2POQX

Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
331
structure length
331
Chain Sequence
ALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPNVEVAYVGTQHPQHKAAVMLCLAAGKAVLCEKPMGVNAAEVREMVTEARSRGLFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLTHVPRAVDWAQAGGALLDLGIYCVQFISMVFGGQKPEKISVMGRRHETGVDDTVTVLLQYPGEVHGSFTCSITAQLSNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFLLPPVPKNCNFDNGAGMSYEAKHVRECLRKGLKESPVIPLVESELLADILEEVRRAIGVTFPQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dimeric dihydrodiol dehydrogenase
publication title Structure of monkey dimeric dihydrodiol dehydrogenase in complex with isoascorbic acid.
pubmed doi rcsb
source organism Macaca fascicularis
molecule tags Oxidoreductase
total genus 114
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.179: D-xylose 1-dehydrogenase (NADP(+)).
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 2poqX02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2poqX01
3ZWOA 4XIJA 1I30A 3KHUA 4UVEA 3IJRA 4O0LA 1XDWA 4JJIA 4BNJA 4N7RA 3TSCA 1HDCA 1SB9A 4FDAA 1EBFA 1MXFA 2JHGA 1X0XA 2C2YA 2G5CA 2PR2A 3QV1A 2BGKA 4KUEA 4Q9NA 2HRZA 3JD2A 1T2EA 2NU8A 5ENVA 5IF3A 5I7VA 4IXTA 4CMGA 4DMMA 4CQMB 3IIEA 1C0PA 3GEGA 1NPYA 3EAGA 4MJLA 3JQ9A 3WBFA 2WMDA 2CF6A 2GGSA 4L8VA 4JP2A 3WMWA 4P22A 2ZIZA 3VAZA 6LDHA 1HYGA 2B0JA 1E77A 3KLPX 3PHIA 2VZ8A 4ND5A 4XR9A 4QECA 3U4CA 2X5JO 4ND1A 4L0QA 1Y5RA 3DB2A 2ZATA 5U9CA 4BNNA 1H93A 1IHXA 1A9ZA 4TRJA 1IB6A 2NU9A 4CR7A 3GOHA 4HWKA 2GN6A 1FDSA 4CQMD 1GV1A 1JN0A 1RWBA 1ZW1A 2HMWA 2VOEA 3BMQA 4NPCA 3NYWA 4M86A 1XIVA 3AOEA 4YTEA 1Q1NA 3ZV5A 3NDJA 3ZWBA 4PRKA 1E5QA 2VYVA 5M6DA 1LXCA 1NR1A 4PIVA 3TJRA 3L4SO 4J4BA 3H5AA 1KIFA 3IAHA 1UDBA 3JTMA 1YVEI 3O4RA 4BO5A 5BSFA 1A71A 4IZIA 3CEAA 3FSRA 3D5QA 2ZTUA 4XX0A 2HMUA 3VOSA 1RPNA 2GN9A 1XSEA 1AN9A 2FPIA 3N7UA 2WM3A 2DPHA 3L77A 3DZFA 3DBHA 3RQSA 1YOVA 5I8WA 3FTPA 3OQ1A 3GLQA 1ZEJA 1TVEA 3WFJA 3ON5A 2X86A 2C0CA 3GGOA 2YV2A 1AXEA 4NJOA 2VWQA 1S6YA 5IDQA 5KTKA 1T1SA 3T4XA 4UVGA 5L95A 3L4BC 3E5MA 3U0BA 2OGUA 3MWEB 4MKXA 3SLGA 5T73A 2GASA 3ROPA 5A1TA 5IAAA 4R3NA 3Q1LA 4DBVO 1M66A 3RBXA 2CNBA 2VQ3A 2VZ9A 3E6AA 1G6KA 1R0KA 2WD7B 3GGPA 3JQ7A 1MX3A 1ONOA 3FPCA 1H2HA 1HEUA 3SBOA 5BR7A 3M6IA 1LRJA 1XU7A 3QWHA 3TZKA 3WTCA 1YDEA 1DC4A 4RVSA 4CM3A 3GHYA 3ZV3A 2E49A 1PZEA 5THKA 4B3IA 1HF3A 4O6VA 4FJ2A 3G1UA 5AOVA 2HK8A 1B3BA 2NVBA 2BGMA 5B1YA 1BDMA 2VN8A 3PTZA 1QKIA 4PLZA 2G1UA 1NWHA 4BNYA 4JXKA 1CIVA 5A06A 3BMCB 1OZAA 5TLSA 1GCOA 1T2AA 4P4LA 4WECA 5TQVA 3VC7A 3W4KA 4U6SA 3DHEA 1RM4A 4WCDA 4CQMA 3GPIA 2E37A 2X9VA 1T2FA 2GRAA 1D1TA 1YL5A 4CV2A 3GC6A 1JAXA 2C20A 1LQTA 1L7EA 1JKJA 4ID9A 1WMBA 3R3JA 4LVUA 4CL3A 4U0KA 2E82A 3JYQA 4NK4A 3U09A 1CRWG 1PS8A 3PZBA 5HS4A 2QRJA 2AG5A 5L9AA 1AE1A 3IOYA 4E30A 4L4RA 2CSUA 1DRWA 3F9IA 4N5LA 1H0KA 4NR0A 3ST7A 5CDTA 3BTUA 4CMHA 4YA6A 3FNFA 4DA9A 4EZBA 1VLLA 2QX7A 1DEHA 1VL6A 3ULKA 1DRVA 2YHIB 5JC8A 1TXGA 1N7GA 4XA8A 4B4UA 4ZICA 2UVDA 3GRPA 4G2NA 4M54A 3ASVA 5MGBA 3BIOA 3LT1A 4M55A 3VDQA 4A27A 3HJAA 2FPPA 3W8EA 3ZHZA 4BO1A 2GD1O 5TIIA 3OQBA 3DZGA 3QVSA 5IG2A 1M76A 3PYMA 1NASA 3H3FA 4YYZA 1VM6A 1ONNA 3BA1A 4XB2A 4FCCA 5CPFA 3NKLA 1PWXA 1D1SA 3AUSA 3L6EA 3ZHBA 2YV1A 3ZHYA 3FBTA 3K2EA 3NRCA 3R1IA 4RF3A 3PYXA 1P1RA 4ROSA 4NG5A 3L6OO 1BDBA 2CDAA 4R68A 4KDEA 3U4IA 4LVCA 3PHJA 4HFJA 1EFLA 3CE6A 2B35A 2PZMA 3JCZA 5ES3A 2Y67A 1TI7A 4YAEA 4BNLA 2G76A 1LLCA 4XDYA 1UXGA 2X58A 3ROMA 4QTZA 4QT0A 4DQUA 3DDNA 4MPDA 3UKOA 3I6QA 4UULA 3WYCA 2HUNA 5DN9A 4TVBA 3F5SA 1SOVA 2EKLA 5EERA 2VUSA 3C1TA 3K9QO 4BNVA 1E6WA 1O9BA 2O4UX 3QVOA 3H6KA 1E3EA 5K9ZA 2JD2A 4B7CA 2DTDA 5AXCA 3QWAA 1YRLA 3GZ4A 3R3SA 1DOHA 2DVMA 4DYVA 5IZCC 3MZ0A 1LDYA 4HP8A 3BAZA 1N1EA 3TZQA 3RASA 3BMCA 1SEVA 4CMAA 1L1FA 2YYYA 3O9ZA 1PWZA 3JYNA 1OOEA 1XCBA 5DCUA 4LCJA 4NHEA 3E9NA 3L4BA 4FS3A 2EEZA 4DPMA 1NPDA 3PRJA 3JSAA 3JYPA 4PN3A 2NLOA 4ALMA 4RF5A 1GPDG 3V1UA 1NFQA 1U7HA 4BNFA 2B4TO 4D45A 3KV3O 3ZU5A 1GYQA 2OMEA 3WYBA 4H3VA 9LDTA 3U9LA 3WTBA 2D0IA 4R9SA 2VWHA 3V2HA 4FGWA 4PGFA 4ZQBA 4CPDA 3T7CA 2GYYA 4LGVA 1BHSA 4CUJA 3JQCA 5U4QA 1N2SA 2D5CA 1JTVA 2ZCUA 5TJ9A 3FR8A 4CJXA 3ASUA 1ISJA 2JCYA 4IUYA 4H16A 4RF4A 1TA4A 4DUPA 1PGJA 3I9MA 3C3XA 5L3ZA 2IZ0A 4XDZA 2Y99A 4R5HA 4GX1A 2WTBA 4NDNE 5ER6A 4BKOA 3NDRA 1EVYA 4R54A 2RHRA 4U7WA 1XWFA 4B79A 3DQPA 2X0NA 1NVTA 1U5CA 4E21A 1HTBA 1E3JA 2ZCVA 1BVRA 2B4QA 4DIFA 1ISGA 1JDJA 4E3ZA 5KVCA 5EL0A 1U2DA 3WWZA 4D0RA 1R12A 3QJ5A 2UDPA 2HMTA 4XQ9A 3A9WA 2AEJA 1DC3A 5TS3A 3S1LA 3MJVA 1VSUA 4IDDA 2J8ZA 2BI7A 4DWVA 3UFXA 1B2LA 4BO4A 3I9NA 1DFIA 1TT5B 4JN6B 4D44A 1KY5A 4XGKA 1E92A 4GVXA 5THQA 3PXXA 3W8FA 1OMOA 4LN1A 1EQ2A 1PJTA 3CPSA 3U4HA 1MXHA 2G0TA 1IUKA 1Z45A 3KEOA 3GR6A 4GQAA 4KOAA 3PJEA 4ZA2A 3VDRA 4C7KA 2Q1SA 2NACA 3H2ZA 4FJ1A 3MJTA 4D46A 3PJGA 3MTJA 1WMAA 1ZSNA 1G1AA 1XYGA 1QYDA 3GH3A 2W4QA 4BNZA 2GF2A 4Z9YA 4PG6A 4ZJUA 2GCGA 3VZPA 4R5MA 1SB8A 3RUCA 3B6ZA 3E9QA 3HB4X 5GZ6A 1YJQA 4J4HA 1GPJA 4XQEA 2YHUA 4GGPA 1UXIA 5BSHA 2ET6A 1EK5A 4J7XA 1X7HA 1YS4A 3A28A 2Q46A 1DLIA 1KEWA 3GMDA 4WLFA 1E3SA 1K6JA 4BO3A 3AY3A 5H81A 1N1GA 2GZ3A 2QHXA 4MVJH 2W2KB 4OSPA 