1RYEA

Crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
356
structure length
343
Chain Sequence
MPEDRRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords glucose-fructose oxidoreductase
publication title Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis
rcsb
source organism Zymomonas mobilis
total genus 120
structure length 343
sequence length 356
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ryeA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ryeA01
2X6TA 3Q0EA 1PGOA 4OM8A 4AJKA 2Q4EA 3V2GA 4TVBA 1U2GA 3F4BA 2BELA 2QHXA 1O8CA 3WIDA 4QSMA 4QXMA 4BGUA 4INAA 4DC0A 3RC1A 1LDMA 2D1YA 1EE9A 3A9WA 4BGIA 3LLVA 2YQ5A 3BMOA 5G0VA 5KJ1A 3DBRA 3P5SA 3FBGA 3AOEA 5FF9A 4MVJM 5KIAA 2DFVA 5B4UA 3VH4A 4XJTA 3CTMA 3RC7A 2DLDA 2I99A 1E7WA 4DVJA 5TJHA 3OHSX 2EHDA 1GPJA 1T25A 1PJ2A 1KEPA 3FHLA 1VRWA 4Q3DA 1YGYA 2GN4A 4IDCA 2C2XA 2X1HA 2HK7A 4Y6RA 1GCOA 5KKCA 4YJHA 1ENPA 2Q99A 2PZJA 3SX2A 4WCDA 2GZ3A 5A06A 5KVCA 4E3ZA 5L4NA 1EVYA 4E21A 5B12A 1ZK3A 4HUJA 3RUDA 3GVPA 3JV7A 5J9GA 1SBYA 3GNSA 4Y67A 1C1DB 1PZHA 4IINA 4RLHA 3EK2A 4D45A 1PIWA 2I9PA 1U7TA 4XYBA 3V2HA 4YRDA 3DHNA 3HHPA 4WKGA 3ONEA 4IGEA 1OAAA 3B1JA 3DO5A 3M6IA 4OMUA 3GPDG 3RU9A 3R1IA 1O9BA 2DTXA 4TROA 2AG5A 3WQQA 2FRDA 2DBQA 3C7AA 1Q7BA 1XU9A 1ZEJA 3PWKA 4IDDA 1KVUA 3ZH2A 2LDXA 3D3WB 1KY5A 5AXDA 5A3JA 1E3JA 4KOAA 3NUGA 2AW5A 4IDGA 5HBRA 5B37A 4CUJA 4GX1A 3PK0A 1E92A 1D1TA 1E6UA 1NR7A 4YAIA 1UP6A 4E13A 5G4LA 5CEEA 3C1OA 1BXZA 4RPJA 1PJLA 1A7AA 5K0ZA 5A4DA 4BL5A 2J3KA 2FMUA 3HWRA 3KTDA 4AVYA 1LSJA 1LRKA 2ZQZA 4MVJE 1WZIA 2Q1SA 4PLCA 4G65A 1BSVA 5KVQA 3PIIA 1Z7BA 3KHUA 2Q1WA 5IZCA 4FN4A 4BO7A 3LT1A 2ZB4A 2EIHA 4Z0HO 1X13A 2X9VA 3FI9A 5JY1A 1T2AA 1IL0A 5EL0A 2ZB3A 4QO8A 3NV9A 4A10A 4YAGA 1KEUA 1NNUA 1YDEA 2QQ5A 2A92A 3E8XA 2P5YA 3PFFA 5FWNA 5A9TA 2PD6A 4BO5A 1I01A 3HUDA 4YJGA 3ZHBA 1HLDA 4J0FA 5KWEA 4RF5A 4CLOA 1D8AA 1T2CA 4YT2A 4R3WA 5TGDA 3ZN2A 5KNLA 5COQA 4I5DA 1NFRA 1HF3A 1K5HA 1PGQA 1GD1O 1U8XX 1C1XA 1U1IA 3PDUA 3D5QA 5J23A 4UUMA 3QHAA 4E5YA 4RVFA 4RDIA 4EZBA 3TZHA 3E9MA 1P1FA 3MJTA 1H6CA 3UFXA 3HE3A 1NFFA 2YHUA 4IDEA 5IJZA 4EITA 2P4QA 2AQIA 1EUZA 2WSBA 3MOIA 1SO8A 1R37A 2C0CA 1FDWA 3JQ6A 1GAEO 5I7FA 3VPGA 1UXKA 1KS9A 1GY8A 5GZ6A 6LDHA 1SC6A 1A4UA 4CR8A 1DLIA 1Y5MA 5G0WA 1WAMA 4DL9A 2D5AA 3W8FA 1N1EA 2C7VA 1LSOA 1WW8A 2UAGA 3F47A 3DAPA 4UULA 1MX3A 2J5KA 2X5OA 4LVUA 1MXFA 1MFPA 3CXRA 1W8DA 3MWDB 2BKAA 4Z9FA 4B4OA 4E33A 3K2EA 1JQBA 4J9UE 4DUPA 4RPGA 2O3RA 3VC7A 3RIHA 4P4GA 3L77A 3PXXA 4BO2A 5A9SA 3UVEA 1K2WA 5IZ4A 3H8VA 4L74A 1ISGA 3AUAA 4WLUA 2PLAA 2G5CA 4D42A 2C20A 4XDZA 3GC6A 3PLRA 4PG5A 3UXYA 5HM8A 5KJCA 3K8ZA 4U5QA 4PVDA 4E32A 4GBJA 3HJAA 5EERA 3P7MA 1PJSA 2PA3A 2NADA 5EESA 5G2OA 4CMHA 4DIOA 4DMLA 2DC1A 1EE2A 3ADOA 4K28A 1LLDA 4NFSA 5JDCA 1I2CA 3TZKA 4CLEA 3WGHA 3ZV5A 4WUVA 1MFZA 1O94A 2VWQA 5A05A 4DLAA 4J1NA 4NG5A 1NVMB 4JLWA 4KQXA 2FSSA 4FR5A 1I10A 4RVSA 3T4EA 2G76A 3W6ZA 5AVOA 1ZNQO 3OH8A 1HETA 1R66A 2CSUA 2J6IA 3DZFA 3F9IA 4IMRA 3RASA 3IOYA 5ER6A 4FFLA 4BNYA 3RUAA 3ZV6A 2NU7A 3FPCA 4HY3A 1BVUA 3JQCA 5EJ2A 1XELA 5JBIA 4FB5A 4GI2A 1EQUA 4N18A 1PL8A 3TWOA 2W2LD 4YCAA 3PYLA 1T24A 3CE6A 1IY8A 4J4TA 4RCVA 4BNIA 1OC2A 2E49A 2E4AA 3TFQA 4RVGA 2ZYDA 4PG4A 3I6QA 3E03A 4ITUA 5T5QA 1RM3A 5JLAA 5DZSA 3OSUA 4AJPA 3DOJA 3AI1A 2O7SA 1HE3A 3AOGA 3RU7A 2ZTMA 1M66A 2GASA 3AUSA 1P44A 3DBLB 3PEFA 1RYEA 1GZ6A 4S3MA 4IJVA 2YHIB 4NQZA 5HS6A 4PLVA 1DC3A 3WYBA 3MCVA 4LSWA 3V1UA 3VH1A 3QWIA 4U7WA 2Q50A 4EUHA 2G17A 2VWHA 5A02A 4Z9XA 3D0OA 2ZB7A 4GQAA 2AMFA 3HDYA 1YQGA 3MWEB 1B15A 4ZGWA 2X8LA 5DBFA 4IZHA 4PLPA 4B79A 5IN5A 3OJ0A 1UDAA 2IRWA 5ILGA 2Z95A 3LQFA 3N7UA 4R4JA 5IDQA 2R6JA 2QRKA 4LMRA 4YT8A 5KJ6A 4ZVVA 2O23A 5KVSA 3KRTA 1H9AA 5BSEA 3VZRA 4PFJA 4WCFB 1VKNA 3AY7A 2XXBA 4RORA 1C0LA 2FP4A 2IYOA 3TL2A 4FFNA 4AJ1A 1I8TA 3PZRA 1MV8A 4EJMA 1XIVA 1ISIA 3DWFA 4ALMA 3ETDA 4EW6A 3HFSA 5HS4A 2UDPA 3JQ8A 5LCXA 2FPGA 2CMDA 3GN2A 3TQHA 1YL7A 1ZK0A 1Q7GA 4GMFA 1ZJZA 2VHXA 3QRWA 4E12A 2PV7A 3OJFA 2Y0CA 1CIVA 1IHYA 1IE3A 1UXIA 2PZKA 1AGNA 4E2ZA 2AE2A 2C5EA 4RQUA 3VPFA 1J0XO 1I30A 3GGPA 5BR7A 2X86A 4CM8B 1GZ3A 1XR3A 1H2BA 5DOZA 2IZ1A 1D3AA 2TMGA 3SLGA 1NPDA 4G2NA 4OOEA 4U0JA 1UJMA 2XAAA 1HDRA 3R3JA 2JD2A 4GAEA 5F1PA 2NVUB 1JW9B 1G0OA 1HL3A 3DZKA 3I52A 3I4FA 1NQAO 4RVDA 3X2EA 4NZ9A 3V8BA 4PVCA 4HNHA 1N7GA 4BQRA 4KTTE 1V6AA 1QV7A 5COAA 5DOVA 3IKVA 5I8ZA 3BXXA 1QR6A 2O2SA 3ZWAA 2CVOA 4QQRA 4W7HA 5ENVA 3TOXA 3ZWMA 1DFGA 3OIFA 3I4CA 4R9SA 4Q3AA 4UAGA 4WLFA 1F17A 4R5HA 3B20A 3R3SA 4GVXA 3DOOA 1OC4A 4J7CA 3PGXA 5JCJD 5ILOA 5H81A 3AUTA 4WJZA 2OO5A 5CP8A 1C0IA 3RBVA 5C7LO 3FR7A 1UH5A 3SJ7A 4MP6A 3VHRA 3WGIA 3CKYA 2OZPA 5DCUA 4CM9D 3MJCA 4EJ6A 4DPMA 3ASUA 4M55A 2I3GA 4KZPA 4YBZA 3WWYA 3ADPA 2DBZA 2CUKA 3SBOA 3FWZA 2WJPA 3OJLA 5EMHA 4E2XA 4NBVA 3PQFA 2DAPA 3HG7A 4CMJA 1CEQA 3F5QA 1HZJA 1V3UA 4YRBA 5JAIA 1Z82A 3TZ6A 2D3TA 3K30A 5ITVA 1E7QA 5IF3A 4OGWA 5ICSA 2GUGA 4WASA 3ICPA 4DXHA 1MG5A 1B3RA 1QKIA 3KLPX 4F6CA 2F00A 2J5QA 3FR8A 7ADHA 5JNLA 1R4NA 3KYDA 2V6MA 4D46A 4U6QA 2W8ZA 2WYVA 4BQPA 5GZ3A 