4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase 1
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
2ZJ1A 4RPLA 3PLRA 2WEKA 4WECA 4WKGA 3JYQA 3TZHA 3GOHA 2Y1CA 1I2ZA 4IUYA 1H6AA 2A4KA 3ZNOA 2R00A 2BMAA 4XIYA 3LT0A 4TZKA 1OBFO 5FI3A 1HE2A 4WOJA 1GEGA 5JBIA 3TNLA 4GGOA 4ALLA 1HZZA 4E31A 5LDGA 1VM6A 2EIHA 1IHYA 4E32A 1VPDA 3VKUA 2V6FA 1E0DA 3DO5A 5EL0A 5A04A 2V7PA 2Q1WA 4PLHA 3WGIA 4R51A 3GUCA 1O95A 4LRTB 4J2HA 4BNLA 4I5EA 1LX6A 4QT0A 5JMWA 1GZ6A 3ENKA 4O59O 1QV7A 4RORA 4DBZA 2VWQA 1O8CA 1F17A 5AXCA 5J9GA 4G5HA 4J43A 2J3KA 1BHSA 3JCZA 5B1YA 3ASVA 3W4JA 4B7UA 4GSKA 3OFSA 3PEFA 1RJWA 1ZMTA 3VZQA 3H5RA 1I30A 2PKQP 1YBVA 1N2SA 4D3DA 3LC1O 4CPDA 2HJSA 1LNQA 2BF7A 1U3WA 4J9UE 1IE3A 3CINA 1MFZA 1N9GB 4GWGA 4IIUA 1GYRA 1E6UA 2ZB7A 4ZA2A 5B4TA 4A0SA 3EW7A 1QKIA 4UULA 1B14A 4P22A 3HDJA 4F46A 1LDGA 4RVSA 4BQPA 5MDHA 3IMFA 5EESA 3ORFA 1QV6A 4CLOB 3WTBA 3E82A 3AUAA 5IXSA 2C2XA 3RWBA 4I9NA 4EEXA 3KRTA 3EVTA 4CL3A 1Y9EA 3D4NA 3TZ6A 4HADA 4PLCA 5JYFA 1LRJA 2JD1A 2NADA 1Y8RA 2UAGA 3GG9A 2G82A 2B4QA 3WLEA 1W0CA 2IXAA 4UAGA 4YAIA 2OBYA 2DC1A 3JD4A 4U0KA 1GYQA 3PHIA 4CUZA 3GGPA 4FFPA 5DP2A 2ZKLA 2FMUA 4IS3A 4NZ9A 3BMQA 4U7WA 5ICSA 1NQTA 1EUZA 4IJKA 3OQBA 4PG4A 4BO4A 3ETGA 3L4BA 1XWFA 2FWMX 5U4QA 3VKVA 4Q3DA 1NX6A 1KS9A 3BMNB 3RUDA 3LF2A 3CMMA 1TT7A 4ZRMA 4MVJE 1W8DA 3ITDA 4K26A 1YOVA 4YA6A 4BOYA 3H2ZA 4JBHA 1U2GA 4J4TA 3AFMA 4YJFA 1XEAA 2C07A 5LCXA 3GDGA 5L40A 3FPLA 3I9LA 2J8ZA 1PGOA 4BKOA 3A14A 5B12A 3JQBA 3M1AA 4LCJA 1MC5A 3OSUA 5JC8A 2VNAA 4RPHA 1Z45A 1U5AA 1XHLA 7ADHA 1E6EA 4NBRA 3RC2A 2XF8A 2CUKA 2BH9A 2QQ5A 1IL0A 1HL3A 4MKXA 3PVZA 1ISMA 4LMRA 5HA5A 3JQDA 4KUHA 3DOOA 3WFIA 1IB6A 3DHEA 2QX7A 3PFWO 4PCVA 1N9GA 4WK6A 3Q3CA 4NFYA 4B8ZA 4MVJG 3GHYA 5KJ6A 4CLHA 4PRLA 4W6ZA 1NASA 3G0OA 4J4HA 3DWFA 1T2DA 1SB8A 3FTPA 1NFQA 4CLOA 3DMYA 4LCEA 5AXBA 3O26A 3F47A 2UDPA 3GRPA 4JJFA 5FF9A 1I3NA 2CY0A 3C1AA 1Y7TA 3AUUA 3OIDA 3RQSA 3VH3A 4WASA 3PYLA 3NTQA 2ZQZA 1PR9A 3JQ8A 2XAAA 2OGUA 1SEPA 2BKAA 2AQKA 1MV8A 1E3WA 2HMWA 1ISJA 1I0ZA 2NUAA 3DZFA 2Q49A 2C5AA 4IJWA 4CM6A 1Y8QB 1H93A 3WX0A 1HSZA 1P74A 3DZJA 4M54A 4Z0HO 4BNHA 4B4WA 1LSJA 4U6SA 4BNTA 3WB9A 5ILGA 5ADHA 4CMAA 5TGDA 3ANNA 3JQ9A 4YQYA 1NWCA 4E5YA 5IDXA 1SC6A 4CMGA 2NSDA 5IJZA 4FFOA 3STHA 2HDHA 4WUVA 3UXYA 3IUSA 4BNMA 4EEZA 1GZ4A 2EHDA 1GR0A 4WLUA 4NNJA 4IZHA 3AM4A 2EKQA 4LVUA 5L7TA 1ZK2A 3LZ6A 4GSLA 3GDOA 4FD3A 5AVOA 1A9YA 4PG6A 1T1SA 4GH5A 5F5NA 1B26A 2AQ8A 5IZCC 1WAMA 2AG5A 3DZKA 3ZV5A 1QLHA 3B1FA 4CM1A 5JDIC 1OI7A 4IXWA 3D3WB 5JE8A 4F6CA 2SCUA 1P1HA 2DUUA 2VYND 3GQVA 1UDCA 2PWZA 4UEJA 4W7IA 2VNSA 1PGPA 4L4RA 4I9UA 1RYDA 3JYPA 1T2FA 3KYDB 4HFRA 5DNAA 1E1MA 2FSSA 1QXSA 4J1TA 1OMOA 4PG5A 1X7DA 5A9SB 4CV2A 1JWAB 2WTBA 1M6WA 4MKRA 5IXYA 1HDGO 1IZ9A 4BO9A 4CV0A 2DTEA 2AEFA 2IZ1A 4CMBA 1VJ1A 2GYYA 1HDRA 1CF2O 4XQCA 3OJLA 3QHAA 3FSRA 3HG7A 2A9FA 3ZWWA 4IDEA 2X9NA 4BKUA 4ZGWA 5KCZA 4S3MA 1GFSA 4Y9DA 4BNXA 2Z95A 3HHPA 2Q50A 2WYWA 1CIVA 2V6GA 2Y0CA 3A28A 4JX8A 3R1IA 3W6UA 4CM5A 3E18A 2X86A 1BVRA 3GT0A 1X1EA 3JQEA 3ZW8A 1H6DA 3G17A 4CMJA 1W73A 2JFGA 2BELA 1XLTA 2QZZA 3DBLB 3GVHA 2LDXA 4FDAA 4BKRA 5CDUA 4HXYA 1ADGA 2A35A 3H5NA 4D7AA 1HDYA 3TWOA 5L51A 3JD2A 3GLQA 4XYBA 3U9LA 2O23A 3JQ7A 4G65A 2CZCA 1U8XX 3ROQA 1DO8A 2X9VA 3DTTA 5COQA 3H9QA 2HQ1A 3FNEA 4AVYA 3DHNA 1YS4A 4AFNA 1W6UA 5JDCC 4Y98A 2Y68A 4MVJA 1VE9A 3DHYA 3AUSA 3GR6A 1P1KA 4IS2A 3GFBA 1GPDG 3E1KA 5JS6A 2RCYA 4YAJA 5AQ1A 4XGKA 4GVXA 2VRCA 1YL6A 2Z1MA 1N1EA 3WBFA 4XGIA 4CM9A 4PRKA 2P91A 1PL8A 5BSEA 1T24A 2YDXA 3I52A 3MZ0A 1ZBQA 2Y1DA 4RF5A 1QRRA 4UVHA 1E3EA 1UP6A 1E7MA 2CNBA 3WGQA 1GPJA 1Z75A 2VTEA 4DTIA 1U9JA 3UICA 1LRKA 4PZDA 4YAGA 1ONOA 3PHHA 4M49A 4CMEA 3CH6A 1A7AA 4PZEA 4RZHA 4QX6A 1V35A 1XCBA 1P0FA 3E8XA 3KYDA 4OIMA 3E5MA 3SVTA 1DC5A 1YJ8A 2VZ9A 3K8ZA 3LYLA 3ZV4A 4XYMA 3PDUA 4GX5A 3LT2A 3OEYA 3ONFA 3NJ4A 4Z9YA 2Q45A 4MDHA 2X5JO 4CMKA 4D3FA 5G4KB 3EZYA 4R68A 4YBZA 3WDSA 5IFLA 2HCTA 3LSYA 5TNXA 4AJOA 4I8XA 1JQBA 1BWSA 4KTVE 3KLMX 3I9JA 4BIIA 4CQMA 4MVJI 4BO6A 5U9CA 1ISGA 5DP1A 4E5KA 4HKTA 3ZWYA 3ONEA 5IN5A 3NGLA 1DJNA 2Q46A 4R69A 1TVEA 4R5HA 2TMGA 4OQZA 3BXXA 2C7GA 2ZYAA 3NUGA 1BTOA 3KEOA 2FP4A 2WM3A 1UR5A 4M55A 4QTZA 1U28A 1ULSA 4YRDA 3K73O 2ZTLA 2ZTVA 3QWAA 1P1IA 4IQGA 1Z7EA 1LSOA 3VVBA 1JAXA 5DULA 2O3TA 3NEPX 2E49A 1Y5RA 1DDOA 1NQAO 2VOEA 3RBVA 5TS3A 2OP1A 1DC4A 1P33A 3AUTA 1DC3A 4RF4A 4J0EA 1B8PA 4PZCA 2CMDA 3R3SA 2IE0A 5TSDA 1LQUA 3RC7A 1ML3A 4RLHA 1D7OA 3PPIA 2BLLA 3OP4A 2Q4BA 1UXGA 4EW6A 4N5NA 3D0OA 2PKRA 3DQPA 4YJHA 1R16A 1JVSA 1E1NA 1DJQA 2CSUA 4DRYA 3ZW9A 3TFQA 2ZQYA 5HTOA 2QRJA 1YWGO 1WNTA 1P3DA 3GVCA 1LXCA 4CMIB 4O1MA 1O94A 4E21A 4EUFA 2EG9A 4JP3A 4YPOA 3E6AA 3EVNA 4L73A 3GNSA 4J1SA 2EW2A 5B37A 1BXZA 4AJHA 4MIYA 4MKZA 2VUSA 2R00C 3LK7A 1V9LA 2JFFA 1TT5B 2EERA 2UVDA 1A71A 3NJ8A 1WZIA 4MPDA 3OIFA 4UUOA 2GPTA 4CR6A 4C7JA 5IF3A 3N7UA 3H9EO 5JY1A 4RQTA 3M2TA 3PP8A 1GL3A 1PQUA 3S2GA 2GERA 3UFXA 4N7RA 3ADPA 1BW9B 2HMUA 3AOEC 3NV9A 3NTOA 1IOLA 3PJDA 3RVDA 1ENYA 2GO1A 1ZJYA 1K6XA 