4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
b'MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase 1
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
3MTJA 3DAPA 4MKXA 4O63O 1R0LA 5DBIA 1E5LA 3H5NA 1D1SA 4GGOA 4FJ0A 1DFHA 4N5LA 3TF5A 2FPPA 4PLFA 4W82A 3OEYA 2ZB3A 4B79A 4CM7A 1DFIA 1GY8A 2OO5A 2GLXA 2Y93A 1NAIA 3JQEA 3CPSA 1U1IA 4PGFA 3O8QB 1PZHA 4B3HA 2VZ9A 3L9WA 1Z7BA 4NFYA 4ALJA 1EZ4A 4RVGA 1HZZA 1IZ9A 3IAHA 2AG5A 3EW7A 1O6ZA 3H3FA 3MCVA 2YJZA 3VKVA 2VRBA 3EZLA 3UVEA 3EY4A 4JJIA 5G0SA 3EMKA 1H6DA 2BGLA 4BO2A 1GDHA 1D3AA 2EJWA 1A5ZA 1K5HA 4P4NA 2O4UX 3H2SA 4BNWA 1WPQA 5EQDA 1X1TA 2H63A 2IYPA 4D3SA 4LMRA 4B7XA 2G17A 4W7HA 1E1LA 5KVSA 2HJSA 2PD6A 2O7QA 1CIVA 2D2IA 4U6QA 2O2YA 4EEXA 3JQAB 2PH3A 2XOXA 4ND5A 3RUIA 4NJOA 5L3ZA 4IUYA 5U9CA 3EVNA 5A05A 5CAEA 1I2CA 4G5HA 4HFNA 3RFVA 4XRRA 2FRDA 2ZYDA 3LLSA 1XYGA 2DFVA 3DBLB 1OI7A 4MVJH 1QSGA 1NPYA 4IDCA 1AGNA 3C24A 4OIMA 5CEFA 5BSEA 1GQYA 4E5PA 1A4UA 3BMOB 4RVFA 2EGGA 1UZNA 1HEUA 4JK3A 4O6VA 1UJMA 5TNXA 1PIWA 3GDFA 1NPTO 2HKIA 3N74A 5I8ZA 1ML3A 3F5QA 1UP7A 1U8XX 3VPSA 1E0DA 1FDUA 1E3JA 3AU9A 3E9QA 5CDTA 4IQ0A 4EEZA 1FDVA 4R51A 3U09A 3I5MA 3BMCB 3WSVA 2OP0A 3NDJA 3F1KA 3GR6A 4QO8A 3SJUA 1LLCA 3K8ZA 2V65A 3O03A 2I67A 1Y8RA 2F00A 1N8KA 4IGEA 5KWEA 2DVMA 3ZV6A 2BLLA 1KETA 2Q22A 3SJ7A 3R0IA 4Z6KA 4PLVA 1YBAA 3GHYA 3GUCA 4OKNA 3M1LA 5EL0A 5ER9A 1RPNA 4E5YA 1PL6A 3H5AA 3M2TA 4LISA 1ADGA 3QA9A 4R16A 1VM6A 3HADA 5F5LA 4DIFA 5ITWA 1HYHA 1I0ZA 2ZQYA 4FSHA 3WICA 2P4HX 1FDSA 1PZEA 5K0ZA 4BKUA 1V3TA 1JVSA 4NK4A 2C7GA 1ONOA 5KJCA 3PXXA 3R6DA 3HFGA 3VH1A 4UEKA 3DXFA 4LRSB 1MA0A 1RM0A 1RYEA 2HAEA 3ZI0A 3L4BA 3NT5A 1UDCA 1UXHA 4YRDA 1MFZA 1QYXA 3PZRA 1ZK2A 2GR9A 4D3FA 3B6ZA 5JMWA 2B4QA 2DTDA 5AXBA 4WLOA 3JQGA 2DBVO 2GZ3A 1ENYA 2Y0DA 4ALMA 4BNHA 2VUUA 1EUZA 3KB6A 3QWIA 4JJFA 4UVGA 4EUEA 5KTKA 1XQ1A 1JU9A 1PTJA 4LCEA 2WE7A 3ZWCA 1ISHA 4YPOA 3V8BA 4NZ9A 2DC1A 1P1RA 3MJEA 5DN9A 4PG8A 4XZ3A 4F46A 3OJFA 4FQ8A 1ENPA 1O8CA 2BD0A 4GL4A 4JBGA 1KOLA 1SB8A 4D7AA 5A9TA 4R68A 4WCFC 3D3WA 3CZMA 1IPFA 1JA9A 2I66A 3VZQA 4HWKA 2C54A 4JXKA 1NQAO 4BO5A 1TVEA 2ZTMA 3W8EA 3SC4A 1HZJA 3A14A 2ZB8A 1X0VA 1Z74A 3AM4A 4OJNA 2FY8A 4K6FA 5IDQA 2PGDA 2BRUA 2CMDA 3TFOA 2JD1A 3E18A 1F17A 1T26A 4IGFA 3V2GA 4FOSA 3RCBA 2WTBA 3D5TA 4NMHA 1AXGA 2BGMA 1RM3A 4J9UE 4OSOA 4PFJA 1MG0A 2C59A 1DXYA 1XSEA 1OOEA 3I9MA 4ILKA 4OQYA 5ILOA 4MDHA 1KEUA 3VTZA 3IC5A 4FFNA 1LC3A 4Z3KA 2Q1SA 4CQMB 4CLOB 5IAAA 4LGVA 4S3MA 4DQVA 3IJPA 1PS8A 4OO3A 2QX7A 2WSBA 1N9GA 4Y8VA 4J4HA 3ZV5A 1XR3A 1WDMA 4GMFA 1DB3A 3LT2A 2W2KA 5AOVA 5ENDA 3K2EA 3GNQA 4BNGA 5HM8A 1SB9A 1UR5A 4MVJM 1P74A 4B8WA 2EP7A 3ROQA 5HWSA 5K6AC 1TA4A 4BO8A 2IE0A 4GAEA 5DOVA 4CL8A 1JW9B 1H6AA 3KTDA 2O3JA 1I01A 1O0SA 3GC6A 1M76A 3ZWNA 2H6EA 1DEHA 3KV3O 1QYCA 3DEYX 4NFSA 2WEKA 5J9GA 4RPKA 3GVIA 3LT0A 3L6OO 4YAKA 2C29D 2W2LA 4GPD1 4QQRA 1QRRA 1EK5A 3KYDA 2PTGA 3PZBA 3T4XA 4XDZA 1X0XA 3BTVA 3GOHA 3I3OA 3HDQA 5G0UA 3LYLA 1E5QA 2Y1OA 1RM5A 4WNCA 3KEQA 3RFTA 3ASVA 3ZNNA 3L9XA 4DC1A 1I3KA 1E1MA 1YBMA 1LNQA 1P1IA 1E1NA 1U3UA 2WDZA 1HF3A 4CMKA 5AYVA 4Y98A 1QLHA 4E3ZA 1IPEA 1QORA 2D5AA 2QYSA 3R3SA 4IQ8A 4Y67A 1NTOA 3S55A 3SX2A 1PWXA 4J6FA 4MINA 1T2EA 4AJPA 3P2YA 3PJEA 1HTBA 2E82A 2D1YA 2W98A 2P9CA 4OSPA 1JQBA 2I76A 1NHWA 4ID9A 4DPKA 1C0PA 5DBGA 5IDWA 3PJDA 3IUPA 5CP8A 4XB2A 1I2ZA 3CKYA 3FD8A 3H9QA 3GRPA 4YA6A 4PZEA 4MVJP 2DUUA 1R37A 1HDCA 2IXBA 2NVUB 4L8VA 3O8QA 4FB5A 4MP8A 5T64A 3FWNA 5IN4A 1AUPA 3GUYA 4J49A 5KKAA 1GL3A 1RYDA 3AY7A 1X15A 2YFQA 1FXSA 5DCYA 2JCXA 3CUKA 1LX6A 3WGYA 2VHWA 5T67A 3DO5A 4PLHA 1GQ2A 1CQJA 3ETGA 5U4QA 1U2DA 1U9JA 4PLYA 3ANMA 3CTMA 4GLOA 4NBVA 1XDWA 3DDNA 1Q0HA 4QO7A 1B3RA 4CUJA 2O2SA 3IS3A 3JQAA 2JAPA 2PK3A 5GMOA 3AI3A 2Y0EA 3C1TA 1DHTA 4R1TA 2ILTA 2VUTA 4CMBA 4CMAA 2ZB7A 4J4BA 2O3SA 2OHXA 3BTOA 3OEWA 3P5SA 2Q50A 3LSYA 1VJTA 3DBLA 4UVDA 2PD3A 2R6JA 3N7UA 1JKIA 4I5DA 3AI1A 3KOUA 5I9MA 1LDNA 2G1UA 4BO3A 4D0SA 2J3IA 3OQ6A 1GZ6A 3OIFA 2E37A 4LCJA 2CVQA 4U0JA 2ZYGA 3BMOA 2WWRA 4CMHA 2Q49A 4PIVA 3C7AA 4CM4B 3SLGA 1Z82A 4ALIA 4BNFA 2AMFA 5KJ1A 2B35A 4QUKA 1KBZA 1V3VA 1BVRA 1OC2A 2Q46A 2AXQA 1Y1PA 3ZWWA 8LDHA 3UHAA 3BMCA 5A5EA 3OJOA 4RJTA 1HDOA 3GMDA 2PNFA 1U7HA 3K30A 4CR8A 3ORFA 2D8AA 2Q1WA 2GF2A 3KLMX 1R4NB 1KEWA 3B1KA 5MDHA 4L73A 4D41A 3NV9A 1E7MA 5KJFA 5EMHA 3AUTA 5JLAA 3AUSA 3JD0A 3Q9NA 4IBOA 4KOAA 5F21A 5DF1A 5G0VA 3WQRA 4CLEA 3JQCA 3EYWA 5HBRA 1LDBA 5L45A 2B5VA 1G0NA 6LDHA 2Y1EA 1EVZA 5FEUA 4NK5A 1DRWA 1CEQA 3HZZA 4GVLA 4P4LA 4XEHA 2HJRA 4RO0A 4WNIA 1QG6A 1EDOA 3C1AA 4ALKA 5A5FA 1ZO8A 1YB1A 4BNVA 1PGNA 1GYPA 3FF4A 3V2HA 3VOSA 2NU8A 4B3IA 1I3MA 1HE4A 3JD3A 4ZQBA 1J0XO 5GZ1A 2XPCA 3PHHA 3GF4A 4HNHA 4BKRA 2J3HA 1OMOA 3ETDA 4J0FA 2ZTUA 5C7IO 1BVUA 1HE2A 3UW3A 5LDHA 1EFKA 4K26A 2VYNA 4E2ZA 2PKRA 4O0LA 1T1RA 2PH5A 1HE3A 5IDXA 2EXXA 3IMFA 4INAA 4Z9FA 4A7PA 2P9EA 3RUEA 4RF5A 1HSZA 4ZU3A 1EVJA 5TIIA 1FDTA 3IDSA 3GN1A 3KM0A 1PJLA 4M54A 2RIRA 3RC2A 2X5KO 1PU2A 3O9ZA 1E3EA 1L7EA 2NU6A 1MX3A 2AQIA 4E12A 2YQ5A 4M87A 4DBZA 