2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
molecule keywords Dimeric dihydrodiol dehydrogenase
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
2O23A 1NQAO 3MJTA 3QA9A 1W4ZA 5HM8A 5KVVA 1R12A 2YQ4A 3U4CA 5IJZA 1E5LA 2FR8A 2Q50A 4TRRA 1NAHA 2DTXA 2VT2A 3TQHA 4BGVA 5T67A 2YW9A 4PG4A 3ROKA 3C24A 1PU2A 2D3TA 1JVSA 4JLWA 4BVAA 5GZ1A 4KUGA 3WJ7A 1OC2A 1ULUA 1Z74A 2QYTA 4DQXA 4UAGA 1X15A 2IRWA 2OUIA 4U7WA 1P31A 5L95A 3QWHA 3G49A 2GN4A 4CMCA 5C7IO 3ZWOA 3JQFC 3KLMX 2FWMX 1XQ6A 4RCVA 3NV9A 4R5MA 3PJGA 1BVRA 3UFXA 4ZJUA 1JKIA 3AY7A 3JYQA 1N1GA 1EFKA 4QT0A 1I8TA 3FPLA 4DPKA 4CLHA 4L4RA 3T7CA 3O4RA 2ZK7A 4IDDA 3DOCA 2VWPA 3OEYA 2NSDA 3UKOA 3PHHA 3HADA 5A5EA 3DBVO 4PLPA 1DOHA 4HX5A 3NEPX 5G0TA 4PLFA 3JQAA 4FSHA 2NACA 1D7OA 3PK0A 4TKLA 4EJMA 3WYEA 5DBGA 3LVFO 3OHSX 3RROA 4IXTA 3FNEA 1WZIA 1D8AA 2D0IA 5KVCA 2PTGA 3LU1A 1QSGA 3IIEA 4D46A 4DUPA 3WGQA 5KOIA 1SOVA 3OH8A 1P44A 4CLEA 1UDCA 4HFNA 2C29D 5ADHA 1UP6A 4URFA 4KP7A 5K6AA 4EBFA 2D59A 3AOEC 4BNFA 1UZLA 5EQDA 1GYPA 1HYEA 2YV1A 2GDZA 2WD7A 4D0SA 3RC1A 3KSZO 3WIEA 4B3IA 2EG9A 3FNGA 2CVOA 1O6ZA 5DCWA 1DO8A 2X22A 3IP3A 1QXSA 1V3VA 5A4DA 3EHEA 2ZB7A 3GNTA 3HWRA 3DBRB 2YHUA 5TQVA 4DMMA 3ZDFA 4AJEA 1WW8A 2FZEA 4ZQGA 4BHTA 3DAGA 4BB6A 1U5AA 5C3MA 3PJFA 4YAEA 4YWJA 3HB4X 5CPFA 2OL4A 3FRJA 4GKBA 3DMTA 2PA3A 1IY8A 3FSRA 4ALNA 1DIHA 3L07A 1HKUA 1E7RA 4XB2A 2C2YA 4GLLA 1I32A 1E3LA 1DRVA 4HKTA 2HRBA 5J9GA 1T2FA 3GFGA 3KYCB 1PGOA 4IJUA 5A03A 4B8ZA 1YO6A 3K9QO 4YCAA 1U8FO 1WMAA 3DQPA 4R1TA 4CUJA 1WLYA 1I10A 4EJ6A 3BMQA 4NH4A 3IOYA 4PN3A 2ZJ1A 4ND1A 2CZCA 4R54A 4EGFA 3QLJA 4XJSA 2GD1O 2WYWA 1H2HA 3ZWXA 3LLSA 3CPSA 4XB1A 3ZV3A 3WGTA 4GSLA 3PVZA 3KM0A 2HMVA 3H9JA 3ZWAA 3W4JA 2B36A 1YOVB 1HZZA 1BXKA 4E2ZA 4FC7A 5JYAA 2PGJA 1M66A 3GDOA 2EXXA 4ALKA 4JN6B 3QQPA 2I67A 1TXGA 5CPBA 4BO2A 1MLDA 3RIHA 3Q2IA 4CQLA 4W4TA 4YRBA 2EW8A 4BO1A 4ZICA 3DOOA 3MJEA 3BA1A 4UVIA 3KB6A 1HXHA 2FZWA 2HAEA 3WIDA 1B26A 2CDAA 4EITA 2OXIA 1X13A 2DBVO 1H9BA 2W90A 2Y1DA 4FN4A 4IZHA 2AA3A 2PZJA 4R3NA 4ID9A 3GEGA 5DN9A 1MFZA 1ONNA 1V0JA 4CM9A 2CFCA 3L6DA 5L4SA 4MDHA 1OMOA 5L9AA 1PTJA 3C7DB 3TL2A 2X1HA 1ISHA 4M89A 3DBLB 5ES3A 4CM5A 5CG2A 4FD3A 3ROPA 4JBGA 4TZKA 4YT2A 2R2GA 3GHYA 3W4IA 4B3HA 3SLKA 4MO2A 3WSVA 3HUDA 2HQ1A 2EV9A 4CMHA 3ZN2A 4YACA 5JY1A 2FSVA 3EAGA 3W4KA 4BO7A 4CLOB 2I3GA 2DTDA 1GV1A 1GL3A 3HFSA 3VH3A 1L1FA 2WYVA 4O1MA 4WCFA 4NU6A 4R9SA 5BNIA 2J5KA 4IQ8A 4HFMA 1B14A 5ER9A 3FWZA 1ADGA 1I2BA 2Q22A 4MPDA 3JQ7A 4BNHA 3ZU2A 4MIOA 5THQA 3VDRA 3AUTA 5CDGA 2HMTA 4ALIA 3LSYA 3A06A 1CF2O 5IDYA 2Y1EA 2E49A 3QVSA 1ZVMA 5TF4A 5B4VA 2JD1A 3FTPA 2Q46A 5JW6A 4DIFA 1PJTA 2G82A 1ADFA 4DYVA 5JYFA 3TZHA 3AWDA 2YHIB 3FF4A 5DP2A 1TT7A 1NX6A 4WGGA 3PYLA 4EDFA 1T2DA 3U9LA 3W8FA 1UP4A 1NR1A 5M6DA 2PR2A 4XKJA 3IKTA 4TWRA 5FF9A 1XEAA 4RPGA 4BNGA 5KNLA 3U09A 4DLAA 3TNLA 4FS3A 1HDGO 1PJLA 1VKOA 4GPD1 5L45A 5F5NA 1O5IA 3JQ9C 3WQQA 3C7CB 3WBBA 3GOHA 1U2GA 2GZ1A 2J3JA 3GN1A 4L8VA 3JD4A 2QZ9A 3O8QA 1DC5A 1ZK1A 5GZ3A 2AEMA 5I9MA 1UZNA 5EESA 3K2EA 4CM8A 4J7UA 4RVGA 3WQRA 4WLNA 2NU8A 1E7WA 5C7OO 3U4IA 4Q3BA 1K5HA 5BT9A 3JQEA 4XZ3A 4C7KA 1ORRA 4K6CA 1U1IA 2VTEA 3ULKA 2F1KA 2POQX 4BMSA 2YY7A 3H3JA 3SXPA 4FOSA 1DEHA 1HDRA 1VC2A 3BHMA 4RORA 3WSWA 5KJEA 1JU9A 5KJ1A 4PGFA 4L74A 5JCXA 1D1TA 1BHSA 2IXAA 3WMXA 4IGFA 1HRDA 4P8RA 4YJDA 2ZTLA 2X7HA 3I9KA 4B79A 1AXEA 4FR5A 4KTVE 3GNQA 2P5UA 2WM3A 2BKAA 4HWKA 2D5CA 4A0SA 1ADBA 3AW9A 3S2EA 1NQOA 1P0FA 4BNXA 4B7XA 2O2SA 3I5MA 4MP3A 1P77A 1DIAA 1PZEA 4IQ0A 1ZXLA 4J3FA 3JQ8B 4RPLA 2VYNA 1KETA 2F00A 3ZHYA 4RVDA 1MFPA 4QO7A 4YJGB 3LT0A 2VCYA 4U0JA 1GYQA 1YBAA 4LSMA 2I66A 5KKCA 1SPXA 4DVJA 4L73A 1P3DA 1Y8RB 1BGVA 1YJ8A 4MKZA 3TZCA 5KTKA 3PP8A 1KVUA 1W73A 2DVMA 3IP1A 4JGBA 2OORA 3WDSA 4GI2A 3M2PA 1PS8A 3UCEA 1FXSA 1PR9A 4BV8A 1JWAB 4KTTE 5F1PA 2ZJ0A 3GAZA 3NTOA 4ND4A 1NXQA 1EBUA 2EEZA 3BMOB 1K6XA 1HSZA 4TVBA 3AY6A 1WPQA 2JHGA 4XA8A 4W9NC 3I23A 1I3NA 4D3DA 1JKFA 2I9PA 5KJCA 1B2LA 3RUCA 2PKQO 4AJ4A 4QFCA 3DOJA 3PHLA 2QG4A 4RLSA 5L7YA 3OP4A 1OZAA 1SB8A 3D4PA 4PLZA 1GADO 3WTBA 3PYMA 1U8XX 5HBRA 1IE3A 3R3SA 4DRYA 4WCFC 2RHRA 2VNAA 4WKGA 4II2A 4XWYA 1DRUA 1T1SA 3OBBA 4IM7A 3D64A 2W2LD 5A5FA 1FJHA 1EDZA 1H6AA 1SMKA 1UDAA 1OOEA 2HMUA 5HTOA 7MDHA 1VL8A 2X5OA 1R0LA 5IFLA 1DDOA 1TEHA 1ONOA 2Q1SA 2GERA 3AUAA 1MG5A 1LJ8A 1F12A 4CV3A 4MVJM 2FMUA 3EZLA 4I5GA 1UDBA 2BFOA 2G76A 1O8CA 1E3EA 3HG7A 4BNUA 1SEVA 2J6IA 4J91A 1H6DA 3PFFA 1ARZA 2DBZA 2BGLA 4TVOA 1MXFA 1U3TA 2B4TO 3R6DA 1K0UA 5T6BA 4OSPA 3LC1O 2NQ8A 3KBOA 2O3RA 4TSKA 4RPKA 1XELA 1AE1A 3ZHXA 4F46A 1KC1A 4OIMA 3SC6A 1FDVA 2I65A 5JMPA 1HEUA 5A9SA 3QY9A 5CDTA 4Y8VA 3DFZA 2VUUA 3KO8A 3JCZA 4GQAA 1ONPA 4J2OA 4NJOA 1M6WA 2Z1NA 5BNFA 4D42A 4Z0HO 3G1UA 3HN7A 3BYZA 3GLQA 1HWYA 3FCOA 4J7XA 5JFOA 1Q0LA 3PRJA 4PCVA 4M86A 4AL4A 4TKMA 3GF4A 3QWBA 1ZSNA 3H9UA 4MIYA 3VKVA 5IZCC 1DC6A 4FOOA 3INRA 1U2DA 2EHDA 4YPOA 4Z3KA 4JP2A 1BG6A 2FSSA 2XXJA 1GUZA 3ON5A 2PNFA 1YS4A 3DXFA 1ZMTA 4QUKA 3CINA 3WYBA 1WMBA 2VRCD 4KMSA 4GX5A 4AJ2A 1ZK0A 2Q45A 4CQMA 1H93A 1TT5B 