3V2UA

Crystal structure of the yeast gal regulon complex of the repressor, gal80p, and the transducer, gal3p, with galactose and atp
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
421
structure length
409
Chain Sequence
AAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRALDPGYDAGKEIMEVYHLRNYNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 137
structure length 409
sequence length 421
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3v2uA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2uA01
4TKLA 5KVQA 3D4PA 3EDMA 4JJFA 5JYAA 4N5NA 4ALMA 2B36A 4XRGA 3MJ4A 1ENOA 2D8AA 4PLYA 3MTJA 3T7CA 2ZTLA 3OH8A 2P4HX 2Y05A 3MJSA 2VUTA 4XB1A 3BMOA 4MKZA 3OIGA 2CVOA 1DOHA 1X0VA 4AFNA 4OXYA 2HKIA 3BMNB 3WGQA 5C7OO 3D4OA 4MIEA 4YTEA 3NUGA 3W4IA 4R1SA 1I30A 1V3VA 1Y1PA 3PHJA 2CZCA 4TVBA 4XCVA 1LX6A 2PV7A 2D1YA 5DBFA 1HXHA 3DB2A 2O2SA 1L1FA 4IXWA 3GEDA 1NX6A 4DQVA 4CM8A 1Q7BA 3K9QO 1P77A 2H1SA 1LA2A 1GYPA 2WD7A 4Z3KA 2QZZA 3QRWA 4B4VA 4RVHA 5CEEA 1UUFA 2RHRA 3S2GA 5IZ4A 3KHUA 3GHYA 3EK2A 4R01A 1N8KA 5K6AA 1DO8A 2PLAA 4J6FA 2OBYA 2WDZA 4HBGA 2Q1WA 3RUDA 1IPEA 1DIRA 1KETA 2DPHA 4E21A 3WGHA 5A3JA 3PJFA 4IDBA 3KZVA 1ONOA 4K6FA 1D4FA 3GVIA 5T57A 4W7IA 2F1KA 1UZMA 4FPXA 3WYBA 1E3JA 2BFOA 1RM3A 1ISJA 2D59A 2NUAA 3EMKA 3KYDA 2I5PO 3FR8A 4W6ZA 4CLOB 3TFOA 3K73O 3VC7A 3VH4A 2J5KA 3CH6A 3OJFA 2DC1A 4MIYA 2TMDA 2X9VA 2GN6A 2PGDA 2O4UX 1P45A 4CMKA 2Q1SA 3GVCA 4RF5A 4BOYA 2VHVA 4HNHA 1VM6A 4NIMA 4D42A 2PZJA 1DAOA 5F5LA 4KDFA 4JP2A 3JYLA 3KLPX 4BUCA 4ONEA 2AXQA 4PLPA 3RC2A 1YB5A 4ZGWA 1KVRA 4C7JA 1J49A 2C54A 3BMQA 3JYPA 3ZU4A 4LMPA 4GI2A 4J16A 5ITWA 1XU9A 4Y8VA 2GZ2A 3M6IA 1SEPA 3Q2KA 1E77A 3HNPA 1ULSA 1F8FA 3G49A 3KLMX 3N74A 4FJ0A 3FBTA 3ASUA 3JQAB 2ZTVA 5DOVA 1A5ZA 4AJ4A 4PG4A 3I9KA 2V65A 5I8ZA 3SJUA 4CV1A 1T1SA 1HF3A 3QVTA 3RBVA 1PS8A 1ORRA 2WYWA 1PL8A 1LC3A 2VNSA 1X7HA 1T25A 3IMFA 2VWGA 5B4UA 4WOKA 1ARZA 1E7YA 2DUUA 1ZVMA 4DL9A 1UP7A 1DHRA 1EK5A 4W9NA 5THQA 3E6AA 3N58A 3RFTA 4IPTA 2A9FA 2DVMA 4BO5A 3V1YA 1O8CA 1KEVA 2ZB3A 3K30A 5DDIP 2X86A 1XGKA 5JAZA 5GMOA 2X5KO 1LRJA 3FTNA 4R9SA 5I9LA 1N5DA 4B7CA 1NPYA 1GZ4A 1P0CA 5KJCA 2NU6A 5KCZA 4ZQFA 2GN9A 2NADA 4QFDA 2QRJA 3DXFA 1QV7A 1GCOA 1O0SA 1SZJG 1CRWG 3D4NA 3LLVA 1KOLA 2DM6A 3HFGA 3GDGA 1Q0LA 5K0ZA 3VPSA 2VWQA 4XYLA 5CG2A 1YS4A 3QY9A 5TNXA 4Z0HO 1QLJA 3FRJA 3I4FA 5MDHA 3ITKA 2PKQP 3A4VA 1GV1A 2TMGA 4QEDA 1U8FO 4WEQA 1C1DB 1MXFA 4W9NC 5FYDA 2VYNA 2HLPA 4XGIA 3S1LA 1EZ4A 1LDEA 2XXBA 3SXPA 5COQA 1PJBA 2OP1A 4FJ2A 4UVHA 2ET6A 1UP4A 3UKOA 4IJWA 3V2GA 3JD4A 4ND5A 2BMAA 3OQ6A 3GFBA 4RORA 1QG6A 4ZN6A 3D3EA 1NAIA 1ISFA 2O7SA 2RAFA 3DOCA 3PGJA 4GX1A 3HDJA 5KWEA 3IJPA 5C7IO 2Y1EA 2JFGA 2O7QA 4OL9A 5IAAA 2HRBA 1YBVA 2OXIA 2IEBA 3PQDA 2ZIZA 1I0ZA 4R1NA 3VVCA 4UUMA 1DLJA 4Z9FA 2OO5A 2CF5A 3VH3A 3ZN2A 5IN5A 3FD8A 3UCEA 3TOXA 1U2DA 3F1KA 5CPBA 5EESA 1MXHA 3KYCA 5G0VA 4BO6A 1BHSA 1YOVB 3NDJA 1HYEA 2EKPA 4H16A 4O6VA 4JX8A 4WLEA 5HRUA 3I9JA 3GPDG 3ANNA 3AOGA 3TRIA 1XG5A 4IY1A 4XDYA 4HADA 3QIVA 4P4NA 5I8WA 3DR3A 2FR0A 4JCOA 5JO0A 3VH2A 5THKA 5FFFA 1KERA 4Q3AA 4DLLA 2W4QA 3C1AA 4DMLA 1P1RA 2OGUA 4IIUA 3BHJA 2DPGA 3EVTA 3WGIA 4OQYA 4XR4A 3WBFA 2ZTMA 4DTIA 2HU2A 4Y6SA 1A9YA 5ENVA 4EZBA 4GMFA 1TEHA 2ZQYA 3S2EA 4P4GA 3IP3A 5A05A 1JW9B 4K28A 2BLLA 2QRLA 4CUKA 3QLJA 4YJFA 3P5SA 1P0FA 5FF9A 1YQXA 1HE5A 3ETDA 5IXYA 4EGFA 5JS6A 4DPKA 1ZKMA 3GAFA 2VOJA 2UDPA 3JQ8A 5F3RA 3M2PA 5TRTA 1GU7A 1GADO 3VPFA 4BGVA 5BSEA 1XCBA 4A2CA 4WE3A 5TIIA 3H5RA 3LQFA 3EC7A 1LLQA 1KS9A 4NI5A 3DHEA 4R54A 1UR5A 4BMNA 2PGJA 1YL6A 3M1AA 4E33A 2AG5A 4LRTB 4RVGA 3WTBA 4A03A 3R0IA 4RLSA 4HP8A 4I5FA 1X1TA 1UDAA 2PY6A 5BSGA 1U3VA 1LRLA 3QWHA 3IKVA 4I9HA 5CDUA 1ISMA 2AEFA 3TL3A 4OHUA 2B5VA 5AQ1A 1LLUA 1R66A 1LXCA 3LDHA 4AJIA 4FFOA 2I3AA 1Z7EA 2C5EA 3WGYA 2AW5A 2V6BA 2YQ5A 1NM5A 2RH8A 4HKTA 3ETEA 1EUZA 2SCUA 4WNIA 1QV6A 3VZPA 2VQ3A 3FCOA 4MP6A 3BA1A 5ENDA 3WICA 2V7PA 3BTOA 3ICCA 1C0LA 4O63O 3BMOB 3EVNA 5G0WA 4JQCA 4L4XA 3RUIA 2DFDA 4OOEA 1PJ4A 4MINA 1GUYA 2DQ4A 4ZRNA 2FHSA 4NFSA 3WWYA 4K6CA 1BSVA 4RGBA 4CM8B 1P74A 1K0UA 4KDEA 2WD7B 4OO3A 1JDJA 1ML3A 3H2SA 1MX3A 3ZHYA 3JQGA 1EVZA 1P1KA 3A1NA 1K2WA 3HB4X 1XU7A 2HRZA 1E3IA 5L45A 4CLXA 3WMXA 3O8QB 2DAPA 1UXKA 4INAA 1JAXA 3LSYA 4NG5A 3L0DA 2BRUA 2I67A 3VHRA 5I9MA 4AJJA 4CQMA 4R5MA 3E48A 3PHHA 5JO9A 8ADHA 3H9GA 2JHFA 1CEQA 2P68A 1U4OA 3HADA 4FDAA 4R1UA 2Y67A 4BIIA 3GEGA 3KYDB 4EJMA 1PR3A 2EEZA 1FDWA 2PD4A 4ZHSA 3AUUA 1O5IA 4DPLA 1WAMA 3GVXA 1NHGA 3D3WA 3MWEB 1E92A 1E3LA 1GPJA 4TROA 4HWKA 3MOGA 3F47A 4Q39A 1ULUA 4EYEA 4NDNE 3EW7A 2B0JA 4PLGA 2PR2A 3DBLA 3D5QA 3I4CA 5JAMA 5JBIA 1PWZA 3QWIA 1A7KA 3PYMA 4P38A 1A4UA 1CETA 3S8MA 4RF2A 3SBOA 7MDHA 3IAHA 5BNIA 2AQKA 2BD0A 4N7RA 1RYDA 3BMQB 3HWRA 3GFGA 3RVDA 4WJZA 1IZ9A 4PZEA 2G0TA 1VC2A 2VUUA 4R5HA 2BGKA 1LSUA 3IIEA 2O3SA 4FGWA 4E5NA 1K6IA 2VOEA 2C5AA 5L7WA 4GL4A 3MOIA 2CVZA 4IDCA 3WQRA 4C7KA 1ZO8A 4DC0A 4E2WA 4R69A 2VYVD 2I65A 3CIFA 4E4YA 5U9CA 4YVFA 3F4LA 1OC4A 1DHTA 1KVUA 5A9TA 4MVJI 4A27A 4E6PA 3Q9UA 1DLIA 3IC5A 4YAEA 4CPDA 5AXAA 4J1QA 1DRVA 1KVTA 4TRJA 