4MP3A 5A4DA 3GZNB 1PQWA 3AY3A 1LRKA 4CL3A 3TL2A 2A9FA 3ASUA 3FTPA 3I9NA 3S2GA 3RBXA 4YT5A 4AG3A 1ZK0A 4MVJF 3A9WA 1J6UA 5ICMA 4A26A 4YQYA 1U7TA 3ONDA 4II3A 3VPHA 2VTEA 3M6IA 3GNSA 4KP7A 1U3WA 3DHNA 2TMDA 3FRJA 4RPJA 5I9LA 4B7CA 5M6DA 3DZFA 1YXMA 3AFNA 3KHUA 3MTGA 4FC6A 4CQMA 4CLOA 1EBUA 3LQFA 1C3VA 1GYQA 2Q2WA 3RC1A 1EQ2A 4A10A 1QLJA 4BNMA 4BNYA 2NUAA 4CODB 3OIDA 5ADHA 4RV9A 1X7GA 4J1QA 3GPIA 4ND4A 5B12A 3WGZA 3SBOA 2AHRA 1K89A 1ZW1A 3VPFA 5L53A 3NTRA 1PQPA 2CUKA 1I10A 4CUZA 4BIIA 1YDWA 3FCOA 4BGVA 4PCVA 3WFIA 5U1PA 4CMCA 1LDYA 1VL8A 4FIZA 3GNTA 3OJEA 4B4WA 1PZGA 4PZCA 1NPDA 1E3LA 4U6SA 1H9BA 1JVBA 2X9NA 4WEOA 4K1LA 4BO0A 2YZ7A 5EPOA 5TRTA 4XRGA 1K3TA 3O4RA 2J3JA 3PHIA 3MJTA 4DMLA 3NYWA 3TZ6A 1EBFA 1W8DA 1D8AA 1YVEI 3Q9UA 3OHSX 4Q9NA 3RJ9A 3QVSA 1VE9A 2CF6A 2JFGA 2AEMA 4ROSA 3LT4A 1OC4A 5AXCA 4OL9A 1QXSA 1ENZA 4NI5A 1ZJZA 4EDFA 5C7LO 3CE6A 3F6YA 4YTEA 4E2XA 4XYLA 4BGUA 4E5NA 3HDJA 2ZTVA 5JAZA 5L4SA 4FFLA 3WYEA 3BTUA 1R66A 3L07A 2GRAA 3FNGA 3N58A 4WCFB 4Z0PA 1T25A 1F12A 3FN4A 1H0KA 1TT5B 9LDBA 4MKRA 3PWKA 1B2LA 1KS9A 1H2HA 2CVZA 4L0QA 4EBFA 1SBYA 4ZVVA 2EKQA 3HE3A 1F8GA 4R69A 1XKQA 4BV8A 4IINA 4BS9A 5DNAA 4ZQGA 4DIBA 2NVUA 4N18A 3OIGA 5AQ1A 3INRA 3I9KA 2E4AA 3DBVO 3LK7A 4XR9A 4DPMA 1KVTA 3HFSA 3OSUA 2BI7A 3GZ4A 1ZZEA 2ZTLA 1TI7A 2YDXA 5JXWA 1VKNA 3X2FA 4KWIA 4IJKA 2H9IA 4AVYA 2CFCA 2IZ1A 3A1NA 3G1UA 2X5JO 1XG5A 2FWMX 2FZWA 3AM5A 5BSFA 1IYZA 3L6DA 4J4TA 3ANNA 4DIOA 4OMUA 5DP2A 1QMGA 4XYGA 4HADA 3FSRA 5B37A 3ZHXA 2I5PO 2GDZA 1UDAA 4YJHB 3K5PA 4YWJA 3ICPA 2EHDA 2PFGA 4IDFA 2YFHA 4A0SA 4NQZA 2G82A 4XYEA 2WYUA 1PGPA 1T2CA 5AXDA 3K73O 3C85A 4G2NA 1LU9A 1H94A 2Y99A 3OM9A 4WCDA 4HY3A 1WXDA 4ZN6A 4NPCA 3TPCA 4C7KA 2PGJA 1A7AA 1R0KA 1ZEMA 5IG2A 4J1NA 1NVMB 1ZEJA 4XWYA 4BNUA 1U3TA 1BXZA 4CM4A 3UCFA 4GX0A 1BWSA 1FF9A 2NV6A 2QW8A 2VT2A 5G0TA 1ISFA 4Q3CA 2ZCUA 1F06A 2YHIB 1Y5MA 1PR9A 3OP4A 3VPGA 4RVDA 2WM3A 5JO9A 2Y68A 1NVGA 4WOJA 5JAQA 3EC7A 4E0BA 1PJSA 5A03A 3RD5A 1YRLA 1YS4A 1P31A 1R4NA 5TF4A 1LXCA 1HDZA 4AJNA 3QWAA 3PQDA 4UREA 1P44A 4TRNA 1X1EA 3OH8A 1B16A 3WWZA 1PJQA 4QEDA 1BDMA 1T2DA 3E5MA 3C7CB 5JE8A 1KY5A 4ZQFA 1ZSVA 3JQ8B 1LDGA 4E13A 1HDXA 2XAAA 3KLPX 2O7SA 1YONA 4J43A 1XGKA 1XLTA 2ZATA 4C7JA 1Q0LA 1WNTA 1PL7A 2JFHA 1E92A 3JQDA 3RUDA 2UYYA 2NU9A 3F9IA 4JIGA 2O3UA 3BMQB 1R4MB 4GWGA 5B4TA 1N1GA 3C3XA 1DRVA 1ZSNA 4WLUA 5CHEA 2FP4A 3H9JA 1EEHA 2VYVD 1JDJA 1SPXA 3LT1A 4F45A 1A9YA 3GEGA 4PLWA 1J4AA 2QHXA 4UUNA 4FD3A 3MZ0A 4IDDA 5JO0A 2GN4A 2CF5A 1EUCA 1R12A 4YJFB 4Y6RA 2BKAA 5C37A 2B0JA 4RL6A 4JBHA 4HFRA 2VRCD 1EDZA 3JCZA 1EE2A 4AJOA 4I8XA 4W7IA 5T8KC 5G4KB 3D7LA 1I5RA 3MOIA 4HFJA 1NQTA 4H15A 4KUGA 3D4NA 2B5WA 3G79A 4HNGA 3WNQA 5L7YA 3QY9A 5G2OA 4PVCA 2QRKA 5H83A 5DULA 4ZRMA 3V1UA 1V6AA 1XA0A 3I52A 2VUSA 1NVTA 2IEBA 3DHEA 1X14A 3NX4A 1UZLA 5A3VA 4NBWA 1MP0A 1XIVA 4CM8B 3DR3A 4MVJG 2EG9A 1DJNA 3U0BA 3UAGA 1CYDA 1O94A 2AE1A 2QZZA 4IM7A 5A9SB 5L9AA 1C1DB 5T8KA 5KCZA 4AJHA 4MKZA 2B83A 3I83A 5LC1A 4Q3BA 4J7UA 3GZNA 4I08A 2CNBA 4YACA 3JSAA 4TSKA 3BYZA 2JHFA 1ZSYA 3TFQA 3PQEA 1E6WA 5BT9A 2Q2VA 4Q3AA 1YL7A 1HKUA 1NYTA 3BHMA 2JCYA 1JAYA 1KIFA 1KERA 2P5YA 4EYEA 5A9RA 2QQ5A 1U5CA 3ADOA 3H9EO 3ZCXA 3GGOA 2Y67A 3K2BA 3ZWBA 1GV0A 4UVIA 1VJ1A 3H2ZA 4RGBA 1EE9A 2GSDA 3BXXA 3K6JA 3IQDB 4EJ0A 3QHAA 3W1VA 2W8ZA 1SAYA 3DZJA 5JS6A 3GEDA 2VHYA 1ZMTA 3VZSA 5KJ6A 5F1KA 3GVCA 1YO6A 4OOFA 3U4IA 1F0YA 4XQCA 1DIBA 3I9JA 4TVBA 4W4TA 4CMEC 5I7FA 2RH8A 1DOHA 1C14A 4CM9D 4F3YA 4XA8A 4EJMA 2J3KA 4YCAA 4L9RA 4QTZA 1DIHA 2YDYA 1P0CA 4OYRA 4U0KA 3RBVA 2AE2A 3VTFA 4FS3A 3D1LA 1JKFA 2GCGA 3LLVA 2HU2A 1KEVA 3RVDA 4XQ9A 4CJXA 3WTBA 3M1AA 2GZ2A 3DOCA 3TDKA 4CMEA 4ZD6A 1DPGA 2V6BA 2RH4A 1ZFNA 2X23A 1O9BA 3ZW9A 3ZU2A 2IODA 3PRJA 5LDGA 1FK8A 2ZQZA 5I8WA 2E6UX 4XJSA 2Z1NA 4ND1A 1LTHR 2NTJA 5BSGA 3I6QA 7MDHA 1VC2A 1VJ0A 2BMAA 4IZHA 4EGFA 1SOWA 1T2AA 1UUFA 4R54A 4F6CA 3QVOA 4JNKA 4TZTA 4GQAA 2UDPA 2Z95A 2PKQP 1W73A 3ITDA 4PLGA 3ONEA 5DCUA 4BO6A 2RAFA 4NFHA 4WCFA 5L7WA 2CDAA 3KSUA 4L4RA 1OAAA 2X0RA 5EQFA 1CQIA 4WPGA 2D0IA 2O48X 1I3NA 4RVUA 5EJ2A 3LC7O 3OA2A 3DONA 4R3NA 4M49A 1TT5A 3RI3A 3ZDFA 1GFSA 1T24A 1UP4A 4Z9YA 3ZHZA 4DXHA 3OF2A 1GUYA 3HDHA 1SEPA 5TS3A 2AA3A 2J6IA 1Z75A 1TEHA 3WWYA 2NM0A 4L4XA 4A73A 2O3RA 2VT3A 3P7MA 3DOOA 3I9OA 1EQUA 4E32A 1B8VA 2J5QA 2YV3A 5CDGA 1QV7A 3CZRA 3BA1A 4XX0A 1MC5A 4B7UA 2AG8A 1E3WB 3RUAA 5JCJD 4BUCA 1BGVA 4R5MA 1E7SA 5KVVA 4EITA 4RPGA 5CDUA 2SCUA 2E49A 4ZGWA 4WLEA 1NQ5A 1SNYA 1UH5A 1T4DA 7ADHA 2XXBA 1UAGA 5K6AA 1NP3A 4CUKA 4FGWA 1VKOA 2A94A 1PQUA 4E5MA 2BI8A 1WMAA 3BTSA 4DBVO 5B4UA 4PRKA 3GY0A 2I3AA 3RROA 2JFFA 3WR5A 2YW9A 3AWDA 3KEOA 2OL4A 5IF3A 3U62A 1PJTA 1ID1A 4KTVE 1NBOA 2GN8A 1WMBA 4YJHA 3NGXA 4NBTA 3DMTC 3VAZA 2PZMA 1Y7TA 5IDYA 5BNFA 4C4OA 3GPDG 4PLCA 2P91A 2NTVA 1YWGO 3A06A 4TZKA 3WGOA 4TRMA 2ZIZA 4J16A 4L4SA 1DIAA 4XKJA 4E4YA 1UXGA 1YDEA 4NBUA 3Q3CA 1L1FA 3WIDA 3E48A 4CLRB 5CFZA 3WMWA 4D44A 3ADPA 3E5RA 3L4SO 1BW9B 3DMTA 2JCVA 2HMVA 2YHIA 2HK9A 1PS0A 4GX1A 3P19A 3PLRA 3DC2A 3JV7A 1WWKA 3I6IA 