2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Dimeric dihydrodiol dehydrogenase
publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
4OIMA 5TRTA 1WXDA 3WQSB 4I5GA 3RSHA 5IF3A 2C5EA 4Z0PA 2DUUA 4LCJA 1BDMA 3GY0A 1U1IA 9LDTA 4D43A 2I3AA 2V6FA 3JQ8A 3K9QO 4JQCA 5ER9A 3RBVA 4HFMA 1HDYA 1I3MA 1YJ8A 1SB9A 3ANLA 4BMSA 5KCZA 1V3TA 3LT4A 2VUSA 3TFOA 4UUOA 1NBOA 1ZSYA 3UFXA 2NUAA 3NT2A 3OIDA 1ZSNA 2CFCA 2QZZA 2W2LD 5AYVA 1AUPA 1LUAA 2GD1O 4R5HA 1N7HA 4BO3A 4DYDA 3O38A 4GL4A 5KKCA 1S6YA 2WD8A 2X5JO 2Y1EA 3SJUA 3E5MA 3W4JA 4H15A 3PYXA 5EJ2A 1N2SA 4TQGA 3QJ5A 3PPIA 2XXJA 3GVHA 3FBGA 3E18A 2G0TA 2IODA 3ZWNA 4RVUA 4DIFA 3GGOA 3LC7O 3L9WA 3CPSA 3JTMA 4DQVA 5JY6A 1BVRA 3PXXA 5ADHA 1UH5A 2EGHA 1LRLA 1J0XO 4PLFA 2WJPA 4OM8A 4QUKA 1D1SA 2YJZA 3F46A 1F17A 4TWRA 3ROKA 3PFFA 2J3IA 2C54A 4ITUA 1T2CA 2UYYA 3VTZA 5I9MA 1CF2O 1ZCJA 1V8BA 3HQ4O 4JN6B 3HG7A 5DP2A 1ZEJA 4BGIA 4EUFA 2FWMX 4XIYA 4L9RA 2HJSA 3GK3A 1E6EA 1JU9A 2B83A 4AJNA 1PGQA 1E7QA 1KETA 2BD0A 3B70A 3RAJA 3ZWAA 3JCZA 1W8DA 1BTOA 3VKVA 3WJAA 1B0AA 1ADBA 1KVSA 4CPDA 4NU5A 4PLHA 1FDSA 1PGPA 1K6XA 3ZH2A 4IGEA 2YV3A 5A9TA 1UP4A 3I9NA 3NT4A 4IY1A 2E4AA 2CDCA 4QO8A 3ZV5A 3JYOA 1XGKA 5JCXA 2BH9A 2O3JA 4DC0A 1UZNA 4ZU3A 3H5RA 4IIVA 4EGFA 2X9NA 1LDYA 1TA4A 1C1DB 3MTJA 1T1RA 1GQQA 5JCJA 4FGWA 1WDKA 4WKGA 4ZQBA 1UZLA 2NWQA 1E3LA 3GMSA 2NSDA 1GUYA 3IQDB 3D64A 3N58A 3SLKA 4YRBA 2HSDA 3BMOA 3PVZA 4AL4A 4E2YA 2Z5LA 1E5QA 1T4BA 3V1TC 1HTBA 2X5KO 2O3TA 1R4MA 4CM8B 1V35A 4DWVA 4FS3A 3RC7A 1BXGA 1I36A 2BI8A 5C37A 2B4QA 3FCOA 4GX1A 1WNTA 5AVOA 1HDZA 1K0UA 2NVBA 3GR6A 1JVSA 2P5UA 3K5PA 4KWIA 3UCFA 1EDZA 4M8SA 2ZB8A 1YE3A 4R5MA 3Q9UA 3ZNPA 5FWNA 1UDBA 4PZCA 3JQ9C 2DKNA 3L4SO 1XQ1A 2NVWA 3D4OA 1ULSA 3FBTA 2ZATA 3AUAA 3KLPX 4J7UA 4TRMA 4R16A 1U7TA 4WASA 4EYEA 2FPIA 1Y7TA 1P3DA 2J3KA 3DO5A 3I9JA 3QQPA 1KVQA 5JYDA 1NVTA 1QXSA 3DHEA 4XYGA 2DBRA 1MG0A 4IMRA 2YHIA 3TZQA 4ZICA 4FIZA 1EFLA 1SPXA 3ZWOA 1VKNA 2B0JA 5JXWA 4AJ4A 3B20A 4XDZA 1E1KA 2ILTA 1DJNA 4B4UA 2CVOA 5KVQA 1D4FA 3AU8A 3EVTA 1HRDA 4O5OA 3W1VA 4BNUA 1HF3A 5KNLA 1CEQA 2D0IA 1T1SA 4WLUA 4NG5A 1LSOA 2I67A 5H81A 1XKQA 4NFYA 4NNJA 1RM5A 4RJTA 1Y8QB 1YGYA 2JHFA 5TGDA 4RF5A 1MFZA 2CUKA 2V7PA 2YHUA 3RASA 2Y66A 2ZTMA 3L77A 1Q0HA 4BHTA 2FPPA 3JSAA 3WWYA 4FSHA 4OKIA 5FI5A 1PL7A 3PHHA 3H8VA 2NVUA 3CMCO 2QYTA 1TB4A 1X15A 2NTNA 5L53A 4WOJA 1WMBA 4CQLB 4FOSA 5CEFA 1QSGA 2Q45A 3HDJA 1IULA 3LU1A 4A03A 3F5QA 4LGVA 1U8XX 3ON5A 4W82A 5EPOA 3O8QA 1PSDA 3GQVA 5TC4A 4BO7A 4Q3AA 4ZQHA 2EF1A 3MJEA 3LT1A 2H9IA 1HT0A 2RBEA 1D3AA 1M66A 2VNAA 1NHWA 3ADOA 3FN4A 6LDHA 3R0IA 1T25A 2JL1A 5AQ1A 2HQ1A 4PN3A 2YUTA 3UKOA 3TZHA 4E6PA 2HAEA 3EZYA 3BA1A 4DIOA 2NQ8A 3PQFA 4FCCA 1UJMA 4AJLA 2ZK7A 4NZ9A 1P1HA 1TXGA 3NTRA 1YQGA 5HBRA 5ER6A 1U5CA 3CZRA 2Q4BA 2W2KA 3MEQA 2PY6A 2B4RO 2DLDA 4LCEA 1I5RA 4EEZA 4XR9A 3E5RA 4BO2A 1LSJA 1VM6A 3ANMA 3QWBA 1ZK4A 3TWOA 4HBGA 5IDQA 4IJVA 4DL9A 2YDYA 4R1NA 1XWFA 2BGLA 1OMOA 2VYND 2FSVA 4QTZA 2DTXA 1ENPA 2RCYA 2Y93A 4IGFA 3I9MA 1W73A 4I5EA 4WJZA 1MG5A 3QSGA 1CETA 4YQYA 1X13A 4KZPA 4YRAA 1B26A 1YRLA 4GVXA 4R1TA 1E5LA 2W4QA 1PGJA 3JD4A 3KSUA 3VH2A 3H9GA 5B4UA 4PRLA 4INAA 2NTJA 3L9XA 4YB8A 4MKXA 3EAGA 2O3UA 4UVIA 2X58A 5C7IO 5IG2A 1W4ZA 4FJ0A 4ZQFA 3JQEA 3I4CA 3RBXA 1PZGA 2A92A 4F45A 1PJSA 3KSZO 1NXQA 1ZFNA 1C0LA 1OZAA 3PYLA 1LEHA 3TSCA 4AG3A 2Y1FA 4BIIA 3A06A 5G4KA 5I7EA 3T4EA 3NTOA 1EDOA 1U7HA 1ZO8A 3JQCA 5I8ZA 3TL3A 3Q3CA 3KUXA 3RROA 2PD4A 5JDIC 4DXHA 3K8ZA 3GVCA 1KC3A 1I2ZA 2EV9A 1A7AA 1ISGA 2V6GA 2Y1DA 2D5AA 2W8ZA 1PJQA 2JCXA 4MIEA 3DZFA 3RWBA 4CQMA 3DHYA 4AJEA 2EERA 4NK5A 4JP2A 2ZYGA 3ZWMA 4BNLA 4WLEA 1NPDA 5GY7A 2DTEA 4J9UE 3UHAA 1AN9A 3HFSA 2DT5A 1GEGA 3PQEA 3QWFA 5G0UA 5ICMA 4WCFB 3IUSA 5THQA 2X0RA 3QVXA 3WSWA 4MVJP 3ULKA 3ZZNA 4MKRA 1E1NA 3DBLA 4KUHA 5CFZA 3ASVA 2OP0A 2B35A 4II2A 3ZNOA 4LVCA 3TZCA 3VZQA 5EQFA 1XLTA 4RPKA 3D4NA 1TT5B 1PS0A 4LISA 4E31A 1KEUA 2W98A 5U9CA 2R00C 4ZQGA 5KJEA 1O8CA 1TVEA 4BO5A 4JNKA 4BKPA 2XPCA 1E3WA 5JY1A 3FWZA 2CSUA 2Q4EA 2Y99A 2B4TO 1EVJA 3HZZA 3MCVA 3DMTC 2HO5A 2VRCD 3MWDB 2G17A 1YL6A 5EINA 1KY4A 4NQZA 2VWPA 2WYWA 1IY8A 3GNSA 1I10A 4D3SA 1HKUA 2Y1OA 4NHEA 1DPGA 2B69A 2AEMA 1YQDA 4EZBA 5B4TA 4JJGA 4OH1A 1DBVO 4RLHA 4OXYA 1DFHA 1IOLA 3E8XA 4ND5A 4CM6A 2ZB7A 4CUJA 4BGEA 1Y9AA 2BGMA 1UAYA 4UVDA 3BTUA 2RAFA 4XYBA 3WBBA 5GZ1A 5T67A 4QSMA 3S2FA 1KIFA 3H5AA 1QV7A 1BRMA 4MO2A 4BNGA 4XYLA 3ABIA 3W8DA 3KV3O 3HHPA 5COBA 4BQRA 4D42A 1PQUA 3QRWA 4MVJA 1ZJYA 4M86A 4WEOA 3RUCA 4J4HA 4LMPA 2NQTA 2BKAA 1HXHA 2GYYA 3G79A 2FR0A 2Z1NA 2O3SA 3RQSA 1P77A 2PH5A 5IZCA 2CDAA 3T7CA 4PZEA 5A04A 2HJRA 3ZNQA 4C4OA 5L4NA 2AE1A 2YQ4A 3FR7A 2I5PO 4NBWA 2VUUA 2Z95A 4WLFA 5A1TA 3S2EA 4J16A 3D5QA 3UICA 5T6BA 3LLVA 4L0QA 3D3WA 1MA0A 4E5KA 1A72A 4GAEA 4CM1A 3RKUA 4GX0A 3LVFO 1WDMA 3LC1O 3VKUA 1PX0A 1HZZA 3ETGA 1MXHA 3R6DA 5IN5A 3GDOA 4TROA 1GAEO 1NPYA 2E37A 2P9CA 4KUGA 4D46A 3OQ6A 3E48A 2I3GA 1QYXA 3ZI0A 4IJUA 3GA0A 4E3ZA 5IZCC 4FC7A 5A03A 4MINA 2Q2VA 1P1RA 4J9VA 3PYMA 5JDCA 1BSVA 4JP3A 4CQMB 3DBHB 4OO3A 1G0OA 2Q1TA 