2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
molecule keywords Dimeric dihydrodiol dehydrogenase
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
3C7DB 1HF3A 2G0TA 4LW8A 4CM9A 1QP8A 1A71A 1R16A 3PJEA 2O7SA 4RVUA 4IDBA 4ALJA 4OYRA 1D1TA 1QMGA 1W73A 3KEQA 1WDMA 4R1SA 3B20A 1N9GB 3WGOA 1DIAA 2EP5A 1F12A 1HL3A 4Y6PA 3NJ8A 1NX6A 5ILOA 5HWSA 4DQUA 2VRCD 1VE9A 4D45A 2P5UA 4P22A 2ZTVA 4BNFA 3GZ4A 5G4KA 1F8GA 2Y66A 1VKNA 3O8QB 3I4FA 2J3JA 4W7HA 1PJQA 1RPNA 4J2HA 3LLVA 4OKIA 3UHAA 1ISGA 3D5TA 1DFIA 1E5QA 2WE7A 3OP4A 3K31A 1SNYA 1HDXA 2VWQA 1E1KA 4TZTA 5TSDA 4PZEA 3PGJA 3LQFA 2IZ1A 5AXBA 1OI7A 4OJNA 3HDHA 3HDYA 3ROKA 2W98A 2D4AA 2VHYA 2W2LD 3NYWA 5TT1A 1C1XB 1GZ3A 4II3A 3ASUA 2GGSA 1LC3A 3M2TA 1ISIA 2VWGA 4LVUA 3ZHXA 1IPEA 2IZZA 4CM8A 1PSDA 1I33A 4Z0TA 1Y9EA 1Y1PA 2ZYGA 5JO9A 4PZCA 4GMFA 3MWDB 1U4OA 1OMOA 3FPCA 4BNMA 4MIEA 4IJWA 1ZSNA 2Q2WA 3TZQA 3GUYA 4K26A 1ONNA 4CMIA 4YRDA 3VDQA 3AU8A 3PRJA 1JKFA 4GWGA 8LDHA 5BNFA 1EMDA 4GLLA 1PTJA 3PJFA 2WD7A 2PGJA 2DPHA 2HCTA 4S1VA 4WCFA 1ENPA 2WYUA 1I8TA 3C1AA 4L8VA 5ER6A 1H9AA 4YJGB 1R15A 2CDCA 3QWFA 3RWBA 4PG6A 4M89A 4YJGA 3DC2A 3VPGA 4CLEA 3DZHA 2JD2A 5JYDA 2ZIZA 5JDCC 5GZ6A 1ISJA 4K1LA 3KV3O 5ENDA 1Y5MA 1GQ2A 3Q11A 2A94A 3RFVA 1KETA 3D4OA 5EQFA 2GLXA 2PV7A 3HQ4O 1CYDA 2IODA 2Q1UA 1Y9AA 1PL6A 2XAAA 3ETDA 3QE3A 3VC7A 5KNLA 3W8DA 1QKIA 3IMFA 1HLPA 1PU2A 2NQ8A 1P77A 1U2GA 4BIIA 1O95A 1K2WA 4HFJA 4YAEA 3VVBA 1Y5RA 1J4AA 3IDSA 3L0DA 1WMAA 3BHMA 4D44A 4DLAA 3H5AA 5GMOA 3PLNA 3AY3A 4AL4A 1HRDA 3DB2A 1RM0A 4Q3DA 2BGMA 3HFGA 4DLBA 4CM6A 4MVJG 1WWKA 3Q6IA 1C1XA 3C3XA 1U3UA 4U6QA 1CDOA 3ULKA 4H16A 3C1OA 2YV2A 2HUNA 1BTOA 4F6LA 1IOLA 2CVQA 3GAZA 5TGDA 4CQLB 1C0KA 1GY8A 4ZHSA 3E18A 4NU6A 4GX2A 3I9LA 1K5HA 3AW9A 4YAKA 2DUWA 4YJHA 3GFBA 3GY0A 4R9SA 5ILGA 3ST7A 5DF1A 3ZWOA 5JC8A 1PQPA 5IZCC 4BKUA 3FWZA 4RPGA 1D1SA 3SEFA 3KYDA 1H6BA 5DN9A 4B7XA 3S2IA 4CV1A 5L53A 5LCXA 4XB1A 3PWKA 1I3KA 5HTOA 3GHHA 2BFAA 3JQAA 3ICCA 2FZWA 3EVTA 3WGGA 3I9OA 5I8ZA 1GEGA 4CL8A 3LVFO 4CV2A 3GRKA 4DC0A 2C82A 2VNAA 5G0SA 4FW8A 5BNTA 4TVOA 3I9KA 3NEPX 5EMHA 1BG6A 2H6EA 2OORA 3PQEA 1CQJA 4IS3A 2PGLA 1LXCA 2SCUA 3I4CA 4CMHA 3WGIA 4CMCA 4MOWA 3I5MA 4RCVA 3JQDA 2DFDA 2J3HA 4DQVA 1I2CA 2BLLA 2HMUA 3Q1LA 3KO8A 5F5LA 3DOJA 3MTJA 1G1AA 3BTOA 1U3WA 5IN4A 1LQUA 1LI4A 2OBYA 1KC1A 1Q7GA 3HSKA 3WGQA 3CEAA 1SB8A 5DBIA 3DZFA 4YEDA 2YZ7A 4KDEA 3DTTA 3IOYA 4YJFB 3H5NA 2P2SA 1PL7A 2ILTA 5BSFA 3IUSA 1LSJA 5CAEA 4PLTA 2ZB3A 4XQ9A 4MP6A 4RGBA 1I3NA 1DLJA 5T6BA 3BAZA 3DDNA 3UFXA 4BNHA 1Z7BA 2PR2A 1Z7EA 3HN2A 2Q50A 1ZCJA 1O94A 3RUCA 3DO5A 3WLFA 4I9NA 2O3UA 1SOVA 4TVBA 2W2KB 3GVIA 3WLEA 3PWZA 1EVIA 2HMWA 3TL3A 2C5EA 2W2KA 4M49A 2B83A 4IDCA 1GV0A 3V1TC 1MV8A 4OKNA 3INTA 3KYCA 5EL0A 2D5AA 2OZPA 3KEOA 5KJFA 4GSLA 4GVXA 1A9ZA 3GK3A 2EP7A 4ILKA 2DAPA 1X14A 1LDYA 1ZO8A 4AJNA 3KSUA 1ZVMA 3LSYA 3F5QA 2ZYAA 3B6ZA 1LSSA 3ZCXA 1T26A 1U28A 4J4TA 3IL2A 1KVQA 4B3HA 2R2GA 1O89A 1ADFA 3FI9A 1A9YA 2GERA 2WJPA 2DBRA 3NT5A 3WGZA 3BMQA 3ADOA 1E0DA 4RL6A 4HBGA 1E7YA 1CJCA 3AJRA 3WYBA 3LU1A 4DGSA 5LC1A 3C8MA 1P1RA 3GMDA 3AUTA 1Y6JA 3RUIA 2Q4EA 5A9SA 3F5SA 1P1HA 3UF0A 1UP7A 1JN0A 4BO3A 1FK8A 2UVDA 4IY1A 3S1LA 3KYDB 3QIVA 1IL0A 5F21A 1XYGA 1B8PA 3GVPA 2NLOA 4TQGA 4E2WA 1QV6A 1MFPA 1YBAA 4CQMD 5CEEA 3GDOA 3AY6A 3OEYA 3ZWCA 2C0CA 4G2NA 2BH9A 1R0SA 3DXFA 1EQUA 3V2HA 1E7QA 5KWEA 1XQ1A 5CDGA 4R5MA 4JXKA 3FNHA 1Z45A 4TRNA 2J5RA 1TLTA 1EE2A 4GVLA 1BHSA 1YH3A 3R3SA 1LBEA 5T64A 3RBZA 3MOIA 4CPDA 3ROPA 4YXFA 1JWAB 1P31A 3GG9A 4FCCA 4RF2A 2W90A 3ZWAA 5A5FA 4CMEA 1BVRA 2X86A 5K6AA 3CE6A 3IP1A 2Q49A 4H3VA 1K3TA 1PEDA 1BVUA 3DEYX 4Z6KA 3SC6A 3CZRA 1GU7A 1U7TA 4RDHA 4CR7A 3ZWMA 4MIOA 5L45A 4YT5A 4KUGA 5JAMA 4R54A 3FR8A 3K30A 1SB9A 1N7HA 3JQCA 1U1IA 1P1FA 5KCZA 1M76A 4ND3A 4MIYA 1NM5A 2VHXA 3U09A 4LSMA 3LC1O 2FN7A 1KERA 4KZPA 2PZKA 3FF4A 1ONOA 2RCYA 1V0JA 4YBZA 2D1YA 1LLDA 4WGGA 4XR9A 4O0LA 4FIZA 4NZ9A 2DTDA 4O63O 4BGUA 1H2BA 1XU7A 2VYVD 4Q9NA 1B2LA 4AJPA 1KYQA 4QEDA 4P8RA 3IJPA 3TN7A 2EJWA 1LRJA 2OBNA 4CQLA 2WYVA 1PGPA 4DREA 1B3RA 2Y1CA 3JQ9A 3IAHA 1UZNA 2O50A 1GD1O 4CV3A 1PZHA 3JQ9C 5TJHA 4MDHA 2G5CA 3TF5A 3Q0EA 4IQ8A 4U6SA 4RJTA 3K9QO 1H93A 2ZJ1A 1I01A 3SXPA 3JYOA 4M54A 1ADCA 1HT0A 2V6FA 3KM0A 4NPCA 4RPLA 2Q2VA 3TOXA 3WXBA 1UDCA 3PHJA 5I9MA 2NVBA 1S6YA 4II2A 4OSOA 1RKXA 4JK3A 1YDEA 4D79A 9LDBA 1BRMA 1YOVB 3TQHA 2Q46A 2HMTA 3PYMA 3FNFA 2VUUA 4J7UA 4E3ZA 4QFDA 4DA9A 5HBRA 4D7AA 3EHEA 1ULUA 1EFLA 3LT0A 4WEOA 4MVJF 2B5VA 3R3JA 3UCEA 1V3TA 3AI1A 1BXGB 1GQQA 1PGQA 2YFQA 4K6FA 4S3MA 5KTKA 3LLSA 3DOCA 2FHSA 1U5CA 2E49A 4QO8A 4CV0A 1AHHA 2FSVA 2IXBA 1WP4A 4N5LA 4PVCA 4NG5A 1YKFA 2JHGA 4I5GA 1P44A 4CJXA 3A1NA 4OM8A 2YUTA 3K92A 4BO6A 3JSAA 3JTMA 4MVJH 2ZK7A 2NWQA 1ENYA 1X1EA 2AE1A 4WEQA 1Y8QA 5C3MA 2VNSA 1U3TA 1B0AA 1E3WB 1V9LA 5DBFA 4IIVA 5CDUA 2IDZA 2I9PA 4BUCA 1XG5A 1BWSA 1SMKA 2VTEA 1NVTA 4JJIA 4ZJUA 1K0UA 4MPDA 3Q2IA 3PQFA 4NU5A 1PZFA 3IJRA 3HDJA 4WCDA 3WGTA 3DAFA 3W4KA 3IS3A 4U5QA 1AUPA 4IINA 2EV9A 2DPGA 2JCVA 4A27A 4NQZA 4XYGA 4LMRA 5L4LA 1I5RA 