3BTUA

Crystal structure of the super-repressor mutant of gal80p from saccharomyces cerevisiae; gal80(s2) [e351k]
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
420
structure length
392
Chain Sequence
APIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKIETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIHGTKGDLKLEGDAGFAEISNLVLYYSGTRKEIMKVYHLRNYNAIVGNIHRLYQSISDFHFNTSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSNISHYSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADP regulates the yeast GAL induction system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Galactose/lactose metabolism regulatory protein GAL80
total genus 121
structure length 392
sequence length 420
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3btuA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3btuA01
4OAQA 4WLUA 5BNFA 1PZGA 5G0VA 4CMEC 1JVSA 3GMDA 2R2GA 1B8VA 1H94A 2FWMX 3LYLA 3PHHA 3C85A 4OL9A 3LT1A 3ETDA 1JAYA 1ISFA 1IZ9A 1LRLA 1H5QA 4XD2A 3JV7A 1FJHA 2C54A 4E2YA 4WGGA 3DZJA 1UH5A 2DPGA 3RBZA 1QP8A 4HFMA 5CG1A 1SC6A 4CM5A 2DM6A 3P19A 3WDSA 4DIFA 2P91A 2HK7A 4CM4A 3F4BA 1EK5A 3BMCA 1E3IA 1QORA 1XLTA 1SOWA 2EV9A 2HDHA 4Q9NA 2JD2A 1HSZA 4EJ6A 5K6AA 3I4CA 1PZHA 4M87A 3O9ZA 2WYWA 4GKVA 1B8UA 1DLJA 5IXSA 2RCYA 3OBBA 4GPD1 4BO0A 3PLNA 4D3FA 1CYDA 4A10A 1DDOA 4DIBA 4J7CA 3TL2A 5A4DA 5T5QA 4OQYA 1A71A 4BUCA 2Z5LA 1A5ZA 1G0NA 2RH8A 3KYDA 1MUUA 3L4BA 4DBVO 2RHCA 1Y5RA 4WE3A 2ILTA 4YAIA 2WEKA 3PYMA 1SO8A 5L40A 2FR0A 2I99A 2HSDA 4NIMA 3DBLB 2PZJA 3U49A 1GCUA 3VH1A 4CLXA 4BNLA 4DPMA 1NYTA 4O59O 4CODB 2O48X 1QYDA 3K8ZA 4JK3A 3G49A 4K9DA 4N7RA 3E6AA 3QJ5A 3VPXA 2JFHA 3WICA 1PQWA 1HDGO 4MP8A 4R01A 3QVSA 4TROA 1A27A 1ISGA 1EVIA 5L51A 4YJHB 1C1XB 1NAHA 3IUSA 4YRAA 5FI3A 4FGWA 1PJLA 4NI5A 3RUEA 3WNQA 1K6IA 2B5VA 4DL9A 3NJ8A 4KWIA 2DT5A 3QWHA 4FC6A 1RM0A 2C0CA 5A05A 2QRJA 3PDUA 1H0KA 1R12A 2XAAA 4E32A 4BQPA 3RBVA 1NPTO 4WLVA 2C7GA 3UW3A 2QYSA 1H6AA 5TT0A 2PZMA 1XEAA 3NUGA 4YJHA 1SB8A 5B1YA 3ZGYA 5IDQA 4OOFA 3KXDA 4J1QA 1MLDA 3GG2A 5L9AA 3RJ9A 1GV1A 2E82A 4BS9A 3WGHA 4HY3A 4Y6RA 5JE8A 3WNVA 3UCEA 5I7EA 2G1UA 1JKFA 2GR9A 4CUZA 3D64A 1FK8A 2V7PA 3IP1A 3QY9A 4WCFC 1WW8A 2IZZA 4OSPA 5A06A 5JY6A 2GUGA 2WWRA 3QRWA 3UGKA 1I33A 4BNYA 4E30A 4ZN6A 4N18A 4YB8A 3GN1A 4K6FA 1SBYA 5IDWA 4J3FA 3I1JA 2XF8A 1ISMA 2AXQA 1I30A 2VNSA 1MC4A 3BTUA 1MG5A 3DOOA 3FBTA 3OEWA 3PIDA 3WMXA 4HNHA 2YJZA 1HF3A 1UUFA 1E7MA 3V1YA 5KKCA 1GADO 4Q3BA 3V8BA 1C0KA 4KTTE 2Q2QA 4B8WA 5KJ1A 1F12A 3UICA 1I2CA 4W7HA 4W99A 2DLDA 1XSEA 3ZWAA 4TRJA 4ZQEA 1PJTA 3H5NA 5DN9A 4FS3A 5CEFA 1JA9A 3CTMA 3GQVA 3FPLA 2R00A 3QE3A 1E92A 4DWVA 3A06A 5JMWA 4A73A 1YL7A 2X22A 4MOWA 4U8GA 1MX3A 4Z0HO 4KOAA 2DFDA 4DYVA 5GMOA 3EC7A 4CM7A 2EW8A 3G17A 3CPSA 5I8ZA 4GBJA 3EYWA 4QFDA 4YBZA 3LK7A 4GX5A 3DONA 1EE9A 4DA9A 2BRUA 4OGWA 1TEHA 3ZV4A 5L45A 4TZKA 3KETA 3R3JA 5H83A 1NAIA 3ZNNA 3V5NA 1AUPA 1PJQA 2RH4A 5BNIA 1EFLA 3C7AA 3H9EO 1T2CA 3VZSA 3E03A 3ZI0A 1GUYA 2BI8A 3ABIA 2VUSA 2UDPA 3GGOA 3NEPX 4CLDA 2Y1FA 5ICMA 1PEDA 1X1EA 3V2GA 1R16A 1PR9A 3T7CA 1D1SA 1ZK1A 3RCBA 1Q0HA 4IPTA 3OJ0A 4EITA 4BKQA 4JP2A 4AJLA 4LSMA 2ZTMA 1OOEA 4BMNA 3ZCXA 2Y1OA 3DZKA 1ZO8A 4BNWA 2V6MA 1SAYA 4HWKA 4B7XA 5A9RA 5MDHA 1OAAA 4OSOA 1I8TA 1XR3A 1N1EA 4P8RA 1Y8RA 2B69A 3GZ4A 3PP8A 1C0IA 3RWBA 3WJAA 1A72A 1U2DA 1J6UA 2B4TO 1GUZA 2FR1A 3P5SA 3K9QO 2NU8A 1UDBA 1QKIA 5CG2A 4LCEA 1J5PA 2X7HA 3DHEA 2H1SA 3GRKA 2NACA 3A28A 3Q3CA 3SC4A 4DVJA 3F6YA 1M76A 1PGPA 4ZD6A 3OJEA 4ZVVA 1KC3A 1O94A 4R69A 4NZ9A 4I9NA 4TWRA 3W4JA 1XG5A 1VL8A 4BO3A 1V35A 3B20A 1N7GA 2QYTA 4WEOA 5EESA 3PPIA 2RBEA 5CEEA 3VTZA 3ADOA 4F3YA 2AQHA 1UR5A 4BKPA 2OO5A 1CRWG 3D3EA 5TS3A 4DQUA 1AHIA 1JAXA 1GEEA 3ROQA 2AMFA 3CKYA 1X1TA 4TRNA 1VC2A 4UAGA 1QLHA 3GF4A 1DC4A 2O50A 3RAJA 1ZJZA 3WS7A 3Q2IA 3ON5A 1YBVA 4G65A 1HT0A 3MJCA 3WWYA 3GDFA 3I6QA 3QHAA 4E2XA 2I65A 3GDGA 3WOHA 1YRLA 2ZJ1A 2WD7B 3D3WB 1LDYA 4FFPA 2PR2A 1FDTA 3EGOA 1GAEO 3JQAA 3CEAA 3UOGA 1E6EA 1EQUA 3VKUA 1Y9AA 3K73O 1DXYA 1T4BA 5L4LA 1YGYA 4N5MA 4RQUA 3ZU5A 3PYXA 4NJMA 4XB2A 2HMTA 1R0KA 3W8EA 3ROKA 4GI2A 4DREA 1EBFA 1U3UA 2VHXA 2QRKA 4OHUA 4XEHA 4Q3CA 3P7MA 5EQDA 2Q1TA 3CXRA 3IP3A 4LN1A 4R1NA 1CQIA 1YE3A 1P74A 1NASA 2TMGA 5THQA 4IGFA 5GZ3A 2OORA 4UUPA 5F1KA 3S2FA 3GZNB 3LLVA 4HV4A 4YJFB 1RM3A 4IJKA 4DLLA 4CUJA 1XDWA 4QO7A 4O63O 1JLLA 2ZK7A 4WEQA 1R0SA 4EYEA 3EUWA 2F1KA 1WVGA 2VN8A 5JCJA 1CIVA 1FXSA 2FPPA 3DZFA 3K92A 2Q4BA 5L95A 4RGBA 5L7YA 1R0LA 4BNHA 1KOLA 1L1FA 4BNUA 4RV9A 1X0XA 2VZ0A 1XA0A 4NFYA 1LC3A 4JX8A 1MV8A 4IDFA 4J6FA 3UKOA 2W2LA 5ES3A 4CMJA 4DPKA 3VDQA 1HDOA 4NFHA 4UULA 1L7DA 3W8FA 1TI7A 4GKBA 1ML3A 3PJEA 1N9GA 4R9RA 2VZ9A 4CV3A 5IAAA 4PLPA 3B6ZA 3QLJA 2O3SA 4E31A 4NU6A 1IPEA 5JAZA 4NG5A 1H93A 5AXDA 1HYGA 2HK8A 4LISA 1ZNQO 1E6WA 3MEQA 2GN9A 3OMLA 4E5PA 2JAPA 1BXGA 5JLAA 3DMYA 4P38A 5KVSA 4WKGA 5K0ZA 3E1KA 1MG0A 1UP4A 2P4QA 2QQ5A 1LLCA 1T1RA 2IZ1A 4OKNA 4BV9A 2BGLA 1XQ6A 1PL7A 1Q0QA 1EQ2A 1KVSA 4D41A 2QZ9A 5C37A 3LF2A 2J5RA 4ROSA 4YTEA 5EERA 3I5MA 3JQ8A 4BNIA 5JDIA 4JXKA 2PK3A 3JQGA 1O9BA 4P4NA 4CM8A 2O4UX 3K2EA 4K26A 1I10A 5CDSA 2X23A 