1A71A 1PGPA 3ZNNA 2PK3A 2ZTLA 3HN2A 2UUOA 2QX7A 1LI4A 2VOEA 4L4XA 2VNSA 1JWBB 1UR5A 4LW8A 1UDBA 2EG9A 3E48A 1OMOA 3DC2A 4FS3A 2Z5LA 3C1AA 3NRCA 4I1IA 4M8SA 5B4VA 2AEFA 4WE3A 1SB9A 3LDHA 4A27A 1EZ4A 3WYEA 3DZBA 2RHCA 2HRBA 3VZSA 4H16A 4AICA 4HWKA 1Y6JA 3JYQA 2DTEA 3WGGA 1ZSNA 3ANNA 3WG9A 5AYVA 3PHIA 3O26A 2FHSA 1M76A 2CDAA 3FNFA 2VWGA 5GY7A 2H63A 5L45A 3WR5A 5CDTA 4S1VA 2NV6A 3JYOA 1GQQA 1T1SA 1DHTA 1JTVA 3JQAB 4FJ0A 4OSOA 4LCJA 4P22A 1DIHA 5T8KC 5COBA 1EMDA 3KB6A 4UUOA 1LQTA 3R6DA 2CFCA 3U0BA 5JAZA 1FJHA 2DKNA 1BWSA 2EP5A 4JGBA 1T4BA 1X15A 3IUPA 1NR1A 1KC1A 2IEBA 1ZXLA 3S2IA 4RDHA 5G4KA 5CDUA 3A1NA 4PLFA 5F3RA 1HSZA 5A5EA 3CINA 1Z6ZA 4XYMA 1TLTA 5DCYA 4CQMA 2HAEA 1ZBQA 2I65A 4IDBA 9LDBA 4Q3EA 4EEXA 3DMYA 5C37A 4LMPA 4E31A 1HWYA 5LDHA 5FEUA 3WSWA 4ZQGA 3ZHXA 4DQXA 3UCEA 1M6WA 3WOHA 4YB8A 3ZGYA 5HRUA 3HADA 1E1NA 3LU1A 3IL2A 1UZNA 3NEPX 4ZQFA 1O95A 3JCZA 3EC7A 3DBHB 3AU8A 3JQBC 1R4MA 2DPHA 4R51A 3NJ4A 3ZHYA 8LDHA 1HDXA 2VZ8A 1EBFA 4YJFA 4IJWA 1EVJA 3INGA 4OL9A 1ZK1A 3BTOA 1QRRA 3WDSA 2Y67A 1UP7A 2XF8A 3IUSA 2FOIA 3OJOA 4MOWA 4U0KA 3RQSA 1NFQA 3Q11A 4BGVA 5BT9A 1OZAA 3G49A 1B16A 4KDEA 4IY1A 1E1KA 2WWRA 3TN7A 4IUYA 4J9VA 2NTNA 4JJIA 2AA3A 4EI2A 3PYXA 2VHVA 3KYDB 1JDJA 3AM4A 1T2EA 5EN4A 1AE1A 1HTBA 3JTMA 2DUUA 1KVTA 1QYCA 1KVSA 4BKPA 1CJCA 2GERA 2VN8A 5DBGA 1E7SA 3ZWOA 5JO9A 3I9NA 4MO2A 5JCXA 1OOEA 1BRMA 4ALIA 3PDJA 1SB8A 4EEZA 3GEDA 4NDNE 5IFLA 2UV8A 3S2GA 4MKXA 2O3TA 4NR0A 2V6BA 3D4OA 1IB6A 3FCOA 2EWMA 3KYCA 5F1KA 4MVJI 4CLHA 3RROA 1P74A 3KLMX 2BMAA 1WMBA 4JBIA 3PPIA 4M49A 3FRJA 4PRLA 1C3VA 3JQDA 1PEDA 4B7XA 5B4TA 1LU9A 4ZHSA 2Q4BA 4AJHA 3IP3A 1EUCA 3GN1A 3HN7A 2BH9A 4PLWA 3GVCA 3PHLA 4TRJA 3WQRA 4D43A 4BS9A 2WYWA 2ZTUA 3TSCA 5CHEA 4EJ0A 4F6LA 1E7YA 4IQGA 1PS8A 3SEFA 3JQ7A 1HRDA 2GNAA 3QV1A 4B4WA 4DTIA 4JBHA 3NGXA 5JE8A 2BHLA 5L7YA 3OETA 2VYND 4KTVE 3WICA 2I66A 2HK8A 4IXTA 5ITWA 4MVJD 2RAFA 1VJ1A 1X0VA 1RJWA 3DHYA 4GWKA 2NVWA 4CQMB 1OFGA 1WPQA 3ASVA 2FPPA 4CM1A 4ZICA 3OQBA 1HE5A 1HYEA 4W4TA 5JPIA 3EW7A 3EYWA 4J2OA 1U5AA 4XYEA 5L95A 2IYPA 3BTVA 1TT5A 4J1TA 1NHWA 1P77A 3GZNB 3GQVA 4OXYA 1ZSVA 3RC9A 3U4CA 1P33A 2Z1NA 4J7UA 4BO9A 3Q2IA 3G17A 4J90A 5TLSA 3LZ6A 4DIFA 3H4VA 3JD0A 4FSHA 4AJNA 2QZ9A 3RKRA 1ZH8A 2OBNA 3EDMA 1NAHA 1S7CA 3I9LA 3NJ8A 1UDCA 1PWZA 4I08A 1N7HA 4X54A 1HDOA 4R1SA 3OA0A 3ETGA 5A9RA 3INRA 4D3FA 2W90A 1HYHA 4EGFA 3UUWA 4CQLB 1WLYA 3L6DA 4FD3A 4BNVA 4I9UA 4RJTA 3FNGA 3RUHA 2ZIZA 1Z45A 4NJMB 4XEHA 3MEQA 3WMXA 4CV3A 3TZCA 3VH2A 5IN4A 1XQ6A 2YW9A 4CM7A 1PQPA 4I5GA 4UVEA 1DRVA 2DTDA 3CH6A 3FN4A 5BNIA 1WDMA 1B0AA 5FI5A 4CJXA 4RQTA 5DCWA 4PLGA 3V1YA 4XYLA 2BFMA 4M54A 4DQVA 1X1EA 4JK3A 4YA6A 4IJKA 1ZMOA 2FSVA 2W98A 1O6ZA 3EMKA 3SVTA 3I9OA 1OI7A 1LLCA 2YFQA 2A94A 3G1TA 1SPXA 4OJNA 1P1KA 4CM4A 5H83A 3RUCA 3H2SA 3PJGA 4XRRA 2WD7B 1Q7CA 1DEHA 1PJ3A 1ZCJA 5F21A 4A73A 4XQEA 1FDVA 1AXEA 2VWPA 4ZRNA 1ZIDA 2Q46A 3GFBA 4OAQA 3E5MA 3ZW8A 5JSFA 2VT3A 5JY6A 3KXDA 3LT4A 3W1VA 2O50A 5A5FA 2BGLA 4N7RA 3MZ0A 3PRJA 4W99A 5T8KA 3Q3CA 2NU6A 5HA5A 1H6DA 5JC1A 3DHEA 4TQGA 1NX6A 1PL7A 2WMDA 2Y66A 4Y9DA 4HKTA 1K6IA 5U9CA 3WS7A 4YAEA 2AEJA 1QG6A 4BMNA 1BXGB 4LN1A 3GGGA 2VNAA 3F4LA 1J4AA 4TSKA 3VH3A 3WJ7A 3H9QA 2B37A 5L53A 3ONFA 3JYLA 2BGKA 2I6TA 1VE9A 4C7KA 2ZQYA 1IPFA 3U4HA 1YXMA 4MVJP 2Q1UA 3NYWA 2HMSA 4RLSA 1E5QA 4KDFA 1Y8RA 2B4TO 3D1LA 3BMCB 2HKIA 3LC2O 1R12A 3I5MA 3JQBA 4KWIA 3TNLA 4L4SA 3F5SA 1U3WA 4W82A 4BOYA 3L9XA 4WEOA 4MDHA 3WIEA 1VPDA 4ND2A 4OO3A 2NWQA 3HDJA 1HE4A 3RBXA 1HDCA 2PGDA 3H65A 5AQ1A 2HJRA 2BFAA 1TA4A 1MLDA 2GRAA 2Q22A 4FQ8A 5EINA 5U1PA 1WDKA 3NAQA 5CG2A 4E6PA 2F1KA 5KCZA 1GEEA 3O8QA 3BMOB 4EYEA 1PGJA 3DBRB 1XLTA 1WDLA 2EJWA 5EQFA 4ONEA 4DRYA 5KOIA 3JD3A 2JD0A 2GD1O 4J16A 4E2YA 4MVJF 2RH4A 3RSHA 4DWVA 2OOSA 3O4RA 4D3SA 4YAJA 1N9GA 3WJAA 4RO0A 5TS3A 3GG9A 4M87A 4YJHB 4XJSA 4BO1A 1ID1A 3G3EA 4J2HA 1SEPA 1SEVA 1U3VA 4R01A 4JP2A 3FPLA 4A26A 1VLLA 1D1SA 3C3XA 3W8EA 2ZTVA 4CM4B 4GSKA 5JMWA 4CMIA 3LLSA 2PGJA 3A28A 1A7KA 3TZQA 1B2LA 4HFMA 1EQ2A 1BW9A 1I3NA 2QZZA 1H6AA 3QLJA 4TMFA 4PCVA 4PGFA 2QYSA 4EUFA 1H6BA 1GL3A 2X4GA 1E77A 4QT0A 1XWFA 2VHYA 5I9MA 3AJRA 4R1TA 1HDZA 3H3JA 4W9NC 1RM5A 1MC5A 2J5RA 2P2SA 4MKRA 2E37A 3K96A 5FI3A 2X5JO 4EDFA 1RWBA 2OORA 2FY8A 3WNVA 1ZK4A 2IE0A 2XPCA 2PZLA 3GG2A 4IBOA 4IIUA 1N1GA 1P1HA 2B5WA 3C85A 1E3LA 4D7AA 3GR6A 1BHSA 1LUAA 3FWNA 4A03A 2YV1A 1UP4A 4XA8A 5L9AA 3GF4A 2YV3A 4GX5A 1Y9EA 4ND3A 3ZWVA 1LA2A 1FDTA 3JQGA 4PG7A 1CYDA 4YTEA 2HK9A 4CR6A 1DSSG 3KZVA 2FR1A 3AM5A 4NPCA 2BD0A 3ZNPA 3ZU2A 1PWXA 4E30A 4TKLA 1CQJA 4CLXA 4KP7A 2HMVA 5TRTA 4R16A 1T1RA 4O63O 1PGNA 2IXBA 1FDSA 4JIGA 2Y1FA 2Y1GA 3OEWA 5TT1A 3QWBA 3GUCA 1R16A 1HZZA 3CSDA 3WBFA 3OECA 1GQ2A 4FFMA 4O5OA 4CR7A 4IMPA 2X58A 3KO8A 4AG3A 1SOWA 4OSPA 4KWHA 5CPFA 1Z73A 2WE8A 1LSUA 4MP3A 2AQKA 3UW3A 1M6HA 1P31A 4ND4A 1KEWA 5JS6A 1OBFO 5DDIP 1DXYA 1PL6A 4CLRA 3JYPA 3L4BC 1PZFA 3E9NA 4RPHA 5TNXA 4GWGA 4YJGB 3O03A 4RVHA 3U4DA 5JFOA 5BSHA 4CLOB 1T4DA 4UUPA 2AG8A 5A1TA 4XIJA 1W73A 2NVBA 2PD4A 5C7IO 2VCYA 4NNJA 3GEGA 1ZJYA 4XWYA 3OEYA 1C1XB 3PLNA 2E82A 