2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
b'ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dimeric dihydrodiol dehydrogenase
publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
2VOEA 4MVJA 3LLVA 4BIIA 4J4BA 5AXDA 4ZQHA 4CPDA 1GL3A 3FD8A 5A04A 1PGQA 4EW6A 5KVSA 3WQQA 1DHRA 3I5MA 1X13A 5DN9A 1DIBA 2A4KA 4WLUA 4L4XA 3K30A 5ILGA 2YW9A 4IIVA 2O48X 4R9SA 3KHUA 4MIEA 2DVMA 2DC1A 3IAHA 5K6AA 1Y9AA 5L4LA 4J0EA 4BS9A 2VT2A 2BGMA 5L4NA 1IZ0A 1IYZA 3ICCA 1F0YA 3GEDA 4Y6RA 4FW8A 4FDAA 3IDSA 1JKJA 1HYEA 3GGPA 2OBNA 3WMXA 5I7SA 2IZ0A 5AVOA 1LSUA 1QP8A 4E5PA 3C3XA 4RJTA 3DZFA 3O26A 2VHWA 2GYYA 3JD4A 1WWKA 2PGDA 4Z9XA 2TMDA 4BO3A 4GMGA 1PJCA 4AJ4A 5T67A 4EJ0A 1IL0A 3CE6A 1ID1A 4J3FA 3WBBA 4PLGA 5HM8A 3OEYA 2D59A 1AN9A 1GCOA 4BNFA 7MDHA 2X22A 3WICA 4IJKA 3Q3CA 4CLHA 1P1HA 3KM0A 1O8CA 5TC4A 4JN6B 5HA5A 4GPD1 1PQWA 1IPEA 3HADA 1QG6A 3R6DA 1VSUA 4RCVA 4RVSA 2H5LA 1PQPA 3Q2KA 3DMTC 3KYCB 1YXMA 4MVJF 1H94A 1ZO8A 1MC4A 1RM0A 4OGWA 2A9FA 2YQ5A 4YJHA 4BNWA 4R3NA 3DC2A 3VOSA 1EVJA 3OBBA 1SB9A 2Y1CA 3Q6IA 1P33A 3HN7A 3QW2A 3FCOA 3SJUA 3GN2A 3QWBA 2IXAA 1I01A 3PYXA 2J3JA 4PLPA 1EMDA 2D0IA 3PIDA 3D5TA 3JD2A 4YAJA 1B2LA 1XGKA 2IZ1A 2JAHA 4IZIA 1PR3A 2VWGA 4RLSA 1XYGA 5T8KC 2BELA 1ZMTA 1CRWG 2FR8A 4Q3AA 4D42A 3H5RA 1DAOA 3S2GA 1W8DA 1VI2A 1I8TA 5TLSA 1LDBA 1YQGA 1N1EA 3ZWWA 3AUTA 4EGFA 4AJIA 1LC0A 3H3JA 1NQOA 1C1DA 1E6WA 4J2OA 5JDCA 1YBMA 4ALMA 4I8XA 1I0ZA 2FN7A 2JAPA 4DBVO 5TT0A 2QZZA 3RC7A 3TWOA 2GGSA 1W6UA 3MCVA 3RC1A 3ASUA 1ULUA 1SAYA 3F4BA 5JAZA 1K3TA 9LDTA 2IRWA 3ZNPA 3PQEA 4I5EA 4OOEA 4HY3A 3PHHA 4ZRNA 4BO5A 2X23A 4H15A 4WOJA 4CMEA 3A28A 4BNVA 3IJRA 2VYNA 2AG5A 2ZK7A 1GU7A 1UDBA 2WTBA 1VE9A 3WTCA 3KV3O 2YZ7A 4E13A 5COAA 3T4XA 2G76A 3RJ5A 3VKUA 4WLEA 3R3SA 4BGEA 5IN5A 3PXXA 1XKQA 1ZK1A 1UP6A 4P4LA 1P1RA 2JD1A 4OQYA 2RBEA 2GNAA 4CM8B 2C82A 5IZCC 4FFRA 4CMIA 4ZQFA 2EKPA 4IINA 4IQGA 3I23A 4E5KA 3GNQA 2GASA 4OXYA 4U5QA 4Q9NA 1NVMB 1X1EA 2YYYA 1ISJA 3RU7A 4EUFA 3HB4X 4NZ9A 5GZ3A 3GLQA 3VKVA 1E6UA 3OIGA 2B5VA 4UULA 1JLLA 4XGIA 5TJHA 2X5OA 1E92A 4B7UA 1SMKA 3EUWA 1GCUA 4ROSA 1OMOA 4I5DA 2D1YA 2VCYA 1JAYA 1R4NA 3GAFA 4L8VA 4ZU3A 1NAIA 1E3SA 2UDPA 4CV1A 2FPGA 4D79A 3DBLA 3GPIA 9LDBA 4CR6A 4WLFA 4TRRA 3IJPA 4B3IA 5G0TA 4FQ8A 1WXDA 4RPJA 3HDQA 4HFJA 5L3ZA 1U7HA 4II3A 1H9AA 2X7HA 1DDOA 4NBUA 4OXKA 5K6AC 3NTQA 3BHJA 2FZEA 1P0FA 3O8QB 3I9MA 1NTOA 1NHGA 4NFHA 1BXKA 1OOEA 4CM4A 3AFMA 2OZPA 1U1IA 1Z74A 2ZQZA 4XQ9A 3DZHA 1SB8A 3JQ7A 4WNIA 2QQ5A 2YV1A 3EGOA 4GX5A 4DBZA 4W82A 1WZEA 3UOGA 2HDHA 2AMFA 3ORFA 1D4FA 1VL0A 1W0CA 1LDYA 5JMWA 4J6FA 4Q3CA 1MX3A 5FEUA 3T4EA 3U4DA 4RVDA 4CODB 4BQPA 1KC3A 2CD9A 2VRBA 4E5MA 2W8ZA 5KJ6A 1MV8A 1BHSA 1RKXA 3GNTA 2I6TA 3GAZA 3H6KA 4CLXA 1G0OA 1U2GA 4NPCA 1E3EA 3RBVA 1ISHA 1LRJA 3U4IA 4G2NA 2OFPA 3OJ0A 4PVCA 3GUCA 2NLOA 2CMDA 6ADHA 2QRKA 3M2TA 3ZWVA 3AU9A 4JP2A 5THQA 3QV1A 2GPTA 2BKAA 2P2SA 3QVSA 4XDZA 3A4VA 5KJCA 3WGTA 3TDKA 1E7MA 4N54A 4P4GA 3K92A 5F1PA 1LU9A 5A06A 2AA3A 3DBHB 3OJEA 4EEXA 1J5PA 1PS0A 2NVWA 1DJQA 3LF1A 1K6IA 4M89A 4YJFB 2YHIA 1NBOA 1O9BA 4FJ0A 4LK3A 2D2IA 3E9MA 3FN4A 3L4BA 2IXBA 4ONEA 4RQTA 2BFMA 3OICA 2VZ0A 2OXIA 4PVDA 3GHYA 1DRVA 5J9GA 4FJ1A 1FK8A 1PEDA 2GD1O 4K6FA 1M6WA 3IQDB 4L74A 2FRDA 4XWYA 4PG5A 4WLNA 3U4CA 3ZWCA 1ENOA 1LSOA 2C20A 4BGVA 1N9GB 4E33A 3DOOA 3F1LA 1PGJA 5JDCC 4HFMA 1PJBA 1NQAO 4CR7A 3PIIA 4Y67A 3JQDA 4F6LA 4AJLA 1H6CA 1KVTA 1NFQA 2PNFA 1SOVA 2PZLA 3VTFA 1EBFA 1VM6A 4DREA 5KTKA 1J6UA 2EHDA 2C7GA 4O5OA 4RVUA 5ER9A 3PQDA 2FSSA 5G4LA 2ZTVA 5EN4A 4FIZA 2I3AA 1V8BA 1E1KA 3INRA 4JJFA 1QRRA 2DBZA 4E30A 5CDYA 2R6JA 4GL4A 4Q3BA 3NGLA 3F5SA 2O3TA 3GMDA 2QRJA 1S7CA 1PS9A 3WBFA 3F9IA 3PWZA 2JFHA 3IKVA 3FNEA 4XB1A 2Q1SA 1C3VA 2Y1EA 1CQIA 4WCFC 1DAPA 1E3WB 2DBQA 1CEQA 2VYVD 2V6MA 3ZWBA 4BNUA 1YOVB 4E3ZA 2OP0A 1UXHA 1UXKA 3BHIA 3GY0A 4DC0A 4R1NA 1B3RA 4XDYA 1SNYA 1HL3A 3OJLA 3GZNA 4CMBA 2GLXA 2ZCUA 3COSA 3OQ1A 4J1TA 3WGHA 4BO9A 1YBVA 2H1SA 2G1UA 2PKRA 4I5GA 1EDOA 1YJQA 2FR0A 2HQ1A 3ZZNA 3H5NA 3ASVA 3CXRA 2B37A 3S2IA 4O59O 3GDGA 4IS3A 4JJIA 4PFJA 5G4KA 4LSMA 3IMFA 4QTZA 3CMCO 4XQCA 1LXCA 2EXXA 3IIEA 1ZKMA 3PJFA 2G82A 2ZATA 2NTNA 1KVUA 3OIFA 4XRRA 1ISMA 2CVOA 2YQ4A 3D3WB 1D3AA 4DLLA 3B70A 2J3IA 2HKIA 3ZWNA 3H65A 2AEJA 3GGGA 1R0SA 1XG5A 3I9KA 4BNXA 5EL0A 2W98A 4DUPA 3QVWA 1M75A 4Y6SA 1TXGA 4XYMA 1Y8RA 7ADHA 4YWJA 2ZB3A 5L95A 1P1KA 4R54A 3BMOB 3V1TC 3WWYA 3HDYA 1UUFA 1MC5A 1U4SA 3CSDA 4L73A 4YBZA 3VDRA 4F45A 3KUXA 4IDDA 2GN8A 4K9DA 1CQJA 4L4SA 4AFNA 8ADHA 5I8WA 1DFGA 4J4HA 4CLEA 2VNAA 1X15A 3ZHYA 4P4NA 4WKGA 1LLDA 1F12A 1TT5B 3FI9A 5TRTA 4BMNA 3PEFA 2HK8A 3GRKA 2Y1OA 3GNSA 2I65A 3U0BA 4S3MA 4DL9A 3ZWAA 4XYLA 1H93A 4MVJE 2WSBA 1N1GA 3QQPA 3CZRA 2GCGA 2B0JA 3C85A 1A5ZA 4UUMA 3ZN2A 2YDYA 2CDAA 2AE1A 2CVQA 4NFSA 4OYRA 4CMAA 4DQVA 4J16A 4J7XA 1CERA 5JO9A 3VVCA 4IJVA 3BTUA 3CH6A 3FBGA 1MLDA 2HSDA 2PWZA 1HYHA 1ARZA 1C1XA 1PJ2A 1C0LA 1DFIA 2X9VA 4INAA 2NTJA 3BTSA 3H7AA 5EPOA 1T25A 3IP3A 3ABIA 3JQBC 5JAIA 3D4OA 4R16A 3RI3A 1FXSA 1KEVA 1KC1A 3V2GA 4TRMA 3AOEA 2WWRA 3OECA 