4F3YA

X-ray crystal structure of dihydrodipicolinate reductase from burkholderia thailandensis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
b'SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLGKQTGVALTDDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVFSANMSVGVNVTMKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGRDAGFFDMQDVLGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
molecule tags Oxidoreductase
source organism Burkholderia thailandensis
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
total genus 79
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4f3yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f3yA01
3AY3A 4G81A 2YQ4A 5JLAA 1PEDA 1T2AA 1KEUA 2Y1GA 1EVYA 5AXDA 4ZD6A 3INTA 3NAQA 1Y81A 3HDQA 1X0XA 2O3QA 4OIMA 4PLYA 4QQRA 3OA2A 2OP0A 3F4BA 3HN7A 3CMMA 2Q4BA 3X2EA 4WLVA 3JCZA 1LU9A 1IUKA 3KOUA 3NRCA 5AXBA 1H6DA 4K6FA 2QRLA 4NMHA 2HSDA 5I8ZA 4KDFA 2VYVA 3VTFA 3JQDA 3ENKA 3GZ4A 4E5MA 1HE4A 4CMGA 3CUKA 4HBGA 4FW8A 1IZ9A 3KTDA 5C5IA 2WDZA 3ETGA 2OFPA 3OHSX 2PNFA 2OBYA 1XIVA 3RCBA 3LF2A 2FY8A 2P2SA 3Q3CA 1GUZA 4JN6B 1X13A 1ZMOA 2BGMA 3HHPA 4RGBA 4RVDA 4BNJA 2EXXA 3HFGA 4UREA 2EHDA 1ZSYA 5IG2A 4J4TA 3WTCA 4YT2A 1LBEA 4IJKA 3B1FA 3D5TA 3RUFA 1N8KA 3UOGA 3E9MA 2Q45A 1YOVB 3ZZNA 1GQQA 5GMOA 1VM6A 5EESA 1LJ8A 2G1UA 2JHGA 2QRKA 5JCXA 3V1UA 1AXEA 1Q7GA 3NGXA 1GQYA 3DBRB 4DBVO 4UVHA 5CPFA 3TFOA 3CE6A 1H6BA 3IQDB 1NWCA 4F46A 3I4FA 4WJZA 3G0OA 4W7IA 3O03A 1NNUA 1O9BA 3FCOA 1EEHA 3G17A 1D3AA 3ZWPA 3IUSA 3DAGA 2HKIA 1YGYA 1Z45A 5BR7A 5JE8A 4RPHA 2I3GA 1P1JA 2CVOA 2ZB7A 4R41A 1DFHA 5GZ3A 1LDBA 3BA1A 4GWGA 1HDCA 4C7KA 4WLNA 1RPNA 1Y1PA 4XJSA 4KP7A 3TQHA 2CF5A 5FWNA 3AK4A 5L95A 2NUAA 5TS3A 4EUHA 1OMOA 1EE2A 4Q3BA 1ZK4A 2VUTA 1F8GA 1NASA 2O4UX 1HE3A 1I0ZA 2ILTA 2IEDA 1ADCA 2Y68A 5CEEA 1P45A 4PIVA 3GNSA 2P4QA 3E6AA 3GRPA 2Q2VA 3VC7A 2YZ7A 4OAQA 1MG5A 3JV7A 2J5RA 3H9JA 1DOHA 3TZKA 4E2ZA 3ONDA 3ZW8A 3V2UA 2X86A 3P2YA 4UVGA 3V1TC 3ST7A 4CLOB 4RV9A 4UEKA 1P1RA 2I6TA 1ZK1A 2I5PO 4QFCA 5FYDA 5DP2A 3T4XA 3RKUA 1TT5B 3WLFA 1UXIA 2PFGA 1RM5A 4M55A 1UAGA 4PLCA 4UUOA 3PYXA 3DEYX 1PJ3A 1A9ZA 5H81A 1KVTA 4ZJUA 4WLOA 1D8AA 5TNXA 3ASUA 4I9NA 1GZ6A 4XGIA 1H2HA 5LCXA 1VSUA 5IN5A 5JYEA 1Z6ZA 2C29D 1AUPA 3BMCA 1W4ZA 3C3XA 4WASA 3DOOA 1A27A 2I65A 1L7EA 4TVOA 4HFJA 3AI1A 2JAHA 2HMWA 3EW7A 4YT5A 2R00C 1HDZA 1K5HA 3FNGA 5A9RA 5EQDA 4P4GA 3AOEC 3U0BA 1LNQA 4TRJA 3NT2A 1E77A 2IZ1A 4GKVA 2HU2A 3GG2A 5JAIA 3ZDFA 2AE1A 4WOJA 1ZXBA 4ALLA 2PLAA 2D59A 4WCFA 4DTIA 1ONNA 3GT0A 2PGDA 3ETEA 1OZAA 1EBFA 2VYND 3I6IA 3TZ6A 3O8QA 5TJHA 1NPYA 4D43A 3GF4A 4BHTA 2EKLA 1C0LA 4XB2A 1YQGA 1LLDA 3JQ9A 1EDZA 4Y67A 3D3EA 1NX6A 1F8FA 1EBUA 3BHIA 4AJNA 1J49A 2BMAA 1ZO8A 1RM4A 3AY7A 4YRBA 4NQZA 2GCGA 1HT0A 3DONA 4MKXA 3NT4A 4JBIA 5FI5A 1M66A 1ZEJA 3O26A 2PH5A 4ZVVA 4QO7A 3ZHXA 3ICPA 3JQAA 1T2DA 4BKQA 2A4KA 1GV0A 4MDHA 1HSZA 4YA6A 3VAZA 4CM4B 1BWSA 3FTPA 5AXCA 4XD2A 1YBAA 3W4JA 4ZRNA 3A4VA 2Q2QA 4FSHA 5CDGA 3HJAA 4YPOA 1GEGA 4LSMA 3DFZA 3I3OA 1KEWA 2HJSA 3QA9A 3H3FA 2C7VA 1IL0A 4L9RA 5TT1A 4CM8A 5KNLA 2JCYA 4FFMA 1ULUA 4PLZA 3JQBC 4JNKA 2GDZA 4CUZA 2X58A 2X5JO 5FFFA 2EF1A 3BTVA 1EE9A 2RAFA 2EKPA 4RLHA 5A3VA 2Y0DA 3RC9A 3PHLA 5K0ZA 3RU9A 2WD8A 2AG8A 2DBRA 3AM4A 4QXMA 1P9LA 5ICMA 4YCAA 2NU9A 2GR9A 4PVDA 3EVNA 3RWBA 3C1AA 5KJ1A 3ZWWA 3RAJA 4MVJF 6ADHA 3OECA 3OA0A 3U5TA 2EWMA 2FRDA 1D7OA 2VRBA 3F1LA 1YL6A 1SOVA 3WB9A 4EW6A 2FN7A 2NACA 4GI2A 1DDOA 1GUFA 2YW9A 1GV1A 1PGJA 2JD0A 2PWZA 2QG4A 1U28A 5IN4A 3JQ8A 3KB6A 2P91A 4OXKA 5AOVA 3PZRA 3WQSB 4CM9D 3PJEA 4N5MA 2NV6A 3DWFA 1EUZA 3F4LA 4TZKA 3WLEA 4BB6A 4R1UA 1BW9B 1FDUA 1NHGA 6LDHA 2FR0A 1LDNA 3EZLA 3GY0A 4JXKA 3JYQA 4A0SA 1O8CA 3I1JA 1YONA 3LYLA 4ALIA 5KVCA 3ZU2A 2Y0CA 2A92A 1PJTA 3H9GA 1UP7A 4NU6A 2HJRA 4B7CA 2JL1A 2J8ZA 1P0FA 3OSUA 4M49A 1V3TA 1VL0A 4NBUA 1UDBA 2VUSA 4AJPA 1HL3A 3DBHB 1FDSA 1LUAA 3LSYA 1I3NA 2SCUA 1ZK3A 3PVZA 4Z9FA 4JJFA 2PZLA 4E13A 3U4CA 1J6UA 4RDHA 3IOYA 5A9TA 4RF4A 3WYEA 2YHUA 2AW5A 4R1SA 4D3DA 1E1KA 5BT9A 3GPDG 3VH4A 2QQ5A 3DR3A 2QW8A 5JSFA 5HTOA 3KLMX 4PG5A 4XIYA 1VJTA 1PX0A 1GY8A 2FZWA 5KJEA 1O5IA 1E92A 3P7MA 4XQGA 5F1OA 5L4SA 1LLCA 1P0CA 1W6UA 3VZQA 3WICA 3FI9A 1E3JA 1ZJYA 4IZHA 1PL6A 1ISIA 4BGUA 1WLYA 5JS6A 4PLGA 4DQVA 2RBEA 1PS8A 4ONEA 4RVUA 3O9ZA 2C2YA 3VKUA 1KC1A 4GQAA 3F47A 4N5LA 1DIGA 5U4QA 3JD4A 5JY6A 2O7SA 2X6TA 2PD3A 4D3FA 2BRUA 5TLSA 4IJVA 2GN9A 1N1EA 4ZICA 4CM6A 8ADHA 2OHXA 3MJVA 1K3TA 3WIDA 4RZIA 1ZK2A 2OL4A 3JQ7A 3Q0EA 1U9JA 3P2OA 4ROSA 4IDGA 4TROA 3PWZA 4AJ2A 3ROPA 4ESOA 1ISHA 3Q1LA 2FSSA 1U7TA 5TRTA 5CDSA 1I3MA 3H8VA 4ZQFA 1YB1A 3PZBA 2BLLA 1DAPA 2PGJA 3C1TA 4HFRA 3NKLA 4IM7A 2PR2A 2G82A 4B3HA 4E5YA 2C20A 2ZYGA 4H15A 3L4BC 3KO8A 4XEHA 1B2LA 2G76A 2W2LA 3OJLA 4ITUA 3QVWA 1XA0A 5L9AA 3QE3A 3DZFA 4R5MA 2YYYA 4F6LA 3VDRA 4GSKA 5G4KA 3DBLB 2JHFA 1B7GO 1MLDA 2OOSA 4UVDA 1VPDA 2HRBA 2ZB3A 2DTDA 1EK6A 2VN8A 3WS7A 4DQUA 4XYEA 1P1HA 1QXSA 1UXJA 2PK3A 4WLFA 1X7HA 3LC1O 4Q9NA 4YT4A 4B4WA 4HWKA 5G4KB 2TMGA 1ADBA 5DBFA 1XQ6A 5BNTA 4BQRA 3M6IA 1FDTA 1U3VA 3KSUA 1S7CA 3BTSA 1BMDA 1H94A 2BI7A 