1NX6A

Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-Semialdehyde Dehydrogenase
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 110
structure length 356
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nx6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nx6A01
2PR2A 3OJFA 3UVEA 1L1FA 2W2KA 4ALMA 3FTNA 3K2BA 1E7QA 3P2YA 4BNMA 2EW2A 1IYZA 2ZYAA 4Q3NA 5AXBA 4H16A 1LSUA 1GV1A 1GEEA 3U4IA 4XGNA 1N7HA 4MP6A 5IZ4A 1J0XO 1P33A 1D7OA 2NM0A 2R00C 5C37A 2B4QA 1V0JA 3QSGA 2O4UX 1W8DA 5TGDA 2Q1TA 2GN6A 1FMCA 4MVJH 2DM6A 2XXBA 4J4HA 4OXNA 2X23A 3B1KA 1X13A 4Q9NA 4NBUA 4P4LA 3HNPA 1JLLA 2BKAA 1TVEA 4GMGA 5G2OA 1P3DA 1VRWA 3ASUA 5TT1A 1HXHA 2B4TO 1A9ZA 2G0TA 4Q3DA 4FR5A 2AXQA 3IQDB 4D43A 1SC6A 1ONNA 3AUUA 3C24A 3LZ6A 4OO3A 1SNYA 4EJMA 4N5MA 5JCJA 2X0RA 2Y1DA 4Y6PA 1ZNQO 1LLQA 4R1SA 3WIEA 3QV1A 1BW9A 5F21A 1HL3A 3NX4A 1QR6A 3DAPA 2JJYA 4NDNE 4L0QA 1A5ZA 1HETA 5COQA 3FNFA 4D44A 1E92A 2E4AA 1P1JA 2ZB3A 3E6AA 3BHIA 3ROKA 2VT2A 3LT4A 2R6JA 1HEUA 4W7IA 1MC4A 1B8UA 2WD8A 4XQCA 4J4TA 5K6AA 1V8BA 1E1NA 4IMRA 3WBBA 1MC5A 4HFMA 3K73O 2DUWA 3BMQA 3FBGA 4J7UA 5F3RA 3V1UA 1EVZA 1Q0QA 4BGVA 1B3RA 5IXYA 2XOXA 1G1AA 1DJNA 4GX1A 1ISJA 2BH9A 4RCVA 2RH8A 2J5KA 3AI2A 5EPOA 1Y9AA 1H93A 2IZ1A 2JCVA 4RDHA 3ZV3A 1RYEA 5F1OA 2GN9A 3WGIA 3BMNA 3KSZO 5KCZA 1YBMA 1BSVA 4NR0A 1LLCA 2BFPA 3SXPA 3IL2A 1PJ2A 4XIYA 2HJRA 3DQPA 4AFNA 2PZLA 1JAYA 1UZLA 1XIVA 3IOYA 2DFDA 3BMCA 3FPLA 1DIRA 4DL9A 1L7DA 1BDBA 3GH3A 1I2CA 4RLSA 3P5SA 3C7CB 1GQQA 3G49A 3MJTA 3BTVA 2P9EA 1GYRA 1LSJA 3OH8A 4M54A 4OQYA 3HDQA 1E3JA 1E1KA 3JQ7A 2VYND 3KHUA 4PVDA 4WOJA 3PXXA 3GEDA 2VTDA 3Q3CA 4XR9A 2BGLA 5IDQA 2GF2A 1HDOA 5CFZA 1V3TA 4YCAA 4BS9A 4MVJP 1KVUA 4PN3A 2WE8A 3GFGA 1P1HA 3ZWVA 3F1LA 1P9LA 1MXHA 2VWQA 4YJGB 4I9UA 1Y8QA 1N9GA 2G17A 1IPEA 3M1AA 2EHDA 3U62A 2WTBA 4AL4A 4FGSA 5CG1A 1DFHA 1T2CA 1T2DA 2A9FA 2EIHA 4XRGA 4WEOA 3UH1A 3Q9UA 2HCTA 2X9VA 4OAQA 3PLRA 1K2WA 1HZZA 1FF9A 1O9BA 3VZRA 5L7TA 1I36A 3AUAA 3FR8A 5DN9A 3WQQA 4QFCA 4PLWA 1KERA 1R0SA 1WNTA 3W8DA 4WNCA 5I8ZA 2NWQA 1P0FA 4M1QA 4AJNA 4TKLA 4RGBA 4IXWA 1OMOA 5KOIA 1NWHA 1CQJA 1R4NB 5I7EA 1U2DA 3GZNA 1HZJA 2Z1NA 5JY1A 3ZWXA 5CPBA 1X15A 2D0IA 4WLUA 4ZRMA 3UOGA 3VDRA 4MVJM 2W2LD 1EBUA 3AU8A 3U9LA 3EK2A 3OJOA 3ZV5A 3OQBA 4J2HA 2YQ4A 4C7JA 3RWBA 3FHLA 2SCUA 3BAZA 3VPHA 1BXZA 1AN9A 2YHIA 4GL4A 4E5PA 4IMPA 3JYOA 5IF3A 4D3FA 3WGZA 1ADFA 4FPXA 1WMBA 3GN1A 3OM9A 1DPGA 2GYYA 2AG5A 3EYWA 3CH6A 4CM8A 3PDUA 2XXJA 3PP8A 2W98A 3CZRA 1QV7A 3WGYA 1C0PA 2D3TA 2ZYGA 3CMCO 2Y93A 3ULKA 3ZWAA 1RPNA 3BZUA 1ZK1A 2HUNA 4LSMA 4IGFA 3RFXA 4EYEA 3QJ5A 3TJRA 4OYRA 2VRCA 3KLMX 3PIDA 1N1GA 1WLYA 4XJTA 3VVCA 4G2NA 5CDSA 3DFUA 4U7WA 4E5MA 4BNNA 3PYMA 1D1SA 4O6VA 3RQSA 4XYMA 2I3GA 3Q0EA 2IZ0A 3I4FA 3UAGA 4BNKA 2FSVA 5A4DA 5L4SA 4YYZA 4XCVA 4ESOA 5FFFA 5A06A 2PV7A 2QIOA 4JBHA 3EDMA 3F47A 3AY7A 4L74A 3NTOA 1H9BA 3ONEA 3W4KA 2EP7A 4DLAA 3NEPX 2OP1A 1U2GA 3MJ4A 4IUYA 1T26A 3KYDA 3WOHA 5A03A 3STHA 3B1JA 3I9JA 4OM8A 2O3TA 1U8FO 2HK9A 2FRDA 2G76A 3PEFA 3E8XA 3WFJA 2ZQYA 2A35A 3GMDA 3NT4A 1PS0A 2BFOA 1OFGA 1EFKA 5ER6A 2JHGA 3OJEA 1K89A 3H3FA 4DPMA 3CXRA 4CM1A 4TKMA 3UFXA 2UUPA 4A0SA 4FC6A 5A1TA 4II3A 5THQA 4X54A 4CLXA 2HK8A 2V6GA 4CMGA 1KY4A 1LC0A 3LC7O 4E12A 3KTDA 1ENYA 1UZNA 4PZCA 2GLXA 1VL6A 1E3IA 3RI3A 1RM3A 2I9PA 1QSGA 3DO5A 2NU7A 4JROA 1S7CA 4BNGA 3DAGA 4R3WA 1YRLA 1BMDA 3L6DA 2W90A 4RVGA 2ZK7A 4YAJA 1K0UA 1DB3A 5ICSA 5BSEA 1VJ1A 1OC4A 5JBIA 3GG9A 5ILOA 1DHTA 4Q3AA 3EUWA 4WK6A 3ZWYA 3NT2A 4FDAA 3WIDA 1GZ3A 3GHHA 4E2WA 4W4TA 3F4BA 2W4QA 1JKFA 3KRTA 2NTJA 5EMHA 3QHAA 3F3SA 5FI3A 2ZTUA 1XWFA 3DTYA 4O1MA 3C7AA 3FWZA 1A72A 1KVRA 4R9SA 1HDXA 2QZZA 2DUUA 3TL2A 4RVSA 3B70A 5T67A 3SX2A 2FMUA 4CMEA 3VKUA 3TZ6A 5B4VA 3W6ZA 3HJAA 4OGWA 3UKOA 1NTOA 3TQHA 2EJVA 3KYCB 2IXBA 4D0RA 1LEHA 4PLTA 5KKAA 1BVRA 2PNFA 1Z45A 1HE3A 1QYWA 3KVOA 1NXQA 4GAEA 4CJXA 4MVJI 2B35A 2Q45A 3PHHA 1EUCA 1N5DA 3DMTC 4MVJA 4FFMA 4UVDA 1RM5A 2EJWA 2PK3A 5JC8A 2VQ3A 3Q6IA 5KWEA 1Q7BA 1CRWG 3WICA 4A7PA 2DVMA 1UXGA 2NACA 4ND3A 4NFSA 5BSFA 5A9SA 2CFCA 5H82A 3GRPA 3I1JA 1TLTA 4URFA 2B0JA 3PDJA 5I7VA 4I9NA 3ADOA 3NTRA 3KXDA 1C1DA 2WSBA 4IXTA 3VPFA 4EUFA 2R00A 3RBXA 5CDUA 2VHXA 3RUFA 2NTVA 3PFWO 3DBRB 2I65A 3NTQA 3Q1LA 1LSOA 4TROA 3K96A 4WLEA 4F3YA 2VHVA 1DC4A 1GTMA 1NP3A 2UDPA 5JO0A 3C85A 3NJ4A 5U1PA 3V2UA 1YQXA 3CKYA 2HAEA 3FI9A 3U09A 3DBRA 3COSA 2V7PA 4UUNA 5AYVA 4PGFA 1ZCJA 2P4QA 3O8QB 5KVSA 2NADA 2YUTA 3ON5A 3T7CA 1VC2A 4IY1A 4LMRA 4YQZA 1BXGB 2PD6A 4E13A 2ZKLA 3AWDA 1T2EA 4EEZA 5EIOA 3PRJA 4BNYA 4ALIA 4YT8A 1E7SA 3QWHA 3JD3A 1XYGA 1Y6JA 4DGSA 4HV4A 4IDDA 4GMFA 5TLSA 4MIOA 2VUTA 5BSHA 4CMAA 4YR9A 4ALJA 4B3IA 5EERA 3SEFA 3BTSA 2GCGA 2V65A 4YQYA 3IUSA 3RVDA 1VE9A 2VHWA 1DHRA 2DBQA 5L4NA 2WD7B 5LCXA 4CM9A 3QVSA 1NFQA 2HK7A 4RV9A 3D3WA 2BELA 1YB4A 1DJQA 1O95A 4BKUA 1XHLA 1X1EA 2P5UA 1KS9A 1MG5A 3W1VA 4M86A 1P44A 4JLWA 1DRUA 3WGHA 4I9HA 1XEAA 1EVJA 3FNHA 1VM6A 4BNZA 4II2A 3UF0A 1U4OA 3ZCXA 5G0VA 3OQ6A 4ZGWA 1WXDA 1ZMOA 2IYPA 1YKFA 5BT9A 4CM3A 1HYHA 2I99A 4ZICA 3DB2A 