3BTUA

Crystal structure of the super-repressor mutant of gal80p from saccharomyces cerevisiae; gal80(s2) [e351k]
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
420
structure length
392
Chain Sequence
APIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRKEIMKVYHLRNYNAIVGNIHRLYQSISDFHFNTSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 121
structure length 392
sequence length 420
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btuA01
1OAAA 1PJLA 1UJMA 3H9QA 4Z9FA 5CG2A 2R00A 2O3TA 1YVEI 5FFFA 4F3YA 1HL3A 1LDNA 4FCCA 5I9MA 3NTQA 5THQA 1JN0A 1PEDA 3PJGA 4RPJA 3MWDB 3VAZA 5ILGA 3DO5A 5DCYA 5G0TA 2BKAA 1HDXA 1NXQA 3E9QA 4A26A 1O95A 3PIIA 2QHXA 2B83A 2WD8A 3JD1A 4XZ3A 4R4JA 4K6CA 3NYWA 5IZCA 3RSHA 3JQBA 5EPOA 1F0YA 2HJRA 1HZZA 3AW9A 3EDMA 3L4BA 1QYXA 2EJWA 2JHGA 3VVCA 4D45A 1LRLA 3ENNA 3JQEA 3ASVA 2A35A 3I9JA 1PZFA 4C7JA 3ZHZA 2QYSA 3ANNA 2AQ8A 1NQAO 1OZAA 4URFA 3PI7A 1LU9A 4CMKA 1HE3A 3AUSA 2YV2A 3JD4A 2SCUA 2XAAA 4ZQHA 2I5PO 2Q2WA 1VJ0A 1T2FA 1YB1A 1LC0A 3HN7A 4ZHSA 3NJ8A 4RZIA 4NMHA 1XDWA 3JYOA 5TF4A 1CRWG 3FWZA 1WWKA 1KIFA 2QZZA 4GVXA 3OA0A 3AY6A 4GX1A 2EKLA 3H7AA 2O2YA 1GU7A 4MPDA 1CETA 3ROMA 3WB9A 5KCZA 1P1JA 4UULA 4ZJUA 4JNKA 1YGYA 5L4LA 3QSGA 5T67A 2VUSA 5HBRA 4NR0A 1I10A 1W4ZA 5TGDA 3GNTA 4DUPA 1LBEA 2EW2A 2UDPA 1W0CA 4H16A 1LC3A 2B69A 5COAA 1EE2A 1Y1PA 1HYEA 3BTOA 2H6EA 3Q0EA 1JKJA 1ENOA 1R37A 3DHNA 4J91A 3QRWA 4LMPA 1ZEJA 3ZU5A 1PGJA 5CDGA 3HNPA 1X0XA 4B4UA 3BIOA 1IL0A 1XKQA 3BMQB 4IJKA 1U28A 2Q2VA 1E3JA 4GVLA 4MOWA 3ZWNA 5K9ZA 1V3UA 1N5DA 4FGWA 5EESA 3FPCA 4MIYA 3KBOA 5TT0A 1O8CA 1ULSA 3OM9A 1JWAB 2VHZA 5BNFA 4RF2A 4DLAA 4FR5A 4I5EA 2X0IA 4ZVVA 3GGOA 1DBVO 2Z1MA 3ETEA 4CODB 3PHHA 5K6AA 3WX0A 4PLFA 4WASA 2Y66A 4E2WA 6LDHA 1IE3A 2X0NA 5A5FA 5L53A 4BUCA 3HUDA 4MJLA 4CM8B 3AI3A 4AJIA 1YL6A 2GR9A 1PSDA 4AG3A 3KO8A 4BNVA 4IGEA 2BFAA 2X9NA 1E7MA 5C37A 3STHA 4WEQA 5HWSA 3S2GA 1YO6A 2VTDA 4BNYA 3RFTA 5JYFA 3DZJA 1R0LA 4L4SA 1TT5A 4N7RA 3PFWO 1JVSA 4CMGA 3F6YA 2NVBA 3WLEA 2XXBA 3MJCA 4NH4A 4EZBA 3WTBA 1OBFO 2VWHA 2W90A 4J4TA 2DAPA 3M6IA 1BMDA 4GL4A 3CMMA 1W8DA 2D1YA 2FMUA 3GGPA 4BO8A 3U4CA 1DC5A 4OO3A 4CM6A 4ZGWA 3O9ZA 2CNBA 1AXEA 1NVGA 1XA0A 1DO8A 4R51A 3C7DB 2DC1A 2JJYA 3GVHA 3KZVA 3AWDA 4UAGA 3GNQA 1R0SA 1ZCJA 4CR7A 3GH3A 4UVEA 3M1AA 3FR8A 1V6AA 4Q3DA 1P3DA 4BO2A 4OSOA 3NGLA 3NUGA 1RPNA 5TC4A 4I9HA 1NFQA 2FRDA 4RF5A 4EJMA 1B3BA 3JQAD 1VE9A 2V65A 3WG9A 4MKXA 3FNHA 2D5AA 3ONDA 1ADFA 1U2GA 4R1UA 3DB2A 5TX7A 4L74A 5EJ2A 1T25A 3WICA 3FTPA 4RF4A 3I83A 1R0KA 4MINA 1KEVA 5L4SA 2HMTA 3GF4A 4EGFA 2ET6A 1ZW1A 4ID9A 1XU7A 1KC1A 1LSSA 2P9GA 2ZB8A 4NBWA 2NTJA 1Q1NA 3RD5A 1P44A 4DYVA 1XG5A 1X7HA 2AQKA 4IMPA 4O6VA 3W8DA 3GY0A 1E92A 4W9NA 3WSWA 1IPEA 4XEHA 2B37A 1D1TA 1UP7A 3WNVA 2HO5A 3PYXA 2NVUB 5EIOA 1DJNA 4BV8A 3PJFA 3OJ0A 2NU8A 4BNJA 3QE3A 4D42A 3OETA 2HCTA 3JQCA 2VYVA 2GZ3A 3KLMX 5F1PA 1MP0A 1PL7A 3TZ6A 5KJCA 3I9KA 4HP8A 1ARZA 1HDZA 4J7XA 5DP2A 4CMBA 4XQ9A 3PJEA 2NVUA 2WSBA 5JLAA 1GUZA 3IMFA 3NV9A 3SX2A 3I9LA 4X54A 5G0UA 4BGUA 1U5AA 3GHYA 1UP6A 2W2LD 4I8XA 3TL2A 4LN1A 2OO5A 4YEDA 3RI3A 2GZ1A 3IKVA 4FB5A 1ZXBA 5JO9A 1B14A 3FRJA 1Y8RB 2FHSA 2BRUA 1NYTA 2PWZA 4GMGA 4OOEA 2AXQA 5MDHA 3DBLB 1I36A 4IDEA 3LDHA 1I3KA 1EDOA 2DFDA 2CF5A 1ORRA 2GZ2A 2PZLA 3EAGA 5DOVA 5IZ4A 4FJ1A 2GD1O 4R1TA 1DFHA 1GEEA 1Y8RA 3O4RA 3IQDB 3PWKA 4OOFA 4JJGA 4FC6A 4DQVA 2B5VA 3H8VA 3DBLA 3OFSA 4OQZA 1DHTA 4JCOA 2JD1A 3FBTA 4JBIA 2Q45A 4NBUA 1N7HA 4R3WA 1KVUA 3ZWMA 2Q1TA 3F1LA 3TZHA 1ZXLA 4DLBA 3EYWA 1AGNA 1MFPA 3PZBA 4OM8A 1I32A 2NU7A 4BIIA 1JA9A 3TZCA 3H3JA 3UF0A 4AJNA 1DB3A 2A4KA 1UXHA 1E0DA 3BHMA 2YW9A 1U7HA 3VTFA 2VYNA 1B26A 4Q3EA 5G0VA 1NPYA 4IJWA 3PQFA 5BSFA 2AE1A 2Q3EA 3R1IA 2Y05A 3H5NA 2Y1GA 1U9JA 3RQSA 3QY9A 3DFZA 5JMPA 4Y9DA 3RUAA 1K6IA 1NFFA 1H6BA 4NQZA 3ZWPA 5DOZA 3DBVO 3DR3A 4ZN6A 2TMDA 2QQ5A 4NFSA 4DYDA 1ADCA 4WCFB 2ILTA 1JU9A 4DRYA 3U4HA 1GYQA 1NASA 3B1JA 3PP8A 3HN2A 2Q50A 2X5JO 4HADA 2O48X 3TOXA 4J4BA 3DFUA 2ZTMA 1P1FA 2FY8A 1BXKA 1TVEA 4TSKA 1V3TA 4KWIA 3I9MA 2AEMA 3HSKA 4ITUA 5G2OA 3JQGB 4WCFA 2B4TO 3SLKA 4ZICA 3JYLA 2PKRA 1NFRA 2DBVO 2X23A 3ONFA 1WPQA 4E32A 1K6JA 2P91A 3V1TC 2HMUA 1Q7GA 4D0RA 4DIFA 4IY1A 1GZ3A 5A05A 5TNXA 1R16A 5EERA 2X1HA 4CMIB 4YDRA 3JQGA 4H7PA 4EEZA 1E3LA 5DBFA 3JD2A 1DDOA 1A5ZA 4BNUA 1YWGO 3W1VA 1U8XX 3GVPA 1XYGA 3DOCA 1R66A 3G79A 3BHJA 3DMYA 4J6FA 5IAAA 4CMIA 5JYAA 1E3SA 4I5FA 1M76A 2O3SA 3OQ1A 3ABIA 3VVBA 3ZDFA 4MP8A 4B4VA 3ZHXA 3HFGA 2PZMA 4CMJA 4E2YA 2YHUA 4QECA 4QQRA 5CEFA 2OORA 4QSMA 3CIFA 3CMCO 3WGOA 4Y8VA 3H2SA 3AI1A 3WQSB 1PJTA 4GQAA 2PKQO 3I4FA 4RDHA 2IZ0A 3L4SO 4NBTA 4NNJA 4EI2A 4WLOA 5CAEA 3O26A 4A73A 4JLWA 4ZQEA 1MGOA 1UDAA 4ZU3A 3PHLA 1TEHA 3ZN2A 4BKQA 5AQ1A 3CPSA 2J5RA 4LMRA 3CSDA 1N9GB 1Y8QB 3F3SA 2G17A 1XLTA 1PQUA 4QO7A 4E13A 4JX8A 3L9WA 3H65A 3NAQA 3RU9A 3I52A 2DVMA 2Q4EA 4LSWA 1MC5A 1U3VA 2YV1A 1ZO8A 1FDSA 2PD4A 4W82A 4PLGA 1YBMA 2I66A 1N9GA 1Y8QA 3RBXA 1DC4A 1CDOA 3F5SA 1ISMA 1NNUA 1VL8A 2B36A 3FWNA 3V2GA 1H6DA 2Y1EA 4WLVA 1WMBA 1B8UA 1RM0A 1X14A 1I2ZA 3WOHA 4YYZA 1VPDA 1U3UA 