1RYEA

Crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
343
Chain Sequence
b'MPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-fructose oxidoreductase
publication title Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis
rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
total genus 120
structure length 343
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ryeA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ryeA01
1A72A 4CV3A 3LC1O 2Y05A 2DBZA 3BTOA 4UVGA 3F9IA 2GN6A 2BGLA 5IXSA 5H82A 1N2SA 1DIGA 2HKIA 4XYMA 4MIOA 3IIEA 4ND5A 1E7MA 1YXMA 3GHYA 5TT0A 1O5IA 2X58A 4P38A 4N5MA 4HXYA 4WLFA 4BUCA 1YQGA 3LC7O 4QFDA 1LC0A 3ZWXA 1V3UA 1EVJA 2JCYA 1V3VA 2AQHA 3PTZA 1U4OA 3U4CA 5JNLA 5L95A 5T5QA 4RF5A 3DZJA 1QMGA 1MV8A 3ZHZA 5ENVA 5FEUA 5BNFA 6ADHA 1SZJG 1T4BA 2A94A 4R1SA 4J9UE 1O6ZA 3I9NA 1UDAA 1R15A 3U4HA 1T1RA 3JQDA 3GAFA 4M87A 1DC4A 4ZRNA 4LVCA 3W4KA 3E03A 2X9VA 2YFHA 4IQGA 3P7MA 3OA0A 3DDNA 4CMKA 3ZNNA 4ZVVA 2Y1DA 3V1YA 1UDBA 2PKRA 2W98A 4HKTA 4HBGA 3NGLA 4QFCA 1KOLA 4ZA2A 2CZCA 1R16A 3HDQA 4ZQGA 3VPHA 2NVBA 1X1TA 3IUPA 1QR6A 2SCUA 3L77A 4XYGA 1B7GO 3TWOA 4R4JA 1K0UA 1GD1O 4L76A 3WGHA 3ZWPA 2YUTA 1BVUA 3GNQA 2HRZA 4Z3DA 2WEKA 3MOGA 4IM7A 4YAJA 1YOVA 3CE6A 2YV1A 4CM5A 3VC7A 3GVHA 4WCDA 4CMEC 4E5PA 1CRWG 4N54A 1JQBA 4DQVA 4HV4A 1N9GB 2IEBA 1CYDA 2O2SA 3LK7A 4DC1A 4EI2A 3CZMA 1LQTA 4CMHA 1P1IA 1ZSYA 5CFZA 1D4FA 3AI3A 3PI7A 4J1TA 3PQEA 5ICMA 2C7VA 2J3HA 5BR7A 3Q0EA 1LSUA 1U5CA 2R6JA 3LT1A 3I3OA 1XR3A 1R6DA 4E5NA 5A02A 5EESA 1DC3A 2FZWA 1CIVA 3JD0A 5G0WA 1GDHA 1EMDA 1HYHA 3CZRA 4MKRA 4ZQBA 4EBFA 4YT5A 3STHA 1BXKA 1ZZEA 4IJWA 3GOHA 5F21A 1A7KA 4XQ9A 3CH6A 4E32A 1M6WA 2RHCA 4MOWA 1UP7A 1ISJA 3BMQA 2DPHA 4UREA 5BT9A 4CMGA 5KTKA 4IZHA 1NR7A 4WLEA 1NVMB 1BHSA 3QWFA 4FW8A 1N1EA 5FYDA 4RF3A 4IIUA 4D7AA 1NNUA 1F06A 5CPBA 1AHHA 1CQIA 3ZU3A 5JY6A 2OP1A 4MVJD 4GI2A 5K6AC 3IKVA 3U9LA 5T64A 1ISHA 2B0JA 4RF4A 3RUAA 3H9UA 3GNTA 3ETEA 1TT5B 3UF0A 3JYQA 2R00C 1VSUA 2TMGA 4E2WA 3UW3A 1GTMA 2D8AA 2FWMX 1BW9B 3JYLA 3TJRA 4EUHA 4CM9D 3ADOA 1J5PA 4CLOA 5JCJD 4J3FA 4CQMB 4I5EA 1C0KA 4QSMA 1GEEA 2VT3A 3L0DA 5JCJA 1ZK4A 1X7DA 4CUKA 5A1TA 4MP6A 1I3LA 4LRSB 3GZNA 1XG5A 1KVSA 5IN4A 3D5QA 3ASUA 1BXGA 4D44A 2PFGA 4IY1A 3V2HA 4W7IA 3H5AA 2WTBA 2B69A 3K30A 4PLZA 1EBUA 1B15A 5DCWA 5JPIA 4KWHA 5KOIA 2YV3A 4IIVA 3ZHXA 3ZDFA 2EXXA 4RPHA 4YJDA 3UCXA 1LA2A 5AXBA 2NQTA 1OFGA 2GN4A 1H5QA 3IQDB 1PJ2A 2EJVA 3UGKA 3ONEA 3FHLA 3NT4A 5T73A 2X7HA 5U4QA 3DBHA 3OJEA 2OBNA 2CMDA 4L0QA 5BSHA 1TB4A 3KV3O 1C3VA 1RYEA 1NASA 2RCYA 2JHFA 4U5QA 4E6PA 1MC4A 1YB1A 3ON5A 2X22A 1K5HA 4GGPA 4XCVA 3TSCA 1GQ2A 3WQRA 1E7QA 5G0UA 4CM6A 1Z73A 3DEYX 1F14A 2ZYAA 1WAMA 5GY7A 4ZGWA 5IDXA 1GADO 5ILGA 3GK3A 3UCFA 4L73A 3KSUA 4YCAA 2DAPA 5K9ZA 3OJFA 1JAXA 4Y6SA 3AM4A 2EEZA 2ZQZA 1EE2A 1UP4A 3Q3CA 3UN1A 4BV8A 1HDCA 3B20A 4NBUA 9LDBA 4NBVA 2IRWA 3NRCA 1ONOA 5K0ZA 3PHGA 1PQWA 1W8DA 3LT4A 4M89A 4ZQFA 4LSMA 5CAEA 3RU9A 4R1TA 2VWGA 1WXDA 2GZ3A 4RL6A 3PLNA 3BMCA 4MKZA 4AVYA 4DPMA 5COAA 1C14A 1A9ZA 1E3LA 3JYPA 4YA6A 3IJPA 2ZCVA 2NU9A 4BNJA 3TZQA 1IZ0A 2WD7A 5DOZA 2BFOA 4XB2A 3ITKA 3LF2A 4R9SA 5F1OA 3D5TA 4DREA 2NQ8A 1EQ2A 2BGKA 4AJHA 3IP1A 1XQ1A 4PLPA 1EBFA 1X1EA 2DLDA 3KRTA 1SOWA 1TLTA 1C1XB 3E1KA 4MDHA 2X0JA 5G0SA 3Q9UA 4Q3CA 3TQHA 4IS3A 1KY5A 4J7CA 3S1LA 1VRWA 4GWGA 4UULA 4Y67A 1UP6A 5TX7A 4OXYA 2BFAA 3ZCXA 3WFIA 4EITA 3ZWCA 4YB8A 3NEPX 1CETA 1IE3A 4Z9YA 4DYDA 4DIFA 4PG6A 5EQFA 4FBGA 3AUTA 4RZIA 2O23A 4R9RA 1G0OA 4JCOA 3WYEA 4ND2A 4HWKA 4XX0A 4YWJA 3FRJA 1VL8A 3KYDB 3C1OA 1GYPA 3RU7A 1A9YA 5FI5A 1DO8A 4LGVA 3D3WB 3O03A 3OP4A 2O3RA 3FWNA 1MXFA 2JAHA 3CMMA 5CDSA 5TQVA 2AEMA 2YQ4A 3JYNA 1AN9A 4L4XA 3OJ0A 3VH4A 4PLVA 4FJ1A 3MWDB 4J7XA 5HTOA 1DRUA 1XGKA 3I4CA 4ESOA 1YJQA 1T2DA 4ZD6A 4K9DA 3L4BA 4C7KA 5CDTA 3WICA 3UUWA 4M86A 5A06A 5JE8A 4RQTA 2EKQA 3ROMA 4NMHA 4J1SA 1PJTA 4JK3A 2VOEA 3EAGA 3KXDA 2QZZA 5KKCA 4U6SA 1QXSA 4OM8A 3DOCA 3DZIA 3KEQA 4WLOA 4EW6A 4I8XA 2CNBA 3GN1A 5MDHA 1E7WA 2Q45A 5ILOA 4RGBA 4KUEA 2OHXA 5L7YA 1HKUA 2FN7A 1E1NA 4BHTA 1WZEA 2GRAA 4TRMA 2QZ9A 3U5TA 3AFMA 3X2EA 1JW9B 5TJ9A 1T2AA 3LT2A 4MVJH 1Q0HA 2RIRA 3ZWAA 5CHEA 3AWDA 1V3TA 1LDYA 2GNAA 3EVNA 4XZ3A 2O7SA 1LDEA 1U28A 3SJ7A 2VZ9A 1RPNA 2BGMA 4DQUA 2IYPA 1WLYA 3E18A 1LLDA 4FCCA 3R3JA 4TKLA 2IXAA 2W2LA 3F5SA 2EJWA 3ZH2A 5I8WA 4PVCA 2CDCA 4XB1A 4IMRA 4U0JA 3U49A 1TA4A 3DFZA 3TFOA 4W6ZA 4AJLA 1YQDA 2AHRA 3HSKA 4R1UA 3NTQA 3IJRA 4DVJA 4GVLA 2HJSA 1HE2A 3JTMA 2GGSA 1T4DA 1PZFA 2I65A 3VZQA 1EZ4A 3OHSX 3WGQA 4YPOA 2C2XA 1WDKA 4JJIA 4L4RA 5TS3A 4TSKA 5J9GA 5FWNA 4CM8A 4E31A 2G1UA 1U2GA 4RVHA 3INGA 1NQAO 4U0KA 1OC4A 3MCVA 4WCFA 2O7QA 1UDCA 2O4CA 4L75A 5A5EA 1AGNA 4HFMA 1KEUA 5EJ2A 1WNTA 1WDLA 4ZQHA 3HWRA 1IHYA 3JD4A 3ZWVA 3OICA 5L53A 3EYWA 4GSKA 5IF3A 2GO1A 3FNGA 3AU8A 4NZ9A 3GQVA 3ANLA 3VDQA 4YQYA 1GAEO 2X5OA 4BB6A 3E6AA 1Z45A 4R01A 4D45A 3BYZA 3ZHYA 5KVVA 4BL5A 2ZTUA 2Y1FA 3RSHA 4TZKA 2XXJA 5EIOA 2Q1TA 2P9CA 1V8BA 3EY4A 3T7EA 3DZFA 4TWRA 1DIBA 4HNHA 3HQ4O 3QQPA 3QY9A 1LLCA 1P1RA 3DONA 3EVTA 1IPEA 3DZHA 4FFPA 4I9HA 