2QZ9A 2ZB4A 3JQFA 4M89A 4WCFA 2DU8A 2AQIA 3EHEA 3U4CA 1T26A 5G0TA 3TRIA 4CJXA 1V0JA 3I4CA 1ADCA 1AGNA 3L6EA 4R9SA 1DFGA 2C20A 5TJHA 3Q9NA 2FR8A 1HDCA 1ZW1A 1EK5A 4FPXA 1ZCJA 4F6LA 3C3XA 5T8KA 3JQFC 2FPGA 2YYYA 4M1QA 3BMCB 1MP0A 1RYEA 4BO2A 3GVXA 4MVJH 4S1VA 5JSFA 3GPIA 5FFFA 2NTVA 2W98A 2E6UX 3NT4A 4DLAA 1DAPA 4YRBA 2DUWA 1SZJG 3PYXA 1WLYA 4Z3DA 3KSDO 1I32A 2NVWA 1TA4A 3ABIA 4DA9A 3CKYA 1PZEA 3A06A 3I23A 4F45A 1GADO 1DRVA 1IYZA 4RCVA 3NRCA 2BI8A 5JC1A 2XXBA 5J23A 5F1PA 3F1KA 4R16A 1NVGA 3KUXA 2GZ3A 1K0UA 2VWHA 1AHHA 4K28A 4ALJA 1HYHA 5IDWA 2HLPA 5F1OA 1Q0LA 3IL2A 1HXHA 1YKFA 1DLIA 1HLPA 4PIVA 4MVJM 2Q2QA 1GQ2A 4YEDA 1IY8A 3D7LA 4WLVA 4D0SA 3DBRA 3TDKA 1NHWA 3GNTA 4WCFB 3GF4A 5TIIA 4OXYA 2JCXA 3WYBA 3TFOA 4ZN6A 3L4BC 1YBMA 5ITWA 3PZBA 2GN8A 2RHRA 2A92A 2Y66A 3MCVA 3OICA 3VPXA 4DVJA 1XR3A 4L0QA 3JD1A 4A26A 5DDIP 5IDYA 4XB1A 5KJEA 3AY7A 4EITA 1PJLA 3P2YA 2X58A 2VZ8A 4HBGA 5TX7A 3JQCA 3QVTA 3QLJA 3UF0A 2OP0A 3W4KA 2Q99A 1G6KA 1HLDA 1DIGA 2B36A 5ER6A 1X0VA 3FNHA 1YRLA 4G81A 3CMCO 4ALMA 3DZIA 1F06A 1WP4A 1LU9A 1H9AA 3JD0A 2VT2A 2AXQA 3V2HA 4WJZA 1NAHA 2AE2A 4J1QA 4Z9XA 5JYEA 2UUOA 2PH3A 1IHXA 4EJ6A 2I5PO 3QVXA 3JTMA 3M2PA 3ETDA 4AJIA 3NDRA 3KYCB 4Z0PA 2WSBA 1LDMA 3K2EA 2OFPA 1KEUA 1MG5A 2O3RA 2PD3A 4Q9NA 1MA0A 1YB5A 3JYNA 1N7GA 3D64A 5EQFA 4A2CA 1EE9A 2YZ7A 2RHCA 4BNUA 4DWVA 1B15A 5DZSA 3C8MA 4HWKA 1I36A 2DTXA 4H3VA 2PZLA 1M2WA 4Z6KA 4PFJA 1ZKMA 4QFDA 4W4TA 2VN8A 1E3IA 1FK8A 5HM8A 3QIVA 2HMTA 4WLOA 3B6ZA 3AOGA 3G49A 1G0OA 4RVHA 3PTZA 3TZKA 4GI2A 4IJUA 4UVEA 1CJCA 1ADBA 4YYZA 4L74A 4PLGA 4DYDA 5L4LA 4WNIA 2HRBA 1N5DA 3H9UA 1ZO8A 5DBIA 3IKTA 2P9GA 3OA2A 2ZCUA 1JW9B 1R0KA 3GEGA 1EVYA 1K3TA 2JD2A 4NU6A 1XQ6A 2B4RO 1R4MB 1ZXLA 3C7DB 5K6AC 2JAHA 4TQGA 4CM3A 4RVGA 2Y1EA 1U8FO 4OOFA 2FZEA 3H7AA 1DBVO 3BYZA 1UH5A 1PS0A 4D44A 2AQHA 1MG0A 5F21A 6ADHA 3TF5A 1U2DA 4BQRA 3C85A 3IP1A 5ENVA 1EUDA 5I9LA 5B4UA 2OORA 1V3VA 4W82A 1H2HA 2JHFA 4D79A 1ISIA 1I8TA 3I9MA 1EFLA 3ZGYA 4OM8A 1K2WA 2WE8A 5EERA 4GVLA 4JJIA 1M66A 4HY3A 3RAJA 1U3VA 4CM8B 5T5QA 2PKQO 4CV3A 4CR7A 3RBXA 4OKIA 3EUWA 1VLLA 1ENZA 1HDZA 3RUFA 5JDIA 1A4IA 1A9ZA 1K89A 3UVEA 4R3NA 4DQUA 2YHIB 2ZB8A 5JY6A 3VDRA 3VZPA 4OMUA 4XRGA 2HRZA 3IQDB 3WIEA 2OOSA 1SCUA 4I9HA 4M8SA 4P4GA 2P4HX 2VUTA 5KKCA 1PJBA 2NV6A 4E13A 4JBGA 5EIOA 1DAOA 4YJDA 3O8QA 2HJRA 2Q1UA 4XJTA 3FF4A 1YL5A 1JKJA 1DHTA 1DHRA 1ENPA 1H2BA 1EBFA 5G0WA 1ZK0A 2D59A 3TPCA 3BHMA 1KBZA 3GN2A 1K5HA 5ICMA 4K6CA 1A72A 1OC2A 4ND2A 4BNJA 1QLJA 2E37A 4UUMA 1IUKA 4KZPA 5AOVA 1V3UA 3O9ZA 2ZTMA 4I5GA 2B5WA 1BMDA 3SEFA 4LSMA 4D46A 1AHIA 1LBEA 3GAZA 2YQ4A 1OFGA 4BNGA 5ER9A 4QECA 1I2BA 2UYYA 1YQGA 4AJEA 2POQX 4XR4A 4B3HA 2EF1A 1QG6A 2YUTA 2O4CA 4RVDA 2VYVD 3U09A 1PTJA 5JW6A 4EYEA 1WZEA 3EYWA 2FR1A 4K6FA 3W8DA 5A4DA 5FWNA 4MIOA 4ZQEA 3SLGA 4UEOA 5KVQA 3WLFA 1F0YA 2GF2A 3ICCA 4IQ8A 3KZVA 3QRWA 5I9MA 4PN3A 3FBGA 2IDZA 4D45A 3AWDA 5A3JA 2W8ZA 2B69A 4O5OA 3ZU2A 4BUCA 3W6ZA 3ZV6A 3WOHA 4KMSA 3WGTA 1O0SA 2EKLA 3ENNA 1IPEA 2GRAA 1LLUA 4IY1A 3RCBA 4Q3CA 3ZWPA 3WNQA 3DAFA 2J3IA 4AJ2A 2P5YA 2YFQA 4CL8A 3L07A 4CUJA 4QQRA 5THQA 5CAEA 1TLTA 4FJ2A 4LRSB 1NVTA 1VJTA 3OM9A 1KEWA 4AICA 3WJ7A 4GAEA 5EINA 3HB4X 4IJVA 3IP3A 4FQ8A 4R1TA 3WICA 4BV9A 3ZWAA 1UXJA 1YBAA 4OL9A 3JQ8B 3MWEB 3MJTA 2NU7A 1KY5A 2X4GA 2H63A 4KWIA 2RH8A 3F5QA 3H2SA 1E3WB 4J4BA 5CEEA 5L53A 3CSDA 1B16A 3FRJA 3DB2A 2VT3A 1P44A 1E6WA 3B70A 1ISHA 2DBRA 3ANMA 4WOKA 4JBIA 3Q2IA 1QSGA 3HFSA 4N18A 1V3TA 1C14A 3K92A 1DEHA 4XQGA 2VHZA 5EMHA 1ONNA 4A10A 1ZSYA 2BFAA 2HSDA 3V1YA 3ST7A 3WR5A 5TQVA 3CZRA 4E2ZA 4R1NA 5KTKA 3GMDA 4JNKA 1C0KA 2PZJA 1HDOA 4H15A 4WCDA 4Y6PA 4PVCA 3OQ1A 1DFHA 5T73A 4ZHSA 3F6YA 3UAGA 4MINA 3INRA 4J91A 2NTNA 2QRLA 3RU7A 3SJUA 3WGOA 1VRWA 4DIBA 2J3JA 3L9WA 4TKLA 1B0AA 4DUPA 3GEMA 4ALKA 1R6DA 4OOEA 5F5LA 4E4YA 5BQFA 2VUUA 3V2GA 1DRWA 4TVOA 2D3TA 2FY8A 3MWDB 1BXKA 2JKVA 2NLOA 2X0NA 3I9NA 2OBNA 2X22A 2EV9A 4BMNA 2CDCA 1CRWG 4RF2A 1PZGA 1AUPA 2W2LD 1ZJZA 3DBLA 1GTMA 2X23A 5T6BA 1K6JA 1JU9A 4Z0TA 2XOXA 2JHGA 3GNQA 1E3SA 4P4NA 1I01A 3K6JA 3OF2A 1MB4A 1EQ2A 5A03A 1P1RA 2X6TA 3MJEA 5DBFA 3V1TC 2I66A 4R9RA 1L7EA 5IZCA 1PQWA 1E5LA 4RDHA 1I24A 1E7SA 3W4IA 2O3UA 5ITVA 1SOVA 3V1UA 3Q1LA 3I83A 5L95A 4EGFA 4MP6A 3M1LA 5F3RA 1GZ3A 4GBJA 1KETA 1GU7A 4AJKA 4FFRA 4BB6A 4TSKA 4EZBA 1DPGA 3IAHA 2CDBA 1WW8A 3HJAA 4O0LA 1BDBA 4TRNA 2YY7A 5T64A 4EUHA 1UUFA 2VHVA 4FIZA 1H94A 1YB4A 1PWXA 5A9TA 2H9IA 4FC7A 1BRMA 1Y6JA 1Q7BA 1UP7A 3D3EA 2FHSA 3HQ4O 4J7UA 3F46A 4TWRA 1SB9A 3MJCA 3UCXA 3DR3A 1DIAA 4QXMA 3G3EA 3L0DA 3R6DA 3SX2A 3A9WA 2PTGA 2DBQA 3NX4A 3ROMA 3X2FA 3JQ7B 1NYTA 4R4JA 2PGDA 4PLFA 1H0KA 3GDFA 1WDLA 3GK3A 1C3VA 3WBBA 5K0ZA 1NR7A 4DIFA 1E3JA 3EY4A 1XA0A 1U3TA 4WCFC 1PQPA 1KC3A 4ZJUA 2O3JA 3FD8A 4IDCA 3SJ7A 1LC0A 4XR9A 4JP2A 4AG3A 3IJPA 2P68A 4FN4A 4K1LA 3OA0A 1UP4A 3DFUA 5H82A 3JYLA 5JPIA 1Q1NA 5L4SA 1Z73A 3GFGA 2RIRA 3RIHA 3AI1A 3KSUA 4TZTA 3VOSA 5GZ1A 4NK5A 3C7CB 1U4SA 4Q3NA 3BMCA 4KWHA 3LLSA 2NWQA 3ONDA 4YB8A 4CMEC 4GX2A 3AY6A 4DC0A 2HU2A 2CDAA 2DFDA 