4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase 1
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
1DEHA 1HE5A 2ZJ0A 4JBHA 1ZFNA 2AG8A 1HKUA 1MC5A 2G76A 2B83A 2I99A 5FF9A 2QIOA 5GMOA 2GN4A 4B3JA 4KUEA 4FPXA 4M49A 1NQOA 4OAQA 4CM6A 5JFOA 1XA0A 3VC7A 2OXIA 3OA0A 4A03A 4YYZA 4UVGA 1ZIDA 1IL0A 4E6PA 4Z3KA 2GERA 4J0EA 3IC5A 4KDEA 2Q1SA 1T1RA 3B70A 3IS3A 3ONFA 2WWRA 3DEYX 1E7WA 3F5QA 3H7AA 4BV8A 4GGPA 4W7IA 4CMIB 1NYTA 3H6KA 1O5IA 4PN3A 1V3TA 3PVZA 4R68A 4WEQA 4E5YA 4TKLA 1O6ZA 3E82A 2XXJA 1KVUA 1NWHA 1Y9AA 4MDHA 4ND4A 4A27A 4GPD1 4EBFA 4JN6B 1E77A 4UEOA 2YDXA 4YDRA 4P4GA 5JE8A 4HFNA 2EP7A 4OH1A 5T6BA 4OGWA 1W4ZA 4BQPA 1P33A 1BHSA 2OL4A 2HLPA 1M76A 2ZJ1A 5GY7A 5JYAA 4E0BA 4FN4A 4ONEA 4CMGA 2NM0A 3K6JA 2BRUA 4TRNA 3O26A 1QYWA 1MXFA 3UICA 4TROA 4PLCA 5DCUA 4F6CA 1Y5MA 3S2EA 3PFFA 4XRGA 2I3GA 3A28A 4GAEA 4KTTE 3K9QO 1E7SA 3P7MA 5BNIA 5L95A 3L4BC 4Z0TA 1LSSA 2VTEA 5IG2A 4R4JA 1PX0A 4AJ1A 4UVHA 3DWFA 1DLIA 2PZLA 3G17A 1E3SA 1IB6A 1RKXA 5ER9A 4BGEA 2E49A 4IDDA 3F1LA 3GMSA 1E5QA 7MDHA 1JWBB 1P9LA 3IUPA 4RF3A 4WCDA 2O48X 3RBXA 1FDSA 3E6AA 2Q2QA 1ZH8A 3DZGA 4AJ2A 1QYDA 1M67A 3PK0A 4J1TA 3RUCA 3GHYA 1GUYA 1P1RA 1UAGA 3ZU4A 2FPPA 5MDHA 4LSMA 4CQLA 1A72A 5JDIA 4WASA 1EDZA 2ZB8A 2H9IA 3LZ6A 1LLDA 3IP3A 1ZEJA 1HSZA 3D4NA 4U6SA 5EL0A 1YGYA 4B8ZA 3RIHA 4AJ4A 4E30A 1HDGO 2O2SA 3GEGA 2QW8A 4YT8A 2PTGA 3DHYA 5KVSA 3WTCA 1D4FA 4PG4A 1OFGA 4I5EA 1GADO 4CQMD 2B4QA 4CMAA 3EMKA 3W6ZA 1JN0A 3K31A 1CETA 3CEAA 4NBWA 3L4SO 2IEBA 1SB9A 3D64A 4B7XA 4PG6A 5M6DA 3WICA 2GYYA 1DIGA 4IQGA 5AXAA 4YAKA 5KJFA 4R1NA 2O4UX 4CLRB 4YAJA 4IPTA 3DDNA 2DT5A 2O3RA 3PPIA 2QYTA 1WAMA 4WLVA 3QJ5A 4DQXA 2D59A 3OM9A 4R3WA 1EVYA 4YJDA 1YJQA 4NPCA 5ENDA 1LTHR 4LW8A 4WCFC 4BNWA 4Y6SA 3ZNQA 2O3TA 1K89A 2PKQP 3QLJA 4O6VA 3W1VA 3PJEA 2ZTVA 1R37A 4RQUA 3ZNPA 1NAHA 4YCAA 2ZK7A 1OZAA 1E7QA 4BNHA 4CMHA 4KDFA 2VCYA 4D0SA 1N8KA 4NBTA 1YB4A 1HETA 4UVDA 3T7EA 4GX1A 5T8KC 1OMOA 3I52A 1KVTA 4BVAA 3PHLA 1EFLA 1UXIA 4YXFA 3TZQA 3V2GA 3PDUA 4HADA 2EIHA 4J90A 3AOEA 3ZNOA 5AQ1A 4R9RA 4MKXA 4CPDA 1F12A 4ZRNA 1SMKA 4D79A 4CMKA 2P5YA 1K6JA 4BNZA 5EN4A 3DTTA 2DFDA 1NQAO 1CEQA 5A02A 1AE1A 2GZ1A 3AOGA 4Q3DA 5AXCA 4Q3EA 1FDVA 3GR6A 4PRKA 3T7CA 3TJRA 1LSOA 3TF5A 1I24A 2P4QA 4YTEA 4HBGA 2HUNA 3RASA 1W8DA 3WMXA 1A5ZA 4NR0A 2HMTA 2HCTA 5JAZA 1ZUD1 2DPHA 2V6BA 5LC1A 2CVZA 1P31A 5IDYA 1JTVA 1EQUA 3ENNA 2I9PA 3GEDA 1HSOA 2GR9A 4IDGA 4U8GA 2YFHA 4PLGA 3H5AA 5IN4A 4KQXA 3Q0EA 4BNXA 4XZ3A 1BDMA 2YDYA 4FFMA 5F1OA 4AJOA 5KKCA 5FWNA 1IYZA 1HF3A 2DLDA 3AM3A 1HDXA 1O8CA 2G5CA 1XQ6A 4RVSA 3W4JA 2HQ1A 4BNFA 1HYGA 1IPEA 3PQDA 4B4VA 1PJ3A 1HZJA 3NKLA 3RC9A 3RWBA 4AJEA 4PLYA 3JQBC 1ENPA 4ZQEA 4D7AA 4FQ8A 4WCFB 1QLHA 1ISMA 4I5FA 3GC6A 4ID9A 1G0OA 4GI2A 4ALMA 3RBZA 1DFHA 1P1FA 2VWQA 2DM6A 4E2YA 3QRWA 5AXDA 1NPTO 3GRKA 5THQA 3DZJA 4DPLA 1ZK1A 1NWCA 2Y66A 2VYND 1E7RA 1KEWA 4PLZA 1N9GB 3JQDA 4KMSA 3RC2A 3ORFA 3ULKA 2NVBA 4ZJUA 1ENYA 2W8ZA 2B4TO 2QQ5A 2R00A 1DIBA 1I8TA 2QRKA 1EK6A 2IEDA 4DUPA 3I83A 3O4RA 2CSUA 3V1UA 2PA3A 3A1NA 2D5CA 4BQRA 3HUDA 2X9NA 1YWGO 5I9MA 4Z6KA 4XJTA 1HL3A 2BMAA 2C2YA 1P0CA 3DXFA 2J3JA 4JP3A 1C0KA 2NLOA 2Q2VA 1PGOA 3RFTA 3K5PA 3ZV4A 1NM5A 3PWKA 4DA9A 1JDJA 3ITDA 1K5HA 1V0JA 2Y1OA 2ZYDA 1PJCA 3GZNA 5EINA 2VNAA 1CF2O 4WNCA 2C07A 4ZQGA 5TT1A 1YO6A 1DDOA 1GPDG 1Y6JA 3PQEA 4DWVA 5JBIA 4BNLA 4P38A 1U3UA 3DOOA 1U1IA 4X54A 2NNLD 4J9VA 1BDBA 4CM5A 3JQGB 1GCOA 1QYVA 2P5UA 3U4IA 3PWZA 3VZQA 1Z82A 4RV9A 1WMAA 3ZU5A 5L7TA 4MKRA 4J9UE 2VTDA 3Q2IA 5JC8A 5ILGA 1U5AA 3EK2A 1JKJA 5TT0A 4N5NA 1Z75A 5F1PA 1BMDA 1H2BA 1NAIA 3F46A 4IIUA 1PGPA 1R6DA 2GDZA 3L07A 4CR6A 3PLRA 4FC6A 4BKPA 2G0TA 1XWFA 2RIRA 2I5PO 3A06A 1ENOA 3GHHA 1VSVA 1ZXLA 3KBOA 1SOWA 3FR7A 1OC4A 1CQIA 2VOEA 4DBVO 1YJ8A 1KVSA 2QYSA 4G2NA 1A4UA 4KWIA 1PJSA 4NK4A 2RHCA 2OO5A 4FGSA 4S1VA 1VKNA 1YH3A 1NTOA 4KTVE 4AJJA 1Y8RB 1PU2A 4W6ZA 2VHZA 4Y9DA 3OJ0A 2EW8A 5CDYA 2FP4A 4P4NA 3LF1A 3IKVA 1I32A 2PK3A 1F8GA 4E5PA 5A4DA 4MIYA 1RWBA 2YQ5A 1Z6ZA 3D4OA 3HADA 4UEJA 4JCOA 3JQFC 1GEGA 3ZU2A 3GRPA 2Q4EA 2QZ9A 3QVXA 3G1UA 2Y0DA 1NASA 4CV3A 2ZTMA 3KYCB 2X0NA 1VM6A 4PZCA 5L3ZA 2J5RA 1ORRA 2CDAA 4DL9A 3HB5X 2O50A 1DC4A 4DGSA 4Y67A 4E3ZA 1XQ1A 1PQWA 1SB8A 4A10A 1YL7A 3EW7A 1ZK0A 3ADPA 4MIEA 4QUKA 5B12A 1HXHA 4CJXA 4CMIA 5F5NA 3KOUA 1P1KA 1LBEA 5T8KA 4CMEC 4GVLA 1Q2XA 4RJTA 4G5HA 5K9ZA 3MJTA 4E5KA 3SJ7A 1PS9A 4LN1A 4IQ0A 2R2GA 5IDWA 1KERA 4JGBA 2O2YA 3VZRA 3EHEA 3ZWWA 3RC1A 3GUYA 3HDQA 4NK5A 3TPCA 5BSGA 3NRCA 3ROPA 1VLLA 1SEVA 4RLSA 3KVOA 1KC1A 4MP3A 1HTBA 2HJSA 1ID1A 3RROA 3MTJA 1ADBA 3LK7A 3PYMA 3GGOA 1NVGA 1YRLA 2X0RA 2WYWA 4RDIA 4FFLA 1LQUA 2FR1A 2X9GA 2EP5A 4FR5A 4QO8A 3WYEA 1C1DB 2X0JA 4IUYA 1ZMOA 4ZHSA 1GD1O 3F6YA 3H5NA 1XGKA 1Y8RA 3JCZA 1CWUA 2PY6A 3WWZA 4BO1A 4K9DA 3WGZA 1N2SA 1DAOA 2GSDA 4PZDA 5HM8A 1OI7A 2B4RO 1GUFA 4ALNA 3ZHBA 4NZ9A 5KJ6A 4J7UA 3U3XA 1WW8A 1X0XA 4II3A 1J5PA 4FOOA 2DPGA 4ILKA 5JSFA 3ONEA 2J3KA 1YDWA 1YONA 1HE3A 1TT7A 3Q9NA 4PLFA 3O8QA 3E18A 5GZ3A 1B3RA 1KY4A 4D3SA 4Z9YA 4B8WA 3ZW8A 3FCOA 