3LVFO 3QV1A 3VC7A 4IGEA 5TF4A 2TMDA 2ZB4A 4CMIA 3C8MA 3ORFA 3DOJA 2AE2A 4YJFA 1O95A 3DB2A 4BO2A 1WLYA 4RZIA 2CY0A 2SCUA 3O8QA 3WJ7A 3RC9A 3OQBA 1E1KA 1PSDA 3JD0A 4FCCA 4UEJA 3WQRA 1A4UA 1F8FA 2E6UX 1BW9B 4OH1A 5CDYA 2OUIA 5IDXA 4TVOA 2VHYA 1ZXLA 1B16A 2DC1A 3COSA 5L3ZA 5TSDA 3NT2A 4RVFA 1P1FA 2I5PO 4U6SA 3T4XA 3ZNQA 5I8WA 1PS0A 2C07A 3A1NA 1ZK3A 2NQTA 2YDXA 4LMRA 3VH3A 1E3LA 2X5KO 1E5LA 1FDSA 3CZMA 2NTVA 1FDVA 2O2SA 4Y6SA 5EQFA 4L4SA 4KTVE 1T24A 1ZK0A 4E5NA 3L4SO 1UZMA 3VPHA 3QA9A 2YV2A 3GK3A 4ALMA 4YJGB 3DAFA 4UUOA 3V2UA 1GUFA 1LRKA 5I9LA 3GG9A 4YXFA 2EWMA 2XOXA 4FD3A 4XQ9A 1F06A 3M1AA 4B79A 1EUDA 5KWEA 4HXYA 3GNSA 3H3JA 4Z9XA 3BMOB 2IRWA 3RU7A 4XYBA 3CIFA 3E9NA 4UVDA 2A92A 3ONFA 3ICPA 2ZKLA 3NYWA 4Z0TA 3RBXA 3DHYA 4R5HA 2O2YA 3V2HA 4MP3A 3CINA 1ZBQA 3QWIA 3FTNA 4JLWA 4NPCA 4PLZA 3AW9A 3MOIA 1ZK2A 1H6CA 4I8XA 3TQHA 2PGJA 4CMIB 2IZ0A 1KVUA 3GLQA 2CMDA 4MVJF 1QYWA 1V3TA 2JHFA 4R9SA 2IXAA 4AICA 1JDJA 3PJGA 3KYCA 4C4OA 1WWKA 2W98A 4RO0A 4BNXA 4FBGA 4AJEA 3UHAA 4Z9FA 4IDGA 2AE1A 4CMCA 3D4OA 4YEDA 1BDBA 3GPDG 2EF1A 3GEMA 2FY8A 3ANLA 3HWRA 1YBMA 3LF1A 5DCYA 4J43A 4ALJA 3TNLA 1K2WA 3ZWNA 4IINA 2UVDA 1TA4A 2O3RA 5BNTA 4RPJA 4L9RA 4GVLA 4NR0A 1GEGA 1U2GA 3O03A 5JBIA 1LXCA 2A94A 3JQ7A 1Q7GA 1U5AA 3K6JA 1LQTA 4YVFA 3VPFA 2C82A 2PZKA 4NDNE 4XKJA 2GNAA 2VHZA 3GH3A 4BMVA 1LUAA 3RC2A 4C7KA 2DBVO 1R4MA 4XYGA 1Y1PA 5TNXA 3DZBA 2BFOA 1VRWA 3ZWPA 4DPLA 4OXYA 1PJCA 2DUWA 1ZUD1 5BSGA 2ZYGA 1I3LA 3U4HA 2FOIA 4Z3KA 1B15A 4QFCA 1WMBA 1SZJG 4JGBA 2AQ8A 5MGBA 1YQDA 4W6ZA 4NBVA 1QLJA 1I3MA 5U9CA 2OMEA 3ROPA 2VYND 3D5TA 2GDZA 3KSDO 3QVWA 2VUUA 4R1UA 1V3UA 4IDCA 4PLYA 1SPXA 3ITKA 5KOIA 4MPDA 1ENOA 1BMDA 3AK4A 1PJ2A 4ITUA 4G81A 1NR1A 1X0VA 3H2ZA 5JAIA 5F21A 3NGLA 5FWNA 4PLFA 2FZEA 3MJSA 1YWGO 2IODA 5H82A 1NVGA 3CE6A 2R6JA 1LQUA 5KJEA 1SEVA 1ENPA 4PG6A 3NTOA 5JDIC 2DBRA 3ITDA 2Q2VA 3R0IA 3IIEA 4MVJA 1SEPA 2JL1A 2Q1WA 3NTRA 1ZEMA 3AI2A 4BGEA 4CMHA 2NU7A 3FI9A 4B3JA 5A5EA 4XQEA 5EL0A 1XU7A 4R5MA 1QV6A 2QX7A 4HX5A 4PN3A 2VWGA 3WYEA 2O3QA 2EKQA 2VWQA 3NAQA 4PFJA 5G4LA 3LU1A 3ZN2A 4NH4A 5JXWA 2Q1UA 2W8ZA 3HDYA 3VZRA 4K6CA 5TX7A 4GMFA 5F1OA 5TJ9A 1XIVA 3RASA 3WIDA 4MJLA 4ZGWA 2ZTLA 5HWSA 1IULA 4BKRA 3VH2A 4CMGA 3VKVA 3U4IA 1NQ5A 3HDQA 4GSKA 2ZCVA 2C2XA 2Z1NA 1D1TA 4RCVA 1HDYA 5IFLA 4CM9D 4ZICA 1DOHA 3AU9A 4WK6A 1U8XX 3Q2KA 3ETEA 4BNJA 1FF9A 3JD1A 5LC1A 1YOVB 3ENNA 3JYLA 1PJ4A 3BHJA 1GR0A 3DEYX 1VSVA 4WLOA 2DTDA 4R68A 5KVQA 1QXSA 1LC0A 2E48A 3E9QA 2HJRA 4A0SA 3OETA 4Q3NA 1QMGA 1T2FA 4JBIA 3ASVA 1ZSNA 3UUWA 4Y98A 1UP6A 1W4ZA 1A9ZA 4IJWA 2BFMA 4CL8A 3ZWYA 3RROA 4DGSA 2C29D 5JY1A 4BHTA 1BVUA 4MDHA 1UXKA 2PTGA 5CP8A 1YDEA 1T25A 1CEQA 4ZRMA 1EMDA 1WZIA 1X7DA 2JAHA 4A03A 4RJTA 4NHEA 3IOYA 4RDIA 5DF1A 4CQMD 3D7LA 1Z75A 1SNYA 1W0CA 2DKNA 4WUVA 2EP5A 3NKLA 1Z6ZA 2VRBA 1DAPA 5ICSA 5DOVA 1JTVA 2NWQA 4PG7A 1NPDA 2ZATA 1KVQA 5C7OO 3D5QA 2AEJA 1C0PA 3GN2A 4GLLA 4WLFA 3E82A 1DFIA 2O4CA 4CQMA 3LZ6A 1A7AA 1ZK4A 4ALNA 1PS9A 1E6UA 3Q11A 4GWGA 4L75A 5KJFA 4KP7A 4L4XA 3WSVA 1VJ0A 1CWUA 4FFMA 2ZCUA 4KZPA 4YT4A 5IDYA 5HM8A 2W4QA 2B36A 4O6VA 3R3SA 5HRUA 1DB3A 4TRMA 2VCYA 3VVBA 3EHEA 4Y8VA 3FN4A 1Y6JA 3X2FA 3IQDB 2BI7A 4BGUA 4L76A 2GASA 4Q3DA 4CLEA 1W8DA 4NQZA 4WLEA 1HTBA 2CNBA 4KUGA 4PLHA 1C1DB 2EJWA 1HXHA 5KJCA 1EFKA 1C0LA 3TWOA 1T2EA 3ZNPA 4XGNA 2VRCA 1MP0A 3FR7A 1BTOA 4OIMA 4B4OA 1K6JA 3JQ8B 3PHIA 5DT9A 1TVEA 3C1TA 4XWYA 1PZFA 3WWZA 3H7AA 4X54A 4PLVA 3SX2A 2Z1MA 1U7TA 4CLOB 3PEFA 2VRCD 1P1IA 1DC6A 1SOVA 5COQA 5CDGA 1EZ4A 4DBZA 4M54A 3WGYA 1M67A 1U28A 4J0EA 4L8VA 1Q7CA 4LVUA 2WSBA 3IMFA 3QW2A 5ER9A 4EBFA 2A9FA 2WM3A 1HE3A 3DQPA 1HL3A 1LTHR 2EP7A 2BGMA 1DRUA 5AOVA 1IOLA 3I9JA 4FDAA 5KNLA 2P4HX 4R1TA 2D3TA 3JD2A 2GSDA 1B2LA 4II2A 3SJ7A 1CQJA 2YHIA 5IZ4A 5DULA 1GYRA 4GX0A 3PVZA 5DZSA 2JFGA 1U4SA 4GVXA 4Q3EA 4YRDA 5EMHA 1LSJA 5JC1A 4Y9DA 4ZU3A 4AJKA 2VTEA 1LDMA 3Q9NA 3BTVA 2G0TA 4CLRA 1RM5A 1R4MB 1KIFA 1QR6A 5JYEA 2LDXA 5EJ2A 2Q1SA 2C5AA 4D3DA 3HJAA 3DOCA 4FJ1A 3ZNOA 2C5EA 3ZW8A 3ZHYA 2B4RO 4QEDA 6ADHA 3UCXA 3UXYA 2B37A 4WPGA 5G0UA 1AXGA 5AYVA 2CDBA 2OL4A 4QQRA 1HLPA 3BHIA 3RD5A 5DP1A 2V6BA 4DRYA 5IN4A 3ZWCA 4B4WA 1PWXA 2O7QA 3DZIA 3TFOA 4M86A 1KETA 5T73A 2PH3A 3HNPA 4MIYA 2QRLA 3VZPA 5AVOA 4AG3A 1HRDA 1GD1O 2EG9A 1EK6A 3OJOA 3X2EA 1PWZA 1LA2A 3ZHXA 4BNKA 1P3DA 1MFZA 1ZFNA 2Y1DA 3KYCB 1IB6A 1V9LA 3L07A 4PGFA 3H6KA 2JCVA 2ZQZA 1I32A 3WGTA 4GQAA 1VLLA 5JAMA 3JQAB 1LSOA 1QSGA 1PGNA 3VHRA 1ENYA 2PKQO 2D59A 4K1LA 2X0JA 1KEVA 3U0BA 2CVOA 1P45A 3JQCA 1D8AA 1PQPA 1P77A 2PD3A 4RF3A 2R00C 3WSWA 3FR8A 4XX0A 1T4DA 2VWHA 2DAPA 5T8KC 1BSVA 3QWFA 1GZ6A 3NX4A 4B7CA 1LJ8A 3NDIA 4CQMB 3EZLA 2BMAA 1N92A 3UN1A 1P1RA 4GX2A 5T8KA 1LEHA 2V6FA 3KTDA 2AEFA 2B35A 1LSSA 1ADCA 1UZNA 5FYDA 3EVNA 3BMQB 2X4GA 3AUAA 4LRTB 3OIFA 4BNMA 1GYPA 2EERA 3GFBA 4I5DA 3AY7A 3NT5A 4IM7A 3PQDA 1BXZA 2VT3A 2WTBA 3JYOA 4BV8A 2GN6A 2YQ4A 3BA1A 3K96A 1ZMTA 1DJNA 4FC7A 4KDEA 4B3HA 3NRCA 1P1HA 2AQIA 2GN4A 3JTMA 5IZCC 4J0FA 1OMOA 2EGHA 4XIYA 4BO4A 3HFGA 4NNJA 3KHUA 4W4TA 1PZEA 1NWHA 2V65A 4PCVA 3H9GA 1WP4A 4CM4B 4BO9A 2PH5A 1K0UA 3G79A 2YHIB 4ZRNA 3MCVA 2OBYA 3NDJA 4HFRA 