1YL5A

Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
247
structure length
247
Chain Sequence
AMARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 69
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl5A01
3AUUA 5IDYA 4TRJA 4CM1A 2A4KA 4OXYA 5U1PA 1AHHA 1Y8QA 1Z82A 2PY6A 1F0YA 1ZEMA 1PJSA 1LRKA 3MJTA 4XDYA 4NBTA 2O3QA 3WYCA 4HXYA 4MVJM 3ONEA 1C3VA 3WBFA 1FJHA 1PZFA 3PPIA 4BO7A 4E2WA 1IB6A 3DAFA 2HK7A 1YQXA 4CM9A 4FJ2A 1HWYA 4E2XA 3IUSA 4P4NA 1QLJA 2NVBA 3GC6A 1E1NA 4PLCA 4YJFB 1X0VA 5CDYA 2AA3A 5HTOA 2BF7A 1T2CA 2J5RA 2B69A 3L4BA 2AHRA 3FWZA 2VUTA 1HE2A 1LDNA 1ZK4A 2DU8A 3PRJA 1SEVA 4TZTA 5F1OA 3TZKA 4ZN6A 4PG6A 1PWXA 4XEHA 4CLXA 2QG4A 4U5QA 2D5CA 3SC6A 2ZATA 3B70A 1KVUA 5TJHA 3VH2A 1M6HA 2DVMA 2Y93A 2YY7A 1V8BA 4XYEA 1I3KA 2CNBA 4YJGA 3FTNA 5ILOA 3A06A 3LLSA 4J90A 1DFHA 5F21A 3SX2A 2E48A 4QFCA 3HQ4O 1PQPA 4AL4A 5I8WA 1PJQA 3H2ZA 4MVJI 3BXXA 4DREA 4EUEA 4BNVA 3RC2A 2HLPA 3AM4A 2I9PA 4ROSA 4BNLA 1ZSVA 1MV8A 3JTMA 1SOVA 2B35A 1Q0QA 1R4MB 4L76A 4RPJA 4M86A 3GDOA 3HN7A 2OORA 2O3RA 1X7DA 2YV2A 2Z1NA 1JWAB 4YWJA 1K6XA 4UREA 3TOXA 1E7QA 2FSVA 1QKIA 3I52A 3V8BA 2CVOA 4UUPA 4W4TA 1H9AA 2YW9A 5C7LO 1BDBA 3ONFA 4KOAA 2WD7B 4XGIA 1HYGA 1V9LA 1S7CA 1O94A 3GVHA 3SJ7A 1GFSA 4JJIA 2LDBA 1EDZA 3I1JA 5EINA 3TZ6A 1GQYA 3MOIA 2XF8A 2VZ9A 4XQGA 4AJ1A 3IP3A 1A7KA 3NT2A 2Q4EA 1YO6A 4KDFA 5JW6A 4KUEA 1EUDA 4QSMA 4Y98A 3HDJA 5AXBA 4BO8A 1PGQA 3RC1A 3K30A 4PZDA 2CF5A 3NJ8A 4EJMA 1OFGA 4MVJH 3WGOA 5IG2A 2Y1EA 3LC7O 1BSVA 1HYHA 1H94A 4RVDA 2I6TA 1WAMA 2D2IA 2PD6A 1T1SA 3ETGA 5JC8A 2G5CA 1O95A 1HZJA 5JYAA 4DRYA 3RIHA 3I5MA 4WCFA 4XIJA 4CODB 2GN8A 5G0SA 1ULUA 1DIRA 3D7LA 4JJGA 4Y6RA 4ZQHA 4ESOA 1PL7A 1WPQA 4MKXA 1LQUA 4RL6A 1I3NA 1KERA 1WZIA 3E9NA 1XG5A 2BHLA 3QW2A 3WS7A 2WTBA 4BQPA 4R41A 3ZWVA 2XOXA 4K26A 4RCVA 3LDHA 2I67A 4CMIA 2XXBA 4K6CA 3WJ7A 1KVSA 3ZWCA 2AQ8A 5FEUA 3C24A 5KJ6A 3L9XA 4FC7A 4WOJA 4CPDA 3AOEA 1TVEA 3KTDA 3KYBA 3VH3A 3VVCA 3O8QA 5MGBA 3A4VA 3EZYA 3FN4A 1OBFO 3OICA 8ADHA 1I5RA 3NTQA 1U8FO 2OZPA 1QYXA 4BKRA 5ES3A 1NR7A 4XX0A 2UVDA 1B2LA 4ONEA 1N9GB 3LT0A 3BTVA 4DYVA 4BGEA 1CF2O 3L9WA 2GNAA 3L4SO 4E2ZA 1T2FA 2GZ1A 4UUOA 4K1LA 1HDOA 4CQMA 4I5GA 4OHUA 4D41A 5LC1A 3LT2A 2BMAA 3BA1A 3CMMA 1RJWA 3C1OA 5ENDA 4DXHA 4WUVA 1VPDA 3AY7A 3QVWA 3WGZA 1P1RA 1L7DA 1YBAA 3MZ0A 3VKVA 2EKLA 2Q3EA 1DO8A 4OSOA 2JHFA 4YTEA 1B7GO 1HLDA 3U62A 2PD4A 3JQEA 3LQFA 3LC2O 3KYCB 4BNJA 4MKZA 4A7PA 5DNAA 3H65A 1YB1A 1DOHA 3UICA 4CV2A 1WZEA 4KQXA 3RC7A 4JNKA 2QYTA 4HV4A 4BO5A 4NR0A 3NEPX 3L6EA 3HDQA 3ZWXA 4RZHA 2BI8A 4RV9A 2X0RA 3I3OA 1UP4A 1H5QA 4N5MA 2W4QA 1R0SA 1XA0A 2Q1WA 1TLTA 3RSHA 1X0XA 2C7GA 4KUHA 4IPTA 4XR9A 5I9NA 3OQBA 1E7WA 2TMDA 3D1LA 3U3XA 4Z3KA 5JAZA 2IXAA 3EAGA 5ITWA 2PV7A 2E82A 1KEWA 1JN0A 3H7AA 4XIYA 2O3UA 4F46A 1PS8A 5A05A 1YL5A 2ZYGA 4WJZA 5JCJA 2AEMA 2QZZA 3H9JA 4UVEA 4UAGA 3QHAA 4J2OA 4HKTA 3PDUA 4Z9FA 5IDXA 4C4OA 2VT3A 3PWKA 5FWNA 5KIAA 2C82A 1FXSA 4R51A 1Q0HA 4K6FA 5H82A 2G17A 1DEHA 1N1GA 3M1AA 3FRJA 1N7GA 4BOYA 3D3WB 5F5LA 1UDCA 4ZQBA 1UXIA 2X7HA 4H3VA 4FOOA 2FY8A 3JQDA 2B4QA 3HE3A 4W9NA 3ZNQA 4B4UA 1B16A 2ZTLA 3DHYA 3GVXA 2O3JA 4L9RA 4J2HA 2EGGA 1PTJA 1ZK3A 2GCGA 3WX0A 4D0SA 3QWIA 1BTOA 3R3JA 3PI7A 1Z75A 4ZICA 5DZSA 2RH8A 5L95A 2HKIA 2NNLD 2B36A 1YB5A 5CPBA 1UXKA 1NYTA 5TS3A 1K2WA 1GR0A 2PWZA 1GZ4A 5CDTA 2OMEA 3U49A 1QMGA 4J4BA 1E3EA 1XDWA 1X13A 3BYZA 1SEPA 3QWFA 4E5MA 3MJ4A 4CM4B 4RJTA 3CZRA 1U8XX 5JFOA 2HJSA 4E5YA 4HFRA 1V3TA 2GUGA 3UXYA 5JNLA 4MIOA 1U3VA 2G1UA 5T67A 1HF3A 5M6DA 2P9EA 1BHSA 2UUOA 4PG5A 4I9UA 1MFZA 1O9BA 3PHIA 1OC2A 3H9EO 3JV7A 1LRLA 1ENZA 2Y1FA 4RLHA 2CDCA 4D0RA 2QZ9A 5AQ1A 2BKAA 3VTZA 1F06A 3JQ9A 4BL5A 5A5FA 3PVZA 3H5AA 5K6AA 1PU2A 1ISFA 2HUNA 1UDAA 2QIOA 2YQ5A 4GWGA 1JAXA 3RROA 2OUIA 3FR8A 3OIDA 1VKNA 4OOEA 3HJAA 3RUIA 3GA0A 1C0PA 2EJWA 4D42A 5EERA 4R3WA 1E7MA 2YZ7A 3ULKA 4YT8A 5CG1A 1CWUA 4KUGA 4AJOA 4D3SA 5JAIA 4BV8A 3PEFA 4UVGA 3JQFC 3QQPA 1R66A 4R16A 4IY1A 4CM8A 2VRCD 4IZIA 3G1UA 4E30A 2PKQP 2P4QA 3NDRA 5ADHA 3JD4A 2VWGA 3OFSA 4IDFA 4S1VA 2EERA 5JMPA 4FCCA 1A9ZA 3HN2A 3I9OA 3LU1A 1NVGA 4DC1A 2WM3A 1YE3A 4AG3A 4DLLA 4XZ3A 4Q3DA 1O89A 1TT5B 4BGVA 2HMUA 4LISA 4QO8A 1IULA 3OQ1A 4B4WA 1B3RA 5AXCA 3VKUA 5HBRA 5BT9A 1IL0A 2Y1GA 3WBBA 5JS6A 4MOWA 3OECA 2EWMA 1HE4A 4PLYA 1PJLA 4FGWA 4Z0HO 2NV6A 1LQTA 1UP7A 4DBZA 4S3MA 1FDVA 3F6YA 4MVJF 1K6IA 3K31A 6ADHA 4CL8A 2GO1A 3ZH2A 1YS4A 1Y5RA 3VDRA 4LVUA 4IMRA 4LN1A 2B37A 2RHRA 4CMEA 4WEQA 2FOIA 1NPTO 3L6OO 2UV8A 5IDQA 2AG5A 3NUGA 4UEOA 1VM6A 3ZWNA 1PJ4A 2EJVA 4J1TA 3ZHXA 3RC9A 3V5NA 2PGJA 5CHEA 4B79A 3PGJA 5JXWA 3CSDA 4KTVE 4IGFA 4XJSA 2VYVD 4IINA 5EL0A 4O0LA 1T2DA 1JU9A 2P5UA 5TGDA 1WNTA 4NI5A 1YOVA 3VPHA 9LDTA 3Q0EA 4W7IA 2ZCVA 4YBZA 5H83A 1BDMA 2YJZA 5EN4A 2B5VA 2VCYA 3GH3A 4WCFB 1HZZA 3WTBA 3PFWO 3EVNA 5AYVA 1PJTA 4PVDA 3AU9A 5C7OO 3C1TA 4GBJA 1PGJA 1N92A 2OO5A 4D43A 1L1FA 5DBGA 3RU7A 3GVIA 4A03A 4ITUA 1BXGA 4CMGA 5TF4A 2ZTVA 1TA4A 4N54A 1R0LA 1B8VA 1P33A 1MFPA 1SB9A 4CMIB 5C37A 1SPXA 4QX6A 5U4QA 3HFSA 3PQDA 3PJDA 3WR5A 2C54A 1PSDA 