2JL1A 2HQ1A 5JAQA 4II3A 3ZW9A 5TT1A 2O3SA 5BSFA 4UEOA 2C29D 2DKNA 3DAGA 1HT0A 1IZ9A 1T2FA 4DRYA 5IG2A 1LX6A 3WFJA 1A4UA 2Y1GA 1MP0A 1NQOA 1AXGA 2E37A 4TRJA 4Y8VA 1GPJA 4B4UA 2Q4EA 4NK4A 2NVUB 1RJWA 3WGTA 4GLOA 2H9IA 1GV1A 1ZNQO 2Y0EA 3OMLA 4HX5A 3H9QA 3S2FA 4CPDA 3I4FA 1HDZA 4XYEA 1R4MA 4MVJF 5JLAA 1DHTA 2ZQYA 3B6ZA 1UXIA 4Y6PA 3TF5A 3PQFA 1X15A 1H2BA 1HSZA 3E8XA 2GSDA 2VUTA 3OH8A 3JQGA 3R1IA 2BELA 1DC5A 3BXXA 4M49A 2ZB4A 4FOSA 4DQXA 2VNAA 5AOVA 4IDEA 2PKQO 3I9MA 4BO7A 4GL4A 4YT4A 4OHUA 2Y0CA 4LCEA 3RQSA 2HU2A 4GMGA 1R12A 4LMPA 3AOGA 4KZPA 5C7IO 1DBVO 4K1LA 4PLTA 3MWEB 4CODB 2E6UX 2CDBA 3AOEA 4IQ0A 4MVJG 3PK0A 1VJTA 5DNAA 5L4LA 3ZV6A 4B3JA 3LYLA 1NAIA 4BGEA 1ZK1A 3NX4A 2E49A 4K28A 3C3XA 5CG2A 3RCBA 4R3NA 4YJGB 2R2GA 2ZATA 2GZ2A 2WE7A 1X13A 3RUEA 2YDXA 2ZB3A 5T67A 4FQ8A 3JD3A 1PS0A 2VYND 5GZ3A 1F8FA 4FJ0A 1PGQA 3E5MA 1GZ4A 1G6KA 3FR7A 1IUKA 3AM3A 4A26A 1LSOA 5IDQA 3A28A 3DAFA 4OXNA 2IE0A 3RUFA 1PJSA 3OJLA 4GQAA 2PTGA 3SC6A 3H8VA 2HK9A 4IDAA 3ROKA 5TLSA 3M6IA 3H6KA 1FXSA 2JCXA 1U1IA 1DRVA 4FFOA 1NXQA 3DWFA 3O8QB 2D2IA 1H6DA 1DFIA 1I24A 2P9GA 4XR9A 4AJ4A 5B1YA 1GPDG 1H6BA 4FR5A 3GVXA 1EVZA 3WGZA 2PNFA 1D7OA 2OP0A 1G1AA 1GZ3A 4EZBA 1TT5A 5ES3A 4DA9A 4NR0A 3G1UA 2Q1SA 2VRBA 3VHRA 2CDAA 2ILTA 1E3SA 4P22A 1ONPA 1FMCA 2X0IA 4YQZA 5JSFA 3LZ6A 3PGJA 4YRAA 3OIDA 2RAFA 2P2SA 4BV9A 3WWYA 5KNLA 2PZJA 4NG5A 4ROSA 3BTSA 1JWBB 3DMTC 3PIIA 1I32A 3KB6A 5KVSA 1KVUA 3QLJA 5KJ1A 1LC3A 2PZKA 1I3NA 1WP4A 2GN8A 1YL5A 2W2KB 1MC5A 2XXBA 4RVFA 2JHGA 2V6FA 1T26A 3PGXA 1DLIA 1GU7A 1XSEA 2C59A 1GCUA 3GEGA 4S1VA 5C5IA 1ZBQA 2P5UA 1I36A 3FD8A 4ZICA 1XWFA 2FPIA 2WM3A 4YTEA 4PN3A 3RWBA 1JKIA 1JKFA 1LXCA 3JCZA 3HADA 1EUCA 2O50A 2P9EA 4IBOA 3LQFA 4Q3NA 3VVBA 2EP5A 1Y9AA 4NDNE 4CR6A 4WE3A 1O9BA 2GYYA 5DOVA 2PH3A 4IXWA 2DUWA 3K2EA 3NDIA 4TRNA 1BVRA 4D41A 3BA1A 4FGSA 4QUKA 3WB9A 1E7RA 4WNCA 3OETA 3JQFC 2OL4A 1DIAA 1DAOA 3WNQA 1YDWA 1GV0A 3I6QA 5TC4A 4OL9A 1E3JA 4CUZA 4BO0A 3BMOB 3V1UA 3FF4A 1LEHA 3W6ZA 3EUWA 3DTYA 1B14A 3AI1A 1B8UA 3MJCA 1QORA 1NHGA 3DFUA 1SEVA 5JAMA 1E5QA 1H93A 4ALJA 4NJMB 1D3AA 2VTEA 2Q46A 7MDHA 1UZMA 2FPPA 5B4VA 1SC6A 1KBZA 5L51A 4RPGA 3IMFA 4ILKA 4A0SA 1GQYA 4BNZA 5AXCA 3Q9NA 3D3EA 2DTXA 3H65A 1YBMA 5I7VA 3PWKA 1QRRA 5ENDA 2OBYA 4UVHA 2UUPA 5H81A 2JFFA 3ZV3A 5DCUA 5ICSA 4CLRA 3PWZA 1JDJA 4Y6RA 4B3HA 1IB6A 2EERA 1PGPA 3DC2A 4R41A 2BD0A 4DBVO 4D79A 2O48X 4ND4A 4K6FA 1ORRA 2YZ7A 1WDMA 1YB5A 5IZCC 2DFDA 3CXRA 4PLGA 3IL2A 4MVJE 1TT7A 1NFRA 4HADA 2I99A 1P1KA 4I5GA 2Q1UA 3C1TA 5THKA 4WUVA 5FI3A 2HUNA 2PZLA 2Y0DA 4PLHA 3AFNA 4IDGA 5KVCA 2FZEA 1NQTA 2QYTA 2GASA 1B3BA 4Q9NA 2HCTA 3TZHA 4L9RA 2NNLD 2DU8A 3JQ9A 2QRJA 2WE8A 2Q49A 2B37A 4G2NA 1OZAA 2PZMA 5JO0A 2NTJA 3PJEA 4RVDA 1Q0QA 1GFSA 5T8KA 1B8PA 1LDMA 3TL3A 1ZEJA 3RC1A 1L7EA 1I3MA 1K89A 4WNIA 2IODA 5DP1A 4BO9A 2YW9A 4EGFA 1U8FO 3I9LA 3JD2A 4TVOA 5IDWA 3O26A 3QJ5A 1PTJA 1PJ4A 1DAPA 4AJIA 4GPD1 4XD2A 1LBEA 2EGHA 4YBZA 4PLCA 3NT5A 3JQ8B 3DBLA 4WGGA 5BSEA 3LU1A 1Z7EA 4XGNA 4OJNA 4MKXA 2OUIA 1N8KA 5JAZA 3L07A 4J9VA 3KUXA 2J5QA 3HB4X 4FB5A 3KYCB 1HDXA 3LLSA 4GVXA 3CUKA 4UAGA 1X7HA 4MP3A 5COBA 3VPGA 2QHXA 2ZB7A 4A5OA 5G4LA 2Z1MA 3WIEA 1VE9A 2PGJA 1I2BA 1GUFA 1ZSNA 3H4VA 3VDRA 2O3JA 1M6HA 3QE3A 2GUGA 5COQA 4FJ2A 1DHRA 3LVFO 2WYWA 4UUOA 5BSGA 3H2ZA 4ALIA 3AY7A 5A9SB 3PDJA 3WIDA 1RM4A 3GG2A 1IPFA 3SEFA 3DBRB 2D3TA 1U9JA 2P4HX 3E5RA 3FPCA 4IJUA 4W7HA 4BO3A 1WWKA 3HB5X 2EW2A 3D4PA 3MJEA 1AXEA 1PSDA 1U2DA 3GEMA 5KJEA 1Y1PA 1X0VA 3I83A 5JO9A 2UAGA 1QYVA 3TZCA 1FDWA 4CM4B 1E0DA 2VRCD 2NM0A 2AQKA 3WS7A 1JAYA 2VRCA 2AG5A 1A4IA 5HM8A 4FC6A 1C1DB 3BTUA 3ZWNA 2W90A 2VZ0A 1X7GA 4DIBA 1UAGA 4I5DA 4CR7A 2VN8A 4O59O 4JP2A 4TZTA 1L7DA 3EW7A 3I9KA 4OOFA 4CMIA 4J7UA 2DPGA 2X0NA 1DLJA 3AY3A 3NJ8A 2Q3EA 3W4IA 1DIHA 3CIFA 2A92A 5I8ZA 2IXBA 5EINA 4KTVE 1MX3A 2AG8A 2VOJA 5TNXA 4HFNA 1KS9A 3G49A 1D1TA 4GX2A 4EEZA 1LNQA 4XJTA 4KWIA 2NADA 5B4UA 5FF9A 1KVRA 5TIIA 5EQDA 6LDHA 1R4NB 1UR5A 4F45A 3FN4A 4Q3DA 1VKNA 3K31A 4CV0A 4NI5A 4WKGA 4AJKA 2B4RO 1XHLA 3PHLA 4EDFA 1O0SA 3AY6A 4RO0A 5LDGA 4PZEA 4YJHB 1BDMA 2OOSA 1E3IA 2Q22A 1I8TA 1ID1A 3ETDA 4MIYA 2EG9A 4PGFA 1PL7A 4BKQA 4E5MA 1ZH8A 3RVDA 4KQWA 3NDRA 4M8SA 2ZYGA 3R3SA 4QQRA 2IYOA 4EEXA 2JCVA 1YBAA 2VYVD 1OBFO 2J5RA 4FOOA 4OKIA 3AW9A 5CDUA 2VYVA 3GHHA 3KHUA 4EJ0A 5A4DA 1VC2A 4R5HA 2AEJA 4PCVA 3UCEA 1SB8A 3HJAA 1XELA 3D4OA 4F6CA 1GR0A 1KEVA 3F4BA 3FBGA 4JBIA 3C24A 2HMSA 3WR5A 4Z0HO 1IULA 3IUSA 3WYCA 5T57A 4YAKA 4J0EA 1J49A 1FDSA 1KVQA 3MTJA 5TJHA 4NU5A 1VM6A 2YYYA 5DCYA 4B4OA 4DPLA 4H15A 3DQPA 3A06A 3BMNA 2RHRA 3PP8A 2YV2A 3WWZA 4DTIA 4BIIA 5JYDA 1EK6A 4WECA 3Q11A 1E3WB 1NPYA 4RPJA 4BNFA 1I0ZA 2J5KA 3DL2A 3PJGA 1MB4A 2DTDA 1KIFA 5JXWA 4BNKA 4Z0TA 3ZU4A 3I9OA 3L6OO 5HBRA 3WX0A 1KVTA 3K73O 4JGBA 4YJFA 5A9RA 1H9BA 1NX6A 1DB3A 2C20A 4QO7A 1T24A 3FNEA 1SOVA 3W8EA 1PQUA 3HDYA 1I01A 2BMAA 3K9QO 1EEHA 1Q0LA 1XYGA 2PKQP 2HK8A 4CLHA 3CEAA 4RJTA 1YB4A 1HL3A 4Z9FA 3KOUA 2X5KO 5F1PA 4JXKA 1ZMTA 4FPXA 1NM5A 4YJGA 2GLXA 4HFJA 2C07A 2IZ1A 4JP3A 4OQZA 1EVYA 5JDIA 3LC2O 3H9JA 4UVDA 2QG4A 4O1MA 