4F3YA

X-ray crystal structure of dihydrodipicolinate reductase from burkholderia thailandensis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
267
structure length
267
Chain Sequence
SSMKIAIAGASGRMGRMLIEAVLAAPDATLVGALDRTGSPQLGQDAGAFLGKQTGVALTDDIERVCAEADYLIDFTLPEGTLVHLDAALRHDVKLVIGTTGFSEPQKAQLRAAGEKIALVFSANMSVGVNVTMKLLEFAAKQFAQGYDIEIIEAHHRHKVDAPSGTALMMGETIAAATGRSLDDCAVYGRHGVTGERDPSTIGFSAIRGGDIVGDHTVLFAGIGERIEITHKSASRVSYAQGALRAARFLAGRDAGFFDMQDVLGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 79
structure length 267
sequence length 267
chains with identical sequence B
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4f3yA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f3yA01
2EKLA 2QYTA 2EIHA 2WYUA 3F9IA 1H9BA 1KS9A 1UDAA 4MKXA 1ZSNA 3OA2A 3E9NA 3SJ7A 3U3XA 1UAYA 5F5LA 5I7FA 2GN9A 2SCUA 5JAQA 1ISHA 4CMKA 1GQQA 1SPXA 4FW8A 1N5DA 2D4AA 1HZZA 1ONNA 3TL2A 1T26A 3ZWMA 2LDBA 3OJOA 4JNKA 1C0LA 1O8CA 2VT3A 4ZU3A 1C1XA 1IYZA 5BQFA 4EI2A 3W8DA 1EE9A 1YONA 3JYPA 1FDSA 3OIDA 4E2WA 1TLTA 4GLLA 3PLRA 5IJZA 3KRTA 1GCUA 2NQ8A 4I5FA 3VVCA 1GDHA 4BGUA 4E5MA 1YWGO 1WAMA 3E9QA 5HTOA 1I3LA 3BMCB 5DP2A 4GL4A 1KOLA 1I33A 3P7MA 4IMPA 5BT9A 1KY5A 2NVWA 5L40A 1CRWG 2PK3A 1ZSVA 3ZV4A 4B8WA 3GK3A 3H5RA 5GZ3A 3R3SA 4K1LA 3KUXA 3IS3A 3X2FA 1SNYA 2X6TA 1VSUA 1M6WA 4BB5A 1EZ4A 2X5OA 1TT5B 4UUMA 3LT2A 4BO8A 2WE8A 2VNSA 5JLAA 2Q50A 2E6UX 4OAQA 4RVHA 5G4KA 4Y67A 4ITUA 3ZWYA 1LLQA 4KUHA 2Z1NA 1E3IA 3GN1A 1DB3A 5JDIC 2P4QA 3QIVA 3RROA 1T2FA 4E13A 3VTFA 3DDNA 4B4WA 3IUSA 4L76A 5DULA 1BMDA 1LC0A 3HDHA 2IODA 4J2HA 1ZIDA 3TZHA 3WFJA 4I9NA 1LXCA 2BGLA 1U9JA 3RUHA 3BMCA 3I4FA 4E12A 1NPDA 2Q2VA 2WD7B 