1F0YA 1WMAA 4KWIA 1HSZA 2NWQA 3C24A 1ZCJA 4M86A 5GY7A 3ZV5A 4QX6A 1X13A 3JD2A 3C7CB 2CSUA 4OAQA 1BW9A 2YFHA 4PZDA 2VT2A 1MLDA 2Q99A 3TFQA 1N92A 4GSKA 3VZRA 1E5LA 4RQTA 4IQ8A 3MJVA 2P9GA 1YBMA 3R3SA 3QW2A 4ND2A 4XZ3A 1NVGA 1R0KA 2PZKA 4FFPA 5A03A 1ID1A 4UEKA 5BSHA 4WLVA 4R3NA 1GPDG 4K1LA 3PWSA 4NQZA 4L8VA 1T2CA 4KTVE 4FR5A 1H6BA 1I3LA 5TJHA 4PVCA 1M6HA 1VPDA 1NTOA 4KUHA 4MKRA 3H3FA 2NTVA 4E31A 1EVIA 4L74A 5T6BA 2H9IA 1DSSG 1U5CA 1ZEJA 2B83A 3DC2A 3RBXA 3ZHZA 1HDOA 3R1IA 2VCYA 5ICSA 2YV2A 1PGQA 3OECA 3B6ZA 1GZ6A 5F1KA 3UUWA 3ZWCA 5JDCA 4WOJA 4NJOA 1FDSA 4L0QA 5EJ2A 4ZQBA 5JFOA 4DRYA 3CZMA 4NZ9A 4MVJE 4S3MA 4NBTA 2B4QA 4UULA 2XPCA 1XQ6A 2X58A 5KTKA 4ND1A 1K6XA 3ON5A 5A4DA 1J4AA 2Z1NA 3ST7A 2C2YA 2JCYA 4ALKA 4CMHA 4EEZA 5HA5A 4F6LA 4J0EA 3SJ7A 5C7LO 4BNJA 4E32A 4OYRA 4AJHA 4LW8A 1B3RA 2NM0A 1XR3A 4J9UE 4OOFA 1PL6A 1FDTA 5B4VA 4U8GA 1LLCA 5DCWA 1DC4A 2DTXA 2PNFA 3ZHXA 3KYCB 1A4IA 3GMDA 4BNFA 1LDGA 1ZXBA 4FFLA 3PTZA 1NQ5A 2CVQA 4BGEA 4NMHA 4EEXA 1PIWA 5JDCC 1R16A 3DZGA 3W1VA 4R4JA 1JWAB 3QVOA 3RUFA 4GVLA 5F21A 4HY3A 4EUEA 4J1TA 1LSJA 4P22A 1KBZA 1DJQA 4AJPA 3IDSA 5IN4A 5JYDA 4GVXA 2RCYA 3NEPX 1IE3A 1MC4A 3OIDA 3ZWOA 3JCZA 2AEJA 4YJGA 3SLGA 2B5WA 3OBBA 5A9RA 3CEAA 1E6EA 2DBVO 2E49A 1ENZA 3GY0A 4XR9A 1HDGO 2FR8A 2J5QA 2DLDA 3PLRA 3PI7A 1KEWA 3INTA 3PHGA 3RJ9A 5A9SA 5CP8A 1E5QA 3MJEA 4HFJA 2NACA 4FW8A 1XSEA 3K31A 1NFFA 1LQTA 2Q3EA 1NPDA 4TRMA 5DNAA 3P19A 2P91A 4YJFB 5ER6A 4IJKA 3GDOA 1RJWA 4WASA 3GRPA 1IULA 1EDZA 1BMDA 4TKMA 2ZJ1A 1GYRA 3AUAA 3JQ8B 4UVDA 5KJFA 1G1AA 3L77A 4O1MA 4CV3A 3HN2A 3MJTA 3BHMA 1PR9A 2EGGA 1XQ1A 3WGOA 3Q2IA 4DIFA 7ADHA 1ISGA 3TZ6A 3D0OA 4ZQEA 4XDZA 3O26A 2YZ7A 4JJIA 3ZNOA 4HFMA 4CL8A 4B4WA 3D7LA 4BNUA 2Y1FA 2G82A 3AM3A 3JQBA 1XA0A 2ZB7A 2C7GA 3ZWPA 3FNFA 2C20A 3DONA 3GUYA 1EFKA 1P1HA 3WSVA 4EJ6A 2FY8A 4PLHA 3U5TA 1VKNA 3FR7A 1QR6A 2NQ8A 2EKLA 3KO8A 4NK4A 2NTJA 1QYVA 3OA2A 4B8ZA 2O3UA 2X1HA 1BVRA 1P31A 3C8MA 1E6UA 2PH5A 2QQ5A 5CPFA 4AJ2A 5EIOA 3WYEA 3JQ9A 1U3WA 1GV0A 3GHHA 4CMIA 1LDMA 4IDDA 4LCEA 4NH4A 4BS9A 3TOZA 3INRA 4BNHA 2GASA 1FDVA 2BH9A 4DUPA 2UVDA 3DDNA 4W4TA 4ZQHA 4U5QA 4YXFA 1N2SA 4L4SA 4RPLA 1XHLA 4RPGA 4Y6RA 5DOZA 2Y1GA 4OJNA 2EXXA 1R0LA 1QSGA 4MVJF 1OAAA 3JQGB 1GFSA 5ES3A 3JQDA 3IL2A 4KTTE 3B20A 1F8GA 3DBRA 1DPGA 4OKNA 4JNKA 4BNGA 1TT5A 4ALIA 1MFZA 3RJ5A 3HB5X 3WLEA 4CQMB 2P5UA 1YJ8A 4IJUA 3UCXA 3T4EA 2EKQA 3DL2A 2X4GA 3AFNA 4BKPA 2VYND 1EEHA 2OBNA 2YW9A 2CD9A 1N1EA 1HRDA 4G5HA 1T26A 2Q4EA 5JCJA 3MTGA 1ZMOA 1YVEI 3S2IA 3L6EA 2FSSA 5CDGA 3ABIA 3D3WB 1DEHA 2W8ZA 3B1FA 5M6DA 3U49A 3FHLA 3TN7A 4OM8A 3VH1A 1C14A 3DZFA 1RM5A 1LDNA 4JJGA 1G6KA 1BXGA 3U3XA 2C7VA 3HE3A 4H3VA 3KVOA 1R0SA 3DBLB 3BTSA 4YQZA 4XYEA 2CMDA 4XYGA 1EDOA 2WEKA 3WSWA 5CAEA 3LF1A 3Q3CA 1YONA 5J23A 2NU7A 5IDWA 2GD1O 1HDRA 1QYDA 3D5TA 3ZWMA 3JYOA 1MA0A 3TF5A 3O03A 2C82A 3I1JA 2Q2VA 2I76A 1BTOA 1E1NA 1WW8A 3U4HA 4NFYA 1FDUA 5FWNA 1KY5A 5BQFA 4WPGA 3SLKA 4DREA 1I2CA 4ZVVA 5TQVA 1IHXA 3FBGA 1HLDA 2WE8A 1KIFA 2P2SA 5IDXA 4HFNA 3L6DA 2EW8A 2VUSA 4ALNA 1B0AA 1MG0A 3OP4A 4M54A 1K6JA 3QA9A 4I9UA 3AW9A 2D4AA 5JAQA 3WXBA 4BKOA 1KEUA 1DXYA 2I6TA 3WG9A 3RSHA 2NVUA 2OMEA 3FSRA 3H3JA 1HYGA 1BWSA 4BGIA 1CWUA 4CLEA 5K6AC 4IDFA 4NPCA 1GDHA 3P7MA 4U6SA 5JE8A 1BW9B 4AJLA 2X0RA 4J4HA 3RU9A 1KY4A 2EV9A 4DBZA 1UH5A 3Q6IA 5G0UA 4MVJM 1JKFA 1Y7TA 4CLHA 2YYYA 3L4SO 3RUHA 1H2HA 3BXXA 3NV9A 2Q1UA 1UJMA 2Y0EA 5H81A 4RLHA 4B7XA 1X1EA 3QV1A 5JDIA 2J3JA 3I5MA 3PK0A 4XQGA 3HDYA 1WWKA 3RKRA 3DTYA 3GN1A 1SMKA 4MVJA 1RPNA 2A4KA 1T4BA 1B8UA 1YGYA 1B14A 2JFHA 2GCGA 3DOJA 1Z82A 3OHSX 3U9LA 4XRRA 1T24A 3F5QA 1Y8QB 1X15A 4N5MA 2G76A 1YH3A 5ADHA 5ILOA 1C1XA 3G1TA 4PCVA 5JLAA 2AE1A 1Z45A 1RKXA 3CUKA 3NDIA 3B1KA 1AHIA 2EW2A 5C3MA 5EL0A 1LU9A 3AU8A 5IJZA 4J7CA 4E5KA 1K5HA 3GRKA 2DBQA 2NTNA 3FPCA 1H6CA 3RFVA 3M2TA 3LC1O 2Q2QA 4EUFA 1U9JA 4URFA 2ZB4A 1GQYA 3NDRA 1MP0A 4J9VA 2JFFA 3FWNA 2Y1OA 1ZJZA 4YDRA 3PYXA 1IPFA 2GR9A 3PXXA 4F6CA 1GL3A 2QRKA 4ID9A 1ZXLA 1HDZA 5JMWA 5IDQA 4GWKA 1EBUA 2YJZA 4J1NA 1BDBA 3P2OA 5ITVA 2VRBA 4BB5A 1Y9AA 5IDYA 3C7AA 3F4BA 3UFXA 3KTDA 3GG9A 5JCXA 3RC7A 2XAAA 2NLOA 4DC1A 1UZNA 4IINA 4O0LA 1U2GA 3CKYA 3PFFA 2PD6A 5HM8A 1UZLA 1ZUD1 3JQ7B 3RU7A 1Y6JA 5JAIA 3GR6A 3H4VA 1ZH8A 4ALJA 1JQBA 2HAEA 4CQMD 2VRCD 1W73A 4ROSA 3GNSA 1PGJA 1GTMA 5AOVA 3G1UA 3IP1A 4IDEA 1H2BA 1W6UA 2E6UX 4Z9XA 3WNVA 1PTJA 1WZIA 2VHZA 4UUNA 2G17A 3KSZO 2FPIA 2R6JA 5TX7A 1PU2A 3JQCA 3LYLA 1P1JA 4YRBA 3JYNA 5T67A 4FSHA 5A9SB 5A04A 1I2ZA 3NT2A 3PP8A 1H94A 3RUCA 5IZCA 4IZHA 3WX0A 3C3XA 4BNYA 3BAZA 3NTOA 3EY4A 3JYQA 1KYQA 1E7RA 4KOAA 1LJ8A 4O59O 4FOSA 4Q3DA 5DCYA 3B70A 2CDAA 2PTGA 1X0XA 3BYZA 1E3WA 1HLPA 5JYEA 3E03A 4RVUA 2O3JA 2Y66A 3DMTA 1NASA 4YT2A 1U7HA 2DTEA 2OP0A 3BTUA 2Z5LA 4GX0A 1PGPA 2AE2A 4IDAA 3VTZA 2F00A 1CJCA 1S6YA 4HNGA 5DZSA 4U6QA 1GR0A 3H8VA 4X54A 4XJSA 1EUCA 4XB2A 1DIAA 4XQCA 3GZNA 2VZ8A 3E9NA 5EQDA 5HTOA 1IOLA 3PFWO 1YRLA 5CDTA 5TLSA 4PG7A 2ZCUA 3ZWAA 1VSVA 4YA6A 4EJ0A 3BIOA 1CIVA 4YRDA 1Y8RA 3OF2A 4CR7A 4DQUA 1L7DA 1ADCA 4J91A 4FOOA 1T2EA 3NAQA 4PG8A 4LVCA 3F46A 1D3AA 1LLDA 