2VRCD 4BNNA 4GLOA 3PYMA 1ONNA 1GCUA 1ZMTA 4UREA 3GUYA 5LDGA 3B70A 2W4QA 4I9HA 2OGUA 3FD8A 1X14A 3NT4A 1C0PA 1H93A 5EQDA 4CMBA 4JNKA 1P9LA 1MGOA 1E3SA 3OIGA 9LDTA 3K73O 4P8RA 4ALLA 1BW9B 2PKRA 5K6AC 4OXKA 3K6JA 1TXGA 4BKRA 2Y68A 1LRJA 4R68A 4BVAA 5CAEA 2B4RO 2B5VA 3AK4A 4GGPA 2CF5A 3OQ1A 1U7HA 4PRKA 4O6VA 2JJYA 4L76A 3VAZA 4B3HA 2JHFA 5K9ZA 2R00C 1K89A 1E6WA 2IEDA 1GYPA 4IXWA 4FPXA 5JC8A 1B7GO 3HFGA 2R2GA 4R1UA 4NBTA 1IUKA 4QTZA 4ZU3A 2EGHA 2ZKLA 2P68A 3QE3A 1Y81A 3W4KA 1QYDA 1ENOA 2D0IA 3QVOA 5A9SB 4R69A 4UEJA 1R0SA 2FN7A 2AE1A 1DBVO 3SLKA 4EUEA 1HE2A 3B1KA 3LC1O 1KVRA 2NQTA 1VSVA 3WXBA 2EW2A 1Q0HA 4QX6A 5TQVA 3I9KA 3LF2A 2PH3A 2GPTA 3JQAD 4BB6A 3I9JA 2DPGA 2W2LA 2NTVA 4UVHA 1K6JA 4XD2A 4YAKA 1DIRA 5BSFA 4HX5A 4BNWA 5CEJA 1RM0A 3K2BA 4CLRB 1NQ5A 3D5TA 2DM6A 3IAHA 3ZWCA 1XGKA 3G79A 3EVTA 1DO8A 1DHRA 2WEKA 4CUZA 3CUKA 3MJEA 4HP8A 1ORRA 1YL6A 3PTZA 5T64A 2UYYA 3ZCXA 2JAPA 5JYFA 5L51A 4YPOA 1Y5RA 3VTZA 4OKNA 3UGKA 2AQHA 3NX4A 2FWMX 4YQZA 4JROA 1JVBA 2Y1DA 4BO0A 4PLYA 3K5PA 1NWHA 2VQ3A 2BLLA 4NU5A 3QP9A 1KEVA 4XQ9A 2QIOA 1YQXA 4N5MA 3OA2A 1XG5A 3CZMA 4NBRA 3WFIA 1KIFA 2YDYA 3B1FA 5GMOA 2BGMA 3Q1LA 1BTOA 4PLZA 4TRMA 3L4SO 3ZWXA 3RWBA 1CERA 2GN8A 2WDZA 3ROMA 1JAYA 4GX2A 5C3MA 3GH3A 3GAFA 2HU2A 2RCYA 2V6FA 3F46A 1YBVA 3RVDA 1QYWA 4NH4A 1IZ9A 4KUEA 3QQPA 4DREA 2Y05A 4O59O 2WD8A 5DULA 3DFUA 1DIBA 1ZUD1 2J3HA 4R9RA 4W9NA 1EEHA 2NACA 3ENKA 5L4LA 1E7MA 3FNEA 5T67A 3ZHZA 2NUAA 1PU2A 1LNQA 1CWUA 1YBMA 2Z1MA 5DF1A 5KJEA 4ZJUA 3U4IA 4WLEA 2H5LA 3S2FA 1I3MA 2HQ1A 4J0EA 3EGOA 3AU9A 2GLXA 1I3KA 2G1UA 4D44A 3V5NA 4FFOA 3EVNA 3IP1A 4QFCA 3ZNOA 4DBZA 4XZ3A 5TSDA 3GHHA 4FDAA 4IQ8A 4DYDA 3KSDO 1NP3A 1GYQA 1BG6A 3BMQA 3E9QA 1GEGA 1YE3A 4L4RA 4RF2A 4CM3A 1VJ0A 4MVJH 4DBVO 1NQOA 3NDJA 1VC2A 5JW6A 1YJ8A 1YBAA 5DN9A 4B4VA 4YYZA 3Q9NA 3CEAA 2X23A 3UCXA 1SCUA 3JQ8B 5G0SA 1YO6A 2B69A 3FSRA 3ITDA 3OQ6A 4DQUA 2X5KO 3ZZNA 3HB4X 2Q3EA 1LBEA 5A04A 2YUTA 3ZWYA 2O48X 2ZJ1A 3ZWNA 1Y8QA 2J8ZA 1NWCA 1MA0A 3EAGA 1DDOA 3H7AA 4TVOA 4CM6A 4G5HA 8ADHA 3ST7A 3BHMA 3NDIA 3O38A 3DAFA 4AJEA 3C24A 4HFJA 2QW8A 4JXKA 3L4BA 3DZGA 3VTFA 2W2KA 2E48A 1VL8A 1Y1PA 5JCJA 4JJFA 2X0RA 3SC6A 3VVCA 3D7LA 4C4OA 4C7JA 5CG1A 3W4JA 1A4IA 3E6AA 3U09A 3QIVA 1Z74A 2NSDA 4CM9A 5I7SA 4ID9A 1ARZA 1QYVA 3WLEA 4YXFA 3BIOA 1N8KA 3Q6IA 4CMCA 2XOXA 1ZO8A 2BRUA 4J6FA 4N54A 1G0NA 4J49A 4ILKA 3D4NA 3TJRA 4WK6A 5G0UA 2GSDA 4BNMA 2CD9A 4DC1A 5C5IA 3QWHA 5TX7A 5GZ1A 5K6AA 4RGBA 4ZD6A 1WNTA 4R41A 3JYNA 4G81A 1JKFA 2V65A 1PTJA 4B8ZA 2Y0DA 3KEQA 1AHHA 1P1JA 1IPEA 2D8AA 1I2BA 2DQ4A 3RC2A 5L4SA 2JFFA 3BZUA 3I1JA 3GNTA 3EZYA 3H5RA 2Y1EA 2R00A 1V8BA 3BMNA 5F5NA 1P0FA 4IM7A 1PJTA 2CDCA 4KMSA 4OXNA 3BYZA 3DBVO 4Y98A 1EVZA 4BO3A 3ENNA 3VZQA 4A5OA 4KUHA 1TT7A 5I9LA 2VUTA 1QXSA 1U8FO 5G0TA 3L6OO 3JD2A 2GGSA 3GA0A 1O89A 1R0KA 3AY6A 5F1OA 3K31A 4FC6A 3GAZA 4XR9A 1R4NB 1N92A 2D4AA 4J1QA 4CV2A 4L73A 1CDOA 1HDGO 1RYDA 2GZ1A 2C5AA 3WTBA 3ZDFA 3KV3O 5THQA 3CZRA 4IS3A 5KJFA 1GADO 5A03A 1I2ZA 3NTQA 3EHEA 4ALNA 4CLDA 4Q39A 2OBYA 3FBTA 3JD4A 2QRJA 1GR0A 1VSUA 4GPD1 1MG0A 1N2SA 4N5LA 1ZFNA 3VDRA 2PKQO 3F6YA 1ZW1A 2X0NA 1ISMA 2VRBA 3WNQA 4XKJA 3KSUA 1PQWA 3MOGA 1ONOA 1M67A 3IJPA 3ZU3A 3QJ5A 2DT5A 2Y1CA 3ANMA 2EERA 3OFSA 3OP4A 1PSDA 4YEDA 4IS2A 3GPIA 2D5CA 4ZN6A 1M2WA 3IJRA 4J1SA 3T7EA 1EBUA 3DXFA 4NJOA 4BV9A 1CRWG 3G1UA 5AXBA 2O4UX 1SMKA 4AJ4A 2FR8A 2YJZA 3ETEA 2A9FA 1T2FA 2Q2WA 4Q3NA 1DJQA 4LK3A 5G4KB 3BHJA 3NKLA 4RVUA 1NVTA 4LSMA 4E5PA 1MB4A 4M89A 4WEQA 5BNFA 2JFHA 2O3UA 4BO8A 1XKQA 2JKVA 4YRAA 1ZXBA 1I36A 3X2FA 2NU9A 5CEFA 1EK6A 4BNGA 3BHIA 5L40A 1W0CA 3L6EA 3W4IA 1R4MB 5IG2A 4FOOA 4BKUA 3B6ZA 4B3JA 1VL0A 4YJFB 4R1NA 1FF9A 4ZQEA 3PHHA 3RUFA 4BKQA 3E1KA 3IDSA 1GUFA 2H6EA 2PTGA 3D3WA 4ND5A 4IDAA 4UVDA 2B36A 1B3BA 1H2HA 2X22A 4WCFC 2DU8A 3PWZA 1GYRA 3W8DA 1SNYA 2Y99A 4RF3A 5ADHA 2PZMA 4GMGA 3S2EA 4BNKA 4FC7A 3M1AA 4XQGA 4JCOA 3W6UA 3FTNA 2H1SA 2ET6A 1WWKA 1ENZA 4M1QA 1V9LA 3RFTA 2D2IA 4MIEA 4OKIA 4GGOA 1YQDA 1YONA 1FMCA 1XHLA 1RPNA 3PJDA 4BIIA 2CDBA 1KYQA 1FXSA 1MXHA 2VUSA 4B4UA 1RM4A 1PS0A 4BO6A 1YS4A 4WNIA 4BNHA 1DB3A 2VYNA 3H9JA 1EDOA 3KYCB 2BFOA 3I83A 4WNCA 2A35A 4MVJA 1BGVA 1MUUA 2C54A 1NAIA 4L8VA 2PD3A 1GQYA 2YFHA 3DQPA 2JCVA 3Q9UA 3DTTA 1QP8A 3U62A 3WB9A 4UVIA 1I33A 1I24A 2HRZA 4PZEA 3VVBA 3PHGA 1ML3A 5ENDA 3MJVA 4HNGA 3AI2A 5CDSA 5JDIC 1Q0LA 1F12A 3GRPA 3PVZA 4QFDA 4PG8A 1U4OA 3I6IA 3TF5A 1XU7A 4LRSB 1UZMA 1ZEMA 1EUDA 1XEAA 1DIAA 4MVJG 5JAQA 3ZV4A 3KVOA 4OOFA 3JQ7B 4YT5A 4FJ2A 4J4HA 4F3YA 1VJTA 5I9NA 1ENYA 3GDFA 2JHGA 1H94A 1LLUA 3DL2A 4UEKA 3P19A 2CY0A 3V1TC 1P1IA 1EDZA 1QLJA 5H82A 3M1LA 5EPOA 1AN9A 5DNAA 1PZEA 5C7OO 2NU8A 1ULUA 1J49A 1UAGA 4ZRMA 4HFRA 2GZ2A 5DP1A 4CM5A 1ADBA 3OF2A 1IHXA 4R5MA 4N5NA 1TT5B 1EFLA 1M75A 2NQ8A 2PGLA 5I7VA 3PQDA 4TZTA 3GEMA 4R3NA 1BMDA 3LF1A 1P0CA 3ONDA 1YWGO 1SAYA 1DFHA 4GKVA 5MDHA 3SJUA 1KC3A 3ZNQA 4K26A 4BB5A 3BTUA 1NTOA 2Y1OA 4IQ0A 2PFGA 4H7PA 4RZHA 4BNZA 4Z3DA 3H2ZA 4BNUA 2YV2A 1JKJA 2GR9A 4II2A 1DJNA 5B1YA 1TEHA 2AEMA 5U4QA 3RJ9A 5TC4A 5DT9A 4W7IA 5IAAA 3P2OA 3GVHA 3SC4A 3F1LA 2PY6A 