1P9LA

Structure of m. tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
245
structure length
245
Chain Sequence
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dihydrodipicolinate reductase
publication title The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 76
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1p9lA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p9lA01
2ZB8A 3GY0A 2YW9A 4OOEA 3H65A 1Q7CA 1AXGA 1UDBA 4JN6B 2GDZA 3PIDA 4BIIA 1VKNA 1ZSVA 1R12A 3DZIA 4YAEA 3ZNNA 2ZK7A 1EUZA 2JFFA 4EBFA 3ZWCA 1WNTA 2JFGA 2PGLA 1BXGB 3ON5A 2PWZA 3V5NA 3ONEA 2VOEA 3W8DA 1KERA 1ISMA 5JAIA 3LC2O 1A7KA 1DB3A 4R5MA 5C37A 4NK4A 2O4CA 3OQ1A 4B3HA 5U9CA 2EWMA 1D4FA 4DREA 1DBVO 4GWGA 4YRDA 3FWZA 2JCXA 3IDSA 1BG6A 3HE3A 3LC1O 5CHEA 3ENNA 1PSDA 4U8GA 5KJCA 2BGLA 3LQFA 4GX5A 4OSOA 5CPFA 2P9GA 3MJCA 3HDJA 3NV9A 4UUPA 1T24A 4R69A 4MIOA 1S7CA 2I5PO 3DO5A 1U8FO 2HAEA 3SXPA 4XB1A 3AY3A 4QQRA 5C3MA 1PR9A 4D7AA 5JE8A 4YRAA 3BYZA 3DBRA 2XOXA 2IZ0A 1I3KA 1IB6A 1U5AA 2YQ4A 1U9JA 2EGHA 1E7MA 1LDNA 1B3BA 4WOJA 1OBFO 4PGFA 2ZQYA 4ALIA 2W8ZA 3DZHA 4GPD1 4HP8A 1HXHA 4DLLA 1EDZA 1RJWA 3QE3A 4R3WA 1A4UA 1H0KA 4GSLA 1R66A 1T2AA 4J6FA 4JBHA 2C2XA 1K2WA 3BHJA 4QTZA 2PLAA 1EUDA 2PH5A 4U7WA 5G4LA 2X0NA 3EZYA 4IM7A 2EP7A 2NNLD 2ZJ1A 1E1KA 4I5EA 3VZSA 2NVBA 1DEHA 1MC5A 4EZBA 3ICPA 3DZFA 4S3MA 1EE2A 5DDIP 2CD9A 3C7CB 5EN4A 2EKLA 5C5IA 2YHIA 4YJDA 4U0KA 1YBAA 4W9NA 4BUCA 4PZCA 3I52A 3DBLA 3LLVA 2QW8A 3ZWBA 1LLUA 1ZK1A 3RVDA 2E48A 2VZ9A 2YJZA 4O0LA 1F17A 2O3TA 3ASUA 1RKXA 3QVWA 5F5LA 4GH5A 3M2TA 1T2FA 1VJ1A 1B15A 1E77A 3NX4A 4CMAA 3R3JA 5BSEA 1ZEMA 4NBVA 1JDJA 2O7QA 2VYND 3OA0A 3CINA 3BTOA 3C1OA 1Z45A 3H9GA 3LF2A 1PL6A 5I7VA 3R1IA 3AJRA 1EVJA 2HO5A 4AL4A 3OICA 2PKQO 2PZKA 3T4EA 4BO6A 2JCYA 5B4VA 3O9ZA 5H82A 2DQ4A 3WJAA 2IZ1A 2YQ5A 4MOWA 3WBFA 2FOIA 2OZPA 1G1AA 4XRGA 5KWEA 1H9BA 3QLJA 4NNJA 2R2GA 5TT0A 1ZW1A 4FGWA 3WXBA 4ITUA 4NPCA 3GG2A 1U7HA 4ND2A 3GNSA 1IYZA 2Y1EA 1FDTA 1O95A 2CDCA 3GG9A 4Z9YA 1A27A 2BF7A 1SPXA 4CMCA 5A03A 3DMTA 4PLZA 5G0SA 4BO5A 4FN4A 4FR5A 4Y9DA 5BSFA 3RUCA 1KBZA 1O5IA 3ASVA 5JY1A 4WCFB 2X5KO 4ZQFA 3ZWOA 3W4IA 5ILOA 2HUNA 4P38A 1D1SA 1UR5A 1YE3A 4PG5A 4J4BA 4CV0A 4R9RA 2X5JO 1NWHA 2C5EA 3BMQA 5J23A 4NK5A 2HDHA 1A72A 1DIGA 2FR1A 2OBYA 3GC6A 4L9RA 4TZTA 3S55A 3C8MA 1CERA 4NBUA 3FSRA 4RZIA 3RAJA 3DONA 3HNPA 1JWAB 4YQYA 1F8FA 2PGDA 1TXGA 1IZ9A 3EYWA 4J7XA 5EMHA 4BGIA 1ENPA 2J5QA 5LC1A 1A4IA 1P74A 5JAZA 1O8CA 4A2CA 5C7LO 2EF1A 2HMVA 3AOGA 3R0IA 4EEZA 1MA0A 4RPGA 1ZJYA 3WFJA 5DCUA 2QRJA 4HWKA 4XKJA 2I76A 4JJIA 1ULUA 2FR0A 1LRKA 4YJHB 2WD7A 3ROPA 1VKOA 2WM3A 3TZQA 3E9MA 1X0VA 1R4NB 2P9CA 5A4DA 4WPGA 5KJ1A 3TOZA 3P2YA 5EINA 3ZHYA 1LDBA 4IGFA 4URFA 2AHRA 3GZNB 3VPXA 1F8GA 2X23A 3JQDA 5I9NA 2PH3A 1RYDA 4B3JA 4BMNA 1A9ZA 1C1XB 4IGEA 4KUEA 1E6UA 4FCCA 2E6UX 5A9SA 3TFOA 2J3HA 3GRKA 4ALMA 2AEFA 4LN1A 5BSHA 1PJQA 3B1FA 1GZ4A 1HDYA 4IS3A 1K0UA 4BNMA 4YAJA 1EE9A 2IE0A 5CG1A 3BTSA 1ZZEA 2V6FA 3T7EA 4J1QA 3ANMA 4L4SA 1DJNA 3AOEC 1N1GA 4I5FA 1H6BA 3PHIA 4BNJA 2WTBA 1AE1A 3EY4A 3AK4A 4ROSA 2EJWA 2RIRA 5EPOA 3WMXA 4A0SA 3ZCXA 4CM5A 5T67A 3OEWA 3S2GA 3VHRA 4TWRA 1HZJA 2CUKA 1V3UA 3IL2A 1U4SA 1UDCA 4K28A 3JQBA 5T6BA 3V2UA 1HLDA 3T4XA 3DOOA 2DM6A 4J7UA 4IJKA 1E7QA 1M6HA 3N74A 4DQVA 4QUKA 5IAAA 3GDOA 1MX3A 5JDIC 4XDYA 3MJ4A 4YVFA 1H5QA 4E30A 5ENVA 5ES3A 3PP8A 2EW8A 3ZW9A 1GPDG 4U0JA 4XD2A 2PZLA 3M2PA 1E7WA 2HMTA 1ISFA 1YJ8A 4MVJF 5G0VA 3ZZNA 3OM9A 1QYVA 1W0CA 3ONFA 1U7TA 1MXHA 3JQ8A 5DN9A 2HQ1A 1Q0QA 1SB9A 2G5CA 1RWBA 1GV0A 1LTHR 2CNBA 4C4OA 5KJ6A 5TLSA 3Q1LA 1SNYA 1P9LA 1XEAA 3E03A 3VPHA 4EITA 4ZD6A 4CQLA 1I3NA 4HUJA 1EFKA 4INAA 3D3EA 1Z75A 2E82A 1D8AA 3AM3A 4WLOA 3HJAA 2Q2QA 1GZ6A 4O1MA 4N5LA 4GGOA 3A9WA 2BH9A 2VHVA 2NVWA 4JGBA 5A05A 4OXYA 2JKVA 1KY4A 1CF2O 3ZWWA 3WLFA 1IZ0A 3D4NA 3KOUA 4WKGA 2BD0A 4PVDA 5DP2A 1XR3A 4CLRA 2Q50A 2BI8A 1TT7A 5K6AC 5KVQA 2X1HA 3GVIA 5JYAA 1KEPA 5IF3A 3R6DA 4B4WA 3Q3CA 5AQ1A 4GVLA 3TL2A 1O89A 4O59O 1AGNA 2JHGA 1PJCA 4WEOA 1B16A 4D44A 2VQ3A 1NM5A 5FI3A 3UFXA 4ZN6A 4CL3A 5IJZA 5IN4A 2RHCA 5JBIA 4OJNA 3QY9A 1EK5A 5T8KC 3WLEA 1N9GB 3K2EA 3JQ9A 4R51A 4QECA 3W8EA 3PYLA 2TMDA 3H6KA 1VLLA 2W90A 1RM4A 4RO0A 5JDCA 1NP3A 3KYDA 3NUGA 4OAQA 4FB5A 3O03A 3QRWA 2BFMA 5L7YA 4GMGA 1AN9A 1PZEA 1BDBA 2NVUA 3ZV4A 1UP7A 1CQIA 3WJ7A 1H93A 1YL7A 1MXFA 4R9SA 4DMMA 3CXRA 3RUAA 1I01A 3FCOA 2IEBA 3DOJA 3A1NA 2GSDA 3TWOA 1HE5A 5JC8A 3WNVA 1R37A 3IKTA 3D4PA 4WNIA 2FRDA 2C59A 4TRNA 3ZU4A 1Y7TA 5MGBA 3EVTA 4YJFB 4CQMB 8ADHA 3LF1A 4FJ1A 4BNZA 3JQEA 3WYEA 7MDHA 1R15A 3AI1A 1OC2A 2UUOA 3U5TA 3LYLA 2VRCA 3BMCB 3IJRA 1Q2XA 1KEVA 2VWPA 1NFQA 1QP8A 3I5MA 1ZH8A 1YQDA 4K6FA 3Q11A 4B7CA 3V2GA 4TRJA 4QXMA 4F6CA 4PFJA 4CMGA 3CEAA 1LEHA 4OKIA 2DTXA 1LSJA 1LQTA 4FFRA 1SBYA 4D79A 2X22A 5LDHA 4N18A 5IZCA 4E12A 1HYHA 1XELA 3PIIA 2P4HX 4OMUA 4LCEA 1DIBA 3KSUA 1BXZA 3S2EA 3WGQA 3E82A 5CPBA 2JFHA 1E3WB 1U3TA 2AE1A 4Q3EA 4PLTA 3E1KA 2JL1A 4CM6A 1FMCA 3PDUA 4YDRA 3ETDA 3F5QA 4JBGA 4XYMA 1ZKMA 4MP3A 4L0QA 5G2OA 4CUJA 4PLHA 1IE3A 3CPSA 2GN4A 3A06A 3G1UA 