2Y0EA 2Z5LA 2RH8A 4IDAA 4D3DA 2PZJA 4FSHA 2UUOA 1ZO8A 5I9LA 1FMCA 2EF1A 3MEQA 1N7HA 3QWIA 2FRDA 5EERA 3QSGA 4CLOB 3TOXA 4E31A 5IZ4A 3B1KA 1EDOA 1EVJA 2JCXA 1UP7A 3DQPA 2B35A 3LC2O 1A9ZA 4NJOA 1FXSA 5JY6A 1Z7EA 1SBYA 1HYEA 4D0RA 4BNTA 2VYNA 2JAPA 4IDEA 3UN1A 4XKJA 5GZ6A 3ZDFA 3ICCA 1V3UA 5DBIA 1XLTA 3UVEA 4Y6PA 2H1SA 3AY3A 1LJ8A 1NBOA 5A03A 4ZVVA 3RJ5A 4JK3A 1A7KA 3BXXA 2PZMA 4NBUA 3JSAA 3F5SA 3WDSA 5CDSA 3HWRA 2O7QA 1R4MA 5AYVA 3GDFA 4FOSA 3RJ9A 1PZFA 2A94A 4IDCA 3VPFA 1EMDA 3D4PA 4DC1A 2ZQYA 1MFZA 5B4VA 3W6UA 3FHLA 2CNBA 4IZIA 4XDZA 1ENZA 1ISFA 3KYDA 3PFWO 1Q0HA 1X7GA 1YOVB 2NUAA 4L4SA 4TWRA 1KVRA 1GQQA 4MO2A 1GUZA 1JQBA 4ZGWA 4I08A 1E1NA 1PZGA 2WSBA 3TN7A 1JVBA 1DAPA 3GT0A 3MOIA 4BB5A 4DMLA 4J16A 3AW9A 4UVIA 1NQTA 4QFCA 1XDWA 3DMTA 1LSJA 3LDHA 3DBRA 1T2CA 2EGGA 4LCEA 2VRBA 2DAPA 5LCXA 1P1HA 1IHYA 3STHA 5JAQA 3LQFA 5L7WA 4LRSB 3SX2A 3ICPA 1LDGA 4PVCA 4J1QA 1B8PA 5I8WA 2FPGA 5IJZA 2NSDA 1BGVA 3L9WA 5I7SA 1CYDA 5KVVA 1H2HA 3DR3A 3RCBA 3JQAB 3F47A 4UAGA 4GQAA 4C7KA 5IDXA 4AFNA 1K3TA 3DOJA 5I7VA 1ADGA 3NTOA 2Y0CA 1T24A 4DPKA 4RF5A 1PJLA 2Q1TA 1LSUA 3PGJA 4R1UA 1PSDA 4BO5A 4E12A 1A4IA 2VHWA 4GKBA 4WOJA 1WPQA 3DAFA 2C29D 4NHEA 2ZATA 3MTGA 3ZU3A 3JQ7B 3QVSA 2P9CA 4EUEA 2ZB7A 4I8XA 2C59A 1PWXA 4YEDA 5I7FA 4TRRA 1Y9EA 3Q2KA 4P8RA 4OOFA 4R1TA 3NEPX 1C1XB 4OMUA 3PZRA 3DZBA 4YWJA 3HDYA 3C3XA 3I9OA 3DMYA 5JDCA 2CDBA 1UDCA 4AJHA 5L4SA 3OP4A 3WGOA 2DU8A 1DC6A 1ZZEA 4RVFA 1LEHA 3QIVA 3ZNNA 1A71A 4TKMA 3BTSA 2GN9A 2C5AA 4AJNA 2LDXA 3FWNA 2JFFA 4GL4A 1VL6A 1RM4A 2BGMA 2I3AA 1U7HA 3GZ4A 2A92A 4IXWA 4RVUA 1ZJYA 4YACA 2DBQA 5DZSA 4GKVA 3W4KA 3L9XA 1DHRA 4E13A 2YHUA 2BFPA 2C2XA 3PYLA 2JCVA 3RFVA 4CLXA 4E2WA 4XB1A 4LVCA 2HK7A 3AM5A 3NGXA 4FBGA 3H9EO 4TVOA 1CIVA 4FFPA 3LVFO 3GFBA 3NT5A 2E4AA 5KTKA 5F5LA 1MC4A 1TLTA 3ADOA 5K6AA 2TMGA 4JJGA 1R0LA 4MJLA 4M1QA 3BTOA 3CE6A 3VVCA 2VUUA 2D0IA 3MWDB 1E3EA 1PJBA 3E9NA 2Y1DA 3VPHA 5A3VA 2LDBA 4J49A 3L0DA 3ZWPA 2HMVA 3H9UA 4EITA 1C3VA 5H83A 4M54A 5DULA 3MOGA 3PHHA 5T57A 4L74A 1UXJA 3WB9A 2DTXA 1E7YA 2BI8A 1ML3A 4IIVA 2FZEA 4CM4A 1FDUA 3UAGA 3OECA 1ZW1A 1AXEA 1I5RA 3VPGA 1LDEA 5I9NA 2E82A 2C0CA 3M2TA 3PJGA 3BHMA 2O23A 1LDYA 1N1EA 3OJEA 4RVDA 3FI9A 1K2WA 4CODB 1UP6A 4ZQFA 2IXAA 1D1TA 2W2LA 2ZCVA 3OJLA 3NTRA 2AHRA 1LNQA 3GDGA 1NFRA 1VI2A 2B37A 2UV8A 4BNIA 1H9AA 1UXGA 2VUTA 1JVSA 4YBZA 4OSPA 2EW2A 5CEJA 4Q39A 3Q1LA 3AI2A 3OQ1A 4I5GA 1RPNA 4B4UA 2O3SA 2P68A 4BKUA 4QEDA 1IUKA 1U2GA 1UP4A 3QV1A 3ZZNA 3G79A 4ZRMA 2QRLA 3PZBA 4BKRA 4NU6A 4N5MA 2AE2A 4FJ1A 2D2IA 5T67A 4AICA 1HT0A 5C37A 5JC1A 5A9SA 3Q9UA 3RQSA 1Q7CA 1I30A 3WNVA 4AL4A 4E33A 3H2SA 4H16A 3QY9A 2DBVO 4KQWA 1P74A 1JA9A 1KBZA 1P3DA 4HV4A 1DJNA 3QWFA 2HSDA 5HTOA 1QYXA 3JD0A 2Y1CA 3HFSA 4K26A 4MP6A 4S3MA 4IZHA 4XQCA 4BL5A 4JX8A 4II2A 3GF4A 3VH3A 4W99A 5KIAA 2JD1A 1T25A 3K73O 1U3VA 2TMDA 5JO9A 4XGNA 3IQDB 5DNAA 2AEFA 3VH4A 5DF1A 2J5KA 2CUKA 1ULSA 1P1IA 4RCVA 5G0WA 3H2ZA 5A9TA 4CM8B 3NDJA 3R0IA 1IOLA 1G0NA 1VE9A 5DP2A 3DMTC 3FSRA 3ZWVA 4YAEA 2B5WA 1F17A 3GAZA 1EFKA 2CF6A 3ZH2A 3LT4A 3EGOA 2AG5A 1TI7A 4NI5A 4R1SA 3ZI0A 5IF3A 2Y05A 1GQYA 4QFDA 3SVTA 2PD3A 3CSDA 3SXPA 2GD1O 2OBYA 2AE1A 3W8EA 2Q1UA 4L0QA 1X14A 1B15A 3JQ9C 1LRJA 1N9GA 4Z9FA 4D42A 3N74A 1YQGA 2Y68A 3ZV6A 4J91A 3VOSA 3ROMA 1ONOA 1B2LA 1U28A 1ISGA 1E92A 4GLLA 4EJ6A 4HY3A 3JQBA 4CL3A 2DBZA 2JCYA 2ZB3A 3X2EA 3AOEC 5KVCA 4DIFA 1E1MA 1B7GO 3DBHB 5HS4A 2PH3A 5DBFA 4CQMA 4DLAA 4OHUA 3U9LA 2VYVA 1JKIA 2OZPA 3C1OA 3U4DA 2VT3A 3KLPX 4PCVA 1BVRA 1X7DA 5A04A 4MVJP 5ER6A 4D43A 3JQ9A 1RM0A 3KTDA 3PHIA 4L75A 2JD0A 4AJIA 2IDZA 1LDBA 4MINA 2HMWA 3OFSA 1OAAA 3PI7A 4IJKA 3ASVA 3C1TA 1E3LA 1ARZA 2C5EA 3I9MA 3NDIA 3I4CA 4XYEA 1CERA 2GF2A 3DBLB 3UOGA 2GRAA 3WGYA 3BHIA 2ZQZA 4IMRA 4MPDA 4UUOA 4BO2A 1NVTA 4I9NA 3I23A 1BVUA 3U4CA 4GX2A 4MVJF 1XSEA 3D5TA 1MP0A 5GZ1A 2E6UX 4JBIA 3ZHYA 2ET6A 3RBVA 3AY6A 5A5EA 4RVHA 3WBFA 1O9BA 3FBTA 3GN2A 3ZWXA 4CMJA 1Y81A 3ROQA 5DT9A 3EVNA 3DZIA 3K2BA 2BKAA 3VZPA 1PJTA 4E21A 1H6AA 4YJGA 1AXGA 4I9UA 5HWSA 2JHGA 3EYWA 4IBOA 4JP2A 1SZJG 1UUFA 1VL8A 3NYWA 1ZXBA 1TEHA 5U1PA 4PZEA 3WMWA 5BNFA 2Q46A 2EG9A 4QO7A 2EV9A 4TZKA 3LLVA 4YJGB 5AXBA 2PR2A 1KOLA 4A73A 1BW9B 1IZ0A 1L1FA 3WQRA 1JAYA 4DBZA 3AU9A 4U0KA 1BRMA 1PTJA 5JO0A 3LT1A 3BYZA 4XJSA 4Q3NA 4R5MA 5IN5A 2DQ4A 5L7YA 4H15A 2AEMA 1X15A 3F3SA 1DOHA 1GPJA 1EQ2A 1RM3A 4IXTA 4Y8VA 4BMSA 1ADCA 2VUSA 4FW8A 4KWHA 2W98A 1VJ0A 1P1JA 3I9KA 1QV7A 2P9EA 2WYUA 3IMFA 3L77A 3HN2A 2Z1NA 1ISIA 3AFNA 3RU7A 2FPIA 2ZIZA 3LC1O 4OXKA 3A4VA 4WJZA 1H9BA 1PJ2A 4HUJA 2NADA 4CLRA 1JW9B 4CM4B 3GZNB 1LX6A 3IOYA 3VDRA 1H0KA 5B1YA 4RLHA 3BMNA 2WM3A 3E1KA 1ZSYA 1ZSNA 4Q3BA 2PNFA 2ZTUA 4RGBA 5CG1A 3UW3A 3UCXA 3WXBA 2V6GA 1A7AA 3RVDA 3DAGA 2DC1A 4K6CA 2ZKLA 4ITUA 3PRJA 4BKQA 1NFQA 5U4QA 4O59O 5L9AA 5CPBA 2NVUB 5KKAA 1TXGA 4WLOA 5BSEA 4XYGA 4ZD6A 3C24A 3ZHZA 4EUHA 4A26A 2QHXA 1LA2A 5JXWA 2Y1GA 3WG9A 3JYOA 1IPFA 1MLDA 2VOJA 1DLJA 2QX7A 4Y98A 1Q7GA 3JTMA 5FEUA 4CUJA 2Q49A 2HO5A 1PGJA 1MUUA 4YT2A 4BO9A 1J4AA 4Y6RA 5L45A 3NGLA 2P9GA 