3V2UA

Crystal structure of the yeast gal regulon complex of the repressor, gal80p, and the transducer, gal3p, with galactose and atp
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
421
structure length
409
Chain Sequence
b'AAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRALDPGYDAGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 137
structure length 409
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v2uA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2uA01
3BZUA 5CEJA 1N9GA 5I7EA 3O38A 2Q4BA 2OBYA 1A71A 2VHWA 3ZNPA 1N2SA 4BO2A 1U8FO 3C8MA 4FW8A 4E2XA 4KUGA 1KY4A 3KBOA 4AJLA 1ID1A 3JYOA 1IB6A 2HMVA 2NTNA 4XGKA 4N5MA 2Q2VA 5CDGA 2CDAA 4R9SA 4CUJA 3DO5A 2RBEA 4UEKA 4JCOA 4BNLA 1NFQA 4GWGA 3ZV4A 5FF9A 5K6AC 2A35A 4J2HA 4FC7A 3IQDB 4D46A 4TROA 1HDXA 4DREA 3OP4A 1O9BA 4AG3A 1SB8A 1U3WA 2F1KA 1GDHA 2RAFA 3JD0A 5G4KA 1UDCA 1MGOA 3HDYA 3ZHXA 3VVCA 2C07A 1T1SA 3WSVA 5AXDA 1QLJA 3QVXA 1G6KA 1K0UA 3CMCO 2P5YA 2WJPA 4IINA 2VN8A 4RVSA 3QY9A 3D4NA 4RQUA 2O3UA 3GNTA 3LF1A 5AXCA 4BNJA 5HTOA 3EAGA 3H9UA 4KTTE 1E7QA 5GZ6A 1JU9A 3ONFA 3WMXA 2ZB7A 3PYXA 4BMVA 3JQ9A 3ST7A 4GMFA 3E8XA 4BMNA 3QSGA 3Q2IA 1XLTA 1ZSYA 3I9OA 1QSGA 1DB3A 2QX7A 4BNNA 2RCYA 4XA8A 1R16A 3EW7A 4CPDA 2ET6A 3S8MA 2EP7A 5A03A 1Y6JA 3H3JA 3JD3A 1HE5A 4FFOA 4HNHA 3RBZA 4YPOA 2PH5A 5A9RA 2W4QA 1SCUA 3CPSA 1N1EA 2PD6A 3D3EA 5F5LA 3UFXA 3ZWPA 4YXFA 2FR0A 1CERA 1NVGA 3RFTA 4YJDA 1PZGA 4P22A 2OP1A 4P4GA 4BNMA 3RFVA 4PG6A 5BNFA 1KEVA 3DZFA 1BHSA 2NQ8A 4ALIA 1HT0A 4Q3NA 3I52A 1NNUA 3ZV3A 4MIEA 4Q3BA 1QKIA 1PL7A 1BDMA 3RWBA 3PZBA 4M87A 1E6UA 2HRBA 4YT2A 2EG9A 4B79A 4GBJA 4LMPA 3ZHYA 2B36A 1W4ZA 4AJ2A 4MO2A 3TF5A 3C1AA 3OECA 3BTUA 5T64A 4II3A 3PK0A 3DC2A 3BHMA 1HDGO 1SEPA 2DFVA 2Q1SA 4L4RA 4WCFA 4XDYA 5A9SB 5TJHA 2NNLD 3PPIA 2NVBA 4WLFA 2JFGA 1X7HA 4XQCA 5B37A 1B7GO 1K2WA 4PLPA 3BMOA 4J0EA 2ZCVA 1DO8A 3I4FA 3WNQA 1Y8QA 2IZ0A 1PGQA 1FDUA 3D5TA 5A9TA 3GAZA 1GAEO 3IDSA 1Z7EA 3CH6A 5EPOA 3ADPA 4BKOA 3BYZA 3QE3A 4YRDA 4L8VA 4FFPA 3ZNQA 3K31A 3VH4A 1H6BA 1O94A 3OEWA 4CV2A 3DTTA 1GL3A 4GQAA 2YQ5A 4BO0A 1FDVA 3RUDA 4ONEA 4EUEA 3FTPA 3NT2A 4NZ9A 5IDXA 3GT0A 1NR1A 2O3RA 3FWZA 2DVMA 3HFGA 4W4TA 3Q11A 3NJ8A 2NU8A 4E6PA 3DTYA 2X58A 3G0OA 1TI7A 3KVOA 3IKTA 1SC6A 2VYND 2IDZA 1YXMA 3WGQA 4FDAA 1EVJA 4KMSA 1SMKA 3MCVA 3ZWCA 1WVGA 4BNZA 1WNTA 3AOGA 4RPHA 5KTKA 2IRWA 2A4KA 1UXJA 3P5SA 2JL1A 3GN1A 1QORA 3F6YA 4BO1A 1NR7A 4CLOB 1PGNA 4RZIA 2YQ4A 4W9NC 2Q3EA 1UXKA 4NBWA 4JP2A 3Q2KA 4DQUA 4CODB 3FRJA 1X0VA 3BMNB 1I24A 4CMAA 1VLLA 2JD2A 2Z95A 3R6DA 1LSJA 3G49A 2PFGA 1LUAA 4YACA 1X1TA 4UVIA 2WWRA 2X9NA 2QQ5A 3HZZA 2A94A 4XR4A 3IL2A 2GR9A 2NADA 3D1LA 3DEYX 4PLTA 4DBVO 1R4NB 1GCUA 2O4CA 3NDJA 3WTCA 4FFLA 3X2FA 3NTRA 3ONEA 3L9XA 1S7CA 4ND1A 3OIGA 1NWCA 4WNIA 3ASUA 1SOWA 2JJYA 2ZQZA 2OXIA 1JKIA 2O2SA 3U09A 1B26A 4UVEA 2EKQA 5L7YA 2Q50A 2J3JA 4EJ6A 3I9JA 1OBFO 2EJVA 5ITVA 3TOZA 2VUTA 3TZKA 2BFMA 5KOIA 2VYVD 1T25A 3KLPX 3Q9UA 1P1RA 2W2LD 4P4LA 3O8QB 4QEDA 2AEMA 5COQA 4YRBA 1C0PA 3OJEA 3ZN2A 4CR6A 4XEHA 3LT1A 4R16A 3OEYA 5CPBA 2X1HA 1HEUA 3ZWXA 4I5FA 4D41A 4YDRA 4YWJA 2WE7A 1JTVA 1NX6A 4B4OA 4Q3DA 2HU2A 3WQQA 3MTGA 1YDWA 1PWXA 4IDEA 2CVOA 5JFOA 3R0IA 4QXMA 4TKMA 2EGGA 3INRA 2EV9A 2B35A 1WPQA 1HDZA 1Y5MA 2G17A 2QRJA 3EVTA 4CM4B 1U2DA 3ENKA 3ONDA 4PLWA 4EYEA 4OXYA 2CFCA 1GV1A 1TT5A 3ABIA 4RPGA 5TX7A 2VZ9A 3MOGA 1IYZA 4ND5A 3BHIA 1PZHA 4J7UA 3JQ7B 2OHXA 4CMCA 4UUPA 3BA1A 3QJ5A 4ZJUA 1Q0LA 2P68A 3PIDA 2O7SA 4W99A 5JNLA 2DTXA 2GF2A 2OP0A 3WB9A 3WJAA 3C7AA 2CVQA 1YVEI 5FEUA 4YJHA 3L0DA 4NMHA 1M76A 3JTMA 1O89A 2CNBA 8LDHA 1E7RA 4TVBA 1YBVA 1HZJA 5KJCA 5B4TA 1GTMA 1T1RA 2NLOA 1ZW1A 4EDFA 2NU9A 2PD3A 2Y1FA 2C7GA 4GL4A 3ZGYA 1LDGA 1U7TA 2YHUA 3FWNA 2Y1CA 4Y6SA 3SX2A 3VH2A 4HY3A 4DLBA 4E12A 5JPIA 4L74A 2CD9A 4KUEA 1PZEA 4W82A 4CV3A 3PQDA 5IXSA 1ONNA 3H2SA 2ZB4A 1T2AA 4RL6A 2X0IA 2EW8A 3X2EA 1MV8A 1LC0A 1QV6A 3VPGA 2NTVA 4BMSA 2OMEA 4DPMA 2FSSA 3FR7A 1PU2A 1YOVB 4TZTA 3LLSA 2NV6A 3ZHBA 1PTJA 2NTJA 3RAJA 5KKCA 3JSAA 2GO1A 2I67A 7MDHA 3G1TA 3H9GA 2Z1NA 4XJTA 4I08A 3PQFA 5EN4A 4M49A 3V5NA 4JJFA 1VJTA 3AK4A 3KB6A 1XYGA 1LDEA 1P0FA 4R1TA 3TN7A 1E5LA 1HDRA 4U6QA 1GEEA 2E48A 4FOOA 3E1KA 2A9FA 5EQFA 2V6FA 1T26A 1MA0A 1YO6A 3SEFA 1VJ0A 4K1LA 4RGBA 1LRLA 2E4AA 5C7OO 5IZCA 1I3MA 4Z0HO 2WYVA 2VYVA 3IOYA 1EVZA 1KEPA 3K96A 1YQXA 3DWFA 4ALLA 3VPHA 3KYDB 3I5MA 1NWHA 4FS3A 3HQ4O 3MOIA 1HDYA 2ZKLA 5T57A 3HB5X 1M6HA 3K8ZA 5I7SA 1GV0A 1ZEMA 4ILKA 1X7DA 4JN6B 1V6AA 2YJZA 3ANLA 3IUSA 4YJGA 4ZRMA 5BSHA 5KCZA 4CMEC 4FQ8A 5IJZA 1E3LA 3F1LA 2HJSA 5JMPA 3V2GA 2QRKA 2GPTA 2WD7B 5DN9A 4BGUA 3BMQA 5ICMA 1SBYA 2DU8A 1YQGA 3T4EA 1DC3A 1LEHA 1FF9A 2FWMX 3DONA 2OFPA 3WSWA 3ZWWA 1F0YA 2FMUA 1UAGA 2VOJA 3A28A 3N74A 4JX8A 2WYWA 3U49A 4E0BA 1WAMA 4K6CA 2CF5A 4CM5A 1FDTA 4IZIA 4DLAA 4II2A 1PQUA 2J5QA 1JN0A 3H5NA 5DCWA 2GYYA 2WDZA 2B4QA 4OJNA 4KWIA 4BNXA 3GVPA 5K0ZA 3S2FA 3MWDB 3FN4A 3LT0A 1T2CA 4LRTB 5JYEA 2PGDA 4NFYA 5TJ9A 4XRGA 2VHYA 1DAOA 1D7OA 3GY0A 4FN4A 4FGSA 4WLEA 3KEQA 3OJ0A 2UUOA 5KVCA 3PHJA 1U5CA 1KIFA 1WLYA 3JQGB 4HADA 