2GNAA 1L7DA 3TRIA 4ALKA 2IEDA 3GT0A 2DM6A 2P9GA 4BKQA 2Z95A 4YTEA 1RM4A 2H63A 1EFKA 2W4QA 3DBLA 4B8ZA 3ANNA 4I5DA 1Q1NA 1QYWA 3PP8A 4BL5A 2AQKA 4CLRB 3EVNA 3GC6A 3ZN2A 1T4BA 3ZZNA 1YGYA 1OOEA 2V6MA 3WSVA 2PLAA 3S8MA 2PD6A 3KLPX 4FJ0A 3LDHA 4YACA 5JDCA 3DMTC 3ZNPA 2R00A 1UZMA 2X4GA 2Y93A 2TMDA 1C14A 2NNLD 4DL9A 4R51A 4DIOA 3PHHA 2HSDA 4D3SA 2AHRA 3TZCA 4Z3KA 3D4NA 4EBFA 1MLDA 4XJTA 3OECA 3WJ7A 2FPPA 1V3VA 4NK5A 4WLVA 1RWBA 3DBRB 1T2CA 2G1UA 3TDKA 1N9GA 3E8XA 4RVGA 3OIFA 3OQ6A 1XLTA 4GAEA 3S2EA 3ZV3A 5HM8A 3AUSA 3DQPA 4XQCA 2GO1A 3BTUA 1GV1A 1B26A 4Y67A 4DVJA 1DRUA 4DPMA 3QJ5A 4CM5A 1BSVA 1FDVA 1Q7BA 2O2YA 3JD1A 2ZB7A 1EZ4A 5I9NA 5U9CA 4QX6A 3F1KA 3FTNA 5JYEA 1KVTA 5COAA 5T8KA 1HSOA 5CPFA 4I1IA 2B0JA 2VHWA 4JCOA 3STHA 4RPJA 5AYVA 1NWHA 1SZJG 4K9DA 5KVQA 3RKRA 1NQ5A 3CPSA 1LNQA 3L77A 1G6KA 1HKUA 1AXEA 5C7OO 3RC1A 3INRA 1HZJA 2D3TA 1R6DA 3FNGA 2JFGA 4GKBA 4E5KA 2YW9A 5H82A 1A7KA 1X15A 2WM3A 2GN8A 1A27A 4PLPA 4INAA 2V6GA 4A26A 1H6DA 1L1FA 4GX1A 1LLCA 4FFRA 2GCGA 1Q0LA 1DIHA 2PZMA 4PRLA 1Q0HA 4XYLA 5JNLA 2B36A 4J90A 2FZEA 2DTEA 2ZATA 5A02A 1I36A 5BR7A 1N1GA 3NTRA 3W6UA 3NAQA 3WIDA 4E30A 3I1JA 1IPFA 4CQMB 5IDWA 3QWHA 1B8UA 3PDUA 1YL5A 2OHXA 3TZKA 3AI3A 2ZB4A 1ZSYA 4E5YA 1LU9A 4HADA 5ADHA 4AJ1A 2NADA 4EUEA 3UICA 5CDSA 1NHWA 1DBVO 2FP4A 3X2EA 2A4KA 2OOSA 3RBVA 4ALLA 5C7LO 1WNTA 3VH1A 2QZZA 4CLXA 1DXYA 1VL6A 5TIIA 2OXIA 5KVCA 1P45A 1CERA 1BGVA 4BNKA 3DZBA 4EGFA 3ANMA 4MJLA 1CRWG 3LT1A 4FN4A 1MFZA 1LJ8A 2Q1WA 1UAGA 3WNVA 2BFMA 4PG5A 4BO4A 3UAGA 2EG9A 1VC2A 4IBOA 1F8FA 1LDBA 3Q2KA 4EW6A 2JFFA 4IMRA 1WAMA 3DMTA 2C7GA 5KIAA 5JCJD 3S2FA 2QHXA 3NT4A 1X7GA 2OGUA 4LISA 3RBXA 4BV8A 5DDIP 1JDJA 1O6ZA 1QSGA 3LT2A 4J2OA 3MJTA 2B4TO 3KXDA 1EBUA 1UH5A 3OJLA 3CSDA 5DT9A 5ITVA 3UW3A 3EYWA 1HYEA 2CDAA 2X0RA 4J0FA 3PK0A 3F46A 1YRLA 1NTOA 5IN5A 1QORA 3KLMX 4CLDA 3FBTA 4NFSA 4FQ8A 3JQEA 5G4KB 1E3SA 3ZHZA 3KVOA 3JQ7B 4OHUA 3K6JA 2BD0A 4UEKA 2XXBA 4IXTA 4IIUA 1GYQA 2B4RO 1VJ1A 2O23A 4BNUA 1DHTA 4DQXA 4DRYA 4TWRA 4RLSA 5L4NA 4MVJD 2AE2A 1J0XO 3WTBA 2D0IA 3UCXA 3S55A 1JTVA 1ENZA 3EZLA 4P4GA 4ALNA 2G82A 1E3JA 3DBVO 4LGVA 3MJVA 4E5MA 5FFFA 5KVVA 4DWVA 2QRKA 4BHTA 4CMKA 2PY6A 1JQBA 2RH8A 2Y99A 3JD3A 2I3GA 4F45A 1XHLA 1NXQA 4IJVA 2Y68A 3R1IA 4FS3A 4NBWA 5A3JA 1EUCA 2BGKA 1ZXLA 4YR9A 1U7HA 1AN9A 4XB2A 1UAYA 3H8VA 5HS6A 4Q3BA 3D3WB 5BQFA 1LDEA 5L7YA 1AE1A 1NHGA 4RORA 3CZMA 2EEZA 3M2PA 5A5EA 1T1RA 1YQXA 4XRRA 2IYPA 3FD8A 4AJKA 1QYCA 1LA2A 4DPLA 5JAZA 1GUYA 4WNIA 3VH2A 2JJYA 2ZJ0A 4ZD6A 2DFVA 4NFYA 1W6UA 4GH5A 2WD7B 1AXGA 4Q3CA 3KHUA 4C7KA 3SBOA 5EQDA 3EDMA 1PJ3A 2FWMX 1B15A 4BNZA 4L4SA 3KZVA 4O59O 1GZ6A 3DZKA 3A06A 4PG8A 4JNKA 1MB4A 2X1HA 3H9UA 1BW9A 5KJEA 4IMPA 1PZEA 2O7QA 1T1SA 2BI8A 2VQ3A 5LDGA 1U4SA 5KOIA 1G0NA 1DC4A 1WZEA 2RH4A 3NDIA 3ZWYA 3FNEA 3ABIA 3OJ0A 4AJJA 4BNLA 1KC3A 3VPHA 1XELA 2GYYA 4B3JA 1UXHA 3EAGA 4FC7A 4D41A 3ZHYA 3HADA 1R66A 1UXIA 3GAFA 2VOEA 5M6DA 2IRWA 1ZIDA 4B79A 3IQDB 1J5PA 5G0WA 1PJCA 4BQRA 3I6QA 4LRTB 3JQ8A 5L40A 3B1JA 1P74A 2I5PO 2VYVA 2X5OA 1CF2O 1E6WA 1NFQA 1SEVA 2OL4A 4PCVA 3PYLA 2H9IA 4XJSA 3VHRA 4YB8A 3PLRA 2DBVO 5ES3A 3D3EA 2OP0A 3H3JA 5TS3A 1C0IA 3RJ9A 1ZBQA 5ENVA 3I23A 4GX0A 1NYTA 3VZPA 3MWEB 1WZIA 2YYYA 1E3EA 3L6DA 3PFFA 4A2CA 1IHYA 1QLJA 2JAHA 3TJRA 4RF4A 2NQTA 3RSHA 4KOAA 3EK2A 4LCEA 2P9EA 1GEEA 1P33A 1SC6A 4XIJA 4BMSA 1JKIA 2QZ9A 1DIBA 1QYXA 4PVDA 2OUIA 3AOEA 3Q9UA 2JCYA 3OSUA 5TC4A 5FI3A 3DWFA 1BDBA 4ROSA 3GGGA 5KJ1A 1ZMTA 1T24A 2HRBA 3ETGA 1EE9A 4ZU3A 1UJMA 4KUEA 3FR7A 1RM3A 1NASA 3WGYA 4BNXA 3UCFA 2FRDA 4E0BA 3WQSB 2R00C 3NTQA 3RU7A 4R01A 2B4QA 5JE8A 2P5YA 2AQIA 5K9ZA 1DRVA 3RUEA 1NQAO 2BF7A 4E5NA 2EXXA 3SX2A 1Y8QB 1W0CA 5A03A 1PQUA 3JV7A 4J1NA 4I9UA 3ZGYA 1LQTA 3WMXA 4R69A 1E77A 3UGKA 2VWHA 5DCYA 5EINA 4HP8A 1YJ8A 3PHIA 4XD2A 1GADO 3TL2A 1GCOA 3TZ6A 3ETEA 4N18A 7MDHA 4CLHA 3ADPA 5KKAA 4FB5A 1O9BA 3I52A 1VJTA 4NR0A 3JD4A 1JLLA 5EPOA 5FI5A 1ISHA 3UN1A 1KY5A 1NAHA 5AQ1A 1Z74A 1QG6A 1HDYA 2EKQA 3B1FA 4AJHA 4NDNE 4WCFB 3ICPA 4BNGA 3EMKA 3RKUA 4LCJA 1DOHA 1BW9B 2DUUA 3L6OO 4OL9A 2ZB8A 1WXDA 2B5WA 3NV9A 3U3XA 2PNFA 2Y05A 2CNBA 3JQBC 5H83A 1XQ6A 2NU7A 4CR6A 1YONA 4PGFA 4CM9D 1HDOA 3BA1A 2Y1EA 4C7JA 3EGOA 4CM3A 1E6UA 3H2SA 3FCOA 4FOSA 5G0TA 2DT5A 3T4XA 3KOUA 4IQGA 1IYZA 3JQ6A 4FGWA 4WASA 2JKVA 1VM6A 3PQDA 1D4FA 5B1YA 1QRRA 3RC2A 1B16A 2WMDA 3E9NA 2E37A 3H7AA 5A4DA 1ZZEA 1WW8A 3AWDA 1ZK4A 2FR0A 2G17A 4J3FA 3PGXA 1DPGA 1D7OA 3ZV4A 1YDWA 1YO6A 2XPCA 1TT7A 4UVEA 4ESOA 3W6ZA 1N92A 3DZIA 1N7GA 1GAEO 1GL3A 1PGNA 1TB4A 3RUHA 1Z6ZA 3AFMA 5MDHA 5JW6A 3WGHA 2NU6A 1IE3A 1DFHA 2P4QA 1T2FA 4JN6B 4W99A 4IPTA 3RUAA 4WJZA 1E7SA 3ZHBA 3IUPA 1N8KA 4GL4A 4MVJP 2AEMA 3LC7O 3O8QA 4UEJA 1VPDA 2Q4BA 2AG8A 4KQXA 2DBZA 4WLEA 1S7CA 1KS9A 1H2HA 2I65A 3DMYA 1PZGA 1M6HA 2IZ0A 1PR9A 3DONA 4NI5A 2YV1A 1H94A 1GCUA 4J4BA 4AVYA 4NFHA 3UH1A 2VHVA 2I3AA 4CLRA 2E82A 1YE3A 3GEDA 2FR8A 3I9NA 4IZHA 4OSPA 4G81A 1PJBA 2PH5A 3DBLB 4XGIA 4BNNA 1P0CA 3LT4A 1W4ZA 1H0KA 1Y8RB 2UUPA 3JQAB 2J8ZA 2NU9A 3GVXA 1NAIA 4WKGA 1EK5A 2NACA 5H81A 3U4HA 5FEUA 