1YL5A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
b'AMARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl5A01
1F12A 3K73O 4KP7A 3BIOA 1NR7A 1Z45A 3GVXA 2RHCA 4IS2A 1MC5A 1FK8A 1C1XA 2ET6A 3HADA 5CDTA 2B5VA 3K2EA 5DZSA 1PZHA 2EV9A 3PDJA 2OFPA 4A7PA 4R3NA 1GV0A 1RYEA 2DM6A 1ISGA 1PL7A 1Z73A 3QQPA 2ZB7A 4H15A 1RPNA 4N5MA 3VPSA 1PGQA 2BLLA 4W9NC 2VTEA 2Y1DA 4RF4A 2CDBA 5CFZA 2ZTMA 3P19A 1ENYA 3JTMA 3KLPX 1H6AA 1N7HA 1QMGA 3CZMA 4XZ3A 5B4VA 4QSMA 1EBFA 3ONFA 4PG6A 1UP4A 4UEKA 3V2HA 3GGOA 2NVUA 4Q3NA 4E2WA 5JXWA 2P9CA 4B4OA 3SLGA 2FOIA 1EUDA 5A5FA 2NVBA 4OAQA 3PPIA 3ASVA 4AG3A 2HCTA 1UZMA 3FPCA 2O7SA 4AJNA 4CMBA 3PHJA 3FR7A 2YQ4A 3BTUA 3OJFA 3F4LA 4IQ0A 5JAMA 3T7EA 3MEQA 2QW8A 2HMTA 4IZIA 3GMSA 4WOKA 2DTEA 4ID9A 1PGJA 5JLAA 3T4EA 3GN1A 4ALNA 2RIRA 4BNFA 5L4NA 1BVRA 1D1TA 2Q1UA 1DRWA 3M2PA 3VKVA 3M1LA 1IOLA 1MGOA 1ONOA 2B83A 4PVDA 2PK3A 1HE5A 3LYLA 2BI7A 2DTDA 4BQRA 4F46A 3CXRA 3TQHA 4KQXA 5HM8A 5TF4A 2PNFA 4GKVA 5BQFA 1HDCA 4XGIA 3KSUA 1QP8A 4EBFA 1X13A 1NWCA 3C7CB 3TL3A 3Q3CA 2FZEA 1U4OA 1N1GA 5C7IO 1WZIA 1Y7TA 2LDXA 2UAGA 3AM4A 1T2FA 1XHLA 3KLMX 2HMWA 3AW9A 4J0EA 1JN0A 5ICSA 1XU9A 1DAOA 4NU6A 3PWSA 5ADHA 4NDNE 3FI9A 4NMHA 3AOGA 3VVCA 4BHTA 2X0IA 2X86A 4WE3A 1E1NA 3AFMA 1IHYA 5KNLA 1ADCA 4CM9A 1C3VA 3G3EA 3UCFA 3ZWPA 1PGPA 1KC3A 1DRVA 3ZU3A 5K6AC 2X0RA 3WQSB 1DO8A 4R5MA 2EP5A 1VI2A 1SO8A 3DONA 1HRDA 4RF3A 2EKPA 3KYDA 1IHXA 1JWAB 2XAAA 4U8GA 1G0NA 3RFTA 3WFJA 3F9IA 4BO8A 1A9YA 4HXYA 1ADBA 4D45A 1U1IA 4RL6A 5EQFA 5FEUA 3JD1A 3GPDG 2B4QA 1CYDA 4QX6A 1UP7A 5CG1A 4GI2A 4FOSA 1RYDA 3IJRA 2V6MA 3GAFA 1GYPA 4XKJA 1MFPA 1XELA 3I83A 3BMOA 5J9GA 5CEJA 5KCZA 4BNKA 2I99A 3PQEA 3PZRA 1NBOA 4G65A 2F00A 1ZK4A 1LLUA 3BMCA 3PK0A 1LNQA 4B3IA 2YHIA 2I65A 5DOZA 3ZI0A 2WSBA 3HN2A 3TFQA 3H7AA 1D7OA 1X15A 3WSWA 3E5MA 1XR3A 3AY6A 2VUUA 3CTMA 3P5SA 2QYTA 3U49A 5JCXA 4BO0A 2WE8A 4D3FA 5TGDA 5L4LA 1MC4A 4P4LA 2OMEA 3UXYA 3V2GA 3KV3O 4MKZA 1QG6A 4HP8A 1BXKA 4IPTA 3BTSA 1RJWA 3X2FA 1QLHA 4GGOA 1GAEO 3MJCA 2CSUA 3CSDA 3OH8A 4XR4A 3VH1A 5JBIA 2X22A 1PWXA 1WPQA 2FPGA 5EINA 1Y8QA 2R00C 1GQYA 3OJ0A 3DAFA 3EVTA 4IM7A 1ISMA 3MJSA 2HMUA 3ZWXA 4U6QA 5KVQA 3VPFA 2YV3A 3AI1A 5JY1A 2QG4A 4MP8A 5IN4A 2IZZA 3KXDA 3QY9A 2O3JA 4IDEA 1TA4A 3EYWA 3ORFA 3H9UA 1DIBA 3AJRA 1UXHA 4CQMB 3ROPA 2X9GA 2VUSA 3KSZO 3HDYA 1K6IA 2CY0A 4DBZA 3DDNA 3DZGA 3HDQA 1NPYA 3EW7A 4TRJA 1HTBA 2O4CA 4BKUA 3PJEA 3GUYA 4CLDA 2VN8A 5TC4A 3JD3A 1VM6A 4P38A 2Q1SA 3JQAA 3I52A 2IZ1A 2Y1GA 2P2SA 1TT5B 1PJSA 2EERA 3WJAA 4ALMA 3LZ6A 3PWKA 5K6AA 3L07A 1NHWA 3DMYA 3NT2A 4MPDA 4YJFA 2Q49A 1RM0A 2GPTA 3ZWVA 1LDEA 1KOLA 4R3WA 1UDAA 4R1TA 5H83A 1P74A 3QV1A 2OBNA 1PJQA 1HDGO 1HF3A 3E48A 6ADHA 4TQGA 3OQBA 1Z7EA 3E9NA 4IMRA 4FFLA 4Y67A 4BB5A 3ZNOA 5L45A 2NM0A 5I7FA 2H6EA 3B20A 3Q11A 5I7SA 2QYSA 5IZCA 4B4VA 4ZQGA 1FXSA 4A0SA 3PYLA 3WBBA 2NADA 4JNKA 4GPD1 4JP2A 4M89A 6LDHA 3MWDB 3C24A 2PY6A 4NPCA 5I9NA 1ZEJA 4XB1A 5COAA 1UXIA 2YV1A 2W90A 2UV8A 4XQ9A 3FTNA 5B4UA 5JNLA 1G0OA 2FP4A 1ZMTA 2O7QA 1Y6JA 1YL6A 1IPFA 2GN4A 4LISA 4HBGA 4MIOA 4CMHA 1XCBA 1LTHR 4YRBA 5M6DA 3ZCXA 4AJPA 1KC1A 1NAHA 4ZRMA 4E3ZA 5EERA 2VQ3A 4Q3AA 3GDFA 1ZO8A 4Z0TA 4J91A 3B1JA 2DFVA 1YH3A 1LDBA 4HWKA 3S8MA 2HK9A 1RM4A 1OBFO 2OZPA 3ZN2A 4NZ9A 3B1KA 4ZHSA 3KYBA 4ESOA 5LCXA 3NYWA 3GK3A 1NQTA 1HE4A 1JKFA 3AU9A 3DOOA 3KYDB 1WMAA 3L4SO 1K3TA 1JAXA 1PZFA 5KJFA 3ZHZA 3ZWNA 5DT9A 1HWYA 1I3KA 2ZJ0A 3FWNA 1W73A 4WCFB 1N92A 3U62A 3IMFA 1GR0A 1NASA 2ZTUA 4RVHA 2PGLA 4WCDA 3W8DA 3CIFA 5KOIA 1U4SA 2R6JA 2DBVO 1U3VA 4H16A 4ZQHA 3EY4A 3NGXA 3ZU5A 4MVJF 1DRUA 1E3IA 2X8LA 2TMDA 3DFUA 3CMCO 4W6ZA 5KKCA 1CETA 4EEZA 1YJQA 4BNJA 2WYVA 3QWFA 3MJ4A 3NKLA 4WNIA 2BHLA 1JW9B 3KRTA 2HAEA 4BKOA 3PDUA 5HS4A 2BFPA 3B70A 3PJDA 4CV2A 1MX3A 4DYDA 1MG5A 3U4DA 2BELA 5KIAA 4Z9XA 3B1FA 1GY8A 3GY0A 3I6IA 5JYEA 4FFMA 4B8ZA 2O3RA 2FY8A 2NSDA 1VJ0A 1HLDA 3ABIA 3BTVA 3ZWYA 4I8XA 5TLSA 3ETEA 2W2LA 4L76A 3OEYA 2IXAA 2PKRA 1Q0QA 4LSWA 4RVDA 1PEDA 1GYQA 4YJHB 3JQCA 1YO6A 2HU2A 4FDAA 1EFKA 1T1SA 4C7JA 3LT1A 3HG7A 4DLLA 1B8PA 2GZ2A 3CUKA 1H5QA 2QQ5A 4I5DA 5BSGA 1VC2A 5B37A 4Q39A 4MVJM 1C0IA 2P5YA 3ITDA 4P4GA 3RUIA 3V1UA 1E5LA 3NUGA 3ANNA 1V3VA 5I8ZA 1YXMA 3CINA 1KETA 1LDMA 5COQA 2A4KA 2Y05A 1QYCA 2QZZA 3WNVA 3WFIA 4ALJA 2EW8A 4LCEA 1V3UA 5A02A 4UVEA 3BXXA 4YR9A 1H6BA 3RVDA 1DIAA 1K2WA 1MB4A 5G0VA 5AYVA 3WMWA 4R51A 3WJ7A 1EVIA 1O5IA 3UKOA 1X0XA 2I67A 3DTYA 3IS3A 4J1TA 3OQ6A 3OA0A 1YL5A 1NR1A 1VLLA 3DQPA 4BB6A 5EIOA 1I2CA 1UXJA 1DXYA 5DBGA 1I24A 3OM9A 3VAZA 4O63O 4II3A 3ON5A 4BNZA 4RORA 3WIDA 1KY4A 1VSVA 4RDHA 4OQZA 2WYWA 2DLDA 2EGHA 1C1XB 4IUYA 4OHUA 2P9EA 3C1TA 1SZJG 1EK5A 1SMKA 4NQZA 3ROQA 1OOEA 4CMCA 3GEGA 1GPDG 4OXNA 5EPOA 1HYEA 4J7CA 1NX6A 3S1LA 3H9EO 1N7GA 1R0SA 5DOVA 1P1RA 4BNVA 4GQAA 5L9AA 3HB5X 4YT8A 4YXFA 1V9LA 3DC2A 4YA6A 1I33A 2UUPA 3HFSA 5MDHA 4CMIA 5IDYA 2A35A 2O4UX 2E37A 4BMNA 1DFGA 1B16A 1GZ6A 1B3RA 4UULA 3GAZA 5IZ4A 3OEWA 5C7LO 4OOEA 4R5HA 3KZVA 3D7LA 1LXCA 5B12A 4I5GA 2AQHA 4PRLA 1ID1A 4PG8A 3GGGA 5A3VA 1HXHA 2E49A 3S2FA 