4F3YA

X-ray crystal structure of dihydrodipicolinate reductase from burkholderia thailandensis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
b'SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLGKQTGVALTDDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVFSANMSVGVNVTMKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGRDAGFFDMQDVLGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
total genus 79
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4f3yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f3yA01
3K6JA 3NTQA 1Y8QB 2G17A 4E2WA 4Q3CA 2HKIA 4YB8A 4PG8A 3WLFA 4XR9A 3JYOA 1JDJA 3MTJA 3MWEB 4LVUA 4FPXA 2NVWA 1MG5A 4RQUA 4YJGB 3SJUA 3TNLA 4CM3A 4RDIA 4E30A 5A03A 5TGDA 4FB5A 2NM0A 1ZBQA 2CZCA 3SC6A 3KEOA 3IL2A 3NDJA 5JO9A 2GN8A 5I9NA 1JTVA 5KJ6A 2VT3A 1ZK3A 3TSCA 4OO3A 4E5KA 3KYCB 3ZI0A 4D7AA 2DAPA 3FNHA 4J3FA 2ZJ1A 1MG0A 1T2AA 1QYDA 4J7XA 1F0YA 2HMWA 1NASA 1T4BA 5CEJA 3H7AA 2C29D 4PVCA 3V1TC 1IUKA 3DTYA 2AG5A 2W8ZA 4UEOA 5A3VA 4A2CA 3CSDA 4CMJA 4XR4A 3PJEA 2J5RA 2HK9A 4BQPA 5A5EA 1PS0A 2ZTUA 1TB4A 1E1MA 1E1NA 4FDAA 3WJ7A 2RBEA 2WE8A 1ZEJA 3AW9A 1NWCA 3PWKA 1SB8A 1NHWA 1T2CA 4D41A 2NQTA 3QSGA 4R1TA 4Q3BA 4DTIA 1U8XX 4W6ZA 1PSDA 3RBZA 1KY4A 3BMCA 3EDMA 1SMKA 3SLKA 4BHTA 2BGLA 3ROMA 4EW6A 3IC5A 4M87A 4F6CA 1ZMTA 3AWDA 3NGLA 4IQGA 3WIDA 4OM8A 1E1KA 3W8FA 1WXDA 4HY3A 5JMPA 1H2HA 3V2HA 3PYMA 1HZZA 3ZV5A 3NAQA 4IQ0A 3HN2A 4O5OA 3DONA 5IDXA 4KMSA 5ICMA 4ZICA 1BXGB 1SBYA 3DOJA 3R0IA 4QT0A 3DWFA 4UUNA 1HE4A 3HSKA 4CJXA 4L73A 2X5OA 5TF4A 5TJ9A 4GQAA 2CUKA 3LC7O 2W2KB 4U6QA 3KO8A 5G4LA 5IFLA 4J1SA 2B37A 2HO5A 4NBVA 4C7JA 4Z0PA 2O3TA 3WMWA 3DTTA 1XLTA 3H3FA 4NDNE 3FNFA 4F45A 4FFNA 4BQRA 4OJNA 3WTCA 1DFHA 1H93A 3KUXA 5T8KC 1E6UA 1NNUA 5KJCA 1ONNA 1GV1A 3PWSA 3G79A 8LDHA 4OSOA 1YWGO 3CUKA 4O6VA 5IN5A 1PGOA 2BI7A 1PJ2A 1XA0A 1B26A 2B35A 3JV7A 3PFFA 1ONOA 3WMXA 2Q22A 5ILGA 2C0CA 2VYVA 1BVUA 1DOHA 2B69A 3OM9A 5JFOA 1HYGA 2GN4A 1GUYA 3G17A 3JQAD 3DFZA 3GDFA 3U4CA 5JNLA 3DAFA 4MO2A 5DOZA 4F3YA 3WGYA 1J5PA 2IZ0A 1QV6A 3FWNA 3ZWYA 5LDHA 5G0UA 3DC2A 4FGSA 3D4NA 4HADA 5L45A 2XF8A 2FPIA 4AVYA 2CDCA 1X0XA 3OIFA 3NJ4A 3BA1A 2E6UX 2XXBA 3DHYA 2O50A 3HDJA 4I9NA 4D3FA 4YT2A 3GAFA 4CLOB 4ZQHA 2AQHA 4XCVA 4BV9A 4BNFA 4YJHB 5CPBA 2Y1GA 2Y05A 1PQPA 5EINA 4L74A 1GUFA 5B4UA 3QVXA 1JQBA 1XQ1A 1QYXA 1FK8A 4BV8A 1LSJA 1XKQA 3RJ5A 2C59A 3B1KA 4PLVA 1EQ2A 3E1KA 3DBRB 3BXXA 1V35A 3LC2O 4LGVA 3BMQB 3UCEA 2IXBA 2RCYA 4Z9FA 4CMBA 3R3JA 4NNJA 4K28A 1A7KA 4O59O 1KC3A 3TOZA 5H81A 4CODB 4NBWA 1DC3A 3JD4A 1E7RA 4DREA 1B3BA 3HG7A 3VPHA 3QW2A 3G49A 5T8KA 1JKFA 4IJUA 4QSMA 4Z3KA 4AG3A 1B2LA 3FF4A 3GAZA 4NBUA 3WR5A 3KM0A 3LSYA 3E9NA 5KVCA 2OO5A 4BO6A 3TL2A 1Y8QA 5FF9A 3KV3O 3RUCA 3WNQA 1H9BA 3ON5A 4YJGA 3QY9A 1VLLA 2C7VA 3TPCA 3HFGA 4CR7A 1I2CA 3H5NA 3ENNA 2O3JA 3HJAA 5IZ4A 1EBUA 3WFJA 4Y9DA 3N7UA 4XB2A 1DEHA 2EGHA 5THKA 2BFOA 4YPOA 3KYCA 5A9RA 3EC7A 2PFGA 4IY1A 4BNIA 4OMUA 4DC1A 4DMLA 3PVZA 4RF4A 1F12A 4PN3A 1K6XA 4LRSB 4DYDA 3P19A 4U5QA 1XU9A 1A4UA 4W9NC 4RLSA 4B3JA 3LK7A 4A26A 1OI7A 5TT1A 1HWYA 3QRWA 4PLFA 5F5NA 4IJVA 1E6EA 3HWRA 1N7GA 4KWIA 4NK4A 4R9SA 4BKQA 3AU9A 4Z0TA 5U9CA 4YAIA 1FF9A 2X4GA 1WLYA 2IXAA 1MC5A 1U8FO 4L4RA 1E3LA 1VKOA 4OXNA 4DBVO 2G5CA 4HFMA 2HSDA 1LQUA 1MLDA 1WDLA 3ZV3A 2ZTVA 1TT5B 1FDSA 4QFDA 4J7UA 3M2TA 3VH3A 1IHYA 3QWBA 2P4HX 1MFZA 2OUIA 4WECA 5I7EA 4K6FA 1PJCA 5M6DA 5C7LO 5CAEA 1PL8A 1OMOA 4W4TA 1BXGA 4CV2A 2PGDA 1WW8A 3RIHA 4KDEA 3U62A 3PXXA 1MB4A 1HLDA 4WJZA 4AFNA 2DTDA 4QO7A 2R2GA 2DTEA 2PA3A 4HXYA 1HXHA 4YJFA 3GHYA 2PWZA 1EK6A 1GQQA 1M6HA 2YDYA 3AY6A 4WCDA 1BHSA 4GVLA 4YEDA 5KVVA 2AQ8A 2V6MA 5HA5A 2Y67A 2C54A 2YUTA 1ISIA 4XYBA 2EG9A 3QVTA 4GX5A 4YACA 1Y5MA 4TSKA 4CQMB 1H6CA 3JD1A 1PU2A 3QWIA 1LSUA 2WE7A 4WE3A 4W9NA 2O48X 3S2GA 4BO4A 1WZIA 4NZ9A 4CMAA 4HWKA 3VDRA 3IQDB 5AXDA 4CLRA 4N5NA 2SCUA 1LRJA 1U3UA 1P31A 3ZWXA 3WB9A 2VYND 2X8LA 5AQ1A 2JHFA 4WK6A 3JQDA 3UF0A 3A14A 3UUWA 2GYYA 2TMDA 5A04A 1TA4A 1PGQA 1U5CA 1LLCA 3D3WB 1KVRA 4BNJA 1DIRA 4HBGA 1R4NB 2Q2VA 1HZJA 2WYUA 4OH1A 5EMHA 5A06A 3BMNB 4TWRA 3WSVA 5BSHA 1U5AA 2HJSA 4BUCA 4MVJM 4CLOA 5HS4A 2EW8A 1SB9A 1P3DA 4RVFA 4YJHA 1NXQA 2X0NA 3ZHYA 1ZK2A 1LEHA 3E9MA 3NT4A 1ORRA 4FR5A 3SEFA 1ENYA 4AJPA 1HLPA 3NTOA 1VJ0A 4FFLA 4ALJA 1JN0A 1EDOA 3DBRA 3ASVA 4MKRA 4U7WA 3BMQA 4RPKA 5B4VA 4IQ8A 3H9EO 2D1YA 4XJSA 4E5PA 4BNYA 3HE3A 3JSAA 2DBRA 4PLZA 1U4SA 4II2A 4WLUA 3ZWMA 3JD3A 4OHUA 1R4MA 4NR0A 2CDAA 3UAGA 3LU1A 4GLLA 1ADGA 2FZWA 3WDSA 1PWZA 3Q9UA 4JP3A 1UJMA 3RBVA 3AOGA 4D0RA 2I76A 4DIFA 4EGFA 4B7XA 2V6BA 3AI3A 3TFQA 2P4QA 4FC7A 1N7HA 4S1VA 3CEAA 2GN9A 3DBLA 2P91A 3DZIA 1K5HA 4H7PA 2VOJA 4RVSA 1K2WA 5IF3A 2GPTA 3IKVA 4OAQA 4YQYA 1BGVA 3ZWVA 1Y7TA 5FEUA 2X9GA 4NI5A 3RFTA 2X9VA 1U3TA 4LSWA 5CG2A 3DMTA 1UDAA 4AJ2A 4BNGA 3C85A 3NDIA 2AEJA 1IPFA 4J1TA 1LQTA 3NT5A 4EUEA 4YT8A 3OA0A 1HDZA 2IE0A 3RU9A 3IUPA 4MIOA 2R6JA 4TROA 1VC2A 1A9YA 1D8AA 4WEQA 3FHLA 2CNBA 4U0KA 1ENZA 1X7DA 2AMFA 4HV4A 2G1UA 1PX0A 1ZZEA 2ZCVA 4HNGA 1DC4A 4KQWA 1NR7A 1B8PA 2WSBA 1UDBA 4JP2A 3L4SO 3EK2A 4JK3A 3INGA 