4RCVA 1O95A 1XQ6A 2P68A 3FBGA 3PWZA 4XIJA 4FPXA 4GI2A 1Z45A 3B1FA 4I5FA 3U9LA 1EK6A 2CDBA 2GNAA 3IJRA 4GH5A 3TZQA 3WS7A 2EEZA 2QYTA 3HB4X 4FOOA 5FI3A 1YOVB 4CM1A 3E9NA 1WLYA 3D4PA 4N54A 2B36A 3JQ8A 4HBGA 5J23A 3PDUA 3WBBA 3PFFA 1ULSA 3UKOA 2PV7A 5FYDA 4YBZA 1LRLA 4BL5A 3VVBA 3T4EA 3OMLA 3Q1LA 4A03A 3FI9A 4BNTA 1LSUA 1U5AA 3WJAA 4BO1A 3ZNPA 2AEFA 4KZPA 5TQVA 3BMQA 4RDHA 1R4MA 3E8XA 1K0UA 3K92A 2C5AA 4J7XA 4XGIA 4ALLA 4D3DA 3H6KA 5L7TA 2Z5LA 1E7YA 4OH1A 4XYMA 1C0KA 1OBFO 3HB5X 4GGPA 3ROPA 2Y1DA 1LSSA 2X1HA 1JWBB 1IHXA 5A06A 2GASA 2O4CA 3VPXA 2O50A 1PX0A 4YJFA 3TZHA 2PGLA 1ZVMA 1C1XB 1ZCJA 4R41A 3AOEC 2A35A 3DBRB 3MJCA 3PLNA 3WGQA 4I9NA 1I3LA 4BMSA 4J2HA 3NEPX 5JAIA 4GX2A 3MJSA 5L95A 3AW9A 1I36A 3Q0EA 1N1EA 4IIVA 1ENOA 5G4KA 1B8UA 1GV1A 4EUHA 4UUPA 4TKMA 5F1PA 4PLZA 4YAEA 3TZKA 1YQXA 4D79A 2PWZA 4CR6A 1KVQA 3D4OA 2DM6A 3WDSA 1MGOA 1LJ8A 2PZKA 5H82A 5KOIA 2EV9A 3F1LA 1BXGB 2WYVA 4Z3DA 1PEDA 4CV0A 4ZA2A 1S6YA 3GGPA 5CPBA 3OJ0A 5T6BA 4AFNA 4CM8A 4DLAA 1GR0A 4GSLA 3MJVA 5DDIP 5IZCC 3F4BA 4KUEA 4LMPA 2DPGA 3F4LA 3PIDA 4KTTE 5A9SA 1C1DA 2VOEA 3DZGA 4KQWA 4WUVA 3UCXA 2IZZA 4LRTB 2PD4A 1JAXA 1KY4A 1P45A 1XU7A 2VWQA 4QXMA 3RU9A 1JTVA 1M75A 2JHGA 4NU5A 4OGWA 4IXWA 1PGJA 5JNLA 5KIAA 3O38A 4XR4A 4L75A 3GH3A 1BHSA 2YUTA 1MB4A 4YRAA 4KDFA 1NFQA 4CPDA 3K31A 3F5SA 4FJ2A 1Z73A 3AOGA 3DL2A 1R15A 3PDJA 1TT7A 5IZCA 2IXAA 3RKRA 2PZJA 2JKVA 2NQ8A 3I4CA 4K28A 2RBEA 3IP1A 1HT0A 4RLSA 2EGHA 2CSUA 1HE5A 1LDEA 1DBVO 2GN9A 3DB2A 3NT4A 2YYYA 4WLNA 1WZIA 4XQGA 4IMRA 1U2GA 3WMXA 2VYVA 3RAJA 4MPDA 2VTDA 4JGBA 2NVWA 3RUCA 4BB6A 1UXJA 4LVUA 2P2SA 1JN0A 2Q4EA 1EMDA 1LEHA 2NVBA 5F3RA 1Q1NA 3OICA 1LQUA 2DLDA 2HCTA 4AJLA 4DREA 1WVGA 2VRCA 3ONFA 1AXEA 4FFOA 5IXYA 2B69A 6ADHA 1YL6A 4ND3A 3U3XA 2I65A 3TQHA 4R5HA 2HMWA 1CERA 4I5GA 4R9RA 4X54A 1DSSG 4ZQHA 4WK6A 1HLDA 4AICA 2DBRA 3B20A 1K6JA 2IEDA 1DLIA 4OQZA 2NU7A 3PTZA 1YJQA 3OETA 2Y1FA 1GADO 1FJHA 1M2WA 1M66A 2G5CA 5T57A 4WASA 2NWQA 2OORA 5EN4A 1T1SA 3UXYA 2X5OA 3TWOA 2Q1UA 2G0TA 1H6CA 3E03A 2PY6A 4GKBA 2DTXA 4EZBA 4CMJA 2HLPA 4YYZA 5BNIA 3HQ4O 1YQGA 3RIHA 1EVYA 1G0OA 5A02A 1E7WA 4J3FA 3Q2IA 1IL0A 2V6MA 4TQGA 3WB9A 3S2EA 8ADHA 3MJ4A 2Y0CA 5EERA 3GVPA 3HN2A 4JLWA 1A9ZA 3F46A 2CZCA 1NHGA 4TMFA 3INTA 4RZHA 2I99A 1LI4A 2VZ8A 3NKLA 3BZUA 3GG9A 1KYQA 3ENNA 3FNHA 3L6EA 3OBBA 2A92A 3FBTA 3IOYA 4CLDA 4MVJI 3Q11A 1GU7A 4UULA 3AUUA 4WKGA 5TT0A 2RCYA 4ALNA 1ISGA 1D1TA 4ZJUA 4M1QA 1E6UA 3UN1A 1NFFA 2AW5A 2RHCA 1E6EA 1RWBA 4R1UA 4CR7A 2WMDA 5G0WA 4HX5A 5GZ6A 1V35A 4CM9A 5JY1A 5KVQA 1H93A 4ZICA 2V6GA 2HMSA 5L4NA 1I30A 5JMPA 1Y5RA 3DZHA 1E3WA 2Q2QA 4EJ6A 5TJ9A 2VCYA 4PG4A 3H9GA 2ZK7A 4M86A 3CSDA 3NTQA 1RKXA 3PHGA 3MWEB 4TKLA 3WGIA 2YV2A 1PJ3A 1F14A 3HJAA 1SMKA 2JL1A 1QR6A 5DT9A 4YRBA 4MIOA 5H81A 2X7HA 3DTYA 1VRWA 1IZ0A 3V5NA 3W4KA 2HO5A 4AJ4A 1E7RA 5EIOA 3PJFA 3FPLA 3GAFA 4AL4A 5CPFA 1HL3A 2DPHA 3VKUA 1ONPA 2NACA 4BMNA 2BF7A 1R16A 1VL0A 2D5CA 1UAYA 1Y81A 3LU1A 4I9UA 3ZHYA 1ISMA 1J49A 3GG2A 3HG7A 2DKNA 3D3EA 1SOVA 3L0DA 5JC1A 2JAHA 2C20A 4E2WA 2IRWA 3QWFA 4MVJD 5TSDA 1A72A 2FOIA 2H5LA 2J8ZA 3H8VA 2QRJA 4A5OA 1D4FA 3COSA 3VDRA 3ROMA 5IFLA 3JD2A 4PLTA 1PSDA 5C7OO 3OECA 3WLFA 1BW9A 2Q4BA 3AFMA 4IDAA 4LSMA 1SEVA 3ROKA 2NQTA 1IB6A 4WECA 4ND2A 2OBNA 4A27A 4PRLA 4E30A 4ESOA 5JSFA 3T7CA 4P8RA 4FW8A 4CM5A 4BO7A 1GTMA 4J0EA 4JP2A 2WJPA 5BNTA 4B8ZA 2P5UA 4BKQA 3G1TA 3C8MA 3X2EA 5C3MA 2X6TA 1P1KA 1QYDA 4HUJA 3RJ5A 1U4OA 2GERA 2Q1TA 2CD9A 1QYWA 5JCJA 1YOVA 3G49A 5JYFA 3KYCB 2AEJA 3QE3A 4TROA 4B4VA 3STHA 2W4QA 5JC8A 4LSWA 1ZK1A 1VSUA 4CLHA 3HSKA 1GPJA 4CMIB 4HV4A 2NNLD 4RDIA 3PYLA 1CJCA 4IZIA 4L76A 3V1YA 4DLBA 3W8DA 2VNSA 1WDKA 2NLOA 2VHXA 2X4GA 4PZDA 1V9LA 5COQA 3TRIA 3ZW8A 4R3WA 3RBZA 4E31A 2EP5A 2VNAA 3D0OA 1ZXBA 3AI2A 1PZFA 2W90A 4YAGA 1GCUA 5AXAA 3ABIA 4NH4A 1MLDA 4II2A 3JQ7B 1LBEA 4OXKA 3GRKA 2BGKA 2XF8A 4DVJA 1DO8A 2FN7A 1IY8A 3ZV3A 2EKLA 3GVHA 3LVFO 4S1VA 3DQPA 3WGGA 4CM3A 4MIYA 4ZQEA 1DRUA 1C1XA 2HMTA 3CMMA 5CDYA 3DBRA 3JYOA 5B4VA 5L51A 1VI2A 2OZPA 4YT2A 1HYEA 4OXNA 3QVTA 3GDGA 2AQHA 4HXYA 3QWBA 1U3VA 1DLJA 1NR1A 4OHUA 3JQ9C 4IQGA 4U8GA 4O59O 1IE3A 2Q45A 5JPIA 4YB8A 3NDIA 4HKTA 3QP9A 4RVHA 1BXGA 2TMGA 1JLLA 2AQKA 4Y6PA 3BHJA 1CWUA 2G76A 5BR7A 2V6FA 3KYBA 4WEQA 5JY6A 3HNPA 1CETA 3E1KA 4XYBA 1YL5A 2GYYA 2I3GA 4BQPA 1ZH8A 4XGNA 4D45A 3JQ9A 3LF2A 2IYOA 1NASA 1YB5A 2FR0A 3BAZA 3PQFA 1NR7A 1GCOA 4XD2A 4N5NA 3WQQA 4IS3A 4FCCA 2FPGA 2JD0A 5FWNA 4BNZA 2DUWA 3DHYA 2PZLA 2RHRA 3LF1A 4J1TA 3RUFA 4E33A 4K6CA 4NR0A 2P4QA 3DFUA 4BMVA 4YQZA 3VH2A 3SXPA 4J7CA 3LDHA 3DZBA 3H3JA 2VZ0A 1ARZA 1BG6A 3VH4A 2YV1A 4G81A 2EIHA 4IPTA 4BGIA 1BXKA 3RASA 2X8LA 1PGQA 4IY1A 4P22A 1Z7EA 4Y6SA 3BHIA 4URFA 3TL3A 3KRTA 1X7HA 1CF2O 1QYVA 4JCOA 1ZBQA 1HWYA 5JDIC 3HUDA 4BHTA 2DU8A 4ZRNA 3RC9A 1NAHA 4MO2A 1R0SA 3IUSA 4IMPA 5MGBA 2VN8A 3QRWA 1R6DA 2C2YA 3O26A 1ZK4A 5HS4A 2LDXA 1TLTA 3WYBA 4DPLA 5HS6A 3CEAA 2EKPA 1QP8A 1LQTA 2VYND 3PIIA 2Y66A 3VZPA 4QFCA 1YH3A 4BO9A 2J5KA 3QWHA 4GX5A 1NXQA 5JDIA 3I9LA 1XHLA 5IN5A 3E6AA 2NADA 5TX7A 