3WLFA 4B8WA 1PJCA 4GSLA 5M6DA 2EEZA 4FJ1A 5CDYA 3U5TA 3WGOA 2UUPA 1L7DA 2EKQA 1UXJA 1C0KA 1U9JA 2IDZA 4RPLA 3UHAA 2XXJA 4XQCA 3GFGA 2OP0A 3GOHA 2DBRA 1E3IA 1DRUA 5IDYA 1LC3A 4LCEA 4PIVA 3PJEA 1GUZA 3IC5A 1F0YA 4CV1A 3GMSA 4FOSA 3GDGA 3GGOA 4BNTA 3VKUA 1T26A 4NK5A 3UN1A 1P3DA 4GLLA 4UVGA 4AJJA 4KUGA 3TOZA 5JYEA 3R0IA 3WGYA 1U5CA 4DPKA 2GCGA 1I3LA 4RZIA 3DONA 3A4VA 2QRLA 3DTYA 2O3JA 2WM3A 1YB4A 3GVXA 2JFGA 1KERA 5JO0A 4MP8A 1DFIA 1N5DA 1X7HA 4Z9YA 5JXWA 1VKOA 3JQFC 4U6SA 3FTPA 3STHA 3HDQA 4H15A 4YR9A 2D59A 4FBGA 4FIZA 1H0KA 1EVIA 3AWDA 5IDXA 5IXYA 4II3A 1MP0A 2O3SA 1HDYA 1PJ4A 1YH3A 2AXQA 1NXQA 4AJ2A 1G1AA 1DIGA 3PP8A 1U28A 2OP1A 1ADFA 4NK4A 1PR3A 1GDHA 3M2TA 3DBLA 4AJOA 2PWZA 2YHIA 1SZJG 2GO1A 2VT2A 1W6UA 4YT4A 4OIMA 3KSZO 3GK3A 1FK8A 5IDWA 2DBVO 3L0DA 2B0JA 4BV8A 2GDZA 3AY3A 1XYGA 1R0LA 3C8MA 3GZ4A 3C7CB 2HJSA 3DFZA 3G0OA 4FW8A 3V2UA 1Y8RB 4JJGA 3WBBA 2ZJ0A 3WGZA 1IZ0A 1Q2XA 3AW9A 1DAPA 3OBBA 3EZLA 4WGGA 2ZATA 4F46A 2EV9A 4PZCA 1EFKA 4UEOA 4FGWA 2RIRA 3ZU5A 5MGBA 3UOGA 2GN6A 4YVFA 2ZK7A 2ILTA 4BMSA 4WLNA 4BMVA 4DYVA 1X7GA 1GPDG 4WCFA 5L7TA 2P5UA 2PKQP 2Q1TA 4K9DA 3S8MA 1KETA 3DB2A 3H9GA 5TT0A 4WOKA 4XGNA 1DOHA 4PN3A 3VKVA 3O8QB 1D7OA 3MJ4A 2Y0EA 4OQZA 1LLQA 4WPGA 2C82A 4YWJA 2JD1A 3UAGA 2EW8A 3ORFA 4NIMA 4P4NA 5A3VA 3RAJA 4Z0TA 3TFOA 3QA9A 2C59A 1RKXA 4NU6A 1GUYA 5TIIA 4URFA 2TMDA 4HFNA 2IZZA 2YQ4A 1V35A 3T4XA 3HSKA 4MPDA 5EIOA 4B7UA 1N9GB 4XR4A 1DRWA 3WQSB 3N74A 3NTRA 4I5FA 4CM8A 1PQUA 1PJBA 1U3UA 2JCYA 3FNHA 3H9EO 1G6KA 2HMTA 3RUEA 2HO5A 3DR3A 1QORA 4OYRA 4TRRA 3I3OA 2HSDA 4CMIB 1I0ZA 3U3XA 1NPYA 3QSGA 3IKTA 4I8XA 1A9ZA 2ZB8A 3K9QO 4OH1A 3NTOA 2NVUA 3T7CA 3DAGA 3S1LA 4TKMA 5JDIA 3RKUA 1ZSYA 3TRIA 2JL1A 2DUWA 4PLHA 3JQ9C 2CVZA 4Z0PA 5FFFA 4J4BA 3ZWPA 2O7QA 4BUCA 3LVFO 3O9ZA 3ZWBA 4CL8A 1A5ZA 5DP2A 4EBFA 4YDRA 5ES3A 2O4CA 4HBGA 1W4ZA 2VUUA 1HXHA 2GYYA 1DAOA 4E0BA 4E5KA 2C7GA 1TB4A 1B8PA 1L7EA 3S55A 2G0TA 2EP7A 1KVQA 5T57A 3MTJA 4GX0A 4AJLA 1CF2O 4RL6A 1LDGA 3JQGB 5BSGA 4XDYA 3PGJA 1YL5A 2X0IA 3IIEA 3WGQA 1DPGA 1V3VA 2OMEA 2I5PO 1BXKA 3A14A 4J7XA 4DLLA 2P9GA 1B26A 1HLPA 2O2YA 3NT2A 3OM9A 1BVRA 3RBZA 1ADCA 3Q2KA 4J91A 1MC4A 4E4YA 3H5AA 3OIDA 1S6YA 1T2DA 1BDMA 7MDHA 4CMEC 2BI8A 2ZYAA 4P38A 3WMWA 2RH8A 2VRCA 5HWSA 4DLBA 5I8WA 1LEHA 1K3TA 2NLOA 2OXIA 3PQEA 5TJ9A 1HEUA 2X7HA 2CVQA 4R54A 2C07A 2IXAA 3RFVA 2I67A 4Q9NA 1XQ1A 2EJVA 2FZWA 4Q3CA 4QEDA 5ICMA 3WTCA 3CMMA 1AHIA 4JBGA 1PX0A 2Y93A 3PJFA 3QW2A 1WP4A 2SCUA 1ADGA 3KYBA 3UKOA 3NDRA 3I23A 1BDBA 4WECA 3DMTC 1O0SA 1XA0A 1LDBA 3BA1A 3GHYA 3WWZA 1E1LA 2O3QA 1WMAA 3AM3A 2J3IA 1YJQA 1I5RA 1U4SA 2Q2VA 3PWSA 1F8FA 1UAYA 3DEYX 4HXYA 4L0QA 3IQDB 5KKAA 4BNXA 4XGKA 3KETA 1GTMA 2ZYGA 2VYVD 1PR9A 4GH5A 1JWAB 4CL3A 5BQFA 2VHZA 2JCXA 1LDNA 1L1FA 4BHTA 4BNLA 4CMGA 4CMKA 3PFWO 4MIOA 4JQCA 4UUNA 4L75A 4Y8VA 1LDEA 4IPTA 2NM0A 4GVLA 1GV0A 2V7PA 4K1LA 3ON5A 3VDQA 4ESOA 1JKIA 3SXPA 2X9NA 2CF6A 4FFPA 4BO4A 1F14A 3LK7A 1IOLA 4CODB 1WVGA 5CPBA 1YVEI 1U3TA 1UZLA 2WTBA 3PZBA 4YQYA 1E6EA 1V3TA 4CPDA 5T73A 4NBUA 3NT5A 1JAXA 3JQAA 1HYGA 3ZU4A 5L3ZA 6ADHA 3E18A 3AFMA 4NBWA 3GVIA 3QVXA 1X7DA 3JQFA 3VPSA 3P2YA 3L9WA 4IDFA 3KOUA 4J43A 1E0DA 3OMLA 3ZWWA 2P9EA 4O1MA 1NASA 4TRNA 4MIYA 3E82A 3ULKA 5ER9A 1YRLA 4WLOA 1KY4A 3D3EA 4XRGA 1VM6A 3QWFA 1K6XA 3FF4A 4F45A 2POQX 4FGSA 1VI2A 2FR0A 2P4HX 1HT0A 1DC4A 1B8VA 4BKOA 5JMPA 2EXXA 1JN0A 5TF4A 3EY4A 3ABIA 1J6UA 3UH1A 2QG4A 4B7CA 3L07A 4CMAA 3LSYA 3KEOA 2H9IA 4WLVA 1QLHA 3BAZA 2HDHA 5BNTA 2X9GA 3HQ4O 4L9RA 1LX6A 2Q2QA 3C7DB 3MTGA 4LVCA 1ZKMA 3DBHA 1NYTA 4D3DA 4IJUA 3GRKA 1CQIA 4K6CA 3KUXA 2VYVA 1JLLA 1YDWA 2HMWA 5CFZA 2VOJA 4MKZA 4TZKA 1GFSA 4GKBA 3F3SA 1GU7A 4Z3KA 1NPTO 2Q49A 3WYCA 1F06A 4LGVA 2A4KA 1KOLA 3HNPA 1A27A 4BNFA 4O0LA 4RPKA 3JSAA 1I32A 4CQMD 5AXCA 4JN6B 3TL3A 2PR2A 4E2WA 4NHEA 3RI3A 4Q3BA 1E1MA 4W6ZA 4XB2A 2JAHA 3AOEC 1JA9A 2NTJA 4HV4A 3VPXA 4AL4A 1GV1A 3D64A 1U2DA 1ZK2A 1NHGA 3QY9A 1ISFA 1WZEA 1XCBA 2CNBA 3C1TA 5DBIA 4D79A 3EUWA 1E3WA 3ZV3A 4A2CA 4FCCA 3WGTA 3WX0A 2HLPA 1WXDA 1LRLA 4IGFA 4NFYA 4D41A 1UXGA 5AXAA 2HUNA 3F1KA 4DA9A 5JYDA 3VZPA 3TPCA 3PHJA 2HCTA 4J3FA 3INTA 4Z6KA 1E5LA 4HADA 3VOSA 2B83A 4IZIA 1JU9A 3U49A 1YKFA 2AHRA 2OFPA 2VTDA 1V0JA 3ANLA 5AOVA 2C2YA 3AFNA 1YOVA 3OICA 2YYYA 3KBOA 3HB5X 1LJ8A 1GZ4A 3HDHA 4PG6A 5JAMA 2IZ0A 2X0JA 4K6FA 1H9BA 4XCVA 1P45A 4ZQHA 3JQ9A 1FDUA 1X0XA 4I9NA 1Q0QA 1QYXA 4ALJA 4OHUA 3GDOA 1SOVA 3LYLA 4DIBA 1YB5A 3IS3A 1DC6A 2ZCVA 1QMGA 1TI7A 3IMFA 1AXGA 3JQEA 3AUUA 1ULSA 1R6DA 3CIFA 3DZJA 4PZDA 4Y6PA 4A7PA 1ONPA 2EGGA 3LC7O 4H3VA 2VHWA 3QVWA 2B35A 1NVGA 3DOCA 1CETA 1IYZA 3BMQB 3TDKA 1B14A 4CUKA 1DC5A 3PIDA 4XB1A 2E6UX 4Y6SA 4A0SA 5LC1A 4ND1A 2YDXA 1EK5A 3DDNA 3ROPA 1AUPA 1PS9A 3RCBA 4E5MA 3PI7A 2B4QA 4U8GA 2QYTA 2VTEA 4CV0A 4FFRA 3K92A 3GZNA 4CMEA 1XDWA 5IZCC 1Y9AA 2RHRA 3DZIA 2YZ7A 1Y8QB 2BFPA 2VZ9A 3COSA 5L7WA 2V6GA 4ZQBA 2UVDA 1LQUA 4LISA 4YACA 3GNQA 4M86A 2PH5A 1TVEA 3ICCA 2AQ8A 1E3EA 1JVSA 1ZVMA 4P4LA 3GMDA 1Z7EA 2W2KB 4DPLA 4KQWA 2HMUA 1K0UA 1QSGA 3DMTA 1IULA 2EKPA 4CQLA 4RF4A 3ROQA 4D0RA 1H5QA 4PLTA 1NBOA 3UICA 