSBA 4WOKA 5ICMA 4Q3BA 3WGYA 2Z5LA 3ASUA 1LSOA 4CMHA 3DMTA 3RAJA 5H83A 3F46A 4IDFA 3HG7A 1MX3A 4Q39A 4DPKA 4JNKA 3VH4A 2ZTUA 2G5CA 2HMWA 2VT2A 2PK3A 2HKIA 1WZEA 3KRTA 4NI5A 4AL4A 4NJOA 2W2LD 4AJOA 3BMQB 4R1NA 2C29D 2Z1NA 2Q50A 5FWNA 3GGOA 3ZU2A 4BNFA 1C0PA 3DZJA 5K0ZA 4J16A 1YONA 2QG4A 3I4FA 3NYWA 2FN7A 3ZWYA 4ALNA 4I5GA 1HDGO 4MVJM 3FI9A 4M54A 2Q3EA 2YHIB 1ZIDA 3DMYA 2J3IA 3UN1A 1YWGO 5AXCA 5CG2A 2NU6A 3CTMA 4Q3DA 1RM3A 2Q49A 3FN4A 3T4XA 1NPYA 1XYGA 1JQBA 1UXHA 2DKNA 5ILGA 1WPQA 4FFPA 4G65A 3GMSA 4XGNA 3R6DA 1C1DA 2EGGA 3QW2A 4YA6A 3JSAA 3JQ9A 4H16A 4ZRMA 4PG7A 3DWFA 3H6KA 3LT4A 1XU9A 4WLUA 4CMGA 3INTA 4MJLA 4J49A 4EDFA 3E8XA 1EVZA 1SC6A 3OJEA 2D5AA 3WQRA 5KVQA 4GVXA 5BSFA 4YAKA 1P1JA 1ZUD1 1IUKA 1YQGA 3I52A 5A9TA 3ZWBA 4P8RA 5I8WA 1F8GA 1X1EA 1SZJG 3WTBA 1E6EA 3A9WA 3E5MA 3LDHA 4PLPA 2YDYA 3CXRA 4AJPA 1PJLA 5C5IA 5JAIA 4KZPA 3EY4A 3HUDA 4OSOA 2YV1A 1QV7A 1RKXA 4R41A 1Y9AA 4AICA 1ENZA 4CLRB 3EGOA 1A5ZA 5JW6A 4K28A 4D45A 3AW9A 3PJGA 2X7HA 3AM3A 4ND2A 2X9GA 4BL5A 1Q7GA 5KJ1A 1NM5A 1W4ZA 4RVGA 3PLRA 3H9EO 1Q0HA 3M2TA 3CIFA 3C85A 4YACA 1HE4A 5KJCA 3WGTA 1CDOA 2O2YA 4F45A 4I08A 4EJMA 3C1OA 4F46A 5A9RA 1GTMA 4Y9DA 1T1SA 4IJWA 3EZLA 1E7QA 3BZUA 1TVEA 4NBRA 2AG8A 3VC7A 3M1LA 4E5MA 4DQUA 5EJ2A 3BMOA 3L07A 4NBVA 5A4DA 1KY4A 3DONA 4BNVA 4H15A 4JN6B 3EZYA 4TZTA 3PHGA 1MG5A 4R16A 3UAGA 3UCFA 4IDDA 4B79A 4BGUA 2XPCA 4NHEA 1DPGA 1YOVA 4TRNA 4PVCA 4ND3A 3H5NA 4HUJA 5AQ1A 4BO6A 4WUVA 3GNQA 1V9LA 5HBRA 3TZKA 1WZIA 1U3UA 3W6UA 2HDHA 5CP8A 4LRTB 1QLHA 4OKNA 4PCVA 1UXGA 4WLEA 1P1KA 3ZU5A 5U1PA 2PA3A 3H7AA 2X1HA 4O6VA 1TT5A 4DYVA 2UUOA 2OOSA 1Q7CA 1BG6A 4MVJP 2GZ3A 3AOEA 3D3WB 3GZNB 1XQ1A 2W2LA 2B83A 2AA3A 3LLSA 2CDAA 3OJFA 3OM9A 3AI1A 4DUPA 4GPD1 2J5QA 1ONNA 2QZZA 4PG4A 1YRLA 3IC5A 3OMLA 3KVOA 4QFDA 4DQVA 1YDEA 4XR9A 4FFNA 2PLAA 4LGVA 3R3SA 2C54A 4JX8A 4LMPA 3E9NA 5JXWA 1GV1A 1K2WA 1W0CA 2ZB3A 1YO6A 4YAEA 4LSMA 3ZW9A 1K5HA 1X7HA 1XG5A 3HHPA 5DOVA 3M6IA 3X2EA 1WLYA 2O3QA 3RKUA 1OAAA 2P2SA 1I01A 1O6ZA 1UUFA 3PYLA 3OQ1A 3PRJA 1LXCA 4CLDA 1C1XA 4Y6SA 1P9LA 2W2KA 2WD8A 2CVZA 3WB9A 4CMEA 2PGJA 3ZU3A 4FGWA 3TWOA 4NDNE 4AJ1A 3QLJA 4W7HA 2O3SA 4IS2A 4UUOA 2JL1A 5CHEA 3HN7A 1T4DA 1MLDA 2NSDA 2VHWA 4GWGA 1DLIA 3RSHA 4RORA 3LQFA 4Z6KA 3S8MA 3B70A 3Q9UA 4RCVA 1C14A 5JCJD 2LDXA 1YGYA 3GVPA 4GI2A 3ETEA 4ND5A 4WK6A 1LLCA 3O4RA 4BO2A 3K30A 1H6DA 4AJKA 2ZYGA 4PGFA 4Y67A 5TGDA 1IB6A 1PGJA 4UUPA 1DRVA 3K31A 4B8ZA 1N1EA 4IY1A 1DIRA 5DBIA 2QRJA 3FR7A 5DNAA 3ONDA 1E0DA 1C1DB 4JBGA 3R3JA 1ADCA 4O0LA 2HMSA 4Z9FA 3H2SA 3DHEA 3MEQA 4N5MA 1BRMA 3LLVA 2YJZA 3SEFA 1YXMA 2ZTMA 4RPHA 3DTYA 1QYCA 1NBOA 1UZMA 3H5RA 5T8KC 4E31A 3IMFA 4MKXA 4UVIA 3CMMA 3KYBA 1GQQA 2H1SA 3RFVA 2NU9A 4L73A 5GZ1A 2VWGA 3W1VA 3SC4A 3DZKA 4IJVA 2R00C 2C2XA 4PLYA 2Q99A 3W8DA 1EVYA 2BFOA 5G4KA 1HETA 4LCJA 4JXKA 1YH3A 5CDSA 1UDAA 3RJ9A 4RF3A 3PWKA 2LDBA 3RUDA 2OUIA 4AJJA 4UUNA 3TRIA 4UUMA 4LW8A 1GUZA 3TPCA 1M75A 2WWRA 4Q9NA 1IOLA 1NPDA 4IQ8A 3OICA 3WMXA 3FTNA 1UXIA 3QVOA 4XA8A 3WGGA 1M6WA 2ZB7A 4ZQEA 5DDIP 4NIMA 5JLAA 3WGIA 1YBAA 2D0IA 5A5FA 3KYCA 3K6JA 3ADPA 3PJFA 1ZBQA 4MIOA 4MKZA 2EG9A 4DLAA 1N9GA 3O03A 4P22A 2WJPA 4U6SA 