3TFQA 3AY7A 1SMKA 3MEQA 2Q45A 5TJ9A 3HN2A 3GMSA 4YDRA 3GRPA 4IXTA 1XQ1A 1QG6A 1JKJA 3WGIA 3PFWO 3KEQA 1X0XA 4WNIA 2FHSA 3OQ1A 4KQWA 1A4UA 4J7XA 5KVCA 2D5CA 1XU7A 4BNWA 4LSWA 4QX6A 4LN1A 5JFOA 3O03A 4FBGA 2J3HA 3JYOA 5LDHA 1ENPA 1HE3A 2EWMA 5KWEA 4DLAA 3ANLA 1M66A 2YHIA 4A7PA 4B3IA 1CWUA 1R0SA 2ZK7A 5IDWA 2C5AA 4W99A 1PEDA 3Q9NA 4TROA 2DPHA 5ILOA 3NYWA 2DLDA 4DTIA 2NU7A 4FFNA 3WYCA 4LSMA 1EQUA 3BTUA 3MJCA 1D4FA 5JMWA 5C37A 4D0SA 3HSKA 4R01A 5DCWA 1XGKA 3DWFA 4CL3A 4M49A 4RJTA 4YJHA 3BYZA 3ZWVA 4AJ4A 3M6IA 2HK8A 3EYWA 2XF8A 1VLLA 4KWIA 4RF5A 4TVOA 3FHLA 1FDUA 5DDIP 2Q2QA 1YKFA 3GAZA 3PGJA 4WASA 2OUIA 4DPMA 2V6MA 1GYRA 1KVRA 4BNIA 2QZZA 2I3GA 1Z7BA 4Q3DA 3GAFA 2AQIA 2OORA 3A4VA 1NM5A 1AHIA 2QG4A 2CFCA 1PL7A 1LBEA 1QSGA 3DEYX 4RO0A 5EMHA 2EW8A 2ZKLA 1BVUA 4E32A 3FI9A 4OKIA 2VYVD 4ROSA 1GUZA 2BMAA 3UHAA 3GEDA 1NHGA 2EJWA 2FPPA 3H3FA 4C4OA 2OHXA 4ND5A 2VUTA 2BELA 1T2EA 1JWAB 2Z95A 4WLNA 5CAEA 2PZJA 1KVUA 4WCDA 4RLHA 4P38A 3E8XA 4HY3A 4OIMA 3PYXA 3W4KA 2GD1O 2P9EA 1SO8A 1LDYA 4R1NA 1XEAA 3ZZNA 4IBOA 3ZV3A 4YB8A 1UXHA 5L53A 1B2LA 1TXGA 3HG7A 4MVJE 1V3VA 3OEYA 4K6FA 3O8QA 2C2YA 3RJ5A 3F5SA 3MWDB 2R00C 4CLRA 4L4RA 1B7GO 3S2IA 2GRAA 3JQ8A 1C0PA 1ORRA 2GZ1A 3KYCB 5B4TA 3GY0A 3GG2A 3NJ4A 2WDZA 3SLKA 5GZ6A 1HXHA 3V1UA 3IL2A 1U2GA 3QV1A 1EQ2A 4JJGA 4EJMA 2RHRA 3GVIA 5FFFA 4HXYA 4QFCA 3SJUA 5IXSA 4LVUA 4J16A 1YBAA 3AI2A 2QHXA 4RQUA 2CVQA 2E49A 1DOHA 1LX6A 3JQ9A 5JPIA 1Y8QB 1QYDA 3RC7A 2Y0CA 4Q3BA 4NZ9A 4XD2A 4CV3A 5J23A 4BO4A 2D59A 2GZ3A 5GZ1A 3JD2A 1MB4A 1ISGA 5U9CA 1Y8QA 5JDCC 4AICA 4DL9A 4U0JA 1LC3A 1X7HA 2AQHA 1NPTO 4AFNA 2B83A 3WG9A 3BZUA 4BKRA 3GDOA 3EK2A 1AHHA 1C3VA 5T67A 2D1YA 1DFIA 