4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase 1
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
2EV9A 4BNJA 1T1RA 3NUGA 4ONEA 4CM9D 4R41A 3RU9A 5T8KC 5JE8A 3KOUA 1UDAA 4EI2A 3I52A 3WJ7A 2UDPA 2AW5A 1IULA 2YJZA 2VRBA 1NQOA 2NU9A 1K89A 2QZZA 2TMGA 1UDCA 4CMCA 4X54A 2CD9A 4M8SA 4D44A 2NTVA 3B20A 3GFBA 1HDCA 5KJFA 1DDOA 4OL9A 1SOVA 1WZEA 2VWHA 1E7SA 4KTVE 4IS3A 4EYEA 3UUWA 1IPFA 1EVYA 1HTBA 1UP4A 2AE1A 4J2OA 3HDJA 3GZNB 5JCXA 2NU6A 3PFWO 1R15A 3BXXA 4RVFA 2D3TA 3GVXA 5K6AC 2HSDA 3I23A 1KERA 3WR5A 2BI7A 4GLLA 4BNWA 4RDHA 3QWBA 1B7GO 1ZBQA 2GNAA 1HLPA 2IEBA 2Z95A 1LSJA 4KUHA 1VKNA 2BGMA 2P5UA 2EKLA 3F1LA 3CEAA 4E0BA 5JCJD 1RYDA 2QYTA 3F6YA 4DA9A 3ZW8A 1M67A 5JC1A 3ZNNA 1FF9A 1IHXA 2FPPA 3LVFO 3RJ9A 3ZU2A 3BAZA 1AUPA 4YT8A 1KY4A 4GWGA 3W8EA 5KJ6A 1P33A 4H16A 4BGUA 3OJLA 3VKVA 3JQ9A 3RD5A 3PJGA 5TS3A 4M86A 2Q2QA 3UICA 1I10A 3NAQA 3GNQA 2ZB7A 5F1KA 1NVGA 4ALIA 4BNLA 2P2SA 4XX0A 3C7AA 1GDHA 3ZDFA 5JYDA 3U9LA 5I9NA 1HXHA 1V3VA 2VRCA 3H5RA 2PGDA 5JDCA 5HS4A 3TOXA 4TZTA 3NT5A 4RVGA 4IJUA 4L74A 5ICMA 3BTUA 3BZUA 4E5PA 2GZ1A 1LSSA 2EGHA 4UUMA 4XYBA 4D41A 5KKCA 2X5KO 1E7MA 2I67A 4HFJA 2E82A 1U3TA 3WNVA 1CDOA 3BMNB 4R1NA 5JO9A 4FOSA 2O7QA 3NT2A 3L6EA 1I2BA 1DB3A 4FGWA 4Y6PA 4J3FA 1XG5A 1GFSA 1HYEA 3DR3A 4BQPA 3UH1A 2H1SA 2JJYA 3JQAD 3MJVA 5AXDA 1I01A 3VZSA 4DUPA 5IDYA 1YO6A 1U1IA 5IZCA 4NU6A 2X0IA 1ADBA 5L53A 1M2WA 1PJQA 2ZQZA 1DPGA 1MP0A 3DONA 3DDNA 3G1UA 1QYXA 2DBZA 4YAGA 4E31A 3BMNA 3OIGA 1E3SA 4D3FA 4RPJA 4IQGA 4HXYA 3KM0A 4YQZA 3F9IA 3GEGA 4NPCA 1LSOA 4YT5A 2OZPA 3ZWMA 1GY8A 3ITKA 7MDHA 1V8BA 1B26A 1QRRA 1ZK3A 2DPHA 4HWKA 4TRNA 4UREA 3VH1A 2WD7A 3E8XA 1ULUA 5F1PA 3L9XA 2Q46A 4E3ZA 5G4KB 3GOHA 5DBFA 2OP0A 2H63A 4CMJA 3GN2A 1EUCA 2Y1OA 4AJJA 2VWPA 1DBVO 2Y1DA 3DQPA 4NBRA 4N7RA 4BOYA 2Q45A 3PP8A 2EEZA 1GZ6A 4YR9A 5ITVA 2O3UA 2X9VA 1HYGA 4GSKA 2D8AA 2G82A 1F8FA 1PJCA 3ONFA 4IM7A 3QY9A 1PJ4A 4BNKA 5JMPA 5TIIA 5IDWA 4M89A 2X23A 5KWEA 4INAA 4ZQEA 3FHLA 3HDHA 1J49A 3O26A 4IJKA 4B7XA 3D4NA 4J4HA 3UF0A 2VTEA 3ICPA 3B1JA 3NTRA 1XIVA 2D59A 2ZIZA 2W98A 4G81A 5ENVA 1N7GA 4NH4A 3DMYA 3PI7A 2I3AA 3PGJA 3R0IA 3D3WB 3U0BA 3DOCA 1PS0A 1WMAA 3BMCB 4L4SA 2NTNA 3VDQA 4TRMA 1C0PA 1KEUA 3MJCA 4YAIA 4DLLA 3LK7A 2CVOA 1PJ3A 2VHWA 4YTEA 4NJMB 1E3IA 4A27A 5EIOA 4NQZA 5JY6A 4DTIA 1I3NA 3WLEA 3A14A 3DHYA 3JD0A 2FZEA 3JQ9C 4FJ1A 4YJDA 1MA0A 4RF4A 4BV9A 3AW9A 3STHA 3NJ4A 3GNSA 3VKUA 4ID9A 3K5PA 4N5NA 1GQYA 5THQA 3DHNA 3H5AA 2V7PA 2OGUA 3FR8A 2Y1FA 1J4AA 1QMGA 4OXNA 4BQRA 2ET6A 3D3WA 3WOHA 2JHGA 1E7WA 4XZ3A 3WBBA 3HZZA 2FSSA 5JDCC 3TL3A 1SZJG 4LCJA 3UCXA 2H5LA 1D8AA 4W4TA 3UCFA 4CV3A 3VC7A 4PLYA 1KYQA 3O38A 1O95A 2PK3A 5G0UA 3CZMA 4IMRA 3G17A 2PZLA 5LCXA 3GGOA 5BNIA 1P31A 2ZYAA 2D5CA 4Z3KA 1EEHA 1Z7EA 1I8TA 3AOEA 1CYDA 1MXHA 2LDBA 1KVQA 1H6DA 4UVDA 1H6AA 3DEYX 2NU8A 4CLEA 1BVRA 2PWZA 3N74A 2UYYA 4FB5A 1OFGA 3SEFA 3QVWA 4JIGA 3PTZA 5IXSA 1JLLA 5IZCC 3T4EA 1TXGA 3QHAA 4PFJA 3DTTA 2CF6A 4CMHA 1ZMOA 4NK4A 2IZ1A 2XAAA 2HMVA 4NR0A 2HCTA 4DC1A 2DUWA 3KEOA 1ZXLA 4O59O 3DZKA 4PLFA 4BNFA 4E2ZA 3RFTA 2HMSA 3RUDA 4HNGA 4E30A 1YBVA 1LQUA 5KTKA 3ZV4A 2PNFA 3WWZA 1JA9A 1LI4A 2DTXA 4F6LA 3HN7A 4XYLA 4OXKA 5U1PA 1M66A 4I08A 1KIFA 4FQ8A 1LDGA 1SCUA 2PD4A 1O6ZA 1YJQA 1NASA 1N5DA 4MOWA 3ADOA 2W4QA 4ZRNA 3GHHA 4D3DA 1R0LA 3VTZA 1FDVA 3JYOA 3V1UA 4XKJA 4EGFA 4RF3A 4CQMA 3GUCA 4PRLA 1Y81A 3UAGA 2OBYA 4XDZA 3DAGA 4JGBA 2E4AA 3VTFA 4D42A 5T73A 4YAKA 2VYNA 4QECA 4YJGA 3TWOA 5L40A 3VH3A 5TF4A 4PZCA 4WOJA 4OKIA 1PJ2A 3DHEA 3KXDA 1CRWG 1SO8A 1TB4A 2B35A 4BB5A 5I7VA 2W2KB 4CLRB 1YB5A 1WMBA 4BKRA 3Q11A 1H2HA 3JYPA 3MJSA 4MDHA 1VL0A 1OI7A 2YQ4A 4J1QA 4LK3A 4P4GA 4TKLA 3ZW9A 5FYDA 4HFRA 3CUKA 1OZAA 3NT4A 1ID1A 1LC0A 1ISIA 5KIAA 1YWGO 4WKGA 2JCXA 4P4NA 2HK7A 5B4TA 2YHIA 3U09A 1SC6A 4NI5A 1BW9A 1GADO 1JWBB 4FD3A 3GFGA 5GZ1A 1I0ZA 2QYSA 2W2LD 4ALJA 1HSZA 2X0JA 1BHSA 3DBHA 3HJAA 3TFOA 2OL4A 1A71A 4O1MA 5C7IO 2AQKA 2VNSA 4JBIA 4BO1A 3R6DA 1WZIA 4KTTE 3ZU5A 1QXSA 1QYCA 5M6DA 3QV1A 1GZ4A 4XR4A 3TDKA 4CLRA 2GDZA 4CV0A 1XHLA 2HQ1A 3WMWA 2B4RO 1PR9A 1KEWA 1YOVA 3LDHA 1NAIA 5A1TA 3WS7A 3I3OA 2F1KA 2NNLD 1W6UA 3AY7A 4ZJUA 3DTYA 4YWJA 2NM0A 4RPGA 1T26A 5H83A 3ZWAA 1T2DA 1EVIA 5CHEA 2GCGA 4I9HA 4YCAA 3PVZA 2VT2A 3FNFA 4J1TA 2Y68A 1IHYA 4GH5A 3AOEC 5C5IA 4IXWA 4DQVA 4DREA 4O63O 1Z73A 3UN1A 2VT3A 4RJTA 4YRAA 3KRTA 3MOIA 1ZK4A 3KYDB 4RQTA 2R2GA 3NX4A 4GL4A 4FSHA 3WFIA 3EDMA 3CH6A 3PDUA 4WEQA 3ZNOA 4NBUA 3AM5A 1HYHA 4HFNA 4P38A 2AHRA 4ZICA 3QRWA 4MPDA 4EJ0A 2WYVA 1XCBA 3SC6A 4CM6A 3HDYA 3KHUA 2WJPA 4ZD6A 1NAHA 2ILTA 3U4DA 2ZTUA 2OOSA 2WTBA 3QA9A 1N9GB 1T2FA 4I9UA 4BNVA 1EFLA 1Z6ZA 4L0QA 2P9CA 5AXCA 3TSCA 1ZKMA 4AL4A 5IFLA 4HADA 1E1KA 5JSFA 3DAPA 5JYAA 1WNTA 1XKQA 6ADHA 3EC7A 1I33A 2QHXA 5KNLA 3Q6IA 3GG9A 2HKIA 2P9EA 3GT0A 3E5RA 3KUXA 1H93A 3ICCA 4N5MA 4II2A 1HE5A 2WSBA 4J4BA 2ZTLA 1MC4A 3PHGA 3M1LA 3DXFA 3ZGYA 1WWKA 4XB1A 5IN4A 1ENPA 1IPEA 3GDFA 2XOXA 4UVGA 1LUAA 3L4BA 3G1TA 4NMHA 4OKNA 2C29D 3EGOA 3S2FA 3NRCA 5TT0A 2HRZA 2Q49A 1EK6A 1FDWA 4NK5A 