1Y5RA 1JAXA 3TPCA 5K0ZA 1B3BA 3RUAA 1UDCA 3COSA 4YJGB 1LJ8A 3PRJA 1JW9B 4CLEA 3MOGA 3GH3A 3E9MA 2EJVA 5A3JA 4L73A 1ML3A 4IDCA 3DBLB 4BO4A 1P45A 1M75A 1P1JA 4U8GA 4OSOA 2X23A 2NADA 4YBZA 2JHGA 3QHAA 3FRJA 5JYFA 4B7CA 1DFIA 5FEUA 3LT0A 3VZRA 2OO5A 2G82A 2Y0DA 4P38A 2VCYA 2AEFA 3I9OA 2FMUA 4M54A 2A35A 2GN6A 1LC3A 1PR3A 2VT2A 1QMGA 4TZTA 4AJPA 1LDMA 3D4PA 4Z3DA 1PTJA 4EJ0A 1ADGA 5TQVA 2P4HX 2BELA 3DZJA 1KVRA 3F9IA 3KLMX 3WICA 3N7UA 3GGPA 1YDEA 3UF0A 4F6LA 3OICA 4OQYA 5COAA 1K3TA 1TI7A 1ZIDA 3JV7A 4CMIB 2O4UX 2J5KA 2EXXA 5G0SA 5T8KA 3AFMA 4RGBA 4UUMA 4HV4A 2E48A 3LC2O 1ISFA 1NWCA 3G0OA 4RVFA 2Y67A 1GADO 4YAIA 5CPFA 4K1LA 4AJIA 3IC5A 3PWKA 3IUPA 4DLLA 3Q9NA 1ZXBA 4IINA 2C07A 4RF4A 1IL0A 1GV1A 4BNMA 1T4DA 3FTPA 3WGZA 2VZ9A 3WGYA 2OHXA 4J1QA 2ZB3A 3H4VA 4BUCA 5IXSA 1EBUA 3OBBA 4BNIA 5K6AC 3N74A 4J1SA 3WMXA 1Y1PA 3OF2A 5T8KC 5DCWA 2WD7B 4C7KA 1Q1NA 5C3MA 4B7UA 4CM9D 1JDJA 2VHZA 1H6CA 5U1PA 3ZWYA 4D0RA 4BNKA 3INTA 3PHIA 3ZV3A 5JC8A 4YDRA 1QYDA 3D3EA 3R1IA 1EFKA 4KQWA 2AG8A 1KS9A 4MDHA 1YH3A 3ITDA 2OOSA 3BTOA 3TJRA 1IHXA 4JGBA 1H94A 1M76A 4NBVA 2I6TA 1ARZA 2WYUA 4JBHA 4OAQA 1DIGA 3GPIA 1J5PA 2J6IA 4IQGA 1M2WA 5F1PA 4YVFA 5A9RA 3PJEA 4JX8A 2EW8A 3RFVA 1IE3A 3AY7A 1MX3A 3RD5A 2VZ0A 3ZNNA 1U3WA 3HADA 3M1AA 5GZ6A 5TX7A 1KY5A 3H9EO 4DRYA 5G2OA 1X7HA 2Z1MA 1A27A 4NR0A 3WJ7A 4LMRA 4RVGA 3M1LA 1K2WA 1HDXA 2PGDA 3U3XA 2VOEA 4B4WA 1LX6A 1KOLA 3TDKA 4ALIA 4DPLA 3QWAA 5CDTA 2DC1A 2FHSA 4G81A 3FNFA 4XJSA 1UR5A 1SOWA 4DC1A 1LQTA 1C1DA 1U2GA 2EKPA 5KVCA 2BFPA 1P1KA 2GCGA 4YJFB 3K2BA 1PZHA 2OFPA 4R9SA 4IS3A 5CEJA 4I9NA 3OJOA 4PVDA 3P7MA 1OFGA 2YFQA 4I8XA 3D5TA 2CD9A 1OOEA 4CM5A 4IZIA 4FB5A 4XIJA 1HETA 3OQ1A 4UEJA 1ZVMA 1NNUA 2DPHA 3I1JA 3OEWA 3DDNA 4RQUA 2ZCUA 5A5EA 3BTSA 4CMAA 1HDOA 1LDBA 3G1TA 4CM8A 3KYCB 4J4BA 2PV7A 1YDWA 3WGTA 4KDFA 1X14A 2BLLA 4Z3KA 4OYRA 2VYVD 4BNVA 1MLDA 1HLDA 1PZEA 3FF4A 3GOHA 1E3SA 4BNTA 1I33A 1IYZA 1YL5A 1YONA 3H2ZA 1EUZA 1O6ZA 2O3QA 1NASA 2PD6A 4M89A 3HFGA 1JKJA 1T2FA 1X7DA 4CLOB 2PKRA 4P4LA 3OFSA 4ND3A 1NHGA 3CEAA 3GMDA 3A28A 2FR1A 7ADHA 2O3RA 3C8MA 2DFVA 2OXIA 1P44A 2BI7A 3H5NA 4ZGWA 1X1TA 3MJVA 1WPQA 3BAZA 4HX5A 4HKTA 4KDEA 2H6EA 2DUWA 4DTIA 3H7AA 4Q9NA 4MVJI 4MVJG 3P2YA 4YT5A 1GD1O 3AM5A 1ONNA 2LDBA 4IIUA 5KJ6A 5KVSA 3EW7A 4WPGA 1NQOA 5IDWA 2GZ1A 2BGKA 3UVEA 1O89A 4RPGA 4RORA 1Y8QA 3U62A 4Z0HO 4XRGA 5THKA 8ADHA 3RCBA 3AI3A 3F1KA 4H16A 3L4BA 3QV1A 2Y1GA 1T2DA 3BMNB 4RPLA 3C24A 4FFMA 4JXKA 4NI5A 3WGGA 2ZYAA 3NJ4A 3NRCA 5JAZA 4Q3BA 2DM6A 3OIFA 5AXBA 4MVJF 4TVBA 1XU7A 3TL2A 2LDXA 4CL3A 4YAGA 1O0SA 4EDFA 1HE3A 4CQLA 1Z7BA 3WWZA 4YR9A 4J6FA 3X2EA 3C3XA 4R4JA 3A4VA 2GO1A 3ICCA 4HP8A 3MOIA 2O50A 3ANNA 4IJWA 1K89A 2EW2A 4RZIA 2OMEA 4UVEA 2ZJ1A 3L4BC 2BFAA 2D8AA 4JK3A 4P22A 3VPFA 2EKLA 1X0VA 1CDOA 2B5WA 4M87A 2OORA 4FFNA 3RC2A 3DR3A 4E5MA 2IEDA 1CERA 3JQDA 5B1YA 4QFCA 3RUHA 3ZW8A 2NV6A 3QIVA 5JE8A 4CMJA 4D44A 1T2AA 5JLAA 3TRIA 1DC4A 5DF1A 2AQHA 3ETEA 3OIGA 3Q2IA 3Q0EA 3JQ9A 2AG5A 5ES3A 4YCAA 3RI3A 1QRRA 4PLYA 4BMVA 5JAIA 3DAFA 3DZHA 4DMMA 4XKJA 4CLHA 4IXTA 1F0YA 3PGJA 4J91A 4J2OA 4U5QA 3PTZA 1ZMOA 1IZ9A 3EDMA 3RUEA 2C59A 3DZBA 3KTDA 3PLNA 4K28A 2I76A 3OSUA 1EQ2A 3K6JA 4TKLA 3QVOA 1FDUA 2GZ3A 1G0NA 5BNFA 1VSUA 3SLGA 4E5YA 2HK9A 1P74A 4BQPA 4TSKA 3Q1LA 3GNTA 3FNEA 1ENOA 4UVGA 3WIEA 1E7MA 1DRWA 3JQBA 2IZ0A 3U09A 5JCJD 2IYPA 2EP7A 4G5HA 3IP1A 2UDPA 4U6SA 1D7OA 1XU9A 4BV9A 3DXFA 4RF2A 1CYDA 4NDNE 3TF5A 4GWGA 2QW8A 2FN7A 1I3LA 1Y8RB 1Q7CA 3RFXA 1FMCA 2HRZA 2R6JA 3RUIA 3PIDA 2HMUA 5JAMA 1UXHA 3TFQA 5A9SB 1SEVA 2AE2A 4J7XA 3QWIA 2CF5A 3F3SA 3SEFA 1I32A 2P9EA 3HDQA 3PJDA 3ZGYA 1WLYA 1EQUA 3UGKA 2O48X 5TT0A 3IJPA 3JQBC 3WYCA 2WEKA 3ZU4A 3D1LA 3I6QA 2BFOA 2WM3A 3GDFA 5EN4A 1XQ6A 3IDSA 3ZDFA 4DQXA 5KWEA 1I24A 3RVDA 2CF6A 2EHDA 2PH3A 3ENKA 3KEQA 4LK3A 5T5QA 4WLNA 1JLLA 3QVTA 1F8FA 1XDWA 3ONEA 2G1UA 1MFPA 4OSPA 3H9JA 2WE7A 5KJFA 1TEHA 1QYVA 2XF8A 5BQFA 4NU6A 3IKVA 4WCFA 5A05A 1AE1A 4J7CA 3AY6A 4E33A 5BSGA 2JAPA 4CM4B 1UXJA 2Q50A 3IL2A 5LCXA 1N8KA 3H9UA 2AW5A 4OOFA 2BHLA 4K6CA 4JJIA 3ETDA 3HDHA 4NPCA 3UN1A 3BHJA 3AW9A 1TT5A 2JAHA 2A9FA 4GH5A 2AQKA 3FI9A 5H82A 5IFLA 3RBZA 3NKLA 3L6DA 4Y6SA 2D59A 5F21A 1PR9A 4FN4A 3BMQB 4XGNA 2TMGA 3NDIA 1N9GB 1PU2A 2GRAA 3KVOA 1ZUD1 4ZQEA 4TZKA 4RVHA 4RLSA 4WCFC 2VHWA 5A3VA 1E0DA 4D3FA 3WNQA 5IAAA 1E92A 1PL6A 4YA6A 1RKXA 3LLSA 1JWAB 3NDJA 4OGWA 2QQ5A 4RVSA 4XGIA 3MWEB 2HMSA 3E6AA 3MTGA 4CMEC 5J23A 2Y05A 1QYWA 2X4GA 1TT7A 1SMKA 4BL5A 3GNQA 2C7VA 2UUOA 3ROMA 1HEUA 5EMHA 2VHVA 3B1KA 4D41A 3OJFA 4GX2A 1E7YA 1GR0A 2JKVA 3KSDO 2Q2QA 4BKOA 2UVDA 4R3WA 1PQPA 2O7QA 3ZWPA 3ONDA 4ND1A 3SXPA 2IXAA 3LDHA 4JIGA 3OM9A 4GSKA 3RJ9A 2QIOA 4GKVA 3E03A 3DFUA 5LDGA 4BMNA 3ONFA 5IN4A 1Z7EA 3ZW9A 1DC6A 3CSDA 5A5FA 4GSLA 3GAZA 4LSWA 4ZRMA 1HDCA 5BSEA 2PFGA 4CR6A 3EHEA 3PDUA 1EVIA 3A14A 4F46A 2ZCVA 4Z9YA 1Z82A 5JDIA 4E0BA 4WCDA 4URFA 3VPHA 4A5OA 3PI7A 1KYQA 4HFRA 4ALLA 3FNHA 4N5LA 2DBVO 2GASA 3NDRA 1LDNA 5L9AA 4IQ0A 4R54A 1DC5A 3DZIA 4RPJA 4E2ZA 2B37A 1SB8A 3PIIA 2OGUA 3U4DA 1LRJA 3KHUA 1PJCA 