3C7AA 1TB4A 1FDTA 3V1UA 2DTXA 2PD6A 2NU8A 4RZHA 4B79A 3TOXA 4GGOA 4ESOA 1B0AA 1JKIA 5IN4A 4F46A 2BLLA 2HJRA 1DIAA 3RD5A 1FDWA 2J8ZA 4NIMA 5CG2A 3DBVO 4HX5A 3ZCXA 4IMPA 5T6BA 1R15A 5T5QA 3C8MA 3V2UA 1NWCA 3V8BA 1CETA 1MG0A 2B4TO 4W99A 1I2ZA 3D5QA 2W2LD 3EYWA 3I9JA 4ZQBA 1NVTA 4L76A 2O2SA 4AVYA 4YDRA 1I2CA 5A9SA 3JV7A 2BI7A 2VT3A 4K28A 2B4QA 1TA4A 4YVFA 3GC6A 3H8VA 3DWFA 5JO0A 5JNLA 1N8KA 4M1QA 3NRCA 4URFA 3BA1A 4KWHA 4D0RA 1Z75A 4J9UE 3SVTA 2RH4A 3HDHA 1PJ4A 4NBRA 3G0OA 4QQRA 1MXHA 5BSHA 4BHTA 4A03A 2CDCA 1UXGA 2R2GA 4PIVA 2PZJA 3DTTA 1IHXA 1QKIA 3EY4A 1P1FA 1WDMA 3ITDA 4XIJA 4YQYA 4YT5A 3DO5A 1SO8A 1O5IA 2BFAA 3HJAA 3WGZA 2QW8A 3D4PA 5GMOA 1HZZA 2GZ2A 2V65A 5BSFA 3WYCA 4GX0A 4Z0PA 3M2PA 1PSDA 1I3LA 3B1FA 1NPDA 1MFPA 5JCXA 4A27A 1O95A 3WS7A 1IZ9A 3W4KA 3WFIA 5FI3A 3E48A 3QWHA 1JTVA 3QWIA 4XYGA 4MPDA 3WQSB 1O6ZA 1YL7A 2R00A 5U9CA 4GAEA 1EVIA 3ZHZA 1C0IA 2AEMA 1LEHA 1ADGA 1PGOA 2ZIZA 4BNNA 2AQHA 1MG5A 4FGWA 3ROKA 1EUDA 3AUSA 3JD3A 3E8XA 1KVSA 5CDGA 2YV3A 5BSEA 4KTTE 4ALNA 4BNJA 4R68A 4YCAA 4CLRB 3H9JA 5J23A 4FFMA 4DA9A 2O3JA 4BNKA 2XXBA 3HG7A 5GZ6A 2E48A 4ND5A 1EQUA 2I99A 4BO6A 4OXNA 3PWKA 1U3VA 3DMTA 3L0DA 4XR9A 1XU7A 4ZVVA 4CMGA 3OJOA 2VYVA 5JLAA 3L4SO 4GX2A 4EDFA 2Q1TA 2O3QA 4GLOA 1PZHA 1JW9B 4Y9DA 3TQHA 4CR8A 2Y1FA 1XEAA 3OHSX 4JROA 5JC1A 3NV9A 5C3MA 4ITUA 2HAEA 1DRUA 4D46A 4BNZA 3GVIA 3JQFC 1KYQA 1EFKA 1YQXA 5DCUA 5TNXA 1PGPA 4OQZA 2XAAA 3KOUA 3ZWOA 2HRBA 5T8KA 3IC5A 3V2HA 4CQLA 4YRBA 4MVJI 3LVFO 4NJMA 2EJVA 5JYDA 3PFWO 1DO8A 3ONDA 1XHLA 1A7KA 2HUNA 4MINA 3UCXA 2UUPA 3AY6A 1M2WA 3C1TA 4XIYA 5TX7A 3STHA 2ZTMA 3FHLA 2DFDA 3E9NA 2PK3A 6LDHA 1F8GA 3F5QA 3WJAA 1Y5MA 1VJTA 1ZK3A 5L7YA 1PS8A 2FP4A 5A3VA 3HB5X 5IDYA 3AM4A 4RVHA 2PR2A 1OFGA 2B36A 3AJRA 3G17A 3PPIA 3JQGA 1UDAA 2RHRA 3VZQA 5IDWA 1ZUD1 1LRLA 4O1MA 2P5UA 3F4LA 4Y6PA 3KTDA 1CJCA 3OA2A 2QYSA 1DPGA 4DRYA 5HTOA 1I30A 4NJOA 2AE2A 3A06A 1A7AA 2WYUA 5JFOA 3GF4A 1VSVA 4B8ZA 4BB5A 3IL2A 4OAQA 3HUDA 2NVBA 3AW9A 3JQAB 1P0CA 5EESA 2OMEA 4NBWA 5AXAA 2NV6A 3DAGA 1WP4A 3TZQA 1ISIA 1RYEA 4YJGA 2GRAA 3G79A 4RQUA 1QLJA 5IZCA 1YDEA 3B1KA 3GH3A 4FFPA 4XYEA 5DBIA 3P2YA 2I76A 2HK9A 3ENKA 4WGGA 4XX0A 4D7AA 2W2KA 4R51A 3ONEA 2Q99A 3HDJA 4GWKA 3WFJA 2UV8A 1G0NA 2UAGA 2E4AA 3WJ7A 3E82A 4J1NA 3FBTA 5CFZA 3GA0A 2A92A 4HFNA 4Z0TA 4BMSA 5GZ1A 1X7DA 2Z5LA 2AW5A 3CUKA 3IOYA 4R69A 3DHYA 4IJUA 1ZNQO 1E0DA 3PYMA 4ZICA 1JVBA 1LBEA 3NEPX 4J90A 3TJRA 2G0TA 3C7DB 3GVHA 3RAJA 4OSOA 3K9QO 3FRJA 4E4YA 1RYDA 1KIFA 4NK5A 4P38A 4LSWA 4P8RA 3SJ7A 3TSCA 3JQ8B 1FDVA 2R00C 1GZ6A 2P5YA 1ZSVA 3WSVA 1ULSA 1LDEA 3F47A 1B3BA 2W2LA 2CVZA 5CDTA 1Q7BA 2FMUA 3BZUA 4JXKA 1WPQA 4M8SA 1ENZA 1I3KA 3FNGA 1GEEA 5DOVA 4KOAA 3PHLA 1LLCA 4UVGA 3WB9A 5A03A 4A0SA 3HSKA 1N92A 3GVPA 2NVUB 1V0JA 3A1NA 1GUZA 4XGNA 4NDNE 1NQ5A 3L9XA 1GAEO 5F21A 3A14A 4KMSA 1H5QA 3HFSA 4UAGA 1WVGA 4PRKA 1E5QA 3OA0A 1HYGA 4YRDA 1DSSG 3OQBA 2Q49A 4GSKA 4N5MA 3MTGA 4XYBA 4YTEA 5U4QA 4JNKA 2WD7B 1U3WA 3I4CA 2I67A 1CYDA 1ZXBA 3Q9UA 3W8FA 4KZPA 4I9NA 4CLOA 5IDXA 1C14A 2A35A 5KWEA 5G2OA 3GEMA 3RUIA 1BSVA 2BHLA 3ANLA 4TMFA 2QYTA 2GSDA 3K2EA 4EZBA 4AICA 2EW2A 5KJFA 4A7PA 1R12A 4GQAA 2Q50A 3ZWMA 3ZNNA 2SCUA 5MGBA 3ZNQA 4FSHA 4AJNA 3KETA 4UVDA 1A72A 1AHIA 5EQDA 3NGXA 1KY4A 4UREA 3BMNA 1MGOA 1R0LA 1X0VA 4DIBA 2UYYA 3BIOA 3C1AA 4R5HA 1A71A 3ZV4A 4YT4A 5C7LO 1UDCA 3KEOA 4L4RA 1BXGB 1V3TA 4RPHA 4KP7A 2BFOA 2FHSA 3HN2A 3TNLA 4PG8A 2VUSA 1T24A 4WEOA 1A9ZA 4PLVA 4DIOA 3HQ4O 1U7TA 4FOOA 4XA8A 4EITA 4NFYA 1IULA 2J5RA 3QP9A 3EMKA 4CQMB 4IDAA 3H2SA 1NFFA 2O3UA 2X0JA 3DAPA 1EE9A 4GGPA 4LMRA 1XIVA 5KCZA 5BNTA 4LCJA 2EGHA 4OMUA 3WSWA 1BWSA 3DBRA 4WNCA 3GGOA 1QYCA 4Z9FA 1UZLA 1E1NA 1Q0LA 4QT0A 2FZWA 3ADOA 4FR5A 2PGLA 2VTEA 3QLJA 4CM9D 3KBOA 1U4OA 3WQRA 4E2XA 3SLKA 1SOWA 4IGFA 1UP4A 3FWZA 2XPCA 4A2CA 3RUFA 4A73A 4C7JA 3NX4A 2VHVA 1B8UA 2X6TA 1GD1O 5IF3A 3RUDA 5JAQA 3LDHA 4WCFA 4NBTA 4FFOA 2NNLD 3I83A 1LSJA 1GZ4A 3AUUA 3KYDA 1YWGO 3BMQB 4IXTA 1OZAA 1G6KA 1HE2A 2OUIA 3S55A 3X2EA 4M54A 3QWAA 4LGVA 1X14A 3AY3A 3RFTA 1I3NA 3PTZA 2V6FA 4AJPA 5IJZA 4QSMA 1CDOA 3VPHA 2JL1A 2OOSA 3VPGA 1DC3A 3DTYA 4CV3A 4TZKA 5B4TA 4OH1A 1KEWA 1WZIA 3ITKA 4PRLA 5CPBA 2Y1GA 4YAGA 4FGSA 1Z82A 3VH4A 5A5EA 3NYWA 1U3TA 3OM9A 4Q39A 3UKOA 5L40A 2GERA 2QX7A 4P22A 4FFLA 5AQ1A 4PGFA 4TKLA 4BMVA 5ENDA 5JMPA 1ISFA 4M87A 3LZ6A 4GVXA 4Z9YA 3JYOA 1T2CA 2NACA 3KLMX 4I9UA 1P45A 4XZ3A 4B3HA 2QZ9A 4PLTA 3ZWPA 1HLPA 4YQZA 3MJ4A 3PVZA 1G1AA 3WNVA 4DPKA 1EUCA 3JYPA 1M66A 1GTMA 3QHAA 3VH3A 5G0SA 5COBA 1BW9B 3C7CB 4NR0A 1BXZA 1DIGA 3IUSA 5G4KB 2V7PA 4B7CA 1EDZA 5I7FA 1DHTA 1DEHA 1PGNA 4I5FA 1GFSA 2BF7A 1HDRA 3BXXA 4BNTA 4R5MA 4CUKA 3ANMA 3VC7A 2X1HA 5HRUA 3KXDA 1GV1A 4U0KA 2WYVA 4U0JA 1H6BA 2AXQA 4QXMA 2EP5A 1IB6A 2JCYA 2O50A 4H16A 4RGBA 3UUWA 4BO0A 3PI7A 1PL6A 2Q46A 4PLYA 4DC1A 2PZMA 1ZCJA 5B4UA 4D0SA 1ZZEA 3QVXA 3KYCA 4FS3A 1LI4A 4CM1A 3FPLA 1HDGO 2D3TA 1MA0A 1L7EA 2HU2A 4ZHSA 1NVGA 1Y8QB 3WTBA 4Z3KA 2UVDA 4QO8A 3LC7O 5CPFA 2VZ9A 3GRPA 3ULKA 4WK6A 1WMAA 1TLTA 2AHRA 4RLHA 3M1LA 3AI2A 3O03A 3RC2A 3GDOA 