1YL5A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
b'AMARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl5A01
3WLFA 4ALMA 4MP8A 3JQGB 1E92A 4E2WA 1YQGA 2ZQZA 4R1UA 1B2LA 3ONFA 1NFQA 4IDFA 1YWGO 1QYWA 3RAJA 3VH3A 3DBRA 1XG5A 4GX1A 1R0KA 4J0FA 4NDNE 3H4VA 2NWQA 1SCUA 4FS3A 3FBGA 3AM4A 4NBUA 1EZ4A 3F3SA 4FGWA 4Z0TA 1I8TA 1HE2A 3JQCA 1Z7BA 4BNLA 3WFJA 4CLHA 1B0AA 5K9ZA 4CR7A 1BG6A 1E6WA 3WQQA 4KDEA 1X0XA 1T25A 2W2LD 2Q1WA 3O8QA 2DBVO 5C7OO 1Z73A 3ZN2A 4CMAA 3F9IA 2Q1SA 4OSPA 1DHTA 2P5YA 3DAPA 1MFZA 3G1TA 1ONOA 3PJGA 3LZ6A 3DAGA 3JCZA 2HMUA 4YT5A 5DNAA 1GV1A 1YB5A 3G49A 3QRWA 1KIFA 4N54A 3TJRA 4FSHA 3T4XA 1ZJYA 4CUKA 2NU7A 4HNHA 2UUPA 3QWHA 3E03A 3M2TA 3RUEA 2AE1A 1K6IA 1A7KA 2ZCUA 3RFXA 1RM5A 2PD3A 3WWYA 3RVDA 4BNTA 3OEWA 3QA9A 5ICSA 2FHSA 1RYEA 3AM3A 2CZCA 1M76A 4RPHA 2NU8A 1EFLA 1EQ2A 1PL7A 1BXGB 1E1MA 1KERA 4W4TA 1HDGO 4PN3A 2NSDA 3HE3A 3UF0A 1HEUA 5TJHA 2E37A 2C59A 3W4IA 1GYQA 2V6MA 3DOCA 2AE2A 3KB6A 3PHJA 4H15A 2OUIA 1BDMA 2Q4BA 4IMRA 3K96A 4JXKA 5T6BA 2P68A 4GVLA 2YUTA 3RASA 1ZEJA 3P2OA 4P4NA 5I8ZA 3K9QO 1H2BA 1JVBA 1SBYA 3DBHA 4S3MA 3AI1A 4BNNA 1XU9A 4UUOA 3ON5A 4QUKA 4DVJA 1VSUA 2VQ3A 4K6FA 4GI2A 1YL6A 4RPJA 2C2YA 4JBHA 3LF2A 4QT0A 1XWFA 4MP3A 4MVJG 5EESA 3PFWO 7ADHA 3K92A 3D4NA 3HSKA 3JD2A 3OIDA 3OQ6A 2WEKA 4QFDA 3S2EA 1VC2A 2FR8A 1V3VA 5A4DA 2BKAA 3W4JA 4BNUA 3VHRA 1TVEA 1MXHA 3ZU3A 2HJSA 4GLLA 4EUFA 1Y1PA 4WK6A 4FC6A 3BZUA 1HF3A 2AEMA 3VZPA 5BSHA 2UAGA 3GPDG 1RWBA 2W2KB 3D4PA 2EGHA 1X1EA 3ANNA 3F1LA 1C0IA 2PH3A 1A9ZA 1ONPA 3KLMX 3K2EA 2JHGA 2NTVA 1EE9A 1KETA 2ZYDA 3OETA 3WBBA 1BVRA 1UH5A 1RM3A 1L1FA 1QYCA 3PIDA 5FI3A 1DLJA 3KHUA 1V8BA 5EQDA 5ILGA 3BMCA 4JJFA 4PFJA 2I76A 4R3NA 3B70A 3DHNA 3LC7O 3GFBA 3I9MA 3IIEA 1Q0LA 4BO7A 4XYBA 2DUUA 3H5NA 2QYSA 2HMTA 2H9IA 2A92A 2G76A 3WYBA 4L4XA 1PJ2A 3RIHA 1D1SA 4L8VA 2W8ZA 1GADO 3ANLA 4G65A 1OI7A 1T4BA 5A9SA 3IJPA 1YDEA 2EERA 3VZQA 4J1NA 5TT1A 5M6DA 3NT2A 4XQEA 3FWNA 4HFNA 3C7AA 4IDBA 3WBFA 3JQ7A 3OBBA 3Q2KA 5ILOA 3GOHA 2GYYA 1RYDA 1DOHA 3E8XA 1ZXBA 2WDZA 3H7AA 5I7SA 4BVAA 4KDFA 2FPPA 4BO1A 1UP6A 4AL4A 2R00A 1GEGA 4G2NA 3ZU2A 2IODA 3ZNNA 1GAEO 1R12A 3WGZA 4OKNA 4XQGA 4N5NA 4XYGA 3UICA 2FWMX 2JD0A 2IZZA 3WLEA 1LLCA 2ZB4A 1HSOA 5DCUA 5HBRA 5G0SA 1GQYA 5JYFA 3H9EO 3JQAD 3RKRA 1I5RA 4E5PA 4NR0A 4YJGB 4OGWA 4WLFA 1E7MA 2PGDA 2NVUB 4BNKA 5AXCA 4DYVA 4R1SA 1LUAA 1NHWA 2EKPA 2O3TA 4PRLA 4IGFA 4XGKA 1LQUA 5I9LA 5JBIA 3PGJA 4EDFA 4O6VA 4RZHA 2NUAA 3KVOA 4WUVA 1D4FA 2NM0A 3QW2A 3OA0A 1GY8A 1YH3A 1PS9A 3ZWOA 1R16A 4NH4A 1U4OA 1I30A 2O3UA 1X0VA 1K6JA 1AXGA 3TNLA 4J1TA 1QYXA 4DBZA 3O26A 2D59A 1KEUA 1PJQA 4PG7A 3CUKA 3EW7A 3G17A 4MOWA 4OO3A 1M66A 2Z5LA 3RWBA 1ZNQO 1EK6A 3RUHA 1BWSA 5JXWA 1XCBA 4YJHB 3ZNQA 4YQYA 2X7HA 3OJ0A 5MGBA 3KYDA 5C7IO 3UXYA 1HXHA 2C0CA 3WMWA 5L45A 2AG8A 3B1FA 1JA9A 5TIIA 4XCVA 3KUXA 3W8DA 3ROPA 4IPTA 1VSVA 4K28A 1CJCA 1Y5RA 4E30A 2WSBA 2JFHA 4K9DA 5ER9A 3NT5A 2V6FA 4Y67A 1HWYA 4GWKA 4AJLA 5HM8A 4J49A 1SB9A 3ADPA 4TZTA 3HZZA 5CAEA 1LU9A 2VUTA 1NFRA 3AFMA 3TOZA 4Y98A 1UZNA 4R1TA 4CLDA 1UR5A 2X0IA 2WYWA 2IZ0A 1B3BA 1NQAO 4CMHA 5G2OA 3VVCA 1XHLA 3ZWBA 5FEUA 4J9VA 3H9UA 5KIAA 4CLOA 1O94A 2YV3A 1JLLA 3MOIA 2BF7A 2J5RA 4NI5A 3PJFA 2E4AA 3AK4A 4Q39A 3EVNA 1OMOA 1ENZA 1EVYA 1MC5A 3M2PA 4OM8A 2VYVA 4CV1A 2VNSA 1GUYA 2EG9A 4CLEA 3PDUA 2C54A 4XB2A 2Y0DA 2Q3EA 2RHCA 3WGOA 4ND1A 3DHYA 2GR9A 1P77A 5C5IA 2GN8A 4DIOA 1HLPA 5J9GA 1IOLA 4INAA 1XA0A 3QWBA 3RJ5A 3U4HA 4B4VA 1LC3A 3QV1A 4RL6A 4OIMA 4EUEA 1E6UA 1P1IA 2GZ1A 3D5QA 2NQ8A 4N7RA 3RSHA 5JCXA 3EAGA 1L7DA 1QLHA 4NJMB 3UAGA 3D3WB 4LVUA 3JQDA 1DO8A 5TC4A 1I3NA 3H5RA 4YPOA 3W8FA 1C14A 1J6UA 1SOVA 1AXEA 2JFFA 3ZU4A 3AU9A 1VJ1A 2X86A 3ENNA 3OJLA 3PZRA 5CG1A 2FZWA 4J2OA 4JNKA 3ZHYA 3DOJA 2QIOA 3E9NA 1KVTA 3HDHA 3IS3A 3QSGA 2Y93A 1SAYA 1ZSNA 1P9LA 4G5HA 3W1VA 1T2FA 2OL4A 4IJUA 1I33A 2FY8A 3INGA 3WS7A 4D42A 4BNIA 3JQGA 5G4KB 3DFUA 4M1QA 3Q11A 4KWIA 2VUSA 1U3TA 1E7RA 4NMHA 2C5EA 2D1YA 1H2HA 1U4SA 1C1XB 5F21A 4CLXA 5JAIA 4BNVA 4U7WA 1JDJA 1AGNA 5JYEA 5F1OA 1ZFNA 2FPGA 5ICMA 1H6CA 1B16A 2DM6A 2EGGA 3EVTA 4GKVA 5U4QA 4EI2A 2BI8A 2ZCVA 2B36A 1CQIA 3MCVA 3A4VA 4CUZA 2X0JA 4NFHA 1VPDA 3C8MA 1KVRA 1K89A 1EDZA 3IMFA 1TB4A 3PHHA 3QHAA 2RCYA 3ETDA 4Z0PA 5IDXA 1ADFA 5GZ6A 1ID1A 3UFXA 4YT2A 1QR6A 2I3AA 4ROSA 2CF6A 1U2DA 3INTA 1E3JA 4CM8B 2B0JA 2OORA 1NR1A 4TVOA 3JQBC 4M8SA 3ZWCA 1NQ5A 4ALJA 3OH8A 3JQ9C 1BW9B 3AU8A 2VTEA 4BNFA 1U3UA 4RQUA 3VOSA 1VJ0A 2JCVA 3I9NA 2PV7A 2C2XA 2VYND 2LDBA 4LK3A 3LYLA 5DN9A 4ALKA 1QV6A 2I6TA 3V8BA 1R4NA 2AQIA 3Q1LA 3GZ4A 4D41A 2DQ4A 3LT2A 1PTJA 2Q2QA 4AJHA 2PLAA 3BAZA 4L9RA 3KO8A 3OHSX 3GZNB 4W9NA 1BXGA 3FWZA 3ICPA 4AJOA 3MJTA 4DMMA 3G79A 3TZQA 4WECA 4L4RA 5T8KC 3SLGA 4CMIB 4JGBA 1IZ9A 1UDAA 4IDCA 1HDCA 2O2YA 3LT0A 3R3JA 4CMCA 4O1MA 1M75A 2ZYGA 4YCAA 3ZWWA 2WYVA 2HK8A 2YYYA 1H0KA 4W9NC 1QP8A 3ZCXA 2HU2A 2IEBA 2IRWA 4XA8A 3N58A 5IF3A 2X5OA 1Y5MA 1C1DB 3ZHZA 2EHDA 3GMSA 2HSDA 4E4YA 3GRPA 2H63A 1N9GB 4J1QA 3DMTC 4XWYA 1DIHA 3KYCB 2G0TA 2OFPA 5FI5A 2AEFA 3GY0A 2EV9A 