1ADCA 3L6DA 3KYCA 1UZNA 3JQGA 2D1YA 4JBGA 1GUYA 3F47A 3D7LA 4GPD1 2ZTVA 3IKVA 1DAOA 4ZN6A 3ICCA 1UAGA 5IZCA 3OJEA 1IL0A 1XQ6A 4S3MA 4BO9A 3HADA 5ADHA 2FWMX 5IN4A 1ZH8A 1GADO 3C1OA 1X13A 3PLRA 1H6AA 3DONA 1YKFA 4IGFA 3FHLA 2OHXA 3C1AA 4OKIA 1I2BA 5G4LA 4UUNA 1KVSA 3GA0A 3SX2A 1EUDA 1E1KA 1LDNA 3ROQA 3OA2A 3JQ8B 1L7DA 4IS3A 3DFUA 4IMPA 2DBQA 1QYVA 2Q1TA 5COQA 5H83A 3L07A 1ENPA 4JNKA 1NR7A 1NVMB 1NWCA 1WZIA 1C14A 2OBNA 3IDSA 3UF0A 1YB5A 2RAFA 3CZMA 4MVJI 2Y68A 5FYDA 5TNXA 1QG6A 1Q0LA 4M8SA 3VTFA 5FWNA 3IP3A 1ZSYA 2CFCA 4GX2A 2P5UA 1FDTA 2O4CA 5C5IA 2EP7A 2PK3A 4J49A 3TOXA 2IEDA 3UCEA 4YT5A 5EESA 2YFHA 3LF1A 4L75A 2HMSA 2QYTA 4W99A 2D59A 2YFQA 5I8ZA 5U1PA 5C3MA 5CP8A 4UVDA 2JD1A 1PQWA 4BNKA 3W4IA 3EW7A 4IXWA 5G0TA 1P0CA 4WKGA 4W6ZA 2P5YA 4EUFA 3DMTC 4CLRA 1LA2A 2PV7A 1GYRA 4K9DA 4XCVA 1RM3A 5DBFA 1KY4A 2GPTA 2BI8A 4A5OA 5ICMA 1E7RA 5JYFA 4TKLA 1DRUA 1P1FA 3ETGA 3FCOA 2X6TA 2CD9A 1N9GB 4E31A 5F5LA 2Y1EA 3H8VA 4GVLA 3RUFA 1HE3A 1EUZA 3E9MA 1UZMA 3VPHA 2IZ1A 2ILTA 4G5HA 1ULUA 1SZJG 2I5PO 1EQUA 1I3LA 3PFFA 2QYSA 1C0IA 2YJZA 1YBAA 3WGYA 1W4ZA 1I2ZA 1VSVA 1KBZA 2VZ0A 3B70A 5HRUA 1MFZA 3PLNA 5G0SA 3WGHA 4CLOA 1E7SA 2PFGA 5FF9A 1KYQA 3PDUA 4MP8A 1PQPA 5AVOA 1DLJA 1JQBA 1WDMA 2VCYA 4ZGWA 2O23A 2W2KA 3OHSX 1ZMOA 3RSHA 4DXHA 3QWFA 4JBHA 3IUSA 4B4VA 4AJKA 3LT0A 2ZTMA 4IJUA 3ZN2A 3P7MA 4I9HA 4WCFB 5ENDA 4BGUA 3QA9A 4BV9A 1ZO8A 5G0UA 4MVJE 3GFGA 3AI1A 3PHHA 4LMPA 4D42A 4DMLA 3QY9A 1LI4A 4ZRNA 3KVOA 3G17A 1GEGA 3HWRA 3Q9NA 2VHYA 1YB4A 3AI2A 3ENKA 1IPEA 2X9GA 2GDZA 4QFDA 3NJ4A 1AHIA 4F45A 3S2IA 4R69A 3GUYA 1GU7A 2I66A 4BIIA 5KWEA 3GVXA 2AEMA 3WJ7A 3WNVA 3C7CB 1ZKMA 2OUIA 3PQEA 4TZKA 5L7TA 1T26A 4P4NA 3GPDG 3S2GA 4BB5A 5JDIC 2J3HA 4PG5A 4MP6A 4EEXA 1K2WA 3LU1A 3SEFA 1H2BA 4BOYA 4OOEA 5CHEA 3WDSA 3NTQA 4E13A 1ML3A 4AG3A 3EGOA 1N5DA 4E33A 3COSA 4J7CA 4ZQFA 1MG0A 1VKNA 2CDCA 3QQPA 1VJTA 5TF4A 3CUKA 4URFA 3G1TA 3Q2KA 2CDBA 3E8XA 3H9UA 1DDOA 2QIOA 3TNLA 3H2SA 3HE3A 1P1HA 5DF1A 4DLLA 3BMQB 1ZFNA 1B3RA 3OBBA 2DUUA 5HM8A 2BFMA 1KC3A 5IN5A 4MINA 4TSKA 3E5RA 1U7TA 2AQKA 2PGLA 1GCUA 3FBGA 4R01A 5TSDA 2EW8A 4ILKA 1BMDA 4DIOA 5LDHA 4AICA 3OJOA 2EWMA 1A9YA 1I5RA 3D5TA 3LDHA 4FBGA 3RKRA 1HYEA 3HNPA 4A26A 1UDCA 5LDGA 1PZHA 1AGNA 4NQZA 3AY7A 2GZ2A 1A7AA 1LU9A 2W2LD 5KJEA 2D3TA 4QEDA 2FSVA 1LLQA 2FY8A 2HSDA 1QR6A 1DIAA 2EG9A 2O7QA 3DBHB 1YOVB 4NNJA 2YZ7A 2JAHA 4KTTE 1EVIA 4M87A 4ZQGA 1H6DA 1DFHA 2NUAA 4IJKA 1UXKA 2DBVO 4RDHA 5JMWA 3PPIA 1VE9A 4CUKA 1JVBA 3DOJA 1QV6A 2DT5A 4XYMA 1QV7A 1EMDA 5TJHA 4INAA 3GEDA 3QIVA 4PLPA 1F17A 3BHJA 5JYAA 4O59O 4MVJP 4NFYA 1GY8A 4AJEA 3AM3A 3GAFA 3DMTA 1DIGA 3JQFC 1O5IA 1U3WA 1DB3A 1O8CA 2AQ8A 1PJ2A 1EVJA 3GNTA 4M89A 4D41A 4KMSA 3K96A 4J1SA 3RC7A 1KOLA 4MVJG 2ZTLA 2PLAA 3EUWA 4LMRA 1PGPA 2X1HA 3LT2A 4H15A 2OP1A 4RVHA 1QYXA 2Y0EA 4UUPA 3V1YA 1ARZA 5L45A 1BGVA 2NVUA 3S55A 3WIEA 1PSDA 1SCUA 3NV9A 5C7IO 1ZIDA 1R16A 4IJWA 2Z1NA 5CG2A 2OZPA 1P45A 1GUFA 2O50A 4OYRA 4NBWA 5TRTA 3V2UA 4IZHA 3BTSA 1A5ZA 2Q22A 1KETA 3I6IA 2HDHA 2H63A 4PVDA 2DUWA 2B5VA 4KTVE 4RPKA 4CM4B 3D4OA 3PGXA 1CWUA 5J9GA 3UHAA 1NFFA 3TRIA 4I9NA 2O48X 3I83A 3KYDB 3DO5A 3UVEA 3G79A 4MP3A 4YAJA 1OBFO 2JFHA 3VH3A 3X2FA 2B83A 4CV3A 2JAPA 4FFNA 1BSVA 3ZU2A 1RYDA 3ETDA 2Y1FA 2HK9A 5GY7A 1MV8A 2W2LA 2W90A 2OL4A 4J9UE 3HDYA 5L4SA 5BNTA 5TT0A 4Y6RA 3E03A 3Q3CA 2VRBA 3K5PA 4NH4A 5G0WA 4CLDA 2PKQP 3GQVA 5T64A 3QP9A 2OFPA 1ZZEA 4IIVA 4KQWA 3F1LA 7ADHA 4BNIA 5J23A 3CSDA 3B1FA 1O89A 4XQGA 5JDIA 1WPQA 1K6XA 1I33A 4XB1A 1P74A 4NFSA 2EKQA 4IMRA 4RVFA 2PNFA 1E1MA 2PZLA 3ZWYA 1T1RA 2B4RO 2HK7A 1H9BA 4YAGA 3PIIA 1ISFA 4OL9A 1HETA 1YE3A 2RHCA 4J0FA 3PWKA 4NMHA 3PQFA 3RROA 4K26A 5IDXA 2FMUA 1FMCA 1W6UA 2ZYDA 2D5AA 3RIHA 3X2EA 1YBMA 3KSUA 2AEFA 4DIBA 2EKPA 2VOJA 2ZYAA 1X15A 3ZNPA 3MEQA 2O2SA 1TB4A 1ENYA 1PGNA 1WP4A 4M1QA 4ND2A 5LCXA 1NPTO 1LRKA 1M75A 2EGGA 4BMVA 1UP4A 1PIWA 3AM5A 2DM6A 1I2CA 2PTGA 2PZJA 3AJRA 2QRLA 1E6UA 3OIFA 4HNGA 4UEJA 4BNMA 1NVGA 1Y5MA 1ZK1A 4FFRA 4RLSA 4XYGA 1I24A 3KBOA 3PHLA 4I9UA 2HU2A 3VVCA 1A27A 1SBYA 2DBZA 1YH3A 4AVYA 3VPSA 1W8DA 4DGSA 4BGEA 2FR0A 3ITDA 2ZJ1A 2FZEA 4F6CA 1WVGA 3DHNA 1PR3A 3OEWA 4CM1A 4IDBA 4D43A 4FR5A 1VL0A 5JLAA 1GUZA 1V9LA 7MDHA 2CVOA 3AFMA 3AU9A 1UJMA 5COAA 5DP2A 1NQTA 3ZW9A 1A4IA 1DC5A 2WEKA 3AW9A 5L40A 4RQUA 1XG5A 2DBRA 1DIRA 1V6AA 1GZ6A 1KEUA 3PEFA 2NU6A 3GDGA 4PLVA 1B26A 4Y8VA 3WXBA 1V35A 3GVCA 2C59A 4I5GA 1HLDA 3Q11A 1ZK3A 2O3TA 3QVTA 3SLKA 2WE8A 1YONA 4CM4A 1ZMTA 2WYUA 3CXRA 4IY1A 5BSEA 3LSYA 3OIGA 1I10A 3O38A 4HX5A 1PJ3A 3JQFA 2H5LA 4BV8A 3KYDA 1AHHA 4UEOA 4Z3KA 1HKUA 2J3KA 4GKBA 1H94A 5EQDA 5KVVA 4R1SA 4OIMA 3KSZO 4TRMA 3DOOA 1VC2A 4RZIA 4Z3DA 4GH5A 4IDGA 5B4VA 3ONDA 4YT4A 4E5YA 3WLFA 3LF2A 4C4OA 2ZB3A 4EGFA 2J3IA 1XKQA 3DL2A 4CQLB 4E2WA 4EITA 3EYWA 3EVTA 3Q6IA 1NAHA 4PVCA 4HFRA 4FPXA 4YACA 1BG6A 4Y67A 1D8AA 4PZEA 2QG4A 1E5LA 1PQUA 3OH8A 1BXKA 2NADA 1GD1O 1Y9EA 1CQIA 1HE5A 1BXGA 5AXAA 1HYHA 1WLYA 3SC4A 1HDOA 4ZHSA 2IODA 2JFFA 3TFQA 3PP8A 3LC2O 1U9JA 3V8BA 3GG9A 4QX6A 5CEEA 2YDYA 4FC7A 3P2YA 2FR1A 3JD4A 3ITKA 1K3TA 5JS6A 2J5KA 4B3JA 4AJOA 4BNXA 1JU9A 4A7PA 1PJLA 3HFSA 4OXYA 3CKYA 1H6BA 1LSOA 2Y0DA 4D7AA 