1YL5A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
AMARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl5A01
5I7SA 4BOYA 1E92A 1GV1A 4Q9NA 1QRRA 1Y8RB 4RL6A 2EKLA 2J6IA 1PL7A 4CLOB 1PGJA 2O23A 3ON5A 1MLDA 1QXSA 2C07A 2W2LA 3QVXA 1DHTA 3L6DA 5KJCA 1GUFA 3STHA 4DMLA 2GZ3A 4DPMA 2JFGA 1XQ1A 3VZQA 4BNKA 3LQFA 1W4ZA 5JY1A 3UGKA 1T2EA 4UVGA 4QX6A 1KS9A 2EGGA 2OGUA 3FPCA 3GHYA 1ONNA 4J16A 3CXRA 2HDHA 1ZZEA 1LX6A 4AFNA 1U7HA 2EV9A 1P1RA 3UHAA 4S3MA 4W9NC 2BFAA 3S55A 4EUFA 1E3LA 3MJSA 4OIMA 1S7CA 2DKNA 3HB4X 1DFIA 3VHRA 2VWHA 2O48X 3LT1A 3OIGA 3DZGA 2VTDA 1UDAA 3M1AA 5BNIA 3SC6A 3LYLA 4PLFA 2CZCA 2O3QA 2FZEA 1KVRA 2DLDA 1I2ZA 3D4OA 4TVOA 1SMKA 4MP8A 1DLJA 2Z5LA 1E7MA 2GASA 2HK8A 3WNVA 4D43A 3OJFA 3H9JA 2FZWA 6LDHA 1Z7EA 3RC9A 1N7HA 4Q3EA 1E3WB 4U7WA 3ITDA 1EVYA 4EZBA 1EFLA 2HO5A 5CDUA 1ZEMA 3WMWA 4ZU3A 1LDMA 5G4KB 4I9UA 3SVTA 4S1VA 1GV0A 3FPLA 5IG2A 4BNMA 3PXXA 3FI9A 4BIIA 2O3SA 5IAAA 4IS2A 4L75A 3HDJA 1EE2A 3LT0A 3NDRA 3I6IA 3WWYA 1Z82A 2PZJA 3K31A 5GY7A 1ONOA 4IGEA 2GN6A 2POQX 5L51A 1HT0A 1JVBA 2OP1A 3H2SA 8ADHA 1MC4A 3FSRA 1O8CA 1V8BA 2DBRA 4XQGA 1PJBA 1N1EA 1UUFA 1Y9AA 4BO9A 2IEBA 4UEJA 5AYVA 4EEZA 3OJEA 4ALJA 1D8AA 3K92A 1IULA 1PJ3A 1JVSA 4XYEA 4CM5A 3NGXA 2CFCA 4LGVA 1ISHA 3GEGA 4XA8A 3DZKA 4JX8A 1P0CA 1LA2A 3O9ZA 4IQ0A 1XQ6A 1XA0A 1DC3A 5JPIA 2YY7A 2QIOA 3ONEA 3ZNOA 5L53A 3EC7A 1N5DA 4PGFA 3UCXA 2VYND 1E3EA 4DQUA 3LK7A 4H16A 1PZGA 2GN8A 3PP8A 4JJGA 3JQDA 2H1SA 4XDZA 1OBFO 3TF5A 1K2WA 4WECA 5ENVA 3EVNA 1ZK3A 4CR7A 2A92A 3DQPA 4HY3A 3AM4A 3S2GA 3GGGA 1EMDA 4OL9A 3WOHA 3KV3O 4CMGA 3I4CA 3ONFA 4YJHB 5JAIA 3KHUA 4JBIA 1PWXA 3KSZO 1Q7BA 5C7OO 2GO1A 4OXNA 4Q3AA 2G82A 5JYAA 4ND3A 1DIRA 4E32A 2DAPA 4DIBA 3FF4A 1HLPA 5G0VA 3WICA 4CM4A 1DAPA 4OKIA 1S6YA 2W2LD 4PZCA 1GPDG 2RAFA 4YAGA 2ZB8A 2VUTA 4ZN6A 5KOIA 1HDZA 3AU8A 3VTFA 3W8FA 4DYDA 4KMSA 3TZ6A 4MVJH 4E5KA 4WKGA 2AE2A 1RPNA 1T2DA 2AG8A 1WMBA 4UULA 1CETA 4Q3CA 4BNNA 2WYWA 2Y0CA 5G0SA 1D3AA 3QJ5A 3PQFA 2P68A 4ILKA 1YH3A 4I9HA 4Y98A 1NPTO 2ZIZA 5HBRA 1YJQA 2CD9A 3GRKA 2DTXA 1I3KA 3KM0A 1LLCA 3JYNA 4J9UE 2C2XA 5ILGA 4A03A 1DO8A 4EUHA 1Y8RA 3VOSA 1KEVA 1V3VA 1ZJYA 4J2HA 4CLOA 1EVIA 1V35A 1NFRA 3I83A 1YB5A 3EDMA 3ROKA 4ZJUA 4CM1A 4AJJA 5COBA 1UH5A 2ET6A 3I4FA 3X2FA 3PYXA 3ZHXA 1DPGA 4AG3A 5CDYA 1YVEI 3LC2O 3RROA 2W98A 5CAEA 3IMFA 5HTOA 3S2FA 3ITKA 3GA0A 4BO8A 3JD4A 3U4HA 3GZNB 3I9MA 2CF6A 1E6EA 2Q1SA 2O50A 3I3OA 2I65A 2ZQZA 4CL3A 2Q4EA 2YDXA 3CIFA 1SNYA 3M6IA 5H81A 4Z6KA 4PLGA 4Y9DA 1PR3A 1E1LA 1LXCA 2JHFA 1YDWA 5H82A 3KSUA 4NI5A 5T64A 2G0TA 1WZEA 4RPGA 3RUAA 5DF1A 3WGZA 2CY0A 4BNTA 1KVSA 2VOEA 4NZ9A 2P2SA 3DMYA 1ZK4A 1K6XA 5I9LA 2J3JA 5IF3A 3ANLA 1LI4A 4E5MA 2PNFA 1E3WA 1NPYA 1YBAA 8LDHA 1PWZA 2ZJ0A 4OKNA 1C0LA 5U4QA 1T4BA 5G4KA 2PA3A 3LLSA 2O7QA 3GC6A 3OM9A 3QWIA 4IGFA 4JBHA 4B4OA 5KIAA 4BVAA 3AJRA 4AICA 2QYSA 1T24A 4J1TA 2Q46A 3FNGA 1Y5MA 4GMGA 1U3TA 3WJ7A 2X0RA 1MC5A 3W8EA 3KLMX 2Y05A 3OICA 1GZ4A 3AY6A 3V1TC 1QYDA 4YT4A 2FWMX 1Y9EA 4ITUA 1XDWA 3BTSA 4IMPA 5KKAA 2B37A 1ISGA 4YJDA 4YT8A 3E8XA 3M1LA 4L76A 1VSUA 1B7GO 4DBZA 1ENZA 3KTDA 2AQ8A 1HE2A 1DOHA 1PZFA 2OL4A 3GDOA 3Q2IA 3ICCA 4PG7A 2ZQYA 1GD1O 5HS4A 4BNXA 2HJRA 3UW3A 3H5RA 5T8KA 3ZWWA 2J8ZA 1NVGA 2DUWA 4WUVA 1IPFA 2FOIA 3HNPA 1ONPA 3QHAA 2GUGA 3PVZA 2P5YA 1FXSA 4PG8A 1DAOA 4GGOA 5TF4A 5THKA 4KOAA 4XWYA 1MG0A 2BD0A 2FP4A 4NFYA 4YA6A 1CJCA 1EE9A 2OBNA 2LDXA 3UH1A 2RCYA 5CG1A 2DM6A 4TKMA 3SLGA 2NSDA 3EW7A 1T1RA 1ZIDA 2FSVA 2Q3EA 3H9QA 4J6FA 4DLLA 4YJHA 4NBWA 4MVJP 1ADBA 2X1HA 4CQLB 3GF4A 3JD1A 3ZWYA 2X9GA 3IQDB 5K0ZA 2EP7A 4JK3A 1OMOA 1PJTA 1YE3A 1W0CA 4J4TA 4HNGA 4KUEA 5IFLA 2G17A 3WGIA 3PPIA 3IUSA 1VL6A 1U2GA 3WFJA 1GEEA 4K26A 5DT9A 1YQGA 3AI3A 3RWBA 3VVCA 4H3VA 3I23A 3OHSX 2GLXA 3TNLA 3RUFA 1FJHA 4Z9XA 2Y1FA 1JWBB 4CJXA 4GAEA 4JNKA 4OJNA 5KVVA 4J9VA 2VHXA 3L4BA 1U2DA 3PHGA 4GSKA 5JYFA 4EJMA 1UZNA 4YXFA 2EHDA 1XU9A 5T8KC 5F5NA 1HDCA 4DPKA 1UXGA 2OUIA 4KWIA 4F6CA 3ENKA 2D4AA 4GQAA 4BNWA 4QT0A 5JDCA 4CUKA 1NFQA 5JBIA 4U8GA 3PIDA 1YXMA 3UN1A 1KETA 3DBVO 1EDOA 5FI5A 1QV7A 3GPIA 5ER6A 2UUPA 4X54A 3VPGA 4F6LA 3G1TA 2JCYA 4NQZA 1UAGA 1WAMA 5TS3A 2UDPA 3GAFA 3RC1A 1BRMA 5DOVA 5JC1A 1MA0A 3AUUA 2GCGA 1SAYA 1LLUA 1T25A 1O0SA 2C20A 3NDIA 3C1TA 4WK6A 3GZNA 1TVEA 2P4QA 4FBGA 3AI2A 1V3UA 4D45A 5M6DA 3PHJA 4FJ1A 4D44A 2C29D 2QRLA 1YQDA 3R3SA 5TJ9A 2QG4A 3EHEA 3VKVA 4GVXA 1ENYA 2JD2A 4DLBA 4MIEA 3O4RA 3L4BC 2OHXA 3DMTA 5JE8A 3GAZA 4NFHA 1DJQA 4CMEC 4E2XA 3SEFA 3QVSA 4WJZA 1XELA 4NPCA 2P9GA 5IXYA 3LSYA 5DCUA 1SC6A 4CQMB 4D3DA 1CYDA 4C4OA 3OH8A 4IQ8A 1H6DA 4NDNE 1DRWA 2HSDA 4HFMA 1JLLA 2PLAA 1P45A 3L9XA 4LK3A 3VKUA 4YT2A 2I67A 4N54A 2NU9A 4GLOA 1BW9B 3OQ1A 3HJAA 4WNCA 4GL4A 1O94A 1FF9A 1GR0A 3V2HA 3LC1O 4WLNA 4HKTA 4NBUA 4UUMA 1I24A 1C1XB 2RH4A 3VH4A 1AUPA 3P7MA 2JHGA 4FOSA 4P4GA 3I5MA 3JD2A 3DBRB 5A3JA 4YVFA 1F06A 3O8QB 1HSOA 2OOSA 3D3WB 2C5AA 1DRVA 2BHLA 3ZN2A 2FHSA 3QVWA 3TZCA 1P1FA 5KVSA 4MKRA 3OEWA 2FR0A 2GSDA 3JCZA 1ADCA 5AXCA 1ULSA 4HV4A 2I6TA 2CF5A 4JIGA 4IS3A 1T2FA 3DOCA 3JQGB 