4R5MA

Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with nadp and 4-nitro-2-phosphono-benzoic acid
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
369
structure length
369
Chain Sequence
MRVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIESLKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHGIHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVINDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEEWKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRRTLRIILAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase 1
publication title A cautionary tale of structure-guided inhibitor development against an essential enzyme in the aspartate-biosynthetic pathway.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Oxidoreductase
total genus 126
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2014-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4r5mA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4r5mA01
1YRLA 5JDCA 2ZJ0A 1GV0A 5F21A 3L4BA 3NAQA 3VDQA 4BVAA 4J16A 1H93A 3MJ4A 2PLAA 4B79A 1CDOA 1BMDA 3LT2A 1NR7A 3LF1A 3TZQA 5KJCA 1QLJA 3VZSA 2VTDA 3JYOA 4WNIA 2YV3A 4PLFA 2GZ2A 4GAEA 2HRBA 1N9GB 2BFPA 2AQKA 3QWBA 3RI3A 4BNMA 3JQ9A 5FI3A 4YRBA 5JYEA 1R4NB 3WGHA 3LC7O 3D0OA 4OOEA 4R1NA 3EY4A 2NUAA 5KJ1A 4Q3AA 4AVYA 3IQDB 3KBOA 1XA0A 5IG2A 3BMCA 4EJ0A 4DC0A 1U5CA 1NFFA 3QLJA 3P7MA 1HZZA 1U1IA 3GGOA 2NADA 4FJ0A 4NBTA 2D1YA 1JVSA 3I9JA 4KUGA 4PVCA 4KQWA 2NVWA 3IOYA 4PLPA 2RH4A 5ADHA 4CM4A 2B0JA 5F1KA 3F47A 1B14A 3ZW9A 1RWBA 4YBZA 3T4EA 4LCJA 4Z9FA 1I32A 4IQ0A 2Q2QA 2GRAA 4JK3A 1DPGA 3K8ZA 4KUEA 1K2WA 1R12A 2EJVA 5EQDA 4CM9D 1SO8A 1EEHA 3KOUA 3M2TA 2RHCA 4Z0PA 4ALKA 4DC1A 2VTEA 4J0EA 4JP3A 4NIMA 3F5SA 1I36A 7MDHA 4RLHA 1SB8A 4Q3DA 3GDOA 5AVOA 5G0SA 2YHIB 2AQIA 5JW6A 5JLAA 4ALIA 3JD4A 4PLVA 2O3QA 1MLDA 3ZDFA 2VYNA 1U28A 4ONEA 3ZW8A 1KERA 3GAZA 4KDEA 3ZWXA 4PG5A 3PXXA 3CSDA 5I7VA 3FNGA 3QP9A 4W7HA 3AM3A 1PJ3A 4QX6A 1YONA 2DUWA 3AI1A 3CUKA 4RQTA 2Y68A 1Z7BA 3RUAA 4DIFA 4DYDA 1R4MA 1TI7A 3JQGA 1Z82A 3OJFA 3PFWO 5COBA 3DAFA 3UCEA 1YO6A 4YVFA 3CKYA 4LSWA 4R41A 3HUDA 2ZK7A 3BMQB 3F5QA 4IJWA 4AFNA 1B2LA 4IDGA 4GBJA 4IJKA 5ITWA 3EK2A 4CM8B 1VI2A 2CDAA 3C24A 1QKIA 2GGSA 3PIDA 1SEPA 5GZ6A 1XCBA 2NWQA 2O2YA 2DBZA 3L9WA 1I3KA 5I9LA 1OBFO 2AW5A 2HMVA 3WGYA 1UDAA 4CL3A 4ZJUA 2BH9A 4E5PA 5JYFA 1E1NA 3RBXA 3GVHA 2W90A 5U1PA 4UVGA 4HBGA 4BUCA 4IDBA 1U4SA 3HFSA 1SCUA 3VH1A 4GVXA 1PGNA 2RCYA 3HDHA 4R3WA 2WD7A 1DEHA 4YR9A 1R15A 3UCFA 4GX1A 1PQPA 3RC7A 3H9QA 2BD0A 1AXGA 4YRAA 1P0CA 1PZEA 3UHAA 3M6IA 3X2EA 4CMEA 4OGWA 3A9WA 4HNHA 1E3EA 5JYAA 3U09A 4FOOA 4E0BA 1BDMA 2JL1A 2OORA 2ZTLA 5DOVA 1LX6A 5JY1A 1K5HA 3K96A 2H1SA 3C3XA 2HO5A 3EC7A 3AK4A 5CDUA 5TX7A 5IZCC 4D3DA 2CVZA 1KVRA 3PHIA 4XIJA 3RUDA 4E5MA 1ADFA 3UUWA 3AOGA 4EBFA 3WGOA 4R5HA 4EUEA 2CF6A 1E3WA 2V6MA 4YAKA 4J4HA 4OM8A 2GN4A 5EINA 2ZB8A 3FNEA 3IDSA 4XR9A 5EN4A 3W4IA 5KVQA 3UAGA 3SC6A 4B3HA 3I9OA 3IJRA 3U5TA 1H9AA 4CMIA 1PQWA 3B1FA 1F06A 4M87A 4QTZA 2FN7A 4H7PA 3GLQA 3LC2O 3RIHA 1EVIA 3GGPA 4O59O 3LQFA 4A26A 3KEQA 2E4AA 2XXJA 4B7CA 3VDRA 1U8FO 3RU9A 4AG3A 1CQJA 4LMPA 2FMUA 4A5OA 1Q7BA 2I3GA 1JVBA 8ADHA 3DDNA 1GEGA 3OEYA 3IL2A 3DBHA 3R6DA 3NDRA 2GUGA 2ET6A 1B3BA 3L6OO 3F1KA 3GDFA 1YQDA 1K3TA 5DBFA 4EDFA 2TMGA 4BKQA 4J9VA 4D79A 3K73O 2Q50A 1JKFA 1JAYA 4J2HA 1NQOA 4YTEA 3T4XA 3KUXA 2P9CA 5I9MA 3FSRA 5B37A 3BYZA 3ZV5A 1GPJA 1KY4A 5DCYA 1Y6JA 1QYDA 4HXYA 3DOJA 4IXTA 4TROA 4DGSA 1O9BA 5KTKA 4YJFB 3ENKA 4XKJA 3CH6A 5EJ2A 2JD2A 1ENPA 1JTVA 4L73A 1TT7A 3MEQA 2EWMA 4IINA 4D3FA 1WZIA 2D5CA 2YHUA 3H5NA 4XJSA 3PYLA 1ZCJA 2HDHA 3ZNQA 2GLXA 3ZNPA 6ADHA 3LSYA 3WG9A 3ZH2A 3FWZA 3LZ6A 3WBBA 1LNQA 2VUSA 4TKMA 4UULA 3SC4A 4FB5A 1YJQA 2EW2A 3GUYA 4IIUA 3O8QB 1CIVA 2CD9A 4L4SA 1YWGO 4HFRA 2HK7A 5T57A 1ZXBA 4JJFA 1J4AA 1VRWA 2UVDA 4FCCA 4HFJA 1BHSA 4XGIA 3VKVA 1P1HA 2FRDA 4ZQBA 4EYEA 3FR8A 4BV8A 1MB4A 3D3WB 3BTOA 1ZH8A 3AY7A 1XHLA 4Q9NA 1D4FA 1A7KA 1RM4A 1C0LA 5KVVA 1VLLA 1B26A 1NFRA 4I9HA 3NJ8A 3WTCA 4TRMA 1BVUA 5JAIA 4WNCA 3L4SO 1LSSA 1O5IA 2JJYA 1I5RA 5T67A 4L4XA 4RPLA 4DA9A 2JCVA 2X1HA 4WKGA 1I3MA 2Y1EA 1IUKA 2FZWA 2QG4A 1MXFA 4ZD6A 1XWFA 2WE7A 4WCFB 3Q9UA 2J3IA 2WEKA 5B4VA 4W6ZA 3OIDA 3JQFA 3EMKA 2VNSA 3KTDA 2GDZA 5K6AA 4ND1A 1NP3A 2YZ7A 5DBGA 3GFGA 1PGJA 4B3IA 1P33A 1M76A 3D7LA 3QVTA 9LDBA 1ADCA 4TVOA 1UZMA 4D45A 3OJEA 1QORA 5EQFA 2O3TA 2EKQA 4YACA 3UCXA 4F3YA 4I5GA 4XQEA 5TSDA 5IDXA 1FK8A 3E6AA 4MKXA 2VNAA 3M2PA 4TRNA 1M75A 1RYEA 3RFXA 1GZ6A 2NQ8A 1VSVA 1KIFA 2OBNA 1Z73A 3W8FA 2CVOA 1JLLA 4UEJA 1DHRA 1S6YA 2EEZA 2R2GA 3D3EA 1V3VA 4GX5A 1LLDA 1TT5B 1L7EA 2GN9A 3DXFA 2IRWA 4RORA 3EGOA 2JFFA 4JCOA 4OXKA 4RVSA 2ZYAA 3E48A 3NDJA 5JPIA 3DOOA 1W73A 1U3VA 3EYWA 5AYVA 3WDSA 5BSHA 1ISFA 3BTSA 4U7WA 4ZQFA 4UUMA 5B4TA 1J5PA 4HNGA 3S2GA 2IDZA 4QECA 1NQAO 2C5EA 4XZ3A 4GMFA 5A3VA 4YB8A 5A03A 2PGDA 3PGXA 5I8WA 3IKTA 2P68A 3GAFA 4P4GA 4OQZA 1ZBQA 4CR8A 3QWAA 3E1KA 1KOLA 2PKRA 4E4YA 5EERA 4MVJM 2RIRA 5L45A 4ZHSA 1LUAA 2CMDA 3JQ8B 3PWSA 3F3SA 3GHYA 4LGVA 2O3UA 4FJ1A 4IZIA 3BMOA 1E92A 4Z3DA 2WYWA 3BMNA 2EERA 1ULSA 2QYTA 1SZJG 3LVFO 3RFVA 1F17A 