3BTUA

Crystal structure of the super-repressor mutant of gal80p from saccharomyces cerevisiae; gal80(s2) [e351k]
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
420
structure length
392
Chain Sequence
b'APIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRKEIMKVYHLRNYNAIVGNIHRLYQSISDFHFNTSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 121
structure length 392
sequence length 420
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btuA01
3ICPA 3WG9A 3FPLA 3E18A 3I23A 1ISMA 3FF4A 1T2DA 1KVRA 4AFNA 5JY6A 1FDWA 1I2ZA 1EZ4A 4R16A 5G0TA 1E7MA 1YQXA 1PQUA 2VYNA 1V3VA 2ZCUA 2O48X 2P9GA 4ZHSA 2G1UA 4FJ0A 1P1HA 3JQEA 4BNWA 3DBLB 4OO3A 1BW9A 3I9LA 3EK2A 1LBEA 3GH3A 3PWZA 4QXMA 3TJRA 4D43A 1O6ZA 1DC3A 1I3MA 1W0CA 4D41A 4CMIA 5HBRA 1E5LA 3L9WA 2EHDA 2HMWA 3TL2A 1NQTA 2X5JO 4DXHA 2I3GA 3OEWA 4ZN6A 2BELA 4GGOA 4QQRA 3KSDO 1YKFA 3FR8A 3L6EA 4BNHA 2NADA 3EZLA 4JK3A 2Q1TA 1GU7A 1A72A 2DVMA 4F3YA 4II2A 4R5MA 5TS3A 3UW3A 2JHFA 3PP8A 2JD2A 2J5RA 4ZJUA 1M67A 3I52A 2OOSA 3IIEA 4EEXA 2A35A 1T2EA 4GVXA 4I9UA 3HDQA 8ADHA 2BI7A 1YBAA 2Q1SA 5JE8A 1O9BA 4ZQFA 1A71A 4CJXA 1WAMA 4B3JA 2QQ5A 3LF2A 1GQ2A 4J6FA 4NH4A 5B4VA 1CRWG 3RC1A 1DHRA 3B6ZA 4D42A 3BIOA 4H16A 4BO5A 4W6ZA 3TDKA 1EUCA 4CQMA 3DO5A 4KUHA 4H15A 5BNIA 1JN0A 4CODB 4D79A 4FQ8A 2EKPA 3PWKA 1W4ZA 5CP8A 4Y67A 1C0LA 1Y1PA 2O2YA 3DXFA 1EFLA 3ETDA 3JQ7A 4GX0A 5JW6A 3RKUA 2B36A 2HJSA 5KNLA 3Q1LA 4WCFA 4CMCA 2AEJA 5BNFA 3S2FA 2VRCA 4EUHA 4RPLA 3WDSA 3H3JA 1IYZA 4BQPA 5CPBA 3UAGA 4UEKA 1VRWA 4XEHA 3TF5A 4MKXA 5GZ6A 3SBOA 5DP1A 1DRUA 4CM6A 4R68A 2YW9A 4UEJA 3RC7A 1ZMTA 4FFOA 2CMDA 3PDJA 5GY7A 5KVSA 1Z7BA 1KVQA 5C37A 1JVSA 4OKIA 4YRDA 3KB6A 5TLSA 4R1SA 4WLNA 3E48A 3ADPA 1DJNA 4J1TA 3VVCA 4ND4A 3INRA 3U4DA 1EVJA 4IZIA 1LSJA 4GVLA 1X15A 5ICSA 1KERA 1GUYA 4GMGA 5KWEA 2BFMA 4Y8VA 3QWFA 3CPSA 5AYVA 3JQAD 4WOJA 5L53A 3AWDA 2PFGA 2BFPA 4OH1A 4E3ZA 5BSHA 1U3TA 3EMKA 2B37A 4YJDA 5BSEA 1XU9A 4WCFC 3O8QA 1QXSA 1ZK2A 4A7PA 3EHEA 3HZZA 3BXXA 5KVVA 1Y81A 1OC2A 4IXWA 4Z6KA 1C0PA 5KCZA 4TWRA 4WECA 4NZ9A 1NWCA 4RF2A 5ENVA 1IHXA 4FOOA 4NR0A 4RGBA 4DIFA 2EW8A 1TT7A 2W98A 4J91A 3PZRA 4Z0PA 4BNKA 1XEAA 4CM9D 3H7AA 3EUWA 5F5LA 1NM5A 1M2WA 1MG0A 1I3KA 4ZICA 4N7RA 1XU7A 4DLLA 4JIGA 3BMCA 1UZMA 5KVQA 3BMQB 3W8EA 3Q2IA 1VM6A 5KKCA 4LGVA 2GPTA 3RSHA 3QHAA 4FFNA 4BHTA 3AI2A 3GEMA 1VPDA 1ZW1A 2WMDA 4PLCA 4DIOA 2YQ5A 4EUFA 4IS3A 2VOEA 2QZ9A 4QSMA 3PDUA 1A4UA 1X0VA 4RF5A 1HZZA 1MC5A 3FBGA 2J5QA 4JBIA 2PGJA 2WSBA 2POQX 2HLPA 2AW5A 3LK7A 4PLVA 4HUJA 1FDSA 3K2BA 4ONEA 3DBRA 3T4XA 5H81A 3DMTA 3PHIA 3VH1A 4FC7A 4YB8A 1ADBA 4LW8A 3VPXA 4Z3DA 3GVIA 3U9LA 3DTYA 5ES3A 1VJTA 4J0FA 3ZW8A 4BGIA 3OF2A 1M76A 3D4NA 4J3FA 2VHYA 3PEFA 4JROA 1KEVA 4D3FA 1OOEA 4RV9A 2YDXA 5L95A 3MJVA 3TL3A 2D4AA 3ZWWA 2UAGA 4KMSA 4MIOA 2LDBA 3WR5A 3E9QA 3WX0A 3HNPA 1PEDA 3I4FA 3HUDA 4ZQBA 4UUNA 1X7HA 4YVFA 1OI7A 1GL3A 2EP5A 1PL6A 1JLLA 2Q2VA 1S7CA 4CM8B 1DC4A 1Y9AA 4AJIA 2QIOA 3OBBA 1J49A 4CMIB 5ILOA 5JYFA 3C1AA 1PGPA 4DYVA 1EE9A 3ZNOA 3RUIA 2WWRA 3H9JA 1YXMA 2X5KO 2OORA 4ROSA 4AJ4A 1GFSA 4GSKA 3DMTC 1C1DB 2CZCA 1BDMA 4TRNA 3H9QA 2WD8A 3DHYA 2D2IA 1ISIA 4FN4A 3RFTA 3L07A 3SX2A 3IL2A 1AN9A 4HV4A 1E1KA 2IEDA 2YDYA 5KJFA 4E5YA 4WE3A 1FDVA 3C8MA 2BFAA 2OP1A 5TX7A 1OFGA 1M6HA 2JHGA 1HYGA 1I36A 3KV3O 1UDBA 3T7CA 4RDHA 2OMEA 4YJGB 3WOHA 2RH4A 4O1MA 4M1QA 3VPFA 1JKFA 2J5KA 5JYEA 3K2EA 1YL6A 1LDGA 1B14A 1IOLA 4QT0A 4KTTE 4P4GA 4CQMB 4W9NA 3PHLA 1M75A 5COQA 4J2OA 4CMAA 3CE6A 4FJ2A 2GZ2A 2RHRA 3MJCA 4WLEA 1MV8A 3QJ5A 3S8MA 3TRIA 4WCFB 4FC6A 1K3TA 3V8BA 3D64A 4AJ2A 2ZB7A 3O26A 1VKNA 3A1NA 4R1UA 5A5EA 3DFUA 4XIYA 4IS2A 4RF4A 2D1YA 1K6IA 1NFRA 1HE3A 4LSMA 1I01A 2PR2A 1N9GB 4I1IA 2AE2A 1M6WA 3SVTA 2ZTLA 2IEBA 3ANNA 3INGA 2QRJA 2BKAA 5DN9A 5IDQA 1HLPA 2RAFA 3WMWA 1LDYA 3ZWVA 4PZEA 3I9MA 3I9KA 4GSLA 5TQVA 3COSA 4WLFA 3PJGA 1YGYA 2DQ4A 4GWGA 1ZUD1 3P19A 1PJBA 3PLRA 1GDHA 3TFQA 4PLFA 3FNGA 4NIMA 3TSCA 3OMLA 4YR9A 4W9NC 5JAMA 1GYRA 1L1FA 1LJ8A 4Y9DA 3LDHA 3U3XA 3E6AA 2UUPA 4XYMA 1JVBA 3PYMA 4EJ0A 5A9SA 3TZQA 2V6GA 1NPDA 4D46A 5JPIA 2JJYA 3MEQA 3M6IA 3WGIA 4NG5A 2HKIA 3LC2O 5CHEA 3E5RA 1BXZA 4OHUA 1GPDG 2C54A 2NM0A 1E7WA 1V35A 4KWIA 1JQBA 2BMAA 1V8BA 2C7GA 3CMMA 1A27A 2HMUA 1ZO8A 3DDNA 4MO2A 3QSGA 4D7AA 1XDWA 2X9NA 5IFLA 2Y1EA 3H2ZA 3NAQA 5THQA 3NT5A 3A9WA 5CDSA 3WB9A 4OJNA 2C5AA 2Q50A 4A73A 4R9RA 2E82A 3D1LA 3WSWA 3MCVA 3PHJA 1ZK1A 4E21A 3ETEA 5IDYA 1E3LA 3SXPA 1LC3A 3D5TA 2ZYGA 4PFJA 4PG7A 3VKVA 2GD1O 4EDFA 3FHLA 5IZCC 4JJFA 4XYEA 3H5RA 2NQTA 3AK4A 4GQAA 3IUSA 2HAEA 1CIVA 3KEQA 4BUCA 4KQXA 2X22A 4KZPA 2EGGA 2X5OA 4O6VA 1N2SA 3G1UA 4RDIA 3GFBA 3WIEA 1YL5A 5A06A 2HDHA 2W90A 1Q2XA 1ZBQA 5L9AA 1PTJA 4PLWA 5EL0A 4BO7A 4DLAA 4F46A 2EF1A 3F1LA 1PIWA 4Z3KA 5KKAA 4MOWA 3ONDA 1QORA 4I9HA 4J1SA 4ALJA 5A3JA 1DBVO 4R41A 2VUUA 4NFHA 1IY8A 1TLTA 1PJ3A 1T25A 2O3SA 1U7TA 3AW9A 4TRRA 4Y98A 2OXIA 3SJUA 3RIHA 4JXKA 1ZH8A 1LLUA 3DQPA 1U28A 5IJZA 2BLLA 5AXDA 2GN8A 1F17A 1EVYA 4WCDA 5JCJD 4MVJF 1Y8RB 2B83A 3LVFO 4NMHA 2G82A 2OZPA 2GDZA 2X4GA 2PLAA 2XOXA 2HUNA 1ZFNA 1D8AA 4KQWA 4OOEA 