3VDQA 1E7MA 3GC6A 3H3FA 2W2KB 4E13A 3FPCA 4H15A 5AXBA 1UAYA 5JAQA 5HM8A 1DFGA 2V6BA 3NEPX 4ITUA 3E18A 4RLSA 4YQYA 4H3VA 5G0TA 3ZW9A 2BLLA 3AWDA 4L0QA 3ZWAA 2EXXA 4IUYA 4F45A 3GMSA 3G1UA 2HMSA 5DOZA 2QYTA 3FI9A 2R00C 1P1JA 4OQZA 4J9VA 4B7CA 1NQ5A 4I5GA 3GMDA 3LC7O 3OSUA 4O5OA 3V1UA 1NASA 5FI5A 1HE2A 2I5PO 3JQAD 4Q3CA 5JAIA 3T4XA 2ZB3A 1LSSA 1GADO 1CQJA 3ROQA 3CKYA 4IGFA 4XQEA 5THQA 1PZFA 4IIUA 4R3NA 3COSA 1LDYA 3DXFA 1YE3A 4ALJA 3W6UA 1QR6A 1P74A 1A27A 1EUCA 1IE3A 3F5SA 3TRIA 1IL0A 4CQMD 3MJVA 4E5NA 1ZJZA 4MVJG 1MXFA 3KO8A 1A4UA 3BTSA 1X14A 4Q3EA 1GPDG 1ZH8A 2DC1A 3DBRB 4NU6A 4B4VA 4DXHA 3ROKA 3JQFA 1H9BA 1BDBA 3NV9A 3F5QA 1PS8A 1BW9A 3A06A 1BMDA 5U9CA 4MP3A 3G17A 2NUAA 4EBFA 1LJ8A 3CUKA 3Q6IA 1X7GA 6ADHA 5IDYA 4HFMA 5IN5A 2EKPA 4E31A 1GQYA 3ZU5A 2O50A 5DCYA 4CQLA 4QECA 2AG8A 5ER6A 3F4LA 4FFNA 4WJZA 3QLJA 1QYXA 4WK6A 5JDIA 5JY6A 1NAHA 3I9KA 1U5AA 1BRMA 2FY8A 2HAEA 2GN9A 3DHNA 3LT4A 4YCAA 4OM8A 2QRLA 1R12A 1YQDA 4P38A 4R51A 2EHDA 3VAZA 4Q39A 2QZ9A 3EC7A 5ICSA 5AQ1A 3W4KA 2JFHA 3O9ZA 4URFA 3SC6A 1AHHA 2DKNA 3VDRA 1H94A 3B1JA 4DUPA 1FDSA 1MC4A 4I9HA 4NJOA 3QHAA 5DP2A 1I30A 2ZATA 5LCXA 5M6DA 1K5HA 4YYZA 2YYYA 1Y1PA 2HRZA 1GUFA 5DBIA 3VC7A 4BS9A 3EUWA 1OOEA 4HNGA 1HYGA 3ULKA 4QUKA 4B7XA 3PFFA 3G79A 3UHAA 3BHJA 1QP8A 2CDCA 4QO8A 3D3WA 1ZKMA 3LU1A 4INAA 1W6UA 2D1YA 4HBGA 1HL3A 1ONOA 1YL6A 4HFRA 4Y98A 3JQ8A 3JQ9C 1DIAA 2X0RA 3JD4A 2J3KA 2UVDA 3NYWA 3M1LA 3IIEA 4RLHA 3K92A 1V3VA 1Q2XA 3L6EA 3ROMA 2FZEA 1N5DA 4L75A 1F8FA 3L07A 3PIIA 3LDHA 2G82A 2Q1TA 1CQIA 4B4UA 1E7YA 3M2PA 3WQRA 4OYRA 1SZJG 2DBZA 3S1LA 4O59O 3WOHA 1ZZEA 1YBAA 4KOAA 5GMOA 1FJHA 2QG4A 3V2UA 3RVDA 1Y8RA 5ILGA 4A03A 4CUZA 3GLQA 2DUUA 1DIHA 1QYWA 3NX4A 4BKRA 5CDSA 4OAQA 2E49A 4HX5A 4J7CA 1GQ2A 3PYLA 1UJMA 4LRSB 1TA4A 1PQWA 1EQUA 2GZ2A 1GY8A 2VT2A 1HF3A 1QG6A 4D43A 4GGPA 4E2WA 3UGKA 1TB4A 2D2IA 1A9YA 2QYSA 1LXCA 1RJWA 3FNHA 3CTMA 1PJCA 2O23A 1J4AA 1KEUA 5CP8A 1H2BA 3U0BA 1M66A 3CSDA 2IXBA 1NQAO 3FBTA 5HWSA 3L4BA 1UXIA 1QYCA 4XYEA 3L9WA 3DMTA 2BGMA 5F1OA 4BGEA 5AXAA 3O4RA 3W4JA 3OH8A 2FR8A 1W0CA 2VHZA 1R0SA 2JHGA 1BXGA 3PJEA 4UUMA 1NVTA 2FR1A 1E6EA 3D7LA 4UVHA 3ZNOA 3CMMA 4I1IA 1LRJA 1XSEA 3MJEA 3DMYA 1Q0HA 3G3EA 4XJSA 4D3DA 1LLDA 2GSDA 3GG2A 2I3AA 1KVUA 3WX0A 3KOUA 4BNTA 3KHUA 5L40A 2VWGA 3AW9A 4J4BA 2D3TA 5TQVA 5L4LA 1BVUA 4Z3KA 3I83A 5G0VA 1XCBA 5KJFA 2YV3A 1VL6A 3DZGA 1V0JA 4JJGA 4E32A 1PX0A 2CY0A 4GX5A 1Q0QA 2FN7A 2G76A 2YZ7A 3JYPA 1WMAA 4Q3AA 4BO3A 1HXHA 4Y6PA 3LVFO 4R3WA 1M75A 4IQGA 3TQHA 1P1KA 3TZCA 2FPGA 3NT5A 3RUEA 3VZQA 3DB2A 3ICPA 4A2CA 1DLIA 4LGVA 3EGOA 3CZRA 3PI7A 3RASA 4IXTA 2NU6A 3GN2A 3F1KA 4QO7A 4UUOA 3GZNA 4FPXA 3JQAB 3GRKA 4B7UA 1XU9A 3LSYA 1UP6A 4DPKA 1ISMA 1C1DB 3AUAA 2V7PA 1D4FA 1QYVA 2YUTA 3ZU3A 3QRWA 5B4UA 2XXBA 5LDGA 3KYBA 2XAAA 3C1TA 5AYVA 1ISHA 4GPD1 2ZK7A 4WASA 2HK7A 1ADCA 1GYPA 2PH3A 4XGNA 4GSKA 5DT9A 2P9GA 5TSDA 1D1SA 1H93A 1CWUA 2LDBA 4GLLA 1XKQA 3DBLB 4RVDA 2Q99A 2GGSA 3RSHA 3NDIA 3ITDA 4FD3A 3ZI0A 4FB5A 3DBHB 1NM5A 3LQFA 2JD1A 3K9QO 3IJPA 1HSOA 1DOHA 4AICA 4CM8B 5AVOA 5L51A 3RFXA 1ISFA 5BT9A 1QLHA 1VSUA 5KVQA 3QP9A 4K26A 4MP8A 3MZ0A 4NBRA 4YJFA 5KJEA 5IDQA 5L7TA 5EQDA 4HUJA 4CLHA 5IDWA 5A05A 3STHA 1AUPA 1LX6A 5EINA 3GAFA 1Q7CA 1N9GB 1XQ6A 2I76A 4R54A 4Z6KA 4XQ9A 3LLVA 4LW8A 4MKXA 2VHVA 3D0OA 2ZIZA 5F3RA 2PD4A 1PS0A 4K6FA 1ARZA 4OHUA 5ILOA 1B3RA 4DGSA 5JMWA 4PLCA 1YL7A 4MJLA 2X0NA 4NFHA 4EJ0A 5IXYA 2Q46A 4XQGA 1K6IA 2X23A 4J43A 4XYBA 2AQIA 2DBRA 1VJ1A 2O4UX 1E7SA 3BIOA 3HE3A 3E5MA 3QQPA 1TLTA 1GEGA 1SB9A 4OKIA 4S3MA 4GVLA 2B4TO 4EGFA 3I3OA 4W6ZA 5G4KB 1LLUA 2FPIA 4JNKA 1DFIA 5G4LA 5U1PA 1P45A 1M6WA 2PGLA 5JO0A 2J6IA 5K9ZA 3WFJA 1HKUA 3GDFA 3CXRA 5I8WA 4WLVA 4BO6A 4FCCA 5EESA 5CEEA 3WNVA 3PJDA 1ZFNA 3R3SA 3PFWO 4P4NA 2C7VA 3PXXA 2PKQO 5DNAA 1NAIA 3PYMA 3R3JA 1I3LA 1LDNA 2Q4EA 4E2ZA 3QA9A 4NR0A 4IDCA 3GG9A 5MGBA 5BNTA 3BTVA 3ZU2A 5L7WA 1Z73A 4WPGA 4A0SA 4NBUA 3ENNA 2JAHA 2CDBA 1EVYA 3ASVA 1Q7BA 3FPLA 1YB4A 2EF1A 4W7HA 4HV4A 2GD1O 4J1SA 5KJ1A 1M67A 1U4OA 1OAAA 2AQHA 4OO3A 3JQBC 1DIBA 4E5KA 5U4QA 4E33A 5K6AA 2WSBA 3UF0A 1ADFA 3ZWYA 1D3AA 4TMFA 2J3HA 5T8KC 3EHEA 4GH5A 5KIAA 4KQWA 3AI1A 5JY1A 5CG2A 3I6IA 2E82A 3KETA 1KS9A 4UVGA 2O2YA 1I01A 1IUKA 2DM6A 4S1VA 2BI8A 4Q9NA 1JDJA 3WYCA 5C7IO 1ZBQA 2AEJA 3KRTA 4MINA 3MWEB 1XR3A 2ZTVA 4U6SA 3GGGA 4DIFA 3QW2A 4WCFB 4IM7A 4ND3A 5CG1A 3WDSA 3ZZNA 4ESOA 1E1KA 4LCJA 4ZU3A 4DC0A 2VHXA 1R37A 3B1FA 1ULUA 2H5LA 3CINA 4U5QA 1EFKA 1UXHA 1MXHA 1Y8QB 4UUNA 1LBEA 2O3TA 5JC1A 4IDBA 4UULA 1C0IA 4C7KA 1KEWA 2GUGA 5DOVA 3WGGA 4IQ8A 4LK3A 3PLNA 3PWKA 1C1XA 2LDXA 3FNEA 5JAZA 3HG7A 5B1YA 2J8ZA 2WE8A 1VRWA 2SCUA 3ZV6A 1NFFA 1ML3A 3AM3A 5JDCA 1HYEA 3RCBA 3GDOA 1LA2A 1Q1NA 4IJVA 3WWZA 1WMBA 3FR8A 1E77A 1T24A 4BV8A 1A9ZA 1ZK4A 3B70A 4GX0A 1EQ2A 4OH1A 2IODA 2W8ZA 3P2OA 4A26A 2X0JA 3QWBA 3T7CA 5A5EA 2RH8A 4RPLA 4PG4A 4DYDA 5A5FA 1P1FA 1B8UA 1EUZA 2HK8A 2YFHA 4OGWA 4UREA 4PN3A 3K30A 4F46A 4MPDA 5IFLA 2X7HA 1SAYA 4ZN6A 3DZBA 3PDUA 1A4IA 1T4DA 3KTDA 4GKBA 5G0SA 1X0XA 1B3BA 3AI2A 2HQ1A 4IMPA 4I8XA 3BXXA 3NRCA 5HBRA 1DC4A 1LC3A 5T73A 