4F3YA

X-ray crystal structure of dihydrodipicolinate reductase from burkholderia thailandensis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLGKQTGVALTDDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVFSANMSVGVNVTMKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGRDAGFFDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 79
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4f3yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f3yA01
3RFTA 1C3VA 1X15A 4JBIA 4NPCA 1OZAA 1I2CA 1LA2A 2PKQO 1F06A 1GU7A 1VM6A 3LLVA 4NBRA 1PX0A 2EW8A 3RUIA 2ZB8A 5GZ6A 2V6GA 2NADA 5KNLA 5IXSA 2GD1O 1E7MA 3QJ5A 4DREA 1UP4A 3HE3A 2X7HA 4QFCA 1VJ1A 2ZK7A 3WQSB 4PG8A 1PEDA 1SEPA 4HFMA 3PTZA 1HDOA 4HY3A 4XQ9A 3D4OA 4IDCA 4JBGA 4ALNA 3QVXA 4HFRA 3W8DA 5HTOA 1QV7A 2HUNA 3L07A 2DUWA 2FOIA 4AL4A 2O4UX 3CUKA 2XXJA 2GASA 3H5RA 3W8EA 3NJ8A 3AY6A 3FHLA 2PGDA 1EDZA 4BV9A 3IUSA 5C7LO 4I9NA 1YXMA 4IS3A 3ZWMA 5BT9A 4J9UE 1U2DA 2VHYA 1Q7BA 1ISFA 4O6VA 4PG4A 1ADGA 1C0LA 4DIFA 4RJTA 1XG5A 3HG7A 3PLRA 2B37A 4B7UA 3CMMA 5L40A 5EESA 3RJ9A 2QHXA 2YZ7A 3E48A 4W7IA 4Q3DA 4ROSA 1DRUA 2OHXA 1DLJA 4KDEA 4CLXA 5G0UA 3CPSA 4KUEA 2D3TA 4Y8VA 2O7SA 4CL8A 1KYQA 5KIAA 3JQ9A 3FWNA 4DYDA 4P8RA 4ZQEA 3VZSA 1PQWA 4PRKA 4BO2A 4P4GA 2OORA 4OKIA 4DLAA 2WTBA 5L4LA 2YDXA 1ZMTA 2RH8A 4L73A 4WLEA 4RVFA 3LT0A 1MP0A 2A9FA 3CSDA 5G4KA 5A9SB 4BNKA 5JYDA 1KEVA 1HWYA 3S2EA 1MC5A 3E9NA 1YQGA 3ONEA 3B70A 3HFSA 3NJ4A 3UKOA 4B8ZA 2FY8A 5DBIA 2FSSA 1U5CA 4RVUA 4BO3A 3B1JA 3K31A 3JD1A 1E3WB 3VPGA 3EZLA 4PZEA 3WR5A 5CEJA 4CM6A 3DWFA 5IDYA 4WNIA 4A27A 1LSOA 2QQ5A 1DLIA 1EVJA 1YOVA 2QIOA 4DQVA 1T24A 3ZWNA 2D4AA 4BO8A 2X0JA 4W6ZA 5AXCA 5TT1A 2EP5A 3AOEC 3ZV4A 3E82A 9LDTA 5COQA 1PL8A 2ZYDA 2CD9A 4WE3A 3WS7A 3DC2A 5A9RA 3K96A 3H3JA 1MC4A 5A03A 2W2KA 3F46A 1P3DA 3RROA 4ZD6A 1R66A 4PN3A 4JLWA 3UFXA 3RCBA 1GY8A 4FFRA 4ZQGA 4E5KA 3NDJA 4QUKA 4HADA 2QRJA 5IAAA 1NM5A 1ONNA 1K6XA 2JFHA 4PLTA 3UCFA 5I7VA 4YT5A 3OJ0A 4R16A 4OOFA 1VJ0A 3PYLA 5CHEA 2E6UX 3DONA 4J3FA 2EJVA 2YFQA 3GZNA 1KOLA 4W9NC 1YWGO 2BHLA 2HO5A 1I5RA 1YJ8A 2PFGA 1YOVB 1NFQA 3AUSA 3PWKA 4A73A 1GTMA 4CQMB 1IPEA 3NGXA 3TJRA 5FFFA 3ITKA 1DC6A 4XQCA 4YYZA 3MJEA 3GFGA 2UDPA 4BO0A 2O23A 6LDHA 5G0TA 4U6QA 1FDWA 5A9SA 1Y8QB 3L9WA 3H8VA 4ALLA 4IDFA 1SBYA 2VHWA 3QWHA 1YQXA 3R1IA 4XRRA 5TRTA 3OJLA 3NX4A 2I5PO 3V2HA 3G1UA 3QA9A 1UUFA 1EBUA 5GZ1A 2J3HA 1J0XO 3LVFO 1O89A 3GZNB 4GGPA 2PD4A 2GRAA 2AQKA 5TF4A 5AXDA 1Z7EA 3PHHA 2JFGA 2HLPA 1Z75A 3UXYA 3DAPA 1N92A 3TQHA 4UVGA 3WSVA 4WLVA 2HK8A 4OXYA 1R4MB 4QO7A 1XGKA 2X9NA 4JP3A 5DZSA 3WGQA 3DFZA 2XPCA 4HV4A 2YFHA 1DHRA 1Y5MA 3AU9A 4LMPA 3E1KA 5DOZA 5ICMA 2WD7B 3AW9A 4RZIA 2AA3A 4CR8A 4JGBA 4BQPA 1KVUA 1VPDA 1TI7A 3VOSA 1IZ0A 1HDCA 4JXKA 1ISMA 3F1KA 5A02A 3D3EA 1CQJA 5KOIA 3FNGA 3JQFA 1Z73A 3KYCA 3PWZA 4RDHA 2WEKA 1I24A 2YJZA 4HP8A 4OYRA 2V6FA 4PZCA 3Q6IA 3OIGA 4M86A 5T5QA 1CJCA 4GVLA 4FS3A 3JSAA 1CIVA 2EKLA 3IOYA 2ZCUA 1R6DA 1HE5A 3DZBA 4XDYA 1CF2O 3RC1A 4BS9A 1NWHA 3IMFA 1VC2A 1QXSA 3UUWA 2ZTVA 3GY0A 2DPHA 1PIWA 3QSGA 3RWBA 4DIBA 3F4BA 3RI3A 3NUGA 1K0UA 3H2SA 3PVZA 3S1LA 2VNAA 1HKUA 4MDHA 4BNZA 2C59A 2X23A 5JAMA 5TC4A 5A05A 2PGJA 3DMTC 3WSWA 3LSYA 3JQ7B 5KVVA 5IXYA 3SJUA 4UUNA 1H93A 5JC8A 4G5HA 2J8ZA 1XCBA 5BNIA 1ZIDA 4KOAA 3OMLA 2B4QA 2Y1GA 3S8MA 4CPDA 3K6JA 3NV9A 1WWKA 2VOEA 4QFDA 5G0VA 1HZJA 4CMEC 4EJMA 2JCVA 3JQ8B 2A35A 4CM5A 1DIGA 5CDTA 4MVJP 1Y6JA 4OAQA 1NFRA 1ZK2A 4FJ1A 2FPGA 5U9CA 5DF1A 4CV3A 2AQHA 4G65A 4WUVA 2CY0A 5EIOA 1HE2A 3I52A 4DBVO 2NTJA 3HB5X 3K30A 2B5WA 1GCUA 4B8WA 4C4OA 1NPYA 3QRWA 3CZRA 5HA5A 5K6AC 2EXXA 3FBTA 4DTIA 3H9EO 1D3AA 4YVFA 1SCUA 1NHGA 5ER6A 3QQPA 4PLZA 2RAFA 5KJ1A 3OFSA 3DZIA 1P1JA 4IZHA 1N7HA 1JU9A 3AI1A 3JQBC 4TRRA 1C1XA 4MVJA 1HYGA 3F47A 4U7WA 3CMCO 2H9IA 2EKPA 5ILGA 4QX6A 2EKQA 2PV7A 3G17A 4DGSA 4NIMA 3GUYA 5BR7A 2IZZA 3GNTA 4N5NA 2FP4A 3DR3A 4UVIA 1UXIA 3KETA 3RUDA 4CLHA 1IULA 3D1LA 1TB4A 4BO7A 3EMKA 1T2FA 2UV8A 4IIUA 3EC7A 4W7HA 3TDKA 3LC1O 2R00A 1SZJG 5LDHA 2Y1EA 3JCZA 1KBZA 2NU7A 2ZTUA 1PZHA 4J1TA 3W6UA 2C2YA 4MVJD 3HDYA 3Q1LA 4GMFA 2YQ4A 4RPKA 5B37A 4W4TA 1FK8A 1V3TA 1LLQA 4TQGA 2C2XA 1W8DA 1LSSA 1ULSA 4BOYA 2AE1A 4J6FA 1MA0A 1VKNA 1KETA 2IEBA 1G1AA 3WGGA 4ALKA 4NK5A 1B2LA 1OAAA 4KQWA 1ID1A 2QYSA 3TOXA 3AM4A 3V1YA 2H1SA 5AQ1A 5TLSA 5L7WA 4XIJA 3GNQA 4NU6A 1GQQA 4MPDA 4XGKA 1JLLA 1LLCA 1X7HA 2GR9A 3EHEA 3GH3A 4YPOA 4NI5A 4D44A 4CM4A 1N1EA 2IE0A 2RIRA 1I8TA 3DBRA 4TRMA 1O9BA 1PJCA 2D2IA 3K9QO 4WCDA 1Y8RB 4XYLA 1I30A 1Y5RA 1K6JA 3HFGA 4UULA 1M6HA 1LXCA 1Y8RA 4XYBA 3I83A 3O03A 4K6FA 1ZMOA 5FEUA 4JNKA 4RPHA 5AXBA 4BNJA 1S6YA 5BNFA 3TRIA 3H7AA 4AJKA 2DUUA 1RYDA 2AXQA 2IODA 3UH1A 2J3JA 1AN9A 2GUGA 2BI8A 2NTNA 2HK9A 2Z95A 4AJIA 3NRCA 4O1MA 3TZ6A 1M67A 3FNFA 3WMWA 4FC6A 4XYMA 3UCXA 2WD7A 3EAGA 1O5IA 4D3DA 4D45A 3JYQA 1GYQA 1I36A 3DHYA 3OJFA 1LI4A 2UUOA 1N1GA 2PD6A 5T8KA 3DDNA 1LC0A 4NNJA 1GEGA 3BMOA 3U49A 4WNCA 2FRDA 2DFVA 4PLPA 4TRJA 4MVJH 4DQXA 4IQGA 1W4ZA 2YHIB 1WPQA 5JDIC 5IZCA 1PS9A 5H82A 5A4DA 4YJHA 3MWEB 5HS4A 4WPGA 1DPGA 3JQGA 3KBOA 3ZN2A 1BVUA 