1DC3A 3OH8A 4TSKA 2W2KA 2J3IA 4CM6A 3GOHA 4PLTA 3OIDA 3DR3A 4MKXA 3ZWOA 3D1LA 2X8LA 3FSRA 1KERA 4ZA2A 4MVJE 1QRRA 3ZU3A 3WQSB 4J16A 2Y99A 5U4QA 2UAGA 5GY7A 3S2IA 2GD1O 3DBRB 2C7VA 4RVUA 4EJ0A 4IZIA 4BNZA 1O8CA 2HRBA 4ZQGA 5JDCC 1HSOA 3GUYA 2P9EA 2XXBA 1OC2A 3DBHB 4E3ZA 1Y7TA 3L6OO 5AXAA 5KKAA 3DBHA 3FNHA 1MA0A 3ZU2A 2PLAA 1YQXA 4D0SA 3WGIA 2EIHA 1XQ1A 3TPCA 2XXJA 5I7VA 4MVJD 4IIVA 4YACA 4BNVA 1DHRA 1NXQA 5JNLA 3VPGA 5ER6A 1PX0A 4FOSA 1ZZEA 1NR7A 4PG8A 2NVBA 5T57A 1HDZA 5CEJA 4OXKA 4XGIA 4E2ZA 5K9ZA 5F5LA 3AY6A 4HADA 3H9UA 4O1MA 4MVJH 3GNTA 4OYRA 2PGDA 1E7RA 1E7YA 2WE8A 3AM3A 3PDJA 3ZDFA 3I83A 3VH4A 1KEUA 5F1PA 3N7UA 2GN8A 3KLMX 4CJXA 3LT2A 3OM9A 4E21A 1M6WA 1GYQA 1LDEA 1GY8A 1YB5A 3PIIA 4D43A 5KJ6A 1YL6A 1GL3A 2AW5A 5JCJD 4XB1A 3HQ4O 5LCXA 4EDFA 4MIOA 4HFJA 3H65A 3V1TC 2OGUA 1NVMB 4RPHA 4W82A 2HLPA 1KC1A 3BMNA 1K3TA 2H6EA 1MB4A 3WTCA 4R51A 2WJPA 2W2LD 1MC5A 3E8XA 3LDHA 3BZUA 2YV3A 1S7CA 1U3TA 2G76A 3KEQA 4RF5A 1XGKA 2GZ1A 4PZDA 3U4DA 5FI5A 2OZPA 4J1SA 4J4TA 3GAZA 4WOJA 4NBRA 1PJSA 2B83A 3DTYA 4M89A 4I08A 3VZQA 3FHLA 3BIOA 1WDLA 2RAFA 1U4OA 4WCFB 3JYNA 5JYDA 4LW8A 4U0KA 5G0WA 4QECA 3FTPA 2NUAA 3ZHZA 2D2IA 2ZTVA 3Q9UA 2YFQA 3RFVA 5HA5A 4D3SA 3KSZO 2CUKA 3FF4A 3PXXA 2Y1CA 5HBRA 3WIEA 2OP0A 4MVJM 2W2KB 1DFGA 1EUCA 4IQGA 2PKQP 3GY0A 1LI4A 3LC2O 5I7SA 4JROA 5DOZA 3JQ9A 5JC8A 1HDXA 5A9TA 5FFFA 4J9VA 4URFA 1MFPA 4YPOA 2JHGA 3ST7A 1YXMA 1IZ0A 3HUDA 1PIWA 3ONDA 1HKUA 4FGSA 1IHXA 3ZU4A 2H63A 3DO5A 3K5PA 4B4UA 1HDRA 2J3HA 1K89A 1X7HA 5TT1A 2HMUA 2QIOA 4YJGA 3GMSA 5BSHA 3INGA 1UAGA 5BSEA 3HN7A 1H9BA 1WAMA 4L4RA 3WG9A 2ZYDA 3SVTA 3F1LA 3UF0A 1GZ4A 1DIRA 3VPSA 5COBA 5GZ1A 5DBGA 3GR6A 5G0TA 3RKUA 3GT0A 3FWNA 2VNAA 4PLWA 3KLPX 3RUHA 2VOEA 2BFPA 1LX6A 4B7UA 4ZJUA 2E4AA 3I9NA 4PG5A 1R15A 3T4EA 4YT8A 1R66A 3SEFA 1TLTA 1VSUA 3L9XA 3B70A 4EW6A 2HK9A 4CMKA 4D7AA 1A4IA 4E2WA 2Y0EA 4CLHA 3PZRA 2IYPA 2D1YA 3GA0A 2JFFA 1PS8A 3B1FA 4U6QA 3NJ4A 1JN0A 2JCXA 3ULKA 4CUKA 1HE4A 3AUTA 3U9LA 3ZHBA 1YL5A 1NWCA 4AJOA 2UUOA 1L7EA 4AJPA 3I9MA 1OC4A 2XPCA 4IY1A 1H9AA 4GL4A 4O0LA 1P1JA 4OJNA 2FR8A 3GGGA 1AHHA 2Y93A 4YAKA 1EDOA 1ZKMA 1EBUA 1BW9A 3AUSA 1LDNA 1V3VA 4E12A 4TRRA 2WMDA 3HB4X 2J6IA 3CSDA 2UV8A 4A5OA 3F46A 1M2WA 3AY3A 4PVCA 4BO1A 4LCJA 3BMCB 4YWJA 1YB1A 4DMMA 1YDWA 1U3WA 4Y67A 4KUEA 4RQTA 3EAGA 1HEUA 3ANNA 3TZQA 1O89A 1UP7A 5KVCA 4ID9A 3EZYA 3TZHA 1JQBA 1O0SA 1Y5MA 4CMBA 1E3EA 1PU2A 4JN6B 1FMCA 8LDHA 4MKZA 1DRVA 3B1KA 1UAYA 4NMHA 4QT0A 1Z7BA 5B4TA 4WASA 4R41A 4BNGA 2FZWA 3A4VA 3UFXA 1VI2A 3L77A 1UZLA 1SB9A 2I3GA 1BRMA 2H9IA 2EJVA 3DL2A 1EEHA 4U5QA 4UUNA 1DIHA 1OI7A 3HDHA 2PD6A 4PVDA 4DMLA 2H5LA 3FD8A 4IS2A 3C7DB 3Q0EA 1OFGA 1JVBA 1NNUA 1HLDA 3C24A 4WOKA 3LSYA 4DUPA 2IYOA 4ND5A 3JD4A 3GAFA 2I76A 2GZ2A 2QW8A 3P2OA 4RDHA 1SMKA 3AM5A 3VVCA 3HSKA 1K6XA 1O6ZA 3RC7A 3RUCA 3E48A 5C7LO 3BTOA 4IS3A 2DVMA 3RQSA 4K28A 2CF6A 3T7EA 4ESOA 3MZ0A 3VAZA 4WECA 1GQYA 2HMWA 3AI1A 4H15A 5A5FA 2X5OA 5ITWA 1Z82A 4GAEA 1HDCA 4BMSA 5J23A 4EUEA 1X15A 1F0YA 1NFQA 4HBGA 4DTIA 4QTZA 2A4KA 2NTJA 5L7WA 1YB4A 4U7WA 3ZH2A 2FP4A 4J90A 3F47A 2I9PA 1AXEA 2DU8A 3BTSA 1ADFA 2Q22A 1LLDA 1N7HA 3RJ5A 4BNFA 1J4AA 1HYEA 3EK2A 5B4UA 5B4VA 5HS6A 3OQ6A 3QWAA 1EUZA 4EUHA 1E3SA 3JQFA 2OXIA 3FWZA 1IYZA 2Y0CA 2Y66A 4Z3DA 3EVTA 2JD0A 4W7IA 5HS4A 5A04A 3OIGA 1N9GB 4CM1A 5FEUA 1HZJA 1I5RA 1ZVMA 1NHWA 4JCOA 3ZV6A 3DHNA 2HAEA 3PRJA 1P1KA 4XRGA 1M66A 2I6TA 2PWZA 2HO5A 2Y1GA 2J8ZA 4FOOA 5JCXA 3GPIA 4PG4A 1MXHA 1QG6A 1LBEA 3RUFA 4BO8A 1IHYA 1Y8QA 4XCVA 4JJFA 1P31A 8ADHA 4MP6A 3H2SA 3KO8A 3WLFA 4DQVA 2GRAA 5T67A 1YKFA 2DBQA 3W6ZA 4LK3A 4B4VA 2AG5A 4IXTA 5L53A 1H2BA 1LSUA 2Y05A 4IQ8A 3JQ6A 2PY6A 1PTJA 1RKXA 4FN4A 1BG6A 3I9OA 3ZV3A 2NV6A 3QVOA 2DTEA 2VUTA 1ZW1A 2YW9A 1ID1A 4BL5A 5JYFA 1G0OA 3H9JA 4AVYA 2Q2WA 1DBVO 3FBGA 2X0IA 1GFSA 3DWFA 4FPXA 3PLRA 5DP2A 5G0SA 2P9GA 3AFNA 4CR6A 1KY5A 3H8VA 4PRLA 1ORRA 3OQ1A 1VE9A 1JKIA 3WGZA 4OO3A 1Q0LA 3G1UA 3GDOA 2G5CA 3QIVA 4CM8B 4EEXA 3HE3A 3L6DA 1VM6A 1ENZA 4D45A 3LC1O 4H7PA 3TDKA 1F8GA 2VQ3A 4A2CA 4L0QA 4XQCA 3HHPA 3O8QB 3BMQA 1KBZA 4UVEA 3CUKA 1KEPA 3JQBC 4M8SA 1HE2A 3NDRA 3TZKA 3WQQA 3U4CA 3U62A 3DDNA 4FFRA 1TT5A 1WMAA 1VKOA 3D3WA 1VL0A 2P9CA 3HDJA 1ZCJA 3AI3A 1IE3A 1MGOA 3ZZNA 4AJ4A 3OFSA 2Y0DA 3CH6A 3DFUA 3E5RA 1XCBA 3RUDA 2CVZA 2BHLA 2ZYAA 3GFGA 4IDEA 4TVBA 1PL6A 1V0JA 4ALKA 2X86A 1B26A 3D0OA 2CF5A 4WJZA 1BXKA 1MXFA 4MO2A 4IDAA 2J5KA 1NHGA 5EPOA 1JW9B 3ASUA 1G6KA 3QWBA 3Q1LA 1LU9A 2HJSA 3IAHA 4FFNA 4Q3AA 1NFRA 2PD4A 3UAGA 1I01A 1UJMA 3GEGA 2NSDA 4EJMA 1YS4A 2CZCA 3TJRA 4QX6A 2AA3A 2EHDA 3G0OA 5CHEA 3PZBA 3V1UA 4NJOA 3U09A 2EXXA 5TC4A 3E5MA 2GYYA 5M6DA 1ISJA 3F5QA 4CLRB 4FFOA 4E33A 2POQX 3PK0A 4BGIA 3INTA 4R54A 5JAQA 3AWDA 2OBNA 2FPIA 3KV3O 1GCOA 3QSGA 1ONPA 1PJ3A 3NTQA 2YY7A 3F1KA 4YCAA 5A1TA 3WYCA 4FSHA 1ZMOA 1CERA 2PA3A 5CPBA 1E3WB 3F3SA 3OSUA 5ENVA 3VDRA 2C20A 1YJ8A 4RORA 3L9WA 2JKVA 2OOSA 4GH5A 4Z6KA 3SBOA 3F5SA 4D44A 4BQRA 1DFHA 4TKLA 1E7WA 1JWBB 2J3KA 3WX0A 3JQ9C 4RPLA 5IG2A 4CMAA 2F00A 3I52A 4ILKA 2BKAA 1V6AA 5TGDA 3DAPA 4KQXA 1NVTA 3TZ6A 1LLUA 1Q1NA 2B0JA 4N54A 3PFFA 5A03A 1Y81A 2JJYA 4P4LA 4E5YA 