1A9YA 3JD1A 3QWAA 4ZA2A 4NJMA 1LTHR 2G82A 1E3WB 5HTOA 1A72A 3BTSA 2WYUA 4DMMA 1KBZA 3NGLA 1LDYA 3A06A 4QUKA 3QVTA 4TWRA 3I9MA 4LRTB 3RJ5A 1LSSA 4BNJA 2EKLA 1E7RA 3LT0A 2OL4A 3H5NA 2BI7A 3H6KA 4BGEA 1O5IA 4XX0A 4NI5A 4ALKA 2PNFA 4XIYA 3WFJA 1LXCA 2OUIA 4AFNA 4AJIA 1J5PA 1YB1A 4I5EA 3ITKA 4NFHA 2LDBA 2RBEA 3KM0A 3ROKA 1YOVB 2DFDA 4RV9A 1X1TA 1LC0A 3N58A 5THKA 2WD7A 3E5RA 2C29D 4D0SA 4B3IA 4XGIA 3DZHA 3UCFA 5JYAA 1C1DA 4OQYA 5I7EA 1PZGA 3D4PA 5FYDA 3U9LA 1QV6A 4MINA 3BMNB 3MJSA 2IODA 4XYGA 1XSEA 1ISHA 5IXSA 4QECA 4WOJA 2DVMA 1NM5A 5KVVA 3VPHA 2NNLD 2ZCUA 4YJDA 1PJQA 3HZZA 1NQTA 3RD5A 2YY7A 3ZI0A 2Q45A 3GLQA 2J3JA 4IIVA 3LT2A 5T6BA 1Z75A 1BXGA 4ROSA 1Y7TA 5CDGA 3RFXA 3ZW9A 2VZ0A 3H9UA 2FZEA 2GN9A 2FPIA 4JP3A 4DGSA 4E5NA 1UXHA 1HKUA 1F8GA 2EF1A 4QO7A 3RUIA 3CPSA 1B8UA 2I3AA 1Q1NA 3UF0A 3H3FA 1HSOA 2P9CA 1D4FA 4MJLA 2I76A 2OHXA 3GT0A 3WSVA 3BMCA 1ZZEA 3AI3A 3CMCO 1ISJA 3QVSA 1R15A 5JDCC 1C14A 1UUFA 5KTKA 3OJEA 1VL6A 1DLJA 2CZCA 2GF2A 2P91A 2WE7A 4GL4A 4JX8A 4NMHA 3M2PA 3GY0A 5F5LA 2BF7A 1P1RA
chains in the Genus database with same CATH superfamily
4DSOA 1W2HA 4F86A 4MWGA 4QGFA 4XJVA 1T5DX 4RGVA 4AJKA 1QF6A 2IYQA 5E7QA 5B6PA 4P3OA 3MNFA 3WIDA 1YAJA 4QSMA 1IQPA 1E1RA 3LPNA 1TLLA 4BGUA 4WA8A 4LV8B 1LDMA 4HUTA 3MRXA 2D1YA 1PFYA 3EXEA 2E5LB 9MHTA 1FPQA 2ONYA 3AI7A 5DM70 3A1EA 2DKFA 1WOYA 3FRIA 5IANA 5BOVA 5D87A 4PTZA 5IAKA 4CYMA 1CHDA 3AOEA 4LJ4A 3OE7A 1U0EA 4BQEA 3F90A 3KSBC 4Z8YA 4QYMA 3W7AA 3P9NA 3OO1A 4KX3A 5U4XA 3W34A 1FFDA 3H7IA 5KIAA 4HNAA 4LQ4A 3S2SA 1EDEA 2OZLA 2VTVA 3B6MA 5TJHA 3BGOS 3DO8A 3R3XA 4R8MA 1S2DA 521PA 1VRWA 1RI4A 3ZXSA 1U7OA 1X3SA 3ZH9B 1M0TA 4IDCA 2X1HA 4QSHA 1TM2A 5KKCA 1A0OA 5DRYA 2NUTA 2IYWA 3PXBA 1JHVA 2HHLA 2XQKA 1PR2A 2ZG6A 4EG1A 5IT0A 4DV5B 1VZ3A 1IHOA 2CW5A 4RJLA 3EXFB 5EZ6B 3T5GA 1MO6A 3N53A 4E3ZA 1SIUA 4M9XA 4Q3KA 4E21A 1G17A 1ZK3A 5KREA 1COWA 3QMMA 2CMKA 4DA6A 1RXUA 1PHRA 3CEJA 1B00A 3B85A 3NH6A 3QA3E 1JZQA 1YE8A 3RVQA 3ZYCA 5J9GA 4CG1A 1NOJA 3SSNA 5BR1A 3GNSA 3M3PA 3RK4A 3SDBA 1JR3A 3NDPA 4US0R 3ND5A 4RLHA 4BATA 1PIWA 5AVVA 3EGIA 1JHPA 1U7TA 2YIJA 4XYBA 4ZEXA 4MV8A 4YRDA 5FUVA 3V2HA 1YIDA 2EX0A 4WKGA 3EZ9A 2NV2B 4XWOA 3E35A 3F5DA 3OLZA 1A77A 3W78A 3B1JA 1DCFA 4YCLA 3RU9A 4RQAA 4LQDA 2UVPB 3AERA 1O9BA 2DTXA 2FDRA 2AG5A 2WMYA 1SUPA 1FZQA 4YQFA 4IX9A 3W79A 3C7AA 1Y89A 1XU9A 3PWKA 3DKPA 3MWDA 3OU2A 5JT1A 3KOWA 2OHFA 3ICWA 4L5CA 2FUEA 1U0BB 3I0ZA 1J5XA 1RHRA 1WCIB 2DQZA 3DE4X 3PSHA 1MB2A 4BJ5A 5AXDA 1W75A 2CBXA 1JILA 2DMRA 4CUJA 1GRRA 4DAEA 4DR2B 2CCJA 3PK0A 1E92A 1TMGE 1E6UA 2C8KA 2W5UA 4OCZA 1GQSA 1ITZA 4MX8A 4E13A 4E09A 1A7AA 2ZAOA 3Q15C 4GE3A 1HR0B 1IQ0A 2CEKA 2QN3A 3QE4A 5CB4F 1OZFA 1K5DA 4R84A 1D2HA 1SD5A 2FPRA 3F2IA 2QD4A 3SYMA 4XUEA 1F4VA 1WZIA 3LP8A 9ABPA 4TLDA 3V8MA 1EYZA 5AFSA 1M6VB 2G40A 2O2XA 1GNTA 1Z7BA 3PIIA 4TMYA 4D56A 3PFCA 1FTWA 2Q1WA 3KPWA 1RTTA 5JYBA 3B13B 3ZDCA 4FN4A 1MJ5A 4AYWA 3IA2A 2EIHA 2QNBA 3KT3A 3Q8LA 2IKQA 1FSZA 1LCIA 3NYIA 4OJQA 2C7OA 1T2AA 1BNCA 2BMJA 1IL0A 3FGOA 3OIYA 4KN9S 4RXUA 4LXUA 4Q4JB 2KSQA 5EL0A 1TJNA 1FL9A 2PZEA 1QQAA 1N5KA 4HRXA 3NV9A 4ZT7A 1BKYA 4A10A 4BQFA 1KEUA 4OH7A 1YDEA 2QQ5A 4QUIA 3H83A 2P5YA 1X7ZB 2V4MA 5A9TA 4C03A 5FWNA 4TSFD 4BO5A 3I30X 2DHCA 4YJGA 2VA9A 2OYRA 3DZCA 3DOHA 4PSVA 5THXA 4R3WA 5TGDA 3ZN2A 1PJ8A 5ALDA 5KNLA 5COQA 1TAHA 4GYKA 4HDKB 3U4MA 4I5DA 2VF7A 1SVIA 1QGYA 1ZU4A 3DVAB 5ITSA 1NMQA 1GD1O 1Q1ZA 1TAQA 2X4LA 1U8XX 4M1SA 3WLIA 3ZUPA 1G4AE 2I71A 1A98A 1U1IA 4HF7A 5FPTA 4F3TA 2MOKA 1XAJA 1RPTA 1MO3A 4E5YA 3EPBB 4RVFA 1FQOA 2PO5A 4C2UA 2GDJA 5TVOB 2Z58A 3TZHA 3WJ1A 2WA2A 4QOJA 3COWA 4M0FA 2A5LA 3UY4A 3MJTA 4AMGA 8ABPA 1RHKA 4X20A 2A9OA 5EUQB 4MVWA 1AZWA 2FQQA 5IJZA 2P4QA 4P7GA 3QY0A 4PO1A 2XI4A 3MOIA 2D0DA 4N3GA 4G0PA 2C0CA 1M2OB 4UMFA 1EXWA 4H1TA 1Z6PA 1RHMA 3OLCX 1XBTA 5AVJA 2O9JA 1M8FA 1JBKA 2ZSBA 1DBIA 1GY8A 3LX5A 4LTMA 4Q1FA 5AM2A 3S7TA 1OI4A 1JHZA 4Q7MB 1A4UA 1GCIA 2J33A 1FTQA 1MEEA 1GA1A 1RABA 1CUCA 1PK9A 1PW7A 2D5AA 2QG9A 3GUZA 2XZLA 3CNEA 3WI7A 2Q5LA 3F47A 1MX3A 2J5KA 4XIGS 3G9TA 3KR0A 1YFZA 2X5OA 1U0SY 4MRSA 2NSLA 1JEYA 1Y4ZA 1SFRA 1VCHA 5KHOC 4IILA 1GWNA 1MFPA 2YUIA 1DRJA 4JHXA 4AB1A 1P2GA 1X94A 1WUIS 1B0ZA 3L41A 1T5HX 4E33A 3K2EA 4JVMA 1LH0A 4Z1MA 2GA8A 1JQBA 3I01A 4OUKX 4D3XA 2QSJA 4ACAA 2JLWA 3FHCB 2WNIA 3VSEA 1K7EB 5JVDB 4DUPA 2GJKA 2O3RA 2JANA 3VC7A 1RYHA 5GOZA 4IFTA 4JXJA 4E1BA 1GGHA 1Y63A 4CEIB 4EECA 3SZLA 3I01M 4MA5A 2DF8A 1PK8A 2PMBA 1QJCA 2Z6UA 4JEIA 4MYRA 3FDZA 2R60A 2P2CA 3L8HA 3MRVA 4IZ6A 2GZSA 5EUCA 5K3SA 1MHPA 2RHDA 4U5QA 1NNSA 4PVDA 4EHDA 2JFVA 2YWDA 4XFJA 2J0QA 1R0YA 5IUKC 1O87A 3TNYA 3HJAA 2BKXA 3TQRA 1Y98A 3DDOA 4LJKA 3CLSC 1AQJA 1L4GA 3DSRA 5CXXA 5G2OA 1G3QA 4DMLA 2YVQA 5JDCA 2XNDA 2QD2A 4R2LA 4X7MA 4NYJQ 4CEJA 1E94E 5FI1B 1FTGA 1O94A 2RH9B 4DLAA 4PZUA 1F48A 2XTMA 3MTAA 2C94A 4RVSA 2G1KA 3NIFB 4JT9A 1YDFA 2VZLA 2G76A 4UEQA 4MR9B 3W6ZA 1J97A 3OH8A 5G1NA 2J6IA 2A30A 4IMRA 3F9IA 3ELBA 1RYZA 1GKLA 2LR0A 2VEDA 1GM5A 3IOYA 4A16A 4FFLA 3F7OA 1J07A 5L6LB 4JBXA 1BVUA 1MH1A 1T5SA 4EMUA 4FB5A 4GI2A 2ZE5A 1RFLA 2YC4C 