2W90A 4QO8A 1N2SA 2EKQA 4GX2A 1V6AA 3JQGB 3GLQA 4WEOA 1E1LA 2OP1A 4WGGA 1E6WA 1GZ6A 1VJTA 3FTPA 3I9LA 2Q49A 3OJ0A 2P2SA 3AUAA 4OKIA 2YHIB 4J7CA 1YQDA 3VVBA 1AHIA 5IN4A 2EJWA 5EQFA 4R1SA 2BHLA 5JS6A 3CMMA 1IPEA 1TT5A 4OOEA 3RJ9A 2V6FA 3RFVA 4TKMA 2PV7A 4E2XA 2FN7A 4YCAA 4BGIA 3AI1A 4EYEA 5T64A 3DO5A 1S7CA 3B1JA 2Y93A 3S1LA 1SOWA 3F46A 2HLPA 3C7DB 3FBGA 1OOEA 4ALIA 4PRLA 3AFMA 2VZ0A 1OZAA 3OP4A 4FQ8A 1P9LA 4EZBA 3M6IA 5U1PA 2WTBA 4BNMA 1UXKA 5J9GA 5GZ1A 2NSDA 3W8DA 3RC7A 1P74A 1UUFA 1ZFNA 1Z45A 1PZFA 2GUGA 5DBGA 1MXFA 3HADA 1C1XA 2WM3A 1W0CA 2PLAA 1DAOA 3AOEC 1NWHA 1C14A 3V5NA 2Y1CA 1KYQA 4ZN6A 4I5DA 5I7FA 2H6EA 3A4VA 2DPGA 1LJ8A 3ANLA 4FJ1A 3RFXA 1CQJA 4A7PA 4YA6A 5BR7A 1GYQA 1K89A 1A5ZA 2ZB8A 1UXIA 1VL6A 3IDSA 4MVJA 1LDYA 4NQZA 2OMEA 4CQMA 1W8DA 2BKAA 4IGEA 1ZIDA 1M6WA 4Y6RA 4RJTA 3KSDO 4FSHA 4HX5A 4E2YA 4G5HA 1JVSA 1FXSA 3V1UA 3OBBA 3GEMA 3GH3A 3ICPA 4R69A 5KKCA 5GZ3A 2PD3A 4PCVA 1T1SA 3V8BA 1RPNA 3WIEA 3JYLA 3BTOA 1QMGA 1QXSA 1TVEA 1KEUA 3NUGA 4Z0HO 1JKJA 1T2EA 1GPDG 1E7WA 5IZCA 1PJBA 5B4TA 4AJHA 4GSKA 4HFNA 5DDIP 1WDKA 4IPTA 5FI5A 1D7OA 3ROQA 4WCFB 1CIVA 1NPYA 1Y6JA 3T7CA 1IOLA 4I08A 3WGOA 1G1AA 4FBGA 4XIYA 1ZSVA 2CF5A 3TL3A 3Q11A 3EZLA 1CEQA 1J0XO 1E3JA 1KEPA 2Q1UA 3U4IA 5F1KA 2V65A 5BQFA 1K3TA 1LC0A 4YWJA 4GX1A 3NTRA 1O89A 1BMDA 2VWPA 5F5LA 4CMCA 2ZCUA 5TNXA 1XG5A 1VE9A 1JA9A 4TKLA 4EI2A 1LDNA 2ZKLA 5ICSA 1QYWA 1NAHA 2JD2A 3GRPA 1E7SA 2FR8A 1PIWA 3AOEA 3PK0A 4BNKA 4L76A 1DC5A 4J4TA 2P9GA 4M55A 4B4UA 1LBEA 1CYDA 1ZK4A 5HS6A 2I65A 3PHLA 5CDSA 1X7HA 2J5QA 5TT0A 2D8AA 3OIDA 1I10A 4LISA 3ZV6A 4BO8A 4JNKA 1MXHA 1NFFA 4MVJE 5L4LA 4ND2A 2HMSA 3V1YA 9LDTA 1ZKMA 1UZLA 4E6PA 3HQ4O 2W98A 3SX2A 1ZO8A 2A35A 4OXYA 1I3LA 3ETEA 3OQBA 2GGSA 4B8WA 4YRAA 3MJEA 4Y98A 1OC2A 3UH1A 3DHEA 2EW2A 2H1SA 2JFFA 3GRKA 2G82A 5CEFA 4F46A 2QYTA 1ZSYA 1E3IA 2HQ1A 1DLJA 5F21A 1I2ZA 3LT2A 2D59A 1N92A 1DJNA 3FPCA 3TF5A 2ZK7A 5GZ6A 2CFCA 4NK5A 2NTVA 1EFLA 1YL6A 1WNTA 2GZ1A 1XHLA 3OEYA 4A5OA 2C5AA 1IULA 4J4HA 1P1HA 2ZJ0A 1UP4A 2X5JO 4WNCA 3MTGA 4IDBA 3H9JA 4IDGA 1PS9A 3GPIA 3QVWA 2UUOA 4GKVA 4UVIA 2NU9A 4DL9A 1LC3A 4ND5A 4TRNA 1N8KA 3DBVO 1S6YA 1VI2A 4MJLA 1DJQA 5GY7A 4D46A 2Q3EA 4ND3A 5C5IA 1VRWA 2X7HA 2BELA 1VSVA 1IL0A 4ITUA 5JLAA 3KETA 3OJEA 1DIGA 5BSFA 4DPMA 4JQCA 4PLWA 3RSHA 3TDKA 3UFXA 5LCXA 4EEXA 1G0NA 2FSVA 2NQ8A 4WCFC 5LC1A 2DKNA 3ST7A 5JDIC 1GPJA 2QZZA 2DFDA 2HMTA 1R12A 4W7HA 4C4OA 2QZ9A 1I32A 3ONEA 4M54A 4WASA 1T1RA 4EEZA 4A27A 5DOVA 1NBOA 4KTTE 3MWDB 3PHIA 2W2LD 3L9WA 4BGVA 5JC8A 5KOIA 2JFGA 2OHXA 2O2SA 4P22A 1T2DA 1C0LA 4UULA 1LI4A 4IDAA 3ONDA 1ZMOA 4AL4A 1E3SA 2VRCD 5EERA 2IODA 2P9EA 3ZGYA 4E12A 2BLLA 1GY8A 2I66A 3JD0A 4E21A 1ZJYA 2D4AA 5G4KA 1VJ1A 3E5RA 5H82A 4CM9A 5IXSA 5G2OA 1IZ9A 5I7SA 1F17A 3H2SA 3AI2A 1BDBA 3RKUA 4ND4A 5ILOA 4J91A 2J8ZA 1HYHA 3WGTA 3I9OA 3BIOA 4ZVVA 4QUKA 1MV8A 3CZRA 2J3HA 3F4BA 5FYDA 4ALNA 4FW8A 1EFKA 1TXGA 2NV6A 3BTSA 3L6OO 2DPHA 1QRRA 3VTZA 3ZCXA 1PWXA 1DHRA 3IKTA 2DBZA 3ROKA 3UXYA 2D5AA 5A05A 4BGEA 5U4QA 4UUOA 4EITA 2DM6A 4MP3A 3O26A 2Q4EA 3H9GA 2X5KO 1RYEA 1B15A 2O3SA 4WCFA 3ROPA 5JDIA 2ZYDA 3PEFA 5KVSA 2Y99A 4EJ0A 2EWMA 4L75A 1J49A 4PLHA 2G0TA 3WXBA 7ADHA 3U09A 3PI7A 1IE3A 4YVFA 2YHUA 4XGNA 4FOSA 5BNIA 1BTOA 4JROA 2Q45A 1SCUA 2Y1DA 4Z6KA 1W4ZA 1LRKA 4AJ1A 4FN4A 4XYGA 1GU7A 4R68A 4UVDA 3UOGA 4YJFB 2HRBA 2O3QA 4WLEA 2VNAA 2Q1SA 4RZIA 1TI7A 4WNIA 3PDJA 2V6GA 4B4VA 1SEPA 5TLSA 4BO0A 4E2ZA 2H63A 3WSWA 5L3ZA 1DIAA 5L51A 5JCJD 3Q2KA 3H4VA 4NJOA 2VUUA 3TZQA 3W1VA 3HDQA 1I36A 1NR1A 1U28A 3LC1O 1EBFA 2JFHA 4Y6PA 1GZ4A 4UAGA 1YVEI 2D3TA 1JAXA 5C7OO 4XWYA 1GUZA 5B12A 2O23A 3OIGA 4JBIA 4JXKA 1ID1A 5KIAA 4TMFA 4BNZA 4CLRB 2C82A 2C7GA 4FGWA 1I8TA 1UP7A 1SC6A 3GN1A 4CQLA 2P9CA 1AE1A 1EE2A 3GNTA 1Q7GA 4GBJA 4IDDA 2EGGA 4QX6A 4RLHA 4UEJA 2TMGA 3OMLA 4RORA 2GERA 3PZBA 2QRJA 3DDNA 4HUJA 3ZWNA 3F1KA 3OEWA 4BKRA 1YS4A 4E33A 3EW7A 4EJMA 1E3WA 1LUAA 1YRLA 3OQ6A 4IJKA 4PFJA 4GL4A 1E0DA 4ONEA 2NU8A 1NYTA 1X7GA 4BKUA 4L9RA 4CMGA 1VKNA 1KERA 3TZKA 3NEPX 5JBIA 4LRTB 3OICA 5I7VA 5ITWA 3GFBA 1VM6A 5ES3A 4E4YA 1L7EA 1N9GB 3A06A 4J4BA 5A5FA 1HDGO 3OF2A 3PJDA 3C24A 2B4TO 4NBTA 4BO9A 5L7YA 3MJ4A 1ENPA 3BHJA 1GAEO 3ZW8A 4B7CA 1BWSA 2E49A 3AUUA 3T4EA 3OECA 1KBZA 1U3VA 4XYLA 5I9LA 3H2ZA 3GR6A 3F5SA 1YBAA 3KRTA 4ALMA 2EEZA 1VSUA 2PGLA 3EHEA 3E5MA 3VDQA 2X1HA 1SZJG 1R4MB 1PR3A 2A4KA 1Z73A 2GASA 2H5LA 2FMUA 3GY0A 4GGPA 1NQTA 3KYDB 3WGQA 4NBRA 3P2OA 4I5GA 1MUUA 2UDPA 3UKOA 2AXQA 3OQ1A 1BRMA 2FPPA 1HE5A 1X1TA 3AM4A 4CV1A 4P4GA 1GEGA 4OGWA 1XGKA 2AG8A 2NTJA 4DMMA 4L4SA 3DBLB 5COAA 4D79A 3EVTA 4JBGA 3LVFO 1BDMA 1ISFA 1G6KA 1RM0A 3ULKA 2ZTMA 3E82A 1Z7BA 2D0IA 3F3SA 4GVXA 5DCUA 3WGHA 1C0KA 2Y66A 2DTXA 4HP8A 1YOVB 4R1UA 1EZ4A 4ZQGA 3AFNA 4EUFA 4F6LA 3KXDA 1XSEA 4XDYA 5JPIA 3TFOA 3D5TA 3VVCA 1CQIA 3F6YA 4TQGA 3PGJA 5JE8A 2NACA 1A27A 3JYQA 3O03A 4NMHA 1U9JA 1JAYA 2QW8A 3X2FA 4CUZA 5IDQA 1A9ZA 1H5QA 2DQ4A 3RC9A 1ZXBA 3H9QA 3HFSA 5DBIA 1HE2A 5TS3A 5DF1A 3UVEA 1GYPA 5KNLA 1KIFA 3PQEA 3IUSA 1Y81A 4D45A 5IJZA 5JY1A 2JD0A 5G0SA 4CM1A 5JYAA 3WX0A 1DIBA 4MVJF 1MGOA 3PGXA 