4XCVA 4WCDA 3SJ7A 1EDZA 3H5AA 3AUSA 3TFOA 2YHIA 2C59A 2AG5A 3JYLA 3NTOA 3AY3A 5IZ4A 4DQXA 3SVTA 1PSDA 4EZBA 3H9JA 4RCVA 3SLGA 2R6JA 3B1KA 5A3JA 3I4CA 3DDNA 3WLFA 3K5PA 4N54A 2PKQP 4RO0A 1WP4A 3U4DA 4JJIA 4G65A 5A02A 1WDLA 2ZB8A 2ZYGA 2JFFA 2P9EA 5LDHA 1MFPA 3GUCA 4U0KA 4CM3A 2JCVA 5IN4A 4J1QA 3ICCA 2JAPA 3OJOA 4RQTA 4GLOA 1J0XO 4BV9A 4MP6A 1EE9A 1VC2A 4DA9A 1JAXA 5BQFA 1BGVA 2I65A 3BTOA 3JD2A 1RM0A 3U4CA 4B3HA 5TC4A 3M6IA 4LCEA 4JGBA 5IAAA 3WLEA 1TT7A 4C7JA 3QV1A 1ZCJA 2YV2A 3UCFA 4EI2A 4XB2A 5A06A 2OBNA 3I9NA 3U3XA 3A14A 5A1TA 2C5AA 2GERA 4RF3A 4DMLA 5L95A 2E6UX 3AI3A 4A7PA 3WWYA 3GVIA 3DOJA 5I7VA 1UZNA 1MP0A 1S6YA 4BKUA 1LRKA 4CL8A 1R0KA 3JD1A 3GQVA 4PZCA 2GN6A 4U0JA 3OM9A 4ZQGA 3GUYA 4Z9XA 2ZTLA 4JBHA 3WMWA 2NQTA 1V3TA 5KWEA 5G2OA 1N7HA 3DR3A 2RHCA 4IPTA 4TKLA 1SO8A 4D7AA 4IXWA 5C3MA 1E3WA 3C1OA 3MJSA 1IZ0A 4XD2A 5BSGA 3S2EA 2I3GA 1N7GA 3OJFA 1V9LA 1BTOA 5JO9A 4M8SA 1ISIA 1N8KA 1I0ZA 3C24A 4R1NA 4E5MA 1QMGA 4TRMA 3BMCA 2Q22A 1E1MA 2GNAA 4EITA 2VZ8A 3EY4A 4D0SA 1BG6A 1ZUD1 3MEQA 3Q3CA 5ES3A 1TT5B 3HN7A 4WNCA 1E6WA 1I36A 3LYLA 4R01A 1NXQA 2XOXA 5TRTA 1KVQA 3GFBA 4BQRA 2Y1DA 1I5RA 4BNFA 2JD0A 4UEJA 1IPEA 3DBVO 3L4SO 4IJKA 3VPSA 1YS4A 4R9RA 4L9RA 4U8GA 4OSPA 4RPJA 4BO7A 4J1NA 5J9GA 1KBZA 4WEOA 4Z0PA 3FBGA 3LC2O 1YJ8A 4YJHB 1VL0A 4GAEA 1EMDA 1NBOA 3DZIA 4JBIA 3JQ6A 4AJPA 4CV1A 4MIOA 4CLEA 1ENYA 1A7AA 2EKLA 1FXSA 3UW3A 1UP4A 3TDKA 3JQDA 1MG5A 4BO5A 4PZDA 5HA5A 4RVFA 4DVJA 2DBQA 3WTBA 3VOSA 1KC3A 1TXGA 1GUZA 3VZPA 1U8XX 4JBGA 1UZLA 1PIWA 4CUKA 4DRYA 3WFIA 3JQCA 4D42A 1ZXBA 3WJ7A 1I10A 2TMGA 3ITKA 3H4VA 1XIVA 5L45A 1PR3A 2NVUA 3WGOA 1IY8A 1R0LA 3HDHA 4Y8VA 4YT5A 3RUAA 4PCVA 4ZGWA 3RKRA 4BKQA 2D5CA 3IP3A 1PR9A 1DRVA 1YB5A 1DC5A 3KSZO 3H9QA 2BF7A 4WUVA 1PJBA 1HE4A 1DRUA 1SOVA 3K2BA 4AFNA 3DZKA 3F3SA 3F4BA 4KDFA 3GR6A 1ENZA 2XXJA 4R1SA 3KYCA 1PGPA 3VPFA 3PGJA 1K3TA 4IZHA 3PDJA 3DQPA 1VKNA 4MKZA 1KOLA 1DRWA 4OQYA 5FFFA 1OFGA 1UUFA 1W8DA 2OGUA 3KSUA 2W98A 1BVRA 4RPKA 3H7AA 2HMTA 1WZEA 1D1TA 1OMOA 3S2IA 1JKFA 5H83A 1E7WA 1ZMOA 2BFAA 4GGOA 2J5RA 2EEZA 3FNGA 3NGLA 4LMRA 3L6OO 4CMIA 2ZYDA 1V3UA 4LSMA 3K6JA 1LQTA 1W73A 2VT3A 3IC5A 3ORFA 3RUFA 4TVOA 4IS2A 3Q9NA 4PLVA 3W8FA 3RUIA 3UXYA 4B3JA 2B69A 2NACA 3OIFA 1YRLA 4E4YA 4YJGB 3GFGA 2XF8A 2C54A 4ZRNA 4TQGA 1P3DA 3BMQB 3RBVA 3H8VA 1JLLA 1E0DA 2UDPA 1YB1A 4GX2A 3U4HA 3NGXA 4F6LA 3FNFA 2VNAA 5DF1A 3WR5A 3WYBA 4IDGA 2Q1WA 3AM5A 4YEDA 4JK3A 2HO5A 2P4QA 1ZMTA 1NFRA 4PVCA 2Z5LA 3WGHA 1A7KA 1KVSA 1J6UA 1U3TA 2ZTUA 1T2FA 2UUPA 3DMTC 1H0KA 5HRUA 1DLJA 4JROA 4PVDA 1OC4A 2JCYA 4XWYA 4Z3DA 4N5NA 4NG5A 3W6ZA 1NHGA 1GZ4A 2X22A 3WGZA 1IOLA 4KDEA 1HWYA 3OFSA 4PLGA 1DHRA 1RWBA 2YDXA 4WEQA 3W1VA 5JCJA 1FDWA 4M86A 2V6GA 3NTQA 5TGDA 3ZU4A 4WOJA 4IY1A 5JLAA 3V2HA 3S2GA 3HDJA 4PRLA 5DP1A 1PJ3A 4DLLA 4OL9A 4QFCA 5CDUA 4CMGA 4CMBA 1HDOA 1VE9A 2PNFA 1NPYA 4Z0TA 1NHWA 3VTFA 2CUKA 1KC1A 1IZ9A 1UXGA 1U9JA 2QZZA 4GX1A 1AHIA 1Y81A 2X9GA 3E9NA 3IAHA 4CLRA 2B4RO 2GASA 4CLXA 2PR2A 1NYTA 1PEDA 2O7QA 3V8BA 1MG0A 2XPCA 3UH1A 2IZZA 1NQTA 2DUWA 3GGOA 3LT2A 4LN1A 4NIMA 4F6CA 2D59A 2GRAA 3SC4A 4FJ0A 4ZQHA 5J23A 3I23A 1UDBA 2FSVA 1GD1O 3IJRA 3IKVA 4NJMA 3F46A 2Y67A 3KUXA 2CF6A 5ENVA 3QWFA 5KVVA 8ADHA 3MJCA 3FF4A 4DIOA 2AE1A 4CR7A 3I6QA 1E3IA 1A5ZA 3AY6A 2GDZA 5BNIA 1E1NA 1ZJYA 1E3SA 4L4XA 4R69A 2X5JO 4PRKA 1ULSA 1VSVA 2EIHA 2OL4A 1GU7A 1BW9B 2AMFA 3HB4X 2H1SA 3GEMA 4DC1A 2A92A 3ZW8A 1C0LA 4IBOA 1MLDA 3OHSX 5LC1A 3OA0A 3FSRA 3VPXA 3PEFA 1CIVA 1EDOA 2HMWA 3INTA 5IF3A 4CQLB 3RQSA 3WS7A 1AE1A 1O6ZA 2HUNA 2GCGA 5HS6A 1SEVA 1CRWG 4WLNA 5DDIP 1R4MB 3PZRA 1E1LA 1F12A 1DEHA 4D0RA 4LVCA 5BSFA 1T2DA 3UVEA 3K73O 4BNIA 2RH4A 4HWKA 1O8CA 5DULA 3FHLA 3VKVA 5L53A 1X15A 2CMDA 1PL6A 5HS4A 4FFRA 1G1AA 1LDBA 4K9DA 2HMUA 2CZCA 3V1YA 2X8LA 3AU8A 3TNLA 4ZHSA 6LDHA 4WCFC 1GZ6A 1HZZA 4IMRA 5JS6A 1L7DA 4YAKA 3ZCXA 2C0CA 4TWRA 1B16A 5G0UA 4DYVA 2VZ0A 1KY5A 4BNVA 5JCXA 1KERA 3LC1O 1Z82A 4FGWA 1BXZA 4CM7A 5EL0A 4BNKA 2EJWA 3NT4A 1DC6A 1UH5A 3GK3A 1Z45A 4L4SA 2DAPA 3D3WB 4IDDA 2FOIA 3D64A 2B37A 1OI7A 1ZEJA 1P1HA 4A73A 4O63O 2DPHA 3TZHA 2VRCD 9LDTA 4CMKA 3JQ8B 2X5OA 4ZQFA 4AJHA 3E5RA 2DLDA 3WXBA 1JKJA 1NVMB 4RJTA 3WG9A 1PQPA 4QX6A 2OOSA 4L73A 3AFMA 2AEFA 5F5NA 3F47A 1DSSG 3H6KA 1VPDA 1QYDA 1LI4A 2H63A 2VUSA 3RUHA 2DTEA 1GYRA 2VTDA 1B15A 2BFOA 4IJWA 3ANNA 4ND2A 3ZHZA 4NNJA 3W4IA 2PA3A 4E3ZA 1KYQA 4B4WA 4FIZA 4DPLA 3GVXA 1ZVMA 4YRAA 1Y8RB 4TRRA 1QRRA 4R4JA 3GF4A 4NK4A 3GVHA 3PTZA 2Y05A 4CJXA 3WIDA 4O6VA 4OOFA 3U62A 4ZA2A 1SNYA 4EEXA 5A9SA 3AOEA 2YY7A 5JBIA 1YH3A 4CQMB 1F06A 2BGLA 5KKAA 5T6BA 1I2BA 3RI3A 4B3IA 2VRBA 4XX0A 5JYFA 4FOSA 3E82A 2ZJ0A 3HADA 3OICA 3DFUA 1E92A 2OO5A 2PZLA 1HSZA 2AW5A 4BB5A 4EUFA 3A4VA 3I9LA 2QIOA 2PWZA 2POQX 1E3JA 4ALKA 3TL2A 2GZ3A 1I3NA 4R5HA 1DPGA 3H5RA 1DBVO 1SPXA 3NDRA 4AJ4A 2BFPA 1BXGB 4BQPA 1QXSA 1XELA 3AU9A 4RDHA 3PGXA 4GWKA 1EBFA 4YAIA 5TT1A 2Z1MA 4Y6RA 1VKOA 4AJIA 4KQXA 1K6JA 2WMDA 3FCOA 3C7CB 2YDYA 4HP8A 4UVDA 2B0JA 2Y0CA 4O0LA 3VTZA 1XA0A 1AGNA 1U2GA 4MVJI 5CAEA 5I9LA 1F8GA 5H81A 4I5DA 4Z9FA 3EMKA 3ZDFA 3AFNA 3E9QA 3VHRA 