1ZSNA 1HWYA 1PJ2A 2HMVA 3PRJA 1Z74A 4CMIB 3OFSA 4K26A 5ILGA 4F3YA 4HXYA 3OJOA 4KUGA 3DFZA 3RKUA 4BNNA 4Q3CA 4WCDA 1WLYA 1RWBA 5JPIA 5KOIA 3KETA 3AU9A 1AXGA 1Y5RA 2P9CA 4OSPA 3ZHBA 4D3FA 3ZWYA 4MIOA 2VHWA 1X7DA 4B4UA 3QWBA 5CDYA 1H93A 4UREA 5K9ZA 5HWSA 1F14A 5U1PA 1YB4A 3JQAD 4Q3NA 3TQHA 1I24A 3AI2A 2Q22A 1CERA 1EVJA 3DBRB 3ANMA 1QYWA 2CNBA 1TT5B 3DAPA 3PDJA 1G0OA 1N7GA 1ADGA 2HQ1A 1PL7A 5KVSA 1ZBQA 3RD5A 2O3RA 1IZ0A 3KYBA 2FZWA 3T7EA 1O9BA 2YHIA 4BNWA 2GYYA 3RC1A 3ZNNA 1ADFA 4NK5A 3HN7A 1KC1A 1NQOA 4YYZA 4R68A 4BQPA 1NXQA 1ZK4A 3FPLA 4Y98A 1WP4A 4RPHA 3VZSA 1NQAO 1FK8A 1R4MA 1E3EA 1C0IA 3LLSA 1I36A 2I3GA 3U0BA 4QT0A 4CJXA 1VKOA 3ITDA 4QUKA 3CPSA 2UUPA 3LC7O 2GDZA 2VN8A 2VNAA 2EWMA 4OIMA 5L4LA 4E0BA 1BXGB 3ZGYA 1H5QA 1XYGA 4CM4A 3OMLA 3ZV6A 1E1LA 2HJSA 1SCUA 1ZK1A 3OM9A 4ZRMA 5AVOA 3AI3A 1YJQA 2E4AA 1AGNA 1PWXA 3C85A 4J0FA 5TF4A 2X6TA 3PEFA 3X2FA 4BKUA 3RROA 4ITUA 4B79A 5TSDA 1EK6A 3IUPA 4U0KA 4F46A 1D1TA 2OOSA 1WVGA 4RL6A 3O9ZA 4L4RA 4CM9A 1UAYA 1NWHA 1IYZA 3I6QA 1F17A 2FP4A 3WIDA 3D1LA 4R3WA 1NPTO 3HDQA 4KQXA 4TRRA 1TA4A 2JL1A 4I1IA 2YY7A 1VRWA 2X9GA 4NBUA 2X9NA 3ENKA 3GAZA 4E3ZA 2PH3A 3AM4A 2X0JA 4RDHA 4R51A 2HDHA 3C7DB 4FQ8A 3KEOA 4CV2A 4OH1A 2AQ8A 4Z3DA 2NVUB 1ZK0A 3H9QA 4WLUA 4CV0A 5A06A 1N1GA 3ONDA 1NYTA 3ZZNA 2ILTA 5TS3A 3JQ6A 2VWPA 3X2EA 4FJ1A 1V3UA 1TB4A 4IGEA 3WBBA 4L9RA 3GVPA 4NU5A 1JKIA 4XD2A 1BRMA 1U8XX 1L7EA 4DIBA 1IY8A 4XGKA 2OZPA 3E82A 1SC6A 2O3QA 1LDYA 3ZWWA 4KMSA 1K3TA 5DT9A 2HSDA 1PGNA 4IMRA 4TQGA 2W2LD 3ROKA 3TZKA 4DYDA 3U4DA 4EI2A 1HETA 2PKRA 3W8DA 4FD3A 1OOEA 1QYCA 1U3UA 2IEDA 1I33A 2P4QA 2W2KA 3BTVA 3GH3A 3L4BA 2GSDA 2Q4BA 1F06A 4XQ9A 4CLDA 4DLAA 3UGKA 5L51A 3I83A 3W6UA 3NT5A 2GERA 2JD0A 3UICA 3PVZA 2BFPA 3K5PA 4U7WA 3OA0A 4RZHA 5JXWA 1VJTA 6LDHA 3OICA 1C1XB 4ND3A 2NV6A 1VL6A 2VWHA 4NBRA 3JSAA 3I9LA 3OJEA 2X22A 4YJHA 1AUPA 4YWJA 1V8BA 1HT0A 2AQIA 3JQFA 1O95A 3DHYA 3WJAA 2YFQA 4Y9DA 4YBZA 1WNTA 4XWYA 2OL4A 4O5OA 4BNIA 4E13A 4YR9A 4FN4A 3ZV4A 3WTCA 1MG5A 5DBGA 3I6IA 3V8BA 4JP3A 3L4BC 1OI7A 3MCVA 4I5GA 4NBVA 1HKUA 3G0OA 1U28A 3E18A 2B4RO 1C0PA 4MDHA 1FJHA 1ZFNA 4J4TA 3LZ6A 4YAJA 4OXKA 1I3KA 1V3TA 3GK3A 1DRWA 2AHRA 4GGOA 4MOWA 4W99A 4RVDA 5A5FA 4FFRA 4MP3A 3ANLA 3TJRA 3F3SA 2W98A 1WZEA 2HJRA 1I3NA 2JHGA 1SEVA 2DT5A 4DMMA 3ORFA 4AJOA 1P1IA 3LK7A 3KBOA 3F9IA 1ADBA 1T1RA 3ONEA 4FFMA 4BO2A 4E5YA 2JJYA 1SOWA 2P5YA 4XA8A 1QP8A 5F1OA 4QFCA 4G2NA 4ZICA 3PWKA 3KOUA 4B8WA 3WWZA 4KQWA 2G5CA 1U4SA 1BDMA 1PJTA 1ZMTA 4GGPA 1VI2A 1A72A 3NT4A 3VAZA 3NJ4A 3GNQA 4RQUA 4BV9A 2E37A 5EQFA 3BMCA 4GBJA 3LVFO 3PQEA 3AK4A 1NAHA 1WDLA 1R12A 5COAA 1E3WB 4W82A 4JIGA 2AMFA 5H82A 3WLFA 2QW8A 4RVSA 1E7MA 2A35A 5KVCA 4CMBA 3ROPA 3W8EA 2ZYDA 2YV1A 4PLVA 2JCXA 3VOSA 2JCVA 3H6KA 1MFPA 2I99A 2QG4A 4II2A 2FWMX 2J3IA 4PZCA 4TMFA 5DP1A 4BQRA 1PJCA 4UEJA 2DBRA 2HK8A 1BXZA 3M1LA 3ZWBA 4BO7A 2UYYA 4TRNA 4XQEA 2JD2A 5KVVA 3STHA 4QECA 1ZJYA 5L95A 3GNTA 4OSOA 2D2IA 1HE4A 1B15A 1ZZEA 2OUIA 5F1PA 2R2GA 1Y8RB 4JLWA 3ADPA 1XEAA 1ZW1A 2Z1MA 5LC1A 3GGPA 4IZIA 4P4LA 1T2DA 5HBRA 3L9XA 5DP2A 3A9WA 3CTMA 4ZU3A 1B2LA 2FPGA 3V2HA 5B4TA 5BR7A 5FI3A 1ZNQO 1YQGA 2X23A 1RYEA 4J49A 2W90A 5EN4A 3IKTA 2H63A 2VZ9A 1R15A 4IM7A 2WJPA 4PIVA 3KM0A 1BXKA 4Y6PA 4J3FA 3DEYX 1D8AA 4LN1A 3V1UA 4WECA 2ZYGA 4TZKA 1D1SA 4PLWA 1VL8A 3ZU5A 3VDQA 5KJ6A 2GNAA 4NHEA 1LSOA 2IRWA 3WGZA 3ENNA 3AWDA 4P8RA 2GRAA 1Q0HA 1J5PA 5JC1A 4NBWA 5DF1A 5B12A 1CDOA 1MUUA 3O38A 4R41A 1EE2A 4MPDA 2E48A 4WKGA 1EBFA 1NR7A 1XDWA 1U7TA 2B69A 4CM1A 1FXSA 1MV8A 3WNQA 3QWAA 3UH1A 4XIJA 3QVWA 2YV3A 2ZB8A 1EFLA 3PHLA 5AYVA 4AJKA 2C0CA 2YHIB 1QMGA 2IYOA 4HFRA 1NWCA 2P9EA 3SVTA 2PWZA 3H5AA 5CFZA 1GQQA 2NVWA 1DIHA 2HK9A 1JU9A 1JLLA 1ISIA 2WYVA 5COBA 1R4MB 1R37A 5IXSA 1GEEA 3OEYA 4UEOA 1YL5A 3WFIA 1ZSVA 1E1MA 3JD0A 4DGSA 4UVGA 4UUOA 4ALLA 4BKRA 4CLRA 2GN8A 1JTVA 1YO6A 3JQBC 4QQRA 1SB9A 5JSFA 5HS6A 2J8ZA 3KB6A 4AJ1A 4CM4B 4YT5A 3DBVO 4M1QA 3TDKA 3EGOA 4S1VA 3H2ZA 2DFVA 1I01A 3VVBA 1LEHA 2Z95A 4QO7A 5AXCA 3DBHA 2BF7A 3PGXA 5H83A 3ZWVA 2J3HA 1PGOA 1R4NA 9LDTA 4A0SA 4ZQGA 2Q1TA 5I9NA 2NQTA 1HTBA 3JQ9C 3ZV3A 2ZQZA 3RIHA 1PJQA 4M49A 1YWGO 2X7HA 4E2YA 4B3JA 3KRTA 4I08A 1IB6A 1JWBB 1YDEA 1PEDA 2EERA 2A94A 3TZCA 3RCBA 2IXBA 3KUXA 5DULA 3ONFA 1VE9A 1IUKA 1XELA 2Q50A 4E5MA 4D3SA 2GUGA 3EUWA 2FR1A 4Q3BA 4CR8A 3GLQA 4A26A 4BHTA 4E2XA 1QORA 3WR5A 2IZ1A 4LK3A 2YQ4A 3EZYA 4RF4A 4GAEA 5T73A 1TVEA 4PG5A 3PPIA 3QSGA 3PIDA 1I32A 4CMAA 3CXRA 4BNKA 3MJCA 4JGBA 5B1YA 3PHIA 3GMSA 3E5MA 4KWHA 1TT7A 3GVHA 4YEDA 3E8XA 3PJGA 3K2EA 4PG6A 1PQPA 3GOHA 5TT1A 5LDHA 4E12A 5G4LA 5JC8A 4TWRA 4MJLA 3AUSA 5KNLA 5A5EA 4E30A 2W2KB 4QXMA 3EAGA 1SPXA 3OJLA 5ER9A 3QWFA 1UXJA 4XYMA 4L73A 2X5JO 4JXKA 4NU6A 3O8QA 4M89A 2WYUA 1XIVA 3ZCXA 4UVIA 2DTDA 3B1JA 3OIFA 4IS2A 3TZQA 4QSMA 4OMUA 4RZIA 3V5NA 5A02A 3NYWA 3KEQA 3QVSA 4YJHB 5KKAA 5CEJA 5T5QA 3HHPA 4YT4A 2BELA 3UVEA 2OHXA 2ZYAA 5AXDA 5FEUA 2AEMA 2UV8A 3E5RA 1NP3A 2HO5A 1DJNA 2Q49A 3WFJA 4BGUA 4WCFA 1PZHA 2WSBA 3ZWNA 5I7VA 1UAGA 5G0SA 4J90A 3VKUA 3TWOA 1Q7CA 5L3ZA 4BO4A 4KZPA 1PS0A 3D64A 4H15A 4KP7A 1SNYA 