3JQAB 3EDMA 1Y8QB 2HLPA 5L7WA 4RF2A 2QW8A 1ENPA 1JVSA 3EHEA 3MJVA 4PRLA 1I33A 1UAYA 3P2OA 3GGOA 2ZIZA 3HFGA 1H6AA 2E4AA 5MGBA 1Y8RA 5DT9A 2VQ3A 1VJ1A 1P0FA 2D5AA 5CP8A 1MG0A 3ZV5A 1P45A 2VNSA 4E3ZA 4CLEA 1C0IA 3GR6A 4XGKA 1J6UA 2LDXA 1MUUA 3ZHBA 3UXYA 4NQZA 1FJHA 3OM9A 1G0NA 2HMWA 3RUDA 2C5EA 4OO3A 2D59A 1Z7BA 3DMYA 4MVJP 2DBQA 4B3IA 3WLFA 2YHIA 2OO5A 2H1SA 3TNLA 2BLLA 4I9UA 3QWBA 1J0XO 1R0KA 4R1NA 1NP3A 1K3TA 1BGVA 3NV9A 1AHIA 1ZCJA 1Z75A 5TRTA 3TOZA 2ZYDA 1CF2O 3VVCA 2PD4A 3L4BC 5L4SA 5CEFA 3JQ6A 5JC8A 3KYBA 2OFPA 4ND3A 3DZGA 5KJ6A 3KETA 3EMKA 4YDRA 1L1FA 3O38A 4BNGA 5ADHA 1HZJA 3UVEA 1QG6A 2EW8A 1HLPA 4FFMA 2JJYA 1F8GA 2YFQA 4GX5A 3GFGA 3RFVA 3N74A 4PG5A 3NKLA 1ZW1A 1HDYA 1LDNA 2Q4BA 3E82A 1Y9EA 5KJCA 3N58A 4DC0A 1K2WA 3M2PA 1XU7A 2HSDA 1PJLA 1P1FA 4CMJA 5AXAA 1C0PA 4XKJA 5T6BA 3GVCA 4ALLA 2I66A 5L3ZA 1HZZA 3L9XA 4J49A 2UV8A 2PLAA 5BNIA 3K92A 3L4SO 1P44A 3TOXA 2WYUA 3KLMX 4QXMA 3GVIA 1YO6A 2O4UX 3KLPX 4F46A 3ENNA 4WASA 3G79A 4HUJA 3HE3A 3WSWA 3F5QA 4FFNA 1U8XX 3FWZA 5DBGA 2Q50A 3PFFA 4I9NA 4NNJA 2VHXA 3DOJA 1H6CA 4YVFA 3BMOA 4LVUA 2O2YA 1HE5A 1P1HA 3OA2A 1YE3A 3L6DA 1HF3A 1NWHA 2Q1WA 1I2ZA 1WW8A 4YEDA 7ADHA 3QVWA 3DZKA 4H16A 1YOVB 4XRRA 4D3DA 2A35A 2W2LD 3NJ4A 2BHLA 4NJMA 4PG4A 3JQ7A 4XQCA 1QLHA 2PY6A 1PJQA 3H5RA 3RASA 4OGWA 2ET6A 5L45A 4IJKA 4D0RA 3LDHA 3JQCA 2VCYA 1VL0A 3P2YA 3TZ6A 5G4KA 4J16A 4R3WA 4KUGA 3WBFA 4WCFC 3GN2A 1NVTA 1HE3A 3ORFA 5L9AA 3RC2A 3FTPA 1LLUA 1XLTA 4WEQA 2BRUA 1SO8A 3QWHA 3G3EA 3CINA 1BMDA 2GN9A 4OSOA 3GH3A 1VJ0A 3RUIA 3TZKA 3UFXA 3RKUA 5JYEA 3WGGA 4XQEA 4A73A 4B7UA 1E6EA 1HYEA 4K6CA 5IXYA 3GFBA 5EERA 1E1LA 1CERA 3QVOA 4NBRA 2AQIA 4BKPA 1X0XA 2W8ZA 4JIGA 1XEAA 4D0SA 3PPIA 2B5WA 3JQBA 4YXFA 4IUYA 2GDZA 1HDOA 2UUOA 1MGOA 4BO4A 5LDHA 4WOJA 4OSPA 4MVJI 5J23A 3Q6IA 1ISMA 2I3AA 4N5LA 1KYQA 5THQA 1M66A 4ZRMA 4ZN6A 4JN6B 3O4RA 4J0FA 2CD9A 1NWCA 1IOLA 1O94A 3T7CA 1JTVA 4HY3A 3HZZA 5DF1A 4J6FA 4PFJA 4GX1A 1QV6A 3JD1A 4OQYA 2DT5A 4KUHA 3Q1LA 1FDVA 3ICPA 1EE9A 3RROA 3QVSA 4JNKA 1R66A 2H63A 1HYGA 4D42A 1H9AA 1Y5MA 2Z95A 2O3UA 2WYVA 3BAZA 3FNFA 5EPOA 3WTCA 4IINA 1KETA 2NSDA 4YT8A 3K8ZA 4CLOB 5JAIA 2X9GA 1EK5A 1NBOA 3JQ8A 1DFHA 1T25A 1VL6A 4TVBA 3GA0A 4XIJA 3WG9A 3RUCA 2EGGA 4B4VA 1E1KA 2X4GA 3GZNB 2QYSA 3BTVA 3QA9A 5F5NA 2BI7A 4O0LA 1J4AA 1ARZA 3NTOA 1BXGB 1YRLA 5GZ6A 2XOXA 3GMDA 4P4NA 1ONNA 3DXFA 2VWQA 2WSBA 1MFZA 3HDHA 1ZKMA 4URFA 1UXHA 2YJZA 1Q1NA 3CTMA 1QP8A 3INTA 2WD8A 1N9GA 2VUUA 1A5ZA 2DBVO 4Y98A 4R54A 4HP8A 5A3VA 3KO8A 3AOEC 2VTDA 3PYLA 2WDZA 1PEDA 3QSGA 4FFRA 1NHWA 2Q99A 4IPTA 3C7CB 4I1IA 3PEFA 3WGOA 1LQUA 2XAAA 1NTOA 1SCUA 1U3UA 5DBFA 3DBHB 4E4YA 1ZK3A 3WGYA 5CPFA 3GGGA 1QKIA 4ALNA 3COSA 3E48A 3SLKA 4B4WA 3L6EA 3U4DA 2CVOA 4FSHA 1PR3A 2W4QA 3WNVA 3TDKA 1SMKA 9LDTA 4Q3AA 1R0SA 1YDEA 3QP9A 3U0BA 5A03A 4OMUA 3QWAA 2DUUA 1P3DA 4B8WA 4CM4A 3ZWWA 3QRWA 4LISA 4YRBA 3EZYA 3KTDA 1LDGA 3ZI0A 2F00A 3M1AA 1C1DA 5U9CA 3IAHA 3ASVA 1ENOA 3AK4A 4A2CA 3QVXA 1NYTA 1W73A 4N5NA 5DDIP 2Q2VA 1EUZA 3DHNA 3PVZA 3NDJA 3BZUA 3MTGA 4IJVA 3VAZA 2ZTVA 1IL0A 3RFTA 1DSSG 5L4NA 1U4SA 3DZBA 4CM3A 3VZSA 1PS9A 3BMCB 4H7PA 3K2BA 1V35A 5JYFA 1E92A 3MJ4A 3RUHA 1ZEMA 3GUYA 1IYZA 3ROPA 1K6IA 4XIYA 1B3RA 2WD7B 3ICCA 4BNYA 2O3QA 3GZ4A 4YR9A 4QT0A 1DOHA 3FNHA 4OXKA 4RCVA 4GGOA 1BW9A 4RZHA 5DN9A 1EFLA 3UH1A 3UHAA 2E48A 5JS6A 4CQMD 5GZ1A 5KJFA 3VKUA 3TN7A 1P31A 3HG7A 3SX2A 4CQMA 3CSDA 1LLQA 5TSDA 1LRLA 3C1AA 1NR1A 1DIRA 1OAAA 2V7PA 1LJ8A 1JLLA 1DXYA 3NYWA 4II2A 4R68A 5IJZA 5KCZA 4WLNA 2HRBA 1JWAB 5JDCA 4M1QA 5HS6A 1DJQA 4NHEA 3GRPA 2GERA 2BI8A 1GEGA 4N18A 4W4TA 1U3TA 2AA3A 4E12A 4P4LA 4E0BA 4NFYA 1QYCA 1IY8A 4QO8A 3OFSA 1BWSA 1AUPA 4UEJA 4XQGA 5IN5A 3TPCA 3RBZA 4C7JA 4J4TA 2QQ5A 3GUCA 3UICA 1MLDA 4NH4A 1MA0A 4PZDA 2HDHA 1YL7A 1BXZA 1DRWA 1HE4A 3A9WA 2JD0A 5DULA 5ER6A 4RPKA 5EL0A 3VPXA 4AG3A 3E9MA 5TGDA 2B4QA 4CV2A 1U7TA 1M67A 4GMFA 2VWPA 1YS4A 4UEKA 4BMNA 3PWSA 1A71A 3VH1A 5LCXA 1PJCA 3PJDA 3ZU2A 4J90A 5L7TA 4H3VA 3DMTA 1Y6JA 1KY4A 3V2UA 4J2OA 2C54A 4BNMA 3JQEA 5M6DA 3E9QA 1XQ6A 1R0LA 1JU9A 1IHXA 1RKXA 4P4GA 3H9EO 1MFPA 4NFSA 2YHUA 2VHWA 3AJRA 3G1TA 4ONEA 4NJOA 1AE1A 1CQJA 3RI3A 2WMDA 5C37A 1HRDA 2G0TA 4KDFA 2P5YA 4BNXA 2EKLA 4D3FA 1D8AA 1H2HA 2RH4A 3GG9A 1X14A 4DLBA 1PL6A 2DTEA 1ADCA 4NBTA 5AQ1A 5H83A 1U7HA 1I10A 2FRDA 4EUEA 4BVAA 3QVTA 3G0OA 4L8VA 5GMOA 2B36A 3BHIA 3F46A 5JC1A 3GC6A 2PGDA 3FR8A 4O5OA 4G65A 4YAIA 4UUMA 3ONDA 2YQ5A 3FBTA 1P9LA 3WBBA 1C1XA 2BH9A 3QW2A 1FK8A 1YVEI 3GDOA 2E82A 4U7WA 1WMAA 1DC6A 5BNTA 4FDAA 4RPLA 4MINA 3W1VA 1T2EA 5F3RA 2EKPA 3JQ9C 4W9NA 4YAGA 8ADHA 1CDOA 5IAAA 2PH5A 3D1LA 4CM1A 3NT2A 3H3JA 4CM8B 3FTNA 4UVEA 1YKFA 4EUFA 5T8KC 3VPSA 1NFFA 4IS2A 1Q7CA 4DPKA 1N1GA 4A10A 2FSSA 3ANNA 2DVMA 4TMFA 3KYDA 3QHAA 3GMSA 4CR8A 3RFXA 3RIHA 4AJOA 2G82A 4BGVA 4DLAA 3D3WA 3OF2A 3OJOA 5A04A 5HRUA 4D43A 3DHEA 4I5FA 3SVTA 3C7AA 1XKQA 2GF2A 2X86A 4D46A 4BNIA 3NGXA 2D1YA 2BF7A 3EK2A 3ZW8A 1B26A 1YQXA 1P1JA 3IOYA 5IZCA 4E21A 4XWYA 4XYLA 1XDWA 1T1SA 3RJ9A 5CDGA 4DYVA 1A7AA 3PZBA 1Y5RA 5KIAA 1SB9A 4NK5A 4ALKA 4BNVA 3DAPA 4NIMA 