2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
molecule keywords Dimeric dihydrodiol dehydrogenase
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
3CTMA 1LJ8A 4ND3A 3BZUA 3BTVA 4Q3NA 1R4MB 2OORA 2PTGA 1WAMA 1NP3A 3B1FA 5IDQA 3WGIA 2C7VA 3DBHA 3TZHA 3ZV3A 5A03A 5DCWA 2W2LD 5I7FA 1LDBA 3PHHA 4Z0PA 2GO1A 5KJEA 1ISIA 1ORRA 4CV3A 2DUUA 3PQFA 1E92A 2Q99A 2PK3A 2LDBA 5ICSA 2X23A 1DLIA 1X13A 3GUCA 2P9GA 1W4ZA 1TLTA 1BGVA 3LSYA 2O48X 3QJ5A 3STHA 4GSLA 5A5EA 4ND1A 2WYUA 3I23A 1HDZA 4S3MA 1TB4A 2RIRA 3EC7A 1GR0A 4PLCA 3IC5A 1ZSVA 3GC6A 2FR1A 4EJ0A 2ET6A 1N5DA 3L0DA 1QV6A 3ZWBA 3MJ4A 2UV8A 5JCXA 1E5LA 3K73O 5LC1A 2FZWA 3EYWA 3G1UA 3WNQA 3L4BA 1B26A 2DAPA 4XGNA 2OBNA 4MP6A 3KV3O 2C2XA 3BTSA 2H5LA 5ENDA 3JD3A 1HT0A 3VH2A 1PU2A 1YQXA 3SX2A 2JD1A 3OEWA 1O5IA 4MVJD 1YBVA 3DWFA 3KB6A 1DBVO 1HYGA 1Z7BA 2GERA 1M75A 5T8KA 3C7CB 3GDGA 3PYMA 5C7LO 3QLJA 3KLPX 4BO9A 4XJTA 4A73A 3F47A 3GG2A 1J49A 1PQPA 3GNTA 3UH1A 2C82A 1AN9A 3AU8A 1A4IA 3OJOA 3DQPA 4YJGB 4EW6A 1PZGA 2GPTA 4M55A 2EP7A 4NBUA 5JAMA 1I3NA 1WP4A 3FI9A 5KVQA 4XQ9A 4AJ1A 4E5KA 1BRMA 5T67A 2X58A 2G1UA 2WEKA 4J0FA 3PP8A 1E7RA 5TGDA 4OL9A 3Q9NA 1LBEA 4TZTA 1EVYA 1JWAB 4W4TA 4AJKA 4E5MA 5EN4A 3DAPA 2P5UA 1ZIDA 1TA4A 2J3IA 1P31A 5FWNA 2G76A 3GEMA 4L4SA 3CKYA 1I10A 4CQLA 1NASA 4S1VA 3QV1A 1JDJA 4CM7A 1DRWA 2PR2A 5L7WA 3NJ8A 1NAHA 1I2ZA 4JNKA 3NAQA 1UZNA 2VQ3A 3DC2A 1EBFA 4EITA 2VN8A 4ZU3A 1MC4A 4BV8A 3WB9A 4N5LA 3E6AA 4KOAA 2X5JO 2Z95A 2F00A 1V3TA 4Q3CA 2VYNA 2GUGA 3JQ9A 2B0JA 2DT5A 1ZKMA 1NPDA 1O9BA 1VRWA 1R0LA 4MP8A 1GYPA 1YL6A 1AXGA 1EEHA 3H9EO 3OEYA 2C0CA 2IEDA 3ZCXA 3ENKA 2HDHA 2PD4A 3PTZA 4J1SA 4RF4A 4YTEA 4CQLB 3KYCA 1BDMA 1F8GA 2C7GA 2QRKA 5TRTA 4CUJA 1LDEA 4M8SA 2HRZA 4RPLA 5JSFA 3ETEA 1GYQA 3FTPA 3EY4A 4O0LA 4QQRA 1QSGA 3NGLA 5JC8A 1H6BA 4XZ3A 3ANLA 4XKJA 3GVIA 5I9NA 3H5RA 3IKVA 5DCYA 3O4RA 2D4AA 4NBTA 5A3VA 2B5VA 3D7LA 4GX2A 3ZHYA 2O3JA 6ADHA 5F5NA 4CMIA 4YRBA 2UUOA 4XYEA 3QRWA 4YT8A 4CL8A 3SLKA 1QR6A 1ZK1A 2G17A 1CQJA 3QSGA 4G81A 3WMWA 4CM3A 3NX4A 4CM9A 1VE9A 3RUFA 3V1YA 4FFMA 1UR5A 7ADHA 3RBVA 4NK5A 1LQUA 2PZJA 3RUCA 1M76A 4ZRNA 3A1NA 4IJKA 2FR8A 1B15A 4O6VA 4BO4A 2JCXA 2VT2A 4J1TA 3H5AA 4W82A 2HMSA 4BV9A 1U8FO 2DTXA 1LTHR 3ZDFA 4NFHA 4D44A 3ZNPA 5AXDA 3TRIA 5CG2A 1LSUA 1ZCJA 4FJ2A 1LRJA 1P1IA 3AOEC 3DTTA 3PXXA 4P4GA 4E2XA 4A03A 4WUVA 1E7YA 3GGGA 1JVSA 1KVUA 4FOOA 4GMGA 2Q2QA 1P3DA 2E6UX 3BMOA 3AUAA 1U3TA 3DHYA 4RVUA 3AWDA 5A06A 3H65A 4RVHA 3PHJA 4FGWA 3HG7A 1YO6A 3RQSA 4B4OA 1XQ1A 1IPFA 1M6HA 3WGHA 3C85A 1PJCA 3GRKA 1PL8A 4UUPA 2J3KA 4BGVA 4GX1A 2HJRA 4DBVO 5T57A 2GZ3A 4YAGA 4Y6RA 1VJ0A 3FD8A 3ETGA 5TIIA 2OFPA 3TDKA 3Q9UA 4ROSA 5FEUA 1EQ2A 2WMDA 1R4NA 4L74A 1DSSG 2JD0A 2NSDA 4IM7A 4QSMA 4RZHA 1E3IA 2QRLA 2VCYA 3IOYA 4RVSA 1EUCA 4ZJUA 1ZMTA 1C1DA 1N1GA 3ORFA 4O1MA 4IQ8A 1IZ0A 2VHVA 4BNWA 1RM5A 3INGA 3RJ5A 2BFPA 3BMCB 5COQA 4NBRA 1T2FA 4RPGA 3AOEA 4ITUA 4Q3EA 1VPDA 1BTOA 4RF5A 4ZGWA 4CR6A 3BMNA 3DR3A 3DMYA 5JFOA 4P22A 1LRKA 2C5EA 1GAEO 4PG7A 4PFJA 2IZ1A 2WD8A 1MV8A 2A94A 4XQCA 2IYPA 4MKXA 4TROA 1T4BA 5A5FA 3OJFA 4MVJH 1VSVA 4I5GA 3GQVA 3ASVA 3QIVA 1LLDA 1Y8QB 3ZWCA 3E9NA 5EINA 1LC0A 5B4TA 4QFCA 4ZD6A 4PRKA 4FDAA 3AFMA 3S2FA 2P4HX 3I83A 4U7WA 2A9FA 2XAAA 1BXGB 4JBIA 4I5FA 2ZKLA 4O63O 4OSPA 1KY4A 1WDLA 1UXKA 3VZPA 3CE6A 4WCFC 3PJDA 4KQWA 1ADFA 1U5AA 3H8VA 2YQ5A 3F6YA 1EK6A 3UCXA 1DHTA 3KUXA 2EF1A 1E6WA 4BB5A 5KIAA 1ONPA 3JCZA 1F17A 3UICA 2XOXA 2NWQA 5F21A 3VZRA 4B4WA 1ULUA 4PGFA 3UFXA 3VKVA 3UGKA 2X8LA 3Q3CA 3NDJA 1MXFA 3B1JA 4R41A 1C14A 5DP2A 4BUCA 1UP6A 3K8ZA 1T1SA 2VWHA 5JY1A 2W2KB 4GL4A 1PGQA 3L9XA 2HMTA 1ZBQA 3TOXA 3OIDA 2WD7B 2HK9A 2YV3A 2I3GA 4E30A 4Y98A 4R69A 4JBHA 3H3JA 1DC6A 2EGHA 4TKMA 1H6DA 3HFGA 2Y1OA 1AHHA 2RHCA 4WPGA 4YBZA 1DIRA 5JDIC 5MGBA 1PS9A 1FDWA 1U9JA 1V9LA 3PHGA 3TPCA 3D0OA 4E2ZA 4MVJF 1FF9A 2VUSA 1E1LA 3BHIA 4KQXA 3QW2A 3G79A 2PNFA 3AI3A 1H6CA 1EUZA 4P8RA 2CVOA 2CDAA 2WD7A 3LDHA 3V2HA 1ZK4A 4MIYA 2DPGA 1HEUA 4K28A 1OBFO 1TVEA 5C7OO 4RQTA 2ZYGA 4NBVA 4HV4A 1GL3A 5U9CA 4IJVA 1UZLA 2IZ0A 3DBRA 3K2BA 2EW8A 3CINA 1IUKA 5IDYA 1V35A 4ZA2A 1CETA 4FSHA 2AG8A 4CPDA 4NMHA 5C3MA 3OJ0A 4GWGA 4FFPA 3M2TA 2B5WA 1M6WA 4DQUA 3I3OA 2G82A 4BNYA 3PWKA 2W2KA 4BKOA 3K6JA 5C5IA 4DUPA 4OIMA 1YB4A 3MZ0A 3DONA 2FY8A 2B4RO 2YUTA 1HDYA 5BSFA 1U28A 3IMFA 4HFJA 4UVEA 3E82A 1IHYA 1NHWA 4IMRA 3LLVA 4K26A 3D3WA 3WFIA 4DVJA 1ZXBA 5KVCA 4Q9NA 1J4AA 1I36A 1F0YA 1TT5A 2FWMX 4B3IA 3JQGA 4BNNA 1SAYA 1GV1A 3IL2A 2XPCA 3EW7A 3UN1A 3ZHZA 1BVUA 4B7CA 1N2SA 3KZVA 5JXWA 4DLAA 4CM8B 1YKFA 3EVNA 3K9QO 1LDNA 2PGJA 2AQKA 1NVGA 3HJAA 1XHLA 3P2YA 4TVOA 4OJNA 3DBVO 1N8KA 1GU7A 5G2OA 1HLPA 1HLDA 3ZU3A 4CM9D 5L4LA 1U2GA 2QZ9A 1T24A 4RZIA 1EVJA 3ROPA 5BR7A 1R15A 4FFLA 2O3UA 1G0NA 2OXIA 4DMLA 4DPMA 4XQGA 4TVBA 2DVMA 1U2DA 2AEJA 1RM3A 3U0BA 1YDWA 1N7GA 3NKLA 4JQCA 5AXCA 1U8XX 4FFNA 1CJCA 3GA0A 2I99A 3JQ6A 4YQYA 5EPOA 1E0DA 1DC5A 4I08A 4K6FA 1Y5RA 4UVHA 4W9NA 5DBIA 3HHPA 4BKRA 3NDRA 1P1RA 3H7AA 4OHUA 1E7SA 5LDGA 1U7TA 4R68A 2OBYA 4W6ZA 4CV0A 1PWZA 3KRTA 3DEYX 1W6UA 