1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords dihydrodipicolinate reductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
1HRDA 1JWAB 3FRJA 1VI2A 5L3ZA 2PD4A 3BYZA 2AXQA 4DL9A 5EESA 3STHA 4OJNA 4MP3A 4Z9XA 3EZLA 1OAAA 4WLOA 2BD0A 3RBVA 5GZ1A 4UVDA 3ANMA 4FW8A 1LDNA 1YDEA 1HZJA 3DBHB 5JAMA 4J43A 1YB4A 3AUSA 3RKUA 4FIZA 4RZHA 3VVCA 3W4IA 3HADA 3D4OA 4RF2A 2AQ8A 1LRKA 1X14A 4RQTA 4GPD1 4XGIA 1T26A 3KXDA 1E6UA 3RUAA 5THQA 3SEFA 1CEQA 4XEHA 4CM8B 2DUUA 1GUZA 3OA2A 1B3RA 5G0TA 2Y1DA 2AE1A 1JVBA 1GQQA 1Q0LA 2YY7A 3K5PA 2A9FA 1H2HA 4YT2A 1U3VA 2Y0EA 1X7DA 1BSVA 3G49A 2C0CA 1BVRA 1NQTA 2B5WA 1P77A 3PGJA 3AOEA 5JMPA 4J90A 1C1DA 4NBVA 2GUGA 3TPCA 2HK9A 3V1TC 1SB8A 2FN7A 3S55A 4AG3A 3DB2A 4IUYA 3QJ5A 3AJRA 1H6DA 5H83A 1XA0A 1LBEA 5J23A 5HM8A 2NU6A 3TRIA 3FNHA 4UVIA 1MGOA 5DOZA 1NYTA 4IDBA 4NBRA 4ALIA 3INRA 4W6ZA 1R16A 1MX3A 3KUXA 1EVJA 1H0KA 1YQDA 1A72A 5EN4A 5L4LA 1YJQA 1UDBA 4EGFA 1UR5A 1KEVA 1U3UA 2O7SA 3OF2A 4E4YA 1Z7EA 4D3FA 3GHYA 3U3XA 1B7GO 2DTXA 2AEMA 3CSDA 4IJKA 3C85A 3UCXA 5L4SA 3JYNA 1AE1A 3E8XA 4PLGA 1YH3A 4DYVA 5CPFA 1B26A 2YV3A 1JWBB 1VM6A 4WLNA 4XQ9A 2VYVD 4DTIA 3ZWMA 3OP4A 5TT0A 1CJCA 2Q22A 4B7UA 1ZZEA 4YTEA 1ZEJA 2HQ1A 1WWKA 4FOSA 3MCVA 4LVCA 3AWDA 3CMMA 3GT0A 3NV9A 3H2ZA 2ILTA 4ZQHA 4E6PA 2BFMA 2GCGA 4J9UE 4QXMA 4YB8A 3DOJA 2CDAA 4IIVA 4WEQA 2W4QA 3JQ8B 1Y8QB 3NX4A 4A2CA 4JJGA 4Q3CA 3QA9A 2DM6A 3WGQA 4NG5A 2SCUA 1C1DB 4MIEA 2D0IA 3M2TA 3DWFA 3W4KA 1KYQA 3QLJA 4BGVA 3VZRA 2PH3A 4BO0A 4IINA 1NWHA 3MJCA 4IQ8A 3DL2A 3PQDA 2UUOA 3BTUA 4J1SA 3CXRA 4YWJA 2IXAA 3V2HA 1QYCA 1EZ4A 1N92A 1V9LA 4WCFB 3RASA 4B7XA 1EVZA 4MVJD 1YWGO 2FSSA 4DGSA 1LNQA 3DXFA 3WS7A 3BMNB 3SXPA 4CMGA 3ZNPA 4MIYA 1C0LA 3U4DA 5EERA 3KVOA 3LF1A 5KKCA 3WQSB 4WLEA 2LDBA 3PHLA 3LYLA 3KETA 1NPYA 4YJFB 2VT3A 1P1JA 4MP8A 1IUKA 1D7OA 3JCZA 3GFGA 3JQAB 1T24A 5IDYA 1PL6A 4WCFA 3BXXA 5IXYA 1HE4A 5TJHA 4TRJA 4R3WA 4AJHA 4KQXA 1LJ8A 4BQRA 5T5QA 3ZWNA 3DFUA 4XRRA 3B1KA 2PV7A 5G4KA 1SPXA 2EGHA 4XIJA 2CY0A 3T4XA 5FI5A 3M6IA 4GGOA 4MOWA 1QLJA 2Y1CA 3AUTA 4Z0PA 2ZB3A 3BMCA 2OP0A 3KBOA 1IHYA 1LRJA 4CM9D 3E6AA 2O2YA 2OGUA 4PLPA 3DFZA 3X2FA 2DTEA 2HK7A 1NASA 1P1IA 2Z5LA 3A06A 3TZHA 3WBFA 3H9QA 3DZJA 5CG2A 2JL1A 2RH4A 5JAQA 3GUYA 3OQBA 5LC1A 5T8KC 5CP8A 3VHRA 5KCZA 3TDKA 3IKVA 1NVTA 5KJ6A 5CDTA 2C54A 1O95A 1JTVA 1HE2A 3KB6A 2PH5A 5M6DA 4A0SA 3U5TA 5U9CA 5LCXA 3EZYA 2JAHA 2VOJA 3JQGB 4HUJA 4J7UA 2JKVA 5C37A 1BVUA 3D0OA 3M1LA 1QLHA 1CRWG 1UZNA 3KV3O 1I32A 2P68A 1WNTA 4CM4B 1VL0A 2W2LD 5KNLA 2VHVA 2J3KA 2C2XA 3GN1A 1GPDG 3WB9A 5BR7A 3CKYA 4E5YA 4MPDA 3AFNA 4QO8A 2PZLA 1HDXA 2B83A 2OFPA 4XB2A 1SNYA 2R2GA 3DONA 3ITDA 4ZN6A 2ZATA 1X7GA 4YQYA 4BB5A 1BHSA 3FNGA 2VZ9A 4PN3A 1F8FA 1RWBA 4RDIA 4NHEA 3UFXA 1H93A 1DFIA 3L9WA 2WE8A 2DUWA 4TKMA 2J8ZA 2PKQP 3WICA 1M6WA 1EE9A 3BMNA 2C82A 4ROSA 3GRKA 4CMIB 5ITVA 1H94A 2HRBA 1U7TA 5BNFA 4BVAA 4UEKA 2V7PA 2VZ8A 2IZ0A 4JP3A 1PGQA 1PSDA 3LDHA 2HMVA 4EBFA 5CPBA 2X5KO 2DBZA 4LMPA 1Z45A 4PZDA 4CQLB 1Y81A 3GF4A 3MOIA 2CF6A 4CQMA 3MJ4A 2DBRA 4XYGA 1G6KA 5A5EA 3WQRA 1XIVA 2EG9A 4BGEA 5B12A 4UVEA 1J0XO 3E82A 1NFQA 4I9NA 1YL7A 1C0KA 1U5CA 5A06A 3LLVA 3S2IA 4D46A 4DMMA 2VYND 1Q7GA 1C0IA 4M87A 3D7LA 3AM3A 1ZJYA 4CV3A 3ZWWA 4XIYA 1LSOA 3JQ9A 4DC1A 1WMAA 1DBVO 3U62A 1XYGA 5AQ1A 3GNSA 5L7TA 2Q1SA 2Q46A 1ZSVA 5DCWA 1T2EA 3JQDA 4D3DA 3ZHXA 4RVSA 3D64A 2QYSA 3S8MA 1ZK2A 2B4TO 2PKQO 1UDAA 5CAEA 5ENVA 3U9LA 3BHMA 1E1MA 2YFHA 4AJIA 1MA0A 1WLYA 4AJPA 1BDMA 4M54A 3KRTA 3RUHA 5B1YA 3PHGA 2VHWA 5COQA 2JFFA 1FDSA 2Y93A 1VSUA 2HO5A 3K9QO 4NFHA 3O4RA 1I36A 2IE0A 3Q11A 3EDMA 1DB3A 3FR7A 3Q2KA 3JV7A 2X0JA 4BV9A 1ZKMA 1LC0A 5C7OO 2DBQA 1UAYA 4GX2A 5L51A 3VKUA 3ZGYA 4FC7A 5HBRA 3PLRA 3T4EA 3KSDO 1I01A 4EW6A 4EEZA 2J6IA 4DWVA 3BTSA 5JC8A 4R9RA 1ZCJA 4RO0A 2C59A 3S2EA 1EUZA 2YDYA 4PLFA 2FPPA 3IJPA 1VJTA 2D5CA 4C7JA 3JQFA 3MJEA 4FGWA 1YKFA 4EZBA 2BGKA 2WM3A 1ZMOA 2D8AA 3PHHA 3F4BA 3I83A 5A9TA 3Q0EA 4Y9DA 1KVRA 4BQPA 4MVJE 4PLVA 4GKBA 4FR5A 5TX7A 3F6YA 5I7VA 1LDEA 4WGGA 4TVOA 3ONDA 4B4WA 5JFOA 1HLPA 1C3VA 3NGXA 3ON5A 2ZCUA 3QY9A 4ALKA 1E3WA 4RPJA 3NAQA 2OORA 2WDZA 1U2DA 4QO7A 2VWHA 5ES3A 4NNJA 3ZU5A 2JCXA 2X0IA 3VOSA 1E92A 5TC4A 3OM9A 2GO1A 3H2SA 2QQ5A 3VPHA 4CV1A 2AG5A 4GI2A 2UUPA 5C3MA 1UXHA 5F1OA 1ULSA 3KYCB 4YT5A 4PG8A 2EF1A 4KQWA 3V2GA 1E3IA 4I5GA 3PHIA 3DMTC 2CVQA 2Z1NA 3PJFA 4BO8A 4BNKA 4J91A 3VZPA 1DFGA 1UP7A 3TZ6A 1C1XA 1Y5MA 2VHYA 3EHEA 4NH4A 2VRBA 3DZBA 2O7QA 2PFGA 2BI7A 5HS4A 4BB6A 2CUKA 3HN2A 3WYCA 3ORFA 4JBIA 1Q0HA 1HSOA 3E5RA 3SLGA 4J1NA 3FR8A 3K96A 4JX8A 2GRAA 1WP4A 5K9ZA 3GK3A 4WECA 4CM3A 3MJSA 2B4RO 4CLRA 4FBGA 1YVEI 3F5SA 3VH4A 1K2WA 5IZ4A 5FF9A 3WGYA 3HN7A 3DBLA 5FEUA 2IZ1A 3HNPA 4R51A 3KSUA 1TB4A 3H5NA 3ZNQA 2WYUA 4BKRA 5DOVA 3U4HA 2EERA 4LMRA 4CLDA 3KZVA 4J6FA 3L0DA 4ZQBA 2QIOA 2IYPA 4WUVA 5EL0A 5C7LO 1ZXBA 1K89A 9LDTA 5JAZA 2NACA 3MZ0A 3QWAA 1UP4A 2BF7A 1ISHA 2NSDA 3NEPX 2Z1MA 3D1LA 4M8SA 5JDCC 2CSUA 2Y66A 2HMSA 4QT0A 2PZJA 5ER9A 2O48X 3CMCO 1J6UA 2EKPA 1XU9A 1Y5RA 4RL6A 1PZFA 3O8QA 4E32A 