2IYOA 3DQPA 2E4AA 2Q1TA 4FC6A 4E33A 4J4TA 3H8VA 1NWHA 4HBGA 4CMKA 5JDCC 2CFCA 2UVDA 4A0SA 1NAIA 5L4NA 3NGLA 4BNXA 4NK5A 4NNJA 1LSJA 3BMOB 1WDKA 1VKOA 4BGEA 1MB4A 3FTPA 4HKTA 3NDRA 4GGOA 4IM7A 3LT1A 3QP9A 3W4JA 3JCZA 5L7TA 4L8VA 3RUCA 1E1KA 3ONFA 3ETGA 3JD0A 4NZ9A 2A92A 4UVEA 4YXFA 2H9IA 4J1NA 5TC4A 4RVSA 1YOVB 2WDZA 2X4GA 3TJRA 1C3VA 2X8LA 4CLEA 1HTBA 1PJ4A 4BB6A 3WG9A 2J8ZA 2YV3A 4JJGA 4Y8VA 3PI7A 3PFWO 2ZTVA 2Q2QA 2CUKA 4OIMA 4FJ0A 3T7CA 4DMLA 3RFTA 3WGHA 2QHXA 2I65A 4ID9A 4BNIA 4FB5A 1GR0A 2O4UX 3O8QA 1UDBA 2EJWA 2VNAA 4Z3KA 2B4QA 4CR8A 1V3TA 1OC2A 4CQLA 4K1LA 1VJ1A 2GSDA 3ASVA 1XQ6A 1PWZA 1I3KA 2DTEA 4GX0A 1E92A 4A27A 3E6AA 1YL7A 2EWMA 3OA0A 1AN9A 1NFRA 1Y1PA 2PZJA 5F5LA 2CD9A 4BO3A 3IP1A 4H3VA 3DBHA 2ZK7A 3WTCA 1T2AA 2FP4A 4YYZA 1DC5A 1DJQA 5JCJA 1ZSYA 3JYOA 3P5SA 3FHLA 2JFGA 3DL2A 4WCFC 3QY9A 1OC4A 3LT0A 4LISA 4MVJG 2DBZA 1K6JA 2DAPA 2IEBA 2X86A 5JDIC 2DLDA 4CM8A 2Q46A 1SB8A 1QYWA 1N7HA 1ISHA 1GUYA 2WYUA 4OH1A 5C7OO 4K26A 4WGGA 4XIJA 3GNSA 3KBOA 4XKJA 2I67A 3OECA 3CE6A 2O3UA 4FFOA 3HADA 1T2CA 1HKUA 5ADHA 3G49A 4DQXA 2HSDA 3N7UA 4CUJA 1AXEA 1ZCJA 1H6CA 3RUIA 3K8ZA 5GZ3A 3JQGB 1A9ZA 3QSGA 4LCEA 5L7WA 2CSUA 1CQIA 3MJEA 5ICSA 2HK8A 4KWIA 4MKRA 2FWMX 3PWZA 4ZN6A 4DA9A 1ZKMA 5F3RA 1VL6A 2YQ4A 3DHYA 1ISMA 2NLOA 1W8DA 1YKFA 5FFFA 3F3SA 3PLNA 1NAHA 2EIHA 3WJ7A 4B4VA 5J23A 2VHZA 3LF1A 2EERA 4M87A 4U6QA 2DFDA 1E3EA 1EK5A 1G0NA 4WCFB 3W4KA 5F21A 2GN6A 4ALKA 1ZK1A 4CM1A 4MVJI 1GUFA 4JP3A 1LNQA 4RLSA 1HZJA 3E03A 2C5EA 4K6CA 3U4DA 4RO0A 3HDJA 2NWQA 5THKA 4PZEA 3NUGA 2GLXA 3LSYA 3HB4X 2WD7A 3KB6A 1DDOA 3LZ6A 4FCCA 3L4SO 2IYPA 4RVUA 2GRAA 3CZMA 3K96A 4TVOA 5TJHA 2EP7A 1P74A 1Q0QA 3L0DA 3NT5A 2C7VA 2IEDA 1UAYA 4A5OA 2E6UX 2DBVO 1P1RA 2X0IA 2GYYA 4EBFA 1VPDA 3GVHA 4CLOB 4AJEA 1CEQA 1FJHA 2DVMA 3GN1A 1FF9A 3TZ6A 3AM4A 3BHJA 3P19A 3TZHA 3PYMA 2EKLA 1PR9A 5GZ6A 4IXTA 1P1FA 1LUAA 4WLFA 2POQX 1JKIA 4OOFA 2HMTA 4YJDA 3FPCA 2NVWA 2NVUB 1DFIA 3JQCA 5BSEA 3OJ0A 4CR7A 3TOXA 3RCBA 3UHAA 2XXJA 3JD1A 3V2HA 1M67A 4IXWA 4CM3A 3BAZA 3AWDA 4IBOA 1Z6ZA 1ISGA 3I1JA 4UREA 4YB8A 5L7YA 4BNUA 2R6JA 3CUKA 3UFXA 2PNFA 1ZJZA 1GYQA 4B4UA 1IE3A 1D1TA 5T5QA 3B6ZA 1H2HA 4WKGA 4J0FA 4ALJA 1ZSVA 1R15A 1HZZA 3NJ4A 3IIEA 3I83A 4ROSA 3KLMX 5IFLA 1N1GA 4PRLA 1JAYA 1KVTA 1U8XX 1Y6JA 2W90A 4BO0A 4BS9A 3OJLA 3I6IA 5CAEA 3QA9A 3RUHA 4XGIA 4MP6A 3BHIA 3GEGA 1U9JA 4BIIA 1B8VA 3C1TA 4ZICA 4W9NC 1LA2A 1BXGA 4U5QA 1YL5A 3CKYA 3MTGA 1PS8A 1E6UA 4CM4B 3UUWA 4J9UE 2BD0A 4UVDA 3U49A 5MGBA 3WIEA 5TIIA 1J5PA 3PQEA 2HUNA 3AY6A 3AY7A 2OP1A 4CODB 5JY1A 2GZ2A 1L7EA 4PLTA 2WE7A 4XYLA 5CEJA 3PYXA 2NUAA 1Z7EA 2Z1MA 3D7LA 5C7IO 2ET6A 5C3MA 4M1QA 3DFUA 1MA0A 1DRWA 3FWZA 4J3FA 1JAXA 2CDBA 3C7DB 1MP0A 2Y0CA 5T57A 4BO7A 1HDYA 3RI3A 3L9WA 1LDYA 1MFPA 1XHLA 3F5QA 3GUCA 4R3NA 2GUGA 1O5IA 5L51A 2OGUA 1E3JA 4JK3A 1NQAO 3BA1A 3V2UA 1V8BA 3SBOA 2ZTLA 4XB1A 3A1NA 4J7UA 3HNPA 4TVBA 3MJSA 3KUXA 3GPIA
chains in the Genus database with same CATH superfamily