3W4IA 1B16A 1SCUA 1BRMA 2YQ4A 2J6IA 1R0SA 4ZGWA 4A03A 1QR6A 4YACA 1FDTA 2YFQA 4NK5A 3MTGA 3PGJA 2P5UA 4WEQA 2DTEA 2HMTA 3F46A 3F4BA 4XJTA 4XX0A 4M86A 4GX2A 3WTBA 1Y5RA 1H6DA 2ZTUA 1DO8A 2CFCA 1KY5A 3CIFA 4A0SA 3N74A 1YBMA 3ENKA 3PRJA 3RUCA 4R54A 4D3SA 3ENNA 3WWZA 5JO0A 3NV9A 4YAGA 1ZK0A 4XGNA 4Z9FA 4XQGA 1HDCA 3HHPA 2NUAA 1BG6A 3WQQA 4EW6A 3B1FA 4Y6SA 3OP4A 2GN9A 4OSOA 3C7AA 1ENOA 1YL7A 4LN1A 1PS8A 3QV1A 4AJ1A 3EW7A 3BTVA 4FFPA 2NQ8A 4N5LA 4WEOA 3QIVA 2W4QA 3A14A 4CV3A 2E37A 3IC5A 1MXFA 1MB4A 4FOSA 5BT9A 3B70A 2PY6A 3DAFA 2A92A 1HL3A 4MVJH 2GCGA 4E2XA 2D0IA 4ILKA 3SLGA 2PZLA 2GUGA 3M1LA 2IXBA 1YB5A 2XXJA 1YB1A 3ZU3A 1E6UA 1SEPA 5B4UA 3VVBA 3KLMX 1QMGA 3KVOA 4FR5A 5EN4A 5A4DA 4XQCA 2AG8A 2P9CA 4XB1A 3FI9A 4WKGA 3JQDA 2J3JA 3EYWA 4BQRA 1G0OA 2O2SA 2C0CA 4PLGA 3GHHA 1ZJYA 3GLQA 4MVJG 3HE3A 3I5MA 1E1NA 1EEHA 2NSDA 2Q99A 4HNGA 1PZGA 4AL4A 1VSUA 2ZB8A 2WYVA 2R6JA 4EUEA 5B37A 4XQ9A 1HE2A 5F1PA 5I9MA 5CEEA 4FSHA 4O59O 4YRAA 2NLOA 5TC4A 3BHIA 3H4VA 2VT3A 4K28A 1YDWA 5G0UA 1UJMA 1QSGA 1ID1A 2HQ1A 4RPHA 1NPYA 4OYRA 2ILTA 3W1VA 3P2OA 4J4HA 2NV6A 4OSPA 2NU6A 1YRLA 1TXGA 4CL8A 3BAZA 1N1EA 4R1NA 5IZ4A 1DDOA 1S6YA 2RBEA 1YH3A 2ZJ0A 4BGEA 5CAEA 2IYOA 4CLOB 1QLJA 2VWQA 2X0JA 4IUYA 3G79A 3GUYA 1BWSA 2VWGA 4XYGA 3CZMA 3MTJA 4NPCA 1I5RA 2DC1A 2X8LA 2Z95A 4L0QA 3E9MA 1QYCA 3PFFA 5CEJA 3INTA 2UVDA 1CETA 5C5IA 3ANMA 3JYLA 1NHGA 3D4PA 4G65A 3JD0A 1WPQA 1GYQA 2AHRA 1UUFA 3IP3A 5AXCA 4YT2A 1ONOA 2ET6A 1ZNQO 3OFSA 6ADHA 5TNXA 1UDAA 2DBVO 1AHIA 2O50A 3KO8A 1PJTA 4MVJE 4I08A 2VYVD 4D0SA 2LDXA 5A9TA 5I8ZA 3UH1A 3F1KA 2NVBA 3GNTA 5U1PA 2X9GA 1E7QA 1A5ZA 4JP3A 3LT2A 3DZHA 3QW2A 2Q1WA 2UUOA 3AJRA 5GZ3A 4YEDA 2X0RA 1V0JA 3LLSA 1EK5A 2X0IA 2RHCA 4HADA 3MOGA 2VQ3A 3ZU2A 3ZWNA 2EKLA 5I7VA 5IN5A 2JCXA 3KBOA 1CEQA 4MVJP 5EMHA 3BZUA 3PHGA 4BNXA 1QYWA 3DAGA 1CQJA 2C20A 1NYTA 3PYXA 2GGSA 1I32A 1PGOA 4EJ6A 3HB5X 3OA2A 4PG8A 1PJQA 4DMMA 5J9GA 1PJ4A 4ZVVA 3VH4A 4WNCA 2EKQA 4RORA 1WDMA 2FPIA 4L4SA 3AM3A 3C7DB 4JQCA 1EDZA 3ITDA 4PN3A 4Y6RA 2NACA 4HNHA 4TVOA 1X13A 1AGNA 3NGLA 3CXRA 3FPCA 1Q0HA 1E3JA 1JU9A 1FMCA 4UVDA 1SOVA 2GO1A 3H9GA 3DHNA 1B8VA 1E92A 3ZZNA 2GF2A 1YQDA 1JWBB 3KEOA 1PQWA 1KS9A 1ADFA 1AHHA 2O4CA 4JLWA 4DQUA 1Z7EA 3DHEA 3FSRA 4I8XA 3ZWBA 1O0SA 3G1TA 1EBFA 1RYEA 3EZYA 4CQLB 4J43A 4CM8A 1JAXA 1WP4A 4BV9A 1ORRA 4CR6A 2XXBA 5DCWA 5L4NA 2B69A 1R12A 4PLTA 3KZVA 1GQQA 1CQIA 1PJLA 1GD1O 1RWBA 4GKVA 3ON5A 4RPGA 4RF3A 4ALIA 3GRKA 2WM3A 1C1DA 4HFNA 4RLSA 5C7OO 5T67A 4JX8A 3K92A 2Y1CA 2CSUA 4BKRA 3VH3A 1R4MB 4R01A 2AQIA 1X14A 4BNGA 3PZBA 2ZB3A 2FHSA 4PVCA 5L51A 3HDJA 4Z9XA 1QYVA 2NVUA 2JCVA 3PJEA 4J7CA 1P1IA 3PQFA 3PJFA 2OBYA 4Q9NA 5DCUA 5G4LA 2BD0A 1ZEJA 3M1AA 3JQFC 1DOHA 3Q3CA 3ZWCA 2PD3A 3NRCA 4JBGA 4O63O 3WBFA 2AXQA 4YBZA 1LNQA 4FB5A 4YJGA 1C14A 5JAQA 3WGTA 3CINA 1XGKA 2EG9A 2G0TA 3X2EA 4CM4B 1NXQA 1WDLA 3IOYA 5TT1A 1EFKA 1HLDA 1ULSA 1UXIA 3LT4A 5TF4A 4P4NA 1ISJA 4BNNA 1H6AA 1O94A 4PLHA 1ML3A 4PG4A 3F9IA 3AUSA 5ICMA 4N5NA 1LSSA 2BHLA 1XA0A 4E5PA 4UUPA 5ENDA 2WEKA 4B3IA 3QE3A 3CEAA 2P68A 2FR1A 3ZHXA 2CF5A 1ZSYA 5CFZA 3DZIA 3RQSA 5HWSA 4PLPA 5A04A 2WJPA 3DZJA 4ZQGA 4YT4A 3H5NA 1N9GA 4EYEA 4U6QA 1DLIA 3RKRA 1H6BA 4E12A 4W7IA 4PCVA 4CLHA 4BMSA 3O03A 1PS9A 3CSDA 4JNKA 2OFPA 1NASA 1GZ3A 4ALKA 2VHWA 1K6JA 1AXEA 4D3DA 3KSZO 3RROA 1DFHA 2Y68A 3EGOA 4WGGA 3DBVO 1NFFA 5EJ2A 5DNAA 3ZV3A 1K5HA 3LQFA 2O3RA 1QV6A 3WQSB 1P1RA 2PZKA 3ZNQA 1UR5A 1P1FA 1VJ0A 4YRBA 4QECA 4BO9A 3BTSA 4CMEC 1E7SA 4XKJA 3DB2A 4OKNA 5TJ9A 2QYTA 4XR4A 2JKVA 3DWFA 3H6KA 2XPCA 3WNVA 4M54A 3ANLA 5A03A 4RCVA 4XJSA 3RAJA 2A94A 2VHVA 5A05A 3RU7A 1O95A 3B20A 1VC2A 5M6DA 3V1TC 3I9NA 3WIDA 4CPDA 5JMPA 2ZB4A 1P0FA 3LLVA 3U49A 3EVNA 2O7SA 4R1TA 1PL7A 1FXSA 4RO0A 2QG4A 4LVCA 1UDCA 1ZVMA 1F8FA 4B8ZA 2V65A 3JQAA 2HO5A 2O3JA 1JKJA 1KVSA 2B4RO 2FPGA 2GSDA 3WBBA 1IPEA 3OH8A 4B4VA 1ZK3A 5EQDA 1DC6A 1MUUA 3PI7A 2X58A 2H63A 3ASUA 4YJFB 4IJWA 4E2YA 2VZ8A 2YY7A 2Q49A 1J0XO 3ZN2A 3UVEA 3WGGA 5CG1A 3ZHBA 5JNLA 1Z6ZA 1T2FA 4AICA 1PZFA 5A5FA 2CVOA 2NNLD 4CM9A 4IMRA 4A5OA 1ZZEA 3ADOA 1DIRA 2YUTA 1Y9EA 5GMOA 1U5CA 3LYLA 3TZKA 3OIGA 4GMFA 2I5PO 4MP3A 2Y67A 5AXAA 2BFOA 1U8FO 1IB6A 3GC6A 4GKBA 5TRTA 5B1YA 4LRTB 2PKQO 4BMNA 3BMNB 2C5EA 4IM7A 2NWQA 4U7WA 3O4RA 1SAYA 2VRBA 3FR7A 4YA6A 4L73A 3AUUA 2ZYAA 2HRBA 3I6QA 1EE2A 2A4KA 5KTKA 3ABIA 1EVZA 1H94A 1ADGA 2C07A 5LDHA 3DFZA 3U09A 1TA4A 1PS0A 3NUGA 4HX5A 4UAGA 1XQ6A 3JTMA 4R3NA 1V3TA 1HDZA 4ZQEA 3JYPA 2Q2WA 3OSUA 5I7EA 3MOIA 2V6FA 3GHYA 5ADHA 1Y8RA 2DBZA 3GGPA 1E77A 1ISHA 4IJVA 3U4CA 3QVWA 2ZTMA 2B0JA 1E7YA 2B4TO 4XB2A 4CLRB 2OO5A 1SEVA 4JJIA 3KUXA 1VL8A 4NJOA 1Y5MA 3GNSA 2DFDA 4S3MA 5TIIA 4LVUA 4JN6B 4QTZA 2DUWA 4RZHA 4QFDA 4FFLA 2O3TA 2I9PA 4URFA 4CLXA 1R0LA 1N1GA 4NU6A 2HK8A 5T64A 2NVUB 1N92A 3NT2A 1CYDA 3RC9A 3GT0A 2H5LA 2PKQP 3UGKA 4AJEA 3KYCA 2IZ1A 1ARZA 3HFGA 1I3NA 2VN8A 1XCBA 3CH6A 4MJLA 2QRLA 4PZCA 4AJJA 5CG2A 5KVCA 5MDHA 1RPNA 4IIVA 3GPDG 1P1JA 5DP2A 4PRKA 3IJPA 4KOAA 3FNFA 1LLQA 1PL8A 4LSWA 4YT5A 1DRVA 3JD1A 1LDMA 4NQZA 4ZQHA 3ZWXA 3R3SA 7MDHA 1E1MA 2ZATA 4BB5A 3STHA 1E3IA 