4DGSA 3H3JA 4D42A 3D5TA 4G2NA 4WLFA 5I9NA 5GMOA 3PQDA 2IODA 3OQ6A 3PQFA 1K6IA 5A06A 4BGVA 4CQLA 1B3RA 2JFHA 3PGJA 2BI7A 5G4KA 2Q22A 1T2AA 2BFMA 4XJSA 2X0JA 3FWNA 1P45A 4LSWA 2O7SA 2X9GA 2HMVA 5M6DA 3GRKA 1E7RA 2J5RA 4XEHA 3K5PA 3EC7A 1J6UA 4TKMA 3F1LA 3ZU5A 5BNFA 2DAPA 1ZSVA 1T4DA 4IDGA 4JK3A 1X14A 1Y8RB 4IM7A 5JLAA 2NVUB 3C1OA 4L76A 3U4DA 3PGXA 3I1JA 2C59A 3ZI0A 1UAYA 3WGGA 4E12A 4IMPA 1I33A 4YT2A 1GUFA 2Y93A 5IG2A 2I65A 3ZNQA 5COBA 5JMPA 3GY0A 1I3LA 2UUPA 3BHJA 4FFNA 1FDUA 3CEAA 4W9NC 1ZIDA 4OAQA 4HNGA 4CM9D 4XA8A 3DMTC 1I5RA 3T7CA 4BNKA 3X2EA 2J3HA 4IXTA 2DM6A 4Z9FA 3WGHA 1NPTO 4KOAA 2EKPA 1PWZA 3C24A 4MJLA 1A4UA 5EPOA 3JQAA 1TT5A 1SAYA 3S2IA 2P9EA 2FR0A 1U4OA 4FC6A 5KVCA 3U62A 4UVDA 3KBOA 4UUNA 1KVRA 4UVGA 5C7OO 3K2BA 1PZFA 2NTJA 2BGMA 3P5SA 4NPCA 3ASUA 3E9NA 2GCGA 4RJTA 1Y9AA 2ZJ0A 2W2KB 1TB4A 1M67A 3RSHA 3RKUA 5BR7A 5C37A 3O03A 3TOZA 3DZGA 3QWFA 4PLZA 5LC1A 3WSVA 3INTA 4E2XA 5CDSA 1Q7GA 1VC2A 2HK9A 1ONPA 5DCWA 1C1DA 3AJRA 4OSOA 1J5PA 2I67A 1XELA 1YQDA 5KNLA 1WWKA 2Q2VA 2PV7A 1HT0A 3QWIA 2NQ8A 1XGKA 4Q39A 4RLSA 3WGYA 1B8UA 4DPMA 1R15A 1AXGA 4GL4A 5I7VA 1Z82A 3GAFA 2WD7A 4TMFA 3KEQA 1CEQA 4WPGA 3BMOB 4XKJA 4IDDA 2EWMA 1CYDA 2DLDA 2PH5A 4NG5A 2J5QA 1N7HA 1XIVA 1BXGB 2ZK7A 1NWHA 1NTOA 4ID9A 4FSHA 2J5KA 4J2OA 3DDNA 4YACA 1MGOA 4HNHA 3UW3A 1MFPA 4A7PA 2PY6A 2EXXA 3UN1A 2B37A 4XX0A 2YHIA 2HK7A 1KC1A 3NT2A 3MTJA 4NH4A 2AG8A 2NVBA 3IJRA 1NBOA 2Z5LA 3CXRA 4RQUA 4IBOA 2O2SA 5DF1A 4E5MA 4J16A 3ZWBA 1IPFA 2WDZA 3BAZA 4CLRB 1Z6ZA 4BGEA 4W99A 3GH3A 1WDMA 1Y8QA 2AEJA 5JDCA 2I3AA 1ZFNA 4QFCA 4RV9A 5TT1A 5CG2A 1MLDA 4LW8A 4ONEA 3EK2A 3KTDA 3VPSA 1RM0A 4DQXA 3RFXA 3AI2A 3WIDA 1ARZA 1WXDA 4IDFA 3ITKA 3RU9A 5JCJD 1NP3A 1YO6A 3ZU4A 4JROA 1DSSG 4H7PA 1EZ4A 4R41A 1BXGA 3S2EA 1JAYA 4L8VA 3RBZA 5CHEA 3PHLA 1Q0QA 2IZ0A 2HMSA 3RASA 2E48A 3AM5A 2Y1FA 3DBRB 2X5KO 4BKQA 2AE1A 4CM4A 1DC6A 3LC2O 4XQEA 3GZNB 4YQZA 5C5IA 2DPGA 1U5CA 1Q2XA 2D5AA 2GZ1A 3D3WA 2RAFA 3ZHZA 2GN6A 2HUNA 3PQEA 3KETA 2AW5A 2GNAA 2WE7A 2IYPA 2PZKA 4JCOA 1M75A 4QSMA 3V2UA 1QYDA 3WSWA 5LDHA 1PR3A 4QO8A 1C1XB 1WVGA 1VSVA 9LDTA 4ZQGA 2P5UA 3P2OA 3ROKA 4GKBA 4ND3A 3L4SO 1R37A 1GAEO 5BSGA 1OZAA 3QA9A 2A94A 3WWZA 1E3LA 5JCXA 1R0SA 2VZ0A 3DFZA 1S7CA 1QYXA 1YOVB 4NBWA 3VDQA 3HSKA 1YGYA 1ZEJA 1NAIA 4RPJA 4DREA 1B3BA 3D1LA 1V6AA 3FPCA 4R54A 2CD9A 3JQGA 1EDOA 1U7TA 3V5NA 1FXSA 1EVJA 1AXEA 1HKUA 2WMDA 3I9KA 4FS3A 1SO8A 5H83A 3FWZA 2QYSA 1D1TA 4O6VA 1R4MA 4HX5A 5FYDA 1KY4A 4C7KA 4R5MA 3AY3A 2YJZA 2NM0A 3DBHB 5CDYA 2VWPA 3GZ4A 4MVJD 4UREA 5FI5A 1ZSNA 2Q3EA 5U1PA 3G1TA 4GLLA 2VOJA 4XDYA 3W8EA 1T2EA 2PK3A 4E2YA 5A1TA 1IULA 4MO2A 1VKNA 4TRRA 3AU9A 5JCJA 3BMNA 3GN1A 3COSA 4ZD6A 3KHUA 1HSOA 3FNFA 4N54A 4MVJP 1JTVA 5TJ9A 1H5QA 4P4LA 2Y05A 4ZICA 2FPIA 3DOJA 1ZVMA 2C7VA 3QWBA 1AE1A 3RROA 1E5QA 1HRDA 1KVUA 5COAA 4BNIA 3DL2A 3HFGA 1E7YA 3UCEA 1FDWA 4N5LA 4KDEA 1J4AA 3VC7A 1P31A 4FGWA 3TQHA 4E0BA 5L3ZA 1U7HA 3WFJA 3ZWCA 1HE5A 3KB6A 4UVIA 3FR8A 2R6JA 5HS4A 1VI2A 3I5MA 1MX3A 3QJ5A 2GSDA 2Q1SA 2FRDA 3GGGA 3SBOA 4URFA 1PJ2A 3QVWA 2GDZA 5G4LA 4NFHA 1A27A 4J3FA 3HN7A 1B8VA 5C7LO 1ZH8A 4MIEA 1I10A 4RVFA 5C7IO 2YW9A 3LT4A 4GX0A 3DZBA 3ZWMA 2H5LA 1GD1O 2O2YA 4MP3A 3AOEA 1X7GA 4Y6SA 3WYCA 1H6CA 1H6BA 4FCCA 4AJ1A 4B79A 1FDTA 3ZWXA 1YONA 5BSHA 3GC6A 1HYEA 3LVFO 4KUEA 3AFNA 5CEFA 2Q4EA 3Q9UA 1I2CA 1ISFA 2VYNA 3ICPA 3OETA 4GPD1 4GX1A 3HB5X 3E48A 1AN9A 1LLQA 2IRWA 3OIGA 4WLNA 3HN2A 2P9CA 4NBVA 3PWKA 2QYTA 3ZWNA 2DKNA 2NQTA 5L45A 4PG7A 5DT9A 1XYGA 3IKVA 3F3SA 4KP7A 2Y0DA 1OOEA 5JAQA 5CG1A 3GVPA 1G0NA 4DC1A 5CDGA 3N58A 2B4TO 2O4UX 3DBHA 5KKAA 2YV3A 1DIRA 3OJEA 4FJ1A 4FOSA 3FHLA 4WGGA 2NU6A 3T4XA 1LEHA 2OHXA 5A3VA 4NJMB 4AJPA 3QVSA 3DEYX 4OJNA 1T1RA 5A02A 4WLEA 4NDNE 3PWZA 4LISA 1LLCA 2X0RA 3WNVA 2V6MA 1D8AA 1XSEA 2X5OA 2BFPA 1X0XA 5KVVA 4GQAA 4MP8A 5CP8A 1T4BA 4YJHB 4B4OA 1R0LA 4OXNA 2TMDA 4PLPA 1YL7A 5HRUA 3RUEA 1N8KA 1VL8A 3E5RA 3JV7A 4DMMA 4WEQA 1GEEA 1RPNA 4KQXA 1M6HA 3PI7A 3DZHA 1EQUA 1EE2A 1SBYA 3EZLA 2PGLA 3I6QA 3LT1A 1PJ3A 2EGHA 2J6IA 2ZYDA 3JD3A 5TT0A 4XZ3A 1QORA 3L6DA 3JQBC 1PJCA 2C82A 1BGVA 4XQ9A 1UZMA 2BGLA 2VHYA 1LLDA 3RUAA 4BMVA 3WWYA 3GG2A 1WMAA 1LSUA 3H5AA 2GASA 3KO8A 4OHUA 3TL3A 5HS6A 4XIJA 4E3ZA 1I3KA 4HUJA 3T7EA 4PLYA 1YJQA 3JQAD 5GZ6A 5EJ2A 1VL0A 1A5ZA 1OC4A 4K9DA 1J0XO 4BO7A 1RWBA 2V6BA 4XYGA 3U4IA 1N1GA 4HV4A 3VZRA 2HK8A 1KOLA 4LGVA 3KYBA 5JAMA 3F5SA 2BRUA 5CFZA 4BVAA 5BSFA 3PFFA 4JLWA 1NHGA 4ZQFA 5HBRA 3DAPA 4IPTA 1PJQA 3PJEA 1E77A 4AJNA 4HFJA 1P77A 3TZQA 3D4OA 2HAEA 3U0BA 2O50A 1YQXA 2OZPA 2O3SA 1PGNA 2W4QA 5IZ4A 5K9ZA 2AA3A 4II3A 3B1KA 3G1UA 4NJOA 1GDHA 4IINA 4NU5A 4E33A 4YT4A 3E9MA 1JN0A 3BIOA 4DLBA 3VH2A 3ZH2A 4BKPA 4RVUA 3INGA 4IMRA 4U8GA 4BO1A 8ADHA 2I3GA 4IGEA 3VPFA 2DPHA 4RPGA 1PU2A 1CQJA 4O63O 4QUKA 4YTEA 3LC7O 1PJ4A 4HFNA 4BV8A 4CLDA 2F00A 4C4OA 4GWKA 5TF4A 5DBGA 3Q2KA 2Y1OA 1R4NB 2IEDA 2NNLD 1JLLA 3VPHA 1IZ0A 5T57A 3K9QO 4DLLA 1PJTA 3KOUA 3F4LA 3RJ5A 3TZCA 5G0SA 2BGKA 4DL9A 2P2SA 1GUYA 2BFOA 1JDJA 2W2KA 2IXBA 2Q2WA 2QW8A 5KWEA 