4XGKA 1DIRA 3AOEC 4BNHA 1P0CA 4IM7A 4BMVA 4HFRA 5A9TA 2PR2A 4YT5A 3SC4A 1BXGB 2EGHA 4PLVA 1IUKA 5H81A 1ZMOA 1ZK1A 2YFQA 3ORFA 3WMXA 1UZNA 1M75A 4R54A 1PWXA 3DOOA 2CD9A 1RM4A 2X0RA 5C7OO 1IZ0A 1YDEA 1U4SA 1GV1A 1BXGA 1UDCA 1TT7A 1Q2XA 4UEJA 4CJXA 2C7GA 3ANLA 4XRGA 1EEHA 4RGBA 1DFGA 3WIDA 1NQOA 4FW8A 1SCUA 4FC7A 4HY3A 4BB6A 1MUUA 2G5CA 1TLTA 3Q11A 3K96A 4WLEA 2ZTVA 5G4KB 2RHCA 3OJEA 4DQXA 1XHLA 4AL4A 5JMWA 3W6ZA 3UH1A 3G0OA 5G0WA 4R01A 3SVTA 3QVSA 1AN9A 4TZTA 2UVDA 4HFJA 1A9YA 5FYDA 1KY5A 5G4KA 2VZ8A 1VM6A 4O59O 1NM5A 5I7FA 2DLDA 3PEFA 2X9VA 4BKUA 2BGLA 5AOVA 4TZKA 3PPIA 4YPOA 5IDYA 1H9BA 2BLLA 5ER9A 4OAQA 3GAZA 4FN4A 4CM9A 3UOGA 4ILKA 4M87A 1LDMA 4HV4A 2PK3A 1YXMA 2WJPA 2Y99A 3PWZA 3KVOA 3UICA 3KSZO 4H3VA 3K9QO 1B16A 3B70A 5TJHA 3GN2A 5L4NA 1I5RA 4FFLA 4BQPA 2IYOA 1TA4A 5AYVA 3NJ4A 1YBVA 3HHPA 1HDYA 5L7YA 4Y6PA 3G1TA 3QV1A 3E03A 2Q99A 4UVDA 2GERA 4J0FA 5JPIA 2VQ3A 1WNTA 1TI7A 3BYZA 3DOJA 3GGGA 1S7CA 3CKYA 1PJSA 3BXXA 3ETGA 5L95A 4J2OA 3EVNA 2VWGA 3K8ZA 3QP9A 1B8PA 1FK8A 4YAIA 1I24A 2Q22A 4RZHA 1E77A 3RWBA 1LLDA 4A10A 3FBGA 1S6YA 4E0BA 2RBEA 3RU7A 3RC9A 5A3VA 2WD7B 5BQFA 1CF2O 3C1OA 1HF3A 4DIOA 1T2DA 4GKVA 2HLPA 4DA9A 5HM8A 5DCWA 1Q0QA 3UUWA 1EUDA 1ZNQO 1E1MA 2Y67A 3TFOA 1XSEA 2D3TA 2WD7A 2YHIB 3MTGA 5T64A 2CDBA 1GD1O 1D8AA 1WDLA 4FFRA 5IF3A 1Z7EA 1SAYA 2YDXA 3F5QA 3EY4A 3GC6A 1UAGA 1WMAA 3DQPA 3OH8A 5KVQA 1ZK3A 4LVCA 3Q2IA 3D64A 1ZK4A 3WWYA 3DMTA 4BVAA 1J4AA 1RM3A 3I23A 4BMNA 2YHIA 3RC2A 3ZU4A 1IZ9A 3IDSA 4FD3A 1LRKA 3OEWA 4D3DA 2X8LA 2IEDA 5JBIA 3C85A 3ZNPA 1I33A 1YJ8A 5MGBA 2VOJA 2VRCA 3GA0A 2AG8A 3C7AA 1KEPA 1AUPA 2B0JA 4J1SA 4YJGB 1FMCA 1QG6A 3K73O 4AJEA 3OSUA 3D4OA 5BR7A 5JFOA 4N5NA 4PVCA 4J90A 4KUEA 4RVHA 5DNAA 1KS9A 4D7AA 1SBYA 3PQEA 4RPGA 4WOJA 2C5AA 2FPIA 2UV8A 4F6LA 5A9RA 1X1TA 2YJZA 4O1MA 2OXIA 4LCEA 4YJGA 1A27A 2NU6A 2HMSA 1XQ6A 4RQUA 3MEQA 3D3WB 1PJ4A 5JAZA 4CV2A 4HXYA 1VL0A 4JBHA 3ADOA 3NTRA 3GHHA 4RVGA 4CM3A 1Z7BA 2DBZA 2VZ0A 4W7IA 2WTBA 1A4IA 3GUYA 4J43A 3BTVA 4U0KA 4RV9A 2OL4A 1HDGO 3ZW8A 2EV9A 2Y68A 3O03A 3H9EO 1EDZA 2BF7A 2CMDA 5CHEA 2QW8A 3NTOA 1LDEA 1J49A 4XGIA 1E3WB 3MCVA 2P4HX 4IQGA 4BO7A 4JP2A 2DBRA 1IPFA 2LDXA 4E5MA 5JAIA 2DTXA 3WQQA 4QFDA 5DZSA 1M67A 4R5HA 4KDEA 2JFFA 4BO4A 2EERA 3PLNA 4ALJA 2POQX 2WYWA 1E3WA 3H5AA 4FOSA 3E9NA 3JQ9A 3OIFA 1XU9A 3EK2A 4YT4A 4WK6A 2VUUA 1CERA 5I7VA 3GEMA 1MC4A 1UXJA 2PH5A 4ZQFA 1LSUA 4B3IA 3WJ7A 1MXHA 2XF8A 4G2NA 5FI3A 1UR5A 3FCOA 3VPGA 5T8KC 1NVMB 3C3XA 4CLDA 1MXFA 2VYND 5B4TA 2DFVA 1BRMA 4M86A 4K9DA 3A9WA 1WXDA 4AJ4A 3D3EA 4O63O 1B8VA 1OC2A 5ICSA 3ZU2A 2ZK7A 5F3RA 1GTMA 3IAHA 1RWBA 2RHRA 4MIOA 1J0XO 1VSUA 2UUOA 1VKOA 2I67A 1E7WA 4XQEA 1I2BA 4QTZA 1ZSYA 1GPDG 4QUKA 2GN4A 2Y1CA 2EXXA 1MG0A 1HXHA 1KYQA 4IIUA 2WYVA 3H5RA 4PFJA 1DIBA 3AJRA 4AICA 4BKPA 2OUIA 4UUOA 1RM5A 1PU2A 3ZV5A 1RYEA 1LSOA 3GZNB 3L07A 3G3EA 3ICCA 4KQXA 1PWZA 1QYDA 3VDRA 1C0KA 1RKXA 4DC0A 1DC3A 1O9BA 4J9VA 4IINA 1K0UA 3V2UA 4YRDA 3MTJA 2JKVA 4IDCA 4XYLA 3W4KA 3GZNA 2B5WA 1PS8A 3DONA 4Q39A 4DC1A 2RAFA 1Q7BA 1K2WA 2G1UA 4IGFA 4PG4A 1V0JA 1ZK2A 5H83A 5KNLA 2H63A 2NU9A 4ALMA 1F06A 4BMSA 1M2WA 4D3FA 2Z5LA 1YQXA 1ISFA 2P5UA 4OJNA 1I0ZA 5BSHA 1YQDA 4MVJH 4AJPA 2PTGA 4RVSA 1DLJA 3AI2A 2DTEA 3SC6A 4OYRA 3BMQA 4DBVO 4IJVA 4TQGA 4XQCA 5L40A 2OBYA 4R9SA 1PIWA 1LQUA 1GZ6A 4TVOA 5KIAA 2CVQA 2VHVA 1NHGA 1SPXA 4E12A 1E1KA 2HRBA 3HDJA 4XA8A 1MA0A 4JIGA 5B4VA 1NHWA 5L45A 5LC1A 4NI5A 3WWZA 4RCVA 4P4GA 4B7UA 2D5CA 3BMOB 4IJUA 5KVSA 1EFLA 1F8FA 2AQHA 2O7QA 5EQFA 1NP3A 1W73A 1VJTA 3P19A 4WOKA 1F17A 1GADO 2GO1A 3DTYA 3C1TA 3BA1A 3U0BA 4LGVA 4J4HA 2Y0CA 1N2SA 1ONNA 2NLOA 1G0NA 3QQPA 1GY8A 2H9IA 5ICMA 3Q3CA 3PDUA 4CM8A 3GAFA 4IS3A 4CM5A 3OP4A 3GOHA 4CLHA 3BMOA 4I5DA 1JAXA 2Y1OA 5FF9A 2Q2QA 3RUFA 3IUPA 2NUAA 1E1NA 1B0AA 4YR9A 4IMRA 3T4EA 4K28A 1DXYA 2YDYA 4E5KA 2V6MA 3H3FA 1X15A 4JJFA 2HUNA 3KV3O 3WS7A 5B1YA 2C0CA 2UAGA 4J49A 3GEGA 4CMEC 4L8VA 2DBQA 5AXAA 1X1EA 1X0VA 3WGIA 3MJSA 3UFXA 5I8WA 4BNTA 4CL3A 3QWFA 2GN8A 3D1LA 3ZHBA 4UUPA 1G6KA 4NJOA 1T4DA 4Y6RA 5A1TA 5LCXA 5L7TA 2XPCA 2IRWA 2C82A 3DZIA 4S3MA 2BHLA 1NTOA 4IZHA 3RAJA 4GAEA 1NPDA 1ZZEA 5G0SA 3WGTA 5C5IA 3ST7A 2BMAA 5JNLA 2X6TA 3E8XA 2A94A 4MIEA 1SZJG 1DFIA 1LRJA 2GN9A 3GK3A 4GBJA 3AY3A 4K26A 1JVBA 4PRLA 5JDIA 4WPGA 1EMDA 3SJ7A 1AHHA 1GCOA 1H94A 3PVZA 4M55A 3EVTA 5A04A 1KEUA 2E4AA 3L9XA 4RPHA 4YBZA 3DAGA 4MDHA 1YQGA 3COSA 3F47A 2BFPA 4U8GA 4E5NA 1Y7TA 4GPD1 1HE4A 1K6XA 4I1IA 5U1PA 5CEJA 5KJEA 4C7KA 2PZKA 4EEXA 3ZWYA 4O0LA 1SMKA 3NRCA 1KVQA 4GI2A 2YV3A 3DEYX 5BNIA 2PY6A 1B2LA 3LQFA 1WW8A 3TJRA 2NTNA 5GZ6A 1O0SA 1E5QA 1PGPA 1LSJA 1QXSA 3OQ6A 2PZJA 1D7OA 1GAEO 1A7KA 4XCVA 3L77A 4RVFA 4YACA 5F5NA 2ZCUA 1PGOA 2YZ7A 5JDCC 3RBZA 2X7HA 2BI7A 4CM9D 4II3A 1U3WA 4N5LA 3VH2A 3QWAA 1LUAA 5C3MA 3GNSA 2J3IA 4GSKA 1A71A 1NR1A 3VZQA 4OMUA 3M2TA 1I30A 5JW6A 1N7GA 2VWPA 3LT2A 3WYEA 2WEKA 3VZSA 3UAGA 1TB4A 4WECA 2YYYA 5JYEA 2EW8A 3NDRA 1I3MA 4D0SA 3AM5A 5IDWA 4CL8A 4IXWA 3QHAA 3WNQA 1ENYA 1LNQA 2R00C 2C07A 5KVCA 1ADGA 3VOSA 4XWYA 2C54A 3FPLA 1ZMTA 3HG7A 2FZWA 4QO8A 4NIMA 2HK8A 3PTZA 