1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords dihydrodipicolinate reductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
1Q0QA 3BA1A 3OEYA 5F3RA 3FF4A 4II2A 1H6DA 1IL0A 4TRMA 4KWHA 1T2AA 5JS6A 5JYDA 2WD8A 2VT3A 3I9KA 4ND5A 3BMCA 3R3JA 4TKMA 4OSPA 1U8XX 2LDXA 3KUXA 1U7TA 4CM1A 4I5EA 1W0CA 2G82A 4GMGA 3RUHA 2FOIA 3VPGA 5TSDA 4BMVA 2PD4A 4RJTA 2WTBA 4IUYA 2Q50A 1ML3A 3R0IA 2GASA 3A9WA 5ITWA 3LC2O 3QIVA 3GRKA 1ZEMA 3CZRA 4ALIA 4DMMA 1PGQA 4AJIA 3CMCO 1U4OA 1JKJA 5TIIA 1ZK2A 4YT4A 5ENVA 5JCJA 5JCXA 1BDBA 3DAFA 9LDTA 1PL8A 3UCXA 2EV9A 3PLRA 3IS3A 1DSSG 1M66A 5LDGA 4LMPA 5F5NA 2WYVA 4PG4A 3WMXA 1FDSA 1A7AA 2NU6A 2ZATA 1F8GA 2B5WA 4NK5A 1YE3A 4RQTA 5CDYA 1BDMA 5ER9A 3I4FA 3V2GA 3I6QA 1EVZA 4LVCA 4BNMA 3STHA 4TQGA 4TVOA 3LT1A 4IJVA 3BHIA 4RVDA 4YQZA 3T7CA 4YDRA 1WNTA 4HADA 3GZNA 3JD3A 5L7YA 5ITVA 1PQUA 4J1SA 1Y7TA 2QZ9A 2RHCA 4GKVA 1JKFA 5FI5A 5CFZA 1B7GO 4HNGA 2PKRA 2R6JA 3I5MA 4NFYA 4PVDA 2Y1FA 3IL2A 5CP8A 2E82A 5KCZA 4IQGA 5BSFA 4I1IA 1ZW1A 4KP7A 3WBFA 1X7GA 2FSVA 4NBUA 2CNBA 4ZQHA 3RI3A 5JC8A 4DYDA 3I1JA 4LCJA 4TZTA 2GSDA 4GH5A 4TSKA 1LRJA 4E2XA 4R4JA 2YV2A 5KVQA 2I5PO 2OBYA 3JQ8A 5JSFA 4ZD6A 4XRGA 1NHWA 4L75A 4EZBA 2O3JA 3MJSA 4G65A 2AHRA 1RJWA 5A5FA 2A35A 4U6QA 3C7CB 3MOGA 4WLEA 3AM5A 1HDYA 4FFRA 1NXQA 4I5DA 3WGTA 4PLYA 3MJCA 1K6XA 2GN8A 4LSWA 4XQEA 3G17A 5JAMA 3PHJA 4NBWA 4RPGA 2BLLA 5JE8A 4MVJA 2Q2WA 4MVJI 4BO5A 4UUMA 2C82A 3HZZA 4HP8A 5FFFA 4BGEA 3IKTA 3K2EA 1ZMOA 3FI9A 1YGYA 3ABIA 2TMGA 2VZ9A 3FTNA 1EUDA 2RAFA 2H6EA 3OSUA 3PHGA 5A9TA 4FC6A 3VOSA 4GL4A 1WW8A 2YY7A 2UVDA 4Y6RA 4OAQA 2O3RA 3OQ1A 2YFHA 1KVSA 4MIOA 1VLLA 1B8PA 2JCYA 3WBBA 4WEQA 4OXYA 2CDCA 4XGNA 1ZK1A 4FFLA 1QRRA 1PL6A 4HBGA 3WYCA 4NJMA 5EPOA 4LW8A 4CQMA 2J3JA 2VQ3A 4Y67A 1NQTA 3KB6A 3GUYA 1B3BA 1X13A 1VKOA 2HU2A 4PN3A 2F1KA 4NQZA 4QFDA 4W6ZA 4D7AA 3TJRA 4IDDA 2VTDA 4PLVA 1O6ZA 3GF4A 3K2BA 1U1IA 4RGBA 2PZMA 4OOEA 3SXPA 3RJ5A 4Q39A 5L53A 5ILOA 1OOEA 3ZWAA 1D3AA 1C3VA 4RORA 3TQHA 3PYLA 4ND4A 1B26A 4ALJA 5TNXA 3U3XA 2O2YA 3ANLA 1VPDA 2B0JA 2ZJ0A 2JFHA 3ADPA 4BNFA 5B4VA 1A27A 4MVJD 1U8FO 2HCTA 3H5NA 4Z6KA 3Q0EA 3GT0A 5ILGA 1EK5A 4Q3CA 3VZRA 1YL5A 4WCFC 4ALMA 5DCUA 4I9NA 4UVDA 3GVPA 5HWSA 5COAA 3OH8A 1A71A 3H9QA 4YAJA 1UZLA 1BXGA 2FZEA 3FBGA 3TN7A 3ETEA 2OFPA 4PRLA 2I66A 4NH4A 3DC2A 3G49A 5TX7A 4OGWA 1FF9A 4ZRMA 3NRCA 2D5AA 4J2OA 2IXBA 4HXYA 1XU9A 3DOOA 1WDMA 1XLTA 2ZB8A 3WS7A 1D1TA 3ROQA 2G5CA 1NFFA 1ZBQA 1GU7A 1XEAA 3DHYA 4IJKA 3GR6A 4BNKA 5J9GA 3WWYA 1RM5A 3SJ7A 4IIUA 1VRWA 3L4BC 3QVSA 3EUWA 4NZ9A 3RC9A 4B7CA 5C37A 1YB5A 4AJ2A 3WIEA 4B3IA 4WKGA 2HRZA 4RPHA 3ZH2A 1BVRA 2GNAA 4NG5A 5KKCA 2PA3A 1XELA 5KJ1A 2CMDA 3WJAA 1V9LA 3RC7A 1K5HA 3HFSA 2YW9A 1LDMA 1G0OA 1ZIDA 4WLFA 2OXIA 1BXZA 1FMCA 2ZQYA 4BB5A 3RASA 3GY0A 1UR5A 3EY4A 1J5PA 1NX6A 5G0WA 4IGFA 2BRUA 5JYFA 4IDAA 4DQUA 4CM4A 1UDBA 3GPIA 3KHUA 2VT2A 3UICA 1I2BA 2JD0A 4G2NA 1NYTA 4R54A 1W73A 1U3WA 3S2FA 1YOVB 3BMOB 4OKNA 3GPDG 1NFQA 1E3SA 2UDPA 4YXFA 4PRKA 3QVXA 1L7DA 1B3RA 5K0ZA 4IQ8A 1C0KA 5L4SA 1QYXA 4D79A 1ZJZA 2DTEA 1DIAA 3HSKA 3OJLA 4YA6A 3UHAA 5I8WA 5DN9A 2V6FA 4CMKA 5IDXA 2PH5A 1Z7BA 4A26A 3A1NA 4FW8A 3LC7O 3ZV4A 3IP3A 3H2SA 2HMSA 1DFHA 3FR8A 2YYYA 2VCYA 2Q4BA 3GDGA 4TROA 5HM8A 5JY1A 4RPLA 3JQ9A 3LF2A 4N5NA 3TOZA 2Y68A 4UEJA 1QYWA 3NV9A 4CMCA 2FPGA 1HYHA 3IP1A 3UXYA 1QXSA 1W4ZA 1P1HA 4BO7A 1BXGB 4B3JA 3ADOA 4I9HA 4Y8VA 1Y81A 5FI3A 3U4DA 1AE1A 1SO8A 2VRCA 2P91A 4LCEA 4BGIA 1E3WB 3GG2A 4FCCA 4U0KA 3BMCB 1SOWA 1YDWA 2P2SA 6LDHA 5L9AA 1UAGA 3LC1O 4DLLA 1GR0A 4JLWA 4Y6SA 1Z45A 3VTZA 2EEZA 4XX0A 1ZXLA 3SJUA 3WDSA 4CQLA 4I5GA 4C7JA 3INRA 1YH3A 4PLPA 3ZWBA 1DLIA 2C5AA 3JQGA 4J90A 4IZIA 3L9WA 4W82A 3X2FA 4UUNA 1EMDA 3TNLA 1UDCA 2VRCD 1VJTA 4CMBA 1ISIA 4CODB 2BHLA 3BMNA 4CV1A 2FSSA 2V7PA 2HRBA 2AG8A 4YJFB 1QLHA 5EN4A 4Y98A 5BT9A 1KVUA 4L76A 5AXBA 4DXHA 5T57A 2NQTA 3KSDO 1Q2XA 2BGKA 4YPOA 3BZUA 4MVJG 4XYMA 3L4SO 1LX6A 4UEKA 1EK6A 1QP8A 2QZZA 1DAPA 2NM0A 4BVAA 1SMKA 3GC6A 1LDYA 3NGLA 3JQCA 3IUSA 3DONA 4XDZA 4DPLA 3F47A 1YOVA 3BMOA 1HF3A 5CPFA 3GGOA 1YS4A 2ZJ1A 4ZU3A 4E5YA 4H16A 3ZU4A 5J23A 1I8TA 1LSUA 3MTGA 4N54A 3VH1A 3KV3O 5T73A 2WJPA 1K89A 3H9UA 3DBHA 4DBVO 4DC0A 2GN9A 3RBZA 2O4CA 3DZKA 4N18A 1EDOA 3PYXA 3P2YA 1RWBA 1YWGO 3OHSX 2Q22A 3EYWA 1FJHA 3PVZA 3VPSA 3NTQA 4UAGA 4WGGA 3WOHA 3RC1A 4U6SA 5MGBA 2XAAA 3TDKA 1F17A 3O4RA 3C1OA 4YAIA 4ZQEA 3DZGA 3UN1A 2PK3A 3NKLA 4XYLA 3IDSA 1R0KA 1A5ZA 2PZKA 1ZXBA 4E5MA 2QIOA 1I33A 4EUFA 2X22A 5T67A 1LTHR 3KYCA 4BKUA 4BL5A 1X7HA 5AVOA 2GRAA 2I65A 4PLGA 1X1TA 2NLOA 1PJLA 4A5OA 3EK2A 2Q2QA 1SAYA 1Y6JA 3QWAA 4R68A 4BB6A 1QLJA 1DC3A 1R15A 3DBHB 1SZJG 4JGBA 4XQCA 1C1XB 4MVJF 4XIYA 3WJ7A 3ZHBA 5I7SA 3DMYA 3MJEA 4KUHA 5C5IA 1G0NA 3E9QA 4BOYA 1ULUA 3P7MA 3U5TA 1NVMB 2PH3A 2UYYA 1DB3A 4L4SA 4GGOA 2J3IA 3PIIA 3I4CA 3GH3A 1T4BA 1PQPA 1DDOA 3ZWWA 4WPGA 1EEHA 4BO3A 1LEHA 3MJTA 1CQJA 1KEVA 1MUUA 5U4QA 5CDUA 4J2HA 4ZQGA 1IB6A 1T2FA 5ICSA 1E77A 4PZDA 1TB4A 1O8CA 2NVUB 3KEOA 5COQA 3V1YA 1UH5A 2ZB7A 4F46A 3QE3A 4XKJA 1A9YA 1GPJA 