1VL8A 1YDEA 3I4FA 5LDGA 2CF6A 1FK8A 4FJ0A 1Y5RA 3IS3A 4XQ9A 4DUPA 2PA3A 3SLGA 4WGGA 2WEKA 1QR6A 3SJUA 4DIOA 3C3XA 4E2YA 3W8FA 3NAQA 1IUKA 3ULKA 3IUPA 3UVEA 4XGKA 2O48X 1NAIA 2GERA 5TQVA 3UHAA 3VPSA 4FD3A 1NASA 4L75A 3P7MA 3RJ5A 3RBZA 2NSDA 2P91A 1P44A 3E9QA 3K9QO 5CDTA 3LDHA 2OMEA 5KKCA 5EESA 2C0CA 4PN3A 4Q3NA 3DAPA 3RFVA 4LRTB 4RVFA 5EJ2A 4CLXA 1DIAA 2EKQA 3AUAA 4UAGA 1BXGA 4AJPA 1JN0A 1WAMA 3HZZA 4L73A 2RAFA 4MJLA 3ZHZA 4FSHA 1T4DA 5CEFA 1X7HA 3ZU3A 3NJ4A 1VJTA 3NTRA 3UW3A 5JFOA 2R00A 3RU9A 4H15A 2ZB3A 4R68A 5F1OA 1E6WA 3GGGA 4QT0A 4RJTA 3DQPA 2V6MA 4D46A 3OJLA 2VNSA 3GVPA 1TEHA 4RDHA 1QRRA 4ND1A 4YAGA 3JQFA 1PJBA 2DLDA 1PTJA 3QA9A 3OQ6A 4RPLA 4WLFA 1ORRA 1C14A 4EJ6A 1GCUA 3QV1A 3E5MA 5HBRA 1WWKA 1GEEA 1R16A 3H7AA 3TZCA 3NT2A 3WMWA 3LZ6A 3AY6A 4XWYA 5B1YA 1P33A 5I9MA 2P4QA 1YXMA 2DFDA 4J49A 3PXXA 1YBVA 4IPTA 4QFCA 5JO0A 2HU2A 2ZJ0A 1M2WA 4WEQA 3W1VA 3RKUA 4FJ2A 4IXWA 4ZJUA 1TA4A 4JIGA 2WSBA 2Z1NA 1WVGA 4GX1A 4BO8A 2O50A 3P5SA 4WLEA 1TVEA 3HN2A 4PCVA 2BELA 3GVHA 4MO2A 2DPHA 4NBRA 1YO6A 4Y8VA 1U4OA 3FF4A 2A94A 3OEYA 3GFGA 2B5WA 4GI2A 4XGIA 1LQUA 3S8MA 3DR3A 1LLDA 2GYYA 3ZWYA 4MKRA 3IIEA 1JTVA 3L9WA 3H2SA 4ZQHA 1BVRA 1YWGO 5L7WA 1LJ8A 5A02A 1PGNA 1YB4A 2AQIA 3KO8A 5JYEA 2Y05A 3X2FA 2UDPA 3ROKA 2YDXA 1KEUA 3DTTA 4BNUA 2EGGA 3PQDA 2VRCD 5FEUA 1ZSNA 5THKA 3DHEA 1BW9B 3KVOA 4WJZA 2IYPA 2HCTA 3TF5A 4HNHA 4IUYA 3TZKA 2Y93A 1MUUA 3M6IA 3NJ8A 4KWHA 3HADA 3ROMA 1LRLA 3TPCA 2BRUA 1EUCA 4YRBA 3H4VA 3HG7A 1LC3A 3OIDA 3JQAB 3PHLA 3F9IA 5EERA 4P4GA 4Z3KA 2C2YA 4R1TA 4OGWA 3PFFA 3B1JA 1F06A 4UUOA 4OOFA 1X7GA 4D42A 5TGDA 4JJFA 3I9LA 1HYGA 4FDAA 5B12A 3JD0A 1LLCA 3FRJA 1DDOA 3ZWNA 3ANNA 4I5DA 1DRVA 2BGMA 3WQQA 4TRRA 3FNFA 2Q4EA 2RH4A 1Y1PA 1BXKA 2HKIA 3PWKA 1IPEA 3OHSX 2HMUA 3RCBA 1KS9A 2IZZA 3H3JA 5AXAA 4H16A 5FFFA 2I65A 3L77A 3LT4A 3SEFA 4DL9A 2JJYA 2OUIA 3UCFA 1QXSA 2G0TA 4J7CA 3C1AA 1SAYA 2FWMX 5KTKA 4OKNA 1ZBQA 3U49A 4KQXA 2C20A 1Y81A 3ZN2A 3O8QB 1P31A 2G82A 2QRLA 2JAHA 3JQCA 1DRUA 4WCFA 5HTOA 3AUUA 4GSKA 4FFOA 3H5NA 2GN6A 3FN4A 3C85A 4K1LA 5F3RA 4Z0PA 3H5RA 1VL0A 3V8BA 1JVSA 1CDOA 2DBZA 1Y8QA 1JQBA 1PX0A 1E3IA 2G76A 4GVXA 3OF2A 1ADBA 3U3XA 5JMPA 2DBQA 5CG2A 3VDQA 4K26A 4GWKA 1SCUA 3UCEA 1YVEI 1OC4A 2YV1A 3DBHB 1ZXLA 4XQGA 2VHZA 4B3IA 1VC2A 4F6LA 5CDYA 4ZHSA 2AQHA 3VH1A 2OBNA 2LDXA 2OOSA 4Q3DA 1UXKA 4RVHA 3RQSA 3K5PA 1DFHA 2X4GA 4J91A 1NR1A 1UXGA 4XR4A 4DWVA 5JS6A 1X15A 4NU5A 1ZJZA 2J6IA 5HWSA 4LK3A 2FMUA 3X2EA 3S2FA 3TN7A 3HFGA 1OAAA 4ONEA 2X7HA 4YJHA 3KETA 1PL7A 4DRYA 4BO7A 1LDGA 3DC2A 1HL3A 3K30A 1R4NA 4BQRA 4E5MA 1NHWA 4L76A 4BGVA 3UN1A 4TKMA 5IFLA 4XJSA 1UDAA 2PTGA 3GZNA 1B3RA 2AA3A 1XLTA 1E7RA 3SJ7A 3L4BC 2CZCA 4D0SA 1GYRA 2Q3EA 3CTMA 4QEDA 3PZBA 1VJ0A 1O6ZA 4MVJH 2JCVA 4MIEA 1OI7A 1C1XA 1ADFA 3I6IA 3DZJA 2J5KA 2VNAA 5JNLA 1MG0A 3QJ5A 4I5GA 2CVZA 4IIVA 1X1TA 2GPTA 5BR7A 3NYWA 2TMGA 3OQBA 1M75A 3GR6A 4I9NA 3ENKA 2VYVA 4RLHA 3E18A 2AE2A 4BNHA 4FFPA 1W4ZA 5KCZA 1JVBA 5G0UA 1TT5B 4BKPA 3AM5A 4KMSA 3D4OA 4BNKA 4D45A 5KVSA 1KIFA 4ND3A 2VWGA 2X0JA 5JYDA 1WP4A 1HDRA 4PVCA 2GD1O 2B4RO 2AEJA 1CJCA 2J3KA 4HFJA 1NPTO 2E37A 3MCVA 3PLRA 4W7HA 2DT5A 5EQFA 1SOWA 2CVOA 2DUWA 4A03A 4BNTA 2J5RA 4PLVA 1X0XA 3DZGA 3D3WB 4MINA 4F46A 3K92A 3RIHA 3TRIA 2JHFA 1PIWA 3GDGA 4N5MA 3H8VA 3RUFA 4JCOA 4B4VA 1C3VA 1GY8A 1VL6A 4HFRA 1UZNA 4BNYA 5JSFA 4II3A 6ADHA 4DQXA 1H6DA 1KVQA 4DIFA 4FQ8A 5JMWA 4J2HA 1GQYA 1IY8A 2EG9A 2BI7A 3A14A 5EL0A 4GX0A 5L45A 3JTMA 3HFSA 4N5NA 3GFBA 1KETA 1WDLA 4IDEA 3GT0A 1BDMA 2X5OA 3KYBA 4KUGA 3FI9A 3WGTA 3RC1A 3TDKA 4XEHA 5JW6A 4DIBA 4ALLA 4J90A 1U1IA 1EEHA 2AW5A 5C7IO 1NAHA 2EHDA 3FR8A 1KVTA 1XKQA 4KQWA 1CYDA 2POQX 2Q2WA 2B69A 3VH3A 2D4AA 2ZCVA 4GKBA 3BXXA 5M6DA 1B14A 5JCJA 4Y6PA 3NDRA 4NHEA 2NU7A 3AWDA 4OQZA 4BMSA 3AOEA 3WOHA 2ZTVA 2NM0A 1BSVA 1NR7A 4ND5A 4FIZA 5JCXA 3DFUA 2H6EA 2B35A 3EMKA 3K6JA 1JW9B 2J8ZA 4OM8A 1DC3A 2BFPA 4FS3A 5U4QA 4P4NA 3F1LA 2HK7A 3KEOA 2GASA 3RFXA 3I23A 3QVOA 3STHA 4J43A 1Z7EA 1JLLA 4BB6A 4WLVA 1WPQA 3ZNPA 4OQYA 3H9UA 3OH8A 1A9YA 1I3LA 1L7DA 1E5LA 4PLFA 5JXWA 4GL4A 4YT4A 3KLPX 5T64A 1BGVA 3PGJA 3NDJA 4XRRA 1NHGA 4CMEA 5I8ZA 3PPIA 4WNCA 3KUXA 5L53A 4Q9NA 4R4JA 2D2IA 1R0SA 5HA5A 5FI5A 4AG3A 3GEGA 5B37A 2WYUA 3Q0EA 1HRDA 3ZI0A 5HRUA 2VTDA 2PNFA 4PZEA 4IDAA 3VH4A 1I5RA 3OJFA 1PR3A 4WCDA 3I6QA 3EC7A 4FOOA 4XQCA 3O4RA 3OETA 3TOXA 4IJUA 1Y5MA 4LMRA 4CLHA 5ICSA 1ZSYA 2EV9A 3CIFA 4PZDA 4A10A 3AI2A 4OXNA 4AJEA 2O2SA 2WE7A 1U8XX 4E3ZA 4E21A 1K6IA 3TJRA 2I99A 2H5LA 2ET6A 3KLMX 4IQ0A 3PTZA 3DFZA 4O63O 4J4HA 4YJFA 3TZHA 1S6YA 4CQMA 5U1PA 3BAZA 3WX0A 1JAYA 1HZZA 2HSDA 4J9UE 1NBOA 3MZ0A 4FPXA 5H83A 3C24A 1I0ZA 4II2A 1EFLA 3DHNA 3BMCA 1PJLA 2WMDA 2UV8A 3K8ZA 3ZWXA 2VYVD 1NVMB 4Z3DA 2Q4BA 1PGJA 3MOIA 1NNUA 2Y0CA 4S1VA 1GUZA 4W9NC 1C1DB 5T5QA 3ZWPA 3IMFA 5AYVA 1GUFA 3M1LA 4AJHA 3BMNB 3RUIA 5COAA 4CM9A 1QV7A 5KNLA 3H3FA 3MJTA 2UVDA 3L07A 4IIUA 3NDIA 4RVDA 1E6EA 4E5YA 2O3SA 1OOEA 1EZ4A 2I66A 4NJMB 3U4CA 3G17A 3GEDA 3KM0A 1JU9A 1JKIA 3GA0A 2B4QA 4B4UA 1YOVB 3K73O 4YPOA 2Y1CA 1E3WA 2O3UA 3PZRA 5IN5A 1R4MA 