2AQHA 5L7YA 2ZQZA 4R4JA 3I9OA 4RVGA 3BXXA 5CPBA 1ADBA 2C7GA 1I3KA 1LSJA 1U3UA 1HDZA 3TZHA 2IYOA 1YQDA 1UP7A 1XQ1A 1FF9A 4NBVA 4L9RA 2AW5A 1WXDA 3JYOA 4E2XA 5DNAA 5JCJD 4MKZA 4RPJA 4N5NA 4MIOA 3RFVA 2Q45A 5JO0A 3CTMA 4FQ8A 2CF5A 3UGKA 4YQZA 2PH5A 3Q2IA 2AQIA 3ZDFA 1HWYA 4O63O 3WGGA 3JYLA 1A7KA 3BYZA 1IHYA 4QO8A 2X23A 1XGKA 2ZK7A 4RGBA 5IXSA 1IPFA 2X22A 4PRLA 3UH1A 4K1LA 3I23A 2CVQA 5GMOA 1R15A 1WAMA 4YJGA 4RO0A 4R1TA 4CUZA 1UP6A 2BH9A 1MFPA 2ZKLA 1EDOA 4QSMA 4TRRA 4WLUA 5I9MA 3ZWCA 1PX0A 4HADA 3ANNA 3GZNA 4GGOA 2O3QA 2YQ5A 4KWIA 3VZSA 3RWBA 3MJSA 3M2PA 1PJCA 1UR5A 2X0IA 4BGVA 3D64A 4EJ6A 2B5WA 1EK6A 3GDOA 1Z75A 4PFJA 3GVHA 2Q3EA 4KDFA 3BMOB 4YT8A 2NTJA 1I01A 3KYCB 5DULA 4CM7A 3JQGB 4B8ZA 5G2OA 4E4YA 1AUPA 1PJBA 5KVQA 2J5RA 4TRNA 5T8KC 2Z95A 1EFKA 4FN4A 3ZHXA 2Y1DA 5JNLA 4J91A 4CQLA 1PS9A 2Y05A 2R00C 3WIDA 2J3JA 3K73O 3C8MA 4IQ0A 4HXYA 4WLVA 3HSKA 4B7XA 3TN7A 2Y0CA 4Q39A 5A5EA 1R4NA 2ZB7A 4EYEA 4ND3A 2YUTA 4JQCA 2I67A 3HZZA 4HNHA 2W98A 4WK6A 3DZHA 1DJNA 5DCWA 1Z7BA 1NNUA 3ZWXA 3NJ8A 5G0VA 3H5RA 3AUUA 4ALJA 3S2EA 5JCJA 1JKFA 3BTVA 4E0BA 3U4DA 3H5NA 2TMDA 4EUEA 2OOSA 3F3SA 3ROKA 3WB9A 3RBVA 4ALNA 4XEHA 5ILOA 2HRBA 2P4QA 1JLLA 2PD4A 4IBOA 4XGIA 1S7CA 2ZYGA 3ZI0A 5KJFA 2VRCD 1GAEO 2I3AA 3WLEA 3S8MA 4TKMA 5EQFA 3F5QA 4BO6A 1QSGA 2DFVA 4DREA 1ZJYA 2BRUA 1PL7A 4JIGA 4ALKA 3RUIA 3P19A 3DZKA 3ZU4A 4Y98A 4A73A 1DHTA 4NZ9A 4BO8A 4WEOA 4WOJA 1KVTA 2P2SA 1E1LA 3CMCO 5A04A 1HT0A 3QWBA 4II3A 1R6DA 1EZ4A 2NQ8A 4LW8A 2X5KO 3AUTA 3UCFA 2PKQO 3H9QA 4J16A 5TT1A 3TQHA 4CLRB 3FNEA 3DAFA 3KYBA 4GBJA 4YCAA 1JWAB 1O0SA 2D8AA 4BO0A 1ONPA 3SJ7A 3V5NA 1PGOA 1BVUA 4ZU3A 2GZ1A 5JDCC 2DC1A 4BNGA 3EVNA 4F46A 3CINA 1J0XO 3DWFA 2PZKA 1YO6A 4II2A 4N18A 2V6MA 4UREA 5JC1A 1NBOA 2IXAA 2RH4A 3FWZA 3WICA 4NU6A 4CLOB 1ENOA 1DXYA 4NK5A 4OM8A 4P38A 3WMXA 2ZB8A 2GN8A 2WWRA 4UVIA 5KOIA 2HLPA 3OF2A 3K30A 3BMOA 1WDLA 4KP7A 4ALIA 2GUGA 4ZVVA 4OJNA 5A03A 3BHIA 3KB6A 5BNFA 1C1XB 1SOWA 1JVSA 3OSUA 4CM5A 3MTGA 3OM9A 3DHYA 1W73A 4B7UA 1Q2XA 3WOHA 2Y66A 4R3WA 2EIHA 1HDYA 1LDEA 3I4CA 4BKUA 1Y8RA 1YL7A 5KNLA 1E3WB 1GQYA 5KJ6A 1DBVO 3UUWA 3DTYA 5TX7A 1MUUA 2V7PA 2Y1CA 5JYDA 3FN4A 5KJ1A 1GQQA 2OO5A 4RZHA 5DP1A 4DL9A 4D0SA 1JA9A 3I9LA 5T5QA 4R51A 5I7SA 5JXWA 3H9EO 2X9NA 1RM0A 4H7PA 3IQDB 2VRCA 5EMHA 1LC0A 4Z0PA 3OJFA 4CMIB 1GDHA 3OA0A 2EERA 1U8FO 1TT7A 2O3RA 3GHHA 3WX0A 3ZU3A 1I36A 3LLSA 5A05A 5HS6A 4LSWA 4U8GA 4DBZA 4YPOA 1LTHR 4GLLA 1C0LA 2HCTA 2Z1MA 4XIYA 3JQDA 5T8KA 4XYBA 1P44A 3FWNA 2GR9A 4ZRMA 2CVZA 1X14A 3GRKA 4OXNA 3PK0A 4RJTA 2F1KA 3ZH2A 3RI3A 5A9SA 2WYVA 5A9TA 1LLUA 1B8PA 5KVSA 3ZW8A 3WGZA 2P9CA 2XF8A 1WW8A 1IULA 5DCYA 3PQDA 1SC6A 2R6JA 4HFMA 3E1KA 5MDHA 3CH6A 4CMEC 3W4JA 2G82A 1K0UA 3ONEA 1E6EA 1LC3A 3RFTA 2EGHA 3K8ZA 1GEEA 1F0YA 2P91A 1RM5A 2TMGA 4DLAA 5K6AC 3WGQA 1R4MB 2PGDA 4RPGA 3AFNA 3D0OA 1NQ5A 4WNCA 2WSBA 4MO2A 2X8LA 3M1AA 3WBBA 4PG7A 1R0LA 4OAQA 3ZNQA 1GTMA 5IZ4A 1CERA 3MJ4A 3PGJA 1PU2A 4X54A 4A0SA 5EN4A 3A1NA 3JV7A 4QFCA 4WGGA 2EV9A 3I52A 2V6BA 1BRMA 5DBGA 3K92A 3RUHA 4BNWA 2NQTA 1DPGA 2EHDA 4I08A 1GFSA 1V8BA 4YBZA 1FK8A 3VPXA 1O95A 4BUCA 4FD3A 4G81A 4NJMA 4J2HA 5AYVA 3ENNA 2GN4A 4PCVA 1B8VA 1GL3A 1C1XA 2C5AA 5BQFA 3SVTA 3DR3A 1HL3A 2BFOA 1X1TA 1GQ2A 5I9NA 2UAGA 5EPOA 3AM4A 3O8QB 3INTA 1R37A 3GVIA 5BSGA 2DPGA 2FRDA 3PWZA 1E3WA 4XQCA 2AA3A 3A06A 2DLDA 2Q2QA 5JDCA 1PGQA 4S1VA 3KSDO 4CV0A 2JCVA 3A14A 3EZYA 5JAIA 2PY6A 3JQ9C 3NGXA 2VT2A 1YL6A 1T25A 3UCXA 4EDFA 2NVUB 1UZLA 2EP5A 1U8XX 1ZK4A 4UUMA 3STHA 5L7WA 4CM6A 4CMIA 4RVUA 3I3OA 3WQSB 1Q0QA 3RC1A 2DTEA 5EIOA 2VHWA 5JYEA 3RAJA 4YRDA 2AHRA 4Q3DA 4I5FA 5KKCA 4EI2A 3EHEA 3FNGA 3RU9A 5I7EA 3KTDA 5F1OA 5F21A 1GR0A 5F3RA 5JE8A 5T57A 4PLGA 3EC7A 3VVBA 2DFDA 2WD8A 4JP3A 2B37A 1PEDA 1ADGA 3QSGA 4IGEA 3F4BA 3O26A 2ZB4A 4WE3A 1PTJA 3ZNNA 1MC5A 4R1NA 4OMUA 1ZXBA 3WQQA 2C5EA 2F00A 3OQ6A 4J3FA 4TZTA 4WEQA 3U49A 3MCVA 3DEYX 3GGGA 4E5MA 4CM9D 1O94A 3EDMA 1TEHA 2I99A 4J1QA 3GAZA 4AL4A 1JKIA 4Z9FA 4YXFA 4BO7A 4CMCA 1OAAA 3CZRA 4JX8A 3H9JA 2XAAA 2FZWA 4ND4A 3UN1A 5IXYA 1XELA 5JMPA 1U4SA 1ENZA 3VZQA 4C7JA 4Q3CA 1PS0A 3UXYA 4JK3A 1DHRA 3ZWAA 1B14A 4IS2A 1R4MA 1HDXA 2DKNA 1C3VA 1NP3A 1Y8QA 1YXMA 1ISMA 3A4VA 2Q2WA 4XJSA 4BGIA 1X7GA 3UW3A 3TF5A 4BL5A 1P1KA 3BTOA 3ZWMA 1T2CA 1PJSA 2YW9A 3HDJA 3W6ZA 3D4PA 4GMFA 2GSDA 4IJVA 4BNUA 2WYWA 2ZQYA 1YDWA 3JQBC 1J5PA 2PD3A 4YWJA 2Q99A 4YT2A 5G4KB 5HWSA 1E7WA 5IJZA 4DPLA 4CM8A 5DZSA 3HB5X 4AJ1A 4YJFB 4CMEA 4BMNA 4EEZA 3B1JA 4WUVA 4I5DA 3O8QA 2IDZA 5KJCA 4DYDA 4FSHA 1P9LA 4OGWA 1U5AA 4HY3A 4JJFA 3MWDB 4E5NA 3GVPA 3LLVA 3LVFO 5K6AA 1Y1PA 5DBIA 3WSWA 1C1DA 4ZQEA 3EY4A 3ADOA 3RU7A 3ZWNA 5KIAA 1E3IA 4XGNA 3WGTA 2EXXA 2FPGA 2YV3A 2IEBA 1UDAA 3HUDA 2J5QA 3VHRA 1EDZA 2Y1GA 2NV6A 3NT2A 1EUCA 4E2YA 3KUXA 1H6CA 4OQYA 4KUHA 3BMNB 3S2FA 3IL2A 5AQ1A 4I8XA 5B4TA 1CEQA 2RH8A 2NSDA 1NAIA 1NHGA 3TL2A 4AJ4A 4CMJA 1MB4A 4GL4A 3GY0A 5T6BA 2O3SA 4CM9A 3P5SA 4WOKA 3WR5A 2VYND 3ZZNA 4RORA 1LRLA 4RQTA 4AJIA 4DRYA 5IFLA 3ONFA 3FR7A 2XOXA 1LLDA 3DZJA 3VTZA 1ZSVA 2JFGA 3EZLA 3GFBA 3V2GA 2BKAA 2O3JA 3TDKA 2Q50A 2UUOA 3PDJA 3FF4A 4DTIA 1W0CA 4WJZA 4OXKA 2RCYA 4MVJD 1U3TA 4JBIA 2BELA 1Q7CA 5CDYA 