4F3YA

X-ray crystal structure of dihydrodipicolinate reductase from burkholderia thailandensis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLGKQTGVALTDDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVFSANMSVGVNVTMKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGRDAGFFDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
total genus 79
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4f3yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f3yA01
3NGLA 2DAPA 1HRDA 4I08A 2G76A 1LXCA 2O2YA 4NJOA 1G0NA 2Z1NA 1PR9A 2YDYA 2DTXA 3JD1A 3I9KA 1NX6A 3GFGA 4CMIA 4RVHA 2DBZA 1JLLA 3QVOA 2Q50A 3R0IA 1LI4A 2CUKA 4IDAA 3L9WA 2O3UA 3TFOA 3D4OA 1QP8A 5A04A 4KZPA 4A03A 1CDOA 3P5SA 2RIRA 1B2LA 1HDYA 1EEHA 4QFCA 4DBZA 3BMNA 4NFHA 1J0XO 1GYQA 5KOIA 1JWBB 3GRKA 4XIYA 3PYLA 4MIEA 3IDSA 2HDHA 2HJRA 5F5LA 4IY1A 1HE2A 5H81A 2X0JA 4Z0PA 4L76A 3K73O 1LEHA 4OOEA 4QEDA 1Q2XA 1XQ1A 2DU8A 5DOZA 5AOVA 5BNIA 2FPPA 1E1LA 4WJZA 4AJHA 1LX6A 4D45A 3CTMA 4II2A 5JC8A 1P74A 4M55A 4PG5A 4F3YA 4CR8A 4CQMD 3DMTA 1ISHA 3O4RA 4CM7A 3JQGA 1O0SA 1DFIA 4CUJA 1PJQA 4BVAA 4CUZA 3JQDA 3PDJA 3QRWA 3JD3A 1CYDA 1KEVA 4PLGA 3PJEA 3SJ7A 1CJCA 3V1UA 4U6SA 4MIYA 4RQTA 4E33A 5IDQA 3RC2A 1ZVMA 1UAYA 4NK4A 3SC6A 3TZCA 1DLIA 2GCGA 3FF4A 2QIOA 3U5TA 1P0FA 3TFQA 2HCTA 3F5QA 3QA9A 5FF9A 3Q0EA 3GK3A 1FDVA 1T2FA 1LLQA 5I7FA 3GGGA 5MGBA 3WGHA 4XR9A 3E8XA 3WNQA 3W6ZA 1F12A 3ICPA 2JD0A 1YOVA 4CMKA 3ZDFA 4RVSA 3GAZA 2ZKLA 4JBHA 5F1OA 2D5AA 3INTA 1VI2A 3V2HA 3OA0A 2Y68A 1UP4A 1M2WA 3IKTA 2O2SA 1GEEA 2H6EA 1NQAO 4R1SA 1EE2A 1GUZA 1E7MA 2DBVO 1GDHA 7ADHA 1Z7EA 3RASA 4W99A 1YE3A 1G0OA 1HKUA 4RLSA 1AXEA 1TEHA 3FN4A 4W7HA 3OJFA 3ZH2A 3C85A 1PZHA 4ALNA 1A5ZA 4K28A 1BW9B 2WD8A 5KCZA 1WP4A 2P5UA 3JQFA 3JYQA 5I7EA 4MIOA 2YV3A 1ZKMA 2B83A 3R1IA 4F6LA 1FDTA 2I6TA 3AY7A 3QSGA 5KJFA 3P7MA 2G5CA 3WJAA 3WMWA 3PEFA 4MVJI 1O6ZA 4LVUA 3V2GA 5B12A 4M86A 5JC1A 1NVMB 4GI2A 4QX6A 2BI7A 2JCVA 4CM4A 3LVFO 4MP8A 4YAEA 3W8EA 4BNNA 4YR9A 1EE9A 2VWGA 1QYCA 5LC1A 2GRAA 3UVEA 2TMDA 3PWZA 5TF4A 4FR5A 2GSDA 3D3EA 3Q1LA 4UEOA 1E3LA 3DOJA 3GNSA 4BO2A 1U3VA 1I3LA 5I7VA 4BOYA 3PDUA 1NASA 3IUPA 5C7LO 3U49A 4YAGA 2CDAA 4E21A 4YXFA 1DRUA 2PY6A 5CP8A 3PHLA 4QO7A 2GDZA 4TSKA 2CFCA 2ZTLA 1V3TA 3ZWMA 1IL0A 5FI3A 3ZZNA 2V7PA 1N1EA 1ZJZA 1MXHA 4NR0A 4XRGA 1T2AA 4G5HA 2VHWA 3GH3A 4WLNA 3DOCA 3O03A 1A9YA 5JYEA 3INRA 3LC2O 5T57A 1S6YA 4A10A 1U9JA 2DLDA 1HSZA 2NTJA 3BHMA 3X2FA 3E48A 3V8BA 4DBVO 1YONA 5ENVA 2JFHA 3K2BA 3O9ZA 5FI5A 3MJSA 3RJ5A 1TVEA 2JKVA 3RU7A 3VHRA 3FI9A 1ZZEA 2AQKA 3IAHA 3PJFA 3VPFA 3OFSA 2RH8A 3RUDA 2QYSA 4PZEA 4MKZA 3FRJA 3SC4A 5LCXA 4OOFA 3W4KA 4CMHA 2FPIA 3JQBA 3FPLA 3VKVA 4PLHA 3UCXA 3RUEA 4YQZA 3EZLA 3OM9A 4HFNA 2PKRA 1E1NA 2Q2QA 1BG6A 1IY8A 1UDAA 1GU7A 3WTBA 2Q49A 2Y1GA 9LDBA 4I5FA 1EUZA 1PJLA 1P44A 2BKAA 3L4BA 3WIEA 4GVXA 2JAPA 2F00A 4OH1A 2O7QA 1I0ZA 5DCYA 2IDZA 2ZB8A 4IS3A 1LDGA 1U3UA 5U9CA 1X0VA 2VOJA 3WQRA 4XJSA 4XYLA 4HUJA 1Y8RB 3HQ4O 2AA3A 3U4HA 3ZWAA 3GVPA 3I6QA 1E3EA 1XSEA 4EJMA 3V1YA 5JYFA 2NQTA 1PJCA 1DFHA 4RZIA 3VOSA 3G79A 2RBEA 3DWFA 1M6WA 1PJ4A 3DMTC 2UYYA 4AVYA 4ZQGA 1SOWA 1R16A 1NQOA 1BW9A 3SLKA 4OXKA 4R9RA 1UAGA 2BFOA 2G1UA 3TOXA 3IUSA 2VWHA 2ZTUA 3DQPA 2ZB4A 1JWAB 1R4NB 1B0AA 4O5OA 5BQFA 4DGSA 1HE5A 3DONA 1YH3A 3TPCA 1Y6JA 1YWGO 4J0EA 1QMGA 4L8VA 1PJ3A 3GY0A 1P33A 3B70A 3WJ7A 4JP3A 3NT5A 1E5QA 3HDHA 3PHGA 1HWYA 2I66A 1TB4A 4W9NA 4BNJA 4CMGA 1AE1A 4MKRA 4MVJA 3PIDA 5HBRA 1G6KA 1D3AA 2C5EA 2D8AA 2EJVA 1QYXA 1VL6A 5CEEA 4Z6KA 3ONEA 6ADHA 4D43A 3WGTA 3RBZA 4ID9A 1X1TA 3SEFA 1W0CA 5KVVA 3AM5A 2NTNA 4IS2A 3LT2A 1P1JA 1GR0A 3TWOA 2NU9A 1T26A 3EHEA 1IB6A 4RO0A 4B3IA 5G0UA 3QQPA 2CDBA 5ENDA 3ENNA 1KVRA 3BMCB 1Z45A 1YDEA 1IULA 2EJWA 3RC9A 5CAEA 3DBHB 3NEPX 3I4CA 5KJ1A 1P3DA 1UJMA 4YWJA 4ZQEA 5K6AA 1R6DA 4L4SA 2A92A 3W1VA 1PGOA 4FW8A 3KSUA 3UOGA 5JFOA 3TL2A 2BLLA 4DREA 4DMLA 4J7CA 1PJSA 4I9UA 5FEUA 1R15A 1W8DA 3OECA 4YRDA 4E12A 4XDZA 2CDCA 4PG8A 4BNVA 1P1RA 1LJ8A 4BUCA 1LNQA 1A7AA 2JHGA 1UH5A 2GASA 4RPJA 2X5KO 1U3WA 3R3JA 5DZSA 4P22A 5G0WA 1ZSNA 4DVJA 4J9UE 3AI1A 2YJZA 1RKXA 1D8AA 1T1RA 2GN9A 3WWZA 4XB2A 1C0PA 2FP4A 3B20A 4IDGA 3VPGA 3ROPA 3QVXA 2BRUA 3TZKA 4ZQFA 1GQYA 4AJ1A 4E32A 3WBBA 1F8FA 2VYVD 2DFDA 3R6DA 4IJKA 3NTOA 4L4RA 1WPQA 2GERA 4NU5A 1DDOA 1P77A 1Z75A 5IDXA 2A9FA 2J5RA 2X22A 4DRYA 3GG2A 3AWDA 3BAZA 3L6EA 1VRWA 3DFZA 2EW2A 1RM5A 2HQ1A 2NVBA 3H8VA 2Q3EA 5GMOA 3NYWA 1I5RA 3NTQA 3FPCA 5JAZA 2QRKA 4LSWA 1NQTA 1OMOA 4CMAA 4P4GA 4CMJA 4ALLA 4K9DA 3ZWWA 4CM9A 3CMMA 2WJPA 3RROA 2EP7A 4HADA 4MPDA 3FSRA 1PJTA 2HKIA 3KVOA 4JJFA 1R4NA 3RIHA 3U0BA 3EMKA 3T7CA 4LISA 4M8SA 3NGXA 2O3JA 1PGNA 4U7WA 2BGLA 3MEQA 4Y8VA 3WMXA 3KHUA 1KVUA 1I01A 3OEYA 3P19A 1U1IA 2DTEA 1FDWA 5ICMA 2YV2A 3GF4A 1N92A 1F17A 1I3MA 5T5QA 1ADCA 3ANMA 3G17A 1TXGA 1NWHA 3M6IA 1LLDA 4O0LA 4ZRMA 1WW8A 1HDGO 3A1NA 4E5NA 5A9SB 5JAMA 2NACA 1YL5A 4MVJH 1HSOA 3GDFA 1JQBA 3F6YA 1ISMA 4BNZA 4R3NA 1ZXBA 3ZN2A 4CLXA 4XEHA 1F14A 2QQ5A 1VJ0A 5IF3A 3GDOA 1JVBA 3RJ9A 2HMWA 1R66A 2NWQA 4BGVA 4WEQA 5DNAA 2O48X 3BTSA 3EK2A 4WCFB 