1BDBA 1E7QA 1Q2XA 1EFLA 3S2FA 4I1IA 2X9GA 5JAMA 1V8BA 2UV8A 1MXFA 5CG1A 5I9NA 3F47A 4LVCA 3RQSA 5COAA 2EW2A 1YQDA 1U28A 1P1HA 2HUNA 1AE1A 5JDCC 2YHUA 3F3SA 3PP8A 1RJWA 2EF1A 4P38A 1HDYA 4MP6A 4FC7A 4IJWA 5DCWA 2FSVA 4KUHA 3WNVA 3IKVA 5KKCA 4H7PA 1GZ3A 4UUMA 2WYWA 1UXIA 2Y05A 3L4BC 1E77A 2Y1GA 1Y8QB 3JYPA 5DP1A 1T4BA 4AJJA 5KNLA 2BFMA 1VLLA 1C0IA 3HHPA 3FNFA 3MWDB 4QECA 5B1YA 4RVSA 3G3EA 3VHRA 5JDCA 1S7CA 1UDBA 1CRWG 4NJMB 3QIVA 1EUDA 2BH9A 1DFGA 1IHYA 5HA5A 1UZMA 4RF2A 3DBHB 4CQMD 4WGGA 4FFMA 3CINA 3ZV4A 3S1LA 1A71A 4TWRA 4CV2A 1HLPA 2VWPA 1NQOA 4BKOA 5DOZA 1DIRA 2GUGA 3NJ4A 2ET6A 4GMGA 4BKPA 4FFPA 3GFGA 4LK3A 1BSVA 3WG9A 5HTOA 2P9GA 3GK3A 3SVTA 1MG5A 4M55A 4KQXA 1BMDA 4I9HA 4NHEA 3SLKA 1Q0QA 5I7SA 4FR5A 4AJKA 3WXBA 1I24A 3UGKA 3FR8A 1NM5A 1L7DA 3DAFA 2JJYA 4UEJA 3QW2A 1Y9EA 2VWGA 2QG4A 4UVHA 3Q6IA 1ZNQO 1ISIA 3G17A 4XIYA 2HRZA 1WAMA 4XCVA 3ZH2A 3WSWA 2PR2A 3PYMA 1NFRA 5LCXA 1MV8A 3CMCO 2BFAA 1OFGA 4OOEA 3NTOA 1I32A 3JQFC 1MFPA 2QZ9A 1PJBA 5CG2A 1E3SA 1NWCA 1YBVA 3ZNOA 4BOYA 4O5OA 5CEEA 2Q99A 2BFOA 4M89A 5JFOA 1HDGO 4U7WA 2QRLA 3V2UA 2C2XA 3JQBC 3ZU3A 1E1KA 4GSKA 3WOHA 3UF0A 4D43A 2FSSA 3ZWYA 4PG7A 2HK7A 5ITVA 1M67A 2FR8A 3KSZO 2VQ3A 1F8FA 3JQFA 1DAPA 2OP1A 4GWKA 2X58A 4BNIA 3QLJA 3NDRA 3D5QA 3WGTA 1I2BA 3OQ1A 3KBOA 3E9MA 3KYCA 4IDEA 5GY7A 3JQBA 2OGUA 1WZEA 3DOJA 3BMNB 4YAJA 5DZSA 4DTIA 1DJQA 4CMIA 3EVTA 1B0AA 3E82A 2A4KA 4OM8A 1HETA 5JYDA 1YKFA 2B4TO 3EK2A 5JYEA 3PPIA 4RQUA 3OJLA 5ICSA 2YY7A 1ZUD1 4BGEA 4DMMA 5L40A 4OAQA 2CY0A 1LSJA 1Y6JA 3TOXA 2Q3EA 4IS2A 3GVXA 4DYVA 1FDWA 3JD1A 4QFDA 3VVCA 3JQ7A 4D0RA 3QVWA 4FDAA 2VOJA 5TT1A 2WD7B 3U49A 1H2BA 2DT5A 3FHLA 1U8FO 3D64A 1K6XA 1BRMA 4XQEA 4MVJA 2I6TA 4CV3A 1P0FA 4NG5A 3EAGA 3AUAA 5THQA 2V7PA 3PVZA 4DGSA 1O89A 1P1JA 3I4FA 3JYLA 1XCBA 3WGHA 3SC6A 4YJGB 2X0IA 3ZNQA 2ZJ0A 3GFBA 3CIFA 4YR9A 3JD4A 5EINA 3ENKA 1UP6A 3ZHBA 4DQXA 5C5IA 3H9UA 5BSHA 2FZEA 1PGOA 1P77A 3C1OA 4PN3A 3IP3A 3HN7A 3GHHA 5FI5A 4J91A 3UICA 5KVCA 1LC0A 2GPTA 2WD8A 5CEJA 1DHRA 4HFMA 2Y1CA 1IULA 4B3JA 2GN6A 4JX8A 4PG6A 1IOLA 2R2GA 4E2YA 3AK4A 4RZIA 3EZYA 1Q7CA 5AVOA 3PHJA 3OFSA 3TJRA 1ZJYA 3ZGYA 2ZB4A 2OFPA 1X7DA 4GKVA 4O1MA 2DAPA 1OZAA 4RPHA 4EI2A 1MUUA 3ZWVA 4WOKA 4XJTA 1N92A 2X86A 2F1KA 3PGJA 3W4IA 1WW8A 3FR7A 4DUPA 1M6HA 3I23A 1B3BA 3QSGA 5ES3A 4LN1A 3ST7A 5K9ZA 3W8FA 4CMGA 3AY6A 3JYQA 4RF4A 2Z1MA 4H16A 2BHLA 1GUFA 2YQ4A 2IZ0A 4RPLA 5L4LA 4YT4A 5JYAA 3JQ6A 3ON5A 4TVOA 4BNJA 3K9QO 2C0CA 2UVDA 1K2WA 2HMUA 3GGGA 3TSCA 5JW6A 1U4SA 2B37A 9LDTA 1P9LA 3KUXA 4N7RA 5JBIA 1A7KA 3DMYA 4IDBA 3M2PA 1ZXLA 3QQPA 2FHSA 1MXHA 4EUFA 5DBFA 4Z0HO 4U5QA 1G1AA 3ETEA 3AU8A 4KDEA 4L74A 3U4DA 1QKIA 4G65A 1LLQA 1ZKMA 4CQLB 2DBZA 3PK0A 3ZWMA 3PYXA 5TLSA 1PS9A 2WE8A 4BNLA 3JYNA 4BNKA 4D46A 1P1FA 3BIOA 2VWHA 3FPCA 4DYDA 5ENVA 4MJLA 5IJZA 2ZJ1A 3WBFA 4IXTA 2HK8A 2B4RO 3AOEA 3C7DB 3GEMA 4DWVA 4RQTA 4YT8A 3PFWO 1I33A 4PLPA 1UXKA 4IIUA 3GQVA 2X22A 4LW8A 4Z9XA 2GGSA 3UH1A 3TOZA 2CVOA 1AHHA 2D3TA 4MIEA 1DAOA 1A4IA 3IIEA 1GAEO 1W4ZA 2O23A 3KVOA 1X13A 1SZJG 1ADBA 5I7EA 4UAGA 4DLLA 2I9PA 1T2FA 4YAIA 3RFXA 4YEDA 1Z6ZA 3H4VA 4QSMA 4W6ZA 3ZU4A 3PWSA 4W9NC 2EERA 4FFRA 4BO4A 5F5NA 1TXGA 4FBGA 1DC4A 1DDOA 4IDGA 3KSDO 3I1JA 2X0NA 3DZKA 3GMSA 4Y9DA 4GLLA 1O5IA 4OKIA 4Q3EA 3RSHA 3A28A 4KWHA 4E6PA 5I7VA 3Q2KA 4FN4A 4NIMA 3QV1A 2DTEA 3OA0A 3K96A 4RORA 1VSVA 1YB4A 4ITUA 3UFXA 4DRYA 4F6LA 1AN9A 1QV6A 2R00C 3L77A 1PR3A 3EHEA 4W9NA 1E3IA 1PWZA 3PEFA 1DC3A 3HWRA 1Y8QA 1ONNA 2FMUA 4E21A 1HYGA 4P4GA 2DQ4A 4BNNA 1VL6A 2OMEA 4BVAA 3B1JA 4JJGA 4AJEA 1M6WA 1YJ8A 4NJMA 4IJVA 4CM6A 3NGLA 4Q3DA 5A1TA 4YJDA 3DBHA 4DA9A 4JBIA 2BFPA 4W99A 2D4AA 4UEOA 4PVDA 1N7HA 1C0LA 2R00A 3PGXA 3T7EA 2H1SA 1N7GA 3U5TA 4I5EA 4NNJA 4BNXA 3SEFA 1DIGA 1YGYA 3KO8A 5T5QA 5ER6A 5CDSA 2EWMA 1G6KA 1EVIA 3TNLA 4JN6B 2ZYAA 1AHIA 3DTTA 3QVXA 4Z0TA 2E48A 3W6ZA 2JD2A 3NT2A 4YVFA 2C07A 3NRCA 4AJ1A 1HSOA 3W4JA 3KZVA 4R01A 5KJEA 4M8SA 2XXJA 3VDQA 3WYCA 3PJGA 4MOWA 1IUKA 1B8PA 2UUOA 1LLDA 1V3UA 1Y9AA 1NNUA 3ZZNA 3ZWOA 1Y8RB 1HDRA 1JKJA 3ANLA 3FNEA 4Q3NA 3U4CA 3DFZA 2OUIA 4RF3A 4K9DA 3GT0A 2GZ1A 3VZRA 1P3DA 4JROA 3MEQA 3LC1O 1Q7BA 1ZK3A 4QT0A 3S2IA 4HP8A 3ZWXA 1SCUA 2IDZA 3UCEA 3FWZA 3LZ6A 4JP3A 4BB5A 1HRDA 2UAGA 3B70A 2D59A 2NTNA 3RU7A 2J5RA 4A2CA 3TN7A 2VHZA 4YXFA 4GVXA 2CDCA 1KEPA 1ADCA 3RWBA 2O3TA 4XB1A 2PKQO 3H5RA 4NDNE 3S8MA 5JCXA 1H6BA 2OBYA 2X0JA 3NUGA 3KXDA 4OXYA 4UUOA 3EDMA 3W6UA 3QJ5A 3CH6A 5A3JA 5ILGA 5BQFA 1XU9A 3ZN2A 3BMNA 2ZKLA 1A27A 4WJZA 3WX0A 1BTOA 3P2OA 5F1OA 4JQCA 4QX6A 1P33A 1D7OA 2DFDA 3DZIA 3R1IA 4WLVA 4RLHA 2OXIA 4N5MA 3JQGB 4UVEA 2HDHA 3HDYA 2ZCVA 1PJ4A 1KC3A 3ULKA 4KMSA 4XDYA 1NWHA 1YE3A 3TZCA 5G4LA 1XWFA 1LSOA 4ONEA 5HRUA 1KVUA 2W2LD 5T73A 1H9AA 5TJHA 1V0JA 3WLEA 2WD7A 1FMCA 3GDOA 1W0CA 3WIEA 3LC2O 3ITKA 3D3WB 2FPIA 2OOSA 3GN2A 5GZ3A 1KVSA 3NAQA 1J5PA 2EJVA 1WDLA 2EW8A 3OQBA 3RC7A 1PJ2A 1ORRA 4CV1A 1MC4A 1ZMOA 3AM3A 4B4UA 1LLUA 4CLRA 3ZWPA 1B15A 1PJCA 4YJGA 4J1SA 4XGKA 4J90A 1LUAA 4BQRA 1GD1O 4TRRA 1DC6A 4D42A 4GBJA 1B7GO 3KETA 3WFJA 