2BELA 3JQAB 4WUVA 4PG7A 1P1FA 4BNNA 4CMIB 3C1TA 2OFPA 3DBHA 3T7EA 1XDWA 1E3WB 1LU9A 1H94A 2TMDA 1EUZA 5F1OA 2RH4A 4N5NA 4R41A 2H1SA 1DAPA 2YV2A 3FWNA 3VPGA 3U5TA 4IMRA 4OM8A 2V6FA 5IZ4A 5JCJD 3NX4A 2YDXA 1YL7A 2XPCA 4Y67A 3DMTC 1YL6A 1CQJA 1QMGA 4IXWA 2FPIA 1E1KA 4DMLA 2A35A 1Z6ZA 4R5HA 2B0JA 4RLHA 4A26A 1PJCA 1BSVA 3WR5A 4EJ0A 4W7IA 5AOVA 4WEQA 1BW9B 3NKLA 2J3IA 3PEFA 4PG5A 4R1SA 4AJKA 3PLRA 5CP8A 1MUUA 1CWUA 2GF2A 1ENOA 4JXKA 4OH1A 1HF3A 1KVTA 1WNTA 2YUTA 3VZRA 3WJAA 7ADHA 1G0NA 1D3AA 1YGYA 1DLJA 1LLDA 2D8AA 1DAOA 1E3WA 1WXDA 1NVGA 4CM3A 4PRKA 3QVXA 5A06A 1B8PA 1SBYA 1A5ZA 1H2BA 4RVUA 3NT4A 3TWOA 4LCJA 4CMEC 2FPGA 3KZVA 3GNSA 1EQUA 1TLTA 3TPCA 6ADHA 3JQCA 2YV3A 1GDHA 2Q2VA 2Z95A 4IQGA 5JE8A 4CV1A 4KWIA 1LLQA 2O3QA 4YXFA 3B1JA 2EW2A 2G17A 4WLEA 5EJ2A 1NM5A 5TX7A 4HNHA 2CSUA 4I9NA 2PKQP 1AUPA 2BH9A 3V2UA 2DKNA 3ANNA 4IS3A 1BW9A 2D2IA 3RCBA 3H8VA 2C54A 4XDZA 4XYLA 4B3JA 2WJPA 2R00A 3NJ4A 4RF4A 1LBEA 1O94A 2W98A 3P5SA 4FC6A 4ZRNA 4QXMA 3I6IA 5L3ZA 4DIOA 1D1SA 2DFDA 4B4UA 4UULA 1EE2A 3K2BA 4GGOA 3SC4A 1G0OA 5IF3A 1IYZA 4ZHSA 2P4HX 2DPGA 5U4QA 1OBFO 5BSFA 4QTZA 4AJ1A 4YVFA 1EEHA 1V8BA 1NYTA 2HLPA 4AJPA 1VJ0A 4NBTA 3E48A 5BNTA 2JFFA 4S3MA 1P1IA 4WNCA 1T4DA 3B1KA 1UXIA 4CLRA 3S55A 4H7PA 1C14A 1KEWA 3M2TA 1HDXA 4MVJI 3L0DA 2AQ8A 1E7QA 3IJRA 1BXGA 4E6PA 4WE3A 2JCVA 3JTMA 1X7DA 2GASA 4PLTA 4FB5A 3G1TA 4W9NA 2H63A 2ZCUA 3QRWA 1RYDA 2O7SA 5I7FA 1UXJA 3TZ6A 1DHRA 3VVCA 5CDUA 3KTDA 4EEZA 3UVEA 4YTEA 5JAQA 3PDUA 2Y1CA 5F21A 2WMDA 5L4NA 4NIMA 1WWKA 4PLCA 1HZJA 3NRCA 1FDTA 2Y0DA 3WGZA 1GZ4A 1JKJA 5BSHA 3O38A 2ZTVA 3COSA 1HLDA 1V6AA 1YJQA 2JD0A 1XU7A 3ASUA 3TFQA 1KEPA 4CMAA 1WDMA 3PZRA 3UOGA 3GZNA 3EMKA 3UN1A 1E3JA 1IOLA 4NU5A 5A9TA 1DSSG 1LSUA 4WECA 1B0AA 3HDJA 4XIYA 3ENKA 1IHYA 2G0TA 3BHIA 4PLYA 4W7HA 3KLPX 4AJNA 1P33A 5T57A 2NTVA 4J49A 4N7RA 4DREA 2OP0A 3GVCA 4FJ0A 4YQYA 4BKQA 2JAHA 3WLEA 4UVHA 3ZCXA 1VJTA 4IBOA 3U0BA 4DLBA 4E2YA 3ZNPA 4KQWA 1A27A 1VSUA 1QYXA 2NUAA 3CSDA 1O89A 5AXAA 4D79A 1U4SA 5AXBA 3DTYA 5AVOA 1F8GA 5JAIA 3JV7A 2DFVA 3WWZA 2X0JA 1KEVA 2YHIA 3NDRA 2B35A 4NG5A 3DTTA 1VPDA 3JQGA 3V1YA 3H5AA 3E03A 4MOWA 3ADOA 3WG9A 2A4KA 3KYDA 2QW8A 4YAGA 1WDLA 3DZJA 5TSDA 4NNJA 1ZFNA 1V3TA 3NJ8A 3GY0A 2X58A 1B8VA 4FPXA 4IJWA 3BMCB 1J5PA 2YJZA 3AUSA 4BGEA 1YB1A 3OSUA 1NWCA 3G0OA 3HSKA 3GMSA 4UEKA 1LUAA 2E48A 3HE3A 3VZQA 2P2SA 2AQIA 2B37A 2PD6A 3ZWVA 1YRLA 5CHEA 3UH1A 3BTVA 1GUYA 1A4UA 2ZB8A 4DTIA 4QSMA 2I3AA 1EFLA 3UICA 4TRMA 3ABIA 5DOVA 4M87A 3ZHZA 1T2AA 2QRJA 1P1KA 1QG6A 2Q1TA 1HYGA 3KEOA 4FFRA 4CMJA 5EERA 4ZN6A 4D0RA 4GMFA 3I9NA 1UP7A 3ITDA 3U4HA 5IXYA 4HBGA 5CG1A 2G5CA 4JP3A 1IUKA 4I9UA 1I36A 3ZWNA 1KOLA 3B6ZA 4IGEA 1B3BA 3S8MA 1YDWA 4KDEA 4ESOA 1DC4A 3GEDA 4GVXA 3A14A 3LC2O 3EUWA 3D5QA 4BIIA 1HT0A 1B16A 3D3EA 3I4FA 2PGDA 4ALMA 3RKRA 1QKIA 4BO8A 3DBHB 3V5NA 2ZB4A 4LSWA 1ZK2A 1RYEA 4PLHA 4J4TA 3KUXA 3AM3A 4DWVA 3A1NA 4ZGWA 1ZZEA 3LT4A 1LRLA 2WEKA 4EUFA 4MP8A 5JDIC 4XX0A 1HL3A 4NFYA 3VH1A 2DPHA 3AU9A 4F6LA 4K9DA 2PZMA 4Z9XA 2NU6A 4P4GA 4CODB 4OJNA 3ZNOA 4GX0A 1F06A 1PZGA 3P2YA 3WFJA 3JQBA 4XGKA 1R4NB 3QWIA 4Z0TA 3T4EA 3IL2A 4FW8A 1N8KA 5FI5A 4LRSB 1N92A 3ZWMA 4BO5A 4CL3A 1ULSA 2NADA 1V35A 3EY4A 2CF6A 1EVJA 2JHFA 4GMGA 1KC3A 2JL1A 3BMOA 1UUFA 4EZBA 2NVUA 1GCUA 3ENNA 5COAA 4CMGA 4LK3A 3E82A 1C0PA 3AK4A 1I2ZA 5KKAA 3GG2A 3EK2A 1E6EA 1PJ2A 1CIVA 1NNUA 3LQFA 1XIVA 4ZQHA 1R4MA 2J3KA 3F3SA 4Q3AA 2W2KA 2XF8A 3GFBA 5B12A 3RKUA 3ASVA 1NHGA 1RM4A 3BTOA 1ISFA 2VHWA 1ZMOA 4ZRMA 3KV3O 4I5DA 3FD8A 5T64A 1OC4A 4J16A 4I1IA 2VYND 3D7LA 1ADCA 5A04A 5BSEA 2Y67A 4WOJA 3RC9A 1XHLA 3DEYX 4MVJF 2Y99A 5L7TA 4WLUA 5I8ZA 4KUEA 4E5YA 4BNLA 4CM9D 4E13A 4K28A 2DC1A 4UUNA 1PS0A 1ZXBA 1I5RA 4CMIA 5IDWA 5KJ6A 1LXCA 1CRWG 3GUCA 3FPCA 3GHHA 3IKVA 1SZJG 1JDJA 1NASA 1WP4A 1PQPA 3EYWA 2X23A 3H3FA 2CUKA 3W8DA 2VHYA 1S7CA 1R4MB 1PQWA 3EVTA 1EK5A 3DDNA 1K6JA 3LT1A 3ZV6A 4N54A 3DBLA 3OIFA 4XQEA 3WICA 4E31A 4MVJD 4M8SA 5CEJA 4W99A 3ETEA 3GH3A 5EINA 3RASA 4DBZA 3RBZA 1ZK4A 3PWSA 3PWKA 3ANMA 4E5NA 3H9EO 2PH3A 4QX6A 3UHAA 1GQ2A 1JQBA 3PIDA 5CDYA 2IDZA 4RQTA 1WZEA 3MJVA 4Z3DA 1QYCA 1YBVA 1A72A 3RUHA 8ADHA 1X0VA 1HLPA 3NAQA 4BNZA 5IG2A 4CV2A 1Z75A 1F0YA 3KSUA 1T1RA 3GRKA 4XEHA 2JCYA 4BKOA 4YRAA 3OECA 4IMPA 3WGYA 2GSDA 3PQFA 1LDMA 3SBOA 2HRZA 5LCXA 3EGOA 3GEMA 2P4QA 3JQBC 4DQVA 1VLLA 3ZU5A 3M1LA 1XLTA 3ADPA 5JXWA 2QHXA 1ML3A 3FHLA 4UEOA 4INAA 3K73O 2WD8A 4OXNA 4DQUA 1NVMB 2OP1A 1MB4A 4FJ2A 5TGDA 5K6AC 2IEBA 3GGOA 1NQTA 2X9NA 1GEEA 4BOYA 1LQTA 2QYSA 3GGPA 3WGHA 3A28A 3L9WA 3JD2A 3ONDA 2DLDA 3U4DA 1SB9A 3IDSA 1JLLA 3BMNA 3P19A 2X5KO 2HU2A 4HFJA 4DC0A 1JAXA 5A3VA 3O03A 4H15A 4X54A 2UDPA 2RCYA 1TI7A 2E6UX 2RHCA 5DDIP 3OJ0A 3IC5A 1ISIA 1UAYA 5KJFA 4TZTA 4YJFA 3BTSA 3LDHA 2Q49A 3A4VA 3INGA 4IIUA 5TNXA 1YXMA 2V6GA 5B4UA 3AFMA 5ENVA 4YA6A 4G65A 4WOKA 4OQYA 4L4SA 4R51A 1HE5A 3UCXA 1Y9AA 4NJMA 3VC7A 3ZU4A 1T24A 4FCCA 2HKIA 5CAEA 3HHPA 4KWHA 1YBMA 5G2OA 1KEUA 4IDCA 4OOEA 2GRAA 4J0FA 3VTZA 3L77A 1HETA 1Y7TA 1MC5A 3JQFA 4HADA 3KYDB 1C1XB 3CE6A 5IN4A 3LC7O 4GBJA 4GWGA 