3BTUA

Crystal structure of the super-repressor mutant of gal80p from saccharomyces cerevisiae; gal80(s2) [e351k]
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
420
structure length
392
Chain Sequence
b'APIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRKEIMKVYHLRNYNAIVGNIHRLYQSISDFHFNTSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 121
structure length 392
sequence length 420
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btuA01
5B4TA 5JC8A 1H6CA 2Z1MA 3B70A 1XLTA 4Y98A 3JYOA 1P0FA 2EF1A 5I9LA 3JQDA 3W8EA 3UF0A 1PZGA 2JCXA 4MKXA 1R37A 1NQAO 3DTYA 1FMCA 1U9JA 2WM3A 4HBGA 3WYEA 2GDZA 4B4VA 3C7CB 4E5PA 1MX3A 2PZKA 3D64A 4R3WA 1E1KA 3PIDA 5GZ1A 2DUWA 4FQ8A 4MDHA 5KWEA 3PHJA 3A4VA 4G65A 4G81A 5G0VA 3E8XA 3ZWOA 1V3UA 5JE8A 1Q7CA 4NR0A 3PHLA 1D3AA 5A9SB 2CD9A 4GQAA 4XB1A 4DVJA 1NHWA 2VOJA 1PGOA 3ETDA 2IXBA 3G3EA 2O3QA 2Y1EA 3G49A 5JDIA 3HQ4O 4GLLA 3SJUA 2GR9A 4ROSA 3MJEA 4J91A 4J0FA 3W1VA 3UH1A 4JCOA 2OO5A 3GAZA 4QT0A 4XIJA 2VHVA 1FJHA 4GVXA 3TWOA 3OA2A 2AA3A 1UXGA 2BI8A 1HE4A 3ZCXA 3INTA 2R6JA 3ZWYA 3RC7A 3HB5X 3DQPA 4GGOA 3X2EA 2OL4A 3F4BA 4A0SA 1NPYA 3WMWA 4QUKA 2B0JA 2Q46A 4M8SA 2EKPA 4Q3BA 3LT1A 1ML3A 3JQ6A 3WB9A 3DZHA 2ZYAA 5JYEA 3P19A 1LUAA 2Y1DA 2PZJA 2VWHA 3GVXA 5J23A 4D46A 1YDEA 3HN7A 3QV1A 2YZ7A 1JKIA 1UP6A 1XYGA 4OXYA 3TL3A 4R1UA 3ZZNA 3IQDB 4L4XA 1HLDA 1WW8A 2OBYA 3EVNA 1FDTA 5IF3A 2ZJ0A 5EQDA 4Z3DA 1DC3A 3QWFA 4CLOA 5JSFA 1E1LA 1Y8RB 1PS9A 5DCYA 1VJ1A 2X6TA 4CMEC 3H5RA 1LDEA 1KY5A 3LLVA 1WZIA 3OIDA 4HFMA 4D7AA 2A94A 3HDYA 4EEZA 3JQ8A 4W9NC 3BMCB 3A28A 4IQ8A 4PLHA 1RKXA 4YVFA 2OBNA 5ICSA 4DRYA 2IYOA 3K31A 4K6FA 3ON5A 1PZFA 2Y0CA 3EMKA 2CSUA 1DAPA 5CPFA 3NDJA 2EJWA 3H65A 3RUFA 3CKYA 3D1LA 2NACA 5LDGA 4CMJA 1Z45A 3R3JA 4AVYA 1BTOA 1NAHA 1P74A 4CR7A 2RH8A 3ANMA 1IZ9A 3W4JA 2P2SA 1DB3A 1HETA 2DM6A 2HSDA 3AUSA 4IDCA 1AGNA 5T5QA 2PKRA 1F17A 2WDZA 1U3UA 3PJDA 3PHHA 4TROA 1DBVO 1TVEA 1YL6A 1EE2A 1U4SA 4JGBA 3WLEA 3IKVA 4IY1A 1WXDA 2G5CA 3L0DA 4GPD1 1YJQA 4JIGA 5JAQA 1O95A 1BXGA 3OJ0A 1U3WA 1HKUA 4CM7A 3ADPA 4IMPA 1GTMA 4N18A 4WLFA 4YJFB 3RI3A 2ZTVA 4NIMA 3HJAA 2CDCA 3LF1A 4KQWA 1NX6A 1DXYA 2JAHA 4TKMA 3A9WA 3FTNA 2EW8A 4PCVA 1QMGA 4JROA 3DR3A 5F1KA 1KVSA 1X0VA 1ZEMA 1U8FO 1HDXA 2ZQYA 3KYBA 4KUEA 4UUOA 2A4KA 3VZRA 2QZ9A 4IDBA 4CUKA 3MWDB 3D0OA 2C7GA 3DMTC 3WWYA 5BNTA 1CDOA 3ETGA 4PG8A 4CM9A 3DDNA 3FWNA 4QEDA 3DONA 1U3TA 3G1UA 1YB4A 3PGJA 4XIYA 4CM6A 1K6JA 3RAJA 1X7HA 2I65A 2PGDA 3E03A 4L0QA 4J49A 4K1LA 3E9NA 3TN7A 4GX0A 2Q1TA 3F5SA 4I8XA 4Z6KA 2Q4EA 4J4TA 1UJMA 2ZIZA 4XKJA 1WMAA 4ILKA 3AM4A 4BL5A 1VLLA 2H1SA 2ZKLA 1E7SA 3QE3A 3K6JA 1BXZA 3DZIA 1VPDA 3IMFA 2VRCA 4J0EA 4JP3A 4TVBA 3UVEA 1W73A 1MUUA 1C0PA 3QWHA 4IDDA 3LC2O 3DAFA 3K5PA 3PDUA 4PLPA 4LW8A 2DVMA 4YJGB 4CODB 4Q3CA 4ND4A 4R9SA 5JBIA 3I23A 3NJ4A 3PZRA 3U62A 4ZVVA 1QYCA 2OMEA 1GQ2A 4CMBA 3T7EA 4KWIA 4QXMA 2BKAA 1DLIA 4NFHA 1MFZA 1EBFA 5C7IO 3WQSB 3RJ5A 4XZ3A 4NK4A 1O94A 1B7GO 2NVUB 1T4BA 2V65A 1YWGO 4DMLA 2BHLA 1PJCA 5I7VA 2OORA 4NMHA 1A4IA 5L51A 1ISMA 2O4CA 4XQ9A 3B1KA 1PTJA 5IZCA 2I3GA 3ZWVA 3ZW8A 2HRZA 3K73O 4ND3A 3ZU5A 2DAPA 2QYTA 2J5RA 1LDYA 1QRRA 1PL6A 5IN5A 2HO5A 4OGWA 4J3FA 4DQUA 1M2WA 4A2CA 1I3MA 5L4NA 4CMGA 1ZVMA 1QV7A 2QQ5A 4D44A 3I9KA 3AJRA 2HJSA 3KSZO 4QFDA 5EJ2A 2FR0A 5DCUA 1X1EA 3ZWCA 2OHXA 1U7HA 2VUSA 1A27A 5HS6A 1T4DA 4CMIB 4IDFA 1YQDA 3DHEA 1NVMB 1P77A 1P1RA 4CM5A 1LNQA 3UCXA 4B8ZA 3I9NA 5LC1A 4CQMB 2ZTMA 4Z9XA 3W4IA 4NPCA 3CZRA 1D1SA 1E7QA 2DFVA 1EVYA 2NNLD 2QW8A 1T2CA 3HG7A 3QVOA 1WVGA 2HMTA 3IJRA 2C82A 3RWBA 4AJLA 1EMDA 2PFGA 5LCXA 1L7EA 3JQAD 3WWZA 4I5DA 2RCYA 1G0OA 3OA0A 2CZCA 1HF3A 2X9VA 1ISGA 3EVTA 4PRKA 4I5FA 5JC1A 1E7WA 2VZ9A 2DTEA 2DBVO 5JLAA 1UDAA 3RU7A 1EUCA 4XYLA 4YRDA 3WBBA 1W0CA 1IOLA 4BNGA 2VCYA 3ST7A 1D8AA 5JDIC 2VNAA 3ORFA 4I5GA 1O0SA 1WDMA 3P2OA 5JYFA 1YKFA 3KYDA 1G6KA 1HRDA 3BTOA 4TZKA 5KVSA 2WD7B 5G4KA 1H93A 1QORA 2CF5A 3PJGA 4MOWA 3ROQA 2XAAA 1VJTA 2W4QA 3L4SO 2HKIA 3CEAA 2HK8A 4DUPA 1Y9EA 1Y6JA 3INGA 2YUTA 1VJ0A 4BO9A 3PQFA 4Y8VA 3HB4X 1CRWG 3GHHA 1YS4A 4MINA 1WNTA 2BGMA 4IZIA 3OETA 1F8FA 2X0JA 4EUEA 5CDGA 1PGNA 2O48X 2Y05A 4CR6A 3S2IA 4DIFA 2EGGA 1PZHA 2QRJA 2BF7A 4XJSA 3W8FA 1XQ1A 3GAFA 5HM8A 1ONNA 1PS0A 1GYRA 3AY7A 4GL4A 1I10A 3TNLA 4CV1A 2FY8A 3A14A 1SB8A 2E37A 2PD4A 4JBIA 1QG6A 4EW6A 4LVUA 2WTBA 2D1YA 3DBRB 5FWNA 3P5SA 3NRCA 4Q39A 5CDSA 3WIDA 4IGEA 5KVVA 3WNVA 3OM9A 3OQ6A 3JQBA 3WGHA 4BKOA 1U8XX 1V8BA 2GCGA 1GV1A 1L7DA 4OMUA 3TOXA 4MVJF 4A26A 1S7CA 1OZAA 3AI1A 4RO0A 5CDTA 1DJQA 1NVGA 3S55A 1VSVA 2V6FA 1KEVA 2X0NA 3AUUA 1N92A 2G82A 1U2GA 3TDKA 1DIRA 4NQZA 4AJKA 3M1AA 4M1QA 4PG6A 2AW5A 3JQ9A 4JJFA 5GY7A 4R1TA 1ENPA 1LTHR 4UVEA 4JJIA 4BKPA 1YBVA 4HY3A 4MVJA 1JKFA 1GU7A 3PDJA 2AEMA 4DREA 3VVCA 1HYGA 3HN2A 4DIOA 4HUJA 2P9CA 4B7UA 2CDAA 2RBEA 2GUGA 3WLFA 5L95A 3HZZA 2D5AA 1T24A 3H9EO 3FNHA 2DPGA 1R0LA 3IOYA 3O9ZA 1HE3A 4R4JA 4FFPA 2RAFA 3ANLA 1F14A 2AQ8A 2DTDA 1E5QA 3IUPA 5JO9A 1I3NA 2F1KA 3BZUA 2RHRA 3FPCA 2NQ8A 3EK2A 4FIZA 4EJ6A 1PWXA 4AJHA 2C7VA 4PGFA 2ILTA 2QZZA 1VL0A 3FNGA 4GX5A 4D3FA 4EJMA 