1PJLA 2VTEA 2WTBA 1LTHR 5ENDA 1VM6A 2BH9A 1WDMA 4HXYA 1Q7GA 2PY6A 3GPIA 5JDCC 1ZSNA 3H9EO 3WBBA 3EDMA 1HRDA 4N7RA 2AQ8A 2O3QA 4IS3A 2OORA 3UAGA 3GEDA 1ADBA 1EK5A 4GSLA 2Q49A 4CLOA 1XGKA 4AVYA 4BNUA 4BNHA 1M2WA 4DBZA 3PVZA 4AJJA 5JC8A 1NQOA 4WGGA 2AE2A 1YL5A 1B14A 1P1IA 4CMJA 1VL8A 4O1MA 1C3VA 1CYDA 4PLZA 3GZNB 3BMNA 3IS3A 1EZ4A 3PHHA 2DT5A 3M2TA 1K6XA 5I9NA 5KVSA 3GDGA 4E5PA 3RKUA 4CV0A 4BVAA 1E3EA 2I9PA 1EEHA 3PJGA 3PWZA 2VRCA 3NAQA 1ZXLA 4PLHA 1B2LA 4BGIA 4E30A 2BELA 9LDBA 1R4NA 4BOYA 3U5TA 2NM0A 4ALNA 1L1FA 3MJTA 3SJUA 1PJTA 1X13A 4OXNA 3VH1A 3C7DB 4ND4A 4U7WA 4NFSA 1KVTA 2VQ3A 5BSEA 3HUDA 3C3XA 1T2EA 1ZO8A 1LSUA 1DDOA 5IG2A 4RVGA 1HETA 1I33A 1HDCA 4K28A 4YJFB 3TPCA 4PFJA 1WZIA 4CM9D 4B8ZA 4IGEA 4KWHA 4OKNA 3AY7A 4CMHA 5JYAA 3O8QA 4HFNA 3OJLA 2OUIA 3UCEA 4NDNE 3JCZA 4JQCA 1P33A 4UAGA 3RC1A 2WM3A 5FI3A 3WGTA 3ZH2A 1I2CA 3EK2A 2BMAA 4IQ0A 4DQVA 4PZEA 1R6DA 3LZ6A 4WE3A 3KEOA 1G0NA 4R1UA 2WYUA 2HSDA 3QIVA 3GRPA 2ZJ1A 5DCUA 1ISGA 3F9IA 3QVTA 1R66A 1KVRA 1HTBA 4CM4A 4GKVA 1QV7A 1WXDA 3QVSA 4WLOA 3UICA 1O95A 3U4IA 3PRJA 1PWZA 1ZNQO 3JQ7A 3AJRA 3BMOB 3GA0A 4KTVE 4ROSA 2UYYA 3L6DA 4FFMA 4H7PA 3RBXA 2RHRA 2F00A 1AXEA 5CDYA 2E37A 4BHTA 4NK5A 5AOVA 3EZYA 4CM6A 4MDHA 4XR9A 3E6AA 2BD0A 1A72A 5L3ZA 3JV7A 5I7FA 4WECA 1BXKA 2V65A 1N92A 1GQQA 5IZCC 2DPGA 5DBGA 2HKIA 3HSKA 1U4SA 2GN4A 3GOHA 4NBVA 5CDTA 4J4HA 4C4OA 4WKGA 4J16A 1I32A 1NP3A 3ANMA 3AM4A 3OMLA 1AN9A 4NPCA 2I99A 1HLDA 4YA6A 1EK6A 4CLDA 1YBMA 4ZICA 3DZHA 3WYEA 5TS3A 4FJ1A 2BKAA 4KUHA 5MDHA 1CETA 3DHEA 3P7MA 3PQEA 1PGJA 4BB6A 1DIGA 1EFLA 3MTJA 4M89A 4ZVVA 2ZYAA 1KETA 4J91A 4NQZA 4XKJA 1GUYA 2QHXA 4WOKA 1DIRA 1I2ZA 1LNQA 5COAA 4D3SA 2PGJA 3CEAA 5CPFA 3T7EA 1YOVA 2ZCUA 3CZMA 1FK8A 1IHYA 3P19A 2FPPA 4HFJA 4NH4A 4OXKA 3GH3A 4TSKA 3N7UA 3E48A 3TOXA 2Q1UA 3QVWA 1XU7A 4J49A 4J9UE 1NPDA 1MB4A 4EUHA 1JAYA 4PLYA 2PV7A 1GFSA 2FP4A 4G2NA 1P31A 1JW9B 4AJKA 3RC2A 1Z75A 3GEGA 4G81A 1LLQA 3W8EA 1LU9A 5JAMA 1P44A 2G5CA 3TWOA 4CM9A 3A1NA 3TL3A 1B8PA 1WW8A 3QWAA 3HFSA 3OQBA 3CE6A 2DQ4A 3KYDA 4PG8A 3RD5A 3LK7A 4BNGA 1PGOA 2C82A 2P5UA 1Y7TA 4XZ3A 4I9UA 4BIIA 2VYNA 2Q45A 1UZMA 5COBA 2JHFA 3UUWA 1G0OA 4X54A 5GZ3A 4DL9A 1H5QA 1C1XB 4EW6A 2EERA 2D4AA 4BGVA 1L7EA 4BKPA 3NUGA 4GI2A 5GY7A 4PGFA 4JP3A 1F17A 2WEKA 1LSOA 1IULA 1IPFA 1O0SA 3PHGA 5C7LO 2WD7A 4NI5A 1GCOA 3IP1A 2FHSA 4RF2A 2JKVA 2BHLA 1BWSA 1EVIA 5FYDA 2PZJA 1U28A 3JQBA 4CL3A 5TT0A 4IIVA 2J3IA 5G0WA 3W8DA 5TNXA 2P91A 4OIMA 1GYQA 4W9NA 2X5KO 3OBBA 1ZK3A 4XRRA 3EZLA 5T8KA 3OQ6A 1FMCA 4Z9YA 3EYWA 3INGA 5L4SA 4BO4A 2YW9A 5JYDA 2VWPA 4R5MA 5JSFA 4CR8A 1H9AA 3K2EA 1YJQA 2G1UA 5BR7A 2EW2A 2VOEA 2X4GA 4FJ2A 4ZQEA 4J0FA 3KV3O 5A3VA 3GNSA 4RF4A 3CIFA 4J7XA 3JQFC 2NVWA 2RIRA 1DXYA 4JIGA 3OETA 2B5VA 1TVEA 4PG7A 2AA3A 2PLAA 5DBFA 4YBZA 3EVNA 1Z7BA 5B12A 1P77A 3JQGA 4E5YA 5TF4A 1HYHA 4WLUA 2EP5A 4A27A 1OC2A 3RC9A 4MVJM 2GZ1A 2P2SA 3HNPA 1K89A 2YHIB 4PIVA 2W2KA 4YB8A 3HN2A 4D45A 3ZWNA 5JDIC 4J90A 3GNQA 2V6MA 3VKUA 3E03A 3N58A 4A10A 5L9AA 3PJFA 1PJ2A 2HJRA 4NU5A 1J5PA 2W2LA 5JCJD 3HWRA 2HLPA 3ZWBA 4AJ1A 3E9MA 1ENOA 3AUUA 5KJ6A 1PJ4A 2EGHA 2IEDA 3ZWMA 1U3VA 1DJNA 3SBOA 4YAGA 4XYMA 2C29D 1GR0A 2I6TA 3PHIA 4QTZA 3DOCA 1ZIDA 3ADOA 1JWBB 1P0CA 4FBGA 2AQKA 2IZ1A 1ZK2A 4R41A 1LLCA 2HDHA 2IEBA 1U1IA 1T4BA 3GZ4A 3VH3A 3ZWOA 1VI2A 2BGKA 1GPJA 3TZQA 1JWAB 3UCXA 4XB1A 2H9IA 3RJ9A 4YT4A 5EIOA 1H2HA 3DAPA 3HHPA 1RM4A 3OF2A 1UDAA 3DBRA 2Y0EA 3RIHA 5FWNA 4IDFA 4J6FA 5B4VA 1F14A 2VNSA 4AJOA 1E3WB 4XGIA 2IYOA 3ZWVA 5I8ZA 1B8VA 1XG5A 1R15A 1ADGA 1V35A 1IHXA 1DJQA 3VZSA 5EMHA 1Z74A 3OQ1A 3BMCB 1WDKA 3DAFA 1E5QA 2AHRA 2WD8A 1MUUA 3GPDG 1DAPA 5TLSA 3HJAA 3GHHA 1C14A 3DFZA 3ETEA 4I9NA 2X6TA 2JCXA 3PWSA 1LQUA 5T67A 2Y1GA 4XIYA 1D8AA 2CSUA 4MOWA 3JYQA 4CM1A 2PK3A 4GVXA 4OOEA 4YVFA 1PJSA 3BAZA 1OZAA 1BSVA 4Y67A 1H6CA 2IE0A 1I8TA 4TRJA 3QWIA 3OA2A 3WGYA 3A9WA 4N18A 3D4PA 3DL2A 4QSMA 5F21A 3PHLA 4AJEA 3TJRA 5EJ2A 5L4NA 2B83A 2B5WA 3TSCA 5KNLA 1AXGA 3C85A 3ETGA 4BNYA 1NPTO 2PKRA 4FR5A 1PS9A 4EJMA 3ZNNA 2HK9A 3PP8A 1EBUA 2PZMA 2X86A 4G5HA 4FC6A 2HCTA 2YFQA 3B20A 3JYNA 4ZQBA 2Q2WA 2QW8A 2DTDA 4DTIA 2Q2QA 3L4BC 4KZPA 3GVCA 7ADHA 4DWVA 2NVUB 3RC7A 3DHYA 2Y1EA 3UN1A 4MVJH 4YAJA 1B0AA 5ER9A 3NJ4A 2D0IA 1JVBA 3H65A 5CEFA 4YTEA 1ISJA 3H2ZA 3IUPA 4RZHA 1Y9AA 1HLPA 3M1AA 4LSWA 4XDZA 1WWKA 2ZQYA 1ORRA 3I1JA 4RVUA 4YAEA 1XQ1A 3MJ4A 4ID9A 4J1TA 3I9MA 5JXWA 4BO8A 4HKTA 4UEOA 3KYCB 2C20A 2ZTMA 4MVJP 4NHEA 1V8BA 2UV8A 4NBTA 2Y99A 4YQZA 1ZSVA 4MVJD 2VWHA 5C37A 5ADHA 2VCYA 4ALMA 1HE3A 1JA9A 2Y68A 5I9MA 4RORA 2NSDA 4QT0A 1CDOA 1PJQA 1RKXA 2C2YA 4RV9A 1CJCA 1H6DA 4R68A 1EE2A 4MIYA 1R4MA 3KM0A 4CMEA 1X1EA 2EWMA 3RU7A 2R2GA 4CMIB 2Y66A 3L77A 2UAGA 1C0KA 4GMGA 4AJNA 3UKOA 3LF2A 3FD8A 4BO9A 2FZWA 1U3UA 2Y93A 2BRUA 1RM5A 3WBFA 2PTGA 2OZPA 4J4TA 1JQBA 4Y9DA 3RU9A 4BNWA 4M54A 3O26A 4I5EA 5C5IA 1Y5RA 4TRNA 3P2YA 3ZV5A 1XHLA 1XEAA 3HDQA 3R1IA 4N5LA 5GZ1A 2O3SA 4ZD6A 2J5KA 3S55A 3AOEC 4B8WA 2BI7A 3KZVA 4TZKA 3ROPA 3B6ZA 3RUCA 4M55A 1ONPA 1XDWA 4YT8A 4BUCA 1RYEA 1YONA 4M1QA 2GLXA 4RDIA 4OSOA 3RJ5A 1CF2O 3AUTA 2AXQA 