2JL1A 1QYVA 3Q0EA 1C0IA 4CUKA 2NVUA 4YDRA 2ET6A 4P38A 3Q6IA 4U6QA 3QQPA 3MEQA 3WS7A 3O38A 3VH4A 4ALIA 2Z1NA 3DMTA 5KJCA 1RM4A 1CWUA 4YRAA 2NACA 3E9QA 4CV1A 3WQSB 1OAAA 1E7QA 1F8GA 4A73A 2O3QA 2YDYA 1VSUA 1KVSA 1GV1A 3HDYA 1XDWA 1GUZA 3E03A 3SC6A 3EGOA 2PLAA 2UV8A 4ESOA 4EBFA 4QO7A 1PSDA 2QHXA 5JXWA 2C54A 3AK4A 1DIHA 1Q7CA 4FGSA 3TJRA 3ZWVA 4OQYA 1GV0A 3PIDA 4A27A 1KERA 5IAAA 1S6YA 4RPKA 4J7XA 4ZVVA 4EJMA 5JO0A 2GLXA 3NGXA 3L9XA 1CETA 2I9PA 4TRMA 1LDYA 5JYDA 3GPDG 1D1SA 2XXJA 1GCOA 2WJPA 2Y1GA 4HP8A 5KJ1A 4QEDA 1KVQA 1MXHA 3V8BA 2OMEA 1Y81A 3QW2A 3KYCA 3LDHA 3SC4A 2Y67A 1C1DB 4TVBA 3CZMA 3OMLA 2OL4A 2FZWA 4D3SA 1PX0A 4BNZA 4CMHA 2CF6A 2IYOA 1A7KA 3MOIA 4INAA 4J7CA 1XU9A 2DBVO 2PGJA 3PIIA 3ZCXA 4ILKA 4OH1A 4DPKA 1UXIA 4RL6A 3NDIA 3RUCA 1RKXA 2VHWA 3BTUA 2WWRA 3BZUA 4JXKA 2G17A 5ILOA 3S55A 3C1TA 1NQOA 2W90A 5AXDA 3OH8A 1Y5MA 1NXQA 4XDZA 1R4NA 4FFMA 3RUHA 3WTCA 3I6IA 4FW8A 3GMSA 1NQ5A 1BVUA 5EN4A 4NBTA 1EMDA 1MXFA 3ZN2A 2X1HA 1KVTA 3HE3A 3ZV3A 3ZNPA 2ZATA 4CMCA 3K30A 3ROPA 4R1SA 1DIBA 2YV2A 3ZZNA 2B5VA 4J9VA 4ZU3A 1NR1A 1UXHA 1PS9A 2DFVA 4OO3A 3VHRA 1W4ZA 3LQFA 1P1FA 3PYMA 2FSVA 3GZNA 3I9OA 4IIVA 4XCVA 4CMIA 4OGWA 1E1KA 4A5OA 2X0IA 3DC2A 3M6IA 4TROA 2D8AA 6LDHA 3QSGA 3ON5A 4DXHA 4YAKA 1NFFA 2EEZA 3EDMA 1C1XA 1PJSA 4GLOA 3JSAA 5TRTA 5I7FA 3H3FA 1J49A 2AEMA 3OEWA 5JAZA 5DOZA 5L7YA 4RO0A 3DBVO 4IDAA 4Y67A 1KIFA 2O7QA 2GN9A 1HDXA 1RM5A 5CEJA 3G79A 1SOWA 1WPQA 7MDHA 3UH1A 4D0RA 1LRLA 3JYOA 1BW9A 1M76A 4MVJF 2FOIA 1HZJA 4BNFA 1U3UA 4B3IA 3WJAA 3OJ0A 3EMKA 3TL2A 2CVOA 3CTMA 3RC1A 3IS3A 2D1YA 3P19A 1D3AA 5F1KA 1SPXA 1WMBA 2IEBA 1N92A 3IIEA 3K96A 3NKLA 4R3WA 4H16A 3UKOA 1SNYA 3PK0A 2H6EA 2XPCA 1P0CA 4JIGA 4E5NA 3TN7A 5JAIA 3O8QB 4XYLA 3AW9A 3GUYA 3OBBA 1UZNA 4KDFA 3MOGA 3F4BA 2Y99A 2E4AA 1ORRA 4CR8A 3W8FA 3JQAB 4PVDA 5G0VA 3RFVA 2EJWA 3A1NA 1PL6A 3KV3O 1FMCA 3WMXA 5KOIA 1NFRA 4F3YA 4CM8A 2BHLA 5A05A 4PGFA 4EUEA 2P4QA 2YFHA 4W9NA 3IOYA 1LC3A 4J0FA 5FEUA 3QY9A 3ZHXA 1GY8A 5CPFA 3LU1A 2V65A 5DCUA 1T2CA 2VYVA 3PWSA 4BNNA 4CLXA 1FJHA 2GN4A 4ZQHA 9LDBA 4BB5A 1CQIA 2D2IA 3ULKA 5ES3A 1QR6A 1VL6A 3KVOA 3MJVA 3A4VA 3IUPA 4ZQBA 1FDVA 3VH1A 3L6OO 1VKOA 3UGKA 4YVFA 4DIOA 4PLVA 4BO8A 1ID1A 4JGBA 4YT8A 1HWYA 3T4EA 1X1TA 3P7MA 3O4RA 4NBUA 3DONA 4B3JA 2EW8A 4OKNA 1NPYA 2WD7B 3ZDFA 5JNLA 1BDMA 2DT5A 1F12A 5IDQA 1EEHA 1O89A 3EAGA 1SEVA 4R1UA 1YDEA 4B4UA 4WE3A 2OUIA 3BA1A 2YHUA 2JD0A 4U0JA 1FDSA 1C0LA 4II2A 3S1LA 1X13A 3LF1A 4GMGA 1LDNA 3U5TA 2QIOA 3HADA 4IGFA 4YT5A 4R01A 1L1FA 1HETA 2C0CA 3D4PA 3WQQA 4DYVA 4BNVA 4PLWA 3GVIA 1ZUD1 4CM4B 1YXMA 4Z3KA 3ZHBA 2DTDA 2GR9A 3B1JA 1ENOA 4RGBA 4BGIA 4XGNA 2C29D 3RJ9A 1DRUA 4E5PA 1LUAA 2AHRA 2H1SA 1HF3A 3BMQB 4XB2A 4IDBA 4E6PA 4YWJA 2FPPA 1TI7A 1QP8A 4JJGA 2Y0EA 1BG6A 4D43A 2EJVA 3ETEA 1QYWA 3CE6A 4OXKA 1TEHA 5A9SA 4LVCA 5MGBA 4KUGA 4AL4A 4B4VA 3FN4A 1B7GO 1LTHR 4D41A 4YXFA 1ADFA 2X7HA 1GCUA 2EP7A 3BTOA 3OJOA 4ND1A 4NQZA 4YJFB 3HDQA 2WYVA 3K31A 5I7SA 4J1NA 4P8RA 1O6ZA 3I3OA 3DOCA 4EDFA 3OHSX 4BNWA 1VJ0A 1E92A 4FR5A 2C2YA 1FF9A 3FBTA 1O5IA 5T8KC 3D5QA 4YCAA 4KTTE 3H8VA 4J49A 2VRBA 1LQTA 3PZRA 3R3JA 5I8ZA 4I5FA 2E82A 3WGZA 3B20A 3GEDA 2G1UA 2I76A 3PXXA 4BO3A 1KEVA 3MTGA 1PEDA 2RBEA 4WEOA 3RI3A 3ZNNA 1D4FA 5THKA 1UDAA 3BHIA 1H9BA 3ADOA 3OJFA 4YAEA 5JO9A 3S2FA 1KYQA 4CQMD 4NIMA 4RF3A 2IZZA 4BNYA 3AI3A 3H9GA 1CERA 3NAQA 5EQDA 2EP5A 1F14A 2ZTUA 4L4SA 1ZK1A 1O9BA 4B7CA 2G0TA 2CVZA 3FR7A 1C0PA 3MJ4A 4BO0A 1DXYA 1PS8A 2D4AA 1R66A 2X8LA 4JQCA 5AXAA 1T25A 3FTNA 3GGOA 3JQ9C 5BT9A 5ENDA 5L7WA 1PIWA 3HUDA 1UAGA 2PR2A 3JQGB 3SLKA 4CQMB 4EJ0A 5TLSA 4XWYA 4TRJA 4ITUA 4XRRA 2ILTA 2B35A 3CPSA 1EVZA 4LN1A 3TSCA 4ROSA 5A9RA 3H65A 5IN4A 4CODB 2GD1O 2I6TA 3H6KA 3JQ6A 1PGJA 3AU8A 3OECA 4E2WA 4CLEA 3VZSA 2B0JA 3QE3A 2B83A 4NFSA 1F8FA 3HZZA 1G1AA 2QRKA 5BNIA 1I3MA 1R12A 2JJYA 2NU8A 4CM7A 1EK6A 4KQWA 4Y8VA 1ZK4A 4FOOA 4IZIA 1XU7A 2R2GA 3PJFA 2OXIA 2EGGA 5KIAA 1EUCA 4I5DA 4L9RA 1HTBA 5JYAA 2DQ4A 1U1IA 2VTDA 3UUWA 1X15A 3PHJA 3F9IA 2PA3A 3UCFA 4FBGA 2ZYGA 4GMFA 4J90A 4BL5A 2PD6A 3DXFA 5BNTA 1HYGA 3UHAA 3U49A 3KM0A 4L4XA 2LDBA 4EI2A 3QV1A 3QP9A 3L77A 3QWHA 5L9AA 4LMPA 1UDBA 4GKVA 3PDJA 5TC4A 4BGUA 3PHGA 1ZK3A 3NTRA 1PZHA 1UZLA 1YDWA 2I99A 3BTVA 3GHHA 4ND4A 3IDSA 4UUPA 3FI9A 4NJMA 4X54A 4DMLA 1EVIA 4YR9A 2CVQA 3WMWA 2GGSA 4PG8A 4OSPA 2ZCVA 3SXPA 4OYRA 5HWSA 4BS9A 4CQLB 2PNFA 1Y1PA 1JKFA 2JAPA 3N74A 3QVOA 3H4VA 4UEKA 3U4HA 3W1VA 3WG9A 2PZMA 3ZHYA 4DPLA 5CPBA 2VWGA 3HNPA 1DOHA 1JWBB 5I7EA 3VTFA 5DN9A 1EBUA 8LDHA 5AYVA 2HO5A 3U3XA 4M86A 3CIFA 5G0UA 2C5EA 5K6AA 4PLTA 1PL7A 2RH4A 1YH3A 3RUIA 4U5QA 1ZNQO 1Q0HA 5DOVA 5GZ3A 2NU9A 5G2OA 5KVSA 2O48X 5L4NA 2W2LA 1HE3A 1UXKA 4DBVO 1LI4A 2GUGA 1E7WA 2ZIZA 3I4FA 1RM3A 1NNUA 1ULUA 3C7AA 5H81A 3PRJA 1HE4A 2CFCA 3HWRA 2BD0A 4BO5A 3NT5A 4W7HA 3RKRA 1JKIA 1SMKA 1GQQA 4IQ0A 4B8WA 2JCVA 1LDEA 1EFKA 3S8MA 4AJLA 4BHTA 4A03A 3VPGA 1X7HA 5A5FA 1CDOA 1P1JA 2AMFA 2HKIA 1LSSA 3RC9A 3GA0A 1XKQA 3H9JA 4RDIA 3BTSA 3KXDA 4ALNA 4DQVA 4JN6B 4NI5A 2OO5A 1ZXBA 4N5MA 2QG4A 5DCYA 