3I9LA 3IL2A 4S1VA 3SJUA 5ILGA 4EZBA 4AJHA 3VTFA 2YV1A 1H6BA 3GEDA 1W73A 3KM0A 4YYZA 1LDGA 3PTZA 1E3JA 1BXGB 4D46A 4JNKA 3H5AA 4R4JA 3AOEA 1U5CA 3GVXA 5G4KA 3M2TA 1T2AA 1Z73A 1E7SA 4CPDA 1YQGA 3MJTA 4IIUA 4ND4A 4YJDA 5H81A 3PGXA 3C7CB 1PGOA 2PKRA 3MTJA 2IDZA 4OXNA 4YAEA 3IJRA 1IL0A 2FMUA 2WD7A 3OA0A 3E9MA 4YDRA 4R1SA 3PYLA 5DCWA 4KWHA 4EGFA 3S1LA 4QUKA 3W4IA 3GVIA 4XR4A 1DIGA 1Z7EA 2HKIA 4I5EA 3JD3A 4D42A 1FDWA 4NBUA 6LDHA 4LRSB 1Y9EA 3G3EA 1ISHA 4I9HA 4R16A 4XJSA 1P0FA 4IUYA 4HNGA 4XZ3A 4DLAA 3EW7A 4YAJA 4NBWA 3WGQA 4J2OA 3K31A 3L4BC 2A35A 1C1DA 4YT2A 4M55A 3WMWA 3DZGA 4YA6A 1ZJYA 1UXIA 3PWZA 2YDYA 3RU9A 1GZ3A 1PGJA 2PGLA 1JU9A 3ROMA 3GVHA 2GZ3A 4FJ0A 9LDBA 4GX1A 1ARZA 5AXBA 4XYMA 4CV2A 5LDGA 2FSSA 2P5YA 2FHSA 5L4NA 5LDHA 3MJ4A 3DMTC 4RF4A 1I24A 3LLSA 4D79A 2VTDA 2YQ5A 1RYDA 3WXBA 2PNFA 3OA2A 3DMTA 4I9UA 5A3VA 3ZWXA 4WCFA 3OHSX 2C59A 1KEWA 2ZTUA 1OBFO 1XU9A 2YFHA 3KB6A 5DBIA 3SLGA 2EKPA 4GGPA 4ALLA 1QV7A 1ISIA 4JJIA 5KIAA 2NNLD 2D0IA 1LLQA 1GPDG 2EGGA 2NM0A 1GTMA 1R4NA 3EDMA 4XDYA 5ADHA 1F14A 1VL6A 1CF2O 2HUNA 5BSFA 1U9JA 4YRBA 2GERA 2E49A 3STHA 4DYDA 1U3VA 3KBOA 2ZB7A 1V8BA 7ADHA 4RF2A 2PFGA 2GCGA 2VHVA 5JO0A 3P2YA 4YAGA 3BMOA 4E5KA 1T1SA 1NTOA 2D4AA 4PLGA 1ZH8A 1C14A 4XRRA 4TMFA 5DDIP 2Q3EA 3DC2A 3OP4A 3IKVA 2BFAA 1TB4A 4XJTA 1QYVA 2HRZA 1ADBA 2X9NA 3O38A 3RUIA 1NX6A 4MVJG 1KVRA 1LDBA 2FSVA 4GLOA 3UCFA 5IZCA 3RVDA 4I5GA 2GGSA 3ENKA 7MDHA 5DBFA 3OF2A 2X6TA 3RKRA 4MIEA 5KCZA 1TXGA 5JYAA 2FRDA 5JDCA 4CR7A 2YZ7A 3BAZA 2WYUA 2ZQYA 3AJRA 4J9UE 4BB6A 3MJEA 1I3KA 3BMNB 4IMRA 4RPKA 1P9LA 3I9KA 1ULUA 3GZNA 4BKOA 3GVCA 2EW2A 4JIGA 1U1IA 3U3XA 3SLKA 4QO8A 4AJJA 1GPJA 1HETA 2UUPA 3KSUA 5A9SB 3H5RA 3I6IA 3HG7A 4RZHA 4QSMA 5C7IO 4PLCA 1YJQA 5DNAA 4J4BA 3RFXA 2YYYA 3QVTA 4DXHA 2VWPA 4BOYA 2CSUA 3QQPA 4BNTA 3IKTA 1NBOA 4PZEA 4H16A 3WYBA 3PGJA 4GSLA 4TZTA 3ZV5A 4INAA 3OICA 3IS3A 2PV7A 2BGKA 1QYCA 1N8KA 1IUKA 3K2BA 1P0CA 2GO1A 3BYZA 4NU5A 4W9NC 2X0NA 4A7PA 4CLOA 1NP3A 1UXJA 4A26A 5JSFA 1B0AA 4Y6PA 2VT2A 3PHJA 2B4QA 5DCUA 1Y8QB 3ADPA 4IQ0A 4MKRA 5TJHA 5ITVA 2V6GA 4BB5A 3ANMA 1K5HA 4OKIA 4MVJI 3DTTA 2X58A 1N5DA 4J1NA 4L73A 2WDZA 2J5QA 4AJ2A 5A9SA 3MJVA 1EVYA 4Q39A 4LGVA 2DQ4A 3R6DA 5G2OA 2IE0A 4DQXA 1B3BA 4Z0PA 3GHHA 5K6AC 3PWSA 1NQTA 2DUUA 3JCZA 5KVVA 5THKA 5T64A 4PIVA 2Y1EA 2X0RA 2HQ1A 1WNTA 3MTGA 3ZWVA 3R1IA 4RVGA 4GGOA 4FR5A 4JP3A 3TOZA 4OOEA 1PL8A 2JCYA 1YH3A 1CJCA 3OECA 4CR8A 4JBGA 5T6BA 3GGPA 1EVJA 4E13A 1DAOA 4FB5A 2P5UA 3WGGA 4JBHA 3WFIA 3ZWMA 1FDUA 3PQFA 4OM8A 4FQ8A 4F46A 1ZXBA 4LVCA 3NV9A 4M49A 4HP8A 1UXGA 1G1AA 3GNQA 1ULSA 3DBVO 4R3WA 3FRJA 4F6LA 2AQKA 1NFFA 2NLOA 4YT5A 4DC1A 1VPDA 3HB5X 4XYEA 2GF2A 2J3JA 3ETGA 1ZIDA 4CV1A 4R3NA 1R6DA 2G82A 3H3FA 4TKMA 2RHRA 2OFPA 2ZJ0A 2BD0A 4PZCA 3KRTA 2DTXA 3S2EA 2RIRA 3KZVA 4IJVA 5TIIA 4IXWA 3U5TA 1KS9A 5L4SA 3WLEA 5HTOA 2O7SA 3SC6A 3WGOA 5JS6A 3PI7A 4BO6A 4EI2A 5I9NA 3FPCA 3DXFA 2P68A 3AM4A 2QZZA 3WR5A 4UVHA 1LRJA 1RYEA 1UDAA 3C3XA 3HFSA 4H3VA 1E5QA 1BGVA 1ONNA 3L6EA 3AUUA 2HMVA 5CDTA 3TZCA 2CDAA 2VYVA 4E6PA 3HZZA 1X13A 2Y68A 1WZEA 1SCUA 4U0JA 1PJBA 1KVTA 3E18A 4Z9YA 4DC0A 4MINA 3JYPA 1HE5A 1YOVA 3INRA 3TSCA 2QHXA 3C1AA 1C1XA 5JW6A 2GLXA 1WDKA 2Q4EA 2VYVD 1N2SA 3HN2A 4FIZA 4F45A 3AOGA 2VYNA 1ONOA 2FPGA 3JQBA 5G4KB 2I3AA 3A9WA 3GUCA 3JQDA 3OJFA 1E77A 3BXXA 3PWKA 1HWYA 5AXCA 3M6IA 2O3JA 2BELA 1DPGA 4P4GA 1X14A 2Q50A 4ALIA 4BIIA 1XYGA 4WNIA 4J2HA 2X5JO 3WBBA 1E7QA 3QVXA 3ICCA 5IN5A 1P44A 4HKTA 1KY4A 3W1VA 3BHMA 4W9NA 4ND1A 5L7TA 3UVEA 3S8MA 4E4YA 1VKNA 3FCOA 5FF9A 2X9VA 4CM3A 1P33A 3NT4A 1ZSVA 1H6DA 1GQ2A 1NQAO 5U1PA 3S55A 1ZSYA 2NVUB 2NU6A 1Y8RB 1DIBA 2ZIZA 4ZQFA 3DAGA 4YR9A 4UEOA 2DFVA 2IEBA 3LT4A 4WNCA 1E3WA 4BO5A 3F4LA 4B3IA 2WE7A 5EN4A 1XKQA 4EEZA 1YO6A 2WD8A 2EKLA 1CDOA 1I36A 1A9YA 2NADA 3OJLA 4KMSA 5CAEA 4NFSA 5B12A 3S2GA 1I3NA 1DSSG 1Q7BA 4CL3A 1O5IA 3FNGA 5GZ6A 3JQGB 2I66A 1VJTA 5BQFA 1XWFA 1B3RA 4J4HA 2Q99A 4CQLA 1BDMA 4J7XA 5EINA 5F3RA 1PGQA 5C5IA 3PJDA 4IZHA 1U7HA 2AEMA 3RI3A 1BVRA 3GRPA 4ONEA 3JQFC 4HFNA 4IJUA 1DJQA 1RPNA 2HCTA 5IXYA 1JKJA 2Y67A 1WXDA 3LC7O 3KEOA 4AJIA 3HADA 2EEZA 2D5AA 1I2ZA 3VOSA 3NGXA 3IJPA 5IF3A 4AJ1A 3A14A 1Z74A 5IJZA 3PQEA 2HU2A 3DBRA 2G17A 4XA8A 4YQYA 3RSHA 3TOXA 1DO8A 4G2NA 1XHLA 1UXHA 2LDBA 3AOEC 4RVHA 5JMPA 4XGKA 4I1IA 3B1JA 2D8AA 3KYDB 4QXMA 4UEKA 1UDCA 2NVWA 3I3OA 1DIAA 2VOJA 4NK5A 2P2SA 4RVDA 1PR3A 3AFMA 3TL3A 4DIOA 2E37A 4CV0A 4D0RA 2CD9A 1YONA 4AFNA 9LDTA 4B8ZA 1E1NA 3W8DA 5C3MA 3W6UA 3ZWWA 5CDUA 2DBZA 1XELA 1DC5A 1LNQA 3FNEA 3MWEB 2I67A 4J1TA 1R37A 2B5WA 3KYBA 4GWKA 5TLSA 1DHTA 4AL4A 4CQLB 5A02A 2X1HA 5J9GA 2IEDA 1ADGA 2D5CA 3H9QA 2DPHA 4RLSA 1J0XO 1EDZA 1A7KA 3G1TA 3KVOA 4OQZA 4RL6A 3L0DA 3D4NA 1AN9A 3KUXA 3I23A 1BWSA 1W6UA 2NTNA 1M6HA 4HUJA 1R4NB 4TQGA 4KQWA 4UVGA 4IMPA 1RM4A 5EIOA 2X9GA 1B7GO 3PFWO 1E1MA 1JWAB 4JQCA 4BVAA 3TN7A 1I2BA 5TQVA 3TFQA 4OMUA 4NK4A 1IY8A 1X7GA 5B37A 4CMEA 3EY4A 3PJFA 1GU7A 2Q49A 1Z45A 2IXBA 3EMKA 1TT5B 1YBAA 3DBLA 4IBOA 4ZQHA 3LQFA 3H4VA 2HMSA 4J7UA 4ZHSA 1TT7A 3WTBA 3TF5A 5F5NA 3FNFA 1D7OA 3C1OA 5BT9A 2CFCA 4ND2A 5AQ1A 1CETA 3MOGA 5KTKA 5ILOA 3TRIA 4FJ2A 