1NX6A

Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-Semialdehyde Dehydrogenase
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 110
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nx6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nx6A01
4BO1A 1WNTA 4YPOA 2P4HX 2PD3A 3SC6A 4XB1A 1I2CA 3AI3A 3E9QA 3FSRA 4GX5A 4E32A 4YXFA 3RROA 4CMEC 4CM1A 4AJNA 3FR7A 3H2SA 4TRMA 1A71A 1NWCA 3IQDB 3C8MA 2A9FA 4TVOA 1F0YA 4MO2A 5A9RA 3RUCA 5LDHA 1NQOA 4LVUA 5B4TA 1GR0A 4MVJH 1SEPA 1SPXA 2B0JA 2W2LD 4BKRA 1ENPA 3W4KA 5JO0A 3RD5A 1E1LA 1NQTA 1GCOA 1IB6A 3JQAD 5IDYA 3GMSA 3ICCA 1NYTA 2QIOA 3FNFA 2UAGA 3EY4A 3LT4A 4IGFA 2X0NA 3TJRA 1UZNA 3DHNA 3NTOA 3QE3A 4YT4A 1OI7A 4U8GA 3U0BA 3WSWA 4CUKA 1UXGA 3NRCA 5FF9A 5F1OA 3Q11A 3WNVA 4CM9D 2GN9A 4W7IA 3RBVA 2W4QA 1OFGA 2WYWA 2BFMA 1T2FA 4ND2A 4AVYA 4IJKA 1ZBQA 3S55A 3L4BC 3F4LA 2JFGA 1Y7TA 1M6WA 4RQUA 1YBMA 5IDWA 3ANNA 2ZIZA 2J3KA 1XU9A 1R4MA 1GZ3A 1DFGA 1UDCA 3F47A 1P3DA 1QYCA 4IM7A 5HS4A 1VLLA 3ABIA 2DBZA 1ZH8A 3B1FA 4I9UA 2Z95A 1NTOA 2PGLA 5IZ4A 2PWZA 4NR0A 1E1KA 2DLDA 4ZD6A 2Y93A 3BMCB 3U49A 3PWSA 1XKQA 4LRTB 3EGOA 3JYLA 3GEDA 4Z0TA 2EKQA 2Y67A 3VZPA 2DUWA 4FB5A 4YRAA 2AMFA 5T67A 2DPHA 4X54A 2ZATA 5AYVA 5LC1A 3ZV5A 4DQUA 5T6BA 2WMDA 3FF4A 2VUTA 3DHEA 2OUIA 2IRWA 4DQXA 1NPTO 2PH5A 4PGFA 4DC0A 3ZHZA 3FNEA 4RPJA 1F8FA 3DZIA 4ALJA 3BTVA 3E03A 4L75A 4YQZA 4XQCA 2EJWA 3ROQA 4BO4A 5KWEA 2JHGA 1EK5A 2PY6A 3ZWVA 1KYQA 4CMEA 4DYDA 3K73O 3UGKA 1M2WA 3ZWWA 3KBOA 2HU2A 3PWKA 3DTTA 4Z6KA 4LSWA 4BNWA 3AM5A 4QT0A 4Y6RA 3HN7A 4J49A 1R15A 1NVMB 1ENOA 1YDEA 1SEVA 1PEDA 7MDHA 2VHYA 1P74A 3GF4A 4JP3A 1ZNQO 4Z0HO 3H9EO 1MXHA 1IZ9A 1Q0QA 4Z3DA 1IOLA 4FSHA 4XYBA 5DP1A 3RU7A 2QHXA 1C0KA 2P5YA 3I9LA 4YJFB 2HK9A 4F46A 2O7SA 1LDEA 4AJ1A 4FW8A 1YS4A 3EYWA 5KVQA 5M6DA 2GRAA 4J0FA 1U4OA 3JQ7B 4TKLA 2Q1TA 3SEFA 3H3JA 2O50A 1LC0A 2G82A 2I3AA 2V6MA 5C37A 2PH3A 3C7DB 1HSOA 4KUGA 3DAFA 3BA1A 1GUZA 3NT4A 1ZFNA 4ND5A 3EDMA 4EJ0A 3WICA 3IKVA 4Y6SA 3L4BA 1QLHA 1H6DA 4JK3A 1PR9A 2NADA 3LF2A 4PCVA 1G0OA 4RVSA 2YFQA 3CIFA 2QZ9A 3KV3O 4MIYA 1GYRA 2C07A 1EDOA 2HK8A 4JXKA 2QRKA 3MJCA 4J9UE 4OHUA 2CZCA 1GEGA 2CSUA 1DIHA 3EC7A 4YAKA 3UXYA 1B0AA 2DPGA 4OQYA 3VH3A 5I7SA 2HKIA 3QVTA 4JCOA 3S8MA 1U28A 3ZHYA 4RVHA 4HFMA 4IIVA 3RIHA 3AU8A 3RWBA 3UN1A 3F3SA 2Q22A 3UICA 1UJMA 1V6AA 3Q2KA 3M6IA 5JMWA 1LDMA 3DHYA 3I9MA 4WPGA 4D3DA 1U3VA 1ISFA 1PU2A 2H9IA 2P9EA 4MVJD 1UXKA 5DBGA 2WDZA 1ZEJA 4Y6PA 3F1LA 3GC6A 1M75A 4AL4A 5IZCC 4FN4A 3VDRA 2DUUA 3Q0EA 3K30A 1MFZA 4S1VA 2EP5A 3ZNPA 1YL6A 3QW2A 5G0SA 4E5KA 3QWHA 2FZEA 5HTOA 3FBTA 3BHMA 3GAZA 4XA8A 5H82A 3ZHBA 1PS0A 1PTJA 1KETA 4IDEA 9LDTA 2AQKA 1IPEA 3I9JA 5EL0A 4CLHA 5C7LO 1LQUA 4XZ3A 5T8KA 5HBRA 1E0DA 3OJLA 3RJ5A 3W8EA 2OO5A 4DMMA 3NDIA 4NU5A 2NVBA 4EBFA 2QYSA 2RH8A 1BXGB 3PDUA 3TSCA 3BAZA 5TIIA 1JKFA 1I32A 5EESA 3ZWMA 5CDTA 4BNXA 2W2KB 3N58A 2X9NA 1VE9A 4RVGA 4P38A 3IS3A 1Z7EA 1E7SA 4QTZA 1N7GA 2OBNA 3L07A 3DZBA 1Q0LA 3C1AA 2Z5LA 1B7GO 3HFSA 4R51A 4EI2A 3V2UA 1IE3A 1BDBA 5DDIP 1HDCA 1YONA 1PWXA 2O4CA 1SZJG 4XJTA 4B4WA 4DPMA 4WASA 5A1TA 4DLLA 4CQLA 3ZU2A 2X8LA 3GQVA 3JQCA 4Z9FA 3ZV6A 1JVSA 1KC3A 4I5DA 2RIRA 3T4EA 1BSVA 1E7WA 4MOWA 3K92A 2PK3A 2X58A 5B12A 5AVOA 1I30A 2ZJ0A 3GMDA 4YA6A 4R9RA 2NQTA 1ZK2A 4J16A 3MWEB 1I3MA 1D4FA 1Y8RB 2NU8A 4IDAA 3DBHA 4PVCA 4NU6A 1DC3A 2HRBA 3X2FA 3B20A 3VH4A 3ZWXA 1Y8QB 2C20A 4FOOA 3A14A 3NX4A 4XCVA 3DEYX 3WQSB 3UKOA 1Z6ZA 2RHRA 3RKRA 3IAHA 3AW9A 4CMCA 1EUDA 2VZ9A 4CM8A 2YQ4A 3VH2A 1YGYA 1DEHA 5G0VA 4INAA 3ZDFA 1X13A 2OBYA 1K3TA 3ZU4A 4I5EA 5DNAA 1NVGA 1TI7A 2VTDA 2I9PA 3AUAA 1QMGA 1ZSNA 3HHPA 4XQ9A 3QV1A 3QVWA 2PGJA 3ICPA 1LEHA 2G0TA 1M76A 1EVZA 2JCXA 4NMHA 4RZHA 3H7AA 5F1KA 4DBZA 5IZCA 1PJSA 2DAPA 3ZGYA 6ADHA 3UVEA 4OAQA 2DFVA 3INRA 2YV3A 2DVMA 1H93A 3NTRA 2CDAA 1QV6A 4LN1A 4RO0A 3WIEA 4CM4B 1QORA 3MJVA 3KSDO 1KEUA 2P5UA 3LU1A 3SX2A 4R4JA 4IY1A 4BNJA 5DZSA 3JYQA 3KRTA 1K0UA 1XIVA 3DBRB 3V1TC 4FC7A 3FWNA 1ZCJA 2SCUA 2DTXA 2VCYA 4BV8A 3O03A 3PXXA 5A03A 1UXHA 4ZRMA 2R2GA 1XU7A 1BXKA 2WM3A 4J7CA 1SOWA 3E82A 2Q49A 3HWRA 3OJEA 4BO0A 3JQ8B 3WB9A 1Q7BA 1C0LA 1KY5A 1XQ1A 5BQFA 2FPIA 5T5QA 4CMGA 5BT9A 3QWIA 4GGPA 4RPHA 1CIVA 3ZHXA 1SB8A 4J2HA 1HYEA 5DULA 3PFFA 5JBIA 3VPGA 3K2EA 4HFRA 1EUZA 2I3GA 5GZ6A 4YJHA 2I66A 4PLHA 1HDZA 1E1NA 2ZTMA 3CKYA 2HAEA 1P44A 3SJ7A 1KVUA 2ZQYA 1Z74A 2FWMX 2O2YA 5H83A 1PSDA 5KIAA 3IUSA 5BNFA 1VC2A 1NXQA 2B5WA 4KDEA 2ZK7A 4DIBA 2BKAA 3CSDA 2VZ8A 3K2BA 3DZGA 2BFOA 2FR8A 3OECA 3HZZA 1G6KA 2FN7A 3DXFA 3GVIA 1VKOA 1JAXA 4IXWA 1ADGA 2G17A 3EMKA 4ZQHA 1BG6A 4J9VA 2Q50A 3F5SA 1VI2A 1ADFA 3KLPX 5JY6A 2UYYA 1NR1A 3CINA 5A3VA 4ZQGA 2G76A 4U0KA 4IJWA 4OKIA 3ZW9A 1EK6A 3AY3A 5ER6A 4WCFA 1H94A 1H9AA 3WIDA 5TT1A 2IXBA 3AOEA 2BRUA 3RVDA 3DQPA 1HXHA 3R3SA 5ICSA 2B83A 3MJTA 2IODA 3ENKA 4A5OA 1Z45A 1DRUA 2HMSA 2UVDA 1NQ5A 1W4ZA 5L7TA 4M87A 1WMAA 1BMDA 2BGMA 3GEGA 4CV0A 5JY1A 1KS9A 5ADHA 4B79A 3W8FA 4KOAA 4E5PA 4O0LA 1WW8A 2CNBA 2E82A 4NFSA 3FTPA 3W6ZA 1B16A 1I3LA 4GX1A 4CMHA 3DFZA 2BD0A 4UUNA 1DAOA 2VYND 4GVLA 5IFLA 1I3NA 