1QMGA 4MOWA 1B2LA 1V8BA 5CDTA 4J6FA 1HEUA 4NMHA 1Z7BA 3WXBA 3PLNA 1LJ8A 3ANLA 1ZMOA 1YE3A 4ND5A 4Q3AA 5KJFA 4FFLA 4NR0A 4Q3EA 3VAZA 1MUUA 1GYPA 2GZ2A 2YV1A 4XD2A 5T67A 4YJGA 2WYUA 1ZZEA 3RD5A 5GY7A 5B4VA 1BSVA 1JVBA 2PFGA 1DLJA 2DBZA 2JCYA 3PJGA 3DAGA 1YB1A 3KSZO 2CF5A 2DVMA 3RFTA 1YVEI 4HFMA 4I1IA 4RZIA 3FNGA 2WD8A 4B7XA 4Q3BA 3ZWOA 4M87A 3AM3A 4L75A 4FB5A 2F1KA 3ZU3A 5JFOA 1E1LA 3HDHA 1EDZA 3BMOA 1MC4A 5I8WA 5A5EA 3WQRA 4I08A 1DB3A 4FJ0A 1UJMA 1LA2A 3UOGA 2PD4A 2FN7A 3Q11A 1NVMB 1GQYA 1DFIA 4E30A 3FCOA 2G5CA 4AJJA 3MJSA 2VQ3A 2G76A 3VTZA 4ZRNA 2VHXA 1NPDA 3R0IA 1PGQA 3NYWA 3NDJA 4LK3A 1KEPA 1TXGA 2D5CA 3LLVA 1Z74A 4BMSA 1XQ1A 2Q1TA 2YQ5A 2VCYA 3TOXA 4NHEA 1L7DA 2D0IA 3WYEA 3VVCA 4XYEA 1P9LA 4AJ4A 1QYCA 1XG5A 4YJGB 4CLRA 4Y6RA 5C3MA 1LDBA 3KLPX 4GGPA 1WDKA 1JA9A 2VRCD 4WNCA 2ZB3A 3CUKA 1NM5A 4NK4A 3DTYA 3IC5A 1ZEMA
chains in the Genus database with same CATH superfamily
1X9GA 4RPLA 1S2MA 1Z2CA 1K4YA 2M1XA 4QL3A 3TZHA 1S2IA 1O5TA 4B2LA 3TR6A 2ZYRA 1W9HA 3IUJA 2C96A 1I6LA 4XIYA 3S8YA 3T4PA 4I9GA 4TZKA 3UMMA 3P97A 4YRJA 4IXMA 5K3AA 3ZX4A 4UZSA 4DCOA 4K6HA 3TD9A 3A05A 1NU6A 1ZM2A 1B43A 4Q7LA 1U5BB 5JBIA 1E98A 1KL7A 1GGFA 1IHYA 1PG2A 3HCOA 3KDSE 5JZOA 1ULZA 1ZMRA 3FPAA 2II6A 4FEEA 4YPFA 4RY9A 2BV3A 2JFBA 2R4UA 3AESB 1DS6A 4F2WA 2DF8A 4LRTB 3DW3X 4G0PA 2VATA 2COEA 1W25A 2EW1A 3QVGB 2VT6A 5I8PA 2N75A 4M1ZA 4KX3A 1BX0A 2VWQA 4HF7A 4D0GA 1Q3KA 2E4XA 2HMYB 1OI4A 4G5HA 5HE8A 1C7ZA 3L2OB 1KDZA 1DJMA 2JLXA 4X62B 4C21A 3VZQA 1T0JB 1AUVA 4G4GA 1YBVA 4KE9A 4KRXA 4DDTA 4EATA 1LNQA 3K4HA 4J9UE 1MFZA 1N9GB 1FBTA 1FQWA 3OCVA 3IUQA 3KIPA 5D7NA 2C61A 2JEYA 2XVYA 1U2SA 3ZHTA 4KSYA 1OUMA 5AI9A 1V47A 5KQRA 2DQYA 4LC9A 1AGXA 4JBYA 3EQ8A 3O4VA 4P22A 2ZDQA 3L40A 1FXWA 2ZKIA 4DV7B 1NN1A 2R48A 1SULA 3DTVA 3GZTB 4BE7B 4G0WA 1W5SA 3PD0A 1DBSA 2ECOA 2DPYA 3BGOS 4ER7A 3D59A 1YCHA 2GT1A 3WTBA 2IS6A 3E53A 1UBFA 3CN9A 2BPOA 1R27A 4QPNA 4OQQA 3GEBA 3BS4A 4CL3A 1LZLA 3D4NA 3GMTA 5I4BA 4HXGA 1Z4OA 2JGIA 4BFLA 5ECWA 1EFRA 1Y8RA 5KB3A 1OWNA 2B4QA 3E8MA 1M54A 3I12A 5IP5A 3BSFA 3FUTA 5LU9A 2IXAA 2C78A 1O54A 4WT7A 1KFKB 2OGZA 1YZVA 3Q7PA 3KUKA 1H69A 2P9TA 2FQXA 3WL4A 3JD4A 4JT9A 1GYQA 1C8VB 1TO6A 3DP9A 1XTUA 4PW0A 3CR3C 5BYBA 4LJ6A 4HLDA 2ZKLA 4M8NE 3SEAA 1BMFA 1SIBE 4IS3A 1R10A 4MJ7A 4NZ9A 1B76A 4U7WA 4Q9AA 1ZG3A 4KRGA 4RVOA 5ICSA 4HRAA 1N6HA 3L8FA 3PI6A 1Z28A 1U0RA 3ETGA 3L4BA 5U4QA 1GTL1 1U8ZA 5IMBA 9ATCA 1RBMA 2P0EA 4ZT6A 1KS9A 3BMNB 3C3CA 5D3MB 4QBIA 1JFFA 2VVTA 2C8VA 4MRMB 1KKLA 4ZRMA 1ZZGA 3ITDA 4K26A 3WNBA 1XA3A 1JE1A 2QZPA 1U2GA 3CW2A 1VGVA 3ZC3A 4J4TA 3AFMA 2QJRA 4MNTA 5B3JC 4OA5A 5I47A 2ZSKA 3AV3A 2YVKA 2WYHA 4YRZA 1QQAA 2QSZA 4AO6A 1DTWA 1DMSA 3I9LA 2J8ZA 3ORYA 3H8WA 2ZUWA 1Z12A 3PDCA 4YGXB 2C7QA 2W6CX 1QRDA 3A14A 4LCJA 1JYEA 1MC5A 2H54A 3ZY4A 4UAJA 4HAIA 2RAVA 5AK4A 3PGLA 2AYYA 2FF7A 2G4CA 1EDBA 4IH9A 4UHHA 3UNXA 4DLKA 4N03A 2I1QA 1HNNA 7ADHA 3SMVA 2ZJBA 1WU7A 2NAPA 4DG9A 5CB0A 3RC2A 2BC9A 4M9UA 4EF5A 4B2PA 1N9KA 3GA7A 3H0KA 2EZUA 4PHFA 1IL0A 1HL3A 1Y8CA 2DR3A 1C1YA 3NWBA 5DRTA 3SU8A 2G40A 1NLUA 1ZW6A 1ZM7A 3JQDA 4DRXA 3MBKA 4KUHA 3DOOA 2CXRA 1FP4B 3OE5A 1B0UA 3DHEA 4HJXA 2GZDA 5F9HA 3E3NA 4PCVA 1IWPB 3Q3CA 3L0BA 4R0MA 1VG9B 3M9WA 2ECQA 3K0CC 3NIWA 3FYUA 1D09A 2FK8A 1NATA 2HRCA 2YIJA 4OY3A 4B8ZA 1NG9A 2CVPA 1J8FA 1KJWA 4BQIA 3KSAC 3TQCA 1PG0A 1EWQA 4WXYB 5A62A 4PSVA 2AL7A 4BCDA 4YRTA 4F21A 3FTPA 2Q6KA 2CUNA 2WNIA 4XJVA 1NVVQ 3F47A 2C83A 3KWFA 2IOFK 1WULS 1XLUA 1QCYA 3GRPA 5CW2A 3A3NA 1XTIA 1EINA 1L0BA 3NBAA 4CYMA 2RK3A 1Y7TA 4XCQA 4A8JC 2ZWAA 3CWCA 2Z2JA 5IM4A 4HLCA 3A36A 2G28A 2XQKA 5REQB 3NTQA 3ANXA 1QP7A 4E51A 1L1RA 5J2UB 3MTBA 3MWEA 2HT6A 4LEIA 3KYIB 1CJMA 5JH7F 5FUBA 2HRQA 2AN9A 1GTVA 1L5YA 2B2NA 2GJSA 2FQQA 5FQOA 4C4YA 4DQDA 3CNLA 3VVMA 5JIBA 1JQAA 3GCDA 4IJWA 3EP3B 4MHOA 3L4JA 4MXDA 4ZMRA 1H93A 3PGKA 3WX0A 4MR9B 4EL0A 4HDSB 3F67A 4MYCA 4Z51A 5BWBA 4TTAA 3QPCA 4LYYA 1FP2A 3M7IA 3UGTA 4D96A 1G8JA 2FPRA 1RQ2A 4Q6BA 4Z53A 2GA8A 1KQNA 3ZTYA 4CMAA 4Q7KA 5TGDA 1EVLA 4L4YA 3R7WA 4EHHA 3NPAA 1KBOA 3ABQB 2A5FA 3DS8A 1SC6A 1FFEA 1GLVA 2NSDA 3K7EA 1WB4A 2F17A 1MAVA 2AOTA 2YMLA 5EKTA 2NZUG 3CRQA 3DP7A 1P4RA 3FUXA 3IUSA 4C0BA 2EHDA 1VYTA 4WLUA 4LSZA 1BJKA 4IZHA 3LTEA 4Q5IA 5CA0B 1O7JA 5L7TA 1ZK2A 4HEA1 4DC9A 5FOQA 2AFHE 3ZZ0A 4PG6A 1KYXA 4L57A 2Z1DA 1WU8A 2ZJ7A 5TMBA 4U1RA 5FTMA 2P1RA 1XJWA 1DARA 3ZV5A 1SCUB 4E5DA 4FWTA 1OI7A 1ZGAA 2TS1A 4GU5A 3G5LA 3EG5A 4EUKA 1P1HA 3OTOB 5KYWA 1MPXA 4RLFA 4KQHA 3SE0A 4XWTA 3TZEA 3GD7A 1UDCA 1FDOA 2HV9A 3EDCA 1TC2A 3IRUA 3M89A 2P6OA 2VNSA 4MZDA 3UUFA 4E15A 4I9UA 2PWAA 1ANKA 2MMCA 4UC0A 1HLFA 3KYDB 4HFRA 4B81A 5TMDA 3HWX1 2X0DA 2NIPA 3V4LA 1OMOA 3O3CA 1MHTA 1LY1A 2QY6A 1RQLA 5IXYA 3TV1A 3MSXA 2X8BA 2FUKA 4FDTA 1E32A 1GA6A 4BO9A 1J25A 1J8QA 4CV0A 3NBUA 3EG9A 3I9V1 2V1XA 2IZ1A 5C53B 1E8MA 3TG8A 2GYYA 1HDRA 2DT8A 1IEVA 3LTNC 3W77A 1C4WA 3IR7A 1AKNA 4BKUA 3OQIA 1E9SA 1KI7A 3EXHA 3FWPA 4RLQA 2JIBA 1GFSA 2CDNA 4RZSA 2Z4SA 4ACBA 4OFXA 3FCSB 1QF7A 1CIVA 2CUZA 2ONZA 1AS3A 5BWNA 4KI0A 