3EZYA 1KEPA 1DO8A 4FPXA 1YJQA 1CIVA 1K6IA 2ZYDA 3NT2A 2EIHA 1P1KA 3VAZA 1UXJA 4GI2A 4B3HA 4IJUA 4ZGWA 4XGKA 1PJ3A 2J8ZA 3KYDB 4BUCA 1S7CA 1W8DA 1E1MA 3ZN2A 5CDSA 3JTMA 2PLAA 2JD2A 3ONEA 4XJTA 1H93A 4HFRA 3SLKA 3C7DB 1JVBA 4MVJM 3UUWA 8ADHA 3BYZA 4NJMB 5B4UA 2VNAA 5I9MA 1F06A 1NQOA 1BW9B 1PJTA 5F1KA 4B4UA 1H6CA 2NVUA 3V8BA 1VC2A 1O94A 4R9RA 4EJMA 4YAKA 3BTOA 2O50A 2GZ2A 2HJSA 3U0BA 4A0SA 3MJ4A 4A27A 2Y66A 3ZW8A 4EI2A 1WDKA 1D1SA 1B8VA 3WGYA 3PIDA 3QWFA 2EKQA 1MA0A 3OETA 4CL8A 1DRUA 2O48X 2OBNA 3IMFA 3WICA 2CD9A 1UP7A 3RUAA 1E92A 4RF3A 1I2ZA 5A1TA 1I2CA 1GAEO 2LDBA 3R1IA 1WZEA 2EW2A 2YHUA 1T2CA 2ZYAA 7ADHA 3F5QA 1DRWA 1PL7A 3H65A 3PJEA 1TI7A 1NPDA 4W9NC 4WOKA 3V1TC 3JQAB 4IDEA 4XCVA 4FGWA 1NBOA 2GDZA 1HDCA 5DOVA 3EC7A 4RO0A 3M1LA 2WD7A 1LJ8A 3OBBA 4UVGA 2WE7A 1M75A 3ENKA 1NPTO 2HO5A 5G0TA 3LQFA 4GSLA 1PGOA 5IXSA 4UULA 5ADHA 3LDHA 5BNFA 5IZCC 3DZFA 1JAYA 5JMPA 4D3DA 1HDOA 1GV0A 4MO2A 5BR7A 5A5EA 2YV3A 4Q9NA 1SEVA 2EGHA 4E2ZA 2Y1OA 3F4LA 3IJPA 4ALKA 4CMEC 4PG5A 1ISHA 3PFFA 4RPKA 4FD3A 1Z74A 2A94A 1GD1O 2Y0CA 4UVHA 3GN2A 1JU9A 3HDJA 4DIBA 1XU7A 3BHJA 5BSGA 2IZ0A 3JQDA 1H0KA 1O89A 4CM8B 1L7EA 2DT5A 3EDMA 1NM5A 4EJ0A 4QUKA 1LSSA 1ZFNA 2WE8A 5BSEA 1T4DA 2EG9A 4D44A 3PYMA 3W8EA 1ZSVA 1PR3A 3CMMA 4PLCA 1UZMA 2FRDA 3DZHA 3WR5A 4BNNA 3NDRA 4CUZA 3LSYA 1U9JA 3A06A 4DLAA 1LC0A 5F5LA 2AMFA 3WYBA 4BO2A 2QHXA 3GFGA 3KTDA 1NASA 2D59A 3AY3A 2OZPA 2X6TA 3OECA 4CMJA 5KVCA 3RKUA 5FEUA 2DFVA 2QX7A 1YBAA 4RDHA 4GLLA 4YTEA 1V8BA 3QV1A 1NVTA 1HEUA 3W6UA 1Q7GA 2DPHA 2P9CA 2I99A 1XR3A 3DFZA 5CEJA 2PKQO 4LVUA 2VHVA 4OH1A 3RROA 3P2OA 3D4OA 5GY7A 2DPGA 4QQRA 3WB9A 3WGQA 3GHHA 3ETGA 4CMIB 5HRUA 3D5QA 3B1KA 5JC1A 4D43A 2X1HA 4R01A 1HLPA 4FQ8A 3ZWMA 4D0RA 4BNTA 1RYDA 2PZJA 2AEMA 1H2BA 1LDBA 3KYDA 4CV2A 3ETDA 2RIRA 4YB8A 3UH1A 4H3VA 4BIIA 5L51A 1QG6A 4W7HA 2B5VA 4BKOA 3I9NA 2X5JO 2QRJA 4BO9A 3CE6A 3K31A 4B4OA 4C7KA 3LK7A 1R4MA 4BNWA 1QORA 4DA9A 4GGPA 3VKUA 1ZH8A 1C1DA 1ONPA 3EAGA 4JNKA 4KQWA 4O59O 1WWKA 3LZ6A 1MC5A 2CF6A 3RUFA 2O7QA 3PHLA 2E37A 2BI8A 4Z9XA 4M54A 1BWSA 3JD4A 3AK4A 4MVJP 1DBVO 2Y67A 4XEHA 3GMDA 2BKAA 3O9ZA 3TSCA 4G81A 3O8QA 4NI5A 1MXFA 1E7WA 2DUWA 5DCYA 1DC4A 5F21A 3NAQA 3OA0A 3QWBA 3QJ5A 1UP4A 1U7HA 2E48A 4TRRA 3AOEC 2GO1A 3P19A 2E4AA 2FPIA 3B6ZA 1DJQA 2EWMA 4Q3DA 4CM4B 4XYGA 4ZQBA 4N5LA 2DQ4A 1N92A 4R51A 2B37A 4DWVA 4L4RA 5IFLA 1N1GA 3UGKA 2RCYA 1R37A 1K3TA 2RH4A 3CUKA 2YFQA 1O95A 2B69A 2D3TA 5G4LA 3GDOA 3CXRA 2IRWA 1SOVA 2IEDA 3EZLA 1E3EA 2PV7A 4WLNA 3L77A 3HB5X 3RKRA 2X9NA 3ONFA 1ARZA 5THQA 1MFZA 1DOHA 4KZPA 2Y0EA 3UKOA 3ZWPA 1ONOA 1AHHA 1Y9AA 4IXWA 4CL3A 2HSDA 3DB2A 4ZJUA 3KETA 5COBA 1I01A 1M2WA 4MVJE 4IPTA 2WYWA 2H63A 4JBHA 3EVTA 1ZEJA 3KXDA 3MZ0A 5JO0A 1S6YA 3QLJA 3GQVA 1DHRA 1ISGA 3T7EA 2CVOA 3BIOA 5A06A 1T1SA 3DHNA 3LT4A 4GBJA 3VZPA 4YJGB 4CLRA 3LYLA 4GX5A 3HN2A 3RC2A 4WNIA 3RUEA 4AJJA 4ZVVA 1QR6A 4O5OA 3W4IA 1ZMTA 2AXQA 3U4IA 5TJHA 3CH6A 1WMAA 3HADA 4AICA 4U8GA 1N5DA 4D41A 2BD0A 4DLBA 4NU6A 4WK6A 1LLCA 4KMSA 1OBFO 4I9UA 3ZI0A 2OP1A 4FOSA 4RV9A 3C85A 3T4XA 4JQCA 1NHGA 5IZ4A 3E1KA 3GVIA 3IJRA 4B4VA 1SNYA 3AY7A 1BSVA 2P5UA 1RM0A 1WXDA 1CWUA 4PZCA 3AW9A 1O0SA 1Y5MA 3DBLA 3TZKA 3UCFA 2YDXA 1AGNA 3DOJA 3C24A 3D64A 4YRDA 4DRYA 2C7GA 5AXAA 3NYWA 1ZK0A 4NPCA 3O03A 3CPSA 3RBVA 4P8RA 1KC1A 3S2IA 4IY1A 2OO5A 1GV1A 5CG1A 2X0NA 4QFCA 2V6BA 4OQYA 2P9EA 1ADFA 2Q3EA 4DBZA 2D5CA 1LXCA 2FWMX 1BMDA 1PEDA 2EF1A 1JWBB 2EW8A 2FPPA 4J4HA 5JW6A 1UXIA 2GYYA 1QV7A 2EHDA 2NUAA 1EQUA 3VZQA 4RDIA 1P3DA 2W8ZA 3KM0A 1E1LA 4CM9D 4LRTB 1DEHA 3NJ4A 3JYNA 2D4AA 3IAHA 3D3EA 1WPQA 2Q1UA 2HMUA 3VHRA 5BNIA 2NTJA 2VHYA 1LC3A 5G4KA 3VVCA 3HNPA 1NWHA 1I5RA 4JROA 4IXTA 1XYGA 4TMFA 1Z73A 1Z75A 5C7IO 1YVEI 5ES3A 5JO9A 5C7OO 4ND1A 5EINA 3WGIA 4J16A 3ZGYA 1HE2A 2PD6A 4PG6A 1KEWA 3M2PA 4GQAA 4IMRA 2EP5A 1A7KA 2OORA 4D45A 4YEDA 3FPCA 5EMHA 2YV1A 3FNEA 4M87A 4OQZA 4GLOA 3BHMA 3DBVO 3DZJA 1D7OA 3MWDB 1EVJA 1MP0A 1NP3A 3HB4X 3INTA 5HS6A 4Q3BA 1BVUA 4FR5A 3ZU2A 1HSZA 2AE2A 2X0RA 1UAYA 1UUFA 3GVCA 5DNAA 2C20A 5TT0A 1O9BA 1Y5RA 5TC4A 1DIGA 4A10A 1PSDA 1BHSA 2NADA 2UAGA 3VZSA 4E12A 5A02A 4E2YA 2BFOA 1KVRA 1E0DA 2EXXA 5EERA 1RM4A 2GGSA 1WDLA 3HDQA 3QVOA 4P4GA 4CMHA 1VL8A 5DF1A 5JYEA 3RUDA 5GMOA 5CG2A 1KOLA 4HUJA 4F6LA 1ENYA 3GOHA 3S2GA 1EZ4A 4A2CA 4D3FA 4G5HA 1YQDA 3WLFA 3Q2IA 4YT5A 2DKNA 1E7MA 4KWIA 4OYRA 4FFMA 3V2HA 1NAHA 3O26A 3ROMA 1K6JA 2NU8A 4BQPA 2DLDA 5IN4A 1IPFA 1YJ8A 3GEDA 1RKXA 1A72A 4K1LA 3VH2A 4BHTA 4IIVA 3CSDA 3RWBA 1LDNA 1P0FA 3GFBA 4JBGA 1BTOA 4CR7A 2ZQZA 3L6EA 2F00A 4CR8A 3UF0A 1KYQA 1H5QA 4HY3A 3W4KA 1XGKA 3Q11A 2PGJA 3H6KA 4FJ1A 4ZQFA 4YT8A 4MKZA 4OXNA 2PWZA 4BNUA 2FR1A 2Q45A 2VNSA 3U4CA 3ENNA 4XQ9A 2PNFA 2V6MA 2JJYA 3AU9A 3KSZO 4LGVA 4CLOB 4IINA 3RCBA 4J7XA 2B4QA 4F45A 5JLAA 1OI7A 3ZV3A 4II3A 3QY9A 1YL6A 4MINA 4CLEA 3UCEA 3Q2KA 4Q3NA 1E3JA 3WQQA 4CQMB 4YRAA 2C07A 4BGUA 3FSRA 1PGJA 2O2SA 1E3IA 4RQUA 4Z0TA 4CLXA 3NUGA 3WG9A 4JX8A 3WMWA 5KOIA 3DMTA 4XGIA 3ROPA 1GQ2A 3DDNA 2H1SA 4RVFA 2HKIA 3DTYA 3RSHA 3WNQA 3JQ7B 4RL6A 5CDGA 