2JD0A 3AI1A 3BHJA 4C7KA 3RU9A 3HN2A 2YFQA 2QYTA 4AJPA 2Q2WA 1B15A 4D79A 3UVEA 5A5EA 3FCOA 2A4KA 4ZRMA 1FDUA 1LSJA 2Q1TA 3HWRA 3WB9A 4RPJA 5EJ2A 2DFDA 5GZ1A 1UP7A 2Y66A 3GNQA 4EEXA 2B0JA 4G81A 1P33A 3K96A 3KSDO 1FK8A 1LSOA 5U1PA 5IDQA 4F46A 5DBFA 1B26A 3KBOA 3PDJA 4TQGA 4A2CA 1TB4A 2IXAA 2VWPA 3DL2A 1A4UA 5KJFA 3WGTA 3NJ4A 4CQLA 4N7RA 5CDTA 1ZXLA 1YB4A 3INRA 4R9SA 2I3GA 2W2KB 3U49A 1XYGA 4KQWA 3DOJA 1E77A 3S2EA 4IJUA 5JSFA 2OORA 4TKLA 3WLFA 5IZCA 1PJSA 3WJAA 4Q3DA 3AOGA 3G49A 5GZ6A 4CPDA 3FBGA 1RM5A 2WE8A 3HG7A 4BO4A 1TEHA 3PTZA 5AXAA 4L4RA 3DBHB 4JJIA 1R66A 1P44A 4YT5A 3B1KA 1IHXA 2X0IA 4CUJA 4I08A 4DGSA 4YRDA 3P2OA 1NAIA 5C7IO 4RVSA 1LDEA 2PV7A 2RH8A 3WQSB 4HXYA 2Q2QA 4HFJA 1SOWA 1U8FO 1NR1A 1O89A 1V3TA 3DAGA 4L0QA 4M86A 1WWKA 3QP9A 2H9IA 2IZZA 3OQBA 5F1KA 2GGSA 1D1TA 3LZ6A 3NRCA 4RQTA 1XKQA 1YOVA 5KVCA 4FC7A 4RORA 4YJFA 3GUCA 4CMKA 3BTUA 4R41A 2X22A 1QLJA 3IOYA 3I1JA 4O5OA 1M66A 3WBFA 4PFJA 3FTPA 3ZW9A 4YAKA 4M89A 4L74A 4HFRA 5A9RA 4R16A 1PL6A 4BKUA 4DRYA 2X9VA 3MOGA 4I5DA 4R1NA 4E3ZA 3IC5A 4PLHA 5B4VA 1E0DA 2C0CA 3ZHBA 4NU5A 4OSOA 4PG5A 1KEUA 1ZH8A 4RVDA 4QO7A 4R4JA 3T7CA 4PCVA 3NYWA 2I9PA 1GTMA 2WMDA 3KRTA 4QFDA 1VPDA 4BNYA 1F8FA 5CEJA 1ENPA 2Q45A 4WPGA 4G2NA 4CQMA 4J7UA 1U28A 4YRAA 1C0PA 5L40A 2JCVA 4Z3DA 4E2YA 2Q22A 3WGQA 2FPGA 2RIRA 4TZTA 5B37A 3ZHZA 3GEMA 1R0SA 1IL0A 3KZVA 1BW9A 4L4XA 1KIFA 2DFVA 1ARZA 4R3NA 3W4JA 2NADA 2DBZA 4XRRA 3JD3A 2VYNA 3NT5A 1C1XA 2FPIA 4GX5A 1PZEA 3LDHA 2QZ9A 1X1TA 3DBRA 2VWGA 1HZZA 3O8QA 2PZKA 3DFUA 3TQHA 1M67A 2R6JA 2FMUA 2CVZA 3D3WA 1ULUA 1YKFA 4P38A 2O7SA 3DEYX 3MJTA 1ISFA 2OBYA 1E3IA 1SZJG 1SB8A 5TGDA 1RM4A 2ZCUA 4E4YA 2H63A 2WTBA 1EFKA 4IJKA 3RC7A 1GU7A 1GUYA 4FSHA 1H2BA 3INTA 3TSCA 1LQUA 3JQGA 4J1SA 2B36A 3ABIA 3IIEA 4JP2A 2NTJA 4FFRA 4IBOA 4NG5A 5T67A 4JXKA 2YV1A 3WWZA 5JW6A 2VYVA 3E82A 3NTQA 4B3HA 3OJ0A 3T4EA 3PGJA 5DNAA 4R54A 2VZ0A 2CVQA 2QQ5A 4PZEA 3H3JA 1QORA 5F21A 2ILTA 2BF7A 4B8ZA 2VN8A 2Y0DA 5EQFA 3TZKA 1DIBA 4XCVA 3K2BA 1V9LA 3OFSA 3NX4A 2DTDA 2HK7A 4A10A 4RZHA 3EMKA 2QZZA 1IZ9A 1PL8A 1U5CA 3Q9NA 4XJSA 3KYDB 1W6UA 4FIZA 3EZLA 2ZYDA 5A5FA 1SBYA 1ZVMA 5JYDA 4OMUA 5IJZA 1R4MA 2ZB3A 4BGEA 1NXQA 2Q4BA 1GQYA 2FRDA 3OECA 1K89A 3PJEA 3HFSA 2W2KA 4A27A 1LNQA 5MDHA 3C24A 3F4LA 1ID1A 3IP3A 4IMRA 3JQ7B 3WS7A 3GG2A 1WDLA 4JBGA 3F47A 4IIUA 4BB5A 1AXEA 3C3XA 1NQOA 2O3JA 1EVJA 3V2GA 3MJ4A 1B8PA 2A9FA 5J9GA 4G5HA 5A02A 3DBHA 4EJ0A 3Q2KA 2PFGA 3KB6A 4FFMA 4NJMA 1QKIA 3RVDA 4BO1A 1I2CA 1HTBA 2F00A 1HDYA 1V0JA 5G4LA 1V6AA 2C59A 2X6TA 3AFNA 3JQEA 3ZWBA 3L9WA 4XGKA 3PFWO 5HM8A 4ONEA 3DZBA 2YQ4A 4CLXA 4GVLA 4QO8A 4I9NA 1C0IA 4DC0A 4MVJA 3DZIA 1AGNA 1NNUA 2AMFA 4RPHA 1NBOA 3NUGA 2IYOA 1ZO8A 1E1NA 4FR5A 5KJ6A 1U7TA 2BFOA 1ML3A 1ORRA 4DQXA 3WGYA 4CQMD 1R6DA 1Y8QB 2PGJA 3M2TA 2FY8A 3QWBA 1L7DA 3U4CA 4EBFA 3GGPA 4EYEA 1P0FA 1I3NA 3AUAA 2B35A 3I9JA 5L4LA 1B16A 1XSEA 1X7DA 4P4LA 5JY6A 2JJYA 2PD3A 3SJUA 5I7VA 2O3UA 3HB5X 3WFIA 1YO6A 4CMBA 4DIFA 4URFA 4IJWA 2X4GA 4IM7A 3AUSA 2DVMA 2PTGA 3MTJA 1T26A 4ALIA 3P5SA 1YWGO 4FGSA 2NTNA 1VKOA 3HFGA 1P74A 3HN7A 1XGKA 4XB2A 4E5NA 1PS9A 3JQAB 3RBXA 1HKUA 2YDYA 5DP2A 4N5LA 2D59A 4KUHA 2PH3A 1NX6A 1GADO 5THQA 4R5HA 2HQ1A 1BXZA 3AOEA 4CL8A 3VH1A 2VYVD 1K6JA 3P2YA 4RV9A 1PX0A 5CPFA 2C7VA 1G0NA 3PQDA 2D8AA 2X86A 3L77A 4J43A 1Y1PA 3O38A 4U0KA 2CNBA 3QSGA 1AHHA 2P5UA 2EXXA 4E2ZA 4BGIA 4RF2A 4EI2A 4FW8A 4LSMA 1NAHA 4XYGA 3N58A 1HEUA 2AG5A 3QY9A 4EW6A 1J0XO 4WOKA 1C14A 2NU6A 3FD8A 1XR3A 3GMDA 4HADA 1B14A 4GSLA 3VC7A 4K1LA 4J1NA 4WCDA 3GVCA 3V2UA 3WIEA 2FN7A 4UUNA 3ZW8A 4MIYA 5KWEA 2AEMA 4QSMA 2F1KA 1GQQA 4XD2A 4M1QA 1PJLA 3PWSA 4D7AA 1HSZA 2Y1DA 2B5WA 1GAEO 3U0BA 5TT0A 3HE3A 1I33A 3ST7A 3SLKA 4MVJI 3D7LA 4OO3A 1JTVA 4TMFA 4CMIA 1BSVA 1U5AA 5JCXA 3AOEC 1VSVA 2WDZA 3E9MA 4ZRNA 1NVTA 4OHUA 1PJ4A 4B7UA 3VZRA 4XZ3A 4DTIA 1ADFA 4PLTA 1M2WA 3KYDA 1X15A 3CKYA 5BNTA 1VKNA 1E3SA 3H9EO 4P4NA 5AOVA 4CM8B 7MDHA 5BT9A 1YONA 2GERA 4BL5A 2C7GA 2Y67A 1TT7A 3FN4A 2FR1A 3A06A 4D46A 3E6AA 4J7CA 3UICA 4GX2A 1I30A 3WR5A 4I8XA 4MVJD 2E6UX 2UV8A 4GBJA 3HDHA 1X7HA 3C7AA 1M75A 1RJWA 3JQ7A 1T2CA 5BSHA 1I5RA 3R6DA 1CRWG 1LQTA 4WGGA 1PQPA 5DOZA 1CQJA 1P9LA 1HZJA 3L6EA 1I8TA 1KYQA 4W7HA 4IUYA 1YL5A 4XIJA 1L1FA 1Q0QA 4YTEA 2XAAA 5L4SA 3TFOA 4DBVO 4RZIA 5AXDA 1DB3A 2PGDA 4AJIA 1ZMOA 5HA5A 4ZVVA 4BO2A 4BQPA 4GX1A 4WLUA 1LJ8A 3DO5A 2XF8A 3PYMA 2CDAA 1K5HA 3IJRA 4FS3A 3UXYA 5JS6A 1LRLA 3LT4A 4XKJA 4PN3A 2EP5A 1YBMA 3E1KA 1B3BA 3AK4A 2O2YA 3DWFA 1EUDA 1R15A 3VPXA 1Q0LA 1DBVO 5JXWA 3TZHA 3D3EA 1Z6ZA 4FFLA 3GHHA 3QVOA 1Y8QA 1GZ3A 1HE5A 3TZQA 2WEKA 4Q3NA 1ZEJA 3EAGA 3GNTA 4NMHA 1LEHA 4OOEA 3RFVA 3MOIA 1X1EA 3A4VA 2JL1A 4P22A 1J6UA 3L07A 3VZSA 4GPD1 5T73A 1H2HA 1R0LA 2C54A 4BNIA 3O03A 2E49A 1JW9B 4Z9YA 3BMOB 2D0IA 5BNFA 5A1TA 1C0KA 4ID9A 1R12A 4F45A 2AE1A 1D7OA 4R5MA 3RKUA 3GGOA 3RASA 3ZWAA 2WD8A 3DB2A 2GZ2A 4W6ZA 2HK9A 2O2SA 5B12A 1NWHA 4K6FA 3V8BA 2UAGA 4QFCA 4AJEA 3C85A 4WNIA 3DHNA 3JQAA 5KCZA 3BTOA 3S2IA 1E1KA 1DFHA 4RVUA 3GY0A 4XYBA 3WSVA 4R1SA 3FBTA 3E18A 