1RWBA 3MWDB 4LCJA 4YJDA 1NPYA 5KKAA 1LSJA 1NAHA 2TMGA 3PJDA 3HJAA 4CV3A 4YJGB 3GNQA 1JWAB 2QG4A 3QLJA 4K6CA 4RDHA 5L4SA 5TQVA 2PV7A 3ITDA 1BWSA 4NBTA 3VZQA 3M1AA 3ETGA 4I5GA 4BNUA 4LSMA 1F17A 3TL2A 2YQ5A 4PLWA 5ENVA 4BO6A 4XRRA 5JNLA 3RBZA 4BVAA 1C1DB 4E2WA 1ZSVA 1IYZA 4RF2A 4BGVA 3JQDA 5DT9A 3QVSA 1IUKA 1H6BA 2O3SA 3RFXA 2YHIB 2QZZA 3F6YA 3NEPX 1Y81A 1DJNA 4BNZA 4UVHA 2BGKA 2FPGA 1I01A 4IS2A 1Z82A 1T2CA 3E5MA 1C14A 3E9MA 1B15A 3NAQA 4GKVA 1X14A 2C2YA 1RM0A 5BNIA 5U9CA 1OMOA 2EERA 1YJQA 1NBOA 4G2NA 5DF1A 1XYGA 1CWUA 5FI3A 5EQFA 3C24A 1LA2A 4TROA 1TT5B 2IDZA 1FMCA 1ONNA 4DGSA 4XYLA 1I33A 2B35A 3DBHB 3D3WB 4DC1A 2YZ7A 1L1FA 2PR2A 2X0JA 3BMCA 1XSEA 3UCFA 4AJKA 1M6HA 3D5QA 4NNJA 3ETDA 2A92A 2ZYAA 2P4QA 1Y1PA 4CPDA 5KJCA 3RU9A 3KO8A 1ISGA 4TSKA 5F5NA 3PZRA 3ASVA 5FI5A 3WX0A 3WGOA 4DREA 3QRWA 2UDPA 3FNGA 4MIEA 4J4TA 1E6WA 4RPKA 3K6JA 5CFZA 4FPXA 1JDJA 5L4NA 1KERA 2JCVA 2JD1A 5JFOA 2WSBA 2YYYA 4DTIA 2V7PA 4PG4A 4IGEA 2VRCD 1RPNA 4XYMA 3L0DA 2NU9A 2FMUA 3WTCA 2Q45A 1N7HA 4BL5A 4CLRB 1VSVA 1TLTA 1K5HA 4J2OA 1KOLA 3WGYA 4BMNA 4A2CA 1E7QA 2GN4A 1V3TA 4RORA 3GVCA 5U1PA 4NBUA 4NQZA 1AUPA 5KKCA 1XDWA 4HP8A 3E9NA 3I4FA 2JJYA 2G5CA 4I8XA 3UFXA 2AQ8A 1IHXA 3RUEA 1E3JA 1VJ1A 3PHGA 4NFYA 3BIOA 2X86A 4O1MA 3AUUA 1MX3A 3AUTA 4JQCA 4YJFA 1Y6JA 2J3IA 1CERA 3IOYA 3QWAA 1B8UA 3DFUA 4NH4A 1W8DA 4L0QA 3WXBA 4QFDA 2NTNA 1OC2A 3GGPA 3JQ7A 4XEHA 1DRWA 3GDFA 1QR6A 2EV9A 1OC4A 4U0JA 2ZB3A 3D4NA 2J8ZA 4XB2A 3H5NA 3WGGA 4NJMB 1UP6A 4WNIA 1UP4A 2DU8A 3DB2A 4C7KA 3GLQA 1HSZA 2GYYA 3DTYA 4LGVA 3ADOA 1XGKA 4TKMA 3UCEA 1P33A 3BMQB 5COBA 1H0KA 3I3OA 4LK3A 2VHXA 1LSSA 3OEWA 4L76A 4E12A 2QX7A 4L4RA 3BMNB 3VHRA 1ZW1A 1X1TA 1ZO8A 3UAGA 1ZMTA 3M1LA 5DOZA 5AXDA 1F12A 2CF5A 2Y1FA 4P4NA 3UOGA 3JYNA 3PIDA 4N5LA 3H3FA 2Q2WA 1A9ZA 1EE2A 4Q3BA 4MVJI 1VJTA 1W73A 3ONEA 5A3JA 1H9BA 1H5QA 1BHSA 2HJRA 1P1IA 2OP1A 3OJ0A 1UDAA 2YHUA 2IE0A 4FJ2A 1K6XA 4XGIA 3OETA 3U62A 4B4VA 3TN7A 4BNTA 1GUYA 5HWSA 3NDRA 6LDHA 3A06A 2WE8A 1OAAA 3PJEA 3BYZA 1U7HA 3U9LA 1D1SA 3AK4A 3LQFA 4ND1A 4W82A 3WG9A 1KBZA 3KUXA 3LDHA 5IDXA 1N5DA 1ZEMA 4BMSA 1ID1A 1F8GA 3ZCXA 3GZ4A 2HRZA 2EKLA 4YT8A 5ILOA 1C1XA 2HMWA 2Y1GA 1C0PA 2IZZA 5KVVA 2IYOA 1HDOA 2GCGA 2EP7A 4R1UA 4XQEA 2C5EA 1QLJA 3QA9A 3S2EA 4K1LA 3PYLA 4R5MA 4JP2A 3WDSA 1J49A 3JD4A 1BXGA 2X4GA 5IN4A 3RC1A 4CMAA 1RM5A 1TB4A 4YAJA 2W2KA 4U6QA 1DHRA 4EZBA 3DMTC 4IQ8A 1EVYA 1DFIA 4P4GA 5ER9A 2PZMA 2WE7A 2QQ5A 5HA5A 5EINA 4HXYA 4M86A 1PGPA 4NIMA 1C0IA 4W4TA 5L45A 1BW9B 1BRMA 4PLTA 3I52A 3VDQA 2X23A 1YQDA 2DBVO 3AFMA 1T26A 1A27A 4W99A 4IZIA 4EITA 1PJCA 4OSOA 4UAGA 2NWQA 1AHIA 1FF9A 1W0CA 4AJEA 3VKVA 3OJFA 3L6EA 3PLNA 4PLZA 3CEAA 4ZQFA 3KTDA 1Q2XA 1VJ0A 2CFCA 1MLDA 1ADBA 2X6TA 2NLOA 5JYDA 3RI3A 3CE6A 4JBHA 2H1SA 2AE2A 1J5PA 1OOEA 1Y8RA 1R0SA 2E48A 2IZ0A 3PRJA 2VWGA 4GMGA 4BNKA 2ILTA 1ADCA 5L95A 4O5OA 3ROPA 1Y8QA 3GFBA 1I0ZA 5L9AA 2VWPA 4EW6A 1NVTA 4Z9YA 3HADA 5TJ9A 3E5RA 3MOIA 3ZWCA 3OA2A 1H6CA 1KY4A 3O9ZA 5JAQA 2EGHA 2FSVA 5A9TA 4CR7A 4L9RA 1E3IA 4URFA 4KTVE 1N8KA 4D3FA 1CDOA 1BTOA 1FDTA 1IY8A 3GG9A 3MZ0A 3OSUA 4WEOA 1JVBA 1PJ4A 3K96A 1WXDA 3P2OA 2Q4EA 4DMLA 4CM7A 5AXBA 3WGZA 3AU9A 2I99A 4WCDA 3BTUA 1J4AA 3AWDA 1NPDA 3LT0A 3R3JA 4FJ0A 5A05A 4OO3A 5G0TA 4ND4A 4Y98A 3CXRA 3ORFA 1X1EA 4UVDA 1YOVB 2EGGA 3PWZA 2BH9A 5JPIA 3HDQA 3DWFA 2HK7A 3IKTA 1QYDA 5LCXA 2C82A 4CM4A 1V3UA 4AJ2A 4YAIA 1LDBA 3PTZA 3IP1A 3WLFA 1E7MA 2J3JA 4F6LA 4XR4A 1JN0A 3WOHA 1HZZA 4ZN6A 4PRLA 3O8QB 3JSAA 3DBRA 3K5PA 4ND3A 1P1HA 5DP2A 3CTMA 2Y1CA 1CRWG 1GL3A 3JD2A 4ITUA 1MFPA 2PKQP 2NTVA 1GFSA 4IJVA 5T8KC 3DMTA 3RSHA 4A27A 2D1YA 1LLDA 1PL6A 3GNTA 3E6AA 1LRLA 3JQ8A 4J7XA 5EN4A 5CDUA 1DDOA 1HEUA 2CD9A 1PQWA 3ETEA 1U2DA 3QQPA 4IMPA 4NG5A 5CDSA 4R5HA 5IAAA 3PLRA 4NDNE 4ALIA 4B4OA 2UUPA 4PG8A 1ZKMA 2I76A 1ISJA 2W90A 1DXYA 2OZPA 1T24A 3LLSA 3SLGA 1XWFA 5GZ1A 1NNUA 1ZXBA 4E5MA 5HM8A 2CY0A 4DRYA 3TZ6A 3UH1A 4EJ6A 3A9WA 5KNLA 4J4HA 2NSDA 4A0SA 2POQX 1JWBB 4WNCA 3ZU3A 2D5AA 3GR6A 2NVUB 4OSPA 1EZ4A 5TLSA 1QSGA 3L77A 4XGNA 5EQDA 4AJJA 4CLXA 4PIVA 2YUTA 2P2SA 2AW5A 3QVOA 4FR5A 2NNLD 4J4BA 5B37A 5T64A 3VOSA 3N7UA 4RZIA 1EQ2A 2V6FA 2VOEA 3BXXA 3HDJA 4YT5A 3ZWPA 1YWGO 3PP8A 4XDYA 3OMLA 3UF0A 4DL9A 4WOJA 4Q3AA 1U3TA 2NACA 3H9UA 2IZ1A 4F3YA 1PL8A 3JQEA 4XX0A 4UUPA 4B7UA 1HETA 1GQQA 1FK8A 2E4AA 3V2HA 1S6YA 4HNGA 2J5KA 4GVXA 1GZ4A 1NFQA 5IXYA 4M55A 5CEFA 3ANLA 1QYVA 3SBOA 4IPTA 1HE4A 3SLKA 4EEXA 4MKZA 4XR9A 4QQRA 4Q3NA 1JU9A 3NUGA 3P7MA 4IQ0A 4H16A 4BIIA 3JQBA 3Q9NA 4PLPA 1EFLA 5TSDA 2OXIA 2WYUA 2H6EA 4UREA 4B3IA 4CLOB 1SOVA 1C1XB 3TNLA 5B4VA 4K28A 3I4CA 4BNLA 5C3MA 1MUUA 4YJGA 3I9NA 5EMHA 1UH5A 1NHGA 5IDQA 3DAGA 4A26A 1X7HA 1E7YA 3BZUA 4ALLA 2X5KO 1EQUA 3D4PA 4GX2A 4KDFA 3TDKA 4GLOA 5F3RA 4HADA 5AOVA 1TT7A 4BMVA 3Q2IA 1HDYA 1PS9A 1E1MA 1VL6A 3WNQA 1MP0A 3EVTA 2Y1EA 3AM4A 3GGOA 2FPPA 1HE2A 3QIVA 1LBEA 4WJZA 3PHIA 3TOXA 1E3EA 1C1DA 3ZNOA 2YV2A 4CMIB 4CODB 3ZNNA 4IIUA 1ENZA 5DBFA 2EIHA 3ZWBA 4O59O 4MPDA 3GN2A 1YQXA 3DBVO 3NV9A 2YHIA 1FDSA 1R0KA 3MEQA 1Y9AA 3IL2A 2D3TA 4D44A 1IL0A 