2BELA 4ZHSA 4B4OA 2PA3A 2O3QA 3ZWAA 1XELA 2HQ1A 3NJ8A 4R9SA 3GA0A 5IZ4A 1I8TA 1XEAA 3IKTA 2X9VA 3H65A 2C7VA 1K6IA 4R4JA 5THKA 1ISJA 2VHVA 5IXSA 2AQ8A 1LRJA 2C5EA 4H3VA 2GO1A 4DQUA 1GEEA 5TC4A 2PLAA 1N9GB 4E5KA 1JWAB 1RM4A 1N5DA 1WP4A 1GZ4A 5TGDA 1CDOA 4FGSA 2DBQA 2W2KB 2LDBA 4WLFA 3WQSB 1SO8A 1LA2A 1GEGA 3MOGA 4EW6A 3UOGA 2POQX 4WE3A 4AJIA 3PI7A 5FFFA 3V1TC 4J2OA 1GPDG 4AJ2A 3INGA 1B26A 3VH3A 1ZIDA 5A04A 1SC6A 3DAGA 3PHLA 1ULUA 4Q39A 2QIOA 4NU6A 4FJ1A 3UUWA 4NBRA 1DC5A 3G0OA 3CXRA 4IJUA 3DWFA 1Q7GA 2UUPA 3KYDB 2HSDA 5FF9A 1GQQA 4R1SA 3EGOA 5COBA 3WTCA 3GAZA 2GD1O 3ICCA 3GLQA 3IL2A 3R3JA 1H5QA 3RUHA 1N2SA 1PL8A 1B14A 3A4VA 3JQAD 5EESA 1TB4A 4R1NA 3AJRA 3JTMA 3U4HA 4BV9A 4DC0A 1ADFA 1LDMA 4PG5A 1GUZA 4TRJA 1NX6A 2FR1A 1VPDA 4CQLA 4MVJE 2HRBA 4J9VA 1KVRA 1KC1A 3H7AA 3ZU5A 3VC7A 3FTNA 3EUWA 4CLXA 2NSDA 1W6UA 1HXHA 3RKUA 4YDRA 1GYRA 3WJ7A 2C82A 4DL9A
chains in the Genus database with same CATH superfamily
1O54A 4L08A 4ZYWA 1HDIA 3COPA 1M1ZA 4MKXA 3D02A 4D56A 3TECE 3M1IA 4NEGA 4F3RA 3WLQA 3TLKA 5ECDA 2HFKA 2PL1A 3SI7A 3H5NA 3TTUA 3B1ZA 1CJTC 1D1SA 2J0EA 4J0CA 5H7XA 2X3UA 4W82A 5G1NA 3P1JA 3OEYA 1FSGA 3KJNA 4OYHA 4LZJA 4CM7A 4E5SA 1GY8A 1CP3A 5AVVA 4HAXA 4EBBA 1JMKC 4HD8A 4URVR 3JPWA 4ZGBA 2VKQA 4FKZA 1FNBA 3L46A 1NJSA 1WXHA 3P9IA 2WHEA 4JJZA 4PGFA 3KQMA 3O8QB 2XUAA 1E0JA 1YS9A 5JZVA 2C0PA 3L9WA 4NFYA 5REQA 3RIYA 3U3OA 3PUXA 1HZZA 2XA2A 5T6MA 4B80A 4RGVA 2JH3A 3T5MA 1M2OA 2VUHB 3H3FA 2YJZA 3LC0A 3VKVA 4AZ0A 3KQOA 2ZKIA 3A1UA 4EKNB 4B32A 1QANA 1U7WA 4N0PA 5DRTA 4DRXB 1NJ8A 1GDHA 1KK3A 3W6OA 5JT1A 2HJGA 1K5HA 3CVYA 1P61B 2BBOA 3AEZA 2O7RA 2QIPA 3MD0A 3TPFA 1SWVA 1PG2A 3D6HA 4FYPA 1O9GA 3G8CA 2VYQA 2H63A 3IVGA 5LZ5A 3ZK7A 3MMXA 2ZRHA 4W7HA 3QUBA 4JUCA 1VLHA 2V97A 3KYJB 4JQZA 2H00A 4DQKA 4EEXA 1QHNA 2XOXA 4ND5A 3S99A 1TPZA 4K3UA 3OI7A 4IUYA 2OBXA 4P0TA 3FUVA 4RIIA 3K0SA 4PHHA 2I2FA 3A2NA 4TYQA 1X7YB 2LV8A 2ZWVA 4G5HA 4KGZA 2FRDA 3UAXA 1FVHA 2ZYDA 3A3YA 4F91B 2UXCB 3FCAA 4HDMA 4BYMA 2B2NA 1LNZA 2XNDA 3RYFB 1ABBA 4CF4A 3C24A 1DWUA 4OIMA 4FDTA 3IE1A 1GQYA 4W1QA 2WINI 3KALA 2KE5A 3GLUA 3NLLA 2P3OA 3UAYA 4GNRA 2QTWB 4O4LB 2IYNA 3GLVA 4JK3A 3TRHA 1ZVJA 3MBKA 4KFTA 1PIWA 2QRPA 5F35A 5CA1B 3MVEA 3IO3A 1RJ9A 3N74A 1S8AA 5BNWA 1E89A 1NVWQ 2I6GA 2EW1A 2PJUA 1VG9B 5EWLB 1E9DA 3TTTA 3NHJA 2N75A 4RETA 1FDUA 1H3NA 4R9NA 4ON9A 1JHMA 1RKUA 3I5MA 3OZIA 5C34B 3DM9B 2WJWA 3MGKA 2YWCA 1F9AA 4V3CA 3FMOB 2HBYA 5I5GA 2V65A 2I67A 1Y1KE 2BGUA 3W79A 2OAP1 1AM4D 4RUKA 1EVQA 5LBUA 2QXYA 4JODA 3NI2A 3G0CA 1PD0A 1OLXA 3ADDA 2BGJA 2FWPA 2BLLA 2JIRA 1KETA 1VIMA 2GSWA 3SJ7A 3R0IA 2ZYTX 4FHDA 4PLVA 3M3PA 2II6A 4M1WA 4MMXB 4JA2A 4RMHA 3M1LA 3L40A 1EFAA 2QORA 3TQIA 1PL6A 4LYFA 3H5AA 4LISA 4R16A 2NO0A 3NWOA 3BA6A 1VM6A 5EUBA 2J7PD 3K6SB 4DDUA 3FYHA 4X1KA 3EZ7A 4ZANA 5JS7A 1OPXA 3GP3A 4UTRA 3WICA 5CD1A 1FX0B 2C8VA 1S4MA 1V3TA 4P5DA 1JVSA 2C7GA 4QKQA 1IZZA 2VTBB 1ONOA 3C3AA 2C4TA 2A2ZA 3R6DA 2JS7A 2WOOA 3HFGA 3TKLA 4FHGA 4TUYA 4UEKA 3IH5A 1LFAA 3G0GA 4BB0A 2UZ4A 1HM5A 1FU4A 1MA0A 3OFKA 2GXSA 5EMMA 5KWSA 3ZEIA 4LYYA 2XNCA 2YIJA 4JOQA 5E95A 1H5NA 1NURA 1RYEA 2H1VA 4ZARA 1WHSB 3TD9A 1ULAA 2BVNA 5DK4A 1BZYA 1MFZA 3LPMA 1XCPA 1ZK2A 5BWBA 3MW8A 5KU1A 2B4QA 3WGKA 1UEIA 5MF6A 4WLOA 5PGMA 2GZ3A 1U0NA 1OZGA 2WU4A 4RENA 5AM5A 1TNDA 4J3NA 4ALMA 1JFVA 1EUZA 1MO5A 2VUUA 1VFPA 3QWIA 4GIBA 3M1YA 3HR7A 1SIOA 1PTJA 1L5MA 3ZWCA 3O4HA 5FBLB 4YPOA 1OKKA 3FG9A 2NOAA 2A9QA 1RE0A 4GRDA 4ZVUA 4NZ9A 5KNDA 3R4CA 2QLTA 3C3WA 2DC1A 3PQ4A 4HR7A 1DDIA 3B12A 3MJEA 4QU8A 5DN9A 4PG8A 4XZ3A 2D0PB 4FQ5A 4FQ8A 1T8TA 1O8CA 4GL4A 4JYMA 2QL5A 1KOLA 4D7AA 2B8WA 1AQYA 4R68A 4BX2A 4KIUA 1FU7A 1JA9A 3AH8A 4X6XA 4XIIA 1ZH0A 2FQ1A 2H29A 2VPZA 3SCZA 3WK7A 4CG3A 4AUMA 2F90A 2H07A 2C2GA 1NQAO 3QYPA 1QV9A 4BO5A 1G59A 2HWKA 4ZOBA 4NABA 2AZ4A 3A14A 4L5IA 3U2QA 4DADA 1X0VA 4WD3A 3BCSA 4S04A 2FY8A 1CW2B 1YVRA 1H0SA 2YWDA 5IDQA 2BRUA 2CMDA 4DMRA 1Z22A 4LQCA 2JD1A 5JR3A 3KYIB 1EXVA 3THYB 2H48A 2XOKD 3L0SA 1VJDA 3FM9A 3EF0A 2GETA 1JB9A 3CX6A 4H6WA 5EWJA 5AIAA 1Z0ZA 4NPAA 4J9UE 1G20B 4PX5A 4JI6B 1OTXA 2C59A 3MWYW 1DXYA 3A4IA 3VC3A 4CTJA 1M34E 2VBIA 2V0CA 3H9CA 3SF8B 4KDCA 4OQYA 2B9VA 4MDHA 4R2WA 4WESB 2HWWA 1VLVA 2H1WA 5B3KA 1R6VA 4BQEA 3UMRA 1DKOA 5IAAA 3K53A 3B1VA 1Z08A 4S3MA 1KFCB 5FPPA 3QEMB 1N7JA 1N9GA 3GJ5A 3ODPA 2Y0BA 1YE5A 4J4HA 1XR3A 1KK2A 4MZDA 2DBYA 4JYZA 2OCXA 2ZIGA 1CQPA 1XRMA 3GNQA 1UDWA 4UHBA 1KRXA 1XZBA 4MVJM 1JHYA 2EP7A 1Z0IA 4R8KA 2RG1A 3QLUC 4DJEC 3C15C 1XTPA 3MT0A 5EHXA 1P7WA 5KINB 1TKRA 5FWDA 3C3MA 5BSRA 3O74A 3WL8A 5AI4A 4CL8A 1H2XA 2FPLA 3NQ41 2A33A 2V9CA 1I01A 4WL0A 1PT5A 2C2KA 2H6EA 1QYCA 5KTNA 2ZWOA 4TXJA 2OCGA 5DVZA 4WQMA 3IBGA 3ESYA 1RACA 3T7RA 2CC2A 3BWCA 3VR2D 3HXTA 3ED5A 4DLPA 3RAEC 1OD6A 1X0XA 2LP4Y 4C6HA 5G0UA 3HDQA 2BKXA 2PZ8A 3KLOA 3IHWA 2FA9A 2Y1OA 4UNNA 2IH2A 2OHHA 1RM5A 2YWGA 3B78A 4RM2A 3D8TA 5LLTA 3LDFA 3ECAA 3LO5A 4MW6A 3IWBB 3BRCA 4F0JA 4I8IA 5EIAA 3ZQJA 1DVRA 3BRQA 1YKSA 4ZYTA 4TYYA 3HYCA 3IFSA 4V1CB 3BFVA 4KRGA 1RVV1 3EA4A 4G25A 1GFZA 2PWPA 