3PWSA 1PGPA 1TT7A 4FW8A 3OA0A 4EUHA 4UULA 3HWRA 3DTYA 1Q7BA 1BMDA 4IZIA 4HY3A 4D45A 1UUFA 3KLMX 3GT0A 5L7YA 8LDHA 4GX0A 1PJSA 5L3ZA 1XG5A 1NFFA 3SC6A 4EUFA 2ZJ0A 2GYYA 3BMQB 2W2LA 4ZHSA 3FN4A 3W8FA 5JDCC 4E12A 2YFQA 2I66A 1BHSA 3FNGA 3ICPA 2J5QA 4RVFA 2HO5A 1Z7EA 3A9WA 5KOIA 1WZEA 3BMCA 5KWEA 1X7HA 5BNFA 1Z6ZA 4DLBA 3TL3A 1ZH8A 4IDGA 1V3UA 5GZ3A 4B3JA 3FSRA 4CQMD 4WCFB 4MIEA 1KYQA 3WIEA 4NPCA 4IZHA 3VH3A 4NJMA 5CP8A 1H94A 1WZIA 1DFHA 4RL6A 3GDOA 3WGGA 4TRRA 4YT4A 3ZWXA 1SEPA 2CNBA 3JYQA 4Y8VA 3AI1A 1OOEA 4FJ0A 1VKNA 1FDTA 1Z82A 4PLZA 4B4UA 3IJRA 1FDVA 3JQ7A 5BSHA 1J6UA 3GMDA 3V2GA 3RROA 3NDIA 5A1TA 1KVQA 3OFSA 4TZKA 7MDHA 4YVFA 3QQPA 3E5MA 3AJRA 3WMXA 4XEHA 4RV9A 3P7MA 1KIFA 4WOKA 4YJGA 2E37A 1PL6A 3ANNA 3GPIA 2HMUA 2P9CA 3B20A 1DJNA 2RH4A 3LC7O 2NQ8A 3DBHB 3FRJA 3SJUA 2CUKA 1ZK0A 4BNLA 3G0OA 1DO8A 4ZVVA 4CMGA 4EDFA 2BFMA 2QIOA 3T7EA 3GGPA 4R1SA 1U4OA 1T2CA 4NIMA 4KTVE 4M87A 1OZAA 3W1VA 4E5YA 3OMLA 4BO8A 5LDHA 4ILKA 1DIGA 3NTOA 4MVJM 3E03A 3LC1O 1QORA 3NT4A 4E5PA 3RFVA 5U1PA 4YQZA 1T1RA 1IPEA 5BNTA 4MVJE 3MOIA 4BNHA 5HWSA 5CDYA 1ARZA 5C37A 1J5PA 4MJLA 2VUUA 3G49A 3F4LA 3WYEA 1X1TA 4BNVA 3AI2A 1HRDA 3HUDA 4XA8A 4IDFA 1T25A 4ND2A 1VC2A 5TX7A 4OAQA 4YR9A 3BTUA 1O89A 2GNAA 4IXTA 3FR7A 1SZJG 4WK6A 5G0WA 2Y1EA 3DZKA 4RO0A 4WLOA 2P5YA 2V6BA 3F1LA 5BSEA 1O8CA 4CM1A 4D41A 3P5SA 1GY8A 3LVFO 1E7WA 5L7TA 4YPOA 5EL0A 1NHGA 2WTBA 2O7QA 3PEFA 5EESA 4RPKA 4IINA 5JDIA 1NBOA 4IS3A 4PCVA 1HWYA 4E5NA 4CV1A 2VUTA 3L9WA 4CL3A 3KETA 1ZEMA 3OQ1A 4WJZA 1LUAA 1P44A 2NTVA 4U0KA 3WX0A 4PG6A 4AJ4A 3JQBC 3WBFA 4CLXA 3ZHBA 4JJFA 4HX5A 4Q3BA 3DHNA 4EUEA 5IN4A 2FPPA 3VKUA 1I24A 4IS2A 3H9UA 4XGIA 4AICA 5A9SA 1Z74A 3PJEA 1YH3A 2VNSA 5JYEA 4PLYA 1GPJA 2VTDA 4UAGA 3QY9A 3IUSA 1MGOA 1YXMA 3HDQA 3ZWWA 5CDTA 2X5KO 3WYCA 3WTCA 1A7AA 3PRJA 3O9ZA 4RDIA 2R00C 3WFJA 3RC1A 3VVCA 2V6FA 4LMPA 5DT9A 2UUPA 4EBFA 3MTGA 3UXYA 4YB8A 2ZATA 3R3SA 2HCTA 5TQVA 4AJ2A 5IZCC 1HZZA 9LDBA 4D3SA 4IIUA 2H1SA 4JROA 2BHLA 1UP7A 4YEDA 4IJWA 2GGSA 3QE3A 4F45A 1WVGA 5ENVA 2FPGA 4C4OA 4N7RA 5A9SB 1QXSA 2HUNA 2IDZA 2A92A 3FHLA 5G0UA 2D59A 4ID9A 4R16A 3D3WB 1GPDG 3JSAA 5DCUA 1NVTA 1GQ2A 2SCUA 2Q1TA 1RPNA 4H16A 1AE1A 5I7SA 4E3ZA 1GYRA 2NU9A 3HFSA 1Q7CA 3I9JA 1GEGA 4DYDA 4PLPA 4KDEA 4BKUA 3VZSA 3BIOA 2NM0A 2YW9A 3I9OA 1ADGA 2XF8A 2OO5A 4ND5A 4E6PA 4BMNA 4XB1A 1G6KA 5CFZA 3QVWA 3AM3A 3UW3A 1L1FA 4LSMA 3T4XA 3IDSA 3IS3A 1DIHA 4Z3DA 4MINA 4GQAA 3BTOA 1UAYA 2G5CA 3H9QA 4XWYA 1A7KA 1EFLA 1KETA 3KEOA 4KMSA 3TZCA 1CERA 4IIVA 3U4DA 4AJIA 4TMFA 4MVJA 4WASA 3ONEA 3FBTA 4YA6A 3OQBA 1I3LA 2WYVA 3LF1A 1RM0A 3TFQA 2WSBA 3RIHA 3TNLA 4D46A 3HZZA 1E1NA 2AXQA 1LLCA 2VOJA 1QMGA 4YAKA 4RDHA 3CPSA 1XDWA 1PJ2A 4I8XA 3S1LA 3KYCB 3C7AA 1X1EA 1YJQA 4U6QA 3ETDA 1MG0A 1U1IA 2C2YA 4BB6A 1RYDA 5IDXA 1HETA 5L9AA 5IF3A 1EDOA 2Y0DA 4W99A 2EKQA 1YRLA 4ZQHA 1DFIA 4AJEA 2FP4A 4BO6A 3V8BA 4CMBA 5KVSA 5KJCA 4MKRA 3DZIA 3DZFA 3RU7A 3BXXA 1SEVA 3E18A 1A5ZA 3V5NA 1IB6A 1KOLA 1BXKA 1HSOA 4F6LA 1E3JA 3VTZA 1GV0A 4F3YA 3JQ8A 4BO1A 4HFNA 3DMTA 1NPYA 3L6EA 5KJFA 3B6ZA 2I9PA 1TXGA 3WYBA 2VWQA 1PGJA 3GHYA 1XKQA 3Q2KA 2EJWA 1OAAA 1VKOA 1UDBA 3MJSA 1HDOA 2IEBA 5EQDA 4CLRA 2ZYDA 4YACA 4EEZA 4PVCA 3X2FA 3JD1A 1H0KA 5U4QA 3GAFA 3N7UA 5JLAA 5HBRA 1YS4A 5IN5A 2YHUA 4PLVA 3OP4A 5J23A 4DWVA 3GRPA 5FYDA 1HKUA 1QYCA 3LF2A 4M1QA 2GR9A 2NADA 1EFKA 4YJHA 1I2BA 3RCBA 1WMBA 1XEAA 1WDMA 3WQRA 3AK4A 1U3VA 3JQCA 1KC1A 4EZBA 4YRAA 2DLDA 1Y81A 3ZU4A 2BKAA 3GEGA 2B36A 3OHSX 2ZB7A 1ZJZA 3VTFA 3OIFA 4RQUA 4IUYA 4XR4A 3W6ZA 3UCFA 2ZJ1A 3V1UA 2Y68A 3NT2A 5FI3A 5HM8A 1MP0A 4OKIA 1YB5A 3ZWMA 4WKGA 2JL1A 5JW6A 1B8UA 4HFRA 2GN4A 2IXAA 3C3XA 2BFOA 3L77A 3LQFA 5CEJA 4TRMA 4IBOA 1OFGA 2IODA 3JQ9C 2EXXA 3JQEA 4XJSA 4DMMA 1AGNA 1JQBA 4DQXA 4UUNA 1I0ZA 3VOSA 2DBZA 1C0KA 4OKNA 5TF4A 3NTQA 5TC4A 1I30A 4CUZA 3F4BA 3M6IA 1X0VA 4IMPA 2OHXA 3JYLA 1MFPA 5GMOA 3DZJA 2PZLA 1QYWA 5DNAA 3U9LA 2QX7A 3WSWA 3GUYA 1LA2A 1NQOA 4M86A 4U8GA 1GFSA 4BNTA 4R01A 3PJGA 4BKQA 3FR8A 3JYPA 2GN9A 4NJMB 1R0SA 1ZUD1 3FNEA 1E1MA 2Z1MA 1PL7A 2C59A 4XDZA 5H81A 3FNHA 3LYLA 3VPFA 3U09A 2HRBA 4DC1A 5EQFA 4E31A 1R4MA 1KVTA 3ZWAA 4TRJA 2VHZA 1LDGA 1BXZA 1JLLA 3GHHA 2GSDA 1YDEA 4X54A 4DL9A 1Y5MA 3OETA 5JAQA 4XRGA 3K30A 1BVRA 3A06A 1R37A 1CDOA 4D79A 4H15A 3VDQA 4C7JA 2VZ0A 2X0RA 3OICA 4BGEA 3WGYA 4ALIA 5L45A 1T2AA 3MJVA 3PQDA 4G65A 1PS8A 4BKPA 5G0TA 1QV7A 3WSVA 1X14A 4PN3A 5KVVA 1XR3A 3AUTA 3PHLA 2IXBA 3ZWYA 1DC4A 4J9VA 4JN6B 3B70A 3PWZA 5A04A 2PA3A 2D3TA 2HMWA 4CMAA 4IGFA 5DOZA 3IAHA 3OA2A 4KDFA 3ON5A 1W73A 1P1FA 4L76A 1KEVA 2Y1DA 3JYNA 5TT1A 3BMOB 4RLHA 4AL4A 5TJHA 1DHRA 4JP3A 4FB5A 3ROMA 2WJPA 3KSDO 3JYOA 4GH5A 1F06A 4R1TA 3U49A 2D8AA 1VL8A 2AQ8A 3KYDB 2IYOA 2NACA 4RGBA 4L4RA 2WE7A 1SC6A 4IQGA 3LT0A 3O8QB 3C1OA 3F3SA 3PLNA 3L4SO 1BW9A 1YGYA 3A4VA 4KUHA 5CPBA 1NXQA 1ENPA 2AEFA 2X22A 1X0XA 3AUSA 1NFQA 4UVDA 4UUOA 1JKJA 3ZU5A 3BA1A 5IJZA 3GN1A 4W7HA 2VRCA 4P4LA 4R1UA 4R3NA 3DOCA 2Q4BA 1B3BA 2EGGA 4AJNA 4K1LA 1P9LA 2VZ9A 3KSUA 3CMCO 4GSKA 3GY0A 4E32A 4QX6A 1ZK2A 4WEOA 1MX3A 1W0CA 3WGQA 