4R69A 3ZHBA 2JCVA 4DPKA 1R12A 3KZVA 4BOYA 2YDXA 1XSEA 4BO2A 2FHSA 3I83A 1DLJA 1LRLA 2Q1SA 2ZB8A 4NI5A 1JU9A 1RWBA 4TRNA 3NDRA 4TWRA 1U2DA 4F45A 3ZI0A 9LDBA 4E4YA 1QR6A 4KUHA 2C20A 1PJBA 3GG2A 5ER9A 5AOVA 4R16A 5ENDA 4CM4A 4CM1A 4L4SA 1OC4A 1L1FA 2DKNA 4NG5A 1DIBA 3I4CA 3L6EA 3ABIA 1TA4A 2ZB3A 5BSFA 2IYPA 5TT0A 2X1HA 1VE9A 3LF2A 5AXBA 4B79A 1I32A 3PGXA 2PZLA 4Y67A 1Q1NA 3WXBA 3VPHA 4HXYA 1JWAB 2YHUA 1HDZA 2W2KA 7MDHA 1SPXA 2CVQA 4G5HA 2AEFA 1SBYA 1ZCJA 1AUPA 3PYXA 3H9UA 3LC7O 4AL4A 4AJ4A 5KCZA 1YBAA 1EEHA 1XU7A 1UXIA 2HAEA 3ZU2A 3VOSA 2B5VA 2OOSA 2FSVA 1YJ8A 5C5IA 1N1EA 3SVTA 2DT5A 3GUYA 3OECA 3ROPA 5M6DA 3F1LA 4KOAA 3GH3A 4YJHA 5CG2A 1ZH8A 5L45A 5A04A 4U0JA 3IL2A 2AXQA 4GX2A 1XU9A 4H15A 3WBFA 4OKNA 5BR7A 1I2CA 3QA9A 1U7TA 3SBOA 2FN7A 2CVOA 3LLSA 1UP7A 1XHLA 5EERA 4BO7A 5LDHA 2PA3A 1GDHA 4LGVA 5IXYA 1ZK1A 2PH3A 1VC2A 1OOEA 4FFNA 3WGGA 5C7LO 3BTVA 3K2BA 5JAMA 3GPDG 4R1SA 4LRSB 4LRTB 1GZ3A 3JQEA 3K96A 4FSHA 2WJPA 4M54A 4XR4A 2NVWA 5AQ1A 4FD3A 1GUFA 3CMCO 1D4FA 1OMOA 1NTOA 4IQ0A 3ZNOA 2CMDA 4AJNA 4BO3A 4TMFA 5TX7A 5A1TA 1IYZA 1E7YA 3GN2A 3O8QB 3WSVA 1EBUA 2OP0A 3C85A 3F5QA 1XQ6A 2BGLA 3MJCA 3RROA 1X13A 2VTDA 3TZCA 2PV7A 3PJEA 5HRUA 5A03A 1JAXA 4WCDA 4D41A 2GO1A 1EUDA 3EY4A 2I3AA 4MKRA 3OQBA 3I9OA 4O6VA 4MVJP 1KEWA 1F06A 3JQ8B 4HFRA 4D45A 4CPDA 2XF8A 2EKQA 1X0XA 3R1IA 1G1AA 1NP3A 4YT5A 3TZQA 4QX6A 3NGXA 1MXHA 3KB6A 4CMKA 4J1QA 2BFAA 4IGFA 4KDEA 3QVSA 3I9JA 2X8LA 1SEVA 1YGYA 4IS3A 4A10A 4UVIA 3WDSA 2X5KO 4FJ1A 3MJ4A 5TS3A 5CDUA 1VL6A 3FBTA 5JYAA 1MGOA 4AJOA 1E3IA 3TJRA 4MP6A 4DC1A 3KEOA 3VH1A 7ADHA 5T73A 1U28A 2EKLA 1K89A 3HFGA 1LXCA 1E7RA 1AHIA 2OZPA 1ENZA 2CY0A 1ZBQA 2HMVA 3PFFA 1NFFA 3OJEA 2JFGA 2ZATA 5A3JA 4OQZA 4MVJM 1XA0A 2Z5LA 4XYBA 4YT8A 3RBXA 1OC2A 3L77A 3NKLA 1EE9A 2P5YA 4UUNA 4WPGA 4D3SA 2ZQZA 2YQ4A 3ZWAA 3FWZA 3DOCA 3PRJA 2W8ZA 1BXGB 2ZYGA 5JCJA 2EXXA 3H8VA 1QLHA 2PZMA 5F1OA 4WGGA 5DOVA 4R5MA 1KC3A 4ZJUA 2VTEA 1EDZA 3V2GA 2O4UX 4J2HA 1IPFA 4TKLA 1Q0HA 4W4TA 2Q3EA 3S2GA 3TPCA 1MG0A 3DOOA 4E2YA 1SNYA 5G2OA 3WGTA 5F1PA 2Q4BA 1KETA 3B6ZA 4AJ1A 3OICA 3D4PA 2Z1NA 5EINA 4LCJA 2SCUA 4DMMA 5TC4A 4U5QA 4I9HA 3QP9A 4NNJA 3GLQA 3V5NA 3HNPA 4A73A 2X7HA 3NX4A 3H5AA 3PQDA 2I9PA 3JQBC 1SCUA 4KTTE 1HDGO 3Q9NA 4DA9A 4Y6SA 2O3JA 2EP7A 4RGBA 3B1JA 3STHA 1BGVA 1FDUA 4AJPA 3GNQA 1W8DA 3RUDA 3DBHA 4BGIA 3CIFA 1V3VA 3MJVA 1ONPA 2GF2A 1GFSA 1QSGA 2NLOA 4KWHA 4BO8A 3GEMA 4ESOA 1NAIA 1XELA 3GVIA 3ZNPA 5CG1A 1W6UA 1ZMOA 3BHJA 4WLOA 1LQUA 2FMUA 3H9JA 2GSDA 2EWMA 2PGLA 2ZB7A 3JQ9C 4P4LA 3WSWA 2DPHA 2VUTA 1ENOA 4XB2A 3W6UA 3UCFA 2ZB4A 2H9IA 3A1NA 3GVHA 4JQCA 1RM5A 2GZ2A 4C7JA 4ZQFA 3E9MA 1DJNA 3MOGA 4ZN6A 3GY0A 2B4RO 2VQ3A 3DHYA 3GA0A 4OL9A 1H6BA 1JVBA 1NQ5A 4MVJE 1KBZA 2YFHA 1S6YA 1E3WA 1H2HA 4DL9A 4QO8A 3KSUA 1N9GA 4DLAA 5AXCA 1GQYA 1LX6A 3IS3A 1PGQA 5U4QA 3RUIA 4OXKA 3KSDO 1KVUA 2DBRA 4R54A 1SMKA 4AJIA 1Q2XA 1FXSA 3WOHA 3BMNA 3JCZA 1BG6A 1DDOA 3G17A 3T4XA 2BMAA 4NFSA 5JXWA 3F9IA 1I3LA 1QYDA 4E2WA 1PU2A 1T2EA 1ZK4A 4N5LA 3ANNA 1Z7EA 1G0NA 3HFSA 3GT0A 2NVBA 3O38A 1I36A 3JYLA 4L8VA 1WLYA 1EVZA 4RZHA 5HA5A 1IL0A 4CQLB 1SOWA 4RQTA 4L76A 4S1VA 4GWGA 3FNEA 1C1DA 5ADHA 3V2HA 4FGWA 1LC3A 1X15A 2I6TA 2NADA 1UXHA 3NDIA 3FBGA 4J7UA 4J90A 3O8QA 3GUCA 1PJTA 4RL6A 2YV2A 3D5TA 4UREA 2IEDA 1LBEA 1UZLA 2ZK7A 5A5FA 4P22A 3TZKA 2JHFA 3PEFA 3QVXA 3EW7A 1U5AA 3PI7A 5B12A 4HX5A 4IINA 4YJDA 4Z0TA 2QRLA 1A9YA 2HK9A 3HADA 5JCXA 2AHRA 1F12A 1QYWA 5A05A 4EJ0A 4E2XA 4R68A 5EIOA 5A5EA 5B4VA 3L9XA 4ZICA 1TB4A 5T6BA 1Z82A 1CYDA 1R4NA 3BIOA 1IULA 1LLQA 1PEDA 2WMDA 1X7GA 4FCCA 3ZU4A 2IDZA 3GGOA 4KP7A 5G0SA 4PLVA 2G0TA 5HWSA 4NJOA 1O5IA 2C2XA 4WEOA 4ZU3A 3F6YA 4OSOA 3AM3A 3WIEA 2JCYA 3Q3CA 3AUAA 4ALMA 3KYDB 1A4UA 3GMSA 5KKCA 2HU2A 3HDQA 1H2BA 4OQYA 4KTVE 1ZKMA 3QWAA 2FRDA 5G4KB 4EBFA 3KM0A 1JAYA 4MVJI 1ADCA 3BTUA 1ENYA 2G1UA 2EIHA 4YDRA 2H5LA 3H2ZA 3SC6A 4RJTA 3HUDA 1RYDA 1UUFA 4FFMA 3VH4A 2G17A 2P4QA 1M6WA 1J49A 3COSA 1YXMA 3RJ9A 1BXKA 3QHAA 4NJMA 3QWIA 3F4LA 1F8GA 1ZJZA 1LSOA 3RBVA 4WLUA 2J5QA 5CAEA 3QRWA 3EDMA 1K6XA 5EESA 3W4KA 2TMDA 1FDSA 4K28A 3AUTA 2D8AA 3ZWMA 1HEUA 3SLGA 3RFTA 4ZA2A 1DHRA 2O23A 2I5PO 5TLSA 3U49A 5L7YA 3AFMA 4HNHA 4M55A 1OAAA 5C7OO 4Z9YA 2R2GA 3PQEA 3JQAB 3JD1A 3DZBA 4YR9A 4ALLA 3VDQA 2E6UX 3O4RA 4JNKA 1E0DA 2UV8A 4IJKA 3LK7A 4PG4A 2O7QA 3JYPA 4E33A 2XXBA 3M2PA 3ZV6A 1ZUD1 3D3EA 5GMOA 1E7MA 1GEGA 4ALNA 4BO4A 2OGUA 3NUGA 1PL8A 3KV3O 4U6SA 2AQIA 3M2TA 5EN4A 3ZHYA 3C1OA 1DC5A 1T1SA 1VRWA 2BGKA 3ZV5A 2NU8A 1EFLA 3KYCB 3BHIA 3RD5A 3LSYA 3D5QA 3AU8A 1JWBB 3I1JA 3RFVA 2XOXA 3SLKA 3MTJA 1C14A 1MP0A 1LSUA 1I8TA 4E12A 1PQUA 4I9NA 4BNHA 2GN8A 3OSUA 5DBGA 4BKUA 2Q22A 5GZ3A 4H3VA 3FPLA 4OYRA 5IG2A 1LLDA 4TSKA 1ZK2A 1Q0LA 3P2YA 2YDYA 5KVCA 4CLDA 4BNWA 4CR8A 1HDYA 3DXFA 1QLJA 5JAIA 3QWBA 1N2SA 5TF4A 3CPSA 1BRMA 4OKIA 3LU1A 1GYPA 4WNIA 1XGKA 2VZ8A 4CQLA 1E1MA 4TRRA 5ES3A 4OOEA 2BELA 3F46A 1HZJA 2VHWA 1H6AA 3L4BA 4L75A 5IXSA 2VT3A 3BMQB 1BDBA 1P9LA 5THKA 2AQHA 1R6DA 4FJ0A 5KJEA 4A03A 4CLEA 1AXEA 4M87A 2BFPA 3TRIA 4FFOA 4KDFA 4CM4B 5JMWA 1H9BA 4JN6B 3RASA 2O2YA 2VYVD 