1HDRA 2DTEA 1CERA 2OL4A 3GVCA 3WICA 3C8MA 3K5PA 3AU8A 3KYCA 1QG6A 4CM5A 3H4VA 4B8ZA 1GCUA 5TNXA 4PLHA 4ZICA 1AGNA 2CUKA 4AJOA 4OSPA 1EZ4A 2I9PA 3EHEA 2OXIA 1DSSG 4PLGA 4D41A 3SLGA 4I5FA 2OHXA 4TSKA 1MP0A 1LC3A 1WVGA 4FDAA 3WFIA 5L7YA 4N5NA 4XGKA 4DPLA 2BGKA 4Z9YA 1Z6ZA 4CLRA 2HU2A 3AY6A 4MVJG 3DZJA 1XYGA 2V65A 3BHIA 4AJLA 1IZ0A 2C5AA 4HV4A 4CLOB 2V6BA 3E5MA 3M1LA 4UEOA 3HJAA 4N7RA 1EE2A 2C59A 5TC4A 4UAGA 3FRJA 2GYYA 2PA3A 3ADPA 2DQ4A 3ONDA 4KOAA 5L51A 3H2SA 1C0PA 3G3EA 1PZFA 1NR1A 1GCOA 3P2YA 4XYBA 3QJ5A 4DQXA 2XOXA 3GN2A 3I9NA 2EHDA 2WYUA 4CMKA 3PJEA 4OXYA 5K9ZA 3TNLA 2OMEA 4AJIA 2BGMA 4QQRA 4ND3A 2VRBA 3R1IA 4AJ4A 4DQUA 3MOGA 4KWIA 3ZHYA 3DBRB 3TZKA 4ROSA 4E2ZA 2X5JO 3GG9A 4XR4A 1EK5A 1DDOA 1U2GA 5J9GA 2X6TA 2J3KA 3H5RA 1Q2XA 2J5RA 3TL2A 4CR6A 2BMAA 1N9GA 3FN4A 4OXNA 3G1TA 1LDMA 1ADGA 5F5NA 2FWMX 3TOXA 3I4FA 2H63A 4CQLB 1ZFNA 4AJKA 2X5KO 4MKZA 5A06A 1DIGA 1DLIA 3U62A 3HWRA 4MP3A 3H3JA 3NEPX 1HSOA 2PZJA 4FFNA 1AXEA 2DKNA 3ZU3A 1PL7A 2X0RA 3L0DA 3FCOA 4BIIA 1AHIA 1K6XA 1LLQA 1ENYA 3WTBA 4M1QA 1DAPA 1WPQA 4ALLA 1B15A 3B70A 1V9LA 2AEFA 4J7UA 5ILOA 3EDMA 4CLDA 1BW9B 5IZCA 4TRJA 1BWSA 4CUKA 2PGJA 1FXSA 2PR2A 1ADBA 1QP8A 1Y9EA 1Q1NA 2OFPA 3PQFA 4NJMA 4BO7A 5BSFA 5JO0A 3W4JA 3DEYX 4ND5A 1GYRA 3WLEA 3E9QA 1HDXA 4P8RA 5F1PA 3VVCA 3OQ1A 1U5AA 4YT5A 2DTXA 1PGQA 1T2DA 3KYDB 2Z5LA 3V2UA 3BAZA 3HN7A 1U7TA 4DBZA 3LF2A 1B0AA 5JCJD 4Y9DA 4CLHA 1ZK4A 1LDEA 2EKLA 1P1KA 4PG6A 4R9RA 4EI2A 3RROA 1CJCA 2CSUA 2G5CA 3DO5A 3VPFA 1XR3A 2ILTA 2UYYA 2VYVA 2B36A 3JYLA 4UUOA 3ZWPA 3D5QA 1A9YA 3PI7A 2I6TA 1RJWA 2Y1GA 5F5LA 3M1AA 1Y8QB 4WUVA 2VWQA 2BFOA 2JCYA 2P2SA 3OECA 4MPDA 5CAEA 3O26A 2HKIA 3KXDA 1ISGA 3FTNA 3IJPA 4RZIA 1N2SA 3AUSA 5L4SA 5ICMA 1EK6A 2HCTA 2HLPA 3VVBA 4FSHA 4CM8A 5I7FA 1DLJA 2VWGA 3DQPA 5DP2A 1FDTA 5ITVA 3AFMA 2IYPA 4A03A 2AE1A 1B8PA 3W8DA 2BKAA 4FIZA 2GN8A 3LU1A 4YXFA 3QQPA 1F12A 1GTMA 1YBAA 5L4NA 3PJGA 2B35A 4WOKA 1I8TA 1XG5A 2F00A 4FFLA 1YDEA 1KEWA 3CXRA 3KHUA 3U4DA 4CMAA 3GZNB 4J1TA 5LCXA 3HDQA 1EVJA 5HS4A 4JBIA 5KOIA 1PJBA 4BNTA 1O8CA 1YVEI 3GF4A 1Y1PA 4NDNE 4R51A 1PS9A 2PZMA 1U8XX 1JDJA 4NZ9A 4L8VA 3MOIA 1I24A 4J6FA 4GLOA 5HBRA 1GFSA 1E3SA 4ZRNA 1KY5A 5F1OA 3DMTC 3BTUA 1PJCA 4RF4A 3ASUA 1HLPA 2YV1A 4BMNA 4R68A 2YQ5A 4BGEA 4DREA 4YT8A 5K6AC 2AHRA 4OAQA 3ENNA 1S7CA 1LRJA 3GR6A 4P4NA 4XIYA 5A02A 3WGGA 1P45A 1KEUA 4RF2A 1PU2A 1LI4A 2FY8A 4Z6KA 3PVZA 3JQAB 4UUPA 4WLEA 2DU8A 1P0FA 3P2OA 4IDFA 4E6PA 3U4CA 3GFBA 5THKA 2AQ8A 4JNKA 1TVEA 4IGFA 4DIOA 1GEEA 3PLRA 1VJ1A 4RGBA 1D8AA 3MJTA 3COSA 2VHYA 4F6CA 4XYGA 5JO9A 2B5WA 4ZQHA 1DC5A 4EJ6A 4O63O 3PDUA 2HJSA 1A4UA 5DBIA 3E82A 5HS6A 2VRCD 4YJGB 2OO5A 2C20A 2YJZA 2GD1O 1HYHA 3HDYA 3JQAD 2EKPA 3I9KA 2RHRA 3NT2A 1YGYA 3X2FA 4B4UA 2VZ0A 2WTBA 4CUJA 3OJ0A 5MDHA 4FFMA 4DL9A 3ZWWA 4RVGA 4D7AA 2A9FA 3WMWA 3L07A 5T8KA 1NPYA 1KVQA 3QVWA 3OSUA 1MX3A 4AJEA 1ZMOA 2NLOA 3O38A 5JXWA 3BHMA 2AQHA 3IUPA 1YQGA 4KQXA 1SEVA 1YB4A 1DC4A 5F3RA 3UH1A 1ZJZA 2QRJA 1SC6A 4BKRA 4YT4A 1NWHA 5B4UA 1KVUA 1UP6A 4RO0A 1T26A 1UR5A 3G49A 4F46A 3PHGA 2UUPA 1DC6A 1PJTA 1XU7A 3ONFA 3SEFA 2FHSA 4XX0A 1BSVA 4EUFA 2BFMA 4ZN6A 2NNLD 4I8XA 2ZB4A 2G76A 1ONPA 2VHXA 4UVHA 5H81A 1ISJA 2W98A 3AI3A 4CQMB 2CY0A 1BTOA 4GSLA 2W8ZA 2QIOA 2Y99A 3F1LA 2YDYA 4FPXA 3VH2A 5IDYA 1A27A 4EJMA 3HB4X 3NGLA 3IMFA 2XXBA 4RL6A 2QRKA 1ZEMA 1NVGA 3A28A 4GKBA 1JU9A 2FSSA 3JQBC 2PKQP 4JN6B 4K1LA 3U3XA 4WLVA 1ARZA 1NYTA 4S3MA 5HWSA 3B6ZA 5AXAA 1B16A 3B20A 3OHSX 4PRLA 1YB1A 4FC7A 1E1MA 2B69A 1EDZA 4CQMD 1J49A 1DOHA 4HFMA 1DRWA 1NPTO 1GZ4A 3TN7A 1ISHA 2O3SA 4GL4A 3R3JA 2Q46A 2E6UX 2D5AA 1ORRA 3RCBA 3ZWCA 3F9IA 1N8KA 3EVNA 1EVYA 3EW7A 1OAAA 2FPGA 5JYDA 3HZZA 1DRVA 1Q7CA 3JYQA 4X54A 3L9XA 4EITA 1M6HA 3PDJA 4BV9A 5JBIA 1E7RA 3H65A 3ZV3A 4FBGA 1ZSNA 2Q1WA 1OI7A 3DZHA 3AI2A 5DT9A 2ZJ1A 1R0LA 4BO4A 5LC1A 5L7TA 1PJSA 3U49A 3PQDA 4DWVA 1E6WA 4MVJD 1UDBA 2I5PO 2OOSA 1RM3A 2X9NA 2JAPA 2X22A 4FR5A 1WAMA 2X86A 1E1KA 5GZ1A 4L9RA 3BA1A 1C1XB 2FZEA 4FW8A 4A0SA 2WWRA 4G2NA 3RU7A 3UKOA 5L9AA 2E82A 1PR3A 3NT5A 2PTGA 4BNHA 1TEHA 4BO3A 1TT5A 4YPOA 2EGHA 1T4DA 3NJ4A 3P19A 2VWHA 3RC1A 1IL0A 5BSEA 4GMGA 1FJHA 1ZVMA 3PEFA 3NYWA 3UFXA 3FF4A 3INTA 3CEAA 3WGZA 1K6IA 2IXAA 3WLFA 3ANNA 4LSMA 3KVOA 4BKPA 3FPCA 2ZTVA 4K6CA 4IQ8A 3DZIA 4NPCA 4IJUA 1NNUA 3PZBA 1NTOA 1LC0A 5G4KA 1NVTA 4IJVA 4CV1A 1UAYA 3AOEC 4LRSB 1KEPA 4O1MA 2P5UA 4BNNA 5A1TA 3PQEA 3RKRA 3UXYA 2FR1A 3VZRA 1I01A 3B1JA 2NVUB 3IAHA 3JQDA 1Y9AA 4YJHB 5DN9A 1HT0A 2Y67A 1BXKA 4RDHA 4YAJA 2NU6A 1T2FA 1QYCA 3TFQA 3QIVA 5CPFA 1EMDA 5KCZA 1XGKA 2JFGA 2P5YA 4Z0TA 3PTZA 2OUIA 1U4OA 5CDSA 1UXHA 2VN8A 4IMRA 1JA9A 3QA9A 4IXWA 1JKIA 4YT2A 2R00C 4W7IA 1TB4A 1ENOA 2H9IA 4A2CA 1C0IA 1NHWA 3OIFA 4K9DA 3ZHZA 3ZU4A 2XF8A 1F8FA 3WMXA 1W0CA 4QFCA 1J0XO 3EZYA 1A9ZA 5IDWA 3V1TC 2YUTA 2I99A 1FMCA 4H3VA 4FN4A 2JHFA 4F6LA 5J23A 3S2FA 3ZU2A 3WWZA 4JROA 1KETA 4XQCA 4UEKA 2F1KA 2VQ3A 4EZBA 1CQIA 1MC5A 4MJLA 5FFFA 2FSVA 2Q4EA 1C3VA 3CZMA 4CLOA 5FEUA 4R16A 1IHYA 1X15A 1VPDA 3JTMA 3RAJA 3OH8A 4BO1A 4BO0A 5I8ZA 3PYMA 2RAFA 1GAEO 3OF2A 5ICSA 5BNIA 1GQ2A 1YOVA 3JQEA 4BGUA 1FF9A 4IDCA 1ZK2A 3OMLA 1IULA 1PWXA 4NBWA 