1R66A 3EGOA 3ON5A 1ZUD1 2GR9A 3OFSA 5JCJD 2FN7A 4IS2A 5H81A 2O7SA 4E5KA 2J3HA 1PS8A 1YQGA 2ZIZA 3PJDA 1YBVA 4PG7A 2Z1NA 5A03A 2BGMA 1KEUA 4XYEA 1E7QA 2ILTA 1EBUA 1IHYA 1NPYA 1RPNA 2X7HA 1I24A 3Q9UA 3Q9NA 1IHXA 5MDHA 1E6WA 2IZZA 3BMQA 4K9DA 1HZJA 3K96A 4WOJA 3RU9A 4CLOA 2C59A 2R00A 2WSBA 3DBRB 4HV4A 3IUPA 5DCWA 3ZZNA 4J43A 2NVWA 1I3MA 2AE1A 3NTOA 2I9PA 2XXBA 1MB4A 1DFGA 4ZA2A 4B8WA 1SBYA 3JYLA 1PZFA 4FSHA 2JCXA 1R0LA 2YJZA 1NQ5A 2VTEA 3B70A 4J0FA 4Y9DA 1OC2A 3KBOA 3OM9A 2BI7A 4YJGA 2WDZA 5G0UA 1DFIA 3L9XA 1K2WA 3PLNA 2D1YA 1F8FA 4WUVA 5HS4A 1JDJA 3DFUA 3G3EA 2XPCA 3V2UA 1XSEA 3HFGA 1QYVA 1HE5A 2AEJA 2G17A 3NT5A 3QWIA 3JV7A 3N58A 4E4YA 4AJPA 3AFNA 5GZ1A 1PTJA 2GCGA 2PD3A 4E5PA 1YBMA 5AXDA 2Z95A 1JLLA 2VYVA 1LRLA 5K6AA 3AWDA 1E5LA 5BNTA 4J91A 4RVSA 2GERA 1Q0LA 2IXAA 3NTRA 4WECA 5LDHA 1L1FA 3TPCA 4GAEA 1X15A 1Z82A 4ESOA 3PPIA 2DFDA 2IE0A 5DDIP 2XXJA 4HX5A 1YDEA 2W2LD 3GZNB 4XRRA 1V6AA 3EVNA 1IZ9A 3ROKA 3HUDA 3PK0A 5LC1A 2C0CA 1M76A 4L0QA 2GF2A 3DMTC 1ZSYA 3GN1A 3GNSA 5KTKA 2X9VA 5FF9A 5TGDA 3GEGA 2X23A 4A73A 4E6PA 4LN1A 1JQBA 4DREA 2FHSA 3TRIA 3MWEB 4I8XA 1HYEA 5C7LO 4RZIA 3FNGA 1J49A 2ZB3A 3F1LA 4KDFA 3MEQA 1ENOA 1DIBA 2EERA 3AI1A 1I32A 1ENPA 2VZ0A 4WASA 4B79A 4EYEA 1EUZA 1GTMA 4XR4A 1PZGA 1UZNA 4OKIA 4L9RA 1BG6A 6ADHA 5AQ1A 2IYPA 4DYVA 1P74A 1VL6A 3FD8A 1AXEA 2Y1CA 1P1IA 3AI2A 2DBVO 4MPDA 1P45A 4BKQA 1PGNA 1HZZA 3LF1A 2HMVA 4E31A 1PR9A 4L4XA 5CDTA 5JFOA 4FFPA 3ZU5A 2Z5LA 3GEMA 1X1EA 1MXHA 2SCUA 3BTVA 2FR0A 1SB9A 1IZ0A 2G76A 1N8KA 3NDIA 1GUZA 5IZCA 3S55A 3CEAA 1AN9A 1LBEA 1LI4A 3WGGA 4CM5A 2C7VA 4BMSA 3JQAD 3PZRA 1T1RA 5HA5A 3JQ7A 2AA3A 3JQBC 1MG5A 2X8LA 4WLOA 1PIWA 5JYAA 2IZ1A 4JIGA 4CQLB 4E3ZA 1JN0A 3JYOA 3S2EA 5DULA 1H9AA 2P68A 3PDJA 4IJWA 4M8SA 3HDYA 3E5MA 2VHXA 3EW7A 2I3AA 3DR3A 1AUPA 3D3WB 2Q99A 2Y1GA 3KEQA 4J0EA 2R2GA 2WMDA 1LUAA 4R1NA 4OJNA 1EFKA 4PCVA 1VJ0A 3E9NA 1KY4A 2CDAA 2B83A 3FHLA 2NU7A 2HLPA 3FNHA 4NBVA 4QXMA 1JAXA 1X14A 3DAPA 5IDQA 2FP4A 3ZWNA 4EUEA 3DBLB 4D46A 3KO8A 3RFXA 5A9SB 1GDHA 2POQX 5I7EA 5DZSA 3E6AA 3D4PA 3Q6IA 2I67A 1DLJA 3ZCXA 3C3XA 2JL1A 2BELA 2NVBA 3FTPA 4ZRNA 2VUUA 3ZNQA 4EEZA 3JQ6A 2PGDA 1GUYA 4OL9A 2Q49A 1TA4A 1HE3A 2BF7A 3B1FA 3QQPA 2HK7A 3L07A 3PHHA 4YAGA 2I6TA 1LQTA 5KVVA 1HDXA 1E1KA 3TFOA 1LQUA 4R5HA 2V65A 1B0AA 4BNIA 3DEYX 1LLDA 4J7CA 4Y6PA 3G1TA 4UUOA 2NV6A 1R4NA 1H6AA 4A7PA 4OHUA 3FPLA 1LRKA 1CF2O 3LU1A 3RUCA 1YB1A 2WD7B 3S1LA 2B35A 5CAEA 1VI2A 5TT1A 2DAPA 3QA9A 3RFVA 1E7YA 1ZK3A 4ZICA 2X0JA 3X2EA 3ITKA 4AJKA 3AI3A 3G0OA 3ZDFA 3TL3A 3ZNNA 3QP9A 4DMLA 5A04A 4NU5A 1YL7A 3WX0A 3COSA 2ZTUA 3FNFA 1ID1A 5JDIA 5KJFA 1B15A 5C3MA 5F1PA 1AXGA 2V6GA 3JQAA 2YDYA 1J4AA 5JDIC 1WP4A 3E5RA 5ICMA 4ALNA 2VWPA 3DL2A 4BKRA 1QYCA 5EQDA 5G2OA 2C2XA 5JBIA 3I6IA 3FR7A 1K0UA 1U3VA 3U09A 1P1FA 3D4NA 3IQDB 4GWKA 1GYPA 4O63O 3OQ6A 4RF4A 4NHEA 3OJOA 4RF5A 1R4MB 4E30A 2ZYGA 1BXKA 3ZWVA 3Q3CA 2O4UX 4GPD1 1AHIA 1FXSA 4MP6A 1GFSA 4E13A 3TZ6A 4MJLA 3M2TA 2VWHA 2FY8A 4JJGA 2O3QA 4HWKA 3DQPA 4E32A 1RM3A 5G4KB 3K9QO 2B4RO 3PEFA 3L4BA 1GZ3A 2GPTA 3ORFA 4AJ4A 4DIOA 3W8FA 1VJ1A 3WFIA 3BTSA 1Q7BA 3S8MA 5DP1A 4HKTA 3EMKA 4J9VA 3VH3A 4DL9A 5A3VA 2JKVA 4OM8A 1ZVMA 2AQ8A 1OC4A 2W98A 5HBRA 4YJHB 5G0VA 2GLXA 4K6FA 1ZNQO 2DTDA 4JP2A 4S1VA 1E1NA 3GGPA 3QSGA 1XCBA 3OIDA 1C0IA 3NDJA 4BO6A 3WGOA 1XDWA 2AEFA 2CFCA 4FIZA 1O5IA 4E21A 4FJ0A 1GUFA 1U2GA 4QSMA 2XF8A 3OMLA 3ST7A 3DHEA 4IDGA 1A4UA 1DC5A 2D2IA 1TEHA 3HN7A 4CM8A 3JQFC 5B4TA 3RAJA 1MG0A 4HFJA 3GNTA 4WLUA 5G0SA 2QW8A 3RQSA 3ZV5A 5DBIA 3VPXA 4LMRA 1WVGA 4BNZA 4EDFA 4HFMA 4BNVA 1Y1PA 2TMDA 4TWRA 4XB2A 3OJFA 1IYZA 3I9MA 3E18A 1X7DA 2D0IA 3PQEA 3QRWA 4XWYA 4DVJA 1VM6A 1SCUA 2PTGA 5JAZA 2RBEA 3W8DA 3K92A 3Q1LA 4LRSB 2P4QA 4QTZA 3PQFA 5U1PA 4J49A 2JAPA 3ICPA 4JJIA 1M6WA 3F5SA 1CETA 1PJCA 1EVIA 2HK9A 4NFSA 3HG7A 2QRKA 2IEBA 4J1QA 3R3SA 4BQRA 1H6BA 3WQRA 4BS9A 1B14A 4JN6B 4Z9FA 4R3NA 1HT0A 1V0JA 3BAZA 3N7UA 3ONDA 1JWAB 4CMAA 1GCOA 1V3VA 2ZCUA 3AU8A 1XA0A 4J4TA 1FK8A 1ORRA 4QT0A 1ONNA 3PP8A 4PLZA 4EITA 1C14A 2W4QA 3HHPA 4XYBA 5KJ6A 5L7WA 2VUSA 2DM6A 1ZKMA 2HQ1A 1KERA 3ICCA 1FDTA 3V5NA 5GZ6A 1HWYA 5TF4A 3PGXA 5TQVA 4MKXA 5M6DA 1M6HA 4BNYA 3KRTA 1D8AA 4OSOA 1ISFA 3VKVA 4CQMD 2VYNA 4JJFA 1YXMA 2NU9A 3FWNA 1R4NB 2IDZA 3D1LA 4R9SA 4FDAA 8LDHA 4DQXA 3RUIA 2IODA 2VYVD 3M1AA 4F6CA 1IY8A 2QYSA 4NBTA 4Q3EA 1EBFA 1ZK4A 3CIFA 2Y05A 4O0LA 1ENZA 4CM9A 1WAMA 2WEKA 3HWRA 4XD2A 4YR9A 1Y8QA 4J1TA 4E2WA 3OEWA 4XA8A 1Y9EA 2DC1A 1ZJYA 1GEEA 1N1EA 3SLGA 4DGSA 2QG4A 1U4SA 3PQDA 1X0VA 1MC4A 1BW9A 1HDGO 1C1DB 3EHEA 3FBTA 3PWSA 1OFGA 5JNLA 1E7SA 3GAZA 3ZHXA 1LSJA 3CTMA 1VSVA 4U5QA 3KSUA 2OL4A 2QQ5A 5L7TA 3LLVA 4XIJA 5JPIA 4XJSA 2J6IA 1DJNA 4WJZA 3QVWA 3WFJA 5T5QA 1P77A 2X9GA 4FFOA 3LVFO 4YJFA 3JQGB 2VUTA 2GD1O 3H7AA 2G1UA 2D8AA 4YVFA 1KVTA 5THKA 2DTXA 3VVBA 1XQ1A 4HNHA 5ER6A 3VPHA 2WYUA 5JXWA 4YRBA 5KIAA 1E3WA 2VYND 3TL2A 1DPGA 3E03A 3PDUA 3ZWYA 3ASVA 1OMOA 1N7GA 4R1UA 2UUOA 4W7IA 1HYGA 4Z0HO 1NAIA 2BFMA 1P9LA 4AL4A 5IJZA 3C8MA 2CUKA 3GRPA 4PZEA 2NQ8A 5KJCA 4KUGA 