4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
b'MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase 1
molecule tags Oxidoreductase
source organism Vibrio cholerae o1
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
1GUYA 1E7RA 2PD3A 4TZTA 5LDGA 1NBOA 4ROSA 4GMFA 1PJTA 2C5AA 4HFRA 3K8ZA 2PWZA 5A5FA 1WAMA 4R4JA 1WXDA 4UUPA 1H2BA 3BHJA 2EJWA 4CMBA 1EUDA 3R3JA 1DIRA 5JAZA 4Q3EA 2AMFA 1EBFA 1GYRA 2DM6A 2OP1A 2R6JA 3RI3A 1QR6A 3WGIA 3LT4A 2FR0A 4C7KA 2EGGA 4U6SA 3T4XA 3AY6A 3MWEB 2HCTA 4DLAA 1T26A 5AOVA 3OM9A 4GBJA 3W8EA 4HUJA 5KWEA 4PLFA 5H81A 3ZWMA 2NU7A 1ZK0A 2X9NA 4R54A 4JBIA 4IJUA 4AJ4A 1VJ0A 4ALNA 4MKRA 4B4WA 4BL5A 3FR8A 4MJLA 4TMFA 2AG5A 4JX8A 4NJMB 5TGDA 1H5QA 3IOYA 2GGSA 2OUIA 3TWOA 4AJOA 1GY8A 3OQBA 5A02A 1MXHA 5IG2A 5CEFA 1ENYA 5KJCA 3L4BA 1W73A 4BUCA 2X0RA 5HS6A 4IUYA 3OJLA 1A9YA 3DZBA 3KYDA 3LC1O 3TDKA 4B79A 1G1AA 2HO5A 1UXHA 1ISFA 3GY0A 4P4LA 4Z9FA 1VJTA 3U4HA 1DLIA 4ND2A 3U62A 3D3EA 2FY8A 4R9RA 5JXWA 1ZH8A 4LMRA 1L7DA 2HSDA 1P1JA 1P45A 2ZCVA 4Q39A 4OO3A 1GYPA 1E6UA 1PJQA 1EFKA 1GZ3A 1B26A 5JFOA 2ZYGA 4GGPA 3L4SO 2CDCA 1UXKA 4GX5A 3U0BA 2GRAA 4CLHA 4BO0A 3RROA 4XJSA 2VT3A 1RYDA 4LW8A 5EPOA 1KVSA 4LCJA 4LVCA 1QORA 3VHRA 3C1AA 2LDBA 5FWNA 2EF1A 3H9GA 3WFIA 4JCOA 3V2GA 4OAQA 4FJ2A 1P31A 4DVJA 4CMEA 2NVWA 3UGKA 4MVJH 2EW2A 3BMNB 5A3JA 2IRWA 4I5DA 1EVIA 3ZGYA 1K0UA 2IZZA 2HJSA 4N54A 1I8TA 2ZYDA 3JQFA 4HFMA 3ZWCA 2OXIA 4GSKA 1ZW1A 1LXCA 3DZFA 4BQRA 1YB4A 1H6AA 2DPGA 2W90A 2W2LA 3NDJA 3VZQA 5GZ3A 1R16A 2ZB4A 1O9BA 1I3NA 4MO2A 2P4HX 2VN8A 3P7MA 4IY1A 3F47A 4WKGA 4DPKA 4BS9A 1PS8A 2PZMA 3H9EO 1EUCA 1GD1O 3HWRA 1YE3A 3SVTA 2Y1DA 4WK6A 4ZGWA 2EP7A 5FEUA 3ASUA 3GDGA 2QRLA 1JAYA 2C29D 1I3MA 1R0SA 4QX6A 3ANLA 4GX2A 5ITVA 5CDTA 4XQGA 4YJFA 4AJEA 1DB3A 2HK7A 4GWGA 1I2CA 4IDGA 3JYQA 1YL6A 3ZWPA 3JV7A 2GNAA 4XD2A 4CQMB 3FHLA 1CRWG 3IC5A 4M49A 1JVBA 2HUNA 4R68A 4DGSA 3NT5A 1T4BA 2Q99A 1HSZA 4DXHA 5B1YA 4WECA 2X23A 2Q4BA 3DOCA 5HRUA 4CJXA 4HWKA 1KY4A 1MV8A 3GGPA 1WW8A 2ZTUA 1NWHA 4IS2A 3OMLA 4BO4A 1B0AA 3PYXA 4K1LA 3Q3CA 3FRJA 4Q3BA 3IKTA 1MB4A 4FFMA 4BNWA 5CAEA 3RC9A 2C2XA 4HP8A 4B7UA 1AXGA 5KVCA 1XQ6A 5DCUA 3RC2A 2AQHA 2B83A 3D5TA 3GHYA 1BXGB 3CXRA 3IJRA 2OMEA 3F6YA 3R1IA 1HEUA 5ES3A 4INAA 5L45A 4BO5A 2Y93A 5LC1A 3TOXA 2WYVA 5C7OO 2PA3A 4DLBA 5IZCC 5BNTA 3IAHA 3GN2A 3JQCA 2HK8A 1OI7A 2O3QA 1PSDA 1SZJG 3DXFA 1X15A 4EJMA 1K6JA 4UREA 3R3SA 4KWIA 3L0DA 3K5PA 3FNHA 5CFZA 5ILGA 5KTKA 4K9DA 1JWBB 3C85A 4GLOA 1Y81A 2G76A 2NACA 2O2YA 4I9HA 1PQPA 2ZB8A 3TFQA 4TRMA 5G4KB 1W8DA 2GSDA 3AI1A 4ZRNA 1R0KA 4FC6A 2OZPA 1U3VA 3KBOA 4EBFA 4TWRA 3OJ0A 4U0KA 4M89A 5A9TA 1JA9A 4RVHA 3WSVA 3EMKA 5TNXA 1GV1A 5DBIA 4ILKA 3SBOA 3FBTA 2RBEA 3O8QA 3PIDA 3C7AA 5KCZA 3B1FA 4HY3A 3GOHA 4CMHA 1R37A 4IGFA 4O5OA 4UVEA 3LDHA 1E1MA 1XWFA 3ADPA 4BMSA 2VUTA 3OJEA 3HDHA 1CF2O 3M1AA 2V6BA 1P1KA 4XQCA 4JBHA 4AFNA 1SB8A 7MDHA 5LDHA 4ALJA 1DXYA 4LN1A 2GN9A 1T1RA 2BHLA 1WLYA 3VZRA 1CWUA 4BHTA 5JC1A 3WGHA 4W99A 3GVCA 4DUPA 3JQ9C 1NNUA 2OHXA 2YFQA 1DRVA 3EDMA 1NR1A 4E2ZA 5EINA 1GUZA 3TZHA 4YAKA 1DSSG 2C0CA 2G0TA 2C82A 3ABIA 4ND5A 1GCOA 1SNYA 3PHIA 4Q3NA 1EDOA 3ST7A 1C1XB 1ZK1A 3PJDA 1LRLA 2Y1EA 4AJKA 3FWZA 4EGFA 2OL4A 4CR7A 3RUIA 3RU7A 4CMJA 2E4AA 4XEHA 4PN3A 3HQ4O 4IZHA 2Y1FA 4PLGA 3S8MA 4G5HA 4QO8A 5JCJA 5L7TA 4NH4A 3OHSX 5JAQA 1O89A 3JQ8A 3ONEA 2LDXA 4R9SA 2NTNA 4KP7A 1YJQA 1P1HA 1ZKMA 2HLPA 5GZ6A 1R15A 4N18A 4RVDA 1Y8RA 1PJCA 1PJ2A 1Y5MA 3H9JA 4B3JA 1TLTA 4CQMA 3N74A 1UDAA 2PZLA 3KXDA 5DOVA 4FW8A 3RJ5A 4AVYA 2JHGA 4U7WA 2VYVA 4DQVA 3AU9A 3D4NA 4MIEA 1NAHA 2YV1A 3ITDA 3ASVA 3BXXA 5A9SA 3HJAA 1TT5B 2CMDA 3NTOA 3JQ8B 1FXSA 4RCVA 5DZSA 3GEGA 3SEFA 2JCVA 4TRJA 2JJYA 4PLCA 4CM6A 1NQTA 1XHLA 3AK4A 4R3WA 4ITUA 2IEDA 4K26A 4CMIB 2Q1TA 1YL5A 5U1PA 4W9NC 4NIMA 3OSUA 2HJRA 2C54A 3KSUA 5EL0A 2D59A 3JQ7A 4CQLA 1EFLA 4MVJE 3MZ0A 2Q2QA 4WLUA 1C0KA 4R41A 3HE3A 5CHEA 3PWSA 4GWKA 3TOZA 2B36A 1B8UA 3W8FA 1M6WA 4BKRA 1VLLA 2AW5A 2UUPA 4EUEA 1WDKA 1HF3A 4NBUA 4XDYA 5TF4A 4FBGA 3BTSA 4NFYA 4BNUA 2DBZA 3C8MA 3JQGA 1OBFO 4J3FA 2DLDA 2XXBA 4Y98A 4PZEA 1JN0A 3UKOA 3W4KA 5JE8A 1F06A 2EIHA 4HFJA 2NVBA 4J6FA 4Z9XA 4IXWA 3DOJA 1V0JA 1DBVO 2Q4EA 1GQ2A 4IDDA 1C0IA 1GZ6A 1PJ4A 4RZHA 3LVFO 3WYBA 4NFHA 1V35A 3WTCA 2Q3EA 3RFTA 3PHGA 1K5HA 1UZLA 5BSEA 4GGOA 2NU8A 4YAGA 1TT5A 2NTVA 3ZWAA 2X6TA 1W0CA 2ZATA 4WLOA 3OF2A 4S3MA 3BTUA 2YQ4A 3I83A 4NQZA 3JQGB 3OIDA 2HAEA 2Q2VA 4UUOA 2GN6A 3EYWA 3JQEA 3EW7A 4DIBA 3CH6A 2EWMA 1JLLA 2BGMA 2VTDA 2B69A 3QLJA 4JQCA 5ADHA 4ND1A 1B15A 2FOIA 1X0XA 1Y8QB 1ARZA 1CERA 1VSUA 1YJ8A 2BF7A 2FPPA 1LSSA 4UEKA 3GPDG 2BH9A 4MKZA 3VH1A 4D44A 5CG1A 3VPFA 3H2ZA 2AE2A 1KVQA 3NJ4A 2I5PO 2EV9A 3ZU3A 4DREA 4E0BA 3IL2A 1P0FA 4J2HA 2H1SA 1IL0A 3EZLA 1I2BA 3WX0A 1ZCJA 3GF4A 2J6IA 3G49A 4I08A 3IIEA 3I9OA 2C5EA 5KOIA 2R2GA 2W2LD 2XXJA 3DMTC 3H5AA 1ADFA 3ZNNA 2NQ8A 5DF1A 4CM3A 2UYYA 3ZZNA 2D5AA 2IEBA 1FDWA 1L1FA 3O9ZA 2RAFA 4W7HA 2PKRA 4O59O 1Z6ZA 1Y5RA 3GH3A 5F3RA 5M6DA 4E5KA 3ZCXA 2X8LA 4TQGA 1VL6A 3IUPA 5T67A 4BO7A 4WOKA 4YJHB 2Z1NA 4YRDA 