1NX6A

Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
371
structure length
356
Chain Sequence
b'MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-Semialdehyde Dehydrogenase
molecule tags Oxidoreductase
source organism Haemophilus influenzae
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
total genus 110
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nx6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nx6A01
3GZNA 3ITKA 3U4IA 4XGNA 4CMHA 1HSOA 1GV1A 3DQPA 3K73O 1QXSA 3CKYA 4GVXA 4DC1A 1E6EA 1G0NA 1PIWA 1YRLA 2HJRA 4N5LA 2B83A 4D3DA 3BMNB 4W7IA 5EN4A 1SOWA 4TQGA 1N1EA 3O26A 1J5PA 3NTOA 3FNGA 3TFQA 4AL4A 4R1TA 3JQBA 5MDHA 3JQGB 2E4AA 4XA8A 3FWZA 3HDJA 2C29D 5TJ9A 4INAA 2P91A 3L9XA 2D2IA 3KYBA 4OAQA 4CV2A 3Q0EA 2W2LA 1HEUA 3GVIA 1H93A 2RAFA 1I3KA 2EJWA 5DBFA 4C4OA 1T2AA 4HY3A 3JQ9A 4R5HA 4FJ2A 1PJSA 2BD0A 5GY7A 3U4CA 4QO7A 1R0SA 2VN8A 4J16A 1C1XA 1E77A 4BO7A 2PH5A 1NQAO 4PLFA 3H9UA 1N9GA 3ZW8A 3PJEA 3DO5A 4FGSA 3PDUA 4BS9A 1FDVA 3BMOB 3GPIA 4UVHA 4J0FA 1CDOA 1DIRA 4Z9YA 5GZ1A 1QV7A 1RM4A 3AOEC 2I67A 5IFLA 2RIRA 5TNXA 1U4OA 1ULUA 3RUIA 4II3A 1D1SA 3ONDA 5J23A 1E5QA 4A2CA 1UUFA 2CDAA 3E03A 2GLXA 2OGUA 2X0JA 2F00A 1QSGA 3GDOA 4K9DA 4O63O 3JD4A 1FK8A 4ESOA 3LLSA 4K1LA 3TRIA 1IY8A 3OBBA 4D45A 3EC7A 3D3EA 1X1EA 3A06A 5AXDA 1BDMA 4MOWA 5GZ6A 1IE3A 4OYRA 1U28A 4FJ0A 1ZK1A 4YBZA 3GVCA 1EBFA 5B4UA 1E3IA 4CMEA 3M6IA 3ONEA 2NADA 3QVOA 1H2HA 1LBEA 1YL6A 4CM5A 5IXSA 4JX8A 2Q2VA 5IZCC 3UW3A 1LU9A 2D3TA 3WQQA 3K9QO 5JDIA 1T2CA 3UFXA 4NIMA 1QR6A 3GMDA 3IOYA 2Q99A 4PLZA 1P0CA 2OUIA 3TJRA 5EQFA 4NK5A 4JROA 2I66A 2V7PA 1I2CA 2Y99A 4ND3A 5ITVA 2OBYA 4FC6A 4Z0TA 1LC3A 1AE1A 3ZHYA 5DCUA 3RI3A 2Q4BA 3L6EA 5JFOA 3TSCA 1LSJA 5COBA 4BO9A 3PHLA 2LDBA 4TZKA 4B4OA 5U9CA 1O89A 4LISA 4FBGA 3EY4A 1TI7A 4XJSA 1T2EA 3BTOA 3GLQA 4GSLA 3ZWVA 3DMTA 2Q50A 2ZCVA 2X7HA 1Z74A 4CM6A 3WNVA 5AOVA 5CFZA 4CLEA 3WYBA 1Y9EA 1U9JA 4WOKA 2OHXA 3BHIA 3BMCB 3PQEA 3ZV3A 1OZAA 4S1VA 4UVIA 3TPCA 1PWXA 1GZ4A 2DBQA 4J2OA 3SXPA 3E5RA 1RYDA 1EVJA 3Q2IA 2AQ8A 1W73A 2E82A 4PLHA 4CMBA 4FDAA 3JV7A 4UULA 1I8TA 4CPDA 3S2IA 4B3IA 3DZFA 1H6CA 1NBOA 3NUGA 1Z82A 5G0UA 2CDCA 4BKQA 1H9AA 4OL9A 1PJ2A 2PLAA 5BT9A 4DA9A 2IXAA 4BO4A 1GQYA 2IDZA 1OI7A 3NX4A 2FZEA 4UUOA 3S2GA 3N7UA 1WLYA 2Q1SA 2Y66A 3WWZA 2V6MA 3BYZA 4JBIA 1W4ZA 5CP8A 2EGGA 1NM5A 3GUYA 3SX2A 2BLLA 4Z9XA 1MC5A 4QFDA 1VL0A 1I24A 2HK8A 3RAJA 3QVWA 3MCVA 2HU2A 5I9MA 4R3NA 4EJ6A 4N7RA 3K2BA 2CUKA 3HHPA 1T4DA 2HJSA 1DEHA 3PEFA 4PLYA 4EITA 1PL6A 3DOOA 5J9GA 4BNJA 4E21A 3NGLA 2PGLA 3KSUA 4YB8A 4YT5A 2GN6A 3DB2A 3QP9A 5ENDA 1O95A 5A9SA 1YQGA 1NPDA 5EJ2A 5TC4A 3VOSA 2O3UA 3WSWA 2OFPA 3AM4A 1GPDG 3ZWOA 2VYVA 1E3EA 3EAGA 3KRTA 5KWEA 1C0LA 3DZIA 1PQWA 3GZNB 1DFIA 4FJ1A 4XYLA 1MLDA 3WBFA 5IDXA 4YYZA 5C3MA 5T73A 1E3WA 2CFCA 3FWNA 2FPIA 3AI1A 4DIBA 5JCJD 4JP3A 4NZ9A 3P2OA 1ZEMA 1G0OA 4YJDA 2EGHA 1KOLA 4CM4A 2VWGA 1FMCA 3EDMA 1EK6A 3JYLA 5A9SB 5KVQA 4PRLA 1R66A 2H5LA 5AXAA 4QFCA 5MGBA 3WBBA 2E37A 3QHAA 4QSMA 3ULKA 3PYMA 4IIUA 1X0XA 4RPKA 4E5NA 3ZU5A 3L0DA 4D46A 4Y9DA 4IZHA 2WD7A 3SJ7A 1BVUA 1BTOA 2UYYA 5I7SA 1LJ8A 2FZWA 2DTXA 1E3JA 2Q45A 3F5QA 5KIAA 1P77A 1ZW1A 2UDPA 3C3XA 2Y1DA 2QRJA 4MJLA 1PTJA 1JWBB 1PGQA 1DIHA 2PGJA 1UJMA 3KEQA 2RHCA 4KUEA 4A27A 1PGJA 1EUDA 2X5KO 3BTUA 5K6AA 1GQQA 2VZ8A 5FF9A 5AYVA 3WIEA 2I76A 3K8ZA 1P33A 1PL8A 2X22A 4UEOA 3JD2A 2FN7A 1MXFA 1V3UA 3ZWXA 3KB6A 4QT0A 1DPGA 3VC7A 3VPSA 1LDMA 1O5IA 3B1FA 1U5CA 2X9NA 3H6KA 3B70A 3QIVA 4KZPA 5TRTA 4BIIA 3VPHA 4OQYA 1P3DA 4E6PA 4Q3CA 1F12A 2CNBA 2QIOA 4UUNA 1IPEA 1WDLA 2CMDA 1SB8A 3DFUA 4XGKA 3NEPX 2I99A 3VH4A 1BVRA 1GQ2A 1QKIA 3L6DA 3GHYA 2QRKA 1UXHA 1U4SA 3K5PA 1C0KA 2HCTA 4IQ8A 1U8FO 4YTEA 3JTMA 5JAZA 3PZBA 2D59A 3TZCA 3F47A 4FIZA 3W4IA 3R3SA 3CZMA 1TT7A 4XR9A 2D0IA 5HTOA 2H9IA 4F6LA 1MX3A 5G4KB 5TLSA 1QRRA 4E5YA 4MKZA 4I5GA 4R1SA 5BSFA 3DZBA 4CL8A 3EUWA 4BMSA 3SC6A 1HYHA 3SC4A 3IQDB 4J7CA 1KVTA 4GAEA 3QY9A 3PWSA 4XQCA 3WGIA 3MJEA 2GYYA 1F14A 3VH2A 1BXGA 4J1NA 2FP4A 2VHXA 2QRLA 2HO5A 3S1LA 3FSRA 1JKJA 3GMSA 5FI5A 1GY8A 1DLIA 4B4UA 4XR4A 1BHSA 4XB2A 5JMPA 1YS4A 4LVCA 3AK4A 3DZJA 1DIBA 3M2TA 4OXKA 4NFYA 4U5QA 3BTVA 5TT1A 2GCGA 1XCBA 4RLHA 1VE9A 1EFKA 5JC1A 1SCUA 5ILOA 2Q49A 3W1VA 3QWFA 3LDHA 4P38A 4CMCA 3U0BA 4E0BA 3ZHXA 1EZ4A 4GX2A 4B7XA 1JDJA 4CM3A 4LN1A 5G2OA 2I6TA 1DSSG 4XQEA 3GVPA 2PTGA 1A9YA 1H6BA 4GWKA 3QE3A 4H16A 2OOSA 5AXBA 1I3MA 1VPDA 1HDXA 2Y68A 3M1LA 3VVCA 1NR7A 2P5UA 1DO8A 4XYEA 5U1PA 2XPCA 4MVJA 1TT5A 5TF4A 3QVTA 1GZ6A 5ICSA 2PNFA 3UCEA 4NJMA 1HLPA 4PRKA 3P2YA 5G0VA 3WXBA 4CR6A 3OJFA 4M49A 1DBVO 4KDFA 4XYMA 4EUHA 3ENNA 4R1NA 1Y1PA 1WZIA 2PD6A 2UUOA 5TT0A 5IJZA 1V3VA 1BRMA 3QQPA 4LW8A 2PKRA 3KO8A 4A26A 4DLAA 3GG9A 5JSFA 3AU8A 1YONA 4OXNA 3RIHA 5DOZA 1TT5B 2YFHA 3ZWNA 5L53A 3ZU4A 4A0SA 1GU7A 5C7LO 1U7HA 1Q2XA 3V5NA 2FR1A 2XOXA 3F1KA 3DDNA 3KVOA 3GFBA 1BSVA 2FHSA 4WLFA 1KEPA 2BF7A 1VLLA 2IYPA 3GR6A 3C7DB 4RZHA 4P4NA 1Y5RA 2C2YA 3NJ8A 2X5JO 4Y6PA 2YFQA 2JFFA 3MWDB 2VTDA 1VL8A 1HZZA 3WOHA 2ZTUA 3FR8A 3WR5A 5A5EA 3RBVA 3F9IA 4BNMA 2ZJ1A 3MOIA 