2VOJA 2BMAA 4MKRA 3SEFA 2GN6A 3ZHZA 3CKYA 3INGA 3RD5A 3QVTA 1EE2A 1R6DA 1Q0HA 3DXFA 2OP0A 3F1KA 3WSVA 1R0SA 1QYDA 5CEFA 4YYZA 2EJWA 4EBFA 2HMTA 4UVIA 1IOLA 3LT2A 1GEGA 1IE3A 3OP4A 4W99A 1SC6A 4KQXA 4BMNA 2YHIB 3M6IA 1KETA 5ENDA 5A4DA 2P5YA 1PGPA 1TXGA 4IBOA 3I3OA 5FYDA 3SX2A 4E0BA 2NWQA 4ILKA 4NMHA 3I9OA 1PJ2A 1UP6A 4H15A 3AUTA 2CSUA 1PJBA 1VE9A 3JQ8B 4P4NA 2ZB4A 2HDHA 4PIVA 2GZ3A 1HTBA 3W6ZA 4RZHA 2UV8A 4PGFA 1VKNA 4LK3A 4N7RA 3L6OO 4FC7A 3V1UA 2Q2VA 1N2SA 2RHRA 4NDNE 4DIFA 3PFWO 3GHYA 4M86A 1WZIA 1Q1NA 2X4GA 4O1MA 1GADO 4GVXA 3JQEA 4FS3A 4DC1A 3L0DA 1KBZA 1FDWA 2Q46A 3JQBA 4FBGA 3NT4A 1KVQA 4AVYA 3F9IA 1BRMA 2GN4A 1R16A 1T24A 3GK3A 1BGVA 3KOUA 1GYRA 1CRWG 1YKFA 3KVOA 5IDWA 2X5OA 3SBOA 1UXGA 3UVEA 1FDVA 2O3UA 5B37A 2NNLD 3NEPX 4ZHSA 5JAIA 5KNLA 5BSHA 3HE3A 4B8ZA 3FCOA 3ZWOA 1T2DA 4OXKA 5AOVA 3OJEA 4A03A 2DBRA 3C1TA 2ZK7A 3H8VA 3O8QB 4ND2A 1PU2A 2JCVA 3U9LA 1C0PA 1EDZA 1R12A 2DBQA 3K8ZA 1ADGA 4ROSA 2P9GA 3ZWCA 1HXHA 2HJRA 2Q4EA 4W4TA 3WGHA 4U7WA 1M67A 3LT0A 5LCXA 1CJCA 1CYDA 3VDQA 3JCZA 4YBZA 2ZCVA 4RLSA 1NVGA 5I7FA 2CF5A 3SC4A 4EEXA 4GMFA 2AG5A 1B16A 4XB1A 5L3ZA 1DXYA 2Q1WA 3CINA 1I3NA 3F46A 3H3FA 3DBRA 3PGJA 4TKLA 4CJXA 4DUPA 3E9MA 3O38A 2QYTA 4QEDA 3SVTA 1PZHA 2NACA 5A9SA 4QO8A 4QO7A 4U0JA 1DRVA 4IGEA 3U49A 2GZ1A 1G6KA 3GVHA 4CM3A 3R6DA 1JKIA 5DP2A 5FWNA 4WEOA 2VRBA 2DVMA 2E6UX 4MP3A 4TVBA 4YJHA 3PWKA 4OMUA 5JAQA 3DTTA 1OZAA 2JFGA 4IS3A 5T8KA 3PXXA 3GZ4A 4CR6A 2NTNA 4CV0A 1HL3A 4L73A 2VN8A 1KY5A 4CM6A 3ZW9A 1N9GA 2IYOA 1XHLA 1PJQA 3BMNB 3GMSA 4CMIA 5IF3A 4IQ0A 3KYBA 2BFPA 1N9GB 4TZKA 1DHTA 4R3WA 3FWZA 1LA2A 2JFFA 1ZO8A 3RJ9A 3KZVA 3LLSA 5IG2A 3GNQA 2DU8A 4YWJA 2QRLA 4RLHA 1HSOA 3QHAA 1N7HA 5L4NA 4J3FA 4NNJA 1E5QA 4BNHA 3BXXA 1TLTA 4J7UA 4FB5A 4RVGA 1GPDG 1F14A 2DUUA 1HETA 3PRJA 2W2LA 5TS3A 1HDRA 2C2YA 3AM3A 1T2EA 3E8XA 1Y8QB 3NJ8A 1HE4A 3I83A 1PX0A 4D0SA 5T6BA 1LDEA 1B2LA 2YZ7A 1YB4A 3PTZA 1E7RA 3PHIA 3JQFA 1C1XA 5CPBA 4AJLA 4CPDA 3VPFA 3JD1A 5KWEA 1XWFA 3JYPA 2AW5A 4ONEA 1ZZEA 4WE3A 3WTBA 4BNXA 1DIRA 2BFAA 2EKLA 2J5QA 3FN4A 3NX4A 4JXKA 4AG3A 1JTVA 3OIGA 1PJSA 5I7VA 4CLRB 1LU9A 4IMPA 4DPKA 4LSMA 4L8VA 3IC5A 3ASUA 3B1JA 1V3UA 3H2ZA 3WSWA 1XIVA 4P4LA 4R16A 1HKUA 3JD2A 3K30A 1ZCJA 5F1OA 2VHZA 4D42A 3GAFA 4S3MA 5IAAA 3JD0A 2B4TO 2WWRA 2A9FA 4CV3A 2ZKLA 1LDGA 4YQYA 2CVQA 2YQ4A 1EVYA 4GX2A 5L95A 5TJ9A 1PS9A 4IDBA 4RVUA 4XDYA 1I3LA 2PFGA 2W2KB 4YAEA 3BTUA 1D4FA 4CLDA 3DAGA 5JDCC 2PR2A 1KC3A 4J4BA 3ZNOA 2EJVA 2VWGA 4UREA 4M49A 1U5AA 4BNJA 3F4BA 2E49A 4PLHA 1KS9A 1NNUA 3TOXA 3UW3A 3MCVA 3CZMA 1UJMA 3C7AA 1C0LA 1QV6A 3ZWXA 4RF2A 4BV8A 3QW2A 3PI7A 2HMWA 3A14A 3GDFA 1PZEA 4YACA 4Z3KA 4UEOA 5H83A 5A3JA 1LNQA 3GG9A 5CEEA 4K26A 5B1YA 1GYQA 4MDHA 4ALLA 2EP7A 3DZBA 5HTOA 3TZHA 4BGVA 2CZCA 3BMQB 2YQ5A 1A9ZA 2HK8A 4IM7A 4RCVA 5K9ZA 3UOGA 4B7XA 4FFNA 1LLUA 4I08A 4AJ1A 4K6CA 2X58A 3D3WA 1NTOA 4CMEA 4ZN6A 1TT7A 3F3SA 1P44A 2VZ8A 4PFJA 5B12A 3WTCA 2ZTVA 3AM4A 3H5AA 1GL3A 1CERA 1YRLA 3WLEA 5IDYA 1MLDA 3IKVA 3U4HA 3AOEA 3VTFA 1GY8A 1ADBA 1OAAA 2JD1A 3OA2A 2Y1DA 2FZWA 3TWOA 1P1JA 1SPXA 4OOFA 1NWCA 2HAEA 4C4OA 1GQQA 1V3TA 4P38A 2OGUA 4URFA 3B20A 1JW9B 2O23A 4PLWA 2OMEA 4AFNA 4FJ2A 4YCAA 1U3UA 3UAGA 1HLDA 1I36A 1ISJA 2DBZA 3GLQA 2BGLA 1ISMA 1EFLA 2P4HX 3H3JA 1Q7CA 2A92A 3W4JA 1TT5B 1U28A 4JBIA 3ZU3A 4DQVA 1IULA 1NQAO 1MGOA 4TRNA 1NR7A 3P5SA 1TVEA 1EQ2A 4EGFA 3GUCA 1JA9A 4KTVE 4GWGA 5EQFA 1U5CA 1WLYA 3WIDA 3D0OA 5IN5A 4KOAA 1UXHA 1Y8RA 1H94A 1XKQA 2YUTA 5I9NA 4GX1A 4R1TA 1PJ4A 2AQKA 5EIOA 4EUHA 1LSOA 1QKIA 1UXKA 5DBGA 1E3LA 4K28A 4M89A 2EKPA 1A4IA 1P33A 3D7LA 2WM3A 5L40A 4FGSA 3MTJA 2R00C 1P1RA 1YONA 1IUKA 2X5KO 3NGXA 4H7PA 4EW6A 1E6UA 1GZ6A 4ND3A 4AJHA 4B4WA 3AY6A 3H9JA 4INAA 3OQBA 1B8UA 2Y93A 5AXCA 4B7UA 2X0IA 1VL0A 3MOIA 4MIYA 4WNCA 3K73O 3I9LA 7MDHA 1I0ZA 3G79A 2Q1SA 3HDHA 3OICA 4IDCA 2O3SA 2CDBA 4KTTE 5TLSA 3ULKA 3TF5A 4Z3DA 3WQSB 3A4VA 4F3YA 4L74A 3E82A 3E48A 3JYQA 4O6VA 2CVZA 1G1AA 2PZLA 1Z7EA 3DZIA 4UVEA 2A4KA 3DO5A 1WMBA 3ANMA 4LISA 2H5LA 4MVJH 5L45A 4CLHA 5L4LA 3WYEA 2W90A 5TRTA 3ITDA 3SC6A 2CY0A 4GVLA 1DC6A 4QECA 1CEQA 4J9UE 5T8KC 4CUKA 2NSDA 4CMGA 1NR1A 1F12A 4OO3A 1SEPA 3PJGA 4PLTA 4AJEA 1IPEA 3AUUA 4GSKA 4NIMA 4KUEA 4NK4A 4BNLA 4P22A 4X54A 1V35A 4WCDA 1FDUA 1CQIA 5EJ2A 2I76A 3JQ9C 2YHIA 1I30A 3H4VA 4XZ3A 3ZV6A 4YJDA 3K5PA 5DOZA 4R1SA 3VDRA 2NTVA 5K6AC 1KIFA 4BNGA 4D3SA 1I10A 2VWQA 4FOOA 4BV9A 1GZ4A 5AYVA 4DTIA 4XQGA 4PG8A 4UUPA 1GQYA 4AJNA 1YO6A 5H82A 1EUCA 2B36A 1CDOA 2C5EA 4DPMA 1U3TA 3I52A 4N5MA 5JMWA 3VH4A 2O3TA 5A05A 4EJ6A 5DBFA 2Q1TA 4YT2A 1HRDA 4NBRA 3H5RA 1SB8A 1X0XA 1PS0A 1J0XO 3OJ0A 3K6JA 4Z9YA 3VC7A 3GVXA 4PLFA 1JVSA 5KJEA 3RBXA 5JDCA 3RVDA 3WGZA 3FRJA 3A28A 2RH8A 2VHWA 2OUIA 3RU7A 1MFPA 2JHFA 2J3KA 4RVHA 5IXYA 4WCFA 1W6UA 1Z6ZA 4J6FA 3HJAA 5I8ZA 5I9LA 1TT5A 3KLPX 1E6EA 4FN4A 3U62A 2JAHA 4BO0A 5EESA 2OHXA 2X86A 4BO8A 4JCOA 1F0YA 3D5TA 2ZTLA 1H9BA 3PZBA 1LLQA 4XR9A 5A9RA 1P0CA 5T64A 4RPJA 3WNVA 1RYEA 1UDAA 2J5KA 3JSAA 5DT9A 2Y99A 3TZQA 3PJFA 4NJOA 3I23A 3OIFA 3N74A 4E5NA 