3BTUA

Crystal structure of the super-repressor mutant of gal80p from saccharomyces cerevisiae; gal80(s2) [e351k]
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
420
structure length
392
Chain Sequence
APIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRKEIMKVYHLRNYNAIVGNIHRLYQSISDFHFNTSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
total genus 121
structure length 392
sequence length 420
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btuA01
5I7SA 4PG7A 1PX0A 5COBA 4BNXA 4GKBA 1ZCJA 3QLJA 4ZJUA 1VC2A 3Q9NA 3KOUA 2JFHA 3GN2A 4O6VA 2JHFA 1U3VA 3ZWBA 1ZW1A 4KWIA 4YBZA 3M1LA 3AUTA 1K89A 1A5ZA 2JCXA 3UGKA 3VZRA 4GX5A 3GGOA 2Q45A 2WYWA 2Q49A 3C85A 1YONA 3MOIA 3PHHA 4NJOA 4ALIA 1CYDA 5I9MA 3INRA 1W73A 3VH4A 3EZYA 3LDHA 1LU9A 4NFYA 4W7IA 4O1MA 3VH3A 2GF2A 1Z75A 3GVPA 2GCGA 4DQXA 4TROA 4XB2A 4XGKA 2FR0A 1E92A 5I7VA 4PLCA 3MJVA 4CM7A 2V65A 2QQ5A 4R01A 1RJWA 4UUPA 5K6AC 4NNJA 1ADGA 4CLRA 3DTTA 2EJVA 4IXWA 4CMCA 1H9AA 3AOEA 2W2KB 1W6UA 2CD9A 4WOKA 3RUCA 1LLQA 4CM8B 3GHYA 4PGFA 2HRZA 4BNNA 3V8BA 3OJ0A 4R1NA 2AEFA 3I9KA 2B37A 1A72A 2Y0DA 3VKUA 1ZIDA 4Y6RA 5F1KA 3AI3A 4DQUA 4MO2A 3NEPX 3DAGA 4F3YA 4H7PA 5L45A 4D7AA 4MOWA 3RVDA 1OI7A 1OAAA 3AW9A 4XGIA 3IJRA 3JQFC 3GEMA 2ZK7A 1BGVA 1P77A 3GOHA 2VZ8A 4CUZA 5ITVA 4XJTA 1EUDA 3DEYX 1YJ8A 4AJ4A 3UCFA 1I3MA 1DFGA 1WVGA 3JD1A 4IDEA 2HK9A 4AJNA 1SOWA 4EEXA 2O3RA 3N58A 1NVGA 1H2HA 4JJIA 1QORA 5BSEA 1C1XB 3PQFA 2G5CA 3DHYA 4PN3A 1DLIA 1PS0A 1CIVA 1MX3A 1QP8A 3MCVA 1LA2A 2OORA 4II2A 1NFQA 1X13A 5DCUA 4D3SA 1HE3A 1N2SA 1BHSA 3TRIA 3ZH2A 4N54A 3QY9A 3DZGA 1BXGB 1LDMA 2E6UX 4E32A 1ZZEA 2HSDA 3CEAA 3IS3A 3KYCA 3V2GA 1WMAA 4NMHA 4TMFA 1ZNQO 4FC6A 1LSUA 3TDKA 3ENKA 4J49A 1DSSG 1UXIA 3WNQA 4E30A 4R4JA 4BO8A 4ZA2A 4NBVA 1VE9A 1X0VA 2D8AA 5A05A 3PHGA 3MJSA 4U0JA 1NASA 2V7PA 4WEQA 3MTJA 1TA4A 4JX8A 3WQSB 1DC6A 2Y1OA 2PR2A 3GZNA 4XA8A 1NWCA 3TL3A 2I5PO 1MC5A 3HADA 2C0CA 4YR9A 1Q0QA 5CFZA 5A9SB 4NFSA 5MGBA 4J0FA 3KZVA 3U0BA 1YRLA 4R9RA 4XQCA 2JFFA 2VYVA 1XG5A 4RL6A 4BIIA 2WE7A 2PGJA 3ICPA 3RAJA 1E7MA 4QO8A 3ZWPA 2NU8A 5B4TA 5BNIA 3HSKA 4YRDA 3INGA 1UXGA 1HXHA 2O7SA 4HFJA 1B26A 5H82A 2W98A 4Q3EA 5JMWA 3E48A 2Q4EA 2IYOA 3WNVA 4HFRA 3WWYA 4OH1A 4OSOA 1I2ZA 1Y8RA 4YQYA 4MVJG 4Z3DA 4PG6A 3HDYA 2ZCUA 5DDIP 1FJHA 2ZJ0A 4KDFA 4NJMB 1PJCA 4B7UA 3QVTA 1NHGA 2QYSA 4U6SA 3DFUA 4IMRA 1NM5A 3B20A 1F8FA 1PQUA 4Z9YA 2QIOA 1N7HA 4JNKA 2YV1A 1HYEA 3JQFA 2VNAA 2VOJA 3I83A 4WGGA 2VT2A 4GX2A 4IM7A 1NWHA 3DZIA 1T4BA 5EERA 2W2KA 4LK3A 1PZHA 3KUXA 1R6DA 4O63O 4QQRA 3H9GA 1YE3A 5BSHA 1QXSA 2NV6A 3DBRB 4L73A 3JYOA 3O4RA 4EUFA 4EZBA 2D0IA 4IJKA 5JDCA 2X0IA 3FR7A 4XCVA 2GN8A 2F1KA 5I9LA 3F3SA 3I4FA 4YAJA 5KVSA 1ZK2A 1I2BA 4YJFB 4MP6A 1G6KA 1OOEA 2BI8A 5CEEA 4OYRA 3PQDA 1GPDG 3HHPA 5I8WA 5DBIA 1N1EA 1NFRA 3H8VA 4L4XA 5KOIA 3BTSA 4RLHA 1E0DA 1P45A 1T2FA 2VHVA 3IQDB 2C54A 3OA0A 4YCAA 3RSHA 4RF3A 2O48X 1GFSA 3OEYA 4I5GA 4TRNA 1KEWA 4MJLA 3OJEA 2RAFA 4BUCA 1I10A 4CLDA 1PIWA 4AG3A 1WDKA 4A7PA 4R41A 1BSVA 3EZLA 4CMKA 4ZHSA 2NU7A 3QRWA 1H9BA 3DOOA 5ADHA 2VYNA 2Y93A 3BIOA 4GL4A 3HUDA 2Y1DA 4OMUA 4WCFC 2BD0A 3D0OA 3L9WA 3GEGA 3ULKA 3B6ZA 3O9ZA 1MUUA 1U4SA 2Q22A 3DB2A 2IZ0A 2QRJA 4D45A 3AUSA 3H5AA 5HA5A 2OZPA 4LRTB 1U3TA 5CPBA 2X58A 5BT9A 3I9LA 1LC0A 5EL0A 3QIVA 5JY1A 4BV9A 2C2YA 3JQAB 4OQYA 4ZRMA 4J43A 3RJ9A 4NIMA 1S7CA 4ZICA 1ADBA 4HP8A 1PJQA 5DBGA 4Q3BA 1O5IA 3L6EA 3UHAA 5JY6A 4RF2A 3TZHA 4CR6A 3S1LA 4Y6PA 4BS9A 2AG5A 4Y8VA 3G1UA 1MXHA 4CM8A 1R12A 1E3WB 2BMAA 4XRRA 3F1KA 5K9ZA 1QRRA 4CLEA 2DKNA 1KEPA 1UP7A 4BNYA 1TT7A 3KYBA 1NVMB 2X9GA 3AM3A 3QQPA 3GK3A 3Q0EA 1P3DA 3QW2A 3NJ4A 4J1NA 3WGIA 4BO6A 3W8DA 1XQ1A 4UVDA 5A3JA 2BFPA 3AUAA 3UW3A 1KC1A 1WMBA 4IUYA 4QFCA 2D59A 1DIBA 3B1FA 4HFNA 1YXMA 2RIRA 3WJ7A 3B1JA 4J2OA 2GNAA 3LQFA 4Z3KA 3E1KA 2O3TA 5KJCA 3JV7A 3RASA 1XSEA 3T7CA 2UDPA 2Y1FA 1PJTA 4EEZA 2A9FA 2O23A 4TRJA 5CDSA 1O0SA 2QRLA 4GPD1 4E6PA 2IEBA 3OSUA 3C1OA 1C1XA 5JDIC 1H6CA 1HEUA 3N7UA 5G0WA 4E2ZA 2NQ8A 4QO7A 2PD4A 1V8BA 5A03A 2NTJA 3KYDB 4MVJH 1U7HA 3EK2A 1G0NA 3VAZA 1R4MB 3TN7A 1AHHA 1E6UA 3DMTA 4ZQHA 4FJ2A 1C0IA 1HDRA 1V0JA 5EQFA 3C7CB 5A3VA 5CG2A 2AQKA 3FRJA 3KLPX 7MDHA 3PXXA 2H5LA 3SC6A 3ZI0A 4R3WA 4K28A 4TKLA 3WGHA 4CV2A 1U2GA 1IULA 3WXBA 3KB6A 4UREA 1Y5RA 2BLLA 3S55A 1KEVA 3VVBA 4LSWA 1ULSA 4MVJD 4BGEA 2C7GA 5DZSA 3DONA 1ENYA 4GSKA 4AJOA 4E0BA 4WCDA 4FCCA 2HMUA 4JN6B 1UR5A 1B16A 4BO9A 1V3UA 4Y6SA 4E5KA 1A9ZA 1ISHA 2Y05A 2CMDA 4LCEA 3H7AA 2WDZA 1R4NB 2PZLA 4S3MA 4BQPA 4NU5A 3DOJA 4XEHA 3PGJA 1R4MA 2JL1A 4UEOA 1PQWA 3CSDA 5B12A 3W6UA 1WZIA 4OKNA 3GVCA 1U4OA 3UVEA 5KNLA 2ZTVA 1LEHA 4B79A 4EBFA 3LT2A 4J91A 1WWKA 4ND1A 3JQEA 4MP8A 2EW2A 4X54A 3VPFA 2V6MA 3WSWA 2Z95A 4U0KA 5EIOA 3GRPA 3WYBA 3ZU4A 2GPTA 3KV3O 3Q2KA 1B8PA 3H3JA 3FI9A 5JLAA 3U49A 3UICA 5G4KB 5GZ1A 2ZJ1A 1DXYA 1MLDA 3QA9A 3FPCA 3PHJA 4RPLA 1EMDA 3D64A 1E3WA 4FFLA 1H6DA 2ZCVA 4EI2A 3DAPA 2EIHA 2XPCA 3NUGA 3ZWYA 1J0XO 3HDHA 1KVTA 4LRSB 2BFMA 3L77A 3VH1A 2VRCA 4TKMA 1R16A 5EINA 1B15A 2VN8A 3HE3A 4O0LA 4J0EA 3QVSA 1H0KA 1KIFA 1T2AA 1T2DA 1TI7A 4R9SA 