4LMRA 4EUFA 3AUAA 1QORA 1CETA 4ZD6A 1BMDA 2O3RA 4RPHA 3RC7A 4PG7A 1E7WA 1YBAA 3FTPA 1JKFA 2R00A 1T2FA 2VNAA 4YPOA 2W4QA 4BKUA 1HKUA 1M66A 2HK7A 4OSOA 3G79A 2VYNA 5EIOA 5JXWA 1N7HA 1R15A 4GX5A 4IUYA 4E2YA 3S2FA 3GVHA 3KYCB 4R01A 1ENYA 2AA3A 3C1OA 3VKVA 1KY4A 2BELA 3AFNA 1ZBQA 4EEZA 3GNQA 5DZSA 4EUEA 3E6AA 1AUPA 1WZEA 5DCYA 4PG4A 1PWZA 4BO5A 4R5MA 3VZSA 3ICCA 3ZGYA 1PJTA 2BH9A 3RKUA 3HJAA 1NXQA 4RF5A 4PN3A 3ZNNA 4JJFA 4GPD1 4AJ2A 2WYWA 2I5PO 3DBHB 2Y1FA 2PK3A 3SVTA 1YBVA 4U8GA 5DT9A 5HS6A 4ID9A 2DVMA 2AE2A 2AQIA 2ZK7A 4WPGA 5IZCA 2QX7A 2EKLA 2JD2A 2P9EA 5ITWA 3NJ4A 1H6AA 1HE2A 1B15A 3NV9A 1PS9A 5I9LA 2DTDA 3C7AA 1DAPA 1T24A 3E18A 1HZJA 4K6FA 5JCJA 5I7VA 3IMFA 4Y6SA 3HN7A 1LI4A 4NH4A 1KYQA 2ZATA 1EDZA 1Q7GA 4WKGA 4E33A 4XDZA 4IDDA 4YJFB 3JYNA 2NLOA 1ZK2A 4DQXA 2H6EA 1U2DA 1YH3A 1F8GA 2XAAA 1E1KA 1ZK3A 4I5FA 4GSKA 3UOGA 3ASVA 5ER6A 4D0RA 5H82A 4U0KA 2WD8A 4BGVA 3RBXA 5EQDA 2VWPA 1X0VA 4DQVA 2BGKA 3IIEA 1HETA 1NNUA 3H65A 4I5DA 2D5AA 4R1UA 2DT5A 2EHDA 2PA3A 2QG4A 2I65A 5T8KC 2YQ4A 3VVBA 1CQIA 5IN4A 3T4XA 1ML3A 1HSZA 4BNVA 5L7TA 1GADO 4FGWA 1E1LA 2G82A 3F3SA 4PIVA 3RFVA 3O8QB 1X7GA 2FR0A 2IEDA 3DBHA 1C3VA 1EVYA 5CEJA 3CZRA 3FNEA 2C20A 2ZKLA 1TA4A 3DFZA 4PG6A 5I8WA 3E82A 3WGOA 1U3TA 1X13A 2GNAA 1GCOA 1R0KA 3AW9A 4XEHA 2AEJA 1S7CA 4TRRA 3MOGA 5DBGA 3W6ZA 5I9NA 3UF0A 1B14A 4JLWA 2JKVA 3K92A 1B16A 3PRJA 3WFJA 4HUJA 4N5NA 2IXBA 4J1SA 3NGXA 4W6ZA 4CQMA 2C5AA 4FN4A 1SAYA 4KUHA 2NVUB 3RCBA 3KLMX 1QLHA 4CMIA 4E5MA 5JBIA 1UXKA 2AEMA 4ZN6A 5JO9A 3BIOA 4W82A 3WTBA 4D0SA 1EMDA 1O6ZA 2XXJA 3HUDA 1GL3A 4PLGA 4Q9NA 4DUPA 1SB9A 3X2FA 5B1YA 4RF4A 3HZZA 1GAEO 3DOCA 3OETA 5KVVA 4B3HA 4DL9A 4CL3A 2VYND 4PVCA 1NWHA 1O9BA 3JQ8A 1AN9A 1DC3A 2O48X 1DXYA 4R69A 3EHEA 2CDBA 3HQ4O 3H3JA 1NHWA 5A06A 1GEGA 1LC0A 1EVIA 2EKPA 1NTOA 3BZUA 3GF4A 3MJTA 3OIGA 4IJWA 4M89A 4QEDA 2VWHA 3ROKA 5A4DA 3OHSX 3RBZA 1T26A 3PLRA 2Y05A 4DPLA 4DMLA 1YB5A 1P44A 1ARZA 5KKAA 1R16A 3LYLA 3LU1A 3I9OA 3PWZA 5CDYA 2X5OA 3R3JA 4RO0A 3JQAA 1HDZA 1HF3A 3ZU3A 2Y1CA 5KTKA 4FFRA 4GKVA 1ZJZA 2C54A 2Z1NA 1YOVB 2E6UX 3RC1A 4ZGWA 1K2WA 2AW5A 4BB6A 1YDWA 3F5SA 3PI7A 5HWSA 5C7OO 1UR5A 2EEZA 4IDEA 5IXYA 2WD7B 3GZ4A 4FQ8A 4HFNA 4IS2A 4MO2A 1PEDA 3I23A 3NTRA 1R12A 2EERA 3CINA 1T1SA 2C5EA 5HA5A 2H63A 4DLLA 1QG6A 1N2SA 4GKBA 5F1OA 1AHHA 4WLUA 1R4MA 5A9TA 4MVJD 4GH5A 4MINA 5L7YA 1PGOA 4I9UA 2GZ3A 3OQ1A 2FPGA 2W98A 4LCJA 4M86A 2YYYA 4OM8A 2ZYAA 1X14A 4TVBA 3TL3A 3ETDA 3GPDG 1PZGA 1H9BA 1XQ6A 2HMTA 4CM8B 5JYDA 3LF2A 1DC6A 1Y9AA 2ZB4A 1ISJA 1ZK0A 1HRDA 1RPNA 2PD3A 2RH8A 4L4SA 1JVSA 4KWIA 1CQJA 2RBEA 2ZTVA 2XF8A 3ANMA 2BFAA 1K5HA 4GI2A 4E30A 2J5KA 4BNLA 4ZQHA 4OGWA 4I9NA 4PG5A 2FMUA 2C59A 3L07A 3QRWA 4RQTA 4RVFA 2D5CA 4JN6B 1I10A 1YO6A 4URFA 2AE1A 1ONNA 3FN4A 3OJLA 2GASA 3HFSA 3OIFA 5JAMA 3GGGA 3S8MA 4IQGA 1XGKA 1Z6ZA 2B36A 3T7CA 3ZZNA 1MFZA 2YQ5A 3OSUA 3V8BA 4IDCA 2PY6A 4BNXA 5L4NA 2GZ1A 1U7TA 1A72A 1AGNA 2Q2QA 1UXJA 1ENZA 4JJIA 1NVGA 4RVHA 1E5LA 1FDWA 3D4NA 3UHAA 2NM0A 5DULA 3L4BC 5ICMA 2DFDA 3UCFA 4TRNA 4NJOA 1FJHA 4B3JA 5FEUA 1GFSA 1E3WB 4L4RA 1YXMA 1EQ2A 1SZJG 3DBLB 3MTGA 3ETGA 3PP8A 4GGPA 4HX5A 4JQCA 3RUHA 3ZHBA 1WWKA 2Z95A 2X58A 5LCXA 3ZU2A 1EDOA 4CM4B 4JK3A 1JA9A 4IDBA 4ND4A 3VPXA 1WP4A 3TF5A 4RORA 5ES3A 4NU6A 4JP2A 1J0XO 2YJZA 1LEHA 1ZEJA 1WNTA 1ZFNA 3TFOA 4WNCA 2ZYDA 1P74A 1P1HA 4UVEA 2Y0DA 4AICA 1ZXLA 1QYXA 2NTVA 5KVSA 5A9RA 4KMSA 1YQDA 3ZWAA 1PZFA 2J6IA 1SEVA 1N5DA 3KBOA 1LQTA 1BG6A 3KEOA 5AVOA 1E92A 5TQVA 4ALNA 1E3LA 3M2PA 4PZCA 1P1IA 3IUPA 3JQCA 3Q3CA 4DC0A 1RYEA 3V1YA 2NNLD 2OBNA 1PGPA 4WUVA 2B5VA 1HDRA 2VHVA 4J3FA 4RPLA 2O4UX 4AFNA 5DCWA 2AQHA 3G3EA 3WNQA 3P7MA 3GGPA 4MP6A 4CMEC 3A14A 2NUAA 1E3SA 3CEAA 1C0PA 2I3AA 1Q0LA 1T4BA 4TVOA 5ENVA 1HE4A 1KBZA 5L9AA 3FR7A 3RFXA 3RKRA 5AQ1A 4CMGA 1XWFA 5EERA 1TEHA 3IKVA 4IGFA 3OA0A 4NMHA 1ENOA 3AY6A 4W9NC 4XDYA 4YRBA 1GV0A 1KC3A 1VJ1A 2Z5LA 1H94A 3OEWA 3EVNA 1PSDA 4J1QA 4ZA2A 3K2EA 4RGBA 3QWAA 4R4JA 1IZ0A 4YXFA 2PH3A 3H8VA 5KJEA 4TROA 4ALLA 1LA2A 1DC4A 1P1JA 1B3RA 1UP7A 5G4KA 4NDNE 3AU9A 4Z0PA 1HWYA 2Z1MA 4DWVA 3H9GA 3NT2A 1WMBA 4L4XA 3TDKA 4Y98A 4BKPA 4EEXA 2WEKA 3U9LA 3OF2A 1O0SA 3TN7A 5THQA 1Y81A 2PV7A 1MGOA 3VPGA 1BXGB 2X86A 1YKFA 1AXEA 2AQKA 3RJ5A 3GAZA 4B4VA 4DQUA 2W2KA 1VL6A 4BO0A 4CJXA 4B7CA 1J6UA 5CAEA 3JQAB 5EINA 4HP8A 4PZDA 1NFFA 4IQ0A 3GRKA 5TSDA 4OH1A 4BUCA 1VSVA 2B37A 3S2EA 5BSGA 2Q1WA 3DWFA 1LTHR 4P4GA 4U0JA 1ZSNA 5CPBA 1IUKA 1MXHA 3LF1A 4II2A 4AJ4A 4BNIA 1YL7A 4XZ3A 3COSA 4TMFA 4X54A 3D0OA 3ZV4A 2QZ9A 3FBTA 4WASA 3PK0A 5KJ6A 2CSUA 2V65A 5TS3A 2P4HX 1MUUA 1VRWA 3R0IA 3K96A 1V6AA 4D3FA 2J3HA 4Z6KA 3HSKA 3PIDA 3W8DA 5KVCA 2UV8A 4CV1A 4YAEA 3KYDA 2JJYA 2UUPA 3GVXA 4HFMA 4BVAA 4NBTA 3CXRA 2BI8A 4Z3DA 3PYLA 1R4NB 2WJPA 1DFHA 1CERA 1V35A 5ADHA 4IJKA 1XDWA 4CMKA 3UCXA 1D3AA 1PJLA 2JL1A 4K6CA 1D1TA 2YV1A 1IZ9A 1Z7EA 3GK3A 1HL3A 4P8RA 2C82A 4ALMA 4B8WA 1JKIA 3VAZA 4M8SA 3Q1LA 4R41A 3WMXA 3MZ0A 2PZKA 1N1GA 1BXZA 2EKQA 2PD4A 1V9LA 3D64A 2I3GA 3B6ZA 1UZLA 3CMMA 1I2ZA 4I9HA 1Z73A 2HMVA 3ABIA 1U1IA 2Y1OA 1E7RA 4EGFA 3OQBA 1U8XX 1UXGA 3L4BA 