4WZAE 2YJ6A 1YVPA 2V1XA 3IQWA 5DP1A 5BW5A 3ROQA 1BFDA 4D96A 3X1XA 4Q3NA 1DWUA 1KIMA 2GDJA 4NARA 4P3OA 2PSHA 3JASA 4FYWA 3LFUA 2FHSA 3KYDA 2XMQA 2HLPA 2H63A 4KWEA 1RIIA 4UEWA 1DC4A 1L3BA 5TPWB 1L5NA 3UT0A 2ZJ6A 4QU5A 4XIGS 3ELBA 4GI1A 4ZAWA 4OXQA 1V4NA 4L7QA 4MS1B 2C7QA 2Y67A 4Q4LA 5LQMA 1EIWA 3WBFA 1DEXA 1W8IA 1C9YA 2OL4A 3AZPA 3KZKA 1X9IA 2JGKA 3CN9A 4PZCA 3TS1A 4C7OA 3RAGA 4V0QA 4IMRA 1O0BA 3IWDB 2Y27A 4J1QA 1I36A 1T91A 2H5LA 1N2HA 3DV0B 4CFSA 1GTL1 4LE1A 2OG2A 5L6LB 2IYTA 5H68A 1AQUA 2ISSD 2Q3LA 4OA8A 3E3AA 3EVGA 4CL3A 2N0SA 4GAEA 2YDXA 4B4WA 2QRVB 2F43B 4BV8A 4Q1AA 1FLDA 2EZTA 3MLBA 3ZK9A 2ZBPA 2O8VA 3ANSA 4KI0A 4QJ4A 5DN6A 2CF6A 5KEIA 1F0YA 3O1HB 1M73E 1FDOA 3DAGA 3NFYA 4EA8A 5IULC 4HNSA 5DBHX 3HKCA 2GZHA 4W9MC 2G4CA 1XKQA 3SZRA 5LP6B 2ZBRA 3RB8A 4W6QA 2AN5A 5JOQA 5GGXA 5BSTA 3TL2A 2JZNA 1CUSA 3IAS6 1PFUA 4JBIA 3FHTA 1GYPA 5A9SB 3GRKA 1D6NA 3RWMB 3L84A 3E1SA 5I7WA 3GF4A 3KZVA 3CUEF 1M8PA 2JHFA 3LWZA 4E0BA 4NICA 2JFXA 4IQFA 1YS2X 1TU3A 1QQ6A 1Z3CA 2I6XA 4M6WA 4Q37A 4RPGA 5EMMA 2O2JA 4K8OA 2J08A 4FNMA 4FS8A 3W5SA 8ADHA 2YHUA 4ZAYA 2XHZA 2FGKA 3N2IA 4J0GA 5CHYA 1G291 1YKGA 2W0MA 2IHUA 4QHTA 3MF4A 5FHQA 1H4TA 2W93A 5B64A 3ZWOA 3IE1A 1PZXA 2GEKA 4PIVA 4DR6B 2XQIA 2OD7A 4HWSA 4HQOA 3OX2A 3KTAA 1DXYA 4L9AA 1XV5A 3GOHA 1MTOA 3AUXA 1G20B 3GEEA 3PXEA 5HR5A 1A72A 4RMIA 1HI9A 3IQGX 3G0OA 1ULZA 3V8QA 3B52X 4ML3A 4A03A 2WDPA 4PEVA 3USES 4AS2A 4GT1A 3JZIA 4DCUA 3K2QA 2JBAB 4CW7A 5FT9A 4OI4A 1MH9A 2CDNA 4YJHB 4BU1A 1Y9ZA 4C5AA 3R5JA 4XE5A 1A7UA 1UBCA 4K1XA 4AURA 4ARZB 2GCOA 5KZMB 1CJUC 2NNLD 3Q7TA 4V0NA 3HB1A 4AB1A 2WABA 5IEJA 2WOJA 2XB6A 4NV1A 1FLAA 2Y1KA 3TAUA 1ZK4A 2I1LA 3FPKA 4K03A 2GESA 2HREA 1WOYA 2FFQA 3V4PB 1M6VA 3ZWCA 2VRCA 1IN8A 4OP3A 5ED4A 2HSEA 5KYXA 3A2MA 2PZEA 3WMRA 2LV8A 2VP9A 4NU8X 3JYHA 1YBVA 3W2IA 2R8EA 4L5IA 4MUFA 2XVAA 5BN3A 2KB0A 2QJWA 4EB0A 5IYZB 5IXYA 4EB8A 1JLKA 1FTWA 4TS1A 4LVNA 3ZWKA 3IXMA 3UT6A 2PL5A 3K9LA 4YC7A 4QO8A 3WBBA 2O07A 1DQNA 2WKWA 1SU4A 3CZCA 3GMIA 4MUJA 3GLGA 5IKXA 4KGVA 1J2UA 4KOEC 3MTIA 4L1KA 4MB2A 4OJQA 3VNQA 1K7SN 2LP4Y 2X40A 3D6MA 3I01A 4CKEB 1XPUA 3B78A 1T1JA 1T9GR 1GRNA 4B4DA 3FLEA 3GOQA 2Q6TA 1HDIA 4UE3S 4C0SA 3L4KA 2YXEA 3LS2A 4XQ9A 2BGMA 4QDUA 5EUQB 1H5NA 2RCYA 1A50B 1NNSA 4LZZA 4LJ4A 3BDAA 2E1PA 4C07A 3GFRA 1FMTA 3X1YA 2O0KA 1YE5A 1QFZA 4H27A 2NACA 3KQLA 4INJA 2CV0A 3HR7A 5FOUA 3TTSA 4HQNA 2WF5A 3VR2A 3WZMA 3ZG6A 4EENA 2YJNA 4C7XA 4ERNA 4QG3A 2D4AA 2IYXA 2R96A 1MAWA 2OLJA 3F98A 3A6KA 2I99A 5EJ8A 2HV8A 5FPPA 1RBMA 4RLFA 1K86A 1VRCA 2P2GA 3GNTA 2Z9CA 4IVNA 5DLQC 2JNWA 1R0RE 2YNMC 4Z9XA 4ZI2A 5G2OA 1U04A 1JLSA 5JD3A 3VKFA 4F8EA 3WYAA 4YCBA 5GPBA 5TF4A 1RYYA 1J97A 1U7OA 4WIAA 4EHDA 2PUAA 2SHKA 3K5PA 2FDCA 4Z4CA 3T7JA 2ZU0C 3KOXA 5JMWA 1SCUB 3BXOA 2QP3A 1TEHA 1Z25A 3JD3A 4KIUA 3TLGA 4Z1MD 1K8RA 3EBOA 3E3OA 2PV0A 4ZV4A 1PZEA 3PIIA 2PXHA 3EHDA 3EC1A 2H06A 2IHKA 1LTQA 2IIBA 5E3IA 3RT1A 3C1AA 3UWDA 3E27A 4ER5A 1JIVA 3KLNA 1J39A 4QLBA 1UDWA 3UIEA 1BX1A 3LDFA 3T4UA 2NZ2A 2P2LA 2PKRA 2OBMA 3EUFA 3EQ9A 3LW8A 3TFOA 2H3HA 3C7CB 4R1QA 2GA9A 1ZDMA 4V02A 1BTOA 2DPMA 5HZMA 4G1VA 5I9NA 4MSUA 4N48A 1B1CA 1LNZA 4KPFC 1U8CB 1XXHB 3QU2A 5JYAA 2HWYA 1UJNA 2D2VA 3A06A 1BVRA 3UWKA 1P1BA 3JQAA 1HYQA 5I9SA 3IQXA 2QZ9A 1EYZA 5FR2A 1ZFNA 5EESA 2G76A 3M33A 3P0FA 3Q6NA 2VUUA 5G0UA 3DZ7B 2IP4A 2XMSA 2RK6A 