4OSOA 2EG9A 3EVNA 3S2FA 5A05A 4RO0A 5JE8A 5FEUA 4BNVA 2IXAA 3E48A 1P1IA 4DBVO 5THKA 1K3TA 3A14A 1ID1A 1HDRA 1DSSG 1E77A 2GERA 1PL6A 2O4CA 4OQZA 1PEDA 1VKOA 3DC2A 1IUKA 3R3SA 4MIEA 1F0YA 5TT0A 3DZGA 4FS3A 1VLLA 3UUWA 2QQ5A 1DEHA 1A4UA 4OL9A 2AEFA 5BSGA 4NPCA 4UUOA 1A7KA 4BQPA 2FZWA 4LCJA 4Y98A 3S55A 3WTCA 3V2HA 1MXFA 2RH4A 1NR1A 3GVPA 4WECA 4YAKA 2GD1O 2O7SA 3I52A 1E0DA 4NBTA 2EW8A 3ABIA 4K6CA 3HSKA 4O5OA 1PJSA 3GDOA 2A94A 3E9MA 1QV6A 1C14A 4QTZA 3C8MA 2VNSA 3JYPA 3QP9A 4ZU3A 1EQUA 3DBHA 1GV0A 1MFPA 3WNQA 1PJ3A 3JYLA 2X0IA 1AGNA 1I30A 2VYVD 1XGKA 2JAPA 4GLOA 3DBLA 4IDGA 4BNIA 4XEHA 4YDRA 2X5KO 1C0LA 1ZK3A 3LC2O 2GN8A 1HRDA 4L4XA 5HS6A 5TS3A 4MKXA 1PR9A 3RSHA 4U8GA 2DFVA 4G81A 5L95A 2I66A 3OEWA 3H5NA 1GCOA 1A71A 1ISHA 4NFYA 3TZHA 2Y0CA 1EUDA 3WG9A 3IP3A 1TT5A 4CV1A 1E3WA 1XG5A 1ZK4A 3GOHA 3RUHA 4LK3A 4XQ9A 4P22A 4QEDA 1P45A 2I76A 3IP1A 5AQ1A 4KDFA 3OIDA 1JTVA 2JFHA 3G17A 3RUEA 2HRBA 2RIRA 3DZBA 4Y6SA 2GASA 4CLRA 3CTMA 1ZK0A 3ROMA 1NFRA 5TQVA 4JXKA 1EBFA 1ZBQA 2O3JA 4Q39A 2Q49A 3VZQA 3JSAA 3AUTA 4R54A 3IC5A 5DBIA 4JJIA 4EBFA 4FJ1A 1GCUA 3TNLA 2R2GA 3ITDA 3QVWA 3QWAA 4XYEA 3ETEA 4KWIA 5BR7A 3K30A 1JW9B 3ZGYA 5CDYA 3PHIA 1YDEA 2AQ8A 4K1LA 5B4UA 1AXEA 1SBYA 4IZIA 2AG8A 3WR5A 4CM5A 4XQEA 2FOIA 2V6FA 4IS3A 5JAZA 1VPDA 3D0OA 5CEFA 2BFMA 4BIIA 4XB2A 3LU1A 4W7HA 3VHRA 4CMIA 2DC1A 3NGLA 1PS9A 3DOJA 1E6UA 1UXIA 4L8VA 1HWYA 1F17A 2C82A 2XF8A 4J43A 3GC6A 1VKNA 1Q2XA 4JJGA 2ZTVA 1LDMA 2NQ8A 1CIVA 2I5PO 5F1KA 3WFIA 4XDYA 4JN6B 1Z75A 4HP8A 1M76A 1H6CA 2FPPA 1NHWA 2H1SA 4PLYA 1VJ0A 4F6LA 2YV1A 3ZHXA 3B20A 3CMMA 3WX0A 3HB4X 3ZU5A 1ZW1A 1TB4A 4UAGA 2AW5A 4P4GA 1EDZA 1XU7A 3GDFA 3H7AA 1OOEA 3JQ6A 2HMTA 3G3EA 1CDOA 1PZEA 1GR0A 1YBAA 4XYLA 3H2ZA 4A27A 4R16A 4IJKA 2JCYA 2FPGA 2OL4A 3DHYA 3OEYA 1FDSA 3SC6A 4YBZA 4BMNA 3ZV4A 2ZQZA 5EQFA 2C0CA 1KEPA 1MX3A 4KTTE 2DKNA 3PIIA 3WYCA 2C2XA 4RL6A 1QLHA 1SCUA 4J4BA 1GL3A 1LX6A 4F46A 4R69A 1BWSA 1LDEA 3ZWOA 2YFQA 4NJMA 4L4SA 2C5AA 4L73A 1DC5A 1ML3A 3RCBA 1CJCA 2VCYA 4MVJE 4M8SA 5JLAA 3I9KA 1DBVO 1W4ZA 2GZ1A 3FBTA 4PCVA 1J5PA 4CQLB 3NUGA 1PL7A 2JL1A 5M6DA 1AUPA 2TMGA 4R1NA 5B37A 4CM7A 1YVEI 1E6EA 3E03A 2LDBA 2Y05A 1W73A 3O9ZA 3PWSA 4Q3EA 4QXMA 3LLVA 4FB5A 4BHTA 2GO1A 1KVTA 5CEEA 2D2IA 4DYDA 1GEGA 1LA2A 2AQHA 3A4VA 4Z3KA 3DONA 2QRKA 1GPDG 4EI2A 1I3NA 4BKOA 3V5NA 4TRRA 1ZJYA 3LF2A 2HMWA 4E6PA 1Z82A 3L9XA 5LDGA 4XX0A 2GPTA 1UAYA 1HDGO 1N92A 4BNJA 4BO4A 4GPD1 1V35A 2X0JA 3B1FA 4ND2A 3BMOB 3G0OA 3BTOA 3DMTA 1WMAA 4XD2A 2VHZA 1B2LA 1MFZA 2Z5LA 3LYLA 2GN4A 3ZW9A 4U0JA 4EZBA 1A27A 5GY7A 2E6UX 4FFOA 3ZWBA 2PD4A 2CSUA 3HFGA 3RUCA 1E1MA 1FK8A 5JCXA 3E9QA 1H2HA 3NT5A 3WSVA 3GFBA 4A2CA 4H3VA 3HE3A 5AXDA 2B36A 3CEAA 1NQTA 3PTZA 3LLSA 4WUVA 4BO6A 5ITWA 3HUDA 2DBRA 4DC0A 1XSEA 9LDBA 5DCUA 6LDHA 3WXBA 3HFSA 1SOWA 5HA5A 4D3DA 2ZATA 2E49A 2BD0A 4KP7A 3VTFA 3IJRA 3QVOA 4AJPA 2XPCA 1XA0A 5J9GA 4K28A 5JC1A 5I7FA 4RPGA 2DBZA 3QVTA 4CMBA 1SAYA 1P1KA 4NH4A 3KZVA 3F9IA 1I5RA 2EF1A 1NNUA 3KB6A 3JQAD 2ZB7A 1XLTA 1PGPA 3IS3A 3JV7A 3PJGA 3QE3A 5DNAA 1ENPA 4GWGA 2NU8A 4YPOA 1SMKA 4MPDA 4JIGA 1UH5A 3LVFO 3PGJA 4U0KA 1JDJA 3ITKA 4QT0A 4L4RA 4CODB 2VYNA 3P19A 4J6FA 3TWOA 3BA1A 1DIHA 4J0EA 1X0VA 1YQGA 1GPJA 3DZJA 1K6IA 2DLDA 2DU8A 3JQDA 4HNGA 2EP5A 5HBRA 3TZQA 4R3NA 1PS8A 4AG3A 4BKQA 1U9JA 2D59A 4FN4A 4A03A 5A9RA 3K31A 3S8MA 2G1UA 4QX6A 4L75A 4M87A 4WLOA 2YY7A 4IS2A 1J49A 2Q99A 4FOOA 2WE7A 3VPSA 3TZKA 1BTOA 3KLPX 4L9RA 4Y67A 1F8GA 1KEVA 4NBRA 4BGEA 4CMKA 1R66A 4WASA 4WLVA 4DQVA 3JQ8B 3UCEA 1DIAA 2X5JO 4TVBA 2EKQA 3QRWA 1E7MA 1O89A 4D7AA 3VZSA 2P4HX 4YT2A 5TX7A 3VH2A 4XGIA 3NDRA 4E3ZA 5AVOA 1HTBA 3SLKA 5F5LA 2VUUA 2Z1MA 4UUMA 4J1SA 3ZWPA 3JQ8A 4I5DA 3DZKA 1UXKA 3DOOA 4A73A 3C3XA 4YJGA 3EGOA 2BLLA 1I3LA 5B4TA 2W2LA 4D46A 4PG7A 2CD9A 3WMWA 4YTEA 1NPYA 3JQEA 4DQXA 4EGFA 3TOZA 1NQ5A 1IB6A 3PYLA 4KZPA 2IODA 2Y0EA 1Z6ZA 1PQUA 3KEOA 1Y9EA 3RU7A 3KM0A 1AXGA 2F00A 2X1HA 5T5QA 3N74A 2O3SA 3N58A 2Y67A 1SB8A 2QW8A 3ICCA 4ZQHA 4BO8A 5JMWA 4FFRA 4BNLA 2FSSA 2Y1CA 3T4EA 3Q9NA 1I0ZA 4B8WA 4JCOA 1R4NA 4J90A 4HY3A 3NRCA 3WJ7A 1XCBA 4WJZA 1EZ4A 3OIFA 4XYGA 3KUXA 4B7XA 4RVHA 4A10A 3QQPA 4GKBA 1BRMA 2BI7A 1AE1A 1PJQA 2OZPA 4KMSA 4AJ2A 1EUZA 5EJ2A 2X6TA 5KIAA 1R6DA 2JD1A 4RZIA 4B7CA 4TRNA 5F5NA 2X8LA 2Y1FA 4CV2A 1I3KA 2J3HA 1HLPA 4PLVA 1A9YA 3PJFA 4HFNA 3ZHZA 1ZK2A 2PGDA 1E7WA 3WMXA 4MKZA 2QHXA 2PKQO 3AW9A 2JCXA 1EE9A 3N7UA 1R4MB 1KBZA 1GUZA 4ONEA 4OXYA 5IFLA 3QLJA 4ALNA 4BO7A 1DLIA 4J1QA 3DBVO 2UUOA 3L6EA 4J3FA 3RROA 1XDWA 1PGQA 3KEQA 4DYVA 4RPHA 3L6OO 2V6BA 5A9TA 2J3IA 3I9OA 1CYDA 2Q2QA 2V6MA 4BVAA 3WSWA 4YT4A 3P7MA 5LDHA 3H9EO 4PLZA 5IXSA 4GGOA 1X7GA 1R0KA 2HMVA 1M66A 2WM3A 1PJTA 4B4VA 1MGOA 4H7PA 1UUFA 4MP8A 1M6WA 5C7OO 3PHLA 4EITA 5JO9A 2YW9A 1JKJA 2CMDA 2EV9A 4PLHA 5FWNA 3QWFA 1D1TA 4OXKA 4DLBA 3WBFA 4RVFA 4QUKA 3HDYA 1B8PA 3AI1A 1U7TA 3CSDA 2CF5A 4A5OA 1MLDA 4XZ3A 4XIJA 3PQEA 5IN4A 4IBOA 1LRLA 4IDBA 3O03A 4GVXA 4WNIA 5TJ9A 5JYFA 3A28A 3AM3A 4MDHA 1MB4A 1E3SA 1EK5A 1X1TA 5CDTA 1PJ4A 5A5FA 3SC4A 4CLEA 4MVJF 5C7LO 3E5MA 2C5EA 3UICA 