5IZ4A 3JQBA 3GK3A 1BTOA 2HMSA 2NTVA 2Q4EA 3ENNA 4MP3A 2IE0A 1ENYA 1NFRA 3QVOA 3L6OO 5TSDA 4UVEA 1XLTA 3ETGA 4KUHA 4CM6A 1ZEJA 2RAFA 1PX0A 4HFRA 5DNAA 3U5TA 2EIHA 1JWAB 2I66A 3OIDA 1I33A 2PH5A 1ZJZA 4XB2A 2FOIA 5A9TA 3OETA 5DOZA 3F6YA 1SBYA 3K31A 2X86A 4JQCA 3UGKA 2LDXA 3LT4A 4YACA 3TZKA 3WMWA 3UH1A 1LSSA 3MTJA 3MJEA 3ZHBA 3H9EO 4XCVA 5CEFA 1YKFA 4BNLA 3RVDA 4J1QA 4PLWA 2H6EA 3DFZA 1I2BA 4IGEA 1W73A 1QLHA 3DZIA 5H81A 5ICSA 3RFVA 1XQ1A 3PQFA 4YAEA 5H82A 3RFXA 5I7VA 2WMDA 4BQRA 3ROMA 2HCTA 3PFFA 4DQUA 2QRLA 2NU6A 1H6AA 4MVJP 3H2ZA 4JP3A 3WOHA 1E3JA 5HS4A 1E3LA 3WX0A 2NU9A 5KJ1A 1ADBA 3FTNA 4I1IA 1HDZA 3VZSA 4MJLA 4FB5A 1E1MA 1PR9A 1UZMA 2ZTUA 1U5CA 4FJ2A 4GKBA 3U4HA 5LDHA 3BMCB 4ZQGA 1V9LA 1ADCA 1S6YA 3CMMA 4CM8A 3LT2A 1HE3A 1KBZA 2X0RA 2PFGA 5AXCA 3GUYA 4ALJA 1YBAA 4TROA 3BTOA 2DLDA 1VL8A 3VVBA 1EFLA 2V6GA 3KEQA 3KSUA 5DP2A 1RWBA 5C7IO 1ZH8A 3B1JA 4PLHA 4ALLA 5KVQA 3UICA 5B1YA 1I10A 5G0WA 2OO5A 4BKRA 4UVIA 4DTIA 4HWKA 3FSRA 4IDCA 1LQTA 4K1LA 2I9PA 1UZNA 1MUUA 1BDMA 5CDUA 2WDZA 4DQXA 3RU9A 5CDSA 1J49A 3ZGYA 3ZW9A 4QO7A 3W6ZA 1PJQA 4I08A 5DCYA 1NQTA 5AXBA 2EERA 3KYBA 2D5AA 2PV7A 4NU6A 4JX8A 1JQBA 3F46A 3VAZA 1QSGA 4ND4A 4MO2A 1F06A 4H3VA 1DLIA 1HZJA 2PTGA 3I9LA 4IJWA 1PJ3A 4UUOA 2EWMA 4Z3DA 4OHUA 5TJ9A 2B4RO 2C54A 3EDMA 2W4QA 2O2YA 2VWQA 2DU8A 3D64A 4DYDA 2OBYA 4MKRA 4E2ZA 1SPXA 3JQFA 2IDZA 4LVUA 4JBHA 5THKA 5BQFA 1UXJA 1HT0A 4TSKA 2E49A 3NKLA 1B14A 4NMHA 5EINA 1T2DA 1BGVA 1E7SA 1HSOA 1P3DA 1RPNA 1LX6A 2B35A 4ZGWA 4CL8A 4E32A 1JU9A 3W8DA 1XSEA 4WPGA 3L07A 1ZBQA 4BVAA 2X9GA 5B37A 4DWVA 4B4UA 5A1TA 4DLAA 5L9AA 2EW8A 1Z73A 3TFQA 4W4TA 1Y5RA 1FMCA 3RWBA 1P44A 5K9ZA 4CMKA 3DBHA 1R4MB 1SC6A 5IXSA 4N7RA 3P7MA 4YJFA 1K2WA 1YL6A 3A9WA 3GPDG 1NNUA 1GV0A 1V3VA 2Y0EA 2VNSA 4B4OA 1T26A 4IM7A 4QUKA 1AE1A 1YB4A 4RORA 4BV8A 4M55A 4XJSA 3WGQA 4XGKA 3UCEA 2DQ4A 1K89A 1PL7A 3GEGA 2ET6A 2WEKA 1QXSA 1E7QA 4GMFA 1L1FA 4YT2A 1YH3A 1B8PA 1N9GA 2FY8A 4MP6A 3Q1LA 3Q11A 1E3IA 1T2FA 3UVEA 4TRJA 1WDLA 4Y8VA 4N18A 3WG9A 1DJNA 4FBGA 3MZ0A 1IE3A 5KNLA 2RIRA 2O7QA 1FDUA 1KEPA 3DB2A 3ZNOA 2Y05A 3VZPA 2O23A 3LC1O 5BR7A 3EVNA 3CKYA 1PQUA 3HNPA 1ZIDA 3KB6A 3VZRA 3WGYA 2IZZA 2Q22A 3TOZA 2DTDA 4UVHA 2VWHA 5HBRA 4OOFA 4CL3A 3V1YA 3FF4A 3G1UA 3AI1A 4CMJA 1E3WA 1M76A 4BOYA 1BMDA 3QY9A 4EUEA 3WGOA 1NHWA 2C5EA 5FFFA 2GZ3A 4BB6A 2Q1UA 3G1TA 2DBVO 3RBXA 5JSFA 1HF3A 5AOVA 1U5AA 1H0KA 2DM6A 2I5PO 2Z1NA 5A4DA 1IUKA 4MDHA 1HXHA 3HE3A 4ND3A 3RCBA 2O4CA 2BD0A 1PWXA 4IDBA 4W9NA 4YT8A 5FI5A 1ONOA 3R0IA 2B5WA 3GDFA 4J43A 4C4OA 1UAYA 2CDBA 5KKCA 2VRCD 1LA2A 2HRZA 4FC6A 4CJXA 3H9QA 1I3MA 1XCBA 4MVJG 4JJGA 3D3WA 4YEDA 5ER6A 5A05A 3OQ6A 1E5LA 4RDIA 3PZBA 4OKIA 3DFUA 1NPYA 5JDIC 1O94A 4A5OA 3AU8A 3ZWYA 4FD3A 2C2XA 3JQ6A 5G0UA 3KSZO 1V6AA 2D8AA 3CTMA 4BKUA 1YRLA 5I7EA 4WCDA 3BMOA 2UUOA 4RDHA 2DKNA 4AG3A 1LLQA 1YS4A 1YB1A 2JCVA 3QE3A 4BO2A 1PZGA 2HO5A 4D43A 3W4JA 1QMGA 3PHJA 2PLAA 1K5HA 2OP1A 3O38A 4OIMA 1XA0A 1D1TA 4D45A 1PU2A 3K2BA 3IP1A 3NT5A 3QRWA 2Q2VA 3GZ4A 4JIGA 5EMHA 4CV0A 1J4AA 3GVCA 1TT5A 3JQAD 5ADHA 5K0ZA 1ZW1A 3UAGA 4DXHA 4HBGA 2Q3EA 3RIHA 1ZXLA 3DZJA 2OORA 5M6DA 4DGSA 1ZMOA 2TMGA 4OL9A 3EC7A 1LJ8A 4MIYA 2X9NA 3F3SA 4L9RA 2I3GA 1NXQA 5B4VA 1QR6A 3CEAA 4BNIA 3DHNA 1A9YA 1P1JA 1B26A 5MDHA 3QVTA 3Q9NA 1ORRA 3H3FA 4IZHA 3DOCA 1FJHA 4QFDA 3ZI0A 1HETA 5IG2A 1U28A 4FC7A 1VLLA 1P1IA 4YJHB 4FPXA 2H9IA 3S2EA 2E37A 4DPMA 4J91A 4DMMA 3G3EA 3SEFA 1QYXA 3GFGA 1E1LA 2WD8A 2VOJA 4J7UA 3GN1A 3WDSA 3K73O 1J0XO 3VPSA 3NUGA 4YR9A 5L45A 4RVGA 1F17A 1B16A 3JQEA 5IXYA 1NWHA 1DIHA 4R01A 4Z6KA 3TFOA 4DYVA 1DXYA 4JLWA 1QV6A 4R1UA 5L4SA 5I9NA 4CMHA 5TF4A 5DBFA 4AJEA 5TQVA 1HDXA 3JQ9C 3D3EA 4GWGA 1C1DB 1HE5A 1GEGA 4KTVE 1HWYA 2GN6A 1YE3A 4L0QA 1KVQA 2DTEA 3PLRA 1SCUA 3ZU4A 3HZZA 1CWUA 4MVJM 1PJLA 4X54A 2DUWA 3E5RA 1KS9A 1ZFNA 1NP3A 4W6ZA 1ZVMA 3EK2A 3WLEA 4ILKA 1Z6ZA 1ONNA 1GUYA 4IDEA 3ANNA 4II2A 3LYLA 4AJKA 1YO6A 4HNGA 1IOLA 4AJ1A 3PP8A 4UEOA 4EI2A 1E7YA 1WLYA 1IHYA 3PGXA 4N5LA 5BSGA 5BNIA 1Z7BA 1LC3A 2P4QA 1ZSNA 3UXYA 1CF2O 1OAAA 3D4NA 3LQFA 3KO8A 4XR4A 4UEKA 4NI5A 3CIFA 2NSDA 5KVVA 5DT9A 3DHEA 1LDNA 3QA9A 5JW6A 1ZK2A 5CEJA 4FFNA 1DIRA 2GDZA 1RM3A 2Y67A 2PKQP 4CMIB 3FR7A 3MOGA 5IFLA 4TZTA 5BNFA 3KRTA 2HMUA 4WLOA 4BO8A 4XD2A 5I9MA 3ST7A 5JYAA 1JVSA 1X7HA 3ZV3A 4NG5A 2VQ3A 2X5KO 4YYZA 5JS6A 5JCJD 1H2HA 1R4NB 4W9NC 1VJ0A 2DPHA 4E5NA 3EHEA 3K8ZA 4QEDA 5HS6A 1JA9A 1H2BA 1I5RA 1LNQA 1PTJA 1XU9A 3FWNA 3DBLB 2Y0DA 4UUNA 3DDNA 4OO3A 4ZQEA 5F1OA 3ZV5A 3I4FA 3E18A 3GQVA 2C29D 3GHHA 4CLRA 1NYTA 3SXPA 4CQMD 1NR1A 1V35A 1XWFA 3I52A 5L51A 1AXGA 1AXEA 3L6EA 4NNJA 4CV2A 2OGUA 4HUJA 3I1JA 4BNHA 2YFQA 4RF4A 3ZU3A 2F1KA 2JD2A 2Y93A 4CM4B 3UF0A 4A26A 4LCEA 5EQFA 4PN3A 1WMBA 3E9QA 4KDFA 3OJFA 3JQ7B 3VHRA 1T1RA 2GN4A 5CEEA 4TVOA 4IQ8A 1M6HA 4G65A 1QORA 2YUTA 4LW8A 1T2EA 4NQZA 5T57A 2FPPA 3N7UA 1JAXA 4U6QA 3U9LA 1UXIA 1GQQA 1Y81A 5ENVA 1D7OA 4MOWA 2YY7A 3PLNA 1YB5A 2XF8A 5U1PA 2BRUA 3U3XA 3F1KA 2JFGA 3WYEA 3BTVA 1YJ8A 3W4IA 3ZH2A 1ML3A 1Q0HA 1R0KA 5CG1A 3ZWXA 4TKMA 3NDJA 1YVEI 2FWMX 4E2YA 1R37A 1C0KA 