4BNTA 3AY3A 4YT5A 1P0CA 1CIVA 1VSUA 1YL6A 1C14A 2VRCA 2R00C 2PK3A 4YJGB 2HO5A 2EF1A 1UP7A 1W6UA 2IZZA 5ES3A 3DBHA 5I8ZA 4CMCA 6LDHA 5L9AA 1E6WA 2Y66A 4FGSA 3EVTA 1Z6ZA 4NZ9A 4YA6A 4I5DA 2Z1MA 4J7XA 4L4XA 1Y9AA 2EGGA 2O3RA 5G2OA 2IEDA 1W73A 2QG4A 3OETA 1VE9A 4BNMA 1MLDA 3RVDA 4D42A 1QYWA 5KWEA 4XQGA 3MJ4A 3H5RA 4P38A 3A4VA 1WWKA 3MJCA 5A3JA 2OP1A 3T4XA 2IZ0A 1XA0A 1X7GA 4A0SA 3PGJA 4IDFA 1TT5B 2C7GA 1O89A 2WSBA 4TROA 4XZ3A 3VZRA 2PFGA 2D2IA 1FMCA 3BMQB 3MCVA 3NKLA 4NQZA 3ICCA 3NDRA 2BF7A 4R5MA 4BGEA 1YQXA 4OKIA 3KYBA 4N18A 2ZIZA 3GEMA 4X54A 5F1PA 3ZWPA 2EIHA 1E7RA 1M66A 1OC4A 3F5SA 1MFPA 3PXXA 3BHJA 2DM6A 1DHTA 3KEOA 4IQ8A 4YDRA 1GTMA 1Q1NA 1QYDA 2C29D 4FBGA 1E6UA 4HFMA 3F47A 1U4SA 5DP2A 1BVRA 2E48A 1NVGA 1EVIA 1DAPA 4JN6B 3RC1A 3UCFA 4A2CA 5C37A 3E6AA 5FYDA 3G3EA 1MV8A 3WGYA 3OH8A 3F4BA 4ND3A 5CEFA 4XQ9A 2VQ3A 4Y6PA 3VDQA 2J5QA 3AUTA 4CQLA 2FHSA 5BNFA 2X6TA 1EBUA 5TNXA 1I3KA 4BKRA 3ZCXA 5JSFA 3U62A 1T25A 1XU9A 4HWKA 3DTTA 2V6FA 2UV8A 3FHLA 1NBOA 5AXCA 3L0DA 2C20A 5BSGA 4FIZA 2H1SA 4NK5A 1M75A 1LUAA 2UUPA 5ER9A 3HN2A 1Y8QB 3VH2A 4FFNA 5A9SA 2B5WA 5TGDA 1V6AA 4JP2A 4OAQA 1B16A 2OO5A 4D46A 1ULSA 4ZQHA 4AG3A 4E0BA 5A9RA 4CLOA 3LDHA 4BHTA 2NVUB 4IIUA 1VM6A 1RM0A 4RVGA 5DCWA 3ZHYA 4E2XA 2YUTA 1GV1A 1NXQA 4NG5A 2IODA 3MWDB 3BHIA 3AK4A 5ICSA 5IFLA 4H16A 3U4IA 3ZHZA 5C7IO 4WLVA 3TZQA 2VTDA 1KERA 2NNLD 2GN4A 4HFRA 2Y1EA 4WCFA 4J1NA 1EK5A 1J4AA 4J1TA 4DLAA 5CDGA 1JTVA 1L7EA 4MVJP 3WX0A 1HZJA 3PLRA 4J49A 3ZNPA 1UZMA 4XGKA 1DIAA 4DYDA 1YL7A 3D3WB 3UFXA 3QWFA 1X14A 1XWFA 3L07A 1SPXA 4OJNA 3RU9A 2PGLA 2Y0CA 1MC5A 2QRJA 4OXNA 4JQCA 3U4DA 1EFLA 5A02A 2ILTA 4GWKA 4LCEA 5TT0A 2PZKA 2FPGA 4FOOA 3FBTA 5GY7A 1E3SA 3IMFA 5A9TA 2X5OA 2GYYA 1DSSG 3PP8A 2EERA 4FJ2A 2BMAA 1O95A 4QXMA 1IOLA 2VN8A 5TIIA 1TT5A 4IUYA 1S7CA 1KY5A 3D4PA 3M1LA 4NIMA 3DZIA 4KOAA 2VHYA 4UAGA 3MJVA 1O9BA 3BMQA 4AJJA 3JQ6A 2RHRA 2EGHA 3JQAB 4YPOA 4CM6A 3Q3CA 3DHYA 1A72A 5ILOA 1KYQA 4DMMA 3OIDA 4DIOA 3ZWNA 4J1QA 3KEQA 4MDHA 3A9WA 5EN4A 1LC0A 5DN9A 2O4CA 4GVLA 3E03A 3OF2A 3NT4A 4R41A 1K6JA 4UVHA 3ROQA 2O3QA 3QV1A 1EDZA 2AE2A 1GPJA 3RKRA 1DC4A 4PLCA 4B4OA 1H0KA 1CETA 4BO4A 1GZ3A 3H4VA 1SEPA 3VVBA 2CF6A 1Q0HA 2BI8A 4BB6A 1XDWA 3DO5A 2A94A 4PVDA 2WM3A 3JD4A 3DOOA 3HB4X 1DIRA 5G4KB 2A35A 4NDNE 4W7IA 4CM1A 4E5YA 3L4SO 4HX5A 3JYNA 2FOIA 4O63O 1E77A 2EWMA 4J43A 4CUKA 1ADBA 2WYUA 1WXDA 3DHEA 1ISIA 3GAFA 4J2OA 2A4KA 1XKQA 3KV3O 4MVJD 1E6EA 2I65A 4E5KA 1WZIA 1Y8QA 2CMDA 4CL3A 1M67A 1KEWA 3RUHA 1ADFA 4FFMA 3ZU4A 2I9PA 5CDSA 4BO0A 1H9AA 1JAXA 1YKFA 2NU6A 2BFMA 1NYTA 4YT8A 3OP4A 4Q39A 2POQX 1PL7A 4FN4A 1EUCA 1K3TA 2B36A 4P8RA 3DZKA 4B4UA 4OO3A 5TT1A 1P1FA 2GZ1A 3VTZA 2AG5A 5KJEA 4JROA 1XYGA 4NBVA 2IYPA 1ULUA 1EVZA 4HXYA 3D3WA 4C7JA 4XYMA 3EC7A 4UEKA 1BDBA 2O7SA 2X23A 4N5NA 2FWMX 1T2CA 1J6UA 1DPGA 2PD3A 3ETDA 4M1QA 1R4MB 2PZLA 5IN5A 2YHIB 1W4ZA 2FZWA 4M89A 4NI5A 5KKAA 1JDJA 5G0SA 1TA4A 3HFSA 1T2DA 5A5FA 2QW8A 1HF3A 1B3BA 2CVOA 4YJHB 5AYVA 4FB5A 1D1TA 4BNIA 5F1KA 1ZUD1 3C7DB 3CE6A 1FF9A 3RQSA 4CM8B 4DYVA 1Z74A 3GVIA 4RF5A 1ML3A 3JQAA 4KDEA 2VCYA 5KIAA 3GHYA 4WCFC 1LU9A 1X15A 4IBOA 4RPGA 1H9BA 2AEJA 3HN7A 3PFFA 1GQQA 3GGOA 1I8TA 5JY1A 3TOZA 1SCUA 5KNLA 4MOWA 3DHNA 4J4TA 1PQUA 4NHEA 3VAZA 2YHUA 2ZYGA 3N7UA 5ILGA 4PG7A 3Q11A 1GUYA 4BIIA 3GZ4A 4IXWA 4QO8A 1WZEA 1PL8A 4XGIA 1KOLA 3O8QB 3JYOA 1XIVA 4M49A 3L6OO 1HLDA 1KEPA 2NUAA 2P9CA 3DZBA 1EBFA 4CM9D 4WASA 1PX0A 1E0DA 3ZU5A 2GN6A 1GYRA 1PWXA 5T64A 3GFBA 4R16A 1OFGA 1BRMA 3ABIA 5JAQA 5G4KA 4RPKA 5H83A 5G0VA 2PV7A 2ZB7A 1DO8A 1MFZA 2AG8A 4G81A 2CNBA 2IXAA 3LK7A 1YJ8A 1P9LA 4JX8A 4IQ0A 2Y99A 1LQUA 4RGBA 2PH5A 3TF5A 4BNGA 4MVJF 1QR6A 2I3GA 1ZCJA 4B8WA 4R68A 3H9EO 3GOHA 3UGKA 3PGXA 4J2HA 1KVTA 4GGPA 1C1XB 1CRWG 1EVYA 5CPFA 8LDHA 1Q7CA 5AXBA 2C2YA 5I7SA 4DLLA 2J5KA 4IIVA 3E5MA 4CMBA 1E5LA 1RM4A 4RDHA 4HV4A 4BNFA 2X1HA 3NX4A 4A7PA 1VLLA 2E6UX 5CDUA 3WGIA 1GUFA 2PGJA 5J23A 4I8XA 1C3VA 1HDZA 3OJEA 4YACA 1PGQA 4XYGA 3WLFA 5DDIP 4YBZA 3UN1A 2FR1A 4BO1A 3ONFA 1SNYA 1PGPA 3W6UA 2VRCD 4UUNA 5ER6A 1UP6A 1LRJA 2PKQP 2G82A 1BTOA 1BVUA 1HDRA 3GEDA 5IZCC 3G49A 4RZHA 2C59A 3WQSB 4ZICA 4CL8A 1LLCA 4BGUA 1A27A 5L95A 3GZNB 1ENZA 4BNYA 4JK3A 4CMEA 4EEZA 4D0SA 3OHSX 4W82A 1R4MA 4INAA 1FDUA 3FCOA 4ALMA 3B1JA 2VT2A 2DC1A 2YHIA 4J3FA 5T8KC 4UREA 5L4NA 4YEDA 2EHDA 2EEZA 4PLFA 3RUIA 3AY6A 1N7GA 1L1FA 1GZ4A 3OJOA 5B1YA 3GGPA 3B1KA 1ZNQO 1UR5A 1DJQA 1DC6A 4YJHA 3ROMA 1H6BA 1NFRA 1R0SA 3HADA 1MUUA 3PZBA 3NUGA 3LT1A 5HS4A 3U3XA 1LTHR 4CM8A 5JNLA 3KBOA 4GMGA 4HY3A 2BELA 4PN3A 2VNAA 3GVHA 3ZWCA 4U5QA 2G17A 1QG6A 1P1HA 3K92A 2Q2WA 5MDHA 3DZGA 1DFGA 4UVEA 5TQVA 2OBYA 1KS9A 4HFJA 4TRNA 4TQGA 3WFIA 4Q3AA 1NTOA 2J6IA 3QLJA 1RM3A 3IP3A 2O3SA 3I6IA 3QY9A 3IS3A 3IJPA 3ZWOA 5CPBA 4AJPA 1HDOA 3ZWBA 3O8QA 3PWSA 4IPTA 4EGFA 1WVGA 4GX0A 1KVSA 1YQDA 5TLSA 2PLAA 1U2DA 3PLNA 3W8DA 4E3ZA 3WYBA 4RCVA 4O1MA 4BNLA 5B4UA 4XB1A 3V2UA 4I5GA 2W4QA 4DQUA 3F46A 4XWYA 1ONNA 1GD1O 3ST7A 1FJHA 3H3FA 3MOGA 5JMWA 2GLXA 3U9LA 5JDCA 4UVGA 1I30A 3FWNA 5L7YA 3HWRA 3TN7A 5CG1A 3CXRA 1GCOA 3GQVA 3I9LA 4A73A 2WTBA 