4OQZA 1LC0A 3FR7A 3ZHBA 3PYXA 1UXKA 4RJTA 2QZZA 4II3A 3ICCA 1LI4A 2VN8A 3N7UA 2V6MA 1E3IA 1X14A 5JAZA 1QLJA 3RQSA 3Q3CA 1IPEA 4RDIA 3IUSA 1TA4A 5L51A 1O0SA 1PWXA 1JW9B 3OJEA 4ILKA 5B1YA 3F1KA 1HSOA 3ZV4A 5KIAA 1DXYA 4ZD6A 1CEQA 2V7PA 4E33A 3NDJA 1QRRA 5L4LA 4DIBA 2IXBA 2RH8A 4J9UE 4AFNA 4ZA2A 1MX3A 4B7CA 4BL5A 1U7HA 1I0ZA 2PY6A 4A2CA 2GO1A 1HTBA 2VUTA 2X86A 1BVUA 2EKLA 4DPLA 1MP0A 3H9GA 1R16A 3IUPA 5EN4A 5AXDA 4J2HA 1C1XA 4GH5A 1T26A 3HZZA 1K6IA 3U3XA 1PJ3A 4O0LA 1XGKA 3F4BA 3DO5A 3E5MA 3EW7A 3RFXA 4CR8A 4E21A 2BF7A 3K96A 1Y9EA 4LVUA 3TOXA 1XU9A 4J7CA 3EC7A 1K3TA 4LVCA 1NFQA 1Q7CA 3IQDB 4ND5A 3C8MA 1HE4A 5EIOA 2FOIA 3GZ4A 4LW8A 5KVSA 1XA0A 1DC3A 4QO8A 3S2IA 4BKUA 4PZDA 3RUAA 1U3WA 4A10A 2P5YA 4YB8A 1KERA 3BXXA 1P0CA 3JQGB 3TJRA 4NK4A 1LX6A 3QVTA 3V1TC 4BQRA 3H65A 3C1AA 2OBNA 3TFOA 5ENDA 4DLLA 3BHJA 2NU9A 1R66A 3KVOA 1YWGO 2EKQA 3PQEA 4Z9FA 2QX7A 5JDCC 1J6UA 2SCUA 1ISMA 4BMVA 1CERA 5EMHA 4D44A 2D4AA 4CR7A 1Y81A 1WDKA 2X5JO 4D3FA 4B7UA 3KYBA 2AG5A 3HDHA 4CQMB 1TT5A 5ER6A 4B4OA 3AI2A 4PRLA 3ZWCA 1GPDG 4OXKA 1QYWA 2ZQYA 5HWSA 5G0UA 3H4VA 1GYRA 4GVLA 3PZBA 4CMEA 5L40A 3RU9A 3WQSB 4W6ZA 5CDSA 3INTA 4RZHA 3ZWWA 2ZKLA 4PIVA 1GPJA 1VE9A 2CF5A 1PGPA 1P45A 2W2KB 3ZV5A 3EVNA 1YE3A 4P38A 3TRIA 4OYRA 4Y6PA 5IAAA 1M6HA 3K92A 4UREA 5F5LA 5I7EA 4WLVA 2X4GA 3D5TA 3E1KA 4CM6A 2B69A 4BKRA 3OQ1A 3D1LA 4BB5A 3L6OO 3L4BC 3K5PA 3ANLA 3E9MA 2BFPA 3QW2A 2NM0A 2WYUA 4O5OA 1DIRA 3U49A 2B4QA 2X8LA 2IZ1A 1Y5RA 4MVJG 4PZCA 3T4XA 2Y1GA 2BGMA 1E7YA 1PQUA 4IJVA 4ZQFA 1ZK3A 1R37A 4RPJA 5JO9A 4KUHA 1LDEA 2PLAA 1T25A 1RWBA 3I6QA 5C7LO 1N5DA 2GN9A 2VHVA 4ROSA 4CV0A 1R6DA 3F46A 2WD7B 1QORA 5DT9A 1DRWA 1DPGA 2AW5A 4J1TA 1R4NA 2JJYA 4CQLB 4RVSA 2GUGA 3VKUA 5ITVA 2P9CA 2JFGA 1Q7GA 5U9CA 1YQDA 3G79A 5IZCA 1D4FA 2DQ4A 4KQXA 3Q11A 1PJSA 4OOFA 1IULA 2Q99A 4JROA 1Q0HA 2C07A 4JJGA 3OEWA 3LZ6A 3N58A 3L6EA 2Y0EA 4NBWA 2GR9A 4E0BA 4K26A 4OKNA 3WTCA 4J43A 1B3RA 2JFHA 4AJHA 1W0CA 2PWZA 3ICPA 1MV8A 2D1YA 5A05A 1BMDA 3H7AA 3ZH2A 4L9RA 1ZEMA 5K9ZA 2I76A 3S1LA 2ZYDA 1LNQA 2GPTA 1L7EA 2ET6A 1CYDA 3OETA 1E6WA 1QLHA 3SX2A 4TRNA 2X0IA 1EK6A 3RAJA 1UR5A 1BDBA 1A9YA 2CDCA 2Q4EA 4CLRB 5I9LA 2YZ7A 2Q3EA 5DBFA 3Q2KA 4TQGA 1XSEA 1PSDA 3AY3A 5FWNA 4PLVA 1WVGA 5G0WA 3HJAA 4J1QA 1Y1PA 4L75A 1TB4A 5I7VA 4JJIA 2UV8A 3VVBA 4ZQBA 1HE2A 3CXRA 3F1LA 4O63O 3QWFA 4HNGA 5TT0A 4NMHA 3RFTA 4Y6RA 3AM4A 3WGIA 4PFJA 3DHYA 3MOGA 1NWHA 3AM5A 5ILGA 2E4AA 3WYCA 3F5SA 4P22A 4H16A 1QP8A 4ZVVA 3DR3A 1H6BA 5KCZA 2GN6A 3I9JA 2VZ9A 5HS6A 5CEFA 2Q1UA 2O3UA 2YFQA 1GZ6A 1VKNA 2Q2QA 4J90A 4WASA 1JAYA 1KYQA 4YDRA 1F8FA 3GRPA 1UH5A 2WE7A 3ONFA 5BSGA 1V3UA 5T8KA 3HB5X 1F17A 4W82A 2AQKA 3ZGYA 1TVEA 5LDHA 5JY6A 2OGUA 4AJJA 4RQUA 4QQRA 1ZKMA 4QEDA 2EJWA 1XQ1A 4ND3A 2B4RO 1PX0A 1X7GA 4XIJA 1GAEO 2GYYA 2QQ5A 3DAFA 3VZPA 4PZEA 3NGLA 4JBIA 1S6YA 1AXGA 1FDWA 4E2XA 3VPXA 3OA0A 3LK7A 3W8EA 4G5HA 1N1EA 1T2EA 2BI7A 2DU8A 3DZIA 1DFIA 3CTMA 3ZNQA 4AJIA 4CM8B 1KY5A 3ST7A 3N74A 4E12A 3MTGA 5AYVA 4E32A 2AMFA 1PL6A 3R0IA 4XCVA 5FI3A 2BFMA 3DC2A 3ZWPA 2J5RA 5THKA 1AHIA 4UUPA 4O6VA 2WE8A 3GVXA 2IYPA 1L7DA 2C59A 3PIIA 1BXGB 4OO3A 3RBXA 1M2WA 4MKXA 4ZQEA 4BGIA 4FFPA 1DJQA 4JBHA 1GZ3A 4D45A 3PDJA 4YAIA 3P2OA 4Q3DA 4YT5A 5G0VA 4M49A 5A9RA 2OZPA 1NHWA 3PI7A 1H6CA 5JPIA 5I7SA 2DBRA 2PFGA 2Q1WA 2A92A 4IS2A 5JS6A 4XQCA 4NPCA 3R3JA 3VDQA 3VAZA 5L53A 3GGGA 3I83A 2EJVA 1LSSA 3I9MA 2O3TA 4TRJA 2AE2A 2NV6A 1I33A 3JQ6A 4GKVA 2XAAA 3MWDB 1PR3A 5CFZA 2FY8A 1XWFA 1I30A 3ITKA 1OFGA 4OAQA 3K31A 1PGNA 4MKRA 3RC7A 4Q39A 1X1TA 5IDXA 2Y0CA 1YVEI 1Y8RA 2W8ZA 3OF2A 4OSOA 4O59O 3U62A 4CUKA 2DUUA 3WGOA 5TRTA 5JAMA 5H83A 1MXHA 1UZMA 3W6UA 2GNAA 4Q3CA 4LMPA 1E7SA 3F9IA 1MA0A 3WMWA 3C85A 5JC1A 4XYGA 2ZTUA 1VM6A 5DF1A 3QIVA 3MOIA 1GCOA 1PGJA 2C7VA 5A1TA 3F47A 2D5AA 4AICA 2O4CA 4ND2A 3LT2A 1P74A 4BKPA 3E9NA 1GR0A 2ZB3A 3GG9A 1HDCA 1KS9A 4XR9A 4M54A 4LRTB 3AUUA 2LDBA 3GMDA 3RSHA 4BMNA 2HO5A 8LDHA 1Z73A 3H5RA 2AXQA 1BDMA 3H6KA 4MIEA 1HYHA 4K1LA 3K6JA 9LDTA 4YJHB 1BTOA 3WNQA 3UAGA 1SO8A 3BMCA 2IZ0A 3FTNA 4JK3A 4AVYA 3ZW9A 3ORFA 4R1NA 4M55A 4PLWA 3CZRA 2E82A 3WGGA 3BTUA 2X0RA 1ZSYA 2PZKA 1DFHA 3ONEA 3WFIA 5T73A 3ROMA 2VWGA 4RF2A 1ID1A 4DC1A 1C3VA 1QYVA 2OO5A 4PG8A 3HNPA 3OIGA 2V6BA 4NJMB 1EE9A 2BHLA 1NFFA 3H5NA 4U8GA 3DL2A 3MJ4A 5JSFA 3QJ5A 5CEEA 3S2GA 3UUWA 4WLFA 4G81A 1JTVA 3A9WA 4RO0A 2AEFA 2P68A 4I9HA 4GX1A 1C0LA 1EDOA 3RBVA 2PGLA 3ZZNA 4YYZA 5IXSA 4BNKA 1Y8QA 2EIHA 1ZBQA 1I24A 1M67A 5T8KC 2C82A 3Q6IA 3KYCA 3OICA 4DA9A 3UW3A 4BNWA 4IDAA 4BUCA 5TS3A 5MDHA 3MCVA 3CUKA 5GMOA 2HCTA 4CM1A 2ZYAA 3H9QA 4U5QA 4FFNA 3QSGA 1P1RA 4R3WA 3SJ7A 2Z1MA 4A5OA 4IY1A 4B8WA 3DONA 1Z45A 1ZJZA 2QRKA 4B4WA 5C5IA 1IZ0A 2PZLA 1P1JA 2HUNA 2I6TA 3CH6A 2EERA 4XR4A 1IB6A 3AJRA 3DZHA 1FDUA 1DLIA 3IS3A 3BZUA 3ZWYA 4OGWA 1J49A 3CIFA 2AG8A 3KHUA 2IE0A 1VI2A 4GGPA 3RD5A 1NVTA 2VUSA 2O2YA 1E3SA 2Q4BA 4YT4A 1NPTO 2VTDA 3GPIA 1Y8QB 1KBZA 2Y66A 4CLDA 1Q1NA 1DIBA 2B5VA 2HK9A 4N18A 2ZTMA 4U0KA 3DZBA 3JD0A 4HV4A 1FF9A 3TL3A 2Y68A 4MJLA 5FEUA 3DBRA 3DZGA 5DULA 4ALJA 2AEJA 5MGBA 