2QRKA 1UZMA 1O95A 1X0VA 3EDMA 4NBVA 2EW2A 1TT7A 1P1RA 3GVIA 4I5GA 3DZHA 4FN4A 4UUMA 2DM6A 4XJTA 1NVMB 3DTYA 4PRLA 4BGVA 3GDOA 3H5NA 3MJTA 4FSHA 2VT3A 4I1IA 2HU2A 4B3HA 1CWUA 2Q2VA 3I4FA 3VKVA 4KP7A 3E18A 4GWGA 1UXHA 1JWAB 2O3RA 3KLMX 3W4JA 1N9GA 1F12A 3ZH2A 1ZUD1 1LDYA 1AHIA 3TWOA 3JTMA 3ETGA 3CINA 2BI7A 3K73O 1JVBA 4BUCA 4IUYA 2Q22A 3GGOA 5I9MA 2UAGA 1GDHA 1RM3A 4OXNA 1HRDA 1GEEA 1GUFA 4ALMA 1Q0LA 3O8QA 5F21A 4FIZA 5CDGA 1T4DA 5ER9A 1DSSG 2JAHA 1ONOA 3WIDA 4LVUA 4YACA 1ZKMA 1MX3A 3LU1A 3VTZA 3ITDA 3I6QA 3QVSA 4TZTA 2GZ1A 3I3OA 1H0KA 2P4HX 5L45A 4TMFA 4CMHA 3ONDA 1XLTA 4FJ2A 4A0SA 1P0FA 2X1HA 5IN4A 3MWDB 1M2WA 1PJSA 4DVJA 3JQ6A 4BV8A 3FSRA 5B4TA 4CLDA 3GG2A 2WD8A 4J7XA 2EV9A 2PZKA 2PH3A 3NDIA 4HNHA 2AQIA 4OKNA 1OI7A 1R0KA 1TT5A 1KS9A 1X13A 4XDZA 2HSDA 4XX0A 5C5IA 2PD3A 2GNAA 2IDZA 1JAXA 3ZU5A 4B79A 3SXPA 1YKFA 4GVXA 1E7YA 4QQRA 2W98A 1KVSA 2HCTA 4N5LA 4E33A 1FDVA 2OFPA 1ZEJA 3F3SA 3V5NA 3GEDA 5C7OO 5DCWA 4E5MA 1JDJA 3RIHA 3RU9A 1ZXBA 3PGJA 2Y1DA 1I3KA 3ONFA 4DIOA 4WASA 4CODB 2RH4A 2DTDA 1KC3A 2W4QA 5EN4A 3WGHA 2FR0A 5TT0A 1AXEA 4IQ8A 4M89A 4CL3A 3K2EA 4N7RA 1PGOA 2Y0DA 1PSDA 2FWMX 1VI2A 3EZYA 5C3MA 1GV1A 3B20A 4RCVA 3BMNB 1GAEO 4KTTE 2VRCA 3BMQB 2OMEA 2WWRA 1H2BA 4XD2A 3JQDA 3DBLB 3KVOA 3U0BA 4BKRA 4BNGA 4H15A 5DP1A 2D59A 2Q49A 4MVJM 2HDHA 1QYCA 1NAHA 1DRVA 3ZWWA 4IGFA 4D79A 3AUUA 4Q9NA 4E6PA 1AUPA 1E7RA 1CETA 4LRSB 3ZWCA 1HE3A 1KVQA 3DZJA 3G3EA 4CM4B 1TVEA 4R54A 5T6BA 2JAPA 3ZNQA 4L75A 3OETA 5DT9A 4DLLA 1XIVA 4BB5A 3PZBA 4RVHA 4J4TA 2GO1A 2GGSA 4MKZA 2UUPA 2DC1A 2Z1MA 1H6AA 4B3JA 3P5SA 4Q39A 5JXWA 3NT4A 1YQDA 3FI9A 2Z1NA 3CTMA 2BFPA 4YR9A 1YL6A 1RM4A 1RKXA 2J5RA 4BKQA 5CG1A 4BIIA 1ZXLA 2J5QA 4OMUA 1B14A 4IDDA 2Q1WA 1QP8A 4KWIA 1B8VA 3U4DA 1ENZA 1VKOA 5G4KB 4ZQHA 1R4NA 3EUWA 1P77A 3PRJA 1LSJA 1R4NB 1ZO8A 2YQ5A 3PHJA 4RF2A 5IDQA 3PXXA 3LT4A 3GMSA 4FGWA 5EERA 4PVCA 4II2A 4LK3A 2WE7A 3RUFA 1WP4A 1WDMA 4O59O 1ZVMA 1KEPA 2O3UA 2WJPA 1UXKA 4XCVA 2F00A 2YYYA 2JD0A 2YDYA 3VZPA 1A5ZA 1C1DA 4R3NA 3L77A 3P19A 4FFOA 5EPOA 4J43A 2ZQYA 4ND2A 2A94A 5KJCA 4E31A 4NDNE 4MKXA 5EQFA 1V8BA 3DBLA 4Z0HO 3BZUA 1FJHA 1GZ6A 1GV0A 3ICCA 4CMCA 3OH8A 1GZ4A 3RU7A 4Z0PA 1T25A 1GPJA 4RF3A 1PZEA 2I9PA 1CDOA 1LEHA 1U3WA 4B4VA 3WLFA 2UVDA 4BL5A 5T73A 1ZK3A 1H6DA 2ZCVA 3FNHA 3ZV3A 3ADOA 2O3JA 3ZV5A 4IY1A 3EVTA 3WGOA 3FTPA 7MDHA 4JROA 2BLLA 4MINA 4BO5A 4I9UA 3OP4A 3T4EA 2G17A 3QY9A 1VJTA 4FFNA 4XJSA 4R69A 4ND3A 1E1KA 2CUKA 4XGIA 2R2GA 3OJOA 3P7MA 4J1SA 3TFOA 2GN9A 3A1NA 3F5QA 4ZVVA 3DO5A 1V3VA 3D3WA 3TNLA 4WECA 1EMDA 4J2HA 4N54A 4BNHA 4OSOA 1RYEA 1GUYA 2Q1UA 4R5HA 1HTBA 1SNYA 3C7DB 3PFFA 4R1TA 3Q0EA 1Q1NA 3D4NA 3RVDA 2O2YA 1UP7A 3HSKA 3GN2A 4D46A 3V1TC 3AY7A 3BIOA 4HKTA 4RV9A 2GCGA 1SOVA 3T7EA 4PG6A 4KUHA 1I2ZA 3ETEA 5ITWA 1I3MA 3V2GA 3CIFA 1RM0A 1B15A 3WXBA 4GMGA 4XQEA 3WWZA 2HMUA 4D41A 3INTA 4NH4A 1I33A 4PLWA 1KVRA 2YY7A 1EVZA 1E3SA 1P1FA 3O26A 1RWBA 4CQMA 1J4AA 1I3LA 5JDCC 3O38A 4EI2A 3WIEA 2FSVA 4CQLA 2PZMA 4DPMA 3DEYX 4DWVA 2DU8A 2X9GA 3PDJA 3SJ7A 2FR8A 3UF0A 3NTQA 3MTJA 1CQIA 1NAIA 3KUXA 3ZWYA 3IAHA 4ALIA 4CLOA 3S2IA 3DFUA 2VZ8A 3M1AA 2AG5A 5JYFA 2FMUA 3GOHA 4OSPA 1ZK0A 3COSA 3NGLA 3U4CA 2JCXA 3G1TA 4BMNA 1XKQA 2EERA 5AYVA 5I8ZA 3ROMA 1E7QA 3JD3A 1R37A 1BWSA 3NT2A 3I23A 1T4BA 4TROA 5CDSA 2Y0EA 4R5MA 1Q0QA 3OEWA 2GYYA 1GUZA 1P45A 4LVCA 1H5QA 3IC5A 3O4RA 1H9AA 1HLDA 3OECA 1P74A 2D1YA 3HB4X 4PLGA 4CM7A 4L74A 1FDSA 5JY1A 1EE9A 4FJ0A 4R41A 4Z9YA 3WJ7A 1LLDA 3ZWPA 7ADHA 5JDCA 2D5AA 1MFPA 4NJMA 1FXSA 3GQVA 4UEJA 1ONPA 4L76A 3ZWAA 2ZB7A 1YRLA 4D43A 3BMOB 4NMHA 4MJLA 3PZRA 2H63A 1PZGA 3TSCA 1P1KA 4UREA 1F0YA 1WMAA 4DQUA 4IDAA 4Y6RA 3OEYA 3TPCA 4ALJA 3RC7A 3DB2A 4UVDA 3WTCA 5TJHA 3GC6A 1WAMA 1R16A 3AFMA 4E5PA 1E6UA 2PTGA 4E2WA 4FPXA 3OIDA 3V1UA 3PJFA 3D7LA 4IMPA 4IM7A 4AJ1A 3ON5A 4QTZA 1E3IA 3BTOA 3F1LA 1NVTA 4YRAA 2FPPA 2CF5A 3GDFA 4ND1A 2Y68A 3FR8A 3L6EA 4AJLA 5CAEA 2VNSA 4HWKA 3SLKA 1XHLA 2WSBA 3AUAA 2NTVA 1BW9B 3KO8A 4LGVA 2P5YA 4IINA 1O94A 1C1XB 1NR1A 5L51A 5JNLA 3GRKA 1YS4A 1LDGA 4BNLA 4EW6A 1XU7A 1ZFNA 3QWIA 5U4QA 1ZH8A 3OIFA 1KEWA 3VTFA 3HDHA 2DBZA 1J49A 1X7DA 3ASVA 1D4FA 2DAPA 3KYBA 4IXWA 4J1NA 4QEDA 4YJGA 3PJGA 1WXDA 4GX2A 5JAIA 1ORRA 1D7OA 4D0RA 1C1DB 3AM3A 1PL7A 4XYGA 2RCYA 2V6BA 1L7DA 2W8ZA 1EVIA 2Y1FA 4H7PA 2HKIA 4F46A 1YL5A 3PI7A 2ILTA 4LRTB 1DFIA 5JFOA 4G2NA 5CFZA 1XELA 3ZGYA 2HMWA 2PKQP 4J90A 1DC5A 2VWPA 3N58A 2BFAA 1N5DA 1OFGA 4M54A 1LC3A 4HXYA 2V65A 1HDYA 4FFPA 4GH5A 4LCJA 4RO0A 4YDRA 2FZWA 1I32A 1DOHA 2DTEA 3ZWOA 3OJEA 1EFKA 1FDUA 2AMFA 4BHTA 2AW5A 3CH6A 4YB8A 3GHYA 3H65A 1XDWA 2R6JA 2QX7A 1P33A 4YTEA 5K9ZA 1ZJYA 3DMTA 3Q9UA 3T7CA 3GPDG 3MJVA 4X54A 3WGTA 4FB5A 3FTNA 4I9HA 1P9LA 3PLNA 2QYTA 1B7GO 1K5HA 3ORFA 3ZHBA 3H5AA 2RHRA 4E2XA 4R1SA 1HDGO 1ISIA 3K2BA 3RKUA 1LRLA 3ROKA 4URFA 2O3TA 3AY3A 1E3LA 2B4RO 4WEQA 4B4UA 2AQ8A 2ZTLA 4B4OA 2ZIZA 3JD2A 3LK7A 1YJQA 1VL0A 3HNPA 1WNTA 4NR0A 5COAA 1LX6A 4DMLA 4QXMA 4EGFA 5B12A 1U3VA 2F1KA 1B8PA 1ISHA 2E4AA 2NWQA 3MJSA 4MKRA 2VRCD 4CMKA 3JD0A 1FF9A 3GPIA 4PCVA 1HDRA 1QMGA 3HDJA 1EZ4A 2VYNA 2EGGA 