2Y1CA 2PWZA 2O3TA 4U6QA 4UUPA 4PLFA 2CY0A 4RDHA 1E5LA 3U09A 5BQFA 4CQLB 2J3JA 5B37A 4RDIA 3U62A 4Z6KA 3PRJA 1ZJZA 1VPDA 1VI2A 3VTZA 2CUKA 3IC5A 3UAGA 2ZTLA 4OH1A 5EN4A 4YT2A 5LC1A 4KDEA 3U4IA 2CF6A 2P68A 4L4SA 1PX0A 4TROA 3V8BA 4XYBA 1S6YA 5CEJA 4BO5A 3IP3A 3WQQA 1PWZA 4X54A 3PQDA 3AM5A 2FHSA 1WVGA 4QX6A 4Q3BA 2XPCA 4DGSA 3JV7A 3A1NA 4M55A 2C82A 3I52A 4OYRA 3PHJA 1R4MB 4AL4A 3VZRA 1RM3A 5JYAA 4GH5A 1KC3A 5DBIA 3C8MA 1WZIA 2PV7A 1F12A 1OC2A 3JQGB 4G5HA 3ZGYA 3HFSA 3WDSA 4BKUA 4BQRA 2NWQA 5KVQA 1E7YA 1QYXA 1ZVMA 2FY8A 3NTRA 1K6XA 2ZK7A 1QLJA 2UYYA 3GLQA 1OI7A 1SPXA 4I08A 4CMEA 3NUGA 4L74A 2X0RA 4BMSA 4BNLA 3KZVA 1ADBA 4IGFA 1W0CA 1PGJA 4YAEA 3V5NA 3I1JA 4XEHA 3S2GA 3W8FA 3DBVO 3KM0A 4Z0PA 4RVGA 1ZJYA 2QRLA 3ABIA 3PZRA 1Y81A 2JFHA 3SJUA 1GQQA 4XRGA 1I5RA 4KOAA 2HMTA 3JSAA 4RVSA 5KWEA 4CMBA 5A9TA 4P8RA 1U3WA 2EP7A 3KBOA 1LSSA 4E2ZA 1F17A 4NBWA 4R51A 1I2CA 1W6UA 3ZZNA 1UXJA 2Y93A 2HAEA 2BFPA 4GKVA 3ROQA 4B7CA 1UXGA 1B0AA 5A05A 2Y66A 4R5MA 1Z82A 2ZJ0A 5I7EA 3RJ5A 2NV6A 1ML3A 4IDFA 4AJEA 1KEWA 1EDOA 4IZIA 4BQPA 4XDYA 3F1LA 2AW5A 2Q2WA 4BKOA 4DMLA 5EMHA 4MVJA 1UUFA 1PS8A 4WLVA 1GZ6A 2CVZA 1JVBA 1UZNA 3C7DB 2JD2A 4GAEA 3OQ1A 3PHHA 4CMAA 5K6AA 2EWMA 5ITWA 4ZU3A 3PJFA 4PZCA 4CM9A 4PLYA 3D7LA 3GPDG 2PR2A 3RKRA 1HDGO 2R00A 1ZMOA 2NVUA 2PD6A 1N7HA 4CJXA 3GAZA 1YJ8A 3ZWMA 1BDBA 1D1SA 3RD5A 2HK7A 3GY0A 4LW8A 2NVWA 1HDRA 2FR1A 1QYWA 2PA3A 2HO5A 4CL3A 3GNSA 2B4TO 3TRIA 4BMVA 4IQ8A 4D3SA 2FP4A 2V6GA 1V6AA 3GVPA 1P74A 2Q2QA 1N92A 4KMSA 3WYBA 1ISIA 1PJBA 2NU8A 3GDGA 1JA9A 3LF1A 5DZSA 4GKBA 2FOIA 4B8ZA 3RBVA 2A4KA 3F4LA 3RAJA 4LRTB 4BNUA 5JDIC 3GRKA 3MOIA 2J3IA 1YWGO 4AICA 5ITVA 4LCJA 4J1NA 5TF4A 2FR0A 1DPGA 3ZNOA 4C4OA 3SBOA 1HTBA 2JD1A 2OORA 4XDZA 3WXBA 3O9ZA 4MO2A 1M75A 3S2EA 2FPGA 3OECA 2GD1O 1HWYA 2VUSA 1FF9A 1OMOA 3WGIA 4OOEA 4EJ6A 4DMMA 1YGYA 1P33A 3UKOA 3WSVA 1ISGA 1ZFNA 4HNGA 1XU9A 4IMPA 4Q39A 4A27A 1LTHR 1KEPA 4R16A 3MEQA 4BNHA 1E7SA 3F6YA 4OIMA 3WJ7A 3CKYA 5G0TA 1LDBA 1Z6ZA 3OQBA 3O8QA 3WQSB 2RH8A 3AUAA 4Q3EA 4PIVA 1ADGA 1CJCA 1SBYA 3DB2A 3MJSA 5U1PA 3ZWYA 4RLHA 3QIVA 2IZZA 1KC1A 4B7XA 2I5PO 2VHVA 4AJPA 1FDTA 1M76A 2CFCA 5DP2A 2C7GA 1LUAA 4DIOA 3I23A 5AVOA 4E2XA 3ANMA 1W4ZA 4CLRB 5HA5A 3N7UA 1PZHA 4INAA 3RC9A 4FIZA 2AQ8A 4W82A 1EDZA 4BOYA 1VKOA 1QV7A 3WMXA 1DEHA 8LDHA 5I7SA 4YYZA 1QYDA 5F5LA 2WWRA 3M1LA 3NAQA 1E6WA 4FS3A 3PDUA 3RBXA 4BO2A 1Z74A 2W2KA 2X6TA 3ULKA 1DJNA 2Y99A 1E3EA 2F1KA 4BNNA 3OQ6A 4OKNA 2YY7A 1NFQA 1DDOA 4DBZA 4FD3A 2DC1A 4NU6A 1BRMA 2B83A 4S3MA 2I6TA 2IEDA 3K5PA 3OIGA 4Y9DA 4YRDA 3TL2A 4JBGA 4E13A 3DOOA 4JJFA 3PFWO 2AEFA 4LMRA 1WPQA 2I76A 4QEDA 3ZNQA 4IDDA 1GCOA 1BG6A 4ZJUA 4RVUA 2POQX 3FI9A 4ND1A 4J2HA 4W99A 4AJ2A 1EVIA 3GDFA 2NUAA 3ZWBA 4E5KA 2J8ZA 5JCXA 3F1KA 1XCBA 4PVDA 3GT0A 3IDSA 1PU2A 3WOHA 2CSUA 3DBLB 3V1TC 1PGOA 4MVJM 4BO6A 1N7GA 4RORA 2CVQA 3VKVA 1P0CA 1LI4A 1ADFA 3ITDA 2Z1NA 2D5CA 4CLXA 1EQUA 2XF8A 4XJSA 3AI2A 3HDJA 4IDCA 2FSVA 3EC7A 2B5VA 3C85A 4KTTE 3DR3A 2Z5LA 2AE1A 3L9WA 3AU9A 4JLWA 2Y68A 2AXQA 3AUUA 4TKMA 2FR8A 3K96A 3EGOA 3ETGA 2WJPA 1TVEA 4FC7A 4AJNA 3VZPA 3B1FA 1O95A 3FSRA 4WK6A 2PGLA 3GGPA 5IDYA 5CDYA 3PXXA 4JBHA 1PR9A 5A5FA 1B16A 3JQBC 4BGIA 1TEHA 2NTVA 2B35A 4LN1A 1I30A 5IFLA 4Z3KA 2V6MA 2OXIA 3GF4A 2GCGA 1QSGA 4RLSA 2JKVA 5HS4A 1S7CA 1ZSVA 3ONFA 4CM7A 1HEUA 3G17A 4XR4A 1NPDA 1LSJA 3P19A 2LDBA 1HXHA 4WLUA 3BMQB 3ZWOA 3A4VA 5C3MA 3OIFA 2G17A 2Y67A 5IZ4A 4BNWA 3DO5A 1A27A 4LK3A 2PK3A 3WLEA 1UXKA 4CMIB 2X5JO 1SEPA 2NACA 1EUDA 3F3SA 5JMWA 3U3XA 2GR9A 1GL3A 1SNYA 3DHYA 3OEYA 3OBBA 1LRKA 1GYRA 1TXGA 2EF1A 3QWIA 4JROA 3M2TA 4B79A 3PYMA 2JAPA 4WPGA 2ZB8A 3QV1A 3B1JA 1V0JA 1O89A 4E5YA 1RYDA 2C0CA 1ZUD1 2QRKA 2OZPA 1CWUA 2I67A 2CF5A 4N7RA 2ZTMA 4XGIA 4CUJA 4EJMA 3R0IA 4J4BA 4NFHA 4RV9A 1I3KA 2PD3A 2X8LA 1EFKA 5F1KA 4E30A 2ZCUA 1U5AA 3H9GA 2GPTA 3KYCA 3PIDA 3SXPA 1ZO8A 2Y1OA 4CQLA 3SLGA 1YBVA 4KP7A 1Q7GA 3VH2A 4JJGA 1ISFA 1ULSA 1N5DA 1V9LA 3H2SA 1M2WA 3WMWA 3ZN2A 3I5MA 4A03A 1XIVA 4GBJA 2C5AA 4RQUA 4WOKA 1C0LA 4F6LA 2NU6A 4CLDA 3D0OA 1GYQA 3IS3A 1GY8A 1LU9A 5JBIA 3ADPA 1PGNA 4ITUA 4QTZA 3S2IA 5B4TA 4TQGA 1KERA 3BMNB 5A9SA 4GSLA 2ZJ1A 2AMFA 3DBRA 1RWBA 2X9NA 2C2YA 1NVGA 4BKRA 3Q2IA 2VHZA 4J91A 3H7AA 3VH3A 4KQXA 1VSVA 1NAHA 4G81A 4A7PA 4BGUA 3PHIA 4O6VA 5CEEA 3VTFA 4ID9A 2EHDA 2IDZA 4YJFB 3MZ0A 3K6JA 5AYVA 1R37A 4DWVA 2DM6A 3UOGA 5B12A 4F3YA 2QX7A 1MXHA 1UJMA 2DBRA 2I9PA 1PWXA 2OGUA 3EZLA 3SC4A 2H6EA 1YH3A 3GPIA 4E2YA 3FPLA 4GX0A 3ST7A 1B8VA 1HSOA 3CPSA 3KEOA 4UVIA 4O63O 2UVDA 4FFLA 4DUPA 2Y1EA 3LLVA 2IZ0A 3B70A 1RM5A 5I9MA 1GUYA 3WTBA 5I7FA 4K26A 1UZLA 3I9JA 3BHMA 2VHYA 4PG8A 2EV9A 3T4XA 2VYNA 1HLDA 4HFRA 3ENKA 4BB5A 4IDBA 4OAQA 1Q7BA 5KKAA 2NLOA 3LT0A 3D4NA 3HNPA 1VLLA 3I6IA 1R4NA 3IKTA 4R69A 4DL9A 3V2GA 1Y8RB 2VWHA 5JDCC 3MJTA 3W6UA 5JY1A 1HETA 3A14A 1ZK0A 3D64A 4YJHA 2V65A 4WEOA 3R6DA 2P91A 1F0YA 4WJZA 1PJ3A 2G76A 1LRJA 3RC7A 1TI7A 4BO8A 2DFVA 2BKAA 4EYEA 3ZV4A 4QECA 1E1MA 2HMUA 2YHIB 1WMBA 4XA8A 5L40A 1K6JA 1XA0A 1CEQA 1BSVA 3OSUA 1H94A 2X1HA 3KSZO 1H0KA 1PZGA 2JFGA 3INRA 4MJLA 5CG1A 1OOEA 