1EFKA 1GZ4A 2ZYAA 3BA1A 3EMKA 1LDYA 2QHXA 1W8DA 1VLLA 3WDSA 1VJTA 1VL6A 1O89A 5CEJA 2I66A 4I08A 2PZLA 4ZQGA 3IKTA 2RAFA 4IDAA 1NVTA 5F3RA 4R69A 3MJVA 1QG6A 5IXYA 2VWPA 1X7GA 3E48A 4CM5A 1OOEA 1M6WA 1NAHA 1QXSA 2W2KA 3VPGA 5JSFA 1ZK2A 2D5CA 2OZPA 2HK9A 4B4WA 1ZK4A 1LI4A 4TVBA 4FFNA 3M1LA 1ML3A 1Z45A 4BOYA 3EY4A 1HRDA 4BO2A 4E2ZA 1I24A 3T7EA 3F47A 4RVHA 2EP7A 4YAJA 5BT9A 2B5WA 1PGNA 2GERA 4GGPA 3AOEA 4IJWA 1BXZA 4AJPA 2Q45A 3BTOA 4JCOA 1F17A 2AW5A 4GMGA 2YFQA 1Y8RB 3F4BA 1BGVA 5L95A 3U5TA 4S1VA 1LSUA 3CE6A 2J3HA 5DCYA 1CF2O 1JKJA 2CVZA 4D3SA 1FJHA 4GAEA 1DSSG 5T64A 1ZJZA 3VKVA 3BMOB 5GZ3A 4R41A 1ULSA 2X5JO 3GK3A 1ISJA 4MIYA 3NUGA 1CETA 2PZJA 2O7SA 3FHLA 3H3JA 5COAA 3AI3A 3DB2A 4RZIA 1NAIA 1B8VA 4FBGA 1UXHA 3KV3O 1B14A 1GCOA 1UJMA 1X14A 4J3FA 3PEFA 4OAQA 4CM4B 5L4LA 5I9NA 4PG5A 2YY7A 4OXKA 4IQ0A 3AI2A 3L6EA 4ZU3A 2J5QA 3UN1A 1ONNA 2DTEA 2X22A 3ADOA 3QWFA 2GPTA 3FF4A 1IPFA 3M6IA 4IMPA 4FJ1A 2FRDA 4GQAA 1PJTA 1PS0A 2GSDA 2H6EA 3IKVA 4MPDA 5COBA 5DZSA 4ALNA 4AJKA 4HXYA 5B4VA 4IUYA 2XPCA 4FN4A 2YHIA 1O8CA 4YJGA 1Y9EA 4R16A 4Y6PA 1UDCA 5A02A 4DTIA 1HZJA 4XRRA 4R9SA 3TDKA 4XJSA 1JN0A 2OHXA 4O5OA 4XIYA 4PIVA 3ETGA 4MVJI 1DRVA 4IJKA 4U0KA 1O6ZA 4NFSA 4W82A 3NTOA 4FFRA 4Y9DA 2DBRA 1XGKA 4CQLB 4BKQA 1MV8A 1XQ6A 2ET6A 5KWEA 3PXXA 4BO8A 4J1SA 5FYDA 2ZQYA 3S2IA 3AUTA 6LDHA 4H3VA 1KOLA 2JL1A 2NACA 4YJFB 2JCXA 4YRDA 1L7EA 2PFGA 5JC1A 2D5AA 2AQHA 3PK0A 3SLKA 1PZEA 2Q2WA 4BKPA 4F3YA 2TMDA 4CMKA 5TNXA 1DJQA 1DJNA 1GDHA 1PU2A 4PG6A 4GX0A 3EC7A 4ALIA 1F12A 3L4BC 3EHEA 2YW9A 2E48A 1P1KA 3DBLB 4AJ1A 1CWUA 4BO6A 1Q0QA 2PKQO 3DWFA 2NVBA 3ITKA 3LQFA 5EJ2A 2QRLA 3IQDB 4F6CA 2HRBA 1E6EA 1NBOA 2PZMA 1IHXA 2HUNA 3RUFA 1FDWA 2PTGA 2XXJA 4GPD1 2O2SA 4ONEA 1WAMA 4CMGA 1NVMB 1I3LA 1WDKA 3BMNB 3QVSA 3KZVA 2C7VA 3MWDB 4PLYA 5CEFA 4U6QA 5A06A 3P5SA 4Z9YA 3RU7A 2X9VA 3ABIA 4IGEA 3PGXA 5KVVA 2PA3A 1ZMTA 3O9ZA 3DL2A 4DQUA 3C1TA 2GN4A 1H94A 3WTCA 3RUCA 1EUCA 1QYDA 2VWQA 4YB8A 1DC4A 3FBTA 1IUKA 3WG9A 2VHVA 1ISMA 2VNAA 1WW8A 3PWKA 2JAHA 4Q3NA 3BTUA 3VZRA 1GYPA 2C82A 4LMPA 3CMMA 2NQTA 3GEGA 1I3KA 3DDNA 3H3FA 9LDTA 2DU8A 5JDCA 3SC4A 4NJMA 1KVUA 1UP7A 3GFGA 5CPFA 1DLIA 4UVHA 4BGVA 4MKZA 1HE4A 4XQCA 4FFLA 3JYOA 3FPCA 4ZHSA 2CDBA 4D44A 1NTOA 1NXQA 5T57A 4XDYA 4M55A 2QX7A 3K5PA 3U4IA 4MDHA 1EE2A 4I1IA 1YS4A 4YR9A 3GRKA 2D3TA 1MUUA 4HUJA 4PVCA 4P4LA 3V1YA 4CODB 1CRWG 2Y68A 3PZBA 2PKQP 2Z1MA 3CINA 2IYPA 1D1TA 2QG4A 5AYVA 4D79A 1PGOA 2PD6A 5FWNA 1ZEMA 1LJ8A 1ZMOA 3HB5X 4KOAA 4TKLA 5BNFA 2AMFA 3OSUA 4WCDA 2HDHA 3JQEA 1U7TA 5L7YA 5G4KA 2ZB8A 1O95A 5AXBA 2G1UA 3RU9A 1H93A 2O3JA 4ITUA 1ZH8A 3S2FA 1U8XX 4LCEA 2RBEA 3AY7A 1Q2XA 3VDRA 1C1XA 4A5OA 3QVTA 2BGKA 4DLLA 1ZCJA 2J5KA 3ANMA 4YQZA 1D7OA 1EUDA 5FFFA 2X5KO 3HADA 4RF3A 2YHUA 3DZFA 4NHEA 3GA0A 3UVEA 3OJOA 1JKIA 3PI7A 1E3SA 4WGGA 3RROA 1Q1NA 1AHHA 1U28A 4B7UA 4O63O 1WLYA 4ZQEA 1LNQA 3LC1O 4E5YA 3GDGA 2O50A 2QYTA 4MP6A 1B8PA 4OL9A 1RPNA 5G0UA 1EUZA 3VH2A 3NDJA 3LDHA 3V5NA 2D8AA 1I32A 3Q2IA 4DQVA 3Q3CA 4BV8A 1BW9A 3QP9A 1R37A 4II2A 4AICA 3GGGA 4II3A 1ZK0A 5H81A 3U4CA 3S8MA 4OQZA 2HMWA 3GGOA 4OOFA 2XOXA 4ZJUA 1YOVB 2C29D 2HKIA 1NM5A 3VH4A 3CMCO 4J90A 2R2GA 3CPSA 3I4FA 4DUPA 1R66A 5IDYA 3GT0A 3GF4A 3NAQA 1K5HA 2W2LA 4NIMA 4FDAA 1I10A 4LISA 4CM1A 2VRCD 4E33A 4Z9FA 1GR0A 1XKQA 5KNLA 1J0XO 3U49A 3A14A 4ID9A 4IINA 3GHHA 4HKTA 5JC8A 3VPSA 5G0WA 1NR7A 4CMIA 1EVJA 4DIBA 2BFMA 3OF2A 4P4GA 3PVZA 2JHFA 1N7HA 3ZV5A 3Q0EA 3MJSA 2ZB3A 1B3RA 1QSGA 4IIUA 5KCZA 1UXIA 3L07A 5MDHA 4BNGA 1C1DA 4M54A 1ZVMA 1YQXA 5BNTA 1NASA 3UCXA 3L6DA 4PG4A 1N9GA 1TLTA 3WSWA 4BO9A 4W6ZA 4NZ9A 3ICCA 1DC5A 2B4TO 4XJTA 1LX6A 4BNXA 1SO8A 4RGBA 4WCFB 3VTZA 3VPXA 3TFOA 3SJ7A 4A73A 4MVJM 1R6DA 1HYEA 2JD2A 2Y66A 3SEFA 3ONEA 3GN1A 1ISFA 4DIFA 2AG5A 3VZSA 4RF4A 1A72A 3I1JA 4CLRB 3HJAA 4DXHA 2EJWA 3OEYA 2OMEA 4LW8A 4U5QA 1E7SA 1XDWA 1ADGA 1CIVA 4CPDA 4YAIA 1VL8A 1T2CA 3OMLA 4BMNA 4DLBA 1ZK1A 1UAGA 5JDIA 1SC6A 3MJ4A 4TRMA 4UEJA 4RO0A 3WSVA 4RPGA 1LDBA 3UH1A 4AJEA 1TA4A 4FFPA 4W7IA 5KKAA 1ZUD1 1YDWA 1F8FA 1WDLA 3Q6IA 5IZ4A 4AJ2A 3FPLA 2GASA 2Y1CA 1NVGA 1ENPA 1UZLA 4ZD6A 3AW9A 2D0IA 3IP1A 4PCVA 5BNIA 3GNTA 3O4RA 5EQFA 1HE3A 3TZKA 1WMBA 3LT4A 1NNUA 4DRYA 3EYWA 1RJWA 2E49A 4F6LA 2VWGA 4JX8A 3JSAA 2WWRA 1JAYA 2R00C 1LDGA 4TSKA 3GPIA 4JJGA 1BMDA 5CP8A 1ZO8A 4YBZA 1DAOA 4QTZA 1P45A 2AHRA 4GGOA 3FNGA 2D4AA 2IXBA 1X13A 1E77A 2A35A 4M87A 4R4JA 4TKMA 1Y9AA 3K30A 3H2SA 4CM4A 5AVOA 1YQDA 2DFVA 5HWSA 2Z1NA 1JTVA 2CY0A 1IZ0A 5AXAA 4X54A 5BSEA 2VHXA 2FR1A 2EW2A 4IZHA 4EEXA 5JAMA 2ZTVA 1HETA 3FI9A 1I0ZA 1VKNA 3FCOA 3GVPA 4PG8A 2P4HX 1S6YA 1Q7GA 2G17A 2B83A 1LC0A 3JYQA 1MG0A 2P91A 3BHIA 2E82A 3HFGA 3PTZA 4OQYA 4ILKA 4BKOA 5KVQA 5DULA 1Q7BA 4YRBA 2O23A 3QE3A 5A03A 1DRWA 2X58A 4HWKA 1C3VA 4UULA 4FJ2A 4UREA 1N8KA 4I9HA 3E1KA 3M1AA 3SBOA 1X15A 4BGIA 1MGOA 1J49A 5H82A 3TFQA 4RQTA 3TRIA 1UP4A 2Q46A 2WD7B 4JK3A 4BGUA 4DBVO 2OBYA 4DREA 4FB5A 3TQHA 1R0SA 1U3WA 3PLRA 3FNFA 3I3OA 4Y8VA 4JLWA 2HRZA 1UXGA 3WMXA 3H6KA 2VZ9A 1NPYA 1U9JA 3QJ5A 3E9QA 1PZHA 1V3UA 