4AJ1A 2B4QA 4TMFA 1NWHA 1NAHA 1EUZA 3P2YA 4JJIA 2J5QA 2JCYA 4YQZA 3LZ6A 3I6QA 5COQA 3C8MA 4XIJA 4N18A 3HQ4O 3Q9UA 2C29D 2ZCVA 3S55A 1ZSNA 5IZCC 2HDHA 3TOZA 3RUIA 3JQBC 3WFJA 5A4DA 4JGBA 3INRA 3HB4X 2EKQA 2Y0EA 3L4BC 6ADHA 1DPGA 1GEGA 1HT0A 2EP5A 1VL6A 2OP1A 3NX4A 1WDMA 1DRWA 1LLUA 2AW5A 2YQ5A 3ROPA 4ONEA 3LF1A 2D8AA 3H9UA 2ZYAA 5IG2A 1K3TA 3FR7A 3E18A 3EUWA 2PLAA 3AUUA 4Z0TA 3ZH2A 5ENVA 3S8MA 3HDQA 1VSVA 1FDUA 4W4TA 4ZQBA 4CLOB 3WIEA 2C59A 4PZEA 2HU2A 1OC4A 4HBGA 2DQ4A 3EMKA 3M1LA 1E5LA 4YAJA 2JCXA 1YRLA 5DBIA 9LDTA 1Q0HA 4CLOA 3W4JA 3GDGA 3GG2A 4D46A 2VT3A 3NT4A 2PGDA 2VRCD 1DAOA 2ZQZA 4DGSA 1U8FO 4FPXA 5FI5A 3H4VA 5ILOA 2FSSA 4R3NA 5J23A 3FF4A 5DT9A 2CVZA 4DL9A 1A4UA 1PS0A 3TPCA 2G76A 3RVDA 4BKOA 4FGSA 4FOOA 2GSDA 1H5QA 1H93A 4XYGA 1C1XB 4BL5A 1XCBA 4BNKA 1DIGA 3RIHA 2JAHA 3VH1A 3V2HA 1DRUA 1CQIA 3U4IA 1PR3A 3ZCXA 1C1XA 3GPIA 4JROA 1I3NA 1HLDA 2CF6A 4PLYA 1K89A 1NPTO 4LRTB 1E3IA 4UVHA 3VPSA 4B7CA 1QORA 3QA9A 1HDCA 1UUFA 3JQ7B 4KUGA 1ZJYA 4HUJA 4DTIA 5K6AC 3ZNOA 1I01A 2DU8A 4PLPA 7MDHA 4WNIA 1H6AA 4E4YA 2CVOA 3BMNB 1SB9A 4B4OA 3K31A 1E3EA 1BVRA 1UP4A 4DVJA 4MVJA 1AHIA 2EG9A 1QYCA 3GDFA 4JK3A 4E30A 3JQ7A 2QIOA 1WLYA 4XR4A 5DCUA 2FZEA 2JCVA 3PLRA 4ZQGA 3BMNA 3E6AA 1GFSA 2HQ1A 1P1KA 4XB2A 2NV6A 3MZ0A 4ESOA 1U2DA 2QYTA 4I5GA 3WMWA 3DDNA 3V1UA 3WYBA 2PV7A 1C3VA 1DJQA 1MG5A 2RH4A 3IJRA 3KXDA 2V6BA 4ROSA 2RIRA 4NFHA 1MB4A 4CUJA 4Q3BA 1PJ3A 5H82A 2OGUA 1T24A 1D3AA 1UZMA 4QXMA 4Y98A 3RUHA 3TRIA 5A3JA 2NACA 4PLHA 3JQFA 3TZKA 3V1YA 3NT2A 1VLLA 5J9GA 2OHXA 1XQ1A 3FHLA 4F6CA 4Y67A 3KLPX 1PJ2A 5TQVA 4DLLA 4D41A 3NGXA 5F1OA 1LQTA 3I3OA 1ENPA 4P38A 4PG5A 2JL1A 4LK3A 1BXZA 4BNNA 4LRSB 3VPXA 1DHRA 4AFNA 4BO0A 3WGHA 3MJEA 3NEPX 5JC8A 3DHYA 3CE6A 3EW7A 4P8RA 1HSZA 4ND2A 3WQRA 4BO1A 4BNZA 2OMEA 1JKFA 3R0IA 1FDWA 2YY7A 2OBNA 2Y93A 1HSOA 3ZW9A 4OSPA 4WCDA 4OXYA 4PZDA 3WYCA 1E6WA 2I6TA 5CDTA 2BFOA 1JWBB 4M89A 1JAYA 3UCEA 3DC2A 1P1IA 1KETA 3E82A 1MLDA 1PZEA 2OZPA 4NFYA 4HWKA 3DZBA 2WDZA 3GDOA 4Q9NA 3Q2KA 1BTOA 5TJ9A 3GFBA 1NQ5A 2HMWA 5EINA 4CV1A 4Z0HO 1YBAA 5TLSA 1UXIA 2E6UX 4BV9A 3CXRA 3E9MA 1T2EA 1V3VA 5AXBA 3KEOA 4CLXA 3R3SA 2VOEA 4KQWA 3ZWCA 5IXYA 1FJHA 1WVGA 1YL5A 1EVYA 3U3XA 2Q1WA 4FJ0A 4PLCA 3G49A 4W9NC 3DXFA 4CQLB 3IOYA 3AFMA 3ADPA 4ZRNA 5EQDA 4CM4B 5I7EA 1LX6A 1PX0A 2C20A 2TMGA 1HDRA 1LTHR 3I9OA 3GZ4A 3VKUA 1SB8A 1QV7A 3T7CA 4FDAA 5KJ6A 3CINA 4CMAA 5IN4A 4CQLA 1QLHA 4FBGA 2ZB3A 2NTVA 5JYDA 1L7DA 3IS3A 4CM4A 4YT8A 1QLJA 2DM6A 3C7CB 3GT0A 3OICA 4K1LA 1RYDA 3DHEA 3ZWVA 4W6ZA 2UUPA 4E31A 4FFMA 3VHRA 3KOUA 3U62A 1Z45A 1NVTA 3BAZA 1WZEA 3JCZA 3IIEA 4L73A 1X7GA 1KBZA 4J1QA 4GGPA 4CMCA 2JD0A 3U5TA 1PZHA 4TRMA 3TZQA 4NDNE 1DIAA 1LI4A 4TKMA 3AY7A 1T1SA 2J3HA 4N54A 4EW6A 1FDTA 4NJMB 3UGKA 4E33A 3OBBA 2O4CA 1HYGA 1BDBA 5JS6A 3CZMA 4TWRA 2B35A 1Z74A 4YAEA 3X2FA 4ZA2A 2P5YA 4OKNA 1HDOA 4WGGA 2A9FA 5B4UA 1XELA 2ZYDA 1FF9A 4CV3A 4ALIA 2I76A 4E3ZA 4NJMA 3UCFA 2CDCA 2GF2A 3JD3A 5HS6A 1YDWA 1YL7A 3MJVA 5BSGA 3FNEA 4DQUA 1EVIA 3WGYA 3BTUA 1NBOA 4L0QA 3ZWAA 3BZUA 2QZ9A 5GZ1A 4A0SA 1OFGA 3F1KA 1ML3A 5CP8A 1SNYA 4A7PA 4PIVA 2NADA 4TKLA 5CFZA 3TWOA 2O4UX 3A4VA 1HEUA 2ZJ1A 5F21A 4CLEA 1HETA 3WXBA 2J6IA 3ZV4A 2C2XA 5I9LA 3E48A 3QVTA 1M66A 2IE0A 4PVDA 1T1RA 2QRLA 1R6DA 3C1AA 2ZB4A 5JCJD 4P4LA 2GLXA 2BGKA 3GR6A 2ZJ0A 4CR8A 1HE2A 1SC6A 1SEVA 3OA2A 2DUUA 5DP1A 4GSLA 4E2ZA 4CQMB 1GR0A 1PGNA 3TL3A 1YS4A 5ITWA 3PJDA 4KWHA 3ZU3A 5F1KA 4GLOA 4IDGA 2I3GA 4Y6SA 4WCFC 1ID1A 2W4QA 5CDUA 3AUAA 4WUVA 5KKAA 1GL3A 1E6UA 3FNGA 1YOVB 4J7CA 1EK6A 4CQMA 1F14A 1WDKA 1C1DB 2ZTLA 3AOGA 1PQWA 3GMSA 3AM4A 2D0IA 4XJSA 3H9JA 3ZWWA 5COBA 5ADHA 5A9SB 2X22A 5CG1A 5CEEA 4LCJA 4ND1A 3P2OA 4CM7A 3KEQA 1YOVA 3DZGA 1P77A 3MWEB 4GX2A 1C1DA 3VZRA 3ANMA 4IBOA 4PN3A 5ENDA 1ZIDA 3HZZA 5L7WA 4J1TA 1ZBQA 4HX5A 1E7RA 5A9SA 2VN8A 2CZCA 4YB8A 3C24A 2V6GA 4J0EA 3VTZA 4OGWA 4EBFA 2BD0A 1EE9A 1KOLA 4KZPA 4YVFA 1H6CA 3D3WA 3B1KA 4NHEA 4B4WA 3N58A 3A28A 2HSDA 2Q1SA 4ND5A 2G82A 3Q9NA 3TDKA 2FR0A 2FWMX 4XR9A 2Q4BA 4D3SA 3JQDA 3A06A 4W7HA 4J2HA 1H2BA 1X13A 4HFMA 4BNIA 1FDVA 5FWNA 1HTBA 3DZHA 2ZB7A 1XEAA 1XR3A 4BKRA 3U09A 3PQDA 1M6WA 2GASA 3ZWBA 2O3UA 1IOLA 3GN1A 3W8EA 3ROKA 3ZNQA 4YCAA 5IDQA 1KVSA 2CY0A 4DREA 2FP4A 3PHIA 3D4PA 1W6UA 3AU9A 1IYZA 1GQQA 3PYMA 4PG7A 1PTJA 2O7SA 4R5MA 3RBVA 1O89A 2VHXA 4YXFA 5JCXA 1PJCA 2Y1FA 3RFXA 4BB5A 2V6FA 3LT1A 4ZD6A 2O3JA 2WE8A 2EJVA 4BQRA 3AFNA 1ULUA 4IUYA 1DLIA 3L0DA 2VTEA 4FS3A 2WYUA 3ETDA 3JTMA 4L75A 3CZRA 1LLQA 4TRRA 4DBZA 2NM0A 2GNAA 1Y9AA 4QFCA 1EUCA 2GYYA 1SEPA 2GUGA 2P4QA 3RFVA 3PHJA 3CUKA 4YRBA 1NX6A 1P9LA 1U4OA 3D7LA 4L9RA 2FN7A 4IIVA 2HK7A 4WEOA 3S2IA 3RROA 4E5PA 3S2FA 4MP3A 1MV8A 1QYWA 4E6PA 2NNLD 1EK5A 3GVCA 4FIZA 5BNTA 4QT0A 3OJFA 4GH5A 4M8SA 3E5MA 3RKRA 4NU6A 2PD3A 2EP7A 1EVZA 2VWQA 2Y1DA 4OXNA 4XX0A 2C2YA 1ADBA 2NSDA 3IP1A 3OEYA 5IDXA 3ON5A 4EUHA 3K2EA 2IYPA 4U5QA 4DPMA 1HZJA 1H0KA 3F9IA 2P68A 1A72A 1V9LA 1KY4A 3JD0A 4GLLA 5AVOA 4ALNA 3A1NA 1LDBA 4MVJI 5CDSA 2D4AA 4LISA 3AU8A 1XWFA 4L4XA 2GPTA 1P33A 3UW3A 2OFPA 4RO0A 4YJHB 3GQVA 4MVJD 2X58A 3L6EA 3B1FA 