3RUAA 1E77A 2JCVA 2QZ9A 4LVCA 1N92A 4CV1A 4ILKA 4JXKA 3EK2A 1GEEA 1Y5MA 2Q50A 3FF4A 1TA4A 3E48A 3NDIA 2PD3A 4NJOA 1BXZA 3DBRA 1I2ZA 3AUTA 3JQ7A 4RZIA 2CF5A 3UOGA 1Y8QA 5CEEA 2FP4A 4PG8A 3A1NA 3KV3O 3FR7A 4HY3A 1VPDA 2B0JA 3AWDA 1HT0A 1DC3A 5G2OA 1V0JA 1NVTA 2EJVA 2YV3A 3SLKA 1QP8A 1QV6A 3BTSA 1U7TA 2D4AA 3OMLA 1AN9A 5HBRA 1PJLA 2J3IA 3BTOA 1CEQA 2VTDA 2Y67A 4EUHA 1EUZA 1XQ1A 2X4GA 2X9GA 1A5ZA 3FBGA 4BGEA 4Y6SA 4Q39A 3KSZO 3GPIA 1R4NB 5T8KA 1BDBA 2HAEA 4QXMA 2GLXA 1O8CA 2CNBA 1MLDA 3PYLA 3ORFA 3SJUA 2C5AA 1AHHA 4D79A 1NXQA 1X0VA 3ZV6A 5EQDA 3GMDA 5THKA 1PGQA 3C3XA 4DC0A 1N2SA 2EERA 2QIOA 4D3SA 5CDYA 4BHTA 2NVBA 2RCYA 3GEMA 4AJEA 1DRUA 3MWEB 4B3HA 3WFJA 3SC4A 1KC1A 4CM9A 1UZMA 5IJZA 3I9KA 2NV6A 3ZWXA 2C2YA 3O4RA 4PZEA 1OC2A 4RGBA 5DBIA 3RC9A 5HRUA 4J2HA 3D64A 1OC4A 4RDIA 1L7EA 1Q1NA 4DLAA 3QP9A 3DZJA 3QWFA 5K6AA 3E6AA 4MIYA 4NBWA 1BVUA 1WPQA 4NU5A 1ZJZA 1NQAO 2WE8A 2X86A 4FGSA 4J0EA 5GMOA 3U4HA 1ZH8A 4L76A 2BHLA 2FR0A 1YONA 3KEQA 5DOVA 2YZ7A 4XQEA 5CEFA 5A3JA 3WGYA 1SNYA 2ZCUA 5TT1A 4P8RA 1ENOA 1X15A 1V35A 3PLRA 1LTHR 1Q7CA 2J3HA 5JCJA 1K2WA 3INGA 1R12A 1S7CA 2YV1A 3BMOB 1X14A 1EQUA 1RYEA 3NJ8A 4IDBA 4LSMA 4WE3A 2J8ZA 3HB5X 1P45A 3H9EO 3BA1A 1SEVA 4CM4B 1LRKA 1O94A 1DRWA 4R1UA 4R69A 4IPTA 4FR5A 1ISGA 3UCEA 4B8ZA 3IJRA 5KJ1A 4YDRA 5KVSA 2AG5A 3IIEA 4IDEA 1L7DA 4LVUA 3O8QA 1QYWA 2C54A 4ND4A 1GYQA 5AVOA 3ROQA 4J91A 4XA8A 4F46A 2I99A 1KY5A 1X0XA 1WDKA 3FCOA 3L4BC 1TT5B 4DXHA 1VJ0A 3I6QA 3TZ6A 1I5RA 1M76A 3RUIA 4Z6KA 1DRVA 4OIMA 4QSMA 3KYCB 4XGNA 5A9TA 4XCVA 3RBZA 2UV8A 4ZVVA 1WDMA 3ZWWA 8LDHA 4YBZA 4CM4A 5JLAA 3VZPA 1LLCA 5BNFA 4DIOA 1QV7A 1UXKA 1DFIA 1LC3A 3ROMA 1B14A 4CQLB 1R16A 3HN2A 3CPSA 4GAEA 3JD1A 2C20A 2PZJA 3BYZA 4DPMA 1P44A 3FNGA 3NGXA 5CPBA 4YXFA 1I3LA 4G5HA 3AU9A 2E37A 1PQUA 2DU8A 3C85A 3GY0A 4E2XA 2B37A 3L6DA 3Q0EA 5JAMA 4LRSB 1XGKA 3JQAA 3E18A 5BSEA 1H9BA 2NLOA 1SPXA 2CFCA 4BNMA 4PCVA 3KETA 3AM4A 3P2OA 2JL1A 2EXXA 1NHGA 2AQIA 4DGSA 1GV0A 4M54A 1ZJYA 1WAMA 2BKAA 1ZW1A 4CL3A 4NFSA 4FFOA 4L4XA 4IQ0A 4GWKA 4CR7A 2VHXA 2Y0CA 3VVCA 1YL6A 3VPFA 4PLHA 2FZWA 1T2CA 2PH5A 3QWAA 5LDGA 4DYDA 3RBVA 1EVJA 1X1TA 1ZIDA 1SMKA 1NR1A 1Z82A 4FCCA 4HX5A 2HUNA 2BELA 4BNXA 2JAHA 1ZK2A 5EJ2A 3DAFA 5CFZA 3MJEA 3I9OA 3NV9A 3PIIA 3AFMA 3DZGA 5KVVA 1E92A 3HADA 1UP6A 2FN7A 5TGDA 1UUFA 1DLJA 1IE3A 1GR0A 3LT0A 3OQ6A 4U6QA 4UAGA 2R6JA 4R3WA 4OMUA 1GV1A 1EFKA 2V6FA 3VAZA 1EE9A 4R54A 4Q3EA 4NIMA 4BKOA 2VZ0A 3G0OA 4RORA 1V6AA 4J7UA 3RBXA 1ENYA 1HKUA 2PFGA 4ROSA 4A73A 5IXYA 3OJOA 4E12A 2WYWA 1NBOA 4ZQFA 4I5EA 3RJ5A 3QVTA 5EL0A 1P0CA 4PLVA 1RM0A 3D5QA 3GZNA 5CG1A 3EHEA 4EITA 2Y93A 3PHIA 1B3RA 4MVJF 1ISFA 1YRLA 2AQ8A 3WQRA 3DL2A 1P74A 4PLZA 4TKMA 1HWYA 3H6KA 1G0OA 3T7CA 1YL5A 3ETDA 1ZNQO 3NDRA 4JP2A 3W1VA 4BL5A 1I32A 1FMCA 1K6XA 2CDBA 3JD3A 4IDFA 1QR6A 3TRIA 1U8FO 1I30A 3RVDA 1YQDA 3F46A 1LU9A 5C7LO 5L7WA 4GX1A 3K30A 4MVJE 1BXKA 1G6KA 1VLLA 4LCEA 2ZJ0A 4NG5A 4D45A 4IJWA 1KVUA 5G0SA 2PGLA 5DOZA 4CR6A 2D1YA 4ZHSA 1PJBA 3PZBA 1CETA 4UEOA 4E4YA 4KOAA 1SAYA 1M6HA 3MCVA 3R1IA 3GR6A 3RCBA 3U4CA 1PL6A 4YPOA 2EGGA 4KUGA 2GD1O 1XDWA 1T4DA 3PQDA 5F5NA 3O03A 1BRMA 2ZK7A 1H2BA 1JW9B 3H2SA 4Q3BA 1W8DA 1KS9A 2VN8A 4QFCA 3QW2A 5EESA 4UVEA 4OM8A 3GAZA 3IAHA 3WYEA 4XRGA 4CV2A 5IG2A 3SX2A 5FI5A 1DAPA 1D1TA 2V6MA 4DBVO 4D0RA 1NVMB 4U5QA 4XQCA 3GDOA 1AXEA 2JD2A 4NNJA 1P1HA 4W7IA 3V2UA 4FFMA 2EKQA 5B4VA 4FFNA 4OXYA 5J9GA 3AFNA 4XD2A 4FFRA 3ZHZA 1B2LA 3W4JA 5G4LA 4CMAA 4BMNA 1VM6A 3WDSA 4JX8A 5TJ9A 2JFFA 1NFFA 2ZJ1A 4PGFA 3RQSA 3QE3A 1ADFA 1CQJA 2DTEA 3FPLA 1SBYA 3Q9UA 2I66A 1W0CA 4OHUA 4WNCA 1HDXA 2Y1EA 1VSUA 1U8XX 1DIRA 2G0TA 3KSDO 4XIYA 1JWAB 4Q3CA 1GPDG 1QYDA 1UXIA 1YXMA 1LX6A 4KQWA 4LRTB 4JQCA 4B8WA 1W4ZA 4IDGA 1YB1A 3B70A 3VZRA 1YQGA 1ZEJA 3D1LA 4PLWA 3GEDA 2J5RA 4L75A 2HRBA 1UXGA 3GRKA 1U3UA 4Z0PA 2AA3A 4DMMA 3U4IA 2GF2A 1PZFA 3JYNA 2J3JA 4J7CA 4J1SA 5FWNA 2YDYA 5BSFA 4J49A 2GN9A 3LF2A 4DVJA 4E5NA 1XQ6A 3S8MA 4BO2A 5DP1A 1LNQA 1B16A 2YV2A 4Y9DA 3QWIA 5L7TA 1NR7A 2BI8A 5G4KA 1P0FA 4PLCA 4GVXA 2RBEA 3PHLA 3I9JA 1C3VA 2I3GA 2BH9A 1RJWA 3FNEA 4P4LA 5L45A 2Q3EA 5CDUA 3ZI0A 3C1AA 3ZH2A 1N7HA 4QTZA 3RAJA 2IXBA 1PWXA 3IMFA 4AJ4A 2G1UA 1BSVA 5B12A 5IF3A 3FN4A 2QQ5A 3GVIA 4WCFB 3E5MA 2X0NA 3BHIA 1E3WB 9LDBA 3EZYA 4YEDA 3RWBA 3AUSA 1BDMA 2FWMX 3K2BA 4RPHA 3O9ZA 1PJTA 1QG6A 1XELA 1P1KA 2IZZA 1Y7TA 1PL8A 4YYZA 1NQTA 2W2LA 3GZ4A 1Q7GA 3LC7O 1CF2O 4YJHB 2BF7A 3NYWA 1PZHA 2Y1CA 3BMCA 3GGPA 2XF8A 2A92A 1B8PA 3JQ8B 1S6YA 4HUJA 4AVYA 1D1SA 1HF3A 4NJMA 2VOEA 2OP1A 2HMUA 2D2IA 3JYLA 4BO9A 2G17A 1H5QA 1X1EA 4WCFA 3GNTA 1Y8RB 3V1YA 3ZWOA 2D0IA 1E3WA 3JQGB 5DULA 3QIVA 4I5FA 2BFOA 3OP4A 2W90A 4PG6A 2HO5A 4G2NA 1W73A 2WEKA 2O23A 3GRPA 3MEQA 1RPNA 2X22A 1HZZA 2Y99A 2X0RA 2G5CA 4PN3A 3I9LA 4OOEA 4YT2A 3VZQA 4Z0TA 4ZGWA 1U4SA 3DBVO 1IZ9A 3OJEA 4KQXA 3WBFA 1TT7A 3JQ8A 2O3TA 3ZWBA 4J16A 4WUVA 4ZU3A 4TROA 2V6BA 5TLSA 3C7DB 2DTDA 4Z9FA 3QSGA 1Z74A 1SB9A 2NVWA 5T67A 2DVMA 5DCUA 3TJRA 4K6CA 1ZEMA 4ZA2A 4Q9NA 4AJLA 4R9RA 4WECA 1HDGO 2DBVO 4B3JA 3BHMA 