1ISIA 4FS3A 4JKOA 3KOZA 4OJTA 5C1DA 2ROQA 3HTXA 3ZHUA 2UXCB 2WTUA 4XD2A 2P3OA 1ST2A 2O9JA 3Q3CA 2IXEA 4DMGA 1A1VA 4Q00A 4L72A 2TSYB 5TR9A 1MFZA 3L4BA 1V4VA 4DYDA 4ZU1X 1N2GA 5EINA 2BR5A 4NZOA 2GVDC 3G7SA 4JJAA 4KQFA 4ZAXA 5E6UB 4HS4A 4RKQA 3WLKX 2MSCB 2OGZA 1GL3A 1VKHA 2BP7B 3GFSA 4G0ZA 4L0DA 4NU6A 5DCUA 3UUEA 1S4QA 3TSYA 2ZZKA 2J3QA 4RGVA 1E0JA 1VCNA 3F9IA 3G6WA 2PSSA 2ZCUA 2PN1A 1IUNA 1GY8A 1SHLA 2EARA 2WWXA 3HKDB 3P0IA 4G8CA 2PZFA 4LXIA 4D57A 1CQXA 5MFPA 4EG7A 1P2UA 3VYVA 2BGKA 1OH5A 2Q45A 2G1AA 3HEMA 2C98A 1YACA 1Z9BA 1Q20A 5K6AC 3AR6A 3UA4A 4DTIA 1NJ1A 2AQKA 2G5PA 1O5TA 4FD2A 1NN1A 5CJPA 1O0SA 1U5AA 3LECA 3J81k 3T1QA 1BN7A 5DHSA 5KQMA 4TV8B 4AU1A 2VJCA 1T34A 3PDUA 4KAJA 3JZFA 4L16A 3M5PA 4AN0A 1LSSA 2O2GA 4LBWA 1N6HA 4OBXA 3CF6R 2ZZNA 1E59A 3H4MA 3D0OA 3BMNA 1HLPA 3SR0A 4AUKA 4EYSA 2V8BA 2C7PA 3IKMB 4DJJA 4GVPA 1PNRA 2HT1A 3TTXA 2P1DA 2VUIB 4YFYA 5JVDF 3OD5A 4JJIA 3VI4B 6ABPA 4WASA 3QVWA 5CCDA 1BROA 2HJRA 1M34E 1PWYE 2R6GA 2ZRJA 4J2TA 4WNAB 5E0OA 3DE4X 1BCRA 3RRNA 4DRXB 2K7FA 2PYDA 3VR5A 5JLJA 1NX6A 2EYUA 4QGFA 5BNTA 4ZAFA 2VTVA 3GEIA 4HJXA 5IVIA 1YQUA 2A9FA 3ORRA 2OE2A 4QXMA 4MVXA 4GBJA 1E2JA 4ZAZA 1HT3A 2I3DA 1MRSA 3SYTA 1GNPA 1CNEA 1H4QA 4BJ3A 4C0AC 1PVDA 2WJ3A 2P79A 4XTRA 2B1RA 3DNMA 5GJWC 5IC6A 5K3EA 5T3YA 3K53A 3S70A 1E7MA 1ZI9A 2NGRA 2VZEA 4RPLA 1GCAA 1ZM4A 3K6RA 4AJNA 4MVCA 1T9KA 5AT1A 5KX5F 3GC6A 4DV1B 2IYRA 2JJ1D 4GXQA 3H97A 3OA2A 3LBIA 4X63A 4DUGA 5JCPA 5AVYA 4E51A 4Q1DA 4WY8A 5EE0A 2ANBA 4IG9A 4RDHA 1UBLS 4BZWA 5TPZA 1NATA 1Z4OA 2OHXA 4C4XA 3ZUGA 1W46A 5JHHB 3TSCA 4BNDB 3P9NA 4CYMA 4YAGA 2PM8A 2YRFA 4K88A 4EVQA 2FZ5A 5CD1A 4CI9A 3O1LA 1A5SB 5SY9A 3ZCTA 4YR7A 3L40A 5ALSA 3LA8A 5H80A 3TB6A 2WEKA 2DZDA 4NLLA 3PB3A 1IH8A 3V1LA 4ZVRA 4HDCA 2C5BA 2YWBA 1XTZA 3FPHA 4EK9A 1GP2A 3SS8A 5I6DA 5M6DA 2JVJA 2HBQA 2XX3A 4MRSA 3EXEB 4GOLD 3EVDA 5KNDD 4YT2A 4QJ5A 4HLCA 3UKDA 1ACJA 4MV4A 1P4AA 4XM2A 3SE0A 1JJFA 1GT6A 1NXQA 3QXGA 4M0KA 4C0KA 2Q1SA 3KKEA 4PU0A 4DHEA 1P91A 1L7QA 3ABQB 2HJGA 1G4AE 1TIBA 4N1AA 4W99A 2O2DA 1ZJJA 1EFTA 3B60A 4Q3AA 2X9NA 3HLYA 3GJ0A 4MAFA 5IF3A 5DGTA 5EWJB 1FTNA 3FJYA 3RC8A 1RI1A 3S1AA 1DOZA 2OCKA 1K88A 2IYQA 2Y1FA 1IN4A 2IZ5A 4TSFA 5F2EA 3SD7A 3RYCA 3KHKA 3VOTA 3CBGA 3IUBA 5JPCA 2FETA 4QGBA 1CJSA 3TW3A 2C8LA 4OLHA 5FA6A 5ENDA 3ZIDA 1PL6A 1M34B 5LZ9A 2P6PA 4OHVA 2N3ZA 4JOSA 2AVNA 1ZA1A 1WULS 2AD5A 4DCMA 4HX5A 1CS4C 4BVAA 5CBKA 4N5LA 1VLLA 1NXOA 2C5HA 3BCHA 2QLMA 4XSGA 1QXSA 1QZXA 4JR1A 5HDQA 4LRXA 1Q1NA 3I72A 6LDHA 1Y8RA 1ITZA 4HUQA 3M6FA 5FJJA 5A3VA 4LF9B 4HP8A 4QNMA 4P4LA 2C7GA 3GRUA 5AVSA 2GASA 4K9PA 2GZMA 3AR3A 3ZWVA 4IF6A 1XQ9A 3IL2A 2CJYA 1DSSG 3C5EA 1TUEA 3E9CA 2PG3A 5HUQA 1AV6A 5DK4A 4JBNA 4EO9A 2QX6A 4ED9A 2O7VA 1P4HA 1EFDN 1P7ZA 1C9NA 5HHTA 1P7YA 4F72A 3A1VA 3S2SA 3WDMA 4NOJA 2QT0A 2QT9A 1T2EA 4Y1EA 2IELA 3PHLA 5DLDA 3O47A 3DBOB 5J4VA 3BULA 3RABA 3PVZA 3RROA 2I8AA 1EUCA 4R1MA 1K7EB 4R9SA 3P4XA 4XGKA 4JYCA 2JHAA 1MZVA 4MUKA 3AERA 1DXQA 2BRUA 1DXHA 4LYGA 4OBEA 1KZHA 1A4XA 3VZRA 4OTZA 1AA9A 4XFKA 2QVXX 3DDSA 1TT5B 1NVWQ 4YMGA 5BMVA 2NU7A 3TDKA 2JJQA 1KARA 4E4YA 3IQHX 4Q9HA 1OR8A 2CLSA 3ZK8A 4JA2A 2FQXA 4FGSA 