3LQFA 1X0VA 4K6FA 1J6UA 1LDBA 1KVQA 1MLDA 1BXGB 2POQX 2Q2VA 2YY7A 1YQXA 3NX4A 4YQYA 3E82A 4PZDA 2B69A 4GAEA 2CMDA 2PA3A 4RLHA 4E12A 2A94A 3Q0EA 4EBFA 4D3SA 1B16A 1DC6A 3B1KA 3DOCA 4NIMA 4YAIA 3OECA 1UAYA 3Q9UA 3NTOA 3HG7A 1GZ4A 1LSUA 4IPTA 4J7UA 4OOFA 5JBIA 4XR4A 2P68A 2DTXA 4KWHA 1J4AA 4W9NC 3UAGA 4CMBA 4PLYA 1V0JA 5F1PA 3VH4A 5A9RA 1E7YA 3DTTA 3O03A 5G4KA 4BHTA 5A4DA 1FDUA 3AOGA 4YJHA 5CFZA 2D2IA 5F1KA 4HUJA 4XWYA 3ZWWA 2X0RA 4WLEA 3LC7O 1Y9AA 4GKVA 4YJFA 3VZRA 4Z6KA 2Z5LA 1LJ8A 4IM7A 4PLWA 3TWOA 5F5NA 1LBEA 2J6IA 3DXFA 3GMSA 4TVOA 3OJ0A 2C82A 4Y9DA 3WNQA 1ZXLA 4RDIA 2NNLD 2OORA 2SCUA 4ITUA 4QO7A 1ZCJA 4Q3NA 1R0SA 2NTNA 1ZUD1 3KZVA 5EJ2A 1V3UA 2OP0A 1XHLA 4PG8A 2JHFA 3UICA 4CODB 1PZFA 3L9WA 4J1NA 5DT9A 5GZ3A 1SNYA 2VYNA 4AJ2A 5JAQA 5ICSA 4FFLA 1KVRA 4BO2A 3JD3A 2RIRA 3BMNA 3TZ6A 4YJGB 3PFWO 3IKTA 4F3YA 1NTOA 5B37A 4AJJA 3JQBA 4IIUA 4Q3EA 2V6GA 2VHZA 2W8ZA 4GSKA 4GX5A 2EJWA 5B4UA 3QVXA 4A10A 3GZNB 3R0IA 4GLOA 1HZJA 1BW9A 3PZRA 1LEHA 4QXMA 4MVJA 5DDIP 5LC1A 5AXDA 1P33A 1M6HA 4UUOA 3IS3A 1BTOA 2X5OA 1MA0A 2O7SA 4LK3A 3M2TA 1HE2A 3QWIA 4AJHA 3UOGA 3M1LA 1HXHA 2HJRA 3OP4A 4HFNA 5ILGA 3RD5A 1GYPA 3VPGA 3JQ6A 3W6UA 3KXDA 1YWGO 1KS9A 2WJPA 1O6ZA 2IXBA 1E0DA 3IP1A 4Y6PA 3D3WB 1F14A 4BMSA 5ITVA 4JROA 3ZV4A 1PZGA 2FR8A 4L74A 4J6FA 4ZD6A 1ZNQO 2AG8A 2FHSA 3DAGA 2HAEA 2NWQA 5BNIA 1R4NB 2QRKA 4QQRA 3DBLB 5KCZA 3ZV6A 1QYCA 3TOZA 1T4DA 2PD6A 4CR6A 4RF2A 1MGOA 2B36A 1J49A 3PVZA 2IE0A 4CMKA 1P31A 3CMMA 3GDFA 4FFOA 2PGJA 4F6LA 1FDVA 1LDMA 1E7MA 2DAPA 2DQ4A 3ANMA 2OBYA 3K31A 5CAEA 1H5QA 1UH5A 2BMAA 3G3EA 1ISHA 4U5QA 4PZCA 3IJPA 5BT9A 5HTOA 4L4XA 3QHAA 4LSMA 4R16A 3T7EA 1H9AA 4D3FA 4WPGA 4MVJM 4JGBA 1CDOA 2EJVA 4Z0HO 1KERA 4MKRA 4XJTA 3HN7A 3PIDA 4BB6A 2O3UA 3ZCXA 1F12A 4BQPA 3SXPA 1NQAO 3AI3A 4RV9A 4FGSA 4PLFA 1Q7BA 2BHLA 3MJCA 2PKRA 4EW6A 3F4LA 3F6YA 2VNAA 1B8UA 2PWZA 2WD7A 1E3LA 3E48A 5L53A 1P77A 1D7OA 3TZCA 4W9NA 3LC1O 4E6PA 2BLLA 1JAYA 1EBUA 4Q3AA 4CLHA 4I5EA 4ESOA 1ADFA 1VJ0A 1DSSG 2UV8A 1LQUA 4CV1A 1DIHA 3VH1A 4W7IA 4KQXA 2AMFA 2GO1A 3NGLA 2I76A 3NEPX 1SMKA 3RUDA 3WSVA 1E7QA 5I7FA 3C7AA 4YEDA 4E32A 3TFOA 4CR8A 2VHXA 4P8RA 3FI9A 1YQGA 2C7VA 1Y6JA 2QZ9A 2FOIA 1ISIA 1P0FA 1HRDA 3WJAA 4RPLA 3F46A 4D79A 3INRA 3I5MA 2I65A 2ZJ0A 2NVWA 4UEKA 1R66A 2JL1A 1WWKA 4DC0A 5JY6A 1RJWA 4AJLA 1Y8RB 5JO9A 4BS9A 2BF7A 3D3WA 1HZZA 4OQZA 4XYEA 5L4NA 1PR9A 2H9IA 1TLTA 2A92A 2YQ4A 4ZQHA 3C7DB 1WZEA 3RJ5A 3DBLA 1C0KA 1D4FA 1K6IA 1B0AA 1Z6ZA 2D4AA 2R2GA 4J90A 1K89A 1LNQA 4K6CA 3QW2A 4OH1A 2DU8A 3NDIA 5HBRA 4BKRA 5DOZA 1ZBQA 3I4FA 4W7HA 4YB8A 9LDBA 2YHIA 1EVZA 4E5PA 5C7LO 3ORFA 1Q7GA 4RPHA 2EF1A 4XRGA 1JWBB 3L0DA 1XLTA 3RCBA 3VKUA 4YJDA 4Y6SA 3EMKA 1IZ0A 3GUCA 1HE4A 5CDSA 1Y7TA 1DO8A 4DVJA 4A2CA 2CUKA 5A5FA 1ZK0A 3NAQA 1VRWA 3QE3A 4TQGA 2AXQA 4GI2A 2Q49A 1XR3A 2QQ5A 3RVDA 4OSOA 5KKAA 3RC9A 5A9SB 1NYTA 3H9GA 2C2XA 4N5MA 4IDEA 2VT3A 3DFZA 3KLMX 3PI7A 5FI5A 3WWYA 1KEPA 3H3JA 4O1MA 4NBUA 5T67A 1UXJA 3DBRB 1Y81A 3U62A 4R9RA 4XZ3A 3CIFA 1F06A 3VPFA 2Q4BA 3N58A 4AFNA 3G0OA 3D1LA 4PLTA 3BZUA 4FC6A 1VKOA 2BD0A 4UAGA 4PLCA 3K6JA 2XXJA 1FDWA 5HA5A 1N92A 3GEMA 3ABIA 4U6QA 3ANLA 4HBGA 4PG4A 4RCVA 2E6UX 2V6FA 4OO3A 3OJLA 5CG1A 3ETEA 4FB5A 3MOIA 2CZCA 2WDZA 3KETA 2GLXA 1HDRA 5TGDA 1LSSA 3KOUA 1NFRA 1M6WA 4I1IA 4RVDA 1ZK2A 3G49A 1LX6A 4Z0TA 1SAYA 4AJNA 4E5KA 5JFOA 5JY1A 1U2GA 4IQGA 1MC4A 3E18A 1ID1A 2O2YA 4NJMB 8LDHA 3RC2A 5L4LA 1KVUA 1PL6A 3HN2A 4L4SA 3FD8A 4MDHA 3JQAB 4XRRA 3RJ9A 4LISA 1F8FA 1CF2O 1XU9A 2JJYA 3D3EA 4XD2A 3AUAA 4TWRA 1P1JA 2GNAA 4JLWA 1P1IA 5IDWA 4EJ0A 1LUAA 4BKQA 1FXSA 3GN1A 3P2OA 3L9XA 5L51A 2FSSA 3PJFA 4J2OA 4OKNA 3R6DA 1SPXA 2UUPA 4JCOA 3JD0A 1UXHA 1X7DA 5CDUA 1BWSA 5FEUA 3BHMA 2VWPA 1NXQA 3JQAD 1UUFA 4FOSA 2X4GA 5EINA 1AXGA 4IQ8A 4GSLA 3TPCA 1QXSA 1U4OA 1HLPA 3IUPA 3N74A 4KZPA 4HKTA 2A9FA 3SJUA 2NM0A 2P9EA 2EW2A 2RBEA 3HHPA 4Q3BA 5A3VA 4WASA 1K5HA 4XKJA 1HSZA 8ADHA 1IE3A 3OEYA 1A72A 4DC1A 2Y93A 4RL6A 1F8GA 1N7HA 5FFFA 5ER9A 3ZNOA 3H4VA 3C24A 1CYDA 1DIBA 3QLJA 3VH2A 2R00A 5C7OO 1OFGA 5H82A 1XA0A 1EEHA 3QRWA 1T24A 3RKUA 2AE1A 4JJGA 4NU5A 4IDCA 3W8DA 4BVAA 2HQ1A 1U28A 1DFGA 1Q0HA 4LRSB 1XEAA 4EJMA 2X7HA 3GF4A 4W82A 2BFAA 2C54A 3MOGA 2HKIA 3DBRA 2NTVA 3H65A 1DJQA 4W4TA 4B4OA 1T2DA 1OC2A 2E4AA 3D4NA 3I9JA 2PH3A 1TT5A 3GNQA 3WS7A 2Y1OA 4MIYA 3WYEA 4YDRA 3DZIA 1X1EA 1NHWA 4IINA 1GZ3A 3WQRA 3WGIA 2Q1UA 3RUEA 3OICA 1NX6A 3KM0A 3NUGA 4U0JA 4MOWA 4ONEA 4FFPA 2JD0A 1Y8QB 1BXZA 1MP0A 1QMGA 2I9PA 1I32A 2HMVA 2V65A 4EUHA 2XPCA 4UVHA 4LRTB 1JW9B 2VUUA 3W1VA 2QZZA 2JCXA 3I1JA 4ALLA 4R41A 2AE2A 1ZEMA 4G65A 4GX0A 2BFPA 3K2BA 4WCFC 4WLOA 2G17A 4YRAA 5CEFA 4MVJF 4MIEA 3NT5A 3HDQA 4B8WA 1SO8A 3GNSA 4DQVA 2IZZA 5JW6A 3WFIA 2H6EA 4CLEA 5K0ZA 4K28A 4GWGA 3JQAA 4CM8B 2C07A 1PL8A 2XXBA 3ICPA 1I3NA 3PYLA 1I0ZA 1SEPA 2CY0A 1D3AA 1Z82A 1KC1A 1QORA 4BQRA 3AK4A 2LDBA 3KEQA 3DMYA 1Z74A 1V3TA 3FRJA 1ZVMA 2P4HX 3ZWVA 1KEVA 1C1DB 1M67A 1QYWA 1G0NA 3TL3A 6ADHA 2HO5A 1ZJZA 5B12A 2VWGA 4BNHA 4YRBA 1P3DA 4O5OA 2JKVA 5JSFA 1N8KA 4NBTA 1E1NA 3AWDA 1RKXA 5GZ1A 1EE2A 2A35A 4NI5A 4YAKA 3I9KA 3WGOA 1CQJA 4J0EA 2H1SA 2P9GA 3LZ6A 4N54A 3C85A 4IDAA 3ZGYA 4B3HA 1PJ4A 