5ITWA 4KP7A 2D5AA 3DAGA 4QFDA 3V1TC 4EEZA 4D44A 3TZ6A 1YWGO 3WQSB 3DZJA 1MX3A 4D3FA 4LVUA 2YV1A 4OMUA 3QWHA 4J2OA 2ILTA 1LDMA 1RPNA 4A5OA 1MC5A 3VZRA 3ETDA 3WICA 5A04A 4FSHA 1JVSA 4E2YA 3NKLA 5A4DA 1NTOA 1YDEA 3ON5A 1GZ3A 1P9LA 4JLWA 3UOGA 4F3YA 4YR9A 2VWQA 2PZKA 1H6AA 4H16A 2NU7A 4P8RA 1DFHA 1PL8A 5CHEA 3FTNA 4PLFA 2R00A 2VUUA 1UP7A 4D79A 1XWFA 2W90A 1DHTA 3KSDO 3KLMX 2FRDA 3JQAA 2GN8A 2IYPA 3IMFA 4MVJF 5JW6A 2O3JA 1EUDA 2TMDA 4L76A 4RF5A 1N1GA 1C1DA 3PLRA 4J3FA 5F1KA 1MFZA 4JXKA 3VVBA 3D4OA 3OIDA 4DIBA 4AL4A 1CEQA 3Q0EA 1U7HA 2DFDA 3D5QA 3U9LA 3O03A 2H6EA 1Z6ZA 2C5EA 2C2XA 1ENPA 2P4HX 5TIIA 1ZK1A 4CLRB 4CQMA 4BL5A 4XYLA 4XIJA 2X9VA 2CVZA 5DZSA 5JE8A 3SXPA 3Q1LA 2Y1OA 4DMMA 3TFQA 4XYGA 3GGPA 2Y0DA 3DBLA 2I66A 1J49A 3WGIA 3JQEA 4RVHA 1UR5A 5CFZA 4QQRA 1RM3A 3SLKA 4E21A 3DBHA 4IDAA 2DBVO 2NWQA 4PG5A 5EERA 4NJMB 3WIEA 1TEHA 1O5IA 4MKRA 2D8AA 4MVJA 4CM8A 3DOOA 5T5QA 2O48X 3KXDA 2IXAA 1ZK0A 3RROA 4LISA 4W7IA 4IJUA 3GHYA 3QVOA 5F1PA 5THKA 1YKFA 1RYDA 4MVJE 1Y9EA 1YGYA 2G0TA 2P9CA 1I3KA 5H82A
chains in the Genus database with same CATH superfamily
1XJ0A 3TR0A 5I7EA 5CEJA 1N9GA 4X7PA 3QBEA 2Q4BA 3CX7A 3ZNPA 2B3DA 3DL7A 2EGUA 1LK7A 5H0IA 1RJ9A 1U8FO 3IHTA 4FW8A 5JVDB 1JA0A 4KQJA 2I7VA 3HI6A 1KY4A 3L0PA 1KA9H 2E9SA 3GH1A 3H1GA 3HV2A 2P6UA 3JYOA 4GS5A 4IFBA 3WWOA 1PG5A 3O91A 2Q2VA 3IT2A 1MABA 2WZQA 1QNLA 3KALA 4G1CA 3RSZA 4CUJA 4C7VA 4D92A 3G2KA 3HBFA 4F6RB 1PYGA 3C8DA 4GBMA 3CZQA 4J2HA 4KH0A 3IQDB 4WACA 4F11A 4QHTA 3OP4A 4CKBA 4FCTA 1Q84A 1T4CB 3JVDA 1P81A 1Q7TA 3JD0A 3GI1A 3I32A 2QR2A 1V71A 4HX2A 4UTRA 3U0VA 2VP0A 4A6EA 4MUGA 3HRKA 1MGOA 1NOIA 3OQMA 3VU8A 2C7BA 3ZHXA 2NXCA 4H35A 1GNLA 3OZ7A 2ONJA 2XMGA 3WLNA 3IE1A 1QUEA 2PUTA 1SVWA 3DXYA 3WSVA 3FCYA 1QLJA 4JXZA 4ZCSA 2WJPA 3HLYA 3IIJA 4RVSA 4JB2A 4YN3A 4BWVA 4RTKA 4RQUA 1IBKB 2AXEA 5AI4A 3GNTA 1KYYA 3DZ6B 1AK2A 2HL6A 3LF1A 3LRXA 3ZDRA 4MS3A 1H1LA 5HTOA 3AUKA 3LQKA 5HKAA 4YRRA 3H9CA 3PGKA 3HWWA 3I1FA 5GZ6A 2D74A 3QU9A 1DCKA 1L5GB 1U7XA 2VEOA 3WMXA 3PYXA 2R7LA 1CUWA 2W9XA 3BB3A 3JQ9A 5JJCA 3HUEA 4GMFA 5JHHB 1N2GA 5K6RA 1W35A 4MLCA 1XLTA 1OROA 2I4RA 3PXAA 1IJKA 1DB3A 3OUUA 2KQUA 5MFPA 1XRRA 2C2HA 3PC8A 2RCYA 4XA8A 4YGXB 4BNNA 4RVOA 2Q7OE 3EW7A 4O8ZA 4ZJPA 3H3JA 3EP3B 3JD3A 5DNVA 3OHMA 3PEEA 2AR7A 3EXHC 1BHQ1 1ECCA 5A9RA 1SCUA 1N1EA 4P58A 4P1ZA 3WLSA 1NVGA 4TSFD 4YJDA 1A96A 4LF4B 4P22A 4U7FA 3UB2A 5IASA 3S81A 4LKRA 5AP9A 1XVLA 1Z17A 1K6EA 5D5QA 3BCUA 3ZV3A 5FNVB 4M7WA 4E09A 4EFLA 4J0HA 3I61A 4TMTA 2VSNA 3TECE 3EG9A 5FLEX 1P6XA 3R2JA 1YR9A 4FBMA 2J5BA 1JEJA 1GAJA 2W0SA 4RPCA 1CY7A 4LMPA 1OXSC 1HORA 3ZHYA 2B36A 1W4ZA 2JI8A 4ZANA 4AJ2A 4MO2A 4JYAB 4NU8X 4EVQA 1RRPA 2PSFA 3C1AA 4EB6B 5CCBA 2R6GA 1XF1A 1DPFA 1X1QA 2EFEB 4KR0A 5BN1A 2I4OA 3DC2A 4EPWA 1SXJA 3PFBA 4QOJA 3D6FA 3ZJUA 4WCFA 3KWLA 1E2QA 3N5CA 3W5IA 5A9SB 4BWGA 5C35A 3PPIA 4DAOA 1OI2A 2Y1LA 3EH2A 4WLFA 4Y18A 1IEXA 1B7GO 1SXJE 3UAWA 1JJIA 4IG9A 3OVMA 4P82A 3ZV7A 4PLPA 1DDIA 1KMQA 3BMOA 4HAOA 3E7FA 4NV1A 1CD5A 2BBTA 5HTKA 4UCFA 3HPQA 3WNQA 3FGNA 4BUZA 2RJ3A 3ROFA 3T1TA 1GAEO 1U2EA 1GL9B 2HA3A 3IDSA 5F4BA 4F91B 1Z7EA 3VO2A 5EPOA 1J0BA 5B1IA 1TC2A 1T1JA 3EIOA 5GTDA 1VPWA 4L0DA 4J0IA 4AAYA 5B55A 3QE3A 4YRDA 1M0EA 1SXHA 4L8VA 1Y98A 3K70D 3MMNA 3K31A 1NLFA 2ZSKA 5JZ9A 4MB0A 4KSCA 4HGOA 3HCRA 1C9JA 4CV2A 2BMJA 2JCSA 3I72A 1FDVA 2SNIE 3D7MA 1QMIA 2IYRA 4JENA 7YASA 3ER8A 3NT2A 1QC5A 3GT0A 2O3RA 3FWZA 2DVMA 4W4TA 3Q11A 3NJ8A 4E6PA 1A9PA 1P1BA 2X58A 2GQ0A 2VRWA 4G4IA 4QUJA 2CLEB 5ARBA 2ZVPX 3H1BA 1RMQA 5LOVB 1KE2A 1PYOA 3WFZA 4ENSA 3C3WA 3PEYA 1SA0A 5FOSA 2DUNA 5C7YA 5CM9C 4TZ0A 1EVJA 2JBHA 4NEQA 4KMSA 2D06A 2E1PA 5M7EA 4BNZA 1QTRA 1WNTA 4DV6B 1YR8A 4FMCF 4Q4DA 5K01A 4RPHA 3AMVA 1P4JA 2H1IA 2JARA 1ISSA 3U3KA 3KQKA 1YKSA 4O4HF 3ZY3A 4EH1A 1U28C 3F6YA 3O75A 4WSOA 4B33A 1SVSA 1T1IA 2EKDA 3LAWA 3M4XA 3OZSA 3QVGA 4O08A 4RZIA 5IBRA 1G8SA 1UXKA 3RJMA 1E6CA 1Y3HA 3ZE2B 2WA1A 3H8SA 2JEOA 4DDHA 4DQUA 3LY7A 3V7UA 1CNMA 4DYHA 2E4VA 1S2MA 2H7XA 2YNMC 5LB2A 1L5LA 2OCAA 5KYXA 1VJGA 3HNRA 4CMAA 1VLLA 5BSWA 1TNDA 2H48A 4MHTA 1CDEA 4I4CA 1N0IA 3AESB 1ZA2A 3FH0A 3G49A 2W2MA 4U2FA 4ID3A 2B92A 4YACA 1JQ5A 3CUTA 4HAWA 4D9JA 4HLNA 2X9NA 2QQ5A 1KOGA 4KXWA 4MS4B 3ZWKA 3O8OB 2GR9A 4BBAA 2XE7A 3TQQA 3RG8A 3ZQ6A 3D54D 4O4HA 3WTCA 1GGHA 3TW4A 4FFLA 1V41E 3NTRA 1JEOA 1ZGZA 3ONEA 4LZWA 3A4MA 2I4LA 3L7LA 1A9XA 4TTVA 3FBWA 3OIGA 1NWCA 3MAAC 1Y7LA 1CRPA 4L2IB 1H2XA 3SY8A 2JJYA 5AW8A 1MX5A 2W4IA 3U09A 1D6SA 1NW7A 2V6IA 2Q0XA 1E8NA 1VB3A 4EHBA 5J43A 3ZH9B 4UVEA 2WFLA 5T3YA 2XDAA 3MN1A 1ZD8A 3KR2A 2J3JA 1H1TA 1G8HA 2HHLA 2HTFA 2CL6X 3AVTA 4OMDA 4AY3A 1ABFA 1FYXA 2BFMA 4WN9B 3GRZA 3MXOA 2V7TA 1T25A 2ENUA 3KLPX 3U48A 3TPZA 1KYIA 1JPVA 4EB0A 2B78A 4EG3A 3TNFA 4QEDA 2AEMA 2XD4A 4KGDA 4YRBA 5C4GB 4S1OA 4EMTA 2G5GX 1GT91 3ZN2A 2FN9A 1TO1E 2X40A 4RA6A 4JI4B 3ZEIA 3KWFA 2WSSA 4NYJR 1Q20A 1DWOA 3UK0A 2FMTA 2NO9A 2W6CX 3KR1A 2G0NA 4KYVA 4YCBA 3D6AA 5AJYA 1NJSA 2ODNA 1BDIA 3WQQA 5BSVA 5K45A 3N70A 3E15A 1EFAA 2ACKA 1PWXA 4L6AA 5BR8B 1AKQA 4IDEA 5JFOA 2BMFA 3R0IA 4MARA 1ULBA 3T7DA 3A3NA 