4BO1A 3AOGA 3F6YA 4MIEA 3MJVA 4R5MA 2UUPA 4W9NA 4HFNA 3I9JA 3H9EO 4TRJA 4JP3A 1MV8A 2PKQP 4MOWA 2FR8A 2BH9A 4BKPA 2EGGA 1T25A 1I3KA 1T26A 5BQFA 1XQ6A 1MX3A 1QSGA 3TZCA 3AJRA 5KKAA 3RIHA 5CHEA 1P31A 1VSUA 5JY6A 4Q3AA 4CM7A 4NR0A 2VOEA 3UFXA 3KYCB 2OOSA 4R69A 3ZNPA 3DOCA 1PQWA 3GA0A 3GGGA 1GCUA 5GZ3A 1ADCA 4ITUA 2C29D 3H9GA 3L6DA 5U9CA 3KLMX 3DWFA 1U2DA 2PGLA 1YQXA 2ET6A 2J5RA 2C54A 2PY6A 3HQ4O 1J6UA 2XOXA 4NFHA 4OIMA 4KDEA 2Y0DA 3ANNA 2W2KA 3PWZA 3AFMA 4WLVA 3AUSA 3QWHA 2Z1MA 4J1NA 2Y1EA 2H9IA 4IDFA 3AUAA 2AQIA 4GKBA 4Z0PA 1H2HA 2FMUA 2ZTMA 2HUNA 3T4EA 1QMGA 4CUJA 4JK3A 3G1UA 4IZHA 3C1AA 2I3GA 3TFQA 9LDBA 4M55A 4ID9A 1DAOA 4AJOA 3IOYA 4BO4A 4E33A 2GUGA 2G0TA 1DIHA 5EL0A 3RFTA 2JHGA 3WXBA 1Y8RB 3ZHYA 1PWXA 3IIEA 1PWZA 5KVSA 4WCFB 1ULSA 1HDZA 4QX6A 4R41A 3W1VA 3WWZA 4GX0A 1XG5A 1EE9A 1ZSNA 4I5FA 4PVCA 1NFRA 3OF2A 2AQHA 4MP8A 4M1QA
chains in the Genus database with same CATH superfamily
3BA1A 3IFSA 3M6AA 1NSYA 4II2A 5TARA 2W6NA 4KIUA 2HIGA 1IL0A 3N07A 5FDFA 3T1OA 1T2AA 4KXWA 1IWOA 3A7EA 4QUJA 4L8YA 3Q8LA 2YN0A 3HKDA 2N1MA 2IUYA 5CA1A 2HH9A 4OSPA 1IOVA 3KYIB 2REQB 4UOEA 1W0CA 1CY1A 4B9EA 4ZIRB 3PNLA 4GMXA 1OIVA 1R9NA 2B94A 3VPGA 4W9RA 1XWIA 2XVXA 5ALOA 5C4MA 3QPCA 4IUYA 3PNQA 4A0QA 4GL2A 2OKCA 4FFDA 3L46A 4FDLA 2GASA 3A9WA 4UDNA 1VE1A 4FTWA 1KNQA 3LC2O 1QO0D 3MHTA 5FLEX 3A6JA 2GPYA 2GD6A 1FMFA 1EB9A 3HYSA 1UJBA 1UXOA 1RHQA 2OYCA 4GRDA 2W71A 4PYQA 3ZIAD 1PHPA 4V2UA 1HOXA 4HVCA 5TIIA 3IP8A 2VSQA 4ENWA 2CYBA 4XW2A 4ZCRA 3O75A 1E1QD 3LKZA 1V25A 4D8TA 4RIGA 2AWOA 4ZDWA 3WLSA 9LDTA 1PL8A 4HGOA 1FP1D 3L0OA 4RGVA 5LQKA 3BILA 2EV9A 4FHFA 4L5JA 3IS3A 1KY2A 4U7PB 4JHLA 1TYEB 3LBNA 4UNSA 5LDGA 3VR6A 1SG9A 1MJHA 2ODAA 3EVEA 3ORRA 5F5NA 3ZX5A 2WYVA 4Z4IA 3H99A 1TAHA 2PMDA 2V9CA 1FDSA 1TTHA 3GLKA 2NU6A 2R7AA 4FMBB 2B5WA 4TLDA 4DZZA 5BT8A 4KFSA 1TEZA 4KU4A 2X14A 5IVPA 3QLEA 2CCJA 4G86A 4PWZA 1EVZA 4D3XA 5CLIA 1U1DA 3QGMA 5BUQA 4CETA 4MPTA 3MPUA 3IEPA 1EGMB 2XDAA 4LFAB 5JZ9A 3RABA 4N3NA 3U0VA 3DDOA 5E8JA 1ULHA 3GZNA 4HADA 4TTTS 1E59A 3RC3A 2OB2A 5FI5A 2QZ9A 5CFZA 3PUWA 2FUCA 2PKRA 3OCYA 2YH2A 1F5SA 1U0TA 3K53A 2HDWA 2E82A 3PB3A 4NV3A 1TZBA 4ZEVA 3HKEB 4IQGA 5LA6B 4UQPA 4KE9A 4MULA 2QMYA 3I8OA 1NUQA 1ZW1A 4ZCTA 4B6OA 3RE1A 2CNBA 2LXNA 5D01A 2BV3A 1G7RA 1KI6A 2AFHB 3FSEA 4TZTA 2HSEA 4TSKA 1ODIA 3QKSA 2HYDA 1MQSA 4TLCA 5T4BA 3K05A 2G7ZA 1HEYA 1ZWKA 5K8JB 3FLEA 3MAJA 4C7VA 1XLVA 3PKJA 5ARDA 2KBEA 2QTHA 2A88A 1T9HA 3D3JA 5FOTA 3TEFA 1KTIA 2EYQA 2A35A 1WF6A 4U6QA 4IF6A 1P5JA 3A70A 3WGTA 1U7PA 1W4AA 3MJCA 4OAPA 1K6XA 1BEZA 4HC4A 4B35A 4BQEA 2W8BB 4DEYA 4NBWA 5AVUA 4JYCA 5C53B 5JE8A 4KPUA 2WSSA 1CU1A 5JXHA 4UUMA 4QLOA 1CPYA 3EWIA 5CM8B 2OXCA 1NIJA 4HHEA 3HZZA 4HP8A 4FLFA 4K1XA 4OK5A 1Y63A 4ARZB 4BRSA 4GU5A 4YUVA 4B3TB 3FMFA 1J56A 3K0CC 4LA4A 3PQVA 4HDNB 1RJ9A 5JJBA 2VAXA 3EF3A 2H6EA 3PHGA 4V0KA 2RG1A 3VOSA 1S1CA 4FC6A 1C4KA 1P7CA 4IDNA 2XCLA 1WW8A 4NZZA 2D13A 2J9YB 2BMJA 2JJMA 3HZRA 4D96A 5JV5A 3CSSA 4UM8B 2VQFB 1G5IA 5AVSA 1GRCA 4MIOA 4A92A 4D81A 2PFSA 3CVVA 1E58A 3WBBA 4WEQA 3NEAA 4IUCS 4WDRA 2P0EA 3RVSA 4XGNA 4Q1AA 1WO8A 3OG9A 3GUHA 5FR1A 1PL6A 4HBGA 3FKQA 3WYCA 4KLRA 3TSZA 2RAVA 5EPOA 3ZI7A 2ZSAA 4Y67A 5IJ0B 1P80A 1YRHA 3S81A 2WSLA 2BCGY 3CONA 1U8YA 1VKOA 1X13A 2HZ7A 1SXJD 1XVIA 4D74A 4PN3A 1YQWA 5F9MA 3L82B 3MBKA 4QFDA 3M3HA 4ZOBA 2MR5A 3C5WP 3TJRA 3VQTA 2W6PA 1VI5A 2V03A 2VTDA 3FHJA 1H8HD 1GRRA 2XNDD 4HXFB 4IV5A 3K2BA 1U1IA 4RGBA 3RFUA 3WADA 2PZMA 3ZOKA 2GM4A 4MI3A 1BWRA 1OOEA 2PT7A 1RW4A 3KR1A 1C3VA 4DSNA 2H00A 1HFKA 2XWJI 3O8OB 4RKEA 4RORA 5JWOA 3AILA 2Q7DA 1N6RA 3EPHA 1EX9A 1O6CA 3IKMB 3FUCA 3ZQUA 2PQ0A 1B26A 4ND4A 3C3CA 5TNXA 4ALJA 5J2TA 4N5IX 4X62B 4BNFA 4RX1A 4MVJD 2VDVE 3C4VA 3NDPA 1U8FO 3ZVLA 2ZLBA 3BICA 2XCSB 4Z6KA 3Q8XB 3Q0EA 4Y2YA 4US2R 1E20A 3RRZA 4HGNA 3KU4A 4Q3CA 3VZRA 3DZ4B 2A2ZA 1T91A 1UM9A 4WCFC 1H8HA 1C30B 1S9DA 3U56A 2WHRA 1ZGGA 3HU3A 4B48A 3WLQA 3BIFA 5HWSA 3TN7A 3ZPXA 3FBGA 5KNBD 4RSGA 1N5RA 3GARA 4NH4A 1OKKD 3DMGA 3W3ZB 1FF9A 1EUDB 2RK4A 3AP3A 3RRBA 5BP7A 4Z5XA 4RZQA 2B98A 2QW0X 2IPXA 1Z8HA 1ZAKA 3IHKA 5HVNA 4QEKA 3OPXA 4NYIR 3PRYA 3CB2A 3I2YX 2VT7A 3ROQA 2A5LA 3B85A 1KBOA 1NFFA 1ZBQA 1XXHB 2FW0A 3OLCX 3G23A 4IJKA 5C0OE 1Z28A 2AZDA 4EMTA 3WGMA 3ECAA 1VRWA 2W37A 1M2EA 4IIUA 4M9SA 4JY7A 4HYYA 4CTOA 1LPPA 4YQFA 2EFEB 5CK4A 3R9IA 2WM2A 1F9AA 1C3EA 1DEOA 4QXAA 1OKKA 4B7CA 1ZUWA 5C37A 4H6PA 1SXJC 4MUFA 3WIEA 4UPEA 4MUIA 3HCEA 4WKGA 4RPHA 2Q6KA 1QF9A 1G21E 2BP7B 4K40A 3FSGA 3AUFA 3GFOA 4R2WA 1XELA 3C6ZA 4XFKA 3ESRA 3EW9A 2CMDA 2G04A 1IDOA 1V9LA 2C9YA 4UXHA 3R4VA 3HFSA 3RSFA 2HMAA 3C48A 4WLFA 4INJA 2OXIA 1FMCA 3DP7A 3KFVA 3L3BA 5DGDA 3KUUA 4BB5A 3ZGOA 1Z0IA 3RASA 2RGRA 4RJ2A 3SQWA 1NJSA 1UR5A 4CIAA 3EY4A 1NX6A 3UFXB 1CQWA 4QVGA 3D2LA 4AXBA 5K03A 2CV1A 1P5ZB 1UDBA 2MHCA 2WKQA 3GFPA 3GPIA 3H1TA 3QKRB 5EWLB 1DCTA 1FZQA 2V7WA 1RYHA 1VPVA 4MIKA 1I2BA 2JD0A 2SKEA 2WD9A 2YIDA 3EEQA 1W73A 1CS0B 3DDZX 4GDMA 3IXLA 1VHWA 1U3WA 1FYXA 1MC1A 4QRDA 4WNAB 1M1YE 2PQ6A 2AJBA 3EP6B 3GPDG 2QPAA 1GL9B 2O7NA 