1RKXA 3DL2A 3KETA 2C7GA 4KTTE 2Q4BA 1H0KA 3QV1A 1I0ZA 1PS0A 2ZTUA 3DBLB 4N5LA 4QEDA 3TOZA 2QYSA 2BHLA 4RF5A 3VPHA 4M55A 3B1KA 1X7GA 2O3RA 3TL3A 4PG8A 1PR9A 2DBQA 4EEXA 4YAGA 4ZGWA 1ENZA 3OJLA 4WPGA 3F46A 1H6BA 3DBRA 1Y8RB 4CM4B 1CWUA 5L7WA 3DMYA 4NFHA 1LEHA 1WMAA 2BI8A 3GPIA 1U7HA 4JXKA 1V6AA 4E31A 2OZPA 3V1YA 1MGOA 1HEUA 1WMBA 5TT1A 3T7CA 4CM7A 2VOEA 2PZLA 4PLCA 2EF1A 3QSGA 3DONA 1GV1A 1LSJA 2W2LA 2Q1TA 5CDGA 1H6DA 3TQHA 5C3MA 3DMTA 4IMPA 2CVQA 1LXCA 4WE3A 1F0YA 5ENVA 2PD6A 1ONOA 1XIVA 1EUDA 1JWBB 1B8UA 4R4JA 5JCJA 2BFAA 3D64A 3H9JA 4WEQA 3VPGA 4BB5A 5KIAA 4HX5A 2J5KA 5KJ6A 3KO8A 4E30A 3JQGB 1C1DB 2WD8A 4MVJH 1QV7A 1QLHA 1ZKMA 2G17A 2BF7A 1BW9A 1M67A 1VSUA 3OJOA 2O4UX 2HMSA 1O94A 3UGKA 4MVJE 5EIOA 3MJVA 4PGFA 5T8KC 2VCYA 4I9NA 3GEDA 1XKQA 1XQ1A 2B37A 2X4GA 4CUZA 4UVEA 1EFLA 2WYVA 4JBGA 1D1TA 3JD3A 2Q3EA 2VYND 1KVTA 4U8GA 4E13A 5KKCA 2J5QA 2V7PA 4UVIA 4RPJA 4W4TA 4G81A 1BVRA 4DLLA 4PCVA 4GGPA 4K26A 4NNJA 2IEBA 3QVOA 5TJHA 3HSKA 4Z9XA 1ISIA 3C7CB 1YL7A 3S2IA 2D0IA 5HA5A 1D1SA 4PN3A 5TRTA 1I2ZA 2UDPA 3FWNA 3SX2A 4XYLA 4BQPA 5IAAA 4OO3A 2J3JA 3FNFA 2IYOA 4BNVA 2X58A 3K6JA 1P74A 1GY8A 4J90A 3ITKA 1EVZA 4RVDA 4WLNA 3CZRA 3T7EA 1LU9A 1GPDG 5JS6A 3STHA 4XA8A 3JQ7A 3DR3A 4LW8A 3ABIA 3OA2A 2RBEA 5IXSA 3HNPA 4WLFA 1YB5A 2E48A 1B7GO 1I10A 3K9QO 3ZWYA 3SVTA 2DBVO 3UOGA 2PKQO 3IUSA 1LDNA 1HKUA 3UICA 5T6BA 3WGIA 2DBRA 3ADOA 2DC1A 5BNTA 4IQGA 2ZQZA 4MO2A 3GZNA 1GDHA 3R0IA 4ITUA 3Q2KA 3CMMA 2X23A 5DCUA 1GD1O 2WSBA 1M6WA 3W6ZA 4EGFA 4ZRMA 1WW8A 2POQX 1EDOA 1HYEA 1GU7A 3U4IA 4MP6A 2A94A 3GA0A 2GR9A 4J1NA 4JP2A 3GEGA 5JMWA 1EUCA 2JAHA 4WCFC 3GPDG 4DLAA 3GG2A 4J3FA 4XWYA 3GMSA 3JQBA 4AJ1A 1A4IA 5A9TA 3SLKA 5G0TA 1NFQA 1GQYA 4LVUA 1O0SA 3K31A 1MC4A 2VHVA 3FHLA 2Y1FA 1AHHA 1ISMA 3AWDA 1M2WA 4MVJF 3DBHB 4Q39A 2E49A 3JQAA 3DOCA 1PZGA 4B8WA 4Z3KA 3Q11A 5KKAA 3CE6A 1J6UA 5JAZA 1E0DA 3LDHA 3ULKA 1GUZA 4C4OA 1QYWA 1C0KA 4YWJA 5A04A 1T24A 3RQSA 1PJ4A 2EGGA 2PH5A 2XAAA 3MTJA 5A5FA 1YL5A 2VUUA 4IGEA 4JLWA 4M89A 4BHTA 5I9NA 4EW6A 2LDXA 1UXGA 3RJ5A 3GEMA 4FFPA 1P1FA 2P9GA 2Y0EA 3ZGYA 4BOYA 4KDFA 3A06A 1WZEA 2IEDA 5M6DA 5U4QA 1T1RA 2OGUA 2QZ9A 1VKOA 1P1RA 2DTDA 3H9UA 5GY7A 4E12A 4OJNA 4B4WA 4E3ZA 1E7WA 4Y8VA 1DB3A 4H15A 4KUHA 1JKJA 3NUGA 1EBUA 1E7MA 2EIHA 2X5OA 2B83A 3H9GA 4A7PA 5KWEA 2GASA 4J9UE 2WE8A 2B4RO 3WB9A 1HXHA 1OMOA 1R4NA 1U9JA 3KSDO 3VOSA 1E7QA 2C07A 3DHYA 2IZZA 3O4RA 1LTHR 4CM1A 1Z75A 5CDYA 1NHGA 3V2HA 1DHTA 3KSZO 5DP1A 3DZKA 5ER6A 2W4QA 5G0VA 1PL6A 1TXGA 1T25A 2YQ4A 9LDTA 1UXJA 5A05A 4CM9A 1WXDA 1X0VA 4TVBA 5DULA 3UVEA 4QT0A 2NACA 1Q0HA 3JYPA 3TF5A 3MWEB 2PGLA 2OP0A 1T2EA 4N18A 2NQTA 1V3TA 4NHEA 1E6UA 2D3TA 2TMDA 3TZHA 2RH8A 4YQYA 1XDWA 4U5QA 1XQ6A 3S1LA 1W6UA 1JQBA 4P22A 1X1EA 3MWDB 4RVHA 1I2CA 1YBMA 5H83A 1UZNA 2BRUA 4CR7A 4BQRA 1HDCA 2DM6A 3UF0A 4Q3EA 3WS7A 1O95A 1DFIA 4MVJP 1QSGA 2PV7A 3I6QA 3I23A 1GUFA 3N74A 2DFVA 3DAPA 3ZV6A 3AOEA 5HM8A 4G65A 3WJAA 2X0JA 7ADHA 1SMKA 1E7SA 2J3HA 3ITDA 2JFHA 3KM0A 3TSCA 2ZB3A 1VJ0A 3FPLA 2YHIA 4HADA 1BXGB 3GRPA 4CMJA 4QUKA 2C29D 4AL4A 4I5EA 4BO6A 2ZQYA 2YY7A 3Q2IA 4ZQGA 1HRDA 2JCXA 2IODA 1E3JA 3D5TA 1A7AA 3L6EA 1A71A 3ONEA 2WDZA 3OIGA 5LDGA 3JD2A 4ZVVA 1LDBA 5DDIP 1WDKA 4D0SA 4RV9A 2AXQA 4D42A 2R00A 3KB6A 3W4KA 2NU9A 4MVJA 4BMSA 3BMQA 1NXQA 2YW9A 2X0IA 4BNJA 1HDOA 4JX8A 4BO5A 4E33A 3H2ZA 5L3ZA 3AY3A 4LCEA 3DWFA 4C7JA 3HHPA 4IUYA 4NBUA 1F14A 1UP4A 3C1TA 3DBVO 4KZPA 1F8GA 2PH3A 4MDHA 4U6QA 4OH1A 1M66A 3A14A 5JAMA 2WM3A 3NRCA 4NK4A 3AM4A 3QE3A 2PWZA 3OM9A 5DOZA 5I7EA 4MVJI 1DO8A 5B12A 1ZEJA 5DCWA 3UW3A 1I3LA 1HDGO 4DBVO 3O9ZA 2X9GA 4YEDA 4LK3A 3U0BA 2GPTA 3ICPA 2A92A 2WJPA 3I6IA 3WQQA 3PYXA 4CV2A 3GUCA 5A9SB 1XELA 4J1SA 3IC5A 2H6EA 4AJHA 2PK3A 4XRGA 5TLSA 4PIVA 3ROMA 4DUPA 3FBGA 4OKNA 1H2HA 1ZK0A 2NU7A 4OMUA 3KRTA 2BLLA 3AJRA 4K28A 1HE5A 4N54A 2C82A 4RPGA 3QHAA 3D4OA 4CJXA 3MJSA 4ILKA 2I76A 4XEHA 3MTGA 5HTOA 1LQTA 3BMNB 1WDMA 2CZCA 3JSAA 4I9UA 4XRRA 3G79A 3I1JA 4FS3A 4URFA 1NAIA 5COQA 1DJQA 2OP1A 2UV8A 1N92A 2ZKLA 3RUFA 5FI5A 1QXSA 1FDVA 5L4LA 2X9VA 3CINA 3I83A 4FD3A 5TF4A 4BKOA 4GGOA 4WLOA 1HL3A 3Q3CA 2OBYA 4UVDA 4BMVA 2Y05A 3DC2A 2NVUA 3HE3A 2FPPA 3CIFA 4YJHA 1KS9A 3AUAA 4NU5A 4M49A 4IPTA 3GDGA 1H6CA 3RUCA 3IP1A 4W9NC 5JDIC 3NKLA 4OKIA 3HDJA 4D43A 5B1YA 2EG9A 1HDYA 3IS3A 4DTIA 5CPBA 2ZTMA 2Z1MA 1YXMA 1DFGA 2G0TA 4ALJA 5MGBA 1T2CA 2FPIA 5G4LA 4FGWA 4Q3NA 2DLDA 3K2EA 3OFSA 1UJMA 3ROKA 4JJIA 1HTBA 2FP4A 4I5DA 5G0WA 3RBVA 1QYVA 2C0CA 1Q0QA 1ZO8A 3OBBA 5KNLA 4DXHA 1DIAA 3WGQA 4TRRA 1P3DA 1SNYA 3FI9A 4RVUA 4LN1A 1EQ2A 3ZV4A 4UUNA 4I08A 2O4CA 3LLVA 1HYGA 4NBRA 2IZ1A 3CMCO 1TLTA 1I30A 1Y5MA 4BO9A 5FWNA 3H5AA 4R5MA 1DIBA 4LISA 3NTQA 3LC1O 5COAA 4NMHA 3PJFA 3PLNA 4R1TA 4XDYA 2DVMA 3DZFA 3ZN2A 2Q49A 8LDHA 2Q1UA 1I2BA 4YJFA 4E2XA 1OZAA 3EVTA 3KZVA 3ZWOA 3GMDA 3TZCA 1HF3A 2AG8A 4PLZA 4FQ8A 5TJ9A 4NJOA 1PEDA 3PJDA 3H8VA 1DJNA 4EEZA 2DFDA 3WJ7A 5JCXA 3OEWA 3WX0A 4EUHA 3OQBA 1CEQA 4Y6RA 5KJEA 3QY9A 3ASVA 1RYDA 3GHHA 3SJ7A 4TZKA 4IY1A 1UDCA 1MUUA 4WEOA 1SAYA 4QO7A 1O89A 1E3IA 3O8QA 4NK5A 4J43A 1AUPA 1E1LA 4NQZA 4DQVA 3DBLA 2HMUA 2HJRA 4BGIA 1SB9A 4XD2A 3PK0A 4YRDA 3WIEA 