2W98A 4MIEA 1VC2A 3T7CA 5AXDA 1Z73A 3UOGA 1F06A 4ZHSA 4NK5A 4WLFA 1K6IA 2JKVA 1NAHA 5JDCA 2OBNA 4B79A 2B5WA 1A7AA 2AE2A 1E5QA 1VKOA 2PKRA 3H5AA 3GGGA 5IN4A 4CMHA 1X14A 1R15A 2GN8A 1GL3A 4DQUA 3CH6A 1NP3A 3GNQA 1ZK3A 4CLOA 2ZJ1A 1R4MA 4PLVA 3PHHA 3S2EA 1EVJA 1D3AA 1BW9B 1LSUA 3NT5A 1OBFO 3IUPA 3FWZA 4DIBA 2HMSA 4NI5A 4Z0TA 3RUIA 4JBGA 1Q7BA 3WGTA 1GY8A 4Z6KA 3NTOA 1U3TA 1PR3A 4WNCA 4QQRA 2IRWA 3A14A 1WMAA 2Q1WA 3TJRA 4OJNA 2VHXA 1OOEA 4E2XA 1LDNA 1ZBQA 2JD2A 2PFGA 4EZBA 4J90A 4OM8A 2IZZA 3AUTA 2EXXA 4YQYA 5ILGA 4LRTB 3TNLA 3KYBA 4CM5A 1G6KA 3COSA 4ALMA 3H6KA 1E1LA 4P8RA 3B20A 2B4RO 3EUWA 4IY1A 1LNQA 2UDPA 1N92A 5DN9A 1Q7GA 5TQVA 1F8FA 5BNFA 4BNVA 3ZN2A 2P91A 1E3SA 1LDBA 1K2WA 1KETA 3KV3O 4BB6A 1XKQA 4DBVO 3JD3A 4LK3A 3OQBA 1O95A 1T1RA 3AM5A 4A27A 5ADHA 3ETGA 3NT2A 3HDQA 3I5MA 1CIVA 3H9JA 4YTEA 1Y7TA 1EEHA 2RIRA 1V6AA 3L6EA 4J0FA 5FF9A 4I5DA 5FEUA 4KMSA 3QSGA 1E7MA 2VWPA 4UULA 5A06A 4U0KA 1WZEA 4D45A 4HX5A 2EV9A 3KSZO 2Y68A 3DFUA 1JW9B 1QP8A 2C2XA 3O26A 2GO1A 3DL2A 4IJKA 3TZQA 5TIIA 8ADHA 3VDQA 4YRDA 4E2ZA 1XU9A 5KKCA 2FSSA 2O7SA 4YWJA 1YRLA 5L51A 2HQ1A 4UREA 4D3FA 5L4LA 3IKTA 5JXWA 4EBFA 3V2HA 3PYLA 3WFIA 2C5EA 1P45A 2ZTLA 3U4HA 1DC3A 3C8MA 4XGNA 1NTOA 4U6QA 4RVSA 5DF1A 4D79A 4UUOA 1B14A 4R9RA 1ADBA 3CE6A 3GVXA 3JQGB 4BO0A 1ZUD1 2ZYAA 4I5EA 1A4IA 1GD1O 2Y0DA 4MIOA 4P4LA 1UDBA 4XDYA 2GYYA 2RH8A 3DZFA 2NSDA 2AEFA 5EQDA 2DQ4A 1QLJA 4UAGA 4BNUA 4BGEA 5HM8A 1MP0A 4L0QA 4M86A 5EN4A 1SEVA 1PZGA 1UXKA 3PGXA 1P33A 3O38A 4RPLA 2UUOA 1I36A 4MO2A 3RBZA 2CSUA 2VZ0A 4YJGA 2QQ5A 3AFNA 1NVTA 1P1IA 1JAXA 3PHIA 1Y9EA 1YOVA 4JBIA 3KLMX 2OXIA 1PZFA 3HADA 1QMGA 2NWQA 2OP1A 5DOZA 3WXBA 4NDNE 2GPTA 