4J1SA 5CDYA 1YWGO 4OKNA 1WDMA 3ZHXA 3E8XA 4I5FA 4BMNA 5C5IA 2J3IA 1IZ9A 3PK0A 3UCEA 4Z6KA 1E0DA 1NP3A 2XPCA 2OP0A 4GX1A 5COAA 4YT2A 5JDCA 5HA5A 1DEHA 3LZ6A 4EJ6A 1FDSA 4L75A 1RPNA 2P5YA 3KV3O 1AE1A 3LT1A 1RM4A 2W4QA 4PIVA 2FHSA 4CM8B 1CIVA 1UP6A 4ZVVA 2UDPA 4YJHA 4H3VA 5L4SA 3CEAA 2Y0CA 1N1EA 3ROPA 1X0VA 3JYNA 2HMWA 1A4IA 1LLUA 1PIWA 3GRKA 4I1IA 1DFHA 4WCDA 2Y1OA 2O3JA 3WB9A 1X7HA 3KHUA 4NZ9A 1PZGA 1Z7BA 4HNGA 4PRLA 2DU8A 2R00A 3WMWA 2VYND 1LDEA 2I6TA 2GASA 3Q6IA 4R5MA 4BNZA 4JJIA 3OIFA 3OQ6A 1M2WA 1WMBA 1RYEA 5BT9A 4O1MA 2B4QA 3DAPA 3ZV4A 3GG9A 4H15A 3V1UA 1ZMTA 5L7YA 1F12A 1HE4A 1Q7CA 3QVWA 1UR5A 2ZTMA 2PV7A 3LF2A 3UN1A 3V2UA 4XRGA 3VPXA 1O0SA 2PNFA 1QYWA 2YFHA 1E3SA 1KS9A 5TX7A 3JCZA 4L4SA 1E7SA 1ZSYA 4CLDA 1MG5A 3QE3A 1HLDA 1ISJA 2EEZA 4YVFA 2QZ9A 3MOIA 1ZMOA 4J1NA 4J0EA 3RBXA 3ULKA 4W9NA 4EEZA 1Y8RB 3G17A 3O03A 4RZIA 4J9UE 1ZSNA 3L77A 1BWSA 3HFGA 1PQWA 4YAEA 5B4TA 1E5QA 2F1KA 3EAGA 2VRCA 2WYWA 4IGEA 5EERA 4TKLA 3MJEA 4BGUA 4TRRA 4LMPA 1AUPA 1ID1A 3WIEA 2NV6A 4A7PA 3S2IA 4BKOA 3QA9A 1ADGA 1YQGA 2G5CA 2NWQA 4NHEA 4NBRA 1FDTA 4AJ2A 4CLRA 2F00A 3KSDO 2J8ZA 4KUEA 3QWFA 5K0ZA 1PZEA 5K9ZA 4PVDA 4RV9A 3LT0A 2BFPA 3AY3A 2VNSA 5IAAA 4U6QA 1GFSA 1LDGA 1MXFA 3NGXA 4JK3A 5K6AC 3TFOA 3IJPA 2O2SA 2AEMA 4E5MA 4JJFA 4XB2A 5COQA 2YYYA 3OFSA 1LUAA 1IHYA 1GYQA 1QSGA 2DFDA 4UEJA 1KVUA 4YQYA 3SLGA 4EZBA 1SMKA 1UXIA 2B4TO 1O94A 4PLYA 4WUVA 4LVUA 3RJ9A 3JTMA 4PGFA 3AW9A 4JIGA 2NU6A 5KJ6A 4AJNA 2VWQA 3ZU5A 3NYWA 1X7DA 4N5NA 3PI7A 3TZQA 1QXSA 1EQ2A 2FMUA 5KVVA 4Z9YA 4EUFA 4WCFB 1HT0A 2QRKA 3F9IA 2YDXA 3A28A 4BNIA 1XA0A 1IUKA 1DC5A 5ITWA 5COBA 3PWKA 2BLLA 1M75A 3Q11A 4JBGA 3BHIA 2DC1A 3ENKA 3H65A 4L4XA 4BQPA 5IJZA 3KYBA 1ONPA 1N92A 1E7MA 4CV0A 2JKVA 4E5NA 5I7SA 4W4TA 4RDHA 1TA4A 2Q50A 4PLTA 5CEEA 2HMTA 1P1RA 3Q2IA 2P91A 4E33A 1U5AA 4H7PA 2RCYA 2NUAA 3LLVA 3K96A 4WE3A 1U28A 1LQTA 4EI2A 1VM6A 1ZK3A 4XDZA 3WGYA 1EMDA 3K73O 1EBUA 1Q7BA 2WE8A 4YACA 5JAIA 1I3LA 4MKXA 2ZIZA 3LYLA 1DC6A 1H9BA 4ZQFA 4HFNA 4BV8A 1LDBA 3QVOA 1ML3A 3UF0A 3L6OO 1DRWA 3D64A 5IDWA 1F14A 2CDBA 1U3WA 4GSLA 4CUKA 4BO3A 2X1HA 2J5RA 4UVGA 4F6LA 4BNVA 1BSVA 4WASA 5F5LA 5A3VA 3O38A 4MPDA 2X9GA 1OAAA 1SEVA 1LU9A 4IMPA 4JP3A 1G6KA 5ER9A 1R6DA 1XKQA 1ULUA 1SAYA 2W8ZA 3I4CA 4NMHA 3TF5A 1FMCA 1HLPA 7ADHA 4ZQBA 3GQVA 4LK3A 1DC3A 5DDIP 2YJZA 1QRRA 4UVDA 5G0TA 2Q1UA 3CMMA 5KJ1A 3C7CB 4FD3A 1Z82A 2P5UA 5F1PA 3LU1A 3I9KA 3ZNQA 3JQAD 4D46A 1W4ZA 3C1TA 3E5MA 4U5QA 4FPXA 3IMFA 4FOSA 5F1OA 4BNHA 3HNPA 1BW9A 3DBRA 4CUJA 4JLWA 4Y6RA 4E12A 1P77A 4XQEA 3DL2A 4UULA 2ZKLA 2D5CA 1IE3A 3UH1A 1I5RA 3G1TA 1JVSA 1D1SA 1YB5A 3WGQA 3DO5A 2V6FA 1P3DA 2Y1GA 4TROA 4Q3DA 3QWIA 4D41A 3DBLA 3ZI0A 5IZCA 2DBQA 3MJSA 4ZICA 4B3HA 5L3ZA 1PGJA 3LLSA 3RASA 4ZA2A 4B4OA 1R4NB 3X2EA 2VTEA 1JKJA 5HWSA 1GU7A 3WQQA 2QIOA 2PK3A 1KIFA 1UAYA 4XR4A 2HQ1A 1HYHA 3RAJA 4CPDA 5TS3A 4CM5A 3FNGA 1HDYA 2UUOA 4WLFA 3ROQA 2QX7A 4DC1A 4WEOA 2QZZA 1PGQA 2Q45A 3QVXA 2GF2A 4PCVA 3UCFA 2Q22A 3H3JA 8ADHA 4B8WA 1ADBA 3GFGA 1DHRA 1U5CA 1U4OA 4HBGA 3NRCA 3EY4A 1MG0A 3BTOA 3C24A 1BVUA 1FDVA 1BG6A 2BFOA 1B8PA 3INRA 2BI8A 1FJHA 3TZKA 4J4BA 5TJ9A 3JSAA 1GQQA 5IDYA 2VCYA 1I10A 1R66A 1I30A 2PH5A 3FI9A 3JD3A 3SJUA 4BGIA 4CMIA 1KY5A 3P2YA 4RVGA 4J91A 3NDIA 1BTOA 4OOEA 1WMAA 3K2BA 1B16A 3PPIA 3QWHA 4OIMA 2DQ4A 3HDYA 4ZQGA 3RUEA 4EDFA 4MIYA 3RQSA 1D1TA 3KEOA 3PYLA 4RDIA 1U4SA 4A5OA 4J0FA 4E32A 1JKIA 5KVSA 1DJNA 2PD6A 1ZJZA 4XGNA 4BIIA 3MWDB 3GG2A 2O23A 4DC0A 3E9MA 2CY0A 1HE5A 3B70A 3GRPA 4BKUA 2JD1A 3NDRA 5BSGA 3BAZA 5A03A 4JXKA 2FPIA 1LRJA 3WQSB 3E48A 1E3WB 4NU6A 3V8BA 1KBZA 1T2CA 2WE7A 4FN4A 1EEHA 1EZ4A 3JQAB 3INGA 5JC8A 4E2YA 3ANMA 5A1TA 3WJAA 2I66A 5L4NA 3PRJA 2CDAA 2X0JA 2Y1CA 5JYEA 3F1LA 4TVBA 1MC4A 5BR7A 4XGKA 3RUDA 4MVJA 1A5ZA 1Q0QA 1UP4A 2DT5A 3D4OA 1UP7A 4OMUA 2IZ0A 1ZSVA 4DRYA 1AHIA 4B4UA 4OXNA 2FR1A 2CVQA 4C7JA 3GUCA 4NBVA 5JYFA 4WLNA 1ENZA 2J5QA 1DHTA 2RH4A 4FB5A 3I5MA 4M54A 3PQDA 5EN4A 3TQHA 3G1UA 1HTBA 4YT5A 4OQZA 1I3KA 2DTEA 3EVNA 3SXPA 4BNNA 3GR6A 1LSOA 4AJJA 2UVDA 3HB5X 3LQFA 5TC4A 2VYNA 1PZHA 3GZNA 4TZKA 1Y9AA 2V7PA 2X0NA 1QLHA 1YONA 3AOEC 3H4VA 3VH4A 4D0RA 1H6BA 5JBIA 2GN4A 2RIRA 1XIVA 5EMHA 1QLJA 5ICMA 4DL9A 4M87A 4OSPA 1DJQA 3E18A 2P9CA 4P8RA 1TXGA 4B3IA 1BDBA 3SX2A 1V3UA 4ALLA 4J49A 3VVCA 2VZ8A 1YQXA 4M1QA 2I99A 3WGGA 3DHEA 3MCVA 1EVYA 3FWNA 3A06A 4IINA 5I8ZA 4FQ8A 5TT0A 1QG6A 4GVLA 3L4BC 4Z0HO 3V2HA 4A26A 4CV3A 1PS9A 3GDOA 4KTTE 2BMAA 3GT0A 2E6UX 1ULSA 2DUWA 3EVTA 3ZV5A 1F0YA 2RHCA 5JDIA 3H5NA 5AQ1A 3ONDA 1I36A 4Z0PA 1E7YA 4K6FA 1Z73A 3HZZA 5JDCC 1QV7A 3KB6A 3L9WA 3BZUA 4QFDA 3GFBA 4Y6PA 1A7KA 3KLPX 1UXGA 3INTA 3D3WA 6ADHA 4J9VA 4XYMA 2FZWA 2DAPA 3SLKA 2J3KA 3D3WB 3DBVO 2HMUA 1TI7A 1ENPA 2X86A 3JQDA 2PD4A 3VOSA 3VPSA 3D5QA 4KDEA 1YXMA 4IQ8A 2GYYA 1E3LA 4F3YA 2EG9A 5AYVA 3ZWOA 2QQ5A 3RUHA 5CDSA 4II2A 2EGHA 3RUCA 2POQX 2WWRA 1J6UA 1HDCA 2EERA 5JW6A 1DLJA 1HDXA 3ROKA 3NT4A 4FDAA 1BXZA 2A94A 1P1FA 2OOSA 1AHHA 1AGNA 2BGKA 1MUUA 4HXYA 4E2WA 4CMAA 2VHVA 5IN4A 1WNTA 3W1VA 2GN8A 4GQAA 4CM1A 1LQUA 4E6PA 