2FOIA 3A28A 4BB6A 2V6BA 3PPIA 1H9AA 1C0KA 1WMAA 2F1KA 3PIIA 3ZWPA 3JQ9C 1IZ0A 1YQGA 3E8XA 3GEDA 3VPGA 4AJNA 2X23A 5K9ZA 3DR3A 1T4BA 3RJ5A 1JA9A 4CMKA 4PVDA 3NJ8A 2HJRA 2Q1UA 1R15A 5F21A 3WYEA 2GRAA 2X86A 3ONEA 4XDZA 3VDRA 4DTIA 4CUZA 4JBHA 2FMUA 1X7DA 2HCTA 4F45A 1FDUA 1ZMOA 4IJUA 4AJOA 1BGVA 1HT0A 5C7LO 1SZJG 4FCCA 1P33A 2YV2A 5H83A 3VTZA 4A27A 5DULA 4OQZA 4K1LA 1KOLA 1L7EA 4BL5A 5A1TA 1QLHA 2VUSA 1Q1NA 4FFRA 2GZ3A 4HFJA 4Q3BA 3C3XA 4I5DA 3DAPA 3Q2KA 4CMBA 2W2LD 3FN4A 3Q0EA 1NP3A 4FD3A 4MINA 1EMDA 1YJ8A 4KDEA 4OM8A 2FSSA 3WQRA 3WGHA 4MVJI 1ZKMA 4JP2A 4L8VA 3F3SA 1C0IA 4GWKA 2JCYA 2Q22A 3U5TA 4IDFA 5FYDA 4DVJA 3U0BA 2H1SA 3W4JA 3ASVA 1W6UA 2DT5A 1ZCJA 5IZCA 1K6XA 1GTMA 5IXSA 1YWGO 2Y1DA 1UP4A 4UVGA 2AG5A 2Y93A 4ND5A 3RI3A 5T57A 3ZWMA 4BO8A 5L4LA 2EEZA 3E1KA 3RBZA 2CDAA 3GDFA 4GAEA 3L6OO 1R4NA 2Y1FA 3RVDA 2RIRA 1FF9A 2PWZA 3F47A 5TT0A 4A26A 4OL9A 4OMUA 3JD3A 5JXWA 2FPPA 1HDXA 3T4EA 5HTOA 1HETA 4BNYA 3HFSA 3GAFA 4NBTA 3RU9A 3QWHA 3DZKA 4HXYA 5BSFA 1I2CA 4XRGA 4LCEA 4IDCA 2IDZA 1D1TA 1VL6A 2Q45A 3FWNA 4OXKA 5AOVA 4GLLA 4RVGA 3JQAB 5HS6A 3H2SA 3NYWA 4J9UE 5CDYA 3G17A 4CLOA 1MLDA 1YO6A 1F0YA 3VZQA 4D44A 1JWAB 4F6LA 3CTMA 3F5QA 1UXKA 1IE3A 1N5DA 1A9ZA 3SC4A 3FNHA 2P9EA 4RLHA 5CDTA 3QVXA 3C85A 5K6AA 4DIBA 1I3LA 3AY3A 3I4CA 2P4QA 3RBXA 4LCJA 4ESOA 2H6EA 1BHSA 1LRKA 3CZRA 2P2SA 3TZHA 1ZIDA 4K6CA 4D0RA 3OQ1A 4S1VA 1U3UA 1KIFA 3OICA 1XLTA 3ORFA 3WJAA 3VDQA 1P1KA 3C1TA 4C7KA 4E6PA 1NBOA 2NTNA 1QYXA 4TKMA 5ITWA 1GUFA 4KP7A 4XWYA 4K26A 4C4OA 2WYWA 1Q7BA 1RM0A 4IDGA 3NT4A 1GV0A 4BO2A 4BNMA 1B0AA 1PGNA 4CMHA 5DDIP 4M49A 2PK3A 1CJCA 3K9QO 1DAPA 3G0OA 4MVJD 4Q3NA 5IF3A 3QVSA 4YYZA 2O4UX 5FEUA 3ZV4A 2CUKA 4M89A 4NJMA 1XWFA 2EJVA 3S2GA 3K8ZA 2HRZA 1UZNA 1I8TA 4Y6PA 2NU8A 5K6AC 5FF9A 2I6TA 4I5GA 2FR0A 5JAIA 4PZDA 1H9BA 3ZWOA 4HWKA 5IDXA 3K31A 5A9RA 2UDPA 3AI1A 3NX4A 1J5PA 4R3WA 3VPSA 1QG6A 1UAGA 3PYLA 4UREA 5ER9A 2JFFA 4BS9A 3D5QA 3GY0A 5JDCC 4E31A 1T1RA 1BDBA 1VKOA 4J7XA 4O0LA 4E5KA 3V2UA 1LQTA 2D5AA 5A3VA 1W8DA 4IDDA 3DOOA 3FCOA 3KLPX 5JCJA 5FWNA 4UEOA 2FSVA 5BR7A 3KYCB 4DRYA 1U2DA 5DBIA 2OUIA 4BMVA 3ROMA 1HYEA 1T1SA 1UP7A 2D59A 2IZZA 2OL4A 4UULA 2AMFA 5DBFA 5T73A 3F6YA 2J8ZA 3KTDA 3UUWA 2Y05A 2F00A 1UZLA 2VZ0A 3RUAA 3AU9A 4EI2A 5L45A 4INAA 5I9NA 4CQLA 4YAEA 1HDYA 2XAAA 4PG6A 3RUEA 2IZ0A 1R0KA 1AE1A 4J49A 3KRTA 2E4AA 4DLBA 3QVTA 3DONA 1BXGA 1DIAA 1BSVA 3VZRA 4KTVE 4LRSB 1DAOA 3NJ4A 3H5AA 1F14A 4L9RA 3JQ8B 3TZCA 3N58A 4XR9A 3IUPA 1K89A 5DBGA 3UFXA 2P4HX 2Q46A 3Q6IA 1WVGA 1B8UA 4LMPA 5FI3A 1R4MA 4TSKA 1TB4A 4XD2A 1WNTA 2AA3A 2WD7B 3D7LA 1Y6JA 1FK8A 2BI8A 1JW9B 3GVPA 1HE4A 3AUAA 1NQ5A 4TQGA 4RZIA 2Q4BA 1LTHR 2SCUA 3GZNA 4JCOA 4EITA 3JQGA 4L74A 2VZ9A 4FBGA 1VJ1A 2JAPA 1F12A 1KVTA 5JC8A 2Y0DA 1R66A 3GQVA 4Z0HO 3C7CB 5DOVA 3TWOA 4P38A 4JJGA 4CM4A 3ETGA 4E33A 5EESA 3ZWAA 2Q2QA 3GGGA 5JC1A 1N7HA 2DTXA 4PLZA 4GL4A 3TOXA 2YJZA 3LC7O 2G5CA 1ADCA 3OIDA 4YWJA 4ITUA 4U5QA 1LQUA 5EPOA 1R4NB 1NVGA 1B8PA 3OA0A 4ZD6A 5L7WA 3GDOA 4J4BA 1HYHA 2P5YA 1GCOA 3U4IA 4W4TA 3ZV5A 4BO3A 3W8DA 4NBRA 3UXYA 3PK0A 3R6DA 4KWHA 3DEYX 3ZHYA 3I3OA 1ISGA 5IG2A 2X0NA 4BNFA 1Z75A 1LX6A 1NQAO 3MZ0A 1R6DA 1IL0A 2I76A 3WLFA 4WUVA 1DSSG 3L4BC 3RFXA 4YAKA 4TZKA 2EWMA 3AU8A 3GAZA 5BQFA 4P22A 4RVSA 5GZ1A 3QP9A 3FRJA 4YAJA 4TROA 1T4DA 1R16A 5LCXA 4K9DA 4OXNA 3F4LA 3IJRA 4A10A 2CDBA 3AFNA 1BTOA 2Z1NA 3O9ZA 1BXKA 3PIDA 4PLYA 2PNFA 2EJWA 3KSUA 2AQKA 1DLJA 1YS4A 1UP6A 3X2FA 1E1LA 3S1LA 1JKIA 3BMOA 4Z9YA 3RD5A 4J90A 5I7SA 5JYDA 4WOKA 4HBGA 1PJCA 2B5WA 4TKLA 5G2OA 4R5HA 2EP7A 4AJKA 1OBFO 4BGUA 5K0ZA 2PH5A 4AJLA 1EDOA 4WJZA 1ZSVA 4XRRA 5CEFA 1KY4A 3GVCA 1MG5A 1GUZA 4IZHA 4FS3A 3ZH2A 1TT5B 2GYYA 2DM6A 2D3TA 5JO9A 4QEDA 3HDYA 3SJ7A 4BO1A 1V3UA 4PG5A 5DT9A 4DA9A 2ZK7A 1P74A 1A9YA 4MKRA 2PD6A 3VHRA 1BVUA 3FD8A 1P3DA 1PZHA 1WW8A 4UVHA 4NJMB 4WLVA 2P91A 1KYQA 4M8SA 4YJFA 4ZRNA 3U62A 3ZNPA 2VYVA 1G0NA 3AM5A 4ND1A 3U4HA 3WTCA 3EAGA 1T2CA 2W2KB 1GCUA 4CUJA 4YT8A 3GN2A 2JAHA 4L75A 1H6CA 4AVYA 4E5MA 3KXDA 4RVFA 3D3WA 5COAA 2IRWA 3OJOA 2YHIB 4NFSA 4BNUA 4RVDA 3F5SA 4CUKA 4G2NA 4KUEA 3GNQA 3B1KA 1PJSA 2FR8A 1PR9A 1KVUA 1WLYA 3BMNA 3RFVA 1O5IA 4BKUA 3LF1A 2JFGA 2NU9A 3JSAA 3JQFA 3PQEA 2VYND 4YTEA 4IDBA 1CDOA 4W82A 1WZEA 1YB4A 2VT2A 4M55A 1U4SA 3QLJA 4Q3DA 1PQPA 1F06A 2CVQA 5KJ1A 5KOIA 2E49A 3VZSA 4XCVA 4B3HA 2ZIZA 3Q11A 1DJQA 1G1AA 4XQEA 1E3SA 1U7HA 1YBVA 1NVTA 3R3JA 4ALNA 4B7CA 5DOZA 1DIHA 3TNLA 4DGSA 3TFOA 1LC0A 1SO8A 4GBJA 3IKVA 3W8FA 3PFWO 1U1IA 2PD4A 3VAZA 2I99A 1BXGB 5JCXA 1HSZA 4J16A 3HADA 2GN6A 4GI2A 4QO7A 4CLRA 4J1QA 5ITVA 5JBIA 1Y8QB 4HP8A 3DBHA 2HK9A 3AFMA 1OZAA 4BNJA 5HM8A 1MFZA 2IE0A 4E2WA 1KC3A 4EJMA 4CLDA 2FZEA 3AY7A 3WYBA 4TMFA 4L76A 3QY9A 5TGDA 1WZIA 3GZNB 4P8RA 3JQGB 2VUTA 5F5NA 3PVZA 2FRDA 2AQ8A 1L7DA 3HDHA 5U4QA 1XIVA 2O3QA 3JYQA 2O23A 3NTOA 3UCFA 4DPLA 2YZ7A 2C2XA 3KM0A 1H5QA 3QWIA 3BTUA 2DLDA 2VHZA 4NHEA 1GPJA 4Q3AA 4W99A 1OC4A 4CQMD 5G0VA 4B8WA 3FTPA 2OGUA 4BV8A 3ZU4A 2Y1OA 3RJ9A 3WLEA 4CLEA 4ND2A 3MJ4A 1I33A 4IY1A 2ZJ1A 4CMEA 5ER6A 4OOFA 9LDBA 1H2HA 2QX7A 5MGBA 3IP1A 4BO0A 