1HLDA 4R69A 1NVMB 4FC6A 1UP4A 3QV1A 2C2YA 2WSBA 4ALNA 1RWBA 5AVOA 3F46A 3ZWPA 1H5QA 5JO9A 3CPSA 1KVQA 3FTNA 2ZCVA 1SEVA 5ES3A 4FJ0A 3GVHA 4IXTA 3IJPA 4XQCA 5JAZA 3WTBA 2BMAA 4D0SA 5ICSA 3E5MA 3DTYA 2EKQA 4Y67A 5COAA 1BXGB 3ZWVA 9LDBA 1VM6A 3ZI0A 4CMEA 4KP7A 4ALMA 2EERA 4J0EA 2AEFA 2B4TO 4MKXA 2X23A 4OOFA 1MX3A 4HWKA 5GMOA 3SC4A 3PHIA 2PZMA 4EUEA 1HETA 3B70A 1E1MA 1DC4A 1UR5A 1W8DA 4AVYA 2Q1UA 5ILOA 3ZV4A 4M87A 4DUPA 4U6QA 5IN4A 3CZMA 4Z0HO 4ALKA 1HYEA 1A9ZA 1BDBA 1GEGA 1TA4A 1B8VA 2XXJA 3CZRA 4A73A 2WM3A 4J7XA 2HMUA 3H9UA 2AW5A 4I5EA 1UZLA 5EQDA 5IN5A 1NR7A 3RUCA 1SB9A 4LMPA 2VRCA 4QECA 1B3RA 4CMCA 2JKVA 3TRIA 5DZSA 4IDAA 4TVBA 4FN4A 4LVUA 1U3VA 4E5PA 2EW2A 2SCUA 4PZDA 3KOUA 2LDBA 4BKPA 1BHSA 4FQ8A 2EEZA 3HADA 5JO0A 1PGQA 3ZWOA 1HE4A 3DOOA 4FB5A 3PZRA 1QYWA 1WDMA 3QWHA 2NWQA 3G1UA 4E33A 4F3YA 5A04A 3ETDA 1KC3A 1QSGA 5JYEA 4OAQA 4JGBA 3BZUA 5CP8A 3MCVA 3WNQA 4DC1A 4DWVA 4IY1A 3HQ4O 1DIAA 3H3FA 4Y8VA 4D42A 4FPXA 4O0LA 2AXQA 3U09A 1BDMA 4ESOA 3IP1A 3WMXA 3WDSA 4L9RA 3MJVA 4BV9A 1HDOA 2H5LA 5CFZA 2NVUB 4HP8A 4H15A 2X7HA 2YHIB 3ZGYA 3EVTA 2O3TA 4CLDA 1WMAA 4YAJA 3GVIA 5FI3A 1TT5B 5FYDA 5JCJD 2CVOA 4QEDA 3OA0A 3DXFA 3MEQA 4AJNA 3EYWA 3F5QA 1TXGA 3I52A 3VH3A 1A72A 3AM3A 2BI7A 4PG4A 1YBVA 1OOEA 4RJTA 2AQKA 1IZ0A 4TRRA 2Z1MA 4WLFA 1H93A 1BMDA 1ZK0A 2E4AA 3B6ZA 4A26A 1YB1A 4DPLA 2IZ1A 1BGVA 4J91A 1A4IA 4ZGWA 4W4TA 3R0IA 3T4XA 1F12A 4II3A 4XGNA 3WQQA 5I7EA 2WYVA 1NYTA 4PVCA 3D4NA 3MWDB 2GN4A 4XGIA 2UUOA 1FDTA 4OYRA 3K5PA 4BMNA 1NM5A 1MXHA 4LCJA 2VZ8A 4CM9A 2AA3A 3LF2A 3ZWNA 1A27A 5JC8A 3JQAD 1EK6A 1CQIA 1VL0A 3LLVA 2ZTLA 5TQVA 1YL7A 1E7QA 2O4CA 4ALLA 4LRTB 1HYGA 4ZQEA 3GT0A 1XCBA 1YRLA 3RUEA 5JFOA 3BHMA 3RUDA 1N9GB 2PK3A 3GQVA 1YQXA 1HWYA 4YAEA 5C5IA 5KNLA 1EQ2A 3IAHA 2C82A 4XQ9A 4OQZA 4IJVA 3WBBA 4WASA 4AJOA 3FHLA 2OO5A 5L7TA 2DBQA 3DZFA 2JFFA 3U5TA 2IODA 1P1IA 1WW8A 3ZV5A 4B8WA 4BKRA 1R0KA 4GMFA 4L4SA 4XYMA 3ZWCA 1DJNA 1X13A 1UZMA 1PJ2A 2Y1EA 3H9GA 3GFBA 3OJOA 4MVJG 3F1KA 1JWAB 4WOJA 3JQ8B 4IDBA 4TRMA 1NFFA 1Q7GA 3L6OO 2JCXA 4JROA 1T1SA 4CM6A 1EVZA 4LSWA 1RKXA 3NEPX 5G0UA 3CMMA 4BS9A 4DLAA 1QYXA 1R37A 4J49A 3TOZA 3KEQA 2W90A 2Y99A 4EITA 5A3VA 3I9NA 4RPKA 3ZU3A 3QE3A 1HE3A 4M49A 4BB6A 5KTKA 1VJ0A 1HXHA 3ORFA 1U3UA 2J3IA 1N92A 1RM0A 2DQ4A 1LSSA 5U9CA 3NTRA 4YBZA 1K3TA 1GUZA 3CEAA 3OSUA 3U9LA 3Q6IA 4AJ4A 1EDZA 4OSPA 2B5VA 1WLYA 2VRCD 2ZTUA 3QRWA 2PKQO 5EMHA 3AUTA 4YR9A 5HS6A 2G5CA 2Y68A 4UUOA 3KEOA 1BXGA 1H6AA 1Y5RA 5DBIA 4B7XA 2QX7A 4BO0A 2PZLA 2V7PA 4O63O 2R00C 3DHEA 5TC4A 5T6BA 3PWZA 1E7YA 4DXHA 3GVXA 1ZUD1 2D5AA 4MDHA 4O59O 4GI2A 2HUNA 3EK2A 4WLOA 1ISIA 2VWQA 1I0ZA 1O95A 3C1OA 2NVBA 1QG6A 3JQCA 3ZZNA 3VDQA 4MVJM 2UYYA 5B4UA 5FWNA 3TOXA 4E31A 2Q2VA 1PQUA 3K9QO 1KBZA 4OXYA 3CMCO 1JDJA 4M8SA 1JA9A 1MFPA 1D1SA 4PRKA 5IDXA 4B4VA 1GYPA 4HNHA 3FR7A 4I1IA 4E12A 1HYHA 3IUPA 2YUTA 4JLWA 3RIHA 2J5RA 2GZ1A 4BNJA 5KVQA 4L8VA 4CMJA 5KKCA 3EY4A 1MV8A 1U1IA 4M55A 3JYQA 3UCFA 4B4WA 3PYLA 1I01A 2TMGA 4C7JA 3KETA 1QMGA 3FWNA 3PLRA 2CDBA 3INGA 1NQAO 4ZD6A 5DBGA 1M76A 2ZTVA 1K0UA 1JAYA 3NAQA 3VH2A 2D2IA 3V1UA 3RAJA 4DREA 3IL2A 4CR8A 1LU9A 1PZHA 1EUZA 1UDCA 1J49A 1M6WA 2FR8A 3CUKA 3Q9UA 1NHGA 4MP3A 3GG9A 4CLHA 2R2GA 3RC2A 2X0NA 4DIOA 3CE6A 4LRSB 4YEDA 1F14A 2PH5A 2I76A 1F8GA 1EUCA 3ADOA 2NVUA 1HDRA 3SX2A 4W7IA 4CM9D 4HFNA 4YJGB 5J23A 2TMDA 2YHIA 2GNAA 5EIOA 3NGLA 1IOLA 1DIHA 2Q49A 1TT5A 2NV6A 3BMQB 5F1PA 3W4IA 3JQ6A 3LU1A 1X7GA 4OQYA 1QYCA 3BMCB 2BFPA 4TRNA 1VL8A 3W8DA 2I3AA 1N7GA 1Z75A 5L95A 3F1LA 3DFZA 4GLLA 4BUCA 2X58A 5JMPA 1PJCA 2EGHA 3F9IA 3H2ZA 1JAXA 3NV9A 2PD4A 4R1UA 2PWZA 4MOWA 4QQRA 1LRJA 3H5AA 3GDGA 3ZWMA 1IE3A 5CG2A 3ZDFA 1OI7A 3PIIA 3JQBA 3EZYA 3KO8A 1BVUA 4IIVA 2VHWA 2HJSA 2QW8A 2VUSA 1C1DB 3VAZA 3BXXA 4WE3A 1UDBA 1PSDA 3WLEA 1A5ZA 3L0DA 3RUIA 3TL2A 3DAPA 1N9GA 3ANNA 5G0TA 4Q39A 2PGLA 3I9KA 1ZSYA 3UUWA 4ZQBA 3JD0A 1Y81A 4FGWA 1R16A 2I66A 3OIDA 2OMEA 1PJQA 3WIDA 1LSUA 3ZV3A 3IDSA 3DR3A 3AWDA 1O6ZA 1E6WA 2QRKA 4TWRA 4OGWA 4MVJF 3ZU4A 5EPOA 2VT2A 3JQ8A 4DMMA 4KQXA 3F4BA 5IDYA 3QWFA 3S1LA 3WGGA 3C7DB 6ADHA 3WTCA 5A05A 3UOGA 3OP4A 4E21A 5JAMA 2BELA 4D0RA 3JYLA 1NQ5A 5KJ1A 1IY8A 1P1KA 4BO7A 5AXBA 2Q1WA 3RJ9A 2GR9A 2D3TA 2YW9A 2EJWA 3RJ5A 4KDEA 2WJPA 4ND4A 1B8UA 5L7YA 3VPSA 4J3FA 2XOXA 3PEFA 1CDOA 3PRJA 2Z1NA 3JYOA 5TT1A 4E5YA 4BV8A 2IDZA 4MIOA 1ZMTA 3JQBC 2JAHA 1XEAA 1G1AA 3NJ8A 2HMTA 3OQ6A 1E3JA 1J5PA 1MUUA 4E13A 1Q7CA 2IRWA 4CM7A 1LDNA 2VUUA 3IKTA 1SO8A 2Y0EA 1QLHA 3V1YA 2YV2A 2NUAA 1NASA 1DC5A 2IZ0A 1PGOA 4XEHA 4NIMA 3HSKA 3PHHA 3UFXA 2X0JA 3PZBA 1BXKA 2RBEA 4BO3A 1MFZA 3OIFA 5ADHA 1AE1A 5IXSA 3BYZA 3W4KA 2V6FA 3FNEA 4NFSA 4UVHA 3WG9A 2RHRA 1GZ6A 3SBOA 4DVJA 4R9RA 2ZKLA 1X0XA 4XIYA 4RGBA 4YB8A 3GRPA 1GYRA 3RU7A 4FD3A 4DQVA 1G6KA 1DHRA 1UXKA 1XIVA 3Q3CA 4NBRA 4PLYA 1I3LA 2FPPA 4BNUA 4CODB 2O4UX 3P19A 1QR6A 1Y6JA 1XG5A 3TL3A 3VPHA 2YYYA 4CMAA 3DAFA 4BMVA 4XQEA 4H7PA 1LDGA 2G76A 1YS4A 1CWUA 4BO5A 1XHLA 3AY7A 4IDFA 4RLSA 2BLLA 4LISA 1EBUA 4R68A 1ZSVA 3U3XA 1LDYA 3X2EA 3WXBA 1OC2A 4AL4A 4EGFA 3S8MA 