5CHEA 2VRCA 3W8EA 1A4UA 3GMSA 4J1SA 3PZRA 4NHEA 2EKQA 4IPTA 4R9RA 2HLPA 3QWFA 2W90A 3EVTA 3N58A 3GG2A 3GVXA 3DMYA 4S1VA 4DVJA 2AG8A 4D3SA 3H9GA 5KJEA 2ZKLA 3C1OA 3QJ5A 5DCWA 4KWIA 3AY7A 2YHIB 2O3RA 2FPIA 1N5DA 1U3UA 1R6DA 3GFBA 3L77A 4WLVA 1WNTA 3AUAA 4IMRA 1YL5A 3GR6A 4IDGA 2J5KA 4IXWA 2CSUA 5ITVA 5G0VA 1F8FA 4M49A 4C7KA 3JQAA 2X0NA 2OL4A 2GUGA 4TRNA 1GYQA 2NUAA 3UHAA 3JD1A 4YA6A 5F3RA 1HKUA 1P31A 1E6EA 3R3JA 3RUEA 1T1SA 3SLGA 3LT0A 3WYBA 1Q7GA 5DF1A 3TZ6A 3ETEA 4GSLA 3BYZA 3JSAA 3UCFA 3EAGA 4EJ6A 4HP8A 2GZ1A 1AUPA 1P77A 3LU1A 4JBGA 3CZMA 1VPDA 4G5HA 3DXFA 2J6IA 2JD0A 1I32A 1ADFA 1SZJG 4R3WA 1Z45A 2AQIA 4FCCA 2F00A 3FNFA 1YONA 4U7WA 3CINA 4YAKA 3OFSA 2AEFA 3T7CA 1HDYA 3EW7A 3MWDB 4JK3A 4O6VA 2VUTA 3H5AA 1CIVA 1B7GO 1H6DA 4WASA 1OC4A 1PZFA 2YJZA 1M67A 2P91A 1MB4A 4NK4A 4NH4A 2BFPA 4ZA2A 4PCVA 1TI7A 4GLLA 2Q2WA 5BT9A 1LQUA 4U8GA 4RVFA 2GN9A 5KKAA 1KEUA 3I6QA 3GZNB 3L6DA 1E7RA 4JGBA 4RL6A 3DONA 4RZIA 3JQ8A 4YAIA 1P74A 3RKUA 1HLDA 2P68A 1XQ6A 3E1KA 3QIVA 5F5LA 1MXFA 4JBIA 3U09A 1KVRA 3VH2A 1PIWA 4XEHA 2PD4A 3DL2A 4BUCA 1D8AA 4OM8A 4E6PA 1DBVO 2VHZA 2Y99A 3PGJA 5DULA 4BNYA 3M6IA 1GR0A 1QV7A 1BG6A 5A5FA 4E12A 4ALIA 4NU5A 2NVUA 3WNQA 5JE8A 3TF5A 1E77A 1FDSA 5EIOA 1Y7TA 2C7VA 2GO1A 1Q1NA 3OH8A 1U8FO 1K6XA 1T2AA 4I9HA 3W1VA 5ICMA 5CAEA 3PDUA 3O4RA 4J0FA 4MKXA 3Q2IA 3TN7A 2ZYAA 1VL6A 4PLZA 1MP0A 2CF6A 3NDRA 4HV4A 4WECA 1Y8RB 1UP7A 3T7EA 4ND1A 2WD7A 1IPFA 2XXJA 2CNBA 3K6JA 2POQX 2WYWA 4BL5A 4BO4A 1GYRA 4B4WA 3LLSA 1LUAA 2GF2A 2WE8A 5I9LA 3MJCA 4RPKA 4HADA 1R66A 3NTOA 5L53A 2ZJ1A 2IYPA 3I9NA 2EV9A 1QYVA 2Z1MA 3U49A 4XRGA 1TVEA 3N74A 4BKQA 2BGLA 1Q0QA 2HMVA 1GQYA 5JY1A 3MWEB 3IKTA 5KIAA 3OSUA 4JCOA 2LDBA 3WGIA 3NT2A 2WE7A 3MJTA 2PA3A 5EJ2A 5JCJA 3LK7A 1BXGA 3NJ8A 5A02A 1O89A 4K6CA 4QFCA 1EQ2A 1JN0A 1GDHA 2ZB4A 3B6ZA 3UN1A 3PK0A 3DZBA 1HDOA 2B83A 3O9ZA 4F3YA 5L7WA 3CPSA 4O63O 2YV2A 5A3JA 3VDQA 4PZEA 4CQMA 3ADPA 4D44A 5I8ZA 1C1XB 3PHIA 4BGIA 4GH5A 4L75A 4B7XA 2IEBA 2OHXA 2ZB8A 2P4HX 4BV9A 1JWBB 4E2WA 4ZJUA 2G5CA 4O0LA 4J4TA 2JKVA 1A27A 1VC2A 1B8VA 4Z0HO 3PYLA 3H9UA 4ALKA 3FNHA 3R1IA 4HXYA 2O7SA 3H4VA 3U62A 4W7HA 2X0IA 2PD3A 3FPCA 1LDGA 1NASA 4R1TA 4FOSA 3L9WA 2C2YA 3JQCA 3LC2O 4IY1A 4R1SA 4IBOA 5KOIA 1D1SA 3BMQA 4TVBA 1ONPA 1LLUA 2AQKA 1WW8A 2EKLA 3ZW8A 1RJWA 1LRKA 2ZTLA 1OC2A 4HKTA 3DZKA 4XJTA 2WM3A 3ZHXA 5A9SB 1T4BA 3OEWA 3FTPA 5ILOA 3D7LA 3GT0A 3AOGA 1DC6A 1U8XX 1A4IA 4CMEC 3GG9A 2Y66A 3JYLA 4QX6A 3DQPA 3DAFA 4MIOA 4WJZA 3KZVA 4F6CA 3SC6A 3X2FA 1UAGA 2DAPA 2Q4BA 3ZDFA 4XQGA 3LT1A 4OJNA 1KETA 4YJDA 4J2HA 3WLFA 4Y98A 3OMLA 1EZ4A 3NDIA 2X5JO 1N7GA 2G17A 3PJEA 3ROPA 4AJHA 2QHXA 5JDIA 1GUFA 1K0UA 4CUZA 1DFHA 5T73A 5COQA 4B3JA 4RV9A 5HWSA 5L7TA 3D0OA 4CM9A 3ROQA 1QYWA 3JYNA 3RC9A 4D3DA 8LDHA 3IS3A 3S2FA 1DB3A 1SEPA 2ZJ0A 5C37A 3UW3A 4PG7A 1BW9A 2QG4A 3O8QA 5LDGA 1UJMA 5C7OO 1DC5A 4HNHA 2BI8A 4J9VA 3RASA 2RHCA 4DLBA 3RUHA 1GQ2A 4DMLA 1FF9A 2D4AA 3TL2A 3DZGA 3INTA 4RF2A 2Y0CA 5IDQA 2C5AA 2O3SA 4EYEA 1NX6A 1GADO 4ZRMA 1U2DA 1TEHA 2PGJA 3QSGA 1HTBA 2J3HA 4D3FA 5JYEA 2J5QA 5JBIA 2PZKA 3RUCA 1R16A 3BHMA 4YXFA 5JXWA 4RF3A 1GPDG 3D1LA 2IYOA 4BNMA 1GYPA 2DPGA 2EJWA 3PHGA 3LF2A 2P9EA 1EK5A 3I9OA 5FWNA 1P9LA 4W7IA 4B8WA 4KQWA 3HWRA 4KQXA 2RCYA 1Y8QA 2X4GA 2BMAA 3MJVA 4E0BA 4PLFA 4IS2A 3JD0A 1V3UA 1SEVA 2PH3A 3SX2A 1N7HA 5H83A 3VPFA 2EF1A 2Q1WA 2Y68A 4MVJH 2GR9A 3GOHA 4N5NA 5JPIA 5KVCA 4BO1A 4YRAA 2DBRA 5DZSA 5TGDA 1EEHA 2O4UX 3K96A 2DT5A 4OSPA 4J49A 1PJSA 3TZHA 3ONFA 4R41A 3HHPA 4CQLB 5T64A 3DR3A 3AWDA 4OKNA 1KERA 1RM5A 1X0XA 1ZK0A 4NJMB 4Q3NA 4BGUA 1L7DA 5C5IA 3I6IA 5LCXA 3NT4A 1NPTO 1Z7EA 2YFHA 4PG6A 2V6BA 3VPXA 2JJYA 3AI3A 4Q3EA 2X58A 3JQ9A 4GBJA 5AYVA 4D41A 3INGA 2P9GA 1DC4A 1W4ZA 1XDWA 4PZDA 3P2OA 4MVJD 5F5NA 1N2SA 2WJPA 2ZQYA 2NQTA 3M1AA 1XR3A 2CZCA 2IODA 3JQGB 1GY8A 4KUEA 4Q3DA 4TQGA 2CUKA 3TRIA 2H63A 1NAHA 2JHFA 4IUYA 3L4BC 4PG4A 3MJSA 1X7GA 1EUZA 4YB8A 2D5CA 3RJ9A 3UFXA 2DUUA 1OI7A 3DEYX 2CF5A 5TS3A 3EZLA 1BVUA 5JYFA 2HMTA 4R4JA 3KLPX 2VTDA 3G49A 2PKQO 4AL4A 3NAQA 1LTHR 2EG9A 1X1TA 2BGKA 4G81A 3B20A 3RQSA 4CM7A 3S8MA 3BMCA 1T4DA 1VKNA 4RPGA 2HJSA 3E03A 1YOVA 4YJGB 1K6JA 5TT1A 5LC1A 1ISGA 4DIFA 4BKOA 2VUUA 2C07A 4BNGA 2Z95A 3RBZA 4MKZA 4RO0A 2EGGA 2NADA 4FN4A 3KVOA 5GY7A 2YDXA 1ZEMA 2W2KB 4CM5A 2VN8A 2C59A 5EERA 3HFGA 4J7CA 1PL8A 2NM0A 1UR5A 3JTMA 2VZ8A 4WEQA 2QIOA 3PRJA 3PWSA 1ZSYA 2ILTA 1QYDA 2ZB7A 1I36A 2Y1DA 4CM3A 5IAAA 2ZCVA 1AHHA 4XQEA 2P9CA 1HRDA 3ON5A 5DBGA 3W6UA 4IIUA 4ID9A 2Q45A 1VRWA 3I3OA 4LISA 4MP8A 2VWPA 2BH9A 1ZJYA 1JDJA 1HE4A 3TPCA 5ITWA 3BAZA 1LDMA 4CMCA 2NQ8A 2Q2QA 1U9JA 1HEUA 4ND2A 1EVYA 1GPJA 5JC8A 4NBVA 2J3KA 3WR5A 3WIDA 4GVLA 1YGYA 3OF2A 3WXBA 5TIIA 2HMWA 4WE3A 4WOKA 4ZD6A 4LRSB 2ZYGA 3WWZA 3FR8A 4UEJA 2FR1A 1KOLA 2NU7A 1DRWA 1HSZA 2CY0A 3ICPA 4LRTB 1O0SA 4GKVA 3RKRA 4EEZA 4B4VA 1BRMA 2FSVA 4EUHA 1WDKA 3E6AA 1KY5A 3JYQA 3PDJA 3S1LA 2JFFA 4LMPA 1IY8A 4U6SA 3AK4A 2A94A 3WIEA 1JKFA 2E6UX 3WGGA 4BO7A 1AGNA 2AQ8A 1E7WA 5JY6A 1I24A 2IEDA 5DP1A 4ZN6A 2PY6A 4E31A 5FYDA 4A10A 1F14A 4CLOB 4GI2A 4AJOA 