4OQDA 1H65A 4N82A 3WNQA 5CG1A 5FBWB 2ZYTX 4MQ4A 4Q4HB 2IZ0A 3UNXA 5ITSA 2SBTA 4RFVA 5E2BA 4ND6A 2NZWA 5CDTA 3L1HA 1SXPA 1P1HA 2C83A 3OQBA 2O1EA 4RZQA 4U7GA 4BLUA 2WSMA 3IQDB 4GDMA 4OL9A 1Z4NA 3AVOA 3VDNB 4HGOA 2V9CA 2NO6A 2QLBA 4OHCA 1GFWA 3H13A 1X19A 2IEIA 3FUCA 4OU4A 1QUEA 4CMJA 1UOPA 2XCSB 5B4VA 3WKDA 1U28A 1NW9B 2TMGA 3OZTA 3LMKA 5LQSA 1YR3A 4DANA 3LKBA 1C1XB 3I6BA 1BW9A 4PXYA 4EITA 1UXKA 3LY5A 4N8DA 4L15A 3DDCA 4IZIA 1WP4A 1G6KA 1QYVA 3QRWA 2G1KA 2UYOA 4R4JA 4LXHA 3CFYA 4OBWA 1VLHA 3PE6A 1YR8A 4EPWA 1Z18A 2O2XA 1GZHB 1JENB 2Z0MA 2HYDA 1V43A 3AU9A 3HFRA 3HHEA 4N7RA 3WLLA 4D41A 4UFPA 1WMEA 4IEFB 2JIDA 3HDQA 3PC6A 2A0WA 2IWHA 3STTA 1P5ZB 1G19A 2XSZA 1ICEA 5FUMA 4AZ3B 1E6LA 3A8TA 1COZA 2BKAA 3JR3A 4R1SA 4CF7A 3DOCA 4L51A 2LBPA 4YUXA 1QM5A 2K2WA 2CCGA 2PDAA 3R5HA 2BFCA 4D4JA 3AR5A 3JALA 1ESMA 3LY8A 1ODCA 3LBFA 1NVXQ 3ZGZA 1P17A 1D7OA 1MW8X 4G5YA 1CY6A 2ST1A 1KVRA 2GAIA 2DUUA 1IJKA 4LC1A 4S3MA 3R4CA 5H82A 1D1PA 5IJWA 3CKKA 3OLVA 3P7MA 2D5CA 3IQIX 4FQ5A 3QUQA 3OO0A 3KAPA 4F9TA 4B3CA 4BFLA 1YVUA 1GGMA 221PA 5EG5A 5F1OA 4MEBA 5C4GB 2C59A 1DIGA 2NVOA 3KEQA 1QMIA 4HDNB 4RA6B 2HK9A 5GP1A 1UMBA 3USZA 3WRWA 4ARAA 1AHPA 1K75A 3UV3A 1TCVA 1A9TA 2P6OA 2GXQA 2R85A 3F2VA 3WS7A 3X2SA 1SBYA 1QAMA 2PL3A 2CLEB 1UFKA 1NYTA 3AI2A 3L8GA 3V8VA 4E88A 3W3ZB 2WMNB 2HCRA 2QL7A 3IBTA 2NU9B 3PPVA 2G9RA 1GZ4A 4BQNA 3BFKA 2C00A 1UPBA 5A5GA 2ZJ1A 2FPSA 2FYTA 4RHUA 2IK8A 1PLKA 3AM1A 1IZ9A 2VHXA 3EGDA 4PR3A 1SWVA 4Q05A 5ALFA 1K5DA 2PZGA 3NIFB 2E5WA 2C84A 1M6EX 4MIEA 2I22A 4I4IA 3ZE9A 5LQUA 3S7ZA 1FMFA 4Q0MA 3HXLA 2JIMA 1CP3A 5SY4A 3ZGNA 1GXSA 4PYNA 2GYVA 4OMUA 3U5TA 4H7HA 3UXEA 2VPWA 4QOSA 1VJRA 2IITA 1RM5A 1DU4A 5CVEA 3U9TA 2CHGA 4REQB 5TQJA 1JFLA 1NVTA 3A25A 3FSRA 1SAYA 4B40A 3WK4A 4B2IA 4XSVA 3QFHA 1GILA 4XYEA 3IRUA 1W49A 4FHDA 3SYRA 3KYCB 4HF7A 3PK0A 1N6OA 4KQEA 3K32A 4M8LA 1DQZA 2AQIA 3ZGVA 5KHLB 3GVCA 3DCIA 3CO0S 4PGHA 1KC1A 2OY0A 1ABFA 4EVIA 5A6SB 2ZSAA 3FCUB 5KJFA 4CG1A 3KS9A 2Q5IA 3HZRA 4FOOA 2R8YA 4PVDA 2DERA 3IVMA 3QVGB 1XQVA 2B0CA 3TNYA 5CVTA 1Z39A 5FBVB 5K51A 3NV9A 3MPUA 4CV3A 4JC5A 2WHYA 3LX4A 5CM2Z 1LK7A 5E7MA 5B6PA 1FBNA 4QUAA 1SEPA 3LTEA 5C5DA 2FSSA 1FMCA 2Z6AA 4YLYA 1EM6A 4K0KB 1KI4A 2GI4A 2QI9C 3VNSA 5JH7F 1HPLA 5AVTA 2Q5HA 4NFYA 3T9CA 4YMHA 4QM6A 2WNIA 3M7IA 2DF8A 1D2RA 1O5OA 3ENNA 1W25A 4AYXA 2ACEA 5CFMA 4CXMA 2V3CC 3WKCA 1B2RA 1N6IA 1RXSA 3JWJA 1HDCA 3CY6A 5DKFA 3VPDA 4Z1OA 1CUGA 1XKTA 1VLMA 2ORVA 1R4MA 2COKA 3IJPA 3PQ5A 2AMVA 5LR6A 4RWEA 1VP9A 2BFAA 2O3JA 1MN6A 5AW9A 5HGXA 5MN5A 4M49A 3E1KA 4L2IA 4J07A 3DLCA 1E2HA 4ALMA 4Q6BA 5JSYA 2IYUA 2XUKA 4HNHA 3UK7A 1K9VF 4A0RA 3DOHA 4YY3B 2JCGA 2VHVA 2PQ0A 2UDPA 4JB3A 1WS6A 1YB4A 2VRCD 4GGMX 2HRBA 4ND7A 2VYNA 3NVMB 4ZJPA 3GYGA 3G17A 5IDYA 1U8FO 1RRFA 2DBQA 4UCWA 1CY4A 1TKBA 2O3RA 4P98A 3UMYA 1QZUA 3QLVA 5AJHA 5E7IA 4KITB 1A77A 4EFNA 2DUWA 1ZNXA 4E1BA 5CYFA 4RHTA 4G0PA 4O1MA 4WRRA 1DG3A 4NC9A 4FP9A 1M7BA 3WADA 3GJTA 1HT0A 2QIPA 3NEPX 1ZOLA 3Q6MA 2M6KA 5BV2P 1M6HA 2IYZA 2P90A 2WM9B 4F06A 4WXHA 1SKYB 4EVSA 4A2CA 2ZSEA 3LQYA 1UODA 3WGJA 4CDGA 2MYTA 4HQFA 1GKLA 2PO5A 3KPUA 2G1JA 2Z08A 3ESBA 4HEA6 4GZ6A 4IIYA 4TN5A 1EXDA 