4I5GA 1X14A 2B4RO 3RBVA 1ZW1A 4ZQGA 4UVIA 4E30A 3UAGA 1LLQA 3RCBA 3KUXA 3LT2A 4BGVA 3BA1A 2V6MA 5A9SB 2IXBA 2HAEA 3PK0A 4FFPA 3AW9A 4YJGA 3WQRA 5H83A 1LRKA 3I9OA 2J5QA 3GVPA 3BMQA 2P9EA 2YJZA 3TDKA 3ASUA 3AY3A 1AN9A 1CERA 1O5IA 3JSAA 4INAA 4K9DA 3BMCA 1I10A 2NLOA 2VOJA 3PJGA 2EF1A 4JJFA 3ZU2A 5K6AA 3NDJA 4NJOA 4U5QA 1ZJZA 1Y7TA 1I3MA 2RHCA 4CV3A 1PTJA 4G65A 1Q0HA 3K73O 4Z9FA 3A28A 4NBVA 4AJ1A 2BGMA 2NU8A 1Q2XA 4PIVA 2GF2A 2J5KA 3TPCA 3GNSA 4OH1A 4J1QA 3FWZA 3GOHA 3HDYA 3U62A 2W8ZA 4NBTA 4YPOA 1DFGA 1IHYA 2Q99A 4UVDA 1Z45A 1I32A 3H4VA 2NACA 4YQZA 1B0AA 1E5LA 3JTMA 2HU2A 2NM0A 3I9LA 9LDTA 5EN4A 5GZ3A 1C1DA 4UVEA 3COSA 4YCAA 1DEHA 4LN1A 4AJ2A 3GFGA 2HMVA 2WE7A 3KVOA 2GD1O 4HUJA 4B7CA 2WYUA 3DTTA 4E0BA 1DSSG 2I5PO 4N5MA 3T7EA 4GH5A 4JQCA 1P77A 3Q0EA 4ZA2A 2X5JO 3ZH2A 1JKIA 1F17A 4BNVA 1VJTA 1CEQA 5I9NA 2NQTA 3KXDA 4XJTA 1E7SA 2VHYA 4GWKA 1IB6A 1WDKA 2PR2A 4PVDA 4AJKA 4IINA 2QHXA 3ICPA 4W99A 1RYDA 2Z95A 3GR6A 1AXGA 5K6AC 4RF3A 3BHIA 1PQWA 5TRTA 1EZ4A 4RCVA 5ITVA 1U3WA 4UEKA 3NKLA 1E7RA 3VZPA 1EK5A 4YDRA 2HCTA 4FFOA 3UF0A 5B1YA 2D1YA 1H9BA 3UCEA 3WGOA 2X9NA 1U9JA 3AU9A 4RDIA 4N18A 4WLEA 5I9MA 1Z73A 5AQ1A 4Z0TA 1A9YA 1YJ8A 3WSWA 2HRBA 3IS3A 1R4NB 3B1JA 2QRJA 1I36A 1H94A 1JN0A 2PKRA 3PJDA 1H9AA 1I2BA 5L4NA 3WYBA 1PU2A 5EINA 3QIVA 3R3JA 1VJ1A 3GH3A 2DU8A 5FFFA 5MGBA 4CMHA 3MZ0A 4BMSA 4E6PA 1WVGA 4ZQHA 5C7LO 2VZ9A 2YZ7A 3FR8A 2HLPA 2YFHA 5JDIA 3MTGA 5JLAA 2ZYAA 4NR0A 5A06A 1ISJA 1TLTA 1VE9A 3BTVA 1ZK2A 2VQ3A 1MGOA 3BAZA 1QV6A 4CUZA 3H8VA 3JYPA 4CV2A 4XR9A 3PDUA 4IPTA 1VRWA 3ADPA 3H65A 4B3IA 3GN2A 3GPDG 4IZHA 3G79A 2XXBA 4XX0A 4ND5A 4PLCA 5F5LA 3ETGA 3E9NA 5C3MA 3FNFA 4YWJA 4FCCA 4KDFA 4ZQFA 3CTMA 3EGOA 5G0WA 4XB1A 5CDGA 1GPJA 4WCFB 4BKOA 4ND1A 3UKOA 5JCJA 2ZB7A 3DHYA 1GYQA 4W82A 4PLWA 4MINA 3D64A 4R3WA 2XPCA 1GL3A 5JAQA 4RDHA 3H7AA 2YV3A 1OZAA 1P1HA 2E82A 4MJLA 3O26A 4IXWA 3VPFA 1CF2O 2EJVA 4NH4A 1AHIA 4BNHA 3TJRA 1JKFA 1F0YA 1O9BA 1ZXBA 4L73A 4YQYA 4CLRB 3W6UA 5ENDA 1WPQA 3NT2A 4II2A 5BSEA 1N8KA 3U4DA 2V6BA 5F1OA 2B83A 4XR4A 2B69A 5JDIC 1UXIA 4BQRA 1ZNQO 5CEFA 2BH9A 3EUWA 5JMWA 1KC1A 5CEEA 3RD5A 2A35A 5TIIA 4MO2A 4TZKA 2NTVA 3ZHYA 2IE0A 3NTOA 4DYVA 5A9SA 2CMDA 4U0JA 1IPEA 2P4HX 4D3SA 3PHLA 3ULKA 1J4AA 3NT4A 2C5EA 4B79A 3E9QA 4J4BA 1D4FA 3G0OA 4KUGA 1A7KA 3DBLB 4U6SA 1MB4A 5TLSA 4BNLA 1ZKMA 4B4UA 1FDVA 5IDWA 2E37A 2V6GA 3GLQA 1M6HA 2WD7B 1NQTA 2IYPA 4RVGA 4A0SA 4GKBA 2ZK7A 1WNTA 2EKPA 5ITWA 2BI8A 5TX7A 3ASVA 3ZWXA 1H6CA 3ZNQA 3RKRA 1ZCJA 4M54A 3H5NA 1DRUA 4MVJE 1HDXA 1ZFNA 4QUKA 1TI7A 4LMRA 2CDCA 2G1UA 2J3KA 2JFHA 1N1GA 4XRGA 3LF1A 2GDZA 5BQFA 1PGNA 2OXIA 2EIHA 1SPXA 3BMNB 4PG6A 4NHEA 3D5QA 2FSSA 5A03A 3K8ZA 4GWGA 3HUDA 3WX0A 1NP3A 4Y6SA 1MG5A 2EW8A 5L3ZA 2BKAA 3PI7A 5T5QA 1LC0A 1H0KA 1CIVA 1GDHA 1KERA 3W6ZA 5G2OA 2W4QA 1N2SA 2GPTA 1EBFA 2ZB4A 2OFPA 4J4HA 4CR6A 7ADHA 2HKIA 4GX0A 4BKQA 2X5KO 1RYEA 3M2PA 2BRUA 5JNLA 2VNAA 2PY6A 1G0OA 1BG6A 3WYCA 4JCOA 4R1TA 4PLVA 3RBZA 3ZV6A 4CM8A 1FMCA 3ROQA 3LC7O 3JQFA 5BSFA 1YOVB 4XDYA 4O1MA 3IKVA 4YJFB 1ZBQA 3TFQA 4XYLA 4RPLA 3OEYA 3PWKA 1BTOA 3QQPA 4MPDA 1Z7BA 5A9TA 3JQ9A 4RLHA 2ZYGA 2EG9A 1SCUA 4K6CA 5IZ4A 3A9WA 3PQEA 1YL6A 1B2LA 4HBGA 4UEOA 4WLVA 1R4NA 3JV7A 4CMIB 3AM5A 1JKJA 1QP8A 3D1LA 3FRJA 3KYBA 1NHWA 1E5QA 2BFMA 3OETA 4WEOA 2VCYA 4JP3A 1OFGA 4IDGA 5CPBA 1GQ2A 1X0VA 3C8MA 2JAPA 1PIWA 3B20A 2NQ8A 3PGXA 1LC3A 1W73A 2D5CA 2I99A 2VT3A 3D5TA 3QVTA 3WGHA 3BIOA 5CHEA 2DC1A 5EESA 5FF9A 4R01A 3DONA 4FDAA 5TNXA 2NVWA 3E5RA 5DCYA 5I8ZA 2ZJ1A 5JDCC 3ROMA 1UXHA 1K6IA 3GDFA 1P1JA 4D41A 4E2WA 4EDFA 1A71A 1HF3A 2Q50A 5I8WA 3GZ4A 3G3EA 1UXJA 5EL0A 2DPGA 4IDCA 4Z3KA 2BGKA 3ENNA 3H6KA 1YDEA 3B1FA 3JQFC 3CSDA 1FDSA 2H6EA 4WCFA 4QTZA 5EERA 3ZCXA 3KYCB 1VLLA 4ROSA 5DN9A 3JQ9C 2YHUA 3A1NA 5L9AA 4KWHA 5BSGA 2HRZA 4FFNA 2R00A 1UAYA 3C1AA 4GGPA 1DIGA 2OZPA 4BNZA 3OA2A 1LBEA 2GRAA 3BMOA 1VI2A 3HDQA 3RFTA 3VTZA 4RQUA 1DDOA 4CLRA 1KVUA 1WXDA 2VHVA 4Y6PA 4YAIA 2HMWA 4JN6B 4Y6RA 3RUHA 1KY4A 1KOLA 4BGUA 3DMTC 2AHRA 3K30A 2B4QA 3ZNPA 3E48A 1XWFA 4OXKA 1NTOA 1QYVA 2PKQP 2VTEA 3DC2A 4WEQA 1GCOA 1HRDA 2Y1OA 4I5FA 3D4PA 1T2AA 3C7CB 2DBVO 2HMSA 2AQHA 5L7WA 2DPHA 4DL9A 1NWCA 5TJHA 5DULA 4LW8A 5T57A 1FDWA 4YYZA 4J0FA 5F3RA 3QA9A 1A7AA 3DBLA 4TRJA 2P9CA 2VNSA 2VRBA 2O3RA 3VDRA 4HX5A 2YQ5A 5CDSA 5BR7A 4WCFC 4GKVA 1R4MB 3DDNA 3MJCA 2IEDA 4PLZA 2WD7A 5HRUA 1LUAA 4P8RA 1XU7A 2Y93A 2AEJA 2Y1GA 1IUKA 1KEPA 1IYZA 2EWMA 1PS0A 5HWSA 1C3VA 3AFMA 3OF2A 3I6QA 1GY8A 5LDGA 4J90A 3ANMA 4NU6A 5B4TA 1WZIA 2BGLA 1JU9A 5KJEA 3WYEA 3U4IA 5LCXA 3F3SA 1SEPA 2P91A 3CINA 2X8LA 4LCEA 3HZZA 5DDIP 1ZK1A 1Q1NA 5C37A 3QW2A 2JD1A 1NPDA 3GK3A 4FJ2A 1EEHA 4BHTA 5FEUA 3A14A 3N74A 4ZICA 3ZNNA 3BMNA 3DZJA 3RQSA 1BVRA 3SJ7A 4NJMB 4PRLA 5K9ZA 1KY5A 3PJFA 1MP0A 4IDDA 1YGYA 3TWOA 4LVCA 3QWAA 4BNGA 1WP4A 3RSHA 4Q3BA 2V65A 1KVTA 2WWRA 3Q11A 5A4DA 3GUYA 4Z0PA 3LVFO 3ONDA 1KEWA 1PGPA 2NU7A 4BNFA 3KLPX 4N5NA 1SOVA 4PLPA 3W1VA 3OJLA 1DLIA 5DCWA 3K2EA 1HL3A 4B3JA 3OMLA 4J2OA 4CV1A 4O6VA 4A5OA 2E48A 3MWEB 1ISMA 4MKZA 2GN9A 