1M67A 2YHIB 3QSGA 3VC7A 5CDGA 4PLHA 4I9UA 3ETGA 3RFVA 4RGBA 3F4BA 1NPYA 1V9LA 2IDZA 3RBZA 1Q0LA 2HK9A 1NVGA 4QEDA 3KTDA 2EP5A 4R01A 1ISMA 1H2HA 3ORFA 3ETDA 1T24A 5FFFA 2FSVA 4CQMD 3ZV6A 4DMLA 4R1TA 4PZDA 2VYVD 4Y6SA 3UCXA 5JDIC 4CMCA 4L8VA 2BFAA 4OH1A 2GR9A 5ENVA 3X2FA 3DBRB 1MGOA 4IQ0A 1LDNA 4ID9A 4IJVA 1SBYA 3OP4A 1HZZA 1W6UA 4RVUA 4J4HA 5BSHA 1DRUA 5AXCA 3RCBA 1WP4A 5IF3A 1KOLA 4CMGA 2W98A 4GX0A 1LLCA 3M2TA 5F1KA 2O3RA 5CPFA 4HV4A 1PR3A 1ZO8A 1FDUA 4RPJA 5IXYA 4K6CA 1XCBA 1C3VA 4E21A 4YT8A 3JQ9A 3K6JA 2GZ2A 1IY8A 1NFQA 3M2PA 4YTEA 4AJIA 4YXFA 5IN5A 1PL7A 1CDOA 1LBEA 3GMSA 4JNKA 2VWPA 5J9GA 1Y9EA 1V3VA 3U3XA 5A04A 1SC6A 3ZWNA 2AE1A 2AG8A 3PEFA 2AHRA 1NPTO 2HU2A 3GHHA 4RF2A 3ZV3A 3HG7A 4RF5A 3FPCA 1X13A 1E6WA 1XG5A 2E82A 4J4TA 3BTVA 3VH3A 4J43A 1F8GA 4BKQA 3DB2A 3AI3A 3KYDB 1P1IA 3QV1A 2YW9A 2AQKA 4IXTA 2DTDA 3T7CA 3NJ8A 2Y68A 3N58A 1NXQA 2IYOA 4IIVA 4XCVA 4W82A 1U1IA 5THQA 3AM5A 1GR0A 3TJRA 4ND3A 1N1GA 3HADA 5U9CA 1YVEI 3M1LA 3PFWO 3WFJA 4L73A 3CUKA 3W4JA 5I7FA 5T5QA 4QSMA 2GLXA 1KEWA 1GL3A 3AWDA 4NJOA 2SCUA 4FR5A 1A71A 3DWFA 3PVZA 3E1KA 2H63A 5C7IO 3P19A 5KJFA 3CINA 2GUGA 3WNQA 3ITKA 2FP4A 3MTJA 2A4KA 4YQZA 3DAFA 1O5IA 5DNAA 1ZUD1 3GNQA 4E31A 4DLLA 3MEQA 4XGIA 3W6UA 2J3HA 3K30A 5G0WA 1LLQA 1GADO 3COSA 2DVMA 2DTXA 3AFNA 1ENOA 5JMWA 4WLVA 4NJMA 1N2SA 4OSOA 1LNQA 2Z1MA 3C7DB 2X4GA 1HDZA 1X14A 2WDZA 1KC1A 2DBRA 3F5QA 5DBFA 2ZJ0A 4Y8VA 1PX0A 1ONOA 4NI5A 1ZFNA 3O8QB 3TL2A 2C2YA 3TL3A 4XYEA 1PZFA 2NSDA 5GMOA 3SC4A 1RM3A 4KTVE 4NFSA 1D7OA 4IMRA 4QQRA 1QYDA 1QP8A 4MOWA 2PKQO 1T1SA 2YY7A 2ZB3A 1J5PA 4E4YA 4ZHSA 2D3TA 4MINA 3TRIA 2B35A 3OETA 1ORRA 2VRBA 5CPBA 4J7CA 5AXDA 4F45A 1LC0A 4BOYA 2NM0A 1KETA 5JYDA 2ZYAA 5MGBA 1K3TA 3HUDA 1YBMA 3QIVA 4FFPA 2X7HA 2DBVO 4J16A 3C3XA 1Q1NA 3DHYA 3S1LA 2JFGA 1N7HA 3GC6A 5ICSA 3KOUA 1YKFA 3WYCA 4WJZA 1AXEA 2GCGA 3HN2A 5L40A 1HE2A 2Y0DA 4YJGA 1A72A 5JY6A 1Z7EA 3FBGA 3I1JA 3H7AA 5B4VA 3VZSA 5JCXA 2CFCA 5T6BA 3DZHA 3WGOA 2O3UA 2Y0EA 1TT7A 2HMSA 1EK6A 1U7HA 1H6CA 1Q2XA 1NFRA 1U3TA 2NTJA 5TSDA 4RVSA 3QVTA 1SO8A 5L95A 3U9LA 2IYPA 3PZRA 2UAGA 1UXJA 1E1KA 1YOVA 1PGPA 3DTTA 5FF9A 3TSCA 3JYLA 3ZN2A 4IZIA 3TNLA 2Q1SA 3PLNA 4J1TA 4MVJM 4QUKA 4ZRMA 3ZW8A 2O3SA 3FF4A 1XU9A 2IXBA 4LGVA 4E2XA 4YJDA 4RLSA 4PFJA 3DR3A 3WMXA 4BB6A 3WTBA 3EK2A 3GA0A 1ZJYA 3D4PA 3R0IA 4EW6A 4DMMA 2EKPA 1XU7A 4WEQA 4XYGA 1S6YA 2VUSA 5F21A 5DCYA 4FFLA 3D0OA 2OBYA 4CL3A 2ZK7A 1R4MB 4DQUA 1OC4A 1XLTA 3RUFA 3CKYA 2BRUA 2VZ9A 4RVFA 4CM4B 1MP0A 2HDHA 3G0OA 2HRZA 4YDRA 3RSHA 1ZXBA 5K6AA 1NYTA 2Y67A 4D3FA 2O3TA 3KZVA 2WD8A 3MJ4A 3DEYX 4JP2A 4CR8A 3VAZA 4BMVA 4FGSA 3QWAA 3HDQA 3WR5A 4XJTA 4B4VA 1HRDA 2PZJA 4BGVA 1MC5A 4BNKA 2AQ8A 3F3SA 3OECA 4R16A 4XYLA 1EVJA 4O6VA 1OZAA 3JQBC 5JMPA 1GV0A 3KVOA 3DZIA 2QHXA 2I76A 4WNCA 1XDWA 2PTGA 4P38A 3JD0A 5CDUA 2NU9A 2JAHA 3JQ6A 4RO0A 3ZHYA 3DQPA 2H9IA 3O26A 3ZH2A 1TVEA 4EYEA 4II3A 4PZCA 2HKIA 1E7WA 3MTGA 5DP1A 3QJ5A 3CIFA 4PG6A 4BNGA 3EGOA 2FRDA 3KM0A 4Z0TA 3PHHA 4YJFB 3PGJA 2VHZA 4LRSB 4IJKA 4D45A 5AVOA 1JTVA 1ZEMA 3E9QA 2GZ1A 3VZPA 1JW9B 1ZIDA 5AXAA 1MX3A 2CSUA 3ZWYA 1VSVA 3JYPA 4JJGA 4CMEC 2E48A 3GZNB 3E9NA 4Z3KA 4PG8A 2ZJ1A 2ET6A 2ZQZA 3LK7A 3HHPA 2VOJA 5F5NA 2XF8A 4MVJP 1G0OA 3JQFC 1VJ1A 3IQDB 5I9LA 5CP8A 1V8BA 1NAIA 2VHXA 4GKVA 1DAPA 4MDHA 2BI7A 4F6CA 2X5JO 2I67A 3DZJA 1PJBA 3GVPA 3LT2A 5GY7A 2AEFA 3KYCB 1C1DA 5JO9A 4XWYA 1E92A 1I2ZA 1I33A 2O4CA 4FOOA 4ZU3A 4WPGA 2EJVA 4NK5A 3PFFA 3GVHA 1PR9A 5KKAA 3ZU4A 3K9QO 4BNLA 1E3IA 1HYGA 1N5DA 4PG5A 3GN1A 4BNFA 1XYGA 1FF9A 3ANNA 3LSYA 4BNYA 4Y9DA 4N7RA 3UUWA 1O6ZA 4NBTA 5G4LA 2A9FA 4AJLA 3WYEA 3K92A 3NGLA 2P9GA 2VT2A 3KYCA 1K6IA 3DFUA 5A4DA 1P9LA 4I5GA 1P74A 4ZD6A 1BW9B 1WWKA 1E3JA 5L51A 4RF3A 3JQ7B 3IDSA 4X54A 3P5SA 1MA0A 2PLAA 4ALKA 1R0LA 1Y1PA 4GH5A 1T2EA 3UVEA 5JO0A 4FFNA 2WSBA 1J49A 4ND4A 3T4EA 4FFOA 3C1OA 3GGOA 4XX0A 5IZ4A 3L07A 5I7VA 1DAOA 1P33A 4D42A 1DIAA 4WNIA 3WJ7A 3I9MA 4QT0A 2B37A 1SOWA 3RIHA 1M76A 3NX4A 4R1UA 3B1KA 2VHWA 3ZDFA 4GMGA 4ZQHA 1OOEA 4RF4A 2PKQP 3BYZA 5HM8A 3TPCA 1TEHA 1HKUA 3NUGA 1LJ8A 2Z5LA 1YH3A 3B6ZA 4QO7A 4NBWA 2A35A 2FZEA 1TB4A 3U09A 2O50A 3JD4A 1YDWA 1JWAB 1V6AA 2Q1WA 2YDYA 1U7TA 3L6DA 4C4OA 1CQJA 4N5MA 2A92A 3DDNA 4J7XA 1UH5A 4MP6A 5EESA 3Q1LA 5I7EA 5LCXA 1J0XO 1SEPA 3JD1A 2GERA 5HBRA 5CG2A 1WZEA 3UFXA 3JYOA 1UZMA 2OBNA 1H6DA 1Y8QA 1IB6A 1NPDA 2GZ3A 2X58A 3WIDA 4AG3A 1F8FA 4YJGB 4L74A 2G1UA 4XKJA 3DZKA 2NADA 4A10A 3GLQA 1LRKA 1A9ZA 2FSSA 2IE0A 4OM8A 1ADCA 2H5LA 2ZCUA 4BNMA 2QG4A 4RPHA 2B0JA 1NASA 3UW3A 1EE2A 1WPQA 5L53A 4O0LA 5TJHA 3AUTA 4URFA 2I3GA 4E30A 1A27A 3P2OA 3IS3A 4DYDA 1R12A 4CR6A 5T57A 4Y67A 1YOVB 2IZ1A 5G4KA 4QECA 3DBHA 4HX5A 2E49A 2PH3A 4FFRA 2H6EA 1NR7A 1K89A 2JL1A 4D7AA 4GI2A 1QYVA 3QP9A 5A9SB 4DWVA 4CUZA 3JQBA 2BKAA 4I8XA 2D2IA 1DPGA 1HL3A 3WXBA 4RLHA 3OQ1A 2PZKA 1E5LA 1DO8A 5KIAA 3GK3A 1Y7TA 1BGVA 1XEAA 4YWJA 1I24A 4FJ0A 4MP3A 5HTOA 4LSWA 2JFFA 3I23A 4YR9A 5C37A 3CZRA 2DUUA 2YV2A 1BXGA 3E6AA 3U4IA 4E3ZA 1EDZA 1HDOA 1XQ1A 4NG5A 3RFXA 3VVBA 2X0IA 4XB1A 4CLXA 1LA2A 3O4RA 5THKA 