1C1XB 2VWHA 4J1QA 2BFAA 5G4LA 3IJPA 3I9MA 1G0OA 1NWHA 5TNXA 4EBFA 3CUKA 4U7WA 5LDHA 3IL2A 4FB5A 3PJGA 3FWNA 4MDHA 2GZ3A 3PLNA 1DFIA 1EQ2A 4DL9A 4J1SA 3GGPA 1NASA 2AEJA 4XRGA 1NFRA 1PL8A 1PZGA 2ZYDA 3DC2A 3HWRA 4FJ0A 2QRLA 4IXTA 1E3SA 5JDCA 3OA2A 4FSHA 3WGGA 4H7PA 2OP1A 2XAAA 1Y1PA 4IQ8A 1DHTA 1BG6A 1JWBB 3O03A 4XYMA 5TC4A 4FGSA 5TSDA 1EVZA 4GGPA 4AJPA 1HETA 2P68A 4FS3A 4FPXA 2X9NA 1FK8A 1U1IA 4RZIA 3JQ6A 1ZMTA 4CV3A 5BNFA 4RGBA 3KLPX 1QYWA 1EVYA 1RM5A 2YDYA 4P8RA 3TL3A 3FPLA 1VJ0A 4HX5A 2X86A 4OSPA 1WW8A 3Q2KA 3DQPA 3VZRA 3ZU2A 3KETA 4A0SA 5T64A 3M2TA 2B83A 3A9WA 3W6UA 5KNLA 1T4DA 2CDAA 3GPDG 5IAAA 5HM8A 2JHGA 1ISIA 1MA0A 4IDBA 1GZ3A 3HZZA 3SXPA 1E3IA 3CMCO 2Y0CA 3N74A 1OMOA 2W2LA 5KOIA 2FPPA 4W7HA 1O6ZA 5H81A 3NKLA 4DIBA 5CDUA 3K2BA 1IYZA 4LGVA 2NLOA 4GWKA 4NBVA 4TRRA 1TEHA 1UXHA 1DDOA 5F1KA 3UOGA 4FR5A 3NT4A 3SC4A 4HFMA 1WLYA 1N2SA 4PLHA 3BMQB 2A94A 3ZDFA 3MEQA 3DBHB 4BO6A 2ZQYA 3DZFA 1F12A 2QYSA 2RHCA 1VI2A 3E18A 3K6JA 5A1TA 1DXYA 3FD8A 4WLUA 4I08A 2I3GA 2FR8A 1D1TA 1IHYA 1NR1A 3I6QA 3ZV3A 4FW8A 4PLZA 1FMCA 4CV1A 5ER6A 2X0JA 1K3TA 3I9JA 4OGWA 4R3NA 5T8KC 4O5OA 4DIFA 4FFOA 1C0IA 4GMGA 5G4KA 2BI7A 1R4NB 4ZQEA 4TKLA 2Y66A 3BIOA 1Y8RB 1X1EA 3JQAD 2CD9A 4QQRA 4CQLA 3BMOA 4OO3A 3QIVA 1ZIDA 3HHPA 5L7TA 4BB6A 1LA2A 3KYDA 1EQUA 1GEGA 1WP4A 2C2XA 3OQ6A 1Y5MA 3ZW8A 1JW9B 2BD0A 4J91A 2Z1MA 1BGVA 3H9UA 2QRJA 1YBMA 4L4XA 1MC4A 2RBEA 1I10A 2C59A 1N8KA 4IIVA 4JBGA 2VUUA 1L7EA 4FBGA 4Z3DA 5BSFA 1BXZA 4AFNA 4AJNA 5DP2A 2QX7A 1G1AA 2IZZA 3WYEA 3B1JA 2PKRA 4DQVA 2GD1O 3UW3A 2V6GA 4J49A 1UJMA 2BGLA 1C1DB 1ZEJA 1F8FA 3WQQA 1BXKA 4ALNA 1XWFA 3K5PA 4GI2A 4I9HA 4IDDA 4EGFA 5HWSA 1VKOA 1H0KA 1KVRA 3U4IA 3VHRA 2O7SA 5GY7A 1I2ZA 3INGA 1D1SA 2CVZA 3IAHA 2VZ8A 3ZU5A 1YL7A 3PXXA 2NQTA 4YEDA 4B7CA 5B1YA 2O23A 1ULSA 5DBFA 2VOEA 3P19A 4CLDA 1HEUA 4I5DA 2F1KA 3TNLA 1R15A 4AICA 2BELA 4B3HA 1PJCA 2EEZA 2C5EA 3A1NA 3FBTA 3OJLA 4NBRA 2PGLA 1DHRA 3MWEB 4BNKA 4DQXA 1DPGA 1U3UA 3DBLA 4RPKA 5JY1A 1T24A 2V6FA 1GV1A 3DZGA 1M67A 2POQX 1I3LA 3PFFA 4QECA 2YV3A 1U9JA 3EK2A 2PNFA 4RVGA 3FNHA 1YKFA 4F45A 5A06A 3GDGA 1RYDA 2PLAA 3CTMA 2IODA 3A28A 3JD3A 3KB6A 4P4LA 1LLDA 3PYMA 1YDWA 1A4UA 1BW9B 4YAEA 3RCBA 4MPDA 4ALIA 3TOZA 4OM8A 4XQEA 2HMWA 4IM7A 3F5QA 1A5ZA 5HRUA 3E82A 3R1IA 1D8AA 4J7UA 4FQ8A 1HTBA 3U09A 4QTZA 3QSGA 3KV3O 3ZHYA 2X5JO 3Q1LA 1VLLA 3UUWA 4PVCA 1SZJG 1GUYA 3STHA 5JC1A 3IUPA 3RD5A 3F46A 4E4YA 2DKNA 2GASA 1J6UA 2TMGA 4JP2A 1EK5A 3ZWAA 4XYBA 3KBOA 3ETEA 1R37A 2NU7A 3QY9A 1LI4A 4XYGA 4RPGA 2CF6A 4YR9A 1QG6A 4II2A 4N5NA 4D7AA 3HB4X 3AFMA 3JQAB 4E13A 2FSSA 2Y1DA 4NJOA 1ENYA 5HS4A 4XQ9A 3ASUA 4RF5A 1QLHA 5CAEA 3IKVA 4HADA 3HDHA 2X9VA 5JDIC 7MDHA 5JBIA 4Y6PA 4FOSA 4I9NA 2Z5LA 3U5TA 1Q7BA 4R5MA 2ZB7A 4GH5A 2W8ZA 1TB4A 2Q99A 4E3ZA 2QW8A 1Z74A 4NFYA 3Q9NA 5DOVA 1JTVA 1PJBA 2VHWA 5K9ZA 2HQ1A 1GD1O 1D3AA 1EDOA 2DFVA 3ZV6A 4GSLA 4YT2A 3FI9A 2WYVA 4QXMA 3W8FA 5IZ4A 4E21A 5B37A 3H5NA 4UUNA 1HSZA 1E3WA 4ZVVA 1XHLA 1F17A 2PZJA 3D4NA 1KEUA 4M87A 4KDEA 4QEDA 4L0QA 5J23A 1EE9A 2J6IA 3G0OA 4E12A 5GZ3A 4ALJA 3JQ8A 4NU5A 3X2EA 1GADO 4IBOA 4UVHA 2VOJA 3FHLA 1OC4A 3GN1A 3W1VA 1U2GA 3GY0A 2CDBA 3AK4A 3RBVA 1LEHA 1DRVA 1ORRA 4GX1A 4DPLA 2ZTMA 3UVEA 5FI5A 3F9IA 1C14A 3BMNA 3V2GA 1ZSNA 2Y1OA 3QWHA 3GNSA 3VOSA 1E6UA 5A9TA 4GVXA 1XGKA 3GUCA 3ZU4A 2HSDA 5IZCC 4BKPA 3OH8A 3ZN2A 2CZCA 3ITDA 5F3RA 2FZEA 3Q2IA 3PHJA 1YXMA 2AQKA 1WWKA 2Q2QA 1U2DA 4D79A 4E5NA 3WLFA 2GLXA 2Q1SA 4M49A 2EGHA 4PLTA 1DSSG 2CSUA 4NU6A 4OL9A 2BFMA 3EZLA 3MWDB 3QRWA 3PYLA 3VZSA 1ZH8A 3TSCA 4IIUA 3I9NA 1RWBA 3PLRA 3WQRA 1FDWA 1SB8A 1QSGA 1LDGA 3C7AA 3OM9A 4JBIA 4XR4A 5ENVA 4ALKA 4EZBA 4CM3A 3ZV4A 4NJMA 4BNGA 5I7VA 3MCVA 2JCXA 5ER9A 3KO8A 4BUCA 3L77A 1X7GA 4DGSA 3KSDO 4RDIA 2GSDA 5T57A 5A9SA 2CY0A 2Y1CA 1QP8A 1SAYA 1MLDA 3CEAA 1NP3A 2WE8A 5L7YA 2JAPA 5I7EA 3AU8A 4JP3A 1UZNA 2H5LA 2VTDA 1Z7BA 1GUZA 3OA0A 2C0CA 1LSUA 1WVGA 3PTZA 5B4UA 3B1FA 2E6UX 4TROA 5JLAA 3PYXA 3WYBA 4II3A 3I83A 3PZBA 4Q3EA 1ISGA 1F14A 1KC3A 1I32A 2WEKA 3DWFA 4O6VA 4CM9D 4GX0A 1V3VA 2EHDA 1ZXBA 2Q2WA 1U5CA 4GKVA 3JD0A 4JN6B 3GEGA 4GGOA 5GMOA 3S8MA 4O59O 1EE2A 5IF3A 1LLQA 2OGUA 3G17A 3M6IA 3JYQA 4FN4A 4NNJA 3PIIA 4KWIA 4IJWA 4TMFA 4AJ2A 1BRMA 1CYDA 4PG7A 3I4CA 3UAGA 2GYYA 1BVUA 3PHHA 3PK0A 2BH9A 1HL3A 3GGGA 4K9DA 4YDRA 1LX6A 5JE8A 4AJ4A 2I65A 1B3BA 2X23A 3JQ7B 3JQGA 2JD0A 3WNQA 1NVTA 2D4AA 1FF9A 1Q2XA 4R5HA 1U4OA 4J4TA 3N58A 3H2SA 1P77A 5G4KB 2NVUA 1X1TA 3ZHZA 1P45A 1G0NA 4IJKA 3DBRA 2EP5A 5CP8A 4INAA 2JCYA 5TT0A 4ZRNA 1P1HA 1CRWG 2I5PO 3JD1A 1YVEI 5DF1A 3KYDB 4YRAA 4ZGWA 3IS3A 3SEFA 1YDEA 2I3AA 1IPFA 4XGKA 4U6QA 1EVIA 2V6MA 2W2KA 4URFA 4YVFA 2DBQA 3RASA 2RH4A 3JQBA 2X0NA 2WDZA 4RDHA 5JCXA 1GCUA 2CFCA 5CEJA 4J0FA 4EJ6A 3K2EA 2AW5A 5ICMA 4KP7A 1M66A 4E33A 4OKNA 4JGBA 2F00A 3KHUA 1Y81A 4AJLA 4D45A 4J1NA 4DIOA 4WLNA 3OJFA 5JYDA 4RF3A 3WNVA 2D1YA 1XYGA 3B1KA 3W4JA 1CERA 4FD3A 5FFFA 3PGXA 1MXHA 3H9GA 3UHAA 1E5QA 1KETA 1LSSA 4Z9YA 4BB5A 3PZRA 3VPSA 4YT4A 4QFDA 1EVJA 3DHEA 1SCUA 4CLRB 4N7RA 4R01A 4D46A 3DTYA 4DVJA 3K92A 