3FTNA 3A28A 4ND5A 3D1LA 2FZEA 3PQEA 5L51A 3GEDA 4I5DA 5JMPA 4JN6B 2BFPA 4RPLA 1N2SA 4B3HA 1P74A 3ZW9A 3H2ZA 4NPCA 1GTMA 2XF8A 1I01A 3N7UA 3I52A 4O0LA 5JAQA 2GLXA 3GDFA 1U1IA 2ZKLA 5I8WA 2GCGA 4UVIA 1SMKA 3BIOA 3DBLA 3JD4A 3PYXA 1PZFA 4R9RA 3L0DA 3RUDA 5G4LA 3WTBA 3OP4A 1VL0A 3LC2O 3FSRA 4D0RA 1W4ZA 1Y6JA 3WNVA 1EMDA 4QEDA 4LCJA 5CG2A 1I2CA 2X8LA 1DHRA 4GH5A 4NG5A 3C1OA 2EJVA 2YJZA 4R5MA 3BMNA 1NWHA 4NNJA 3O03A 3DZGA 3BTSA 4WASA 1GZ6A 1PZGA 4JROA 2GUGA 1XSEA 1C0KA 4YTEA 3IUPA 4KTVE 4ESOA 1WNTA 1R15A 1PL8A 3JQ8B 4LGVA 1PQWA 4MVJH 2UYYA 4JBGA 5K6AA 4GL4A 2HCTA 2GDZA 2YV2A 3ZI0A 4Q9NA 3GUCA 4IIVA 4N5LA 1P33A 4RDIA 4JP3A 4I5EA 1P0FA 3BHMA 2CFCA 3ZWPA 1VRWA 4PLZA 4MKXA 4NU5A 2NU9A 3DZKA 1JVSA 3D64A 3H8VA 4CQMD 5A5FA 4RF5A 3GLQA 4JBIA 3DBRB 1ZXLA 4RORA 3W4KA 1E3LA 1OC4A 2QW8A 5ENDA 3I9KA 4PZCA 1AHIA 3H9GA 5TLSA 4YVFA 3EDMA 4CM9A 1IULA 2DTXA 3WGHA 4B8WA 1DAPA 3R1IA 3RC1A 2BI7A 4UVGA 1ADBA 2IEDA 2CVOA 1QV7A 1B8UA 4NFYA 1ISGA 1WMAA 4AG3A 3KOUA 4B8ZA 3HFSA 2G5CA 5I9MA 3RC9A 1DEHA 4EJ6A 4TMFA 4ZRNA 4BS9A 1YL7A 3OQ1A 1YONA 4FQ8A 2Y67A 1LLDA 2PNFA 5DF1A 4HADA 3F6YA 2WD8A 5DBIA 3NYWA 1PR9A 1XEAA 2ZJ1A 4R68A 2DTDA 1OFGA 4DPMA 1Q7CA 4J4HA 3JTMA 3GG9A 3QVWA 3DHEA 4LSWA 2VUUA 4M86A 1GPDG 5LC1A 2J3JA 3UUWA 2I65A 4BNHA 4J7UA 4E2XA 4KTTE 1A4IA 4U6SA 2FMUA 4YA6A 2RHRA 4FCCA 5IG2A 4J9UE 4J7XA 2JFGA 1A9YA 1MP0A 1P1HA 4HNGA 2PGLA 4QQRA 4WKGA 2GF2A 2B37A 3LT1A 4CV3A 2WYUA 1MB4A 1DDOA 2OGUA 2RIRA 5AQ1A 5A3JA 3ASVA 1K3TA 3NDRA 2DVMA 5IN5A 3RBZA 3NTQA 1Y8QB 4J4BA 3F4LA 5TF4A 4XZ3A 1FDTA 4OJNA 8LDHA 4U0JA 3COSA 2HLPA 3QVOA 3C24A 4ND3A 4B7XA 4EYEA 4RPKA 3B1JA 4GWGA 3DBVO 4CV0A 2HK7A 1NQTA 4Q3DA 1YRLA 1BRMA 2J3IA 3PQFA 5K0ZA 5L40A 3G0OA 1E0DA 1HKUA 3LF1A 4D3FA 1MX3A 1FDUA 2I9PA 4YAKA 3DBHB 4UVDA 4CMEA 4E6PA 4BO0A 3EGOA 5EPOA 1JU9A 1YJQA 3PFFA 5A3VA 5B4UA 1FDVA 3NT4A 3BXXA 5CPBA 1YOVA 4ZGWA 4JIGA 2O3QA 4FFOA 5G0VA 1WVGA 4R3WA 1MG5A 4RJTA 4CJXA 2BELA 5CHEA 4E32A 4XYEA 1KBZA 3ITDA 4Z6KA 4QSMA 1PJCA 4J6FA 4QO8A 1XQ1A 4BGEA 1E3EA 4BO4A 5KTKA 1LSSA 1WWKA 1YO6A 1MC4A 1IE3A 3VTFA 1HSZA 3RC7A 4LSMA 1SZJG 1HDXA 1I2BA 1O5IA 3NEPX 4TRNA 5B4TA 4J4TA 1E7QA 3CXRA 3X2FA 1MFPA 1WDMA 1ZW1A 2X6TA 3A9WA 3KM0A 4ALLA 5JYDA 3GVCA 4H7PA 2EKQA 1XR3A 4BNJA 3JYNA 4Y6RA 3W6ZA 4A10A 2EEZA 2X9NA 3AUUA 5JY1A 2VYNA 2Q22A 5JY6A 1GL3A 2ZK7A 3S55A 4CM3A 1ZIDA 2QZZA 1OAAA 3MOGA 2Q50A 4OMUA 2AQKA 4WCFA 3WX0A 2Y1FA 2PK3A 4FFMA 4TZKA 3AY6A 4URFA 3RFVA 3FRJA 2DPHA 3ZWAA 1PIWA 3PJDA 5DOVA 1Z75A 6ADHA 5L53A 4WLVA 2BD0A 2VHWA 1LEHA 3WGTA 4KUGA 3U09A 1VM6A 4EEZA 5F1KA 2POQX 2JD1A 4CLRA 3E6AA 3T4EA 1D8AA 1AE1A 3AOEC 1JW9B 1T26A 3WJ7A 3QY9A 3KETA 2YZ7A 4QFCA 4WEQA 1GU7A 3WXBA 3GR6A 2X4GA 4CM7A 1A5ZA 3RUIA 4IDEA 3JQFA 4ZVVA 3ZGYA 2YV1A 5F1PA 4YDRA 4DPKA 5TS3A 4IY1A 1HZZA 1PGJA 3MEQA 5KJFA 3IDSA 1U5AA 1ZBQA 2E6UX 3UCFA 2AEJA 5B12A 2RH4A 4UVEA 3JQFC 4XR9A 4DMLA 4L74A 1LDEA 2Y0CA 4NQZA 5HRUA 1A71A 2EP5A 5L3ZA 1ISHA 1HL3A 4J91A 1QRRA 1NPTO 3K73O 1PS8A 1DIGA 4CMJA 1IHYA 3ZV6A 1PX0A 2DLDA 1T4DA 5HTOA 3PPIA 5KKCA 4KUEA 2UV8A 2NVUA 4XX0A 3LSYA 2GO1A 1GQ2A 1BVUA 3RCBA 3DFZA 3IUSA 3HQ4O 3TZHA 3RBXA 5JO0A 2Y99A 4XGIA 4BQPA 4PLVA 3GAFA 5JCJA 5IAAA 4YRAA 1NYTA 4B79A 1NFFA 5TQVA 3OIFA 4PVDA 1Z6ZA 4DYDA 2Q4EA 4D46A 1E1NA 4DPLA 4WEOA 4PLWA 4J2HA 4EGFA 1C0PA 3VPFA 3AFNA 5JPIA 1LRKA 4QX6A 4OH1A 4KZPA 1BSVA 4YJHA 4WLNA 1G6KA 1HE5A 3PJEA 3NJ4A 4E13A 3JYPA 3JQAB 2CDAA 5DDIP 5AOVA 5KJ1A 3DZHA 3HDQA 3JV7A 5THKA 9LDBA 3H5AA 1X7DA 4XEHA 3K6JA 2WMDA 4B3JA 2A9FA 1KVQA 1DRUA 1WXDA 2IYOA 2BGLA 4CR6A 1V6AA 1PR3A 4WOJA 3JQ6A 3I4CA 3L9WA 1PSDA 4CLOB 3GEMA 5CDGA 5TX7A 1HDRA 1YKFA 2O4CA 2FR0A 4HY3A 3RD5A 2B4QA 4BIIA 3DEYX 4R5HA 3GG2A 1A4UA 1YBAA 2HO5A 3D5TA 1HYHA 2YFHA 4BO3A 4UUPA 4J16A 1H5QA 1UZMA 2GN9A 3TL2A 4BNWA 1R0LA 3E82A 1KYQA 3CSDA 3N74A 4ZQBA 3SXPA 3ZU5A 3B1KA 5ADHA 4NBWA 2NTJA 3DZBA 3AUSA 4L0QA 2ZB7A 2CSUA 3HDJA 3FR8A 3B6ZA 5COQA 4LVCA 4CMBA 5EINA 4FJ0A 1LSOA 4MO2A 2Y1GA 1RM4A 3DO5A 3KRTA 2X0RA 2DPGA 4WNCA 4NK4A 4XYMA 3WWZA 4K26A 4GSLA 5IZCA 3KSDO 2FOIA 4Z0HO 4JJIA 4BHTA 4DQXA 4E5NA 3ZWMA 2DKNA 3GN2A 4MVJA 4I5GA 3P7MA 1P44A 4PLGA 5KJEA 2B4RO 2A94A 1HDOA 1PJ4A 4RLSA 1W6UA 3RI3A 3D3WA 4DC1A 4E5KA 2DFDA 5B37A 3DAFA 4GBJA 1LSJA 4FW8A 5L7TA 1YBVA 3WOHA 4O59O 1DBVO 3S1LA 1XYGA 3CH6A 5A04A 3JQ8A 5JDCC 1N1GA 3C7CB 1XU7A 4EZBA 1PWZA 3C85A 2UVDA 4A2CA 3OQBA 1F8GA 1KVSA 4KQXA 3E18A 4PGFA 3UKOA 4GSKA 1EVIA 1YB1A 2VOJA 1Y7TA 3NX4A 4XIJA 4DLAA 3T7CA 1ULUA 3FR7A 3KXDA 3GVIA 4DL9A 1MLDA 3V2GA 3STHA 4XRGA 4IS3A 5G0TA 1B26A 1E1LA 3PHLA 4P38A 3GC6A 3MZ0A 3AM5A 4F45A 2I67A 4B7CA 3CZMA 1NPDA 2VHYA 5DCWA 1P0CA 3G1UA 3R6DA 4OXYA 4GMFA 3NDIA 3E5MA 1QORA 4OYRA 4ZQFA 3H9JA 4DWVA 3D3EA 4J0EA 5CDYA 4KWHA 2HQ1A 4D45A 1TEHA 4TQGA 2LDXA 2JKVA 4EITA 3KEOA 2J8ZA 2AQ8A 2IZ1A 1T24A 4CL3A 3PIIA 3TN7A 2X23A 2Y1EA 5BQFA 4MJLA 4D0SA 2ZTMA 3LLSA 1EQUA 4CQMB 2JJYA 4IBOA 2C07A 4H16A 3DMYA 3CTMA 5IDWA 1SOWA 2FN7A 3EZYA 4TRRA 2F00A 3TSCA 3DTTA 3KYBA 4L76A 4UAGA 4ZRMA 4PLHA 3WYCA 3WB9A 4AJIA 4CM8A 1IPEA 4XYLA 4PZEA 