3HN7A 1B8UA 2ZKLA 3PHGA 4KUGA 2JD1A 5T64A 5TQVA 3D4PA 1PJTA 4IXTA 4DBZA 3BHIA 1U4SA 5U1PA 2C82A 2IXBA 3I9JA 3C7CB 3I9LA 5DBFA 1A4UA 2BH9A 5H81A 5A1TA 2NU6A 5FI3A 1HLPA 3C7AA 3FF4A 3S2FA 1CYDA 2JHGA 2OO5A 4GBJA 1JW9B 3KEQA 2VYND 5BQFA 3QVOA 2G82A 4FFMA 3UN1A 4CM1A 4EEXA 3WB9A 1SOWA 4RVGA 1KERA 5L95A 3NYWA 1Q2XA 3UW3A 3ZDFA 3N74A 3VDQA 1M66A 1A4IA 4YEDA 4RPGA 1GL3A 3PHLA 2VHZA 2Y1OA 4GAEA 3C1OA 4R3WA 5TX7A 4M8SA 3GNSA 1H9BA 4ITUA 5I7SA 2NACA 1B16A 4ND5A 4U8GA 1I0ZA 2PZLA 4Q3CA 3R3SA 2W2LD 2GZ2A 4RDIA 1UDAA 2JL1A 4R1NA 1ENPA 2J6IA 3GAFA 5DULA 1PR3A 1PGNA 3D5TA 4BNWA 2X0IA 4EZBA 1PZFA 3GHHA 4CM9D 1I01A 3GZ4A 4YJFB 4EBFA 3WNVA 5CG2A 3DHNA 1UZNA 1LSUA 2GN6A 3RQSA 4W9NA 4YBZA 3PFWO 5BNTA 3VZQA 4MIYA 1WDLA 3UOGA 1DDOA 3W6ZA 4BO9A 2X9VA 5DBGA 1NQTA 5C7IO 2NUAA 1ENYA 4Z3DA 4CM9A 4E2ZA 4IJVA 2X0NA 2OP1A 1E3WA 4M55A 5ADHA 4AJPA 3HUDA 3UAGA 1R0LA 1NFFA 3INRA 3GF4A 4WLUA 1C14A 1HT0A 3ANNA 1JKJA 2W90A 2W2KB 5B1YA 4TSKA 3WFIA 4CV0A 4F3YA 3C1TA 4YRDA 5M6DA 3KV3O 1NWCA 4E32A 3OQ1A 3W8FA 1SPXA 4LMRA 4FBGA 1U7HA 4E5YA 4PIVA 2OP0A 2PGLA 3AU8A 4NFHA 3E6AA 2E37A 3EVNA 2Z5LA 3DMYA 4U6SA 3SEFA 1Y1PA 4GX1A 1SO8A 1Y8QA 4UUOA 4EITA 1K3TA 1UAYA 4BNYA 2OBNA 1HSZA 4MVJI 1E1NA 8ADHA 3G0OA 4MVJG 1JA9A 4CMBA 1D8AA 1EK5A 3ZNNA 2DPGA 4TVOA 5ITVA 4YXFA 4NFYA 5A5EA 4AFNA 4OIMA 1YBMA 3WBFA 4NU5A 2AEJA 2TMGA 5TNXA 4MVJE 1JQBA 2Q4BA 4E2YA 4OXKA 2PH5A 3LT2A 1U8FO 1BG6A 4LN1A 5JCXA 1QLJA 3WGYA 4YCAA 4I8XA 5THKA 5JMWA 1UZLA 2HK7A 3LQFA 5JBIA 4WGGA 2BGMA 3JQ9C 1WMBA 4L0QA 1DFGA 5L4SA 1HF3A 1Z7BA 1DB3A 2ZATA 1PWXA 3DAGA 4ILKA 4QECA 5EJ2A 1N9GB 5I7EA 4JJIA 2VUUA 4IDGA 2I99A 3IKVA 3OHSX 4YRBA 4ZGWA 1QYVA 1BSVA 1GZ3A 1JVSA 4GLLA 5IZCC 5JDIA 2PZJA 3PHIA 4AJ4A 3PP8A 1TEHA 1EE2A 1QRRA 3ZWVA 3GEMA 5L7YA 1EUZA 1AE1A 1EUDA 3JD4A 5ICSA 5T8KC 3LZ6A 3VH4A 2O4CA 4YQZA 1PJ4A 4P4LA 4RVSA 1QYWA 1PL6A 1IZ9A 1ZK4A 2PK3A 2G76A 3S2GA 4RQTA 1ENOA 3KLPX 2OXIA 4C7JA 1DAPA 3KZVA 5KJ6A 3IP1A 1KY5A 1A7KA 3AM5A 3B6ZA 5I7FA 2BRUA 1NHWA 3Q11A 5JO0A 1IE3A 4IZIA 4P22A 4XZ3A 4HFJA 3LC2O 2VOJA 3U3XA 2Q4EA 1R0SA 4UEOA 4EEZA 2CDCA 2D0IA 3OQBA 1V6AA 3STHA 2EGHA 2LDBA 1JWBB 3IP3A 4M87A 2CVQA 3F6YA 3ZW8A 4HUJA 1VL8A 4XEHA 1PJ2A 2Q45A 3A06A 1BMDA 4MP3A 1F8GA 4CQLB 3H2ZA 5CPFA 4F6CA 3BMQA 3CKYA 3TF5A 3W4IA 5A5FA 4YAKA 4XYEA 5DP2A 2FPIA 2AG8A 5J9GA 2ZQZA 1LDBA 3VVBA 2WDZA 1Z74A 4R9RA 4YWJA 2Q2QA 2HJRA 3I9NA 4RGBA 5HS6A 5L53A 2NVWA 4AG3A 1CEQA 5JCJD 2JD2A 1R15A 1YL7A 3ANLA 4QO8A 4RPLA 5BSEA 3MEQA 3WGZA 5FF9A 1N7GA 1HETA 4WCFB 3E8XA 5HRUA 4OQYA 4FOSA 3U5TA 2I66A 4RVDA 2R00C 4B3IA 3R0IA 3VC7A 3UHAA 3M2TA 1GFSA 1YDEA 2I76A 1N8KA 3F5SA 4XIYA 4Z0TA 1FMCA 3PDUA 5AXAA 2GDZA 3H3FA 4JJFA 4XR9A 3RASA 3GRPA 1NNUA 3FR7A 1MV8A 1RM5A 3UICA 4CV2A 1W6UA 5FI5A 1EVYA 3TOZA 4JP2A 4DA9A 3NEPX 5CDYA 5DDIP 1SMKA 2OZPA 3BYZA 1OC2A 1L1FA 2P9CA 2NM0A 3JQBA 4L4XA 1HE4A 4IGEA 4L9RA 4WCFA 5IJZA 4BGEA 4OM8A 4K28A 2X5JO 3ZV6A 4ZN6A 5TS3A 3QE3A 3KHUA 5ILOA 2VCYA 1YH3A 5K6AA 1B3BA 4YT4A 1P31A 4NZ9A 2CDBA 4E13A 8LDHA 2X0RA 3GGPA 1EDOA 1U8XX 3KOUA 1Y9EA 1IL0A 4NBWA 4UUPA 1QORA 3UVEA 1BXGA 3GVXA 4L8VA 5KCZA 4EUEA 3D3WB 3WLEA 4ZRNA 5IFLA 2FR1A 1BTOA 1ZSVA 1SB8A 1ZJZA 3KM0A 3TFQA 2X5KO 4YT8A 4JX8A 5JY6A 1VSUA 1XYGA 2Q1SA 3S55A 3GVHA 4HBGA 5I9LA 3AFNA 2B36A 4CMEA 1AGNA 2PKRA 4U5QA 4CM3A 5B4UA 2OGUA 1P0CA 4ZICA 5JLAA 4A26A 5I9NA 2CVZA 4O63O 3OQ6A 1NQ5A 1VE9A 2SCUA 4EUFA 1LTHR 4D0SA 3ZI0A 3ROPA 4HX5A 3QV1A 1P44A 2BELA 3AOGA 5L3ZA 3X2FA 4DUPA 5MDHA 4YT2A 3L4SO 4WEOA 1VRWA 3RAJA 1U3UA 2TMDA 1YE3A 5KVCA 3RFVA 2GN8A 2VWGA 4B4WA 4N18A 1Y7TA 4J4HA 3QLJA 3ZZNA 1A9ZA 2DLDA 2GERA 2VWHA 3Q9NA 2HRZA 3INGA 3CZMA 4S3MA 4CMAA 1TLTA 1ULUA 2AE2A 5JC1A 2FHSA 2B4TO 4J4BA 3K8ZA 4UEKA 2J3KA 2GZ3A 1SAYA 2JKVA 4R68A 4Y6SA 1NR7A 4NQZA 1DIHA 2EWMA 4AJEA 3JQAD 3AI2A 5L9AA 1E3JA 3ZU2A 1BXKA 4RLSA 3FPLA 3JYOA 3EY4A 3BAZA 4JJGA 3JQFC 4FGSA 3GUCA 3I9MA 1V0JA 2WMDA 4Z9XA 4TRNA 4NG5A 5ENDA 3IUPA 3GN1A 3C85A 1BXGB 1IHYA 3NAQA 4ONEA 3H9QA 4AJ2A 2A4KA 3ICPA 4ZJUA 1NYTA 1K2WA 4D3FA 3CE6A 1R4MA 1HZZA 4GX0A 3ZHXA 4CM8A 4OO3A 1YGYA 3DBVO 2AEMA 3ADPA 3BTUA 4NJOA 4PLFA 2NQTA 4M1QA 2YV3A 1BHSA 1ZK1A 3I4CA 3GT0A 1BVRA 4N5MA 2VHVA 3RBZA 2D5CA 2QZZA 4P38A 4A5OA 4CLOB 2I6TA 2GLXA 3GR6A 3DOJA 1JTVA 3UGKA 3AI3A 4XR4A 3WJAA 5KJEA 4AVYA 4GL4A 3VPXA 1JKFA 1ZCJA 4XB1A 2BGLA 2D8AA 4E12A 3BTVA 1YONA 1HEUA 3RKRA 2CZCA 4WK6A 5AOVA 1PQPA 2CSUA 1VL6A 3HQ4O 4CLRB 1U1IA 5G2OA 3U62A 4TKMA 1E0DA 4MOWA 3L4BA 4OOEA 3E03A 1QR6A 2VUSA 3KRTA 3F9IA 4WLFA 1BDMA 2C29D 3H4VA 3W1VA 4WKGA 1E3EA 1PR9A 1Q7CA 5KJFA 1BXZA 4M49A 2O3QA 2JCYA 2YW9A 1MG5A 1V35A 4O5OA 1P1HA 3LT1A 4XRGA 3DBHA 3GEGA 3L9XA 5EQDA 3DZKA 2X22A 3FN4A 3OSUA 3IJRA 3M1LA 3QWBA 4OQZA 4CMGA 2DT5A 3HJAA 4YAJA 4J9VA 3RUAA 2OL4A 5JAQA 1HYHA 3ENKA 1RJWA 3OBBA 4IJUA 5BSGA 2VRBA 1NP3A 2X58A 3ZHZA 1NXQA 3FNEA 2HRBA 3QIVA 1G0NA 1ZNQO 3RUHA 3DAFA 3MZ0A 1ZSNA 3K92A 4PGFA 2CFCA 4ID9A 3WICA 2G1UA 1IYZA 3KSUA 2X86A 4FOOA 3ST7A 5F1OA 1QLHA 4PVDA 1WDKA 3AOEA 1MB4A 4IDEA 4CR7A 1LDEA 1PJBA 1U28A 3WWYA 1DRWA 1UXJA 4H16A 2VZ9A 1T1RA 2I3GA 2P9GA 1H6CA 3ZU3A 1H94A 