3QWAA 4YYZA 3GVHA 4W82A 2I99A 4YCAA 2PZJA 2LDXA 4XRGA 5BSGA 3PVZA 1TT5A 1HE3A 3K5PA 1V6AA 1XGKA 2AW5A 2E6UX 2EIHA 3ZWVA 4MO2A 1MX3A 3WNQA 5A3VA 3E5RA 2WDZA 3I9JA 3QY9A 4F3YA 2AMFA 3EZYA 3AUAA 3I6IA 2AXQA 1VL0A 2J5QA 5JCXA 4EYEA 5ITWA 4JLWA 2YQ5A 3OF2A 2DKNA 1AGNA 3TZHA 3ZH2A 1Z75A 2B37A 4YQZA 4ND2A 5J23A 2EW2A 4RPKA 4IZIA 4BNIA 5LDHA 4HUJA 1UUFA 4R68A 1PS0A 2ZCVA 4JJGA 3IIEA 4CLOA 2IYOA 4HX5A 4UUPA 4GGOA 2LDBA 4BO9A 4ZQHA 5CEJA 2CMDA 1IZ9A 4J16A 3ENKA 5JO0A 3P5SA 1ZEMA 1YB5A 1H6AA 1H5QA 4BO8A 3ENNA 4YQYA 1KIFA 1UR5A 5DOZA 1UXJA 4L74A 4WCFC 2BELA 1LC0A 2CD9A 5K0ZA 5KVSA 2JAPA 2PGDA 1I2BA 1C1DA 1A72A 1O5IA 3OIGA 2O48X 4B3IA 3MJCA 4RDIA 3VZQA 5AVOA 1UP6A 2UV8A 4EJ0A 3QV1A 4G65A 1TVEA 3JYQA 1U8FO 1WLYA 3DZGA 1I30A 1M66A 3PIIA 4NH4A 4ONEA 4Y8VA 1K89A 4UREA 1SOWA 1GPDG 3CXRA 1ADBA 1CIVA 4WNCA 4LVCA 5L7TA 1YQGA 2QW8A 2QYTA 2POQX 3DAPA 1HXHA 1PWXA 3HHPA 3D3WA 2JL1A 5L9AA 1HDZA 3CH6A 4QQRA 3QQPA 4JBHA 2X5JO 4NBVA 2EERA 4CMIB 5HRUA 3PIDA 4JBIA 5CDYA 3ZU3A 2AQHA 1NWCA 2C59A 2V65A 1R4NA 1VSVA 4RQTA 2EHDA 4D0SA 3SJ7A 1YS4A 3FHLA 3OQBA 1EK6A 1KEUA 4WK6A 4PLVA 2J6IA 3OMLA 5L3ZA 4Z3DA 3ZV5A 3RASA 1PJSA 4YA6A 4NNJA 4KQWA 4QTZA 1F0YA 3WIEA 4HXYA 1JVBA 2ZQZA 2YHUA 1LSUA 3GUCA 4FFPA 3NUGA 3WFJA 2BGLA 5I9LA 4U8GA 3TNLA 2ZTLA 1I32A 4XEHA 3VPSA 3X2FA 4E5PA 5K6AC 2CF6A 4R1UA 4R5HA 4FR5A 4XYMA 4YJHB 1OFGA 3RUFA 5HA5A 4FBGA 3MTGA 3F47A 1GQYA 4OOFA 3RFXA 2X6TA 3TOZA 4AICA 3ROQA 5BNIA 2X0NA 3OEWA 2D2IA 2VCYA 3R0IA 2B35A 3PEFA 3TSCA 1GTMA 3I83A 1Y8RA 5COBA 5DULA 3VZRA 1P1JA 5MGBA 4OGWA 4ZICA 2C5AA 3CUKA 1DJNA 2I76A 2E4AA 2JD1A 3F4BA 3JQ7A 3G79A 5AOVA 2B69A 5JMPA 3HUDA 1NFRA 2D8AA 1PGJA 1FDSA 4E31A 3UVEA 2PH3A 5IF3A 5EERA 1UDBA 4PRKA 2P9CA 4K28A 4XDYA 2DC1A 3G3EA 4FC6A 5L4SA 1JW9B 3PJDA 1CWUA 4FFMA 1ZFNA 4ND1A 2OO5A 1R4MB 3KSZO 3V2GA 5BT9A 1XU9A 5JAIA 1CQIA 1X13A 3E9QA 2Y0EA 3VKVA 1YBVA 2AEFA 2Q99A 2J3IA 2P68A 5IZ4A 2FSSA 1N5DA 1GYPA 4B7UA 2VT2A 4RVHA 5CHEA 1QR6A 3UXYA 2Y1FA 3VTZA 1R0KA 2VT3A 3D0OA 1I3LA 2TMGA 4UUMA 1VI2A 2O3TA 2PWZA 3N74A 4OXYA 4PLGA 5CEFA 3AI2A 3ZW9A 4FSHA 5IDQA 3NRCA 4EITA 4PIVA 1MGOA 3FSRA 3AOEC 3NGXA 4IM7A 2NTVA 4IJKA 1NVGA 3DBHA 3DAGA 4UVGA 4CL3A 1GYRA 4MKZA 3K2BA 4IGFA 1FDTA 3HZZA 3B70A 2OFPA 1GDHA 4B4VA 6LDHA 4OIMA 4IDDA 3QW2A 1XEAA 1AHIA 4PLHA 3WB9A 4TRMA 1PL8A 4Y9DA 4LK3A 2Y0DA 2FPIA 3E1KA 3E48A 3VDRA 3FRJA 3IKTA 4A5OA 4BS9A 4XKJA 2PKQP 1N2SA 3M1AA 1A4IA 1EDOA 3BYZA 3KBOA 3QRWA 5DCWA 3JYPA 5KJCA 4CQMA 4BO0A 3C85A 4CM4B 2PKQO 4R41A 4Y6SA 3DBHB 3JQGA 3OBBA 3F6YA 2VWPA 4DBVO 3HWRA 3NDJA 2FR1A 4JQCA 1BXKA 2ZTMA 1ZK2A 3FWNA 4WOJA 4EEZA 4EI2A 1GUFA 3A28A 4FGSA 1YB1A 3GNQA 3TFQA 1OC4A 3U49A 4E13A 1HLDA 5JFOA 2A35A 1ARZA 3B1KA 1MUUA 1ZMOA 1E6EA 5I8WA 3W8EA 1J6UA 1FJHA 2PZLA 4GSKA 4I9HA 3QVTA 2VYND 1CETA 3C7AA 4FFOA 4E12A 4FJ1A 4GGPA 2UAGA 2ZCUA 2F1KA 3AM5A 1QYDA 5EJ2A 3OICA 2VRBA 3M1LA 1ZK3A 3UOGA 4PLFA 8ADHA 4YDRA 3A4VA 3H2ZA 3G49A 2VUTA 1SCUA 2ZYDA 4OOEA 3KYBA 1IHXA 1PX0A 3O38A 1Y81A 4J1TA 1FDWA 1LEHA 1DEHA 5COQA 4TMFA 5EIOA 3NX4A 4N5NA 2O4UX 3WSWA 3E5MA 1LRKA 5JXWA 4J7XA 1F17A 3WG9A 4C4OA 4G5HA 4AJIA 3O03A 4D46A 1I24A 4DIFA 3DZJA 1HYGA 5FYDA 3ZWXA 4BNTA 1ZK1A 1RM5A 1MXFA 4UVIA 1RYEA 1ZK0A 3H65A 4IGEA 4BGVA 1EUDA 4YRBA 5B4UA 1YBMA 4BGIA 5G0VA 4JP2A 4NBTA 5U4QA 2IEBA 4RVDA 1Q0QA 5DBGA 4CMBA 3K2EA 1ZH8A 2CDBA 2D5CA 3BMCB 3LC2O 5CPBA 1DO8A 2EGHA 3MJ4A 1NPDA 3INGA 4I5FA 3E82A 3L9WA 4D3DA 4GPD1 1NPYA 4WE3A 1B8VA 3O9ZA 1LUAA 1TI7A 4PG7A 1U3VA 1PIWA 4CM4A 3JQ8B 1P0FA 1HE5A 1ZW1A 3HB4X 4RQUA 4EZBA 2BRUA 2CVOA 2QRLA 3GGPA 3PJGA 4IDFA 5GY7A 1E7RA 1PQWA 2X9VA 4P38A 1MC4A 3D64A 1NPTO 1IULA 2UUOA 3OETA 4WLFA 1SBYA 1UZLA 3G17A 5B37A 2WE8A 4RVSA 2HJRA 5CG1A 1LTHR 1MXHA 1PWZA 3I3OA 2J3KA 2GN9A 3G0OA 5THKA 1DIGA 1JU9A 1C0LA 3IC5A 3FBGA 3VPFA 3K96A 3BMNA 1PR3A 1X0XA 3PFWO 5AXAA 3TPCA 1SO8A 4UUOA 1VRWA 1LDGA 3MJSA 4XQGA 4BO2A 1OC2A 1OBFO 4MP8A 3A9WA 3OJOA 3JQFA 4F46A 2W8ZA 2DU8A 2GR9A 3RFTA 5IG2A 2FY8A 1C3VA 1HDGO 3RJ5A 4EDFA 2GRAA 3I9MA 1NR7A 1X1TA 3IKVA 3JQGB 3NKLA 3KETA 5F1OA 4R3NA 4URFA 2PD3A 2VTDA 5IDXA 5AXDA 4BOYA 1NQOA 1DB3A 2CSUA 2WWRA 4Z0PA 3FN4A 2VZ0A 3GHYA 2E48A 3GN1A 3PZRA 4IDGA 2YFHA 2DTXA 5ICMA 1BDMA 3GZNB 3AK4A 5F5NA 4ID9A 1U2DA 2NM0A 4GBJA 4P4NA 3OHSX 4FD3A 2NTNA 3JQFC 4OH1A 3G1UA 4ZA2A 1SAYA 4W7IA 1RYDA 2HK8A 4QUKA 3VTFA 1KEPA 2I67A 1ONPA 2BFOA 1PJTA 1I3MA 3QSGA 4BQPA 2EW8A 1YWGO 4GKVA 3BMOB 1WPQA 3OA2A 1LX6A 4W4TA 1DHRA 4BGEA 4R4JA 1BXZA 1XCBA 3QP9A 2VUSA 3CIFA 3HNPA 2Q1SA 1HTBA 2WTBA 2PK3A 4MVJE 5TRTA 4MVJA 4J7CA 1IB6A 4Q39A 3VAZA 3KTDA 3ZU2A 3MJEA 1HDCA 3PI7A 2Y1DA 3NT2A 1D3AA 3HDQA 3DBRA 5FWNA 3U9LA 1ZSVA 3QWBA 1DDOA 2BFPA 3DFZA 3ZNOA 4JIGA 4UVDA 2CUKA 4NK4A 1VKOA 2C7VA 4HY3A 3ZWWA 3AY7A 3PXXA 3OIDA 4XCVA 1H9BA 3SC4A 4DYDA 3FTPA 4BV9A 4O1MA 4K6CA 4XX0A 1V8BA 2CFCA 2X9GA 5AXCA 5KKCA 1MC5A 5EN4A 3U5TA 1LDMA 1A5ZA 4DIBA 4JP3A 4DLLA 3RQSA 1ZJYA 3JYLA 3ZU4A 4BO1A 5G2OA 1DLIA 4ALIA 3ZWNA 4PG4A 1PJ4A 4BB5A 4BVAA 4D0RA 2O4CA 2Q1TA 4YJDA 1MA0A 1UP4A 3GMSA 4E2YA 1JVSA 5JBIA 2X8LA 4RF3A 2VRCA 4YPOA 4YAJA 