4NHEA 4J7XA 3EHEA 3LC2O 2PH5A 4HX5A 4BOYA 4NZ9A 2G1UA 1FDSA 3WQRA 2ZQYA 2HMWA 4AJIA 3LC7O 1YBMA 1EFLA 1ZBQA 1XU9A 3ONDA 3GFGA 3OP4A 3PWZA 2D5CA 4GMFA 2E37A 1LJ8A 4EJ6A 1UUFA 2WM3A 1NP3A 2R2GA 1PR3A 5IZCC 1F14A 3LZ6A 1IYZA 1ONPA 5AXAA 1YS4A 4UEJA 4MVJP 1IZ9A 3E5MA 4ZU3A 2HU2A 4OSPA 4XD2A 2WD8A 1LDBA 1XKQA 4MKXA 1IZ0A 1Z73A 2DTDA 2TMDA 1B8VA 4CMAA 5JCXA 4WE3A 4BO5A 1NR1A 1Q1NA 3NTRA 3T4XA 5K6AA 4FGWA 3FHLA 3D7LA 1E3JA 4L4RA 3SC4A 1Z82A 5C3MA 5KVCA 1BWSA 2BI7A 4TVOA 3TSCA 1BG6A 3AWDA 1Y5MA 1GY8A 2GLXA 5JCJD 1P1JA 3UFXA 2PKQP 5GZ6A 4YAEA 5I7FA 4DLAA 1HSZA 4R68A 2YJZA 3GRKA 3LLSA 1OFGA 4U7WA 4BO3A 3F5SA 4NJMA 4A27A 5KKCA 3F4BA 1IUKA 4FS3A 3W6ZA 2HDHA 5THKA 5KVVA 1GCUA 3L6OO 2CF5A 1XELA 2YW9A 3ASVA 3WLEA 5CDGA 1IL0A 4GWKA 1PGNA 5JYDA 1HZZA 2HMVA 1DAOA 4IDGA 2OHXA 1QV7A 4R5HA 4MIOA 2FP4A 5JXWA 3E8XA 4IDFA 4MVJI 5FI5A 5EJ2A 2C07A 2I76A 1R4NA 1P33A 3STHA 4PIVA 2JCYA 2GUGA 1J6UA 4XJSA 5G0SA 3VZPA 3UKOA 1GR0A 2O3JA 3M1AA 3JD0A 1D8AA 1N5DA 3SJUA 4B3JA 1Y8QA 1LRJA 4RZIA 2GD1O 3PJDA 2B83A 4IDCA 3WSVA 2RCYA 3JQBC 2OBYA 4KWHA 4KTVE 3CXRA 4PRKA 2CY0A 1KC3A 1QLJA 4DVJA 4WPGA 2NVUA 2PV7A 3FPLA 3ZN2A 3ONFA 4E2WA 1AGNA 4Z0PA 1F0YA 1GUYA 3WTCA 1T24A 1JN0A 3NT4A 5IDYA 1EE9A 2BGLA 1UH5A 1O95A 3RUAA 4G65A 3JQAD 2D4AA 4WLFA 1M66A 4BO1A 1OMOA 3QJ5A 4CM4A 3CKYA 2HLPA 2NTNA 3F5QA 3GG9A 5ER9A 1WDLA 3WIDA 3NGXA 1HDGO 1LDNA 4DPLA 5ER6A 1ADCA 4RPGA 2O2YA 1XGKA 3C3XA 4YQZA 3VC7A 4IQ0A 4YT5A 3ZV5A 4KP7A 3DDNA 1QLHA 1I24A 2X5OA 4FBGA 2AW5A 3PIDA 4KQWA 2CVOA 2V6BA 2NUAA 4CV1A 1O8CA 4UAGA 4XYMA 3TZCA 1CQJA 3JYLA 2AQHA 3QV1A 1DO8A 2BH9A 4BNWA 4BNFA 4XIJA 3GLQA 4GI2A 1UZMA 5BNFA 3LVFO 3AJRA 3VPHA 3RBZA 1BMDA 2VHWA 2YQ4A 4OGWA 5DNAA 4PLFA 2B36A 3FNHA 4Q3AA 1NFFA 4ZQBA 1D4FA 3ONEA 2JKVA 3OF2A 1YGYA 3O8QA 1D7OA 5DOVA 1KS9A 4ZRNA 1LDGA 3RI3A 4LN1A 4EUEA 4AFNA 4FB5A 9LDTA 2HKIA 2FOIA 2UUOA 4EYEA 5JO9A 3R3JA 4YJHA 1BW9B 5BQFA 3ZV4A 1XA0A 2AHRA 2YFQA 1BVRA 1EDZA 3BTUA 4DYDA 4UVGA 2WYUA 3I4CA 2CF6A 3K31A 3WYCA 3VKVA 1ZH8A 2E48A 5AYVA 2VUSA 4EJ0A 4MVJM 1DB3A 5ICSA 4P22A 1ONNA 2WD7A 2J8ZA 1X7HA 3ORFA 4OXNA 1GYQA 4WCFA 4J1SA 4GMGA 1LTHR 2OP0A 4MVJF 4AJKA 4RF5A 3HFSA 3ZWXA 3LK7A 3G0OA 1ISMA 1LQTA 2IRWA 4KUEA 5KKAA 1C0KA 4BO7A 2HAEA 3UCEA 1CERA 4CPDA 3LT0A 1PL6A 3GNTA 3IAHA 3BMNA 3NTQA 1I3NA 4NK4A 4D3FA 3U4HA 4DMMA 1T2CA 4DIOA 5DULA 4PG4A 5AOVA 4EDFA 4YJGB 1E7WA 2HJRA 3HZZA 5ENDA 2NU9A 2CNBA 4TWRA 5DN9A 2P9EA 2PZKA 3K96A 5JSFA 3WJAA 3NYWA 4IZIA 4ALMA 1TT5A 5FEUA 1E7QA 4CQLA 4MKZA 1ZJYA 4PRLA 1OC4A 1X7DA 4W9NC 1OBFO 1XIVA 3QWHA 1ML3A 5L51A 3GGGA 1DPGA 3RFTA 2W8ZA 4YTEA 5JAQA 9LDBA 1C1DB 1LX6A 3PK0A 1VL0A 3DQPA 4JIGA 4RLSA 5IN5A 3WR5A 4BNUA 4NDNE 1DEHA 4CQMD 3RKUA 2O3UA 4D42A 3PFFA 1ORRA 1E77A 4C7JA 1A4UA 2YDYA 3GC6A 2IDZA 4XQ9A 1YJQA 3D3WB 1E6EA 2P9CA 4DTIA 5T5QA 1GAEO 1YDWA 2PY6A 1VI2A 4CLHA 1ISFA 3MJEA 5DP2A 3EUWA 1IE3A 4O59O 4E5YA 3EGOA 4ALKA 4CUKA 4CLXA 1E1MA 2G82A 5TIIA 3KM0A 1HWYA 3VDQA 4BKUA 3TFOA 4G5HA 4A10A 5KTKA 1PGOA 3MWDB 4I5DA 4D44A 1UJMA 4Y98A 5HBRA 3BYZA 1PJSA 5CDYA 5JS6A 4B3IA 1EUZA 1ENZA 3ON5A 4GLOA 1LLUA 3OBBA 1EBFA 4KOAA 4QEDA 4D0SA 3KXDA 4BNLA 4CMHA 3WG9A 2B4TO 2I66A 1IY8A 4ITUA 3WOHA 3NKLA 4Q3CA 3ZWMA 4BHTA 4IINA 3L4BC 1GZ6A 1IPFA 3KLMX 1PGJA 4A5OA 2I99A 1DFHA 4GGPA 3IJPA 3WGYA 3ZU2A 3GGPA 1NTOA 3KBOA 1YB5A 3JQ7A 4E21A 4XDZA 4P8RA 4NR0A 2CSUA 4MVJA 3RC2A 3LU1A 4M86A 4YEDA 2CUKA 4DLLA 1PS8A 1ZO8A 2OP1A 1SBYA 4WK6A 1DDOA 2WD7B 4R5MA 2YYYA 1U2DA 3PGXA 4XR9A 1P31A 1P1IA 1U3WA 3TZKA 3RC9A 1FDWA 2NWQA 4ID9A 5T64A 1LRKA 2JAPA 1IPEA 2DPGA 1HSOA 2AA3A 1NR7A 1LDEA 3JQ9A 1Y9EA 5T8KA 2DC1A 4DQVA 2GN6A 1IB6A 1J5PA 5T73A 1H2BA 5DCWA 4HBGA 4B4VA 4OM8A 3DHNA 3O38A 1LSJA 1HDYA 1GU7A 4FDAA 1FXSA 1F06A 2HQ1A 2H63A 1GQ2A 5JFOA 3H2ZA 5GZ3A 1JLLA 2Z1NA 3NDRA 1KOLA 3PTZA 3NDIA 5HWSA 4TRRA 2YZ7A 1WW8A 3DXFA 1O89A 4W7HA 3S2IA 3AI2A 3E9QA 3SXPA 1A9YA 2CDAA 2FY8A 3ZV6A 1JVBA 4DREA 3OJLA 4A2CA 3FTNA 4PLZA 3T7EA 3UCXA 4CM9D 4GGOA 3D1LA 3OHSX 1MC4A 2VWGA 4FJ0A 1KERA 4P38A 2RH8A 4HADA 1GZ3A 1HDXA 4Z6KA 4RDIA 2Y0EA 3QVWA 1P1RA 3ETEA 1N92A 4BKOA 3PP8A 1C1DA 1FK8A 4XB1A 1PGPA 2YHIA 2Y67A 5G4LA 1RKXA 2JCVA 2VWPA 3I3OA 4OAQA 1PJ2A 4DGSA 2AQ8A 1EE2A 1JWAB 1DLJA 1YOVA 3RUIA 3PHLA 4Y9DA 3D4PA 3GDFA 2B5WA 3VOSA 4B7XA 1CWUA 3QVOA 1F8GA 4H3VA 1WZEA 1YKFA 2NVWA 1SMKA 1PJBA 3QSGA 4UEKA 5I7EA 5AXCA 3NDJA 5M6DA 3R0IA 3ASUA 3OM9A 4GX1A 1MG0A 1D1TA 1HZJA 4OQZA 4YA6A 3OH8A 2YQ5A 4RO0A 3WTBA 5MDHA 1N7GA 3K9QO 4PLGA 4BL5A 3L4BA 2PA3A 1E5LA 1KETA 2O50A 3TOXA 2Y0CA 1D3AA 4CMIA 1Y81A 3U5TA 3U4CA 4ZGWA 1R15A 1K5HA 2PH3A 1I30A 2VHXA 2DVMA 4UUOA 3BMOA 2RHCA 4YJFA 4M8SA 2XXBA 2DBRA 2H6EA 4J9VA 4AJHA 1X1TA 3C7DB 1AUPA 2WMDA 3RKRA 4RQTA 4QTZA 4EUHA 4J4TA 2X4GA 5HS4A 3K8ZA 2CDBA 4PLPA 1A27A 3ABIA 1A4IA 3PYMA 1M6WA 1ZVMA 4G2NA 1QYVA 4UULA 1SEVA 2VYND 3KO8A 4OOEA 3CZMA 4J1TA 4M54A 4NI5A 3FWNA 1SO8A 4YAIA 4QFDA 1UXHA 3ZV3A 1OZAA 3GZNB 4DMLA 1EDOA 3I6QA 4B7CA 2CVZA 1GYRA 1SB8A 1WDMA 1MV8A 4BKRA 3L4SO 1U5CA 4CMGA 2Y68A 3I6IA 3NJ8A 3WB9A 4H16A 4CJXA 3U4IA 5IF3A 1NAHA 2J5RA 4CMIB 4K1LA 1C14A 3DFZA 4U8GA 1ZKMA 1KVRA 