2X7HA 4WASA 2OMEA 3QQPA 3P2YA 2Q2VA 4IQ0A 2PY6A 3FBGA 4OM8A 3CZRA 4CR8A 5JYEA 2X0RA 5A9SB 3OIGA 4CV0A 4WJZA 5A4DA 1I3LA 1G0NA 1LA2A 1W6UA 1CWUA 2YJZA 4DQUA 2VTDA 1RM5A 4L4RA 3AI3A 1I2BA 1YDWA 3RUFA 3PP8A 1YGYA 2EJWA 3W4JA 1EDOA 1E7QA 2R00C 1UP6A 3GH3A 4GLLA 3ZZNA 1Q0QA 2VWGA 3BMCB 3JYLA 1DO8A 1GZ6A 4AJNA 4F6LA 3G0OA 3VTZA 4L8VA 3A9WA 2WEKA 2ZIZA 4PRLA 5G4KB 4BKOA 5I8WA 4L4SA 1XSEA 4Q3AA 1P1HA 3OQ1A 3WGZA 4XQEA 2VQ3A 1N1EA 3RU9A 4F6CA 1MC5A 2WTBA 3WNVA 4YAEA 2YYYA 5I9MA 4F45A 5JYFA 3SC6A 5KOIA 4CMEA 1MV8A 4A10A 4PRKA 4YT4A 4YPOA 1F17A 5IN4A 3FNFA 3S1LA 3LQFA 2G1UA 1W73A 4M86A 2GLXA 3CZMA 2NU8A 4DVJA 4XYEA 4BNIA 1ZNQO 2GZ3A 1QORA 1HDYA 2B36A 4CMJA 1SEVA 3ONFA 2UYYA 5KVQA 5TQVA 2X58A 1AXEA 4EEXA 3PWKA 2VRCD 4EJ6A 1V35A 2YQ4A 1QR6A 2V6BA 3DHNA 3H9EO 1X1EA 1V3TA 4MKZA 1RJWA 2GSDA 1QV6A 1AGNA 3ZHZA 4G81A 3ST7A 2YQ5A 4CM6A 4GVXA 4ND3A 3RBXA 4DMLA 1M66A 2Q3EA 3OBBA 1JDJA 4EYEA 4ITUA 1PJ4A 4OSOA 1KOLA 4BNHA 3GLQA 2W2KA 1MC4A 5A9SA 1M67A 2E49A 2O3JA 3OSUA 5IDQA 2ZKLA 2FPIA 1LLQA 4FQ8A 1RM3A 3WNQA 3OJOA 4XX0A 5L95A 3I6IA 4RORA 1MXHA 3QIVA 3WQQA 3UN1A 1R15A 2NU9A 4H7PA 3WOHA 1KVQA 4UVGA 1YB1A 1K6XA 2OBNA 5I9LA 4I9HA 3JQEA 1LUAA 4G2NA 2QHXA 1BMDA 3BA1A 4FFOA 3LK7A 5JW6A 1IOLA 1B8PA 1OMOA 5CG1A 4YR9A 1E3SA 1DXYA 4TRMA 4GMGA 3KOUA 4MVJM 4PVDA 4R1UA 4TZKA 1E0DA 2ZK7A 4KDEA 2E4AA 3L07A 3W6ZA 3C7CB 2HCTA 1DSSG 1VKOA 5EMHA 4BL5A 5IZCA 4Q3DA 5IJZA 5ILOA 4DPMA 3IJRA 1BW9A 1P1FA 1KIFA 1P0CA 1E5LA 4TKLA 1LLDA 3K2EA 1B16A 5JYAA 5IF3A 2P4HX 2FZWA 2O3SA 2ZTMA 4GLOA 5TT1A 4BKQA 1YONA 1YJ8A 1GD1O 2I76A 2JCVA 3VPSA 3UKOA 3TZKA 4WLVA 2WD7B 3ULKA 4AJKA 2B5VA 1UUFA 5JNLA 1HTBA 4OQZA 4E12A 5G2OA 4L76A 5ADHA 5G0WA 4LRTB 3DR3A 3GMDA 4R5HA 4W99A 2FRDA 1QRRA 4D42A 2X5OA 3NGLA 1SAYA 5TIIA 2GN8A 4HFJA 3PJGA 3TFOA 5ICSA 3CIFA 1E3WB 1GAEO 2AW5A 1HSZA 2GPTA 5F1PA 5TGDA 3M1AA 1TT5B 3AI2A 4FN4A 4M89A 4Q9NA 5L7WA 4BNZA 2WSBA 4NJOA 2NM0A 4RVGA 5F1KA 3JQ7A 3RQSA 5I7SA 5GMOA 5JMWA 3DC2A 1AUPA 4OXYA 1TEHA 1GUFA 1IE3A 1M76A 4NU6A 4OXKA 5JDIC 1PEDA 4FFRA 4NR0A 4IQGA 3MEQA 4MDHA 4OOEA 1I2ZA 3NJ4A 4NZ9A 1RYEA 4E2YA 2PK3A 4CLHA 3GMSA 5DBIA 3IP1A 4H15A 2Q4EA 3WLFA 2HKIA 3DAGA 4ILKA 3UF0A 4B79A 3RVDA 1UZMA 3R0IA 3JD3A 4WOJA 4PLTA 9LDBA 2HMTA 3EMKA 3GFBA 3H5RA 3JQGA 4FJ1A 4AFNA 4AJEA 1U9JA 3R1IA 4QEDA 3RWBA 3MJTA 3TL3A 2Q2QA 3V1YA 4EDFA 2IZZA 3FBTA 3WLEA 1IPFA 1NFRA 3Q9UA 2V6GA 1ID1A 1VRWA 2YHUA 2PA3A 3RSHA 1PU2A 4D44A 2I6TA 3WJAA 3D3WA 4A27A 2QG4A 4J3FA 3GPIA 2WMDA 4JN6B 1NWCA 1R4MB 3NJ8A 4BNGA 2VWQA 1DRUA 1Q7CA 3ROQA 4OO3A 1GTMA 4UVHA 4BIIA 2J3JA 2XF8A 1I0ZA 3VH1A 3TSCA 1FXSA 4J0FA 3UUWA 4M1QA 1NR7A 3AM4A 1YS4A 1NVGA 2PD6A 1E3LA 1EUCA 3V5NA 4K6CA 1QMGA 3ANLA 1VSVA 4D0RA 4CJXA 1ML3A 2VYVA 4GH5A 4BV8A 3HDYA 3FD8A 5DP1A 1K6IA 4AJOA 3OJFA 1SC6A 4HNHA 3X2EA 3AOGA 1DRVA 4IXTA 2HJRA 4Z0TA 3PJEA 4NK5A 2AQHA 4GKVA 1ZK1A 2PZMA 4NI5A 1UAGA 3JQAD 3NKLA 3WFJA 3GG2A 2YW9A 2OBYA 4DIBA 1CETA 3JQ7B 1DOHA 3ZV5A 4IDAA 3C8MA 3NT4A 2DU8A 2PGDA 3GZNA 3HFGA 4R1NA 4B8WA 4IIUA 1DAOA 2C20A 3HDQA 1UXKA 1N9GB 4D3SA 4U5QA 3G17A 1M75A 1YRLA 4GX1A 1GY8A 2A4KA 4XRGA 4BNMA 1U4SA 1E7WA 5A9RA 3FTNA 5IDXA 3HFSA 3AUUA 4UEOA 5U1PA 1X13A 3JSAA 4G5HA 2X22A 4NQZA 4PG5A 2Q2WA 3JD0A 5IZCC 4PIVA 2AHRA 1PJSA 5JCJD 1N2SA 2C7VA 1PZGA 1A7AA 4S3MA 1V3VA 5K6AC 1A71A 4U0JA 1IPEA 3EAGA 1VJ0A 3NDRA 2NVWA 3QRWA 1G1AA 1XKQA 4EI2A 3RAJA 1U1IA 1B0AA 2GZ1A 4BO5A 5JDIA 2VUSA 2W98A 4YA6A 3AOEC 5AVOA 3CUKA 4CUZA 1XELA 4GSLA 4BO1A 4AJJA 1I3NA 5IFLA 4O0LA 1A7KA 1B3BA 4OGWA 1KEPA 3D4PA 1LDGA 3H9GA 3ZW8A 2BMAA 1O9BA 1IY8A 2O3QA 2BFOA 3W8FA 1ISIA 1ZBQA 2CVOA 2ET6A 4QTZA 3GAFA 3K31A 2YV2A 1ULUA 4DPLA 4UEJA 4K6FA 4R3NA 2IRWA 3PFFA 4IMPA 4LSWA 1P33A 2EW8A 5ILGA 4HY3A 4RLHA 1VL6A 1PGPA 1NFFA 1KY5A 3B6ZA 5LDHA 1OC2A 4TSKA 5CEEA 4I5FA 2Y1GA 1LDMA 5AXCA 3VZSA 1CYDA 4RVUA 2OP1A 3W1VA 2BGLA 4W4TA 5TRTA 4TVBA 3TOZA 4IDGA 4W9NA 1J4AA 3JD1A 4Q3EA 2VYNA 4LW8A 2CNBA 3ADPA 1DIHA 2HJSA 4WKGA 3ZHYA 4LCEA 3EK2A 1PJCA 3BMQA 1XR3A 3RKRA 1NVMB 4E5PA 3OIDA 1WW8A 5TS3A 1VE9A 4II2A 3ROKA 3I3OA 4E3ZA 5TJ9A 5C7IO 3LLSA 3P5SA 4CPDA 5C5IA 2HLPA 4DBZA 2I5PO 3DZFA 5JO0A 4CR7A 1Z73A 3JQBA 3GVHA 2EXXA 3U4IA 3IAHA 1EBUA 3NT5A 2D2IA 1GZ4A 3JD2A 4HNGA 4JCOA 1T2CA 1MB4A 2X4GA 4DA9A 4IS2A 4YJFA 4X54A 1U7HA 2VHXA 3DQPA 4DLBA 1CQJA 4P8RA 1E1LA 3FI9A 2JJYA 2GN6A 2RH8A 5AYVA 3WWZA 3UVEA 3KTDA 3NTOA 3FNEA 5FWNA 1S6YA 3ZDFA 5A1TA 1UXIA 3WTCA 5A02A 1HYHA 2GYYA 2G17A 1HKUA 3KEQA 5TSDA 4CMAA 2NQTA 1NBOA 3OJEA 4FOOA 1BDBA 3WGOA 4BNFA 3OJLA 1DPGA 2X9NA 3B20A 1EK5A 4HFRA 3ANNA 2GASA 1OC4A 2PLAA 2FZEA 3E5MA 4BKUA 1CIVA 3ZW9A 1GZ3A 2W2LA 3VPGA 4GBJA 3GG9A 4PZEA 1TVEA 4K9DA 4NU5A 2O4CA 4AVYA 3F3SA 3W8EA 1FDVA 1S7CA 1MLDA 2VCYA 1YBVA 2DPHA 2WD7A 3HWRA 3OETA 4GAEA 4CMKA 4W7HA 1HLDA 4KTTE 3BTVA 2YFQA 3OECA 1T1RA 1XEAA 1NTOA 1ZVMA 4CUKA 1ONPA 2YDXA 1JVSA 3BHIA 4RPGA 4Y67A 4CLEA 1ZO8A 1FF9A 2BFPA 2LDXA 4JIGA 4E2WA 2CD9A 1B8UA 1P74A 1A4IA 3K6JA 4TZTA 4GL4A 4IJVA 5DT9A 4AJ1A 5JCXA 3RROA 4EITA 2D5AA 4FFPA 3DMYA 4AJ4A 4MVJG 2ZTUA 4RZIA 5T67A 4I1IA 4DC0A 