3KHUA 1C3VA 4KUGA 3WJ7A 1NAHA 2C2YA 4MDHA 2B4QA 3PGXA 2VRCD 3PHHA 3ROQA 3K6JA 2V7PA 8LDHA 4FFMA 3ZU5A 4AJPA 3WGQA 4E30A 2B35A 3SLKA 4Q39A 3B1JA 4CR7A 4BKOA 1ZEMA 5KJEA 1HE5A 3DOJA 3DMYA 3P5SA 4FDAA 2J3IA 1RJWA 1I30A 4BNVA 3RBVA 2CNBA 4H7PA 3O38A 4K6FA 4OIMA 3H9EO 4IIUA 1RM3A 1MFPA 3OETA 4YQYA 2OBNA 1WDKA 4FGWA 2PGDA 4TVBA 2PV7A 4XGIA 3QRWA 1B3RA 4DQVA 2DAPA 2HMVA 4DBVO 1NVMB 1DIBA 3D4OA 2YV3A 5EIOA 1E3EA 1PR3A 2HU2A 5F3RA 4RPKA 3LT1A 2HK7A 5CDUA 5FFFA 1TEHA 2YHUA 3WWYA 5KJ6A 1SOWA 4DL9A 2PTGA 3BMOB 4GX1A 4JGBA 2EERA 4G5HA 3UHAA 3OHSX 2I67A 2YV1A 5IDWA 4NBUA 1E3WB 1ZSNA 4MIYA 2VTEA 1WWKA 1NR7A 5L7YA 2QYSA 2Y0CA 4U0JA 2NVWA 1I24A 1GZ4A 3SEFA 4HY3A 9LDTA 1NAIA 1P45A 1J4AA 3WFJA 5I7FA 3WYCA 4KDFA 4F6CA 1T24A 3EVTA 1OMOA 1IULA 2O7QA 3H65A 5A02A 4GPD1 1GZ6A 3AM4A 3L9XA 1C1XA 2J3KA 3RUHA 1SB9A 3MJEA 1E5QA 3ZV6A 2OP0A 5T8KA 3S55A 5JAZA 1TVEA 3GZ4A 3RC2A 2R2GA 3NTRA 3WGZA 3HN7A 1I0ZA 1Q7GA 2PGLA 3TZ6A 4WPGA 4IGFA 1RYDA 2VNSA 4FPXA 3VPHA 3OEYA 4DREA 2BRUA 3H8VA 2WE8A 3D3WB 1U3VA 3DL2A 3EY4A 5BNTA 2ZCVA 4LMRA 3KETA 1BVRA 1K2WA 1RM5A 1Q7CA 1W73A 1KBZA 3V2HA 3QWBA 1Q0LA 1XELA 5HA5A 1PGQA 2FZWA 3DTTA 2AEFA 4PIVA 2I3AA 1P77A 3PQDA 1KEWA 4B4WA 3GGOA 1G6KA 3WMXA 3BYZA 1P9LA 4U0KA 1IUKA 5L4SA 3W4KA 5JYAA 4B4UA 4WNIA 3IS3A 1NWHA 1HF3A 1LXCA 1YVEI 4RJTA 2Y0EA 4RVHA 1X1EA 5TSDA 3C24A 3HN2A 5KIAA 1DPGA 5T8KC 3A06A 4J1NA 1WMBA 2Y66A 4BKPA 4XYBA 4BNLA 2IXAA 2H9IA 1UAYA 1AXGA 2W8ZA 1MP0A 1A7KA 1ENPA 3JQ9A 4N18A 4YQZA 3VH2A 2EGHA 2DFVA 3V2GA 3H9UA 2FN7A 3G49A 2GZ1A 3HSKA 3UCEA 5H82A 1EQUA 3KOUA 1UXHA 1P31A 3GMSA 5HS4A 4YJHA 2UYYA 1KEPA 3LT0A 2GNAA 3OJ0A 3DBHB 3MJSA 4MP6A 1Z82A 4FIZA 1BW9B 3UF0A 1U2GA 4QUKA 1LDEA 3GUCA 4WASA 2B5VA 3BHJA 3C1OA 3UCXA 3QQPA 1LDNA 4CM1A 1KC1A 1LDBA 2VWPA 4L4XA 4J7UA 3ROPA 3RUFA 3AUTA 1PSDA 4CM5A 1GAEO 1PJ2A 4B7UA 1LU9A 4U6SA 3GMDA 5ILGA 2C7VA 4DC0A 1NPTO 5LC1A 2ZTVA 3L77A 3SC6A 3RASA 1V9LA 4J0EA 1IHYA 2DBRA 4IDAA 4OGWA 4QFCA 5IXYA 2C82A 1GY8A 1OAAA 1Q0QA 3I9JA 1VE9A 1HTBA 3ULKA 3I1JA 4FGSA 4UVEA 1GV1A 2BGMA 6LDHA 3DOCA 1QV7A 4TRJA 1ZXBA 5F1KA 1QRRA 3M2TA 4RVUA 2CY0A 3ZHZA 3EDMA 4GLOA 3JQ8A 3JQCA 4ZRMA 2YFHA 3CMCO 1VL0A 4RPJA 1P0CA 1MA0A 4NI5A 3IQDB 3ZCXA 3NDRA 4IGEA 2G17A 4R69A 2WD7A 4WLOA 4C7JA 3GVHA 3S2IA 4HKTA 4PRLA 4MVJM 4II3A 3VKUA 3PXXA 3V1UA 1D3AA 1H0KA 1T26A 1U5AA 4RQUA 4BO6A 4IQ0A 2Y1GA 2CF6A 4BNZA 3JQ7B 5AQ1A 5G4KA 3V5NA 4IMPA 1QP8A 4YAIA 1HSOA 1ZXLA 3K96A 3WXBA 4E4YA 1CWUA 2X1HA 2PKRA 1KEUA 3E03A 1GEEA 2JL1A 4D45A 4QX6A 3R0IA 1SC6A 2GN4A 2VCYA 3D0OA 1FJHA 1SPXA 3H3FA 5HRUA 5BSGA 5G0SA 2FP4A 3OM9A 2D5CA 1U8XX 4CMGA 3ICCA 2W2LA 1ENYA 4BVAA 1LI4A 3I83A 3HG7A 3GFGA 1XR3A 3ZWYA 3PLNA 3AOEA 4Z0TA 4BO4A 2FY8A 2V6MA 3A4VA 3DZBA 4FJ1A 1JDJA 1NX6A 1LRJA 2I66A 1GEGA 2FWMX 1Z74A 1B26A 4NNJA 3LU1A 1HDGO 5JS6A 4N54A 3KYDA 1YJQA 3HWRA 1GADO 4UUOA 1ULUA 3GA0A 1H2BA 1C1XB 3GG9A 4IQGA 1YONA 5EINA 4IDEA 1LUAA 5AVOA 3O8QB 1YOVA 1J6UA 5JFOA 3VC7A 4BNIA 3E5MA 3GF4A 1PWXA 1N7GA 2ZQYA 1NTOA 3BA1A 1LRLA 1B15A 1DC5A 4ALLA 3QVOA 5L40A 1Y7TA 1NQOA 2JFHA 1K0UA 1H93A 1DFGA 3BMCB 3MJTA 3CKYA 4CV2A 1DEHA 2OHXA 3E9NA 3JV7A 1YDEA 3G3EA 5T6BA 3R1IA 4M87A 3W6UA 5JDCA 3OECA 4NU5A 1JTVA 4DPKA 3T7EA 3GG2A 3AOEC 4I5FA 3LSYA 2NTVA 3TN7A 2Y99A 3VZPA 5B4TA 4MP8A 2JD1A 2CVZA 2ZQZA 3JYNA 5F1OA 4UVIA 1B3BA 1TT5A 3DBRB 3MWEB 2Z5LA 4IXTA 3HB4X 4YCAA 5COBA 2JD0A 3WGOA 4CV0A 5C3MA 5IAAA 5JMWA 1CERA 4A2CA 4E13A 1QKIA 2E6UX 1UXJA 3ST7A 2TMGA 4DWVA 3P7MA 3IDSA 1WXDA 3TPCA 1UH5A 3AI3A 2BGLA 2RH8A 1E6WA 2BH9A 1SMKA 4R9SA 4XGKA 1PGJA 2J3HA 2AEMA 4BNTA 3AOGA 3WICA 1HXHA 1KETA 3ZDFA 4LK3A 1AUPA 2W2KA 2PZJA 3QA9A 1IZ9A 4YJHB 4CM3A 4H3VA 4ID9A 5JLAA 3NDIA 2WDZA 2YHIA 1NNUA 1HWYA 1XHLA 2DKNA 4DC1A 1EUZA 4EEZA 1NHWA 4MVJA 1ISFA 2EXXA 4HFMA 4L4RA 4E5NA 3ZI0A 4B79A 1U9JA 3GK3A 1X1TA 4BOYA 1YE3A 5DZSA 2DU8A 2VTDA 4AG3A 5IN4A 4IBOA 3WS7A 1RM4A 2VOJA 3RUDA 1A4IA 1B2LA 3PJDA 1LA2A 1HDRA 3GR6A 1IPFA 3JD4A 3RWBA 5LDGA 3Q9UA 4UUMA 4RQTA 1LSOA 4E2ZA 5L7TA 3FTNA 4DBZA 5FI5A 3TOZA 3WGYA 1DXYA 2CDCA 1I2BA 2BGKA 3D3EA 3QWAA 2WYUA 1U3WA 2DUUA 3M2PA 2R00A 2E48A 4MPDA 4NFYA 2ZKLA 3VTFA 1HKUA 2VNAA 1DFIA 3L6DA 1A7AA 1E0DA 1ZJZA 4E32A 4CM7A 4ZA2A 3EC7A 1UXGA 3TQHA 3MWDB 1MXHA 1E6EA 3W6ZA 3OJFA 4XZ3A 1ONPA 3DZGA 4WLUA 3FNEA 1SB8A 1P44A 1Y8QA 4PGFA 1XQ1A 3DBLA 2EIHA 4NBVA 1NR1A 1X0XA 5B12A 1EK6A 1LLCA 3K30A 4TZTA 3JQBA 3FBTA 3L4SO 4Q3EA 2G76A 1ONNA 2X9VA 3JQ6A 1D7OA 3LC1O 4XYLA 4GH5A 1O89A 5G4KB 3L4BA 4W7HA 3PTZA 4OAQA 3L0DA 3BHMA 4U8GA 3Q9NA 3UOGA 1U4OA 2ZYDA 4GX5A 1CF2O 4DUPA 2DTDA 2PH3A 1ZK4A 4CR8A 2GASA 4B7XA 4I9NA 2VHXA 3NKLA 1VI2A 2I65A 3PWSA 4XDYA 5G0WA 1PX0A 2GERA 5I8WA 2AQHA 4YDRA 5EERA 2WE7A 3OJEA 2Z1MA 1GYPA 2R00C 3HQ4O 4G81A 1HZJA 4BKQA 1XG5A 1O8CA 2NU7A 4GGPA 1MGOA 3GEGA 2PZMA 2X7HA 1GR0A 2XF8A 2WTBA 1HRDA 1EUDA 4IINA 4BIIA 1LEHA 3AY6A 2BF7A 1PZEA 2EW2A 4O5OA 4IQ8A 5THKA 3WNQA 3NEPX 5KJCA 5T5QA 1B7GO 2PA3A 3P2YA 4TRMA 4NDNE 4DYDA 1PWZA 2EV9A 2D8AA 5J23A 4E0BA 2YYYA 2HMSA 4YXFA 1R37A 4FW8A 1VLLA 2DPHA 3GOHA 2CD9A 3JQBC 3IAHA 4EZBA 4N5MA 4MKZA 3KYDB 1MC4A 3I9OA 3UICA 5A9SB 