3F9IA 3M2PA 4DLBA 3PHLA 4E0BA 4KUHA 3RC1A 4XQGA 5A3JA 4E5MA 4XIJA 1DEHA 4C7JA 4RLHA 2ZB3A 1DLIA 4KDFA 3JSAA 1KYQA 4UREA 1NM5A 2O3UA 1Q2XA 3DZHA 3GVPA 3N58A 3OEYA 3W4KA 3ZWBA 4FW8A 4IDDA 3LT0A 3JYQA 2QG4A 4J91A 3O26A 2NU9A 4O5OA 4G5HA 1S6YA 3WFJA 4JJGA 1GV0A 3QP9A 1NQOA 4IDBA 4L74A 4XDZA 1J49A 4BNNA 1B14A 2ZB8A 3K30A 2W90A 1QYXA 2PZLA 4S3MA 2AG8A 2O23A 3AU8A 1E1LA 2O3TA 2VHWA 1B8PA 2OHXA 2YHUA 1N1GA 3N74A 4EUFA 4N5NA 2CDCA 5COAA 3IUPA 3JQEA 5JFOA 1C3VA 3UH1A 1U8FO 3O4RA 4NBTA 5JO9A 3CMMA 1D4FA 3JQAD 5TRTA 1YVEI 4WLNA 1HYHA 4P22A 5CPFA 2JD1A 4GMGA 3D4PA 5I7FA 5BR7A 3Q6IA 3GC6A 4XR9A 5JPIA 4WCDA 2BH9A 3IDSA 2CVQA 2Q46A 3RUAA 1OZAA 4J49A 2GPTA 4ND3A 5ENDA 3MWDB 3ONEA 3WBFA 2OP1A 1EVZA 4II3A 3I4FA 3KOUA 4RVSA 4BGVA 4RPGA 4UUMA 1IPFA 2BF7A 2ET6A 4XYLA 1AE1A 4BO7A 1T26A 5I9MA 1RWBA 4N5LA 4YQZA 3RFTA 3SXPA 2FN7A 3ZW9A 2NQ8A 2C2YA 4AJNA 4LMPA 4ZQBA 5CFZA 3PHGA 3WB9A 2YUTA 2VZ8A 4BKUA 2NVUA 1I0ZA 3CZRA 1T2DA 1HZZA 1WPQA 1WDMA 3DFZA 1VJ1A 4M1QA 2Q45A 1DRWA 2UYYA 2WYVA 1BHSA 3GHYA 1D3AA 4NJMB 1M75A 4MVJP 2AHRA 1ZEJA 4PRKA 1F17A 2BLLA 4FFLA 4UVIA 4A27A 4CM9A 3M1LA 1GDHA 1NPYA 4I5FA 4F6CA 1E0DA 1AGNA 1RJWA 4LSWA 3RIHA 2Z95A 3JQ7B 1H2HA 3CMCO 1GQQA 3IC5A 1EE2A 1PQUA
chains in the Genus database with same CATH superfamily
2FGKA 5HOQA 4OMDA 4PAGA 3EGDA 4WLUA 3LBYA 2C84A 5G0VA 2NYAA 4G8BA 3WA6A 2WKRA 1AZTA 4B7AA 3LYLA 2R2GA 1XZJA 2JFVA 3HYNA 4EFLA 5HIAA 3IIJA 5FWAA 1WOYA 3KQUA 3LT1A 5G02A 2ID7A 4DRXB 1IZ9A 1LRLA 2W58A 1H5QA 2R5WA 3PV0A 1YACA 1MB2A 2WZDA 3HA3A 3EF3A 4WGGA 1K63A 4DANA 3DZJA 1P19A 1CS4C 1V6CA 2NXNA 3R40A 1ZY2A 3ZR4B 3V4FA 3NM4A 1DOZA 3T9EA 3ZHCA 1XTSA 4M9CA 3OVMA 3WDSA 1XDSA 3BL6A 3I5YA 1Z5OA 1THZA 5LA6F 3WRXC 4D02A 1QCCA 2ES4A 3I6ZA 1KSHA 1CRQA 1GP2A 3IDFA 5H1YA 3TRFA 2HDHA 4OXIA 3ANXA 2JD2A 1HSZA 4IZ6A 1JJBA 1JNYA 1YU6A 4EJ6A 2DSNA 3I4CA 4MQUA 1PZHA 4M87A 5CFNA 2QLLA 2WYWA 4MS1B 3D6UA 3QY0A 2RCYA 2W2XA 4GPD1 2VSQA 3JWHA 4LC1A 4BO0A 1QP7A 1N3BA 2X3UA 4V03A 2G5PA 1CYDA 3B51X 1F60A 3L0ZA 3NH9A 3JR3A 3SPXA 5BV1A 1I94B 3THWB 3TL6A 1A71A 2ZUDA 3BE4A 5IKMA 3P5BA 5JAPA 2R86A 2RGXA 2WF7A 3LCVB 3SMVA 2RH8A 1G3MA 5DXAA 1MUUA 2PXCA 3QOYA 1SFRA 3H04A 2FZVA 4YJKA 1Z26A 5LNK6 3PYMA 1AKEA 1RXCA 1NE2A 1E60A 1XLVA 3HUFA 3TVTA 4B33A 1QP0A 4JXXA 4BWYA 3HCWA 2EWWA 1KZ1A 3I01M 3DE3X 5L3SB 4OI0A 1DC7A 3G49A 4K9DA 1E2NA 4GPBA 4MHSA 3QJ5A 1C2TA 4BX2A 2JFHA 4KACA 3WICA 3OKPA 3BD6A 1W5BA 4UCQA 1EFDN 2BFEA 4R01A 4TROA 1KMCA 4Q4AA 3TE7A 2FWAA 2XUZA 1H4QA 3BFJA 1G38A 1TKCA 4RTMA 4EMSA 3UXHA 4ISCA 5K0EA 4PC7A 4UXHA 1G4UR 4FGWA 5FBKA 1G5IA 1K6IA 4L4ZA 2JFXA 4MQ6A 2B3DA 2H0AA 4S24A 2IUEA 2OBXA 4ZDKA 1OX4B 2A57A 3NJ8A 4FZVA 1RZ3A 2AV6A 1V37A 4GNRA 1Z4KA 2R8PA 5A05A 2VNIA 3HZRA 3PDUA 4V24A 2E5WA 5F1YA 3HLYA 5DI3A 4G2TA 2VQSA 4MQFA 3RBVA 4LBYA 2C7GA 4HRYA 2H1HA 1FFDA 3LXXA 2QYSA 3PFCA 1RXSA 2NV0A 2PZMA 4U2FA 4ASUA 5I48A 3NUGA 2AFHA 1S1MA 1SB8A 3ABZA 4OHRA 4B43A 4OOFA 4ZIRB 4DMCA 1L1QA 4C4AA 1NYLA 3GG2A 4DWOA 4DLUA 5BXYA 3AVUA 4HPJB 2W43A 2QRVA 4UHCA 1DG3A 4AM8A 4IHKA 5JE8A 1W93A 2Q6VA 2YXNA 2G4VA 4YS6A 1MABB 2J5XA 2H1VA 2REOA 2AJLI 3D64A 3P9SA 4X6XA 2H65A 2V7PA 4DJFC 1U0JA 5CB4B 2ETVA 3Q88A 5A06A 5E6UB 4CLQA 4JEIA 1S2IA 2WWRA 3IEKA 1DUIA 1WUKS 3VZCA 4ZI5A 1DBQA 4GOOD 4KIFA 4NYIQ 3UMSA 4MR8B 2NP7A 2PL5A 2V7QD 3ZYZA 4ZN6A 5K2OA 3WK4A 1PNRA 3MERA 5EUMA 4CIAA 2QT9A 1RS0A 1XWIA 2GK6A 1LLFA 1PAUA 5K8VA 5IDWA 1KPHA 1P6UA 4J3FA 1NBEA 3U60B 2PQ2A 2AXQA 1I30A 1XNHA 2IDJA 2VNSA 2Y4NA 3FBTA 5CJ2A 3RV3A 4DJAA 4MS4B 3TH5A 5JADA 4M8LA 1LJUA 2YJZA 4EHBA 1RRGA 3WHKA 4TWAA 1GADO 1F5SA 5FORA 2SICE 2GILA 5DEOA 3TJMA 4LRXA 2Q2QA 3OT1A 4B8WA 3AJAA 1VP3A 4EKEA 1I2CA 1LWOA 3Q85A 1T6YA 2JLYA 4HQLA 4JUBA 5GOZA 1WOMA 4JVOA 3O5AA 5LYJA 4CKEA 5JOQA 2DBYA 1KZ9A 1VFPA 1JXOA 1TUEA 1N2CE 3H5NA 5JSKA 4QM6A 4XUGB 2UYGA 3A4YA 5DN9A 5DYGA 1IHUA 3TDNA 3U1BA 1JA9A 3CW9A 3MC1A 2NO1A 4I2VA 1E92A 2Q62A 4DWVA 5JMWA 1V41E 4MOWA 4P3PA 2CJWB 4EVSA 1RWPA 4CM7A 4QBKA 1N6KA 5I8ZA 5INTA 4QFDA 2R6FA 3PFHA 2X7XA 1MC8A 1Z22A 5JALA 1W6RA 4NYIR 3VMMA 4G23A 1THMA 2REQB 5J2UF 4OGWA 3O0TA 4RU1A 1FQKA 3VX4A 3ZV4A 1N75A 3FJOA 4Q93A 2GOYA 4S2UA 4XCQA 4EG8A 2H1CA 3W6OA 4AMGA 5BVHB 3V5NA 4B35A 2H5IA 1SOAA 3VFDA 1CV2A 2H1WA 1RPAA 3AYZB 4PSAA 1N5RA 4GYJA 1L7BA 3L8EA 1OX5A 3NEPX 1CUEA 3PJRA 2E89A 4BY9E 3RAGA 4YX9A 5ICMA 4GOKA 3RS5A 2E85A 3NHRA 1O5TA 5A5VA 1BNCA 1IAVA 1X1EA 2ZPTX 2CCJA 3OE7A 3BPSA 4XW2A 3V2GA 1NDQA 1PR9A 1QH1A 2ONCA 1D1SA 3KZOA 2M98A 4EY4A 1QC5A 4U7DA 1FNDA 4IWNA 4MCAA 4XLLA 1TA9A 3SYMA 2ZTMA 3QTBA 3T0GA 1M2JA 2C57A 2P65A 2Y1OA 5HNKA 1ZL0A 1TNDA 3R41A 4HWKA 3DZ2B 1WEHA 4YR7A 3F6EX 4OSOA 1I8TA 4RNDB 4I1RA 1WNFA 1Y8RA 2XJ9A 3LQ2A 3PP8A 3FVQA 4A1OA 3DYVA 5A7GA 1HA3A 5CFQA 1RZUA 1U2DA 3QX9A 2C4VA 1GUZA 1UBCA 1MJ5A 2VLBA 2CHUA 1UDBA 3EZXA 3U1VA 4Q66C 4Y7CA 3E8SA 4PNZA 1J5PA 1EHIA 4UFPA 2P90A 2F2TA 3L5OA 1SXIA 2H1SA 3LLMA 4D8UA 1WZNA 4HS4A 1CFJA 2Y6UA 3IP6A 4ZD6A 2VAPA 1EP3B 2JFQA 2YVUA 4R2MA 4F2WA 3ZIDA 4ZVVA 5K0JA 5KNDA 1KC3A 4R69A 2QN1A 9ATCA 4I9NA 4TWRA 5CXXA 5IK2A 1ISPA 4IICA 1QMIA 1PFGA 1VL8A 3LKVA 3B20A 4Q4HA 3MA0A 2BR3A 1N2BA 4PO1A 5CEEA 4GF5A 