3GFBA 4K26A 4XYMA 5AXAA 5ITWA 3INGA 1HE5A 3S55A 3SC4A 4EBFA 2ZQZA 3BYZA 3ORFA 4FGSA 3FHLA 3KZVA 1UXKA 3DOOA 3AM4A 2AQIA 2O4CA 4HUJA 5IJZA 3NGLA 1C0PA 4O0LA 1KEPA 3ZCXA 1LQUA 4DLBA 3HDYA 3C7CB 3W6ZA 1ZJZA 3C1OA 5TT1A 1E3JA 1UUFA 4YRDA 1XA0A 3QWHA 5ILGA 3OA2A 2C20A 3MJTA 5CP8A 5L3ZA 3DBHA 4NJMB 4DIBA 1RJWA 4O6VA 2R00A 1H2BA 3FNGA 3CUKA 6ADHA 5DDIP 4CV2A 2NNLD 2D4AA 3DAGA 1XIVA 4YJGA 5F3RA 3T4XA 1I2BA 5L95A 1DHTA 3QE3A 1JWBB 4BOYA 3DMTA 3AK4A 1DOHA 2WTBA 3V2HA 2OZPA 1EMDA 1P33A 4ZJUA 2PKQO 4RPHA 5DBFA 3GEDA 1X7GA 3E9NA 1WZIA 3FWNA 5I7FA 2GDZA 3G49A 1LA2A 1ENYA 1LNQA 1PJ3A 3HUDA 3K2EA 2P2SA 1SBYA 2AQ8A 1A5ZA 1CIVA 1BW9B 1MV8A 4UVHA 4FR5A 1IHYA 3C7AA 3WX0A 2HDHA 3WTBA 4OXNA 5JSFA 1XCBA 4PRKA 2NU6A 3LF2A 5DCYA 1D8AA 4OOEA 4GBJA 3AJRA 1GUFA 4CQMD 1XG5A 2ZTVA 4L4SA 1ZNQO 4U0JA 3FPLA 4W4TA 1R6DA 1YBAA 4BB5A 4RQTA 4CV1A 3HB4X 1HZJA 3ZWVA 3PJFA 3U4IA 2HCTA 1DAPA 1GQ2A 4PGFA 4R1UA 4IS2A 1PWXA 3AUSA 3F47A 3GVPA 4O59O 4QQRA 3VPSA 5DOVA 1JVBA 1R0SA 4I5DA 1SZJG 3PLRA 4A2CA 3EMKA 3DONA 4CMIA 4IMPA 3KYDB 1DIAA 2WYVA 1F06A 2E49A 3UCXA 1H2HA 2EWMA 4BNNA 3U0BA 1O94A 3SBOA 2NM0A 4UAGA 1NFFA 1Z75A 2G5CA 2O7SA 2I99A 1IZ0A 5A06A 1PJLA 4BNHA 2OBNA 5TIIA 2VOJA 1XYGA 5CDYA 1VPDA 1GU7A 3PGXA 1JTVA 1C3VA 4YXFA 3UW3A 3EY4A 3ZWCA 4LRTB 4DPKA 2RH4A 1LXCA 1ONPA 4U7WA 1GV0A 1EVZA 1R16A 1ISIA 1GPDG 3CIFA 1Z45A 4NIMA 1FDWA 3DBRB 3PFWO 5JYEA 5KJCA 1E7SA 4YQZA 3C1AA 2AXQA 2QRLA 3WIDA 1U4OA 5I7VA 1WZEA 5ILOA 1RM4A 2Q1SA 3ADPA 4H7PA 2WD7A 1ONOA 1PQWA 2X9VA 2PNFA 5L40A 5JC1A 4HXYA 4XA8A 4IXWA 4FFLA 4P4NA 2HK7A 1DRUA 3GGGA 2Q49A 4NFHA 4L75A 3UUWA 1ZXLA 3S1LA 1IB6A 5DT9A 1MC4A 1WMAA 4XB1A 3H9QA 1F8GA 3W6UA 3WGHA 2GZ2A 2YV2A 3NUGA 3K96A 2HRBA 2XAAA 3GRPA 4FDAA 4R1SA 2WDZA 5F5LA 4MVJD 1W6UA 3L6EA 1R12A 3F4LA 5CAEA 1YXMA 4ILKA 3O03A 3IS3A 4ZA2A 3BMCB 1I30A 4WNIA 2CZCA 2ZYDA 1MXFA 2FY8A 3HWRA 5DCUA 2AMFA 5T73A 2WSBA 4CMHA 5TJHA 5IZ4A 1OC4A 1ADCA 3Q2KA 2DFDA 3JYNA 2Q22A 3RFTA 4DMLA 1YKFA 2VZ8A 3ROPA 4FQ8A 4PLTA 4B3IA 1R66A 1KERA 3KO8A 4YJFA 3QW2A 4E2WA 4Y9DA 1NYTA 1Q0QA 4J0EA 1BHSA 3JQAB 1BWSA 1E6WA 4WLVA 1DLIA 1U28A 1WW8A 2QRJA 1Z6ZA 3I6IA 3WSVA 3WTCA 1DIRA 2Q2WA 3DTYA 3U5TA 4TRJA 1NVMB 5JYAA 2JD1A 3AUTA 3V8BA 4L4RA 4EJMA 3KYCA 1H6DA 5A4DA 5EQDA 2R2GA 4B8ZA 3NV9A 4FD3A 1F14A 2Q3EA 1F12A 5CDGA 4D7AA 4QX6A 3ZWXA 2P91A 3JQFA 4J43A 3UOGA 4B4OA 3W8EA 1GYRA 2J3JA 4FPXA 3GF4A 4MKZA 5H83A 5KOIA 2H5LA 4AVYA 3PDJA 3S2IA 3A9WA 1GUZA 4A26A 3VDQA 3ZU2A 4CLOA 3INRA 3LK7A 3NGXA 2X7HA 1AHHA 3HN2A 3LZ6A 4A10A 4GLLA 1SO8A 3G3EA 4A0SA 4CM7A 5K6AA 2B36A 4FOOA 4YWJA 1VI2A 4Q3NA 3CXRA 3H3JA 4HWKA 4CMKA 4PVCA 3ZHYA 1B7GO 2XOXA 4ESOA 4LVUA 3EVNA 1L7EA 2YYYA 1P31A 3QVWA 1LLDA 3JQFC 4GWKA 3I5MA 3EYWA 1HSOA 3WGIA 1D1TA 4L4XA 2JFFA 3IOYA 3NTQA 1JAYA 2O2SA 4DA9A 1V9LA 4YYZA 2X6TA 3CMMA 4ALNA 3GC6A 4YTEA 2EEZA 3CH6A 2IXBA 2X0JA 1LSSA 3HE3A 1P0FA 3L07A 4S3MA 3O4RA 1A9ZA 4PFJA 3R3SA 4E2XA 3HNPA 1NM5A 3M2PA 1LRKA 3ENNA 2FRDA 3ZU3A 3LQFA 4ALMA 4Z6KA 4L76A 1E1LA 3RKRA 3BMNA 1KC1A 2GNAA 2IDZA 1VE9A 1B2LA 5GZ3A 1VJTA 3JD0A 1C0IA 4M49A 4PLCA 2P68A 4E13A 3VZSA 3IP3A 2QHXA 3NJ8A 3ROQA 3WG9A 4OQZA 4ZD6A 4EW6A 5JO0A 4BVAA 4IBOA 1O9BA 3I52A 4FJ2A 4GMGA 2BFMA 1RWBA 4QFDA 4XD2A 1G1AA 2YFHA 2J5RA 2Y0CA 4ZVVA 2J8ZA 4Z0TA 3P5SA 2WWRA 2HK8A 1YJQA 2QZ9A 3U9LA 1EZ4A 4YAKA 1AHIA 4K6FA 2GSDA 2AHRA 5KTKA 3Q6IA 1ZKMA 5G0VA 2X9GA 3DEYX 3IMFA 3GUCA 2D1YA 1EEHA 4OMUA 1RPNA 3PK0A 5DBGA 3DFZA 1XELA 5U4QA 4YT8A 1VJ1A 3VH1A 1AGNA 1N1GA 3VHRA 1JQBA 1LI4A 4WLOA 2EP5A 1LU9A 3DHNA 3V1UA 2VRBA 1HYEA 2VTEA 4C7JA 4JBGA 2UAGA 3I3OA 3GHHA 4W7IA 1E3EA 1DJQA 3HN7A 2V6BA 2ZJ0A 3QVSA 1GZ6A 3DOCA 4YJDA 2YQ5A 3X2FA 1W0CA 3NT5A 1Q7GA 3E9QA 3JD1A 3P19A 2DAPA 1MC5A 4CV0A 1DFGA 2VWGA 1UP7A 4MVJH 5T57A 4PLPA 3O26A 2X0IA 2GLXA 1ENZA 1KVUA 3FPCA 2ZKLA 1HYHA 1ZBQA 1N1EA 3ZV6A 1L7DA 2CNBA 1VC2A 1SEPA 3E1KA 4R51A 5JW6A 3RIHA 1QLHA 5HTOA 2JD2A 1PZFA 5HS6A 3OMLA 4GGPA 4OJNA 3SVTA 3AOGA 4PCVA 3DBVO 2W2LA 4GVLA 1I01A 2YW9A 4RL6A 4BNJA 4E30A 1CQIA 1FF9A 5IDYA 2H63A 2D3TA 2CVQA 1Y8RA 4YAEA 2V65A 3AM3A 3KM0A 4EITA 4WE3A 3PHGA 4QO7A 1YOVB 2TMDA 4Q3EA 3W8FA 1SOVA 5A9SA 2PLAA 4R01A 4J1NA 2C29D 1ZH8A 2OP1A 4AJKA 1ISMA 1EUDA 1FXSA 3AU9A 1G6KA 3DQPA 4AICA 2JFHA 2NU8A 4XEHA 1QR6A 3VPGA 3DB2A 2DQ4A 3CTMA 1R4NB 4OXKA 1GTMA 1O5IA 1NQTA 2D5CA 4D3DA 4WECA 5HS4A 3GG9A 3PP8A 3GG2A 4ZN6A 3H3FA 3A1NA 4JBIA 4BNZA 2BRUA 5L45A 1YL7A 4P8RA 3VAZA 4UUPA 2IEBA 3DWFA 4UUNA 1Y6JA 2H1SA 5JMPA 4A7PA 4NH4A 1BDBA 1Y5MA 4XDYA 4YJHB 1NPTO 1YBMA 4QECA 4B3JA 1OI7A 2GN8A 3DC2A 5IXYA 4W7HA 1LTHR 1T26A 1JN0A 4CM4A 1U2DA 3GZNB 3UAGA 4R68A 4MJLA 4PG6A 1OC2A 2QYSA 4LN1A 3WGQA 4RDIA 3VC7A 1T24A 2VNSA 3KYBA 1ISHA 3H65A 1H6BA 1NAHA 4NMHA 1VLLA 2OUIA 4MVJM 1HE4A 2IYOA 1BGVA 1QV6A 5L7YA 4QEDA 3I83A 1GPJA 3QLJA 4N54A 3EGOA 4I5FA 1GZ3A 4D0SA 2JCYA 3U4HA 5DZSA 3BMQA 3OECA 1JKFA 1N9GA 2G76A 2J5QA 2HMTA 4II3A 1YS4A 4NBRA 1P0CA 2I9PA 5K9ZA 3CINA 5CG1A 1E1MA 3RU9A 4EJ6A 5BNTA 4Z9FA 3ZHXA 3TNLA 4BO0A 3JQGB 5JNLA 4MP3A 1N92A 1OBFO 2PWZA 3LF1A 5AXCA 4D79A 1SCUA 4JROA 3GEMA 2DBZA 