2WTBA 4YJHA 2FHSA 2ZYAA 4BNVA 1GCUA 2DTEA 1LUAA 1GTMA 3ITKA 1K6IA 3IUSA 3HZZA 1I01A 5C7OO 3ENKA 5COAA 2OGUA 3UKOA 2Q2WA 1Z74A 1H6DA 4TZTA 2HAEA 4E32A 4CM8A 1Q1NA 5G4KA 2P2SA 1E6EA 2EKQA 4XRRA 3V2HA 4Q3CA 3C7DB 4DMMA 4BNGA 1B3BA 4MVJG 3OQ6A 1WLYA 3RU9A 4B4WA 1F8FA 1R16A 5A3JA 4CR7A 1U5CA 2VRCA 3OEYA 3WTBA 2X7HA 4M55A 5TQVA 1U8XX 4FFOA 1V3VA 3FTPA 3PXXA 4R51A 3HDHA 4ZICA 2NU6A 3RD5A 3EDMA 3H9JA 1XYGA 5COBA 5BSHA 1HLPA 4L76A 4CL8A 1EEHA 3TQHA 4JQCA 2HRBA 1DC3A 5JYDA 4FIZA 3MWEB 1ZJZA 2OUIA 4K28A 1SOVA 1UR5A 5JNLA 2AQ8A 3ETEA 3I9LA 2P4HX 4XYMA 1B0AA 4W4TA 2ILTA 5ADHA 3IP1A 1V6AA 3JD4A 4AJLA 1W0CA 3DZHA 4RORA 1EUZA 4FFNA 1GYPA 3D3WA 4UUPA 3UHAA 4LMRA 1I33A 1B8UA 3WGQA 3NT4A 4J4HA 3RUHA 3QVTA 2IXBA 1JLLA 1QR6A 3P19A 3NT2A 3DOCA 4BNKA 2EEZA 2WMDA 4OQYA 1SPXA 3K30A 3WIDA 5G0VA 3OICA 3OBBA 3PDJA 1ONPA 1Q0LA 5TF4A 5JDIC 5KJCA 2AQIA 4XR9A 8ADHA 5EJ2A 2NVUA 1IE3A 1I2CA 1KC3A 4HWKA 2OFPA 4ZA2A 1WDLA 4LVUA 5CEEA 4KZPA 3HNPA 2V6FA 2FSVA 1AHHA 1EE2A 2YHIB 3EZLA 3K8ZA 2NV6A 4ZQBA 1ZK2A 3UXYA 4DREA 3LLSA 5T73A 3SEFA 1SCUA 4EJMA 4EDFA 3FF4A 3R3JA 4IGFA 1YL6A 3TOZA 3BZUA 4YRDA 4NMHA 2X8LA 2BGKA 3CKYA 4R01A 1LQTA 3WJAA 4LCJA 5JW6A 1PJQA 3GN1A 3CUKA 3I6IA 3INTA 3RUAA 3TDKA 2CF5A 1EUDA 1DXYA 1IZ9A 1ZK4A 2VQ3A 3FPCA 3GVCA 2VYVD 4IDFA 1NNUA 3RAJA 4CR8A 3R6DA 3RSHA 3W4IA 3O03A 2BFMA 2FZWA 4RO0A 1PL8A 1PS8A 1M2WA 3A14A 1H93A 1H94A 4GMGA 2HRZA 2IE0A 3FBGA 4HX5A 3E5MA 5DOZA 4D3FA 2G17A 4YAGA 4O0LA 1PS0A 4IM7A 2EJWA 2J3IA 4HFMA 1XG5A 1O89A 4GWGA 4A5OA 1YKFA 2O3QA 5CP8A 1R15A 4PLTA 5A06A 3C7AA 5A5FA 4HNHA 3SBOA 2JL1A 3VH1A 5CDUA 2V65A 2Y67A 1GR0A 2C20A 1JU9A 2GO1A 3QWBA 1C0PA 1X1TA 1YBAA 1Z73A 4O5OA 5AVOA 1U4OA 2I67A 4QECA 3VDQA 4U0JA 1IULA 3GGPA 3P2OA 1WMBA 3V2UA 1U3WA 2WD7B 5HA5A 3INGA 1QXSA 2NVWA 1O95A 1WWKA 3CZMA 3QE3A 1LRKA 3BMOB 3HB4X 3KEOA 1DPGA 1C1DA 4FC7A 5DBGA 4BO7A 2WEKA 2PLAA 1ULUA 2X23A 3PWSA 3OA2A 1Y5RA 2YUTA 5H81A 2D3TA 1QYCA 2F1KA 9LDTA 1XHLA 2H5LA 3BMCA 3OIGA 2HK8A 3FD8A 3SLKA 1NR7A 2Q3EA 3ZWCA 5G4LA 5TSDA 3CPSA 4QQRA 1SC6A 2B5VA 2CVQA 4LMPA 1HEUA 5A1TA 4O63O 3SLGA 1UAYA 3JD2A 2BH9A 2WYVA 4J2HA 4KP7A 5H82A 1PL6A 4BGIA 2POQX 2OORA 1WNTA 1GZ3A 3JD3A 1ZCJA 2WDZA 3BMQA 3KSZO 2EHDA 4RPJA 4OKIA 1LC0A 3K92A 4IGEA 4IS3A 4I5DA 3DZFA 2BD0A 1UH5A 1VC2A 1PGNA 5TX7A 1QP8A 2J3HA 3S2FA 4OJNA 3KZVA 4A7PA 3S2GA 4Q9NA 4CQMB 3EVTA 1T2DA 3LC7O 1GU7A 3KETA 3GOHA 3DBHA 3KV3O 3WGTA 3ONDA 2HMSA 3HHPA 1EBUA 1FDTA 1LC3A 2JD2A 2HKIA 5DOVA 4B79A 4BMNA 4IINA 4JLWA 4EYEA 5JYFA 4R9SA 3S2IA 3FNEA 2SCUA 4M8SA 3WX0A 4G81A 3VKUA 3FR8A 2GASA 1YQDA 5JDCC 1T4BA 3SC4A 5TLSA 4WLEA 3DC2A 4PRLA 4DTIA 5ENVA 5C3MA 3I1JA 3KRTA 3MZ0A 3KXDA 3U09A 5IZCC 3H3FA 4DPMA 4RZHA 3WQSB 3ROKA 3IL2A 1Y1PA 2EERA 2RBEA 3PP8A 3FWZA 4QTZA 4AJKA 2IZ1A 1VKOA 3A9WA 3M6IA 4XEHA 3O9ZA 1UDAA 2C82A 1ZKMA 2IYPA 3CMCO 1I3KA 1T2EA 5CEFA 3VZSA 4HFRA 1YVEI 3KEQA 3ABIA 1H6BA 1PZEA 1PGQA 4MOWA 4FDAA 4UEKA 4WOKA 4IQ8A 3K2EA 1NFFA 1S7CA 2AMFA 1GYRA 4L8VA 3T4EA 2XAAA 1U4SA 5CG2A 1LU9A 1LLQA 1MA0A 1V8BA 3C85A 4ND1A 5CPFA 4I1IA 4CLOA 1D3AA 2Q99A 3ETDA 5THKA 1JAXA 4DIOA 2CVOA 4L9RA 1XCBA 4LISA 5BQFA 4GVXA 1PWZA 3OJOA 3RUEA 3LT0A 3OIDA 1PR3A 1YQXA 1J49A 4R54A 2J6IA 3M2PA 3O8QB 1B14A 1NHWA 4XA8A 2GPTA 2JHFA 3I3OA 2BHLA 4N7RA 4W9NC 2YHIA 4K1LA 2GN8A 2HJRA 3PIDA 3L4BA 3TNLA 2FOIA 1B26A 4YAIA 4XCVA 4RDHA 3ZWOA 2VWGA 3B6ZA 2BFOA 3IJRA 3O38A 4CUKA 4IY1A 3DO5A 3GA0A 3MJVA 4J1NA 2WJPA 4BO8A 5KWEA 1XIVA 4J4TA 3GY0A 3FTNA 1U3TA 2W2KB 3H3JA 2B69A 4RVGA 4BO6A 5FYDA 4JROA 3UF0A 1NPYA 2EKPA 4Z9XA 1VJTA 3SC6A 3H8VA 4W9NA 4BNUA 2NU8A 1RJWA 4GLOA 3WGIA 4R16A 2OBNA 4B7UA 4EGFA 2AA3A 1NP3A 1NXQA 3IAHA 3GLQA 5JAIA 2PGLA 5T5QA 4ROSA 2FR0A 3AUTA 1ZNQO 4XYLA 1IY8A 1E3IA 1QORA 3ASUA 3MJCA 1ADFA 1GAEO 5JMWA 2NQ8A 2CY0A 4XD2A 1UZMA 4MP8A 4NBRA 3ZWMA 4XWYA 1GY8A 1I2BA 3GQVA 4WLFA 5G2OA 4DXHA 4MVJM 4NJMA 4CMEA 1XU7A 1GQ2A 1YB1A 2D1YA 2IYOA 2Q22A 1EZ4A 4FGWA 3PHGA 1XEAA 1WP4A 3H4VA 2DUUA 1YB5A 4IJUA 2X5OA 3TL2A 3D5QA 4GGOA 1EK5A 1GZ6A 1BG6A 2E48A 3V5NA 2A35A 2VWHA 3AJRA 4I9HA 3E03A 2Q1WA 3AWDA 3MCVA 3KUXA 5BT9A 3WLEA 1PIWA 4DVJA 3WYBA 3BHJA 4JIGA 4RPKA 5G0UA 3INRA 1TT5B 4HNGA 4B3HA 3FPLA 4IDBA 5JLAA 5TC4A 3TZ6A 1Z45A 2B0JA 3UGKA 3BMOA 2PD6A 5DCWA 2WD7A 2HU2A 4RPGA 3I4FA 1E5LA 4BMVA 1AGNA 3JQAD 5G0SA 4Z0PA 1YXMA 5U9CA 4B3IA 1PJ4A 2Y93A 3DBVO 1P45A 5TRTA 3DHEA 1M66A 4XQGA 4ZQHA 3E48A 1CDOA 3L6OO 3CTMA 5TIIA 2JFGA 4ALJA 5IFLA 4YR9A 5JY1A 1C1XA 9LDBA 5TJ9A 1PQUA 5BSFA 1CRWG 4KOAA 2ZB4A 1H5QA 3RI3A 4DQVA 2X6TA 2EJVA 4YJFB 2X22A 3I9JA 4TMFA 2VZ8A 4LSWA 4XQEA 5FI3A 3P5SA 4DYVA 4E2XA 3JQ7A 3U5TA 4YPOA 2O4CA 5MGBA 2OHXA 4D46A 2C54A 2NTVA 5TGDA 4BIIA 4JBGA 1UJMA 4OL9A 3TWOA 3WGHA 3RUFA 1E6WA 3QWHA 4AVYA 3EC7A 1DIRA 3KYBA 1UDBA 5TS3A 2D4AA 4RF4A 2DBRA 4FB5A 3I9NA 4F6LA 3FNGA 2PFGA 1NR1A 2X1HA 4H3VA 3PIIA 4XB2A 1L7DA 2UAGA 4M89A 2B36A 1Z7BA 3TRIA 5A05A 2DFVA 4ND5A 4YA6A 3B1JA 3F4LA 2A9FA 4YRAA 1R4NA 1NPDA 1LRLA 3VPSA 1GZ4A 3D3EA 1U9JA 3WBBA 5J23A 1E6UA 1M75A 1XR3A 2H63A 3NDRA 2OP1A 3S8MA 3OJFA 5L4NA 