3OICA 4NJOA 4RVSA 4ZICA 1ENYA 1R4NB 2FP4A 2OBNA 5L4NA 1DFIA 1Y81A 2YQ4A 1C0LA 3DZJA 1BHSA 3EK2A 1HYGA 2QRJA 3WIDA 4UEKA 4KQWA 1FXSA 2BHLA 4CV2A 1GCUA 1T2DA 4BKUA 5JO9A 1KY4A 4JP2A 4AFNA 4RVDA 1R4MB 1Y8QA 2ZTLA 1U2GA 3FD8A 5KVCA 4HP8A 5ER6A 3TPCA 3WGYA 3ZHXA 1TXGA 1ORRA 5JE8A 1KY5A 4CL8A 4J43A 3GZNA 1HDZA 1P1FA 1E3WB 2H5LA 3HN7A 4M89A 4CUJA 3R3SA 1YVEI 1GPJA 2CUKA 3R0IA 3U4DA 3W8EA 1E7WA 3ZV3A 3CKYA 5THQA 3AWDA 3TWOA 2P9CA 3CZRA 5A9TA 5JFOA 5HS4A 1M67A 1ZSYA 4Z9XA 1DB3A 2WM3A 1H9BA 3V2HA 3FN4A 1TT5B 1FK8A 2OXIA 5LDHA 2Y0EA 3KYCA 4HBGA 3FNEA 3SC6A 1SPXA 4RCVA 4IJVA 1BDBA 3HUDA 4GVXA 4N18A 1KEPA 5ENVA 4OOEA 4PZDA 3QQPA 1IYZA 5L9AA 4RV9A 1CERA 1W0CA 2NTNA 3GVHA 3ZNOA 1SEVA 3IJRA 1I36A 1U7HA 4BNMA 3F46A 5C3MA 3DONA 3GVXA 2NV6A 3INRA 4GX2A 1H6AA 3RJ9A 1AUPA 1KEVA 5CEEA 2VRBA 4HFRA 3HG7A 1XLTA 4MIOA 2V6BA 2P4QA 2OP1A 1GYRA 3GUYA 3I9LA 5TJ9A 2Y1DA 3BYZA 2X0NA 1MA0A 5I7EA 5JNLA 1IB6A 3I9OA 3BTVA 2BGMA 2VZ8A 4DA9A 4B4UA 3B20A 3V1UA 1ZKMA 3WQSB 2OOSA 2VRCA 5JDIC 3PYMA 4B3IA 5A1TA 4IZIA 1Y8RA 3KLPX 3NGLA 4NBVA 1I3MA 3WQRA 3V2UA 4A7PA 1G0NA 2O4UX 4BKRA 1YGYA 2DUWA 4EUHA 1W73A 5CFZA 3BMOA 1CQJA 2CMDA 3UGKA 5A05A 1HDYA 1DIBA 4K1LA 4YYZA 4EJMA 2OP0A 3ZHBA 3MWEB 4FOSA 5JW6A 1JWBB 4IXWA 4YT8A 4QECA 5IXSA 2CF5A 2NU6A 4LRTB 1IL0A 1E3IA 5JAZA 1T1SA 2PZKA 4WLEA 2VTDA 4A0SA 1ZSVA 1N1EA 1P3DA 2XAAA 1I2ZA 4WJZA 1UDBA 3D4OA 2YHIB 1OZAA 2PD4A 4ND2A 3WJAA 4FIZA 1JQBA 2CD9A 4Z3KA 5L7WA 5JS6A 1CDOA 3LU1A 3V1TC 3Q9UA 2VYVD 1JKFA 1T2AA 2PWZA 2D2IA 1M6HA 4U8GA 3VC7A 4IQGA 4A26A 5BSFA 3GNSA 1F14A 3MJEA 3ONDA 3QIVA 3DTYA 3RQSA 4BNYA 2P2SA 1KC3A 1RM0A 5TGDA 3ZWNA 4BL5A 3BMQB 4IXTA 3NKLA 3IC5A 1ZK3A 2VCYA 4WLUA 1CYDA 3UOGA 4CQLA 2HJRA 3PP8A 4LMRA 3UW3A 5T5QA 4BB5A 1LRLA 3PYLA 3HN2A 3WGIA 3TZ6A 4EW6A 3GDOA 2GZ3A 4IQ8A 1FF9A 2HMVA 4YJFA 1F06A 2NVWA 1DXYA 1LLUA 4EBFA 3JQAA 1XELA 3OM9A 4P8RA 2HMSA 4I9NA 2R6JA 1PGQA 4KMSA 3K8ZA 4UEOA 3C3XA 1PJLA 4GLOA 5DBFA 5CDTA 2WJPA 3PWZA 5ITWA 4OSOA 3ETEA 2O48X 2NNLD 3H65A 2BH9A 2WTBA 1PL6A 2VT3A 3GAZA 4BUCA 4D43A 3IAHA 5IN4A 3A1NA 1S7CA 4YAEA 3ZNPA 1Z7EA 2FSVA 4Y6SA 3I9JA 4XB1A 1E5QA 1D3AA 3TL3A 4W7HA 3BHJA 1G1AA 5KJ6A 3HWRA 4CM9D 2OO5A 1EEHA 3P19A 3PDJA 5TSDA 2VZ0A 3CIFA 1NQOA 1G0OA 1YJ8A 4PLFA 2ZATA 5ES3A 3C1AA 3Q9NA 1GV0A 4YACA 3VPHA 4NBTA 7MDHA 1LRJA 1SNYA 5TRTA 1N92A 2B69A 1JAXA 2C20A 5F5NA 3C7DB 2O3SA 4PRKA 3NV9A 4K6CA 5HS6A 4UUNA 2UDPA 1PJBA 3I83A 3OA2A 1YXMA 3JD0A 4MKRA 5KOIA 3WGQA 2J6IA 1V9LA 4PLPA 3ZZNA 1HLDA 2DBQA 2I99A 4C7KA 5I7VA 1XIVA 5DP2A 3ENKA 3AOGA 3NRCA 3WFIA 1PWXA 1FDSA 4L73A 1YL5A 1NWCA 5IDQA 3KSZO 4MIEA 3ZDFA 5K6AC 2BMAA 2FPIA 1YBMA 2WE7A 1EBUA 5DOZA 3LLVA 3WYEA 2AXQA 1EK5A 4PLCA 3OJEA 5U9CA 4FD3A 2Q99A 1LBEA 4EJ0A 2FSSA 1V35A 4QXMA 2DAPA 2Y1OA 4TRJA 5BR7A 1LLQA 1N7GA 3SVTA 1PEDA 4E21A 2EIHA 8ADHA 4LRSB 3WIEA 5EIOA 4GKBA 1BTOA 3OIGA 3ZWVA 4CR8A 2EW8A 3O8QB 4D7AA 3E5RA 5A5EA 4XQ9A 1V0JA 1O9BA 3NGXA 2PH5A 1SEPA 4Q3EA 4R51A 2W4QA 3DXFA 5C7LO 2H1SA 4BMSA 1ZZEA 2W90A 2Y05A 4ZN6A 2P5UA 2VT2A 4A27A 1H9AA 3ULKA 4Z3DA 1LTHR 4FC7A 4R01A 5EMHA 3WGGA 3EZLA 4YEDA 5CDSA 4HFMA 1MXFA 4D3DA 2DBZA 2GZ2A 2VWHA 5ITVA 1PQPA 4FOOA 3FNHA 4P22A 4I8XA 3GGPA 4IS2A 2GNAA 2EKLA 3JQBA 2Q1TA 1UAYA 3JQ9A 1VI2A 2NLOA 5J23A 4MVJP 2X9GA 1H6DA 3ROMA 3PHGA 2TMGA 1NHGA 4CQMA 2QRKA 2V65A 1GUZA 2IE0A 2YQ5A 3DOOA 1VKOA 2I5PO 1K6XA 2V7PA 4RDHA 3MJCA 4CM6A 1P1JA 5LCXA 1X1TA 4N5MA 3ASUA 1E7YA 3H9QA 4E12A 1OC2A 2GN6A 4WOKA 3A06A 3DQPA 5KVSA 3OECA 4C4OA 4YAGA 3S2GA 4Q3AA 4R54A 2YDYA 4XKJA 5T8KA 1DPGA 2GD1O 4HX5A 4R1NA 3O38A 4DGSA 1YB4A 1QYVA 3GHYA 3P2YA 1ISIA 2RH8A 1R4MA 2CDCA 4CMEC 1ENOA 4ND4A 1PJSA 4YJDA 3I6IA 1VE9A 4PLTA 4OKIA 2X1HA 1ADCA 4TWRA 2JAPA 4AJJA 2QZ9A 2BLLA 3JD3A 3KSUA 3DMTA 2PY6A 1LA2A 1E3WA 1KEWA 5KJCA 1QMGA 1GQQA 2Q1UA 3X2EA 5LDGA 3F1KA 5U1PA 4C7JA 4MVJF 3WR5A 2DC1A 1DFGA 1NX6A 2HAEA 4NU6A 5L4SA 1Z74A 1AN9A 3I5MA 3RUAA 1JWAB 1K2WA 3UCEA 3WNQA 3RC2A 2JCYA 5JMWA 1B7GO 1TT5A 4RVFA 2A4KA 3WICA 5HA5A 4WLOA 3BMCB 4NBRA 5I7FA 4ZA2A 4A03A 3DZIA 2VOEA 4JQCA 4GX5A 4E0BA 5GZ1A 4OXNA 3F5SA 3UHAA 4I9UA 4I5FA 4WE3A 4XGNA 4L4SA 2GRAA 1M2WA 3ZWYA 3L4SO 4IM7A 1DIAA 3TF5A 2IDZA 3ROQA 4WCFC 5A9SB 3RBVA 1YE3A 3JQ7B 5EERA 2EF1A 2AA3A 5A9RA 1NP3A 2CVQA 4XR4A 1WP4A 1T2EA 5JCJD 3JYLA 1H6BA 3TZCA 2ZTUA 3PWSA 1V3TA 3EUWA 3QWAA 1U8FO 3L6OO 4KUHA 1A7AA 1UUFA 1X7HA 1O0SA 1HT0A 3LK7A 2WE8A 1A27A 2W98A 4AJNA 2PGJA 4LN1A 4UUMA 3ST7A 2CNBA 4E3ZA 3HHPA 3VDQA 3D7LA 3PQDA 3MTJA 3AJRA 4YWJA 3E9MA 4AVYA 4BNZA 3QLJA 4RF2A 1U5CA 5EL0A 1K0UA 2PR2A 2Q49A 4BO5A 3K2BA 4ZQHA 4XD2A 3KEQA 3HB4X 2NADA 3U9LA 3HDYA 1GZ3A 4RVUA 1UXKA 1WZIA 1U3VA 3GQVA 3VH1A 1TI7A 1WPQA 5IJZA 3U3XA 3HNPA 1PJ3A 3JD1A 2XXBA 5DP1A 5C37A 3IP3A 1QLJA 1GD1O 3ROKA 3DR3A 1J5PA 1EBFA 4Q3CA 3ORFA 4NK5A 5B1YA 2GGSA 1KC1A 2I3GA 3KBOA 3GNQA 4QO7A 3KYDB 4RVGA 1LXCA 3TOXA 1DFHA 2C5AA 4RLHA 4B4OA 3L77A 3VAZA 2P9EA 4J7CA 3PHIA 1GFSA 3L9XA 1ARZA 1IY8A 1HTBA 3FTPA 3IOYA 4BB6A 4TROA 2O7QA 3CEAA 4MVJE 1SB8A 4E31A 4M49A 3U62A 3BMQA 2UUOA 3RFTA 2Z95A 2C7GA 5JYAA 4F46A 5AXDA 