4A5OA 1Q7GA 2ZATA 2O3TA 5CG1A 3GUCA 2EF1A 2EG9A 1B8PA 2Y1DA 4WLNA 4BNVA 3DQPA 2JAPA 4CUZA 3RAJA 1E0DA 4CUJA 1CF2O 4UAGA 3NRCA 4PLTA 3UW3A 3DHNA 3UN1A 3VZQA 4NJMA 5L53A 4CM7A 5I7EA 1I2BA 2IE0A 3VPHA 4IJVA 2YDYA 1OC2A 4RPKA 4BO9A 4N18A 3FWZA 2CF6A 2POQX 2V6GA 1UXHA 2B37A 1V0JA 1PX0A 4WCFC 5BNTA 5GZ1A 4ND4A 4B3HA 4RDIA 3TPCA 1GQ2A 1M67A 3OJ0A 2BHLA 3ZDFA 2IDZA 4AJNA 3CMCO 3FI9A 5EINA 3UXYA 5JDIC 3RASA 3RC9A 4I9NA 1B7GO 3GA0A 3GEMA 1M2WA 4FIZA 1ONNA 2GN4A 4LRSB 5HS4A 3A06A 4GLLA 3SEFA 4BMSA 3DZHA 1D7OA 1MB4A 3BMCB 2YUTA 4R9RA 1H9AA 1P44A 4MP8A 1WXDA 3H9UA 2IZZA 1SBYA 2HMWA 3DZJA 4LCJA 4EDFA 4CMGA 4W7HA 4AG3A 4FCCA 1U3TA 4CR6A 3JQEA 4XGNA 3HDHA 4C4OA 5JY6A 2PZMA 3CMMA 4CQLA 1W4ZA 5JY1A 3HSKA 1PZFA 2Q45A 3COSA 4GKVA 4XX0A 1CQJA 2CDBA 5J9GA 1KVQA 2QIOA 2JAHA 1T4DA 1PS9A 4CM9D 1SB8A 4YJGB 1OZAA 1O94A 3QJ5A 3QE3A 2NSDA 3QQPA 3VPGA 1SAYA 2ZJ0A 1OFGA 2O48X 4PRLA 3JD3A 3HJAA 4PFJA 3GC6A 2CUKA 4BNLA 3G3EA 4D0RA 1LDBA 4E5PA 2HMTA 3CSDA 3CE6A 4MO2A 4FS3A 3IOYA 1N7HA 2FPPA 4YQYA 2FZEA 3H65A 2R00A 4YACA 4EW6A 4D43A 3WB9A 2PD3A 4WUVA 3P2YA 2WE7A 4WK6A 4XEHA 3QP9A 4GPD1 3DZKA 3PZBA 1PJLA 2RH4A 3RBZA 4CM3A 5TT0A 1TLTA 3UF0A 3K8ZA 4D45A 1EMDA 5B37A 1MGOA 2OORA 1NVTA 4NNJA 5EMHA 2XF8A 2PFGA 3NKLA 5L40A 1I5RA 5T64A 1CQIA 5L7YA 2CDCA 4L76A 1VSUA 3F5SA 4EBFA 1HDCA 2WTBA 1JKJA 3EYWA 5L9AA 2GLXA 3IS3A 4WLFA 2XOXA 1NBOA 3HQ4O 3RQSA 4AVYA 2BGLA 1N9GA 1XKQA 1I3MA 4PGFA 4GX2A 1Y81A 1DBVO 3S2FA 3FNGA 4ESOA 2H5LA 4OXNA 4WEOA 1DDOA 2D3TA 3VKVA 5U4QA 2R00C 1E3SA 5IZCC 3GDFA 1M75A 3Q1LA 1M6WA 4FGSA 1B26A 1HE2A 4BB6A 4XKJA 1E6WA 2J6IA 1P1FA 1PJSA 3KSUA 5GZ3A 1ENYA 2PK3A 1NFRA 3H9JA 4IIVA 2DKNA 4YB8A 4CM5A 1P33A 1WDMA 1ZK2A 1W0CA 4MKXA 3LC2O 2WD8A 1FMCA 1GY8A 3DMTC 2VHYA 3DZIA 3WYCA 5G4KA 3VTFA 1GZ3A 2VT3A 2HCTA 4JROA 2EJWA 3U4CA 4FBGA 2DBZA 3E1KA 5L4SA 1LNQA 3WOHA 4KUEA 3KXDA 4CLRB 2ZK7A 4WNCA 5CEFA 3W6ZA 4JBHA 1HDYA 4Q9NA 4ZJUA 4DIOA 3V1TC 4DVJA 4LSMA 2YDXA 3WGTA 4WLOA 3GT0A 3K96A 1Z73A 3F1LA 5CDSA 1XLTA 4YPOA 1Q1NA 3C1OA 3NTRA 1GCUA 2PGLA 3HFSA 4R16A 2QYSA 4IXTA 1NQTA 3DBHB 4Y67A 2BGMA 1V35A 1NR1A 1R4NB 3PQFA 3GF4A 4IQ0A 1KC3A 4J2HA 4LSWA 3I9MA 2NU8A 1O89A 4MVJH 1DAPA 3OETA 1ZIDA 1UXIA 1JN0A 1E7QA 4BO0A 3NTQA 2FN7A 3DTTA 1NVMB 3WS7A 4HX5A 4TVOA 4DXHA 3ZW9A 2B4TO 4RVFA 1Y5MA 2Y93A 1GYQA 4N5LA 1Z6ZA 4D46A 4LVUA 3DAGA 3JV7A 1PQUA 1TXGA 1HZJA 3IQDB 3Q0EA 1EUDA 3ZI0A 3TL2A 4GQAA 2QHXA 5IF3A 4IS3A 4CL3A 3SC4A 3U62A 1RM0A 4A10A 4BNZA 4BMVA 2WWRA 3RFXA 3HZZA 5JNLA 2AA3A 4L75A 4BNXA 2QZ9A 3OQBA 1ZK3A 4B7UA 4RF3A 4DBVO 2JKVA 4II3A 5EERA 1QLHA 3F6YA 4HUJA 5DBIA 3WGGA 4DA9A 3H5NA 1GAEO 3GPIA 1Z75A 1YQDA 4PN3A 3TZHA 1WDKA 2GPTA 4RPJA 4HV4A 4FC6A 4UVEA 3I3OA 3CINA 2VHXA 1ENPA 4R1TA 3WDSA 2GZ1A 4CMCA 2HUNA 3WJ7A 5I7SA 1UXGA 3ZWXA 2BI8A 3WQQA 1GUFA 3ICPA 3Q11A 2I66A 3PJEA 4J2OA 3AI1A 1TI7A 1J6UA 2PZLA 2X5OA 4DYVA 3AUTA 1QRRA 5DN9A 3GGOA 1LTHR 1HL3A 3DO5A 1KVSA 1W8DA 4OQZA 1YDWA 1NNUA 4LISA 2UAGA 3SC6A 2RHCA 1C3VA 3HG7A 4N54A 3DWFA 3MZ0A 2VRCA 1LC0A 2HMUA 3EHEA 1OBFO 1VJ0A 5ICMA 4J7XA 2VTEA 3DAFA 1YB1A 3PZRA 3CZRA 1LUAA 4CM6A 1JVSA 3C1TA 5L7TA 1QYXA 1X7GA 2V6FA 4PLZA 4GKBA 1VLLA 2OFPA 4LMRA 2JD1A 2WMDA 2CFCA 1WPQA 5JMPA 1E7SA 1HZZA 3LT4A 3W4JA 3ZNQA 4M55A 1M66A 4MVJP 2EGHA 3AFMA 2FSVA 3BMNA 3K92A 3ZW8A 4I5DA 4WCFB 1ISHA 1U5AA 3A14A 4B3IA 3ETGA 4I8XA 5CHEA 1A9ZA 3OSUA 2GGSA 4YT8A 2NNLD 2O4CA 3ROQA 1I10A 1DC5A 5T8KA 4GSLA 4U0JA 2RIRA 2H6EA 1YXMA 1T2FA 1Q0QA 4M87A 4A7PA 3PIIA 2I9PA 3DFUA 3WQSB 5TGDA 4D79A 4RV9A 1IL0A 1AE1A 1DFGA 1YE3A 4IUYA 3WIEA 2FOIA 4UUPA 5C5IA 1BG6A 4YCAA 3VPXA 2BFAA 3PJDA 3Q9NA 1AHHA 4NJMB 4NR0A 2V6MA 3KSDO 3OQ1A 2Y0DA 3RUEA 2RBEA 9LDBA 4RJTA 1X14A 3GQVA 5FI5A 3T4XA 4BL5A 4CLOA 5KJ1A 2DUWA 1LQUA 4JK3A 3NX4A 4D0SA 1FF9A 5KIAA 1KEPA 1EQ2A 4RCVA 5T8KC 2WM3A 3ROMA 1Z7BA 4M8SA 1AXEA 1ZEMA 3JD1A 1PZGA 4GMGA 1UDBA 5A1TA 4YAIA 3I9OA 4CODB 1B16A 3FN4A 2GF2A 1JAYA 3H7AA 1G0NA 2ZCVA 3N7UA 1EVYA 3DMYA 3ZU3A 1H0KA 3EZLA 1B8VA 3ASVA 2EP7A 4LGVA 1SO8A 1DB3A 4BNMA 2C2XA 1E1KA 3DZBA 3O4RA 3PDUA 1U1IA 3ULKA 3MWDB 4CQLB 4AJEA 5GZ6A 3TNLA 5JYFA 2HK7A 5KKCA 1V6AA 1YBAA 2Q2WA 3G17A 1WMBA 2J3KA 3VDRA 2GZ3A 3JTMA 2IODA 1A71A 1LBEA 3AJRA 1DRUA 2XXJA 3JQFC 3TSCA 1NHWA 4QTZA 4BKQA 3JQAA 3INGA 1PZEA 1QKIA 5TC4A 4BNTA 1B3BA 2E82A 4EUHA 1P3DA 3GN2A 5DCUA 4Q3EA 3G79A 4IBOA 3L6OO 4PLCA 2ZTUA 5JCJD 2C59A 2CY0A 3ZU2A 1XWFA 1LSSA 1PSDA 1Y8QA 4CMEA 5IFLA 1JVBA 1EE9A 3AY6A 4TZTA 5C37A 2UUOA 4BV8A 2QYTA 2AG8A 4OKIA 3V2UA 2VTDA 1IHYA 2Y0CA 3HUDA 3GGGA 4AICA 3UAGA 4IQGA 1UP6A 2BKAA 4FB5A 4AL4A 1T2AA 1V9LA 3W8FA 3E9MA 4D7AA 5BSFA 1J0XO 3LT0A 2EP5A 3GG2A 4YAKA 3I52A 2QX7A 1CYDA 1HYHA 3DOOA 1PQWA 3RI3A 1A7AA 1N9GB 1VL0A 1BGVA 3OEWA 4GLOA 5BT9A 2O50A 1NFQA 4QO8A 4Z0PA 3S55A 3GZNB 2X0NA 4YAGA 4CMEC 3L9WA 3AOEA 2D5CA 2EJVA 6ADHA 4A73A 4E2ZA 3JQ7A 4XYBA 1C1DA 2BFMA 3NGLA 1DIBA 2HMSA 2BI7A 3U4IA 4NFHA 5BNFA 4J7UA 1DC6A 5LDGA 1PJ3A 4D41A 3A28A 4OGWA 2C29D 4IMPA 3IUSA 5AXBA 2DU8A 2PKQO 3RUAA 4G65A 1P9LA 1H6AA 8LDHA 1S7CA 5I7FA 4J4BA 1MC5A 1HDXA 5F5NA 5G4KB 1HE3A 4YRAA 1DFIA 2EIHA 2B35A 4TSKA 2AQHA 1I8TA 