4WEOA 4AJLA 3PWKA 4UUMA 1MV8A 1SNYA 2NQTA 2A4KA 4OXYA 4EZBA 1Z7BA 3PHGA 3O8QA 1KVSA 3OP4A 3WICA 2PGDA 2BFOA 1VKNA 3KTDA 1NPYA 2AG5A 2PZLA 2BKAA 4BO3A 3ZWBA 4KQWA 2NSDA 3ROPA 2A92A 3WG9A 4J7XA 1TVEA 3I52A 3JQBC 4HBGA 5JO0A 3JYPA 3GDGA 5TJHA 4WJZA 4IPTA 1BXKA 1WDMA 4BO6A 1LLCA 1K6IA 4S3MA 2FY8A 4IMRA 3WLFA 4PLPA 4CQLB 2EJVA 4U6QA 1PS0A 4TZTA 4L74A 1IOLA 1CJCA 3AY3A 4IMPA 2NV6A 3INRA 2CZCA 4MVJP 1EUZA 2O3QA 2V6FA 4XCVA 4NK4A 3A1NA 5IDYA 4F3YA 3JQEA 1R4NA 4OHUA 1H0KA 5LDHA 2X0NA 3LQFA 3LLVA 3GNTA 1PQPA 3O9ZA 2VOEA 4RQUA 3IJPA 2GN8A 2GUGA 5IF3A 3H5NA 4TWRA 4AJEA 1DAOA 3PGJA 3HADA 1NAHA 3I9NA 4R3WA 1GEEA 2VYVD 1D4FA 2VZ0A 2X8LA 3U5TA 2E48A 4MKRA 5BNIA 4DBVO 4WCFB 5ER9A 3PHHA 2JFGA 1GR0A 3L77A 3LC2O 2YV3A 3G17A 3UGKA 4EJ0A 3WGQA 4J7UA 3SJUA 1FDTA 4YEDA 4WNIA 2Y0CA 4FR5A 3PGXA 3OEYA 3RWBA 2Y0EA 2J3JA 4G5HA 5EL0A 3KXDA 4QX6A 1YJQA 4I8XA 5CEEA 5HS4A 1NFRA 4ITUA 3PJFA 3OECA 2VWQA 2ZTLA 4IGEA 3RFTA 3RUAA 2VHWA 3EZYA 5EMHA 5COAA 4C7KA 5A1TA 2QZZA 3WX0A 3HB4X 1PU2A 1I30A 4F45A 4O6VA 4MVJF 1BW9B 3FF4A 3I6IA 5TIIA 1U2GA 1Y8RA 4BV9A 1A27A 5H83A 1DOHA 2ET6A 4LCEA 4YJFA 4PLVA 1MG5A 2DC1A 4DTIA 3Q2KA 1XU7A 3I6QA 1HDGO 1OC2A 4TSKA 1K89A 1QP8A 3I83A 2DFVA 2TMGA 3DAPA 4FS3A 1NVTA 1E0DA 4HKTA 3W4JA 2P68A 1JQBA 2OXIA 4ZJUA 1C1DB 1XR3A 3EK2A 4ND2A 5CDTA 4RZIA 1W6UA 2B35A 1NYTA 1IPFA 5BNFA 2O2SA 1LLDA 5THKA 3QV1A 3I9KA 5EESA 2O7QA 4AJHA 2NU9A 1WVGA 1NX6A 2DU8A 3I5MA 5A5FA 4ND1A 4MVJH 4FFLA 4NG5A 4Q3DA 1JTVA 3RU9A 1SEPA 2O2YA 1L7DA 4A10A 1KEVA 2GPTA 2VOJA 4E2WA 2AG8A 3PLNA 2W2KB 1HE5A 1N8KA 3WYCA 1DRWA 1UDBA 4XWYA 5M6DA 1HDCA 1ONPA 2GZ2A 2PKQO 1OAAA 3DC2A 1ADCA 1ZXBA 4E5PA 3UAGA 2G1UA 2Q1TA 4QECA 2Q2WA 2V6GA 3JQ7A 1M67A 1Y5MA 4CR8A 4AG3A 1BGVA 2YDYA 5L40A 2CF5A 9LDTA 5A02A 3P19A 2NU7A 2BFPA 3EVTA 5IAAA 1GPJA 1ZCJA 2JAPA 3FNFA 4EI2A 3KOUA 5JAIA 3C1AA 3FTNA 5JYAA 2X0IA 3I3OA 4HV4A 1UH5A 1GZ3A 2O7SA 4RV9A 3VHRA 1SC6A 1QMGA 5I7EA 5JNLA 4I08A 1UAYA 1KC1A 1E7SA 4Q3EA 4W7HA 5I8ZA 4Z0HO 4QQRA 3I9JA 1VC2A 2HK9A 4F6CA 3F46A 5CDGA 1KERA 2JHFA 4PLTA 4UEKA 5H81A 4PLCA 4LK3A 5GZ3A 3E48A 4OSPA 3W8FA 4NFHA 4ZQBA 5T5QA 1P1KA 1T1RA 1E1MA 4BOYA 3CIFA 4G65A 4BGUA 3STHA 3AWDA 3GY0A 1GYPA 5T67A 4DVJA 2CY0A 4QO8A 2YY7A 3E8XA 3GN2A 2I9PA 1YB4A 3KETA 5EPOA 1Q1NA 6LDHA 5T64A 4WLVA 3WSVA 2QYSA 1ENPA 3H2ZA 1W0CA 3GUCA 3KLPX 3UXYA 3Q9NA 4YJGA 3QJ5A 4FC7A 1IHXA 1HLDA 1IL0A 1OBFO 3BXXA 1B7GO 3OIDA 3H9QA 1I01A 4XYBA 3JD1A 4CV0A 2AEFA 5CG1A 4L8VA 5JE8A 4FFOA 4KP7A 4DMMA 3FPCA 2HAEA 3PPIA 4NU5A 3AM3A 3FCOA 2VRCA 4Q3AA 1PGNA 4DPMA 1WPQA 3BHMA 3A28A 4QTZA 2G17A 3DEYX 2WYVA 2PZJA 5A05A 4E2XA 3ZI0A 2DUWA 5DN9A 3AUUA 4WGGA 2VUTA 2Y1EA 3GRPA 3LZ6A 3E9NA 3DONA 4OQZA 1R6DA 3LT0A 4BQPA 4CLDA 4R54A 1Q7BA 2ZB8A 2C7GA 3QA9A 4RVDA 1E6WA 3Q9UA 4GLLA 3VTZA 5BNTA 3IL2A 1JW9B 4JBGA 1X7HA 2NTJA 3JCZA 1I5RA 1WW8A 4C7JA 1VSUA 3ZV5A 5DP1A 3VZPA 4CM7A 3PFWO 1LSUA 2OP0A 3ZNPA 4W9NA 1A4IA 2HMWA 3H2SA 3KUXA 1M6HA 4XKJA 3ICPA 4ZHSA 3ROQA 4A5OA 1IULA 4NR0A 7ADHA 2PFGA 2YV2A 1SO8A 3HG7A 3OH8A 4YAKA 4E4YA 4M1QA 4XD2A 2OORA 3ZN2A 4HNGA 4CLOA 3LK7A 3JQ9C 3BHJA 5JCXA 1SOVA 3K31A 3MTJA 2VUUA 4N54A 1P45A 1ID1A 1VJ0A 1ZSYA 4XRGA 5JY1A 4KTVE 4NBUA 2WSBA 1B8UA 4Q3NA 1MP0A 4FB5A 1C1DA 1RKXA 1IHYA 3G0OA 2FWMX 3L6OO 5DF1A 3JQ8B 3OJ0A 3EYWA 3NDJA 4XB1A 5JDIC 2X9GA 4CUZA 3AUTA 4OOEA 3HDHA 1PL7A 2QW8A 3H9JA 1TB4A 4OOFA 4BMVA 3PQDA 4FOSA 3ADPA 1EEHA 2WDZA 3KSDO 2XXBA 2HKIA 4NBVA 2AXQA 3DR3A 2BGMA 5L95A 4RPGA 3U62A 2R00C 5BSHA 4U6SA 1I3LA 1WDKA 4JXKA 4YAIA 1NVMB 5L3ZA 1DHTA 1Y8RB 2C2XA 1HTBA 3NTQA 1Y7TA 3ZNOA 1XEAA 2YZ7A 1NR1A 2G5CA 4RVUA 3A9WA 4BO2A 3V2HA 4IZIA 4GX1A 4BMNA 4MIYA 4IJVA 4EDFA 4K26A 3FHLA 4DIFA 4H7PA 4FOOA 1JU9A 2VT2A 3B1JA 1LQUA 1ADBA 4OKIA 3VZRA 4DGSA 5JC8A 2P9GA 1LX6A 4PLWA 4ALIA 3JQDA 4DYVA 1M2WA 4J2HA 4NQZA 3D5TA 5IN5A 5IZ4A 4Z3KA 1X15A 4DPKA 4PCVA 1ADFA 2C0CA 1XKQA 4CMJA 4RF2A 2JFHA 1YJ8A 2NVUA 5HBRA 4E31A 2X9VA 3ENKA 4UEJA 3JQ6A 4XQGA 4KWHA 3A4VA 4YAJA 3I9LA 1R37A 3DZHA 4R9RA 3OFSA 1YOVA 3BAZA 4O5OA 1N7GA 4BGEA 4D3SA 1ZUD1 4J9UE 5KJCA 1MC4A 1B3BA 3IP1A 4HNHA 1E7YA 2C07A 3RJ9A 2AMFA 2O23A 3GEDA 5B12A 5BSEA 3AM5A 2VRBA 3C24A 4G81A 1K3TA 2B0JA 1D8AA 3CE6A 4YCAA 1NFQA 4W4TA 1M6WA 2ZIZA 4Q3BA 1Q0QA 1C14A 5A3VA 2VT3A 3TOXA 2OL4A 2ILTA 3JQ7B 3TZ6A 3DTTA 1F06A 4BNZA 3DBRB 3LSYA 3TZKA 4L73A 2ZJ0A 1OOEA 4P22A 1XELA 4J9VA 4FFMA 1XLTA 5DOVA 4E3ZA 3D1LA 3RUFA 4IDAA 3NDIA 3VDQA 3ON5A 3F1LA 3GEGA 4CM8A 9LDBA 3DOJA 1NQ5A 1BDBA 1VM6A 4NNJA 4DRYA 2NVWA 2DTEA 4FCCA 4ZICA 3LT1A 3HFGA 2FOIA 1H2BA 2AHRA 2RCYA 1TXGA 1EVZA 1FF9A 2B5WA 3GDFA 4P4LA 5AXCA 1ZZEA 3DBRA 4RJTA 3ITDA 3MJCA 4L0QA 1YWGO 4RDIA 1Q7CA 1W8DA 4XJTA 3WQSB 1PR3A 3ONFA 1I32A 5G4LA 5TX7A 1QLJA 5FYDA 2W8ZA 2VUSA 4ALKA 4RCVA 4OKNA 5T57A 3WJ7A 2CVZA 4E2ZA 4PZEA 3ZHZA 1EBUA 4AJPA 5DBIA 1ZIDA 1CRWG 1PR9A 1QYCA 2E49A 3EMKA 4BNKA 1GDHA 4PVDA 4XGIA 4JJGA 4ZVVA 3V2UA 2GR9A 2HMSA 3KV3O 1HE3A 3AY7A 2D8AA 4J4HA 3OJEA 3H4VA 2O4CA 3NDRA 3DAFA 4WEQA 2PZMA 2VHZA 1LRJA 5JDCC 4YACA 4OJNA 2B4RO 1Y8QA 1DRVA 2P5YA 2YHUA 4WCFA 5IDWA 2VNSA 1NQOA 4YQZA 5LDGA 4CM9D 3GH3A 3FD8A 