2G82A 1N5DA 2DT5A 2WD7A 4G81A 1DC3A 3QVXA 4MVJD 1GEEA 3IL2A 4HFJA 4AJ4A 5GMOA 1RKXA 1B15A 4KP7A 1EVZA 1P31A 3K31A 3KTDA 1F0YA 2EWMA 4IDDA 4YT4A 1T1RA 1FMCA 2IXAA 2O3RA 1WZEA 2BFOA 5T73A 2BFAA 3L4BA 3AUAA 1TT7A 2J3KA 1DC6A 1BXKA 3DC2A 4BQRA 5H83A 1J4AA 3G3EA 4BV9A 4HV4A 5EN4A 3GH3A 5BSGA 4MINA 5FF9A 4WPGA 4XDZA 4IDGA 1LDMA 5DT9A 4DC0A 5F5LA 2YDXA 5JLAA 4E2YA 2VN8A 1E1KA 3SX2A 4BMVA 3GMDA 4L75A 1Z82A 1Q0HA 2ZIZA 2ZJ0A 2EXXA 3I6QA 4FPXA 3NTRA 1KS9A 3F5QA 1P1RA 3AY3A 3OFSA 2QQ5A 4YXFA 3PRJA 4FR5A 2F1KA 1EDOA 3ZW8A 1DIRA 4W99A 3SJUA 3VVBA 2B35A 3ZWXA 2V6GA 1E5LA 5DBGA 1PGPA 2SCUA 2ILTA 3QWIA 5T67A 1LQTA 3OJFA 5IZCC 3NJ8A 3I23A 5CDUA 4OHUA 4FGSA 2VHZA 2B5VA 2PKRA 3LVFO 3RKUA 5TT0A 1OBFO 2BRUA 3U0BA 3W6UA 5IFLA 1GUFA 5GY7A 3MTGA 3ZV4A 3VKUA 1UXJA 1PQUA 4WNIA 3PLNA 3ZH2A 1LDNA 3D0OA 1QKIA 4Q3BA 2P9GA 1CEQA 2Q2VA 4E5MA
chains in the Genus database with same CATH superfamily
1M7GA 3WLFA 4MP8A 1VRCA 3L05A 2ZWVA 1FFCA 2A1TR 1K68A 1SURA 4DLWA 4H1WA 2ZQZA 4PPQA 4ZDIA 1B2LA 1V41E 5TY0A 3B6MA 5CCEA 4QEZA 4KO1S 4JL6A 1Z0DA 4LF6B 3CJRA 1QYWA 3B3QA 3PXEA 4GX1A 2G5TA 4AWXA 1J0EA 4YWHA 2GPSA 3H4VA 4ODIA 4KCGA 4OEHA 2AEEA 4CETA 4ARZB 1W4LA 5CX1A 3AR6A 1KTVA 4GR5A 1HA3A 3STUA 3TEMA 2PBRA 1L4GA 2BFEB 1I8TA 3WRVA 4JOQA 2XMZA 3M3PA 5FBRB 3LX8A 3WP0A 2PUWA 1A1VA 3LDUA 5K9ZA 3RG2A 4KQ9A 3UK6A 1FFAA 3WQQA 4MPTA 4Z7NB 3JQRA 1MO5A 2Q1WA 3BFPA 2MINA 2DBVO 5C7OO 1Z73A 1R6BX 3G9XA 4OSPA 1DHTA 5FEUA 1NG9A 2PYIA 4UTOA 1CUFA 2LKCA 3ZWDA 2ZXFA 2D1SA 2C5SA 3JCZA 2JF0A 3R0VA 1S2DA 2I22A 2OCKA 3B1WA 3G6KA 4YT5A 3VO1A 3HVRA 1ZCAA 2ZJAA 3GCDA 4DV6B 2ECKA 2ZJBA 2C92A 3G49A 2HA3A 3LDGA 5LL6P 1NRIA 1DARA 3OEHA 1WS6A 1X42A 3R4CA 4G0PA 1BVYF 2JC3A 2P6NA 2CNOA 2N1MA 2NU7A 3N7AA 5KTPA 3RT7A 3SSNA 4IUBS 3QF7A 3E03A 4L6AA 3NTVA 1Y4UA 1K6IA 5DI3A 3RFXA 4F12A 4Y2XA 3WWYA 1OA1A 1O6GA 1DAMA 1CTQA 2YIVX 3VUFA 2FHSA 3QX7A 1RYEA 1WKVA 4GUAA 5EXTA 1VYVA 4WKPA 2H1CA 1Z0FA 3DMGA 4R84A 1G8AA 2NU8A 3IYLW 3TMKA 1MJNA 1L7XA 5F9MA 4EUNA 1H22A 2O2DA 5AOCA 3UMSA 3KAJA 1FDOA 5A0FA 4BX0A 1HDGO 2X2FA 3TQSA 2CK3D 2FEXA 5TJHA 3JATA 2E37A 1YSCA 2E87A 3TD2A 1C4KA 4HXGA 1MJHA 3AUJB 2HIHA 1YZLA 2V6MA 3PDIA 2AE2A 4IOLA 3VSDA 1UIMA 3GIDA 1ZW6A 1FQKA 5T6BA 2P6UA 3PWTA 4M53A 4P0TA 1DV1A 1DBWA 4J6EA 4HL6A 1V5GA 1K7FB 4W8OA 3AP1A 5I8ZA 1XCLA 2OILA 1MD9A 5JNTA 3TRKA 3O8BA 3AI1A 4BNNA 1XU9A 5IKOA 2C3YA 2ZIAA 2AH5A 3LBHA 1GM5A 4NVRA 1VSUA 3PEVA 4CDGA 3GFPA 5EKDA 2ONCA 1V1RB 3GPBA 4EZEA 4QT0A 2ZUCA 2V7XA 4WZAE 5DGCA 5EESA 3PFWO 1FA9A 3D4NA 2NSYA 3EXHB 3M5CA 2H5EA 3HSKA 3JD2A 4REQB 1K1EA 2O8CB 1A9RA 1BMQA 3DOUA 4BNUA 3W2EA 4C01A 2O8EB 4W5NA 1UCFA 3EGXA 3PFNA 1S2GA 2JIMA 3LP8A 4I2VA 4K7JA 3ZU3A 2HJSA 1X77A 4GLLA 1Y1PA 2ODBA 2DE0X 4MQFB 4EUFA 4Z4CA 2QX6A 4EG8A 5JXJA 3MMZA 1S96A 1QRTA 2AEMA 3VZPA 2AOVA 2UAGA 4W5OA 3GPDG 2JFXA 2W2KB 4G26A 3D4PA 4IRXA 4PAGA 1X1EA 2FX3A 2VJBA 2BY4A 3KSMA 3F1LA 3NH9A 2ZT5A 3NXKA 5HQJA 2WOOA 3K2EA 1YR9A 1ATIA 2BMDA 2JHGA 2NTVA 4IIFA 1EE9A 4MRSA 5J40A 3EDOA 5EC8A 4TYQA 3X0DA 4YV7A 2PX4A 1SPBS 3PD0A 1AGYA 1BVRA 4LRXA 3MWJA 5JQWA 1RM3A 1L1FA 1QYCA 1NLFA 3AZQA 4I9FA 2QMQA 4R40A 2AYXA 5FR1A 2NPFA 2JLWA 4AY2A 3PCXA 3GLHB 5EQDA 2BMJA 3BMCA 3LQKA 3JAWA 1P9RA 2I76A 4KIWA 3IIEA 4ZCQA 3LC7O 2WLSA 3I9MA 1SXHA 2VHUA 4XYBA 2GPAA 2W93A 2GBIA 3NW9A 4ZU1X 2Q7XA 1EFAA 1M0SA 1WF3A 2H9IA 5JJLA 1E66A 5EVCA 3WYBA 3VI3B 5KKNB 1D1SA 3R8FA 1GADO 2ONYA 1Q20A 3PXGA 4DRXA 3AF0A 1YDEA 5K3DA 1P0PA 3TIIA 3EGDA 3T95A 3V4PB 3K35A 3KBBA 4XQEA 4QHTA 5ELMA 3FWNA 3NXSA 4IDBA 4R1MA 4H1TA 4KZKA 1PJZA 3GOHA 2WUDA 2GYYA 1JHZA 1QVAA 1DOHA 2YHBA 1SUPA 1E2KA 4GXRA 3UHFA 4GFDA 1VP9A 4CQJA 4M46A 4H0NA 4TLLB 3ND9A 5CR9A 2JAXA 4DJAA 2I7VA 4LQLA 3I5XA 4R6XA 4M1ZA 2QRHA 1YA8A 4G2NA 2IODA 3ZU2A 4TYWA 1R12A 2CMGA 3WGZA 3OFVA 1NXOA 4XQGA 4XYGA 3BK2A 1XTIA 1GT6A 1Z0KA 3UICA 2AB0A 4AM8A 1E2HA 3JPYA 2JD0A 5A0VA 2FWAA 2Q3BA 1E1QA 2XYHA 4YP0A 5DCUA 2HBRA 5G0SA 5TPZD 1Q7TA 4DDMA 1GQYA 3PUYA 4BVBA 5JYFA 1FYVA 3QXCA 2IEGA 1QF6A 3RKRA 5KTSA 4NR0A 1GCGA 4WLFA 4BNKA 5CRIA 2ZUDA 3KZXA 3N07A 4L5JA 1LUAA 1NHWA 2EKPA 4GPZA 2WTXA 5E6SB 3U3ZA 1LQUA 2VUIB 2HPVA 3PGJA 1XPUA 5TPWB 4TQUS 3CRVA 3HGQA 3P9YA 1GY8A 3OA0A 2A8YA 3MPUA 1V2GA 3G8DA 3U4AA 5INTA 4MW0A 4QOFA 2PMKA 2ZRNA 1I30A 2MTBA 2O0KA 3NGMA 1JHDA 1XZHA 1X0VA 2XNCA 2NZXA 4DBZA 3HTXA 1OGJA 2M2IA 2ZWOA 2G09A 2YWFA 1OZGA 3CF6R 3CUKA 4MOWA 1Z37A 2ANCA 3NNNA 3ZE2B 1EK6A 2O14A 3RUHA 1BWSA 5JXWA 1SJ9A 2CDNA 2FEAA 3K0AB 3LJKA 1JDBB 3IXQA 2GCEA 3TTYA 1KFBB 2P90A 4JSYA 3ZNQA 2ES4A 1M0EA 1U1EA 2VTBB 2H2IA 5C7IO 2H06A 2R44A 4UARA 4PQYA 2F1OA 4BFVA 5IKMA 3ZGOA 1Z2CA 3AHEA 5TIIA 3DZ6B 1KE1A 3KUXA 2C9BA 1MJGA 5JZ9A 1JQ5A 2DSNA 2NW6A 2QLTA 1Y48E 3BKWA 1VSVA 1L7OA 3IO5A 4IPTA 2FG7C 4K28A 5FA6A 4RCYA 1GZVA 3C5HA 3IE2A 3T3PB 2CXRA 3EEBA 4BFUA 4C3UA 3FFBA 3FVRA 1E58A 4F91B 2Z8YM 5LU8A 1Z0ZA 2B1RA 2GCOB 3HGTA 1T4CB 3WK8A 4H7DA 2PBLA 1WXHA 3FJ1A 5BNWA 2Y4OA 4OB7A 1ZIPA 4RS4A 2A5YB 4IUDS 5BQ3A 2VYQA 3AFMA 1RC1A 4B46A 5AD1A 4Y98A 1UZNA 4I3GA 5CT4A 5ULLA 4CLDA 1UWCA 5LJLA 