2C7VA 4OGWA 2P2SA 3DL2A 1SB9A 3VPHA 1MUUA 4ZQBA 2G0TA 4R4JA 3F4LA 1NPTO 1EK6A 2W2LA 4J91A 5C37A 1E7WA 1O0SA 1T2AA 1V9LA 3BHMA 1I3NA 4KTVE 1LQUA 4R9SA 4QSMA 4CMIB 3C3XA 5L4NA 2FN7A 1J5PA 3PQEA 4ESOA 2PNFA 3Q2KA 2XF8A 1KVTA 3RD5A 4IIVA 1PQUA 4PG5A 2LDXA 2NVUA 2IYOA 3M2PA 2Y67A 3BHJA 2NVUB 4CQMD 1F14A 1O6ZA 3GG9A 4J7UA 1HSOA 1ZW1A 3HZZA 3FD8A 2QRLA 2B5VA 5G4LA 1U4OA 4B7XA 3JQCA 3VZRA 4MIEA 3ABIA 4BNMA 4O0LA 3LF1A 4B7CA 4BNXA 1U3TA 5IF3A 3I5MA 5G0SA 4YAGA 3KYDB 2P91A 1U7TA 1YVEI 3MOGA 1T26A 2Q2WA 4AJOA 3TL3A 3KB6A 2B69A 2V7PA 5DNAA 1E1LA 1TA4A 2C07A 4GX5A 5DCUA 4DC1A 3A9WA 4IQ0A 4PLHA 1CERA 1Y81A 3QWAA 3D5QA 3EGOA 4EJ0A 3BMCA 5F5LA 1ZBQA 3N7UA 4S1VA 4GQAA 5JMPA 1EQUA 5KKCA 2DBVO 2X8LA 2JFFA 4I5EA 4L4RA 1GYRA 4PLCA 4DPLA 4Z6KA 4GKVA 5G0WA 2O2SA 1DIBA 3TN7A 3WDSA 3PQDA 4W99A 1NQAO 1YB4A 5EMHA 4BMSA 3JQEA 4BB6A 4RORA 1MLDA 2VT2A 3QWFA 3QHAA 4BNUA 1I10A 2BMAA 1GCOA 4RL6A 3GK3A 5K0ZA 2WYWA 1UDCA 2V6MA 4IMRA 4Q3NA 5JPIA 2IXAA 2Q3EA 1MXHA 4HNGA 1BGVA 3A28A 3BMCB 3PPIA 4FQ8A 3WYCA 4NFSA 3OA0A 1OBFO 2PR2A 1DC4A 2I3AA 2X5OA 1LRJA 2PLAA 3WYBA 4A10A 4Z9FA 3TZHA 4TVBA 1S7CA 3L6OO 5JCJA 3V8BA 1XA0A 1LQTA 4UVEA 1F17A 1DAOA 2X6TA 4CLEA 1J6UA 1AXGA 1X1EA 5JYAA 3P2YA 3GFBA 3IJPA 1PJ3A 5B4VA 1B26A 2YUTA 2YV2A 1E1MA 1KIFA 5JYEA 4MIOA 1XQ1A 2ZYAA 5A04A 1KY4A 4E3ZA 1QKIA 5I8WA 1A72A 4II3A 3B1KA 3AK4A 3M6IA 3OF2A 1MG0A 2DBRA 3MJ4A 4NBTA 2YHUA 2Y66A 1DXYA 5AVOA 2VTEA 1GD1O 1LLUA 2OUIA 2DKNA 4ZQFA 3U4HA 4BO6A 4C7KA 3Q3CA 1K6IA 4XQGA 1IOLA 4J0EA 2EIHA 3WTBA 1ZSYA 3RJ5A 2DVMA 4NBUA 1ISGA 5CEEA 3MCVA 4J2OA 2YV1A 5TJ9A 3C8MA 3JYNA 2NSDA 4Z3KA 2BKAA 2NU9A 4J0FA 1T2CA 3ASUA 4YJFA 2EEZA 1VLLA 4MP6A 5KVSA 2VWQA 2WYUA 1G0OA 1PJLA 5KWEA 2WM3A 4I08A 1GR0A 2POQX 1QG6A 1KC1A 4IJWA 5FWNA 1UH5A 3QVTA 1PU2A 1WZIA 1VSVA 1PGQA 3AUTA 4GGOA 3ZNPA 5MGBA 2O50A 4OJNA 1D1TA 2O3SA 1H2HA 3H9JA 1YBAA 1GQ2A 3SLGA 4WLOA 1OOEA 2PY6A 4K6CA 4L4SA 3T4XA 3WFJA 4ND4A 3L0DA 5IDXA 2P68A 1YB5A 3VVCA 3IKTA 1PGPA 4K26A 3BTSA 4K9DA 1MFZA 2C5AA 1IHXA 3WQQA 4CMJA 5IDWA 2HJSA 2B83A 5CEFA 1NASA 5TIIA 1D1SA 4YA6A 4PFJA 3JQAB 3UCEA 3WG9A 2B35A 5BSFA 2NNLD 2CMDA 2IYPA 1JAYA 1GADO 2IZ1A 2Y0CA 3U4IA 4PG7A 2ZYGA 3ROQA 1EFLA 3QVWA 2Q1TA 4DRYA 3GVPA 1C0PA 2UYYA 3GLQA 2WYVA 5CPBA 4LCEA 3RUCA 3FPCA 4WOKA 1Y9AA 2VYVD 1YB1A 4AJJA 1Z45A 2Y1CA 1HYEA 3V2UA 1LDNA 2DBQA 2FZEA 4FC7A 4AJNA 4E30A 4XGNA 2E82A 1OC4A 4PZDA 2GPTA 2GN4A 3ETDA 4IDBA 4JN6B 1C0IA 4WJZA 4P4NA 2QG4A 4K1LA 3PYXA 5EINA 5F5NA 2E49A 3IIEA 5JAZA 2OBYA 1NTOA 5HM8A 4KDFA 2VTDA 5DCYA 1LUAA 4J16A 1GYPA 1B3RA 3SVTA 2J5KA 3NKLA 4J49A 3I9OA 2DQ4A 4MP8A 3GDGA 4ZHSA 1DIRA 1XWFA 3FCOA 3LYLA 3G79A 2QZ9A 1FDTA 3PK0A 4EUHA 4DYVA 3MTGA 4J1QA 3E9QA 5KVQA 2CDAA 3CEAA 2EF1A 3I9KA 5HBRA 4E5NA 3BMNA 3SC4A 2G5CA 3K5PA 3SC6A 4NHEA 4NJMB 1A9YA 1HDZA 4DL9A 2Y05A 2JJYA 3SBOA 5LC1A 2I65A 1XU9A 4U0KA 3LC7O 1EQ2A 3JQAA 1PTJA 1X7GA 3DXFA 1DEHA 1L7EA 3A4VA 3PIIA 3TZKA 3AJRA 3EYWA 1JN0A 1Q7GA 3FWZA 3BA1A 4ZA2A 4BKUA 1DFHA 3NDRA 3PJEA 4KWHA 2I67A 1ISJA 4IPTA 4E0BA 3JYLA 2GF2A 5JS6A 4FFLA 3VDRA 2VHXA 3KYCB 4DC0A 1M6WA 1QYXA 2Q50A 4LISA 4RF5A 4A03A 1U5AA 3LF2A 3I1JA 4R51A 1DJQA 3ZU4A 1PS8A 4FR5A 4IJKA 3VPFA 1PGJA 4MVJF 4GWKA 4BNNA 4JBHA 3RFXA 4CM8B 5CP8A 1E77A 2WE8A 1DO8A 3PEFA 4Y98A 2BGKA 2XAAA 3GA0A 3WMXA 5TGDA 3D0OA 2QW8A 2EP7A 1IPFA 2ZJ0A 3RC9A 1OMOA 2H6EA 2O7QA 4BMVA 5EL0A 4LSMA 2E48A 2X4GA 2ZTMA 3H9UA 2NV6A 4Y67A 1UR5A 4INAA 4TKLA 5F1PA 1F8FA 1HL3A 1UXGA 4CR6A 5LCXA 2VN8A 1U2GA 5BSHA 2Y99A 3KSZO 2J3IA 1XQ6A 4ZU3A 5DN9A 4DMMA 2BF7A 3LLSA 3AWDA 4U0JA 2IZ0A 3ULKA 4CLRA 1XSEA 3P2OA 3R6DA 5T57A 4RQUA 3Q2IA 4RLHA 3JQ7A 2CNBA 4Q3BA 5F3RA 1MGOA 4Y9DA 5T67A 3WX0A 3DOCA 3PYMA 1E92A 1LNQA 3EW7A 4EDFA 4I5DA 4H3VA 3DBHB 1JKIA 3TZQA 4DPKA 2VUTA 3CXRA 2C20A 2VQ3A 3DZGA 3MOIA 2JHFA 3OM9A 3O9ZA 5FYDA 3ZNOA 1NVGA 4TWRA 1YO6A 3KTDA 2IRWA 1ARZA 3ZWXA 1M75A 2EHDA 3FBGA 1PS0A 3IQDB 5GZ3A 3VH3A 1E6WA 5KTKA 4A7PA 3PWSA 2Q46A 2XOXA 1ADBA 5JW6A 1Z6ZA 2NVBA 3L4BC 3RUEA 2HMTA 2IEDA 1X0XA 1LJ8A 1T2EA 4NK4A 4A2CA 5DOVA 1T1SA 3HHPA 1IY8A 3GMDA 4J7CA 5COBA 5L7TA 1NX6A 4IBOA 3FRJA 4QT0A 2C0CA 4DXHA 3DZFA 4BO1A 3D64A 4WLNA 5GY7A 4JK3A 3IDSA 1Z82A 1TXGA 4GSLA 2P4QA 4E21A 1LU9A 3QW2A 3SX2A 3EK2A 1W0CA 2YHIA 4OHUA 4JCOA 3ZCXA 5LDGA 4Q3AA 3JYPA 4YJGB 1DIAA 4GKBA 3H6KA 3RBXA 9LDBA 1RPNA 3GVCA 4JIGA 4W82A 3C24A 1ML3A 1UAGA 4GSKA 2BFOA 3E9MA 3IL2A 4XWYA 4G81A 2CVOA 3U9LA 4RF4A 1BW9A 1UJMA 3ENNA 4YQYA 4BNFA 3GAZA 4R1UA 3PJDA 4RPJA 4BNVA 5H83A 3NTOA 2C54A 4XKJA 1AHHA 1MXFA 2Y93A 3E5MA 3LDHA 3R3JA 1WW8A 2NQ8A 2RHCA 3DQPA 1ZZEA 3DOOA 3DTTA 3VH2A 1U9JA 1R12A 1I2BA 2HQ1A 3VKUA 2CF6A 3JQGB 3KEOA 2GSDA 2NU8A 2VYVA 4Y6PA 4KZPA 1HDXA 4EJ6A 4BKOA 1H6BA 2DFDA 4ZRMA 3DBRB 2P9EA 3PGXA 3PIDA 3OICA 5J23A 4BNTA 3HWRA 1LDMA 4E4YA 3PQFA 4BO4A 5IZ4A 1B0AA 2C7GA 4FCCA 2HMVA 1QSGA 3RC2A 4CJXA 3W4KA 3RSHA 2O48X 2EG9A 1T2DA 2HMSA 3C1AA 5GMOA 6ADHA 1A27A 1QV6A 1G6KA 2ET6A 1YBVA 4MO2A 2BFMA 3TL2A 1BRMA 5CDUA 5JSFA 3GGGA 1DC3A 2A92A 4OH1A 5THQA 4BGUA 4BKPA 4DLBA 3HADA 3MJCA 1A7AA 3KXDA 1E5LA 4BNIA 3X2EA 3OA2A 4FW8A 4Q3EA 4KMSA 