2P4QA 3HN2A 4M87A 3IS3A 2DQ4A 2PR2A 5FFFA 1ZVMA 4YQYA 2UAGA 3C1TA 1LDBA 1QYVA 1OFGA 4HFRA 3TOZA 4BNGA 1DJQA 2B69A 5JY6A 2HMUA 3C7CB 4KQXA 1L7EA 1V8BA 5G0TA 4BL5A 1PQUA 1LLQA 3ZWPA 3GA0A 4L76A 2NVBA 3B1KA 2YUTA 5F5NA 1UP6A 4R9SA 4ILKA 1HYEA 4MVJG 1UP4A 2GN9A 4YVFA 3AUSA 4FW8A 3PFFA 3GT0A 2NWQA 1A7KA 4BO8A 1KVRA 2UVDA 3I4CA 2BMAA 2WWRA 3JYOA 4XQ9A 4E12A 1O8CA 5BQFA 4U7WA 1PJQA 4CR7A 2FR8A 3PDJA 4XRRA 3EGOA 5K0ZA 3O4RA 1XU9A 5K6AC 3FBGA 3KM0A 5JAQA 3NT5A 2P9CA 2DKNA 4IXTA 3TNLA 4KOAA 1MB4A 1XSEA 1X7DA 1T25A 1DB3A 3DHNA 2DM6A 4YT2A 2DBVO 3OICA 3CPSA 1XA0A 3OJOA 2RHRA 3LC1O 3WYEA 1K0UA 4UVDA 4BNNA 5HM8A 1GD1O 1GYQA 3LC7O 4CQMD 4TKLA 4J0EA 5T8KA 3AOGA 4O0LA 3F6YA 3ROMA 4RDHA 1UZMA 5FWNA 3D4OA 1FXSA 2JAHA 1HT0A 1EUCA 3C85A 1Q0HA 1RM0A 3FRJA 3SLKA 1GUFA 3KZVA 1Y8QB 3V1TC 3W6UA 1I33A 4I1IA 4NJMB 5CG2A 1F8FA 4BHTA 3CTMA 3D5QA 1ZNQO 3F4LA 4Z9FA 5JLAA 3RUEA 2X1HA 4B8ZA 3T4EA 2IEBA 3PZRA 3IAHA 1LSSA 3QVSA 2HUNA 1J4AA 1DLJA 2Y1GA 4WLOA 4IDFA 1GYRA 1NP3A 1U5AA 2BFMA 3CUKA 3TL2A 5L7WA 3DXFA 4GQAA 1JVBA 3B20A 4PGFA 1LDEA 5DNAA 1ZMOA 3UH1A 3WGTA 2HDHA 4J6FA 4YR9A 3BMQA 1KETA 1XHLA 2JCVA 3QVXA 4RPJA 2G0TA 2D4AA 1H5QA 2OO5A 1PS8A 3TZHA 3ZWYA 4N18A 4BNUA 1TLTA 2O3TA 5L51A 2DPGA 5JDCA 3W4KA 1PJ4A 4DYDA 1AHIA 2Q4EA 2FPPA 3H3FA 1CF2O 5A03A 3U49A 2DLDA 2NU8A 4LMPA 1IB6A 1D7OA 1R4MB 2GF2A 3IC5A 5DDIP 3GG2A 1E1NA 1LSOA 1ZH8A 1NPTO 5C37A 4MPDA 3I4FA 1M76A 3FI9A 1PJ3A 4JNKA 2CVQA 4L9RA 3PXXA 4GLOA 1YDEA 2CVOA 5KCZA 2W2LD 3S55A 1H6DA 1G6KA 3RASA 3GN1A 4MVJI 2GRAA 4D7AA 4JIGA 5HRUA 2EP7A 5FI3A 1LRKA 2Q46A 1EK5A 5L45A 4ONEA 5A04A 3VH3A 3PIIA 3WLEA 4BKRA 3O03A 4YDRA 3BMNA 1LLUA 3G1TA 4L75A 1CEQA 1YB1A 4I5EA 1ZO8A 4AJ1A 3DHEA 3H9EO 1OMOA 3KYDB 4MVJE 2W90A 1J49A 3ADOA 3OMLA 3JQGA 1ZKMA 4KUGA 4F46A 2O3JA 5ILGA 2D1YA 4CM9A 4MVJM 1Z45A 3JD3A 3KYCA 8LDHA 3N74A 3MJVA 5JS6A 3ANNA 3MJSA 4JCOA 3WTCA 4IIVA 3UKOA 2ZQYA 3ZW9A 4YJHA 1ZMTA 3WGHA 4LSWA 2FSVA 4XX0A 4YAGA 3DBVO 2POQX 2EWMA 4WLNA 3ZNQA 2JHGA 1LRLA 3QLJA 3IKTA 2YHIB 5F1KA 3CMCO 1GUZA 4YT8A 1QV6A 5B4VA 4GX0A 1P1FA 1WAMA 3ORFA 4ZQEA 2OMEA 4G2NA 4FFPA 3BA1A 4OO3A 1DRUA 4ZU3A 3F4BA 3D7LA 1GTMA 2NU6A 3QW2A 5G0SA 3VH1A 4GWGA 4D43A 2X4GA 3INTA 5KJFA 1OC4A 4CMAA 1UXIA 3WJAA 1SMKA 4IJUA 3IDSA 4FSHA 1ULSA 5CHEA 8ADHA 1KY5A 4NFSA 1NWCA 3Q11A 1CIVA 1O94A 3DAGA 4TRMA 2EF1A 3EZLA 1ISFA 3DHYA 4QXMA 3PQFA 4CQLA 3SEFA 4MKXA 1V0JA 2ZCUA 3ZV6A 1UZNA 1LDNA 3LT4A 2VRCD 3RC9A 1VKOA 4D44A 4NBRA 1YQXA 3JD0A 3IJRA 4GGOA 1B8PA 4GL4A 2YDXA 2OZPA 4WLEA 4M55A 2EXXA 5GMOA 4B79A 1HDYA 3QWIA 2NACA 1HDOA 4XIJA 4GBJA 4MIOA 1YE3A 5C5IA 4YRDA 3WWYA 3NT4A 3K30A 4WECA 2X23A 1P1RA 2IODA 3MJ4A 4OIMA 4ZQGA 3IP3A 4J1TA 5K9ZA 1Z75A 1UDCA 1YL5A 2IZ1A 3O38A 5U4QA 3QWHA 4MDHA 2OP1A 4WCDA 3RD5A 4DREA 3HDYA 2BRUA 5KNLA 1FDSA 4A7PA 1RWBA 2WE7A 1U3WA 3VKUA 1F0YA 1JN0A 1SBYA 4W99A 2TMDA 2YW9A 3HNPA 4ROSA 4UVGA 4CM1A 1BW9A 2ZYGA 2ZB3A 3U4DA 3ZWMA 4Q39A 3HWRA 3V1UA 4YJGB 3SBOA 3E5MA 1G1AA 2VTEA 2VQ3A 1ZJYA 1ZSVA 1MFPA 5TGDA 3JQFA 4BNYA 4H3VA 3WQRA 3MEQA 5KJ1A 3GC6A 4D41A 4FFNA 4BGIA 4J4TA 3SLGA 4BO1A 3U4HA 1DIAA 2BHLA 3U09A 5A3JA 2EV9A 1NHGA 1QYWA 4RVGA 2J5RA 2ZTMA 3UN1A 1KVQA 3RUCA 3AFMA 5G0WA 3Q6IA 4HADA 3BMCA 4CUJA 1PX0A 1K6JA 4WE3A 3GHHA 2J3KA 4JGBA 3UICA 4CLXA 1X1TA 3NYWA 1EE2A 3NAQA 4LRSB 3FNHA 1L1FA 4DBZA 2HSDA 1EE9A 3TZQA 3GFGA 1DFGA 3X2EA 3JSAA 5F21A 5JPIA 1JWAB 3NKLA 4CLRB 1SPXA 1B26A 2VCYA 4BNWA 4RF3A 4BNFA 1EQUA 1LDYA 3RC2A 4RL6A 1MG0A 5F5LA 2CF6A 3DTYA 2QQ5A 4IINA 1LXCA 3VPFA 3ZWWA 4B4WA 2NTNA 3R1IA 3OQ6A 3H7AA 5L4LA 4HWKA 2O50A 1XYGA 4M54A 3C8MA 1ORRA 3LT2A 2GGSA 2ZB7A 3K6JA 3PYXA 5LC1A 1PZHA 3FPLA 4R51A 4CQMB 5L4SA 4WK6A 1B0AA 4JBHA 6ADHA 2QYTA 3DMYA 4D42A 3RUDA 3DZKA 3I1JA 3E1KA 1U3UA 3QWBA 3WB9A 4R68A 4AJKA 2NQ8A 3GAFA 4KDEA 5B4TA 2IZ0A 4TRJA 4LVUA 1V3TA 4LRTB 3AI3A 4BKOA 2J3IA 5KKCA 3ANLA 2X6TA 3OM9A 3PJGA 3PVZA 4AJOA 3UUWA 1E6UA 1KIFA 4BB5A 3JYQA 4UAGA 3RROA 4UREA 4PG8A 2CD9A 2DUUA 4TKMA 2Q3EA 4CODB 5CDSA 2V6BA 1DC5A 3INGA 4RLSA 1YGYA 4IS3A 4BNHA 1XQ1A 4J43A 3CH6A 3RSHA 1AXGA 1ONOA 4NPCA 5C7IO 1P9LA 4O1MA 2ZQZA 4R16A 1P0FA 1ISMA 2BGLA 4CUKA 4NBWA 3WDSA 3T7EA 5JW6A 1GCUA 1B8VA 5B37A 5COQA 3QSGA 1DHRA 2J5QA 1XG5A 3I9MA 2GN4A 1U3VA 3L9WA 2HQ1A 2WYUA 1T2DA 3E9QA 1HYGA 4IM7A 4HFJA 3PHIA 4NHEA 2FSSA 3PJDA 2IZZA 3W8EA 4J91A 3WIDA 5JYFA 4YJHB 1E7MA 1NAIA 3H5RA 4FPXA 3RVDA 4Y6RA 2HLPA 1KEUA 1FDUA 3AJRA 3ZWCA 1YVEI 4WCFC 2GD1O 1VJTA 4XIYA 4H15A 1CYDA 1C1XB 1YBMA 1WMAA 3R6DA 1JAYA 4B7UA 3HE3A 3E9MA 5CPFA 1MA0A 1PJBA 5IG2A 3WGYA 2VHYA 2JD0A 5IDQA 3H5AA 1XIVA 2WE8A 4YA6A 1P31A 4ZRNA 3ZCXA 2C7VA 1B2LA 1BWSA 1I2BA 2JD1A 3BMOA 4XYGA 3UVEA 2R6JA 2GO1A 3M1AA 4FD3A 3VZQA 4A03A 4DIOA 2IRWA 4ZRMA 4DXHA 4E5KA 4EYEA 3ASUA 4GVLA 2P2SA 1WXDA 1I36A 2VZ9A 5F3RA 3IUSA 4MIEA 4GMGA 2YHIA 4UUPA 4DLBA 4YT4A 3D3WB 3WMWA 1DJNA 4ND5A 5CDUA 4YWJA 2DBZA 3L4SO 3P5SA 4Y8VA 1HXHA 4D79A 2HRZA 4CLHA 1E7QA 3GOHA 4IXWA 3JQAD 4CV3A 2JCYA 4LSMA 4BNTA 4GMFA 4YRAA 2PKQP 4BQRA 4PFJA 2O3SA 3WGGA 1I0ZA 2A94A 2J8ZA 3PTZA 1F17A 2GERA 3WS7A 4EBFA 4AJIA 3GNSA 4BV8A 1Y6JA 3N58A 