3GLQA 2DFDA 2C07A 3RI3A 3K73O 2NQ8A 3F3SA 3FTNA 4MVJD 3ZWYA 4RO0A 3IKTA 1K6IA 1U2GA 4EUFA 1EZ4A 4E5MA 1A4IA 2WM3A 5L95A 1YBMA 4FJ2A 2E6UX 3PLNA 4I1IA 4IIUA 3U62A 3B1FA 2DBQA 2QRKA 1ZFNA 1VL6A 3L9WA 5A03A 4MIOA 1HE4A 2VUUA 2E49A 3WJAA 4L4RA 2C82A 1KEPA 1Q7BA 1PIWA 1E6WA 3HHPA 2I9PA 3D4OA 4CMKA 5HA5A 4HKTA 4B4VA 5GZ3A 1M75A 1LRLA 1R0KA 1JQBA 3KLPX 4OSOA 1XSEA 3N58A 3EUWA 2V6GA 4Z3DA 3RUFA 4YAEA 3CMMA 4CR8A 3AUUA 3KLMX 2BRUA 5T5QA 4DBZA 1C1DB 3QJ5A 4U8GA 5JNLA 4JNKA 3GHYA 1VSVA 3HG7A 3JQBA 2VNAA 4EW6A 4N54A 2P68A 2AE2A 3GC6A 3AJRA 1UDBA 2FSVA 1LEHA 5A06A 4JP3A 1XLTA 2WE7A 2AXQA 2FY8A 2EWMA 3WYCA 4R51A 1TLTA 5L4SA 1P1IA 2DC1A 1WLYA 4JLWA 1E3JA 2I76A 2FHSA 1EE2A 2C5EA 1YKFA 1BG6A 4KZPA 3W6UA 1H6BA 2O2YA 4H15A 4CUKA 1ENZA 2P4HX 4BNTA 2W2KA 3RIHA 4K28A 4K1LA 3P5SA 4U0JA 1N1EA 2DUUA 3JTMA 1MXFA 4IY1A 4IZHA 2NVUB 3VPGA 4IINA 1UAGA 2YY7A 4WK6A 4Y8VA 3GG2A 1H94A 2EP5A 3AUAA 2ZATA 3ON5A 4RVDA 4OJNA 5JDIA 4AG3A 2PKQP 1FDSA 1I36A 2O4CA 1AGNA 1E7QA 5DNAA 4BNHA 5A05A 4W82A 5JXWA 4FIZA 4ND2A 1LLUA 3OFSA 3DOOA 4JK3A 4WCFC 4D43A 1TI7A 1DFGA 3ITDA 2HJSA 1KETA 1NYTA 3EZLA 3AY3A 3B6ZA 1V9LA 3VPHA 4Y6RA 3JCZA 4IUYA 4EJMA 1F8GA 4RVSA 3ADPA 3LYLA 4C4OA 3I9NA 3HFSA 2QW8A 3FBTA 4AJHA 9LDTA 2WD8A 1PQWA 2PV7A 3UFXA 4PLGA 1PGJA 2VUSA 3MJ4A 2DAPA 4IXTA 4Q3NA 2PA3A 4GI2A 3WGHA 3HWRA 5IDXA 4E21A 1DC4A 1LJ8A 1WVGA 1PTJA 3PFFA 3IP3A 2IYOA 1JAXA 2BLLA 3JQDA 2CVZA 5A02A 3D7LA 1J0XO 3DOJA 3H4VA 3KZVA 1DXYA 1WDLA 4WLNA 2ZB4A 3EW7A 4WOKA 2GRAA 2AEMA 1U7HA 2BD0A 2RH4A 1ADGA 4MO2A 1WXDA 2JD0A 5AQ1A 3FWNA 3H8VA 3KYDA 3NGLA 1E0DA 3EAGA 5ADHA 2X5JO 4ESOA 1VJTA 1FJHA 1ZSNA 2GN8A 3ANMA 4WASA 1U28A 1JDJA 4MVJI 3EYWA 5TQVA 3FTPA 1Q0HA 1A7KA 4GQAA 4GX2A 2ZYGA 3L0DA 4IDDA 2VZ8A 3ANLA 1YVEI 1H9AA 3FWZA 4AJNA 1NM5A 3DBLB 4RLHA 2OFPA 4GLOA 1HLDA 4IQ8A 1MX3A 2JD1A 1L1FA 5GY7A 1GUYA 4M1QA 5CEJA 1N9GA 4OH1A 4RZHA 3PYXA 3F5SA 3E9MA 1HL3A 3A28A 2P4QA 4NDNE 4ITUA 1QKIA 2B83A 1IL0A 3F47A 4BUCA 5KVQA 2Z5LA 4UVIA 5A4DA 3H2ZA 2XPCA 3S55A 3WGTA 5BT9A 1PGPA 2VHZA 1DHTA 3RC1A 3CTMA 4XRRA 1LRJA 3GUYA 1E1NA 3ULKA 5MDHA 4J0FA 1BWSA 4I5DA 3JQBC 1Y1PA 3M1AA 3AU8A 3C1TA 3ZZNA 3ZWCA 3Q2KA 4QEDA 3TZKA 5KCZA 3PDJA 2GR9A 2V65A 4MP8A 3ZCXA 1MFZA 4QFDA 5JO0A 3UXYA 1Q2XA 1JKIA 2YFHA 4BNNA 4MVJP 1HDOA 2YHUA 3ASVA 3W6ZA 4C7JA 2AEFA 3WWYA 1ZXBA 1GAEO 4MINA 3BTVA 3LU1A 4KMSA 4Z9XA 1QSGA 1ISJA 4J43A 2UAGA 2YW9A 1Y9AA 1PSDA 3IDSA 2QX7A 2YFQA 4OYRA 3OBBA 1NQ5A 4L8VA 3ZWNA 3M6IA 1E7YA 4L73A 3A06A 4CPDA 1LA2A 1ML3A 1JN0A 5F21A 4FFPA 1LDMA 3RUEA 2O2SA 5TJHA 4FPXA 4XJTA 3W4KA 5I7EA 1YH3A 5ES3A 4BGIA 1SB8A 1DAOA 5KOIA 5JDIC 3LT4A 3RFXA 3PIDA 3G3EA 1R4NA 3INRA 1BXGB 2AQHA 3NTOA 3LZ6A 4PG5A 1J5PA 3IL2A 1ZUD1 2DFVA 4YRBA 3TNLA 4S1VA 3VVBA 3PXXA 1NHWA 4PG4A 1Y6JA 5KJCA 4M55A 1QLHA 4DQXA 4TMFA 1U4OA 3GAFA 2B69A 4KUEA 3B1KA 4BMSA 3GH3A 2VYVD 3MWDB 4H3VA 5A3VA 4CL8A 3K8ZA 1V3UA 1H0KA 2WMDA 3TN7A 1DO8A 4WGGA 4Z9YA 4CLOB 4LGVA 1NWCA 3CSDA 1DHRA 4U6SA 4Z0HO 1PZEA 2IXAA 4UEJA 2GN4A 4YB8A 4S3MA 5TRTA 4CMBA 3E82A 1FDUA 3AI1A 4IGFA 1E3EA 5JS6A 1Y9EA 3R3JA 2OBNA 1XEAA 3WQQA 2IODA 3DC2A 1A27A 5I9MA 3MTJA 3Q9NA 4G65A 4EZBA 4D7AA 5ILOA 1D4FA 1MB4A 3NKLA 5I9LA 1BMDA 1VRWA 2C7VA 3GN1A 5MGBA 2CY0A 4OAQA 4E2WA 3I83A 4LSWA 1LBEA 2PZMA 3U5TA 1ONPA 4K6FA 4A03A 2OXIA 2IE0A 1YGYA 5C3MA 3KYBA 4UEKA 2BFMA 3LF1A 2CUKA 4O0LA 5FI3A 1Z75A 3KO8A 1E6EA 3IC5A 4FDAA 2EW2A 1ZSVA 3K92A 3BMOA 2OUIA 3DO5A 3GK3A 4PG7A 2DBRA 3ENKA 2O3QA 5U4QA 2Y05A 1JKJA 3EVNA 4TVBA 4XGKA 1ZK1A 2ZKLA 4J90A 3UHAA 1G1AA 1KEVA 5IAAA 3U49A 2JAPA 4FW8A 5H82A 4RVHA 4O6VA 2RAFA 4TZKA 4GPD1 4B4UA 3AM3A 5G0WA 3AI2A 3PZRA 2EKPA 5CP8A 4FS3A 5F1OA 1ULSA 1PZGA 2JCYA 4ZRMA 3H9JA 3JYQA 3P2YA 2ZQYA 2X5OA 2J3KA 2ZB3A 5DDIP 1K5HA 1TT5A 2CDCA 2PTGA 4BV8A 2Y0EA 1M6WA 1PEDA 4JN6B 3KYCA 4I9NA 4E13A 3FRJA 1R66A 1P1JA 3I9MA 3WIDA 1WW8A 5H81A 2B4QA 3NDJA 3L77A 3X2EA 1D7OA 5IDQA 3MTGA 4M49A 2WDZA 3OH8A 3DB2A 3OA2A 2Q1TA 3WSVA 3PJFA 5K9ZA 1R37A 5HM8A 4UVHA 3WGZA 4CQLA 3N7UA 4GX5A 2GO1A 2RHCA 2DM6A 2ZB8A 4W7HA 4ZQGA 3V2GA 4J9VA 3JSAA 1PS8A 2JFGA 3CZRA 4JBHA 2BFPA 3E03A 4CM7A 5BSGA 1AHIA 5IZ4A 4CMEA 4L9RA 3F4BA 3GGGA 4R16A 4ZN6A 4E32A 4XQGA 4A0SA 1EVZA 4MKRA 5COBA 5KKAA 2HMTA 1DFHA 2NUAA 4GMFA 2RIRA 4FBGA 4P22A 2CSUA 4EEZA 1T25A 4MVJH 4CMIB 1ISHA 5JY1A 3ZNQA 4E2YA 5A5EA 2OMEA 3ABIA 4CM5A 3GF4A 1F17A 1EBFA 4QUKA 4BKPA 1IUKA 1ISMA 4LMRA 1B8UA 3ZWVA 2FR8A 4LMPA 5COQA 3W8FA 3RC7A 3ST7A 5EINA 1B0AA 1RKXA 2PKRA 4YAJA 3H3JA 3FNHA 4CLHA 4QO7A 1JAYA 3R3SA 4NBVA 4PLPA 1GCOA 2PZKA 2JKVA 1K3TA 1HE3A 3UKOA 4F6CA 2O48X 4JJIA 4CMIA 3DFZA 3LT2A 3TOZA 5TSDA 5I7FA 4ND5A 4J7XA 3BIOA 2I65A 4NFYA 3U3XA 1UR5A 4GSLA 1A4UA 1PX0A 1X13A 2CMDA 3PRJA 3RUHA 3QWHA 4CMGA 5C7OO 5JAIA 4R01A 5CDGA 3DZFA 4MVJM 3BMQB 1PU2A 1R0SA 4IBOA 1MC5A 1U2DA 3IUPA 1VE9A 3JQEA 1O5IA 3JQCA 4HBGA 3CINA 1YQXA 4W6ZA 2DLDA 5DBGA 4WLFA 5B4UA 4KP7A 2VHVA 4XIJA 2Q4EA 1LXCA 2C7GA 1DIAA 2HDHA 3ZHBA 1FDTA 4CLXA 3PQEA 5DN9A 1X7DA 3S2EA 3OIFA 4DIFA 4K26A 1NPTO 2PGJA 5ICSA 1LDNA 1MUUA 1P3DA 3Q3CA 5ENDA 