1ZR2A 3ZBTA 1QP4A 1S9DA 4UBMA 5JRZA 3O83A 2DP4E 3BGWA 3TL6A 1LLFA 2GKSA 2HWXA 3JWIA 1ECFA 3WLMA 4KIJA 3H9UA 5B30A 4EYOA 3WO0A 4CLOA 4EZIA 1O94A 3ZGXA 2BF7A 4N4AA 3WAJA 2DH5A 4ZOQI 3AINA 1EXMA 3KOYA 3SOZA 1THMA 5FJIA 3I3SR 3EVNA 1X9GA 2P2ZA 2EBFX 2P67A 3N0TA 3PHBE 4B76A 1HX7A 1G42A 1ENZA 2XE4A 3QKWA 2WUEA 4ACAA 4CBVA 1EVYA 1MC5A 1QGZA 2VEOA 3EF1A 2ALJA 2Q0HA 5FADA 3V1LA 4CV1A 3R7BA 1T9BA 5DASA 1RXIA 1RTKA 2BBWA 4RAOA 3TQRA 2EG9A 4CLEA 1XZKA 1WJGA 1AC5A 3PDUA 2BGNA 4XB2A 4QJBA 4PYQA 5EPEA 1VHTA 2EU8A 4K6KA 4RELA 1JNXX 2OHHA 2Z56A 3WGOA 3VISA 1OBHA 4ZYTA 1A9XA 4L9WA 4QUHA 3BERA 2JEYA 1ZN7A 2YMQA 2GR9A 1P77A 4CQNA 2F8SA 2QUZA 3KSBC 4ECEA 3IEVA 1T8YA 1E1CA 2GARA 4C0BA 3VV3A 5J9GA 1IOLA 1DEXA 4KE9A 2XNSA 4INAA 1JHRA 3ZY6A 4JKOA 2OHOA 1YUMA 3QPBA 4J76A 3PPVA 3QWBA 1QMHA 4PEVA 5TR9A 1UBHS 1GUDA 1W29A 3L8HA 3TM4A 2YUIA 2GSWA 4EUEA 3ETJA 3HXMA 1SVNA 4Q03A 4QPPA 3EMVA 1F9EA 3EAGA 5D2CA 1QLHA 2Z2XA 3RSHA 2QXUA 3D3WB 1QWOA 3D7KA 4LVUA 1P2TA 3UJAA 2IBSA 3SHOA 1VGRA 4XASA 1RQLA 5CVUA 2QSZA 1C14A 3V46A 1LQ2A 1QBGA 4MPJA 3JQGB 2GZAA 3K1YA 4O2RA 3KQPA 3WOVA 3PQ7A 1H0SA 2JFFA 3AHFA 2IP4A 4GBGA 2AMVA 2FG6C 1PR0A 3ICVA 4G4SO 3RTDA 2O2ZA 1XKXA 3ENNA 3P9NA 4FDMA 3T52A 2FZWA 5CG1A 4J0DA 3ZDEA 3BWBA 5FPQA 4BZWA 1V8ZA 3GLVA 1ZSNA 2G8LA 3N8HA 2INGX 4YMWA 3K05A 4G5HA 4MSUA 3LXMA 2PVSA 1I2MA 2OL4A 2QDXA 2W2MA 4IJUA 1FS5A 4X7PA 4RJJA 5CW2A 5DHQA 4D42A 4BNIA 3FGOA 2EX0A 1Y34E 3L0SA 3ZHQA 2XVZA 3P2JA 3NBUA 4XXHA 4KWIA 4L9AA 1XTTA 5E2IA 5CVEA 2C88A 1QGOA 5SZKB 1S02A 1U4SA 4MV8A 1THTA 2Q0SA 1WBBA 2O0HA 3BXZA 4TPKA 2OQIA 1COZA 4U7WA 1AGNA 2JJ1D 2I1WA 1VJDA 5LSAA 1GG8A 3KU1A 1ZFNA 2EFGA 1FMLA 2CLCX 2UVQA 4QLBA 1UPTA 2XXAB 4AURA 2BFEA 1B16A 1CRQA 4K6MA 3UOWA 1RC0A 4U00A 5A3RA 4H3HB 2B36A 5EHZA 2RJOA 1G8MA 2R11A 4IV5A 1VIVA 3B1YA 4ICIA 4NDZA 2R87A 1U2EA 3LHKA 4FFDA 3C45A 5EZ6B 4FN5A 2WWHA 4NFHA 4Y3UA 5CDHA 1X3SA 1M5UA 5MFZA 3HXLA 3OWXA 3QHAA 5IDXA 1IJFA 4EGAA 3B1XA 3I76A 4NTZA 4EHDA 2EFYA 2Q5OA 3ABRB 1STOA 3G5AA 2I3AA 1IMJA 1HL7A 3A4LA 1DX9A 1IY2A 4ROSA 2CF6A 2ZR0A 1IC6A 4LYDA 2B0JA 2XUDA 1NR1A 2CHFA 4IXNA 2X0FA 2O59A 3DFKA 4TVOA 4RTKA 4ALJA 4RQAA 4WL0A 1F0NA 3VRHA 3NS7A 4TKZA 1RS0A 3I9FA 2PMFA 1U3UA 3IR6A 2GYWA 1MHMB 2FW8A 3H8JA 2QZSA 3JVIA 4DLNA 3UJ8A 5J4HA 4D1YA 4I1OA 2LDBA 3VPAA 2HO4A 5DN9A 1MZPA 2VA8A 5C9ZA 1CZNA 2FFAA 1R4NA 2I6TA 1DG9A 3CX8A 4E5DA 5DHUA 3Q1LA 3OD1A 1PFQA 3AR2A 1H1LA 2PSJA 2C58A 3EVZA 3GZ4A 1DXQA 4MUMA 2A2ZA 4R3UC 5BSVA 2B99A 3G2QA 2ZBFA 4MVCA 3OPVA 3NRJA 2P2DA 1LVGA 1PTJA 4URVR 2QN1A 2W37A 1E62A 3BAZA 3GZNB 4W9NA 4DMMA 1FRNA 3G79A 4RVOA 4FMBB 3CVJA 3SLGA 1X8KA 3AR9A 4ZI7F 3WLQA 4NE2A 2B21A 2QSUA 1IZ9A 1VYTA 1ISSA 1UEXC 1YI8A 2O2YA 2Q1XA 3K0BA 3LT0A 3QJYA 3R3JA 4EG7A 4O1MA 2G1KA 1JFVA 1FFXA 1OWPA 2ZYGA 1X9IA 2HRRA 3RVSA 4TWBA 2CXSA 2HK8A 4P4SB 2IGTA 1BGWA 4NDAA 1XZMA 3ZCVA 3WKAA 2X5OA 2IYFA 4ZMBA 2ZIFA 2QTTA 3PHCA 2HSDA 2JGFA 1T9ZA 1H0HA 3OC0A 1N9GB 1VGQA 4J1QA 3V97A 4N3NA 4C0QC 2BV3A 1T9KA 1DIHA 2J3MA 2XHEA 2YVLA 3W3AH 3KB8A 2ADMA 3KHKA 3PQCA 3EPKA 2VPIA 5ICEA 4IJQA 5E8JA 1NV9A 3FPEA 2F8MA 3EMKA 1GZ4A 3BA1A 4ZGGA 1LDYA 3L04A 4FGZA 5CJ2A 2ZRDA 4E1BA 2QHXA 3OEED 3EXHA 1CY8A 1VJTA 3RSZA 4REQA 1FNNA 1DE0A 4GDMA 5CVJA 2I66A 1SIUA 3QYFA 1TTTA 4II7A 3Q15C 1W46A 3LCCA 1SVIA 3ICEA 4IDAA 3UGQA 3MD9A 3R9KA 3HZOA 3ZK9A 5ARBA 5L8VA 4HZUB 2H4ZA 3PV0A 1D7AA 2XCLA 4R69A 5F3RA 1KZ1A 2QLFA 4LC0A 3LWNA 4MEAA 4CM5A 1VLMA 4FDUA 1NAHA 3IOEA 2CUNA 2RHJA 2W2KA 1NZDA 3NPAA 4DCGA 3PKZA 5JSFA 2OPHA 3T15A 2OZPA 4FHEA 4Z4HA 4FOPA 3AG5A 4B4WA 1LI4A 2YVQA 4YRSA 4OHBA 4HDOB 4LXYA 4MXDA 4BO2A 1D03A 3T7EA 4LHZA 4RVHA 2EP7A 4YAJA 2PZ8A 3IP5A 4ZTUB 4Y2UA 4JT9A 2GERA 1W0JD 3NNDA 2HREA 3B3GA 4XW2A 1AKEA 1CZLA 4AJPA 1N5OX 2AVNA 3CX6A 4FFBB 4G67A 4JCOA 1XTSA 3VNQA 1ZIOA 2YFQA 3U5TA 2DLNA 5L95A 1BGVA 1TMGE 4C2AA 5LYJF 1LSUA 3OPXA 3GFFA 2XKAA 2ETVA 1CY2A 1I13A 2YWRA 4MKFA 4WUTA 3MGCA 2YWEA 3PC6A 5DCYA 5DNWA 1JKJA 2CVZA 3V34A 3WGUA 5JXGA 3BT7A 3K09A 3G0BA 4UM7A 3BMOB 3EUEA 5E9WA 1KJJA 4W8HA 3I6ZA 3LQRA 4UU7A 2ORED 5HIJA 5TQ2B 2PH1A 3EPLA 1Q0ZA 4Z7QB 3KQHA 3DNFA 2AFHB 2WG0A 3E7XA 3LY5A 1LVHA 1KAGA 1UJMA 3KV3O 1B14A 1IHPA 3CF4G 1ZHOA 3PEFA 4CFYA 3U40A 3WLLA 2DR0A 3RSCA 2YY7A 3WLKX 1D2AA 4RTJA 3N3BC 1HNZB 1QG4A 3AI2A 2C4WA 4FHZA 2AJCA 3L7CA 1SU7A 2VF8A 1ONNA 2DTEA 3M49A 1P75A 2X22A 3ADOA 3NHZA 4BLVA 4UM8B 3D31A 1IPFA 1FRQA 3M6IA 4IMPA 4FJ1A 1GFWA 1BE1A 1EB9A 4ALNA 4AJKA 5EEHA 1XROA 4LZWA 4DZRA 1JBEA 1G5TA 1O8CA 1QK3A 4TXNA 2QNIA 3PNSA 1NZFA 5E6SA 5ANRB 3PTLA 4Y6PA 1UDCA 2C99A 3C6BA 3H8SA 4IRMA 1KMHA 2V7GA 5TPWA 3GMTA 2RE8A 1VLZA 1GPYA 1QOPB 2OHXA 4KE6A 4PIVA 2LPMA 1PD0A 4X92A 3WMFA 4C04A 1DRVA 2H7CA 4IJKA 3LY7A 4U0KA 2YV5A 2BFFA 1BOOA 4W82A 1XAGA 3ET4A 4QL3A 4KO4S 1N8NA 1JZQA 1VSTA 3QUQA 2ET6A 4G0NA 4KXNA 1Q15A 4OYLA 4MR7B 1RJDA 4TX1A 4LYGA 3ONVA 5JPDA 3A3OA 4Q15A 4JAVC 3FJOA 3O2NA 2C04A 3VO8A 3K1ZA 2VTBA 3IWCB 4UMFA 1KOLA 2IOFA 4JYBA 2AUTA 4YRDA 4UD6A 1TQHA 2J67A 2ZJ4A 5JC1A 2R8RA 5SZIA 2I8CA 1JG2A 1PZEA 1BS9A 2Q2WA 1SHJA 1NOIA 