3LF2A 3D4NA 1T2CA 3G1UA 1WZIA 4BGEA 1WAMA 3I1JA 2P2SA 1PL6A 3F4LA 3WGQA 1D4FA 1GYPA 2D2IA 1YB4A 4B3HA 2O23A 2VRBA 2ZATA 3MJ4A 1Y5RA 4YJHA 4IDFA 3GMDA 2NVWA 3HDYA 3KHUA 2O3QA 4WE3A 1NQTA 2D59A 3QWHA 4P4NA 4CMHA 4JP3A 3S1LA 3SBOA 3IKTA 4LVUA 2C5EA 1CIVA 1IHXA 4UREA 3T7EA 5IXSA 1X7DA 4B3JA 4IPTA 3GRKA 4FJ2A 1DEHA 4JXKA 1HLPA 3GG9A 4GWGA 5HS4A 3OJOA 5A06A 1PS9A 4OQYA 4CUZA 4MVJP 1BHSA 4B79A 5L9AA 2PNFA 1YB5A 1LLCA 1PR9A 4HKTA 5DDIP 1P45A 2I9PA 3U4DA 3KYCB 4C4OA 1YH3A 4NU5A 1KEWA 2DTDA 4R1SA 3MOGA 3U9LA 3RKUA 4BO6A 2EGGA 4Z6KA 1QYVA 2EIHA 1Y81A 4FFNA 4GKBA 4EUEA 1U5CA 1A9ZA 2IDZA 5DBGA 1ZFNA 3JYNA 3KYCA 5TS3A 4FFOA 4Z9XA 4A5OA 2PD6A 1ZH8A 3QJ5A 1I8TA 1LJ8A 1ISJA 1VJ1A 3QWBA 5ES3A 5HA5A 3ZNNA 5ITVA 1TT5B 1EBFA 2BFMA 2V7PA 2CFCA 3NKLA 1BVUA 4MVJE 3WBFA 1LDGA 2PH3A 3PDJA 3WFIA 4AJKA 4ND3A 3F46A 5BSEA 3RJ9A 3DL2A 2VHYA 2X9GA 3G17A 2AQIA 1PL8A 2Q1UA 4CPDA 5ER6A 4J16A 1C14A 3I4CA 4NK4A 1UDBA 3W6UA 4E21A 1EBUA 2F1KA 3ITDA 3LLSA 1O94A 3JV7A 1HKUA 1MX3A 4TROA 4ZRMA 3QVOA 2NQ8A 5F5LA 4YJFB 1PQPA 3KM0A 3N7UA 3FD8A 3ZWOA 1JLLA 3DMTC 4I9NA 1E6EA 1BW9B 4Z3DA 1I3LA 3PIDA 2XXJA 3V5NA 3W4IA 1HYHA 2IEBA 1Y9EA 1ZKMA 2F00A 3QVWA 5IFLA 3TFQA 4YJFA 3F4BA 4R68A 3FNFA 1L1FA 4IDAA 1BW9A 3BMCB 4PG8A 5JCJA 2Z1NA 2NWQA 3PGXA 4IZIA 2PKQP 3K92A 3PGJA 1KERA 3SEFA 4NBVA 4BO3A 4YWJA 3H9GA 1O5IA 1PJBA 3AM3A 3PYLA 1CEQA 3BMCA 3AOEA 3IJPA 1F12A 1IB6A 2ZKLA 3GVXA 2GDZA 1T2AA 3PK0A 1T4BA 1G1AA 3TNLA 4AVYA 4R9RA 3PZRA 1QKIA 3DWFA 4ND4A 3KSUA 3RUEA 1N1EA 1V35A 2GCGA 4BNLA 2AEFA 3HJAA 3QLJA 3LT0A 1ZEMA 2H1SA 1HWYA 3MJTA 1EQUA 3CTMA 1P1HA 1D1SA 2JHFA 4INAA 3MOIA 4BOYA 4JN6B 2I3AA 2DT5A 4Z9YA 3OMLA 4UUMA 3UXYA 5B12A 3ROQA 1GQYA 4QX6A 4CM1A 1BGVA 5CPFA 4DWVA 2PA3A 1E7SA 3K2BA 5JC1A 3JQ9C 5JY6A 3Q6IA 2W8ZA 1YE3A 4IQ0A 1EQ2A 3E1KA 1CYDA 2PGJA 1JTVA 4NPCA 4A27A 1KC3A 1OOEA 2J8ZA 4QEDA 1ONOA 5DN9A 4KP7A 2AE2A 3DBHB 5A5EA 2I65A 2ZYGA 4XYBA 2VUTA 2FOIA 2WM3A 1F8GA 4B8ZA 4XB1A 1Z82A 1C0IA 4EITA 3GUCA 3JQ6A 3KB6A 2FPPA 4LW8A 4GWKA 4CLRB 3TN7A 2JFGA 3EHEA 3AK4A 5KOIA 2VNSA 3KSDO 4YRAA 1J6UA 4PLTA 4ALLA 3DBHA 1J5PA 5TRTA 4RVDA 1P74A 4Q3CA 4YAGA 4M54A 5AXCA 1EVJA 3FSRA 3OECA 3HWRA 2X4GA 3QIVA 1L7EA 4G5HA 1Z73A 4YAKA 3PHGA 5U9CA 1IY8A 4CLRA 5KTKA 1E1LA 3PXXA 4H15A 1TXGA 4TVBA 1CJCA 3E5RA 4FSHA 3BTSA 1NAIA 1R15A 2X5OA 2I99A 4E2XA 4DPKA 4XJTA 4AJ2A 2QX7A 2B4RO 1R4MB 4CQMD 1VRWA 2J5KA 4OH1A 3P5SA 3INTA 4FFPA 2W2KB 4RORA 3LYLA 4IXTA 4RPKA 1XIVA 8ADHA 1JKIA 2ZIZA 1KVRA 1R4MA 4WKGA 2EF1A 4S1VA 3RC1A 3W8FA 5GY7A 2E82A 4NBRA 3ZI0A 2HAEA 3R3JA 4UEKA 2W2KA 5JAQA 5FEUA 4XDYA 3WGGA 1YKFA 3IUSA 3JQ8B 3D5TA 1O6ZA 1GDHA 2Q46A 4Z0PA 4XD2A 2J3JA 4D44A 1M6HA 4LSMA 2RCYA 5CPBA 4MVJM 3DZFA 3LVFO 2VNAA 1ISIA 4XKJA 4WLNA 2FPGA 3H2ZA 4A2CA 1BSVA 5TIIA 2J3KA 2DPHA 3ENKA 2HJSA 1JDJA 3LSYA 1DSSG 3JQ8A 4L4RA 3IC5A 4BNGA 4KDFA 3OHSX 1QP8A 5I7SA 3INGA 5C7IO 3EZYA 1DAPA 1G0OA 1HE5A 4XYEA 4BGVA 4GX5A 4B7XA 4CV0A 3LU1A 4MKZA 1QSGA 3WSVA 3ZGYA 3UKOA 3OIDA 3QW2A 2Z95A 2R2GA 2DUWA 1KVTA 1GQ2A 3DTTA 3GRPA 4UVIA 2FR1A 3LC7O 3HADA 2RH8A 2BI8A 5K0ZA 1ZUD1 5U4QA 3UVEA 1C0PA 2C7VA 4HFNA 4YQYA 3IL2A 1VKNA 5I8ZA 3L6OO 2YQ4A 1LEHA 2ZTUA 3GFGA 4IDBA 4MO2A 2IZZA 3I5MA 1UXGA 2AEJA 4U0JA 2Y0DA 3ICPA 1GUFA 3TSCA 3U49A 5GZ3A 5L3ZA 4A03A 3T4XA 1YONA 4TRNA 1UH5A 1ONPA 7ADHA 1GCUA 2EHDA 4PRKA 1N1GA 1AXGA 2O3RA 4KTTE 3AUTA 1DOHA 3KTDA 3VDQA 4PCVA 1UXKA 3D0OA 2BH9A 4PG6A 1CQJA 2QRJA 4JBGA 1IHYA 4RVUA 1PZGA 5DULA 5TT1A 5A03A 4WNCA 2CDAA 4EJ0A 5JDIC 1NWCA 2HKIA 2P9EA 4GX0A 3ZWXA 5KJFA 5KKCA 4PZCA 1B7GO 2HK9A 3DZKA 1CWUA 2VZ9A 4U6QA 4EJ6A 1PJQA 1E7YA 5I9NA 1WP4A 3OF2A 2R6JA 3JYQA 3PRJA 1V8BA 5T8KA 4M1QA 4RQTA 4J3FA 3P7MA 4KTVE 5GMOA 1E7QA 4O5OA 4R1NA 2EEZA 2WWRA 1N8KA 1ZK0A 4IDDA 4PGFA 4MVJG 1GPJA 3GEDA 4RPLA 2FR8A 2W98A 1EFKA 2A92A 1Z75A 4JQCA 4WLFA 1ENZA 3JQAB 4W99A 3TF5A 4J7UA 3ZV6A 2FSVA 4KMSA 2DPGA 4P22A 4XYMA 4N5MA 4YA6A 3ZZNA 3GLQA 3LT4A 1SO8A 4Z3KA 1GV0A 2JAPA 1H2HA 1Q7CA 4EDFA 3JQAA 5KVVA 2YFHA 1P31A 1P0FA 5G4LA 1BWSA 1GYRA 3HB5X 2CUKA 5HTOA 1BDMA 3FN4A 3GPDG 3VPFA 4UVGA 1B15A 5EN4A 1SOVA 5T73A 5JO0A 3HFSA 9LDBA 1P1RA 1YJQA 2O50A 3RASA 3TQHA 4BNFA 4HNGA 3HE3A 4IQ8A 3HDHA 4HNHA 2Q49A 2VCYA 1MFZA 3L6DA 3LLVA 1R4NB 3K5PA 2OP0A 3CH6A 3WR5A 4D79A 4R16A 1DIHA 2E37A 3SJUA 1B3RA 3LC2O 1SOWA 4BNWA 1XGKA 4MP6A 3NDIA 3NDJA 1EZ4A 3GVIA 4AJLA 4J9UE 4WLUA 3B20A 4NG5A 5T57A 4RJTA 4XIYA 3DBRB 3KUXA 1R4NA 3WDSA 4BHTA 8LDHA 1ISHA 5THKA 3RUDA 4ALKA 5HRUA 5EMHA 3FI9A 4E5YA 5L51A 3KYBA 4J1NA 2EKPA 1ZVMA 3EC7A 3Q1LA 3K6JA 3JSAA 2XOXA 3ZV3A 1Y6JA 3DBRA 1LDYA 1I2CA 1QV6A 5C7LO 2OOSA 4KOAA 4G81A 4PLWA 2EWMA 4BGIA 3A14A 3ASUA 4G65A 5AXDA 4RL6A 3K30A 4EYEA 3RCBA 5CDYA 3KYDB 4D43A 1OMOA 1GZ4A 1VI2A 5M6DA 2CSUA 3PFFA 3UHAA 3WGZA 1U1IA 3VH3A 3M2PA 4M49A 4IS2A 4I08A 3WJAA 4CUKA 2W2LA 5KJ1A 1A7AA 4TRJA 4BO5A 3KYDA 3FTNA 3DAFA 3VC7A 3X2EA 3ZHYA 3QVXA 1DC6A 2IXBA 3RC7A 1BG6A 5JE8A 4PLZA 4FQ8A 3WTCA 1C0LA 4AJOA 4L76A 3V8BA 4K6FA 3I9NA 4MKRA 4OKIA 3O8QB 2QG4A 3R6DA 2E49A 5JXWA 3LC1O 3LK7A 1N92A 5T6BA 2DKNA 1U7TA 2JFHA 4UUNA 4OXKA 1AE1A 4RLHA 2H5LA 2IODA 3UCXA 