3UHPA 3EPJA 2PYIA 3QJYA 2B35A 1HDZA 3K6SA 2G17A 3NETA 5EWMA 1J8FA 3VFDA 1U2DA 5LUAA 1XCPA 3ONDA 4EF6A 4QLOA 1GV1A 4RPGA 5C1DA 1PFUA 5JUWA 3MOGA 1BQ3A 2ODQA 4QXPA 4HO1X 5YASA 1PZHA 1A8UA 2OHXA 4D9GA 2P6MA 3BZWA 2ZUTA 4CMCA 3MUNA 3U7IA 3D4LA 3IEUA 4LY6A 3T5TA 2P68A 4HSEA 3VR5D 4ZJUA 2UU9B 2G1PA 3M8KA 1NU8A 1ZWKA 2GF2A 3DLAA 2A57A 5JNVA 1OH7A 1KIMA 1JUDA 2OP0A 2IHYA 4C4XA 3FTDA 4PPQA 3Q5EA 1CTQA 4YJHA 3R8XA 3L0DA 3EUEA 4G5FA 2BH2A 4PYRA 2ZR8A 2RGDA 3DUWA 1M76A 1F8UA 2POCA 3MUFA 1TLFA 1GVNB 4F92B 1CQWA 3CYFA 2CNBA 3NHWA 1I14A 2FZKA 3KTAB 1GQOA 2R68A 1YBVA 1ECLA 2R84A 5J5VA 5B4TA 1T1RA 1XMPA 1V4NA 2DRIA 1FTNA 3DB1A 1QOZA 1Q50A 1ZD3A 2Y1FA 3KOZA 2YHUA 1Q21A 2G70A 4L16A 1OWLA 2Q5LA 2QVZX 4Y6SA 2BZSA 2PYZA 3PQ3A 2UYHA 3HNOA 1P5RA 13PKA 4L74A 1OZGA 1N2XA 2WKWA 3PG5A 3EIWA 4KO1S 4KUEA 5DI9A 2OQVA 1CLUA 1T5TA 3CNBA 3IPCA 4W82A 2XA9A 1ONNA 4WFJA 5TQJA 3EP5B 3A31A 3HB1A 4RL6A 3UNXA 3VHLB 4CCYB 1RNLA 3K1AA 1M2JA 2QEQA 2WWTA 2FSUA 1LC0A 2QG6A 2Y2UA 3VPGA 2NTVA 3ZLBA 3KJZA 4PHTA 4PO8A 1NBAA 1ZP6A 2EHJA 1DNPA 2W00A 2OMEA 3RYIA 3T9CA 1WHSB 3G0CA 4EYGA 2Y4OA 1VDMA 2WICA 5F9FA 2YXNA 1RPTA 2ZTHA 4TZTA 1PUJA 4CEIA 2AL7A 2NVOA 3SQWA 3M34A 1GGKA 2B9VA 3H0CA 4X63A 1SKMA 1MMFB 2FPPB 2QIPA 2VDJA 2NTJA 1ZN9A 4ITRC 3RAJA 2OMKA 3G5UA 2XSZA 3SIRA 4B5KA 4CQMB 5KNDH 3DJYA 2A1UB 1JIXA 4A8JC 4YCJA 1ZC3A 1STOA 1JMVA 4KN6A 3SZGA 3AK4A 1WPRA 1XYGA 5IAGA 1WNFA 1ZJ6A 4R1TA 4U6QA 3H0VB 1I7PA 3GU3A 4ZCTA 1SBHA 3RABA 2A67A 2WJ6A 4FOOA 2A9FA 3ZX4A 4OFZA 4EMBA 2QN2A 2Z98A 2XUOA 2W2QA 2O2XA 2X3FA 5HJ5A 4MIKA 5AMXA 5JJ5A 4FDMA 4M9RA 4DILA 5E8RA 3DTVB 5C7OO 1P5FA 4FWIB 3K5HA 4KBYA 4IIBA 4JI1B 3KYIB 3NKFA 3DOUA 2PRKA 1KEPA 3WADA 5BV0A 1YS7A 1PVOA 2IA5A 2W71A 3RK0A 3DC7A 3KYDB 1J8MF 1ODIA 2IYZA 3W04A 1U0SY 3LGSA 4XE5A 3WKAA 1KORA 2P1RA 1KBOA 4MZDA 1SIUA 3BB4A 4X62B 2Z57A 3G6WA 2C2OA 2ZVDA 4ZRMA 2X1LA 2DHQA 3HVJA 4FQ8A 4CMEC 1PNTA 3LKVA 5IJZA 2O8EB 2Z9BA 4MITA 3V2GA 2QRKA 4EI2A 2IY8A 2HIHA 2WD7B 1SBYA 1YQGA 1X7YB 2CL7X 2BCEA 1FF9A 1EM8A 3DONA 3WYFA 2PBZA 4HLQB 2C4TA 2VXOA 3L79A 4JSYA 4ON9A 1SHTX 3T7SA 3WYNA 4A6XA 5HKKA 5JRJA 3N74A 2AFIA 2IZOA 2TRSB 4FXPA 3F49S 2CF5A 1P2GA 1FDTA 5I4IA 4YECA 4O0MA 3ITEA 4II2A 5AW9A 5TMEA 1JYFA 1R5OA 3H5NA 3SZOA 2A5DA 2PL5A 3KKOA 4CHGA 4MX8A 1QH9A 2AFIE 4ES6A 4C87A 3R7SA 2Y6UA 2O6HA 4A0QA 3LMKA 1N75A 2YTZA 5J2TB 1XCOA 1DTWB 3GVPA 3K6RA 3S2FA 3F7TA 3LT0A 1YSCA 2H7YA 2XTMA 2AC2A 3AJAA 4UPVA 3SN6A 3UT5B 3THWA 2G6BA 1G8GA 2WTXA 4INJA 4DJTA 2EFJA 2XIJA 5ADUS 5BP7A 5KQSA 2OHGA 4FN4A 1DAOA 1D7OA 2XUJA 4FGSA 1FRQA 1ZGCA 2F64A 1CU1A 3HBJA 1IZ8A 2WVJA 3PHJA 1KIFA 2VNJA 4N0QA 4MRSA 4XUGB 1NJGA 5D84A 4OQNA 3BFJA 5ECYA 4QYMA 4YP7A 2EYQA 3B13B 3SGLA 3FPFA 3GPLA 4YJ2A 1E7MA 3DQQA 4BLWA 2ES4A 3MGKA 2Q5QA 3AR8A 1SCBA 1XBTA 4CT0A 1TVCA 3IKJA 1DFGA 3NEPX 4NOLA 4ITUA 1UBNA 1GGNA 3E18A 4R2MA 4RLSA 4YQYA 5DM4A 1W2HA 2QAGB 2AJBA 1QDUA 2XV1A 3D4BA 4L0QA 4DDKA 4F45A 5MF6A 5I6DA 4Z4FA 1J5XA 1U90A 2GBFA 5DTIA 3TB4A 1E3TA 3FI9A 2R00C 4ISBA 4ZIRB 4PSAA 4GBED 3RC8A 3THXB 3RAGA 4OQZA 4Y2XA 2RGBA 4ZP1A 1NQ5A 4B7CA 4EATA 2XE4A 3LP8A 4O5OA 2AJ8A 3QITA 1U0JA 3V1UA 2KLBA 5FI5A 2FH5B 2CVFA 4U2DA 3EF3A 2FA9A 4OB8A 1GADO 1TE2A 1N1MA 1TAQA 1ECBA 3ROQA 1QPGA 1NVVQ 2LIVA 3CKYA 3TVYA 5EG5A 4AZSA 4XQEA 4IDQA 4S2EA 5JYCA 2AJLI 3FYCA 5P21A 1D7AA 4R3NA 4ALJA 1YE3A 3WNCA 2YZNA 4R2IA 4HLUA 5JNUA 2UUCB 4FUQA 1QR6A 3EULA 4IZOA 4DA0A 1EUCA 1L5HB 4DIEA 4WFIA 1TJ3A 3DP9A 3DNMA 3MJVA 4KXNA 4JNCA 1DBQA 3AEKA 4P86A 3GP8A 1CQPA 5DVZA 1OIVA 4NU6A 3DBRB 4WXYB 1N78A 2BF4A 1K8XB 2OOKA 3ZY4A 3NQ41 5IJWA 1CEXA 3MPOA 4B82A 3OZWA 3LDGA 4X1KA 5CMLA 2NUAA 1OYVA 1JR6A 3OIWA 4GDMA 4L8WB 5IDYA 3DM9B 4FIDA 4HFMA 1U8ZA 5KB3A 3L8GA 5FUQA 1G8JA 2A0WA 2FQQA 2WU4A 4E31A 3QEMB 4AURA 4Q4HB 5BYKA 3NO4A 4CQLA 4FGUA 1J70A 2F1OA 4HQKA 4LGCA 1E3QA 1XDDA 5ER6A 5JSZB 4RTMA 2FHPA 2G9UA 1O0BA 1YHNA 1TFUA 2AF3C 3QLJA 3V6MA 5JDIA 3CCBA 2CHGA 3HABA 3WRYA 1NAHA 2XT0A 1G5TA 1U5AA 1BRMA 1TC1A 4MPRA 1AC5A 1ORIA 2FY8A 2HAEA 2QVXX 4KAAA 3LT4A 3TSOA 3C3EA 1KI3A 5GINE 1YQDA 3DGFC 5K3AA 5HQ3B 1GCAA 1R0XA 4Q39A 3ERCA 5ICSA 1A76A 7REQA 1H8EA 3FJ1A 2O8EA 1CUUA 4NL4H 1JTEA 3EXG2 3ES9A 3JVIA 4PTZA 4YLGA 5FD8A 3SC6A 3O9ZA 3SM9A 3VDRA 621PA 4KAFA 1D4AA 1N6NA 2BI4A 2UZAA 3INNA 4L9AA 4LV8B 4MW4A 5F98A 5CT8A 4LJ4A 2WUFA 5LCXA 1ZIXA 3CEPB 2HX1A 2OCYC 2XE6A 2P9JA 3CZ5A 1FPMA 5C5CA 2M98A 3VC7A 4HQLA 1RCUA 5B7GA 1UIRA 3AEUA 5CLHA 1IH8A 1AOXA 1OOEA 4HB3A 3RK4A 1V6CA 1OXVA 1RXCA 3FHCB 3Q7RA 2XMPA 2ZIGA 4KOEC 2ZIXA 3PFFA 3W6NA 4UHFA 3ZE1B 1XRLA 3VC2A 4QHSA 1QP8A 1RHKA 1NIJA 4X9XA 3TS1A 2PIAA 1UFOA 1W6UA 4HNQA 3KVYA 4Q4AB 1K8ZB 1T36B 5CJ2A 5JI2E 4HBGA 1O7JA 1W2GA 2H4JA 3MSXA 5BR4A 4PC2A 3RO7A 3JQ8A 3R7FA 1DIAA 2X0RA 2ZSEA 4DRZA 3KSAC 5CDHA 3IIEA 4FUTA 4FMBB 4JWTA 4B46A 3L6EA 1DCMA 4JJKA 4L75A 4Q3OA 1KU6A 3LI2A 2K7FA 1SOMA 3IMKA 1EVEA 1FRFS 1NF3A 2QN8A 2HYDA 3UWDA 1U2GC 5C18A 4LY9A 5HXAA 1VGRA 1CQIA 4B4UA 1E7YA 4HQ6A 4JBXA 2QPOA 4OYRA 5IDXA 4LNUA 4RWEA 3S1LA 1X1SA 3WOHA 3MGCA 5J2UF 1VHDA 2W70A 3O8RA 2XDWA 1M7HA 4QUGA 2NNWB 3RVDA 4CGZA 1E1QD 4XFKA 3AVOA 