1MC4A 2W2LA 4Z9YA 1U28A 4JQCA 2H5LA 4RVHA 3WLFA 2H6EA 4IUYA 4WLOA 5EPOA 2FRDA 4HP8A 1AHHA 4HUJA 4JX8A 2EKPA 4NBRA 3ETGA 2QIOA 3I4CA 3C3XA 3RUIA 1R0KA 1E1MA 1KVRA 1X1EA 2C7GA 3K30A 3O26A 1SCUA 4GLOA 3V1UA 4LGVA 5G4KA 4IDGA 2RBEA 1A4IA 3I9LA 3AI3A 2Y1OA 1CDOA 2OBYA 4RV9A 2Y1FA 1EMDA 3FR8A 2VZ8A 4Y6SA 4MVJA 4GL4A 1YKFA 3RU7A 3AI1A 4DPMA 2VWQA 4FDAA 1UXGA 4EUEA 4C7JA 4NHEA 3NDIA 4FGSA 1I3MA 1LC3A 1OAAA 1UAGA 1ZCJA 3OIDA 2A94A 1A71A 4IIVA 4RVFA 4AJOA 1E92A 1R15A 1PS9A 4HFRA 4R69A 2IYOA 3BMQB 1KY4A 1XR3A 5G4LA 3ZW8A 5JLAA 4C4OA 2VNSA 6LDHA 4WCFB 4OHUA 4WNIA 1PWZA 3GK3A 1YB4A 2R00C 1EVIA 2NTJA 1HDYA 3PGXA 4PLGA 1ENYA 2PKRA 1SOWA 1C0IA 3JQ7B 4IDBA 2P9EA 1U3VA 1M76A 3WX0A 2HSDA 3HDQA 3JQDA 4J9VA 4YQZA 3MJCA 5G4KB 2O4UX 1N2SA 1XG5A 2WDZA 1H9AA 4WCDA 2EWMA 5T5QA 3Q9NA 3M1AA 4R1UA 4A73A 1RJWA 2J3HA 4CPDA 2CNBA 2UUPA 1PEDA 4CLXA 1DB3A 5I8WA 4KDFA 3X2FA 3MTJA 5JCJA 1Q0QA 4Q3NA 1XKQA 1B7GO 5A02A 4MINA 2ZATA 3V2HA 3GAFA 4UVDA 3TDKA 2FR1A 1AN9A 2VRBA 3AOEA 2BGKA 2GCGA 5JYEA 2HJRA 3W1VA 3QP9A 4FGWA 1PZHA 3RWBA 1IL0A 3DMYA 4GSKA 2X9GA 1DJNA 1YL5A 1VL0A 2JCXA 1UXHA 2EGHA 3D0OA 3D4NA 1DFGA 1A7KA 3H2ZA 4NQZA 2AQHA 3PFWO 1DIGA 2VRCA 4R01A 1GD1O 1JWBB 5DP1A 5BQFA 1RKXA 2OHXA 4MVJH 3PJDA 1ZO8A 5COBA 3VH4A 1U3UA 4L0QA 1ZH8A 5FFFA 5DCYA 3O8QB 3WOHA 1C0KA 3QHAA 4IINA 4CMBA 4TMFA 5H82A 4J0EA 2W4QA 1QV7A 3TZQA 1FK8A 3I52A 1G6KA 3CMMA 4D3SA 4GAEA 2C0CA 1ZUD1 2O3JA 1C1DA 1F14A 2IEDA 3PPIA 5ICSA 3SVTA 3MZ0A 2FN7A 1O95A 2NTNA 4KZPA 5EQFA 3BMNB 1B8UA 4BV9A 3ZWBA 2O7QA 2X9VA 3I3OA 1P1HA 1YB5A 2CD9A 2HDHA 2UYYA 3SJUA 2YYYA 4OKIA 1E77A 2OOSA 2DM6A 3PGJA 4KOAA 2QRLA 4RZIA 4EUHA 4D43A 2BLLA 1T4BA 1X7HA 3FI9A 1E6UA 3KEQA 4E3ZA 4YJFB 1LLUA 1DHTA 4CJXA 4GWKA 1T2CA 3FN4A 4AG3A 2JAPA 2VHZA 5H81A 1EUCA 2GLXA 3SEFA 4HY3A 4BO4A 3V2GA 3JQ8A 1W8DA 2DUWA 4DBVO 1YDEA 2XOXA 2NQTA 3VPHA 1FDSA 2I99A 4NBUA 4YJGA 2YFHA 3BAZA 4I5FA 4I8XA 2H9IA 3P7MA 4ITUA 1N7HA 3VOSA 1N7GA 4WEOA 4BQPA 4YBZA 4XRGA 4JJFA 2DBQA 1VSVA 3GC6A 2O48X 5IDQA 2IODA 3JYLA 3GR6A 4XQ9A 4IZIA 4LCEA 4CM4B 1HDOA 4I08A 4J6FA 1I3KA 5JBIA 3R1IA 1GY8A 3FNHA 4XRRA 3WWYA 1YONA 3ZU3A 2DAPA 4L4XA 2EP5A 1U4OA 2G1UA 3VHRA 4A7PA 3Q9UA 1Q7BA 4UUMA 3OFSA 4XYBA 3RFVA 1NP3A 3OJOA 3QVOA 1LQUA 3M6IA 3OQ6A 4F6CA 4R4JA 3WB9A 3L9XA 2X0NA 1ENPA 1EUDA 4XD2A 4JNKA 1RPNA 5L7WA 1YQXA 5AQ1A 3E9QA 1NQ5A 3DHEA 3RI3A 3SLGA 5KVQA 4TROA 1EVYA 4E4YA 3WBFA 4CUZA 2XXBA 4FFMA 2Q2WA 3B20A 4EW6A 2CY0A 3PQDA 3S2FA 4XJTA 3O9ZA 1SEPA 2PH5A 4F3YA 3PHJA 1CETA 2C20A 1ZW1A 3X2EA 5COQA 1NPDA 4M1QA 4BNTA 2B5WA 3EZYA 4U6SA 2NNLD 3WNVA 1AGNA 4ZU3A 5DBIA 2ILTA 5HRUA 1I3LA 3F6YA 4YAKA 1VL6A 3UXYA 4ONEA 1HE3A 1PJ4A 1YH3A 2NWQA 2P91A 2A9FA 3B70A 3RVDA 1MGOA 4F45A 1VJ1A 3Q0EA 1PL8A 3RUEA 4Q9NA 3E6AA 4CR6A 4E5KA 1X0XA 3EDMA 3KXDA 2PK3A 3IJPA 1G1AA 1JA9A 3LF1A 3PTZA 4R16A 4LN1A 4RF3A 5JC8A 5KWEA 1ZIDA 4CMKA 3CKYA 1ZSVA 3KOUA 5FYDA 4BO3A 3JD3A 1BWSA 2PD3A 5DZSA 1EQ2A 4OMUA 3L4SO 1FMCA 3TZKA 3CZMA 3HN2A 3NTRA 2VWHA 3G17A 3HFGA 5B4TA 3NT2A 2C5EA 4CL8A 5A3JA 4BNVA 3PHIA 4DGSA 3GPDG 5ILOA 3ETDA 4PVCA 1JN0A 1ENZA 2V65A 4Z0PA 3MEQA 3GT0A 3OMLA 3VH2A 5A9SB 4J4BA 1VRWA 1P9LA 1LLCA 3ZI0A 2NU7A 1LDYA 3WXBA 3PWZA 5DCUA 5AXCA 3RUFA 4UVEA 4RDHA 3JYNA 4FJ1A 2IZZA 4MVJE 5TIIA 4NK5A 1J4AA 4NDNE 4CM7A 3C1OA 4Y98A 1IZ9A 5TJHA 4BNIA 3PLNA 1GUFA 1ZEJA 4NZ9A 3MJSA 4BGUA 2WTBA 4BO6A 2R6JA 4BO9A 2P9GA 1GEGA 3FBTA 2Y93A 1M75A 1QV6A 2GN8A 1Y5MA 4FFLA 3AFNA 2TMGA 1LDGA 3RJ9A 2GGSA 3QE3A 1GV0A 4I5EA 2PV7A 5LDGA 1SAYA 2O50A 1K2WA 1QYDA 1LTHR 1E1NA 1RM0A 1LEHA 3DZKA 3PXXA 1KVSA 3OA2A 2BRUA 3RUDA 2CVZA 5TLSA 2ZCVA 2J8ZA 1U7TA 1I01A 4WK6A 3B1FA 3NGXA 4XGNA 3RJ5A 5JO0A 1ZNQO 1PL7A 1GFSA 2BD0A 1N9GA 1A7AA 4JCOA 5K0ZA 3TN7A 4K6FA 1CJCA 3DWFA 3JQ9A 1EVZA 5ITWA 1Q2XA 2X6TA 4N5MA 4BS9A 2FP4A 3G3EA 4FBGA 2GZ3A 3F4LA 3C7AA 4U6QA 3OJLA 5BR7A 4A03A 1H0KA 4ALLA 2JD2A 1A9ZA 3VPSA 4RGBA 2J5QA 2AHRA 4P4NA 3GVPA 3CEAA 1RM3A 3HQ4O 1WAMA 2RIRA 2HMWA 3PJEA 4D7AA 3JYOA 1LDBA 2WSBA 4RF5A 4YRDA 2E37A 3NT5A 1RM5A 3QV1A 1LRKA 2FR0A 4G2NA 4DL9A 1E1LA 1HDZA 2HMSA 2VOEA 4N5LA 1N9GB 1Z7EA 5B37A 3NTQA 1E7MA 3E18A 2UVDA 4LISA 4RPHA 3BIOA 1MG0A 3GUYA 2NVWA 2LDXA 3KETA 3VTFA 3E8XA 4YT8A 1NPYA 4MVJP 2VQ3A 4BNMA 2BI8A 5TT1A 4LMRA 1CQIA 1C1DB 1U9JA 3E5RA 4NFHA 3UF0A 4Z6KA 1BRMA 2JKVA 2BMAA 1H5QA 4IJKA 5DNAA 2NVUB 4IDFA 1XYGA 2C5AA 2NLOA 4HXYA 4E30A 5JMWA 1KIFA 2VYVA 2YQ5A 5IN5A 4OXYA 2CDBA 4EYEA 3JQAD 4WJZA 2ZQZA 4E2WA 4XYEA 5JDIA 4BNJA 5GZ6A 4NR0A 4P4LA 4J4HA 4NFSA 1K89A 2Y05A 3LYLA 1PJQA 4PG6A 1EZ4A 1JVBA 3LF2A 4XYMA 5J23A 4CQMD 2OMEA 5HA5A 4UEJA 3STHA 4R9RA 2AE1A 1U5CA 4GX2A 2HJSA 1LSOA 3I9OA 3W6ZA 4NBVA 4JIGA 3RC2A 2WWRA 5EL0A 1OI7A 4L76A 1PGQA 5TJ9A 1E5QA 4BNYA 1I2CA 4IDEA 3TF5A 2YDYA 5TC4A 4AJLA 3GA0A 3MWEB 1NR7A 3DAPA 3I1JA 5C37A 1J0XO 1LA2A 3JD1A 1PIWA 1W6UA 1GQYA 2VT3A 1YOVA 2VZ0A 4UUOA 3NYWA 3IAHA 3CMCO 2EGGA 1DBVO 1NBOA 2PD4A 2DTEA 3ROQA 4BO0A 1GU7A 2EP7A 1ISJA 2UUOA 3GQVA 3VZSA 1LDNA 4E5MA 4FQ8A 4S1VA 4YEDA 3UCFA 1LSJA 4EI2A 3GVIA 3OM9A 4UVGA 2HK7A 3TOZA 3WS7A 4R68A 4H3VA 1Z7BA 1ZJYA 