4EJ0A 4Z0HO 4PG4A 1E7WA 2HMVA 4OQYA 3H2SA 2B0JA 1R0KA 3AM3A 4Y6RA 3U09A 4ZQBA 1C1XA 4XQCA 3FR8A 3ZV4A 3JV7A 3WOHA 1YVEI 4NBWA 4I1IA 2UAGA 1HLPA 2ZYAA 3C1OA 4MP6A 2FR0A 1B3RA 4YJFB 1WLYA 3V5NA 1D4FA 1I36A 4JCOA 3RI3A 5A3VA 2HMSA 1B15A 3W8FA 3ZV6A 1LDYA 3SX2A 2NU7A 4BNXA 3U4CA 3WSWA 2GO1A 3P2YA 4K6CA 5DBGA 3ZV5A 2G0TA 2YQ4A 3ETEA 5B4VA 3KETA 5C7OO 1EQ2A 3A28A 4KWHA 3GG9A 4FGWA 1UXHA 2RH4A 2Y05A 2CSUA 2NTVA 4WNCA 4ONEA 3GZNA 5DULA 1VC2A 5EIOA 4QQRA 4HNHA 4ZGWA 3JQFC 2GZ2A 2D1YA 4CLEA 1I33A 3M2TA 4BO5A 3I5MA 1X7DA 1XQ6A 3QWAA 4GSLA 2E37A 4NFYA 3VPSA 1EZ4A 4BV9A 3C8MA 2DQ4A 3VPXA 4WECA 4D79A 3Q9NA 5JY6A 2OORA 4P4LA 4ROSA 3I9OA 3LSYA 3NDIA 1YB4A 4XR4A 2VTEA 5CHEA 1LDNA 4CR7A 1YGYA 4IINA 2Y1FA 4ND4A 3ANNA 4Q3DA 1CQJA 4DTIA 4Q3EA 3L9XA 3BA1A 3WTCA 1EK6A 1U7TA 3IQDB 3OJLA 4D41A 2HK7A 5U1PA 3ZHBA 2WE8A 4CLRA 2HSDA 4BKOA 4DLBA 3ZNQA 3MTJA 2W98A 4E6PA 1OOEA 4Z9YA 4Z3DA 3NJ4A 4CMEC 3NTRA 3UICA 4R9SA 4UUMA 4R3WA 1VJTA 4I9NA 1R12A 4OKNA 1B8PA 3OA2A 4PIVA 4CM3A 3KOUA 1T1SA 4DL9A 1KC3A 2NSDA 4OSOA 2B4QA 4PLPA 3WNVA 2XOXA 4RVDA 3PFWO 4ZN6A 1U2GA 1IYZA 1V8BA 1N9GB 3UW3A 4XIJA 4RORA 2V6MA 1EDOA 3DL2A 3RWBA 2Q22A 1Z73A 1UZNA 1DIBA 3DZJA 3CH6A 1BXGB 4CQLB 4CLHA 3JQBC 3WIDA 1LSOA 3FTNA 4UUPA 2B5VA 1NR1A 1D7OA 3K96A 3Q2KA 1PEDA 3GEGA 4YJFA 3GUCA 3VH3A 3HDYA 3QW2A 1N1GA 3GDGA 5GZ1A 1UXIA 3GHHA 3KXDA 4EUHA 4Y9DA 1NFQA 3L4BC 4OXYA 4CJXA 4IDDA 4AJEA 3PK0A 3PYXA 1NP3A 3DZFA 2XXBA 2HRBA 2R6JA 4CLOB 1IE3A 4FFOA 2NLOA 4AJNA 2CVZA 4BNUA 4NH4A 1DC3A 2D5CA 2X58A 1PSDA 4E5MA 2VWQA 3OICA 1I3NA 4RF3A 2JAHA 1JU9A 4WLOA 2DBRA 3VKUA 2P2SA 5JDCC 3WS7A 4II3A 4Z9XA 4O6VA 1PWZA 4TKLA 5TRTA 2C5AA 4L9RA 3PJGA 4TRRA 2HRZA 4BKPA 1NFFA 3GMSA 5EESA 2Q4BA 1PJ2A 3ETGA 3RC7A 1GAEO 1ZSYA 4BNWA 2JD2A 4D7AA 3OQBA 4U0KA 5TS3A 4BO6A 1CQIA 2J3HA 2AQIA 2EXXA 2HMTA 3PRJA 4JLWA 1A71A 4FC6A 5L4LA 5CEJA 1VSVA 2P4HX 2PZJA 3EAGA 1XCBA 2V65A 3HUDA 3LU1A 3WWYA 2O50A 3F1LA 5L51A 1TLTA 4W9NC 3JQAD 2E49A 1Q7GA 4DPMA 4B7XA 2WWRA 4NBUA 2FR8A 3INGA 4MVJM 3HFGA 4YQYA 3ZW9A 1NVTA 1T2EA 3JSAA 1GZ6A 4D3DA 3WBFA 4C7KA 1E1KA 3NV9A 4IJWA 2ZQYA 3EY4A 4KQWA 3HB5X 1P1IA 1YBVA 2J8ZA 1NPDA 1NM5A 5C5IA 3SBOA 2VT3A 2OHXA 3MTGA 4R1UA 4EDFA 4ZRNA 3E5RA 3NJ8A 1I2BA 4XGNA 2P91A 4E4YA 4XYBA 1UZLA 1BXZA 4BNKA 5KVQA 4R69A 1H6DA 1HYHA 5A03A 2VUSA 5TJ9A 3AI2A 4JJIA 5AXAA 3EUWA 1OC2A 2EKLA 5K6AC 3H7AA 3PYMA 3JYLA 3PHJA 1N9GA 4D3SA 3HHPA 4IMPA 5L40A 1A7KA 4PRLA 4Y6SA 4BO8A 5CDYA 1F0YA 4FCCA 1DOHA 2X8LA 1IPFA 3W4IA 3JQ9A 1HL3A 4ILKA 1BXGA 2HK8A 4ITUA 3IJRA 2IRWA 1YB1A 4XQEA 1PQPA 2GN8A 1NWCA 3FWZA 1NPYA 4FD3A 5JCXA 5K0ZA 2O4UX 2B35A 4NJMB 2VUUA 3A14A 4OSPA 5HS6A 2JFGA 1LSJA 1C0KA 2ZTVA 3GA0A 3NRCA 3F4LA 2PWZA 4FFPA 3ZWYA 2AEFA 1MC4A 2JCYA 5COQA 2PD6A 5B4TA 3BTUA 1Y1PA 4BGIA 4WEOA 4IZIA 5F5NA 4MINA 3C1AA 3RBVA 4H15A 4GH5A 3KB6A 4TRMA 3E1KA 4BMNA 3WYCA 3CPSA 1BHSA 2I76A 2P9EA 3HZZA 1ZK2A 1QV7A 3KRTA 2VHXA 4LVCA 1PQWA 4RLHA 3N58A 4GQAA 1E7YA 1JKIA 3K9QO 1C0IA 2X0RA 2PZMA 1PL6A 1KBZA 1VL0A 2VHZA 1T24A 1VKOA 2FMUA 4MVJG 4URFA 4CV0A 4UUOA 5BSHA 5JXWA 1SO8A 2NV6A 5AVOA 3E9NA 2C7VA 1ZJYA 2X0IA 2PNFA 1GADO 1SB8A 2EG9A 3C1TA 2FY8A 3I9JA 1ZFNA 1QXSA 1SB9A 4NPCA 2XAAA 5EINA 2X9GA 3PIIA 3FNGA 3H9JA 3ITDA 5H82A 2D4AA 3QWHA 4NNJA 4GMFA 2LDXA 4XYEA 5JDIA 2H63A 4K26A 4R4JA 1LA2A 1MXFA 1XHLA 5CFZA 4YAKA 1EVJA 3PI7A 1XG5A 2OZPA 4D44A 1XR3A 2VHVA 4BNHA 4EZBA 5THKA 1PZFA 4ALKA 2SCUA 2GUGA 2FRDA 2IEBA 2YFHA 3G1TA 4J9VA 2VRBA 4PVCA 3PPIA 1ZMTA 4U8GA 1MX3A 1WDKA 3H9GA 4EI2A 4TVBA 2FSSA 5HM8A 3AFMA 4WUVA 2O3TA 3LT0A 3PJDA 1HDXA 3GPIA 4IDBA 4UEJA 3JYPA 4BKQA 1FXSA 1HE4A 4TVOA 5G0TA 5HTOA 4F45A 5COAA 2Q1SA 3KUXA 4DUPA 3A06A 1N7HA 3LLVA 3I23A 4WOJA 3WICA 1XGKA 3RFXA 1XELA 1SMKA 2YDXA 5T67A 4MO2A 4NBRA 2Y1DA 4J16A 4FFLA 4XD2A 2WE7A 3FNHA 3QVWA 4MJLA 4B4WA 4GBJA 5A4DA 9LDTA 3IC5A 4KUHA 4Q3BA 4EJ6A 1NHGA 5IZ4A 1K6IA 3DR3A 1KC1A 3WYEA 1V3VA 3JTMA 4GX1A 2FN7A 4KP7A 3X2EA 1H94A 1UUFA 3JQCA 1ZW1A 5JE8A 4NJMA 3WXBA 1NAHA 4J7UA 4LRTB 5JPIA 1LQTA 1N5DA 1ZK3A 4B4VA 4BKUA 5HWSA 2WYWA 1NQ5A 3ON5A 3E9MA 1GFSA 3KM0A 2ZQZA 1F06A 5JLAA 5JMPA 3STHA 5ITVA 4GWGA 5I8WA 3D0OA 2VYNA 3LLSA 4R5HA 4ESOA 4W6ZA 2W90A 2HJSA 1UXKA 1ZEJA 4CPDA 3AOGA 1NAIA 4GL4A 1HTBA 3GT0A 4QUKA 3HDQA 1BGVA 3QVSA 4BS9A 1B7GO 5KTKA 1UXJA 1YBMA 4AJOA 1LDBA 4EUFA 4LRSB 2W8ZA 3VH4A 3CEAA 1RYEA 2W2KB 1YS4A 4WLUA 4JBGA 3WGOA 1I2ZA 2BH9A 2D59A 3H3JA 5DOVA 1O94A 1ZBQA 3DBLB 1F8GA 3EYWA 3QHAA 3TNLA 3HNPA 5M6DA 3C24A 3ORFA 3I1JA 1U7HA 5L7TA 5EPOA 1LBEA 1E3WB 4RVUA 1UDCA 1ONOA 2OGUA 2DBQA 1CF2O 1DIHA 4AJKA 3MOIA 1G1AA 3NT2A 1CEQA 1GY8A 1PJBA 2JJYA 2JFFA 3TQHA 3OMLA 2YZ7A 4A27A 2DUUA 1ZXLA 1PS0A 5AXDA 4FDAA 4DWVA 4GLOA 1FK8A 2W2LA 3KZVA 1K6XA 3GN2A 1IPEA 1XLTA 4G65A 2ZYDA 3RD5A 3PWKA 5C3MA 3I52A 1YO6A 2R2GA 1P1KA 3H5AA 3C7CB 4WCDA 3P2OA 1Q0QA 4JJGA 1H6AA 3EW7A 3W4JA 3AUAA 4DC1A 1DB3A 1X1EA 3DDNA 4LMPA 1PS9A 2ZB3A 4DIBA 3G1UA 2OOSA 3QIVA 2GR9A 1OZAA 4DIFA 2P5YA 3TRIA 3CIFA 1YB5A 4U6QA 1BXKA 3F9IA 2AXQA 5EQFA 3UH1A 2GF2A 3F3SA 2AEMA 2X5JO 1OI7A 3E9QA 2Q2VA 1ADGA 5IDYA 1CWUA 2V6GA 3WQQA 1PIWA 4K1LA 