2VUSA 4L0QA 1U2GA 3Q9NA 4H16A 3PPIA 5TIIA 1U4OA 4J0EA 4BNHA 3FBTA 2B0JA 3JYNA 4FCCA 3FNEA 4FFPA 5KJ1A 3GVCA 4K26A 3ZNPA 2AW5A 2F00A 4GKBA 4IXWA 3I83A 2FRDA 2I99A 4IUYA 5L40A 1HE3A 1ZCJA 4JX8A 4PRKA 2W4QA 4R3NA 4XKJA 3WGIA 3M1LA 3F5QA 3H3JA 3W6ZA 2C2XA 4A73A 2O7QA 5TX7A 2BFAA 3ASUA 2PNFA 4MOWA 2GZ3A 2Y0CA 3PHGA 4PIVA 4ILKA 1HKUA 3WWYA 3JQCA 1UDCA 4P4LA 4DA9A 3IS3A 2YW9A 1ZJZA 1WMAA 2JL1A 2EP5A 1C1XB 1PJ3A 4NFHA 3GHHA 2GD1O 2O4UX 1DC6A 1DLIA 5A1TA 2FPGA 4PGFA 1ARZA 2PKQO 1R66A 1AUPA 1DFGA 4B3IA 3FR7A 3GDGA 3I6IA 1AGNA 1QLJA 3BAZA 2EF1A 3GVHA 3WGGA 4UUMA 3KSUA 4DLAA 1Y8RA 1ML3A 3JQ7B 2HRZA 2PZKA 7MDHA 4NU6A 3DOCA 4FFOA 1FJHA 1IHXA 2HDHA 1FDUA 2JCXA 3AM5A 5JAMA 3Q3CA 3BMOB 1D4FA 4Z9XA 5T57A 1NFRA 4S3MA 4UUPA 1P1IA 1HDYA 3EVNA 2YFQA 2ZTLA 3T4XA 3DXFA 3ADPA 1LX6A 2FR1A 1U7HA 3I9JA 1GL3A 1RJWA 4ZRNA 1UXHA 3F9IA 3E9QA 1LTHR 1LDEA 2XPCA 3GGOA 1EQUA 1OFGA 3DZJA 1BXKA 4OL9A 3CKYA 3KOUA 2PGJA 2EV9A 1Q0HA 2C07A 3BHIA 4JJGA 3RUDA 3VZSA 4CL3A 1IZ0A 4U6SA 3NYWA 4CM4B 4PLGA 3I9KA 3SJ7A 3CXRA 2F1KA 4E5NA 1Q7CA 1E92A 3ZWPA 1YJ8A 4BB5A 4RVDA 4KWHA 2Q2QA 1N9GA 2VQ3A 4JJFA 4Q9NA 1DXYA 3ZHBA 5AOVA 2WEKA 1UXGA 4OXKA 2FP4A 2Z1MA 4MIYA 1FDWA 2QIOA 1HDXA 2AQKA 3OSUA 4HKTA 3A1NA 1YH3A 5JW6A 1HDRA 4XQCA 2YY7A 1H0KA 4J90A 2VWQA 2VWHA 2VYVD 1PGNA 2GZ2A 2VHXA 5A9SA 5C37A 9LDBA 4G2NA 3SXPA 4OKNA 4XRRA 3TN7A 2ZB7A 1ISGA 1ISHA 5L7WA 3OFSA 4CM5A 5L9AA 3HN7A 3KYDA 3FWZA 4BL5A 1V3VA 4LSMA 3ZWCA 4DPLA 2DU8A 5T73A 5KTKA 1L1FA 3JQEA 2FWMX 3D64A 1T25A 4R41A 5EIOA 2O3UA 3S2FA 3K92A 1QYCA 4UEKA 1JVBA 3RU7A 5CFZA 4JBHA 1MP0A 1JWBB 4GWKA 2BFMA 4NFSA 3EAGA 1GQ2A 2QRKA 3ENKA 4EUHA 3FD8A 3S2IA 1YOVA 3GPDG 3WLEA 1CJCA 4RF3A 4RF5A 1PZHA 3WFIA 1GCOA 1B3RA 5DCYA 3I9NA 3STHA 1X14A 2IZZA 4DIOA 4KUEA 2X86A 4XX0A 4D3SA 1B16A 3PJGA 5DNAA 1X13A 2NVUA 1GEEA 1NP3A 5DBFA 4R16A 1R16A 1BW9B 3CMCO 1VL8A 1WMBA 3EYWA 2QG4A 2ZQYA 1OBFO 1DBVO 4JN6B 2C2YA 2W2LA 1Q2XA 1LDMA 4O63O 1QG6A 5TJHA 1VPDA 4XQGA 2B36A 5JSFA 4CMKA 4I9HA 5A02A 2E48A 2HCTA 2Y1FA 4PZDA 1WVGA 3GNQA 4M8SA 2WD7A 2GCGA 4OQYA 4BGUA 1I2BA 1IB6A 1DSSG 2PZLA 4GMGA 2I9PA 3OJFA 2I6TA 2VRCA 3H6KA 1NAIA 1HF3A 1U2DA 3QHAA 2HK7A 4CLDA 2Z5LA 4GAEA 4N7RA 4RVUA 2H9IA 4LMPA 4Q39A 3M1AA 1A71A 1XDWA 1WDMA 4YAGA 1GR0A 5JYDA 3PJFA 4N18A 5ITVA 1I01A 2CF6A 1PGPA 4OYRA 4J9VA 3VH2A 3RKRA 5CP8A 4BS9A 1H9AA 2EKPA 4RQTA 1MC4A 3VHRA 1SNYA 1RM5A 2BD0A 4G81A 4YR9A 4FIZA 3EUWA 4MP6A 1E5LA 5TQVA 4MP8A 4AJ4A 3KB6A 3DZGA 4BO5A 4WUVA 3B20A 5G4KB 3FRJA 3IIEA 3RUFA 3AY7A 1NQOA 1NHGA 4NHEA 5JYEA 3JQ7A 2VTDA 4YRDA 2IZ1A 1I3KA 1XQ6A 1E7QA 1M66A 3B6ZA 5CDGA 3AY3A 4FJ2A 3S8MA 3MEQA 1TT7A 1O5IA 3C1OA 3P7MA 4NFYA 4IZHA 3BMOA 5JC1A 1B7GO 3INRA 5F1OA 4EDFA 2X0RA 1YDWA 1XR3A 4GMFA 3IJRA 1T2FA 1Z74A 1LSOA 3W4KA 1C0IA 5HTOA 5JAQA 1YBVA 2X23A 3X2EA 1BXZA 3OH8A 1NVTA 4A0SA 1EUZA 3K2EA 1LNQA 4J16A 1IYZA 2LDBA 2YQ4A 4ZGWA 1GDHA 2YFHA 1RWBA 4IS2A 3U0BA 1E5QA 3RVDA 2HK8A 4E5MA 3WOHA 3QJ5A 1KVQA 3PQFA 3RCBA 3LT1A 3A28A 4NIMA 4PLYA 4CM4A 1H6AA 2P68A 3H8VA 4XA8A 3K96A 5F3RA 4I5EA 1E7YA 3RBXA 1M67A 3VOSA 2E82A 5CPFA 1W73A 4J2OA 5CDYA 1XWFA 4FJ0A 4C7KA 2NLOA 4R54A 1ADBA 1SPXA 3DB2A 2JCYA 1CWUA 3LZ6A 1EK5A 3QLJA 4BNTA 4L4XA 1BVRA 1O9BA 2DVMA 5BSEA 3JQ8B 1YONA 2O3RA 3I4CA 4DIBA 2CVQA 4RL6A 3WWZA 2J6IA 3JQAA 3GZNB 2CY0A 2GF2A 4LW8A 3L6EA 2OORA 8ADHA 3RUIA 2PY6A 3V2UA 3WQQA 2VHYA 3W6UA 4N5LA 4ID9A 1KVTA 4JCOA 4YTEA 1P1RA 5JDCC 1NQAO 4OQZA 3QVSA 1SO8A 2HMVA 2X9NA 3UCFA 3W4JA 1XCBA 2JJYA 1YL7A 3RUAA 2Y0EA 3VKUA 4N5MA 3ZN2A 1Z82A 3MCVA 5L95A 3V2GA 4DYVA 3R3SA 1HYEA 4HFRA 1G0OA 3HDHA 3MOIA 2OZPA 4CQLB 1I30A 3BHMA 2JKVA 2QX7A 3DAPA 2GSDA 3WYEA 3ZU2A 4UVEA 1TLTA 4ALLA 3ZHXA 5HWSA 1KC1A 1T24A 5DZSA 3DQPA 2B4QA 3ORFA 2PTGA 4LVCA 3BYZA 5IG2A 5C7IO 2V7PA 3IP1A 1QORA 1YKFA 3JQBC 4B79A 3SVTA 3ZWWA 4CM8B 1JKIA 4J6FA 5AXAA 1E3WB 3B70A 2EHDA 3I9MA 4QEDA 3PYLA 5EL0A 3WGZA 4XGIA 4JGBA 4XDZA 5JMWA 1ZNQO 1GYRA 1GADO 4ZHSA 1YBMA 3SBOA 3ZWBA 3O9ZA 4DLBA 3GG9A 3VZQA 1DO8A 3KSZO 2GO1A 2Q2WA 4CV0A 2NADA 3DHNA 3PLNA 1BW9A 3DZKA 2E4AA 3FN4A 3K31A 3L6DA 4E31A 2GDZA 2X0IA 3AJRA 4O1MA 2X58A 2NWQA 4URFA 4UVHA 3NX4A 2D2IA 1DRWA 4PG6A 1PQWA 1V3TA 1X0VA 2AE1A 2LDXA 3WTBA 1R0SA 4DVJA 1K0UA 4TZKA 5G0WA 4XEHA 3GC6A 1PJTA 3RROA 2BFPA 2YZ7A 4MVJP 3FI9A 2PR2A 2RHRA 4E32A 2NU6A 3LLSA 3UGKA 1EVZA 2FR0A 4BNUA 2E37A 2AQIA 4FOOA 4RF2A 5JDCA 4QQRA 3TRIA 4IIVA 1ZSNA 4D42A 1DAPA 4PLTA 3I5MA 3ZU3A 1B0AA 1Y1PA 3H9UA 2A94A 4ZQFA 4A10A 1ADFA 3PLRA 4XYEA 5H83A 3HHPA 3ANNA 1QKIA 3I1JA 4Q3DA 1HTBA 3E03A 3O4RA 4J43A 4B8ZA 3Q1LA 1I33A 1I3MA 1WAMA 2VHZA 2P5UA 4R01A 5JCXA 4RPGA 3AU8A 3JQBA 4LCJA 4BB6A 4BNWA 1V9LA 3U3XA 3O8QA 4GSLA 1UP6A 3S2EA 1Y9EA 4INAA 2EKLA 3OJOA 5IAAA 3PZRA 1I5RA 1FDVA 1OAAA 4ZU3A 4YBZA 3BTVA 3VPSA 4RVHA 5TC4A 4IM7A 1WWKA 4ZQBA 3GFGA 3AUSA 5THQA 4KP7A 4TZTA 4YQZA 4RVGA 1UZMA 1M2WA 2PKRA 4M49A 4IXTA 1DDOA 5L4SA 1B14A 4MPDA 1GTMA 2VCYA 4DQXA 3TZHA 1XELA 1YO6A 4RO0A 4WKGA 3ZU4A 5MGBA 3ETGA 2QYSA 2DBVO 4XZ3A 1ULSA 3VAZA 4WOJA 1HRDA 2QQ5A 4CR8A 4I1IA 4FFMA 3ZDFA 4CL8A 1DHTA 1LDBA 5J23A 3DZBA 1C3VA 1E7MA 1Q0QA 2X6TA 4R3WA 3LYLA 