3RUDA 4BNYA 1KBZA 1C1XB 3RJ5A 3I23A 3TQHA 2DTDA 3WR5A 3JQ7B 2PGJA 4IDFA 4AJOA 2NU7A 1E77A 3WQRA 3PZRA 3I9KA 2D2IA 3K73O 1HDGO 2ZTUA 1U3VA 3OP4A 2JD0A 3QA9A 1GDHA 4E32A 4FFOA 3SX2A 1VKOA 4I9UA 1NFRA 1H93A 1H9AA 2CY0A 4BGVA 1GYQA 2NACA 5BT9A 4CLRB 4MIOA 4ALJA 2QG4A 1E6UA 4TVOA 1V3UA 2X86A 3PZBA 4BKQA 1Z74A 3JD3A 1N7GA 1ZK0A 4LW8A 3VVCA 3FD8A 4PLGA 4CMCA 3CKYA 3DAPA 3EUWA 3GDGA 1DHRA 5B4VA 1MUUA 4DLAA 1PL8A 5ITVA 4YT4A 1XHLA 3E82A 3WYBA 2HMVA 4RCVA 1GQYA 1DSSG 1DIBA 3JQ8B 1ID1A 3EZLA 4N5NA 1A4UA 1EE2A 4LRSB 1WVGA 3CZMA 5AXDA 3RU7A 1EK6A 1GY8A 1PGOA 2AEJA 4U6QA 4DGSA 1BVUA 3V1YA 2DVMA 2YDXA 3HJAA 1CWUA 5C5IA 2HU2A 4XRRA 2BF7A 4HFJA 2PD3A 3IAHA 1SNYA 1M67A 3LT2A 4KTTE 4XQ9A 5B12A 2O2YA 3MJSA 1LLCA 4KTVE 2Y0EA 3H2SA 1QG6A 5G0WA 1E7WA 1P1FA 4CODB 1GCOA 4XCVA 4NJMA 5KIAA 1CRWG 3NYWA 1ZZEA 3G17A 4E21A 1I3NA 1KEVA 1R0LA 4HNHA 3IJRA 1RYEA 3DL2A 4FBGA 2NTVA 1ZEMA 4AJHA 5EESA 1BXKA 4P4GA 1XR3A 4BB6A 4Y6RA 3TZKA 2HMWA 5M6DA 2VWHA 2WE8A 5DOZA 4CLDA 2FZEA 4QT0A 1Y9EA 1DO8A 4WUVA 3WDSA 4B8WA 4X54A 1LSUA 2A94A 4DBZA 4CMEA 2I65A 5FI3A 2I66A 4QXMA 3BHIA 4DQUA 4GX5A 3PHLA 5HRUA 4F6CA 1J49A 2VTDA 4R41A 2NU9A 3SC6A 4YEDA 1BW9A 1B8UA 3BZUA 3JYQA 2CDBA 1XEAA 3LSYA 2FOIA 4HFNA 3K92A 1S7CA 2EKQA 3S2GA 4FC6A 4Q3CA 3W4IA 1U5AA 3V2UA 3OA0A 4GGOA 4MIYA 2IE0A 1HYGA 2F1KA 5L4SA 4MP6A 1IPEA 4L74A 5B37A 4GI2A 7MDHA 4BV8A 1M6WA 3IKTA 2JJYA 2C7GA 3PWZA 3B1FA 3OEYA 3RC9A 2VYNA 4BO9A 3R3JA 1EE9A 3G1UA 1R0KA 1NWHA 2PZLA 5ENVA 2A4KA 1I2CA 1UZMA 1HE2A 4OKNA 5HA5A 2FSSA 3KYDA 2YY7A 5CHEA 1LLUA 4PIVA 3PQDA 1YB5A 1VJ0A 4XWYA 2EGGA 3D0OA 3LYLA 3PJGA 4PG7A 1HSZA 1I8TA 1PEDA 2SCUA 5I8WA 3K30A 4RVDA 3RC1A 4W9NA 2HLPA 3F1LA 1QLJA 3DZKA 4TKMA 1V3VA 3F4BA 5FFFA 5F1KA 2HUNA 3JYLA 3ZWWA 3L0DA 3BMOB 3AOEA 1EK5A 1E7RA 5KJ1A 1YVEI 4O1MA 3DBRA 3B6ZA 1YWGO 1CQJA 1DC3A 1BMDA 5TF4A 1R4MB 4J1TA 4H3VA 3AUUA 3OETA 2HKIA 5EL0A 1BXGB 1DEHA 1DRVA 3TOXA 3VPXA 4EUHA 2VQ3A 3WNVA 5C7LO 1EVYA 1B3RA 5CDSA 3GZ4A 1A4IA 1DDOA 5JAQA 4FW8A 4XQCA 4W9NC 4AJJA 4WGGA 3WGOA 1H9BA 5LDHA 4CR8A 2VN8A 5MDHA 1H0KA 4Y67A 4B4VA 4KMSA 1SC6A 3MJCA 1FJHA 2GUGA 2DPGA 4Q39A 1HL3A 2E82A 4L8VA 4YAJA 4NBUA 4BS9A 1PJBA 3AOEC 4A27A 4YPOA 4F3YA 1NX6A 4NK4A 1VRWA 4IQ8A 4NBTA 1I3KA 1K6IA 1K6JA 4CM3A 4CLXA 4IZHA 5C7OO 5HWSA 3VOSA 2VHYA 4IDEA 1LC0A 1P9LA 2GPTA 3WXBA 4XJTA 1Z73A 5CG2A 3I4FA 2PKQP 2O23A 2YHIB 1O95A 3BMCA 3OJEA 5AOVA 5GMOA 4KQXA 2Q99A 3NEPX 4GPD1 1AXGA 1QYCA 1U3TA 4ALKA 5BNIA 2NLOA 4ID9A 5L4LA 1NQAO 4MP8A 4IJKA 3JQAA 4E4YA 4Y98A 4TRNA 4UULA 1DAOA 2OL4A 3VTFA 3TZ6A 1FDVA 1VL0A 4PZDA 2EJWA 2OBYA 3NX4A 3DTTA 4J3FA 3GT0A 4WEQA 2V6MA 2VUTA 1Y81A 3MZ0A 2Q46A 3KEOA 4Q3DA 4EUEA 2VRCA 4GKBA 4W6ZA 2NVUB 4CV3A 3ITKA 4LSMA 2IRWA 2IZ1A 3GVXA 2CVZA 4RV9A 1ZK1A 3C1TA 1J4AA 4MPDA 4AFNA 2JCVA 2Q1WA 5CEEA 2ET6A 1IPFA 3D7LA 5DP1A 3W4KA 3DZGA 1CJCA 3O8QB 4Y8VA 4DUPA 3VVBA 3T7EA 3U49A 1EUCA 4BNFA 4UEOA 4J2HA 2ZIZA 2UUPA 2RH8A 4J0FA 2RIRA 2Y68A 5COQA 2J3HA 2RHCA 3VDRA 1Q2XA 2VT3A 4HY3A 3UCEA 5KVVA 1A71A 3M6IA 3DOJA 4KUEA 1NQ5A 3JQ6A 3GAFA 5FF9A 5TS3A 5L51A 3JQAD 4J49A 4W99A 1HWYA 5G4LA 1DLJA 5TNXA 5DULA 2GR9A 4N5MA 4XQGA 1RM0A 1PJTA 1QKIA 1ZK2A 3WLFA 1X1EA 1GZ4A 3PWSA 5JO9A 2DU8A 3AWDA 1LDGA 4TMFA 1A9YA 1C14A 3TOZA 3TN7A 1UAGA 1UXIA 2W2KB 4D45A 1GL3A 1I0ZA 1NR7A 2PA3A 4DREA 3B1JA 2UV8A 4M55A 3UXYA 4O63O 5DNAA 4R69A 5BR7A 4G65A 1MP0A 4BO1A 1RM3A 1X0XA 3WMWA 4JLWA 3BHMA 2DBQA 3C85A 4Z9XA 1ULUA 3KXDA 4I08A 4B7XA 2P4QA 2QX7A 3ICPA 2PZKA 2YV1A 1ZMTA 1YB1A 1B8PA 1WDLA 3CE6A 5T64A 1GCUA 3WBFA 3I9LA 4XB2A 3OQBA 2PK3A 5JS6A 4XR4A 4KWHA 3ASUA 1HDRA 2JFGA 2GN9A 4B79A 3P2OA 3WYEA 1GEEA 4GQAA 5DBIA 1NAIA 4XX0A 1JKIA 3QP9A 4WOKA 3ZHBA 8LDHA 3STHA 3KETA 1UP6A 4UREA 3AI2A 4YT2A 4OL9A 4FJ1A 1Q7BA 4ZRNA 9LDBA 3C7DB 5L7WA 5MGBA 4KP7A 3VZPA 1DB3A 3V5NA 4XZ3A 2EG9A 3PHJA 4B3HA 2X5OA 4XQEA 4CUKA 5G4KB 3WOHA 3EK2A 4GMFA 4CUZA 3K31A 4FFPA 5EERA 2POQX 1HLPA 5A02A 1JA9A 2FR8A 1C0KA 2ZB4A 2CMDA 1WWKA 4Y6PA 3O9ZA 4BO6A 3HB5X 1J6UA 3SJ7A 4BNWA 5I9LA 2C5AA 3GN2A 4IDDA 4PLZA 3KOUA 5TJ9A 2X0NA 3L6OO 1N5DA 5I9NA 3GPDG 3KRTA 3MJ4A 4CMGA 2C82A 5CDUA 4ND4A 2X8LA 2ZTLA 1L1FA 1B16A 4I1IA 1LBEA 5BSFA 4EEXA 1KVTA 2Y1CA 4IDGA 2YZ7A 4CR7A 4BGUA 4PG4A 2PTGA 5BSHA 4TRRA 1WP4A 3GLQA 1U4SA 3ZU5A 1NP3A 4IDBA 2EIHA 4WNCA 5JDCC 3VH3A 3RUFA 1FK8A 3GRKA 4RO0A 3U4CA 1E3IA 1YQXA 2AA3A 1BG6A 2C2XA 1P1IA 1V0JA 3FTNA 3WS7A 1E3WB 4CMBA 4A73A 3EC7A 5ENDA 5JPIA 3FR8A 3GVIA 2GN4A 4EI2A 4XYEA 4J90A 2PGLA 2QRKA 3H6KA 3OHSX 5KKAA 4GLOA 1PIWA 2GERA 3M2TA 1NR1A 1YOVA 1LDEA 1U8FO 1T2EA 2GGSA 1ORRA 4UEKA 4WK6A 3DMYA 4YACA 5G0TA 5TLSA 1PS8A 1DXYA 1H5QA 3AFNA 1UXGA 2Q1UA 4ROSA 4RF3A 3GEGA 2FZWA 4CM9A 1EBFA 3ZWBA 1KEWA 3OH8A 1ZK3A 4DVJA 5I7SA 4R3NA 3OJLA 2P5YA 3AY3A 1ADFA 4N18A 3V2GA 4MVJE 3JD2A 1RYDA 1VL6A 3OJ0A 1R4NA 4FFRA 4HADA 4CL8A 2XXBA 3BXXA 1ISJA 4DYVA 4G2NA 3KB6A 1K5HA 5IDXA 3NAQA 5F1OA 3WQQA 1OAAA 4CJXA 4RDHA 4HNGA 3WLEA 5CPBA 5EIOA 4PG8A 2C0CA 1DIHA 2P9GA 5LC1A 1PJ2A 1NTOA 4AJ2A 4BKUA 5TSDA 1PGNA 4ZHSA 1Q0LA 4NFSA 2W90A 3WB9A 3IIEA 4U0KA 1MGOA 4OHUA 4YJHA 