4A10A 4Y6PA 2VT3A 1Y8RA 3DTTA 4D44A 1NBOA 1K6JA 3ZNNA 3D3WA 2X0NA 1V0JA 4YAEA 1EQUA 3VPSA 4CMGA 4NJMB 2YFHA 2CDCA 2NM0A 1MA0A 1UAGA 1E77A 4ND4A 5FF9A 3PHJA 1D3AA 4D0RA 4MP8A 5C7LO 3WQSB 1HDZA 1Z45A 3LT0A 3OETA 1LQUA 4J4TA 1I3NA 3RJ9A 3GVPA 1NWCA 3DAGA 3I52A 4IIVA 2AMFA 2JD0A 5I7SA 3ZNOA 3LLSA 2ZYGA 2P4QA 3CTMA 5KJFA 5T73A 2VWPA 4XGNA 3GQVA 4ZA2A 3RC2A 4WCFA 3WIDA 3H7AA 3E8XA 4U0JA 3PHHA 4J49A 4L0QA 1DIHA 2HQ1A 5C7OO 4OL9A 1WDLA 1YS4A 5CP8A 3GN1A 2C2YA 1QYXA 4RDIA 3TZ6A 1NASA 2H5LA 5A4DA 1R6DA 5TS3A 4DMMA 1C1DA 1ZMTA 2W2KB 3IP3A 3QVXA 4YYZA 1A5ZA 3JYNA 1BDBA 3TDKA 2O23A 3DTYA 3WYEA 5TQVA 1HLDA 4IDDA 5T64A 3S55A 4KP7A 1TA4A 1DBVO 3E9NA 5IF3A 1YQXA 1DFHA 1L1FA 3HADA 1X13A 2A4KA 2JD1A 3VC7A 3E5RA 1IYZA 1AN9A 2VYVD 2B4TO 3RUEA 3OICA 2AE2A 4RCVA 4C7KA 2QQ5A 5K0ZA 3W6UA 1X7DA 5CEJA 3MJEA 4YDRA 2HRZA 2JKVA 5EPOA 3GK3A 5JSFA 5ILGA 1WWKA 1UUFA 2P4HX 4RPHA 3JD1A 3ROPA 3PWZA 1KEVA 4NBVA 1PSDA 1NPDA 4CM3A 1YDWA 1HWYA 4GH5A 4IS2A 1YH3A 1H9BA 3WOHA 3NV9A 4AJ2A 4DIBA 3RVDA 3NX4A 3O03A 4KMSA 4RF3A 5JNLA 1UP7A 4FGSA 4DMLA 2GSDA 2C54A 2YV2A 3VHRA 4HY3A 4KWHA 5IN4A 3PWKA 4FFRA 4HUJA 2Y0CA 1CYDA 4JGBA 4HKTA 1HE4A 1E7YA 2GF2A 1YE3A 5ES3A 5A5EA 1XU9A 1DC3A 4NFYA 1P44A 4Y67A 3SJUA 3N58A 3H3FA 4JJGA 4ZQEA 5JC1A 2HK9A 4U6SA 2AEMA 2AA3A 3JQ8A 1VC2A 5JC8A 4ID9A 4R9SA 4B3JA 3VTZA 5BNFA 4BO2A 4D3SA 5A3JA 4OOFA 1H94A 3G0OA 3C7DB 2NV6A 4L4RA 3TFOA 3FNHA 3TPCA 1GYPA 2I66A 3PGJA 4HWKA 1W4ZA 5CDTA 2O3JA 4YJDA 3HG7A 4PLYA 3QWFA 2AG5A 3AU9A 1FDWA 1OFGA 3S8MA 1XEAA 1SBYA 1KYQA 4P38A 3DZGA 3OA0A 3W8EA 1QMGA 4YAIA 2I3AA 3OP4A 4GLLA 4K6FA 1ML3A 1EUZA 4QXMA 4R3NA 4DLBA 1X7HA 4BNUA 1R16A 4BNKA 1R0KA 3K2BA 4E32A 4DPKA 3ZCXA 3LYLA 3GRKA 2NTNA 2VZ8A 1XLTA 4L76A 4BS9A 3RSHA 4BNWA 2GO1A 1N5DA 1PTJA 2WMDA 1BXZA 2Z95A 1N7HA 3ZI0A 2DT5A 1GADO 3HB5X 5TGDA 3H9EO 4YA6A 2GERA 1LJ8A 4KTVE 1YL6A 3PP8A 2CF5A 3EZLA 3C1OA 1MXHA 3I3OA 3JCZA 4GPD1 3G1UA 2PNFA 3WNQA 5G2OA 4OIMA 3GY0A 2NVBA 4O5OA 4PVDA 1O6ZA 1FDUA 4S1VA 3VAZA 2EJWA 1JW9B 4N5MA 3BMCB 3TWOA 4BNIA 5AQ1A 2UUOA 2B5VA 2ZATA 2AEJA 2FR0A 2O7QA 2ZCUA 3JV7A 4CMHA 3RFTA 4J91A 3P5SA 3RUHA 2Q45A 3RUIA 2HMWA 2NSDA 1RM5A 5T5QA 4IBOA 2X8LA 4A73A 4IZHA 4CMCA 2A35A 4BNZA 5CG1A 3I9LA 5L95A 5U9CA 1MG0A 4W82A 3K92A 1NX6A 1QV6A 3GT0A 4WOJA 3RWBA 3GZ4A 4GI2A 1VL0A 4XCVA 3K30A 4OHUA 2EW8A 2CDBA 2QW8A 1UH5A 3AM5A 3D4NA 1LSOA 1GZ3A 3DZBA 4B4VA 3EAGA 3N7UA 2HAEA 2HSDA 2J8ZA 4CQLA 1DRUA 4PZDA 3LT4A 3ZHXA 1LLUA 1YBVA 3WSVA 3R3SA 4E5YA 1Q0LA 3MCVA 1GYQA 3E03A 3RASA 3DFUA 3WYCA 3KV3O 1IPFA 2ZYDA 4FJ2A 5CG2A 3NGXA 1N1GA 4AJJA 1KC3A 3WWYA 1T4BA 3MJCA 3ETDA 4BNFA 4M54A 1PZHA 1R4MB 4RPKA 3ZWNA 3I5MA 3LT1A 5C37A 1V3UA 1PS8A 4YQZA 2Q2WA 4FFOA 5HRUA 3C7AA 5JMPA 4JBHA 3GNQA 3WQRA 3VH4A 5AOVA 1X1TA 2BGLA 4PRKA 4B4OA 1MFZA 1RPNA 3FTPA 1OC4A 1K89A 4R1UA 4XQGA 3KYDA 1V8BA 1ZSYA 2P9EA 3A4VA 4GSKA 4J7CA 3QRWA 1BRMA 1BXGA 2G82A 5C5IA 2HMTA 3DHNA 1U3TA 5JDCC 1JN0A 2PD4A 4W9NA 5JDIA 4JIGA 3PRJA 4XQ9A 3L4BC 5ENDA 2YDXA 3ANMA 3LK7A 4OSOA 1MG5A 3BHJA 4Q3BA 5CHEA 5BQFA 3PZRA 3VPXA 3GVIA 4NG5A 4E2YA 1WNTA 1PJQA 1Q7GA 1K0UA 3INRA 1H2BA 3WFJA 1Y8QA 4PZCA 3ANLA 4FOSA 4E21A 2DPHA 2R6JA 1R0SA 3JQ9C 4AJNA 1NVMB 3ZZNA 5TIIA 2WD7B 1DXYA 2GZ1A 2D4AA 4TMFA 2JHGA 1XSEA 2XPCA 4J4BA 4D46A 4HFNA 2FR8A 5JAQA 2Z1NA 4WECA 1BGVA 3QWHA 4BNXA 4PFJA 2DAPA 4M86A 4BNLA 4GQAA 3ST7A 3VZQA 5C7IO 4L75A 1Z7EA 1N1EA 3ETEA 4PZEA 5H82A 4BO8A 2G1UA 4NU6A 1NQ5A 4FC6A 3ZHBA 3WBFA 3AFNA 2ZIZA 3E9MA 3G17A 3I9MA 4IS3A 1VKNA 1E3WB 1G6KA 4I1IA 5GZ3A 3F4BA 5G4KB 1JWAB 5KVCA 1H5QA 2IXBA 5AXBA 3DFZA 1Y81A 4MIEA 1KVSA 2I65A 2HUNA 4J7XA 1PGOA 1IHXA 1ZK3A 5A9SA 5L53A 5L40A 3WR5A 1LRLA 2DUUA 1IE3A 4CMIB 4RQUA 3KYBA 4PG4A 2ZCVA 2O7SA 1E6EA 3NDIA 5CEFA 1B8VA 3WGTA 3L77A 4XYEA 3WSWA 4RJTA 3DB2A 1HE2A 3HN2A 3VTFA 4U0KA 2YFQA 3SBOA 3UN1A 4XYMA 2Y1DA 4CLEA 1MV8A 1ZSVA 2GCGA 4GX0A 2VRCA 1W8DA 3I4CA 1L7DA 1PX0A 2X7HA 2O2SA 5DF1A 1V35A 2E37A 1U2DA 3ZU5A 1VM6A 4TKLA 4MIYA 4OQYA 4LRTB 2ZB7A 1YKFA 4RVFA 1G0NA 2V6GA 3Q0EA 3U4HA 4Z0HO 5KVSA 1GQQA 3ORFA 3NTRA 3MZ0A 1OC2A 3QWIA 4WK6A 1KBZA 4LVCA 3VKUA 2O50A 3F6YA 4II2A 2VZ9A 4PLTA 4R54A 1P9LA 1DIRA 3IKVA 4R69A 2HK8A 3RC9A 4YJGA 1VJTA 4MIOA 1HETA 3GGGA 2C2XA 1YJ8A 1EE9A 2Y1OA 3GH3A 4Q3CA 1IY8A 4ALNA 3F4LA 2IE0A 5EMHA 2PZKA 4DVJA 2FOIA 5A9RA 4E2WA 5JY6A 3WNVA 2Y93A 4ALMA 2QHXA 4H16A 3FD8A 2IZ0A 4PG7A 2PFGA 1YOVB 4TQGA 4B7XA 4QO8A 4IDAA 1IPEA 4OYRA 3OQ6A 4YCAA 3U9LA 2YYYA 4J1QA 4DRYA 4BNYA 4M8SA 2Y1CA 1ONNA 2Q1SA 1BG6A 3VZPA 4IDEA 4CMEC 2EP5A 2QX7A 4WJZA 1GR0A 1D7OA 1IOLA 3ON5A 4NI5A 3JQ6A 5CEEA 5JFOA 2GZ3A 4CLXA 2D2IA 3C85A 4CM6A 4F45A 1LDGA 3WYBA 4JQCA 3QW2A 4J0FA 3ICCA 4LMRA 5BR7A 1CRWG 3Q9NA 3KLPX 4A27A 3HFGA 1WLYA 1Y5RA 1A72A 4GVLA 5IZ4A 1PIWA 1UXKA 3BIOA 2QZZA 1X14A 1QRRA 4P4LA 3GVXA 3FR7A 2Q22A 1EBFA 4XB2A 2NTVA 3W1VA 3NT4A 2VHZA 4CQMA 1E3LA 2B4QA 3AUUA 3V5NA 4MOWA 3V1UA 1LSUA 1FDSA 4BL5A 4HP8A 1PJLA 3A1NA 2NTJA 1H6AA 4NR0A 1MFPA 3INGA 1G0OA 5IN5A 4ND2A 3FBTA 4TWRA 5IJZA 3KLMX 4XJTA 3ZWMA 3NTOA 1ZJYA 2Q99A 5THQA 4QFDA 3BZUA 3AUTA 1ZUD1 1NM5A 1VE9A 1G1AA 3ZWAA 1T2AA 1ZIDA 2EP7A 2DPGA 2I67A 5FYDA 4BKUA 2W2LD 3H6KA 1P1JA 4DPMA 1CETA 