1DIGA 1YL7A 4B4OA 2Q46A 4MVJG 1C0KA 3LT2A 4YJDA 1E7WA 4ILKA 4D44A 4DWVA 1HSOA 3IJRA 2IXAA 1LI4A 2IZ0A 1GUZA 5G0TA 1K89A 1ZSYA 3PYLA 2C07A 2A92A 3AY3A 4XIYA 3RWBA 1YOVA 3R6DA 1GEGA 5JW6A 3AOEC 2NVBA 2Y1CA 4Z0TA 4Z9YA 2Y99A 1JA9A 4JBIA 5TJ9A 3K2BA 4MVJD 4FC7A 1YKFA 1DC3A 1OMOA 2W2LA 4CMJA 4XJTA 2ZKLA 1EQUA 3I9NA 2FRDA 3BZUA 5G2OA 2FMUA 2G1UA 4H7PA 2YHUA 3LF2A 4PLFA 1O6ZA 1LRKA 4DQXA 4K9DA 1R6DA 5EPOA 1BVUA 3WMWA 2VZ0A 3L07A 2J5RA 3FTPA 2LDBA 2VYVA 3LU1A 1Q2XA 4Z6KA 2Y68A 3PWZA 4IGFA 4JBGA 3UCFA 3ADOA 1RM4A 2LDXA 3FNEA 1A27A 1UDCA 1VJ1A 3NJ8A 3AY7A 4FFNA 4GH5A 3I23A 5LCXA 4BVAA 2GO1A 3AM5A 3E9QA 4WGGA 3PLNA 2X8LA 3MEQA 2O2YA 4RO0A 3QVXA 1SOVA 4G81A 4BO1A 3UOGA 1H9BA 4GX5A 5MGBA 3U09A 3R3JA 3KV3O 4ZA2A 3W4KA 2EHDA 5A3VA 3QHAA 2O23A 3ZNPA 4JN6B 1H6DA 4BO8A 1F12A 4PVDA 4DLBA 5IG2A 1DFHA 3UHAA 3NGXA 4ZD6A 3K6JA 3LT1A 3SX2A 3FNHA 2D5AA 3BHIA 2X0IA 4IDGA 1M76A 4F45A 1AN9A 4PRKA 2PA3A 3GZ4A 3ZH2A 2IYPA 4DPMA 4I5EA 2D0IA 3FF4A 1Y9EA 4EITA 5KJEA 3H9EO 4GWGA 1QXSA 4D3DA 1ONPA 4BO3A 5L4NA 1GD1O 2NU9A 4J43A 4J1SA 1HEUA
chains in the Genus database with same CATH superfamily
1LFAA 4YMIA 2E21A 3WLHA 2F4NA 2FPWA 4M0DA 2HREA 4LV5B 4MWBA 3MJ4A 1QQ5A 3UG6A 1Q1AA 4DARA 4EHKA 3S29A 1V11A 2W6JD 2B1JA 1F8XA 3T7CA 4M1EA 4GZMA 721PA 5IK2D 2Y05A 2GTIA 3JQQA 4ZAXA 1J20A 4XB1A 2DPYA 1HURA 2JGFA 1YR8A 2P2NA 3GOQA 5E0KB 1AQJA 2QA5A 3CZ9A 4AFNA 4Y2SA 1I4TD 3MRVA 3WSTA 1Q7EA 3EXFB 3AB8A 4MIEA 1NR5A 3EISA 3ZQJA 4AZSA 3LXMA 4R1SA 4ZOLF 4XCVA 4WESA 1E2KA 3KTOA 5EA2A 3EXHA 4YXWD 4NXMB 2D1YA 1C5KA 1HXHA 3DMFA 3EF1A 2ZRCA 5IWCA 2NZXA 1DG3A 2O2SA 2GF9A 1ST3A 4CM8A 4DMHA 2ZJ7A 5HUJA 1XZLA 2RMKA 5LWHA 4G5OA 2H1SA 2ORWA 4HQFA 3W5BA 1GYPA 3ISTA 1L3IA 1GIAA 3VOTA 4PU0A 3E3NA 3AONB 2OYSA 3FGNA 2XMRA 4BQOA 4Q1VA 2OBYA 4G6ZA 4GIBA 2I33A 3UHJA 4EY7A 1DIRA 1KETA 2DPHA 3RO7A 4E21A 5DMHA 2GHRA 3F71A 4OAPA 1G4HA 1VSTA 1JG1A 4OQDA 4K6FA 3UYKA 1F20A 2HJVA 1QDEA 2VSYA 1Z5UA 2I6QA 2HPVA 2J6BA 1TTHA 4FX5A 4H77A 4HR7A 4EGJA 4HNTA 2F1KA 5A3SA 2MT9A 2FVXA 4FPXA 3WYBA 4EGSA 4W6ZA 2G1KA 1Q7RA 1IWOA 5K3SA 4CLOB 1WX1A 3K73O 4TTVA 1HH4A 4QPJC 2R6HA 1GZUA 2VQEB 5FWXB 3GD7A 4EFLA 4DR2B 4RABA 5AJUA 4RDXA 3L1UA 4ND6A 1LLFA 2DC1A 4MIYA 4ISBA 3LY9A 3ZDYB 2CCGA 2RGUA 2X9VA 5FPHA 2QVGA 1EHYA 1IM2A 3LW7A 4PBSA 1FPMA 2O4UX 2DH5A 3ZGOA 2HYIC 1RXYA 3GVCA 1ZUHA 4RF5A 2AC7A 2BT4A 2QKYA 3OWHA 3T5CA 3PD0A 4WZAB 6PFKA 1VM6A 2GVZC 5FTMA 4D42A 2AK3A 2QMYA 1XMSA 3PQVA 1DAOA 2A84A 3CX3A 4K9QA 5F5LA 4ZXFA 3TIVA 4DLRA 5B2EA 2RBKA 4GPBA 3KLPX 5BN4B 1PUJA 2ABWA 1FLVA 1NVKA 5BR1A 2BEKA 4JZKA 4E1VA 3HP1A 1YB5A 2H07A 1KVRA 5HKKA 1HX7A 3UEOA 1J49A 4JGGA 5C5DA 4DV5B 4MMXB 1SUWA 1Y4DE 2PV0A 3A3PA 4J16A 3R7DA 2ZJAA 4Y8VA 3V1KA 2YFKA 4CCSA 2G36A 1SEPA 1S2IA 3KKKA 3Q2KA 1E77A 1F3OA 4JCCA 3G49A 4C04A 3QVGA 4AXXA 3GD5A 2UYHA 4L7VA 2PUGA 3FBTA 5B3JA 1G6OA 4EEKA 4EKNB 1L9KA 1VMIA 5AIBA 1S96A 1TJ4A 2IY8A 5DYWA 5LLSA 4JFAA 3EIWA 2A0XA 2JVJA 2BLNA 3E1SA 4HQNA 2W0SA 4DSZA 4HVCA 3RBVA 3BVPA 3C6ZA 3AUJB 1ORRA 3L06A 4FBMA 1PL8A 4YRPA 4EG6A 3IO3A 1HFWA 5F2EA 1IXZA 5G0WA 2FPRA 2XKAA 3IOMA 1YQQA 3HB1A 2FPMA 3H0EA 4WOKA 1E7YA 1FYEA 1PFVA 3GA5A 3S6JA 1UP7A 3C8DA 1EK5A 1H3EA 1A9QA 1GFZA 2IU6A 2ZUWA 2HPZA 1KE2A 4F4CA 4JYAB 4FYPA 3E61A 1XQXA 1IN1A 3UJ7A 4MS1A 5IDVA 5JOQA 2GD6A 5JAZA 1GKIA 2GPAA 4JX9A 5D7BA 1YDHA 1T8PA 3CUWA 4LQ4A 3ZGXA 1RLJA 1Q6YA 1TVCA 3L02A 5KJCA 4BQNA 4YAFA 4XIIA 4WBNF 3DJFA 1SG0A 2GN9A 2OQIA 4QFDA 4RHTA 3L7AA 4S35A 3B2QA 4B0PA 4BATA 1QV7A 2PGOA 2BFBA 3BF8A 1XTVA 3D4NA 2W93A 4E08A 5HR5A 1P6QA 5D3QA 2C2KA 5EXEA 2DM6A 4NY1A 5EQJB 1WKBA 3NBQA 3HFGA 1QH8A 1UMCA 2Y6VA 4UFPA 1KMMA 1QWOA 4G09A 2N3ZA 3FZYA 3F3KA 4M60A 4EY4A 5CG2A 2WAOA 4KO8A 2AN3A 3M4ZA 4MI6A 3TXAA 3ITKA 5BV2P 1GV1A 1QQ6A 4H7IA 4W9NC 2FCAA 2OAGA 4GSYA 4OL0A 3U60B 2K4MA 1RR6A 1TE2A 5KNCH 1QE0A 3N2ZB 3SXPA 2DYKA 1OLXA 5COQA 5GTDA 1RT9A 1Y7LA 4UVHA 3HY6A 1RJ9A 3WAJA 1KK0A 4E5VA 3AF4A 5SYAA 3TCXB 2KWIA 4CQJA 2X77A 5J5CA 5DGHA 3H0VB 3V2GA 3U44A 2ONKA 4KV7A 2B8EA 2Y6UA 4QC2A 3GFBA 5KQMA 2I0FA 4D4MA 3D3EA 4DQDA 3KZ1E 4N8SA 2H9AA 2O7SA 3DOCA 3IJPA 1N3IA 3GI1A 3O8OA 4FFDA 2HRBA 4OL9A 1FBNA 1BOOA 1UPXA 1M34E 3N28A 1I0ZA 4LJ5A 1COZA 1QC5B 4L16A 4S0ZA 3RTBA 3UANA 5G1NA 1DLJA 4Z9FA 5DVZA 4JNCA 3FD8A 1JF8A 1ZCAA 2FLWA 5F2KA 1YK0A 2HJ9A 3FKSA 1MXHA 2JIZD 3LHDA 1BHSA 1RXWA 1PFWA 2HWWA 3EZXA 3V33A 4L3WA 2EKDA 2EKPA 1SXIA 1WY5A 4H16A 1GL6A 1Z0SA 4KFSA 4WLEA 5DHAA 1CHNA 5FP0A 2WJVA 3AOGA 3HXPA 4QYXA 2XQJA 1XG5A 3NNNA 2W5UA 3A2MA 4IY1A 5BW6B 5IULC 1Q0TA 2H4FA 1T9HA 3K32A 2LCQA 2WQZA 3FGPA 4WXYB 1XE3A 2WVAA 3FPGA 4Z5XA 3DUFB 1Q6ZA 4YUZA 4NC9A 3VH2A 1Z4NA 5THKA 4F6RA 4X8HA 5FFFA 3TIGA 1W88A 1WMSA 4Q18A 1IM8A 5CGZA 4C29A 1RP1A 4UM9D 4IIUA 2IS1A 4G84A 4OQYA 3G9UA 4XR4A 1NXVA 2V5UA 1WMEA 1WUJS 4Y6SA 4ZAGA 3S5JA 4EMTA 1P2VA 1IJBA 1XZIA 2QR5A 5CGQB 1P3JA 2HUPA 2ONYA 4ZCMA 2VTKA 1VKHA 4HSEA 5FCDA 5H1YA 2ZQYA 2W42A 3H2YA 1BOFA 1JQAA 1RHUA 5K8LA 5A05A 1U2DC 4K28A 3TDMA 2GJ4A 2EBFX 4KO2S 2E5LB 1GKLA 2OQ2A 4XWAA 2ONJA 2QD4A 3G9XA 4G0NA 1YVPA 1YTLA 3PC4A 4UMFA 1ZLXA 2PL3A 3P5SA 3JAWB 2QLJA 1R2QA 