4DYVA 3QWBA 5L7WA 5KNLA 3CSDA 1NM5A 1Z75A 4R5HA 4CV1A 4ESOA 8LDHA 2RHRA 4DPLA 3F1KA 5IFLA 3AUAA 2YV3A 3NT2A 2Y05A 4W6ZA 4YCAA 3GNTA 3JD2A 3UAGA 1Z45A 4E5YA 1GZ4A 5U4QA 3Q9UA 1IOLA 3GEMA 5TQVA 4RL6A 4TVOA 5FI3A 1GPJA 3AY7A 4OYRA 5L9AA 1GUFA 4ZQEA 2J3JA 4IIUA 2D8AA 4FJ1A 4P4GA 4H16A 1ZBQA 4NK4A 1H0KA 4AL4A 1MFPA 5BQFA 2B5WA 1KEVA 2PY6A 3WGZA 1NTOA 1DOHA 1ZK4A 2Q2WA 2X9VA 5FI5A 2W2KA 4OXYA 3IP3A 1UUFA 3PZBA 1PWZA 2GO1A 3H8VA 3UICA 1G0NA 1R4NA 3OIGA 2NQTA 4JN6B 1VL8A 4NNJA 4BGEA 1OMOA 5JAMA 4YB8A 1E77A 5MDHA 2VRCD 3V1YA 1JDJA 1YL7A 1C1DB 2X5OA 5TT1A 2DKNA 2B4RO 2QRJA 3G3EA 3I9NA 5JCJD 1DFGA 3GUYA 4D79A 2WMDA 5AXBA 4XRRA 4P22A 4IS3A 1LI4A 3PP8A 4M55A 1P0CA 2QYSA 1T25A 4YRBA 4DBZA 2Q46A 1YBVA 3FPLA 2NNLD 1L7EA 3WLFA 5DBGA 3KUXA 5T8KA 1B14A 2YZ7A 3KLMX 3S2GA 3QVSA 3GAFA 2O4UX 5I8WA 3Q2KA 1NQ5A 1NX6A 1LC3A 2VUUA 1E6EA 3GVXA 3GZ4A 1NHGA 5ENDA 3WICA 3I6IA 3OH8A 1XELA 4KZPA 4WLEA 2C59A 1YGYA 4UUMA 3W4IA 1LDYA 1BHSA 1ZNQO 1E3EA 1MFZA 5B12A 4KMSA 4XYBA 3HSKA 2P68A 1U2GA 2OFPA 4LCEA 1PJLA 3R6DA 4CLRB 2GPTA 3WG9A 4OOFA 4BNJA 4DBVO 2PGJA 2VQ3A 4QXMA 3ZWBA 1KVRA 1T4DA 1YO6A 4YYZA 1ISIA 1PU2A 3NTRA 1GDHA 1UJMA 1Y6JA 3GNSA 5TIIA 2V65A 1OC2A 2B5VA 2YUTA 4PRKA 4RPGA 4S1VA 1UAGA 3PXXA 4RPLA 4CQLB 3VPGA 3QW2A 1N9GA 3I6QA 3VTZA 2AQIA 3FR7A 3ZU2A 4ONEA 4R1SA 3GDFA 3DC2A 1M66A 3VTFA 3NKLA 2CUKA 1X1TA 1GTMA 1VI2A 3W6ZA 1ONNA 2VWGA 3AI2A 4IDEA 3EHEA 1SOVA 3DHNA 5C3MA 2C20A 5A06A 1D3AA 2CF5A 2FR8A 1EVZA 1DIHA 2QW8A 4KDFA 3RC1A 1EE9A 3ICCA 2ZTLA 1DFIA 2QYTA 4EUHA 2OORA 3E82A 3B20A 4OKIA 2GD1O 1ISGA 3BMQA 3PDJA 2JD0A 1H93A 3OBBA 3KETA 2BD0A 5G2OA 4GVXA 4OJNA 1PGNA 3DTYA 4CM4A 3RC7A 4UAGA 5KKCA 4BKPA 2AA3A 1BDMA 2IXAA 3Q9NA 4RPKA 1T2AA 3WBBA 5IXSA 4CV2A 1KERA 1KVTA 5A5EA 5I9NA 1KC3A 3IKVA 3QQPA 2Q49A 3MJVA 4RORA 4FC7A 1E7QA 4L4RA 3RD5A 3DAGA 1LTHR 4CLOA 3OJFA 4WGGA 3OA2A 3OICA 3HB4X 1EK5A 3FNFA 3RWBA 3VDRA 4CLOB 4IDCA 1T2DA 3IP1A 1PTJA 5JNLA 4NDNE 2BELA 1RWBA 1HYEA 5T64A 3TN7A 1AN9A 5CEJA 3DBHB 1ZVMA 3DONA 1JAXA 3PGXA 1PEDA 2WTBA 1U2DA 1QMGA 1K6XA 2OO5A 3MJCA 3GPIA 2EKLA 3WLEA 1KYQA 4W7IA 3UOGA 1LSUA 1NWCA 1HWYA 2AEJA 3LF1A 4MVJD 4BO2A 1S7CA 2JFHA 3OEWA 4TRNA 1GCUA 3DMTA 9LDTA 4YBZA 2VWHA 3RU9A 3H9UA 3ICPA 5DT9A 1UDCA 3ON5A 3ADOA 3NEPX 4IDFA 2PFGA 1IYZA 3GGGA 3CTMA 1WDLA 5GZ1A 2JCYA 1HSOA 3PJEA 2V6GA 4UVIA 2EW8A 5G0UA 2I65A 3ETEA 5JS6A 3PDUA 1VE9A 4YA6A 3AU8A 3S2FA 4QFCA 4OXKA 3L9XA 3DMYA 2ZQYA 1HDGO 3IUSA 1GEEA 1YBAA 4P4NA 4FGWA 1D8AA 5IDXA 4R3NA 1O8CA 1PS0A 5HS4A 1J4AA 3SC6A 1EQUA 1YRLA 5I9MA 1CEQA 5JLAA 1IHXA 2P2SA 5DCWA 4CODB 3CMCO 3LC7O 3U5TA 1IPFA 1IPEA 1YB1A 3F4LA 4AJ1A 1VPDA 5EIOA 1Z74A 3AFMA 4G65A 1CETA 3FSRA 4DA9A 4R69A 4ALIA 4CM9D 2X5KO 1YS4A 2XAAA 5ER6A 1U3UA 2JHFA 3WOHA 4F46A 4I5EA 2GDZA 1RJWA 4ZN6A 5J23A 4PG4A 1I0ZA 1QKIA 1YDEA 4CLEA 3BIOA 1C1XA 3N7UA 1XGKA 3TZCA 1CYDA 5JYAA 1RM5A 3VDQA 4IPTA 3ZHZA 1Q0HA 5BNFA 4TSKA 3NTQA 4CM8A 1NVTA 3QY9A 4B7XA 2BFMA 1LDMA 2FPGA 1F17A 4MVJF 1N7GA 4KUGA 2WJPA 4A0SA 3EZYA 3AUSA 4BNTA 1LLDA 4XIJA 2I9PA 3A14A 4DIOA 2EXXA 1N8KA 3WS7A 1PJ3A 3QHAA 3WDSA 3DFZA 4XR9A 4XQ9A 4IBOA 4PVCA 2R00C 4D3SA 4EJ0A 3FN4A 2Z95A 4AJPA 2CVZA 2NLOA 4AICA 4OGWA 3EUWA 4D3DA 1PL8A 3BMQB 2D0IA 3KEQA 4FSHA 3A4VA 4EEXA 4IQGA 3AOGA 4IDAA 4BV9A 3F5SA 2YQ5A 2HMVA 2YHIA 3L6EA 4CL8A 1GQYA 3S55A 2Y99A 3OJOA 2ILTA 4HNHA 2CNBA 3BA1A 4KOAA 4G81A 5G0VA 3GMDA 4Q3CA 3A1NA 3ZHBA 1NQAO 3CZMA 3PJFA 2O7SA 2D1YA 1KEPA 3UXYA 4KWHA 3PIIA 3STHA 2XOXA 4TKMA 2E37A 3PWZA 4IM7A 3WWZA 4QTZA 2I3AA 2FWMX 1NQOA 1O95A 1E1NA 1DIBA 3RBVA 1N9GB 3PLRA 5ILOA 3V1TC 3WNVA 2J5KA 3F46A 3RVDA 3WWYA 1RM0A 3CPSA 1LEHA 4A73A 2DPHA 4KQXA 4B7CA 5G0SA 4DPMA 2TMGA 1JQBA 3KRTA 3I4FA 5JY1A 5TLSA 1DC4A 4OL9A 1BVRA 2ZTVA 1MLDA 4UVHA 1H9AA 4UUNA 4MIOA 3DBLB 4PLPA 4PLWA 1PJSA 2NVUA 6LDHA 1P44A 4WCFA 1C14A 4J7UA 1SPXA 3I9JA 1CQIA 2CF6A 1YQDA 1RKXA 3WSWA 5A9RA 1BXKA 3JQAA 5JPIA 4AJHA 3VKUA 3EC7A 1SCUA 3PTZA 3QRWA 3LC2O 4BNXA 2WD7B 4RQTA 4BO9A 3FTNA 1VL0A 5H82A 3T7EA 1HXHA 3K31A 3PYMA 5EQDA 4PG7A 4B8ZA 4Q3AA 5B4UA 3B1JA 1C0PA 2G17A 1HDRA 2WEKA 3H2SA 3W8DA 3ZNPA 1X1EA 2RH8A 2CD9A 4U0JA 1ZXLA 4HADA 5KJEA 4YPOA 4A27A 4DIFA 4RQUA 2TMDA 1OFGA 3DOOA 3BMCB 3ROMA 1JKFA 1C0LA 3H5RA 4E5PA 3OA0A 1I32A 1M6HA 2BGLA 4Z3DA 1HZJA 1XSEA 1X7GA 4D0SA 4E13A 3GAZA 3PHJA 4YT4A 4FIZA 3ZWVA 4LISA 3AJRA 3E03A 5A05A 3A9WA 4FS3A 4YRAA 1JU9A 1A7AA 4DQXA 4IJWA 3NV9A 3PQFA 2CZCA 4NPCA 1T2FA 1ZEJA 1LSJA 4MVJG 2D4AA 1I01A 2ZB7A 5EJ2A 1KEUA 1Q7GA 4OQYA 1CJCA 1E3WA 4BVAA 4GAEA 2HRBA 3G79A 4N5LA 4R51A 4CM7A 3U49A 3MJTA 4BO8A 4BB5A 1FK8A 1UDBA 1DIGA 2Y66A 4O63O 4M86A 1K2WA 2W2KB 4UEOA 3TZ6A 3D7LA 3FCOA 3PHLA 3H6KA 4U8GA 3ZWXA 2C7GA 1U9JA 4L0QA 3MOGA 3ZNOA 1QV6A 4OHUA 4MP8A 2UV8A 4JROA 1A4UA 1GAEO 3HFSA 3E5RA 4GLLA 4GL4A 3AM3A 2X22A 5KVQA 1V3TA 4EITA 1PL6A 4J90A 4GPD1 3FTPA 1LX6A 3HN7A 1PQUA 4LRTB 3I9LA 5T73A 3V5NA 2JD2A 2AXQA 4CMKA 1SB9A 2P9EA 4NR0A 4YEDA 1B3RA 1ISHA 3M6IA 1BRMA 4JGBA 1U8XX 5H83A 2PR2A 4M8SA 3U4CA 3H3FA 1B2LA 1UZNA 1NHWA 1HETA 1WVGA 3VH2A 3HDJA 1WZIA 2EKQA 1B8VA 4IDBA 