4CI9A 2I80A 4QDJA 3KTAB 4RV5A 1UR5A 3CJRA 2BKLA 1PZMA 4RCYA 5CT6A 5TS3A 1VJCA 4TUYF 3CB4A 3UT6A 2BGGA 3CKYA 1J7JA 3V80A 1QLHA 5AOCA 4BFSA 1MB3A 3IOEA 3WS7A 2OG2A 1QQ5A 1K8QA 2EJUA 5C9ZA 2W2QA 1MAUA 4ZZ2A 3MJCA 4BFVA 4IV5A 1L5MA 4HLCA 2I65A 1P4GA 5I3CA 1N2EA 1AU9A 2ZJ1A 1GPBA 1T0UA 2WD7B 3D3WB 3RTGA 3NASA 3I5XA 2IFTA 4FFPA 1RQLA 3T9BA 1C81A 4N41A 1FDTA 4U5XA 3JQAA 4YRMA 2NXWA 1IN6A 3UOGA 5T3YA 1JQAA 3VKUA 3BCRA 4YUVA 4PXSA 3K73O 4UKDA 2WA1A 1DXYA 3FB4A 1T4BA 3IBFA 4WOPA 5FO1A 3QLVC 5L4LA 1CW2B 5E95A 1VE5A 4RD6A 2VJCA 3D6MA 4TMZA 3A3NA 2DMRA 2J41A 3TFWA 3ZWQA 1R0KA 3THWA 3ROKA 1T6BY 4DREA 1RIFA 1QWSA 4IH1A 4IDQA 2EEPA 2QRKA 3IBGA 4XEHA 5DGXA 4B6FA 3P7MA 2YOFA 3KR9A 4Q6WA 4TT8A 3CRZA 1ZD1A 2PX8A 1Y7LA 1RXIA 1P5HA 2P41A 4FT4A 1DS6A 1NASA 3RRNA 3LKZA 5FCDA 4CFZA 2ZR0A 2EYQA 2JI6A 4IGFA 3QEJA 4LQCA 4RVNA 4C6HA 2OCGA 4W5NA 3STXA 2VXCA 4QU9A 4NC9A 1DRJA 3PEWA 2A84A 3FOEC 4GI5A 5C4GB 4LWPA 2AX4A 4KDCA 1DV2A 3CLUC 3C74A 4HAIA 4Q6BA 4CUJA 1RRKA 4O63O 1KK1A 2EQ5A 1JLLA 4WEQA 1R0SA 1SC3A 2ORYA 1ZJWA 2BR5A 2FPPA 1KKMA 2Q4BA 5L7YA 1FXWF 5I9TA 1ZS9A 4P98A 1JEEA 4OJYA 4LQ4A 3D7MA 2K2QB 5JSZB 1L1FA 1FIUA 1ZVVA 4RV9A 4OQNA 1FP2A 5EKSA 1UMKA 1MV8A 3TLMA 5B57C 2JBWA 1YJ5A 1SBQA 2BYTA 4YP5A 3E7FA 3CURA 2V97A 4YK7A 1G8AA 1IEQA 2JIBA 2Q8PA 2VTVA 4IX1A 2ZWVA 3AIMA 3RAFC 3A32A 4UULA 2HOQA 2NUBA 5FV7A 1YGPA 4ECAA 1G7TA 3VR0A 5KWJA 3A9RA 3FE2A 5ESDA 2A5YB 4E07A 4R9RA 3C5WP 3G23A 1R9GA 4PLPA 3B6ZA 1GGMA 2ISCA 1I6MA 4LZJA 1Z0SA 4JH0A 5KPJA 1CZOA 4C7OA 1YZUA 3BG5A 3B5JA 2OB1A 1X42A 4LTNA 4X6UA 4FYMA 3HR7A 2A30A 3WO1A 3MEQA 1NUPA 4FZ5A 3PEVA 1GHTA 1NVDA 3MTBA 2JAPA 1BXGA 3MT9A 3DMYA 5KVSA 4BQOA 2ERCA 2HA4A 4MJXA 1KOGA 3GRAA 1MG0A 2Y1XA 1U0BB 1UP4A 3E1GA 2ROQA 1LLCA 1WTAA 2EFGA 5K5EA 2BGLA 3BSYA 2IF2A 4PM4A 5KWIA 5HF8A 1KVSA 1JJ7A 3NEJA 1QRTA 2FPUA 3C16C 3N1UA 1GTL1 2J5RA 4ROSA 5DMHA 5EERA 2DWQA 3JQ8A 4CM8A 2C83A 2X5NA 3JQGA 3VVLA 1ZNWA 3KQVA 2GHIA 1HKHA 2GARA 3PXAA 1GA6A 5J4KA 2ZB4A 1KNXA 4G37A 1J00A 1CUVA 1X3LA 2VAMA 4TZ6A 2ACEA 2AE2A 4UBKA 1O95A 1Q0ZA 1VIYA 4MW5A 3ZS8A 3IERA 1FFBA 4MUYA 4BO2A 3BA6A 5DHTA 4JB0A 1MN6A 2O1SA 4TYYA 1E1KA 3HCNA 1ZH0A 4MA5A 2OYSA 4FI3C 1QANA 1JTFA 3VR2D 4FKBA 1A4UA 5LQNA 1BW9B 5M7EA 4K9OA 1WJGA 4A6PA 4BYGA 1X9HA 4ZU1X 5EA2A 1RHQA 5DYYA 5DLQC 1C1HA 5AW9A 1FXWA 3KXPA 1OHHA 5TSDA 2DLNA 2P0AA 3WYGA 4EA8A 2G9ZA 1M1YA 3SR3A 4YXWD 3ZNQA 1UBFA 2AVDA 2C07A 4CE6A 2B82A 2V6IA 1ACJA 3AEZA 1EVLA 2YDXA 1OA0A 4EPYA 2A88A 1DCMA 2VQDA 4AUEA 1Y33E 4UTVA 2OK7A 2WABA 1E3LA 2C4KA 4C7BA 4JVNA 3HJUA 2X41A 5IT0A 3A1SA 5EMMA 4A0HA 5HJ2A 1A9PA 1UBNA 2ZYTX 2O2SA 2Q0SA 2O2ZA 1J99A 2AJCA 2WJJA 3VDXA 3VKFA 1EYZA 3G6WA 3I37X 4OYHA 4KTVE 2IS1A 3T1QA 1QF7A 4LIPD 2FDCA 4LJ5A 1UZMA 5JZSA 5A4JA 4G85A 1CJVC 1VXOA 3DAFA 2P2CA 3F6BX 3H1GA 4MI3A 4YXFA 5FJIA 2EWMA 2R8YA 5AMXA 2ZUUA 1UOPA 2C2ZA 2CHVA 5AJUA 3T5PA 2GXQA 5CYFA 4X20A 3Q40A 3ZHUA 2ZR7A 4BTLA 5KWEA 1W5FA 2OY0A 2CVFA 3RDPA 2WIBA 1W2WB 1W5TA 3BWXA 4ZV9A 2HHHB 1CG6A 1XZBA 3UB2A 2BFFA 3E9NA 2A92A 3ONFA 4MW9A 5MFPA 5J1TB 2FJPA 2IU4A 1G17A 3AP1A 2VT6A 4Z0TA 1VMDA 2XHZA 3DHYA 2O2YA 1NSTA 3PQ8A 5I9BA 3UJ3X 3ZUGA 1WHTB 3PG5A 1C7RA 2XD4A 3FKQA 3FVTA 4JLWA 4NPCA 4WBSA 5D3ZA 4EB6B 5M34A 2BMFA 5FBLB 3MOIA 1M1ZA 4GMXA 3A9CA 3CA8A 3GEPA 4I8XA 3TQHA 2PGJA 2Z2YA 1UKAA 3QE2A 3EA5A 1AB5A 1TU3A 1RWQA 4R9SA 4AICA 3PJGA 1QP4A 3PGMA 5IYZF 4RJ2A 1E1QD 2ZSUA 3KYCA 3ZQKA 4DLVA 5BOSA 4DIKA 4F92B 1FUYB 4M38A 4CT4B 4ZO8A 1P9NA 2YWBA 1UINA 3Q9LA 4HO1X 1OH5A 3GFRA 3UHAA 1EUQA 4OHZA 1J2TA 4F21A 3TEFA 2AE1A 4C05A 4CMCA 1YZYA 2VDLB 1A95A 1NMXA 4YEDA 2EF1A 4XIFA 5LQJA 3PXDA 3HWRA 5CGZA 4EF6A 5DCYA 1KO5A 2VP9A 2CNOA 5DX8A 2XVXA 3TNLA 1K2WA 1W5EA 4IINA 3EPRA 3MXTA 1W88B 3QITA 4JUIA 2UVDA 1TA4A 4MRRA 1VXRA 4KN6A 4B3DA 1C0EA 3HB9A 4L07A 4NR0A 1LXCA 3IHTA 3DOEA 4R8RA 2O0JA 2PZKA 5K4HA 3ZK7A 1SBHA 1AF4A 1K2VN 1NW3A 4QWMA 4Z4GA 1ID8A 3OUZA 3TPZA 1JZSA 1U04A 4M6WA 1R4MA 1OBOA 2QBYB 1FSPA 2XB9A 3DOUA 3JQRA 2R66A 2WJAA 3DZBA 4KO8A 4PSKA 5DGIA 2ZVQX 3A6LA 1PYDA 2R7KA 4OXYA 5FWXA 5JR3A 2DUWA 1JG2A 1GITA 1A82A 1I3LA 1CEYA 1B15A 4QFCA 1E6LA 1TKBA 2KLBA 2HPAA 3A9VA 2D2XA 1FFYA 1I13A 1YQDA 4QHTA 1QLJA 2GK3A 3EXG1 4O4HF 3D5TA 3KSDO 1I2MA 4R1UA 1V3UA 4MS4A 1NUAA 4CG2A 5BURA 2OG1A 5JNSA 4EB8A 1M1UA 2O20A 2JAXA 3LC0A 4KWEA 4G81A 1XZDA 4KIWA 4RLQA 5JRJA 3HP1A 2HT1A 3ZTTA 1L0BA 1TVKB 1L7RA 1XTZA 2X8BA 4KGDA 1P2SA 2C5LA 3IBTA 3NGLA 5FWNA 2H57A 5K8UA 1G9TA 3QNWA 4V1CI 4N3GA 1YWGO 4M1EA 1VOTA 1WCXA 5DT2A 3CE6A 4YIKA 2C4TA 4CG1A 2O05A 2R6JA 2HQBA 3K20A 4A3SA 5C4MA 2YMPA 3CR3C 3UIEA 1ENPA 2O5RA 3ILYA 5JDIC 2C8VA 4G1MB 1QS0B 2DBRA 2Q2VA 2RHOA 3R0IA 5BMVB 2ERYA 4EFNA 1SEPA 3K71B 4QELA 4XUDA 4EVRA 4BGEA 5TQ0A 1LKZA 3D8HA 5IYZA 1Z6GA 2O54A 2NU7A 1K8XB 3OCXA 4TTTS 1VIAA 4WZBB 3RADC 3DT9A 4J2TA 4D80A 2ODQA 2QDXA 3WYEA 4PN3A 1EIWA 2EKQA 3NAQA 4PFJA 3N07A 2AHOA 5JWRA 3EIFA 5G4LA 1FX0B 1KQPA 3KNZA 1QFMA 4H1UA 4M88A 3TLKA 1Z5UA 4RQBA 3PR2B 1USWA 3ZN2A 2FOXA 2O1EA 4BLUA 4RPIA 5HRAA 1H3NA 3CLUD 4MAFA 5G1NA 2Z04A 5JXWA 2Q1UA 5D5QA 3PFGA 2UZ1B 2EX4A 3OQIB 1FP1D 5EXXA 2MSKA 2C3PA 2Q8QA 1QO0D 3HDYA 2QLBA 4GMFA 4JODA 