3LQFA 3DC2A 4BNYA 3RC1A 3R1IA 4RDIA 4R54A 1R0LA 4GX0A 1XWFA 5A02A 1CQJA 4O6VA 2NVUB 1DFGA 1JN0A 1HYEA 3WYBA 1T2EA 1GEEA 5TT0A 4BNLA 4MVJI 2B5WA 2PKQP 2DC1A 4J91A 3DZKA 1SCUA 3OIFA 4GVLA 4CV1A 2PY6A 4YRAA 3Q9NA 4BV8A 1X0VA 1HRDA 3TF5A 2IODA 2Y93A 1UJMA 4XDYA 1JLLA 3I4CA 4RQTA 3JQ7B 3TL2A 5DBIA 3OQ1A 3DL2A 2IXAA 4J1TA 1AGNA 4JJIA 2YHIA 1SAYA 5KCZA 3U3XA 4XGKA 2W4QA 4CMJA 1N9GB 3PJGA 2FSVA 2WEKA 1DO8A 4XDZA 5T67A 3DMTC 4K9DA 1ISGA 3K30A 4ND5A 4O1MA 3LT2A 3OJOA 5CDYA 4LCEA 1FJHA 1E3WA 2Z1NA 1R6DA 2PKRA 2D0IA 1HEUA 3D0OA 1FF9A 5HS6A 2CNBA 2R2GA 1TLTA 3NJ4A 4CM5A 5DZSA 1EK5A 3KSDO 4CQLA 4WE3A 3QWIA 1PJQA 4JP3A 4EDFA 3DTTA 5EJ2A 5K6AA 2WWRA 2OXIA 3SC4A 4CMAA 4J1SA 3VDQA 3HUDA 5F3RA 2Y1OA 2GASA 2I99A 4YJFB 5A1TA 3UH1A 5JC8A 3MJTA 3QWHA 5BSFA 4CM9A 2DVMA 1MC4A 3OIGA 3QP9A 3ZWVA 3RC7A 3GMDA 3D3WA 5A5EA 1ENYA 4IDEA 2O4CA 1I33A 3PQDA 4UVIA 1Y9EA 3ZHYA 3RBZA 1MFZA 1Z7EA 2B4RO 2D2IA 3LK7A 3R3JA 3WOHA 1I3LA 2GRAA 3RU7A 2DFVA 4LMPA 3U62A 4D44A 1DIAA 4FD3A 1PL8A 2YDXA 3A06A 4DYVA 3PYMA 2GZ3A 4MVJE 4OXNA 4PLPA 2CY0A 1PJBA 1T26A 3TRIA 2CDBA 2D3TA 3DZJA 5A5FA 2NVBA 1W73A 3S55A 2X0RA 1WW8A 1Y7TA 1E3LA 4NBTA 1U8FO 5F5NA 1TXGA 2IEBA 1YWGO 4YJGA 5BSEA 3EZYA 2W98A 2XXBA 2FWMX 4B8WA 3HZZA 4QT0A 5F21A 5AQ1A 2PA3A 2Q50A 2HRZA 4Z3DA 4BO7A 2X5KO 3AU8A 4L76A 3UCEA 4YT8A 4R9RA 1XKQA 3WGZA 5HA5A 4R1TA 1ENPA 1WZIA 2H5LA 3HDYA 4FOOA 1Q7BA 9LDTA 2YFQA 1WDMA 2EKQA 1LDGA 1PTJA 3QHAA 4IIVA 4N7RA 1B3RA 1OBFO 1BXZA 1DJQA 2E4AA 2JFGA 3DHYA 3KEOA 4J6FA 4TWRA 3UHAA 3B20A 2Q1SA 4IIUA 1LC3A 5IJZA 4A5OA 3ZCXA 3OEYA 1HKUA 4EZBA 1DJNA 2B5VA 2YV2A 4XYGA 1ONOA 1G0NA 3QRWA 1PSDA 4MP3A 2EERA 2B35A 2E82A 2C59A 1F14A 4D46A 3PDJA 4OOEA 1C3VA 1A5ZA 4JBGA 1RM0A 3FBTA 1BDBA 4PG6A 4DLBA 1PGQA 5T6BA 5JXWA 1VI2A 3AM5A 4IDBA 1DIHA 3ZNOA 2RIRA 4CR8A 1IE3A 5THKA 2NADA 1U4SA 1BHSA 5COAA 3VH3A 3OF2A 1R16A 3U4HA 1PQPA 1Q7CA 1EMDA 3C7DB 4OM8A 5L40A 4FDAA 1ZMTA 2X0IA 3H4VA 3GN2A 4GWKA 4XQEA 3VHRA 3ZU4A 4CM4A 4GL4A 1T25A 3C7AA 4RORA 3VVCA 1PZEA 3UCXA 3SVTA 1YO6A 1FXSA 2AQIA 4NNJA 3FRJA 2FPGA 4MP8A 5A03A 1U2GA 4B4UA 3L6OO 1B14A 1MGOA 2O50A 4AJOA 4OL9A 2C54A 2Q49A 4RJTA 4M87A 2OZPA 3O8QB 4HNGA 4PVCA 1TA4A 3A28A 2OO5A 2VHYA 4I5GA 4QECA 5JBIA 2Y0EA 3IIEA 2FR8A 1Z82A 4L73A 4BNGA 5HBRA 3K96A 1BVUA 4UULA 4PG4A 1Y8QB 4GLOA 5CEFA 3WWZA 5BSGA 1OFGA 3W4IA 5JPIA 3H7AA 2OGUA 1WXDA 3VTZA 2J6IA 2PGLA 5LDGA 1N7HA 3ZU3A 1E7SA 3RFVA 2WSBA 1SC6A 5C3MA 3BZUA 4I08A 1BXGB 5CDUA 3ABIA 3F46A 2Q99A 3PHHA 2NM0A 4IDDA 4EJMA 3U09A 2P5YA 1SEPA 4U0KA 3V1YA 1E6EA 4MVJD 1HDYA 1WMAA 3BHJA 3ZV6A 3PK0A 3GNQA 4FGWA 1LLUA 4E21A 1NQAO 3RBXA 3GGGA 4JJGA 3TL3A 3LLVA 4ZQGA 5G4LA 3ZWBA 2J3KA 1GYRA 3D4OA 3ZNPA 3VH2A 4BGVA 1W8DA 2WM3A 4J7UA 4ZGWA 3EC7A 4BNTA 1Q1NA 1Y9AA 1KEPA 2ZKLA 3Q2IA 5DOZA 5F1PA 1Z7BA 2Q4EA 1F17A 3IS3A 2LDBA 1TT7A 1MXFA 1EQUA 1BVRA 3G1TA 1PQUA 5C7IO 2CDCA 4DIBA 2WTBA 3AY6A 4D7AA 1U3UA 1NVMB 1GAEO 2JAPA 1GD1O 1IZ0A 1ZBQA 1A72A 3FHLA 1U1IA 3OFSA 2CUKA 1XGKA 2OMEA 3D5QA 4TRNA 3GFGA 4LN1A 2C07A 4KWIA 4W9NA 1B8VA 2Y1CA 2DUWA 1U3WA 1E0DA 4IQGA 3E5MA 1IHXA 1NQOA 3VH1A 1HETA 2O2YA 4Q3CA 4CMEA 2B83A 3DOCA 3MJ4A 1G0OA 2GZ1A 4D79A 3KRTA 4OHUA 3NUGA 4KDEA 1KS9A 3NEPX 3NTQA 4OKIA 4K28A 3G1UA 5CG2A 1FDWA 1AN9A 1NFFA 2EGGA 4CM3A 5FI3A 3W8DA 1DHRA 3DBRA 3OIDA 4L74A 4PLHA 2ZTMA 4RF5A 4CLDA 4CV2A 4XRRA 5JDCC 2IZZA 4WCFB 3S1LA 4PN3A 1ZEMA 1LC0A 1LSUA 2Z5LA 3L9WA 5A05A 1P77A 5JAZA 4DA9A 1LSSA 2WJPA 5JCJD 3K73O 1IB6A 1V0JA 3FTNA 4U6QA 5CG1A 4H16A 4MINA 3PGJA 2V6GA 3K2EA 4RPGA 4LMRA 4KZPA 3FWZA 3ORFA 3JTMA 1K6XA 3K5PA 3GHHA 2NU8A 1NWHA 1PGOA 1T1SA 1E5QA 5JAQA 4XZ3A 3D1LA 3WGTA 3BAZA 3R3SA 1BXKA 2Y99A 2X0NA 1NHWA 1IPFA 3BHMA 3I6QA 3OETA 1LDYA 3GAFA 5JMWA 4CM7A 4MKRA 2HUNA 3JQFC 4JK3A 1M6HA 1X15A 4RVGA 3DZBA 2EV9A 2E48A 3UCFA 4FFLA 2J3IA 2RHRA 1E7YA 3UW3A 4MOWA 2G17A 2NTNA 4Q3NA 3O38A 2GN4A 2J3HA 1B8PA 1WZEA 4DMMA 4CLRA 1C1DA 4ZN6A 1HXHA 2AG5A 3I9JA 1CIVA 4B4VA 2QHXA 3VZRA 3ZWXA 1JA9A 1HE5A 4DLLA 2UVDA 4E2YA 2W2KB 3JD3A 2DAPA 4L8VA 4FR5A 1UP4A 2VT2A 2YJZA 2EG9A 3H2SA 1CETA 1VJ0A 4IS2A 2F1KA 3L6EA 3OJ0A 3IP1A 3JQ9C 2ZCUA 3I83A 1UDCA 2ZYDA 4S1VA 4E31A 5DULA 2CDAA 1LRLA 2VWGA 4E30A 5JCJA 4J7CA 3HSKA 4FC6A 4KQXA 4GH5A 4R4JA 1JQBA 4P22A 1SEVA 5AVOA 3K92A 4IQ0A 4CMKA 5KOIA 1N5DA 2D1YA 2WYVA 3JQCA 2BKAA 4XX0A 2B4QA 3FNEA 5IF3A 3PHIA 4QUKA 5G0UA 1Z75A 4U5QA 2YY7A 4DPKA 1DIRA 1GTMA 3KZVA 3Q9UA 4AFNA 3ZGYA 3WSVA 1ONPA 2VZ9A 4PLVA 4P8RA 2RH8A 2WD7A 3A9WA 4Y6SA 2BI8A 1GADO 3MTGA 1NTOA 3W6ZA 2HDHA 3MWDB 3GR6A 2QZZA 5GY7A 4RF2A 3ZV5A 4AJIA 4NK5A 4PLWA 4PG8A 4OQZA 2X0JA 1B16A 4Q3EA 3K31A 5THQA 3IKVA 1NBOA 3KUXA 5BSHA 5EPOA 2Q3EA 4BNMA 4E0BA 3JYNA 4MVJG 1HLDA 2DFDA 4RPKA 3K9QO 4LGVA 2FHSA 4WNIA 3CEAA 2WYWA 2I9PA 3GDFA 4XRGA 4YXFA 3KLPX 3HADA 2AQHA 4IINA 4R3WA 3WMXA 2CZCA 2EJWA 4DPMA 1U2DA 3B70A 4FFOA 4W99A 3T4EA 3ZV4A 4BNHA 3W1VA 1X1EA 3WFIA 2PTGA 3HN2A 1X7GA 3H3JA 2XPCA 4DIFA 2C82A 2PZKA 3DZGA 3GH3A 3PGXA 3RJ5A 4AVYA 4YRDA 1PGNA 4LRSB 4YDRA 2F00A 1U3TA 4TZTA 2X5OA 4NIMA 1TB4A 1NFQA 3U4DA 1IOLA 3GGOA 5CEJA 1PR3A 3LT1A 5JAMA 4GPD1 3QJ5A 3H6KA 4DVJA 3DBHA 1SZJG 1V3VA 