3KETA 4AJHA 1OI7A 3VH4A 1UZLA 4BNXA 2IXAA 5LDHA 5JSFA 3O8QA 2VHWA 4CMEA 2BGMA 2BELA 3ULKA 3O38A 4DXHA 2X0JA 1T26A 2E48A 3N74A 4F45A 1QRRA 4I9UA 2WMDA 2NQTA 1JQBA 1PGQA 2YUTA 4NK5A 3WBBA 4U6SA 1NR7A 4DMLA 3OJLA 5IN5A 2P9CA 4BO9A 4GMFA 4UEOA 3SLGA 2AG5A 2G0TA 4MVJF 3B6ZA 4RLSA 5EL0A 5IJZA 3EZLA 3PWSA 4RF3A 4AJJA 4F46A 1U3TA 1ZJZA 1R12A 3OIGA 2JD2A 1IULA 2WE7A 3OQBA 5LDGA 3VZPA 2QRKA 1Z6ZA 4R41A 2O2SA 2GGSA 1DRVA 4II2A 4EUFA 4DPLA 3IP3A 4NZ9A 5A02A 2X86A 2VYVD 4XGNA 4XRRA 4WJZA 3RUCA 4Q3AA 1H9AA 5KWEA 2VT2A 4R69A 1RJWA 2PGLA 2UYYA 4RDIA 5T5QA 1JW9B 2ZQYA 3WLFA 1ZSVA 3RJ5A 3QWIA 3KRTA 2AMFA 3ONEA 2X5KO 4U7WA 4XDZA 3UN1A 4OIMA 3VPHA 3H6KA 5DF1A 1FXSA 2PFGA 4DIBA 1Y5MA 4Q3NA 3JQFC 3DAPA 1LA2A 1GUYA 3JYPA 5B37A 3ITKA 4KUHA 3BHIA 5TSDA 1QMGA 4BNMA 3SXPA 5JY1A 5JDCA 2HRZA 4OHUA 3D5QA 4BS9A 3NT5A 2IZ1A 4YJDA 1ISGA 4DMMA 2LDBA 1UAYA 4XQGA 3S2EA 2GN6A 2AA3A 4OL9A 2AHRA 1LXCA 1HRDA 3EGOA 4YT2A 4YTEA 3CEAA 5BT9A 1K5HA 4B8WA 2HMVA 4CR6A 1Q0LA 4GGOA 5JAMA 1QR6A 3VKVA 3I6IA 1VC2A 2GRAA
chains in the Genus database with same CATH superfamily
4KGZA 1WJGA 3LBIA 2HA7A 3H9QA 5CG2A 3VYTB 2PUCA 2R00A 3H99A 5DX8A 4A8JB 3PT9A 2R1VA 2VQDA 4D97A 5JANA 2QUKA 3IEUA 4F3YA 1WCXA 4NDAA 1V96A 2OG1A 4HPWA 1FTSA 1N4AA 4C87A 1Z26A 3TECE 3N8GA 2JHCA 1JDTA 2DLNA 3ZGNA 5EP4A 4Y1FA 2AD5A 2FW8A 1H8HD 3MRXA 4B3FX 4RK6A 4NPHA 2O5RA 4XZ3A 1C9EA 1GVHA 2F9MA 5B7GA 1JEQB 1MD9A 5KBYA 2AK2A 2AFHA 3R44A 5EVJA 1VE3A 4D45A 1A50B 2BMEA 3ENNA 3B1YA 3ZU6A 3OF3A 4IHKA 2WA2A 2V5AA 2IK8A 3BB4A 4WINA 2EFDB 2H5IA 4TZ6A 4HNSA 1E62A 4URFA 3A3YA 2IYLD 1LU9A 4HBZA 4MHOA 1W2HA 4XIIA 3E53A 3G6KA 4EM6A 2H00A 3EP8B 4IWYA 5AM1A 3UGQA 2YVUA 3O8LA 3HVJA 3K0AA 4UAJA 2I5PO 2BVNA 4CQJA 4JHLA 3MRVA 4WFKA 2F43A 2C31A 5BUZA 1LC0A 4ZHSA 3RYFB 4G0NA 2J7PD 4ZTUB 1O4WA 1I3OA 4N41A 3MVEA 5LU9A 2QTZA 1ZI9A 5ECGC 3L0PA 1WWKA 5T4FA 2ZWAA 5D2CA 1I1NA 5AI5A 2A5DA 1SXHA 2CV2A 4GX1A 1Z07A 1YZKA 2EKLA 3IRUA 3O7WA 5IVPA 2ZLBA 1KEEB 4MPDA 2XCSB 4IVRA 1UPUA 2OUKA 1GL9B 4KG7A 5HUJA 3WB9A 1ZLXA 1P1JA 5KCZA 3M6LA 1SXIA 3LDAA 4C7VA 1JKJB 4DR3B 5A4FS 5L4LA 3QSGA 2X14A 3ADKA 4KGVA 2AX4A 5FQOA 1ZITA 4L0DA 4K9PA 1W4ZA 4URWR 1N0VC 1BH6A 3BC1A 3GLUA 3GNTA 3MHPA 3QJYA 4CF3A 1W0CA 4KN5A 4KLNA 5KOJA 3FDZB 3BXZA 4K3VA 3KSAC 1JEJA 1LC3A 2JGDB 3UWSA 1EE2A 4W8GA 1Y1PA 1HYEA 3OOYA 4JEHA 2XUGA 3Q0EA 3ZVRA 1O96B 4FEEA 4DLRA 3ABRB 3QRWA 3M4XA 3BFJA 1B6GA 1V39A 1YRWA 2GM4A 1RJFA 3HNPA 3KJZA 4NENA 5K0EA 3Q7QA 3Q6NA 2A5FA 3T4PA 2PMFA 1RAHA 1G8YA 4N6NA 4MOWA 5K9ZA 4RKFA 4ZU6X 2IEAA 3RYHB 2IT1A 2PVSA 3H0CA 4DLXA 1EWTA 2E89A 3LUJA 4P0PB 4RKWA 3RRYA 2GJAA 2X6RA 2KE5A 4DLAA 2XKJE 3RYIA 4I5EA 3V00A 1F2DA 5CBKA 3GGOA 1DBVO 3M81A 1T3SA 4WJLA 2DQSA 1X19A 1XVUA 1K1EA 1O5TA 2WK1A 1UBEA 3O7MA 3WX0A 2DWPA 2JKZA 5K6AA 2YJ3A 3C7KA 4QA9A 1IE3A 4YJ3A 3U1TA 4BMZA 4FDUA 4YFYA 3NTVA 4C7OA 4ZTZB 4GOJA 4CM8B 3DZCA 4AJIA 1YL6A 3K9NA 3FMIA 4HDCA 3ZX5A 1PSDA 4HDSA 3HCBA 3G9ZA 1NE7A 3CURA 5CLHA 4XOUA 1I4OA 2YFKA 1IK4A 5KTSA 3PNVA 3NFRA 2VTVA 5CIWA 2GAIA 5IARA 2B7LA 1HORA 1G6OA 3S2GA 3KVYA 1WL8A 1RQLA 3DT9A 4NNPA 4WK4B 3RFTA 1QPZA 5JYFA 1YQUA 1R0LA 3DZJA 1Y9DA 1VL1A 2FHPA 2OR3A 3ET5A 5EJAA 1UC9A 3F6YA 4MJ3A 3NJRA 4IDPA 4EY6A 3E7WA 3QKUA 1ZPDA 3KZKA 1AA6A 2GARA 1Q3KA 2HFJA 1OBFO 2IX9A 3F2VA 5JD3A 2GHRA 4B4DA 5CB8A 3M6IA 3HNRA 4OGGA 1Q83A 1XTJA 1EWQA 1HT3A 1SXJB 3C4QA 4ZCPA 1DC5A 2IIBA 4PO8A 2O5CA 4KQHA 5TY0A 4OQNA 2B92A 5J2TB 1M2OA 1TU0A 3Q10A 2C04A 3CHYA 2JJYA 4IICA 3GVHA 4QEZA 1XZQA 5EXTA 3M1YA 1R0SA 4IF4A 3X3HA 5ADUS 3FR8A 3KKQA 1P3DA 4D81A 3NGLA 2YUIA 3O8BA 4FP9A 3QXCA 1NFQA 1UOPA 4ZXPA 2FW1A 1EM8A 3IEPA 1XVVA 3IPXA 3JQAD 5AVYA 5K51A 2V1XA 2ZRGA 3FNHA 4DNFA 4MWOA 4MYSA 4O4LF 5CRIA 2QAIA 2YIJA 1P9NA 5TEVA 3V8MA 1ADFA 3UJNA 1RVV1 1TK9A 5BN1A 4S1PA 3DB2A 2P8SA 4ZMBA 1QAOA 5BN4A 4L74A 3GD7A 1M8FA 3CLTC 1AX9A 1FTNA 1T25A 4TXMA 5IKPA 3K0BA 3FTPA 4KW7A 4OL0A 4UUAA 3U4QA 2QLJA 1RAIA 1JLHA 4U9IS 1LPNA 2L17A 3AGPA 2QD2A 2HMTA 4FNOA 3DZ4B 3I2JA 2A0FA 1JIJA 2PIAA 3H1PA 4OJMX 3I9V1 3MMXA 2Z8YM 1LSSA 1R8QA 2GO7A 2P9GA 2ZB8A 3C87A 4NBWA 1QONA 1R8SA 1YHNA 2NU8B 1UODA 3EQ6A 2DQZA 2D13A 1XG5A 2C7BA 1X7HA 4IMPA 1Z7YA 3W8DA 4H0CA 3RH0A 3OX3A 4FYPA 1RI3A 1RT9A 4OHRA 3VHXB 3WNVA 5JARA 3EULA 4LXXA 4TWAA 1OILA 3Q3IA 4J0DA 4XLZA 4US2R 1DJNA 2Q5IA 4YRLA 5CFRA 4LDZA 1GFWA 3P94A 3PJFA 4BV8A 5MHTA 5K6TA 2XKAA 1EP2B 4BNJA 3QE3A 2HCTA 5AJZA 5F1PA 3TR0A 1MP0A 7MHTA 1XB2A 3IAM1 3GO4A 3K1TA 5D86A 2ZRKA 2WFAA 1ARZA 3HZOA 5A4KA 5BSVA 3T9EA 3KB2A 5C52B 1G8JA 3GFPA 3OPXA 2CYCA 3PJEA 4OBBA 4Q6WA 5G53C 4LQ4A 2FUNB 2FDXA 3IALA 2R97A 1EWVA 4JS0A 1OFUA 1WU7A 3BE6A 5FA5A 3TQSA 4A0QA 2NXEA 1E94E 1UC4B 2YW2A 4WZBE 1NBWB 2R6FA 3MMSA 3IT2A 4Q3OA 4TYQA 3ND6A 3E2MA 1AS3A 2PX2A 3NHLA 1KQNA 1EYZA 4M22A 4NDZA 1EB8A 4LN1A 4EG7A 2OO5A 4HQ6A 5HQJA 1B6RA 4OD0A 3IKVA 4I50A 5EY5B 3P52A 4L07A 1ZUIA 1I7BB 1XFDA 3Q3HA 4FBLA 2OM2A 4C76A 4D4IA 3LCUA 4KJXA 4L8WB 2PWZA 4GMGA 3M3HA 1DBWA 3QXHA 4KAFA 5MDHA 1Y7PA 3QVMA 2ODBA 4PC6A 1DQNA 4GEKA 2DFDA 1EDOA 2JRLA 4TN1A 1OFHA 4IH4A 2PZLA 3C5WP 3MT9A 4M0FA 2PIDA 4R1TA 2WWWA 