2IXBA 4X3PA 4Q3KA 2XTMA 3TTYA 2FPXA 3R2JA 4NYMQ 3U1BA 3QSYA 1ODIA 2VFAA 3HM9A 4J7CA 2GTPA 5EXPA 1JIUA 3GJ5A 1BOOA 1DJLA 1KVSA 5DISB 3SIRA 3FCOA 4YK7A 3MQ2A 2CW5A 3EYAA 1FNSA 2D5IA 3DV2A 4FWIB 2RB4A 4FUQA 2Q3DA 1IHXA 3G2HA 3M81A 3PX2A 4IICA 1FA9A 4KAXA 2Q2OA 4NMHA 1CKEA 4UATA 4B35A 3BXEA 1PL8A 1VI6A 1T6BY 2VYFA 3A3YA 4HY3A 4TRJA 5AHKA 3RSQA 3VAAA 1F5SA 2DHCA 2GNOA 3FWYA 4B6RA 1IN7A 4Z49A 5IJ9A 3MWDB 1KTIA 3MGAA 4XB6B 5JSHA 1DB3A 1E9SA 2YTZA 5JSZB 4Y1RA 4JR2A 2HA0A 5EKTA 4DWWA 5C7YA 5B55A 3RIHA 4MAMA 3U1VA 1CE8B 5CBPA 3COJA 3UAWA 2YY7A 4KIWA 5TT0A 3OFJA 3ET4A 1KDOA 1I4TD 3W8FA 2AF3C 2FPPA 1JFFA 3FOWA 4MJXA 2G9NA 4O2AB 4Y6RA 4DSUA 1CDDA 3SS7X 4CN8A 1U63A 4CEIB 2ANCA 4IRXA 3DDNA 4HGZA 4EA7A 5IC4A 1YU6A 2NPOA 2QQ5A 4JD5A 4IDAA 1GTG1 1TJPB 2FPNA 3PNSA 5AW2A 1WXHA 5U4XA 1JI0A 4BZQA 4FN4A 4BIMA 4IIHA 3LUCA 5DM70 3BTSA 4H6VA 1GD1O 3AWIA 3IUNA 4P1ZA 3CX7A 3T1HB 1NU8A 2VK1A 4G0WA 3G8YA 4V0MA 1B0UA 1RJDA 4RK1A 1KRXA 4P33A 4J6EA 2JW5A 1HDZA 2YVAA 3RS7A 2NQTA 6REQA 5ES4B 2FW1A 1FJ2A 3WMWA 5KSOA 2PS0A 1ATIA 4FE4A 4BNMA 1H2WA 2Q6KA 5K0NA 4DSOA 4DWVA 4ESOA 1R6UA 4CKCB 1M1NB 1A1SA 2F62A 4PLCA 1X74A 3ABRB 4IP0A 2EW8A 3A1TA 3V46A 1THMA 2PKCA 1E6KA 2Z6UA 5A62A 1O4VA 1TM4E 1V5WA 1CR1A 3PGA1 1VSVA 3BILA 3GVXA 2KYRA 3UKOA 5B6JA 3JQAD 2K7ZA 3ST7A 2ZRNA 4OATA 1LC3A 1US8A 2G0AA 2QU8A 4BGDA 1KP3A 2Y1CA 5FBLB 1D0IA 4L95C 5SZHB 3CEAA 2XA1A 3T7IA 4WEOA 4XRRA 1OLXB 4BLQA 9GPBA 2OCIA 1Y8CA 1OROA 3A36A 1W47A 1Y34E 1XP5A 5EXDA 3VSEA 2JJYA 3D6FA 1L5KA 5FI5A 1U0BB 4Q9JA 3SSAA 2XNJA 3GO4A 5A3RA 4RGYA 3EGEA 3Q7RA 1ZNYA 1B0AA 4BMZA 3DW3X 4KXLA 2A9PA 1T3GA 4M46A 3P52A 1KYZA 5I01A 1W6UA 3UJBA 5JAUA 1KHHA 3MYRA 4X1OA 1UKAA 4F3CA 5FBQB 2H0QA 3BSFA 1LQ2A 1H8EA 3ZHRA 2EF1A 3EGVA 4IAOA 4MWTA 4C6HA 4ZGGA 4L4YA 1BXRA 2GK6A 2BT4A 4JZKA 3KAJA 3VTZA 2AL7A 3PHBE 2RHHA 2VOEA 2Y66A 5AKIA 4BVEA 5DRTA 2BEWB 3A4NA 3AZQA 1VL2A 2J87A 4XJTA 1ZN2A 3Q7PA 2XITA 3IBCA 1L1FA 3UFXB 3IX7A 1ZYUA 4M98A 4HB3A 3I9OA 3R0JA 2E9SA 2R79A 1XEAA 2VWPA 1W29A 1NXPA 1OX5A 3VJRA 2OBBA 3HVJA 4E6EA 3RD5A 3MMSA 4HGPA 2BH2A 4JL8A 1Z5ZA 1NA5A 3BHMA 1YJCA 3NM6B 4PQGA 5LOVB 1AQYA 4RVDA 3OWOA 2PH5A 3KM0A 1KMHA 1Z2OX 3EWSA 5TEVA 4F3YA 2TECE 2WIBA 1ZK0A 3GR6A 1Q91A 2NTEA 3AUJB 4KO3S 5FEMA 5HF8A 3VUEA 2UKDA 2W0SA 4GLLA 3DTTA 2CWWA 4RESA 4X1KA 1P4RA 4DCCA 4AWAA 621PA 1PT6A 3VR6A 4XWTA 3EVTA 1BJRE 4I4CA 3OCYA 4B6FA 2KHZA 4MV9A 1KNXA 4QHSA 5BYKA 1CNMA 3E4CA 1DKQA 4PM4A 3WYBA 3DNFA 1Z38A 1IXZA 4OLAA 4L6CA 2W8BB 4XIFA 3NYRA 3QFTA 4N54A 3P2IA 1U1GA 2A94A 3ZTWA 5AKZA 2IODA 4NBLA 3L4JA 3E8SA 4WK0B 1SU6A 1QV6A 2FSIA 4U0KA 3T0GA 2QRNA 3E2MA 2BJWA 4YRPA 3ZJYA 5M29A 4DUYB 4I2NA 2II6A 4N65A 3UAVA 1U6KA 3E18A 5BNIA 1JHDA 2GWHA 4KPYA 3TD9A 4QYIA 3ZC3A 3OT1A 2IBTA 5A2QA 3R1IA 3KDSE 2YS6A 3MGCA 2ZYHA 5HCNA 1JXAA 5TPZD 5CW1A 1BEZA 3PFBA 1GAJA 2E2WA 1VA4A 5G3ZA 1B76A 3W5DA 4S1WA 1DAGA 1FYVA 3HO6A 4IDEA 3GMDA 4RJIA 1JDPA 1TCAA 2A9QA 2GTHA 2A58A 2PT9A 2FG5A 1ZN8A 3F5DA 4NZYA 3LXXA 4XH9B 5FAXA 3KQMA 4N7BA 2COUA 1R8XA 3H6GA 4MRRA 4NENB 4C7MA 4QO7A 2JGDB 3E7PA 3WK7A 3K35A 1Q16A 2B5OA 5H81A 1OKKD 1ZAYA 3QYFA 3HU5A 2GBFA 2PRYA 1F48A 4P4SA 1GT91 1D2MA 2AE2A 