1KEUA 4YJHB 5ES3A 3HN2A 4YAEA 4LSWA 3U09A 1IB6A 3QP9A 3JQ8A 4CUJA 4GPD1 1PWZA 1UP6A 2OOSA 5JO9A 3DHEA 1BDBA 4XA8A 3G49A 4CUZA 1XEAA 2PWZA 3I6IA 3WQRA 4F45A 4R01A 1DBVO 1DHTA 1LRKA 2RBEA 4GLOA 4F6LA 1HXHA 1ZEMA 3VPSA 2ZB4A 3WYEA 3ZWBA 3IS3A 1M76A 3A14A 4GI2A 5A3JA 1QYDA 3RBVA 2EJWA 1NPDA 2PA3A 1E5QA 3L6DA 1NQOA 1DJNA 3NT5A 1P1IA 1SEVA 4RZHA 3TZCA 2VZ0A 4PLYA 4TZKA 4CUKA 4D3SA 1ADCA 4YJDA 3WNQA 5A06A 4D42A 4CMIA 2NLOA 4WCFC 1EEHA 1WZEA 5F1KA 2Q99A 5KKAA 1C0KA 1PJQA 4CV1A 1E7SA 2B0JA 1V3UA 4D7AA 5IG2A 5A9TA 1SC6A 1XR3A 4XB2A 1W73A 3KYDA 3H9GA 5ENVA 1X1TA 4OL9A 1IUKA 1UDBA 2AHRA 5JE8A 3WBBA 2C5EA 4WOJA 3ZW9A 1LBEA 1WLYA 4LW8A 1N2SA 1WVGA 3VHRA 1A71A 4AJHA 1EUCA 2ZB3A 1NBOA 3WGIA 4HFNA 3ZHYA 3VH1A 2P5UA 1GPDG 1GQYA 5HWSA 1O8CA 2AEFA 3KSDO 4FD3A 2H5LA 4BVAA 3E5RA 3JV7A 1Q0HA 3VAZA 3HDQA 1EBFA 3NTRA 4UAGA 3BXXA 5IN5A 4FDAA 2BD0A 1E6EA 5A3VA 4UVHA 4EYEA 2ZJ1A 4PLVA 4KQXA 1K89A 3O8QB 1CRWG 2DTXA 5TSDA 1ADFA 4BGIA 2HAEA 4YAIA 2XXBA 1X14A 1YDWA 4JQCA 4BQRA 4I5FA 3B1FA 4IS2A 4AICA 3WOHA 3ANMA 1TT5B
chains in the Genus database with same CATH superfamily
2W2MA 4F4JA 2Q6LA 1X15A 1WTAA 5AHXA 5H80A 5JQGB 4C3UA 2GRJA 3SYMA 5BSUA 5A2QA 2B61A 2NO9A 3IDZA 3ND5A 4RXUA 2YY6A 3UOWA 4TV9A 4EVSA 1TVKA 3CPEA 1GU7A 4G85A 5JVDB 3LLVA 2EW8A 1SVMA 3NC4A 5GZ6A 2NADA 1TM3E 5KNLA 4LE1A 2RONA 5EQJB 1IPHA 3H04A 1Z4LA 4BLTA 3DE3X 3GYGA 1SBCA 4D8YA 1ZH4A 1HI9A 1OXXK 1NTRA 4EO9A 1UP4A 1Z83A 4WOBA 3SDZA 3ZJVA 1NN0A 5ALFA 1AURA 2XQVA 1W4BA 3GEPA 4R8LA 5D1HA 3IJ5A 3ROEA 1JFLA 1NVWQ 4PG8A 1TQ2A 1TQDA 2CHVA 3PQ7A 2WJ6A 4UZFA 3ROGA 3V1LA 1DQSA 4G4GA 1V1JA 4IJMA 3BGOS 4FDUA 4IDCA 3RRXA 2H51A 4B6PA 5EEGA 5HTOA 1AHNA 3L07A 4JODA 1NRIA 2OUKA 2I55A 2O4UX 2FJPA 5ELXA 1YB2A 1CUBA 3E8MA 3H05A 4RL4A 3SICE 2P8JA 3ET5A 3FM9A 4CKWB 3H5RA 4UUAA 5C8XA 3OOSA 3W9SA 3FHLA 2V6IA 1XZBA 3DXXA 3R0XA 1N0VC 3DWGA 4PPFA 4PS0A 3DVQX 5AD1A 1ZRMA 1PR4A 4BN0A 4EX7A 3ZOKA 1U2DA 2IHYA 1IONA 2ZBGA 1HNZB 3S28A 3HY4A 3BIJA 4A82A 3ZZ0A 1C0LA 2QB5A 3PIRA 4RJTA 1NQUA 2VC2B 4B7UA 2PTHA 4Y1RA 4AIIA 5EESA 1PUXA 3RJ9A 2QHXA 2YZ7A 4F6RA 1Q3KA 1QHIA 1I3CA 4Q3DA 1N3LA 1E6CA 3OD5A 4XE5A 5BQOA 4CN9A 2OV8A 1HTWA 5IKPA 3VOBA 3WK8A 1L1EA 5G0UA 2FWAA 3PC8A 4IL5A 1DWUA 4Y8VA 5JSQA 5E3JA 1PNQA 2H65A 3SVLA 1Q17A 3FWNA 4LJ8A 4ZQEA 5HQ3B 4PRKA 1N2XA 2IU3A 3QSYA 2OORA 2BH2A 2PS9A 4DLAA 4MDEA 5JTUA 3T0FA 5FNZA 3ZTTA 4EMTA 2YDXA 3K4QA 1VE3A 2QW0X 2RH8A 3UKJA 2IHNA 2R47A 3HN6A 3LT0A 4LOIA 3VR6A 4B47A 2CLIB 5CVVA 3PPVA 3DZDA 1TQHA 2FLVA 4HYQA 1HWYA 1CHNA 2ICAA 4PNEA 3S2EA 3U3ZA 5ED4A 3LW8A 3E9NA 3LHIA 2PUFA 3JVIA 1YZHA 2FY8A 2I54A 3G2PA 4QNMA 5DBIA 4K1XA 1UEXC 2IYNA 3M4XA 3P32A 4Q7KA 4UMEA 4BO3A 3FWHA 3JD1A 2WHPB 2QX6A 1YUNA 4BAZA 2R0QC 4R81A 2CV2A 5CEJA 2WR8A 1VMDA 3DWFA 2FETA 1PYGA 1G17A 1ZG3A 3S2UA 1DE0A 3CM0A 5DGXA 1KDVA 4C6HA 3TECE 3LBHA 2Q29A 3KVYA 3VMMA 5JZMA 2QQ5A 3KHSA 1DLIA 1IDOA 1EVJA 1QF9A 1R0XA 1TU3A 2ORVA 2YNMC 3A3NA 3LY8A 1U1GA 1ZI6A 2H7YA 2ZJOA 3OVMA 2D4AA 4NMLA 5KOJA 4BPBA 2KBEA 2Q5IA 2X0JA 5AXCA 2H1OA 4M88A 2JI6A 2Z1DA 3BF7A 2FJ0A 5TT1A 2EP5A 1VKJA 3ESRA 2M2IA 3NZEA 5COQA 1PL8A 2ZYDA 1JDPA 5FWDA 4WE3A 5A9RA 5EIXA 4ARCA 3CB2A 3K96A 3T1OA 1FYXA 4X63A 5FQOA 5BUZA 4GYWA 4WZBA 3UFXA 3OZRA 3RC8A 2WZBA 3HCAA 2BEUA 1N77A 2QRJA 1NVEA 2BFDB 5EQTA 1K6XA 3TX6A 4YP5A 2TS1A 3AILA 4YT5A 5I8PA 4HXEB 3OJ0A 1CR6A 5IASA 1RAEA 4HQFA 2PX4A 3EXHC 1OFUX 2E6UX 2HNKA 2OK8A 1ULHA 2YFQA 4ZEWA 1KOLA 1NLUA 4WV3A 1FJ2A 5TMBA 4Q16A 3T12A 3PWKA 2GO7A 3HPRA 3B38A 1GTMA 3BWXA 3F7NA 3EIEA 3QXCA 4BQEA 3RAGA 4AO6A 4CKWA 4PZAA 1CUYA 1I0IA 3SS7X 1RNLA 5HDBB 2IDJA 2ZAOA 3KFXA 5TARA 5JXIA 3L41A 4RSHA 3GFGA 3T54A 2UDPA 1HT1E 1Y80A 4D8TA 3DEHA 3SBDA 1TUIA 4HC4A 4JC4A 3W2TA 4ZYLA 1G6Q1 2YC4C 3H9CA 2CYAA 2PKEA 1JH9A 1T5SA 2G7ZA 3QUSA 4LJKA 4BQSA 3QA9A 1U7XA 2PUHA 5GZ1A 3IEVA 1JBEA 1SBTA 3I6MA 1TZCA 1P62B 4UTNA 2PD4A 5F9HA 5TF4A 1U7ZA 5TMDA 4ACAA 4KHZA 1Z7EA 1EYZA 3FPGA 1NUTA 1UT6A 3WK9A 1VXOA 3A26A 2GM9A 4YCBA 1YJ5A 3GBVA 3DAPA 1GPBA 3Q72A 4RTSA 2P6NA 1S96A 3TQHA 2ZR0A 1OXKB 3CVJA 3KKQA 1K3UB 1QTIA 2CNWA 3M34A 4TXHA 4DCTA 1JEDA 3RPEA 3MWGA 3WSVA 3QJGA 2HK8A 4OXYA 4GC5A 1THZA 2GBFA 2NAFA 2VG8A 4CKCB 1NYQA 2X9NA 3FPAA 3C39A 3DF7A 3WGQA 3JR3A 4ENRA 1JIUA 3VR3D 3B9QA 3LX8A 1DHRA 1C7JA 1GU1A 1Y5MA 4KN8A 1CW2B 1K92A 2EC5A 1H2EA 3AW9A 3A3PA 3JSXA 4H1WA 2G5GX 1Y1LA 2J45A 3EIOA 2IBMA 1IZ0A 1YU9A 1J5EB 1ISMA 1GR1A 5GJBA 5A02A 3TSAA 4Z54A 1CY0A 3D3EA 5BSVA 1Z13A 3FNGA 4K86A 3FMFA 2H06A 3I2HA 1VE7A 1Z73A 3JQFA 3KYCA 4QULA 4RDHA 5JEDA 1VHWA 2AFRA 2WEKA 2BE7A 4ZVSA 1I24A 4OYRA 1FYVA 4HP8A 1ELOA 5HF5A 2ACWA 2V6FA 4H6VA 1YJCA 3OBIA 5CDFE 2J0SA 3JSAA 4IHJF 3TIFA 2IPNA 3CS3A 1KK2A 3PHCA 2HNBA 4XDYA 4IZ6A 1Q7RA 2B94A 3IMFA 4JKOA 1VHQA 1KZ1A 4NKRA 1U2EA 4HQ6A 3O2QB 3V1MA 2ERXA 4OLJA 4UM7A 1BX3A 3IIKA 3KPVA 3QSGA 4HNQA 1KTIA 2QJRA 2FZKA 2OC4A 1L0BA 3IALA 3BGSA 4NMWA 1M6YA 5EFOA 1K0UA 2WG0A 5HUQA 3PVZA 4HS4A 1TF7A 1HKUA 3GLHB 1QIKA 2C59A 2MSLA 3CWZA 3OQPA 1B2RA 3UK7A 5AW4A 4UJ3A 4WKPA 3VQTA 3K70D 1NVAA 5A05A 4QYIB 4S1NA 2HQRA 5K7SA 4ZOAA 2OESA 3GGJA 1ZONA 3RRNA 