2OCAA 1Y8RA 3O4RA 1S96A 3PWKA 4ZOLA 2M32A 2X77A 1NF9A 4MITA 3HXOA 1XZ8A 4DQVA 2PSFA 1QGUA 3DBLA 3TUIC 1DHTA 4Q4JA 3UXHA 1K7FB 1JQAA 5CJ2A 3ZXSA 1BFDA 4ZRDA 1J2EA 3O1HB 1GDDA 3DTVB 2Q45A 4JBIA 4D9KA 1G5FA 4Z54A 2Q1TA 1P19A 3PUIA 3TZHA 3AJ8A 1ZXLA 2ZBRA 2YZKA 1E4YA 1FB5A 3Q87B 5KHAA 4HNTA 1IBSA 2O2CA 4I8IA 4GG1A 3OOHA 4DCCA 3TMYA 1UQTA 1BEUB 2AC4A 1JA9A 1L8OA 2JBWA 3H3JA 3GBPA 4G1FA 3UF0A 2YW9A 3ZVNA 3VTFA 3MS7A 3V4RA 3IWDB 2R6DA 2VYNA 2UVQA 1H1LB 4BFXA 4ZZ1A 5G0VA 4WN3A 4HDRB 1NPYA 4MLZA 3PQFA 4H1TA 5AI4A 4X90A 5M34A 2ABWA 4DJJA 2X6QA 1QZXA 3H5NA 1II9A 1QF6A 5TQ2B 2Y1GA 2R3SA 3RQSA 1S8OA 1ZJJA 1IOZA 4P9NA 1PD1A 4NESA 1NVUQ 1S3FA 2B30A 4LYEA 4N48A 4KNWA 3LVRE 1NFFA 3P9XA 4KX3A 4PSCA 5ESWA 3B53X 5DOZA 4QYTA 4RXMA 3DBVO 1BOFA 2IBSA 1M2KA 2TMDA 4Z4CA 2YWHA 3GZTB 4WCFB 1KKLA 2Z6QA 5JS1A 4DRYA 3IERA 1NASA 2H48A 1TCCA 1M8KA 2GQ0A 2ODNA 2X5JO 4HADA 2WABA 2O48X 1QX4A 1T10A 2O8DB 3DFUA 4QAQA 4MRSA 1V3TA 1RWVA 4KWIA 2NUPB 2VF4X 2Z9BA 2C2WA 2NNWB 2PQ0A 2RHOA 3H5TA 4QUEA 5FH9A 3K1AA 3FOCA 3V4PB 5C2JB 3ONFA 1Q17A 1I6WA 4Y2QA 4GI1A 4Q4DA 1CY8A 1CF4A 2I62A 3MFQA 1QTRA 3IODA 5M3BA 2P91A 3DGFC 3OTIA 1UT5A 3PEVA 2ZRMA 4AMBA 5DGTA 1BU8A 4R2MA 4URUR 5TNXA 4CMIB 4EEZA 4O4IB 3ZD9A 2D62A 1NF8A 1YWGO 3W1VA 3X2SA 2QORA 3IJEB 2WIJA 3PXUA 4LZAA 3TE6A 2W42A 2GVDC 2ZBDA 3Q72A 1COWD 3G2IA 3BHJA 3UH0A 3DMYA 3OO0A 2JAQA 1KQFA 3HMKA 4J6FA 2YCLA 3BM5A 2AOTA 4I5FA 3U9SA 1M76A 1H22A 2EKZA 1XEXB 3L06A 4US0R 4BFVA 3K32A 3A11A 1Z28A 4FUQA 5JD5A 3ZHXA 3C4JA 5HQ3B 1AKNA 2FXIA 3I92A 5ESDA 2WU8A 1F2VA 2DRIA 1CT9A 2PWAA 2YHUA 2YVLA 3ETCA 3FSGA 4QECA 5CAEB 2X0DA 4QJ3A 3VC2A 2JH8A 3LGSA 2YOGA 2OORA 5EXPA 3CIFA 2GCOA 1AKQA 5FQNA 1FSPA 1TAQA 3DBOB 2PMBA 2G5GX 4L3OA 5K0CA 4QYIA 3O82A 2WC1A 4GP9A 3BIFA 3LGAA 1DCMA 3AJ9A 4NBTA 5EXXA 4QM7A 4WLOA 1TUBB 2DKOA 3A6LA 3LL4A 3ANTA 2IBTA 3PFKA 3PHLA 1TEHA 3ZN2A 4BKQA 2OTCA 1BDIA 3CPSA 3NHBA 2PWPA 2J5RA 2J46A 1W0KA 5KDOA 1C9NA 1I4TD 4JEIA 1J90A 3F3SA 2R68A 1C7JA 2ZSJA 4P80A 4BQIA 1AKYA 1H42A 1PBTA 1S8NA 1TZJA 3DWIA 4FINA 4JX8A 4E13A 3OZXA 1F38A 5WRFA 2CLEB 2Q4EA 3LKDA 3PE3A 3LZDA 1V47A 2WIAA 2PT6A 3PC8C 1UMDB 1U3VA 1BXRA 4IEEA 4YI5A 2PD4A 2NO0A 4DSAA 4PLGA 2I66A 1II8A 3C48A 4PO3X 5JVDB 1Y8QA 3SF0A 2AN1A 3F5SA 1ISMA 2B21A 2C3UA 1NNUA 3IAUA 4U5XA 5H4HA 4D4HA 4EHDA 2O8BB 2HV8A 2HDOA 1OBHA 1BQ4A 4D9NA 4RBNA 3V2GA 2Y1EA 1MF7A 1UC5B 1EZZA 2CNDA 2GKSA 1RM0A 4WLVA 4ZCSA 5IYZF 1DC8A 1P81A 2E55A 1A97A 2PJDA 4WKBA 5HF6A 1G21E 2H1IA 3AOEC 4YYZA 1Y48E 2IS4A 2CL7X 2X40A 4HFRA 1KI8A 3LOQA 2IA5A 2PR2A 2QRMA 4IVPA 2DECA 3JALB 4YUVA 4A0RA 4BQOA 8AT1A 2H17A 4PLVA 2JJMA 1MQSA 1Z0SA 4LOJA 4MDYA 4JQYA 1ULZA 3MJFA 2A8YA 2AFHE 1UOEA 2JJ2A 2CLDX 4WVLA 1JIQA 2WJIA 3IP7A 2GCNA 1RM4A 5JTTA 4QPDA 1M34A 2H7YA 4FZVA 1TT7A 4OLFA 1Q2XA 5BW6B 5C5EA 4FD2A 4RM2A 1G3QA 2C7GA 4XRGA 2CYAA 2RGGA 3C3PA 4RGBA 3ER8A 2XOKA 2IY9A 1EJ2A 2YMLA 4UZFA 1NVKA 5AVRA 1I7MB 3LX6A 4HY3A 4QTXA 4TTPA 2G5CA 3GMIA 4UW9A 2CXRA 2PSSA 5AK0A 3K96A 5JTUA 3VNVA 3QPCA 2ZFUA 2ZTVA 4CZ2A 1QK3A 1OY1A 2IIQA 2RHCA 2R96A 3DKIA 3OJEA 5G4KB 4C6TA 4ZI2A 4DQXA 4RK7A 4AL4A 4E1AA 1X8LA 4DV7B 3HA7A 4JBXA 5G0WA 3SBDA 4ARSA 2BGIA 5E6UB 4J03A 1KQGA 4EG1A 1KDTA 3DM5A 4I2VA 4NZYA 1U9CA 5FYDA 4JI1B 4CVNA 1KY5A 3O1JC 4F96A 1ECFA 1NM5A 3REGA 2W6OA 2DLDA 3C6QA 4M2LA 5ESXA 3LKZA 4NP6A 3B6KA 3E7XA 3ESZA 4RIHA 3RRZA 1JSXA 1Z4JA 5IDYA 2J9GA 2G67A 1VJRA 2QTTA 4H7DA 3UJDA 1H9BA 1Y3DE 3HJNA 4RQAA 5ER9A 5JWOA 4YUXA 2Z04A 4CM9A 4M87A 3EW9A 4CT0A 1EFVA 1LDMA 2K5UA 3FHJA 2WJPA 4G0XA 4L9WA 5P8WA 1N7IA 2XOEA 3CO0S 4KIWA 4TYMA 2V7GA 3UICA 5CD9A 5I7HA 2Z2XA 3K9QO 2GFQA 4RSMA 1SUCA 1NQUA 4G8DA 4IR7A 1W87A 5AUPB 3HKCB 2N1BA 2IYOA 3LBAA 2RHJA 4RADA 3NJ4A 4MVXA 4TV9F 5J63A 5CFLA 3OU2A 3BF7A 1ZJ4A 2O7NA 1BCSA 4HNAA 3G1TA 2DERA 3QV1A 2FW7A 3D4BA 4D56A 3UQYS 1SZPA 3VO2A 1OZFA 3LUKA 4H1HA 1SVMA 1WNTA 1RXSA 1ISSA 3PKZA 1WKCA 5FOVA 3TINA 4IUDS 1RKQA 3R9XA 2AD1A 3AHGA 1MIOA 3JWEA 3EVNA 4K9SA 4KWCA 3GLSA 5HEKA 3VZBA 1Q57A 1QHEA 4EATA 5I3CA 2QE7A 4L4UA 2HYIC 3W8RA 4LC1A 3RWBA 4UBLA 1T5LA 1EUDB 4TXLA 5DK6A 3FBGA 3R5HA 1M1XB 1XCPA 2RBEA 1XZCA 1NW8A 2EJTA 3RC9A 5ARCA 4ZO7A 2YMQA 1OTYA 5AM3A 2Q9AA 1CF2O 1N6NA 3Q7EA 1HF3A 1D2RA 1G3UA 1T2DA 3KQQA 3GUVA 4A2WA 2HLPA 4BZZA 2EAUA 2FN8A 7ABPA 4GM1A 1P2UA 1YACA 1N75A 1DKLA 2N9UA 1L5VA 3A1TA 3B1ZA 4YAWA 3I2KA 4GXQA 1ZNQO 3D4LA 1E1MA 3ORRA 3JARB 3BSSA 1WOYA 4ABYA 1N0UA 1D8AA 3K0FB 3OZFA 1N0WA 2ZTSA 1ZD8A 4X8HA 1CIPA 3O4FA 1TA0A 4RTPA 3EVAA 3HCDA 4HRYA 3R6LA 3A6JA 3ZV7A 1RI1A 5C8YB 3A0UA 1ZK4A 2PMEA 5GPBA 3WWYA 4OQPA 4M46A 3T3OA 2VAMA 2LR0A 1CY1A 1H2FA 3ZQJA 4DQLA 3CVVA 3KKPA 1UEJA 2W4IA 5L3QB 4HEA6 3VR5D 4D3DA 1JEAA 4P35A 1FFEA 1VA4A 4NATA 1T3HA 5LA6B 3SIWA 1R4ZA 1QTQA 1QGYA 1Z83A 2B0JA 3A05A 2WJZB 1KRWA 4GECA 2D1RA 3BL5A 2G1JA 3K73O 3EXHC 3OSUA 5BNWA 4ROTA 2WZCA 1Y1SA 2BHSA 3TDMA 3IUYA 3ZVLA 3CZ4A 5DNAA 2BP7B 4ZT2A 4EB3A 2R7AA 1FX0A 1QK4A 1ODCA 1A76A 2UV8A 3QU2A 4FWBA 1FCJA 1X1TA 3D3NA 4O1MA 2I6UA 3VQTA 1H9CA 1I6LA 4QHTA 3E3MA 3N2KB 1FQOA 4C7BA 2LKCA 3F3MA 5JAZA 3K5HA 2Z2IA 2I7XA 1B4DA 1ZR2A 1S2IA 4LDQA 