4M21A 5F33A 1LV7A 4HN4B 3EQ6A 4KSBA 2ZYTX 2XTJA 2EDAA 4QT4A 4JZYA 1C0KA 5EVCA 5EJ4A 1ZJZA 2DTEA 1FTYA 5CJPA 1J8DA 4YA6A 5I8WA 2AVNA 5DN9A 1Z4KA 3F7TA 3URKA 4CMKA 4BNDB 4PX9A 4ZTUB 3UH0A 1RR6A 1Z7BA 4B81A 4A26A 1CEYA 3HVJA 2VFAA 3QEKA 5KO2A 4RTPA 4N41A 2F3QA 2J0UB 2OQRA 4KLZA 3FR8A 2VCYA 2JI7A 3GDGA 1FYFA 1L7MA 1M8JA 1ZL2A 2FOXA 2WIKA 2YJGA 5EKDA 1HLFA 1RQPA 2RBGA 5AK3A 5GOZA 1MAUA 3LF2A 1NG9A 4LMBA 3OX3A 3TOZA 2SBTA 3VDXA 5IC4A 4P98A 2QXTA 4CMCA 1WVMA 1ULTA 1YR6A 2FPGA 4RULA 1XPRA 2QIPA 2N46A 4E15A 1N2JA 4YUAA 1RRMA 2PMCA 1P1HA 2VJQA 1MIOA 1OAOA 4NCNA 4FOLA 1TVKB 2PKXA 4B3JA 4FDTA 3ADOA 4I9HA 2C7PA 3IDFA 2VI5A 3HU5A 4QJ3A 4M9UA 1Q84A 2ECFA 3PE6A 3ESYA 4BFVA 3BC1A 4EG5A 2BDUA 2R79A 1Y3DE 4BGIA 1E3WB 1KMNA 1OFIA 2C96A 2XVMA 3BMCB 4U0KA 4EYQA 4CCYB 5GJCA 1GQSA 4XTRA 5BMVA 5B7PA 4MRAA 1I80A 3LC1O 2JATA 5L9AA 4Y6SA 3VTZA 4V3CA 4XX0A 2AC4A 2XTMA 2QRQA 3KDSE 3NM4A 2FUEA 3CEJA 4V0LA 4YP0A 1DLIA 3G0IA 4URVR 2X7JA 4GOKA 1IAVA 4UMFA 4HS9A 5MN4A 1RABA 3X2FA 4UUNA 5ALVA 1KU6A 2WYOA 4CMBA 2HNAA 1G5TA 4UU7A 2OESA 3BMNA 1ISSA 5F78A 3RF7A 4CV1A 1HRKA 3VO1A 3IHTA 2AG8A 4YJFB 3N75A 1QLHA 4K0RA 3FLBA 4DZTA 3B1YA 2GEBA 2Z3ZA 4JI2B 1KVUA 3IPLA 4NJEB 2D7JA 1JJFA 3KEGA 3U6KA 3QENA 3U9SA 3B1ZA 3ZGXA 2GYVA 5T57A 2UZ4A 3UMYA 3AVVA 4TV9B 5I7AA 4OQNA 3DFKA 2BGKA 4YPOA 1C7QA 1OJLA 3I45A 4BE4A 5JVDA 2JZOA 1DXQA 1E4YA 2G06A 3ZZUA 4RCZA 4UEKA 4URYR 3ZTWA 4BQQA 3P52A 1DJLA 1QP8A 4H60A 4JOSA 3OM0A 4Q01A 1SMKA 1FP4B 2VDQB 3IX7A 1Y4AE 1W7AA 3DONA 4LE1A 4DPLA 1FUEA 4GRIA 1EZZA 1CY4A 1KJ8A 1TYCA 1YOVA 1Q1GA 3BMOA 1NBWB 4NAHA 5CPFA 3VNBA 1WIWA 3VGPA 3WBJA 4YONB 1AHNA 1ZIPA 5KPDA 3QEJA 1R0XA 2IDJA 4H16A 2XT6A 1JXAA 1I8TA 1LSUA 1D0VA 1KAGA 2F1JA 2RGWA 2V7QD 2X41A 4G84A 4U8HA 4DB4A 3E7FA 1VTKA 3ER6A 3VR6D 2SECE 1J22A 3DBHA 3H9UA 2Q41A 5CDFA 2DKFA 4LFCB 1JR3E 3DZKA 3PYXA 3HLYA 3TXYA 4G4JA 4RANA 3B9QA 1UZUA 3VYSB 3PVZA 3VPSA 4E1AA 1WSBA 2ZRLA 4FWBA 3S2YA 5JBQA 4WGGA 3UT0A 3VV3A 2PXCA 3SSNA 5MGBA 4ABTA 1JLKA 3TDKA 4NF2A 1F17A 3HPRA 4LI3X 1QMHA 2B4KA 3JZIA 4HTAA 3C1OA 3M5PA 4L85A 3UJCA 4A36A 1GCAA 4M88A 2PK3A 2GJ9A 4N0PA 4JU9A 1A5ZA 4DM7A 3AEKA 3P9ZA 2A9VA 5IASA 4ZU1X 4BMYA 4EUFA 5LP1A 1Q22A 2BZ1A 2IYYA 2NT4A 3SQNA 4N40A 5T67A 1PNTA 4BKUA 1DV1A 5T4HA 3WBKA 1A8SA 2FV8A 4EW1A 1FFXB 4AZVA 5G1PA 1GM5A 4PLGA 1YS2X 2C3OA 3PNBA 1PJLA 4TUYB 1TQ4A 4Q00A 3LCRA 1E2GA 2IXFA 1SKYB 4Q4DA 1SAYA 4PAWA 2CL6X 3PX7A 3KGDA 4WL0A 1JTFA 1R15A 3LX6A 4JGBA 2QPLA 4XQCA 4ZT2A 3ELDA 2IPOA 4MYDA 1C1XB 1Q3HA 4TKVB 4DFDA 3WJ7A 1LJUA 1M1NA 2XCOA 4ZT6A 2I2AA 2WJAA 4KUHA 4G5SA 5C5IA 3D8RA 2NTYC 2X7XA 4XASA 3D8HA 5D3MA 2FEXA 4KR7A 3U5TA 3M82A 3X1WA 3AXSA 1PCXA 1PNVA 1Z5PA 2YBDA 3K72B 3PIIA 3I4CA 2QLNA 3GA5A 3K94A 3A6EA 4HDKA 3GH3A 4IO0A 2OQIA 5ALLA 2ZSUA 5A7HA 4DLZA 5K8LA 1ABBA 1T4BA 1DDOA 1M5TA 1PN3A 1R50A 4WPGA 3WB1A 4BO3A 5KDDA 2JLXA 4DLSA 3M4YA 3MJTA 1I13A 2LGJA 2ONYA 2WT4A 2XKJE 1YVUA 5U4QA 4J2HA 5JADA 1Q0SA 1IB6A 4XSHA 2QR2A 4H6VA 1GP2A 1W88B 4I9GA 4PZDA 3V9PA 1O8CA 4N5DA 5FLYA 1JSZA 3KEOA 3ESDA 1DI0A 3ZHTA 3V1YA 1UH5A 2QW1A 4YRCA 3TCNA 1ECPA 4LRXA 4MV9A 3T4PA 3HJHA 4FPXA 1KEPA 5BWBA 3R4CA 3MC1A 3PNOA 2I7CA 4RHEA 1ODFA 4DGQA 2GCNA 3GLIA 5AVJA 5E9WA 3NT2A 4OHRA 4O2AA 1KJ9A 4G89A 4ZGWA 5LN1A 2L82A 4C2BA 1E79A 1X1BA 4N49A 3BWEA 4LRYA 1S7CA 3E1SA 2ZBQA 4US0R 3D2AA 2O5RA 2C04A 1PG0A 3CQ9A 1TF2A 1SBQA 2UYGA 2Y71A 1KZ1A 5BQ3A 3Q12A 1B73A 2PLAA 4IIJA 3RT1A 3ZCQA 1XPUA 1FXWA 2FQWA 2BTQB 4LKRA 2FE4A 3B36A 4HFRA 1HY3A 1ZOIA 4LVOA 4RY2A 3N2YA 3SLKA 8ADHA 2UYHA 3TI9A 4I66A 4EJFA 1IOWA 5ECWA 1T35A 3EQ2A 2VNAA 3AJEA 3W2GA 1ZVQA 3QX9A 3P9YA 4P3KA 2JKYA 4MW6A 4LHVA 3TQQA 4BQSA 4C03A 3ANYB 1H6CA 1RP7A 1YDGA 2DWUA 1KH2A 3K1ZA 3QUBA 4HDKB 4KBFA 1IY9A 4MQ4A 2OCKA 4Y7CA 1G20B 3DGEC 1O6FA 3GWGA 4EJMA 4ZZIA 4NY1A 3H5LA 3P9XA 4IVQA 3H97A 2XIJA 4FZRA 3C3JA 3CZ5A 2ZJ4A 1QRTA 3MJ4A 3WFZA 3V4RA 3B6JA 5C51B 3CWCA 3MK31 4JSYA 4JJ7A 3WL8A 1QRSA 3H2JA 3OZVA 2VDPB 1P7ZA 1U98A 4LZOA 5AJWA 3JR7A 3IKJA 2PEZA 3QBEA 1HKHA 2D3WA 4CL8A 2A1UB 4D02A 5FR2A 4C4RA 4EHDA 3B12A 3IMFA 1BX3A 2WU8A 3AERA 4K3UA 5JLJA 3SQXA 2YYAA 3CYFA 3RUAA 1E92A 5A1TA 2OG2A 2HK6A 2VJNA 1TO6A 2Y8EA 3H1BA 3CNEA 3N2ZB 2MU1A 3K7EA 2LDBA 1NC3A 3QKTA 1HQYE 1FRQA 2YHUA 1C3OA 2FRVA 3KQTA 3SM9A 3F5QA 4V3BA 1KZ4A 2G4CA 3VSDA 2WVGA 3O90A 4WI1A 4C3OB 3STXA 1RZRD 4QTTB 3PLAE 3OQMA 3JQAB 1SELA 3WYGA 2DGDA 4YJ3B 5KYUB 3Q8WA 2JH9A 4FGWA 1UBEA 4GNRA 2POCA 4RO0A 4U1RA 1NF2A 5J3JA 3PFBA 4ZHQF 4UVGA 2WE7A 1OYVA 4UTZA 1M75A 4V0ME 1QU3A 1NPTO 2C9MA 1NXTA 2I2XB 2JZCA 2YY5A 3K0BA 4QUIA 5B1SA 4A8TA 4GSLA 1PGOA 3BK1A 1PEAA 3I9V1 3R6TA 2CEAA 1V9CA 4QUEA 5ADHA 1SC3A 3O4GA 5IT5A 5IZCC 1M5RA 4Y9UA 1OR8A 3G6KA 3ITNA 1GV0A 4UHFA 5G40A 2F8MA 1JMYA 1TAGA 3NG1A 3FSJX 4C29A 1J1ZA 1VMKA 2G72A 4PS1A 1T5TA 4C6TB 4LOLA 2PYZA 2EGHA 3BUSA 4S04A 3NBYC 3IAM1 3MRTA 1PO7A 1ZN8A 5HJEA 2VJPA 4D9KA 1E3TA 2YX1A 2QBYA 1H2FA 4PM4A 1Z8NA 3LQYA 3LAWA 3PFFA 4UQLA 1XUOA 2RGYA 3K0KA 1EM8A 2BR5A 2Y0CA 4UVHA 3R9KA 1JU9A 1I72B 1IN1A 4LZZA 5HIJA 2QJWA 3H9CA 4WJKB 2VK4A 