4EGFA 5JS6A 4LPKA 1K5PA 1ZKMA 4NDZA 1Q2UA 4WZBB 3E22A 3GAFA 4MKIA 2PUAA 3JQ8A 4N48A 5FTJA 2YWGA 2EJUA 5F3RA 3SFTA 1Q22A 1JYEA 1GU7A 3HM2A 1AK1A 2WM2A 1PKXA 1R0BA 4BGVA 5BSEA 5AVYA 4DAEA 4A2CA 3L4EA 1CP3A 1VMDA 1OKKD 3PGLA 1KS9A 2HN9A 4NI5A 4R54A 1M9NA 5CMLA 4QEKA 3FPBA 4ETWA 1UWLA 2PGJA 5I47A 1KH1A 2OA0A 4BAZA 3M1AA 1DVRA 1GDTA 1D4AA 3DT6A 3EG9B 4LXQA 4S2EA 3L5KA 4MQMA 4RVGA 2QBYB 4A03A 3ZQ6A 3R0IA 4JFRA 4KE7A 4EA7A 1OV4A 5AHWA 4BQSA 2DQYA 2PZ8A 1QQAA 3T0IA 5SICE 5BSGA 2X4IA 1U3VA 1LRLA 3L7MA 3IKVA 4MV7A 4Y6QA 4BN5A 2LUOA 3RAPR 2HOQA 3BH7A 2HI0A 1D8TA 4W7SA 3TLEA 3RADC 2V74B 3H2HA 4WA8A 1EGMB 3PJRA 1DC7A 5AQ1A 1R66A 1AV7A 4UZFA 4WDQA 3OKPA 3G5TA 4FFOA 2I3AA 1BO6A 3V8VA 4G0ZA 4MB6A 2H4HA 1NM5A 2YQ5A 4HEA1 3O93A 1NMYA 3CPJB 1EUZA 1T0HB 1TVKA 2DY0A 3D4LA 1UKCA 5KTYA 2ZRAA 1GVNB 1XLTC 2OXRA 4M1WA 1VA4A 4DMKA 1GM5A 3RKSA 3VNAA 3D9QX 3V3TA 5L3SA 1FP4B 1Z3IX 3G5UA 1O96B 4G8JA 3E9ZA 5FUMA 2PGIA 3DDZX 1O7JA 2O05A 2ZYHA 4G9EA 3WYFA 5IH3A 1ORWA 3ZCSA 1KRXA 3BMOB 2WQ6A 5IBCA 3N2GB 4EP1A 1O87A 3LWNA 1L4HA 2P90A 1UYJA 1OJ7A 3IUQA 4IJMA 2B34A 4O4LB 2OGSA 3CX8A 4FR2A 5CYGA 5WRFA 1VZ3A 3MUNA 2JLVA 3IV9A 1TIKA 2DQ4A 2JFOA 2VAXA 1EVKA 4XM0A 3WWYA 4ZOQI 2X0KA 2H0AA 3B85A 3KS9A 2PQMA 3LVQE 4X8MA 5FUVA 4PTLA 5CURA 4D81A 4ECAA 2ID8A 3C7TA 2WD7B 2BHNA 2WD9A 3H2SA 4PXYA 5TPWB 3LP5A 3IWDB 3RSQA 3NTUA 1XU7A 1L8QA 1J1ZA 4DV7B 1QV9A 1T6XA 4LC0A 3UK1A 3W04A 3IT3A 4B3FX 1VGRA 4C3VA 1Z0AA 2JI6A 1VYTA 3WJ1A 1JAXA 2GKSA 1XZCA 1K3FA 1M1UA 4EZEA 3JAKA 2BRUA 4KYUA 4RKFA 4AJJA 4R5MA 1BMFA 3PHHA 1ZUIA 4JLDA 1K6MA 1CJBA 3CURA 4GEKA 4HG2A 2WWVD 3ETJA 3GGSA 5FBLB 2R4UA 5IAEA 1PTKA 2CVHA 3CLRD 1IN5A 2XWQA 5EVJA 4BIIA 4RXTA 5EOVA 1YJBA 4U2EA 3KYDB 2C3MA 3G68A 4QOIA 2NUAB 3SEQA 5EP4A 4OUKX 4BTVA 1PN3A 2EEZA 5FL3A 3M4YA 1AZLA 2ODWA 4WD3A 3K7EA 4DPLA 2WJYA 3GVXA 3R5TA 3ETLA 1NHGA 3GCZA 1Z5PA 3MWEB 1E92A 3EGWA 3NBXX 3OOJA 5CUQA 3OT1B 4DV6B 4HWKA 2QP9X 1PEKE 3F47A 1AS0A 4YRMA 1XJ5A 1FXUA 2A3RA 2AJTA 2O0MA 1SVOA 1V1MA 1XT6A 4HPJB 4XWOA 2Z1DA 1JQ3A 1SVKA 3HLTA 3T52A 4F2PA 2BDTA 4HWRA 4TKVB 2ATXA 3I4CA 1OBVA 1PWZA 3OU7A 4R31A 5AW5A 1NUPA 1U3DA 5LUBA 2M6LA 5ALNA 2ZRNA 2BFDB 3GQBB 4IGKA 2IU3A 2P9QA 1A4UA 1CETA 2CLDX 4GKAA 3S8MA 3SBOA 3EDRA 2CXOA 2J4DA 3CZ4A 2NQ2C 3SQLA 4E5DA 5BNIA 1KOFA 4EHLA 3TRKA 1I1OA 1ZM2A 2KI5A 2NUTA 4EJ2A 5E4YA 3TMYA 1K1EA 2JLRA 2WG1A 4TS4A 1Y1RA 1O5OA 4BLRA 2VSNA 1B4DA 5CXXA 2FSIA 4WK2B 1BNCA 5AR1A 4O4JA 4IDOA 1L6IA 3Q5GA 1IRXA 3ND7A 4URXR 9ABPA 3UATA 2NO7A 4H7EA 2DUJA 2O3SA 2XW6A 2ZSFA 1AZWA 2VOEA 4FGWA 4KR9A 5L7WA 1AH2A 4WL0A 4KXUA 2KM1A 2CVZA 4GL4A 4IDCA 5BURA 4YI5A 5HIKA 2R79A 3KT3A 3FUXA 5U9CA 2XSZD 3IXLA 4P2BA 3QLVA 5GONB 1DHTA 5A9TA 4FYXA 4JUDX 4E6PA 5ALQA 1JG6A 3AZOA 1THGA 1YVDA 2P41A 2UVQA 3QXJA 5E4TA 5E95A 1NKSA 3AR5A 4NENA 1TQ8A 3PPWA 4BFVA 4TRJA 1WMAA 1II0A 4RJLA 2COUA 1SCKA 3H1AA 2NWQA 3TNDA 4Z3OA 2WAAA 3LYAA 4JUFA 3SSAA 4D3XA 1OVMA 1RNLA 2IW1A 3V55A 3JD2A 3C7CB 1PVDA 1RLMA 1Y8CA 4BLUA 4DZRA 1MLDA 1S0UA 3TFQA 5E9JA 1UFRA 2VJOA 5AVUA 1N92A 2C2OA 2ZWOA 3BFXA 2HA2A 1E1QD 1G19A 2F3QA 3K0AB 1N8SA 1VMEA 1KDVA 4DBLE 1A9OA 1BWRA 1PV1A 4JEIA 3R40A 4RH3A 3RYCB 4ALMA 1TK9A 2ODTX 1PDVA 2QROA 4ZOLB 3RANA 1K2VN 4FYIA 2KLHA 4Z4GA 3PXAA 1CFJA 3KLBA 4FFPA 5A03A 1DXQA 1P5ZB 4UEKA 4M37A 1GPDG 4K1LA 2GM4A 4KO4S 4L8VA 2I2FA 3O75A 2AC4A 4FR5A 4KTVE 4PFKA 4TMWA 5CVVA 5TJHA 2O8EB 1W34A 2H1RA 2NTVA 2Q6IA 3A9SA 4RIGA 1R8JA 5AIAA 5F12A 2AD5A 4E31A 3G0GA 5F7OA 5K0BA 1HDOA 5ICSA 3QXSA 1N2CE 2CL7X 1PGQA 3KQVA 1XAIA 5D6OA 1Z34A 3OM8A 2BC9A 1QZUA 2ZUTA 4MTLA 4Q4CA 5KCMA 4ZQBA 5SV2A 2BCJQ 4DRYA 2PWBA 5JSKA 1UFKA 5MF6A 2YWFA 1GQFA 1RLIA 2AJLI 4BN0A 3S81A 1XQ6A 5KTKA 2YHAA 1EIZA 4OHXA 4UPVA 4A3SA 5LXTA 1UKEA 1ECJA 4C6HA 2M9MA 2RB4A 2AI3A 1U2RA 1J4AA 2JBWA 3QG5A 5E6UA 4EEZA 1VA5A 4MB2A 4RA9A 5C7LO 3TNJA 4HYQA 4MQBA 4HS4A 4NCHA 4LW8A 1B3RA 3TAUA 2H59A 4YBRA 2NM0A 1XR3A 3IA2A 3P0FA 4J9UE 1CJVC 1JLHA 1PL6A 1CD5A 2ZJ6A 3EY9A 4U8GA 5B4VA 1Y6RA 3COZA 3I2FA 3A4YA 4MS3B 1NUUA 5DCWA 2X1LA 1DBQA 1MRZA 3MGGA 2UZ3A 5KYNA 3ZHXA 5DBEX 5JADA 2VJKA 3ACBA 4BFZA 2NSHA 4FFLA 3TE6A 4U7DA 2CVQA 4EEXA 1CCWA 4F72A 2ZT6A 2GEDA 3OQJA 5C5IA 4DE5A 5D3MA 2VL7A 3ET4A 3S3TA 3FWKA 5F21A 5LN1A 1M2FA 1LSJA 4P22A 5HF6A 4DWOA 3ZX5A 1DJQA 1J8MF 5AJZA 4EYQA 4ZYLA 2GRJA 1GPYA 3G5LA 4CW7A 1ZOLA 4GVXA 3NEPX 1SFRA 1KJ9A 4IWXA 4XI9A 3M6WA 2JHPA 3OIDA 2JIRA 3SLGA 5JCPA 2B5WA 3OBBA 4JBWA 3CEAA 2E49A 1QVVA 3FYUB 3NHSA 4HDKB 2R47A 3EDCA 4QBKA 4BXOB 1Q1QA 4NCIA 3QH4A 5K09A 3Q3VA 2J5QA 1G20B 2BGRA 1KEWA 3ROEA 2QLTA 3IA7A 2IP1A 1KP9A 2B0CA 4QODA 1E5QA 3MJEA 4GQIA 4I14A 4EQ6A 1JZTA 5CR9A 3VNQA 2OE2A 3DZ5B 4FW8A 5DNAA 1GGVA 1F7UA 1NPDA 5AQEA 2P91A 2N46A 1L7OA 5D01A 3BXOA 1EFHA 3LX5A 3PFGA 3CRMA 1IULA 2XB6A 2PCJA 1GYRA 4G24A 4MYHA 4N7JA 2XWPA 4FNOA 4F56A 2WFLA 4UVDA 4UTVA 5K5EA 1V5IA 5KJFA 3ZVLA 4C0JA 4CV3A 4D8UA 1CT9A 3C97A 3EPKA 3L7YA 3MJTA 2X2OA 4R2XA 2ZSDA 1IUPA 2JIQA 4YH1A 1Y7HA 2NVOA 1DELA 4Q1EA 4OB6A 1Y98A 5FOSA 2W6MA 3A0UA 4X44A 4DV1B 3BG5A 3BREA 3WKDA 1HDEA 3NBKA 4KN8A 4DIFA 1IN4A 1M7HA 4EJFA 3VJRA 4WBNB 1UPTA 