1PWZA 2SCUA 4WLUA 1R37A 5IDQA 3GNSA 2J6IA 3Q6IA 3EUWA 1UZLA 5EESA 4XB1A 3BTVA 3ZWBA 5DNAA 1VL8A 3JD0A 5TT0A 1DAOA 4WGGA 1QR6A 4CL8A 2EXXA 4CMBA 3ROQA 4GWGA 4Y98A 4PLWA 3TRIA 1E5QA 3PFFA 4NFSA 3DHEA 5JE8A 1P77A 1Z74A 2O48X 5G0UA 1NAHA 4AICA 1UXIA 1P31A 1NQTA 1KC1A 3JQCA 5ER9A 1U3UA 2Y66A 3C1AA 4BNGA 3S2EA 1T1SA 2W2KA 1EFKA 4ZU3A 1GL3A 2V6FA 4GKVA 6LDHA 2C7VA 4CODB 1LBEA 4RLSA 3TJRA 1LLCA 1LDYA 5IFLA 1LRKA 1R66A 4R01A 3JQ7B 5AXDA 4BGVA 5LDHA 2CFCA 1C1XA 2VOJA 4B7UA 1RM0A 3D1LA 1SPXA 1SOVA 2VT2A 4CV0A 4E5KA 4MINA 4DYVA 1B3RA 3VH3A 1P1IA 2P91A 3V8BA 1SOWA 1JAXA 3IIEA 1C14A 2D8AA 3GNTA 3KSUA 1GUYA 3BMOB 3E18A 2GNAA 2NU8A 4WASA 4CPDA 2EV9A 3D4PA 1ID1A 1OOEA 1IZ9A 1HSZA 1HZJA 1U3WA 4O0LA 4TZTA 4ESOA 5BSGA 4GX2A 1IB6A 2VHWA 2Q2VA 1ZK1A 2Y0DA 1ZW1A 3Q1LA 2PD3A 3KYCB 2D59A 3ZWVA 4WCDA 1ZZEA 4XDZA 4UREA 4L74A 2UAGA 3V2GA 4G5HA 1X0XA 3JQFC 3PHLA 1LA2A 2GN6A 4MKRA 5CFZA 3BXXA 1ULUA 4CV3A 4BB6A 1HE3A 1ZNQO 4GWKA 4QSMA 4R1SA 5GMOA 5EL0A 2QRLA 3GOHA 1N7GA 3CPSA 4RZHA 1PQUA 4AJPA 1Y7TA 4CLRB 3GC6A 2VUTA 3HQ4O 1PGPA 3PPIA 3PIIA 4NH4A 5BT9A 3QVSA 4II3A 1I33A 1WP4A 3L6DA 4J2OA 1PL8A 3AW9A 3SXPA 5AXCA 3RD5A 1PJ2A 2BELA 3ETGA 2LDBA 4E5NA 1VL6A 5DZSA 3KEOA 4INAA 2CNBA 3WXBA 4Y6SA 4O6VA 1CF2O 1E5LA 1AE1A 5IXYA 3RBZA 4W99A 4IM7A 2PY6A 3RKUA 1ZXLA 2BI7A
chains in the Genus database with same CATH superfamily
1F20A 3K20A 1L9XA 2WIAA 1SUFA 4HLUC 3L4BA 1I13A 4J16A 2BFNA 2XB2A 1J2YA 1C81A 3LT2A 2ZEJA 1NR7A 3TZQA 1L3CA 5KJCA 1QLJA 3U4QB 2PUGA 2XNDD 2VTDA 4QATA 3DV0B 4LBYA 4LRYA 2YV3A 3G2NA 4P3XA 2GZ2A 1CJVC 2HRBA 3M4YA 1RYYA 2BFPA 4HH3C 1UPTA 4Z4HA 2P1DA 3GLGE 1R4NB 3WGHA 3BORA 3ABOB 3LC7O 4R0NA 4R1NA 2W2MA 1RDFA 1XNJA 3JX9A 1ZLXA 1WABA 4P58A 1YZNA 5EJIA 4BTLA 3QPBA 5KJ1A 3UWDA 2WB2A 1O4WA 3IQDB 3QG5A 4NX2A 2YXNA 1CQWA 1LFDB 3RR2A 1SIUA 1U5CA 3CLKA 2WJYA 3W5SA 2VF2A 1NFFA 4CCYA 4PYIA 3SFZA 1AXRA 2GD0A 4X1KA 1CJTC 3NZEA 4DJJA 1SVOA 1GGMA 3UWKA 4DLWA 3I9JA 4KUGA 3GELA 3W78A 4CF4A 5B3JC 3LT5A 2GM5A 1R4ZA 1U0LA 1W5TA 1DJPA 4RHUA 3QNWA 3SF8A 2OD2A 3GJSA 4CM4A 5ESWA 3KVRA 3IHTA 3IA7A 5HE8A 3CPHA 3ZW9A 5HKKD 3B6JA 3MA0A 2HA0A 5CDFA 2VSNA 5A0FA 1X7WB 2B1GA 1PFKA 1L5GB 2YWFA 5FV7A 1R88A 1QHFA 4CM9D 1TKRA 2PH1A 1EEHA 3KOUA 4JVMA 4RELA 4R7GA 4EO9A 5KHLB 4DC1A 2OZLB 1JEYB 2W11A 1RVV1 2PL5A 4J0EA 2HDNB 4EWLA 2Q1XA 1I36A 3F5SA 7MDHA 3G6KA 4RLHA 3U80A 2CJXA 5HF5A 5AVOA 1RQGA 3TINA 3U16A 3HTXA 4CEHB 1DI0A 3PTLA 2VQSA 3UJ8A 2AQIA 3BB1A 3FCXA 4TPKA 4EHFA 4Z8YA 4UDNA 4G23A 4KV7A 5CA1A 1WBBA 3CX7A 1MLDA 4YRIA 2RHHA 4ONEA 4ZYTA 4FIDA 4DG5A 1KERA 4KFUA 2ZPTX 4PG5A 4Y2QA 1WKVA 3QP9A 1NSTA 4XOUA 4PSDA 1G8AA 3MCWA 1TYBE 3EXAA 4QWWA 4QLOA 1Y42X 1YRYE 1VHJA 2YWRA 3CUKA 4JWKA 3GLUA 2AJDA 4DIFA 2HC9A 4JQZA 4GUAA 4C6TB 3BBLA 4MCJA 4RETA 1L3BA 3UWOA 2EFGA 1A3CA 1EVQA 2W6CX 1H2ZA 4GG1A 1QHXA 1ZU5A 3UGTA 1QR2A 5CD1A 3QXHA 1K06A 2F9FA 1LQ2A 2PKYX 3A2NA 3A6FA 3F5QA 4IJWA 3HJHA 2OXFA 5AVYA 3Q7IA 1U7DA 3MS4A 1ZNWA 2QRVA 1B2LA 2SKCA 3JVIA 4KEAA 2Q6KA 5TEVA 1M8JA 5FNVF 2YN2A 1OX4B 1KAHA 3VO2A 4CM8B 1PP4A 4IHKA 2R1TB 3C24A 3INNA 1G7SA 1FLAA 5L8VA 4FKMA 3V55A 2FQYA 4NDAA 2J0UB 5D8DA 1MMFB 2H0QA 1SEPA 2GJ8A 1MZVA 1XCBA 2IZOA 3CH4B 3QTLA 2W22A 2OWDA 1OBFO 5B5SA 1DELA 3O6VA 4RV5A 1IFXA 3HRIA 5JPDA 1GCAA 1QZUA 3D0QA 2DFPA 3T9BA 4CL3A 4W5QA 1Y6RA 1L4KA 2GOYA 3USZA 2OTCA 2JDIA 1Y4SA 2PQ6A 2VHJA 3AFIA 1ZM3A 1QOQB 3IRUA 4BUCA 3IESA 5J63A 1E4EB 1M7BA 3L8MA 4J29A 1SCUA 1U8UA 3A9SA 2Z8YA 4UPEA 2SECE 3DW3X 3SQWA 5D1NA 3HDHA 1XZBA 4QPCA 1OI4A 2WD7A 2G08A 2H3EA 1SM4A 3I76A 4MV0A 4LUCA 3TX2A 2O7RA 3OU2A 1GXSA 1XP8A 4NCXA 3DMPA 3DZ2B 1H2EA 3UHAA 2GAOA 2UXDB 4XM2A 4PO8A 4OHKA 4CMEA 1WXEA 3B9PA 3CISA 1WMSA 1Q1ZA 4DIMA 3A9WA 4HNHA 5BOSA 4QGGA 3U09A 1CUWA 1KAMA 4EX6A 3U6KA 4BXOA 5AW5A 5KYKA 4CF3A 4IW3B 1PFUA 2YWCA 2H1SA 4LC0A 3C3XA 2G0NA 2FKNA 3EC7A 1YJBA 3N2YA 3OKAA 3P0HA 3T7DA 1P5HA 3DFKA 1RBZA 4IVPA 3BS4A 3W3AD 5IZCC 1EHYA 4NV1A 2FEMA 5EYPA 1A2OA 2CVZA 1KVRA 3CWQA 4D3DA 4E5MA 5JU6A 1TUGA 1FMFA 4BDTA 3UUWA 4EBFA 3LHIA 1DKQA 1ZAYA 1QK3A 4OM8A 3A9TA 4NOMA 3EAFA 3SK0A 5IS2A 3IFSA 4KMOA 2REXB 3GP3A 5AI4A 5DEIA 3VAYA 2OG2A 4Q19A 4MXDA 3TS1A 2A0YA 4ATNA 2H1VA 1SKYB 4ARZA 4CMIA 3THXB 1N6OA 4DCVA 2P8JA 2FPPB 4YAWA 3RS4A 1QGZA 4H7PA 3GLQA 4X1IA 1EVIA 4O59O 4DG8A 1N1MA 3N0RA 3TUXA 2R6GA 2XA9A 5AKKA 5FIUA 2JK1A 3NEAA 4P5EA 4OQDA 1JEJA 3UJPA 4X9XA 5B6PA 3VDRA 3AEZA 3IALA 4AZ0B 5AVQA 4RIEA 1OX5A 1G5TA 4XUDA 5AK6A 4ROTA 2F4NA 3E84A 1JVBA 1RWVA 1V95A 1AC5A 4RD1A 5CCDA 3LY5A 2BM1A 8ADHA 1W581 1H8ED 3DVRX 3G9UA 3DBHA 3PUIA 4ZXFA 3ZQ4A 2ET6A 2ZT7A 1B3BA 3GDFA 2PS1A 3U9TA 1Q50A 3PGA1 3DE6X 1KYTA 3FWHA 4ARBA 4EDFA 5A1JA 3IOEA 3JATB 1P2BA 1G5FA 1MNAA 3DE5X 1IB0A 2Q50A 3LBFA 3N76A 4B48A 3HJFA 2IYLD 2P9CA 5JNTA 3JU3A 4G5YA 2YINC 3EPPA 4H6VA 5I9MA 3VU8A 3ZXXA 1MQSA 4YY3B 2ZDQA 3Q7TA 4D9GA 4HXYA 1NE7A 2QG9A 4PTYA 2BFCB 4OH7A 4QJBA 4TROA 3O2NA 4IGKA 3HLKA 3RREA 1EM6A 2ODWA 4D2IA 4LFCB 2WHYA 2QYOA 2R4TA 3DMDA 1VXOA 3ENKA 3H4IA 1CUHA 2JD2A 3HY6A 3NC1C 4PR3A 4Q4AA 2NQ2C 4X61A 5E7IA 4B7ZA 1ENPA 1KNXA 2GCOB 2XMSA 4XB6B 5AHKA 5BUQA 1AX9A 5DRYA 5DHPA 4ZEVA 4WN9A 4AQYB 2W71A 4NULA 4OI0A 3PYLA 