3V1TC 1ZH8A 1B8VA 1A9ZA 1ID1A 1BWSA 1QRRA 2BGKA 3K30A 3KYDA 4LCJA 4PLTA 3WFJA 3WSVA 1ORRA 4TMFA 1JA9A 3OIGA 4RQUA 1LRKA 3K31A 2I67A 5JDIC 2HK9A 2Q45A 3D1LA 4D0RA 1JAYA 4JBIA 4E31A 5JAIA 2ZJ1A 4HNGA 2XF8A 3DB2A 3MWEB 4UULA 4IGEA 3ZGYA 4BB5A 1GQ2A 3JD2A 3PZRA 4TWRA 1NR7A 1Y9EA 3WLEA 2D0IA 1E3IA 2X0NA 2HAEA 4DPKA 1BMDA 3K5PA 1KVQA 2GPTA 3ZWXA 2NU8A 1JN0A 1U5AA 3GNTA 4Q9NA 3UXYA 4RVFA 3UAGA 4N54A 3OQ1A 5AQ1A 4WPGA 1V35A 1T4DA 5KKCA 4OIMA 2PR2A 5DBFA 3ZI0A 4B7CA 4H3VA 4GX2A 3AUSA 4BO9A 1NHWA 4FOSA 4YJDA 1GCUA 4YAIA 5A5EA 1EUDA 4R1NA 3E82A 1UDBA 2HU2A 3WGQA 3D4NA 2ZCVA 2X9VA 2UUOA 1P45A 4M87A 1HYEA 2DKNA 1R37A 1ENYA 5JCJA 2H9IA 3AU9A 2W2KA 3BTOA 2OUIA 5HA5A 4EBFA 3DBLA 3GPDG 4UVIA 3IP1A 1JVSA 1CERA 1HE3A 3OBBA 2J3JA 4TZTA 2IYOA 2C0CA 1H2BA 3UCEA 1E3WA 2AHRA 3RUFA 1R0LA 4RJTA 2DT5A 1U3TA 2E4AA 4E30A 1O8CA 3H9UA 3ZU3A 3WGGA 3TL3A 4Z0TA 4WOKA 4CV1A 2DPHA 2XXJA 4DQVA 1ARZA 1IZ0A 4ND1A 3KYCB 3GN1A 3BMOB 1AGNA 2X9NA 3KTDA 4OHUA 4ZHSA 2RHCA 3O26A 4KUEA 5IAAA 5THQA 1IUKA 5I9NA 1B8UA 3CZMA 5COBA 5JBIA 2OFPA 5L45A 2IXBA 5EQDA 3LZ6A 3VZQA 3ONDA 1AHIA 1KY4A 4MVJE 2AMFA 2H5LA 3IOYA 3GRPA 3PVZA 2YYYA 4NFSA 5TJHA 5EJ2A 5I9LA 1YJQA 1ZO8A 4ND5A 4CLRB 2Y1OA 4R51A 3LF2A 3BYZA 4ZA2A 3L6DA 4CV2A 5K9ZA 3Q9UA 4C4OA 1OBFO 3TJRA 3GNQA 4IDEA 3OIFA 3FNFA 1Y7TA 3RSHA 4JIGA 4IJUA 1YBAA 2YW9A 2IZ1A 3CUKA 1AUPA 4IJVA 4CQMB 5L7WA 2C54A 4J91A 3TDKA 1QKIA 1V9LA 2EKPA 1RPNA 4B79A 4K6FA 3PTZA 4N5LA 4RPLA 5LDGA 3TZ6A 3JD0A 4XCVA 2Y0EA 4PG6A 2Q1WA 5CDTA 3D64A 1HT0A 1ZK1A 4OL9A 3K8ZA 3DBRB 2WDZA 3K2EA 4QT0A 4GSKA 3KSDO 1H93A 1DRWA 1PS8A 4EUEA 5ADHA 4YT4A 2WD7B 1DEHA 4IQGA 1DHRA 4BQPA 4LN1A 1PTJA 4CR6A 4TZKA 3GR6A 1X13A 2JHFA 5T73A 3DFUA 1HETA 4E2ZA 3ZNOA 1E1MA 3SJUA 4PLVA 4WE3A 2R00A 4EYEA 3PQDA 4WGGA 4FPXA 5DCUA 1O5IA 1I10A 4P4NA 1PZEA 3DAFA 4F46A 1K0UA 4HBGA 1MA0A 1JKFA 3I3OA 4IM7A 4OMUA 5L53A 1VKNA 2RAFA 2WMDA 2GD1O 4J90A 4J1SA 3ZW8A 1ZEMA 3COSA 2F1KA 3BXXA 2C2XA 4PZCA 4L74A 3I9MA 4CODB 4FC7A 2C82A 3GMDA 2HLPA 4HP8A 4LK3A 1T4BA 1A4IA 1MG0A 1JKJA 3ASUA 4BQRA 5EERA 4XKJA 4KTVE 1C0LA 4PLWA 3EGOA 1LSSA 2E82A 4FS3A 3M1AA 3S1LA 4TRJA 3KYCA 4XA8A 3BMOA 3DAPA 3DMYA 3QE3A 1U28A 5BSEA 2VZ9A 2CZCA 5TC4A 2GZ3A 2WYVA 3MJEA 1WDMA 2ET6A 3ZV3A 1Y81A 3RAJA 1Y5MA 2PA3A 3GVXA 3C7AA 1OAAA 5FFFA 3CSDA 4G2NA 1M76A 1ISJA 3AI3A 4GKBA 1U8FO 5HRUA 3S2GA 5KVSA 4Q3CA 4R01A 3G0OA 4IGFA 3VVCA 2BGMA 3C3XA 1VJ1A 3GLQA 5T6BA 4AL4A 1DBVO 1YRLA 1YQGA 1I2CA 3H5NA 1AN9A 3RCBA 3DXFA 4ZD6A 2Y67A 2Z95A 1BDMA 1ISFA 3K6JA 2YQ5A 1DC5A 3GC6A 4GGOA 4J6FA 2X4GA 4YAJA 5BNTA 2IE0A 4CQMA 3SXPA 1YDWA 5IN4A 1WMAA 5BT9A 1DLJA 4PZDA 2I3AA 4OM8A 3QP9A 3UHAA 3TZHA 2B69A 3DZHA 4E2WA 3D7LA 2Q1TA 4I9HA 3OQ6A 2QX7A 5IXYA 2VOEA 3R3SA 2ZATA 4ZJUA 2GGSA 2VZ0A 4B3JA 3DBRA 1Y8RA 4R1TA 2Q4EA 2VYND 3CMCO 1Z7BA 4FJ1A 1LDMA 2OMEA 4IXTA 5JO9A 2WD7A 1D1SA 4GLLA 5BR7A 1SZJG 5JW6A 4OYRA 3F1KA 3H65A 5TSDA 4DXHA 2NADA 3ANLA 2AQ8A 2EP5A 3OEWA 4WK6A 2QHXA 3AOEA 3ASVA 3VH1A 5LDHA 4EW6A 5F3RA 2UDPA 2Y0DA 2HUNA 2CVQA 1Q7BA 4RF4A 1ZSVA 2B4RO 1AHHA 1WMBA 1N8KA 3WGZA 2Y93A 3T4EA 5KJCA 1PR3A 1WNTA 3S2FA 4PCVA 4O59O 1IZ9A 2TMGA 3WDSA 2Y1CA 4JNKA 4TKMA 1RJWA 1YXMA 4JGBA 3LYLA 2BFAA 4IZHA 1H5QA 2CY0A 1K89A 1DXYA 3OSUA 3KO8A 3HE3A 3ZNNA 4BV8A 3H6KA 1KETA 4FQ8A 4GAEA 3IL2A 2W2LD 3M2PA 4EEXA 2EV9A 3EVNA 4B7UA 3KSZO 3JCZA 3DTYA 3Q6IA 4ZU3A 3D5TA 1HXHA 2OXIA 2NQ8A 3BIOA 5IG2A 4XDYA 1ZK0A 3WB9A 1AXGA 4CLDA 3I4FA 2DVMA 2NVWA 4NBTA 3SVTA 5KVCA 1IHXA 4LGVA 2CD9A 2YY7A 1LDEA 3BMCA 5L4SA 3EDMA 3HG7A 3ROKA 3FD8A 2QZ9A 3CINA 4WLEA 3BZUA 1LRLA 3ZWVA 1EMDA 3VDRA 5TX7A 2OP0A 2JCXA 4W4TA 2C07A 1ZIDA 3NAQA 1SOVA 1MP0A 3LC7O 5IXSA 4PRKA 2PGDA 3FNEA 2X86A 4KUGA 1GL3A 5GZ3A 1BSVA 4YT2A 1KIFA 1C1DB 1I24A 4S3MA 3AJRA 4YRBA 4A26A 2HMUA 3WG9A 4MP3A 4BO7A 4XJTA 3IKVA 4PFJA 3T7EA 1WAMA 3WR5A 4B8ZA 2ZJ0A 1SC6A 4IMRA 4RPHA 1Q0LA 3IIEA 3PQFA 4RDIA 1ZK4A 1FDSA 3LQFA 3ZU2A 4J0FA 2QZZA 1MB4A 1Y5RA 2PTGA 5DT9A 3I83A 4QSMA 1XEAA 4OQZA 3H9QA 4AICA 1X7HA 4BO3A 3ULKA 1B14A 4HKTA 5A1TA 3PQEA 1E3JA 3ZHXA 4FJ0A 2I5PO 2Q1UA 1HZZA 4LSMA 1HDCA 2PH3A 4PLZA 3RFTA 1ISGA 1VPDA 2NM0A 3HJAA 1J49A 4Z3KA 2OBNA 4N7RA 1A4UA 1L7DA 5ITWA 2JD1A 1SEVA 4RV9A 3UUWA 3DC2A 3MZ0A 1HYGA 3JQ7B 2Q46A 4U0JA 1NPTO 3H2ZA 5DP1A 2J3IA 1P31A 3JQ8B 3GVCA 4FSHA 5F21A 4AFNA 5JCJD 4B3HA 2ZK7A 4NU6A 4LMRA 4OGWA 1JW9B 4GPD1 1QSGA 3ITKA 1K2WA 4AJ2A 4DPLA 4KDFA 5A05A 4Y98A 3O38A 3ADPA 2QRLA 1RYDA 4M54A 5A06A 3LC1O 1ENPA 1E7SA 1EFKA 1DIGA 4L0QA 3B6ZA 4AJLA 4YVFA 4S1VA 2VWPA 5JS6A 2B4TO 4QTZA 3S2IA 5L3ZA 2I99A 1I32A 2BD0A 5I9MA 3RBXA 3AUUA 3CZRA 3KLPX 2XPCA 1RWBA 4YTEA 2D3TA 1GPDG 3I9NA 3JQEA 1WDLA 4RF2A 3RUAA 4E2YA 1PZGA 3ENKA 4Z9FA 3VZPA 3PHHA 4WKGA 3RFVA 4WNIA 4CMIB 3GUYA 2GNAA 1GYPA 2BFPA 2P9GA 3ADOA 4QFDA 4E13A 1TI7A 3AM4A 2LDBA 3QWBA 4A5OA 3AOEC 2VUTA 4R54A 5GZ6A 1U4OA 1VL8A 1V0JA 2O23A 2P68A 4YJGA 5G4LA 8ADHA 1U5CA 1EQUA 4PGFA 5JO0A 4WLFA 3S2EA 4FFRA 2RCYA 3BMNB 1SAYA 4H7PA 3L77A 4DQXA 2YV1A 3DEYX 3LF1A 3S55A 2ZTMA 4BMSA 1NNUA 3S8MA 3LT4A 7MDHA 1KEUA 1C1DA 1LSUA 3DAGA 2DTDA 4CV3A 2UVDA 1PGJA 4AJ4A 3CKYA 2AE1A 