2DUUA 2RGWA 3QF4B 4BKRA 1YU9A 4OAQA 3T5GA 1SVOA 3VPDA 2QP4A 1GQ2A 1X7WB 2AZXA 4MQ5A 1XTPA 4YIKA 2Z2ZA 4LRSB 4O1HA 5AM5A 4F2PA 3QKRB 5LQRA 4W5NA 2OG1A 2R1UA 1GZDA 1QUFA 4M0CA 4M9ZA 1TKCA 2QRNA 2VT2A 4D43A 4E2WA 1L6RA 2M32A 2WF7A 3CO5A 3RVNA 2ZJYA 3CJQA 3UGKA 4F60A 1X9IA 2D2IA 2BE7A 2ON6A 5GQSA 3SKYA 3DBIA 3FRIA 3S4YA 4IF6A 5AVRA 3CTMA 4FYVA 5KX5F 2F3RA 3O4FA 1G3RA 5J2UA 1J4AA 2YVLA 1UT6A 4GPTA 1P2DA 3HSYA 5CP8A 2FU5C 4IQFA 1SXJD 3U0BA 1PV2A 3EPKA 3P9CA 3HVHA 2ZG6A 4L3VA 4MUJA 1QQBA 3H5LA 1OKKA 1S8FA 1OYYA 2NSYA 4LS3A 3UGTA 3SZ3A 4KYUA 2QBYB 2OD7A 2BGMA 2VI5A 1Z36A 4H7KA 5DB4A 3O4RA 2J9RA 1BXGA 3QV2A 4UUMA 2GT1A 4WZAB 1E6EA 4UVHA 1U9ZA 1G7CA 3OOWA 1D5WA 4OYHA 1ZDMA 4TYMA 5CNMA 3WLPA 3D4IA 1MVOA 3BD7A 3G3EA 2NUPA 4G8BA 2J6CA 4LI0A 5D3MA 3GG2A 2I3AA 1NF2A 4UHJA 3KOUA 4BNTA 3PX7A 3KHUA 1T10A 4NZZA 1ZN2A 4MUYA 4EOGA 2AG6A 1B0PA 3MJDA 2IBTA 1CUGA 3ZDAA 4J4BA 4OMFG 3M81A 1VGQA 5KX5A 2W6MA 4G5YA 4EQ6A 1DQPA 1O94C 2B98A 1F8YA 2WOOA 2ZUWA 4KKXB 2NUTA 3H2BA 1M33A 3P9SA 4RULA 4V0QA 1L1RA 3DZGA 3S1AB 2HHAA 2VF7A 1XD9A 1Q0QA 2HRRA 3JYPA 4GU5A 4BO3A 3SDSA 2IYFA 4P4TA 1RMYA 4WNAB 3TZCA 1HFEL 1Q91A 1FYWA 1ZL0A 5GM1A 1HOTA 3NT5A 4ZDWA 1OFUX 1THGA 3DB2A 3ICPA 3Q7IA 4DMCA 1UKCA 4A2CA 2IU4A 1DLIA 2YMMA 3A6GA 1TU4A 1KZGB 3FPGA 3K8QA 3L04A 2NU6A 4PZYA 3GN2A 4ZCRA 1Z9BA 1EFUA 4EW3A 3NBXX 1VRVA 3DE4X 4HGPA 4UUOA 2GM3A 4FPXA 3N5KA 1AKUA 4D2IA 2YWBA 4TLLB 5EMJA 1XU9A 3LSYA 1AG9A 4INZA 1UP6A 3PU6A 4DPKA 1ISMA 1C1DB 1THTA 2ZRMA 5CB4F 4C6RA 1N0HA 3DAOA 1N2EA 3DCJA 1CF4A 2Z5FA 3ZDCA 3TNJA 1OX5A 2WHQA 2PDAA 2A2ZA 2VJBA 5LDGA 2XCUA 3KYBA 2MR6A 2WIGA 3H2KA 5AYVA 4EKNB 4PCUA 2M1XA 1KJJA 1GYPA 2PH3A 2YC2C 4BDTA 7ABPA 4G8CA 4M1ZA 3RQIA 5K05A 3IUEA 3IRUA 1SXIA 2P9GA 1D1SA 2ZVJA 3LVQE 4IEEA 3EZ9A 3NCHA 1NXPA 1E0SA 4LC0A 4RLFA 2QLMA 2DQSA 5IH3A 4D3ZA 5ALVA 3VNUA 4EIWA 2Q99A 2VT7A 1ESEA 3RSHA 2X9LA 3C16C 3ITDA 3QNWA 2YFKA 4AF7A 1BWRA 3MYYA 3VXKA 4C78A 4Y6QA 3DDCA 1V3QE 5MGNA 1RQNA 1OX4B 5HIKA 2FZLA 1V26A 4N41A 5F2EA 5EJ6A 3LA8A 2ID9A 5DYGA 3N87A 4L8YA 4C7BA 5CB4A 1JKJB 4QDUA 3OFNA 1QLHA 2JW5A 5KVQA 1SG6A 4MP8A 4RZUA 4NBRA 5KJEA 2AG1A 3Q6NA 1JFFB 5L7TA 2I78A 5IDWA 3REFA 3VR4D 4X6UA 3QOXA 1AUPA 1V4BA 2I7XA 5EINA 4ZOLF 1JLMA 5FPTA 5AW2A 4S05A 1DEXA 1N9GB 1Q7CA 2QX4A 4G4SO 2XWSA 1L1QA 2QORA 1UPFA 2JGKA 4GM0A 4LW8A 5CLLA 3ZS8A 4GNRA 2VHVA 1N6RA 2ZIZA 3A9UA 1JLRA 2PD4A 3D0OA 2R47A 1ARZA 1AKVA 1RJ9B 4X91A 5DK6A 1CZHA 3KAKA 1M83A 5REQA 3VOTA 1ML4A 2JCBA 1SUCA 3DWEX 1ADJA 1GQRA 3OKCA 5DW3A 5FA6A 4DGSA 5JMWA 1W4CA 2EWVA 1MABB 1M1YB 4OP3A 4I6GA 4HWOA 4KQIA 2F2TA 4MQEA 4XFDA 5IVDA 1E4YA 5M3BA 5FBVB 2ZYUX 4J43A 4XYBA 2PX8A 2AQIA 4LNHA 2DBRA 1VJ1A 1E7SA 1N8SA 3HE3A 1DCFA 1GKUB 2XCOA 2FCAA 3AIIA 4QDZA 3HXQA 4I50F 3OX3A 1Y8AA 3CURA 3H1AA 4MLZA 4NOKA 1KQPA 2B4TO 1FYVA 2WFZA 3LZDA 3I3OA 4W6ZA 1XU4A 3ZDYB 3IA2A 5HOQA 3WO1A 4ZOLA 3ORRA 2AMVA 2FMFA 2WSSD 1YMQA 3SFVA 2WFAA 4GXRA 1JR2A 3AR2A 1GSHA 3OE1A 4EB8A 2XBMA 2HDOA 2OC4A 2PGLA 1CHDA 3FE2A 3OI7A 1O5TA 4JL5A 4MCHA 3GUVA 4RH3A 4C4RA 3WFJA 4Q05A 5EIXA 1VXOA 1KJNA 2H1FA 3EZ7A 4U2EA 4TWZA 1OW3B 1NT4A 1Y6RA 2XE8A 3CLTD 1J00A 2ZAOA 3ORHA 3PL1A 4ZEWA 1R6XA 3TR6A 4MS3B 1H1LB 3PJDA 4NSNA 4P54A 1YNSA 2W2NA 3PEVA 1TM7E 4P4NA 2AMJA 2C7VA 3BE8A 1ZUHA 3TEJA 3V8QA 4CXMA 3PXXA 1F1JA 4MQUA 5B53A 1P4AA 3TX2A 2HCBA 4C6TB 2CXQA 4I50A 2FPKA 2EBWA 4P5PA 1WU7A 4Q19A 4BQSA 3IUBA 3ZY5A 1RWKA 1T9HA 3QA9A 2Z1DA 4FMPA 3IELA 4NR0A 1GPNA 4PEVA 5HF6A 4DHEA 1QHNA 2LZ0A 3EBPA 3GG9A 2JFXA 4OU5A 3MRTA 4MICA 4P08A 4R8VA 4DQDA 1IBMB 4NMWA 1GTG1 5L7WA 1SCUB 3A1EA 2GSWA 3VPAA 4TTAA 1GFZA 2EX4A 2ZAGA 2MIIA 1Z73A 1Y1RA 4EF5A 3KOMA 3ENNA 3P9XA 2VL7A 4J1SA 2Q41A 4TTSA 4CE6A 5HDBB 3HZHA 5BV7A 2ADOA 2Y6VA 3OESA 4BX3A 4EYSA 6REQA 3O0DA 1USUA 3JQBC 1VBFA 2IIBA 2ZR9A 5U4QA 4MZXA 1AU9A 1JIQA 2JA1A 3I05A 4GR9A 1ANKA 4UC0A 1Y5LA 1ADFA 1Z16A 3BQMB 3EG9B 5DBEX 3ROEA 1VJDA 1PD0A 3EASA 4TMFA 4H7HA 1KJIA 4M0DA 4TSRA 4URZR 2HCJB 4WXEA 1N6HA 3EIXA 5HRCA 1VP3A 4YQFA 5HKBA 1V7QA 4DMRA 3KETA 3D3QA 2PWYA 4NYIR 1I01A 2OCPA 1TECE 1VPVA 4S35A 4NICA 1NN1A 2GWHA 1YTUA 4LYHA 4AI6A 2VHJA 1ZNXA 4QGGA 1XAJA 4ER5A 4JU9A 2BR5A 1SXJB 5AESA 2PVSA 4WCFB 4L5AA 5FAXA 3UC5A 1J99A 4OAOA 4ND3A 1PTJC 4FVTA 4M9CA 1I80A 3FTQA 1MJ5A 4GYYA 1E1KA 3K4QA 5TXGA 1AUOA 1NW4A 2VHXA 3PPYA 1K8QA 2FEAA 2WWHA 1UJ6A 3V33A 2ZJ3A 2H5LA 1Z08A 3CINA 3P4XA 1EFKA 4KV7A 1XAGA 4RKRA 2WF9A 4ECEA 5JC1A 2JASA 3H84A 1WZNA 2QTZA 1TQHA 2QN1A 3LXRA 5IHPA 4Y7CA 4A6PA 1KEWA 3BH0A 3IIMA 4EHDA 4TLDA 4X6LA 5C32A 1K8YB 3RRXA 4LK3A 3PLNA 3S2ZA 1V8FA 2GRJA 5K2MA 2KBFA 3VSBA 4D3XA 1UXOA 2PEYA 4WY8A 4LHEA 1RE0A 1JDBB 5D7NA 5K3EA 2WE8A 4IOLA 3ZV6A 4BBJA 4U7GA 5JDCA 5BRJA 5LQKA 1NURA 3CY6A 5FPQA 3RCBA 3GDOA 1LA2A 4DUGD 1QC5B 3LT5A 4KQHA 3LQ2A 4NCKA 3WWZA 2FG6C 4K6MA 3FR8A 3HVUA 4BV8A 5MHTA 3FOEC 5EQTA 1QK3A 3LCCA 1WW3A 5C52B 3FUWA 4YUXA 2RJOA 4TVKA 4L9SA 4DQLA 3QKIA 2O57A 1BE6A 1SA0B 1ODFA 1XO1A 1V45E 9ATCA 2LV8A 4B80A 2IUEA 4IV0A 4PHFA 3OCXA 3HJCA 1LFDB 1MRSA 3T7CA 2OCLA 3PBKA 4QHYA 3VR2D 3WB0A 4PG4A 2FPUA 2COUA 1B8UA 3LYAA 1X7ZA 2HK8A 3NHFA 1B8NA 