4MDHA 4J7UA 2Q99A 3A4VA 5JO0A 1ADFA 4PLTA 3FWZA 3ZCXA 5HM8A 3I52A 3NT2A 5TS3A 4FD3A 4L76A 5T6BA 4FFNA 3KEOA 3O8QB 4G81A 4YRAA 5ENVA 3WGOA 1K3TA 1VJTA 3WX0A 4C7KA 3WGQA 3ZDFA 3VVCA 3PRJA 2A35A 2PLAA 2QHXA 2EGGA 1DBVO 1EZ4A 1UP4A 5L7WA 3R1IA 4BNKA 4ESOA 5J23A 2O4UX 4PLWA 3GVIA 1GUFA 2BFOA 3RWBA 1JAYA 4N5LA 4PLHA 4DA9A 2RHRA 2TMGA 3PDJA 1AN9A 8ADHA 3PWSA 1ZSNA 1U8FO 1EQ2A 1LI4A 1PU2A 1JTVA 2GZ1A 5KCZA 4EGFA 2G17A 5U9CA 1ZK1A 3DZJA 4IGEA 2V6GA 3X2EA 3QHAA 2Q3EA 3FNFA 3GMSA 4ND3A 4MKRA 4RPKA 4F6LA 2I9PA 4IQ8A 4RVDA 1HTBA 4WLUA 3UN1A 1ULUA 1QYCA 3CINA 4J7CA 4II3A 1K6IA 2ZTLA 2QZ9A 4W99A 1TVEA 1Q0LA 1Z7BA 3AUUA 3PEFA 4LVCA 4QXMA 3B1KA 4YAKA 3M2TA 1V6AA 4I9NA 2FPIA 4JLWA 1ZEMA 4MPDA 3JQ9C 4BMVA 4KQXA 1B2LA 2VYVD 3RC1A 3W8EA 1YQDA 3ZWWA 5AQ1A 2GZ2A 2OXIA 2CZCA 1Z45A 4N7RA 4E2XA 1HKUA 3HQ4O 1Q7GA 2ZYGA 4LCJA 3G1TA 1N9GB 5A9SA 3LF1A 4F6CA 4YAGA 1ISIA 4BB6A 4CMJA 2AE1A 1YWGO 4I08A 5CHEA 2Q1WA 1DRWA 3K6JA 1PTJA 5TX7A 4BNZA 2DBZA 1P44A 4OOFA 4OXYA 3PPIA 1HL3A 1H5QA 2EV9A 5CEFA 1I36A 3VDRA 4JJGA 5CDTA 1I3LA 5I9NA 3ADOA 3H6KA 3E82A 2DBQA 1SAYA 3JQ8A 4W6ZA 2C7VA 4DL9A 5IAAA 1ISJA 5LDHA 3DWFA 2I67A 2WE8A 4NPCA 2X22A 3V1TC 5L95A 1CJCA 5GY7A 3HDQA 3WYEA 3EVNA 1IOLA 5L9AA 4MIYA 4RVHA 4I1IA 3GAZA 4FFOA 2HMTA 4B8ZA 4K9DA 2B35A 1Q7CA 4ALJA 3RCBA 5JNLA 2V6FA 4BMNA 1LRLA 3K5PA 4XKJA 4ND4A 1NPTO 5L4SA 1UAGA 1NQAO 3GA0A 3I9OA 1QYDA 4YVFA 4HY3A 5JMPA 4BO2A 2DLDA 2IXBA 3RROA 1CEQA 3BZUA 4M89A 5IXSA 2R00C 4GX0A 1HE5A 4TVBA 3GF4A 2PWZA 2ZQZA 2FZWA 5G2OA 3N74A 3WGZA 3VZSA 1MFZA 2UYYA 4WLNA 2YHIB 3IUSA 2B4RO 4HFMA 1YDEA 2DTXA 3LT1A 3AY3A 3EYWA 2GN9A 4WKGA 1Z6ZA 4J16A 1PZEA 1LQUA 4DYVA 4O5OA 1K2WA 1MG5A 5IG2A 1ZJZA 3Q2IA 1V3VA 4HNGA 3GPDG 4B3HA 5K0ZA 4J2HA 3HB4X 4RVFA 2J3JA 4JCOA 5F3RA 1P1HA 4KUHA 3TOZA 1M75A 3BMQA 4JQCA 4Q39A 3FNEA 1I0ZA 2Q4BA 1DAPA 3LYLA 4AJ2A 4K6CA 2FMUA 1R0SA 3L0DA 3JYQA 3VPGA 4IIVA 5CAEA 2C82A 2PD6A 3BMCB 4MP3A 1DIRA 1P74A 4MVJE 5DCYA 3JQDA 3TJRA 2WTBA 3Q9UA 2X8LA 1GPJA 3AU8A 3BMOB 3R6DA 3S2FA 4GVXA 1JKFA 3IP3A 4DPMA 2QG4A 4W82A 2FZEA 3C1TA 1P1FA 4J4HA 2VT3A 3Q1LA 5BSFA 4GKVA 3H9JA 1SB9A 2DBVO 1ZSVA 1W0CA 3GZ4A 2O7QA 1C3VA 3FTPA 2P9GA 3ZHYA 4YWJA 3ANLA 2ZB3A 4R1UA 3CE6A 3I9NA 2EP5A 1Y1PA 2FR1A 3GDOA 1RM5A 4HXYA 3K2BA 2JFGA 2AXQA 1E3EA 4PG8A 4R54A 4I8XA 1NPDA 3ITKA 1GYPA 3VZQA 4N5MA 2P2SA 3AK4A 3KTDA 4RF4A 2Y1CA 1T4DA 1P0FA 2UV8A 5G0TA 5C7LO 3ZHBA 3ZU5A 3AOGA 1PJ3A 3ST7A 4YXFA 4LMRA 4QECA 1T25A 3U3XA 2GRAA 2QYTA 5JC8A 2EJWA 1NX6A 1B3BA 2I65A 3H9QA 2C2XA 1FDTA 4IJVA 3A1NA 1M67A 4RPJA 3V2HA 1I8TA 3FNGA 3O03A 4IBOA 1J4AA 2EF1A 3ZNNA 3JQ8B 3ROQA 4H15A 4GVLA 1E7YA 1I3KA 5COAA 1H94A 2J3HA 2RBEA 4XX0A 2PKRA 5JYFA 1V9LA 3C7AA 2WEKA 3AY6A 3U4DA 1G0OA 4FC7A 1DJQA 3JD3A 2FSVA 2GERA 4DPKA 2WJPA 4GH5A 2EWMA 3LF2A 3RUEA 4WLEA 4CQMB 3GN1A 3VPXA 4A0SA 4DXHA 3OJFA 4Z9FA 2NQTA 5U1PA 1PGQA 4AJLA 2YUTA 4URFA 1SOVA 4OL9A 3HN7A 3TPCA 4PLYA 1VRWA 4Y67A 3H4VA 4FPXA 5H83A 5LCXA 2VTDA 5KVQA 3LT4A 3TNLA 2GDZA 3OETA 2G0TA 1DIAA 2IZ1A 4N5NA 2GO1A 1DRUA 1A7AA 5ICMA 5EN4A 4JGBA 3D3EA 1GV1A 2BGMA 1LNQA 2BFAA 3PYXA 1X1EA 3A06A 2B0JA 5U4QA 3FF4A 3I5MA 1G1AA 1CETA 4FGSA 1ZEJA 2X86A 1O94A 5AVOA 1QMGA 2X0RA 3JQAA 4E12A 1QG6A 3E03A 4LGVA 4CM1A 1DRVA 3BXXA 1L7DA 2Q2VA 2PFGA 2PGLA 1DHTA 3NX4A 2X5JO 1TLTA 1N9GA 3A9WA 3PZBA 1DIGA 3GNQA 4BGUA 3UXYA 4BO4A 4A03A 4F46A 5KJFA 1X7GA 3BMCA 4M1QA 3OIDA 1GUZA 3VHRA 3ZWNA 1S6YA 4PZCA 3GEDA 3CPSA 5F1PA 4YDRA 2ILTA 2HK7A 1AXEA 1H6AA 1PS9A 3G17A 3BHIA 3G79A 4K26A 1XHLA 4XRGA 4UUMA 3IIEA 3KSUA 2QRKA 3P7MA 4TZKA 1K6JA 3GPIA 4OHUA 3RQSA 1HF3A 3CH6A 2OGUA 2VOEA 3PIIA 4DC1A 1V35A 2D1YA 5JC1A 4E31A 3W1VA 5A9RA 5IFLA 1GEGA 2W90A 3GG2A 2Q50A 4L0QA 5CEJA 1GL3A 4OKIA 5CG1A 1MP0A 4UVHA 5FI3A 5G4KA 3DHEA 4IJWA 3VH2A 2J3IA 4CV3A 3ROPA 1RYEA 4GSLA 3ZZNA 2YHUA 2NNLD 1B7GO 3ANNA 4WNIA 1BW9A 1WAMA 4JBGA 4NBWA 4FOSA 2HUNA 4UVIA 2W4QA 3KYDA 3PYLA 3AFMA 1EFKA 2O3QA 3E9NA 5ES3A 4CL3A 4CM3A 4LISA 3TL2A 2EHDA 1T2EA 1LUAA 1YL5A 4WJZA 4DUPA 5DF1A 1B0AA 3F47A 1TB4A 3PDUA 3MJTA 5L7TA 1JQBA 2P5UA 4J1QA 3O26A 4RGBA 5JW6A 1E7RA 4WCFB 3H9EO 3CMCO 2AEJA 4BNHA 2HK8A 3ETDA 1TXGA 2ZB8A 3OIGA 3MEQA 2DT5A 4E5PA 4CR8A 1CQIA 2EP7A 4TSKA 4ALNA 4BNGA 1C0PA 3IUPA 4JJFA 4NBUA 1DOHA 3GVHA 3GFBA 5ITWA 3AM4A 2P5YA 1L7EA 2NACA 5THQA 3BHMA 4ZD6A 3FD8A 1NVTA 3WMWA 4BNJA 4K6FA 1XQ6A 2J3KA 3NAQA 4NK5A 3GMDA 4NU6A 5F1OA 4ZQFA 2X23A 4M87A 3S2GA 3UF0A 1MFPA 1YBVA 1WLYA 4AJJA 2QW8A 5IDXA 1EK5A 1Q7BA 3QWAA 4ZN6A 3ZHZA 2DFDA 3H5NA 5DOZA 1EEHA 2P4HX 3SBOA 3EW7A 3LLVA 4XIYA 4KZPA 4E5MA 2B69A 3W4IA 5IDQA 3JTMA 4XYLA 4BO0A 4GQAA 1SZJG 4JBIA 3RUDA 4E2YA 2VRBA 3OQBA 5IZ4A 4RCVA 4E5NA 3ETGA 4XYEA 2J6IA 5JPIA 1SCUA 1BXKA 3MOGA 1LXCA 3CMMA 1GEEA 4ZVVA 2E49A 1NHWA 1R66A 2A4KA 1E5QA 1VKOA 3JQCA 2DAPA 1NAIA 3D3WA 1GZ4A 1UDCA 3JD2A 2C59A 3MTGA 4CM5A 1HDCA 1EUCA 1JWBB 2FRDA 3K2EA 4IS3A 3ZWAA 1E6WA 3RU7A 3WFIA 1XLTA 3FSRA 2XF8A 3CTMA 3OICA 1B14A 1M76A 1U5AA 1U28A 5LDGA 1UP6A 1ENPA 1MB4A 4B8WA 4D46A 3WMXA 3VTFA 1UAYA 4RPHA 5BR7A 4XR4A 1JDJA 3WGGA 3KSDO 1GD1O 3PFWO 5TJHA 4XQGA 1EVYA 4XGNA 1I01A 2QX7A 4FQ8A 