1PJ4A 1YO6A 2FPGA 5J9GA 3VH4A 3ZN2A 3GFGA 4PLVA 3Q11A 4K9DA 1PWZA 1GYPA 3GZNA 4PG5A 3UH1A 1TLTA 1WAMA 1QP8A 2PZJA 1LLQA 4MOWA 3ZV4A 2ZQYA 1BXZA 5JMWA 3GUYA 3GN1A 4ND2A 1H6AA 3D3WB 4XGKA 3WFJA 5HM8A 2RHRA 3F5SA 1U9JA 4S1VA 5L7TA 3ZHZA 3BIOA 1M6HA 5ICSA 1VL8A 5F5NA 4R9RA 4E12A 4E5PA 1YBVA 1VSVA 5JFOA 4I9HA 1MB4A 1UDAA 3PEFA 2VHXA 1NFQA 1NVGA 1AXEA 3GHYA 3QY9A 3FSRA 2E6UX 2B5VA 2VWQA 1XSEA 3AI1A 2X22A 4KOAA 3JQGA 4IUYA 4AJ1A 4DBVO 4J4TA 1IUKA 2WMDA 2VYVA 1U3UA 4ONEA 2BMAA 1R37A 5JBIA 1C1XA 1V6AA 2GF2A 2F00A 3S8MA 5FYDA 1A7KA 4IPTA 1ZW1A 3WFIA 1B15A 3JQ7A 4DPMA 1YB4A 4PLWA 1PS9A 3F6YA 1B8VA 4JCOA 4N7RA 2X1HA 1GFSA 3JYPA 4IDAA 3HSKA 2C2YA 1SAYA 4BNXA 1ZSVA 1B14A 1R15A 5DN9A 4M1QA 2FP4A 4IM7A 4JJFA 3KBOA 2IZZA 4CLRA 2PZMA 1QORA 4RZHA 1FDTA 4NJOA 2PR2A 3ST7A 4BKRA 4E5NA 3BTVA 4BO8A
chains in the Genus database with same CATH superfamily
1ZHFA 3BB1A 4OIMA 3BD9A 3PQCA 3UPUA 1WXDA 3WQSB 4P33A 3IOCA 3CUTA 4HQFA 2H9YA 1GRRA 4RJ2A 2YR0A 1KEZA 5KAPA 5IF3A 1WXWA 2D8MA 4KQJA 4OP3A 1O0CA 5H5JA 3NTLA 1POXA 1XTKA 3AUYA 1GG9A 1CSEE 1LBHA 1U1IA 2NO5A 2P67A 5DB4A 3KK0A 1M6NA 3CV3A 1JDSA 1U8ZA 4ND7A 6Q21A 4L16A 4Q9IA 1WB9A 4D1YA 3JQ8A 1CD5A 4OTZA 1T9HA 4ZCRA 4HFMA 1HDYA 5DRYA 5ADUS 4MYUA 2XZOA 3F96A 3D2AA 3THYA 2GM3A 4W5NA 4JT9A 4OGKA 4ER7A 5KS2A 4TV9B 3AL3A 4JEIA 5I4IA 5LQRA 5ISMA 4HH4A 3P97A 1C4OA 1BKDR 1YU9A 4GOLD 4NZPA 1GTL1 3NT2A 5JYCA 3TECE 4DSTA 1NUTA 3L0CA 1ZSNA 4V0ME 3G88A 4AW9A 5AYVA 3C8DA 3HR8A 3OEED 5DHQA 1AUPA 4I36A 3RYIA 3ZV6A 5IARA 4JSYA 5CCXA 3O38A 1BDIA 3DJYA 3A6JA 4YCCA 4G63A 5JCZA 3W4JA 3E5MA 4C03A 5EJ2A 3RSGA 4EAAA 4TQGA 3LCUA 3QJ5A 3GVHA 3QEOA 4NYMQ 4NOMA 4Z8YA 3IPLA 3HWSA 4RVUA 5CT4A 4M2LA 5DM60 2CLHB 5C1BA 3U4QB 1YVDA 1NE7A 4N0DA 1ZN2A 2HR1A 3JTMA 4DQVA 3PXXA 1MDBA 2OCGA 4B6OA 4P4TA 4OP1A 4LNUA 4RMNA 3ONWA 5K51A 1SUFA 5EC8A 1D1SA 3OCXA 4YRZA 3V3TA 2BT4A 1JIJA 3KZOA 5LYJB 1F17A 1RZ3A 2H2WA 3CHYA 4MSUA 3ROKA 2G6BA 3DG9A 2J3IA 3GJSA 3PQ8A 1T2CA 1T9DA 1PDVA 3T9AA 1V8BA 1YQWA 4UPDA 1WMFA 3A27A 4F8JA 4JN6B 3HG7A 3JWJA 4S05A 1KPHA 1ZCBA 2ZIUB 1OUMA 4EUFA 4QC2A 1V7ZA 2R68A 4L9RA 4NVRA 1FPQA 5FPQA 1IG0A 1AVTA 2GN0A 4TXNA 4B5LA 2W00A 2VQDA 5F78A 3PCXA 2KS6A 3R9IA 1G3UA 2QSJA 2Y92A 1XBTA 1K7CA 4L85A 3OX3A 3O4JA 2I87A 3GYBA 3JCZA 4D0GA 2ZRCA 3A1WA 3AESA 4YFVA 4J3NA 4FSXA 1J8DA 1TUBA 3RVLA 1AV6A 1RWOA 1KVSA 4C06A 5MN6A 4PLHA 1E61A 3RTDA 1FDSA 2OESA 3OTWA 4IGEA 4HH1A 4O2AA 1BRTA 1E2LA 3I9NA 4HDKA 3W5JA 2WT8A 5FTNA 4W1QA 1XZEA 1M3SA 1KXJA 1GLGA 2H85A 4GW3A 1X1AA 2R4UA 2PIDA 3NOVA 2NYVA 4B3TB 2QTRA 3M6LA 3O92A 1WG8A 4LECA 2RG1A 4HVCA 3FFBA 4ZU3A 1G21B 1M5TA 4HQRA 4YONB 4ESVA 4EGFA 4XWAA 2GHIA 4M9RA 4ENVA 4PO1A 1Q15A 2BEUB 2GEFA 4KO2S 3ESBA 3ITNA 1FXWA 1M8PA 3GUVA 1TYAE 4OGGA 5F64A 5EJEA 2H1WA 4J3JA 5JCJA 4YAIA 1X2EA 1VLHA 5DWVA 1WDKA 4L5CA 4WKGA 3WO0A 1P81A 4DUYB 1BMFA 1ZCAA 3B5JA 2NSDA 1JEOA 1IAQA 3IQDB 1NOJA 3KP1A 3SLKA 2FF5A 4YRBA 1UPFA 1XTRA 5JWHA 5LVAA 1WL8A 4FLEA 4KGXA 3MUNA 3OPNA 3IT2A 2P6NA 3BDVA 1T4BA 2GHRA 4N65A 2X6RA 5I5GA 5JPDA 1HTBA 4OJTA 2X5KO 5SY6A 3UUFA 3UWMA 2QG9A 5AR1A 1HR0B 3HYLA 1OLUA 4MHSA 3RK4A 3ZDXB 5G02A 3TAXA 4BCDA 1PWEA 5HKAA 1XAHA 3OAAD 1I36A 5LQCA 1Y8AA 1TJ4A 2B4QA 3X1XA 4EJSA 2ZAOA 3ED5A 5B1HA 1G8PA 2FDRA 3K5PA 4Y2UA 1EDZA 1XRLA 2B8EA 2OE2A 1EK0A 4O4HA 4QLAA 4W8OA 1YE3A 2C4VA 1SXJE 3EOAI 3CKLA 1ICEA 3SGLA 3JQ9C 2DKNA 2JKYA 4LOAA 1BOFA 5JVDA 4L95C 2RGNC 3S28A 1TUGA 3FBTA 5IKMA 1PEYA 2GD2A 3U7RA 3FPEA 1COWD 3Q5GA 1US8A 3E1SA 5C8XA 5CFOA 3KQOA 4JI8B 1YCHA 1UM8A 2AXNA 1Y7TA 2A33A 4FEYA 3ROFA 5DU2A 4QPPA 2AOVA 2F3RA 2CMHA 3KELA 4CCYB 4URVR 2HD4A 5DX1A 4FP9A 5P21A 4HPXB 3E4DA 2NQ2C 1BOOA 1KVQA 4UDOA 2AUNA 1NG1A 2FPKA 2ZU6A 1CZKA 2BP7A 2QW1A 2G1PA 3KQLA 3GGJA 1E9EA 5BQ3A 1QP7A 1S3IA 2YHIA 1RNLA 4ZICA 1S0UA 4FIZA 3VOAA 1ZNYA 5TE9A 4DLZA 2Q6IA 3BH7A 3ZY3A 4MUEA 2C7RA 4RGQA 1DT3A 1E1KA 3AV3A 1AD2A 1FTYA 2IW1A 3IP8A 3DBIA 5K8LA 1CRLA 1Q44A 2BV3A 4WJKB 4OUDB 3GLRA 3NANA 4ARSA 1E2BA 1YK0A 3G9ZA 3QVVA 4WN9A 3N9IA 4NG5A 1LSOA 2I67A 3D6TB 3K71B 1XKQA 3OF3A 4PONA 5FL3A 4LBWA 5TGDA 4AS2A 1MFZA 2QLFA 2VHQA 4CQNA 2ZIWB 3RASA 5TPZD 2ZTMA 2VTVA 1E0AA 1Q0HA 4Q7JB 4BHTA 3KSAC 3M3DA 1LJLA 3A58B 4GXRA 3LRPA 4DCPA 5TF0A 1GAXA 3MT9A 5F3DA 5F51A 3CMCO 3QLVA 1K6MA 3PD7A 3RYCB 4I4TF 1P2DA 1WMBA 4FOSA 1QJ4A 1ZG3A 3TE7A 2Q45A 4CTKA 1XKXA 4FHCA 4BFYA 3HDJA 2RC6A 2XCUA 3F5QA 1T0BA 1CE8B 4RZQA 2O8BB 3DLAA 4V1CI 3UJ6A 4BO7A 5CW2A 5JQGF 4R9UC 4EQ6B 4C0SA 1EFRD 2EF1A 1T5IA 3IOMA 4MQ6A 2H7YA 3SFZA 3NORA 4BZZA 2H9IA 2OBBA 2RBEA 2B92A 2XMSA 1M66A 4ZEWA 3QXCA 3CURA 1HQKA 3K0KA 2WQ7A 3R0IA 5GJBA 1P5RA 3QKSB 2V7WA 3P9IA 2JGDA 4ARZA 1KJNA 2IYAA 2J4CA 2O2HA 2WTNA 3CJTA 4TKUA 4E6PA 2EBFX 2JIPA 4Q1FA 4ZI7F 1X70A 1AF4A 3QA3E 1E2KA 2JLBA 3WWEA 3E7DA 4DIOA 3F3YA 4ZEOA 3PQFA 1ZOIA 4GYKA 4AJLA 2PT9A 2C94A 1L5HB 1P1HA 3NWOA 1Z07A 3B53X 2G1KA 3DM9B 3DDHA 1NW5A 2KJQA 4N7MA 4OQEA 3IVMA 4DKXA 5HBRA 4LV5B 5JZOA 2BR3A 4LWOA 4BCBA 2Q4BA 1QQBA 2W2KA 1KAHA 2Q2NA 3BSFA 5FTJA 2HN9A 4U2DA 1I5RA 4EEZA 5DNUA 4C4XA 5ICGA 5AJVB 1XZGA 1W0JD 4BO2A 