4NK5A 1JQBA 1L7EA 1DC6A 4CLEA 5I7FA 4EJ6A 1PR9A 1LTHR 5LC1A 4KTVE 3R1IA 4A7PA 4R51A 1UP6A 2ZTMA 1MXFA 1GCUA 4IZIA 2DTEA 2CSUA 1U4SA 3F5SA 3ROPA 5IZCC 5LDHA 1PEDA 2DT5A 1RM3A 1XLTA 1ADGA 2AQIA 1E6UA 1P31A 2J3HA 3D0OA 3FNHA 2DUUA 2CUKA 5ER9A 1VC2A 1LDBA 1ZSNA 4ZHSA 4CV0A 4QXMA 2Y1CA 3E03A 2X5OA 1GFSA 4IDEA 3RFXA 1PS8A 1E7WA 3GEDA 4D3FA 4NK4A 4KZPA 4MP6A 3MJEA 5L45A 1U4OA 1U8XX 2ZATA 3L4SO 3CH6A 4ND2A 1HDGO 5COQA 3RI3A 1DXYA 3ZU5A 4RF4A 1Z74A 4RF5A 3TN7A 1T4DA 4TROA 4UAGA 3VVBA 1LLDA 3SXPA 4CM4B 3V5NA 4UREA 3GN1A 3F6YA 1P3DA 3DZHA 5DP1A 4RVHA 1OC4A 3OBBA 4TSKA 4DA9A 4YRBA 3PFFA 2PD6A 3Q1LA 4NNJA 4AJLA 4W9NA 3PLNA 2A94A 4KTTE 3G17A 2NNLD 3ETEA 4IQGA 4OM8A 4RVFA 4AJHA 3QLJA 1OAAA 4RO0A 4FOOA 4UUPA 5TSDA 1UJMA 4CM3A 3KYCA 1EQUA 3HHPA 3GMSA 2VHZA 3K6JA 4YACA 4BO6A 2GYYA 3N7UA 1H6BA 1ENOA 4K28A 1BWSA 5ICMA 2OP0A 2UVDA
chains in the Genus database with same CATH superfamily
1S2LA 3ZKWA 4D82A 2JZCA 3FIJA 4JLMA 1KTIA 1K3FA 4PS1A 4RGVA 3ZLBA 4IH4A 2EKLA 1O6BA 1KI8A 4OBEA 4YRTA 4ES6A 5C8XA 3THXB 2EKZA 2GDJA 4NWIA 2AXNA 3ON5A 1CUBA 3T4PA 3GJ4A 3QVXA 3PFCA 1BKYA 1GUFA 1GARA 1R0BA 3STHA 2WWWA 3WIUA 2OXCA 3R8CA 2Z5GA 4Y1FA 3VZQA 1IHPA 1DP4A 4H3HB 4Y9TA 1K2VN 5I8PA 1W4ZA 5JY1A 1UC5B 4UCXA 3UGKA 1RXEA 2BEJA 3UT6A 1F6WA 4HDMB 2VT6A 4M76B 3T38A 4O2LA 2OGUA 1JBKA 1XZAA 3I1YA 1P2DA 2XCTB 4P2GA 3DFIA 4R1QA 3DH0A 5F77A 3G6KA 4B6PA 1O9GA 3CLSC 3L93A 5TY0A 4AFNA 1DEKA 1ZJ5A 2QYHA 1GPLA 3DCJA 3FOWA 3OCYA 4S3MA 3WIOA 3ZLVA 4LJSA 1HNNA 1QBKC 5J43A 1TAUA 1KYYA 3OIUA 1S7CA 5JQGA 2CNDA 3MB8A 5AJWA 2CW5A 2G80A 4C7VA 2GJAA 1W85B 1CXZA 3DJFA 3V4FA 5EXSA 4F9TA 3U60B 1P7CA 3FCCA 1H2EA 3CNBA 3QFHA 1QBGA 2PTHA 1Z3CA 3A6HA 1KK3A 3AR3A 3G2QA 3A4YA 4HQ0A 4UE6A 2ZT6A 4A1OA 4C43A 4BYGA 2CYBA 1PQYA 3WDLA 1PUIA 1KZ1A 2AF3C 1H3NA 1E7MA 3RVPA 3UWPA 4RIIA 3OJFA 3UK1A 5MFPA 5DBEX 2EYQA 6LDHA 1JEEA 1Z7EA 1AGYA 2CXSA 4MEJA 3AEYA 4UTXA 2Y77A 4U7WA 2V54A 3ITDA 3L84A 4EF6A 1EFLA 3HFRA 3JQPA 1IAQA 2PUEA 2JCSA 5B36A 3GLHB 4I9UA 4IWNA 1B00A 2AX3A 4NHOA 3PVSA 3FI9A 5IAAA 3ED1A 10MHA 1T1EA 4L75A 3II6X 1E2KA 1EE2A 1JR3D 3I6IA 3LT0A 3N0TA 4XFDA 1Z82A 1L4UA 3K31A 1O4WA 1ONOA 4MS3A 3GCXA 4X62B 2V58A 4DCCA 2Q28A 4OHPA 5TQ2A 2O6LA 1FNDA 2PLWA 1OI2A 2G9NA 2VL7A 2CKDA 1JVNA 3SHFA 2B20A 1O8CA 4XQGA 2DBRA 1PJBA 2P9JA 4JLKA 4BE4A 1UUFA 1Y9AA 4KIUA 4MLPA 1RBYA 1AUVA 4JZYA 3V7YA 1WXGA 3QUSA 4DLKA 1YTUA 4OHYA 1D8AA 2V3WA 4MGZR 3EQ8A 4MS4A 3NVMB 3MTDA 2NV2B 2W6JA 4DKXA 4ZK2A 4XYEA 5DWVA 2GHTA 3DLPX 1DAGA 1U11A 3L1KA 4CM5A 3ZVKA 2JHPA 3BC1A 2Z3ZA 3AF1A 2K87A 1USWA 3MWEA 3RYIB 4AZTA 4HDRB 1EM6A 1PG2A 1RPAA 2GBIA 1ISHA 3OX3A 4G8DA 4WZBA 4C0HA 4DNXA 2OILA 4JX8A 1K92A 1LA2A 3O9ZA 4IQ0A 3NOXA 1XA0A 3B2NA 4E70A 4WH0A 2V3CC 1Q92A 5JPIA 2YY7A 1KRHA 3CLSD 3IVRA 4IDNA 5GJCA 5B57C 3OM0A 3EC7A 4KJXA 2AFRA 2P6MA 4OMFG 2O07A 4GDMA 5F1YA 5AVJA 4MWEA 3C3YA 3AIKA 4H16A 2GN8A 3PP8A 5M34A 3NBQA 3RT9A 3RYCB 2HNKA 3WK7A 1OBFO 1V11B 1I51A 2C9OA 3V8NA 5JUWA 1AUQA 1KDRA 1Z4NA 2RGXA 3DQPA 4R6XA 4ZO8A 2D2EA 1UM8A 4C3OB 4CMGA 5FPSA 3T7AA 1JMKC 3ONFA 5HCNA 3KHUA 4TV9F 2CLHB 1U1CA 2R5WA 3RSFA 5G40A 5E1DA 1U9ZA 1SVOA 1BC5A 1FRNA 1VYUA 2GO1A 1FTSA 3DZ8A 2OBLA 4OXNA 5JYAA 3VZDA 4CRWB 1ZM7A 3NXSA 2DAPA 5HSGA 1GNLA 3IUBA 4CM4A 3R40A 2GEUA 4OKIA 1SVSA 1GPDG 2E7ZA 4UW9A 1VKRA 3L06A 2OHFA 4WUTA 3ZS9A 3W8FA 2HLDA 3QLEA 3HBAA 4KMSA 4UOEA 1VL2A 3KPUA 3TLMA 3DMPA 1XXHB 1C3OA 1KJQA 1RPNA 2WHPA 2WTEA 1ADJA 4JEUA 5EIBD 2HRCA 3R3UA 1P7ZA 4UULA 4JJ8A 5IYZB 1PNOA 1CETA 3DE4X 4JGGA 3ZQUA 4ZYUA 3PQFA 2HWKA 4ILKA 4LWPA 2FDRA 1XVAA 3A4LA 3UPUA 2QM3A 4URWR 3I0ZA 4URZR 3I73A 1OPRA 4Y98A 5AUNB 1TQ8A 5FIUA 3NIGB 4EY6A 1J2YA 4UQPA 2G70A 2PQ2A 3O4HA 1KFEB 4I81A 4JC8A 1KAGA 4J94A 1QMIA 2HI0A 4J9UE 4A0HA 4MVWA 4JB2A 4WY2A 3MT7A 2C2XA 5AUQA 4NAVA 5ILGA 1AM4D 3MPOA 3DAHA 2D2VA 2WQ6A 3VOSA 2XD4A 1TK2A 6NULA 1CUHA 4ENSA 3I83A 3P27A 3VR5D 3QTTA 1P6QA 3HXQA 5G02A 4UNRA 1JBQA 3KBBA 4Z7OB 4AJJA 2JIRA 4RXMA 3ETCA 1UC4B 2Q3HA 4N41A 3JZIA 1DPGA 4M1ZA 1E5DA 2LE0A 3TLBA 4ENRA 4JJAA 4BFZA 1PFUA 1UOQA 2HCJB 4HDMA 5JMOA 1RSZA 2JFXA 4C76A 1OR8A 1ZGHA 1UPTA 2B7BA 4LTDA 4CKBB 3IHKA 5HTOA 1KDTA 4BO8A 3GX1A 4E88A 3FB1A 3GZNB 1W4RA 3UM9A 2WKRA 3DL0A 3I3OA 3M89A 5JCPA 1W2GA 2I65A 2ZQZA 5AICA 2FW6A 1ABFA 1QPZA 2H51A 1A9RA 4XQ0A 4WLVA 5CYGA 4C5AA 2JGFA 3O8DA 4MEBA 1R0XA 1W85A 4G1VA 3ABRB 5H81A 5IT0A 4Z6KA 5F52A 3E8SA 3LRPA 1KY2A 1UM9B 1LXCA 1FFEA 4NI5A 1KIMA 4K6OA 2DHEA 1WCIB 3VU1A 3H5VA 1V7PC 3OZTA 2OSVA 5CYOA 4CTKA 3SIRA 4X97A 5H0IA 3RUAA 4OP3A 1Y3BE 5B1DA 2CY0A 5EZ6B 3ANTA 2C3PA 1M2GA 3SN6A 2R97A 3TCNA 5D6OA 1K6XA 2W6JD 3EF3A 1QVZA 2BVNA 1HE1C 2XE7A 1LI4A 4H6XA 4W5JA 2UZIR 3TTWA 1SXQA 2IIVA 5I48A 3VUEA 1C0LA 3EFHA 3P97A 4V0QA 4AWBA 3GRAA 2ZRNA 3LLSA 2O7QA 2VIIA 3GLHA 4V0NA 5CNMA 3CG4A 2YXNA 1XDGA 4X85A 5FPQA 4IGFA 4DA4A 2ASVA 3SICE 2DFTA 1P91A 1WULS 2A84A 3TQRA 2HU7A 1RC8A 2OQIA 5I5GA 3P0IA 5D8DA 3A1CA 2QYSA 4TMZA 1WF3A 1Y5MA 5KAPA 2HX1A 4TV8F 1EWYA 3VPDA 2X0RA 5DRYA 3WJ7A 1ZIXA 4YV1A 3UY4A 5MHTA 1K88A 1ORIA 1EI9A 2XNJA 3W8EA 