1B15A 5IDYA 3RUAA 3VKVA 1MG5A 3NTRA 2FP4A 1T4BA 3EK2A 5A3JA 3FNHA 3V1TC 3OETA 2BGLA 3IMFA 3OMLA 3H7AA 4YVFA 3AOEC 1VJ1A 3KRTA 1NQOA 4TROA 4NBRA 2VUTA 1YJ8A 1HSOA 3PHGA 4E2ZA 2WE7A 3WG9A 3JQ8A 4IDFA 3DC2A 4FJ0A 2VNSA 4FOOA 3NT4A 1GV0A 1QLJA 5COBA 2OXIA 3PJDA 1IZ9A 4AJPA 4GMGA 5JPIA 2GERA 3FPLA 3LK7A 3AY6A 1VL8A 1OC4A 1YGYA 4LCEA 2NU7A 5FI3A 2FN7A 1I3MA 2IRWA 3SC6A 4NFHA 5DOVA 4TMFA 1YB1A 2UYYA 4M49A 4YR9A 4FW8A 1WDKA 3B20A 3QVWA 1RYEA 3JQEA 2VHVA 2A4KA 1Z73A 4QUKA 4J9VA 4OHUA 1FJHA 1DAPA 3MJEA 3OFSA 2YDXA 1Z7EA 3F1KA 3INGA 1WNTA 4A03A 3JD1A 1U1IA 1LDGA 2C29D 2I6TA 1VI2A 4WLNA 1A4UA 1OI7A 1EE9A 2QW8A 3RBZA 1QP8A 4P4GA 3ZWPA 4D3DA 3U3XA 4CL8A 1YBVA 2Q1WA 1CJCA 4XYLA 4DLBA 1IYZA 3GN2A 1N9GA 4BNTA 3T4EA 4YJHB 1U3VA 3U5TA 3LT4A 2Q4EA 3HQ4O 4L73A 3RFXA 2I3GA 1VPDA 3HDHA 1QLHA 1CETA 4L76A 5ITWA 3FTNA 3GT0A 1I8TA 1B7GO 3LYLA 5AXBA 2IYPA 1IOLA 1ORRA 2VYVD 5TC4A 3DBVO 4Z9XA 4KUGA 2VTDA 5CEJA 1HDGO 1M2WA 1PJQA 3DZBA 3GG2A 5A02A 3GK3A 1QRRA 3HFGA 4GWKA 3OIDA 4J43A 4DQXA 1V3VA 3DAPA 4PLHA 3IC5A 3PWSA 5JAMA 1G0OA 4BKPA 4DPKA 3KO8A 2E48A 3ADPA 4CLXA 2HJSA 5I9LA 4WNIA 1IY8A 3JQ7B 4FFMA 4R1UA 5JAZA 4WCFA 5CDGA 4HV4A 4FIZA 4J4TA 5JCXA 4B4WA 1ULSA 2VTEA 4J1TA 5C37A 2X0JA 1NM5A 3AU8A 2LDXA 1BW9B
chains in the Genus database with same CATH superfamily
3ZWOA 1QIDA 3IJRA 4JJIA 1N6LA 3V9AA 3F8TA 4Z4CA 4DMUB 4D6XA 4AXBA 1T1GA 2G5CA 2PR2A 1YZNA 2R6DA 3Q7QA 3DAYA 4AF7A 5K3BA 1T2EA 2B61A 4P9NA 5ENVA 1PEKE 5CITA 2F3RA 4YV7A 2QBYB 3U39A 3GRFA 5GVRA 1WO8A 3UGTA 4ISBA 3UHJA 1PYOA 4BLSA 4CMGA 1T10A 1WOMA 2AG6A 2QUZA 4ZMBA 1Z7GA 3IQXA 5KTRA 2BFFB 1OZFA 4KPYA 4EB0A 4LE0A 2KMLA 1Z28A 2WMDA 4IO1A 1OZ0A 3E0XA 3B38A 4L8VA 2RAVA 5JWOA 4RHUA 5DLPA 2QK4A 3NBQA 1JG1A 3ESZA 4TM8A 2HIAA 3O7WA 4NG4A 2ZJAA 3PHIA 2QJOA 3ZK9A 4ND5A 3U4CA 1N2HA 2GCIA 2I4TA 3EIEA 2X5JO 4XR9A 3UK2A 1H3FA 2BDTA 1Y5RA 4L0QA 4M8IA 1HLFA 5U9CA 1SK8A 2R7MA 3HO6A 5EZSA 5CLIA 1A9ZA 3ZBTA 4CR7A 5M34A 2HSZA 4BVGA 4HYYA 3BGDA 3DKKA 3HVIA 5IJ9A 2GHTA 3EMDA 4OXXA 5ALTA 1CBUA 1GV1A 3COWA 3DDSA 3IB6A 5F2OA 1RWBA 3UM9A 3WKAA 3WRXA 5C35A 5JSZB 4N0DA 4WCVA 2ZCJA 3VKHA 2R8BA 3T7KA 2WP8J 5I7AA 2PS0A 4BECA 1BU5A 3KDSE 4M86A 1E61A 3J81A 3ZV5A 3ZWBA 4PFSA 4TM7A 1KE2A 3PUXA 4J07A 1W0JD 4BFZA 4DR5B 1ECGA 3LXRA 4Q4JA 1KIFA 2ETXA 5AVSA 5HZMA 1RCTE 4RJKA 1MAHA 4ZEXA 1JG4A 2ZUTA 1A71A 3HACA 3CEAA 2PGNA 2XUJA 1L4KA 1KY2A 3FSRA 1Z6TA 1IY9A 3OTIA 4HQKA 4XX0A 1W30A 3WP1B 3EPKA 3STVA 2WU4A 3K9FC 2L69A 4QOJA 1C4KA 4FDUA 1AN9A 3U5ZB 1PSZA 1W1IA 1VLVA 2WM3A 3L77A 4IUCS 3RW9A 2GX6A 3DBHA 3DZFA 4UQLA 1YOVA 3OMXA 4X3PA 4PAQA 5A7FA 1KMIY 3E23A 3ESCA 5ELMA 3GLQA 1PRYA 1PVVA 2J87A 3WFJA 3ADCA 1FYXA 2BMEA 2C0CA 3GGOA 3D7RA 2YV2A 1AXEA 1N2ZA 1YQTA 4BP3A 3LLMA 2C58A 2EFDB 5BRAA 4CGYA 4DCGA 1T1SA 1K97A 2NUBA 3LBFA 3T4XA 3L8CA 2HGSA 3GJRA 4EG3A 5L95A 1GSAA 1T8YA 3E5MA 2WAOA 2WP0A 3MWEB 4JOBA 4OEHA 3R7FA 3ZZMA 3PTAA 4LHSA 2HLHA 3ROPA 2VA9A 4D4IA 5CB4A 3PUJA 1NMXA 2FFBA 4DBVO 3OKCA 3MJRA 5IS2A 3QV2A 2J59A 3JQ7A 3PEWA 3IQIX 5GP1A 1MX3A 1ONOA 3C4VA 1H2HA 3FPCA 4NMWA 3SBOA 3UC9A 4P5DA 4AP9A 4BC0A 1Z0KA 4BQIA 3QWHA 5BR7A 3HS3A 1P7PA 2IT1A 1CUAA 1NUHA 1UFOA 2FX3A 3A6JA 1XO1A 3CLVA 4IGKA 2ZUFA 2WWWA 3W1EA 3LRXA 1PZEA 2IDJA 2R85A 3W9YA 1RNLA 4WL0A 3L6RA 3QXGA 5SZIA 3UTCA 4EPTA 3V46A 4C0WA 1B3BA 2C04A 2BGMA 1FP7A 2J0UA 2RGNC 1G6Q1 4PLZA 2G1UA 2HRCA 2QKYA 1VHJA 5B6JA 3U44B 1SUAA 2JFZA 4UCFA 2GYWA 5DXJA 2GTIA 1ACLA 4EA8A 1IY2A 1IIBA 1T2AA 3N05A 4DDHA 1CZHA 5TQVA 3FOEC 3VKWA 4E1VA 3F7MA 2VG8A 2H4HA 3H1TA 2GBLC 1EBBA 2VF8A 1N8TA 4WCDA 3LKDA 4GE3A 2IHNA 1YTLA 1G17A 2UUBB 1Y6ZA 2R97A 3ZJTA 3UJDA 1D1TA 4CF3A 4CV2A 1BXRA 1BEUB 1EXNA 1LQTA 1UBFA 4HR7A 4K6KA 4I3HA 3TD9A 2PBLA 1RI5A 4PC2A 3R3JA 1KKUA 3B5JA 4ZAZA 2O8FA 3H84A 4U0KA 1W0JA 3MRSA 4UHEA 3QE2A 3OWHA 3IMKA 4OD0A 4LXTA 2D6FA 3PZBA 4EKYA 2H31A 1CRPA 4AIIA 2AUTA 3FNIA 4M9CA 4RGVA 4WWHA 5TQ0B 3F90A 2RGCA 2HPVA 1T9GS 3AIMA 4JEHA 1CY6A 4L8FA 1B73A 3EGWA 5EWMA 3RYHB 4YA6A 2PCJA 3E9ZA 1XMPA 2QX7A 2GQ0A 1VL6A 1GTJ1 1JDTA 2AK3A 3W5CA 1RRVA 3BDVA 3FROA 3X1MA 1T3HA 3ZEAA 3THXA 4EGCB 1N5IA 2XW6A 2B5OA 2ZYIA 5FOXA 3NAZA 3TLCA 3LT1A 4HQNA 3VX4A 4A27A 3HJAA 4EJSB 2RGUA 4KLAA 4XPIA 4BO1A 1RU3A 3OQBA 1U8EA 2XX3A 5TIIA 5E7QA 4UM9D 3T6KA 1YZKA 4WDRA 3WV5A 3IRVA 2J3MA 1I2DA 3PYMA 1M6EX 4UAJA 1QGED 3NOQA 3S27A 4E4RA 1NASA 5IWAB 3RVOA 4C7OB 3EEFA 1JPUA 4OHPA 3M4JA 4JOSA 5CPFA 3L7YA 3ZTTA 4GW3A 3AQIA 3MHPA 2OQRA 1T8SA 3K2EA 3NRCA 2ZULA 4I4NA 4RF3A 4Q4HB 1PFKA 1RKQA 1FRNA 2ECPA 1HUQA 4WNAB 3VSCA 1N0WA 2GFHA 2Y77A 1EI9A 2ZSUA 5HM6A 2PXHA 3KVNA 4PC7A 1BDBA 4R68A 4DDUA 3AF1A 3KB2A 1R6XA 2WK1A 5CVEA 3O2QB 3U4IA 7ABPA 1JQKA 1NLYA 4KVZA 4PO3X 2CXQA 5CDFA 3JCZA 3AJDA 3LZCA 3M3HA 4ROTA 3H2BA 3EP5B 4YAEA 4BNLA 4DLNA 1XMVA 4G36A 1MB3A 1UXGA 2X58A 3BA6A 3FYTA 5EMJA 2ZXEA 1YGPA 2OZLA 5LZ7A 3R5XA 4J8PA 1NL3A 1KSGA 4QT0A 3I6QA 5DN9A 1ZPDA 3S28A 5FL3A 2XOKD 4BAGA 2QY6A 3TB6A 2OG2A 3D1VA 3K9QO 1E6WA 1XRMA 1O9BA 2Q3JA 2G1PA 3T7AA 1E3EA 1TO1E 1OHHD 3PUIA 4PSUA 4UNIA 3X1XA 5M5BA 3P9YA 1VIAA 1QIHA 2VAPA 1K75A 1MJGM 1XTPA 5LP1A 2JBAB 3R3SA 4CWAA 1YZHA 1WXGA 3BWEA 2A86A 2OBXA 1LDYA 3B1XA 1V41E 3CT4A 4HP8A 3SIXA 