1JKFA 2J5QA 4KDFA 4DLBA 4XYMA 4CLDA 2GYYA 4Y98A 1AXGA 3BMQA 5TC4A 4NBTA 4MVJG 5L3ZA 1GTMA 3ZV5A 4AFNA 2GN6A 2C0CA 1BTOA 3ANNA 1XU9A 1GYPA 5DZSA 1R6DA 5ER9A 3PHJA 3AOGA 4FJ0A 4XJSA 5L4LA 5EERA 3IQDB 4U7WA 5DP2A 5AYVA 4A26A 3P19A 2DT5A 1FXSA 4AJ1A 4CUJA 1Q0QA 3WTBA 1X7HA 4GMGA 2AG8A 2WD7B 1NPYA 2GGSA 3GMSA 4TRJA 3IS3A 1GUFA 2TMDA 1U5AA 4GGPA 3E1KA 4I5GA 4BB6A 1B8VA 5TNXA 2B5VA 2R00A 1UJMA 1V3TA 2PLAA 3OIDA 3K2EA 3WIEA 3E9NA 2OORA 3CKYA 4DMLA 1NX6A 1DLIA 2A94A 1XR3A 4GX0A 3WLFA 1RM3A 1U3VA 2Y1GA 3OEYA 5AXBA 1ZZEA 3I1JA 3OEWA 2IYPA 1HRDA 1C14A 4AJPA 4CMEC 3Q1LA 1NNUA 5K0ZA 4XDYA 4MVJA 2HMWA 3TZCA 4RLSA 1K0UA 2OHXA 2C2XA 1NPDA 2IZ0A 1F0YA 5GZ6A 2J6IA 1TEHA 4ZQHA 1GQQA 5I8ZA 3WNQA 4B4OA 4CUZA 2GASA 2NTJA 3WGOA 4BNZA 3V8BA 1K6JA 1I24A 3BHJA 4E5YA 3IOYA 5BSHA 1VC2A 4IZIA 5DCYA 3ETGA 1YBAA 2CZCA 4BVAA 2NWQA 2UVDA 4OO3A 1G0NA 3D0OA 1A7AA 3FD8A 1OMOA 4ALKA 5JC8A 3GDGA 3WGIA 4JBGA 1ZMTA 4WLVA 1MFPA 4BO8A 1IYZA 3RROA 4RF2A 3G49A 4R3NA 1QLJA 3SJ7A 4FOOA 3W4IA 3AY6A 4ND1A 1DIBA 2BGKA 3A9WA 2POQX 4YJFB 3S2IA 3TZHA 1O9BA 2RH8A 2Y66A 4DQUA 3ROPA 3PWKA 3L07A 4FFLA 3MZ0A 2C59A 2VOJA 4LN1A 5I8WA 5LDHA 1DIHA 3WX0A 2VQ3A 5EMHA 5JW6A 1PWZA 2PH3A 1EQ2A 3IP1A 1RM5A 2VHYA 1C1XB 4B4WA 1MGOA 1FK8A 3S2GA 5CDSA 3HNPA 2QRLA 4C7KA 1DEHA 4BO5A 3VPXA 4MKXA 2VRCD 1B3BA 4JROA 2NQTA 4B7CA 3H65A 4A5OA 1F06A 3L6OO 3VDRA 3COSA 2AMFA 4IJVA 5DCWA 1XA0A 1UAYA 3KVOA 4RF5A 4YJFA 5HS6A 3JQ6A 3ZWPA 2UUOA 1E5LA 2PD6A 3C7CB 3KB6A 3I5MA 2F00A 1EDZA 3KTDA 4WCDA 3QVSA 3GVPA 4TQGA 3OECA 3QLJA 2Q4BA 3L4SO 4MJLA 1C1XA 2Q1SA 3TZQA 2P91A 4UUOA 3KSUA 4YJHA 2LDXA 1GL3A 2H6EA 2OO5A 3VHRA 4Q3AA 1IB6A 3LT1A 3V5NA 3ZHYA 3C8MA 4IDAA 4GBJA 5ITWA 1JTVA 2PKQO 2FR1A 4E6PA 5BR7A 2FOIA 3OHSX 2GERA 5EN4A 2BFAA 2GZ2A 5TX7A 4LW8A 5A04A 5T57A 3RFVA 3OF2A 1VJ1A 4MIEA 1Y8RA 4QQRA 1T2EA 1CQIA 3JQGA 3AI3A 4ND3A 1ONOA 5AOVA 1YL7A 4BNYA 4CM8B 4FC6A 1YS4A 1OAAA 1LDYA 2O3SA 5A9SB 1XU7A 4QT0A 3WXBA 1Q0LA 5CDTA 4BKQA 4YT4A 1Y5RA 3INTA 2Q1UA 3M2PA 1JVSA 3DZBA 4DIBA 1SEPA 2A9FA 3JD4A 4LISA 4EEXA 2R00C 1DOHA 1C0LA 4CQMB 1E3LA 4N18A 4CM1A 1PGOA 4R5MA 2Z1MA 3A4VA 5HWSA 1XWFA 3UGKA 5BNTA 3V1TC 1YDWA 4YJGB 1Z7BA 5KVCA 1GYRA 3OA0A 3WGGA 4WEOA 1LLQA 2X58A 1EDOA 1DJNA 1KC3A 2YDXA 4KWIA 3UVEA 2Y0DA 5G0VA 4BNIA 4PVCA 4CM8A 1DC5A 3GPDG 5A9SA 1YE3A 4A2CA 3ETEA 4KWHA 3EY4A 3H9QA 4DPKA 3M2TA 1WP4A 1YDEA 3Q2IA 3TPCA 4R4JA 3AK4A 5COAA 5I7SA 2O50A 1VKOA 4A7PA 3RUCA 4TRRA 1P9LA 4ALMA 3FI9A 3WICA 2YHIB 3X2FA 4QX6A 1OOEA 1BW9B 2P5YA 1KBZA 2NACA 3TL2A 4DRYA 3DMTA 4B3IA 1ORRA 4XGIA 3DBHB 4RQUA 4HP8A 2VWGA 5L7YA 3DZIA 2P9GA 3SVTA 1YB4A 1ZK0A 5EQFA 1MG5A 4FN4A 1T2AA 1HEUA 2HK8A 2J5KA 2BGLA 4WLUA 2FPIA 4JJFA 1LDEA 1UZLA 3RU7A 5L9AA 4I8XA 4D0SA 1U5CA 3RKRA 1YOVB 3F1KA 4XR9A 4EDFA 4IS2A 1C1DA 2JFHA 1PR3A 3ONDA 4R1TA 4WLOA 4YACA 3RKUA 1TVEA 8ADHA 1ADCA 4OOFA 3JV7A 5EPOA 5T64A 3PWZA 3PYMA 4DYVA 1IY8A 3DFUA 1U3WA 1YJ8A 2QG4A 4RV9A 4XB2A 2GZ3A 4BO7A 4ALLA 4ALNA 1F12A 4J6FA 3T7EA 3H5NA 2E48A 3I4FA 2X9NA 3VPSA 1JU9A 4BS9A 1J6UA 1E1LA 1EUDA 3T4XA 3WSWA 5KJEA 5CG2A 1R4MB 2B5WA 1BGVA 3HFGA 4B7UA 1UH5A 3CMCO 2X7HA 4J4TA 5U9CA 1OBFO 3ZNPA 4PRKA 4CM3A 1HDYA 2GPTA 1A72A 1ZCJA 2AEJA 3WGQA 2IRWA 3E9QA 3C24A 3ZHXA 1EBUA 1DC6A 4II3A 2NVUA 3HE3A 1D3AA 3HSKA 3K31A 1ZVMA 3OJFA 4J9UE 4TVOA 5JMWA 4RPKA 4XYEA 1LSUA 5JPIA 1ARZA 1N1GA 2VCYA 4NZ9A 2D5AA 2DPGA 1C0KA 4N5LA 4CODB 2QRJA 3IJPA 4UUPA 3K9QO 3OETA 3VH4A 2G76A 3LSYA 3OJ0A 2YYYA 5FEUA 5F3RA 2EP7A 1Z45A 3G79A 3RSHA 4JCOA 1R4MA 1I2CA 4E33A 1PJSA 4XQ9A 2HJRA 5ER6A 3HQ4O 5FFFA 2VYVA 1HZJA 4TWRA 4W9NA 4F45A 1GQ2A 4NHEA 3OSUA 1C0IA 3K6JA 5L4NA 4A10A 2GUGA 1T1SA 1HSOA 2H9IA 5ILGA 2HK9A 1GPJA 5G0TA 3ZV3A 3ENNA 3TQHA 1IZ0A 4PZDA 5DF1A 4IIVA 1KOLA 2VUTA 1HDRA 2B4TO 3PK0A 2GSDA 3ASUA 4OQZA 5A5FA 1DJQA 1XYGA 4EUEA 4BO3A 4AJIA 4BKUA 4CQMD 4DPLA 3SXPA 4F3YA 3CE6A 5FF9A 1VL8A 3V2HA 3VOSA 1AE1A 3C1OA 3DBRB 1T24A 2I6TA 3JQ7B 3SBOA 1Y8QB 2VYND 4XWYA 1HE2A 4CJXA 4K9DA 2X6TA 1DIGA 4XEHA 5CPFA 4AJOA 5JAZA 2ZYDA 1LQTA 1NFRA 5AXAA 3JQFA 2VZ9A 4IDCA 2PR2A 1I3MA 3DMTC 2VWQA 1CIVA 4KDEA 3DBLA 3GQVA 1QORA 3PHHA 3SLGA 1LDBA 4NFHA 3WG9A 5JFOA 2DKNA 5T6BA 2UUPA 4WNIA 3FPCA 3ROKA 3IUSA 2EHDA 3WMXA 1MV8A 2HU2A 3LC1O 2Q99A 3H9GA 1A9YA 5CAEA 7ADHA 1GU7A 4FC7A 1B15A 4OGWA 5JYFA 3PEFA 4BO6A 2Q1WA 2FMUA 3D3EA 4B79A 1JVBA 1UXHA 3OICA 3RASA 1IOLA 3LQFA 3PWSA 4O5OA 4AJKA 2WYUA 3PGXA 4YA6A 3I6IA 3FSRA 2Q2WA 1EK5A 1ONNA 1GD1O 2EF1A 4UUNA 5F5LA 4GGOA 2ZTVA 2YUTA 1T4BA 2O3RA 2SCUA 4OSPA 2NSDA 3H3FA 2CDAA 1SOWA 1I3KA 2WWRA 3KBOA 4M87A 3NTQA 2EIHA 2O4UX 5LC1A 1DSSG 3WQSB 2A4KA 4R68A 3DZHA 2X1HA 3F5QA 1E1MA 3TF5A 4E5KA 5B1YA 3CXRA 4HFMA 3HUDA 3QVXA 4GKBA 5HTOA 3MJTA 1E6UA 4BIIA 4GVLA 3K96A 4IMPA 3PJDA 4ZQBA 3OQBA 3QQPA 1F14A 4BGVA 4RL6A 4JJGA 3TFQA 1NTOA 1CERA 1QYVA 3H9UA 4J1NA 1P77A 4U0KA 4YRDA 1GZ3A 4PIVA 3I4CA 4BNUA 2YQ5A 1EMDA 3OQ1A 2HLPA 4R9SA 1GEGA 3ZN2A 2RHRA 3LC2O 2O3JA 1PQPA 3WB9A 1BXGA 1KVSA 2ZTMA 4W99A 1MG0A 3PQFA 4GKVA 1NFQA 5A9RA 1X7GA 4H7PA 4W9NC 3DWFA 1KVTA 3GVHA 4BNGA 2FPGA 3D4PA 