3HSKA 3I5MA 3D0OA 3NTQA 3SJUA 3V1TC 2AXQA 1GV1A 4L4XA 4J43A 3TSCA 4JXKA 3GUCA 2EGHA 3DONA 1E3WA 4J1SA 3AK4A 3N7UA 1NVMB 2NQTA 1C0IA 4FCCA 4J0FA 5TNXA 4L73A 3RKRA 4RL6A 3G0OA 3TL3A 2H6EA 1I2ZA 1BXKA 4EW6A 3KO8A 1EBFA 4BKOA 3L6DA 1VL0A 3VKVA 3I6QA 2Y1EA 1YOVA 1W73A 4WLNA 2VHYA 3WJ7A 4R5HA 1A27A 3NUGA 3RFXA 3D3WB 4PG8A 3GVXA 3P2YA 3OQBA 3B20A 2PD4A 1EE9A 5C7LO 4WCFA 1P44A 1W6UA 2VHVA 2YYYA 4XIYA 3E9QA 1YBVA 3U62A 3WSWA 2NWQA 3AI1A 4UREA 1G6KA 4OO3A 5JPIA 1R4MB 4INAA 1U2DA 2YQ4A 4FJ0A 1MB4A 4QXMA 5DP1A 3S55A 3N58A 4D44A 4GSKA 2YW9A 1E0DA 4NFSA 5IAAA 2CD9A 3JQCA 2QG4A 3V1YA 2BLLA 4CM9D 1JWAB 5HBRA 2GLXA 2GN6A 3FNFA 3AY7A 4F3YA 2BGLA 4OSOA 4CM7A 5CAEA 1BXGA 2BF7A 4Z3DA 1UXHA 3ZHXA 3NJ8A 4RPLA 1WDMA 3W8DA 4YT4A 2DTDA 4NFHA 4RZIA 3DBLA 1YBMA 3KHUA 5F3RA 2I65A 5JCXA 3D7LA 4XGIA 1RM5A 2NACA 5C5IA 3ZN2A 3EZYA 1FDWA 4NJMB 3G49A 1E7MA 2JFHA 4PG7A 4WKGA 3HG7A 4BGVA 2WE7A 1O94A 5G4KB 4OXYA 3FN4A 4PLPA 1HZZA 1ZEMA 1ZMTA 4NDNE 1MG5A 4E5MA 5BR7A 3H9GA 1UZLA 3OIFA 3E5RA 1H6CA 4GH5A 1YS4A 2XPCA 4URFA 4IJVA 3JQ8B 3WWYA 4GWKA 4WLUA 3F9IA 1WXDA 4BS9A 3FRJA 3ZCXA 5CDGA 2VT2A 3HN7A 2VNSA 2PKQO 1WVGA 4J2OA 2YV3A 2W2LD 4CLHA 2DKNA 2G1UA 2ZYGA 3WGGA 3F4BA 3LYLA 4F46A 2RH4A 3UCFA 1BWSA 3PYXA 2P91A 3AU8A 5DCYA 2PV7A 3ZV3A 2IRWA 5KVQA 4GBJA 4BUCA 5EPOA 2PWZA 5AOVA 1KIFA 1MFPA 1DO8A 1N92A 1I36A 2V6MA 4P22A 3PQFA 5ILOA 5HS6A 4TRJA 1SEPA 2X4GA 4MVJA 3Q6IA 1U8FO 1I3NA 1OC2A 1HRDA 1KEPA 2Q4BA 4WK6A 1TVEA 3RUDA 4CM9A 1F14A 5KCZA 1LLUA 3GNQA 3ZWYA 1K0UA 1XU9A 1ZVMA 5FFFA 4U7WA 3WFIA 3HQ4O 3CIFA 1I3LA 1DJQA 3PGXA 3KYCA 4TQGA 4CV2A 4LRTB 5JCJA 1X7HA 1NX6A 3HDJA 4C7JA 4CQLB 5I7EA 1GV0A 4WPGA 3QW2A 4NNJA 3ZWNA 4AJPA 4MVJH 4DQUA 4BHTA 3TFOA 2GCGA 3GVHA 4KUGA 5F1KA 5F21A 2UUPA 5ITVA 5K0ZA 1X0VA 5JAMA 5L53A 3KM0A 3WR5A 2Q50A 5A9SB 2BELA 2X5KO 1J6UA 1QV6A 3JYNA 1BW9A 3JQFA 2FY8A 5TJHA 1HDCA 4MVJI 3NJ4A 2YZ7A 4OYRA 5K6AC 3AUSA 3MJSA 4NFYA 2NTNA 1DRVA 2YV2A 3PJDA 4ZU3A 1VJ1A 1DC5A 3DFUA 1LI4A 1WZEA 5ES3A 1D1SA 2FSSA 3F1KA 5CFZA 4DC0A 3IIEA 2YV1A 3IKTA 1GFSA 5LDGA 3MJEA 4BNNA 3RKUA 6ADHA 3RUIA 3ZV5A 2X58A 5ITWA 1RYDA 1E3WB 3G1TA 3E9MA 4PLWA 1T4DA 2RHRA 4DLBA 3C7CB 4R41A 3HFGA 1SAYA 3WLFA 5JMPA 4NH4A 1HWYA 2IZ0A 2FN7A 2W90A 2YFQA 2YY7A 5CDTA 1GYQA 3TFQA 2RCYA 3GGGA 1ISJA 1D7OA 2VRCD 5JYEA 4NU5A 4QX6A 1HDOA 1B8VA 3ZWAA 5DDIP 1ISHA 1MGOA 4NIMA 3U0BA 4YRBA 4BO3A 5JCJD 1LDNA 3HE3A 4CM3A 5LDHA 4A0SA 3FNHA 2AW5A 7ADHA 4O1MA 5L40A 3OH8A 3DB2A 1Y8QB 6LDHA 3H5RA 4CUZA 4PLVA 5IXSA 2NU9A 4CM1A 1A9YA 4IJWA 2GUGA 3KSDO 2ZCUA 4ALKA 4FS3A 3JQ6A 4FD3A 4TSKA 1YDEA 1UZNA 4GSLA 4YJFA 1T26A 4EJ0A 1QMGA 4OXNA 4GMFA 2OOSA 4E2ZA 3TZCA 2A4KA 4QT0A 1PEDA 2PKRA 1KEVA 2BFAA 1HLDA 4J3FA 4UULA 4HP8A 1QRRA 3UCEA 4BB6A 4EI2A 3ANLA 1I3MA 3AM4A 3JQ8A 4J6FA 3BIOA 1N5DA 3G3EA 1E3JA 2X5JO 3PLNA 4EEZA 3QP9A 3ON5A 2ZTLA 1HE2A 4GX5A 4PIVA 1FK8A 2V7PA 4J7XA 3EAGA 4N5LA 4U5QA 2F00A 1X1EA 4BOYA 3JYLA 3GVPA 4WE3A 5B4UA 1VRWA 4NBVA 1E1KA 2I6TA 4XR4A 4PFJA 3H65A 3CINA 3ANNA 1YL5A 3R3SA 2NTJA 3VPXA 1DFIA 1JKFA 1TA4A 3VH2A 3ETGA 3W8FA 4IS2A 1WZIA 1EVIA 2R6JA 3EUWA 1BXZA 2UVDA 1I0ZA 3WQQA 2CZCA 3UH1A 4LGVA 1R12A 2E37A 1F0YA 1SO8A 3CMMA 1GEEA 1BXGB 5ICMA 2D8AA 3GG2A 3DFZA 2RAFA 1DIAA 4YQYA 1EUCA 3R1IA 2UYYA 3X2FA 5CHEA 4OKNA 4EUFA 1AHIA 1PZHA 3JV7A 3JQAA 4YB8A 4UUNA 3VTZA 1DIHA 1BSVA 2PGDA 3UUWA 2W4QA 4BV9A 4NQZA 2OP0A 3GNTA 1MV8A 1RYEA 2PH5A 2C7GA 3JD1A 1QSGA 3WOHA 3GPDG 2X9VA 1S6YA 2AQHA 2FMUA 1F06A 2AEJA 3DHNA 1HYHA 3M1LA 4TRMA 4A2CA 4WUVA 3PEFA 3K96A 3GAFA 5EQDA 4U6QA 4OIMA 3AUAA 3KB6A 3JQEA 4JJIA 4ND3A 3BTUA 1WDKA 4WNIA 1DBVO 1BTOA 2W2KA 3UFXA 2CDCA 3WIEA 4OQZA 4DRYA 3IDSA 3CXRA 1DSSG 1C0LA 3GK3A 3OMLA 2GZ2A 1UXKA 4JNKA 3KYDB 2DUWA 2VN8A 1E1LA 5G0TA 3VHRA 1R0SA 3PHJA 5DN9A 5IZCA 3CH6A 4YT5A 1TB4A 5FI5A 1ONNA 4E4YA 5L4LA 3KLMX 2DVMA 1R4NB 1QG6A 2HMUA 3AUUA 4YQZA 3U49A 3JYQA 5COQA 1G1AA 1DHTA 1L7EA 3DL2A 2IODA 3HJAA 4J4BA 2VZ0A 1MX3A 2WD8A 4D45A 1J0XO 2EXXA 1R66A 1U7TA 4HXYA 1VSUA 4TVBA 4ZN6A 3WS7A 4EEXA 3OF2A 2I76A 3QVOA 4K6FA 3ZWBA 1P77A 3QVWA 2Z95A 4XIJA 1Q0QA 2GZ3A 1LLCA 3ST7A 5I8ZA 3H9QA 4W7HA 4BO4A 5KOIA 2WE8A 2Y1FA 1ZBQA 4PVDA 2Y99A 4GX0A 2IZZA 4IMPA 2FR8A 4MVJD 1GDHA 2GGSA 4MKZA 1B16A 3WYCA 3U4HA 1D8AA 1XKQA 3LU1A 3AI3A 5EMHA 4ND2A 1PQPA 3TZHA 4WEOA 1DRUA 3WFJA 4UUMA 8LDHA 3D1LA 4W82A 3C8MA 4ESOA 3L6EA 2VHXA 4BO0A 3GH3A 4C4OA 4LK3A 1KYQA 3NAQA 1DB3A 3BA1A 1NHGA 2JJYA 4H7PA 4B7CA 1LDMA 2O3JA 4YJHB 4R69A 2XF8A 1YE3A 1AN9A 4BNMA 4PLHA 3DZKA 1IHXA 5HRUA 5BNTA 1VPDA 2JAHA 4OM8A 2QRJA 3VVBA 1NQ5A 4HFJA 2XXBA 3GMDA 1MXHA 1HDRA 4M86A 4G65A 3BTVA 1TT5A 1DFGA 3PTZA 4MVJE 3S1LA 3IJPA 2EKLA 2Z1MA 2D5AA 1MG0A 3B1FA 3QA9A 3GNSA 4E5NA 1AUPA 5EQFA 1KETA 4R3NA 4ALIA 1XELA 3GG9A 4D41A 1DRWA 3QWAA 4DLLA 1T2FA 1ZSVA 3C1AA 1Y8QA 2JKVA 4KUHA 3ANMA 4XYBA 3VAZA 4RQTA 2HDHA 2O7SA 4ALLA 3BAZA 1QLJA 3BMNB 4BGUA 1KY5A 1QKIA 4FJ2A 3BMQB 1X13A 2C7VA 2X86A 3GEMA 3QHAA 2PZKA 5ICSA 3RC7A 1GL3A 1I10A 2CFCA 4F45A 2G82A 4NG5A 1R0KA 1CQJA 3ZW9A 4CLEA 4YVFA 5EIOA 1T2AA 4XDYA 3LSYA 3NV9A 4XX0A 