4JCOA 1LBEA 3I6IA 5TLSA 1KVQA 2HAEA 4NQZA 3GFGA 1VRWA 1PIWA 1QV7A 5KVVA 2DC1A 4P4GA 4YACA 3QP9A 4WCFC 2JL1A 3LZ6A 1IE3A 1ZJYA 1Y8QB 4RVSA 2O2YA 3PIDA 4CUKA 3DFZA 1GPJA 2YHIA 4B3JA 3EDMA 1UXGA 5EMHA 3WGHA 2VWPA 4D44A 1KEVA 3INRA 4PZCA 3DZBA 1FDTA 5G0TA 1TXGA 1IUKA 2O7QA 1EK6A 3QV1A 1ZJZA 4CMHA 1NM5A 5DULA 3CZMA 2NVWA 1QV6A 2Q1TA 4LRSB 1XQ6A 2HDHA 5T6BA 3KOUA 4MP8A 3DFUA 1DIHA 3BTSA 5L3ZA 3ZNNA 3EUWA 4O1MA 2IXBA 2PTGA 4MVJA 4YJGB 4PG8A 2C5AA 4DUPA 1AXEA 5TX7A 1MX3A 3IIEA 4CQMD 2QRKA 3IOYA 5KVQA 4F3YA 5TJ9A 1CJCA 1ZUD1 2VHVA 2DUUA 4IDEA 3JQCA 4ND2A 4Q3AA 1IPEA 1KVTA 3HFGA 4E32A 2E49A 3WTCA 2H9IA 1KY5A 2DPHA 1UAYA 4PG4A 4ND1A 3TJRA 4KTTE 4I5EA 3RJ9A 1HDRA 5AXAA 2FRDA 3WJAA 4BNZA 4JXKA 3I23A 4W82A 1HE5A 1YQGA 4HP8A 2Y0EA 5JYFA 3ROKA 4JK3A 4IDAA 5G0UA 5FYDA 4EYEA 4LCJA 2PFGA 2ZQZA 4D3FA 1F8GA 4IQ0A 1IOLA 4YJFA 2IYPA 2JFGA 2P2SA 5JYEA 5L4SA 4NPCA 2VYNA 2C20A 4D3DA 3Q11A 4NBWA 4AVYA 5THKA 1R6DA 3GRKA 1P0CA 1D7OA 1CETA 2X4GA 3EC7A 4RVFA 4XYLA 3OETA 2AQHA 5JCJD 1V3UA 3ZWMA 2HMTA 2WWRA 3QE3A 3U0BA 5JO0A 5IN4A 3TZCA 1J4AA 3UN1A 1P3DA 1E77A 5G0VA 1AHIA 2Q22A 2GPTA 3SJUA 4TRMA 1VL8A 2X0IA 3KSUA 2DAPA 5I8ZA 3RWBA 1E1MA 1ZBQA 3C7DB 1ZSYA 1XELA 5CPFA 1T4BA 2IRWA 5L4NA 1EZ4A 3WFIA 3BMCA 4IMPA 1N7HA 3DONA 2UDPA 3MJCA 1LSJA 2H1SA 3RBXA 3E5RA 3V2UA 4NBUA 4AJIA 1UAGA 4FFPA 4YAKA 4XB1A 1IZ9A 5CEEA 3ZU3A 3VH1A 3ROQA 5ICSA 4J16A 3RI3A 4WNCA 2B4TO 3TFQA 4J4HA 2J3HA 3AUSA 4R1SA 4XGNA 2R00A 2PGDA 2V6BA 4Q39A 3FSRA 1NHGA 1AGNA 4R1NA 1GPDG 1EFKA 2V7PA 3WFJA 3ORFA 3D5QA 2R2GA 3BHMA 3P5SA 2WD7A 4DMMA 3WGQA 5B4VA 2W98A 3DO5A 5DCUA 3EMKA 2DFDA 4BS9A 3TRIA 4FFMA 4Y8VA 4RORA 3O8QB 3HG7A 1T1RA 1VL0A 1E0DA 5I7FA 4DLBA 1YH3A 3WB9A 4NJMB 3UCEA 1JKFA 1A9YA 2GR9A 3JYLA 2GZ2A 3GFBA 2EW8A 3IC5A 1CQIA 2NU9A 3GT0A 4RQUA 3E5MA 4XJTA 4CJXA 4CQMB 3DOCA 2IEBA 2NADA 4CLOA 5TIIA 4MIYA 1PQUA 4MVJE 3NGLA 4MP6A 4NMHA 3IMFA 3WMXA 1VE9A 2O50A 4YAGA 1YQDA 3AI3A 1NPDA 5KJFA 2OP0A 1ZVMA 1JDJA 3WOHA 3TQHA 1ZZEA 2ILTA 3OHSX 2G82A 4YRBA 1HDCA 2EW2A 1PZHA 2X1HA 1LXCA 2GRAA 5AOVA 4GLLA 3WDSA 1WMAA 1RM3A 4WE3A 4ZQFA 5IFLA 3GG2A 3JYNA 3FNFA 2QQ5A 3GUYA 4WLEA 2WMDA 3W8DA 3DXFA 3GRPA 2PR2A 3OEYA 4FFRA 1JQBA 2FP4A 4GX2A 4LMPA 1XSEA 3WSVA 5A02A 2PD3A 3DMTC 1JKJA 1GU7A 4OXNA 1DIGA 2A35A 2Q4BA 1ADBA 2HO5A 4P38A 3LLVA 4TVBA 3I9LA 2Q49A 3X2FA 1RPNA 2O3TA 4QUKA 3ZZNA 4B8ZA 1N9GA 2IZ1A 1I33A 1ML3A 3JYOA 4B8WA 4BNXA 2G0TA 3QA9A 4BKQA 1NQOA 1HDZA 1C0KA 1U3TA 1UH5A 3LVFO 2CUKA 4L4RA 1KIFA 4ND3A 3ZV5A 3S55A 1E7SA 3ANNA 4IS3A 1FDUA 4FFNA 4WOKA 2B0JA 3GK3A 3N7UA 3NDJA 3S2GA 3H9QA 3ROMA 4ALLA 5KCZA 4BQRA 3RUAA 3S2IA 4R68A 4BNYA 1CIVA 5IXSA 3KYCA 3WGIA 5JDIA 4ND4A 3I9KA 4HWKA 1HXHA 1EBUA 4CUJA 4IQGA 3VVBA 3LC1O 3TZHA 4J9UE 4AJKA 2X5OA 3HB5X 3VAZA 3GPIA 4LSWA 2VRBA 3O9ZA 3GVCA 5JO9A 3LSYA 5IDWA 4OAQA 3IP1A 4BV9A 4B4VA 5L9AA 2DTEA 1B26A 1H93A 5CEFA 4CM7A 1A7AA 1B14A 2PKQO 3TZQA 3W4IA 2C7VA 5MDHA 5JSFA 1KEPA 4MO2A 4CM5A 2JCVA 2J5KA 1XCBA 4OQZA 3FF4A 2AQIA 4XDZA 4EI2A 1QYVA 2NU6A 4YXFA 1PJ3A 1PGOA 1LDYA 2PK3A 2VN8A 3ADOA 1VL6A 3NX4A 3RUCA 4WNIA 1VSUA 3H5RA 5BSGA 3PJEA 4LCEA 5KVSA 2XPCA 3F4LA 4CMKA 2GERA 2GN6A 1U7HA 1FDSA 2Q1UA 1MUUA 4ZA2A 2WYWA 2NSDA 3EVTA 4ALMA 5IXYA 5KJEA 3BZUA 1JVSA 1IY8A 4GKBA 4GX5A 3BHJA 1PZEA 1D4FA 1MGOA 3ROPA 2H63A 1KYQA 4RF4A 3DBVO 2ZKLA 4BNIA 3WSWA 4M1QA 3WICA 4BNFA 4CM6A 5COQA 1NBOA 2D5AA 3AM3A 1V0JA 2C2YA 3ZWOA 4RVHA 4EITA 4PLPA 3ZWYA 1M6WA 1DB3A 2DQ4A 4CM8B 4TQGA 1CDOA 5BNTA 1LRJA 4HY3A 1ONPA 1SO8A 1ENPA 1SOWA 4JBHA 1NWCA 1XEAA 3E1KA 2JAHA 2UYYA 4EJ0A 3FR7A 1J0XO 4NIMA 4W6ZA 3CPSA 2QHXA 1KC1A 5FF9A 3ZWBA 3C8MA 1E1KA 2YQ4A 1LDEA 2ZJ1A 1GL3A 3IJRA 1NX6A 1BMDA 2NWQA 2LDXA 4JJFA 4IUYA 5A04A 5GZ6A 1S6YA 5I7SA 1AUPA 1UZLA 1HDXA 1ZK1A 3GVPA 4PRLA 4O63O 2BFOA 1NQTA 3V1YA 5I9MA 1KOLA 3NTRA 4YT5A 3UCXA 3M1LA 2VNSA 2ZCUA 2YFQA 4RVUA 1UZMA 1WDKA 2DTDA 5C3MA 2VHYA 4CMAA 3KZVA 5EJ2A 4BO4A 1M76A 4AJHA 3GEDA 2J3IA 3EW7A 1NXQA 2Y05A 1H6AA 2EV9A 1PJ2A 4MIEA 1PR3A 2HMSA 4LSMA 4XB2A 1WDLA 4PIVA 2A9FA 3L0DA 5DCWA 4R69A 1H6CA 1T26A 2AEFA 2FHSA 1GCOA 2OBYA 1JKIA 2ZB4A 3UH1A 1P31A 2DT5A 2W2LD 3O26A 4N5LA 1U3WA 3VH4A 4B4OA 4WPGA 1EEHA 3BAZA 3TPCA 5ITVA 5JAQA 2X5KO 3TN7A 3OEWA 3GG9A 2E4AA 1V35A 1Y9AA 4AJJA 3DOOA 2DTXA 3C1AA 1MC5A 4OIMA 3U4CA 3CINA 1LTHR 5EESA 1TI7A 2RCYA 2X8LA 3AUAA 4IJVA 2B4RO 2DLDA 1WMBA 1KY4A 3OF2A 1P9LA 1Y9EA 3ZNPA 1ZFNA 5LDGA 3ASVA 1O8CA 1TT5A 2IEDA 3KLMX 1YOVB 1LC0A 4DPKA 3VZQA 2EP7A 3D4PA 4YB8A 3WMWA 2NTVA 4IJUA 4NFHA 2EKQA 2O48X 2J8ZA 1QYCA 2FMUA 3VPFA 3BMCB 3QJ5A 4MJLA 4CL3A 2NACA 2O4UX 4PLGA 3QVTA 1DLIA 4L74A 1W73A 1I2BA 2NQ8A 2HK9A 3Q3CA 4KQWA 2JJYA 1I8TA 5KJCA 3DTTA 4M54A 3W8EA 3CKYA 1YWGO 5U9CA 1ZCJA 3H3JA 4H16A 1T2EA 2ZJ0A 1GDHA 3HADA 1B0AA 5T73A 1BXGB 1NPYA 3HNPA 1QYDA 1XIVA 3G79A 2V65A 4U0KA 1KBZA 2IZ0A 3GLQA 2J3JA 3WGYA 2DPGA 3KM0A 3E9MA 4PZEA 2P9CA 4PLFA 3G3EA 4R1TA 3DMYA 2VT2A 2FN7A 1P1KA 4IXWA 3SLGA 1DIAA 1RYEA 4X54A 3ABIA 5KWEA 4BGIA 1MG0A 1Z73A 1XU7A 3F1LA 4YJDA 4EUFA 4BMSA 1E3LA 4U0JA 1YJ8A 1I0ZA 1HDGO 3BTUA 4Q3BA 4OOFA 5COBA 3UCFA 