1QSGA 4KDFA 3JD2A 3WNVA 3DBHA 3DEYX 3U4DA 3GA0A 3GEDA 2HU2A 4PLPA 3TZ6A 1ZH8A 5K0ZA 5JO0A 1YE3A 5L7TA 1O0SA 4MVJD 5EESA 3CH6A 3DMYA 5EN4A 4CLHA 1PL7A 3SLGA 4CQMD 4GH5A 3KLPX 2BI8A 4D3DA 1CDOA 3EY4A 2OXIA 1QR6A 1EUCA 3JQ8A 1Q0LA 3H5RA 5BT9A 2VYNA 5ADHA 3ICCA 3AK4A 3GZNA 3TJRA 3UCXA 4TRRA 3ITKA 3QQPA 4H15A 3TOXA 3PHHA 1P1FA 4R9RA 1HL3A 1Y8RB 4I8XA 4K1LA 4DGSA 4CMIA 1B8UA 4I5FA 2J5KA 3QWAA 1TEHA 4ZD6A 4PG4A 3F1LA 1KEVA 3RQSA 3U9LA 1C0PA 2VWGA 4BKOA 2ZIZA 1MA0A 1ZK1A 2YDXA 4EBFA 4UVGA 1IY8A 4ZRMA 1GFSA 1ZUD1 3R6DA 3UN1A 2POQX 1L7DA 3FR8A 1H94A 5EPOA 3IP3A 1K6JA 4BO2A 2FSSA 5EQDA 3PHJA 4GX0A 5KJFA 4TVBA 2HUNA 2AEFA 3KEQA 4Y8VA 3ZHZA 1O95A 3CPSA 5HRUA 1YXMA 4YYZA 3RUEA 1XIVA 4J9UE 3G1TA 2I3AA 1LRLA 1A7AA 3INTA 2VUTA 2FY8A 3LF1A 3VH4A 4DUPA 4TRMA 1Q1NA 2OFPA 4CM8A 1B8VA 3E18A 4Z9YA 4CMEC 5I8WA 3ZU5A 4NJMB 2GN6A 4K6CA 4P8RA 1EVYA 2EP7A 1K6IA 4GLOA 3ZW9A 3LLVA 1V8BA 5A4DA 1ADCA 1ZVMA 5JAIA 4B7UA 2HAEA 4MKXA 4D44A 1M75A 2VOEA 3RAJA 4XB1A 2AHRA 2X22A 4YT4A 4BO1A 3WBBA 1O8CA 3PWZA 2DBQA 4RPHA 1KEWA 2EERA 4PVDA 3MOGA 4YT5A 5A9SB 4XYMA 3D4PA 2CVOA 2Q50A 2WMDA 3LDHA 1T26A 2Q1WA 1ULUA 1CF2O 1R37A 1U3WA 1UAGA 2YV2A 1PJSA 1AHHA 3I52A 3F4LA 4K9DA 1EMDA 2DT5A 2GNAA 3VH1A 1Q7BA 4PZCA 4NH4A 2QRLA 1F8FA 4CV3A 5DT9A 4U8GA 2DC1A 4DRYA 1C1DA 3P5SA 4X54A 1Z6ZA 2JHGA 1SOVA 5ER9A 2CVZA 4BMNA 1DRUA 5KCZA 3VPGA 5B37A 2I67A 1QV7A 3VKVA 1ZXLA 1FMCA 3FCOA 1UZNA 3IAHA 4DLLA 1NPTO 1LLUA 3PIDA 1LA2A 1F8GA 5AXBA 1HETA 2OOSA 1GZ3A 3W4IA 1ISJA 3D3EA 3GMDA 4J1QA 1V0JA 4CMEA 4OSPA 4MVJH 3RI3A 3DFUA 2NVUB 3M2PA 4WPGA 4IDFA 3EGOA 1U1IA 1D1SA 3I23A 2QHXA 4BKPA 3PYXA 2B5VA 1PJLA 2ZQZA 5AYVA 3WQSB 1U7TA 1UXJA 5JAZA 3G0OA 3JCZA 3LT4A 4CR6A 1R6DA 3L0DA 2HJRA 3PP8A 3L4BC 4QFCA 3RD5A 1P1JA 1WPQA 2AEMA 4N54A 3R1IA 3KVOA 1F06A 2PD6A 3ITDA 4WLFA 5I8ZA 1AN9A 2HMUA 5DP1A 2WD7B 2B83A 3I3OA 3MJSA 1CRWG 3VC7A 4MKZA 1YB5A 1D1TA 3QP9A 4P4NA 4AJLA 1EEHA 2G76A 3L77A 3U49A 4NPCA 1EUDA 1QYVA 2VRBA 2NTNA 5G0TA 3UICA 4BO3A 1AXEA 1XEAA 4Y67A 4CUKA 4AICA 2ILTA 3E48A 4GI2A 1F14A 3K2BA 3RC2A 4XD2A 4CM9D 4Q3NA 3BZUA 5CG1A 3BTUA 4HFJA 1DB3A 5COBA 3C3XA 4MIEA 2UUPA 2YQ5A 2ZYAA 4J0FA 1P45A 1O94A 1KOLA 4BOYA 4MINA 3QWFA 4RCVA 1HDCA 4KQXA 2BGKA 5KKAA 1ONPA 4IIUA 3GDOA 1H6BA 1PJ4A 1YDEA 2A92A 3DOOA 2Y68A 2DLDA 2IEBA 4IS3A 3L07A 4KOAA 4FD3A 1WP4A 1KETA 5IXYA 2YYYA 2VNSA 3F47A 5EJ2A 1LU9A 1X15A 2J3KA 4R5HA 3WYBA 2W2KA 3JTMA 4GPD1 1VL0A 4AJOA 3ADOA 1GD1O 4J2HA 5KJEA 3IJPA 1O6ZA 4YAEA 3GGPA 2Q4BA 4Q3AA 4BMVA 4I9UA 4JIGA 5ENVA 4NU5A 3L4BA 3VZPA 2ZYGA 1PQUA 5DN9A 2WWRA 2BMAA 1V3UA 3JYPA 4M1QA 4XGKA 2X0JA 4O0LA 2Y0DA 4KUHA 1W6UA 1PS8A 3JQFC 1I24A 5CDTA 4JJIA 1ISMA 4II3A 1T4DA 4E5YA 3LT0A 3UHAA 1QLHA 1ZEMA 1LLQA 1J4AA 4B3HA 3Q0EA 2B5WA 4NJMA 2ZB3A 2EIHA 3AM3A 1LLDA 3HB4X 3NRCA 1RKXA 1UR5A 2BF7A 2PKQP 3DMTC 4GGOA 1N1EA 1UH5A 2EJVA 3D4OA 3PTZA 4BNVA 1PZGA 4RGBA 2BRUA 3GZ4A 4AJIA 1A72A 3OJLA 3QV1A 4YDRA 2RAFA 1M76A 1BSVA 1PR9A 3QA9A 3CTMA 3SC4A 6LDHA 3JQAB 5A3JA 5K6AC 3HNPA 1JLLA 2DFVA 2NUAA 2O4CA 2I5PO 3GG2A 2GLXA 5IDWA 3PFWO 3C1AA 2Y1EA 2OL4A 3EMKA 4WOKA 1BG6A 3AUTA 4LMRA 3ZV4A 4KZPA 4ESOA 1SEVA 5ENDA 2BGMA 3RWBA 2Q46A 4AJJA 5HM8A 4DC0A 4KTVE 3PDUA 1DFIA 4XQ9A 3KBOA 3JQ6A 3WYCA 2J3JA 4ZJUA 3FTNA 1YGYA 3FNGA 2YV1A 3NV9A 3DZFA 4IBOA 4B4WA 1P44A 3CZMA 3RASA 3D5QA 4RV9A 4CM7A 5DCWA 3GN2A 4DBZA 1LSSA 3WG9A 1NVMB 5C3MA 1FDTA 1D3AA 1YL5A 1DIHA 3GF4A 3TQHA 5IDYA 4OOFA 3TWOA 4GWGA 3PIIA 2XXJA 3RUHA 4Z3DA 3KZVA 2D5CA 3ZNOA 3WBFA 2VN8A 1OC4A 5BNFA 1SAYA 3LQFA 2FHSA 2PH3A 3GVXA 5AVOA 3JQFA 4CLEA 2UVDA 5L4NA 2VZ9A 4W7IA 3OA2A 4R5MA 2OGUA 4TVOA 2RH4A 4RPJA 1RM3A 3Q6IA 4DPKA 3NJ8A 6ADHA 2ET6A 2Q99A 2WD8A 4DQVA 3WJAA 3QE3A 4XQEA 3PRJA 4BO7A 2C5EA 2EXXA 1P0FA 5COQA 4E13A 1NM5A 1NQ5A 1YB4A 3OETA 4QECA 3D1LA 5KWEA 1QP8A 5K6AA 5B1YA 4AJKA 5FWNA 1XYGA 2PZJA 2J3IA 4R1NA 3CINA 2RH8A 3GNSA 3Q2IA 3KTDA 4XRGA 1PGJA 3ABIA 2ZATA 3G1UA 2VHVA 4LCEA 4ALKA 3KHUA 4H3VA 4YXFA 4BNXA 4OIMA 3VTFA 3G3EA 3N74A 1YB1A 2Z1NA 3GVIA 2CSUA 5IZCC 1Y5RA 2IRWA 4CPDA 1EVIA 1GV0A 2XAAA 3HB5X 4MVJI 1KVUA 4D0SA 4IZIA 3GUCA 5T67A 3K8ZA 2Y1OA 2P5YA 2FOIA 1P33A 4G65A 4LK3A 3O8QB 1YQXA 1ZW1A 1PTJA 5CDUA 4BNNA 3QVOA 1H6DA 1R0KA 3LF2A 2IYOA 1RM4A 2JAPA 1DRVA 3HZZA 3O38A 4TRJA 3DR3A 4WLVA 3WQRA 2YV3A 4R4JA 3C7AA 3QIVA 4ND1A 1CETA 3C7CB 2DUWA 3DL2A 3GVPA 3MJCA 4RDHA 1WZEA 4IGFA 5JY6A 4HNHA 4FFRA 1YJQA 3PQDA 5TRTA 5JYFA 1LDGA 3TZCA 2R00C 4WLOA 3DZHA 5TSDA 4Y6SA 2DUUA 1HSZA 2AE2A 5CHEA 5FI3A 4XIJA 1R0LA 2AA3A 3QWHA 4UREA 1XU7A 2PK3A 2IDZA 1Z75A 4IJWA 4AJEA 3MZ0A 2OP0A 2O7SA 1EVJA 5JCJA 3DBHB 2JAHA 4FS3A 3I4FA 1NX6A 4KUGA 1EDZA 1KS9A 3BMCB 3H5AA 2I3GA 3GMSA 3NKLA 4IINA 5A9TA 3GEGA 2Z95A 3K30A 2JCVA 2GR9A 3GK3A 3I6QA 3D3WA 4DXHA 3JQ9C 3U4HA 3VPFA 3C1TA 2BH9A 4RZHA 1R4NA 1ZK0A 4DWVA 3KLMX 4JLWA 5GMOA 3ZNQA 4BNLA 3BMNA 3C8MA 2UYYA 4W82A 2WJPA 1E3EA 1PL6A 5I9MA 4CM6A 5CEEA 2O2YA 3ANMA 3UW3A 1PJQA 4ZA2A 2FZEA 4YRBA 2VHWA 4M86A 5F1PA 3GOHA 4U0JA 4CMIB 1J6UA 2CDBA 1I3NA 3MJVA 1HEUA 3WS7A 1N1GA 5L53A 1CERA 1GQYA 5K9ZA 4PG7A 2WYWA 1HDOA 3EZYA 2CD9A 4IDEA 3H65A 5DULA 5T5QA 