4CM5A 4N5MA 2ZCUA 4DC0A 4ALIA 5EMHA 3N74A 3JQGB 4L75A 1QV6A 3QJ5A 2P4QA 1V3UA 1J5PA 3HSKA 1ENOA 2Q99A 3PHIA 1M6HA 3KYDB 3RUCA 4IDCA 3FTPA 3BTVA 4JXKA 2PKQO 5EL0A 3SLGA 4YB8A 1B26A 2DUWA 1UXGA 1GV0A 3NDJA 3B1FA 5J9GA 3AW9A 2DPGA 4L73A 2VNSA 4ZVVA 4I5EA 3E18A 1HEUA 5FWNA 2JL1A 4J4HA 1IHYA 4GX5A 4YCAA 4GKVA 3TSCA 5B37A 2WEKA 3MJTA 4KTTE 4YRAA 1LC3A 2FSVA 1PU2A 1E7QA 2B37A 2QYTA 4KQXA 2J3KA 4BMVA 4ND2A 1YOVB 1DRVA 4ALJA 4PLYA 3UF0A 5CG2A 1Z82A 4XRRA 5IJZA 3Q2IA 2VYVA 2PD4A 3HDJA 1DAOA 1H6CA 4LW8A 1ONPA 3JQ7A 2YFQA 3FR7A 1LLUA 2AW5A 4Q3NA 3EZYA 4KWIA 3JQ8A 3VZSA 2OL4A 3VTFA 2VZ8A 5IZCA 1DJNA 1QLHA 4F6CA 2EW8A 1GEGA 1SBYA 2V6BA 4KMSA 3QWIA 2BHLA 4QECA 3QVTA 2Z5LA 3OJ0A 4DA9A 3RKUA 3AFNA 5BSFA 1N2SA 1TT7A 2EKQA 4XX0A 5DF1A 2AQHA 3VPHA 1QYVA 2X7HA 4NMHA 1ZMOA 5T8KA 1QLJA 3FBGA 4AJIA 1XU7A 2DFVA 1MG5A 3AU8A 4BL5A 2FZEA 2CF5A 4D3FA 5KJ6A 5IDWA 4EITA 5DBIA 4RL6A 4Y67A 3VC7A 4MKXA 1X0XA 1U8XX 4J4BA 3DBVO 4UVDA 5JYDA 3JQ9C 1QORA 4E5PA 1MGOA 5U4QA 4YYZA 5JYAA 3KLMX 1K5HA 2NVUA 3D5QA 1E92A 4CM4B 1H2HA 3UKOA
chains in the Genus database with same CATH superfamily
3A6HA 2FHPA 4GMHA 3I39X 3EP4B 1PF7E 2DF8A 2G76A 1LXCA 3KT0A 3MXOA 3P26A 4B09A 4CL2A 2O2YA 2BMWA 2ZU6A 4YP9A 1WMDA 4OU4A 1PR9A 2XRZA 3F2VA 3I9KA 3GFGA 3QFSA 2G80A 5ARDA 3IXMA 4Q7LA 4G24A 4JFAA 2WNSA 3INNA 1B74A 2B61A 3QVOA 1RXYA 1M1YA 2E21A 2ZUWA 4IHJB 4N7MA 3LCRA 1M6VB 1KYVA 3QF4B 1SIWA 3TK1A 3L9WA 1WCV1 1V6SA 2O3UA 4PAWA 5ALIA 2UYCA 1QP8A 3STWA 1HQCA 4G0VA 3NG1A 2IIPA 1CDOA 1V5EA 2VTVA 1HDYA 1I6LA 5D3ZA 1Y8ZA 4DUYB 4TTQA 4HDCA 5C1OA 3TUTA 1FFCA 3BMNA 3CWCA 1Y1SA 2G25A 3VC2A 1B0UA 3DQQA 3GELA 3O31A 2HDHA 1VLMA 2ODQA 5LZ7A 2VJKA 3O8DA 3MTIA 3GLIE 2QJRA 4Z0PA 4LY0A 5BN3A 1M0WA 3NHPA 1J2EA 1LEHA 4OOEA 2CE7A 1R4ZA 4ZI7A 3FPFA 2YZKA 3THYB 3NIFB 1Q12A 5BNIA 3FCEA 2FPPA 2JZCA 1RP7A 4JJZA 4AJHA 1I6MA 4ZXPA 4UTNA 4D45A 4B34A 4O4JA 4NMMA 4F96A 2REOA 2O0LA 4II2A 3T7SA 1CY4A 1FRZA 2AG1A 4YCLA 1P74A 4HDNB 4PG5A 2IBTA 2JJMA 3O4RA 4KMRA 1K4YA 4YMTA 2MMCA 1O0SA 1DFIA 1CJSA 4BVAA 3QRWA 3MG9A 1CYDA 2ASEA 4PLGA 3W8RA 3H0KA 2FPIB 3RC2A 4F21A 1MEOA 4A8JB 2QIOA 1F0PA 1ZM2A 3FUUA 4PGHA 3F5QA 1XTBA 3RSFA 3UB4A 1JHVA 4DJFC 4PRYA 1IOZA 1T2FA 1OAOA 2H1OA 1HTWA 4HWRA 4YRSA 5I7FA 3L43A 4EY5A 1U9YA 1AZTA 2Q5CA 1EXVA 3IDAA 3E8XA 3OCUA 4NZYA 3I12A 4CMKA 1YOVA 3DEKA 1N8NA 4RVSA 3ND8A 1E4OA 2NZ8A 2ZKLA 4NKRA 5F1OA 4JLVA 2D5AA 4D6XA 1GZ5A 1ELOA 4DQ0A 2VTKA 2WTUA 3FGZA 4JI8B 2QS9A 2WWIA 3HL4A 1L7XA 3IPXA 3OZVA 2O2SA 1OX5A 3PRHA 4LV8B 1GGJA 3W5JA 5FP0A 3CJQA 4UM5A 2P6MA 1TE2A 1TO1E 1LB1B 1MW9X 2Q6VA 5JXHA 3WGKA 3RASA 1CF4A 1IBRA 1EG7A 1G0OA 1HKUA 1SUAA 1QVAA 1PV1A 2DMRA 2PFSA 3FN4A 3FLMA 3KCNA 4RLSA 3NALA 4ZT3A 2QOEA 3C85A 3ZH2A 4O2RA 5JSUA 3B8EA 3FGPA 4LPKA 3TIIA 3LCCA 4ILEA 4K28A 4UUAA 4BLQA 4EL0A 3SSAA 3EVAA 2PMEA 1FYWA 4Q3KA 4QYSA 4B85A 3JYQA 4P4TA 3EIHA 4LBYA 4L3OA 3FYDA 4F6LA 1FDTA 1RLTA 2WT4A 3AY7A 1ZIXA 3TW4A 1AU9A 4QYWA 2YIDA 3ZE1B 4P3KA 1RWWA 1A77A 2VF5X 5K3AA 3V2GA 4M86A 1LW6E 2PAFA 2AOTA 3TLBA 5JJKA 3GPCA 2BI7A 4OBWA 4CM4A 2R5FA 1I7NA 3W8EA 3EY9A 3QBEA 3TQIA 1EE9A 4MJ7A 3T3OA 4I4TA 2CNLA 1U8CB 2W43A 3L02A 2VA9A 4LOJA 2GSDA 2JJ2A 2HV9A 3D3EA 3Q1LA 1GKLA 4UEOA 4GPAA 1E3LA 3E22A 4DJJA 4B1FA 3MRTA 3CW2A 5I7VA 3N0WA 2XCTB 4BOYA 2AUMA 2JATA 1TUIA 3E9CA 2EU8A 2GEBA 1DDIA 3NBUA 2ZUTA 5LMUB 1AIPA 3IUPA 5C7LO 3OO0A 2B34A 1FUIA 3CLTD 1DRUA 3R3WA 5CP8A 4CCSA 3PHLA 4QO7A 3O6VA 4TSKA 3WE7A 4ACAA 1QHHA 1YJ5A 1IL0A 1XRLA 4NAHA 1JIIA 4Q34A 3WP0A 1CB0A 1HDEA 2WU8A 1MXHA 1E9BA 3Q8XB 4NQRA 3OU7A 1FJGB 4WLNA 1JENB 3TUIC 4HWGA 5JYEA 1AKVA 5GONB 2V0GA 3W6PA 1NYLA 1VOTA 3U37A 5T57A 1YDGA 2PZEA 3L79A 4OGKA 4N40A 1KBOA 3D7SA 5CAEB 1OB5A 4O1HA 5JJLA 1AQLA 5AVZA 3OCCA 2Q5IA 4BECA 1JMKC 2RHBA 2XB6A 5JSQA 1U1DA 1GTG1 3BRQA 1M2FA 5ENVA 5LXTA 1TGVA 5FI5A 3ZDCA 3QYJA 3AG6A 4OVKA 4MQ5A 4Z3OA 1N2ZA 1EINA 3G0GA 3VHRA 4E4TA 1AJEA 1XZDA 5DTIA 1ESZA 1MB0A 2AQKA 3D2CA 3PJFA 4EUSA 4B48A 4FE4A 4G41A 5E4TA 4B7ZA 2RH8A 3RUDA 1WSWA 3AHHA 5HW0A 1F0KA 1E2QA 4PZEA 5M7EA 1K27A 2PSSA 3M7IA 5LCXA 3VQTA 4BQSA 4FFDA 4FCVA 3W4KA 4CMHA 2IDJA 3EPKA 3FPLA 1E6CA 1XRJA 5KSOA 4IXDA 3KYIB 3WWEA 4C6TA 2VYCA 4YQZA 2GMWA 4D4IA 4BB0A 2DHQA 2PKRA 3H5IA 4E5DA 3BQ9A 4IOJA 5LLSA 4UUQA 1BG6A 1R3DA 1SBZA 1T0IA 2FP4B 3F9CA 3DMGA 4X63A 1L4LA 4URZR 3QPDA 3RT9A 9LDBA 1ZM7A 4YMWA 2ZXUA 1T3SA 1F7VA 4FFBB 3EF3A 2V0NA 2ETXA 1YI1A 1G18A 3L4BA 2JFOA 3ISJA 3M83A 4KVGA 2JAPA 2F00A 3I09A 4Z7QB 2YN0A 4CKZA 4DR3B 2ZB8A 3BXPA 1LDGA 2ZWIA 3IBTA 3R9IA 5U9CA 5AOAA 4YI3A 2QUHA 1IN5A 2JLWA 2RGYA 3SYMA 4Q3LA 2QGNA 4XYLA 6PFKA 1QE0A 3B5EA 1S2DA 4DNQA 1XSEA 2QL5A 4EJMA 3G5LA 3H1AA 3V1YA 5JYFA 4R05A 1WQ4A 2J0UB 3ASZA 1S9HA 1Y7HA 1DFHA 1UMDA 3ABOB 3DBOB 4D8VA 3WYNA 2I71A 1SVSA 2OY0A 4DMRA 4D9CA 3DMTC 3CPJB 1L5MA 2P77A 2QN7A 5KQLA 1R16A 3FG9A 1BW9A 1NDQA 4LC9A 1BD3A 4A1FA 4C21A 2IH4A 3NHKA 4XVUA 1MENA 2RC5A 3IEUA 2OFFA 1OILA 1TA9A 4X62B 3L6CA 3L92A 4FMBB 4YPVA 4DGSA 3HJHA 3W8NA 4BYMA 1R0ZA 1UYJA 2M6RA 4KN5A 4J0EA 5KAMA 4AP6A 2XBLA 1X92A 2J3DA 3M4XA 2VNIA 2VH2A 1NUAA 1U90A 1BNCA 1X8KA 3WJ7A 4V3CA 