1YRLA 4W4TA 4ZQBA 3BMOB 4RZHA 1V3TA 2Q1SA 4UUNA 4N54A 2QYTA 2V6BA 2A92A 4IDFA 3PYXA 3WGYA 3C7DB 1PGQA 1HE4A 3KB6A 3VZPA 4RL6A 2ZIZA 4G2NA 2B0JA 3D5TA 4UVGA 4IDCA 1G6KA 5IDWA 1H6CA 2AQ8A 3DMTC 4G81A 1MGOA 2FN7A 3L9XA 1XQ6A 2XXBA 1N7GA 3GZ4A 3EUWA 1ZIDA 2DKNA 2G17A 1LA2A 2QX7A 1PS9A 4GAEA 1QYXA 3S1LA 3EW7A 5JCJD 3ITKA 3PYMA 1P77A 1ZMOA 5AXDA 3F4LA 1X13A 3KYCB 1JA9A 2VWQA 5GMOA 2G1UA 1EK6A 4KUHA 3PJFA 5G4KB 1E3EA 1V9LA 2OFPA 3PWSA 2OORA 3I83A 3ZU5A 4OH1A 4I1IA 4B7UA 3WG9A 1XGKA 1PQUA 1DC5A 4R3NA 4BKOA 1C0PA 1LDEA 3U0BA 1I2ZA 4L4XA 3ST7A 1AXEA 2QZZA 2I3GA 1I8TA 1I33A 4R54A 1T1SA 2NU9A 5C7OO 3F6YA 5F1PA 4CJXA 1DFIA 4CV1A 3UICA 5ITVA 4RVGA 3QSGA 4ALNA 3WSVA 4PLPA 1LC0A 3RC2A 1G0NA 2DC1A 1K89A 3U62A 4J1NA 2X9VA 5COBA 5KIAA 4D3FA 4I9HA 4IS2A 2D8AA 3SVTA 1ENZA 5JC1A 5JAQA 3EAGA 4ILKA 4GQAA 1U2GA 4UEJA 1WDMA 2EKPA 2QQ5A 3NTQA 3GOHA 3GNTA 4NG5A 5DULA 3GNQA 1NPYA 5TRTA 4M49A 4YQZA 1MV8A 1SEVA 1J5PA 1T2CA 1EQUA 2CMDA 4IDGA 3TFQA 2HLPA 1YH3A 2IRWA 3GHHA 1E1MA 1KEWA 2H9IA 2RHRA 2WDZA 3MJSA 4MIYA 2DFVA 2YZ7A 3LSYA 3JD4A 4E6PA 1LU9A 4HFMA 4CQMD 1CWUA 2PZJA 1PS0A 1XSEA 1IPFA 3V2HA 3FHLA 4MDHA 5BNTA 3G3EA 5L51A 1JWBB 3B70A 4QSMA 2LDBA 4DYDA 4FW8A 2C7GA 2D0IA 1BW9A 4Q3BA 3SC4A 2BGKA 1V6AA 1PWZA 3FPCA 1TLTA 5DCYA 1B2LA 1U3WA 4UEKA 2O3JA 1B0AA 3D1LA 3ZW8A 3DAGA 1B8VA 1ZCJA 2VTEA 1W73A 3PK0A 4BO0A 4YJGB 3KTDA 4PG7A 1WLYA 3JQBC 4HNGA 4M86A 4CM9D 4IMRA 2J3IA 3JQAA 2X0IA 5TF4A 1XDWA 3RWBA 5L95A 1YB1A 3ZWMA 1JKFA 1WZIA 1SO8A 1SC6A 2EERA 1CIVA 4W6ZA 1N7HA 3JYLA 4RF2A 3WQRA 2B5VA 3PQFA 5CAEA 3KSZO 3F3SA 2WD7B 3G0OA 4RVUA 5THQA 5A5EA 3I9NA 2D5AA 1ZK2A 5ADHA 2IXBA 1LNQA 5T73A 4KDFA 1GQQA 2DTEA 4BHTA 3QVTA 5TT1A 4YBZA 1BVUA 2FSVA 4QFDA 3IC5A 4J2OA 4OIMA 2FZWA 1U3VA 3I9OA 4L8VA 4CMHA 4ZU3A 1FDUA 3ITDA 1QLJA 3IAHA 4U6QA 3RJ9A 3M1AA 4PLCA 1PZHA 1ENYA 1C0KA 3I9JA 1M67A 4J16A 5ILGA 3GUCA 4CLOA 3HWRA 2PR2A 2D59A 1I2BA 3ONDA 4BNLA 3O8QA 1BMDA 5A9SB 1M76A 4NI5A 4CUKA 3ZWAA 1J6UA 2YV2A 2HJRA 1QYWA 3DHYA 3F47A 4FFNA 3PQEA 1T25A 4RLSA 2ZB7A 4XYGA 4DVJA 1Q7GA 5CP8A 3P19A 2R6JA 1MP0A 4R1UA 5A3VA 2PKQP 3MTGA 3VAZA 5GZ3A 4CMIB 1MFPA 2YY7A 3FTNA 1HT0A 2W98A 4DBVO 4UUMA 1I10A 3INGA 4LW8A 1I24A 3OFSA 9LDTA 1MFZA 1V0JA 2EJVA 4PIVA 4MVJI 3DBHA 1OFGA 4FGSA 1UJMA 4EGFA 3K96A 1ADGA 4FC7A 4MKXA 1I30A 2QYSA 3OECA 1LI4A 4YR9A 4FBGA 3DWFA 3JQGB 2E4AA 3JD1A 1M66A 3V1UA 4FFMA 3OJEA 2EXXA 2HMSA 4RQTA 3D0OA 4C7KA 4JQCA 5GY7A 5TSDA 1HSOA 3ZV3A 5JAMA 2X86A 4BS9A 4RDIA 1WZEA 1LDYA 4PLGA 3JQ9C 3FTPA 3JD3A 1DJQA 3LU1A 3QQPA 3KEQA 2PD3A 4HFNA 5JDCC 4R41A 3DL2A 2HMWA 1SZJG 2PZMA 3E9NA 4XA8A 4KOAA 1NQAO 4E33A 3BA1A 3LLSA 3WTBA 4BGUA 5L4NA 1H9AA 4TVOA 1Y9EA 3BTUA 4YT5A 3VDRA 3GVCA 5KKAA 4B8WA 3AUSA 4BO2A 3QP9A 5AVOA 3KXDA 3V1YA 2Y0EA 1D3AA 1CEQA 4U6SA 1HSZA 1D1TA 1K6XA 3ZDFA 4GLLA 4A5OA 1N92A 1ONPA 2Q1UA 2GZ3A 3ICCA 4IXTA 1GEGA 1TT5A 2VRBA 1HTBA 4J9VA 5JPIA 2WD8A 3GGPA 2ZYAA 1KY5A 4A27A 4R16A 5KOIA 3IP3A 1FDWA 4DYVA 5I7EA 2W4QA 2A35A 3KHUA 4BO9A 1J4AA 4DXHA 3C1TA 2EW2A 4M54A 1PU2A 3AM4A 1R6DA 3WIEA 5CEJA 1HETA 4CLRB 4WOKA 2F1KA 2VHYA 1T2EA 3NKLA 4M89A 1EQ2A 5ITWA 1NPDA 1U5CA 3VZQA 4CMJA 4IQGA 2HK9A 3EZLA 1WXDA 4MVJA 5IZCC 1DLIA 2O3QA 2VUSA 1ZK0A 3WGGA 5TS3A 1B8UA 3WQSB 1U3UA 3D5QA 2Y1GA 2I3AA 3BHIA 3JQAD 4L74A 3UOGA 2QZ9A 2EP5A 1SB8A 3QWIA 5DNAA 3LT2A 1JKJA 1PQPA 2VCYA 1ZVMA 4NQZA 5TJHA 4XIJA 1NQOA 3FBGA 1YL6A 2CVQA 3PJEA 4WASA 5G0TA 4PLWA 4K9DA 3N7UA 1Q0LA 3QWHA 1UXHA 2RBEA 4J1TA 3WFIA 2X9NA 4Z9XA 4MVJP 2NVUB 2OP1A 5I8WA 5LCXA 1PJSA 4B4OA 1O94A 3HUDA 1XG5A 2DUUA 1YQGA 2VUUA 4ZA2A 3UKOA 1HDXA 4UVEA 4GGPA 5F21A 1G0OA 1GADO 1DO8A 4D3DA 4KZPA 4BO4A 2BKAA 3U4IA 4DA9A 4R1NA 2HRZA 3L6EA 3WTCA 2BHLA 4RGBA 1U28A 1W6UA 1BTOA 2OO5A 3DOCA 3WWZA 4CMKA 3GLQA 2GLXA 5L40A 4UVHA 4XX0A 3HDYA 4LRSB 4MKZA 5JLAA 1B7GO 2RCYA 1YB5A 3DZKA 5AXCA 2AEMA 2DBRA 4ZICA 1V8BA 4MPDA 3R3SA 4AJ2A 1SMKA 4Z0HO 1LXCA 2PFGA 3PRJA 3OBBA 4RVSA 3ZHBA 3JYNA 1PS8A 2C7VA 5I7SA 2VN8A 2SCUA 5K9ZA 2R00C 2NUAA 3CH6A 2GR9A 2DVMA 3ETEA 2Y66A 1J0XO 4XYEA 2CY0A 2JD2A 4NFHA 4WUVA 2VHWA 1PGPA 5DOZA 2GNAA 3B6ZA 2P68A 4IINA 4E4YA 2YFQA 3PHGA 4PG6A 1L1FA 2OXIA 3EHEA 3SX2A 3OJOA 3JQFC 3GN2A 4G65A 5IXYA 1HWYA 1WDKA 4YT8A 1W8DA 3PFWO 3JYOA 1HDGO 2FPGA 2I6TA 1GUYA 4EUEA 1DPGA 4DPKA 2ZTUA 1H2BA 4BVAA 4CM8B 1NVGA 3IJPA 3Q9UA 3RUEA 4CR7A 3D64A 2AG8A 1PJ2A 5TC4A 1E1LA 3GPIA 1ARZA 4B8ZA 4AJ1A 4UVIA 3OIFA 3I9MA 4BNNA 1A5ZA 3IKVA 3OA2A 2QHXA 4PG4A 3GUYA 4AFNA 2ZTMA 3E8XA 4CLDA 4CUZA 4LSWA 1ENOA 3WWYA 1Z74A 3GN1A 4BL5A 4R01A 4IDDA 5DT9A 2AQKA 3BHMA 5HS4A 2W2KB 3HN7A 3F5SA 3KRTA 5DZSA 2GGSA 5KJEA 2X58A 3RC7A 2B36A 5A9TA 2C07A 4DBZA 3WDSA 3ZV6A 1Q0HA 1DRWA 2Y68A 5FWNA 5K0ZA 1BHSA 5TX7A 1HF3A 2FPPA 5AOVA 3UUWA 5BSGA 1SEPA 2YDYA 1ZK4A 4ND4A 2IODA 4C7JA 4LCJA 2O4UX 1GAEO 1F12A 2O7SA 4Y67A 4J1SA 1BWSA 1C1DA 3VVCA 4EJMA 1GTMA 3L0DA 3NTOA 3CKYA 3BMNA 4AJ4A 3GGOA 3QHAA 2EIHA 4RF3A 4A73A 1E92A 3G79A 3AU8A 2IEDA 3CZRA 3VPGA 3MEQA 3PVZA 5CDSA 4YTEA 1LDMA 1I2CA 4RF5A 5I7FA 1FF9A 1PWXA 4NJMA 4IZHA 5CFZA 2Q45A 3INTA 1QSGA 1F0YA 4MVJD 4OSPA 2BFOA 4CM4B 5F5NA 