2AMFA 1CQJA 4Z6KA 3PP8A 4BNNA 4DLAA 4IGEA 1LJ8A 1ISJA 2J3KA 1NHWA 1P74A 2I66A 1UUFA 3OJOA 2VZ0A 4CLOB 3GZNA 4E31A 2WSBA 1W8DA 3WXBA 4MVJG 1U28A 1H2HA 2AXQA 5BSHA 4XD2A 2HK8A 3JYPA 2UUPA 4WKGA 4Y67A 4BNWA 5KVCA 1DJQA 1GTMA 3ENKA 3OJEA 3CIFA 2GN9A 4QO7A 1ADGA 3CE6A 2PH3A 4CUZA 3R0IA 4DBVO 1IHXA 1H6BA 4PLVA 1PX0A 4R9SA 4BMNA 2P9GA 2BRUA 3GMDA 3TDKA 2PH5A 1LSOA 3EGOA 2CVQA 2IDZA 3GGOA 1RM0A 1AN9A 3GAFA 1CEQA 5F5NA 1AXGA 3AWDA 3M2PA 3WG9A 3VDQA 3JQFA 5KKCA 4TVOA 1C1XA 3RQSA 1EBFA 1QXSA 3IDSA 1WXDA 1A72A 3AY6A 1ZNQO 1LNQA 4HNGA 2AG8A 2VRCA 3ZI0A 2ZB3A 3F4BA 4XKJA 1J49A 2PA3A 3RBZA 1H6DA 4JIGA 1A27A 3WWYA 3VPGA 3LF1A 3O38A 4ZHSA 3PWSA 4E5KA 1QR6A 3OIFA 5LCXA 1HE3A 5BNIA 1W0CA 1LLCA 3AOGA 3D0OA 1ZK0A 2VNAA 3RUFA 5IN5A 1E6EA 2G76A 4J6FA 4B7XA 3OIGA 4BNUA 3DB2A 4M55A 3MJSA 3IKTA 3SBOA 4GQAA 3UFXA 3L4BC 3OBBA 1R12A 2JFHA 1RKXA 5KJ1A 3MTJA 4CV0A 4YPOA 4E5PA 4BO9A 3C3XA 1NFQA 3H8VA 4Z9XA 4UEKA 1PL6A 4CMCA 1HT0A 1Y7TA 5TQVA 1UXJA 1SNYA 5EPOA 4YYZA 2BGKA 4ILKA 4L4SA 2RAFA 5L40A 3ICPA 3H4VA 4Q3NA 4XCVA 4N18A 3MTGA 1ZW1A 4MINA 1E1LA 4XWYA 4HFJA 4NG5A 2OFPA 4CQLB 2HMVA 2Q45A 3GDFA 3W4KA 3BMOB 4EEZA 1GQQA 2YYYA 4EW6A 3LK7A 4ID9A 4PLWA 2P4HX 1ID1A 3IQDB 4JROA 1LC3A 2ZK7A 1NNUA 1DC4A 3BMQA 2VYVA 5DDIP 2GF2A 3QWAA 3DBHA 5F1PA 2WD8A 3AY3A 4A5OA 3WIDA 3DAGA 4OKIA 3DZJA 3T7CA 2OL4A 3GR6A 4CLHA 4EDFA 1DIBA 1OOEA 3QLJA 1Q1NA 1ENOA 5IJZA 1NTOA 4RQTA 4J9VA 4YJHA 1T25A 4H15A 4GLOA 4K28A 1DC5A 2D8AA 3TF5A 3ENNA 2X6TA 4XA8A 4L8VA 3E6AA 4GMFA 5G2OA 3ST7A 5BSEA 1OZAA 2C29D 4BHTA 1A4IA 3U4HA 2O3SA 3WLEA 1ONNA 4UEJA 3NJ4A 3H3FA 1R4NA 4F6CA 1YONA 1RM4A 1J5PA 4YQYA 4R9RA 1Y8RA 6LDHA 2EF1A 4LW8A 3ANMA 4BO2A 4YAJA 3DR3A 4PCVA 1PQWA 4CMBA 3DBLB 2GDZA 4YCAA 4OJNA 4NFSA 1B8PA 1M2WA 3I4FA 2Q2VA 2OXIA 2HRZA 3L07A 3Q9UA 3ZWWA 2PZMA 4MP3A 4PFJA 4OMUA 4Q9NA 4BKUA 4UULA 3GNTA 1I30A 3DDNA 4KMSA 4Q3CA 1E3JA 1VJTA 1H9BA 4DYDA 1ADCA 1I36A 1JLLA 3P7MA 2VHZA 1B15A 3D3EA 1BWSA 5L53A 1NFFA 4IDCA 9LDBA 1LU9A 1ZMOA 5EIOA 3LT4A 4BIIA 1C1DA 1DRWA 1GV0A 1Q0LA 4YQZA 3ETDA 5JPIA 4PN3A 4G2NA 5B4TA 1IZ0A 1N5DA 4KZPA 2AE2A 3HUDA 2I76A 3ZHBA 3AOEC 4PRKA 5DOZA 3EY4A 3RFTA 2FZWA 3Q6IA 4UUMA 4RPLA 4I5FA 5AXDA 1AE1A 1PS9A 1ISHA 3AW9A 4J7CA 2JD1A 3RJ5A 4LK3A 1DFGA 4RLSA 1GQ2A 1I24A 1GUFA 2W90A 4RO0A 4TWRA 3RUEA 3COSA 4Z0PA 4B3IA 1E6WA 4ZD6A 1VC2A 1DAPA 1BVRA 3DMTA 3HDYA 1HRDA 2PZLA 3GAZA 5A3JA 3NDIA 3RVDA 4L73A 3INTA 4BO3A 1YB4A 1NVMB 3GF4A 1ISMA 3AI1A 3KEQA 3OMLA 5KTKA 1QORA 3G1TA 1DC3A 1VJ1A 3KVOA 4EUHA 4HBGA 3UGKA 1Y6JA 4FJ1A 3F47A 2WJPA 3MJVA 3NTOA 2A92A 2AE1A 4WK6A 4OXKA 4XQCA 2HRBA 1BW9A 3ZWPA 4YAIA 2EG9A 4XRRA 4KWHA 1XKQA 4JQCA 4ZJUA 4CLEA 4FC6A 3NT5A 5TRTA 4YRDA 5HS6A 4BNTA 1PWZA 2VTEA 4YA6A 4W99A 5A5EA 2VQ3A 4A73A 4CR6A 5L7WA 3NAQA 1NAIA 1PR9A 4HFNA 4QT0A 4WCDA 3SLKA 5DCYA 4WLVA 2NTNA 5I9LA 5T8KA 5BR7A 2BGMA 4U8GA 5JY6A 1A71A 1E3WB 3F5SA 4DWVA 2DBRA 5CG2A 5CDGA 5AVOA 3EYWA 4LVCA 2JD2A 3D5TA 3PQFA 4FDAA 4CMJA 3NV9A 1YL6A 3RKRA 4BKOA 4DTIA 2GGSA 3JQ8B 5A4DA 1P1JA 3JQAA 5A3VA 4I1IA 3EHEA 1Z7EA 5DP1A 1JAYA 1E7YA 1GYRA 3F1KA 1R4MA 3HSKA 2WYUA 2FPGA 1UP6A 4MVJP 4W9NC 4E6PA 1HSOA 2BLLA 3BMNB 1JVBA 1YJQA 3JQBC 2IYOA 4NK4A 3C7CB 3U4DA 1U7TA 1Z45A 2D0IA 5TT1A 4AJEA 2Y68A 2DBZA 4GVLA 4MKRA 3SVTA 4DA9A 4RF2A 2YFHA 3GZNB 2ZYAA 1R16A 3CXRA 1K6JA 2OBNA 1I2CA 3QVXA 3ZCXA 5DT9A 1ADFA 3PJFA 3LT1A 1DRUA 1W6UA 2FPIA 1X7HA 1O0SA 1LUAA 2BFPA 2IE0A 2WE7A 1P0FA 2YUTA 5DN9A 3T7EA 3DOJA 1Q7CA 5ILGA 3PWZA 4BO0A 3GN2A 3WWZA 3K9QO 3LYLA 4HUJA 1I01A 3DL2A 1Z6ZA 4UVIA 3AI2A 4JLWA 5COAA 3TL2A 1O5IA 4A10A 3KUXA 3ANLA 3KEOA 4DMLA 1P44A 5EQFA 4G65A 3RFXA 5C7IO 1K89A 4ZRMA 3RUDA 4WASA 3V1UA 2VHXA 3C85A 3S1LA 2DBVO 1K5HA 3QVSA 3GNQA 3NGXA 3PHLA 1NQ5A 2X22A 5A9SB 4WECA 5A03A 2DUWA 4LRTB 3ZNOA 2ZB8A 3MJEA 5L4LA 1K0UA 1ZXLA 1UDBA 3VTFA 4G5HA 3O4RA 1XR3A 5FI3A 1NAHA 1U4SA 4E0BA 2HU2A 4TSKA 3JQ9C 2E37A 5J9GA 2ZTUA 3DZKA 4OH1A 5K6AC 4EEXA 1PGPA 2JKVA 5G0WA 3LF2A 2Y99A 3V2HA 4BMVA 1EFLA 3FNEA 3G49A 1GYPA 1GEEA 3PQEA 3JSAA 4U6SA 4WLOA 5DBIA 5A9RA 4DQUA 2HJRA 2P5YA 3R6DA 3FPCA 3D4OA 1W4ZA 1GZ6A 3UKOA 1G6KA 1E7RA 3QVOA 2UAGA 3DZHA 4GPD1 1PEDA 4NDNE 3VC7A 4TZKA 3B20A 4PGFA 1ZO8A 3H6KA 4J3FA 1GAEO 4OQYA 1OAAA 4A2CA 3NYWA 4NZ9A 3KSZO 4MVJD 1MG5A 4IZHA 5CDSA 2I99A 3JQGB 4OYRA 4ZQGA 4F6LA 1XQ1A 1M75A 4NK5A 3PHGA 3GHYA 4WLFA 4E2YA 1YBVA 1SC6A 3E48A 2FR1A 2C07A 3ZW9A 3RUHA 3NRCA 4NH4A 2NVUB 3ADPA 3FNGA 4R1UA 1U5AA 1XU9A 4IS2A 3VPXA 1DAOA 1R0KA 3DBRB 1MP0A 4J43A 2FWMX 5THQA 2NU8A 4BGUA 4G81A 3AJRA 1Q7GA 4DC0A 4WGGA 2OOSA 1PGNA 1N1EA 3KRTA 2FR0A 1GYQA 4M89A 3OP4A 1KS9A 3ICCA 1C0LA 2B5WA 3ITKA 2JFFA 4BNHA 1LDMA 2W2KB 4BNMA 3U9LA 4TRNA 3PDJA 4LMRA 5HA5A 3F3SA 4WEOA 2D59A 3A14A 2O4CA 3RU9A 4FIZA 1MB4A 2OHXA 1P1FA 5JMWA 5L51A 1JA9A 5JAMA 3GEMA 2VYND 1MXFA 1OI7A 1QRRA 2CMDA 2SCUA 4CMEC 4GL4A 4BO1A 1V6AA 3AM5A 4A26A 1VSVA 3S2FA 3AFNA 8LDHA 2ZIZA 1HDYA 4HNHA 4ND5A 4YJHB 5BQFA 3P2OA 4CR7A 3JD2A 1LDBA 3JQ7A 5K0ZA 2EKPA 1ZK2A 2PZKA 4RPHA 4R4JA 7ADHA 4JX8A 3RFVA 1HYEA 1NQAO 1PS0A 3T4EA 3RKUA 3DZIA 4BVAA 1DJNA 