2V7PA 4DIBA 2C20A 3KYBA 3RUDA 2Y93A 1GCUA 2BMAA 3O03A 2EWMA 2J8ZA 1T4DA 4GPD1 2H9IA 1RKXA 1QG6A 1ENOA 4BNKA 1B8PA 3ZWVA 2VTEA 5TSDA 2BI8A 3S2IA 2X7HA 1Y9EA 4BNIA 4Y6SA 1H6AA 1ZSYA 2EG9A 3ASUA 1D3AA 4ZQEA 4BOYA 5F3RA 2JHGA 3TF5A 4A0SA 4DC0A 3UHAA 1NQTA 1PJBA 3WLFA 5T5QA 5ITWA 1DPGA 2R00A 1A9ZA 4LCEA 1Y8RA 2Q2VA 4N18A 3I9LA 4CMJA 2W4QA 1H2BA 2EEZA 4GGOA 2P2SA 1I3MA 2HMVA 1NYTA 2WM3A 2NU6A 1QRRA 3IKTA 4L0QA 2J3JA 3JV7A 4B7XA 3G3EA 1R6DA 3NEPX 3ZNOA 5JYAA 3D4OA 1Z75A 4RJTA 1K6JA 5ICMA 2VYVD 4MO2A 5JPIA 1IOLA 3GVPA 4CODB 5H82A 4WCFA 1XWFA 3I4FA 2GZ2A 2NUAA 4J49A 5A9TA 1O0SA 4JP2A 4AJJA 4PG4A 2AEMA 1A27A 3ITKA 3T7CA 3R1IA 3TQHA 2BGKA 2Y0CA 1D7OA 3WOHA 3UF0A 4BNUA 4BO2A 1F14A 3GZ4A 2GRAA 5H83A 4RPHA 3ONDA 3EGOA 2ZQZA 3ADOA 4CM4B 4EEXA 5L51A 3OM9A 4BMVA 4YCAA 3SVTA 1X15A 1CQIA 4FC7A 4PLFA 3WNVA 4DGSA 1PGOA 1NAIA 4Z0HO 4FD3A 2QW8A 4BQRA 3OJLA 3F46A 5A3JA 2YHIA 4E21A 2BFAA 3N58A 3M1LA 1HE3A 2QYSA 1QLJA 3PHIA 5BT9A 4OGWA 5GZ1A 1F12A 6LDHA 4L8VA 3TN7A 3GDFA 1UDCA 5DZSA 4GKVA 4QUKA 5AXAA 1C1DB 3PJFA 2V6GA 3WWZA 4O5OA 3HE3A 3VDRA 3H2SA 3RAJA 5FI5A 1YOVB 3DBLA 3G1TA 4BVAA 3OBBA 2V65A 1JN0A 1NM5A 3Q1LA 4R1NA 1MB4A 4UREA 5LCXA 4E4YA 3OSUA 4PLGA 1P1HA 4A27A 4BNFA 2Q1SA 4UEOA 2J6IA 4J90A 3QWIA 5TS3A 3BYZA 3P2OA 3U5TA 4DIOA 4Z9YA 1C1XA 3L4BC 1E3LA 4P38A 1GDHA 5K6AA 4IDBA 5I7VA 3H6KA 1UJMA 1ZO8A 1JU9A 1BW9B 2DPHA 4PRLA 5L4SA 5ILGA 3F5SA 2R6JA 4NU6A 5B4VA 2JHFA 2Q49A 3JTMA 1UP4A 3VC7A 1GEEA 1N92A 1Y8QA 2IE0A 1CYDA 2ZB4A 4I9HA 2E82A 2F1KA 4DYVA 3JQGB 2PV7A 5CDGA 5IFLA 2NU8A 3E8XA 1SB8A 3RVDA 1PR9A 5JNLA 3U4HA 2XXJA 3ZN2A 1K5HA 5BQFA 3CZRA 1DRUA 1GZ6A 2QG4A 2PKQP 4YJDA 4L4XA 2CVZA 2EV9A 5JE8A 2VRCD 2X0JA 3AW9A 5HA5A 1PJLA 5JBIA 1DEHA 1XSEA 3ST7A 1FDSA 2B35A 4B7UA 4GBJA 1QYVA 1EUDA 2C07A 1EK5A 3QVTA 4BO3A 1HYHA 2X86A 4OQYA 3WR5A 3JQAA 4GAEA 2BD0A 4URFA 3LLSA 5JAZA 1SBYA 4IDDA 2Y1GA 3RKRA 3LU1A 1HYEA 3LT2A 3RBZA 3BMNB 4GX5A 4B8WA 3KBOA 1HSZA 4J4BA 2EP5A 3QA9A 4TSKA 1XLTA 1K6IA 4DREA 1A71A 1K89A 3SLGA 2Q3EA 3DB2A 1HE4A 1Q1NA 1GCOA 2BGMA 2W98A 4LSWA 4RORA 3RUAA 3S55A 4E33A 3GLQA 3ENNA 3LK7A 5A9RA 1P0CA 2H63A 1KBZA 5EERA 1H5QA 3FPLA 3QVXA 1LQTA 1UXGA 1PSDA 3OIGA 3PIIA 4A26A 1NWCA 1JAXA 1ZFNA 4HUJA 2ZB8A 1VL6A 3CZMA 4E0BA 4NZ9A 3DZBA 1LLQA 2C5AA 3IP3A 1JW9B 2D5CA 2X5OA 3TZ6A 2VOEA 1BWSA 2FN7A 1LU9A 3VPSA 2YZ7A 4R9SA 2GDZA 2BRUA 1HF3A 3WG9A 1BG6A 5M6DA 4HKTA 2NVUA 3B1KA 1LDYA 4NG5A 3K92A 2X1HA 3NJ4A 4RVGA 1KY5A 1ZXLA 3JQAB 4NBWA 5A02A 4YJFB 1UXIA 2I65A 3I9MA 3O8QA 1E6UA 2EIHA 4L9RA 3QWHA 4JBGA 1MXHA 5JC1A 3D64A 1P74A 5EJ2A 3JD2A 2OL4A 2Y05A 4GLLA 5FFFA 3WIDA 2P91A 4B8ZA 4DPKA 1FK8A 5I9MA 3D5TA 1B7GO 2NVUB 1GD1O 2R2GA 3TOZA 1NR1A 2DM6A 5CDSA 1PR3A 1ZJYA 5KKAA 5DN9A 1C1XB 1PZEA 3QHAA 5AYVA 5TLSA 3K96A 2HAEA 3FWNA 3S8MA 3GOHA 2HK7A 4QT0A 5JDCA 3W4JA 3ZI0A 1VLLA 1EE9A 2DBQA 2GLXA 2O3SA 3CUKA 4NU5A 4ZICA 3HNPA 1W8DA 4LW8A 1WNTA 3I6IA 5BNIA 5THQA 3ABIA 4EI2A 1HE5A 1S6YA 5I8WA 4A2CA 1KEPA 1LI4A 1EMDA 4J6FA 5G4LA 5AXBA 5TNXA 2OOSA 3VHRA 4E13A 3V2UA 4QFDA 4ALMA 5JAIA 3NTRA 3W4IA 4ONEA 2DQ4A 2B83A 3SJ7A 4R51A 3L6OO 1O6ZA 5G4KB 1XIVA 2GASA 2VZ8A 2DUWA 1C0IA 3DBRB 3GVXA 3KYDA 4CM5A 3O38A 3VPXA 2AW5A 3VH4A 2D5AA 3KVOA 1EBUA 3TL2A 3CIFA 2Q1UA 2Y1CA 3L07A 2Q50A 4RPJA 3BHJA 4HNGA 4D42A 4WE3A 2G0TA 4DIFA 2JAPA 2CFCA 3ZNQA 1N1EA 2CSUA 3MJTA 5K0ZA 1ONOA 1M67A 4O59O 4XX0A 2GZ1A 1HDGO 4TKLA 2X0NA 2PY6A 1TT5B 1X7GA 3I52A 4RF2A 2HLPA 4DPLA 3QWFA 3Q6IA 4W7IA 5IG2A 1PQWA 3RC9A 4HP8A 1G0OA 4NR0A 5JYFA 4D43A 2FR0A 4BNMA 2EHDA 3GNSA 2OUIA 1NFRA 1PZFA 1NQAO 3X2EA 4XB2A 1JKIA 4XIJA 2O4CA 4J2HA 3TWOA 3DMTC 5JMPA 3UCEA 1ZSNA 4GI2A 2O23A 4JLWA 3DFUA 3OH8A 5DBGA 1P1JA 3NT5A 3HN7A 4Y6PA 5IXYA 3U62A 4II3A 4DBZA 1MFZA 2HU2A 2Y99A 1P1KA 2YQ4A 4Z9XA 1E7MA 1I32A 1E3SA 1IZ9A 1V0JA 2X4GA 1OC2A 4J1QA 1ISGA 4I9NA 4ZQGA 3C1AA 3O26A 1LDMA 4U6SA 2DBVO 4Q3AA 4XGKA 2BF7A 1JWBB 2Q1WA 1ISHA 1E3WB 1I3KA 1HTBA 1YOVA 3MOGA 2E49A 4XYBA 3ZWPA 5T8KC 1K3TA 3WXBA 3MCVA 2FMUA 1DAOA 2OP1A 3VVBA 4NFSA 4CV2A 3AY7A 4D3DA 1NWHA 1YONA 4JJGA 2RCYA 4M89A 4G5HA 4OQZA 1JAYA 2NLOA 1H9AA 4GGPA 1E7QA 3BHMA 4HFMA 4MVJI 1ULSA 3PZBA 2X9NA 2B4QA 1GUZA 4AG3A 3LT4A 4N5NA 1KC3A 1EVIA 3D4PA 9LDTA 1ZZEA 1N9GA 1KEWA 3TZKA 2UVDA 4KWHA 5COBA 4H3VA 2QZZA 2WDZA 4CM4A 4EJMA 3DL2A 2YV2A 4MOWA 1UAGA 3ZH2A 4NNJA 3Q11A 3DAGA 4Y67A 3HSKA 3FF4A 4BNJA 4AJHA 1I8TA 5L4NA 4QECA 3PVZA 4HXYA 1Y1PA 4FGSA 4ZN6A 1ZW1A 3FNFA 3H9JA 3KXDA 3RC2A 4OXNA 2PGLA 4YT5A 2IZZA 5G0SA 1NVMB 2PGDA 2CD9A 1DXYA 1DB3A 4ALJA 2PKRA 2I3AA 3BAZA 4LRSB 5AVOA 2DTDA 5G0VA 3JQ7B 2AHRA 4Q3DA 1SNYA 4XRRA 2OMEA 5B12A 2J5KA 1AXEA 2Z5LA 1QLHA 4PG5A 1JTVA 4HBGA 2GN6A 1PJTA 4N54A 5JCJD 5GZ6A 1GADO 4IDCA 2NU7A 2W8ZA 4A5OA 2Q22A 4WNCA 4BGIA 1ID1A 1R12A 2CY0A 2IRWA 4WEQA 1N9GB 3EAGA 4UVGA 3JD0A 4DRYA 2ZTVA 4OO3A 4CLRB 5CEEA 1VJ1A 4AFNA 1OMOA 4HADA 1ISFA 4GWKA 4MP3A 1I01A 3S2GA 4XYMA 1DDOA 4J7XA 3WGOA 3ZGYA 3PDUA 2O2YA 3DZGA 3OQ6A 1DLJA 3I1JA 2HJSA 2JJYA 1XELA 2Y1FA 4GMFA 3ZWNA 1WDKA 3C24A 3IUPA 2QYTA 1V3VA 3MEQA 3SBOA 2A4KA 3WGZA 5ILOA 5JO0A 4UEJA 3D1LA 