4XYGA 6LDHA 3O8QB 2JHFA 1VI2A 3PJEA 3PPIA 4PVDA 1H6CA 1PL7A 3MOGA 4WLEA 1CWUA 2XXJA 1KVRA 4OQYA 1E7RA 1UXJA 2PY6A 4WJZA 1N8KA 4CLOA 2Z1NA 4WPGA 4PLTA 4QO8A 4HV4A 1HDZA 2A35A 1A9ZA 3LLVA 2DQ4A 4BMVA 2Q2VA 3D5TA 4TSKA 1P1RA 3LLSA 3RC2A 1P1FA 3HDQA 2FRDA 4R5HA 4MKZA 4BO0A 3OM9A 2EW8A 1ZO8A 2IDZA 4EBFA 1RWBA 2CVQA 1HETA 4EJ6A 4Q3DA 3F4LA 5BQFA 5J23A 3UW3A 4D46A 5JAQA 1UP7A 1GUZA 1E5QA 3NEPX 2XXBA 1UZNA 2ZCVA 3GVCA 3JQAB 3P7MA 4URFA 5IN5A 3S1LA 4DL9A 2O7SA 1ZSYA 3WYBA 3JQFC 4Y67A 2EJWA 4MP6A 4UULA 2NU7A 5B37A 1O89A 2EG9A 1GCUA 3CIFA 4RPLA 3IKVA 2BMAA 1NP3A 4RVUA 2Q22A 1LLDA 4IGEA 5DT9A 3W8DA 3ZU3A 1PS9A 4BO4A 2IEDA 3GA0A 3HB4X 2B36A 5C37A 1U9JA 1O0SA 4YVFA 3VH2A 3ONEA 4AICA 4MP3A 3JD2A 3ZU4A 3EVTA 1RM4A 1CJCA 4RCVA 4YQYA 5JBIA 1PGNA 2I5PO 1NWHA 2W8ZA 5JYEA 4HNHA 4DWVA 5L51A 3EMKA 3QVOA 2X8LA 3WTCA 4R1SA 3H7AA 4AJ2A 2NADA
chains in the Genus database with same CATH superfamily
2EV9A 3UANA 3ECSA 3HO6A 3SYRA 4AY4A 4ONEA 4KVAA 4CM9D 4FDVA 4PZ0A 4EI2A 3AF2A 1YKSA 2QUJA 3KT3A 4CXMA 1EUYA 3N0VA 1YR2A 3K72B 2XRZA 4TZ6A 1WD5A 3ZY4A 1RE1A 1E59A 2AW5A 3UJDA 1TKCA 3V42A 1IULA 1C7IA 5A0FA 4GXRA 2OMKA 2QZZA 4CMCA 4QJ3A 3KJIA 1URPA 4TYNA 2VJQA 1I6MA 5JIBA 2QTHA 1MU0A 3KE9A 3RSOA 3R9WA 2XA1A 1FUYB 4MR9A 4OL9A 1GUAA 5EI5A 1H3EA 5LP6F 1E7SA 4KTVE 2FPWA 1FSSA 1DADA 2FGJA 1RRVA 3W9UA 3ER9A 1YC5A 1IPFA 2IZ7A 1EVYA 4CIAA 3BRWD 3NBAA 3CE9A 2WAAA 5ABPA 3HDJA 3GZNB 3IO5A 3NO4A 4P5PA 2HO4A 3BGDA 3L43A 4EIWA 4N3BA 2R60A 3BXXA 1FW8A 5K6AC 3DMRA 4Q7QA 3HU5A 2QL7A 2R48A 5DX0A 3I23A 2EDCA 3WR5A 2JNWA 4JU8A 3UJ6A 4RDHA 4INJA 5B3KA 1MT0A 3I5XA 2IEBA 1HLPA 1RVDA 2Z95A 1K7XB 1QRUA 1TYEB 2C99A 2P5UA 3X1JA 1TE2A 4LKOA 3STWA 2PVCA 3O8RA 3O4HA 1JHZA 4YRIA 1H5NA 1KJIA 4QNNA 4LFAB 2ACKA 3BB4A 3ZY6A 2J0UB 2EDAA 1M67A 4BLSA 5JC1A 1IHXA 4DLNA 3P0EA 1PR6A 3WB0A 1W1WA 4MCAA 2QPTA 3BAZA 1X70A 3D8TA 1KY4A 3UUEA 2JFQA 1KI6B 1FSZA 1B42A 3KXPA 5AKKA 4Z1MD 4UNRA 4RPCA 3EG9B 4RHYA 1JDUA 3M6LA 1BA2A 3UICA 4ESVA 3RABA 4ANFA 4KE7A 3TPFA 5I5GA 5FH9A 4DV3B 3URMA 2R8XA 3ZDFA 2VQ6A 5FUYA 3LLUA 5I9NA 3TKLA 5AD1A 1Z8FA 3F6SA 4QWWA 3Q0IA 4R9UC 2C04A 4UM8B 4Z4CA 1AO0A 1XK6A 5JDCA 3QELB 3SF8B 2ZWMA 3UM9A 2FRDC 3FRIA 2G83A 4I8DA 4U39A 1CR1A 4Q16A 3UOAB 2HD4A 3ED1A 5MF6A 4IJUA 1Z33A 3KKZA 4GZ3A 4I8IA 3U3DA 3JQRA 4DUGA 4XUGB 3BZUA 1XMOB 3HGMA 3B85A 2GZ1A 2OCGA 3E7PA 4L50A 4UUMA 1Y4ZA 4WKOA 4E5PA 3D2CA 4WXHA 2ZCJA 2IP4A 1M2JA 3VYRB 5KKCA 4C0LA 1E7MA 2I67A 2JA2A 3OO0A 4LY0A 5EWLB 3I53A 4RTKA 2H11A 4V0OA 4DKXA 3ZC3A 2XUDA 3AKEA 4FE3A 4JHXA 3RGWS 4DW8A 4FOSA 2IE8A 1UBLS 4Q21A 3VU1A 5C32A 3QMPA 1QHEA 4RD6A 1XG5A 5B2FA 1G8MA 2WUWE 3RLFA 4B3GA 4UBLA 3E22B 3M81A 4EPVA 4NCBA 1NUTA 5ED0A 3AFGA 3AW8A 1AKVA 4EHJA 1M5TA 5KVAA 221PA 1I01A 3PT5A 4ZHQB 1ZUWA 1YO6A 4TS3A 4C87A 3G7SA 1OXVA 1P6XA 1PVVA 2X0IA 1ADBA 2V5VA 4RHCA 2REQA 1QHGA 1KSJA 5ALUA 4BMYA 1QTNA 2J33A 4UD6A 1QMHA 1E94E 3ADBA 5G3ZA 4MRMB 2XDQA 4JBYA 2ZQZA 3FH0A 3DMPA 4HTFA 4A1OA 3L5OA 4O4HA 1D6NA 4LDNA 4KR7A 1AQUA 1JIXA 1BVYF 1T3LA 1RLIA 1G5IA 2FLWA 2Z4SA 3Q3HA 3QOYA 3L8DA 3QE0A 4OV6B 4Q4JA 3UY4A 3NVMB 1Z8HA 3OIGA 1KYWA 2EFHB 3LJKA 4PTYA 3FHJA 1RKBA 2YCBA 4HXYA 3KM0A 1Y6FA 4DR6B 1WD7A 3CSSA 3F5MA 1N0VC 3STVA 1DKRA 3GEGA 1LKZA 1HK7A 1LSOA 3KJQA 4NPCA 2OZPA 1VYUA 2HQSA 2NUPA 3IIKA 1UBRS 1UPFA 3DCJA 4TRNA 2RG7A 3T8YA 421PA 3VH1A 4EHHA 2V6IA 2C4WA 3A6KA 4KN9S 5F1PA 3NWBA 4DSTA 2Q46A 5KINB 3GOHA 3CHYA 3BK7A 3GN2A 2ZSDA 4N7RA 1Z5GA 1AGPA 1W49A 2OB1A 4KHZA 5F7OA 4CI9A 2EEZA 4RU1A 5CFLA 1D6SA 3CKKA 3A6LA 4CHTA 1E4OA 2AUNA 3CLUD 1I7CB 2G82A 3OOSA 3LK6A 5HOEA 1DQZA 1Y7PA 4OJQA 4IM7A 1KR2A 3ECCA 4BNKA 3KZOA 3MGCA 2F7SA 5JMPA 1K86A 3USES 3KAKA 5IDWA 2X23A 3V3KA 4EW3A 5TIIA 3K53A 4ZQEA 3HBFA 1DMRA 4JLAA 4RHUA 1ZD5A 3AUFA 1RYMA 2Q5CA 4AP6A 3ICPA 1PT6A 1T6BY 2ZIZA 3NTRA 4Z4HA 4G81A 2Q27A 1KE2A 1GL6A 3IQFA 1N7GA 4MS4A 1HBJA 3MWKA 4JP5A 4NKRA 3UT5A 1UJ6A 3H2KA 3LUCA 2GM5A 1I4WA 3TK1A 3AF0A 1FFDA 4JUDX 4QICA 3TDNA 2VK2A 4U7DA 2QTRA 3NGMA 3AO0B 4DV0B 3LGSA 3BMCB 4L4SA 1E1RA 4TRMA 1TM4E 3SJZA 1XD2B 2WTMA 1XK7A 2R5WA 3PRKE 4MVXA 5TR9A 2LV8A 2VHWA 1DVRA 1E2DA 4JP8A 4NJMB 1HG0A 4YTEA 5AK0A 2FWBA 3GRFA 4BN4A 2LVBA 4NQZA 4YMSA 1E2BA 4NENB 4R05A 2WILA 3A14A 2FZEA 3DLCA 3H11B 4FJ1A 4KU4A 4QNRA 3VPDA 1C9YA 4BV9A 3AW9A 3STHA 1T9ZA 2H9AA 1Z2DA 3GNSA 1MX9A 4ID9A 2BI4A 2JJ8A 3TOVA 3VKUA 5HVNA 2O2DA 2XGOA 3K5PA 1OXTA 2HF7A 3H2BA 5LQJA 4WHMA 3E3OA 1Q21A 1XXHA 3DHNA 1JA0A 1Z0IA 1H2YA 2XBLA 1Z25A 4MZDA 1SHLA 2OYSA 1JSCA 4MRNA 3UNXA 1JHAA 3RIXA 4BQRA 3I5UA 4OK5A 2LPMA 1E7WA 4MITA 2WF9A 1L4KA 4GDFA 2KYRA 1T35A 4XM0A 3MS4A 3VJRA 1T8YA 3P2IA 4DCNA 2VAMA 4YDSA 4AMUA 2P69A 4RGQA 3ZGXA 1EGHA 3NFYA 1JFTA 1MVLA 3VZCA 3VC7A 5F9FA 1D04A 2WSMA 5G0UA 5F4BA 1W30A 3DEZA 3G17A 2GVNA 3IXLA 4OGKA 4KN5A 5HJ2A 3CG0A 3TQRA 3RYCB 2D5CA 3Q3JB 3MMZA 2A5GA 4JR2A 3RRBA 3G9QA 3DT6A 2ASVA 2VDNB 4H2DA 5EXDA 3W9SA 4R1PA 5CNKA 1MD9A 5BP7A 5HJ5A 3RJTA 4Q3KA 1IY0A 3CUYA 4FYPA 1H6AA 4CEIB 2MT9A 1J8FA 5EA2A 4H6VA 4KXNA 4FE4A 4TTIA 3N74A 1UBFA 4OATA 1ZOIA 2UYYA 5BQOA 