2IYPA 1YQGA 4CMHA 1X1EA 3E8XA 4PG5A 2WDZA 4MVJG 3ZH2A 2UV8A 4RPLA 4CUJA 3GT0A 5HBRA 3GQVA 1RYDA 5DP2A 4QTZA 4YAJA 4BVAA 5MDHA 2RIRA 2A9FA 2OBYA 2C20A 2XOXA 3CE6A 3IOYA 1N5DA 3WICA 1A4IA 2VT2A 4Q3EA 2R00A 5FFFA 4J49A 3T7EA 4YAKA 3ZZNA 4BIIA 3DAGA 4FC6A 2PH5A 4ROSA 4E0BA 3VPXA 1PZEA 4E3ZA 1PEDA 1P1KA 1NPDA 3B1FA 5BSGA 3IMFA 4QXMA 2NVBA 2NNLD 1KY5A 4D43A 2CMDA 3K73O 3ETDA 3GGGA 2VZ8A 4PLCA 5AXCA 5KVQA 4ZQEA 2RHCA 3ZWOA 1EE9A 1GCUA 3NT2A 2JD1A 3ZNNA 3E6AA 2NU7A 2WYVA 3ONFA 2B4RO 3K9QO 1E77A 4IMPA 4YJDA 1Z7EA 3HDYA 4MDHA 3KYBA 4M89A 4W99A 1JW9B 3N58A 4DQUA 3JQ9A 1I0ZA 2ZB4A 2UAGA 1JU9A 4A03A 3HUDA 4L8VA 2YJZA 1NTOA 1P77A 3CIFA 3K5PA 4B4OA 5ER6A 3OHSX 1LXCA 4R51A 1KVSA 4P38A 3FSRA 3L9XA 3D7LA 1AXGA 5LDGA 1R15A 3U5TA 5BNTA 4J1NA 4EJ6A 3FPLA 3COSA 5JXWA 3NGXA 1HSOA 1MX3A 3VZRA 1MFPA 3P2YA 1UAYA 3RC1A 4IDCA 3JQGA 2GRAA 1HT0A 2OBNA 3W8EA 4PZEA 3MJTA 1DPGA 1Y9AA 1C1DB 2YHIA 3GUYA 3D0OA 3ZWAA 1H2BA 1JWAB 1P0CA 4CLXA 1ENOA 2PD4A 3S55A 2PZMA 5G0VA 4WLNA 4IMRA 5T6BA 4BMSA 1NFQA 4NG5A 4XJTA 2VTEA 2Q1TA 4LN1A 1NVGA 2IEDA 4AJNA 3NDRA 3A9WA
chains in the Genus database with same CATH superfamily
4N3GA 2O2XA 2YZGA 4C01A 2C7QA 1JFFB 1JRLA 1Y8QB 2G17A 3EWIA 3OKCA 4A5SA 1RZ3A 4G07A 4E2WA 4BWVA 5SY9A 3FGPA 3DDSA 4ENTA 1JKXA 3A4LA 4CKEA 4RQUA 3MTJA 1V25A 4WNAA 5F2NA 3SJUA 3GIDA 2RGUA 5A03A 4ZDKA 1QKJA 3TW3A 4DWOA 4OK6A 1CR2A 1DBQA 3BD9A 4BRSA 5K7SA 2XWJI 1Z7WA 3R44A 3RYIA 3SC6A 5C1PA 3U3OA 4NC9A 1WQ3A 4US1R 2C0PA 2W7TA 1WMSA 2C61A 3VR2A 2GN8A 2WOJA 4KXWA 1ZK3A 3BCHA 4OO3A 2HTEA 5BYBA 2WNIA 3RS9A 2DAPA 3SP1A 3H19A 4KPYA 2ZJ1A 1U0EA 4PQGA 2PMEA 1MG0A 1NRJB 1A1SA 1P2FA 2WUFA 4J7XA 2OGSA 4JJ7A 5J40A 1KR5A 4JQSA 1MJFA 1O6GA 1U0OC 1M6EX 1MPTA 2AJ8A 4KH0A 5TEWA 4DLYA 1IUKA 1D6MA 2H54A 2CNWD 2VA8A 3DTYA 2AG5A 4RACA 4Q9HA 5KQRA 4A2CA 3AUJB 1Y7PA 2CN1A 1X87A 3CSDA 3QYPA 4CMJA 4ZOQI 3D2LA 1VLQA 1WB5A 2J5RA 4COOA 5DEOA 2WF9A 4GYJA 3DLHA 5C35A 3WGLA 1Y4UA 4P4SB 3JVEA 1TB4A 1KK0A 1PG5A 2W2NA 3F8TA 3BGOS 3AW9A 2ATXA 4KIJA 1SB8A 3IUQA 1CUZA 4L3OA 2CW5A 2RH9B 3FPHA 4R1TA 4W6ZA 4YREA 1KY4A 3M4XA 5K03A 2QSZA 3HV2A 3I4LA 1F4VA 3EDMA 4GIBA 4NXMB 4BHTA 1Y8AA 1F0PA 4C6SA 4XH9B 1Z0UA 3SHWA 1CUJA 1YVRA 1BH2A 1OXSC 3AWDA 3KKNA 4N0EA 2FZ4A 1XZEA 3RRBA 4LWOA 3LCCA 3VPCA 3KC2A 4PIMA 1CULC 1ORHA 2DLNA 1JG3A 3PU6A 4KSCA 4TPKA 3TNFA 3GGJA 2DT8A 1SY7A 4EGSA 1ZOPA 1WBJB 4KX5A 1RXSA 5TVGA 3DONA 2B1GA 2CYAA 3LMKA 4YCNA 3DVLA 4TWBA 1I7SB 1BXGB 1B6SA 1IZ8A 4MRAA 2FEWB 2WFMA 2WVHA 1WXFA 1AKVA 4NV3A 4Y0NA 1AZTA 2FRVA 4L73A 3ZLBA 1TTTA 4GPAA 2MDTA 1FC0A 4JYCA 2CUKA 3PQVA 1TDJA 4WFIA 3WKCA 1G3QA 2W5UA 3JY6A 4L5IA 3SYMA 2AR0A 5EWMB 1EHCA 1YZYA 4F96A 1NGSA 3AEXA 4L5YA 5C3UA 2O3TA 4EG8A 3DTTA 2FK8A 1SURA 3NHFA 1JJBA 1G4UR 3ZEAA 2HBQA 3U0VA 4DA4A 4DV4B 1ZR4A 2ZIUB 4FFNA 4KODA 1NG1A 1DFHA 2FP3A 1AT1A 2EATA 1TUGA 3LO8A 1H93A 3KUXA 4P84A 4WSOA 3NBUA 5DGTA 5H3CA 1OXTA 2UYQA 3KKQA 4ASUA 4Z1MA 3EZ6A 2PZEA 3C3JA 3ZJTA 4WRRA 3MAGA 3KR9A 1YB7A 1XROA 2ZI3A 4BBPA 4NBNA 4YP7A 4O6VA 3NGMA 4GEKA 4AULA 1P5ZB 4BFCA 1E4YA 2W22A 2B35A 2AK2A 1ONOA 5ILGA 5DTJA 1E9VA 4JYZA 1BVUA 1DOHA 2XE6A 2ATVA 3FGNA 3OM9A 3P0EA 4GRAA 3J81A 2GN4A 4YR7A 1H3FA 3U4GA 3U4CA 2Q9UA 4RTQA 1N8TA 1BEEA 3DAFA 5TXGA 3JR7A 4JVMA 5DOZA 4A2PA 4QAQA 5LM3A 3QKUA 1CQZA 4ZDWA 3ZK7A 5LDHA 2XMQA 1NW6A 2IHUA 2O8FB 2EZTA 3JS5A 4FGSA 3AHHA 3TLYA 2XF8A 1W59A 1Z0KA 2FPIA 2JEYA 4M60A 5SZJA 2VYQA 4MR8A 1CX9B 2AOWA 3OIFA 2WJ4A 3NJ4A 4HAYA 3G9ZA 2GF9A 2XXBA 3EDQA 2ZAGA 3FNBA 4I9NA 5E6SB 1GL9B 2J9GA 3BL6A 4G25A 4IIHA 4NZZA 2VAMA 2DUJA 1GG2A 4XCVA 3F71A 4ZQHA 4KQ2A 4YJHB 4BNFA 1AQIA 1UDXA 2DSNA 1JBEA 2DWQA 4JL6A 5I4IA 4ZO9A 4LDZA 5SYAA 3HY3A 5ABPA 2VSQA 5LZ8A 1USGA 2EU8A 1QYXA 2XMZA 3F5DA 4YHBA 3VYWA 1GO2A 2DLCX 3ZG6A 2LPMA 4PLVA 4TUYB 4V24A 5LL6P 4C2TA 4NE2A 4IYRA 2GD2A 3LC2O 4LGVA 2Z58A 3BMQB 3EA4A 2CVPA 2MTBA 2IXBA 1X7ZA 1ONSA 1OKKA 2A9JA 2RCYA 3OOYA 1NRWA 3QMPA 3JAMA 4FKMA 1X3SA 4NNJA 1A7KA 4O59O 1Q15A 1MO4A 1PZNA 2FEXA 2QV0A 1WPGA 1TFUA 3L06A 1GTZA 5EJIA 4QGSA 3O8CA 2G9UA 2N1MA 4HB2A 4YFYA 1FPQA 1EJ6A 1WV1A 3DEJA 5T4FA 4EUSA 6Q21A 3JD4A 2YWCA 4DREA 3OAAD 4OAOA 2IXDA 3VPHA 4C5AA 1NVFA 1KOGA 5T8KA 3AL2A 4HXFB 1T35A 2WA1A 2P2GA 2P8SA 4BPRA 4REMA 4OVKA 3GAZA 4NBUA 2OLEA 4N7BA 5LSAA 2HR1A 1QVRA 2LCFA 1NVUQ 1E2PA 1Q0UA 5B1SA 3KM0A 1V5FA 4RIIA 1S3GA 1AKQA 2OO5A 2HREA 1BKSB 4PSVA 3IE1A 3TL2A 4ZV4A 1JFFA 4DCMA 1Y8QA 2VSOA 3T5GA 1A2BA 5FPKA 4RK4A 4NQRA 3WNQA 1H9BA 2GF0A 4YALA 1M7BA 1W49A 3DZ2B 1FMFA 3CLRD 4URUR 5CM9C 2C7VA 4C2AA 1E2EA 2GXSA 1Z63A 1JX6A 4LZPA 1DTEA 1IPHA 1MN6A 1RAAA 2O3JA 1EBUA 2Y77A 3LX8A 1LBIA 2I2XB 3NM5A 4Y9DA 3WFJA 1M2FA 1RSZA 2POCA 3E3NA 4NOMA 3SPXA 4XB2A 4KVFA 4WOCA 4Z4QA 5THKA 2WJAA 4EEKA 1I94B 2BFOA 4R7TA 4FW9A 3UAVA 2V9ZA 4M46A 2X76A 4X84A 3UPTA 4L5JA 2C0QA 1XNRB 4KN9S 4TMVA 3EGWA 4DFDA 2A8YA 4G5XA 4RF4A 4RX1A 4DMLA 4A1FA 2R6R1 1HOXA 1W96A 3E8MA 5KNBD 3AO0B 3EEOA 1APBA 4DYDA 4I4NA 1AUXA 4WZBB 1OI7A 1KAOA 2QVLA 5TT1A 4PLFA 1G5TA 4IJVA 5BSKA 1N7GA 4KWIA 3RPEA 2OV1A 1WY7A 5BP7A 4EO9A 1G7RA 4R9SA 3AU9A 3B9BA 1GXSB 4G6ZA 4JLVA 4BVLA 3V8QA 4ZMSA 