4O8ZA 3ORRA 3QUQA 1TB4A 1SJ9A 3NBZC 3MSCA 3DD1A 2Y1KA 2YNMD 1L4NA 4MVJA 3H1EA 1E98A 1G6KA 3INYA 4UZSA 5CVDA 3EFBA 1QYXA 2H08A 4RTSA 2UUCB 3SDSA 3ET5A 3IKMB 5JU6A 2XTZA 2YZMA 2XMSA 3ONEA 3AONB 4D1YA 4D43A 1U5BB 2ZVDA 4QOJA 1AKRA 3BF7A 1KO8A 1X1TA 3GLHE 1WUJS 2RHGB 3CGGA 4JYPA 3HJFA 2NTNA 2BN4A 2WTEA 3BH0A 2AJDA 2ZR0A 3BWBA 3LT2A 1P1JA 3LQ4A 4A2WA 2ZXFA 3I1FA 2Z9DA 1GWNA 3JZDA 4FEAA 2X0FA 3DEZA 2GNPA 2ZUSA 4H4EA 3QKSA 1T26A 3FDJA 3DAYA 3S68A 3NBKA 4DZTA 2PPLA 3Q7TA 3EPBB 5GJVC 4D3YA 3AR3A 1DZ3A 1PK8A 3ENNA 3QBTA 1Z45A 1U8EA 1YDEA 3P97A 4L08A 2HCBA 4ZPXA 2EJWA 3RC9A 4PSDA 3IJEB 3QI2A 1E2EA 4TKVB 2Q21A 3DBHB 2BHSA 2HBRA 1YVRA 2WG1A 3BZBA 4YWJA 5REQB 1ZD1A 3AF2A 4LXYA 4MNTA 4MV6A 2A92A 4WZZA 5AJVB 1PGOA 2QZ4A 1G5RA 3QTBA 4FW8A 1KNQA 1DJOA 5DTMA 3O8CA 3A3OA 2GJKA 1FFXB 2ZJ7A 4QUEA 3AVYA 3JAWB 1MIOA 1MZVA 1R15A 3P2JA 4YRDA 3SS9X 3LHIA 1ZOOA 3TW8B 3LUAA 1K97A 3DZ5B 1BX1A 1W34A 4UUBA 4J3NA 4BNVA 2IC5A 1V41E 2L2QA 4R71A 4PO3X 4CDGA 1U3WA 4LHWA 1QZZA 3R3JA 5DZSA 3GLFA 4DV4B 5FBKA 1P19A 4DVJA 1L1QA 3N87A 1HPLA 3N2EA 1ULBA 5JSHA 5ELXA 2YJZA 3BD6A 1D8AA 3QJYA 1BWPA 1JPJA 5C8YA 1S3GA 3SQLA 2O2EA 4LKOA 2IHJA 3HKBA 1WXQA 2GJAA 3Q7RA 4DC9A 1E61A 5EWLB 3B20A 5C2JB 4G1FA 4NAVA 3I9V1 3ROPA 4A6DA 2GFIA 4AKHA 4UJ3A 4ZQFA 2I2AA 1FJXA 1CUJA 4XDGA 3RVJA 4N6OA 4E32A 1QE5A 1IBMB 1C2TA 2QTNA 1XZCA 4N3AA 2DFDA 3R6DA 4IJKA 3B89A 5J59A 2QGZA 4U1RA 1WPQA 5H80A 3R7AA 2EFYA 2IITA 1P77A 3UKJA 1QZTA 3FYCA 4DRYA 3K9WA 2F9FA 3L6EA 1XP5A 3D8UA 1CUFA 2EW2A 5I3ZA 1RM5A 3M4JA 1GQOA 4D97A 4B5KA 4YUZA 1I5RA 5JISA 3HU2A 1UF9A 1TUBB 2QRKA 2IEAA 1J0AA 3R3VA 5EUMA 5HKOA 1OMOA 4BUJA 4CMJA 4X1IA 1JA0A 2FZ5A 4U39A 1G20B 4NABA 4G8DA 3RFCA 4JVSB 3CMMA 2WJPA 2GD2A 1C9NA 1W59A 3ETLA 3LA6A 2EP7A 5FAKA 3ZHVA 1UIRA 2AFHA 5HE8A 5DHFA 4GI7A 2REQB 1QTNA 3CYFA 3OPQA 3U0BA 4KV7A 1NVXQ 4HLQB 3T7CA 3IOBA 4DMFA 4MW0A 2UZ4A 3LKDA 3ZC3A 1FFWA 2GUWA 2WLTA 3DJYA 3DWGA 3ILHA 3NGXA 3PPXA 1PGNA 5LB4A 3TL6A 3UMVA 3IAM6 3SXJA 4BFCA 3WK6A 1B2RA 4W7SA 3OEYA 1GSIA 2OZEA 1CBUA 4WBNA 1U1IA 1I0IA 2DTEA 3TCXB 4EL5A 4MK4A 1A2OA 3BPSA 2C58A 1GFWA 2FSIA 3EXEB 3IPRA 5ICMA 3VNUA 1HL7A 2IUTA 1OWNA 1N75A 1NXXA 4HDMA 1LLDA 4DG9A 5A9SB 1HDGO 2DYKA 3FCYA 4MVJH 1H1TA 1KFKB 4HRVA 1PK9A 4YV0A 4I1PA 3IHKA 4HAIA 1GCGA 4R3NA 5IANA 2I4NA 1KZHA 2XGMA 1ZXBA 4LE2A 5HMLA 4CTNA 1Y82A 2QTCA 3ZK9A 1SVMA 3N6VA 3EGCA 2QQ5A 4QBKA 3GDOA 1JVBA 3OE1A 1WCYA 1ZM3A 4L8LA 3U60B 3DJFA 2R5NA 4WCFB 3K53A 1X1CA 2Q0XA 1AMOA 1UBCA 3AY3A 1IY2A 4Y1RB 1MC8A 5ALPA 4AYXA 4EB8A 3UPUA 2RB4A 3LHKA 1L0BA 5NLLA 1UFKA 2VRCA 3F96A 4I9GA 2R00C 1A5BB 1NUPA 3I8OA 4XUEA 4BAGA 1OTHA 2R62A 4N9QA 2HO5A 1E1RD 1W6UA 1AKTA 1WXGA 2EF1A 2IZZA 2QRGA 3LBHA 4CMCA 5L9AA 4FGSA 2V03A 4KKVA 3Q41A 2JC3A 4UAVA 5EFZA 1AK1A 1SCQA 1VSTA 4L4XA 5ERXA 4C78A 3TGWA 3GEBA 4IHKA 4ER7A 2BFNA 5TPWA 4BRUA 2EGGA 3LLUA 1AB5A 2Q0HA 4WFIA 4KRYA 3VO1A 2PJZA 1FW6A 1NJ8A 1W73A 2FPGB 3LLMA 3OETA 1VE9A 4RD3A 3RVDA 4LHZA 1T43A 2N47A 2X2FA 3DLPX 3SEAA 4B6GA 4F56A 3MJCA 2HJHA 2JFYA 1XA0A 1CIJA 1CHDA 5GADl 2FDCA 1YZTA 4D3ZA 1O89A 2WSBA 3DLCA 3CNHA 3ZQ6A 2Q5EA 1KDYA 2PFGA 1DJPA 1A9TA 3CZ4A 4S05A 1FU4A 2AN3A 1Z6XA 4LHXA 5JVDB 3O4GA 3BMQB 3MCVA 2D8MA 2VH1A 3ICCA 3NDRA 3BB4A 5FUYA 4BGEA 5MHTA 4JV5B 2OXCA 3Q7QA 3KYBA 4MWOA 1WUKS 3P2EA 3IVCA 4A2PA 4JYBA 5E6RA 4RTNA 1E6KA 1E7RA 2RAUA 1M66A 3G0DA 4PSCA 1WD7A 3PD0A 2DM6A 1DHTA 3I76A 4IQ8A 2RH5A 1JJIA 3PGVA 5GIPE 4WX2B 5DMXA 1ID8A 4NWIA 3QX9A 1SXHA 4H3KB 5CYPA 1JPUA 3C3MA 1J21A 4Q4JB 1JDPA 4W1SA 1GG5A 5ETJA 2I1VB 2VVTA 2NW6A 1U4SA 1C4KA 4JT4A 4ZWNA 2E48A 4LF9B 1ZUNA 3CF4A 2R8PA 2HM7A 2PUTA 3DL4A 3FIUA 2JARA 2GRUA 3LW8A 2E4XA 3OU6A 2UZ3A 3G3EA 1MV8A 3WGYA 3UKDA 4MWCA 4CE6A 3M6MD 3AZQA 4S1WA 3MGAA 2VQ3A 2H8GA 2GEKA 4JXJA 4O2AB 2CW5A 4DABA 4CIYA 4CQLA 2V4UA 4EG1A 2L69A 1YR9A 2FMXA 3F98A 4FYXA 4OP1A 4YCDA 4UJ5A 5DU2A 1I4EB 5T4BA 3M9XA 2OO7A 2G04A 3DTTA 4TQUS 2OKCA 1ZESA 1N5RA 5HCNA 3U81A 4KE6A 2JGFA 3U7FB 1KU6A 1J8DA 4NK5A 3UWMA 1QX3A 1GAJA 1LUAA 2IH2A 2C3YA 2OXFA 2VJLA 4CIAA 2AEEA 5IEBA 1N4DA 3F3MA 2HI0A 2ID4A 4JP2A 4OAQA 4BLUA 1B16A 2OO5A 3SYLA 1E9VA 1ULSA 3JVIA 4E0BA 4ZV4A 4O4IF 4IKPA 4FYYA 1EZZA 2J9RA 3BN3A 3LDHA 3N3BC 4PX9A 7REQB 1B0PA 3ZHYA 3HB9A 3NB0A 1A8UA 1CK4A 4DA8A 1US8B 1DT5A 1GV1A 2P41A 1Y4UA 5ICSA 3CNLA 5I7AA 3N9IA 2GN0A 1GRNA 1YMVA 2PZFA 3IO3A 3AGQA 3BSYA 2HGSA 1XL0A 2OM6A 2Y1EA 4JR2A 1U63A 1V5FA 2VT6A 5FO1A 3V9PA 3NHUA 3KLOA 1JLLB 3OY2A 4KU4A 4C2AA 1MB9A 4QT4A 5CDGA 2Z6UA 2HPHA 4Z99A 1UZMA 1U8YA 1DIAA 2ZAOA 1OQAA 2ZBEA 4EY7A 2C8VA 3D3WB 2V7EA 3Q15C 5HDBB 2I1LA 5B3JA 2AD5A 4QXQA 4ZJPA 1XWFA 3T5BA 3ZXIA 1EFTA 2Y0CA 5FR1A 2QRJA 4OXNA 4JQCA 1W85A 5G3YA 4B3XA 1EFLA 4GWKA 5TT0A 4FR2A 1JWLA 3V32A 4E22A 5MN5A 2O5CA 3CZ5A 4YO8A 3MN1A 3TLGA 1NNLA 3QJGA 4B0PA 3UATA 1AQUA 2X5OA 2GYYA 4PAGA 1DSSG 1J0CA 4F3KA 2YCLA 1DAHA 1O95A 4ZALA 2C2KA 2Q8NA 1HBJA 3G7SA 3MD0A 4WESA 4B84A 4BE4A 5JNTA 1TT5A 4IUYA 3D4PA 1KY5A 1J39A 2QNIA 2ZI9A 3FHJA 2QL6A 4QULA 1E60A 4AQ7A 3EP5B 3NBQA 3ZE6A 4C3ZA 5K3OA 3MJVA 1H2XA 3OZDA 5BVGB 4JLKA 1O9BA 5GVSA 4XSGA 5EZYB 2BTEA 3S4YA 