1E3WB 3ROMA 4ZICA 3U4DA 4I5FA 3BHIA 4E2ZA 2Q3EA 2VQ3A 3MJEA 3WSVA 4H3VA 2WEKA 2FY8A 4BKUA 4DIFA 3C1TA 4E21A 3V2GA 5L40A 3C3XA 2B37A 4Q3CA 4Y8VA 4Q9NA 4WUVA 4NI5A 5TNXA 1B26A 5C5IA 1DIGA 2JFFA 1I8TA 4MP6A 3C7AA 3KEOA 4EYEA 1T25A 4L8VA 3RFTA 1TT5A 4WLFA 4AJ4A 1LSOA 4S3MA 3PHJA 3PI7A 1O89A 5COAA 1PJLA 1YB4A 1JTVA 3D3WA 2O4UX 3HB5X 1F14A 3AM3A 4GWGA 3VZRA 4E5NA 5FWNA 3LC1O 2X9VA 1NHWA 2Y0EA 2UUOA 2VNSA 2BFPA 3RQSA 3DBLB 3DL2A 4UUOA 4PLCA 3X2EA 4BO7A 2P91A 3PIIA 4RVUA 4FOSA 3ZU5A 3V5NA 3D7LA 2FOIA 5DN9A 1ML3A 1GQYA 1HL3A 2BF7A 4WCFC 4GLLA 4QUKA 5TT0A 3AOEC 2WJPA 4YAGA 4IDFA 3S1LA 4ALMA 4DA9A 2C2XA 3H9JA 4GBJA 4L4XA 5BNTA 1I36A 2FP4A 3I1JA 3I6IA 5EERA 1HYHA 4MJLA 3G3EA 4FFOA 1QV7A 3S2FA 3WFIA 3GG2A 3DR3A 2Y99A 3JQ6A 3PGXA 4CLRA 1X7DA 2Z1NA 4OIMA 3O4RA 4WLOA 2NU6A 1UR5A 4I1IA 1MC5A 2AEJA 2GNAA 2EJVA 1PJ2A 1DRVA 2YDYA 1LX6A 2B4TO 4B3JA 4OM8A 2VHWA 5TGDA 3ZV3A 4PZEA 1PJBA 2F1KA 1PJQA 4ZQEA 3KYBA 3F4BA 3FR8A 2R00C 3WGQA 3GDGA 4QSMA 1I2BA 1ZK1A 3OEYA 3VH1A 4CV1A 2Y68A 3TZCA 2Y0DA 4W9NC 4TQGA 1R12A 4Q39A 1YH3A 4AJLA 3W6UA 4MP3A 1Q0HA 1P0CA 3BTSA 5JDCC 1YL7A 1EBUA 1LRJA 3ROKA 4I9HA 3AI1A 3OM9A 2BFAA 4K9DA 4NJMA 4RJTA 3D3EA 1G1AA 4IBOA 1K89A 3VC7A 4YQYA 4GQAA 1VL8A 5THQA 4BGUA 1GQ2A 1RYDA 1GYQA 3SXPA 4E31A 2OGUA 2EG9A 3IP3A 1LLUA 1WLYA 1HWYA 1M66A 1ZK4A 3BMQA 1SAYA 1T4BA 3SC4A 4XQGA 1PGOA 4L4SA 4J0EA 2JD2A 3BMNA 2JD0A 4MDHA 3CZRA 4PVDA 3KSUA 3FCOA 2Y66A 4J1QA 4RVDA 1SBYA 1HF3A 4D41A 2OOSA 3GHHA 2HMTA 3B1KA 4BOYA 3MJSA 1GADO 5MGBA 1QXSA 2H63A 2CDBA 2WD8A 4RF3A 2HQ1A 5IXSA 3GUCA 3PZBA 1PQUA 3EZLA 3FTNA 2OFPA 4E13A 4J6FA 4GSKA 1ORRA 2YJZA 4HX5A 4E5YA 1BVUA 1V0JA 5FEUA 4YACA 1PZGA 3WR5A 4HBGA 5JYFA 3ONDA 3F9IA 1KVQA 4JJFA 1KVTA 1UAYA 4Z3KA 3EW7A 1TXGA 2GGSA 3H5RA 1PGNA 1ISHA 4DXHA 3E18A 4GMFA 4E33A 4A73A 5ES3A 4ZQBA 1RM4A 2WYVA 2OP0A 1QKIA 1T1RA 2BGLA 2HMVA 1GYPA 2O3RA 9LDBA 3GEMA 3WYEA 4RPLA 4NPCA 2HDHA 1UAGA 2R00A 3VPFA 4AFNA 5J23A 3L9WA 4KWHA 4M54A 4YCAA 3WLEA 4PFJA 4W9NA 3RC2A 2B36A 2VRBA 5A02A 1UUFA 1LNQA 2GDZA 3OQ1A 4DIOA 5BSEA 3G49A 2D8AA 1RJWA 3CPSA 2PA3A 4FD3A 1YXMA 3SJUA 5KJEA 4A10A 4FFNA 1EEHA 4AJPA 5BSGA 5JDCA 3KETA 1YKFA 1BW9A 3E8XA 2Q2VA 3D0OA 1T1SA 2ZCUA 4FFPA 1D3AA 5JCJA 4RQTA 5JSFA 1K2WA 1HRDA 4ZA2A 3NGLA 1A72A 5A4DA 1Y9EA 1A7AA 4QXMA 2OL4A 1RYEA 1KEVA 4FJ1A 4NHEA 1FDUA 3GPDG 1XEAA 4LCEA 1X15A 4UEOA 2QRLA 5JO9A 2GZ2A 3VPSA 4R41A 5GZ3A 2RCYA 4AJIA 3GFGA 2R6JA 1GPDG 1KEPA 3GAFA 4PG6A 3WJAA 1K6JA 3WGTA 2GUGA 2ZCVA 4JGBA 4R1TA 1R37A 2ZKLA 4TRJA 5TRTA 5TF4A 1HDGO 1F06A 5CP8A 1UDBA 1E3SA 1DLIA 4UULA 2CVZA 3HG7A 2XAAA 3VZSA 4CQMB 4KWIA 4GGOA 4D42A 3GRKA 2WD7B 1U8FO 4CLEA 4HUJA 1TA4A 1R66A 4B7CA 2V6GA 4OOEA 3HDHA 3ZNQA 3R0IA 4EGFA 4XYGA 2D59A 1N1EA 3KZVA 3FPCA 3LYLA 1YOVA 5ICMA 2C7VA 1O95A 2PD6A 1LDNA 1RM3A 4B8WA 1NR7A 4RLSA 4LMRA 2NU7A 4YB8A 2XOXA 2TMDA 2NVWA 4FC6A 1VPDA 2O23A 1A5ZA 5C7IO 2ZB4A 1B14A 3O8QA 5I9MA 1QRRA 3RUAA 5JCJD 1MG0A 3OP4A 1P1FA 5JYEA 4OL9A 4CL8A 4E2XA 1NP3A 1NQAO 5G0UA 1H2BA 1U5AA 3TFQA 4FFLA 3ONFA 4CR6A 3GPIA 1BVRA 4QFCA 1P1RA 1C3VA 3K8ZA 1DO8A 3WJ7A 4MP8A 4BNGA 5JCXA 3WBFA 1EMDA 4R3NA 1J0XO 3CZMA 5B4UA 1CETA 1PX0A 1SCUA 4CMKA 2EXXA 2I65A 3F46A 3GVHA 1HTBA 4XDZA 4TRNA 5BR7A 2Q46A 2Q4BA 4MVJE 3KYDB 3HUDA 3ZWAA 4FS3A 3WGIA 2OHXA 3LC7O 4NJOA 4NK5A 3UHAA 1Y5RA 2GZ1A 1P31A 2AG8A 3OF2A 3LLVA 3NKLA 4RV9A 1YVEI 3PK0A 3KLMX 4MINA 4E4YA 5ITWA 4B3HA 1HKUA 1SO8A 2NVUA 3DOJA 4YTEA 4F6CA 4II2A 4OXKA 5F5LA 1WDLA 1WWKA 3JTMA 4OYRA 3U3XA 2YFHA 3UCXA 3AI2A 1KC1A 2C7GA 2DKNA 5DCWA 4BO2A 3COSA 5IF3A 1LDGA 1GAEO 5TX7A 1MA0A 4IQGA 1DSSG 1ZK0A 4XD2A 1DPGA 1Z75A 3W4JA 4G5HA 1MC4A 2B69A 5EJ2A 1O5IA 5CEJA 3N74A 3WQQA 2QYTA 3L9XA 2W98A 4FGSA 5JLAA 3GHYA 4N7RA 2Y1OA 4GX0A 1E6UA 2AXQA 3B6ZA 1NWHA 1R0LA 2GN8A 3QP9A 2BHLA 5L51A 3MJ4A 3BMOB 5I9LA 2PNFA 4R1SA 5I7EA 1PZFA 1AN9A 2NV6A 2ZJ1A 1UXIA 2GSDA 2Q1SA 3DZFA 1NASA 2VHZA 3WMXA 4ZRNA 1Y5MA 2BI7A 4GSLA 4PG7A 4KP7A 5JE8A 5F1PA 2VZ0A 3I9KA 1MB4A 2GO1A 1MG5A 5CAEA 1VSUA 3OIGA 4FQ8A 4CLOA 1KEWA 2Y1DA 3ZW8A 1IHYA 2DC1A 5CDGA 5G0WA 5K0ZA 3JQGB 4QEDA 1P77A 5L4LA 5I7FA 1DAPA 4TZKA 4RCVA 3O38A 4RF5A 4M89A 1SB9A 3L6DA 3MCVA 1ZUD1 3KXDA 2PKRA 4JBIA 2D5CA 4ZVVA 1VRWA 3RUFA 4CMIA 3GH3A 2BMAA 4PLYA 4BGEA 3I6QA 1HE3A 2AG5A 2WTBA 2UV8A 3ZWYA 5A9SB 4IDGA 2D4AA 2EHDA 2FSSA 3NGXA 1PWZA 2I67A 4BO9A 1PJ3A 1GV1A 1H2HA 1E3WA 4EEZA 4L74A 2GERA 1N1GA 3GVXA 3JQFC 4PLGA 4FCCA 3RCBA 4UUMA 5ITVA 1YDWA 1QP8A 2AEMA 2VT3A 2FR0A 3K31A 4BO5A 3RBXA 4D0SA 4WLEA 1LTHR 1CJCA 4ZU3A 5TJHA 4ONEA 5EIOA 2JKVA 1ZJZA 4Q3DA 4YVFA 3IJRA 4KQXA 2AEFA 2DQ4A 1DB3A 3NDJA 4DYVA 2EWMA 5KVCA 4IUYA 2XXBA 1E6EA 1LSUA 1MV8A 2Q2QA 3Q9UA 5DBIA 4U6SA 3VTZA 5FFFA 2FR1A 1PR3A 1I24A 4P22A 3DZJA 5A5EA 4BO8A 4UEJA 3Q6IA 2HJSA 4UEKA 5JW6A 1LLCA 3DBLA 4TWRA 3FRJA 4Q3EA 1HDRA 3DZKA 2HSDA 4D7AA 5THKA 3IUPA 3M2PA 1XA0A 2GZ3A 3ANMA 4O6VA 3RUIA 5F21A 2IEDA 4I08A 5TC4A 2DT5A 2X5OA 3JCZA 4R1NA 4R01A 1BDMA 3E48A 4UVEA 1E7RA 2XPCA 1X0XA 4E6PA 3NJ8A 3W4IA 3OA0A 1EVJA 3IDSA 4JX8A 1YO6A 3H9QA 4L73A 3IMFA 1IPFA 5JS6A 2PKQO 1AE1A 3AY7A 