4CM5A 1IHOA 5FOUA 4E1AA 3OQVA 5H8WA 1W48A 1RRKA 3CU5A 4HSGA 1CD5A 2W22A 2VTBB 5B1HA 2FZLA 5JD5A 1BVRA 3WISA 4HSEA 3RTCA 4EJFA 3ZW8A 4TKZA 2ZIUB 5K0CA 4YALA 1OAKA 2BDTA 2JI9A 3LUFA 4ZTBA 3DBLB 3AETA 3GVHA 3MTAA 2NUAB 4JSTA 1SU8A 1T1EA 3I2KA 4RIHA 2BTOA 3O83A 2A35A 4YLGA 1JHRA 1GDDA 1TPYA 5EHIA 4IIFA 5J63A 1YCGA 4Y9SA 5F35A 3S29A 4CQJA 1U94A 4DIUA 4XYBA 5F78A 5L51A 1YZHA 4PO9A 3SVZA 1V7CA 4UM8B 3DL0A 1B2RA 1NXTA 4G65A 5IC6A 2CZCA 3ZHOA 4Q4CA 2ICAA 4BB9A 1DO8A 3DTTA 3F97A 3TGPA 3FNEA 1SHLA 4U2CA 1W85B 1QV9A 4LBZA 2HQOA 5HF5A 4Y98A 2I7TA 1JLLB 4CIYA 3GR6A 1N4DA 2V4MA 1E2EA 1U63A 1AQUA 1P1KA 4E5UA 4CU2A 1NDUA 3AY0A 2RCYA 4YAJA 3ONWA 4L3WA 2ASVA 1IN4A 3ZE0B 4E7PA 5ARBA 2ZS8A 4Y0AA 3C5EA 5AI4A 3SR3A 1J56A 1JEOA 1N1EA 3R74A 3Q0TA 3R5FA 5EMMA 3UFBA 2RKBA 4WA7A 1KO5A 4MA5A 1U0LA 2X1MA 3B51X 5F73A 5C80A 1E2PA 3H1GA 3OHMA 4RK5A 4CNQA 5CGQB 1GAWA 2Y1DA 3LP6A 2VA8A 1E3EA 1ZI6A 2ZETA 4TV8A 1WKVA 5CITA 3WGQA 4TMYA 1MOQA 2G8LA 2ZJOA 3JR7A 1WM1A 3ND7A 4PCUA 4ZV7A 3T95A 5BN4A 1Z0KA 5EI5A 3UICA 3COJA 3ML1A 3IO3A 1ONOA 2CXOA 2Z58A 3E27A 3GRUA 4TTVA 1U7OA 3QVKA 4QFMA 4ARIA 1P7CA 1W88B 3CKLA 1G41A 2VDKB 4PZEA 5EMNA 1OVGA 5HF6A 4AY3A 1GRNA 3WBJA 3PPYA 1P0IA 3Q10A 5J4KA 8MHTA 1DC5A 1YJCA 4ZCPA 1Z6PA 4ROTA 3VYTB 1CG6A 2EFHB 4LOAA 1O0CA 3PDUA 2ADMA 1YV9A 4Q9IA 2EAUA 4Z9YA 2GCNA 2OXRA 2Q45A 4YREA 3WRYA 4BYGA 1UEJA 2JLWA 2PZGA 3C70A 3EZYA 2Z3WA 3N75A 3OAAA 4PYQA 4R68A 4YBZA 3KVNA 3TNFA 1G21E 5CM8B 5CLIA 1AUOA 5AKHA 3UXMA 5ADUS 5IFLA 3G1WA 5TNXA 3RJZA 4AJOA 4GOXA 4XSVA 3BILA 3MGBA 4G5XA 3KLMX 3I9JA 1XZIA 1QBKC 4OSEA 4Q18A 1L7XA 4BIIA 4XUEA 4P80A 5JXJA 4LVOA 4BO6A 3T9BA 1DAKA 3DEAA 5JHGB 3IE1A 4E5KA 4WK4B 1P3JA 4UEWA 4GPEA 4P3KA 3ONEA 2HHHB 1RAIA 2IUYA 5EY5B 2FFHA 3GXOA 3VISA 4GXNA 1K3FA 1PHPA 1Z7WA 2RBGA 3RAEC 3NUGA 2ZYAA 1FLNA 4M0FA 2WM3A 3USCS 2CB0A 1YNSA 4AF8A 1VIAA 4PC6A 2SHKA 3HKCB 2JPDA 1G8HA 4C4RA 4F2PA 1QMIA 3K1JA 2WFMA 3L7JA 3TJMA 1P1IA 2IYTA 1R0WA 4IQGA 1LSOA 2GJAA 4MAFA 2CL7X 2CUTA 1EX1A 2E49A 1Y5RA 2JK1A 4LPSA 4OQDA 4YROA 5CRIA 5IAOA 1ECBA 4MW5A 2O59A 3JRNA 1RWQA 5E3JA 8AT1A 5L6LB 5KYXA 4ER3A 2KI5A 3LYAA 2ZYIA 3H04A 1LQUA 4FUTA 1ML3A 1XX6A 1D7OA 3DLHA 1UBSB 3CW9A 5A1JA 1X2BA 2BRUC 2Q4BA 4N5NA 4YJHA 2HU5A 2PKRA 2VPWA 1ESCA 1C3LA 6AT1A 1D2RA 1G6OA 1DJQA 2YRWA 2CSUA 1M1YB 3P9KA 1X8KA 3U3RA 3ZW9A 3EDYA 3OLZA 2ZQYA 2HBQA 4DLSA 4BLWA 4N7MA 4MHSA 4QXAA 1ECJA 1JJVA 1WNTA 4EW2A 1BS1A 3GVCA 2WDPA 2G8NA 4R05A 4I9FA 4CIVA 5GOTA 3J7AC 1OTXA 4AP6A 5C8XA 1JR4A 3IEPA 5ESXA 2C88A 3VDMA 5FBLB 4UBNA 5JY1A 2EG9A 2ZTHA 2RGCA 1KY3A 1FW6A 1CVLA 1F2TA 1I1NA 2B4KA 2EW2A 1BXZA 3B89A 1M6VA 5B37A 1V8FA 1NJ6A 4MKZA 4Q9JA 4BP9A 2PRSA 3A10A 3IMCA 2A5YB 1A97A 2G9NA 4EB0A 4EMBA 3T1YB 4W6QA 3ZJXA 2A1UB 3OIFA 3DVSX 2OFFA 3EUFA 3CG0A 5JCZA 5B55A 3GJZA 4GEKA 1ZAKA 3SBDA 2WWIA 4E14A 3MMXA 1TK9A 2IYNA 1PQUA 4ZDKA 2AN3A 1OCEA 5FUYA 1DGQA 3NV9A 1XK7A 3LBHA 5I6DA 1WY5A 3I2HA 1HEYA 4O02B 1QHFA 3EOAI 1ZJYA 3DUFA 3TCNA 1O95D 4H2DA 1NVFA 2HNAA 4CU5A 2K87A 2VF4X 1M7HA 1TU4A 1TF2A 3CT4A 3D4BA 1D0IA 3JARB 1Y6QA 5EUBA 4GC9A 4WL0A 5TJHA 3VU0A 1EI9A 4G37A 4DR7B 1O03A 1QONA 2FR8A 1HDCA 3ZUGA 1KAGA 2LWIA 4F6LA 2J3MA 5TXGA 5T41A 4OJMX 2W00A 3THWB 2E5WA 2YINC 4L50A 3ESRA 4HS4A 1RYEA 2ACEA 4BO2A 1JE0A 3GPIA 1KQOA 4XUCA 3ZDRA 5HQ3A 3BDIA 3VR6D 2QLTA 1DAPA 4YRBA 1T1GA 3SF8B 1I32A 3A04A 5K2MA 3RSGA 2QGZA 4DDMA 2AT1A 1YFKA 4RZ3A 1GADO 2NPOA 5HX7A 1E5VA 3M6FA 1PO7A 1SXJD 5JCOA 1NQWA 2OVFA 4RD0A 3P26A 2XXBA 3C97A 4PNZA 1QGUA 1RCUA 1A0OA 1PAUA 1NVGA 1BVYF 1BROA 1CUWA 2H3EA 1XAHA 3CGGA 3KJXA 1JR3D 3R4VA 5GJWC 2R11A 2FTKE 4ALJA 2ZDGA 4D8UA 3IL2A 1A9RA 5BN5B 5CTAA 1T9AA 2AK2A 1WUHS 13PKA 3KTFA 1E63A 4DILA 1HYBA 2H1VA 2H9YA 1GO2A 3WYNA 1U7DA 3OWHA 1JFLA 1IY8A 1CZNA 4X7RA 4WLVA 4D0SA 3DBRA 4M9XA 3TDKA 3CSUA 1TM3E 1KJIA 2JCXA 4ES6A 3PPVA 3UV6A 3C41J 2QTZA 4HQ0A 3GO4A 3EODA 3QA3E 4K9MA 3H5TA 3KU1A 1CY0A 5ITWA 2OAQ1 3PZBA 2GN8A 2RHRA 1JVNA 1N2ZA 2A92A 2RJ3A 2VXBA 2Y66A 3MCVA 3EF0A 3OHPA 4Q7JB 1XR3A 2IYFA 3B9PA 4URWR 1CUDA 1OGJA 2VA9A 3LDFA 2YJGA 2FEPA 4JC5A 4HS9A 2OQIA 3S3TA 1Z2EA 3IBGA 1E2NA 5JH7A 2BKXA 4EITA 2VO1A 3P2YA 3IH5A 5EC8A 4GWLA 1H2FA 1UJ5A 1VYHA 5TX7A 3SPXA 3SOPA 3N76A 5GM2A 3GEHA 1GQOA 3G6WA 2BHRA 3QLJA 5BV0A 2JG3A 3W4KA 1G6KA 2EZ4A 3K72B 1DIGA 3QEJA 1YI8A 3UANA 2O0LA 3ZR4B 3WL6A 4ALMA 2X4LA 4CKBA 1XPRA 3CUWA 3AVXA 3L79A 4R9NA 2WILA 2FQ1A 1NDHA 1NLYA 1QKKA 1TCVA 4H7DA 5BWLA 3N07A 3SVLA 1LU9A 1H9AA 1ZYUA 3CWZA 5FPQA 1TJ3A 1W36D 2X8WA 5BUQA 4WJZA 5CNIA 1Q0TA 1NMXA 2XCSB 2I2DA 2QN2A 4G3XA 5DO9A 2I5PO 3QVXA 5GVRA 3O2NA 1IBMB 2JLBA 1HA3A 2GKGA 2ZRIA 1HNWB 3KYCB 4Z0PA 3EPRA 4RTQA 1VLVA 1LDMA 2OFPA 1ZXXA 4KSCA 1MG5A 2HSEA 4LJ7A 4MWOA 4B83A 5EXSA 4YMVA 2EDCA 4PQFA 4Q9NA 4X1YB 3L7BA 1QU2A 2CLSA 3I62A 1N7GA 1H85A 1RVV1 4P0TA 5EQFA 2ATVA 2OK7A 2ZSAA 4XW2A 2H07A 4A2CA 1C7JA 4CWAA 4DA7A 3VOBA 5DZSA 1K7XB 4JC0A 5BSRA 1T0HB 1Z3CA 1I36A 2VPZA 1JHDA 2UXCB 3O4JA 4KMMA 2YHAA 5JRZA 4J75A 3TCKA 3LJKA 4Q66C 2XXAA 5KAPA 3OE7A 5HGJA 5IT9A 1Z15A 2ZXUA 4Y30A 4AY4A 