2NXJA 3JQDA 3PE4A 1XRNA 3TE7A 3NVMB 2I6GA 3MT7A 5DYTA 2Y6VA 1YMQA 3SZLA 3NOVA 1WB9A 1XK6A 1Z39A 4O02B 2HA4A 1W5FA 2WE8A 1ZLXA 1T4DA 1CY0A 3DJYA 2PXAA 1SHUX 3KDAA 3GB9A 4NULA 4DCSA 1PZMA 5IUJC 3V4LA 1X2EA 4EAQA 3LWBA 3HA2A 3KSMA 4EA8A 3D0RA 3W6PA 2O8EB 2CKDA 2F9FA 3L02A 2CFTA 4MYSA 1LF5A 3WK8A 3GFGA 5FI1B 1QFYA 1CTQA 3OECA 3GI1A 4TUYF 2RC5A 1ULZA 2QVYX 1YBAA 4X24A 3BPSA 1S2NA 2W5UA 3HJTA 1OYYA 4P6VF 1V8BA 5DGTA 1E9BA 3GLIE 3LBHA 5AMXA 5B3LA 1QQTA 3HFRA 1HEUA 2PSDA 4PZ0A 4CN9A 2DPHA 2XGMA 2P9CA 3RYIA 1XR3A 2WYHA 4OA8A 1NX9A 2R84A 2BUCA 5EIEA 1OXBB 1ITZA 1GGHA 3HCWA 1A82A 3WGQA 1F2TA 3WKEA 3ETGA 1C3LA 4MR7A 4CMIB 3B1KA 4L28A 3C70A 2X9LA 2Q27A 3AHJA 3O8LA 1P2SA 4FQ8A 1JEYB 3WIOA 2QVXX 5EJAA 5TPZD 3TBHA 2AMLA 5CNJA 1ZC3A 1H3EA 2QL5A 2PZJA 3HBFA 3OM8A 4CV2A 2Q1XA 4DF3A 4J75A 4YB8A 4MRMA 4BY9E 4H3VA 3H04A 4UBIA 4X93A 1OVGA 1V4NA 1Q11A 2JZNA 3RWMB 4W7HA 1JU4A 2C4WA 2X5JO 2QRJA 3COYA 3GJ6A 1QP7A 2YC2C 3K31A 4BFXA 2CXQA 2JEYA 2OFOA 3TV1A 1A5AB 1UPTA 3KYJB 4GGPA 1ZH8A 1X1SA 3EAGA 5DH9A 4O59O 2MSCB 4OMDA 4BJ6A 4Q12A 3E7PA 2H85A 1MC5A 3GEEA 3LIIA 4HYEA 4NBLA 3USZA 4F1KA 621PA 4R8MA 2E37A 3PF8A 2BI8A 2PGIA 2QX6A 1SQSA 3NATA 4M54A 4Z9XA 4MVJP 1IN5A 2CBGA 3NBZC 3OCWA 521PA 5A6SB 2P6RA 3O9ZA 2I80A 3GCDA 5EIFA 1DAKA 3A04A 2QM0A 3P94A 1DC4A 1IK6A 2GCOA 2ORED 4DSZA 2J9GA 3FF1A 5JTUA 5FTLA 3D5EA 4OFBA 1ATIA 3DFIA 3K1TA 4AX4A 2QMEA 3D6HA 3FCXA 4Q3DA 1UMCB 4CM4B 1TJPB 1EIWA 4YRJA 4ZQBA 3BA6A 3ZKAA 2BEUA 2I4IA 2DOKA 4JQOA 4R51A 5AM4A 2ZZKA 1DG1G 1O8BA 4L4RA 1G7SA 2RCYA 2RGGA 2BBWA 3NRBA 1E66A 2B8NA 3SKYA 3DLBA 1FYEA 4Q5IA 1JT9A 4QYTA 2XLCA 3AIKA 4YCBA 1TEXA 1A7JA 1IY0A 3HU1A 3LH5A 3EZLA 2OBLA 2PV7A 2ZSKA 4OFXA 1A77A 3UK0A 3A6FA 5HFNA 3HB5X 2QT0A 2OV2A 2FW8A 1ARZA 1E1CB 5JH7B 1MFZA 5BNZA 1DOHA 2Y0EA 3KQHA 1D2CA 3V2IA 1AHHA 3MTQA 4GPZA 5BQOA 5J4HA 1Y9AA 3ZE0B 1RU3A 2IX9A 3W2TA 2YCLA 1Q1QA 3MS7A 3SIXA 4EO4A 1I01A 3GT3A 1M2WA 2IHZA 4ZJUA 1P9WA 4MVJE 2FPIB 3AF2A 5SV2A 4EARA 2WYWA 4XVRA 4AYTA 5KKNB 4ZALA 2JK1A 2IOHA 4LJKA 3FX2A 2J41A 4R8VA 2GEFA 2G67A 3T7EA 2CVOA 4RVCA 3BIOA 3LT4A 4PS0A 3VZPA 4TV9A 3U39A 1CJVC 2GZAA 3ESXA 3HN2A 2ZBRA 1KR2A 3V6MA 2NAFA 4ZVVA 1LBHA 1RMQA 1YR2A 1FLAA 1V8DA 2ERCA 5LFAA 4O5OA 1UOEA 3DZ5B 4XM1A 3W4IA 5BV1A 5TJHA 3CH6A 1GZ7A 5JCOA 1ZGHA 3L5OA 2R7MA 4U8GA 4JR1A 3TBKA 4AKGA 4GD3Q 4RHTA 4KYTA 1M8KA 2GM3A 3CF2A 4MMXB 1F4LA 3LY5A 4NU6A 4RIEA 1LLCA 1U9IA 1YZQA 4LC0A 1H2EA 4WK6A 3DZ8A 1AUVA 2WTEA 3O84A 4XDHA 1NW9B 4FOSA 3UJHA 3ZI0A 1R5OA 2ZIVB 4BRZA 5BSKA 3CW2A 4HAZA 3PEEA 1I7BB 2J6CA 1YJXA 1OZFA 5C4IA 3Q5DA 5KNCA 4C3ZA 4I8DA 1XX6A 2PZFA 2GN2A 4HNTA 4C7OA 2CCGA 1R1DA 5IWCA 3AW9A 2PLWA 1Y5MA 1GG8A 3DBLA 3KV1A 4HWPA 5ERYA 3BREA 2WJWA 3SMQA 5AXAA 5TQ0A 4D6PA 4YV1A 3F97A 3NYWA 1ZK0A 4NPCA 1UMDB 4WADA 3RSLA 2YXBA 1U2ZA 3CPSA 3RBVA 2H0QA 3JASA 4P8RA 1KC1A 3SQOA 4N01A 4PAGA 3O6VA 1AX9A 1QGDA 2PSSA 2CT8A 2X0NA 1VDZA 1WE2A 4QFCA 4BFLA 2Q3EA 3DXZA 3PR3A 2FPMA 2YWGA 3AJDA 3NUZA 5KSZA 1SRQA 2D5CA 5LZ9A 3TTTA 3GYBA 1BMDA 1N5MA 2IOYA 4G1EB 1CE8A 2EF1A 1JWBB 1QX3A 4NZNA 1VRVA 3SSMA 2P7IA 1AVTA 2AN1A 4DNFA 1XNQB 1NI3A 1F3LA 5DLDA 3QUSA 1DUIA 4ZV9A 2VR1A 3PJRA 2W8ZA 3KM0A 5DLPA 2P5SA 1SXJA 1DEHA 1FSGA 1U3GA 3DNFA 3NJ4A 1CR0A 5AJZA 5BQXA 1NVUQ 2HMUA 3AF0A 1ID8A 1MHTA 5BNIA 3UJ9A 4M0MA 3MUNA 1NWHA 1SR8A 4OXQA 2RGBA 3I6YA 4QOFA 1VPEA 1QH0A 3HDTA 1N2HA 1Z73A 1Z75A 1RHUA 3BRCA 3GELA 2XUPA 4M37A 5ES3A 3WMEA 1X1QA 5B3KA 2FSFA 1PBNA 2IXDA 3I04M 4ND1A 1JYFA 3WLTA 3LPMA 3WGIA 2PO5A 2H7YA 2ZBDA 3QXJA 2PD6A 3L8DA 4PG6A 1Q14A 4W1PA 4GQAA 4IMRA 4X5OA 4I1PA 2G70A 1DDIA 3DM9B 2J0UA 2YV1A 3GYGA 2Z8YM 2QVCA 4NMMA 4NYJR 1K7SN 3DBVO 2B5OA 3DZJA 4OQZA 3LVRE 5LUBA 3WHPA 3ZI4A 1MP0A 3BG5A 3MRSA 4MRRA 4OU4A 2DQZA 1WUIS 4Q4HB 1VP3A 3IEIA 2BIFA 1AQYA 1SU4A 1ZA2A 3GLHA 1BVUA 3K1YA 4FR5A 4HGPA 1UUFA 4N7JA 2C20A 1RYMA 2UZ3A 5TC4A 1DIGA 4IX1A 1Z4IA 3SZOA 4X3PA 1BHSA 1VHTA 2UAGA 3VZSA 3LXRA 3OJCA 4E2YA 4BLOA 2VXBA 1HQCA 3PQ8A 1YU6A 1JHRA 4RHFA 5E4YA 1P62B 1QIMA 1TKCA 2XUFA 2EXXA 1EG7A 1XRPA 3E9ZA 3EIXA 5EERA 2YWRA 1RM4A 2ODEA 4MGYR 4AQDA 1R00A 1T4MA 1WDLA 4DNPA 3QEBZ 3ML1A 5KSPA 2NO6A 4KN6A 3K1AA 3OBIA 3TQTA 1Q6YA 2OK8A 4EVQA 1L1QA 3ASYA 4HUJA 1XALA 2DT8A 3TMYA 1W5EA 3S2GA 4OY3A 1RLMA 2ID7A 3ETJA 4IDPA 2WHYA 3ILYA 4D3FA 2R0QC 2GK7A 3ZBPA 1WCXA 4ZV4A 1YULA 4QYWA 3S2ZA 4G5HA 2EJBA 3BORA 4DJTA 1I4WA 1OAOC 4KWIA 4FFMA 1WBBA 3V2HA 2LCQA 1OTYA 2BWJA 3I72A 2OAP1 3O26A 4JZKA 2G9QA 2C5LA 1NSFA 1JQKA 1L5SA 1UOOA 2DLDA 3PPWA 2PRZA 5JOQA 1IPFA 3EZNA 2ZBPA 3RS5A 4DCUA 5HKOA 4F5EA 1VSTA 1PV4A 4JLNA 3Q88A 3E4CA 1IFXA 2LCIA 4J03A 4BHTA 3LUGA 1AKWA 3K09C 3ZK9A 2DCUA 2ID8A 4X94A 1P0FA 5K1ZA 4DCGA 1UMCA 3HABA 3F96A 4R1OA 1XRRA 4CR7A 5H80A 4OI1A 1NW6A 4DQKA 3L6EA 3SBDA 4B6GA 2F00A 4H0CA 3IRVA 1G3UA 3B2NA 1XZJA 1ZMBA 4FJ1A 3H6KA 4YT8A 2PIDA 1C1YA 4MKZA 2QLTA 4OXNA 5IBRA 1BAPA 3ESCA 5J2TB 1HO3A 1K7YA 3IOCA 2DP4E 2AZTA 1Z6AA 2V6MA 3B7GA 2BFCB 1NOIA 4LGVA 3KJEA 1O4VA 2NUPA 4AN4A 2JGKA 3G5LA 2JB9A 2QG6A 3AGQA 3Q4GA 1FVFA 4A91A 1PNOA 2C57A 4II3A 1HMPA 