4MQFB 3QPWA 4L4YA 1QIMA 2XNCA 2VA9A 1XDBA 3WO1A 3WGVA 3W1EA 2ZLBA 1N0WA 4UMFA 3K8YA 1KNXA 2FPIB 1H93A 1GGMA 2J8ZA 3KR9A 4MQUA 4RHEA 4HD8A 1XPRA 3NWEA 3IHLA 5C5EA 5AVUA 1U0RA 2VXYA 1WXEA 1RYZA 3KU4A 1IM2A 4KIFA 3NV9A 1WWKA 4M0DA 1RSZA 4QFDA 4CMEC 2R97A 4EJMA 2JCVA 5HW0A 1DX9A 3JQ8B 2A35A 1GSOA 2ZRNA 3OCVA 1FY2A 4LJ9A 3M5CA 4KQ1A 4MV4A 3SYNA 4CVNA 1X1AA 1O58A 1BFUA 1DIGA 2OY0A 3VYVA 1G66A 2BHSA 1PWHA 2F9LA 3N86A 4P5EA 5CDTA 4H4CA 4YDQA 3EZXA 3NFRA 3ODGA 3C8ZA 4X1IB 5AR1A 4N47A 4BFTA 1Y6JA 2C2KA 2OXTA 3RRZA 1ZK2A 2CE2X 3NO4A 4YJ2B 1OYVA 2AQHA 1BIFA 3ABOB 2CY0A 5EIOA 2BR5A 4LWQA 4WUVA 1HE2A 1W5TA 2BTEA 1AUOA 4DBVO 4NG4A 5CH3A 5K8IA 2NTJA 5AW8A 1SUAA 3VPCA 3VR4H 3X1ZA 1FDOA 3D5EA 3F96A 2O05A 3WLSA 1WZUA 5EJ8A 1G4HA 4QNRA 5J5VA 4C4OA 2RGRA 2IS4A 2PCLA 2L0XA 3CUTA 1O97D 3NEAA 5HA5A 3TD9A 2EXXA 1DBWA 1CY1A 2C95A 1Q84A 2NTYC 3S40A 4YVFA 4YYEA 1Q1AA 4FKMA 2QN7A 3DZIA 1UWCA 1CVIA 1P1JA 1JU9A 3WZMA 4HDSB 1JT9A 3Q3JB 1E64A 3UYLA 1H22A 4HYTA 1J25A 4DKJA 2P30A 5K0EA 1SN7A 2WWYA 3OESA 3N07A 3IEPA 5ILGA 1JI3A 1Q92A 2RJOA 1YHYA 3CPJB 3E7DA 1QM5A 3ROZA 3SHQA 3ZDAA 1XDUA 1TIPA 4J0IA 1KP3A 2PV7A 4IR7A 4I3HA 3ZHCA 3E3OA 3H16A 3B82A 3NHFA 1JHOA 4YJKA 3DR3A 2H4XA 5AKGA 3EF0A 3RUDA 1IULA 4K40A 2RJNA 1ZIYA 4MRMB 1KY2A 4O8CA 4ETNA 3R9WA 2VK1A 2IYYA 1EDDA 3PHBE 1NC3A 2BVNA 2Y2VA 3A4YA 3OE4A 3I05A 3LC1O 4ZI2A 1SZJG 2FK8A 2Y1EA 4IIDA 3J81k 1QGED 3NS7A 2DHQA 3C3KA 4FONA 3HL4A 1PZHA 5GWXA 3GUUA 3KD2A 2WAXA 1CJMA 1FFAA 2C2YA 4N5DA 4TQ9A 2QYHA 3JAMA 3CRQA 3F8SA 4Z4HA 3Q1LA 4GMFA 1RJEA 3EP6B 5F2KA 4EF5A 3TKYA 2X8BA 4G89A 2PL3A 2BBSA 3ESXA 1LJLA 1LLQA 2Z9CA 5A5DA 3FVRA 5JSHA 4MDFA 3UMCA 1CZNA 2W2XA 1ULSA 3T3DA 4BOYA 5LOVB 1ITZA 2R1VA 1SHTX 3RSZA 4AN0A 3UC5A 3L7AA 1ZH2A 3SX0A 16PKA 5LP6C 2KHZA 1K63A 1XN1A 2ZIUB 3PTLA 2ATXA 5TLSA 6NULA 3RNOA 1II0A 2O06A 4XIJA 4DEYA 1EIWA 3FCYA 3NDBB 4GG1A 1TMYA 3GNQA 3UHJA 3QM1A 1JECA 3IVCA 1T9AA 2ISCA 2IYLD 2XVXA 3A1DA 3C5EA 3HRKA 3ORSA 4DILA 1BMFD 4YPOA 1V5WA 1VJ5A 1MPTA 3FUCA 3R6WA 4TRMA 5KTMA 4KQ2A 2QR2A 2XUGA 3A27A 4L5YA 3N2GA 4GYYA 4RH1A 1SCUB 3V34A 1Y8RB 4I4IA 4GIBA 1Y5RA 1NVKA 4JITA 4EB8A 3Q6MA 3COYA 2XNDD 2NX2A 3O03A 2QMYA 4RZXA 3N3AC 1XJQA 1GUBA 2F3RA 1WVMA 3HABA 1S6YA 4JNKA 4ZAFA 3TRIA 4AJKA 3VJLA 1JFFB 3LMKA 4NJEA 1CQZA 1RYDA 3T0IA 1DJOA 3HBAA 3L1UA 4UE6A 2I8CA 2Z5VA 5EMJA 3B6IA 4PHFA 1NI4A 2Z95A 3VU8A 2HR1A 3NRCA 1UBFA 4GEGA 4INJA 3TZ6A 4IIHA 4QPCA 1JHUA 1W59A 2PS1A 2AEEA 4RM2A 4Z4QA 4GP6A 1MO4A 3W5JA 1OFIA 2XKAA 5EJ5A 1KQFA 2JZNA 1OIXA 5TPZD 3IVAA 3CGWA 3F3YA 3L8DA 4ZZ3A 1RP1A 1BKYA 1CD5A 1E79D 1SD2A 2HM7A 4OGLA 4O3MA 1LI4A 4B3GA 1TAGA 2E85A 2PD6A 3H1TA 2H17A 4POAA 3CZ5A 1CP3A 5BQPA 3U49A 4W5TA 1T9GS 1Z0FA 4R8KA 4PLPA 1QG2A 2KSQA 1AIPA 5ESDA 2VF4X 3UB4A 5HK9A 1SUFA 5IZCA 5CGQB 4BCCA 2PX8A 2XEXA 3PEYA 2VJCA 1L5SA 1I7CB 3FYUB 4B3DA 5BUQA 5H7XA 4DLPA 1DPGA 3U7EB 4O4LB 2CLSA 4AK1A 4MW5A 3ZN2A 5IK2A 2JFVA 4NFLA 3M1IA 1GXSB 2DH5A 1QAQA 1ACMA 3K1YA 4EB6B 3MCZA 1X0VA 1YZYA 4QZVA 1GO2A 1KH1A 1Z88A 1TLFA 5CM9C 1B43A 4KFCA 3PQ3A 2LCFA 3NBKA 3AHGA 4FOTA 2RGCA 1UBUS 2VDPB 3OHPA 3SYLA 4EELA 1R6UA 3GVIA 1IU9A 2ZSAA 3FPSA 3HZRA 1PKEA 1ZNYA 4XJTA 3M6MD 4BGVA 4HB0A 2O1XA 4JEUA 4KO8A 5DM0A 3RU2A 3JWJA 1U8EA 2YWHA 4FI3F 2VDJA 2VT3A 4TWAA 4XAQA 3AFOA 2FGKA 4QU8A 5IT4A 2J32A 4GWGA 2FN9A 3HCFA 1U7DA 4OFWA 5A1JA 4Q15A 5B3JA 3AGPA 2O3RA 1N9GA 3AVWA 3FZQA 3CF4G 3M49A 3V00A 3TWOA 5CH8A 5HF8A 3JTMA 1DCFA 1EG2A 4TTPA 2CLCX 5GOTA 3OU6A 2BI7A 4Z9BA 1XZGA 5AVXA 1AD2A 3PR2B 3QFTA 1CJUC 4IUYA 4WXRA 5I9MA 5LPNA 4QUIA 3WLJA 2QKYA 5DJ5A 1RM3A 5HGXA 1OR8A 3SIXA 2Z6UA 4ALMA 1A95A 3WRVA 4D81A 4U7HA 1NKTA 3AHDA 6GPBA 1DNPA 3D9QX 4Q1VA 2H54A 2WSYB 2Y9MB 3GJ8A 2XYQA 3F67A 3I8SA 3NATA 2VEDA 4P4UA 1RQ7A 2QLNA 1WRBA 1ONOA 2X40A 3K09C 3KDSE 3S70A 4YACA 3WIDA 1ZKMA 3TO5A 1WD5A 4BJ5A 4A0HA 4TL9A 3RVNA 4Q9KA 3UJAA 3EGWA 1F7VA 5EC8A 1XEXA 1ZZGA 2PMBA 4TZTA 2HYDA 3G89A 1Z0AA 3I3OA 1TGVA 5AK0A 1H0KA 5KX5A 5KPJA 2MSKA 3ZK9A 2MJLA 3JASA 2BEUB 1KHHA 1RI2A 3N05A 2PO7A 5A6SB 2BSXA 4K7JA 1P0FA 3LUHA 4L0DA 4N9WA 5KOHB 3G8YA 2XNSA 5EIBC 2PBFA 1JJFA 4BVGA 4BV8A 2LUOA 5B4TA 2FZLA 4LXHA 4F5ZA 3PXUA 2IPAB 3GG2A 4MWSA 4R0NA 5KUTA 3FJOA 4MR8B 3FI0A 3OT4A 2PZKA 3F6PA 4HNHA 2AQIA 5AI5A 3BERA 4CDNA 1GOTA 2PMWB 4QUBA 4XDZA 3S44A 2XR1A 5AJUA 2GKOA 3E53A 5E1DA 2PD3A 2WJHA 2QPOA 1JAXA 1VYVA 1W94A 2Q1XA 3BAFA 5C5CA 2ZBVA 1DEKA 1B0ZA 1YKFA 3I3SR 4QU0A 1GL7A 2G36A 1KAMA 2YQZA 2W98A 5EYPB 2HCTA 3VSBA 1AV7A 4UKDA 3WGMA 1KMCA 4ARIA 2OFPA 1D1QA 1W5SA 1ZEJA 3GEDA 3V5NA 1VIYA 5FBLB 5C7OO 3LOUA 3VUEA 3Q7IA 1JDJA 3RU9A 1ZXBA 3D6FA 4HX2A 1SQ0A 1I3KA 2HFJA 4H4DA 2C04A 2IK8A 3F71A 4WASA 2RH4A 2XLBA 1KC3A 5L3RA 4GPEA 4OQXA 1X77A 3UAXA 4IH9A 2NZ8A 4N7RA 4KRFA 3BGWA 3KFLA 1JG7A 1YBHA 4M21A 1ZM4A 1EK2A 1ST2A 3BMNB 4U2BA 3U7HB 2VRCA 3BMQB 4H1HA 5JH7A 5REQB 5C32A 1EE1A 3L8GA 4DYHA 5J58A 3FAKA 4QDKA 4QOEA 1GM5A 3C15C 2ZDGA 1KEZA 1E3MA 1DAMA 2XZPA 3MELA 1PWYE 3NHUA 2Q49A 5EYPA 1ZD5A 4MVJM 5FLKA 4ZVQA 1EA7A 2XSZA 1DRVA 4G9GA 4IGFA 3BH7A 1B6SA 3E7XA 1JR2A 1V5FA 4NZNA 1U0TA 5AI0A 2XKBA 3TDNA 4E6PA 