4R9RA 4AJ4A 2P91A 2PA3A 3CMCO 5JYAA 1R4NB 2BI7A 2GASA 3L4BA 3IP3A 5IFLA 2YDXA 3QHAA 3UKOA 3U4DA 5I7VA 4DPKA 2CY0A 3BIOA 3O26A 2Z5LA 4OQYA 4NIMA 4QECA 4QSMA 2X7HA 1LLUA 3ZV6A 4Z9XA 4R1NA 1LRLA 3CINA 2HK7A 4OQZA 2JCXA 1EQ2A 3GNTA 4Q3AA 4N5MA 3WDSA 3OFSA 1KVRA 2P4HX 3ROMA 2ET6A 4EJ6A 2GZ1A 3MZ0A 2QG4A 4AJLA 3ASVA 1E3WA 3NGLA 4GLOA 4KDFA 4NBRA 3N58A 4RVFA 5GZ1A 1YL6A 4Z0HO 1T2EA 3AM3A 5B4VA 4A0SA 4JROA 4L75A 3ONFA 2GN6A 3ZW8A 3GLQA 5A9SB 5HS4A 5IJZA 3PZBA 2O2SA 1HEUA 1BMDA 2YY7A 3U0BA 1DC5A 3ZI0A 4TSKA 4OAQA 3T4EA 3W4IA 3JD2A 4EUHA 4J1SA 1ZKMA 3GH3A 2NUAA 2Y1GA 4ZVVA 3L07A 4Y6RA 4M86A 4OO3A 1HSZA 4YJFA 3WMWA 4ZQEA 2X9NA 2PD4A 2XF8A 1X0VA 5CDTA 1ZUD1 3GF4A 5TLSA 1C0PA 4RZIA 4J91A 2GPTA 3WTCA 1DRWA 4I8XA 4TKLA 2UDPA 5JS6A 3GPIA 1X7HA 3EY4A 3T7CA 4A73A 4DMLA 1GFSA 4DTIA 1M67A 1I0ZA 5T57A 1JWBB 3DHEA 4WUVA 9LDTA 5DOVA 1K6XA 1K6JA 5L7WA 4UULA 3QVSA 3S2GA 2V7PA 1XWFA 1XDWA 2HDHA 5T5QA 2ZQYA 5B12A 2A9FA 1TEHA 2CF5A 4GWKA 4BNVA 4U0JA 5ICSA 2HJSA 1U8XX 4RF5A 4WECA 4UAGA 2Y0CA 4A7PA 1QV7A 1TT5B 4GMGA 4E33A 2Z1MA 2G76A 4CMAA 2X22A 3W4JA 4TROA 3RC9A 4BMNA 2RBEA 1P1IA 2Q2QA 3BHJA 2VHZA 4YAIA 4D3FA 5TJ9A 1F14A 4HNGA 2HLPA 3F9IA 4W9NC 1TA4A 1VLLA 3U4IA 2HMVA 1X7DA 5I7FA 1EBFA 3L4SO 2OP1A 2HK9A 2WD8A 1B14A 4H7PA 3GEMA 1N1EA 1WDKA 5B4TA 5C37A 4W6ZA 3KRTA 1XKQA 4FJ2A 3GDGA 3GOHA 2QYSA 2UYYA 2C2XA 1WMBA 4ZGWA 1KEVA 3WFIA 1LSOA 2X23A 1XA0A 1LDNA 4NJMA 3GFGA 1ENOA 4KWHA 2IXAA 3GEGA 3AOGA 3D1LA 3OQ1A 3ON5A 2JFHA 5T8KC 3SJUA 5EESA 4CUZA 4RLHA 5THQA 1A7AA 4NJMB 1OAAA 1JAYA 1DIRA 1DSSG 3JYNA 1HYHA 5JY6A 3RROA 1IUKA 2HQ1A 3JQBA 2GUGA 4DBZA 1PS9A 4HV4A 1SEPA 4RO0A 4RPHA 2YV3A 5A05A 2O3SA 4XQEA 3ZWBA 3SLKA 4R16A 1E3IA 1P9LA 3EUWA 2RAFA 3AUUA 4HFNA 1ZXBA 5JDIA 2X0JA 2EF1A 1DAPA 4YT2A 2AG5A 2HO5A 3GA0A 5I7SA 4XZ3A 4MINA 3WYCA 1IY8A 3VKUA 4DC1A 5DP2A 5C7IO 1ISFA 2VN8A 3A14A 4MP3A 2WYWA 3F4LA 1HDRA 4B8WA 1UDAA 2A92A 3VPXA 4BB6A 2AQ8A 4CMEC 4XA8A 4YT4A 3GVCA 2HKIA 2H1SA 2EWMA 2PTGA 4Q3NA 4CM1A 2C2YA 4DMMA 5CP8A 4NMHA 3H9QA 2XXJA 2AEJA 1BXGA 4Y98A 4J49A 1QXSA 3RC7A 1O0SA 4R1TA 4TRJA 4WLUA 4XYBA 3AFNA 3ITDA 5JC1A 4YWJA 1K6IA 3M6IA 1DC3A 3VVCA 4B4OA 1WVGA 5KJ6A 4RV9A 2O3QA 4N54A 5T73A 2XOXA 3BMOA 3BHIA 1DC6A 1NNUA 3U4CA 1UXGA 5TNXA 1B3BA 1PGOA 3PTZA 3QWIA 3O4RA 5G0UA 2BHLA 4HFMA 3ZNQA 3KB6A 1VJ0A 1YVEI 1H6CA 1PS8A 3GGOA 1KY4A 2NVUA 2C29D 1NVMB 2I66A 4ALMA 2VYNA 3GPDG 5J9GA 3P2YA 3MCVA 4F6CA 3WBBA 4FFLA 3SVTA 5JSFA 1HZZA 1E7WA 2RHCA 4IJUA 1JKJA 1I10A 1R12A 1U9JA 4NBUA 4D43A 1YB4A 4TRRA 2HRZA 2CVZA 4A03A 2YHIB 3DHYA 3HB5X 1R0LA 1VSUA 1KBZA 5IZCA 1JA9A 4QT0A 4PLWA 2GD1O 5CG2A 3ITKA 4B4WA 3WR5A 1Q2XA 1LLQA 4R3WA 4GI2A 3KSDO 2GF2A 1HETA 5FF9A 4CMJA 3WYEA 4XR4A 4CODB 3UUWA 3HJAA 1PJ2A 4EUFA 3NDRA 1ID1A 4MVJI 2FOIA 1ZNQO 5ER9A 4KWIA 5A9RA 4J1QA 3VH4A 2YJZA 4E2XA 1EVJA 2O3RA 3LF1A 4E4YA 3GNSA 4J0EA 3JD0A 4WLNA 4PFJA 4RZHA 4JJFA 4ND5A 4DUPA 4JBGA 4ZQFA 4TKMA 1E3LA 3VOSA 3G1TA 4E2ZA 4ZRNA 3CMMA 1E1NA 1EEHA 3P2OA 4FOOA 2R6JA 3ZU5A 1J49A 3WJAA 2F00A 4Z9YA 4AJOA 2Y1OA 2NVWA 5F1KA 3WWZA 1YQDA 4CMGA 5DP1A 4QFCA 4M8SA 3PHLA 1V35A 5IDYA 1SPXA 4CM7A 4AG3A 5DCUA 4IQ0A 1ULSA 2X0IA 5JLAA 3RAJA 3KUXA 1T25A 3DOOA 1ML3A 5L95A 2Z1NA 1E1LA 5U1PA 3TWOA 2EGGA 1KOLA 1GZ4A 1NP3A 4J43A 1EVYA 2Y67A 5BSEA 3TFOA 3Q3CA 3RU9A 1KVUA 4L0QA 3ONDA 4BKRA 4LMPA 3T7EA 4XGNA 2FPGA 3NTOA 4J6FA 1PJLA 2FMUA 4M87A 5TF4A 2DBQA 3V2UA 3DR3A 4OXNA 4YVFA 3GG2A 3E6AA 5JY1A 2W2LA 4UVHA 3OJFA 3H5RA 4MKXA 4XWYA 2VZ8A 5DNAA 3V8BA 3BZUA 3C7CB 1Z73A 3GZNA 2Q45A 4O6VA 4PLCA 4BNWA 4N7RA 4IDAA 3HG7A 5A04A 3EW7A 3JCZA 5G4LA 1O8CA 1EVZA 2QIOA 4KTTE 5A06A 1MG5A 4PLZA 2YHIA 1E1MA 1UXKA 3ANLA 3W8FA 2WEKA 1G0OA 3C1TA 1Y7TA 4J9VA 3GRPA 1DFGA 1P3DA 4WPGA 4X54A 1W8DA 4KUHA 4CUKA 5CFZA 2C20A 4KTVE 1F06A 4AJ2A 1GR0A 1R37A 2PKRA 1DAOA 3DHNA 3BMNB 4U0KA 1U5AA 5TQVA 1C1DB 4H15A 4B4UA 4BO5A 5A1TA 3H4VA 3D5QA 4FDAA 3WOHA 4J4HA 5C5IA 3BTVA 3V5NA 4XIYA 1NBOA 2HU2A 4ND4A 4XDZA 1GPJA 1NR1A 1ZJZA 4GX5A 2PFGA 4CM8B 4ZQBA 1FF9A 1YOVA 5JMWA 3E9MA 5TT0A 3PPIA 3LF2A 4GQAA 2GDZA 3RUDA 4B7CA 3D4PA 4UEOA 4DYVA 2RHRA 1HE4A 4ZN6A 2YDYA 3QA9A 3L4BC 4NJOA 4FFNA 3WQRA 2BKAA 5JCJA 3QVWA 1CEQA 1QYVA 3AM4A 3V1UA 3DFUA 4ZRMA 1EUZA 2V6BA 3ZDFA 4HNHA 1ADGA 4J9UE 3WX0A 1KVSA 4L76A 1GUZA 4IUYA 3U62A 1FXSA 4HKTA 2X5KO 4UUNA 4WLOA 5I7EA 1EDZA 1E92A 2JHFA 4M55A 2NTJA 3C24A 1M75A 3ORFA 3DL2A 2J5KA 3H6KA 3N7UA 5T67A 4YT8A 1YL7A 4XYEA 3EC7A 1HE2A 5IAAA 1R4MA 2AA3A 4L4RA 3LZ6A 4LRSB 4XGKA 3RCBA 2IE0A 3H3FA 5F1PA 3PYXA 4EEXA 1YJQA 2ZTUA 4D42A 2NV6A 4PLYA 3OA0A 1MG0A 2HAEA 3COSA 3HN7A 3WICA 1TXGA 1XIVA 2JD0A 1P1KA 1T2DA 5TX7A 4P4LA 1T4DA 3H9JA 3PHGA 4BNYA 3QVXA 4HWKA 3WS7A 2HMSA 3QVOA 1ZEJA 3CTMA 4HFRA 4CUJA 1ISMA 5IXYA 1XSEA 4LN1A 4AJEA 4IDEA 1A4UA 2EJVA 4I5EA 4ZQGA 4IS2A 4DXHA 2H5LA 4E6PA 2QX7A 3ZWPA 4EJMA 4U7WA 3MEQA 3GN2A 2GZ3A 3LYLA 2BMAA 3F1LA 1Z82A 3V1YA 4M1QA 4W9NA 1NFFA 5JAQA 3P19A 4L4XA 3CKYA 4OXKA 3LK7A 2RIRA 3PDJA 3Q9NA 4A10A 4JX8A 4E21A 3WBFA 4JGBA 3OJEA 3RD5A 4BMVA 4I08A 5L51A 2QRJA 2EKLA 4ITUA 3K8ZA 4YRAA 3L9XA 3W1VA 3BMQB 