3BMNB 5KTKA 3JQ8B 3WNQA 4OSOA 3LC7O 4BMNA 4ZQEA 1UP6A 3F9IA 4NI5A 3GC6A 4Y8VA 2WE7A 3ZN2A 4WUVA 1H5QA 4DBZA 2Z95A 1AHIA 3INGA 5ITWA 2HK8A 3QV1A 3ZWAA 3C24A 5MGBA 4R16A 2RH4A 2RCYA 1C1DB 4BO9A 1VKOA 1HSOA 3DZHA 3T7CA 1DLIA 3C85A 4J0FA 1J0XO 1A7KA 3DB2A 4MVJA 1DXYA 2AQ8A 3SBOA 5I8WA 3PDUA 4IMPA 1JTVA 5ILOA 3BIOA 1KVRA 3IDSA 1LQTA 3GPIA 3JD1A 3I23A 1DLJA 2DPGA 4R68A 2X22A 2V65A 2GGSA 3DQPA 2I67A 1U5AA 1IULA 3GN1A 4TRMA 3S2IA 4D3SA 1UAYA 2EW8A 4XKJA 5JO0A 5KKCA 3VPFA 4FPXA 2WE8A 1AXGA 1E7RA 3PRJA 1NAHA 5K6AC 2DLDA 1XYGA 2VYNA 1FK8A 4NBVA 4WCFC 3Q11A 4R51A 4Z6KA 3FR8A 4WGGA 5ADHA 3E5RA 1J4AA 1E3WB 4CV0A 3ONEA 2PZJA 4FB5A 3C8MA 4WCDA 3LC2O 1T4BA 4YEDA 2V6FA 1JVSA 1CYDA 3DDNA 1DRVA 3QY9A 1YKFA 4J9UE 4BGEA 5DCUA 2H1SA 1B3BA 4PLFA 4JP2A 5DN9A 4BL5A 3BTUA 1JAXA 5L4LA 1HDGO 4W82A 4GSLA 2W8ZA 3FSRA 5GZ6A 1B0AA 5F5LA 3PHJA 3LLSA 5IDXA 3CPSA 1K89A 4IDCA 5EERA 4R5HA 2LDXA 2VRCA 1YQXA 1YS4A 2VWQA 3JYOA 5U9CA 1LSOA 2YV1A 5COQA 1Q0LA 4CMBA 1QORA 2Y05A 1MFPA 2WMDA 2Y66A 3WGHA 3PP8A 1LA2A 2VOEA 3TNLA 3LU1A 1Q0QA 1I2ZA 3CZMA 2E37A 3BTOA 3GEMA 1VE9A 1WDLA 2GPTA 1U4OA 3TDKA 3KVOA 1XDWA 1LXCA 3VVBA 4BGIA 2GSDA 2V7PA 4U0JA 2IYOA 4DL9A 2CFCA 3HE3A 5JO9A 3KM0A 5TGDA 1EUDA 1EVZA 2EGHA 2HQ1A 1A4IA 4ND1A 4BO0A 3IJPA 3WGOA 1QLJA 3P5SA 2GERA 4B3JA 1PJSA 3FPCA 4FIZA 4MP6A 5DF1A 4NHEA 3FNFA 3L4SO 1YBMA 4TVBA 3VPGA 3AI3A 1LSJA 1ZSVA 3M2TA 4CM1A 1D1SA 1GZ4A 4YBZA 2RHCA 4XWYA 5L7WA 4XYBA 4J2OA 3WG9A 2QYTA 1MC5A 4A26A 3NJ8A 1UXKA 5ILGA 1NR1A 1MX3A 1R0KA 2CVQA 2VCYA 1UZNA 1I36A 2ZCVA 3EVTA 2X8LA 3C1OA 3QQPA 3LVFO 3NV9A 3IP3A 4HNHA 1Q0HA 1ZH8A 2ZYAA 4XA8A 4KUGA 1U8XX 4AJKA 1JW9B 3HQ4O 1K6IA 3EK2A 4IXWA 3E9NA 3ZW9A 4CODB 1KOLA 1E6UA 1N1GA 1YH3A 3UUWA 2P9CA 4RL6A 2AXQA 1PR9A 1P1IA 1YJQA 3CMCO 1VKNA 2D8AA 2VT3A 5KJFA 3WSWA 5L4NA 2G5CA 5AXAA 5H83A 5IXYA 4FJ1A 4AICA 4Z9XA 4BNVA 3AFMA 5T64A 1R4MA 3F6YA 5KWEA 3ZNNA 3GOHA 1ISMA 1P31A 2X9GA 4L4SA 1BSVA 3M1LA 2DKNA 3MJCA 4JROA 5I7FA 1ISFA 4NK4A 4GKBA 5LC1A 4CUJA 5JDCA 2O48X 4J2HA 4NBRA 1PZFA 4ALNA 4KMSA 4CR7A 1Y6JA 3GVPA 2EJVA 4LCJA 3L0DA 3EDMA 1NVTA 3G49A 3TZQA 1E3SA 3WR5A 1C14A 1QG6A 3OBBA 1UR5A 2W2KA 1JDJA 1VJ1A 3D64A 3AOGA 3RUAA 3LDHA 4D0SA 2ZTLA 4H3VA 5B12A 4ILKA 1BG6A 4C4OA 3S2GA 3S2EA 2O3UA 2VYVD 1B26A 2PKQO 2AE2A 1PJ4A 1PGPA 1XLTA 2UUOA 2NQ8A 4DQXA 5COBA 5C37A 3TN7A 3ZHBA 5HWSA 2Z1MA 4E2WA 2XF8A 1Y5MA 1P33A 4LRTB 5A4DA 1ZFNA 4HFNA 2ZIZA 3PQEA 4DGSA 4BIIA 3AUSA 3U4IA 3H2ZA 5T73A 2E6UX 2ZJ0A 3TOZA 3WNVA 5G0SA 1C0IA 5DP1A 4ZHSA 3P19A 4J90A 1E1MA 1AE1A 1DRWA 4QTZA 4D41A 4XCVA 3I9NA 2QIOA 5ER9A 4TMFA 4E6PA 2B69A 2GNAA 4BKUA 4BO6A 3W8FA 4AJHA 5KVQA 2Y1EA 3RSHA 2FZEA 5G0TA 5LDHA 2HLPA 1Y8QA 3DTYA 1SOWA 1ZW1A 2ZQYA 1SB8A 3I5MA 1XSEA 2NTJA 3AUUA 2OORA 4R1NA 3BMOB 3PLNA 3MWEB 3NTOA 3DOJA 2DU8A 3ONFA 1YL7A 1GU7A 4H7PA 4AJ4A 2JFHA 1DC3A 2EP5A 3GRKA 4QFDA 4WLEA 4UAGA 1EUCA 4BO2A 3NDRA 5L3ZA 5DBGA 2P4HX 2BHLA 3BMOA 3SX2A 3ITDA 1H9AA 4CLXA 4J49A 4OJNA 4Z0TA 4OMUA 2WYUA 3PYLA 3EHEA 4XYLA 2QYSA 4J1NA 1XHLA 2Q1UA 1HDOA 4BMVA 1HDRA 4PLTA 5T57A 2B0JA 3RI3A 2D5AA 1C0KA 3STHA 3DBVO 4NH4A 1X14A 3EAGA 5CP8A 1D1TA 3JQFA 3ZWNA 4A27A 4BKRA 4BUCA 1PJCA 3GQVA 4A73A 1E3IA 2P9GA 3E1KA 4LVCA 4RO0A 3RFXA 5M6DA 3GG9A 3KHUA 4N18A 4CL8A 1G6KA 4PFJA 3DBLA 3PJDA 4HP8A 4FOSA 1JWAB 3X2FA 3H9EO 4YQYA 3OQ6A 2AA3A 1NP3A 1WP4A 2VHXA 4L75A 1V35A 4Z0PA 2AHRA 4RVFA 5B37A 3MJSA 1D4FA 5GZ1A 4EEXA 2NQTA 4X54A 3LZ6A 3LT4A 2X9VA 3DZIA 3PHGA 1ZXLA 2NU7A 4UUMA 3D4NA 1YQDA 4BMSA 2HK9A 1H93A 1Z73A 1YDEA 2JCXA 4RQUA 3I9MA 3FWNA 1P44A 3FR7A 2NTVA 4XGNA 1A4UA 1BGVA 2C2XA 2C5AA 4PRKA 4IGFA 4YQZA 4DC0A 4GGOA 1XU9A 1IHYA 4F6CA 1R66A 1GDHA 4J9VA 4BV9A 3WFJA 4IY1A 3ROQA 1ZVMA 3RUEA 5IDQA 5T8KA 2VWPA 1E1LA 5L7YA 1Z74A 1WDKA 4Q3AA 2V6MA 3VZPA 1J5PA 5JW6A 4IPTA 1H6CA 4UUNA 2POQX 2Q22A 4PG7A 1GQ2A 3RASA 4CM8B 3NYWA 3ENNA 3GVXA 1ADFA 2YUTA 3HG7A 3OJEA 4HX5A 4M89A 1DC4A 1GZ3A 3ANMA 2NNLD 3QVXA 2O3RA 4ND2A 4B8ZA 1EVJA 1H6AA 5JDIA 1QMGA 3IC5A 5T8KC 1QV6A 4NPCA 4RLSA 1XELA 3GAZA 2GF2A 4JLWA 1DHTA 1O94A 3JYLA 2Q2WA 1P1KA 3RD5A 4E33A 5TSDA 4AJ1A 4L4RA 1F06A 4OYRA 3UAGA 3PLRA 3HB5X 3MTJA 1X1TA 1EFKA 1SB9A 1I30A 1I2BA 3AW9A 4I9UA 1KVSA 2UV8A 4B7UA 2JJYA 3KYDB 1KERA 2ZB8A 1R4NA 3N7UA 3O4RA 3SC6A 4IXTA 4BNIA 4DIOA 2HMVA 5IXSA 4B79A 2NVUA 1A71A 5TF4A 5CAEA 3BMCB 3UICA 4GX2A 4WKGA 3DAPA 3HB4X 2A94A 3GMSA 4C7JA 1DAOA 4Q3DA 5EQFA 5JDIC 4MVJH 4TSKA 1GUYA 5I7SA 4O0LA 3EY4A 4JIGA 4B7XA 2PD4A 4CR6A 1JKJA 2UYYA 3QW2A 4Y6RA 3TOXA 4NG5A 4KQWA 4QO8A 1NAIA 1RJWA 2ZK7A 1Q2XA 1DFIA 4I1IA 4FBGA 2BH9A 1QR6A 2BGLA 3WMWA 4BS9A 4DC1A 2G0TA 4GLLA 3WBBA 1KBZA 1C1XA 1TVEA 1WNTA 1O6ZA 3N58A 3UN1A 3G3EA 4GX5A 2BF7A 4G5HA 4IUYA 1DB3A 3KBOA 2W90A 1H2BA 3N74A 4FJ2A 4LK3A 5KKAA 5DT9A 7MDHA 4NFYA 3L9XA 3CH6A 1YB5A 2HMTA 4PZEA 4CMHA 1BTOA 2GN8A 2OP1A 1I3KA 4EBFA 2P5UA 2ET6A 4YAEA 3PIIA 1GFSA 4AJLA 3GDGA 4OH1A 2WD7B 3D4PA 1ZKMA 4DRYA 1YVEI 3ZI0A 4D42A 1JKIA 1YOVA 1JVBA 1R12A 4BO5A 2HCTA 3GA0A 3PTZA 5ENVA 1HF3A 4RPJA 3T7EA 4JCOA 1OI7A 3A1NA 3F3SA 3I52A 3H5AA 3ICCA 2VUUA 3JQAD 4J7XA 4INAA 3PJFA 4WNCA 3AJRA 1Y5RA 1LDMA 1CJCA 3QLJA 2JD2A 