4XJSA 4GQAA 1QG6A 5DDIP 3SLGA 3AOGA 3H6KA 4MVJG 3T7EA 4CV3A 5I8WA 1SEPA 5HS4A 2IDZA 3GRKA 4QFDA 4IDCA 3LDHA 1GUYA 1HSZA 2AEMA 4ZQBA 4GX0A 1NASA 5JAQA 3ZH2A 1Y1PA 5DZSA 3ZW8A 2QRLA 4DTIA 1U3TA 2GRAA 2QRJA 4QSMA 1VJTA 3D3EA 3W6UA 4NIMA 4CLOB 2ZYDA 1DFGA 4J2OA 1DXYA 2IEBA 3FPCA 5JMPA 1YGYA 3VTZA 3WWYA 5L45A 3HQ4O 4IIVA 1N1EA 4R1TA 4DIBA 2IYOA 2C29D 4BKPA 2OXIA 3D5QA 4LVCA 3HN2A 1HKUA 3PQFA 1QP8A 3PHGA 4ILKA 1E3EA 2VRBA 4YAGA 1NPTO 4QO7A 1N2SA 3NDIA 2GUGA 1OC2A 3Q2IA 1I32A 3NKLA 4FIZA 4D45A 4M89A 5CG2A 2Q4BA 4RLHA 3D7LA 3C1AA 2B37A 3DEYX 1TT7A 2ZJ1A 3VAZA 3KYCA 4FW8A 3VC7A 3X2FA 3ASVA 1V6AA 3FSRA 4ZJUA 4FD3A 2BFAA 3JTMA 2OORA 3UCXA 4EEXA 4YA6A 5BNTA 1LUAA 4PG6A 4Z9YA 2X0NA 5ER9A 1PTJA 1YH3A 2EGGA 3TOXA 2NU6A 2O2SA 3TFQA 5A3JA 4ZRNA 2YDXA 3WGOA 3CUKA 1Y8RB 2GNAA 4N18A 3BXXA 4EDFA 3S2IA 2FHSA 1KETA 5IZCC 4JX8A 5BNIA 3PZRA 1PGJA 1TXGA 1P77A 5L9AA 1JU9A 5TJHA 4Y9DA 3V1TC 2AMFA 5IDXA 4BMSA 1KVSA 2O3QA 4DMMA 3WGQA 3GEMA 5CPFA 2FZEA 4CL3A 1K5HA 4E2ZA 4WE3A 2HDHA 3KYBA 3R3JA 1B26A 1KVQA 1K6XA 4P8RA 3L4BC 1JAXA 4MJLA 1NM5A 5DULA 3O8QA 4J16A 3ENNA 3RJ5A 5MDHA 2VUSA 5EN4A 4GGPA 5JAMA 1BXGA 4IINA 3S2EA 3JQFC 4YJFB 1JA9A 2VZ0A 2NVUB 1YDWA 1H9AA 2H6EA 1WDMA 3R0IA 1E6WA 1EVIA 2BI8A 3GF4A 1B14A 4BO9A 3SBOA 1LDNA 1UZMA 3EMKA 3BTUA 2BGMA 2O50A 3MCVA 3PJEA 1M6HA 4HBGA 2Y1GA 2I67A 2IE0A 4YAIA 1NVGA 1CWUA 1PJCA 3H9GA 2NSDA 3IMFA 1W6UA 2Q2WA 3AM4A 3BYZA 3FNEA 1MUUA 3L07A 4YJHB 2BGKA 2A92A 3K6JA 4MP3A 1ADBA 4E33A 2WD7A 4MOWA 3EC7A 3CE6A 1DDOA 2VOJA 3JYNA 4TQGA 5EINA 3A1NA 1HT0A 2P91A 3JD0A 1Q1NA 3PPIA 1T1SA 3D1LA 2FN7A 4YJHA 1RM0A 2ZTMA 3O26A 3GNTA 1U5CA 3OJ0A 4B4UA 1KEWA 4GSKA 1H2BA 2G82A 2EWMA 4AJOA 3W4IA 2WYVA 3T4XA 1LBEA 2ET6A 1TI7A 3I5MA 2C59A 4KOAA 1IZ0A 1LTHR 4CM6A 3VPXA 3R1IA 4MIYA 4DUPA 3TPCA 1M2WA 3QIVA 4U6QA 4J9UE 5EESA 2A4KA 4GX5A 2JFFA 4TVOA 3W4JA 5L4LA 1YB5A 5L3ZA 1NVMB 3OIGA 3MJVA 1E7YA 4BO3A 4XKJA 3RAJA 1GADO 4IDAA 4KUGA 4Y6RA 3M1LA 1WZEA 4ND4A 3U4DA 5I9NA 1PQPA 4NU5A 3OFSA 2NLOA 2RAFA 4I8XA 3TRIA 1PJBA 4N5LA 5GZ6A 4CQMB 1U4SA 2VYVA 4DPLA 4QQRA 4XWYA 3ZI0A 3H65A 1YONA 3D4PA 3WB9A 5FI5A 3MZ0A 4LGVA 1SEVA 1CF2O 1J4AA 2Q2VA 5EL0A 5C7IO 4BNTA 3RIHA 2HJSA 4WCFB 1H94A 5ENVA 2VTEA 2NVBA 4IDEA 4CUKA 4E21A 1YL5A 3QVXA 1ENZA 2OHXA 4BB5A 2I3AA 4I5FA 5B1YA 1M75A 3VVBA 3RU9A 3PVZA 4FGWA 1DRVA 1KYQA 1Y5MA 3DL2A 3GNSA 1T2FA 3INTA 3JD4A 4GH5A 3PZBA 1GQ2A 4BNUA 1YJQA 3GT0A 4PLFA 4P4NA 4CQMD 6ADHA 3GQVA 4PG8A 3PHJA 4E30A 3O38A 4ZQFA 3TZCA 1I2ZA 3ETGA 3MJEA 3GGOA 3WDSA 4BMVA 3ANMA 5JXWA 1MV8A 2HQ1A 1Y5RA 3U4CA 2WYWA 3ZU2A 1YB1A 3E1KA 3VOSA 4WCDA 3MJSA 5L7WA 5JDIC 4E31A 2QYSA 4I1IA 4KQWA 1Z74A 2PKQP 1EMDA 8LDHA 4Y8VA 1I01A 3WJAA 4DC1A 2CDAA 2ZJ0A 4YAEA 1RYDA 1SO8A 3L77A 3WNVA 3OMLA 3EZLA 1QRRA 3U4HA 2EEZA 5HM8A 3DFZA 4NU6A 4E4YA 4UULA 4DMLA 4E2XA 1UP4A 3RUAA 4OMUA 4QO8A 3AFNA 4TWRA 1GY8A 4HFRA 4MKRA 3UW3A 1P1FA 3DR3A 4W9NC 4B3JA 3VH4A 1LQTA 1EDOA 2P9GA 2GZ2A 3GAZA 4HFJA 1C1XB 3RKUA 1O6ZA 1FDTA 4HXYA 4G65A 4LRSB 2H9IA 4UUPA 4ZD6A 4PRKA 3DTTA 2VWGA 1NBOA 5J23A 3DXFA 3K5PA 3ADPA 4PLPA 5TC4A 3VPGA 1D8AA 2HU2A 3DOCA 5IG2A 1ZFNA 2C7GA 3H3JA 4WLNA 3BHMA 1VI2A 3KOUA 2E37A 3K9QO 3RBVA 1PL8A 1QYCA 2X5OA 2ZTLA 4FJ0A 4UEKA 3VDQA 3RJ9A 5KKCA 1OI7A 4P38A 3JQ9C 5DOVA 1UR5A 2BRUA 2CNBA 5T8KC 2OMEA 2YJZA 2O2YA 3RUIA 1F8FA 1I8TA 4OIMA 4NNJA 2H63A 1ZIDA 4UEJA 1D4FA 4PRLA 3OA0A 4BO5A 1LC3A 3HZZA 5L40A 4Z0HO 4RJTA 1Q7CA 1DAPA 3ICPA 4E5YA 1MA0A 1PZGA 1XKQA 5G4KB 1ZJZA 3GR6A 3OJLA 4NI5A 4E32A 2GGSA 4DVJA 4WEQA 4IGEA 5TIIA 3U0BA 5T6BA 4XYBA 4J7CA 4BO1A 1GYQA 4RQTA 3ZDFA 3JQGB 1BVUA 1HDCA 1LDYA 3OHSX 4UVIA 3ZV6A 4R41A 4QECA 3CPSA 2HMSA 4GVLA 1T25A 1O94A 5JW6A 2Q1UA 3H9QA 5HWSA 1VSVA 1MG0A 5JYDA 3KSUA 1BXKA 1UDBA 1F12A 1G6KA 2VOEA 2J6IA 4JJFA 4ND5A 1GD1O 4GLLA 1UP6A 4FCCA 2GZ3A 2ZCUA 2FWMX 1WW8A 4NBVA 2Q3EA 3D4OA 3Q11A 1NFFA 5A02A 2VN8A 2B4RO 5T57A 1HE5A 3OSUA 3G79A 5AXAA 4HADA 1T4BA 1A4IA 3I6IA 1LDGA 1KOLA 1HDYA 1VSUA 1YBVA 3ROQA 4CQLA 4F45A 3AU9A 5KJCA 2B5WA 1T4DA 3FTPA 2W2KB 3UCFA 4R68A 4B4WA 3R6DA 4ROSA 2VWPA 2IEDA 2PZMA 4YB8A 3FNGA 4N7RA 1PJLA 4AVYA 4IIUA 1IZ9A 4J7XA 5K9ZA 1PX0A 1V3UA 3LQFA 3AJRA 3MWDB 3AUSA 1WDLA 2D5AA 1LLDA 3QA9A 4GKVA 1GUFA 2O23A 1IL0A 2OFPA 2Q22A 1YWGO 4RPKA 1LLUA 3E82A 5CHEA 4YACA 1QYXA 5A04A 1OZAA 1Z7EA 2Y0DA 3FN4A 3H5AA 4YRBA 2DTXA 5KTKA 1G0OA 1H6AA 5B12A 4FFPA 2GR9A 3DZIA 4O0LA 3VZPA 4KUEA 1BG6A 3QWIA 3LC1O 5CP8A 1PGOA 3BMOA 1ONPA 4IZHA 3AOEC 4CUJA 1XELA 3H4VA 3JQAB 4BNHA 2FPIA 4IJWA 1NPDA 4N5NA 4ZN6A 1X0XA 4IQGA 1JVBA 4FFLA 3WS7A 1Z7BA 1BW9B 5CAEA 2C7VA 3RASA 3JQAA 3AK4A 5IZCA 1NX6A 4J1TA 4UVHA 4E0BA 4WOKA 5GZ3A 2NNLD 1QKIA 2CVOA 1I2BA 1JQBA 3S1LA 1HYEA 3DWFA 1DRWA 4Q3BA 4IQ0A 4AJIA 4E5KA 1WWKA 1ZMTA 3BMQB 1QMGA 1CEQA 5H81A 3WQSB 4J1NA 3L4BA 3WLFA 1F06A 4B3HA 4PLGA 2P2SA 1X14A 1LXCA 1ZXLA 1ULUA 3GY0A 1ZSVA 5EQDA 4OKNA 3G1TA 3W8EA 5JCJD 2QX7A 1X7HA 1YE3A 4HNHA 3JQCA 3JQFA 1B3BA 1RWBA 2J5QA 4BV9A 4TZKA 1ISGA 3BMNB 4CL8A 2HLPA 4ZA2A 2WEKA 4BOYA 3ZWWA 4CR8A 3ZHYA 4LISA 4NFHA 5DBFA 3BMCB 3OBBA 4PG4A 4B79A 2P68A 3GLQA 4K26A 