3GDFA 6ADHA 1DJQA 1ORRA 3H9GA 3GQVA 4Q3EA 7ADHA 2NVUB 1FDUA 1NQTA 5IXSA 3HE3A 3VZSA 3JQAD 1V3UA 4Z9FA 2NU8A 1FMCA 1Q7CA 2GZ2A 3P7MA 4IXWA 1JAXA 3ONEA 3E03A 2VOJA 5JYFA 5BSHA 3K73O 2C54A 5F3RA 4OMUA 3ZNNA 2Q22A 4L73A 4KMSA 2Q3EA 4YAGA 3AU9A 4CLOB 3D7LA 3R6DA 4BKOA 2GN4A 1MP0A 3GR6A 3QLJA 1I2ZA 4BKPA 3WWYA 1E5LA 3DTYA 1L7EA 2DLDA 1B7GO 4PZDA 5JDIC 2I6TA 5A9TA 4PN3A 2YQ4A 4FPXA 5DZSA 3WQQA 2WSBA 3KYCB 4QXMA 3FPLA 3OH8A 3PWSA 1KEWA 4BO7A 2GSDA 3L6EA 1M2WA 1RJWA 3NJ4A 4LSWA 4AFNA 3BXXA 3BMCA 4CR8A 1E7MA 3H9EO 4MKRA 2NSDA 1D8AA 2X58A 4NHEA 2ZKLA 4WOKA 4O5OA 1IZ0A 3SLGA 4KP7A 2CZCA 1T2AA 4BNJA 2O3JA 2EKPA 1OZAA 4L9RA 3OM9A 2OMEA 3RIHA 2C07A 1QLHA 3VH3A 1HWYA 3BTSA 4TZKA 3MOGA 3RI3A 2D59A 1XR3A 4QO7A 1YXMA 5GZ3A 2DVMA 3HFSA 2QQ5A 4E32A 5JPIA 1WDLA 1VL8A 3RVDA 3F3SA 4MVJM 1M6WA 2VZ9A 2DQ4A
chains in the Genus database with same CATH superfamily
3M6AA 1XZHA 1HF3A 4LW8A 1YZFA 2YNMD 1SG0A 3AR7A 2AMYA 4JJ6A 4HZIA 1A71A 3PJEA 3MUFA 4A2PA 4RKYA 4OYRA 2WQ7A 3HKCA 1W73A 3I2JA 1J0CA 2IS2A 6NULA 3KEQA 4DDHA 4R1SA 2EP5A 1IN4A 2Q3DA 3BRWA 4EY4A 1ZH0A 1KBQA 1CUFA 2G9UA 2VRCD 2WSYB 2FX3A 4I9FA 2C88A 4HAWA 4P22A 2GB4A 2DQZA 3GZ4A 4Z7JA 1F8GA 1Z18A 3CRMA 1FS5A 4YYEA 1W5FA 1E1QA 4PNZA 4W7HA 1PJQA 2GEUA 1LS1A 2G09A 3FPJA 4QLOA 4YXWD 1DFIA 3RJMA 2H5JA 1N25A 1GFIA 3UK7A 1J1UA 1RJDA 4PQRA 3DGFC 5TSDA 4JBXA 2AZDA 4PIPA 3TLZA 2DFLA 1DQPA 2VP3A 2R6CA 2GXAA 4L5YA 5KU7A 2FWIA 3HDHA 4RADA 1I1NA 5BN4B 2V0NA 3IDFA 3SJZA 3W2TA 1OY1A 1Y5NA 4H0FA 2JGRA 2D4AA 2VHYA 2NYVA 4B3FX 3KJNA 3ORSA 4KR6A 4LRQA 1ZLXA 3CS3A 2GGSA 2C03A 2VTBA 2VWGA 4IOMA 2QQ0A 1TQDA 3E4DA 5F4BA 1BMFD 1IPEA 2FN9A 3F6EX 3FSGA 2C5BA 1I33A 4Z0TA 2P40A 5HNKA 4O8CA 1V1JA 2ZYGA 2OY0A 3STTA 3HGTA 3NBUA 1Y8ZA 3L8GA 3D8HA 3PF9A 3WL6A 3U31A 1BS9A 2D0OB 3G0IA 2PQ0A 4MIEA 2YXPX 4M88A 4IJWA 3TLCA 4LZAA 4MTLA 1QH1B 2G83A 3LZCA 4EPYA 1NSTA 1C7JA 2FRXA 3LFUA 5FLEX 3ZCRA 4DN6A 3F73A 4RTKA 2F17A 4KIJA 4Y1FA 3N8IA 2QM8A 4ZKEA 5BNFA 1YZKA 5PGMA 4BP1A 3LX4A 5IT0A 3OCZA 2NZJA 4C89A 2GJSA 4RMHA 1N5RA 2DPHA 5KYWB 2RBGA 3RARA 2AMJA 3CH4B 4WCFA 5LFAA 4HDNA 1ZS9A 1XKXA 1U3CA 3C1AA 2YVAA 1FMJA 1ZUWA 4TYMA 1R15A 4XVQA 1UBJS 1U65A 1L5FA 1VE5A 4M89A 4PW0A 4YJGA 2BFNA 5CFPA 1JSRA 2VF2A 4GOKA 5BYAA 3LX8A 2YUIA 3KUKA 3KV3O 3HH8A 1SXQA 2C2ZA 3RVMA 3VQTA 1GJRA 4KPGA 1AMNA 1IAQA 2OO3A 4X00A 1G2PA 1O2DA 1SZPA 2A94A 1KETA 1NZFA 2ADMA 4LEIA 1ZZGA 3PD1A 2IODA 3M6MD 1VKJA 4H4EA 1Y9AA 5I5GA 2A86A 3W34A 2FMTA 1PLKA 4IX1A 3W8DA 2E0IA 2P9QA 2HPAA 2NQ8A 5GGYA 3NWBA 1U2GA 3CEJA 3H11B 3TB4A 4BIIA 4HNTA 2JLVA 2FWAA 2AUMA 4UE3S 3ICWA 3R74A 2G4LA 1W0JA 1IN8A 4GDMA 4DLAA 1EUDB 1KAGA 1QR2A 2ACWA 2P4EA 1TIKA 3BHMA 3H5AA 4PSVA 2VPXA 3T9CA 1NRJB 2NZWA 3G8YA 2XQIA 4AL4A 1JMVA 1HRDA 5IH3A 3VI3B 2XZLA 2XDWA 1N6OA 4ZOCA 5EHGA 3C3XA 1CV2A 5MN5A 2QZ4A 2CLKB 4LJ9A 3DQZA 4PHGA 4RD3A 1A8SA 3W78A 2V1XA 4LNUB 2Q6IA 2JVJA 4NV3A 4D9KA 1DUIA 5H0IA 2Y9MB 4HAUA 2VPTA 4CQLB 1WNFA 2P4UA 2I8CA 1PR2A 3IO3A 3THRA 4ZHSA 5HK9A 4FLEA 4NU6A 5IX8A 4GX2A 2R7MA 3GH1A 4YAKA 1BOOA 3TMAA 1KJYA 3SQLA 4OYLA 1NVDA 3KSRA 1A1VA 4PNHA 2HEGA 1CQIB 1EP3B 2V7VA 5JC8A 1JSCA 1VJ5A 2M32A 2Q5CA 1BGXT 1XDBA 2V7BA 3KQWA 4OB7A 1QVWA 3SIWA 2VF8A 4EYOA 1WBJB 2WTNA 4N3GA 1UBLS 2XBLA 3PWKA 3K71B 3WMEA 3EZ7A 3ZQ4A 5DNUA 1F60A 4NZZA 1O97C 1TD1A 1JYEA 2W00A 5I8ZA 5T3UA 4MQFB 3FVVA 4NENB 2V4MA 1TO1E 3FWPA 3FKJA 3UJHA 3TIIA 3TLGA 4GNKA 4DC0A 3AZQA 1P9RA 4FW8A 1UMCB 5BNTA 4NEHB 4Y30A 1VPTA 5EZQA 2OXEA 2VVTA 1LK0A 1MO2A 1I7NA 2YBEA 3ELWA 1FFWA 4BRSA 1FFHA 1BG6A 1YI0A 2H6EA 1L6IA 1CQJA 3OOSA 4CZ2A 2SCUA 2WV9A 2O1SA 3SQNA 4D9CA 3H2JA 1US8B 3JX9A 2BGRA 2PSSA 2QTCA 4MOWA 4RCVA 4WINA 3E1SA 3OCUA 3T52A 5A4AA 3M3HA 2M1ZA 3A8TA 2R6DA 1KOJA 1ZM7A 3C6BA 3Q1LA 3L7IA 5F5LA 1T8SA 3MTJA 1ETUA 1TU0A 1VG8A 3X44A 3JRWA 2H16A 5IN4A 4R31A 4E51A 4I99A 3TQIA 1LI4A 3C3MA 1KC1A 3EBPA 3ZQJA 3CEAA 1JKMA 4JBNA 4C6TA 1QK3A 2YZ7A 3J7TA 4KDEA 3EPAB 3BJMA 1MJNA 1VHQA 2P2SA 1PL7A 2ILTA 3BE6A 1YQWA 1OIXA 3K9NA 4KN5A 2C1ZA 4V1CB 1AF7A 5CAEA 1SUWA 4EQ6A 2ZB3A 1Q7RA 2MJLA 4P84A 4RGBA 5ESRA 3UANA 3ZK8A 3CX8A 3DDNA 1Z7BA 2PR2A 2W6IA 1V4VA 4NEQA 2P4SA 4PSDA 4L5JA 3UXHA 1TYCA 2W7TA 2A59A 1O94A 4NBKA 1QIFA 4R8VA 3WLFA 1YZTA 1MNAA 1VBFA 4I9NA 3LO8A 4J2TA 4Y2RA 5GVSA 5IULC 1QP0A 4TVBA 4F1WA 2UVQA 3E2PA 1FTSA 1NY6A 1O3YA 2G0AA 1HDIA 3A05A 3EQZA 3B52X 1VMAA 4OHRA 4AY4A 3DBOB 1NBME 2B83A 4XWTA 5KQLA 1JIIA 1G8JA 1RTKA 5B58T 4GOXA 4OKNA 5E0OA 4DZTA 4LNAA 2RC6A 3KYCA 4RGQA 1E2GA 1ODIA 2OZPA 3COVA 4KX5A 4FFWA 1JTEA 1Z5WA 3EXAA 2DAPA 1X14A 3ER9A 1ZVMA 4M3NA 5AVJA 3OWXA 1D7AA 4E15A 2X8WA 4MYUA 1LSSA 2H1IA 3ZW7A 1U28A 1EWYA 3LWBA 1U7ZA 1EDBA 1ZPDA 1F3LA 2QG6A 3OPQA 2XMBA 4PBTA 4NCAA 4B3HA 1J2JA 1A9YA 3NHBA 2FW6A 1ZJWA 2PJUA 1GXSA 5ED4A 2DBRA 4HDSB 5JG7A 1E0DA 4XFDA 4EM6A 1DBPA 4BXOA 1LVUA 2H7XA 3CWCA 2P9YA 1E7YA 3LHKA 1FQWA 1G8HA 1WW2A 2DFKB 1BEZA 5LQCA 2OZVA 3VFDA 2E5LB 3LA6A 4WSOA 4BVLA 4OATA 5F35A 4Y18A 1A82A 2C8JA 2NSYA 2C96A 1Y6JA 3KNZA 2WG1A 4QDOA 2RGXA 4V0KA 3K8YA 5A9SA 1KP9A 1UZUA 4AW9A 4G8BA 1NG9A 3NP7A 1XNRB 1OFTA 