4U5QA 2NUAA 1S7CA 1U4SA 1CYDA 1Z7BA 2OMEA 4BQRA 1ISMA 3DOOA 4JJGA 5G4KB 1JW9B 2CVOA 2PFGA 5AQ1A 1HDXA 4IS3A 4AG3A 5TS3A 5EPOA 2NM0A 3FWZA 4RVFA 1LLQA 1PZHA 5BSFA 1XR3A 2W8ZA 5CPBA 2AA3A 1WMBA 1GU7A 2PZJA 4OH1A 3JQBC 4QX6A 4IJUA 1H6AA 1N9GB 1U8XX 2VUUA 2B4QA 3QVXA 3A4VA 5IJZA 2CDCA 3K9QO 1LU9A 3PJGA 3PGJA 3DMYA 3DOCA 1N92A 2O3UA 3E1KA 4BKQA 3EAGA 3PDJA 2ZTLA 1GDHA 4BKPA 4CR8A 5JXWA 5JAIA 2Q99A 4GL4A 1XHLA 1ULSA 1PJTA 4BNIA 3C7CB 1ZXLA 1O6ZA 2AQHA 3JQFA 5I9NA 5JAZA 1U1IA 2WWRA 5KJ1A 3RC7A 1KVSA 3PFWO 3OIFA 1V3VA 4OXYA 5K6AC 2QW8A 3W8DA 3STHA 4C7JA 3LT1A 4IXTA 2O3TA 2YW9A 4R3WA 1T2AA 4MVJA 3H5AA 1ZSYA 4UVIA 2E6UX 1GV0A 1R4NB 4E30A 4IDBA 1GD1O 2X1HA 1O8CA 4U7WA 5MDHA 3GY0A 3WBBA 2PGDA 2LDXA 3NYWA 4TVBA 2O48X 4GWKA 1I3KA 4YRDA 3GZNB 3INTA 4CL3A 1PZEA 1DLJA 2P9CA 2J5QA 2VTEA 3DDNA 3ULKA 1RKXA 2J3HA 1NFFA 1DOHA 4DQVA 2CMDA 4WECA 4PZCA 4YEDA 1D7OA 2VHVA 1JAYA 2Q1WA 4DVJA 1ZK3A 5KOIA 3INGA 4FIZA 4NBVA 2VN8A 1HT0A 1LRKA 5HRUA 1ZMOA 4BNYA 1ONPA 3LSYA 1Q7CA 1E5LA 4WK6A 3H6KA 1A7KA 1SC6A 3OFSA 4HFNA 2DBQA 3TWOA 5CG1A 3WYBA 1U5CA 1IULA 3ADPA 1K6IA 3Q3CA 3IJPA 3PPIA 4N5NA 3KSZO 3JD0A 1SMKA 3ZH2A 2PLAA 4MVJM 3JQAB 3PYXA 1EVIA 1E92A 1BXZA 2B4RO 4ZHSA 2ET6A 2VOJA 3T4XA 4K26A 3RASA 2DTEA 3F1KA 1YBVA 3H65A 4NBRA 4DPLA 1QG6A 1XG5A 5CPFA 3KYCB 2JHFA 3GVPA 3ZI0A 5DOVA 4JIGA 4NBWA 3GN1A 3ITKA 4J91A 1YQGA 3FBGA 4PG5A 3WTBA 2EKPA 2JCYA 3OIDA 3P19A 4A7PA 3HNPA 1P45A 2AE1A 2JAPA 5JC1A 1G0NA 4WE3A 1FDVA 3EUWA 4D3SA 5GY7A 1CEQA 5L53A 1HLDA 1VL0A 2DM6A 3D4OA 3A28A 3ZWNA 1E77A 3GUYA 5CHEA 2VNAA 4GAEA 4FGWA 1ZIDA 3KEQA 3EHEA 1JKJA 1B2LA 1D8AA 2DTDA 2E49A 3PHLA 4AICA 2IXAA 2EEZA 4IDCA 3OICA 1TEHA 5K6AA 4GKBA 4ESOA 4E3ZA 4R16A 4GPD1 2VWHA 5T73A 5IG2A 2GR9A 3G1UA 3ON5A 1HZJA 2A94A 1YB5A 3AOGA 1EBFA 5U4QA 4BNNA 1DC4A 2AHRA 4MVJP 4OJNA 5CEEA 3PQDA 4EUEA 2ZYDA 2ZQZA 4B7XA 3HFGA 1NFRA 1PIWA 3RUDA 3VKUA 1B3RA 4M8SA 4RPGA 2ZB7A 4NZ9A 5G4LA 3KVOA 4JBGA 3I9OA 2RH4A 3H8VA 4J1SA 1EFKA 1FXSA 3S2IA 1DIAA 5JDIC 4BQPA 4EUHA 1J6UA 1WZEA 3PQFA 4CQMA 2RHCA 2AQIA 3HE3A 1SNYA 3RJ9A 4XIJA 4YR9A 4GH5A 2X0RA 5GMOA 1DJQA 2WD7A 3Q1LA 4B4UA 4IINA 4RDIA 2CF6A 2YY7A 4EUFA 3GNSA 3KOUA 4BB6A 2ZTVA 1YBAA 2PD4A 2D2IA 1OBFO 2X22A 4BGIA 1XCBA 4NK4A 4YT2A 2NQ8A 3QY9A 2PZLA 3TZHA 3QSGA 4ALNA 2Y05A 1EE9A 3DONA 3I5MA 4BV9A 5KJ6A 4N5MA 4D46A 4CV2A 3GGGA 4IMRA 3VVBA 4D43A 1BGVA 3TFOA 3U4HA 3TPCA 1PS8A 4N54A 3PQEA 2DFDA 1NAIA 2JAHA 3P5SA 4LISA 3JV7A 3DZHA 4QO8A 4JROA 2EF1A 1R4MB 1YL5A 1I5RA 4IDDA 4QO7A 1ZJYA 2EW8A 1OZAA 3I23A 3JD3A 1LC3A 3UUWA 3NT2A 2LDBA 3TF5A 3VTFA 2D0IA 1T2DA 3B1JA 3MTJA 3FN4A 3QHAA 1U2GA 3GT0A 3IC5A 1LI4A 3ASUA 4RLHA 1O94A 2HMUA 2I6TA 4CJXA 1WDMA 2P9GA 4J7UA 4J1TA 1DIRA 1CQIA 1JLLA 4CUJA 2VWQA 3L6OO 3TRIA 3KYDA 3U4CA 4WLUA 1WZIA 1AHHA 3CUKA 3ENNA 2G1UA 3A1NA 3HQ4O 4HWKA 1MGOA 5L7WA 1R6DA 8ADHA 2ZTUA 3TZQA 5KVSA 3PHHA 1WPQA 4J3FA 3BTOA 2O3QA 3TOZA 2GPTA 5I8ZA 1I10A 4DBVO 3G79A 3JQ9C 4HV4A 2RBEA 4CQMD 4G65A 1LDYA 5CG2A 4CUZA 3LC2O 2A4KA 3EZYA 1AGNA 3CMMA 4OMUA 3F5QA 4M1QA 3S2GA 4B8ZA 1ZVMA 1KIFA 4ZGWA 3PJFA 2ZYGA 4BNVA 4PRKA 4R68A 1KVRA 5AXAA 5JDIA 1WAMA 2BLLA 3LF1A 1PGQA 8LDHA 2VYNA 2RAFA 3WWYA 5JMPA 3WGHA 3NJ4A 5I8WA 3UW3A 4JNKA 2B5VA 2OORA 3FPLA 4KUEA 3DO5A 1UP7A 2GN6A 4RF4A 3KM0A 1DBVO 3U09A 3R6DA 4JJIA 1D1TA 1GCUA 1GPJA 1YB1A 3TL3A 7ADHA 3BMOA 5DCYA 1N2SA 2PZKA 5CDYA 1A4IA 1B8VA 5A04A 1DFHA 2FZWA 4FFMA 3V8BA 1AXGA 4N18A 1HYGA 1I2ZA 1ZZEA 2EW2A 1E5QA 4WLNA 3TQHA 3OQBA 3JYOA 5JC8A 1GTMA 4R69A 3WMWA 4PN3A 4TMFA 2X9GA 3OH8A 4ZJUA 4Z9XA 1M67A 2VUSA 3HN2A 4J43A 4KMSA 2PTGA 3RKUA 4Z0PA 3W1VA 1B3BA 1YRLA 3G1TA 1R16A 4DLAA 4PLVA 3JQGA 1U7TA 4LW8A 3JYPA 4OGWA 5C7OO 1ARZA 2VYVA 2C5AA 3KHUA 4TRRA 4MVJG 1E3LA 3VPHA 1DC5A 1X0VA 1ULUA 3P2YA 4CM6A 1YE3A 4OKNA 1IZ0A 1HE5A 4MIOA 5A9SA 3AFNA 4J1NA 2J5RA 1HLPA 1V9LA 4J90A 4W7HA 2JFHA 2X5JO 5A06A 2Y0CA 1JQBA 4BS9A 1GZ6A 2FRDA 1GEEA 4DLBA 4YBZA 2CUKA 4FDAA 2HCTA 1U3WA 2GASA 1O0SA 1TVEA 3JQ9A 2IEBA 3H2ZA 4I9NA 4ALKA 2E37A 4BNHA 5T57A 4YAEA 5ILGA 1WVGA 1T2EA 2FHSA 1JKIA 3V1UA 2HLPA 1NM5A 2J6IA 4MKRA 2GD1O 2C0CA 4YDRA 1ONOA 1B8PA 4XYEA 2H5LA 2VRCA 4BKOA 5LDGA 3C1OA 4CLDA 5COQA 5FYDA 2ZB8A 1Q1NA 3PYMA 3GA0A 3MTGA 4H15A 3CH6A 4UVGA 4CM5A 1VKNA 1UZLA 4K6FA 2Q1UA 1L7DA 2GF2A 3ZZNA 5L7YA 1LJ8A 3ZWOA 5KTKA 1XLTA 4DPKA 1ISIA 3GK3A 3ST7A 3OQ6A 2C29D 1DHTA 5G2OA 3U5TA 1T4DA 3R1IA 3H4VA 4WKGA 4YRBA 4F45A 4E0BA 3JD1A 5BSHA 4MVJF 4CQLB 2VYVD 2XXJA 1AXEA 4QECA 4O63O 4W6ZA 1PGJA 1U9JA 2BI8A 3C85A 3EK2A 3M2TA 4JN6B 1CQJA 5G4KA 3RAJA 4D0RA 1P0FA 5I7VA 3VAZA 3FHLA 2A35A 4BUCA 1UZMA 2XF8A 3T7EA 3WFJA 3LT2A 4CM3A 4DWVA 2GLXA 4EDFA 4HKTA 1QYXA 4E2YA 4OQZA 1N9GA 1Q7GA 3RC9A 4CM8B 2NTJA 4YWJA 2F00A 4R9SA 1EDZA 4AJOA 4EJMA 5B1YA 3I83A 3PVZA 5ENDA 3TZKA 1L7EA 3ZV4A 3QWFA 4HNHA 4BHTA 4G81A 4M49A 4CMBA 1FJHA 3WS7A 4WOKA 5H81A 1LQTA 4LVCA 3WYCA 2I5PO 3FNHA 3D5TA 3RUHA 3VVCA 4KUHA 4BNMA 4PZDA 4HY3A 4LMPA 1WP4A 2O2SA 4XGKA 4P8RA 1GUFA 3VPXA 4YYZA 3HSKA 4XKJA 4H7PA 4OOFA 4WEQA 3FI9A 4CMJA 1R4NA 3NTQA 4II3A 2VT2A 3OHSX 1LXCA 4P4LA 5L3ZA 3LVFO 