2QZZA 1EVIA 1EBUA 2C59A 1YOVB 2QW8A 3LZ6A 1VSVA 3OQBA 1MX3A 4IJKA 3K73O 3ROKA 4LISA 3GDGA 1RKXA 3GRPA 5U9CA 4J9VA 3WFIA 3KYBA 3BTOA 1F8GA 1D1SA 1M66A 2VWHA 2UV8A 1SNYA 4DQXA 4Q3CA 4DPMA 1TI7A 4CL3A 4MIEA 5TJHA 3GPIA 4QO8A 3WSVA 2NTJA 3RCBA 3ZW9A 2QHXA 3GN1A 5C7IO 2C29D 1E3WA 4I5EA 1GQYA 3IKTA 3JCZA 3ZGYA 4CV1A 3NGXA 1HEUA 5DF1A 1SBYA 4DMLA 5JDIA 5I9LA 3FWZA 2QRKA 3JYOA 2Q4EA 2GR9A 5AXBA 4ALMA 2O3UA 1XSEA 4AJHA 2RCYA 3E82A 3UN1A 3JD2A 1T2AA 1Z73A 4NK4A 3N7UA 4CMJA 4OQYA 4B4OA 1NFQA 2IYPA 3V1YA 3VOSA 1V6AA 3S2EA 1JAYA 4P4LA 1X7GA 3ZNNA 3GVXA 2GLXA 4ND3A 4XA8A 4X54A 4J2HA 1EQ2A 4EGFA 3CUKA 1QYDA 4HFRA 1DHTA 4IPTA 3IMFA 4OXYA 4R4JA 3BMQA 3ITKA 5JY1A 1BMDA 3HJAA 4R51A 2AE1A 4YPOA 1Z45A 2TMDA 5EQFA 3OJLA 3UKOA 1XKQA 4NBWA 7ADHA 3OIFA 3I6IA 4BGVA 2Q3EA 4WK6A 5CDGA 3DC2A 1DIGA 1E7RA 3OQ6A 3ONFA 4EBFA 3K5PA 5L3ZA 4XIJA 5JDIC 3NTQA 5JSFA 2A9FA 1HDOA 2DBQA 3NDJA 1PU2A 2IODA 1XYGA 1DB3A 3DZFA 4J4TA 4RL6A 1LLDA 2HSDA 1DRWA 4ZU3A 1LSUA 1N8KA 1D4FA 1I10A 2X6TA 5CPFA 2DPGA 1ENZA 5DCYA
chains in the Genus database with same CATH superfamily
4V38A 3WG9A 1ISMA 1U0NA 4RJJA 3LX6A 3KKZA 3FF4A 4EVSA 1T2DA 2C4MA 3FPFA 4F97A 1RTTA 1PVOA 1DTSA 5K0SA 4K0RA 2D1RA 5JY6A 2R85A 4ZVMA 4LA4A 4OBEA 1GARA 4ME6A 1FDWA 3DF9A 4R9UC 3EZFA 1OU0A 4JL5A 4Q3OA 4B1FA 5AESA 3KBBA 1ABBA 1AIPA 2FF7A 4ITVA 1MJGA 2VYNA 1V3VA 4PAOA 2O48X 3D3NA 2P9GA 2G1UA 4UBIA 2XOEA 4M1MA 4BNWA 5BSUA 5EXXA 2WV9A 1Y9DA 4RNCA 1U9IC 3AFHA 5D1NA 2CGEA 1UJ5A 1YNSA 4Z4GA 2WLSA 1FFYA 2EFGA 4KG7A 3RRXA 1L9XA 4MARA 5HBRA 2QTZA 2DCUA 2HMWA 1JJAA 3R20A 4EHNA 1GTG1 2FWAA 4DXHA 2GWHA 5BWCA 2RHGB 4U7PB 4RVOA 4D4MA 1ISSA 4QUBA 4WY5A 2VH1A 1QNFA 3L6EA 3MYYA 2QN9A 4BNHA 5BSWA 2QRNA 1TJ5A 2Q1TA 2UYHA 1KU0A 2JGNA 2H48A 3ZKAA 4ZMSA 3U61B 2JHFA 3HSSA 3PP8A 1KI8A 2Q28A 3VNQA 2FNAA 2J5RA 3QFHA 2XEXA 3G9ZA 1M67A 4PCLA 3T5DA 1O94D 3IIEA 4RYDA 4YY3B 4XTCS 1QUFA 3MWLA 3ICWA 3WWEA 2P3OA 1T2EA 4B3GA 4FLFA 3HDQA 3PITA 5D5HA 5JBQA 1K06A 1U7PA 2BI7A 4ENPA 5EQTA 1I6KA 4ZQFA 3P9RA 4UU8A 1A71A 4Y2YA 1EFPA 3G6WA 1U02A 3NVKI 2AI1A 4TKVA 3Q7SA 3B3AA 1QZUA 2VBFA 3B51X 2CK3A 1IBRA 4J6FA 4QXOA 3EXG1 1MRSA 3A37A 1FVOA 4H16A 5C4IA 1GFWA 1EH5A 2I7VA 3BIWA 3BKXA 1O0BA 1Z2NX 3ZR4B 1NW6A 2PM8A 3DO5A 4KUHA 4DDTA 1JN0A 3ZCTA 4ETWA 3MD9A 1X3SA 4RELA 1DQRA 1W5BA 1A2BA 1OKKA 1Y3HA 2AN3A 3ET4A 4HS4A 4Y67A 2YNMC 2EX4A 2PT7A 2X3YA 3DXFA 2OECA 3ETDA 3JQ7A 3N0WA 4ZXFA 3UB3A 2WUVA 3RKUA 1UKAA 2YASA 4QYMA 3AJAA 4FR0A 1OYOA 1RBZA 5KNLA 1AOXA 4ZOAA 4CF5A 2R6GA 3TR5A 4BVJA 4GI3A 1RPJA 4JFAA 1T15A 2MSNA 5E95A 5E9WA 3HXTA 2AVNA 3ISVA 5DI3A 4IV0A 4GC5A 4XEHA 1U6IA 4ARUA 2ZQ5A 3EIXA 1XZMA 3KJXA 5IH3A 1Y3DE 1ZD4A 3KZMA 5HKBA 2Q3JA 1N34B 5IT5A 3EUAA 4UEJA 4S24A 1ZI9A 2VJDA 3PEVA 1SKYB 1SXPA 2CMDA 3PDJA 1BD4A 2I54A 3GCGA 2WHXA 5CAEB 4NMXB 3UAYA 2A0WA 4PXSA 4FOTA 5CW2A 5EZYA 5DTEA 5C37A 1C3JA 3C3MA 1PT7A 4R1SA 4WLNA 2RI1A 3QUTA 1NXOA 3G7UA 4JEHA 1FX0B 3HVHA 1O95D 1QE3A 2HQSA 2WF9A 4J1TA 4QYWA 5J40A 4DDVA 3TH5A 1GRQA 1JLHA 5AW5A 5LP6A 4LHZA 1X15A 4LKRA 3QJYA 3FW1A 4R31A 5ICSA 1UWKA 2C1XA 3BWCA 3IBFA 3I39X 1C1YA 1DINA 3PX7A 3H1FA 3C5WP 2FG6C 2V45A 1X87A 1YIAA 3QWFA 4IHJB 4Y8VA 4F3RA 1IZZA 1JPJA 2KHZA 4MRVA 4WOJA 5DFAA 4AWAA 4HUTA 2EKDA 2O8BB 4CDGA 5L53A 5KYUA 4E3ZA 1CY4A 2V0GA 3HKCB 3MUNA 4RSRA 1TAUA 1L0BA 2NAPA 3A10A 3SZLA 2AN9A 1YI1A 2A0XA 4WCFC 5BWLA 4LV8B 5HRCA 3U7GA 5HKOA 1VLZA 5KS2A 1OC2A 4UM5A 5DNCA 4B4KA 2WB2A 3LKZA 4P34A 4WECA 3A6FA 2JIMA 3P9IA 4DIFA 2PZAA 3RARA 2W98A 3ZXSA 1AUVA 3NBMA 3L8HA 1QFZA 3D31A 5HDBB 1U0BB 1XEAA 3H7AA 3EUWA 2J0UA 1DBPA 4N41A 3QF4B 5CDSA 4KR0A 1M2WA 2G8NA 3ML1A 3SK0A 1EYZA 4ZICA 1JT9A 2ISCA 3H6GA 1T1GA 3IJEB 4KRGA 4N7RA 2LIPA 2QLLA 5KVQA 3BMCA 1JT2A 5EP4A 3UWPA 3V4PB 1VM6A 2ST1A 4I1UA 4MR9B 4JJAA 3KQNA 3RSHA 4PIMA 4BV2A 3QHAA 3RSLA 3GEMA 4PCAA 3U17A 1VPDA 4FMCB 5K0JA 4EUFA 1REQB 1KP9A 3O8NA 4IS3A 4YDQA 2VOEA 1IWPB 1JFSA 4G8DA 1CQJB 1A4UA 1TIPA 2HSWA 2IEGA 1MC5A 3CEHA 3X1JA 2DZDA 2J5QA 4I55A 3TAHA 1P2BA 3ZLTA 2Q5IA 2WSBA 3AHCA 4O0MA 4PLVA 2AW5A 2A88A 4L5AA 1FDSA 1R5BA 2DFNA 3KVYA 3T61A 3IB3A 5H81A 4QPDA 3T4XA 3DMTA 2GLUA 3BSWA 3PHIA 3FGZA 1I5OA 4MV4A 4Q00A 3VH1A 4X64B 1HY3A 1ADBA 5FR2A 1GIAA 3P0FA 3WV5A 5ES3A 3EFOB 1HT2E 1I4DD 3ZEIA 4ZYVA 3KKOA 5ADWA 2B1GA 3HU3A 4PC1A 3FDZA 2DEUA 1LW6E 4KK4A 4X91A 3LO8A 3TGWA 5CJ2A 2WZCA 1USGA 3WNZA 2YDXA 3JZDA 3U3KA 1QRSA 1CQXA 3O4IA 1EWVA 1VJRA 2QGZA 1NM5C 1NBAA 1QWOA 3O91A 5LMZA 4PHGA 1OFTA 4N47A 1GDDA 3WR5A 1E32A 1NNLA 3H1EA 3E9QA 3W9UA 3WX0A 2PT9A 3HNPA 3IEIA 3AMVA 2MYUA 3HCAA 1JHMA 5CUQA 3I4FA 3IBTA 1PNQA 3N8IA 4TWZA 4UUNA 1NATA 2X14A 1NBMA 4WFQA 2Q4TA 1J2TA 2C2BA 1OBVA 1W30A 2QT1A 3UKJA 1PL6A 4W5TA 2JZNA 3ZZMA 5KYWB 3L43A 4Q19A 3I2YX 5CVJA 4PGMA 3PUVA 4OK6A 4R81A 2O8DB 3OBBA 4E5VA 4LGMA 3AR6A 4KBYA 3U3JA 4ZZ0A 1A96A 3I8SA 3BWBA 1WJGA 1JDBC 4QEKA 1G8MA 1K8RA 4UPVA 3KETA 1CPYA 2BN4A 2PYIA 1H5NA 2RG1A 2WWRA 3RUIA 2HX1A 4HNAB 2X5KO 2WP8J 2PH1A 2BZ0A 2CZCA 2MMCA 1BDMA 1TCAA 3H9QA 5HZMA 1EVQA 2D2IA 3F6EX 2O57A 3R09A 4AXXA 4KNYA 3FOWA 1NUAA 5H9VA 3B52X 1GRVA 2CYAA 3QMWA 1E1KA 4GP7A 