1Z8DA 4RQBA 3FETA 1FYXA 3Q3CA 4DA0A 1IDN1 4JA0A 5ILOA 2N1MA 2EKZA 3OIDA 4X1KB 5CA1B 1KTIA 4A2QA 1IN6A 1QDLB 1YBHA 5FBHA 2ZYUX 3AQIA 3KXLA 1UDWA 5FXMA 3ZWNA 4D99A 4DIDA 3A9WA 5BXQC 4CKEB 4XCXA 3RS5A 4O3FA 4UHEA 2ZSKA 2O4CA 2I6GA 1ZD5A 3OF2A 1LTQA 3NT4A 2BKXA 1K6JA 2VSNA 5AVUA 3KUUA 3D8NA 1Z47A 1AZSC 4U7GA 5BQOA 4FFVA 4ZDJA 4EZEA 1G8FA 1H0KA 4E70A 3A25A 2YYAA 2AI3A 4COOA 4ZYYA 2RJOA 1RC0A 1PVVA 1F38A 4TYNA 4BLSA 3I58A 1L4YA 5JYBA 3OQHA 3JX9A 4R40A 1Q0HA 4CL0A 4P9NA 1R7RA 2BI8A 3TRDA 4B3FX 2UYQA 4S0ZA 5K6TA 1NUUA 2BM8A 5HF9A 2ZJFA 1L7BA 5G02A 3DOOA 2Z58A 4OU5A 4UZFA 5A5DA 5A7FA 5BQ5A 4NDNE 3K0SA 1XHFA 1JDUA 1CC1S 2XJ4A 3J7TA 4CM1A 2ZJ2A 3DKKA 4HX5A 2GCOB 2CHVA 2FOIA 4ZT5A 4J43A 4CUKA 1QQ7A 4DLXA 3RSZA 3I28A 1Q95A 3EEBA 1W96A 1WXDA 1KMHB 1GFIA 4WH0A 1SBCA 3U5ZB 3NHSA 1ZVKA 5ALVA 1FUUA 4F7WA 1Y8QA 2OUKA 1WXFA 1KEWA 2KI5A 1U0NA 1T4CB 2H2HA 2WSLA 4NFLA 2ERYA 1P1CA 3GBVA 2YYSA 3RM3A 4YCNA 4LVOA 2QIPA 2OBMA 4BO0A 4IILA 2WDPA 4GRAA 1JH9A 4DN6A 1TGYA 4GMKA 2BFMA 5IVHA 5A0TA 1TM3E 2A1TS 1USWA 2OECA 2POQX 3OP4A 3DVAB 1ZVQA 1EFRA 4FN4A 2JCSA 4PTZA 1NVFA 2BFCB 4BFZA 2IL1A 2YVKA 4OO3A 4S1PA 4XSVA 5TT1A 5JNUA 2Y2UA 5CT9A 3HBAA 3HWWA 2XW6A 3DB1A 1JEEA 3F8SA 5HZMA 4NBVA 2XV1A 1WRBA 1QFJA 1KRWA 4O4IA 3HXMA 2FQXA 1ORWA 4FZJA 1JFTA 2FPUA 4XOIA 3T3DA 3G13A 3OUZA 4IV5A 2J5BA 3T5DA 3E84A 3D8HA 3G2HA 2PZ8A 3R7FA 1IIBA 2X23A 3AKZA 4N5NA 3HB0A 2FWMX 4CEIA 4PC3A 4Q1BA 3WIOA 1SOAA 2IP2A 1MPTA 3FLBA 1MHMB 3ETDA 4BQOA 4DCTA 5BSKA 4LGYA 4M4SA 4PCLA 4TPKA 1ZICA 1EVLA 3RHTA 2YHIB 4OHXA 3A7DA 1IG3A 2JI4A 3ZCSA 4Q1AA 2FPNA 1JDJA 1KFCB 1OGIA 3BGOS 2XUIA 4F5ZA 3L7YA 4MR8A 4K8RB 1TA4A 4NX2A 4DLPA 2EARA 2F1JA 2P67A 3A0RB 1L4BA 1FS5A 1JXQA 2PH1A 5ALHA 2W6IA 4Q5IA 5LWHA 4HWSA 3V3TA 4YJHB 3P4YA 2A67A 3M6AA 5AYVA 3RS4A 1DGQA 4REOA 4RHEA 3RT7A 3KJZA 3BWYA 5C35A 4CM8B 2H0RA 3HYTA 1DKUA 4N3BA 2CLLB 4KDEA 3RLIA 1T2NA 2VCYA 4W9RA 1W5TA 3W5IA 1FLAA 1X15A 2GEUA 1IK6A 2OG2A 5BNZA 4FMDF 3EBPA 3U6BA 4EG0A 3PFFA 1CY2A 1GQQA 4PYRA 3FOFC 2NUPA 4WNAB 1R64A 2VYQA 5KNLA 4RYLA 1TKRA 1TRKA 2XVZA 3DHNA 4G5FA 4J4TA 2MINB 1C29B 2ZYGA 1XDZA 3OC6A 4PNHA 4LFBB 1N2CE 2ZSEA 3Q9SA 5ILGA 3F0TA 1BE8A 3GZ4A 2WQ6A 2J9XB 4QO8A 5KREA 1WZEA 3K70C 4JB0A 3JYOA 3C4QA 4V0NA 4EECA 5K20A 3HTXA 1YNSA 3W3AA 4OMFG 1XTJA 2NUAA 2P9CA 4G1VA 3ED1A 2JIOA 1M1NA 4P4SB 1Q6ZA 2AVDA 2AG0A 4LTMA 5I9IA 4D74A 4ZC1A 3GFBA 2V7TA 3UMMA 3X43A 3L0PA 3CEHA 4RPKA 4QFMA 1PBNA 5G0VA 5H83A 2BI4A 2ZB7A 1MFZA 2MR5A 4D9BA 4NBKA 4G81A 3RFFA 2IXAA 4N47A 5GP1A 3ZVNA 5FL7A 2XE4A 1YJ8A 1P9LA 4ZVNA 4RGBA 3ZCTA 4LYYA 1PT9A 2C9YA 3R0XA 1BOOA 4BNGA 1FMLA 1QR6A 3F71A 3RVQA 4BTLA 5AUOB 4F12A 3TUJC 2OGTA 1N0UA 4GEKA 4RK6A 3EULA 1ODFA 1KVTA 1Q17A 5LQCA 3Q3HA 2Z5GA 1EVYA 1K88A 2H00A 2XSZD 3G2IA 3SHWA 4B80A 5AXBA 1YVDA 4BNDA 5F76A 2W0SA 4YRPA 3BBPA 1GZVA 1X80A 2P9FA 2WJJA 3E5MA 4BWYA 1E5LA 1QIGA 4RDHA 4LJ6A 2X6RA 5TF0A 4Y9SA 5K99A 2X1HA 4GOKA 1YQ9A 1R5JA 2ZSJA 4YLEA 1RDFA 2E6UX 5TMEA 1IAQA 4WJKB 5CDUA 2JEOA 5I7OA 2D1TA 2YQZA 3IWCB 3U7QB 2PGJA 2NU7B 1S2LA 5J23A 1C3VA 3DH0A 2FSPA 3B7WA 3OJEA 4JYMA 1E3DA 2XE7A 4F9GA 5CA0B 1WEKA 4YBZA 4DIEA 3ESYA 4NCIA 1SNYA 1UP6A 2PKQP 3EP7B 1HT3A 1KJJA 2NZYA 2QDKA 4QDUA 3GEDA 4BAUA 5IBCA 2O07A 4RZHA 2QM7A 2KBFA 5JBQA 4GPIB 4M21A 1UBFA 1XZPA 3V00A 2Q4RA 4BGUA 1KAQA 1DMRA 1RJ9A 2VDLB 3D7MA 1G38A 3B1VA 2XA1A 1J2YA 3WLJA 2BZ0A 1K92A 4W82A 2O1SA 3MXTA 1R4MA 5PGMA 4EEZA 4D0SA 2AL7A 3M33A 2DC1A 1E8NA 1TC2A 2H06A 3GT4A 4UREA 3W2TA 5BWNA 4ENPA 4JD5A 2EHDA 5DX1A 1WE2A 2G7ZA 3I9FA 3GGCA 5JJBA 4Y2JA 4I4CA 2VP2A 5FB3A 3NUQA 5F5XA 1G5HA 1U1EA 2VPPA 3GGPA 4DLSA 1ZNQO 3BFPA 1UR5A 4QARA 3G8YA 1DC6A 3OF3A 3ROMA 3IIKA 1C50A 1NFRA 3N7AA 3RVSA 3TKYA 4TYYA 1MUUA 4YO7A 3ZJVA 3ADDA 3V4LA 5HS4A 1HH4A 3UIEA 1UC4B 1A5TA 4HY3A 1R00A 4BLRA 3V8PA 1T9ZA 3LY9A 5K0GA 1BYIA 2HLDA 1PE0A 1PI3A 5MDHA 2EFDB 3CUSA 1OLXB 3JALA 4CIVA 2AN9A 3L93A 3O4HA 1TD9A 1DFGA 4NDAA 2OBYA 3TQFA 4TRNA 3KZXA 5IJAA 3WFIA 2C9OA 4DBLE 5BSRA 1LKZA 2C1EA 4F8EA 5EKTA 3L7LA 3QLJA 3IP3A 1ONBA 1KQGA 2CZQA 3TIVA 4KFCA 1QOQB 4KPFC 4OPMA 4LYFA 1G41A 4QRDA 5EJ9A 3EGVA 1XYYA 1HDOA 1E5XA 2VK8A 2WSSD 4FS8A 5E7JA 4CW7A 5BY2A 1F2UB 3O8QA 4ZJZA 1U8UA 1OTYA 3CO5A 3LPDA 1TKAA 1WVGA 2QX4A 1KVSA 1VXRA 2HT1A 4M9RA 2VXYA 2F3RA 3RYIA 3P1JA 3QM1A 4GNKA 1W5BA 4Q3OA 2PLAA 5LQRA 4JQOA 4JELA 4UNNA 4R2JA 3PQ4A 5LOVF 3RIYA 3NR2A 3U56A 1J00A 3KALA 2EOAA 2W4QA 3ZZTA 4Q1CA 5AESA 1ONNA 2OK8A 4G8BA 1FJHA 4UOQA 1F3LA 4RH3A 1UL1X 3NHAA 5AK6A 1GQSA 3CJRA 3LQKA 1NLFA 3KS9A 3EIWA 3HVUA 3FWNA 3GEIA 3TN7A 2FPXA 4EARA 5CM8B 3I9LA 2BE9A 1NRIA 2XUQA 1IVNA 1MX1A 3PPWA 4XUGB 4PG4A 1A69A 4Q15A 5TS2A 1AQJA 2B0JA 2HDNB 1C1XA 4EIWA 3UGJA 4DJTA 3ODGA 2MWMA 5BSUA 2NSLA 3ZV4A 3OCZA 4RIHA 3WOHA 2ZTHA 2ONYA 2P6PA 2UAGA 4NBWA 4NECA 3C1OA 4UFOA 4JXXA 2FR0A 1ZXXA 2W37A 4RKRA 1D4FA 2JLBA 4YIKA 2XQFA 4D9JA 4G67A 2R44A 5DI3A 2HMSA 4IICA 1IM5A 2ECPA 4X3PA 4JCCA 5H0IA 3CY6A 1B15A 3W8FA 4Q47A 1J2TA 1LDYA 3IDQA 3SX2A 3L04A 4DEVA 2M98A 5IK2A 3UNXA 2G1JA 4C07A 1P91A 3ETEA 5IYZF 3SBEA 2Z6AA 4NBLA 3B5JA 3KWJA 4HG2A 3W7VA 3WWPA 3KU1A 