5CVTA 4ICIA 4X1OA 2FKNA 5HTKA 1AT1A 1GZ4A 1TF5A 1YDHA 1F2TB 3ZLUA 2FZLA 3UAWA 1XDWA 3BK7A 3OJXA 4RSRA 4OYLA 5LBIA 1N0WA 4YR7A 3A9RA 1R88A 3L8FA 3M49A 5KKAA 1RAHA 4CL2A 4LNAA 4WDRA 1ISGA 5ALRA 4TLBA 1DZ3A 4XI9A 3RS3A 3DDOA 5KOJB 3M1LA 2VJPA 1I2AA 2Q8QA 5K8TA 5ELXA 1M8JA 5AW0A 1XCGB 4DBZA 4X8MA 3RYIA 1ENZA 1K75A 3R09A 4HDRA 2GKSA 1DOHA 3SMVA 3HB7A 5HQ3B 3A6KA 1DAFA 5ALPA 1I0LA 3DAYA 3AV3A 1VIMA 4EJFA 1XNQB 1U2PA 2JI6A 3U1BA 3P0FA 4X8HA 2HLDD 3H5RA 2WY2D 2J8ZA 3L2OB 1NVGA 1T8UA 3PQ2A 2FOIA 3HNPA 5F2OA 2G06A 5AW9A 2CEAA 4L28A 4DCTA 5ISMA 2A58A 4F60A 1A69A 2XMPA 3RYCA 4BZXA 4HWRA 4AXBA 1V11A 2OBNA 3A1EA 1G21B 2LDXA 4F3NA 4D4MA 3KX2A 7MHTA 5CFOA 3SLGA 2NSDA 3EW7A 1ZIDA 2GS9A 4NBKA 1EWRA 1X2EA 3B2EA 4Z7NB 3WKCA 3R7DA 1WMSA 1Y7HA 5ALIA 1L5QA 2CB9A 4NS1A 1U0TA 4NC9A 1GGKA 4QXOA 1OLOA 5CGZA 4IUBS 4ZAXA 3TBHA 4ZI7B 4PYOA 5K0ZA 1IEQA 5JALA 4MV6A 4DDHA 2FE1A 2C2GA 3U48A 2Z1DA 4HNGA 2FPLA 5IJWA 3I2HA 3RRMA 2WW8A 3LIIA 4ISCA 3QVMA 3FJ1A 3IUSA 4Q15A 1U2GA 5BRJA 1DRJA 4KBFA 2C9YA 4L4ZA 1Y89A 4GZ6A 4M0CA 1OBCA 3QLUA 1YQGA 5D7NA 3QMVA 5ALJA 3SK0A 2AMVA 3VOBA 1P73A 2VR1A 4H3VA 4FOTA 5JYCA 1T29A 4CDNA 1XXHA 1WMDA 2JVJA 3BQMB 3OHSX 5B3JC 5AVXA 3TNLA 2GNOA 2EBWA 5EXDA 1SCAA 5IYZA 1MB3A 4HH1A 1I0IA 2PX5A 3W5BA 4CJXA 4K88A 1UK8A 2Z43A 4OJNA 1EHIA 2CGEA 2Q3BA 1DQRA 1NBMA 2PUCA 4M88A 4GSKA 4NQRA 5JYFA 1X1CA 1L7RA 4NZPA 4PAWA 4WJLA 4HQFA 2GK6A 3WK4A 4YXFA 3D81A 4AIIA 3C16C 1PG5A 4DPKA 2OUIA 4F6CA 1P2SA 3BULA 3ODPA 4Q6BA 4FZVA 1ZN8A 1E2LA 1GNVA 4UDYX 3T7IA 3KQTA 1XCPA 4RPCA 1SULA 1G18A 3KQMA 4EI7A 3PR3A 3PIDA 1YXMA 3D4LA 3UN1A 1KETA 4Q1BA 3DBVO 3ZVLA 1W88B 2Q6TA 4OMCA 5CH5A 2IZOA 3HJBA 3T0GA 3GJ0A 4EKNB 2J9GA 3FOFC 2QJOA 4IX1A 1NONA 1DWPA 5T7BA 3WLRA 4F6LA 1K5GA 3G1TA 2JCYA 2ZAGA 3FRHA 1KA9H 1UAGA 1Z7GA 5TS3A 1DUIA 2X13A 3PFIA 1OH5A 3USZA 2EQ5A 4D9BA 3NOOA 3UMYA 2G5PA 3DVSX 3GWGA 3CPEA 1QHSA 1P1BA 4RY0A 4LBVA 2GCGA 2E18A 1SBZA 2YOHA 3NDIA 2ZSIA 3MHTA 2D00A 4WK6A 4LG1A 4CKBA 3N07A 4DSUA 5EJ6A 2Q5IA 1UDXA 3GZNA 1WKCA 3HSYA 3QLUC 3KK0A 3LA6A 4IDOA 4YJKA 3WZLA 5E38A 2KJQA 4FJ1A 4K1XA 2C29D 4Q66C 1W19A 1HK7A 3S8YA 5HGXA 4F3RA 1H22A 2VVTA 2C2ZA 4XJVA 4YUXA 1MRNA 4B82A 2E0IA 1KPIA 3TIVA 3UW1A 1X7YB 2R751 2YNMA 3D7KA 3O4RA 2WAYA 1A9PA 3DMTA 1CP3A 3BIWA 4YRMA 1UM9A 4FP9A 3EP6B 1JJ7A 2PZFA 2ZBVA 3GAZA 4BBAA 5KU1A 3IV6A 1SXHA 3MXOA 1WCIA 3T94A 4FKBA 3WO1A 1G6OA 2C7OA 4WJZA 4AF7A 3AVTA 1XELA 4HB2A 3ZD7A 4ZOQI 5DCUA 4F92B 1J9EA 4JVSB 5GPBA 3M81A 4JYBA 1OFUX 2PRZA 1M6VB 1EFAA 2RHHA 2FPGB 2QBYB 1DRWA 1UKAA 1P0QA 1XZLA 3L9XA 4V24A 5BYJA 4N54A 2R4QA 1M2HA 2FPOA 1TMGE 5LOVB 3LRXA 5F7OA 3FVVA 1FF9A 3MB5A 4G26A 1MB9A 1PKXA 4O4JB 1ZLYA 2JHGA 2R86A 4KE9A 4P4GA 4WDQA 5FTJA 3DBRB 3FFBA 3LBYA 3I37X 3ZDDA 4JMPA 4D8YA 3ECAA 2JJ8A 4RZQA 3D3WB 4WX2B 3PT9A 4QU0A 3PJRA 4JVLA 2FHSA 2A0KA 2XR1A 3PXEA 3TZCA 1P1FA 3OEWA 2FG6C 2FR0A 2O2JA 1ADCA 3A05A 4G41A 4WOBA 1BQEA 1ULSA 3T3MB 3TUIC 1H8HA 1TAHA 4JT8A 4HLUA 1KAMA 4IS3A 3S7ZA 4ZCTA 3OQMA 2JD0A 5HF5A 5KOJA 2FSPA 2XWSA 4QDXA 1CUCA 3MMSA 5E4TA 4YCJA 5CLFA 3HP1A 4BFYA 1ACMA 4M0MA 1X38A 1N77A 4BBZA 5HQ3A 5KMGB 1VPEA 3NNSA 4LRQA 4G9EA 4D98A 4PZLA 4EQZA 5G1OA 1NJ1A 4A0QA 4YGYA 1S8OA 1UOOA 2Q1TA 1OH8A 4RPJA 4WINA 2ZTHA 1NVXQ 2Z2JA 4MPTA 5BNWA 3WWCA 5IC5A 1UZAA 4EYOA 3JWJA 4TKZA 3BIFA 2IHBA 2Y66A 1RTKA 2QIPA 3GNQA 2JJ1A 2O2ZA 1JP7A 3CEPB 2XEDA 3ICOA 3T52A 3EPLA 3VX3A 1T9ZA 2Q0SA 4BQSA 1XRSB 1QIFA 4G81A 1YZ3A 3C97A 3HA3A 2OZLB 1NBMD 3KSDO 5HFAA 5H59A 2O8EB 3EEQA 4TQGA 2D2FA 1P3JA 2JRLA 5ICCA 3TLJA 4TMXA 1G7CA 2HFJA 3DL2A 4G0OA 3JWIA 5KJFA 3CN9A 3WGTA 3BCUA 1F20A 3NAMA 3W6OA 4U2CA 2EP8A 4C5BA 3IX7A 1ZXXA 4X9XA 4E4RA 1ZXLA 1YB4A 3INRA 4ZI7A 3QVGA 2Y4OA 1S1MA 2BFNA 2XUIA 4W9MC 2P65A 5DVZA 5E6RA 1VA4A 3PC8A 3LOQA 2XUOA 2ZSDA 4PQGA 4F2DA 1ML4A 4MRPA 5K4GA 4IJUA 4D8XA 1WU8A 2Z6UA 2ESRA 1UQRA 1RADA 4HLUC 4F56A 1FYXA 3I8OA 5IZCA 5KVAA 3AFHA 3EXHA 1QHIA 3DFKA 1V48A 4FEYA 5GADl 3FBGA 1U0SY 1O7JA 1VHLA 3EN0A 5H9WA 3FPBA 5EUCA 1H2RS 3LP8A 3W3AH 3PTZA 3W7AA 5KYYB 5AXAA 4TXHA 3AF2A 1GN8A 4HNRA 2Q6VA 3DBHB 1U7DA 1P44A 2R79A 2ZREA 4L6IA 3W9YA 2IIQA 4CUJA 4I08A 4K9NA 4GOLD 4MGHA 4CDRA 4GYJA 1D0SA 3VR6A 1FCJA 2A3RA 1LDEA 5J2UB 4X65B 3AV0B 3ENWA 2Y71A 1Z56C 2NAFA 3NBFA 4QPNA 4F1WA 3T1HB 1DOAA 2OQRA 4LTNA 3PQVA 1D09A 1QM5A 2Q2QA 1SOWA 3RVMA 3WLJA 1U8FO 1K68A 1NR1A 3LMKA 4FXOA 4OLFA 1PRYA 4BCBA 3GRUA 1V3TA 3DAGA 4DLSA 4MMYB 1QU2A 4L0QA 4QDUA 3RTDA 1W88A 1WWKA 1F4VA 2A14A 3A31A 1QHEA 2QZSA 1KQFA 3OQBA 2BKEA 2DJIA 4G0VA 4O33A 4TPKA 4P2BA 2AUMA 3BWCA 3E7WA 3L1VA 1Y3CE 3DEKA 3R9IA 2QSUA 3NHAA 1SZDA 2IHZA 2X3YA 1XKQA 1YOVA 3O91A 4N47A 2PL1A 4BJ3A 4RORA 4YJFA 3VO9A 3TV1A 2PDAA 5ALUA 4DDMA 2X22A 3RWOA 1WTCA 3PC8C 4BWVA 5GIPE 3IOYA 2JGLA 3I1JA 4EABA 3ND5A 2YMMA 2VXBA 2DT8A 4Z5XA 1M1XB 4O4IB 3QOWA 1Q5PA 2I2AA 1G9TA 3KOWA 1FUYB 3QE0A 3U39A 2WIJA 2NO4A 2N75A 2BR4A 2X9VA 3RF6A 2IH4A 1MH1A 1IEVA 3DEZA 4CXMA 1XDZA 4I5DA 4PLHA 5B4VA 2BBSA 1NY5A 2Q62A 1TYCA 1X7YA 3H75A 4GLFA 4NU5A 1L3CA 1SVNA 2PCLA 2DR0A 3CRQA 3NC1C 3A7EA 3T7CA 