1E6UA 4BNTA 4LSWA 3E9NA 4DLLA 4PLWA 4CV1A 2VZ8A 1ZXBA 5FFFA 5ER9A 3H3FA 4JX8A 1ENYA 2UDPA 2EIHA 4AJ1A 2OMEA 5I9NA 5C7LO 3S8MA 3JYOA 4MP8A 2HMVA 1E3WA 4BS9A 3AUSA 4J4HA 4CMCA 2HJRA 1T2CA 3Q2KA 2FMUA 5JFOA 4PRKA 2AE2A 1ZXLA 2NU7A 5JMPA 3W8DA 3HHPA 3PLRA 3VPFA 1UH5A 3CMCO 1NQ5A 1SAYA 5JW6A 3LSYA 4M54A 4GLLA 4ZQEA 5G2OA 3PYXA 1P77A 2D0IA 1PL8A 4GWKA 5C7OO 2H5LA 3GEDA 3S55A 4MPDA 3WJAA 2G5CA 1Y7TA 2D4AA 3HN2A 1PQPA 4AFNA 3KSDO 2P4QA 4FGWA 1Q2XA 3F47A 3HN7A 4PG7A 3JQAD 3BHJA 3VOSA 1DFGA 5AXDA 1NPTO 3JQAA 4IGEA 5I9LA 1B2LA 4YACA 1Y8QA 2V6BA 4MIEA 1ZK2A 3JQFA 1RM0A 4JQCA 4AJJA 3X2FA 1E77A 3DTTA 3B1KA 1PZEA 1JN0A 3KVOA 3TFQA 4ZHSA 4BO1A 4Z9XA 3JQ7B 1PIWA 4W9NC 2J3KA 2J6IA 4CL8A 4U8GA 1MG5A 3P5SA 4E33A 2RBEA 3BIOA 2X23A 4J43A 3H5NA 5HWSA 2NTNA 1JKJA 1O8CA 2I3GA 1YONA 1YL6A 4FN4A 3FCOA 3HUDA 4TRRA 4UUNA 3ZNPA 2DQ4A 5G4KB 3W4JA 2QIOA 1U3VA 4ALMA 5G0VA 2YDYA 5A3JA 2GZ1A 3OEWA 1GUZA 1ZIDA 4J1QA 2A9FA 3ZU5A 2VT2A 2BFMA 2TMDA 1ENZA 4WCFB 1BTOA 4NPCA 4IXTA 2ZKLA 4DXHA 3T4EA 1FDUA 1ULUA
chains in the Genus database with same CATH superfamily
2VJNA 1E2JA 1GSIA 2PG3A 4B3GA 3NMUF 2QR3A 1UJNA 3C45A 3CUVA 1XZKA 2GBFA 2HKIA 3DVSX 4XYMA 1EGHA 2AF3C 1QOQB 3GLSA 3IIEA 4A2PA 4L22A 3CGWA 4ND5A 2G0NA 2RCNA 3HCNA 1E7MA 3ZW7A 1YXMA 1MRZA 4BGDA 1VLJA 3COPA 1GRRA 4GXTA 5NLLA 2F1RA 4R71A 5BORA 2X58A 2I6XA 4P38A 2PMBA 4QFDA 1LC0A 4EGAA 3THRA 2ESRA 4KREA 1V3VA 1PWEA 2PS1A 1IOVA 1R0CA 1U4OA 1X7ZA 3U4CA 3FNQA 2CE7A 4EHAA 4ZYTA 3JAWA 4NMMA 2EATA 2NG1A 1TEZA 2JBHA 5JALA 2D7JA 3KL4A 1QMGA 1MV8A 1E2NA 2PSSA 3ZHZA 4MVCA 3K20A 1OAKA 4GD3Q 3CKMA 3NFYA 1SZJG 4A0GA 2B94A 3HBAA 4Z2AA 2A94A 1O57A 2V96A 3WKBA 2P69A 4S1NA 3I9NA 2JGLA 1UDAA 3EN0A 4G0MA 1U99A 3LHIA 1OB2A 5HUQA 1USWA 2VF2A 4ZRNA 3WIUA 4LVCA 3E15A 1CF4A 4IQGA 4CMKA 3SR0A 3ODGA 3E3AA 4MYRA 4ZVVA 1T4CA 1UDBA 2PKRA 3D7KA 1TX4B 4ISCA 2Q0QA 5DTJA 4F8JA 5AVQA 1W25A 4HNQA 3AUKA 3HDQA 3VPHA 1X1TA 3WO0A 2H11A 1HNNA 3QOYA 3K71B 2X0FA 1HNXB 1DKPA 4DR7B 1TUGA 1B7GO 3IALA 3TWOA 1SHKA 4X8LA 1K0UA 4QU8A 1CZUA 3ZWPA 3NHUA 5LXTA 3FPHA 3K4QA 4N12A 4P4TA 1ESDA 3K8YA 3OE4A 4PCUA 5F33A 5CIYA 3KD2A 4IM7A 3R9WA 3CE6A 1V4NA 2XUGA 3VA7A 1K92A 4QRHA 4WCDA 4CMEC 2HGZA 5LQNA 3W5SA 5IVIA 1KP9A 3GYBA 5CNMA 5LN1A 1PNVA 2BJWA 2AD5A 5IX8A 1CYDA 3LK7A 4F3TA 4RV4A 2D7CA 4WV3A 3SR3A 3CZMA 2V7EA 3TI7A 1P1IA 2XMSA 2SKDA 1Z68A 2X14A 3FPFA 1F1BA 3IHLA 1Z0UA 3O3OB 4DV1B 1BDIA 3F7TA 4QHYA 2XBMA 3HGMA 4G1VA 2ZTSA 3BXGA 4YP0A 3O1HB 5HHTA 4L08A 3LY5A 5E7QA 1C7FA 1JHRA 2I6UA 2X40A 3LK6A 5BR7A 2C2HA 5IVHA 1M2FA 1U5CA 2R6JA 3AGQA 5FO0A 1BXRA 3NLLA 1PDWA 4KO3S 4S2UA 1X3SA 3P9PA 4JASB 3LT1A 1XV5A 2WKWA 4ZK2A 3IODA 1IHPA 1D2HA 1XR3A 3AQIA 4TYPA 4JEUA 3PQ5A 3JQPA 4OHCA 4I50B 3QX9A 5EESA 1XB2A 4WAUA 1RAIA 2ID7A 5TVGA 5TY0A 4EB3A 3IPRA 3SOPA 4GZ6A 3CZRA 2R68A 2HSGA 1L5RA 2H51A 2LBPA 4YT5A 1EESA 4R1MA 1JG3A 1W48A 1QJCA 1SXHA 3CH6A 4MAFA 4WI1A 4E32A 3VYUB 1UP7A 4CMGA 1SVNA 3BMQA 3TDMA 1NVWQ 5KYWB 2H18A 4YI3A 3AP1A 1QF6A 2FF7A 1KI6A 5CTAA 2OHOA 4QDUA 1MU0A 4WLEA 4HQ6A 4FZ5A 4X1OA 5BYBA 1Y5LA 1YQTA 1LS6A 4IIUA 4D7AA 4D79A 2R5NA 4MUNA 5CPBA 5D6NA 1ND6A 2GA8A 1EM8A 1CQIA 3ZU3A 2GSWA 4BQSA 3JAMA 4WKOA 3U9LA 4C3UA 3GROA 5T64A 3CYFA 3KAJA 2WVAA 4OMDA 5ENZA 4CNBA 5DCLA 2M1ZA 3H9UA 4WKBA 1BWPA 1OGJA 3HA7A 1N8TA 2R00C 1VSUA 2JJMA 2TMGA 3UW3A 1FSZA 1GTMA 2D8AA 4PAQA 2FWMX 1BW9B 3THYA 2G80A 4GE0A 1Y1RA 4MW6A 1DTWB 2WHPA 1YU9A 2ZAYA 2CKDA 2W48A 1Y6FA 4E15A 1JR3E 2DF8A 1MQAA 2VT3A 3SF8B 1KJ8A 4EFLA 1T10A 2VP4A 3MWFA 3SBDA 3ZOZA 3FYTA 3CUTA 1TMYA 3GZNA 3DEAA 4HZUA 1W5TA 3O8RA 1L4MA 3ASUA 2Q1XA 7MHTA 4C01A 3OQIB 1JENB 1GAWA 4W7IA 1JG6A 2EF0A 3H5AA 4BN5A 1LV7A 2WTBA 2B69A 5IBCA 1ZHFA 2FH5B 3FPEA 2X77A 2NYVA 5JAUA 1QFZA 1MO3A 5JPIA 2YV3A 4JSYA 2RBGA 3ILXA 3ZDFA 1GPLA 4M1SA 2EXXA 2A1TR 2F3UA 4JVLA 4RPHA 4X8OA 5A4FS 1VYTA 4MR8A 3MAJA 3P2EA 5DK4A 1X9GA 2R65A 3SK0A 2HWWA 3A3KA 2QP3A 2ONZA 2JEYA 3IQDB 1Q21A 4G0OA 2LRHA 3UGKA 1J1IA 3KQKA 4R0NA 1J20A 1TQ6A 1UQRA 2VHUA 5JNWA 3FHLA 3HU3A 4RMNA 2CCKA 2X7HA 5THXA 3U3DA 3EVFA 4I1VA 4JGIA 4LAFA 2Z4TA 2CXPA 1EGMB 2X7JA 3FFTA 5A6SA 3RVPA 5C32A 3LE8A 1W59A 2RCYA 4E07A 3QGMA 3M9WA 1MC4A 4LIPD 1Q74A 4M88A 5AUOB 1AKNA 5ALJA 1TM4E 3WJ2A 2AGVA 3VFDA 3WQRA 2IYZA 3NTXA 2PUVA 3D59A 3TLXA 1Z73A 3IAS6 3AFOA 4LJKA 2ZUCA 5GY7A 2VAWA 4PSVA 5IDXA 1GADO 3N8NA 5ILGA 3HM2A 3I2HA 4RWZA 4KFRA 4YCAA 1I6WA 3BC1A 5LYYA 3PXCX 1ZMBA 4MPRA 4PC2A 1GNRA 4BC0A 4MQFB 2EEZA 2ZQZA 1J2YA 1EE2A 1RQNA 5EJ7A 1GN9A 1HRKA 3CJTA 3UN1A 4ZYXA 2AJDA 4IJ5A 5LZ7A 3UXHA 3DAYA 4P7GA 4JENA 3WZLA 3ZHOA 1WXFA 5FPYA 5C18A 3NRCA 4JI1B 3RT1A 3BHNA 1G2QA 3PHGA 4MS3A 1FRNA 1RTTA 4D96A 4LJRA 3I73A 5TQ0A 3EDOA 3IT1A 4OD0A 4MWZA 2OO5C 4EFKA 4LGYA 1XDDA 4OHVA 4R1TA 2ADFA 4FYVA 1JHPA 2VTBB 1WXDA 4RL6A 3MSCA 5EE0A 4MKZA 1N0UA 1Z2DA 5COAA 3RIEA 4LF4B 1KNXA 4GR9A 1NVUQ 3IXLA 3AVPA 1OWPA 4J8PA 3AG5A 1IZ0A 3ZCQA 3K0BA 4MWDA 5DOZA 1QAOA 2BFOA 3LF2A 3KALA 1TM7E 4DREA 1XVTA 4H31A 1L4YA 1R18A 2NQ8A 2PGNA 1B23P 3DUFB 4D5EA 1OASA 1XQ1A 4PLPA 1EBFA 2P9FA 3CC8A 3RC8A 2WWTA 1SOWA 4IRUB 1TLTA 2QRZA 3E1KA 1W1IA 