3SEFA 1O8CA 1KOLA 4PG7A 3B1FA 4FBGA 1YL5A 6ADHA 2X86A 3N74A 3V1YA 4PLTA 1YQXA 1PJSA 1NQTA 1UR5A 1DC6A 2B4QA 5A4DA 2HMUA 2DLDA 2W2KB 1HDRA 1T2AA 1YB1A 4GH5A 4PLZA 3GC6A 4GWKA 3MTGA 1A9ZA 2DBZA 4WLVA 1P3DA 4K6CA 4D0RA 4DYVA 5AXAA 4TRJA 3OIFA 2PY6A 1LSSA 3FNFA 1KEPA 3ZWBA 2HMWA 3DZGA 1TLTA 3VH2A 3IC5A 4DC0A 3CTMA 5JDCA 1RJWA 3JV7A 3LT4A 1NNUA 4YJHB 3QW2A 1B14A 1LSJA 4XX0A 2X22A 4E3ZA 3ZDFA 4FDAA 3EHEA 4N5MA 2VHXA 2FPPA 4L73A 3C7DB 2P4HX 3GDGA 1BHSA 3K30A 1Z73A 4QTZA 2V6GA 1VSUA 2JL1A 4QFCA 2OXIA 2HQ1A 4NBVA 4LMPA 1D7OA 1HT0A 4INAA 4E5MA 1CEQA 2CVZA 4UEKA 3PXXA 3PHIA 2BD0A 1LRJA 1PIWA 2D4AA 4YCAA 3IDSA 4II2A 4DBZA 3UXYA 1H9AA 3HDHA 4RLHA 4EDFA 1R15A 3GEGA 3CXRA 1CQIA 4I1IA 5MDHA 2NV6A 2QYSA 2BFOA 3D3WA 3KOUA 2EJVA 2XXJA 1QYXA 3JD0A 4IXWA 4FOOA 4D0SA 4QQRA 1DRUA 3UN1A 5KJFA 4Q9NA 4IZHA 5AVOA 1ZO8A 1A5ZA 3JQAA 4ZRNA 5TJHA 4A27A 5L53A 1BWSA 2Y66A 3GRPA 3G1TA 4LISA 5IZ4A 4L4RA 4XYGA 4Q3EA 1Y8QA 2WEKA 1GCOA 2V7PA 3H9GA 3AY6A 3PWSA 2XPCA 1LDNA 3ONDA 1LLUA 5BSHA 3Q1LA 1KVTA 1E3JA 2VWGA 3DZFA 4LMRA 3H7AA 3DC2A 5THQA 4RZIA 4BKRA 3U4HA 2GZ3A 1YQGA 4GBJA 3ETEA 3GHYA 4GVLA 2GN4A 5IJZA 3JD2A 1DOHA 1E1NA 1I33A 1KVRA 4B7XA 5CHEA 1I0ZA 3KYCA 4FFLA 4RVFA 4GKBA 5COAA 4IIUA 3DZJA 1YVEI 2CNBA 3Q9UA 4F6CA 4YRBA 2DU8A 2RHCA 4BO5A 2GLXA 1ARZA 1YOVB 3WFJA 4Z0PA 4J7CA 4W7HA 3F47A 2O2SA 4WECA 2JD1A 1ISFA 4WCFB 4CQMD 5F5NA 5I7SA 3EYWA 2IXAA 2YQ5A 4E6PA 4BNMA 1EK6A 3C1AA 4RORA 1MC5A 2FSSA 1K6IA 4I5EA 2D5CA 1EFKA 1VM6A 3V2UA 3WNQA 1QV6A 4Q3DA 3ZHXA 1NPTO 1MV8A 4J43A 3MJTA 3WICA 3GZNA 4E5YA 1EQUA 4JBHA 2NM0A 4YWJA 3KBOA 1LQTA 2WSBA 3RKUA 3JD4A 3I4FA 4B4WA 2VHZA 2UUPA 1SOVA 1EZ4A 3ZW9A 1SAYA 1NWHA 2P9GA 1TT7A 1PGPA 1P1FA 2PR2A 3BMQA 1YE3A 1I2BA 1NVTA 3KEQA 4B7CA 4N54A 4ONEA 3WGZA 3C7AA 3S2FA 1PJ4A 1XG5A 5DNAA 3RUAA 3SX2A 3E5RA 5IN4A 2GNAA 3DFUA 4MIYA 1ZFNA 5HBRA 2Q2QA 3FI9A 3U0BA 3U5TA 2GASA 2F00A 3ITDA 4EYEA 1B8UA 1PJ2A 4XGNA 2ZTUA 4YAKA 2W90A 1YDWA 1ZSYA 4BNXA 1Q7GA 4BQPA 1HDCA 3AOEA 1E3SA 4Z9FA 3DFZA 1LEHA 4YAEA 3DBHB 2PWZA 1Y1PA 3ICPA 2JD0A 3HWRA 3KTDA 3CH6A 1X14A 4DPLA 3ZV4A 5DDIP 1BW9B 3VKVA 1GD1O 2OFPA 5K6AA 3FD8A 1Z7BA 4O1MA 1Y5RA 1JA9A 1WZEA 2ZCUA 4FN4A 2V6MA 1BDMA 3ROKA 5IDXA 2Y99A 3AOGA 2Q49A 4E2ZA 2O7SA 3RUHA 4RF2A 2I66A 3WTBA 1ISJA 3OJLA 1ADFA 1Q7BA 3Q2KA 3NTRA 4J9VA 3QVTA 4BMNA 1U4OA 3TOZA 2LDBA 4MVJG 3NGLA 2JD2A 1WP4A 1P1IA 3NTQA 1E3WB 4RQUA 3VTZA 1WDKA 1GYQA 1HYHA 1LDGA 1LRKA 1N9GB 5DF1A 2Y0DA 2GZ1A 4L74A 4E5NA 3ADOA 3HE3A 4R41A 2B69A 3LT2A 3VC7A 5H81A 4R9RA 1JW9B 3DBVO 2H6EA 3QJ5A 3U4CA 3L9WA 1WPQA 3BMNB 3NV9A 1ZMTA 4YQYA 4FC6A 5IZCC 4YAGA 3KETA 3OQ1A 4CL8A 2ZJ1A 4MKZA 4I9UA 4RVUA 2RH4A 4ZD6A 3DB2A 3VVBA 4RLSA 5A9RA 4KQXA 2O50A 3ASVA 3ICCA 2QX7A 3TFQA 1C1DB 2J5KA 1B16A 2P68A 5T57A 1NWCA 1TI7A 1U5CA 4RCVA 4EEXA 3CSDA 3IKTA 1GV0A 4XQCA 4CLHA 2HRBA 3CE6A 3M1LA 3L4BC 2AMFA 4FR5A 4ZHSA 4OJNA 3UW3A 4BO1A 1HDOA 3IIEA 1C3VA 3TZHA 3C24A 3M6IA 4UEOA 4EI2A 3UGKA 2VN8A 1WAMA 4ITUA 3AI2A 1ULUA 3S2EA 3VZSA 4CLRA 2ZYDA 4NFYA 3JQ7A 1OBFO 3ZWXA 2BRUA 5KNLA 4XCVA 1PS8A 2PGJA 3Q6IA 4GAEA 2Q2VA 4KUGA 2X9NA 5C3MA 4XA8A 3DMTA 3DZKA 2Q1UA 3GG9A 5CP8A 2GRAA 3C1TA 4X54A 2YV3A 4Q3NA 3K8ZA 1DAOA 4XEHA 2JFHA 1R4NB 4FGSA 1GUYA 4J4HA 1Z74A 4CV0A 4C4OA 2VT2A 4F46A 4G2NA 3GOHA 3NYWA 5L7WA 4W7IA 5DBFA 2J3JA 4E5KA 3ZGYA 3KO8A 4AFNA 1GPJA 3GEDA 2E48A 5COQA 4B4UA 3HSKA 1E3EA 4P8RA 4II3A 5JDCC 4WEQA 2CFCA 3MCVA 1YOVA 2QHXA 8ADHA 5JY1A 2HCTA 3AW9A 4U6QA 4UULA 1TEHA 3KRTA 4P38A 4PG5A 1B3RA 1PJQA 1DIGA 1CWUA 1SC6A 2ET6A 2Q1WA 4FJ2A 4YTEA 3H4VA 4DLLA 4EZBA 4WCFA 3MEQA 2JAPA 4N7RA 4BIIA 9LDTA 5EL0A 3U4DA 3WGIA 2AE1A 2G76A 4HFJA 3GR6A 3PYLA 1XCBA 4J1NA 4IBOA 3ZH2A 3MZ0A 3KVOA 1ZIDA 4NJMB 1ZW1A 1R0SA 4RPKA 4CL3A 5L4SA 4IDEA 3F1KA 1K3TA 5H83A 3WJAA 3D4NA 2P9EA 2GERA 4IXTA 3HDJA 5FI3A 5I7EA 2B37A 4IM7A 3WMXA 2Q50A 4RF5A 4MP8A 3IP3A 1Y9AA 4ALKA 1Z75A 4TZTA 3DBLA 2JFFA 3OF2A 5I9NA 4D43A 3ONFA 1DO8A 4CMAA 1MFPA 3JQGA 2FZWA 2YY7A 3L6OO 3U3XA 1N5DA 5BQFA 3T7CA 1VKOA 2DTXA 3U9LA 3VH3A 4GSLA 5K0ZA 2UAGA 3PP8A 5H82A 5KJ6A 3D7LA 1B3BA 3BHMA 1P1HA 2LDXA 5IDWA 4B3HA 1IPEA 1MLDA 4ZQBA 1M75A 2NUAA 3ZWWA 4XGKA 4WOJA 3QY9A 4IJVA 5DZSA 1PR3A 1DFGA 3OHSX 5ENVA 2WYWA 2AG5A 2PKQP 2WYVA 2YYYA 3I9MA 2FPIA 1BW9A 3WS7A 2OUIA 4ND1A 5AXDA 3G0OA 3MOIA 5G0WA 3BYZA 1P45A 2E49A 3ZU3A 5TGDA 4IIVA 4CV3A 4BNZA 1EUZA 3E48A 1OFGA 1D1TA 2OP1A 1P0CA 4WLEA 3RCBA 3AM5A 4R1NA 1T25A 4BNLA 4CM3A 4MIOA 4ND2A 4O59O 2EG9A 3EZLA 1P1JA 1JN0A 1B8PA 5ITVA 3GRKA 1GEEA 5B4UA 4LCEA 1P44A 1V0JA 3OFSA 2VWQA 4FOSA 2Y1GA 3HHPA 1ADGA 4YAJA 3OIGA 3VPFA 1Y81A 2VWPA 4AJ2A 2TMGA 4GMFA 1TT5A 4O0LA 2RIRA 2C29D 1HZZA 3DTTA 2YV1A 4PIVA 2CF6A 3S8MA 1KEUA 3O26A 4RVSA 3VHRA 4KZPA 2PH5A 3LDHA 1ISIA 1DEHA 1NXQA 3OJOA 4IDGA 1N7HA 1WWKA 4DWVA 3OEYA 1NHGA 1F0YA 3TSCA 1CERA 3WGYA 4OH1A 2V6BA 4AJEA 4RVGA 3N7UA 3FTPA 3ZV3A 1TXGA 4H16A 1K2WA 2NSDA 3CZMA 2I67A 4EITA 2IEBA 4J1TA 2A9FA 1HSOA 1T26A 3PTZA 3EAGA 4Z3KA 3UCEA 3Q11A 3ENNA 2VRBA 5TRTA 3WX0A 2VYND 1C0LA 4JBGA 3AOEC 3T4EA 1SZJG 1ADBA 4BB5A 2POQX 2O3TA 1PL7A 3FHLA 4Y6RA 4M89A 4DPMA 2NTVA 4YEDA 