3QWAA 1SNYA 1GQQA 1XCBA 2UAGA 5F3RA 3GZNB 1NAIA 4PVDA 3AOGA 2VHXA 3OQBA 1BXZA 2BFAA 3JYPA 3TSCA 3V8BA 3DFUA 3HDYA 4J1NA 4QECA 4A27A 5JNLA 4XGIA 4YJHA 9LDBA 2VYVD 3D4OA 1Z82A 2ZYGA 5U1PA 4J1SA 3AU8A 5I9NA 3OJFA 1O9BA 4D41A 1E0DA 4YAJA 5LC1A 5JYDA 3FNFA 3H2SA 3D3WB 1PZFA 4YR9A 3NUGA 2I5PO 1V9LA 3QVWA 4Q3EA 5HS4A 2DT5A 3JSAA 2ZIZA 3DB2A 5JDCA 2HK8A 3DZFA 5DOZA 4FIZA 4WPGA 4CLOA 1QR6A 4FFOA 1NFRA 2B83A 2CMDA 3GDFA 2FPPA 3DHNA 5ICMA 1IHXA 2NVBA 2C2XA 4B4VA 4E5PA 3KSDO 1ISGA 1PJBA 2FHSA 4XDYA 5F1KA 1EBFA 3KRTA 1NTOA 2GZ2A 3F5QA 5GY7A 4CM4A 2CVQA 1UJMA 4RL6A 1GTMA 2EF1A 4XQGA 4QFDA 1B15A 1R0SA 3UGKA 4DYDA 3GDGA 4Y9DA 3D3WA 2O3SA 3FBGA 3L4BA 3LLVA 4OL9A 1SC6A 5G0SA 1LRJA 2VOJA 3K8ZA 4MP6A 2Z5LA 4EEXA 1YQGA 4IPTA 3GN2A 4DXHA 3ZNNA 1KVQA 3VPFA 3GVHA 1Y6JA 3Q1LA 1IPFA 2RAFA 3PHGA 4NI5A 3IMFA
chains in the Genus database with same CATH superfamily
3T7AA 5IKXA 3A3YA 3CCBA 1RMQA 5CB6A 5KVVA 1G9XA 2GWRA 1QWSA 1FDOA 1U65A 2FPKA 4YCCA 1R12A 4F2GA 2EKDA 5L6LB 1E5LA 3ACCA 5BT8A 3KSMA 1JHVA 2Q50A 1X38A 3PUYA 1UODA 1XRRA 3V7UA 4PX2A 4LZAA 1Q91A 2AD1A 2HHLA 4LJ7A 1BA2A 1RU3A 2D3TA 4JLWA 4LY9A 1KFBB 3KKNA 4PYNA 4EGJA 1X39A 3B89A 5AHKA 1BNCA 3SIRA 1XHEA 4JKOA 3GCGA 4DQXA 4OHYA 1M7BA 3M6AA 1N2JA 3EG5A 3EZGA 4U7WA 2OAGA 4UAGA 2BV3A 2ERCA 3CH4B 3FOCA 1J2JA 3ZWOA 1KO5A 3ENWA 5BN5A 3KLMX 4JXXA 3BPSA 4CKBA 4XFDA 1LVUA 2PL5A 1BQEA 3NV9A 3PJGA 3UJPA 1W1WA 2ZYHA 4BE9A 1NBMA 3MUOA 2AZ4A 1GQRA 1Y6GA 1N1GA 5ANRB 4LYJA 4BLWA 1V37A 2WJYA 3NGMA 4L4RA 5G53C 1GNRA 5AT1A 4DSNA 2FOLA 3K0FB 2ADMA 3PHHA 3R0VA 1JAIA 3DBVO 3HYLA 1DOHA 4Q4HB 5A5EA 1H0HA 1X80B 3SEQA 1WB9A 2IDKA 3UHPA 3AVOA 4URZR 3MRTA 3F5MA 5CCBA 1ZQ1A 3F8SA 4G0WA 3BT7A 3PK0A 4LWPA 4TKLA 4EJMA 4RZ3A 3KU1A 4OGFA 4B82A 4CETA 4WXRA 3LVFO 3OHSX 4D5EA 4AURA 3DVSX 1TGYA 1PQ4A 1WZIA 2D0IA 2GK4A 3ZX5A 1P7PA 1PDWA 3IIEA 2IZ5A 2MYTA 2BDUA 3HR4A 3TX6A 3ZPXA 3OI7A 3U5ZB 4QUHA 4KG7A 4YR7A 5L3QB 4X00A 2I55A 4MTCA 5IFKA 3WGQA 5KOIA 4LZNA 3H5IA 1SOVA 1UIRA 2QB5A 1P44A 3GJ6A 4UZEA 4XPIA 4DNXA 1AKRA 1YCGA 2C29D 1HKHA 2PUVA 1WM1A 1ZAYA 4B45A 5EPEA 1UZLA 2P1ZA 1FFXA 3U31A 1HYEA 2HCBA 3SOPA 3UJCA 3RC1A 1GZ5A 1OLSA 2EFJA 1PLLA 3RT9A 3FNGA 3TRKA 2PL1A 1O6ZA 1Y82A 3AKEA 3BH0A 3IP5A 3V80A 1V3VA 1UKYA 1E9FA 1FUIA 3EHEA 2JIBA 3GNTA 3L18A 4O2BB 4A6EA 3L40A 4HLUC 2CN1A 4MS4B 2V0CA 1WDTA 1ECLA 4LXIA 3U7JA 1S5PA 4CTJA 1KP9A 4AJEA 2FZEA 4HYYA 4DNQA 1UINA 1T1JA 2RHMA 4P1ZA 1HY3A 5GTDA 1PD1A 4C04A 4BB6A 3SJCA 1DXQA 1JB1A 2ZYSA 3PJFA 2KB0A 1V26A 3DTVD 3HB4X 4YAEA 4XLZA 3PD7A 3ML1A 3DMTA 1IBSA 3B1ZA 3Q3VA 1IY8A 3FSRA 4QVIA 2XTMA 4Y6GB 4EHNA 1DIHA 2V7WA 4WKNA 1E7RA 4NVRA 1U8AA 4XB2A 1OA1A 4GLLA 3SVZA 1I32A 3ZH9B 1FU8A 4LE1A 2IXGA 1E1CB 4A0HA 1DG9A 4GR5A 2YC2C 4HAVA 1C7QA 3ESAA 4C7XA 1PG5A 4S12A 4DE5A 1QTIA 2I6QA 4REOA 1JE0A 2RC5A 1L4KA 3QEMA 4KR0A 4US1R 1T2FA 3LA6A 3LGSA 2OQVA 3SC2B 3NVAA 2F8MA 1MOZA 1UM8A 1I51A 4UBMA 1XQWA 1YO6A 2WI8A 1VJRA 3EEIA 3G5UA 4H17A 3WRXA 4R1TA 4CUJA 1I10A 5DLQC 2RGNA 3AVWA 1W52X 1X1DA 3BMQA 2INGX 3ILVA 4NH4A 5ALSA 4MYHA 4R54A 3TTTA 4W5HA 4BP8A 2LWIA 1R74A 3AETA 1YUMA 5IH7A 1JEQB 4DNPA 3RAPR 1DRJA 3DTNA 4RVCA 4XB1A 1I6WA 1KJWA 1IEWA 1UK6A 2GPYA 3WLIA 4DSZA 1SXJD 3E9ZA 2H59A 1NIPA 2GCEA 1U8UA 3V3KA 3H9JA 5J4YA 3C43A 3EP9B 5F5XA 3HUTA 3L0CA 1YOVB 1IUPA 3GBPA 3KB1A 3OE4A 2WAXA 4E2ZA 5KYYB 3AJ9A 1RWVA 3TEFA 5JYAA 2WMNB 3U6BA 4RIHA 3GDOA 4KFCA 3ZZUA 1ATIA 1T9BA 5EE0A 1E8MA 1DAFA 2I67A 1OCEA 4MVYA 3DMNA 1G5PA 4U9IS 4KQMA 1Y0BA 4ZT7A 5B53A 4BN0A 1P60A 2G28A 4BO2A 1ODTC 4BFXA 1CQPA 4YASA 4BMZA 3PD1A 3U61B 3DOOA 3IVRA 3N70A 5EI5A 5CFPA 1JIIA 3BA1A 2Z5FA 4ZEVA 2HAEA 3BB1A 3L1VA 2AOVA 2HIMA 1DO2A 5IAGA 1FXWF 4LRXA 3OQMA 4JYZA 4FN4A 2BZGA 1RRPA 3ESDA 3CVOA 2F1IA 3VSBA 3WBKA 1GG8A 4B32A 3ZVNA 3EP8B 1A8PA 2XAUA 3MBIA 5EKDA 3WLTA 3SQMA 3C7DB 1SXJA 5JD4A 4P3NA 1OGJA 3ELWA 3AIKA 5A2GA 1E9CA 1ZHOA 3RM3A 1XMOB 1WO8A 2BJWA 1WZUA 2G7ZA 4NEGA 3DO6A 2G7MC 3B7PA 1RWWA 4TWAA 2H8GA 5BQPA 1Z2EA 3HUDA 2BEUB 2YBEA 2GYWA 3ZUPA 4B46A 3L7LA 3GLTA 3LDAA 4QU5A 4B3BA 5FQNA 2IYRA 4L85A 1TUGA 4BO7A 3WRYA 4XGQA 4L16A 5BUCA 3GT7A 2WJIA 4LGMA 3HFSA 4I4TF 3VH3A 2HADA 1FFGA 2WYVA 3N0WA 4LOKA 4NU6A 3H1AA 2EATA 2J5KA 2WU8A 3DEFA 5ER9A 5LQSA 2JAUA 1YA8A 2G3YA 3VGPA 2Q22A 1DEXA 2ANBA 2BCJQ 3NBKA 4MPDA 4DC9A 4AZ0A 3Q41A 3JPYA 4HEA1 3ZU2A 4EFLA 4B40A 2BLNA 2A0FA 1J0CA 1TFUA 4D99A 1ACLA 1R6VA 4GMHA 4HEA6 1NBAA 2GPJA 3MTEA 4LJSA 4XDGA 2F1OA 4TLDA 3UM9A 2JD1A 1DX4A 1KU6A 4GHWA 2Q46A 1GGJA 5AUPB 5JW6A 1T6XA 3UMVA 3QNWA 4LC9A 3T0FA 1USGA 4BRSA 3RS9A 5AW3A 4M0PA 1W96A 3FKSD 4CKZA 3NNNA 1TECE 1ADFA 3OLQA 5EKUA 4DYVA 1AGRA 3UAZA 5BN4A 5EJEA 1BQ4A 5CVVA 1HI9A 1O94D 1MT3A 3A4IA 5TXGA 3SZOA 1OYOA 4HNRA 4YO7A 5AW6A 1F51E 3AWDA 1A9RA 1QPBA 3FF4A 3AHCA 2ZGVA 3KVYA 5DP2A 4QL3A 3H86A 1N3IA 2P3SA 1TT7A 1NX6A 3CF0A 4WGGA 3BEOA 2A3NA 2NW6A 1H3FA 4TYYA 2XYRA 1T2DA 3U9LA 5M6DA 1SIOA 1FP4B 2SBTA 4R7TA 4F91B 1HO3A 4EW3A 3QNMA 4RPGA 2ZUBA 1UZUA 3RANA 3VYRB 1KSJA 2P2NA 5KWIA 3R3HA 5KNLA 4CCYA 3I6MA 5L3RA 3HB1A 2A0KA 2XXAB 4MW6A 5A71A 3TQTA 1RBYA 4DDHA 