1VI2A 3OA2A 5BR7A 7MDHA 4J4BA 5JMWA 3D4PA 3LVFO 1ISIA 2IE0A 1NASA 3D3WA 2Q22A 4IDGA 2F1KA 3VDRA 4O59O 2WTBA 1UDAA 4Y67A 1K6XA 2B4TO 1LNQA 2Q1UA 4CLOB 3RU7A 4J49A 2R2GA 1I3NA 3WFIA 3DBLA 2JCXA 1ZK4A 3GEMA 1N92A 2WMDA 3DMTC 1JAXA 2EP5A 5T6BA 1IYZA 3EW7A 2LDXA 2X0RA 2Y93A 2EG9A 1A4UA 1RM3A 4AJNA 3HDQA 1UAGA 4QUKA 3NRCA 2A9FA 1NQTA 5F1PA 3TWOA 1KVUA 1A7AA 2BI7A 1PJCA 4OMUA 1ISGA 1GUYA 3GQVA 1ISHA 5CEFA 1A5ZA 3PHJA 2A35A 3WGZA 5I7FA 4MP3A 2FRDA 1LUAA 3CSDA 4A73A 3KSZO 2DBRA 1RJWA 4K28A 1A71A 2WM3A 2EW8A 1A9ZA 3AI2A 3DL2A 1KEWA 4CLRA 1S6YA 4HXYA 3HB5X 3BMQB 1ADGA 3DZGA 4CMIB 1LDGA 1R0LA 3RQSA 1JLLA 1RM5A 2H1SA 2EIHA 1M75A 5KOIA 3TQHA 4KTTE 2GSDA 4IBOA 4NI5A 3ZH2A 2GDZA 2IYOA 2HRBA 1PZEA 3G49A 3VTFA 1N9GB 2DPHA 2RH4A 2DAPA 3GGOA 1DDOA 4LGVA 3JQFC 1QYDA 4EW6A 1C0IA 3BTSA 3ST7A 4AVYA 2PWZA 4EJMA 3KHUA 3V2GA 4MP8A 1CWUA 4IY1A 1DIGA 4ZQFA 1KS9A 2EW2A 3ETEA 4E32A 3U3XA 2G76A 4J90A 4ALJA 2QHXA 3ZDFA 2B4QA 4WOJA 3MWEB 5DP2A 3AOEA 4E13A 3G1UA 1EFLA 4N5MA 2Y67A 2SCUA 4RVSA 4AJJA 5JYEA
chains in the Genus database with same CATH superfamily
1DPFA 3GZNA 3U4IA 2CL6X 4W7SA 1ONSA 4YRZA 3R5XA 5LPNA 4IMJB 1QXSA 2PMKA 3CKYA 4RULA 3T3MB 1JJAA 1D0VA 1N0IA 1N3BA 1G0NA 2W8BB 4HGQA 1Y9JA 2Q62A 4W7IA 1QGYA 2C7PA 2WJHA 1Z7WA 3OZEA 5EMKA 3TSZA 1AZTA 3FPSA 2A9JA 2EZTA 1J5PA 3FNGA 4NMXB 2O0KA 4EG3A 4F4JA 4AL4A 4R1TA 5JMOA 1HORA 1KNQA 4YHBA 4DA0A 1SKBA 2ID4A 2ATIA 4MKHA 4QJ5A 5LJLA 5MDHA 1KQ3A 2HWUA 4K6HA 4XA8A 2JAQA 1C7RA 2C29D 5TJ9A 3Q5EA 2PEZA 3M34A 4LNAA 4C7OA 1SBTA 3KT6A 3KYBA 1AGXA 1O97D 4DR6B 4O5AA 4TLDA 1COWA 1V7QA 3MMPA 3X2SA 1VKJA 5CLLA 3ROZA 5REQA 4UTRA 4F2WA 2CT8A 4C3ZA 3WV5A 1RYBA 4HY3A 5LNK1 3JQ9A 4R5HA 2FK7A 3Q8LA 1L7QA 2PG3A 2E2WA 2BD0A 3MAAC 2VN8A 4RZQA 3FX2A 4H35A 4OH7A 2B94A 3DE5X 4Q1DA 3W3AD 3OLWA 1DADA 5CCDA 2Q4OA 1I7SB 4K05A 4M9SA 1NQAO 4BCDA 1SVWA 5B7NA 2F8MA 4LE2A 4AJ9A 1N9GA 3IBSA 1OW3B 4IUBS 5J2UA 4I2NA 4PWYA 4CFSA 5EZQA 2RGDA 4UVHA 1P2SA 5ED0A 1CB0A 4IIBA 1MOZA 1CDOA 1DIRA 2JZOA 3B12A 3MUNA 4IIFA 2V9CA 4Z9YA 4AKTA 5ALFA 3PCTA 1QZ3A 4ODIA 4HI0E 3HFJA 1AZWA 2HIAA 5CLHA 2CBGA 5LWQA 3TOCA 3IP8A 2ENWA 3UUFA 1KMQA 1UYJA 1K6EA 3M4NA 5TNXA 2QT9A 5D3QA 3GRVA 1IQUA 3B52X 1SD5A 2OAP1 3EWAA 3THRA 2AOWA 3IFSA 1D1SA 3ONDA 4II3A 5J5VA 5LR6A 3R9WA 1E5QA 1OLXB 3OTGA 1ZGJA 4KPUB 4A2CA 4AMYA 4OI4A 5B36A 4PU0A 3WLKX 3LP6A 3QFSA 4CETA 4IMIB 3P9YA 3ZDAA 4O63O 2ZVQX 4FMBB 3OMWA 3FOBA 4DZRA 1EWTA 1IY8A 1OPRA 3OBBA 2XHEA 1YZQA 3EQ7A 4MV8A 3VQTA 4BMOB 5J1SB 1P17A 3MT8A 4XWKA 5GZ6A 2BBSA 4RD6A 3V4LA 4ZDJA 1IE3A 4ND6A 5NLLA 4FJ0A 1F2TA 4M4SA 1ICIA 3SPXA 1HDIA 3KPWA 1EBFA 1AX9A 3OQIB 3AFGA 1E3IA 1C7FA 2FCAA 4ADSG 3U56A 1W5SA 2BC9A 3M6IA 2NADA 3ONEA 4O1HA 4J3JA 1M1NA 1LBEA 1UJ2A 3IP9A 5IXSA 3U13A 1GITA 5J2TB 5EI5A 4EA8A 1QYRA 2BLNA 4KQ6A 2BGNA 1MIHA 3QEAZ 3KSMA 4JT8A 1D07A 1KO8A 1AZLA 4EHFA 1T2CA 2F7SA 1OFTA 4NIMA 1QR6A 1U6KA 2CHGA 4MR7B 1GNQA 4X71A 3O4VA 4GOMD 2QMZA 1H4SA 5K0LA 4A3SA 1VP3A 1I2CA 3LKBA 2IYAA 1YRYE 2WOOA 4E70A 5LOVB 2OBYA 5DYNA 2YL2A 1M2GA 1AE1A 1PL0A 5J5AA 3MQ4A 4QJBA 3RI3A 5HJ5A 1A7UA 5AK5A 4WBNA 3PFKA 2ZFUA 4LZAA 2EL9A 3T9BA 3TSCA 3ZS9A 4BO9A 2LDBA 1S3FA 3N8NA 5FPYA 3EY4A 2UUCB 4PONA 4ZO8A 2XZDA 4KQJA 3ZWVA 3DMTA 5IUKC 3N2LA 4JWTA 5BMOA 3CG0A 2D5BA 3IEPA 2XKJE 3WP1B 3WNVA 4DV4B 1N1MA 3RRBA 4HXFB 5AOVA 1KE1A 4A92A 2I0FA 3EW9A 2J59A 4G8JA 2F55A 3WYBA 1R10A 4HWPA 1S3IA 2FEWB 3ZV3A 5K20A 3AP3A 1FLAA 1OZAA 1NATA 4S1VA 3DLAA 4MRVA 4V03A 1FXUA 4K9KA 5E6SA 1A76A 5BO5A 1SKYE 3LHSA 1W73A 3A1TA 4WBNB 4PLHA 4CMBA 3OT1B 1JB1A 1TX4B 3EXFA 3IAAA 1KAGA 4GICA 4EKIA 3MMXA 3FNQA 2PXAA 5C8VA 1J00A 4FMCB 3QUBA 3AR6A 1X7YB 4RVNA 3ZY2A 4B3IA 2PFKA 4D26A 1QIGA 4A8PA 5KWVA 3EIHA 1G18A 3A6JA 3IKJA 1RXIA 4I4TA 5G0UA 3IEIA 1H8HA 4GVPA 4OL9A 3QI2A 4OU4A 4WOCA 3RV3A 4AWBA 2Z8XA 3QKSA 4TZ6A 1CY1A 1Z88A 2FX3A 1GQYA 2F59A 5DK4A 2IH4A 2KX7A 1OA1A 3M70A 3SE7A 1MENA 3ZK8A 4Y9RA 3HWSA 4NBNA 1WLYA 4LJAA 1D04A 4FMDB 1FRQA 2E4WA 2G0AA 4A23A 1UC4B 2IYUA 2FLVA 3C41J 2GBLA 1W4ZA 3OPXA 4JBIA 4NF2A 5CP8A 1NM5A 4YO8A 5ETJA 2C58A 2WJWA 2QDXA 1XJWA 2BLLA 1SK9A 4XVUA 1D0SA 4YLGA 5CA1A 4Z9XA 5C0OE 8MHTA 1MC5A 2GS9A 4H2DA 4QHTA 3O94A 2OV6A 3Q98A 4ZVTA 2HU2A 2FUKA 4KBFA 3QPUA 2QN7A 3SHVA 2RHMA 3HXTA 4H9GA 4AROA 1DEHA 4WY8A 2H7CA 3DOOA 1L6RA 4PTYA 4RD1A 2OO3A 2O1SA 2DJ5A 2IQIA 2B2CA 3C6BA 1OFVA 2HV9A 4IICA 5EWJB 5C81A 4YB8A 3H11B 4PO3X 1RXYA 4LHYA 3DB2A 4Y3UA 5FOWA 3ZTTA 3QP9A 2WMNB 4F3RA 3C6YA 4NZOA 1O95A 3A3KA 2DPMA 4UTZA 2IHVA 2FW7A 1JECA 4ZU6X 4HEQA 3O90A 2OFPA 5K0JA 1GPDG 4YAOA 5IWCA 2GCNA 2GEKA 3EAGA 4UQOA 4UUBA 4V2UA 4C7OB 3LCMA 1LD3A 1JR3D 4KVFA 1DFIA 4FJ1A 1CRQA 5IDXA 2EZ8A 3UQZA 5C3MA 2CV0A 4Q3KA 3FWNA 2IZ5A 1IONA 4TKVB 2ECFA 2FPIA 2PLWA 3UOWA 1CJBA 3AI1A 4WZAB 4BEVA 5JCJD 5JXJA 3R7BA 1ZEMA 2V9ZA 3DKIA 4D6YA 2OWEA 4C0WA 4RMGA 3TAHA 1N32B 4TMYA 2J9FB 4YJDA 3DZ2B 1MAWA 2EGHA 1KOLA 5I4IA 1YJAA 1APBA 1A5SB 2PWPA 1CBUA 2K4MA 4OCZA 1CJUC 4B47A 1OXUA 1XTZA 3KIPA 2BMDA 4HWGA 4IOJA 5AXAA 3ZOZA 4C4YA 5BMVA 1OGJA 2JDIA 4HDNB 4CKXA 4L9WA 5H3HA 4QM7A 1A9RA 3O8OB 2ZUCA 4IIUA 4QSMA 2V5UA 