4C7KA 4ALIA 4YT4A 5K6AC 1O6ZA 3GDFA 1ISHA 2EGHA 4OOFA 3TL2A 4HADA 3SJ7A 1A7KA 4GKVA 1U3VA 5A06A 4WASA 3NT5A 4GSKA 4UEJA 1DRVA 1O89A 3JTMA 3GQVA 2C59A 3QQPA 4A7PA 3JQFA 3MWEB 5CPBA 3I6QA 5L3ZA 2R00A 4CM9D 1VL8A 2Y93A 1QKIA 2EW2A 4WLNA 1GPDG 1E92A 1XR3A 4XRGA 4NHEA 3RU9A 2AEJA 4TQGA 1M76A 4O63O 4GMGA 5JY6A 1H6DA 3FRJA 3NAQA 1CQJA 1ZXBA 1B0AA 2C0CA 2PK3A 1X1TA 3C8MA 1K0UA 3LVFO 5CEJA 3H6KA 1UXJA 1B8VA 3GFGA 4DBVO 2UDPA 5DOZA 1H0KA 4DYDA 2VRCD 1GQQA 4UUPA 1EVJA 3INRA 3WFIA 2IZ0A 4JXKA 1UAGA 1W4ZA 3I52A 3UHAA 3EZYA 1LLCA 3OBBA 4PLYA 4BO6A 1T2DA 4NDNE 5DBIA 4HNGA 1I3KA 5KTKA 2C5EA 2IE0A 5FFFA 2YHIA 4OO3A 3FR8A 2VYNA 4J16A 5TJ9A 3D3WB 4EUHA 1DRWA 1E5LA 3Q2IA 5GZ6A 4J7XA 4IDAA 3OEWA 4XQEA 4WK6A 4JJGA 3DEYX 1UDCA 4XR9A 2HUNA 3RC2A 1R16A 3BA1A 3TQHA 3O03A 5I8ZA 3WQQA 4CM8A 2HLPA 1P1KA 1NFQA 5A3VA 4FB5A 2AQKA 3WQRA 5CEEA 3FCOA 3K2EA 1LC0A 4E30A 1Y8QB 4IJUA 1ZZEA 3A06A 5JNLA 1J0XO 1J6UA 5F21A 2W2LD 2NU7A 1FDVA 1PR9A 1M66A 4P4GA 5BT9A 1R4MB 2QG4A 3LC1O 1C0IA 1MG5A 1I30A 3W8DA 2NWQA 3VKUA 5TQVA 1OI7A 2PTGA 1IB6A 2PLAA 4QECA 1RM3A 3VZPA 4F6LA 1GZ4A 1I2ZA 2EEZA 3UAGA 4NH4A 2A92A 1E3LA 2NTJA 4TRMA 4YACA 4I08A 5G0TA 4BVAA 4B8WA 3OJFA 3WG9A 1HE2A 1VI2A 1WMBA 4D79A 1PQPA 4BMVA 1QXSA 2DC1A 2W98A 2FWMX 2EP5A 3TZ6A 2X4GA 5A9SA 4JX8A 4N5NA 1V35A 4YPOA 4LN1A 3BMOB 1LU9A 3ROMA 5KJ1A 1JTVA 4CLXA 1BVRA 4J6FA 1LI4A 4WCFC 1SB9A 1EQ2A 1CJCA 2PD6A 4RDHA 3TFOA 1PWZA 4JK3A 3UUWA 1ULSA 4Q3AA 4F3YA 1KY4A 5KJCA 3AK4A 3K92A 2CDBA 2FP4A 4XQGA 4AJJA 3EUWA 1RM4A 4J1SA 3GZNB 1RPNA 4NBTA 2JJYA 4M86A 5JMPA 1P31A 4DQVA 3ASUA 3TF5A 4NU6A 4NZ9A 1UDBA 5F5LA 1ZNQO 2HJRA 3KXDA 4NBRA 5ILOA 4QSMA 5TSDA 2GYYA 3BAZA 3FF4A 4FW8A 4HV4A 2EERA 1X7DA 1E6UA 2Q99A 2X0IA 5A02A 3KLPX 5ICMA 1XEAA 3DAGA 4PRLA 1PJ3A 2W2LA 3GGGA 4GLOA 4DTIA 3NJ8A 4CUJA 4PLWA 1V3TA 1B26A 1YB5A 2Q45A 2NU6A 4J4BA 3JSAA 3QLJA 2O3RA 4GX1A 1CF2O 1GY8A 4KMSA 3ZNNA 1XWFA 2ZCVA 1IY8A 4MP3A 1WDLA 1NFRA 2C5AA 3IAHA 1DHTA 1PSDA 4RV9A 2YJZA 4IJWA 4URFA 3BTSA 5T64A 4D3DA 4DXHA 4BUCA 1Y8RA 2D2IA 1DFHA 2JKVA 4NBUA 4OXNA 4A5OA 3C3XA 5A9TA 4J2OA 3ZNQA 5G0UA 1HXHA 4WNCA 2DQ4A 2EV9A 3PPIA 4UVGA 4BGEA 1ZXLA 4UVDA 2FPGA 1JDJA 4IS2A 3UICA 4W6ZA 5IDYA 3IUSA 1LDMA 2P5UA 2CUKA 2VUUA 3BMCA 1YL7A 3RUEA 2B5WA 4MJLA 3WJ7A 3R0IA 5F3RA 3CMMA 3JQCA 1SO8A 5JS6A 4XJTA 2YFQA 1IHYA 4CJXA 4R5HA 2FR8A 2WYUA 3DWFA 3S1LA 4FPXA 2DBQA 3CUKA 1UXKA 4K9DA 3VZQA 2NQTA 5K9ZA 1EVIA 3F3SA 4PVCA 5J9GA 2X5OA 2FZEA 3RSHA 5AYVA 5T8KA 5JFOA 1CETA 4DGSA 1IE3A 4ND5A 1GCUA 1UZNA 2A35A 5ITWA 4BNIA 3GDOA 5EPOA 4PLCA 2GGSA 5TNXA 1AE1A 2UVDA 3RUCA 3P7MA 2D3TA 3IJPA 2GD1O 4XYMA 2EHDA 4ZGWA 4WOKA 3ENKA 2B83A 1IHXA 4U0KA 4YAIA 5DP1A 5CEFA 4MVJD 1YONA 3E9QA 4D42A 1IUKA 2VYVA 5BNIA 3DMYA 3VTFA 3H5NA 1Y7TA 4O5OA 4B3JA 1MXFA 1MC4A 2WD8A 3PJFA 1R0KA 4BNUA 1UP4A 4E21A 1LA2A 4PLFA 5KKAA 4PZDA 1PZEA 2X9GA 1YH3A 3RC1A 1V9LA 4PVDA 4YJFA 2HMSA 3WYBA 5KVQA 2WE8A 4YA6A 3LYLA 1P33A 3PWZA 4CLRB 3U09A 5C37A 3KHUA 2BLLA 3JQ7B 1ZJYA 4XWYA 3GFBA 4GGPA 2HDHA 3ZWPA 4DQXA 4ZQEA 4E32A 1UAYA 4MO2A 1NR1A 3GGPA 4WKGA 1KERA 2Z95A 1UH5A 2ZTLA 4W82A 4RPGA 5FYDA 4XDYA 4RPHA 2Y1CA 3X2FA 3JD3A 4BNKA 3JYNA 1J4AA 4OM8A 1BSVA 2C54A 1N8KA 4P4NA 1M67A 3ZN2A 5BSEA 5B1YA 1E6EA 4XYEA 4BGVA 1R4MA 3WGQA 3H3FA 3GVCA 4ZQGA 4BHTA 2Y68A 1ID1A 3NT4A 4PZCA 1ZK3A 4S3MA 3PHGA 4LSMA 4JP2A 4RPJA 4M49A 3DAPA 2BFMA 1ZEJA 4XD2A 2X0RA 5HTOA 1AN9A 1C1XB 2P91A 5COBA 3NT2A 3IP1A 2DUUA 3I5MA 2VHYA 1I01A 2Y67A 3VPXA 3PVZA 4YB8A 6LDHA 1LDBA 5I8WA 1ZK0A 3JQFC 2R00C 2I76A 3R3SA 5FI5A 2D59A 2IZ1A 1DSSG 4PFJA 4MIEA 2Y1FA 4B3IA 3AU9A 4HFNA 5DCWA 5KIAA 3BMOA 5I9MA 4R51A 3H9QA 4U7WA 4ZRMA 1E6WA 3VAZA 2VZ0A 3U4IA 1DIHA 5KOIA 1J5PA 1JVSA 4CMCA 2JHGA 4U8GA 5L40A 1U1IA 4UUMA 1HL3A 4YJGA 5ILGA 2Q2WA 1PJLA 1ZSNA 1ZSVA 2O3SA 1PX0A 2D0IA 2GN9A 4BV8A 5JAZA 3DL2A 1UZMA 4OHUA 5JPIA 5TIIA 2J3HA 4FFRA 3QVWA 5MGBA 3ONEA 3JYQA 1HYEA 4WUVA 1NM5A 1Y5MA 1CIVA 1T2FA 2PD3A 4HKTA 2NVUA 3LQFA 3DHNA 4IMRA 1V6AA 3DBLB 4YQZA 3VPGA 4EUFA 4YYZA 4BGUA 2PNFA 3RVDA 3VDRA 4ALJA 3JQGB 5G4LA 4XRRA 3RIHA 4PZEA 5DP2A 3ZWNA 3K9QO 1Q0QA 2DFDA 3H3JA 1KC1A 4YXFA 4BKQA 3WTCA 5BNFA 1MB4A 3E82A 5L9AA 2B36A 1C0KA 3AI3A 1HSZA 2FOIA 2X5JO 2E4AA 4XDZA 4BMSA 3I9LA 3ZHZA 1N7GA 4BV9A 2UYYA 3GF4A 1EK5A 2IODA 4IUYA 5JYDA 1BVUA 1GAEO 4J9UE 1AHHA 1FK8A 1DFIA 4BNFA 4R01A 1B2LA 1HWYA 2H63A 3DOJA 3V1TC 4Y9DA 1I5RA 3PZBA 3V1UA 3GNTA 4CMEA 3GMDA 4CMIA 2B35A 4HP8A 2BI7A 4TVOA 4AICA 2J8ZA 3GPIA 1GUZA 3WGOA 4W9NA 2O3UA 1M6HA 3N58A 4CQMA 4IPTA 5TT1A 1JKJA 3FN4A 3OMLA 1GADO 3PWKA 4CMHA 3WYCA 1HLPA 2J3IA 1BMDA 4HWKA 1GR0A 1E77A 3RQSA 3I3OA 4EGFA 2WWRA 4YT2A 5HS4A 1H5QA 4BQRA 5U1PA 2C2YA 2UUOA 4WE3A 3LZ6A 3AY3A 3PLNA 4UAGA 5CDYA 3KUXA 2GPTA 5CFZA 2IRWA 1JQBA 2QIOA 3GN1A 5IFLA 1TT5B 4BB6A 1QYVA 4FS3A 1DIAA 4RF4A 2E82A 4L9RA 2WD7A 3GNSA 5EMHA 3UKOA 2J3KA 5IDQA 4RF3A 3W6ZA 3RC9A 1QP8A 1VKNA 4H7PA 2IZZA 1DC4A 1K5HA 2QRKA 5T67A 3UFXA 1PQWA 3D4OA 4UVHA 1KIFA 1KVQA 3E5MA 1NPDA 4FC7A 3GK3A 2GN6A 3B20A 3E1KA 4R3NA 3VPSA 1MA0A 5EQFA 4OIMA 1GZ6A 3ITKA 5JO0A 5JW6A 1NBOA 1DPGA 3PLRA 4K26A 5L7TA 1GL3A 3LT0A 