3IQIX 2JB9A 1P3Y1 4Y2GA 1R1DA 3ZC3A 1BVHA 1NV8A 4O4IB 4KXMA 1YR2A 4MICA 4B74A 5AVSA 4CKYA 1S02A 4YMIA 1WCYA 3T3NA 3QH4A 3GROA 1GSOA 1YVUA 2VUSA 2WFLA 4LNAA 4OGFA 3NDPA 3DCNA 3AF6A 3RSCA 4X66B 2ZDGA 1VSBA 2YJ6A 3NHZA 4HFRA 3U7RA 1COWA 2CXOA 1ZXBA 3QMWA 4Y30A 5I4BA 2G1JA 2UVDA 3DKIA 1M2EA 4LOKA 3VKVA 3L8YA 1QVRA 1FS6A 3QEBZ 1K7CA 4IFBA 2FRDA 1S2LA 6NULA 3QPVA 1XEWY 3KQQA 1JEQB 3VHQA 3DHWC 5AW0A 4BV8A 1MB4A 3D3WB 3RB8A 2OAQ1 3BTOA 5FLEX 3AY7A 5A2GA 1VLQA 1XHLA 1VKRA 3MGCA 4Q9NA 4B2PA 1PNQA 4CEJA 1N2CB 1RM4A 2VDQB 4CGYA 2CZGA 2XZDA 3EDRA 3WA6A 3P26A 5HGXA 1L0BA 1NFRA 2WMOB 2XWSA 1QHNA 3B1XA 3BPSA 1A82A 3COYA 1DMRA 3GJRA 3NJ8A 2D1TA 4K9PA 4PHFA 1BVUA 1DWQA 3FB4A 1O5IA 2JBAA 1LSSA 4ZVSA 4QUEA 5T67A 3QI2A 4CLQA 1UKEA 1A9RA 2JCVA 3HWX1 2X1HA 5E8RA 1C4OA 4WKGA 4QUGA 4WHMA 1G98A 3RABA 3QHQA 2FZWA 4U2CA 3KVYA 1AA6A 3KB8A 5BT8A 2CLEB 4BC0A 5ARCA 3WQBA 5K99A 3OPNA 2J3IA 4CGZA 3NATA 4P3YA 4YLYA 4WBNF 4OHYA 2VNSA 1RQXA 1I72B 2GDZA 3H6GA 4JOQA 3ZGNA 1K66A 3OOSA 2Z4RA 4UMEA 1CIPA 1CHNA 1M76A 3D7LA 3PQ8A 2CJPA 2B0CA 2YCLA 3DFMA 4N49A 3TYXA 1ADCA 1KF0A 3KFVA 3CVXA 1N0HA 1MAAA 1NVKA 3WK5A 4RW0A 3AW8A 4DJ5X 1KH3A 3C7TA 2O1WA 2PIDA 4F3YA 1KYXA 2GAAA 3DVSX 4I5GA 5G40A 1FK8A 3P9NA 3HB7A 4MKXA 1PDVA 4N0MA 4MB6A 1RYEA 3L1KA 3M83A 3CLUD 4FYHA 1RWNA 3LM8A 1RE1A 2AVNA 5DHAA 3UB3A 1Z73A 3AEQB 3ECAA 5T7BA 4U02A 3HEMA 2PVPA 2WABA 3IODA 2DOKA 3N75A 4HTFB 1WZ2A 1V3VA 1Q20A 4E15A 1LLDA 4IKOA 5CT8A 2ZIXA 4H4CA 4I50A 3TIXB 5EXDA 1TT5B 4QYMA 4V24A 4P0TA 2GSWA 2GN9A 3IPAA 4M9RA 3UMSA 2JFFA 4ZI7B 3SS9X 5I9IA 3IHWA 4CNQA 2ZRIA 3E48A 5JPIA 1VYUA 2ZBUA 2IF0A 3QNUA 4PGMA 4R6WA 2VJLA 3OOWA 4GOOD 4PYOA 5B2ZA 4DLXA 1SKMA 2YC2C 2IXTA 1PG5A 4OJQA 2A1TR 1QHEA 4PZLA 5B4TA 4F97A 3CUTA 3DOHA 2VXCA 5E2IA 2OCDA 3ZJUA 2VQEB 3PUYA 1F8UA 4GLFA 3IT0A 1SXGA 1AF7A 2HV9A 1NJGA 2PGDA 4YK7A 5BQ5A 4WZ6A 4Y0NA 5FJJA 5FH9A 1QP4A 1YR7A 3Q87B 4JI1B 3QLVA 3GAFA 3M4NA 1GSAA 1JHPA 3NO4A 1HLGA 1MPTA 4F9TA 2Q8QA 1KOLA 1XA3A 2ZUWA 1ZUNA 4MVJM 1DEOA 3EIUA 2VTBB 1RJEA 3Q7PA 1CY4A 2IZ6A 5DHFA 5DTEA 1E2QA 1QVVA 4ZHSA 3QU4A 3B9QA 1LUAA 2CMDA 2QT9A 3E4DA 1MQ9A 4LGVA 3BX1A 4O29A 4LIPD 3TSZA 2D62A 2O3UA 4FJ1A 5IKMA 4Z2AA 3H11B 4IZIA 5DM2A 3HA5A 4JEMA 4QG3A 4KPFC 5F64A 3D9QX 2RGNA 2WICA 2XKAA 2VPQA 3G5UA 3M49A 4WOBA 5KOJA 1QFSA 4NYJQ 2V3VA 3H3XA 1CUXA 3PDHA 3QKSB 2Y1XA 3JWPA 1F17A 5EJ7A 2DTEA 1CERA 2N3ZA 3EQZA 2F17A 5IT9A 2RD2A 2UXCB 2I3BA 1EP2B 2YICA 1LK0A 1XCMA 3GVCA 5CLIA 3UK1A 1FZTA 5E9QA 2J09A 3K5PA 2P35A 3KYCA 4J76A 2Z43A 5B58C 1QG6A 1IQ0A 1M1NB 2GAFA 3K9HA 1PZXA 2BZ1A 4BRUA 1GCUA 4ZICA 1VBFA 4GIBA 4LHWA 4AJOA 4F85A 1AQJA 3NOOA 4CHGA 4ER5A 2BTOA 4NZZA 1CR0A 3B6IA 2GK3A 4RWZA 1G9TA 2D0DA 4ZT2A 4UNNA 4PLGA 2G40A 2O0LA 1DAGA 1HORA 2NYVA 3MB8A 1U8YA 5CK5A 4XD7A 5B2FA 1LC3A 1WVGA 3T4UA 4E5VA 3CY6A 3WFIA 3HCAA 1AKWA 1E18A 2REQB 4XGKA 3T7TA 4EG5A 5ADVA 8MHTA 3A1TA 4M7RA 3ZJYA 1E1YA 1Z6ZA 4YCJA 4EPXA 3HBNA 4Y0VA 3OTWA 1C80A 2H51A 2QTWB 1RRKA 3G85A 5EJGA 4YFVA 1CQIB 2FUG1 2HRCA 2WTXA 4HV4A 2H2GA 2WK1A 3AUFA 3WK6A 3E5MA 4HEA1 4CLOB 3M1LA 3D3JA 3CTPA 1O2DA 1ZOIA 4N7RA 2L42A 4Q4JA 4LRXA 3OE4A 1IQRA 3E2IA 4Y9TA 1XF1A 5CH5A 5JFGA 2GYYA 2F6RA 3CH5A 4M8NE 4D4JA 4Z4CA 4E4RA 3ONDA 5CIQA 4G0UA 1N34B 1ODJA 5DSTA 3F8WA 4ZJPA 5EPUA 4NCHA 1GCOA 2BONA 3QJ5A 2I6UA 3SR4A 3BXOA 1S8AA 2EHDA 1J8MF 3I9NA 4ZVNA 1DAEA 1EFVA 1Z0ZA 2BR3A 2YV4A 4CMKA 2C7BA 2WNSA 4CCAA 2V0CA 1DADA 5CJJA 4Z9AA 3TNLA 1BOOA 2R2AA 1WIWA 4G0XA 4AJIA 4QQRA 1X6VA 3DLHA 1E79D 2VRBA 4KR3A 1I2DA 3TR6A 4E2ZA 5KQPA 3O84A 2HDOA 4MW1A 3RYIA 1CUCA 3GGJA 1QH8A 1JAHA 2E4XA 3KE8A 1Q77A 5A7FA 1DDOA 1U2GA 4MWCA 4QOSA 2J3KA 3GFFA 2DWUA 3DV0A 2J5RA 3RFUA 3F2IA 4C2AA 4V3CA 2BMAA 4HRYA 721PA 2F43B 2Y76A 2OBXA 3D2AA 4R8SA 3GJZA 3MILA 5C1OA 1HEYA 5DISB 3SS7X 1ADGA 1JPJA 1ZFNA 1P6QA 5EIAA 1NJ8A 2BISA 3GRCA 2OOKA 4MZDA 4AJKA 1QNFA 2EFDB 3Q72A 3QFFA 3WIUA 2FAXA 2HOQA 1MAUA 2W37A 1DKRA 3A31A 1HSOA 3DMNA 3UBMA 2C7PA 2P5SA 3ZXUB 5B1EA 4KL8S 1EUDB 5LP6F 3V9PA 2PUEA 3QZUA 4PYJA 1ZGHA 2WSYB 3L0ZA 3EZXA 3ZU3A 4Z4IA 2IHYA 2X0RA 4UPVA 4YV2A 1RRCA 1E99A 5F12A 1TVCA 5K0LA 3UTCA 3DP9A 3SE0A 1MKYA 1DAPA 4UE3S 3H5VA 1DUSA 3EDMA 2EJTA 2RJOA 3MD9A 2EEPA 4U00A 3RTBA 4MA0A 1BWSA 3RVMA 4KLZA 5IM4A 1TAUA 1JBKA 4RSHA 4YAOA 3RHSA 2RK4A 1UPAA 1OGYA 3D8RA 3BEDA 4L5AA 1ADBA 1X7WA 2J46A 1DZ3A 1G20A 4MWOA 5BSFA 5JO0A 5LYJA 2ZRQA 3W4JA 1N8SA 4NVRA 3E9QA 4OXQA 1BYIA 4ZYLA 1LD3A 4R2XA 4JH0A 1AZWA 2BP7A 3IDQA 4BU0A 2DTXA 4ZHQB 1UK9A 2F1JA 4CU2A 2HUPA 2Z5LA 3Q3EA 4CEHA 5C8YA 1IRIA 1CKEA 1KU6A 3LF2A 5FLXA 4AKHA 3SXJA 4CLHA 1T5OA 4ZO4A 4YP9A 1U63A 3DNPA 1JJAA 2CSUA 3PL5A 1RBYA 1P7VA 4LRUA 1A1VA 4ESEA 5EIBC 4MA5A 2RMKA 3WNDA 1XR3A 2ILTA 2Y9MB 4UUOA 3EDYA 5HIKA 1WTCA 3HA7A 4KCGA 3PVSA 2H5EA 5D87A 1DZIA 1NUTA 1XZAA 4KO3S 2JKZA 2GX6A 2BFOA 3WA7A 1UBGA 4X65B 4HEQA 2XT9A 4HBZA 2WWHA 5IX8A 1A4XA 3ESXA 4ZVTA 3WISA 3D3KA 5EMMA 3IRVA 1N2SA 3AUSA 1NUUA 2IY7A 3X1MA 1QZZA 3DL7A 2FPXA 2GCPA 1G41A 1RKQA 2P75A 4EIWA 1OX4A 3VVBA 4CM8A 2IYZA 3ES9A 1M72A 1DLJA 2R1TA 1C7IA 1BMQA 2VWGA 3FZNA 5I7FA 1XRNA 1R00A 4P7KA 2J0UA 2OSVA 3H13A 4TLAA 1V39A 1BWQA 4LSZA 1BFDA 4HGRA 4KK4A 2DQKA 