4J16A 2XXBA 1GFSA 5JPIA 4FGSA 4CMEC 1WZIA 2Y05A 3JD4A 1UH5A 1R0KA 2X9VA 3ZWPA 1WDLA 1ZSNA 3H8VA 2VN8A 3I4FA 1R66A 1ZJZA 4EUHA 4PG6A 1XGKA 5DN9A 2G0TA 2C5EA 4S1VA 2NVUA 1ZH8A 4MKRA 3IMFA 4A7PA 3VZQA 4RDHA 3DZIA 5EPOA 3D5QA 3AY3A 1AHHA 2Y0CA 1EEHA 3QHAA 3GGPA 3PDUA 5G0VA 1NP3A 1R37A 3LC1O 3CPSA 5J9GA 5IDWA 2X0NA 3RC2A 3PWZA 4YCAA 3E9NA 3L6EA 3ZU4A 4G65A 5L7YA 4B4VA 1V6AA 1GEGA 1RYDA 2O50A 3BMOB 1NXQA 4UAGA 4YJGA 3WBBA 1SBYA 3AK4A 5JYDA 2E37A 1I33A 1MP0A 2H5LA 4BMVA 3N58A 4FB5A 3P7MA 3TJRA 4YJDA 4N5NA 4LGVA 4Z9YA 1PR3A 1IB6A 1GYQA 2FR0A 2NQ8A 5EINA 2B69A 4N5LA 3H5AA 2D59A 2BFAA 4BS9A 3IUSA 2CZCA 3O03A 3WSWA 5A05A 4NFYA 4J9VA 4OQYA 1HDCA 1ZK4A 2RHCA 2WYWA 3VDQA 2A35A 2GERA 3H4VA 1R0SA 1BXKA 4HXYA 3TZQA 3GN2A 4FFMA 4U8GA 3QVTA 5KWEA 3IL2A 2FR1A 1QYXA 3OFSA 5DF1A 4DUPA 1JAXA 1B2LA 4QSMA 4CQMB 4IZHA 4L0QA 4ZRNA 2ZJ1A 3SC4A 3WMWA 5EQFA 4BMSA 1SMKA 3GRPA 5DCYA 3KEOA 4XGKA 3ROMA 1YE3A 1Y9AA 5FI3A 8ADHA 1EQ2A 5KVSA 3MOGA 4ZHSA 4BNXA 4K1LA 2VTEA 5L53A 1GYPA 3GA0A 5COBA 3IUPA 3P2OA 4A26A 1N1GA 4HBGA 5JE8A 2JFHA 3PGXA 1YB5A 4XYMA 4OHUA 1UZLA 2D4AA 2Q1WA 3UOGA 4O59O 3NYWA 1ISMA 1BXGB 1EUDA 1XHLA 2IDZA 4FCCA 4P38A 4ZRMA 5HRUA 3LSYA 1UJMA 5L45A 3R3JA 1CERA 1ADGA 3JQ8A 4BUCA 3ZWCA 3UCEA 3QP9A 1T2DA 4XR9A 1BGVA 2POQX 1ENOA 1L7DA 2PKRA 3C3XA 3HB4X 3K8ZA 5L40A 5ICMA 1FDTA 3RU7A 1ZW1A 4Y6SA 2WJPA 2Y1EA 1I10A 1V3UA 5A3JA 3JYOA 4KWHA 4IGFA 2VWPA 2C7GA 3GAZA 2HDHA 4L74A 1CF2O 2J3HA 4IDCA 3ZWBA 3HJAA 4MJLA 3I9NA 4CM9A 2FSVA 3W6UA 1JLLA 1PZEA 2X8LA 4WCDA 4J49A 3RC9A 3VH3A 3GHHA 2QZ9A 3ONEA 3NDJA 3MTJA 4ZQGA 3WJ7A 1PL7A 4J1QA 5ENDA 5G4LA 1PQUA 4KOAA 4E33A 1GL3A 1SZJG 4WE3A 1R4NA 2JCYA 4E21A 1AXGA 1V0JA 2P9CA 2BI8A 6LDHA 1EVIA 4GSKA 1JA9A 1LQUA 4YRBA 3E18A 4XDYA 5KJ1A 3V2UA 5DCUA 1H6BA 4R69A 4E2ZA 1UXJA 4R4JA 3RFTA 4CMCA 2R00A 1HETA 2E6UX 1Y8RA 2PZKA 1B14A 5MGBA 4C4OA 4CUJA 4E0BA 2DQ4A 2RBEA 2UVDA 2QRKA 1KVTA 2QZZA 4L75A 1EFLA 3Q2IA 2DFVA 3I9MA 4DRYA 1ADCA 4D7AA 2GZ2A 4UREA 5GY7A 2ZYGA 3RFXA 3RCBA 3NTQA 4J4HA 1L1FA 3H6KA 3I9JA 1F14A 3ENKA 4XD2A 1ZXLA 4RJTA 5GZ6A 1GCUA 2HK8A 3M2PA 3BAZA 1MUUA 3GDFA 1H6AA 1GUYA 3EW7A 5A03A 2DTDA 5I7EA 3JQAA 2QYTA 5EQDA 5T73A 1HXHA 3O38A 3PIIA 4K26A 1NPTO 3G3EA 1PGJA 4XJSA 3BHJA 1OBFO 4HP8A 3PXXA 1E77A 4FFLA 5HS6A 1T2AA 1Q1NA 1DIRA 5AOVA 3QE3A 4CM5A 2GD1O 2EW2A 1JAYA 1LQTA 1D1SA 1LC3A 2H9IA 3PYLA 2X5JO 2QRJA 2VOEA 2Z95A 4OAQA 1KVSA 1O8CA 4IMRA 3OEWA 2CMDA 2OOSA 2EJVA 1D4FA 3PRJA 4ND5A 1DLIA 2Q50A 3N74A 5CEFA 3I23A 1P44A 4N18A 4LSMA 4DPKA 1GQ2A 3PYMA 3VH2A 3HE3A 2ZYDA 3ZV6A 3HUDA 1WZEA 5DBGA 5B4TA 4CLOA 4BO7A 3DZHA 1LTHR 3BTOA 4JQCA 1UXGA 2I3GA 1U4OA 1Z6ZA 1PJLA 2W90A 4C7KA 3GUCA 4M49A 1YL6A 1HDZA 2GN4A 2P91A 2UAGA 3LZ6A 4JXKA 3RUIA 3RFVA 4PLWA 3QV1A 4AJ2A 3TF5A 1ISFA 3DBRB 3H9UA 4B3JA 2Q49A 4M55A 4Z6KA 1HYGA 3WG9A 1CQIA 1IYZA 4MKXA 2ZQZA 3WR5A 4Q39A 3O8QB 4RPLA 3INGA 3FHLA 3L4BA 2FWMX 1NNUA 2WD8A 1D1TA 1B15A 2B4QA 2I67A 4ZQFA 3TWOA 4E5KA 4UULA 1PGOA 4CLOB 1HEUA 5JY6A 3LU1A 1K3TA 1TT7A 5CDYA 3DBVO 3S2FA 2H1SA 4R54A 3H9JA 2XXJA 1UDCA 3I6QA 1DDOA 1LX6A 1LXCA 3JQFC 2WWRA 3ZWXA 1LSJA 4IJWA 3NRCA 2IEBA 2RCYA 5F5LA 1QKIA 2Q1UA 1A9ZA 4MINA 1M6HA 1U28A 1DIBA 4ZU3A 5MDHA 4NPCA 1O6ZA 3H65A 3OMLA 4HKTA 4MP6A 3UICA 1C0PA 4ZGWA 4CLRB 2QW8A 4FJ0A 1TT5A 1H2BA 4KWIA 1YQGA 1RKXA 3LT0A 1WMBA 3PQEA 4YQZA 1K6JA 4Q3NA 1DIGA 3LC2O 5BNTA 5JXWA 4GQAA 3VC7A 4JBGA 3RJ9A 3TOXA 5T6BA 2E48A 1GDHA 3OQ6A 4E31A 3UGKA 1HDGO 3FF4A 3JTMA 4EUEA 2BELA 4PLYA 1PJBA 1DEHA 4B7CA 2VNSA 1Y6JA 3PIDA 3DAFA 3GOHA 3QWFA 3L4BC 1Y8QA 3TFQA 4O5OA 1O0SA 3PZBA 3OIFA 4CM7A 1NQ5A 3L4SO 1FMCA 1NAIA 1Z82A 2B35A 2DBVO 5BT9A 4I8XA 4BO3A 2V6FA 4CQMD 4YXFA 2JAPA 3R6DA 2P9EA 5CDUA 3AUAA 4BNWA 3RJ5A 3PDJA 4IBOA 4U6QA 4B3HA 4BO4A 4GVLA 5I8ZA 1IZ0A 3VPXA 8LDHA 4N7RA 2ZJ0A 1Z7BA 4IDFA 4PCVA 1R4NB 2Q99A 4PLHA 4P4GA 1GEEA 3LC7O 5F21A 1YQXA 3GR6A 3OEYA 2OZPA 4MVJF 4XQGA 1E6EA 2CDCA 3PEFA 4U0KA 1NQOA 3ZNOA 1XQ6A 4NMHA 4OKNA 1ISJA 1VKNA 4OIMA 4CODB 3VAZA 3Q9NA 3EYWA 1FDWA 1K0UA 1BRMA 6ADHA 5KJFA 4Z9FA 1ZK3A 1DHRA 2DPGA 4R41A 3GGOA 3AY7A 3PFWO 2AEJA 4DYDA 4OOFA 3ZWYA 1XQ1A 3WGHA 1E3JA 1P1KA 4KUGA 2EGGA 2PWZA 3LT2A 1FJHA 2WYVA 4RGBA 1SOVA 5THKA 3VPFA 3ZCXA 1F0YA 3NT2A 1VPDA 5LDGA 1PQWA 2NWQA 1YOVA 4LRSB 1U8FO 1F06A 2VRCA 1PWZA 5G0SA 1I30A 1J5PA 2J3IA 1LI4A 2Y68A 3P19A 4INAA 1MG5A 3V8BA 3H7AA 1KBZA 1K5HA 1EFKA 5BSHA 4W7IA 3DBLB 1BWSA 2NLOA 1O89A 7MDHA 4KDFA 1P45A 1HT0A 3IP3A 2X9GA 4BNNA 3K92A 4AICA 4YBZA 5JAIA 4CLXA 4ZA2A 1TA4A 3QVOA 1MXFA 1YL5A 4XQCA 4A5OA 4DIOA 1JN0A 4AL4A 3FN4A 1R12A 4RQUA 3WSVA 3ZV3A 1N8KA 2R6JA 4XCVA 4Y6RA 3T7CA 1HF3A 2UV8A 4RCVA 2NUAA 5IN5A 3I1JA 1JQBA 1PWXA 2CVZA 4JJIA 3L9XA 4DREA 2ZCVA 3IS3A 3RC1A 4CL3A 1KEUA 4IY1A 2JD2A 4YRDA 3KLPX 3CINA 5IXSA 4HWKA 4H16A 3L77A 1LU9A 5DDIP 1XDWA 5H81A 5I7FA 4DLAA 2P9GA 4JGBA 4YDRA 3R3SA 2XOXA 4J1TA 4YT8A 4BMNA 2EV9A 3G1TA 3TQHA 2Y1OA 3GVIA 3ZNNA 1LEHA 3QVXA 4HFMA 4U7WA 1KERA 3WIEA 1O5IA 1DJNA 1BTOA 4IM7A 4J0EA 4WOKA 1DIAA 3DO5A 3GVCA 2FY8A 3ASVA 4YJHA 2ZB8A 1U5AA 4UUPA 1EVYA 3U4CA 