2JIDA 4OP2A 5J40A 1R9NA 3RQIA 1SXJB 5A2GA 5K3EA 6REQB 4JC8A 3O26A 2YZ7A 2PN1A 3LDFA 4HS9A 4Q66C 2DSNA 1SURA 3BRWA 3AR8A 1PQ4A 2FR8C 1WXIA 4LOLA 5LP6C 4BNUA 2G82A 3LXXA 4FT2A 3U2QA 1DMSA 3ZWPA 3PVSA 4R84A 1REQB 4WSOA 4X8OA 1M1YE 1EUDB 1CHDA 1P7WA 3GUYA 1X80A 1EFKA 4P08A 4PZUA 4ESVA 1XK6A 2FY8A 3OE4A 4NBLA 4PLHA 4Y0VA 3A1VA 2EKLA 2BKUA 3KO8A 5E9WA 4M0UA 2NTJA 5IMBA 5KYUA 1QYVA 3MINB 3OTGA 4UTOA 2RG7A 2VHTA 3NAGA 2O3UA 4JUAA 1UM9A 1YDFA 3CUSA 5J59A 4B8ZA 4B3DA 4F04A 4R2LA 1US8B 3W5JA 4IIHA 2PH5A 1K68A 2Z8YA 2HJWA 2I2AA 1JJBA 4QXOA 3WYEA 3E5NA 4C5BA 3IP7A 4RM2A 3FPKA 2E1PA 3GP3A 1LF5A 3L3BA 2EZUA 3OM0A 4NH4A 2MJLA 3D2CA 4UASA 4B3MB 2Q6KA 4PRYA 5BWBA 4RAOA 3AKCA 4FUTA 1OPRA 4W63A 3TOZA 3P45A 2GASA 5FA8A 1PFKA 1Q0SA 2EIXA 2UVDA 1F9AA 3BD8A 1EK1A 4Q34A 4ZQHA 3RG8A 1W35A 1YA8A 4MGIR 3IEPA 3D8NA 5IJ0A 2BDEA 1BXRA 3DFFA 1SR8A 2H52A 2XUPA 3N8IA 1BE0A 2VXCA 5CBKA 1YOBA 3GLVA 4Y6RA 4YMGA 2Y1GA 5ENZA 4EA9A 2ZRIA 2NT4A 3KT8A 4AZ3A 5HZMA 3T1HB 1XEFA 2D2XA 5CM2Z 4PO3X 3IXQA 2HIMA 1VHJA 2ROQA 1WMDA 2VDMB 2CXQA 3SZOA 1GNPA 1GA6A 3AT1A 3JQDA 5HZHA 3IL2A 3B20A 3RJTA 4EKYA 4OQXA 3DEFA 4OKNA 4KYTA 1A9XB 4DXDA 1KZ4A 5B7NA 3BKWA 2XQGA 2WWWA 2JA1A 3PHBE 5E1DA 3F73A 4N8EA 4CKZA 2I4LA 4HX9A 4LC9A 4FNGA 4GFDA 2KB0A 4Z99A 2P5UA 3KZXA 2Z2ZA 4IRMA 4ENWA 2GBPA 2LVBA 3ZJVA 2X3YA 4EKGA 2GAAA 4BKPA 1ORTA 3FFWA 2OBNA 3SDBA 2C1ZA 1N1EA 2IDKA 2A5FA 1TPYA 1ZVQA 4JWTA 3S28A 3OLYA 3B8HA 3RARA 2NXCA 3PNOA 1NVBA 4MDEA 1XRJA 1ZMOA 4HOYA 5DNEA 1SCQA 4D3ZA 3OOEA 3R5XA 4ETIA 1HTTA 2C5FA 2C42A 3N2YA 3D3WB 5I5GA 3UIEA 2V3VA 5CFQA 2I7VA 3B1FA 5J2TF 3MSXA 3PGVA 4Z4HA 5IKPA 3ONVA 3TN7A 3TMKA 3VISA 2OC9A 2DHQA 1G6KA 3KVOA 3EZ2A 1G5IA 4KKXB 3OZUA 1T29A 3DBLB 3G0DA 4YQZA 1W0JA 4XYGA 1EDOA 3W9SA 2WUDA 4JI3B 4XUCA 3VNRA 3SFZA 4TVSA 3KKEA 3LF1A 5CAEA 5JFGA 2WU0A 4OLFA 2NU7A 2GD1O 3I2IA 2Y71A 2IHKA 2Z8ZA 5LIRA 4EW3A 1WLSA 2PIAA 2D7CA 2IXEA 4MMYB 2PBZA 2YN2A 2Q2VA 3DZ8A 3HBNA 3LG2A 4EB6B 5IRCD 3IHWA 4Q02A 4ZVTA 1ODLA 1SIOA 4L6IA 2YMPA 4NFYA 1FDUA 3FE2A 1KY5A 1QZZA 5BQFA 3BORA 3JWGA 1YQWA 3C6XA 3GFPA 5TF0A 3SLKA 3X1DA 4A8TA 3TE7A 1HLDA 2ODEA 2WHXA 1KIFA 3FDIA 2P2SA 3JASA 5IDXA 1WB9A 2RKBA 2C5LA 2C9DA 4O25A 1M5UA 4HFNA 1KK3A 1C8VB 2SKDA 2R1VA 3L6DA 3PS9A 4ALNA 1DWUA 1T3HA 4CF3A 2V55B 3VPBA 2OV2A 1RQNA 4CCYB 3QA9A 3EXHC 5FNVF 3WYDA 3D3NA 1W0KA 1S1MA 4EL0A 1ZNZA 3B5EA 1DXYA 1XFDA 1ZS9A 2C2ZA 3EMDA 4BDTA 2NVUA 5JU6A 2OMEA 2IPNA 3LOPA 5CLJA 3HK2A 3H3JA 5IEBA 1TZMA 2B61A 2HCBA 3ZHTA 4B31A 3KJHA 5K0FA 4UKDA 3DVSX 4BGIA 1WHTB 3UGJA 1ICIA 3P9XA 5TB5A 1U1GA 4IDFA 2CSXA 2OO7A 3QOYA 1XN4A 2YYSA 1H65A 4QXRA 1BW9B 2IYFA 3KL4A 4OHFA 1U0JA 5FULA 3CISA 2VQDA 3RU9A 1BDJA 4QDZA 1UBFA 5ESXA 4AD8A 4DBZA 1RE1A 1HA3A 2HA4A 1Q84A 1UT6A 2CXUA 4UPDA 3SDZA 1Y7TA 2I78A 2QM7A 4OQLA 3L4SO 1TTQB 2V4MA 4MGHA 4JH0A 3RUHA 3BXXA 3U61B 2Y0EA 4RD2A 5GVSA 5H81A 4MV9A 3WHKA 4RLHA 4Q48A 2XMCA 3R75A 4MCHA 3QV1A 1BA2A 3HCWA 4MQ6A 3V7NA 3GAMA 2PG3A 4N1AA 4E2FA 5JDIA 2HB6A 4EG7A 1RCTE 3WBKA 4XQGA 3GRRA 5JQWA 3PKJA 3RKRA 4AMYA 1VPVA 2MYPA 1G7SA 5BMOA 1L7AA 3K3PA 1FLAA 2GB4A 4HDRA 4F9TA 2FG7C 2H1LA 3AVVA 4ZVPA 3DDUA 3U9LA 4CT5A 2EGUA 4XRRA 3QEBZ 2B7CA 1Y8QB 3CNHA 4P35A 1XRRA 2H18A 3EZ7A 4N5MA 4CM1A 5ILOA 1C1XA 1GGJA 1EX6A 1AM4D 1QHFA 3G5MA 4CDMA 1HEYA 4KH1A 1CC1S 5JD4A 3CUKA 1ZI6A 2XNSA 4CDGA 2W4IA 5DSZA 5EL0A 2FP3A 4OY3A 1MH1A 2AK2A 3N2KB 4IWYA 4OREX 5BMVA 3P0RA 3RIMA 4EZIA 2WC1A 2I7TA 3FNQA 2MSLA 4J16C 1LNSA 3M2TA 2H0QA 1RKQA 3PQ4A 5DMXA 2FEWB 5HJ2A 4UDYX 1OXVA 2OGWA 2R65A 3B36A 4K6HA 3OCZA 4KX5A 2ZB4A 4RNDB 3TW6A 4D2IA 3RREA 1T0UA 2VBIA 3H86A 3F5MA 5IJXA 3BHNA 3I9V6 5GGXA 1GU1A 2GXUA 2OK8A 2GR9A 4YDRA 3PYXA 1SRRA 5IKXA 1EXNA 4HB3A 4UD6A 5JMWA 1XD9A 1PSZA 3KB1A 1W87A 4P7FA 4RLFA 5KYGA 1EBUA 4Q7KA 1MJGM 2FFJA 4QASA 1T5HX 1JEYA 1FFSA 1FNCA 2I4OA 5IDYA 5JJBA 3HL0A 4CKWB 2QZSA 4Q1FA 1AHPA 4NMMA 5ALVA 3SSNA 3REOA 4DC1A 4IINA 3CLTC 1V5WA 1ZWLA 3MQ4A 4O0LA 3FVRA 2V03A 4Z51A 1D2AA 1UOOA 2VK4A 4KXLA 2MYUA 2WAMA 4RGQA 3RU7A 1HOTA 2QYHA 5JAIA 3DOFA 1QU2A 1H8ED 3CGGA 3GLHA 4BRUA 4Q21A 2PWPA 2HAEA 4IDHA 1WVMA 2QDXA 4UCFA 1J0BA 1NBIA 5FPQA 2EF0A 3AJ9A 1ZH4A 3V7UA 2NUPA 1LK5A 1DAFA 3D2AA 4D0NA 4IDEA 4NLLA 3DA8A 4Z9XA 1ESZA 1PTJA 1YIAA 4J6EA 4TTAA 4UUNA 2G17A 3HM9A 3KSZO 2FPIA 4IEFB 2VDJA 4CGYA 4H4CA 2BR4A 3LYLA 4R7ZA 1JB1A 4F5DA 4QA9A 4YRBA 2VDPB 3ED5A 1P7PA 2HM7A 2ZDGA 3Q12A 4HDAA 4WGFA 2V54A 4TTPA 1I2ZA 4X6XA 1CTQA 3RUCA 2C4HA 1FTNA 2F3RA 4D02A 4IZHA 3ZS8A 3QKRB 3WX0A 4DANA 1Z33A 1JLSA 2V0CA 4BNYA 2WVHA 3BAZA 4RE5A 3EY4A 4KOAA 1C30A 3AJDA 3D8TA 1BD4A 4FNMA 4O59O 4FOSA 4XLLA 5DCYA 4ZAZA 5M2QA 2BEVB 1CY1A 3GMTA 1CNMA 3RRZA 3AF0A 3N76A 1HLPA 5JYEA 5JEDA 3DE3X 3DOIA 3I39X 4TV9A 5EJGA 4ARZB 3NWPA 1NASA 3MD9A 4YT2A 4AWXA 4BMDA 5KOHA 3ZLTA 2KW5A 4TVKA 5EVCA 4GX0A 4BVBA 3ZE1B 2AE2A 2CHVA 1VMKA 3R23A 4IDAA 3VA7A 3EPBB 3RIGA 3TUTA 4H08A 1UBNA 4U6QA 2BISA 1EUCA 3PKIA 4MUNA 1DIAA 2XDAA 3VI3B 5EQDA 3LKDA 5HTOA 3QBEA 1GKUB 3LLCA 1E99A 1U3CA 4C07A 2UZAA 3FJOA 3A6JA 3ZWAA 3F7TA 4YA6A 1CIVA 2W70A 3OF2A 2OPBA 3WQBA 3IEKA 2Q1YA 1RZRA 1JDBB 521PA 4AKHA 1ADCA 