4IQGA 1ORRA 2NTNA 3PFWO 4XGIA 2NU9A 3OH8A 5JCJD 1FDWA 1N1GA 1SEPA 5IAAA 1O9BA 4BNJA 3AWDA 4LK3A 2WE7A 5FF9A 2BH9A 4PLGA 5BSGA 5ER6A 2AE2A 4CLOB 4BNNA 3QIVA 3DBRA 5DULA 4CUZA 1ONOA 4PN3A 2FR1A 3GVPA 1FF9A 1Z6ZA 2VOEA 4BNVA 3FR7A 2HK7A 3NEPX 3WR5A 3L6DA 3FSRA 3CINA 1KYQA 3PK0A 1C1XA 1NASA 1EDOA 4NK5A 4E0BA 3PYMA 2VNSA 1JLLA 3H2SA 5L4LA 2J6IA 2I99A 4MVJH 4GI2A 4AG3A 1T1RA 1H94A 4BS9A 1A7AA 3E6AA 4DLBA 4DIBA 4E31A 4RPLA 5I7FA 3DO5A 4ID9A 2AG8A 1YO6A 4QO7A 2C07A 4NBWA 3SXPA 5U9CA 1R66A 5FEUA 3QSGA 4ZQHA 5T8KC 3SC4A 1KS9A 4Y6PA 3MJSA 4YBZA 1RM0A 3PIIA 4CV2A 5DN9A 3UOGA 4OAQA 3R6DA 1IZ0A 1XKQA 1NR7A 5DT9A 4JLWA 2PKQO 4WJZA 4LVCA 3RKRA 1HE5A 3EC7A 1A71A 1B15A 4B4OA 4YRAA 1I24A 2X58A 1HTBA 3BXXA 2B4TO 4OSPA 3KLMX 4BO0A 3EGOA 4W99A 2X23A 3E18A 3ULKA 4BNYA 4LSWA 2YHIB 4Z0HO 4NU5A 4RDIA 3G79A 1YRLA 1NQOA 3OP4A 2Y1OA 1A72A 1NYTA 1XDWA 1XIVA 2Y0EA 4MPDA 4RVDA 1AXGA 4RVHA 1RYEA 4BNTA 5B37A 3I6IA 4E13A 3RFXA 3NTOA 1PGJA 3V8BA 2YW9A 3GZ4A 8LDHA 4CM8B 3L07A 3RBZA 1YBMA 3Q0EA 3AFNA 1LJ8A
chains in the Genus database with same CATH superfamily
5GAJA 1Y1QA 2AOVA 2NU7B 1H6CA 2Z1MA 2QD1A 4P7JA 1KQNA 3BJZA 2QDKA 3JYOA 3C8DA 5EIWA 1QBGA 4KXNA 5CK5A 1KEEA 3S8YA 4PANA 1JZSA 3W2FA 3AHIA 5FLYA 3TQRA 3DZCA 4TOIA 1AMNA 5JWHA 1FE8A 4MKXA 1FMCA 1Z7GA 2WM3A 4HBGA 4B4VA 2GDZA 3WHPA 3C7CB 3AVUA 3STVA 1MX3A 4KX5A 3IILA 1VGQA 3LPMA 4XSHA 3KKZA 1KEKA 3IPXA 2DUWA 5KWEA 1KI8A 5FL7A 5BVGA 3PHJA 5FUQA 1DCFA 1TKRA 2C99A 1Q19A 4OG2A 5JE8A 4R1LA 1PFVA 2G1AA 5LP6B 3C6KA 4X97A 4CEHB 1NN5A 2PGNA 3ETLA 5BYAA 3HYCA 2CL6X 3NAMA 2O52A 1X19A 2H9YA 1P2FA 2W8BA 3MRTA 2VOJA 5AVKA 2IXBA 3FTEA 3AIIA 3G3EA 2DGDA 4PAMA 3ANYB 3V4FA 3RAFC 3PICA 2X4DA 4GLLA 5JHHB 4LPKA 1NXSA 2Q8PA 3FZEA 2CSXA 1Y98A 4YUYA 4PR0A 1SC4A 3D7RA 4KSYA 3L1UA 4QT0A 1RC0A 1ZGJA 5P8WA 1T43A 4EZEA 4NEGA 4BVEA 1UXGA 2BI8A 5KOHB 3ZCXA 3HDGA 3VKHA 1NVKA 3EDQA 5ULLA 2O2EA 3O2JA 1WRBA 3HMKA 2AMLA 1JDPA 1Z6GA 3C5EA 2QM8A 2VTVA 3X2EA 4LDNA 4PQEA 2OL4A 3NWBA 1A82A 1NM5C 1NVWQ 1V2GA 1ORDA 1F6WA 2ATVA 2EJTA 3OZSA 1KQGA 2NZXA 3H7IA 4FGZA 4YDSA 1V43A 2YQZA 2P69A 2BDUA 3U7QB 1UMDB 2AG1A 2EKPA 4RHUA 1BCSB 1NY5A 3B9RA 1ML3A 1VCHA 2Y1KA 3EE6A 1GRQA 1EQAA 3WB9A 3PXAA 3QKTA 3OEHA 5FLKA 5JSHA 5JYEA 2Y1DA 3H04A 2ODWA 2PZJA 3ER6A 1WJGA 1WLSA 1M0SA 4IHJB 1M5UA 2WWVD 5KQLA 2O2HA 3ID6C 4WA7A 4AZ0A 4A82A 2ZBPA 3S1SA 3E7XA 1M5RA 4GRDA 3TL3A 2PRSA 2RH5A 4WVLA 1N6HA 3QKSA 4ISBA 4LZLA 4EKYA 1K5GA 1HLDA 4OHWA 4PZ9A 1RNLA 3EVNA 4JMLA 4EJSA 1BO6A 2ZJ0A 5EQDA 4HDMB 4Z3DA 5B3KA 5IF3A 1J8MF 3QWFA 1E1LA 3TJMA 1Y8RB 3O2NA 4BQSA 4EY3A 1NU8A 4X6UA 5CA1A 5EIEA 5DCYA 2WFMA 4B73A 2BEJA 3H2HA 3ZY5A 5ABPA 1QRUA 5EWJA 3U31A 1J7JA 1WZIA 4KMMA 4LF7B 3ZE2B 4MLCA 1L5VA 2ERYA 5F33A 1B2RA 2PUHA 4EEZA 2HIAA 4EG5A 3AQIA 5BW8A 3EAQA 4P36A 4LJ9A 4AXXA 1XRMA 3ZW7A 3OLWA 1EFPB 3SMVA 2RCNA 3VDMA 4DRYA 4S2EA 5A5GA 4WXPA 3HJGA 1VJGA 2IYOA 3LWNA 3OZ7A 5F78A 4K6FA 3VU8A 1PZFA 1L5SA 3EXHB 5HQJA 5A5VA 3SDZA 1A97A 1IM5A 3D8TA 4EQ6A 1RC8A 4C6RA 4QQ8A 3RUFA 2EJWA 4OI1A 1T10A 3CKYA 2IOFA 3K1TA 5LDGA 4CMJA 4ZKEA 2GPNA 2Q7DA 2HW8A 1Z2NX 1QFYA 1TVKB 2QOEA 3ELYA 4Z7JA 4HB2A 1SBHA 3D81A 4CR7A 3UJ7A 4I55F 3K70C 2P30A 4BTVA 2P2SA 2AUMA 2QT0A 4O1HA 2WU3A 5IK2D 4MX8A 3F7TA 3RVSA 5T5QA 3RWMB 2WM2A 5LIRA 2V96A 3COVA 1X7YB 3PJDA 1KH1A 1NW7A 1U1GA 2R3SA 5F7JA 3ASZA 2Q9CA 3BZBA 4FE3A 3ZKWB 3ICOA 1EE2A 1C8BA 2QTRA 2G36A 2GKGA 4FD2A 4IY1A 4Q24A 4U2FA 2NZUG 3R2JA 1YZVA 3RFUA 1SKYE 2G5CA 1AGPA 3ZZUA 3O9MA 4RD0A 4BQOA 2ZE6A 5DNYB 3L0DA 3VISA 1YJQA 3DM5A 4JIGA 3WNBA 3HU1A 5BRAA 4C7VA 1TYAE 1HI9A 4G36A 4IMPA 4N18A 4WLFA 4TKZA 5C1DA 4NIMA 4O8ZA 3HJAA 2CDCA 3EF1A 4PU0A 1U0BB 1PV1A 1S3SA 4GPIB 3ZDQA 1L5OA 2CYBA 4DWOA 1SIOA 3CF4A 1QX3A 4EY5A 2VJKA 4TXLA 5ESWA 2IYXA 4LG1A 3ZY4A 4TXHA 1XNGA 1KR2A 3DR3A 2AUTA 2XGGA 4EI9A 1U8FO 2I33A 2P3OA 4G6ZA 4UUOA 3JASB 3G2HA 2VDNB 4QU5A 5C8DA 5HVNA 4IHQA 1DCKA 2OHFA 3IVGA 5FR2A 3CNEA 3DMTC 1SY7A 3WWYA 1C1YA 1C3LA 1CDOA 3LBFA 3Q10A 2R1ZA 2QTFA 4PG8A 4YDQA 1NBMA 3AJAA 3HB7A 5G1NA 3FWNA 4QEDA 4BRUA 4KO4S 2GBGA 2HRCA 3WIVA 5JI2E 1PZNA 3PGJA 3H11B 4ITVA 2C8KA 2QQ0A 2G3YA 4EIWA 3THXB 1IJBA 5JSUA 4MA4A 5EKDA 1G8AA 3KAJA 3T3HA 4CN8A 4JHLA 3P0EA 2PTHA 3UMRA 2PGDA 1HBJA 2Y6VA 2DWQA 5BYBA 3AY0A 1JT2A 3SFVA 3ZVKA 5IJ9A 3E1SA 4I8XA 4Z6KA 4KL8S 1M7GA 2EL9A 1QO7A 2GK3A 2VC2B 2Q5EA 3L0OA 4J4TA 5AI6A 5K99A 3NKFA 2ZYIA 1GZHB 1U0NA 1E5VA 2H8GA 1WMAA 1PR5A 5B57C 1UDRA 5LP6A 2CJWA 1HORA 1VLLA 2BONA 4ZZ3A 2ZKLA 5AVSA 2IH4A 1MNQA 2I9KA 1XRNA 3K6JA 1BXZA 1QGED 4JP3A 3K9FC 2VRCA 1F2UA 3IBCA 2IYRA 4QUAA 1J1ZA 1T5DX 3QW4B 3QWHA 5E7QA 4CU5A 2JFUA 1AK2A 4FR2A 4R0VA 2JIBA 4X62B 4ZAVA 1YI8A 3KJEA 1AKTA 4DB4A 4CODB 3ZLUA 1G41A 2EZ4A 1ESMA 2OQ2A 4YASA 2NUTA 5FV4A 3SX0A 1RHUA 2W7TA 4CMBA 1GQ2A 3OE7A 5KOHA 4EBBA 4QXMA 2BKAA 2OZLA 1MFZA 1W88B 2G80A 1W85B 3RJ5A 3O21A 3EGDA 4G07A 1O94A 2MYNA 4JLPA 4PZPA 4TL6A 1WPXA 1Z0KA 3D4IA 4QXQA 4P1ZA 4UEQA 1PJCA 1W49A 3GJTA 1SUCA 2OORA 4NMHA 4O4LA 1ISMA 2O4CA 4LE1A 4ZAXA 1IWBB 1XB2A 1EP3B 4FNGA 1TGYA 1ZHFA 2QR2A 2Q5QA 3J7AC 4N7BA 1XL0A 1U8EA 4LHWA 5CB8A 4Y0NA 