2CDCA 3TZ6A 3LDHA 3K2BA 2IYPA 1R6DA 4Y6SA 2FOIA 4YT4A 4D44A 2WD7A 1N2SA 2B4QA 4G81A 1GV0A 4M54A 4YJFB 2YY7A 4M8SA 4UVDA 2IEDA 1P1FA 2PGLA 4GSKA 2BGKA 5KCZA 1PGNA 4ZQBA 1YL5A 3P19A 4CR6A 3DB2A 4MIYA 1HDRA 3IIEA 5L95A 2TMGA 1BDMA 3GLQA 3WGHA 5I8ZA 1B26A 5G0UA 3O9ZA 4IIUA 3AUAA 4XIJA 5THQA 3GVCA 3JQ9C 3D3EA 5G4KB 1DLJA 1ISMA 3G17A 3KO8A 4XYEA 1HRDA 1O89A 5A02A 4IINA 3TZKA 4FS3A 1GQ2A 1E0DA 2GR9A 2A92A 1Y81A 2C0CA 2EHDA 3HZZA 4FFMA 4WGGA 1OAAA 3K9QO 2C7GA 4BKUA 2Y1GA 3KYDA 2ZB8A 2Y1OA 3RWBA 3VPGA 3V5NA 2OMEA 2W2LD 2YW9A 4NG5A 1V8BA 4FJ2A 5CPFA 2HMWA 3C7DB 4GWGA 5TJHA 2PZKA 1M76A 4HFJA 3PZBA 1HLPA 2OO5A 5T73A 4N7RA 4AJLA 2FY8A 1MXFA 2I65A 4BS9A 1OZAA 1WWKA 3QRWA 4CQMA 1DFGA 2C82A 4D3SA 2WYWA 4BMVA 2V6BA 2HLPA 3DTYA 3AOEC 4HFNA 1TI7A 5H81A 2DPGA 3L4BC 4B3JA 1YOVB 4YAJA 1EFLA 1BXKA 3NDJA 3WSWA 1WP4A 3PJDA 1A9YA 4DPKA 3GH3A 1HDZA 2JCVA 3GFBA 3ZWCA 4J1TA 3KOUA 3FN4A 1XSEA 3IMFA 1G0OA 1IOLA 3F6YA 3FD8A 1ZMTA 2FRDA 5LC1A 4PG6A 3HB5X 1EK6A 4N5MA 1U5AA 2EP5A 4FOOA 4G65A 4DXHA 3ROKA 1F0YA 1YH3A 5K9ZA 3LT0A 4AJ1A 2FR0A 3I9LA 1C1DA 2WEKA 4W82A 4E21A 3KB6A 5HBRA 4ALNA 3B1FA 3TOXA 4DQVA 3GHHA 2X0RA 4LCJA 4B7CA 1ISFA 3EW7A 3GA0A 4DWVA 1MGOA 2CD9A 3WICA 1PU2A 2GLXA 4MDHA 1BGVA 4NNJA 3GT0A 3TWOA 3JQEA 4KWHA 4OKNA 2G0TA 4FB5A 1X7GA 4E30A 4MVJD 2PWZA 5IZCC 3ZGYA 5F1OA 4BNZA 4CLEA 2WM3A 4MVJG 1R16A 1J49A 4R54A 4OGWA 2J3KA 1RYDA 2HK9A 2PZMA 4NBRA 4CQLA 3RQSA 3D3WA 3QWBA 5L7YA 8LDHA 1EVYA 4ALLA 4M89A 3M1AA 3D1LA 3RC2A 4L4XA 3DMTA 3EDMA 5JAZA 2PGJA 1UXGA 4XJSA 3JV7A 5T64A 1H93A 4XR4A 4YAEA 5A5FA 2DBVO 4PRLA 2HRZA 4DUPA 5A9SA 1D8AA 2NACA 3LZ6A 4BV8A 1KC1A 3R0IA 1Y9AA 4Q3CA 3DAPA 2D0IA 1EFKA 1N1GA 4KUGA 