3ZU5A 4R01A 5B4VA 1C1XB 2UUPA 5MDHA 4DYDA 2VZ8A 3WGIA 3CIFA 1WVGA 1UUFA 1RM3A 4FQ8A 3RUCA 4CMIB 4YJFA 5EL0A 2DUUA 2GN6A 3MOIA 2C0CA 4HKTA 1WWKA 4LSWA 4QSMA 5EINA 3E8XA 3PI7A 3W6UA 3V5NA 3WJ7A 3HDJA 2DM6A 4HXYA 1OAAA 3I9LA 3AUAA 5JC1A 3L4BA 2ZB4A 3WJAA 3GFBA 3W4KA 4YTEA 3RUHA 3SLGA 3ZNQA 1Y8RB 2R00A 2PZMA 3WGYA 1QLHA 1YB4A 5B4TA 4MVJM 2VHWA 3WX0A 3GDOA 4W7HA 1ZCJA 4OO3A 1LLQA 5A3JA 2ZJ1A 1S6YA 4BNUA 2I66A 1DPGA 1GCUA 3E82A 4R69A 2XXJA 4BKOA 1PS9A 4GGPA 3MJEA 5FF9A 4BO1A 2BELA 1VRWA 1HE2A 1R0SA 2A35A 2GD1O 1JAYA 3F1KA 3ZV3A 4EJ0A 2HMSA 4HADA 2DBVO 2CVZA 2VQ3A 4UUPA 3ULKA 5A04A 1SMKA 4QEDA 3ROKA 3W8EA 4B3IA 5L7TA 1P1FA 3DFUA 5IDYA 3ADPA 1KVQA 5TIIA 5A9SA 4MVJP 4DREA 1F0YA 1SPXA 3D7LA 2Q1TA 3IMFA 3U9LA 4BO4A 1MP0A 5H82A 3NT5A 3JYPA 4DXHA 3ROMA 2Y1FA 3QWBA 5EN4A 4OGWA 3IL2A 3ITKA 1PIWA 1GPDG 5ES3A 4E5KA 3AWDA 4IJUA 2FP4A 4J4HA 2VZ0A 4XB1A 2O2SA 1N92A 5BNIA 2IXBA 2UAGA 1EVIA 2JFFA 4I8XA 4FS3A 2YV3A 1DRUA 5J23A 1CDOA 4UVEA 1I24A 4E32A 3MZ0A 3E9QA 4GX1A 4P4NA 1T2CA 4BOYA 2H63A 1N7GA 3EGOA 1KIFA 2CF6A 5ENDA 4NJOA 3BYZA 4CJXA 5I7EA 4UEJA 5KJ6A 1UXGA 3SXPA 3JQBA 3BXXA 4RVSA 3SJ7A 2AEMA 3RBVA 2VWHA 4I9HA 4IZIA 3TZCA 4CLRB 4HY3A 1YE3A 3S2FA 5L45A 8LDHA 3H65A 3QIVA 4FJ0A 1BW9A 3IJRA 2GYYA 1RKXA 4BO8A 1RYEA 2AEFA 5G0VA 3MCVA 3SEFA 3ZWCA 2PV7A 1LRKA 3IAHA 2HAEA 3OH8A 4BNNA 4CLEA 2EEZA 4F3YA 4P38A 1CEQA 1CWUA 4MPDA 5BNFA 3WXBA 1FDVA 1WAMA 2J5QA 3QVOA 2O3SA 1YXMA 4QX6A 3B6ZA 3I9KA 4WEOA 4Z9YA 5JNLA 4DPLA 3Q6IA 3TZHA 4R9SA 3PFWO 4MIYA 4WEQA 4GVXA 4CUKA 4YJHA 1LDEA 4E12A 3Q2KA 2VNSA 3E03A 1UZMA 3EMKA 2GLXA 3KSZO 1YDWA 1HTBA 4NJMA 4HV4A 3JQ6A 4EI2A 3GGPA 3PFFA 1MV8A 3E18A 3VPHA 3HNPA 4IBOA 4K6CA 3KV3O 4E5PA 3AU9A 1O89A 3K6JA 1LX6A 2E49A 4BNZA 3JD2A 3HFSA 4JX8A 2OUIA 3L6DA 3JSAA 1ENOA 5F1KA 2IRWA 3GVHA 4J0EA 2NSDA 3AUTA 2VTEA 4CQLB 1IPEA 3JD0A 3JQGA 4M8SA 1I01A 1NR7A 4OQYA 1GR0A 4BO3A 2JCVA 1SNYA 4NFHA 3VOSA 2X4GA 4KWHA 4ND3A 4O5OA 3L07A 3CTMA 1T4DA 4WPGA 4XQ9A 5HM8A 3K2BA 3G79A 2X9NA 4YAJA 1NM5A 2PH3A 4ALKA 1O0SA 1QRRA 1T2FA 3K8ZA 4PZDA 1NQTA 2B4TO 1OC2A 1QYVA 4HUJA 5JYAA 3RJ9A 4PZCA 1QP8A 4NBWA 5FEUA 2B37A 5IDWA 1VL8A 2FMUA 2JKVA 2NWQA 4II2A 2VTDA 1NVGA 3M1AA 3ANLA 1TT5A 3PWKA 3KYBA 1R15A 1L7DA 1R4NB 3GUCA 1YBVA 1EQ2A 3CSDA 4Z0HO 1VC2A 1A7AA 1H0KA 4EEZA 4BQPA 5ITVA 4YJHB 2BFAA 3A14A 3VPXA 3QWAA 1KYQA 3WQRA 2NU6A 4YAGA 5IZCC 3NTRA 3LF1A 1QYXA 1PS0A 3LT0A 1V3UA 2BFPA 3R0IA 2IYPA 4YWJA 3OEWA 4FGSA 1MUUA 3C7CB 1MG0A 1LEHA 2VNAA 2VHVA 1DC5A 3S8MA 5I9MA 3CINA 4DWVA 5HS4A 3ETDA 5CFZA 5C7LO 3IKTA 3KETA 4JQCA 3H5NA 4AJJA 4EGFA 1E1NA 1ORRA 5U1PA 2QZ9A 4J4BA 4J1QA 2C5EA 3DXFA 4J3FA 3RC2A 4TRRA 4YVFA 4BNXA 5T5QA 2NLOA 3TSCA 4OKNA 4ND4A 2O23A 1DC6A 1U5CA 1VLLA 1GPJA 1MA0A 2FOIA 4CQMB 1NFRA 3OMLA 4BNWA 3E48A 4B4OA 4JBHA 1UZLA 3PPIA 5JYDA 3TWOA 3VPSA 1LRJA 1NPTO 2B36A 4NZ9A 3B1KA 4UEOA 1R37A 1HZJA 1P3DA 4TKLA 4A7PA 1E7WA 4IJWA 1ISJA 3TJRA 3CZRA 3UF0A 2H9IA 1PWZA 3JQAB 5L51A 4F45A 3NX4A 4BKPA 1YL5A 1K2WA 3WTBA 4WLUA 3H5RA 3U49A 1TI7A 1A9YA 2J3JA 2BD0A 4G2NA 4ALMA 2D5CA 4NFSA 1HLPA 1K6JA 2EW2A 1GCOA 4IDFA 4CMEC 4ZA2A 2P68A 2X1HA 3AFNA 5I9LA 4II3A 2O7QA 2O3TA 1WPQA 1CRWG 4OSPA 1LQUA 4IDAA 5KIAA 1VL6A 1ZJZA 3F5SA 1PJ2A 4NU5A 1LTHR 1ZSNA 5TC4A 3BMQB 3PWSA 3ANNA 3HDHA 1XEAA 4LISA 1M2WA 2I3AA 4IS3A 1E7MA 1YRLA 5JY1A 2GUGA 4J43A 5IAAA 3FPLA 1GYQA 1JU9A 1OOEA 2UDPA 3DO5A 1DBVO 3ZHZA 5B4UA 1XG5A 1BDMA 1KETA 2Q1WA 1ZZEA 4XJTA 3V8BA 3ZWOA 5DCYA 1BRMA 3FD8A 3H9UA 3WGQA 1CF2O 3UXYA 4YR9A 5KJCA 4KTVE 2VRCD 4YAIA 2ZQZA 5IZCA 4N54A 1V9LA 4XQCA 4E5NA 2DPHA 3M2PA 1PWXA 1TEHA 3RIHA 4WK6A 1HDXA 1N9GA 4R3NA 2DTXA 3PQFA 3NDIA 4MIOA 1HWYA 2ZATA 4PCVA 3WWYA 4JGBA 4YYZA 2X7HA 4OOFA 5I7VA 1DSSG 3JQEA 2CD9A 4KTTE 1ML3A 4W9NC 2ZTUA 4EJ6A 4M1QA 2AEJA 2FPIA 4FFNA 2GZ2A 4PGFA 4YAKA 3OQBA 4Q39A 3BMQA 4NR0A 5ICSA 2FPPA 4CLOA 4O59O 2AMFA 2FR1A 5KVVA 4A2CA 3ZH2A 5CDTA 2P9EA 1EDOA 3WQQA 1NPDA 4GBJA 4M86A 4NDNE 4XR9A 1BXGA 3QSGA 4W6ZA 1ZUD1 1I10A 4L0QA 5C7OO 3R6DA 1VSVA 3JQGB 7ADHA 1WMBA 5TQVA 1V8BA 4RF3A 4FFRA 4U6SA 1HZZA 3OM9A 5A06A 3DAFA 5L53A 3PIDA 4RPLA 3FN4A 4KUHA 3DHNA 1O95A 1XQ1A 4CMIA 4EUFA 1B15A 4ID9A 3ZWYA 3SLKA 5G0WA 4Z3KA 1E6WA 3UFXA 2VHZA 1R4MB 4ZU3A 3MOGA 4BNKA 1QYDA 1C0PA 2Y67A 4J16A 4KUEA 3SJUA 4CMCA 4RVHA 3QVSA 1ZIDA 1ZK0A 1ULSA 2TMDA 5EIOA 4U7WA 5JMPA 1B8UA 1MXHA 4WECA 4ZQBA 2Y1DA 3RFTA 2C7GA 3DHEA 1G1AA 1L1FA 3DMTA 4P4LA 1QYCA 1AHHA 5ER6A 5K9ZA 1KEVA 1I2CA 5DOVA 9LDBA 3CKYA 2GO1A 4CPDA 4GAEA 2DBZA 3QWFA 4ALJA 1EFLA 1LI4A 1ZNQO 5IFLA 4RZHA 3WDSA 3TFQA 5DDIP 2R6JA 2HO5A 4K1LA 3HWRA 4TKMA 4A10A 3RQSA 1QSGA 1UH5A 3GNTA 1JKFA 1UXHA 1YJ8A 1MB4A 3GZNB 3DMYA 3GUYA 3GVCA 1NYTA 3RKRA 5A9SB 1K0UA 2ZTVA 4E4YA 3FF4A 3NDJA 4M54A 3V2GA 4GMFA 4BNFA 4WOKA 4MJLA 3GHYA 3KEQA 4FCCA 1OC4A 4AL4A 3NGLA 5CPBA 2YFHA 3OP4A 4KOAA 3AM3A 5JFOA 2X23A 2YHIB 1DIBA 4U8GA 3GVIA 4K26A 1KC3A 4XIJA 4CL3A 5TJ9A 3RUIA 2A9FA 4IMRA 4MO2A 1HYHA 4ZQHA 1HYGA 3INRA 1E5LA 3AOEA 2DQ4A 1U7HA 2BFMA 1IYZA 1RWBA 1QKIA 4O63O 4EITA 3PXXA 1M75A 1NQ5A 1XR3A 1KVUA 1I8TA 1JWBB 4I5FA 4MKZA 1W0CA 1EZ4A 3MEQA 4S3MA 2J5KA 3ON5A 1Y8RA 3KYDA 2BFOA 2IE0A 