3R09A 1P2VA 2VDVE 3EVCA 3GGJA 3KOYA 3NAGA 1UJNA 3C7CB 3WBBA 3L0OA 2N1BA 5FOXA 4EHFA 4F4FA 3JD4A 3UO8B 4EPYA 1DC5A 1ZK1A 4BZPA 3SE7A 1XCJA 4I9GA 4J7UA 3HU3A 3NWJA 3L6UA 4JDPA 5C7OO 3GZJA 3MIZA 5CNJA 2JJ8A 2CHGA 2RGCA 2V5AA 3EZ9A 3PFCA 5CAEB 1Q21A 2A33A 2NVOA 2QR5A 3CLKA 2J07A 4ZO8A 2ZRMA 3UAWA 1HQCA 3USES 1WVIA 1NI4A 2POQX 3HDVA 2YY7A 3H3JA 3B2NA 3MM4A 3L8FA 4H7DA 4RD3A 1DEHA 4L8LA 2VHTA 4K9SA 1T2NA 4NZOA 2P9FA 3BHMA 3N2IA 5KJEA 1JU9A 1D6NA 3HHEA 2O8VA 3R7DA 3WSWA 3P5BA 4OQDA 1PT8A 4KOEC 4M76B 1BHSA 2YYAA 4DOMA 3WMXA 3ZWQA 2VF4X 1HRDA 1OIVA 3O90A 2X7HA 4ME6A 3T3EA 1W0KD 2XJ9A 4RJKA 1SXPA 1AXEA 3HK2A 1BFKA 3FZNA 3M4XA 1UKZA 5EMMA 2D5CA 4R84A 3MRXA 1IOVA 1ADBA 3BFPA 1NQOA 1DV2A 4U39A 1RXYA 2QD3A 4B7XA 2O2SA 4I1UA 4MP3A 2WR8A 1ISPA 1DIAA 2G83A 2GA8A 1PZEA 3N39C 4O1HA 3JQ8B 2B4KA 2ZUTA 1DT3A 4RPLA 3GRAA 3JAKA 2VYNA 3LUJA 2IUUA 1N0UA 5JNSA 2GCIA 5AW7A 4JYPA 4D9IA 3C1UA 3OOHA 4B44A 2I6UA 2J31A 1CUWA 3N0RA 1VCIA 3TZBA 5BWBA 1MV5A 1HX7A 2BDTA 1PG0A 4JLNA 1DVRA 1REQB 2FFBA 1YU6A 2H06A 2H5IA 4WK2B 3SKXA 4AJ9A 1NBME 4LSMA 1GGMA 1MJGM 1QDLB 1SPXA 1V7CA 2HA0A 3A4YA 1FYVA 3C5WP 3EYAA 4L73A 3PXGA 3ZWDA 4DVJA 4DKJA 1P3DA 1Q1EA 3PU6A 1L7XA 4GOJA 5ALGA 4HSGA 3TZCA 2O05A 3PP8A 1A8IA 3QBVA 4I4NA 3IP1A 3L8DA 4JGBA 2IHKA 1FXSA 1SXGA 1CHDA 4F6RA 4D4JA 3L4EA 2IDMA 3PC4A 2GS9A 3NTOA 1QS0B 3S0JA 5BUZA 1NXQA 5IHXA 2WSSA 5IUNC 3CONA 3H42B 2IIBA 5EMLA 3AY6A 4FFWA 3WYNA 3W2EA 1QFJA 5BW6B 4CXMA 3I23A 4PC7A 2HYIC 1JMKC 3DTVB 5CDFA 2G08A 2QTBA 4AUEA 2R6DA 1JKFA 2I4RA 5KJCA 1B2LA 1O6CA 3QBTA 5I5EA 2R5FA 1GZVA 1M83A 3G9XA 4QOJA 1YK0A 2PUTA 3ZWKA 2QG4A 4OXXA 3E8SA 4FSDA 5MGNA 5LKRA 4MKHA 1OVGA 4PLZA 3R2JA 3IHLA 2QNBA 3V8MA 1U8XX 3K2IA 3WTBA 2I91A 1XK6A 4DRYA 3VDMA 3T95A 4I9FA 2VNAA 2PVCA 4II2A 4CNQA 1YFJA 1AQLA 5K0BA 2PXCA 3ZBTA 3E7WA 2RG1A 1ZDMA 4ZCMA 3CGGA 5CT9A 5ALHA 3OBBA 4IM7A 3D64A 1N2HA 4KFTA 1QQ5A 3REFA 2W2LD 5MN4A 3CGWA 1SA0A 2RK6A 2GEDA 4K9KA 1SMKA 1GNSA 1KAQA 2VBFA 4Z5XA 2CLCX 3AJ8A 5HTOA 3D4IA 3P9YA 2R7AA 3M6LA 3V97A 1J97A 3HU2A 4L9WA 3V8RA 1R0LA 1XD2A 2G4LA 1DDOA 3FUXA 4F3TA 2BE7A 3AUAA 2J4DA 1MG5A 4BE7B 1VL2A 1LJ8A 2HPZA 2MR5A 2FW8A 1OBCA 2FMUA 1SRQA 3GLVA 1XNGA 4R1QA 2FN3A 2ODTX 1UDBA 2NZXA 2P9YA 1FS4A 2BFOA 2VDUE 1O8CA 5F35A 2P9HA 4HXEB 1VBFA 4LV5B 4J91A 5HBGA 4LBYA 2P9QA 2HT1A 4DCPA 2HIAA 3R6DA 1NOKA 1CUVA 1G17A 5HZGA 5EJ5A 2FZKA 1JEEA 2P78A 2Q6OA 5AK5A 2H9AA 2OC4A 3ZKAA 1K7CA 1KC1A 1GTL1 1FDVA 1HEUA 5CH3A 3QY9A 3PUVA 4Y8VA 4F2DA 3EWSA 5KNCA 2XE7A 4F5ZA 3ZCQA 3UKDA 4GQAA 3BSYA 3QLUA 3R7SA 3EXHC 2Z1NA 3DV2A 4Z0HO 2UVPA 3G1UA 3GLQA 4RZUA 4Q00A 4GLFA 4RIGA 1Q0LA 3PRJA 1P9NA 3I04M 3HEMA 3D8RA 4MUXA 3N8GA 4R9NA 1KPIA 1Z2DA 3A9CA 4FOOA 1U2DA 1CQJB 2JKYA 3LL7A 4IXMA 4YPOA 4Z3KA 2Q8NA 3NEJA 1BG6A 2FSSA 2FMIA 3ON5A 2IHYA 4CKWB 3DXFA 2CLHB 2OHJA 4J1TC 1V1MB 2Q6VA 2QT0A 1DEAA 4OIFA 2YV4A 3WYAA 3HLKA 4LQDA 2DE0X 3NIWA 1NUHA 4CQMA 4HAYA 4N3BA 2BELA 3EQ8A 3BRCA 1GVHA 3P26A 4WUVA 4F3NA 3TMAA 3GFSA 4P3XA 4CMIB 5AKYA 2WQ7A 5LP6F 4QLAA 5B1SA 4BWYA 2XDAA 2XGSA 3L7YA 4K8OA 4AIRA 2NSYA 1PJRA 3IBSA 3ET4A 3R6GA 4PWYA 5F1OA 1X8XA 3I3SR 4N3GA 2YV2A 2QLBA 3UJBA 4IMRA 1QIKA 4OM8A 2J3LA 3A31A 2JIZD 3R5FA 3GJQA 2V4UA 1IM5A 4OK6A 2D74A 3SDSA 2EC5A 2XPCA 5GJVC 3DMTC 3V4LA 4I36A 4ZVMA 1WZ2A 3BCHA 5IC4A 1JPUA 1I7PA 2VDWB 3L7IA 2A35A 4Z4EA 2ZRQA 1GGHA 1Z6ZA 4G97A 2B0JA 5C1BA 3L79A 3E1SA 3IA7A 3TM5A 4JZYA 1CNEA 1LBTA 3MD9A 4QJIA 1BW9B 2ZI9A 1G66A 1N3BA 4PG5A 4AJKA 3OCYA 3OOWA 1DBIA 3CZPA 1CWUA 1US8A 3LHKA 1BS1A 4F71A 1KVTA 3F97A 1G0NA 3H6GA 5DW0A 1YGYA 1DLJA 1RW4A 2D8AA 1DAOA 2UUCB 3L1UA 3HXLA 3QKUA 1J0AA 3FWPA 2BTEA 1BD4A 2LKDA 1B8PA 1SBYA 4B6OA 3RYCA 3GJSA 3NLLA 1RRVA 1G7SA 1XLTC 2FPGA 4HBZA 4JLDA 3KT8A 3TPCA 3I72A 6ADHA 5ENZA 3EXG1 1F2TA 3A6EA 3O1IC 1GDHA 1SG9A 4MUNA 4CV1A 1ULBA 4GOLD 2Q8QA 2O3QA 3INYA 4KWIA 1W5AA 4L8YA 4YXFA 4DR1B 4S24A 4WLEA 2QPLA 4AY6A 1C9EA 2EFGA 2OHOA 3A9UA 5HQJA 2B78A 3RYTC 3IUQA 4H6PA 4HGRA 1OB5A 3BUSA 2DKNA 2WHYA 3ANNA 3IQHX 2X3YA 4AMBA 1JDUA 3RCBA 3H8VA 3E27A 3IQXA 4XDZA 3X43A 3Q8KA 1BHQ1 2WJPA 1M2OA 1LBEA 5DX0A 2WZBA 1NZFA 2JLUA 3BJMA 1YCHA 2WT9A 3ZCVA 2CE7A 4TQUS 2X8JA 2WIFA 2WT8A 4RS3A 3OAAD 3GEHA 5K0SA 4PGMA 4QXMA 3I6IA 4CT5A 1YFLA 4FMPA 1LPBB 5JQGB 2PU5A 4YALA 2DFDA 2RHBA 3H1PA 1Y8ZA 3NTVA 2EZ8A 1MO2A 5JCOA 1FNMA 5JROA 2PBZA 4HNUA 1G0OA 2FZVA 2P4HX 2VRWA 1OBFO 4D98A 1IUOA 5BSFA 3HH8A 4QG7A 4MUJA 4QTZA 4AJ1A 4DB2A 2IEGA 4YVFA 1EEHA 1ZNWA 5DYNA 1VXOA 3G9TA 2XMRA 2QN8A 4LYAA 1N7JA 1LFDB 4AJPA 1CJSA 4K6OA 3W1WA 4MLDA 3E48A 1Z6TA 3HEAA 2Q2NA 1Z18A 4PHGA 1CSEE 1T4DA 4EARA 1VKZA 3SFZA 3L84A 4CLRA 1E3DA 3BQMB 1UDXA 1XUOA 1ORWA 4HAXA 1A9TA 1KEWA 3JALA 5LOVF 5KS2A 2VHJA 4KQJA 5A7HA 4EJSB 1MJGA 3TSYA 4OI0A 1VL5A 3HNRA 3LFHA 4PW0A 3IDQA 3VTKA 2G6BA 5K1ZA 1XXHE 3IJRA 1BXGA 1RRKA 5AVWA 4J8PA 5DI3B 5LDDC 3ZXUB 2AI3A 2LRHA 4PLTA 2CVFA 4FB5A 2WUVA 1YS6A 2H63A 3QRWA 4ID3A 2O7SA 1FX0B 5I7FA 3PDIB 2QLLA 1X8KA 5JFTA 1ORHA 2E21A 5CDUA 4PBSA 5IHPA 4YLYA 2OBMA 2H29A 3E0QA 3V55A 4WY2A 3AZQA 1RXWA 3PDUA 3DZ6B 3EGVA 1QZ3A 2B1IA 3VUEA 