1LLUA 3EMKA 1TI7A 4OYRA 2VWPA 4D7AA 4Z0TA 1R4NB 4NH4A 1GQYA 1SOWA 2VRBA 3H5NA 2Z1NA 5B4UA 4FS3A 1N7HA 3F9IA 4Z3KA 1LEHA 3BMQA 3GGOA 1VL0A 3R6DA 4WLFA 4J2OA 1EDZA 2NVBA 4R9RA 1XGKA 4JX8A 4UUMA 2ZIZA 5KCZA 2P9EA 4R5HA 1D4FA 1U3UA 2X9VA 3U4IA 5KTKA 4I1IA 4DA9A 4Z9FA 2ZTUA 2FPIA 1GTMA 1NPTO 3VPGA 3HQ4O 2YDYA 3P19A 4MKZA 4GLOA 1HZJA 1ZVMA 1Q0LA 4PZEA 3INTA 3TZQA 1FJHA 5J9GA 2CDCA 4LCJA 2YY7A 3SXPA 3WTBA 5ER9A 4LISA 3WS7A 1KERA 4XD2A 3AUUA 4LMRA 5K9ZA 3GR6A 2NTNA 5IXSA 2O3TA 5ES3A 1PEDA 3TFOA 2PZKA 1R66A 4EYEA 3D5QA 3ITDA 3V1TC 2HK8A 1P33A 1PJ3A 4OOEA 2W90A 4WGGA 2DBRA 3RFXA 2WE8A 1XU9A 4ESOA 5F1KA 5T6BA 2AE2A 2JFGA 2DC1A 2YHIB 4XQEA 1QKIA 2J3HA 1V8BA 4D3FA 1EQUA 2FHSA 1PS0A 1ISJA 3WWYA 3GFGA 1ONNA 1YB1A 2QQ5A 5JYDA 1O94A 4R4JA 1R0KA 1MC5A 4WOJA 4NI5A 4FN4A 3RUIA 5CEFA 4IPTA 4E2YA 1E3EA 2PH5A 1B14A 1U3WA 4LVUA 4CLEA 2Q46A 3NGXA 2JKVA 3MWDB 1K0UA 3F5QA 2ZCVA 4J3FA 3U4CA 2EW2A 5DDIP 3T4EA 4YAIA 1Q7GA 3KOUA 1B0AA 1JA9A 1XA0A 1G1AA 4MDHA 2P4QA 3PYLA 2Q45A 5KKCA 5K6AC 5GY7A 2I6TA 4OOFA 4ALNA 5IDWA 4AJOA 3D3EA 4L73A 3I4CA 1B16A 3FCOA 4FIZA 2VYVA 4CMHA 5CAEA 2AQIA 4W9NC 4BNXA 4YWJA 2FRDA 1NX6A 1DOHA 3G17A 3MWEB 4QO8A 4JJIA 2XXBA 1ENZA 3WICA 4CLOB 3C8MA 2ZTMA 4M49A 3DOJA 3K2EA 2RBEA 1P0FA 3PK0A 1Q0HA 4IY1A 3PZRA 4OXYA 1ADCA 4I5EA 1LNQA 3COSA 3W8EA 4Y9DA 4J7CA 1IL0A 4JXKA 1KEUA 3GFBA 1LRLA 4F6CA 3DZHA 4IXWA 5I7EA 2NV6A 2AA3A 3RUHA 1C0PA 4KZPA 1Q0QA 3ROQA 3ZV6A 3S2EA 4FC6A 3ADPA 3DFZA 2GCGA 3QP9A 1XYGA 1YWGO 1YVEI 2AE1A 4RVDA 5CPFA 1EVZA 4BIIA 2PLAA 5I8ZA 3FWZA 3PIDA 1C0LA 3WQQA 4NQZA 2QRJA 4UVIA 2BELA 1YQGA 3CEAA 2TMDA 3GVHA 1VM6A 4IDEA 4PLWA 3E9MA 4CQMB 2NQTA 4NDNE 3RI3A 2B37A 3TSCA 4MVJP 2H6EA 3WLEA 2JAHA 2PFGA 3PPIA 4YT2A 4DTIA 4PVDA 1RJWA 2VWGA 5EMHA 3KEQA 1Z45A 1UXJA 3IQDB 2JFFA 2JCYA 4KUGA 3UOGA 1RYEA 4FFRA 4J91A 3HB4X 3ULKA 5HS6A 3FPCA 3KO8A 2FZEA 1HDXA 3IIEA 1ENYA 4M54A 1Y7TA 1YL5A 4KWIA 2ZYAA 4FPXA 4RLSA 4CLDA 3W4KA 4A7PA 1V6AA 2V6MA 1Q2XA 1F8FA 3DO5A 3A28A 4LGVA 3PLRA 3I9KA 4C7KA 5L40A 4CMEC 4K9DA 1FXSA 3WDSA 4DLLA 4YAEA 3ZNNA 5IZCA 4WLVA 4R3WA 3K5PA 3PGJA 3WJ7A 4CMCA 4UEKA 4LN1A 1PWXA 3QVOA 3Q0EA 3VAZA 2OGUA 4BHTA 4GVLA 3A14A 3GH3A 1VSUA 5F5LA 5JCJA 4CJXA 3LZ6A 4YRDA 4ALKA 3MJCA 1DRVA 3PFFA 1C3VA 1ZK3A 2BGLA 1Y9AA 1JVBA 3VPHA 2VHXA 3AOGA 2C29D 1BSVA 3ZW9A 3WJAA 1OI7A 2PZMA 2J5RA 3DHEA 5AQ1A 4H7PA 1I2CA 1GUYA 1XQ6A 1FMCA 2GN8A 4XIYA 4N5MA 3DBLB 1U4SA 3AY6A 4G2NA 3JQDA 3RASA 4R54A 3AY3A 4BO5A 2EKPA 4YDRA 4WNIA 1VJTA 4PLHA 2VHYA 1IULA 4JK3A 1P77A 4BS9A 5A05A 2CF6A 2I67A 3HADA 3JQAD 5F1PA 2C54A 4E2WA 1WPQA 3R3JA 4XYGA 1WXDA 1VI2A 1LSJA 1MA0A 5EIOA 3NUGA 2PH3A 4CUKA 5CG1A 1GZ3A 3OECA 1K2WA 1WWKA 5B1YA 1TEHA 2AQHA 2UAGA 4WLNA 2JFHA 3H3FA 1HL3A 3GVCA 2OP0A 2D1YA 4IQ0A 1YBMA 3ZU2A 1K6XA 2NTJA 3RD5A 4CLOA 1R16A 5IAAA 3H2ZA 2P68A 3CXRA 1S7CA 2WYWA 4J9UE 1WLYA 4TWRA 2D2IA 2HKIA 1GUFA 4J0EA 3AFNA 3JQBA 4NFYA 3C1TA 4YJHB 3EK2A 4MIOA 2O3RA 1RWBA 3ZHXA 4JCOA 4BMSA 5KJ1A 5MDHA 4RF3A 1XCBA 1M66A 5DBFA 3TJRA 3RSHA 1LSSA 3R0IA 4QXMA 2QHXA 1ML3A 4CMEA 1ZEJA 5F1OA 4ZQFA 1NR7A 2ILTA 3PYXA 3W8DA 1YBAA 1P45A 1E77A 3EDMA 5THKA 2DKNA 2FSSA 3AU9A 3ANMA 1NQ5A 4J1NA 1I33A 2WWRA 3KM0A 2B4TO 4OXKA 1DIAA 2FOIA 3NYWA 4DQVA 1PZHA 5I9LA 1WW8A 2HQ1A 3MTJA 3ZZNA 3RU9A 2ZCUA 3I5MA 3W6UA 1T2DA 1QP8A 2VT3A 1DIBA 2Y67A 4IDAA 4IGEA 4I9UA 3GPDG 2DU8A 1IE3A 1MLDA 3UAGA 1CIVA 2RH8A 2CMDA 4Q39A 1D8AA 5TT0A 3HDYA 3GEDA 2JD2A 1KVRA 2UDPA 2POQX 5T64A 1HDRA 2HSDA 5B37A 1B8VA 3D4NA 2EKLA 3FBGA 1PTJA 3HDJA 2LDXA 4ND4A 5IZ4A 5T73A 1CF2O 2CZCA 4BGUA 3RC7A 1A4UA 2DTEA 3E48A 2ZTLA 3JQFA 2Y66A 3HN2A 1AUPA 1QYXA 3GG9A 1GZ4A 3IJPA 1U5CA 2Q4EA 4CR8A 1CEQA 4LRTB 3VZQA 4II2A 4XCVA 1D1TA 1A9YA 1NNUA 3ROKA 2NNLD 4QO7A 1BDBA 1ADBA 1D1SA 4I5DA 4WLUA 3AM4A 5JY6A 4BO0A 1T26A 2DFDA 5CHEA 4K6CA 3DOOA 3ZWOA 5KJ6A 1LC3A 1IYZA 1PX0A 5JMWA 2Y0EA 2CF5A 4CM6A 3PQEA 3EZLA 4OM8A 3JQ8B 3Q2IA 5AOVA 5HS4A 3K31A 2YJZA 4FR5A 4J4HA 4PG8A 4WECA 1DJQA 1Y8RB 2AMFA 3L6DA 1SCUA 1DAPA 1PIWA 1EE2A 3EVTA 2B69A 4XDYA 1ISMA 1CRWG 1Z73A 4ALLA 1PJQA 3FTNA 4L75A 4EGFA 5TJ9A 4LVCA 3DAFA 4FBGA 1YE3A 4KUEA 3PFWO 1PGNA 1UDAA 2O50A 3HDHA 3IP1A 1X7DA 3H9GA 5ER6A 5A4DA 3GAZA 1LX6A 1E1KA 3GK3A 3PDJA 4KP7A 5HRUA 1KS9A 1ZMOA 5COAA 2ZQYA 4XYLA 4B3HA 4AVYA 2PD3A 3N74A 3SC4A 4YAJA 3H4VA 1J0XO 1CWUA 2E48A 1B3RA 4CMKA 4TRNA 2CVQA 5C7IO 4RCVA 3KHUA 1WMAA 4FCCA 2RHRA 4NJOA 3WQSB 4LK3A 4HNHA 3ZW8A 3LC2O 5HTOA 1EZ4A 4PZDA 5KNLA 1UH5A 4Z6KA 3GZNB 1SMKA 1SPXA 2BI7A 1A72A 3KSZO 2X9GA 3DDNA 5G4KA 1H9BA 1T2EA 5L53A 2OZPA 3RUEA 3PGXA 4GVXA 1OC4A 3GMSA 1U7HA 4BNGA 1HXHA 1XU7A 4CR7A 4BQPA 3SEFA 2VYND 3MJEA 2YDXA 4P4NA 5FF9A 3OJEA 4PLTA 1KVSA 4U0JA 3F1KA 2EERA 4OMUA 3CSDA 3M1AA 3RBXA 3CH6A 1L7EA 3GZNA 4D0SA 3I9NA 1E5QA 3LT1A 3M2PA 3CMMA 4IJUA 4CM8A 1I5RA 4CLHA 4DXHA 2X6TA 4QEDA 1IY8A 1SO8A 2O3QA 2ZB3A 4AJPA 4R5MA 2Q2WA 4PZCA 3DXFA 2CDBA 3E5RA 3QWAA 3C7DB 3NRCA 4QTZA 3GN2A 3HB5X 3ICCA 1HE2A 3NV9A 4KTTE 3RFTA 3KTDA 3JQFC 1YQDA 1MUUA 2RAFA 4D0RA 2D0IA 2NVWA 3JD4A 5JO9A 1SB9A 2E4AA 4WCDA 2YFHA 4CMIB 3UKOA 3GNQA 1H2HA 