3KSDO 3TL3A 4IQ0A 4CUJA 2VHYA 3DOJA 1EBUA 4KUGA 2VHXA 2EP7A 2VYND 2JHGA 3AM3A 1YQDA 1R4MA 1Y6JA 2XOXA 4GX1A 1Q7CA 3RROA 2EEZA 3V5NA 1BDBA 1B15A 5CP8A 2HK7A 3SC4A 1PJTA 5B12A 3BMNB 1VKOA 1Y1PA 3MEQA 3RUAA 1BVRA 3Q0EA 1H9BA 4YPOA 3E5MA 2CFCA 1XELA 2B69A 2YHUA 3P19A 2X8LA 4UUPA 3LSYA 5JAMA 2E82A 3K5PA 3VTZA 4BKPA 1EK6A 1PWZA 3AM5A 3SBOA 1EE2A 5A9RA 4CLDA 3NTRA 3NJ4A 2RH8A 3PJDA 4LN1A 1DLJA 4QECA 3ETDA 1TT7A 3DBRB 2C0CA 4DPLA 3MOIA 1ENPA 1MFZA 1DOHA 3AOEC 1Q2XA 1UH5A 1C0PA 5DDIP 2NWQA 1OBFO 4RF5A 4WUVA 2JCXA 5FF9A 3TZCA 1GZ3A 1EVZA 1HDCA 4PLCA 3JCZA 4TWRA 3OP4A 2DFVA 3PJGA 3RSHA 3ZV6A 1NM5A 1VJ1A 3VH1A 4WCFB 4IDFA 4EBFA 5ES3A 4KDEA 3KYDB 4AJ2A 3P5SA 4RPLA 4E5YA 4XKJA 4PZCA 4K26A 4LVCA 4E21A 4H7PA 3EZYA 1WAMA 2ZYDA 1NR7A 3IUPA 5F1KA 3ZU5A 3ZU2A 3AFNA 4AJJA 4M86A 1ZK4A 1Y9EA 1RM4A 1PZEA 4EJMA 3C24A 1YDWA
chains in the Genus database with same CATH superfamily
1ORIA 4YPVA 4E7OA 3D0KA 3IUJA 2I91A 4HDOB 2FSUA 2IW3A 4WL0A 1X94A 3C3WA 2PKYX 4Z9BA 3LFUA 1GL3A 1PGQA 2M6LA 3P4XA 2PUHA 5KVSA 3RVRA 1ZP6A 3AGPA 5A1JA 5ALFA 1NW7A 1NNEA 4QXAA 2IIVA 4OUDA 4RIHA 4WLUA 1NV8A 1I9CA 3X0DA 1JH9A 1XRMA 2YW9A 2O48X 4R9SA 4U7JA 2WIFA 4MIEA 5JQGF 1GRNA 5FL3A 1VHLA 1NJSA 4XSGA 5K6AA 5L4LA 3R3XA 4M46A 2VT2A 4RD3A 1EUCB 5LOVB 4Y2XA 3JATA 3F6CA 3BH0A 3O21A 1C7IA 4R05A 2OBNA 1H23A 4BTLA 2IZ0A 1V96A 5FTKA 5LQRA 5JS1A 4E5PA 2QI9C 4RJTA 3DZFA 4C08A 4F9GA 4MW7A 1NC3A 4Z9XA 2CLMB 4C0SA 2QBYA 2TMDA 4MW0A 3GYBA 4GMGA 1N4DA 5FWYA 5D5HA 1VMAA 2ANCA 3JAWB 1E0KA 1RYNA 4FHDA 2I78A 4JLAA 5EJ5A 1D4OA 1VLQA 5AVUA 3NIWA 2Y6UA 5HM8A 2R6HA 4RFSA 4A6PA 1NDUA 2D59A 4JSRA 1AN9A 1RC8A 2MSKA 4XUDA 1SCKA 3HXKA 3MJFA 1X8LA 3HPQA 4KSBA 3Q3CA 3G2PA 4L28A 3IUNA 2JGDB 1H1LB 2CVFA 2JRLA 2I6QA 4YGYA 5TC4A 4I4TB 1PQWA 3T5GA 1IPEA 2H48A 3HADA 4V02A 3GLGE 1L7OA 2QLJA 5AD1A 2WFLA 4RCVA 1FBNA 1T0UA 4RVSA 5D1HA 4B6GA 2H5LA 3VR2A 2QORA 1YXMA 4MVJF 5AOCA 2PAAA 4EABA 1PYGA 2A9FA 4AULA 1E2HA 4BNWA 4D9FA 1BN7A 1WW2A 3OBBA 3TAUA 2YVQA 3D1JA 4IDPA 1P33A 2G6BA 2Y1XA 4JDPA 4OSEA 4M8IA 2QT0A 2JIQA 2QNBA 4X8HA 2BKVA 3GN2A 4LZJA 2IXAA 1COWD 4PLPA 4Z0NA 4I55A 4B5KA 1SQGA 4Q1AA 4F8EA 2G0NA 3HYCA 5EPEA 2CGEA 2IZ1A 2QV0A 4OK6A 3HCFA 2I3DA 3TM5A 3EPAB 4A2WA 1M7HA 1FMTA 4E3WA 4YV7A 1QU3A 2LV8A 3QQ5A 4EY3A 1EIWA 1XYGA 1TCBA 1XXHB 2P2DA 2AT1A 2EL9A 2JEOA 1YCDA 3A4NA 2PUWA 3BQNB 1R74A 1G7TA 2FR8A 4TV8B 5AVVA 4IVNA 3ETNA 1JPUA 4D42A 3H5RA 4HPXB 3S2GA 1PG5A 1D07A 4OYYA 1V8ZA 1VI2A 3I61A 3EPJA 1LDBA 2AI2A 1N1EA 2OXRA 4N1AA 4UDOA 3EZGA 3R7WB 3NIGB 4QELA 1LF0A 2YY5A 1KYXA 3FMIA 3L4KA 1SWVA 5DM2A 3VR4H 1E6WA 5JDCA 2FDRA 3A6FA 3AVQA 3EUAA 4NAHA 1GILA 1NLMA 1I0ZA 1X42A 2Z2KA 2BEUA 1LBIA 1J8DA 4R6XA 4DBVO 5AK4A 5ALLA 2RHLA 2JLVA 4N3CA 5JJIA 3TWOA 1G4HA 5E3JA 2DFTA 1ICEA 2P90A 4EF6A 4EG4A 3RC1A 1YRWA 4C4RA 1OX4B 2JFWA 4I0WB 5JAZA 3F4BA 1K3TA 2ZJFA 2IRWA 2J3LA 4WZAB 1QCDA 1FIUA 4EZEA 1WXEA 1KZ6A 2QVBA 3FVQA 3OZSA 4HY3A 4H15A 4YALA 1FPQA 2ILVA 3C4JA 3RS2A 3UK6A 4CMEA 3UPUA 1KU0A 3GRZA 2F4NA 2GAOA 2MT9A 3NNDA 4H7JA 4ZAWA 3QYAA 4PQYA 4RKQA 4ZWNA 1UDBA 1KPHA 3U81A 3PQ5A 3VKUA 2G76A 1K7CA 1LVUA 2GEVA 4KXVA 3W8NA 5P21A 2XVAA 4K46A 2QRZA 3R3SA 2IPNA 4KQIA 4WJKB 5IN5A 4CT0A 4QXOA 2P78A 3ENVA 1ZVVA 2QR5A 4LV6A 121PA 1XKQA 2HEIA 3M70A 3FYUA 4GQBA 4XOUA 2HTEA 4RDXA 1GPMA 2C3PA 2GNAA 2QTRA 4CM8B 3ZHUA 2ODTX 4AXXA 4DR4B 2EKPA 3DTVD 2ZWMA 4KXFB 1M2FA 1EGVB 3MTQA 1RXSA 2Q7DA 4Q05A 4HAUA 1E6UA 2EG5A 3MOSA 4E51A 1OLOA 1U0GA 4HNUA 2OCXA 2IE8A 4KQ9A 5TJHA 1EZZA 1G5HA 3H4IA 3MGKA 1DKQA 5BR8B 4ROSA 2QU8A 2V96A 5AKXA 3TKYA 2VCYA 1BE1A 4MS3B 5KNCD 3Q4GA 3D4BA 3EG9A 4ZU3A 4DA6A 3C48A 1QU2A 1E3SA 1ESCA 1DCMA 1QBGA 1V16B 2UDPA 2V0NA 2IV7A 1URPA 1Y3IA 5BV8A 4G3XA 1QOQB 1ADJA 1U94A 4TRRA 1KNXA 4WLFA 2ZIVB 4WBSA 3REGA 4ENRA 3FUUA 2IUSA 1OBHA 1E0SA 4MV6A 4HUQB 3UJ3X 1H5UA 4ZALA 1XVVA 1YR9A 3PDCA 4HFJA 1U7HA 3NFYA 4II3A 4Z54A 2X7HA 1WB5A 2OVBA 3U7IA 3RYCA 4OXKA 5SZIA 5K6AC 3NALA 5DHAA 2NTYC 3FNRA 3BGDA 4PYOA 4C7XA 2H57A 5KWJA 3QBEA 3RODA 2CLSA 2EL7A 2V7BA 3RHTA 1U1CA 2ACEA 2JHAA 2O2EA 1I4TD 1OIXA 4QODA 2C2KA 3CO5A 3DNFA 3DZHA 3JQ7A 2YV1A 1B0PA 3ME5A 1Y4ZA 3PNVA 3WP0A 1BQ3A 4TL9A 2HDHA 4LJYA 5HNKA 3LVBA 2CJYA 5JMWA 3RS0A 5FEUA 1IBMB 3T4EA 4EVQA 2INGX 4HSGA 4K9QA 5CIQA 3BGVA 4JVSB 4ZHQA 2CMKA 1KC3A 3I04M 2EYQA 2JW5A 2BBWA 3I6BA 5KJ6A 1N5KA 3PD1A 3N2NA 4OHKA 4K9NA 3WLLA 1NVFA 3KKLA 5B64A 1LRJA 3HU2A 1H0HA 4TWAA 1H8EA 4RH1A 2WFZA 4G2NA 1Y9ZA 1KSJA 5BN4A 3CVWA 2QRKA 5A7GA 1Z6TA 1Z0IA 4YRJA 4TPKA 5THQA 3TTTA 1TD1A 1YUMA 1MO4A 2B2CA 5IVDA 4BE7B 1DQRA 2CXQA 1G2IA 3QVSA 3VBEA 5AVQA 4P83A 4GPAA 4M37A 4K6HA 4QUJA 1ILEA 3TDKA 3BL8A 3M6VA 2W0SA 1BMTA 2I1LA 5T7BA 5SY9A 3K92A 2BKUA 3QLUC 3T38A 3TLMA 2Q9AA 2AA3A 3M0EA 4EEXA 2BEKA 2CK3D 4ESEA 4KO4S 4J76A 4P0TA 3MMXA 1C1HA 1M6VA 2HQOA 4MYTA 2XE8A 2H06A 1O9BA 1OT3A 3E9MA 2CB9A 3KXPA 1KAQA 2PUCA 4AWAA 4RQTA 2LW7A 4N7MA 2BFMA 2DQKA 2OZVA 2ZS7A 4HN4B 2H07A 1TRHA 5D01A 5T6BA 2OXIA 3JRNA 1T0JB 3MLBA 3KSMA 1U2EA 5DU2A 5FPQA 4FILA 1FK8A 3SHQA 1K0FA 4QREA 1PT6A 3RT7A 5KQSA 3QTTA 1GG5A 3UMCA 6CHYA 