1PV4A 2QZSA 5CCDA 3U3JA 5JS7A 1VM6A 3FPAA 4WZZA 2GNPA 3QU4A 1BA2A 1ZK4A 2N47A 4FDUA 4EZIA 1V6SA 4Q5IA 2JJ2D 3UJ7A 5AVVA 5IDQA 2YOGA 2YDYA 4R1NA 5I48A 3PU6A 4NFLA 4RTNA 1L7PA 4B2LA 1OMOA 2VYND 2FSVA 2WNSA 3LYHA 5A4KA 2Z09A 1ENPA 1D4ZA 4IGFA 3ELBA 5FUYA 4CT4B 4KPGA 2WIAA 4IHJB 3QU9A 4QFMA 5A4IS 3TOVA 1Y1LA 5EIXA 2CWDA 1MG5A 1I4EB 3OM8A 4DS3A 4OX9Y 1X13A 2OBXA 3GJRA 4GVXA 4YRNA 2G70A 2W4QA 4KO4S 4WXMA 1FC0A 3D6JA 5CX1A 2QTNA 3A32A 1G3RA 1M1YA 1RRMA 2JFNA 3TNDA 4P6VF 3ZHUA 2YKGA 1GZHB 2GK7A 4Z4EA 3FCAA 3P5BA 1G2PA 4BLPA 4RHXA 4PRLA 2DZDA 4INAA 3KWLA 5JI2E 3OEHA 3TW8A 5GINE 4AO8A 4DT1A 4PWYA 1V2GA 4D4MA 3QOYA 3A9TA 2DHDA 1UJ2A 2IU6A 1W4ZA 4KR0A 1NN3A 2G83A 3HRKA 1PR5A 1FYXA 2Q3CA 3QE4A 4DA8A 1MNAA 4YS6A 3E70C 2A92A 1T6XA 2P1DA 4F45A 4WQMA 4HDRB 4YO7A 3UV3A 1USVA 4QOSA 3K4HA 1C0LA 2H5IA 5EJFA 1LEHA 2XOEA 5CBKA 4GM0A 4RAOA 5TVGA 3JVIA 2ZRBA 3TSCA 3A06A 5G4KA 3EVCA 3T4EA 2B4KA 1JAZA 2DPLA 4HG2A 2Q0HA 3QMVA 4JKOA 2W2NA 4MUXA 4YO8A 2X7JA 3DEKA 1ZO8A 3JQCA 4IEFB 4KAAA 5I8ZA 3WLLA 5KYNA 4R7GA 3ESAA 4N7BA 3BBPA 3V6MA 1Y4SA 3ZOZA 5IU6A 3KAPA 5F52A 4G5XA 4ZXPA 3O4HA 2W8ZA 5KTNA 1WX1A 3G8BA 5L3QB 2V6IA 1PJQA 2JCXA 4MIEA 1YJ5A 4K86A 4MQEA 4OHPA 5ESWA 3TQCA 1UIRA 3LFTA 2CW5A 3IAS6 1JLLB 5I6DA 2FPLA 2HOQA 3BIFA 3THWB 1QF6A 1Y34E 5CK4A 3BFKA 3HL4A 4N76A 4CKBA 4GBMA 5GY7A 4B84A 1OPXA 1KZ7B 5AUQA 1XPRA 3HFSA 4II7A 4F6RA 2ZRMA 3PQEA 5HGJA 5G0UA 1BX0A 1XQYA 3IUSA 2CEAA 5K8CA 3AUFA 4GQBA 3WSWA 4U3JB 4QDTA 4LJ6A 1E1NA 3DBLA 5C8YA 4KWTA 2Q41A 4A0QA 5CFZA 1FUYB 1H2RS 1O54A 2OP0A 3BWCA 5MN4A 3PEYA 2FPSA 5I51A 4LVCA 1B1CA 1JI3A 2BGJA 1KK1A 3VR4D 3NHFA 2BUCA 1NW4A 2AVNA 2ZWIA 3D4NA 1FYFA 2M9MA 4MW0A 3R20A 5F12A 1S2DA 3UV6A 4DJ5X 4ZZ3A 2WG0A 2VF5X 1KEUA 221PA 3UJAA 1BYUA 1GU0A 3MWGA 1Q7RA 1TYBE 1YB2A 4R2XA 1O8CA 3D7KA 4DDVA 1TVEA 1RWMA 5JY1A 5GAJA 3FWZA 3GFSA 1VRVA 2CSUA 4LYGA 1W7AA 1XN4A 1PNRA 2B4TO 1EVJA 2ROQA 2V0CA 1PAUA 2HO5A 2B3DA 3CLVA 3MCVA 5F73A 4MUMA 1S8FA 2ZJ4A 2GK3A 3OLXA 1U6KA 4CI0B 1O7JA 4YX9A 1I10A 4D9NA 2NYUA 3OU7A 4NHEA 1DPGA 4EZBA 3P9RA 1XZDA 1EXWA 5EXDA 1O96B 4JITA 4OH1A 4I50A 2WTUA 2CXNA 4DR7B 4F97A 1DFHA 1H1TA 2ZB7A 2GF0A 5FA8A 8GPBA 3F3MA 1DV2A 1PFQA 3HJBA 1QHNA 2JFPA 3PC8C 1Z12A 1IDN1 1T8TA 4S35A 3PF8A 1VI5A 1V5IA 3WBBA 1UZUA 5BW5A 5IMSA 4DSOA 4LXIA 5LD2B 1INLA 4QSMA 5BUQA 3L0YA 3FH0A 4Q1VA 4BNGA 3W8DA 3AHGA 2WSSD 2Z9BA 3CLRC 4D42A 4PZYA 2UZ1A 4BQRA 1WRBA 1BH2A 3EH1A 1I1QB 3QRWA 4HAXA 4NHOA 3PDIB 4WEOA 1E6LA 4J4HA 4E4RA 1XK6A 2V7TA 1JI0A 1E8DA 4RBNA 1LV8A 1QOPB 2GPNA 3G79A 3ETLA 2Z1NA 1V8FA 3VZCA 3T1TA 2O3SA 3RYHA 5IZCA 2PH5A 2XNDA 2CDAA 2BKLA 3O6VA 4PZEA 3S2UA 4D80A 2C9CA 1KFKB 2YFYA 3LM8A 3PGA1 3RTCA 3CONA 4OBEA 3I2YX 4Q66C 3ZNQA 2AE1A 5L4NA 1W5BA 1L9XA 4G37A 1YFLA 4MW6A 2OPHA 2VUUA 2XMRA 4AN1A 1GL6A 5EXXA 1V47A 2CXPA 2JIRA 2XYVA 1VHTA 4PPNA 5MGNA 3UICA 5A5VA 4ZTZB 10MHA 4M8LA 1YZLA 1IJKA 1MA0A 4ZVOA 2ENWA 2QRMA 3FVTA 1PX0A 1HZZA 1CS4C 1MXHA 4UBMA 4Z4GA 3GDOA 2NSJA 3IEPA 2BUAA 3W5DA 3L84A 1H4TA 5FR2A 3PE3A 3G7UA 1YUMA 2R62A 3OQ6A 2I3GA 3CM0A 2RKOA 4IGAA 4IJUA 1Z0FA 2ZJ6A 4Q1DA 3ROEA 4ENQA 3C74A 1M9NA 4LJ7A 2Q2VA 3IVAA 6CHYA 3RHSA 4X65B 4E70A 1DG9A 4BX0A 2H54A 4HPWA 3OSZA 1IVSA 1KMNA 3A3YA 4RSMA 2CXOA 5JDCA 4X8MA 4YRLA 3KB1A 1ULBA 1T0UA 1G0OA 5FTLA 2IOFA 4MV9A 3VR5D 1O0BA 4OY3A 2V7EA 2XMCA 1MOZA 3MT8A 4XWTA 3ZXXA 2FQQA 1GPBA 3SQOA 5KOJB 1KTIA 1OT5A 3EC1A 1UDCA 5AHXA 3OZXA 5DLQC 4FCWA 2A3RA 4DOMA 2H0AA 3L8GA 3PRJA 3NHLA 1QIMA 1U2TA 3QXSA 4HNQA 1P4SA 2QUHA 1ZI9A 2ZR9A 4X3OA 2BOVA 2DHCA 5A3JA 4L27A 5ARBA 4G0OA 3WGMA 1M75A 4BO4A 4Q3OA 5E1MA 3S6JA 1WZCA 3IP5A 3M6UA 4GUAA 2L19A 1RLTA 4TS4A 1C5KA 4JL5A 4OLJA 2V1XA 3CH7A 3DFKA 3VYUB 4TLCA 2QTLA 3HO8A 3W2FA 4KEAA 2YYAA 1QBKC 3E9DA 3MCWA 1HI9A 4WAUA 4ZV7A 3S40A 4B7CA 1DFIA 1B23P 1PCXA 2CNDA 4OGFA 4S0ZA 2XRYA 4HYYA 4GOXA 3MCUA 1BXRA 1I3OA 2OZLB 4QDKA 3VZRA 3R0XA 2NU6B 2OO5A 3HNRA 2PX6A 1Q3TA 4P38A 2REXB 1CUWA 1JHMA 4N0PA 2A35A 2F1RA 3DLIA 5B2EA 2WVAA 1B42A 3A10A 4UUQA 4O4LF 1BGXT 5CFMA 1JJ7A 2VT2A 4TZTA 4RKWA 1LDMA 2J3MA 1SCDA 1A4RA 2PANA 1AKNA 3D4PA 3DFIA 3GO4A 5TQVA 1XFAA 4FN5A 1Z8FA 1JXAA 5C46F 2FK7A 2Z2IA 3KLMX 4Y0NA 3N7UA 1U28C 3U1VA 2GYVA 5JYBA 3L7IA 3OICA 4FYXA 4OQYA 1WKCA 1N77A 5E9AA 3AGPA 1CJMA 2QXYA 1CUGA 2O8CB 4B2PA 5EJAA 3WAJA 1YDHA 4MS4B 1IC6A 2V3VA 4QE3A 4QRHA 4QUEA 4EB8A 4ZEXA 2NO7A 4TV9A 3GJ0A 3AIKA 4GI5A 3UHFA 2RGBA 1R6UA 2Y76A 4JA0A 1L5OA 1W5EA 3AFMA 3PQ6A 2RMKA 2QK4A 4PFSA 3IR6A 3TM5A 3IFSA 3W06A 5D7NA 4BNDB 2XD4A 1ZVVA 2IUYA 1KGDA 3IAM6 4K1LA 5SYAA 2O8DB 1H2ZA 1IPHA 2GO7A 4JEUA 5JNUA 4EYOA 3Q8XB 3RTGA 7REQB 2C8JA 2I3ZA 1XMXA 3Q9NA 4IYJA 1HMPA 1WDWB 2B34A 5AI6A 1JIVA 5B58C 3WGZA 1ESCA 1NVFA 3U4QA 1CJVC 3A4TA 4U9IS 3ZE0B 5C53B 2ATIA 1ULZA 3H4VA 2FJPA 2HA5A 3NP9A 5C52B 4R71A 1EBUA 3GFTA 3QE0A 2Y1LA 4HLDA 5K6AC 1GJRA 1DQRA 1T3TA 2QSUA 3SKXA 1BEZA 1Y1PA 1NMSA 1P6UA 2PUJA 1U5BB 3FIJA 3GGCA 3OF2A 3G8DA 3BEDA 4JB3A 2GPYA 2JFXA 4GQIA 4J0JA 4PCUA 4TL7A 3C3AA 5DYTA 1PHPA 3R6LA 4L5BA 1JDJA 1L3CA 5LYJA 3K2IA 3FUXA 4B35A 3FDJA 4EPRA 1ZOLA 5HRAA 