4ZTBA 3S1SA 1YBMA 1LNQA 2YYAA 5KX5F 1JBKA 4KI0A 2WDZA 1SBCA 1HF3A 4LIPD 5AYVA 1QLHA 3OZDA 2B3DA 1QPZA 3HWX1 2DKOA 2P3LA 4RC9A 2QYSA 5BOSB 1HOXA 3KVYA 1VIAA 2ZIWB 3G2PA 1U0EA 1NTOA 4GC9A 4D25A 3SX2A 4KLRA 4NICA 1JIKA 4J6FA 4MINA 4DIMA 1MB0A 2JFWA 5HPYB 1D1PA 4EK9A 5LIRA 2D1YA 1LZKA 2O5VA 2QN7A 2V58A 2X2PA 1CZHA 3A6KA 2W98A 3I2KA 5LLSA 4ZDKA 2ZRNA 3CZ4A 3KKMA 4DPKA 1C0PA 1QHXA 1W88A 3BULA 4N03A 3ZXUB 2COEA 3SEAA 5L3QB 4DA4A 3EQ2A 5CP8A 1T4CA 1NUQA 3H05A 5DB4A 4KITB 1XLUA 4W5RA 1GCGA 3I5YA 3GRPA 1L8AA 1PJ8A 4PZEA 2LBPA 2NT4A 3C7KA 3IUBA 2DUUA 3O4GA 1R37A 4LC0A 6NULA 2QRQA 3AKEA 1H8HA 1W30A 4DHWA 3PXEA 5M3BA 1CY1A 1F0NA 3AG6A 2WWWA 1Z34A 3L1IA 1U6IA 3FWNA 4MP8A 4O2LA 1AUPA 5T64A 3UXHA 7YASA 3WA7A 5J1TB 4JI0B 3H1TA 3MUEA 5BW4A 1X7ZB 5LNK1 1Y8CA 5CCDA 2AEEA 3N5CA 4QOIA 4FU0A 1Y48E 1FXSA 1IPHA 3CZ9A 5DCYA 3ZQ6A 2PUAA 3AESA 4RE6A 4E51A 1FTYA 1KQOA 1F6DA 3FE2A 3ND8A 1H1LA 3PNSA 3A2LA 2OO3A 3GP8A 3TXYA 5DWDA 4ZU1X 4EGJA 2EJCA 3LBFA 4TQUS 3UZUA 2R7KA 5GIPE 1AK1A 5U4QA 3PNOA 3RU2A 3HKBB 4BN5A 1YGPA 2IYEA 5K4HA 4L15A 1A96A 3WKEA 3LE8A 1P4JA 1K66A 1WXIA 3JAMA 3R3ZA 4YDQA 5CR9A 2JAPA 2PK3A 1G2OA 3T3NA 1GGEA 1HLGA 4EFNA 2H1CA 4CMAA 1IBLB 3ZJVA 4J4BA 1ODIA 1N8SA 1WB9A 1YMVA 4GPZA 2PD3A 2Q3JA 3HJHA 3JR3A 2PX5A 4G5XA 4K9MA 1G5HA 3AI1A 4RYLA 4MR9B 3GJYA 1W4CA 4D0SA 4D96A 5KMGB 1IIRA 2CLFB 4UD2A 1NZDA 1E3DA 3KKEA 1IRIA 1BMFD 4NULA 4O4JF 5IAEA 4BAZA 3VR4A 2Z43A 1P60A 1IMOA 3Q2OA 1MPTA 1FUUA 2VQSA 1UKBA 1R5NA 3C6MA 3IOCA 3KEMA 4NOJA 1CX9B 3SLGA 4DR3B 2RAVA 2BE9A 5EZYB 1JX6A 4QUKA 1KBZA 2LIVA 1Z5GA 1U31A 4FW9A 2R6AA 5CFOA 4RSHA 1R0ZA 3K72B 2AXQA 4UJ3A 3CLUD 2I34A 2OBMA 1E79D 2QG6A 4KXMA 3H99A 1GTVA 4M9QA 3BMCA 3ZLUA 5A5EA 3HB1A 1HDOA 3GMDA 2ZWPA 4EA6A 3ORFA 2CK3D 2EFYA 3FNQA 1P3Y1 2GF2A 4IDPA 1O94D 4JLNA 5P8WA 2ATCA 2I2AA 3B1KA 1BKSB 3RWOA 4HN2A 5IVPA 4L73A 4RA9B 1E7MA 1DV1A 4LC1A 5KJFA 3EFOA 4F5ZA 4NZNA 5CT6A 2WUWE 4ALNA 3VR0A 4IIEA 3WQRA 4CLEA 3U1TA 1WPRA 5KTSA 2AGVA 2YW2A 1TPYA 3EYWA 4IYJA 4EATA 1LDBA 5L45A 4HRXA 2OUKA 4MXDA 4CTNA 4GYYA 4NK5A 2C84A 3VSCA 1SZCA 3QF4B 7REQB 3X1ZA 1LI7A 3QTTA 4P4LA 2NU9B 2ZI5A 5FULA 1Y5NA 2DF8A 4C7MA 1J0EA 2RGBA 2YWBA 5BY2A 5E8JA 3ZCUA 2FP4B 3H2BA 5DYGA 3UOWA 2QVZX 1MD9A 1QG0A 1YB1A 3HCDA 1CBUA 1J1ZA 2DFKB 3R20A 5KQGA 3T5PA 4OQEA 3ZHVA 1WKBA 1QCZA 2FE4A 3D0KA 5KWVA 2B8NA 3W5BA 4KXLA 4YGXB 3S5UA 4BCBA 1I3MA 2ZUWA 1SVIA 2F1IA 3JD3A 4HQNA 4HUQA 1BOOA 1EUCB 3FVQA 1NBAA 2REOA 1L7VC 3DEFA 3ETDA 2ZTUA 5C7IO 3OZWA 1KYYA 4K26A 4OK6A 2VYNA 4K9PA 1WCV1 3LX4A 4CKBA 5C32A 3QGMA 3AM1A 2PH5A 3CX4A 3LFTA 4EPWA 1HE3A 2QUBA 5IDXA 3MD9A 3IMFA 4I7EA 3O4IA 1YZFA 3IP6A 4INAA 4YP6A 2VUIB 2ZSFA 3LZDA 3BS4A 1TMGE 3PCXA 3ZK8A 4A7PA 2W6OA 2CXSA 2DQZA 4KO3S 4N82A 4UTPA 4ZCMA 3PEEA 1HSZA 3W2GA 1I14A 2VPQA 1FDTA 3IDSA 2H7VA 3MB5A 3ROFA 1GLNA 1AKWA 1II0A 2OOKA 2RIRA 1F6BA 3RC2A 3AP2A 2O5RA 2X5KO 1E3EA 2Z1DA 3VQTA 1SQ5A 2NU6A 2QZSA 4G07A 4QT4A 1RZRA 1RAAA 2AQIA 1H0RA 2WNSA 3O1HB 4ACAA 4DBZA 4YLGA 5A0VA 1JMVA 1M34A 4MP3A 1POWA 1UK9A 3VYSB 3OE7D 1I4EB 1PQWA 1RQXA 4DMKA 1MVNA 1G8KA 3AY3A 4CL3A 3TL2A 1UJ2A 3HVJA 2GYVA 2IZ5A 4H1HA 4MUXA 1W93A 4TYWA 5A4KA 4DUYB 4LBVA 5HCNA 1IQ0A 2Y76A 3VYUB 1HT2E 1U7TA 4RAQA 1ZIYA 3GQBB 4HOYA 3KT3A 4B6QA 1YS1X 3PL5A 3OCCA 2R6DA 4O3MA 1U3WA 3K1AB 1U02A 2TMDA 4PS1A 4D0NA 5I9LA 4KIFA 3FLBA 5M6DA 3DZFA 3DZ5B 1YXMA 2BCJQ 4LDRA 1EK2A 2ZBUA 1WDWB 4CKZA 1OH5A 1MZVA 5DM1A 3UJCA 3EPRA 3LQFA 1GYQA 2Q2WA 3ZGOA 1EQ2A 2J9FB 3MN1A 4NL4H 1G3RA 1TQ2A 2O7NA 2IV3A 3SFTA 3ZLBA 5CFNA 4BNMA 1RLMA 4BNYA 5CRIA 1X7GA 2XQGA 4A0RA 3FAZA 5CFPA 3LPLA 5F33A 1YIOA 3SHQA 1D4OA 1VZ2A 1Z56C 2AHOA 3CO5A 3H86A 1O7JA 3RR2A 3SY8A 3VPFA 1K7XB 2V7BA 1Y1LA 7GPBA 4LNHA 3LVBA 5D7NA 2XLCA 3FCOA 4HJXA 2QJFA 5CVDA 5FBHA 3KCQA 4BGVA 1ZD3A 3GBVA 4CMCA 4Z7NB 3VSEA 1VL8A 4LMBA 1J00A 2C8KA 3OAAD 3GNTA 3OJEA 4EFLA 4EPVA 5LQUA 1H9BA 2RK4A 3EG5A 1Y9ZA 4BO0A 3GZTB 2YZ7A 4HWSA 2FSIA 2J3JA 3MJTA 3NYWA 1EFUA 1KI9A 3ZVLA 1EBFA 4AULA 3N9IA 1NMEA 2QMQA 2IL1A 1CUEA 4Q9NA 1JTFA 3QVSA 3RJ9A 3ZD9A 4JP1A 1UPBA 3BE8A 3FAKA 4ZVNA 2HZ7A 1KQFA 3BGIA 1T3ZA 3SZRA 4BX8A 4GBED 1AS3A 1I9GA 2QU8A 3IT0A 2G40A 5C80A 1ENZA 4NI5A 3UANA 1HFKA 2QRUA 1QO9A 3HYLA 1WSWA 3CE6A 3F6YA 4EDFA 1OI4A 4YTEA 5C53B 4BGUA 4DR6B 1VG0B 3BH0A 3HDJA 4UNQA 4ZTUB 4DOMA 2PX8A 4LOKA 2ZSIA 1EZZA 2OV6A 3BTUA 4M99A 3H1PA 4KJZA 3L8HA 3FNGA 3SBXA 3A6JA 2IEYA 1L5NA 4FE7A 1ZNYA 3KVVA 4H2DA 5IFKA 3ZGLA 3VR3D 3KKNA 1TDJA 3LCVB 2GZRA 3FN4A 3Q6MA 1F2UB 2OHIA 2XLBA 3QQ5A 3THRA 4HAYA 1JALA 4X8MA 4HAVA 2XB8A 1RLOA 2O2DA 5EHNA 1M2JA 2G04A 3UG7A 3UMGA 3PJRA 4YHBA 3G2KA 3LECA 4EG7A 3V8EA 4ZVVA 2JGDB 1K3UB 3BE6A 4EWLA 4OHMA 5TGTA 1I5OA 3SWWA 4TMYA 3RPEA 2V4UA 3BD7A 5INTA 5KSYA 4GP7A 4IHJA 1ACMA 4O4LF 4MAFA 3VR1A 4X91A 4N18A 1Z15A 3PRHA 5AQ1A 4PZ9A 2ZSAA 2YMLA 3I9KA 5CA1F 3LK7A 1Z5UA 1UFRA 3HFSA 3OSUA 2BI7A 1TEZA 2PJZA 1AS0A 2YVQA 1YB2A 3AHHA 1K6MA 2FN4A 1NI4A 2CL5A 1HE8B 5AOBA 3SFZA 3IX7A 2QL6A 1E2IA 2H0AA 4KWIA 2R7NA 4G5SA 1GGJA 3IEPA 2CFCA 1C30B 3I05A 1NVFA 3A1NA 5HQ3B 2Q6TA 4K0RA 2X5JO 