3HKCA 1UJCA 2H2GA 1JSXA 2WVJA 1X94A 2JGLA 4IKPA 3NHFA 5F12A 4IFTA 5AHKA 4CLEA 5JJLA 1CUXA 4IVNA 1O6GA 5JHGB 2ZAOA 4F84A 4EL5A 1PNRA 4WDQA 3KDPA 3BK2A 4BGUA 2P5TB 1PGJA 1ZUIA 3O3NB 4H4DA 2F1OA 1S8AA 5FA8A 2C9DA 4Z0TA 1Y80A 3N8HA 3NUGA 4RNDB 4TT3A 4YRIA 3WG9A 1KYZA 1A1VA 2Q3DA 5KOIA 2OCBA 3GD7A 3WMGA 4QJ5A 3DDNA 4KV9A 3TNJA 1MJNA 3UUFA 4Z4EA 5E3IA 3UAWA 5CDGA 2AF4C 5A0FA 3FUXA 2O06A 3ON5A 5IMSA 1C2YA 2G71A 2GR9A 3OFSA 3G02A 2IW1A 1DARA 1FX0B 5H81A 2O7SA 4BWFB 4C2UA 3OOYA 1K8QA 1XC7A 1VMEA 2BGWA 5KYYA 2XZOA 1A04A 4K46A 5IEJA 4M0UA 5M04A 2CLLB 2J9FA 3G1WA 1T5OA 4PO9A 5EPUA 2FQYA 2ILTA 1EBUA 1DBQA 4IIGA 4YRPA 1RPNA 2DERA 2PZGA 4ENRA 1R9JA 2J46A 1IZYA 1E6WA 1GQFA 1M6NA 4O4IA 2NO4A 3K96A 3A3YA 4E1VA 4WOJA 4CLOA 5LQDA 1DKMA 1O95C 1RAAA 3WLPA 5MGNA 3UMMA 4PYOA 3U3MA 3IUPA 3H4MA 3KJFA 1T6BY 4UW9A 5DCWA 3ZZNA 2IEIA 4J43A 2JLZA 1XHFA 4ZGBA 2AE1A 3NTOA 2XXBA 4KYIB 2XADA 2GBGA 3C16C 2YNMC 4RFSA 5FUQA 5DMHA 1U28C 5BOSB 2IGTA 2ACKA 2IUFA 4JP8A 1B76A 5AH0A 4B8WA 4NDAA 5ADVA 5JQGA 1V6CA 2H5JA 1TVCA 1XQVA 4LYJA 5EKTA 5IM5A 4M36A 4E5DA 3B70A 2CNLA 1Y98A 4J0FA 1Y7LA 1OC2A 4O4JA 4Y9DA 4YECA 2WTMA 3NEYA 4MNTA 1XJ5A 3BFPA 4RK5A 3PLNA 2D1YA 1RVV1 4DBLE 4OJKA 2NPIA 4G5GA 2WBLC 2QZSA 3TQSA 1HEIA 4EYSA 1E9CA 2P8SA 1IQPA 2H5EA 3D8TA 3HFGA 2W4MA 1XMIA 5TPZA 2AEJA 1OFVA 3N58A 4QGHA 3HPQA 4AJPA 2IS6A 5GZ1A 1PTJA 1BIFA 1UC9A 4ZDKA 1YBMA 2WF8A 4QNNA 1NUUA 3SEZA 1UL1X 4Z7QB 2XMZA 3WXMA 2QGNA 4PR0A 4IVPA 1OXXK 3UPDA 5K6AA 2Z3VA 2AOUA 3DH0A 3LHKA 4RVSA 1KKLA 1Q12A 5JR3A 3FIJA 2GERA 2ZDGA 4N9WA 2HFJA 1FVXA 3CKKA 3C97A 4WECA 3QE2A 5BR8B 4ZVLA 2VIIA 2XV1A 3GU3A 2DFDA 1QS0A 4CEIA 5E9JA 1KDOA 5DDIP 2DE0X 2XXJA 4LE2A 3ZLTA 5LUAA 3OX1A 3HKEA 1CHDA 2Q0XA 3NHMA 3AB7A 4I2NA 1JFFB 2ZVJA 4XRRA 4C0HA 4QASA 5E3JA 4MWCA 3HUDA 3EF1A 1IH8A 3PK0A 4L0QA 4LSZA 1EK0A 1GPYA 3K16A 3VI4B 3GNSA 1G9SA 1USGA 2X23A 4A73A 2DH5A 3D6TB 4RK1A 1R6UA 3L7LA 4RZIA 2QTNA 3JX9A 1J49A 1GGFA 1L1RA 2Z56A 2ZB3A 4U00A 4KDFA 3MEQA 1E2QA 8ABPA 3NQ41 5I6DA 3SQLA 3EISA 1YZFA 4FLEA 1ENPA 1J07A 1Z22A 2VZ0A 1ZR2A 3UAVA 1GTMA 5B5SA 4UDYX 2FMHA 3ZWKA 1AKNA 5JNUA 2PCLA 5AIBA 4MR8B 2Y1CA 5CURA 4F96A 5JH7F 1E0AA 4HQ6A 2HZBA 3AI2A 4EQ6B 2LIVA 4AI6A 1J2UA 1U1CA 2IOFK 1NF3A 2JIZD 4G85A 3WO0A 1R2QA 2HMVA 2J45A 4IEIA 3N2NA 4FFPA 3EIUA 4BX3A 4Q1VA 2RHHA 2KM1A 1ZMRA 3FAKA 2A30A 4HF7A 5KYWB 5C9ZA 3FTEA 3NDIA 2G76A 2H4HA 3B3AA 1FFWA 4CEHA 1AN9A 3WGGA 1JIKA 1OFUX 4AF8A 3AF6A 1I79B 1JDNA 2IBSA 1X3SA 2BE9A 2P9BA 3A05A 5JMOA 3A31A 3U4QA 4RE5A 1CUSA 2B0CA 4TWJA 4KVFA 2KWIA 2IZ1A 3ZKWA 3TR0A 4D57A 4DE5A 5F7OA 2ZUVA 4CQLB 3AL3A 1SU6A 1W4CA 3BZBA 3OF5A 3PDJA 1W88A 1Z83A 3HDYA 4MV4A 2B99A 4PBRA 5K4HA 4J0CA 3DR3A 1USWA 4N0MA 3EXFB 1F60A 1K2VN 3KEQA 1I7CB 1KMHA 2XOKD 2R2GA 2WMDA 4R1NA 2A58A 1LWOA 1W4RA 4PCVA 1A5BB 4OMFG 4W7SA 3QG1A 2HR1A 2J3EA 2I87A 1K8ZB 3T5BA 2HLPA 3PGMA 2C8KA 1ZD3A 2VYCA 2IYSA 2YHBA 1XCGB 2J31A 5HF8A 4XVQA 4COKA 5I48A 1X14A 3EOZA 3V6LA 1OPXA 2FP4A 3O91A 3ZWNA 2H4WA 4R8KA 5FWDA 5J4VA 4FDUA 1J2RA 3AH8A 4ZO9A 5LIRA 2X2OA 3SXJA 3T52A 3IPCA 1P3Y1 5ALRA 2POQX 1F2DA 4HDNA 3UAOA 4DIMA 4QE3A 5HMLA 4ENQA 5I7EA 1YTLA 1UMBB 1L5NA 3E6AA 5B1HA 4G36A 1DKPA 2ODPA 4M6WA 1AURA 1JDUA 4QWMA 4BJ3A 3ZCXA 4ZYUA 2PS9A 5FPHA 3OTHA 2QN1A 5JAPA 4Q3LA 2VUUA 2Z6UA 1FLVA 1P2TA 4G5QA 1U2SA 4GICA 5ALNA 5EIXA 2W43A 1RC8A 1TA4A 2F9LA 3AETB 3PC3A 1L6IA 5JS8A 5L6LB 3AEXA 3B1FA 3QQPA 3BL5A 3MGGA 4YAGA 2I6TA 3CBGA 5LLDA 2I3ZA 2O8BA 1E1KA 2C1EA 1T13A 2CBXA 3ZY2A 1ZVVA 1LQUA 1RWKA 1L8LA 4BAZA 4URHA 5GQSA 4RS4A 4JWTA 4L0MA 2FSUA 1TIKA 2VJAA 3B9PA 4Y6PA 2YC4C 1EVQA 1IAQA 5A2QA 2F17A 2NV6A 4IIHA 4UHJA 1XJWA 2VDWB 1RT9A 2TRSB 1MEJA 3GLTA 1A96A 5K6TA 4CCAA 2OQ2A 1NP7A 3KB2A 3KQWA 2AJLI 3RUCA 5C1BA 5D84A 2WD7B 2VBGA 3H5WA 4GZ3A 1VI2A 4MQUA 3TLXA 5TT1A 4YCNA 1E7YA 2X0JA 5AK6A 4HUQA 3AI3A 4CTJA 5G41A 4NVRA 1OWLA 1FU8A 4ESEA 4JLJA 2Q5LA 3HVIA 3NHBA 1Y9ZA 4GM0A 3EEOA 4BP1A 5A04A 3W2IA 3NS7A 1CIJA 3WX0A 1H1TA 4F4UA 2ZTUA 3DKVA 2WJZB 2B1GA 1ID1A 3FNFA 4OGFA 3EY9A 4ZCSA 4AMYA 4BC0A 4GI7A 5KJFA 4OV6B 1AXGA 1Y3FE 2Q5JA 3K5WA 4FIDA 3JQAA 3M7IA 1VECA 1WY5A 2IP1A 1GG2A 1B41A 3FZQA 5AK5A 2CLEB 3WI7A 4FZJA 4C6RA 3H86A 5HNKA 4UMDA 4HWGA 5JQWA 5IRCD 1W2GA 5JBIA 1EWVA 2GPNA 1K0UA 1U3VA 4V1CI 1GPMA 2L0XA 4LJSA 1L5GB 4PC1A 2WAXA 4O63O 5H1YA 1KJYA 3M49A 4MUAA 1QO0A 1XJQA 5DX0A 1WF3A 5ELXA 3WGJA 1N2GA 4LJ7A 4G8BA 2O4UX 4GPD1 1A0OA 4LZAA 2F59A 4MP6A 3K5IA 4RGQA 1GFSA 1YS9A 3ELBA 4JD5A 5K3CA 4BZXA 5REQA 1ZU4A 3BFVA 2VWHA 1P9RA 2FY8A 2CL7X 3EVAA 3JSXA 3KK0A 3OCCA 2RBKA 5JSZB 3IVMA 3HA5A 3IIJA 3U1VA 1T15A 4NENB 1O4WA 2APJA 4Q3KA 4UNRA 1PJ8A 4GI5A 4NC9A 1CRPA 3FUTA 3K9QO 2CXRA 2R1ZA 3K8QA 3QOXA 5G4KB 2B4RO 1QE0A 2GJ8A 4KR6A 2NUTA 2J5XA 2Q07A 3KOYA 2B3DA 4AJ4A 2VRNA 3OU2A 4NSNA 4DIOA 2ESRA 4L5CA 3P32A 1VJ1A 3BTSA 4R31A 2EKDA 1NVXQ 4IYJA 3RWOA 2V7VA 5DP1A 3ZQ6A 2FPPB 4D8XA 1I9CA 2Q5CA 2IUEA 2JI6A 2UZ0A 4OM8A 4UE2A 4ZJYA 1FX0A 5BVHA 3T3NA 3EQ8A 5CBKA 4YJHB 3JAWB 1R3UA 3ZD9A 4DB2A 3BE5A 3QF4B 4R83A 5ICFA 1QIDA 1Z4OA 4S1VA 3ZBUA 3QSGA 1SOMA