4FBGA 1A9YA 3IIEA 1MXFA 3NT5A 1V35A 2YV1A 3GZNA 2DBRA 3LZ6A 4HFJA 3AY6A 1P1KA 3SVTA 4ID9A 4XIYA 2X0IA 3L4SO 4KZPA 5DCUA 3HB4X 3BHJA 5A5FA 5JYAA 1V8BA 4BO3A 1PL7A 4D45A 1U3UA 4KTTE 3GDOA 3U4IA 4A03A 5K9ZA 2V65A 5AXCA 3WWZA 4TZTA 2Z1MA 3AUSA 3GOHA 2O7QA 3G0OA 4ROSA 4KQWA 4JLWA 5IN5A 3RFVA 3HDYA 4BNFA 1A4UA 1O9BA 1P1JA 2W2LA 3D1LA 4ILKA 3OBBA 1EUCA 4XRGA 3MOGA 4OXNA 4YJHB 2V6BA 3JQAA 5KCZA 4PLFA 2C59A 4Y9DA 5J9GA 4IZHA 3G17A 1JA9A 4NFHA 3V1YA 3WQRA 4AJHA 1NX6A 4FFRA 5KJFA 3OJOA 3KYCA 3D64A 3CMCO 1XQ6A 2QRJA 3DAPA 1YJ8A 1Z73A 2BELA 4CM9A 2JL1A 3B70A 1ENYA 3QWBA 4MKXA 3LK7A 4XWYA 4C4OA 3H9GA 3AJRA 3EVNA 2P68A 3GRPA 1DC6A 4LRSB 2IYPA 4D79A 4R54A 1WDKA 2HUNA 2YDXA 3DC2A 3PEFA 3ZN2A 4DUPA 2HO5A 4WGGA 3QJ5A 4XJSA 5HS6A 4WCFB 1GY8A 1UXJA 1CF2O 1QYWA 1W6UA 1VM6A 1DIBA 4Y67A 2C54A 4WLVA 1P9LA 2X7HA 1PQPA 3T7CA 4RL6A 3KB6A 3O26A 2CVQA 4BB5A 4GI2A 4RGBA 1XELA 5JAMA 3FD8A 2O3JA 1LUAA 1X7GA 1FDWA
chains in the Genus database with same CATH superfamily
2P9FA 1WNTA 3G8BA 5LZ7A 1I6MA 1RLOA 4RH3A 2QUAA 2V1UA 3T41A 3MUFA 2YBDA 2YVQA 3FSRA 3I76A 4GX5A 1KEEA 2CFOA 4CMEC 2V0GA 4CM1A 3FR7A 4NV0A 4YAWA 3PX3A 2A9OA 1CJBA 3SOZA 2A9FA 3DNFA 1F0YA 2HXGA 3ABSB 4MO2A 4DIUA 6CHYA 2JGLA 4FGKA 2PEYA 3I12A 3JARB 2QMZA 4HB4A 1II8B 2HRDA 4MPPA 1VPEA 4Q93A 521PA 2Z6UA 5LP6C 2PRZA 2WOOA 4IOKA 5K3BA 2W2LD 4M0EA 1U7DA 2ODWA 1WMSA 3HVKA 3KELA 4ZVQA 4BKRA 5TQ2A 4DEVA 1RWNA 5HSGA 3L93A 5JH7F 4NH0A 3HFJA 4QDJA 3LD9A 4EAAA 1UK7A 2GCOA 1NYTA 4JEUA 4QWMA 1SZPA 4IGFA 4EKYA 2L17A 4NEGA 4R7TA 3DHNA 4QRIA 4V0RA 4W9RA 1NG1A 3QE3A 4PFQA 5JTUA 1YJBA 3U9TA 1VKZA 3WSWA 3K6KA 1BQ3A 1RD4A 3A1VA 5FB3A 3NRCA 5SZIA 3RYFA 3OE1A 5F1OA 3AEQA 4UXIA 4D57A 3NWJA 2RI6A 3Q4GA 4CEIB 5DASA 1MRZA 2W4QA 1ZJ5A 2EG5A 2WJ4A 4NOKA 5JSKA 4ND2A 3E3LA 2PX2A 4AVYA 4F5WA 4RTQA 3S55A 2BDTA 1A8UA 2KPOA 3M34A 1UBMS 2WHRA 1TQ4A 3UXMA 1ZUWA 1N1DA 5AK3A 5CIWA 4RQUA 3EFHA 8AT1A 2RG1A 2KB0A 2PCJA 2WUWE 1C9NA 4I4TA 1VBFA 3ANNA 4QULA 4ZOLB 3FPEA 5JQGA 2GQ0A 3AX6A 1CP3A 1GSAA 2VQDA 3R3WA 5ERXA 3W3AH 1B23P 3SXUA 1JQ3A 1UDCA 1L4GA 5EHXA 2DZDA 1QYCA 3CRMA 1OX4B 3LWZA 1CS0A 1I5OA 3Q3HA 1GITA 3O9VA 1NY5A 4Q1BA 4L5JA 3LOQA 5KKNB 1WY7A 2PWZA 4D26A 4K6MA 1Q0SA 4JCCA 1JKMA 2G67A 3EG9A 4EHLA 4O4JA 2PR7A 4X1KB 3W34A 3KT0A 4O5AA 4LRTB 2AI3A 3WIOA 3QKSB 3JYLA 3GEDA 3OT4A 5DE3A 4Q15A 4EECA 3THYA 4NTZA 4JIMA 2DUWA 4A23A 4YRAA 3AESB 1G38A 3FGNA 4JKIA 5T67A 1V47A 3ZV5A 2B7LA 3LLMA 2A5DA 3FF4A 1SA0A 3CNOA 2ADMA 3DHEA 5AOCA 1E3MA 4CDRA 1NPTO 3ROTA 4YRSA 4DC0A 5EG5A 3ZHZA 1F8FA 1KOFA 4JOCA 1JDBC 3DZIA 4OXRA 3DGEC 1SHZA 3E03A 5CW2A 3DQZA 1ONBA 3G0IA 1GRCA 3T4PA 4F4FA 4BO4A 1LPNA 3ZWVA 4L72A 4CKEB 1QFMA 1KYQA 1X7YB 1P9RA 3K73O 3M1YA 4KXUA 5ISMA 4HVLA 2FXVA 3G0DA 5DM70 1RQRA 2BJVA 2V7TA 4KQGA 2NU9B 3TBFA 1M2WA 7REQA 5CIQA 3DMPA 1KDRA 1GILA 3AEUA 1BDJA 1PTJC 2D06A 3ZHTA 4Z6KA 3PD1A 1GUAA 2WY2D 3G5MA 1OI2A 3AKYA 3C6YA 3U7HB 1YDEA 1XZIA 3F7NA 4QDUA 3L0SA 1Q7EA 4LCBA 1MB3A 2I8AA 3GJ4A 4G5SA 4C4ZA 2IDMA 3UFXB 1ZNQO 3IOMA 2ZS9A 2X3YA 1IOLA 1L4KA 3RU7A 1H65A 3I9LA 2HEIA 3PQ2A 1ZR4A 1LDEA 2J9XB 1Y8AA 1JFTA 3ASYA 1US8B 3CQ9A 4R8RA 4DLUA 1BCRB 4M3NA 4RWEA 2FW7A 1IN5A 1XL1A 4G36A 5HDBB 1W4AA 3JQ7B 4TKLA 4AROA 2O50A 4YP1A 3R75A 3DEHA 2AC2A 2G82A 2I3AA 1HSOA 2IEZA 5B3AA 3BA1A 4ND5A 3NT4A 4YDSA 1U98A 4CIAA 1WQ3A 2JIPA 5F1YA 1S3GA 2YV4A 1MENA 2CD7A 3L4BA 4LYGA 1ESDA 1P7ZA 4V0QA 2I2BA 3GP8A 3ZE0B 1G8FA 1I4LD 3KV3O 4MIYA 3W3AA 3PUXA 4CNQA 4YAKA 2Q3LA 3MD0A 3UXYA 3AEKA 3LAWA 4CG1A 4Z5XA 1B0AA 5BMVB 1D0IA 2M1XA 3B60A 3T7DA 2JHCA 4JCOA 1GWNA 4J07A 3ZK7A 4X61A 1U28A 2F64A 1XBTA 1GNQA 3GIDA 1R4AA 3SQLA 4DCGA 4US1R 4PNEA 3R5JA 1XDGA 4C87A 3G9ZA 2X0FA 4C0LA 1QM5A 4YRFA 4WK2B 3C41J 1GTL1 3WWEA 4OVKA 4A8JB 2RGRA 2PWPA 4V0ME 4D98A 4ERNA 4YRQA 1TAHA 1TQ2A 1VE7A 5JMWA 4FKMA 4RK5A 1RWMA 3PGKA 1BE1A 3NOQA 1PNQA 4B3RB 1YR1A 3K4HA 4D99A 1NC1A 1EKXA 1EWVA 1U3VA 4WERA 4BC1A 4RXMA 4B3SB 1D6SA 3OLXA 4DKXA 1A8PA 4GI3A 4KAAA 3RBXA 1X1DA 2G72A 2LCFA 4LPSA 2NT3A 3N86A 3WLOA 4ECAA 1IMJA 1NQXA 1O94C 4X64B 1Y3FE 4M99A 4OJQA 2NIPA 3GD7A 3P9ZA 3EOAI 3H2YA 4IIJF 3KTFA 1S96A 3DCYA 4OLHA 2FWIA 4S1VA 3E2IA 3IDFA 2IBSA 4ED9A 2IUYA 5C1PA 3BFJA 4KNWA 1XMIA 2BFBA 4IJ6A 2GBLA 4C7OB 3YASA 4DM4A 4UQLA 2VPZA 4HATA 4NENB 3VYRB 1YQ9A 1XZJA 3MMSA 3EDCA 4MUXA 1LI7A 4D02A 1FYWA 1JLRA 5C7LO 1I7PA 3QKRA 4RY8A 5CT8A 3ZWKA 4HNAB 2F3RA 1Y4ZA 3IQIX 1E0DA 1MZVA 3BXPA 4R8SA 4G67A 3RJ5A 4QQKA 1UQTA 4K9RA 1GPYA 2C9OA 4M1TA 4LE1A 4RIHA 3UM9A 2DUJA 2IELA 2K87A 2QYSA 3PDUA 5AI4A 5A7HA 2M6KA 3TSCA 3TGLA 5EESA 1HT2E 2I6QA 3ZWMA 2QBYA 1KK1A 4F5YA 2WWYA 1VE9A 2CXRA 4I55A 4M9SA 4P38A 5E38A 4RM3A 2FMFA 3GLIE 2OBNA 3C1AA 4UU7A 1Y5IA 2IP2A 3W3AD 4WWHA 4EFMA 5ALVA 5LA6F 1DRKA 5BSUA 4NVRA 1YONA 1ODFA 1HOTA 1TU3A 1PWXA 2VIIA 4HTFA 5MF6A 5E9WA 3UBTA 3KOWA 5C8XA 4DPMA 3L7DA 2R3SA 4OI2A 2SICE 4WASA 4HUQA 4FZRA 4KCGA 3ZU2A 5AUOB 3JQCA 4G0XA 4Z9FA 5JT1A 3FCSB 4I5IA 2OORC 1RJ9A 2WSMA 4G1CA 5AHKA 2G4VA 3PUZA 4BRUA 4Y2RA 4AKTA 1H2AS 4N3GA 3T4EA 2FP3A 4MOWA 4NHOA 3K92A 5K0GA 1SXIA 1I30A 5FO1A 1JTEA 