4ZICA 3HHPA 5CHEA 3U09A 4II3A 4OKIA 3E9QA 4KMSA 4O63O 2RHRA 4J7XA 2V65A 5AXBA 1Y7TA 3L6OO 4HFNA 2VHZA 2C07A 2RIRA 1P1RA 1PJ2A 4CL8A 5TF4A 1OZAA 3UW3A 4R5MA 1ENZA 2J5RA 3K2BA 3DZKA 3ETGA 3E03A 4PFJA 4W82A 3B1JA 4KTVE 1I24A 3PPIA 3RUEA 3D3WB 1RPNA 1W4ZA 3PI7A 4J4BA 4RF4A 3KYDB 2NV6A 1DC3A 4GWKA 4D43A 2HU2A 2AE2A 2G5CA 1MG0A 5BSFA 1ZMTA 1J49A 3A28A 1I8TA 1XU7A 1DJQA 3RUDA 4H3VA 3WXBA 1GCOA 2BHLA 5JO9A 1EQUA 1P3DA 1B8VA 2ZYAA 1F8GA 3WIDA 2NU7A 3RIHA 3TL2A 2P5YA 3B1FA 1QXSA 1KS9A 2CDBA 3IDSA 3AU9A 3KYCA 1YO6A 2B0JA 2X1HA 1KC3A 1X7HA 4LCJA 1L7EA 4FDAA 4HADA 2AMFA 4IPTA 1X0VA 2H6EA 4XJTA 4RLSA 1RM0A 4J2OA 3L6DA 4NBWA 3SJUA 1QP8A 1PQPA 4TMFA 4R1SA 1PL8A 1P9LA 3DHEA 5F5NA 1DC6A 3K73O 4YAJA 5T64A 4B3IA 3C7AA 2O3RA 4YVFA 3ASUA 3UCFA 2Y67A 1HYEA 4CQLA 3SX2A 7ADHA 3FPCA 2HAEA 3DEYX 3OA0A 4LK3A 4GX5A 4XYBA 4IDEA 4QECA 3UAGA 1YBAA 2YHIB 4YJGB 3SLKA 3D5TA 5JDCA 3GQVA 3OICA 4E5NA 1PIWA 1FK8A 1SO8A 4OSPA 1ADFA 3EVNA 1GR0A 3NTRA 4P22A 1LRLA 1A4UA 1VC2A 1WDKA 3KYDA 4Y8VA 3QVSA 4WNIA 1HWYA 2GN9A 1NQAO 1ENPA 2C29D 2NADA 2NNLD 4P4NA 3BMQB 4BGIA 4OMUA 3GDOA 4XR4A 3D4NA 1HL3A 2JD1A 5A3VA 3JQ9C 4IDDA 3PVZA 4ZQEA 4D79A 1T25A 4TWRA 3FSRA 1GQYA 3HDHA 2ZB4A 1Z75A 3HZZA 2ZQYA 4CM4A 4UUNA 1JKFA 5JSFA 2I9PA 3N7UA 3KYBA 1BW9B 1LDBA 4HX5A 4B4OA 4D0SA 1DFHA 4KP7A 4WLUA 3PWSA 2VZ0A 2BGMA 2FR8A 4GMFA 4I5EA 4D45A 3F47A 2FOIA 1KC1A 2FP4A 5DBFA 1R4MA 2NTJA 5CFZA 2EP5A 1ZUD1 4OL9A 2PGJA 3TN7A 3HDJA 4YRAA 3WFIA 2BKAA 1D3AA 3G1UA 2OHXA 4WEOA 3A1NA 5BQFA 5CDGA 2EKQA 3JYPA 4FPXA 1GPJA 3PJDA 1HDRA 1U3TA 3F9IA 3GEMA 3EC7A 2X6TA 3AU8A 4BO9A 1ISGA 4NIMA 1P31A 1PJTA 2NVBA 3DOOA 5IAAA 1P0FA 4XDZA 4MVJP 4B8ZA 1DC5A 2ZTVA 3HQ4O 3KM0A 1C14A 1HE5A 4DLLA 1NM5A 4EJ0A 2I66A 3PZRA 3GY0A 3FPLA 4BNJA 2YV1A 1SEPA 3IQDB 5EIOA 4GX0A 4RVHA 1KETA 2IEDA 5DULA 4I5DA 1NR1A 3E48A 4KUEA 2O3UA 5IG2A 2GDZA 3DDNA 3FWNA 2TMGA 1JKJA 2YHIA 5T57A 4CM8A 3C1AA 3NDIA 2UDPA 3ICPA 4F46A 5HTOA 5KJCA 3ICCA 4BO6A 5FYDA 1EBFA 3DTYA 2NTNA 1JU9A 1ZEMA 3RD5A 5JLAA 2EP7A 1N9GA 2A94A 3VKVA 1TI7A 3QWIA 4MO2A 4KUHA 2O2SA 3SJ7A 3ZV4A 3GEGA 1EK6A 1EMDA 4YACA 4YYZA 4PVCA 4RVFA 1OFGA 3WX0A 5T8KA 1CDOA 1H9AA 4IGEA 3UH1A 3F4LA 4RPHA 3IC5A 4ALJA 4BNYA 3QW2A 1VL8A 1Q7BA 2HSDA 4JJFA 4B4UA 1SOWA 1GADO 3OH8A 3C24A 2A92A 5DZSA 3LT4A 4FC6A 4BO2A 1FDUA 4L9RA 2AQIA 4TRNA 3MTGA 3A4VA 3INTA 3K30A 2EKLA 3KO8A 4PG7A 1ZSYA 3UXYA 3RBZA 3PK0A 4WPGA 2FHSA 1MFZA 1NHWA 3KHUA 2Y99A 3E1KA 4BOYA 2JD0A 2G76A 5GZ3A 1LSUA 5F3RA 3DMTA 2OL4A 2Y1FA 4LISA 1XWFA 3FCOA 5HWSA 1W8DA 2XPCA 2PTGA 3JQ6A 2JHFA 4DQXA 5H82A 2I99A 5G0UA 5I9NA 3ZWVA 3BZUA 3F1KA 3C7DB 1I5RA 1O94A 1PS9A 2C5AA 4ZD6A 4PZCA 4CV2A 1N5DA 2J5KA 3SBOA 4JP2A 4FD3A 3WTBA 4N54A 4DXHA 3ENNA 5KIAA 3PLNA 4YAGA 3C1OA 1E3EA 2IODA 4BNTA 2NTVA 5K0ZA 3ETEA 3AW9A 1E7RA 4FS3A 3DAPA 4BGUA 3I52A 1LSSA 3S2GA 2Q4BA 2BLLA 4E2XA 1SCUA 2Q1TA 1M2WA 3CE6A 4BNVA 1H5QA 5AXAA 4JBHA 2GGSA 3GVPA 4MVJA 4ALMA 1ZIDA 4I08A 4E5MA 3VTFA 3H3JA 4MVJI 3I9OA 1JKIA 4YAKA 5JCJA 3ZWOA 4BHTA 3ZU2A 2W2KB 2E82A 3DHYA 5B4UA 1JW9B 2DKNA 3JQBC 4NBTA 1TXGA 1X1TA 4PLCA 5L9AA 3A14A 3F46A 2P4QA 3I9LA 2O3TA 3VDRA 2P2SA 1IHXA 1WXDA 5AXDA 4U6SA 1KY4A 3OHSX 4RV9A 5FFFA 3ABIA 1X0XA 4Y98A 2CF5A 4IXWA 1H9BA 2XAAA 1DAPA 4XZ3A 3PHJA 1W0CA 1T1SA 3H3FA 3RI3A 5U4QA 1PZHA 4W9NC 3ADOA 1QYVA 3PQFA 4GWGA 4ND4A 2EIHA 2X86A 2B37A 2FMUA 4R68A 4YEDA 4L73A 4ALLA 3U0BA 2TMDA 1ONNA 2AEFA 1I2CA 3GC6A 1ENYA 1KEWA 4TQGA 1VLLA 2DFDA 4ND1A 3I9KA 4QFDA 2I3AA 2AQKA 4JROA 1U3WA 5BSGA 4DIFA 1NHGA 1XCBA 1Y8RB 4WCFC 5DP2A 1V8BA 3LF2A 3IOYA 3KSZO 2DLDA 4MVJH 1E7MA 1E7YA 4JNKA 4BNUA 1HDOA 2O4UX 2WE7A 4QQRA 4NFSA 1LLCA 2PNFA 3GZ4A 3EY4A 4IJUA 4L4XA 4ZJUA 3C1TA 1DHTA 4J7CA 1HE3A 5JC1A 2ZTLA 2D3TA 1WPQA 4EUFA 4Z3DA 1WAMA 4UUOA 5JY1A 1YBMA 4FFNA 4R01A 2DT5A 2J5QA 2OXIA 5BNIA 4OH1A 4TRRA 1F12A 1ZFNA 5A04A 4URFA 1N7HA 4A03A 1E1NA 1IULA 4ND2A 3GGGA 3LVFO 3U49A 2Q45A 1NPDA 1H6CA 4XKJA 3V1UA 3DBRA 3HB5X 5B37A 3QWBA 4Z0HO 2FPGA 1GU7A 4Z3KA 3ROPA 4QX6A 2AG8A 3NUGA 1R0LA 2JHGA 1QYWA 1NX6A 3EGOA 2PGLA 4NBUA 2HMUA 3Q3CA 1NAHA 3TZCA 4R9SA 4XB1A 1SB9A 4NDNE 3MJVA 1PJ3A 2OO5A 4CMHA 5TLSA 4Q3BA 2PD3A 2O23A 3DOCA 3LT1A 1ZK0A 1ORRA 1BXGA 5L4NA 4BKPA 4HV4A 1GV0A 5JBIA 2X23A 3SVTA 1PR9A 1I3KA 4GGPA 4QFCA 3GNTA 4YJHB 1VJ1A 1Z74A 4XA8A 1KVUA 1RM4A 2DVMA 1WVGA 3W8DA 3I5MA 3AY6A 4ONEA 5KVCA 2RAFA 3WMXA 4J2HA 3Q6IA 4WNCA 1QV7A 2GNAA 2VT2A 1ARZA 2VUUA 4CM1A 3MWEB 4DQVA 4QUKA 3GPDG 3DBHA 1PX0A 3EVTA 1DLJA 4BNLA 4PLZA 4ALNA 3QVWA 5HA5A 3PTZA 3B70A 1ADBA 1N7GA 3ITKA 5KJEA 2ZB7A 1E7SA 3HG7A 1QG6A 4WK6A 3CEAA 2QX7A 1PGNA 3COSA 1E5QA 3GDGA 1LLUA 3EUWA 1XG5A 5B4VA 4A73A 3IKTA 4LVUA 2EWMA 1DC4A 3QWHA 4LN1A 4I9UA 3RC7A 4F3YA 3ETDA 5EJ2A 1WDMA 3G79A 4XYLA 3CTMA 2Y0DA 2H63A 2OUIA 3KLMX 4K28A 1LDYA 1Q2XA 2CFCA 4RVDA 3ZH2A 3OJ0A 4D41A 4OYRA 4CR6A 4FSHA 5BSEA 3FWZA 5CEJA 3GVXA 4DBVO 3F1LA 4ID9A 4TROA 3MWDB 1XLTA 3ZHBA 5KTKA 4CMIA 3RUCA 3BMOA 4ZVVA 5TNXA 4Y6PA 5KVVA 1OOEA 1QSGA 2V6MA 4EJMA 3IIEA 3VVBA 2F00A 1PS8A 2GR9A 4IZIA 2C2YA 3DZGA 4R16A 3ZN2A 1U8XX 4XWYA 