1AUPA 1TVEA 5T6BA 1WEHA 3FWYA 3OZXA 4HWPA 5FUQA 4DLLA 2GBCA 3K8OE 3N0VA 4BB5A 2GI4A 1MAWA 4LS3A 4RKEA 1SU6A 3MINB 4OU4A 2GGSA 2J41A 1MT0A 2CHQA 3CUEF 1F6DA 3TW6A 2DC1A 1T3ZA 1VIAA 1Y1QA 2AWNA 4V3BA 4B3JA 2CMKA 3OTGA 1JFFA 2B1JA 1Y33E 1QCDA 2W0SA 2PLWA 2W43A 2Z1NA 5D7BA 1JKMA 2Q62A 4DDVA 2GXAA 1F0KA 1ZXLA 4BIIA 1OXTA 1VJRA 3HKCA 2P90A 3KKMA 1RHQA 1LBTA 2ZRHA 3IP8A 4GW3A 3NIWA 4KWIA 1Z08A 4D99A 1B8VA 2D2XA 2REOA 4US2R 5JANA 3EZ6A 1VKOA 5G4KB 5GADl 1O6FA 3OQJA 1RW4A 2IDMA 3PRJA 4KIWA 1CJKC 1R4NB 1RMTA 4W8OA 3HJRA 2P2ZA 1C4XA 2HZ7A 3C3YA 4RF2A 4CL2A 5IDQA 3B36A 2ZI3A 3FZYA 4GI5A 4QARA 3NRJA 3FOFC 2XCUA 1JXMA 2YXDA 3OIUA 1M6NA 4MRPA 4K9NA 2CYCA 2NSLA 4KDRA 2IUFA 3JATB 4EGAA 4HX9A 5HMMA 1JG2A 3IQXA 3RHTA 1L4NA 4L5IA 5H16A 3UKDA 4DV5B 1K27A 1A76A 2OKGA 3MRVA 3GLGA 4WNYA 4JI8B 4XCVA 1KEPA 1Y6QA 2I7TA 4H1VA 4JI3B 2YDYA 3VZPA 1NRXA 3K4PA 2O20A 1UPFA 2P27A 2QUZA 1FSSA 4P7KA 3H0EA 2E0IA 4BLUA 3P19A 4ZOBA 2O0LA 5CURA 3U26A 1KZYC 3F97A 2A94A 2FOLA 1QVVA 4ND2A 4HATA 4NDNE 3HBMA 4EGJA 1D1PA 3E1GA 1V8BA 3BZUA 1M6VA 2G08A 2QR3A 1U9IC 3CH4B 3IWBB 2FDXA 3L7LA 5CB6A 3QU9A 5GONA 3ZXSA 5F78A 5LZ4A 4NARA 1GPNA 4Q9AA 4KIJA 1MRNA 3KAKA 4YRNA 5HIJA 1P19A 1UPAA 2QVXX 1GPJA 2CC2A 3L6RA 4QQ8A 4RF3A 3U37A 5FLXA 1LEHA 1U3WA 1ZIXA 4B4VA 1HUQA 5HVNA 2UVDA 2OHFA 3C6MA 1NN1A 2OV2A 1ZK3A 3ADOA 2IIPA 5E4JA 3OTHA 5I01A 2O3JA 1RI5A 4HR7A 1UKCA 4I8DA 1XVVA 3FTPA 1UEIA 5DNDA 4JROA 4QJIA 3VYUB 3U3DA 5DN6A 3KR0A 3OLCX 3G5UA 3OP4A 2E2WA 3ESQA 4P54A 1PV4A 2WJ4A 3AHCA 2XVZA 3OQNA 1XZJA 3IQFA 1EP2B 3QY9A 1P5JA 2GTIA 4XJSA 4R69A 2K2WA 4XGIA 2R2GA 1KO7A 3FNIA 3I76A 3VJKA 2GKGA 2VTBA 4J1SA 4HQRA 2ACKA 2FW9A 3F5QA 5A62A 4ZVVA 3E84A 4WECA 1EMDA 2B98A 1Z4PX 2L2QA 2YVLA 4EENA 1ZM2A 4OSOA 8ATCA 2FOXA 5F33A 1BCSB 2KYRA 2Z56A 3PFFA 4PPYA 4XTCS 3VISA 3LM8A 4ZAWA 4KR6A 4L95C 3RVDA 2O2YA 1UP7A 1XTUA 3HSKA 3GJXC 4FVTA 4KSBA 4AUNA 2CGEA 2EJBA 4XARA 5FBHA 3AESB 2BZ0A 4RFVA 1FTYA 4HKTA 3X1DA 1NDUA 4TN1A 3CVWA 4IXMA 3MT8A 1C30B 2ZYSA 3T7EA 3BRCA 4H6XA 5A6SA 2EX1A 2BFWA 1HEYA 3L8ZA 2K5UA 4EG7A 5AJVB 2EVWX 3BFKA 2HMUA 2ZUVA 2CUTA 3GFRA 4D41A 4AP9A 1JFRA 2QMOA 1QHFA 3DCYA 4PLWA 5TEWA 1DZ3A 2WJZB 4LPSA 4UNSA 1P1FA 4C30A 4CETA 1KRXA 1NMQA 1RCUA 2CXSA 4M0PA 4NZYA 4UTXA 1RWBA 2WFZA 5HFAA 3TTWA 3WGLA 4CQMA 5CXQA 1GJRA 1QH0A 1OKKD 1KZ4A 2EBUA 3TV1A 4U4AA 3RU3A 3TUJC 3SG0A 4DPMA 5KTOA 2ID9A 3DEYX 5EXTA 2X9GA 4GO1A 4DWVA 1Y1TA 3KCNA 1NSFA 4M36A 1ZUIA 2XQKA 1T6BY 1JLRA 3B3AA 1WB4A 2P1ZA 4YMTA 2OPBA 3MTJA 2ZI6A 2B3DA 4OGFA 3L8HA 1UZAA 1WSBA 4LY3A 4MKFA 4NEQA 4RZ2A 4TL6A 2VHCA 2XMPA 4E3WA 1VLZA 5AESA 3DLBA 3GOHA 2OXCA 3EPJA 2WUVA 3PQ8A 2LBPA 3EZ9A 3IUYA 2G1JA 4KBYA 4MW7A 4TN5A 4BMNA 2XUKA 1XO1A 1JDSA 1M2HA 1FQWA 1OV6A 3DTVB 4CU5A 3N8KA 4L9WA 4DABA 3K9LA 3TR6A 3GIDA 2Y0EA 3L1VA 3R7SA 4R5MA 1RQXA 4QGHA 1V6SA 1IZ7A 5IT9A 4WY8A 2H59A 3OF3A 4HLCA 4LXYA 1OH8A 1ZY2A 1O4VA 3RV3A 3O4RA 1H9AA 1J8QA 3E4DA 3OECA 2D1YA 2VSOA 5LVAA 1JYSA 1EE9A 3GUVA 5E9JA 1HX7A 3AEXA 3EJWA 3MFQA 3HI4A 4TV9F 4S1TA 1EP9A 3LV8A 3IWDB 1C2TA 2ORIA 4DQKA 1SUEA 2ZZKA 3OFJA 5JDCA 2D5AA 2PMFA 5A4JA 5JV5A 2ECOA 1DRKA 3USES 5CFQA 2IELA 5KBYA 4JUIA 4Y2JA 5FA5A 4BE9A 1NDHA 2H0QA 4G1MB 4RVCA 3R7DA 1ONPA 1G38A 4MJXA 2WINI 2R48A 1V45E 1YRLA 1QZZA 4ER5A 2IS6A 1V41E 2W6ZA 1P1KA 3WC4A 4Y6RA 3SYTA 3OEYA 3REOA 3RGWS 1YVUA 4KVAA 4AYTA 4MRSA 3PRKE 1U1CA 5TJHA 3TXYA 3TLGA 3LRPA 1WZCA 4TYQA 4GECA 5IUKC 4E2WA 2CJWB 2E5LB 2E55A 3NW9A 4OPMA 5AOBA 3PJFA 1QQTA 3IBTA 5DU2A 2AV6A 2VLIA 4LJ4A 2CL6X 1U1EA 2EP8A 4B32A 1J0CA 4MUNA 4HVLA 3O8NA 1AF4A 2CB9A 3RT7A 2JGAA 2RGNA 4M4SA 3IESA 1HFJA 2EZUA 2VNSA 1NE2A 2CBGA 3OCYA 2OXRA 2V98A 3SLKA 3HCDA 2C0QA 5DEIA 2OQVA 5FIUA 2NTVA 1BW9B 5CGZA 2CXOA 1KJZA 4MHTA 2FQWA 4P86A 3ZGLA 1RYBA 4DJJA 4LGVA 2FRXA 1DI0A 3WIUA 1O94A 1XPJA 4RHFA 1C1XB 1NR1A 3KLBA 4DW8A 5L51A 1QU2A 3L1HA 2ZIGA 5EZQA 4EW6A 1XU7A 2DECA 2NAPA 2VATA 3DCNA 3QWIA 3ZY3A 4BATA 3NKFA 2ZYUX 1J49A 3KYBA 2GUWA 1MGPA 4IXWA 2DFKB 4Q01A 4RZSA 4TLDA 2EBWA 3PJGA 1E6KA 2MT9A 1ULAA 4G8JA 4D92A 1DGQA 1FSGA 1D7OA 4PZPA 3VV2A 1GQSA 5JCZA 3F49S 3AW8A 2XGSA 4QHSA 4B3CA 1PL7A 4XYGA 5JQGF 5AOCA 4W1QA 5D5HA 4EATA 1V7CA 2CT8A 4I46A 1L7DA 4X3OA 2W8ZA 5TPZA 4OJMX 4RMNA 4F1KA 5DNYB 4H7PA 2XOKD 1IN7A 2HKIA 3ED1A 4DDKA 1UM8A 4GXNA 1XK6A 2R6HA 3E9RA 3E3LA 3PKZA 2IY7A 1Y4DE 4G2NA 1XELA 2PG3A 3ZGYA 4YRGA 4FMCB 5CFZA 1J8FA 1PG0A 4QPNA 2HMWA 2VWPA 2P69A 1N5DA 4Q9LA 5JIBA 5BXYA 4LMBA 4OLBA 4IGAA 2V65A 4QKQA 5IT0A 3QW4B 4EAAA 1RYFA 4RO0A 2DJIA 1KDRA 2X8JB 3BH0A 1TZJA 4U2GA 4YMVA 1L4EA 2RH5A 3NOOA 4CG0A 1N2EA 1T43A 2QTBA 1EFKA 2XB9A 1FDUA 4ZVTA 4FHGA 4Q24A 1EX1A 4BHTA 1UBCA 4F56A 2BKUA 4MPJA 2CUZA 2Z30A 5HHTA 5BYBA 1NW6A 3O95A 3GHYA 4IHJA 4INZA 2IV2X 3E8SA 1OH5A 1XDWA 4XOIA 2P7HA 3OZBA 3GIWA 4DDMA 1Z0KA 1Y5LA 5GM1A 4D9BA 5I9BA 3DMTA 3Q9UA 4Q1DA 1PJZA 2C99A 1G6OA 2HHJA 5JQGA 2P75A 1CZUA 4FB5A 1T4GA 3JRXA 3B2QA 3BIXA 3DDHA 1MRSA 4L8YA 1B7GO 5IC6A 4D97A 2UZ4A 5E2BA 3H5AA 2IUUA 5BR1A 4E2XA 5EMLA 3ROKA 1SHKA 1Z8NA 1E3LA 3C5VA 3W9YA 4WRRA 3AFHA 1QFXA 2IZ7A 2QW1A 4FNOA 4OF4A 2FF5A 3L1IA 5G41A 1V8DA 