4D3DA 4RQUA 3H3FA 3CIFA 1SEPA 3RBVA 1AE1A 2OBNA 4FIZA 5EESA 3GUYA 4J90A 3VPSA 4YT8A 3FCOA 4LSMA 2R6JA 2O3SA 4JP3A 1QYXA 1PSDA 4CQMA 3MZ0A 4FSHA 3BMNB 3WLFA 2EKPA 3UAGA 1DC5A 1N8KA 3DMTC 1KEUA 4IMPA 2EXXA 3BTOA 1E1KA 1PZGA 1DC3A 4NBRA 4YT4A 1O9BA 3DZFA 1X14A 3GR6A 2ZYDA 3U62A 1VL6A 2GN4A 2YY7A 1LDYA 4P4LA 2AEMA 1TT5B 2OUIA 1YL7A 3IKVA 4QT0A 3S2EA 2VTEA 1BDMA 3ZWCA 4Q3NA 3I9MA 4D41A 2Y66A 3ROKA 3JQGA 5JDIA 3UOGA 4YB8A 4B4UA 4DIBA 1DHRA 3QWBA 3Q11A 3GQVA 1W4ZA 5A4DA 2FHSA 2B4QA 2CVQA 3P19A 4U5QA 3AM5A 3KRTA 3JQ6A 3DBLA 1U1IA 1A71A 4QX6A 3ZNOA 5T8KC 1Y6JA 3OA2A 2ZKLA 4UUNA 5KJ6A 4GWGA 1HLDA 3EY4A 3DTYA 4IY1A 1PL7A 5C7OO 1GTMA 1ZSYA 2IYPA 3E6AA 2PTGA 4R69A 1Z7EA 1L1FA 4XZ3A 3RIHA 3E18A 2LDBA 1YB1A 4HNHA 1M6HA 3CUKA 4R1SA 3WWZA 2GZ3A 2GR9A 3BHJA 4RVSA 4WOJA 1WP4A 3HDJA 3HFGA 3PHIA 4CLOB 3DZKA 3MJCA 2EKQA 2IE0A 4P4GA 3U09A 3Q3CA 4Q3DA 1HETA 4JBHA 1LSSA 1PEDA 2Y1EA 5JE8A 3L6DA 4PZEA 1ZK3A 2DUUA 4FFRA 4TZTA 2ZB4A 1P1KA 3EC7A 4GBJA 4J9UE 4LVUA 1Z74A 5L3ZA 1NPYA 3WQQA 2Y99A 5C7IO 4RJTA 2OL4A 2PD3A 4WLVA 2XXJA 3OQ1A 4HKTA 3K30A 4UVEA 1PQPA 1CDOA 2VNSA 2VRCD 4YYZA 2BKAA 5HS6A 3BA1A 4DBVO 2ZB7A 1QSGA 4BNVA 2VZ0A 3TWOA 4BNIA 2I6TA 1V3TA 1HT0A 1R0KA 1JA9A 4BVAA 4L8VA 2BGKA 1P9LA 4INAA 3FBTA 3JYNA 1I33A 3GUCA 2VUTA 1VPDA 4OJNA 4CLOA 1QR6A 3H5RA 4EW6A 1E3LA 3PLNA 2OMEA 1K6XA 4PFJA 4BNMA 2BHLA 2E4AA 5DBFA 3ZHXA 2OOSA 5L4NA 1IHYA 4I9UA 2PKQO 1CF2O 4CODB 5L4LA 2HRBA 5TQVA 4AJPA 5EPOA 3RU9A 2O2SA 3HN2A 4RVUA 3A28A 3ENNA 5KWEA 2Q46A 3T4EA 3TQHA 4D43A 3HNPA 8LDHA 3QWIA 3F46A 2C5EA 1BVUA 4J4BA 2G76A 3M6IA 5TT0A 2JHGA 3ZWVA 1YQGA 3ROMA 3L9XA 1HLPA 2FPGA 5B1YA 3F4LA 2NTVA 4YJHB 3OQ6A 1NQTA 1EVZA 3QWFA 4ALLA 4CM9A 1H93A 3C24A 1E1NA 3FN4A 1HYGA 4IQGA 4C4OA 2YV2A 3RD5A 1HDOA 5TC4A 1Y8QB 2FN7A 3PI7A 1XDWA 5EQDA 3GHHA 4L74A 3UH1A 2UAGA 4MINA 2ET6A 1LLCA 3P2OA 3F6YA 3JQGB 2OFPA 3P5SA 3DBHA 4R1TA 3IP1A 2ZATA 2NVUB 3AOEC 2W2LA 5DT9A 1QKIA 2P4QA 3EAGA 3R3SA 4I9HA 4RDHA 3ZW9A 3HG7A 2GSDA 1ZXBA 3GDGA 4HWKA 3W4JA 3GVXA 1R37A 2W2LD 4YACA 3EMKA 2VUUA 4AJEA 1RPNA 1PZFA 4N18A 5HRUA 3D5TA 3D4OA 2Q1TA 3W4KA 3NT5A 1UZLA 4J6FA 2VCYA 2DUWA 4IZHA 2O4CA 4AL4A 1F12A 2ZIZA 3F1LA 5H81A 5L53A 3NRCA 1YQXA 4RV9A 3SJ7A 4A73A 1KY4A 5KIAA 7ADHA 3JQ7B 2X7HA 1SPXA 2XOXA 1XYGA 5DP1A 4U6QA 1FDVA 4CMEA 4EITA 3QP9A 3K73O 1VL8A 1DJNA 3ADPA 2DPHA 4YRBA 2DM6A 1E1LA 4JP2A 1NNUA 2CDCA 2EERA 3ANMA 3IOYA 5G0UA 2NSDA 3GY0A 1TEHA 5TGDA 4ILKA 5EMHA 1YH3A 2POQX 2HO5A 4NBTA 4IGFA 4YPOA 1E3IA 4ND5A 3WGTA 2D5AA 4LMPA 5BSGA 1YL6A 2IZZA 4NQZA 1LBEA 3G3EA 5F21A 2C5AA 3B70A 3RUFA 2UVDA 4FOOA 3HB5X 2YFHA 3BAZA 3M2PA 1T26A 1ENOA 4PCVA 4WASA 4L9RA 2Y1GA 5C5IA 2NM0A 3DO5A 4E3ZA 1O6ZA 3UUWA 4DWVA 4IXTA 5KJEA 1NQ5A 1UDAA 4HV4A 1PJ4A 1JKJA 1NBOA 3E9MA 2HCTA 4M55A 5IJZA 3H2SA 3H9UA 1HE4A 3E5RA 2QZZA 1T1RA 1U7TA 1QV6A 1ZK0A 4B4WA 4M49A 4PZDA 1MA0A 3AU9A 1I5RA 4QSMA 4PVDA 4KTTE 2Q1UA 4FW8A 3PWKA 1BDBA 3EVTA 3RC7A 3IL2A 1GCOA 4WEOA 4AVYA 4P4NA 5FFFA 4DC0A 2I3AA 4CMBA 1UDBA 2X6TA 2PK3A 3PLRA 5LC1A 2VHZA 1EVJA 1CRWG 4FN4A 3DZHA 2B5VA 3NGLA 5KJ1A 3GH3A 4D0RA 4GAEA 3X2FA 1MXFA 3W8FA 5HTOA 4R3NA 5J9GA 2FSSA 2Z5LA 5G0VA 3D5QA 1VM6A 3PZRA 3PJGA 3KETA 4W9NA 3TZQA 1MGOA 4IS2A 1E3SA 2BELA 2X9VA 4CLRB 2X1HA 4JROA 2NADA 4BQRA 1WXDA 2DQ4A 3ZW8A 4FJ1A 4F45A 3OFSA 4CQLB 1VSVA 4WECA 5IN4A 2H1SA 2UUPA 1AHIA 3DC2A 1SNYA 2HMSA 1YO6A 2RH4A 3FBGA 4NH4A 2X0JA 3DBHB 1XU7A 2P91A 3MJ4A 4CM6A 5A5FA 6ADHA 3SX2A 5JAZA 3MWEB 5ILOA 1B3RA 3AFNA 3I9JA 3TFQA 2BRUA 3LSYA 4W4TA 4DRYA 1T1SA 1AXGA 2IODA 5JYEA 2JD2A 2X5KO 2VHYA 4LW8A 4R16A 4XQEA 5AXBA 3K92A 4BB5A 2FPPA 2HJSA 2P68A 1B8UA 1IHXA 1PWXA 1RM0A 4IDAA 1X15A 4TRMA 4IDBA 4QUKA 1Q2XA 1NXQA 5TSDA 1E7SA 1YB4A 1EVIA 5JCJA 1ZXLA 3C8MA 4E4YA 1VKNA 3WICA 5IXYA 2GGSA 1RM3A 3KEQA 2Q2QA 1LSOA 2OO5A 1KBZA 3WBBA 1BTOA 4L75A 1Y9AA 1F17A 1OC2A 1U9JA 2IXAA 4IDDA 4BKPA 3WIEA 1R0LA 1FF9A 3KHUA 5GMOA 4TQGA 2BF7A 2H9IA 1JKIA 3RBXA 1KVUA 3JCZA 2NLOA 3SVTA 3KYCB 3BTVA 3AY7A 3GT0A 3D4NA 3OIFA 1A7KA 2DTEA 1D1SA 3RFXA 2NVBA 3RUHA 1KVQA 3DBLB 2VWHA 3G49A 4PLVA 5IZCA 3NV9A 4D79A 2E82A 1RWBA 5FF9A 1I2CA 4ONEA 2DU8A 1H6BA 4KDEA 2VWQA 3V1UA 1NQOA 1P0CA 2YDXA 4YJGA 4GLLA 5TRTA 5B4UA 1ZMOA 3H65A 1DFIA 3DOCA 1ID1A 1N1GA 5I8ZA 4A26A 1FDUA 1SC6A 2X9NA 2D2IA 3COSA 2WWRA 4ND2A 1RYDA 4ROSA 2ZYAA 3PJFA 4Q9NA 1X0XA 2EW8A 5CP8A 4BGVA 4E13A 4XYGA 2AMFA 1ZFNA 1KYQA 2C29D 3P2YA 2PZJA 1DIHA 3LC1O 1GQYA 3DMYA 3JQBA 3DR3A 3RFVA 3U9LA 1VJ0A 2FWMX 1WPQA 5T67A 2EGHA 2WSBA 5TJ9A 1LLDA 3ZWOA 4DLBA 1Y8RB 1LC3A 1Y7TA 2NU6A 3KVOA 3ZNQA 2A94A 4WLOA 6LDHA 2GASA 3EDMA 2VQ3A 4CL8A 2SCUA 2Q1SA 2PNFA 1YBAA 3IDSA 3SLKA 3JD4A 4NFHA 1WNTA 4Z9XA 4Z0TA 2JJYA 5T57A 3JSAA 1JU9A 3ICCA 2AE2A 4RZHA 5A04A 4I5EA 1RM4A 5JBIA 4FFPA 3V5NA 5TF4A 3DL2A 3ZNPA 1HYHA 5JAIA 1HDZA 1XR3A 4EJMA 4WNCA 1VLLA 2FR8A 4YT2A 4PG5A 1DC4A 1EQUA 3L07A 3SEFA 2PGDA 4BNTA 3SLGA 1PWZA 3A14A 4NG5A 3I1JA 1PJLA 3FR8A 1YVEI 3DBRA 4IIUA 3TZ6A 1BXZA 5COQA 1VSUA 3INTA 1BXGA 5B37A 4CR7A 5FWNA 4OIMA 3NTOA 2WYVA 1JVSA 1KVSA 4ZQEA 3V1YA 2AG8A 3ITDA 3OEWA 4KUGA 5L7YA 1HRDA 2GYYA 4MIEA 2YV3A 1NYTA 