3WLEA 4LCEA 4W6ZA 1I33A 4WGGA 1M67A 2HRZA 5CDGA 3VH1A 1KC1A 2WJPA 3C1TA 1UP7A 2X9NA 1HDZA 1P31A 1ZEMA 3LT2A 3TF5A 5JPIA 1UAGA 5TF4A 4FC7A 4CM4B 2ILTA 3Q2KA 2VT3A 3TDKA 1U3WA 3NYWA 4WKGA 1XQ6A 2JKVA 3JQ7B 3HWRA 1WVGA 2C2YA 1CERA 3GG2A 4FJ2A 4E2YA 3ZHBA 4Q3CA 3UXYA 2HMUA 3GEGA 3ONDA 4ZHSA 2H5LA 3MOGA 1LNQA 1BDMA 4R9RA 4CM4A 1UXHA 1JWBB 2OGUA 1SPXA 2X9GA 2DTDA 3I9NA 4IPTA 4IM7A 4BO2A 1FDVA 5COAA 4TRJA 1GFSA 3L0DA 3ANNA 2C07A 1Y8QB 2E82A 3GDGA 1N9GB 5I9LA 3UN1A 2UAGA 1VL0A 4D41A 3AY6A 3NGXA 1IHYA 4EJ6A 3U5TA 3LT0A 4GBJA 1R15A 4B8ZA 1DAOA 5KVVA 4NHEA 1PWZA 3AY3A 4ITUA 3GNQA 1E1LA 1XQ1A 3A9WA 4WCFC 5FF9A 3ROPA 3KSDO 2EKPA 1QORA 3DDNA 5DT9A 4RDIA 2ZCVA 3ZNQA 4RQUA 4DQUA 3OF2A 4Z0PA 5JNLA 4NZ9A 1DO8A 1NYTA 1ZO8A 2X86A 3QWBA 3K2EA 1ENOA 1GAEO 1SZJG 3PFFA 3RFTA 3GZNB 2Z95A 4J49A 1V3VA 3FF4A 4E5NA 4C7KA 4PIVA 1DC6A 5I9MA 3K8ZA 4HUJA 3FWNA 1EEHA 3RFVA 1JVSA 2BMAA 4LRTB 1JWAB 1DFIA 2UYYA 2YHIB 2YQ5A 1DIGA 1Q0LA 3F5QA 3OP4A 3WGTA 1GDHA 3JQBC 4FBGA 1ARZA 3MTJA 3PWKA 3H2SA 4AJKA 4CM8B 3OECA 3DAFA 3MOIA 1WZIA 5L53A 2DAPA 7ADHA 2J3KA 2CDCA 1T2AA 5HRUA 3ENKA 3M2PA 1ISMA 4BB6A 2UVDA 2Q1SA 4YEDA 1R4MA 4RF5A 1ZH8A 1CQIA 5TNXA 3H9UA 4KQXA 5DP2A 1DIBA 1U7HA 4RZHA 4BGIA 1N8KA 2HKIA 4KDEA 3F5SA 1R16A 5FYDA 4BO0A 4N54A 3RC2A 5JDIA 3EY4A 1NAHA 3GVHA 4JGBA 2BHLA 2TMDA 4CV0A 3GN2A 4U6SA 5ICMA 3L4SO 5DCWA 4DA9A 4R4JA 2PD3A 4WLFA 5DF1A 5K0ZA 1QXSA 2QYTA 3ZWCA 4UVGA 4ZQEA 4AJ4A 3RD5A 4DIOA 2B69A 3H5RA 3IUPA 1J6UA 7MDHA 2JD2A 2YYYA 5U4QA 3ZNNA 3KYDB 2ZIZA 4M49A 4W9NA 3ONFA 3I9MA 1CETA 1KIFA 1LRJA 4CR6A 4XB1A 1DLJA 1C0KA 3EVTA 5IDWA 3EZYA 3IJPA 3L9WA 2D8AA 2DTEA 1B15A 4Z9FA 4FSHA 1ISFA 1IY8A 2VRCD 5KNLA 2AHRA 3GVXA 4BGUA 4YWJA 1E5LA 3B6ZA 2NQTA 3WQRA 4M55A 1YXMA 4B4OA 3V2GA 4TZTA 3BIOA 3ZU4A 2PGLA 1QYVA 5JY6A 2PZKA 1GU7A 4O63O 1R37A 4D79A 1HYGA 4HX5A 3TL3A 2DQ4A 2DPHA 2O3RA 2VHYA 3JQ9A 3ZWMA 1I10A 2QG4A 1OBFO 4DIFA 5KJEA 5T8KA 1FJHA 4I5EA 2VNAA 1PR3A 1FDUA 3VKVA 3RC7A 1L7EA 1VL8A 5JDCC 3NDJA 3PJDA 1LU9A 3P2OA 1H5QA 4IJVA 4H15A 3F6YA 2LDXA 2NUAA 3I9LA 3MTGA 2NV6A 4WPGA 4XR4A 3JD1A 3GUCA 3V1YA 5G0WA 5KJFA 2AQKA 4C4OA 1UXJA 2P9CA 5IN5A 1NHGA 3PI7A 2W8ZA 2RBEA 4R5MA 4W82A 3PWZA 3W8FA 1U3UA 1QLJA 1PQWA 4R1UA 4GWKA 4CLOA 4BV8A 2XAAA 4GSLA 3E5RA 4JBIA 2Y99A 1RKXA 3GA0A 4ALKA 4D42A 1H6BA 1MP0A 3ZNPA 1IPFA 4KUHA 1HSOA 2O3UA 2DT5A 3VH3A 5I7SA 3DHNA 4I08A 1SOVA 4BL5A 3TN7A 2J3JA 1UJMA 3RUDA 1A7AA 4GI2A 4LN1A 4B7UA 3RKRA 4DRYA 2BF7A 3GPDG 2OP0A 2Y68A 3DZFA 1F14A 1ZVMA 5ENDA 5KJ1A 1LRKA 2POQX 1LQUA 2GDZA 4Z9XA 1LSSA 4JNKA 4BKRA 2FR8A 5DP1A 1JKIA 3FD8A 3HN7A 4CPDA 1WPQA 1JN0A 1B16A 3H9JA 5TRTA 1ZEJA 3HADA 3F1KA 3KBOA 5A3VA 3WTBA 5JAIA 5A9SB 1U3VA 1YL6A 3PYXA 2YHUA 4S1VA 3GVCA 5ILGA 3ZN2A 3ZU3A 2FP4A 3SVTA 3IIEA 5GZ1A 1C1DB 3AFMA 5AXCA 4RORA 4AJJA 4DPKA 2OOSA 1Y8RA 1C3VA 5C3MA 5JSFA 1RJWA 3OA2A 1N7GA 2PA3A 4ID9A 3CIFA 1ZZEA 2HO5A 2OBYA 4UREA 4PZEA 2OO5A 1NVTA 4A26A 1FDWA 5MGBA 4NG5A 9LDTA 1XU9A 2EXXA 1EVYA 4OOEA 4MVJD 3U3XA 1WAMA 5LC1A 3AOEA 2YV3A 2WDZA 4DWVA 4EW6A 4KTVE 5K6AC 5G0UA 3M2TA 1ADCA 3E9NA 4D0SA 1K6JA 1IHXA 2DPGA 2X4GA 1YL7A 2X58A 2ZB4A 3PGXA 5AOVA 3IKTA 1YS4A 3F4LA 1T24A 4NQZA 1NAIA 1KC3A 2AEJA 4OH1A 4LW8A 4IDFA 4GX2A 1ULSA 2PWZA 3D5TA 4ALLA 1U28A 2NVUA 4YJFA 3LF1A 3ZWNA 2JAHA 1X7DA 1HE2A 3LK7A 1NQAO 2P5YA 4JP3A 2PFGA 2Y1EA 4W99A 2VZ9A 1ZKMA 1O0SA 3OETA 3EAGA 1IOLA 1WP4A 5H83A 3TFOA 4BNFA 5TSDA 4RVUA 3I3OA 2GSDA 2DBVO 4NK5A 2C54A 2WMDA 1UDAA 2AE1A 3D3WB 5G0TA 4XRRA 3NAQA 4PG5A 4YRAA 4NJOA 2JFGA 1E7RA 4JP2A 3CZMA 4RF4A 2CVQA 5COBA 3HB5X 4K9DA 1U8XX 1XR3A 3AI3A 2CY0A 4PLCA 2JHFA 1PSDA 4CMJA 5BQFA 2FR0A 3JCZA 2J5RA 5BNFA 5C5IA 5F1PA 1W0CA 3DMYA 4JBGA 4CUZA 5HTOA 4CMHA 4EUEA 1B7GO 1Z73A 3D4NA 3A06A 2PH3A 3F46A 1LJ8A 3QY9A 4MINA 5IAAA 3M6IA 4R51A 1PGNA 1PU2A 3H8VA 2OBNA 1FXSA 2JD0A 4AICA 2IZZA 4INAA 1U1IA 4CM9D 3CINA 2QZ9A 4YRDA 4FFNA 3IAHA 3JD2A 3ZNOA 4I5GA 3O4RA 3SJ7A 4RVDA 4J0FA 1EFLA 3NV9A 3DZHA 4O59O 3GAFA 3I83A 4FOSA 3BHJA 1HF3A 3D64A 2UV8A 2HSDA 2YZ7A 3AM5A 3V8BA 1GZ6A 3INRA 1KY5A 4S3MA 4TRMA 1YOVB 2I6TA 3E18A 3HDHA 2VZ8A 5JFOA 5A5EA 1ADGA 1HE4A 4BQRA 4CQMA 4K6FA 2NVWA 3ETDA 3IDSA 2ZB8A 2D1YA 1AHHA 3WWZA 1PWXA 1R0LA 3ORFA 4BUCA 1YOVA 5JYAA 2X22A 4XGKA 3OQ1A 3OICA 3GHYA 4JK3A 4PVCA 3EHEA 4ZVVA 3GGGA 4PZDA 3KV3O 1YJ8A 3RC1A 4WCFA 3EW7A 3LT1A 3DBHB 4YXFA 2B5VA 3S2GA 3RC9A 1DOHA 3HG7A 1TEHA 1PZFA 1ZSYA 1H6DA 1I3MA 2RHRA 5U9CA 3JYQA 4RPJA 3GPIA 4R01A 3TSCA 3DBLB 4PFJA 1UDCA 3C1OA 2PKRA 2EGHA 1ZXBA 2C20A 1PIWA 3GZ4A 4OJNA 2O48X 1YO6A 4CLHA 3MWEB 4AJHA 1T1RA 2Q4EA 2PZJA 2PLAA 2Y66A 2YV2A 3MEQA 4UEOA 3UGKA 4DBZA 2FR1A 5T64A 4AJEA 4NMHA 1P74A 4OOFA 4TMFA 4EJ0A 4CMCA 5IDYA 2AA3A 1TT5B 2G5CA 1E3WB 1LDBA 2CDBA 2D4AA 4JQCA 1C0IA 4FQ8A 1PZHA 4RPLA 1HLDA 2RCYA 2D5CA 1NWCA 1Y81A 2WWRA 5GMOA 3JQBA 4U5QA 3WGGA 3FCOA 5L51A 3INGA 4CLRB 1O8CA 1NQOA 1EE2A 3GUYA 4LMPA 3QW2A 1IE3A 2J8ZA 1EK6A 5DCYA 1ZSNA 4OKIA 1LI4A 1U5AA 4CLDA 4XQGA 1V9LA 1S6YA 2NU9A 5G0SA 1NR7A 2B83A 3ANLA 8ADHA 4LVUA 2VWHA 2O7QA 1E5QA 1WDKA 2Q1WA 2PGJA 2RHCA 4L76A 2EERA 1B0AA 