1T2CA 4BMVA 1ZSNA 1X7GA 4J6FA 2VRCD 3I9LA 3JQ8A 4YAJA 1QYDA 4OXKA 2P4HX 1BSVA 2GZ1A 1ZEMA 1HYGA 2IEBA 3WGIA 3RU9A 1SPXA 1LRJA 1T24A 1YOVB 1F0YA 3HSKA 2PKQP 3OECA 4ZVVA 5DBFA 4ZQEA 3RJ5A 4I9HA 1SEPA 3V1YA 2V6FA 3DBLB 1I2ZA 1NFQA 2BFOA 1YB4A 4O59O 2G5CA 2DQ4A 1DLJA 3H9QA 5HWSA 4CJXA 1O6ZA 5GZ3A 2B4RO 3JYNA 4BQPA 3MJEA 4EUHA 3G1TA 3VZRA 4UVGA 3DL2A 4K6FA 1E7QA 4OOFA 3Q9NA 4IBOA 1KEPA 3AK4A 5JDCA 3GZNB 2ZB8A 4TKLA 4DYVA 1T2EA 1E7MA 2E6UX 2JHGA 4OSOA 1I32A 1I3NA 4RVUA 4M1QA 4J49A 4OYRA 2W2KA 4R41A 1EK6A 4QUKA 1P33A 2AEJA 3EGOA 1I2BA 1Z7BA 1FF9A 3ENNA 2Z5LA 4CV1A 4XD2A 4E4YA 4RQTA 3F5SA 4RLSA 4CLXA 1WAMA 1P45A 3C1OA 3PP8A 1DIRA 2VHWA 3RQSA 5ER9A 4KTTE 1WDKA 3I4FA 1NVTA 1CWUA 1PL8A 3JQ7B 4CLEA 4MIEA 3D4NA 3WGHA 4YQYA 2J3IA 3JQBA 4J7XA 2PA3A 1UAYA 2GDZA 3JQFC 3DOCA 4N54A 4TMFA 1N5DA 4PFJA 4G5HA 5B1YA 3FTPA 1XEAA 1XA0A 4W7HA 4FQ8A 4GWKA 4RPGA 5AXCA 3ST7A 1HSOA 4Y98A 1M2WA 3ZWBA 5L7YA 3VHRA 3LC1O 2X5KO 3C7DB 3RU7A 3BMCB 2E4AA 1QV6A 5T5QA 4TWRA 1HDZA 1XQ6A 4OKNA 4DLBA 3I9JA 2OORA 3WGZA 2HKIA 4BGUA 1GL3A 4XB2A 3R6DA 4BNMA 3WBFA 3RUAA 1E0DA 1KEWA 2PZLA 3W6UA 2C82A 3O26A 5EMHA 4KOAA 3LF2A 3X2EA 3LVFO 4PG7A 4BNNA 4WKGA 3N58A 2DFDA 4IJKA 5BR7A 3INTA 5AXBA 2X9VA 2OOSA 3PVZA 4GAEA 2GNAA 2EHDA 3WGQA 5JY6A 5CDYA 5DCYA 3TZCA 2Y0EA 4RO0A 4E13A 3DTTA 3KOUA 2IODA 3AUAA 5BNTA 1BGVA 2VWQA 2O2YA 4E2ZA 1R4NA 1U5CA 2QX7A 1WXDA 3RWBA 4BO4A 1DC5A 1V8BA 1B26A 1CRWG 2UYYA 3SJUA 3PTZA 3DOJA 3SEFA 3TNLA 3AY3A 1Q7CA 3IL2A 1YQDA 2H1SA 3L4BA 3RCBA 5IDXA 1MFZA 2JL1A 3O03A 3QWHA 4M49A 3WX0A 3JYLA 3RC9A 1EUZA 4IDGA 4XEHA 5ILOA 1PQWA 1XIVA 3D4PA 4KTVE 1MXFA 5T73A 3EDMA 3PJFA 4CMAA 3C1AA 2C54A 5K0ZA 3TFOA 4E5YA 4KUEA 2WTBA 2VWHA 2IXBA 4E2XA 2PFGA 3EZLA 3H9JA 4JCOA 5I9LA 1LSJA 3FNHA 4AJIA 3RASA 2PD6A 2DKNA 3NGLA 2BD0A 1RM3A 1PIWA 1ZFNA 1ZK0A 5TT0A 1P77A 4EZBA 4BOYA 1E1MA 4ITUA 3CEAA 1ZZEA 3FBTA 2NUAA 3QHAA 3GVHA 5IF3A 4XYGA 4PZEA 3RJ9A 3JQFA 3JQ9C 1YOVA 3ANMA 1D8AA 3RKUA 4O5OA 2VRCA 3RFVA 3U3XA 3TN7A 4YRDA 5AQ1A 2C20A 4R9RA 3WS7A 4D7AA 1GUZA 4GX0A 1GADO 1EUCA 1HE3A 4IINA 2AQIA 5L53A 3O8QA 4M86A 3WQRA 2IDZA 3KETA 5KVCA 2YDXA 4BKRA 4CLHA 1W8DA 3OQ1A 3K8ZA 5IG2A 3BA1A 2GLXA 2CFCA 2QRLA 3KYCB 2W4QA 3QRWA 4J1QA 3NAQA 3P2OA 1I5RA 1M6HA 3K92A 1PZGA 2ZTLA 2VNSA 4FW8A 4OKIA 2Q1WA 1XLTA 2PZKA 2Q99A 5JDCC 2GR9A 4J2OA 3AI3A 2VRBA 3JCZA 4EI2A 1Y1PA 1KY5A 2VT3A 3GHYA 5F5LA 4CMEA 1LQTA 4KDFA 4XGKA 5CAEA 4Z0HO 3PGJA 3HN7A 1QXSA 3IUSA 4MOWA 3UHAA 1WDLA 5JSFA 2YYYA 3DB2A 4NU5A 4R68A 1R0KA 4KDEA 2HDHA 3MCVA 2RHRA 3QE3A 4GX2A 1NPTO 1X7HA 1X7DA 3RUCA 2Q50A 4TZKA 4AJLA 4MINA 3HHPA 3LK7A 4RDIA 3NT4A 1MUUA 2RCYA 2BFAA 4DA9A 3LC2O 3C3XA 4R16A 2CZCA 3OA2A 5IAAA 4P8RA 1MP0A 5C3MA 1XGKA 4Z6KA 3ETDA 5F1OA 4M54A 4PG4A 3OF2A 4CUKA 1FDVA 1PWZA 3L9XA 1U3UA 4K1LA 4U0KA 1YGYA 4BNLA 4N5LA 4UAGA 2AEFA 2ZTVA 1UAGA 4R69A 3H5NA 4DWVA 3H9GA 5KJCA 5IZCC 2J3JA 5A9TA 2X6TA 2JAPA 4RV9A 3QIVA 5AVOA 1IULA 4M8SA 2ZCUA 4E6PA 3N7UA 2DU8A 1P9LA 2PV7A 1WNTA 1VL0A 2X0JA 1F8GA 2CF6A 4BNGA 4URFA 1M6WA 1W0CA 3TDKA 4YACA 4I1IA 4XR9A 4B3JA 4J4HA 4MVJD 4MVJG 3K9QO 1YKFA 8LDHA 4NNJA 2PWZA 3GQVA 2B36A 1R16A 2EWMA 3MJTA 4E5MA 3NTQA 1EVZA 4HNGA 4PLCA 1I10A 3INGA 5CDUA 1LC3A 4FOOA 1E7RA 1LSUA 4W9NA 1GPJA 1TB4A 3FR8A 5JE8A 2PGJA 1O8CA 1P1JA 5EQDA 1QLJA 4UREA 4XDZA 3ZWOA 1NM5A 3L6OO 4E2YA 4TRNA 1WDMA 4RZHA 2EF1A 4ZRNA 3FWZA 1DPGA 5T8KC 4DC1A 3ANLA 2JCYA 2WM3A 3NDIA 1SOWA 3AM5A 4R01A 4GGPA 4AJHA 2Y1CA 1AGNA 3B6ZA 1Q1NA 2GZ3A 2BGMA 1E3WA 1CQIA 5C7OO 3DMTC 3GFGA 4GWGA 1SC6A 1SEVA 1DHRA 2BI8A 2J5KA 3VOSA 3W6ZA 3WB9A 4WK6A 4BV9A 2X1HA 3ZHXA 4Z3KA 2PD3A 3F3SA 1NQAO 1LUAA 5IDQA 2NQ8A 3KVOA 3W8FA 1AN9A 4FC6A 4FJ2A 3LLSA 1ZSVA 1PSDA 4NK4A 1ONNA 5JMPA 5TIIA 1RWBA 2AW5A 4EJ6A 2O23A 4S3MA 1C0KA 1LDNA 2YQ5A 2GERA 4EJ0A 1Q0LA 4HKTA 1KVQA 2PZMA 3K96A 3PFFA 4YT5A 2X9NA 5T6BA 1T2AA 7MDHA 2E82A 2H5LA 2DPGA 2Y68A 2VOEA 3BMQB 4GLOA 5A06A 4B7CA 1E7YA 3G17A 1NPDA 4GH5A 1C1DA 1PR9A 4TZTA 3ZV5A 4CLOA 3JQDA 5LDHA 2WWRA 1E3SA 3U0BA 3V8BA 3DZKA 3K2BA 5JAZA 5B4TA 3U09A 1W4ZA 4PLVA 2P4QA 2VHVA 3QSGA 1ONPA 1H0KA 4CMGA 4WCFA 1E6EA 3ZU2A 4YDRA 4RVGA 5ES3A 5JO0A 3KYCA 1X0VA 1MXHA 4CUZA 4AJEA 4J16A 1KEUA 5HBRA 3L77A 3UN1A 4UVIA 5IJZA 4BIIA 1LJ8A 1KS9A 1UH5A 2AMFA 4Y6SA 4F6CA 4FIZA 1VJ1A 3DBRB 3NRCA 3PRJA 4HFJA 4TVOA 5FI3A 2ZJ1A 5CEFA 1QYWA 2ZYGA 4RPJA 1F8FA 3BAZA 1SNYA 2I3AA 2GCGA 2OP1A 1KVRA 2X23A 3LT2A 4CR8A 1GD1O 1A7AA 3KEQA 1J6UA 1U5AA 4CM5A 3TSCA 4NHEA 4CM8A 5TJHA 1EVJA 4F3YA 5K9ZA 3DBHA 3GVIA 5CPFA 1S6YA 4ND1A 4F6LA 4DC0A 5THKA 3EK2A 1AHHA 5GY7A 1R15A 2EJVA 2EW2A 3WGOA 1MA0A 3GGPA 5F1PA 4DGSA 2OBYA 2VOJA 4YEDA 3VKUA 1GCUA 1M76A 4K9DA 1B2LA 4P4NA 3PYXA 1YDEA 4JIGA 1UP6A 1LI4A 5IFLA 4IXTA 1OZAA 3TZKA 4IDFA 2GD1O 4L4XA 3DBLA 3WLEA 1Y5RA 4C7KA 1ZXBA 5ER6A 4PRKA 2A9FA 3K30A 5AOVA 4AVYA 4M55A 3WTBA 2NU6A 5CHEA 1GQQA 1PS0A 3D4OA 2HMSA 1DAPA 4E0BA 2DVMA 2WJPA 2NWQA 4GSLA 1SB8A 1CQJA 1KBZA 3QVXA 1VKOA 1Y81A 1E3LA 1X1TA 3PHGA 4BNXA 5I7VA 2FWMX 4L9RA 1BRMA 4R9SA 3OIGA 4FGSA 3CH6A 3I9NA 3VZQA 3RBVA 3Q2IA 4ZA2A 3UUWA 