3PJFA 3DBRB 3T4XA 3M1AA 3GDOA 1PR9A 4J7CA 1P0FA 3BMCB 4WECA 3AFMA 1HE4A 4BNJA 5IXYA 2XOXA 4AG3A 1O0SA 5KJEA 2I66A 1N7GA 2Q45A 4BNYA 3MJ4A 1V9LA 3TZKA 2R00C 2QZZA 4M87A 1OBFO 1ZK3A 4PG5A 4P4LA 1T1SA 5KJ1A 4MIOA 4XQ9A 3OEWA 1M6HA 4CLDA 1N1GA 4HKTA 3CZRA 5EESA 1C14A 3KSUA 4CMCA 3GFGA 5T64A 3LT2A 3GVIA 2AQKA 3VTFA 2FWMX 1K6XA 1V35A 4QSMA 1HDYA 5KNLA 1LXCA 4B4OA 4Q3AA 1KEUA 4RF2A 5B37A 4CMBA 2J8ZA 5B4TA 1Q7BA 2YJZA 1KVQA 4CV1A 3DAPA 1PL7A 2PGJA 3JYPA 3JQGA 3OHSX 4DYDA 2X0IA 4Z0HO 3Q11A 2OMEA 1M6WA 3COSA 3LF2A 4N18A 2J5QA 4L4RA 5L51A 2CMDA 4CV0A 3NX4A 3WSVA 5C7IO 2VWPA 3QQPA 2UDPA 4FFRA 5A9RA 4XGKA 3E8XA 1Y7TA 4DIBA 4UVEA 1FJHA 4JJFA 5J9GA 1HDZA 5IDQA 1OOEA 3ZGYA 1FF9A 3EY4A 3Q3CA 4WGGA 3V8BA 3WNQA 3GPIA 5JS6A 2GNAA 1SNYA 2O3UA 4EZBA 3OSUA 3OETA 1EVZA 2EWMA 1CJCA 4OOEA 4N54A 2HK9A 2BI7A 1KS9A 3DTYA 4PGFA 2NU7A 2VZ9A 4RPHA
chains in the Genus database with same CATH superfamily
3T0IA 4FGZA 1PLJA 1K06A 1Q0ZA 1G21E 1ZFNA 3MBIA 2AG8A 2V4UA 5DBEX 4HH0A 1HKUA 3W2IA 1NT4A 1X1RA 2B83A 2I99A 4HXFB 5FF9A 3UG6A 3K9HA 4WA8A 3QSYA 5AVVA 2GN4A 4FQ7A 4B3JA 3GBVA 1W2HA 4M49A 4CM6A 4RYDA 1JFVA 3HN6A 4ZCSA 1Y80A 1ZGBA 2YIDA 2P9ZA 4TKUA 1G7SA 1PNQA 4AUNA 121PA 2RGRA 1XNRB 1G59A 1TF5A 1Y5LA 3K2IA 3OZXA 2ZYSA 1IL0A 1L7RA 4C1BA 3KOMA 4F93B 3IC5A 1CP2A 2CLHB 4KDEA 3FPJA 3HEMA 3DEIA 4GU5A 3BH7A 1T1RA 2RGGA 3WDKA 5K99A 2I71A 2D1FA 3ONFA 2WWRA 1GCIA 4A15A 1Y1QA 1SQSA 1E7WA 2QXYA 4ZYYA 5JNUA 1P5FA 4LHYA 5JQGB 4PYLA 1O5IA 2DUMA 4M1WA 1HO3A 1V3TA 2G8LA 1FSFA 2N42A 2VHUA 3DOFA 5I3CA 5KYYB 1SVIA 3E82A 3MW8A 3G0HA 2WFAA 4ND4A 5FBZA 3DXZA 3BB1A 2CXRA 1NDHA 2C0PA 3ABRB 3KS9A 1MZVA 5JASA 2J85A 1VIAA 4EBFA 2O1EA 3G82C 3K1YA 1T4MA 4B6QA 2CFIA 4B2LA 5KZMB 4Q7QA 1E77A 2YDXA 4YDRA 1M34A 2DSNA 4HFNA 4MKIA 1PCXA 3DZ8A 3ZDEA 4ZO9A 4BASA 1ZG3A 2OY0A 2XNDD 3F6BX 4Q1CA 1RQXA 1J0CA 2OCXA 2BGTA 2VJPA 4ZOLA 1HR0B 1P33A 3TX2A 2HLPA 2QI9C 2Q8PA 1RXEA 5JYAA 4CMGA 1OF1A 3NXSA 4RHTA 4O8ZA 4YCNA 3DV0B 1GGNA 2VXOA 3FKQA 3O26A 4Q03A 2C9YA 3EBPA 1XQYA 3HJGA 1JXQA 3UICA 1NVAA 1RKBA 3DUFB 1XQXA 4WUTA 5HIMA 3QXGA 2HHCA 3K9QO 1E7SA 2J9FA 1W4AA 2VK4A 1JKMA 3L4BC 3DE7X 4QDOA 1H9CA 1RJGA 3ZKWA 2IV3A 1QG0A 3IUMA 4FYHA 2YS7A 3EDYA 2D6FA 2HV9A 1IB6A 3COPA 5ALQA 4XIIA 4G0UA 3TI7A 5E9QA 4LMAA 3MCWA 2FG5A 7MDHA 3IALA 4RF3A 3RBXA 1FDSA 2POCA 1G4HA 2HQSA 4P08A 2Q1YA 1U5BB 1QYDA 4CF6A 2FX2A 1NJGA 3FWKA 4OLJA 3VX3A 3IYLW 4N12A 1I7BB 4CIYA 5AK3A 1M6VA 4UAVA 2R7LA 4WASA 1U11A 4IJ6A 1MB2A 3TTVA 1EDZA 3N07A 2ZB8A 3ZE7A 3LZ6A 2WIFA 4GKJB 5K3EA 3HL0A 3LUAA 2IIVA 2R47A 4P7FA 4E30A 4GT1A 2PUGA 1NP7A 2APJA 1GPYA 1WUTA 3RF7A 3NHUA 2QW8A 2PTGA 3DHYA 3WTCA 1D4FA 3ZKAA 2YJ4A 1W35A 3SBEA 1ODFA 3IOEA 3W6ZA 4K81B 1KZ6A 4DHEA 3L4SO 2IEBA 3GFSA 4PG6A 3WICA 2GYYA 1DIGA 1JQEA 1CUJA 2F8MA 3BWVA 4HN9A 3U3OA 3IJ5A 3GP5A 2RH5A 4M0PA 4IIGA 1Z4LA 1OH6A 3DDNA 3RTDA 2TECE 2FMIA 1P8JA 1T9AA 3D8TA 3PPIA 2ZETA 2Q7XA 3OIVA 2WQZA 3QJ5A 5KSPA 3WKCA 2PGIA 4DQXA 1OH8A 2A8YA 3A9VA 3JARB 2VPYA 4ZVUA 1PNRA 2HYIC 4Y18A 4FYXA 1YCDA 2GZMA 4IKOA 4URUR 1LTHR 4ENWA 3OTOB 4JWKA 3LP8A 1L5NA 3P32A 3IBCA 3ZNQA 2PKQP 1TCVA 5DHRA 3W1VA 3PJEA 3Q8XB 1R37A 4K0RA 1EVEA 2RE8A 5C5CA 3R3ZA 2HLDA 3BWBA 3IO5A 1Z4NA 1WHTB 4RZSA 4OI0A 3DGEC 1R5OA 1YB4A 3P2MA 1T8UA 1LB1B 2VKTA 4ROTA 1OMOA 3AB8A 3K6RA 1PW5A 1QO9A 1G2IA 2HBRA 1EFLA 3PHLA 3OWHA 4WBNA 2EIHA 1G19A 4NXMB 2CLLB 1LWOA 1UOQA 2HMYB 3VYWA 4R9RA 3OZDA 3ZGLA 3ZNOA 4X8OA 1F12A 3JALB 1L5GB 4B17A 2BYTA 2WUFA 1SMKA 4GP7A 3M6LA 1ZUNA 2GETA 4AY6A 3HU3A 4Z2AA 2P5YA 2WWTA 2ZR0A 4BNZA 2XRMA 1QVRA 1T5SA 2Z8YA 3AH8A 1TKRA 1Z4OA 4WFIA 5A02A 4Q3DA 2GZ1A 2Z4SA 4Q3EA 2PDAA 4UAUA 1FDVA 4YMVA 3T7CA 4CEHA 3ZE8A 3DNPA 3TJRA 5CVEA 1QHHB 1IEXA 1IG3A 1Q1QA 5K0BA 2PMBA 3A1SA 1I24A 3UOWA 1D2RA 9ATCA 2I9KA 2QMOA 2QKYA 2DHCA 3LIPA 1NUUA 2H1WA 3X1WA 1J8MF 1JQ5A 2B61A 5BW5A 1VRCA 5L3VA 5LQCA 1H22A 2H65A 3NAZA 5BW4A 2HMTA 5FI0B 3RREA 3UAYA 5K0FA 1E1QA 1RT9A 1ZUD1 3UUGA 1JUDA 5DXAA 2YTZA 1NZDA 2RARA 5IDYA 1EQUA 5ALMA 2I9PA 2HOQA 3FFAA 4D9GA 4KZKA 1KMIY 1XPJA 5JXGA 4EH1A 3U39A 4LDZA 5F1OA 1ZNWA 3I01A 3W2EA 821PA 3A3PA 3K94A 2UVPB 3A1TA 3OC0A 3VR2D 1NRIA 5EIWA 4BQFA 5CD1A 1HYGA 1WA5A 3D6MA 1YF3A 1EFRA 2WHEA 4RGVA 4S0XA 3IE2A 4CEHB 2CC2A 2QVBA 3NCHA 3NOXA 3P9ZA 5AVWA 5IF9A 3RC9A 3CJQA 3UBMA 1FQJA 2YWDA 3CFYA 1L4UA 1G21B 3KWJA 2CXOA 2DR0A 3UGTA 3D43A 4Q02A 4ZOEA 4D7AA 2R1VA 3TNYA 3SR4A 1QLHA 3QITA 3SKXA 4ID9A 4P3XA 1G0OA 2KWIA 2Z0MA 4FKMA 4GI2A 4IUBS 3TTWA 1OFUA 1W581 1QR2A 2IOFA 2VWQA 3DLBA 2DM6A 5AXDA 3UOAB 1Q0PA 4EGSA 3STUA 5GWXA 2H59A 2WIGA 2XOKD 2VYND 1KEWA 3ND5A 4OF4A 3MTAA 4WL0A 4PLZA 1N9GB 3SCZA 4ZU1X 1KOJA 3RIGA 5D86A 2C8JA 4DVGA 5GJWC 3LPLA 3UKDA 4EB6A 4ZJUA 4EFMA 5AK6A 1DIBA 1EK6A 2IEDA 4HNQA 3I83A 2WJWA 1QUFA 4BRSA 5K8JB 2C88A 2QRUA 3O4RA 3V1UA 4QKQA 4ESVA 4BQRA 4RULA 3HUDA 4LXUA 3EF0A 4JLMA 4M9SA 4MPJA 5AJHA 5CDFA 5C81A 3S70A 4ZT2A 1L7OA 1KMQA 3CLSD 4WESA 4Z4CA 4L6CA 4MWSA 2HJVA 3CX4A 2NLOA 2NSYA 3P27A 1NN1A 4AROA 4BN0A 3L93A 4ZOQI 1KQ3A 3O83A 2C7BA 3HLYA 4ZMBA 3PWKA 4DA9A 4D9KA 