3WYBA 3DHEA 4J9VA 4HWKA 4MO2A 1C1XA 4Z0TA 5IJZA 4YVFA 5ADHA 4HKTA 3HDJA 2IRWA 4RF2A 1Q7GA 5JYEA 5KVQA 4D3SA 3I4CA 4NK4A 3X2EA 2PH5A 5ITVA 4J91A 3PLNA 4KWHA 1GZ4A 4BNWA 5JS6A 1SB9A 4CMIB 2EKLA 4DREA 1OAAA 2Q46A 4IJUA 1P0CA 1BHSA 1D3AA 2AE2A 3PK0A 4YT5A 4AJ1A 4DLLA 2F1KA 1GQYA 1TA4A 3IKVA 4G5HA 3PQDA 4LSWA 3RBZA 1Y7TA 4AJLA 1G0NA 2NTNA 3I23A 1RM4A 4TSKA 2PTGA 5DBGA 3U49A 1I24A 5KVCA 3I6QA 1DC3A 1O5IA 5DOZA 2WYUA 3WYEA 2CZCA 1B8VA 1IULA 5G4KA 1ZUD1 3KO8A 4ND1A 4XDZA 3GVIA 3G1UA 4OHUA 3GMSA 4DXHA 3GGPA 2FY8A 2CF6A 2OUIA 4OSPA 1H0KA 2AQIA 3MJCA 1GYPA 3FR7A 2PY6A 3FRJA 3K92A 1Q0HA 3JQGA 1E3LA 2YFHA 2Q50A 3HHPA 4XA8A 3NJ8A 4BNXA 4IQ8A 4EUHA 4Z6KA 3UHAA 4R5HA 4F6CA 5CEJA 5JDCA 3KETA 2YDYA 3ST7A 4NJMB 1KEUA 1QYDA 4Z3DA 5T73A 2CVZA 3SJUA 4CMEC 1AHIA 4YJDA 2X7HA 1YQDA 1ISIA 1BGVA 2Y1OA 3ZZNA 4RF3A 1ORRA 3C7DB 5ES3A 4ZQGA 1ONOA 1P1RA 2E48A 3LSYA 1EQ2A 2CUKA 1R12A 3GK3A 4CR7A 4UVEA 4NBWA 5L7YA 5KJ6A 5G4LA
chains in the Genus database with same CATH superfamily
2NSJA 3E0QA 3OC0A 2W2KA 1L1FA 5AVKA 4Y6LA 1MEJA 1L1RA 1Y33E 3K2BA 1E7QA 1WCIB 1YDMA 1ZOOA 2OC9A 3P2YA 4QOJA 3V48A 1AN0A 1H22A 1IYZA 1NT2A 2EW2A 1XFAA 2ZYAA 3O74A 5AXBA 4EY5A 4PN7A 1LSUA 4KAJA 1GV1A 1GEEA 3I30X 5CTAA 2W5UA 2QX8A 4EI7A 1N7HA 1Y8AA 3RVOA 3LVRE 3WQBA 2XSZD 2NM0A 4F3KA 1F2TA 1M5UA 1T9AA 4ZCMA 4UBOA 1I5OA 5FADA 2Y1XA 1JFSA 3FF1A 1NT4A 3GT4A 1U02A 3V3KA 1D8TA 1T8YA 2BFFB 1E69A 3B1KA 1ODIA 5GPBA 1X13A 4Q9NA 3B51X 2C3UA 2ZSFA 3DPUA 3HWWA 4G8CA 4JQOA 4QYIA 4L7QA 2HL6A 3PB3A 3CRVA 2BKAA 1TVEA 4GMGA 3L0CA 1VRWA 2PMKA 3FPJA 4LJ7A 1K5DA 3OX2A 2B4TO 1A9ZA 1V37A 2G0TA 4Q3DA 4NCNA 3T1HB 1PUXA 4FR5A 5JMTA 4HJXA 1OIVA 1M0WA 1R5JA 1FA9A 4Y1RB 3CX3A 4OO3A 1XYVA 3HSYA 1ZCFA 1S4QA 2WJJA 4N5MA 3MB5A 3AKZA 4B3TB 1CEXA 2Y1DA 1UPCA 2BGNA 4RPCA 5KYVA 1WCXA 4UHCA 2OV1A 3H7IA 3BF7A 2EEPA 2R3SA 4N3CA 2R8PA 3SCZA 4NDNE 2WA1A 2QE7D 2I7TA 5HM6A 5COQA 2ZB3A 2E4AA 3DO8A 3HDVA 3BHIA 4OFXA 3NHLA 3MMNA 3LT4A 3ROKA 1HEUA 4PYOA 5I7WA 1E18A 3EGDB 4FBMA 5M29A 4RTOA 4HFMA 2BHNA 1FFXA 1W9MA 2DUWA 3FBGA 3IMGA 5F3RA 2WHEA 4HLUA 1XZIA 3QMPA 5HVNA 3EH1A 3P96A 2NU8B 4FGZA 4B83A 1ZMXA 4EA8A 4DCOA 5F9FA 1VSQA 5K7SA 1O95C 2QAIA 3LUBA 2BH9A 2QQEA 2RH8A 3AQIA 2RGWA 3R3XA 1I1OA 5LXTB 5D5PA 1IY9A 3LHFA 3MBIA 1Y9AA 4NYJQ 3KOMA 4P7KA 4RDHA 1VCMA 2WVJA 4URZR 2WY2D 4EJSA 1NBHA 1QGUB 5F1OA 3R7WB 4LOKA 3RFUA 5D51S 5I51A 2IPLA 4TM8A 2Q1XA 1AKYA 1P5JA 1PBTA 1ZRSA 4UDYX 3KTAB 4C4PA 1Z7WA 4G5XA 3B5JA 2PUBA 1OVMA 2SKEA 1ZISA 4HWRA 3STVA 2IDMA 1ESNA 2HJRA 2A9QA 2I29A 1Q50A 4IWNA 3QUCA 1WHTA 4R0VA 4AFNA 1UZLA 4BRSA 3RYCA 3BMCA 1GDDA 2ZM5A 3UATA 1BJTA 2WFZA 4N3NA 3DFIA 2WJAA 1FP7A 3IHLA 2FMTA 1I2CA 2ZRKA 3L41A 3CF0A 1YDFA 2A0WA 2A67A 2XYRA 3P5SA 1RKUA 4A6XA 2UYHA 3QI7A 2AC2A 1EFPA 2ZUVA 3BTVA 3G49A 5C3UA 2EG5A 2P9EA 2QKYA 1HYQA 1AQIA 2WUWE 3CRZA 4M54A 3DP9A 4OQYA 5C5EA 1E9SA 1BHJA 3CXUA 2HSWA 2IWRA 5ERGB 3CRQA 3JQ7A 1J0DA 1W30A 3C5HA 4JUDX 4KWTA 4QU0A 1LV8A 4WOJA 1SHKA 4HUQB 2R6GA 3LUJA 3REQA 3PDCA 4QUGA 3OT4A 4XR9A 1D6JA 2FN3A 3O2NA 1RXVA 3QUAA 2BHRA 5D3MB 5CFZA 1ORIA 1NJGA 4CIWA 2A9PA 1JQLB 1CDEA 4MVJP 4GE3A 1AKQA 4QIHA 5KOHA 3RWOA 3V46A 3WP0A 3O90A 3UTCA 1XEXB 2K2WA 1OUMA 3BWYA 5A4KA 2VWQA 1XQ9A 3I37X 1ZNYA 1N3YA 2PU5A 4ZHQA 4JYAB 1O5OA 2PKEA 4GMXA 1ESCA 1IPEA 2PN1A 3M1AA 2XZOA 3HO6A 4L50A 1USKA 1Z5NA 4AL4A 1RI1A 2QAGB 2VI5A 3AIMA 2FDXA 1CNFA 3D2LA 4FGSA 1DFHA 4IO0A 3RU3A 1PX2A 4WEOA 2JC3A 3LECA 2A88A 3MWFA 3T3EA 3G8BA 1IH8A 1M2HA 1SXIA 3IQEA 2P2NA 1DKNA 1V71A 2V9ZA 1I36A 3AUAA 3FR8A 5K3EA 1FL9A 2YWRA 3KCQA 1R0SA 1WNTA 4LIPD 1GZUA 1OWLA 2HY7A 2KQUA 5GONA 3WLHA 5EWJA 4CEHB 3TCNA 1P0FA 2CJPA 3C16C 4M1QA 4AZTA 2FU5C 1A8IA 4RGBA 2PSFA 2IUTA 3L1UA 4V3BA 2WV7A 1OMOA 1E96A 5KOIA 1WOMA 1R4NB 4I55A 3OFKA 2FPXA 3IERA 4JLMA 1T4GA 4TWIA 3U39A 3KTFA 2SCUB 3LKBA 1JDBC 2QVYX 4GMDA 4ZRMA 5KDOA 1W52X 3RIMA 2IPNA 3OEHA 3DOUA 1FMTA 1ZM9A 2IYNA 4KXLA 3ZV5A 5FTLA 3T3NA 2WSIA 2OYRA 3BICA 3RWBA 3VR3A 4K3VA 4L2IB 3BAZA 1K5GA 4ZWNA 1X1RA 3ZHOA 4E5PA 4IMPA 5F33A 3TZBA 2X2OA 4LYAA 4D3FA 4WHMA 2ONZA 3ZCQA 1MIOB 2XD4A 4OQLA 4E14A 1QH8B 3RVQA 4AUMA 1DPGA 3VYWA 2O2XA 3G8DA 2P8JA 3S5UA 3M0EA 3T1OA 4XIIA 3G5MA 4REQB 1QFXA 4RAOA 1GSAA 1QHFA 1YACA 3EC2A 2REQA 2IUYA 4EGQA 1NKSA 3W2EA 1TM3E 3O5AA 5F4BA 4C6RA 1A8SA 4IGFA 3IR7A 1N75A 3OPNA 5EYPA 4EYEA 3PIDA 3WLAA 2R7NA 4G2NA 3DFUA 1P2DA 2E5FA 1QO7A 4U7WA 3MD0A 4UAJA 3OPYB 1RWVA 4TXNA 3WGGA 4AQ7A 3Q0EA 1VSBA 4LYDA 5ALLA 5L4SA 1QVVA 3DZ3B 1QFYA 3KQTA 4X64B 2PV7A 2B82A 3EDMA 3AY7A 4L74A 2VNJA 4G9BA 3R9KA 3I61A 1M1UA 1N5JA 1F1BA 5J2TA 5HF6A 2EP7A 4UNIA 4RTLA 1E9VA 3FSGA 2OP1A 3LQQA 4CGZA 3ENZA 3MJ4A 4GE0A 3KYDA 4DDHA 2PQMA 1UEIA 2O7VA 3FDXA 1BNCA 3A6FA 3AKYA 4Q4HA 1NXVA 3HCRA 4TYPA 3OUZA 3KPJA 3N75A 1TYBE 4X3CA 2FFRA 4UE2A 2PZAA 2ZDGA 1SZPA 3UHPA 2X41A 1E0AA 3EGIA 4D9IA 1SXJB 2XYHA 4L8WB 3F90A 1OFGA 1EFKA 5P8WA 3L6UA 1DPFA 2ENWA 3KDPA 3M1IA 4AUEA 1BZYA 3OJEA 1UF9A 4DPMA 2NUTB 3CXRA 4CM1A 2PQ2A 4FC6A 2Q9CA 1VIYA 4A0SA 1UBMS 4EECA 3NIBA 2DECA 3KJHA 4II3A 5KQLA 4CLXA 3UKJA 3ZDCA 4Y9TA 1LC0A 3RAFC 