5ENVA 4WLOA 2YDYA 3NJ8A 1N9GB 4D43A 2JFHA 4I9NA 1MV8A 3DFZA 3PQFA 4YWJA 4JBIA 4I5EA 2CNBA 5JCJD 3PIDA 2EKQA 3RUDA 3I9MA 4J1NA 4CR6A 5T57A 1V35A 3OIDA 3NX4A 4XQCA 1CERA 1B8UA 1IZ9A 4BO5A 2DUUA 1HETA 4I08A 1O95A 2QIOA 3DO5A 2YFHA 1KEVA 1GU7A 3ZW8A 2ILTA 3SXPA 1YBVA 1LDYA 5H81A 3TPCA 4BNIA 2NU7A 2V7PA 3EUWA 3PZBA 1DDOA 2D8AA 4MVJP 1PX0A 3M2TA 1ISHA 1Q7GA 1IYZA 4FB5A 3HQ4O 1E92A 4BO6A 1P1KA 2I76A 1ZK2A 1M67A 3DR3A 5KJEA 3DHNA 1E3EA 4W4TA 2HQ1A 1ZIDA 3INRA 4CLRB 9LDTA 1LSSA 4D41A 3PFWO 1PL6A 3E9MA 2EEZA 1XWFA 3PHHA 5T64A 2AA3A 2IZ0A 5MGBA 1PJ3A 4YT2A 2ZATA 2OP0A 2Q1TA 4IQGA 3IKTA 2PKQO 1PGNA 5U4QA 1DJNA 1WLYA 4W99A 3UCXA 3S2EA 4CL3A 4CLOB 1TT5A 4YBZA 3D3WA 3GPIA 1R6DA 2G1UA 4GSKA 1GUFA 1EFLA 5JPIA 3U4HA 4EITA 1K6JA 4XIYA 4IJVA 4FJ0A 4O0LA 4YJFB 4CV0A 3GT0A 1X14A 1R4NB 3JQ8B 1J0XO 2ZIZA 1EMDA 4LSMA 3HNPA 1N2SA 1RM5A 4EJMA 1EZ4A 4BMSA 4Q3DA 1BHSA 2VUTA 2B37A 3IQDB 4ALKA 3FN4A 3DAPA 4DPLA 3WGYA 4DMLA 3JD0A 1MLDA 2EKLA 4YAEA 1KVUA 2OO5A 3FRJA 3HDHA 1PQUA 1AXGA 1BXGA 4XQGA 3UH1A 4OO3A 3PHIA 3N74A 1HZJA 4RCVA 3GNQA 1BDMA 4FFNA 3DBRA 2GSDA 4YJGA 1UR5A 1ULUA 4I5FA 3VH4A 1U8XX 4DXHA 1ZKMA 3D1LA 3FSRA 1Z6ZA 4QFDA 1Q0HA 3WYCA 5HTOA 2PGDA 1VKNA 4H3VA 3ENKA 1ZJYA 3H3JA 1YWGO 1T2DA 2D3TA 2NTNA 3COSA 2EGGA 3GZNA 4F45A 1T4DA 4U5QA 2B4TO 3HFGA 1X1EA 3GUCA 5T67A 3JQEA 5COBA 3DBHB 4YVFA 3F47A 1P1IA 5TJ9A 2W2KB 3CMMA 2QRJA 3S2IA 5A9RA 2UUOA 3RAJA 2JKVA 1BW9A 4NJMB 1GZ4A 1EDZA 2PR2A 4X54A 1JKJA 3WYEA 3LLVA 1XDWA 2H63A 4WCFC 4A03A 3NTRA 1B15A 4YB8A 3GZ4A 4HV4A 1IZ0A 3O9ZA 1I8TA 5DDIP 3JQ7A 3VH3A 5F3RA 3WGGA 4BL5A 4PN3A 3AI2A 1LX6A 4K6CA 2YY7A 4QFCA 2O3UA 3E1KA 3JQBC 3GH3A 3G0OA 5A1TA 4J0FA 4MDHA 4ROSA 2VNAA 3WQQA 3W4JA 5G0WA 1FDUA 2C5EA 3SJ7A 2C5AA 4KUHA 3HUDA 5JCJA 3F46A 5JO9A 3H5RA 4XRRA 4ZQFA 2G82A 4J2HA 1V6AA 4NFHA 1ZH8A 5AXAA 1JVSA 4E21A 4EEXA 1DSSG 2J8ZA 3O4RA 1NWHA 4JX8A 3JV7A 4LCJA 3MZ0A 2FHSA 4TROA 3SBOA 4MVJA 2G76A 3W8EA 1V3TA 1RKXA 1IUKA 3GMDA 4Z3DA 3R0IA 4BNHA 3QVOA 1YONA 4DPMA 4QTZA 1DBVO 1WZEA 2C7VA 3O38A 1BG6A 3TZHA 5CG2A 4NFYA 2GRAA 3QW2A 3FD8A 5EESA 2J3KA 2O3QA 1VRWA 2TMGA 3M1AA 4WOJA 2PH5A 1H6CA 4J90A 1A72A 3VDRA 3C85A 4IDDA 4KWHA 4YJHA 4B4UA 2J5RA 3MOIA 1S7CA 1LLCA 1XG5A 3E18A 4GMGA 1PU2A 2G17A 2CVZA 4PVCA 3DMTA 4NBWA 3UF0A 2IYPA 4CR7A 4NJOA 2B69A 3I6QA 1A4UA 4UEJA 2ZYDA 2BKAA 4CLRA 3A14A 3MWEB 3IP3A 1NQ5A 3EVNA 3NEPX 4OXYA 3HE3A 1UZLA 3SVTA 5A9SB 4BS9A 5L7TA 2Q45A 1B14A 4IZHA 5CPBA 3WGTA 3HJAA 2DTXA 5JC8A 1PJ2A 2P68A 1VPDA 3AFNA 4L4RA 3F6YA 2DBZA 3LDHA 1T1RA 2HRBA 4RVSA 1PTJA 3RFXA 2VT2A 5L51A 3ROMA 1GUYA 1GZ3A 4YAKA 2YW9A 4BKQA 5L7WA 1XYGA 1U9JA 1UXGA 4GX1A 4XGNA 2NLOA 1LSOA 4XWYA 4AL4A 5A3JA 3EC7A 1TEHA 4JQCA 5BT9A 3E8XA 1QR6A 3DZBA 3OP4A 4IJUA 5A04A 3MJVA 1PJLA 1WVGA 2VYND 4R1UA 2D0IA 5KVVA 3VZSA 5TX7A 1SCUA 3KEOA 4HY3A 3UGKA 5TT1A 3ZDFA 1M66A 1BMDA 2DT5A 4XJTA 1R37A 3H6KA 4ZN6A 5DULA 2Y1OA 2ZYAA 2OL4A 5BSEA 2Z95A 2AQKA 4U7WA 3V5NA 4BO7A 3Q0EA 4YJGB 5CDSA 3IJPA 1AUPA 3DWFA 1Y8RB 2VZ8A 1E7WA 3GLQA 3QWAA 4AICA 2B0JA 2HMVA 3KO8A 3NDJA 1JLLA 3F1KA 4LW8A 4YAIA 3QVWA 4JK3A 3A4VA 4FPXA 3RSHA 4D3DA 2EP7A 4ZU3A 3BMQA 1J49A 2Q2WA 3SX2A 1QV7A 2JAHA 5CDGA 1VL6A 4BNYA 1LBEA 3FF4A 1PS9A 5IN5A 3ZWMA 2FMUA 3UCEA 1DFHA 2D5CA 1O94A 3GOHA 5TS3A 2HK8A 4L8VA 1EQUA 5ITVA 3EZYA 3H4VA 1WWKA 2DC1A 3ONEA 4ND5A 4I9UA 1YJ8A 2VZ9A 5JFOA 2IEDA 3C8MA 3IKVA 3ZU4A 1QORA 4WLVA 4A10A 4PZDA 4D0RA 4LGVA 3KB6A 4Z9YA 4HFRA 3WOHA 4RF2A 1LLQA 1A4IA 4QT0A 2X58A 4DQXA 2FRDA 4JJIA 4PLHA 3BHJA 3L6EA 1ZVMA 2C29D 3RC1A 2B5WA 2OXIA 4D42A 4IS3A 3LT4A 2CDCA 4RF5A 2ZK7A 1K5HA 1LLDA 4J1SA 1JA9A 4FR5A 4FFPA 1LU9A 2CUKA 3BHIA 4JROA 4QO7A 4A26A 4IXWA 1SB9A 4NIMA 2YUTA 1L1FA 4EGFA 1LDGA 2NV6A 2AQ8A 1PGOA 3I23A 1UXKA 3D3EA 1JTVA 4OH1A 4EW6A 5DCWA 4ALIA 4HUJA 2C2XA 3FNGA 1U8FO 4Q3EA 4OL9A 2J6IA 3T7CA 3QVTA 1NAIA 2Y1FA 1H94A 4DTIA 5KVSA 3DEYX 1QSGA 3I9OA 4DIOA 5JDIA 1NNUA 3S2GA 4JBHA 4GVLA 1N8KA 5C37A 1Y9EA 2JFFA 4CM4B 3AOEA 3A9WA 5LDGA 4WEQA 1DEHA 4QXMA 3E9QA 4ND2A 4XYMA 4DBVO 3JQ6A 5JW6A 3I3OA 1B7GO 1XU7A 2Y0DA 3UVEA 2H9IA 4WECA 2Q2QA 3KHUA 2FR8A 3R3SA 4JJFA 4CUJA 3GG9A 2HJRA 2FSVA 1E3WB 3GFBA 5JS6A 4BKPA 2O3SA 2B35A 5EJ2A 2F1KA 4WASA 5JAIA 2GGSA 4CQMA 5BSHA 4NFSA 2I66A 3BHMA 3GC6A 5LC1A 1NVMB 4FFOA 1T26A 4UEOA 1LEHA 1I36A 1G1AA 3CKYA 4LVUA 4MVJH 3ZW9A 2J5QA 4S1VA 4FFRA 4FGWA 5FFFA 2C07A 3JQAB 3L6DA 3ASUA 3MTJA 5G4LA 2O50A 3L9WA 4HX5A 4R54A 4TSKA 3AU8A 4DRYA 3BTOA 1H6DA 5G2OA 1WP4A 3ZGYA 4L74A 1YBMA 3TOZA 4Y6PA 2HO5A 4L4SA 2JD0A 3P7MA 3TZ6A 2POQX 4CPDA 2BF7A 3PLRA 4PZCA 2OUIA 5JMWA 1C1DB 1OI7A 3EAGA 3SC4A 1EEHA 1JWBB 4NI5A 2EIHA 2SCUA 4GX5A 1JQBA 3IC5A 4ND4A 2BFMA 2X5JO 2GUGA 3OIFA 3TOXA 1O89A 2HSDA 2D4AA 1A7KA 3UOGA 2AHRA 3K6JA 3R1IA 4PCVA 3GEMA 4QQRA 4ZGWA 5KJ1A 2QRKA 5A03A 4YCAA 1I30A 3V1TC 4RPHA 1F17A 1GQ2A 4E5KA 4UUOA 2WE7A 4BO3A 5F21A 3Q2KA 2AE2A 3C7AA 5THQA 1ENOA 3ZH2A 3RC2A 4AJKA 4PIVA 1R0LA 2P91A 3AUUA 4TRMA 1I0ZA 2AE1A 1P1FA 2IE0A 4XIJA 3WXBA 3ZWAA 2AG8A 2XXJA 5U1PA 2FR0A 2JD1A 1DIGA 1H2BA 1ZK1A 2NACA 3OICA 4OGWA 1VL8A 