4F5WA 5AVSA 2P9HA 3ACCA 3MWJA 1OXUA 4IYRA 2IEDA 2YDYA 1UEIA 1Y1RA 4JI4B 2A67A 2IPNA 3KKEA 3C8MA 2IPAB 2Z83A 2OP1A 1J2UA 1TU0A 1F6BA 4B46A 1NMXA 3LQ1A 2PSFA 4RSMA 1KAEA 4NH0A 3I2GA 5DH9A 2WU4A 3VX3A 1V5IA 3M81A 2W6PA 4EJSC 3EP5B 2Q4OA 4Q9DA 3QVKA 2OMEA 4KV7A 2QP4A 1EGVB 1N3BA 1IBKB 1YS6A 3BFKA 2QR5A 3PC4A 4ZJYA 1NU6A 5JYEA 3EGXB 3L01A 4JR0A 4U39A 1YL6A 4FOLA 5I8PA 3B2QA 4P4GA 4CQMB 1Z13A 1COWA 1S1CA 1WDWB 4W9NA 1BX0A 1CUYA 1TOAA 1QTNA 1W76A 5IBQA 2CEAA 1I4WA 1CJBA 2I1WA 3C3WA 4FJ2A 3WDMA 5FI1B 2GZ2A 4BFSA 3MJCA 4WLEA 1MV8A 4EECA 5LB4A 4JI1B 5AHKA 3TRIA 4F6RA 4IWXA 1DX9A 2R7AA 1SBZA 2XUZA 3LRTA 5D85A 4MAFA 4XIYA 1KWGA 3L7YA 3VNUA 3VDXA 4YUWA 1NFRA 4HDKA 1ACMA 4LSMA 2AD5A 1AU9A 4M99A 3BAFA 5B1HA 2FEXA 3D43A 3VSDA 1M6WA 1Z4IA 4TV8F 1UFRA 2J3MA 3L3BA 1P4RA 3H04A 3H17A 4TLEA 2BKAA 1HLPA 2RAFA 2WAAA 4JLUA 2NUPB 3I9MA 4K9LA 2OCDA 4CKXA 3AFOA 2QD5A 3S5JA 2I8LA 3OE5A 4BB0A 2R8PA 3C5HA 2ZROA 2GCIA 3GX1A 1S8FA 5JPCA 4DEXA 3OCXA 1WS6A 3TNJA 1JVNA 1KBQA 3N2GB 3MRTA 3O4HA 4BX3A 4M7RA 4CKCB 3GT3A 5EIAA 4PLFA 2HBYA 2F1OA 4P32A 1C9YA 2P67A 3OMLA 2GVZC 1YA6A 4DRXB 1GYRA 1SIUA 3AJ9A 3HM9A 2J41A 3IOBA 3ZE7A 5ICCA 1XNGA 1JQAA 3AR4A 3E6AA 3BX1A 3NBKA 4LQLA 1JVBA 4ISBA 1PNOA 4K9QA 4LWQA 2PZGA 1N5JA 3WLAA 4ZJZA 1ZH2A 3TZQA 2QLFA 3CUWA 3KALA 4HGYA 2AV6A 4D46A 2FF5A 5C0OE 2XTJA 4HATA 4LECA 1ZJ4A 2AS0A 3M6IA 5HHTA 1P3Y1 3PFBA 4RIHA 1VE6A 4KO2S 2PUVA 3P0JA 1BXZA 1RDFA 1FTQA 1VJDA 4FZVA 1QVWA 4FN5A 4LHYA 4PXYA 1L5ZA 5EFOA 5JG7A 3OO0A 3HJBA 1RWNA 1V8BA 2OGTA 4RIEA 2PL5A 3DDNA 2EG5A 1ZO8A 1OI3A 2QAJA 3PNPA 4MO2A 4US1R 1XDWA 2X9NA 5AW1A 3H2ZA 1FQKA 3BDVA 3NAQA 9MHTA 5B6JA 2HD4A 1FYWA 1XT6A 3WB9A 1HTWA 5LL6P 2V9CA 2C5AA 2Q50A 2R66A 1B8OA 2WJVA 1ML4A 3BJZA 2ATXA 3CF6R 3DLPX 1MQ9A 2UYGA 1EFDN 1JJBA 3D1LA 3FFWA 1G2IA 4ZAXA 4BFYA 3VVLA 4EP1A 5AUOB 1Z3CA 3SSMA 2FTKE 3D2LA 4XPIB 3IV9A 4F12A 3SXPA 2YFYA 1DUSA 4K6OA 1KP2A 4GG1A 1W36B 3K20A 3W3AA 2WA1A 4EDFA 4OQ4A 1XA4A 4JJFA 3H19A 1XTQA 3VA7A 4DR7B 1H66A 3IUSA 2H11A 2HAEA 3GFPA 2ENWA 3C87A 5K2OA 2X22A 3A6PC 3G8BA 4OVKA 1B6TA 4AF8A 5JROA 1AQ6A 1BOOA 1RQNA 5A06A 1Q92A 4HGPA 2I6QA 1Q2XA 3U3DA 1V2GA 4BP1A 4BO7A 1A8UA 1KZHA 4M8KA 3OC0A 4LXYA 1UM8A 4RETA 2C92A 2QDXA 2IPMA 2ZBVA 1PIWA 3IE0A 5B1EA 3UK2A 4Z3KA 3D4LA 3ONDA 4ZAFA 5IJ9A 4J1SA 5A3JA 4R41A 1UWLA 2WTNA 3MUFA 1BKSB 4GZ3A 1IY8A 1TLTA 4TXLA 1HQCA 2OHIA 4Q18A 1ZLXA 2XX3A 4Y98A 3SJUA 4ZANA 3RIHA 2O8FB 4O2AB 1ZH8A 1HKHA 3DQPA 2BLLA 3AV0B 1GNTA 4LNUA 5KHAA 4EG1A 4AKGA 2HXGA 1F17A 2BSQA 4EA7A 2IYZA 4X6YA 1O7JA 3VR5D 4MVJF 2B83A 1OH7A 4G0VA 3GFOA 4JUFA 2G82A 3IULA 3HDTA 2X4GA 1TCBA 3SFZA 5C1DA 4JI8B 3FKSD 3DEZA 2WJAA 5ITSA 3H2BA 2O1WA 3NOOA 3U19A 4KQWA 4L5JA 5GAJA 1PNRA 4II7A 3H11A 1NXXA 5F52A 3CZPA 5CB8A 3IURA 2FEKA 1S02A 2C04A 3GLUA 4DUYB 4BE4A 5LXTA 4I1PA 4RKFA 3ND5A 4YACA 1GILA 5HIKA 1ELOA 1XZKA 1Z0JA 2MOKA 2HMAA 4P58A 2CFIA 5LUBA 4YI3A 4YCMA 5FWAA 3DNFA 3STXA 3JY6A 3MG9A 2NX2A 4X95A 2GK4A 3PGJA 3A26A 3LHKA 1GCGA 4NRDA 4XJTA 2GLTA 3W3AH 4J07A 3R3YA 2G4LA 1TM1E 2PVPA 5E2IA 4JP1A 2AN5A 4PO1A 1KY5A 2AK3A 3CIFA 4DNOA 1NW5A 1YBMA 1SUSA 1HT3A 2E1RA 3USCS 1A9TA 1CC1S 3F7TA 4I5IA 2BKLA 2CL7X 1SRRA 3WWZA 3NV9A 3ND6A 4YAGA 4MA5A 3WK4A 1UQUA 3OEED 4RACA 2EZTA 1X38A 1XAHA 1SU4A 3HHPA 3RODA 2D6FA 4QWMA 1XEWY 4NS4A 1THTA 5AT1A 3C7AA 2C2WA 4OX9Y 3BJRA 3GA7A 5BWOA 1FTYA 3JVIA 4QBKA 2D4HA 1J1ZA 3SIWA 2FP3A 2F8TA 2GKSA 2VS1A 3LXRA 2A84A 4FFPA 3BTVA 1UC4B 2NQ8A 1XWIA 3LQQA 4ETNA 3O21A 4E88A 1J00A 2W4QA 1E2QA 1MB4A 2C2MA 3OC6A 4FOSA 4UDXX 4Q9JA 4A8HA 4Y1RA 5IMSA 4YHBA 3E1SA 4WX2B 1PFWA 2A92A 3RAGA 5CD9A 4Z54A 3D6JA 1JDZA 1R0YA 4PZAA 1CZNA 4TV9F 2GCGA 4O4JA 3ZJUA 1P80A 3BFVA 2PZLA 2CHUA 2FSVC 3KZ1E 4JOCA 4MPRA 4PYKA 1C7ZA 1XDGA 4R2WA 1JHOA 1KSJA 3OPXA 1ZOPA 1SEPA 2GFHA 5DCLA 3VVBA 4E2FA 4MLPA 4ARSA 4FR5A 4BC0A 5A4DA 1O6BA 2FK8A 3L49A 1N0VC 2M2IA 3K94A 5T4FA 2NXJA 3FI9A 1WV0A 1WPGA 3BOSA 3PKIA 3DEHA 2PIDA 4LEIA 4QJBA 3RSFA 3GLVA 2P7HA 4P53A 3VJKA 4HLUC 4Q3KA 2NSYA 4PLGA 5HJ5A 4MVJG 1D4AA 1A77A 4X44A 4MW2A 5EIHA 4HAWA 2Q9AA 2PLRA 3I5MA 2Q99A 2NSDA 2WFLA 3DOIA 2E4YA 1PZGA 2II6A 3IUBA 2G0NA 4IEIA 1W46A 2ZB8A 3WLQA 4EG5A 2R6JA 4HHEA 5CIYA 4XQ9A 2A5YB 3PPWA 5EMJA 3ORSA 1GSIA 3FYDA 3L4EA 2QORA 4JJ6A 2IHVA 2V5UA 4YRAA 5HJ7A 1JEEA 2NLOA 3K5HA 4YREA 4BFTA 4K28A 5ECYA 3OPYB 1MO3A 3OWOA 3FAKA 2YC4C 5AICA 3T8YA 4CIBA 3HUEA 3GLFB 4TM8A 1R6VA 1KFJB 3O75A 3O8CA 3RTEA 2ZJBA 1XRMA 4N7BA 4J4HA 4QRDA 5JQGB 3RHFA 5A62A 4F8EA 1KO8A 2O5RA 4XVCA 1TAQA 4YRIA 1I5EA 3OAAD 2YY6A 2JAXA 3BAZA 3QNMA 4CT0A 5A6VA 3REFA 2I29A 4BMOB 2FW9A 4QATA 4A1FA 1NDUA 3PCRB 1S6YA 4WVLA 10MHA 2ZXFA 1RLOA 5LQKA 2GO7A 2IYOA 3FLBA 3UHFA 4CLOB 2VWQA 4IUYA 2VPZA 2P2NA 3UV7A 1GVNB 6ABPA 1BWSA 2QRHA 3L6BA 3ILVA 4LJ5A 4XYGA 4X00A 4LXUA 4ZAWA 5I3CA 4Q5IA 2DR2A 2X8LA 4F5YA 1SC3A 4LXHA 2AG1A 2UVDA 1GQSA 2PT5A 5F78A 1T6YA 4MEBA 4MQ5A 3ZI4A 5K3CA 3ANMA 3C43A 3UJDA 2QUZA 5B3JC 3JYLA 3AONB 2A0YA 4YRTA 3D4PA 5JZBA 4Z7JA 3IP3A 5BN5A 4R8LA 3JX9A 5EUQB 4KNVA 3C3KA 3QA3E 1FUYB 3QKUA 4IHJF 5DIZA 3ZZTA 3CVOA 1Q0RA 5TNXA 3T0GA 4KN8A 2VJMB 2F90A 1UDAA 