2YZ7A 5ITWA 3GZNB 2EEZA 4MIOA 4OXNA 1Y1PA 1HZZA 4WLFA 1PJQA 5K6AA 2P5UA 3ZWAA 1X15A 1T4BA 3PYXA 3DTTA 4JK3A 1GV1A 2D1YA 4E30A 4ESOA 3BIOA 1A9YA 4NK4A 1I3MA 1PS0A 1T2FA 1A27A 1ONOA 1G0OA 1YXMA 2NVUB 4R1TA 4NJMA 4RPKA 2EHDA 3O9ZA 4P4LA 1AHIA 3WWYA 4KZPA 2VUTA 4JLWA 4XGNA 3GEDA 1MFPA 4N5MA 2YUTA 1EE2A 5CDSA 2JFGA 2IXBA 1YOVB 1IL0A 1TLTA 4NJMB 4O6VA 3AM5A 1EDZA 3QSGA 2G82A 4UUMA 1AN9A 4PG4A 1GYRA 3ZI0A 5A5FA 3E9MA 4IS3A 5JS6A 4RF5A 3GNQA 1T4DA 1D8AA 2BH9A 2I65A 3T7EA 4YAIA 1DRWA 1R6DA 1Y9EA 2AA3A 1BXZA 2HUNA 3TNLA 4AJLA 1A5ZA 5ER6A 1BG6A 4FJ2A 3HSKA 2PR2A 3Q1LA 3AFMA 1U2GA 4E13A 3AI1A 3D3EA 2HRZA 3I4CA 2VNAA 1PTJA 4RF3A 3WGIA 2W8ZA 1OI7A 1E6WA 3WYEA 3JQCA 5COAA 3ZU3A 3F5QA 2QRLA 1E1KA 1C1XB 2HMWA 4O1MA 1IZ9A 3O26A 4CMBA 2DAPA 2F1KA 3JYQA 3WGTA 3WGGA 2DC1A 1QYDA 3CH6A 4PGFA 5DNAA 3UHAA 2BRUA 2IYOA 2GF2A 4J4TA 3WYBA 3WDSA 3FTPA 5KKAA
chains in the Genus database with same CATH superfamily
1FA9A 1HRDA 1VI2A 2PD4A 4RA6A 4JUDX 5EESA 1KOJA 4OJNA 4MP3A 3ADCA 5BQXA 2CFTA 5E6RA 3N8HA 4JI2B 2OCBA 4ZALA 4W1SA 5GZ1A 3ANMA 3G0HA 3K4PA 1W1WA 4EB6A 1V26A 2J5XA 1AIPA 4KIUA 4PXAA 4EJSC 4GL2A 3DBHB 2E5LB 1O9GA 1P29A 1VIAA 1VIDA 3PNMA 3RKUA 3VZDA 3W4IA 4C07A 2FDCA 2DH5A 4MQEB 3JW8A 2AQ8A 1MB3A 2A59A 1K27A 3MELA 3P1JA 4MWSA 2AN3A 4G0XA 1E6UA 4MJXA 4AY4A 4BEVA 1CEQA 2V4MA 4X24A 4QQNA 2PAAA 1GUZA 5EQJB 4QU0A 2WB4A 4TQUS 1GQQA 4BXOA 1OJLA 2A9FA 3R40A 1H2HA 2Y0EA 2FEKA 1A50B 4MSUA 5EZ6B 2UYQA 3OLYA 3CZCA 3RIGA 3ZJ4A 4YUZA 1U2ZA 1NQTA 3PGVA 4D9GA 1Z39A 3O8BA 1UBJS 4J90A 3V4OA 4I1PA 4CQMB 4JL5A 2HK9A 1JG6A 4MCHA 4EYQA 3V7WA 2DPMA 4AG3A 4IUYA 1RVDA 4ARIA 4LDNA 3EIWA 1H6DA 1JAZA 2HA0A 4FHGA 4HH3C 1YZFA 2OQ2A 4PR3A 1D2HA 1K8YB 2AHOA 2CXSA 3JRWA 4GRIA 4PONA 5C8YA 5DWQA 2WNSA 4F38A 4K86A 5HM8A 1Z68A 2ANCA 4NBRA 1MRNA 4P3PA 4W6ZA 1TFRA 1NXXA 2A67A 3A6HA 2J46A 3SXJA 3UO8B 1Z7GA 1S7GA 2GN2A 2ZRLA 2CEKA 3KUXA 4XJXA 4AP6A 1H0KA 4IRMA 1ZVVA 5EN4A 2OQRA 1OHHD 3EUAA 3ETJA 1UR5A 2ZUWA 3ZC3A 1U0EA 3IDAA 5IJ0A 1G2OA 3MHTA 1TJYA 5AMXA 1TYAE 2BGWA 1ZCFA 2WJ3A 1HC7A 2VZEA 3U3XA 3FZGA 5EWJB 2H85A 1QC5A 2DTXA 3CSDA 4IJKA 5DE3A 5BN5A 3NO4A 5B58C 1NMEA 3UCXA 3I9FA 1AE1A 4L5YA 3AIMA 1YH3A 1P5ZB 3L7KA 4DYVA 4LFAB 5CPFA 4L07A 5JJ5A 2YV3A 1JWBB 3VU9B 2DWPA 4G5QA 2I3DA 1KMNA 4XQ9A 1XTIA 4DTIA 3Q6NA 2V7VA 2QV0A 3N2EA 3IMGA 1KMQA 4IHAA 5D2CA 1K2VN 3GT3A 2Q0XA 2TMKA 3PXGA 4RMHA 2VP9A 1DPFA 4FOSA 1I7LA 4TQAA 4KRXA 3EN0A 1XJWA 1RXEA 3CMMA 4PGMA 3QU5A 2GCGA 2J08A 1BD4A 1OHHA 1E64A 2C4KA 2JEZA 2VNHA 1P6XA 4IF4A 3TX2A 2PQMA 4IIVA 1TZBA 4UW9A 4WEQA 3UBMA 1U0SY 2W4QA 5JZ9A 2Q3LA 4A2CA 4JJGA 4A9AA 3PUVA 3ZUGA 2C2BA 3WGQA 2REXB 1WM1A 4JASB 4MS3B 2OHHA 4IDQA 1K4MA 2SCUA 1C1DB 2H9YA 1VMEA 3UK7A 3M2TA 1RKBA 1U98A 3EGDB 3DAOA 3IBYA 3UAYA 4BO0A 1FQKA 4TVSA 2PH3A 3Q7TA 4G1EB 1N6OA 1ZH6A 3JWGA 4J76A 4WW0A 3A6DA 3DL2A 1FRFS 3BTUA 2IXAA 3ENQA 4JUBA 2PSJA 2QSJA 3G5AA 1MNAA 4RMNA 1BCRA 4WCFB 5L8VA 3DLCA 2I0FA 5IWAB 1VL1A 5D3MA 3FKSA 1KI4A 4DUGD 1HKHA 4GC9A 2FSSA 4YP0A 1GNVA 2EFCB 4DLXA 4HLNA 5E3JA 2Z83A 4PSKA 2CL5A 3FHOA 3HVHA 3HJNA 4RV5A 1C0LA 3ZLUA 4FFVA 2XMCA 4WDRA 1DVRA 4EF4A 3K35A 2OCIA 3CVOA 3OFJA 1CQJB 4D9FA 5KKCA 3FROA 3WQSB 4UDYX 3LYLA 2GKGA 4EB6B 4UUQA 3KETA 1S1MA 4EKYA 1DC8A 2VXOA 4G6ZA 4KYVA 1A9XB 4C5AA 1CC1S 4QREA 1IUKA 4C7OA 1KI3A 4MR7A 3JQAB 1YCFA 4AZWA 1NZJA 2UUCB 5C3UA 3RT9A 2JBHA 4GMHA 2AN9A 1FFAA 2XTZA 4TLCA 3V33A 4AJHA 1JFFA 3I64A 3U48A 3VVLA 5C31A 1JZTA 2CEAA 2WFLB 1OY1A 3IUEA 2G3YA 3MK31 2WIDA 4HMOA 1NBAA 5BSUA 3TJMA 4RGQA 2CUNA 4DNXA 1P2GA 1Q3HA 4U7DA 1V8FA 1SVLA 1O1YA 3T61A 1PF7E 2EGHA 4CQNA 4GGOA 5BQ5A 1OXKB 5JROA 3LWZA 3AUTA 1HLGA 2ZB3A 2YQZA 1Z4PX 3AHIA 4N0QA 4WY8A 3SI7A 4DMRA 1OB5A 5TQJA 2DKFA 3G0DA 2AZMA 2B2CA 4CM9D 3E6AA 2BKEA 2O2YA 2OGUA 2WJ6A 3OQMA 4PYMA 4R1MA 2WPDA 2HK7A 3ZLBA 1P1IA 2B4AA 2NV0A 5TPZA 2JL1A 1XEFA 3VHRA 3OQBA 5KCZA 1VYVA 3TDKA 3L1UA 1JQJC 3KL2A 5KJ6A 4Y2RA 3CZQA 2ZWAA 4JJ7A 1HMYA 1O95A 2C54A 4F8JA 6CHYA 1YF3A 4QDJA 5JRJA 1TPYA 4CTJA 4B9AA 1M54A 4ND7A 3RJ5A 4B3TB 5EE9A 1EVLA 1AUXA 3ODGA 5IHPA 4HUJA 2VOJA 2OO7A 1DV1A 5C1BA 4PTZA 3CNBA 1MJNA 5GM2A 4E94A 3KV3O 1I32A 4LE1A 4K9KA 5AVUA 2RHJA 3KQNA 4Z3OA 1QX4A 2OD7A 2W2LD 1Z6AA 2GN0A 4OUKX 3L46A 2YINC 1GPDG 3WB9A 2AG0A 3HABA 4GOMD 4KJZA 4O4LF 1RQPA 4LHWA 4W8HA 1AMOA 3WJ2A 1NX9A 2FEOA 1TUBA 1B6GA 2C5GA 2O2HA 3B5IA 4OK3A 4WZZA 5DGCA 5AKLA 3LBYA 4MJ3A 3K6SB 4RTNA 5KQSA 2B83A 2OFPA 4BB9A 3H2HA 4XB2A 1JIUA 2R2GA 2XA1A 5BYBA 1JUDA 4BGDA 5HUQA 1R8JA 3L01A 3OLZA 1NVBA 3T9AA 2VZ9A 2GF9A 1F8FA 1T43A 3OX1A 2QD3A 1KSGA 2ENUA 3UYKA 3WYAA 1P3Y1 1L5ZA 1Q1ZA 1YNSA 5JCOA 2QPTA 1FB5A 3VKGA 4G37A 1BE8A 1CVLA 5KNCA 2J85A 3KZKA 3P20A 2XCIA 3GXOA 5LQJA 1EE9A 2H18A 3BMNA 4ROSA 1W0JD 4Y0AA 3NRJA 4EHIA 2VDMB 2Z2XA 1TAQA 1H94A 2R8BA 1DXOA 3CX7A 3GGCA 1U7TA 4LNHA 5I7OA 1S2DA 2FSGA 2BUCA 4MARA 4BVAA 4FKBA 5KNCD 3ISVA 3EZFA 3V1LA 5AUPB 1V6SA 2IZ0A 3OWHA 2IWHA 3T94A 1MQ8B 3I12A 1MO5A 1X8XA 2X5KO 1Z45A 1AC5A 5HG0A 5SZKB 1S8FA 3NHBA 1J5XA 4PZDA 2IHTA 3PQ6A 3A4MA 5NULA 3IAAA 3L84A 3HO1A 3BKXA 1G6KA 