1M6WA 2WQZA 3NUZA 4XWYA 5K3OA 1KO1A 4WLNA 1TJYA 4FN5A 1E9VA 4LMBA 1N9GB 5ENZA 2H2FA 5FQOA 4D99A 3F1LA 1PGJA 5AI0A 1XRNA 5D85A 5JDCC 5BV1A 4HFMA 1NQAO 1VTKA 2HH9A 3LCVB 3PIIA 1GG8A 3FLEA 4NX2A 4Y67A 5DWQA 3JQDA 4F9FA 3J80A 4N3BA 1BX3A 4AJLA 4DN6A 2PZLA 4DREA 3V34A 2NPOA 1RBZA 5TARA 4P5PA 1P3JA 2EHDA 2N9UA 5TVKA 4F4JA 4OHCA 2ETXA 4DEVA 1NJ1A 5FOVA 2JASA 3R5FA 5EN4A 4X91A 4CT4B 3AR5A 4EQ6B 1JZTA 1EEXB 2ZRBA 4TYNA 3F96A 2W42A 2F43B 1IEXA 4KQKA 4RY0A 4HT3B 4TTJA 5DRYA 1UT8A 3N70A 1O97D 1ZNZA 4PIPA 5H4GA 4DCPA 2O3TA 1BJKA 1VLJA 2AZXA 3LHIA 1KRWA 2HDOA 3TDNA 2EZUA 2RHDA 2VP6A 2CHVA 1MMFB 3AYZB 2MYTA 3IKVA 3FOEC 1IWOA 2HN9A 1DAPA 2DBQA 3DL0A 1YA4A 4GOND 1U81A 1YU6A 4QOJA 4U9HS 2XMCA 2GFQA 1FUKA 4UHJA 1PWHA 4WDRA 5EP2A 1JSXA 1YOVB 4WN9A 5BOSA 4JLJA 2JH9A 4MCJA 4R1NA 1B3RA 1JXOA 3R7NA 4P4TA 3GZNA 1P7WA 1PK8A 2ZCUA 5KAMA 4J3NA 4UNQA 1M7GA 1D6MA 3ELDA 1P9OA 4BO9A 1OXSC 1DARA 2ZJ8A 2FZ5A 2OHGA 4MEAA 1IHUA 5DHRA 5FLYA 5CIYA 5E7MA 5ECGC 5FHQA 1FQKA 1W88A 2B5OA 3P45A 1S89A 4JQSA 4QPZA 1G64A 3BMXA 2OAEA 2IOHA 5JAPA 3ZVKA 3CXRA 1LTQA 2IUUA 2B37A 2R3SA 4OPMA 4ZVRA 4JYAB 4IS3A 4JJIA 4XQCA 4MYSA 1S2LA 5FOXA 4CKCA 5DWVA 2EXXA 2I7VA 3C6QA 1OFUX 1E61A 1WDTA 2NZVG 2PFSA 3RTAA 3LL7A 4PM4A 1WUJS 5CD1A 2DCUA 1K7YA 4LGYA 2YQ4A 2HGSA 5KX5B 1I5EA 4HK4A 1HG1A 3G9TA 4HMQA 1UBLS 4ZMBA 4F4DA 1TJ4A 3H65A 4J0GA 1P5ZB 3TD6A 3Q9SA 2ZSFA 2ZUTA 4Y30A 5EL0A 2KBFA 4Y6SA 3S5UA 4XYMA 2FWIA 2WYIA 3LFHA 4TS1A 4FM9A 1K7EB 7ADHA 5JU6A 2ZB3A 2ZDQA 1P1KA 4JUAA 3BORA 2GM9A 4BBJA 4BMXA 5K03A 1NG9A 3UB2A 1T13A 1OGIA 4OMFG 3QNWA 1QWSA 3KUXA 3N8KA 4H0NA 4IDDA 4L4SA 3W34A 4AFNA 2RE8A 4B6PA 4BWFB 5JCZA 3VU0A 3AL2A 1DFGA 3HXTA 4KNWA 3SCZA 5J3JA 2VNAA 4LYYA 4K9MA 1ESEA 1IM8A 4P4NA 1RWXA 1OA0A 1WD7A 5BWCA 4JZYA 1CUGA 3G2MA 4M0UA 1ECPA 1TT5B 2IHBA 3FI9A 4RU1A 2HK8A 3QA3E 4LS3A 2Y1OA 3HYNA 1N75A 2JCSA 3U0BA 2B34A 1KMIY 1M2OA 2MYNA 3K70C 3B6MA 4KPUA 5JNRA 3E81A 3SYLA 2NT3A 3A1VA 3C3DA 3AFGA 3QQPA 1N1GA 3SOPA 4DIMA 3ESZA 5A5GA 2ZWVA 1CSEE 2GCGA 3DEJA 3WGUA 2QUBA 3ZDCA 3C5EA 3ZN2A 4GECA 2YDYA 4F7DA 1Z06A 1UDXA 1K5DA 1J0AA 3NHLA 4J7XA 3ZZTA 4ZV4A 3VTKA 3BM5A 2C5HA 1CF4A 1T6NA 2AL7A 3OOYA 1IRXA 1HYHA 1Q95A 2JANA 1DELA 3NHZA 2XGOA 1G2OA 4KBFA 5B3JA 1CYEA 4I81A 2X9VA 1XA3A 5J5VA 2FMHA 2NTJA 3WLIA 4C03A 1N8SA 2ZE8A 4Y2RA 1OA1A 1D5CA 4EOGA 3AEYA 4RANA 3JQBC 2A2ZA 1ZHHA 2D00A 5DGXA 5JAIA 4OY3A 4R16A 2P9HA 1KC1A 3V2GA 4TRMA 5GAJA 3AOEA 2WWRA 3UOWA 3C7AA 2ZWAA 4DCSA 5K01A 2NU8A 2B8EA 2O2ZA 3DAYA 4GGOA 4HDRB 4ESOA 4XJVA 1F7UA 2FDXA 4BECA 2AKEA 5IN4A 3NATA 3B9RA 2BLLA 2HJRA 1DIAA 1KAGA 2WWFA 3E53A 1FDWA 1UT5A 2ZPUA 1GL7A 3MT9A 3B52X 4R31A 1WPGA 6REQA 4PYKA 5CA1F 2OO3A 3ZCXA 2DHRA 1YJ5A 4IMPA 1R15A 1P5FA 2HCFA 2XH8A 4OJYA 3LDFA 1SN7A 1ZYUA 1XTVA 2P4UA 3QH4A 2PKEA 2V7QA 4PIMA 4TT3D 1CETA 3WNDA 1OJLA 1C3XA 3X1XA 3R0VA 5FO1A 4ZQBA 1PT7A 4M1EA 3LRPA 1NVTA 1XL1A 2VHTA 1L4UA 2BISA 5K45A 2Q0QA 5A9SA 2JGLA 3JV7A 1JPVA 4C87A 1SCUB 2IX9A 2F1RA 3LV8A 1TA4A 4PHCA 3H8VA 4YRCA 4DRZA 5JNLA 4UCFA 1C50A 1P4JA 1UMDB 2DZDA 3L8GA 3BA1A 5ALMA 1RJDA 4C5BA 3UC9A 1U1EA 4Q15A 3SVTA 4DBLC 3HDHA 3VTAA 1BMQA 2WUEA 1QV9A 2XZLA 4DJDC 1T3LA 4QQRA 4UEQA 5BSHA 4BHTA 3CM0A 1UXGA 4PIVA 2PZJA 1PDWA 1TTQB 3ITDA 4CF6A 1P1FA 4YUVA 4CKXA 2J32A 4X85A 4CQJA 3RGGA 1SO8A 4I1SA 5EE0A 1QHHA 2OV3A 2V65A 4DJTA 4DJEC 4Z0PA 4GX0A 3T1YB 2XYRA 1XEXB 2QF7A 4PRYA 2JI6A 4N03A 1TYEB 3WNBA 4LOIA 4O1HA 4A27A 4U39A 2VYCA 5JCXA 5E2AA 2QMHA 3USZA 4Q19A 3WS7A 4C05A 5J4LA 2NO4A 2QSJA 3M4YA 4KDRA 4G9EA 1Y3BE 2AI3A 3CKLA 3KKMA 4LJAA 4B7AA 1JTVA 1DBPA 2EZ9A 3VR1A 1T5IA 3E3AA 1GNRA 5U9CA 2V1XA 3B7GA 4GAEA 1EVIA 1UBTS 4JC4A 5B2ZA 4FX5A 4UM7A 3ZE0B 2WKPA 3GT4A 2AEMA 2Q27A 1KSHA 4ZT2A 1BDHA 4CGZA 2BEVB 1CRPA 3GEHA 2D1FA 1VGRA 4RGVA 3CNHA 1KZ1A 2CEAA 3MWKA 4WINA 3ROKA 3AUSA 3NIFB 4UBJA 5IT5A 4TTQA 5F64A 4EO4A 2QLBA 1JQEA 3E22A 2E1PA 1K75A 5K3DA 2YV3A 1X8JA 5BSEA 3B89A 5AVRA 1NGSA 5FJIA 1VHJA 1X7WA 4AS3A 5AKEA 2VLIA 1G6Q1 3U2QA 3H9JA 4CI0B 2EWVA 4LYEA 2C9MA 5T6MA 3T3PB 2O3JA 4B83A 4BNKA 4DA9A 1PR4A 2E48A 3A05A 4B6RA 3CEPB 3QKUA 4MRSA 1N32B 3QEMB 1I51A 1YJAA 3C3PA 1N2GA 3CPHA 1NR5A 3QPBA 5JLAA 2EJTA 3QEJA 1R6VA 3H8JA 9MHTA 1NDQA 2JFBA 5DHUA 3WAKA 4ZDIA 1K06A 1RWVA 2Z5GA 1AX9A 4DIEA 2Y1FA 1RCTE 1W49A 2AFRA 2AMJA 3ILYA 3IJEB 3NV9A 2IVFA 4H7KA 4Y7DA 3KUDA 3L6UA 5EFOA 3A0RB 4L8FA 2FPPB 2QP9X 3EEFA 4WKCA 1P75A 4UAJA 1CY0A 4A2QA 4D46A 4U7DA 2BZ0A 3GVIA 4PQEA 3JQFC 1ZD3A 3WDLA 3X1MA 1EFKA 3BWEA 3LVQE 4GF5A 1MTZA 1NLFA 4QYMA 1YC5A 2HRBA 4CQLA 4D02A 3TRHA 4KI0A 3LVFO 5CUQA 1II8A 4RM2A 3K9LA 4NYMQ 3PFWO 4ZGBA 4Q1DA 4G1MB 3UWKA 4MDFA 2A1TR 3HI4A 3ZOKA 4MINA 1SFRA 1SD2A 4FOPA 1RQXA 2UUPA 3I58A 4RK4A 2FRXA 4W5TA 5DPMA 3CN9A 3AEQB 4DCOA 1QBKC 1RHRA 3FHLA 2EKDA 2DFDA 1KHTA 4CTNA 3E9NA 3Q7EA 5JEDA 3OFNA 3G5AA 2W70A 1EK0A 3O4VA 4ZOLB 3WJAA 3TGPA 3LK6A 2PBRA 1PS8A 4QHYA 1QQ5A 3G5UA 3HB5X 5A3VA 3HYTA 3MB8A 3FB1A 3AM4A 4KQGA 4RVHA 5B3JC 5ITZA 2PR2A 2CWWA 1OFGA 2B36A 3LS2A 1SVIA 3ZD8A 1S02A 4NDAA 1PNTA 3UMFA 3E0XA 1A50B 1WETA 3IIIA 4F7WA 3HR4A 2P5UA 3SR4A 4HAOA 