4CODB 5ER9A 4J4HA 4MP8A 4LMRA 2P4HX 4S1VA 1EBUA 3WTBA 4A5OA 3HQ4O 3V1YA 1DIAA 1PIWA 3H2SA 2I5PO 3F3SA 3BAZA 5TSDA 3VDRA 1U3WA 1EUDA 4YVFA 4A2CA 1E6WA 1W0CA 1J0XO 4Q3NA 1PJSA 1XR3A 3QJ5A 3OJLA 2GSDA 3I6IA 2A9FA 2VOJA 5L4NA 1LRLA 4ND4A 2ZYDA 1HDOA 3AUSA 1LLDA 3GG9A 4R4JA 1SOWA 2AA3A 4NPCA 1H2BA 3WJ7A 1P0CA 3UN1A 2G82A 2DBQA 1PQUA 5TS3A 1G0NA 3QP9A 1KY4A 2AW5A 2PZLA 2Y1FA 3RIHA 3DOCA 1LLUA 4J9VA 3ASUA 3NUGA 4TRMA 3KZVA 5KJ1A 2DBZA 2IYOA 4B4OA 4PRKA 3S2FA 3JQ7A 5A3JA 4IQ0A 1DDOA 2P2SA 3ON5A 2Z5LA 5AQ1A 2ZB7A 4RLSA 5K0ZA 2PGDA 3KEOA 3DZKA 5LDGA 3OECA 3W1VA 3BMQA 1T2AA 2E48A 3ONDA 1N1EA 1YBMA 2QX7A 4CUKA 5BSHA 1NQOA 1FMCA 5JS6A 1YQDA 2D8AA 5L7TA 1FDTA 1TVEA 4NFSA 5DBFA 5TLSA 1U3VA 4TZKA 4E6PA 4XCVA 3GF4A 3W6ZA 1YJ8A 3I23A 2FPGA 3TN7A 3OF2A 4JJFA 1SC6A 4CM8B 1LSSA 1W8DA 5IZ4A 3DBRB 3AY6A 3DBHA 3JQAB 4UVGA 1E1MA 1VL8A 2OGUA 4II2A 3AI1A 3E1KA 4L74A 4IDFA 2A94A 4Z9FA 2V6GA 5C5IA 5CDSA 5JYAA 3FNEA 1V0JA 4TMFA 2AG8A 3V2UA 5JCJA 4XB2A 3RUCA 1C0KA 1H6CA 1JKIA 4OYRA 3IDSA 3DXFA 3RUFA 1VSVA 4CM6A 4Z0PA 5I9NA 5A1TA 3MCVA 2JCXA 2BH9A 1DRUA 3WGOA 3D5QA 4DIOA 5JYDA 4MKRA 1U8FO 4EW6A 3FR7A 4FJ0A 1H94A 1FF9A 3DMYA 5DBGA 3VZQA 4BVAA 5L7WA 4MP3A 1YGYA 2DTDA 3PHJA 2VZ8A 4O5OA 1NVMB 4PG8A 1LU9A 2R00A 1X7DA 2VN8A 2NU8A 1DPGA 3GFGA 4GWKA 4W9NA 3WQQA 3VVBA 1VPDA 1M75A 3I9NA 3NGXA 4TKLA 3KHUA 3QWIA 1MV8A 2V6FA 3MTJA 4G2NA 2JAHA 7MDHA 1ZKMA 1HF3A 5JCXA 2BFOA 4YXFA 3QVWA 2YQ5A 5C3MA 1ZW1A 3PQFA 1MG5A 2PD3A 2CVOA 3GC6A 4TKMA 2CDBA 1DFHA 1ISJA 1ID1A 2DFVA 1CDOA 2D3TA 1MC4A 3ZV5A 4WCFC 5G2OA 1MX3A 4CQLB 1VJTA 3L9WA 1UAGA 4GKBA 4WUVA 1TA4A 2HO5A 3SEFA 1Y1PA 1T24A 3I9JA 4PZCA 5L4SA 3OH8A 1Q2XA 1DAPA 2AXQA 2CF6A 