1Z12A 2FPWA 2FMIA 2V7VA 3N86A 2C03A 2J9FA 3K0CC 4HTAA 4M37A 3TUIC 3WBKA 3IMCA 4J4TA 4RCVA 3C97A 1FW6A 2J59A 3UKDA 5DNYB 3ZK7A 4L3OA 1FP2A 3SMVA 3UFXB 4ARZB 3RHZA 3WLLA 3E03A 3WLMA 2JHPA 2K7ZA 5JLAA 1WL8A 2O05A 3BL8A 4ZFNA 1HE3A 1ZD2P 4UXHA 3OCZA 1PUIA 5KQLA 3QXJA 4FZRA 4RY9A 5I3CA 2WWYA 3DBLB 1DIOB 2HJGA 1L3CA 2JJ8A 4QFMA 4ENPA 3GJ5A 2WFAA 2PFKA 1MTOA 3NVAA 4IJVA 1CZUA 3BC1A 4NQZA 5HGJA 3WYBA 3MCVA 4LSWA 2WW8A 4XSGA 2ZVQX 4U7WA 3KTAB 4Y1RA 1V37A 1JIKA 3NB0A 2VWHA 4IVNA 4E5UA 1IZYA 1CR0A 5K7SA 2PU7A 2AMFA 1JGTA 2HMAA 1YQGA 3ZCTA 2V1UA 4XVRA 1I4WA 1S4MA 4RD2A 4ZGWA 4KRYA 1NXSA 1NULA 2A88A 3O92A 3DJYA 3IOMA 3OHPA 1TAUA 4B85A 1ZA2A 2Z95A 3LQFA 3N7UA 3GFVA 4R4JA 1BQEA 2R6JA 4HH0A 3FHTA 1XVUA 4N3NA 5IVHA 4OHKA 1DGQA 1GRCA 3DMGA 1TIPA 2CLSA 4YT8A 5KJ6A 3Q5GA 1BHQ1 2YWEA 5BSEA 1FLNA 3A05A 1NJSA 2J0UA 4XARA 2HREA 4PFJA 3S1AA 1VKNA 1BFUA 1N6IA 3LY8A 3EQ8A 2FP4A 3TL2A 5KQRA 1DO0A 2QR3A 3PZRA 1QVZA 1U2PA 3R6TA 3H6HA 4EJMA 4BCDA 3KSAC 2IPXA 3RRFA 4QXRA 1ONBA 2WINI 3D6FA 2ORVA 3TSAA 4B9EA 2FYTA 4F72A 3ETDA 3FYDA 1R00A 3BRCA 5KTYA 2OPBA 5LCXA 2FPGA 3A3KA 2IITA 2QXTA 4H7FA 4ZCPA 3S2ZA 2CB9A 2IW1A 2IQIA 1AF4A 2VHXA 4O0MA 1P91A 1JKXA 4V0RA 4YASA 3TGWA 3OJFA 2GAIA 2QTAA 1QUEA 1C3EA 2J7PD 2Y0CA 4IIGA 2WZBA 4FZJA 1IE3A 4BFVA 4PQEA 2X3UA 3AEQB 3V3KA 3VPFA 4RMNA 2BEWA 1QO0A 3PE3A 5HE9A 5BR7A 2QV0A 4EZIA 2EF0A 3VI3B 2X86A 3HI4A 2OM6A 4FYVA 3BD8A 1XE3A 3PDCA 1D3AA 4RTJA 1RFGE 4GC5A 2O5RA 5E1MA 2XCOA 5EWMA 5FUQA 3SVZA 1I2AA 1U8EA 4KWTA 3SLGA 4C7VA 3AUXA 1OBVA 3OZIA 1VGVA 4DCNA 2F8SA 4EJ2A 5IWAB 3IPCA 2IIBA 2A86A 3PFBA 3TVDA 2JD2A 2BEVA 2FETA 1UQUA 1S4QA 3VHXB 1NQAO 4A2QA 1YMUA 2PGIA 3HMKA 3SR0A 4ZAWA 5ALZA 3NAMA 2YYSA 4PVCA 3V8BA 1VJCA 1L7NA 5HJ5A 2A59A 5FUBA 1AA6A 1TO2E 4RK0A 1OA0A 2WHPA 4KTTE 5JISA 2CSXA 2EJBA 3OWXA 1IZ7A 3B1XA 3LHDA 3PGA1 3DYIA 3TEFA 1KZ4A 3LP6A 4EGSA 1ZI8A 3KDPA 4ARAA 3BXXA 3SZ3A 4P86A 3T1NA 4OQMA 3ZWAA 3TW8B 5HKLA 4JC4A 1QHYA 4RIFA 3OC6A 4TV9A 1DQSA 2ZIVB 4I1SA 4ACBA 1DFGA 5KYUB 3FZEA 3EQ7A 3GNLA 4M1OA 4R9SA 2AFHE 3UV7A 2G3YA 3PCRB 4WLFA 1JTFA 1N1MA 2E85A 3EVBA 3C5VA 4LECA 2FPMA 2BSAA 4KL8S 1QGZA 2X8JA 1CUHA 2FG7C 4KIUA 1OC4A 2PRYA 2Y1LA 3UHFA 1SQ6A 4RD4A 1CJSA 3GLRA 4WJZA 1WP9A 3EP6B 3Q9LA 1C0IA 1XI2A 1UBGA 2B1QA 2HF8A 2M9MA 3LRPA 2ZR8A 3HCEA 4MEBA 4MQUA 4XASA 3X1DA 1C5KA 1GL7A 4CQNA 4AIIA 4EBBA 3VHRA 1XZJA 2C2GA 3DXXA 3LO5A 4H17A 3QX7A 2XOKA 4KZPA 4L5YA 3MCUA 3ADPA 2WB4A 4BX0A 2CUKA 3FWZA 3OJLA 1JWLA 5E3HA 4E2XA 5HX7A 2DAPA 1H2EA 3HG7A 3A6LA 5J43A 5LOVF 4ZTUB 1NF3A 1HZJA 4HNQA 4N4AA 4YRBA 3B51X 1Z82A 5JAIA 1YIAA 2D3TA 3K30A 3OHMA 4O3FA 3ABSB 4U7GA 2DPLA 4DNOA 4L8GA 3PQCA 5ICSA 3QBTA 1T8YA 1L8XA 3ICPA 3PG5A 4WASA 2C9MA 1IXRC 4BXOB 4DXHA 2CLOB 2C95A 3HY6A 1DAEA 4JJAA 1QKIA 2D06A 2QM8A 2HNAA 3QOWA 1ZM3A 4YR7A 3GCZA 2XJ4A 3KLPX 1GVHA 4YRSA 2J5QA 1NNI1 3FR8A 2HOQA 2L69A 2ZJAA 3EA0A 3DOUA 5AJTA 4D46A 1SZPA 2WSIA 2W8ZA 4GMHA 1CJMA 3DVLA 5BQ3A 3S1SA 3HVUA 2QLJA 2VP5A 4YRCA 5LQSA 2P7HA 3AFIA 2BZ0A 1NF2A 3HN2A 4FGKA 1AT1A 1LI4A 2O2DA 1QR2A 3ABZA 2VNSA 3LLUA 4TMVA 1IM8A 1UR5A 1CUVA 3HS3A 2ESRA 3EP3B 1RAFA 3E48A 4Y1EA 4FS3A 2DKOA 4G4GA 4KLAA 3ZCVA 2FW8A 4B3FX 4IVRA 1I6LA 10MHA 4YAUA 3U3KA 3BAFA 1MZVA 3PUYA 3LZDA 2IBSA 1XJ5A 2LPMA 1QU3A 1Y6ZA 3NHKA 1V2GA 5K01A 1FFXB 4HWKA 1P29A 2X0KA 3R6LA 5ILQA 5GINE 1KRXA 5I9BA 5CLIA 5FXMA 1KJIA 1WXGA 3DYBA 3PHIA 1A04A 2G36A 1PZXA 4YX9A 1M76A 2CDAA 3FNFA 3C87A 3K0CA 4S1VA 4O02B 4KMRA 4HGYA 1DHTA 3A32A 3IVXA 3JQAB 2WHQA 3NNNA 4OSOA 4LCJA 1DV1A 1KI7A 1C41A 3C70A 5COBA 5KTOA 1EMDA 2XZTA 3PT5A 4RADA 3KB6A 3PV0A 2XTZA 2I22A 1QE5A 5J3JA 3WL3A 5FOSA 3U0BA 3JATB 1FJHA 4Y0AA 1NUAA 4AJHA 3THOA 4DS3A 3IUPA 3QYFA 2CE7A 2Z2XA 1W4LA 4DJTA 1JI0A 2FX2A 3S2IA 4LY0A 3N6XA 3MK31 4YRKA 1ADJA 3PUKA 4F5ZA 2OEPA 3TX6A 3A1NA 4DB2A 1P17A 1KQOA 1WMSA 2A1UA 1HSZA 3VYVA 1QHEA 3C48A 4XYMA 5TQ2A 3VDNB 3W3ZB 1ZKDA 4ZKEA 3TBKA 3CT6A 3NVMB 1KFCB 2P78A 2CXXA 4C01A 9LDBA 2PR7A 2O0JA 2YVLA 1KMQA 1OVMA 1TDJA 2G1AA 5C37A 5JZMA 1HWYA 5FEUA 2VJBA 3EJ6A 1XMVA 3JPYA 2PL1A 4ZQGA 4DQXA 1MT0A 3DHWC 4OL0A 4UOEA 3AJ9A 1XQ9A 1HOTA 3ZY5A 4BEVA 1RBZA 3IL2A 4J0GA 4ZQFA 3WDMA 3KSMA 4FR0A 1SBNE 2EQBA 3JQBC 1R4MA 4QPCA 4YIHA 2ZJZA 3ZHYA 1HDXA 4MS4A 3L1HA 3UA3A 1M1UA 3LPCA 1D6SA 3INGA 1AX9A 1SURA 1Z0IA 1BMFD 3WDSA 1HT2E 1P5RA 2LP4Y 5DO9A 2PLWA 3E9RA 3OJOA 3OLWA 2ISSD 1YQWA 3WK8A 2IUTA 3TYXA 2JBHA 3HKDA 2O8EA 1OZAA 3ZY4A 1EDDA 1W25A 4FHCA 4YP9A 1ZGJA 3HM2A 2GFQA 1V47A 1W94A 4IY1A 4C0AC 4BP1A 2WWRA 2UXCB 1DZ3A 7GPBA 5CYPA 1T0UA 2AA3A 3LUFA 3PYXA 3N5KA 1IATA 3KYDB 3ZE8A 4KHPB 4A0RA 1NU8A 5D7NA 1XLTC 3G7UA 4DMKA 1M1YA 1MRNA 4ZODA 1AE1A 2H9AA 3OZEA 4LC0A 2MR5A 1T9HA 2GERA 1QO7A 1Z8DA 3L7LA 3LW8A 3M6FA 4WNYA 2JJ1A 4ZU6X 4D4MA 3UGTA 4DKXA 4LOHA 1YI0A 3T3PB 2CVPA 3B9BA 3K7EA 1BRMA 1W0JD 4LJLA 4Q82A 3R7BA 1SB8A 3V4PB 4EEZA 4F21A 3AP2A 3PEUA 5GV7A 3VUEA 4NR0A 4KO1S 1NJGA 3ZE1B 4KACA 1N5IA 1SG9A 3FCOA 5EKDA 4LYDA 3U5ZB 4DV3B 2XY4A 3SDSA 2CZQA 3D2LA 2EBHX 1CY0A 2OB2A 3LL4A 1Y6GA 1XMQB 3WP0A 4N12A 2A0UA 4N48A 1WMBA 4RV4A 3ZDYB 3MQ4A 4DABA 1X77A 3FRJA 4YO8A 4BE4A 