2AG5A 2FSVA 1YJ8A 4EJ6A 4J4TA 1AHIA 1MG5A 3QWBA 5ITVA 2X0IA 4AJLA 3ONFA 1H93A 5DP1A 3RJ9A 1YL7A 5DF1A 4JGBA 4FFOA 3WGTA 4CQMA 2EJVA 4MVJG 2PD6A 5L95A 2BLLA 4FOSA 1PQUA 4OH1A 4TQGA 2O4UX 1JKFA 1Y6JA 2BH9A 1UZMA 4FJ1A 2DFVA 5ADHA 4XR9A 4NHEA 2GD1O 3EZYA 2YV1A 3I6QA 3VH1A 4J43A 4A10A 8ADHA 2A35A 3E1KA 4FQ8A 2I76A 1NTOA 4BNZA 4YXFA 1LSOA 1E3WA 2O7SA 3ZV5A 4BL5A 1DC3A 2JCVA 4J16A 5CDUA 4JIGA 4GKBA 1UXHA 4YJFA 4BO7A 2PKQO 3E9QA 4ZRMA 3WBBA 3ZV4A 3AM5A 3RWBA 2VNAA 2TMGA 1LXCA 4WLEA 1FDUA 1GQQA 4J7UA 3OF2A 1HDCA 4MPDA 4F46A 1IHXA 1ZNQO 4YYZA 3GF4A 4INAA 2VHWA 3U3XA 3RKUA 1L7DA 3INRA 3QVSA 4PIVA 1B2LA 4NK4A 1QYDA 5DULA 5JS6A 5BSGA 3PI7A 3UVEA 1RM4A 2PWZA 1SOVA 2ZK7A 4U5QA 1DFGA 3EUWA 2YYYA 4OSOA 2I5PO 1PJ4A 3EHEA 5DOVA 4HWKA 4ZQBA 1E6EA 4B4VA 3UUWA 2GF2A 2UYYA 1BXGA 1M2WA 1O95A 4B79A 2O2SA
chains in the Genus database with same CATH superfamily
4YMVA 3CTMA 3LQ4A 2FVYA 3BZUA 3KJHA 1B0ZA 3HUFA 3NEYA 1R4MB 3X0DA 3FKJA 1FX0B 1VBFA 2I4MA 1UK7A 2XUQA 2C7VA 3AVPA 3DBHA 3DXXA 3TNDA 1RHKA 1X7YB 1BRTA 3GBPA 2H4YA 1CFJA 4LV6A 3UYLA 1R18A 3SHVA 1ISIA 1PR2A 1Z5UA 3MGBA 4QTUB 4KQHA 4NE7A 2E3JA 1BYIA 3EVFA 3HY3A 1CT9A 4BQIA 1Y3HA 4XOUA 4G56A 3ZE7A 3EH1A 2DUJA 1LW7A 4PO3X 2O48X 4IWYA 2QR2A 3PUWA 4MWEA 4LX8A 2IV3A 1L4HA 2BGWA 2R68A 3GZJA 4FHEA 3SBDA 3I23A 3OPXA 2O1SA 4S3MA 5D3MA 5THXA 2W0MA 3BJRA 3IC5A 1ZSVA 3OM8A 3ABOB 3TSYA 4F85A 2BJVA 2FR1A 3M7IA 2AGVA 4N9QA 1ES9A 3PITA 2P1ZA 1QCCA 3L0DA 3MJ4A 1VKZA 1AM4D 5JCXA 2FLVA 1B41A 5LZ8A 1C4XA 2J6HA 2ISQA 2J4DA 2FETA 1L5HA 3EYWA 3WNQA 1ID8A 1JHVA 2DAPA 1VP9A 2OBNA 2WF5A 1GGFA 2C2XA 2H5LA 4Q4DA 1VHDA 2NXWA 3OEWA 1RKUA 3DWFA 1QE0A 4G0ZA 3SNKA 1JJFA 5TE9A 2GERA 4YV1A 4OX9B 1DZIA 1FRVA 1WY5A 2DERA 2JLYA 5AVZA 1V5WA 2FW0A 4GNRA 1CRPA 1X19A 3QG5A 4JYAB 4WCVA 1HT3A 3SZOA 1MOPA 5HFJA 3SU8A 3KLPX 1W1IA 4DLPA 1CR6A 1T4GA 3N2GB 4A73A 2ENWA 1W88A 3P2MA 1W35A 4V2IA 4UCQA 1J49A 3AQ4A 2J07A 4J1TC 5F33A 3WP1B 1AN9A 4G01B 1A4IA 1ZOOA 2IOQA 3PNVA 2CYCA 2UZAA 4M55A 2PZEA 4CI0B 1TAGA 4PSKA 4LHWA 5JAMA 4DR6B 2Q2NA 1P19A 3B78A 4Q7KA 1CY8A 2JGKA 3G2KA 4MWOA 3FI9A 2VVTA 3GQBB 1DXHA 2Z8YA 4KAXA 4WDRA 3EPHA 4MV3A 3MBKA 2PQ0A 5HZGA 4C4PA 2NO4A 1AQJA 3ER9A 3CX4A 2XVYA 4IF4A 1SPBS 5TGDA 2GBPA 1IVYA 2PL9A 4BRUA 3IR7A 1OKKA 2Z83A 1UOEA 2A9KA 1KY3A 4AZWA 4RANA 2RKWA 1U8ZA 4DLTA 3VR2A 2WWXA 2FWBA 2XMZA 4B71A 1SG9A 3JATA 1BJRE 2H0RA 3IMCA 4NMXB 4QHTA 5E0OA 2JK0A 4YIKA 3RJMA 3SMQA 3NYIA 4EGSA 1UBUS 2PR2A 2QQGA 2AMLA 3TXXA 4X8OA 5LP6B 1PJ8A 3KWMA 1USUA 1T91A 1H3NA 2R84A 3N6VA 3M6FA 3N2KA 2M2IA 1W2HA 2AW3A 4JNKA 4B6SA 1Q14A 1EGAA 4E5SA 2H48A 4GLBA 2XGSA 4GMDA 3O8OB 4M1WA 4BV8A 2PM8A 4IG4A 3AF2A 3WB9A 1ECLA 1U2EA 3HVUA 4IMJB 3VNSA 2QT9A 1WXXA 2JVKA 2F00A 3EBLA 3X43A 1V3TA 2C9YA 1CQPA 2ZRAA 2R4UA 3AVQA 2VYNA 3FJ1A 3NHFA 1Q0SA 1X94A 3G2QA 1GG2A 5DH9A 4F5DA 2IUUA 3U7IA 2VZEA 4A16A 3K1JA 1ZKMA 3NVAA 1O9BA 4PSCA 1N3IA 1OSNA 1VRWA 4I55A 4MP8A 4PEVA 3UEOA 1C8BA 3IUBA 4TPKA 1YL6A 3DLPX 5TSDA 4MUFA 1DBPA 2FSUA 3OEYA 4NOLA 3THXB 2X77A 2YV4A 5DWQA 4CQLB 2FZVA 2OZKA 3OAAA 1C3OA 3VPDA 1XTIA 1BDMA 4B40A 1F4VA 1F8GA 4LBVA 5L3SA 1A4XA 1GLNA 2XNHA 4KIFA 3RQIA 5AI0A 2CMHA 1E9VA 5FUBA 3UFXB 1TUEA 5JU6A 3EY4A 3G5LA 4FE3A 5FBLB 2VXCA 3ELUA 1H6BA 5BSMA 3RVSA 4V0MA 2PX2A 5I9NA 1Z07A 1IOWA 2DECA 3ND8A 4HH0A 5DCYA 4B2PA 3O4RA 3GCDA 4EB8A 2JGLA 5I9TA 4UPEA 2D0OB 3NLLA 5FLYA 4KACA 1TVMA 2NSJA 3DG9A 4GX2A 1J1UA 3ZHYA 4HWOA 3IR5A 2O3JA 2PV0A 1ZQ9A 1MPTA 1XV5A 3DM9B 3ISVA 2QP3A 4FXOA 3S99A 3IA7A 5F5NA 1KIMA 4DC9A 3P0JA 4R7ZA 1GGKA 1VLHA 4CTJA 1E2HA 5IHPA 3SSMA 4YRBA 1GNVA 1IRXA 4PC3A 3QRWA 4XYEA 4YT8A 3SLKA 1QR6A 1CQJA 4CM9A 3WMWA 3NX4A 4KQMA 4ZHQB 4MB0A 2BUAA 4OU4A 1GXSB 5HRAA 3DO8A 2MSDB 1UR5A 2V97A 5EEHA 2JA2A 7ADHA 1ADYA 2PZJA 2IW1A 3RUCA 4K9KA 1BE0A 2FR8A 1B15A 3G2NA 4TWZA 4UUAA 5CA1A 3L49A 5DM1A 4LHZA 5FUXA 1AHNA 2QE7A 4KVAA 1RE1A 2VQ6A 1U65A 3PPYA 4WMLA 3H5AA 5HF5A 5MN5A 2HMSA 4BV9A 1U8FO 4MJ7A 4UM9B 3NP7A 3DQQA 3ZDFA 5PNTA 4NFHA 3TRIA 5CB4A 1E1CA 4J75A 5EMLA 5CG2A 1LSUA 4HBZA 4JLVA 4HO1X 1VP3A 3QKTA 1C1YA 4NZYA 4YREA 3I6ZA 1FRFS 3GJ3A 4H1UA 3RSCA 5K3FB 2B1IA 1E7YA 3UK2A 4A03A 1YRWA 4Z86A 1SQGA 1RPJA 4IDPA 2BEVA 2L17A 1KVUA 5ALHA 3IDOA 5AVQA 5B2ZA 3D6JA 4KXQA 4MA5A 2JFXA 1P3DA 3WKEA 3U44A 3FVQA 4MI9A 1U3TA 3C43A 4B17A 1KDZA 1E98A 5A06A 3AWDA 2YWBA 3LECA 4MW9A 1T8SA 4RVHA 4CIAA 2I4RA 3R9WA 3HG7A 3RQSA 2CLHB 5HSGA 1HI9A 1Z4OA 3JWGA 1IPFA 2AN5A 4JJAA 4BNDA 1XDSA 5JNUA 5AVXA 1YB2A 4PHGA 3VM6A 2H52A 3V4PB 1MOZA 1WETA 3HDTA 3FD8A 3ETGA 5TIIA 3D3JA 1A8SA 4TKVA 4MQLA 1E0KA 2QBYB 2FK7A 4X7RA 2QS9A 5LMUB 1MB2A 3JWIA 4IM7A 3KTAA 3GP5A 5EKTA 2VCYA 3IOYA 1WD7A 3CVXA 1IC6A 4ZJUA 1N1GA 2VJLA 4RIIA 4AQYB 4MB2A 1IZ0A 2ASEA 2VHVA 2YOHA 2IYEA 1MORA 1YJXA 1Z7YA 2R44A 2BFPA 4NBRA 1T2FA 1G16A 2VPXA 4L08A 4EFDA 5JZ9A 1PR4A 4N3AA 3OWOA 4BRWA 3BMNA 3U1TA 3DMYA 3GUZA 3HRKA 1Y8CA 2C5EA 4G3XA 1GAEO 4PG7A 1CJTC 3K9CA 5FUYA 3ESYA 2V6IA 3THOA 4DT1A 3KXIA 5FBHA 3RK0A 2A94A 3SDZA 3UHPA 4XQCA 3B5JA 2V7TA 2G36A 1GQFA 4FM9A 2BBSA 5H4GA 1KTVA 1RZRD 1H42A 4UNRA 1GUBA 