3HUUA 3NEJA 2VZ0A 2FWIA 5L3SB 2A2ZA 3GBVA 2H08A 1P29A 5JALA 4LECA 4KDRA 5EJ5A 3AKYA 9MHTA 5AD1A 4YPVA 1K63A 1KMIY 2XD9A 3S99A 3UJ9A 2NZ2A 1G5RA 2Y68A 3EC2A 4F8EA 1V26A 3O03A 1EDZA 3RVQA 3S28A 1V1MA 4MI3A 4YROA 1T6YA 1X94A 3RYCB 3LIPA 1J49A 1WVMA 2A5JA 2A0XA 1RWQA 2P4HX 3K8QA 4L5JA 2IIPA 1FBTA 5FA8A 2DBRA 1IPFA 3NR2A 4EYGA 2IP1A 1ZU4A 3U3JA 3WQQA 2AI2A 2PYDA 5DM60 5JXGA 2NP6A 1CVLA 4KNVA 3PLNA 2MYPA 4R6WA 4QGFA 4UNNA 4BFTA 4G0WA 2P2GA 1KZHA 2PVCA 2EWWA 4CF7A 1EK2A 3F6BX 5EGSA 1AS0A 3OURA 1KTIA 2POQX 4GMXA 5KMGA 5M2QA 5KU7A 1JR3A 3JQ9A 2EJCA 3EK2A 5KNDD 2C4VA 1JDSA 1A1SA 1YTLA 2PMDA 4RMHA 4YT4A 4PBSA 1CERA 1GT6A 3LHKA 4I55F 5I7VA 1T4GA 1MC4A 2HJWA 1A2KC 2VKQA 2BL4A 3HCFA 3QUSA 2BBWA 4HDOB 4B87A 2QGZA 1LSUA 2X76A 5GAJA 3QKTA 5FNVB 4DJEC 2XF8A 3FCOA 4BX3A 1VMEA 1USIA 1YDMA 2IHBA 5E8RA 3IE1A 3FOEC 1M8JA 3GLIA 1G3IA 4TZ0A 4DSUA 2PRIA 2YV5A 4BFYA 4L8LA 1BRMA 6REQA 3WIBA 3GZJA 3JATA 1WXDA 3MWLA 5EYPB 4TX1A 3D3EA 5CDFA 5FWYA 4O63O 4C1NA 3I32A 1CR1A 3H1EA 3L7NA 3UFBA 5ICSA 2GD0A 2I55A 2WTMA 1QRUA 3H5WA 3SMQA 1V45E 2BTOA 2PU5A 2RHRA 4JBLA 3VHQA 4P0QB 3UAWA 2LWIA 1VSUA 1JIUA 1K4KA 2FSVC 1M72A 3DE1X 1VKOA 1N2GA 5H68A 4KBFA 1E7WA 4R1MA 2ZUFA 2C9DA 2C8JA 3DGEC 3PNLA 4JITA 2ACWA 1VLQA 4QTZA 5DM2A 3AY0A 3V9PA 3TGWA 2Y92A 4B73A 3EF1A 2GN4A 4MKIA 4MQFB 1YZTA 3QYJA 4OYLA 5JI3E 1HXHA 2FAXA 2O8FA 5I9IA 4PFJA 2C4WA 3GRFA 2B2XA 5ALXA 5E1OA 2FUG1 2J32A 2OUIA 2QXTA 4UHFA 5FI0B 4JJZA 5BPHA 3E7DA 5D1NA 1B73A 1LSOA 3IIJA 4ZHQA 2J3QA 2VK2A 2XT0A 5T41A 2HI0A 1QYDA 1K6EA 1ZGJA 4PYMA 4DBLE 5KOHB 4O4JB 2MSNA 1XMOB 2VDMB 3ZBQA 4AKTA 1N7JA 4V03A 3KQMA 3RSZA 4CDNA 1YC2A 1JDNA 1R10A 4J9VA 1P4GA 3F74A 1DKNA 3D0KA 3MTJA 3AJEA 2JKVA 3DSRA 4IDCA 5EWMB 4XYLA 2ZIEA 4YLEA 3W4KA 1NGSA 3U1BA 2G9ZA 3HYNA 3OOJA 3FYTA 2B5WA 4M36A 5SY9A 2LCQA 3DONA 2BJVA 4Q39A 2O6LA 2XNHA 1Q7BA 4YP1A 1K2WA 4KO3S 5F1YA 4PG4A 1N2JA 1OXSC 2YY6A 4NYIR 1ZMRA 2FEMA 3VJLA 3H8WA 4E22A 1A7JA 2XNKA 4FYWA 2NU9A 3D8BA 3SI7A 1CZOA 4UBNA 4BMSA 3JAMA 5K8LA 2Q6KA 3QBEA 3T7KA 1ISFA 4I4LA 3LCJA 1I0ZA 1YQDA 2UXDB 4MVJH 1QH9A 1N2CA 1DLJA 1U04A 4RVSA 3BMQA 4JL5A 4R31A 3R4VA 1G8AA 4QG3A 3HO1A 4GR5A 3H17A 1YZNA 2OECA 4YJ2F 4CF6A 1N3IA 3FKJA 3C3AA 1PIWA 1QZ3A 1DUVG 3RS3A 1X8XA 5KAPA 3RS0A 2HGSA 1KTVA 4JYCA 5JQWA 3DQZA 2BTQB 1DOZA 3Q0IA 4MR7A 3SPXA 1NHWA 2ZS7A 3T7DA 3WYDA 5KYYB 5F12A 2HU7A 1KK3A 4RCVA 1R0RE 3FCYA 4IJUA 2ADOA 5KVSA 1E3QA 4XASA 1XZKA 2O7QA 3EAQA 4KV9A 1D1QA 2H5EA 4P4UA 2BPOA 3OQHA 3MNFA 3EDOA 2WPNA 1UM9A 4JOCA 5EJEA 4ZXFA 1GY8A 2PXAA 4G9GA 4EGSA 5ALWA 5TQ0A 5G3YA 3M49A 2O2IA 4LPSA 3WRXA 2WKRA 2D0PB 4BY9E 5J5CA 3QTLA 2MSDB 4PSUA 2JGAA 4UMFA 4X85A 3TXXA 3ZGOA 1YJBA 2AF4C 4L6AA 4HTFA 4EHAA 3KV1A 2QENA 1FDIA 2NUAA 2ZI9A 3HPRA 1E1NA 4U8HA 1KZ4A 5ELMA 1WKVA 4UE2A 3VM6A 4MKFA 4R9VA 3OOWA 4NYIQ 1L6IA 1DI0A 1MNQA 4NCKA 4QHYA 4E5KA 4QJ4A 2BV3A 4TKVB 4JJFA 3ROGA 2EQBA 4BBJA 3HZHA 1Q1AA 2UAGA 4JKYA 5K3CA 4BPBA 3UK6A 1WMSA 3GEGA 3UMFA 1N2EA 5AXAA 2SECE 3IPLA 5LBUA 3THWA 4TMZA 1BWQA 3G0GA 5KNBH 3ZHOA 1WULS 1YUNA 3WGIA 5I8WA 4BJ1A 2QROA 2XYQA 3GD5A 1C3XA 3DV9A 1GZSA 3ZHBA 1XJQA 5LCXA 1AG9A 4N7BA 3SE0A 1NJ2A 4COOA 5JOQA 4S3MA 5LWQA 2BHLA 1AUXA 4GMDA 4KXMA 2OPHA 5MFZA 4CEJA 4L16A 3M4ZA 4WBXC 3T95A 3WGTA 2VK4A 5JNWA 4HLUA 4HWRA 4JP5A 2R44A 3MD0A 2XHEA 4KI7A 3UYLA 2VPIA 2ORIA 3DS8A 1LRJA 3AGQA 2EX4A 4JUAA 2NVOA 1RPZA 4LQLA 1DBSA 2QR3A 1IY0A 1EMDA 1ZJ6A 1CULC 1U1EA 1H94A 2SNIE 3PVZA 4M55A 5KTPA 3A2LA 3D6NB 4W1PA 3SQDA 2XAUA 4DMRA 1KEUA 1NVXQ 4YBZA 3VKWA 4DDHA 3COSA 5AVUA 3T3PB 3KBBA 1Y7TA 4DDVA 1KO4A 1K6XA 1K7EB 2GJSA 3L6RA 3SDBA 2P6NA 3ZQ6A 3P0HA 3DP9A 4Y3UA 3R0VA 2HSEA 3WL8A 3L7BA 1T1IA 1JIIA 1XRMA 1XVTA 1ZRSA 2VQSA 4GXTA 5AHKA 3WLAA 4BEWA 3BJMA 1E5QA 2C0QA 4X00A 4RMGA 2PZJA 2JFQA 5CXUA 2PLFA 1JXOA 5FAXA 4KXVA 4EY8A 1DADA 3GUUA 4IOKA 3CIOA 3L77A 4RVFA 5K3BA 4Y0AA 2WUEA 2EVWX 1TVCA 1G20B 1PGOA 3EFOA 5AKXA 1KY3A 4LWPA 1TCVA 1EGMB 3TIFA 3MYYA 3TZBA 5A0VA 1U3WA 5DTMA 3QWAA 3VH2A 1LUAA 3ORQA 4Y2RA 2J3IA 4DKXA 1KU0A 1I30A 2DFNA 5B1DA 4IZOA 1N7GA 3WKEA 1CF9A 3DHWC 3L04A 1E6LA 3AHFA 4MR8A 4V39A 3WYEA 3PEYA 1WA5A 1L5MA 5JYEA 2ZJZA 4OP2A 4MCJA 4WECA 3TRIA 1I3MA 4D8TA 3AM5A 5IDWA 3O2NA 5IHXA 4CL8A 2EC5A 2GCPA 2Q5CA 1IN6A 2XA1A 4OB6A 2HF9A 1ENYA 1LNQA 5ECYA 2Q5OA 4PHGA 3BJZA 1VLHA 4XX1A 5SICE 5LP1A 4QXAA 4XWYA 1IEWA 3IV6A 4KO2S 3FPLA 3DMNA 3QFFA 4IIDA 5E9WA 5HCUA 3LECA 1T2UA 4E7OA 3T1HB 1M7GA 2C7RA 3TLXA 3K2QA 4DR1B 5HMMA 2B4QA 1NAHA 3P2YA 1A98A 1KI6A 5JBNA 4U9HS 2GJ4A 1PT9A 3I6QA 3W1WA 4A8JC 2HT6A 3D7RA 1GPNA 2G77B 1IB0A 2ZCVA 4PNZA 4QPCA 3E2PA 2HDHA 3TOZA 4MSUA 3JQBC 1T29A 3RUIA 1TYBE 3BRQA 3WFJA 2B5OA 1YIOA 2CW5A 4JGBA 5HRAA 2XYGA 1C9DB 3R9KA 1F4VA 3RK0A 3SE7A 4ZI3A 1DPGA 3CVXA 1GEGA 1ORVA 4TLBA 2QQ0A 1DL5A 1BMFD 1IHPA 1W1UA 2ST1A 1SKUA 2OP1A 4PPNA 3NX4A 1KA9H 5EMNA 2WM9B 1JNYA 4HDAA 1HURA 3WQHA 3HSSA 2YHAA 5LDDC 2AW5A 2YQ5A 4J0HA 2FYTA 3H9UA 1V1RB 2ZYAA 2OBXA 1K3TA 4IIFA 3EUWA 4KXQA 3I2IA 4PONA 3IBFA 4BYMA 3FYSA 1VZ2A 1NI3A 5ENVA 2O9JA 3SYTA 3EPHA 2GN2A 1PJAA 1VZ3A 3OU7A 2C98A 4PZEA 3KELA 1QVWA 3K20A 3ZPXA 2REQA 