5CFZA 5IX8A 2R68A 2XE6A 3BJIC 3OIUA 4C1NA 4DMKA 4IQGA 4LIPD 4Y6QA 3CINA 4XARA 3UB3A 3DVQX 1DRJA 5T73A 3OPYB 4CCWA 2JEOA 1J8MF 2ZYDA 1M83A 1ONBA 1KVUA 2FZEA 1A88A 3ABSB 4TMTA 4PNPA 1V0JA 1NSTA 4Q4JA 1SR8A 3BK7A 3RVNA 3V3TA 2CKDA 1GTSA 1MJGA 4IVPA 4RZHA 4FMBB 4N5IX 3O4VA 5J5AA 1XTPA 2X3FA 1F2TB 1Q0UA 3TCNA 4EATA 5H9WA 1UJ2A 3RFCA 3BC1A 4KUEA 1TIKA 3PS9A 1UBMS 2ZYUX 3LHDA 5ALXA 1Q6ZA 4N47A 1QPGA 3TRHA 3U4MA 2WWTA 2XADA 2D0PB 3LQRA 4CTKA 3GUZA 1DDIA 4JI0B 2ZSFA 2WV7A 2SKCA 3JVEA 3NX4A 3A9RA 2XNDA 3BH6A 4QFBA 2MR5A 5FTKA 5TX7A 3V33A 1RWPA 3VSCA 3HLTA 5CA1B 4ESHA 1KJYA 3MCZA 3LXRA 3LG2A 1HURA 1SUBA 1YJQA 4G4SO 3DOOA 4LRYA 3WLIA 5CFPA 1DBSA 2CJFA 3KPVA 3ZI7A 1CB7A 4HFJA 4ZC8A 1FS6A 1QGED 1VB5A 1JQEA 4R6WA 2X0JA 5J5VA 5D51S 1F9EA 4EKIA 3V6LA 1EE2A 1X1RA 3H8WA 5T8KA 4B8WA 1GPJA 4BEVA 3TUIC 2ZXFA 1W35A 2ZBUA 4B80A 3GL9A 1CU1A 4FHGA 4AS3A 2WTMA 3UY4A 1EG2A 1KFEB 4KYVA 1JA1A 4WJZA 3GZ4A 3GLIE 5F52A 4MHSA 4LYEA 1MQ8B 3SOZA 1D9ZA 2ERYA 1U6IA 4G81A 3TUJC 4HLNA 3ZZMA 1RWKA 3C5HA 3E0XA 4K2HA 1VL8A 1NUUA 3BBLA 5I5GA 3HY6A 2AI2A 4ZV7A 3KHSA 3OE4A 1PRYA 1MOSA 3RFFA 3ZEIA 5KWJA 4PQEA 1QRTA 1NIPA 3IJEB 5KDLA 1SOWA 2FPMA 2AUNA 2DHRA 2Z04A 3GJZA 4REMA 1H9AA 2WOOA 1CTQA 1EX7A 5LZ7A 1TO6A 4ZQFA 1W94A 3AUUA 1U7DA 1XA0A 2W5UA 3C41J 3G0HA 4WW0A 5JZOA 3ZX4A 1LPAB 3RUPA 3SM3A 2B37A 3G02A 1DIOB 1D1SA 4MVJH 1DBQA 3CH4B 3UC9A 2C3OA 3V00A 2P5YA 4RD4A 5K0EA 4JLOA 4H7IA 4OQEA 2A9JA 5JI2E 3AL0C 1R0KA 1KQGA 3OTOB 3LQQA 2XE7A 2P9QA 3L8EA 1IL0A 1RE1A 5FA8A 1JXMA 3OEWA 4WXRA 5KVCA 1FDIA 1YZ3A 1A76A 2LRHA 3QXHA 5HJEA 5TGZA 2PX5A 4ABYA 1ZOPA 5DSXA 1GEEA 9ATCA 1JL3A 1EIZA 1G6Q1 1JQ3A 2JFYA 2NQ2C 5AJTA 3MHPA 4BBPA 2BGLA 4RXMA 4MYHA 3FI0A 4WFQA 4M9UA 3G8AA 3MWJA 1X94A 1Y9EA 4JI1B 2ZIZA 2NW6A 4B5LA 5DBEX 4R54A 4PZLA 1R0XA 2LIVA 4QAJA 2IY8A 2B4RO 4ITRC 1M2HA 4FGJA 3ZCVA 3GN2A 3HWSA 3KCNA 1I9CA 1C29B 1RRGA 3KAQA 4NCIA 1NVUQ 2OAP1 2A9KA 3D8BA 3UUFA 2VZ8A 5KQGA 3EBPA 3IAUA 2V7WA 2QVBA 1L5LA 3HCNA 1MKYA 1NURA 5A4AA 1N3YA 1UKCA 2I33A 5C37A 4DQDA 3O8LA 3AKEA 4RD6A 3V4OA 1R74A 2I7XA 1JSCA 2VLIA 3OUZA 4RDXA 2QM3A 5FEUA 1H6BA 1U4SA 4UQLA 3RC1A 7AT1A 4X44A 4Q7JB 4KPUB 1SD1A 1I24A 1KSJA 3AL3A 4H7DA 2H1CA 1H22A 3M3DA 4PWYA 1O89A 3RYFA 4TLMB 4F2HA 4MINA 1E7RA 3F6EX 4XX0A 3LIPA 4Z0PA 4HRAA 5ENVA 3UW1A 4UMVA 4IV0A 3GLIB 4XQEA 3A70A 2O19A 3IAM6 3JQGA 1IEQA 2UVQA 4I9HA 3RT9A 4QXRA 5KU7A 1XAHA 3MT9A 3QF7A 4E21A 3RS5A 2FPIA 1W2WB 4JQOA 4JEMA 5JE8A 2XUDA 3TX6A 1E5LA 3VPXA 2J30A 4IDPA 2Q5FA 4Q9KA 2HO4A 4MR7A 1QAOA 3IEKA 4TUYB 4I81A 3HFSA 3AG6A 3GGGA 4JENA 4MP3A 5JYEA 4OKIA 5E6SA 3R8CA 5IVPA 5K8JB 2LGJA 1CT9A 3QEOA 3TQHA 4XWOA 3WQQA 3KXPA 4CG0A 4MS3A 1DJMA 2FKNA 1XTVA 1Y5MA 3UV6A 1AGNA 1HC7A 4PHFA 4ZODA 4Z8YA 4YCAA 5TRTA 3F6RA 4WLNA 3UQZA 4ZYZA 3BGIA 2COEA 1M0SA 3L4BC 4QC2A 2PV7A 1ZD1A 2YWRA 2HFJA 3NKLA 3SC2A 3AVUA 5JSFA 1E4OA 3B6MA 3CXUA 3ESXA 1IRIA 1MOPA 1Z5UA 4LF8B 4BTVA 2W6MA 2OD2A 3OHSX 3UAOA 1P31A 2R1VA 5DJ5A 1Z75A 3ZKWA 5KC8A 1NHGA 2WTBA 3ZBUA 3GDGA 4AZVA 1PEDA 2REQB 3C3EA 5KVSA 3TXYA 1XYVA 2PH7A 3H2BA 1TUBA 3RF7A 1I94B 3BQ9A 1VMEA 3MUFA 4HDAA 1VB3A 3LUDA 1JDJA 3RTDA 3SKXA 4JROA 2BCGY 3A1CA 5FORA 1E2DA 