2XUHA 4F3YA 2Q5HA 3P94A 4BKPA 4G0VA 5T4FA 3PFIA 5LDDC 1SU8A 4Y2QA 5D7NA 5SYMA 3W05A 1Z6AA 3DP9A 4MW4A 1GDHA 3ZS8A 3PQVA 5LB4A 3O1JC 3FX2A 2F55A 2GCOA 1T4CA 2X4DA 4MCHA 3BVPA 5LR6A 2P6RA 3ZUGA 2MYPA 1TO2E 2W6JA 4F8EA 1YS2X 3G0DA 3GU3A 5FOVA 3CB4A 2PKQO 3ITKA 1T3ZA 3LQFA 1XNJA 3PEEA 4JLUA 4Q34A 5EHQA 4J3JA 4F6CA 1LNSA 2PZMA 1NBOA 4PTZA 1IHXA 3IHKA 2HUNA 4JL8A 1KR2A 3M83A 3VKHA 1ZOOA 1O7JA 2ZULA 4R1LA 3X1XA 1A7UA 1FDWA 5FOTA 5SY4A 4AMVA 4LZAA 4JC0A 1NJ8A 3UJBA 1Q22A 4E70A 3BMNB 4MV4A 1Y9JA 2PL1A 2WHQA 1BU5A 3KZVA 5BT8A 2C7VA 2XUIA 3MWDB 4KJZA 1JR6A 3T34A 2IQIA 5K45A 5FOWA 3RU7A 5FBHA 3ABIA 2PRYA 4G07A 4AB1A 2DQSA 2PA3A 2RHHA 3O9ZA 3KP1A 5AK3A 4X3OA 1NF2A 4TGLA 2OSBA 1D4ZA 4CIWA 4FCVA 2E5WA 2X3UA 3R2JA 5CFOA 3I32A 1QYDA 5BYAA 3MLBA 3GRUA 5JXIA 2YFYA 2CNNA 2G1AA 1DC4A 1PUXA 3FBTA 1IUKA 3K6RA 4QGHA 1JFRA 2VSFA 4QOEA 1ORTA 3WG9A 2ZSHA 4KQIA 4C6RA 4EOGA 3VBEA 1Y98A 3OQJA 1RXUA 3VZRA 2C82A 1JG6A 2IOFK 3GEGA 2ZYTX 2OAP1 3DDNA 2J3LA 3H3FA 9LDTA 5JDCA 1EESA 3SC4A 3FRIA 1KVUA 3O2JA 1DLIA 2C83A 1PN3A 4UVHA 4ZAYA 3SZOA 1V8DA 4MKZA 3IIJA 4XQCA 1SXJB 3FPCA 5CYOA 2CDBA 4DMFA 4BLSA 5T57A 1M8GA 1TKCA 2CXNA 3Q7SA 4G41A 1YCHA 3BJMA 2QTFA 3K5PA 1JSRA 4GRDA 4XDYA 1A8QA 2IHBA 2OOKA 4MV0A 5CT9A 1UK9A 1YS4A 1UBSB 2ZIUB 2C00A 3MF4A 4KQEA 3GRKA 4PINA 3SXUB 3WV5A 4G24A 1Q21A 3V3KA 4C20A 1MUUA 2WTMA 3DT9A 3EIEA 4MAFA 2AJDA 4R8RA 2X8BA 2NUTA 4QZVA 3CC8A 1CRWG 1W85B 2Y68A 4FYWA 3PZBA 1XNRB 2IYPA 2Q6KA 1D1TA 1U0OC 3DSRA 1PGOA 5JI2E 5EFZA 1ZMOA 4HEA6 5L3SB 4DIDA 3PA6A 5D6OA 6AT1A 1UBCA 3FCCA 1QCYA 5K0FA 4WCDA 3PFBA 2IDJA 1C3JA 2R47A 2Z2KA 2JH8A 4MWZA 4O4IF 5L7YA 1O95A 2PS3A 4EJ2A 4OJTA 1Z9BA 5AJYA 3WWOA 1H93A 4L6IA 4G1UC 4DEXA 2FDRA 2FSHA 1Q2XA 2JS7A 3QEJA 4HDQB 2VC2B 3W6NA 4ZJYA 1HFEL 4A5OA 2NIPA 3GGCA 2GYUA 3M6MD 1XQWA 1ZCJA 5FBLB 3OOJA 3VC2A 2MU1A 4YQZA 2XXAA 1TOAA 5C8DA 1AMOA 1CUVA 1M33A 5FFFA 4Z86A 4KXQA 2WUFA 2QL7A 2X5KO 3HADA 1ULTA 2CHVA 3IURA 3PXUA 1P60A 1Z68A 1LZLA 1DJOA 3DZFA 4IWNA 4JYMA 3GA0A 4DLYA 5AVZA 3UVEA 2Q6TA 2WJJA 3OJOA 1U31A 3PI7A 1QZUA 3QBEA 4QFBA 5KMGB 1LNZA 1Q1NA 2WWVD 4I8IA 1OXMA 2GHIA 4O63O 1RPAA 4A91A 3O90A 4RTQA 1WLYA 4HPWA 4X41A 4CIVA 3IMCA 3Q8KA 4E5YA 1B00A 4CKWB 3ZZ0A 3L7BA 3TOVA 4DNXA 1DJMA 1M0WA 2VDNB 3EC1A 1QIEA 1I7QB 3V5NA 1GLGA 1I4DD 4PYIA 1F3OA 1G4UR 4GICA 1SVOA 4QHYA 3FHTA 3Q98A 4BV8A 3C3AA 3OKAA 3WRYC 2VI5A 1RHKA 1VGVA 2OCAA 3SFVA 3TV1A 2P9TA 3MXTA 1ZK0A 5H81A 1H2YA 4YECA 4MB6A 3I5UA 3KCQA 2H7VA 4OOFA 1J21A 4FZ3A 4XTCS 5I7WA 2B1JA 3LXRA 5CFZA 5F12A 1YOVB 1EFVB 1WW3A 1NM5A 2HWYA 2IXEA 3JASB 4NF2A 4RIHA 5BV2P 3IJ5A 2OHFA 4EB3A 5KTYA 1F51E 2R2GA 3CPSA 3EWAA 3HA3A 4DY4A 3HYRA 3QVUA 4RNCA 1KJNA 3DM9B 2EOAA 4NIMA 1I10A 2AOUA 5H4HA 3PNVA 3HYSA 3NYIA 4MA0A 4Z9FA 5J5VA 4MWTA 4BQEA 5LQRA 1UEJA 5KNLA 4ZVLA 4YI5A 2AG6A 3U49A 4OJYA 3V3TA 1EIWA 1U9ZA 1W49A 4XLLA 4HKTA 1KI8A 1DP4A 1NUSA 2QE7A 1NR7A 3G8BA 1P73A 5G0WA 1EVJA 1W36C 2XNJA 4DIBA 2XUFA 3FMIA 3MTAA 2J07A 1FSZA 1Z5OA 4P4GA 2FWPA 2JHFA 1G291 1ZMXA 4Z7OB 5A7FA 4KR3A 1ZLXA 1A9OA 3QUAA 2H8KA 1FDRA 1IAQA 1UPAA 2KI5A 3ACDA 1QSGA 1JALA 3GZTB 4IIUA 4P4SA 3L07A 4FHGA 3T3MB 4K0KB 4MW2A 2WWIA 4OUKX 1H2ZA 3N5KA 4DJ5X 2NT3A 4US1R 1T5HX 1X8XA 1A8HA 2OLKA 3OPQA 1YQXA 5FTNA 1NDHA 1H2RS 3L6DA 1N9GA 1W59A 3LXXA 2DXIA 1TLTA 4CEHA 4MVWA 3R24A 1P4JA 4BO9A 1KI6A 2IF2A 1OWMA 1DC5A 4V0RA 4EPXA 1DQRA 1A2OA 4IVNA 3RSOA 3VPXA 1INLA 2ZRBA 4UU8A 1R6DA 4Z53A 2Y66A 2QPLA 4MB0A 3I9V1 2IYNA 1EFRA 1WEKA 3IT1A 3RSSA 5F2KA 1ISFA 4BMDA 4YDQA 5K3AA 5BRNA 2HXSA 1Q12A 4YLEA 2NPIA 5CM9C 1QQTA 1MTOA 3AGPA 4JLMA 3WHIA 1TZ2A 3OX1A 1HFJA 4ZEXA 1RXEA 5AKJA 5BQ5A 4DQ0A 3MB8A 1Z8FA 2XSZA 4GQIA 4HZUA 1WHTB 2BMVA 4DXHA 4RVCA 4QUGA 3NALA 3FUCA 1WUYA 4CPDA 1O57A 1V7QA 1T2CA 1VL8A 2O52A 2ZJ8A 1ORHA 2FK8A 1XTJA 5FBWB 4R81A 3ZCRA 2FQYA 4LDZA 3KOOA 2FU5C 3D1JA 1G60A 4NYIQ 1Q6YA 4AJEA 4W7IA 3ZGLA 1XT6A 4X45A 2FDCA 1P2FA 2PLRA 1YDWA 2JFUA 1WDLA 4QQKA 5A1JA 5EJ7A 5CNJA 4L51A 2H1RA 2VR1A 2C7PA 4OQ4A 2WYHA 3CX4A 4FFBA 1CEEA 1VE3A 2D0IA 1LF0A 3IP1A 1SQFA 4MTCA 5BNIA 3I37X 1JFSA 1GXSB 2BTOA 2H59A 3TZKA 1GZSA 1WMBA 3LT4A 5FT9A 3TQTA 5CFLA 3TNDA 2IW1A 4IKEA 2AXPA 3RIYA 1VCNA 3MJHA 9ABPA 1MC8A 1UANA 2VWGA 4JX8A 9ATCA 1DKLA 3JSAA 1E59A 1U2RA 4W5JA 1JAYA 1YT5A 1OW3B 1P18A 5JATA 4FS8A 3KJGA 5GIOE 1K6EA 3VJRA 4Z0NA 5LYYA 4XX0B 5KTOA 4HEQA 2G08A 2FSGA 3KKOA 3NJRA 4Y7DA 5TQ2A 7ABPA 1KP3A 1P45A 3NATA 4GGOA 1ULHA 5EXDA 2DHCA 3FNGA 2D4AA 5DWDA 4A1FA 5J4VA 1X13A 3D7MA 2AFHA 1MOZA 2W6MA 1NXTA 5SV2A 4PGAA 3P9XA 3V8RA 3K30A 4B44A 3ZDAA 3H2SA 1NVWQ 4PYOA 1BRTA 5AVOA 4XSVA 1YQDA 1C41A 4ZREA 3EHDA 4TLBA 1JTVA 2CY0A 3C4JA 3SR3A 4KAXA 4Q3OA 4DZTA 2A84A 2BM0A 2R4QA 2KWIA 2F1IA 3P9IA 3WA7A 4GC9A 4ZP1A 3NORA 1KARA 3MSCA 4GZLA 4DMCA 4EEXA 1BROA 3DB1A 3L8DA 2DRIA 3RVMA 4BP3A 2ZBGA 3EUAA 5JAMA 4LJ8A 3ZDDA 2CVHA 3STYA 4WY5A 3ACCA 3ERCA 2X2EA 1Q7GA 1N33B 2G17A 2B83A 4J1TC 2DB3A 1XE3A 5FI1B 4NAHA 2E82A 1Z12A 3L1HA 5TARA 5LQJA 4OQYA 1ZIXA 3RRNA 1E2IA 1DKPA 1Z3CA 3ZE0B 2E4YA 3EQ2A 3ZWQA 2Q4RA 4BRWA 2O23A 1SUSA 3DCJA 