1IAVA 1PSWA 1RQNA 1CF4A 1SVLA 4J0GA 2O2XA 4GPEA 1IYZA 1MF7A 1T3HA 1B73A 1LZLA 5K20A 4OMUA 1ZW6A 3QMVA 4QYIA 1O5TA 1Z7WA 3KUKA 4XYGA 5B37A 1XJWA 4EG3A 1O97C 5T3YA 4C5CA 3JVEA 4B4KA 1OXUA 1UDAA 2WZBA 1FRQA 3TS1A 3U0VA 3ICPA 3AVUA 1OPRA 3KKQA 4GXNA 5E6SB 1PQ4A 1DU4A 4A0SA 4NQZA 4PYNA 3V97A 3D6VA 3V46A 1C9JA 2FAXA 1QZTA 1ESMA 2W48A 4ZDWA 1KPHA 3K73O 1EGHA 2E0IA 4G2NA 2NSYA 5AVSA 3DEHA 2BGGA 1BCRB 4NPCA 3RSZA 1E9FA 3TPCA 4OK5A 4DILA 1A7AA 1QFXA 3G8YA 2R1ZA 3WLTA 2AC4A 1EWYA 2H18A 2X7JA 2IYAA 2XCTB 3I0NA 4Q7KA 4BNUA 1U3TA 2H08A 3TJMA 2ZS7A 1GSAA 2C4HA 3UCFA 1ECLA 2BCEA 2VT2A 3UGTA 1ISFA 1E6LA 4BX3A 2ZCUA 1C4KA 3DG9A 3PSAA 3UK6A 1L7QA 4MDFA 2P77A 2PZGA 2GAIA 2QF7A 4PU0A 3H5VA 5JSKA 5DI3B 4R7GA 2O2IA 5B7NA 3Q0IA 4EO4A 1VG8A 1WLSA 2QGFA 5L51A 1P0QA 5J2TA 2KHZA 4KAFA 4E0BA 2FPNA 1PJSA 2LTAA 1GRRA 4K05A 4POAA 2HGSA 4RFSB 1L5ZA 1P31A 1LXCA 2IY7A 2PL3A 1VHQA 3AETB 1P44A 3ECCA 1NMQA 4B74A 1FQWA 1BDMA 1L7MA 2A5FA 2I7CA 3KSRA 1E9CA 1G18A 5JE8A 1KY5A 4XX1A 1DI0A 3JQ8B 3MQ2A 3AJDA 1LDGA 4RLQA 4E13A 1C8LA 3FCEA 3G0BA 3KLPX 4J43A 3NRJA 5CA0F 1XGKA 1XLTA 5DPMA 3FGNA 2J4DA 1QVRA 3DMFA 1EJ6A 4MGEA 4GYJA 2PUTA 2Q1XA 3R7WB 2CV1A 1JLHA 2ZRPA 2C61A 3GROA 2KSQA 2GARA 5FTLA 1E1QD 5DYYA 5JRJA 5A7HA 2YJ6A 3W3AH 4ER5A 3E84A 4JIGA 1XK6A 2QAGB 2UVPB 4YT4A 1H1DA 4WI1A 2O07A 5B4TA 1Y89A 5BT8A 1HOTA 2H2DA 2O8EA 1DRVA 1XZLA 1GO2A 4WA8A 5JCPA 1KIMA 3ZH9B 1JT9A 3EVZA 3G0HA 4F3TA 3LT1A 1MN6A 1KKMA 4ODIA 4JP8A 3DP9A 3ZXIA 3C5VA 4ESHA 1X39A 3WGNA 5CBKA 3DV0B 3IDFA 4OQXA 3GJTA 1KYXA 3TMAA 1SUAA 2P78A 3ABZA 4PGHA 5EEGA 4IJ5A 5C37A 2XCRB 4HFRA 2VRCD 5FHRA 1WKCA 1SUPA 2ID9A 3LYHA 2EJBA 5LBIA 2HXSA 1ZRHA 1NU6A 4JXXA 2C03A 2P0EA 2QA5A 5JIBA 2B2XA 4JI4B 4KUGA 4BVKA 4C0AC 4GUAA 5LMCA 3H2IA 4R84A 4XD7D 1NOKA 4AQDA 2HCBA 5H83A 2JHAA 4ZRMA 5B53A 1XA0A 1EZ1A 1J0CA 2RMKA 5NLLA 2G4VA 2GHTA 1IJEA 3CLRC 3PE4A 5DX8A 4KK3A 4IX9A 1MP0A 1G3MA 2V3CC 3TD2A 2O20A 2R8BA 3S6JA 2QE7A 4A8TA 5ALWA 2YHBA 2EG9A 4G8DA 3INNA 3R8FA 1QH8B 1CYDA 1C9MA 3OU6A 4HEA1 1UKYA 3G5MA 3L92A 4GE3A 1MAWA 5C51B 3TZEA 4MKZA 4MQUA 2FPUA 4B3SB 4F86A 3C3YA 3LX5A 5EIEA 2ANCA 4Y18A 1N5RA 4I08A 4YACA 1LF5A 4U2GA 3BYZA 2JHFA 2AI1A 3AXTA 3FJYA 3TOVA 3G0DA 4MRMA 4GRAA 4O1IA 4Q3AA 3TEJA 1YL7A 4WY5A 2JCYA 5JJIA 2WKWA 2ZITA 1JU4A 1KIFA 4QUJA 2E9SA 2XGOA 3WYAA 2Q5JA 5A9RA 4G01B 4RQAA 3P0EA 1CZUA 1OW3B 1WY7A 5JMTA 2ZUEA 2C97A 2Y67A 3FUWA 4ZAWA 3ZWBA 5ALYA 5B30A 1KZGB 1X9IA 3BIJA 3H2ZA 4RGBA 2WYOA 1EE9A 3BXXA 3K6JA 2A0FA 3SQWA 4Q1DA 4EJ0A 3B7PA 1SAYA 1Z4PX 1XZ8A 4OBEA 5BSVA 4RM3A 3A6LA 3HR4A 3IURA 4MCAA 5K3EA 3P0JA 5KJ6A 1I13A 3NBKA 1R8XA 2C3YA 2IXEA 4INOA 4YJKA 4QPZA 3ZJUA 4QVKA 4C22A 1F0YA 2OBBA 4O25A 3FETA 1ZM4A 2QTAA 2RH8A 4KCGA 1Q44A 1DOHA 3DNPA 1SUDA 3D3KA 5K3DA 2BTQA 3LFUA 5BWNA 4URZR 1QVAA 1HORA 3KT0A 3N2KB 4XA8A 2PSJA 3DLCA 2J3KA 2C9DA 1TQ6A 2PLNA 5D5HA 3RSQA 1NQVA 1M6YA 2OK8A 4OYRA 3P2IA 1IN8A 4AROA 4DV6B 3BERA 1W4BA 2W6ZA 1FXWF 3D1LA 5CBPB 4WJKB 2P9YA 4J29A 1QKKA 2GO7A 2FOLA 4RQBA 1KEVA 2VJKA 3RVDA 1JHXA 4XQ9A 2MSLA 3F8TA 4GQBA 4NYIR 2R5FA 4M0EA 4PAWA 3WTBA 3M1AA 1JSLA 1LJUA 1POXA 2MMCA 5I9SA 1OTHA 4ZD6A 1UBGA 1Q15A 1VB3A 2RH4A 2X23A 5ALFA 1UF9A 2I6UA 2Q62A 4A6EA 3BK2A 3DQQA 4HQ0A 5I8WA 4JYCA 1EWVA 2R97A 1PWEA 2ZBEA 3QLTA 3TBFA 3QSYA 2RHWA 3HJTA 4J0QA 4ND1A 3THWA 2VJCA 3L1VA 2B5OA 1TGVA 3P32A 4ABTA 3I6QA 1EWRA 4YRRA 1VJ0A 2BMAA 4ZREA 3A9RA 2CWDA 2WW8A 1H1TA 2JASA 1ZH2A 3D4IA 3M33A 1T2AA 3W7BA 1UUFA 1TQ4A 4EW2A 2ZJOA 2UDPA 3H6GA 1QZZA 1SCKA 1Y7LA 4TS9A 5JCZA 4NFHA 5L7WA 3GLSA 1DTEA 2JHPA 3W5UA 4C6SA 4L4RA 5F9FA 2X0RA 2QT1A 2FVYA 2JFNA 4P82A 4WPGA 1F20A 1BDHA 3LA8A 3OA2A 4R3NA 4M49A 1XAIA 2D74A 5F73A 1TT5A 3L8FA 1T24A 3OCXA 1MEOA 3OKAA 5ED0A 5GV7A 4BCCA 4C1NA 3OF2A 1AKUA 4MULA 2QW1A 4OHFA 3M6MD 5TS3A 3ZDCA 1BD4A 2W9XA 1G7TA 2CV0A 5IM5A 1XZDA 4A73A 2Z4RA 4AJ4A 2VT3A 2QJRA 3C3BA 3DOOA 5L6MB 1F51E 3GW8A 3A27A 3B3AA 1H65A 1UWVA 1B8VA 3ANXA 2YV3A 4OQMA 4A2QA 4RWEA 3TLMA 2Q5LA 3QPAA 3OQNA 1QV7A 1KI8A 3G2LA 4XX0A 5EZYF 1QHYA 3PQ5A 3NIWA 1E3WB 2XMPA 3A25A 3PFHA 3V8MA 4N9QA 4B73A 1BX1A 1F8XA 3CPEA 2BV3A 2A5YB 5FAXA 1HYBA 4EITA 2SCUA 1THMA 2VCEA 2E49A 4ETMA 5CDHA 5LKRA 1CCWA 2XDQA 1C7IA 1U8EA 4LZNA 1UH5A 4UTOA 2C8JA 1RVDA 3GLKA 1G7RA 3OY7A 1UAGA 3GB9A 1G7SA 4Y9RA 1HT3A 2WM2A 1PR6A 2A94A 2YXDA 3R3UA 1ZWKA 4FGWA 4FS8A 1PQUA 5GPBA 3RYHA 3WVNA 5JQGA 1J5EB 3W77A 4BBZA 1PNOA 2GNPA 2VZEA 3GY0A 4PAQA 4DCGA 3PQ6A 4DBLE 4OJYA 2YW9A 3S3TA 1OZ0A 3AWDA 5H5JA 5A4AA 3SSAA 2ZIXB 1XJQA 2AF4C 3QUSA 2XD9A 1T6XA 3DXXA 1NBOA 5B4VA 1WMBA 2G6TA 1CRLA 3CLSC 1NG1A 3NHSA 4MV9A 2ZCJA 2MOKA 2EFCB 1NVEA 3HDTA 5ALTA 2ZRCA 3GPDG 2BUBA 2NXCA 4JR0A 3N39C 2BGWA 2P91A 5JH7F 5LU9A 3GJ4A 2YVUA 1MQAA 5IVIA 2BFBB 1GGHA 3KAQA 3KZXA 1VPWA 4YNBA 1W0KA 4E1BA 5KBYA 4TRMA 4J16A 2J9ZB 4MA0A 1UXGA 1QHHA 1SQ0A 4EVQA 5DGCA 1EFTA 3HCPA 2NN3C 3Q41A 3TAUA 4D99A 2J87A 3Q5GA 2PU5A 1J2EA 3G9QA 3QTBA 3AF3A 5AKHA 1BW9B 1YRBA 2GB4A 2VRNA 4CCWA 3B52X 3DV9A 4QTUB 2QL9A 3TBHA 3VOAA 2P30A 3W2TA 3GLGB 4RCVA 3AB3A 1I3OA 2WR8A 4EI9A 4KRFA 4G0ZA 