3LPMA 5T4EA 4BEBA 5IWCA 5EXPA 1AHIA 2JFUA 1DCTA 2HW8A 4WRRA 1VLHA 3RG8A 3D54D 1QE0A 1GZDA 5FTMA 2CT8A 2PXCA 2LDXA 3UH1A 2NVBA 3SN6A 1E7QA 2RHBA 4X1IB 4DLSA 5IP5A 3DZHA 3H2IA 5KSWB 2UUOA 2QMZA 1C80A 4Y2HA 2X0RA 4N7MA 2PJDA 1RLJA 1G21B 1JBEA 2AT1A 2YXDA 3K9GA 5K8UA 3COPA 2X0IA 3OKCA 2RHCA 4QDJA 2VQ3A 1A2QA 1NMEA 4JEMA 3TRJA 1U9IA 2ECQA 3QPDA 3ISTA 3I2JA 1STOA 1OXMA 3Q3IA 1HI9A 1N6LA 5KTNA 3Q7QA 5KOHB 4MVJP 1XUOA 5EMHA 1QRTA 1ZGJA 3PHGA 2Z9CA 1QH9A 3A1UA 3SYMA 2WZQA 5BQXA 2A7QA 2XB8A 5FWYA 3FNQA 1NYTA 3PYXA 1XZHA 2JGLA 4GPAA 3D59A 1G16A 4EJ6A 3O83A 4PG8A 4DMMA 1SUPA 5J9GA 2FU5C 3FG9A 2WJ3A 2N46A 1BS9A 1QCCA 4WXEA 5CVVA 2HOQA 5FBZA 1WDMA 4AWXA 4EKYA 4XWWA 4MGYR 3AEYA 4L4SA 3E7DA 1ATZA 1F48A 2FH5B 3C7DB 2J9FB 2NACA 5FOVA 4DCJA 4TVOA 4AMGA 1GQFA 4MVCA 3URMA 1G2PA 2BE9A 1N4AA 2DXIA 5BMVF 1H3NA 5P21A 1U7UA 3HI6A 1KJQA 1Y8ZA 4ZCTA 3WWPA 1K5GA 5LQJA 1MB9A 1NU8A 3H9GA 3DHNA 3NASA 3ZZNA 1M54A 1MD9A 3UKDA 1CK4A 2L69A 4XOUA 4DMKA 3HCRA 1KS9A 2H7XA 4PNEA 1UPXA 1V6SA 2NAFA 1UKZA 2OILA 2ZYWX 1Q84A 3LMKA 3S4YA 1TVMA 2FDRA 4ZT6A 1O0SA 1EBFA 1RYEA 3D7MA 4O2BB 3MK31 4FYXA 2JH3A 1JAXA 4J43A 3ABRB 3R3HA 4MB0A 4NYIQ 2I2CA 2XXBA 1GPLA 4YAOA 3X2SA 3GEPA 4OQFA 5JT1A 2B69A 1R12A 3KZVA 1GQQA 1CQIA 1SCAA 1ACJA 3U4MA 4NFLA 1D2EA 3S8YA 2JDIA 4GKVA 1VJGA 2JLBA 4RFVA 3VYSB 4KXQA 1RLIA 4OKSA 2BUBA 1KORA 4OQEA 2C97A 5HUQA 1Q57A 3VDMA 2ECKA 5B3LA 2IUYA 2ZBFA 2Y1CA 2CSUA 4BKRA 5CLFA 1P9OA 3OQIA 2AQIA 4WA8A 1HUQA 1W1UA 2F43B 1W0JD 4MUJA 1T36B 3GJYA 2FSUA 3OLYA 2ZDGA 1UOEA 1TC2A 3NCHA 3O1IC 4I4TA 4Z9XA 4ENVA 1QYVA 2NVUA 3TLEA 1KOJA 3PQFA 3VUEA 5DCUA 5H0IA 2CL6X 3KTAA 4AN1A 2JVJA 1L3IA 3M6LA 2P2ZA 1DOHA 1PUXA 2GJ8A 1AV7A 3E2IA 5D7NA 1V5FA 3WBFA 2AYYA 5A4JA 1JMKC 2ONKA 1T35A 4MWCA 2VP9A 4FB5A 4D3YA 2PJRA 3FGOA 4YJGA 2QPTA 1C14A 1K7FB 1E0JA 4IEFB 2EG9A 1L4UA 3X2EA 2PNJA 4BRSA 4R1OA 4CM4B 1NXQA 1WDLA 3JAMA 5TT1A 4CIDA 4NMWA 3KJIA 3ICQB 4F71A 2D1FA 2FRXA 3OE7D 1JEYA 1WKCA 3CU5A 1YZKA 4OK3A 5BW6B 4I8DA 4L7QA 1H6AA 5B6IA 1QHXA 1BS2A 3OD1A 4IOLA 4QTTB 4AP6A 5C8XA 4CIYA 5ICMA 2OO7A 1IRXA 3ODPA 3T15A 1XA0A 3B48A 5A0FA 3R23A 1Y37A 1YU9A 5T4HA 4B3IA 2XTMA 2PX5A 1Q0UA 2A5LA 3HR7A 2P68A 4BU1A 4LE1A 3B9BA 5JCPA 1PT8A 3VR6D 2CF5A 3U4AA 1D5CA 2QZJA 4NCNA 4NWIA 4G0YA 5HWSA 1U65A 1DUIA 1OV6A 1EAYA 2HU5A 2WJPA 3L8GA 4AKEA 2F3QA 2ZUWA 4UOQA 4YT4A 3EXIA 1RZRA 1ZR2A 4IFBA 3MS2A 3VOAA 1M2KA 2VP2A 2FWNA 3JALA 5IKPA 4MZDA 4N49A 3SQDA 4E12A 4W7IA 2IYFA 5EJAA 2XUKA 1B6SA 4B6RA 2YINC 3EP4B 4JNKA 2PDAA 1XZFA 1NASA 3THSA 3N75A 1GZ3A 2ZLBA 1EK2A 4HXGA 2IDMA 4BFWA 4BNDB 5A7GA 1L7NA 2C4HA 2P69A 2H5JA 2Y68A 3FA2A 4AT1A 4OLJA 1VPTA 3T7RA 1NFFA 5HZGA 3HNRA 2LR0A 3ZV3A 4GE0A 3HXKA 3TI9A 4BRUA 3PXDA 1QV6A 1P1RA 1I3CA 1UIMA 3VSEA 2PZKA 4B7AA 3ZNQA 5LKRA 3ZE6A 1G7TA 1KZ1A 1GAJA 4HXEB 1O94C 3V3TA 3FGNA 4XKJA 2ZI4A 1YIOA 4XR4A 2JKVA 3H6KA 2XPCA 4MULA 3N5KA 4M54A 4X7BA 5CIQA 3P0IA 4MW9A 5LWHA 4XJXA 2A94A 2AYXA 2OHGA 4RD3A 3RV3A 5A05A 3B20A 1VC2A 5DV9A 1D2GA 4JDUA 3WIDA 3SICE 5DNEA 2ZB4A 3HFRA 3OWHA 1TZKA 5TVOB 1G5TA 3EVNA 1RRPA 4R1TA 4ZCLA 1PL7A 4RO0A 2QG4A 1UDCA 1B1AA 3IDFA 1ZVMA 2IW3A 3O2SB 5A4IS 4JASB 2WWYA 4P81A 3RV4A 1XMXA 5EMNA 3FMFA 4G5FA 4LQ4A 2WTEA 5EQDA 2J48A 2AG6A 2ADMA 1QG0A 1MUUA 1O4VA 1WHSA 1YQUA 3CPEA 3GIWA 4CF7A 4YJFB 1EP1B 2AFHE 1DWUA 2IZOA 3O3CA 3YASA 4ZMRA 5AVWA 4HDRB 3CZAA 4B85A 3ZN2A 4UCFA 2Q7DA 3UVEA 4BZPA 3WGGA 4C0JA 5B7QA 5JNLA 1EHCA 3E7FA 4MVXA 4AICA 4EG8A 5A5FA 4QG3A 5BP7A 1TQHA 2NNLD 2PVCA 4GO1A 4B75A 1DIRA 2YUTA 3TLGA 3QX7A 1Y9EA 1YASA 3UA3A 4BLWA 3EN0A 4IIXA 3TZKA 4MCJA 2J9YB 2W9XA 4FUTA 3BBLA 5EE5B 2Y67A 3FLAA 3FPBA 2BFOA 5AXAA 2Q62A 5TRTA 2QRUA 1IXZA 4HVTA 2O54A 1MT0A 1PBNA 2OBMA 4LDZA 4BMNA 4QFBA 3D6NB 2FPNA 4ZCQA 5H3CA 3HGQA 4MGKR 4MUAA 3RAPR 1M1YA 4QNMA 2ANCA 2OV4A 3O4RA 4XSHA 2VRBA 2RC6A 2N47A 4L73A 2H9YA 1TO2E 2HRBA 4ZAVA 4CEHA 2CFTA 1G20E 4EJSA 4LRYA 3F2VA 1KJWA 3NUGA 2I8CA 2O0MA 4UAGA 3WWOA 2GEFA 3ZHVA 5J4LA 5KBYA 4R3NA 3RSZA 4C5AA 1AJEA 4O2AF 1DXOA 1FFBA 4R1MA 1ATIA 1FY2A 2Q2WA 3JYPA 2AL7A 2RH5A 4P7KA 4ZQEA 2ZRGA 4ZMBA 2GWRA 3MOIA 8ATCA 4B0OA 1FB5A 5CA1B 1Z7YA 3LL4A 5EJMA 5ADHA 2E4VA 2JGKA 1N3LA 1ISHA 2QF7A 3GGPA 4GZ6A 1RAFA 3QVWA 1IH8A 4NENA 3M3DA 3TOVA 3URKA 1E7YA 3T7DA 2B4TO 5FBQB 3B1VA 4R1QA 3V4ZA 5I6DA 3FOZA 2PGNA 1SEVA 1ICEA 2RHJA 5I7AA 4JJIA 1FCJA 1VL8A 4UARA 3ZHUA 1U11A 1QO0D 2ZM5A 4BEJA 3GNSA 5FWXA 3C7TA 4G5QA 1UPTA 3G9TA 4LVUA 2WUGA 1BU8A 3EY9A 1GLNA 4JSTA 4PF1A 3CZQA 2ZVDA 1E66A 3KVVA 4QFDA 2QY9A 3P0HA 4HLDA 4RL4A 4DLPA 2O3TA 1YS2X 1Y7LA 3AQ4A 3IELA 4LJSA 4URFA 1BJTA 4ZYUA 3K0FA 2LXNA 3KVNA 4MHOA 4E15A 2OA0A 4CQJA 4A15A 3LIIA 3NT2A 1CYDA 1J0CA 1XA3A 4GSYA 4O4IA 3D6FA 4XIFA 2BAGA 4YNBA 5F51A 3W90A 4LF8B 1ARZA 1EU1A 4PRYA 5JRJA 1G55A 2W70A 1GZUA 3UJ6A 1XCBA 2ZYSA 3RSCA 4AJJA 3DZ2B 1G3QA 2YQZA 4IIVA 2J31A 4TOIA 1VA5A 4MMYB 1X1SA 1MQSA 2R47A 3V8VA 1GL6A 5FTNA 3IJPA 1E96A 4KOAA 4HC4A 4Q4CA 1AF4A 4P84A 3AXSA 4LSWA 1DARA 3ZWXA 3IPCA 2QUHA 1ZGAA 2BC9A 4U7TB 1ORWA 2GOYA 4Y6GB 2R0QC 2PH7A 3H97A 3ENQA 4BB6A 2QQ0A 2V6BA 4AZ0B 2EFCB 3PIIA 4CF4A 5K0NA 2B6NA 