4H6VA 4U00A 1FZQA 1DV1A 3OUUA 2VDOB 4HH0A 1E5LA 1RXCA 5C3UA 2G7MC 2DUMA 3IBGA 4FXPA 2I7DA 4RHYA 5EVCA 1X7WA 3T3IA 3VR3A 4MWBA 1W93A 4YIKA 4CLOA 2Q29A 1X92A 4D46A 2VT3A 3NT4A 1FVOA 5FIUA 4PGHA 4ZKDA 3WI7A 1U7UA 1DAOA 3FVTA 4LJAA 4NCIA 3B13B 3NRJA 3CH5A 1U8FO 3I6YA 4NL4H 1RFLA 1VCNA 4ETIA 1A88A 1OJLA 2FSSA 2IYWA 1XP5A 5GWXA 1QHGA 1PJRA 4Y6OA 5KTNA 4EI8A 1PF7E 4DL9A 3U6KA 5C34B 4QU5A 1CQIB 4P7JA 3Q4GA 3EEQA 2DZDA 5TVGA 4D4LA 1H5QA 1FVHA 2WRZA 3W06A 4XYGA 2X1MA 3U0VA 5IULC 4JI6B 4NYMR 2ACKA 1YVRA 3KHTA 1XCBA 4X61A 3FTCA 4B44A 1XMIA 4NBSA 1CZNA 3RIHA 1PHPA 3V2HA 4X95A 3VNSA 5L3RA 3EXIA 3U4IA 4JUBA 1PR3A 2BE9A 2VH2A 4D96A 4OX9B 1P6XA 2VJAA 3OMWA 1VDZA 4PLYA 3TZLA 3X1JA 2JIPA 4KXLA 1G2QA 4P3YA 1CQZA 1J2TA 1DPFA 3DUWA 4H08A 4X45A 2WTEA 4BBAA 5LMNB 1H1DA 2QW1A 4KUGA 1WUKS 1AUVA 3MMPA 3A4MA 3AZOA 7MDHA 1KDPA 1H6AA 2WDPA 4F1JA 2QJOA 4I4IA 1L5GB 3LP8A 1I2DA 5KYXA 1BVRA 1E2LA 4DVJA 1BMQA 4YMWA 2PQMA 3R0JA 4MVJA 3LC0A 1U0HC 4HVAA 2QIPA 5CTJA 3HBNA 3SLRA 5AKGA 2P2LA 2WHPB 3JQ7A 4WZZA 2GVNA 2QIOA 5EXDA 5FPSA 5B1SA 3T5AA 1EG7A 3GJ5A 4M0PA 1QHIA 1R3UA 3PLRA 1FSZA 2YJ5A 3QFTA 4A23A 4D9HA 2QQEA 1GFSA 1F4PA 3LQ4A 4OQEA 4RY2A 2EATA 5C31A 2FU5C 1U2DA 5IEBA 3V42A 1RZ3A 3IJ5A 4YV2A 4JYMA 5JS8A 1KP2A 2C83A 2KI5A 3L7AA 3HR8A 3KXDA 1Z6TA 1C3VA 2BEJA 3IJRA 3O1IC 2K87A 1GQFA 4YCLA 3QMMA 3R0ZA 2E6KA 3DL0A 3EEOA 4Q3BA 2AFIB 3C43A 4ZPJA 3WLNA 3OUZA 2OGUA 1T24A 4I2NA 1QHFA 1UZMA 1C7ZA 2G7ZA 4AD8A 4O2BA 1JFTA 2XDQB 5KO2A 2QTWB 3JQFA 2GM3A 2WQZA 3V1YA 3PT5A 4EG6A 4F6CA 3SZUA 3FHLA 2QRVA 1V2GA 2WHQA 3GELA 1QHHB 1T6NA 3G7NA 2V6JA 1KE1A 3FCEA 4D41A 3OZSA 3PEWA 1ENPA 4MEBA 4UJ3A 4PG5A 4LK3A 4LYFA 1BXZA 1CE8B 1HM5A 1TUIA 1WXWA 3DF7A 1XXHA 3INNA 3P4UA 4O2AA 2IKQA 4TTVA 3RJZA 4F5EA 1FPQA 2C00A 2KMLA 4BO0A 4DLPA 1E99A 1XL0A 5J2TF 2QN8A 1F2UA 3SHOA 3NEPX 1SXJC 1X7XB 3UWPA 3T15A 1D4ZA 4ND2A 3OCVA 4M0KA 4QULA 4BO1A 1RQGA 2Q8NA 1FDWA 1H8ED 2YY7A 3KOWA 4L95C 2YMMA 5ILQA 1ZAYA 5D5QA 2QUIA 3VAAA 3ZW9A 3ZX4A 1GRNA 2WYIA 4GPTA 3L7YA 1ST3A 1A8QA 3HUEA 3AESA 5KNBA 3RSQA 3PQVA 2KBFA 4KKVA 5CDTA 3I0ZA 1T2VA 4M89A 3HDGA 1C0EA 3NWEA 1DCTA 3HK2A 1J2UA 3H84A 3OQIB 1FOEB 2XB9A 3E82A 1JR3E 6CHYA 4OU5A 2ISSD 2VP2A 4CGYA 2XGOA 1E9SA 2OZPA 3KXIA 4X64B 1TW2A 2WDZA 3EA0A 1ZA1A 4ILEA 3K0SA 2VBIA 2FRXA 3I04A 3O3MB 4BTVA 1Y1RA 4RA9B 4AMUA 2P4UA 3U2QA 3CLUD 3QF4A 1D9XA 1UXIA 5AVKA 4BV9A 4YDQA 1J5XA 1D6MA 2XMCA 3FUVA 3N53A 5JMOA 5LZ7A 4GL2A 3R3SA 5P21A 3ZWCA 1FJHA 1W4AA 1YL5A 1EVYA 1R6UA 2Q1WA 3CX3A 2X19A 3RVNA 5BMVA 5CDFE 2AMYA 2CEKA 1PSZA 2PEZA 3UA4A 1L6RA 5I7EA 5EQDA 2HCJB 2XSZD 2J0EA 1LX6A 1NBMA 2C20A 3TKYA 1BE6A 1D9ZA 4B5LA 2C78A 3QE0A 3GZ4A 5D3ZA 5FRDA 3VKUA 2CKDA 1CU1A 2O2DA 3DF9A 1NI4B 2JGKA 3T7CA 5KNCH 1M7BA 4FDAA 3U39A 1OZ0A 4QFBA 1RVDA 3WGNA 5BWMA 3NS7A 1KWGA 4X93A 3R3ZA 3QE9Y 1MW8X 4C0JA 4JI7B 2R8ZA 1L7DA 2I2FA 3BQMB 4E5DA 2PBLA 3MSXA 3EG9A 1QLJA 1XMVA 3C7CB 3ND9A 1ULAA 1RYDA 4HDKA 3QUAA 4TS1A 3V1MA 1U0LA 2UUPA 1W1IA 4WT7A 2R60A 2GBGA 2WTAA 2ZIXB 2IEYA 2WF9A 3GCXA 1Z45A 1YNSA 2XQVA 4R8SA 3EFBA 1EDBA 3MUFA 3N0WA 3OE1A 2QUJA 1PD0A 1D5WA 4OGFA 3GLGE 2XV1A 2NZWA 3EGIA 1E8MA 1AKWA 2JD0A 1KAQA 4M53A 2V7EA 3GJZA 4MYDA 3ANSA 1GDTA 2BRUC 1H2EA 3U5TA 3TZQA 2XYRA 9ABPA 4NDNE 4KH1A 3AY7A 2OBLA 1DCFA 3AO0B 3PE6A 4V38A 1MB9A 4PQGA 2PS1A 4M8IA 3OEEA 4NJMB 2HRRA 4CWAA 2O8EB 1DJMA 3TQRA 4LMAA 4NE7A 2IPNA 1V8OA 2YOFA 2A3RA 4UEWA 2J0UA 2YZ2A 4BX8A 5CFOA 4JELA 1NJSA 1SM4A 1PWEA 2H2AA 4TWRA 4UU7A 3ICOA 3VI3B 1YS2X 1ZUHA 3DFFA 1YMQA 1HDOA 2GEKA 2XEXA 4F86A 1XELA 3H1GA 5KC9A 4HDQB 1FF9A 3JZDA 3WJ2A 4ZVPA 1S2DA 1N2CE 2P4SA 4W5WA 3UCFA 2GF2A 2M6SA 4LYGA 4MS3B 5CM2Z 1TL7C 2PXCA 4ESEA 1T35A 5BXQC 3MM4A 5HS6A 4V02A 5GIOE 3C7TA 3MJVA 5KI6A 4W5OA 1ZH6A 2XODA 3C8ZA 1SWVA 4DQUA 3WGYA 4QOGA 3BTUA 1FQKA 2XA2A 1K97A 4I1YA 4L0QA 2YWGA 3NHKA 3CVWA 3SQWA 3BZUA 3GLFA 1EWKA 4QRHA 4LHSA 3DFIA 3K5WA 1OFGA 4KN8A 4A0SA 5TGZA 1JG2A 1RI4A 4PIVA 3CNQS 2NADA 1R27A 2UYGA 2CWDA 4TKLA 3THOA 5CFZA 4HAZA 4EG5A 4CKZA 1LV8A 1F3OA 1GGHA 5DM0A 1WBBA 3A1EA 5IUKC 2J6IA 2PUHA 1G8KA 1Y8AA 3ENWA 3M6MD 4X1KA 4DUGA 3GLFB 4XEUA 4ZTBA 2V9CA 3SHVA 4H35A 4KYUA 4FMCB 2ZRIA 3NALA 2PR7A 4P4LA 3QMWA 1J7JA 2BGKA 1H4VB 4XPZA 2ZJ0A 3ZQKA 3UMYA 3NC1C 1KZ7B 1ODJA 1K3FA 3ES9A 1SEVA 3Q8KA 2YY5A 2DUUA 2XF2A 1TADA 2I80A 1U9ZA 1J09A 4E2ZA 4CQMB 5E2IA 5ITWA 4M6WA 4CYMA 5EWJB 1KYXA 4PGAA 4PNEA 3ZD6A 5DM1A 4BMYA 5KX5B 4IDGA 2I71A 4MB2A 1Q20A 3WLSA 3E9EA 2QX9A 4WCFC 2W4QA 4CIAA 4G24A 3DLIA 3NANA 4GE3A 5KSWB 5EE9A 2L18A 4WUVA 4IXDA 1DDIA 1EK6A 3M4YA 4BDSA 2H18A 2ZIUB 3HGQA 1C1DB 2FPSA 5BYBA 4JQOA 4ARZA 2GD2A 2R1ZA 5H5JA 1RYYA 1DBIA 3CYFA 3LSTA 4TMTA 1PR5A 1U11A 1TO6A 1UDRA 2TMYA 3AYZB 1ITZA 3H9JA 4RVCA 5EMLA 3UOWA 4B48A 5A9SB 3RVKA 2GA8A 1IN4A 1UXOA 2IW3A 4CM7A 3OCUA 4M9SA 1NX9A 2BFFB 2QY6A 1JQ3A 1YOVA 1KZGB 2BFCB 1MB2A 1JHOA 1U6IA 3KG2A 4GX2A 4ED9A 4ML3A 4ASUD 3ANMA 2IY7A 3CCBA 2PCLA 4IF6A 2R25B 4AJOA 1JHUA 5L7WA 3S5UA 1O6BA 4B71A 3O93A 3K4HA 1E7RA 4LBZA 5GP1A 4H31A 4B6SA 3VTZA 4J0EA 1LPPA 3MWEA 1F9EA 3EA5A 3TOSA 4TWIA 4PS1A 4OA5A 4MUKA 2HZ7A 4C0AC 1XZBA 1RACA