1R6AA 4CTMA 1DDGA 1VI6A 2X5XA 3TOVA 5CFNA 3LP8A 2QYSA 1P1BA 3RQIA 1PDVA 1DPGA 3R74A 5HHTA 4LSGA 4MUGA 1A7AA 3A1UA 2FMIA 3B9PA 5JFOA 3MG9A 1GXSA 1YVRA 2ASVA 3AW9A 2IYFA 4PNHA 4PZAA 4QBFA 3AF3A 4OQMA 2IEZA 3BWBA 1P61B 4QGFA 4RSHA 5HTKA 2OYRA 4FGJA 3TSZA 5HKBA 3TZQA 1JR4A 2X1VA 1MOPA 4TXNA 1CPYA 4BVBA 2ZPTX 4YJGA 1LPPA 4JYCA 3CLUD 3B8EA 1XTRA 3OO0A 1Q0RA 2PIDA 1R0RE 3KX2A 1JBKA 1NW4A 4GBGA 5P8WA 3LT5A 4XYEA 5DBIA 1CUFA 1SQSA 3P2YA 2NZXA 2I76A 3ZHSA 1G9XA 1QK5A 2IUFA 1N0HA 1TMYA 2WFAA 3P97A 1VJ5A 5BN3B 2W2KA 4YN3A 1T8WA 3B5JA 3FE2A 3CR7A 3ONEA 1SIWA 1I0LA 3WFJA 3GRFA 3DT6A 4ECAA 2FPNA 1G0NA 2UV8A 4QXRA 3USCS 5KO2A 5JNTA 4LG1A 4WW0A 5JNVA 3E82A 1WSDA 2VH5R 1RHQA 4PQGA 3WO1A 5CFZA 4HFNA 1K4MA 3MWLA 4TYPA 4ZODA 1X7DA 3RRJA 4KVFA 5FBLB 3TTWA 2N46A 4Z4HA 4B3RB 1RIFA 4OGKA 3F5FA 2B3DA 1DX9A 2PSDA 1N6LA 4ZICA 1I0IA 2RGNC 4IJUA 1AVTA 2IYSA 4WBXC 3N28A 3STVA 5B6IA 1A95A 3B9QA 5WRFA 1CT9A 5I9BA 2I1WA 1OLSB 3EXEA 4DWOA 3O95A 2VP9A 1Y4DE 4NK5A 3I72A 5ILQA 1DTSA 5I7HA 1R0BA 3LTEA 3R75A 3EGDB 3UK1A 4ER5A 4WY2A 2AFVA 2VDWA 3UNXA 1IUOA 3AETB 3JQ8B 1SUFA 1Y9JA 2XADA 1FDVA 3WHIA 5BQPA 4MRPA 1EWYA 3TYXA 2P5YA 2Q6KA 5D87A 1KSGA 2HNKA 2X5NA 1LDEA 1CJMA 2WB4A 3SZUA 4Q7JB 4MS1B 2AR7A 3EG9B 1KJJA 2X2FA 2O5EA 4OU5A 3IDAA 1S01A 4M8SA 1ESMA 4KOAA 3GP3A 3PHLA 4UASA 2H9YA 3ZWQA 3IBCA 2VHQA 5A03A 2X4LA 4EKEA 1QGYA 3AG5A 2QR3A 2XMQA 4N9WA 4YH1A 2NVUB 1V0JA 4CYMA 4RY2A 1B4DA 4C6SA 1O94C 2NUTB 4LXIA 4YCCA 1D2EA 1GKLA 1B6RA 2IY7A 4QUEA 4XGNA 4TKVA 1UC9A 2HYDA 2FUNB 3I2KA 3A14A 2X0FA 2P62A 3UKDA 4CI9A 3AVOA 4E09A 3HFSA 1Z38A 4UAGA 4BN4A 1JAZA 3CNEA 1E5QA 2DUMA 2RBKA 3IPCA 4FLMA 3PB3A 4CHGA 5I01A 1DSSG 2RGUA 4HGYA 1UPBA 4C78A 3T5BA 5JFTA 3BK1A 1U99A 4L5BA 5AQEA 2XXAA 4KK3A 3BF7A 4M1ZA 4FCWA 3HCNA 4K2AA 2P2ZA 4CLOA 2H7VA 2QGNA 4US0R 1UPUA 2A35A 5C52B 5G2OA 3RUIA 1BSVA 1N8NA 5CB4B 2AVNA 2I8CA 2QYTA 2GSDA 2O2JA 1X1CA 2WSMA 3K2EA 4UM8B 3T41A 1GWNA 4C5CA 4EZBA 5BV7A 2FEOA 2Z6QA 4CKEA 3QF4A 1JJAA 1R12A 4GQAA 2Q50A 1CUXA 1YE8A 3HCDA 3ZNNA 3ZWMA 4PWZA 1YJBA 2GZDA 4FSHA 4A6DA 4A0QA 3K2QA 4AJNA 3KETA 1I1NA 1QOPB 3PQ6A 4G4SO 4OHVA 1KOFA 4Y2YA 4DSNA 1KY4A 2D5BA 3WRXA 4TQAA 3ORQA 4FMCF 2NG1A 2P9YA 2Q3JA 4HWTA 4Y1RA 4J2TA 1EFTA 1USWA 2BFOA 2FEPA 1N5RA 3H0VB 2FHSA 5IPFA 1O96B 2JBWA 1T24A 1U28C 2QK4A 3Q8KA 2XCUA 3P0IA 1R9MA 5DM0A 1XTPA 4RZSA 3UJNA 4EITA 2JI8A 4NFYA 3BFJA 1X1DA 1NYQA 4OGFA 3BVPA 4R7ZA 1QIEA 1A8PA 2G71A 2WF5A 3TAXA 1SXQA 3RC8A 1ZRNA 3QUQA 5BNTA 2IIBA 3UA4A 4KQFA 4RYDA 2JFVA 2VXCA 5CLIA 4EGCB 2FWNA 3N2EA 1Z5VA 4OGGA 1L1QA 3LBFA 5J2UA 1UZLA 4QUHA 1Q0LA 4GZLA 4Z7OB 4FR5A 3TQSA 4Z7NB 2PGLA 2VTEA 2ZRQA 3QLJA 3UAVA 4CIYA 4C07A 2NT4A 3PNBA 2ZRDA 4KWTA 1YR2A 3FIUA 3ROXA 4CM9D 1MT3A 2M1ZA 1UFQA 3WBJA 4BPRA 4QJ3A 3AR3A 4NEGA 4ZARA 2QN9A 3HKEB 3FWZA 4MGKR 4YP7A 1TF7A 4BVFA 4C14A 2VHVA 1GD1O 1I7LA 4WXPA 5JAQA 1Q57A 3KJFA 2PRSA 2NQ2C 2A0YA 1MB3A 1OPRA 2V7EA 4NBTA 5FAXA 2PUEA 4JT8A 2WJIA 2IF0A 4DAEA 5ALWA 4BRZA 5LZ2A 2CN1A 1E64A 1YWGO 3BMQB 1JDPA 3GEBA 3LCJA 4TLBA 2HXYA 4FKMA 2VPXA 1OZAA 1G6KA 2OUIA 2QWXA 4LHZA 3VJKA 2W2PA 4Z2AA 4ZVQA 4AXBA 2ZKIA 3RFTA 1CZNA 3AY3A 2ZQ5A 5IH3A 4KKXB 5JT1A 2MHCA 1MHMB 2ZBVA 4NU8X 3DGEC 2J4DA 2OHIA 3VPHA 3T52A 3B13B 2HFJA 1JT9A 3QPAA 2EFYA 1DC3A 4CV3A 1FP1D 4US1R 4UBKA 3K0CA 4AKGA 4LCBA 5CPBA 4YAGA 4QUDA 4FGSA 3ESYA 5TGTA 3IGFA 1V11B 4LZLA 1QQBA 4K9LA 4MZDA 5JQWA 4FLEA 3NYWA 1SVSA 2KHZA 4LAFA 3H8SA 2QRVB 2YCBA 1IQPA 2XOKA 2Y1KA 1X19A 5AHWA 5L40A 1NBEA 2FFBA 5CLFA 1GFZA 2QD5A 5J4KA 1UFRA 3R6LA 5LQJA 2E6KA 4O4LA 4URHA 3LZ6A 4Z9YA 3MRSA 2XVMA 3BRWD 3IPLA 3L5KA 1ZIYA 4IO1A 4KR3A 4B3HA 1G5TA 1Z8NA 2XNDA 3JZDA 4TXMA 2WM8A 2VK2A 3OZFA 2OO7A 3ZWPA 1G1AA 1XYYA 4BXOA 4DPKA 4MTCA 1KKUA 3OCWA 4YIHA 2YYZA 1X7ZB 3JYPA 4IIJA 2FUG1 1M66A 3ET5A 4TV9A 1GTMA 3LOUA 4K03A 5DK4A 2EFJA 2DRIA 4QAJA 3V4PB 2FWAA 1U0TA 2JGNA 3GRCA 2X76A 3DFMA 3FW1A 3OUUA 4NR0A 2Q8NA 5K3SA 2GJSA 3MSXA 3R6GA 3GGJA 3AHEA 2HHJA 1XLUA 4KYVA 4V3CA 3SM9A 4EB8A 1ISRA 3L7NA 2CJFA 1E99A 1DEHA 3MIIA 5I7RA 3ERCA 4I5FA 1Z88A 1HDRA 4NAVA 4L16A 3M4NA 3N1UA 1PD0A 5HJ7A 3VC7A 2Q6LA 2X1HA 3IKMB 3I6MA 5CXXA 5DSXA 4WDQA 3ZXIA 2ZCJA 4U0JA 4YRKA 3FYCA 2JCYA 2O50A 1JI3A 2REXB 1A69A 3ZVLA 2P41A 3AQIA 5K4AA 3KK0A 1F0NA 2AX3A 1KZ9A 1V9CA 1XJCA 2WP0A 4OLJA 1S3GA 3N6RA 1ZZEA 1DO0A 3KCQA 3QVXA 3KYCA 3HFRA 1XTKA 4CEHB 1N1MA 4Q4JA 1AN0A 1VRCA 1MA0A 1L7EA 2FSHA 2HU2A 4ZHSA 4MV7A 3VGPA 4AJ9A 5FWXB 4D57A 3PQ3A 2UVDA 4EBBA 3LC7O 3KUUA 1P8JA 1TFRA 3CZCA 3QYPA 2QYOA 2CHEA 2Z2ZA 5FV4A 1TLTA 3C6XA 2WG0A 4PN7A 1JMYA 3TGLA 3AI2A 1YZUA 2HQRA 1YUBA 2PL5A 3MMSA 1MX1A 4C0AC 5HF6A 5IZ4A 1ZVJA 7YASA 5IBCA 5KNDA 3PD0A 2HMSA 5DI9A 2RDMA 5ETJA 4I7EA 5HCNA 1BWPA 3FWPA 4M0LA 4I9FA 1KI1A 3DEAA 5TE9A 4UVEA 1F3LA 1JEQA 2NO5A 4PO9A 1OXKB 3DPIA 2PWPA 2XZPA 2VH2A 1RLIA 1PX0A 2F2TA 4HFRA 2Z9BA 4LFCB 3I04A 5I3CA 3TW6A 3OIDA 2I66A 4KIJA 5EE5B 2PH5A 3CC8A 3M9WA 3OETA 1N3BA 5DOZA 1I80A 1DRJA 5D3MA 1ZGBA 3D8RA 4B2IA 2G1PA 5HQJA 1L4MA 4YACA 1G9TA 3CF2A 2FLWA 3LUFA 3UH1A 1LSSA 1VE1A 3ZHBA 2PGIA 1D2CA 4XCVA 4C30A 3HA3A 3ORSA 1HUQA 