3ZVMA 3PPWA 2PKEA 3HZRA 4R9RA 2SHKA 4GP9A 1A5SB 4J16A 4UBOA 4TTTS 3IEIA 3IURA 4TVKA 2NU8A 1MV5A 1W34A 4YLYA 4B74A 2HRBA 1UAAA 2B8TA 2DR0A 2FR8C 4V38A 1TUGA 1Y8QB 2C20A 2R6FA 1Y3IA 3EPJA 3B1XA 3DEYX 3UKOA 2TS1A 2O14A 4CMCA 3HP7A 3LY7A 1NVVR 1KEZA 4MLDA 3VH2A 4YXWA 2GHQA 1N4DA 1UADA 4HJRA 1VPWA 3SIXA 2FWBA 3PLAE 3ZDFA 4EQ6B 5IFKA 3R4CA 3FCYA 4X63A 5LXTB 4RVCA 5FWXB 1KFJB 4HBZA 4BVEA 1AHPA 4YLEA 3ZU4A 4I5EA 1O2DA 2BRUC 2XEXA 4HLUC 3TKLA 4Q4JA 5LD2B 4EB3A 1L9XA 1YZGA 1Q1ZA 1QMGA 1ZSNA 1NW9B 2H7XA 4A2WA 3FTFA 3QV1A 3SP1A 1XPUA 2IHTA 2G0TA 2CLOB 1LJUA 3C3AA 1CLUA 3L6UA 4TLCA 3TDMA 1FTSA 3P9RA 4DBZA 1UOQA 5LOVF 2VBCA 1QIJA 3VJMA 3ZGYA 5HDQA 3UVEA 6ADHA 1W35A 2DFVA 1FDOA 3T5BA 7GPBA 4ZXFA 2Q7OE 3STTA 5TF0A 3TG8A 2DVMA 4EY3A 2CDAA 3I4LA 1QV6A 2AJLI 2K6GA 4RZ2A 3FMVA 5DKFA 1C9JA 2FRDC 1QORA 2FOXA 3GP5A 3KSDO 1ZWKA 4HSGA 4PSDA 1QNFA 2P2CA 2P5UA 4U3JA 5GJBA 1YRQA 1XMVA 2F1IA 4G9BA 1VCOA 4IL5A 1LW7A 3DLAA 4U7HA 3W2EA 4DCTA 1G7TA 2O2GA 3K0AB 3ZX4A 4Z4EA 3MK31 4ZANA 5FWYB 4KQMA 4Q00A 4CT0A 5C0OE 4AXXA 5JXJA 4BV8A 3IIIA 4N3CA 4RABA 4RKFA 2DKOA 2XVMA 2R2GA 2VUIB 3AMVA 1BXKA 2C8VA 1PV1A 1SOWA 1SVUA 3W3ZB 3JQ8B 1QGOA 3IERA 5A4FS 4C3OB 1HO3A 4IWNA 3BL6A 3M6XA 4Y3UA 1XQ1A 4MQFB 5BQFA 2FDRA 3ADKA 8ABPA 5T5QA 2X1LA 4CMGA 2WJJA 5FFNA 221PA 3B6EA 2ZITA 3H97A 3IESA 3SQMA 5AVYA 2BSAA 2C2KA 1SB8A 4J2HA 2IVZA 4BCCA 2YN0A 1X1AA 2XGJA 1ZQ1A 2QAJA 3EC1A 2ZSJA 1T2UA 1ZM2A 4HFRA 4D6XA 1EUZA 1SCIA 4G89A 4YJHA 2F9MA 1HDZA 1E1NA 2BHNA 2O8EB 1NMXA 2HAEA 3R7BA 2JHPA 4YXWD 1KVUA 3QLVA 5KWVA 5AI9A 1VIAA 3RVKA 3DEIA 3G85A 5AVSA 2FFHA 5F2NA 1PKEA 1N3YA 3KKNA 3HGQA 2VP6A 2WT9A 2B98A 5KIAA 1VC2A 4YLGA 5B3KA 4ZJZA 1R8QA 2ZK7A 4MAFA 2BEWA 2BFOA 2OCDA 3SICE 3SXJA 4QAJA 3T1HB 3H6HA 5AHWA 3W8NA 4L0MA 2LIVA 2M2IA 2YQZA 2ERXA 3DXFA 1E5VA 3PQ5A 4DABA 5KEIA 3QKIA 1QU2A 2C96A 4IXWA 2G17A 2AH5A 3VNVA 4J9VA 5SZJA 5BT8A 1OXKB 3AGPA 1MEOA 3D3NA 3F5SA 5CJPA 5JY6A 3FKQA 3VV3A 3D54D 4Q03A 3MMPA 4M21A 1TMKA 1RC1A 2HA7A 3EYAA 4OKIA 3WGLA 3W5DA 1DWOA 1MC1A 2WYIA 4XM2A 3LDAA 4POOA 5P8WA 1POXA 2IXBA 3AOEA 2QX9A 1Z25A 1C2TA 2JDIA 3TUJC 1HXHA 1Y8CA 3SEZA 1KYWA 1ORWA 1ZD3A 3A1TA 3ENKA 3BSSA 3MJTA 2J7PD 3A0UA 3QGMA 4LIPD 5EZYB 4D6PA 1DTWA 5E6SB 5JAOA 3HCOA 2HMSA 1U2ZA 1NQ5A 2UVDA 3BCRA 3LCCA 4HDRA 4FDMA 3NBAA 2HU5A 2HJ9A 5L7TA 1WMAA 4MROA 4XX0B 1XEXA 1C5KA 1RMTA 2MSLA 3GEGA 3HY6A 2HT6A 3OO1A 1KS9A 5JY1A 3AT1A 4FHCA 1O08A 4Z53A 3JWGA 4FFVA 7ABPA 1Z5ZA 4I4TF 2VP3A 5JQGF 4OHOA 4NFSA 1EX1A 5JRZA 4GX1A 2P2LA 2E4ZA 2R68A 4UUNA 1JG1A 1NXTA 2Z2ZA 4HJXA 4L9AA 4D4LA 2XE8A 3NP7A 3CVYA 2FZGA 3GBVA 4GVLA 5HFJA 3ZHUA 1GT6A 4NYMR 3D8TA 3KAPA 1CDZA 2OC4A 3KVVA 4OX9B 1YJ5A 3N07A 3VU3A 2VKTA 2TMGA 3S68A 3FCUB 1QJCA 2WIKA 1ADJA 4O4JF 1T0HB 1QIFA 2HWYA 2WJGA 1X9IA 1JHYA 1T15A 2J30A 1DUSA 3ZKWB 5L4SA 5TQVA 2PV7A 1IWPB 3BJZA 4KIGA 3ZC3A 2VO1A 1DX6A 5F3WB 4I5GA 4BNUA 4LSMA 1DC8A 1KI7A 4B2PA 3RM3A 3V8MA 1E6CA 1GP2A 4YAUA 1UBNA 1G64A 2C0QA 4Y18A 1MVLA 4DGQA 2H2IA 2GAIA 1ZSVA 2P90A 3LVBA 5LLTA 3B51X 3QVJA 2EIXA 3U6BA 5D87A 1AF7A 4B75A 1ZU4A 1UBOS 4MCHA 1RHQA 1BX0A 4Q7KA 1XDDA 1IN6A 2PQMA 4ANFA 4KGVA 4P3OA 1YR2A 2G9RA 2F3QA 5CLLA 1Y81A 1NU8A 3U4QB 1DJNA 1G6OA 4IHJA 3TFWA 3T3GA 1JQEA 3DW3X 4P08A 5AVVA 2GXQA 1Q50A 3W78A 1AQ6A 4YV1A 3CYFA 4BJ3A 2PIAA 5AUPB 4HNTA 1CSEE 1M72A 3ELUA 1B15A 1J5EB 5I4KA 1SOAA 2JDID 2OFOA 1CK4A 2Z30A 4NZOA 1Z0FA 4P5PA 4JR2A 4W1PA 3SDZA 3LX8A 2AG6A 5FOQA 1NBOA 4G2NA 1KSHA 3CJQA 1DC7A 4JHLA 4KI0A 4PZPA 3TCKA 3EPRA 5ELMA 3SHFA 5BWLA 2R1TA 3C24A 1D09A 4TROA 5EQFA 2IDZA 1FMCA 3BJRA 4UM8B 4WACA 3MT8A 1EWTA 1FW8A 5E1OA 1N6PA 2C31A 1L1FA 4AJKA 3BMCA 1XSEA 2QAGA 4A8JC 1XZAA 5DTRA 1Z12A 3ETDA 3WRXC 4Z7NB 4HWSA 1JDTA 4DLTA 4PM4A 1T4MA 4P3YA 3USCS 1PYDA 3O1HB 4WJLA 1Y9JA 3KO8A 4MX8A 1PD1A 2OLEA 4TSKA 1RHRA 3ASVA 1CE8B 2QUBA 5FI5A 2P3OA 1WEHA 1KR2A 3TCNA 4ZV7A 1G2PA 3RARA 5DGTA 4AW9A 1QBKC 1VLVA 2XVYA 4HF7A 5DGDA 4DA4A 5ELXA 1RZ3A 4RPKA 4ER3A 3BJIC 3ACCA 1P7VA 1Z4KA 1EDDA 1MJNA 4FPXA 5EIEA 1JDJA 5L4NA 1KERA 1UPFA 2WSBA 3QI7A 2OHOA 1I7BB 2C4VA 3FETA 3M6AA 2F1RA 1SHLA 1VP9A 4F1WA 5K7SA 1CYEA 5KDOA 5M34A 3VTKA 2D4HA 1P80A 2WKPA 3GFQA 3L0DA 1C8LA 1WS6A 4UEWA 3PXUA 4IDNA 1PJRA 4BL5A 1K5HA 3CNLA 1Q1BA 4LDZA 1FXWA 1GL9B 1V3TA 2N9UA 2WTXA 1VCNA 3N2YA 2I4LA 1GFZA 4I4CA 2FSGA 4N8DA 4AD8A 4UNRA 4GM4A 4WINA 4JSTA 1Q11A 2QRHA 2JJYA 4TT3D 4I8XA 1P19A 1QTIA 2A88A 1E3JA 3RV3A 1ESNA 3IPRA 2P69A 3AUUA 1MX3A 3BJEA 2GFQA 4EL5A 4CG2A 4YJFA 4UCFA 3AHHA 4HCJA 4PRZA 3I61A 5KQPA 4Q21A 3DFUA 4NH4A 4ODIA 4JUFA 4ZCLA 1N7IA 2NTNA 3AVPA 3GGPA 2HMYB 1C81A 1ZN2A 3AYXB 3EQ7A 4CCWA 4CCYA 3MRVA 1B6SA 1FBNA 1VLZA 2AWOA 2JFZA 5IBRA 1X8JA 3UPDA 2IYYA 1AS0A 3BB1A 3NKFA 3OC6A 4RUKA 3OX4A 5GP1A 1ZGCA 2FF5A 1CTQA 3QOWA 4XH9B 2POCA 5DJ5A 1G21A 5BR1A 2JPDA 5IM4A 4QFBA 1SIBE 3VFDA 4AWXA 1UP4A 2DU8A 4NAHA 4E4TA 1G6HA 1I1OA 4ZEVA 4QGBA 3HV2A 1I6KA 3ADOA 3DTYA 3G2NA 4TKMA 4K87A 3BMQB 1VKRA 2OT3B 1O96A 3OEWA 1L9KA 1QX4A 1TAQA 2HA6A 4PE5B 3SQOA 4C30A 4L76A 3EXIB 4EM6A 4X7BA 2QX7A 5GM2A 3JAWB 3UV6A 1E5XA 3FMOB 1K3FA 1V8DA 