2QRVB 1C3XA 2R1VA 3A58B 3KTDA 4QODA 3JZAA 2H18A 3DMHA 2BDTA 5D3KA 2DP4E 3S27A 5CA1B 4M9QA 5SICE 1U7XA 1MO2A 4FDLA 4Z2YA 2YZKA 2I9PA 2WVHA 3DO5A 1SU4A 2NU7A 5E1BA 4W5QA 1S7CA 1GFWA 4C5AA 2XRMA 1ZM7A 3DAGA 4CTKA 2XADA 5E7JA 4EYGA 1V1RB 5J4KA 1BMDA 2C88A 2W90A 2MYPA 4RVGA 3RVLA 1SXJD 4IIYA 1U0FA 5BSEA 1VJ1A 2BCGY 4WN9B 4Y2PA 4LZZA 3GG9A 1KYIA 1NLMA 3LDGA 3ZWYA 1Z36A 3HKBA 2ATXA 3NT2A 1XF1A 3E5NA 3AZOA 1L7BA 2RGUA 4W1SA 3VU8A 2EBHX 5HXAA 2W4QA 1JKFA 5EMHA 1E94E 3QHAA 1XEWY 2NAPA 3NBMA 1LB1B 5BN4B 1A98A 2ZTUA 4LHYA 4YGXB 1Z2NX 1YVUA 3HCEA 3KV1A 4BBZA 2XQKA 2CJWA 2VHJA 2ZIAA 4YJ3A 1KVRA 3O0TA 5L6LB 2P78A 1HDXA 5LOVF 3MHTA 5FL7D 4RMJA 3TL2A 2H1OA 2ETXA 3VKUA 3TZ6A 2ZWPA 3DCYA 3V1LA 1F0PA 1U1DA 2WV9A 1I7BB 1KK1A 1H69A 1N4DA 2WYHA 3GJ6A 4NH0A 3TQHA 1TK9A 2R11A 4K3UA 3KYCB 3T5CA 2IXBA 3CPEA 3LYHA 5LYJA 4D0RA 4ZZ1A 1LEHA 4XWAA 5KX5A 5F51A 5KKAA 3U3MA 1Z45A 1U9YA 1X6VA 4QRIA 4YRTA 1JJ7A 1DI0A 2CUTA 2WB2A 3K0CC 1SK8A 1AXRA 1QZXA 2NSHA 4BFSA 3M9LA 2Q45A 2LNDA 1CY2A 2AG0A 3DMTC 2NU6B 4L5BA 3RYFA 3I34X 5JZBA 1H8HD 1RM5A 4MV4A 2PK3A 2VQ3A 1DEXA 5HFNA 3VR1A 5KWEA 3IEUA 2XF2A 5LKAA 2P9BA 3LW8A 3LL4A 4A7PA 1UXGA 2NACA 4ND3A 1K1EA 4O2BF 2FA9A 3HYCA 2CKMA 5A9SA 2AFIB 5H82A 2B99A 2EP8A 3PDJA 4I9NA 3N7AA 3HPQA 1H4TA 4G5GA 3TLEA 2WSBA 1SUDA 3ZQ6A 5B1EA 1J2EA 3PEWA 3VX3A 2CKDA 3KKKA 5CDUA 2VHXA 4NL4H 4QGGA 2Z3VA 1OFIA 3PD0A 4HB2A 2Z3WA 1PNVA 3P0HA 3KFLA 1P8AA 1I7LA 1M8GA 1ZINA 3MM4A 1Y3CE 2HI0A 3AR3A 3VAYA 4AS3A 3K96A 1TQHA 4WLEA 1X86B 5BRNA 1DC4A 2XUKA 2UDPA 2I3DA 4FGUA 1TA0A 4PNHA 2QRGA 4OHPA 1N6NA 3J80A 3DBRA 3IDAA 3R0QA 4DY4A 3CWZA 3TW3A 1SG0A 2QN6A 2V7PA 2G5GX 1N0IA 2QMZA 1C9MA 3VDQA 1T5IA 2P4QA 3ISJA 5IAOA 3M5WA 1B23P 4D1YA 2YUTA 2XW6A 3O9VA 3PFBA 3QNMA 2R8BA 5JQGF 4YQZA 2NNWB 1QB8A 3R23A 4M1MA 3IB6A 1IY0A 2PD6A 4K0RA 1EFUA 3UBMA 1RJEA 1TJ3A 4PONA 3WKAA 4DWOA 1B74A 4EEZA 3PRJA 2X5XA 1Z8NA 3AERA 4LVOA 3CGGA 4ALIA 3NHAA 3ELBA 1U65A 4JB3A 1Y6JA 4AY4A 5FAKA 1JSLA 4M7PA 2ARKA 2ZDQA 1T5SA 4IDDA 1X1DA 5FEMA 3GGSA 1AU9A 3EG9B 3SNHA 1E60A 2QSZA 1AV6A 4MIOA 2PUHA 3LCJA 3QU7A 4I9FA 5DW0A 3RARA 3ZWQA 4CMAA 4YR9A 1Z6AA 5C9ZA 2II6A 5ALJA 4MWSA 5EERA 3TLZA 5C8XA 5JROA 2GCGA 2AC4A 3IUSA 3RVDA 1VE9A 4EARA 1XOIA 2VHWA 4CM9A 4PSKA 1OAOA 1L7NA 1E8MA 2HK7A 1WD7A 2QU8A 3CG0A 3CW2A 3D3WA 4G5SA 4OQ4A 4Z8YA 1UT6A 4F8YA 1ZAKA 3QFFA 5JFTA 1JB1A 1L1EA 3B2QA 1MN6A 3TOCA 5HZKA 5ECYA 1KS9A 2E7ZA 2OK8A 3NYQA 3W1VA 4D3XA 2XB8A 1TCAA 5HQTA 1U8TA 1E0KA 3LTNC 5F3WB 1L7MA 3KKPA 2WSMA 4I9HA 4MJXA 2P4EA 3QOYA 2EJUA 4BCCA 3IQXA 3OLYA 3K6SA 4KWCA 2ICAA 3PNKA 4KBFA 4M0UA 5G3ZA 1F5NA 1UC9A 4Q9DA 3V00A 5LMUB 5L3SB 4DILA 1V5WA 4ARBA 3KZKA 5G0VA 1WXDA 1ZMOA 3CKLA 4MRMB 5BYKA 2ATCA 5KSPA 3SKVA 1NNI1 4DUYB 5BT9A 5ULLA 5J43A 1PJ8A 4CM3A 2IU6A 3JXEA 4ZICA 3DB2A 1HM5A 5IFKA 1ODLA 4OSOA 3FAZA 2GZSA 2Q9UA 3C6MA 2ORIA 5F2EA 4AK9A 4BNVA 1JA0A 2YXEA 4GOND 2V5UA 1M9NA 5B1IA 4ENTA 4EY6A 5JYCA 1PG5A 5LVAA 1UMBB 3KQUA 4D4LA 1A2KC 3MC1A 4Q16A 3BD6A 1HDRA 2QAGC 3SS7X 2A4MA 4R7GA 4D80A 2GERA 1PL6A 1Z83A 2O4CA 2YYAA 4OQZA 5D3ZA 4CCWA 4Z2AA 4OI0A 5LQNA 3AF6A 1UQUA 3PX3A 1V9CA 2CHFA 1VKOA 2J3LA 3OD5A 5LQCA 1NXPA 3TR6A 5TT0A 2HJGA 3CKKA 1D07A 2J85A 1EUQA 5IS2A 1ZIYA 1DEHA 2PMWB 5TGZA 4EHAA 4TQ9A 3D5EA 4NPCA 2ZDHA 2BFNA 3RU2A 2FZWA 3QE9Y 4KLRA 2L18A 5CK4A 3VNSA 1CR4A 2FWIA 3FLBA 1M2GA 3C14C 4Q19A 2IYTA 3P9KA 4HLDA 2J0VA 4MWGA 5GAJA 2O7SA 4DS3A 2B30A 3LHIA 5JBNA 1JDVA 2PT6A 3A3PA 4B44A 1N2OA 4IEFB 4NBTA 5LLDA 1FTQA 5LU9A 1E2EA 2HR1A 5IJXA 2A94A 1KXJA 5LBTA 1T8SA 1SU8A 2FP3A 3QP9A 4RMGA 2FK7A 5BOSB 1POXA 1GV0A 2CLDX 4WZ6A 5CM8B 1MFPA 1T2UA 1Z0JA 3HJBA 3JYLA 2VDMB 3N8IA 2VJOA 4G0ZA 4PO1A 5DHUA 3WYAA 4EY7A 4Q48A 1AGNA 4QPPA 1L4EA 1OIWA 1VB5A 2XWQA 4Q7KA 2VYVD 4DJTA 2PUFA 1EU1A 3EXG2 2JAPA 5CT8A 2GETA 3DBLA 3I58A 1TLLA 1U0BB 2X5KO 1X87A 3LC2O 2J0UA 1YKSA 5J5AA 2O2DA 3OKFA 2W9XA 4Q34A 4PHFA 1NUAA 3MWEA 3QXCA 3LA6A 3CLSD 5K3DA 4C5BA 4E51A 1KP3A 2AI1A 3WLSA 3EDYA 3TE7A 2I66A 3DV2A 1BCRB 4FNMA 4BDSA 4FQ7A 1E9BA 3H5NA 2F64A 1JHOA 1GCOA 3AEXA 2WUFA 2Y0CA 1B43A 2WFAA 5JV5A 4KN8A 1OAKA 3IV7A 4XQ9A 1K7FB 3ESAA 3E1SA 2I76A 4LK3A 5BYBA 3ZZTA 5FKJA 2AK2A 4KDFA 1GXSA 2V7UA 3HCOA 1P4JA 3L79A 4AB1A 5BMVF 2O57A 4BCBA 4PXSA 3SX4A 1XEFA 3D7KA 1NVUQ 1P6QA 3DZ8A 3G17A 3DF7A 3HP4A 3D3QA 4PX2A 5FTJA 5J1TB 3RUEA 2VZEA 3L7AA 1XN4A 2V9PA 3QUSA 1R8SA 4PFQA 3E3LA 3VISA 1XP8A 4BNDA 4ZEMA 1ZBQA 4IVNA 1QK4A 4TT3A 2I1WA 3JSAA 5AK3A 3AUTA 2VJCA 5DIZA 4R54A 2MMGA 1FQOA 4JJIA 4KE6A 5BQOA 5SYNA 1JH9A 5EE5B 4N0QA 3F6CA 3ITDA 4US1R 2WF5A 2XMSA 3X0DA 2E18A 3X43A 4B46A 2NV2B 4YFVA 4KWIA 3H5VA 3SBEA 1F4LA 2JHPA 1JW9B 5BY2A 4K1LA 1NMSA 2AQ8A 3ICWA 1JF8A 1HRKA 1UKEA 1SBYA 2DBYA 4IXNA 4MPPA 4I2VA 1KI2A 1SXJC 2IDJA 1PSWA 4XQEA 3EISA 3FPHA 3LX6A 4KGDA 2V6FA 3TM4A 4CM5A 1YFKA 4AX4A 3D0OA 4PWYA 4FD2A 2D54A 4YV2A 3LUHA 4XB2A 3CLTC 5H0IA 2CLLB 2F9FA 4CMIA 4Z4HA 4MA0A 1CR0A 1FS4A 5LIPA 3F67A 1E6UA 2H00A 3HJNA 5JD3A 3NBQA 5TE9A 4CF6A 1WRBA 1X2BA 4IEIA 3VU0A 3DXYA 3RR2A 3EB9A 1MA3A 2J9FB 4ZT2A 3M6AA 3NFRA 2IOHA 4ZAZA 5F1KA 5LYYA 