2CNOA 4RKWA 1TM4E 3W9UA 4I4TA 4WLOA 4AUEA 2MSKA 2HD4A 2ORWA 1G0OA 3PTZA 3ZW7A 3MJDA 1OQAA 4L6IA 4IJUA 2BHSA 1XTBA 4V3BA 4B6PA 2H4JA 1F8UA 1UPUA 2JBWA 5A4AA 2Z4TA 2AMLA 4OHWA 4L74A 5KQMA 4PLGA 2IPLA 4WVFA 5L4LA 1LWNA 4WNIA 1K8YB 1OLOA 2FPSA 2GFHA 4U7PB 3A1UA 4G24A 1C30A 2DWQA 2LVBA 2ZCUA 1FZQA 4FXOA 4DJFC 1P6XA 3GEGA 8ATCA 1K3TA 4EPVA 2JD2A 4FGUA 1FNNA 1XQ6A 4MMZB 4L0MA 4OFZA 2VQ6A 3K1AA 3IJ5A 2WB4A 5K6AC 4X24A 5LZ4A 4M0CA 2N47A 2H2DA 4QPPA 4Q9KA 2LKDA 3DL7A 1JEQA 2YXBA 4RVGA 4EHJA 2XMCA 1U8FO 3C5VA 1M2EA 4NZZA 4LCBA 2HW8A 1R74A 5DX0A 4XH9B 1UH5A 3LBNA 2YICA 2B7LA 1MG0A 1ZD9A 5F21A 2W7TA 6ADHA 3KR9A 5IUJC 1WPRA 3KPVA 4DNQA 1OZ0A 2VH5R 2FEWB 1P73A 4O4IA 5CCBA 5JRJA 3TOSA 3NIDB 2DH5A 4KR9A 3KSBC 2M6SA 2OORA 3CUEF 2VYFA 4I1SA 4DFDA 1H2HA 1SBQA 4D79A 3I9MA 4EQ6A 4WBXC 1F7VA 1K2WA 4AZVA 1NC3A 1XMPA 1XL1A 1QM5A 2X2OA 1C9JA 1M66A 3MCTA 3N70A 2PUJA 3QFSA 3R3UA 4FKZA 4HY3A 4CV3A 5HUJA 1JHZA 1UC8A 2J08A 3L7NA 1KFJB 4I99A 1WXWA 2AYXA 5EP4A 3RUFA 4FDVA 3FUWA 2BHTA 3CO0S 5JDIA 4R3NA 3S7ZA 5JY6A 3VDRA 1DT5A 3DOIA 3VZPA 1DWOA 2H5JA 2G1PA 2HRZA 2JA2A 3V2IA 1SVSA 1NJFA 2IDJA 4P4GA 1FS5A 2P4HX 2FXIA 5CR9A 3MQ4A 2AUMA 1KYVA 1PJBA 5HGXA 1Q77A 3IE2A 2P1DA 4E13A 4R6WA 3WDMA 3W5AA 4JBGA 3LMKA 3DKRA 2WQ7A 4B85A 5EIOA 2GUWA 3K32A 4QM6A 3RK0A 2RHHA 3WIBA 2Q1UA 3DOEA 4NV3A 3FF4A 1YL5A 4NFLA 1JKJA 4OQPA 2BGRA 4BJ1A 1JZTA 1ILWA 3KPYA 3VHLB 3A0RB 1UFVA 3TLBA 4NYMR 3I0ZA 5DLEA 1TZBA 4I1RA 3BHMA 1GCGA 2YXNA 3TPCA 2BR4A 1NBMA 4B3XA 4OP2A 5AW2A 1PJ8A 4O2BB 2OR3A 1QLJA 3K9CA 2A8YA 4NABA 5F77A 2E37A 1IUNA 5FA5A 4EL5A 1ISPA 4XM0A 3K53A 2ZTMA 1I6WA 1FIUA 1OJLA 2GYUA 4ZOBA 5CAEB 2YXEA 1AHIA 1DCFA 2VAPA 2JC3A 3SEFA 2ZIWB 4D46A 1OXKB 4FE7A 2OGTA 2C4VA 2YQ4A 1Y4AE 2QTVA 4Z4HA 5JD6A 1I2BA 4MGZR 4W5WA 2FFRA 1QQ6A 4Z1MA 5EWLB 5AW4A 5PNTA 3VC1A 1QG6A 4LYFA 2YUTA 4J76A 4RVDA 4WESA 2W42A 5ULLA 1UJ4A 1PJRA 4JP5A 3OZDA 2D1SA 4Q1DA 4ZVQA 4ESVA 5E7IA 4B87A 1SVUA 3CO5A 1BRTA 4HNRA 4Q4JA 4DE5A 1MVOA 2FR1A 1JQKA 3QFFA 3TUZC 4RCZA 3W8DA 5A4DA 4EGQA 2GNPA 2QENA 4MIOA 3OIWA 1ZOIA 3MINB 3H1BA 4JLDA 3ICCA 2ZIEA 4CEIB 4IQ8A 3STWA 3QVJA 4PR3A 1TQ2A 5B6PA 2IDZA 3HWWA 1U0JA 2B69A 1V5EA 3RSCA 1GGNA 3ZU2A 3W6ZA 4D0NA 3TE7A 3EGEA 1W47A 4KR0A 3VJKA 1AN0A 1XDZA 3ND8A 2O8DB 3WWCA 2ZJ6A 4KMSA 1O0SA 3KXPA 1IPEA 3QNMA 4IY1A 4GF5A 4B44A 1K08A 4D4IA 4C3ZA 4QC2A 1NJ8A 2WAYA 3EXIB 2J3IA 5TR9A 3RYHA 3U40A 1F0PA 4LF8B 4CUJA 3L07A 1TQDA 1XRLA 2F8SA 1C29B 2ZRCA 2OKGA 4WGFA 5CAEA 1NUQA 3QG5A 4FJ2A 1NVTA 2BM0A 3OM9A 4QUEA 4H31A 5FL3A 5M29A 4RTNA 2DHEA 4FILA 1QPGA 2O8FA 4JUDX 4Z4EA 2WPNA 5EINA 1CY7A 1H22A 3IP3A 2RJNA 4FQ8A 3UJAA 3W2IA 4BLTA 2DY0A 2NXJA 1WOMA 2X3FA 1QIJA 1UXJA 1YBAA 2XVZA 1M5TA 1NT4A 3PFIA 1NLMA 3TTWA 1XEFA 2QUJA 3MJTA 3QU2A 2X4GA 4GQIA 1K5PA 2XMBA 3U6KA 2C2OA 1SA0B 4KE7A 4M0PA 4KWIA 4EH1A 2RH8A 3F5QA 2EQ5A 1E3WB 2GEVA 5IT4A 4P84A 3AERA 4TKUB 3L6RA 3IA7A 1O6BA 3CSDA 5CJPA 5FOXA 4C3VA 1P44A 4JB3A 4JT8A 4M4SA 5MN6A 5NULA 2L42A 3GLIA 5FXMA 1V3QE 1ISHA 2Q6IA 4JBIA 1DXOA 3S68A 2EFGA 2HIAA 2R2AA 3AHJA 3BFXA 3HFSA 3HXTA 1DEHA 1SCBA 4QBHA 4Y2VA 1Q74A 2C2GA 4IWYA 4LWQA 1ZSYA 3TH5A 1QGDA 5TDHA 3WR5A 4E2ZA 1CSEE 4PC1A 5DGIA 1YZTA 4A15A 3SQWA 5JZMA 1FUKA 3GMDA 3LUCA 4QLAA 3T4UA 2PBZA 3FDFA 1L4EA 1SKBA 2XNJA 4LXYA 2XVAA 2QU8A 1E60A 2ZYVX 5BR4A 1DFHA 1VA5A 1CB0A 4PNPA 1FFBA 1WCXA 3DD1A 1UDRA 2GZMA 3EXFA 3INRA 5LYJA 1SG0A 1SKYB 2QRLA 1R0YA 3WGOA 2J3JA 3SJUA 3ZY2A 1NNEA 2RHDA 3NXSA 1YB7A 2R8XA 4QHTA 5AUNB 5HIMA 3L9WA 3GRAA 5KYKA 1CY4A 1K06A 4TKLA 4ECAA 4ENPA 1Q0UA 3MHTA 5H1YA 3TIFA 3HFRA 5EAIA 4B4KA 3A6PC 1YF3A 3SN6A 2DWUA 2B98A 3E0XA 4YCLA 3QPVA 4A6PA 1W2HA 3AL3A 2V9CA 4AIIA 3V1NA 3I1FA 4DQ0A 3K8YA 3KKQA 3NCHA 4NU0A 5DI3B 2HXYA 4RF2A 2QL5A 1PZGA 1AUPA 2EFDB 3M8KA 4KXNA 2VSFA 3PDWA 1GTMA 3ZQUA 4QUJA 5A2GA 5ERYA 4WFIA 4RZXA 2GEFA 2JHGA 3W6PA 5K8VA 1RXCA 3ZDQA 3PQ7A 1V1JA 3EJ6A 2ZSEA 2V3WA 1WUKS 2XNDD 3LQ2A 4REQB 4ITRC 2IV2X 2ZLBA 1QTRA 1P1RA 3RABA 4YJ3A 1W8IA 2I66A 2DGDA 3TNJA 4E2FA 2A9RA 4TVSA 1ZNYA 1UKYA 1KHHA 3MWLA 5ESDA 4YY3B 1A5SB 5CBPB 4L6AA 1TJNA 4QT4A 1PW7A 1GG2A 3NNSA 4JGIA 3V1UA 3AUJB 3L93A 3I83A 4J3JA 3M1LA 2R5FA 3AHHA 3C4JA 3UOWA 5B53A 4PS1A 4FFRA 3QNWA 4LQ4A 2OQ2A 2QN1A 1ZITA 5SYNA 4CTJA 1Z8HA 3LXRA 5J4VA 2JFWA 3I28A 4O0LA 3WB0A 2HF7A 2VHVA 621PA 1Q15A 3L0PA 1PWXA 2BBTA 2O52A 4I3GA 3A31A 2QMOA 3SS7X 4FC7A 4R1OA 4W5HA 1BRMA 2W37A 3DL4A 3FOWA 4GS5A 4KFUA 1Q7BA 2PH1A 2HLDA 3ESQA 3D3EA 1OW3B 3LQKA 3OEED 5DHSA 7ABPA 4TWRA 3HQ4O 3AF2A 3IT0A 4BDSA 1SB9A 1XXLA 3UCXA 2NOAA 3HV0A 2XTJA 4O4JB 3G3EA 3ZCTA 3AM1A 3HMKA 3A0UA 3C7TA 4EBBA 4K3UA 1CFZA 3E22B 3DO8A 5HF8A 3UPUA 2DBQA 4QWMA 3NX4A 1Y5LA 3JQ7B 5L3VA 4RVCA 4GECA 2DEUA 2O0MA 2ZRJA 1UK7A 4PLFA 3VO2A 3BX1A 3LY5A 4BEWA 1H0KA 3GDFA 1WDLA 1I7DA 1C3VA 3WBBA 3VNBA 1GAXA 4WERA 4DIFA 4JU9A 3EY4A 3FOAA 1XA0A 1PQPA 2O1SA 3KC2A 1RWNA 3KWLA 4IDCA 4MVYA 1NVBA 1LC0A 1G6Q1 4N65A 4TV8F 4CF3A 1XWIA 3O47A 2JDID 3PXAA 1MX5A 1ZHHA 1IIBA 4FGKA 1CHNA 3QE2A 4JR2A 4LRXA 3RBAA 5DNCA 2C7PA 5LP6F 3DDCA 3FKJA 2H57A 5JPIA 3KVRA 