3OF3A 4LGYA 3N87A 5F76A 5GONA 1T5LA 3E8XA 3MLBA 3NIBA 3IV7A 2X23A 4MRSA 3AEUB 2BPOA 2V6IA 2CLKB 3DR3A 2Q6LA 4G8JA 1T4BA 4TLAA 1JA9A 4PVDA 1UFOA 1S8AA 2Q1UA 3X1MA 1R15A 4IXMA 4NMMA 3AF1A 3QHQA 1DAMA 4A8JC 3VDRA 1VTKA 1FUUA 3RRYA 4HNTA 2HCTA 2XKAA 4YP0A 1FDUA 4D74A 1PG0A 3Q8LA 3EF1A 1AKWA 1U2GC 1HT0A 2WUFA 4LYFA 1SZJG 1E1QA 3JWEA 1P33A 4RA6B 4P5EA 4D2IA 3U1VA 2EX1A 4HDQB 2PUWA 4OQZA 2BVNA 1U6KA 2ZYHA 1OXXK 4PRZA 3WJ1A 4LJ8A 2VUSA 4AK1A 4LVOA 1JIVA 1T9GR 2V7EA 2WKWA 1HOXA 2B3DA 2CLSA 3DAPA 3X1WA 4BYMA 4X97A 2ID4A 5AVVA 3Q0EA 1EMDA 1YJ8A 4KDEA 4QGSA 1QIKA 4TXHA 4LWZA 1XCPA 2QR3A 8ABPA 1KMHB 3AR9A 3F3SA 4UMVA 4GWKA 4C1NA 2OZEA 4D0GA 2F3TA 4DA4A 3L82B 3GJ4A 4DVJA 3RH0A 3VO1A 3R9XB 3V4RA 2H4WA 1Z8HA 3NO4A 3L8MA 3VPBA 2ZYUX 4QT4A 5FOQA 2B2NA 2RG7A 4BQNA 1YWGO 3S40A 1SCJA 1XK6A 1NY5A 2CLEB 1YK0A 5ALFA 5T57A 2JGJA 3TLZA 3CW8X 4C7MA 4D3XA 3E1KA 3AHEA 3FYUC 1ZPDA 1R4NA 3TW3A 3IOCA 1U5BB 2RH9B 1FF9A 3LBIA 1PTKA 4A26A 1TRHA 3MXTA 4BASA 4EJFA 2FPPA 3HZHA 4OMDA 5HTOA 3IAUA 1NUTA 3K9HA 5KAMA 4J7AA 3ADKA 3HFSA 3GAFA 3CJQA 4NBTA 5P8WA 1LBSA 1QPZA 3T1TA 4H6WA 5A2QA 3L0SA 4GM0A 2A9QA 3NS7A 4I2NA 1XJ0A 3W5JA 5KNCA 2J33A 1EBBA 5HGJA 5JQGF 1KQFA 1UFQA 2OCAA 2R8XA 2QN2A 4IDCA 4YJ3A 5ALKA 2EDAA 2IDZA 2FK7A 4KYTA 3FWNA 5EP2A 1VDMA 1NA5A 1QYIA 4RVGA 3GP3A 3USZA 5HS6A 4HEHA 5EZ6B 2XNKA 3QKSA 1JKJB 4US0R 2PUFA 1NT2A 4HX9A 1YO6A 3VZQA 1F0YA 3R7SA 5D51S 1MO4A 5AW9A 1I4TD 1PW7A 2P9EA 2QPOA 3QVXA 4MV0A 4RIGA 1D04A 4DC9A 4JLJA 1L8OA 2Y2UA 1OAOC 3I4CA 2P4QA 3QU9A 3NHAA 4TS1A 4ESOA 2Z09A 1BHSA 3ELYA 4PX3A 4AX4A 4CKBB 3OZIA 4XUCA 2P2SA 5E0OA 4FZ5A 4H7IA 1N0HA 2ACEA 3Q5GA 3ETHA 1U3UA 5BRAA 3AP2A 1VLQA 4M9ZA 1KAGA 2NSLA 3F90A 3T9DA 4EF6A 3ORFA 2Q5OA 3WLKX 1P1KA 1VSQA 3OZEA 3LBYA 3CKMA 1GKUB 3UPDA 2V5AA 3UG7A 4GYKA 1QYXA 4UZSA 2IHYA 6REQA 2MSKA 1V39A 1XJCA 3OLZA 1A8PA 5L6LB 2XCQA 2F1IA 4KP7A 5M5BA 3NRJA 3QI2A 4XWYA 2H06A 3B85A 4K26A 4B84A 1GUDA 1Q7BA 1RM0A 1H0SA 1GV0A 1THZA 4IDGA 2IWRA 3RS2A 3PFNA 4CN9A 1B0AA 2NXCA 3D4IA 1YFJA 4EAQA 4BECA 5ARDA 2OCYC 3L8DA 1L7AA 4WDRA 3T7JA 4AK9A 4CMHA 2HN9A 4CTNA 3S81A 5C2JB 2PK3A 1CJCA 2YHSA 5JU6A 3UJ3X 1TQ2A 4DIKA 1GZ5A 3PJRA 2UVQA 4YYZA 2ZRQA 3ZV4A 2CUKA 1UEXC 1SD2A 1CR4A 3QEKA 4UPDA 4M9RA 2XZDA 4QPZA 2J09A 1VKZA 2XVMA 1I8TA 1XEXB 4WCVA 3EHDA 4FWTA 3I8OA 5C9ZA 2DPLA 4K86A 4ZOLB 3J80A 2WTXA 3FE2A 2DWOA 5A71A 3ZWOA 2PGXA 3L8EA 3F3YA 2PMDA 3GAAA 1J5PA 1W4AA 3M4ZA 4B3DA 2XKJE 5KWVA 4PZUA 1QG6A 1UAGA 3PYLA 4UREA 1ZIPA 4Q9LA 5ER9A 4D9JA 5HKAA 1NMSA 1E79D 2H7CA 3X1KA 1XLTC 3UA4A 4E31A 5KNDD 1CFZA 1VKOA 1YAJA 3FMVA 4J7XA 3RTAA 3HWWA 1HNNA 1LQTA 3UBMA 2D5AA 5A3VA 3GRZA 2XUPA 3DOOA 4L51A 4C7VA 5FWNA 5F9FA 2QIPA 4UEOA 4E09A 4CG3A 2OZLA 2FSVA 4MRMB 5J2TA 4ZYWA 3CLUC 4DRYA 4ZIRA 4TYNA 4ENSA 2JGIA 4BMVA 4I4IA 4IHQA 5DMXA 1PP4A 2Y9MB 4PPNA 2IZZA 1HYBA 1JI3A 4GXTA 1EM8A 5JS1A 3UUWA 2IOQA 2F00A 1N77A 5IEJA 4UMFA 4BRWA 3EPHA 4QA9A 3UUGA 4EI2A 5L45A 3BCHA 3ICEA 2FSHA 1J09A 1E9VA 3L18A 2DERA 1H1LA 3E7WA 2XIQA 4YAEA 4RMJA 4IILA 2EWWA 4PG6A 2PTHA 3TVYA 2XUGA 2GAOA 3RUEA 1G291 2IZ0A 2COKA 4O2BF 1R0KA 1TM3E 4XJVA 1AE1A 1J21A 5F12A 4C43A 3JR7A 4LZJA 1DOAA 2E4AA 1USKA 1FRFS 4DLBA 1OSNA 3QVTA 1LGYA 1TJ4A 2E21A 2FEOA 3TEFA 5JADA 5B2EA 2I2FA 3LBFA 4Y2PA 3K6SA 2UVPA 5LA6F 3EEQA 1XXHB 1DAOA 4JLOA 2FKNA 3RIXA 1F14A 4I14A 1TVKA 1I79B 2VO1A 1K89A 3DZCA 4XR9A 4ZT3A 4RXTA 3UFXA 4OFXA 3DE6X 3RYCA 3GJ6A 1WVGA 1B8UA 3WNCA 3FDFA 4RLQA 2FFBA 2X19A 4EYGA 5LOVA 3OIYA 1IXSB 3QVVA 1T6ZA 4GXNA 4XD2A 4CEIB 4Q15A 2AJLI 2WD7B 1Y6JA 1FK8A 2GDJA 3GVPA 1VMAA 3MRXA 3VYTB 4HB2A 1R0BA 3QM1A 4JOQA 3ZGLA 4HSGA 4TQGA 4LFBB 3MJHA 4FYWA 3PFGA 4HG2A 1ILEA 4EITA 2OCBA 1Y3CE 3HL4A 1MRZA 2VDVE 3JQGA 2JAPA 1F12A 1KVTA 4PYOA 3VAYA 3ZKWB 1Y8CA 4AZSA 4Z0HO 3C7CB 2YW2A 4Y7CA 3TWOA 3ZXIA 3OBIA 1X42A 3W8RA 3ETGA 1NRIA 3E22A 1VFNA 1G17A 1CD5A 1RXUA 5AKZA 2ZYTX 4D1YA 4EKDA 3FYCA 2Q2QA 2QM8A 2RGDA 3V00A 1N7HA 3NW9A 2OUKA 4L4UA 4PLZA 1WV1A 5B3JA 4ANFA 4DY6A 2NUBA 2IV7A 4US2R 3ER9A 3LC7O 1JX6A 1TK3A 1ADCA 1I1OA 3EH1A 4ITUA 1CZLA 2WSMA 5BVHA 1R8JA 1VJCA 5EGNA 1CR0A 2B4KA 1LTKA 3FMIA 3KR9A 3AZQA 4ZD6A 1L5SA 5JSZB 1V26A 3GDOA 3L4JA 4NBSA 1HYHA 3LRPA 3FI0A 2O8CA 1NQVA 1TM2A 3FVVA 4IRUB 3N86A 3HBNA 1R74A 2J59A 5CGQB 4KWHA 1M6EX 2BZGA 2PWAA 1MORA 1V2HE 1ISGA 1EWYA 4JLSA 4URYR 2HJGA 5C8YA 3GT4A 5LB2A 2X8JA 1HDEA 1BROA 1GL7A 2IHTA 5CFPA 5IG2A 2BKEA 1NQAO 2IE8A 2ZRHA 3G9XA 2OM2A 1R6DA 2IX3A 4A2WA 5FV4A 5E38A 4HWGA 3FFAA 3QE0A 3LOUA 1PR6A 3LOPA 1R2QA 4B3MB 5I5GA 1L8XA 1TTTA 1PKXA 3AU8A 4MICA 3DDCA 5BQFA 4DV6B 2B78A 3F5DA 3QP9A 4PZLA 3FRJA 4C0HA 2PS9A 4TROA 3U13A 4DJTA 2QRMA 4K9DA 3CLSD 3K1AA 3WLPA 2A30A 3T4PA 1GTZA 3RADC 3AFNA 1OIWA 4DKJA 2Z1NA 2PUTA 4EO9A 1K7EB 2ZYIA 2EJWA 3VBEA 4NDZA 4MLDA 4EB0A 4GQBA 3FH0A 4TLCA 1X74A 1KL7A 2MSLA 1HG1A 3EWAA 1E1LA 1T5DX 3X2FA 1P8AA 3QU2A 3PRKE 2JG3A 4B6PA 4ZO8A 4J90A 5J9FA 1Y6GA 3JATB 1PJCA 1Q20A 3D0KA 5G3ZA 3B6MA 1RAGA 4QUIA 3RS3A 3ZYCA 3NC4A 1Y7IA 1JL3A 3ZWKA 1M2EA 1ZNXA 2X7JA 3TX2A 3W9YA 3GU3A 2GZSA 2WU0A 2HRQA 2PJUA 4P0PB 2C8VA 1E4EB 4HZIA 1OCEA 3E5HA 4JJ7A 3DMDA