1B8NA 4ZTUB 4G0PA 5KEIA 4BB9A 2P4EA 2QYTA 5F2EA 1PL6A 3T4UA 4ZT6A 4DEYA 4OGWA 3HRIA 3CS3A 5ECYA 2XVXA 3M89A 2XTAA 4DQUA 2GF0A 1M2WA 1AD2A 3PNQA 4A2CA 2HU7A 4N3AA 2ORED 4Q93A 1GG2A 1HTTA 2QQ5A 4AMVA 4BVHA 3AVXA 4D44A 3I9KA 5CB4A 2PAFA 2YIJA 4E5UA 3LI2A 4B82A 1BH6A 3KSZO 1CUUA 3G8DA 3VYTB 2W4MA 1MAAA 3ESYA 1II9A 3ZWCA 4GZMA 2FPRA 1J0EA 2WHYA 1RIIA 3ED5A 3IO3A 3PL1A 2VUSA 3PUVA 9ATCA 2GZAA 3UT5B 1LPMA 1YSCA 4CMIB 1A88A 4IDFA 4JLMA 2G9UA 1H8ED 3DHEA 1NVMB 3RS5A 1VBMA 4I36A 4DKJA 5K1ZA 4MB0A 3WDMA 2IUFA 1N5KA 2AOTB 3DJYA 4JLNA 3HU5A 3OVMA 4FW9A 4UZEA 5ERGB 3JVUA 1Y1TA 1ZGBA 4C1BA 3NS7A 2OHGA 2ZTMA 2G0NA 4Z9XA 3BC1A 3CONA 3B7WA 4NPCA 3W4IA 4KXLA 3LC0A 4ZAZA 4DCJA 4R71A 5DMHA 3LVBA 2GLUA 2IC5A 2J9ZB 3IJRA 3W5UA 1ZR2A 5AJWA 2O59A 3NALA 2PIDA 1J2YA 4QBHA 3NYQA 3I8OA 4E94A 1G0OA 3NP7A 2X9VA 3DR5A 4ZT5A 3R4VA 3TEJA 3ZK9A 1ISGA 3HZHA 1GWNA 3U0VA 4QG7A 4PRKA 1RJ9A 2OC9A 2ZRMA 1EGHA 2IITA 4DUYB 3CEMA 2P8JA 2DBVO 3RRBA 4C78A 1UDAA 4HVLA 3T1VA 3B89A 4NOMA 5JROA 2DUNA 1RKVA 2PXAA 4KKXB 5I9SA 2WAOA 4DUZB 3L8CA 4YRDA 1E2QA 1BEUB 4RYLA 2VCYA 1EE1A 3ST7A 5KNBH 1ZICA 2HWWA 1BYUA 4JLUA 1O0SA 1BC5A 3C6ZA 1L6RA 3KYDA 5P21A 3BTOA 4DB2A 4N3CA 1J2RA 4G9BA 1XWWA 3M83A 5BVHA 1VDMA 2IIBA 2ANBA 2XAAA 5AKIA 3DEFA 3UMFA 3D0KA 4TKVA 1BWQA 1E89A 4N7JA 3L4SO 3KR2A 4DUPA 1WKBA 1Y9EA 3PEEA 2QAIA 4KLRA 3AB3A 3LCCA 1ECBA 2YUTA 4LZOA 4GR5A 1T1EA 1W25A 3PFNA 1CRWG 2ARKA 2ZIUB 2HJVA 1YS4A 3U3DA 3KAPA 3PRYA 3CZ9A 2D0OB 5C8VA 3U60B 1BQ4A 4DV2B 4YP7A 4KGDA 2Y05A 1E61A 2F1RA 4DIFA 2EGGA 4RULA 3EWIA 3OU2A 2QRJA 2VKQA 4UHCA 2VL7A 1ORWA 3GAFA 1R9NA 3WK9A 5HM8A 1ONNA 2MYPA 3WYNA 1TU4A 1SB8A 1K8ZB 2XQJA 2PD4A 3OM8A 1UJBA 4TLAA 1LS1A 5FJJA 5JR3A 2P27A 1XZKA 3ESRA 4LVUA 4PO3X 1VYUA 2H57A 1E2LA 3TOCA 3WIUA 3PQ4A 2J0VA 1Z33A 2AXNA 2JIDA 2QN6A 3K05A 1V1JA 1OI4A 1V48A 2HBRA 2XNDA 2JFNA 2XYHA 5CDSA 3THSA 3WNVA 3QFTA 2OECA 5BOSA 3THXA 3UJ8A 1L7DA 2ORYA 4NJEB 4OU5A 3TOXA 2SNIE 3AUKA 3VR5A 1NLFA 2ZE5A 3N86A 4JLSA 5LD2C 1G2PA 2X76A 4RAQA 2VF2A 4RO0A 1JTEA 1I80A 2ZRIA 1JLLB 3LJKA 4HB0A 4N5DA 4V2UA 1VSVA 3T9FA 1IZYA 4RD3A 1U2GA 2A33A 3TDKA 4GFDA 3W79A 2B7BA 1MW8X 4NQZA 4AJKA 4NCKA 2QLBA 1DTWB 4M1QA 1OLUA 3J81k 1H22A 1VECA 2AJCA 4O2AF 4O4JB 4ZZ2A 4R1TA 5T4EA 1SVNA 3ANSA 1ZONA 5GVSA 4QPNA 2QENA 2ERCA 1TJYA 1MT0A 4JIMA 2AEMA 3NIDB 1TZKA 1VMDA 3KE9A 1MN6A 2I4IA 3OCUA 4DIOA 4UZFA 2W6OA 5JECA 2FZ5A 2P9CA 2H4ZA 4NKRA 5HFAA 6GPBA 3A6LA 4B7UA 4CQNA 4JXXA 4Q19A 3WLFA 1KJ9A 2C8JA 1T24A 3H9EO 2B7LA 3KE8A 2QN3A 2DPGA 2W6ID 3DDWA 2RGNC 3GEHA 1N2GA 3IOEA 3UPDA 3EZGA 5HKAA 2LGJA 5AK4A 4ZTBA 4FFPA 5AM1A 2RAFA 5JVDF 3IV9A 4DILA 2AQ8A 3KQPA 3IUPA 3MT9A 4L6IA 1KI6B 3PEYA 4TQUS 2CL5A 5BUCA 4YMGA 2VTKA 2OR3A 2RHRA 4QWMA 2IXGA 3EK2A 4UTZA 1UYJA 3SHOA 1KQOA 1J56A 4PGFA 2ILTA 2KE5A 3OF5A 2VPIA 2QZZA 1R10A 5M3BA 4ZT3A 1O95C 3AZOA 2YN0A 2XCRB 4C2BA 3RVBA 5EGSA 4R69A 4WV3A 3F6RA 2IU4A 1L3CA 3Q7TA 3ZHBA 4QM6A 4U7PB 4KFUA 3KZVA 1YQWA 4DY6A 5JS1A 1VP3A 1YV9A 1XVTA 1H2EA 1DLJA 1LRLA 2Q1SA 3MGKA 4MCAA 1NDUA 1PT9A 1RWBA 1U4NA 3G5UA 3KD3A 4NI5A 4TWRA 5HSGA 2IIQA 3NR2A 1J42A 4PBRA 4F45A 4E4YA 9LDBA 3KIPA 1PJBA 3AZQA 4ZYXA 5DI3A 3H6HA 5ER9A 4Q00A 4UHEA 4F4UA 3FYHA 3N2KB 4R16A 5DSTA 4CM4A 4OXRA 4CM1A 3VHLB 5IARA 2A0KA 4QYMA 4D99A 3MTDA 5CXQA 3T1YB 3N8GA 3CWCA 5TT0A 1PKXA 5ANRB 1VE9A 1L5YA 2DQYA 5G53C 3OEED 5AXBA 2QYHA 3PB3A 1ZN7A 3VMFA 4EATA 3K0HA 2PZLA 4L72A 1L7NA 1P4SA 5C8XA 1ZQ1A 3FTCA 1LBSA 1HDZA 3W78A 2I2XB 4G5HA 1DNPA 2AEFA 2NPOA 3G2QA 3VR4A 3PYXA 2QZJA 3EWNA 1FS6A 3JATB 4QVKA 1U0HC 1QG4A 3H2IA 3BCUA 4AJ4A 5KCZA 1EEHA 1FY2A 1R6BX 2ZFUA 3AO0B 2ZSEA 1P3JA 3LRTA 4JHXA 1E2PA 4W5WA 3RGGA 3X2SA 4OMCA 1AHPA 2GPJA 4WBXC 4KIFA 1UBEA 2BMFA 3C4JA 4YYEA 4FINA 1YJ8A 2PRYA 4BLWA 3SVTA 2DT5A 3GUYA 1OREA 3IJEB 4IZOA 3RDPA 1SIWA 3O1HB 3F1LA 1TKCA 1UT5A 4U2DA 1HYQA 4YJHA 2TRSB 2QI9C 1A95A 4KJZA 1PSZA 3RS8A 1XU9A 2HBQA 1JA1A 2NIPA 1KRHA 3LQQA 5BR7A 5I7WA 1CDDA 1V3QE 1I2CA 3H9BA 3QA9A 5IUJC 4HAXA 1IG3A 3P9RA 1IVYA 3R7FA 5LJLA 4H1HA 3GFTA 5CLGA 3SJCA 1NN0A 3SFZA 5LD2B 1WZCA 5LDHA 1M54A 3DE6X 3NONA 1KTVA 2PSDA 4ROTA 5IXYA 1ZK1A 2BFEA 1QHEA 4EB6A 1OOEA 3D6TB 3H4TA 1QPZA 2PXCA 4EFMA 2PUJA 4HNQA 1YHYA 4UMDA 3WGMA 4Q7QA 5HRAA 4LRSB 4LRTB 1MF7A 1PTJC 1MC8A 1R8YA 4FSHA 4I66A 4CKCA 4FOTA 1X8XA 1K92A 3F6EX 3MUEA 1NV9A 1YFLA 1FNBA 4RZXA 3CMCO 1D4FA 5M29A 2XWSA 4X94A 4MDYA 2XDQB 3FHCB 4UE3S 5G3YA 4X92A 2R84A 4WD3A 2Y92A 4KGVA 2CMDA 3A9RA 2C58A 3L7OA 2C5HA 2ZJZA 1AM4D 4MK4A 3B82A 3EZ7A 1EBUA 1SQ6A 2OP0A 2Q1YA 2FN4A 2C9MA 1XQ6A 3F5QA 1Z62A 5LL6P 2BGLA 4ZZ1A 3SZUA 5BT8A 3F8SA 2VTDA 1Z2AA 5TGZA 2GQ0A 4HQKA 1JAXA 1PKEA 4HLUC 5IWCA 3OU6A 5KMGA 4AKIA 1XMVA 2EF0A 4P0PB 1N6KA 4YP6A 4NJEA 3BWCA 4KK3A 2XMQA 5K8IA 1MB0A 4NY1A 5KHLB 4EY7A 1RQLA 4QDXA 3P4UA 2P2LA 4HYTA 2F43A 1QHSA 3FPJA 4DA7A 3RW9A 2FPXA 1U9CA 2EKQA 1YB7A 3ZJ5A 4M9XA 1F0KA 2DFNA 4L15A 4X6YA 2P41A 4PTYA 4RCZA 1V4NA 1MXHA 5EMLA 5HHTA 4KDEA 3QVSA 1H2XA 3EQ8A 2XNHA 3I9JA 4A10A 3I2IA 3HVIA 3WDSA 3N0TA 1TZMA 4HGNA 4EGAA 4NCXA 1VL6A 2C5GA 5JYAA 3FBTA 3U2QA 4TN1A 1MGOA 2MINB 1SIBE 1YRAA 3HCOA 3P9NA 