4CM4B 4I5FA 4WUVA 2AQIA 3C1AA 5A02A 3PJEA 4XYBA 1K0UA 2ZTUA 1XEAA 5TT1A 1GV0A 4YJDA 5BNTA 4BGIA 5TLSA 1GDHA 2A92A 5TNXA 5CPFA 1GADO 2Q2WA 2J5KA 3QE3A 3I23A 1FMCA 4BKQA 4BMSA 4HUJA 1JW9B 4RVGA 2DFVA 5A5EA 1ZMTA 3VTZA 4KMSA 2Z1MA 5F5LA 5JDCC 1U8XX 3DAFA 4IJUA 1QYWA 5FYDA 4E33A 3OECA 2EKLA 1PL8A 3GNSA 2LDXA 4IPTA 4PVCA 1XWFA 2X0NA 3DZBA 1XCBA 4XWYA 2D3TA 4JXKA 3ZGYA 3IKTA 4BV8A 2F00A 1ZK4A 5IDWA 5A9TA 3GAFA 4FFMA 4CUJA 3S8MA 3WDSA 3TF5A 2JD0A 5AXDA 1W8DA 3CZRA 4OO3A 4OXKA 3OJOA 3WFJA 5JYAA 1EK6A 3WS7A 5B4VA 5F5NA 1EBUA 1UXJA 3PVZA 1I32A 5CDUA 2ZTMA 1PR9A 3V2UA 3F9IA 2XAAA 3BMQB 3RJ5A 3KSZO 1VJ1A 1ISGA 3OMLA 3DBVO 1ONOA 2J5QA 5ILGA 3QVXA 1Q0HA 5L40A 4Z0HO 3HJAA 4S1VA 3WBFA 2JAHA 2R00A 1U3UA 4DIFA 2EEZA 1ZUD1 4ZQGA 4R51A 4FR5A 4JK3A 1ARZA 1UZNA 2PZMA 1UXKA 1BRMA 3IMFA 4L4SA 1GQQA 4AJ1A 2JD1A 2C20A 2CFCA 5A06A 4B4OA 1C0LA 1J49A 1KY5A 1HE2A 2VZ9A 4XDYA 2EG9A 4RORA 4CV0A 3ZU3A 3IC5A 1YOVB 4CMEC 4J3FA 4AICA 1M2WA 4DBZA 3Q6IA 5JAMA 5A1TA 3HWRA 2I3GA 2IEDA 1JAXA 5C37A 3JYPA 3AI1A 3PQEA
chains in the Genus database with same CATH superfamily
3R9KA 4II7A 1PX0A 3F96A 1GTL1 1O54A 2FEXA 4C6RA 2LCFA 2HYDA 2DWOA 4GKBA 4ZJUA 1OFIA 1MIOB 2FPKA 1V39A 3EF3A 3FCCA 3KOUA 3Q9NA 4OUDA 5LP6F 3MBOA 3BREA 3ISVA 4TN5A 3A6HA 4YBZA 1FMLA 3N9IA 3I37X 1OX4B 4H6PA 1K89A 1A5ZA 5A0VA 3O8DA 3LKDA 2FLKA 1VYHA 4PYOA 4M98A 3VZRA 2A84A 5EXTA 5I4IA 2C7RA 1Z56C 2W2TA 3ECAA 4KR3A 3C85A 5CBPA 4AP5A 4OH7A 4UBIA 3R5SA 4KK3A 5A71A 3E81A 5I9MA 3LNTA 3IDZA 4HQ0A 4AZSA 1N2HA 3DLCA 4EUNA 2VLBA 3O84A 5B2ZA 2XE4A 2EJTA 4DQXA 1EESA 5HDBB 4ZT7A 3A1UA 1NJFA 1AGYA 3NKVA 4HDMB 3NHKA 1E3TA 3TIVA 4CFSA 2FR0A 4Q7LA 4PLCA 1B0PA 4D97A 1UMCA 2IDKA 1ETHA 2BT4A 2V65A 3D2BA 4CM7A 3HXMA 4N0PA 1XFAA 3ODGA 1AX9A 3VVLA 1V8OA 1YVDA 4C08A 2MSNA 1H8HA 1EFPB 3DTTA 3OLZA 1EWYA 4BATA 1V95A 2CDRA 4DKJA 1C9KA 4ARVA 3WKBA 2W2KB 1W6UA 1C7RA 2JZCA 1L3BA 5LQAA 1OIVA 2H8KA 3GHYA 3AM1A 2AYXA 2HRZA 4BCBA 1NX9A 3V8BA 4RTOA 2Y6UA 1H9CA 1ZIDA 3GLHB 1KSHA 4MUMA 1A9XB 3NU1A 1NQUA 2CHEA 4YUAA 4I4TA 1L4NA 4D7AA 4XLLA 3SHOA 1TU3A 1TEXA 2QMOA 4BTLA 3RVDA 4IHQA 1OAAA 3AW9A 3FMPB 3TXXA 4GKKB 3OT1B 1WKVA 1NQVA 4BWFB 3JQFC 4D5GA 3GEMA 3DV0B 4ZZ2A 4OJKA 2PMDA 1VA5A 1EWTA 1P77A 2BKEA 2GAAA 2PYIA 2VZ8A 3PR2B 4ZI7B 2X5XA 5AM4A 4RHYA 4IEFB 1K6MA 3DF9A 3QG1A 5C46F 1NBMA 1VP3A 1I3MA 1RVDA 3OU7A 4H4EA 3UCFA 3OVMA 1JE1A 2LRHA 3GCZA 1QB8A 4EEXA 1P18A 1Z4LA 1L7BA 2G04A 1NVGA 2NZXA 3SBDA 3ZZMA 3NBQA 2FX2A 4HR7A 4EHIA 2HIHA 4JJIA 5JCPA 1NLFA 1X1DA 2GTIA 5BSEA 1CY6A 5CT4A 2BE7A 4O1IA 4RKFA 1V16A 1BH2A 3VYSB 2J5BA 4X3CA 2QRUA 1XN1A 4JP8A 5C18A 2VYCA 4NDZA 3T7IA 3M4ZA 4ESVA 4UKDA 1NBHA 1X13A 4I4CA 1VPWA 4IEIA 5DCUA 1N2SA 4LTDA 4D3SA 2CYCA 1M2GA 1JI0A 4X5OA 4HRAA 4X60A 3QY9A 3ICWA 3NTVA 3AESB 4E32A 3MFYA 1LF5A 3HGTA 4Y3UA 1OV4A 1ZZEA 1TTTA 4X3OA 3KYCA 3MERA 2BN4A 3UY4A 1WMAA 3ZZTA 4I1RA 4FC6A 5JNTA 1TZ2A 1LSUA 5LB2A 4AZ0A 1CUEA 3HCFA 2ZWMA 2BMFA 1VG1A 2GBGA 4R8SA 1V8FA 4UXIA 4L9SA 5ERXA 1U8YA 2C58A 3ABSB 3M6UA 2ZVJA 3PHGA 1GRRA 1H4VB 2NZJA 2V7PA 2BKXA 3L7KA 4PSUA 1DBQA 4U0JA 4WEQA 4QJBA 2L17A 5KTYA 3N86A 5LJIA 3TQTA 4JKIA 1TU0A 3FZQA 3T7AA 4Y9RA 3HADA 3HJUA 1BCSA 4U6NA 4YALA 2C0CA 3OEHA 4FEGA 3A4NA 4QNNA 4YR9A 5CFZA 2I6SA 2VNKA 4YGYA 3SEAA 4M1TA 4ETMA 2G1JA 2G88A 5HCUA 1TLFA 5MGBA 3EUAA 1K06A 3LUKA 2H0RA 2J1LA 1WHTA 1XEWY 4XQCA 4R9RA 3W5SA 4FE3A 2OG2A 1MT0A 2QS9A 3HXLA 1X74A 3EZGA 3FJOA 5T4EA 13PKA 4YP7A 3RYHA 2HA5A 1M2VA 1BE6A 1CB0A 1POWA 2PGJA 4W8GA 3GQBA 1QX3A 5DBOA 3HSKA 4EF5A 4M4SA 3INGA 3UUGA 1UXGA 2QLLA 1HXHA 2QQFA 1BH6A 5ICFA 1GQFA 5H82A 2SBTA 4M99A 2B3DA 5AW2A 2IPAB 1NXPA 1K7EB 1Q0ZA 1WDTA 4OH1A 1E2UA 1I2ZA 4G5OA 5SY4A 4EFMA 4YQYA 4YP5A 1OB5A 4PG6A 3HDYA 4WTOA 1Z2DA 5CB0A 4M1EA 4U6SA 3SZUA 3DFUA 5BP7A 3D8NA 1QOPB 5E2AA 2BGGA 1PQUA 4Z9YA 2EEPA 4JNKA 1LVUA 3EQ7A 4MICA 4YRPA 1HYEA 4MV4A 4MQBA 3TRJA 1I5OA 2VT2A 1BCRB 2DHEA 3DZIA 3HEAA 1Q1ZA 1X8KA 1TF2A 2JRLA 1R6DA 1FS5A 3H75A 4QQRA 1A8HA 1II9A 2XA9A 2XGSA 1QXSA 4R83A 5T6MA 3O4RA 2AVDA 1QIHA 4UNPA 2X40A 2X0IA 3NNNA 4LNAA 3TG8A 4KPYA 3T7SA 4NFLA 4M7OA 3MB5A 4B76A 5B6IA 1I2BA 1TFUA 2V0CA 4EOGA 4MP6A 3UWMA 3DHVA 1OOEA 4RXMA 2DWPA 1RNLA 5A4FS 1MENA 1TYAE 1UBUS 3O7MA 4WXYB 4KQHA 1S02A 3VKFA 3FHTA 1I51A 4PGGA 4Q15A 4Y0NA 1ZD8A 4ZCQA 1C4KA 3BTSA 1RYFA 3PUVA 5H70A 5CVDA 3B36A 3LJKA 4CG0A 4D96A 1JSRA 1NGSA 1NMZA 4Q16A 2QX9A 3AV0B 3TM5A 3U19A 4M7WA 4PBRA 3TDMA 3HYNA 1KP9A 1OI4A 3R76A 2LW7A 3D3JA 3WV4A 4CTJA 1GPMA 4JHXA 4MJLA 1XEWX 4BUCA 1I10A 1JPUA 1Q17A 3ASYA 4YLYA 1PIWA 3SYMA 3FTQA 1OWNA 3KVNA 1RJ9B 3DOUA 3PHCA 4JLOA 1WDKA 3KLNA 4A7PA 2IS6A 4NYMQ 1H9BA 3ORSA 1SC4A 5ADHA 5KQSA 4A6XA 3BIOA 1X7ZB 5BN4A 1K7YA 3VA7A 1BDIA 1K7SN 5KBYA 1AQLA 1EI9A 3S7TA 1ZUWA 5JQGF 3D0OA 4H31A 3B5JA 1BXRA 1SUEA 3QE0A 3B6ZA 3PXCX 4COOA 2P6UA 5JWRA 1RU3A 2IIBA 2NUPA 3KXKA 4BVKA 5A7HA 4U00A 5HA5A 2WF6A 2OZPA 3LNCA 4LRTB 2C42A 1QIIA 1P5JA 5EI5A 3LSTA 3UAZA 5BNWA 3UOAB 3I9LA 1VECA 3EF1A 4K86A 3QIVA 1NULA 2JBWA 3H2IA 1WTAA 1PE0A 1SN7A 4IQ4A 5LKRA 3PGKA 4J43A 3RJ9A 1O58A 2QAGB 3RM3A 4DLZA 3DLHA 1A9RA 4KNYA 1PJQA 