3RRXA 4FB5A 1OFGA 1GVNB 2JHCA 5AJHA 3SEFA 4EF5A 1U98A 4JIGA 2Q4TA 1Q50A 1SCUB 3E3AA 5LU9A 1JEYA 5IDVA 4LBYA 1TXGA 1JJVA 4M1OA 4YV0A 1N5MA 1ZESA 2NSJA 2QXYA 1W52X 2PSEA 3DQZA 3DTTA 1ZRMA 4MJ3A 3U48A 1LBIA 4MUHA 1LGYA 1XCLA 3ZJUA 4NK4A 4IHJA 4RD1A 3SJAA 1GVHA 3A9CA 2DQKA 4DC1A 3LQQA 4A82A 5LOVB 2DETA 4PLFA 4E2ZA 2X5XA 4ABTA 3A7EA 1ABBA 1J1ZA 3WY9A 1BCSA 4RNDB 1B1AA 1PV4A 1FFCA 2BEKA 3H4MA 1YBVA 1Q92A 3R7DA 3WVNA 2F3QA 1CP3A 1C50A 1C30B 1TD1A 2A5YB 1JA9A 1LI4A 4F6LA 2J5XA 1HPLA 3JR7A 4YMWA 1ZISA 2CHUA 1CBUA 3KHTA 3V3TA 3AP3A 4HAUA 2QRVB 2I0FA 4I08A 1OWMA 4LXIA 1QOZA 1O6ZA 2ZJ6A 2VP0A 4RAOA 1PSWA 4DCJA 4EGCB 2ZJOA 4RK7A 3PFHA 1YS6A 2BEUA 5KQRA 2DBYA 5LPNA 3EIFA 4H0FA 2VF5X 3BXOA 1W4CA 2VQEB 1MCZA 1R0LA 3LFUA 2VKQA 4H1TA 1EX7A 4DMKA 5ADWA 1R7RA 1XA4A 4TMXA 1ICIA 1B0PA 1F0NA 5K8IA 3SEAA 2ZJAA 3GUCA 4GXQA 4IV0A 4PRLA 3C8UA 2ONJA 5K8JB 1EA5A 2GCPA 2OBYA 4BB0A 4FMPA 5FHRA 3OLWA 1TIKA 4JGBA 3VTFA 1E20A 1A2KC 1FYEA 1J0DA 1J99A 2CXHA 2NO0A 3OEHA 2CBZA 2FWAA 4QECA 4KV9A 5J5VA 1KEZA 2RONA 3KT6A 2VPPA 4G1BA 2WABA 2XE7A 4PZCA 4V2UA 5TF4A 1X6VA 1Z6PA 2PXHA 4FN5A 4D97A 2FV8A 1TIPA 1CRWG 1AJEA 1TB4A 2WJYA 1DG9A 1RWPA 2JI7A 4CLRB 4Z1OA 3QFTA 2MSWA 1UBOS 3CKLA 3JYPA 2FMTA 2YQ4A 3VR5H 1KAGA 1FE8A 1CE8A 1TA9A 4LK3A 1NKVA 1L7VC 4H6PA 5IMBA 2W6PA 4WFIA 1ISIA 1EHYA 4DJTA 5DGCA 1LBQA 5H7XA 1Y6GA 1DCKA 4JH0A 1Y37A 2WAXA 2R6CA 5B4TA 2GESA 3CLTC 3RRZA 3MAJA 1SC6A 3N1UA 3UK7A 4EVSA 1BW9A 4KPEC 1GADO 1JWBB 4LGCA 3GFGA 5GZ1A 1I0ZA 1S01A 1JHOA 1V26A 3EVFA 3W5UA 1K7CA 1D4OA 3G8DA 1PVOA 1HSZA 2PMKA 3DDHA 3DMDA 5FWXB 2R86A 4Q9LA 1R9NA 3B9QA 2JAOA 1FPQA 1Q2UA 1XZFA 2J32A 3DBHA 3TFOA 2J07A 2C8JA 5DLDA 1A71A 1GILA 1XZIA 3GGJA 4O1MA 3E9ZA 4WNAB 4ER7A 4MW6A 3I8SA 3KJFA 3LHKA 3DOHA 4KTTE 4XR4A 3QV1A 3CISA 1DTWB 3TDKA 3UEOA 3C6XA 3ZHRA 4F4UA 2GDZA 4KAAA 4MV5A 5J47A 2VBIA 2HQ1A 4NECA 4KGDA 4P3KA 1NG1A 1X1BA 2RI0A 4K6OA 4CBVA 4EYQA 2BTEA 1YZLA 3SFTA 4X61A 5E9QA 3I30X 3DZDA 5A1TA 3WS7A 5FNZA 4QPCA 5C8YB 3DTYA 1ULAA 3PFNA 1IOWA 2O5EA 3OQJA 4NZNA 4RPGA 1I7SB 4TWBA 3WBKA 2VPWA 4TWAA 2YUIA 5LBIA 1RJDA 2I80A 1A8PA 3TRFA 2GCGA 4I9HA 5UKDA 1RLOA 4F5DA 3IT3A 3PVZA 2X1MA 4HAVA 3NHWA 3FNFA 5JBQA 1ZU4A 1JYEA 5HFNA 2ZI3A 4QUDA 4IXWA 4LJRA 4QBHA 3SK0A 2OA0A 4DREA 1E2EA 1Z73A 2RHOA 2VUHB 4AECA 4B6QA 4M6WB 3KYDB 4KN8A 5H4GA 2Z5FA 3A26A 4YJ2A 3GX1A 4B71A 4W7SA 3QTBA 1K8RA 1P29A 1V25A 4BP1A 1WSAA 1OKKD 3M9LA 5BPHA 1QK3A 2NZVG 3GFVA 1U2EA 4G63A 4HFNA 4P38A 4UU1A 4EARA 3ZJ5A 5FUQA 3L79A 4EAQA 1R9JA 4JWTA 3R8FA 3BZWA 3WZLA 2WYVA 5AESA 1N3LA 2G0NA 4KQEA 2JA1A 4CM6A 3HDYA 3KHUA 1KDOA 5EP4A 1G42A 4YP7A 4E3WA 2ILTA 4AKHA 3ZHVA 5E6UA 5DHRA 3QA9A 4FYJA 4BNVA 4AL4A 1KJQA 1QH1A 1X7WA 1FP4B 2IPXA 5AXCA 1JZQA 4CNBA 3FTFA 2P9QA 1E1KA 1BJKA 2YR0A 4GM1A 1QH9A 1XKQA 3MIIA 5I45A 3OWHA 2FPKA 1TQDA 4ZVNA 3UT0A 1YFJA 3KL2A 3L1IA 1QO0D 4CDMA 2MINB 1KEEA 2BM9A 2HKIA 4K03A 3GT0A 1H93A 3EP7B 4II2A 3EWIA 4J4BA 2R25B 3K8YA 4Q4CA 2ZTLA 1MC4A 2AFIE 1G9TA 4KXQA 5CYPA 1ODSA 1WWKA 5IN4A 2QW1A 3HO8A 2O07A 3C16C 4P4SB 5A4JA 1CS4C 4MTLA 2Z9CA 3F6PA 5HHTA 5KDDA 1QG2A 4YCJA 3TH5A 2XOXA 4UVGA 1N4AA 2RGWA 3L4BA 1SA0A 4MR7A 2QTMA 2P67A 4ZXPA 3GNLA 1E6LA 3A9RA 3RF6A 1MENA 1VTKA 1V1RA 2AB0A 1VBKA 3GYBA 5TT0A 1ZY2A 4L5AA 1LX7A 3ZE1B 4D4IA 3MUEA 4KRFA 1E77A 5J5AA 1GCAA 1BGXT 3NRBA 2DHDA 2IKSA 1N92A 2TYSB 4QAJA 4X7BA 3K1TA 5M3BA 2VF8A 3JWEA 3NPAA 2BZ0A 2ZR7A 5TQ2A 1Y5MA 1F2DA 5FUXA 4C5BA 8OHMA 1JLMA 1FX0A 1ZJJA 2E4WA 2VJAA 4HAXA 4ZYVA 5K8VA 3GBSA 4DR2B 3HABA 4MARA 1F60A 1W19A 2O06A 1B2RA 1YHYA 1DRJA 1XROA 5EZYF 4LQ4A 3OQIB 2CF5A 3UOGA 3MTAA 1XO1A 3ABZA 4PG8A 1FTNA 3KV3O 3FR7A 3N39C 4S1WA 5CEEA 4GYKA 1ATIA 1UWKA 2CLKB 2O8EA 3T0FA 1E2IA 3T0GA 1DC3A 2F9LA 4KITB 3HP1A 4D99A 1QP8A 3GFFA 1QV6A 1U7TA 3KT0A 2WI8A 3SS8A 4BP8A 2Y1LA 4DM7A 4G5SA 1P6UA 2J3IA 3BTOA 4DR4B 2Y67A 4EUHA 2X4GA 2X9GA 4WXYB 1A5ZA 2IFTA 3FBGA 3S99A 3ZTTA 4BGEA 4QVKA 1WHSA 1YRQA 2YJGA 2DJ5A 4HAIA 4MGHA 1CX9B 2CNBA 4FCTA 3TMAA 4FMDF 3HDVA 4AU1A 3E9CA 1O1YA 3AHFA 3LDGA 4ETNA 3KAJA 4D79A 1VKZA 1CC1S 2GZMA 4FDMA 3HSYA 5EQDA 5BMVB 2H2HA 3G2IA 5DNWA 4TXLA 3JZDA 4AD8A 4LOIA 1VG8A 2B3TA 2Z2KA 2WD9A 2EL9A 1Y63A 1DRUA 3ZEIA 3SC4A 3AJEA 5KC9A 1WULS 3WKAA 3ESQA 3L8EA 4G5OA 3SHWA 1KJYA 3WRWA 4LSZA 4RGBA 4E1VA 3O74A 4W5RA 5FV4A 3LZCA 4X94A 5HRUA 3D64A 3UYKA 1QFJA 1U1GA 5DBOA 6REQB 1ZMRA 1OU4A 1SHKA 1QFYA 2FQQA 5EZ5A 1TYDE 3DZJA 4C03A 2JGLA 3E6AA 5K6AA 4IIFA 1TK3A 5H3HA 5IF9A 1IWPB 3D9QX 3PX2A 2FF5A 4BMZA 2D62A 3NEYA 5P8WA 1ZJZA 3WRXC 1NQAO 4G36A 1C9NA 4V02A 3TCXB 1RAEA 1FU7A 3WISA 2BKLA 4J0EA 3D6VA 1WCIB 4UNNA 1ZH8A 3NHFA 1SPBS 2C8LA 4N0MA 3T9FA 3G9ZA 1HE8B 1X1AA 4B6JA 3C5VA 3MWEA 3VR1A 4AF7A 5CEFA 3FW1A 2OUKA 2P27A 2H1HA 3LCVB 3QXJA 4Z49A 1I7DA 1X1QA 4YAFA 4NJEA 4OQPA 1EFHA 1S8FA 3CBQA 3U13A 4OB8A 4EA7A 1LTHR 3KB1A 2P9JA 3PUIA 3AIOA 4A8TA 4Y2VA 1Z06A 3INGA 2PG3A 2Q1XA 1QIGA 5GJCA 2JLWA 1FYWA 1W5SA 1WW3A 1X14A 3KR0A 3NJ8A 4WE3A 5E9WA 4S04A 1E1YA 1T5OA 2CFSA 3NWPA 1FNDA 3OKPA 1B93A 1GRCA 3H9EO 1KI7A 3IEXA 4HSEA 1LRKA 3W3AA 