1XD2B 1Z4JA 4EPWA 3NW9A 1Z73A 3OCZA 3N8IA 4A16A 5A7HA 3KHKA 5K3EA 3VOSA 5GZ1A 1S01A 1F8XA 1U8TA 1YU9A 2DKOA 3C7CB 1BCSA 1Q21A 2HIGA 2ZI3A 3D4IA 3UMCA 3BMCA 2VJMA 3WQBA 3P2KA 3BQMB 4CL2A 1V37A 5CT9A 1BCRA 1NN3A 1RYBA 1JKXA 3FFBA 3LZDA 3ONDA 5BVHA 4GX2A 1GAQA 2Q8PA 3AY6A 4LRUA 4HDQB 1EWYA 5HCIA 1CR6A 3TVYA 2P3SA 4MJ3A 2Z8YM 3H3JA 1M2VA 3QV2A 4J07A 1M1UA 1WW2A 4WLFA 3W04A 1C4XA 4X64B 4OAOA 4LDAA 4DAOA 1BKYA 3D54D 2P6UA 5A5GA 2XYVA 1JSLA 2YVQA 3QU4A 3COPA 2YMPA 1S3SA 5G4KA 2Q22A 3OOYA 4KXFB 3L8GA 2Q2NA 2X0JA 1C5KA 3GFSA 4XJSA 2O2CA 2V45A 2X9GA 2GLTA 2OV2A 3GRKA 1E7RA 2YV5A 2J5RA 3K5PA 4FMCB 4JP8A 3ZU5A 4B3TB 5I7UA 2DAPA 2ADOA 1GVHA 1IY2A 1HOTA 2QTFA 1N0UA 1RQPA 1XDDA 2WJAA 3HJTA 4IDGA 4X8LA 4E2YA 2IXGA 2NSYA 4KWTA 4LJLA 3M3DA 3U4DA 3ZBQA 3N8KA 3SX0A 1UAYA 5JQWA 4IJQA 1I33A 5KSWB 4B8YA 2FN3A 4DJJA 4ERNA 2I65A 3B12A 5COBA 2PAFA 1AMUA 1AUQA 4E7OA 2XNHA 2BOVA 2WWFA 2H2HA 3BQ9A 3C6ZA 4FFNA 2PLFA 2FGKA 3CEAA 2PWBA 4W9NC 1BHO1 4NICA 3TAUA 4D9JA 2GJKA 4HNGA 1I5RA 4QGSA 1SOUA 5H7XA 3BE6A 2X0FA 2DM6A 2ZB2A 4V1CI 1W5TA 3OPYB 4HAVA 3WAKA 5ESWA 1T34A 3IQGX 4AC9A 4MJLA 2GF0A 1TT5A 2VBCA 4BQEA 3S2IA 2P9EA 2GLUA 1TJYA 3GJ3A 3ABSB 3KOZA 2VCEA 2WF6A 1U0GA 3SP1A 5CVCA 5KVCA 1E8DA 2AMVA 4UVDA 2JIMA 4G5YA 1KP2A 4UVGA 1EP9A 5FLKA 5LP1A 3A6JA 1UXOA 2I7VA 3MUEA 3D1VA 1PQ4A 3F9RA 4P4TA 4Y2QA 3UFXB 3SD7A 1YNOA 1U28C 1ZIOA 4RJTA 3PVSA 1DMRA 5CFLA 3DB1A 1GZUA 1OHHA 3WL3A 1XI2A 2EKDA 1I7SB 2GPBA 2VUIB 5C8YF 3A6HA 2IX3A 2NO0A 3N0TA 3GAAA 3I1YA 4QOSA 5C37A 2ORIA 4LV8B 3IB6A 3TOZA 4C22A 4Y1GA 4OK6A 4FFSA 3GJ5A 5CMLA 3INTA 2PL3A 5LC1A 3BRQA 3NHRA 1E79D 3A9CA 4LWZA 4RK7A 4EG6A 2SECE 4RU1A 1D2CA 1LVHA 2ATEA 3LX8A 1J5PA 4LUCA 4OSOA 5CVUA 5IJ0A 5HVNA 5LMZA 3R7NA 4MRNA 1XJQA 4PBRA 1ZQ1A 1UBEA 2J85A 3HCPA 2P1ZA 3LPLA 4ZXPA 3V8RA 5CIYA 3WGYA 2PCLA 2VDQB 4MW9A 1U9ZA 2YVLA 5E7MA 3F98A 5I7VA 4OUDB 2JJMA 3RARA 2OO7A 4KV7A 4QATA 7GPBA 1ZMBA 1CEQA 1QDUA 2JRLA 3BMOB 2P6MA 2EWMA 1XZPA 3F8SA 2DLDA 5CLGA 2PH5A 1TYZA 4NG5A 5C5EA 3ERCA 3L6CA 4CF4A 1ZUHA 2HBYA 2XKJE 1NTOA 3EXAA 5HKKA 1XDUA 1ZJJA 4HQKA 1V7QA 4YACA 4YMUA 2UUCB 1MGOA 3UW3A 1QAMA 1GNPA 2PKEA 3BAFA 2VL7A 3NYIA 4RABA 4AN4A 4W5OA 3KQLA 2EXXA 1JEDA 1TUGA 2Q5EA 2BIFA 2OZKA 1OTHA 3R40A 1VLMA 4KBGA 3ABZA 4ZOCA 4NH4A 2P40A 1M2KA 1Y1SA 3UV7A 1WEKA 1UQRA 3VNQA 2P9ZA 1EFAA 5AVYA 4H1WA 2GK6A 4RHTA 4FCVA 2PRIA 1NC1A 1X42A 1BXRA 2WDZA 3BAZA 3QJYA 1BIFA 4RD4A 1N0VC 1EFRD 4BGEA 4C6RA 1VOTA 3GH3A 3VC3A 5EZQA 4C0XA 3ESDA 1D9ZA 1EG7A 4IOJA 1OX4A 4RV9A 4IP0A 2BKLA 1MLDA 2OCGA 3FYUC 4LW8A 1Z2NX 1A95A 1T6NA 3BDVA 4P7GA 3NGMA 4A4DA 4CKEB 3W3ZB 4DQXA 5JCOC 3NDPA 3N8NA 2EWVA 4B45A 3WDLA 2H4FA 1SXJE 1XEWX 4IDFA 1ORTA 4EW3A 3PFHA 2C94A 2JJ2D 4UMFA 3FMOB 4KGDA 2NV0A 4UAVA 3W2EA 1QIEA 1DSSG 4PM4A 3W5JA 2BKUA 4DXDA 3S2EA 3CNQS 3NOVA 3OOSA 4YUAA 1M2NA 1DADA 2NZ8A 2YUIA 3I2IA 1S4MA 5KYTA 2CCGA 2E48A 2QBYA 2C9OA 3AM5A 4XSHA 3V7YA 4MUIA 1Q95A 2VPIA 4CHTA 1NVXQ 2IIQA 4BKQA 5JPDA 3OJCA 5LMUB 1T0UA 2BW0A 3GIWA 3CA8A 3QU9A 2DCUA 1SCIA 5CYOA 4MYSA 2WHPA 2WUGA 4MUFA 5C5IA 2PGIA 4K9LA 3ZWOA 3OZCA 3SNKA 1U5CA 1Q2XA 2L19A 5CW1A 1C41A 1SGWA 3ZVKA 1GL6A 2XHEA 5KSZA 2MSEB 2AF4C 1RHJA 1YMVA 3BL8A 4RJKA 1QYDA 2GM9A 4WQMA 3WSWA 2FPMA 1QKJA 2Q0HA 1C1XB 3MTQA 1G7SA 1VSVA 4C0QC 4J0KA 3UJ3X 1T9HA 4IG4A 5LU8A 4ECEA 1WV1A 2P5UA 2ZP1A 3HA3A 3ROKA 4DKJA 4GKBA 4ND3A 3L4SO 4O8JA 1GAEO 2YC2C 3HYRA 1H5UA 5JSUA 1W36C 1W76A 4TTQA 3CM0A 3E4DA 2V9PA 1I3OA 5AJWA 1KNQA 2CMGA 1U3FA 2C4NA 5HOEA 1QYXA 3MW8A 4RGVA 3LKVA 3T1NA 1RQNA 3EZ6A 5FUVA 3WOVA 2PDAA 1U7XA 4J03A 3GLFE 2V58A 1BE8A 2GSWA 2X6QA 1QG0A 3ED1A 3LCJA 3TDNA 2FDXA 1CS0B 1UM9A 3TRDA 2P2CA 1EDOA 1U7TA 1NSTA 3U7JA 3BBPA 1FXSA 1EVJA 1W5EA 1AXEA 2ZYSA 4MGIR 3I9KA 4FS3A 5JADA 5TVKA 1OLXB 3UKDA 4K9RA 2OYSA 3VR3D 2QTBA 2F9MA 2QYSA 4UNIA 4BLOA 1K2VN 3WDKA 4O6VA 1R4MA 2O8NA 2AJ8A 1A82A 2SBTA 3GLHE 1PFQA 2OAEA 2YJZA 3MN1A 2QRVA 3NONA 5H16A 4MUMA 1GSAA 5CDYA 3OIVA 3GZ4A 5EP3A 1F5SA 1RI1A 4V0MA 3WMGA 4Q7QA 3MXTA 1VJCA 1UK8A 4PSDA 1L6RA 1P5ZB 1XHEA 2GCOB 2OWEA 3L0YA 5CX4A 5LBTA 3UHJA 5M2QA 4GLLA 3W8EA 5LXTA 1VLQA 2PK3A 2PT9A 1DKMA 1IULA 1H1TA 2R4QA 3FDIA 3I9FA 3MG9A 3P9SA 4HAUA 4MV6A 4Z9BA 5JCJA 3BMNA 4HXFB 1ZH2A 4JR1A 2HN9A 1RHKA 1RMTA 4KQ9A 2INGX 4KV9A 5D3MA 1O9GA 2HYDA 4ZD6A 2FLKA 3X2SA 4MVJP 1OIXA 2IHKA 4HWPA 1H5QA 4M2LA 2W6ID 4ZVMA 2Y05A 5TJ9A 2PMEA 3TMKA 5AOCA 3MB8A 3RROA 3JAKA 4TQAA 4NCJA 5KSYA 2ONYA 3P2MA 1XCLA 1KVUA 4LDRA 4M46A 3DL2A 5K20A 1HL7A 1L4MA 4N5LA 1ACJA 3EXHC 1E99A 1OGYA 5AHRA 1MZVA 4O4IF 3VDXA 3VSCA 2GJ9A 1P31A 2R7MA 3TQHA 1E96A 1QVZA 2ZI5A 3EXEB 4UHCA 5L3ZA 3ZWQA 4E0BA 4ZYVA 2GEKA 2RGDA 3RK4A 3ZWCA 3E7PA 1R9NA 1LB1B 3KQUA 2OE2A 1ODKA 3I5MA 1R8QA 2J46A 3VYWA 1JILA 1W1WA 2G25A 4GKAA 4MRVA 1E2MA 3SBOA 3AINA 4YI3A 3AP1A 2CLMB 3UMYA 3QVWA 1YTLA 3HEMA 4IW3B 3D6HA 3NM5A 4GP9A 4LECA 1A27A 4DVGA 1FU4A 2JIZA 3CCFA 4FNAA 2P3QA 2QRVB 4Q21A 4RVFA 3ND6A 4GPAA 4ZANA 4GX0A 4O2RA 5B58T 1GD1O 2RGWA 3O94A 4MP3A 1DCMA 5F3WB 3IVAA 3GROA 4MKHA 4FLEA 2CD7A 3FYUB 1U1FA 2ZT7A 3F5MA 4IXNA