1T4BA 5A5FA 4KXYA 3O8LA 1TIBA 3CXUA 4I5GA 5GONA 3THYA 1MVNA 3PFBA 4FIDA 1LLDA 4MRMA 1Y8QB 2O06A 4LX0A 2OQVA 4H27A 1OH6A 4MQ5A 4K9SA 2OV4A 2VUIB 4Q4AA 2NZ2A 1M9NA 2OXFA 2XAAA 4JWTA 3OC6A 3RYIB 1ZPDA 1ZGHA 4KQIA 4TMZA 4EMSA 4AKHA 3OCXA 4Q7QA 2IITA 2PHZA 3JASA 1NN5A 1CR2A 2G3YA 2ZAOA 3KKLA 4TKVB 4C3OB 1RKQA 3PJDA 3OQOA 4YP7A 1KO7A 1T6XA 2VBCA 2Q2OA 5AM0A 3L8CA 1KFJB 3PXDA 4AT1A 3VKHA 1J00A 1Z2PX 3WRXA 3BSFA 3KUXA 3PR3A 2Z8YM 4INJA 4M7RA 1ILWA 4BB9A 5KIAA 4ZT5A 1ONPA 1F17A 2XOXA 4HH4A 2PVSA 4XJVA 1OIWA 4R2HA 5F21A 3VZRA 3ZH9B 5IKEA 1WG8A 1ULUA 4PGFA 3UFXA 1Z4PX 3QKWA 3T1YB 4REQA 2I80A 2P1DA 3B1JA 3DHVA 4FUQA 1LGYA 3THRA 4EELA 5I9IA 3PPXA 3AVWA 4RD0A 2V98A 1J99A 2C9BA 1XZAA 2YX1A 4ZC8A 3K8ZA 1GAXA 1T1SA 4ER7A 2W2KB 1NT4A 4GL4A 3HJTA 3GELA 1AY0A 4WESA 4F8JA 1R6TA 4KFSA 2HHHB 4B3FX 1JSZA 2O1WA 1UAAA 1ISSA 1ZBQA 2CEKA 4MR7A 5FL7D 4BX3A 2ZBFA 1P60A 2HK9A 2G5PA 2I3GA 3KWJA 1TDJA 2VP4A 4N6NA 4R69A 1FP6A 4Y98A 4B3XA 1UKYA 4LHVA 2X3YA 4RVOA 1NE2A 2MR6A 4W5QA 1YR7A 4ZDWA 4Q1AA 4YBZA 3MF4A 2PX5A 1DIRA 3CO0S 4S1OA 1PS9A 4X6LA 1FDWA 1KO4A 4TTQA 4CKBB 1U9JA 3QUBA 2QLJA 4GBGA 2HRDA 1PYDA 4DQ0A 4E2ZA 1N7IA 4BFYA 2VUSA 5C4GB 5E6SB 5LJIA 4X8MA 2J67A 3OC0A 1ZCFA 3KAQA 1KL7A 2PNFA 1JEOA 2P5SA 4RMHA 3CNLA 5FBWB 4P8RA 5CM2Z 2CVOA 1A82A 2NMVA 1Q3KA 3VJKA 4UE3S 3R3VA 1ZK4A 4X3OA 4MIYA 1UKBA 2WIGA 3U60B 4PAOA 3FYDA 1IG3A 2VP5A 1TVEA 3KQLA 2R1TB 4G1VA 2GTIA 4RQTA 1G3MA 2C2BA 1Y5LA 2OCBA 5CBPA 1P7WA 5U9CA 2PBZA 4G1MB 3GCGA 2ATCA 3RRYA 8AT1A 2XXAB 3W5CA 2QGNA 2I34A 3FCCA 4ZA2A 5I8PA 1DKNA 2AG8A 4CPDA 2FP4B 2FHPA 2YXEA 1YA8A 1JZSA 2PRSA 4NS4A 5CYOA 1Z4QA 1NYRA 1K1EA 1X3LA 2I2FA 4FFPA 3M2TA 2B5WA 1M6WA 3I3OA 2DHQA 1EHYA 4BKOA 4JKOA 3ZK8A 5C5IA 1WBDA 1RAHA 1E0SA 3TQQA 1U8AA 2VZLA 3MZ0A 5K3CA 5JXJA 2DBYA 1R8SA 3P0HA 1N2JA 4WVLA 5BSFA 4UVEA 1PWYE 3IMFA 3RANA 4O2AA 3DEKA 1IHYA 1BQ4A 3BH0A 3VHXA 4CHTA 3LLVA 1UINA 1OVMA 2ZE8A 3D3WA 4K9PA 4QFMA 3WFIA 3HMQA 1A9XA 1FB5A 1RJGA 1VRVA 1UPTA 1HMYA 4EPYA 1DTSA 4XIIA 3RTDA 4Q9NA 2H4XA 4F60A 1I36A 4O4JF 1TT5A 2FWMX 1A76A 1NSFA 4PY2A 2HWWA 1AK2A 3UH0A 3V4VB 1SAYA 2Y3IA 2I6XA 5LOVB 3IL2A 4AMZA 3EW7A 3UN1A 3OKAA 1ZNZA 3KZVA 2C98A 4QKQA 5EOVA 3FX2A 4DLAA 5CYPA 4J8PA 5C52B 3K9QO 2FUG6 1J06A 3HCRA 4XVCA 3DMHA 2GXUA 3DBVO 4OJNA 4I50F 3OIWA 2ZJ5A 1PBNA 3T61A 4EYOA 1HNZB 3SYMA 2V8BA 5JJ5A 1KI9A 3C4QA 1NVVQ 4G0UA 4CM9D 1FLVA 5LLDA 1OYVA 1ZNXA 4QOFA 5AI6A 2QD2A 2PYDA 5BR7A 1R15A 3ZOKA 4CKWB 1I0LA 4AG6A 1G0NA 2GVNA 1A50B 3ODPA 4DMLA 4YMTA 3AETA 3L0SA 3M83A 1QU3A 3C3DA 1KO8A 1P73A 1DMRA 1GZDA 9MHTA 2JGRA 2ODTX 4L1KA 4NFLA 3WHLA 2XYQA 4B35A 2I33A 2Y0BA 3DVQX 1FVHA 3TAUA 4PZZA 5BVHA 1JR3A 5AVKA 4NENB 1DC5A 4MQ6A 1Y5RA 2PO7A 3R74A 3UMCA 4Q9DA 4OHUA 2QRPA 3PTLA 5LDGA 1U7TA 5DNUA 1H1TA 1VHTA 1BD4A 2QTLA 3AGPA 3ZLTA 4D81A 2I6UA 2MMGA 4KO3S 4HR7A 2DPXA 1GVHA 3PWSA 1PGPA 4FW8A 4C06A 4Z9AA 1QGZA 5KOJA 4B3GA 2HA3A 4ZEVA 3LBAA 4JWKA 5FPTA 4NYIQ 4EG0A 1F5SA 3PSAA 3DTYA 1Q7BA 4IZIA 1VLVA 1W48A 4FZVA 4PV7A 4FYWA 2CL7X 2JFUA 3KLMX 4UNNA 5CH5A 2UUBB 4GX0A 4L8YA 1N6OA 5L3ZA 1FQKA 3E1GA 5EJGA 4MWSA 1T8WA 1OX4B 4EUFA 7REQA 5C1IA 3LBFA 2IYSA 2CNWD 3LCCA 2GYYA 4LPKA 2VJAA 3FFAA 3QTLA 2VP9A 1AB5A 5JDCC 2YFQA 2FPGB 2Q3LA 2Q4TA 2I66A 2NO9A 1BHSA 2V9PA 4DKXA 5JD5A 1PK7A 3ICPA 5AW7A 2JVJA 2HO5A 2I8AA 2CBXA 2NZ8A 2R6FA 3NVMB 5CX4A 2ZRIA 3EPKA 2NG1A 5DI3A 4F2PA 1YZNA 4QJ5A 16PKA 1PFQA 1X7HA 2FEMA 3FDJA 4ZJPA 5KOIA 5HRUA 4LF6B 2HQBA 1ZH8A 3DZ2B 2Q5CA 1PKEA 1PUIA 1THMA 4JLUA 1KH1A 3IQHX 2BZ1A 4BU1A 5BQ3A 4WCFB 1H0SA 1UBSB 1RWVA 5EKSA 1KYQA 1D1PA 2IBTA 3VH3A 2B7LA 1PJZA 1WZIA 3UHFA 1DFHA 4RL6A 4QU8A 3W3ZB 1B93A 2DQYA 2FKAA 3FGOA 1JGTA 2GJSA 3AHGA 4YT4A 3MGKA 5L8VA 2QTAA 4MCHA 3AEKA 4KKVA 2BPOA 3IV9A 2CHEA 5CRIA 4F71A 1T0UA 4WH0A 4UQOA 5M5BA 1Z82A 4B4UA 1AX9A 4LRUA 4WADA 5M34A 5CVJA 4S1NA 1TYEB 2RJOA 3BB1A 3RROA 3TO5A 4TZKA 4X97A 7MDHA 2YRXA 4YVFA 3OX4A 2F17A 5LL6P 4J0GA 4OQQA 1RZVA 1ZUNA 3P7MA 2XTNA 4HXFB 1ZH2A 4YJGA 2B82A 3Q7SA 1DMSA 3KBBA 1CUVA 3EUAA 4PFKA 2HMUA 1P4GA 3S2UA 2P9CA 1ZKDA 3NWOA 1XNRB 1DJNA 3CCCA 5CK5A 4IDNA 4YP6A 5EMNA 5IBCA 1LPNA 1IXKA 3D7KA 2X9LA 3QF4B 4BASA 4ZVVA 2DFNA 4AXBA 1ZGBA 1CYEA 5KSPA 2QIOA 3URMA 2P0YA 1M1NB 1Z6GA 3GGPA 1JTFA 4GYJA 2ODBA 2R1VB 3AV3A 3Q72A 4HQLA 4M87A 4PZUA 1W44A 3CX8A 3TL6A 3W1VA 4AWAA 4DSNA 2CNKA 4E5YA 3HVRA 3MHTA 1QTQA 4Q9AA 3FROA 4ND8B 3RRMA 4RW0A 4XXHA 1DKMA 2AJ8A 521PA 2I4LA 4C07A 1UKVY 3NTOA 5BURA 4MVJM 3PEWA 2VPTA 4L6AA 3RFVA 4KJZA 2ZRJA 3HS3A 4XWKA 1T1RA 2GM9A 1QAOA 2NYVA 5GAJA 4YAUA 3MOIA 2JGDA 2L2QA 3Q0TA 4BNHA 1WXGA 5E2IA 1VLMA 4MJLA 2VUUA 1VJ5A 1EK1A 1F2TB 1JUDA 2W43A 3WYEA 1X1TA 3ES9A 4ZCQA 3X1KA 3S1AB 1HRDA 3ZI4A 3ITEA 4FWIB 4M2LA 5AJXA 3OKPA 4FWTA 3QI7A 2Y0PA 4GZ5A 3ILYA 1O89A 1XDBA 2GNAA 2KBEA 3PDCA 3FR7A 1AUQA 3VKFA 4YCMA 5KOYA 3IXLA 3FSJX 4IHJF 3DZKA 4BMZA 3EVEA 1QVRA 5A5VA 2MU1A 4US0R 3P5SA 4D41A 1GY8A 3F7NA 4CEIB 1S2NA 1E7WA 1LJLA 2WINI 4BN4A 1NHGA 1ODCA 2H5EA 1ONBA 5EESA 2OO5C 4I99A 4IINA 2BCGY 4RPKA 3OPYI 4IS3A 3EXHC 4CV1A 5GVRA 4MYTA 1ZN2A 4DEVA 5BN4A 3KETA 2O2EA 