4EELA 5KMGB 4UASA 1WHSB 4JEIA 4Q1DA 5KOJA 1VJ0A 4E09A 3ZWMA 5KAMA 3UC9A 1THMA 2XIQA 2VJQA 3P9CA 3HB4X 4LZJA 1ZW1A 1TYCA 4UAGA 1KE2A 2DCUA 4P4GA 4EW1A 2P2YA 3UV6A 1XU7A 1FJ2A 1CV2A 3JQ6A 3KOWA 2HMTA 3Q15C 4XVHA 1CDOA 5B30A 1PZEA 1HFEL 2ZXEA 1MD9A 4AMVA 5ED4A 1R74A 1UBKS 3OESA 4A27A 4AM8A 5KSWB 1QTIA 1XVLA 2JCYA 3OEYA 4C4RA 4OU4A 4YBZA 3RS4A 5EUCA 3ZV4A 2ZQZA 1QHIA 1XBTA 5EQFA 4G0NA 4JKOA 2DKNA 3V8PA 3EQ7A 5JAUA 4DIDA 2PUTA 2C2XA 4RL6A 2REOA 4J4BA 3U61B 3AL0C 1K8RA 1LX6A 4M9XA 1W34A 1KKUA 1YI8A 3AR8A 2WW8A 4L6AA 3GJQA 4LA4A 4QYXA 4MKHA 2MSDB 4L73A 4M8SA 4O4LF 2ZBGA 3ORQA 3W5VA 1UJBA 2I91A 2YZNA 3E8MA 4B17A 1FMLA 1Y7PA 3CF4A 1FUIA 1P3JA 2L2QA 3EIHA 1EGVB 1HQDA 3U7IA 2GZDA 2M1XA 3W6OA 1PK9A 2TMGA 3S6JA 3TPZA 5B37A 2OO3A 4QOIA 4CM7A 5D1HA 4ZK6A 5CFRA 3K0AB 3THXB 2LDBA 3B38A 2OBMA 3VR5A 4EGSA 1PTJC 5FV7A 4Q82A 1ZU5A 4QXMA 1XKXA 4FB5A 2BEUA 1PR4A 3PFCA 1URPA 4R31A 1M6YA 1EA5A 2D1FA 2GBPA 2Z2YA 3BERA 2GWRA 2QQFA 5TQ0A 4ARAA 4DYDA 3A6LA 5CEEA 3LFTA 3WHLA 1Q6YA 4DM4A 3V7YA 16PKA 3DONA 3GFRA 2VDWA 2QRKA 3L0SA 2GCEA 2BKVA 4AO6A 4EI2A 1I4LD 3E3OA 3P26A 1ZJYA 3BBLA 3L9XA 1T3LA 2IDKA 1X3SA 3DAHA 2QORA 1M2KA 2ERXA 5LDGA 4PAMA 3U9TA 2C7RA 4WDRA 1UAYA 1HDGO 2OENG 3PUXA 4G26A 1EM8A 1RPZA 5KQSA 2D7CA 3H5TA 3EPJA 2XVZA 4CG2A 4GPD1 5EXDA 4U9HS 5ITZB 1MW8X 3BMOB 3KSBC 3BTOA 1G9XA 1WMAA 1B2LA 3BORA 4MS4A 3D59A 3O4IA 3LYLA 3ZW9A 3UGQA 1CQPA 3FUCA 4AYTA 4QUJA 5KNBH 4H4CA 4KMOA 1A5SB 3OKPA 3TLKA 5K4HA 3KXIA 2XOKA 2IH4A 1MAWA 2Z4SA 2PD4A 1X80B 3HFGA 3ZZ1A 2ZG6A 3N05A 4MUAA 1JHXA 4UUAA 4C0XA 1U9IC 3PPYA 1H2HA 4WZBB 3NT5A 2QYOA 4H27A 3WSVA 2Z57A 2Z9CA 4YLYA 4EKNB 4H3VA 2CYAA 3GRVA 4OB8A 4U02A 3TOSA 2AFHA 2VC2B 4N3BA 1X7ZB 4B71A 1YZHA 1VKJA 1NQTA 1U3CA 1YR8A 2VAPA 2I6XA 3PTZA 4RWZA 1VQ1A 3U1VA 2XCTB 3NTXA 3OU7A 1XZCA 3U3KA 1FSPA 1JBQA 2R68A 2RKOA 5DCUA 2XB2A 3WXBA 2P30A 2PA0A 3O3MB 4GECA 5DNEA 1SOWA 1X7XA 1XTQA 2YQZA 3LWDA 3VR2D 4D3DA 4I3FA 2BEWB 2BUAA 3E27A 3L1KA 3LA8A 4XLTA 4Q6BA 1IHOA 1KYVA 3VTFA 1NBEA 4AJPA 5SY4A 2VFAA 2XPCA 4Z9AA 5H59A 1KO4A 4MAAA 2JLXA 2GCIA 2ZWIA 4PTZA 5TVGA 2DPMA 1CRQA 2H16A 2GYUA 1CHNA 2ACVA 2ZUBA 3KZVA 3F9IA 4XDGA 1N9KA 3THYA 2XBLA 4FLFA 1WSWA 3CIOA 4NQRA 5GVRA 5TMEA 2POCA 2Y8EA 3EASA 3IS3A 1PGPA 4LV8B 1XCMA 1IN1A 1ULHA 4MB6A 1QTQA 3OZWA 3LVFO 3H0KA 5I3CA 4LWZA 4U0KA 3R3ZA 4MUMA 5TXGA 3LSTA 3URKA 1OXUA 2HD4A 4ZO7A 3V4SA 2VYNA 1GG2A 1ZH4A 5KTPA 2FJ0A 3BB3A 1FZTA 1J8YF 1ZI9A 2P27A 3KFXA 5HW0A 1Y80A 4KVZA 5J4YA 3N2KA 4JLPA 1X0VA 5D00A 4HWPA 3GLGB 2VSQA 3WL7A 5CCEA 1K6IA 1X9IA 2DLDA 2DU8A 2GTIA 1H2RS 4AT1A 2B20A 1VHJA 2ADOA 2EYUA 1Z47A 3G2MA 2XQGA 4L3VA 4N6NA 4YECA 4AG3A 1OE0A 1G8KA 2HQBA 4BWYA 4CDMA 1DBSA 5A9RA 2CVPA 1N8TA 1DWOA 1RRVA 3UWDA 4IRMA 4QX6A 4M87A 3DVSX 5AQEA 3DSRA 2QNIA 3AVTA 5BW4A 4HCJA 4MNTA 3S81A 2BM0A 4CHGA 1RMYA 1BTOA 3KLPX 3PGVA 3TZLA 4L9RA 2YRXA 3LKZA 3LI2A 2ONKA 4MMXB 1CRPA 3ANXA 5K20A 3E22B 1MJ5A 4NBRA 2BHSA 1P1BA 3NHPA 4L85A 5EJIA 4BGEA 3C87A 3RTAA 4BDTA 4RY0A 2FWBA 1ATIA 2X5JO 1BYUA 2EKQA 1XZJA 2PGOA 3QRWA 1O89A 3MS4A 3PQ2A 8ATCA 1S3IA 2VG8A 5TX7A 5A6VA 1D0VA 2YN2A 2FPUA 1DC8A 3KKEA 1BMQA 1NLYA 4UNQA 3H16A 1X1BA 1Q1ZA 4UFPA 4ZAGA 3PNYA 1Z3IX 1Q0PA 2Y3IA 4QKQA 4I5DA 4ER5A 1UXKA 1KH3A 2AJCA 3BXFA 3M6XA 5KHOC 2C2KA 5EUQB 2BGJA 2JBWA 3CJQA 3A7EA 3CLSC 4G8JA 4P6VF 3T3MB 4YAOA 4QU5A 4OB6A 5J1SB 2LRHA 1ZJWA 3ECCA 1IVYA 1HEYA 1YBFA 1BFUA 2PRYA 2ATIA 2VEOA 4YTEA 4DQXA 4ENQA 4DR1B 2XUOA 5EUMA 3KEGA 1NQ5A 3SC3A 2IOFA 2WP8J 2IODA 2PYDA 4RD2A 5DNVA 3MD9A 1PQUA 4HDRA 1BGWA 3C98A 1QPBA 1NJFA 3NHYA 2F00A 3F6RA 3PD7A 5DGCA 1Z6PA 3N58A 2QW8A 4GBED 3IP7A 3NRJA 3V7NA 4CBVA 4HR7A 1KMHA 5I47A 1SCIA 4M0LA 1Z3CA 3JSXA 3O1HB 5ALQA 4CG0A 4M8IA 2G77B 1DKUA 2XOEA 2XWBF 3LQYA 4WWHA 4Y2XA 3TDNA 2R6DA 1N5IA 3WJ7A 5GOTA 3X3HA 2CXRA 3IP8A 4B0OA 1YOBA 5DM60 3C3JA 4CKBB 4B7XA 2DULA 2JEOA 3BWVA 3T41A 3QQPA 4GKBA 5L3QB 1BRMA 1EUZA 2OECA 2HBZA 3QKUA 5EJ2A 3VX4A 2X2EA 3F6PA 1MT0A 3WRYA 4RZIA 3ABRB 4B7CA 2V6JA 3AX6A 3GT3A 2Y1FA 4CV2A 1FRZA 2PS0A 2ZP1A 3GGCA 4N48A 3PJFA 1I1QB 2BTQB 5KTSA 1I6LA 3SYRA 1JFLA 1V26A 1IG0A 1E7WA 2E4UA 1XD9A 4KU4A 5KNCH 2QHXA 4IR7A 2PKQO 2VT6A 2JVKA 1MENA 4LXHA 4KO4S 3OP1A 4QXPA 1CQIB 3SXJA 2WJVA 4OQMA 2FPKA 3DL7A 1VIAA 3DF9A 2PUJA 2P9YA 3UYLA 1KARA 2VHUA 3T9EA 2X4IA 3VYUB 1XJWA 3X1JA 4J0GA 4RA9B 3RTGA 1C4XA 2O7NA 2JK1A 3B7GA 1U6KA 4DYVA 2C95A 1NJ2A 4F96A 4RPHA 2ZM6B 3IUMA 1RDFA 2NO0A 4C76A 2J3IA 3CRW1 4H31A 2X0FA 4F38A 4XUCA 3PS9A 2Q2QA 1IB0A 3AC0A 3W2FA 1U0HC 2C58A 4YT4A 3JAWB 3P7MA 3SBDA 4RD3A 3WSTA 1XTVA 3T7IA 5K0CA 1M10A 4KMRA 4UTZA 1J00A 1WD5A 1RLTA 2HMVA 2O14A 1ITZA 2VP0A 3A6GA 3BE5A 2QLTA 4HEA1 4G8BA 3EPRA 2OG1A 5CVVA 1SOAA 1L8LA 5JO9A 2BRUC 4IDPA 4D98A 1F3OA 2IEGA 2RCNA 3UTDA 1EP9A 1BQEA 4HZUB 4M0FA 2QZSA 4J03A 5J2UA 5JZ9A 5K4AA 3WBFA 5FO0A 4QUKA 2RONA 5LQSA 2ECKA 2ZR7A 5JSZA 2E4YA 3C74A 1U7TA 2OFOA 3CSDA 2NMVA 1XZDA 2CF5A 4URHA 1V45E 3T7TA 3SYMA 1AQLA 2DPXA 1ZD3A 4OM7A 2BDUA 2EOAA 3E3MA 4G07A 2AVNA 1LRLA 3SIWA 1U7WA 4JZKA 4GVXA 4QXRA 3TMKA 3ZHCA 3GIWA 5TJ9A 2IEAA 5AD1A 1NF2A 5EI5A 