1RKQA 1XIVA 1U8EA 1DNPA 3BS4A 4UVEA 3AETA 3LHFA 4GOXA 1AKEA 3R4CA 2O1XA 1C0KA 1U5CA 5A06A 2V59A 2WTAA 3S2IA 2EJBA 4DMMA 1TCUA 4HGPA 2COEA 4IX9A 2VYND 1KZYC 4WJKB 4ZCLA 3W5SA 5L3QA 3GLUA 3IXQA 1WKCA 2Z30A 4FMDF 1E4EB 1YR8A 4GDMA 4FI3C 3PXBA 3OCJA 4HMQA 1K7CA 2QD5A 1KZHA 3U37A 5K05A 1T0IA 4P33A 4QDOA 1VKRA 4NU0A 3U62A 1EA7A 1XYGA 3GNSA 4X97A 5L7TA 2PUDA 2Q1SA 4UOEA 1TGVA 1G2QA 1PLLA 2I2WA 1C30B 4WFQA 3ZHXA 4ETNA 3S8MA 2HSWA 1Z0IA 1XD2A 1PQYA 1OFHA 2VHEA 2XUJA 3IT1A 2P78A 4RESA 5AVSA 5ENVA 2JB9A 3LIPA 9MHTA 4KQKA 1E1MA 3AH8A 3PWTA 1L0BA 3DZDA 1BDMA 2HCJB 3KRTA 4HWTA 1WVMA 4BPBA 5B1YA 1ST3A 4XLLA 3QKRB 5HF6A 3AV0B 2Y93A 3P0FA 4EHLA 1GTSA 1EM8A 5F77A 4GS5A 3K9QO 1CP3A 2L2QA 4NAUA 1AZWA 1HQDA 3OF5A 4M88A 3EDMA 3UMFA 1DB3A 5TPWB 4AIRA 3LO8A 3OUZA 4ZI7B 3TI9A 1JHVA 3IB6A 2HQRA 3JV7A 2X0JA 1N6RA 1SKYE 2YMPA 3PE4A 4PICA 5LR6A 3AEKA 3G7SA 1UAYA 2CJFA 2CLOB 3REQB 5L51A 5CK4A 3AERB 3SQDA 4BCCA 2BFFA 3ZQ6A 4A15A 1KO5A 4MULA 4TTQA 2J6IA 3SQLA 3BTSA 2Q5FA 2IIPA 3ESBA 3ABQB 1ZJ5A 1M2VA 1Z0KA 2VNKA 5L6LB 2WICA 2VYFA 3S2EA 1TEXA 2VBFA 3HBNA 4ZJYA 2O06A 3NVKI 2YDYA 2A8YA 4Q4HA 1HG0A 4LS3A 2V3VA 5BSMA 3NEAA 1SKMA 4NEQA 1YKFA 3EISA 3OC0A 3TNDA 5F78A 3K3PA 5JECA 3IQFA 5KNBH 1LNZA 2K7ZA 2WM3A 3EQZA 4HH1A 3QW4B 4Z1OA 5JHGB 3I83A 4MUKA 1QFMA 1P80A 3GMTA 4PRZA 3UBTA 4XUEA 4Y9DA 2JRCA 4N01A 4YP7A 1ZBDA 1PR4A 1LDEA 2EJTA 4HJXA 4DUGA 1IXZA 1BX0A 4TVOA 4WGGA 4A16A 2O5CA 2X1LA 4B4WA 5JFOA 3ROZA 1C3VA 1LS1A 4MW2A 3QY9A 3W8NA 1LPPA 1E3WA 4D8UA 4MW7A 1ZGHA 5F9HA 1VLQA 2GMWA 4R31A 1U2DA 4ZVNA 1ODJA 5BY2A 1JDNA 4JT8A 3FPGA 3RKSA 4I6JA 1EP9A 3BSYA 4TM7A 1XAGA 1IEQA 2JGFA 2PTHA 4X84A 1Y7IA 3UJ7A 5MGNA 3VPHA 3CRZA 3EQ6A 5GOZA 1G8YA 2P11A 3H2YA 2PZBA 3ZCVA 3MMZA 4O4IA 4GI2A 3GNLA 5F1OA 1ULSA 3KYCB 2NO5A 4YT5A 5KNDD 3V2GA 1E3IA 4I5GA 4KKXB 2NYUA 3PJFA 5BR4A 5JPCA 4BNKA 5JJIA 4JGIA 3RVLA 2VJLA 2BCJQ 2XGMA 2PH1A 2A2ZA 3U4QA 1V8OA 2GYVA 3HKEA 4DHWA 5CD9A 5A4IS 4MUNA 1W1UA 1G5TA 2V9PA 1K4YA 4LXXA 3H2GA 2PFGA 1USIA 1SQ5A 2CUKA 4BB6A 4INZA 3H97A 1XTBA 3HCBA 4JBIA 3ZGVA 3WLTA 1IZYA 2FW7A 3SLGA 1ZIOA 4O8JA 3NHSA 4OEHA 1US8B 4BZPA 3IWDB 1TX4B 2GRAA 2K2WA 3N70A 2JLQA 4WECA 2XUPA 3P8ZA 2HNAA 2P2ZA 3F5SA 3VH4A 5I47A 4HAYA 4EI8A 1FFHA 1K2WA 2G07A 5IC6A 4WY2A 4N6OA 4DEVA 4XWKA 4WK0B 5CLQA 5FF9A 3CG0A 1HFKA 3JAWA 4QRDA 3HN7A 3DT8A 2IZ1A 3HNPA 1XKTA 4R51A 4QGBA 1BH6A 2PS0A 3G2KA 4KAXA 4PWZA 1TB4A 5DNDA 2WYUA 2ABWA 5DX8A 2VVTA 2HOQA 3BK7A 1P6QA 4RY2A 2EERA 3L7JA 1QGED 3KZ1E 4JOCA 3LP5A 3LDUA 1UBLS 4J6FA 3TXXA 1SUCA 4Q6WA 1EFAA 2RSLA 1Y4ZA 1Y3HA 9LDTA 1UBHS 3KKLA 4M0KA 1AVTA 4V0MA 4F9FA 3QXXA 1ISHA 1LS6A 3FFTA 2NSDA 3OZTA 5YASA 1UPUA 3TXAA 4B44A 5HQ3B 2HMSA 3DMPA 1AH2A 1H2AS 4X1OA 3RS7A 1J6UA 4CGYA 3UAWA 1RABA 4Q47A 1BVHA 5T3UA 3T99A 3P9ZA 1DWQA 2YR0A 1IZZA 4FMPA 2ASEA 2X7HA 3K94A 4E32A 3QQPA 4FHDA 2GVZC 5CU7A 4EUKA 5DNUA 2CWDA 3FBGA 3AKYA 2C2KA 2QJRA 1GZDA 3D7KA 5JYEA 1FRQA 2A9VA 3AUYA 1P7CA 2GTPA 2VPTA 4G56A 1I3LA 5A4DA 1N78A 1G0NA 1OA0A 5K45A 5CA1A 2GD0A 1TEZA 5DGTA 1E32A 4UU0A 1RDFA 1YDWA 1CKEA 2QJFA 1YGYA 4D4LA 3W4JA 5SZJA 4C20A 3I0ZA 5HFAA 4WZBE 3ZZNA 3KQLA 4ZOLF 2XYPA 1PUJA 2VWGA 1II9A 3EZNA 1H0RA 3ZVRA 4AJNA 4F6LA 5KQMA 5A4FS 4YR7A 1A8HA 3G0OA 3H6HA 4L8VA 3NVDA 1Z6TA 2VYQA 4PRLA 5HFNA 4OTZA 4UU1A 5KUTA 4FU0A 2OZEA 1U8AA 3G2IA 2CMGA 4LX0A 1SU7A 5M3BA 1G6HA 3ND9A 3H9CA 3R6LA 1QQ7A 1CS0B 1MX5A 2QT1A 3LZDA 1AZTA 1MV8A 3GRYA 4L2IA 4YPOA 4IFTA 1F17A 2GKOA 3S1LA 4P0TA 4U7JA 1H05A 2DPXA 3A1VA 2ZRAA 5JNUA 1JLRA 4LRUA 2QV7A 3LX4A 2RJ3A 1XNJA 1Q15A 5FA6A 4CMJA 2GPSA 2O6LA 2MWMA 4B47A 1YCDA 3AHEA 3CEMA 1P2VA 3E7WA 2X58A 5EUCA 1AXEA 1NUAA 1PR1A 2CHFA 2XGGA 2X2FA 2UXBB 1JIJA 2VRCD 2A5DA 4EJ6A 3WMRA 1P7WA 4AZ3A 5BVHA 1QR6A 1RCFA 4MUMA 4TTRA 5HCUA 4D99A 2F3UA 3H9EO 4UNPA 4E03A 3Q1KA 5INTA 3L05A 1RJWA 1IY2A 1XDZA 1V4BA 5EUBA 1E3MA 4DR7B 1FP6A 3LX6A 4CNQA 1IOZA 1TPZA 2FKAA 2JLAA 4ZGBA 5WRFA 2OXTA 5KS2A 4G81A 1E9DA 4TXLA 1FFCA 5CH8A 2XZDA 3ST7A 2AFIB 2D54A 4ND3A 3NAGA 3RBXA 1TA0A 1CJBA 2YC4C 1A97A 3T5CA 3T3HA 4BU0A 4M1ZA 5C8YF 4AY2A 1A4XA 1N8TA 2JGMA 3EOBI 2XUGA 4BNHA 3O1JC 3OJCA 4KXXA 1VE5A 3M82A 1MC4A 3HZOA 4IVPA 1M67A 4JR2A 1NQWA 4K9LA 5ALDA 5A9SA 3H4TA 3WYDA 2WVHA 3EA5A 1SIBE 5EIEA 3PEEA 5KQRA 1I4WA 1RM3A 3WNQA 3I2GA 4XX0A 2VDWA 3EFOA 3HVKA 4PV7A 1MXHA 2FZCA 3WQQA 3EPKA 3DPSA 1BDIA 5FWXB 3ICEA 2Z58A 4PRYA 4PZ9A 3WOHA 4HRXA 2COUA 2VA9A 2QE6A 3QQ5A 5I9LA 2AN1A 3JQEA 1D1PA 3G85A 2QHXA 4MGZR 4QU9A 3RSFA 2FUG1 2J6BA 1M9NA 5JW6A 5CG1A 3QHPA 1DXYA 3AWIA 3GMIA 2XHEA 1Q16A 3MTBA 3TKLA 1S2MA 5IXJA 3BFKA 2BKLA 4PVDA 3GLGE 3UMGA 1V5GA 2ZOSA 1E0DA 2P35A 4QUGA 1H66A 4I2NA 1WL8A 2E4AA 1E6LA 3L07A 4ZRDA 2CMFA 5AIBA 5LP6F 2Z5FA 5JQWA 4KLZA 1VKOA 2QK4A 5JSZB 1Z5NA 5IZCA 3WDMA 1JILA 2R44A 1E4VA 2J6HA 4Y2SA 1F48A 3ZDDA 4XUGB 1L9XA 1XZAA 3FYUB 1X1RA 7YASA 3V32A 1E58A 4AUEA 2JLXA 4RENA 1JALA 4OD0A 1FMLA 1PT6A 4P5DA 3K2EA 1B16A 2H1WA 4JYPA 2B78A 3ZDZB 2WHYA 1DJPA 2FZWA 2I29A 5F7ZA 3TTSA 1JMYA 4LF4B 4BKQA 1B76A 2O7VA 4GBED 1YJ8A 6ABPA 1B42A 1GD1O 5JSUA 1P9WA 