3ED5A 1M2VA 3LU1A 3N5KA 2GBGA 3SY8A 3C6XA 4D82A 3KWMA 4YV2A 2JASA 3KWFA 3WHIA 3IEMA 3P0EA 3T38A 3D9QX 5FL7D 1D4OA 3DDWA 1YFZA 4EX6A 3NJRA 4HH0A 1K4KA 2EOAA 1XLTC 1JR3A 3DZCA 4L0CA 4MWCA 3AEZA 3EG5A 3EHEA 1NY6A 1JDZA 3HY4A 4TTIA 4WADA 1JJBA 3CMCO 1U9YA 3EARA 3P4UA 5K03A 2BH9A 3IYLW 2ZB2A 5TQ2B 5LA6A 2QUBA 2QL9A 1QE0A 3M4ZA 1QO9A 2FOLA 2B1QA 2HU5A 2IUTA 2QDKA 2XUPA 2ZYSA 1EBBA 1I6KA 2OQVA 1RCTE 1ACMA 1QOZA 3OPYI 4R69A 4C1BA 4MICA 2FR0A 3UWPA 1LBEA 1QIMA 2H1RA 1EVEA 1VXOA 2GMWA 4K81B 2HU2A 3TG2A 1W6RA 3QHAA 5JXIA 2WG0A 1Y8ZA 1CD5A 1KC3A 1KFJB 2WJGA 4R7ZA 1G42A 5SYMA 2Z9BA 3JW8A 1ZBDA 1QHEA 1HR0B 4H77A 1OE0A 3GLSA 3UCXA 5GVRA 4BNWA 2JLUA 4ZFNA 1A9SA 3T12A 3QKWA 1XJ5A 2BEUB 3E3MA 2FLVA 4FFLA 3S5UA 5CTJA 1WW3A 2CB9A 3TEMA 1D4AA 4GVLA 4FFVA 4LDJA 1J22A 3PC7A 2BMVA 3WLAA 3U3OA 1GPLA 4L3OA 1ADJA 3M2PA 1X8XA 3KKNA 1R7RA 4LPSA 2DRIA 4KB5A 5J2UB 1ZXXA 1KO1A 3SZ3A 1Z6XA 3OG9A 3WLNA 3KXDA 4ZQCB 3NXSA 5JYCA 3HWX1 1CDZA 1PGOA 2P91A 2Y77A 4C3ZA 5JCZA 1C3XA 2AC7A 1JAHA 1XZMA 2R6HA 3FLAA 1EWVA 1K89A 2XHEA 3PXXA 1JDBB 3OQIB 4YFVA 3STXA 5IJAA 4I4TB 1P7CA 3HDHA 3GLUA 1JLLB 1NTOA 1CHDA 2H2HA 1ULBA 2V7QD 2XXBA 4MPPA 4HMQA 4B85A 5G1PA 1BE0A 1JVSA 1MRNA 3WLHA 4K6MA 2O6HA 3DO6A 3QOWA 4YRGA 2OD9A 3THYB 4YAJA 1GVHA 3I6QA 3UPTA 5LWQA 4HDMA 1T5OA 1GNTA 4CM4A 1MABA 3PWTA 1PYDA 4HTFA 3GG9A 5CNMA 4EGSA 3L01A 2Y0DA 1U94A 2GPSA 5BNZA 2QSUA 1RXUA 3EEFA 3G8BA 2GM3A 5J9FA 3SDZA 1O8CA 4ZU3A 3CCCA 1E3WA 2R2AA 5JS2A 1JHQA 1MJ5A 1YDWA 2X0EA 3BWEA 4RLHA 2FN8A 2MT9A 3L49A 3MS2A 2UZ4A 3I9V6 4RA9B 2XV1A 4ZVQA 2Q22A 5BSKA 4H1VA 3FETA 4HB2A 1GV0A 4ZVPA 1CDEA 1XEXB 4XGRA 2W6ZA 2DKFA 4NE2A 4U8GA 1RHJA 3H99A 3A32A 4DIEA 1RD4A 4BFZA 3Q8KA 5FUXA 4ZI3A 1U7HA 2PH3A 4RWZA 5CW2A 4ZOCA 4FINA 3AINA 1AIPA 3CLHA 4IDHA 3LQ1A 4EJSB 1B6GA 4EY7A 3DBLA 2F3UA 3O2JA 4J94A 4GYYA 5C1IA 1PFQA 5LKRA 5J2TB 2YRWA 3KSAC 3URKA 2VATA 3I9KA 3O2NA 1JDVA 2GR9A 4L4XA 4DZTA 3GH3A 3NBAA 4R2KA 3Q8MA 4HVCA 2VQEB 3SSOA 1YVDA 2JD0A 5BYAA 1UBTS 4K9RA 3ANMA 2BKUA 3FIUA 3NAQA 1IBSA 1KEPA 4JAVC 4JR0A 1K06A 2OAGA 3GD5A 3K4HA 1TKRA 3ZWQA 2J5BA 5ILOA 5JPDA 5IAAA 3ZJUA 3DL7A 5AUPB 1A7KA 1ZU4A 3Q3GE 3DBRB 1RTKA 1RPNA 4MWGA 4PC1A 2RDMA 4EI9A 5CXSA 5A4JA 5BUCA 1G63A 1ZGHA 2ZJOA 3OC6A 4HYQA 5FI3A 2QL5A 1PIWA 4BKUA 2FWNA 4DDTA 1T0PA 1UBNA 1I0LA 4GX5A 4MS1A 5CFOA 5K6TA 1RHRA 4O4IB 3EAFA 5IP5A 2B1IA 4QZVA 5IKOA 5TXGA 1DOHA 5E1OA 2XB8A 5K4AA 1GUAA 3GLQA 4QAQA 1PG5A 2X3UA 2H1LA 4J2OA 3RIEA 4DJFC 1IDOA 2RHWA 1GQ2A 4HOYA 4QT0A 5AK5A 4R5MA 3OZRA 4ZRNA 1NHWA 4C88A 1SKBA 2YW9A 5A4KA 1ABEA 2QRVA 2F43A 4ZAVA 4F2PA 4MYCA 4PGGA 5B7GA 3C8UA 1X42A 2SKDA 1LPPA 1Y1TA 4JHLA 2BRUC 4XDZA 4LFAB 1CNFA 4MRNA 5NULA 3TUZC 1U0EA 1EJ2A 1NDUA 5KOJB 5LP6A 1U1EA 1L8OA 3NP9A 3OZIA 3TUXA 1GQYA 3E5RA 1I3NA 1PGQA 4HAUA 4MO9A 1YFJA 3AV3A 2MMGA 3OEEA 4EY4A 1W36C 3BH7A 5AI5A 2GKOA 3ICCA 4JKIA 4D9FA 4QOFA 5A9SA 1GDHA 1Q12A 3BTVA 3GNLA 1WUKS 2ODPA 3AJDA 1WPXA 3C8ZA 1BHSA 2VJAA 2PXXA 4PG5A 4ER7A 3GAZA 3ZCQA 4LSGA 2BUCA 5JJKA 1K7YA 2PCLA 4QYTA 2A0UA 1QZZA 2W22A 4TT8A 1GAXA 4XUDA 4GF5A 3DAOA 5IWAB 4Z9AA 2I1VB 4FOLA 1TYAE 3EF3A 1JFTA 3FGPA 3EXAA 1AKWA 2W6IA 2YIVX 4GMDA 4NJEB 4AJLA 1B42A