2WIJA 3DFMA 3TLAA 3TLGB 1UP7A 4URVR 1AIPA 2UVDA 3AESA 4UXJA 3S1LA 5DM1A 1IL0A 1ACLA 4L9SA 1PW5A 2NLOA 1MCZA 1TKAA 1YBAA 2WV7A 3AFIA 2GPAA 3PR2B 5CEEA 3VSBA 5HJ5A 2ZUUA 1LZKA 3LHIA 1GTG1 1QPZA 2PFKA 3ZWCA 3ZE2B 5C8DA 5DEOA 1FVHA 1UYJA 1NUUA 1R5NA 3BD6A 1TVCA 1E7QA 3NHUA 4LQ4A 3MQFA 3BHNA 4HAXA 4QRHA 5EKSA 3SXUA 3IULA 2GT1A 4B3GA 1PYGA 1R00A 3R40A 4QUJA 4NYMQ 4MITA 3W5JA 1Q1GA 1K8YB 3G13A 3IALA 2FZKA 5DYWA 1ZIOA 4HPXB 4BRUA 4QG3A 1QHYA 3QX3A 1N0IA 3AEKA 4YXFA 1JWAB 5JSZA 4CIWA 2FB9A 4X41A 4DDUA 4FKBA 4RZ2A 1KRWA 3DCNA 2JARA 2X86A 3UJNA 2A14A 2IVFA 2R65A 3BE8A 3CE6A 1E2IA 4GRIA 3DAYA 4EGFA 1HY3A 1JXAA 3A1EA 3E0QA 4CR7A 3CCCA 1CUJA 1NXVA 5FIUA 3V97A 4F5DA 1A88A 1VMIA 4TLMB 3QEOA 4KMRA 1M2NA 4R54A 1CY2A 4UW9A 5FOVA 4C7VA 2F9FA 3K30A 2VHEA 3EFOA 3FPKA 3LOUA 1N7HA 1U1IA 4LYFA 4X8MA 2Y2VA 2ZI9A 4WY8A 4ND6A 2WHXA 2PUVA 1DEKA 4OMCA 5I45A 4ND3A 3LQRA 5LD2B 2PGAA 1NM5A 1XRLA 3E2IA 3TQSA 2C78A 1TZMA 3RHTA 3KKKA 2JI9A 4QIHA 3DNFA 3F6RA 3FF4A 3KB2A 1N8NA 1V0JA 2RCYA 1EZ1A 4GIBA 4J07A 1CUIA 2V98A 3RC3A 3MGAA 4MHSA 3BSWA 3BXOA 4O25A 1EUYA 4C22A 4EGSA 2DTDA 4O63O 4BGUA 4F8YA 1XU7A 1DELA 4Q9NA 4LYAA 5J2TA 1B2RA 1KI8A 1Y82A 1KYQA 2YIDA 2C8LA 2Q3HA 3M6UA 3P9RA 5BRNA 1PGPA 2QTZA 5LZ7A 4DREA 3REGA 1XTBA 1KYZA 2O50A 1QP7A 4UHCA 5JVDF 2FPSA 3OUTA 5HUJA 1EM8A 1KS2A 5DTJA 3OOWA 4IHQA 4QXOA 4RXMA 3TF5A 3F3YA 4IQ8A 4U6SA 2WZQA 2ACKA 3UKJA 4Z1MD 3K9QO 4U7DA 1H93A 1H0RA 1SPBS 2ZJ1A 3K9GA 1QIIA 1DQZA 4M54A 1ADCA 3SXPA 1ISSA 2XUOA 2V6FA 3B1WA 2BEUB 4YRSA 5AOBA 4UUBA 2Q2VA 4MUIA 1R0BA 2YWCA 1A5AB 3PHJA 1XZMA 5I9MA 4II2A 2CLSA 1EFCA 2J9RA 3KAPA 4OSOA 5EWMA 2LCQA 4F8JA 3EGIA 3O1LA 4NBSA 9LDBA 1OX4A 3L7YA 3MB8A 3KXLA 4TOIA 2E21A 2F8MA 3ZXUB 4DA9A 4QYWA 3TQOA 1KDPA 3BFXA 4JY7A 2C4TA 2OXRA 4D7AA 3EHEA 3LT0A 1EFLA 4ERNA 5BR8B 2O59A 2FFAA 1DWQA 1K92A 3OLZA 4TTPA 3UCEA 1V3TA 1DG1G 4AN4A 4INPA 1JFRA 1PGQA 2YFQA 2Z5GA 3AY0A 3GEBA 3FH0A 3KIPA 3DOCA 2PT9A 4OHMA 5E2BA 2E49A 1PBTA 1NVFA 4LMBA 2XQJA 3FDIA 4RJIA 2MT9A 3AKDA 4LHYA 5CXUA 4NG5A 1YI1A 7AT1A 2C1EA 3K92A 4CIYA 1RLTA 1N2IA 3TTTA 4JXJA 4B84A 4MVJH 4NHOA 4Z4HA 2JGFA 3EEYA 1ENYA 1X1EA 2NWQA 4WEQA 2DBYA 5IJXA 3UWSA 1HR0B 4TM8A 1G63A 2VNSA 1SOUA 5CK5A 3UQZA 3ZTYA 3RTGA 4KZKA 4OGFA 3KU4A 5CDUA 3ZVRA 4LA4A 2HA7A 5DM0A 2UZ1B 1RKBA 1AGXA 2VTEA 2C3UA 5JTTA 3ITEA 2ORYA 3V4PB 4KXWA 4LY0A 5AKYA 3Q2IA 2GBGA 1PZFA 1KAOA 4PC7A 1JQEA 5BMVF 3HDJA 5FUMA 1TX4B 1T36B 4F5WA 3D43A 2X4IA 4KQFA 4TSFD 4AS1A 4YXWA 3DDWA 4DMRA 1W4BA 3LGXA 3QM1A 4LXGA 5DM70 3LI2A 4PRZA 1G20E 4HDOB 2GNAA 1TZ2A 1L7DA 5KOJA 2VPIA 5JCOC 5L4LA 2J0SA 4C30A 4QVGA 1MOQA 2OILA 4RIHA 5AQEA 2Z95A 4D5GA 2H63A 1EFKA 3N3AC 3O1IC 3EFOB 5MFZA 2ZLBA 3I45A 1RFLA 3LBAA 1F2VA 1QYWA 2H0RA 2ZOSA 3ZWKA 4CLRB 5I7RA 3MSCA 5F78A 4YMGA 2QBYB 3ZN2A 1Y4SA 1U4NA 1LBQA 1MABA 2C57A 4TMYA 3UATA 3HKEB 3RK0A 4C5BA 1VSTA 1XN1A 1YACA 1XC7A 2VIIA 4RMGA 2PX0A 3HHEA 4M21A 4NYIQ 2QX4A 2OSBA 3LDGA 2PD6A 1TA9A 4ZEXA 2FWJA 1CZRA 3DMTC 1HG0A 3QBDA 1E0JA 3I09A 1QJCA 2TMDA 3LM8A 1IHOA 2O7VA 2GMWA 2IIQA 5TXGA 2R6R1 2COEA 3FGOA 4D5EA 4D3SA 2X8BA 4O8JA 5H8WA 4Q9AA 4M9UA 3PGMA 1SC3A 3PIRA 2J3MA 2FFHA 2JH3A 3NR2A 3P4YA 2HIAA 4OU5A 3MYYA 4NK5A 3IV9A 4JELA 4YRFA 1RWBA 4PCUA 4UU0A 4FEAA 3ISTA 2XYHA 3I2IA 4AD8A 4WOBA 5ALOA 1N9GA 3TDKA 4RVGA 3UOAB 4TZ6A 1CUHA 1GZHB 2AXPA 3DO6A 1OLXB 1M74A 1XLTA 2OXFA 4LWOA 4OLFA 4D3ZA 1WM1A 2B7BA 2XDQA 1RMTA 1P5RA 3GCZA 3N07A 4GAEA 3S2EA 2QRUA 3COWA 1HL7A 4OM7A 3TGPA 1KH1A 3HJUA 4MJXA 2GO1A 1GV1A 1E4OA 2WWXA 1N33B 3PXEA 1LBSA 4XWKA 1G8KA 4XLLA 4MHTA 4WWHA 3KQOA 4AIIA 1WZNA 4DPMA 2XADA 4V0ME 1CIPA 1I4LD 1WUYA 3VR3D 3WK5A 1FDVA 3C3YA 3CZ4A 3R7DA 1BIFA 4UOEA 3FUWA 1UIRA 4F1JA 3EVDA 4QX6A 3F1KA 3FTNA 5FBQB 2CBGA 5JYEA 1OH7A 4F7DA 4NKRA 4P5EA 3NHLA 5EFZA 1YVPA 2IIVA 3W2IA 3ZXSA 5AMXA 1ZR2A 1T6NA 1NWHA 2E6KA 3OUZA 4E08A 1SCKA 2NPFA 1C7RA 3CPSA 1OHHD 3CC8A 3Q4GA 4O4IF 5JI2E 4DWOA 3EDCA 1IM8A 5ARCA 4I66A 5HTKA 4JD5A 4WFQA 5HHTA 4GXTA 3PCXA 3PPYA 1JB9A 4E5KA 2YW9A 4AQDA 1COWD 1Y3BE 5ECYA 5SV2A 2GN8A 1A27A 4NZNA 5IK2A 2V6GA 1L1FA 1RTTA 3JVEA 2CJYA 4TN1A 3COZA 2JLYA 4CN9A 2GCGA 3EXEB 5GM2A 4KAAA 1M8PA 2VEDA 5BMVA 4IGKA 1KQFA 2Z3WA 2FZEA 3A3OA 3PB3A 1C7FA 4GPTA 2FF5A 1C30A 1I36A 3NTRA 2OWDA 1QU2A 2IPXA 3EOZA 4FFBB 5IDWA 1P4GA 2IUEA 4CQMB 3IMKA 5AP9A 1SKAA 4QOSA 4WGFA 4PONA 5LOVF 221PA 1NVAA 2ZB4A 1H9CA 2Z4TA 4US0R 1T6YA 5AIAA 2HDWA 1Y1LA 1BMTA 3OCXA 3UICA 4EUEA 3X2EA 1PAUA 3NBZC 1X80B 3BE4A 4JCCA 4OHPA 2A4KA 1TMYA 3HXKA 3VPAA 4NZMA 4KREA 3RBVA 4UMVA 2VI5A 3CRVA 1N2ZA 1IBCA 2J67A 121PA 1FDRA 1P7WA 3HCWA 3K9WA 3YASA 4BUZA 3VH1A 4X92A 2PYDA 3ND8A 1DKUA 3D6TB 4FDVA 4CLXA 3ABQB 4CKZA 1KPIA 4BCDA 3IT1A 2OXIA 3KUCA 3HO1A 3NV7A 5KYXB 4FHGA 3ZV7A 3WHKA 2VUIB 1NQUA 4MJLA 1CRWG 3CR7A 3EEBA 3PX7A 3F7NA 3P9ZA 3C6QA 2GESA 3WNVA 2TMYA 3HJGA 4G63A 4FOLA 1HEIA 2BFMA 3EIOA 4HX9A 3W7AA 1AUXA 3OPYI 3IA2A 1WU7A 2COUA 3UJ7A 3P2IA 2D2FA 2EG9A 1YBFA 2AT1A 3LWZA 4IBOA 1F8FA 1LDBA 4KDRA 1T9HA 1XMSA 3CWZA 2W93A 4IMRA 3R6TA 5LB4A 1T1IA 4BEVA 4D4JA 1S5PA 3B3JA 3DMTA 2XTZA 4CKCB 2FFJA 