2JAXA 3X1JA 1F1BA 4PPQA 3TZKA 2WD7B 5LYJB 4GQBA 1T36B 3W5BA 1JL3A 3DCIA 2FQQA 2WV7A 1JENB 1FBTA 1UUFA 2B5VA 2BONA 1VJDA 4FYIA 4JC4A 4MUXA 3OHMA 3T41A 4C7BA 4D8TA 1HPLA 2PT7A 1OX5A 4O4HA 4IHQA 2QROA 2E6KA 4DABA 5BUCA 4NJEA 5G2OA 3O47A 1SBZA 4J0QA 4ZCQA 3TQRA 2FPSA 1TUGA 4W99A 2B99A 1CRPA 4PCUA 2QMZA 2IYRA 1AMNA 1YASA 3VNSA 2X5OA 3NGLA 1LI7A 2I7CA 5BN1A 1TMOA 1SAYA 3G2PA 5TIIA 4HFJA 3TFOA 3EWSA 3CIFA 2N0SA 5FUWA 2C97A 2AW5A 3FLBA 2Q41A 1X38A 3A7EA 5TGDA 1QPZA 1YR1A 1UFQA 1IAQA 1S01A 3IKJA 4YRTA 3SQMA 4BQEA 3NHZA 1IC6A 3PL1A 3X1ZA 4B6EA 1D8TA 3AI2A 4M89A 2ZYHA 4FN4A 4R8LA 3PTLA 1ZD4A 5L7WA 2K7FA 2WSBA 4I4TB 2PGNA 4A1FA 4RVGA 1RHRA 1PV1A 3D7RA 5F1KA 1F2UB 4XM1A 5I7SA 3D6UA 1ATIA 1JA0A 3JS5A 3DC2A 3MFYA 1M5RA 1AUPA 3DV2A 4OXYA 4UNRA 1IE3A 3WLOA 4RA6B 1QE0A 4P4SA 4FFRA 4I14A 3RJZA 2FDRA 5JLJA 1UMBB 3HJGA 3L8YA 3EPAB 4OOEA 1I2ZA 3NJ4A 4NZ9A 4YIKA 4ZTUB 1JBEA 2PK3A 4QFMA 1IN1A 4CLHA 5DBIA 2OGWA 2A9KA 3SR3A 4IKPA 1VI5A 4HYTA 3AEUB 3W77A 1E89A 1Z4JA 2EARA 1OGIA 1QIHA 2A1TR 3LYUA 4UBMA 3R7DA 2V3WA 5C52B 2I6FA 4G01B 3EMKA 3R7NA 4JQSA 4AFNA 3JQGA 4YC7A 1CDDA 4AKIA 3WLAA 4B0OA 3MIIA 1U9JA 3NC1C 2ZDHA 1DKOA 3BWCA 4G67A 3RWBA 4LDAA 1MB9A 2WTMA 2OAQ1 5SV2A 3IJ5A 3V1YA 2I3BA 1TCVA 4GXRA 1RC8A 4IVRA 2IZZA 2MSEB 2G1AA 3C5EA 4UEWA 5HK8A 3OY7A 5KAMA 4KAAA 3VSDA 4CCSA 4DJEC 4WZAB 1PU2A 2BFDB 3DEJA 4D44A 1ZCBA 2G8LA 1Z8HA 2I6TA 3D3WA 3QOXA 2IDJA 4G1CA 2OAP1 4HUTA 5K3DA 3GPIA 4JR0A 5B1DA 2W4IA 3Q8KA 1D03A 1Q57A 4I1VA 5C81A 1L7NA 2V7XA 3GRCA 3L06A 3NJ8A 1U2SA 2Q6OA 4FHZA 4QGHA 1K9VF 4F86A 4H35A 2QJTA 1QZXA 3PU6A 4OQMA 1DRUA 3SJZA 4PAWA 1GTMA 1R5NA 4R7GA 2WA2A 4M7PA 5EMJA 3VH1A 4UDXX 3TSCA 2D4HA 4J0FA 2WLTA 4KDRA 3RVKA 2BSAA 3ENWA 4TT8A 1Q7EA 4B32A 2PD6A 3V5NA 2VBCA 2GQ0A 2XA9A 4D0RA 2MSLA 2VG8A 2FYTA 3Q85A 1OLUA 3RU3A 4I9GA 4R2WA 4LJSA 1OI2A 1TYBE 1YHZA 3EEBA 4AMUA 1K6IA 4YMGA 3MXOA 4IAOA 4AJOA 1G4UR 1VBKA 4K3VA 4LRYA 1RW4A 4Q7MB 1UFVA 1KK1A 1MOQA 2BMFA 2YCLA 3GA5A 2HJRA 1QHGA 3PJEA 4IXTA 4NK5A 4ZZ2A 4Z7OB 1QE3A 4GKVA 4NI5A 1SZDA 3JQAD 3NKLA 4U9HS 4QICA 2O52A 3PC8A 2YW9A 5LQSA 3B9BA 3EJ6A 2ZGVA 1UBSB 3EIUA 4CU5A 1Z8FA 3LKZA 1Y1RA 1CK4A 5JQGA 4Z49A 2YZNA 3KXPA 4IDAA 2W2TA 3BD8A 4QFBA 4EX7A 5EE5B 4R1NA 3WKDA 4GRDA 2RK4A 5CFNA 3I6MA 1N9GB 2O8CB 4U5QA 3G17A 1M75A 4GX1A 1R5BA 4F1KA 4S1WA 1ZGGA 2O1EA 3H99A 3O93A 3Q7EA 4C3OB 4XRGA 3MTEA 1Y82A 2HXSA 4N8DA 5AKJA 2XGJA 1FNBA 3AUUA 1P2DA 2CJYA 3PDHA 4MICA 3HDTA 2GK3A 4L0CA 4Z8XA 1KORA 3H1GA 3DVSX 2Q2WA 4PIVA 4MDYA 1AK2A 2AHRA 1HQKA 4YDSA 3R9XA 1E1RA 3ZY2A 2C7VA 4FQ5A 4DV5B 4KPUB 2EJUA 1E1DA 4BDSA 1OGJA 5CR9A 4W1RA 3HEBA 1V3VA 2O9JA 5TQ0A 3FDXA 3PL5A 2GBLA 4LC9A 1IPEA 3EAGA 1EJ6A 3N2LA 3SYKA 5LSAA 3SHQA 4V0SA 4M53A 4LXYA 3L02A 1XKQA 1T5OA 4RHFA 4AY5A 4EI2A 3ZUPA 1B0AA 2GZ1A 3DDSA 4MYHA 4YLGA 3CNLA 5AP9A 2QPOA 4IOLA 1C7RA 1P81A 1TJNA 3IBFA 2VUSA 1FS5A 2W98A 2YWXA 3FPEA 3AOEC 1UBGA 3A1DA 5AVOA 4R9VA 3ZDXB 1ODSA 1XELA 4Z8YA 1SUWA 2IXFA 1THZA 1MQAA 5BMVF 1MRSA 4PBSA 4TMYA 4G5XA 1ABFA 4ZO6A 1LK5A 3IT3A 2IHBA 4OGWA 1MEOA 1NDHA 4W7SA 1QQBA 2Q29A 3U6KA 3D4PA 1LDGA 1SQFA 2C58A 3HNRA 1E5DA 4H0NA 5F2KA 1IY8A 3ZE7A 4AN1A 2O0HA 1HR0B 1JXMA 2WW8A 1MCZA 2CVOA 2ET6A 4QTZA 3VPBA 1J24A 1E18A 1TMKA 2AYXA 1KMMA 3AYXB 3WL5A 2Z8YM 4YAFA 2BMEA 1QANA 1XZQA 1LQ2A 5LKAA 3SC3A 2O8BA 3TQFA 4F4JA 2EW8A 2G4CA 1Z0JA 2BIFA 4HY3A 4BLSA 3O94A 1UM9A 1VL6A 2ZIXB 4R2KA 2GCOB 4RLHA 3UMJA 4CN9A 5HR5A 4MCAA 5HZGA 3QX3A 1PGPA 5CFRA 2ETVA 1TDJA 2FVXA 1TKRA 1HFWA 1K1EA 4MGKR 4TL7A 3MWYW 2R79A 1KKUA 4C3VA 4F3CA 5AVQA 1XCGB 1SCIA 2Y1GA 1LDMA 4WA8A 2IHVA 2BGLA 4LSGA 4TVBA 3TOZA 3RIEA 1J4AA 3ANTA 3T5PA 1XK6A 4LW8A 1P4HA 5FJIA 2FG7C 2BRUC 1QU2A 3UPTA 4GPTA 2HJSA 1X8JA 3ACDA 1IB0A 4IGIA 4C22A 1JZQA 6REQB 3DO6A 3BG5A 3IPLA 4TS9A 3OTOB 3EK2A 2BL4A 1BN7A 2XSZD 3OIDA 3H4MA 1NW5A 3ROKA 3I3SR 4KR9A 3VHLB 4E3ZA 2J59A 1XLVA 2O0JA 2P90A 2QI9F 3AYZB 3FSGA 2J3EA 3PT9A 5CK5A 3LLSA 5K1ZA 5TJ9A 3P5SA 3GP5A 5TARA 2DETA 1YNOA 4QGGA 4DBZA 2BMVA 1PTJC 4A2PA 5F7JA 3JQBA 4CR7A 4CW7A 3GVHA 1Y6ZA 5JH7B 5ENZA 3THSA 2D2IA 1ZXXA 3GAMA 2LIVA 3MA0A 2RBGA 3EXG1 1VZ3A 5C8VA 4JCOA 1XCOA 5DVZA 4YJFA 3MMSA 1A9SA 1EFVB 1X7XA 1KU6A 2IX9A 1U7HA 2VHXA 3NFRA 1E8MA 2OBBA 1XAIA 3AVPA 1Z12A 4P36A 5DLEA 5SY6A 4DLBA 3UMMA 1E1LA 2WZCA 1XZIA 1TKBA 2MCFA 3EWNA 4POAA 3HCEA 5JYBA 4MI6A 2P2GA 2ORYA 2NZXA 1GGEA 3KTDA 2GD6A 3NIWA 5FWNA 1S6YA 1JHRA 2ZBUA 4TVKA 3OZXA 5A1TA 3OOWA 4CMAA 3S27A 4BLUA 1JLMA 1GL7A 3OJEA 2WLSA 5FH9A 4Z4FA 3OJLA 1NYRA 5IKOA 1C7QA 3RVJA 2XQVA 3GRUA 3MAAC 4I1YA 2W0MA 4N8EA 4AM8A 3T95A 1NDUA 1OWNA 1OC4A 2O2DA 1XVIA 3EGDA 4BKUA 1CIVA 1RHJA 2SKEA 2Y6VA 3ZW9A 5CFOA 1C2TA 3PQ8A 4GBJA 3GGSA 4DDVA 3BE4A 3MGGA 1T0JB 4NU5A 3N8NA 3F3SA 4FX2A 4X1KB 2C9YA 3W8EA 4B3SB 3WNCA 1ZN9A 4QDTA 2B3DA 2OK7A 2QRZA 4CMKA 3EARA 2D5IA 4EL5A 3W2TA 4JC5A 4V1CA 2W42A 2PS1A 2B1RA 3OECA 3V48A 4Q9JA 1A2OA 4C05A 4CUKA 3DCNA 3WMFA 3BHIA 2E4VA 3BIFA 3FA2A 3QELB 4Q7JB 3TLGA 4B09A 2ZKIA 4S24A 1XMQB 1XHEA 1FLVA 4I9FA 5CW2A 2LDXA 4HZIA 4JIGA 4E2WA 4WV3A 1DKPA 2F8TA 3VAAA 