3VO2A 4JJ4A 2CVHA 4IWXA 3AONB 1U5BA 1E2NA 1E3DA 3V48A 3IAXA 3LQKA 4RF2A 3M33A 1ESZA 3E1SA 2O0KA 4BJ6A 5IFKA 5E6RA 5D3MB 1SUPA 3D0KA 4O2LA 5ECGC 2O20A 4CM8A 3I61A 2JGLA 1W48A 1E3WB 3A6DA 1AGPA 1ZX1A 4XRRA 3TCNA 3S1AB 4N7BA 2DKNA 1E1QD 1PHPA 1PV2A 4AN0A 4URYR 4REQB 3ZDAA 1KXZA 3MWJA 5L6MB 4FDVA 1CLEA 3OM1A 3LW8A 3QQPA 5LL6P 5ECWA 3NJ4A 2YJ6A 4C88A 1ICIA 5BVGA 4UVDA 3TOCA 4KQGA 1K68A 2BFPA 2VSOA 1PVOA 4RD1A 1FFCA 2JIZA 1KARA 2IYTA 2V4MA 3V4FA 2D59A 3GMTA 1DIBA 3B1FA 3IILA 4U7HA 2W7TA 3WJ7A 4NKRA 2WB4A 3E1KA 2WRZA 2J67A 3T7CA 1BWPA 4OI4A 4RD3A 4RZUA 5IBRA 4NVRA 2JK1A 4O3FA 5E3IA 2ZM6B 3CWCA 3ROEA 5DRTA 4GPD1 2IEBA 3OSUA 3DEFA 1NUSA 3C1OA 3EQ9A 5AK0A 2RG1A 3Q8LA 5BV1A 4L6IA 2B21A 3T0GA 1XA3A 5DHQA 1HEUA 4HRVA 3D59A 3C5WP 2F67A 3OTWA 2VQEB 1G1MA 3HU1A 2XECA 2NYAA 3EEQA 4EQ6B 4E2ZA 2NQ8A 1PZMA 3I64A 1HYBA 5A03A 4A23A 2NTJA 4QG3A 4Q9KA 3BJEA 4YROA 4G1FA 3ZTYA 4YMLA 3ZGLA 2P5SA 4YMUA 1DQPA 3EK2A 5DNYB 4FFWA 3ER9A 1AHHA 2GEVA 1XMXA 2XMRA 4F6RB 1S3FA 3DMTA 3A1DA 1QB7A 3NBFA 4PU0A 2G09A 3G7SA 3HCBA 3VDMA 2Q6IA 1BVHA 1SRQA 2H2WA 4FNOA 1V0JA 4BAUA 4DA7A 5KX5F 2BVNA 3D6MA 3HMQA 8ATCA 3FRJA 1TW3A 1NI4A 2Q4RA 2AN5A 2OAGA 4UBLA 4WIAA 1MU0A 4K28A 5E8JA 1RHRA 1P2SA 4F9TA 2VP0A 2JNWA 3IJEB 1GNTA 3LGXA 1P5ZB 4R7TA 1NDUA 3WRYC 3CT4A 3KPUA 5KYUB 1UZAA 2QM8A 2QBYB 1TMYA 4D4KA 5K03A 4FBLA 5FRDA 2KHZA 2WHXA 2ICAA 5DZSA 1TJ3A 4L5JA 3SZLA 5LNK1 5LZ9A 1JZSA 1KAQA 4E0BA 1QC5B 2IQ5A 3B51X 1NVVQ 1ID8A 5B3KA 2Z04A 2YASA 4JN6B 4IIGA 1B16A 1W47A 1B0ZA 4BO9A 1Z2OX 1Q20A 3LA6A 1GTZA 5TVOB 1JYFA 1FU8A 4Q05A 4R6XA 3ZJ5A 2WDZA 3MTIA 3WGMA 2PZLA 4QBFA 4UMDA 3V8RA 2K6GA 2QTFA 4YV1A 1LVGA 4S3MA 1HA3A 3EXEA 1JP7A 2FN3A 4TWIA 3TYXA 3NIFB 3FF1A 3R5TA 4EYGA 4PAQA 1KQOA 1Y7HA 4WA7A 5E4TA 3OPYB 4I55A 1PQWA 1ZM2A 1NYRA 3CSDA 5B12A 3UANA 3H05A 5DGHA 3HZOA 3QVGB 3GVCA 2AMVA 4G5XA 2IYNA 4CKYA 3GGCA 4MWOA 2CEKA 3K6RA 1O2DA 1F2UA 4B79A 4EBFA 1RI2A 4IIHA 3RVJA 2YIVX 4AO8A 4C29A 2HCBA 1ZPDA 4MP8A 4L9AA 1TK3A 1E9FA 1R10A 1VG0B 1DZ3A 5J2UA 1GPBA 4PFKA 2W37A 2XT0A 8MHTA 2IEGA 2V6MA 2Z95A 4Y6OA 1DJMA 4LXYA 3V97A 2NAPA 2CNDA 3GUHA 1FP4A 2GTPA 5FH9A 1B8PA 1QTRA 2PL9A 4MWZA 1XD2A 2WPDA 3JR3A 2AFHE 2IX9A 1J9GA 1ZY2A 1MZVA 3VSAA 4KWCA 1TRKA 5LKAA 5K3DA 1QRDA 4K3UA 4MS1A 5G02A 4IIBA 3SR3A 2BP7B 2WAAA 5JJCA 2QI9C 4AY5A 2SNIE 1Z33A 2HCFA 4X63A 4Z54A 3AETA 1QBKC 4ND7A 3O4VA 2BFMA 1OWPA 2P78A 4TKMA 1VOTA 2VN8A 2ZUBA 3GZJA 3HE3A 1M6YA 5FOQA 2ZI6A 2C00A 3QVSA 3U9TA 1H0KA 4BLUA 1DAFA 1T2DA 4KEAA 4YI3A 3URKA 4HX5A 5EYPB 2ZS8A 3B3AA 7ABPA 4AJIA 3MM4A 3TMKA 2CLHB 4L9WA 3KPWA 3I30X 1ZVVA 3LC7O 4TUYA 3ZLBA 1GDTA 3KKZA 5F4ZA 1QS0B 5FI0B 3TVDA 4CL0A 4E4RA 1IY2A 3GFGA 3ZQUA 4COKA 1X1QA 2D5CA 3LUDA 3RIEA 1HM5A 2BTQB 3RB8A 4E5DA 4BQQA 4EJ6A 2MR5A 2DGDA 3D8SA 3A4LA 1KDYA 1FDOA 1T9HA 4I99A 1IYZA 5AXAA 5C8VA 2IPMA 3D54D 3KL2A 4MVJP 1U2SA 2B2NA 2R6AA 3GBVA 5CW1A 1W25A 2BGIA 5FX2A 2XUJA 7AT1A 3RYCB 1ZGBA 4OSPA 3CZCA 1KFCB 3ZDYB 1G20B 1F5NA 1EFVA 4RY2A 2PWAA 2BFBB 3RJMA 4AWAA 1UINA 1OX5A 2IEYA 3AR9A 2RJNA 1IZ0A 2IPNA 3L7AA 4G01B 4JWTA 2C8JA 1S0UA 3BOSA 3NXKA 4IVQA 4CMAA 2M1ZA 2AZDA 3ESDA 4ZYZA 5GJCA 2O8DB 3T4XA 1R2QA 4JFRA 4M38A 5K6AA 1CS4C 4UUQA 1TF7A 1W5AA 3HCDA 2EFGA 4L4RA 1Z82A 2WAYA 2WR8A 2DSNA 3B6KA 4UFNA 1V7CA 4GR9A 1RD4A 1YUNA 4PTLA 5AJXA 4BEBA 1N2CA 3OQOA 4PQFA 3W8RA 2AOWA 2A7XA 4N49A 1JIIA 5K6RA 1M0EA 2V6JA 2P69A 3CR8A 1KDOA 2PBLA 1Z5OA 4KE7A 4PNHA 4TMVA 1HSZA 4AMUA 2TMYA 3LLSA 1DMSA 1OFGA 4BO3A 4DIKA 5KKCA 1WZ2A 5B57C 3F4BA 1IUKA 1B2RA 4B3BA 4EG7A 2WDPA 4XFKA 2A9RA 1GCUA 2OO5C 1T5DX 2W8BB 1FS4A 1WY7A 2ZRNA 4GWKA 1A88A 3WBJA 4LV8B 5HGJA 4IDGA 1FFGA 3E61A 1QV7A 2XYPA 4CTKA 5HSGA 4WWHA 2G72A 2FP4A 2GM5A 4G0OA 1T10A 2XBMA 3N0WA 5FI5A 3BH7A 5EJ2A 1PO7A 2C07A 1GUBA 2P8JA 3WLQA 1SHTX 3RT1A 3SS7X 3STHA 4PIVA 4XJSA 2GUGA 9MHTA 3HUFA 3LI2A 1X1BA 3FLEA 1GR0A 1EVLA 3SZMA 1F8YA 4IKOA 4BFUA 1VG9B 2FWJA 3PNBA 2RGAA 2V7XA 3SJUA 3L02A 1FFYA 1Y8QA 3TUIC 2A3RA 2GD1O 2WLSA 2YJ5A 4L85A 1MQSA 2WNSA 3GRAA 4ASUD 3DQQA 1WB4A 4KWHA 5CFOA 3RF6A 1B6RA 2ZDGA 4ZVTA 2H7XA 2CY0A 4JEMA 4QUEA 4LI0A 3FPLA 1F4VA 2QM7A 1THTA 1GUYA 3WTCA 4LI3X 1JN0A 4FCWA 3NT4A 5HRCA 1DC8A 4C6TB 1XLWA 3SQLA 5ALVA 1U8TA 1JXOA 1O95A 1OUMA 4AZWA 1CJMA 3FLMA 2R65A 3JQAD 4WLFA 1YQUA 5IAGA 1OMOA 3QJ5A 4KFTA 1Y6GA 4TLAA 2R47A 1G2IA 2CT8A 1ATIA 4ITRC 5CXXA 4XQ0A 4H1WA 1WPGA 5ER9A 1PT9A 2I7VA 3UMVA 3FTEA 1YB7A 1HDGO 1RYNA 4GEKA 3USZA 1B0UA 2XWBF 5D5HA 5ER6A 1AMUA 2GZHA 1EGHA 2WMYA 4BU0A 2QZSA 2I71A 2O05A 1R6XA 1OU4A 1JLLB 3ANXA 4DCNA 3GEIA 1QLHA 1Y8CA 2X5OA 1CS0B 1TC2A 2ZJ8A 4FBGA 4FLFA 1SELA 4TS4A 4D74A 4OA5A 4RSRA 4NQRA 4Q93A 1O8CA 3NYIA 3JASB 4QVKA 5GOTA 1B73A 1IEXA 4UAGA 5DK6A 3TZCA 3NG1A 5ES4B 1CQJA 3JYLA 1AKRA 2AQHA 3QV1A 1DO8A 2FOLA 3O3CA 3QMVA 4BNWA 1R8YA 2A9JA 4BNFA 5K05A 5KTNA 4NXNB 3QA3E 3EMVA 2IZ5A 4Y2GA 3PGLA 2DSTA 3LVFO 2HSWA 4KE9A 4MV6A 1J5XA 3RBZA 1G4HA 5DNAA 1NI4B 2B36A 3L18A 3UG7A 3IEMA 1Y37A 3ZDDA 2YXNA 4NZZA 1ZXXA 4DAOA 4Y2YA 4YMWA 5TF0A 1ACLA 3D43A 2R66A 2ZG6A 2RK6A 1GTG1 3GMIA 1D7OA 1VGVA 3DS8A 3DTVB 3L1VA 3ZEIA 1NLUA 2EKDA 4OGLA 2IYLD 