4LMBA 3VR4A 3JR3A 3A9RA 4IZHA 3GWZA 3DDUA 1VE1A 4HWOA 3SJ7A 2FWBA 3V7WA 2UYYA 1IWOA 4P2GA 1E3JA 3GD7A 3NC0C 4V3BA 2IW1A 4GP7A 2IZ7A 5T4HA 1ZW1A 3UG7A 2GRJA 3H2IA 3RTBA 4MJLA 5JNTA 1RRMA 1PGQA 3KEMA 1DIHA 4LGCA 4TTAA 4OBXA 5EJMA 1OIXA 3IV9A 3TZEA 1RLUA 3FYUA 1PR1A 2CZGA 3OEHD 2PCJA 3H87A 1TNDA 2WJZB 2C94A 3FPEA 4IIXA 3WYDA 4DE5A 5FPHA 4KR9A 1VMIA 2C5FA 2O2IA 4EVIA 4UAJA 4XASA 3R5FA 1Z07A 1YUNA 3EQ8A 4H08A 2CXTA 2QF7A 3WIEA 5ADUS 1VIVA 1C30A 3E7PA 1ODFA 3NP9A 4KPGA 2B6HA 1WU7A 2V9PA 3K8ZA 4KK4A 2AIRA 1JKXA 4P4UA 1PL8A 3KT3A 3ED5A 1U1FA 2PEYA 3QKTA 3U7EB 2AOUA 1Q11A 4DSOA 4F4CA 1XNJA 2Z9BA 3BDIA 3UT5A 2BTEA 1GTSA 2C31A 1KR5A 2X9NA 4RHXA 3UMJA 1YK1A 3B70A 3LPDA 3I64A 3QIVA 4KZPA 1XQWA 3AV3A 5TRTA 2Z6UA 1UODA 4ISCA 1F12A 3M9WA 1IPEA 3REGA 3U5ZB 4DEYA 1GO2A 5JSHA 2PRJA 1NVKA 1Q50A 5LBIA 4XGKA 2CLOB 3OQJA 4V39A 2WQ6A 3C3EA 2HIHA 1I5EA 5JXGA 3RSLA 2ZBFA 2QRKA 1U7ZA 1CS4C 2VI5A 2WSYB 3DLTA 3K5PA 5CLFA 4MRSA 3HY6A 4IQ8A 1U8FO 2WVHA 5JAZA 3W4IA 2EG5A 3R3SA 2ZT6A 3BHNA 1FVXA 2DOKA 3EGDB 4NAHA 4P33A 2JHAA 3SS7X 5J2UB 5K0CA 4EOGA 2GT1A 4XE5A 2AN5A 2EKZA 3V4RA 1Y7PA 3KE9A 1Y6QA 4P6VF 4DBLC 1SCUB 5J4HA 2EKDA 4MQLA 4MEBA 1TZKA 2PZ8A 3NM5A 2BTQA 2WM8A 2QTHA 2DQZA 3ESXA 4MW6A 3MJEA 2XWBF 4D74A 4J1NA 4FBLA 4N03A 3D6VA 2VHXA 3CWQA 2YXDA 2AKEA 5CT4A 2XVAA 4HD8A 1X94A 2QLLA 4NMMA 1CB7A 4K8OA 3U39A 1P2VA 5HG0A 4EATA 4IOMA 2JH8A 4KXXA 3PQ5A 1FP7A 2RJOA 1P6QA 2QTFA 4NFYA 1FMFA 1EEXB 3MRXA 4KG7A 4QBTA 3R7NA 3ND9A 4DSAA 1QCZA 2A5JA 4ENUA 5DK6A 4FCTA 3GLGA 3CH5A 2WJ4A 2VH1A 1FLNA 3GT3A 4IIJF 3HV2A 5ILOA 3AM1A 1R27A 3QWFA 4ZOLA 3D5EA 2QX8A 1MJ5A 3W1VA 1YRAA 3LY9A 4GM0A 4JLSA 4IIEA 4JYMA 4ZJPA 4PYMA 1DINA 2GCEA 2ENUA 4BLOA 2PKXA 3K9HA 1YJXA 5E7QA 5TMBA 3BJMA 1QK5A 2VPTA 5CBPB 4Y2GA 1JDJA 3MGCA 4UHFA 1W0KA 3NTVA 4ICIA 4LN1A 3UAOA 2ADMA 2Q9UA 5F4BA 2QP3A 4YP6A 1DSSG 4C3OB 4XQEA 4C2UA 3GVPA 2QMEA 5CVEA 3UK7A 1EH5A 2IIPA 1HH4A 2TS1A 3H1EA 1NBWB 2CLSA 1UMDA 3HVIA 5DNWA 5DXFA 1SOUA 1P5ZB 1ZI6A 2ZTHA 1QHNA 4I2VA 3LFHA 2NUTB 3VVCA 1YQQA 1PT8A 3FYTA 3A1VA 3G2OA 2G1PA 1KH2A 3IT1A 2CK3A 4XYEA 3N2YA 1TT5A 2FFQA 4TV8B 2QRZA 2VDKB 3AF5A 4BQEA 3PENA 3KQUA 3COZA 2PNFA 4XXHA 1P75A 5P21A 1U0SY 1XAHA 3OZSA 4RH1A 3N0RA 3PXCX 1RYYA 5E8JA 2KI5A 1Z6XA 4LY3A 1DBVO 4KDFA 4EUHA 3FROA 3O5AA 3NBUA 2R6CA 1O95C 3ENNA 4R1NA 3COWA 4OQFA 4QDKA 1WZIA 2VHQA 1DBWA 5GIPE 2PS9A 1OKKD 1BRMA 4YREA 3U4MA 1NI4B 3GZJA 1VMAA 3G82C 1PQ4A 4JQSA 3RAGA 4UPEA 1VBNA 4DLAA 2JFWA 3AU8A 4C07A 4Q47A 1VRCA 1IBKB 1E2IA 3AP2A 2WP0A 1UBTS 1OBVA 3TCKA 5KOJA 2XY4A 1U7HA 3P4YA 3K70B 4H7FA 3K0EA 4NPAA 1KMCA 4A9AA 3EQZA 2IYPA 3GR6A 4Q9LA 1JLKA 2QGNA 4X90A 5JTUA 1BQ4A 4ZCPA 3OHPA 3OAAA 1GL9B 2C2YA 3L18A 4CTJA 2OAGA 2WJ6A 3HGMA 1C1HA 1NIJA 2QENA 5CU7A 5AI8A 1E8MA 2VTDA 3MWDB 4GMKA 4LWPA 2RD2A 5C18A 1J90A 2CMHA 3LHFA 1TM7E 1YZNA 1KHTA 1U9IA 2L18A 4KCGA 1RYFA 4PSUA 4RD0A 4ZVRA 4TMZA 3W34A 4EBBA 4WH0A 3WXMA 1LTKA 4QGFA 1XTTA 3MGGA 4MUXA 1IIBA 3RBVA 4B17A 3QHQA 3FMGA 4LMRA 1YE5A 2C1ZA 4EUFA 2PYIA 2JLVA 1X80A 3AUAA 3LIIA 3LRPA 4G4SP 4TKUA 2PUHA 5CA0B 3K9FC 3QVMA 4RPHA 4AG5A 3QX8A 5BV1A 1YBAA 2PAFA 4ZOBA 3SBDA 1R0YA 1JKFA 3AW8A 4DHWA 2R00A 1U2QA 1TC2A 1ZIPA 2W4QA 1J42A 4Y30A 5AUOB 1XZPA 4OSOA 4HNTA 2JIRA 1R9MA 5EIOA 2BBWA 3OZGA 3ZQUA 2EJUA 3LCVB 2VTBB 1W0JA 1FNCA 1RXUA 3GI1A 3MWKA 4GR5A 2IS1A 3AFNA 4EHLA 3D6AA 3SXUA 4EEZA 2F9FA 3GNQA 1Z7GA 2L42A 2PBRA 3BDAA 4HXEB 4ZHQB 4PG4A 1Y5IA 2OXCA 1KMIY 4R2JA 1PWZA 2AFHA 4R5MA 4TKZA 4D96A 4ZV4A 1PJTA 4KMRA 1V5EA 4WV3A 1ODKA 3SEZA 1P62B 3DFMA 5IKXA 3HTXA 4AO8A 1YC5A 4C04A 1N0VC 3UUGA 1T91A 3CRW1 1SA0B 5AKJA 4F2PA 3AVUA 2R68A 1RAGA 3B36A 4WJLA 1ZVJA 1W93A 2Y1FA 3KEGA 4RZ3A 4K5QA 4Q15A 2OAQ1 2WIKA 3OPQA 3B7PA 3OPYB 3A6ZA 3W3AA 4RD4A 4WPGA 3ZIAD 2DETA 1C41A 4LNUB 2HJWA 2D8MA 1MW9X 1FNSA 1WD7A 2JD2A 2P9EA 3G7SA 4NCJA 1SQFA 3T3EA 5CK5A 1UKZA 2Z9CA 3BRQA 1JMYA 3AEUB 1H6AA 1HE2A 5DKFA 1RPZA 1EM6A 1W1IA 2VSNA 2Z2XA 4LTNA 2PJDA 2X4DA 3SF0A 3DDOA 3DYIA 1F60A 4EO4A 3PXEA 2O2CA 2IXEA 4MB2A 4K6FA 3P52A 1NT4A 2FPXA 2J5XA 4NZMA 3FZGA 5EJAA 2GHTA 2NG1A 3ONWA 2VF8A 1GTRA 2JKZA 1KYQA 1J21A 2YNMD 3DLIA 2KS6A 1Q1GA 5AKHA 5K3CA 1NV8A 2X4LA 3FJ1A 4C3UA 1BMFA 4P93A 3UJDA 1U2ZA 3RS0A 1IN5A 1EINA 2DUJA 1FYXA 3JAKA 3F74A 2HQBA 2NLOA 2JBHA 4BC0A 4OKSA 4RY0A 4DQXA 4LAFA 4P1ZA 4LYGA 3G6WA 1E1KA 4UM8B 2EWWA 3QNMA 4O4JA 5F7JA 2FHPA 3RC3A 3MQFA 1BH2A 2OHIA 3FPKA 4LYAA 4U0KA 5DASA 5ISMA 3EFHA 1ND5A 4MUGA 1DBIA 1U0BB 1LF0A 4OLJA 3IIEA 3ZZ0A 4D79A 5ENZA 4HQ0A 2DT5A 3CYFA 2D2VA 1YNSA 4INJA 5I7RA 3EF3A 3USES 4X8LA 5JS1A 3HCCA 1QS0A 1OFUX 2QLBA 5BW8A 2CNDA 4YAFA 4BNVA 4TN5A 1VGVA 4QYIB 2OD9A 1GADO 3AG6A 4FGWA 2QD4A 3EISA 3KFLA 4EPVA 2CFTA 1LK0A 3IOMA 4R98A 5LUBA 1TTTA 3N0VA 3QBVA 4LF7B 2IEDA 1PZNA 2GA9A 3EBOA 4KXNA 1EVYA 4HQOA 3FNEA 3FPGA 1BO6A 4LK2A 3K94A 3EULA 3EAQA 4J0QA 4OSEA 3DFZA 1OWMA 3I61A 1AMUA 1YQ9A 3WGOA 3ZDXB 1X13A 2I4NA 1AB5A 4TVKA 4QGBA 4XEHA 121PA 4PYOA 4TRRA 5D5HA 3DTVD 4EVSA 1A9PA 3JX9A 5KI6A 4N8SA 1XB2A 3AJEA 3PRJA 3BWYA 3T5CA 4FLMA 3KZNA 2XE4A 4OQLA 4CQMA 2GBFA 1EX7A 3RADC 1CJKC 2RHDA 1SAYA 