1PU2A 3IUPA 3FNHA 4LVUA 3UVEA 4XYMA 5KVSA 4PRLA 5IZ4A 1KY4A 1PZHA 4CV3A 2IZ0A 1SBYA 3GZNA 3GK3A 2EP7A 3WIEA 4DMLA 3EYWA 4OXYA 4I5DA 5AYVA 4YJGB 1PZGA 4D45A 3RUDA 5EMHA 5G2OA 4W4TA 5HRUA 3PEFA 3RROA 3WYCA 2QRJA 2V6BA 4BVAA 1XCBA 2W2LD 3OICA 4HFMA 4NJMB 1SO8A 4EUEA 2AQKA 4IGEA 3GLQA 2OBNA 4G65A 2XAAA 4URFA 3EUWA 4XR4A 4Y6PA 5DNAA 3TPCA 1UDAA 1XU7A 3RVDA 2IDZA 4DUPA 1E3EA 1QV7A 5B1YA 1I32A 1E7QA 4YB8A 4I5EA 4MIEA 1ENZA 2VOJA 1I5RA 3COSA 1CQIA 3CXRA 2HK7A 3FBGA 1ADGA 4CQMD 2DTEA 1CERA 1M67A 1KY5A 2XOXA 3BMNA 3WBFA 1T24A 4FN4A 3UGKA 1F12A 1NXQA 2CMDA 3I9OA 4Y9DA 3ADOA 5TX7A 1N2SA 2Q46A 4BB5A 1GL3A 1GYPA 3OJFA 3B1JA 2HMUA 3VKVA 1QYWA 4ZRMA 2YQ5A 4FC7A 2NVWA 3WGGA 4GMGA 3KYCB 1IY8A 1X7DA 4E2XA 4L4XA 4YJDA 4AG3A 2PD6A 4DLAA 1PL7A 5I9NA 2CSUA 4CQMA 4EYEA 1T1RA 3KXDA 5DCWA 4Y98A 1PQWA 4N5NA 4D0RA 1ARZA 3VZSA 4CLHA 3UKOA 4YACA 3KYCA 5BQFA 1FMCA 4TQGA 3H9QA 3QVTA 3GEGA 3L77A 1P74A 3D3WB 4RCVA 4E3ZA 3V2HA 1V6AA 2D4AA 3AI2A 4FFPA 5J9GA 3ZWMA 4LW8A 1H9BA 5CHEA 5JYFA 4AJEA 3F5QA 1PJLA 2DBQA 1DEHA 2DT5A 3ASVA 4A03A 4IQ8A 2O3JA 1M6WA 2BGKA 2H6EA 1ID1A 3GEDA 1M76A 2I76A 2YDYA 2EIHA 2QX7A 1RYDA 2JD1A
chains in the Genus database with same CATH superfamily
1TUBB 4X7MA 3AIKA 2VXYA 3OQJA 5IKEA 5LWHA 2LE0A 3VVLA 3EZFA 1NLYA 2YQ4A 3MWLA 1T2AA 3G6WA 1VOTA 5H9VA 2WKRA 3INTA 3KG2A 3HDQA 3O75A 5GJVC 1URPA 3SEZA 1X0XA 4OIMA 3DL0A 4NBKA 1W6RA 4PNPA 4U1RA 4EHIA 3OA2A 3HR4A 4K46A 3DCJA 4QHSA 1JMKC 1CUBA 1ODFA 2Q4BA 4NZYA 4O4HF 5CX1B 2FWRA 4WLVA 3JCZA 1JJBA 1LU9A 2KW5A 3BG5A 5FWXA 5GP1A 3KOUA 5AXBA 1N36B 2AXEA 1L6IA 4K6FA 2WDPA 2RHGB 4G0WA 5I8ZA 1IQ0A 2DRIA 3I28A 3VTFA 3T5TA 1GU0A 3KR2A 3A2NA 2V8OA 2K7FA 3QPCA 1K92A 3ENKA 5E38A 2GA8A 1AH2A 3ZVLA 4D8YA 4TYNA 4IH1A 4HBGA 4WZZA 3K9BA 2Z8XA 4YQEA 5B6PA 5DWQA 5DIFA 4RCYA 4KVGA 4YONB 3SJZA 2FJPA 3BIJA 1EAMA 1JDBC 2Q4DA 1CZLA 3Q3CA 1AUOA 1GUZA 4JN6B 2BGMA 3MBKA 4RGBA 2YIJA 3ZOKA 1ZG3A 2QMYA 4R0MA 1X7YB 3E2PA 1IHPA 3HFGA 2EHDA 3CB4A 3DMHA 5LP6C 2JKYA 2WWGA 3OPMA 4Z8XA 3KXIA 4EMUA 2PE5A 3WTCA 4EQ6A 1LBEA 1BX3A 2C9CA 3B1FA 1LLFA 1MIOA 4WACA 3LCVB 4NPAA 1L5OA 1H3NA 1SXJC 5EESA 3LVRE 4C06A 4DV1B 4Q05A 2WOOA 2CHQA 1XTKA 1E62A 2X5NA 1AXEA 4Y9SA 1Q7GA 3V1UA 4EABA 5JCXA 1AGYA 5K20A 3DBRB 5CPFA 3TFOA 5IJ0A 3NBZC 1WVIA 4QVGA 3ORRA 3J81k 1NVKA 2I1LA 4MUFA 2WW8A 2ZIEA 1R8YA 2WY2D 4JD5A 3BRSA 4WJZA 4W7IA 3O03A 5IS2A 2WJYA 2AS0A 5KYYB 1ZD1A 5D2CA 1OTHA 2H2WA 2GJKA 3EYAA 3WNZA 4TQ9A 3GIWA 5CDHA 4QOFA 1U2QA 5JE8A 2I54A 3BCSA 4RPHA 2LIPA 5CFMA 2FSUA 1X7ZB 3OQIB 5GZ3A 2NYVA 3DKRA 1PX2A 1ELOA 1X92A 4MW6A 1IZ8A 1E5DA 1GQOA 1RE0A 2WU8A 2FLKA 5LFAA 2M98A 3DD5A 4NL4H 3AK4A 4OP2A 1OMOA 1YQEA 4IYRA 4D4GA 1NI5A 1ZK4A 3MD0A 3NOVA 4BX3A 2XB6A 2XTZA 3TR0A 5HE9A 2PH1A 2E5LB 3KWFA 1L4HA 3AP1A 1OSNA 1UMDB 3GNSA 2H29A 3Q7TA 4PIVA 2BFCB 3N5CA 3I8OA 1C4WA 4RGVA 4DA7A 1EUQA 4NPHA 2HTFA 5TVGA 2Q2VA 3VDXA 2Q6LA 3PGA1 4KXVA 3VC7A 1MG5A 2FLVA 4DRXB 3N2ZB 4E2ZA 4B80A 3PFBA 1UJNA 2RGCA 2X86A 3KZNA 1F0NA 2RKWA 3KNZA 1M6NA 4LOLA 3ST7A 1PLJA 2AXNA 2ZBRA 3R20A 4IIYA 3S6JA 4UEKA 4ARSA 4K03A 2DFNA 1UPCA 3CUUA 4YRPA 2I5PO 4JEIA 4QFCA 5DH9A 5FYDA 3N0RA 3C2QA 4TT8A 2REQA 3UMSA 3RG2A 2PFGA 5ECWA 4LHZA 4M55A 4YUVA 5SICE 4MS4A 1Y89A 3DEYX 1PJ3A 2HK6A 1SCNE 3UWOA 4BQEA 2ZDQA 3VHXA 8MHTA 3K4PA 4K9MA 1KEZA 1IJKA 1D8AA 5CXUA 5TNXA 1UJ6A 4FT2A 1EVLA 2GH1A 4CBVA 3IKLA 4I9NA 1GZ6A 3O94A 4XGIA 1H2HA 1T2NA 5LCXA 1M2KA 2QTZA 4LXUA 3FYUC 1AUPA 4G0PA 4TMZA 1MRZA 3L18A 4I4TB 4L9AA 4KXUA 3ORSA 3KTAB 5K6TA 4YT5A 5DBEX 1NBMA 2QTWB 5ES4B 1SOUA 1HDZA 3A4YA 3LBFA 4IWNA 3TK1A 3TR6A 4U39A 4C30A 3TLJA 3D6FA 3NUZA 1ATZA 1RKBA 1GILA 4FT4A 2ZRGA 3Q4GA 1MEOA 1LNQA 4TRJA 4FR0A 4AZTA 2PFSA 4DABA 1N34B 2ZYIA 2IT1A 4C78A 3PI6A 4Q82A 1VA5A 4AG6A 1V4NA 4AAYA 2PYZA 3INNA 2R6CA 5C51B 2RHLA 3KGDA 3ZG6A 1XJWA 4KO1S 1FFDA 1N5MA 3I2JA 4PANA 2N9UA 3KCNA 1ONNA 3SYMA 4F06A 1KU0A 3ETEA 3LGAA 3CUYA 3PXAA 5AK0A 1U81A 3A1WA 3TI7A 4QDXA 5A4IS 1UBFA 2H7XA 3EXIA 3T34A 3GF4A 4F4FA 1YQGA 3B48A 4IUDS 3D3EA 3GFRA 1NX6A 1C8KA 2YJNA 4JKIA 2XZLA 1QAQA 2ZBEA 3MYYA 1F8FA 2RK4A 4BDSA 5K0NA 4QGSA 3U9TA 2O0KA 2GCGA 1JHUA 2FPNA 1HT0A 3RSLA 4PBSA 3EXG2 3SC2A 1WEHA 1ESCA 5BY2A 5HZMA 4OJTA 3WQHA 1M66A 1NP7A 3HVUA 1U3FA 3ZHXA 4EHAA 3LK6A 1S2MA 2H1FA 5DMXA 2XQKA 5D7NA 5CNMA 3EDRA 2OPHA 3HCPA 3HCWA 1AIPA 4XD2A 3ROEA 2A1IA 3ISVA 3QH4A 2XV1A 3B7GA 1J97A 4HN2A 4ND6A 5LXTF 3RYTC 4CG2A 5CDGA 2HHHB 1YQQA 3KHKA 5KVAA 3DFZA 3AF1A 4ACAA 1KEWA 1ZM7A 4B5LA 3WADA 2HJSA 4RS3A 2YWFA 4KWCA 3H3FA 2WVJA 3SF8B 1SQFA 3H42B 4CM8A 1HLFA 3GLIE 4K6MA 2IW3A 1KEEA 3LLUA 3MMXA 3U3KA 3LYAA 4TZ0A 2PN1A 4WNAA 3TI9A 3QXSA 2X8JB 4I5IA 4TTQA 4LXYA 1J1ZA 4C3VA 1UYJA 2VDQB 4AMVA 2BGRA 2ZR9A 2WK1A 3F6RA 2G67A 4PXAA 4CF7A 3ZDCA 3MB8A 1TW3A 4RSMA 2RCNA 4NCNA 5HKOA 5ELXA 2E7ZA 1EE9A 2P40A 2WT8A 4M76B 3RC9A 3SYLA 3RU9A 2AG8A 2C8VA 4JL6A 5A0TA 3VR6D 4RX1A 2NU9A 4PVDA 1P5JA 3EVNA 2WC1A 3MINB 3RWBA 3UJ3X 4ENVA 3ZWWA 3HXMA 4PO1A 3GP3A 3IT1A 2IZOA 2UVPA 6ADHA 4U2DA 3U5TA 3P2KA 1XTTA 2HA6A 1R6BX 1H2WA 1NLZA 2XCLA 2ZJZA 3U3MA 4NCJA 4S04A 2JJ8A 1YL6A 1PR0A 3WB9A 2FN7A 2NACA 3G9TA 1SQ0A 1WOMA 