2QRMA 2P6MA 1TMOA 1X1TA 4G3XA 4XE5A 5IHPA 4JYBA 1XDZA 2H57A 4RGVA 3PIDA 1FE8A 5CGQB 4N5LA 4I55F 4OP2A 4PYMA 3B1WA 1XNJA 1A9ZA 1EE2A 3H2KA 4LOAA 4AWBA 4YIHA 2VJBA 5K45A 4MVJI 1W73A 3GT4A 1CC1S 1R3UA 5GM1A 3VZCA 4K3UA 5A3JA 3ACDA 1H5QA 2HJRA 4C0AC 1P1IA 4IIEA 4C22A 1AB6A 2IE0A 1SK9A 2O5VA 3SS7X 5JZ9A 2PL5A 2IYLD 4MAMA 3TN7A 5JD4A 2ZXFA 4EF5A 4KAJA 1PDVA 6LDHA 4EFKA 1VYVA 3AW8A 1T6XA 5MFZA 3PJEA 3WRYC 5LD2C 2WAOA 1C9DB 4I6JA 4BLTA 3PVCA 3V9AA 1C3OB 1OFTA 4D8VA 1WJGA 3PFIA 3R9XB 4CGZA 4KDRA 4C78A 4ND1A 4NNOA 3WG9A 4ZZ3A 2C94A 1D07A 3LDHA 2C92A 2WA2A 3MMZA 3P0EA 5GTDA 3LX6A 1Y3HA 1M2VB 4TTQA 4MRMB 1F8GA 1I7LA 5EXXA 5HJEA 3O8CA 3DW1X 1LW6E 4YT8A 3KZXA 1G19A 1OVMA 2HMWA 2Y1GA 3DZ4B 2H1HA 2IZZA 2GILA 3PFHA 1Y6RA 2BBOA 4MCJA 5FKJA 3MS4A 4ZK6A 5KVVA 2GCGA 3PC6A 3ZGNA 2EP7A 4XQEA 4BYMA 1QLJA 5IC4A 3PTAA 5AM1A 1HZZC 2NVOA 3PYLA 1SELA 1Z6XA 4ZO7A 4Y2XA 3WDSA 1BXGA 2X4GA 5IN4A 3K71B 1L7XA 3UWDA 1Z63A 3MGGA 1G20E 1T8WA 1Y3CE 2QD4A 1WXXA 1DEKA 4LJ9A 2QP4A 2V7QA 4K9MA 4LS3A 4MJ3A 4MV8A 3Q8WA 4F3KA 1EDEA 1DHRA 1ODKA 3GLKA 3DMGA 3RHFA 4IVPA 4EZBA 4QTYA 1EVYA 1J07A 4P4GA 5BWNA 1EGAA 5JFTA 3U44A 4WKPA 2WE7A 3LHKA 1JIQA 4CWAA 8MHTA 3FCCA 3NHAA 4NIMA 5IF9A 2BIFA 2OESA 1BW9B 1BRMA 1DCKA 4P4TA 3I52A 3H2BA 3U3ZA 1K6EA 1GLGA 2QLLA 2R6R1 4QTXA 5BW8A 5H1YA 3HXLA 4LDAA 3AFMA 2J7KA 4MAAA 2VBIA 1N6RA 4IHQA 4EJSB 2P5TB 3LCJA 1GZ7A 4IZIA 4OSOA 3B8EA 4UAGA 2A33A 3S29A 3DLPX 3PWTA 3WHIA 3IV9A 4MQEA 5JU6A 4PLZA 1YU6A 3KEMA 3CEAA 5AK6A 3HA5A 1VJ0A 2CFCA 2QI9C 3AL3A 1SKAA 4WZBA 2X6TA 3WYNA 3X43A 4BLQA 3HLYA 3CE6A 1CIJA 1QG2A 1Q91A 2H1SA 1OOEA 1Y8RA 1R0SA 2IZ0A 3IPAA 1BCSA 2A67A 3C5CA 3OQHA 1FTYA 3IH5A 4LHYA 3ESDA 2ZM6B 2QAIA 2CNLA 2OXEA 1RZRA 2Z3ZA 1TVKB 2VWPA 1XUOA 3H1AA 4ZQCB 1NVTA 4EA8A 3MOIA 1DKRA 5C4GB 1GGVA 2A0KA 5DTMA 5K8TA 1XTPA 2AJTA 1E3IA 5GV8A 5B30A 1R0ZA 3KALA 4OHZA 1XMOB 1YZUA 1Z0AA 5DI3B 4YUWA 4F6RA 1FDTA 3ECAA 1TD9A 3GG9A 4TS4A 5TGZA 5LU8A 1TKCA 2P9YA 1S89A 1R6UA 2OSVA 1L5OA 3O90A 2Q4EA 1TF7A 1PP4A 3OVMA 4DMLA 3LHFA 4CM7A 4FR0A 1P3JA 3JZFA 3WGZA 3AU9A 4R83A 1YVRA 4WCDA 1QKKA 1U0BB 1XD2B 4TZ6A 2V6JA 3A6ZA 1E8MA 3B7WA 3EDOA 3DFKA 1U0LA 4N7BA 1U81A 5G0TA 1ZD9A 3MS7A 1BGWA 3UTCA 4H4EA 2VRWA 3ORFA 1X1EA 2V7QD 4HGOA 4UVDA 5E3IA 3ZUGA 1GRVA 2IIVA 3AJDA 3BXZA 3SZ3A 1PNOA 4XVHA 5C1IA 1JHOA 1QYDA 4L8WB 2C82A 4RBNA 2ISCA 2ZAOA 3AM1A 2AUTA 1MW8X 4BY9E 2QN6A 2UZ1B 1KFBB 3PTZA 1L5VA 1FNBA 4O89A 1WU7A 2Z04A 3B89A 3BDAA 4XR4A 1LKZA 1CJTC 5C31A 1CU1A 1C0EA 4F6LA 3V4ZA 1X3LA 1N0HA 1C3XA 1UQRA 2ONCA 3GJYA 5G1OA 4PRLA 2YOGA 4MUYA 3TR6A 3JRNA 4C14A 2X40A 2Z3WA 5FIUA 2G0AA 5FOWA 1RJDA 5K0NA 5CLFA 1PL0A 2Z2IA 2BMWA 1RQ7A 5HQ3B 3EEOA 2XB2A 4C76A 4RTSA 4A27A 2JFUA 3OWHA 1YIAA 3GNTA 3TNYA 3E6AA 1LRLA 5SYNA 4EUNA 1QGZA 5EN4A 2ZBRA 5CDUA 4GPTA 3UK1A 2BEUA 2CSXA 1U2DA 2YIDA 4Q1EA 2LKCA 3PKZA 1ZHHA 1OGIA 5H3HA 2JIZA 2XQKA 4PG8A 1D2EA 1HDEA 3U80A 3N6VA 1A8IA 2I76A 2ZGVA 1J1IA 4D3ZA 5CD1A 2PUDA 4QBFA 1V5FA 1T24A 2GWHA 1TCVA 1XWFA 3WZLA 5BN4B 2GX6A 1YULA 3D8NA 1I7MB 2I1QA 4F56A 3IWCB 2ON6A 4KMOA 4EARA 1DJLA 3NVMB 1T1EA 3GJQA 1ZM3A 3A9WA 2D5IA 2XYRA 2P3LA 1U0TA 2NSDA 3ILSA 4FX2A 3HC7A 5AKHA 4CTOA 4CG0A 3NIBA 4DAEA 1Q77A 1ZI6A 5A4IS 4MV1A 421PA 1EM6A 2CLFB 4Y2HA 2F43A 5TLSA 1JEDA 2UZ0A 5FBKA 3G02A 4DLZA 2MYTA 1ZAYA 4WK0B 4AB1A 2PU7A 2AW5A 1YACA 2GAOA 2HI0A 3LPMA 3OHMA 4J4BA 2DWOA 4PNPA 3N7UA 1L5FA 4W5JA 1ZW6A 2MYNA 4U6NA 5LBUA 1QVVA 4FFBB 4F3NA 1CUYA 2L82A 1CEXA 2KE5A 4YUVA 2MSDB 2XZDA 3CNEA 4BX9A 2EFDB 3AETB 1SXJA 3GIWA 3UF0A 4B83A 2I4TA 1P7CA 3HI6A 2X0DA 3KZKA 1N9ZA 2MSKA 2CYAA 4JLSA 1ZONA 3ABOB 2IZ1A 4YECA 3K3PA 1QHSA 1FFEA 3MTBA 1EWRA 2V98A 3MILA 1JHVA 1MAUA 4JDUA 4IHJF 4UUPA 4B7UA 1HETA 1QQAA 2GNOA 1D9ZA 2BYTA 1NBAA 2C2BA 1RLJA 2JFBA 2E4AA 4GDMA 3EQ2A 3V2HA 4AO6A 2I7DA 4DJJA 5BWCA 2Y4OA 4YHBA 4AZ3B 1SKMA 3AF5A 2HD4A 1F5SA 3LFUA 4TLLB 5FUXA 1FVFA 3EIEA 3HVIA 1UKBA 2N1MA 2HBQA 4IIFA 1M1NB 3BRWD 3SBOA 3SLKA 2FKNA 3U48A 4V2IA 3WWCA 5ALOA 3BXGA 3GLHB 2WIBA 4XR9A 3IQHX 4WDRA 3ZBUA 3SGLA 2G9NA 3P7MA 4JBXA 4RKEA 4IQ0A 3VDMA 4DANA 2JIZD 2A58A 1HLFA 4H16A 3M81A 5ITZB 4BIIA 4HH0A 1MJHA 2WYUA 5CBKA 4B3IA 1L7QA 1C1XB 3M7IA 4D3XA 3I4CA 4GRDA 4YJGA 5KSWB 4DCCA 1UH5A 2Q7XA 5IDQA 4ALLA 1E7YA 4WZ6A 5B36A 3KU1A 1ZNXA 4KDFA 4MMYB 5I01A 3TDKA 5F3RA 1IN7A 1ONSA 1EP1B 1FCJA 1TT7A 1XF9A 1HURA 1JIVA 3Q2IA 3H11A 4YRRA 1E1MA 1N5MA 1JZQA 5FX2A 3GGOA 1OZGA 4B1FA 3FMGA 1HE2A 1Z2AA 1E2PA 3E4CA 3QIVA 3QPDA 4A1OA 1XCGB 3PG5A 4M0DA 4F4JA 3NCHA 5FI1B 4YUXA 2VBGA 4N49A 4K6KA 2VNIA 2EIHA 3A6KA 2M6RA 3ZWBA 2ZBFA 4FYIA 3LZCA 1VMAA 1YQXA 4E3WA 1SBHA 4ZYLA 3SIRA 2HGZA 2YHIA 1FDSA 1J8QA 3F67A 3IUBA 4S24A 4B6RA 2VPQA 4MLCA 1ZKDA 1IL0A 2P6NA 1TMGE 4UE3S 4S12A 5CR9A 1P0MA 3ROMA 5JRJA 1B42A 4E2ZA 4DLPA 3UANA 4G0WA 2DG2A 1KH2A 1E18A 1FRNA 3PXCX 5FJIA 3UJ3X 3EIUA 4JYPA 3KVRA 1WCWA 4UM7A 2O5EA 3HEBA 2X76A 4NECA 4NWIA 1CHNA 1J2EA 4R7ZA 3RAEC 1F9AA 1FXWF 1SXJD 1MB0A 3C1TA 4E21A 1O7JA 4OEHA 3TD9A 3B1YA 4Y8VA 5CGZA 5L40A 1GKIA 4Q9NA 1B26A 5DYNA 1VJCA 1A9RA 3KOZA 3SIWA 3BWEA 4Q9HA 4BNDA 4L78A 2QSZA 