2H2DA 4KUHA 3E3AA 4LX8A 3OOSA 3GLRA 1U3FA 3C0KA 1OR8A 2O8FA 4HSEA 4Y2QA 4U8HA 3BIOA 4W82A 3WTBA 3AQ4A 4JDUA 1J23A 1O6ZA 4PE5B 2OVBA 2HWKA 1NVFA 2RGNA 4C0SA 3QKUA 4KQEA 2XH8A 1E4VA 4Q9NA 2DUNA 5IM5A 1ZGHA 5ALTA 4DUPA 4POOA 5KQPA 1THMA 1BFUA 3E70C 3X2FA 5AVWA 3SLRA 1GAEO 2DF8A 1U04A 5KVVA 2R8EA 3OFND 2X40A 2PT5A 2REBA 4X1KB 4HT3B 4B3BA 1ZPDA 1MO6A 1AN9A 1EGHA 1ULTA 2PVPA 1I0IA 4NOJA 3QLUA 2BGJA 3M5DA 5JRZA 5LYJB 1FQJA 3HQ4O 3ZGNA 1RMYA 1NHWA 2ATEA 2O2DA 3ZDZB 4UKDA 1AMNA 1JZQA 1GAQA 2G72A 2OCIA 3H16A 3P9CA 4ZRDA 2AXNA 3C3KA 5FWYB 4RHTA 1WUYA 4HQNA 3D1VA 4KBYA 5EKUA 3ROKA 3RBZA 4DM3A 1T26A 2Y05A 2PVCA 1L3IA 5SZKB 4AIIA 4MA5A 5G1PA 5KKAA 1TA9A 1R16A 3LYLA 1Y4UA 4M8NE 1JTFA 3TM5A 3PWZA 2QDKA 1GKKA 4K9OA 5FFMA 5C51B 3MRSA 2EOAA 3K0CA 4ZVLA 3G9XA 3ZU3A 5K6RA 3TV1A 2I1VB 4BVJA 1YB6A 3LWDA 4PYLA 2E6UX 4MRMA 4BP8A 4ER0A 4JI1B 1K88A 2DWQA 3TQRA 4E1VA 2JAXA 4EW1A 5LFAA 1I51A 2QVLA 5KQGA 2AW5A 3E53A 1GRRA 5IBPA 4AKEA 2B1GA 4RTSA 3Q12A 2AG0A 1YDWA 1XXLA 3N0WA 3P4UA 2H2HA 1AY0A 3DKPA 3NOQA 5TR9A 2AD5A 1ODJA 3R7WA 5HWSA 1RABA 4WOBA 3PQ4A 1USWA 1G3UA 4MO2A 1Z2CA 4FQ8A 4IS2A 4LQ4A 4ZDWA 1PEDA 3I23A 2AR9A 1Y1LA 2A9QA 4P54A 3LKDA 5DV9A 3CINA 3W2GA 4LRUA 3W9BA 1O6BA 1N2SA 4GKBA 5F1OA 5AVSA 1R4MA 1JLLB 2IEAA 3PA6A 5A9TA 1BS2A 4DG5A 1SHUX 2VEOA 4L8WB 5BWNA 5IKEA 2Q5IA 3T5PA 1CR6A 3P9KA 3K4PA 1W5FA 3MYYA 3Q7QA 1PGOA 2XJ9A 3AB8A 3NCTA 3OQ1A 2W98A 2ZWVA 3P71T 2I6UA 2X8BA 1N2BA 1TIBA 2G88A 2MHCA 4BJ5A 3I2IA 4EJSB 4EG4A 1I0LA 1USIA 4EB0A 1SPBS 2EATA 2GEJA 1Z08A 3N3BC 1JYEA 3ETDA 2Y9MB 3GPDG 2HMTA 1SC1A 4MYCA 4CM8B 5JYDA 3N0XA 1DC6A 2ABWA 4JY7A 5BWLA 3HI4A 4QDZA 2RBGA 1RPNA 3CUWA 3KKNA 1PFUA 4RSRA 1I7DA 3TG2A 1VG8A 2ZTVA 3G2NA 3HCAA 2O8EB 2XUZA 3HKDA 2CLMB 4ZC8A 1E99A 4HSGA 1WBBA 2RGRA 1YMUA 4ZQHA 2BDTA 3DDCA 4OEHA 4MUJA 5AR1A 3O8NA 3TAUA 1EFCA 3V97A 5CFRA 3BWVA 2KM1A 4I9NA 4PG5A 2Y27A 2HCFA 1G2IA 3UGQA 1LH0A 2D5CA 4XQ0A 3CZ5A 4EARA 1GTL1 4JI2B 3KKEA 1MT0A 2ZSAA 1G38A 1AO0A 3N87A 1EPUA 5KNBA 2B36A 2D5IA 2ONYA 1MFZA 3OSUA 4LFAB 1U7WA 2BFCA 2HM7A 3GJ3A 2MMGA 3UB4A 4BNXA 1P0PA 3S2ZA 3QLVA 1U7TA 2BWJA 3M9LA 3V2IA 4WY2A 1B76A 2CFIA 1T0PA 1YMQA 1T9GS 3LA8A 3HU3A 3RYHA 1RJ9A 2Y4OA 1E9AA 1TVCA 1O08A 5FBWB 4B6GA 5DULA 4ARCA 5ICMA 5D51S 3M5WA 1PTKA 4OD0A 4HX2A 1P9OA 4RSGA 1E3WB 4WFQA 4BYMA 4TS3A 5JWRA 2VF4X 2YYSA 1EQ2A 5FPPA 3DBLB 1EXWA 3DPIA 3HGQA 3PVSA 2OQRA 1JQDA 3S5UA 2YW2A 4LPSA 2PH1A 1WWKA 4JEIA 2Z95A 1DE0A 1TUEA 2HA6A 5H80A 2VBIA 3ZU2A 1EDOA 3CISA 5NULA 1R6VA 1H05A 4ZOQI 4MJXA 2H8GA 1KH3A 4C0JA 6REQB 1WP4A 4Q3OA 3VU1A 2XRFA 1QNLA 3EEYA 4RORA 5FTJA 4NU6A 1Q1EA 2IU3A 4HN2A 1LEHA 4NV1A 4G8CA 4D4GA 5K45A 5IARA 1DI0A 2FN8A 2YY6A 1U8CB 1WNTA 1ZD1A 3E84A 3ZEIA 1QHIA 2I2CA 3FMFA 5LN1A 1IM8A 1CQIB 5CJPA 2RARA 2VP5A 4WNCA 4HRYA 4KFRA 4UVEA 1DUSA 2RI0A 4AICA 2ZULA 3M7IA 2MYUA 2FDCA 1Z56C 3E7WA 1KRWA 2AB0A 2AOTB 4FDUA 2O6LA 2FEPA 4JR1A 4X7BA 4BZZA 4DLWA 4C4SA 3STVA 5EMMA 1U80A 4KXFB 1EVQA 2EC5A 1BG6A 5AVOA 1E92A 4ALNA 5JS8A 4UDOA 2WJAA 4ABTA 3PUIA 3JQCA 4YCBA 3QXJA 4DC0A 5AJZA 3R8CA 3IIMA 1PT7A 3LBYA 1YIDA 2NNLD 2NPIA 4WUVA 4CDRA 1L8OA 2VHVA 2Z5VA 3DDZX 4XDHA 4YJ2F 3FPFA 1D7AA 4UZFA 5DXAA 3KUCA 1FA9A 4O4LB 3V8NA 4EKDA 1RQPA 3OT5A 5TVKA 3S68A 3P7MA 2O1XA 4MP6A 4MA0A 1D2AA 4CMEC 4TGLA 1IRXA 3OCUA 1SXJC 1Y82A 2NUAA 3QX9A 1UMKA 2I2WA 5FAXA 3IEXA 3X1DA 4TVOA 1RXWA 4FHZA 3EIUA 5ENVA 1KBZA 3EMVA 1FB5A 5AQ1A 1XAIA 3RKRA 2QGZA 1TEHA 5C9ZA 1VRVA 2CHQA 4UXIA 3JARB 2OZLB 4IGFA 1WMDA 2HI0A 2XOKA 4JJZA 4XDYA 4NICA 4XWOA 3LIPA 3TE6A 1P39A 4YRBA 1FS4A 5TPWB 1IWBB 3OTQA 1KQFA 1Z37A 1U2DC 2E5WA 4MICA 4HNAB 2YJGA 5FBHA 3W90A 2AN3A 4X95A 4RGBA 3VHLB 4E94A 4R4JA 2IP1A 3ZHCA 4A8TA 2EJCA 5IU6A 1XV5A 1PN3A 2FU5C 3GEEA 5CB4A 3QOWA 4UM7A 5FR1A 1QTRA 4ZQCB 5K4AA 3E61A 3G5TA 3AU9A 1HWYA 3LDGA 2RAUA 1WRBA 1NUAA 1YFZA 1NF3A 2H8KA 2XA1A 3AR3A 3TRIA 4BKPA 4C4PA 1YR8A 5EYPB 1Z2EA 4LWOA 1XK6A 4JI6B 2E85A 4G0XA 4KI7A 3TN7A 5A0TA 2HH9A 4E08A 1L7AA 4L0MA 1BXGB 5GVSA 4X44A 1TYAE 1AXEA 3ND8A 4LDAA 2AQKA 4ZGBA 5ABPA 2OMKA 3EEQA 2RI6A 2VPWA 4X94A 2HB6A 1T9KA 3G85A 1B0PA 3GAZA 5SZHB 2VP3A 3ILHA 3KZCA 3F9CA 4L3OA 3L5KA 2Q8PA 5DBHX 3JQAB 2VNIA 2CL5A 3VU8A 4PZDA 2FZ5A 4FYVA 3MWEA 5CAEA 4PBTA 2PLFA 5JSQA 3KJHA 2ZPTX 1WUHS 1BNCA 5TSDA 2RIPA 4OH1A 1KFKB 1VSVA 2OWDA 2ZE8A 1JJ7A 2B37A 4V0KA 3QE2A 2HU7A 1BJRE 1UM9B 2BEJA 2G36A 3DWFA 2J32A 4U0JA 4P4GA 5CPBA 3UHFA 3HXPA 3QYPA 1W7AA 4BP3A 1DAEA 5EZYA 3LF1A 3ZU6A 1U1EA 4FNMA 2AF3C 4LS3A 4PIMA 2HYIC 3A4NA 5LLSA 3GFPA 3LUCA 3D0OA 3WV4A 2QZ9A 1GNTA 1RLTA 3PK0A 4WASA 4AQDA 3NPAA 3IEMA 2CSUA 4L78A 3R0IA 3GJ0A 2YWGA 3CBQA 1HG0A 1GGMA 4HLCA 1RAEA 4X84A 4EHHA 3F2IA 2BCJQ 2X0KA 2GPSA 1E69A 2UV8A 4XVQA 4CV1A 4DCPA 1NQWA 1EX1A 4BPRA 3O1JC 1QH8A 5BSUA 1US8B 5SYNA 4F3KA 1INLA 1RRVA 1SU8A 1Z7YA 2UUPA 4NBTA 4P4SB 3STTA 1E4EA 2JBAA 3SYRA 5C1OA 3O8DA 1Y9DA 2OV1A 2FV8A 4Z3DA 3L7NA 4EHNA 3I9V6 3NBQA 1CERA 4Q02A 2HPAA 2Y1XA 4IJKA 1WKCA 4CKBB 1PR2A 3PPVA 5ADHA 3QIAA 1D3AA 1I7MB 1P9RA 4MIKA 4QQKA 3VR5A 3NFRA 1KO4A 3EG5A 2YIJA 3GK3A 1HL3A 4P8RA 3BD7A 1MF7A 4D81A 4F3TA 3VAZA 2A1TS 