1T2DA 4J3FA 1EBFA 1YOVA 1UAGA 4XGNA 1Q1NA 4Z0TA 1X14A 1ZNQO 3WYCA 3JQ7B 4RPKA 2VWHA 3VKUA 4CR8A 1PL8A 1SOVA 3WBBA 2V7PA 3WB9A 1VSVA 1R0LA 3CUKA 4MVJE 4W99A 2HRBA 3BMOA 5BNFA 3RASA 4WK6A 2XF8A 4BOYA 4GLOA 4WLUA 4E2XA 4EEXA 1O0SA 3H9EO 1ONNA 1LUAA 3WGOA 4NU6A 3VTFA 1FDSA 2Q1WA 1LSUA 2C82A 3CMMA 1MB4A 5DBGA 4UREA 4EJ0A 3EGOA 3SBOA 3K2BA 3WGZA 1Y8RB 4NBWA 4WCFC 4D0RA 5FF9A 5MDHA 1H94A 3HB5X 1GR0A 4LSMA 4BNVA 1DXYA 3RD5A 3C7AA 3TZ6A 1PEDA 2I9PA 2WJPA 4XQEA 2QIOA 2Z1MA 3E48A 4FC6A 1UXJA 1VRWA 3KYCA 4ZRMA 3TL3A 3VKVA 3EDMA 5G4KA 1GL3A 4BO3A 1E1NA 4DGSA 4IJVA 4RF4A 1GZ3A 1H2HA 1EVYA 1UP4A 2Y1OA 3GVXA 4LVCA 2Q46A 1E0DA 1DIHA 3Q2KA 4UVDA 5KVCA 4GKVA 3PLNA 1ZMTA 2YFHA 3O26A 1MC4A 2Z5LA 4UEOA 2B37A 1P1IA 4DC0A 4YAKA 2CDAA 4M8SA 3RROA 3G49A 3TNLA 1PZFA 3VOSA 1HDZA 8LDHA 4BNGA 1ZXBA 4F3YA 2YUTA 1VSUA 1N1EA 1ONOA 4GX2A 5B4UA 4E0BA 3HSKA 3NT5A 3G1TA 1Q7BA 3MTJA 3ZHXA 4TVBA 2PD4A 3AFMA 3RI3A 3OJ0A 3HHPA 2F00A 4JP3A 3S2IA 2CFCA 2Y99A 4OO3A 4HY3A 2D5CA 5EQDA 2ZYDA 1H6AA 4Z6KA 5JDIA 1ZO8A 1XIVA 4RORA 1FDVA 1E3LA 4WLNA 4AICA 3ZGYA 4BKUA 3HQ4O 1C0IA 3MWDB 2AXQA 1B8PA 5IDXA 1TI7A 3MJVA 1UXIA 2Y0DA 1QLHA 4J0EA 1N9GA 3PHJA 2XAAA 1NTOA 1EMDA 4ALKA 3GK3A 1ULSA 3RUDA 2GUGA 1ISIA 4OXKA 3ETGA 6LDHA 1P3DA 3Q2IA 3FWNA 3I3OA 1ZEJA 3RFTA 2DPGA 4LGVA 1T26A 3UGKA 1Y8QB 3L6OO 2FHSA 3SLKA 5L4LA 2CDBA 4EW6A 5KJFA 4CMBA 4PRLA 3HB4X 2EEZA 3AI3A 4KP7A 4QO7A 4W82A 3L4SO 4TSKA 4NH4A 4MVJM 4IQ8A 3F1KA 5CEEA 4W7IA 1HDCA 3ZWVA 4K6CA 3N58A 4IJWA 1GFSA 4B79A 4YJGA 5ICMA 1NQTA 3HDHA 2VUTA 1QYCA 2UAGA 1YQXA 4AVYA 3VZRA 1M6WA 4GBJA 1EVIA 1P1KA 1LRJA 1ML3A 2O23A 2V65A 3WICA 3GAFA 2NADA 3KZVA 4R1SA 4XJTA 3FR7A 2YYYA 4ESOA 5JY6A 3TSCA 5T57A 1I32A 4PG8A 1AHHA 4NDNE 5K6AA 3DTYA 5DBFA 3OP4A 1PJ3A 3JYPA 3DXFA 2A9FA 1IHYA 2IYOA 4ZRNA 3RSHA 2WWRA 2NV6A 2PY6A 5TJ9A 3VPFA 1EBUA 1NVTA 1XQ1A 4CODB 2DU8A 3GQVA 2AG5A 3NT4A 3H9JA 2QG4A 4HX5A 5A3JA 1UZLA 4NJOA 3EVNA 1K5HA 5DOVA 4BQPA 3LVFO 1HYEA 1QORA 5T8KA 3E5RA 3A4VA 3WNQA 1DC4A 1DHTA 2VZ0A 4ZGWA 3RU7A 3I1JA 4QO8A 3PJGA 1GDHA 4D3SA 2YV3A 4MP8A 2X0RA 2FY8A 4LMPA 4F45A 3CMCO 3DBRB 2GRAA 3V1TC 2VZ8A 4XYBA 5L4SA 1A71A 4PLYA 5ENDA 4J4TA 4JK3A 3NGXA 4M55A 3T7CA 4CMIA 2XPCA 4DTIA 5I9LA 5BT9A 3PWZA 3JYQA 3MOGA 4IZIA 4XR9A 3RC9A 3IOYA 3FBTA 3IP1A 4YCAA 4DPLA 5DBIA 3ZV5A 4FOSA 4HXYA 3VH2A 3COSA 3DMYA 3PDJA 1TB4A 2XXJA 2FPIA 1AUPA 4OYRA 4EUFA 1MLDA 1UZMA 3QIVA 1R0KA 4BGEA 3JQGA 3JV7A 2WYWA 1VI2A 3GF4A 3BTVA 1V35A 3DEYX 1KOLA 1QV6A 4BNXA 3NGLA 4XZ3A 4CMEC 2FSSA 2YHIB 1HEUA 4AJIA 1VE9A 3DBLB 3OMLA 4NZ9A 1QKIA 1ADCA 1KVRA 3GEMA 4KTVE 4D41A 2DAPA 1LSSA 1GD1O 4JJGA 2ZTLA 1GYQA 3VC7A 3DB2A 1E3SA 3VVBA 2Q49A 3B20A 2JAPA 4HKTA 3QWBA 3K31A 2GN9A 4NMHA 3I9KA 1DSSG 3PEFA 3W4JA 4A26A 3QW2A 2NQ8A 4BKRA 1T1RA 1YS4A 2PV7A 3RKRA 1GQ2A 1N8KA 4ZQGA 3KSDO 3RUHA 1K6JA 2B4TO 4XDZA 4BNFA 3U4DA 5A5FA 2P5YA 4TMFA 3LK7A 4JP2A 3QWFA 4XCVA 4YAIA 3PHHA 4NBTA 4Y6SA 2VT2A 1NXQA 4JBIA 4YT2A 1F14A 4RCVA 1XCBA 3WGHA 2DTDA 4NR0A 1DHRA 1YBMA 2JD1A 2OGUA 4NFYA 4BV9A 1KYQA 2BFAA 2CF5A 2Y1FA 3NRCA 1PJ4A 3F46A 4I9UA 3UAGA 3PI7A 3D7LA 3HDQA 3KBOA 1EDOA 1HKUA 4ZVVA 2X9GA 3BMQB 1IULA 2H63A 3P2OA 3UH1A 1Z6ZA 4CLEA 5GZ1A 5A04A 1LLQA 3AY7A 4XYLA 1GU7A 2RH8A 4XB2A 4KWIA 2FP4A 5H81A 3ADOA 4RPJA 4TQGA 1UP6A 3U9LA 4U5QA 5TIIA 1PZGA 2NTJA 4I08A 3MWEB 3LT0A 3H9QA 1IOLA 3MJEA 1NQ5A 1CQJA 2NLOA 3L6DA 3FD8A 4E2WA 2IXAA 3GAZA 3Q9NA 2ZQZA 3FPLA 5ER6A 2AMFA 1YGYA 1K3TA 1AHIA 3JCZA 5HS6A 2NTVA 1ID1A 2Q99A 3WIDA 4R5HA 1IHXA 3GRPA 2JD0A 2HK8A 1P45A 3INRA 5AXBA 1GPJA 3Q6IA 1LX6A 3QVSA 2GCGA 9LDBA 1I36A 4CM7A 3GHYA 4P8RA 4L4RA 4MVJG 4BNWA 4FFLA 3U09A 3ZH2A 2FR8A 2NWQA 4BNIA 1A7AA 1RM3A 1XU7A 3PJDA 3A28A 1ISHA 3OSUA 4DQUA 1RM0A 3ZNOA 3U4HA 2O2YA 4CR6A 1HE3A 1KVSA 2OHXA 4LVUA 1DAPA 2Q2VA 3FNHA 2I67A 1UAYA 4H3VA 1QYDA 3AW9A 5GZ6A 4E2ZA 2FZEA 2NQTA 1RPNA 2PKRA 4IY1A 4YEDA 4WE3A 5CDUA 5A1TA 1NFFA 1CRWG 2X6TA 4WECA 3RBVA 2W2LA 3PGXA 1HDOA 3WSWA 4YB8A 2Y1DA 1NWCA 3DDNA 4RV9A 1RM5A 3CZMA 1Y9AA 4RQUA 4AJNA 4NIMA 3ADPA 3AUTA 1T4BA 2ZCUA 3GMSA 1OMOA 3H5AA 4TROA 4ZQEA 4TZKA 4CM8A 4AJLA 4BMVA 5DF1A 2PK3A 1R4MB 3SC6A 4N7RA 5F1KA 3FNGA 2OL4A 1EVZA 2PD6A 3E6AA 1C0LA 1WMBA 1X1EA 2GO1A 4CM1A 4E32A 3TQHA 5IZ4A 1P1HA 2D3TA 2X8LA 4KTTE 2H1SA 1YL5A 4OHUA 5G0WA 1YDWA 2ILTA 1DFGA 1Z73A 1ZFNA 2W2KA 2NU6A 1KC3A 3BZUA 3GDFA 4E13A 1Z82A 1JAXA 1GV1A 4EDFA 4J0FA 5IG2A 4AJOA 3EK2A 4RPHA 4YWJA 3UCXA 5L9AA 3AU9A 3DAFA 4ID9A 4AJJA 4BO1A 1L7EA 3JQ8B 3ORFA 3VTZA 5A9RA 1DAOA 4KDEA 1XA0A 1I3MA 3H2ZA 5HM8A 1KVUA 1NFRA 1LSOA 4HADA 1V3VA 2WE8A 2P9EA 1XYGA 1E7YA 5IDYA 4OL9A 4DLAA 4P22A 2UUPA 4XIYA 3ROQA 5IXSA 4ALJA 2PGJA 4BV8A 1WW8A 4CQLB 2NU8A 4BB5A 1E7SA 4DPMA 4X54A 4A7PA 1IL0A 3WR5A 5BNIA 4M87A 3W4KA 1P1FA 5BQFA 4YACA 4Q39A 2UYYA 5B4TA 1E5QA 3JSAA 2YHUA 1CETA 4CM4A 3IUSA 1GCOA 5FYDA 2V6GA 3QWAA 3W6ZA 4Q3AA 1FJHA 1ZUD1 1UUFA 2ZKLA 3DZBA 3JQ7A 2NACA 4H7PA 3RBXA 4M1QA 2VHXA 4NFSA 1NYTA 5DP1A 4EYEA 3CSDA 3GH3A 1PGOA 2HJSA 1B26A 4TRMA 1QG6A 5A06A 3CE6A 4D43A 3D3WA 4E5NA 4YXFA 1N5DA 4AJKA 2DBVO 1MG5A 3IQDB 2Z95A 1D7OA 3LT1A 2J3JA 4QX6A 