2HDOA 5H80A 1TCUA 2UZ1B 1N2BA 1M1ZA 2OSBA 3L2OB 5I7AA 2F48A 1PJCA 5EINA 3NP9A 3AR2A 4WNCA 4M0EA 1Z4QA 1RI3A 4G3XA 5AJYA 5JXHA 1KJQA 4ZQIA 1Y6JA 4Y0AA 2O5CA 3Q2OA 4BNLA 2Y4NA 3DYVA 5EE3A 1GQRA 1U1IA 1Z7YA 1LBQA 1KNQA 3DA8A 4LGCA 3UT0A 1ZJWA 2CB9A 4OBWA 3JQGB 4JJ8A 4TN1A 1GCOA 4EAAA 3WVNA 4ZVKA 4MUHA 3PWZA 4JR0A 2JLRA 4MKRA 5L7TA 3SZRA 2CNWA 1CLEA 4KXXA 3VJLA 2I7DA 2H57A 3TXXA 1MPXA 4JB2A 3VYUB 4AS2A 3DKPA 1XE3A 1B41A 2E4XA 4KSCA 1IBLB 5TT0A 3SD7A 2LCFA 3EZ9A 1X1DA 4KW7A 1OIXA 3PKZA 1A2BA 1BMDA 1CZKA 2CXPA 4IDHA 3F46A 3ZDZB 4F60A 5I7RA 1DKRA 4IIUA 5AJZA 4CTMA 2BM9A 4X94A 3ROFA 2A0UA 5IEBA 3ZZ1A 2PX2A 3R5XA 4BKPA 2WHRA 4FFBA 5JVDB 3OLXA 4CIBA 3A06A 3GHHA 2R62A 2IHZA 1JGTA 1OC4A 2B2CA 1CQIA 3AP2A 2O0KA 2WOJA 3FR7A 3NZEA 4HRXA 4RY0A 3SM9A 3RLFA 2VVTA 1TF7A 4FE4A 4EX6A 5J4LA 4ZK2A 4NK4A 1PJSA 3A1EA 4IRMA 1RZVA 4FGSA 5JMOA 4S1VA 5LWQA 3GJ3A 1YH3A 1NTOA 4EPXA 2I3BA 1Y8RB 5JS1A 2QAGB 1PU2A 3G9XA 1N2OA 1XCJA 4W6ZA 4Y0NA 1H2FA 1RTTA 3NRBA 4GNKA 4PYKA 4Y9DA 3OJ0A 3WB0A 1I4DD 1MX1A 4JB0A 5CDYA 3L18A 2JFOA 1ZITA 1U0FA 1RXSA 3LF1A 2PK3A 4O2BF 4S2EA 2B8TA 3EP5B 4BZZA 2C4VA 5JMWA 3HADA 3V80A 4XSVA 1GEGA 3ZU2A 5I4CA 1RXCA 2XTNA 3QVXA 1F8UA 4UMFA 4K9NA 3OWXA 3I45A 3HJRA 1FPMA 3IOMA 1VM6A 4PZCA 1XPRA 3EJ6A 1BFUA 2GZAA 1T0HB 1BMFA 5DX0A 3ZWVA 2H8GA 2WIDA 3AQ4A 3OCJA 3RU3A 2O50A 4EF5A 1TQ8A 4XWAA 3O3OB 4EIWA 1XQ1A 3FKSA 3PT5A 5C3UA 1UKBA 4IDNA 3EW7A 1OH5A 2O05A 1XALA 3FYCA 2J9XB 3C3JA 1BKSB 1WBDA 1YTLA 1HXHA 1YGPA 1J1IA 5F5NA 5C52B 3KOUA 1P1KA 2H31A 2O9JA 2UYOA 3G7NA 5DYWA 3QXXA 1GTSA 1RP1A 1EXVA 4FE3A 1JALA 3URMA 2XXAA 1MA3A 3MJTA 1D4AA 3I39X 2Q07A 1L5OA 3OT4A 4X1YA 3VC1A 2ZAYA 1B8OA 1QGZA 2QG9A 3D0QA 1E9BA 2KE5A 1QIDA 1UJ4A 3RC1A 3HDQA 5B7PA 1Z6XA 4DSUA 3ZY5A 2VHQA 3DJFA 2QRMA 3CZPA 4LF8B 3MTJA 1ADBA 1GZVA 2ZWPA 3GGOA 5HCNA 3N87A 2WYWA 3IAEA 4QYIA 4GR5A 2R5FA 1OFHA 2HY7A 5EP3A 1U2DC 1Q1ZA 3RRNA 4NZZA 2FR1A 2X9GA 2EP5A 3PGLA 5LXTA 2ZU0C 1KSFX 3TKAA 4RKWA 2X0JA 4ZHSA 1CZHA 3F6YA 3H5NA 3T7DA 2H07A 1CWUA 2PY6A 1XP5A 2ATCA 2I2CA 4K9DA 5HM8A 1QBKC 1DAOA 4PZDA 2QSUA 2QRHA 3GAMA 2R6R1 4MRMA 5J2UF 2Y1LA 1N3YA 1ILEA 2RKBA 5KJ6A 4HGQA 3LRTA 2NZVG 4J7UA 5EE0A 1X8JA 2I2WA 3ED5A 4FHCA 3UGQA 4ILKA 4TLCA 2DPGA 3DOHA 3D7SA 1CDEA 4BRWA 1D0VA 1YDWA 1FFWA 5FUXA 2OM2A 1BWPA 1H65A 2OO3A 1EDBA 3Q9NA 3QI7A 2GM5A 2Q3LA 2ZJ5A 5GZ3A 4MARA 4V0RA 2I6XA 4PYJA 1KORA 3IHKA 1KY4A 1W5SA 2CLCX 4HH4A 2JVKA 5HILA 2J5XA 4B8WA 4G9EA 1SCNE 4IZ6A 4MHSA 2RH8A 3QBJA 2PTHA 4ZAVA 5I9LA 2ZUUA 3F8WA 3P2KA 2QTHA 1DQZA 2W6OA 3ZE1B 3ESXA 3KT8A 3MPUA 5FJJA 2XB4A 3SJBA 3RPEA 3W3AH 1GILA 4GD3Q 1ZZGA 3LCCA 3B1KA 4E31A 5HJ5A 2JCXA 3DQPA 2B35A 1D6MA 3CKMA 4NJOA 4K8RB 1RSZA 1FDOA 1I7NA 3UMRA 5EMMA 3DNFA 4ZZ0A 1VHDA 1DOZA 3DE4X 2VYNA 4IVNA 1JBKA 3HBMA 4R81A 4L2IA 4FLEA 3SI7A 5LZ5A 5LOVF 2AOWA 1A97A 4Y6PA 5E9JA 2ZPUA 3CEJA 3T9AA 5CYOA 3K6SB 4JX9A 1C4KA 3BXXA 4HGZA 4NBUA 5EC8A 2G9QA 4MW7A 3WDSA 3NNSA 3SVLA 4DW8A 3HWRA 3V46A 4BPRA 3HSYA 3NEAA 5AYVA 3QXCA 3R20A 4G8DA 1I9GA 2V1XA 2IC5A 3RJ9A 1K4YA 3Q3JB 4AC9A 2CBZA 1YZVA 1G8PA 1PZFA 1OFUX 2RGCA 3E8MA 2ID4A 3R9IA 2P6OA 3VI3B 1FFDA 2VP4A 3QX7A 3IGFA 1ZX1A 1M6YA 3NALA 3D4PA 5F3WB 1C7JA 2ZQYA 3E3OA 2KSQA 5AHOA 2P2LA 2BISA 1Y34E 4IZIA 1ENZA 1M6NA 3L7BA 3T1VA 1CULC 1ISFA 5REQA 5GAJA 1W87A 3A1FA 4IHJF 4KYIB 3VR1A 4RTMA 1X7GA 2C5HA 3CR7A 1Z29A 3CRVA 3DT9A 4CF5A 4HVCA 4EPRA 4TT3A 1MVNA 3ZHQA 1E79A 1L5QA 5ELLA 3TLBA 4I08A 1E1NA 3TN7A 2A9JA 1UC9A 4B6PA 2B92A 5FUVA 3KVYA 2G28A 3KXPA 3V8NA 3SHWA 2JIQA 1JIUA 3WA7A 1XDWA 2HRQA 5L3RA 3DMTA 1LSJA 3LDHA 3DBRA 4LRXA 4QU9A 2WOOA 2QSYA 2QK4A 4YS6A 1ZKDA 2Z8XA 5GV8A 5JAQA 3AFIA 3MT0A 2BR5A 2LCQA 4BMXA 4QQ8A 3SX2A 5A7FA 5L7WA 2IGBA 4PVCA 3PUHA 4UBLA 3PEWA 2OBMA 1Z15A 3ISVA 3VHXA 4CKWA 4PZUA 2FPGA 3A04A 4ZVMA 2C58A 1S2MA 1X39A 1U7DA 2AL7A 4Q7LA 5KVVA 3OQNA 3V4ZA 1J8DA 3DR3A 4Z9AA 3JQAB 1UBTS 3F47A 4LEIA 4GQAA 5DH9A 4IHAA 1XC7A 4E2FA 5CNMA 2NMVA 2Y0CA 4DDUA 1A8UA 1UC8A 5ES4B 4D2IA 1ECPA 1PJLA 5AKXA 4BO5A 5DYNA 1WPQA 4RW0A 3T7KA 1TYBE 1ZY2A 3N2EA 3SSNA 3NBUA 2C29D 3H83A 2WYIA 1B23P 4ZAWA 2O54A 1TZMA 2GS9A 2SKEA 4COOA 1M3SA 4PN7A 1DMRA 1EXDA 2I4IA 3RHTA 3ORYA 2QXUA 4EUEA 2ZB7A 2C59A 3AI7A 1PWXA 2Z08A 4YEDA 2BI4A 4C7XA 4EL5A 3Q5EA 3U17A 4P8RA 1XDSA 2ERYA 4R1TA 5CH8A 1AKQA 5SY6A 3UB2A 5JROA 1C1XB 1A2QA 3UGJA 2JLZA 2DMRA 1RTKA 1U6IA 2YMLA 4P54A 5JU6A 1WKCA 1IJKA 3DMYA 3Q1KA 5JDCA 4CQJA 4ZCMA 3A3NA 3NC4A 1F9EA 3OP4A 2DU8A 5SZJA 1WS6A 1ZZEA 4RVFA 4WZBE 5AKEA 4EPVA 4F11A 1TAUA 4WOPA 5EUQB 4JB8A 2FE4A 4RXMA 1N4AA 2Z6QA 2C5AA 3GT3A 2LDXA 3FWNA 2JFFA 5HE8A 4EA6A 2IUSA 3C70A 4ND8A 4DDKA 4UMVA 2PGAA 1WW2A 3A32A 3GZ4A 4BP1A 1OROA 4Y6LA 4XFJA 4YACA 3K9LA 4HGYA 1WQ1R 5TGZA 7MHTA 3HZRA 1UBHS 2AD5A 2YXPX 3L9XA 2UXCB 2VF4X 1TJ4A 3SIWA 2YH2A 4GM1A 1U0LA 2XIJA 1FSZA 1ZA1A 2C2XA 1GTJ1 1NQVA 2JEOA 2PZAA 2MIIA 3FDIA 1GN8A 1O9HA 4FYVA 4ZRDA 4CLXA 1A8PA 2GX6A 3A1VA 3K0BA 5B3JA 3RG2A 5E6UA 3H9EO 3B13B 4LY0A 1CIVA 3U7QB 1XTPA 3GFBA 4OJYA 3SDBA 1A9XA 3NT5A 1XCLA 2E4AA 2J87A 1P6QA 5TQ2A 1HI9A 3THOA 