3DAGA 5G4KA 4RPLA 3VPHA 2NVUB 1LRKA 3WSVA 2PZJA 3OJEA 1IPEA 1OC4A 3AUSA 2CMDA 4NK5A 4MKRA 5TSDA 3E6AA 4K28A 5A05A 4K26A 3BZUA 3IIEA 1U2DA 4R1SA 2W98A 4CM8B 5JYFA 2Q2VA 1K0UA 4PLZA 3JD4A 3MTGA 3NT5A 4KMSA 4WPGA 4IIVA 2CVOA 1QRRA 5A4DA 3GRKA 3VTFA 1D1SA 2VCYA 3PXXA 3S55A 4YT4A 2UDPA 2DAPA 4BUCA 2PTGA 1A27A 5JYAA 2WD7B 4NR0A 2XXBA 4DPKA 2QZ9A 2NNLD 3KTDA 4J43A 1P3DA 4BV8A 4DUPA 5HA5A 3KM0A 4ILKA 5ILGA 2X7HA 3SC6A 3GNSA 2ZB4A 3H2SA 3O8QB 3QWBA 2W8ZA 4LMRA 5HS6A 2VHYA 4CQMD 3GNTA 5L40A 1Q2XA 3WLFA 4XCVA 1NP3A 1YB5A 5DNAA 3D5QA 3DBVO 4CM3A 2JCXA 3GHHA 4Y6RA 4CM1A 4H7PA 3JD2A 4DIBA 2P9GA 1JKIA 3RD5A 1V0JA 1ZNQO 2NTVA 3RBXA 4B7XA 3VTZA 1LRLA 4AJ2A 3QLJA 2YV2A 5F5NA 1FDSA 5BNIA 1ZBQA 1GTMA 1Z82A 4DIFA 4UUMA 3BMNA 5GZ6A 4R1NA 3U4CA 4CM6A 4MIYA 5U9CA 1HDXA 1J5PA 1M75A 1DC4A 3OHSX 1ORRA 4FSHA 4YQZA 1U28A 2J3HA 2BRUA 2I3GA 1EBUA 4MVJE 3CZRA 2JJYA 2WYUA 3AOEC 3JQAD 2FPPA 1ZCJA 3FNEA 2VHZA 4GLLA 1N1EA 4OMUA 3TZQA 3GF4A 2VHXA 3OBBA 1KIFA 1E3JA 1ULSA 1OMOA 3RKRA 2Y1EA 1B0AA 1PS8A 3P2YA 4D0SA 2GN6A 5I9MA 5A5EA 4RGBA 4IMPA 1YS4A 3T4XA 3TL2A 4A2CA 3TF5A 2VYVD 2IYOA 4LVCA 2Q4EA 1OFGA 1BDBA 1IY8A 1VE9A 3BMOB 5JYDA 5T8KA 1R12A 3LT0A 3JYPA 3CPSA 1HDOA 1NVGA 1GYRA 1H2HA 5IXSA 1L7DA 2GF2A 2YHIB 2V65A 4ONEA 1PQPA 1B8VA 4YRAA 4IDCA 1VSUA 1Z74A 2RH8A 4J4BA 3E82A 1F06A 1ZSYA 4MP6A 4BNUA 1R4MA 3OFSA 2I6TA 2AXQA 3EHEA 2Z1MA 3WTCA 1U3WA 5EN4A 2HRZA 4AJ1A 4Z9FA 4U6SA 4HNHA 3ETGA 3Q1LA 1ISFA 3H8VA 1HEUA 3AY7A 1YL7A 2NU9A 1YB1A 4INAA 1KERA 2NTJA 1ARZA 3DHYA 3IUPA 4CMJA 2ZQYA 3JQ9A 4HFMA 4XYBA 1U7TA 4J7UA 3D3WB 2FN7A 1GCOA 3RUHA 5ICMA 4XYLA 5L3ZA 1DB3A 2GO1A 5FI5A 3ROKA 4WLUA 3VPXA 4RQUA 2OHXA 2NVWA 4LN1A 1PJCA 2JCVA 2NQTA 1CEQA 4EDFA 2G0TA 4EYEA 1E6WA 3M6IA 3W4IA 2CVQA 3QJ5A 4RZIA 3GA0A 3WYBA 2JD2A 3OJLA 2PD4A 2CF5A 2XOXA 5G0SA 4B3HA 4XX0A 3R3JA 1TVEA 1ZK3A 5C5IA 4IGEA 5G0TA 4J9UE 5A9SA 2ZKLA 1HLPA 1LA2A 4FJ1A 1R66A 3ZNPA 5KJ6A 5G4KB 2ZQZA 3ZWCA 4IGFA 1NTOA 4A27A 4MKXA 2RH4A 2EG9A 4B4WA 2Q22A 1FDTA 2C2YA 3ZZNA 1TLTA 2HUNA 3HWRA 4AFNA 2DBRA 5FYDA 1QYXA 1UJMA 4BO9A 1Y5MA 4N7RA 2VZ0A 4OIMA 1O9BA 1EDOA 2BMAA 3I4CA 2YHUA 4PLYA 3IOYA 3FPLA 3PHLA 4CQLB 3I9KA 4IDBA 3RIHA 3PEFA 5KTKA 3VH2A 4AJ4A 4LMPA 2FR1A 1BW9B 2HLPA 3GN2A 2Q4BA 1SBYA 2WD7A 3DZIA 3GVPA 1ENPA 1F14A 3NJ4A 3ITKA 4JXKA 5ENDA 4BGEA 1Z75A 1CIVA 2X5OA 4RLHA 4DL9A 3D64A 5FWNA 3UAGA 4U0JA 1IB6A 4TKMA 4E5PA 3GR6A 1NHGA 2LDBA 1NXQA 3ICPA 3IAHA 3ULKA 3H2ZA 1GV1A 5HRUA 2I5PO 4IJWA 1HDYA 2IRWA 1E6UA 3ICCA 3FHLA 1I3MA 1UDCA 1XKQA 1CJCA 1ADGA 3Q6IA 1ISIA 1P1HA 3SLKA 4A5OA 3TRIA 2GASA 1PZEA 4WLFA 3ONDA 3W1VA 3ZNQA 5G0UA 4CM7A 1G6KA 4KZPA 3V2UA 3G49A 4L75A 2NU8A 3BMNB 2DBQA 3F4BA 3UICA 4LRSB 2YJZA 4Y8VA 4ZQBA 1H9AA 3OMLA 3BYZA 1U7HA 3OETA 1YQXA 3GG2A 2Y0CA 1ZW1A 3A28A 4IY1A 4Q9NA 4L73A 2GN9A 2I9PA 1LQUA 4ZJUA 1HKUA 1JAYA 4QEDA 1ZUD1 4HADA 1K89A 3RROA 4GBJA 3ZHBA 2R00A 2W2LD 1FDWA 2Y99A 4KWIA 2E48A 2D5AA 4ZICA 1ENZA 3HZZA 4FD3A 2QHXA 3D0OA 4UVHA 5DN9A 3NV9A 1BTOA 3WR5A 1HZZA 2ZB3A 3L4BC 4CODB 3ADPA 1AXEA 2CD9A 3ZV3A 2VYVA 2PLAA 4MJLA 5GZ1A 1YBAA 4JN6B 1Y8QB 3E5RA 4PG5A 1TI7A 1VJTA 4FC7A 1UDBA 2AEMA 1LC0A 3A1NA 1GEGA 4WNCA 4PLPA 3U9LA 1PJ4A 3OJOA 4LRTB 2UVDA 3UW3A 5DP1A 1EE2A 2Y66A 3WG9A 1A71A 4WGGA 3WIEA 4CMKA 4KQWA 1NYTA 1ZMOA 2DUWA 2EXXA 2OGUA 3ZNNA 5JC1A 1R4MB 4GMFA 7ADHA 1KVSA 2O3TA 2X4GA 4II2A 5BNFA 4Q3CA 2GYYA 4G2NA 1E1LA 1SOVA 1C14A 1BXZA 2WEKA 1GEEA 1CF2O 3PI7A 3PIIA 4DVJA 5TNXA 4CL8A 4CMEC 4B79A 3PQDA 4DLAA 4FN4A 1ZXLA 4YJDA 1K6XA 2FSSA 5L95A 4XYEA 1HL3A 1HDRA 4AJOA 4IIUA 4LK3A 1H9BA 4OQYA 2X0NA 1N9GA 4JGBA 4UVDA 5AXDA 1MG0A 4E31A 3I5MA 3MOGA 3JSAA 4Y9DA 4W7IA 2D1YA 2Y93A 4ZD6A 4E5NA 2A94A 4D3SA 4WLEA 4EUFA 3LSYA 5I8WA 5IDWA 4BGIA 2AG5A 5IXYA 3LC7O 4TRRA 9LDBA 2O48X 1CDOA 1GDHA 3DZFA 1PJTA 1TT7A 4GVXA 4GKBA 5I7EA 1OAAA 2JFGA 4D44A 3JQGA 3U5TA 2Q46A 2BGLA 4RJTA 4WLNA 3GDGA 3AM3A 4XJSA 3QA9A 1AHIA 2XF8A 5F1KA 3JYOA 1DC3A 3ZV4A 3DZHA 4O1MA 1XQ1A 1YRLA 4DQUA 3ZWWA 1E1KA 4YTEA 4R4JA 1DLIA 5CEEA 1A5ZA 1I3LA 3RC7A 3K31A 4L0QA 1Y8RA 3VVBA 3WDSA 4D79A 3RBZA 4O6VA 2GN8A 4RPKA 3QP9A 3A06A 5GMOA 1ADFA 4YAGA 2WMDA 3AWDA 4UUPA 2ZCVA 4B7UA 3JYQA 5DP2A 4TVBA 1UZNA 1HE2A 1JU9A 4NH4A 4AJJA 2V6GA 4CQLA 1GFSA 1JDJA 2EJWA 4OM8A 3LF1A 1NQOA 2CDAA 3FNFA 3ZHYA 2VWPA 4G81A 4JLWA 3WWYA 3WWZA 4CM9D 5ITWA 1ISJA 1JVBA 3PWZA 5EL0A 2Q3EA 5TQVA 4ALLA 1DIHA 1P0FA 1QYVA 3RI3A 4BVAA 2V6BA 5BSFA 1U3TA 3GDOA 4A73A 3PYMA 1U2GA 3GVCA 1T25A 2Y67A 3HDJA 3E03A 4BGVA 1KYQA 1IL0A 3F5QA 4Q3BA 1SAYA 4NG5A 5J23A 1B3BA 1YVEI 4NBUA 4C4OA 4E30A 4BNWA 1BWSA 2C7GA 4FBGA 2JHFA 1L7EA 2BGKA 3ZV6A 1DHTA 3VPGA 3D5TA 2RAFA 4RVFA 2A92A 3QWIA 3RUFA 5KWEA 1E77A 1Q7BA 3F1LA 3VDQA 1EQ2A 2P5UA 1FMCA 3GRPA 1TXGA 1BXGB 4ND3A 3I1JA 4UUNA 3LQFA 4CMIB 3DHEA 5FF9A 1DOHA 4XDYA 1C0PA 3NTOA 4QO8A 2DPHA 3STHA 4M87A 5TRTA 4Z0PA 3PGXA 2D59A 3GEDA 3U4IA 1IE3A 2O2SA 3G1UA 4EUEA 5DBIA 1Y9AA 4MO2A 4W82A 2VTDA 4WEOA 1FJHA 1HYHA 1HSZA 4DMMA 4DQVA 4CV3A 2PH3A 1DFIA 1E5QA 1BVUA 3UFXA 1DJQA 2Z1NA 3TWOA 4J3FA 1EVYA 3W4KA 1PR3A 4KUGA 3NDRA 5CP8A 