2C5AA 2IDZA 1Y8RA 3B1KA 1XU9A 1Y6JA 3UXYA 3KYDB 1DLJA 3ANLA 4IMPA 3I4CA 3GPDG 3ZNQA 5L7TA 4JLWA 1ZK3A 5J9GA 2QRKA 1P0CA 3WGIA 2E49A 3L4BA 1XHLA 1WMAA 1E3JA 1VM6A 5CDGA 3NEPX 1ISGA 3OIGA 4CL8A 2ZATA 2Y67A 3BIOA 2B83A 5COQA 1DIRA 3O38A 4GMFA 1P1RA 2A4KA 4DC1A 2BMAA 1P0FA 4Q3CA 2GZ2A 2ZYGA 2Q1TA 4Z9FA 1YJQA 1DC6A 3F4BA 2GN8A 4CPDA 4HV4A 4CM3A 3WYBA 4MP6A 4LISA 1J49A 3QVXA 2VT3A 3W6UA 5EIOA 1Z7BA 3DBVO 2CSUA 4HBGA 2W2LD 4P4LA 2C54A 3GMDA 1PJTA 1P1JA 5L3ZA 4DLBA 5JYFA 2OP0A 4CV2A 4G5HA 4E31A 4JNKA 5ER9A 4YA6A 5DCWA 1OZAA 3ABIA 4DMLA 4PRKA 2VYNA 2D1YA 4Y98A 1GYPA 4B7XA 1U2DA 4BKQA 3JQ6A 1BRMA 5JO9A 1QMGA 3AFNA 3KV3O 1DOHA 5IDQA 4JXKA 1KC1A 1UH5A 3WS7A 3JD2A 1PQWA 4CV3A 7ADHA 4CLOB 5KVVA 5TNXA 4Y6RA 2Q22A 2BLLA 1VPDA 4TKLA 2VOJA 2WYVA 4YYZA 1YONA 2C29D 3UF0A 1XWFA 1HLPA 4IBOA 4E5KA 1N2SA 2NTNA 4UULA 2P5UA 3ZU2A 4EUHA 3FNEA 1O9BA 4O5OA 4E5PA 2ZB4A 4JX8A 1LBEA 4O6VA 3LC7O 1NX6A 1ISJA 4I8XA 4IDBA 2GF2A 1X7DA 2GZ1A 2P2SA 1YKFA 1HE2A 1RYEA 1FXSA 4JROA 4EI2A 2O3RA
chains in the Genus database with same CATH superfamily
2IH5A 1HTTA 4DLRA 3AZQA 4ZT7A 2VF7A 3H65A 2WZBA 3I1YA 3FCAA 2N0SA 1I2AA 2JFOA 3IKJA 4DM4A 2CVPA 2GDZA 2ZBFA 3PIDA 2QVBA 5TPZD 1ZSVA 1J0BA 2XDQA 3DZIA 3HFRA 4ENSA 2JFFA 1BOFA 2AYZA 4YMSA 2F59A 4D56A 3Q7QA 4ZZIA 1EDEA 1P8JA 2WMOB 4U2BA 2PGLA 3LI2A 2Q6TA 5B1DA 2VOEA 3SFZA 3W9SA 3W8DA 1KERA 1ISMA 1XEWX 5E4YA 1I2MA 1A7KA 2G5TA 4R5MA 2J9YB 2KPOA 3ACBA 3DT6A 3BRCA 4OQLA 5CRIA 3WIOA 4M53A 5DI3B 4C4PA 3DLPX 4EK9A 2EWMA 2JFZA 5BN3B 2ZR9A 3G2MA 5AKYA 1A9OA 3V42A 3KKEA 1DBVO 1ZU4A 1XRSB 4ZCMA 3N2KA 5IT5A 2JCXA 1BG6A 1G18A 3QKRA 5FNVF 3Q7TA 3LC1O 2GK3A 5CHEA 2PZ8A 1JT2A 3Q3IA 5KJCA 2GVNA 2P9GA 4KLRA 4G56A 4NZOA 4CWAA 1T24A 3N0XA 2XRYA 3EW9A 4KGZA 2BF4A 5EKDA 2IYYA 1JDNA 2ZS7A 4EQ6A 5BOSB 1NVBA 5CFPA 2HH9A 2K6GA 1JG3A 4XB1A 2JZOA 4QQRA 3HCCA 4OU5A 2ORYA 3AKZA 3WAGA 5C81A 2GCOB 1N36B 6GPBA 4RA6A 4HAXA 1AU9A 4I1UA 4XAQA 3C5VA 2OO5C 4WN9A 1I3KA 3G7UA 3MJRA 2QUZA 2B4KA 1OBFO 3HXOA 4ALIA 3PKZA 2W8ZA 3CLRC 5JH7F 3KTAA 2Z6AA 1U9YA 4DLLA 4R7ZA 1BDIA 1EDZA 2JEYA 4HDAA 2XB9A 3U4GA 2BGRA 4R3WA 4H6VA 3I12A 1MW9X 2FEWB 1AV6A 3WK6A 1CYEA 1SXJD 3FW1A 3GBSA 3BHJA 4FOLA 4OLHA 3ORRA 2PLAA 5G4LA 2C78A 3EZYA 4GEGA 1JTEA 2ZRMA 1GTJ1 2PAFA 3KWMA 3R41A 2GI4A 4C0HA 4I5EA 1BMFD 2NVBA 1DEHA 1MC5A 3NIDB 4Q4AB 4ZIRA 3VJKA 3C3CA 5F3DA 3WK9A 5JZSA 2RGBA 2WIAA 3UK0A 2OQIA 4Q7EA 2Q8PA 5EN4A 5JSUA 1XZFA 1YCFA 3UMVA 2AFHA 3LX4A 2AVDA 2PQ6A 1U7XA 2H57A 2OD7A 3EEBA 5EP3A 5FLKA 3RVJA 4ARZA 3HJUA 4AX4A 3PD1A 1LLUA 1ZK1A 3RVDA 1S8NA 3KSRA 4O0LA 3T9FA 5EFZA 3DLBA 1DJPA 2OBXA 1W47A 3FJ1A 3IQFA 2O3TA 3ASUA 5B2ZA 3EP7B 2FJUA 1Z83A 1KTIA 4O2LA 4X1YA 1XVVA 5F5LA 2IWHA 4DB4A 1P62B 4RZSA 1GTSA 1AKMA 2ZPUA 4IIBA 4HSEA 5BSEA 3BDAA 1RQPA 3U31A 1KORA 3RS7A 1DCTA 4KSCA 5JTTA 1C7QA 1C9NA 1Z45A 3VR4D 2OCBA 3EPAB 4BVGA 5IJWA 4PE5B 4P53A 1J39A 1EVJA 2AZ4A 2JBHA 3F96A 2ZRIA 4HNVA 2YXPX 2ECFA 3A1EA 2BUBA 2PKQO 1JS1X 2PZKA 2VBFA 5B4VA 2WIDA 1ZESA 3ZQKA 4R05A 4PWYA 2C2ZA 4MOWA 1UKVY 1RXUA 3GFQA 1EJ0A 5GVSA 1G5HA 1Y1QA 4BATA 1GPMA 4BEJA 2W9XA 3QLJA 4XWGA 3UAZA 1QM5A 5TT0A 1JPVA 1M6EX 1ZW1A 3K09A 2YV5A 1UPXA 1ZCAA 3IXMA 2QBYA 4WQMA 1IOWA 5JCOC 3NGMA 3QXCA 4NPCA 4JKIA 1U7HA 2GYWA 2VT7A 3HZHA 1NULA 1RWOA 1FVOA 3VBCA 4NONA 1GN8A 2DR0A 4XI9A 1QH9A 3GG9A 5JVDA 1SPXA 2V7BA 3HCPA 1Y6QA 1T8PA 4M38A 3KC2A 4Q19A 1G17A 2WICA 5BSFA 3M0EA 1M1NB 1DO2A 4S35A 5JY1A 1PJ8A 3BIXA 2ORWA 2AKYA 1DKOA 5CHYA 3G6WA 3DT9A 1UR5A 3SMVA 3RWOA 2WU4A 4J4BA 4L72A 3V7YA 3J7TA 4CV0A 5LSAA 4GG1A 4ARUA 3D7RA 4U2KA 1QAQA 2VTBB 3BMQA 3FLBA 1H69A 1V2HE 2A1TS 2FPWA 3EAFA 2VP4A 3PDWA 4KQCA 2RGUA 4RHYA 1DBRA 2OBYA 1ZVKA 1WXFA 2Z4RA 1MU0A 4Q4DA 4QHSA 4JELA 4RZIA 1UM9A 3IDQA 5AI0A 4YRZA 4B5LA 4HUQA 4U2FA 3WK8A 1V6CA 1NQWA 1E2LA 1SCUB 3HNPA 3EQ8A 2MT9A 4QLOA 3R9KA 1RPZA 1WEHA 1FRVA 2NPIA 3TQHA 2PGDA 2XB4A 4D3ZA 2YZ2A 4ODIA 2SHKA 3EYWA 4X90A 3GARA 3H16A 3UUFA 2J5QA 4PHTA 5LC1A 1L5ZA 1P74A 2C0QA 2TRSB 1FRFS 4A2CA 5C7LO 3R0IA 3AOGA 2OFXA 1JZTA 1QVWA 1MA0A 1VE5A 3I34X 3KVVA 4G84A 4RPGA 4H1TA 3WFJA 2Q2NA 2QRJA 4F9GA 3L7NA 3R5TA 1G8GA 4HGQA 3UMFA 5A7GA 4JJIA 2C42A 4EGJA 1ULUA 3LM8A 2I55A 1PV2A 4O0MA 1K08A 3DH0A 3HZRA 3COVA 4JX9A 5EHQA 2ZE7A 4PC1A 1PT5A 2HF9A 3D6VA 2EBHX 2ZI9A 2NYAA 3EVBA 3KEFA 4UAVA 1KOFA 1X0VA 2GX6A 3PJRA 1TM1E 4Z1MA 1EA5A 3WLTA 3QF4A 1UKBA 3H42B 5B1SA 5KC8A 3MUOA 1T5LA 2BEUA 2V9CA 3A1VA 1X74A 3OZIA 3BXZA 4NX2A 3A1WA 3LIPA 1RYDA 4BZXA 2FQWA 2PVCA 2VHUA 2X9QA 2XD9A 2AH5A 2GUWA 5I9IA 1I4DD 4IH1A 1A9ZA 1XEXA 2R7MA 4G0UA 1C1XB 4WERA 5GJWC 3M89A 4QG3A 1C3LA 4M0MA 1O3YA 4A1OA 4LN1A 4U1RA 5BSHA 3B1FA 3ZUPA 2J3QA 4MLZA 3SN6A 5IVKA 4BNMA 2Q3CA 4LOJA 3I64A 4JENA 2QAJA 1EE9A 4MULA 4PSCA 4YAJA 5BQPA 1BHQ1 4U3JA 3N8KA 2OYRA 1DX6A 3H99A 1RYMA 3NNDA 3ANMA 5L3SA 2F17A 4L4SA 3KSMA 3AQ4A 1N1GA 1JH9A 3MMZA 4UBLA 2XE6A 5KOHA 1H6BA 5D6NA 1S3IA 4FYWA 3E0XA 3QE2A 5LQSA 5DM0A 4Q93A 3KP1A 1Q21A 2WP0A 3TI9A 4HLUC 5IBRA 4R1QA 4YMHA 5T7BA 3C15C 4PC2A 5EGNA 5G40A 2DOKA 4JI1B 2RIRA 4CM5A 2R6AA 4Q66C 3OEWA 5T67A 1ZR4A 4QLBA 3P97A 2QTVB 