2FZEA 2X0IA 4J4BA 1DHRA 2VOEA 2ZTVA 5IF3A 1WDKA 2ZQZA 4RVGA 1ZVMA 3JD4A 3ZU2A 4GPD1 5EIOA 4HBGA 5A05A 1L7EA 1MFZA 4BO3A 4WCFA 1JLLA 3ZWPA 1NQTA 4CLRB 3UW3A 2PR2A 3ABIA 3DR3A 3H9UA 5IDQA 3G3EA 1P31A 1DSSG 1E7SA 1XDWA 3JYQA 4YAGA 1PJ3A 5B4VA 3DZBA 4IQ8A 2WMDA 4CM4B 3VH2A 4ALJA 4A03A 1ZH8A 3E9MA 1GFSA 4JQCA 4QXMA 1N9GA 4GKVA 1N7HA 3KSUA 3WBBA 4ID9A 1DO8A 1B16A 5KIAA 1LUAA 3R3JA 5JO9A 3H9GA 3HFSA 4AJHA 5ITWA 2CMDA 3NTQA 3KM0A 2Q4EA 2C20A 2EG9A 1H6AA 2NV6A 4EUFA 1MUUA 3PTZA 4RL6A 5KKAA 1EE2A 3H4VA 4J91A 1I2CA 3B6ZA 5EJ2A 5AXBA 4HWKA 5EESA 3PVZA 5EINA 2C07A 3WGZA 1LTHR 3AM4A 2HK7A 1NQ5A 1C0IA 2O4UX 2B36A 4IDAA 4XKJA 4B3HA 4RV9A 1K6JA 2D2IA 4R41A 2ZQYA 2X23A 4E5NA 2O3JA 3CKYA 1E3WB 1HSZA 4TRJA 4EEZA 2NVBA 3FF4A 2G5CA 4DYVA 3SC4A 1Z82A 2UYYA 2YZ7A 3ZU4A 1BXZA 1T2CA 2O23A 5BSGA 3NDIA 5KOIA 3VZPA 2B4TO 4QECA 2E82A 4RZHA 2PH5A 1RM5A 4YAIA 3INGA 4OSOA 5CDGA 2PLAA 3PJFA 2HJSA 2X9GA 4CMEA 2ZCUA 1ML3A 1E7WA 3LF2A 4MP6A 5DP1A 4I08A 3RBVA 1P1HA 2Y67A 4NFYA 5JO0A 3WMXA 2FSVA 4YA6A 3ZWBA 1HL3A 2JFHA 4MOWA 3PWZA 2Y99A 3WNVA 1SOVA 2AG5A 2ZYGA 1TT7A 2GN6A 2VNAA 2YV2A 2O3QA 2FMUA 4BNXA 5TF4A 5G0SA 4H16A 4J7CA 1E7RA 2A4KA 2VTEA 2YDYA 1WMBA 1S7CA 3ETDA 4FCCA 4E5PA 2DM6A 4CM9D 1PGQA 3K30A 5DT9A 1O9BA 3LSYA 1H9AA 1JAYA 1KEUA 4FGWA 2X5KO 3GZNA 1XWFA 1ZK2A 1YXMA 3AJRA 3VZRA 1I30A 2VCYA 1JU9A 1HE2A 5FWNA 3LC1O 1EDOA 2VHZA 4LW8A 3S55A 5TX7A 3OJEA 4IMRA 2O50A 1MA0A 1UUFA 5JY1A 3LLSA 3UUWA 3OHSX 2BD0A 5CEFA 3PRJA 5JBIA 1A7KA 3MJTA 1ENZA 3ZU3A 3GGPA 1IE3A 3RU7A 3B70A 1GZ4A 2Y0EA 3DZJA 4Q3AA 3VZSA 3JQFC 5B37A 2F00A 3ICCA 3ITKA 4R3WA 3NGLA 4JP3A 3W8FA 1PJ4A 4IUYA 3PZRA 4NMHA 2DTEA 5F5NA 3DBLB 3NRCA 3T4XA 3U9LA 