3K73O 1B8UA 3WIEA 4UVDA 3ZGYA 1EUZA 2EIHA 4DPMA 3AUTA 3BHIA 5KKAA 4GAEA 5GZ1A 2EXXA 2VUSA 3RAJA 4A27A 2VWQA 5T5QA 3DAPA 2O2SA 3P2YA 2RIRA 4Z0TA 4GSKA 1XLTA 2YDXA 2NUAA 4C7KA 1SBYA 3OSUA 4Y6SA 1EUCA 3D3WA 3GOHA 2P91A 4J0EA 1ZKMA 2Q50A 3E9QA 3E8XA 4L75A 2D3TA 3FCOA 1WDMA 3KXDA 1YGYA 2YV1A 3ONDA 4C7JA 4NHEA 3FBGA 1E92A 1X15A 1EMDA 2YHIB 3V1TC 4J7XA 5L45A 3D64A 5C5IA 2YHUA 3K8ZA 3OJ0A 3UF0A 2R00C 2NTJA 5IZCA 3E03A 3W6ZA 1GY8A 3T4XA 2Z95A 1H2BA 3BTOA 1HLPA 3MOGA 2Q46A 5CFZA 5EQDA 1DC6A 4CR8A 3WQSB 1I3MA 3QWBA 4IDGA 1X14A 1DBVO 2X9GA 2ET6A 4Y9DA 1P1IA 1YRLA 3ON5A 2X58A 1HKUA 2Y0DA 2XXJA 3GQVA 4P22A 1E5LA 1T2AA 3GHHA 1TT7A 3FTPA 4CM4A 4ZU3A 1LLUA 3B6ZA 4M8SA 4CLRA 2H6EA 2Y67A 1DLJA 3CH6A 3GZ4A 4I8XA 2GN4A 3TFOA 3DHNA 3L6DA 3K96A 2R6JA 3WGTA 1ARZA 2DM6A 4R54A 2NM0A 4TKMA 3GMSA 5JDCC 1UR5A 2HCTA 3VZPA 4FFLA 5B12A 3DEYX 3TWOA 3S2EA 1SMKA 3JCZA 4B7UA 2J5QA 3R3SA 1ONOA
chains in the Genus database with same CATH superfamily
3AUUA 1PDVA 1ZJ5A 5DHSA 4BZQA 5AM2A 5JNRA 2IUTA 2W4MA 5B2FA 1KMIY 3KVNA 1Y8QA 4WZBA 4DUZB 3LH5A 3N8DA 2Y27A 1AK2A 3G9ZA 1FQKA 3R20A 4R3UC 1T3LA 2XTMA 2C2KA 1TUGA 2FOXA 4NBTA 4YPFA 2A5GA 3LNTA 3WYCA 4QOGA 4MVJM 3ONEA 1FJHA 3PPIA 3B1VA 4BO7A 5IT0A 4E2WA 1NVEA 2BLNA 3IAFA 4LXTA 2YWRA 3DKRA 3IRVA 4UAUA 4E2XA 3IUSA 4P4NA 1JAZA 5ALEA 5GPBA 3DTVD 1V8OA 1P62B 2DLNA 4BUJA 3EVAA 3S2ZA 1RWNA 4GBED 2OXCA 4XTRA 1E99A 1W4CA 4X60A 2OV2A 5KYXA 5EOVA 3H0CA 1G7TA 1IMJA 1ZIXA 2AHRA 1G5HA 2B69A 3SX0A 3RFUA 5ALMA 4WFIA 1CC1S 4XEHA 1DEXA 3U4AA 4C4PA 4RX1A 4UMDA 5CLGA 1YK1A 1UINA 3FDFA 3G0BA 4AQ7A 1M6HA 3PC6A 2YY7A 4RFSB 4C05A 1V8BA 5ITZB 4V0KA 1I3KA 2CNBA 2DGDA 4YJGA 4HEHA 3ZOZA 1KJWA 1R4ZA 5AJHA 3VYWA 4ARBA 3LLSA 2YICA 1HYBA 2BHRA 2V3WA 2X3FA 2ZAGA 4J90A 3SX2A 4CG3A 2FEXA 2FXIA 2PUVA 2JDIA 1U6JA 3GJZA 3PDHA 4MRRA 4OGFA 4TTTS 3RIXA 3U48A 1KNXA 2CV1A 2PRZA 1OLUA 3M9XA 4MVJI 1LV7A 4DREA 5BWBA 1V11B 4DQ0A 5B7GA 3L8HA 4I55F 3ND8A 4BNVA 3RC2A 2R66A 3NGMA 2I9PA 3WMFA 4ROSA 2BDEA 2BUCA 4NZYA 1NVAA 1ISSA 1K5GA 1MV8A 3DAYA 2CCGA 2PO7A 3JTMA 2CJYA 3OEED 3IFSA 3DD5A 4EI7A 1GR1A 3RBAA 3NFYA 1T5BA 4L76A 4ZANA 1TK3A 1U9CA 3CRMA 4YMHA 1YRHA 2X6QA 2XODA 4RPJA 3NORA 1SELA 4IRXA 3S8YA 1YVPA 2GAFA 3HN7A 3RHTA 4CKXA 2O3RA 1X7DA 5H9WA 1JWAB 2OCPA 3RS7A 1CK4A 4QPJC 1E9DA 1O0CA 1QKIA 5GONA 1EGQA 1I0IA 5K8CA 1IIRA 1QWSA 3BIJA 2RG7A 4UUPA 3MWJA 2REOA 1SM4A 2YW9A 1P6QA 1P19A 3E2MA 4KOAA 1INLA 5KNBH 1FXUA 2QGNA 3KPVA 4JDPA 3BZBA 3IBTA 4RW0A 1GPH1 4WKPA 3SJ7A 4WZAB 1SXQA 2XUOA 4L5YA 2IH4A 3DE6X 1CNMA 2XMCA 2COUA 1BWQA 1IY0A 5JFTA 1MHTA 1A7KA 2WUVA 1E1QA 3CCBA 3QLUA 5JS2A 4KUEA 5IAKA 4Y98A 3UV3A 4AMVA 3HDJA 4DV7B 3RC1A 3K30A 4I4TF 1L1EA 2JI7A 2YWJA 4K9NA 4PZDA 4QYIA 4LJKA 3W04A 4DRXB 2VBGA 5TE9A 4JOSA 4PCLA 5GONF 3WGOA 2Y1EA 3LC7O 1BSVA 1LVUA 1ZRNA 4MR7B 1CQIB 2J6HA 2X4IA 2I6TA 4URWR 3ZWDA 1WAMA 2P3LA 1S4QA 2GI4A 3VXKA 2O2DA 5JC8A 4DUGA 5J2TA 2VDWA 3DMGA 2H9AA 1SOAA 3E35A 4V1CB 4DB4A 3ZJVA 2V3VA 4XIJA 2RCNA 3GIWA 3PRYA 1ULUA 3OG9A 2H11A 1WPQA 1MENA 3LKDA 5CD9A 1GPAA 3DPIA 1LQUA 4RL6A 2AF4C 3NB0A 1HFWA 4DGQA 3KR0A 2Q8QA 2VPPA 4MB0A 3WS7A 3QW2A 4DXDA 1C5KA 4R41A 1FBNA 1YCDA 2A6PA 3I6BA 1SD1A 1YQUA 3AZOA 2VJYA 4G0YA 4X6LA 3W5UA 4IEFB 2HSGA 1DMSA 2XA9A 4NENA 2JCSA 5LLSA 3S5UA 3VGJA 4GZ3A 1FNDA 4A0HA 1YR8A 4CMIA 2OO7A 3H87A 1YS9A 1V48A 1QE5A 1KVSA 1PFVA 1Z6TA 2HA7A 3AFIA 4P31A 3WJ7A 3IO3A 1Z4OA 2PWAA 1H3NA 4L0MA 2VDOB 1RI3A 3C24A 3L9XA 4BX2A 4OI0A 1XVTA 4WOJA 1KJNA 2FPWA 4CPDA 3AOEA 3A11A 1VLHA 3KYBA 2C3OA 2XYRA 1Z9BA 1T2UA 5HKBA 3L06A 1OBFO 4Q4DA 1XYYA 3UANA 4BKRA 4HMPA 1MIOA 1ZGAA 2VIIA 4WN3A 4BFSA 5GIPE 4DA8A 2FEWB 4JI1B 3BTVA 3TTSA 1FZQA 2WWGA 3E3OA 4D5GA 5CH5A 4DYVA 4L7QA 3L9WA 2GNAA 2BFDB 3QEJA 4HQNA 1UBUS 4B44A 3ZHCA 1EFAA 1FDOA 2GZ1A 4K1LA 1XD2A 4M8IA 4CQMA 4ITVA 3KJGA 2WYOA 1RLJA 4JOBA 2BMAA 4IHJA 3CJQA 3OTGA 5ENDA 3GLHA 5ENZA 3G9TA 4DXHA 2P62A 3RF6A 1K4MA 3AY7A 4UXHA 4BZXA 2EKLA 1ZD4A 4DV6B 4TQUS 4WHMA 4BNDB 3Q3HA 1CS0A 5AKYA 1N2ZA 1B7GO 4GC5A 2PD4A 5JNWA 5GJVC 4F8JA 3LC2O 4EPYA 4Y1EA 3I01A 4XGRA 4POAA 4JB0A 5DNAA 4A7PA 2CLLB 2XYQA 4F2DA 1DOHA 4W1SA 3K6SA 3RNLA 3IDFA 3T5PA 2QYOA 2P4SA 3QPBA 4Z8XA 2EBWA 1BQ3A 1GPWB 1QB7A 3R7LA 4BO5A 1JEQB 1J00A 5JNVA 2H2GA 3EFOA 4D4GA 1ADJA 3BL6A 3HDQA 4HSGA 4LFAB 4KN9S 4ED9A 5H1YA 1L5GB 2BMVA 3R6LA 3FA2A 4JLUA 2RGBA 1G55A 2W4QA 3SOPA 4RADA 4Y1RA 3S8MA 2ODTX 3RSHA 3NP7A 1X0XA 1FTQA 3UC9A 5CURA 3UMFA 4YHBA 4XR9A 4YRFA 3OQBA 3D1LA 3A0RB 4HGNA 2GKOA 4L6AA 2IXAA 3RSQA 5AI6A 5ITWA 2E82A 1WZ2A 4CKWB 5AW6A 4HNUA 4G36A 4F46A 1UK6A 2FTKE 2CXOA 1HM5A 1YGPA 1R9MA 2YVQA 3JR7A 4MYUA 1E0SA 1O96A 1Z5PA 3H9JA 4UAGA 4J2OA 1EJ0A 4GQBA 1A1VA 2Y76A 2Q9BA 1VHLA 3GARA 4LOHA 1WMDA 3ORYA 1THGA 3U1VA 2AMVA 1Y7IA 3ZVKA 1JMKC 4R51A 1FXSA 2XQIA 4RV4A 4LHXA 4K6FA 1CJMA 4KGXA 1MABA 5IC6A 2ATVA 3M1AA 4ZYVA 5F5LA 2QD2A 2RGXA 2V7VA 2Z2YA 2I03A 3EF0A 4HF7A 4EY5A 3KUDA 5HKKA 2ID9A 5EJ4A 4UJ5A 1YTUA 5BN3A 4C04A 7REQB 3JQDA 1JJAA 4B4UA 2HI0A 3ZNQA 2XSZA 2LE0A 4MS3B 3S68A 5LOVB 1B16A 3W6NA 3U4QA 1DRKA 3NATA 1MX5A 4L16A 2QZSA 