4YCSA 1O6CA 1PEDA 3ILSA 4AZ3B 4ZHSA 1DQRA 1ZI9A 2Q4BA 2DY0A 1TJ3A 1EUCA 2YWFA 3CRNA 3FYUB 4PLWA 1RVV1 3BA6A 4KJZA 3UJAA 4E03A 4F12A 1AKWA 5CFPA 3FIUA 4F96A 1VECA 2BEKA 2WYWA 2ZTUA 4F04A 2BGTA 2EU8A 1WDTA 2ST1A 5K3DA 3QZUA 3DKKA 4UMDA 2CLFB 3T7TA 3M5DA 4CU2A 2ZT6A 3NNSA 2GNAA 1TKCA 2LCQA 3WGLA 1KYYA 2AB0A 4DIDA 3A1TA 1UBLS 1FUEA 1TJYA 1SVKA 2R2AA 1OROA 5L7YA 2P6RA 3INYA 4H6PA 2FZVA 2V7XA 2YJNA 2RAFA 4ENSA 1KJQA 2P11A 3MSXA 2IPOA 4CQMB 3RAEC 3NTXA 4X8HA 5M34A 3JAKB 1GPH1 3NALA 4B3TB 1OFGA 1P0QA 2R4UA 4O3MA 3GBPA 2XYGA 3EMDA 2H7CA 5BW6B 2HXSA 4ZICA 3IP8A 2NUBA 1HYEA 2AWOA 3A31A 4EG8A 4D6YA 4MHSA 5JPIA 5FTLA 2H1FA 2W6JA 1EXMA 1G4UR 2QAGC 1OYYA 2PQ6A 3QNMA 2IGTA 3ZK9A 2IYPA 5L95A 2GEJA 1NHWA 4O4LB 2UUCB 3FRHA 4JYMA 3SCZA 2IDKA 4IMIB 5CB4A 4P3PA 2ON6A 1LB1B 3TQIA 4BUJA 4J7UA 2P3QA 5K0NA 2B4AA 2G04A 4J90A 4H3KB 3KKLA 1SCAA 1PJAA 4FSHA 4DIFA 4EG0A 2D1QA 1Y1TA 3NOQA 4M0UA 4AJNA 2GARA 3IJ5A 1NYQA 4S1OA 4MUAA 1ZH8A 2OBNA 3RKRA 5EJ5A 4TZ0A 3SSMA 1NG9A 4I1YA 2A7QA 5IMSA 1PWZA 1XMSA 3OQVA 4I08A 4DG8A 3TPZA 5CA0F 3LQQA 4R1SA 3WIBA 3ZDZB 5A9RA 1M0SA 4F6RA 1L7RA 2W90A 3V7FA 2JIPA 3IBFA 4I81A 4P5PA 1T8WA 2PUCA 4MW7A 3C39A 2ZSEA 3IPRA 3CT4A 1ODFA 4QDKA 3T94A 4ZEOA 4RJTA 2I1WA 3SYLA 3MEQA 1KARA 1GNPA 4CE6A 3VH2A 5I9SA 4CM7A 2JFUA 3ZE9A 1SC1A 2N0SA 1RHQA 5JRZA 1VPVA 1OWPA 2O7VA 4CJXA 1TUIA 5BWBA 4NBSA 2JEYA 2GPBA 4F4IA 4M54A 2ZJ4A 5K8VA 4DQVA 4JK3A 4ZCTA 1WS6A 2X5XA 1BDIA 1M7GA 2AL7A 2H06A 4IJKA 1QRSA 1O6ZA 1THGA 3COPA 3FPBA 3L18A 3PNVA 2C3YA 1EFCA 1OI7A 2XMCA 5DLEA 2M6LA 4QTYA 4IGKA 3AL3A 1SC4A 3AR6A 4YLGA 1KJWA 1NDQA 3AHHA 3MMPA 1RP7A 3PJGA 3DE0X 1NSFA 1MAAA 1DEHA 1N0WA 1ZCJA 2JH3A 3ORHA 2RGDA 4JYBA 5M3BA 2HLDA 2ZJOA 4MW6A 1QGED 2XUPA 3OBIA 1BMQA 2R7MA 3FZGA 1BKDR 4OBEA 4ZRNA 3D02A 3GFBA 4JSTA 4NEHB 4DDTA 1XNHA 4IQ4A 3KXDA 2HDWA 1Z08A 3KQSA 1CFJA 4M9QA 4K2HA 3W1VA 1CE8B 3FPHA 3GRUA 5JC1A 3MZ0A 5CD9A 4S04A 5C1PA 1ZM7A 3OPQA 4RAQA 4TQGA 4XM2A 3S3TA 3SK0A 4UQPA 5LYJB 5AW9A 1J7JA 1NZJA 4WL0A 2XMDA 4AWAA 2CHQA 1TIKA 2XDQB 4L7VA 1K6IA 1PR5A 4AZ0B 5U9CA 4RKFA 3WS7A 4MMZB 4YAEA 4YRRA 4ER5A 2R6CA 1VMIA 3FMPB 3D1JA 1TUBB 2X76A 3BDIA 1JB9A 1J06A 2FPKA 4UUBA 3GGGA 1J4AA 3WJ7A 3LUJA 3DPUA 3ZHCA 2VDUE 1TJ5A 1W76A 2XLCA 5L53A 1PR4A 2H8GA 3SI7A 5EE0A 4G9EA 2JCGA 1VE9A 5HXAA 1XV5A 2RGEA 4E94A 1XEWY 3CM0A 2L0XA 3U4HA 1V4NA 1GO2A 3LS2A 3PUJA 4NCHA 1DAHA 2HMSA 3TSOA 2XMRA 3WMRA 4EHNA 4RLSA 5F1YA 1E5QA 3W5IA 1Y8RA 5LZ4A 4ZK2A 2B4TO 1R5BA 1Z34A 3FJYA 3I5MA 2IF2A 3JQBA 4L4SA 2AOUB 5ALYA 4O2BB 1L4FA 1T5BA 3HP7A 1X1QA 4WEOA 3QM1A 5KSPA 1U4NA 1RQXA 3L7MA 4OO3A 1E64A 4JI1B 3CLRC 3HVKA 1HE4A 3GBVA 1F2TB 3TNJA 4QM6A 5AQ1A 5B7NA 2HJRA 1LFAA 2BFAA 3IVAA 4BB0A 3GGCA 4XOIA 2V3CC 4DR4B 4JHLA 2Q22A 3FCXA 4TYQA 3NAQA 5L3SA 3OTIA 4E6PA 1QFXA 2XE8A 3RDPA 3I6BA 2J41A 4NBKA 5C0OE 4NARA 1O5OA 4I4NA 1XLTA 4TKZA 5KWVA 1RZRD 1DBQA 1UMKA 1U6JA 1Y4SA 4RD0A 3DZDA 2M1ZA 3BZWA 3JWJA 1KQNA 4ZPXA 3ZJXA 1P0PA 4DLVA 3HVHA 2HJVA 2MTBA 3ZV7A 5BORA 2I1QA 2JJMA 3JD3A 2D7DA 4LYAA 2GD1O 4U9UA 1D2CA 2DFNA 2RH4A 3DM9B 5CFMA 3H1PA 4D3SA 5DN6D 5CLFA 4XCXA 3HACA 3OJXA 3WJAA 4RO0A 4EJFA 5TS3A 2ODTX 3H8WA 3GG9A 4M87A 4YJHB 5F4BA 3GMIA 4AX8A 1NUHA 3JWHA 4ZT2A 2W22A 2E2WA 2ERCA 4BP9A 2NOAA 3C3XA 5H80A 3T8YA 1ZG3A 1IUNA 1V6SA 3W8EA 1NV8A 2GWRA 4CMIA 3U44A 3LLSA 4DMGA 3EASA 3M3HA 4RVNA 2FK7A 2QZZA 1I3NA 1BX3A 4DJAA 4EHFA 3EB9A 4XIFA 4PCVA 2G9RA 4PGFA 2XHEA 4YJKA 4AROA 4KR3A 4B81A 1H6BA 4M9ZA 2X4GA 1XRLA 1CRPA 3ROEA 4NCJA 2HSZA 2YVUA 1QAOA 4O2AB 4FI3F 4W9NC 4ECAA 3TUXA 1QH0A 2QX6A 2DH6A 1V7PC 3BK1A 4PGHA 4Q9DA 4HX9A 4B3BA 2TMKA 4CIVA 2KMLA 5KTPA 4W9MC 1AMNA 1Z5OA 3K96A 2F8MA 3BH0A 4TLCA 5C2JB 3AYXB 5LP1A 3PNBA 2X5JO 4W5RA 4QBTA 3S2YA 4XLZA 1GUDA 1VSTA 3I92A 4X64B 2PZLA 2W8BB 3GG2A 3BGIA 4IIUA 1N1GA 3FTQA 5JNSA 5BUQA 1JG2A 4ISCA 4PXAA 3GR6A 1UM9A 4Q0MA 4Y3UA 3GF4A 1JFLA 4UCFA 1SKBA 1Y9EA 4ND3A 5KWJA 3ILVA 1L0BA 3JQGA 4MQEB 4PG7A 1CYDA 4YTEA 1VIYA 3PNQA 4Q7KA 4YUVA 4B47A 4CR6A 2Q9BA 1N2IA 2FR1A 2A3RA 3AM5A 1Z22A 3HJBA 4JLNA 3AEZA 4TKLA 4B8YA 4KXVA 4KP7A 4OATA 2P27A 2VF2A 2Y92A 3H8JA 5LLDA 1T1RA 4O63O 1PGNA 1FDSA 2P2YA 2MCFA 4BMYA 2Y1GA 3OEWA 3OX1A 2QAGA 1R5NA 1TZBA 1H2RS 3C41J 3BWXA 1R16A 4JQSA 2MR6A 3RRJA 4UM8B 3ADCA 3CSDA 3WBFA 1GQ2A 4EO7A 4ZYZA 1DXOA 5FBZA 1Q7RA 2I3ZA 3C8ZA 5AVUA 3E22A 4RDXA 4OSPA 1RYYA 2CXTA 4PHGA 4D96A 5LA6F 1UANA 5JALA 3MYRA 3PSAA 4ND4A 2JBAA 1KEWA 1PSWA 1JIVA 4FWBA 4RTNA 4DFDA 2BGWA 1YTUA 3H0EA 2O8DA 1DXYA 1N0HA 1RYNA 1GL9B 1S2OA 1VTKA 2MYUA 2ZYTX 5E2BA 1LTQA 4Q9KA 3V4VB 4CLRA 2XMPA 2Z43A 3BB1A 3B52X 3GRFA 1Z17A 1CF4A 3G0BA 1PZFA 3L4BC 2WHEA 3C5CA 3EBPA 1Q6ZA 2WWIA 5LFAA 4QUGA 4RPHA 5IASA 4X3OA 3U1VA 4RVHA 1LJLA 4OK5A 1D03A 4U7TB 3EPAB 3H86A 3G5TA 4OA8A 4ZREA 4DNPA 5IHXA 3EMBA 3CB4A 3R2JA 1KGSA 3F97A 4Z7NB 4KI7A 4NNJA 1O58A 2BTEA 2O0LA 3GEGA 1BS1A 4P7FA 2YHAA 2WBLC 3BDVA 1J25A 3BFVA 2IVZA 5IJAA 5AJHA 3WLQA 1ZMTA 4BECA 4UREA 4F3KA 5LDGA 4PO3X 3E70C 3WV4A 1U3FA 2BWJA 1MRSA 3E9DA 4XWKA 1XN1A 3T3MB 2OGUA 3OPYA 1K3UB 5ED4A 2B6HA 2W2MA 4FXOA 4TTIA 4R7GA 1TCBA 4JNKA 1P9LA 2J0VA 4UNIA 4WT7A 