1PE0A 3Q8WA 1XDBA 4MP6A 2H2WA 5FNVF 3CNQS 2IPOA 4JB8A 4V0NA 5K3AA 1Z4LA 4DNQA 3HV0A 1XMSA 4IKOA 3KEOA 4PO1A 3O4VA 4LNAA 5T73A 4OL0A 3GUUA 2Y77A 1A8UA 4H35A 4E6EA 2ZJ6A 1VJ5A 4PAOA 4TV8F 3LT1A 3AGQA 1A2OA 4S1NA 5IEBA 2A5YB 3UW1A 2FB9A 3GLHE 2JLRA 4V3BA 5JEDA 2I87A 4F97A 3FKSD 4RMJA 1ACMA 1PL0A 2WKWA 1NU6A 3MAAC 2JFGA 3AEQA 2JA2A 3CZ4A 3V8VA 4DEXA 4RTLA 4XJVA 1ZU5A 4H6XA 4AXBA 1PF7E 3CLSC 3TRJA 1Q21A 1OC2A 1TNDA 4AS1A 1EE9A 4MB2A 4UUNA 4WPGA 3ZCTA 1KO8A 2YQ4A 2Z8YA 2ZBRA 1ZMXA 5C1PA 2AOXA 3DOCA 2I1WA 1GAXA 1BXGB 1Z34A 3MILA 1GTVA 5JCJA 2P6PA 4W7SA 4RA9A 1NOKA 1E3MA 4O2BB 3C8HA 1P72A 1FRZA 2VJPA 2ACWA 2XW6A 4LQLA 3TS1A 7REQA 1KC3A 5CYFA 4MZXA 3Q8MA 4TS3A 2ON6A 2PYDA 3IULA 5LUAA 5K09A 1RTTA 2R7NA 1JSXA 2B0CA 3QG1A 1Z4KA 3V2GA 3FOWA 1IPFA 1SBCA 3KKQA 2QAGC 4ERNA 4HRXA 1H3EA 1MIOA 4TWIA 1USKA 4ENSA 3CRNA 5GGXA 4QOEA 5A3RA 2R5FA 2RARA 4TTTS 1KYVA 1HOXA 2Q4BA 1KETA 3B6ZA 3F3KA 3ND8A 5E8JA 4HG2A 1R0WA 3D4PA 2BDTA 2AMJA 2WTAA 2WJWA 4RM3A 3FI0A 4FQ7A 4WIAA 5KDDA 1HDIA 1FEZA 3LRXA 4ZCPA 3ZVMA 3F7NA 5TC4A 4I9HA 3QP9A 3UB4A 4NNJA 2IV2X 3GLQA 4Z7QB 1DAHA 1JHDA 2JRLA 2PVSA 3H5AA 3PQDA 2JEOA 4NATA 3LO8A 3PXCX 1OSNA 1SCUA 4KW7A 2JVJA 5C46F 4NCHA 1HDGO 3Q9NA 3KKPA 3C48A 1TGVA 3B1JA 1NBHA 3STHA 2GILA 4RGBA 4YP5A 3M4YA 4AJPA 1W8DA 3RUDA 3A36A 3DBHA 4GXQA 4H0CA 4LC0A 2CXXA 1QTIA 1V3VA 5LQDA 1ONPA 2GF2A 2NLOA 1QSGA 3AF1A 4KWHA 4BO8A 2XCSB 3GVIA 3ZNPA 3W8RA 2QMHA 4AJEA 3BHJA 4Q03A 2ILVA 5T3UA 5HIAA 2V7GA 3JQ9C 2PGLA 3HU2A 1NT4A 2W43A 1B93A 3RLIA 1DV2A 2ZB4A 4D9JA 3AF4A 5BV7A 3A1NA 4R8KA 3GVHA 4ND6A 2POCA 1RM5A 1B0ZA 2HSJA 3LX6A 5K6RA 5AK6A 5A6VA 3BKWA 4AY2A 2RGDA 1DJNA 5IW8A 2VQ3A 2ETXA 1JVBA 2C94A 1A9XB 1V37A 4I50F 2YFHA 4KREA 1S6YA 1E3WA 4F71A 4DL9A 1MQAA 1Z15A 3OPVA 4QO8A 3TAHA 3GT3A 4DLAA 3I05A 3ODPA 5ERYA 5AXCA 2P6NA 4F4CA 4ESHA 3EG5A 1UZAA 2GN2A 3DKKA 1LX6A 2V7QA 1MVLA 4PSUA 3KSDO 4CT5A 1KVUA 2DBRA 2XUIA 3T3EA 5B2EA 1VDZA 1ZITA 3BERA 3CNHA 3BE8A 4ILEA 1WUHS 2R751 2I80A 4QEKA 1DDOA 3G17A 4KBYA 4NFSA 3KVNA 3RF6A 3T4XA 3DLAA 3F9IA 4PXSA 1G17A 3GFRA 4C01A 4LEIA 1LPAB 2QD3A 2V45A 1DS6A 1T2EA 4E2WA 1JLSA 3GLSA 3H3XA 1RYFA 3GT0A 1U6IA 4O89A 2REXB 3JYLA 3AETB 1WLYA 3M82A 1FFHA 1NRIA 3C16C 3LUBA 5HA5A 1SOWA 2XDQA 4RQTA 4L8GA 1N2OA 3R40A 2FSPA 1LC3A 1X15A 3M3HA 1C0EA 4J90A 4GWLA 1KO1A 1LW6E 3DVAA 5KC9A 3K4PA 2Z2YA 2P9JA 4IFEA 1W4AA 2YUIA 1TUBA 2VDUE 2YV2A 4A4DA 3PNMA 2R9VA 1NV8A 2YN2A 3N5KA 1QK3A 3OUUA 5A5FA 1MMFB 3TZKA 3PEFA 3TH5A 4G41A 3THYA 2XUOA 3BJIC 2PMEA 2OV1A 3W5HA 1S1CA 2QPAA 3H5WA 1ZM4A 2XWBF 4RU1A 5BURA 4IIFA 3TR0A 2QLFA 1XAJA 1XI2A 2JDID 4IINA 4QLAA 4TTVA 4W1SA 4ZREA 2OFFA 3W77A 1G2OA 3Q6NA 1AS0A 4PGHA 2OESA 1JV2B 1Z5VA 2ORVA 3GLKA 3HWX1 4BC0A 1PJRA 4KQMA 1G5TA 1WW3A 1QYWA 1XWIA 3FYUB 3WE7A 3WZMA 4D9KA 3U44B 4E2XA 1L8LA 3RR2A 2HJ9A 5A5EA 4PIPA 4BKMA 3SVLA 4ZICA 1YTLA 3AFHA 1Z82A 3UMMA 3BIOA 2HHJA 5BRJA 2VHQA 1BDHA 3GGOA 2HF2A 3PRHA 4KP7A 4QDUA 4BWVA 1GNRA 3A2LA 1Y5LA 3B3AA 1WUJS 4TL9A 4NPAA 4R7GA 2IOYA 3IBSA 1C4KA 3LUHA 3QUBA 3F6YA 3EUEA 1C3OA 3EIXA 4HLQB 1PLKA 4YJ3A 3A58B 4LFBB 3Q3CA 4Y6GB 4ALMA 2KW5A 2NVOA 2EIXA 2QNRA 2HU2A 1G3QA 1U3CA 4D4MA 4KTVE 2ZAOA 5G4KB 1X9HA 5YASA 4DMCA 4EG1A 1RI3A 2COKA 1ENYA 4N82A 5KYUB 3V4RA 4YDRA 2QVBA 4R0MA 4ZKDA 1Q11A 3I92A 5CTJA 1RYDA 4RJTA 5I45A 2F9MA 5FHQA 1R6UA 4BWFB 4DR3B 3VH4A 1U6KA 2G17A 2C7BA 4HTFA 1DGQA 2RHWA 1H23A 3R5HA 4N39A 1DDIA 1YXMA 2HRRA 3NJRA 5E1BA 3I42A 3RHSA 1L4MA 3Q15C 1BXKA 1NXVA 4NJMA 4LZZA 3RJ9A 4BASA 3BXOA 4TLLB 4WBNB 1YOBA 4MR9A 4JYAB 3I2KA 4MGKR 1UDWA 3B6JA 4MPJA 4QDJA 2J5QA 5CAEA 1K6XA 1VL1A 3CUEF 4MUXA 5EESA 5TQJA 3W4KA 2TMDA 3VU3A 3AUTA 4N0DA 5CW1A 1U94A 4M1OA 5BMVB 3BB4A 3SLGA 1GRNA 2MJLA 3RFTA 2FUEA 1MA3A 1XZEA 3ELDA 4N0PA 2I5PO 3V7UA 3FTFA 1E9EA 3W5AA 2DQSA 3FWHA 3KZ1E 3PR1A 4ZO6A 4OX9Y 2QRMA 3IUBA 4LHEA 4ES6A 1RLMA 2BKLA 4Z9YA 1Y82A 4IKEA 1Z07A 4L4UA 3DUFA 1Y5IA 2DF8A 1X7WB 4NBLA 4NQRA 4PONA 1R9JA 4Q3LA 3TTVA 2V7VA 2FKAA 2M32A 1E32A 2FW9A 2NUBA 1C4WA 3DM9B 3QLVA 5I51A 4JNKA 4JJZA 2UV8A 4BMPB 1WULS 3CVVA 1BX0A 5JFGA 4PG4A 2O7QA 3JYPA 1M2OB 4QBKA 3ZV6A 4E33A 5KNCD 1PYOA 1Q2UA 1ZUD1 3D3EA 2WJYA 3P20A 4ALNA 1E7MA 1GEGA 1SN7A 2G77B 3MBKA 4ED9A 4EGQA 2OGUA 3OJWA 3N2EA 1L4FA 3NUGA 4ND8B 1Z18A 1Z36A 4U6SA 1XCOA 2OD2A 3SN6A 1SXJB 1MPXA 3R0ZA 3G9QA 5EN4A 4J29A 5IK2A 3GUHA 3HVJA 3C1OA 4GKKB 1NLZA 3MAJA 1JEYA 1JS1X 3GXBA 3VC3A 3ZV5A 4EKIA 1J25A 2JLWA 2Q3MA 1UC9A 3C3CA 4YP0A 4EA7A 3W2TA 5JWOA 3KJGA 2ZU0C 2XXAA 1NVEA 3KYCB 3EULA 3LOQA 3IUQA 2PL1A 3F67A 2IOHA 3RD5A 2JLVA 1KZ7B 1E98A 1JWBB 3LVRE 4B17A 1RDFA 2XOXA 1UM8A 3MTJA 2QJRA 2VBIA 4BQQA 1CFJA 1D2CA 1I4OA 3SNKA 1GZSA 1SG0A 1EP9A 1O9HA 1TF7A 2HV8A 1SBTA 1TZCA 2ISCA 2BBSA 2KI5A 2WHXA 3MNFA 4JU8A 4UW9A 5CNMA 3RSQA 4YJ2A 1EFHA 3M6LA 5U4XA 3ZWDA 4B34A 1W2HA 1ODSA 1FTSA 1Q0LA 1IY0A 5TPWB 1HDYA 1QLJA 2IZOA 5JAIA 4DIDA 1ILEA 2C7OA 3CPSA 3BWDD 1BRMA 2G28A 4GT1A 5CH3A 4DBLC 4NU8X 3LW7A 4GZLA 3SQNA 3C70A 3NATA 4GP9A 1QIFA 1A9QA 3U80A 3OLZA 3D2BA 3IIJA 2DE0X 2ZLBA 1VPVA 2PBRA 3GIDA 1IXYA 4C5AA 4DBLE 3FVTA 4ZT7A 5IAKA 4B33A 3GDHA 3ZYCA 