3B7GA 4IIGA 3RREA 1IAVA 1PTJA 2XCSB 1XD8A 5JS1A 1WDTA 1E2DA 1R6UA 3BGDA 3PI7A 1Z0AA 1Z75A 3URMA 4YONB 3ZVMA 5DZSA 4Z4IA 5K51A 2QTBA 3KUCA 1JHZA 2VSYA 3PFNA 4OY3A 1I7CB 2NNLD 1V26A 5L95A 5CPBA 2VF2A 2QD5A 2VDPB 3OMWA 4RCYA 1NYTA 5GJWC 5G1PA 5TS3A 4DILA 2FJUA 2PWZA 4LV6A 4EVSA 5EMJA 2AN4A 2D2XA 1QMGA 1J2JA 2GEUA 3BYZA 1SEPA 4CCWA 1EXMA 3II6X 3M3DA 2QUBA 4G0ZA 5T6MA 1GGMA 1MRNA 4E5YA 3WHPA 2GUGA 4HGZA 2GK3A 5JNLA 4MIOA 1NQUA 4GUDA 1WB4A 2ATIA 2G1UA 3OX3A 4OK6A 4R2HA 2G04A 2WIBA 3VJLA 1GQOA 1YMQA 5BMVA 3OC0A 4ARIA 3WLMA 1H66A 2GAOA 2B7BA 3KQOA 4LVNA 2HDWA 5BYKA 3KVRA 1VBKA 2W6ZA 4FQ7A 1DCFA 1E2QA 1UXOA 2G25A 2R4QA 4I9UA 3FCCA 4PRZA 2AKAB 2H85A 4D81A 1FB5A 1XFDA 3H9EO 1XQ9A 3JV7A 3PR1A 3U4MA 1U28C 1JJIA 4CKEA 5HRCA 2A3NA 4COOA 1CKEA 2CDCA 4D0RA 5IKPA 3R5KA 5AQ1A 1DKNA 4IZ6A 1ZCZA 4UBJA 2JLRA 2QGFA 1S3GA 3ZCPA 5FUQA 3F8TA 3JQ9A 3OE7A 4QPCA 5KYYB 1PU2A 4XCQA 2HUNA 3LP8A 2HC9A 1OFUX 3Q5DA 4E1BA 4M1MA 9GPBA 1B0PA 1MH1A 5EWJA 3NBUA 1X86B 8OHMA 4ZV7A 4EPRA 4DV2B 4U2GA 3PS9A 2BRUC 1M8JA 3VU1A 5BOSB 1FPQA 2Y77A 1WM1A 3HJAA 2QUAA 4ZOEA 2Q29A 3B85A 2W2MA 2EJWA 4D42A 2Z3VA 1Y6RA 3TH5A 1AQLA 1KPIA 4HPJB 3HKDA 4FHCA 1J39A 2XVMA 721PA 3CUYA 4YRMA 2KB0A 4EMBA 1V4BA 1EAYA 3QQPA 4R16A 4IY1A 1TK9A 2VRCD 3C5VA 4E30A 1U65A 1RPAA 2H1IA 2GK7A 1N0HA 4JQZA 4URVR 5ADHA 3IBYA 5KU1A 1LPPA 5IUJC 3RRZA 5HUJA 3C70A 1G5PA 3H0WB 5JD3A 4IDFA 1E2EA 4G5GA 2N1MA 3KKPA 5LUAA 1O3YA 1NVGA 1JTEA 3W5VA 3K70D 1FNBA 3O0DA 3ABSB 4AG3A 4TKUB 1O89A 2WYHA 2BC9A 1SU8A 3PD7A 3H5OA 1D7AA 1KFJB 4HJXA 2UXCB 3W9BA 3ZDQA 3KZ1E 1JT9A 1X7ZB 2AD5A 5AXCA 4ZFNA 1P17A 3SHFA 5HTKA 1DKLA 3HPRA 3VKUA 1AOXA 1EX7A 1PZXA 3TDNA 1JG4A 2JATA 1V41E 1DKUA 4DEXA 1TUBA 3HR8A 1CUZA 4YS6A 2ZOSA 1TF2A 4RELA 1ZA1A 1LQTA 2NUTB 1I6LA 1UKVY 3DP7A 4DBZA 1FDVA 1H8HA 4JC5A 4DKXA 1QS0A 1ZI8A 3K31A 3GFOA 4RK4A 4P2GA 2I1VB 3WLKX 4H0FA 2P67A 4LZLA 5CA0A 4BJHB 1KHTA 4I66A 5EYPA 3BWVA 2XDQA 4L6IA 5JATA 4FFWA 1SHTX 2R85A 3QEKA 4I3FA 4RHEA 4YP0A 5LMZA 5IJAA 3AEZA 1DBPA 1DINA 2IYNA 1A9TA 2F1OA 3JAWA 5T3YA 3HVJA 3UWPA 5ALXA 3THWB 1AB5A 1TD1A 4LNHA 1SXGA 4AX8A 3RUPA 4RK0A 4ZVKA 4UEOA 1QAQA 1OROA 3EA0A 1ABFA 2GUWA 2W11A 4W7SA 1NXWA 3ZHXA 1KU0A 3DDSA 5F2OA 1B1AA 1QIEA 5K0TA 4ZDWA 2G0NA 3VX3A 4AJEA 1GA4A 5F3WB 2FVYA 1I7PA 4X3CA 4QXQA 5TMBA 2ZJ3A 2JA1A 1WXHA 2OD7A 2R62A 1Q91A 2ZJ5A 3PGJA 4QHSA 3VU9B 3SYMA 1NZFA 4IGFA 4XJSA 2VYVD 4DCSA 1I7DA 2H5IA 4RHXA 5EL0A 3NIBA 5CA0F 1FS5A 3ILXA 3PR2B 1JU9A 3SZMA 1RXYA 1G2QA 3AUJB 5CLQA 3GLFA 4DY6A 2SHKA 3VPHA 2HNKA 3Q0EA 4W7IA 3O1IC 3FTFA 3DDZX 3BE5A 1B76A 3PKIA 1XDUA 3ZQJA 1P7CA 1XJWA 3GROA 2B5VA 3EEQA 3ICQB 3HSYA 4JXJA 3GH3A 1HZZA 2JGDA 3TBKA 3WTBA 3B6EA 4L15A 4MRSA 2QLBA 3AU9A 3SZ3A 3A4NA 4RTQA 3VDMA 5F98A 2PZBA 4GBJA 4ZGBA 1L1FA 3D8SA 1LW6E 5DBGA 5ALFA 2KSQA 4S04A 3MS4A 3FSJX 2B6HA 3A1FA 4L8FA 2VCHA 1Z39A 5TF4A 4DSUA 4CKCB 2WSLA 3DNFA 3HJCA 1R0LA 4N54A 4I8DA 4LRUA 2DFKB 4OQQA 1KO4A 3N2GB 3HM9A 4TSRA 4RESA 1T9KA 1NN0A 4HXEB 3PQDA 4P3XA 4OBEA 1A0OA 3ZDYB 3AVUA 2JI9A 4F6LA 5G4LA 1ZOLA 2IOQA 5BP7A 5ALRA 3ZYCA 5FWYB 3LCJA 4NCIA 2Q3CA 2AOTB 2GRJA 1NWHA 3NTLA 2F59A 4PPYA 2OXTA 3V55A 3HCOA 4BLSA 1UMCB 2AEEA 4R31A 2Z6UA 5AW9A 1C29B 1Z2CA 3MQ2A 3RS4A 2FGJA 3JSXA 4J1SA 3GGPA 3S28A 4BFYA 4DMFA 5EQJB 4DMRA 4MQ5A 3WMEA 1PZGA 5AJXA 4FJ0A 5DO9A 3DOEA 5FFMA 2QVLA 4B3BA 4QDUA 1QFJA 4K8OA 1P7VA 4FSHA 5I9TA 4QYSA 3CBGA 3K70B 3ZV7A 5ICFA 4AJ9A 2GBGA 4IQ8A 4M1YA 2JFZA 4C06A 2OV4A 3PENA 4QUIA 1JXQA 1L7AA 2AYZA 4K9MA 4UEQA 4FN5A 4OD0A 1CQWA 4F85A 5CVUA 5JS8A 1EVZA 3BWCA 4F0JA 4D26A 3SJBA 2X9NA 3EGDB 1SZDA 4RZIA 3L0SA 3A4IA 4AKGA 3VR1A 2KI5A 1Q95A 2QTAA 4F11A 2HCRA 3AG5A 2VHCA 3TL3A 3G0IA 4P8RA 2I3BA 3VHLB 1VRCA 4FK8A 2IYVA 2UVQA 3EUFA 3H42B 4XUGB 1WW8A 4D4IA 5JOQA 2ZBEA 3VZRA 2CLIB 3DQPA 3KETA 1YS1X 3QU5A 3IUNA 4K3UA 3ZGZA 2WJJA 3BWDD 3K9NA 2BSXA 2X4DA 4HGYA 5HM8A 2JHGA 2N42A 1WKCA 1AKEA 4AMGA 1LVGA 1Q20A 2V3CC 1NVBA 2Y0CA 4CVNA 2GOYA 1OMOA 3EXG1 2W2LA 4MH0R 1O6ZA 5H81A 1PK9A 1MRZA 1F5NA 1H0RA 1LBSA 2R11A 3QTLA 4GE3A 3RH0A 3TMKA 5KOJA 1XCOA 3L4KA 1N9ZA 3IP9A 2E5WA 2XYHA 4B83A 2ACWA 2GQ0A 3FFTA 2BJVA 1TEHA 4P7GA 4P0QB 3OOJA 3IKJA 4RZXA 1CJVC 3SC4A 4YIKA 3NBYC 4N8EA 3SC2A 3L01A 5EEHA 3SSOA 2O5CA 2A94A 2GBCA 3ZDFA 2RI1A 1ZL0A 2RH9B 4GOJA 5JRJA 5JSHA 2XJ9A 4JI5B 4DMKA 1VI2A 3E18A 1VPTA 3HKBB 1RYNA 4LDNA 3SF8B 4EF4A 1YVUA 2QM3A 2BBOA 1UANA 2CV2A 2CYBA 1IHYA 2ERYA 1RACA 1PUIA 1ND6A 3HBMA 1SK8A 4W8GA 4COKA 4HGOA 4B17A 3ACBA 4FW8A 1QDUA 3M6FA 5JHGB 1BCSB 2AOWA 1JJVA 221PA 2X0JA 4ZCTA 1Z62A 5LYJA 3R7SA 4YMGA 4RMHA 2QTNA 2WIAA 4M46A 3WLNA 1H4SA 2OM2A 3AKEA 3SZGA 1LY1A 1RXVA 3KHSA 1R4NB 4F3TA 3ZHOA 1FQOA 4G67A 2Y66A 3BIOA 2BMFA 1B43A 4QPPA 1N2BA 1X1EA 5AHXA 1K8RA 3SY8A 2B3TA 3CRNA 3GQBA 4GS5A 4OH7A 4CQLA 2EFCB 1KQPA 1D2AA 2LIVA 2NAPA 5L7TA 4BB6A 1LA2A 2YV4A 5F7XA 2H4ZA 5IHXA 1QVWA 1EXDA 2HLDA 3ROZA 1GEGA 1OX4B 1JFFB 3NASA 3OQ6A 3H5VA 1FFGA 1Y5MA 1JW9B 2BD0A 2QY9A 4HDKB 4AWXA 5LYJF 2QRJA 4NL4H 4XWGA 3ZE0B 3IWBB 1XJ0A 1RTTA 1XHEA 3CZ9A 4N5HX 4KOEC 4QPDA 3I4LA 3AB8A 5BSFA 2OQIA 3CLUD 