4JB0A 4UJ5A 3AERB 4EH1A 1U63A 1SD5A 1Z5PA 4L8VA 3GEPA 4G85A 1L5SA 4J8PA 4WLFA 3RFTA 4J0QA 4KDCA 3VQTA 3UMBA 3PHJA 3ZE2B 3ZZTA 3H17A 1JTVA 2O4UX 4LF6B 3B6KA 4Q18A 4MRPA 3I6YA 4MK4A 1XTBA 3IQGX 3BT7A 3CWCA 2Y76A 2P8SA 4TMYA 4DT1A 4M1EA 4E5NA 1DXQA 4C4YA 4LDPA 2ZRGA 2VNSA 1T5OA 2ZFUA 4FLEA 4BMZA 3AHCA 3DL2A 3OESA 1WPGA 1Q44A 3PIIA 4LXYA 3RIYA 4O2BA 4FEAA 1CR0A 5E4FA 3SJAA 3O2NA 3PPYA 5IM4F 3EMBA 4FOSA 3ZU5A 2QTBA 3ECCA 4L50A 3Q7SA 3LCVB 3G1WA 2FOIA 2GZRA 2BF7A 4QUKA 4ZALA 4ZVKA 2WJPA 1QO7A 4O4IA 4IDFA 2D2FA 2CL7X 5FHRA 1Z29A 1J2JA 2QQEA 3E9EA 4UFPA 1CUSA 2E5FA 3DL4A 3I1JA 1HYHA 3G3EA 3HR7A 4OQEA 3WFIA 1H3EA 1T9DA 5SY9A 3CPEA 4HDSB 4CLRA 5DM60 1X7DA 2Z1NA 1L8LA 2EYQA 2NU6A 3IIMA 2NUAB 2I6GA 1FVOA 3MPUA 2AEJA 2GNAA 2YWFA 3FSGA 1H0RA 4RH0A 5D2CA 4C88A 4TVSA 4AUKA 1TA0A 2B4TO 1L5WA 4B3JA 4N0EA 4M7PA 3NHRA 5JAPA 2GVDC 4PZEA 2GM9A 3AP1A 4R1LA 3HK2A 3BREA 4OUKX 1PEAA 3S1AB 5LKAA 3WGQA 2G63A 3GDGA 1AB5A 1I2BA 4QSMA 4X24A 4YCBA 5JCOC 3HXKA 1Y80A 1ZK1A 2I22A 2PSJA 2Y68A 3TZCA 2Y0DA 1R5OA 4IRXA 1DT3A 4KPGA 4PHHA 1NVFA 4TQGA 1G5RA 1Z0IA 2HOQA 4W9NC 5AHRA 3LGSA 3NAGA 2ZREA 4X1IA 4H35A 3C3YA 1QTNA 5J2UB 3UJBA 2Q9BA 4MP3A 3T5MA 3DJFA 4HLNA 2GEKA 4BB0A 1MABA 2PLRA 5T4BA 5JDCC 2WZDA 1YL7A 5ALGA 4X1YA 3G2JA 4H1HA 3P9KA 3ROKA 1W0KD 3AI1A 2GFHA 4I9HA 1GPBA 1JYFA 3OM9A 4QLAA 4O4HA 4EJSC 4IBOA 1V41E 5SYMA 1U2SA 3HKDB 5THQA 1VL8A 4TMVA 5GVRA 5JPDA 2JAXA 1YHZA 3KP1A 1RXYA 3MCUA 3JSXA 2BMDA 4A9AA 2OGUA 4UBIA 5HGJA 3H84A 1PUIA 1YUBA 2CVFA 4EG1A 1GA4A 2Z8ZA 4A8PA 2VAWA 2XSZA 4QTUB 2MSWA 3PT9A 4HGPA 2JD2A 1XK6A 2JD0A 4UCWA 1NDUA 4L08A 3C15C 3G2PA 1HH4A 4C2AA 1ODTC 3DTVB 3FCOA 2VAXA 3FLBA 4MUJA 4QD3A 3S2SA 4J1QA 4Z51A 2XTJA 1BO6A 2QN2A 4P7JA 1XRQA 3I6MA 4JJAA 2ZBGA 3H0EA 2ZAYA 3GLFE 4P4SA 2Q3FA 4WOBA 4ZVOA 2BDEA 1OA1A 3GHHA 2HMTA 3X1JA 2GA9A 2YJ4A 1L7AA 1I1HA 1U7UA 3MJSA 1UBLS 3R0QA 4D8UA 2XNKA 2I8LA 5DHRA 2ONJA 1WSWA 1I4OA 2G1AA 2OBFA 4H7HA 3GRVA 1KXJA 1QXSA 1FSGA 1GKYA 5JHHB 5TMBA 3CO5A 2CDBA 3Q5DA 4MS4B 2HQ1A 2A78A 3GUCA 3FSGD 2YJZA 4HX5A 3RRJA 2YH2A 1OTHA 2QENA 3GD5A 4NOLA 3E7DA 5FR2A 2VJQA 2G04A 1WV0A 3G5AA 4UFOA 4WCVA 4RSHA 2E1RA 2YYZA 3OUZA 1X9HA 1KP2A 1KVTA 2GK7A 4H3HB 2JLVA 3EW7A 3H5RA 3BE4A 1WNFA 3E18A 1I4DD 3ETCA 4DR2B 1QMIA 4I3FA 5ES3A 1RM4A 1KU6A 2W2QA 4UKDA 3AVUA 4DSUA 1EVEA 2CEKA 3AILA 1QKIA 2O3RA 1P17A 3W7AA 1GYPA 1KMHB 1ODCA 1FNNA 2ZR0A 3PQ3A 3K1JA 4K2HA 5GAJA 2IIQA 3KXIA 5B3JA 3RVBA 4EF6A 2YHBA 3SHTA 4BN4A 2R8BA 3CLTC 3P0HA 2R00A 2Q5EA 5CLQA 3SU8A 4DLWA 1ID8A 2PS9A 3ZG6A 4N5DA 5J23A 5JRDS 3L9WA 3RO7A 4B3TB 4LI3X 1T4CB 3CUUA 4GEGA 3UB3A 2C5BA 3FYSA 5TS2A 1LNQA 3EODA 5BSEA 1V4VA 5CNJA 1F2DA 1MQ9A 1U4NA 2JATA 3SJUA 3F5FA 5KJEA 3GRUA 2B1JA 2XSZD 3K7EA 2O2ZA 1K4MA 3SFZA 3Q0IA 4JI0B 1NURA 2HSJA 4BDSA 2BPOA 3MINB 1W2HA 1RFGE 2ZCUA 1XQVA 3GFSA 5JCJA 4RQTA 2E85A 5HFAA 4J03A 5E9JA 1W30A 1A72A 1MU0A 1TZKA 1II9A 4WVLA 2KHZA 5A4DA 4YQEA 1A7AA 1MH1A 2C2MA 3CZ9A 3NEYA 4GKAA 1RYEA 3J80A 2QZ4A 4DV5B 1KEVA 2IUSA 4KQHA 4EL0A 4OLAA 4FJ1A 2GEBA 5LYYA 3VHLB 5EMNA 5LQMA 5G3YA 2LE0A 4NHEA 1T9HA 1XEAA 3EP3B 2VF2A 4K6OA 6NULA 1VPVA 1QHHA 3HL4A 3WHKA 3IMEA 4R41A 4EUSA 1KEPA 4J0HA 5C8YB 4LSZA 4W5HA 5LJLA 4CEJB 1K8XB 5D5HA 4QEKA 4NCAA 1PQ4A 3L84A 5I7OA 1RC0A 4MW7A 1Z17A 2FN8A 3D59A 3OAAA 4HL6A 1VKHA 1MVNA 4X20A 1XD9A 1O97C 2B5OA 3ID6C 2FWJA 3NM5A 4HS4A 3K16A 4JGBA 1GA1A 1DAEA 1USKA 3CHYA 3DMDA 4R1TA 1ZI8A 5TRTA 4IMJB 3WAGA 3CVXA 3THXB 1XVVA 3R20A 1DO0A 1SBIA 1CUEA 3F6PA 2W6MA 5B58C 1X19A 2CVZA 3P2IA 3JYHA 2K2QB 4QU0A 1A5AB 3HG7A 3G88A 5K2MA 2W2XA 3VZSA 1L5ZA 4K8RB 2ZRDA 2ZUSA 1TM4E 1W29A 5KYWA 1P4GA 1OAOA 1GPNA 3CVVA 1TA4A 1R66A 3ZY5A 3ZNQA 3UPTA 3CG4A 3R0IA 4EGFA 2FEOA 1XXHA 1DBRA 1JEJA 2EFJA 3FPCA 4DJEC 5BN5B 1WB4A 5KYYA 3TIVA 1MX5A 1QDUA 2WKRA 4XCXA 1GL7A 2AIRA 2FMKA 2G70A 1YI0A 2PD6A 2LWIA 2CWWA 1QGUA 1U0RA 4B8WA 4Q19A 3Q5GA 2ZAMA 1Z5WA 4LMRA 1P8AA 2COKA 2NU7A 3ETNA 1R74A 1MKYA 2XOXA 4YB8A 1W88A 4FC6A 5CFPA 2IS2A 2B4YA 2GN0A 4EY7A 1A5ZA 1D6NA 4G9GA 3OG9A 1BU8A 3M0EA 4PFSA 1Y8ZA 5JCJD 1L7RA 1JFFA 3HBAA 1AS2A 4QYXA 5JYEA 4UBLA 3C98A 4M0UA 3AH8A 1U5AA 4W1QA 3TFQA 3ONFA 4CR6A 1QIIA 5HOEA 1IATA 1TTPB 3JRWA 2DGDA 4J0DA 5TQ0A 1C3VA 3NIFB 3ZU6A 4TYNA 4NLLA 3AFOA 3HEAA 4AY5A 5JCXA 1ATZA 2P7HA 5IUKC 2BFDB 4QJ4A 1GRNA 5ALMA 1I5EA 5JH7B 4CMKA 3PV0A 1AQIA 1L7VC 1R27A 4DQ0A 3ZGVA 1HMPA 3AKEA 3EVEA 4Q6WA 2Q46A 5IT5A 2TRSB 4P4UA 4IFTA 3O74A 3OAAD 1X8KA 3EGXA 2J31A 2PMWB 4NJOA 3UHAA 2G83A 3MSXA 4YO7A 2P2GA 5LZ2A 1TYEB 1XZBA 3S0JA 1ZR2A 5FTMA 1EUYA 1XAHA 1Y82A 3KOYA 1DX4A 1DJOA 1O03A 3AR7A 2G09A 1RRMA 3DUWA 3LLVA 1CQXA 4HYYA 5HIJA 5BV7A 10MHA 1T3ZA 3KLMX 4DM3A 3D6AA 3VOBA 2I1LA 3AEXA 4ZYUA 4DCSA 3PF8A 1QHNA 2DPLA 4X7RA 1GKKA 3DOJA 1EFPB 2HDOA 1FPMA 3PQ4A 4F6CA 3VDNB 1QO9A 4EX6A 1E5DA 2Z9DA 3QK7A 4II2A 5CT4A 3RRBA 3WL4A 1WDLA 2HQBA 1WWKA 4OYRA 4L51A 3MWYW 4YIKA 1UMDB 4BWYA 4INJA 3NEAA 3PXEA 2VNHA 2PXHA 3AI2A 3I58A 4E15A 1ISPA 2VQSA 2FZKA 3ANYB 1MJGM 2I3BA 1U2EA 4LECA 2RGNA 3VPCA 5AO9A 5IJAA 1MA0A 4R2HA 3H9CA 1M34A 1Z75A 1H2YA 2VJMB 4TQAA 3W4JA