3UK0A 3X1MA 4A92A 3R5SA 3EARA 1TLTA 5ALOA 3ADOA 1HURA 2O2XA 1T29A 1YUBA 2TMGA 1F2TB 4Q7EA 3CCFA 4M1QA 5TQJA 1D9XA 2BFWA 2CZGA 3DYIA 3EVFA 2LE0A 4XDGA 3PL1A 3VAAA 1SUPA 2PMDA 4QE3A 2RC6A 2PT6A 1Z39A 5IJ0B 3IBFA 3OIYA 3S4YA 2Y6VA 4DRXA 5A3VA 5IHPA 5IKXA 2OO5C 1R18A 3AEQB 2QPTA 3F49S 3L0DA 2F7SA 3H9UA 2OUKA 5H83A 2PMWB 2JLBA 2OQRA 4Q16A 5ITZB 1UDRA 2GK4A 1ZNXA 4L74A 3RFFA 4EG0A 1UXJA 4JBYA 2QGFA 4XCXA 2A0FA 1JE1A 1E7YA 2RC5A 1WVMA 4C7VA 1ML3A 4IIVA 3I6YA 4N39A 1FDUA 5EKTA 4US2R 1RR6A 2HRDA 3S2SA 3CRZA 3OECA 2BP7A 2I3ZA 3T3EA 1SZPA 4CDNA 4U63A 1GOTA 2FG7C 5TVGA 3LWDA 2IWHA 1U0NA 2E82A 4YIHA 5ADUS 5JECA 3T1TA 5AKIA 3QI2A 2PJUA 4RLFA 1YR9A 2JIDA 3D1JA 4WACA 1IUOA 3HI4A 1JPUA 4XLTA 4EI9A 3HCEA 1SZDA 4P33A 4QBIA 4EMBA 1QU3A 1VLQA 5TQ0B 1RJDA 4CODB 1UP6A 3JASB 4YJ2B 3NETA 1MW9X 2YBEA 2ZCVA 3MBOA 3E1SA 1LNQA 4NLLA 1NFRA 2B37A 2ORYA 2AMLA 3P0FA 5ECWA 1Y42X 4AYXA 3ES9A 4BNIA 4V1CB 1HYBA 1QGYA 1B6TA 3OOEA 3VA7A 1V1MA 4OUDA 1N1MA 5FA6A 1L7AA 4OSPA 4TMTA 3ZJVA 4JLJA 4Q39A 3GLHB 5AESA 3OQ1A 3AI2A 1PF7E 2GTPA 4I5GA 4TMWA 3HJNA 1RPNA 4PCAA 1VJ5A 3A6DA 4X45A 2CE7A 4K9MA 4A6DA 1OAKA 4PZAA 1QQ6A 4QEDA 3KZNA 1N9ZA 1IUKA 1G55A 2C2GA 2FHPA 4IMIB 3RYHB 3QV1A 5JVDA 3HA7A 3G79A 4OM7A 4QREA 4NU6A 3FAKA 3M6WA 5FBLB 5T67A 3NYIA 1ZL0A 2WWHA 4FMBB 1WD7A 5A9SA 4M46A 4XSGA 2NZWA 4DSAA 5KS2A 3RQSA 3EIEA 1SXPA 1I2DA 4AN1A 1I30A 3GUHA 4ODIA 3UA3A 1SQ5A 3A1DA 5A3SA 2XUGA 1RRMA 3GMTA 3IAUA 3UMJA 4WBSA 1BROA 2XDQB 3QLVA 4GOKA 5FBKA 4H16A 4KQWA 4EA8A 2NSHA 3GBSA 4TV9A 1NBMA 4L4ZA 3R8CA 4EY6A 3A0RB 3Q7QA 3QVLA 3L8FA 3RNOA 4IG4A 3QWFA 2WUDA 4DV6B 2WKRA 1WEKA 2Y1CA 4HGPA 4S3MA 4XQCA 1II9A 2BKVA 4IZHA 1GZDA 1KXJA 4TS9A 2YY6A 3ND6A 1L5WA 5KIAA 3Q15C 4AURA 3K73O 2ZBDA 1UBRS 2ADFA 4LK2A 3TLCA 5JG7A 2EZ8A 1H8EA 1P9WA 5DNAA 4OG2A 3WLPA 4C7BA 4HNRA 5H4GA 1XCGB 3VH4A 5DF1A 2J5KA 4LJ9A 2BZGA 2HIGA 3BCSA 3ZD8A 2VJQA 2O0LA 1GNLA 5BUZA 5FWYA 4XSHA 1KDZA 2X6QA 4I4IA 4IICA 3HL4A 3TQTA 2BM0A 1Q1EA 3NDJA 1VE9A 3P0RA 2VDRB 4AY5A 5DJ5A 1ANKA 2JH3A 4WESB 3EEIA 2DWPA 4UMEA 5DHSA 5BQXA 3ZH2A 1USWA 3LT4A 3IWCB 3DNMA 3EF3A 4NI5A 4R1SA 5ALRA 3KLOA 1COWA 4YRRA 3PC7A 4HHEA 2HSEA 2Y05A 1JDVA 4CIDA 4U7DA 3IR6A 1CJSA 3SVTA 4QATA 2JGDB 3CSDA 3I8XA 2GD1O 3PNPA 5HR5A 1DWUA 2BV3A 2RH9B 5CX1A 1TK2A 1E4YA 3RS8A 3OZEA 3GIDA 4XWOA 4N47A 3RHSA 2XCRB 1PR6A 1FVOA 1B15A 4QDTA 1LRJA 2VJLA 1N9GA 4Z9FA 1E9DA 4K9KA 4YJKA 4HLCA 4CBVA 1KS2A 1Q0UA 2R6FA 5CT4A 4J91A 1GKLA 1KAQA 4MR7A 2JGMA 1ZRHA 3D02A 1QP0A 4GFDA 4HY3A 1RHUA 1T3SA 2FKNA 2JCYA 4C2AA 4CL3A 4LF7B 1B7GO 3DBHB 3MGBA 4N0EA 3Q7TA 4NX2A 4MEJA 3CEPB 4WK0B 4KBGA 4PSDA 2R1VB 1AZWA 3VNQA 3WMEA 3O8CA 1X9IA 3PQ6A 4KEAA 2CNOA 5BY2A 2VT3A 1E79D 2QL6A 1Z3CA 3RIYA 4RTRA 1BVRA 1OQAA 3H84A 1GZSA 1X7DA 4Q9JA 1XJQA 2QNIA 1OYVA 3GWZA 3JQ9A 4IZOA 3C5HA 2H1RA 3PHIA 3I3SR 4ZWNA 2JGRA 4L75A 4KR2A 4Y6OA 3N76A 3PXGA 4P0QB 1LD3A 5CFMA 5JEEA 2WG2A 4NP6A 4HGRA 2QTBA 4CXMA 3OQVA 2BUAA 2AB0A 2C5EA 3NDIA 4XYEA 1T0PA 2BGJA 2AFIB 2ZSEA 3DBLB 3UOGA 2WG1A 3KL2A 3AKYA 4UOEA 3NHSA 3WGYA 2QZ4A 3BHIA 2EFEB 4PONA 4F4FA 3FRHA 4QEZA 4PS1A 2QUBA 3ZDRA 2W4IA 1XAIA 3G23A 4ERNA 4C2UA 1XSEA 1SG9A 3ZHYA 2WA2A 4G41A 4JGIA 2VIIA 4X7PA 3RBVA 2EVWX 4XTRA 3MUEA 2PX5A 5A5EA 1JFRA 1OXVA 1HL7A 4DMRA 3CY6A 3GRFA 5KAMA 1J2EA 3E58A 1Y81A 3TJZA 4CKBA 5IUNC 4EMSA 4ARBA 2R7NA 3DZIA 1Z0UA 2BKAA 4RCYA 3RYFA 1SD2A 3FMOB 3C0KA 2O7NA 1FP4B 2ONYA 4I9UA 4MLDA 3HGQA 3EYWA 3STVA 1ZUNB 1SZJG 2GTHA 3ILVA 1VL8A 4R71A 5AM1A 2WYOA 4OQXA 2O2ZA 4K88A 5BNFA 3N05A 4QO7A 4TZKA 2EV9A 4DNOA 3H5TA 2PR2A 3EH1A 1KOLA 3WO1A 2C57A 1SQ0A 1M83A 1IZ0A 2YXNA 3ZY3A 1JRLA 5BN3B 3V1NA 3DOUA 1ZBDA 5LP6A 2X1LA 2V9PA 3AU9A 4QUAA 4U0KA 5J63A 4OLBA 3JRNA 1SKAA 4DAEA 4RKFA 2EQ5A 4Q3NA 4EUNA 3F96A 4K3UA 4N0PA 1PEKE 1GGKA 1KK1A 4HD8A 4OLAA 3KOXA 3GLTA 3F3SA 2BTEA 4HAYA 3W5AA 1OYWA 2FRDC 5IKPA 1TYCA 2GN0A 4R2HA 4YWHA 4LS3A 2VUSA 1OZ0A 4FW8A 3UTCA 3R5JA 3DL4A 4JEMA 3U9SA 3ZIAD 4IGIA 2WYUA 2XZDA 3KAQA 4M0LA 2E4UA 1ZRNA 3BXOA 2Z1NA 3HWX1 3N70A 1ISIA 2JK0A 3C8DA 3LGSA 4JDPA 3RU7A 1Z0KA 2OFFA 3A4VA 1H9BA 2ANBA 4X65B 3VUEA 1CZUA 2WU4A 3KD2A 4LBYA 2NADA 1M1NB 4P81A 1XWIA 1VSQA 1JW9B 3GGCA 4CLRA 1V9CA 3GZNB 2GBFA 4X8LA 2V8OA 4NCAA 3EXHA 4HDOB 2FEXA 1P2VA 1XRLA 3RBAA 5B1YA 1TKAA 3OCYA 3BMNA 2WM3A 4RHCA 1TOAA 5CW2A 3VFDA 1W96A 1T3TA 1ZSNA 621PA 3VR2A 2GJKA 3UCXA 3L0PA 1A7AA 3RVDA 2DC1A 4A6EA 1RQPA 1DARA 1FTSA 2Y92A 5DLQC 1QIHA 1NFQA 5U4QA 4BJ1A 3II6X 4I4LA 5CIQA 5FUBA 3C8HA 2CHEA 3PDWA 3PFKA 1MO2A 2CL5A 4WLOA 2XVYA 5K8LA 4LY3A 3B89A 5EQTA 1PR4A 2E5WA 5LB2A 4V0SA 2ORED 3KU1A 4NE9A 1NXXA 1XB2A 2Y1GA 4DGQA 4QYMA 1V5FA 2FLKA 3JYOA 1WUIS 2GPYA 2RGEA 4W6QA 5IAGA 1O6FA 5FEUA 5EEGA 2OV6A 4YX9A 2QQFA 4N7JA 4KL8S 2G07A 4YT2A 1J4AA 4UHKA 2F62A 1M2VA 5FFMA 1R4ZA 2GCEA 4KNVA 3LX6A 4MQFB 3WWCA 4Y1RB 3NTLA 4KN5A 4WXMA 2L19A 3ITKA 1QIIA 3ICVA 1G9TA 3O5AA 1DKQA 1EA5A 4IEFB 1NVVR 3HZZA 5DTRA 4D4LA 1I01A 5I5GA 4MWBA 1LTKA 3IQIX 4EA7A 1EXMA 4LDAA 5JJBA 1Q84A 3D8UA 4CNBA 1FZTA 2XA1A 2YHBA 3ZU6A 4F04A 4Z4QA 3OZGA 5G4KA 4WD3A 1ZHFA 