2R2GA 2VYNA 4JP3A 3H65A 5DF1A 2D2IA 3VC7A 8ADHA 5L4SA 3G79A 4NJMA 5JAQA 4PLGA 4PLFA 1HT0A 4MP3A 1XSEA 3DZJA 2BH9A 1I01A 4FCCA 1D3AA 1P44A 1QKIA 1WW8A 1EE9A 3OSUA 3WMXA 1DC6A 4CM4A 4D46A 4IQ8A 1KVTA 3WICA 2FPIA 3DXFA 3LU1A 4XA8A 5KKAA 4BNTA 2C0CA 2HJSA 1P0CA 4E33A 3EMKA 3WNQA 4YPOA 1YE3A 4JBGA 4NBVA 5DCUA 2FZWA 4J9VA 1O0SA 4NBTA 4GL4A 3IP1A 1ZJZA 2VWGA 3AUTA 4JJGA 3RUEA 5H82A 4E12A 3QVSA 1OC2A 4PGFA 3H3FA 1E7SA 3K5PA 4BO2A 1W6UA 4YYZA 4HFNA 1A9ZA 4B8WA 4OJNA 4QECA 2YFQA 4PLWA 1NFFA 1T4BA 3PLNA 4XQEA 1AE1A 4FS3A 4XRGA 4PLTA 3FBGA 2YZ7A 3KBOA 4BO1A 1PJBA 1J4AA 2HK7A 3H5AA 4OSPA 4WUVA 1YDWA 3HB4X 1NFRA 1ML3A 1UUFA 5JDIC 1P31A 3KUXA 3VZPA 4E32A 4NBRA 4WJZA 1C0LA 4N5NA 3FCOA 2C59A 2WD8A 1WMBA 3PJGA 1YQGA 1D4FA 3L0DA 2XPCA 2WDZA 3KSDO 4DREA 4P22A 4MVJI 4J4TA 1H93A 3Q9UA 3IDSA 3CE6A 3JQGB 4N18A 2RBEA 3TJRA 4IDAA 3ADOA
chains in the Genus database with same CATH superfamily
2H2GA 4K8OA 2REQA 2X6RA 2CXRA 1Z45A 4U2GA 2P1ZA 1G5FA 5FWDA 3THOA 1MEOA 4TXMA 1FK8A 2PJZA 4BZXA 3DTNA 2ET6A 2O9JA 2ZSDA 3FDFA 3HADA 5CDTA 2HA4A 4UE3S 2B5VA 5DTQA 3AKCA 3K2EA 5DSXA 3V42A 4IF6A 3PDJA 4MI9A 3WYNA 2A6PA 2XUOA 3MUEA 3A11A 2YVLA 1N5LA 3QEMB 5LVAA 1AQJA 1V41E 1ISGA 4H15A 4H6XA 5CFPA 3EG9A 4MQBA 3ZQ4A 1WD7A 4KO3S 3SS7X 4EA8A 3KOOA 3V7UA 2O8CA 4B3FX 1MBZA 1Y37A 3H87A 3P19A 4PAQA 4BP9A 5E1OA 1ENYA 1QR2A 1WO8A 3D2BA 2II6A 4JSRA 3EBLA 4DN6A 3RG8A 3VKGA 1H6AA 1G4UR 1QH8A 1EJBA 4V38A 1QMGA 3WLNA 2WIDA 3CZMA 3T9EA 7REQA 1SBZA 4Q9IA 4I55B 1W35A 1ZN2A 2O6LA 5DHRA 4JXZA 1ORVA 4PG6A 2IOQA 4FGJA 3AP1A 4D4LA 1J7JA 2NVUA 1M2JA 5JXWA 2P9CA 2DMRA 1ITZA 2XWPA 2ODTX 1SIWA 4MB6A 1MQ9A 5FHRA 4B4OA 3C4QA 4ZV4A 1KSFX 1GL6A 3WISA 2WM9B 2O5EA 4UE6A 1R5JA 2NVBA 4OAQA 3PPIA 2Q4DA 3HXQA 3FPCA 2ST1A 1GGNA 4CMBA 2YWBA 4OHKA 5YASA 3FR7A 2BDTA 1TD1A 3BTUA 4LBWA 5LYJB 2FZ4A 3IKMB 4BFLA 1KZ4A 3EC2A 1IUPA 3U19A 3IALA 3P0EA 1XJ0A 3T7EA 1SJ9A 2QW8A 4IZIA 3JQPA 2DTEA 4ID9A 1N6IA 2QWXA 2ZU0C 1GGEA 4FT2A 2HJGA 2JJ2D 4UD6A 4O0MA 4AX4A 4BNFA 1D1TA 4NFLA 4YUXA 5HUJA 5JXIA 4Y2TA 4EL0A 2VDPB 1C4WA 3HY3A 3M2PA 3DOEA 3O7MA 4ZDKA 3H2BA 3ZVNA 1MGOA 2JBAB 1NQWA 4OGGA 1USUA 2PK3A 3BF7A 3ZOZA 1Q22A 3T0FA 1E1CB 4F1WA 1G5HA 5AVQA 2VTKA 4HYYA 4OFBA 3CXRA 1OKKA 2WWVD 3TQHA 4CIDA 3DYVA 1C80A 4TX1A 3RK0A 4EBFA 4U2CA 3C7CB 4LTDA 4B9EA 2WJJA 2FZEA 1N1GA 5CJPA 1WZIA 4WOPA 2ZUFA 3WB0A 3IT1A 4OQDA 3FXAA 4HRAA 4J0EA 1DAOA 5B58C 1TEXA 2VF4X 3IUBA 3UEOA 5LIPA 1DQPA 4W1RA 2MHCA 3F2VA 3OOHA 1Y4DE 4XOUA 1V95A 4A91A 4NMHA 4ZCTA 2GETA 3ZHQA 4G0WA 5J59A 1ZC3A 4DQKA 3L7NA 4ZOQI 1PVDA 4MWEA 2X0IA 1TO2E 2X86A 3UHFA 1PEAA 1PE0A 2N9UA 4ERNA 1QJCA 1X94A 2AOTB 2DWCA 2W2TA 4Y2PA 1C3VA 2BGUA 1K92A 2I7VA 3V8EA 4AECA 1T29A 2WZCA 3KQTA 5AOCA 5SICE 1A8SA 1KI4A 2C57A 3M9XA 1SO8A 1RWNA 4QVKA 1KZHA 3COWA 1KJZA 2FQ1A 1JWAB 2NQ2C 3PVSA 1L7PA 5F73A 5AHKA 4ARZB 2JI6A 1O2DA 3RFTA 2QSYA 1DKRA 1W5SA 1WKVA 4QDZA 3FUWA 3KT8A 4GEGA 4RUKA 2UZ1B 5K0GA 1ABBA 1ADBA 2QMEA 1R0ZA 3CRRA 2A1UB 4MCAA 3N2NA 2HF9A 1MX1A 2V8OA 5SY4A 5EHXA 3P9XA 1UP7A 3IBYA 3AR2A 5EUMA 2TMKA 3QQ5A 4DVGA 3A3PA 4M21A 1GYPA 4M9ZA 4KH1A 2JCGA 2IF2A 2Y2VA 3ROKA 1IJEA 3IPXA 1BGWA 2EBWA 1PT5A 4BNKA 4YDHB 3IIMA 5EZ5A 4D80A 4MS3B 3HGMA 1LLUA 1T8UA 3PK0A 5KTMA 4NE2A 2I65A 4RJIA 3WRYC 5LBUA 4FGKA 4LVOA 3SSMA 1LWOA 1USVA 3H7AA 2OCXA 1X15A 3JTEA 1CSEE 2B78A 3AF3A 4ZI5A 5JR3A 4EHAA 4W5NA 1DKPA 3P0RA 4MA0A 1JZQA 2QYTA 3U49A 1FMTA 1PJZA 3OY7A 3BH7A 3VFDA 4H08A 3ROEA 4AF7A 2WE8A 3F90A 4YO8A 3HB9A 2QG9A 1Z0UA 2JH9A 1UT6A 2GCOB 2RGUA 4HQNA 4RYLA 1ZD3A 3V2GA 4BFTA 5C8YA 1TW2A 1RJWA 3X2FA 1QLHA 4J3NA 4E46A 3OH8A 1RYMA 4C2UA 3N8GA 3KHKA 1KMMA 2IF0A 4WFJA 2FPGA 1TL7C 3IA2A 1VMEA 3LZDA 4B40A 3EVTA 4IM7A 3T3NA 2YASA 2ZFUA 3MJSA 1GJRA 4JQSA 3TR0A 1R9JA 3SE7A 4AMYA 1F7UA 1JKXA 1QFMA 4IG9A 4U6QA 4A16A 2IUYA 5JD4A 1TJ3A 1GNPA 3NWJA 5JY1A 3FGZA 1ZL2A 3OLWA 4EYOA 3NYRA 4V0LA 4AS3A 2VYFA 5IN4A 2IZZA 1SVKA 1FU8A 4DXAA 5AW7A 1W29A 2XZDA 3E3LA 3HGTA 3AF5A 3VYUB 3ZWDA 3K1JA 1AT1A 3V7FA 4B75A 3TB6A 1UT5A 4QG3A 3AJRA 1UXHA 3A3KA 2X3FA 4DCVA 2F48A 5KYUA 4C07A 1M6YA 1JLHA 2VUSA 3TD6A 1C5KA 3HDYA 5NLLA 2ZRNA 2CY0A 2GCNA 4E09A 3O92A 5CK4A 2H1IA 1TLLA 2P27A 2XCQA 1KJYA 2O4CA 3ABZA 3IB3A 4M22A 2WT8A 4KK4A 5I51A 1TQ4A 1JEYB 4Y2XA 2QSJA 1OBOA 4RW0A 1VM6A 2QSUA 3ONWA 5FOSA 3T1VA 4C4PA 1U5BA 4F71A 1P2GA 3VC3A 4QU8A 3SR0A 1TT5B 3G2LA 3ACDA 3LZ6A 4B74A 1F60A 4V0RA 1T0BA 3PNPA 3QLUC 3OPYI 4JUFA 3VR5H 3SFVA 4IEFB 2C2GA 2YZMA 2Q49A 1RM0A 1LF5A 2ZRJA 5AP9A 3VU9A 3ZWVA 2F55A 4ZODA 3HR4A 3WDKA 1P74A 1ZRNA 1HDGO 1C8LA 3WP0A 2QTVB 3COPA 3UM9A 2BY4A 1XVLA 1LKZA 4Y67A 1ZRMA 4B81A 4FNMA 1M5UA 2GYVA 1M2OB 5JJBA 2NM0A 2B1RA 2PUCA 1K8RA 3TQFA 2J7PA 3K0AA 4V1CB 5I7SA 4P6VF 5DW3A 2ZVJA 1B8OA 1IK4A 4L78A 3A6LA 4A0SA 4QWWA 3PYLA 3WBBA 1KK2A 2NADA 4JP2A 4PS0A 2AFIE 5L3QA 5GIOE 4UUQA 5ALGA 1ZGJA 4Q4JB 3VC2A 4NPCA 2PY6A 5AOAA 1J20A 4NBKA 4KR3A 5HCIA 4XB1A 1K7SN 1PR5A 3ZWXA 1M2FA 3FGNA 3IRVA 4QOJA 4V2UA 1NW5A 4ZRDA 1I0IA 4LJRA 2JGIA 3PFGA 2L2QA 2FP4A 1J70A 2BUBA 3PT5A 2YXEA 3IQIX 3CUTA 1YL6A 4FX5A 