2X0JA 3QWHA 1YVEI 3AOEA 1ISIA 2BFPA 1DC4A 2X4GA 2VHWA 1IHXA 2CVZA 3DFZA 2BGMA 3I9MA 3ONEA 1GV1A 3WWYA 3ROQA 3P5SA 4U5QA 1H2HA 4ZRMA 2ZCVA 4EGFA 3P2YA 4R69A 5KJCA 3DBVO 3AU9A 4LRSB 3PIIA 2JD0A 3N7UA 1Y8RA 3S2GA 4CMIA 5CEJA 3Q6IA 1I2ZA 2HMTA 3KTDA 3UF0A 4RDHA 2VUUA 4GAEA 5FI5A 4AJIA 4BO9A 3INTA 4NU6A 2H63A 2WSBA 1ZEJA 3LT1A 4M55A 4OH1A 4BQRA 3I3OA 4O0LA 3MZ0A 1RYEA 4C7KA 1XYGA 2HSDA 3ITDA 1NR7A 4FFLA 3RKRA 1B0AA 2RH4A 1MXHA 4DC0A 2Y66A 3IP1A 4G5HA 4RF3A 2GZ2A 1AXGA 1WZIA 5T8KC 3G49A 1O94A 3HWRA 2GERA 1DEHA 4E4YA 3KETA 3PQDA 4J1NA 1PJTA 4PLWA 1E1KA 5CDUA 4CL8A 3PHGA 5L9AA 1ZFNA 2IE0A 3BMNA 1LJ8A 2NADA 1T2DA 5ICSA 4GX0A 4N18A 1JN0A 3RVDA 4CUJA 1GTMA 1DLIA 1WDMA 2H1SA 1YB1A 3K6JA 4S3MA 1I0ZA 1E5LA 4JROA 1IB6A 5ES3A 3WGGA 1XG5A 1I24A 1NBOA 1B3BA 1R4NB 3UCXA 2C59A 4PZDA 2Q3EA 3LU1A 5JSFA 1I5RA 1B8VA 5I7VA 1UZNA 1HYEA 3ULKA 2OZPA 4XIYA 2QW8A 2CUKA 4IJVA 2EP7A 1E3WA 5F3RA 4IJWA 2AEJA 3GDGA 5KJEA 1QLHA 1PQPA 5DOVA 4JXKA 4OOFA 3ONFA 2NM0A 4FDAA 2P68A 1PSDA 4BNGA 1ULUA 2XXBA 1E3EA 2V7PA 3RFTA 4GX2A 1JQBA 4QTZA 1HT0A 3G79A 1YDWA 4N5NA 2OL4A 5DCYA 3V2GA 3F46A 4AJKA 4WK6A 1KVTA 3BHJA 4DA9A 1VM6A 5GMOA 4XB1A 3ZHXA 4QFDA 5JY6A 2W2KB 4PCVA 3RFXA 3FSRA 1HEUA 3MJSA 5CG2A 1F17A 3BMOB 1I3NA 1H0KA 3EY4A 3JQGA 2X86A 4TRNA 5HWSA 2XXJA 3HN7A 4A73A 3HUDA 2W8ZA 3LK7A 4IS3A 4CPDA 3Q2IA 1VJ0A 4YCAA 4CM4A 2GN4A 3IOYA 3SLGA 4HNGA 4Y6PA 4DGSA 5BR7A 3OETA 4NHEA 3VOSA 1HSOA 4U7WA 1XIVA 3L07A 4W7HA 3FBGA 3PLNA 4IM7A 2P9CA 1RM4A 2C29D 4QT0A 1WXDA 4PVCA 3JYNA 1BXGA 3VAZA 1OI7A 2X8LA 2X9VA 4XGIA 3Q1LA 4MJLA 2QIOA 2NVUA 4GBJA 3OICA 1V35A 4KP7A 4ZQEA 3AOGA 2I3AA 5T8KA 1LDGA 1F14A 2RAFA 3GPIA 2VZ9A 1K6XA 3GDFA 3U4CA 