5L4NA 4YV0A 3G68A 1WWKA 3QVUA 1GKLA 2D06A 5FO0A 4R2HA 3W6NA 2VSYA 3O38A 1HLDA 1V6AA 2P62A 1QH1A 1AS2A 2V3VA 1MDFA 2Y2VA 2J67A 2AUTA 3PQ5A 4NOMA 3EMKA 5DLYA 3UN1A 1E3JA 1IOLA 3O2NA 4NU5A 4QVGA 1IN6A 3D7KA 1LSUA 5GJCA 1IBLB 2RBGA 1FQWA 3AVQA 3NHZA 4XIYA 3Q8LA 1EWQA 3ENKA 4C1NA 1IHYA 1MH1A 1T4CB 3BHIA 3HR7A 3KLPX 3LJKA 1Z3IX 3HU5A 4PLYA 1E20A 3STYA 2NTVA 4J49A 3IX7A 1D5WA 1YUBA 1EJ2A 2V9ZA 5ISMA 3GVCA 4FYVA 4YRJA 4BKQA 3SF0A 4UVHA 1K63A 1BCRB 3UXMA 1VJTA 1ZU4A 2HPVA 4DA8A 2NZJA 2F8TA 1A27A 5UKDA 1SA0B 2NXNA 4G3XA 2NUAA 2W8BA 1E61A 2WNSA 3CSDA 1WKBA 3N2GB 1IMJA 5EMKA 1O89A 2EFCB 5AXAA 5FWYB 4D79A 3NEYA 3CEMA 5HFJA 3V4PB 3YASA 3HTXA 4JQZA 3M49A 1NSYA 3I5UA 4XCQA 4MB2A 2X0JA 4PX9A 4UAVA 3VPDA 1AKVA 2YHIA 1JSRA 2YMLA 2B35A 3CUEF 4IIDA 5JZBA 1SBTA 3V1YA 3H5AA 3WG9A 3K0HA 2A4KA 3KYDA 4YAGA 3H2IA 3IUBA 4DMFA 3DZJA 1IY9A 3GIDA 2B99A 2H1FA 4JFRA 3CH5A 4W5RA 4AY5A 3QEMB 4ZALA 4DADA 2XNDD 1WQ3A 4DF3A 4FPXA 1KXJA 4IJWA 3BMCB 3A04A 3E2PA 1JFFB 1YB1A 4OHPA 3HZRA 3WLPA 3DMFA 1WHSA 1NWCA 1T5OA 4HVCA 4C7OB 4CG0A 3HSKA 3GMSA 5EWMA 1WXGA 1XN1A 2ZR0A 3H2YA 2QRHA 3VZQA 3ZWVA 4EHAA 5BR4A 3DXYA 5DXAA 3NCTA 4WWHA 5CHEA 4D9GA 3MMPA 4PPQA 4DTIA 5CU7A 1EFLA 3H8JA 3VOTA 2XGOA 2OZLA 3N8IA 5T6MA 2WJVA 1HEIA 1Y3HA 2OXTA 4BQEA 3ADBA 1X1BA 3V3TA 1MJHA 2ZSEA 4I1SA 3HY4A 2IPNA 5JVDB 3LHSA 1EE1A 2X5NA 1TVCA 5AVSA 4FFRA 1W87A 5EERA 2ZJFA 2DQZA 2AB0A 2JJ2A 3RABA 1RBQA 4D0RA 3U60B 1Z6XA 4X84A 2C58A 3U4HA 4NYMQ 421PA 1ZJJA 3VR2D 1H8HD 4IWXA 1FP2A 2W2VA 4LJ4A 3GYGA 5T41A 4R3UC 3TPZA 3K4PA 3T61A 2FCAA 4D0LB 4EY5A 5GWXA 3EGWA 4AU1A 1I36A 5F3DA 1AIPA 3CCFA 4FUTA 3KALA 1N1MA 3S8MA 4C0WA 5JARA 3Q8MA 3AVYA 4KDEA 4FMCB 3I32A 2GBFA 1JKMA 1XZMA 1P39A 2JA2A 2CJYA 2O0KA 2PYZA 4URVR 1U9ZA 1TU4A 2XUQA 3UQYS 4BO8A 2ZB4A 3QU7A 3F5QA 4MR7A 2I71A 1SUFA 3HS3A 2FQ1A 1UJCA 5EMJA 4RTSA 4JXZA 1CE8B 5FUBA 3OTHA 3L8CA 3OEHD 4AWAA 2W0SA 1ULHA 3LT4A 2XI4A 2VK8A 2QSYA 2QMHA 2VYFA 2ZJ4A 4Y1RA 2BR4A 2E6KA 3UFXB 1EAYA 2I7VA 3VJLA 5F7JA 1T6ZA 4XIGS 4MYUA 5HR5A 3VNQA 5SYAA 2YJNA 4PSAA 4Z9XA 1QX3A 4A8JB 1A5SB 4EELA 2TMYA 5JZVA 1CZOA 1F06A 1HYBA 1SCAA 2UZAA 3O8NA 3KZOA 2IYYA 5LJLA 1D03A 3IKJA 1R4NB 3JZIA 1TYCA 4RMGA 5FI5A 4LRSB 2VT6A 1ACMA 2WWGA 3IXQA 5BO5A 4BO5A 1HFEL 1ULSA 2J4CA 2PWPA 1U2TA 1V35A 3EY4A 2CF6A 2PTHA 1R00A 2G0AA 1IN8A 3U17A 1NQWA 3KTFA 1NF2A 4B3FX 2I8CA 1GCUA 4L08A 4DY4A 4TUYA 3GLHB 3GG2A 5C4IA 4EGQA 3EK2A 4X6UA 1O7JA 1CIVA 5CT6A 3SLRA 4IG9A 1L8XA 1V45E 1OX6A 2J3KA 4Q3AA 1SKMA 1RYMA 3WADA 3SWWA 1U3CA 1ZZGA 2V6JA 2ZYIA 3ASVA 4UOZA 4XJVA 3EF3A 1RM4A 1MTOA 1KMNA 4FMCF 1U99A 1YFZA 3D43A 5CMLA 5KYXB 1N5KA 1CUCA 5C80A 1LJUA 3KGDA 1U2SA 1XVAA 1PZXA 1NVVR 2AYYA 2OC9A 2Y67A 3ES9A 3LWDA 3MMZA 3OHPA 3UK2A 2A86A 1XHLA 5L7TA 4MVJF 2Y99A 3FOAA 4WLUA 1E2LA 1Z4LA 2XRYA 3C87A 3EEBA 3STTA 4K28A 1N8NA 4P3YA 1PS0A 1RQLA 1I5RA 4I3HA 3TZEA 3UAYA 4Q6WA 1ZOIA 3G2JA 2QM3A 2I3ZA 3GUCA 1M1NB 2R9VA 3DMHA 3GHHA 3L0ZA 5FOTA 2P69A 3N6XA 3T0GA 1SZJG 1YDGA 4Y9RA 1DG1G 1NASA 1QIHA 3TAXA 3ZIAD 3H3FA 4KXYA 4KFRA 4JS0A 4BWGA 4XJXA 1CUYA 3W8DA 2XCQA 3EG9A 4NMMA 4QZVA 2BBSA 2PYIA 4N48A 5ARCA 3FPGA 3L6CA 1NRWA 3DDNA 2OD2A 5JSYA 1L4EA 4QU8A 3GJ3A 4N54A 1XTIA 3WICA 5DM60 4UNNA 5I3ZA 3QX9A 1N2EA 2I4LA 4K9QA 4ZCLA 8OHMA 1QH8B 4TL7A 3VOBA 2C92A 2H17A 3GH3A 3SC3A 3WY9A 5JADA 1I4DD 1DAGA 4DBZA 1ZK4A 2CHEA 3D6HA 5AIAA 4C78A 2WM9B 4HNVA 4C4SA 3TR5A 1M5UA 3UHAA 2ZAGA 4Q1VA 3PIDA 3AUYA 2IDZA 4RQTA 7YASA 1Y5IA 4ZMBA 1DV1A 3WLRA 1X7YA 3MJVA 1KI2A 1YBVA 5GQSA 3IKLA 1V5IA 2ZWIA 4G0QA 5DPMA 4TZ6A 1UOOA 2VZLA 4QTYA 4L4ZA 4EG4A 5JNUA 3BE6A 3NC4A 4XWKA 1VE1A 3IDZA 5CFMA 4HZGA 1QU2A 2F3PA 1T5HX 3GRKA 4OUDB 3A9RA 4BC1A 4BKOA 3ZDEA 1JG2A 2HFJA 3WGYA 2PS1A 4WVLA 4GDMA 3FNQA 1LGYA 3PQFA 5KTOA 3FHCB 3KLNA 4EHJA 4BFZA 4H2DA 4JB3A 3AEQA 5LCXA 3TI9A 1Z4OA 3KVNA 4GOOD 1JLRA 1I1HA 1QK5A 3ET5A 3G7UA 2MTBA 3OG9A 4DQVA 1Z8DA 2YWCA 3A4NA 3ZU5A 4CE6A 2W4MA 3M1LA 1SU8A 2QHXA 3FHLA 4UEOA 2FEKA 5TGTA 4INAA 3K73O 1W4RA 3WMRA 4BMXA 2X5XA 5REQB 4OHXA 1GKIA 2PUAA 1G291 2DHDA 1BC5A 2J9FA 4G67A 4OU4A 3C3KA 1GZUA 2IEBA 4MQ5A 5TGDA 3V7NA 1NQTA 1GEEA 1TTPB 3OQIB 2VATA 4V39A 3C97A 3GGPA 3SG0A 3FUVA 3A28A 2EWWA 4N9WA 1R50A 1OZHA 2DLDA 2ISSD 4UM9D 4V3BA 3G9QA 3N28A 4U2CA 3ZQJA 1OHHD 4JC8A 4HFJA 1DAEA 2QZSA 1T29A 2Q3JA 3L04A 3CF6R 3BF8A 4UXIA 5AJWA 5HIJA 1QGAA 3FMOB 3EE6A 2HK6A 1L5RA 2RCYA 3OX2A 5DNCA 2JEYA 1JDBB 1TJ3A 2DLCX 1KMHB 3R44A 2ZJ5A 1C8LA 1TM7E 3BK7A 2Q49A 1PLJA 2JJ1A 3ETLA 2XBLA 4FDUA 4IIUA 1VMAA 4ZC8A 5TNXA 2VHCA 4D9NA 3AFMA 4C6RA 5J4LA 1UBSB 1GCGA 4D80A 2PS3A 3QOFA 2J4FA 4TWJA 5ALNA 4L4SA 1CY0A 4PFQA 4R51A 4M7OA 3ILXA 2IELA 1FMFA 4IR7A 1Y9AA 2I4NA 1VIAA 2Z3ZA 4FCCA 4X20B 3NBQA 2HUPA 4KC0A 1DEKA 3VC7A 5CAEA 3CISA 2VDMB 4ENTA 1W0KA 2CFTA 1KEUA 2HWYA 2A0XA 3GLHE 5DGDA 1NSFA 2GRAA 3I1FA 1EFAA 1HETA 1Y7TA 4TMWA 5CUQA 4Z4QA 3NAMA 3P0EA 4PHCA 3LC7O 2B2XA 2F3UA 2V97A 4YNBA 1GTJ1 2GFQA 5B30A 1E6MA 3ZHBA 3PYXA 4OAPA 4U2GA 4PO8A 3OBIA 4PYMA 5KSZA 3HVKA 1OWLA 4L51A 1RZ3A 5GONA 3N7UA 1U0EA 2XB9A 5JAZA 3OKPA 3FKQA 2CXQA 3OCXA 3O4JA 4YP5A 1NR5A 