4PGAA 5KC9A 1R0ZA 1MD9A 1ZH6A 4LFBB 1BS2A 1EA7A 3W9BA 4MDYA 4BNGA 5HNKA 4O4HB 2CEKA 3KXKA 4HF7A 1MHTA 1H4TA 5A3JA 3BG5A 3TLKA 3PNQA 5C5EA 4PPQA 2VRCA 2VDWA 3WTBA 3CS3A 3D8RA 2QBYB 3C98A 2NU6B 2AJCA 2XA2A 3PXXA 4RFVA 3HDHA 4GXTA 1SUWA 4ZT5A 3H04A 3I2FA 4KOEC 4ZEMA 5BSHA 1TEVA 4H2DA 3AYXB 4YLYA 3DZ2B 3TG2A 4L76A 4E6EA 3ICQB 1EEHA 5FA8A 4P5PA 1RWXA 4JQCA 3FPAA 4HWSA 4KFRA 2ZVJA 4PWZA 2AFRA 2PX8A 4CIWA 1CQZA 2PCLA 1G2PA 4ZI7B 5DN6D 4UBKA 1WF3A 2G9UA 4J2TA 1SOVA 3WSTA 4J0CA 3SXJA 1G5PA 3ZCVA 1AK2A 1PT6A 2GXQA 3BZWA 3PLAE 3IEXA 4N3AA 5JD6A 1WBJB 2ZSDA 2QLNA 1SZCA 4L8WB 1S8NA 4W4TA 5H3CA 5ADHA 5HDQA 5F2NA 3VPDA 4ACBA 2JZNA 2AVDA 2B6HA 5IAEA 1GYPA 521PA 4BP8A 4DHWA 2B25A 4QJ4A 1H8ED 1M2VB 1B8UA 3CX3A 4HAWA 4MCJA 3T7JA 4CIVA 1TTTA 4J3NA 5M2QA 3RUHA 4EG1A 4L0DA 3QEAZ 4V1CI 2HHHB 3REFA 1AU9A 2V7QA 1UBOS 4JZKA 3WGVA 2PT5A 3GDHA 3EIHA 3ZVMA 2E3JA 2WMDA 1G3IA 3H4MA 3K1ZA 1SPXA 4JP5A 4PXAA 4W9MC 2VDOB 2J0UA 1ZVKA 3CSUA 1WMEA 3K30A 1ES9A 3MWFA 4FYWA 5G0VA 3OICA 3OBBA 4DQ0A 2DGDA 5TF4A 1O5TA 2B7LA 1GU0A 1MQ9A 4LSGA 4XR9A 3HCPA 8ADHA 2NVUA 1ZM7A 3H1TA 5AVQA 4OHKA 2VPQA 5HYVA 1I2CA 1XNHA 1GLNA 2ZRAA 4HWKA 1YBHA 4HDSB 5MHTA 3QQ5A 2F4VB 3HNPA 1L6RA 2V6FA 5AM5A 2QUAA 3GLIB 3K8ZA 2OPBA 4MTLA 5F5XA 5T73A 3SEFA 3WV4A 5LNK6 3HLKA 1J2JA 3FF4A 3THYB 5SYNA 3PEYA 5C1PA 2GRJA 3RRFA 3MM4A 3BZUA 2IKSA 4YRDA 2WNSA 3TLAA 3FRIA 3W79A 5HOQA 4HYYA 5E0KB 5K3CA 1S01A 3CZCA 3QLEA 1U7XA 4GYKA 1PJQA 3GUVA 3CUKA 3I6IA 3LQ2A 1U2RA 2G1KA 5JJIA 5IJ0A 3NIGB 1AUOA 1ZUWA 2PQMA 2V54A 1J42A 2JFUA 3RSSA 3TDKA 1DXYA 2WVJA 1ZWKA 2A9VA 3WRYC 2VYVD 1H3NA 3I04M 1KWGA 3RSHA 5AKJA 5DLYA 2X1MA 3CSSA 5J4KA 2CLMB 4QDZA 2FZWA 1S2NA 1M6EX 1PL8A 2PYIA 2I2BA 2WD9A 4P2BA 3A14A 4ZEOA 2FPPB 1U7WA 2ZJ2A 1TVKA 3ZE0B 4GMGA 2HRZA 3PUIA 3AR7A 3F2IA 4FWBA 4HX5A 3TOVA 2RGYA 3OU6A 4FI3C 5HZGA 4NCBA 3BHNA 5K51A 4O0LA 4AECA 1PS0A 4IM7A 2CSXA 2HF8A 2EJWA 2ZUEA 2LGJA 4IXNA 3ZQJA 1O89A 3K5WA 1W36B 5DE3A 5CP8A 4PLTA 3JPWA 1SXQA 3ACBA 4UTPA 3FOBA 3P4YA 4KQCA 2ZRGA 1RXWA 2YWCA 3OU7A 1IN7A 2V65A 3KE8A 4OSEA 3CQ9A 4GOMD 4D96A 1IWBB 3OTGA 1CF4A 2DKOA 1H2XA 2Q62A 3L8DA 4PYQA 4DR2B 5H8WA 1YBAA 5IBQA 1EFCA 3B36A 3ADKA 3F90A 1UWLA 5I4BA 1PFUA 1FBNA 1W8IA 1J24A 3GGPA 4U0JA 2F1JA 5EXTA 4LF9B 3I12A 2IUTA 1B42A 3QTTA 3RVMA 3H1AA 2PSHA 4A1OA 1WWKA 5FLEX 3CZMA 5AVSA 1KZ1A 3IUBA 4NSNA 4Z8YA 3Q3EA 3HB4X 5DSZA 2B8NA 2AR0A 2WEKA 5GOZA 4BO7A 4TL9A 1KI7A 2PLAA 2W6JD 2YUTA 3K8OE 3R76A 2F1KA 1SIUA 4ZC8A 2JJMA 3BMCA 1GU1A 1YS9A 1QC5B 3CX8A 3EXG1 4HPWA 1E0KA 3NPAA 1VB5A 3TV1A 1XJ0A 2GZSA 2X3FA 2A1IA 4PHCA 2P1ZA 5CLFA 3ZWCA 2IU6A 2GJAA 3B82A 3TGPA 4RTOA 5AFSA 1E2IA 1YNOA 1FFCA 4CQMB 3M6UA 4LIPD 3JD2A 2WYVA 1E20A 2G9NA 1KBOA 2PUBA 4B45A 3T3HA 1ZGGA 1BFDA 2WDZA 1LS6A 2I8CA 5KHLB 1NRWA 2YY5A 4OKIA 5AJXA 2HTFA 4GR4A 4LFAB 1EB9A 5IVPA 4PNZA 2QS9A 4EA9A 1VC2A 4MDEA 2B99A 1F5SA 1QB8A 3KWFA 3SOZA 4TLBA 4A7PA 4GI3A 4Q9NA 3DDSA 3LC7O 4EG4A 4ENUA 5IEJA 2ARKA 4GYWA 3HO1A 1C3OA 3DBHA 5KUTA 1W5BA 1UBCA 4NS1A 3WGTA 5KTOA 5K3DA 4XARA 3EFBA 3KZ1E 2PU5A 2OYCA 3EYAA 1M2OB 3L8CA 1OBVA 1FDTA 1KFJB 3A70A 3X2SA 3PC4A 1LC3A 4PAWA 4RJJA 2HKIA 3QNWA 3I0NA 4XGRA 4WFJA 4L5IA 4R9SA 3WX0A 3W5BA 1QZTA 4NE2A 1IK4A 4G81A 2EKDA 3FGZA 3FR8A 2RGAA 5CTAA 2GASA 1YQDA 4C88A 3KTAA 1T4BA 3L49A 5D7BA 1PVOA 5TLSA 4GRAA 5AIAA 2FJ0A 5CX1B 3RR2A 3DC2A 4NF2A 2C2WA 2GXSA 3KRTA 1KIAA 3MZ0A 4MMYB 5IX8A 3GLRA 3U09A 2JI8A 4ZIRB 4LJ8A 4DPMA 3FIUA 2BBTA 1QQ7A 3IESA 3QBEA 1KJ8A 1WSBA 2FQWA 1BAPA 1JR3A 1Z16A 2HF7A 3PUWA 3PP8A 3FWZA 3A9WA 3EGVA 3MQFA 4TXLA 2AOTA 3C7TA 2W42A 3AILA 2C82A 2Z30A 2IYPA 2YXBA 3CMCO 3F8TA 1I3KA 4BRUA 4G1BA 2QX8A 3QEOA 5GONA 3VZSA 4WRRA 5HMLA 2WAYA 2NSLA 5E6RB 3ABIA 4PV7A 4X8MA 1PZEA 4JOCA 5BVHA 4MOWA 4FDAA 3LUBA 1F1JA 4L2IB 4CW7A 1WMFA 4IQ8A 1BE6A 5DWVA 1NFFA 2OGZA 4BV2A 1EVLA 1KHTA 2Q27A 2Z98A 4KGZA 1GYRA 1RI4A 2IEIA 3I6BA 3LY5A 3WGNA 4GOLD 2HLNA 1U4SA 4TQUS 5CG2A 1DBSA 3NOVA 5KPDA 1LLQA 5FP0A 5AKKA 2V7QD 3PQ4A 4UZFA 1Q17A 5EP2A 3UJPA 2UXDB 3O4HA 4I1IA 1D3AA 1IN4A 1NNSA 1OZHA 3OCCA 5EJFA 2BGIA 3HH8A 4DM3A 2JFNA 1KH2A 4PNHA 1Q12A 1JAXA 1X38A 3DG9A 1TQ4A 4UCFA 4L9RA 3CJRA 3CPJB 4MGYR 1CYEA 4KACA 3H19A 1Z2DA 4GICA 4NL4H 3OJOA 3RUEA 3LT0A 5ENZA 3UT5A 1YQXA 2RG7A 3KQQA 3W3AA 4F7WA 3BKXA 3ND9A 3SFVA 3U9TA 1NXWA 1B14A 1X87A 2VF7A 3CG4A 2GPTA 4J0DA 3EDQA 3IPYA 4JKYA 4XA8A 1LV8A 4EW2A 3BORA 1XVTA 4MWZA 3CR3C 3MJFA 2CV1A 2Z5GA 2D2XA 4FMCB 2FOIA 3BWMA 3SX0A 1QH0A 1R8JA 3WADA 2HJHA 5P21A 2J31A 4LYFA 4RDHA 3ENZA 3ZWOA 2VWGA 3B6ZA 1SC1A 3O38A 1MO4A 3ZQUA 3ZHOA 1TO6A 2JIMA 4MW2A 2WJPA 1UADA 1YUMA 3IXMA 4MQBA 4S12A 4J4TA 2Q9BA 2YN0A 3EXIB 1GTRA 3EVBA 4ILEA 1GG2A 2H17A 3D4BA 4OTZA 4RVGA 4EKEA 5LXTB 1Z28A 3UF0A 3VOAA 2IFTA 1NL3A 2MTBA 4OBXA 4KK4A 3GLKA 2ZRCA 3CX7A 4EHBA 2H51A 3IAAA 4XVRA 1QO0D 5TQ0A 5EWMB 4W9NA 5ERGB 3SC6A 1IXYA 1ZGCA 5F9HA 3SGLA 4BQSA 1RRGA 3NUZA 5FQNA 1RJWA 2PVPA 4GLOA 2OKCA 4ZYTA 3O1IC 2OBNA 1PLLA 2AA3A 1DKLA 3H1PA 1NXQA 3O9MA 4DA7A 2ALJA 2NYAA 2E9SA 3V1KA 3WL7A 1GGFA 4EVQA 1POWA 3AUTA 2AX4A 1ZNQO 5JYCA