1E89A 4U7PB 3GG9A 2UZ1B 3I1IA 4UOEA 9GPBA 4MKGA 2D06A 3N05A 3R09A 4BLWA 4FXOA 3GZNA 4PHTA 5ALFA 4LF4B 3X1YA 3IDFA 3ZS8A 3ZZ1A 4OQ4A 2GK6A 3LPAA 3ESQA 4CKCA 2I3DA 2WOJA 3D1JA 2IP4A 1FSFA 4O4LF 4Q7MB 4TL8A 5EXSA 3Q7SA 3M2TA 4HZGA 5AUNB 1W0JA 4PPNA 4BO5A 3SQWA 1A3CA 1L5GB 4H7FA 5D8DA 4GSLA 3PVCA 1G2PA 5BSVA 2H85A 4QHYA 2M6SA 3HXOA 1CQIB 3DWEX 3GLVA 1SPBS 2ZIAA 3IBGA 3MW8A 4EB6B 4DLKA 3LM8A 4JY7A 1JV2B 5DW0A 2EJBA 4WA7A 3A9VA 3UMRA 4BEJA 1IWBB 1YB4A 2ZJ6A 2W71A 3TTWA 3IE0A 3I2FA 1FMTA 1TTTA 4JSRA 1QB7A 3GLIA 5CHEA 3W9SA 1LDNA 3S2ZA 3B85A 3NWJA 1EUQA 1Z63A 2RG7A 1ZONA 3NFYA 2HHCA 1LPPA 4DTIA 4PX5A 2XEDA 3L9XA 3SJCA 1U7TA 2OVFA 3EVGA 1GL6A 3P45A 3AEZA 3OJLA 3ONVA 4JT8A 4C0KA 4ZTUB 1TK2A 3C3EA 4QG7A 1SBQA 4W63A 1OUMA 3ZHBA 2ZJOA 2PS3A 4BKOA 2I6FA 2BTQA 5I47A 1SU8A 5JS1A 1DTWB 4NESA 1FLDA 1KMIY 1WZUA 2DSTA 2JGDB 2Z6QA 5HCUA 2RD2A 3NHLA 4IKOA 4X61A 4EKIA 2W58A 5BWMA 5HZHA 3EQ2A 4R9SA 3EDYA 4UUMA 5JR3A 3NDBB 2HTEA 1J20A 2B8NA 1R12A 1T0JB 2WHRA 2YBEA 1JL3A 4I50F 5EMLA 3ABZA 4DADA 4EP1A 2PQ2A 1V39A 4RDXA 5KBYA 1LNSA 4C7OA 2OO3A 3KOUA 4ZVTA 2NZVG 1E2BA 4ZXFA 2IYEA 1PFVA 3WNVA 1VHLA 1G21B 3A6JA 3THRA 3O91A 4Y6QA 4YCMA 4RVDA 3PFWO 1GNPA 4P86A 1CNEA 2H1CA 3WJ2A 4YMVA 4Y9RA 1U02A 3CA8A 3ZBUA 1FC0A 1GO2A 2JZNA 3T0GA 2V3CC 3B1ZA 5D6NA 3R5HA 4YONB 3NBFA 4IG4A 4OX9B 5EZ6B 2CB0A 1RHMA 1X2EA 5AICA 3H6GA 4Q1VA 3VDNB 2CUZA 2BSAA 3GLHA 4A4DA 2AN5A 3BAFA 1RLIA 4KACA 1U94A 1LSOA 3WIDA 5LOVA 4Q6BA 3LWBA 3EXG1 2FZCA 1QRTA 4DF3A 1C7ZA 1NR1A 1L6IA 1D6MA 1D7OA 2AYZA 2ODTX 1P17A 2NN3C 2WHPA 3D1VA 1PEDA 1BMQA 2FEAA 4MLCA 3VH3A 5JPDA 3HDYA 5IVPA 2R65A 2E1PA 4I4NA 3KQMA 1T1GA 4JOSA 1T6BY 1OXVA 5DHUA 3UV6A 4EO7A 3PJRA 1I5EA 5JPCA 2WIAA 3L4BC 3OWXA 1N2HA 4PGMA 4YGYA 4JJ6A 1W1IA 3E70C 2HQBA 2PZAA 5KNCA 3DZFA 2VS1A 2HRBA 2IV7A 3WAKA 4US2R 2VEOA 4CLOB 1IE3A 2QT9A 2GPYA 1AV7A 3S44A 4GPTA 3ZX5A 5EEGA 2X58A 2QA5A 3TVYA 2VWQA 4HOYA 3EG5A 1FB5A 2ISCA 4CN9A 4R0VA 1GGEA 4MYSA 4WLOA 1QP0A 3H7IA 1G98A 3L8CA 4IJ6A 3I62A 4MA0A 5HFJA 4PW0A 3FTFA 1PWZA 5AI0A 5TRTA 4KDCA 4OBBA 3PJGA 3LWDA 3QXHA 5YASA 4OYHA 1X42A 2OQ2A 1NI4A 1U0JA 1RBZA 1SD1A 3H5OA 1E9EA 3VOAA 3RC7A 1GAEO 2YKGA 4BNWA 1Z26A 2C0PA 2JD2A 5DLYA 4MMZB 3SHFA 1YOBA 2W00A 4JDUA 4D7AA 2C4NA 1A2KC 2XDQB 5TS3A 1X7WA 3D6AA 1KRHA 1VECA 1JFLA 2J3EA 2HMTA 2EXXA 4HRXA 4RY2A 4X92A 4PHGA 2RMKA 3HC7A 4C1NA 1VSVA 3HUDA 3LU1A 4GHWA 1VJCA 1P62B 1ODSA 1XCBA 4GI5A 2XGOA 1JZQA 3EGXB 2QN3A 1QGUB 4K6GA 2EZUA 4TLBA 2WWRA 2NAFA 3D4IA 4G4IA 5NULA 4X94A 5I6DA 3KHTA 3PGLA 4N49A 2J09A 3FDXA 3QK7A 3DM9B 1TYEB 1E1KA 4X1OA 1QH8B 3HB5X 3QX8A 1MR3F 1NPDA 1NM5A 1QHFA 3O9VA 3SBOA 3CCBA 3D6VA 2VT3A 2WJAA 1JDZA 4JEIA 4RSRA 4FI3C 4V0LA 4PINA 4X95A 4PR3A 3HJBA 6ABPA 3HMKA 2YOHA 1I2BA 1OA1A 4FD2A 2VI5A 2OMKA 3DP9A 1NVAA 3F67A 4K46A 1SA0B 2CUTA 2IZ5A 2VSFA 3E9DA 1A88A 4XYBA 4TYMA 3CG4A 2FFHA 2ZB2A 1GR1A 1X6VA 3G2OA 4R69A 3WISA 2CLEB 4BNKA 4EGQA 3AI2A 4JJIA 1QM5A 2A0KA 1OC2A 2EKLA 3SDBA 4DEXA 4QGBA 2CMGA 2J3LA 1CF9A 1KI6A 1BH6A 1NVVQ 2BCGY 2FEXA 3PYMA 3AC0A 2HRQA 2WAAA 3JYLA 4FEEA 3ESBA 4QOHA 2QAGA 3OQIA 1N9GA 4K81B 4IMPA 4HB0A 1TM5E 3HABA 4R7ZA 4KG7A 4L9SA 1OF1A 4QATA 4I50A 2VJMA 4BO8A 1OU4A 5CDYA 5HRCA 2CKDA 4FCCA 5EWMA 2X8LA 2VEDA 1IPFA 1MU0A 1RJGA 1HL3A 4ILKA 5GM1A 2XZLA 1BXGA 4LQ4A 4DSTA 2R66A 1KDZA 5KU7A 4HVLA 4QU5A 4EMSA 4PXYA 2GN8A 1FLVA 3FWZA 1NPYA 1UK7A 2I6XA 3AR4A 2O4UX 2B35A 5EZ5A 4NJMB 3VR6D 3IOMA 5HS6A 4KN8A 5DM0A 3BCHA 5A7HA 1ZH0A 1Z68A 2CYCA 4MQBA 1X87A 2IYZA 2FWRA 2VJAA 3KPYA 1OLUA 1RRMA 1Z7GA 4P31A 3WRWA 4EPTA 1HK7A 5JMTA 1TVKB 4MRMB 3QOWA 5FTMA 3KKNA 4FNGA 1QO7A 1N5IA 5AW8A 3QKUA 1WV0A 4ZANA 1YMUA 4EUNA 4EVQA 4TRMA 3C1AA 3FAZA 2SKEA 3WRXA 4F71A 3CPSA 1RYZA 3OFNA 3GD5A 7GPBA 1JB9A 3L4KA 4ZI7F 2A9PA 3UK0A 4ZZ1A 1QV7A 1R0YA 2XQVA 4GQAA 1E7YA 5EPUA 1XZMA 3R0QA 1C0IA 2AUNA 3WV5A 4RWZA 3QEKA 3LNTA 3H1TA 1IZYA 1PL6A 1KBZA 2VK2A 1VL0A 3KT3A 4X0EA 2W48A 4I3GA 1VKOA 3UAWA 5LP6F 3DEHA 5AK5A 5FLYA 1CEXA 5KMGB 5BV8A 4MV3A 3BUSA 3FUXA 4CV0A 4UUOA 5C52B 4IF4A 3E9NA 1E6LA 4DY6A 4PTLA 4AP5A 2P4SA 2C7VA 2X0IA 2PRYA 2EG9A 4DRZA 2YTZA 3BEDA 4TT3D 4AXBA 1ZFNA 1W2WB 4NPCA 4NU0A 2Z3ZA 2YNMA 3OIWA 3P71T 4M8KA 5EINA 3B52X 1HV8A 2BISA 1G8AA 4GMFA 1H8EA 3U80A 3M6UA 3K0BA 5JJ5A 1QH1A 1R27A 2V98A 3E0XA 3EXFA 4EHBA 5BORA 3P52A 3QVMA 5CFZA 4HWOA 4YAKA 2C9CA 4G0OA 1XG5A 3HDTA 1F9EA 3RTCA 1XR3A 4N8DA 2XDYA 5EHNA 4EZBA 1UBGA 3C5WP 5THKA 1QQ6A 2YINC 3ZYCA 2IEBA 4N5DA 4RSMA 2YFHA 1MJHA 4Q1DA 2VRBA 4PVCA 3PPIA 3RSLA 3VU1A 1VMDA 4Q37A 4U8GA 1AO3A 2A5GA 1ECJA 1Q92A 2YVUA 2ZREA 4X8HA 3SQDA 1UPBA 4JP8A 5HM8A 2HA4A 1XCOA 3GCXA 4HQFA 3AHJA 1HUQA 2Q5HA 3OLZA 1HDXA 2FUEA 3LX4A 4LXGA 1SCUB 3BXZA 3C7KA 4FWBA 4EYGA 2IOFK 4HLUA 1QH9A 1ZYUA 2JF0A 4XPIA 1D6NA 3MGKA 2LE0A 4MZDA 5G0TA 4NMWA 1PWHA 4R1QA 3GLFE 3L8YA 2PYDA 2QDXA 3C74A 1QHYA 3T9FA 4DUPA 3OEHA 4EF5A 4ZEMA 4CFZA 5I01A 3I23A 3WICA 1XELA 3LWNA 1RI3A 2OQIA 2SHKA 3R75A 3UWKA 1YKGA 4E88A 5JMOA 4OMCA 5AMXA 5K7SA 1TYZA 1WCXA 1JI0A 2Y1DA 3B6IA 3VNSA 3FNHA 2RI1A 3V6MA 4GBJA 4KLRA 5A4DA 1S96A 4HPWA 1G8MA 4NCKA 4Q3BA 5AKXA 1PL0A 3TDNA