4R1NA 1VRWA 4XZ3A 1ZZEA 3GEDA 3K2EA 1D4FA 4RJTA 3KSZO 3Q0EA 1NVMB 1QYCA 2PGDA 2PGLA 5DULA 3I3OA 3SJ7A 3UHAA 2OGUA 3ZWWA 2JCXA 2P4QA 3D1LA 4XIYA 3H9QA 4PLVA 3RKRA 2EHDA 2VNAA 3FNEA 3PJGA 4YAJA 4YAIA 3FD8A 4ALMA 2CVOA 4BO6A 3CE6A 3OEYA 4A2CA 5JSFA 3ONFA 1DDOA 2O7QA 5IDQA 2FN7A 1VKOA 3S2EA 1NFFA 5EQFA 4GKBA 1GEGA 3RUAA 3PQEA 2G82A 3BMNA 3AOEA 1VKNA 3AUUA 3BHMA 3GVIA 4ZJUA 3I52A 4WOJA 4XA8A 1XR3A 1B7GO 2DFVA 4KQWA 1H94A 2VHYA 3WQRA 4A03A 1HE3A 5L4LA 1EUZA 5B37A 4DTIA 2WM3A 1U8FO 1E1LA 1QYXA 3ZW9A 4WCFC 3VPHA 4L76A 3VKVA 1B3BA 5TRTA 4BO1A 1PGOA 5C7LO 2IODA 2C07A 4FCCA 9LDBA 1BMDA 4G2NA 1ZK2A 4Q9NA 3WGTA 2JAPA 4NU5A 1IZ0A 4J1QA 3DZGA 5T8KC 3RKUA 4K28A 4I9NA 2WD7A 2C7VA 4KUHA 4MVJI 4D43A 1IULA 3BMOA 2O48X 2WYUA 1PWXA 5FYDA 4HKTA 5BNIA 5BSFA 2VZ0A 3AM4A 3BMOB 4L9RA 4PLZA 1GPDG 1R4MA 3NAQA 3BMCA 3KO8A 4CM9A 4J2OA 2NVUB 4LSMA 3U4DA 5DP2A 1VC2A 2YHUA 5DN9A 5DOZA 2V6MA 2VOEA 3WBFA 3ENNA
chains in the Genus database with same CATH superfamily
4J0KA 2HIHA 1GUYA 4L15A 1VHDA 4WY8A 1GZSA 2ONCA 1MN6A 1NBOA 4K5QA 3LUJA 1SU7A 1LLFA 1X1AA 2C5AA 4PZAA 3GI1A 2DHEA 1SG9A 4I50A 5IAKA 5IBRA 1WXDA 3ZVNA 4EPXA 1CUBA 1LS1A 1EUDA 4LOHA 3AVXA 1U5BA 1MEEA 3P27A 2MU1A 1OLXA 4BU1A 1VBKA 3AY6A 4DLAA 5AOVA 1PEYA 2WJYA 3WAKA 1NBAA 2H4FA 1QKJA 3OIWA 3ZI4A 3W2TA 4HUJA 4LF9B 2ISCA 4ND6A 3TTVA 1K7SN 2NU7A 2AJCA 4U9HS 1W88A 2BFCA 1C2TA 3NNNA 3ITNA 2PUWA 3OEED 4JBIA 1G21A 4AX8A 1AG9A 3HWSA 3HCPA 4WOCA 1V41E 2PLRA 1P6QA 4DWWA 2W5UA 4Q0MA 2PRYA 5AM2A 4JX8A 2WJ6A 4NJMB 3WHPA 2X5XA 5CFOA 3F78A 2HQBA 2OUIA 3AP1A 5HX7A 4LQDA 2QD2A 1MXHA 2IVFA 5CEFA 4DHWA 1I5OA 3H2BA 1PUJA 3DZ5B 1MMFB 1W73A 3L7NA 3LHDA 4U9UA 2VJMB 3DZBA 4EKNB 4OGLA 4H35A 3B3QA 3LC1O 3WB0A 4EL5A 3E4CA 3U4HA 1VJTA 5ALNA 2WTUA 4LX0A 4X3PA 5IT0A 4ND2A 1J0EA 3GPCA 3U62A 2FY8A 5EIFA 3G6WA 4Z7OB 1ZH8A 3M9XA 4LZOA 4RTKA 2ORVA 1P45A 4LJ5A 1Z0SA 4OO3A 4Q39A 3V34A 2IHTA 4XWOA 1AHNA 3ZIAA 3FTEA 4JQZA 4FFWA 4NCBA 4NFLA 2XWBF 2ZW9A 3LI2A 3HBMA 5BUQA 1KZGB 4GYYA 4CIXA 2PKXA 3BB1A 1RYDA 1Q7TA 2FXIA 1OLOA 4RCYA 4TVSA 2FGKA 2PUAA 1I7PA 3SDZA 3KWLA 1CUHA 1QORA 3C1AA 3G8DA 2LDBA 3GDHA 1LZLA 4KSCA 4KPGA 1JR6A 1II0A 3IPCA 4Q00A 5EJ6A 5FLEX 4YQFA 3OM0A 4HDKA 4JCOA 5FHRA 2OC9A 2OESA 3TNYA 4F84A 4H1VA 4OAQA 3SQWA 4YCLA 1KDOA 4RHCA 4MVWA 4RKYA 2IEYA 5KS2A 3P45A 2UYQA 5F9MA 5GJCA 1EX7A 4PC6A 2QM7A 4G26A 4JC8A 3VR6H 3O8BA 2HLDA 3PV0A 4X6LA 2ATVA 4I9GA 4OA8A 2JI6A 2YBDA 2JI4A 2HJSA 4N54A 4UBJA 5DO9A 2P7HA 1DJOA 2ODTX 4GSKA 2OCBA 3ZVRA 3SQXA 4BYMA 4HSEA 2DPGA 2V0NA 3B7WA 2Q0QA 1XPOA 2W90A 3TKAA 1OASA 4TTSA 5ERXA 5LQDA 1MHTA 1E2MA 2X2EA 4LDPA 4POOA 2ZB4A 4MO2A 4HUTA 2CNKA 4KRXA 1NLMA 2P4HX 1AZLA 2W6QA 3M8KA 1WHSB 2OZKA 4IY1A 5B2FA 1NW7A 3T3OA 3RSCA 3U4AA 3HTXA 3TLMA 1EUCA 3JXEA 2OCYC 5FPSA 1J99A 4BVHA 4YRNA 2GPJA 4CKZA 2ONZA 3D54D 3G2IA 3JAKB 3EVBA 4FEYA 2O5RA 1M2FA 4MAMA 3SVTA 2XCSB 4WK6A 2EP7A 3ASUA 3GDGA 1DU4A 4GU5A 2FPRA 4MGIR 2X9LA 4QEKA 4QWWA 3U3OA 3FTFA 2GAOA 4CFYA 4RK4A 4QX6A 3ANLA 3HEMA 1AKMA 4XQGA 2PZBA 3FSGD 4F06A 8GPBA 3VNUA 1ZIXA 4W5HA 1W2WB 2MMCA 4DRXB 1EWTA 2H08A 3JYQA 4ME6A 1NOKA 4BN5A 1G8SA 5DNUA 1CUEA 1C3OA 5EJ8A 4KX5A 3SAJA 1CRWG 1RVDA 2QZ4A 4EG6A 2IYUA 1Q1QA 2LZ0A 3NT5A 2Q99A 1HSZA 4XSVA 5B1YA 3C87A 1RIFA 3GRAA 2GAAA 4WECA 5JZBA 2V9PA 2Q4BA 5HRUA 4F5WA 1XVUA 4GOXA 2IZOA 4HWKA 3W9BA 4CJXA 1KY4A 3GGPA 1UC9A 2QR3A 1UPBA 2QG6A 3EODA 2NVOA 5IXJA 3S2UA 2Q7XA 1JQAA 2DWCA 3OKFA 3K15A 3FRJA 2NXNA 3PQ7A 4YGYA 4LJ8A 4BNWA 1RS0A 4PBRA 1OR8A 5AI9A 3GFRA 1QMPA 4C3UA 4HP8A 4B7UA 1AXGA 1G41A 1ZGHA 2QW1A 3Q7SA 5DCUA 3JATA 3RC2A 3D5TA 1Z2NX 1JJIA 2B83A 3LW7A 3C48A 3TW6A 1TCUA 3R1IA 1JDSA 4JYZA 1VI6A 1RZUA 2W2PA 3OIYA 2VSYA 5L45A 2FTKE 3TOXA 4BBAA 4N8DA 1H1DA 5C7OO 2WYVA 2O8BA 3W1EA 4DLBA 1QFJA 2PGXA 4PPFA 2JFNA 1TAUA 2EJCA 3FPGA 3IAHA 3I1YA 4KDCA 1OTYA 3LM8A 2JW5A 3H1TA 4IIFA 4D9HA 1ZJJA 2HK8A 3EFOA 3GUZA 3GFTA 4WZAE 1A77A 1WD7A 1R8XA 3OZBA 4QDJA 4BLPA 3DXFA 1X15A 1OLUB 1HFEL 4XFJA 2R84A 4KWIA 1WULS 5AHWA 2CHUA 3L0DA 1RJDA 2HWYA 3FNHA 3K5PA 1GZ5A 5ILGA 1P75A 4TMTA 3THWB 2J46A 1N6NA 4A6XA 1Y81A 2O2YA 3T7KA 3RS2A 3P1JA 4G25A 1RKVA 4NYIQ 1RI5A 1JBQA 2H29A 4OAOA 2IL1A 3FFXA 1NBHA 4Z4GA 5G4KB 3AT1A 1R0KA 4M22A 2J4CA 1QIMA 3NYQA 4FC6A 1EP3B 3AFHA 1U3VA 3T9AA 1N0HA 4PNEA 3QVJA 1QTNA 1V5IA 3IALA 4MARA 4LYEA 4OHRA 4WCVA 3WKBA 3QEMB 3BGIA 3WL3A 4JUIA 4BDTA 1U2SA 3WSVA 1JEJA 4ED9A 3EMKA 5TNXA 2NO0A 2NW6A 2ZRMA 1YZKA 3R40A 1DS6A 2YV4A 1NZJA 2L42A 1OBVA 3BSWA 4ER7A 1DDGA 3CF4A 4M9ZA 5FUQA 4Y2GA 2BCGY 5HQJA 3C7AA 3AR2A 3A0RB 1EFDN 3LRXA 3DV0B 4HY3A 3GOHA 5DH9A 4OG2A 3EFHA 4IGFA 2X0EA 3T9BA 2VF4X 3IQXA 3LDHA 4LOLA 1E1MA 3I5UA 3STXA 3SZRA 3VM6A 3HM2A 1SKUA 3ADPA 3EG9A 1T8UA 4X5OA 5FPQA 2ZT8A 5K3FA 3NAMA 5CX1B 2V6BA 4MAFA 4XQCA 4PY2A 4TTTS 4HZUA 4ALJA 3T3PB 5BWCA 1KNQA 1WLYA 3VZRA 1R64A 4KIUA 2PX2A 5JC1A 2J9RA 2QMOA 1OT5A 1DX4A 4W99A 5FUYA 1SIBE 1CVLA 2XGMA 2PU5A 2GYUA 3CEPB 3H1FA 1NNUA 3L1JA 2YFQA 2B9VA 3MUEA 4X1OA 5H9WA 2C5SA 3EDMA 4Q37A 1T1EA 1G19A 1W1UA 2EDAA 1OXXK 3Q41A 4BIMA 3KVYA 1V16B 3A1FA 3HB1A 1N0UA 