1NJ5A 1E32A 4KLNA 3FVTA 3AHEA 4NRDA 5JJKA 2IXTA 4WA8A 2G4CA 5I9SA 3KXIA 2JVKA 4S0ZA 4C03A 1JQ5A 4C0BA 1NJ1A 3UW3A 2NO4A 3WL6A 3R3ZA 4QXPA 1XMOB 1XZAA 3SQDA 1DP4A 4Y2RA 4MR8B 4UU0A 1PYOA 2RHJA 3DM9B 4KAJA 4QFMA 3G02A 1GL7A 5FTNA 4MW4A 1U63A 4Y0AA 1XWFA 4GI2A 5HG0A 5B1HA 4D82A 1H0KA 1E69A 2XEDA 1WULS 3RKSA 2O7SA 5GY7A 2UZ1B 3PCTA 5J63A 3HKEB 3PXXA 2NQTA 1L5FA 5B1YA 1ULSA 3FKSA 4RZ3A 4LZZA 4OJKA 2VOEA 4OHFA 2EBHX 1HEUA 1WHTB 2XT0A 2F1KA 4IOJA 1IBLB 5C4IA 4X44A 2C5EA 3FBTA 3LGSA 3OJLA 4KFTA 5AVTA 5JJ5A 2CFSA 1IHOA 2PH1A 3VDXA 2I6QA 3S2YA 3GLGE 2A5LA 4HUQA 4DQXA 5BSWA 1U3UA 1M2FA 1S2MA 1XQVA 5JU6A 1T24A 1QPGA 3FH0A 2Q7XA 1QIKA 4Z5XA 1WUJS 2POQX 4C2AA 4G2TA 1OGJA 5JROA 1GSOA 3PGA1 5BV1A 1USUA 1E6MA 2CNDA 4OP3A 4F45A 2O54A 1SXJA 2NX2A 4YR7A 4KYUA 1CUUA 4M9CA 3JD3A 2YC4C 5GQSA 3WWOA 4OP1A 5BSUA 2VATA 3CLSD 3BXGA 4EG5A 3BC1A 4QATA 5AVJA 3RCBA 3I1FA 1SVNA 1RE1A 1A2KC 1JSLA 1R9NA 4IM7A 1V1JA 3O4JA 5F64A 3B6MA 1SC4A 2O9JA 4JBWA 3E82A 4MW0A 1D8AA 2ALJA 4J7UA 4EELA 2ZSHA 1DEAA 1HTBA 2R751 4QTZA 3QSGA 2ZETA 3ZY4A 5JCOC 1BCRB 1TZBA 5DV9A 3U09A 2DR2A 3Q1LA 3TV1A 1Z38A 1T0PA 1VLLA 1RLMA 3FPJA 3ECCA 5FPYA 1SA0A 2XZDA 2K7ZA 5KAMA 1SZJG 2HBQA 3TQTA 1QMHA 4RSRA 1V7PC 3F46A 4M1WA 5CK5A 3WQHA 4R2JA 4CFYA 3E4DA 4BUZA 3FTCA 1AQUA 5ECGC 3R7BA 2JLYA 5TEVA 3R3WA 1TYAE 5AVXA 3DWIA 2MINA 4KV7A 2HYDA 2OSVA 1PW5A 1OLOA 4XD7D 2J7KA 2QI9F 2WUWE 4EHFA 1QG6A 3FRIA 3A3PA 1C9JA 3ETCA 3L0ZA 4LZOA 3E27A 2FSSA 2X5NA 4ODIA 4DANA 1ENYA 5IMBA 4L08A 4XQ9A 2ZPUA 1S3SA 2PKWA 3ASUA 3K4PA 4Q6BA 4RF5A 4RZSA 2GPNA 4YLEA 3UATA 4EHKA 4BAZA 5CB4B 3C8HA 1M2EA 4HADA 4GLJA 1Z4NA 1WV0A 5EXSA 4D2IA 3P4YA 1NW6A 1R7RA 1Z4JA 5JDIC 5LZ9A 3GT3A 7MDHA 2DE0X 1I5EA 1ZQ1A 2HUPA 3N86A 4I9NA 4WBNB 4OG2A 3U5TA 2QBYB 2ZFUA 4QUBA 4R5MA 3S7ZA 4RQBA 1XRSB 4NEQA 5HKAA 4Z51A 4ZT3A 3TMYA 3ZBUA 3I61A 4HH3C 5EJAA 3L0OA 5D3QA 2HHLA 1JEDA 2ZG6A 1JTVA 3A1TA 4WZ6A 3FYTA 3PV0A 5EZYB 1NU6A 3HBAA 1D3AA 2L42A 4LC9A 3ZV6A 5REQB 3H99A 4Z2YA 1HA3A 2ACKA 2PMEA 3SZOA 2IU3A 4YT2A 3GWZA 4WXRA 3HBJA 1I7LA 5B37A 1P2FA 4TS3A 2XNSA 1L3BA 1NU8A 4X6XA 5EJ7A 4IIDA 1E3WA 4H1WA 1XHLA 3QEAZ 1OXUA 4GI7A 4LJAA 1H8ED 2VDNB 1J97A 3AB3A 3B1WA 4TWJA 1HKHA 2IS4A 2PSJA 5J23A 3LXUX 2F9MA 1NDUA 2NSHA 1Z0DA 1PWEA 4ALJA 3JVIA 3ROGA 2I7XA 2GA8A 1Q12A 2W83A 4OQFA 4CF3A 1TZKA 2PS0A 2Y1LA 2C4VA 3K0CC 2FYTA 3FHLA 3ROXA 3W1VA 1U2GA 4N1AA 2CDBA 3HTXA 3RBVA 4M88A 1TDJA 4DR6B 3AKZA 5FI5A 2VRNA 2NTEA 2QX8A 3Q8WA 3M6LA 4U4AA 4HBZA 1W0JD 2WFLB 4NOJA 4Q1AA 4H7IA 5B6JA 5IT5A 1RLOA 1ETHA 3C43A 2I33A 4BKPA 1M8GA 2P8JA 3REQA 5F3RA 2C95A 2DUNA 3JALB 3Q2IA 4DLSA 4EGJA 4EWLA 1AQ6A 3THYB 2GPBA 1U2DA 2CB0A 2QV0A 2XCLA 3NCHA 3SBDA 1QQ7A 3WMGA 1L4HA 2B1GA 2ZWIA 3EW9A 4O2BB 1D6SA 4Y6QA 5JFGA 4RA6A 2I4TA 4NU6A 4QQ8A 1QWOA 1FMTA 1Q50A 2G4LA 2RHBA 3EEIA 1UFKA 3MWDB 4DEVA 3BT7A 3PYLA 4MAMA 4V0ME 3TSCA 1DQRA 3CUTA 4IIUA 1ZUHA 3PE4A 3QI7A 2JA2A 4J0IA 3PLRA 3OM9A 4J94A 3UWKA 1LDGA 2P2ZA 3C7AA 4XUCA 2IFTA 4CLQA 2P2DA 2X9LA 3W1EA 1NV9A 1RJGA 2JJMA 2JLXA 3UFBA 2DX7A 3PNSA 3HK2A 4TXHA 5K20A 2OPBA 4BUCA 1RBYA 4DGSA 2FMTA 4RDIA 3VOBA 1KJ8A 1A9PA 1LB1B 2CY0A 5CGQB 3OQIB 3IHWA 3CEAA 4EF5A 5I7EA 1QH0A 2JAPA 4DA6A 1K97A 3GIDA 3LW7A 2H5LA 4ES6A 3FNQA 4V0QA 4MCJA 3W5BA 1XWIA 4NAVA 4F12A 1KY3A 5ALIA 1MEJA 4TROA 5JLAA 3PL1A 1H2XA 3I2YX 4MDEA 3CLRD 1V96A 2C4TA 5DM60 4OQLA 4N9QA 3T9DA 3GRYA 2XDWA 4WX2B 3V97A 4AY4A 1RI4A 1V3VA 2I34A 2P9ZA 1PWYE 4TTRA 4GKVA 1OH6A 3U3KA 4WRRA 1FS4A 3VPCA 1X42A 3B2QA 4O59O 1EE2A 4FI3F 4XX1A 3R7WA 2OGUA 5C1OA 2QMYA 4DFDA 4TMFA 4UTNA 3DTNA 3PQVA 4AJ2A 3FDZB 2ORIA 5LP6A 3DZ8A 1NBEA 4F1KA 2IBMA 4PG7A 1BVUA 1NMZA 1DUVG 4ZVSA 2BH9A 1DTWB 4O5AA 4FXPA 4IIJA 1RVV1 3ZCTA 4K9DA 1N5OX 4AJ4A 3G88A 4PHGA 2I65A 5KNCA 2XCRB 3FDIA 1CDEA 4ENWA 2R0QC 2JD0A 2OD9A 1KZ4A 2QK4A 3NHLA 1Q2XA 3KR2A 1QTIA 5IHPA 1RWXA 5F9FA 5C1IA 2JDID 2KMLA 1L8LA 2NVUA 3NBKA 3L18A 1QCCA 1X1AA 4LXUA 1IY1A 3CA8A 4F86A 3DBRA 3COJA 2EP5A 1RCFA 4E4TA 1Q77A 4GW3A 4B47A 5AM0A 3IJEB 3Q7SA 1BFDA 4OU4A 1SVSA 5CMLA 5CU7A 3JD1A 4BEVA 2BOVA 2X14A 2HBYA 3WO0A 1A9SA 1QZUA 4MS1B 3C6YA 4B2LA 5EHXA 3IS3A 1G20A 3B3QA 2I3AA 1IPFA 4AG5A 3LGAA 4XGKA 3RNOA 3DE2X 3ZIDA 4BFLA 4ER0A 5J43A 1EVIA 1H5UA 2W2KA 2WF5A 4URFA 3EEBA 2RH4A 4PS0A 4OJMX 2OORC 2XWSA 3SDSA 4B33A 1XZEA 1VSQA 2F3QA 2OLKA 4MV1A 4NE9A 4RDHA 5JCXA 2V45A 3ZD9A 2FLWA 4UDYX 2FSVC 1ODFA 2YZKA 3NH9A 3D2CA 4R6XA 3TRDA 4EI8A 5A1JA 4GUAA 1GNRA 5DM1A 4OLBA 3M6VA 4HK4A 2F00A 1Y81A 2P6UA 2E5LB 2R7KA 3SD7A 1WD7A 2XBLA 1ZC3A 3O95A 5JYDA 4Q4CA 2W6CX 1XYGA 4ZOQI 1CERA 1DVRA 1KO5A 4FD3A 4CIXA 4M0EA 5MN4A 2LD4A 4U3JA 1E1QD 1ORTA 2CBXA 2GT1A 3G2JA 3MGBA 3ZJ4A 4BB5A 5BWNA 1L8OA 3Q4GA 3FLEA 4RWZA 1SOUA 3S99A 4CCAA 1SCUA 3D6HA 4L28A 4FCVA 2B4AA 5A7FA 1X1DA 2DY1A 1LPBB 4FR0A 3U37A 4D9IA 2JZNA 3KFVA 2VJLA 3TEJA 2UUAB 3QX3A 2VDQB 1PFQA 4FEEA 4FT4A 3V3KA 3GRAA 2HAEA 4NQZA 4DUGD 1UBCA 2VTBB 1T6BY 3EH2A 4JUDX 1UEJA 1M1NB 3H86A 3N8IA 1AKRA 2RHLA 4E70A 4ZKDA 5C80A 5JMTA 1O95C 4YACA 1XKLA 4DQLA 1Q74A 1Z33A 4MQMA 5KYTA 4WCFC 2QROA 4D5EA 3LZ6A 1I7MB 