1HT2E 3K70D 3M5DA 1IRIA 4LN1A 2PXHA 5CK5A 1ZOPA 3HA2A 4EUEA 1IH8A 5KB3A 5AI8A 1SVMA 4KQJA 5CNIA 2W4MA 4CEIB 1DTSA 1J0BA 5HKAA 2IS1A 4KH1A 3MTAA 3KEFA 1UIRA 2QRQA 3GYGA 4UHCA 3DDHA 3EMBA 4GXTA 2QP3A 2NO0A 3CPEA 3ZPXA 1G60A 1TCCA 3QX3A 1BVRA 2QRHA 5JVDB 1E1RD 1EDZA 3KJEA 3N6RA 4ON9A 3VU8A 4FGKA 2FX3A 4S1TA 1GNPA 3L46A 2ZJAA 4I55B 2W2PA 3CPHA 5BUCA 1DBIA 3BL5A 3C97A 4YX9A 4M7RA 1QH8A 5AYVA 1SIWA 4P0QB 4MR9B 2Q28A 4KGXA 3BCRA 3WYDA 3OZEA 5ICSA 1H1LB 2I2XB 2WD7A 2J8ZA 1X7HA 4OXNA 1UT6A 2P2LA 2QZJA 3DFMA 5B1IA 2PUGA 4GMGA 1TM5E 5CCXA 4UTXA 3ZCSA 4PQYA 1IIBA 1MAUA 1OTXA 5HYVA 1L1EA 4AJKA 2WKQA 4YAWA 3KYIB 4MQEA 4Z2AA 2J5XA 1LQTA 5AVSA 1C0KA 4KLNA 4UNSA 1LFDB 5AJYA 3KQNA 1W2HA 4UATA 4H7HA 3W9YA 2OHHA 3A1SA 3B7GA 4QEZA 1HQCA 3IAHA 3BMNA 3O1LA 1IZZA 5BN5B 4NK4A 5K3FB 3WADA 4D3FA 2Q8NA 3SY8A 2NO6A 1T2CA 2XRYA 3L43A 1SCIA 3LBAA 3QPBA 3R0ZA 1YZHA 4PG4A 4G36A 2IK8A 5BR8B 3I12A 1QPZA 3WLPA 2BCJQ 1KQGA 1JPNA 2NU9A 4FYMA 2P9EA 1Z47A 4GOLD 1KBQA 4QRHA 4E94A 4ZXPA 5I01A 3K1JA 1T29A 1IY1A 2WUWE 3NYWA 4ENWA 1G6OA 1TT5A 4WZAE 1E7QA 4YC7A 1P0PA 2AJLI 5BW4A 1AKQA 1IQUA 3PFHA 2XQJA 1OC4A 5ESXA 3IB3A 4G0YA 2G67A 4W9NC 3KOYA 2C8KA 1XIVA 4RANA 2GPWA 2LV8A 1H05A 5AICA 1AUVA 4XVUA 2LUOA 4JI8B 5AWFC 1Y48E 4AKSA 3PENA 1MAAA 3TNYA 3RFTA 4BVJA 2WFLB 4HAVA 3ZOKA 3PQVA 1MJGM 1XVTA 2O2DA 4EMUA 1DIOB 3WR5A 5HZMA 4ZK6A 4BNUA 4K9PA 4F85A 1YASA 4EVRA 4RUKA 1K6EA 4WZBE 3RKSA 4CQMD 2DKFA 2O2EA 2ODWA 4TLDA 3RKUA 1GPYA 3UJ6A 5BPFA 3BT7A 5C1IA 3OCUA 3UK1A 3C6QA 1ORRA 1INLA 3DFFA 3PFFA 2WVGA 1RBMA 1U1EA 3GC6A 4KXYA 2PL1A 4C7JA 2IDZA 5CB4B 1KJJA 1GTRA 4N5HX 2XVXA 3QVUA 1EDEA 3KXLA 3VSEA 2YXPX 1GQRA 5T5QA 2EWVA 2ECKA 2GA8A 2PY6A 2XDYA 4KO4S 3LK6A 4CLHA 3HUUA 1IE3A 2PMBA 3TTWA 4E5YA 1JHDA 3EUFA 2R8YA 1SCQA 1XRPA 1JF8A 2NSYA 2HHLA 3KM0A 4NZNA 4C4TA 4TMTA 5BSWA 1ICEA 1L5HB 1Y0BA 2DE0X 4U3JB 3GH1A 1PGOA 4FS8A 4I5DA 3HU3A 4D44A 5EJ5A 4KRFA 1M6VA 4LY6A 1VBKA 2Q9AA 4UD2A 4BJHB 1YI8A 1R64A 4Z5XA 3EBLA 1SUSA 5A2QA 2VAMA 3ON5A 4Q66C 2IOQA 3NWBA 4RLFA 4JH0A 3ER6A 4DEXA 3OBBA 1EBFA 2RGEA 4QEDA 4MUXA 2IXTA 3RHZA 3X1MA 1RIIA 3ZZ0A 2ETXA 1Z0KA 5TEVA 2B4TO 2IUEA 1D5WA 3HI6A 4UXHA 5ALSA 3ZYZA 5JEDA 2C96A 4Q3CA 3ZWMA 4MQ6A 4WNAB 5KDOA 4Z4FA 1RBZA 3UATA 4CGYA 1TVKB 4M0UA 3UMYA 1A4XA 2ANBA 3R24A 2XNKA 5KCMA 1GAJA 1GWNA 2DHQA 1L5NA 5B58C 5EIBD 1YNSA 1SU7A 4QNRA 5AR1A 1AUXA 3K9LA 4FYJA 4LY3A 3IJPA 5FT9A 1HK7A 3FPHA 2A0KA 3AFHA 3K1ZA 2FCRA 4L4UA 3IAEA 5KYYB 2JLWA 3JQ7A 1DADA 4Y1RA 3IR5A 2CSUA 3VZBA 3GLIA 1EU1A 3RC2A 3MQ4A 4DLLA 5EZYF 1JEDA 4IIJA 5TQ2A 4C30A 1PYDA 3UB4A 5CBKA 3CRW1 4S1OA 1AY0A 5HK9A 3PX3A 5GGXA 5DYTA 1IM8A 2BZSA 3ZLVA 3P9IA 1BHQ1 3PGXA 5IARA 4XR9A 1ILEA 4WT7A 5AHXA 3ZWCA 1FDWA 2NWQA 1AUOA 3QBJA 4KB5A 4M1ZA 5BW5A 2O8CA 3U13A 1JTFA 3PEYA 4DR6B 1CP2A 3AERB 1CQZA 3WQBA 2AA3A 1L3IA 3IAAA 2JG3A 2YVQA 3M34A 5CTAA 3NHFA 1IB6A 1J5PA 1H2BA 2IXEA 2KPOA 4HBGA 1XT6A 2F55A 3ZDZB 1O9HA 1Y9ZA 2IU3A 2CK3D 5IEJA 4FDAA 4Z8YA 1FXSA 3AW8A 3IDOA 4EL0A 3V00A 1GQ2A 1SZCA 1XK6A 4IP0A 4ZZ3A 4DSTA 1D03A 4RK7A 1LTKA 1PEKE 1WIWA 3NDRA 4TYPA 1KOLA 2D2VA 3P32A 2L2QA 2R6R1 3E84A 3ICVA 1P4GA 1KZ1A 3GFVA 4RE5A 4RIIA 4W7HA 1Q57A 3E9QA 2FMHA 3S2IA 3VU3A 2WV7A 3RAPR 2ODNA 5FPHA 2V98A 4B0PA 1GRQA 1Y34E 2FY8A 2VQ6A 2IBTA 5HMLA 4IHJB 3B85A 4AMZA 3K70B 1N2BA 3E7XA 4BN0A 1U0TA 3R2JA 4GPZA 3EDOA 3Q10A 4GGOA 3IUMA 3A11A 3OHSX 3EDQA 5ALWA 2PT5A 1HI9A 2VWGA 3H2JA 4RHTA 4AUMA 4IO1A 4JBXA 4P38A 4EHKA 1YIAA 2AOVA 3DWIA 1QH1A 1WP9A 1LCIA 1O6CA 2BW0A 4WBXC 1M2VB 3HPRA 3EISA 3LDGA 4GZMA 4UCXA 5G1PA 2Y0EA 1JEEA 4C0LA 1SBQA 3FJ1A 1GO2A 2W6PA 5B6JA 4BKOA 5KEIA 2PX4A 2IUSA 2CVFA 4DNXA 1PW5A 1OQAA 5EZYA 4MV3A 5G4LA 1RXEA 1RKXA 2JCVA 2V7BA 1A98A 2OTCA 3HDTA 3RUIA 4MPJA 3UYKA 4MS4A 5H02A 2FPIB 3G8BA 3UFBA 4JVOA 5IU6A 1U8CB 5AW6A 3OO1A 3L8HA 3TR0A 2GAJA 2GBIA 1F8GA 1WZEA 3GL9A 4ME6A 1GFWA 1PNVA 2IHTA 3RGGA 4LOAA 3QSGA 3EPAB 1M1NA 2FE4A 5J1TB 4NV3A 4QDJA 5AXCA 3UK0A 1KNXA 5I7EA 1PX2A 3MD0A 1ZINA 3NNDA 3EGIA 1FYXA 1EM8A 5ALLA 5P8WA 3VO9A 1KRWA 5KNBH 2J9FA 2ATXA 4OK3A 2AJBA 3OH8A 3DP7A 4TQUS 1DTEA 4WSOA 3IE0A 1IY9A 3L4BA 2BUBA 1KU0A 2E0IA 1TEVA 4HLNA 4GGMX 1F51E 3PRYA 2Y0CA 1D3AA 3TOXA 1MX5A 3WL6A 5JNWA 1J7KA 1R15A 1US8A 4IV5A 4J75A 3TQQA 3ZHRA 3FUUA 3GRCA 4OA8A 5AOAA 4IDQA 3DNMA 4UUOA 4RSHA 3OIVA 1OE0A 2ASEA 3HJTA 4FZ3A 4IYJA 5JNSA 4M8SA 3HH8A 1OZFA 2XXBA 3KQUA 4AJHA 4M8LA 2VHTA 1WCYA 3RKRA 4BFXA 3ICEA 1S1MA 3NASA 2XE7A 4QTZA 4I3FA 4U2BA 1JPVA 4Y6GB 3MD9A 3CVOA 3QKRB 5EP2A 2X4GA 3GJ3A 5I7RA 2CDBA 1A7UA 3D0QA 4FDLA 2AOUA 2GS9A 5E1BA 1K1EA 1SEVA 4CCWA 1O95D 3OOYA 3CZMA 4IIDA 1L5MA 1SO8A 1N5IA 3QLUA 1ZN8A 4HMQA 4P33A 4LXHA 5REQB 4F0JA 5CT9A 1L4YA 3GRRA 4EW2A 5JQWA 1K5GA 2OZKA 3C6MA 3EXFA 2ZI5A 5K2MA 2CVZA 1GYRA 3CX7A 5IP5A 1Z63A 1QM5A 2ADOA 2QJFA 3CTPA 4RKYA 4I3GA 2GCNA 4KV7A 2ZQ5A 2XHEA 1IAQA 2JGMA 2VUHB 4ASUA 1L5WA 1YC2A 3L4SO 3GLIB 2Y68A 1UPFA 4B3MB 1K9VF 1Y63A 1R9NA 1DAEA 2J5RA 4QGAA 4O2BB 3R7WB 3RYFA 3EG9A 4QOIA 5EGSA 4CMIB 3KTAB 3VNUA 1S5PA 1SU4A 4KREA 1KVRA 5HQ3A 4MDHA 2SECE 4NMMA 1TYBE 1H2ZA 3FWZA 3ZCXA 3LRXA 3I52A 1T15A 4DCCA 