4ND5A 4UASA 1AHPA 3U61B 4FK8A 3MPUA 1QRAA 4Q3NA 3Q1KA 1ZK1A 3OM8A 1Q1GA 1VYUA 4N1AA 2MSDB 3VC3A 2W6IA 1P1CA 2XBUA 3CLSD 4QPCA 4DA0A 1M2NA 2WIAA 2GF9A 1KDRA 3OEHD 2BCEA 3BL6A 3CVXA 2E4AA 3S8MA 4PLGA 4TLDA 2A86A 3MOSA 1X1QA 4N0PA 1J06A 3LE8A 1RE1A 3OOWA 5JCJA 4UPEA 3DDSA 4MK4A 3QW4B 3AKYA 1O89A 5A4IS 2CKDA 3QEKA 3REFA 1JFVA 1QB8A 4R9SA 4G89A 4E03A 2NTNA 4F3RA 1I0LA 3NCHA 1C9MA 3FCUB 4NV3A 4WNYA 1BX1A 3SG0A 2JIDA 2CXRA 1RWOA 1OV4A 2A1UB 4RNDB 1PJCA 4NEHB 1JIQA 4RVDA 4M0CA 3GLHE 1G98A 3IEIA 2R65A 4AVYA 1UDAA 1QIKA 4KSBA 3O2QB 5DOVA 1FYFA 1WLSA 3TLEA 2VYVA 5ICCA 4DQVA 4ZO6A 1YZFA 2M9MA 4M8LA 1UBGA 2BJHA 2R44A 4GBED 2YJTD 4DNPA 4X94A 5A9SA 3I8OA 2VNIA 3BSFA 2BKVA 2QMZA 3NTOA 4II7A 5DZSA 1UADA 4RCVA 4YRRA 3PUXA 4EK9A 4ES6A 5DYGA 1TM1E 1WUJS 2HA5A 4F9EA 1QG4A 3QXXA 1O87A 3H4IA 2WTEA 3OOEA 2WWVD 3YASA 2PUDA 2ANCA 1E18A 3FWPA 3O95A 4PZUA 4UAUA 3O1IC 1I2AA 4RE6A 4R3WA 4C0SA 3J81A 4OX9Y 5LD2B 4ITUA 2FNAA 5BOSA 3JQPA 1LI7A 2IEDA 2ABWA 2XDYA 2Q1TA 5IJWA 3QYAA 5C8YB 4NIMA 2HJRA 5TMEA 4YUZA 3FTCA 5A71A 3EP4B 2ZUSA 3FZQA 1SG0A 3DQZA 2Q2QA 4WXYB 5CHEA 3T5PA 3HE3A 1PX2A 1ZD8A 4GWKA 4QG3A 3HL0A 3TOZA 5KYWB 3C39A 3JARA 4KQJA 2QLMA 1E60A 4L95C 2GARA 1N2GA 3IT0A 1M6WA 1RAGA 3KU4A 3P9NA 3H4TA 4URUR 3V4FA 1VLLA 3I8XA 1TQ8A 4K9MA 4CE6A 4NBUA 4PAMA 5FBKA 3ER9A 2ZU6A 3N8NA 2DP4E 2V0CA 4Y2VA 5EAIA 4WKBA 1Y6RA 4BNUA 1N4DA 3R5KA 4BRZA 2C9ZA 2HJWA 3A1DA 4DLVA 5BSGA 5AHOA 4DYHA 4BPRA 1QFMA 2GYWA 2M1XA 3ZDYB 3I76A 3ND8A 4J6FA 4Z9XA 3FMFA 4X1KA 3DYBA 1LF0A 3DOJA 1V0JA 1DBVO 1XQWA 2W6MA 1WMFA 2QROA 3AL3A 3GGCA 3R0QA 5G41A 1GZ6A 1IJFA 1PJ4A 4ZVMA 3WYBA 1JG7A 4KQCA 4V0KA 3WTCA 1HQYE 1QE3A 4QYIB 2B2NA 1U8YA 1K5HA 2BONA 2O19A 5BSEA 3RJMA 4YAGA 3Q8XB 1HBJA 1QR2A 4PYMA 2JJ2A 3VO1A 4L6AA 2X6TA 3E35A 5G02A 5JBQA 1RWNA 2B7LA 3OF2A 4YLEA 4NVRA 1PV4A 1V43A 3OZ7A 3I83A 3B2QA 1O2DA 3D8SA 1ZI9A 5HYVA 2HAEA 2X3YA 2XTJA 3TVYA 2GN6A 1WPRA 1GTZA 3JQEA 1U11A 4FGZA 1IXRC 2FZCA 2VQFB 2QUJA 1V11B 3QLJA 4OQDA 2NZ2A 5H3CA 3BD6A 3WDMA 4YJ3B 4XVHA 2FOIA 2JFBA 3QX9A 3EFBA 1X0XA 1YASA 1VSUA 1DAIA 1YJ8A 3EIUA 3NB0A 3P71T 4JH0A 2R8BA 4Q19A 2BH9A 3VH1A 4C7XA 3TG8A 1R8JA 3H2ZA 4UNNA 1SJ9A 3LDUA 2I5PO 4URZR 4E0BA 3N39C 3RLFA 2XA9A 4TZ6A 1OX6A 3KB8A 5DGTA 1IL0A 1GZVA 4ZI7B 3HO8A 4GI7A 2R8YA 3SS8A 1ZCJA 2ZTSA 1CQZA 3GF4A 4F56A 3IIEA 2O1WA 2PZFA 5KOIA 2XXJA 3DMTC 3ZNNA 1E1RA 2NQ8A 5KAPA 3FDJA 5DF1A 1T9DA 1H4QA 3DDUA 2DHCA 1PSZA 3JATB 3QU7A 4UHDA 1D03A 3O9ZA 5GAJA 2QJOA 2XYPA 4W7HA 4F7DA 2HBRA 3NRJA 3C45A 2UXCB 4O59O 2F4VB 1MVLA 2BFWA 2X14A 4GOND 3A27A 3DW1X 4RYLA 2X8LA 3EP5B 3O4GA 4TQGA 3IUPA 4BO7A 3RTBA 1UBKS 4YJHB 3RVJA 2PFKA 4UTXA 4YRDA 4BU0A 1KOFA 4CL8A 4TKUB 1K7EB 4OKNA 3ZHXA 3KL4A 3AP2A 5C5IA 3EGDA 1TJPB 3BBPA 2ACEA 1IZ9A 3IP8A 2C3YA 3PK0A 4Z6KA 4MYTA 1PFYA 3PX7A 3QPUA 1KDVA 1I94B 5J58A 3NBKA 3D1VA 3PQ2A 4GX1A 4TT3A 4D6YA 1CY7A 5JDCA 1R0ZA 3NMUF 1DEHA 2O2HA 3JZIA 4FDVA 4LJLA 5TV2A 4R1QA 1WV1A 2P5YA 4HDNA 3H05A 3GPLA 5TPZD 4A1FA 1A8UA 3RODA 5J59A 4AJ9A 4PIVA 3F49S 1YRYE 4TLLB 1JAZA 4FUQA 1NXPA 4CM8B 5JXHA 1W87A 3NDPA 4OD0A 4FNGA 2A0YA 1TQ4A 3DDOA 1J2YA 1P29A 2Y0CA 3FCXA 4GL2A 1N1EA 4NHOA 3SX4A 1QRDA 1X0VA 5F98A 1W76A 2FUNB 2HMWA 5E9JA 2J6HA 5C53B 2BMDA 2YJ5A 2Y1OA 2O3JA 4K9SA 3CUWA 4RD0A 5HM6A 9MHTA 3KHUA 4MKFA 1VHQA 4EFLA 3GJYA 2L17A 2Q2NA 5DI9A 5J5VA 4AK9A 5JNSA 2DU8A 2R00A 2J33A 4KDRA 4TKVB 4L3WA 2ZXEA 2G9NA 4B71A 1ODIA 3FPBA 1OREA 5EE9A 5FHQA 3OKAA 4HG2A 2GASA 4XFKA 3NPAA 3CONA 3Q6IA 3RTAA 1M2WA 2AS0A 1MRZA 2ILVA 4NP6A 1JB9A 3ZV4A 4H15A 1MAUA 2ZRCA 1VSQA 1UJNA 1F12A 4EG7A 5EKXA 2WZQA 3IDOA 1CQPA 3B5IA 3LF2A 2C8KA 4F1KA 2LKDA 1N8TA 4MKIA 1XMSA 3QKWA 2F7SA 4UQOA 3VMFA 1O0SA 4PQEA 1V2GA 1JPUA 2B2CA 3GGSA 1E3SA 3ZGVA 3FZGA 5DNCA 1Q74A 4KKXB 1ZSYA 4K6OA 4OVKA 5CTAA 4YRLA 1YK0A 5EMNA 2BH2A 1MG5A 4BMOB 1A7UA 1ISJA 4O2LA 2GMWA 4FINA 1DWQA 3BXFA 2QZ9A 1I4WA 2C2WA 3RBXA 4CTOA 4Z51A 1MAAA 3W2IA 3HJFA 3AG5A 3ZTTA 3O03A 4ZK6A 3TUTA 1BWSA 2YIDA 1LV7A 2IYSA 1WY5A 3EAGA 2PBFA 3B52X 1ZRMA 5H3HA 5B4TA 2VSFA 3MJEA 3MF4A 1XNHA 2RBKA 4G2TA 4LMPA 2DX7A 4AUEA 3V9AA 4ZHQA 3AR6A 1YR7A 1JSZA 4DF3A 2RARA 3FDXA 5CB0A 4IFBA 1ADGA 2PG3A 3B7PA 1ZLXA 4LXYA 3UMYA 1GHTA 5CXUA 1CRZA 1MZPA 2F00A 3L0YA 1CZOA 1YR1A 3QWFA 3UMMA 1H2AS 3P97A 1RRGA 4NOMA 1M34A 4PVDA 4QQ8A 1HX7A 1NT2A 1OJ7A 3CC8A 3P9SA 3LT0A 4IIYA 3A9SA 3WMRA 2PUHA 2P40A 2VNSA 4RANA 9GPBA 5IAAA 1CUUA 4JK3A 3PICA 1J1IA 2JGEA 4D9NA 1SXJB 5LNK1 2AEMA 2WWGA 1U8TA 1VMIA 4HQ6A 4REQB 5COQA 5EGSA 4Z4FA 2EU8A 1HO3A 2ZWMA 1TF2A 3IVMA 2JAUA 3R5XA 4YQYA 5DBOA 3VC1A 1KVUA 1H2EA 3MJFA 1SKYB 2A4MA 3H42B 2B4TO 1NURA 4ABYA 4UTOA 1WXIA 3RJ9A 4LVUA 2UXDB 2ZSEA 3OOSA 1QLWA 3ZJ5A 1LX7A 2FPMA 4DCPA 3OTGA 4IF4A 2NU6A 4HDQB 4CETA 5FI1B 2ZVPX 3RSSA 2AMVA 2PRKA 2Q41A 1A3CA 1L6IA 3M1IA 3TZQA 3WYFA 4Z3OA 3ILXA 1I1QB 3F97A 4EAQA 4XCQA 3VR6D 5G3YA 1NMZA 4AMUA 1BDIA 1D4OA 1RAHA 2GFIA 1VB3A 1X9GA 2GJKA 4HRAA 4K0RA 4EUFA 4WCFB 2V3CC 3B1VA 1EB8A 3KAKA 2XTMA 4G01B 1XA0A 4O2BF 5ITWA 1M5RA 4B46A 3EDYA 1B41A 2GLTA 4KO2S 3BHIA 5DK6A 1O0BA 3ZLBA 1P6UA 3ZY3A 