4WN3A 1GZHB 2C61A 3W9YA 4DAOA 1ZGCA 3CH7A 4MQFB 3IUBA 3I2JA 1DQNA 1QVVA 1XLTC 4NZZA 1WD7A 2VF4X 4GM4A 2IYVA 1TQ4A 2AXEA 2Q27A 4EITA 1MC8A 2V74B 5EEGA 2GPAA 2NYAA 2FZ4A 1CEYA 1HH4A 2IZOA 3FVWA 3V9AA 2PEZA 4KQHA 4H17A 1RFLA 1IHDA 2ZTUA 4AJ4A 4D92A 4IJ5A 4UQLA 4H0FA 3E35A 1N57A 5C51B 3IEVA 4M3NA 1PNRA 1UWCA 5JPIA 1LFDB 2JA1A 2M1XA 3FLMA 1QCDA 2ERYA 3TVTA 2YXNA 2IGTA 2YIMA 3JD4A 1UH5A 1R0KA 2XKKA 2CJXA 2PIDA 3DL4A 4TV9B 3H8VA 4WBSA 2VN8A 4LXIA 3PENA 1BMQA 2D1RA 4MUHA 3I4FA 4KN5A 5BVGA 4P4UA 4Y1GA 1YTLA 2GJSA 1ND6A 2G0TA 3D0QA 1K8XB 1AKYA 3V7NA 3NALA 5GIPE 3NWJA 5EPOA 5BWCA 2ZEJA 3AY3A 3CT4A 2FP3A 3VO8A 2Y0CA 1EEHA 2Z2KA 2CL7X 3GGPA 3T5BA 3PDUA 4DJJA 1NP3A 3UUGA 2ZIAA 3CPSA 4MQ5A 3RAPR 3V97A 2IBSA 3B36A 4E14A 9ATCA 4YI5A 2X0NA 3QKRA 4MUJA 1T35A 2GRJA 3CGGA 4G0VA 1ZL0A 3SX4A 4G65A 2AVDA 4TS4A 2P9FA 3FGPA 4YAWA 5L7YA 3ZD7A 1Z0DA 2J9FA 2O50A 1NXQA 4YJGA 3G6KA 1SBYA 3NUZA 3WYFA 1LX7A 2H5LA 4V1CB 2XOKD 1UKAA 4C04A 2KI5A 3OKPA 3PRYA 3DE1X 3TIFA 3NW9A 5AUNB 4W63A 5K8CA 4Z9YA 5FOXA 1IB6A 2HW8A 3COVA 2FR0A 2RGEA 3S81A 2NQ8A 1MJFA 5EINA 5BYJA 1IH8A 1P2BA 2WI8A 3OZVA 3BCUA 1N4AA 5EJ7A 3H86A 1JVNA 5KI6A 1HK7A 2B1QA 4CIDA 5A05A 4DNPA 4OQYA 2ZRBA 2LUOA 3E53A 5F64A 1L8QA 2EZUA 3VDQA 4PFKA 2GERA 2C5LA 3A6EA 3C48A 4WXYB 2XCTB 4J0GA 2Q4OA 2H00A 4QLOA 1T1JA 4HXYA 5TXGA 4L6CA 1KH2A 3K32A 5KWEA 5HF5A 1XMOB 1JJBA 4DKJA 1JAXA 1RWPA 4EI9A 2IT1A 4GLBA 2PWBA 3ORYA 4OMFG 1O87A 5FB3A 3SC4A 1SIOA 3WMWA 4BMSA 5I4BA 3RVPA 3UJ9A 3E2PA 1M2OB 2PL9A 2P9ZA 3G5MA 4YCMA 5B30A 4ARZB 3NHYA 1EFVA 1YE3A 2DCUA 4GI1A 1LI5A 1AGYA 1J0AA 1EQ2A 3TIXB 5GADl 2W00A 2QYHA 1ITZA 1GDTA 4BNXA 4O25A 2R6DA 4U2FA 1A9PA 1HURA 3MVEA 2VATA 3O3OB 1DO2A 3AUJB 5I9BA 3VTAA 5L53A 4DQLA 3S8EA 3GA0A 3ITEA 5COBA 1K5DA 2WVGA 1I0IA 1O97C 3IUPA 3OZSA 3P2OA 5H7XA 3HDVA 1T29A 2PDAA 3IOMA 4UCFA 1UZLA 2D4AA 2NPIA 3NYWA 3P0HA 2D0DA 5DSZA 2CCGA 1BXGB 1EUDA 1PTKA 1XHLA 2TYSB 4FCCA 4BFZA 1Z25A 1FS6A 4PC6A 1LB1B 1CERA 2O14A 3NONA 2CLFB 5ALSA 5A0FA 4RKQA 4KXNA 2VJDA 3KALA 4R7TA 3V00A 3VUEA 3H0VB 1J97A 5GINE 4BUCA 3E4CA 3UCEA 3ZDCA 1F6DA 1QWOA 1ENOA 3KC2A 4JHXA 4D9HA 4MVXA 2HXYA 2L18A 3C3XA 3HB4X 3K8ZA 1T8YA 1KJZA 3PHBE 1T4CB 3LKVA 1CX9B 4P7JA 4QDUA 4AF7A 3VM6A 3RU7A 1ZW1A 2RHGB 4ABYA 2FXVA 2FSUA 2IELA 4KN9S 1XAHA 4JLJA 5A3JA 1G1MA 5D7BA 4IGFA 2VWPA 4O2AA 2VHTA 2C7GA 4BV3A 3CO0S 4HDSA 4QWWA 4BCBA 4CM9A 3HJAA 3LUGA 1XEWX 1DDIA 5EJGA 3RC9A 3I8XA 1OD6A 1WY5A 4H7KA 4V2IA 3AVWA 3Q7RA 4PGGA 3LRPA 1VMAA 3NDJA 2B8WA 1PL7A 4URYR 1QZ3A 3R7LA 3WJ7A 5G4LA 4E33A 2YJ4A 4KOAA 3F3YA 4ZCRA 1GL3A 2ALJA 3UK1A 2W0SA 1O2DA 2JHAA 2FF7A 1B0UA 1C41A 121PA 6LDHA 1EVIA 1JA9A 3LO5A 1L7XA 2HLNA 5KJ1A 2YXPX 4DR6B 2IUYA 3AXSA 1H6BA 1U6IA 1V7CA 1ZU5A 3PBKA 3KLOA 3UTCA 4FN5A 1E99A 5B3JA 4CMCA 3R24A 2R00A 2XDQA 2QTMA 1KDTA 4HDMB 1ZD5A 2PZKA 3EC1A 3WJ1A 2BFCB 5MGBA 1N5JA 3JARA 1KPIA 1L4EA 1L5HA 3SBXA 3UWKA 4CUJA 4ZT3A 1AV7A 3T12A 2UVDA 1KVTA 4RK7A 4LQLA 4WOBA 1IONA 1PT5A 1QO0A 2R6GA 3WK4A 1R0BA 1H1LA 2FR8C 3FZYA 1KE2A 3PNSA 4CCWA 5GY7A 1V7QA 3HH8A 4C5CA 2ZYGA 3ZHCA 1W34A 3DLAA 4D8VA 1USUA 4TWBA 4FZ5A 4RD1A 2IHYA 2PQ2A 2H2HA 3BE5A 4JOSA 2B7CA 2JNWA 1M0TA 1OH5A 1ZXLA 4RJTA 2HK8A 1MUUA 4DR1B 5E0KB 1VKJA 1QIMA 1RC1A 3EW7A 4F9GA 2G36A 1QR2A 2QYTA 4I19A 5EQDA 5H4HA 3EQ7A 1FSFA 3SCZA 3ZE6A 3PIIA 3HGTA 3VC3A 5KYXB 2ZBQA 2B1JA 1I3OA 4GG1A 1UK6A 4Q3KA 1QQAA 1NPTO 2F1HA 2V5UA 4QNRA 1BHQ1 1O6GA 1Z4NA 2J1LA 2ZR7A 2N75A 1IBMB 2ETXA 5IF9A 2DR2A 3SS9X 1ZICA 1CRQA 3URKA 3PXXA 5KO2A 2E5FA 1J2UA 3ML1A 3PITA 1Y6RA 2PKXA 2VEDA 5AOVA 1S02A 1YR7A 4NEHB 1XZJA 3KU1A 4CM5A 2EW2A 2W6QA 1HFJA 1LQTA 5D3MB 3M89A 3KQUA 3PYLA 1GZSA 4IH9A 2PMCA 1KVSA 2ZYUX 5ECGC 3RWOA 3CT6A 4IEEA 1FTWA 4L4UA 1NN1A 3PRJA 4OI0A 4QYWA 2W8BA 2W6OA 3SN6A 1USWA 3HV2A 1QF7A 1WIWA 1Z62A 3VV3A 4GKAA 1VG1A 4MQMA 4ZGGA 1VB3A 4DPKA 1WXWA 2UZ1A 3U13A 1UBEA 1U80A 5ESDA 5SZHB 2BM8A 4GOKA 4NQRA 5B4TA 1DP4A 5BN4B 3W6OA 4CLOA 2WU1A 1T36A 3BRCA 4HGNA 4ZFNA 3D5EA 2OT3B 1YUMA 4OHBA 1U4OA 1FSZA 4TGLA 3NXSA 3DE7X 5DLQC 2W90A 3SGLA 2M9MA 3N0VA 5HRCA 1G3QA 4Q1EA 3VPDA 1HDZA 2GN4A 4O4IF 4CNBA 1T0UA 3U1BA 4JAVC 5DTRA 1TCAA 1RE0A 3FDZB 1IVNA 2FOLA 4OHYA 1IM5A 2CV1A 3IQWA 4ZAYA 2PO5A 3LRTA 3FUVA 4AJ2A 1L1QA 3DBRB 3H9UA 1H2ZA 3P2JA 1SELA 2BISA 3I45A 2H4WA 3ZVMA 2RGGA 1XD9A 4DG9A 4Z6KA 1HYGA 3B6JA 4B6OA 1M34E 2XE7A 3FFAA 4ETMA 3QFHA 2OD9A 2NXWA 3BL8A 1W9MA 5A2QA 1JQDA 3WR5A 4Q39A 1PR6A 4KXVA 1DBIA 3MWJA 1N2IA 1AKVA 1OAOC 5FR2A 3GYBA 5FPSA 1BX3A 2WINI 5FOWA 1B15A 3ABZA 4G1MB 1ZP6A 2B4QA 2GTIA 5CVDA 2GRUA 1B1CA 2I67A 1C4XA 1VGRA 4ZQFA 5IMBA 4E5KA 4M1KA 2E4WA 4UULA 4F11A 4GXNA 5JY6A 3TLJA 1K3TA 1J9ZA 1VRCA 5FXMA 5JBNA 1ZD1A 2XD9A 2HSGA 1TT7A 4A92A 3S2FA 4JEUA 3PFBA 4R54A 4YLEA 2X5XA 4PO1A 3I2HA 2V45A 3C6MA 3JQFC 2WWRA 3QVKA 4TS3A 2XDYA 2GB4A 2AYYA 2II6A 2VDKB 3BDVA 2E55A 1NQVA 2Y8EA 3ENVA 4IJWA 4PQGA 1C50A 2VBGA 2PU7A 4WSOA 4UFPA 3QPAA 3I0NA 4MINA 1M6HA 3FH0A 1DIBA 4ZU3A 5MDHA 4NPCA 1O6ZA 2OHIA 5FO0A 1C0PA 2QTFA 2PMDA 4JT9A 1X7WB 2G80A 2COKA 1UM8A 1O4WA 3O21A 4FJ0A 2XRZA 1UJCA