1TM5E 3R7LA 4EY5A 4LXQA 4LISA 2A88A 4C6SA 4MIOA 1FU4A 2QQFA 3G9QA 1CNFA 1LTHR 5EIWA 4YRBA 1L3IA 3LKBA 1A2BA 1J8MF 2LD4A 2NV2B 3EP3B 1UEXC 2XD4A 4ZRMA 5G3YA 5EFOA 4E3ZA 2VQ3A 1E9AA 1H2ZA 3DGFC 3F6RA 4F0JA 4F60A 1T13A 3B1JA 3Q88A 3CE9A 1THTA 2BE7A 3EH1A 2HK9A 2OCAA 2XB9A 3MD9A 3B1KA 3MWKA 2IQIA 4NZ9A 1RYYA 2X5NA 3ZK8A 4BBAA 2HT1A 3MCUA 2AFHA 1NQVA 3NHWA 3K1TA 4L3VA 1HE4A 1L8OA 4FSDA 3L4SO 2W6QA 3CNEA 1JAXA 1UPUA 3ZHZA 3ZWNA 1DAHA 1HWYA 2Q4RA 2ZJ0A 3FWNA 1R74A 1AKVA 3GZJA 4MKFA 4YS6A 3T1OA 2CL0X 4C43A 5H8WA 4DB2A 1NV8A 5JYBA 1GPLA 1WCIB 5JATA 2I1VB 4I4TF 1X8XA 5IM4A 1SCIA 2PGLA 4LBZA 4RK5A 4MW4A 4EYKA 5LLDA 4YASA 1VKHA 5ADUS 3KJEA 1NJ6A 4H16A 3OCXA 4HXEB 1ZUHA 1TQ2A 4MULA 1SKYB 2CEAA 3SXJA 3U31A 3NGXA 3U1TA 5JSHA 2IOFA 4KBGA 1DRUA 1E3IA 3WIUA 4NU0A 2FCAA 4ZT7A 4LF6B 5KKCA 1CETA 4EEZA 5K0JA 2XCSB 5DIFA 1EX6A 4JBNA 3PC3A 5B55A 2WYVA 4KVGA 1YFLA 4J6EA 3NKLA 1IVNA 3AIKA 1N33B 2JIPA 3DS8A 4ZVLA 1O95C 2HAEA 4UZEA 2QRPA 2FX2A 3OPVA 3N2IA 3B70A 4HZUB 4CV2A 4YJ2F 4RHXA 1XZMA 3B1YA 2BELA 3RVRA 3FPBA 1ZVJA 1NJ2A 4Z9XA 3I9V1 3B1FA 1UBFA 2ZSFA 1BD3A 1NXOA 3I6IA 1FTSA 3F6PA 3BRQA 4LNUA 5JYEA 5CA1F 2WLTA 4FE7A 4GM1A 1GPNA 4FLMA 2ON6A 4HNUA 3QBVA 2GCOA 1HLDA 1YK1A 2PMBA 3GA7A 4KQ1A 2ZVPX 5ALLA 5E8JA 4ZEOA 3ETEA 2W2LA 3IESA 5ICFA 2RJNA 3LVBA 1N9ZA 1C50A 2ZUDA 2EFGA 3W6OA 4LSWA 4EYQA 1G8GA 5IW8A 4F5WA 4YJHB 2ATCA 3AR9A 1XZ8A 2HU2A 2PXCA 5C53B 1OAOC 3HY4A 4FDAA 2EATA 1EFKA 1LFAA 4AZ3A 1X6VA 3UWKA 2CJWB 4R6XA 3LT1A 4HUQA 4AKGA 4PFKA 1B8PA 2Q0XA 2GZ2A 2VAWA 3ZG6A 1H4VB 1QO0D 5C32A 2Q6OA 4YRLA 5JARA 5B37A 5FTJA 3J81A 3HYLA 1ODJA 2V8BA 3RQIA 2RE8A 1RMYA 2P5YA 1VPTA 1E5LA 3H2KA 2ZAMA 1IUOA 5I8ZA 4EHIA 5KYUB 1YXMA 1C9KA 4ER3A 1XNRB 3TUXA 4Z2AA 5D7NA 4ASUA 3OOJA 4LCBA 3WFIA 3QU9A 4M53A 5I9BA 3OCUA 2EW8A 1PT9A 3UBMA 1UBGA 2ZP1A 3SHFA 1DBIA 3PKZA 5KAPA 3SM9A 4LDRA 3PUXA 3AHIA 5B3AA 3R2JA 4B34A 2D62A 1QWSA 3TH5A 1KI9A 3I2GA 3LL4A 2NZVG 2FFJA 2PKWA 1GRQA 1RP1A 1CEYA 3WKEA 1COWA 3WLQA 3Q7QA 3LLCA 3WMWA 2XUZA 4X64B 3BSYA 4R51A 4L57A 2AJTA 3L01A 4B3DA 1CUVA 1VPEA 1O5IA 4PGGA 2JEOA 3DDCA 5LBIA 1N2CA 4H0NA 1S3SA 3H2YA 2I67A 4HB4A 3VA7A 4Q12A 2ABWA 4G0OA 4JEUA 5EZQA 2KBFA 4BB6A 1I2CA 3UG6A 1JIJA 2Y76A 1DXYA 1GITA 3H19A 1I24A 4O8ZA 5E1MA 2RONA 3VAZA 1KL7A 1DJMA 1QMHA 4O63O 1WHTB 2IYQA 4MV6A 3ON5A 4MX8A 1IBLB 1SUAA 4IKOA 1MJGM 4QXAA 1VB3A 3LUJA 1VSVA 4PXAA 2IIVA 4RDHA 1M34E 4JBWA 2BRUC 3TLYA 4KVFA 5A2GA 4F97A 3HCCA 4N6NA 3MXTA 5HILA 3QTBA 3C1TA 3W2GA 3AINA 2UZ4A 1POWA 4UDXX 5CH8A 4I55F 1GPDG 4L5JA 2WM8A 5CDFE 1IXZA 2E1PA 1KP2A 5DOVA 1WUTA 3EF1A 1B8NA 1TRHA 1CUUA 2C2ZA 5L9AA 2I9KA 1PEYA 4YT8A 1V9LA 1HFKA 2GJSA 1I33A 1T9CA 2O8CB 3KKEA 4AZTA 5INTA 4NENB 3ISVA 4F3KA 1S4MA 4EY6A 5LP1A 2DQKA 2FLKA 2DLCX 4OJMX 2A35A 2E37A 1Z2CA 4KQIA 4KYVA 2OFWA 2RAPA 1L5VA 2O5RA 1GZ6A 5J1SB 4X91A 4YAUA 1TVMA 3ZD6A 4N5DA 3SE0A 4R5HA 4LHSA 1V11A 1EGQA 3HKBA 1QHEA 2IHBA 4HWSA 5DNCA 1NLZA 5B12A 4I5GA 1DKMA 4K9MA 3GGGA 4GICA 4NULA 3R7BA 3GELA 3AIOA 2DR0A 1N2JA 2G36A 1LK5A 3R5TA 5LYJA 1VFNA 4BX8A 4EH1A 3CLRD 4JL5A 2Y6UA 1MAUA 1SH7A 4TMXA 2AKEA 1QYDA 1RWVA 2E6KA 2Q4OA 2TSYB 5ALEA 4A8JC 4EHJA 2GZ1A 1ZEMA 4OY3A 3PGLA 1H05A 5C1OA 4GC9A 5DNEA 2GHIA 5LUBA 1WCIA 4M1ZA 2AKYA 1LRJA 5F35A 4KREA 1S2GA 1RYBA 4UMVA 3CZCA 2XGGA 2C7PA 4OB8A 5TMPA 1TMKA 2YZGA 2FF5A 1JQDA 3PNQA 4HN9A 3L7KA 2MU1A 2QLNA 2ZI3A 4OMFG 5D6NA 1U1FA 3V1YA 2IHVA 3LA8A 3PGVA 3E9ZA 2VYCA 3KKNA 4L6CA 1BE6A 1I2ZA 1L5ZA 4TWJA 4H1WA 1AKQA 2GJ4A 2DQ4A 5KX5F 4PONA 5HWSA 5HQJA 5CCBA 3R5FA 3CZQA 3QX8A 2YWXA 2B4RO 4N3CA 5EWLA 2O0JA 1A5BB 1BMFA 3JYNA 4JB2A 4KHZA 3VR3D 4EUHA 1FTNA 1J9GA 1Z8FA 3EFOB 4UVGA 1OFTA 3DL2A 3PNLA 4OOFA 4OHCA 2E1RA 2HX1A 1KEPA 1P8JA 1E9DA 1MZPA 3REFA 2CD7A 4CKWA 3LPMA 3ZY6A 2JHGA 4HWGA 4NAHA 5BWLA 5HSGA 2O20A 3FYSA 3KQMA 5F64A 4RVUA 4PZZA 1O54A 3HV0A 3I2IA 1CD5A 4YGYA 2ZUBA 4S1PA 5FWXB 3RNLA 1N5KA 3EGOA 3H11B 3MRXA 5L8VA 1Z7BA 2FG6C 4UM5A 3ENNA 3O5AA 4YLGA 2OV3A 3ZDZB 2VPQA 2WV9A 1BA2A 1DKLA 1VHTA 2QM3A 1DIRA 5G40A 3RQSA 3MERA 3UB3A 2P4SA 4GM0A 4A0RA 1XTBA 3WIOA 2P9ZA 2AN3A 4RMJA 5CVDA 4OBEA 1RKUA 1PL8A 4ZI3A 4LQCA 1IBCA 1V8FA 3D4NA 5CA0F 3LYHA 4V03A 1D6NA 1YZFA 2AN9A 2Q9CA 1CP2A 2J3IA 3JQBA 3LY5A 5LQUA 1GG5A 4TVSA 3FZQA 3AUJB 2GDZA 2WKWA 3DOCA 4IGAA 4JB0A 1PG0A 5ECYA 3NUZA 5KTNA 1GZDA 4ZCQA 2G88A 1AOXA 4CG3A 3OTOB 4RPGA 3PF9A 1A9OA 3ZKAA 3W5AA 2RARA 2YXLA 4O4LB 5ECGC 1Y1LA 1SG6A 1XZIA 4CGZA 3U4QA 3X1JA 2QLLA 4YHHB 3PD1A 3SI7A 3LC1O 4FDTA 5AHOA 1V16B 2O06A 3OSZA 5A5GA 1PSZA 2E5LB 2HT6A 2E4AA 2XI4A 3CONA 3VOTA 3C43A 1VLZA 1PK9A 2CJXA 1DX6A 1D4AA 3I9JA 2JVKA 3M4YA 3EG9B 4DLBA 3T5AA 3GEHA 2HKIA 1EFPB 3RS0A 9ABPA 3FJOA 3R7FA 1ONSA 3R6DA 2PZ8A 3W6UA 1KBQA 5EMHA 3O26A 1OB2A 4PNPA 3U81A 2QX8A 3OEHD 3LWBA 3NATA 3DEIA 3X2EA 4XVQA 4HSGA 2BM1A 4PG7A 3RYFB 2MDTA 4FYHA 5FUMA 5AJZA 3JASA 4BNNA 4Q00A 1RCTE 2HV8A 1TU4A 3S0JA 5BR7A 2FAXA 5HX7A 3SF0A 4L3WA 4QLBA 1XJWA 3UAVA 3JAMA 4MQMA 2EHDA 5CDYA 4UQOA 1Q20A 1DELA 4DA6A 2FPRA 3WOVA 3QY0A 1GSIA 5E38A 4NXMB 2XTNA 5FKJA 2JAXA 3OZTA 3KSMA 