3L1KA 4WK2B 1P44A 1WNFA 1NQVA 5F4BA 1CSEE 2Z43A 2R65A 4FU0A 4CLXA 3R8CA 4Q3BA 3UOAB 3DHNA 1TECE 1BQ3A 1P8AA 2FPPA 3EEYA 4JJ4A 4JHLA 2ATXA 4ASUD 3H9UA 1XTUA 2VH1A 2JG3A 3PJEA 3U4AA 1U94A 2EQ5A 1YH3A 4RIEA 1KXZA 4YCJA 4G5GA 4O02B 1E99A 2JZCA 1N5JA 1SOUA 4PLYA 5C2JB 3PQVA 1QWSA 2VLBA 4K9RA 5FWYA 1ZM4A 3MM4A 3QY9A 4UAGA 1CZNA 3EG9A 2CJWB 1KHTA 1SM4A 5TMPA 3CGWA 5DHTA 4DMFA 1KMHB 3EPJA 3O82A 2BBWA 3I2KA 3TOSA 2A1TR 2A3RA 2CBGA 2DZDA 2WA1A 3UG7A 4EJSC 1KR2A 1EAYA 1HBJA 1RHJA 2FRDC 4YB8A 3R3SA 4JODA 3S40A 4D25A 4X7MA 2FQXA 1NW8A 4AJ2A 5BR8B 4YNBA 3OCWA 2BEVB 2R4TA 1IN4A 4F92B 2BHLA 4QDJA 2AC2A 3E61A 4JEHA 4QE3A 3U9SA 3P2JA 4F45A 721PA 3P9IA 3RHSA 4Z53A 1X77A 4YLGA 2BRUC 3W2EA 2Q0SA 2DT8A 2VDQB 3I6MA 1Q50A 2XWQA 1SZCA 4HDSB 4XE5A 2QNRA 1ZCBA 3ELBA 4LYAA 4NJEA 2IDZA 3IAS6 3PLAE 4X1IB 3H5TA 4NBSA 3VO9A 4OK5A 1CEXA 3IAFA 2O8FB 3H8SA 4LYYA 2IHJA 4OAPA 5H3HA 2SCUA 3T52A 2Q1TA 1RPNA 2FRVA 2C57A 2C95A 1P3JA 2OCKA 2PUWA 4K5QA 4Z8YA 4DZZA 3O2SB 5KX5F 1NMYA 1EM8B 5KNCD 1ZR2A 2WB2A 5AJUA 2G72A 2XA9A 4R1LA 4LJLA 4PLPA 4DYDA 4GI3A 1A9OA 2WJJA 1M2JA 3TR6A 4LZWA 2I29A 3JU3A 2OB2A 1X1BA 4WBXC 1DG3A 4ZOBA 2RGEA 3K15A 4ND5A 4IRUB 2R8PA 4BMNA 3AM3A 2AK3A 3KT8A 1ATIA 2Q29A 1QH8A 3LVQE 1SY7A 3N76A 1L1FA 4H2DA 1DIHA 5LBIA 4UHEA 1MJNA 2A6PA 5EP2A 3BTOA 4ZGGA 3TB6A 5JRJA 1UAYA 2V96A 2ZZMA 3H9QA 1UODA 3KEOA 3TZCA 2QTZA 1CERA 2BHRA 3UKDA 3QEBZ 3NEJA 3OZFA 3EXAA 2CD7A 4WASA 4MRRA 4CL0A 1HYBA 3NUQA 3ONEA 3FBTA 4O4HA 5A5GA 2DB3A 3GT3A 4RKQA 2WYVA 2JVIA 3OHPA 2XT0A 1CC1S 4R2WA 2ZTSA 3QLUA 2DHDA 3HB7A 3KZNA 1Z4NA 3HZZA 1E1NA 1I4WA 2YFYA 1QMGA 3GD7A 5DMHA 3TD9A 1YULA 3C39A 4WKNA 2F8MA 3W3AH 3K09A 3VZDA 2PSSA 3C7AA 1YJQA 3PC7A 3ETDA 4KNWA 2F64A 4EHNA 1U1IA 5TXGA 3T15A 4BB6A 1G7TA 1HETA 4MS3A 5EIWA 1UL1X 5IDXA 5L9AA 5SYMA 4D9IA 5IF3A 1EDOA 1TCAA 221PA 3MRTA 4EJ2A 2PUJA 4W99A 2OBFA 4HQOA 4QWMA 5I9BA 4H7EA 4URXR 1N0IA 4Y2RA 3D4LA 2NXJA 4M9RA 1XZLA 1ODIA 1ZD3A 3N2IA 2E18A 3IR6A 4N8EA 4P6VF 1YZYA 1Q77A 3DZIA 3PCRB 2W6MA 3U7FB 5AKGA 4Y0AA 3V5NA 1QFYA 3RFFA 1R4ZA 2Z3WA 1ZHHA 2AI2A 4XFDA 2BMJA 3AEXA 3K72B 4MEBA 4QSHA 3VX4A 3VTZA 4AF8A 4EJSB 4F6LA 1JKXA 1JP7A 2A9JA 3HN6A 3NO4A 1Z8HA 1EPUA 2QQEA 4HFNA 4ETNA 2VAMA 2J08A 1NPYA 4MVXA 3C7TA 1TXGA 3FWKA 2X4IA 2XLCA 2PAAA 3SKXA 3RT7A 3T7JA 1KEEA 3J81k 4A2WA 1IEXA 5MFPA 3GHYA 3MTAA 1G2OA 1VKOA 3DZ5B 2IEBA 3JZAA 1UJBA 4YACA 4O1IA 3HCAA 1YBHA 4KIWA 3ZHCA 4YDHB 5H0IA 4PVCA 3SZUA 3X2FA 1O58A 3JD1A 1H0KA 4RV4A 3GAFA 3GFTA 5JXGA 1QVWA 5G40A 3AKCA 2GWHA 2JKYA 3AFIA 4ZHQF 3Q7EA 4DB2A 4DWVA 5MN4A 5FYDA 1QNLA 4PCUA 1B6GA 4M1QA 3D6UA 1LTKA 2AG6A 5EVJA 2OHHA 2E4ZA 3BQNB 2JGEA 4LFAB 3DWEX 4A9AA 1CXZA 1EXDA 3D8HA 4GECA 5AJWA 1AF7A 5DLPA 1RCFA 2BKAA 4UHDA 3TR5A 2B36A 1XKLA 2H1VA 3UK1A 4A4DA 2ZB7A 2GSWA 5KX5B 1MBZA 3VTFA 5T7BA 4RQUA 2N9UA 1Z6XA 3VJRA 3X44A 2JAWA 4N49A 3K8QA 3GRCA 3NT2A 2AKEA 4KE9A 4LEIA 2H7YA 3AFGA 1NE7A 2J9ZB 4DDHA 4QHYA 4QDUA 3ZWMA 4WKGA 1IEWA 1KPHA 4UTXA 1B8UA 4PCAA 4DWWA 3UJ6A 2RD2A 2AMYA 3E9DA 1YMVA 4XWWA 2BFOA 3LQFA 3SWWA 5I3ZA 3EIHA 4TRMA 1OGYA 3STWA 1OHHD 4DMMA 1GRVA 5EIBC 5K4HA 2HBRA 4P1ZA 1S7GA 821PA 3R09A 3E22B 1A97A 4JT8A 5LBTA 4JBXA 3BGVA 3M6IA 3QPBA 1X0VA 4CUZA 2PU5A 1ULHA 3KD2A 5EEGA 1IBMB 3VR6D 5CGZA 3DW3X 4GRAA 3DZJA 3UV3A 4LMBA 2Q0HA 2F9LA 5EMMA 5D51S 5AMXA 5AIBA 1T1JA 4Q4HA 4RM3A 3TSWA 4BNTA 4Y2XA 5TQJA 5TMEA 5B3KA 4KQGA 2HNAA 3D0QA 3PJGA 1G19A 2GN9A 4Z8XA 5IK2D 5FP0A 1QGUB 1P5HA 1T3TA 2I1WA 2Z1MA 2XCQA 3LW7A 3MA0A 4XDZA 4XFJA 1G8FA 4JT9A 3TLGA 4ZVTA 4EKYA 1Q7TA 2EEPA 3AIIA 4NCXA 3AR2A 4Q1FA 3VPFA 2XX3A 2HRBA 4G8JA 4QLOA 5A3RA 5KTTA 3Q15C 5CD1A 3RLFA 1VHJA 1IMJA 1ODLA 4HJRA 4D4LA 1JLLA 2FSVC 2G08A 2ZIAA 2R6DA 4JJ8A 3SS8A 4DLVA 1YDEA 2H51A 3JS5A 4KKXB 4KO1S 4G1FA 4X54A 2HF2A 2KQUA 3ZTYA 4DL9A 1IY1A 3COWA 4BMXA 1BVRA 4B2IA 1R37A 3DTNA 3BN3A 3RVLA 2IY7A 2JI4A 4PM4A 3ZG6A 3OICA 4ALIA 2AOXA 3MJVA 4JBLA 4UJ3A 1PS8A 2HTEA 4UPVA 3QYFA 2ZREA 1P1BA 4MS1B 4PINA 4D9HA 5I45A 1LWOA 1P6QA 4PN3A 2JEYA 1KDOA 4I36A 3AUTA 5KVVA 1NJ6A 1BMQA 5A1JA 5EUMA 4J9VA 3R7BA 1BU5A 2RIPA 1L4GA 1W0KD 4HWGA 5CJ2A 5A04A 3EE6A 2FEAA 4CMAA 4IGFA 5DOZA 1R5OA 3L8YA 4BQQA 2BR5A 3QXJA 4Z9BA 3JYNA 2Z9BA 5AHRA 1XQVA 1K8RA 5TJHA 3S2SA 4JP3A 1RKBA 3KSDO 1DQNA 1F06A 2VJDA 3PXUA 2JCSA 2XMCA 5JISA 3S8EA 2IYOA 3OX2A 2WE7A 4H1HA 1MA3A 4IQGA 3LT0A 3ZE2B 3O8QB 3C1OA 4ICIA 5F73A 3J7AC 3OTOB 3GRRA 1XXHB 2JAQA 4PTYA 5AVRA 4YRQA 2YXNA 1TYZA 4MV8A 2GZRA 5CPBA 1YRAA 1OTXA 1OW3B 2X22A 2FJUA 2JJ1D 2QAGC 3M1YA 3WOVA 5L3QA 5E6RB 3ZU5A 4RA6A 3VO8A 2I9KA 5FTMA 4RQAA 3GN1A 5L3RA 5IJZA 1CEEA 1YQQA 1G42A 2VRCA 2BEJA 1ZJ5A 1Y7LA 4R1UA 1R6BX 3DOCA 2Q4BA 3ENZA 2AF3C 4UDYX 5HQJA 4M9XA 5JCOA 4FNOA 3NHBA 3SHOA 1H4SA 3DDOA 2I3ZA 4C0LA 3WFZA 3QUTA 3SPXA 4QX6A 3F2IA 1O96A 4IDOA 3ND7A 1NJ1A 1EU1A 1E94E 4S2UA 1CV2A 1D2NA 1MX3A 1NOIA 1OGIA 5AOAA 3U40A 1W0CA 1IK6A 4KIJA 3DZ6B 2V7PA 4QPPA 3IBFA 4LOAA 4R1PA 1TJNA 3Q7QA 4QUGA 1RBZA 3RUDA 4QTTB 3DE0X 4BFWA 1I7NA 2ANBA 2GRJA 5JCOC 2EWMA 5E6SA 3CNEA 4KQKA 5F78A 2FA9A 4MCIA 1OIXA 4YX9A 4MUEA 2OM6A 3BD8A 3D0KA 3GRFA 