2X0JA 4N8SA 1A82A 1R50A 2IJGX 2W83A 3Q9UA 3W8NA 2MYTA 4IS3A 3S1LA 4Q93A 1JIUA 2A9VA 1KYTA 3F74A 3UJ7A 4H6XA 4P3KA 3ZCXA 2QD2A 4ZOLA 3ZWCA 1RKVA 5K8UA 4QAJA 4YRDA 1OHHD 4AYTA 3OHPA 1CETA 3DR5A 1T8WA 1XEWY 4XUCA 3EP7B 4DYDA 2GB4A 3ZZ0A 1FLNA 1DAIA 2O23A 1U1FA 3C8UA 4FT4A 4OA8A 4UUQA 4JCOA 4DIUA 3T38A 4XX0A 1M1UA 1NLFA 5CLGA 1LZLA 2IELA 3KYDB 3C1OA 2I7CA 1A9YA 2GBCA 2ABWA 5I9SA 4LXTA 2IEZA 5C3UA 4BP9A 5KNCH 4DM3A 2VUIB 3FWNA 2PE5A 3CMMA 3CNQS 3ZHCA 2JGKA 1NRXA 4AMVA 5J1SB 1FJ2A 4FLMA 1NV8A 2CBXA 4OUDB 5CCBA 2FQQA 3HI4A 3O95A 3JWPA 3OJ0A 4Z53A 1AZTA 4PLVA 4D1YA 3MWDB 1FP2A 4NVRA 1XQXA 1YR9A 2ZP1A 1YS9A 4ESOA 3WIOA 1SBNE 1T2DA 4K9DA 5C51B 4C7KA 1ZN9A 5JHGB 1ZPDA 1JIIA 4M86A 4PHHA 3QE2A 3TTYA 4JJ7A 4NMHA 3QQ5A 1PJTA 4QTXA 4BLSA 2FSVC 3EAGA 2W22A 5AOCA 2A7QA 3RHSA 5JXIA 3KXDA 2JGMA 2QZZA 3X1YA 3D54D 1QXSA 5ANRB 3OOJA 2F4NA 2WHXA 5EXXA 2R6DA 4OM8A 1KFJB 3DZIA 4WLOA 1MJGA 4K1XA 3HVIA 3IUQA 1VE5A 4NZNA 1QRAA 1D2MA 1CY1A 1E7WA 2Q45A 1U8CB 2FR8C 3WGNA 1M1ZA 2J5XA 1G17A 1HKUA 2AV6A 2AX4A 3OCVA 1WZEA 2ST1A 3R23A 4PE5B 4TRMA 4HG2A 2Z0MA 3I6YA 5JQWA 3AFMA 1E59A 1T3ZA 6GPBA 2XUPA 4F5DA 1E3TA 2BTQB 1G9XA 5IJAA 4Y1RB 2PYIA 2DFTA 3OPQA 5TJ9A 4C87A 4KR7A 2JS7A 1IWBB 3OG9A 4MUBA 4ZAXA 2RIRA 5JI2E 3ZWAA 3RSZA 4BE7B 4C3OB 4DZRA 5K0BA 2WU0A 2VJLA 4MUIA 4WA7A 1V1RA 2IH5A 3BBPA 1FVOA 3C5VA 3LY8A 3LY7A 1F48A 1U28A 2O7SA 4Q7KA 4RZSA 5BUQA 1GUDA 3GV0A 3QVMA 1M6VA 5DTEA 4DQUA 5H3HA 2X15A 5E4FA 5JAHA 4RNDB 3E18A 1Y0BA 2ZDGA 4FCCA 3GARA 3WKDA 5JSQA 4BBJA 5BWLA 4PYKA 5AJXA 4DSNA 6NULA 3HP7A 1HT3A 3K8OE 2W2LA 3H8SA 4MUGA 1FVHA 1S3IA 4IMRA 1TRKA 4V1CB 3DFZA 2OQ2A 1S1CA 1YQDA 3HSKA 3NTQA 5IT4A 3KTAB 3TIFA 4EVRA 3TLCA 2OO7A 5DYWA 5LKRA 2GZMA 3UGTA 1E61A 1T4DA 2O2EA 4INPA 3HO6A 4JR1A 3UWSA 3L1JA 5E3HA 1OTHA 4P7KA 2I65A 2QW1A 2CNNA 3BXOA 3WGQA 1BU5A 2GWRA 3C7KA 2C2XA 3BDVA 3KJQA 4JJIA 4QXRA 4HDNB 4TSKA 4YCCA 1LW7A 4CM8A 4P98A 2H1HA 4E31A 1U2GA 1NURA 2PDAA 1EKXA 1YE5A 3BXPA 3GWGA 2VHEA 1JJ7A 3QXCA 4W8GA 1OC4A 1MABA 3W5JA 4ZVMA 4PAWA 2IP1A 1CY2A 1UDCA 1XDZA 2L0XA 2O4CA 1AGNA 2VTKA 1KEUA 1X7WA 2PKYX 4L75A 5ALRA 5A0TA 1G5QA 1WDLA 4ZQHA 4MX8A 1SELA 4HT3B 1U7XA 5L53A 3LCRA 3ANYB 5IF3A 2GO1A 2QKYA 3FNGA 4OB8A 4F7DA 4DHEA 4C7XA 3C3MA 4YQYA 2X5OA 3E6AA 1Z45A 3DE2X 3GJ3A 4D45A 5FX2A 4B6JA 2BN4A 3CPHA 5KVVA 3ZDZB 1CUXA 1VP9A 3U0VA 3OCUA 1XHEA 2G08A 2VDKB 3RSHA 3JALB 4HB3A 1QCCA 2YX1A 4DKJA 2CV2A 4TZKA 1DV1A 3T3EA 5EPEA 4LV6A 4P54A 3FYHA 3K9NA 4MHTA 2FB9A 2Q1TA 2Q8PA 4JKOA 2P9CA 3FNIA 3NHFA 5E8RA 2BFBB 3CISA 3T7EA 4NEHB 5A4KA 2GAFA 4JP8A 3O8OA 4HNHA 2X4DA 1JG4A 3HQ4O 3PFGA 3QQPA 3HLKA 3QY9A 5AUQA 3U3KA 1LLCA 3R76A 1IPEA 2EFYA 3I61A 3BK7A 1XKXA 2R7LA 2HQ1A 2NZJA 5JMTA 2JW5A 3I8SA 3M34A 2ONJA 3HM9A 2G4CA 5TT1A 1KEEB 3Q3JB 4NCXA 2D4HA 1Z5UA 2XWJI 3F0TA 2IC5A 3WRWA 5LOVA 1HT0A 3PR1A 3TVYA 3PEVA 4F4UA 2UYGA 2J3QA 1T2FA 3CA8A 3GLKA 1UOPA 2Q0HA 4K81B 2E4ZA 1I7LA 4WBSA 1LX6A 4CNQA 4INZA 5ALHA 1AXGA 4URZR 3OX4A 4TRJA 1U1DA 1GPJA 4DVGA 4B7AA 2PS0A 2ZJBA 2ZIWB 4GW3A 5CNIA 3TEJA 1JA1A 1RJWA 1PT9A 1YCHA 2FUEA 2N47A 3A6EA 1GV1A 3AB8A 2R751 3RS0A 3NYIA 4HX5A 3IKJA 1N3BA 3UMSA 1PNRA 1HGXA 3TUXA 4N39A 4DNXA 2RGRA 1UBCA 1HDZA 3LP8A 4HDMA 5AQEA 5FI1B 2ATCA 4PYQA 3MT7A 3NNSA 3PHCA 1UXIA 2JJ1A 3WLLA 3TF5A 2VDUE 2WINI 1X15A 3P9YA 4QYWA 3TB6A 1JAZA 4AMUA 1G55A 3FCUB 4ZQBA 5F21A 1SHZA 3OH8A 1A50B 3DT8A 4KW7A 3IERA 3T8YA 2ZB4A 3PCRB 3EDQA 3ZWKA 4Q48A 4DQXA 1PFYA 3LRTA 2VNAA 4NMLA 4E5SA 1EQAA 3AI7A 2ODAA 1QHYA 3L04A 1LBHA 4HD8A 2PSHA 2WTMA 3IP5A 4ETNA 4P81A 2H1VA 3UV6A 1Q7RA 3BZWA 4Q4AA 3EGIA 3FOEC 1CRZA 4JH0A 4K1LA 1DBVO 4P36A 5HIKA 1E79D 2FZ4A 3HMQA 4I0WB 1HFEL 5GGYA 2BGJA 4B5LA 5TF4A 4EHFA 3AOEA 1E79A 1H4SA 3IVXA 3TG2A 1ZG3A 2GXUA 1NQXA 2BEWA 3D8SA 2ZYUX 2FFHA 3LZDA 4OFXA 4KR2A 1JHOA 2DP4E 1K4YA 3IXQA 3N3BC 4BGEA 4TGLA 3IX7A 2E49A 3QTBA 2JA1A 4XJVA 3SYRA 3VYSB 5CG2A 5JVDA 4UQOA 3GOQA 1RRMA 2YDXA 2ZB3A 5EC8A 5T67A 4FQ8A 3NHWA 2H2HA 3H16A 4DLYA 4C04A 3JD3A 1ZD2P 5INTA 1F8FA 2QLNA 2BP7B 1JG2A 2GVNA 1T6ZA 2QIPA 4II7A 2QOEA 3INYA 3ZJTA 1RD4A 1Z26A 2WUGA 1Z5GA 3H0CA 3K32A 4C0WA 4G1FA 5IP5A 1BKYA 1FMTA 1R9MA 1VB3A 1OJLA 2Q8QA 2XD4A 4LQDA 3VYTB 4C21A 2IE0A 4EKNB 1I6LA 4NSNA 3OJLA 2QD5A 1TU0A 3GUUA 3R0QA 3QPAA 1ZU5A 2PGXA 4L9AA 3A6DA 3M6IA 3L7YA 4KR0A 1G8FA 3NEYA 3RK1A 1V6SA 1SQSA 1W4RA 5C4IA 1DRVA 3I45A 4FFOA 3DWFA 3E5HA 5D3ZA 5AJUA 5BMVA 1Z8HA 2Z09A 1Z47A 2OCIA 4XR9A 1QB7A 2Q5QA 3T0FA 5CFLA 1ZOPA 4U02A 5HSGA 1JAIA 1XDUA 4RHEA 1V8FA 4EKIA 4Q7QA 3ND8A 1JHQA 3GFSA 3QYAA 3EZGA 2OP0A 3IV6A 1G1AA 2PYZA 1NNI1 1KDTA 2QVYX 4EZIA 2XE4A 3N5KA 4FXPA 2WIDA 1ILWA 3MC1A 4MCHA 3WYDA 4MV4A 4Y1GA 5AVXA 5LJLA 2CDAA 3FPBA 5C4GB 2ZUEA 4NYJR 3F5MA 4RKFA 3FIUA 1Z3CA 3AUFA 1E18A 2OFFA 1PT6A 2CUNA 5CA1B 1FMFA 5SZJA 5FH9A 4L5BA 3IIMA 3IH5A 4E2FA 2P2SA 5AJWA 1R1DA 1JDVA 1RQ2A 3GLUA 2E4UA 3WWYA 1MPTA 1BC5A 1TO6A 5ALEA 5BXQC 1B1CA 5ERGB 3BTSA 4DJFC 5DJ5A 1BH6A 1UM9B 3BKWA 1TYZA 1LC3A 2ZU0C 1WP4A 2JGDA 1YL5A 1E62A 1MC5A 1Q1QA 1ZVKA 2C03A 4CZ2A 1OT3A 1CVLA 1GTZA 4BPBA 4FFWA 1E1YA 4NECA 5C5IA 1D1QA 1I36A 1JQ3A 3I2KA 4ZICA 