1FJXA 2HR1A 4C3UA 2D13A 4E2ZA 1GZHB 1JHXA 1U5CA 4X7MA 4G0YA 3L1KA 4FEGA 4P08A 1DC5A 1V8BA 2UYYA 3IIIA 4FYJA 4QFBA 3UMBA 1KDRA 3H5WA 3DCIA 1HT2E 4B48A 4QLOA 3MUFA 3AY3A 3BB3A 5EZSA 4ZMRA 3IL2A 5JD6A 3L4BA 4ASUD 5LP6B 3O03A 3QWHA 4I4IA 3DVSX 1BE0A 1EUZA 3E1GA 1L3BA 4XEHA 5ILOA 3D4PA 4I1PA 4R2HA 4KTVE 2VNKA 3EDMA 2XUAA 4HZGA 3UAYA 3TFOA 1BS9A 5HNKA 3L8YA 5TVOB 2CJYA 4E2FA 3DXZA 2VWHA 1S7GA 2QPOA 1UMBB 3PC7A 4OHMA 4X84A 3SYNA 2MSNA 1G7CA 3WWDA 3TW3A 4E2XA 1QGYA 2EFCB 1PLKA 1R0YA 1RDFA 2FPUA 4AO6A 3ODGA 1J1UA 3RASA 2IGTA 1JBQA 4HMPA 3EVBA 2FZCA 1JA1A 4UNQA 3TUTA 2DKNA 3COVA 2IZOA 4MWZA 3PXBA 1EIWA 4ZCPA 1A2OA 1U7XA 4BOYA 3C98A 1F38A 2JFUA 3OF5A 4A3SA 4EZBA 1IG3A 3WK6A 3M6FA 2R66A 5JS8A 1GLNA 1JXMA 1URPA 2ATIA 2QUBA 2XQKA 1XJQA 4MUGA 3FZYA 1GHTA 4H1VA 1EX1A 1GKLA 2CKDA 2L19A 2FUEA 1V47A 2RJ3A 1XZCA 4JLNA 5IX8A 3ABSB 2OVBA 3JZFA 2QRHA 3L2OB 5IDVA 3QSYA 5DLDA 1ZOPA 1UIMA 2FFHA 1LBIA 3G7SA 3JAKB 3UMJA 2B8TA 3QFTA 3K72B 4LTMA 2G6TA 1ISPA 2O7VA 5KUTA 4G0VA 3HUTA 4LG1A 5AQ1A 1H1TA 1GUZA 1KE2A 1GADO 1EUCA 1HE3A 2VJAA 3K0CA 1U2EA 5JSUA 3OWOA 4URHA 2IDZA 1P4AA 4AN0A 2O0KA 4XUEA 1LI5A 4BKRA 4D98A 5BSKA 1W8DA 5IG2A 1P29A 3ZE7A 4PSKA 1NVDA 1A7JA 2XMBA 3F71A 4FUQA 4ND8B 1E5DA 3U7HB 1BE1A 5C1IA 5DFAA 5H80A 2XYVA 3DWGA 1Z5UA 4J1QA 1TNDA 3GBVA 1I5RA 1V37A 4K2AA 1PJAA 3Q7RA 4CE6A 1SHLA 3WK5A 3DZ7B 3QELA 5CLIA 4GFDA 4OKIA 4PO3X 4X92A 2O2DA 3OE7A 2P2YA 4HDCA 1MAWA 2G9NA 4AN4A 5BN5A 1WHSA 5IH7A 3CUWA 1NJGA 3K09A 2WHYA 1JLKA 4EI2A 1Y1PA 5FPQA 3LCUA 4CMEA 1LQTA 4GP9A 2ZM5A 4PZPA 4GIBA 3CG4A 1GNRA 2VEOA 1V3QE 4YLYA 1MV5A 2ACEA 3C7KA 3E7DA 2VPYA 1J8DA 3IUSA 1VIAA 4MOWA 5FR2A 3IAM1 3UHAA 5AM2A 2PG3A 2JA2A 3CJTA 3OFJA 1R0KA 1ZA1A 3HYNA 4EW2A 2OOKA 3EDCA 1ZWLA 2HQSA 2Z98A 3A1WA 3NIFB 2GBIA 5AKYA 2Q50A 1KZ1A 5JNVA 3LS2A 4MINA 2F1RA 3OCJA 4JB8A 3LK7A 2Z2KA 4P5PA 4Y9UA 2R6R1 1B41A 2A78A 2GM3A 5AVUA 3FKSA 5M29A 4PZLA 4P8RA 3OZAA 2XUKA 5DX1A 1AQNA 4UCQA 2V4ZA 4Z6KA 2RB5A 5F1OA 1EGVB 4M54A 1FJGB 4EELA 1N6KA 2QU7A 3OF2A 2NOAA 3CU5A 4PYNA 4XXHA 3V34A 5LKRA 5KTRA 3KL2A 1TUBA 3N8HA 1U3UA 3DV0B 4K1LA 2LPMA 3LRXA 4CEHA 1N8SA 4ESVA 2KWIA 3VO2A 2IOFK 1YS2X 5DXAA 4QZVA 3WE7A 1ODKA 3H9GA 5KJCA 3LL7A 4RNCA 2UYCA 1O77A 1JZSA 3MBKA 3PC6A 3VNUA 1P9RA 4LYFA 4KO1S 1QKJA 1WNTA 4EMUA 1XMJA 2X0JA 1T4CB 3QVVA 3QBDA 5JS2A 2JATA 4BNGA 1Q16A 2GKOA 2PVPA 1M6WA 4W9RA 2A2ZA 4MYUA 5ALWA 5F7OA 1T0HB 1TZMA 2YV4A 1CY6A 5TEWA 5IJXA 2HSGA 2G40A 2OG2A 2PMDA 3I0NA 4GGMX 4J4HA 1M2EA 3WA6A 3EN0A 4BBZA 5JH7F 1KQPA 3PVCA 5CB4B 2PWZA 2ZJAA 1TA0A 1DTSA 2TECE 3HKDA 5AIAA 4CYMA 4GRAA 4QPDA 1FFAA 3MJTA 4HNAA 2WD9A 4RMGA 3ANSA 2VEDA 1H2RS 1II9A 1LC3A 1OWMA 2QLTA 3HRKA 2OZVA 3HU3A 1E0KA 2YXBA 3ET4A 4FOOA 4QDXA 5CR9A 4K46A 3FR8A 2GZSA 3IELA 2R5FA 4LKRA 3PC2A 3GFTA 1NM5A 2ZBEA 3M70A 1WDMA 3U0VA 5AJWA 3U4MA 3FWZA 3GUZA 4R8LA 5L6MB 1Z4NA 4DC1A 2FE1A 3BH0A 1U8ZA 2WM3A 3B1WA 2CJWA 2PHZA 4U9HS 2OBBA 4FOLA 3G5LA 3N2EA 1VRCA 5AJTA 1ODTC 3THWA 3KC2A 1W9MA 2I03A 5JNUA 1LJUA 4NPAA 1YRWA 1KYTA 1KZ9A 3JATA 1AZSC 1U3FA 4ZFNA 2BEUB 2FEWB 5IFKA 1DHRA 3LQQA 3S1SA 1M1NB 3RSCA 1RMQA 6YASA 3ICWA 1J8QA 4WT7A 3WB9A 3B78A 4BV9A 2M6LA 1E0SA 5FL7A 3KTAB 3KVOA 3KAQA 1FRQA 3EVCA 5TGTA 3W8FA 3T54A 4OREX 5EJ9A 2ZIXB 4HBZA 2VF8A 4NK4A 3GBSA 3W3AA 2W6JA 3T06B 4M1KA 2F90A 4N01A 3TIIA 2XV1A 1QIFA 5EZYA 4RHEA 1JR3E 4EMTA 3CH7A 4DNOA 5BQXA 4KGZA 5HIIA 1OT3A 1KVQA 4YT5A 4AS1A 4PV7A 2X9NA 3C8ZA 5AIBA 4OHZA 2BFEB 4TV9F 2QY6A 4GLOA 3OD5A 2AXNA 1N0UA 3ANTA 4R83A 5CW1A 4PPFA 1UBHS 3F5MA 2FB9A 5K20A 4GQBA 1PR9A 4TWAA 5KINB 4KSCA 4WKNA 1T6XA 1ZMXA 5LDHA 2WWRA 4YHBA 3U0BA 1GT6A 3LOUA 2IYLD 2ZQ5A 2P35A 5JAZA 4A36A 3RSOA 1SN7A 2J41A 2AFHB 2XD9A 3CWCA 3DOIA 1W4ZA 5C5EA 1P2SA 3HCNA 1D2MA 1XAIA 1KY2A 2Q2NA 1WEKA 2OV2A 1XNHA 3TRHA 1JTEA 3L0SA 4XWOA 1C3EA 3QSGA 1ONPA 2QVBA 3QE4A 4XFKA 1H0KA 4CMGA 4EENA 3JWPA 3ZU2A 4RVGA 1F4VA 3MMXA 4IQFA 3BWDD 5BMOA 3PKJA 2IYEA 4FLEA 4UU0A 3WRYA 5IJWA 2A57A 3KU1A 1JS1X 4AJEA 1WSWA 1KEUA 3HYTA 2JIZA 5JQWA 5IWAB 1G98A 3UN1A 1E2JA 3SX4A 1HFEL 4P7BA 5EQTA 2XMSA 1F2TB 3UK6A 2DT8A 1UH5A 4GI5A 5JCOC 2AMFA 3LDUA 2LUOA 3VYTB 1HQYE 1U7ZA 4FKMA 5D6OA 3U80A 1R6TA 4KXLA 5KQPA 1C4KA 4TVOA 5ALNA 3GCDA 4M6WA 4YREA 5CH3A 1RXEA 4R1QA 1QYWA 3O74A 4BUJA 4UW9A 5ECWA 3U7QA 2ZYGA 1QK4A 4RPJA 4ED9A 4KNWA 3BAZA 2JAQA 3NDPA 4PO9A 1KVRA 4RLFA 1SY7A 4I8IA 3TXYA 4D97A 1GD1O 5LLTA 4BXOB 2W8BA 3P20A 3GDHA 3QVGB 1ZM4A 2QJTA 4B3RB 2O0HA 4P82A 2OO7A 3VJRA 4CM8A 1UKVY 1EVJA 3SQNA 4F3YA 2GD6A 1U8EA 1G6OA 3Q15C 2EJCA 3TSYA 4YRKA 5IUJC 3HJCA 1CJVC 1EWRA 2XKKA 4MR8B 3OC6A 1EX7A 3F7TA 1SCDA 1XZQA 2VBIA 2ZIAA 2WDPA 2C4HA 4G9GA 3SIRA 4Z51A 2BC9A 2WG2A 3M82A 3OQNA 3N59A 2NZJA 2O19A 1H8HD 2X1MA 2EJVA 2EW2A 3BRSA 3DMPA 4A0QA 1B73A 4DGSA 1ZAYA 1JHDA 1P1BA 1QCYA 1K08A 1Q12A 1S8NA 4YEDA 1CW2B 1GCUA 3TLCA 4K9DA 2OKCA 2XNCA 3AIMA 4OLFA 5BNZA 4P4NA 1WEHA 4HAUA 3ECCA 2AUMA 2HSJA 3GJ8A 3K20A 2BFBB 1YDEA 2Q9AA 4JIGA 4L8GA 2C4TA 3CS3A 5AH0A 1QG0A 4CN9A 3PDIB 4IDFA 2GD1O 3WLEA 1Y5RA 2H8KA 1AC5A 2HPHA 3JWIA 5CM2Z 2PWYA 3BIXA 