3FWHA 4P4SA 1UPXA 1FF9A 1UBLS 2Y2UA 2NSJA 2IXAA 1MC5A 3GZJA 3JSXA 4QTUB 4YRDA 4BDTA 1E3LA 5EHXA 4OXNA 3C3KA 2Q2NA 4UZSA 4BP1A 2G5CA 2ZR0A 4J07A 4C03A 2Q6TA 1F7VA 1G3MA 2NIPA 2VXOA 3L1KA 4N7MA 5EXTA 3WYGA 1S4QA 3WAKA 3FTDA 3LI2A 1M73E 4J7UA 1U0NA 4KBYA 3W5UA 1JZSA 3OQOA 3VH3A 2F2TA 1QX3A 1N77A 4ARUA 4JB3A 2ZUSA 4ETWA 3QVMA 4PR3A 3TR5A 5DLYA 2OUIA 2P9QA 3ID6C 2F1HA 4JODA 3RK4A 1PJCA 3FTFA 1QPGA 2FSIA 5M6DA 1EZZA 2PM8A 2AFIE 4PGGA 3CNBA 4W4TA 1BXGA 4CV2A 3U13A 4KDEA 3U62A 1A9SA 4OKSA 3LY7A 2DJIA 1HLDA 4AFNA 4O02B 3IYLW 1G7CA 3M6UA 4QO7A 2PA3A 4B48A 3QEBZ 4MUJA 4AMUA 3LCUA 3O7MA 4GP9A 4UTZA 4K3UA 1NQXA 1X1AA 4B3FX 5LWQA 2VH1A 3PNYA 3ICQB 4ZVMA 3TOVA 2AQ8A 2D06A 2V6MA 4N3AA 1L3BA 4UAUA 3I2KA 3RSLA 4E11A 2CSXA 2C54A 1D4ZA 2DUNA 3SS9X 2F6RA 3OX3A 3VR5H 1QMIA 2N3ZA 4YACA 3QVTA 4BAZA 2IDJA 1KMCA 3HCOA 4CL0A 2FETA 3QPVA 5CB0A 4L6CA 1KFKB 3JD1A 4JC4A 1PU2A 3V46A 3OE7A 3ESDA 4UARA 2OA0A 4W9NA 2IPAB 2VHEA 2YOHA 3AY0A 3MT0A 3UMJA 5LZ2A 4CMAA 3L92A 4NZ9A 3BL5A 3C3WA 1KZ7B 2YS6A 3DV2A 3IQDB 3L7KA 5AXDA 4YIKA 1DWUA 5BN5B 3B1VA 4JJZA 6PFKA 4Q4LA 2ABWA 2GO7A 2EFYA 4WDRA 1LRJA 2EX0A 4RKYA 1E59A 1P31A 2VYND 4WMLA 4WK6A 3B1ZA 1I4WA 3EPBB 1FA9A 1JKJB 2GYUA 3PVSA 2GYYA 2ZBQA 4D57A 2BV3A 1ZP6A 5A04A 1I7QB 3KDSE 4J1TC 2N75A 5IARA 3R5HA 1V1MA 3H17A 2AXNA 2P9ZA 3IDZA 4B0OA 5JG7A 4I3GA 3T9CA 1U0RA 1XTQA 2IXFA 3QX7A 4OH1A 4E88A 1AUQA 3N75A 5EMHA 4F72A 2J0QA 1W47A 4P54A 3BMNB 5JD6A 2H1RA 1XMVA 3NV7A 2OGWA 5ALTA 5AW3A 2L0XA 4GPIB 1YT5A 3FRHA 1PLKA 5E6SA 2CXSA 4RWZA 1G5HA 1L4NA 2VHUA 1HFJA 4YJHA 4Q16A 2NO0A 4KIUA 5EIBD 5J2TB 1MAWA 2CE7A 2BT4A 4MS1B 3V7YA 1T4MA 3TM4A 2FVXA 2J45A 4AYTA 2ZXUA 1U63A 1N3YA 3NP9A 4HWRA 3DCYA 2WM9B 1O95D 3IAEA 2PZGA 4HNAB 4OUDB 3KXKA 1P4SA 4TUYA 2Z4TA 1VHDA 1Y34E 2CJXA 2GVNA 2OK8A 4MKRA 4U7WA 3BMQA 4B34A 1X1RA 2P9HA 4LKOA 5CVTA 1FNCA 5E3HA 5DO9A 3DS8A 4OLAA 2OLKA 4XJSA 1OZGA 1H2AS 1RFGE 2ZIVB 3FWKA 3H97A 2QLTA 4BNYA 3JSAA 1WOMA 2X9QA 3FI0A 3H11B 4MV3A 3TX6A 4C89A 4WLUA 3EF0A 2DWUA 1MOSA 2QRGA 1QTRA 3JD3A 4RHYA 4XWGA 1OH8A 1C7ZA 1R4MA 2CDAA 3UAGA 1QIHA 3LU1A 1N0WA 9ATCA 2BFNA 1JR3E 4GLJA 3TD2A 1YRYE 1URPA 1PWZA 2VJMB 1Y3AA 1QHHB 1W44A 4NONA 1HMPA 3V97A 1UKZA 3CF4A 3RBVA 1SG6A 1UIMA 2V7WA 3BPSA 3FETA 2VRNA 4XSVA 4DIFA 1M0TA 4HF7A 4COKA 1KNXA 1II8B 1N7HA 4IOLA 1JIUA 2ZQ5A 4JC8A 2P91A 3DZIA 4YY3B 2VOJA 1UKYA 1T13A 3P0HA 4WACA 2HSEA 3TRHA 2G9VA 4OAQA 2D2EA 2HWWA 3VSCA 3GFFA 3VR6A 5UKDA 2X9GA 2ZJYA 4NI5A 3RFTA 1FSPA 1UDAA 4J7AA 4AJ2A 3C85A 4G8BA 4NICA 1PBNA 4F3RA 1IPFA 1O08A 2HGZA 2JJ1A 5KYUB 3NT5A 1L5VA 2PBFA 3OA0A 5SZKB 4X3CA 2IE0A 4Y1RB 4X7BA 3R9XB 3RYCB 3DZCA 3CRVA 3MXOA 3ZY6A 3ZDRA 1UWCA 5BXQC 1W35A 4RDCA 1D8AA 3WLRA 4OHMA 5EP3A 4F92B 4J0HA 5IBPA 5LJIA 1CZOA 4NS4A 4BEJA 2CNBA 3CKKA 3M3HA 3R40A 1Q14A 3E7XA 4G1CA 2AMFA 2GI4A 1ZZEA 5JQGB 2X8AA 3C8HA 2XIJA 5M04A 1ZD3A 3N8KA 3F6CA 3PD1A 4HNGA 5EIAA 1DEKA 4ZT4A 2EFEB 2ECFA 4WZBA 3OMWA 4E70A 5SY4A 4Q03A 1NONA 1QIIA 1S3FA 2BBTA 4JK3A 4MA4A 5LA6F 4ZV9A 3IURA 5B7QA 4C0XA 2X2PA 1V6AA 2X41A 4OU4A 3SHTA 4BP9A 3K94A 1EA7A 4OL0A 4P9NA 4WEOA 5JMTA 5BV7A 2OP1A 1QHFA 1WPXA 1RKBA 1VJTA 3I9LA 4NG4A 3KKEA 2Q49A 5LMZA 1DO2A 2BHTA 2R11A 3UFXB 4JQZA 3F2VA 4HLUC 2GM5A 1PFKA 1NKTA 3BJEA 3SN6A 3WL7A 1YHYA 4AQ7A 1AHIA 2IFTA 2HSZA 2PSSA 1YRQA 3FHJA 1ULBA 1G8AA 4LYGA 1VDMA 4IP0A 4PC1A 5EQFA 1SCJA 5KC9A 5LZ9A 3HZHA 5EP4A 2PUWA 3RRNA 4BE4A 4PPFA 2Q3FA 4Y2GA 4TTAA 3K70C 2BONA 1U9ZA 1Z07A 4KR6A 3RJ9A 1UBRS 2V6FA 3FOCA 2PV7A 2C42A 2OO7A 4BGIA 4Y30A 4DCUA 4EYEA 3G02A 1RI5A 3TB6A 1X1SA 2Y93A 1SOWA 2Q8NA 1OOEA 4O2BA 4PRLA 3EY9A 2L19A 3AFMA 5HW0A 5AOCA 4R2JA 2WTBA 4F4FA 1YMUA 1VYVA 4AS3A 3RC7A 1T9KA 4M0LA 3V42A 5C8ZA 1ZFNA 4R71A 1GGMA 1HNXB 1PZFA 3KLNA 1CF4A 2OKCA 5IT9A 4WXPA 5DBGA 1DP4A 4ZVSA 1DKOA 3UJPA 5K3DA 4G23A 5HOEA 3KPYA 2WM3A 1YB6A 3O8RA 1U2SA 3LQRA 2Y1CA 1KYQA 1SC1A 4EKYA 3QLVA 2H6EA 3A4VA 3DEKA 1LJ8A 2DWOA 3Q8XB 4NAVA 4ZK2A 1XV5A 3RFXA 3RRJA 2NVOA 2PUDA 2QNRA 3ZJ4A 2B21A 2NUTB 4WA7A 1K89A 1OF1A 2ZB8A 3JRXA 4PFSA 5ALZA 3IDSA 4M3NA 4MVJA 1AS0A 1IOVA 3TLCA 1VI6A 1E3TA 2BKAA 2ZI5A 1SXJB 4IGEA 3R7WA 1GU1A 5KQPA 1CHNA 1ZIDA 4QIHA 1M6WA 4F71A 1UT5A 1RAEA 2IC5A 4NCIA 4Q9JA 4FSHA 3AG6A 4F9GA 4TZ6A 4EG3A 4MUHA 1FXSA 4RW0A 3V1UA 1H9CA 1HTTA 2QM8A 2Z0MA 3OBBA 3RG8A 5BN5A 4V1CB 1T1GA 4JVLA 4F4CA 3L8CA 5KKCA 1A9TA 3PC8A 3WIEA 4REOA 2GCEA 2VPQA 2JH3A 2ATIA 5JSYA 4CDMA 2B1IA 2J5XA 2PRYA 1T2EA 1JKJA 2V0CA 4JELA 1WXQA 1GPDG 1E7WA 421PA 3OZIA 1NXOA 2GEVA 5F1YA 4DLRA 3HY4A 4DMKA 5IX8A 4HRYA 4DV3B 3K0CC 3TZBA 4EX6A 4X44A 2K2WA 4KEAA 2W43A 3ROQA 1WU7A 3ECAA 4MB2A 5I47A 3F4KA 4UNIA 1NUQA 1OHHD 1IOLA 1M1NB 4CFZA 5CFLA 4RZXA 2PAAA 4FBGA 4XIYA 3OTGA 1OBCA 2C1EA 1PT8A 3Q11A 3A26A 1WP9A 2RGNA 1GPAA 1CEQA 1OYYA 2ZGVA 1FL9A 1VHQA 2W58A 5F1KA 3H2HA 1H4QA 3K0AA 1FJGB 2GESA 4BFYA 5J2TA 1EXNA 1NW5A 3HYCA 1HFEL 4LYAA 4MWSA 3NTRA 4MS1A 1X1QA 2VWPA 4X6UA 5F5LA 4CMCA 2VJKA 1IQRA 5TNXA 3HJTA 4HNAA 1RWNA 4OUDA 2QN1A 3GV0A 3SM3A 4EKDA 1KO1A 5J59A 1NAHA 5BQPA 1K7CA 3ROFA 2B7LA 2ZT5A 4F85A 2KB0A 3QK7A 2B78A 2JGDB 3RH0A 3UA3A 3IOEA 4BNKA 4L76A 