3UGJA 2AG1A 5B57C 3GP3A 2QHXA 3S2FA 4EYSA 2OGUA 4O89A 2H1WA 5DPMA 3RBXA 4BLPA 4OHVA 4OREX 3KKQA 1F2TA 4D8TA 2HV8A 1Y0BA 2G72A 4Q7JB 4UTRA 1KU6A 2KI5A 3F7TA 4KCGA 3P2KA 4M1EA 5EPUA 4YFVA 5K8IA 1Y4ZA 4MA5A 3BDAA 3A6JA 4KWCA 1OQAA 2IQIA 4F4JA 1HYEA 3MN1A 2WAAA 1NVKA 4J0FA 1CD5A 5B30A 3RVQA 1JBKA 3WK8A 5D3MA 3QY0A 1PDOA 5JZMA 4UAJA 4NLLA 2EX1A 4NFSA 3U7GA 1SUEA 3PQ4A 1NQWA 3ZHZA 4BFYA 3JQ7B 2RHWA 2IZOA 3K6JA 1RWPA 1VCOA 4M0LA 1ZD2P 4BN5A 3LQ1A 4IXTA 1GYQA 2B4RO 2HIGA 2O23A 2PRKA 3MGCA 4RLSA 4TWRA 5HDQA 4MVJD 3MMNA 4D8UA 3R5HA 4OLJA 3V42A 2ESRA 2Q8QA 3S55A 1JTVA 2AF3C 2HPHA 3EZLA 1BWQA 3DWGA 1NE2A 2B2CA 2VPWA 4A8HA 5F77A 3GLTA 2I3GA 4YS6A 4LHEA 3T3EA 1TTTA 2WAYA 1R2QA 3GBVA 1TECE 3HUEA 5LYYA 2P79A 1QX3A 4HQ0A 1U7HA 4NICA 4XB2A 1G7CA 1CQWA 1Z22A 3M0EA 5HS6A 5C46F 3EEOA 4Q3BA 3TJZA 1W5AA 1AKWA 3HVIA 1AE1A 2HC9A 3NVMB 1NHGA 1OTHA 2H17A 3CX4A 4JWTA 5BNWA 2PUWA 1FMFA 3M2PA 4NAUA 5I5EA 5JIBA 2HW8A 2EQBA 3PE3A 3FD8A 5B3AA 5B64A 1LA2A 5BMVB 1GUYA 1SXJC 4D9GA 3HCBA 4YAOA 5KNBA 4LF8B 1BRTA 1ECFA 2ZJ0A 3C3BA 3M6FA 2DFVA 2V7TA 3OU6A 4P4SB 4UCQA 3UWPA 1E8DA 1JEOA 2AOUB 2H59A 3M83A 3GDHA 3TVTA 5JFGA 4LJRA 4C7KA 3IESA 2Z58A 1SUCA 3FMOB 4AN0A 2X6RA 3QFHA 1NMYA 3T7TA 1GTJ1 1VJCA 1B15A 4PU0A 3RHZA 3K1TA 3RVSA 5DYGA 4WXMA 4YI5A 5GJWC 4O59O 2BM1A 3FPHA 1T2VA 2PWBA 4RSMA 1BN6A 3OEHA 3DPUA 4YC7A 2HQSA 1PG2A 1PZEA 2M98A 4P81A 2BI8A 3U6KA 3JZDA 1U4SA 3V7NA 3VR3A 5KOIA 1DC4A 1WZEA 1QH1A 2FZCA 2J0UA 2RH4A 2XEDA 3N86A 2Q5LA 4ARUA 1P4JA 2PMKA 3MWFA 4IIJF 4LRWA 3WMGA 4B82A 4CN8A 3I12A 1RDFA 3UHPA 1XELA 2HJVA 4UZFA 4Z1MA 4XSHA 4B3JA 3I4LA 1OREA 4R1PA 4C88A 4DDWA 5JSHA 3NAMA 4FFBA 3WRYC 5F2KA 4GZMA 2C0PA 4X85A 3MINA 3GLHA 3HB1A 2PZGA 4H7HA 4MUYA 1L5YA 1PNQA 2WWGA 5F1YA 1S4MA 2FFQA 2XF2A 3FCSB 4RD0A 1MAHA 1COWA 1XZAA 1M2GA 4PC6A 3WIBA 3LUFA 4LZWA 1DJOA 1ZIDA 4TS9A 3IQDB 1PK9A 1J5PA 1AKRA 1FEZA 1PJCA 5DX8A 4LRTB 4MEJA 4IJ6A 2FGKA 4LDRA 5L40A 2I5PO 3GFTA 1P4AA 1SXJB 3ZZ0A 1KO8A 1K5DA 1CF2O 1YZQA 3NW9A 3EXHB 1HE1C 4JX9A 5F4ZA 3ICQB 2O19A 1SEVA 1HNWB 1WZ2A 5L3VA 3HBAA 3PC8A 4PCVA 2H9IA 1ZMXA 5K8UA 4YB8A 3WWEA 4XAQA 1HLGA 3GUUA 3R9XA 5DGHA 2L69A 5ENVA 1ABBA 3A4IA 1QH0A 2W6PA 3ESCA 1WZIA 3KUDA 1E60A 1E9VA 1F5SA 2Z2YA 4JUCA 4AAYA 3T1QA 3EPPA 2PCJA 2EWWA 4JP8A 4A2CA 2JAHA 3MD0A 4HVAA 2P3SA 1QF6A 1OLSB 3RSHA 1OROA 2VDUE 2GTPA 3EK2A 4W5TA 1JH9A 4J75A 4DWJA 1SC6A 3BWDD 1K6EA 1QYXA 1GTL1 4K2AA 5DHTA 2OUIA 3AOEA 4XOIA 3Q9UA 3HWSA 2JCYA 2Q5FA 3OSUA 1IVSA 2WF7A 5FI3A 1BDBA 4ROSA 1G18A 3K1AB 1T24A 1RXYA 4NXNB 1UF9A 5DRTA 4F38A 2O5VA 3CTPA 4UFPA 3EGXB 3I2HA 3LOPA 4KUEA 3Q12A 2FUG1 1YS9A 1Y4DE 1M34E 1N2GA 4EG3A 4MGYR 1NASA 5KNDA 4C2TA 5DTRA 3WGYA 4GUDA 2B78A 2IH4A 6Q21A 1JJVA 4KO3S 4LBYA 1RHMA 3S2ZA 3NTQA 5LZ5A 1XLWA 3SC2A 2FETA 1DAKA 2M2IA 4LUCA 4R01A 2WSMA 4NCHA 2RAVA 2LRHA 1YMQA 2GF9A 3IBGA 4NU8X 4XLTA 2BF7A 4JQOA 1XE3A 1GCAA 3KWLA 1Y7HA 3H75A 1PQUA 1NJSA 3PXAA 2AF4C 3LRXA 4GEGA 3ZGYA 5ICEA 2RARA 1DADA 1L4EA 4R69A 3E53A 5CT9A 2QR2A 1D1QA 2GFIA 3I2YX 4KB5A 4L5CA 1L5LA 1FTYA 4CTJA 5BURA 2G8NA 5EJMA 2ZRDA 4K6CA 1GADO 1I13A 3F67A 1GCOA 1IXRC 4N18A 5AVKA 5B1IA 3VR1A 4RD1A 3J80A 1M83A 3ADPA 2QBYA 2GAAA 2VJQA 3F74A 4MV0A 2VCHA 5JD5A 1S0UA 5F64A 5EPOA 4U2CA 5KTOA 3EGVA 5HKAA 2PKWA 3UN1A 4EO7A 3BWXA 5BSKA 3O3MB 5IVPA 1D6SA 2JAWA 1XCLA 1VECA 1DRKA 2COKA 2PS0A 3B1FA 4YREA 2BBOA 2CL0X 4NYMR 5CBKA 2JFQA 3QMPA 2GPJA 2YL2A 3RKUA 4IR7A 3GU3A 4AXXA 1G20B 1X94A 3THWB 3U44A 2B5WA 3K0AB 3U3XA 1QHIA 4HAZA 4HQNA 2VG8A 4CBVA 1NN5A 2CW5A 4EHAA 5HIKA 5C32A 5H83A 4DCMA 1FMTA 1KO5A 4L6CA 2AGVA 2EBFX 1UPXA 2Y1EA 1T9DA 3EVCA 3D3QA 3LMKA 4IQGA 1I6KA 4YECA 2Z2JA 1J9GA 3AJEA 2QW0X 4CU5A 5CD9A 4D8XA 1GHTA 5TEVA 1W87A 3RG8A 3KZNA 1QFMA 2KHZA 3PQDA 3KT3A 1D4FA 3ZY6A 1QRRA 5B1YA 1VOTA 1B16A 3F71A 5ESDA 2EQ5A 3EXIA 3FW1A 4L85A 5TQJA 4ASUD 4B7AA 4ZAGA 5LBIA 3F6SA 1YDWA 1I7SB 5DEIA 4BJ6A 3L7MA 1HDEA 1R74A 1Z5PA 1ZINA 4UVEA 4U39A 3QIAA 3NP9A 4UBLA 1N7GA 1GVNB 1V8FA 5CJ2A 4IZOA 3RUHA 4QHSA 2IKQA 1E9EA 4JHLA 3FVRA 2O54A 2OPHA 2XKJE 1IE3A 3AB3A 1P39A 2AYZA 2KX7A 4W99A 4BP9A 2Y27A 1LNZA 3UWOA 2C9MA 5ERXA 3EEQA 5HGXA 1TADA 2IBMA 4FT4A 2AEMA 4G4JA 3LSTA 5FAKA 3GV0A 4CWAA 2Q4BA 2ZPTX 4EKEA 1BKYA 1RI2A 2AG8A 2JGKA 2W8BA 4KQXA 4QPCA 1JEYB 3UO8B 1C8KA 4L02A 1V5GA 4WLEA 1NVXQ 4Q7MB 1S7CA 1SUIA 1L4MA 3GFFA 2XYPA 1DT3A 5EUQB 3R9IA 1PZGA 1FUYB 2JZNA 1H94A 3B9QA 4J4BA 1K3UB 2VJOA 4LPSA 3KDSE 1XNJA 4HGZA 3VKFA 2OKGA 3ZJXA 1J9EA 2I3AA 4CLRA 5JECA 3KV1A 3ZCSA 3VZCA 3GEDA 4Z4CA 4D26A 1W4ZA 1H0KA 3G6KA 4IMIB 1IG0A 4U2FA 1W2WB 2F4NA 2NU9A 2XODA 5FULA 1E63A 2NACA 4Q1CA 4RFVA 4HDQB 1NMEA 1W35A 5H81A 3S3TA 5FEUA 3PC6A 4W82A 1UWCA 5CXQA 3DL7A 2LDXA 4XRGA 2NOAA 3UUGA 1VFPA 2WM8A 5BSGA 3FLAA 3WV4A 4P7BA 4TQ9A 2BC9A 4W1PA 2Z4SA 3WP0A 4MQEB 4C0LA 1HE3A 3L0ZA 4RK1A 3RS8A 3TUZC 3LCMA 2AW5A 2FW7A 1KWGA 1HURA 4L3WA 1W96A 4MO2A 5K2MA 3VHLB 1OYVA 2NVOA 3C4JA 2M9MA 4EA9A 5BWMA 1BMFA 3KHSA 1GRQA 1B0ZA 2WF5A 1Q77A 3UT5B 2VO1A 2JHPA 3AUAA 4FYMA 3I6IA 5IEJA 2AXQA 1P72A 1VL0A 5J4HA 2CVFA 1BYIA 4IF6A 4KAJA 1CC1S 4EYEA 5ITWA 