3EGVA 5DGDA 4XPZA 2O2IA 3D43A 2IJGX 4FOOA 3D31A 1J07A 4DZZA 3OTHA 1JHZA 1N8TA 1IBMB 1L4FA 3JVIA 4LVCA 4D9JA 2GD0A 3VI4B 3A37A 3M5PA 1D3AA 1ZSNA 4CMIB 1HWYA 2HMVA 1Z74A 5K3DA 3RYHA 4AN4A 4K26A 1EXVA 1W29A 4C3OB 2AOUA 2ZI6A 3OJOA 4MR7B 1XRPA 3DFZA 5J4HA 1KTIA 2B1IA 2FUNB 3RKUA 4BNNA 2YHSA 3A6GA 1N3YA 5SZIA 4UNRA 3KETA 2YRWA 4BV3A 2C5HA 4U9IS 1P18A 3WV4A 4KIFA 1Y5RA 3THXA 4OYYA 4YJ2F 1JMKC 3IBTA 3IAS1 1COWD 3NIDB 3UOWA 4FYWA 3CVJA 1SXQA 4HSGA 2O2CA 5CDYA 2Q9UA 3A6FA 3EWSA 4DEVA 3QENA 5K9ZA 4O4IF 5CH5A 3ZHQA 3JQAD 1TAUA 4U3JB 2VPXA 3TQHA 3L0CA 4O8CA 5BY2A 1EVJA 1M0SA 1R0CA 3ANMA 3KX2A 5AVQA 1QE5A 1T35A 2CNBA 3O2QB 4JDUA 3GBPA 1X39A 3KJXA 3O9MA 1DJMA 4X8LA 1N7GA 1ADGA 1F38A 1PL7A 1ZBQA 2VVTA 1KZ6A 2B2CA 3FUUA 2O3RA 2CBXA 2YY6A 3L93A 1JXAA 3PNPA 4MAAA 5CH8A 1U63A 3WB2A 2Q5OA 4QGHA 1O9BA 5L3QB 1Y34E 2YHIA 5HEKA 3ZPXA 5E7QA 4BNWA 2GYYA 1AGRA 2NXNA 2B21A 1CW2B 1E5VA 1ADFA 1P0PA 5AJHA 2NPIA 5IYZA 4BQPA 5KSYA 1NXQA 2F4VB 2PRKA 4Y98A 4NAVA 4QBHA 3ZY6A 3FZEA 1XKLA 3VHLB 4AKIA 4UHFA 1R4MA 3TJZA 1IFXA 2XTMA 3LLSA 1I36A 2WR8A 4KODA 4ZVLA 5DM60 4AY5A 1N36B 1DCKA 2RGYA 3M6UA 2C84A 2VIIA 3EAQA 4L9AA 2F3SA 4QT0A 3HKCA 4QUKA 5ESDA 3CPSA 3M5WA 4N3GA 2GDZA 2VN8A 3MPUA 4PIPA 4TS1A 3ND6A 1YMVA 2VDQB 4B3XA 3QBVA 4ZDWA 3ZV6A 2IP2A 4ESHA 2HJSA 3OVMA 2QS9A 3DM9B 4FINA 5J9FA 3FMIA 1KO5A 1ZK1A 4M6WB 5FJIA 3AI3A 1NM5C 4G5FA 1PWXA 4J0FA 2VPZA 4CU5A 3I04A 1H0SA 4TT3D 3EEOA 4KXMA 4AWBA 4TXJA 5CW1A 4QTUB 1XWWA 2I7DA 1WVGA 4YWHA 2TECE 2W6ZA 3AEKB 4Z7NB 2PS9A 1NWHA 3CM0A 3I6QA 4KBGA 5GAJA 2UUCB 3BJIC 3D1LA 4IIJA 4PN7A 2IWRA 2QZPA 4RETA 3TOCA 1YIDA 3N9IA 4KQXA 1TA4A 3OPYA 4I1IA 4B6PA 2VDOB 4EVSA 3EE6A 3QVVA 4AS3A 4JI1B 1VXRA 1WB6A 3GAZA 2PH3A 3JQRA 1VJ5A 1DCMA 4RDHA 1GA4A 4B3SB 2BFNA 1E4EA 4KKVA 3SC2B 3RRNA 1A97A 4C6RA 4CV2A 3M4JA 1ZN2A 1DBPA 1GGKA 4OH1A 3R7WA 5KX5F 5KTTA 1XOIA 3CF4G 1ZK0A 4M0EA 3PUVA 5DLEA 4I4TA 2H1OA 2BTQA 2R86A 2IYEA 5IT0A 3PUJA 1NP6A 3WWEA 4CV0A 5K0SA 2Q6OA 5CLIA 2Q5IA 2Q29A 1N1GA 2IYAA 1L5ZA 4JKYA 4X3CA 2QTWB 4EYSA 2QL9A 2FN4A 2A30A 2V3WA 3MMSA 3VGJA 1XTZA 2QT0A 4PAQA 1TB4A 3BKXA 4PSAA 2BRUC 3GVPA 4XD2A 4NU5A 1SQGA 4DV2B 2QN3A 4DIBA 1IY8A 1T9GS 3TTVA 1LDYA 5FBRB 2DLCX 4KMSA 2FPXA 3BGWA 4TQGA 1VKRA 5IAKA 1N4AA 2WJ3A 2XGMA 1L7BA 2A6PA 4TV8F 2WWXA 4EKIA 3EIXA 5E8JA 3WZ2A 4GBED 4EI2A 3W8DA 4EFMA 4U2FA 1QYCA 1U3UA 4NV1A 2W2KA 2H3HA 4UCXA 2G7MC 1KNQA 1XZQA 2GSDA 3GEPA 1F06A 5C3UA 1WBDA 2ZWMA 1JKXA 1C80A 2J08A 1J8DA 2ZBRA 3D7NA 3ZU6A 2GERA 1XDSA 2JD0A 1H1DA 2R1TA 2F43B 2G09A 4MSUA 5JNSA 3BPSA 1JJFA 4QPCA 2HGZA 3I8SA 4DKJA 4U7WA 1P4JA 4DUGA 3A3YA 3EARA 4CKCA 1WV1A 2WJZB 4ZXPA 2BEJA 3D8HA 6LDHA 1C3EA 3OT4A 3ZHRA 2QGZA 2VPIA 3UAWA 4C0HA 4FKBA 5FB3A 1O97C 1C4OA 2JBAA 3I9LA 3OJEA 4RIEA 2GBCA 5KYXB 1YMQA 4EELA 1UANA 1YT5A 2CXNA 4L02A 1R0XA 1DZIA 3IE1A 2BI4A 3DHYA 4GE3A 2XXAA 3BFJA 1FP7A 1L5MA 5FL7D 1FYWA 2FNAA 2OL4A 3AEQA 4CL0A 1U11A 1RQLA 5BRNA 3D7MA 1Q50A 2NU6B 3RS3A 1Q7TA 1QG2A 3EUFA 4X71A 3VKWA 4GXRA 2XI4A 5F7JA 4YR9A 1R18A 3Q98A 5FIUA 1ZC3A 4MUBA 5J2TB 3AVXA 2N1BA 4I3HA 1O5TA 4HGQA 4JLSA 3I6IA 3W6NA 3V8BA 4ASUD 2W2XA 1WOMA 3IAFA 1M74A 3NB0A 4I5GA 1VHWA 1O54A 1R4ZA 4YY3B 3E18A 1X1DA 3QLVC 3GYBA 5EPUA 1FJHA 2X5XA 5JFTA 5GADl 4WXMA 3HKEB 5YASA 3D6FA 1BMTA 1BROA 4OJMX 1DRWA 3B3AA 2AHRA 4MOWA 1NJSA 3NHAA 4P4UA 4F4DA 5IKEA 3TLXA 2EL9A 3DMPA 3RVSA 3WB1A 1ESMA 1MNQA 1BE1A 2JIPA 1I3NA 2PPVA 2DT5A 5HIJA 4BP9A 1E3DA 3ORFA 4AJOA 2ES4A 1JGTA 5B57C 3F9IA 4IR7A 1DV2A 2BJVA 3SLRA 1E69A 4E5YA 4LE2A 4RC9A 2XMZA 3SXUB 1AG9A 1VP3A 5AK3A 4ZDJA 1XXLA 4GI1A 1SBCA 4KFTA 1NW9B 1QP8A 3AR2A 1X8KA 3F6RA 3Q40A 4G2NA 3PUXA 3ANSA 2J0VA 1O2DA 5TVKA 2C00A 4KITB 3PWKA 4L51A 4B8WA 2R66A 3BL8A 4NICA 4PHCA 1ZMTA 1U28C 2P9HA 4CL2A 2OCKA 1A72A 1WXXA 1W85B 3R7BA 4B2LA 3GNQA 3DXXA 4G9GA 2B2XA 4LI0A 5IC5A 3CW8X 3ZWDA 5EQFA 3LZDA 4LV8B 5SZKB 3I6ZA 3UPTA 1DE0A 2Y77A 3PQEA 1SA0A 1CS0A 4OCZA 1NAHA 3W05A 5COAA 3T1VA 1IG3A 2WJ4A 4IMIB 4TS9A 3NVDA 3W2FA 3L01A 5H82A 3UT5B 2GBFA 4YO8A 4V39A 1T4MA 5LQMA 4RVSA 4QJ3A 2A35A 4OEHA 4MS4B 1KYYA 4CMBA 4YP0A 3I0ZA 4X6UA 1L7NA 4IVPA 4A5SA 4F12A 4TMFA 2QG4A 5HILA 3TLJA 3A1CA 2X5NA 2W2MA 4XLTA 4BQRA 1R3UA 2O5VA 3ZI7A 4OQ4A 1PJCA 2RH5A 3V80A 5EJIA 5LKRA 3AFOA 2G63A 1BE8A 1BXZA 1Z5GA 2HH9A 2Q6LA 3H16A 3K1YA 4TRNA 1QAQA 1V48A 3A27A 4QHYA 4NTZA 5KVVA 1OBOA 5L95A 2GN0A 2AS0A 4X1YA 1E61A 4DILA 4HZUA 1L5FA 3EEYA 1J70A 5F1PA 5EP1A 4ZJYA 2R2GA 1Y8RB 2R6AA 4IXDA 4BYGA 1B1CA 4ZYTA 2J3LA 2C2MA 2MSNA 2BZGA 4S1PA 2JAXA 2BH2A 2Z1MA 3ABZA 2AFIB 3IBCA 3LQRA 4AU1A 2WDPA 3UA4A 5DP2A 5C8XA 3DE0X 1I4LD 2GXSA 2RGNA 2XOKD 3CTMA 3GGCA 3IRVA 4WN3A 4JJ7A 3V2HA 4F85A 1AHNA 5B4TA 2OY0A 3HA3A 5T7BA 2H48A 3E4DA 1RYEA 1XQ9A 2ETVA 1EJ2A 3GLUA 3IKTA 4OJKA 2H63A 2P8JA 4WKBA 1Z4IA 2VZ9A 1R15A 4JI2B 1TKBA 4PIVA 1U7WA 1KYWA 3MERA 1H2RS 3DSRA 2F64A 5HKKD 1YZTA 3ZDBA 1W1WA 4W8HA 3H6GA 4MEAA 4C6TB 1IQ0A 4I50F 4PLWA 3ZU5A 3VDQA 2XCLA 1VSQA 2FEMA 3TCNA 4DADA 1VFPA 3N75A 2IRWA 3WGZA 1Y82A 3DKIA 4P8RA 2GRAA 5BPFA 2VDKB 3KQLA 3ZHSA 2QW1A 5DF1A 4R98A 4EUKA 3N8KA 1MUUA 3BGSA 1QDUA 4YMWA 1JZQA 2FU5C 4MPDA