2ETXA 5LR6A 4AX8A 2VJMB 4B4OA 2PKCA 3IAS6 4L8LA 5DTMA 2PPLA 1YJQA 2OCPA 1N6NA 1UC8A 1Z39A 2FFHA 2GNOA 3NBAA 5COAA 3MWJA 4DC9A 2WMYA 1IOVA 1Z6QA 2OCAA 2CCKA 1SBHA 2F4NA 1MNAA 2E4AA 2NWQA 2QZJA 3ADKA 3ADCA 5IHPA 3O74A 3TUTA 3DE6X 1YJBA 3JD0A 3CVYA 3E3AA 2AX4A 3GPIA 4BJHB 1EZ4A 3HN7A 2EGGA 1RWNA 2Q9UA 2ZKLA 4PFQA 5KYVA 3D4PA 4JI6B 1PJTA 2C5GA 1SHZA 3ELDA 3HJGA 4HDRA 4TUYF 5EFZA 4B31A 2H52A 4QIHA 4DR4B 3BHIA 4M0EA 1U4SA 2C82A 3P2JA 5C8YF 2HA5A 5IEJA 2Q28A 2X5NA 3IEXA 3ACCA 4MI1A 3WLMA 4EMUA 5J4HA 2K2QB 5DX8A 3WFZA 3C7TA 3OEEA 3SVZA 4TLBA 2C00A 1JW9B 4ZHQB 2J07A 3DPIA 1WKBA 3L4JA 1CU1A 1OY1A 1OQAA 5IAEA 4C76A 3MB8A 4PAMA 3UN1A 5A0TA 2HHHB 5CFPA 2PUEA 1XALA 4RVGA 1NQWA 3HDVA 1QJ4A 2BGWA 4UZSA 3GU3A 1J0BA 1P7WA 2NUBA 2C3UA 4BLSA 1KARA 4HDNA 3VDQA 4RPIA 3GRVA 3R4CA 1GL3A 2HO4A 3I6BA 5AM2A 3H97A 3K15A 3PHLA 2J3DA 2VHZA 3HKBB 1Z4OA 5TX7A 3NXSA 2AUTA 4RIHA 1SCJA 1IZYA 4TZ6A 1AKUA 1C4OA 2DFPA 4JB8A 4Q3CA 3RVJA 1QDLB 2W2LD 2KQUA 2D8MA 3EUAA 4JKIA 4MW0A 3I6ZA 2JL1A 4KXWA 1KP2A 5FBKA 3BXHA 4PYMA 4RM3A 2BGTA 1Q77A 5G40A 3VKFA 3R9KA 4EYKA 3EY9A 5CXUA 3GHHA 4CM9D 2I6UA 5KDDA 3GX1A 3K8QA 2MSWA 3DE7X 3E5HA 4LHZA 4YJFB 3WNVA 1TIKA 1W1UA 3IDQA 1U1FA 3O1IC 4N82A 3DHNA 1ZJ5A 1U99A 4MWZA 5DW3A 2JIPA 4P82A 1GU0A 2B3TA 3M33A 3T7AA 5EUMA 3B48A 2H2AA 2Q8PA 5BN4B 4EKGA 4M22A 4BO9A 2X9VA 4G1CA 5DBGA 3UENA 2OKCA 3UJCA 5C7IO 2M32A 1ENYA 2NUAA 4E2ZA 1Z47A 1C8KA 2X0NA 1HBJA 2QLLA 4UHBA 2XRZA 2WWIA 4HHEA 2XA2A 3UAGA 2CLHB 1XUOA 2VDQB 4JASB 3ANYB 1KU6A 3T9AA 4M9XA 1ANKA 1C14A 2MIIA 2QIPA 4CKBB 3ANNA 2W90A 4FTWA 3UFBA 2O8CB 5JJLA 3E70C 2QM7A 4BP9A 4EO4A 3CRRA 3KPYA 3F4KA 4G24A 4OJYA 4QYTA 3SEZA 3SQMA 5BV8A 1HLGA 4FQ5A 2FUG1 3DYVA 3PUVA 4NP6A 3TRKA 3KWFA 2DQSA 3IBCA 3KKLA 5JI2E 1E96A 1FJGB 2A2ZA 1OGJA 3EPAB 2BEVA 1Z07A 2C9CA 2Q3LA 3E6AA 3AU8A 2MYTA 3EVNA 1EHIA 4NFHA 1GGNA 2FG7C 1F8YA 1Y1PA 5CLLA 4MCHA 1PZMA 4K2AA 121PA 1SO8A 3LKBA 4UUOA 3TH5A 4MHSA 1Z5UA 1R5NA 2OBNA 5JZSA 4BLOA 5FNVA 4WBNF 2PGOA 1XN4A 1E1NA 2G06A 3JWHA 5CW1A 3UJ3X 1JA9A 2BFDA 3KPUA 1D8AA 3ZNNA 2WG1A 2F1IA 4CMBA 2FWBA 1FRQA 5ITVA 4OJKA 5HUHA 3C45A 4LOLA 3RVRA 1KI4A 1U02A 2VNIA 3EGDB 4C4TA 4EW2A 4C0QC 1B42A 3CKLA 4AFNA 4BVLA 2VXOA 3U7FB 2OWEA 5KYWB 3R41A 2R62A 3PC6A 3RTEA 3SF0A 4WFIA 4G5OA 3OFKA 2JLBA 1FFWA 4PAWA 4WSOA 1MR3F 4GNRA 1BG6A 3DW1X 1O6BA 5ED0A 3SSMA 5JCXA 1MW8X 1QLJA 2C7PA 2WC1A 5KINB 2DB3A 3WGYA 4PAOA 1Z28A 4I8XA 2OHVA 4I3GA 3LQFA 4YRRA 4B75A 2C4TA 4G3XA 3RSQA 5JBIA 2Q27A 4A8JB 3UK2A 3KJIA 4KXMA 4N7JA 2IP1A 4YMHA 5H1YA 4D3ZA 1G8SA 3SJCA 3O1JC 1M8FA 9ABPA 4JYZA 4OK6A 2I80A 3KTOA 3RRFA 4PZUA 5BQXA 1C3OB 1N9GB 4HZIA 5F2EA 4TTVA 4AS3A 1FS6A 2I99A 3OHSX 3PR1A 4M37A 1JVSA 1GZ3A 4X6YA 1Y6FA 4EPVA 4E4RA 1EDBA 3PHIA 4FKBA 1CUWA 4AJ4A 4MB0A 1BXRB 5DYNA 2XXAB 2JH8A 4EY8A 1QPZA 1LWNA 2WJ3A 2XGOA 3ZEAA 4UTVA 1EUDA 4BRZA 5P8WA 5J4VA 5T8KC 2HPAA 4KXVA 1DUSA 1XBTA 4PANA 4G01B 4WX2B 4HT3B 4WZAB 2GARA 2PK3A 2G76A 3SXUB 3DWIA 4Q1AA 3TQQA 4X64B 5BV7A 4RULA 4NX2A 3UHOA 3RAFC 2R44A 3KZVA 4FKZA 4PHHA 4E5VA 3ADBA 3RLFA 4BCDA 5IUJC 3AM5A 4KN6A 1EX9A 2G83A 2XMRA 5I7FA 3GLGE 4FBLA 5IKEA 1NHWA 2FPPB 4YCCA 4IZIA 4P22A 2E5WA 3IRUA 1ESMA 3K1AB 3PVCA 1KH2A 3EZGA 1X2EA 3QZUA 4HFJA 4AX4A 4ZIRB 3AL0C 4K0KB 4FYYA 1SM4A 3KZMA 3OPQA 4H2DA 1M7GA 1N0UA 1QBKC 5LFAA 4F4FA 3T9CA 4U63A 1QWSA 2GPNA 1A5TA 1FP2A 2EYQA 2BP7B 3WMRA 4EEZA 2ZYTX 3KPJA 3OQBA 1N25A 1V6AA 1Z0DA 2EGHA 2OCXA 1JWBB 1VG8A 2QP9X 1O9HA 1YDFA 3EWIA 3IP3A 4FHEA 4RWZA 1ZD1A 4LJ6A 4MGEA 4IWXA 3KVRA 3P20A 5JR3A 4HUJA 2XTMA 2WM8A 3N3BC 4HPJB 2WTMA 1FSZA 1PJ2A 2Q45A 2JCBA 4FYJA 1F8GA 1YQUA 2DWPA 3C87A 4JB0A 4ZALA 2HBYA 3ZHTA 3LK6A 4F6CA 4ZPXA 1NW8A 2RHTA 4WESA 2J48A 1IJFA 3H8JA 1S4QA 4MJ7A 1KAHA 2HDWA 3WYNA 1JVNA 5HNKA 4AULA 4EHHA 5FTMA 2VPPA 3KEMA 4R9RA 2Q2QA 1XJ0A 3I9NA 4EY5A 5IWCA 3TNYA 1S2DA 1DTWA 5HS6A 1T6NA 1YMUA 5AJWA 2NVWA 1PV1A 5DBEX 5C4IA 5JCJD 4EUSA 1YL7A 4D9HA 1ZN7A 2A1IA 1KEEB 1MABA 3JARB 4WGFA 5ESXA 1MJGM 4WCFB 4J1TC 2YZGA 4QOFA 1CEYA 1XD9A 2PWAA 5AMXA 4L2IB 3U17A 2I66A 1SUCA 3VV3A 2EYUA 2F59A 4OHZA 3OCJA 3RREA 3R0IA 4BNDA 2C84A 4NAHA 3U4GA 2A0FA 3UHAA 1Z7YA 2GDZA 4KQ6A 4AZ0A 1BD4A 4JJFA 4B8YA 1G8KA 5JAHA 4XR9A 3LRXA 4FM9A 1XNGA 4UM8B 2Q4TA 3E61A 2RB4A 3A2KA 3WBJA 1YE8A 3GB9A 2JZOA 3FR7A 3QX9A 4DUGD 1HMPA 2GJSA 1RM5A 2C3OA 2IXTA 2ZJAA 3AUYA 2AFHE 5T4BA 2VH1A 4MI3A 3SM9A 3BSSA 3VR5H 1YRBA 3WKAA 4K3UA 2HWWA 4B5KA 2QG6A 4RSRA 4F4HA 4D98A 4A16A 5FI3A 4IFBA 4Q47A 4ZGGA 1K98A 2P62A 2FPRA 1KI3A 2OZPA 3BYZA 1OC2A 1RCFA 1JDBB 2G28A 2NM0A 2P9CA 4IXNA 5ITZA 4KPYA 4WCFA 2CLFB 2QRMA 5GOZA 4OM8A 3ZE2B 3ZV6A 3ANSA 4ZV7A 2QNRA 3MT0A 2PXAA 4JLPA 4DANA 5ILOA 4OUDB 1OXSC 4KNWA 3SQLA 1Z5VA 2Q5HA 4PRZA 1IJBA 2H48A 4YT4A 4ZYVA 2IOQA 3GLFA 1OIVA 3DKRA 2JJMA 4W5WA 1EK0A 4EFDA 4NBWA 1EDOA 1RCTE 3OLVA 5DM60 4F7DA 3UVEA 5I4IA 4CF6A 4JDPA 2Z08A 1TPZA 3S99A 3TJMA 4L8VA 1GILA 1UT8A 4OFXA 3V8NA 1M2VB 3TOVA 3WLEA 5K0JA 4ENVA 1BTOA 1YUBA 5K1ZA 4A0QA 1N1DA 1ZSVA 3R40A 4YMSA 1OIWA 1WKVA 1KHTA 4MWBA 4IDPA 1MB3A 1BKSB 4PX3A 1T3LA 4TXJA 4AZ3A 4OCZA 1QO0A 2LE0A 3MCTA 3IEMA 2JCGA