3NT2A 3EPLA 1KQFA 1BXRB 3KEOA 3O8QB 3ZGNA 1EG2A 3HI4A 3W90A 4YRAA 4IDNA 1C5KA 1OBHA 2W00A 1H65A 1XV5A 5ENVA 3GEPA 4LZPA 1VJTA 5HMMA 2B9VA 2J07A 1B1CA 1N9ZA 3P20A 4GR4A 1R6VA 3E3MA 2B20A 3I42A 3PRJA 3QIAA 2HGZA 2A35A 2G0NA 1C4OA 2PLAA 1YS1X 3DO6A 1EZ4A 5L7WA 3JVVA 4Z1MA 2G8LA 1DWOA 3T38A 5J23A 2IP1A 3QBDA 4XM1A 4UU8A 1JAYA 4HLUC 3UT5B 2TMGA 3I6BA 8ADHA 3PWSA 5ALHA 3QYJA 1U8FO 4XDGA 1T1GA 5E1DA 3FRHA 4LYFA 5ALQA 2Q2NA 1MW9X 2AV6A 3H0EA 1D1QA 4DCSA 1LI4A 4YFYA 4A2QA 4S2EA 4TMWA 2VT7A 5KCZA 4EGFA 4ERNA 1A8PA 3SOZA 4N3CA 1OY1A 1ZK1A 1GGFA 2V6GA 1C1HA 2RFLA 2Z5FA 3A7DA 3R23A 3FNFA 4ND3A 4PS1A 3TVYA 4GI5A 4MKRA 4BU1A 3AT1A 1I7SB 2G6TA 2JLUA 3HBMA 4GYJA 5F5XA 5AUQA 4RVDA 4B6RA 1HTBA 1ULZA 1N2JA 5TQJA 1VJDA 2PBFA 4Q7EA 4NP6A 3X1JA 1TM7E 1K6IA 1IWPB 2MTBA 4QA9A 3F9CA 1QE5A 2CFTA 4W99A 6Q21A 3KX2A 4LHVA 2NSLA 4JYZA 3AUUA 2O54A 3AF0A 2JIOA 3G2MA 5G3YA 1LFAA 2QOEA 4O4IF 3I2KA 4YRRA 1V6AA 2GX6A 3NIWA 2FPIA 2P6OA 2GCOB 4JLWA 2ODQA 4KQXA 1KZ9A 3RC1A 3O73A 3QOWA 4K9SA 3ZVLA 1YJCA 3ZWWA 4XVHA 3JALB 5ALOA 4EPWA 1FIUA 1KAEA 4N7RA 3SF0A 4PX5A 3EZ6A 1I1HA 2W9XA 4F92B 1N2ZA 3DL7A 4HAWA 4QSHA 1Q7GA 2XNDD 3VX4A 4FR2A 3OKCA 4D1YA 3A3KA 1Z2PX 5A9SA 1TUBA 4BNDB 3LF1A 1D6JA 1G8HA 2J31A 5HP4A 2PPLA 1OA1A 3N2KA 4N39A 4FNAA 2AE1A 3NOOA 4I08A 4KSYA 4UBOA 3U37A 1W9HA 2RHJA 4X1IA 1N77A 3ZUGA 1NVDA 3OOEA 1DUVG 1P44A 5A3QA 1SM4A 5FB3A 3CV3A 3EQ8A 5SZIA 5B3JC 4I8DA 2GILA 1H5QA 5CEFA 1I36A 3IAM6 4JJGA 4XUCA 4X6UA 2GM4A 2WTEA 2R7AA 1G3IA 4RMJA 1K8QA 2HT6A 1SAYA 4W6ZA 1PWYE 2C7VA 1KI1A 2GMWA 4UHEA 2AS0A 3K3PA 5CM9C 5LDHA 5JHGB 3H0VB 3F78A 2HJVA 2WE8A 4ML3A 4JOCA 1BHO1 3UEOA 4ZMBA 1I2DA 4YFVA 5L95A 1EH5A 1OI2A 5GY7A 5L9AA 1TCVA 1IOLA 1UC5B 4US0R 4XTCS 4DJJA 1XMVA 3QPVA 1KY2A 2OD9A 1VE3A 3QUSA 4PGHA 1X7WA 2HBQA 2HMTA 2D2FA 1ZJ6A 4B8ZA 4J16C 4XTRA 4K9DA 1Z6AA 4ZCLA 2G08A 3R5HA 1IOWA 1F1JA 3IVMA 2GYVA 3EIOA 5IBQA 4ALJA 4NRDA 3N8IA 5TPWB 1W1UA 3QF4A 3JS5A 3PPVA 4KLCA 1G8KA 1Z6PA 4G1VA 4RJ2A 4XKJA 2MSKA 5CAEB 4ZI2A 1UAGA 5L4SA 1U11A 3GA0A 1FTSA 4LZLA 3TGLA 3LCRA 4LSZA 5DE3A 4BP9A 3SIXA 3ICOA 4HY3A 3RAFC 4HAUA 2DLDA 1W87A 4P1ZA 4M89A 1WUKS 5EOVA 2I80A 4ZO7A 5C35A 5IXSA 4Z4GA 1J5EB 1AHPA 5B55A 1FL9A 2JH9A 4NARA 5DHUA 3X44A 3FMFA 1ISRA 1OIWA 2PWZA 2WIDA 3EZNA 3N74A 1YI1A 3VZSA 1EFTA 1MFZA 1NW3A 2OT3B 3O4GA 2VEOA 3ROGA 1LBIA 2LZ0A 4EG1A 3KEMA 1DEKA 2TSYB 4EATA 1N7JA 4JJ6A 4MUAA 3AY3A 3EYWA 4LZJA 2YRXA 2QY6A 5AT1A 2HU8A 2YN4A 1LQUA 2FPSA 2UZ4A 5JG7A 4DZZA 1NG9A 3F8SA 2NGRA 4EZEA 1QAOA 1ZJZA 3NVAA 4HNGA 3JVIA 4J0QA 2J4FA 5DHRA 3GPDG 4DQKA 4YCMA 2GB4A 2ID8A 2IHUA 5A6VA 2BFEB 5K0ZA 2PU7A 1PNQA 3DAOA 3H3XA 3KVYA 4JCOA 5J43A 1RLOA 1FP4B 1ZI8A 2E4YA 3R6WA 3SDBA 3OMXA 4CQNA 4OK6A 2JGJA 1NSTA 5CVTA 2B1IA 3EPBB 1I7BB 4KUHA 1M75A 3EAQA 1N3LA 4TMZA 3KIPA 5T3UA 5KREA 3KLOA 3F74A 2X9QA 1KORA 5GP1A 2Q4BA 1KYTA 3NPMA 4U9UA 3H13A 4AJ2A 4D26A 4BRUA 4K6CA 2XSZD 3OPXA 3NANA 2J6HA 5AKXA 1KXJA 3FUTA 1RPTA 3LY8A 1UWLA 2WWVD 1P2VA 1DIRA 4MVJE 3IE1A 5K0TA 1PR0A 3ENWA 3OLVA 4RSMA 3WO1A 1KQNA 2FTKE 3H11B 2YYZA 5AM3A 1R8JA 4PX9A 2IL1A 2ZYIA 4KITB 4Q4LA 3TBHA 2HDNB 2PUCA 2FZEA 3C1TA 3L05A 2FG6C 3QKSA 3TQSA 1CZLA 1NU8A 3DXYA 5AUOB 3Q1LA 1V11B 3L01A 4CF5A 3M81A 3PD0A 4JSTA 3OZBA 3GLIE 2NUTA 2AMYA 3H5VA 1P9RA 2VJPA 4GKVA 3RC8A 1N5OX 2DBVO 2ATIA 4ZALA 4HLDA 1T6YA 1ZSVA 1W0CA 3NEJA 4FZRA 2J6CA 5H0IA 1E6LA 1U2QA 4JI3B 3FTPA 4G67A 4HGZA 3U7JA 3W7AA 1P6XA 4ZEWA 4X20B 3CE6A 1VI6A 1DTWA 3LUAA 3ZBUA 1RM5A 3MMXA 1NC1A 3K2BA 3NCHA 2JFGA 1NW9B 3H99A 5J5AA 5AKEA 3WK4A 3NBXX 2AKAB 4MAFA 5DTQA 4MYTA 4EQZA 3D4BA 3FKJA 2PKXA 3VZQA 5E4FA 1KSGA 4RF4A 3CVXA 2Y1CA 1T4DA 2OCXA 3VQTA 5G0TA 1E6MA 4DDMA 1I72B 1N7IA 3RYFB 2V7QD 4MKHA 4LMRA 4QECA 3GJ8A 4X66B 4AY2A 1T25A 3NHUA 2A86A 2QYTA 2R8XA 2EJWA 1JKXA 1NX6A 2F3PA 4QTXA 2QXTA 2C2XA 2C9YA 3A6FA 4I19A 3Q6MA 4IJVA 5SYMA 3VYRB 2QX8A 3KOMA 3I5YA 4IBOA 2B4YA 1KH2A 1QMPA 3STTA 3ZVMA 1AXRA 1QFXA 4IJMA 1P4HA 1E7YA 4L5AA 3T4UA 2L0XA 4Q9IA 1EVKA 2ZI4A 1O94D 4D9MA 5LZ2A 5C1DA 1Y42X 2YMLA 3AY6A 2QRPA 2YOHA 1G0OA 4FC7A 5EEHA 2ORYA 1XNQB 3OLQA 2HUPA 4DPKA 1CY0A 4S35A 4H59A 4D4JA 2D8MA 4F38A 1YE8A 3QVLA 4WLEA 2GWRA 4XLTA 1S2OA 5LIPA 4MR7A 3RG2A 3VPXA 1FJXA 1JQEA 1CLUA 3EGXB 4N41A 2R8RA 4AJLA 2XZPA 2AXEA 5IC4A 4OL9A 1KI3A 4Z1OA 1ZUNB 4PLYA 4FPXA 4F5DA 1UC9A 2HD4A 2CMGA 2VTDA 2XUAA 4Y18A 3L5KA 1QHFA 2Q6LA 2GDZA 3NBYC 1SCNE 2OOKA 3RYHB 3AI7A 3LC0A 3O4IA 4MRMB 4QTTB 3I58A 2RI6A 1H22A 2QL5A 4N5NA 1RAHA 3ZIDA 4LV6A 4G5RA 4RPIA 5EN4A 3P45A 1GV1A 3O8LA 4NJEB 2YUIA 3BSFA 3G8YA 4RHFA 1NVFA 3ABRB 4EG0A 4DUYB 1X1EA 1BJKA 2GEDA 4FOTA 3TLCA 1W2WB 3LS2A 1E2QA 1W0KD 2IZOA 3FF4A 1SHLA 1G1AA 3PC6A 2NYRA 4L72A 3U3KA 1WX1A 5DKFA 4JI2B 2I2BA 3DLIA 3JQAA 2X0RA 1DAHA 4YV7A 3KKNA 4E12A 2VAWA 3MTQA 2BFEA 3GX1A 4CM1A 3BXXA 3M4YA 2WM2A 2PFGA 221PA 3I2IA 5IC5A 3T3HA 3VR5A 5JAOA 4Z4HA 4HUTA 1NMYA 3B3FA 1IXSB 3IVXA 5E0KB 3EVGA 4YDQA 5KQMA 3HXOA 4EA7A 1USKA 2C97A 2CNWA 4JZYA 3JQRA 5IT0A 1CX9B 1WZUA 3AVOA 3BWXA 2V9CA 3D6TB 3CX3A 3I45A 4IXNA 4F46A 4XUGB 4RZSA 1R1DA 1X7GA 1X92A 2R87A 4QOGA 1XCJA 4RMHA 1T9KA 5AVTA 1OFUX