2V4UA 3NUQA 4YGXB 5CA0B 1IULA 3C8ZA 4ZEOA 4CMGA 3VKVA 5ETJA 2R751 4INZA 2YWEA 2GD0A 4GSKA 2VDUE 2B5OA 1C4KA 2H48A 3BDIA 4NX2A 3OD5A 1FUUA 3HCEA 4RY2A 4CM9D 5IFLA 3H75A 1UBJS 1DOHA 3H87A 3KXLA 3QOWA 4C87A 2FPLA 1LV7A 3DVSX 1FF9A 3ETEA 3PGVA 3Q8WA 4UNNA 4PBRA 5LC1A 3JYLA 3WLNA 1I1HA 4DW8A 1RD4A 3OQJA 2ZWIA 3IHKA 4HDSA 3WGMA 5CUQA 1T9GR 2QAGC 4R68A 3X1DA 5KYXB 1QXSA 1TF5A 2DUMA 2E48A 2I4RA 4FINA 4O2RA 4W5WA 3S1AB 4E11A 3QVUA 4QTTB 4MV8A 1R0BA 2PHZA 2PUWA 1AKQA 1T2FA 4AB1A 1ELOA 2OCDA 3MT8A 1KTVA 4Y98A 4RS3A 1A9ZA 2HJVA 2WB4A 4IJWA 4UMDA 4V0KA 4CL8A 1R8YA 3KD3A 3QVGA 2PBRA 5HFNA 2PRKA 1JBQA 2C29D 3BREA 1R10A 4ARVA 5JY1A 2ASEA 4MDHA 1RJDA 2PTGA 5CP8A 5DKFA 2KBEA 5E4JA 3BH6A 1W9HA 1MIOB 2EX0A 1CEQA 2HCBA 3LCMA 3R5TA 4MRMA 1VHDA 1WZIA 3UV6A 4BCCA 3TQIA 4BVBA 2CLMB 1NY6A 3GNLA 1Z75A 2DKNA 3BK7A 4KPUB 4G0OA 4U7JA 4YHBA 1XD8A 3ZPXA 1Z6ZA 4A92A 4URYR 4JLUA 2IGTA 5DOVA 5LQCA 2JHCA 1U3CA 3DGFC 2I9KA 2NWQA 3SIRA 1DT3A 4WNAA 2PUEA 2NZ2A 1TOAA 1KVQA 2LE0A 2ZATA 1JJAA 4BMCA 2AEJA 5EJEA 4O29A 2JCSA 1O9HA 4GLLA 4WLFA 3WK8A 4KVAA 5BR8B 4N0DA 4C0XA 3Q7IA 5FPTA 2ZUTA 4NS1A 1A7AA 2ZJ7A 2PL3A 2OUKA 1RYNA 5EJIA 2QJWA 5KJFA 3CZPA 1NIJA 1T3GA 2PNJA 2WFLA 3ESDA 1KWKA 3PQ7A 4KP7A 5HQ3A 1V1MB 1VRVA 3LHDA 4ZP1A 1UJCA 5KWSA 1UAAA 1IDN1 4G25A 2PVCA 1NOIA 4KAAA 4OFXA 1S5PA 4KZPA 4X24A 5EZYA 4NLLA 5BW6B 1AKVA 2OT3B 1MZPA 2B36A 4NY1A 3R3SA 3SSAA 1X1QA 1TYEB 2Q5QA 3EVAA 4X91A 3RSSA 2JJ1A 1P2FA 2NVOA 2XGSA 4Y8VA 3NW9A 2PMCA 3RC8A 4PZ0A 1RI1A 2BI7A 4FDLA 3ZBPA 4Q3DA 3HN6A 3N3BC 4UHDA 4JI2B 2GJ8A 4OGGA 3RVOA 4DJTA 2XRYA 2VUIB 1QIHA 4NQZA 3SEZA 2I71A 3THRA 5C8ZA 1CUZA 1TJYA 3OKAA 4CF5A 1ZH2A 1C0LA 1QHHB 2V7EA 5L3RA 2D2EA 1T2EA 2JEYA 3ENZA 4XGNA 4MVCA 3LS2A 2RHDA 1US8A 4I5IA 2GBIA 1I79B 1GPMA 4LV6A 3LSTA 4B4OA 5I7RA 1RZRD 1OXMA 3C1TA 1PZFA 3LQKA 3WWZA 4AIIA 5F2NA 3PA8A 1Z17A 1O4WA 3SX2A 1U1CA 1KZHA 3T38A 1U7TA 5CFMA 5TPWB 1GLGA 2P9YA 2VRCD 1NXWA 1DC6A 2BWJA 3QF4A 5DHPA 4B84A 3ZCUA 4HVLA 4X44A 3W3AD 3F9CA 3GJ7A 3M9LA 5JS1A 4FHZA 1T0PA 1GNRA 3KG2A 4Q9LA 3WP0A 4L8VA 3FUTA 3I61A 1Q7CA 3PHBE 4HWSA 5CVUA 5AHKA 3IMFA 1ICIA 3QW2A 5ER9A 3L8YA 1JE0A 1ETUA 4IIYA 3AINA 4K3UA 1HE3A 4KBYA 1QNFA 2ZRCA 1QGYA 1P2GA 2O8FA 2DECA 2B1JA 4MMYB 1LY1A 1AQNA 4QLOA 1GAJA 4YCJA 3RC3A 2W8BA 2HJHA 2BGMA 3DFMA 3R24A 3HVRA 4ZYLA 4WZBA 3SE0A 1XVLA 4XJVA 1VG8A 2CJXA 2VP5A 4B2PA 5A1JA 3GOQA 2GSDA 1A8UA 1B2LA 3BZWA 5EHQA 4UD6A 1M8PA 2Y1LA 5BSMA 5IZ4A 5DULA 3OZBA 4GX0A 2JJ8A 3PVZA 4ZGBA 2QVZX 1U4SA 2G3YA 4B82A 1JAZA 9GPBA 2J33A 4U2GA 3QLEA 2NZWA 4Y9DA 3UKDA 1VA4A 2J07A 3LNCA 2GM9A 1JHRA 1U7DA 4KGVA 2ZDQA 1YS1X 3HFJA 2VTEA 3V33A 3TO5A 2DEUA 3Q9NA 4AUNA 4P3KA 3BTVA 1WD7A 3KT6A 2A58A 3HPQA 1O57A 2QUAA 1Q2UA 1QR6A 2CLSA 1B00A 3FPEA 3L0IB 4FGKA 4I36A 5KYTA 3UJNA 2Q3DA 1B23P 1G3RA 1AH2A 1NVVQ 3HJAA 2FPPB 3C3DA 5GONB 5DHSA 4C3VA 1G63A 4QDXA 3S3TA 3ZW8A 1ZOOA 4ZAYA 4EW3A 5B55A 1MABA 2PSEA 1VYHA 2CDBA 2OL4A 3ACCA 4QQRA 4WZBE 3VSAA 1HLPA 5A2GA 3EB9A 3VRHA 1A8PA 4BQFA 1I72B 2IZ6A 1CNEA 2R6ZA 3PEEA 2J32A 3TFOA 3HNPA 4QJ4A 3CLSC 4ZVMA 4AG3A 1E9DA 1QUEA 1EK6A 1B6GA 1S2LA 1LA2A 3DLTA 3PFNA 4A0RA 1MFZA 3V4RA 1L9XA 4D3ZA 1OH6A 1IB6A 3PNBA 5AUPB 4UPDA 4LQDA 1CY1A 5B5SA 1JG4A 1XMXA 3AVXA 1TK3A 3SBDA 1YDFA 1ZESA 3WFZA 1GPWB 4UC0A 3AEQA 3FGPA 1WPXA 3H4MA 3EFEA 3TLEA 2EDCA 1R7RA 3DNMA 5LUBA 2GEDA 1KYYA 4X1YA 1KMMA 4G1UC 3UTCA 3TECE 4YCNA 1LSOA 4OQQA 4GT1A 1OIVA 2P6RA 3M3DA 1SWVA 4GZ3A 4IVNA 1KEVA 1QGUB 3DA8A 3KSMA 4EPRA 5IKEA 2FMIA 1D8AA 1PQPA 4FYHA 1OXKB 1D6NA 1ORVA 3FR8A 3NBFA 4ZT7A 3R8XA 4ARZB 3CH7A 4R8SA 1G4AE 1Z63A 4YMTA 5C5CA 3IWCB 4R84A 1JILA 4YUAA 1P4SA 4MVWA 1FNCA 4RH3A 3EE6A 2V8BA 4EPXA 2W4IA 3HGMA 1A9TA 1L7XA 3LW8A 2QX9A 3PD0A 1J0CA 4WY2A 5CLHA 5F35A 4X1YB 2YR0A 3NKVA 2C2GA 4KYUA 5LA6A 1OT3A 2CLHB 4XX1A 4QRIA 5FYDA 2QTBA 1EDEA 2FXVA 2X4GA 2RGAA 1JYEA 3AUAA 3NCTA 4N8SA 4QQKA 4RPCA 4Y1RA 5TGTA 2QQFA 2RK4A 3UBTA 3J81k 4ZOQI 3AY7A 3HC7A 3IQEA 3RWOA 1AY0A 3BWDD 5HG0A 1D2NA 4UBJA 3OZVA 3MN1A 2ZJ3A 3HJBA 1T6XA 2J3EA 5CK5A 5ALIA 2C7OA 1GT6A 2B7LA 2L69A 4TT3D 2GN6A 2PO7A 1CHNA 2ZROA 1ZMTA 1Q20A 1CY8A 3AV0B 3JTMA 3AG5A 4YGYA 4GZ6A 5DGDA 3VX3A 4TLLB 4OHCA 3R76A 3GJXC 3KHUA 1K5DA 4Q03A 4W4TA 3VNVA 4PS0A 4C3ZA 4CFYA 1QQ6A 2FRVA 3MF4A 4EBBA 5HW0A 3L04A 4MV1A 5IH3A 5LVAA 3RJMA 5AUNB 4JA2A 5KYWA 4Y6GB 1FY2A 1ZGAA 1BVYF 3WL4A 5FLKA 3WDLA 3MCVA 3NDJA 3OH8A 4HK4A 4FFBB 4MWEA 1NXVA 3SLRA 2W2KA 4MWCA 2PMKA 4D57A 1YIOA 3IMKA 2CLCX 3OIDA 4CHGA 4D8WA 3D1LA 2X8LA 3OM0A 1KNQA 2RH5A 3EZFA 2VIIA 3M33A 4KXMA 2H4JA 4YN3A 3WQSB 1MT0A 3INNA 5B64A 4URXR 3BM5A 2IS4A 3S2IA 6YASA 4NBSA 3DBRB 1IY9A 2C7VA 3NNSA 2BMVA 2LP4Y 1N78A 2F3TA 4BNZA 3DAHA 1DCTA 2HCJB 1O8CA 2E87A 1S0UA 1Z8FA 4ZQGA 3OY7A 2DPXA 1QU2A 5EC8A 3GUYA 3SQMA 3GZJA 2P9EA 2BMWA 1OC2A 1YBFA 1SIBE 3AUXA 4JI5B 3H0WB 4E3ZA 1AMNA 3L6OO 2DT8A 2Z9BA 1E2EA 2QAJA 2HHLA 3QLUC 3QXHA 3KZCA 1Z6YA 2V4ZA 4F96A 2BCGY 2G88A 4LOKA 3WGIA 4FYVA 4JJ4A 2XXJA 1ILEA 4JKYA 1K8ZB 1VQ1A 1SQSA 2LKDA 4IIVA 3O4IA 3UAOA 5JNLA 3K6RA 1NBWB 1OH7A 4N3AA 3S99A 3LFTA 2I6UA 1AGPA 1AQ6A 2W93A 4PG8A 4OXKA 3AC0A 4Q1BA 5ADVA 3KIPA 4AAYA 5K9ZA 3IRVA 1N3LA 3H1EA 1UT5A 