3AKCA 3CR7A 4C29A 1B73A 3IVXA 3N6XA 4BFUA 4LWPA 4BNKA 1CXZA 3INTA 1O6FA 2GLUA 3PHIA 3ZV3A 5JC8A 4G97A 4V2UA 1EG7A 3HK2A 1EFKA 4N39A 1SVKA 3D2CA 2REQB 4I6EA 4MDHA 3RG8A 3K1JA 2OOSA 3BTOA 3NRBA 3V4FA 5K8IA 3KKZA 4NBVA 1ARZA 2XBMA 2QY6A 2C5HA 4YR7A 5IHPA 1J5PA 3I2KA 5F1PA 2FW8A 1SHLA 3DLBA 3RFVA 4BMPB 4RADA 1JDVA 1K8QA 3ESCA 1NM5C 2VZ0A 2XUJA 2EX1A 4KLRA 4LRYA 3C97A 2GOYA 5CAEB 5GZ6A 5TX7A 2A9JA 1KY5A 3H9EO 4DRYA 3AEXA 1X7HA 5G2OA 4R0VA 4CDRA 4LZAA 4X61A 4FNGA 4AULA 2XX3A 3M1LA 1K2WA 1HDXA 4GF5A 2Q5HA 4RVGA 2X14A 4F4FA 5K5EA 3U3XA 5FKJA 4B4WA 3ZLVA 4U02A 1G21A 1NL3A 4JP1A 1RWNA 5H3LA 5T3UA 2FHSA 5AKXA 2BEUA 2F1HA 2VBCA 3ANXA 4XJSA 1FFXB 2F1JA 2PBZA 4BEWA 2R4QA 3H4MA 2AF4C 5KVCA 1U2GA 4R8VA 1C80A 4YJFB 3LK6A 3K2BA 1PZHA 2OFPA 3ZUGA 4Q4CA 3H8WA 1M34B 4I9NA 2UUBB 2VHJA 4G4IA 4B3RB 1V4NA 3P7MA 5J2TB 2O8EB 2YFQA 3M7IA 4BEJA 5CVEA 5CVCA 5LJLA 1KIMA 2AC2A 3D8HA 3T8YA 4XIJA 2COUA 3L1KA 2E6KA 3DV2A 1XROA 3V42A 2FFHA 3I1JA 3OEWA 1WXGA 4CMAA 4KPYA 1FZTA 3NBUA 4JP8A 2H0QA 3IV9A 4L5JA 3RFCA 1WUKS 3G1TA 2CFOA 1SWVA 2PV7A 2Z43A 4KE9A 5J59A 4PAMA 3WGTA 3EP5B 2PL9A 1XMPA 4BN5A 3NEAA 4EHIA 2BLLA 4OYRA 4HWSA 1L1RA 2IHUA 4Q7LA 3RAPR 1K2VN 2QL7A 2QP4A 3NIDB 5BVHB 1QQ6A 2QE7A 2JGFA 1E3SA 3VR5H 3Q40A 3SHOA 2P8JA 1O6ZA 1COZA 3IT1A 1J9GA 2O3QA 3E3OA 4I55F 4Q4LA 2R7KA 2HCBA 2ZYUX 2X4IA 1OD6A 4M89A 3PNPA 2FZCA 3HFGA 4RA9A 4E94A 4CLOB 3CGGA 4KYVA 1WABA 3OFSA 2NSYA 1GQFA 3H7IA 1Z5GA 5FI1B 3HS3A 3KQPA 3GMDA 3A28A 1TM4E 2XKJE 3VNAA 1UBOS 3LPCA 2XWPA 1WB4A 2NG1A 7ADHA 2PMEA 4CCYA 1XEXB 2A6PA 2O3RA 3B6MA 3V1KA 4CNBA 2WA2A 4NV0A 2XTJA 1EZZA 1P44A 2NPOA 4M36A 2VK4A 4ZMRA 2VAWA 3QJGA 2Q8PA 3S7TA 1XPUA 2VF2A 3PX2A 1WMSA 1QHIA 1WPQA 4PWZA 4BVLA 4HX5A 1V8DA 2NUPB 2PO5A 4KDEA 3ZE7A 4A82A 1XLWA 4MLDA 2VCEA 5T4EA 2WKWA 4DTIA 7MHTA 1BS2A 1QK3A 2HF7A 1GD1O 3AM5A 2LDBA 3E5HA 2V7QD 3QBJA 4YJ3F 3ZBUA 4WPGA 4AF8A 4EJFA 4OUDA 1OH5A 3TH5A 4EAQA 3QOWA 1WXFA 3F0TA 4TXHA 4U7PB 3PGMA 3URMA 4EI8A 2DWQA 3T9CA 1ECGA 1TCBA 1DJOA 4LHEA 4XRGA 2LGJA 3SDZA 4BLSA 1EVLA 4X60A 1FNNA 1FRNA 2KSQA 3L4BA 4C0WA 3QV1A 2FZ5A 2Y1GA 1P62B 3OCVA 3FAZA 2XWJI 2O2CA 2WQ6A 4G0WA 4KSYA 3W3ZB 1RPZA 4I8DA 5CB4F 5JAZA 5CVTA 4CCAA 2DM6A 1SUAA 1Y98A 3OIFA 4L4UA 3UAOA 5B6PA 1T9CA 2CYAA 2P6UA 3C4VA 4ZO8A 5GQSA 4CL3A 3RYCA 1KYXA 5FCDA 2JARA 3AR8A 4Y9UA 5BUCA 3WWZA 3SC2B 3X2EA 2PUFA 4WWHA 4DR3B 4HWGA 2WWTA 5A5DA 1CE8A 2O8BA 3KKMA 2DG2A 1N32B 3DB1A 4EUKA 2ZFUA 4HP8A 1JQ5A 4DLTA 1V95A 1K89A 4EQ6A 1C4KA 2OMEA 4DJJA 2FOXA 2O0LA 2H4WA 3B1WA 2ZJ1A 3D7RA 3N5CA 3WAKA 4JK3A 2D8AA 4NYMR 1NSYA 3QKSA 4P22A 2CUNA 3AX6A 1IEWA 1X0VA 2EQAA 1KNQA 2B5WA 1OYVA 2BRUC 5NLLA 4A4DA 2OORA 4FFNA 4XVHA 4IDHA 5FNVA 3CR8A 4Y6LA 4LKRA 2MT9A 4EG8A 1X8XA 4PPQA 4EHNA 2A1TR 1IUNA 2FWPA 1KSFX 1L5HA 1T2AA 2YZKA 1ZA2A 5JLAA 4Z8XA 3IQGX 1DC4A 4RXUA 3TK1A 3AF1A 1ZHOA 4HGPA 3Q2IA 1NJGA 1WIWA 3LUCA 2JCSA 3J80A 3J7TA 3P4YA 2NTEA 4U7TB 3RS3A 3C7TA 1HLGA 5AVZA 4L3OA 4NYIQ 5K4HA 4X7BA 4WIAA 5BYKA 3C4QA 2XRMA 3PTZA 4D9CA 2IS2A 1FPMA 1U3FA 2GZRA 3EDMA 5CNJA 2FPXA 3KTDA 2YC4C 4LBVA 4MV1A 1CZLA 3FZNA 5JWOA 3OSUA 1PFWA 4DCNA 4H6XA 4LYFA 1DBQA 4TKLA 3QVOA 2BE7A 4KXXA 5FUWA 5HF8A 3PLAE 4IHJA 2GZ3A 4PF1A 5BNFA 4POOA 1W44A 1Z0IA 1VSUA 4RHYA 2HK9A 1P74A 4P80A 4P34A 1A8SA 5FH9A 3GNTA 4NE7A 5F9FA 1SKYB 2PM8A 3RVKA 3VHXB 3E53A 4GOJA 2PKWA 3TNJA 2I4NA 3HY3A 2EP7A 1TPZA 3MN1A 1DINA 4OXQA 1GXSB 2UDPA 4EYSA 2GHQA 2IW3A 2R6CA 1MQAA 2AS0A 2B30A 4N5IX 5J3JA 4PY2A 2IVZA 4J0IA 4AYWA 2A1UB 2O1SA 3TMKA 3ZVLA 4B3GA 1I3LA 3THYB 5EJGA 3PE6A 1GL9B 1UBRS 1TQ8A 1XWWA 1SKAA 1OLOA 4R1QA 3PIDA 4P53A 2HIAA 4PGGA 3RVNA 2FSIA 4KMOA 4EMUA 3UXHA 4F4DA 1KI8A 1U7XA 1SD1A 1HM5A 1TMGE 1TEZA 4BB0A 1UXHA 2J0VA 3TFQA 4DCSA 4HDRA 3QWIA 4LQ4A 4E6EA 3F3SA 2G80A 3FMFA 3N87A 1J2UA 5CFLA 3AF3A 1WLYA 4DLVA 1EQUA 3OPXA 5FOVA 1RWQA 5BY2A 4DV4B 1NVVQ 3A6GA 1ZH2A 3JQBC 1BU5A 2W6NA 1B43A 4IL5A 5EXSA 3UANA 2JH9A 5U4XA 3ZLUA 2WM3A 1RHRA 1SZCA 4QUBA 5EFOA 2GX6A 1VIYA 2O1WA 3HDVA 3HUTA 4D2IA 5KTOA 5AHWA 4ZRDA 5KTYA 2IYRA 1JIQA 4O8CA 4KGDA 3MTIA 5L3QA 3H1GA 1AZTA 5JADA 1JLLA 3QVTA 3NVMB 4K9PA 2YY5A 1TQ6A 5HDBB 5KJFA 4L7QA 2WE7A 4UMDA 5FPHA 1Q5PA 2AVDA 1N3LA 4EMBA 3G1WA 3UK6A 1ZLYA 4R1MA 4BVJA 5KQMA 1A9TA 3SLRA 4AUEA 5A05A 2MSCB 5LQMA 5J58A 1NNLA 1T2NA 1R27A 1OH6A 4U3JA 1HO3A 3AY6A 3HJHA 2XNHA 4B0OA 1E5VA 3RSSA 1PNOA 4CM4B 4B32A 5LCXA 2UZ0A 4QRDA 4K6CA 5JBQA 1TF2A 2VO1A 3DZDA 3ETDA 2J6CA 3HDHA 3DEAA 4R2WA 2UYQA 1VIAA 1T0HB 4QPCA 2D00A 2JAHA 3CRQA 4QKQA 1H3EA 4PC6A 2BCGY 4NESA 3G68A 3VR1A 1A5TA 1GWNA 3FGZA 2OYSA 4PC3A 3RBZA 1EJ0A 4Y6SA 2YN0A 4KAJA 4IIHA 4UW9A 3BMQB 1J7KA 2TMGA 4ZQEA 1Y8ZA 4RVHA 1E0DA 1P0QA 1MT0A 2CCJA 3PPXA 3LLSA 4Q05A 2AL7A 2RG7A 1NBMD 1T29A 1E1CB 1Q74A 4PX3A 3E6AA 1IN6A 3T7AA 4NS1A 1QYWA 3EOZA 3U3MA 3VC2A 4ZC1A 1SMKA 1AU9A 1H4QA 1MBZA 2I8AA 3CKKA 1ACJA 1MX9A 1NUAA 4YRJA 3IPRA 1HEUA 5EMHA 3ROMA 1O96A 2JI7A 1FMTA 1V7CA 3HDTA 3TJZA 2BONA 3WJ2A 3UWPA 3WKBA 4RTQA 1GR0A 1LPMA 4M1ZA 2Q2QA 4C6RA 1AZSC 5D84A 1PT5A 3OHPA 1LK5A 4EPVA 1N2EA 3UMRA 3QKRB 3G2KA 1NMXA 1RTKA 3LDHA 