1DC5A 5A5DA 1PZMA 4J4TA 3H11A 4KO8A 2P9GA 4M55A 5CHYA 4A91A 3M6FA 3ZCUA 4EUKA 4GI3A 4ENQA 1D5WA 1QONA 4Q93A 5TT0A 5DVZA 1K4YA 3G5UA 4G85A 2JI4A 1MJGA 3HVKA 3ZV6A 4C05A 4CFYA 4S04A 1MXHA 4Y7DA 4EA9A 5IAKA 4ND2A 4QRIA 5K0GA 2A9OA 1SCIA 1TM5E 2P6MA 1ZKMA 4UNQA 2A5YB 2JW5A 2F3UA 1GTRA 2IZ6A 2ZTHA 2CFOA 4GUDA 1VL5A 1II8A 4IW3B 1TA9A 1FUEA 1FJXA 5EAIA 3ICEA 1JG2A 1ULZA 5DK6A 2X3FA 1ULHA 1L4HA 2LCQA 3R0ZA 3BWEA 1L7QA 5GOZA 2XZPA 3RDPA 4F1JA 5K8VA 3GRKA 4DV1B 5CEFA 2WAAA 3IULA 3ZQ4A 4F46A 2I91A 2HADA 3A4NA 4DS3A 4TXNA 5KYUA 5EEHA 3SJBA 3K71B 4B6GA 2F9LA 5EI5A 3R9XA 3BRWA 3RYCA 1FTYA 5L6LB 1ZG3A 1I2ZA 1YVDA 1BX1A 1SU7A 3LT2A 4HUQA 1YZUA 4RE5A 1W34A 3TF5A 1XZDA 1UDRA 1A04A 4DSZA 5GZ6A 2CFCA 2Q28A 3VVLA 1EFLA 1NQUA 3EIOA 1WNTA 2GZ1A 1HI9A 3OEYA 3SCZA 2C5AA 3WWPA 1KO8A 2ZJ0A 3QOWA 4MRMB 1UP4A 5B7GA 3DKRA 3DTVA 3MTGA 1DQYA 4CYMA 5I45A 4ZOEA 2O8FA 1VB3A 5HK8A 4KDCA 5AK5A 5FOXA 3GPIA 5CNIA 4HCJA 4S2UA 1MRSA 2D7JA 2P4EA 2JFNA 3TGLA 2H48A 2WOOA 2UUCB 1DJQA 1S9DA 3DFFA 2NXNA 5C5IA 2JGJA 2Q3EA 4UNNA 1VRWA 3C6KA 1IAVA 6GPBA 1XMQB 2J9FB 1J24A 3JALB 4K6HA 4XM2A 1ODCA 5ERGB 4YPFA 4WT7A 1TRHA 1KMMA 5F77A 3ZYZA 3DP9A 4PLWA 4F11A 1B76A 5DT2A 1J5EB 3UFXA 1U04A 4Z7NB 2QTLA 3KQMA 1PL0A 4EEXA 1ZITA 1CJMA 1MF7A 2Q5LA 4I1VA 1RNLA 2NQ8A 5LC1A 3ST7A 5JDIC 1GPJA 2O14A 1UT6A 1XAIA 2DFDA 5HZKA 1R12A 4I50F 5JWHA 1TK3A 2QZ9A 2DHRA 1I1NA 4WASA 3M4NA 2AFIB 2A5JA 5DOVA 4DM4A 2QLBA 2OV6A 2O2GA 4KRXA 2WR8A 3G8YA 4ZOCA 3SXJA 5LU9A 1MVOA 1EXWA 2M32A 2W2LD 4AYWA 4BGVA 3LBAA 5JC8A 4YMWA 4YRZA 3MM4A 3VAYA 5TV2A 2VUHB 4QDOA 3LY5A 2OHXA 1G16A 1T2DA 4ZEVA 1C0LA 2GBLA 1GPYA 2EBUA 5E4JA 4NX2A 2O0HA 5CURA 1TU4A 5K05A 1OFTA 2WTMA 3CURA 5CW1A 2IYQA 3ZGYA 1T8YA 3D31A 3ZJYA 2BLLA 3W1EA 2I66A 4JGIA 1N78A 3BIFA 1JZTA 1ZJYA 2D4AA 1J9EA 2ECKA 5G4KA 4CM9A 2H65A 1PE0A 2V1XA 1U28C 4UHEA 1IZ9A 1TMYA 3SQMA 2NTYC 3PKZA 2P30A 3H2SA 2WSSD 1JH9A 3W2IA 4HEA1 3BXHA 4EHHA 1Z4NA 1HG0A 1RCFA 1SXJA 2OFWA 5ILOA 2IH4A 5I7FA 4J91A 2J8ZA 4KLAA 4H7JA 3I9OA 4U7JA 5IVKA 4ZVVA 3VDNB 1NF2A 1QG2A 3RVNA 5K8TA 1JFTA 2BM8A 2VP2A 3OOWA 3F4BA 4QARA 4WKBA 1EI9A 1P9WA 1XL0A 1TUEA 2VEOA 4JVSB 3CCBA 2ZYIA 2ECQA 3IVXA 4YDQA 3A1VA 2AX3A 4LQ4A 3ZCXA 1DHRA 4ZCQA 2ZB2A 2DBZA 3MJDA 3ROKA 4EG5A 1EX1A 2BR4A 4IEFB 2H4FA 3CRW1 3IALA 3N0TA 1DKQA 4LV6A 2X5KO 4MPPA 3ESYA 1RYEA 1MD9A 2QD4A 2SHKA 4YDSA 4KO3S 2J46A 1UFQA 3HA7A 1JFRA 3U7RA 1LGYA 2CNLA 2XI4A 1M1NA 4TM8A 3PEFA 2JFQA 3TLKA 1VE6A 3C4QA 3X1MA 4L75A 1OZ0A 3LKVA 3ILYA 2WIGA 2OT3B 2GAAA 3G1WA 3N59A 4S1WA 7ADHA 4WBNB 1IE3A 2O2CA 4FOSA 5CIQA 5AESA 4L08A 4JMPA 1WD5A 1BTOA 1M5UA 2Q45A 4Q9AA 3FPSA 4P31A 1W4ZA 4A3SA 1W93A 4AJ1A 4FN4A 1KAGA 1CJBA 2JRCA 3IV6A 1GU7A 4NJEB 4HC4A 4XYGA 3ONVA 2HRDA 3FZGA 3UOGA 1UOEA 3QX3A 5TR9A 4MVYA 1R6AA 1WQ1R 3T1HB 2XRZA 1FUKA 4X1OA 5TLSA 2NSLA 2RJNA 3A2MA 3I9FA 4HVAA 5L3ZA 4NSNA 1DIAA 4DMRA 1E6LA 3LX6A 3OD5A 5JCJD 3HTXA 2ODPA 3M49A 5JADA 5DTEA 4ZCSA 4U2FA 4M0EA 1JE0A 3W1VA 1RT9A 4O8ZA 2QXTA 5BV0A 1H0HA 3MIIA 4UAGA 4YRKA 5BR1A 4FGLA 4RIFA 5EY5B 4KL8S 3QE4A 4V3CA 4HYQA 2J0SA 1YVEI 4XPZA 3M7IA 3JWGA 3URKA 3OU7A 2C7PA 2O23A 4XW2A 4XPIB 4JXKA 2CLKB 2FFAA 2XUIA 3WB1A 4I55B 4FGWA 4HQRA 3BICA 2C2BA 2INGX 1SC6A 1ZQ1A 3CA8A 3GN1A 1D2MA 3AX6A 2W37A 3LQYA 1EE2A 3PRYA 1MB9A 1ZC4A 4GBJA 5A3QA 2KLHA 1ZD8A 1MNQA 1Y5NA 2EGGA 4RLHA 1V96A 1FJ2A 5BYAA 2FEOA 2ZRLA 4F9EA 3IKMB 4MUAA 5HOQA 4XJXA 2A5GA 2VTKA 1O6CA 1U81A 2YWFA 4AY5A 3K05A 1JNXX 1UMDB 3P26A 2WKQA 1J42A 1Z36A 2OFOA 3EFEA 2QPAA 4BVEA 2GXAA 5ALEA 1JVNA 1LUAA 3VNUA 4K9OA 4POOA 5FAXA 1CEEA 1MQ8B 3FJ1A 1NYTA 1X7GA 1W76A 2XUPA 2Z9BA 4U39A 4WZZA 3OOHA 1ORDA 3UMCA 2VXYA 1YK1A 2ZS7A 5JBIA 4LRTB 1FTWA 4RMIA 5I7VA 2H3EA 1VM6A 1OLXA 3GMTA 3O8OB 5AIAA 4X6XA 5DH9A 5J2UF 1FUUA 1FU7A 5KDLA 4H7KA 1BOFA 1A5BB 1VXOA 3H83A 3R8CA 2QSUA 5JS8A 1ENPA 5KQLA 4CE6A 2I2DA 2QLLA 3BHJA 4B7CA 4H7HA 1Z8DA 2E49A 1KU0A 2FP4B 1KBZA 1QF7A 4UATA 5FTLA 3TI9A 3H2ZA 3I1IA 3JALA 1WBBA 121PA 2H9AA 4MUEA 5LPNA 1KAHA 2EEZA 2V3WA 1XDUA 3E5MA 5HKBA 3HUEA 3V4VB 4E2FA 4Q5IA 2H4JA 5K3CA 3HXTA 1SZJG 1PR3A 2XIQA 2A4KA 1C3EA 4QVGA 2KW5A 2FMUA 3LUGA 3F67A 2FZKA 2QENA 3L1UA 1E2UA 4HZUB 4KC0A 2ZYRA 3BH7A 4KVGA 3KYDB 4RHTA 4NBRA 1M8GA 4I5GA 5BQXA 1A8UA 3DDZX 3CX3A 2GBIA 4TTTS 3OQ1A 1BRMA 3FVTA 3KQLA 1HE5A 4G8JA 4LHYA 1Z8FA 4CV1A 2DHDA 3KWLA 1L7VC 4MS3B 1LK7A 3BGIA 3VKGA 4L4SA 1E5XA 4FYPA 3H5IA 4JBGA 4DXDA 4DR1B 3AFIA 4TT3D 1VLHA 2CXPA 1Z2DA 3QJYA 1FXUA 4J0JA 4XTCS 2P78A 1E2KA 1G6KA 3LPLA 5K8JB 2X6QA 4MV1A 1MHTA 3E82A 4AY2A 1Z7BA 2D0IA 2PS3A 3KZXA 1FTSA 3C39A 4YRTA 3GYBA 3G85A 1KORA 4ZAXA 3TQRA 4QVKA 1C0KA 4YS6A 5AW8A 2Q6KA 3EA5A 1T8UA 1TLFA 1YOVB 1QB8A 2WJ6A 3JWEA 3KUKA 5C80A 2YC4C 1ZJWA 4G84A 4ZQGA 3AFNA 4RJJA 1XSEA 1WA5A 2R1VB 2XR1A 4XDYA 5EKXA 3ZX5A 5IXJA 4U9UA 1CQIA 1GZ5A 2XJ9A 4LYEA 1GCIA 2NACA 4N82A 4RH1A 4LOIA 4TQGA 4ZYXA 3QKSB 2H31A 2VJPA 4O29A 3JZIA 5SICE 3S40A 5BN4B 3H16A 3OLYA 1NZJA 1ZXBA 5LB2A 1VE7A 2OYCA 2XYQA 4ARZB 1HE2A 3OE1A 1GYPA 1NKSA 1KIFA 2NT4A 1OE0A 3PQEA 1F20A 1Y81A 2BFFB 1QH1B 3IUSA 4WZAA 2V6JA 2JD0A 2ZDGA 3T3IA 3KALA 1XCLA 1L5HB 4CM1A 1EGVB 