2HA0A 4DBLE 2I3BA 1GUFA 4NYMQ 4CQNA 2GCEA 2QG4A 1J06A 3U26A 2DWCA 5DK6A 1BKYA 4C04A 2EEPA 2V5UA 3ZIDA 4I55B 2P91A 1WCIA 2I2AA 4UMFA 3WQSB 5L6LB 2WVGA 4C0SA 3PJEA 1YRQA 4N5MA 4C14A 3Q9LA 3CLUC 1TJ3A 3GQBB 3B8HA 3D0RA 1BW9B 2YV5A 1YR6A 1EB9A 2FR0A 3K9WA 4ZI7F 5DK4A 3GY0A 2I2FA 521PA 1Z0JA 3HKEB 3PPVA 5C34B 4S12A 2G83A 4RKWA 5CTAA 4ZI3A 2D62A 1YONA 2WUEA 2BR4A 2QENA 2Y0CA 4MR8A 5EHNA 2A33A 4CIWA 2WTEA 3NP7A 5LQRA 4Z4GA 4BE9A 5AM4A 3HDGA 4B7CA 2FRDC 2JVIA 1P0FA 8ATCA 3HK2A 1Q14A 2QTTA 2WV7A 2A2ZA 5TB5A 4FYYA 4J0GA 1D0IA 3NAMA 2GMWA 5B30A 4MPRA 1FDSA 2BFDB 1XBTA 4ZKEA 1QO0A 3U3ZA 2REOA 4QTTB 4XD7A 1ZK3A 2BT4A 4OLJA 3GWGA 1FTYA 3HEBA 4G63A 1P75A 5DHPA 4QG7A 4RMJA 1ZA2A 3T4UA 3GRUA 1S01A 3TIFA 2AL7A 2AW5A 2BHRA 3OX1A 1NI4A 3AB7A 1HR0B 1DQNA 1MORA 3NVAA 2QW8A 3HEAA 3F49S 3QFFA 1OXKB 1KYIA 3EARA 2BMVA 4XXHA 7REQA 5JSFA 2PO7A 3OF5A 4PG5A 1Y3AA 2ZRIA 1VJTA 1PX0A 4B6JA 1OASA 4DDWA 1EIZA 3GJSA 1GM5A 1AX9A 2FZWA 2CE7A 3ITEA 5KSPA 4XQGA 1THZA 5HIAA 1LLCA 1JJ7A 4DMRA 3PFCA 3VZQA 3K9FC 3WICA 3FI9A 1B6RA 4Y1RB 3WLNA 1ZJYA 4IUCS 2GD0A 4IZHA 5JS6A 1UBTS 3SS8A 3QX9A 2Y3IA 3VDNB 3O9ZA 2C2YA 1HA3A 3I6YA 3QU4A 1QHGA 1DRJA 4L9WA 3BWVA 2ETXA 4R2KA 3TLMA 3UG6A 4B6SA 1FS6A 2X6TA 1REQA 3FY4A 1A97A 1KQ3A 1W48A 1N1EA 2FEXA 3T06B 2OHXA 1SXQA 3V8VA 2P6PA 3UA4A 1M1NB 3P9PA 3MC1A 4MVYA 5IVPA 5F76A 3D8SA 2BFBA 5KC9A 4ROSA 1ZICA 3D5EA 2VDWA 4EB6A 3ACCA 4O25A 4IDGA 2YCBA 4TROA 4ESOA 1U0BB 5CVJA 1ISHA 1I3MA 2H1IA 1GQFA 4ZQFA 2FEMA 4TLMB 1ZX1A 1PEAA 4AZ3A 5I01A 1FBTA 3NKLA 4K3UA 1P5HA 3LPAA 4GMXA 4UCFA 5KWSA 3MUOA 4TM8A 4RTPA 3EX7C 2C20A 4MICA 1YRBA 4V39A 3P45A 4H15A 3L4BC 1RVDA 5HZGA 5GIPE 5JG7A 1A3CA 1JHAA 2YMPA 4XEHA 1JYSA 3AZOA 3I53A 3A0RB 2G76A 4CL2A 1KAGA 1XTUA 3IAAA 3QE0A 1MJGA 4ITUA 1M6YA 2ISSD 1XA0A 1THMA 3FIUA 3X1KA 5AVTA 3N8HA 1T13A 4RETA 1ZD3A 1K08A 5BNWA 1ZI9A 2JHFA 3IUMA 3NHYA 5LP6A 2ZJOA 3ZE0B 3S1SA 1X38A 1L8AA 2FZVA 2HRBA 3FG9A 3PCTA 5TS2A 2NUAB 2EF0A 1C0EA 2VJOA 3S70A 4O2AA 2R4UA 1P1HA 2P3QA 4D8VA 1X7HA 1UDWA 1XZNA 4N5HX 4Q9NA 3W6OA 4DCGA 4YT4A 2BFBB 3OZEA 3K70D 1U5BA 4X7PA 2ZANA 1UBOS 5JS8A 1XQ6A 1VSQA 1N2CA 4XEUA 4EH1A 1KDPA 1RAIA 1U3VA 2F17A 4AMYA 5DYWA 1S7CA 3BTSA 1BMDA 1H94A 2CJYA 2WSLA 3AILA 4G25A 3TKYA 3VR6A 3K9GA 4ZCPA 1QB7A 2D2XA 1QIGA 2V96A 2NVUB 1DFGA 2R62A 3RFCA 1DCKA 5AKZA 4BNLA 4MVJI 2B5WA 4OJYA 3H1TA 2QEQA 4QTUB 4XSHA 2H4JA 5CVCA 5HJ7A 3EPKA 4INZA 4HGQA 4LZJA 3OQHA 2VJLA 1TADA 3LGSA 1XNGA 1HRDA 1W30A 3T94A 3TUZC 1PVDA 1Z2PX 2Y93A 2JFVA 3HLKA 1Y4DE 1YOBA 3I4CA 1CUSA 3VI4B 1EXNA 2QR5A 4OMFG 2GEJA 5JEDA 3TL2A 3KEGA 2B92A 2XYRA 1LFDB 3H13A 1I7SB 2OV3A 4JJIA 2YHIA 5HFJA 4DR4B 5FOSA 3U3XA 5KCZA 1ACJA 2W4QA 4CMJA 2LVBA 3E3NA 4OK5A 2IELA 1N9GB 1TF2A 3LW8A 4JXZA 2XZOA 1V7CA 4K9DA 1ISGA 3R4CA 2UZ0A 3OOJA 5EYPB 3LQ2A 3V7NA 2AZMA 3LT2A 3C98A 3OJOA 4I1VA 4AS3A 1E3WA 5EJ7A 4KJXA 1L5KA 2WKSA 2VJAA 1DKOA 3THYA 3MMZA 1HEUA 5LU8A 3GLGA 1DMRA 2I7CA 1FF9A 3ONNA 4WOBA 1Z0IA 3R7NA 5HS6A 1Q92A 4Q66C 3MWKA 3NTUA 2H1OA 4EGAA 1TLTA 3NJ4A 3QVVA 2XB2A 3EEBA 4ZCMA 5IBRA 3VR2A 3ZD9A 4EG4A 2GCIA 3H2IA 4C5CA 3DZ3B 5EY5B 3RS5A 5K6AA 2OXIA 3SC4A 1UPBA 4DV3B 1YQTA 3VI3B 4CMAA 3RYFB 3GT3A 5F3RA 2Y1OA 3H2BA 4YJFB 5JZMA 3RVRA 1JEOA 2QTGA 4M53A 3GRAA 3TSWA 4AD8A 2OCDA 2DVMA 3BB4A 3L8YA 4WN9A 4LGCA 2WV9A 1I7BB 3NZEA 3OIGA 3QP9A 4HI0E 3CN7A 4P9NA 2YVLA 3SM3A 3GMDA 5F2NA 3VVMA 2WSSA 1U0NA 4MTCA 4IDEA 3FYUA 1Q57A 1I33A 2E2WA 2VPTA 4GI3A 1QIDA 4GYJA 4HDSA 4G5FA 4UDYX 5FTMA 1G7RA 3WBJA 4P0PB 3ZJUA 3JARA 3ZHYA 4IO0A 4PRZA 3R3JA 3LK7A 3WOHA 2F3UA 5FKJA 3U62A 1OLUB 2XBLA 4D44A 1QU2A 1DIAA 5BSMA 5K0CA 3SHVA 3AEKB 3WXMA 4H6WA 5BW6B 3EFHA 4WKBA 1BE8A 2HIGA 2JK1A 4OXNA 4KRFA 3HN6A 4LK2A 3NUQA 4LV5B 2F3RA 3OAAA 2CY0A 1Y8ZA 1FOEB 4UXJA 1PJBA 1PNRA 1J2UA 2DCUA 2I55A 3CF2A 3K6SA 2J3MA 2C7PA 3L6RA 5LZ7A 4RD6A 4N1AA 5KX5F 2BM0A 4H18A 1I2AA 1U4NA 5TV2A 3TEFA 2HPVA 3ZBQA 4EYKA 2C2HA 3T52A 5F5NA 4YUYA 5FJJA 2YICA 3O1LA 1MMFB 3KB2A 3L0OA 5LWQA 4YJGA 4XTCS 4E7OA 3EZYA 3TOSA 5LZ9A 2XXBA 3E81A 4B8WA 3HZZA 3P0HA 3PC3A 3JATB 4P86A 4QT0A 4FYPA 5AQ1A 2Q50A 4Y2JA 1E2HA 1RI3A 4YY3B 1TKCA 1Y3DE 3A1VA 1JSCA 2OHVA 4L8FA 3OQVA 4UXIA 4W5OA 3KD2A 4RTMA 3BT7A 5BMVA 3TSAA 5AT1A 1WZIA 5ALWA 1E2MA 3OPNA 1Q7BA 1WHTB 2WSIA 3H2KA 3LS2A 1V11B 1WDMA 2EKQA 4ZP1A 4Z9YA 4WV3A 3GJZA 4J6FA 4ZOAA 2JFGA 1TFRA 4GZMA 3R0JA 3HZHA 5GOTA 3RVMA 4J0HA 3A8TA 3R6LA 4IIUA 4D8XA 4QELA 4HF7A 3I61A 3EQ2A 3VZBA 3ZCXA 3OEYA 1HKUA 4A5OA 3EZXA 2IOFK 4INJA 4EZBA 5HP4A 1TK9A 2B5VA 2YV2A 4LEIA 1YTUA 5JXJA 4NBSA 4LFAB 1G0NA 3BD8A 3MMSA 4MP3A 3W3AA 1M2HA 2C59A 1FQOA 3KQUA 1HO3A 4CTOA 4EKGA 1C3VA 3WLSA 3WZLA 3HKCB 1DWOA 1JKMA 1L5RA 3IPLA 4JBGA 1BDBA 4DJTA 1PGQA 1QZ3A 3AM5A 4O3FA 1ILWA 1HDIA 4WGFA 1N0UA 5JPCA 2WIFA 4PBRA 4RXUA 4DYHA 5JD5A 3RAGA 2PX2A 1EX7A 1U4SA 4KVFA 4OBXA 3RTBA 1M3SA 1BCRA 3U4HA 1R16A 5JAOA 1AK9A 1HE1C 4BLQA 1BU5A 4TMKA 1FJGB 1G3QA 2G77B 3OZUA 2ZYTX 4UHKA 4UOEA 1VG8A 3M9XA 4RD4A 2IDMA 5L40A 1G98A 3VHRA 2GARA 4XQEA 1Q12A 3STWA 2XJ9A 3NNNA 4Q7LA 1PQ4A 1WMEA 2ZE8A 3C7AA 4QBGB 1N77A 1XZJA 1XQWA 1L4EA 4N3BA 4PAGA 3MSXA 5K4GA 4QQFA 5JCZA 2ZI7A 