5ALRA 6GPBA 5F35A 5HE9A 5HZHA 1BE0A 2OFFA 4NBKA 4HI0E 4OD0A 1L5RA 2QB5A 4E1BA 1X1TA 5CDTA 4ENPA 5A5FA 4P84A 3SC4A 1QFSA 4OQEA 3OIWA 1AQNA 3F5MA 2R1UA 4MUXA 3UMRA 4LF4B 5BSWA 3S29A 3UICA 4XJSA 5CNIA 2BI4A 3W9YA 1BDHA 3AOGA 1F4PA 1WVMA 4FXPA 3TCXB 5I8WA 3I04A 1ISRA 1G8JA 5JRJA 3GRKA 5EFZA 4REOA 3TXAA 5L6MB 2WU1A 1JYEA 4Y1EA 1RNLA 4IDCA 3QFTA 1XAJA 3BREA 4OY3A 4QJ3A 1YZNA 1WIWA 3UB3A 1HSZA 1FP6A 2AEMA 2HLHA 2ZBUA 2QTBA 2WAMA 3K5WA 4GUDA 3T5MA 5EJ8A 3WDKA 1UJ6A 4QREA 2J6CA 2LWIA 2AV6A 4ZYUA 4OA5A 3VGJA 2QRLA 3REFA 4DZZA 1A1VA 1JEYB 4M1SA 2K87A 3KUCA 2WWGA 1D1QA 3EWAA 4NAUA 4O5AA 1QE5A 3S2SA 4WY2A 4JELA 2C04A 1FTSA 1DXYA 2IEBA 5JMPA 2Q07A 1YGYA 3BILA 4MVXA 3W3AH 4IIVA 2J31A 5ECGC 2R5FA 1CFZA 3G02A 3Q2OA 1CZKA 3AEQB 1YVDA 1BIFA 3SC2A 1G3RA 1C1HA 2Z8YA 3BGIA 4H7HA 1GNSA 1OYVA 4KXFB 1HKUA 2C31A 1YA8A 4PGHA 1Q0RA 4HEQA 4NMXB 2CMKA 4UTVA 2VJKA 3IUBA 3PHGA 2D3WA 4G41A 4AIRA 4NYMR 2VRBA 5D87A 4YAGA 3QXHA 4GI5A 1N2SA 1FBNA 3Q2IA 3V9AA 1FYVA 5FUMA 4TWAA 4D45A 1QDUA 3DAYA 3IBCA 3BC1A 1BFDA 2Q4BA 2JA2A 1FNSA 3C1AA 3EGVA 1CVRA 1E2HA 1JPVA 2JFQA 2QSYA 4Q4DA 3X2FA 3GUUA 3K53A 4FD3A 4P7JA 1ODTC 1P9WA 4QA9A 4R8MA 4KXNA 4TV9A 3RVJA 4WK2B 2BONA 1C9NA 3EN0A 2JATA 5BNTA 2VL7A 3OQHA 4PG6A 4FZVA 4WXPA 2CNOA 4DWWA 4ME6A 2PJRA 4MHTA 1YH3A 1BWPA 1ORHA 4MQLA 3H17A 5D86A 3BH0A 4MQ4A 2ZSUA 3TOXA 3A0RB 1EHIA 1YK0A 3LUAA 4DJAA 5A3JA 1IQRA 4MYHA 1ZAYA 3HB1A 3VV3A 4ZRNA 4I46A 4YV0A 2DWCA 3GEHA 3WGOA 2JCSA 3RS5A 1YB6A 2DH5A 2VBCA 2C3OA 4N18A 4AXXA 4EDFA 1T1IA 3T3OA 1FNDA 3O2QB 5DVZA 3UC5A 2YV5A 3IAEA 3PC8A 4X95A 5A7GA 2WJZB 3RWMB 4F06A 5IT4A 4JX8A 5JSHA 1DEKA 1VJRA 1DO2A 4X1IB 3IFSA 2QP3A 3TO5A 1VZ2A 4R1MA 2Z6QA 4OHYA 1TNDA 1QIKA 2AMFA 3LWBA 4UHFA 3V1TC 1AC5A 5E38A 1LS6A 3VR4A 4ZHQB 4DMMA 3WGQA 5CPFA 2HNBA 3CU5A 4CNQA 3E9EA 5JH7A 2OMKA 3SVLA 4CL3A 5LOVB 1GFZA 1SCBA 4RTKA 4E2ZA 4WE3A 3TLGB 2HDHA 4CFZA 1XTZA 4IX1A 3M49A 4TYNA 4FYHA 3LPNA 1P17A 2YMLA 1DX4A 3W8RA 4IIJA 1KP2A 2VP6A 4QAJA 4ZDIA 1NM5A 5DULA 3VM6A 2A0FA 2ZJZA 1OV4A 2VAMA 2VDVE 2V7GA 1EESA 4TSFA 1E9EA 4NMWA 1XLUA 3PNLA 1BXGA 5IM4F 3S2EA 2VZ0A 4AZ0A 3DDSA 3UMGA 1P0QA 1H9AA 1GKIA 1PT9A 4QM7A 1BAPA 2BAGA 1WDTA 1DJPA 3FUXA 3I2FA 1HNXB 4R6WA 1BD4A 2J3EA 3WRWA 2VP5A 3CJTA 3UMFA 1XTRA 4ZPJA 1RLJA 3BTUA 1G8FA 3I39X 1B8OA 4LKOA 3PJEA 1M6HA 2HQSA 4O2BB 3FG9A 3AEUB 1NY5A 1SVKA 2QN3A 3O8DA 4Y2UA 3H9GA 5K09A 3IMFA 3RG2A 3RT7A 3K70B 3BYZA 1XWWA 3FE2A 3FNEA 4KO2S 5SZHB 3V9PA 2DJ5A 4MP3A 4BPBA 5BV8A 2WD7A 3EC7A 3NQ41 5F78A 1UWKA 1D6SA 2CVFA 3KU4A 3BQ9A 3HI4A 3V6MA 3F3MA 1L8XA 1W47A 2HHLA 1Q1NA 2P91A 5AK6A 2J3DA 1JBEA 1FP1D 1SZCA 2CXTA 2XGSA 1OLXB 1LK0A 1W9HA 4PQGA 4BGDA 2EFEB 2HV8A 2QVZX 2N46A 3W0LB 1U5CA 3OJ0A 1H0RA 3RSQA 1KZ6A 2ZWMA 5JZVA 1NP6A 4GSKA 3EF1A 2VQEB 3T4UA 1ECCA 4QNMA 1SC1A 1TI7A 1LS1A 2C59A 2F3TA 2ET6A 1FX0A 2PRJA 3I5MA 4MXDA 2C3MA 5FUQA 1X74A 1AO0A 4KNYA 3VJRA 3VPXA 1KMCA 3R1IA 2ZE8A 3PITA 1BOOA 4MIYA 4DUPA 2P3LA 2P62A 2Q2OA 4MUFA 1KE1A 3TPCA 2XUJA 3QIVA 3K70D 3LUPA 1WSBA 4II7A 1NI4B 4G1MB 1TKBA 1YB5A 1NVMB 5BNWA 1E7YA 3MERA 4BO3A 1FS5A 1ZH6A 3ECAA 4IDAA 2WILA 2QF7A 3BE6A 4JLBA 4KRGA 3IEVA 1VHTA 1QAMA 2BOVA 1J23A 2RG7A 1CW2B 4ND4A 4UPEA 3DZ2B 3ODPA 1Z33A 5JRDS 5GZ6A 2PMCA 3WWPA 4CQMB 1VI5A 5K0EA 1QQ7A 1ELOA 3GRYA 1M74A 5TMPA 2I33A 2QK4A 3H65A 4G36A 3VHLB 1YQ9A 5FI5A 8MHTA 1KEEB 2PO7A 5D01A 5CFMA 3OOSA 1GHTA 1CF2O 1J4AA 2Q3MA 3LPAA 3BS4A 3PCRB 3NATA 4HMOA 2JAUA 5KYUA 1DQPA 1UC8A 1E4EB 1SC9A 3H84A 3GROA 4CYMA 3IBGA 3P2EA 3MGAA 4N6GA 4YC7A 4OSEA 2HLNA 5ENVA 2NVBA 3HMKA 3ROFA 3B6JA 2YL2A 1ENZA 4WJLA 5B1YA 3WZMA 3RIYA 3RNLA 3TR5A 3VVBA 4D9EA 4JA0A 1CJBA 1PP4A 2QGZA 2QTGA 4K6MA 1E3MA 3RF7A 1Y5MA 5YASA 2N47A 1F3LA 1T2FA 4DZRA 3BWMA 2E6KA 5FUWA 5C8YA 1WO8A 3W6NA 5C1BA 1N36B 3JD4A 5FQNA 1GQ2A 3LLCA 5CNKA 4MR8B 1JHYA 2I1QA 3GT0A 4UMVA 1PV4A 4J0QA 1JQEA 4CQMD 3WV4A 3GQVA 3PHJA 1J7KA 1TU4A 6ADHA 3GCXA 5F4ZA 2ZT5A 3O38A 1IQPA 4ZQFA 1I2ZA 1KH2A 1SJ9A 3MJEA 3KZNA 1NVDA 3R0ZA 3FOAA 2BGIA 3ANMA 5D2CA 3ZTTA 2FOLA 4Z4CA 1Y5RA 2VNKA 5D5HA 1SVMA 2WAYA 2RI1A 1BHO1 4WCDA 2BKXA 3RYTC 2I7VA 3FUVA 1VHLA 3LUFA 3W1EA 4BBAA 1Q3HA 3NHMA 5JDIC 2DG2A 3ZY3A 2HEGA 4UXIA 1ODFA 4HTFB 1Z74A 1ZHHA 5DISB 4Y8VA 3KEMA 1SO8A 4K9OA 1HNWB 3AEZA 3WNVA 1VLZA 4FYVA 4BE7B 3B36A 4XASA 5DXJA 2B7LA 2P3QA 3KWFA 4BN4A 2O8CA 1C0EA 4E4YA 4W6QA 1JEQA 2ZBDA 4OMUA 3RUAA 2V96A 4NULA 4RIIA 3JARA 3TQQA 5B58C 4HFRA 4A0RA 2WOOA 2WTUA 2W42A 4GUAA 1WJGA 4KN6A 2XB9A 2B78A 4B3JA 3EWSA 5AI6A 1DCMA 1LQTA 4L6IA 2PZGA 4UBLA 3VUEA 4WQMA 4G6ZA 1FDTA 4HXYA 4UUPA 2BTOA 5JZMA 4KPUB 2QBYB 4DVGA 1U0LA 3ORSA 4OXQA 4PRKA 1UMDB 1Z26A 2VDOB 5DBEX 4Q1AA 2AN5A 3OO1A 3K5PA 1B6GA 4Y9SA 4EGAA 3JZFA 2Z4RA 4KX5A 3V8MA 1MO5A 4MQBA 3ZCVA 4EX6A 4MITA 2QJFA 1TK3A 1ZHFA 3D2CA 4H7EA 4N4AA 2VZLA 2HBRA 3GLFA 4X92A 2FVYA 1G4HA 2E37A 4FZ5A 1PL8A 4UNRA 4KW7A 1WS6A 3QLUA 2FLWA 2RHTA 3OEEA 1ZD8A 1P2VA 3EDRA 4UARA 4DHWA 3SOPA 2B1RA 1K5PA 4ZAWA 4CN9A 5MGNA 2YJZA 2CNWD 3OE5A 2EAUA 2WP0A 3NMUF 3AEYA 5E8JA 3A1UA 2P8SA 2H63A 1C3OA 1JJBA 4I1SA 3ML1A 2QLMA 1M33A 4MYRA 1LC3A 4BO5A