1HZJA 2CUKA 1SPBS 1XLVA 4HO1X 4C2UA 3MS7A 4YMUA 3JQBA 2DHCA 2OB2A 4RMGA 4RHFA 1KAOA 4ARVA 2GAIA 5DBEX 3F3KA 2XEDA 3QUQA 1Y9JA 5K09A 2DM6A 2AFHE 4J7UA 4IJKA 4HVLA 4B3CA 4GDFA 3Q7RA 4GLJA 1WUJS 3HPRA 3PUYA 4QUKA 4YJ2B 1MX3A 2QXYA 5GV7A 5IULC 2J7KA 1XCOA 4MO9A 1MVNA 4D9BA 5I4BA 1H5QA 1IXYA 3HA7A 3O4VA 4OK5A 5KYXB 4XD2A 4FSDA 3H04A 1BZYA 1I2DA 1E7WA 3DDSA 1ISFA 2TMYA 5BN5A 2H59A 4ENQA 3OM9A 3R0JA 2H4HA 2NN3C 5BURA 3NNSA 1QYVA 2AKEA 3K9FC 4BGDA 1G9XA 3ZEIA 2H1LA 4QDTA 3AJAA 3VZBA 1HR0B 3JQ8A 4MQLA 1Q0QA 1SB9A 4L95C 4O2RA 1RWBA 1FNNA 1A8UA 3NP9A 3QY0A 3RREA 3W34A 2IX3A 3TG8A 3AETB 4C4OA 1U9IA 3QFTA 1E4YA 1PR0A 4TLAA 3NZEA 4ZT4A 2I03A 2HDWA 3FTFA 4F2GA 4KN9S 3IVGA 2CVHA 3BJIC 5DHTA 1Q20A 4GKJB 1G4UR 3VMMA 1XVIA 2GRJA 5J2TB 3JQQA 1Y8CA 3OZFA 5DW0A 5K01A 1B73A 1CDEA 1Z75A 1TYAE 1D8AA 2FN3A 2VAPA 2VAXA 3D3EA 3CZQA 3OQIB 4Q1VA 4Y2JA 1QP4A 1IJEA 5GM2A 4PAQA 4O1MA 4GGOA 3A9WA 1P72A 1I4WA 2VBIA 3HYSA 5AM5A 4JOQA 2WWVD 1TTTA 1S2NA 3KPYA 4N39A 3ELDA 3R6WA 1Y1KE 3X0DA 3AONB 5FBQB 3PNLA 3LFTA 4X93A 5HF9A 2RAVA 3DM5A 1Y5NA 4WKGA 1N33B 5HZMA 2OK7A 2UVQA 4Y9RA 1PWHA 2LCQA 3VJRA 4CLRA 2WVAA 1TT7A 3RSFA 2HM7A 5K6AC 2X1HA 2LZ0A 1R1DA 3DL7A 4B4WA 5F23A 1IB0A 3B6EA 1O89A 3D3QA 3VM6A 1D4OA 1AGNA 1YQEA 4GD3Q 3TQRA 3T6KA 1L7VC 3D5EA 1UBCA 3N0VA 3SFTA 3HLTA 1RW4A 4I8IA 1SQSA 1OCEA 2OHVA 4OGFA 5FI3A 4ZN6A 4QFBA 5ARDA 1V45E 1NQVA 4F04A 4A8JB 4HQ6A 1XPJA 1Z9BA 4QECA 2R1TB 1TO6A 3W8EA 3I2GA 2QZSA 3H6KA 5ITZB 1FTSA 3EDOA 1FX1A 3Q6NA 2J0QA 5JDCA 3OIWA 5FPHA 2Q3BA 4ID3A 1U63A 3BB3A 1NG9A 1N3LA 1ESMA 3QLTA 1AO3A 4GMGA 1XRLA 1SXIA 1QHXA 3PXBA 1OHHA 1BDBA 2NVUA 1UP7A 3I28A 2VFAA 1PSWA 1MXFA 4PEVA 4DMMA 1ZUNB 3W0LB 1OV4A 2B1JA 2Q41A 2IEBA 5D5QA 1IN8A 2E3JA 2VRNA 3A1NA 4EI8A 3TWOA 1HE5A 4MW1A 2GTIA 5KTPA 5ALTA 4WNIA 1Z62A 2C59A 4IO0A 3LO8A 3RIYA 2VP3A 5FOQA 5HR5A 5MGBA 5ISMA 1ZH6A 8ADHA 1Z36A 3PNPA 2HSGA 1FNSA 2WYHA 4RNCA 5DNEA 4OMCA 4QAJA 2O52A 4RKFA 4OI2A 4LRXA 1L5FA 1R15A 2MYPA 2VQSA 1R9JA 1OC2A 3BGOS 3KEMA 4G0NA 4RE5A 3MMPA 2CV1A 2XB6A 4DNXA 1GGNA 3VO9A 1R9MA 2CKMA 1KEVA 1T13A 2VWPA 3U9TA 1NFQA 1T1IA 1ZH8A 1YQDA 4K6FA 5JZMA 5DYWA 2FPOA 2QROA 4HB3A 3S5UA 2V5UA 3UUGA 2LKDA 3WMRA 1Z0ZA 421PA 3BFXA 3FCSB 1Z0UA 2GEUA 3QELB 3MM4A 1KI6A 1UKEA 4J3NA 5GONA 3SNKA 2JGFA 2A9OA 5LYJB 1SCDA 5IZCA 3EG9A 4E12A 4CQJA 1CJKC 2OBBA 4GBED 4GM0A 1CF4A 4BBAA 5KNBD 1C7IA 3S2EA 1RAAA 2BT4A 2VK8A 4FN5A 1E0SA 1O4VA 1XOIA 3LNTA 1FUEA 1TUEA 5BW8A 2D3WA 5TMDA 3QTBA 9MHTA 2ILVA 3K5WA 1BCRA 1CY2A 1X94A 3LS2A 4KHZA 2JL1A 4UCQA 4C07A 2IYXA 3EFBA 1CCWA 3ZGXA 4BLOA 1TAUA 4JDPA 5IUJC 4R2KA 1NOIA 4R8MA 1DXOA 1XCGB 4MP3A 1JBEA 2CJPA 4DJJA 1LK0A 2G5PA 3HS3A 3QZUA 3TE6A 4UOZA 2Y77A 4DA7A 1MQAA 4IV5A 3T1NA 3I4FA 2MIIA 8MHTA 5LDGA 4LG1A 1FK8A 1N6PA 5EIBD 2OHIA 5HCIA 1THZA 3CRZA 1RWNA 4QFMA 4FILA 5ANRB 4LJRA 4WGGA 1QR6A 4OBXA 4DIOA 2VPQA 2CL5A 4JLAA 3O8OB 4KJXA 5F2OA 3AF2A 1XTUA 3ULKA 3W8FA 4D2IA 4MDFA 2VLIA 4XGKA 3A6PC 4GPIB 5SZIA 3OT5A 1I1HA 1BA2A 2GERA 3K2QA 4GZ3A 5E4FA 4ENUA 4FXOA 4FHDA 4E1AA 1C4OA 5M5BA 4H18A 4L75A 1R5JA 2WIJA 3OD5A 3E3NA 1Z2EA 1P44A 4KC0A 4Q6BA 1O1YA 2FEKA 4K9PA 4IZ6A 3DTNA 4I4IA 1EFUA 3ZD8A 2IUTA 1VSTA 2NG1A 3MYYA 4X20B 4C1BA 2ZZMA 3BFJA 4K9MA 3HZZA 4HPWA 2RAFA 3LQQA 4L73A 3ZHZA 3ZHSA 2FUNB 4H35A 1E5TA 5IG2A 3NJ4A 1TZBA 3NTRA 3UW3A 1D1PA 1UOPA 3HBNA 3TZLA 4CZ2A 3GRVA 5BMVB 1HDIA 2ENUA 2NGRA 1WU7A 2WHXA 4JGGA 2YJ5A 1U0HC 4X91A 1RAIA 121PA 3KOMA 4HWSA 4PXYA 3V3KA 3KOYA 4S1NA 1XZAA 1XDBA 2PBRA 1OX6A 3I5AA 3OJLA 2VHQA 1GLNA 2VNSA 2C9CA 3U3MA 4GWLA 4YAGA 1IY2A 1CPYA 4I4TF 2DYKA 2Q07A 4Z51A 4EGSA 1FFEA 1C14A 4P3NA 4JBXA 4S04A 1CV2A 5CUQA 2OCPA 3E5MA 2MR5A 4O02B 3RR2A 3HKCA 1WWKA 3TZCA 1R16A 4F6RB 1JIKA 1KK1A 2H5IA 1B6GA 4AKEA 1H8HA 2OYCA 2WPNA 4UM5A 1SU4A 5JS8A 4J49A 4LKOA 3GMIA 3PXXA 4KQGA 1YBVA 4R7TA 3M3DA 1NUUA 2ZAMA 2XWBF 4WZAB 5JO0A 4WEQA 2RGEA 1L5SA 1TU0A 1WLSA 3H19A 3CZAA 3OU7A 4FJ2A 4TLDA 4JIGA 5DHPA 1XLWA 3GCXA 3IPYA 4I19A 5C8XA 4OFXA 4TLEA 3N8HA 1WPRA 2PSFA 4MI9A 2FZVA 4WLEA 3VPDA 1TVEA 3H5VA 4R0MA 1UKAA 3HN2A 1Y4DE 3M70A 1JKMA 3WLQA 1JYSA 1U4OA 5C34B 4DNPA 1E61A 3HBJA 2BSAA 3EBPA 2C7RA 1A69A 5BSRA 3OOSA 1KJIA 4JU9A 4CKWA 4UD6A 5DRYA 4JOCA 1PJAA 3ESZA 1BQ4A 2CLEB 3ZWYA 2O8FB 3L9WA 1JTVA 3Q9SA 1S1MA 4RAQA 1YWGO 4UE6A 1LJ8A 5A02A 1NYQA 3KO8A 3M4ZA 5L7WA 4PQFA 2Y05A 3ROKA 1WPGA 3Q7IA 3FTEA 1KEUA 2Y92A 4BPRA 3J7AC 5IUKC 3EVZA 2FEXA 4IQFA 4MWDA 2DJ5A 1OREA 2DWOA 4OQXA 4LBWA 3DHEA 1T0BA 2F64A 1NKSA 2FP4B 1BJKA 2FW7A 2K4MA 5BVGA 4RANA 4LFBB 4MROA 5J5CA 1N6IA 1LBSA 1L5YA 1NIPA 2GEDA 4HNHA 4YUWA 3KHTA 1UOOA 2CNNA 2WFLB 3FA2A 3M6IA 3B6IA 1JHZA 4FT4A 1KGDA 2EKDA 3WRXC 3ZE8A 3THWA 1AS2A 1ZCBA 3DCNA 3HY6A 1IBMB 1QR2A 1TQDA 5EERA 4NCJA 5BV7A 4FSXA 4REQA 1G9TA 2WFAA 5F12A 3OZUA 1JLRA 3IAM6 4GQIA 1SC3A 1RYZA 2PMCA 4V03A 1GNTA 1KDTA 2VSFA 4JJFA 4GECA 2JFBA 1YFLA 4FDAA 5B12A 3SC3A 5CVEA 1QU3A 4OXRA 3ZWNA 3ANNA 4R8RA 3ZLTA 3IURA 1YHNA 3FNFA 2XMCA 5F76A 1BXKA 1GGHA 2R3SA 2FSIA 3ANYB 4R1OA 2NPFA 3RYHA 4G1FA 3KX2A 1JSZA 3UMYA 4B3DA 1AOXA 2HMUA 3RCBA 3H17A 2IZZA 5ERYA 4ABYA 2B92A 