4QA9A 1XNHA 2UVQA 4B31A 2GN8A 3VHXB 3FMFA 3MWKA 1FW6A 4HAUA 3QQPA 4Y6QA 5T3YA 1YBAA 3LUCA 5H5JA 1S5PA 2O8VA 3VZBA 4NRDA 3HYLA 3WMFA 2YS7A 1KI6B 1XG5A 4LPSA 4EG6A 4UHEA 4C76A 1QIKA 4WMLA 1P2TA 1TU0A 3GZNB 3M3HA 5MGNA 3EN0A 1E4EA 1QMPA 1KSHA 3L93A 4LHXA 3U3OA 3MRTA 4HRAA 3ZLUA 4CIDA 4OJMX 5K09A 3IDOA 3NG1A 1C30B 4PZUA 5A7HA 5ALWA 1NT4A 4YP5A 2H1FA 4NV3A 3PITA 4Y9UA 4RKYA 1LV7A 2H2DA 5JNVA 1O96B 2PZMA 3RE1A 1I4WA 4IZ6A 2R79A 2GJKA 4X7MA 2AXNA 2P9QA 1M9NA 1VLHA 3G2OA 3IHKA 1KY5A 3NWEA 3DMTC 5BR8B 1E66A 3N28A 4X1YB 3K05A 2CXSA 2XHEA 2CL7X 1RHRA 1SHKA 3GIWA 1H4TA 5GJWC 4UOEA 4JI4B 4JBNA 3PFGA 2QF7A 4J7AA 2CGEA 2MMCA 1HYBA 3A37A 3BFJA 4P3PA 4TWJA 2AHRA 2F7SA 4OAQA 4XX1A 3T5CA 2P40A 1UF9A 4UNPA 3ENNA 3LWDA 1LPAB 1S7CA 3GR6A 2Z2XA 5ALDA 3R40A 4C4SA 2VH1A 4H7EA 4DMCA 5BN3B 4FFVA 3OFVA 5B30A 5KNDD 4YRKA 5JZVA 4KODA 2VHCA 1OCEA 1O94C 2CLDX 1Z36A 3CNLA 3QX9A 5AICA 4PM4A 3P2OA 2VJBA 3AWIA 3DM5A 5THKA 4EHDA 5JLJA 3QE0A 2AQ8A 1X7ZA 2JLYA 4DIOA 2Q9UA 3PLRA 1W2HA 3EXG2 2Q7DA 3GFOA 2ZAIA 1D0IA 2VPTA 4UXHA 4ZQHA 1YJAA 4ZCRA 3JRWA 2AFIA 4Q9KA 4O63O 3PDUA 3ZBPA 2C5SA 3E82A 2IXFA 2VRCD 2YWBA 1A2QA 4GP7A 3KSMA 5A3SA 2E5WA 2OO5A 3ZHQA 2JFQA 4L6CA 4JKYA 1N2BA 1BEZA 2EKPA 3A2LA 4TGLA 4R1PA 1USKA 3NT2A 4DV4B 1T3HA 4AZ0A 3C8DA 2VZ0A 1T9GS 2I71A 4L8WB 4FFMA 1YHZA 2C2MA 2LCIA 4FMDF 1ZWLA 5IW8A 3WMWA 2J3LA 1Y6GA 3FTDA 1T3TA 2YYAA 5KYUA 5T8KA 2WC1A 4PSKA 3B5IA 5DHRA 2OZEA 2YWDA 1KQNA 2E4WA 1LK7A 1ZMOA 1L4HA 4D56A 1T43A 5HIAA 1AD2A 4ZI3A 2YMQA 3R3ZA 4PC2A 4D92A 1ITZA 1YQGA 3ELBA 4QDUA 4KQEA 1SEVA 5LQMA 1NNEA 2EFYA 3PNOA 3QPWA 1LF5A 2WTEA 2XUAA 1ZJZA 2QRJA 3JVDA 1RHQA 4ASUD 2OVBA 2BFCA 4ZAWA 5B4UA 3FW1A 1RZ3A 4FX5A 3ID6C 3CYFA 3KR9A 1YT5A 1WM1A 3G49A 1KMCA 2XODA 2DYKA 1DC6A 3CRMA 3IVAA 3IVXA 1G59A 4JT4A 1XU7A 2JFXA 2OCGA 4QODA 4EKGA 3TXAA 1OAOC 1BSVA 5JJBA 2BSQA 3WHLA 4WD3A 1IJBA 2BFMA 5CDHA 3NR2A 4ZN6A 2HDWA 1HT3A 2NNLD 3OFJA 1RAIA 4O4IA 3MUFA 4AMBA 2ZB4A 2DR2A 2W2NA 1ONPA 1KMIY 1U6IA 5BV1A 3W5AA 4ODIA 5F7ZA 1BTOA 1THTA 3RRMA 3TTVA 2O05A 2QIOA 2V7VA 3NALA 3O8CA 4V2IA 4PYRA 2YDYA 3OJWA 1J7JA 1J8DA 1SVKA 3VH2A 3BKWA 3WLSA 3L0CA 3I45A 4EJMA 2A5JA 3IIMA 4BP3A 5LMCA 2ZRFA 3KXPA 4LZOA 4RIHA 1E1DA 2XXBA 1O0CA 3EP5B 4RL6A 3A28A 1WZNA 3S99A 1RLUA 1L5RA 2FSSA 3M81A 4GKBA 2ZSFA 3MAGA 4XLZA 4Z7OB 5IKXA 4TMVA 3H18A 1JEQA 4K1LA 5J4KA 4LZWA 2VHUA 3FVRA 3KP1A 2Z6QA 2Q4OA 4P34A 1YRBA 1TZMA 4WXHA 5AXAA 3VO1A 3B20A 5HWSA 5K3EA 1JHAA 3TZLA 4A92A 1N2CA 1KBQA 1RCTE 1GA1A 4BVJA 2B69A 3IMGA 1W85B 1P75A 1LBIA 4DARA 4CT0A 1GZ4A 5G1PA 3TN7A 4KQGA 4Z49A 1C3LA 4QPPA 3ZDEA 1E2DA 1E1QD 2OB1A 5LU9A 1GPYA 3EC2A 4KO8A 2Q46A 3KZMA 4IIHA 3IA2A 4DEXA 1ORRA 3DFIA 1FOEB 3NHJA 3WWCA 5HVNA 1GPMA 3ZWCA 3P9ZA 2NU9B 3EPJA 5LP1A 1N8KA 3EVNA 1EVYA 2EYQA 2FPGA 3CNEA 3CWCA 3DA8A 3GQBA 2VJDA 2R7KA 3HZZA 4GEGA 4GM1A 4PNZA 3TXYA 2FUKA 2VK4A 3O3MB 4C29A 5AVVA 3ABSB 2IHKA 2PJDA 1UQRA 5JBIA 4BV9A 3RVRA 2VO1A 4P92A 1E7RA 3HNRA 4HLNA 2Q1WA 2ATEA 2C3PA 2JJQA 2QL6A 4HL6A 1B6RA 5DT9A 2ZJ1A 1R0LA 1N78A 4BFXA 5DTMA 4Q18A 4P2GA 2HU5A 4BO4A 1F48A 5L7TA 4DB4A 2DR3A 1YB2A 4KVGA 4DWVA 2YKGA 2DUNA 1VGQA 4R1MA 2CFIA 2W48A 3GRYA 2WPDA 2PSSA 4MVJD 3NBUA 4C08A 2XB8A 1W5BA 2ID4A 3QPCA 3HU3A 4Z0NA 5G3ZA 4ENSA 4OG2A 1E1KA 1ECLA 1PWEA 2BHNA 4II7A 4L9RA 3FY4A 3GCZA 2FZEA 3K6RA 3O2QB 3AEQA 4H08A 1UWKA 2GD2A 1HV8A 2JATA 2B20A 4UMVA 3VAAA 3H5WA 3R4VA 5K1ZA 1CBUA 4P54A 1JG1A 4AX8A 4HTFA 4YMLA 2H7CA 2PTGA 2LBPA 2NX2A 1DXQA 3C0KA 3DJYA 4I6JA 5JQGB 1YTLA 3H83A 3W5UA 4GXRA 2XE7A 4MAFA 1WV1A 3BJZA 1QHHA 1TT5A 2VDKB 2IHUA 1A77A 3L7MA 4F8EA 3W1WA 1JIVA 3C14C 2QMYA 3QX8A 1RRGA 2VK8A 4E94A 4ZI7A 5LMZA 4YREA 3HXOA 2CSXA 2GBLC 1PBNA 1CUSA 1V7PC 3OIUA 3NYWA 5FWYB 5IASA 2VCHA 1QVAA 3FF4A 2M6LA 1C3OA 2V4MA 4PZ9A 4R2IA 2QX8A 1M5UA 1K6IA 2VJPA 2WVJA 4HXFB 4LC1A 4LSMA 1G5IA 1RJ9A 4QICA 4HVTA 4BKPA 2GMWA 1FNBA 2ZTVA 4JJKA 4X8OA 4YDQA 3DZIA 4KQ6A 2J9RA 1VPTA 2QTRA 4NPCA 4OMDA 5BURA 1P0MA 4IJUA 1NNUA 1NTOA 3EY9A 3R9WA 3E9RA 3TLMA 3WLHA 1LC0A 2PM8A 3U7QA 1NVTA 1JXQA 1YDGA 2VJMB 3ZEIA 4IJVA 3QU9A 4CV1A 3AOEC 4KWEA 4ZKDA 4OQQA 2AMYA 1QJ4A 5B1IA 1HURA 1B00A 1W88B 1PVOA 4XWGA 2AWOA 3PQEA 3U60B 2DB3A 3N8HA 3V8RA 5I9TA 4GU5A 5EP2A 3QV2A 4G89A 2I87A 2IEGA 2OFOA 3LUKA 1V7ZA 1UBRS 2Q1YA 4PRYA 3I32A 3H11A 1GA6A 2AZ4A 2QD1A 4YPFA 1YSCA 3TFQA 4OYYA 4KQKA 3Q0TA 1M34B 1XRJA 1EMDA 5CPFA 1V9CA 4MVCA 4B3SB 4GP6A 2BSAA 3TK1A 1XGKA 2Q3LA 2R68A 2CNKA 2IPOA 4KPUB 3TQOA 5KTMA 1NKSA 2B4KA 4YJKA 4EY8A 4IMRA 3QA9A 1JKIA 2J7PA 1OPRA 4F38A 1Y0BA 1Y1KE 4RULA 3G82C 2ZSKA 1E6CA 4MAMA 3PF9A 4Q7LA 4R83A 5DM60 2FJPA 1OD6A 1OI2A 3MQFA 2B7CA 4L85A 1GKYA 2H9IA 1S96A 4PFSA 3OIFA 4LZZA 3NCHA 3PD7A 1IDN1 1J42A 3OLCX 3RAPR 5AHOA 4EJSA 1E4YA 1F38A 2ZITA 1QYIA 1BRTA 2V59A 5E9JA 3WMXA 4EA9A 3QSYA 5BUCA 3LXXA 4Q4HB 4D9JA 2DQSA 1J0XO 5IDWA 1QTQA 5DNEA 4QUIA 4AKTA 1E2UA 3UPDA 1NRIA 4Y2UA 1VCOA 5BXYA 4M0UA 4S0XA 1YUBA 4LQLA 3EF3A 2EAUA 2JFOA 2X13A 3EP8B 2Z0MA 3BK1A 3IPRA 4Y6OA 3ROFA 4TN5A 3PVCA 4K6GA 5EP4A 3WWZA 3C41J 2YVKA 3SZMA 4AZTA 3HJUA 4I81A 2VQ3A 4FYWA 4N5DA 3QIAA 1CQIA 4EZBA 5JT1A 4MJLA 4ND7A 4BATA 2FSVA 3NM5A 1C3VA 3WP1B 3M5WA 2WJ6A 5BQXA 