3E84A 2WWXA 5JJ5A 4FN5A 4U2BA 2PBLA 1G8YA 1NUSA 1GN8A 5KU1A 3ZLJA 1EK1A 4G0XA 4KXMA 4MV6A 3SVTA 4NNJA 4UPVA 2JGEA 2IC5A 2RH5A 2G5TA 4U7DA 5A7GA 1U2GA 4PTZA 4GMHA 3L6OO 2V7XA 4EJSA 2O50A 3KSAC 2ZKIA 3PXDA 2H08A 3T3GA 4AYXA 1H69A 2Q2OA 2XE7A 5IYZA 1BCSA 4RJTA 5K8TA 3A6HA 1N6KA 4GECA 2F1JA 1SU8A 2A59A 3EHDA 4TMTA 1FP6A 2ZUWA 4HLUC 3MLBA 3OZTA 2VHYA 1X8KA 2H85A 1WJGA 1SXIA 4I1RA 4I5GA 3RRFA 5JBIA 4CDNA 2FR8A 1SIBE 1Z82A 4YUAA 3EP7B 1QYRA 4D9GA 3WK5A 4R98A 2VPPA 1GL9B 5HIIA 3K96A 3W5SA 5BW8A 2B1IA 2WTNA 3P0FA 1GFIA 5CEFA 3WWZA 2GDJA 3COWA 2P30A 2J0VA 2ZXFA 3QNWA 1SXJA 3MS4A 4MA4A 4NYMR 3ZU3A 2UXCB 2OGZA 2WSBA 1SC6A 3RIYA 1JU4A 2X3UA 4OHFA 2J85A 2YZMA 2PMCA 4JQZA 1Y5NA 4LRXA 5B3JA 5IDVA 2ECQA 4GKAA 3ANTA 5AUOB 5JOQA 5ALHA 5LOVF 3BJEA 5CDUA 3ABIA 3F46A 1S7GA 1Z38A 3BERA 2NM0A 2CUNA 1E8NA 1SPBS 2E55A 5IM5A 3U09A 2P5YA 3OCXA 4HWOA 5EZ6B 2V9CA 1LCIA 2V9PA 1LW6E 4WXRA 5EJGA 4FGWA 4BFCA 5K3OA 4IX1A 5BMOA 4R1QA 2ZRBA 3BXOA 3DWEX 1QKKA 5CNIA 3TTSA 3L7OA 5HEKA 1T6XA 2UYHA 3D6MA 1GYRA 4G5OA 2JJ2D 3RYHB 4BGVA 1XQXA 2ZIVB 4HMPA 4AKSA 4EVRA 4XPZA 2Z08A 2UZAA 3UMFA 1WOYA 2FWNA 2QN1A 1XRLA 2H7VA 2ZKLA 2YC2C 5DOZA 1KP3A 3CO0S 1SZCA 1F17A 1G8AA 1Q3KA 1FEZA 4HXFB 3TLBA 2LDBA 4F56A 2OAP1 4BWFB 3DT9A 1T5SA 4WK2B 1YS9A 3S2UA 4JJ4A 1LI7A 4UMEA 1BS2A 1CY7A 1K7SN 2MJLA 3UTDA 1VHQA 4FGUA 5EJMA 1GAEO 2JAPA 2H7YA 4JLVA 4AUMA 3RH0A 1SHUX 1JQAA 3VGJA 3CKLA 3FOAA 4N40A 2EJCA 2OV6A 3KJIA 1G21A 2CUKA 4BBZA 2EHJA 5EZQA 4YAUA 5K05A 1XGKA 2WNSA 2IITA 1BKSB 4MGZR 4TRNA 3QPAA 2Z9DA 4OQLA 3UMVA 3QVMA 3GFGA 3NEAA 4EBBA 2NX2A 3OP1A 4HYEA 4XM1A 3RC8A 3AEKA 3IWBB 1G5IA 3L43A 4KWIA 1AM4D 1Z5VA 2Y1CA 3FW1A 2DUWA 3R7DA 2O8CA 3DP9A 3E5MA 5CMLA 3GIDA 5K0GA 1HETA 1KGDA 3FJYA 1ISSA 1BS9A 4I8IA 3DDWA 7YASA 3HH8A 3DOCA 3MJ4A 3VR3D 1G0OA 2F7SA 1SCJA 5REQA 3KRTA 1E32A 5BN4B 3L46A 4OKIA 1UBRS 5CG2A 1D2NA 1GPMA 1D2MA 3EIQA 3Q9SA 3W8DA 3OIDA 4FWTA 3GYBA 4L74A 1FSSA 1T5TA 3IESA 4XVHA 4C2AA 4CLDA 1XZBA 3ETNA 2BEJA 2NXEA 2W8BA 5IK2A 5AVWA 4WCFB 3I6BA 5E3HA 1ZEMA 2ZI9A 3QPBA 4C20A 3CN9A 3CSSA 1OX6A 2TYSB 2HU8A 3ASZA 4JGIA 4IIFA 2I3DA 4NS1A 5JAZA 5EKDA 1LSSA 4W5RA 2WJPA 1THTA 5JCJD 4U6QA 1QP0A 5CG1A 4H16A 3PGJA 2V6GA 2DG2A 4R2JA 2F8LA 2M6RA 4D96A 4EW2A 5AESA 3LPNA 2C7BA 3B3AA 3AF4A 3C8HA 3RFUA 4EW3A 1E2EA 2Q1YA 4EB8A 1GGJA 3BDAA 1T1SA 1L3CA 5HDQA 4KDCA 4YMGA 2W11A 5EYPA 4BMPB 4RA6B 3DOHA 2JLUA 1Z15A 3KOWA 4QGHA 4R2HA 4GZ6A 4MV3A 3WYGA 5A0VA 3BHMA 1W5EA 4IQFA 5LYJB 1Y6QA 3RK0A 1M6HA 1X15A 4HOYA 3BXHA 1C4KA 1VZ2A 2R7AA 1RCFA 2E48A 4TXMA 4XFDA 1WRBA 2YJ5A 3RHTA 2RHRA 4FX5A 5BVHA 3C45A 4QUDA 3HO6A 1E7YA 3WHIA 2IBSA 1RJFA 3HM2A 3NAGA 2GF9A 4WXPA 3UW3A 3VU9A 5ALVA 2G17A 4Q3NA 3O38A 1YNSA 4E94A 1B8PA 1WZEA 3TD2A 3Q1KA 4FCTA 3H0CA 4I50F 1O58A 4O29A 1G3IA 2UZ3A 3G2KA 1HXHA 3I9JA 4TV8B 2QVGA 3B6EA 2ZYWX 4NSNA 5EZYF 1JSZA 1UT6A 2WG1A 3TS1A 2QMQA 1R6AA 3OQOA 4NAHA 1UWLA 1JA9A 2QBYB 1P3JA 1TCAA 1X7XB 3BGIA 2A1UB 4E2YA 4FLFA 1S3IA 1XEXB 4C0XA 1UMDA 2YMLA 4L8VA 2C2KA 2ZRHA 2QTNA 4MQFB 1UP4A 2EG9A 3E35A 3H2SA 3KFVA 4R8MA 1P39A 4NKRA 2JBWA 4M38A 3T3EA 3OJ0A 1XROA 3W90A 3IP1A 2AG0A 1F48A 2JJMA 2ZCUA 2ZTHA 5B3AA 4CIBA 3VPBA 2PUJA 2PKWA 3NYRA 3GLTA 4A0FA 1L7RA 3B9RA 1ZD9A 5KPJA 1SKYB 1TJPB 2L42A 4QNMA 3WB2A 4E31A 1IBMB 1LRLA 4P7GA 1X9IA 2BMFA 4BC0A 5KO2A 4J7CA 3HSKA 4DXAA 4FHZA 1JQBA 2CXXA 4F85A 2I4IA 2H07A 2WZQA 2R48A 1NGSA 4CMKA 3RV3A 1Q83A 3BH6A 1TOAA 1F5NA 3UNXA 1G19A 4XX0A 4X7RA 3T5GA 5IF3A 4ARZB 3PHIA 3D3KA 3ZHVA 3KDAA 5G0UA 3ZCSA 4O3MA 1KQGA 2G72A 3T7JA 3PNBA 2QN9A 1T5OA 4F5DA 3H8JA 2Y4OA 1ONPA 3KALA 5FYQA 2FU5C 4PLVA 2Y27A 4JSRA 4G5SA 1Q91A 4P8RA 4PSUA 5IJ0B 2O8NA 2WPNA 1AQIA 2WD7A 3P71T 5ADVA 2RJ3A 2EP8A 4KKXB 1W0JD 3C4QA 5F52A 4Q4CA 1YJXA 1Y1QA 4CV1A 4DSNA 5E3JA 4PC1A 4QDTA 1GLNA 5B2EA 1ECCA 5B7GA 5GY7A 2QZZA 3DNMA 4Y2RA 4GYKA 2J0QA 5H3HA 4FQ7A 2ZVPX 1GO2A 4NK5A 2W43A 5JH7A 4OQZA 1GITA 1B16A 3QNUA 4EA7A 4G36A 1G8JA 2XMGA 3F6PA 3GEPA 1K7CA 1DKUA 3OIUA 5HJ2A 3TTTA 4RSRA 3KPYA 1JIKA 2IH2A 1T5IA 1UFVA 5BSHA 5EPOA 3C6ZA 5IC4A 2NQ2C 2CYCA 2BEVB 2FUKA 3JYNA 2P3SA 5H4HA 2DFDA 3GLUA 3NIDB 3SJBA 3T9AA 1V2GA 2HD4A 2CVFA 2NG1A 4WNIA 1KU6A 1P8JA 5SY6A 2D4HA 4C0LA 3ZDRA 4YXFA 2AW3A 4N76A 4R05A 4W5WA 4DNOA 4PAQA 4KH1A 1PL0A 3B70A 3T4EA 3ZV4A 1NBMD 5ALOA 3PXBA 3RSQA 1D1QA 2GXAA 2XDQA 1TLFA 1X7GA 3EWIA 2ZRCA 3T3HA 2XPCA 2JLBA 2C82A 2X0EA 1KIMA 5C31A 4YRDA 5L3RA 1YA8A 3B3FA 3MSCA 4HH3C 4I7EA 1H0RA 1LI5A 4DMCA 4TZTA 5FBQB 1A76A 1IOLA 4Z7OB 1KNXA 3NVDA 5JAMA 1X2EA 3RC3A 4GPD1 1Y1KE 1I5OA 1TO1E 2XYVA 3H6KA 3RDPA 3VRHA 3GI1A 4UNNA 5KTKA 2OT3B 3AEQB 3F74A 3JQ8B 3OD1A 3B89A 4IO1A 3WNQA 4OSOA 1VTKA 3F6SA 4H7IA 3D59A 4HQLA 1KDVA 3RRMA 2BEVA 1UP6A 4B44A 4KQJA 2AC7A 2GPBA 4Y8VA 3ZN2A 1P4GA 4BMZA 3BA6A 1ST2A 2J9GA 1JQLB 4XPIB 5ICCA 2I34A 1GGFA 3PJRA 3JR7A 1EJ6A 2N42A 2DFKB 4KAXA 5IC6A 3OLYA 2Z5VA 1C29B 1RRKA 3HVKA 5E6SB 3ZEIA 5MGBA 1C1DB 4OSEA 4GXNA 3Q3GE 1DLIA 1G20E 3KR9A 3T7CA 3C85A 3U1VA 1QPBA 4O4JB 3DB2A 1DXYA 2AQ8A 4PZAA 5I8WA 1E2BA 2A5LA 3LDAA 1T1EA 1O03A 2ID7A 4LRYA 1K66A 2QTRA 2GZRA 4BB9A 3LOUA 2P2GA 3GCDA 2RI6A 3I04A 2F9MA 3R0QA 