4MI3A 2RFLA 3NOXA 4A6DA 4Q21A 1E20A 4J0IA 1QF7A 3L2OB 5FL3A 4LRXA 3PF8A 4JI3B 3ZWQA 1RXEA 3OZCA 1SKMA 2QDXA 1S89A 2EW2A 1RXSA 1Y7PA 4ZHQF 5JNLA 1UXOA 2P35A 4LKOA 1P2VA 4BC0A 3K6KA 4OQNA 4D9EA 4ESEA 1XK7A 1E3QA 1SC1A 4C2AA 3LPNA 1Z7GA 3L8EA 2VP5A 3IIEA 4TQAA 2IYOA 4CLOA 3QEMB 3TECE 4GGOA 2V54A 4KMOA 1SOMA 1NE7A 4BFZA 1E1QD 2YC2C 3JZIA 5DXFA 4C06A 1UC9A 3DZ5B 1EM6A 1KI4A 2J59A 3AVYA 1IN5A 5KWIA 3P5SA 2BW0A 1ECLA 1NDHA 1H6AA 1H5QA 1TYBE 3LVRE 4JB0A 1UXJA 1CNFA 4V2IA 4WCFC 4PZ0A 1QGZA 4G0UA 3H86A 4IDOA 3U37A 1C7IA 5BWOA 2F3SA 3OC6A 1O5IA 1D2GA 3BQNB 2O48X 3MJCA 3TUIC 3CNHA 4RL4A 2P7HA 3H83A 3TLMA 4YMUA 4JQSA 4EJ0A 1T5OA 2W6ID 3U3MA 2X8JB 2XWPA 2ZUTA 2A9VA 2QP9X 1T91A 3JPWA 4D02A 4ZOEA 5M2QA 1AUQA 4FNOA 4OD0A 2NZ2A 3C1UA 2DR3A 3AHEA 4BMXA 2I6UA 3DZGA 3PIIA 1M66A 5C31A 1V26A 1JMKC 4Y8VA 2GDJA 4YR7A 2W2PA 4RTOA 3WK4A 1PNOA 4UREA 2M6RA 1WW3A 2GM5A 2LGJA 4BDSA 1SXJD 4GI7A 3BD8A 2QT1A 2HJWA 2X0DA 1CRPA 4MIKA 2V6IA 3SHTA 4RC9A 5CBPB 2ZJ4A 4NOJA 3PEEA 2QW8A 4BEWA 3HY3A 3DAPA 1HXHA 2XIQA 5BY2A 1AA9A 1R0ZA 3HHPA 4NULA 5D8DA 3UPTA 3HCRA 4UNSA 2VDRB 1X3LA 2VJAA 1ACJA 2BRUC 2WI8A 1L4YA 4HGRA 2R68A 1CEYA 1KRHA 2X5JO 4KFRA 5I7OA 5EP4A 1SCJA 1B00A 4G4SP 2GHRA 2RG1A 2ZS7A 1Z6GA 5AESA 5JNUA 3VUEA 2V65A 2Q5EA 2GZDA 2IIBA 5LBTA 2CNDA 2EHDA 4L8FA 3TZEA 4M22A 7MHTA 4PTZA 4D0SA 1SBCA 1S2GA 3OQBA 1DKMA 3QW4B 1EK6A 4UARA 1Z4QA 1W30A 5D1NA 1O7JA 2J6IA 4YASA 3VR5H 1H4TA 4F04A 4F92B 5CCBA 4HLNA 3VO2A 4JLUA 5F7OA 3SFTA 1BJRE 2B9EA 3AVTA 1OVGA 3ZV5A 3EA4A 4ZEVA 4LE2A 1K9VF 4YA6A 3V3KA 3NRJA 1N6NA 1YJCA 4U9IS 5BR1A 1JVBA 5BVGA 5JS8A 2ZQZA 5F23A 2YHUA 1H1TA 5CB4B 1E9CA 4QICA 5LMUB 1QYRA 3GUCA 4FFPA 5TGZA 3USZA 3QYFA 2BGLA 1NF8A 5I9LA 1AQNA 1EXVA 2ODQA 2V0GA 3U3JA 1QRDA 2ONKA 1D2EA 1PNVA 1ZDMA 2VNIA 5K6AC 5K4HA 1TYAE 4PV7A 5F5XA 2BP7B 3UGQA 4EGJA 1W4RA 4XYMA 1EE1A 2B98A 5FTKA 3ODGA 1QFJA 2XH8A 4AICA 1NTRA 2O8EA 1G8AA 1P29A 3HB7A 4D9NA 3JALA 2IDMA 4KR7A 2X0NA 4X8LA 1BE8A 1UEJA 5K6TA 4DB2A 1MW9X 1PK7A 1ZOIA 2CEAA 3QBTA 5FBHA 4XSVA 1DKPA 3PEFA 3QU5A 3RSSA 2GLTA 1N78A 5DULA 2EJBA 1P1JA 4JDUA 1QHSA 3LLUA 4BE7B 5E8JA 4UCWA 3CUKA 1P2SA 2OE2A 1RW4A 2E4AA 2R11A 3PNVA 5SYAA 3G79A 5FT9A 3ZHOA 5FFNA 1IXSB 2F3TA 3F3MA 3N0VA 4X63A 2LZ0A 4MQUA 4X64B 5EQJB 1W88B 1ZUNB 1PGJA 3JATB 2ZUDA 4B2PA 4E31A 3EN0A 2GJAA 3G3EA 5L4SA 2I6GA 1B1AA 4EHBA 4EEKA 1V16A 4P7JA 3AUXA 2OFFA 5B3LA 4TM7A 3Q7RA 5E8RA 5BWLA 3A4TA 2OO5A 3KQNA 2EQAA 1HNNA 1KH2A 4IL5A 1TEVA 1CQIA 3KVVA 3R3UA 3D81A 4WXPA 3C5HA 3UB4A 2Q99A 2AEFA 1GAWA 1U2QA 2RKOA 2VH2A 1L5HA 3N7AA 1D6NA 3I0ZA 1IRXA 3SMVA 2FSSA 1BU5A 3DEIA 5IZ4A 3O8RA 2C83A 2ZBUA 1YF3A 2GCIA 5CHEA 1QR6A 3RNOA 3UW1A 1C0EA 4Z49A 3LP8A 3OOJA 1MPTA 1I3LA 2VNHA 2IV3A 5BN3A 2OV2A 3N74A 3ABOB 3CWQA 5KTMA 4JT9A 4PE5B 3ZW9A 3SZRA 5TPZD 4DTCA 3Q6NA 5D01A 3NRCA 3ED5A 3JZMA 4PIVA 3TBFA 3K1ZA 2PEZA 4D8VA 3EVAA 3JWEA 1KEEA 1OXMA 3JY6A 4RIGA 1E99A 3SE0A 1CP3A 2VDKB 2ZS9A 2BGUA 4ENQA 2QL9A 2JCSA 1GYRA 5BW4A 3I73A 4MLZA 2PANA 4B31A 3WB2A 1SVOA 2OFPA 3QTTA 2VJYA 4O3FA 4OIMA 3ZDAA 4N0MA 5EHXA 2CK3D 1JHUA 1XEAA 2BFDB 3RTAA 4FHEA 3H84A 5AM2A 2VT7A 3VDRA 3SN6A 1VB3A 2GBLC 2ATIA 4QJ5A 1N2SA 3M1AA 3WZLA 2WKWA 3T5CA 1UBHS 2RHOA 1X1DA 2AZXA 4LYDA 4OPMA 1ZRSA 3IH5A 2PKQO 2C5HA 3UZUA 5BSVA 2PMEA 3JQGA 2N3ZA 1DARA 1AUOA 2JGMA 1KZ9A 3F6YA 3HWRA 5CA0B 4JQCA 2KLBA 5AKKA 1SIWA 2ABWA 1XVTA 3UMVA 2W6OA 1RS0A 4OLAA 1SCQA 3MCTA 4B6OA 2XV1A 4TTIA 6PFKA 3N2GB 1XMOB 1OC4A 4ZFNA 4KN9S 4ML3A 1HLDA 4QDZA 1GG9A 3T5TA 1VG0B 2CB9A 3GJSA 3KB1A 4GMKA 2P62A 3L05A 5I8WA 2CFSA 2J32A 1J6UA 5CX1B 5EUBA 4Q9HA 2HF8A 4GSKA 2UYCA 4I9HA 5JXIA 3S7ZA 4ZYXA 1XD9A 4ZALA 3ZIUA 3E3MA 3Q40A 1H85A 1I5OA 2HDNB 1W76A 1ODTC 2ZIXA 4X3OA 3IWCB 1UJ5A 3GXBA 5FRDA 4C4PA 1Z06A 1A9SA 1QK5A 1XD2B 2V3VA 3H2ZA 3BZWA 5AKZA 1Q1ZA 2CJFA 5DIFA 1KQGA 4FYWA 2ZYDA 1J7JA 2NO7A 3Q8XB 1XCOA 4C7BA 1PX0A 3GLKA 4GD3Q 4J1TA 1FDWA 1KSGA 3ROTA 1GA1A 4TMFA 3LIPA 3KVYA 5IARA 3F8TA 1AHPA 4B4DA 4DEVA 4YMLA 1R18A 3GLGB 2H11A 1KJQA 1R3DA 3E5MA 1S96A 2H8KA 3HR7A 5D5HA 5JXWA 2H1HA 3K1AA 1JXOA 3WG9A 1W5EA 1VA4A 2DKOA 5D3KA 4C4OA 4NE9A 4HGNA 3T3IA 3A0RB 4AJIA 4D46A 4M1WA 4IOJA 5CR9A 1PD0A 3SD7A 3GJ4A 2VTVA 1TQ4A 1EFDN 2EFDB 2PUFA 2MSKA 1KY2A 4OU4A 3DUFA 3A1CA 1MJ5A 4QXAA 4GLFA 4KR0A 4UPVA 5E7JA 2VRWA 2XTMA 4YK7A 3WBKA 3H65A 4BGVA 2NPOA 3DHWC 4YRBA 1FP1D 3SGLA 4J76A 4PR0A 4F84A 4KK3A 4CTOA 2BVNA 3JVIA 4JP2A 4IIDA 3EXFB 4X5OA 4FSXA 2QUAA 1K5GA 2F59A 2XT9A 4CMBA 4P54A 4L78A 4OX9B 1AN0A 1Z2EA 2CYAA 4N7MA 1KPHA 1H65A 4XJVA 2ZFUA 4WE3A 4BLVA 1XZQA 1V5IA 5M29A 3C3KA 3QUAA 4PXSA 4K0KB 4K86A 1W48A 2D74A 1XFDA 2GNOA 2G0NA 3MLBA 5EHIA 5AW4A 2XIJA 4KRGA 1X87A 4P3OA 1L7VC 2BDTA 1X8XA 1OFUA 2BRUA 2QRLA 3GGPA 3PJGA 4C87A 1OZFA 4IDFA 4EELA 1NY5A 2BUAA 3CUVA 4RDXA 5K7SA 4WAUA 1NPTO 4WLFA 4QEKA 2WZBA 4UNRA 5CG1A 3ZD7A 3G0DA 1LTHR 1R88A 3KCQA 1FC0A 2HBQA 5IJ0B 5HFNA 3I3OA 4DG5A 3G02A 2RMKA 3U7QA 4DJ5X 1KMQA 1LY1A 3H1PA 4XD7D 3LX6A 4MV9A 1EB8A 1N2CE 1JU9A 3KZMA 4KNWA 1TU3A 2D1SA 2HCJB 3GXOA 1KJ9A 4JT4A 2M1XA 4NJEA 3VPFA 5BV0A 4OLBA 1SIOA 2EC5A