2JHAA 4DXAA 1XWFA 5I5EA 5CVTA 1R6TA 1DAGA 5HIAA 4YTEA 3UWMA 3N2LA 1JKIA 16PKA 4EO7A 1LXCA 2F8MA 5IM4A 2A67A 3B78A 1NSFA 3HADA 2ZBRA 3VI4B 2IYXA 4LG1A 4Y9UA 3MQ4A 3LQFA 4Q3NA 3VVBA 1Y3DE 1A88A 2AZDA 4GRAA 1Y9AA 2XVMA 4AZVA 1QG4A 2P0AA 2I3ZA 2QS9A 3K5WA 3PXAA 4WE3A 1O9BA 4IICA 2XWBF 4O25A 2GTPA 1UOOA 4TRNA 4IKEA 2IUUA 1T9AA 2X2PA 4QUKA 3WB9A 5CT6A 3NWOA 1DKQA 4WNCA 3X1KA 3ESRA 1DIAA 2J4CA 1Z2PX 1NNEA 3NHRA 3BFJA 4CUZA 1ZOSA 4JYMA 5AKZA 2QG9A 2PSFA 1I2AA 3MIZA 5EVCA 4WIAA 3DDUA 4FYJA 4J0DA 4Y6OA 4MRNA 1VLQA 3WNZA 4DADA 1KR5A 1MX5A 3B12A 3NI2A 4PC3A 3NONA 2IDKA 1B8UA 5FUVA 3MJCA 3OOEA 4BE4A 1PVOA 4GDFA 5K3BA 3IOEA 4MUXA 1NHGA 4GFDA 1SEVA 2BHNA 1TAUA 4LDQA 1T36A 4ZVOA 4GZ3A 3NC1C 3QU4A 2FPPA 3GI1A 3ECSA 3G0BA 4NCNA 3EFOA 3FNBA 2JI7A 3RLFA 5B4VA 2ATEA 1PW7A 3UBMA 5AXCA 5JCOC 2GAOA 3R5SA 3ESAA 1QRRA 1KPGA 5C8YB 4TKUA 2OBYA 2AWNA 1LCIA 2R6FA 1RHMA 4QPJC 3CNOA 1GL9B 3CUYA 4LK2A 4TXHA 5B36A 3ZV3A 1RLTA 3FUUA 5CGZA 4W8HA 3J81k 1JDJA 1ND5A 1WHSB 4ZVNA 3NB0A 1FQKA 4UJ3A 2H0RA 1PGPA 1VBFA 2BD0A 2G8LA 5JZOA 3U7GA 4P80A 1K98A 1YB5A 4KXYA 5FTNA 2PL3A 1J21A 1OFIA 4PLGA 2WIBA 1G8PA 1TM1E 1NFRA 1AB5A 1TT7A 3WYGA 2XLCA 3WBKA 2ZEJA 2ECFA 5FI3A 5EHXA 3DDSA 4IOJA 2QAJA 1CR0A 4P31A 1YBHA 2WWWA 3TNJA 4IDPA 5J2TB 2XUAA 5JQGA 4M0CA 2D2VA 4Z49A 3HBFA 1P2UA 1EX6A 3TZHA 2QRJA 3BGOS 5FO1A 3KXKA 3DVLA 1Z0AA 5CXUA 2IXDA 3RS3A 1SG9A 3R8CA 4KRYA 1QONA 3A1DA 3HNRA 5JO0A 3IQEA 5EWJA 1VLMA 1X1RA 3TD9A 3TCNA 3WLPA 4Y6GB 3TL3A 2G7MC 4NYMR 1L7EA 2ORVA 3EZFA 1SH7A 4BO9A 5LDDC 1FCJA 2YW9A 1RRFA 4B83A 2FEWB 4JQYA 2FYTA 4DTCA 5E2IA 5IDWA 4TV9B 3O26A 1XLWA 4PW0A 4OGFA 5E9QA 4E6EA 4AMYA 1BHJA 1DAPA 1A9RA 2JANA 2H3HA 4GM4A 3M5DA 2H57A 4RSRA 3PF8A 4AF8A 3AEKB 1JP7A 5HKAA 2EGHA 4B9AA 3LT5A 3I42A 4Y2JA 2ES4A 5DK6A 4ITRC 4X64B 4E7PA 4WGGA 5LQAA 1LF0A 2EBUA 4G5XA 4MUKA 4XGNA 1RHKA 2UVQA 3R6WA 2V1XA 4IYJA 3UWKA 5AKLA 5ALLA 5KWIA 3T54A 4YS6A 3VR6A 3G5LA 3KB1A 4YLGA 2IOFK 2WT4A 4FB5A 1RCUA 3M49A 2YVUA 3QW4B 4GVXA 3TCXB 1OJ7A 4Q4HB 1Y9JA 3UTDA 3R6GA 1O1YA 2IY8A 2RK3A 1XTBA 2XYHA 3B1XA 4UAGA 3TZLA 4CKEB 2HBZA 1X7HA 1E2BA 5E2BA 4NESA 5F2KA 5GJWC 3KV1A 1X1BA 1BDJA 2UKDA 1HTWA 2KW5A 2MSNA 2Z1MA 5DYYA 5BN4B 3F8WA 3SXUA 1R5OA 2PZBA 4CIDA 3PRYA 1QHGA 2B6NA 2HRRA 3G8CA 1I2BA 4J1TC 4WKCA 1GUFA 1GGFA 3NORA 3Q8MA 2BHRA 5C53B 2H17A 3ILHA 4FJ2A 2HU5A 3LVFO 2JAUA 2WYWA 4X66B 3H4MA 2VP3A 3I53A 4UUOA 1VDMA 3VR4H 5BSGA 3HO1A 1GPWB 4ALIA 2XT9A 4BBAA 4LXIA 1KI2A 3RT9A 3GG2A 3L7MA 3SEFA 2YV4A 3DBRB 5IAKA 1Z0SA 2CK3D 1M0TA 3PPWA 2PRKA 2OGTA 4F11A 1UINA 3TS1A 2CK3A 4XARA 3HP1A 2X8BA 2EW2A 4DT1A 3D4PA 4ZIRA 5AI9A 3NP7A 2JGEA 4IHAA 4PYOA 5JPCA 3QE9Y 5HBGA 2I8CA 5KJEA 1A96A 3WV4A 3EP9B 1X0VA 2AUMA 2XAUA 2UAGA 3I83A 3TZCA 1WQ1R 4B44A 1FDWA 4CM4B 5CTJA 1ANKA 2NM0A 3VZDA 3V4PB 5EZYA 4NG4A 1DOAA 3D02A 4GSYA 3EWIA 1Y4DE 1FTNA 4C0QC 5E1MA 1GA4A 2R8RA 2O0MA 2P75A 3CEPB 5JJCA 1I4WA 4JR0A 3BTUA 4JS0A 4L5IA 2BBTA 5IARA 5CJ2A 2O5EA 2NUPA 2W90A 3ETNA 5FUXA 4DIBA 1UAGA 3HB0A 1N2CB 2NO1A 1KDYA 4Q4JA 3MMSA 1CR4A 2QI9C 2C98A 1LZKA 3AYXB 4JP2A 3LDGA 3ZKWB 4XE5A 4DEYA 4OOFA 5CRIA 4UPEA 4MQ4A 2X0NA 2W58A 1SQFA 3VJMA 1QK3A 1OE0A 1YR3A 3AVQA 3FAZA 3ZPXA 2GZHA 4CDRA 1O4VA 4OQPA 4V3CA 5I8ZA 3P0RA 1RKQA 4JU9A 5K8IA 3IQHX 2IXBA 1GPNA 1YRBA 2QU8A 3ZLTA 5EINA 4KTVE 4ZCIA 1MX3A 3BXEA 2B1RA 5F78A 3U3ZA 3AIKA 1UBOS 3DMFA 4EFDA 4X1KA 1CJKC 1KS9A 3FZYA 1I80A 2D2EA 1Y37A 4QOGA 3W6OA 3GJYA 3O1IC 1WEHA 5EXPA 3B48A 4D4JA 5T7BA 2ACWA 5K3OA 5TIIA 1QYIA 2LZ0A 1R4NB 2Z9DA 1PEAA 1N5RA 3EXFA 4Q3DA 1QGED 3NWPA 3K31A 4KWTA 1OAOA 4WKGA 3Q9SA 3QG5A 2B4RO 4ZOBA 4D2IA 4DB2A 3EJ6A 2I91A 3F90A 3GJ5A 1E3IA 4KLNA 4MIYA 2J9ZB 2EG9A 4OQ4A 3KAPA 1J07A 1PL7A 5DFAA 3RVDA 5DM0A 1AOXA 5AHKA 3NDRA 4M8SA 4FGKA 4I4TF 5I7WA 3D7RA 1RRGA 1COWD 2ZIXA 3R3SA 2O54A 3TYXA 4I14A 1P80A 3RVSA 2CLIB 1COWA 5FA8A 2VYVD 3VRHA 1APBA 4B3TB 2J1LA 4DXDA 1R8QA 5CDUA 4QM6A 2VYVA 2PAFA 3GHHA 3KHUA 4WMLA 3LPLA 3OWXA 4EJ0A 2QROA 2AEJA 1QFJA 2XUFA 4F2WA 2FAXA 1TA9A 2D2FA 4BLQA 1GR0A 4G85A 1CUEA 3UAZA 3UOWA 3WR5A 3HXLA 3ORQA 3I1YA 4FWTA 1E2MA 5FT9A 3V1MA 3IUSA 2CNDA 4DARA 2OZVA 4KQIA 1J49A 1KVQA 4RELA 3SEAA 3BN3A 4ZZ2A 3JRXA 5BOVA 3AEUA 1YDHA 1SG6A 1UZUA 2JLAA 2NIPA 2C4TA 3BMNA 3B2EA 4GM1A 2B3DA 1HQCA 1O08A 3PP8A 4KGVA 3WWZA 2PM8A 5K8VA 3FPSA 1E3WB 3IQIX 1P75A 4HDAA 3TIIA 1I0ZA 3ED1A 4MDFA 3EUEA 5JTTA 1MB4A 1S9HA 2NZ8A 2Z2KA 3JRNA 4IKOA 5FJIA 5K3FB 2QTHA 4AY4A 3D5EA 4BNKA 4Z0TA 5B6IA 1YBFA 2VCHA 3IBSA 5HBRA 5A9RA 5BSMA 1V71A 2B3TA 3M9XA 3HU5A 4HDCA 1H9BA 3BJRA 3HA2A 3NDPA 2A5GA 3NQ41 4OEHA 4CG1A 5KQRA 3VJRA 1X7YB 1XVUA 2J0UA 2QJFA 5C5EA 2XB6A 3L79A 2H5JA 1M2OB 1UDWA 5HCNA 1JRLA 5TS2A 2XCRB 4HTFB 3KQOA 4MQUA 4NZPA 4JYCA 4X6UA 1RP7A 3WK4A 1LJLA 1N6KA 3I2JA 1KK1A 3OQPA 1XTKA 5GJBA 4JXKA 1XZHA 4FPXA 5CXQA 3O2QB 4J0QA 2C07A 5LJIA 3H9CA 1EVYA 3TNFA 2FQWA 2XITA 5JDIA 1KZHA 3LC2O 2WWHA 3RAPR 3L49A 4K9KA 2QG4A 1S2LA 5G3ZA 2CT8A 5LUAA 3HL4A 1GCIA 3KLBA 3RTCA 3ROXA 2D54A 2VPTA 1BE6A 1QH1B 3EHEA 4JLVA 4RF2A 1YJBA 1IQPA 2QW0X 4R8LA 3SCZA 5DTMA 3P2OA 2OLEA 3GGOA 1EWKA 2EL7A 3HFGA 3F7NA 3LVQE 