3BXOA 3LWZA 3B1XA 3TI9A 2BFCA 1Q91A 4F2DA 4PLWA 1FLNA 4YHHB 4DCUA 5H81A 1Z0FA 3BWDD 1XQ1A 1ZCBA 2IUEA 3RTEA 3VNUA 2UVPA 4R0MA 2NU8B 4QTUB 1U1DA 1J7KA 3RFXA 3ICOA 4CU2A 3DKRA 3DV2A 1SXJE 1Z0DA 4L15A 5DT2A 1TK2A 2GKGA 3SBDA 2QRLA 3LGXA 3VBCA 4DQUA 2RHJA 2NU6A 2DWUA 4B31A 3WOHA 2MTBA 3F0TA 5DW0A 1E3JA 2VFAA 1PV1A 1JLMA 2QAGB 3W90A 4V0RA 1X77A 3ZQ4A 5A2GA 4RTOA 4O8CA 1QB7A 2CCGA 2NU9A 3LSTA 3T5TA 2A88A 1AKVA 1HDZA 1QZUA 3VZSA 4BZWA 3PU6A 2FJUA 3QLVC 2ZYUX 1KDVA 2NXJA 2M98A 3HP1A 2A1IA 4ZQGA 1EHCA 3SBXA 5CT8A 1ADCA 4XASA 3CMMA 4RS3A 3O75A 5E8RA 5JAUA 3LG2A 1HE3A 5AW7A 1KBZA 1TVKB 4BMDA 2J0QA 5CFLA 3ZDYB 5AXCA 1MRNA 4KV9A 4HNVA 2IS6A 4EECA 3KKZA 1KE1A 4TV8F 1OYWA 2BM8A 4LY3A 3DWGA 3L8EA 3VYTB 4ND8B 3HMQA 1VL8A 2V6GA 1FFGA 3IMGA 1W2GA 3KSUA 3PUHA 3SQMA 1THGA 2WF9A 1FNDA 4HNQA 4PLHA 4A23A 4ALLA 5B1YA 5KYNA 1LX7A 2K7FA 1I10A 4DTIA 4HWKA 4IDCA 3GP8A 1RQRA 2UZ4A 1QIMA 1XDDA 1PJ8A 2HA5A 3C43A 1MUUA 4DQKA 1BDMA 5L3QA 5CDUA 1FVHA 2BN4A 1GVNB 1IOWA 3CX8A 4IZOA 2WDZA 1TAGA 3IKJA 2ZRHA 4RADA 4TXLA 3PGVA 1GSAA 1K8ZB 3R76A 4UZSA 1DTEA 3IODA 2CMGA 3ZGYA 1EA7A 4B3TB 4A36A 2QTZA 4OBBA 3STUA 5DM70 3EXAA 5LIRA 1XC7A 4ZFNA 1FY2A 2XCSB 1NQTA 2QT9A 4MWOA 3GRVA 2Z1DA 5AVJA 5AXBA 3IP8A 2BHSA 1FXWA 1ZMRA 3JWJA 2NO9A 1SHKA 1PR6A 1U0LA 3O8NA 5JMOA 5KU7A 3HYLA 4HQRA 4PPNA 2YW2A 3UJ6A 3EOAI 2DHDA 1XZHA 2QLTA 3OTGA 5AOAA 3PXGA 1FNCA 4TYYA 3KQTA 3NQ41 5DE3A 4KLRA 2G08A 1NQUA 4H3VA 3INNA 1DLIA 2XT9A 3C2QA 5CBKA 2EC5A 4URXR 3I9LA 3VVLA 3NWPA 1S96A 1U8CB 2BJWA 3H6HA 2UYGA 4DDTA 8OHMA 2FPRA 4X60A 1N2EA 1ZONA 3D7SA 2VWQA 5DJ5A 5E0KB 2VF4X 5DNWA 1EJ2A 3ZE9A 4E2ZA 1MAAA 3ZDDA 3QPUA 3OTIA 1A5TA 3WGJA 1UXJA 1HT0A 2WWIA 1TK9A 1SIUA 1B14A 1MO5A 1VXOA 4UXHA 3COVA 1XTBA 2RC6A 3AP2A 4LKOA 1Y82A 2DQZA 4YP5A 3C5CA 4RMJA 4D9NA 2IHJA 3KWLA 4CL8A 4KE7A 3U1BA 2AIRA 1J0EA 4H08A 1F2DA 4QA9A 1XBTA 5EIWA 4TM8A 2ZM6B 5LZ5A 4HB0A 1YAHA 1QVWA 4PC3A 1SXJB 3LPCA 1J7JA 3L07A 4WPGA 3SR3A 3L0BA 4BVAA 3KFLA 1ORDA 4B4UA 2RK4A 4DLAA 3T9CA 4TMVA 3GRAA 1MB9A 1Z08A 5JATA 2M2IA 4W4TA 3SY8A 3RWBA 1P44A 5K9ZA 3A31A 4LOAA 5AWFC 3GZJA 1EFHA 5BV0A 5IXSA 4N7RA 3KVVA 3CH5A 4MWGA 1YL6A 3TX6A 1WCWA 4I50A 2W11A 1J2JA 3MF4A 5HZHA 2HLHA 5H70A 4DT1A 3GLVA 4QUKA 4Q03A 1E8MA 2GX6A 2E7ZA 3KPWA 3PFKA 4G84A 2IHNA 1CQPA 3AFOA 4M55A 1CCWA 3V7FA 5J4YA 3A6JA 2P5SA 3HJCA 1XMQB 2DQ4A 2YNMD 2ZDGA 4BJHB 4ZXFA 2ET6A 4CCSA 4ETNA 3RRXA 5HQ3B 4GMFA 1OIWA 1NYLA 2D0OB 2I2BA 2LIPA 3DR5A 2ZZNA 1GARA 3G0CA 3JQRA 2XUIA 5EMMA 5J2TA 1NRJB 1BROA 3Q1LA 3Q11A 4EY4A 4I1PA 3LBAA 4ZO4A 3N2KA 1UF9A 1FSFA 3ROGA 3I5AA 3FYHA 2VP4A 3UVEA 4HO1X 4WTOA 4IZ6A 4GS5A 4GYJA 4DSZA 3WG9A 4ERNA 1T3SA 1QGOA 2JATA 1EXWA 1K9SA 1U9IA 1SVOA 2RGWA 2H08A 2O7QA 2RIRA 2ZXEA 5SY6A 3RWOA 4EJSC 4PZZA 5KTNA 1EA5A 3ZNOA 2OCKA 4X1KB 2O23A 2A5JA 2R4QA 3CKYA 3HNPA 3GJQA 3KB6A 3VZRA 2DSNA 5LWHA 2Q22A 2ZUBA 4QGAA 2HWYA 2D62A 3BAFA 5CNIA 1FFWA 5HBRA 2IZ6A 4OOFA 3V1YA 2MIIA 2POCA 1FW8A 1KS2A 1Z4QA 2WHQA 4JVLA 3ZDRA 4CMJA 3DO8A 3TW4A 1A8SA 4MQBA 1E3WA 4CEIB 1M76A 5JS2A 1C3OB 3QU7A 1BMDA 1OV4A 1TUBB 4IVQA 4ZOQI 5FFFA 2FZGA 4HQLA 2Q1UA 2DBVO 5JSFA 2OBBA 3L8FA 4EJ2A 1HF3A 4MUXA 2QRQA 3X43A 4LV8B 2BLNA 1RJGA 4N8EA 1NSYA 2QN1A 3H7IA 1QCCA 3SS7X 4DTCA 1QQAA 1AS0A 1FOEB 1E9EA 1SCJA 4ZAVA 4LDZA 3GX1A 4MI1A 5EWMB 5A4DA 2I5PO 1EG7A 3ZK8A 2BEWB 1IUKA 3RRBA 4U7PB 2QPAA 2CLHB 4ND3A 2ZR9A 2NSHA 2PKCA 2BD0A 2PMEA 3PNLA 5B3KA 3DULA 3HVKA 3SMQA 2AWOA 1JYEA 1K7SN 5DO9A 4LHYA 2DT8A 2QENA 4JH0A 4XWAA 3ES9A 4LOHA 1KP9A 1ODJA 3CBGA 1N5JA 1Q7TA 3GDFA 2PH1A 2ZIXB 2CDBA 3R4VA 4GM0A 4H1TA 4KL8S 4NYJQ 1PBNA 3F6PA 4CJXA 4EO9A 1FMJA 4YEDA 3IB3A 1SWWA 3HYRA 4ZKEA 5A05A 5C5DA 1RRGA 4OKIA 1G6HA 3BHNA 5JDIC 1R27A 4HBZA 4A5OA 5ELXA 4ENSA 4U2FA 5BVGB 3KSZO 2D8AA 2O5CA 1NBIA 3CTMA 3OU6A 2I33A 1SUPA 3K9WA 5I7EA 4WCDA 3BMOA 4ARVA 4EW1A 4RDHA 3CNQS 1LLQA 3NZEA 1YB1A 1D0IA 4F71A 1M7BA 2QRGA 3QE3A 1OFUA 2Q3DA 2R66A 1TKAA 2G09A 4L27A 2BCJQ 4HDMA 2QGZA 1ZZGA 2OP1A 3NBUA 4R2JA 3R3HA 1D1TA 2ZXFA 2Q2NA 4IH1A 1GZDA 2HWWA 3OJCA 4WWHA 3GJTA 2MDTA 1W5TA 3IP1A 1KK1A 4KSYA 4YO8A 5CCDA 4CKBA 2IITA 4ANFA 3HKCA 5EMHA 4CV0A 1J4AA 2WJHA 4OMDA 3TLAA 3EWAA 5ADHA 2ZAIA 5K0ZA 4H7FA 2Q4DA 3AVYA 3WNZA 1C5KA 4HDKA 3DDZX 1Z5WA 1ZXLA 3P9XA 4EDHA 2JJQA 2OORA 4ZO7A 3QSYA 3FGPA 3TTUA 1AT1A 1ADYA 1HI9A 1WU8A 4HSEA 1QR6A 3CEAA 1ZIOA 1E5TA 3EVAA 2VQEB 1DI0A 5A7HA 1B26A 3TUZC 4RJKA 3UAZA 3QVTA 1SCDA 2QRNA 3OLYA 3H3FA 3ZIAA 1K4KA 1MA3A 2IP2A 3OM0A 4IZHA 4ZAXA 2O8CA 3B53X 4ZI2A 5CA1A 3ZI0A 2FFAA 2HU8A 4C7OB 1HETA 4IOLA 5EP4A 1W0JA 2JK1A 3EUFA 5JAHA 2GLTA 4AZTA 3WDKA 3OCVA 5AHOA 5E4JA 1VLLA 4NNOA 1U6IA 3B8HA 3CGWA 4HS9A 2ZT6A 4QEKA 2GHTA 4MICA 3ICVA 1AIPA 3LQ2A 4J91A 2E0IA 3G3EA 3TAHA 3EVGA 7GPBA 5KX5F 3HXOA 1FP6A 4KZKA 1QYXA 4DJJA 3GFGA 3W78A 4Z1MD 4DHWA 3HGMA 4X3CA 1EWQA 3PNSA 3L49A 1GGEA 5AJVB 5FXMA 3QPVA 2X1MA 2OA0A 3SE7A 3NUGA 3VPSA 3AY0A 4YR9A 3LRTA 3PHCA 2CNLA 5IXYA 4QVIA 4GL2A 4V0NA 1U8UA 1QG4A 3L0ZA 2Z8YM 4PFKA 5KKNB 5CR9A 4Y1RB 1QZZA 1SBHA 5FDFA 3F49S 4FHEA 1VPVA 2YIVX 5H3CA 1PEKE 4B7ZA 1IBLB 2EQBA 3LPDA 5LQK