4RDIA 5DTMA 3QVJA 3S2IA 1EGMB 5SY9A 4ILKA 3LECA 3KR2A 3QIAA 4UDOA 4OHWA 3HRIA 3OF3A 1NOIA 1TM1E 4JJEA 1FUEA 3EQ7A 4E33A 2MYNA 5CLJA 1QRRA 2OVBA 1U7UA 3A10A 4DIBA 3FZEA 4ZA2A 3QLUC 2WV9A 1MX3A 2FUG6 3ITEA 5GINE 1U7HA 1P4RA 3EC2A 2XTNA 3DFFA 4G8JA 4A2CA 1HTBA 3IUPA 3ABZA 1VBNA 3EZ7A 4DPLA 1MP0A 3AKCA 1R16A 5I5GA 4OMCA 4J3NA 4C22A 2RI0A 5HGXA 1C1XA 4JYAB 3HZZA 1NXXA 1QB7A 3U3XA 5EE3A 4NXNB 4FIDA 5LQDA 1XGKA 1Z39A 3OWHA 3F4BA 4IIFA 4YXWA 4MUHA 2ZVPX 5JQGA 3RFXA 5KCMA 5HIIA 1VHJA 1ADJA 2IYQA 1MAHA 2BF7A 3VC3A 2PGOA 1LBHA 3VU9A 3ZCTA 1E9SA 1CNMA 1SBIA 1YDHA 1Y9EA 1LFAA 5DJ5A 2QI9F 1ZH6A 1ST2A 3OSZA 4HCJA 1FYXA 5DHTA 3FTEA 1K3TA 4LVCA 4QWWA 2QQGA 1FNCA 4NH0A 1Q7CA 2QNRA 4I8IA 5I9NA 4R1MA 3C8MA 2FOIA 3BILA 4B5KA 3ILYA 3IWBB 4LW8A 4BKUA 1MC1A 1JG3A 3H04A 1BEEA 2OR3A 5F77A 3TGLA 1AZLA 4JYMA 2IVFA 5EQJB 1KDVA 1G4AE 1YR1A 4RLQA 1O87A 4ZT3A 1P0CA 3TJRA 4C6TB 5C8DA 4NK4A 2B4AA 1N75A 3V1TC 1VYUA 2H4WA 3E3OA 5BQXA 5LQRA 3UWDA 2O2IA 3AX6A 3IO3A 1R66A 1C3LA 1E1DA 2HEGA 2Q9UA 3GDWA 2QX7A 2IYVA 1DADA 3PQEA 1ISMA 5JDCC 1JLMA 9ATCA 3SE0A 2J3QA 3O3OB 4BIMA 4B3MB 1P91A 4CR7A 3CEPB 1BYIA 2QV0A 2EHJA 4PE5B 1WHSB 4B7UA 5IUJC 5LP6A 1OASA 1T9HA 3HDHA 2QTRA 2DH5A 5FPTA 3O8LA 1IY1A 1KF0A 2ZPUA 4G8DA 1NU6A 3RDPA 4P7BA 4B4OA 3T3NA 4HPJB 3ZWCA 3UC9A 3QKRB 2ZQYA 1S1MA 1DS6A 4CMEA 3S1AA 5L40A 3WQSB 2PX5A 1GM5A 5CLGA 2HT6A 4ZVUA 4L5YA 16PKA 1UT6A 4JAVC 1MIOB 4PIVA 2JS7A 3CY6A 4C2TA 2ZSAA 3T1NA 3EXEB 2ZJ7A 3KB2A 1VCHA 3NVDA 3SSNA 3EVNA 5EZQA 4C5CA 3IUMA 2XTJA 3IWDB 2QJTA 4F9GA 2NXJA 4KAXA 1M6HA 3G59A 2AFIB 3I42A 3BAFA 3K92A 2RHLA 4UREA 4HLDA 3N7TA 4X93A 2JNWA 2H2FA 3HPQA 3E1KA 4B48A 2ZIFA 3CR8A 4LJ5A 1N5LA 2O20A 4LDPA 4BB5A 2OE2A 1O2DA 1PT9A 2O0MA 3K5PA 4PCUA 2C5LA 2EARA 4FONA 1R4AA 2NM0A 4P5PA 3ENQA 5BYKA 3FVTA 1VI5A 4HRAA 1MAAA 1QS0A 2P0EA 2VAWA 5CA1A 1C41A 4ZKDA 2B4QA 4NNOA 1WBJB 2LVBA 4PZCA 2Z6AA 1KIMA 1FYWA 4NESA 4WCVA 5H4HA 3ME5A 1PQUA 2Z4RA 4ZQFA 4ZK2A 4PO3X 1ZK3A 4HH1A 1DAHA 1RYBA 5DK4A 4KUHA 3D3JA 1ZMXA 1MKYA 3OD1A 2QV7A 1NJ6A 4IUBS 1PKEA 3TDMA 1FDIA 1T25A 4Y0AA 3C8UA 4MQBA 1OWMA 1JR6A 3I2IA 1RAEA 2GSWA 2QRVA 3EVAA 3NNDA 3VMFA 4B76A 3F46A 3AXTA 3OIWA 5H0IA 4LMBA 4RKFA 3GJYA 4EL5A 2I7XA 1DAMA 4J1TA 2X2FA 3NKFA 4QXQA 2ETVA 2JJYA 3VKFA 5KYTA 1A98A 1EEXB 2H31A 4LZZA 4J0KA 4CQLB 5ITVA 2P9CA 1Q7GA 4R7ZA 1F8UA 2J7KA 1Y3FE 2QJWA 2ZJBA 4HATA 3I01M 4KQXA 2BJHA 4FHZA 1IULA 3GFTA 2Q99A 3N75A 5HJ5A 4JROA 3KZXA 2R8OA 2WF9A 1Q0HA 5AI8A 3VI3B 4KQHA 2YS6A 4CVNA 1XDUA 3O1HB 1QGOA 3LZ6A 5EIFA 2YL2A 2GR9A 2P27A 3QY0A 5DHRA 4HQOA 2L82A 2XVYA 4MW7A 4E0BA 4AO7A 4QM7A 3WTCA 1C81A 1YZKA 2E87A 3ISTA 1J7KA 5LYJA 4A82A 1RXVA 1F20A 3FUTA 2EFHB 4PXAA 4F7WA 1BCSA 1CJUC 1X1CA 3H7AA 4BLUA 1O5TA 1ZEMA 4RFLA 5JNVA 3COVA 4FFSA 1ZBDA 2J3DA 1LNQA 1YNSA 2GPTA 1XLWA 2JKZA 3P4UA 4YV1A 2FK7A 3O0DA 2AN5A 3E8MA 1FFAA 1E9RA 1N7IA 4BN5A 5CM9C 1G8MA 1EK6A 1QAMA 2Q3FA 1B23P 1D6JA 1BDBA 1A9YA 1DXOA 1UK9A 2CDCA 2OWDA 3EGDB 2Q4EA 1LH0A 3G9UA 1WTCA 2CNNA 3GDHA 3TW8B 3QENA 4CLRB 5I9LA 1LX7A 2YZ7A 2NYUA 2PJUA 4D9FA 2VDPB 4CF7A 3O94A 3Q2KA 2OBXA 3SHWA 1GA6A 3OHMA 5HPYB 1KTIA 1Y4DE 3NIFB 2FEPA 1XMXA 1WVGA 2IK8A 4OB6A 4PLVA 3T3DA 3ZEAA 3L93A 5IC6A 2AF3C 2UV8A 3OUUA 3ZZMA 4MV8A 2N3ZA 3VVBA 2Z8YM 4MMXB 3ROEA 3SHQA 4ZQBA 5IJXA 4C07A 3NWEA 5LZ9A 1KP2A 5TT0A 4DZRA 2Z5VA 1KTVA 3RVQA 1AV6A 1L7PA 2QGNA 3A3KA 4L9SA 2BPOA 3K0EA 4O2BF 4PSKA 4K9PA 5FUQA 2X8BA 3WGIA 2W2XA 3CG4A 3VHLB 1KJNA 221PA 2YNMC 5EJ4A 1TCUA 2YV5A 4EEKA 2P6OA 1SURA 2NZVG 4P22A 1OX4A 1QP8A 3GLFA 2J0EA 2ZZNA 4ZVVA 1USUA 2Z8XA 3DR3A 3F6BX 4PSCA 5I9BA 3WK8A 5KCZA 3HXTA 3I9JA 2CHUA 4LJKA 2YFQA 2VT7A 2QTGA 2YJGA 4IICA 3RIEA 3KFVA 3K05A 3SZRA 4A1FA 1N36B 1KYQA 3P9XA 3PPWA 3HJTA 3PEVA 4S1OA 4C0SA 5IRCD 1N77A 3VR5D 5BSGA 1ZWLA 2Q5QA 3HB5X 1F17A 1PNQA 1G38A 1OE0A 3KZNA 2OGUA 1EFUA 3CNEA 1T4CA 3WKAA 4MPJA 4C3ZA 4LJYA 4RQUA 4AB1A 5IS2A 1CXZA 1CZRA 3KKMA 1Y9JA 1N9ZA 4QEDA 1L4FA 2EFDB 2FDXA 3GUUA 4FZ5A 4L15A 4DARA 5HUQA 1CP2A 1GRVA 2BZ1A 4LVNA 1D9XA 2ON6A 2VNIA 1JHYA 3VZPA 4PZEA 1S6YA 1FDWA 4D6YA 5CX1B 1HPLA 4RHXA 2DU8A 1DFIA 2OHFA 3IODA 1ABEA 4L6IA 1KY5A 1HQDA 2OYSA 3UWKA 5A4AA 5AYVA 1I3OA 1RXUA 3BIWA 1CUEA 1PL6A 1YSCA 4J3JA 5CA0B 1JHDA 3KOWA 1U11A 4XOUA 2BFMA 3HCPA 1L5OA 3ZWPA 1NXOA 1F0PA 1QUFA 1EYZA 1RLIA 5THKA 3SEZA 5AM4A 1UDRA 4N39A 2O8BB 1H2YA 2GEJA 2LUOA 2IYPA 4UHDA 3PIIA 4OO3A 4Y2YA 5IC5A 4JEHA 2KPOA 3RBXA 1C3JA 5LQNA 1KRXA 5F2KA 5B1EA 1BU8A 1DJQA 4EVIA 1LPNA 3BULA 2BGWA 4JBHA 3LBIA 1PX2A 3WLKX 1WE2A 4UM9B 4CIYA 4OD0A 4EMTA 2PA0A 2ID9A 4XQ0A 1Y7PA 1DEOA 3N2LA 2OBLA 3S7TA 1G2IA 2XA2A 1C4OA 2WIKA 4IKEA 2DBRA 1SIBE 3GJ5A 3KUUA 4TV8B 1VHTA 5AP9A 1OD6A 3SDBA 4BPRA 3ORQA 4UOEA 3U7IA 1V4VA 2R7KA 2XIJA 4NPCA 1R5BA 2OCBA 3R3JA 2I2DA 1CDZA 2WBLC 3R3XA 1YS1X 3I9MA 1JDZA 4X8MA 2YIVX 2AE2A 5CA0A 2ZXUA 1RFLA 1MHPA 1EFPA 4LDRA 3EVGA 2XAAA 4MV0A 1PR3A 4KNWA 2I54A 1VECA 2BDEA 1XWFA 3CPHA 1JQDA 3KZMA 1L4UA 3DKVA 3NG1A 3C5CA 4N0PA 2ZR7A 3A05A 4D9BA 5LLTA 4HGOA 1JR3D 2RDMA 3GP3A 4RCYA 1UJ4A 2VJDA 5IDXA 5AKJA 3RVBA 1RI2A 2DUUA 1QIEA 4PSVA