4JY7A 2A9FA 1H5UA 4M0KA 3AVYA 3NBZC 1M8KA 1YMUA 4JA0A 4X1YA 1AQIA 1ODFA 1JDSA 1K5DA 3EWNA 1K27A 5CHEA 4HRVA 3ZWQA 4D9JA 1WBJB 1XDBA 5DXJA 5FEMA 3L3BA 4IV5A 4YXWA 2EU8A 4C5CA 3TTYA 2WBLC 4CCAA 4HWTA 4NOLA 2XWBF 5GVRA 1RE0A 1CQJA 1KBZA 3D8UA 3U16A 5HP4A 5B1IA 1X1TA 1I1OA 2PCLA 4D8UA 4EX6A 3RSZA 2FEAA 1PDWA 4TMYA 1BQ4A 2LIVA 2VKQA 4R9SA 2ZSBA 4ZEWA 3T35A 4MS3A 4EKGA 1IN1A 2XWQA 3SKXA 3HUFA 4AWBA 3R6WA 3RBVA 1JI3A 1W5AA 4S35A 5FFNA 3DE3X 4C0XA 4MSUA 1WZNA 1QHHB 2VBFA 1VA5A 2ZTHA 2JGKA 3NJ8A 4IEEA 4KKVA 4GMKA 1V45E 2MSLA 3EUAA 3FW1A 4G2TA 4I9NA 1MV8A 3PQFA 2B7BA 4QHTA 1ETHA 3Q3VA 2BR4A 5EYPB 2WWWA 1CFZA 2QG6A 5CIQA 2KBEA 4EW3A 5JCJD 1DCTA 3PIDA 2XA9A 3EEIA 4A4DA 1UODA 5KWJA 1SR8A 1N0IA 3O4IA 2HPVA 3AR4A 4L85A 4CR6A 4IG4A 1JHPA 1QE0A 3M6XA 4IWNA 5C8YB 3M81A 4WRRA 2JFNA 3NX4A 4N9QA 5AJXA 2JNWA 5F23A 1IZ9A 2DUUA 1HETA 4I08A 5A3SA 4BY9E 3L0OA 3DO5A 2J7KA 4JJAA 1GU7A 2IXGA 3G2PA 1KR2A 3H16A 3PXDA 1QX4A 4KGVA 3TIXB 4WINA 3SXPA 2XCLA 1LDYA 3SOZA 1CP3A 1JV2B 3TPCA 3GAMA 2QTGA 1I4LD 1L4UA 1W0KD 4KN5A 4MVJP 1PX0A 3I9FA 2MINB 3M2TA 1IYZA 1M7HA 1G20B 3W04A 2GX6A 4P53A 4V0SA 2KQUA 1ST3A 4WADA 1XMPA 3E05A 1UXOA 5CYPA 4B6OA 1JHMA 4BWGA 4CEJB 1NC3A 2ZI5A 3B51X 2P90A 1GFZA 2GEUA 3WHPA 5A4JA 1ILEA 3AVXA 2VCEA 5AW6A 3K6SB 2HQ1A 1JQKA 2HLDA 1LSSA 4J75A 4NCIA 2OYRA 5BWMA 5FBHA 1DIOB 3PTAA 4ZTBA 1K3UB 1ADYA 3QLTA 5MGBA 5DRYA 4YT2A 1CS0B 1N2CE 3CHYA 2AXEA 3IKTA 4DSZA 4MDFA 1I4TD 4IOJA 2AJDA 3OCYA 2WIBA 5F5XA 3ZVRA 3ED5A 4W99A 3L0YA 2RGXA 3R0VA 1ZZGA 4CL3A 5JLJA 3BSFA 3IAXA 1CE8A 3IEVA 3H8SA 3ZC3A 3ZGOA 3D3WA 3GPIA 4MYCA 4ZC1A 4GSKA 4NP6A 4EITA 2FUKA 2XHZA 3HYCA 4MAFA 4PYRA 2IH5A 1QC5B 5HFNA 4HGQA 3T5DA 4B85A 1P7VA 4MUHA 2I4NA 1KJQA 1A8QA 1YZUA 3ZLUA 3JAWA 2RC5A 4ZTZB 4WKOA 5C5DA 1KTIA 2ZIZA 1VHLA 4LSMA 1D1PA 3HNPA 1NNI1 3DDUA 1YJXA 1YTUA 3WGLA 4F9EA 4BMSA 3DF9A 2V3VA 4Q3DA 2OKGA 1KYIA 2CE7A 2AD5A 4DPLA 3H2IA 1P7ZA 3AYZB 2EKLA 2FDXA 3CPEA 4HHEA 3T9BA 5FJJA 1KVUA 2JLWA 2EHJA 4GECA 1IVSA 2FRVA 2ISCA 3HDHA 4B6QA 2OLJA 3ZX4A 2J32A 2W5UA 1BXGA 3ZQUA 4XVCA 1TYBE 2QW0X 4XQGA 1MQSA 2R3SA 4QYWA 3UH1A 4GOND 4Z4GA 4OO3A 1JJBA 2VDLB 1HZJA 1J5EB 1KH3A 5EUBA 4G3XA 3OLZA 2C78A 2JAWA 2GSDA 1BRTA 2HSZA 3KZKA 3MAGA 3FPAA 4YH1A 3ZV7A 2I2WA 4BMYA 4I5FA 4D3ZA 2J67A 3QPBA 4BX0A 4OQLA 2VBGA 4X1IB 4ZYVA 4B3SB 1ZKMA 5LZ7A 2DUJA 1ZMBA 4JI0B 4QFDA 1GGHA 2O7RA 1O97D 1Z5OA 4KFSA 4LHVA 5HTOA 2ZJ2A 4G1EB 4EVRA 4DDMA 1AV6A 3SZMA 3OHMA 5K8VA 4HL6A 1T2DA 2D3TA 3M83A 2NTNA 3T3PB 1YR1A 4CKWB 3A6DA 1M5RA 1T4DA 2HUPA 5DYGA 2BAGA 3HFGA 3B7WA 4Y9SA 5T67A 5COBA 4UNSA 1UMCB 5FWYA 5BSMA 1BX3A 1E0JA 1QQ6A 1V6CA 2O2JA 2W2KB 3G2OA 2ERCA 3L04A 3Q7SA 4PC2A 1J9EA 3FPFA 1EDZA 1IJKA 5TPWA 2YIVX 1ZUIA 5D3MA 4QARA 2UYGA 1EZ1A 4WCFC 4QIHA 1BX1A 3NWBA 4PSUA 4RC9A 1D5CA 4AUEA 4ZTUB 2R4QA 1OTXA 4E5UA 4MYTA 3HR8A 4NECA 4U9IS 3NC0C 1Q95A 1NVVQ 1GGJA 3G88A 4JJEA 2IXTA 3VH3A 4HN4B 3H2HA 5F3RA 1T1GA 3RU3A 4FMCF 4PN3A 2YY7A 1O96A 1IZ7A 1JZTA 1QVVA 3L0IB 1O9HA 1T10A 5EIAA 1L5NA 5BNWA 2PZGA 5A1TA 3A9RA 3GH3A 1CPYA 1KIMA 2F64A 3HXKA 5AI9A 1BX0A 1DKQA 4MDHA 4LXUA 2ECQA 4UD2A 5SY6A 1OB5A 5CBKA 1L7QA 4IJ6A 5TARA 5G0WA 1CR1A 5DW0A 3BB1A 4LZLA 5I5GA 1K2VN 5JFTA 1R3DA 1NKTA 1TD9A 1Y5LA 2FEOA 2J08A 1J2TA 1US8A 3F46A 2EF0A 4V3CA 2FMFA 4XRRA 3RS4A 1UPBA 1RXYA 1MOZA 2G82A 3FUCA 3LBIA 1RWQA 4I1UA 2D2VA 1H2XA 3IMEA 4X20A 2GM9A 3ZKWB 3HA7A 4C7VA 4S05A 5F9FA 4NFHA 3WNDA 2R4TA 4OJKA 1ZH8A 2XCUA 1JVSA 2QTFA 4E21A 2J8ZA 4ENWA 4R9UC 1NWHA 4JX8A 5DMHA 4D92A 2DG2A 3JV7A 2DUNA 2ERXA 4XVHA 1ORWA 1J1IA 1GSAA 1XEWY 2FHSA 2HNKA 2JLCA 4TROA 3SBOA 2CV1A 4XDGA 1OTYA 1DQSA 3W8EA 1JSLA 1KDZA 1BKDR 1RKXA 2H9AA 3R0IA 4GOMD 4RZXA 3QVOA 4BNHA 1AO0A 4EB8A 1YONA 4DPMA 2ZZMA 1JJFA 4MW1A 3RYFA 4C76A 4E0BA 4BWYA 5LIRA 3QW2A 2I78A 3FPSA 1UJ6A 2OD9A 1G8PA 4GL2A 3GO4A 4URVR 5B6IA 3FSEA 4TYNA 4NNPA 3LUKA 4H7JA 1MQ8B 1J21A 3LP6A 1A72A 3HBMA 4G09A 4KPGA 4YMSA 1XROA 3R4VA 4C0KA 4IDDA 2HRCA 4KWHA 5EJFA 4B4UA 5LA6F 4XASA 1YZQA 1S9DA 1ZI6A 4N65A 3L0ZA 4Y0NA 3KQLA 2GPWA 4BFCA 2YKGA 2QL6A 2XQGA 4POAA 1DCKA 2CVZA 2G17A 1V8ZA 1M74A 1XQVA 1K8ZB 2MINA 4PVCA 3WYGA 2FUG6 4NU8X 1E4EA 2RK4A 4JHLA 5JALA 2UYOA 1X8JA 4NJOA 1B1CA 1A4UA 2ZYVX 4UEJA 2ZYDA 1IXYA 4CLRA 1QIIA 4N48A 1U2DC 1EWQA 2FPLA 4KI0A 3QU4A 2N1BA 5K1ZA 3TLAA 1QH1A 1HT3A 1OF1A 3HE3A 3AHDA 2FZKA 1KGSA 1CY1A 3EPJA 1OBVA 5L7TA 1WA5A 1X1RA 4M0MA 5EP4A 4ZIRA 2CLHB 2C4WA 3AHJA 5JC8A 2OO3A 4TLCA 2ZRIA 3GCWA 1EDEA 1VPDA 3O8DA 4WY8A 1G21E 2VT7A 3AG6A 4QDUA 3F6YA 2DBZA 1N2ZA 4QOEA 1W4LA 5FNVA 1ILWA 3Q5EA 4JI7B 5C1DA 1JA0A 3ZCUA 1J33A 2VT2A 1TYAE 1GUYA 3Q7EA 3B9BA 4BKQA 4U7FA 4D4IA 1JG4A 1WY5A 4RQBA 1KR5A 2HU5A 1LSOA 1MOSA 2NLOA 1UQTA 3KKKA 4FCWA 1WJGA 1TEHA 4FX2A 4JP1A 3A2MA 4FYKA 4MV8A 2VDRB 1E4YA 4UOQA 3RT9A 3ITNA 4EO7A 1K4YA 4ZHQB 2W7TA 2WFMA 3BDIA 4LJ5A 1MW8X 5A04A 5IVPA 4DV2B 4H77A 3R8XA 1FSFA 1Z15A 4LFCB 4WBNF 2F3UA 3V3TA 1Y3AA 2Q5LA 3CSUA 5IDXA 4O4IF 3UGKA 4B2IA 1Z35A 5UKDA 3LUHA 4LFBB 2P2ZA 1JE1A 3H6KA 2DYKA 4RM2A 3I1IA 3UUFA 2Y1OA 3BXZA 1CUEA 3ENWA 5FBVB 4LUCA 3RHTA