3DZ6B 3NNSA 4R1PA 2J0SA 5JI3E 1QB8A 1RXSA 1Z33A 2IPXA 521PA 4LJ4A 4C21A 3V4ZA 3PITA 3ONFA 4BMNA 4DJAA 2Q0QA 4BE7B 1Z7EA 3ZW9A 4RHFA 5P8WA 3U3DA 5FL7D 1NN0A 1JJBA 3GT4A 5LIRA 1JZTA 1TTPB 4AY2A 2PH7A 1UQTA 4H6WA 4NAUA 4UJ3A 5CYFA 4ZRMA 1UFOA 5BWBA 3EHEA 3GJ3A 2VNHA 3PDUA 1RJFA 3A0UA 4KQIA 4Z9YA 1D2HA 2JA2A 3COPA 3M6VA 1ND5A 4IHAA 2VPTA 2GM4A 4URFA 3TR5A 1ODCA 3CJRA 5BR4A 3JZDA 3ML1A 2OQIA 3PI7A 4JASB 4N5LA 3VU9B 2EQBA 3NDRA 2H51A 4RSGA 4XWGA 4Y1FA 5JZ9A 1MW9X 2A0YA 2BAGA 3DZIA 1OXSC 3HB0A 1SB8A 2IBMA 3AZOA 5KNBD 2OGUA 3E35A 3A9UA 3GFBA 3COWA 2Y1XA 1WF6A 1C1YA 4QXQA 3EXFB 4G5FA 2PX0A 4E2XA 1ODLA 5AXAA 2O8DA 4MI1A 3PGLA 3QPAA 4S2EA 1QRSA 3F74A 2DH6A 4P83A 3FHLA 2IIPA 2QU8A 3CQ9A 3DOOA 2YS6A 2IX9A 2CN1A 3VO2A 4GS5A 4EW2A 4IG4A 4DR1B 4HUJA 2B2CA 2O4CA 4ZEMA 1C0PA 2WTAA 5JXJA 1BWRA 1LQUA 2RJOA 3IGFA 5AKGA 2OB2A 3C7CB 3HDYA 3W6ZA 1DX6A 3K5HA 1XTZA 1I80A 5AWFC 4WXPA 4XSHA 1CEXA 1E3JA 1UUFA 1E62A 2HYDA 4GO1A 5L3ZA 4UTOA 2FG6C 5ALHA 2PH1A 4X6XA 4GPZA 4PRZA 5GM1A 3TKAA 4Z49A 1BJRE 2J85A 3FNGA 2Q3JA 3AONB 3CUKA 2DWUA 3HGTA 5JASA 6ADHA 5DDIP 2PUTA 4AP6A 3RGGA 2D4AA 5KOJA 3T0GA 1VE3A 5IVHA 2WG2A 3L7NA 3ZWKA 2F2TA 1EINA 3GLKA 2GEVA 1NQVA 1P5FA 1XIVA 3DAGA 3N1UA 4IVQA 3VDNB 1ELOA 1QZTA 2IHVA 3QE3A 1CUXA 4FMDB 4LDAA 4WFQA 5E7IA 3DMTA 3TOCA 1T36B 1AX9A 4Q0MA 1BKSB 4RK4A 2ZJYA 4BQQA 3G85A 5HE8A 4GP6A 4PIPA 1L6IA 5HKOA 2ECOA 3AHEA 4KH1A 1T3HA 3FWNA 1WZIA 4KXYA 3WL5A 4AIRA 1G2OA 2ON6A 4ZJPA 5BMVF 5I7FA 3RU2A 4GMHA 1TGYA 2DR0A 1LA2A 4LF7B 2O14A 4ILEA 1A5ZA 1BW9B 1RCFA 2QSYA 3DVAA 4UVHA 2NZYA 3WTBA 1SVMA 2OZLA 1U2PA 2NU6A 3N0RA 1NLMA 1D8AA 2QJWA 3B9QA 4OOEA 4PRKA 5CU7A 3GGSA 2XUKA 4YRQA 1GUFA 4CQMD 5GV7A 4L4SA 5AJZA 2BDEA 5EYPB 3FPLA 4W4TA 1QHYA 4OLAA 3PKZA 1CK4A 4FDTA 1OXVA 1HZJA 2WWYA 2OGWA 2RJNA 4GZ5A 1Z6AA 3ZWVA 5E9QA 2HCTA 3UFBA 1JPJA 2WWHA 3GYGA 4N6GA 3L4JA 1G8SA 1PZXA 4LOJA 1ZPDA 3IQEA 4GR5A 3CVXA 2HCFA 1NKSA 3AUSA 3VPSA 4MJ7A 3IT3A 4QQRA 5DOVA 2A9RA 3UXEA 2O8CA 3KGDA 3Q0TA 4MS4A 1C7FA 3DONA 4NONA 4FYJA 4IMPA 4YASA 1IJFA 2WU8A 1LFAA 1NIPA 1Z3CA 2OAEA 2QTMA 4HNVA 1F06A 3UCXA 1X7WB 1ZRHA 1Q11A 4QGAA 4URUR 4BNNA 4DJFC 4UTRA 4JUAA 1O94A 1E69A 1OWLA 4UAGA 3ZBTA 1RHKA 1Z75A 2G5CA 2O7SA 2BFBB 3NBAA 4N3NA 1G38A 5A06A 3WIUA 1OYWA 2NV2B 3ODPA 4BNHA 3WK6A 4DDTA 5TIIA 4FKMA 7REQA 1Z5WA 1FUEA 4OLBA 3WFZA 1EIZA 2HPHA 1S4QA 4O1IA 3SYLA 4LRTB 5AUNB 2JEOA 4DPKA 5JZSA 2GCNA 3SZMA 4ZI3A 4GRDA 3HSYA 4C4PA 1U6IA 2YWCA 1ISIA 1WQ4A 3CIFA 3N0TA 2ZUTA 5KJCA 2I7XA 3CLRD 4F2PA 1UPXA 3DVQX 1CR6A 3H2JA 4YQZA 3C1AA 4OA8A 1D7AA 4WZAB 4DIKA 1WZEA 1SQ0A 2P79A 1JDTA 1CT9A 5LBTA 4OHCA 4YRGA 4HXEB 1MNQA 2G9ZA 4M6WB 4YDHB 3NHWA 4HXYA 2OHOA 4J0DA 2EFDB 4W9RA 4BDTA 4PS0A 2O57A 4YC7A 3WZLA 2EAUA 1AMOA 1D2GA 1CY4A 1DKRA 4P4NA 4RZUA 3ZE6A 4HQNA 3CX6A 4RD3A 2PLRA 2IOHA 4NULA 3GW8A 2ZZNA 2REQA 1ZXLA 2P2LA 3KAQA 1JSXA 4NCIA 3KZKA 3G0HA 5DT9A 4C4YA 2HWKA 2VXYA 3H9QA 1VCIA 3WGHA 5LU8A 4TYNA 2SKEA 2YV2A 3KDSE 5D5QA 5DBHX 5CLHA 5GGXA 4DYHA 4XDHA 4FDAA 2WDZA 5JNVA 1OVGA 3W2TA 4A8JC 4BMYA 2D2XA 2VSNA 1Z17A 4P3KA 1THTA 2R6FA 2LCQA 1X39A 2ZVJA 3CW9A 3HGMA 3IXLA 1DBSA 4LZLA 4KQ6A 4EHBA 3F4LA 1GGFA 1X7XB 2CC2A 2PL5A 5CAEA 2ZDQA 1VGQA 2R1TB 1ZA1A 5AM5A 5BV1A 5KBYA 2QNIA 1PG0A 3WK9A 3F8SA 2ZBEA 3JZAA 4G4SO 4KGZA 3COZA 4U7GA 3X1JA 5T73A 4N3CA 3H0WB 2WSBA 1AA9A 4LSGA 5IZ4A 1SC4A 3Q2KA 2EYQA 3RFTA 1PN3A 4DMLA 1FFXA 4KYUA 2VZ8A 3U61B 4FQ8A 3V7YA 2X0EA 4MEAA 2C42A 4YJFA 3WVNA 4EOGA 5KNBH 4I1PA 5TMPA 1M34A 4J0EA 5BSTA 3BL8A 3GJXC 5J2TA 3A6HA 4PAOA 1U31A 1DLIA 1WW8A 1XDSA 2VJAA 2EHJA 3QH4A 4WLVA 3N2LA 4AQDA 1DIRA 1X92A 1D2MA 1ZI8A 3P0EA 3TTTA 3ZIAD 4TZ0A 1LBIA 3U5TA 2B99A 2WJJA 4WKNA 3RRMA 4PICA 1X1RA 3HRIA 5CB0A 2GBGA 1QGED 3AUTA 3WRXC 4G1MB 4HSGA 1JHXA 1UK8A 4EJMA 2RB5A 3OQMA 1DX9A 2R8RA 4UJ5A 1NBHA 3CW2A 3A36A 2VDJA 4JI3B 1YMUA 4B8ZA 5SZJA 4ZU6X 3VNSA 2DQZA 1F14A 1TKAA 2YXDA 3G9TA 3OE5A 4L3VA 4Q18A 2ZUBA 2P91A 1CS0B 2E0IA 1GYRA 1EUCB 4BAUA 4TTVA 4YRKA 2PQMA 4M0CA 3V7WA 1TU4A 2ZRFA 1H2WA 2H5LA 3GPBA 2PR7A 4XXHA 1OW3B 5AK3A 1I2MA 3PDJA 2WAAA 3FNRA 3KTOA 5IC6A 4CDNA 1GPNA 4MQ4A 3VDQA 1U04A 2ESRA 5B1SA 3INRA 3LK7A 3ZU2A 1SD2A 2FPWA 3EOBI 4CLOA 3HN2A 5HZMA 1A95A 1MEOA 5F2OA 2Q4DA 1V26A 4A0SA 2B36A 1PI3A 3WK8A 4YWJA 3T9FA 1W5AA 3MAAC 2IDMA 1XEXA 4PVCA 1P9WA 4OQDA 5AT1A 1OYOA 3ZHYA 4BMCA 4EO9A 4ESOA 3B2EA 3U0VA 3EVNA 1L7EA 3WLAA 1F6BA 1AKQA 1P31A 5CH3A 1H8EA 2IHTA 1ECBA 4RYLA 1YJXA 5AUPB 3BILA 1N3YA 2NUPA 5DPMA 1YULA 1HTTA 1G8KA 1OZHA 2NSHA 3P2IA 4IV0A 3NTQA 2O2SA 4DA9A 4GFDA 2P3LA 1O6CA 4H27A 2X6TA 4DADA 3OUZA 2PRKA 3D2LA 4HEJA 2B1QA 4YTEA 5JZBA 3U9SA 3CH6A 5JNSA 3O8NA 1W46A 5THXA 3DD1A 3LDUA 4GBED 4PFJA 2X0KA 3R3SA 3OZBA 1CQXA 3HM2A 1VBFA 3LWBA 3NC0C 3IPAA 4JLVA 4N3AA 3WYDA 4D0NA 1H2FA 1LRKA 3ENNA 5LQDA 1OGYA 1J90A 3ZU3A 2VT7A 4ALMA 4L76A 4MEBA 4Z6KA 4DMCA 5JISA 3DZ8A 2D2VA 5KMGB 3R8FA 3MS4A 5HZKA 2CXUA 3TTUA 1VJTA 4HB4A 5E6SB 2X8AA 2YVAA 3L7LA 4ZYLA 3VZSA 4KE6A 3PXGA 3NJ8A 1BHO1 4FILA 1Y33E 4PHHA 4XQ0A 5JO0A 4RZ3A 1AHPA 2WYOA 3ICWA 3SC2A 3BZWA 4IBOA 4RESA 4XX0B 3HR4A 2