2DPGA 5AOBA 1T8UA 1E9BA 1D2HA 1T9CA 2GLTA 3EDCA 5JXIA 5C8VA 2FPMA 2PGXA 2I67A 1FFAA 1TO2E 3DYVA 3S2IA 4D3SA 2VK4A 4WFIA 1M7BA 2PGAA 1L5QA 1P62B 4XKJA 4YMSA 4D3DA 3OTOB 3P52A 3GDWA 3VPFA 1RWVA 3IPRA 4XVUA 2HLDA 1JR2A 1E7RA 2QJRA 1NAHA 1JHDA 2DLDA 4NBVA 1FK8A 5CA0B 1FXWA 2ZE5A 2ANBA 4WCFC 2ATEA 5BUZA 4FYKA 3W2FA 5FOVA 3QUCA 4LF6B 5DRTA 3FPHA 4KMRA 1SKAA 2ZZMA 4Q7MB 1QAMA 1E18A 5AMXA 1P7VA 3ONEA 1SOMA 2COKA 1NYQA 2HBZA 4WCDA 1JEYB 2V0CA 2O2IA 4HUQA 1R10A 3HB1A 1V2HE 1UODA 1ZRSA 3U7JA 4YEDA 3VU1A 3E7FA 4Q4AA 1HDEA 1QRUA 4G4JA 1FFCA 2Q27A 1YJ5A 3KJFA 1DRVA 3H84A 3TMYA 4BGEA 3EQZA 4YRSA 3DLTA 5DCUA 3WGMA 5IUNC 1B3BA 2B3TA 3H4TA 4FGZA 1KXJA 1LKZA 4GOMD 1CJVC 1OVGA 2K7ZA 3JAKA 3PC6A 5L4LA 4JR2A 2XLBA 4K1XA 1F9AA 2YMMA 4QZVA 5IT5A 5LXTA 1LJUA 4MGHA 5HKAA 2JJ1D 4FYXA 4NU8X 1O9GA 4C0QC 4OHBA 1SCUB 4OHKA 2CC2A 2QRZA 1BD4A 2XNCA 4BJ1A 2HWXA 2LDXA 3JYOA 1YQXA 2VWQA 3ZQ4A 4F1JA 1HNZB 4JI7B 1HE8B 1PT8A 4FILA 1MFPA 3WLHA 2HSWA 1WABA 2Y66A 3WGHA 1G6OA 3GLIB 2RGAA 1ZNXA 3FB1A 3N6VA 1LA2A 1I6LA 1D04A 3UHPA 1I2ZA 4BEVA 4BIMA 1XCLA 1JX6A 2GPAA 2PVSA 1WDLA 4MR9A 1OXTA 1U4OA 2GPTA 2XUQA 2O7NA 3DYIA 3HGMA 3KVOA 4HDCA 1WS6A 1Z8DA 5IBQA 3SG0A 2OFXA 1ECLA 2DQSA 1XMSA 3F67A 4NYIR 4X6LA 1KRHA 1JG2A 4OTZA 4BAUA 1MABA 2CFCA 4QU9A 2QD5A 3KM0A 3RT7A 1EVZA 4ND1A 4R1LA 4BO0A 4B40A 3SJCA 5SZHB 1KDYA 1GCIA 2AR9A 1M2NA 1SVIA 1QLJA 2JF0A 2VAXA 3FCSB 4GMKA 1ZCFA 4P4SB 1TQHA 2UKDA 2ONCA 4B3JA 3FPCA 3THYB 4NWIA 5DF1A 4NHEA 2VJMB 3TUIC 5CFLA 4C4SA 2EATA 1KJWA 2OILA 2XA2A 2RONA 1LSJA 3N7TA 1TTQB 1ZSVA 5IULC 2ZUEA 1EGQA 3M2TA 1WXWA 5TC4A 4DWWA 3THWA 3DWIA 4MUXA 2JLRA 3WLAA 4ASUA 4FDLA 1QHYA 8ABPA 1GZ4A 5KAPA 4EG1A 3PQ2A 2CBZA 2AK2A 4V1CB 3NJ8A 1UXKA 3Q7RA 3MWEA 4RHEA 3H2HA 5GGXA 3U37A 3HYNA 3ZBPA 2VCYA 1I36A 3QFRA 4O4HA 2Q28A 3LVFO 4GG1A 1CG6A 2FMHA 4GPEA 3AEUA 1O3YA 2GN0A 3B6IA 3I3SR 4KUGA 1JW9B 3N28A 4M1YA 1DQPA 3VV2A 5JWRA 4D97A 3ABZA 3ZW9A 2QORA 3MIIA 5F5XA 1MN6A 5EOVA 5E7JA 1KHHA 4ZEOA 4HT3B 3FKQA 4GXQA 4KNVA 4MMZB 3VO1A 4DRZA 4DUGA 1OWLA 5KNDA 3OLVA 1PR9A 2QRNA 3CWCA 3EA0A 1NMXA 4A8JB 3CMCO 2D8AA 3N2KA 1I7PA 3P9RA 4PZPA 5KJFA 4X6XA 3WSWA 5LQNA 1L0BA 2G5CA 1YQWA 2PKXA 3CG4A 3A3NA 4C3OB 4WBNA 2QRVA 2WM8A 2AKAB 1VPEA 2D1TA 4Z9XA 2FW9A 3QVJA 4MWOA 4IIXA 1OLXA 4ZVUA 1P31A 5ALQA 2X9GA 3CZPA 1BSVA 3EDOA 2GJ9A 3WLTA 2DKNA 4JROA 1SUFA 5TPWB 1G21B 1QGZA 2W2VA 1ZM4A 3L82B 4NK4A 2RHWA 5CB4B 1NJ5A 3D3NA 2O48X 1I4DD 2G7ZA 2R751 3OU6A 4LYJA 4NBRA 5J5AA 4KMSA 4CR7A 3HR7A 4UARA 2I80A 3SSMA 4KPUB 4C76A 2DWUA 1DO2A 1JA1A 2VSYA 5FWAA 1R6UA 3NTXA 3EPAB 3G49A 1JJAA 3L7YA 3E7DA 1QG6A 5HCIA 3VZCA 1QIIA 4EG6A 2DYKA 5C2JB 3LY5A 1AG9A 1JPNA 1UANA 4D0SA 3CTPA 3WE7A 3GELA 3K4QA 4YLGA 4H3VA 1LTQA 4DIUA 4YV1A 4C2UA 3M1YA 5FOTA 4ML3A 2XGSA 4GO1A 4JXJA 5AW4A 1H4SA 1K5PA 2O3UA 1QCCA 1Y4UA 2TS1A 4QHYA 4C7MA 2MR6A 1QK3A 3L01A 4WN9B 3CUVA 3KT6A 4I2NA 1RYZA 3CURA 4C5AA 3RVNA 4JT9A 2NQ8A 1L7NA 4BV2A 4DQXA 4WZAE 1A9XB 4HPWA 2B8WA 2XF8A 3TX2A 1Y5MA 1YRAA 2K2QB 4DQ0A 4HQOA 4MVCA 4JQSA 2ZIZA 3PRYA 1L5MA 3AUSA 3O1IC 3WNVA 4CLQA 4B6EA 4L2IB 4F4HA 4ZT3A 4ZHSA 3EQ9A 3P19A 4YRZA 2O19A 2P0AA 4BFUA 3R3YA 5DT2A 4M1MA 2KLBA 2F8TA 3BK7A 2WD9A 4INPA 1TJ4A 4N4AA 4BX9A 4IHQA 2JGFA 3QX3A 5DXJA 3O74A 2B69A 2R8RA 3A4LA 4UKDA 3IBGA 3HXPA 5KVQA 1I1HA 1TKBA 3QU9A 2AYYA 2FZEA 2G9VA 5ARDA 2HYIC 1XP8A 3F98A 3CONA 1RJGA 4QOSA 2QJTA 3Q7EA 2WWHA 2WILA 3EG9B 3I5MA 1XSEA 2VJKA 2ZBDA 4XUDA 2R1UA 2OORA 1PTKA 3FFXA 4GYWA 2RFLA 3AUFA 3PLNA 1V71A 3NTOA 4H7PA 4AJ4A 1YL7A 5A5DA 3K1JA 2EP5A 1BJRE 1RLOA 4OBBA 3SHWA 2JLVA 1R7RA 2RGDA 2PL3A 1MVOA 4PZUA 5DBGA 1VBKA 4QPNA 5BYJA 3UK0A 1PJZA 2F1RA 3DTNA 3QXJA 2RBKA 2Q8NA 3SX2A 3ITDA 4PCAA 3TG8A 1SVLA 1K97A 2BHNA 4CI9A 4MKHA 1O87A 4KYVA 4TMWA 4PR0A 4Y2YA 3PYLA 4I46A 3EHEA 2PT6A 2H1VA 1XTPA 2JRLA 3D6NB 1BE6A 5HBGA 4WCVA 1PFKA 4YP0A 2D5AA 2C98A 1JDSA 1ECPA 1XN1A 1ZL0A 3DBVO 3DMFA 4DSTA 1L1EA 1K6MA 2R6ZA 5I7WA 3ND5A 4C22A 1N2CB 4ARZA 3EAGA 1JR4A 3JQFA 5K5EA 5EXXA 2OKGA 4QJ4A 4BUCA 1FNBA 4HNUA 1VA4A 1WPXA 1RWXA 5CFQA 4INOA 1J0EA 1TK2A 3LH5A 3E1KA 3FFAA 4KBYA 3DW1X 2ZZKA 4IP0A 4RO0A 5AK6A 3VJMA 3Q41A 3KHUA 3ICWA 1EFVB 3N3BC 5C1IA 5L3QB 4PFJA 3DBLA 2IY9A 3A9SA 4FOSA 2LR0A 1CJUC 1MQSA 2FA9A 4P3PA 1SVKA 1LPMA 1V8DA 4X94A 4XOIA 1WCIB 1IVNA 5CVUA 1PK8A 2AA3A 1WP4A 2W6OA 3DE1X 3K1AA 1ZP6A 2IY7A 3KL4A 3MJSA 2OZLB 2IFTA 5CT9A 3KHSA 5IWCA 2FP3A 1UQUA 4JAVC 2NO1A 2HN9A 3LZ6A 3ZHOA 4E1BA 5LZ8A 4MQ6A 4P2BA 2X9VA 4X1KB 1Z5GA 1KOFA 1FUUA 1ZXLA 3SMQA 1RQRA 3BSFA 3G0BA 2CXPA 2FN4A 4G2TA 2VSQA 1H93A 1F5SA 1Z73A 1YDEA 2AIRA 3AEQA 2JCXA 4RQUA 4UBNA 3SU8A 2WIDA 3W2IA 2I91A 2APJA 3D6AA 3I9MA 1P44A 2DPXA 3GJ5A 3FR7A 2NTVA 3TEJA 2G6BA 2LCFA 1IB0A 1QTRA 1QHSA 1JQDA 1V11A 4JITA 2AFHA 4KK3A 1EXMA 3M83A 4KXWA 4D5GA 5KEIA 1GT6A 4XIGS 3QSYA 4NZNA 3I73A 1EFCA 2HC9A 1GDHA 2N46A 3PQ4A 3D1JA 4ND7A 5CM9C 5DYTA 3WDMA 4OAOA 3ROQA 4JX9A 4HQKA 4JB0A 1FQJA 2YNMA 1WDKA 5ERYA 3IEVA 2ZBUA 5TPZD 1ZM9A 1DWPA 3O0DA 4Q3AA 4UHDA 5H68A 5JXHA 1XQYA 2FI1A 2JFUA 1J5PA 2P2LA 1AB6A 5KKNB 1H6CA 2QLNA 3I1YA 4O4LF 2Q22A 3DTVD 2FETA 1GZ5A 3NYWA 4W8OA 2RK6A 1FUIA 3RNLA 1IRIA