4KEAA 2IITA 3AXTA 4ML3A 3TLYA 3IUNA 4MTLA 4OD0A 4CLOB 2QRVA 1QJCA 2EL7A 2J1LA 1TMYA 2ONYA 2XB9A 4YLEA 1QH0A 3V7WA 2EC5A 3X1KA 5MN5A 2X7HA 2EFYA 4M7OA 4AD8A 3QVGB 5K0CA 5I9SA 3BD9A 4ZN6A 3OC6A 4BZPA 5C8XA 3PDUA 1A4IA 1SUEA 3AP2A 3NONA 5HSGA 3G2OA 5G0SA 4KI0A 3DXXA 1G21A 4IMPA 1TO6A 3LE8A 4FN5A 4E1AA 3BXXA 1WCIA 4FGJA 1TW3A 1DC4A 1IN4A 3GXOA 4XCVA 4HAIA 3NBKA 5HBRA 4BBPA 5KYXB 3C74A 4KO4S 3SJ7A 3TXAA 4CZ2A 3H5AA 4FD2A 3TMAA 3ZDQA 1QQ6A 5ADWA 4YCMA 4TYNA 2C7QA 4P7KA 4GKJB 1G21E 3H8WA 3AY3A 4NXMB 1WP9A 4WXMA 5A0FA 1MF7A 3SHFA 3UC9A 1NDUA 3ZCUA 3DH0A 4I4NA 3B1KA 1XTKA 2QT9A 2L2QA 3DDNA 1G5HA 5EE0A 4N54A 1TCCA 1W29A 1LJLA 1VJCA 2X42A 4RO0A 4O4HB 4B2LA 2QJTA 1E1YA 5DHFA 3DDOA 4G65A 2ZYGA 4Q9HA 4Y2PA 1KDZA 2JFFA 3FUVA 5DHRA 4Z7QB 1UEJA 2JI4A 1MFPA 1A9XB 2HY7A 3G82C 3PUYA 1Q17A 2JCVA 4Q7KA 2H1OA 4M0EA 4PBTA 1GGJA 4B44A 3FJOA 2BFNA 1VC2A 3EDYA 3OT5A 4DA9A 4UOQA 1JAXA 3QPUA 2ZYRA 6NULA 4G85A 2WFLB 1RM0A 121PA 4WTOA 2A1TR 3BC1A 1G291 4LCEA 3B82A 5TC4A 3RSLA 4C7MA 1TT7A 4MEJA 1GPKA 1X1DA 3GNLA 3UBMA 3K4PA 2OBNA 3I9NA 3PKZA 4NYMQ 3U3XA 4AXXA 4RBNA 2IV3A 2GERA 4C0QC 3JRWA 2Y1XA 2MCFA 2E6UX 3KXLA 4DMLA 4LYEA 3C5CA 1QS0B 2AHOA 2B1JA 3VR6D 5E3HA 2ZREA 4UM7A 4WD3A 1S6YA 2GTIA 1H85A 3FNQA 1C81A 3KUUA 3ZHOA 3GQVA 4ZQGA 3FB1A 5B58C 4Z9XA 4CIWA 3GUYA 1J23A 3IBTA 5DT2A 3DMFA 4F56A 3DR3A 2N3ZA 3P4YA 3EWIA 4ZK2A 5C3MA 3HJHA 3U44A 2PZGA 4NKRA 1V11A 4XD2A 4CBVA 2IEAA 2I3GA 1NL3A 5JJLA 2MSCB 2ZAMA 3FTFA 1A2QA 4GM4A 2D5IA 1ISIA 1N8KA 1I0ZA 4R1NA 3ZGVA 1YCFA 4UNRA 1REQA 2CXXA 4GPZA 3K6SB 5EWMB 1W8IA 3C41J 2VZ8A 3I01M 2PX5A 4Y2TA 2QL5A 4JA2A 5H80A 2P3QA 3LYLA 3L8HA 5IC4A 1TQ2A 1NXQA 2XOXA 4LRWA 4ER6A 3H5WA 3CUEF 4YMSA 4BQRA 4GP7A 5EHNA 2XUGA 5EC8A 4UEJA 1KWKA 1IPEA 2BEWA 5CFOA 1Z34A 4Y30A 2PX2A 1VCIA 1YS4A 2QLBA 4QPZA 4I6EA 4MJ7A 2I1QA 2XUDA 2DY1A 1NNLA 3L6UA 3RTBA 1KBZA 2H4WA 2P0YA 2VIIA 3OPNA 2JLXA 5ICGA 3FBGA 5DHQA 3WHLA 2JFNA 1ZLXA 4YJHB 3LHKA 2V9CA 5DXAA 3USES 1CPYA 2DYKA 3D2BA 5BMVB 3QLVC 4FFSA 5LZ8A 3CR7A 4AJPA 1RZRA 1MJGA 4MIOA 2C3OA 4KXUA 3UMGA 4CI9A 1MAUA 5K8CA 3TZHA 3UW3A 3ZE8A 4BLVA 2I9KA 5KPDA 2WNSA 3KFXA 5GGYA 2OSVA 3JARA 2DBQA 3WTBA 4KFUA 4H3KB 4ZVLA 4AMVA 1TXGA 2WJHA 3ILYA 1H8ED 1U8XX 1F5SA 2CNNA 2JS7A 1T0BA 3FG9A 4JBGA 5IMBA 1PSZA 5CJJA 4EPVA 1UZLA 5BUSA 3JVUA 2P78A 3DAYA 4FM9A 1B6RA 1EI9A 4EI9A 1LS1A 5DLYA 5FR2A 2J3MA 3WFIA 3AH8A 3TIIA 5FUMA 1EH5A 3QEOA 3H4VA 1XIVA 5JD5A 1YDGA 2NVUA 2ZS9A 4UW9A 1C9MA 4ZYYA 1I51A 4GYKA 1OI4A 4KODA 4U2GA 4FSDA 4ZREA 3RYIB 3VAYA 4ZGWA 4LFBB 4IWNA 1VLMA 1SH7A 4CFYA 2JGRA 4RY9A 4CEIB 4K9MA 2WZDA 4I1RA 4YAWA 1HURA 3H9QA 4YRTA 2WVGA 2VKTA 3J81k 4X44A 3K8YA 4JGGA 4X65B 4EGQA 1BKYA 4RHUA 5IEBA 3I2JA 4R1SA 4R8SA 4YJ3F 5IU6A 1HUQA 4MW5A 5CK5A 4JYZA 1IXKA 1MEJA 3PGJA 3V3TA 4IZHA 3PDJA 3DQPA 1DRWA 2M6KA 1BQ4A 4XWOA 3BBPA 4FW9A 4GI7A 1NXWA 1T5HX 3DKRA 3E3LA 4QC2A 3UGJA 3A6DA 1B0ZA 1U0NA 1ZZGA 3SICE 1OMOA 4L3WA 3GD5A 1HG1A 3ZGOA 3NVMB 2H5JA 2Q6OA 4GGOA 4QOGA 3LY5A 2WJAA 5DRTA 5HCUA 1U0TA 3SPXA 3L6OO 4UE3S 3T95A 3ZWQA 5JS7A 1V3UA 1M72A 2WHPA 4DEXA 3K6JA 5E7JA 4UAJA 4DIKA 1GRRA 3IC5A 3JAKA 3ORFA 4RHTA 2C99A 3FYTA 4MA4A 3RUFA 2QROA 3I2HA 1T8TA 4X8LA 3L2OB 5GPBA 4YJ3A 1JHMA 3HKEA 3RUIA 1C2TA 1G20A 2VDQB 3LGAA 1WCWA 1FL9A 3ND8A 3UXYA 4B3JA 4G1MB 4C7JA 4ETIA 4RSRA 3HYTA 2YQZA 4M6WA 1NMYA 1R0WA 1A7UA 2ZBFA 3P9QA 4GR5A 4L6IA 1V1MA 1S8NA 1UPBA 2AOUA 3GFGA 3CTPA 4RH0A 4TLMB 4DUZB 4MDEA 2NO1A 1MZVA 3LHSA 3FRHA 4ZJYA 3P0FA 1G20E 4L5CA 4KR6A 1GGFA 1UPAA 3WLRA 1E0DA 1KXJA 1WA5A 4Q21A 1KYWA 1EM8B 3U4HA 3IIKA 4F6LA 5LKAA 2VNAA 3Q87B 3WR5A 5DU2A 1LKZA 1Z88A 4IDGA 4G0NA 4OGFA 2VF2A 1C50A 5LWQA 4ZCIA 5I5EA 2AFIB 1ZMTA 1HTWA 1F6BA 2JFVA 4PVCA 2OT3B 1A7KA 3WGHA 3ZW7A 2AH5A 3TQSA 1T2FA 1PD1A 2BGJA 1M34A 3THSA 4A8JA 1YK1A 2UUPA 2VPXA 2XCRB 1HLGA 4II7A 1JG4A 1H0KA 1KYVA 2CXSA 1CZLA 2O52A 2WAMA 4KXVA 5KMGA 4KRGA 4OATA 1VMKA 2R66A 5IHXA 2HJ9A 1M34E 4QSHA 2NGRA 4HNUA 2HDNB 4GO1A 2JCYA 3B3FA 4XWYA 3QUQA 3THWB 1KYZA 3I92A 3PUVA 1I72B 4RK0A 2X22A 4PLGA 4OXQA 4YCCA 2ZE7A 1JJFA 1RWBA 3HCFA 3KZMA 2ZDGA 1L8QA 1E9EA 4D8UA 2RKOA 3QYFA 5KWJA 4OYYA 5BN3A 1WQ4A 5AK5A 2V6GA 3NTQA 4LXTA 1E3DA 4YJ2B 3U37A 4ISCA 2HSWA 1KYXA 3LOUA 3V2HA 2MHCA 5LLTA 2I8CA 3WGNA 3ICQB 2B1GA 3V4ZA 3HDJA 2WT8A 1KRXA 5DP1A 3AT1A 1KMCA 3OZFA 4QFCA 1QV9A 5IDVA 3K0BA 2P2CA 1VE9A 3P32A 1NPYA 5TMPA 4E88A 1MAHA 2BEVA 1UXGA 2GM9A 1TM3E 1YE5A 1N5JA 4GX1A 1UANA 2V98A 4DFDA 4CLRA 1LS6A 3ER9A 2B4RO 2PLNA 4QM6A 3NIWA 4AKTA 2PL3A 3N6XA 2HC9A 4LWQA 2FK8A 2GK4A 3GUHA 1MG0A 3OZUA 4UM9D 5SZKB 3AINA 2DUWA 3SS8A 3GGOA 4LN1A 3EP7B 2NMVA 5CXUA 1D0IA 3UK1A 3O1IC 1Z37A 3SC4A 1FFXA 2BN4A 1NVEA 3ZHUA 4MLPA 1NBHA 4GWLA 2Q5EA 2YRXA 4IH4A 2PS3A 3L43A 4NJMA 4G1UC 3F46A 1I7LA 2Y67A 3KPJA 4CCSA 5H02A 1QAOA 1F20A 1EUCB 2GVDC 3AL2A 4OUDA 3ZOZA 3GWZA 4QBFA 1BXRB 3MJCA 3I76A 1SCAA 4LV6A 2AE1A 2O06A 3C6QA 4L27A 4RFSB 3GROA 3AEKB 4JLPA 1MB3A 2FWIA 3SI7A 3T4UA 4L4XA 2QKYA 4ZI5A 1KU0A 1NBWB 2IDJA 2H07A 3HDVA 3HI4A 3OBIA 3WYGA 1NM5C 1ULSA 1VSVA 1JQAA 4JSTA 2OL4A 1GU7A 4A2WA 3HB4X 2NUAB 3GEMA 4DC1A 3FPBA 5DLEA 3FOZA