2QX6A 1KMQA 1KZ7B 1UBMS 2X19A 1L5NA 3K4QA 2J45A 2J9XB 1SEVA 3SHQA 1VPEA 2GWRA 4PZAA 3R7NA 3JARA 3AEUB 3Q7EA 1GWNA 2ZREA 4WRRA 1OOEA 1SOUA 2DJIA 4G41A 4DMGA 2GPYA 3E9NA 2OXCA 5GONB 4C4AA 1YULA 4M9SA 2CZQA 3L04A 1IZYA 1OWMA 2JIRA 2LGJA 2JGDA 3PRJA 3JYPA 2ZP1A 1WSBA 4TS1A 3TZLA 1N2BA 4RJIA 1NYLA 1EVQA 1OH6A 3KJHA 4HI0E 1RQNA 3DVAA 4O2RA 4KWEA 3SD7A 1XAGA 4BNFA 2HJ9A 2LZ0A 4QDJA 1P5FA 2GBIA 3PFBA 4HWGA 3ZU5A 2IYTA 2X6QA 2XWSA 4KPUA 5IM4A 1Y1KE 9LDTA 3WTBA 4GHWA 5HW0A 2ONKA 3TSOA 1SA0B 3EQ8A 2PQ6A 4XQ0A 4M0FA 1YIDA 4POOA 1BH6A 1EZ1A 3HEMA 3LX6A 4R8RA 3WGLA 4CU2A 1BHSA 2HSGA 3KZNA 4JP1A 3JQCA 4CUJA 2RGNA 1CY2A 3G2LA 2D5CA 4EZEA 1RI4A 2ZCUA 5TJ9A 3FR8A 2YINC 4JVSB 4GSYA 3ASUA 2L0XA 3VOBA 4MV7A 5LNK6 1DG1G 4IUYA 3PNLA 4O8CA 3UB4A 2V1XA 4CEIA 3PQ4A 1PGJA 3HRHA 3I9MA 4PICA 3C3XA 2PQ0A 3LXUX 4JJZA 1PR0A 4HRXA 2GBLA 3VYWA 2IZ0A 3TLZA 3VI3B 1THZA 4XLZA 3GLGB 1Y82A 2WTBA 3AEKA 1M2OA 3CX6A 1A88A 3D7MA 2YJ4A 3EXEA 3VR0A 1EVYA 1FUUA 1MQSA 1SKUA 5B36A 1S9HA 2GA8A 4HDRA 4LQ4A 1GPMA 3OOJA 4B79A 2XZTA 3PRYA 5AFSA 3EBOA 1U5CA 3U3ZA 2PGXA 1BD4A 1CJKC 3ILSA 1XZLA 5FV7A 2IYWA 1KI3A 2XOKA 1ODSA 3EF3A 4C08A 5EL0A 3NWBA 4ZO6A 3UJ3X 3K9GA 4G09A 4QPNA 2AOUA 3WWZA 4D0RA 4XQ9A 3H5OA 3A9WA 3EJWA 3JWPA 1OHHA 3MJVA 3L7CA 5DX0A 4DWVA 5CXSA 3UFXA 2WLSA 3HVKA 3H04A 2R6FA 2XTJA 4TLCA 1DFIA 2WJYA 2A1TS 1LY1A 4FOTA 3MYRA 4Z4IA 4C30A 3SQNA 3DM9B 4D44A 3K70B 2DERA 4ENRA 1C9NA 4X1YA 2HJWA 1QHGA 2JGIA 5A3QA 2H2GA 3PXXA 4KQHA 3UV3A 1WV1A 5ESDA 5HQJA 4OAPA 1EQ2A 2D5LA 1JBKA 3BFKA 2IPLA 1DUSA 2EBUA 4PRZA 4TKZA 4NV3A 1O95C 3GR6A 4UNPA 3W2TA 4F9TA 1I80A 4M88A 1V8PA 2CK3D 2Q1SA 4FJ1A 5B58C 3NV7A 1Y3IA 3QVVA 5ISMA 2WMNB 4D46A 3PJGA 3AF3A 5EJ9A 3AUXA 3TIGA 3ED5A 4IOKA 1XYGA 4MVCA 4B40A 5JAPA 3IALA 1MT3A 3D6MA 4CF7A 5JNUA 1C9EA 5FA6A 4CTKA 3O0DA 4BNZA 2GF2A 2F90A 3DZ5B 4PG6A 2PM8A 3T3MB 3R44A 4ZC8A 1XFAA 3QI2A 3TFQA 2AOTA 8GPBA 2WOOA 3KEMA 4K1XA 4FHEA 4HUTA 3EVFA 2GCOA 5K2OA 2QI9C 3DLBA 1TCUA 3BUSA 4A2QA 1X1BA 2I2XB 3AWIA 3QYFA 4PEVA 4HNVA 4Y9RA 4EG1A 3IA7A 1CDDA 3QVUA 4HQ0A 4ZOAA 3ES9A 1EK5A 2PKEA 4V0ME 4EF6A 1X7HA 1UWLA 1J20A 1CY4A 2QQGA 4GRAA 4MX8A 2QG6A 1WB9A 2VXBA 4TTSA 4CEHA 4OHVA 1GGJA 1DLIA 1P5JA 3GMDA 4AKSA 2V5AA 1E2IA 2B4KA 3QOWA 2FMFA 1MOSA 2CYBA 3VC1A 1KH1A 4CGZA 4X0EA 1LBHA 3IMGA 5E8JA 3JASB 5LA6B 1N1GA 4Z5XA 2OHOA 2QHXA 3KT0A 4MJ3A 5JI3E 2FWIA 3AMVA 3D6TB 1KQNA 3KYCA 4JLDA 1Z83A 5DYGA 5L3VA 1N9KA 5E2IA 2XQGA 3VXKA 4YRRA 4JBGA 4IJQA 3Q3JB 4YP7A 3F47A 3T1NA 4FYMA 1GT91 2ZTVA 2Y92A 1EKXA 5K0FA 4BLQA 3EPAB 4CT0A 4ZN6A 1T5DX 4KRGA 1MJNA 4Q4DA 4N8DA 4RHEA 3TAHA 1CQJB 4AURA 1U1GA 1IL0A 4S3MA 3L43A 4MDYA 5ADHA 5CIYA 3EVEA 3PCRB 2VJBA 3L82B 1B23P 5IRCD 4V1CB 1X7YA 2NVOA 4KJZA 1CTQA 5KNBH 1O95D 3PLRA 1JSXA 1SHJA 1ZIYA 1FW8A 3FPGA 4W63A 2YRWA 3WK9A 3OI7A 2O8CA 1FUEA 1QX3A 2AN9A 2OZVA 2E5WA 3S40A 1YQWA 4I1YA 4ZYYA 1TZBA 4NH0A 5G4LA 2G88A 1DU4A 1JU3A 3C5CA 3DD1A 4AWBA 3ZD8A 2I6FA 1QPGA 2GPNA 2UYOA 3IR6A 4PY2A 4EHAA 4IS3A 1F8YA 3DFUA 1E6LA 1HFWA 2ABWA 2DBQA 3RYTC 1LI5A 1QYVA 3RS3A 2CK3A 5FV4A 5IVHA 1AURA 4J0CA 4I4CA 1CVIA 1MC8A 2GMWA 5ITZA 3ZVKA 3IIIA 4ETNA 2O20A 1P91A 1MOQA 1TUEA 1QG6A 4PHHA 1JH8A 3VU0A 3VTFA 1H8HD 4HH4A 5H9VA 1OYVA 2O4CA 5C5IA 1AGRA 3MWGA 5CB4F 1L7BA 3UCEA 2ZRKA 4YT5A 2H5EA 4DLZA 2YFHA 1Q84A 3C3KA 1AZLA 4L75A 1P7ZA 2Q3FA 5HIKA 2QYTA 3BKWA 4NOKA 2QMZA 4PZYA 4W99A 1JSCA 3FSEA 1L5GB 4BVHA 3SY8A 1AJEA 4ZCMA 2PJZA 4MWSA 3C3EA 1PQWA 2F1OA 3W4IA 4LK2A 1P2SA 3USZA 5BPFA 2FHPA 5FFMA 2H29A 1KQPA 1SVSA 4ZHQB 3AI7A 1LA2A 4X64B 1DJMA 1A2OA 4G24A 1RM3A 1KFBB 2R1ZA 4PGAA 5C52B 2GPTA 3H5TA 4A5OA 1E7RA 3QX8A 5JYFA 2OEPA 4TKLA 2W8BB 1I4LD 3ETGA 2IU6A 4B48A 4BMPB 4H35A 1FMFA 3SR4A 2HSJA 3OZVA 1E59A 1YACA 1TFRA 1WA5A 4HZUA 1N0UA 1V39A 3RUFA 1A9TA 1UZMA 1XE3A 3FVTA 4O8JA 1YJCA 1XXLA 4P6VF 2ILTA 4YP1A 1GAJA 3LQQA 1DXOA 1S2IA 3QUSA 2Y2VA 3PFFA 4LOIA 4E1AA 2VQFB 1C0IA 1YOBA 2YOHA 1YBAA 1J2TA 1I2ZA 1KBZA 2P9HA 2WLTA 2YW2A 3B70A 3OZFA 3QKSA 3SQDA 5CB0A 5LZ2A 3S1SA 2X0EA 1QGOA 1JFVA 2BFDB 3C48A 2Q6KA 5IUNC 2WFZA 4HMQA 5C4IA 1DLJA 1JQBA 3EIXA 3R41A 4KW7A 2IDKA 2IY7A 4JOQA 4J0GA 4C29A 3DLAA 3K0CC 3TRDA 2JJMA 2QRMA 4AD8A 1V96A 4DXHA 3VR6D 4II7A 3KSMA 2YVLA 2VQ6A 3KU4A 3BRWA 4JL8A 3S2YA 1NGSA 4AMUA 1QE3A 4EX7A 1TZJA 4LS3A 2SBTA 4LBVA 3CONA 4GC9A 5IVPA 4NPHA 4KFUA 1Y6FA 3O4IA 4D0LB 1OGJA 2INGX 2QRHA 2HYDA 3I39X 1GG2A 1OXUA 1ZWKA 2EBWA 4NCKA 3EC1A 5IN4A 4MVJE 1G5FA 1QO9A 5IKPA 1NN0A 4D42A 1EAYA 4ZRNA 3KVOA 2BEVA 4FE3A 3WNZA 3Q9NA 1LNZA 1YB4A 3VR5D 3EVGA 4YMUA 1IPEA 4MVWA 4RXMA 4ZVMA 2HI0A 2QMYA 5CTJA 4L4ZA 1TQDA 4R1LA 4TUYB 4JI7B 4G8JA 4JB0A 4H4DA 2IOFK 2ISCA 3BIFA 5DT2A 3TW8B 1H8HA 2X8AA 2RHLA 1BYUA 3STXA 4HWPA 3C7CB 5JSYA 4L5YA 4Q1CA 4MTCA 4TZKA 1Y4AE 4HBZA 1T26A 4HEHA 4YMSA 2REOA 5CRIA 3X2SA 1ORIA 3BEOA 4BB5A 5JDIC 3QKWA 3DMPA 1U0TA 1WCIB 4IG4A 1P2DA 2HF9A 1TKRA 4QAJA 4JEUA 4MP6A 5EJ8A 4ZT3A 1AQUA 5AW2A 5BMOA 4EEKA 3FZQA 1ZN9A 5KNDH 3CUYA 2WJIA 1A5BB 4MS1A 3GLFB 1NW7A 4IJ5A 3LE8A 2B9VA 3QYPA 3PC3A 3S0JA 5BNWA 3ORYA 1G3QA 3QVLA 1XAIA 1X1QA 1R0ZA 4REOA 4E13A 2FZKA 5EXPA 2I1VB 3KL2A 2ZRBA 1VKNA 2CDCA 4C78A 3LPMA 3IT0A 4QZVA 4B5KA 3AL3A 3CUKA 3QFRA 2NU9B 