1FL9A 1D4OA 1Y8QB 2LZ0A 4RVSA 1I4WA 4WZBB 2NO0A 1SC9A 3PIDA 2IJGX 2PZAA 2BSAA 3UUEA 2BGJA 3ZX4A 4ZMRA 1A8UA 2IDJA 2ZDHA 5LWQA 1DXQA 1Q44A 1ZGHA 4HH4A 5EMHA 4RTJA 1SXPA 4LWZA 2Z43A 2RMKA 2VWPA 4U2BA 3WGHA 2XGOA 1I7NA 1Y4SA 2XJ4A 1NZJA 1M2GA 5EHGA 3SM3A 1FDTA 5AVYA 2R6GA 5A6VA 1PG0A 2EJBA 3SQOA 1TXGA 2YV5A 2I71A 5FX2A 1EK6A 1AGYA 1QHGA 2C9CA 2ZIAA 5KYXB 3QV1A 1S2NA 4I55B 2ZJAA 1S3IA 1NM5A 5AVQA 1TRHA 1FC0A 4Z53A 3IVGA 3PR3A 4JYCA 3CZMA 3O83A 5DULA 4CDNA 2KWIA 2ZXFA 3VI4B 2F62A 4RENA 4JR2A 1GRNA 2HDHA 4LE2A 3OX2A 5G3YA 1EX1A 2C7RA 1WB9A 5C51B 1FFCA 2QXTA 2AUMA 4L2IA 4MP8A 2RJ3A 3QYFA 3RRYA 2QPTA 3BTSA 1TU0A 3ZNNA 3WV4A 3EUWA 2QS9A 3JWIA 4O1MA 4MVJA 4YJGB 3PNLA 4PG8A 1AXEA 4ZV4A 4DV0B 5AD1A 5DM70 2PV0A 4CQMD 5BN3B 5FAKA 3QU4A 4F3YA 1ZM3A 5TJ9A 3FNRA 2OILA 4WY5A 4Q3AA 3JQCA 1OLUB 2NU7B 3LXMA 4E32A 2GH1A 3F4KA 3VNVA 1S5PA 1RXIA 1QJ4A 3DBIA 1IK4A 4ZALA 2ASEA 1SUDA 5TQ0A 4OLHA 3VR0A 1KK1A 4I5EA 4BCDA 4XW2A 4QGSA 1QHFA 1M33A 1V5WA 1PHRA 1NF2A 5AXAA 2HXSA 1NUSA 4BNZA 3HCWA 1IEWA 3EYAA 4US0R 1ZH4A 3I23A 2DH6A 3F6PA 1HE5A 2RE8A 3MMSA 1H05A 1GKLA 3CU5A 1NF9A 1O54A 3OC6A 4LDJA 5JYFA 1J9EA 2PR7A 5K0BA 2VXCA 5GONB 2WLTA 4PN7A 4XSVA 4KSBA 2EX4A 4BQSA 5A5GA 4YMVA 5JYEA 1W88B 3CPEA 2VYNA 3CZPA 3MILA 4NPCA 1YR1A 4F9EA 2XB8A 5LP1A 5THKA 2VYCA 2BONA 3GRKA 1Q1QA 2XGGA 1D7OA 1N6HA 1DDGA 1TQ4A 1WPRA 3TXXA 2P3SA 1VXRA 1JEOA 1CETA 3NYIA 5K3EA 1M6NA 1P5FA 2F1RA 4RVFA 1NJGA 5EIAA 5MFZA 1PV4A 3OLZA 3MS7A 4JLJA 4BLQA 5KYUA 1VB5A 2FK7A 4IX1A 5JO0A 1WS6A 1XALA 3RAPR 5HFAA 3SEQA 2QRMA 4G0PA 1OB2A 1E77A 5G0VA 4KE6A 4QYIB 4MHSA 1J8MF 1KYXA 2I2DA 3N75A 2AMYA 3OUTA 1KEZA 5SYAA 3RU3A 1U1EA 2JKZA 2W22A 1AQYA 3A3KA 2X0IA 5FPKA 1PFKA 4QRHA 2SKDA 3ZJ5A 1LK5A 1ZBQA 3GBVA 4K6OA 4NBKA 4TYWA 1DC7A 1OA1A 1OHHA 5HKKD 3O4VA 5J2TB 4X0EA 3IE2A 1T4BA 1DEKA 1QVVA 3QKSA 2DSTA 4G6ZA 3BMCA 4NDZA 1OASA 4OYHA 1L1QA 4Y2JA 1RTKA 2UDPA 1PFWA 3UTDA 2XSZD 3QBDA 3TW6A 1PLJA 1UAGA 3PNMA 3PFGA 5LQJA 2ZI3A 3FUVA 3NBAA 2ODEA 4MEJA 4NARA 4Q9LA 5EP4A 5HF9A 3WB2A 4D02A 3VH1A 4UNRA 5CEEA 3ZDZB 4J16A 4B82A 3TFQA 2ZW9A 1I2DA 1JDPA 1GCAA 2FB9A 4K9RA 2J59A 1XROA 3DCIA 3ABZA 2YOFA 2PGDA 4IVQA 2V5UA 3RYTC 2PS3A 1L1RA 3EDYA 4ENRA 5LWHA 3MGCA 4PTYA 1H42A 3VDRA 2QRHA 2XI4A 3K2IA 3ML1A 4RDXA 4HNTA 2CC2A 2R2GA 1Y7PA 3BHMA 3P5SA 2IUYA 1F8YA 2WD7A 5EKTA 3ZE8A 1ZITA 5B4VA 1Z0JA 2W98A 4WCVA 4GMDA 2YMPA 5GVSA 2D0DA 4DNPA 2D62A 4V0RA 3RVKA 5DCUA 4DIDA 4J0QA 4DCPA 4HAIA 1P9NA 4PWYA 2GBFA 2SECE 1L9KA 4FGZA 1K8QA 4PW0A 5T7BA 2X40A 3F7MA 4FFMA 1CUIA 1JJ7A 2ZUWA 4RE6A 2PX3A 4RORA 4Y8VA 5TQ2B 3PPXA 4BJ6A 3ZJXA 3CPHA 4AN0A 2JFNA 3EBOA 4HDCA 3DT9A 4KXVA 4UU7A 3OHPA 2XRMA 1J09A 1ZICA 1E89A 1YH3A 1YQTA 1Z12A 2IIQA 4HXGA 4JUCA 4KRGA 5CTJA 2H29A 4DNOA 4EHBA 4ZYXA 5LPNA 3ZY6A 2GR9A 3U1TA 2K7FA 2EWVA 3V4LA 2EW8A 3A4MA 3O73A 1UODA 3GT0A 4L3OA 1KOFA 4RQUA 4RTSA 2QQEA 1XD2B 4RD1A 4CQMB 3PSAA 4CJXA 4OA5A 3BGVA 1ZM2A 5JBNA 1CRZA 1T6ZA 2D4HA 3GLHB 1S0UA 1JBQA 2GJ8A 2QM0A 4W8HA 1TIBA 3IMFA 3WMXA 4BEWA 3F2VA 3QOXA 2O50A 3N8HA 4BVEA 5ALPA 1YQDA 3OE7D 3H11A 3CF6R 2C9BA 1CS0B 2OP0A 3I12A 4OHVA 1M0TA 2R97A 1ZVMA 4F93B 3QU2A 3IQWA 2LUOA 3WOHA 4MGKR 1ML4A 4EZBA 1AURA 4OQEA 1ZZEA 3AI7A 3U7EB 4XPZA 2G82A 2HRCA 3AEKA 3EZFA 4REOA 2XXAA 2FPOA 4B3XA 5JXIA 2A9PA 1JPJA 1TIPA 4S24A 4TYQA 1RU3A 1CDZA 2BM8A 1EE1A 2H1LA 3EFOB 4GM4A 5AOVA 1T9AA 3SCZA 3WDSA 4DJJA 2QMOA 2COEA 3Q8XB 1P0PA 1FYXA 4WOBA 4PAMA 3GB9A 5EZ6B 3W8DA 2JKYA 3GRPA 4B73A 3OEYA 5KSYA 5JAUA 1XKXA 4FFRA 4LMPA 2FP4A 1OPXA 3MJHA 1GU7A 5AKLA 1UWKA 3CX6A 2DKOA 4PFSA 4OXNA 4YX9A 1H85A 2FW6A 3TQFA 1CRPA 2CUTA 2HO5A 3LLVA 2Q49A 4GWLA 2OFFA 1QGED 3EXEB 4ZCMA 3K72B 2GVZC 2WIGA 1O96B 4MQ4A 1U9IA 3IEMA 4B8WA 1Q6ZA 1TM4E 3AHHA 4K5QA 4D80A 2Q5LA 3HP7A 3BUSA 3VC1A 4TV9F 4RK1A 2C4NA 3K0EA 3OD5A 1QHXA 3EIHA 4L4RA 3LTEA 3U7QA 2A9KA 3L1IA 4TM7A 2OAQ1 4WOKA 4FFNA 3L1KA 2WWVD 1MABB 2QJRA 4LE1A 4D6YA 4PFKA 4CF6A 3HCEA 4R83A 3ZLBA 3TX6A 2XOKA 3S2IA 1HFEL 1JXAA 4Q66C 1H8HD 2ONZA 4BDSA 3EP7B 2Q5EA 3VKFA 4OHPA 5JDIA 3U4QB 1KMMA 3ACCA 1IONA 3FGPA 2VTKA 3I9KA 1P8JA 2JS7A 4YJ2F 2C78A 2BDUA 3JWEA 3L5OA 3DZDA 3VVBA 5B53A 3IAEA 3C39A 3H18A 4P1ZA 1DO0A 5J59A 2VRBA 2ZJZA 4RS3A 5TS2A 5E95A 1F6BA 4ETIA 2BE7A 2JEYA 1W94A 3A4TA 1VYVA 3GYBA 3WXMA 5L9AA 2W2PA 1PUJA 4N4AA 5CEFA 4CM7A 1GG2A 3KCNA 2XMSA 4IF6A 3TZQA 4ZI7F 1QPBA 2OC4A 1LH0A 2ZVPX 5MDHA 4ILEA 2PUBA 4CM5A 1C9DB 2LTAA 1YOBA 2Q62A 2JCVA 3EGXB 3MWYW 4HB4A 2J5KA 4LZWA 1X1SA 3VO2A 1RRFA 2I6FA 1ZI9A 1H4QA 5LBIA 4FOTA 1AVTA 2XUFA 2BFWA 1PJ3A 5FO1A 1DEOA 5LQUA 2R8OA 1PGOA 1LDYA 2PK3A 2VN8A 3WGVA 1EPUA 4YRIA 1TW3A 5KQLA 2WAXA 1W44A 2KLHA 1VSUA 1Y9ZA 2WPDD 2RG1A 3H5RA 1NQWA 3HRKA 2NW6A 5KQRA 4GOLD 1X7XB 4L51A 3EAQA 1V6SA 3NV7A 3FW1A 2C98A 4CKEB 2Z08A 3MWGA 4LRYA 5CW2A 3STYA 1SCDA 1C81A 5K8UA 1GZVA 1YRYE 4G07A 2WYWA 4R8MA 4Q34A 4Y2XA 4KL8S 3EVTA 2F6RA 4LJ7A 2EYUA 2LKDA 2YOGA 4GKBA 4GX5A 3CNNA 1XZBA 4DSOA 3CT6A 5EWJB 4GZLA 3ROPA 5JLJA 1NTRA 1KMQA 1KYQA 2GK6A 2HF2A 4UZEA 3DBVO 2Q28A 4EDHA 4H4DA 4YRQA 4RD2A 3WSWA 2ZWMA 4M1QA 2FETA 2H2HA 2Z9C