1O95A 1XQ6A 4X0EA 3UT6A 2UYCA 4IH9A 3GI1A 1EEXB 3LRXA 2PKCA 2P68A 1PG0A 3BGDA 4XIJA 3MUNA 4BMZA 5EJ9A 1Z45A 1KO5A 3A0RB 2GNAA 1W25A 1E1CA 1J9EA 5FUVA 2FV8A 5AHRA 1TIKA 1JNYA 1P8AA 3IVMA 1SUCA 1YR1A 4CM1A 2QYTA 5FI3A 1YOVB 2O1EA 3D4PA 4AO6A 2EHJA 3KOMA 5H9VA 3RS5A 1G5PA 3UMSA 2C99A 4NDZA 1Q14A 2YWEA 3FPEA 1ZC4A 3PFFA 1ULSA 3RVNA 1FS5A 1RHKA 2NZJA 3ADBA 4YBZA 2WF6A 3U60B 2BHTA 3DCJA 2A1TR 4UE6A 3V4LA 2XUIA 3UK0A 4TVSA 2P90A 1BDIA 4DCJA 4A03A 1M8JA 3FSGD 2JBHA 3FI9A 5JQWA 9ABPA 1LSUA 1XXLA 1F3LA 2ZVDA 3LCRA 4FI3C 4LVOA 4S24A 3WJAA 2IEAA 1QS0A 3PHCA 2XGMA 1RWMA 4KZPA 4C4TA 3AGQA 2C5AA 4HDCA 2ZBVA 3ND5A 3DBIA 2IITA 4D80A 5L7TA 2A59A 2Z5LA 3O31A 1E7YA 4HBZA 1KZHA 2H4JA 3SX4A 1XD2A 3U81A 4GGPA 1OBFO 1AUXA 4FUTA 4RYDA 1I1NA 5ICEA 4NHOA 3ND7A 4CI9A 4HJRA 1JEQB 2YINC 1ANKA 1H3EA 1GTZA 1OHHD 3L6CA 3MJCA 3PLNA 4UBMA 3DBRB 4IVRA 3SHTA 1I3LA 4BMSA 2F6RA 2V5VA 3PTLA 3AVYA 3MJSA 3FPSA 1K3FA 2B1IA 3JWJA 4IFTA 4FLMA 5BQ5A 4IIVA 2G72A 1ENOA 2WUGA 1B8UA 2ASEA 3FDZB 3OKFA 1IZ7A 5EZSA 5CLIA 2FSFA 1FFXB 3STYA 4TKMA 5F1PA 4B6GA 1ODCA 1YQXA 2ZRAA 2WUVA 1Z62A 1KL7A 1W75A 1X19A 4J0IA 3WDSA 2DM6A 1NC3A 1LJ8A 1HFEL 4XPIA 2Q7OE 2O8BA 4BTVA 4GYWA 4BMXA 4Q6WA 2XADA 4MJ3A 2PGXA 4XGQA 5EJ8A 3DZ6B 1BWRA 2XE4A 1FP1D 1FTNA 1QUEA 2H11A 2XE7A 4FDLA 4KX5A 2E4ZA 5CPBA 5T6BA 2VIIA 1JH8A 4KPFC 3I09A 5DDIP 3K5HA 3F4BA 3MJVA 3D7SA 3B5IA 4PTLA 3ZI4A 2DPGA 4PBSA 4KTTE 1C1DA 2VOEA 2R5NA 3DUFA 2IZZA 4LRTB 2PD4A 1XWIA 1EAYA 2HA4A 2VWQA 3JARA 4KO4S 4QXMA 3RTBA 4NU5A 1PGJA 1KH2A 2AOUA 4M22A 5K3BA 5KIAA 2YIMA 1YCFA 2PUJA 3GH3A 1P2BA 2L82A 2QX8A 1MB4A 5EP4A 2UKDA 2CKDA 2JHCA 1NU8A 3LI2A 4L0CA 3CW8X 5LOVA 3S70A 3QKUA 2H1FA 3IT2A 1Z73A 1E69A 5TQJA 4Y9UA 2ZYRA 3DL2A 3VO1A 4BEVA 2VQEB 2Y92A 2FPGB 1OXBB 3V7UA 1D4AA 4HLUA 1OCEA 2PZJA 2RHGB 2NQ8A 3HACA 3I4CA 2VT6A 4JB0A 2OZLB 5TEVA 3IP1A 3K70B 3JRXA 5CCEA 2LGJA 4YJ2F 4DLKA 3DQZA 5HG0A 3PICA 1HE5A 2GVNA 1X1BA 1LDEA 3I01A 3FX2A 3JWEA 3B6JA 1WZIA 1SHJA 2PKEA 1RHRA 3ROGA 2VYVA 2OFFA 3RAJA 2HDNB 4MPDA 1VPVA 4KVZA 2NVWA 2YN2A 4NYJQ 3D7MA 4BZXA 2VNKA 4BB6A 1ZP6A 3P94A 1CE8B 1O08A 1P18A 2ZAGA 3E3LA 1NMSA 1FDIA 3GRCA 3FMIA 2BN4A 2QW0X 1EMDA 3TIFA 4JBNA 4Y6LA 2H4FA 1A8SA 1X3SA 4H31A 4QYSA 3U17A 1MJGA 2DLDA 4RV4A 2HCTA 4X5OA 4AZTA 4AJLA 4DREA 1ZD5A 2OORC 3STTA 1E0SA 2G7MC 1G41A 2IDMA 3HPRA 1GA6A 4H77A 3VHXB 5FH9A 3CEMA 1YL6A 2EKBA 5IXYA 4D6YA 1UQRA 3MFYA 3C3JA 1ZRNA 2M1XA 1CERA 4R9RA 4X54A 1B6GA 5DYNA 5ICCA 1HLDA 2CE7A 2OKGA 4MUHA 2YZKA 5FOXA 1PL0A 1K6JA 1WUIS 4AICA 4DUGD 2W0MA 3TW3A 4TQ9A 1E9RA 3K9BA 3NIGB 1N8TA 4IOLA 1YJQA 3VHLB 3OETA 4CKEA 4DIUA 1GADO 5I7OA 3MS4A 1FJHA 1OZFA 3I45A 4AY5A 4QJ4A 2E5LB 2JIQA 2J85A 4WASA 2GBIA 4YGYA 2D7DA 3M49A 3LY5A 3EQ7A 2XHZA 4L7VA 2JLYA 1R0YA 1UAAA 3SQXA 3N2YA 2NTYC 3ETJA 3UXYA 3H0VB 3PFIA 4IIFA 4U39A 2HB6A 2QDKA 3F6RA 3N7TA 4ZMBA 1BFUA 2ZYWX 3MSXA 3FKSD 2PY6A 1XALA 3ZCQA 3LDGA 4J0HA 3W9YA 4DR4B 3PNPA 1DS6A 4YAFA 4YO8A 4YYZA 3UJPA 4MQFA 1K8XB 3ZIUA 3QE4A 5BNIA 3HQ4O 1XDBA 2GHRA 4I1SA 3RIHA 3GLHA 5G1PA 2QPAA 4P6VF 3UBMA 3OZCA 5CGZA 1CUAA 1UBEA 1IL0A 1CY7A 2XZTA 5KPJA 1AK9A 2J7PA 3LY9A 4EEKA 7ABPA 3A0UA 4UTVA 2L69A 2Y0CA 4WZBA 3V6LA 3FHTA 2IPNA 1O96B 5JFGA 1U0JA 4FVTA 2QWXA 1Z6YA 4JLWA 5HE9A 4MHOA 2MMGA 1CJBA 2BC9A 2NUPA 2VDQB 3KZKA 4RZHA 4G56A 3GG9A 3PCTA 3PR1A 2HYDA 4IIJB 4V0MA 2C96A 2P4UA 4X7RA 5AVQA 1RWOA 3FNHA 3L6EA 4LQLA 4PZZA 5EC8A 1UMDA 1MVLA 1G60A 3FBTA 3QMPA 4DC9A 3DDZX 4W5OA 2GOYA 2YXNA 5ALHA 1D1TA 2DUJA 1Z83A 2Q41A 1J07A 4M1QA 3THOA 3W04A 5E6UA 1PUJA 2VA8A 4UM9D 1H5UA 1RWBA 4R1UA 5I8PA 5JU6A 5G0WA 1VL5A 2O0HA 3T1HB 1I0LA 1QFSA 4M37A 4C7VA 5KVQA 1W0JD 2C3OA 2HMSA 3WL3A 4ZZIA 4DA6A 4AKGA 4YCNA 1ESEA 1EFPB 1Y5RA 2Q2QA 2Q9AA 2D7CA 5ALVA 5EYPA 2H9AA 2DPYA 2WI8A 3V34A 1YRWA 1V11B 3NTQA 1UPUA 4AKTA 2CEKA 4G0MA 4GUDA 5KDLA 3KJHA 5IT4A 1ZQ9A 4JI8B 1RAEA 5FBZA 4ZPJA 1W5EA 4DHEA 2BFNA 3S0JA 4U9IS 2CXTA 5TMBA 3RTCA 1T34A 1QE3A 4ZOAA 1Z6AA 1VMIA 3PPYA 3EXHB 4KQ1A 3X1XA 5JI2E 5AJYA 1E7RA 5EIOA 1VPLA 3PJFA 4GYKA 4DJJA 5KKNB 5GJWC 1MIOB 1QPBA 3JU3A 3OM8A 3PUJA 5CPFA 4A2PA 1CRQA 2BAGA 4BNJA 4M7RA 3K05A 2C7QA 4HQRA 2R4UA 4PYRA 3RLIA 1ONPA 2BFFA 2OYCA 1H2WA 4KPUB 1JH9A 1UAYA 2D5CA 1FUKA 1W35A 1YDGA 3CCCA 3FZNA 3L01A 2RKOA 3T3EA 3TIVA 2XOKA 2X41A 1EINA 2R86A 2C7BA 3K32A 3URMA 5B58C 5DM4A 4F11A 3ZXSA 1XAHA 2FW0A 2IRWA 4U4AA 2AUTA 1HEIA 3PEUA 1BH6A 5DTRA 2FOIA 1JIXA 1QJCA 2J8ZA 5EJIA 3O21A 3QELB 1DIOB 2QRJA 5LQCA 1GM5A 4GWLA 3VNVA 1CUVA 4GGMX 5ALXA 3ESDA 5DHAA 3A3PA 4BQFA 1N5LA 5AM4A 5KHOC 4PLTA 2GM5A 1PSDA 1UOOA 2J07A 2ZBQA 5C7OO 3DMRA 3SZLA 3V4ZA 3OECA 4XJXA 2Q4BA 4YCDA 3AFMA 3CY6A 3NIBA 5F77A 1GDDA 3MT8A 1J2JA 2PLRA 4DSAA 1G2PA 2OBNA 2JDID 2NUTB 3T7CA 1SQFA 2EKDA 2ORYA 4FW8A 5JSYA 5F12A 5AVYA 3GCZA 1OLUB 1UODA 3MTIA 4F2DA 2Z8XA 2IP1A 3AJ8A 4B8ZA 3LCUA 1MHMB 1QYDA 1REQA 4HUJA 3NXSA 1U4OA 3LJKA 4UKDA 5E38A 5JAHA 3KFXA 3RARA 2KBFA 5G53C 5JCJA 3TV1A 4KLNA 3ZVNA 1X3LA 3IV9A 3QE3A 1INLA 4KDRA 4GXRA 4H0NA 4EABA 4GPTA 3STHA 1NUHA 1OGIA 2AIRA 1NP6A 4MUBA 5EQJB 1KI1A 4LSWA 3VR2A