5AXAA 5I9SA 3PC3A 1KYYA 5ALFA 2I3ZA 4DL9A 3LA6A 2HWWA 3UGTA 3PI6A 4Q1BA 5BN4B 1J8QA 1FFCA 1QXSA 2XV1A 2ZJBA 2G0TA 3PGLA 4G5FA 4J7CA 3ORYA 3OWHA 4FS8A 1SAYA 1P7PA 5KTKA 1C3XA 1ZBQA 4LC1A 1MNQA 5A4IS 5HZGA 1OLOA 1Z12A 2F1HA 3IAUA 4R1PA 4X24A 2XWPA 4N3BA 2WY2D 3U49A 5HTOA 4WCFA 1E64A 3AUUA 3HWWA 2E4YA 1P3JA 2C5SA 2NIPA 3KT8A 2OCGA 3QXSA 6REQA 4TWZA 5F3RA 1VGRA 1XTKA 3ZE2B 3AO0B 1JVSA 3V8BA 1CDOA 3HLYA 1Q0SA 4M37A 4DV3B 2HA5A 1JQBA 4GVXA 1VMKA 4JJ6A 5DKFA 1AKTA 1FLAA 2JI6A 3DO8A 5KU1A 3PIRA 5JMPA 5SZJA 3T5BA 1V7QA 2XIQA 1BX0A 3VDQA 1RI4A 2BCGY 3C6BA 3NBAA 1Z4QA 3AKYA 1V5WA 5JSQA 1J8MF 1YVEI 2YV1A 3DBHB 1YULA 3I1FA 5KX5F 1VC2A 2P3LA 5EIHA 4ZHSA 5FTWA 2AQHA 2G4VA 3E7PA 5ARCA 2V3VA 2VAMA 3E53A 4XR4A 2BCJQ 1NR1A 3N76A 4Q9AA 4DWVA 1X15A 1BQ3A 4JXZA 4NU5A 3ANTA 3PX3A 1IAQA 1ZJZA 1E9FA 4FGUA 4LK3A 3S2FA 3P4UA 5KTOA 2REOA 4ONEA 4YJHA 1E2HA 3HUUA 4DRYA 2C5HA 5AVTA 3OFND 1QPZA 1YCGA 2WJJA 5AJUA 3UBMA 1X7WB 1B0PA 3DC2A 4ZO8A 3KQUA 2E85A 1E2BA 4ZANA 1R4NA 4WOBA 4U7TB 1WY5A 3VR3A 3QPAA 4HWGA 4AQDA 3R24A 3VU1A 1PFGA 4ZHQA 2WHPA 2ZI4A 4BGVA 1L4HA 3UN1A 4BQNA 4X3PA 3TM5A 4HB4A 4FMDF 2D1QA 2OHGA 1UT6A 3T1TA 3PICA 3N05A 1NLZA 2Q3EA 3LHSA 4HNQA 4BB0A 1P6QA 2WYOA 1GCAA 2WU0A 3E3AA 3L02A 3PFBA 4MVJH 4MR7B 4MIEA 1R50A 3RYFA 4IH4A 4XM2A 4G63A 3DZJA 3KQTA 4JT2A 4FINA 4XUCA 1F3OA 3RT7A 1EFCA 4EDHA 2WQ6A 4F11A 1M54A 3QJ5A 5FR2A 1WUKS 3WISA 4QPJC 2CZGA 2HXSA 4F5EA 5BR7A 2VYCA 2CD7A 2ZIFA 3ZUGA 2WIGA 1M75A 3SHQA 1OYVA 1RPTA 2QTWB 2IU4A 4RLHA 2AFIA 4FFPA 1ZH4A 1TVKA 4B6PA 1EBBA 3IP9A 2XQKA 2NO5A 4OX9Y 3AM5A 1IM5A 5A5DA 3FRIA 3KKZA 2WWYA 4D9FA 3OI7A 2AEEA 2VWGA 4ND3A 3O4GA 3ZJVA 3DPSA 1ZD5A 4FT2A 3LZDA 1EP3B 5CVCA 1XRPA 3S5JA 1PJRA 4Q3LA 1ZGAA 2E4ZA 4TN1A 3WGJA 2AOWA 2J3KA 2R1VA 3K0AB 2E37A 3PXDA 4G0MA 4MUJA 5EQFA 3TW4A 2ZSDA 5BUSA 1M1XB 5JYCA 1L5HA 2CVOA 2E9SA 3W5JA 1S3GA 2BFFB 3UY4A 5IC4A 1MZPA 1K8ZB 3V4FA 2IXEA 3O1IC 4CN8A 2Z9CA 1VYHA 2QZ4A 4B3MB 1TC2A 2J5RA 4FHEA 4PLVA 4KE7A 3K0CA 5BYAA 3EODA 4MINA 3CQ9A 3IO5A 3EXEB 3K92A 4F46A 3O2SB 2YMLA 3F49S 3FI0A 2DQKA 3QW4B 3G2OA 4AROA 1N2ZA 1C3VA 1KWKA 3W1EA 3EPLA 5JSFA 4JSTA 3DDWA 4II3A 4WT7A 5EXTA 1JSCA 1K86A 1J5XA 1H6DA 5I5EA 3BN3A 4W5QA 1PQYA 4B1FA 1D2CA 1O08A 4FCWA 2QRMA 5DB4A 3ZOZA 2AZMA 2WAMA 1UMBA 4A9AA 3M5DA 1UBFA 5LU8A 1T3GA 4ZRDA 3HU3A 4MXDA 3LRPA 4CKEA 3KQKA 2R48A 1NBMA 3KLOA 4Y6OA 4LNUA 3D6UA 5EJ4A 5JAPA 3A14A 3NAGA 3RF6A 5REQB 4P9NA 3TIVA 4E88A 1PG0A 3HFSA 4XW2A 1SQ0A 1WDLA 2MMCA 4HDKA 1SHUX 3SE7A 3ZDZB 2C31A 5BQXA 4HAOA 2COUA 3KYBA 1PT6A 1T5OA 3FI9A 4KUGA 1KI2A 3WGTA 4KCGA 4B4DA 1HMPA 1SVIA 2Z98A 3PG5A 3QU7A 4ALLA 3L84A 4OXQA 1VKJA 4BBPA 1O5OA 2AW5A 3L8YA 4P4UA 3CR8A 1G98A 1AXRA 2EHDA 3C6XA 3FR8A 2OXEA 2Q5HA 2YWHA 2PGAA 4RHXA 1CYDA 1KQFA 1F2DA 2XVAA 3EYAA 2Q2WA 4PYKA 2B69A 1LWOA 3WOVA 1T9KA 2HU7A 3G5AA 2VCHA 2WMNB 4Y0NA 3LPDA 4RU1A 1UEJA 2CMKA 1WZUA 5FADA 1NLFA 4JAVC 1VL5A 2OWEA 1FX0B 1VECA 2H4FA 3E84A 3PNMA 4IVPA 4FIZA 1FFWA 4OMDA 4XX0B 4L8WB 2ZS9A 1K7CA 1P18A 4DEYA 3EMKA 4D25A 3K6JA 3L5OA 4ZCPA 3V46A 2W2MA 1UDWA 2BFPA 2BBTA 1Q7EA 2Z4SA 4FS3A 3SJAA 2BEWA 3I53A 3R75A 3CVOA 4HNTA 4OHKA 4J43A 3O0DA 2R4TA 3R4CA 4BB6A 4WLVA 2H9AA 2VXOA 1OGJA 4L3OA 4OQYA 1OBCA 4QNNA 5EYPA 1Z0FA 2YUIA 4GXNA 2IPOA 4WK4B 3PXAA 1MCZA 1J22A 3PEVA 5JXWA 4GL4A 4Y3UA 1I4TD 5T64A 3NDJA 4JWTA 4B43A 3GAAA 4C0AC 4EAQA 3ENWA 2DKOA 2JAQA 3I5XA 3PPIA 4WNCA 2O1WA 2WWXA 3A0UA 3E35A 4JR0A 4CEHA 3T54A 2C3UA 3B5IA 3DWGA 3TFWA 4R4JA 2D2IA 1B00A 3EPJA 3ACDA 2G1PA 1JDBC 3UJ6A 1NU6A 1ZH0A 4BQQA 5JG7A 4MR9B 4LPKA 2YS7A 1SZCA 3ZI0A 2NSYA 1A4XA 2VTDA 4IDAA 1OFHA 4PZEA 4NHOA 4JSRA 2ZR0A 4E5DA 3HTXA 3IIIA 3S6JA 2VO1A 3D1JA 3QNMA 4YHHB 3RFFA 3LKDA 3ZKWA 1E9SA 2YNMC 3N2ZB 4ZXFA 3LBHA 1QHFA 1Y5MA 2RJ3A 1PDWA 1HQKA 4CG0A 2O05A 1AF4A 2HEGA 5FH9A 4PZDA 4AJEA 3KGDA 1U8XX 2WE7A 1AJEA 3OWOA 3OZTA 5HP4A 3V6LA 2CXNA 1USUA 4AF6A 1QF7A 4FK8A 2ET6A 5FJJA 4IQ0A 2QGFA 1KAGA 3PTZA 4J4HA 4YJFA 4CQMA 1S6YA 3U2QA 1QTQA 1T9GR 3HXMA 2HSDA 2PA0A 1CJSA 4CT0A 1T5HX 2A5YB 1OA1A 1T2VA 3OX4A 4EB3A 1PJLA 2UV8A 3K8ZA 4GNRA 1Z5PA 1KZ4A 3ZWXA 3FHTA 2DSTA 1WXHA 2XCQA 5KTRA 3DUWA 2Q4BA 1PGJA 3W7AA 2Y0CA 4W9NC 3GLRA 1C1DB 4KITB 1NUHA 3ZWPA 3R44A 3IMFA 1MTZA 4EJ2A 5IEJA 3F6RA 1ZINA 4O2AA 3L7OA 3OCUA 4AJHA 3BBPA 3RUIA 4HDMA 5ITSA 4HSGA 4W6QA 2IL1A 1TVMA 3J81A 2AFIE 2J33A 3FMGA 3AYXB 3GEPA 5KNLA 4P82A 4LF5B 2UVDA 4OQDA 1XJWA 4Q9DA 3NDIA 1IEQA 4FP9A 5G1NA 2O3SA 4B6JA 2CB0A 4J94A 2BFBB 3JSXA 2I66A 2HDOA 3UQZA 3U4CA 7GPBA 5K3OA 2ZAIA 3GMTA 3F6PA 3NASA 3AXSA 5K8IA 1D2NA 3KJFA 3HBLA 2OLKA 1YOVB 3K73O 2KS6A 1GTVA 1EFRA 4QPNA 1JF8A 2D2XA 2CV0A 5HE9A 4JYCA 2W71A 3EQZA 2F8SA 2IOYA 1JL3A 3H4IA 2RONA 1KRXA 2QTLA 1GJRA 2P9FA 3EPPA 2ODBA 3O91A 3SSAA 5KQLA 3PFHA 1U65A 1JYEA 1ATIA 2Q1SA 4US2R 2QAGB 2V6BA 2A92A 4IDFA 3WGYA 3BB4A 4PXSA 1PGQA 1GRCA 3VZPA 4BECA 3BILA 3KTFA 2ZIZA 3BIWA 1KMCA 4G2NA 4HK4A 2D6FA 2JIPA 3K15A 1EAYA 3E7FA 4KWTA 5DNCA 3GLGB 1TCVA 5C35A 1I51A 3HN6A 5C1IA 3FWPA 4G81A 1QRUA 2IZOA 2OG1A 3L9XA 5AR1A 1NBME 1ODCA 3I8OA 4C21A 1XQ6A 1QBKC 3GZ4A 3EUWA 3TDMA 3B1WA 5CVJA 