3L6CA 3H9UA 1Z68A 3SNKA 4NNOA 1CUSA 1OTHA 2G7MC 3REOA 4CTKA 4OYRA 2LCQA 5EIFA 4EPVA 2FW8A 5REQA 1U8EA 1E7RA 1F0PA 2CHQA 2WUVA 3AHIA 3KDAA 1RXVA 1E7YA 1G8SA 3UGTA 1ITZA 3N53A 3TEJA 4MDEA 3F5FA 4F1WA 4C5BA 2GN8A 1L8LA 1V26A 4E4RA 3L93A 3F6PA 1X8KA 4LMAA 3PIIA 2J48A 4A8JC 1DUSA 1L4LA 1LWNA 3PPYA 1YL6A 1GL3A 1G7RA 4IG4A 5C32A 1HC7A 4JSTA 5LCXA 4JI6B 5E9QA 4M6WB 3H65A 2EJBA 5C18A 3VYTB 1JX6A 4FR2A 1X2BA 5A62A 2PYZA 4W82A 1K7YA 3N2EA 1KC1A 3BMNA 4TL9A 4PO3X 6Q21A 3PC3A 4YFYA 2H6EA 4AS3A 4EYKA 1D6MA 2WJPA 1LW6E 1YBHA 2WWYA 3D54D 4JI8B 3BZUA 5LBIA 2YV3A 5ALNA 3A1TA 1JNXX 3IAUA 4XTRA 1XGKA 3CUYA 4OFZA 1WU8A 3I5UA 5FI5A 1F2VA 2A1UB 1ZWLA 2PAFA 2R85A 4J4TA 1PJSA 4HSGA 3QIAA 2BKXA 3C3AA 5AK5A 2D13A 2XUPA 3U3DA 3DTYA 2QA5A 3FFBA 3KU4A 3TS1A 3ILXA 4C20A 1V47A 5DYNA 5I45A 2XKKA 3VKGA 1AKWA 1JFVA 3Q7EA 3TVDA 2RAFA 3LW7A 4A0QA 4U0KA 1U7UA 4EG6A 3FTPA 5A5DA 3PRYA 4RZXA 3KQTA 3ZHZA 4CT0A 4EDHA 2P6PA 4FE4A 3KT8A 4DMFA 4DJJA 5A7FA 3P0FA 2YFQA 1KDRA 5HA5A 3S2SA 2ADFA 1ZU5A 1TJNA 2WAXA 1Z6AA 2CUKA 3INYA 3ANTA 4I81A 2PJRA 3HO1A 4W8GA 1KYWA 3IO3A 4ER0A 2W2KB 4WKPA 2B9VA 1VIMA 2H4WA 3E7DA 3GFSA 1XJ5A 1V43A 3GD5A 4E5SA 3BRSA 2CUNA 3IV6A 4IQGA 4L8GA 4KI7A 4KJXA 4QU8A 3LC2O 1CJUC 4JROA 5TPWA 3TM4A 5F73A 2CXUA 5A9TA 4C5CA 3MTAA 5MHTA 4A2PA 5J63A 5MDHA 2OHVA 2QM3A 4L08A 4L4UA 3DL4A 2BGNA 3EFBA 2XWSA 1NBHA 1ADYA 1K08A 4FGSA 1IHXA 4PR0A 4F4FA 3C3MA 4B4UA 4I99A 1E62A 1HDRA 2J3HA 1K89A 4ROTA 1PNOA 3F3YA 3RRYA 1YJXA 2QU8A 2BIFA 5IAKA 3GMSA 5BSHA 1EKXA 4ZDJA 4M76B 3R7LA 1UAGA 1RIIA 3E61A 5EIAA 2WR8A 3KQMA 4KKXB 1EINA 2VP3A 1L7AA 3QPWA 3WNDA 3WG9A 2KS6A 4L4RA 3F1LA 1GZ4A 4DCVA 5GZ1A 5G0TA 1AKNA 2M1ZA 3TVYA 1IJEA 1OPXA 2I6FA 3RT9A 4QGBA 2QL7A 5KTTA 1P72A 2AT1A 1JT2A 2YYSA 2PE5A 3I9NA 1R15A 2WTMA 4DSUA 5CCXA 1VSUA 1A96A 5E6SB 4EW6A 1TQHA 5DNWA 3FGZA 4KO3S 4N82A 4POAA 1BYIA 1S89A 1OY1A 4H3HB 4CLHA 3PZRA 4TLAA 1QKJA 1VTKA 2VPWA 3DDZX 3GA0A 2EQBA 1NLFA 2JFFA 1EFPB 3AI7A 5CT5A 4CVNA 4OMFG 1CP2A 3VYUB 3QNUA 4UASA 2NX2A 4BE9A 4JEMA 2JLUA 2GTPA 2JCXA 1D2HA 1FVOA 1U7ZA 1ZDMA 2QTVB 3K0BA 2V58A 3I42A 3U9LA 2PS1A 1ECJA 1DKNA 4DM4A 1DZIA 2DHDA 1Y3CE 3CNHA 5F7OA 4WXEA 1D1PA 2ABWA 4TUYA 3H8SA 2UUOA 4BEBA 4AJPA 3I9MA 4XARA 1Q3HA 2K6GA 2XECA 4UHFA 4OB8A 4GL4A 4O0LA 3W8NA 1IBCA 1OXSC 3FPKA 5AICA 2FR8A 4Y2JA 2G8LA 2JDIA 2H06A 4YAKA 3CF4A 4EW2A 3O82A 4RTOA 1R88A 1E32A 1QBKC 2WWXA 5DBEX 4HAOA 2IIBA 4LYFA 3ELYA 1IRIA 1L4GA 1Q7RA 3EJWA 3F46A 3GRRA 4BBJA 4F2HA 4QGAA 2AW3A 3N87A 4KK3A 3Q8MA 1SA0B 1II8B 4OA5A 1FJ2A 2KSQA 2G36A 3ZTYA 4DMMA 5LB2A 4IDNA 2XJ4A 5IVDA 2WTUA 5KVCA 3ANNA 3TZQA 1UP7A 2H5EA 1SG0A 2PMFA 2PL9A 3PXBA 5D3KA 1K1EA 1G20A 2ZSDA 3A04A 3OFNA 4U7GA 2J9GA 5KAPA 2ZUVA 1RI5A 4HDCA 2BGRA 1E3EA 1FMCA 5CYGA 5C5EA 2CVHA 3VR3A 1UAYA 5C7YA 4CL2A 4NMHA 1G19A 1R0WA 1V4VA 3QMWA 4BNGA 1Y4DE 2BM8A 3A4VA 4QREA 5DCLA 1JB9A 1VI2A 3GFOA 4Y2SA 2ZCJA 1ACMA 5DTIA 2A9RA 3MD9A 3DPIA 3ER8A 4DR2B 2QPOA 3IKLA 2HBZA 1O54A 2PUTA 1NURA 2ZITA 3B8HA 3LY8A 1A4XA 5AJZA 5DLPA 3TAHA 4B6GA 1SVKA 4BLRA 4Z1OA 5CD9A 4L0DA 4HEHA 4DMLA 1ZN8A 3FD8A 2R97A 4LPKA 4IS2A 3Q0EA 3G88A 1OFGA 4HEA1 1UFQA 4YRQA 4ZV7A 3TNYA 1OZFA 1NNUA 3E22A 2VI5A 1QHEA 2CXRA 3DEFA 3RW9A 3LSYA 1R8JA 4AWXA 5IEBA 5GJBA 1SXJB 1ZICA 4BVJA 4OI1A 2ZDGA 2BBOA 3PR1A 4M1TA 2NZYA 3VVCA 2PWAA 1GG2A 1O6ZA 3QQ5A 2YZ2A 3R09A 3E48A 4ZVSA 3JWIA 4ESOA 3T7EA 4PPFA 4K28A 2JIZD 2JNWA 4WECA 1DBSA 4XOIA 1J5XA 2O9JA 4I1UA 3D7KA 2II6A 3DJYA 4WNAB 3AI1A 2QTTA 2QTVA 5A5FA 1GT91 2CB0A 3SZMA 5ITWA 2IK8A 1Z82A 1V2GA 3PUHA 2FTKE 4GAEA 4I9GA 4BMSA 1FW8A 2NUTA 4EUEA 5I7UA 1F0YA 1NFQA 2N1BA 2XEXA 4MA0A 4X62B 2FWNA 2JEOA 2ATEA 4P81A 1F38A 3A3KA 1G59A 4F3TA 5LMUB 5FDFA 1H8ED 3KQWA 1J2UA 3WGNA 3HVJA 2VQ6A 1QHNA 4U3JA 4DA6A 1Y1SA 2Q5OA 3WVNA 1AXEA 3BTSA 1ADFA 3RJ5A 4G41A 3IIIA 1US8B 4BNFA 4DM3A 3O90A 4QJIA 5B4UA 3O3CA 4HAVA 2H2GA 4JY7A 4S35A 4GKJB 3E0QA 4EHNA 3JQFA 2IPOA 3FWZA 1IYZA 2Y0CA 5EMNA 4Z3DA 2R84A 3FZEA 4EJSC 2XEDA 1UYJA 2D1FA 4Q9AA 4US0R 4WA7A 5EMLA 4ESVA 1ZH4A 4H4CA 1ZVMA 3H2YA 3ORRA 3VXKA 2ZBPA 2CL5A 5JNVA 2JAOA 3ZE6A 3PRJA 2GS9A 5JWOA 2PWZA 1AQLA 4X41A 4FEEA 1RNLA 3RIGA 2VYCA 1F4LA 1HBJA 1OKKD 2G06A 2CMKA 2WJGA 1JDPA 3UC5A 1P7PA 1ES9A 5CJJA 1TEVA 3D7RA 3G2JA 8ADHA 1U7XA 2PUAA 3KO8A 1WPGA 1QK5A 1P0PA 3G2LA 3ZXSA 3HP4A 4O89A 1MF7A 1JFTA 3T99A 3W6ZA 4DUGA 5CFOA 3CT4A 1FX1A 2JGAA 4X45A 2AG5A 5FPYA 4NF2A 1P62B 3D8BA 4TT3A 5ITSA 1H2BA 3LMKA 1RXWA 2D5BA 2HMAA 3EP4B 2Y05A 3BKWA 3CEJA 3SBEA 3O8NA 2QLJA 4J0HA 5B2ZA 2C1XA 3DKRA 2E7ZA 3GLVA 4FN4A 4IG9A 4RTLA 4FQ7A 3HB7A 5BUQA 5JI3E 1ZHOA 4LDJA 1USIA 2A59A 1M33A 3CB2A 2YW9A 3RTCA 2AMVA 4DLWA 1T36B 3GDHA 1RCUA 2Z56A 3ZJVA 1Y5LA 1G0OA 3LPAA 5MN5A 3AZOA 1E4EB 2IYSA 4Q9HA 1UC8A 2G9VA 2VPZA 4IHJA 3C6QA 4PX2A 4BFWA 1IAQA 2BMJA 2FWJA 2Q28A 2WFZA 4GE0A 4J03A 2X0IA 3DWFA 2XZPA 4MGKR 5TGZA 5BYBA 1Y8ZA 2P9GA 1RLJA 1FC0A 3M8KA 3EC2A 3WGZA 4C43A 4F3KA 3WDMA 3G1UA 2G5CA 1FYXA 2A33A 3CH4B 3QIVA 1XWWA 3H97A 3K1JA 2WYIA 4M1ZA 4OHFA 2C9BA 1XLWA 4XLTA 3HUTA 1E64A 3OKFA 1ENZA 2F1JA 1LJLA 4H7PA 4ENQA 1MGPA 3PFKA 1UFRA 3LFHA 1RHKA 2O0MA 4L0QA 4A2CA 1H1DA 3A4TA 5H4GA 1D4ZA 2W6ID 4P92A