3HRKA 1V5WA 1DRWA 3D81A 4R69A 3IOMA 5DYWA 1RZVA 4A8HA 4WADA 2PANA 1QGUA 1KK1A 4GPZA 4YDRA 1UF9A 3NBYC 3A1SA 3V2IA 3ZR4B 3MQ2A 3M5PA 4OYYA 4YPVA 4WZ6A 4G25A 4BZWA 1AA9A 1J8MF 3O8QA 4PZYA 3ICQB 5CH5A 3ZYZA 1SG6A 5F1YA 2A30A 4FYIA 5BT8A 1GYQA 2QQ0A 3DFIA 2I99A 4XJXA 1X0XA 1WDKA 3FCOA 4V0LA 5ALNA 2NZXA 2GVDC 1G3RA 4DJJA 3TZ6A 3MGAA 3QX7A 1I5RA 5DI3A 1G8YA 3I5AA 2G9QA 1DRVA 4OIMA 2XA9A 5HF8A 1FFHA 1QS0B 2ISSD 4XGNA 3N6RA 5A9TA 2WVJA 1X1RA 3RBZA 5IUJC 1CQZA 1ONBA 1WDMA 3UPTA 4J03A 3MF4A 1L4YA 4CM4A 1WEHA 1E3DA 2QI9F 2HHCA 2QGNA 1A50B 4DJEC 2BE9A 4A91A 2WWTA 1W88A 4Q4AB 5AP9A 3VO9A 2PBRA 2QJFA 2X7XA 2VBCA 4DCPA 1T8RA 2W8BB 4EI7A 5IWCA 3AR4A 2HJVA 1EG7A 2PZJA 2CXPA 1P44A 3H19A 5CPBA 5DTRA 2FW1A 2ZLBA 4AKGA 4DSZA 3UYLA 4DRXB 3Q8XB 1NA5A 3C85A 2IIQA 3COZA 3F8SA 2FQYA 3L6DA 4FYKA 4EJ2A 4MYSA 1WV1A 4IXDA 1QIDA 1UMCB 2C4MA 5J1SB 3BD8A 3JQAA 4ZC8A 3WLSA 1TF2A 1S8NA 1BN7A 4M0UA 1L4NA 2A5DA 2CFCA 4BNMA 4EELA 2AOTB 3HU3A 2IYUA 3NNDA 1OZFA 1FLAA 1ZLXA 1J42A 1GV0A 3FIUA 1G16A 1EFTA 4X24A 4EK9A 4AY6A 2BTQB 1JHPA 2BKAA 2KBFA 1A1VA 5LNK1 1KSGA 4L4XA 4P2GA 4IQ0A 5LN1A 1IHUA 1OLUB 2MIIA 4ZKEA 4Z53A 4CR7A 3FYCA 1BZYA 2GBPA 4RYDA 2XB2A 2C8KA 3A6FA 4PLHA 2XTJA 3IJ5A 5ARDA 4PICA 5CM8B 2WAYA 3W6PA 1ID8A 3HUUA 1RXEA 1PT9A 4KV7A 2I8AA 2OY0A 3FWHA 2OPBA 4B47A 4P3NA 5CLQA 2FSHA 1CY7A 1X1TA 3PVCA 5BSRA 4MEAA 3WLMA 5C2JB 3T7KA 4F8EA 5HX7A 1WZNA 1C80A 3WGUA 4AF8A 2QTZA 2BELA 2O2GA 5AVTA 2JAHA 1ZK2A 1ND6A 1Z88A 3OCXA 5AIAA 5CFZA 3A6PC 5F2EA 1TK9A 3AR5A 1KS2A 1NRXA 3N8GA 3WE7A 3DZGA 4TXJA 4KQ2A 3C41J 3H5OA 4H0NA 5TGDA 1KH3A 3LT0A 3OQ6A 4OQNA 4UAGA 4Y2RA 1KQNA 1AKMA 2R6JA 3B5IA 3DCNA 4KXYA 4V0MA 4U2EA 3K1JA 4XSVA 4K3UA 4TKVB 3RSSA 4R54A 2CWWA 4PSDA 4B9EA 4NIMA 2J85A 1W5FA 4BKOA 1JB9A 1H2RS 4B4DA 3SQXA 2W6NA 4KL8S 1TJ5A 3DTNA 2HWYA 4J0DA 1E2FA 4M8IA 2WWFA 2HQOA 3LZDA 1C29B 1E9CA 1XTUA 4Q9JA 2C9ZA 4B2IA 4E12A 3KPYA 3QLUC 1BXRB 5K3SA 2LBPA 2IEIA 3ELYA 5KNBH 2P2CA 1CEYA 1MF7A 5AW0A 3K6SA 2A9RA 2GJKA 5LYYA 1NBOA 2YWXA 3ZI7A 1JPJA 2FXVA 2IYWA 1P0CA 2Z4TA 2AN5A 3GZNA 2QSZA 5EY5B 5CG1A 1J21A 4IFIA 3U3JA 5JXJA 1I7PA 3PHIA 3VNUA 4UDXX 1ISFA 1G3UA 1EESA 3A4NA 1EE1A 1OY1A 1PZMA 1SCKA 5DW0A 1P91A 3STUA 5A5VA 3WQRA 1R10A 1G21E 4PLZA 3VU0A 2GKGA 4UBNA 4A4DA 4LF5B 1E9VA 4TKMA 2ARKA 1OAKA 2WSLA 1RCFA 3ETDA 3AVTA 4CF6A 3ZPXA 1I32A 1FMCA 4LGMA 3WA7A 1WMFA 3TRIA 2D6FA 1L7OA 1YE8A 3HB0A 4KO4S 1H0RA 3FDJA 1LU9A 5C7LO 1J39A 2BSAA 1GFWA 4GX1A 3WIVA 4CETA 4D81A 4IXMA 1G6KA 1VLLA 2OCAA 2EKZA 1COWD 2ZJ0A 4NG5A 3UUFA 4LWOA 4D45A 2DQSA 1KKLA 4X41A 3KXLA 1KI6A 5DOZA 1GPBA 3V34A 3VA7A 1KNXA 1IG3A 2Q62A 3PZBA 3HYSA 4ZCLA 3RAGA 3CTPA 5LLDA 4E4YA 3EG9A 1CUUA 1P9NA 2FMIA 2GO7A 2PTHA 4ARAA 3A3YA 4D1YA 2DH6A 3CH4B 4KUGA 1R9MA 1T4DA 2ZT5A 1FTWA 2EJUA 1M2KA 1RMQA 1WU7A 4LOAA 4ED9A 1RYBA 3O03A 1DRKA 2COEA 1JW9B 3AR9A 2C7PA 4EENA 4J0GA 4NCAA 3KZXA 1W8DA 1ZCAA 4XX1A 4CKEA 4N5IX 4R2JA 3QELA 5EESA 4LBZA 5E8JA 5GONF 4UCWA 3SF8A 1N1MA 4DE5A 3K9HA 2CVPA 4YJ3F 3G59A 4PR3A 3IAHA 4Q7JB 3WYEA 5A2QA 5TGTA 2NYAA 4CV2A 5IG2A 3G2OA 3ND5A 4DBVO 4Q7KA 3PNPA 1LVHA 1NVMB 2BAGA 4L6IA 2I54A 3O5AA 4XQCA 2PGIA 3LCMA 4ZZ3A 1EZ1A 2RJNA 2CLEB 3KEGA 4BTVA 1GNRA 1XD9A 4W7IA 1CR2A 2GXQA 3V2UA 2E4XA 4FEGA 1AQNA 3HVJA 4TL8A 3CT6A 3M9XA 2EKQA 2WWIA 4P86A 4ZYUA 3Q0TA 5CNMA 4HNTA 1C4XA 1N6NA 3IGFA 4Y9RA 3AFNA 2YS6A 5AJUA 4BATA 4IMIB 3ZHZA 2MSCB 4ZYWA 3E22A 1NC3A 1QO7A 4L15A 1L4UA 5AUOB 3FGZA 2J0QA 3K4PA 4JX8A 1Z6QA 2JFFA 2PU7A 3MT8A 4GMHA 1D2RA 3B7PA 4KRGA 3RQSA 4ZHQA 3QE3A 2OCXA 2DTEA 4PGMA 2SBTA 5CNIA 1OLXB 1SBYA 1U99A 1Z2OX 2HI0A 2OFXA 4KPFC 4ZO7A 1YTUA 4BBPA 1ZJ4A 4OHUA 4YREA 1VA5A 2O2ZA 4TWIA 3X43A 5ED4A 3PG5A 1RCUA 2ZVQX 3BE6A 4MRMA 3EP6B 3KSDO 1N57A 1SD2A 1DX6A 2BHTA 3R3UA 4FQ5A 3DHVA 4Q3CA 1PL0A 3HXLA 1QYDA 1TGYA 2JIMA 2P7HA 3KDAA 1T4CB 1KQ3A 2C9BA 1XV5A 2DR2A 4LRTB 3VZRA 4O4LB 3QH4A 4IQFA 3ESYA 2SECE 1FLVA 4LXTA 4PLWA 4RKRA 4F4HA 1GO2A 2J5RA 4HLNA 2H07A 4XLTA 4C7JA 5JRDS 1UXGA 2CMKA 3TECE 2JI4A 1PZFA 2XTNA 2JVKA 3L6UA 5HK9A 1M2VA 4F8JA 1G8KA 2YDYA 3CPJB 2QL6A 2F1OA 4J49A 2OTCA 5FBHA 2H4WA 4JLUA 4QPPA 4IHQA 4DIUA 1B16A 1IDOA 2BUAA 4RPIA 4Y9DA 5C34B 1NR7A 1TNDA 4Q7EA 1P0FA 1Y1QA 4NS4A 3JSXA 2GAAA 4GPAA 1NOJA 2V7VA 3VTAA 4WTOA 1U2ZA 1NVUQ 2B25A 2XUGA 1RJWA 3IB3A 3MW8A 4HPJB 1N0HA 3FNEA 4X3CA 1JEJA 3G2QA 4P4LA 5KB3A 1T0JB 5CDUA 3ZI0A 3UK1A 5JEEA 4ZJYA 1BRTA 1FPMA 3LVBA 5LFAA 2NZ2A 5LKRA 1ZGHA 2G1UA 2IW3A 2QQ5A 1UBHS 3E5MA 1Z0AA 3MT7A 3TBKA 3NAZA 1B6TA 4PCAA 2BHSA 3R9IA 4M2LA 3K2BA 2GEKA 3O9ZA 3N2IA 4EB6B 1XELA 1PRYA 1XKLA 1FUIA 2NT4A 5E1BA 1NQTA 2FZLA 2NX2A 2W2LA 4DJ5X 2CCJA 4G3XA 1CF2O 2VXBA 2NUTB 3EWNA 4YJHB 2V1UA 4R1OA 3HYLA 3QBEA 3KB2A 4B74A 2JB9A 4LRWA 3B3JA 4OQXA 1DWPA 3BMCA 3DTVB 4PHFA 4G4SO 5FO1A 1B8PA 1R0CA 1U2RA 4H0CA 1S6YA 3U16A 4AVYA 1XD2A 4P08A 2HA2A 3OIYA 5FNVF 4IOJA 4NJMA 1JT2A 4RH3A 4HQRA 2M6KA 3ANXA 4TMWA 1Z6XA 5KREA 4RE6A 1H5QA 2IT1A 2XKJE 4H7JA 4DABA 5LZ4A 2J31A 1ISPA 1KU6A 3V1YA 1ODFA 4ROTA 1E3WA 3JQGB 4DMRA 3PNLA 1IQPA 1TKAA 2D7JA 4C0WA 1L4MA 1FA9A 2A0XA 