3Q1LA 3EGCA 1N7IA 3IURA 4M8SA 2PZKA 5A1JA 1WB4A 1Q1BA 1BXZA 3KSAC 2EKQA 1GAJA 4Q9DA 4BLRA 3D64A 3FAZA 1MNAA 3B6ZA 3LQ2A 4QATA 1UZLA 4RENA 3RFCA 3V1MA 1I2ZA 1N9ZA 1RCTE 2PO7A 1OPXA 3A9SA 2HMVA 3KQKA 1U1IA 4M0KA 1DEKA 2I7XA 1E7RA 1ZS9A 3ZTYA 4AJLA 3A3NA 4WEOA 3IUEA 3A3OA 1EVLA 1FFGA 2WWFA 2ZYHA 4QU9A 3LLMA 5AO9A 4MUIA 4Z2YA 3CLSD 3D3NA 2PGDA 3I2HA 4PZPA 5C8XA 4NYJR 2CUZA 3KTDA 2GD2A 4ZO7A 5CCEA 2AG5A 1P1CA 2BKAA 3ZWBA 4BO3A 5IFKA 4KSYA 4M9XA 2WDPA 2A92A 2G4VA 1FJGB 1H5NA 1AKMA 1KI9A 2Z0MA 3I5XA 1IVYA 4UNRA 5JO0A 1SCAA 4IPTA 1Y1RA 2ZJZA 1Y8ZA 1OLSA 4Z0NA 3NWJA 1IRIA 2FY8A 1MVNA 1NX9A 4EVRA 3UTCA 3UJNA 1UJCA 1PS0A 4U6QA 1F5NA 4TZTA 3ADDA 2M2IA 3KZOA 1EK0A 1CJCA 1YAHA 2AC2A 1U0JA 2BGRA 1GUAA 2QLFA 4IMPA 3SYKA 5CXQA 1OFUA 1T4MA 2O3QA 2V6FA 1KEKA 2QLJA 2GPNA 4LQCA 4EG5A 1POWA 1I4EB 3R9XB 1A4RA 1T9AA 2DP4E 4F3YA 1Z4IA 1JLSA 1Z25A 2VCHA 2UZ0A 4O4JF 4BGDA 3VSAA 3LQFA 3VTKA 4YV1A 1W5AA 4XUCA 1QVWA 1PQPA 2CNNA 2BH2A 2ZIVB 2Z09A 1TTQB 2JCSA 5B53A 1VHWA 2WAMA 3WL6A 1EGAA 4F5YA 5IF3A 4TWRA 1Q20A 3LM8A 1NYQA 2XAUA 1Y98A 3HADA 5A5GA 1KP3A 4R3WA 1JG3A 4TS1A 4HDSA 1V4BA 4L6AA 4IOKA 1L4NA 2FZ4A 3EH2A 4PAOA 4XW2A 4GU5A 4YFVA 4FGLA 4MKRA 2A14A 4A6EA 1PCXA 3TVDA 1PAUA 5JCOA 2IK8A 3HJTA 4DAEA 4A0HA 2YV3A 1ORWA 1QX4A 1GRQA 2WIJA 3MHPA 3BRSA 3WA6A 3IR7A 3IPYA 1FDTA 2BEUB 3K5WA 5L6MB 5CURA 3LVQE 4K3UA 4HAYA 4FR5A 1QQTA 1Q22A 1R8XA 2WOJA 4LJKA 3HXQA 3LYHA 3TKAA 5TPZA 3BREA 1T0UA 3M9XA 4URYR 1KNXA 1Q6YA 1YJQA 4I8XA 3ROTA 3VR5H 3U9SA 4UBLA 3S99A 4ITUA 4US1R 5C4GB 4DWWA 3ITEA 1GIAA 1V9SA 3CCFA 4L07A 4UXJA 2VWQA 3AVXA 3HCNA 1JFVA 4B87A 3OM1A 5EYPA 1JEAA 1J0CA 3D54D 3U1VA 1S1MA 3R74A 3EZYA 5EMHA 2IOYA 4C7KA 4RIFA 3BJEA 3ZJYA 3WX0A 3U9TA 1DGQA 1T9DA 1PU2A 3B2NA 4ARZA 1J8QA 3I6IA 4HDRB 2UZ1A 1RFGE 3QPDA 4XOUA 1GGNA 3QLEA 2OBBA 4ZODA 4BV9A 3OQMA 4AKIA 1A27A 2C96A 2YJTD 1NXOA 2ET6A 2YINC 4LXYA 5H83A 4YJFA 4Q66C 1QP0A 1RHJA 4KVAA 1M6NA 2DC1A 1QOPB 1S9DA 3EZFA 3QBDA 4YFYA 3UC5A 4GZ5A 3QU4A 4AC9A 4JL6A 1JFTA 5K51A 3LQ4A 1DJOA 1X1DA 3IWBB 3V4SA 4YCCA 2DFVA 4LRYA 4OAPA 4FS3A 4P58A 3R0VA 1ILEA 5JH7B 2PYZA 2DHQA 2A86A 4E07A 5KTOA 1E2FA 1XR3A 3EK2A 5HCNA 4ND2A 2QROA 1W6UA 3X44A 1KI1A 4KRGA 2O2SA 1LLDA 2GSWA 1SQSA 4UNNA 1XN4A 4M0UA 5THKA 1ATZA 4NOMA 2A8YA 4F84A 2HC9A 5GQSA 4A2PA 1JGTA 3PNVA 4LWQA 3BF8A 3T3IA 3I5MA 2OUKA 4ND1A 1DBSA 4I55B 5J4VA 2VIIA 2QUKA 1V2GA 3LUDA 1LFAA 3QKRB 1W4RA 4M60A 2ZJ7A 2J6HA 1C0EA 3PV0A 4KZKA 5F12A 4C1NA 1L7DA 4MULA 4A10A 3HM9A 3AL0C 5JS7A 2OHFA 5EXSA 5EXTA 5IAEA 3KQHA 1HE5A 2IPAB 4EG1A 3WYCA 1DRWA 1J9EA 2JC3A 3LQ1A 3AR5A 4XWYA 4R0MA 1TGVA 5FWAA 1Z0FA 4BWFB 2QT1A 1OAAA 3DC2A 3DE7X 5BNWA 1NUHA 4NBSA 1XHFA 3UPUA 5H3CA 4DILA 3DPUA 5BN4B 3TLGB 1E2DA 3HKBB 4R2IA 1ZCFA 2ZSUA 3ZX4A 1UCFA 1UBKS 4R8VA 1Q92A 2NAPA 5KDLA 3T6KA 2R7LA 3B60A 4J2TA 5I47A 2N75A 1G42A 3REQA 1OUMA 5BR4A 2CF5A 3B5IA 1UJNA 2FSGA 5A02A 3P19A 3QKRA 2K7FA 2NU7A 2BFBA 1GPJA 1ZCJA 1PLJA 5IC5A 4GLFA 3FMPB 1S1CA 3HLYA 3OUUA 5D3KA 5IT4A 2WHXA 5CJ2A 3FTNA 5JYAA 4MQ6A 3DNMA 2R48A 3UC9A 2WABA 1QMGA 1R3UA 4GI3A 4I08A 3IVXA 3W05A 1U3GA 2PHZA 4E22A 3DV0A 2E87A 4RPIA 4U6NA 3UMVA 4GYKA 3DH0A 4Z0HO 1QFZA 3CX7A 1PSWA 5J4LA 3NDBB 2HK9A 2G71A 4BEWA 4PLCA 4LK3A 5TEVA 4OMDA 5ARDA 4UCFA 1CC1S 4IQFA 3B78A 4O3MA 4ZQBA 5T5QA 1XFAA 5D8DA 1P1KA 1E1MA 4BOYA 1OLSB 5AP9A 3CIFA 1EP2B 1X77A 3AZOA 3FETA 2JAUA 1PT6A 1YZKA 4OTZA 1P5HA 3P5BA 1NW6A 3GY0A 1OYYA 3O1HB 1UOQA 2CY0A 2VJBA 3R6WA 3E8XA 3EGIA 4DVJA 1Z8HA 4F6RA 1KQPA 4GI1A 4R0VA 4TMTA 3QY0A 6LDHA 4EYOA 4PQRA 4HZUA 4F1KA 3MINB 3ACDA 2ODPA 3FPJA 5ALLA 4V0OA 1L3CA 1KO5A 2RAPA 4V24A 1IHXA 4KIFA 4G4SO 5DB4A 1IL0A 2QB5A 3BH6A 3BXXA 4K9MA 4YR7A 1I01A 1M0SA 2FG7C 2QR5A 4XYBA 1W4CA 1J97A 1KSHA 1QFSA 2C5HA 5IK2A 4Z8YA 9GPBA 4YLEA 1PT5A 5EZ5A 1YR3A 1VQ1A 1I1OA 2E6KA 1KBQA 2HAEA 3K16A 3Q8WA 5D01A 5LU8A 3QX3A 2PT9A 2B5OA 3FZEA 2DT8A 1ZUWA 2XNDA 4Q3AA 4QOJA 3A28A 3AHJA 3FOAA 4QTZA 1M54A 4YUWA 2Q07A 3DEYX 3JWIA 4E2XA 4KPUA 4JI4B 1C9KA 1JS1X 1YCDA 3PUYA 4WGGA 4A5SA 5BSTA 4C29A 3HUUA 3FFBA 2H4WA 3N75A 1RYHA 1WZUA 2G7ZA 3LZ6A 1VBFA 4OQZA 4QRIA 1R6DA 3S7ZA 1P6UA 1FQWA 4EI8A 1PVOA 3RF7A 1Q7BA 4I5IA 2QJTA 3QA9A 4ILEA 2ZPAA 3Q9UA 5KUTA 1JKJB 2UYCA 5BNTA 3KB2A 1WR8A 3DULA 4BQQA 4V0NA 4JEMA 3SFVA 1RQLA 1M2VB 4D3YA 4OP2A 1X7HA 1Z5UA 1WHSB 4C76A 1Z0JA 1J8YF 1B74A 1T8UA 1U8UA 3T7TA 1YA8A 3F5MA 3TEMA 3TTWA 3TVYA 4YRKA 2PRZA 4C7JA 2HU8A 3FHTA 1GSOA 1N2ZA 3VZPA 3EPBB 1IAQA 4ENRA 3SYNA 1GXSB 1LSUA 2EQ5A 5EZYF 3OE1A 1GZ5A 1EHYA 4W9NA 2HMWA 5EKTA 1TMYA 3IVGA 3AX6A 4OHBA 2YXPX 3N1UA 4R6XA 3ROQA 2XDAA 2PYDA 1F6DA 1CRLA 3FH0A 7ADHA 1IBRA 2QQGA 5DEIA 2PQ2A 4ITRC 1Q0PA 3ZS8A 5K0SA 3NUQA 1K66A 2ZRGA 4MUNA 4O2BA 2UZ1B 3BXPA 3RW9A 1Y4ZA 4M83A 3V3KA 4D9HA 5B7PA 5E3HA 4NABA 1BS1A 4HNGA 3LK7A 1QR2A 1YI8A 3CEMA 1SOVA 1M8GA 4QPNA 3K31A 4ZVKA 4F85A 3GLHB 2XWSA 2FKNA 4N54A 4H6XA 3RUPA 3UAXA 3ZNOA 1L5RA 4REMA 5KX5A 3D1JA 2QTTA 4XRGA 1RWMA 1W4AA 1X1BA 4L57A 1TIPA 1GA6A 2AG1A 2CHFA 1TUGA 2V58A 3MCAA 5FJJA 1WUJS 3S27A 3SBEA 4KQKA 3I5UA 1KAOA 4LMAA 1ZL0A 3T99A 3UT6A 4DANA 1NN3A 4FB5A 2HIGA 5EP4A