3M8KA 3TECE 4UDNA 3PGXA 2IUYA 4ZO4A 4XUCA 1V9SA 2IYAA 3Q9NA 1G1MA 3EUAA 1RZRD 3UYKA 1YA4A 1A1VA 4QE3A 4W1PA 2B0JA 3KNZA 2K4MA 3PXGA 4EMUA 1JUDA 4UTRA 5KJ1A 4QHSA 1BFKA 1N1MA 3ZNPA 3IUBA 5EFZA 2F00A 1P4GA 4G5GA 4GKBA 3UIEA 5KYTA 3I83A 3P9KA 2IEYA 1UJ5A 4YCDA 4YQEA 2D1SA 2WHRA 2Y4NA 2ZRKA 3CR3C 5AM0A 2EYQA 3ETCA 4QU0A 1RBYA 1HE3A 1ZCJA 2H3HA 2G5PA 2RAPA 3LFUA 4ID3A 4IIJA 3GEPA 3AEKB 2QZPA 3C97A 3DA8A 3PQ4A 4TYMA 5FFMA 1FDOA 4FZJA 3ROTA 4E08A 3H3JA 3ADCA 1NKVA 2DFLA 2WKSA 3HLTA 1ZIXA 1PW7A 1YIDA 2O7QA 3CW8X 4RSMA 5DM2A 1R6TA 1TGYA 1IM5A 2OXCA 5FR1A 5A3SA 1HNWB 3IEIA 3WQHA 1ESMA 3Q5EA 2JCBA 2A4MA 4ILKA 1HKUA 4LBZA 1A7UA 2D13A 4NJEA 3WWYA 1UDCA 4CG3A 1YI1A 3TINA 1ZJZA 4BJ5A 4NFHA 1FNDA 3GHHA 2O4UX 4ZOLB 1DC6A 1RLJA 1I0LA 3DHWC 3LUAA 5JJLA 5AWFC 4UAVA 1OJ7A 1AUPA 3FR7A 3GDGA 4O3MA 3I6IA 1AGNA 3OCYA 1R7RA 3NNSA 2YXPX 5FPQA 5LP6B 2VDJA 1QLJA 2RDMA 1H2FA 5PNTA 2EF1A 2GAFA 4H9GA 4UUMA 4XSHA 5IKPA 3KSUA 3WGUA 1Y8RA 1ML3A 2ZSEA 3W3ZB 2DPXA 4NU6A 2QTFA 3GFSA 4N6GA 2I3BA 4NOLA 4BZWA 1K2VN 1U9IA 2BFCB 2NZ8A 4A4DA 4B80A 4EZEA 5A4IS 5KQGA 3K9FC 1D4FA 4V0QA 4Z9XA 3J81k 4MDEA 3OTHA 4TL7A 1PWHA 2PUJA 4S3MA 2Q7DA 4DIMA 2JLSA 2ORYA 3D4IA 3HSYA 4MVCA 4XPIA 5DHSA 4AIRA 4XLLA 4D9IA 2J7KA 2X1LA 4PF1A 2ZTLA 3PNVA 1NY6A 1NV8A 2ZBRA 4V2UA 5CVJA 4QXRA 2V97A 3ZWQA 4YO8A 3LECA 4AN1A 1T36A 2C3MA 4QXOA 4A6DA 1VMAA 1PKEA 4OJMX 2YIJA 5IJ0B 1UXHA 1ULTA 1KK1A 1LTHR 1JAIA 1NXTA 1SUIA 1D2AA 5D3QA 1CRQA 1KJZA 4IKEA 1ZRNA 1T91A 5AI4A 4FFDA 5D8DA 4AD8A 4I4TB 2C07A 3BJIC 1UMDA 2ZAMA 4KQFA 3CEHA 2FPSA 3HVHA 4WXEA 2CUTA 4L0CA 1WTCA 3V1LA 3I9KA 3HCAA 1FNSA 3SJ7A 2YCBA 2VT6A 1OX6A 2PGOA 3ZWPA 3LTNC 4BB5A 5AJZA 4RVDA 4KWHA 4G01B 3WO1A 4JJFA 4ON9A 2QAGB 4Q9NA 1M6YA 1J22A 2IS1A 3CLTC 5LJLA 4D4IA 3TVYA 1W6RA 3ONWA 1DNPA 1CTQA 3C0KA 4B6JA 2JLCA 1XYYA 2FP4A 1NMEA 4Q00A 4EOGA 4URYR 3GELA 5DPMA 4TMTA 4R1MA 1HDXA 1KKUA 1SHJA 2R6CA 4YWHA 4HKTA 3A1NA 1YH3A 3PS9A 4K2HA 4YJ2A 3KPVA 4GNRA 2AC2A 3WV5A 4KQIA 3U7GA 2ATCA 2G04A 2VWQA 2VYVD 3Q1KA 1IH8A 5C37A 2YYAA 2C98A 4GR5A 3IHWA 3TW6A 3TN7A 5JRZA 1TKAA 3TAUA 2FW1A 1XBTA 1G8HA 3OFSA 1L3IA 4CM5A 1LBTA 3FWZA 3KYDA 5A4KA 1V3VA 3MMSA 3CY6A 1U11A 3OZEA 4XI9A 4JASB 1EUYA 4DPLA 1XTTA 5T73A 2G7ZA 5KTKA 1L1FA 3JQEA 1FFAA 1ST3A 3EX7C 1IUOA 2FWMX 2WB2A 1IRIA 2GEBA 2GHIA 2IGBA 2J30A 1BX3A 4D99A 2QLNA 2R8PA 1JVBA 4UEKA 4BFLA 3UBTA 4IDOA 4RGVA 3GJ3A 3QFHA 1AVTA 3B3GA 1JWBB 3RFUA 4KIWA 5JFGA 2XD9A 3T9AA 2BFMA 2VDLB 4NFSA 4FE4A 1SRQA 1M0EA 1VZ3A 2QRKA 3ENKA 5EIEA 3QMVA 2D6FA 3F78A 1IHUA 1YOVA 4AN4A 1GTJ1 3GPDG 1O4WA 3WLEA 4QPJC 5TB5A 2QZ4A 2I1QA 5KMGB 4RF3A 1QH9A 4KGVA 1O58A 1PZHA 4EHFA 3WFIA 2R1VA 4F5YA 3VO8A 1XZMA 4PBRA 3OO0A 1U7XA 5KI6A 5ILQA 4BN0A 5DCYA 4ZCMA 1ZH2A 3QKSA 5IHPA 4C3VA 5BVGA 1X14A 4OFBA 3QEAZ 3LBIA 3WGMA 1E2BA 3KOYA 4OFXA 3B3QA 1U65A 4DA6A 4D3SA 5M2QA 1B16A 1YZQA 2ADMA 2BSAA 2QUHA 2WTNA 4QNRA 3RWMB 5HSGA 4QEKA 4ND8B 1U8ZA 5DBFA 1HPLA 4ARZA 4L3VA 3ELYA 3BS4A 1BW9B 3HDTA 3QNWA 1BE8A 5FUWA 5GOTA 5B7NA 1WMBA 2P11A 4PC7A 1QH1A 1TMGE 1P17A 2QG4A 1AXRA 2ZQYA 3NTXA 3OF5A 1CS4C 4V0LA 1DBVO 1L5HA 3MS7A 5TEVA 4CF4A 1XQXA 4R2IA 4P5EA 1LDMA 2Z8YM 5DNWA 3BWBA 3I2IA 1OFUX 1EB8A 2O6HA 3GFOA 4XQGA 4ZV7A 4IUCS 2JNWA 1C2YA 1Q1BA 4I9HA 2FGJA 4J16C 5EZ5A 3HUFA 3QKTA 3B6KA 4E03A 4B6EA 2WD7A 1IQPA 2A84A 2VYCA 1I2BA 5DLQC 2P79A 2G70A 2J3DA 2OHFA 2WKRA 2X1MA 3DD1A 4ZI7B 2VQFB 3O4IA 4GMGA 1A50B 4U1RA 2VRCA 4OBWA 5MN6A 1MB0A 2QGZA 3H6KA 4ZK6A 1U2DA 2F8MA 3N2EA 3GARA 3I2GA 3PUIA 1X7XB 3NO4A 1E1RD 5C53B 2O2IA 3KWFA 2O5EA 3AEKA 5JUWA 1FP4B 3SZ3A 2WTEA 3H6HA 2ZU6A 4JC0A 1T3HA 2Z56A 3M1AA 3GB9A 4WOBA 3I3SR 5K0SA 3BN3A 4MX8A 1KDYA 4DMGA 5ITVA 4MYRA 2CF6A 1RP7A 2EG5A 2PZBA 4B2PA 3Q8LA 1IK4A 1OWNA 4TSFD 3RIXA 2Q7XA 1B0UA 2YWGA 3EGIA 1VP3A 1CS0B 3GAMA 3MB8A 3EUWA 2CFTA 4MP6A 2DEUA 4PSUA 1E5LA 4ZOLA 2UVPB 3HN6A 1VGRA 1V4BA 3CX7A 4O2AB 4OJKA 1XTUA 3NTVA 1G64A 1CBUA 1PUIA 1W94A 1FYXA 4WUVA 5FBWB 4EPVA 4JI8B 4HQNA 4YP9A 3Q3HA 2IEAA 1NHGA 4ILEA 4F4UA 5K6TA 2PS9A 2VTDA 2IZ1A 2XJ4A 3IE2A 4W1SA 4H3SA 5CDGA 5LQRA 3MMXA 3KQPA 3MEQA 2NV2B 1TT7A 2VG8A 2BFCA 2JARA 1O5IA 3C1OA 3DLCA 3P7MA 5T4HA 1HT2E 3Q3EA 1Z0FA 3D8SA 1IN4A 3RANA 3GL9A 4C88A 5JC1A 3N2GA 4G09A 1YIOA 5AVTA 4REQB 3V32A 1YDWA 1FX0B 1UINA 3OEEA 3PHBE 1WXXA 4RGQA 4X20A 3W4KA 1C0IA 3BF7A 5FOTA 5JAQA 5HTOA 3P0IA 3A6HA 4FT4A 1BXZA 2CUZA 2XCQA 1ZY2A 3X2EA 2JLWA 3W5HA 3OEHD 1PRYA 4TTQA 4A0SA 1Q1GA 3I12A 1L7PA 5IJ0A 2AZ4A 1LNQA 1RCTE 4LNAA 4V2IA 221PA 2IDKA 3NM6B 4JT2A 3UAZA 5MGNA 1BHQ1 2LDBA 3K72B 2PXCA 2VZEA 4IS2A 3SNHA 2C2OA 3RVDA 1V2HE 2QTRA 1II9A 2AZMA 4I4TA 2QLFA 2I78A 4MRVA 3V1NA 4E5MA 1KVQA 3PQFA 1SCAA 4JENA 2XYGA 3LOPA 3LT1A 3CZ9A 1Y8CA 3CB2A 4WN9A 1Z6PA 3A3YA 4NIMA 4HS9A 3R3WA 4LXXA 4N76A 4RV5A 2QNBA 4XOUA 2P6OA 4LUCA 5HGJA 2J0UB 3K96A 2BM9A 1JLHA 2KI5A 4RTPA 3GT7A 2BE9A 1WL8A 2W6CX 1W73A 1ZD9A 1U0SY 3S0JA 1GVHA 2ID7A 2MSEB 2Y76A 4KQGA 2NLOA 3R3UA 1OQAA 3DB2A 5I5EA 1CWUA 2HWKA 1S8NA 2H92A 1LV8A 4P83A 1CP3A 1VHWA 4L4XA 5ELMA 2D1QA 4PCAA 5JEEA 3IERA 4KAFA 5BSEA 3QUBA 4NCHA 4MUXA 3ROZA 3RR2A 2FSGA 2J6IA 2VSFA 2ZLBA 4M88A