3B6IA 4GF5A 4LDPA 3HEBA 4HWKA 1C3VA 3PFCA 1EXWA 1D6MA 2VXYA 1EI9A 2VP0A 1NE7A 1N8KA 1M1XB 3P4UA 4XDGA 1XXLA 3DKPA 4WH0A 4NCXA 4MKHA 5E2AA 1X15A 2R4TA 5H82A 3WL8A 4BGIA 1IB0A 1M6VA 1EWKA 1TK9A 1PVOA 1AUOA 1DPFA 2Q46A 2XYGA 3TQHA 4BVFA 1RLJA 2BZSA 2PUFA 3W9UA 2X6RA 1MF7A 3FXAA 3ZD8A 3WMXA 3MCZA 1QHYA 3JXEA 2Z5VA 2EWWA 2ZVJA 3ZDCA 3REQA 4F3TA 2A9JA 1TRHA 1Z4OA 3KG2A 3R7AA 3QJ5A 1PZHA 1A98A 1V3UA 2GOYA 2ZETA 4TMZA 2B82A 4OP3A 4B2IA 2CYAA 4N48A 1IOZA 3GEDA 5JMPA 3AB8A 2FUEA 1SUFA 2BFPA 3LM8A 4JB3A 5EIXA 4B3HA 1YMVA 1QH1A 1LJUA 2WR8A 4RKRA 1FVOA 3U4MA 1XF1A 3SZUA 3H2ZA 5B3JA 1GZHB 1GTMA 3VKFA 3T0FA 1Z2OX 4O0LA 2I6GA 2GD6A 3L93A 5IYZF 4DILA 3GDFA 2P3QA 2GCGA 4V0LA 4HS9A 4DMKA 1JT2A 1W5TA 3L0DA 2XTAA 2B2CA 5G4LA 1W2GA 3RU2A 3FSRA 2G6TA 1YRQA 2JIZA 3NHRA 4NSNA 3WNVA 4D0RA 1T34A 3O4FA 4M1MA 1R0RE 3EP6B 4CCSA 2ZIEA 3N1UA 4QEDA 2WZDA 5JHGB 4LCJA 2NVOA 5DRTA 5HR5A 5JPCA 3WMGA 3OZUA 4OXQA 5FKJA 1Z18A 3R5HA 3C1OA 1L1QA 3NAGA 1SCKA 4R5MA 5AUNB 3BMNA 3KVNA 3TJZA 3O03A 1L8LA 2FYTA 2G67A 3MWDA 4GEGA 4OKSA 5HPYB 1GZ6A 3B52X 1XSEA 2YYZA 4B73A 4HT3B 1IRXA 3NIBA 4MGYR 3JQ8B 4LGVA 1PQWA 1YUBA 4JBGA 1TYZA 1QNLA 2N46A 2Z4TA 1XDDA 5K6AA 1W7AA 2EEPA 2YV2A 1E0KA 1Y6FA 2UXCB 4CG1A 3ZJUA 4RANA 1JS1X 1P33A 1UDWA 2I6SA 4RDIA 3QVJA 4G8DA 5FPPA 4A3SA 3PR2B 2H51A 5M5BA 3ZWPA 4LOJA 1OBOA 4PLZA 4MKXA 3MCWA 5GJVC 1D2NA 1P4GA 5IBQA 4JLBA 2B6HA 3CWZA 4F5ZA 3H8VA 4EHNA 3GCWA 1UZAA 4RF5A 3GLQA 5DTJA 5AMXA 4RORA 3RVNA 3W4KA 3JARB 2GWHA 4NY1A 1OC4A 2BFDA 4DCMA 4BQFA 2G80A 4K86A 5ENDA 4PZCA 5I47A 2DEUA 3H9GA 4TMWA 3VSCA 5KI6A 1QFXA 3QJGA 2R6R1 1JJAA 2BKUA 4B8WA 1JSCA 2JANA 1SXJA 3SSAA 4ZMRA 2WIGA 1ADBA 4K40A 5ADVA 4A8JC 1QV7A 4NFYA 1B8UA 1Z6XA 1OD6A 1WMAA 2F67A 4AG3A 1ZVQA 3DF7A 4B8ZA 2HQSA 5A3QA 5I9MA 1SXGA 3USES 2XR1A 3HWSA 3L4EA 4EJ6A 5K05A 2QU7A 1W85A 5AKZA 4BS9A 2EJBA 2BKLA 1ZD1A 4PGHA 1NG1A 3IPCA 1LLDA 1TADA 5L3SA 1GL7A 3F6YA 3KQVA 4F0JA 1UKZA 5FD8A 3OTOB 3KFXA 4I5IA 3NYWA 1QO0A 1YC2A 5BOSA 1XEAA 2ZJ1A 1O2DA 4R68A 4LDAA 4DPMA 1Q7CA 2AR0A 5IKPA 4CCWA 2C98A 2QD3A 3G23A 1E6KA 2W6ZA 3HACA 4M86A 2JPDA 5J4LA 1GPDG 5LC1A 3UUWA 2I65A 3KV1A 3H1AA 4J7UA 4WIAA 4XD7A 2QMEA 4KTTE 3ZWKA 2ZE7A 4U6SA 1RRMA 1W4AA 4QDJA 4YA6A 2RHRA 1EBBA 1HNXB 1DG1G 2E21A 2PPVA 4WKGA 2YHSA 2IUUA 1U2DC 4MWDA 4CG2A 5CFMA 1DAIA 1DDOA 2OGUA 1KWKA 5IVKA 1BZYA 5IN5A 2DVMA 2W2QA 4F4IA 1TF7A 1N4AA 3NTQA 2X7XA 5I6DA 5KMGA 1SKMA 5AW3A 3CNHA 3I42A 4Q9HA 2OYRA 1UYJA 4MB2A 2ETXA 3B82A 2HLPA 2XNDD 3QVOA 2FW9A 3R20A 4ND3A 4MS1B 4CKWA 3FMFA 4JD5A 4GWGA 1KJ8A 1TZCA 1YR8A 5EJIA 2HK7A 2WW8A 3PQFA 3T5GA 4EX7A 4FT2A 1HYBA 1RI5A 5L40A 2O7VA 3ABZA 3EYAA 3G0OA 3WNCA 4BJ6A 5I01A 1XVTA 4IG4A 4MRVA 3ZBQA 3PEUA 3I04M 4D3FA 5IASA 1LPSA 2VPPA 3C5CA 1Q0SA 3OQPA 3AQIA 4JBLA 1ACMA 2FMXA 3FDXA 4GXQA 4HN4B 1IXSB 4KQGA 1NKSA 3TMAA 2GJ4A 1YZNA 1DUSA 2PT5A 3EGOA 1FDIA 4DV3B 2WHEA 1DO2A 3BXXA 4H1UA 5CPBA 1YOVA 1EFVA 3JASA 5SICE 1SU6A 3G7UA 3THSA 3X43A 1UKEA 3UMMA 5KTRA 4RA9B 1EXNA 4Q1DA 5G0VA 2OVFA 1MG5A 1JAZA 1Z7GA 2WWGA 3HCPA 2BELA 4FMCF 4YBRA 4FONA 4N7JA 5CHEA 4XYEA 2IE8A 4H1VA 4RNDB 3FAKA 1CYEA 1C7EA 2XKBA 4Z6KA 4FZRA 4J6FA 1U94A 4IEFB 4QLAA 1OKKA 4IHKA 4KRGA 5KTKA 3Q7RA 3PFHA 1HK7A 1HSZA 2JGNA 1Z08A 3RF7A 4AMYA 5B4TA 4ITVA 1R6UA 3MQ4A 2I62A 4J4TA 2CL5A 4GR9A 3RUPA 4AS2A 5HKKA 2ZB2A 3QM1A 4K8RB 5EYPB 1E7QA 3AP3A 1QG2A 1MFPA 4JGGA 3UV6A 1VE7A 2Q1YA 2PQMA 4FCTA 4FHCA 3TQOA 3GVCA 4H7PA 2ZRLA 3DBIA 2BUAA 2L42A 3EUFA 2EEZA 2J4CA 2HBYA 3AUUA 3DDZX 5JSZB 1RWMA 1Y9ZA 4JC5A 4EI7A 1N6OA 3MCTA 5KEIA 4OLAA 4DABA 3ESZA 1TL7C 3HBFA 3MILA 4UD2A 4OP2A 3URMA 2VHCA 2WQZA 2IY7A 2Y1FA 4MRAA 2PK3A 1BCSB 1UKYA 4HYTA 3TLAA 4TZKA 2X3YA 4URFA 3RFVA 1IATA 2JH9A 2IPAB 3OVMA 2GT1A 2XVAA 4ND8B 1ODJA 2DPHA 1PIWA 3ZWAA 2ORWA 5DOVA 4BP9A 2X41A 1Z75A 3GLIB 1LD3A 3CRRA 4F85A 6ADHA 5EIFA 4UZSA 3L0PA 5AW5A 2VHWA 3BCSA 4KUGA 4HRXA 1X1BA 4PBTA 2POQX 3A9TA 3OMWA 3CIOA 3T4EA 1D8AA 1JW9B 1WHTA 3O8OB 1UQTA 3R44A 3QY9A 1K2VN 2DQZA 4L3OA 2C94A 1U7XA 4RXMA 4WXEA 4RK0A 2R8OA 3KETA 1SCIA 3CSUA 3OCJA 2IUSA 1SZDA 3MLEA 1A5ZA 2XWSA 5BW5A 5JD4A 2YZ2A 1U0SY 5JSYA 3ZQJA 5C53B 2DT8A 2R6AA 4LOKA 2QTHA 2VL7A 3FE2A 4ZVVA 1GSHA 1YQEA 5AVYA 2O0LA 4Q1BA 3H04A 1JHXA 2P27A 1N2CE 2P9JA 4U2KA 1U5AA 1XMSA 1Z13A 1ZBQA 2EX1A 4KQKA 1W1WA 2P5SA 4XSHA 4DCNA 4IVQA 4OGFA 2LNDA 1RYBA 1Z26A 2VDOB 4UVEA 4JEHA 2KS6A 3EIOA 1PD1A 4NYIR 4K3UA 1M10A 1Q91A 2ZRMA 1H5NA 4LYHA 2IV3A 3OLQA 4L85A 4NQZA 5JUWA 1WVIA 3ZVKA 1V6CA 3EA4A 3I64A 1A71A 1MDFA 1T3GA 3SKVA 1K7SN 1QPGA 2OCBA 2LUOA 1ISHA 1HNNA 3HP7A 2GHQA 1QGYA 1KI4A 3RTGA 1NF9A 3PUZA 4Y2VA 3A05A 1SC4A 1IHYA 2Q2OA 3LWZA 3K9FC 3FVQA 4GE3A 1T4DA 5HTOA 3PPIA 1G6Q1 3PVSA 2NVUA 2XRYA 4XX0A 4A6DA 4G25A 3DFZA 2VP3A 3G5LA 4HC4A 2YYAA 3AB7A 4NOLA 4BGDA 2Z6UA 5BWBA 1N25A 1E6MA 2NV2B 4F8JA 1L5HB 2SICE 3WIOA 4UXIA 4D0LB 4PO8A 1KAHA 1BXRB 4O4IB 3K0EA 2W83A 3NKVA 1RWXA 2VDUE 1G59A 1NYTA 4BWYA 1GGHA 1NFFA 1V6SA 3OIFA 3T9DA 3PNKA 4P3OA 3USCS 1C9NA 1T1IA 1QVWA 1RYFA 3TUJC 5CFPA 4DPLA 5ENZA 2N42A 3NKFA 1V45E 3T9CA 2REOA 5DHTA 1LRKA