2HJ9A 1L4NA 3OD1A 2DG2A 3P27A 1YKGA 3H83A 2Q7XA 2IK8A 3PENA 4MB0A 2FWNA 3DH0A 3EQZA 3EQ9A 1P0FA 1KAHA 3ZV5A 5LQRA 3N0WA 3QK7A 4MUHA 3S8YA 1A5AB 2AI1A 4GI1A 3ZEAA 4EMSA 3E4DA 3OMWA 3UXYA 4G0QA 5C0OE 5BY2A 3FW1A 1JB9A 2D59A 1Q17A 1GXSB 2DBQA 4B3IA 1RWNA 1KA9H 4IWYA 4H9GA 3UM9A 3N1UA 4KFSA 3ZGNA 1SXJD 7REQB 3K35A 4ZCPA 2OXTA 1WXGA 5JWOA 5EHNA 4IR7A 1SXJA 1VHDA 2BLLA 2JHPA 4IQFA 1OVGA 4U9IS 4C5AA 2GK3A 2P9JA 3QWBA 1J0XO 3OZCA 2A78A 1ITZA 3TRDA 3UMGA 3W05A 4YDHB 2HXSA 3U7JA 3HJUA 1YC2A 4D82A 5CFNA 3OZWA 4OGLA 1K3TA 4HL6A 3ZE0B 3B6JA 5B30A 1ZCJA 4R2WA 1LS1A 1NUTA 3R20A 5TRTA 2CMFA 2ORIA 1A76A 1L4LA 3WYAA 1CF2O 4CG2A 1CUIA 1FB5A 3T6KA 1ATZA 3L4BC 1HORA 4WJLA 5L4SA 2CLOB 1JS1X 1K8YB 3R44A 4US1R 3CWZA 4ND3A 3TMAA 1PO7A 3BG5A 1BX0A 1ODLA 4V0LA 4YDRA 4IHKA 2Y71A 4G4GA 4N5HX 3MD0A 3O38A 5BN1A 3KELA 3UVEA 1P1BA 1QG6A 1CB0A 3R0ZA 4MV6A 1UBKS 2QYOA 4PG5A 3NKLA 5ALZA 1A2QA 1X7ZB 2Q4BA 2JEOA 2Q5FA 2ZYRA 1CNEA 3MGKA 1NQUA 4P5PA 5AW3A 1K2WA 1L7BA 4FUQA 2HIHA 4FONA 4TMVA 2HSDA 4WADA 4V0ME 1P1FA 4WDRA 3T7SA 1LGYA 3WMEA 1WMSA 3JQRA 1CY4A 5T6BA 4DCMA 1RXVA 2Z5FA 1CXZA 1RPTA 2I66A 5L3ZA 3WSTA 4UDXX 3EZ6A 2Q2NA 1HR0B 1YIAA 4PSDA 3NTLA 3MTQA 2KYRA 3G59A 5LNK6 1CUHA 1N2OA 3IEVA 1YZTA 1FYDA 4OXIA 2YHAA 3TOXA 3ZCPA 4ESHA 5JXHA 1OILA 2P2LA 4G1UC 1FBTA 4BYMA 2EVWX 4JOCA 4UDYX 3LBHA 3SLRA 2RJNA 3ENNA 5JANA 4ZT4A 1T8RA 2OV1A 2SBTA 3KZCA 1AKWA 2R86A 3AVYA 1YKSA 3AUJB 1T4CB 3HFRA 1FS4A 1TQ8A 3FWZA 4OY3A 5DBGA 4EGJA 5HRAA 3M6AA 4GRIA 3EEOA 3CVYA 4D4HA 5H8WA 3C6ZA 4XPIA 1TU3A 4EARA 4CIYA 1H2AS 1H6CA 4LVUA 3HTXA 2O2YA 3DGFC 1M72A 3E81A 5CDFA 1HE5A 1YE3A 3OA2A 5AKJA 2OAP1 4OYLA 2E1PA 1N2CE 7ADHA 3QVWA 2A0WA 3SM9A 4XRRA 1ISRA 3OZVA 1TK9A 4GVPA 4EY5A 2QSUA 3AO0B 4BZQA 2BHLA 2F7SA 4NJMA 2MR5A 4JU8A 4LBWA 3ROGA 1B6RA 3H5RA 1AKTA 4ZGBA 3HCWA 4P3PA 4FK8A 4QDOA 4N01A 2ET6A 3O4VA 2NO5A 3FVTA 4R1OA 5AVVA 1EFVA 3OC0A 1EX9A 1GL7A 3NBQA 2W42A 1U80A 4X93A 5G4KA 3LRPA 1FFXA 2PKCA 1WM1A 4KUGA 4EATA 4EH1A 3GN2A 5B7QA 2I4OA 5L9AA 3S5JA 4WY2A 3RC2A 4WEQA 2OK8A 2BRUA 4YGXB 1BXRB 1ISPA 3KKKA 2XNKA 3FZQA 2X5XA 4G63A 2X76A 3GH3A 4MUJA 3RUIA 5I9BA 3RKUA 4A6XA 2ISCA 5L6LB 1ODCA 1HYEA 1Y82A 4K6CA 4X20A 4AUMA 3K9CA 2ZIVB 1X0XA 3WKCA 5BWBA 2Q5EA 2W8ZA 3FDXA 3H99A 1ECFA 1II0A 1UXOA 4JIGA 1EWRA 5AI5A 1Z6GA 3CVVA 4EG1A 3JQBA 1SBQA 1TQ4A 2A59A 4ZCRA 4BU0A 4B43A 4DJEC 3HH8A 1HDOA 1XEFA 2UUOA 1MGOA 3N2EA 4BO4A 1M2VA 1JBEA 5CVDA 3SX4A 3NASA 4GP7A 5J23A 3UBTA 3I5UA 3MJHA 3IAM6 2QP9X 4QODA 1KI6B 2Y2UA 1D2RA 2V7TA 4LV8B 4PRZA 4YRQA 4ZN6A 1I2MA 4JUFA 2WSSD 3L6BA 3T41A 4EUKA 5AVRA 1O2DA 2AHOA 3T7CA 1EM8B 1CQIB 4EPTA 3KB8A 1ULTA 5DF1A 4YX9A 2RGDA 4DNQA 1IJKA 1LTKA 1QS0A 3ETJA 1QIMA 2FWPA 1I4OA 3Q8XB 3BICA 5B1EA 2NO7A 3EPBB 2FJUA 4JNKA 3SIXA 3T52A 4D42A 2VQEB 2CFTA 3THYB 2BUCA 5FOUA 3FNFA 5FPQA 2FK7A 1JDZA 1WF6A 2WHPB 3IIKA 1KETA 2JH3A 1E64A 3UAOA 1Z39A 5JAIA 1C4XA 1EK5A 1NBOA 3JQ8A 3OT5A 3LOPA 1ZIPA 3EIOA 4M4SA 1DFHA 1T25A 2VH1A 4QYXA 4TVBA 1VL6A 2TRSB 3GA0A 4KX3A 2IPMA 2WLTA 1F2TA 1MAUA 1O96A 3GZNB 1UJCA 10MHA 3MINA 3QA9A 1BCRB 4HZUB 1A5BB 1MB2A 3I6BA 4NEQA 3ZUPA 3SU8A 4L5AA 2UUCB 1YRLA 3GMDA 4NCHA 5FNVF 3ZYCA 1BRTA 3LFUA 1ONNA 2P2CA 1YZFA 4G8BA 2P4UA 4J07A 5LP6A 5E3JA 1CZOA 1FBNA 1AY0A 4BVGA 4URFA 3TTTA 1EVEA 2R85A 2YJZA 5EKXA 1W47A 4WFJA 1Q1NA 2FPOA 1DWUA 1JJFA 1C4OA 1QP8A 4IIDA 2UZAA 4QFBA 1EVLA 4COKA 4YMGA 1A5ZA 4R54A 3MBKA 2C5FA 4HP8A 5A3VA 3M6VA 1V4VA 3UAXA 3AF5A 1MEJA 3PV0A 1NHWA 4IPTA 2NU8B 3HUEA 2Q1YA 2RKBA 2HIAA 1TVKA 3LGSA 1LQUA 3PEFA 3IQXA 4JUAA 1U3UA 4Q03A 5DBFA 1DBIA 4E4YA 2E18A 1QKIA 1TNDA 2JF0A 3COSA 3Q6MA 3RFUA 1Z4NA 1X19A 2D2XA 1KYVA 3E48A 4KAFA 3SLKA 2AFVA 2WF9A 1PR3A 3WNVA 4CEIA 3C6KA 1YFZA 3EVZA 1XMXA 1NOIA 2PQMA 2GH1A 1ZA1A 1ZGAA 2ZJ2A 4WY5A 1XTVA 4WXPA 2GRUA 5A03A 3U0BA 4F85A 2BKUA 2H48A 3PFKA 1Y7HA 5CLIA 5B1HA 4DABA 1U3FA 3N76A 3ELYA 2GEBA 3EZYA 2IV3A 3EWSA 5DTIA 1PR0A 2F00A 3M1AA 1KOFA 4UAJA 3V6MA 2BY4A 2H1RA 5KNBH 4H27A 4N3AA 1WUHS 3SZMA 3T9AA 3TUJC 3MN1A 4A2CA 3QVXA 4D80A 1W73A 5K0CA 2DERA 2NZUG 2IZ6A 4DZTA 3AXTA 1DKLA 2FQXA 3HKEA 1MOSA 1TJ3A 2V45A 1YQUA 3MTGA 5ETJA 3UT5A 2RIPA 2A5LA 4MS3B 1E5TA 4J3NA 3V8VA 3BB3A 4L9WA 2PLRA 4Y1FA 3TKAA 3QEOA 4O8ZA 3ZBQA 4KPFC 3IV9A 3DZBA 2VEOA 3TI9A 4CM3A 3L40A 2O6LA 3BEOA 4H7PA 1XMVA 3K2BA 1SD1A 1V35A 3IVMA 5AT1A 3RUHA 3TPZA 3ZVNA 1SUWA 1IYZA 3LWBA 2XB9A 3ROPA 4BNDA 3R09A 4ARZA 5AW6A 1RI4A 3DJFA 2O8EB 2RGUA 4MI9A 2XKKA 1DWOA 1VLHA 2RGXA 3FNHA 2HZBA 3LX5A 3MTEA 4OQXA 4OXKA 4R8MA 3WWOA 5DN9A 3TECE 2V8OA 3UH1A 1NW4A 3ECAA 4CHGA 3V4FA 4YXWD 2V6JA 5FFNA 5TPZD 4EVSA 1L8XA 1P31A 5IC4A 2P9BA 1E4YA 1E58A 3AP2A 3CSDA 1A7JA 3ABZA 3D6MA 2EW1A 1P2GA 5TSDA 3V8RA 4YJ2A 1ECPA 4BVLA 1LJ8A 1NY5A 4UM5A 2HRBA 1JWAB 2XOKD 5CT5A 3NGMA 4ZOLB 2ADOA 1YR7A 2YCBA 2ZIGA 3I6ZA 4M1QA 5TMBA 2XOKA 1NI4B 4X3CA 1U6IA 3DF9A 1UBNA 1BS9A 4DIEA 5JISA 5B64A 4BFCA 3HO8A 4PO3X 2VDVE 4NFYA 5AJTA 1T29A 4RK7A 3KJFA 4K88A 4XX0B 4L5JA 3Q8LA 4UEJA 1IH8A 2WTEA 3EVEA 2BTOA 1ZCAA 1JIKA 3TV1A 1G5PA 1DJOA 2EX1A 2PX4A 4J4TA 3V7YA 4ED9A 4ZEMA 5MHTA 3UG6A 1OI3A 3B52X 1TUBA 4NH4A