4CLOA 5FEUA 4MLCA 3RU2A 3ZS8A 1NOKA 3JTMA 3RAJA 1RAEA 2PGXA 2YWGA 4KLCA 2EZ8A 4MYRA 3QX7A 4BO0A 4Z54A 1ODSA 1P9OA 3QUSA 3G0CA 1GQ2A 1YOVA 4QVIA 4U1RA 4M38A 1DOZA 3DLPX 4BAGA 1RKXA 2P9ZA 4FDVA 4URWR 4JL8A 3IKLA 2J59A 4KITB 4LZPA 3O2SB 4RA6A 3DDZX 5FR1A 4C04A 3AYXB 4DLVA 3HSYA 3QV1A 3O9VA 3DAHA 4FEGA 2ZTUA 5D00A 5DCLA 3Q8LA 4FEAA 3TOZA 2QYSA 2BHLA 2JVKA 4RF5A 3B1KA 2A78A 2A5FA 3H75A 4PG8A 1LBQA 2O20A 2OHFA 4K1XA 4RFSB 4ZGWA 3F74A 2C5GA 2GZMA 1Y8RB 5TMBA 4AYTA 3DMYA 4BFUA 1F3LA 3QEAZ 4CCSA 4HUQB 4UBLA 1BEUB 4JB3A 1PLKA 1WMAA 5IU6A 5EIHA 2FYTA 2DQZA 1NONA 5LP6C 2F43A 2OZPA 3V1YA 1MGOA 2GJSA 4XPZA 5I48A 1TU3A 5D5PA 2PZLA 2A86A 4PLCA 3NYQA 2EF1A 2AN4A 3DYBA 2PG3A 3PKZA 4HGNA 4YIHA 1BNCA 1HFWA 4O4HB 4POOA 4WXMA 3WK9A 1KYIA 3TQHA 5CDGA 3MT7A 2BZGA 1Q22A 3HKBA 5IK2A 1OFHA 3M6FA 3O4GA 1EX7A 2PD6A 1NYRA 1ONOA 2JCGA 2ARKA 2OD9A 1EUDA 1TM7E 1Z5NA 4NENB 1JTEA 3VV3A 5EI5A 1EB9A 2GARA 3R3UA 5KYNA 4NEGA 4IG9A 2HB6A 3D64A 3H9JA 5J2UB 2WJGA 2BEUB 3LVRE 1IDOA 2Z6UA 4UCQA 5KIAA 5KU1A 1MRSA 1SOAA 2J5KA 3AXTA 3KX2A 1D2CA 1OZ0A 2QPLA 1G3IA 2WD8A 1ZKMA 5J47A 3OJOA 2BF7A 2O2XA 3MGBA 3DUFB 3LNCA 3MF4A 1L7VC 2YIDA 3B48A 4FMPA 1XA4A 3UGKA 4MVJE 5EIOA 1EIWA 1RJDA 2IYVA 3S40A 4ITRC 3ZDXB 4KFTA 1A97A 1EFLA 4UVEA 5K3DA 1D1TA 1UPUA 2FRVA 2Q3EA 3NTLA 1YZ3A 1DAIA 2YJNA 1VG0B 2QN8A 3SZOA 5KKCA 3BRQA 3A4YA 1CZKA 2WMNB 3FLBA 5EGNA 4Y1FA 4MS1B 1KBOA 3KJIA 1SC4A 2B98A 2ZPAA 5BRNA 4DLLA 4GGPA 4ZDKA 3QPUA 1P4GA 3COWA 2IEBA 4B5LA 1XZNA 3RF6A 1EK0A 3B36A 1RACA 3HSKA 1SKUA 2KB0A 3EEYA 5IAJA 2A4MA 1JS1X 4CG2A 4K8OA 4ZKEA 5TMEA 4WXYB 1TJ5A 2D0IA 4ESHA 5K01A 1D1SA 4PN3A 3MHTA 4LZNA 3SX2A 3CZAA 2NZ2A 4JUDX 4N7JA 3SP1A 2ZWPA 1O8BA 4DCJA 2CBZA 2JJ1A 4GZMA 2ZANA 4LHEA 1E5VA 1A95A 1R9MA 1YE8A 2F3PA 3ILHA 5C4IA 2XRZA 4HG2A 4WX2B 4RVDA 2RARA 1DTWB 1SBCA 4N5HX 4KXUA 4C0QC 2A0WA 4RTMA 5JS6A 4I4TA 3STHA 1U1DA 1P2DA 2AV6A 5DPMA 1UIMA 3CU5A 2BFFA 5JNRA 4DA0A 3HNPA 5K8CA 4Y2TA 1YB5A 2E48A 4MVYA 1B7GO 3H84A 2JDID 3EEBA 4V39A 3SVTA 1VIMA 2HGSA 2R97A 2XOEA 4KDRA 2YR0A 2PKQO 4ZOQI 3IBTA 4HJRA 3IUSA 5AOCA 5FP0A 3VHXA 8AT1A 4ZP1A 3UICA 2FWRA 1JJ7A 3SE7A 1MD9A 4HS9A 4ZV4A 4FGZA 4MX8A 4JFAA 1ZA1A 2VIIA 4XPIB 5HJ2A 2C0PA 1NLZA 2WYIA 2PUFA 1P19A 2ZT6A 2ZQZA 2FPLA 2I78A 3GZNA 4OAOA 4WW0A 2PX2A 5FOVA 3RK0A 1T1JA 3MMXA 3KZXA 7YASA 4ITUA 3WE7A 4MDFA 1NQUA 3DDUA 4PC1A 5C8ZA 2H2AA 3AC0A 5JAOA 1TGYA 4FD2A 4IVNA 2Q3FA 2POQX 3MXOA 3OQPA 2CHFA 4DDHA 4CKCA 2CV1A 1NL3A 2XYRA 5BNWA 1RZUA 2D00A 2QEQA 1RD4A 4MRRA 2ZUTA 5JMOA 4FW9A 4ICIA 4J1NA 3EIEA 4JP2A 5C5CA 4C87A 1IXRC 3VPCA 3UAOA 4WCFC 2I2CA 2JLRA 2BGRA 3E70C 3WMRA 2C31A 5ALEA 5BW4A 3FBWA 4RD3A 1FRFS 4J3FA 3H1EA 3DDWA 5JROA 5LZ2A 1SKAA 3B38A 1OBVA 1O3YA 4ZCIA 2QLTA 2JPDA 3K31A 2XTJA 1B1CA 1U7ZA 4K9RA 1DGQA 1ISMA 1U0RA 1ND5A 3K8OE 4GWLA 1QOPB 3SEZA 4Q39A 3URKA 3UUEA 2E49A 5LFAA 3L8FA 3MMSA 4OA5A 3SIXA 1ZC4A 2XDYA 3A3NA 1D2GA 2WVHA 2XCUA 3RRZA 3WWEA 3P9QA 1FFDA 1N7IA 3N7AA 4OA8A 3NWBA 2ZVPX 4KGVA 4LDRA 2VA8A 4UBJA 4CL0A 2P67A 3KDAA 5AM2A 1XTBA 4E5UA 2ISQA 4A23A 1FS5A 1C0KA 2DKOA 3ZYZA 1T24A 4M8IA 3RWMB 2PH5A 4JV5B 3W8NA 2CD7A 1FA9A 4PRZA 1YL5A 4JLWA 4BEWA 4PX9A 4BHTA 2QZSA 4N5IX 1U80A 4OK5A 4CETA 3AJ9A 4EFKA 3AP2A 2XADA 4C89A 3HUUA 3ZGYA 3V8VA 4LJ4A 3LQKA 4KDFA 1SD2A 1WZEA 2I03A 3BFPA 3IR7A 1DWUA 2E4YA 3I2IA 1T1RA 1JA0A 1KWKA 3KD3A 2OGUA 1P1RA 2DTDA 3F97A 2HU7A 3A4NA 4HHEA 4E11A 2BVNA 2XOKD 1OY1A 1WU7A 4N3AA 1ISSA 1FFSA 1E7WA 4FOLA 4FDMA 4OPMA 2ZAMA 3OEED 4KUHA 1FE8A 4MS4B 3G2PA 4QG7A 5EOVA 2NAPA 2OHVA 2BWJA 2X5OA 2BZSA 3FRHA 3Q5EA 3DB1A 4A7PA 2HYDA 5FTMA 2AYZA 2QR3A 3SSAA 2ZRHA 3FYTA 4A0GA 2B4RO 1ZZGA 2JGMA 4ISCA 1KP2A 3VOSA 4O5AA 1ILWA 1NR5A 1Y1LA 2Q28A 2YJ4A 4JOSA 5HM6A 3FPBA 2YOGA 3SDBA 5BUSA 1G2QA 1SQ5A 3TZBA 1LTQA 4TT8A 2BGWA 1Z15A 1I6MA 1T25A 2YQ4A 4MV7A 5INTA 5A05A 1EDBA 3LX4A 4PC3A 4C6HA 1WXDA 2Q7XA 2O6LA 4QT0A 1ORIA 1Q0HA 4C3OB 3TF5A 2I6GA 2CBGA 1EM8A 1RJFA 5DN6A 2NQTA 4OHWA 1E3DA 2TMDA 4CF5A 3C4JA 3S1AB 4BU1A 1K5GA 1QCDA 4Q21A 3QUTA 1UK8A 5DYIA 1QYRA 5FHRA 2W42A 3OZFA 1YAJA 1R0CA 4BQRA 1HDCA 1COWD 2DM6A 2J3DA 1R5JA 4Q3EA 1E8MA 2WSIA 3MBKA 4YRFA 2EC5A 3URMA 2MSDB 3M5CA 1DFIA 4EHIA 1QSGA 2DHQA 4MYUA 3I6QA 3ZV6A 1RAFA 2ACKA 2X8WA 1EU1A 3OCVA 4OI4A 4BMXA 3V4RA 1L7AA 3BXHA 4HAOA 1VYVA 4NZOA 4L08A 2X0JA 1NJ5A 5ICGA 2VXBA 2J3HA 3ITDA 3ZE6A 4B3FX 4OLBA 3GJ5A 1E58A 2ATXA 4RHCA 1GZUA 2JFHA 4BYGA 2VJYA 1KPGA 4FN5A 3FPLA 1VJ0A 3PDCA 5C52B 1KJZA 2PCLA 4QUKA 2ZU0C 2C29D 2P9HA 2W2TA 2FN8A 3CEMA 1UL1X 3L4EA 8OHMA 3N0XA 1YR8A 5MFPA 4UJ5A 4FYJA 2ZQYA 3K9BA 4JI8B 1GPNA 1QFXA 5ES4B 1J5EB 1BROA 3LUGA 3Q2IA 4O4JF 3ANTA 2JCXA 3E8MA 4IOLA 4AY4A 1J06A 3D5TA 4IEFB 5JWRA 2G4VA 1CUYA 2QW0X 3GJTA 1XWWA 2C8KA 3OIGA 2BFDB 3U6BA 1F5NA 1AK2A 2EYUA 5DDIP 4PBTA 3ZD7A 4Z53A 1DARA 4ILEA 2FF5A 1JUDA 1S0UA 3LW8A 4JYCA 3H99A 4MHSA 1XLVA 4RV9A 5FPPA 3S81A 3VISA 2R00A 3VOTA 5FTWA 1G19A 2NU9A 4K6MA 3W4KA 3K0CA 2ZRNA 3TQTA 4BMSA 4QYTA 2IBSA 1NXQA 1PK8A 2C61A 2FZCA 3FPHA 4BNJA 4LGYA 3MCUA 1CUAA 2HT6A 4BO5A 4AUMA 3SR0A 4E33A 2ATCA 4J0JA 3EPBB 4B0PA 4F4FA 1HE1C 3C3PA 3DWFA 4C7JA 2SKDA 5ED4A 3VRHA 1W29A 2CK3A 3VSAA 2PH3A 1Q2UA 4PF1A 1A9PA 1F3OA