3IAM1 3FETA 3SN6A 3LGAA 4HCJA 3KYBA 1G2OA 1N92A 3I8SA 1W1IA 3ENWA 3ZXUB 1H23A 5DNEA 2J7PA 2QBYA 3LLCA 3S1AB 3IO3A 4DARA 2EZTA 2IYYA 5LMCA 4UE6A 3EPLA 1HM5A 2Q50A 4GBGA 3U3KA 1SXJC 4IAOA 4GXQA 2O14A 2WIKA 1P1RA 3UIEA 4E33A 1QIGA 4H7PA 2P30A 4BBJA 5C35A 1PDWA 1XCGB 2WFLB 4EQZA 3RSZA 4F3NA 2QRVB 3FKSD 1U28A 3G13A 1VM6A 2NYRA 4KRYA 4PS1A 3L93A 3SXUB 2QTZA 4YGXB 1EMDA 3LUBA 3K73O 1CUXA 1E6LA 1XRNA 3BZBA 3CA8A 1EBUA 3FDFA 3GAMA 1Q7BA 5FAKA 4EY8A 3HPQA 3LVRE 2A9KA 3STYA 2QRHA 4C7BA 4KGZA 4O4JF 3D3KA 4QUGA 1LWNA 2J59A 1CY4A 3TSZA 4BV8A 1N2XA 3OLYA 3UF0A 4DEVA 3L6OO 4M8IA 1F14A 2CDBA 3A9UA 4K9KA 4M38A 4CUKA 4BO3A 1LJLA 1KJYA 4D8UA 5LMUB 3FXAA 1BSVA 2QP3A 4MYCA 1T3LA 1DBIA 3CRRA 3MWLA 1OAAA 1QYRA 2Z8ZA 4GYKA 2UUCB 5B7PA 1R6DA 1XKQA 4DV6B 3R23A 2DCUA 4YHHB 1XLTC 1VLQA 2O20A 4HAZA 4AW9A 3MT7A 4BASA 4G84A 1FMCA 3C3BA 4ER6A 1HLPA 3PNKA 7ADHA 4M9CA 3GQVA 1DC3A 2JLVA 5CLIA 2I3ZA 3Q7RA 5IM4A 1QRRA 4KACA 2IWRA 3U7GA 2E5LB 1XJCA 1TQHA 3CMMA 5KJ1A 1DTSA 4MMYB 3C7CB 4HWRA 1BZYA 1JMYA 1PG5A 2XNDD 3G2MA 4FD3A 1Z82A 2CWDA 3LU1A 5EMLA 4YIKA 4GG1A 4JC5A 5FBLB 1QHHA 1RJFA 3JQAD 4X6XA 3TXXA 4D46A 1NVFA 1VFNA 2OHIA 4OQXA 2GCPA 5HP4A 1PWHA 1YCFA 3FCSB 4PZLA 1EGHA 4LHWA 1WVIA 4Y6GB 4MLPA 1ZGBA 5EXSA 2BFNA 4YDHB 5ILQA 2F43B 3EEFA 2XMRA 5ALVA 2IHJA 5IUNC 4ODIA 1W4AA 2V7EA 4BYGA 2QTGA 4MUAA 4JP8A 3RYFB 1XTZA 1TMOA 2Y1GA 4N5HX 4L22A 4MV4A 4QOSA 3DO8A 5FTWA 5I9SA 3RWOA 1TUIA 3DHWC 4BB0A 2HYIC 3I2FA 3LDFA 4MB2A 4ZICA 3OE1A 1I7LA 5E3IA 5C80A 1H2WA 1IMOA 5D3MA 1GFWA 1K7CA 2B2XA 2BR4A 4NYJR 4TN5A 1I6LA 4B4OA 1G55A 3PSHA 2IGTA 4MWCA 1K7FB 1GR1A 3FZYA 5D1HA 3OEHA 3KQKA 2VF2A 4FGKA 1UAYA 1QU3A 2HQ1A 2FSHA 2G40A 3IQWA 4WWHA 4DC1A 4QL3A 1RZRA 1DZIA 4WEOA 2QZZA 4A4DA 2CWWA 2W4MA 3PC2A 1IZ7A 1U98A 1T0BA 3AJEA 3O94A 2BYTA 1A1SA 3V4RA 2GF2A 1J8YF 2ZYWX 1UFVA 4KRFA 3UCFA 2F48A 8OHMA 2Q22A 2CEKA 4Q16A 5HEKA 3GFGA 5F35A 2H2GA 2Y77A 2FPUA 3T15A 4NCAA 3C97A 2OCPA 3GFFA 1JEEA 2F3SA 3EY4A 2ZBVA 3V1NA 4A92A 1BG6A 2BFOA 2O0LA 3TZKA 1IAQA 2XCTB 1G291 5JSKA 3EZ6A 5LLTA 5IDYA 2H4HA 2PH5A 2YXPX 3FI9A 4FS8A 5H68A 2QF7A 5BVHB 1E63A 3ORRA 3SJUA 1KZ7B 1GPUA 2OUKA 3NEAA 4IVPA 4M4SA 3HMQA 1XCLA 2IHNA 3W77A 3B1WA 4RVGA 1ZINA 3W5DA 1BTOA 2WFAA 2RJNA 4PS0A 4C78A 4Q3LA 1B16A 1RLUA 3HKDB 1P9OA 3RS9A 3DMNA 2I6UA 3R3WA 4DXDA 4UOQA 3RQSA 4DSOA 4OMCA 3KEOA 3GQBB 4BFTA 4O25A 4Z1MA 5T3YA 3DE3X 3FSGA 2VJQA 3NG1A 3NH9A 4MQ6A 3KEGA 1ZM7A 2Q6VA 3K0HA 4BIIA 5G1OA 5CYOA 3MWDB 3GG2A 2O23A 1EAYA 3QOWA 2CHFA 1BEZA 2XMGA 2ZQ5A 1CD5A 5D01A 2NPFA 3RTCA 4DUYB 3E9MA 1Q44A 2RK6A 3ENVA 4FZVA 3W9YA 2JD1A 4EFMA 1DC7A 2FWBA 2A0FA 3GZJA 3LIPA 2FPIA 1LRJA 1QH8A 5FAXA 1U8AA 3E48A 5IAEA 4NU6A 4ZYWA 3ODPA 2Z2IA 1EZ4A 3CZAA 2DMRA 5K4GA 1WB5A 2PX4A 4LOAA 2VEOA 4ENRA 2EP8A 1RJ9B 4LZNA 4DVGA 2WJVA 3RSLA 3QI7A 2XVZA 2CDAA 3C7KA 5AESA 3FLMA 4NE2A 4TVBA 5BR7A 1N5JA 5LNK6 2G6TA 2IYXA 3GGJA 4XGKA 1YUNA 3BUSA 4MVJA 1NUSA 1Q0QA 2DT5A 1T0IA 1UP4A 3FOZA 1UP7A 1XAIA 2IZ0A 2XA1A 2HDWA 1GUBA 2V7VA 4FGJA 4G5GA 2OXTA 3RNLA 4Y18A 4N5DA 1UKAA 5F2OA 2FR1A 3N05A 5JS1A 4CKXA 2CVQA 4C7JA 3A7DA 5JYFA 2J5QA 2VNHA 5K0JA 4LBVA 2ZI5A 2R6ZA 3U7FB 1TM4E 5LYYA 4YT5A 4OQZA 1NJ1A 3N0TA 3EVNA 4DJDC 3L7BA 5AM3A 2BDEA 4FT2A 4QE3A 1ABBA 2OCGA 2Q5CA 1X1BA 3D59A 5CLGA 2R6DA 1O1YA 2WMOB 4OQEA 3PJRA 1WBJB 5C3UA 1QANA 1D0SA 1VIDA 2VUHB 3H4VA 4BX2A 1BWQA 5JBIA 1H6BA 4PAQA 5J2UA 3QHQA 1Z0ZA 1XIVA 3OTQA 2V98A 4OJMX 4R2XA 2P75A 2HV8A 5ICMA 3TQRA 4DL9A 2VHQA 4J75A 3KSBC 1UPTA 3Q72A 1DJQA 4ZT3A 1UT5A 4P8RA 3AJDA 5HFAA 4GOKA 3QVKA 3SX2A 2QAGB 3N1UA 4M1QA 5LJIA 4QUJA 2PANA 3FPHA 2O8EB 3NKVA 2BSQA 1IQRA 3DHEA 2PUTA 1G9TA 2YL2A 3A06A 4GT1A 4IX1A 1XTIA 2YCBA 1QG6A 2X4IA 4FQ8A 4GVLA 4A26A 3U3ZA 4YR7A 5KWIA 1KWGA 1CEEA 1ZOPA 5IDVA 4OGKA 3OQJA 5FOQA 1G8FA 1VGQA 4DSTA 4NV1A 4KTTE 3FNQA 4ZQIA 3V1MA 5IKXA 1JIIA 2E6UX 2Q4TA 1CF4A 2NUTB 3HKEB 1WF3A 2V45A 3VU3A 2DOKA 1F7VA 3K1JA 3PL1A 3DOEA 4MWTA 3NHFA 1P4GA 3ONDA 2GCOB 3Q8WA 5J1SB 3FRIA 1I36A 1FE8A 2QT9A 3KLNA 4R0MA 5BWNA 4Z99A 2MDTA 4O4IF 3VYUB 3X44A 2X6QA 4LEIA 4L02A 3L9WA 3BZUA 4Y6PA 5ICFA 1GGHA 3JWEA 1BOOA 1Z5WA 4FDUA 3IWCB 2VVTA 4NE9A 6ADHA 4J9VA 3F9RA 1ECPA 4N39A 1ZRNA 2OD2A 3IOCA 1E4OA 2J3KA 1A50B 2ZR9A 3DBVO 1DOZA 1JENB 1A9XB 1U2QA 2HMUA 4TS4A 3TLJA 1C0EA 2SKEA 4I46A 3ZHUA 1CRPA 2WB4A 3JQDA 3PDWA 4QPZA 1AGXA 3G5LA 5BWOA 3VOSA 2WLSA 2LE0A 5BV7A 5JARA 1PKEA 1H2RS 3AXTA 3VPSA 1T2NA 4KDEA 1YXMA 2GCOA 2GYYA 3D0RA 3ZS9A 4EO7A 3MSXA 1CB7A 5B1HA 2W6ID 4JR2A 2FEAA 4YECA 4C7OB 1A5TA 2X41A 4IDOA 1C7EA 2IT1A 1SZDA 3ILVA 3A26A 1W36B 3IQHX 2WHPB 2POQX 1EFPA 1T9CA 4IOKA 1J6UA 2EERA 2EKBA 3HA7A 4KXNA 2ORYA 4LQ4A 3NT4A 1NW4A 1CP3A 4Q3KA 1ESNA 1E1DA 4IRXA 3IH5A 2IYLD 4KLRA 4Q4CA 3NFYA 4TKVA 1T0HB 3PQ3A 5EP4A 3NBYC 3ZQ4A 4E2WA 4QC2A 4CMAA 2CJPA 2JCGA 2VHVA 1VXOA 4GPTA 4QHSA 1BHO1 3C6YA 1ZCZA 1WSAA 1OWLA 1T3GA 3DVRX 3W1VA 5KBYA 5HF6A 1DPFA 2PT7A 1A2QA 1OSNA 2CCGA 3MQFA 5LZ5A 3KEFA 3JTEA 1FNCA 2D7DA 2X8BA 2FPNA 1TF5A 5I3CA 5IAGA 2I80A 3IUMA 5KYVA 4FFBA 1AGRA 3ECSA 4FLMA 3SHFA 1SKAA 3IOBA 1TU4A 1NPYA 2WKRA 4POAA 