3WKEA 1DDOA 2WVAA 5C0OE 3H2SA 3MVEA 1P1HA 1UK8A 5DF1A 2AKYA 3G23A 4YX9A 2C57A 3P4UA 4DLLA 4JT2A 4LV5B 1ZFNA 2VDUE 2QMHA 1JVNA 1WCWA 4LZOA 2P8JA 1V6CA 5HCIA 2JEOA 3H0EA 1KC3A 1V1RA 2ZLBA 1U6JA 5CA0A 2WD9A 1DINA 4IW3B 4RD4A 4EKEA 5BSWA 5FDFA 5J2TA 3G7SA 2PGLA 2Z0MA 3CSSA 5A6VA 3AEYA 2FG7C 6AT1A 2Q1XA 3A6HA 4ILKA 4ENPA 4Q1DA 4M4SA 2EWMA 4N82A 4UOZA 2ZYRA 1E5TA 2V9ZA 3LDHA 5KOJB 1H4VB 2PH1A 3RKRA 1VHLA 1YC2A 3A31A 5DNUA 1Q77A 3VR6A 2ZBRA 3ZV7A 1PZHA 4NYJQ 5ALIA 3URMA 4NQZA 5A4FS 5KWSA 1PT9A 4US1R 5E6SA 2W2LD 4OYYA 2FMXA 4G1BA 5J2UB 2UXDB 1LLQA 3B3JA 2FY8A 4O4IA 4MEAA 4WHMA 1DIAA 4NNJA 5EE3A 3TO5A 2YZ7A 4B43A 2HGZA 1NLMA 1GXSB 3FX2A 2NUAA 4ZQGA 4ZEVA 1EWQA 3B7GA 2F3TA 3R9KA 3ZXSA 1MRNA 1QQ7A 3BH0A 2G5GX 4HLDA 5A4AA 5JZOA 1RC1A 3B9BA 1KEKA 4HGPA 1HNWB 3WA6A 1U0RA 3LA8A 1G2IA 3VR5A 1L5ZA 4QLAA 3MQ4A 4XYMA 3WFZA 1QV7A 2VDPB 5BR4A 3PRHA 3I76A 5EEGA 2OE2A 5FTNA 2BWJA 1F17A 1E2EA 1NSTA 3BHJA 3E9YA 2FDRA 3G8AA 2BKXA 4FCWA 4MVJP 1Z16A 4TS3A 2ZQ5A 3ZHSA 3AM3A 1ZGAA 2QLFA 3ABQB 1M1NA 3UJHA 5JJBA 4ZAFA 1ECLA 5AJVB 2C7BA 1Z0UA 2XTMA 2LV8A 3UMYA 4ZAWA 1KU0A 1EVJA 3DLIA 3OLZA 4QOHA 4M89A 1SUIA 3N8HA 1GTVA 5IX8A 1AMUA 2CLEB 2HK6A 3N0XA 1FX1A 2JAWA 3BD6A 1BOFA 2WU8A 4Z4QA 4NENA 1POWA 1VMDA 1PHRA 3K5WA 1Z63A 1GNTA 2OP1A 2P4EA 3OZCA 1IEXA 2CNWD 3DZ4B 3V1YA 1E32A 3P4YA 4UQPA 1PSDA 2KLBA 3NV9A 2JG3A 1ST2A 2HEIA 2IDMA 3HXLA 2O1WA 3JVVA 4IJWA 4CVNA 2FR8C 3K8YA 3DTVD 2O50A 2JZOA 3CQ9A 3QELB 2JLYA 3VR1A 5TRTA 3V2UA 2W4MA 3K0CA 4G9GA 1RT9A 4WBXC 2VTKA 3SDZA 4URZR 3F4KA 3W0LB 4PW0A 3U3OA 1FFXB 3LIPA 2XNDD 3AHIA 4LUCA 3VMMA 2CUTA 2OCKA 3EMBA 3HGQA 3P2IA 3R2JA 5JH7B 2DHRA 4J0KA 1H2ZA 5NULA 4Q3OA 4CM4B 5ELXA 3PGXA 2JA2A 1ZU4A 1CWUA 1JKJB 5E2AA 1KHHA 3FPKA 3UHAA 1NC3A 3ZIUA 1JS1X 2BZ0A 4HAUA 4YAOA 4W5RA 2WG1A 4IH1A 3AFHA 2O48X 3KYDB 2YFYA 4HXEB 1VKZA 3UVEA 4CDNA 4OP3A 1AN0A 1OBFO 1Z26A 3VH3A 2ZIGA 3WKDA 2HCJB 3G0CA 2F3QA 2JAPA 1WIWA 1Y8AA 2Y1FA 4I6JA 1KO4A 3KT8A 4R2WA 1MV8A 2W2LA 5SYNA 3N8KA 5KYYB 4ZU1X 3V4ZA 3IEMA 5BNTA 4HHEA 3P2MA 3R0JA 4RKQA 2EDCA 2CKDA 4TKVA 1W5SA 4WFIA 4QBTA 5EHNA 4IVQA 4CLDA 5JYCA 2WHQA 3NAGA 3JAWA 4IIVA 4IRUB 4DDWA 4KIGA 3L01A 1NXSA 4BNIA 2J31A 1YB2A 3F8SA 4L8GA 3LBAA 1EX1A 3CSDA 3WBKA 3UHPA 2OKGA 5EMNA 2JGNA 3K72B 4TSFD 5JDIA 2IWHA 4ZK2A 1A8PA 5I3CA 4N40A 1I33A 4AY4A 4BPBA 1ZINA 3PKIA 4JI0B 2ZRHA 4RVFA 1N2JA 3ZWYA 3TGLA 1T1RA 4WZAA 2J7KA 3PV0A 1H9BA 4W5OA 2C61A 4URYR 4ZYLA 1NBWB 2FLKA 1VIYA 2WSIA 4OL9A 1HETA 1SVLA 3FTQA 1DS6A 3PWKA 4NMHA 4MHSA 3RROA 4QGSA 2D8MA 2NQ2C 2AIRA 1Y6GA 1FMCA 1W6UA 2ZYDA 2GEKA 3EDCA 3RIHA 3X2EA 1JR4A 1NVVR 2J33A 5FBVB 2EKPA 3BT7A 1I72B 1XTJA 4KRXA 1O57A 3FPHA 3GUZA 2ZYAA 4H08A 1X15A 1V5WA 4MI3A 1ZHOA 3KHSA 1S96A 1SIOA 4M1QA 5JMOA 5REQA 5LCXA 4D0GA 3D6NB 1MH9A 5A7HA 2EGGA 2HBYA 4DIUA 1Q44A 2CNWA 4COKA 1TCBA 2QTNA 3AJRA 3OIFA 1UMCB 2ERCA 4UEJA 4BNMA 1UKAA 3LK6A 3QNMA 4FFRA 5D3ZA 4BASA 2FETA 5B3JC 1KPIA 5AVQA 2VRNA 1TM5E 3PHLA 2NO1A 4I9UA 2ERXA 2NSJA 3DTVA 4OUDB 4GR4A 1FJ2A 3SF8B 3V7FA 3VVCA 1X7ZA 2FJ0A 4ZCQA 1SBYA 2VUHB 4AVYA 4B6JA 3AR4A 2ID4A 2QMQA 3DE7X 1QH1A 4JSTA 2LIPA 3L0PA 2JARA 3WI7A 3R9XB 1VKJA 4BGEA 2IEAA 4W8OA 3M9XA 2XNDA 3CPEA 3FCXA 1TK2A 2FZEA 2K4MA 3KR0A 4TV9F 3DHNA 3L46A 4F6CA 4CM1A 3RTGA 2FZLA 5E1OA 4I4IA 3W6PA 4KQCA 1JG6A 3KV1A 3GZJA 1LCIA 1QNLA 4UE3S 3UAVA 4CZ2A 5AW0A 4PZLA 4LF8B 1QG4A 2ZIFA 3B78A 4V0NA 2YS7A 3LMKA 3MERA 2QLJA 3AW9A 5AJUA 2GCEA 2ZJZA 4RQUA 3ECCA 3UFBA 5L40A 3C8DA 3GXOA 1XXHE 3PR1A 4HO1X 4KK4A 4ZXPA 3VHLB 5K3OA 4QSHA 3GDGA 4J0IA 2WSYB 4PLVA 4L9WA 3WXBA 1SU7A 2O5CA 3HBJA 4G0VA 1Q92A 1WULS 3G2IA 1HLDA 3Q11A 5CW2A 2O3TA 4R1OA 4A2PA 3AP1A 2I71A 2PX2A 3CXRA 2VNKA 5EZ5A 2G9NA 3TGPA 3LSYA 2WU0A 5AI8A 1BFKA 1J1ZA 4G0WA 1AHHA 4KX3A 4AQYB 3V7NA 1HKUA 4GKBA 1FYDA 2VCEA 4JU9A 4TSFA 1F1JA 5LDDC 5EQDA 2VJYA 2RC6A 5KAPA 1DQPA 2ZJ6A 5JJCA 3KSZO 1CP3A 1J33A 1PR5A 1TYZA 3DOOA 1VC2A 2O1EA 3KP1A 4RZIA 4TRMA 1PKEA 3A6PC 1VIVA 3IEKA 3ZD6A 3P0EA 3DS8A 1SJ9A 5KZMB 4FNMA 3LF2A 2IJGX 1P2BA 2J3IA 3DL2A 3L7IA 3OPVA 4HYTA 2OPHA 2GARA 4EGFA 3DJFA 3KQPA 1EVLA 3BILA 3EVTA 4BJ1A 4HFRA 3EOAI 1BG6A 1G7RA 1E2KA 3R3XA 4WIAA 3V42A 2AL7A 5LN1A 2G4CA 2N46A 1GD1O 1G2OA 3H1BA 3LOQA 4P32A 3FLMA 5FAXA 1HYHA 4P7FA 4F4CA 2GJKA 2NZ2A 4FFSA 3UWMA 2V3CC 2FN3A 3PP8A 5H70A 3LC2O 3WL7A 5CYGA 3AX6A 2OAP1 2K7FA 1FLVA 5ENZA 1FS5A 5IUJC 3V8BA 3ZXUB 3BFXA 3DAHA 5CEEA 4RZ2A 5CIQA 4EMSA 2HNKA 1BHQ1 3JD4A 3R5KA 1UMBB 1K86A 3LLCA 1K3FA 1YQEA 2J5KA 1M8PA 1GKYA 3ZCSA 4BNXA 3KR2A 4KDCA 1NF9A 1IONA 3CKYA 2WKRA 2C5GA 4OXYA 1EZZA 1TZKA 3GP3A 4M21A 2M98A 3F2VA 2ZZMA 3QYJA 3OIYA 1NV9A 4EY5A 4YQEA 3RRFA 4ND6A 1O5OA 1T2VA 2QTBA 4X8HA 1YZUA 1JLLB 2VDRB 2HFKA 3R7WA 1R8YA 1NUPA 3A2KA 1I3KA 1LSJA 1J5EB 1HDZA 1FPMA 2H1OA 4OHKA 4UDYX 5M29A 1FNNA 2NT4A 4EW2A 4F11A 1LNSA 4H4EA 2J9RA 4V0KA 4LC1A 5DNAA 3TSZA 4RPJA 4N5NA 1FRVA 2VDWA 1AT1A 3OEED 4MIOA 3GLVA 4K05A 3EXG1 4X84A 1NVAA 2H57A 2C96A 3FNRA 4LDZA 4LYAA 1PR2A 2XWBF 2CCKA 3LC0A 4M9UA 4B7AA 2Y1WA 4YQZA 3WLMA 2H9AA 3PFNA 4B44A 2A3RA 2HHAA 4Y1RA 2OVBA 4DCPA 2QI9F 1HWYA 1KI1A 2J0EA 4AMBA 1TYEB 3TQTA 3EXHC 3BYZA 3MJFA 4R98A 5DRYA 5THXA 1ZN8A 1QWSA 1IPFA 1XRQA 1XZ8A 2G8LA 