2CXOA 2LWIA 5I7HA 1GTMA 2OCLA 2ORWA 3L8HA 1F8FA 4BFTA 1CF9A 3OCCA 2ZRDA 5KDDA 2D62A 4G2NA 4J7UA 3SZMA 2TMYA 1C0PA 1OJLA 1P6UA 1M6VA 3KZCA 4Y2PA 3WGQA 2FPGA 3H0WB 2H54A 2XNSA 3BM5A 3CJRA 3Q5GA 4JITA 4CKZA 4YAUA 4JC4A 4LIPD 1IL0A 1AQ6A 1OUMA 3E8MA 3EDOA 5EIWA 4Q4DA 3BE8A 2N42A 3ZS8A 5B7NA 3JRWA 4L6CA 1IXZA 1PNTA 3SFZA 3WV4A 4ZT5A 2DFVA 5LOVA 1TMOA 4R3NA 1XEFA 4BMCA 1G8YA 3QEOA 3CF4A 1RHQA 3I32A 4H4DA 3M3DA 4O4JA 2QLMA 5EGSA 3NC0C 3LBNA 1O1YA 3DBRA 3K32A 3OHPA 4O2BF 3F71A 2PZKA 4TN1A 4B48A 2R6JA 4R81A 3M9XA 4M60A 2QM0A 2CVZA 3D3WA 5AJUA 1YA8A 2GF9A 3B3JA 5HRAA 2JJ1D 1DT3A 2O7SA 3DEYX 3KQQA 1H4VB 1UBLS 4FE3A 3RS9A 1O3YA 4I1RA 3R0VA 3X43A 3WMRA 3L8GA 3Q10A 1I7NA 5TQ0B 2IBTA 4G5QA 1RKQA 1EFKA 3WLKX 3GFQA 1GU7A 2IYAA 1IG0A 4JI1B 2O0KA 2ISSD 1JEDA 1GAWA 1TJ3A 1XKTA 3NM5A 3BHNA 5ESXA 1NUTA 2HA3A 4IJ6A 4Y2JA 4QOSA 4GECA 4PF1A 1RLMA 4BFLA 3UJAA 2BEWB 4IBOA 5C7YA 1DARA 3B12A 4JXKA 2Q7DA 1RRKA 2OFXA 2Y0BA 2RHDA 3FKJA 2KB0A 3Q87B 5KMGA 3U6BA 4DLZA 4Q37A 5DNAA 4R54A 2C99A 2A5YB 5GJBA 2CVQA 2PUWA 3OVMA 3GCZA 1G291 2PRYA 3KJHA 3LCMA 2JAQA 3OWXA 2VDUE 3H3JA 4YRZA 3O8RA 4GWLA 5F21A 2ILTA 2BF7A 4PSKA 5BY2A 1PJAA 4UTVA 3LFTA 4RUKA 5EQFA 5FP0A 3RRNA 4XCVA 3K2BA 4GXRA 3TZKA 4BZPA 3OFSA 4W5QA 3OQVA 3NX4A 2HK7A 3I9FA 3R9XB 3FG9A 5DRTA 4EO9A 4UTPA 3B5JA 1NVDA 2C1ZA 3FZEA 4AYWA 2O8EA 2P41A 1W6UA 2ID7A 3EZLA 5IKEA 5A5FA 1G3UA 3FCEA 3VR6D 4OMUA 3B51X 5EJ8A 4BGEA 1MEJA 1NXQA 1JUDA 3DM9B 3O73A 3WNBA 4WVFA 4ND8B 1BHJA 2AT1A 1UPFA 4UNIA 4YP7A 3HFSA 1JB9A 4C7BA 4LZWA 4QUHA 4BP3A 4IICA 4YP6A 1JA1A 2CVHA 4DOMA 3F4LA 4F1KA 2VF5X 1PLKA 3OD5A 1AK9A 3QKWA 2YTZA 2ZUTA 2R8RA 1G3MA 5LQAA 3T1TA 2ZAIA 1DWUA 2JVIA 3GROA 4L3VA 4GRAA 4NCNA 1Q3TA 4G1BA 3ZW7A 1KMNA 3TVYA 4KU4A 2G1KA 2HA2A 5A4FS 1VI6A 1LD3A 3EH2A 4P5PA 5ADWA 1CQJB 4KMMA 4DR1B 2G08A 4DB2A 1NQOA 1JIVA 2JKZA 4X24A 1K66A 5KYYA 4W5OA 2XMSA 3KHKA 4FSDA 5FOUA 4BLQA 4OXIA 3ZD8A 4KQCA 3GDHA 2A9FA 5A02A 3DBHA 4NJMA 5JSYA 2VI5A 3CM0A 4QOIA 2RGCA 3TXYA 4IHJF 1TUEA 1JFLA 1PP4A 1CIPA 4C6RA 5J2UA 3AFNA 3ZWBA 4HTFB 4YRIA 3CRVA 2G1PA 2QW0X 3PFWO 4L15A 2XY4A 4CLXA 4GVLA 3H0EA 4H7DA 4I55F 4I9NA 1XJ0A 1P2BA 3KG2A 4MRAA 3ROFA 3U80A 3WY9A 5KKNB 3DZIA 1EJ6A 1L5SA 3DOEA 3HEMA 3MQFA 2HGZA 4FOPA 2QL5A 2IYOA 1E1NA 1G9SA 3IEVA 4NCBA 5KJ6A 4IMIB 3NHPA 1YB7A 1EUDB 1XZBA 4NZYA 2I71A 4NCJA 1OYYA 3KQSA 4JUAA 3WGYA 1U7PA 4BAGA 4UFOA 1WX1A 4DCSA 4PAMA 2GKGA 1N78A 3HZRA 3BICA 1JDBB 2V7TA 1C1YA 2R8PA 5CFMA 1CNMA 4EBFA 1LPPA 1P0FA 4H18A 3AUAA 1E3DA 1RCFA 2WUEA 2ODQA 3B36A 2BISA 3AETB 3I9JA 4JBLA 3EX7C 3IJ5A 1PI3A 4O4IA 1VLJA 4UM7A 5A0FA 3PITA 4YMWA 3R20A 2ROQA 4LBYA 4RPIA 2JJYA 4C0QC 1Z08A 1ZD1A 5I7VA 1PFYA 1XPUA 2O3UA 3HB5X 2B25A 4BU1A 2JW5A 5KEIA 1E2IA 1JDNA 2F8TA 5BN5B 1ETUA 3HVRA 1KWGA 1CVLA 2VPXA 4B3CA 5IC4A 1ZNXA 4JR0A 2YBDA 3MTJA 3T1OA 3O2JA 4F5ZA 3P5SA 2NTNA 1P60A 1T5IA 4M8NE 4MUKA 1H23A 1YR3A 3WB1A 1Z3IX 1LI5A 5DN6D 4XB2A 2FMKA 2QE7A 4QTXA 5DGDA 4NZZA 1NQXA 2C2BA 1BJKA 2NO9A 2IDKA 2ZM5A 2XT0A 1J5EB 3AVPA 2FF7A 2CVPA 2ZUCA 1E1QA 4FFVA 2PH3A 1GADO 1NX6A 1TQHA 2HQ1A 3K1JA 2IJGX 1BXZA 3Q2OA 5CVDA 5HE8A 4EB0A 1ZVVA 2YMLA 2FK7A 2EU8A 3G5LA 4JV5B 1P9NA 5P21A 4HGQA 1PX0A 1ZMBA 4R8VA 3BXGA 2C7VA 3LBAA 3PQDA 2D8AA 2X86A 3L77A 3KSMA 5TS2A 5KHAA 3E4DA 4Z51A 2XJ4A 5DCLA 3TLAA 2H7YA 1ZCFA 2H5EA 1U2EA 4RTSA 3E1SA 1ZA1A 3QSGA 1S3FA 1QQBA 4CDMA 2FLWA 4TTQA 4DR3B 3C7TA 1CULC 4RF2A 4KODA 4LYFA 3GLTA 3IAAA 1NAHA 2J09A 5CM8B 1G8MA 5HUQA 5A4IS 3T3DA 1TU3A 2F3TA 5DI3B 5JJ5A 2NPIA 3PUZA 1U31A 1XR3A 3DG9A 4FDLA 5AHXA 5TQ0A 3TIIA 2BJHA 4J1NA 2ZJ5A 2ZJ7A 3RVOA 4AS3A 4UUBA 2XT9A 1RWXA 4RJKA 2PSDA 1HTWA 2R2AA 3PCRB 3WZMA 1ZGAA 3KKEA 2CLFB 3LH5A 4KKXB 5IT9A 1BMTA 5KWEA 2BEWA 2AEMA 1FFXB 2QD4A 2O2DA 3GJZA 4QOFA 4XD2A 3D8UA 4M1QA 1NKSA 1PJLA 3FHOA 5KYVA 1YHNA 2H0AA 2MSKA 2X1MA 1GAEO 3D2LA 2WF5A 3I28A 3LX4A 4NDZA 4G23A 3PNBA 2XMCA 1U90A 2ERYA 2AMYA 1UOPA 1UBUS 1XDSA 1KJIA 3HE3A 2KM1A 1THZA 2HEGA 4MVJI 3CSUA 3DDWA 1H0SA 1T3SA 4TWAA 1BSVA 3ZDRA 5B58T 3E9MA 4MROA 4RANA 3JZFA 4OVKA 1NVKA 1Z2AA 2NP6A 2EFCB 3AB8A 4B7UA 3R9XA 4ZQCB 3O3NB 1PR1A 4DC9A 1W8IA 3SNKA 2MOKA 2GH1A 4PLTA 4MQLA 3AR7A 3Q3IA 2IEYA 2CMHA 3H9EO 1S3GA 3CNOA 1I6MA 3DE2X 3EGEA 2VZEA 2JC3A 1Q11A 7MDHA 3LVRE 3IMKA 5BT9A 1YONA 1NR5A 3HVKA 4FFBB 4LYAA 1MAHA 4QYTA 3IQZA 3GA7A 4ND8A 4W5RA 1A9XB 1CHDA 1TT7A 2F2TA 2ZRHA 4RV4A 3L7NA 3WQBA 1DMRA 3UICA 4GX2A 3NIDB 1I30A 5LYJF 4GQBA 1BCSA 2UV8A 3HDHA 3ZCTA 5HOEA 1P9RA 4DDUA 1RJWA 3OTOB 1H8EA 5BSHA 4ZKEA 4CN9A 2CSXA 2CEKA 3FRIA 1P72A 1LQTA 5KOYA 5DOZA 1CQJA 2ZYIA 1QQ7A 3LZDA 3L6EA 3IPRA 3HVJA 4MNTA 4B2PA 2CE7A 2HRDA 2QF7A 3FBWA 1I8TA 1KYQA 4IUYA 1SUSA 1FFCA 3EIOA 3SR4A 1Q0QA 4YTEA 3ZWDA 2L19A 3ONVA 4Q9DA 1R9NA 4JVNA 1QDUA 2CJFA 2WYIA 2OCYC 4FLMA 1SWWA 4JB0A 3D7MA 4TKVB 4MRMB 1RRCA 4HTFA 3QSYA 5DWDA 2PXCA 3QOXA 3H19A 4ZRDA 5ARCA 5I7FA 2C04A 3CRW1 4BO2A 5DH9A 4BQPA 4L72A 5FBQB 4C0JA 1R27A 1JHDA 3HJHA 2GTIA 2HUPA 3CY6A 4CW7A 2YMPA 3ZDXB 5KWSA 2MHCA 2CDAA 1VSQA 2WIFA 4ERNA 3UXYA 3UJ9A 1LRLA 1WPXA 3LT4A 4HWSA 4LGYA 1IUOA 2EP5A 