5JPDA 1WQ1R 2IDZA 2P9TA 1CNEA 3LYHA 3NXKA 5EZYB 1NVGA 4B2LA 1VBNA 1M2HA 3G23A 3P0HA 2FFAA 1R88A 1RJGA 2ZETA 3C2QA 3DJFA 3T3DA 4B33A 2ZUEA 2BBTA 3EDRA 1Z6XA 2WSYB 1O95C 2NSJA 1ZISA 2Q3FA 4QXOA 2XYHA 4LYFA 1ST2A 2AFHE 4PFKA 2VYVD 4GM4A 5CH5A 3R75A 4RMHA 2ONYA 4IH4A 3D4BA 4Q66C 4KN6A 5EGNA 1LD3A 4RAOA 4OH1A 3JWJA 5K6RA 5KNCD 1T10A 1Z6QA 1CJKC 2GR9A 1CW2B 1SBIA 1MGOA 4IQ0A 1LDNA 4RK5A 5FKJA 4BTVA 1JHVA 1G8PA 1W36D 3AVVA 2GCEA 1POXA 3OP4A 3ZIUA 1W6UA 1XE3A 2OD7A 5EJEA 1WR8A 4P7BA 4RVUA 4DKXA 3SEQA 1DX6A 3PCTA 3RCBA 1QCZA 3I2JA 1A1VA 1KOLA 2H1HA 2W98A 3OQNA 3DO6A 1OU0A 4GX0A 1JJBA 4Q4DA 3RRYA 3M2TA 1NF9A 4UUAA 4QDTA 5CPFA 1SELA 3PKJA 5TQ0B 4B8YA 2HWXA 4HV4A 3NIGB 4CTNA 3EXHB 2WF7A 4PX5A 4K6CA 3PC4A 4E21A 4IDNA 4Q01A 5ANRB 3M2PA 1IY8A 1NFQA 1NXSA 3B51X 3OZTA 3MS2A 3V46A 2I33A 4AJIA 3EVEA 3JAKA 4TTPA 3ZXIA 4K0KB 3FLEA 3GMSA 2I4IA 1QONA 1MPTA 2NU9B 1V3VA 2WSSA 3WZMA 1I7DA 4DKJA 2AE1A 1KMMA 4U9IS 5LQMA 3K8QA 1WW2A 3DVAB 2AHRA 2OT3B 1JDVA 4ENPA 5T4EA 1VCOA 4RF5A 4COOA 1AKNA 1E1QA 1VLMA 1X13A 1XA4A 1B6SA 3WVNA 5GVSA 2C3MA 4TM7A 3SM3A 2ZJ4A 1FTWA 4J43A 1F8GA 1IUPA 2C4HA 1V8ZA 4TV8A 3UW1A 1UK6A 2AR0A 1QCCA 4M9RA 4MJ7A 3QV1A 2VCHA 3O47A 2QTFA 1EPUA 5CH8A 2AOUA 2Y68A 4AMYA 3TBFA 2E1PA 2Q3CA 4DLSA 2QM3A 4MQ5A 2BUBA 5EZ6B 1GR0A 3A1WA 2GM3A 2B30A 1NLYA 3OUTA 4TXLA 5FPPA 2ESRA 2GBFA 3OFKA 3WFJA 5FH9A 3CUKA 1DKPA 1IN6A 2BOVA 2GZMA 2SECE 1V4NA 5J4HA 1K68A 2ZRPA 3BIXA 4EA9A 2FEOA 5IUJC 2JI8A 1KJZA 1MH9A 4LY3A 1A71A 1E58A 4JVLA 3E1KA 3ZX4A 4KQ9A 2H63A 5C7IO 5KJFA 3R41A 3VJLA 1QP7A 1JHQA 2GUGA 3ER6A 4E5VA 3WNQA 4UOZA 3TUZC 3IQFA 4KXLA 4LWQA 4DLXA 3KQTA 1K08A 1U6JA 4U1RA 4MVYA 3ABRB 1ECFA 5DWVA 1FS4A 7AT1A 5CBPB 4HO1X 5B7NA 3UANA 5I7WA 1S1MA 3W5AA 3W6UA 3GLFA 2OV2A 4ZANA 1DBSA 3ZGNA 5BN4B 5LOVA 2FCAA 2DVMA 1ENOA 1OF1A 4ZOLA 1XB2A 2QSYA 1I5EA 4WLVA 2DKOA 2Z3WA 4OSOA 1OH6A 3C5EA 4DQLA 3NXSA 1Q19A 1MO5A 2XHZA 3H16A 4KODA 4D5GA 2WDZA 1D9ZA 1VG9B 2QN2A 4M0EA 1IG0A 2ZJ0A 1EFUA 1RI2A 3FMIA 2Z5VA 3L2OB 5IC5A 5J9FA 4RHTA 4B48A 4L5YA 1EG2A 2C2YA 1J7KA 3D9QX 3Q3VA 4KN5A 4Q1EA 4P92A 2E4XA 5GMOA 4DCSA 1BXRB 1O77A 1YFKA 1QC5A 5DGDA 3HYRA 2FW1A 3DUFB 3IT3A 3R7WA 1QYDA 1JLRA 4BLUA 2WMYA 1RABA 1FVXA 3KQHA 2PKQO 1T1SA 3E81A 3HJUA 1J5PA 3EIQA 2P1RA 3UH0A 5I51A 2H3EA 2DF8A 4XEUA 3S29A 2B35A 3IBFA 4AROA 4YMGA 5EHZA 4J7CA 1FU4A 1MX1A 2VDVE 1JF8A 5JSHA 2G70A 3VUEA 2VR1A 4BNDA 2QRUA 5MGBA 1AT1A 1IWBB 1IPHA 2AGVA 3O9VA 3IUNA 3PEEA 4FFPA 4M1WA 2DBVO 3A4MA 1C8BA 1R3DA 2FLKA 2YWBA 3DAHA 3IQZA 3SC3A 3VO8A 7GPBA 5MN6A 2OWEA 3L05A 1E0SA 4RA6A 4IIXA 4XARA 1N7HA 2VHJA 4HL6A 1UDRA 5AKYA 4ZDWA 3WO0A 1OLSB 3NEJA 2EATA 1XLUA 1COWD 3K0CC 4CIAA 3OM1A 5ALTA 5K8JB 3HXQA 3OZVA 3EPRA 1HE2A 1XTSA 4FGUA 5AK0A 1A72A 1AGYA 3W1WA 5JY6A 2ID7A 3L8ZA 5KX5B 3MUFA 3H7AA 1SWWA 2WSLA 3BG5A 2BGTA 4JFRA 3P9CA 1Y9ZA 4DV3B 1N5LA 1U4NA 2FPGB 4R7GA 5GONB 4US1R 3WGOA 4ZEXA 1W85A 2O3UA 4GMKA 1ZD4A 1GKUB 2YJ6A 3F71A 1Y9DA 1O4WA 4C6RA 1QRSA 1Y33E 4WVFA 3UC5A 3L43A 1J9ZA 3RNOA 5E3JA 1RLIA 3FCAA 4RVSA 3QVTA 4IXMA 1YUBA 4WGFA 3U9LA 4DM3A 2IYPA 4RY8A 4LC9A 5GV8A 4HMPA 3LCMA 3DTTA 3P0FA 4I8DA 4L5AA 3WIUA 4B1FA 1XN1A 1FSZA 3DMPA 1ZGGA 1U8ZA 2V96A 2XNHA 3L8MA 2R5NA 2WJAA 4HB4A 4IZIA 2FW0A 2ZIUB 3VSAA 4QDKA 1JHYA 2B1GA 2V5AA 3DCJA 4KBYA 2AX3A 3WY9A 1BVHA 4AP9A 3TLCA 2PT9A 1VIMA 1DRJA 1XU9A 1RAAA 4Q05A 4YV0A 4RFSA 4ECAA 1A82A 1WO8A 3VHQA 3W5SA 5JQGF 4RLSA 2NXCA 2XTZA 3WTBA 1AMOA 3GA0A 2PXCA 4L3OA 4EAAA 1IN5A 4DMMA 3Q10A 2SNIE 3LG2A 3KQPA 3VMMA 4WEQA 2AZTA 3N59A 1S6YA 1GP2A 3H1BA 4KWTA 4PU0A 2OBYA 3OESA 4DQKA 1OC4A 1XLTA 3L8CA 3D8HA 2OR3A 4PFSA 3UMRA 5JXJA 2AFHB 1PDVA 2BRUA 2UZIR 5LYJF 5C52B 1UPXA 2AEEA 1T5SA 2HIMA 3LXXA 1Q3HA 4CM4B 4DA8A 3SJCA 5LKRA 1KH2A 1MP0A 2JZNA 3E7PA 4N76A 2WM8A 1AF7A 2PIAA 4KNYA 3I05A 1NYTA 2F17A 2XWPA 2Z30A 3AMVA 3C70A 4HEA1 2O3TA 1E2DA 1K06A 2VA8A 4RIIA 2QORA 3KKZA 2ENUA 2EX4A 3OFVA 4BMVA 5DEIA 3QG1A 1W44A 3EUFA 5DX1A 4MQFB 3HDQA 4ROTA 4XJTA 5ARCA 1MOSA 4AZ0A 2G88A 2H3HA 2Q6KA 1HRDA 2WMNB 2ZIFA 4MQFA 3ME5A 1W35A 4Y1EA 1OFHA 2O5VA 3ACDA 5KWSA 2XUQA 1JAHA 4E46A 1VHJA 2JB9A 5CAEB 3F3SA 3LY9A 4R16A 1U2PA 5JAPA 2PBRA 2PEZA 1GV0A 2PMCA 1M72A 1YNSA 4OK5A 1UZAA 3ABOB 4TOIA 2JLYA 3FJ1A 4WNCA 2P27A 4ZPXA 1FUYB 1XDWA 1ABFA 3AESA 4YXWA 2VDOB 4P38A 5FNZA 1NZDA 3X43A 1G8JA 3EDOA 5CDUA 5LUAA 1J22A 1RWVA 1ZD5A 4N6GA 3JQ6A 4RO0A 2GNOA 3ABZA 2R5FA 3L7OA 3OZFA 4UW9A 4G24A 3IILA 3B1XA 4H0NA 3O26A 4GOJA 2NP7A 1TVEA 2A0WA 3S3TA 4EYEA 4PZCA 1K3FA 1POWA 4F0JA 3COWA 2C99A 4Z0TA 3EXG2 4M7WA 3FHCB 2QXYA 3P2KA 3PGJA 1M6VB 4D45A 1E2KA 3DT9A 1LH0A 1DEAA 3EFEA 3QKUA 3EVDA 4IHKA 4AZTA 3HN6A 1B43A 1HI9A 3C98A 3I5AA 4MRRA 1SIOA 4DLPA 1NKSA 1JW9B 2I71A 4OP3A 1WIWA 3DPIA 1RQXA 2CSUA 1O4VA 3IESA 1JQDA 2RHMA 3JYPA 5LXTA 1DEXA 2FN9A 1IBLB 4LXHA 3GZNB 1FFSA 1C7IA 3SP1A 1XC7A 2CDNA 1TIPA 5F5NA 4ZI2A 2BZ1A 2XF8A 2RGNA 1VJ1A 3EULA 3IQDB 4OK3A 4DLTA 5JI2E 3ZDZB 1V8BA 2AJLI 1JZTA 1AQIA 1O5OA 1MB0A 1RACA 1DAPA 1ZI8A 2BI7A 1JEQB 3LTEA 4MDHA 1JX6A 2I67A 4A1OA 5AR1A 5HPYB 1VG8A 5LM3A 2QX6A 4Z9AA 4HYYA