1S1MA 5FBQB 3HLYA 3K0CA 4KN6A 3TRFA 1H6AA 1IQUA 2PVCA 2EG9A 3IVMA 3WRXC 3OT1A 2FFBA 4LJKA 4AZ3B 1ULAA 1TQHA 4ZZ2A 2WIBA 1N2ZA 1V45E 3VR4A 4TTRA 2JHGA 1XNGA 2MYPA 4ISBA 4A0SA 1JPUA 2ECPA 2G7ZA 3TF5A 1IM2A 3UHAA 4A15A 2GPSA 2JDIA 2QW0X 4OI0A 1R2QA 3BK7A 1O4WA 3MMNA 1TRHA 4FDUA 4N18A 3CW8X 3TBKA 3GFQA 5I7HA 3QVLA 1UMBA 1VCHA 2H54A 5KU1A 1HRKA 4REQB 2BR3A 5E3JA 3G85A 1C7QA 3W6PA 1YF3A 1YVUA 2DWPA 2NU6A 4QOIA 3ZY2A 4JUIA 4L0QA 3T7IA 4EB6B 4AS1A 3NEPX 3ZNOA 1JEYA 2WRZA 1SWWA 5JYAA 2QG6A 2YJ5A 5CB4F 1HOXA 4WNYA 3GRAA 3O7WA 4QYIB 3LBHA 1TJ3A 2V9CA 5AICA 1H2ZA 2VYVD 1RZ3A 1SUAA 1Y82A 3QMVA 1PFGA 3VZBA 4P4TA 2ZSKA 3I0NA 1LTQA 1A9TA 1EE1A 1Z22A 2D5BA 3UT6A 3EXFA 1XWFA 3CLRC 2IFTA 3OM1A 4H1WA 4GXQA 1SCIA 1IN8A 1O0SA 4HAUA 1THTA 2RGRA 4UBLA 4PG4A 3WQBA 2ZFUA 2WJHA 1A27A 4RFVA 3TOCA 2BGKA 3BDIA 1EUCB 3WOHA 4BNUA 2IUTA 2JASA 1C7JA 1JSCA 5FT9A 3WZ2A 4E3WA 4I66A 1GPYA 4MW5A 5H83A 5BRNA 1JFTA 3LFUA 1EFVA 1XZDA 4DUGD 4HYYA 2ZQZA 3LLCA 3EVDA 3OM9A 4BMVA 4YCAA 1KAGA 1CQIA 4FC7A 1QK4A 1MQAA 1WXQA 3LDGA 3IWDB 5C4MA 2GFIA 3C45A 1P9OA 1ZGJA 1GRCA 1N33B 4FD3A 1J0CA 3MB5A 3UT0A 2XODA 5AUQA 3SG0A 3WXMA 4ZJZA 2AOUA 2YHIA 3OE7D 2BFAA 4O8CA 2ZLBA 3COYA 4LYFA 1RJ9B 2Q28A 3A32A 2OYSA 3B6MA 3ESQA 1HE3A 2QYSA 1G6OA 1MMFB 5GZ1A 3BORA 4LXYA 3U7QB 4F12A 3LY9A 1BWPA 3TN7A 3GDFA 5L3VA 4F3CA 5JVDF 1EWQA 4GKVA 1C1DB 1Z15A 3C3BA 3LYUA 2QMOA 3PJFA 4CW7A 5MDHA 2NVOA 4ZWNA 3DGFC 3H2SA 3RAJA 3RSZA 1YOVB 2ZVDA 2V65A 1NM5A 4NBNA 4E4YA 5KBYA 2WMOB 2XWJI 5FJIA 1SHLA 3O8BA 3SOPA 1JR3D 4B6RA 4RY0A 3ZGNA 3EVZA 4CNQA 3DDSA 5DNYB 2XNDD 4JMPA 4P38A 1GDHA 4B0PA 4DJJA 3MILA 1V6CA 2VR1A 3IP5A 3H6KA 1UJMA 3GEHA 3I42A 1BW9B 4YS6A 1VB3A 4PRLA 2IPXA 1KJ9A 3KQQA 1ZGAA 3F5SA 5ESWA 3GLFE 3ZV7A 4OUKX 4HL6A 1MHMB 2F43A 5A2QA 3U44B 1Z3CA 3V8NA 1AVTA 3L7YA 1UP4A 4L3VA 2R8XA 3TR0A 5JADA 3NP9A 1HL7A 2NUPB 1EHIA 4B0OA 2C78A 4WVFA 1II0A 2R6GA 1VPEA 1T5IA 4N4AA 1QHGA 2F1OA 4FYXA 3JQGB 4DYVA 1YQEA 3KV1A 5FTJA 5IFLA 4IDHA 1IN6A 1SB8A 1XFDA 3RVDA 2J33A 4BN0A 1E2FA 4L5JA 4W8OA 4C4XA 5CB4B 1GZ6A 1YB7A 4O4IA 5LQNA 4JFAA 1KORA 4XPIA 2PKQP 1CHNA 5JZMA 3O91A 4L4XA 4TT8A 1NMZA 1XXHE 2EKZA 5JE8A 5KQPA 2IIQA 3D9QX 2ZSHA 5F2NA 1PQ4A 3JZDA 5CLIA 2G8NA 3ZEAA 2VK2A 5JBIA 1KYVA 3LUGA 1REQB 1XMPA 4JYZA 1KZ9A 3AO0B 5E6UA 2C07A 3QVTA 2DP4E 3F9CA 3IPYA 4QYMA 6NULA 3JQAA 1QAQA 4C1NA 3BWXA 2G1KA 3NASA 2YMMA 3FBWA 5EVCA 1ULTA 2B3TA 2IX3A 2M1ZA 5JAZA 1I5EA 2IYXA 1D03A 3M6VA 1VPVA 4NYJR 5CFNA 2Q0XA 4AZ0A 5FWXB 3MERA 4RAOA 4RK5A 1ZL0A 1HOTA 3EUFA 4H4DA 4XM0A 3VSAA 4F4DA 1F4LA 4B8WA 3KBOA 5HZHA 3QA9A 2Y1KA 2GJ8A 2CNOA 2X14A 2HXSA 4ZVMA 1WHSB 4P2GA 1Y5NA 3X3HA 4DREA 2PO5A 2FZGA 3SLGA 2Q3EA 4HEA1 4EG5A 1GCOA 5KYVA 3IVAA 1SU7A 4E33A 4LC1A 3RT9A 2FEPA 3FUUA 3ZGVA 2I3DA 1YHZA 2F3QA 2KYRA 1KBZA 3OIGA 5K3AA 5DYTA 4HC4A 3U6KA 3P9PA 4FX2A 2YHAA 4ND8A 3EDYA 5C32A 2AZDA 1NP7A 3P0EA 1P9RA 1XC7A 2W58A 2ZAGA 3QY0A 3TINA 3VHQA 4C05A 2V6JA 5FV7A 1KYTA 3EFEA 1O03A 3B2NA 1P80A 1FSFA 4MPPA 1CQIB 3WB0A 3DE7X 4Y6GB 1BWSA 1XTTA 1Y48E 3PFIA 1LU9A 1ULZA 2XDQB 2YZ7A 4R9SA 1KWKA 4NCAA 2V7BA 4I9FA 4OTZA 1ZUWA 3K6KA 1YDGA 4GI7A 3QMWA 3ZZTA 5KYWA 2FKNA 5HDBB 3TTSA 3CB4A 4ZGBA 1E2IA 3B1KA 3EC2A 3KQOA 1LDYA 1N9KA 2VQEB 5K8LA 1Z12A 2L42A 5TQ0A 3TQTA 4RVGA 1C3JA 2CCJA 3T3PB 1EWYA 3PNPA 4F4HA 3HJNA 5A02A 3NYRA 1N5IA 4F9GA 5KPJA 3NNSA 2EJCA 1VJCA 3HBMA 2VQDA 3EA5A 1CJVC 2KPOA 1CF4A 1ZHOA 1VXOA 5FWXA 1M2VB 4MUAA 1GZHB 3GARA 1XTKA 3GT7A 2VC2B 3P2IA 3B5IA 5EJ2A 1W2WB 2Y05A 3NWJA 4J0QA 3VGJA 3VR1A 4GU5A 4EW2A 1DX6A 4B8ZA 4DPKA 3SCZA 1AHPA 4U3JA 3V34A 2DKFA 4ITRC 3QLVA 5I9MA 4C7OB 3MPUA 4MUKA 1NSYA 1GD1O 1C8VB 1NR1A 2DM6A 4HPWA 1V4BA 5ALYA 4BECA 3BICA 1U0TA 4G09A 5K3EA 3CF0A 1ZN9A 3RHZA 5EXDA 1PZEA 3COPA 5KYYA 4YV2A 3HM2A 3PD7A 2AJLI 2HAEA 2JFBA 5HKBA 3MCTA 4AYWA 2IPOA 2RMKA 2W4IA 4NCJA 3FWNA 2J9XB 4BLPA 3A9RA 4QT0A 2HHLA 3W4JA 1BCSB 2PMCA 3ZI0A 4IIBA 3DULA 1XL1A 2DBQA 4NWIA 3FDZA 2O3SA 3CUKA 3X1ZA 4S1PA 4LS3A 1W581 3THYB 4LY6A 1SU4A 2LCQA 1PJAA 2KLBA 3KUDA 1TCCA 2HLHA 4MR9B 3DLAA 1JG6A 2YBDA 1KSFX 4P7BA 4ITVA 1WNTA 2FQWA 1R6XA 3ED5A 2P6NA 3MS2A 4EI2A 3HRIA 2A67A 4WK4B 3WLMA 2ONZA 3QOYA 4HWTA 4J6FA 3LUJA 4EMUA 1QQAA 1IB0A 4ALMA 4E13A 1TZJA 1J20A 2IP2A 4US1R 4RACA 3W4IA 3SYKA 1C9YA 1IQRA 3IEIA 1KP3A 2QN9A 3QG1A 1O6ZA 5G4KB 1Y6FA 4IH1A 2GASA 2VZ8A 2DUWA 2EP8A 1RLOA 3KYDA 3RRJA 4R2LA 3WWEA 1LV7A 3O38A 4RH3A 4V38A 2AW5A 3SF0A 2RC6A 3A2KA 1EZ1A 2X76A 3TL2A 3E2IA 3IUQA 3LDAA 4G6ZA 2W6JA 3L07A 3AIOA 2Q50A 2LTAA 3E5HA 2VAPA 4I2NA 3WA7A 1E63A 2A9VA 2VDUE 3FTQA 1CVRA 4HNGA 1JX6A 2ID7A 2JAPA 3M81A 1U2ZA 4LHYA 3P26A 4Q01A 3VUFA 1BIFA 3T7RA 1K8QA 1WRBA 2RGXA 3DCYA 3MFQA 3EPLA 4OQ4A 1Z6TA 2ZG6A 4O59O 4BFZA 4BEWA 2GZ1A 3COZA 4PPFA 3BZBA 1A88A 3O2QB 4JEUA 4YO8A 5J59A 1U90A 2HI0A 2P8SA 3WBKA 2JFZA 4C2BA 3FMFA 1GNRA 2J3DA 4BCDA 1M6VA 2GEBA 1X7GA 3I52A 2FFJA 3M4ZA 3K9NA 3Q6IA 1WR8A 4LGYA 1D4ZA 1PQWA 2R8OA 4ARAA 4UMDA 4HP8A 5EPUA 5AJVB 1MN6A 5LP6C 4IV8A 4A8JB 1XHEA 2EHDA 3GNSA 1W46A 3JQRA 1VBNA 4XB2A 5AW4A 3UAOA 5FPYA 3ZPXA 3DMTC 3P0IA 4GQIA 4WIAA