2QYHA 3CEMA 2JRLA 1LA2A 1K97A 1QYXA 2I6FA 4PAMA 1WQ1R 2YX1A 4J0DA 4UC0A 4A16A 4BVJA 2B6NA 4IHAA 2Z3WA 3EW7A 2XWSA 4HAUA 2GM4A 2COEA 3T12A 1RI3A 1MOSA 1T91A 3PYMA 4G97A 3NDPA 3RODA 3F2VA 1AK1A 1A77A 1X13A 3CLHA 2BGIA 2C2HA 3NIWA 3RRMA 2G1UA 2HHJA 5FNVA 5G4KB 5NULA 4CETA 1WB6A 2BFCB 1E3EA 1ACJA 2OXCA 2WHQA 3AZOA 2XMZA 4IXDA 1ES9A 4N6GA 4RKWA 2PAAA 5JPDA 3EWNA 3ZDYB 3G2PA 4IUCS 1XZPA 1Y7IA 3WG9A 4U2DA 1SGWA 3I2KA 4BKOA 4Z2AA 3U0BA 1AXEA 4H0NA 3K9BA 1QANA 2IUFA 1I33A 1T1SA 3LAWA 3RG2A 2WHEA 4MPPA 5F1PA 3F6YA 5ALSA 1DFIA 5A7HA 1JXQA 4RM3A 2GPAA 3NANA 2ZULA 1X2BA 4RVGA 3VOAA 1YT5A 2AOTB 5K05A 3SXUA 3WSVA 1Z4IA 4DHWA 1G0NA 2DC1A 2B2NA 1K89A 3P20A 2PSJA 4XOIA 5A71A 2X9VA 3HA5A 4MYDA 5E2IA 1TK2A 3U62A 1QOZA 2GXQA 3CUTA 2D8AA 2HA6A 5CGQB 1UWVA 5FWXB 5JH7A 4MB2A 4TS3A 3CX4A 3ZV7A 3JPYA 4F5ZA 1Z2OX 1SCIA 4PCUA 4WIAA 5JC1A 2HDNB 3UAXA 2E55A 1A9PA 5LMZA 1USWA 4EO4A 2PUAA 2GN0A 4UEJA 2VAWA 2WZQA 1KP2A 5D2CA 1REQA 1U0GA 3HJFA 3AIIA 2GHRA 2ZYSA 3SIRA 1ETHA 3ECSA 4BP3A 5F77A 1E9RA 2RBGA 1PT7A 1MV8A 3FUWA 4JT9A 4UBKA 4DY4A 3M1YA 3WLAA 3HB1A 1J5PA 1N2BA 1RBMA 4WACA 4D0NA 1T2CA 4PYJA 2IHZA 2CMDA 4EABA 1G42A 4DV5B 1WG8A 1V16B 2O2IA 2ADMA 3UWOA 1RKUA 1E1MA 3F97A 5BSUA 3TD2A 1RCFA 2VP2A 2ZE5A 5FTMA 2WDZA 2VI5A 1ZI9A 1ZM9A 4I4CA 3EIXA 1QG2A 3LSYA 5DNWA 1H3NA 4ZMBA 1T8WA 1YC2A 3UKJA 2CEAA 1PFKA 2Y4NA 1U80A 3ID6C 1PS0A 4BLWA 4URXR 1IPFA 2WT4A 1K5GA 1QZZA 3KR2A 4MDHA 4D8WA 5K6TA 5L51A 3A26A 1HRKA 2FSGA 2ZJOA 4QSMA 1GQFA 1PF7E 1XZNA 1NU8A 4F21A 2XT9A 4MV9A 4V0RA 1G6Q1 1I1QB 3ABRB 4Q3BA 4WCVA 4Y2TA 1FFBA 3SC4A 1NBIA 3LIIA 4QXRA 5C46F 1TLTA 2GZSA 2OZLB 4UEKA 2O3JA 5C31A 2VK1A 1B8VA 1ZCJA 3EDYA 1W73A 3GT7A 3FPAA 4WJKB 1RYBA 4J76A 3AHFA 1ELOA 4PG7A 5HTKA 1W4CA 1IXZA 1JG7A 1U7ZA 5EJ5A 3ZGLA 4C7BA 4JJEA 2J3IA 4LXXA 1Z29A 2X0IA 4KB5A 4PW0A 2AOUA 5TF4A 3RWBA 5IJXA 1AH2A 2NYVA 4JUDX 5CYOA 3TLGB 5KPDA 3ZWMA 1SC6A 2EERA 1QJ4A 1J99A 5CH3A 1YZKA 3PBKA 4FMCB 4DNFA 3WQRA 1RLMA 4ZCIA 3PQFA 4A92A 4YAFA 1L7BA 2HZ7A 4CHGA 3G0OA 3RVOA 1XHEA 2FQYA 1DQYA 1EGVB 1RKBA 3CG4A 2XRFA 3I9NA 3MWGA 4X41A 5AHOA 2YR0A 3TR0A 5T73A 2GEKA 2PSSA 1NI4A 4Q03A 1CUWA 1O6BA 1WKBA 4TMWA 2XX3A 1OLXA 2ZRPA 3EEYA 3IC5A 4G01B 2YCLA 3D43A 3NRJA 4BZWA 1Y3HA 2FZWA 2NZUG 3I9OA 1C81A 3L7YA 3MAJA 2BMFA 2M2IA 3ADKA 1Z6QA 2BR3A 3RJ9A 3NR2A 2AC2A 1D04A 1PZHA 1ENYA 3DMGA 1C0KA 4M8LA 2FW1A 4J16A 1KMHA 2PR2A 1N57A 4JUIA 3ONDA 5A9SB 4J6EA 2BHNA 3N53A 4E5VA 2PLRA 4G26A 3ZWAA 1J6UA 1P2DA 3DZ8A 3W3AA 3IE2A 3DHYA 1ODKA 4TLMB 5JBQA 4BCBA 4P93A 3CZ9A 1G20B 2FW9A 4O2BF 4RLSA 3CWZA 5AHXA 4F4JA 2B99A 4ENRA 1WBJB 3TQOA 2FQXA 1PNRA 3PXGA 4C2TA 5A7FA 2PKQP 4JEHA 3EEFA 3VAZA 1R8QA 4ZOLB 3K35A 1K63A 3FSGA 3FYUC 1HT0A 2CFSA 2JAXA 2LV8A 3INNA 3K1ZA 4HN9A 5A4JA 1I10A 1YHZA 3REOA 2IYNA 1WUTA 2ZWOA 4YAOA 3N59A 2I78A 1MFZA 1V0JA 2R60A 1V26A 2IU0A 1V5GA 4UU0A 5KDLA 1TEZA 3QMWA 4FGSA 2UVPB 4XX1A 4FC7A 1UMDB 2FPIB 4MKXA 3ZVLA 4HS9A 4CLQA 4MKFA 1AA9A 1J2TA 1N0HA 3P26A 2H0QA 3JQGB 1P7WA 4X44A 5D5PA 5B7QA 1OQAA 1IBCA 3JD1A 1MJ5A 3QFCA 4FFMA 4OAPA 5CYPA 3V8VA 2EXXA 2OBFA 5GIOE 4J03A 3LOPA 2QRZA 3RT9A 3BF8A 5DLQC 1NSYA 2QUBA 4NBKA 4C7KA 1UPFA 1W4AA 2WNIA 5HSGA 2QG9A 1NM5C 2OM6A 3IAEA 3JVIA 4RV4A 5FA8A 1NQXA 3F4KA 3ZV3A 2X3FA 2F67A 3G9ZA 1G8AA 2XA1A 2VJLA 4PLGA 2DERA 1J25A 3H1EA 1ZLXA 3JQ9C 3QQPA 3LU1A 1RHJA 3KEQA 3G9QA 4P1ZA 4JH0A 2VF8A 3C4VA 3MQFA 4PBRA 2P5TB 3LPLA 4KLNA 2JLXA 5KYKA 3ZK9A 2XGGA 4KYVA 4L2IB 1STOA 1EX9A 4PYRA 3FCYA 3P2IA 5AM4A 1H2ZA 4LY6A 4KOAA 5K8CA 1D8TA 5IJ9A 2DB3A 4TYQA 1NQAO 4H4EA 1H05A 5HKKD 3IQGX 4MHOA 3LLSA 2AYXA 4Q1DA 1JYFA 4E5UA 4MRVA 1TTPB 3KYIB 4RH1A 4ZALA 3QJYA 3TXAA 2IUEA 1W30A 3GVCA 5KKAA 4XWWA 3Q1KA 1QCDA 1CJBA 4BO2A 2YIDA 1ITZA 4DCJA 2FPLA 2JKYA 5D01A 3OF5A 4AO7A 2Y0EA 1D3AA 1CEQA 3FE2A 3DCJA 3Q3VA 1D5WA 4DBLE 1ESCA 2R7AA 2G6TA 2P27A 4JYBA 2JZCA 1MV5A 2Q1UA 4LYHA 3U61B 1SCQA 4CCYB 2GZ3A 3ICCA 4PTZA 5BO5A 1Z07A 2YVQA 3U3ZA 1GEGA 2WQ7A 4M1TA 1J09A 3CUEF 5HBGA 5JPIA 5GJBA 5FA6A 2WD8A 1V8ZA 4RIFA 5HIIA 3ZTYA 1BRTA 1RMQA 2I4TA 4M22A 4C5AA 1DMRA 2PGOA 3OP1A 4OXXA 4DYVA 3KHUA 2PJRA 2ZZNA 2EBFX 4AZVA 3AERA 3AM4A 1JEAA 5ALWA 2ZDQA 1R6DA 2I2DA 3WIEA 1HETA 2PZEA 2AI3A 4KAAA 5HIAA 3KUKA 3NKLA 1EQ2A 1U5CA 3VGJA 3VI3B 4CMJA 2P1RA 4RQBA 1WXDA 2EFHB 3R76A 3N8GA 3EH1A 2VUSA 1ZK0A 3PHCA 1G9SA 3UJ9A 3WGGA 4K1XA 4QPPA 3ZZUA 3BSFA 2HA2A 5H59A 4ER3A 2Y1GA 2I3AA 3ZJXA 3UOGA 4CCSA 3QWIA 1YJBA 1PWYE 5AVUA 3Q8MA 2ATIA 3LT2A 3UFXB 4DE5A 2WU3A 1JKJA 3EXAA 3M6WA 4IDQA 3SLRA 3JXEA 5CYGA 1JJAA 5IX8A 3LXMA 3U6KA 3S28A 2JGDA 1KE1A 2BZSA 3FBGA 4EY3A 2SKEA 3HI6A 3WGMA 3AG5A 3PJEA 4JJ4A 1X7ZA 2WLTA 3C97A 1FTYA 3H4TA 4K9DA 3N7UA 3W3AH 4MX8A 2PRZA 3OFKA 4PXAA 3TEFA 2RBEA 4Z9XA 4EW3A 1DTEA 2GJ4A 5LYYA 1SZPA 3CKKA 1IRXA 4DR6B 1CQIB 1PJSA 4B4OA 5G3ZA 2Z6VA 1XHFA 1M72A 3K9HA 1YQGA 2VUUA 2J5XA 5E6RA 2ZIXA 2XZOA 1QIHA 1RVV1 4JWKA 1N75A 5EZYB 4K9QA 3UKOA 4TT3D 5F21A 4GGPA 5J2UB 5TGTA 1WTCA 2X4IA 2PMBA 1FFXA 2BKAA 1SVKA 1G8YA 1TJPB 7MHTA 3G2LA 4R1NA 4ZVTA 4OCZA 1EP9A 3PNBA 3GFSA 1TMGE 3TX2A 1U28A 1W6UA 3G2IA 3U81A 4DLPA 1PTKA 1X70A