4TPKA 1W73A 3DBOB 2O23A 1SVUA 3MEQA 1RPNA 7YASA 5ICEA 4RFSB 2G63A 4HEA6 5GPBA 3M1IA 2HJHA 4GI3A 3TLJA 3PEEA 2RHBA 2Z2IA 3Q15C 2RGBA 2G5CA 2HRRA 4MW9A 5ALHA 2OXTA 4RGVA 3QJGA 4H08A 4X9XA 4OOEA 4D4GA 3OZIA 4Z0TA 3WLAA 1QGOA 5HMMA 1JG7A 4W5QA 1IZ9A 1GT6A 3OJEA 1V9CA 1WRBA 5LP6C 3UJ9A 3R4CA 2BGWA 1P2SA 2O3TA 4L8GA 3ZWBA 2AJCA 2HLNA 2F3SA 4AKSA 3T1HB 3D7SA 3VX4A 1GNVA 2XMGA 1N2CE 2GJ9A 3LW8A 4TROA 4OI2A 2DTDA 1R3DA 3H9CA 1U0LA 3QSGA 4MW7A 1SB9A 4WN9B 2NVWA 2G4VA 3PSHA 4JDUA 3WNDA 4XPIB 1U04A 1IJBA 3IUNA 1R0WA 4JYZA 1I6LA 4L07A 2BR4A 2CJXA 3U3RA 4F2HA 4F56A 4F21A 1ZEMA 3QOWA 3T5BA 1YT5A 4URZR 1TVKA 3G88A 4O2LA 4Q9NA 3VSCA 3ZIUA 4R9RA 4DEVA 4L7QA 2CNOA 2GN1A 2VDQB 4WECA 1BMQA 4BDTA 4Z4EA 1M7GA 5CXXA 1E63A 4CQNA 3C74A 3B5EA 5EIAA 2C07A 4JZYA 4TWZA 1TA0A 1J06A 3F3SA 4EYGA 3RVMA 1TZ2A 4RO0A 3IKTA 3U9SA 2HWKA 3WGLA 4CWAA 4EUFA 1EZ4A 4P1ZA 2E21A 5L95A 1FVHA 2WVAA 4X1IA 1RJGA 2QVGA 4FFSA 4IIUA 1C2TA 1EWKA 3SDBA 3B1FA 3WLRA 4EHKA 1MZVA 1QGZA 1BH2A 1RYFA 1I7QB 3O73A 1KI2A 4HN9A 1XOIA 3DVQX 3SHVA 5IM4A 1C7ZA 1QIHA 5DNCA 5LOVA 3PNYA 3U61B 2AZDA 5F33A 3KU1A 3B6EA 3TXYA 5IARA 1QZZA 2C82A 5D51S 5C9ZA 4JXZA 5IPFA 1KXJA 4M8KA 1OWLA 3NATA 2REOA 3AI7A 4J29A 2BUBA 1GTZA 3QBJA 1VKRA 4BBJA 4M3NA 1I5OA 2PHZA 3L1VA 5CVDA 1C30A 1Z4QA 3WK8A 1W0JD 1LRLA 3NBKA 1R0KA 1F4VA 1JQBA 1UJ4A 4L3VA 2OHHA 3TOSA 1M74A 4YMGA 2QRVA 1JIUA 1ESEA 1V47A 1ZUIA 2HY7A 2V6GA 3DMNA 4OK6A 3UAZA 3WRVA 4CR8A 3AUUA 5CYOA 2PUVA 2V9ZA 4RNCA 5T5QA 3ZH9B 3T5MA 2GXAA 1C1DB 3VMFA 2HQRA 2VEOA 4BLVA 1L5ZA 1E32A 2DUMA 3DOEA 1VSVA 2BYTA 3HG7A 4JENA 4YP1A 1EFPB 2OM6A 4ZVLA 4E4RA 2VNAA 5KTYA 3L7AA 4N54A 1XYYA 5EJAA 1OFIA 3W8NA 5IJ9B 2FUKA 1CZUA 3WO0A 5CB6A 5BR8B 4TTRA 4UOZA 1MAAA 1UDBA 3FTCA 2PLNA 5A06A 1VE7A 1WF6A 3LNCA 4JP3A 4MSUA 5I01A 3EODA 2PCJA 1TUIA 3KB8A 3EEOA 5AKJA 2JJQA 4EKYA 3WYCA 3ISVA 4P82A 1TLTA 4H1VA 1EUDB 3UMRA 1P1IA 1UOOA 4IWYA 4JUBA 3BIXA 3I76A 1ESCA 4EDHA 3L8GA 1BG6A 2BKVA 3GRYA 2O2YA 4AP9A 1KAMA 2NO7A 4BNTA 4US1R 1Q11A 3EGWA 2BR5A 4EZEA 1MN6A 1RZUA 4K28A 3P5SA 3VYVA 1KI8A 1XQVA 3KP1A 2WU8A 4LECA 1T3GA 2OCPA 4HS9A 3JWPA 4IINA 3PGLA 3P26A 3UFXB 4CT0A 4MR8B 5FV7A 3IL2A 1SG0A 1SKAA 2ZIWB 2ZYRA 3LL7A 5CFNA 2Y0BA 2ACWA 2HM7A 3QIAA 5KSZA 4PANA 3CEHA 4L0CA 1KMNA 3VR6H 5LM3A 1NMYA 4BNHA 4GIBA 3GL9A 5EXXA 5HIIA 5K3CA 1LLUA 3FPFA 3BM5A 1GLNA 3EWAA 3OFSA 1TFUA 4FQ7A 4KSCA 5FWXA 3RSCA 2JC3A 2YJ3A 4D43A 2OD9A 3ITDA 4LXHA 1NYTA 4CKYA 3WRXA 1E2LA 2H4JA 3JCZA 3PR1A 3B6KA 5C1IA 4DYHA 3GWZA 1U8AA 2QMZA 1Q7EA 1UCFA 4EJMA 2V7QD 1VHQA 1DTWA 1F8GA 2IY8A 3AERB 4HDQB 4NU8X 4RVSA 5EIXA 5HF6A 1TAGA 1UMDB 2V5AA 3CF0A 3K1AB 2CXUA 2JIBA 3HFSA 3R0QA 3ZK9A 4C4OA 1CHDA 5AVQA 4C7OA 5DTJA 4PLGA 3OQVA 1KYIA 4DWOA 2BFFB 2I2WA 3CO5A 5CB4B 4QBIA 3QPWA 4Y18A 5GV8A 5C8YA 4QUHA 4Y1RB 4Q1VA 5KNCD 1ZH6A 4FONA 1P9OA 1WVGA 1PTJA 3PFFA 4YRZA 1VG1A 4AN4A 4RPHA 2PSFA 3ICWA 3SX4A 2QTCA 2IYOA 3I45A 4JJ6A 3D7LA 1EJ2A 4P92A 4WLNA 1TPZA 1RQXA 1WDLA 2Z6UA 2DZDA 4UNIA 3GUUA 3EW7A 2XKAA 1BS2A 1XL1A 2AEMA 4NNOA 2RH4A 4WOKA 1ADGA 2ADMA 2HF8A 3QUQA 5JNUA 5KC8A 3G5TA 3T4UA 2HCRA 1NW6A 4ZO9A 5KOHB 1GN8A 3FWNA 3KYDA 1K7FB 4MV0A 1OZHA 1RAGA 2PVSA 2ZANA 5F7JA 3ESAA 4WASA 1E0AA 2J9ZB 1F5NA 1XTKA 1JSZA 3CKMA 4WKBA 3P9XA 3F4KA 1IM5A 1T3ZA 2Q0SA 1NXSA 4B1FA 3KZKA 2JLSA 1Q0HA 4FT2A 4GX2A 2D7CA 2ODNA 1CQPA 2X41A 4O8CA 3ANLA 1F9AA 1M6EX 1RDFA 1H9AA 3FWZA 1VOTA 5EE3A 3K9CA 2EBHX 4WY2A 5KQMA 3J81k 4U7FA 2P9ZA 1X3SA 1MX3A 1AUXA 5GY7A 4M1QA 4QAQA 3F5SA 4GYWA 4G0WA 1F0KA 4EQZA 4NDNE 2PRSA 1RE0A 1QKIA 3M5CA 1IL0A 5CYFA 2WIKA 3EFBA 2QTFA 1ADJA 1L1EA 1J20A 2F48A 3A36A 4UVIA 3FB4A 4F0JA 4KR3A 2AYXA 2LCIA 2P8SA 2W0SA 1I51A 4LFBB 1L4GA 4EY6A 2ZJ8A 3BKWA 3NJRA 2VHZA 1Z5OA 2II6A 3Q5GA 4JBXA 4XOIA 5FLXA 7ABPA 3PICA 2UYHA 4HGNA 2EJCA 2H1VA 1E1NA 5MDHA 4J0FA 1BWSA 4C3UA 3JQBC 1Y1PA 4UQLA 1FNNA 2OXRA 1Z26A 3C1TA 3AJ9A 1M1ZA 3PCXA 3QMVA 4WACA 1SUCA 5D8DA 5LQSA 3O3NB 3ZWCA 4F2GA 5I9IA 3OOJA 2FSVC 5DM70 4BFLA 5F35A 4F5YA 4MP8A 3ZCXA 1MFZA 1ZL0A 3KALA 4EJSB 2GCNA 1JKIA 4HPWA 2XVXA 1OVGA 2F8MA 4JP1A 4E51A 2XUHA 4UMVA 4P36A 3X1XA 4RTQA 3QOXA 2AEFA 1W59A 4NY1A 3IBCA 4P53A 2XMSA 5FL7D 1OD6A 4M1SA 3IA7A 3UKJA 3Q72A 3TTVA 1TM2A 2UAGA 4J43A 1C7FA 3D4LA 5LJIA 1FDIA 3GUHA 3OUZA 4PBRA 2WF8A 4YY3B 1I7MB 1U7WA 5G1NA 1DU4A 3M6IA 3OQIA 3S27A 3QKTA 3A06A 3OBIA 3SOZA 1ORWA 1ZIPA 4FHZA 4BUCA 1MIOB 2IUSA 4FKMA 1P60A 1R0XA 2J46A 3RUEA 1R5NA 1GKUB 1E79A 1V4VA 1R27A 3GP5A 5DLQC 4EHIA 5I7EA 1GARA 1F7VA 3K0BA 4UKDA 4CL0A 1YFZA 4TT3D 4EYOA 3TSYA 2HXGA 4KO8A 4RM2A 5EZ6B 3LT4A 4BMXA 2WPDD 3C45A 3E8MA 1NGSA 3N87A 4RSGA 1X8LA 3TSWA 1P7WA 1SZPA 3T06B 4BY9E 3I62A 5TDHA 2YJ5A 1XJ5A 3B5JA 3DXZA 4PPFA 3AJAA 4RLFA 2PCLA 3RH0A 4LJ6A 3QFRA 3MRXA 2ZUUA 5FKJA 4PG5A 3G5AA 3PXAA 2XW6A 2AUMA 1U7XA 4Q93A 1I7LA 1RPAA 2DFVA 3KXKA 4S1VA 3VVBA 3IHTA 2DX7A 4AXXA 1ZINA 1EX1A 2I1VB 2W6QA 4PG4A 3KTFA 4U2DA 3TMKA 4OP3A 2D06A 4X5OA 3O83A 4LJ8A 4DQXA 3T3DA 3RVRA 3V4VB 2IBMA 2J48A 2B69A 1P6QA 4XVUA 6NULA 1FS6A 3WAGA 2P4UA 2AFHE 1UBEA 1EWRA 4DM3A 5A3VA 5CLIA 4YAUA