2GD6A 1TXGA 2Y68A 1H42A 2ZSKA 2B5VA 2AKYA 2HHCA 2JGLA 3CC8A 3P9RA 4K03A 4GPTA 4LVNA 5DBOA 1MBZA 5ITZB 5IX8A 1U0NA 5KQPA 1EUYA 1B76A 2X9QA 1BA3A 1O9GA 1S3SA 3KPUA 1Z0AA 1N5OX 1YACA 1ZONA 3ZGXA 2ZYUX 3ZWQA 2FEOA 3T35A 3CVUA 3U4QA 4OHWA 3OZRA 4XWGA 3WQBA 4AYTA 1Z18A 5LZ5A 2JHFA 2R00C 1K89A 1E6WA 5GJWC 5HBGA 1GYPA 5DOVA 4IXWA 1Y37A 9GPBA 3TG2A 4FPXA 5JC8A 1Z36A 3HFGA 5EFOA 4R1UA 1FFBA 4NBTA 3FLEA 5CCDA 3SHVA 4ZU3A 2ZKLA 3LXMA 3UJNA 1T35A 4MB2A 3WYAA 4RU1A 3GRYA 1OREA 1CNMA 3KT0A 3LGXA 3QLUC 2D0IA 4BYMA 4EPWA 3RYFB 3IT1A 3QBDA 1TMKA 4B4KA 1MJNA 2BHTA 1DBVO 1G8HA 3C15C 3KVNA 3SLKA 2Q3BA 4MHOA 1ZAYA 3I5YA 1M2GA 1QIMA 1UBOS 5K20A 2OBMA 4L4YA 2JGNA 3TX2A 3LK6A 2XBUA 2QLNA 3TH5A 2ZXEA 5CBPA 2PH3A 3PNPA 2GPTA 3F5MA 3KVRA 4EKGA 4BB6A 3I9JA 2FEPA 4JAVC 4KQJA 4ZOLF 5C8YB 2NTVA 3GQBA 3L05A 4UVHA 5FL3A 4YAKA 2ERYA 5BWOA 1SOUA 4Y6QA 2OV2A 2GEVA 1MEJA 3O7MA 3A1FA 2Q27A 2JZOA 2F4NA 3AJEA 2PMCA 3L01A 4HX5A 1ZISA 4NZPA 1M2VB 4BNWA 5CEJA 2ONKA 4P5DA 2XYRA 4BBZA 1NQ5A 3BKXA 3D5TA 2DM6A 4NZNA 5DE3A 4L57A 5ALNA 1XGKA 4NULA 5A6SB 3DDHA 3ZWCA 1R6UA 1CT9A 1DO8A 4YLYA 4AY2A 2H57A 4X7PA 4C3OB 1FYWA 4LTDA 1N6NA 1YL6A 2XCLA 5M7EA 3WLNA 1OY1A 2NIPA 2WU1A 5JYFA 4B87A 3LCJA 4N0MA 1CUSA 3HI6A 3VTZA 3MCWA 4JMLA 4OKNA 3VHQA 2I1VB 3IO3A 3NFYA 4P32A 4KOEC 3NHRA 1RKBA 1JVBA 3TIVA 4PLYA 1J00A 3K5PA 4YIKA 4IFIA 4GT1A 4G2TA 2QTHA 2WAMA 4DEVA 3QYPA 1NW3A 2ZIFA 3FETA 5E3JA 3MAJA 4UHCA 1DQZA 1A9QA 2PLFA 1FNDA 4XX1A 3WFIA 1QKKA 3CLHA 2ZYSA 4G25A 3M7IA 2W48A 5KNDA 5ESDA 2PX3A 1BTOA 3SQXA 3LAWA 5FQNA 4ZOEA 1C8KA 4MUYA 1N7IA 4P4UA 2WDZA 5KX5F 4HYQA 5DBEX 2AMVA 3W06A 2PKCA 3AUFA 3R9KA 3SHFA 3TINA 4LAFA 3GAFA 5B7QA 2HU2A 1Y34E 2F62A 1ORHA 2RCYA 2H29A 3ELYA 3F46A 4QDOA 5GVRA 3W2IA 2C7RA 1V39A 2YFYA 1IZ9A 2XVMA 4S35A 2Y05A 2WUVA 3IQHX 5HUJA 2ZYWX 4HT3B 5DULA 3DFUA 1DIBA 3LYHA 4RESA 5KHAA 1ZUD1 2GEUA 4W9NA 3ENKA 2DE0X 4FMBB 1E7MA 3U40A 2JRCA 2KWIA 1LNQA 1TO6A 1PT7A 1CWUA 1Y4AE 2AYYA 2MSLA 1FFGA 4HCJA 1Z33A 5HE8A 1E3QA 3FX2A 3EEFA 3S2FA 1SUSA 4R83A 1I3MA 1K7SN 2BONA 2J9RA 2VL7A 4J0EA 5AW3A 6Q21A 1NRWA 3K70B 4R40A 3C3EA 1N7JA 4F1KA 3FM9A 2CL7X 1RWQA 2PRKA 1ND6A 5ALLA 4C7BA 4MZDA 4X7RA 1N5JA 5TSDA 4D9NA 2X2FA 1OXXK 1XTKA 1YRHA 4IQ8A 2PGAA 4WY8A 1NP3A 3EXG1 4ZZ1A 3K6SA 1GYQA 2FCAA 2JFYA 4R2IA 4E46A 4KH0A 4G4SP 4NG5A 4RF2A 4GQIA 3O8NA 3KKOA 1VJ0A 2AS0A 4GBMA 1Z37A 4M22A 5JW6A 5I01A 4B4VA 3SM3A 3CEAA 4AKEA 2X23A 4ZEMA 2FF7A 1I7BB 1KK1A 1VJ5A 221PA 2MINA 1OHHD 3OCXA 2CXRA 3RO7A 1PKEA 3JQ8B 1H3FA 5H70A 3FSRA 2JFPA 2O8BA 1H5NA 4DQUA 4DR6B 2VP4A 3HB4X 3U16A 3NC1C 1CBUA 2XYQA 2JATA 4RFVA 2XODA 4XGRA 3C4JA 1EH5A 1XZLA 3LYUA 3H7AA 4C2AA 2WB2A 6PFKA 1NVBA 4CKZA 3UA4A 4G5HA 3A6GA 3I8OA 4X93A 5EC8A 3ZTTA 3BHMA 4ADSG 3KXLA 2KBFA 3O38A 1O4VA 3CS3A 5AK3A 5CCEA 5FPSA 5E4TA 4AJEA 2P9ZA 1GTL1 5JBQA 3PI6A 1Y3AA 3L4BA 4P80A 3KL2A 3VTFA 5J2UB 4PYJA 2GBCA 3IUJA 4Z5XA 5IWCA 3PNOA 5E6RB 2E48A 2O2JA 4UBIA 6ABPA 1Y1PA 1XMXA 5JCJA 3R3UA 1YGPA 1DT3A 1VL2A 4AP6A 1P7PA 4LV5B 1XN4A 3D7LA 1KZ6A 2H5IA 4EI8A 5CG1A 1Z62A 3N0WA 4MUMA 2IH2A 2Y1XA 5LD2C 3VMFA 3E6AA 2PMWB 1AKNA 1DP4A 4XM1A 2QUZA 5TMEA 4CM9A 2AXNA 1O97C 3G23A 4ID9A 5AI8A 3G9ZA 1NDHA 1YZNA 2D13A 2ID7A 2IZ5A 2NT4A 1POXA 4JB2A 1KZ7B 1BO6A 1IEVA 3H2KA 4FI3C 4MCIA 1N8KA 2PJDA 3F2VA 1LVGA 2HA4A 1Q3HA 3QEAZ 4ILKA 2GSDA 2E1PA 5LWQA 1Z2PX 5C5IA 1G8YA 1KGDA 4GI1A 2XGMA 4RGBA 5YASA 4ZVPA 3JYNA 2UXDB 3M9WA 1HLFA 3ZTYA 4CHGA 3GFTA 4HNVA 4B8ZA 1ZH6A 1QP7A 1AHHA 3OT1B 1I2BA 2G88A 3ETCA 1M72A 4RHXA 3UJBA 2J48A 3KC2A 4AP5A 5AM3A 3B5IA 5L4SA 3VGPA 4WOBA 4YFVA 1N78A 4YREA 3JRWA 4EM6A 1JDTA 3FUVA 4TS1A 4AY5A 2J67A 3UMBA 2R00A 1K4YA 1XX6A 1DVRA 3VO8A 1T8PA 3BMNA 1X86B 3V33A 1G41A 1QJ4A 3E4CA 1IDOA 1UOPA 5HIIA 3UQZA 2GQ0A 2P75A 4KMSA 4ZAGA 4X63A 2VHEA 2FXVA 2JLQA 5CFOA 1H4SA 4AK1A 3R7WB 4V3CA 3DBVO 3EXHC 4EHAA 1H2ZA 1JE1A 1V8ZA 4BO3A 3M6LA 1TQHA 2ODAA 3STWA 1CR4A 5F7ZA 3K35A 2EL7A 5H02A 1TT7A 4H31A 4Z7OB 3P0FA 3QLUA 4PX3A 3VNAA 1QXSA 3A6HA 3BJRA 1JBQA 4PRZA 3L6OO 3X1KA 2AYZA 2FAXA 1E1QA 1SU4A 1ZHHA 2YBDA 3Q40A 2RAUA 5KO2A 4EP1A 1KIAA 5EWLA 4BNNA 1IJBA 2O0KA 5KS2A 6ADHA 1O89A 3C98A 2C5FA 2NO5A 3K31A 2VJKA 4FC6A 4IF6A 4KAAA 2A2ZA 1GAJA 1R4NB 1K6EA 1N92A 4MUIA 1AGRA 2D4AA 2O2IA 5ICMA 3H19A 1EFAA 4L73A 5CA0A 4C43A 1KDOA 3CX6A 4MQ4A 5B5SA 1Z6YA 4U00A 2GZ1A 1WD7A 2DWPA 3NBXX 5DLPA 5FR1A 1AD2A 3DP7A 4IJ6A 2C4HA 4G1BA 1WUYA 4KXXA 4JD5A 1M1NB 1KMHA 1EVLA 3IDAA 4IS3A 4ML3A 3GRZA 4KE6A 1KBOA 3AKDA 5CT9A 4I66A 5K0LA 4LXIA 4RHUA 1ESDA 1I13A 3ZLUA 5DH9A 2G4CA 1J23A 4N7BA 4GPD1 1N2SA 1UPUA 3N87A 4N5LA 2EKDA 4GRAA 3VDRA 4X65B 5CDFE 1GSIA 1X1RA 3QHQA 1V5FA 2CDRA 2SKDA 4FDLA 7REQA 2VK4A 4XKJA 4H7KA 4AY3A 1HK7A 2PXHA 5EXPA 2FN9A 5KYXB 3KK0A 3W5UA 3IJPA 4UDOA 1UBRS 3R0XA 4HC4A 4WSOA 5EKUA 2JVKA 4OGLA 3CVWA 2RBGA 3HBJA 4HB3A 4L72A 4MV1A 4YMTA 1HT3A 1X8XA 1JQLB 3GPIA 3O31A 4MKGA 5DKFA 2AX3A 1N4AA 4EYQA 4W63A 3O1JC 1JECA 1TMYA 1EX1A 1ZN2A 3A0RB 1KYIA 2ZJ2A 3IJRA 2DG2A 4P83A 5FEMA 4J1SA 5AJZA 4PV7A 3BN3A 5LP6F 2AUTA 1XTBA 2IYXA 4H0FA 3VJKA 3AX6A 4GBGA 4G5GA 1N9KA 1RXEA 3REGA 1ZVVA 3OVMA 1CRWG