1NRWA 2JIRA 3EDCA 3LY9A 4B3TB 5I5EA 4NOLA 1N5IA 3MLAA 3BMQB 3QUCA 3WZLA 2ZZMA 1A5BB 2AQHA 3NHLA 1MX1A 4NOKA 5KYGA 5KJEA 3WL8A 4PQYA 1OFHA 4A03A 4HSGA 4KO3S 5J1TB 3JAKA 3CF4G 3FDZA 1OFVA 2HOQA 3FGNA 5AHWA 4S1TA 4X8LA 2O2YA 2VYVD 3SEFA 1PNRA 1O8CA 2Q0XA 3DF7A 4YX9A 4OSEA 2QZSA 2FVXA 1I0IA 1U0OC 2X8BA 5DWQA 1J2TA 4FBGA 4Y1EA 3ESXA 3AR5A 6ADHA 4DV6B 1OFUA 2Z09A 3N74A 1L7RA 1X80B 3AHGA 4E09A 1KJ8A 4G85A 3ORHA 3LX8A 2BZGA 1DC6A 1KPGA 2HMUA 2IELA 4MYUA 4LTNA 3TGPA 3FYUA 4ESVA 1SXPA 4N12A 4PS1A 1Y3AA 2JVKA 4QU0A 4RSHA 1YB1A 3EMDA 4XOIA 3LQ4A 3GC6A 4ENTA 3NHMA 2RKWA 1KJZA 1A9ZA 1RLJA 2DBZA 2FPSA 2HA2A 3MTGA 3QYJA 5KREA 3O0DA 2XNKA 4TLMB 3RS2A 3OIFA 2PY6A 4DT1A 1EZ1A 5DM1A 4LDPA 1KEPA 3HXPA 4BN5A 2HMWA 3DZGA 4TYQA 2H7VA 4R2IA 1PD0A 2RB5A 4DC0A 3JV7A 4RE6A 3LT4A 3OCYA 4ZDIA 3EDRA 3QW2A 2OBFA 2YRXA 3AONB 3EMBA 5F7XA 2J9XB 3A4YA 4MUHA 3T99A 1KZYC 1Z8NA 2H16A 4N5MA 2AT1A 2C3YA 2PX8A 4IICA 3IMEA 2PXXA 3OIUA 3I34X 3C7TA 4JI6B 1F7UA 4RS4A 1IUNA 4BJ3A 1E0AA 1Z9BA 3K9HA 3OCCA 2H1HA 4OK5A 4B43A 4YRSA 4DM7A 3GL9A 1SVUA 1BQEA 1VSUA 3V34A 4OFBA 2IYUA 4UM8B 2HT6A 4JAVC 1FB5A 4XFKA 3H75A 3NNSA 3RARA 2FEMA 3MSCA 4WBNA 5JJIA 1AN0A 4I4LA 4INAA 3PA8A 2V8OA 1KBQA 3FF1A 3GFVA 1N0IA 2AFVA 4QIHA 1CEQA 1S02A 2JGNA 2PS9A 1R9GA 2CVZA 1I4DD 4EVRA 2V9CA 2YV4A 3OTIA 3PHIA 1EXDA 1SBIA 1PIWA 2A9QA 2D4AA 5D00A 2Z2IA 2F64A 4OIFA 5KYYB 1YASA 4II2A 1E1YA 5K3FB 1RAFA 1H8EA 5SZHB 3GYBA 3HCDA 4RLHA 2XB6A 4FCVA 5BO5A 1BS1A 3UXYA 2JIPA 1R15A 1XK7A 3NW9A 4L0MA 1CQIA 1IM2A 4E07A 5MDHA 2OAP1 4BCDA 3L84A 4ARZB 1TMOA 3D3WA 3KOUA 5IAJA 2EJVA 3GOQA 1RQXA 3JD0A 2BMWA 3QPBA 3QXHA 4D0SA 4BNDB 2K7FA 3VA7A 1VSBA 4CIVA 3O90A 4Q9NA 4XWWA 3F73A 1XEWX 3GO4A 3L7KA 1A04A 3GCWA 5L53A 1BWSA 3OWOA 5JSYA 3GRPA 3JZDA 4LISA 1PFWA 2D6FA 4HVCA 1O57A 4XYGA 1Q84A 1Y8QA 2WEKA 4ENRA 1ZH4A 3HY4A 1GCOA 2V7PA 2G25A 4YFVA 3H9GA 1JQEA 1XP8A 2AZDA 3AY6A 3PWSA 2QVXX 4K3VA 3AFGA 4B3XA 1E3JA 2VWGA 5BSHA 1A77A 5ALIA 1C3EA 2GA9A 2A9KA 3DMFA 1RQ7A 4TM7A 4XH9B 3LTEA 4D4GA 4DR2B 2G07A 2ONCA 2PUWA 2FUG1 3L7AA 4GBJA 3OTHA 4B6FA 5FOUA 1E1NA 5CCXA 1GLGA 1XPOA 3K16A 4GG1A 3KYCA 2QTHA 4MQUA 4IIUA 2YINC 3TLKA 4JI4B 4EPWA 1TD9A 2YJ4A 2RHCA 4BO5A 1V5FA 5H68A 4Z0PA 9GPBA 2VF5X 1E5XA 1YR3A 2J30A 2IV3A 3GEPA 3U7IA 3QXCA 5L3SB 2WINI 2IVZA 1V1RB 3KWJA 5BWOA 2ZAYA 2V5AA 4ZOLB 5I7SA 3EYWA 5BMOA 2YMMA 2YQ5A 3DMRA 2GBLC 4NZOA 4ZT4A 1EK6A 3CVOA 1NQXA 4I1SA 2DXIA 4RORA 2OWDA 3ENVA 1RJGA 4NV1A 4Q12A 2I6QA 2XVAA 3V2UA 1V96A 5EUQB 2HR1A 2LW7A 4ZVUA 2Q6IA 5CCDA 1Z4NA 3MJTA 2AR9A 4UTOA 2QORA 1ZWLA 2X40A 1KK0A 3R5TA 4JBHA 3RU3A 4FE4A 4FGJA 1N1DA 3JD4A 3I4FA 4P31A 4B4WA 5HKOA 1EZ4A 3OZRA 1NWHA 3L0IB 1LS6A 3BMQA 5DRYA 5EP2A 2M1XA 4UU7A 4B7CA 4OHCA 5DJ5A 5D5PA 2Z57A 4ONEA 4GMHA 4GC9A 4BMDA 2LKDA 1IK6A 3RUAA 4D8VA 3K6KA 3E5RA 5JANA 5KB3A 1DBIA 4P0QB 5IN4A 4HNAB 4OUKX 4GXTA 3IPCA 4F4HA 4PN7A 4GOMD 3A0UA 2D2EA 3FI9A 3U0BA 4BWYA 2IYVA 1Y0BA 5HE9A 4KMOA 2ZQ5A 1DOZA 1WHTA 1PJ2A 1FFWA 2Y6UA 4K6KA 3WL3A 5L3VA 2QROA 1GNQA 3LYUA 1X8LA 2E4UA 1W4RA 5K8JB 5DTEA 1KSHA 1ZSYA 2Y76A 1DU4A 1I9GA 1E3SA 3KPWA 1FFXB 4LJ4A 1MORA 1B6SA 4G5FA 3ICPA 3KHKA 2JJ2D 2OCYC 3AHDA 3HWRA 3SU8A 5DDIP 4P3XA 2GAIA 4MMXB 3FD8A 1CR2A 1Y5RA 1XLUA 1JR6A 1I3CA 5CA0A 5AVYA 2KBFA 4KRYA 4FN4A 1BDMA 2DPLA 1CUJA 3GLUA 3M81A 5IDXA 4GF5A 1SXQA 4ZAGA 4AG5A 5H3HA 1KMHA 1PVDA 3RC8A 1G21B 2HRDA 1UK8A 3IPRA 3MCZA 2O7SA 4PAWA 3RJZA 3TLAA 2QR5A 1EB8A 4E2ZA 1EAYA 2UXDB 3KQUA 5CVCA 1SCQA 3P71T 4C6TB 4U2BA 5DYGA 1UBJS 2ZSBA 3HZRA 1UFKA 3OJLA 1ADFA 3O4JA 1TO1E 4PC2A 3IVXA 4KE6A 4TTRA 5KSOA 5GJBA 4YWHA 2P2YA 1HFEL 2HWXA 1U4OA 2P40A 4PQGA 2QDXA 1N9KA 3TOZA 4BMNA 3NGLA 3FLMA 1WP4A 2FVYA 4URYR 4ZPJA 1P1IA 1U8UA 3VTZA 4F8EA 4BGDA 1HYHA 3KEGA 3QE2A 4L74A 1GOTA 1JYSA 3ADOA 3T9EA 3M3DA 2IYNA 2JGAA 3HE3A 2B69A 1XZGA 1OBVA 5K0NA 2BAGA 3HA2A 5K4AA 5REQB 3PUZA 3BMNB 5M5BA 2OHIA 3DV9A 5DM2A 1BKDR 4YQYA 4FC6A 4X3PA 2E21A 3IQEA 2XNJA 3OQ1A 4CL8A 2JGIA 5IASA 5IMBA 5KU1A 3LDFA 4I9UA 2RH4A 4ZD6A 2AXPA 2MYTA 4RLSA 5FR1A 2WD9A 2AJDA 3G5TA 4U2EA 4PTZA 1J0DA 3G8AA 1C7ZA 3JPWA 3LUJA 3TSWA 2BKXA 3CYFA 5T57A 3ZCUA 2ZROA 1RD4A 5KYYA 3V8EA 2DQZA 4GOJA 3GH1A 3Q98A 3MTIA 4NX2A 3E61A 1GV0A 1XQVA 5EMMA 5AW5A 3DPIA 5EJEA 3EFEA 3M1LA 3OEEA 2AMFA 4FR5A 3P1JA 1YE5A 5FWYB 4IMIB 2A1UB 3C24A 3ZGXA 4H7EA 3M6IA 4LV8B 4UEOA 1WZ2A 5ALSA 3F5DA 3M4NA 4ARZA 1SWWA 1ZOSA 1AQIA 3AVOA 3F97A 4FK8A 4ADSG 2HFJA 2JIMA 1RWNA 3VZSA 1GLNA 4OLHA 4BCBA 2PUTA 2YZGA 3BD9A 2AOWA 4CLRA 4DKXA 3NVDA 1K3UB 1XZLA 4MUBA 1DUSA 2XNSA 1V8OA 1ITZA 3B52X 1BWPA 4V0OA 2I22A 4XCVA 4GSYA 1PS8A 3LAWA 3CEHA 4RACA 2BM1A 4ZQIA 1JIJA 3MXOA 4RPCA 1PJZA 4AK9A 5C3MA 3DMTA 3LKDA 4GD3Q 4F3CA 2GRAA 2Z4TA 3C1UA 5BWLA 2WMOB 2YV3A 1M7HA 2GJSA 1SK9A 2DCMA 2O7RA 3PUJA 4G8CA 5AFSA 1RLOA 1G9SA 1R4NB 1GUYA 3ESDA 4H31A 3QLUA 1QGDA 4CV0A 2G6TA 2ADMA 3EEIA 4ZCSA 4CKBB 4F46A 3FVQA 2RHLA 4R1PA 2E87A 2H9AA 4GI5A 3F4KA 1TUEA 4G4SP 4KQJA 1KZ9A 4NYIR 4UXHA 1KFJB 3KO8A 4Y6QA 4JYPA 1A2KC 2E48A 2MMGA 5COQA 4B4UA 1E3EA 2PGAA 1M1YB 1SVWA 1OX4B 3L8MA 4PNPA 3QXXA 1CG6A 3JAWB 4AN0A 2O5CA 4Z9BA 3MCVA 1H2YA