1YBMA 2RHGB 3ORHA 1KHTA 2MMGA 2O5VA 3BFVA 2GK7A 2Z0MA 1EUDA 1DBVO 3ZDAA 2QE7D 3D3EA 1MV5A 3LX5A 4QVGA 4KQKA 3T5AA 4NZOA 1EUYA 2O0JA 1IJKA 1RIIA 2FXVA 3EZ6A 3KQPA 2ACVA 3TZQA 3U7QB 1VDMA 5JZBA 3R8XA 3QW4B 1E1QD 1FRZA 4OOEA 3RFVA 2DJ5A 3MOIA 2XJ9A 3Q7TA 4INPA 4KVFA 3JALB 3A4VA 2OWEA 3CGWA 4KC0A 5CT9A 5AI4A 1MABB 4WKPA 3O03A 2E49A 1JW9B 2Q2NA 3QY0A 2WJ3A 1GA6A 3LDAA 4OK6A 1XFDA 2D0IA 5BNFA 1UBJS 4DQ0A 1Q91A 1Z35A 3NH6A 2QP4A 1X94A 4NXNB 3A6PC 2B8TA 2AE1A 1D7OA 1J56A 5LJLA 3GGOA 3G8BA 3RASA 5BN5A 2WD8A 3ECSA 1L8AA 4HAVA 3IBCA 2Q5CA 1WCV1 1YC5A 1G16A 3M3PA 2IYUA 3OF3A 1UQTA 4E7OA 2OCIA 3N59A 1NWHA 3BRSA 4K6FA 1WCXA 3SYKA 4V0OA 4BJ5A 3LHSA 2JPDA 2NZWA 4LX0A 4QFCA 4AJEA 1GFIA 1Z62A 4XFKA 4J76A 1A77A 3UMSA 2LP4Y 4J0KA 1XRRA 4R1SA 3FBTA 3C3CA 2AFHE 3HZHA 1HLDA 1M33A 2FEPA 4FC6A 3A6LA 1JEOA 2WSBA 2C2YA 3WAGA 1RWBA 1YOBA 1FIUA 4WV3A 5JO9A 3CPSA 2BDEA 2IYLD 3OE4A 1ZA2A 5ES3A 1ZY2A 4AW9A 4MUGA 4CTNA 3WP0A 3IJPA 4BVKA 3GP3A 1JDBC 1Z7WA 1TADA 2BMAA 4M0EA 1H5NA 3VOAA 3E5MA 3L7DA 4OSEA 4R2MA 3P9KA 4PO9A 5COAA 3ZWVA 1BXGB 4WXPA 3WLOA 3ZI0A 4C29A 4CT4B 4B6EA 2KHZA 5IBCA 4G0WA 5DI3A 5E3IA 1MX3A 1G55A 1V1RB 5GMOA 4F7DA 3PGVA 4CFSA 3QKSB 1MOSA 4EFLA 5KTSA 1DC4A 4FHDA 4G6ZA 2PJZA 3EY9A 2NPFA 1Q21A 1R4ZA 4K9LA 4DUPA 4EHBA 5IN4A 1SFRA 2I4OA 1W5FA 1XRQA 4Z0HO 2WU0A 3CZMA 1Z7YA 1FFXA 1N5RA 4KITB 5KDOA 4EA8A 1Q1GA 3W2TA 2WM3A 3H9UA 4LFAB 3KAKA 1H8ED 4XWWA 2PL3A 2B3TA 3FDFA 3C45A 4AZSA 5FR2A 5JLJA 1Z63A 2VRCA 4QECA 2XNDD 4UM9D 2P62A 4KVGA 1Z06A 5JI3E 3GU3A 4KNWA 4ENUA 3K5WA 2XMQA 5C52B 5CDFA 4MIKA 3N0XA 4LVUA 4KE8A 4P80A 3NTUA 1U9IA 1UKBA 2EW2A 2XRMA 2BJWA 4LY0A 2LDBA 4AY3A 2IY7A 2IX3A 2DR3A 4HYTA 3KJGA 3HADA 5JO0A 5EZYF 3NLLA 1SM4A 1KK2A 3RE1A 2I2DA 3KAPA 1HE4A 1E9DA 2E85A 4FIDA 2W6QA 1FNBA 4QJ3A 3VR3A 4M0UA 4FFBA 5CCBA 2IUUA 3I5UA 3PRHA 1A9XA 3AT1A 2QD5A 3KPYA 3IXMA 4JGBA 4NX2A 4INOA 4OAQA 2NUBA 4DC1A 4DWVA 5KYTA 4FCVA 2GXUA 1NMYA 1DIAA 2INGX 4P7KA 4EFDA 4FPXA 1SC3A 2AXQA 3AEQB 4O0LA 1BDMA 3L0IB 5D3QA 3U09A 3WDSA 5BRNA 2E5LB 4M0PA 2K4MA 1CR6A 3QE4A 1NX9A 3HB9A 2G1AA 3OIWA 1ZOPA 3WHPA 4BECA 2X41A 3ZGYA 2O3TA 2WSIA 1QUFA 4KVZA 3EA5A 2PS0A 2V96A 521PA 1IZ8A 3GVIA 1TT5B 1V4NA 1VYTA 2IU0A 4KLNA 4KH1A 3Q7QA 1T0UA 2FH5B 4U02A 3RG2A 3HJUA 1GTL1 1KU0A 2G8NA 2O52A 3O84A 1NI4B 4ZVMA 2WJVA 3KEGA 1X9HA 3JVIA 4TRRA 1L9XA 3IR7A 4K40A 3EFEA 4TKVA 4MRMA 1DO2A 2E4AA 2GFIA 3B6ZA 3CF6R 4GMHA 5E7IA 4DPLA 4ARUA 5KX5B 3ZTYA 1A4IA 3DF9A 4U2FA 5FBZA 2QRUA 1Z26A 2OV3A 1F12A 2QGZA 1AV7A 1QGED 4II3A 1P0IA 4XGNA 2Z6AA 2X9QA 2WYVA 3HHEA 5FV7A 4E5UA 1BE8A 2Z6QA 5DGTA 1U9IC 3UB2A 3D4NA 4FZ5A 2GN4A 4XGIA 4DM4A 2BRUC 2P1ZA 4Y1GA 1WCWA 3K5PA 5D5PA 1T9GR 2LW7A 2WV9A 2XB2A 2XAUA 3TVDA 3ZWNA 3LF2A 5JASA 1A27A 3B8EA 1KARA 3E5NA 3F8TA 3LLVA 5KU7A 3U7QA 2ZTLA 1U04A 4XSHA 1E7QA 2O4CA 3WGLA 5FOSA 4YMVA 4C2AA 5IC6A 4B4KA 5BXQC 1N9GB 2PK3A 5DTQA 5C5IA 1Q17A 1S2DA 2ZDQA 1H5UA 3JALA 4IRXA 2CXHA 5FTWA 2BMDA 1ZONA 3GWZA 4BLWA 1U8YA 3LGXA 5L7TA 1MABA 3A9SA 4XVRA 2DBQA 2VJQA 3CPHA 3ZV5A 4B8WA 3C3KA 3UO8B 4UBLA 4GMFA 4LF6B 3PEEA 2D5BA 1NMZA 4GPEA 1W96A 2Y1EA 2W6ZA 2AOVA 1XAJA 4O2RA 3DEAA 3JQ8B 3WGVA 4ZCRA 2HIAA 4PFKA 4TRMA 1RKUA 3STUA 2JCXA 2ZBDA 3LW8A 2I78A 1DOZA 1RKXA 4S1WA 2HBQA 4I7EA 4XUCA 3RVQA 3SG0A 1LBTA 3Q9LA 4BS9A 4DLAA 4J49A 4GZLA 5JJCA 2XIQA 3KEQA 2W90A 4CU5A 2FW1A 1VA5A 3I9NA 3I53A 3QE3A 2N1BA 4MKGA 4M49A 1ZUIA 3UMBA 4BB6A 2DXIA 4AULA 1VJ0A 4I4TB 3LQ1A 2BDTA 1QTNA 3OZ7A 3R74A 4TM8A 3ZK8A 1OXTA 3IKLA 1LSSA 5U9CA 5JMTA 2GK3A 3DYBA 3OSUA 2BFDB 2FKAA 4RJJA 2HWWA 3P9RA 5JPDA 3Q6IA 2FF5A 4AJ4A 3SSAA 5KTTA 4UOZA 1EDZA 4XARA 1FP7A 3AVYA 1T5LA 2GF0A 1WA5A 2PBZA 4J03A 4N3AA 2B5VA 2VRCD 2ZTUA 4OSPA 5IHPA 3PEWA 2PKQO 1B8NA 3AUTA 2G5CA 1NF9A 2QL9A 3JWPA 2FFBA 1BXGA 1H6AA 3OUUA 4FONA 2C3OA 4IOLA 4KXXA 4O4LB 4TTAA 2NXWA 1C80A 4TS3A 1P19A 2VHTA 1JKMA 1PLJA 3ISJA 1VCHA 1N6RA 2OO7A 3QUCA 3CIOA 4NU0A 4KIFA 1V1RA 2Q5EA 1E7YA 2QK4A 3LX8A 1J22A 3GUVA 4DXHA 3CTPA 3QKSA 1ZUD1 2IUSA 3EF0A 4K81B 1BNCA 3RLIA 3JSXA 1A8IA 4O59O 3VR3D 4KQ1A 3TLCA 5BV0A 2VWQA 1RXIA 1I0ZA 1O95A 4P98A 3HXOA 1WHSB 2NVBA 3FB4A 4HXEB 4ATNA 1EUQA 2Z2YA 2G9ZA 4MVJM 3SYMA 3L40A 4OLBA 5B4UA 4CEJB 1VB3A 3TQSA 1USIA 2Q2VA 4DLPA 5AW7A 3OZDA 4MLDA 2GNPA 3LKBA 5ALEA 4ZU6X 1JA9A 1RKVA 2PUHA 4GI3A 4B4VA 1UFQA 2FPPB 3Q0IA 5IH7A 1MKYA 3F6CA 3H87A 3PTLA 4LQCA 2JFBA 1FRVA 3IUPA 3NIWA 4G67A 4GLJA 4QD3A 3A2MA 4ZYVA 1BE0A 5J3JA 1XYVA 3OJWA 4RVNA 2H2HA 1N32B 4BNJA 1Q19A 5KVQA 4V3BA 3RHZA 5BRAA 2BTOA 3K72B 4Q18A 1U1IA 4X3CA 1N0UA 3UCFA 2D0DA 2FUG1 3PYLA 5BR1A 4X1YB 2CDBA 2YXBA 5TMEA 1OXSC 3T15A 2HA6A 1G5FA 3Q8MA 3QH4A 1OXMA 1T8TA 2D2IA 4NS4A 3SM9A 3V1UA 4XUGB 1KSFX 4EKIA 5C46F 4G5YA 5HZKA 3IL2A 4CR8A 1RMYA 3LAWA 1QHHB 3K6RA 1OX6A 4MP3A 3VSAA 2PCJA 4CLHA 1L3IA 1VHWA 1M73E 4KGVA 4MI3A 4DIOA 1VE5A 4RBNA 3HCAA 1UBMS 4LRSB 4H7FA 3AEQA 2PH5A 1DU4A 1F14A 2I76A 3CVJA 5AKEA 1F8GA 3QPDA 1HC7A 4GC5A 2QVBA 4IOKA 4EWLA 1Y5IA 3ZHOA 1JKXA 1YR1A 1EWKA 3P0EA 2WMOB 1QHNA 2PGIA 2TMDA 4HFNA 4MHOA 3LPLA 1O95C 2FCAA 1E1CB 3NGLA