1GUDA 2X22A 4O3FA 3BJZA 3UH1A 2AYZA 1JHDA 4DKXA 5CVVA 2CVQA 1WAMA 4PSVA 3TQIA 4YJGA 4A36A 5FPHA 2BFWA 4PS1A 4QSMA 4TRRA 1D1QA 1M7BA 3D2LA 3MC1A 4IQFA 2WWTA 4C4PA 4MR7B 1JB9A 1MCZA 2QM8A 2J30A 2X7XA 3OTQA 4EVIA 4KYTA 2VJNA 2D1TA 3MTIA 3OLVA 1ESMA 2G28A 4A1FA 1BVHA 3UJAA 1EK6A 1G20E 3GJQA 3GDOA 4WINA 5E7MA 5B3JA 3K4PA 2H2DA 4IV5A 4KEAA 4A1OA 4B33A 4EPRA 3KQQA 3UTDA 1NUTA 1I01A 1Z3CA 3G9UA 4MR8B 2NXCA 2FUCA 3CRNA 1N5JA 1AUPA 1JBQA 1NRWA 3UIEA 3ANTA 4DFDA 3AUFA 3BULA 1XEWX 2Z95A 3EZ6A 1YVPA 2WAMA 3HKBA 3RGWS 3ZE8A 4KWTA 3GW8A 1R7RA 3CW9A 5CMLA 1RBQA 2Y1DA 4GBMA 4JBLA 1JR6A 1CP2A 1X7XA 1SKBA 2Y05A 2YHAA 3MA0A 2XA2A 4C05A 4EK9A 2R00C 5AW8A 5BW4A 2ONZA 1YJXA 4IQ0A 4HXYA 1OASA 2PZFA 3KTFA 4H6PA 1TX4B 5CA0F 3VO2A 1SIBE 5FLEX 1NOJA 3PXCX 3A1VA 4WBNF 5A5EA 3EP7B 1UC8A 1R4NA 4EYEA 2GJ4A 4ND3A 3ZI7A 1IRIA 4N3CA 3DPIA 2GXAA 3W5HA 3HBMA 2W98A 3DZHA 4HLCA 1DJNA 4I50F 4YMTA 3UYKA 5DCWA 2QLMA 1S2DA 3N8DA 1TU3A 3ZWXA 3WL3A 1G8SA 3QA3E 4QYTA 1Y3HA 2QL5A 5G0VA 4MRNA 4O4IF 2VXOA 3GJ6A 1SN7A 1QZZA 3NWOA 3JXEA 4KKXB 3HWWA 4GEGA 4QRHA 1GAWA 3BTVA 2EZUA 1HRKA 3S2EA 3OEEA 4B17A 1IHOA 4FVTA 4MPTA 3E8SA 4PXYA 4EUEA 4QVKA 3F3SA 1J5XA 4M1KA 3RBVA 4ALNA 4XEHA 4C7BA 3Q10A 5EKXA 2YMPA 4E5VA 3SJBA 2PD4A 3ZI0A 2ZYGA 4NCHA 3WLEA 1IJKA 1QGAA 4NEQA 1UBUS 3E5HA 3R20A 2PSFA 2A9RA 1RHMA 1L8LA 4BO6A 2IKSA 4QXQA 3URKA 2HPHA 3ROXA 4RSRA 4DREA 4JIGA 2H4XA 3P19A 3U56A 1DT5A 1DHTA 4NZ9A 4U2CA 4WEOA 2HADA 4XXHA 2Y27A 4ZGGA 2R8RA 1KVTA 2B7CA 1IXYA 1QTQA 2RKWA 1SU6A 1RHUA 3QH4A 4II3A 4F04A 2NQ8A 2PLWA 3W78A 3GRZA 2AMLA 4J7AA 3GA7A 4LX8A 2OO7A 3UCFA 1JI3A 1FFWA 2UYGA 4M0KA 3A2NA 4MLPA 3DMHA 5AKXA 5JWRA 3N2KB 3FG9A 2EU8A 3PGMA 4WBSA 1TTHA 3KJEA 3X1KA 1E6CA 1ONPA 4MB6A 1KGSA 1PGOA 3PRKE 2GZ1A 1EVKA 1J99A 1SKQA 2V7BA 2ZGVA 2BW0A 4FSDA 5H59A 4U3JA 5E1DA 3N9IA 1P81A 3DWFA 3I9V6 4X93A 5IJXA 4G8DA 4JYBA 3QOFA 3KFVA 4PF1A 5ECGC 3PR2B 1A50B 3S5JA 5EOVA 4N18A 1X3LA 2RH4A 3N5CA 3FFXA 2AZMA 1ENOA 3EQZA 1DXYA 1GSHA 4XGRA 3CNLA 2DHEA 2GN8A 2ZB8A 3WMXA 1F6WA 2JLQA 4NY1A 2CLMB 3OSZA 3JATB 3RG2A 1IN1A 1IBLB 4MLCA 1MW8X 4OJNA 1L4MA 3ISVA 1YE5A 2C1EA 2CDNA 4RKRA 4WMLA 3SXUA 4IIEA 4C0BA 1D6SA 3LBIA 3OM9A 1NUUA 1W73A 3H11A 2RGGA 1WUJS 3WOHA 3I1FA 1T0HB 1PG0A 5JAOA 1JFFB 2ZTHA 1HDYA 3EXHA 4ER3A 1LDEA 1GL6A 1Z06A 2HM7A 3I4CA 3QLEA 4BKUA 1BU8A 5HCNA 5J59A 1YL7A 3L8EA 3CUWA 1PTJC 1R4AA 5KJ6A 1DBVO 4IIJB 3SQMA 1HNNA 1MUUA 2JH3A 3IVCA 1ZDMA 2KI5A 1HYBA 5JYDA 3D0RA 3EB9A 3G5MA 3FN4A 5EI5A 2JAQA 3MB8A 1DWOA 2DT8A 1QIMA 3ASZA 2ODNA 1J2YA 3I2JA 2P67A 5DP1A 1JA9A 5JXWA 3AHDA 4RV5A 3UK6A 4WAUA 4KOEC 3IQDB 4KLCA 4BEVA 1WMFA 2KJQA 4RVNA 3SFZA 4Z0PA 4O4JA 1YR3A 4JITA 4FSXA 4KYUA 1MJFA 4GDMA 1L5OA 5KYXA 3E2IA 2O3RA 3C3MA 2X9QA 3GHHA 3I72A 4PGHA 3WX0A 2XBMA 2FMTA 4B3RB 3M6VA 2WSLA 4LSWA 1RYFA 4M37A 2B7BA 2YN0A 4UUAA 4L8YA 4AKTA 1ODJA 4MW0A 2Y6VA 3CX7A 4REQA 4DQDA 3A4MA 3JQDA 1E18A 3OLXA 2JBWA 3RSGA 1XTIA 3T7SA 4HWTA 2GRJA 2CVZA 4K88A 5EGNA 3X0DA 4EB6A 5EJMA 1J25A 5DM60 3CYFA 2XGOA 2NYUA 2YJ3A 4H7JA 4JUDX 3B60A 3N2NA 5ALQA 3RI3A 5A4MS 1F2TB 1X87A 2WIJA 1VE1A 1CFZA 1FQOA 5KVSA 1KTIA 4PPYA 1M1XB 4D8UA 1GT6A 3NBAA 4KN6A 3DHVA 3L8MA 1WW8A 1CZUA 1QVVA 2HH9A 1IULA 2P77A 2PX5A 3BQNB 2A5YB 5DCYA 1CZLA 1SC6A 2R6JA 2ZJ3A 3M9WA 3E1KA 4Q01A 1XKTA 2Y0BA 2QG9A 3CH6A 4N65A 4AO7A 5MDHA 3JZDA 5DI9A 4CNBA 1U3GA 1JSLA 2MYUA 1UOEA 3O9MA 4WA8A 4LQLA 4HX9A 1DBWA 4I4TA 1RACA 5EJ7A 1LC3A 3ZQ4A 2D7CA 2EGHA 1GEEA 2Q6IA 2WJHA 2WHXA 1R2QA 3D3NA 5K6AC 2RB5A 3WGQA 4BLUA 1SVIA 2AT1A 1M5TA 1NQ5A 3D0OA 2HTEA 4WNCA 4QARA 4B1FA 2WSBA 4MO2A 3LP6A 3LY7A 1VSQA 3M1AA 3H0VB 4NS4A 4P0PB 3ABRB 5K4HA 3D0QA 3AL2A 3N76A 5FPKA 1UBHS 1BA3A 4RJLA 1TZCA 4KYVA 3R7BA 4A0SA 3UT5B 1U8TA 5F33A 1BMFD 3A1NA 2QTCA 3UXEA 1SC4A 1NUAA 2XUGA 2YH2A 3JV7A 3LX4A 5H68A 1H05A 1VECA 4KSCA 3I52A 3RSLA 2QR2A 3RUHA 4ECEA 2GJ9A 1RAFA 1RDFA 1V8BA 3ZCQA 1DPFA 1FK8A 2BIFA 5E1BA 1SWVA 2I7DA 5LLSA 3H9CA 4NJMA 3AILA 2FDXA 3BK2A 3C70A 4J2HA 4O1IA 1GL3A 4PCVA 2OC4A 2FCRA 3C8ZA 1CPYA 1XOIA 4Y1FA 4LXXA 2XEDA 5DGHA 1S4QA 5FOTA 1JE0A 4NAHA 4E4TA 1ZI8A 1UEXC 1YKGA 4P4UA 5AM2A 2XLBA 1J8MF 2IF0A 2P4UA 1CJMA 1P7VA 3INTA 1IEVA 1E0SA 1U6KA 4LYDA 2FZ4A 3U37A 2VBGA 1Q0TA 1M33A 4F1JA 1E3WA 3COZA 1M8GA 1U6IA 3SSMA 5FWXA 1SC1A 2DE0X 2DLDA 3A06A 3CB4A 2DPYA 3DL0A 4V0LA 5CU7A 3N2GA 3UV7A 1L4UA 4ICIA 2RI0A 1OV6A 1II8A 2V9CA 5KHLB 5JAIA 2WBLC 1GLVA 2W2OA 4EHHA 2AN4A 2IK8A 1F7UA 1E4OA 3MGBA 1AGXA 1P7CA 1SCQA 3DT8A 5DBOA 4EDFA 2QEQA 3KBBA 1ZK4A 3HR8A 4A6EA 2AI1A 4B3TB 4WK4B 2QRGA 4Y30A 1DKMA 4K8RB 5L7WA 3CO0S 4RVUA 4YV0A 3WQSB 2HXSA 4FGLA 4HAZA 1VHQA 5ECYA 2VHWA 5JYEA 3JAKA 3FB4A 3FWYA 3LIIA 3FZYA 1I6LA 3P97A 4WJKB 8OHMA 5L6MB 4AUMA 3FNGA 5I7EA 1EHYA 3KTDA 2CLIB 3CE9A 4N0EA 3B2EA 3EEIA 1E64A 4J0HA 4OHYA 2DUNA 4C6SA 3EC7A 1Q0SA 2EDAA 2DFDA 3OPXA 3CEPB 4G1EB 4JB3A 4Z99A 3ZE9A 5CT8A 2B37A 1PEDA 1UC5B 5CCXA 1OZGA 3F4BA 4WE3A 4GNKA 4CW7A 1YZQA 2YJ5A 1D2CA 1PTJA 4HMPA 4RKYA 1DBQA 1MC5A 2HA2A 3T8YA 3A27A 5J58A 3WQQA 2F00A 4TZTA 1FYFA 3PL1A 2I3ZA 5GQSA 1PN3A 4RFSA 2QZPA 5C53B 4B5LA 5TVOB 3KR1A 4E5MA 2O5EA 4CM9D 2K7ZA 2XVZA 1TEHA 2I99A 4I1OA 3GAZA 4RANA 2Q1YA 4U8HA 3HA7A 2FN8A 1SHKA