3SVTA 1TEHA 4ND1A 4PLZA 2ZB4A 1QRRA 4F45A 1I3KA 2NVUB 4JIGA 5DNAA 5GY7A 1DIRA 1SEPA 3PEFA 2OFPA 1ZXBA 3DTTA 4WECA 1GQYA 5ENDA 3I52A 3LLVA 4J0EA 3BTVA 3LC2O 1EVZA 3NDRA 5A3VA 1QKIA 3VPHA 3CEAA 1FXSA 2YHUA 3A28A 4CMJA 3CXRA 4MVJF 1HLDA 4KQXA 1OFGA 1KVSA 2PKQO 3JQBC 4PLGA 3TPCA 4DREA 2DC1A 5AVOA 1RWBA 1X1EA 1GYQA 1A5ZA 1ZXLA 3MJEA 5JNLA 2WD8A 5A03A 3ZI0A 4AJEA 3PP8A 3DHEA 5CG1A 5KVVA 2Q99A 4K9DA 3RASA 4PG5A 1Y5MA 3AUUA 2GF2A 4NJOA 4PFJA 2FZWA 1DAOA 5U4QA 2YV1A 5EERA 2X58A 4D0RA 3G1TA 1T25A 3WTCA 3IAHA 5I9MA 1BVRA 4EDFA 2O48X 1NFFA 1O0SA 4RVUA 3RSHA 2VHYA 1DRVA 3F1KA 5EL0A 4MVJH 2X0NA 4J7UA 1PQWA 3H9EO 5C7OO 1HWYA 1WW8A 4GSLA 5H83A 3U49A 3ZHZA 2UUPA 3TQHA 1PJBA 4Z3DA 4ONEA 4D7AA 3QA9A 1DHTA 4B8ZA 3PI7A 2B37A 5TC4A 4O6VA 2VRCD 3A1NA 4NJMB 3UICA 1WNTA 2G76A 1CEQA 4XQCA 3JQAA 3CPSA 4ALIA 1WVGA 3TRIA 3GHYA 1V3UA 3RUDA 2HJRA 2WWRA 2IZ1A 4RVFA 3WSVA 4PG4A 4PIVA 4NU5A 5K6AA 4OXKA 1P74A 5F1KA 3ZWAA 3VKVA 1A71A 1V9LA 1BXGB 2J8ZA 2XAAA 1F8GA 4Y98A 3MTGA 1O5IA 5KVQA 3MJ4A 3NKLA 4R9SA 4XYGA 4ALKA 4R5HA 5CDTA 3Q0EA 3D4OA 4YJDA 2VHVA 3F1LA 4JLWA 3JQ7B 4AJNA 4TRRA 3F5QA 3V8BA 1Z75A 1HDCA 2YHIB 4NIMA 4OMUA 4L4SA 1LQUA 2DBRA 4D42A 3ZWWA 1YO6A 4FFRA 4LISA 2AE1A 1W73A 4P4GA 4PLPA 4KZPA 3EZLA 4RPHA 5IFLA 3QVXA 3WB9A 1QYXA 3LQFA 1ENYA 3LT4A 3IQDB 1ONPA 1BTOA 3H5NA 3PK0A 3PWKA 4K6CA 1XLTA 2NU9A 4IS2A 3ZU5A 3JQ8B 4WEQA 5G0TA 4CMEC 2I67A 3ORFA 1AXEA 1ULSA 4WLVA 1IY8A 4DYDA 2I76A 3RC9A 3DQPA 1BG6A 1DIGA 3WR5A 4JJIA 3D4PA 4L8VA 1GEEA 2B35A 2FWMX 3CMMA 3M2PA 3Q3CA 4ZQFA 4BNKA 2YV3A 1QYVA 1VL6A 4KOAA 3PWSA 1YL7A 3W6UA 2PD4A 5JYFA 3GZ4A 2NNLD 5BSEA 4HKTA 2UV8A 4CLDA 3T4EA 4CMAA 1QR6A 1K5HA 1LSOA 2DKNA 4LMPA 1Y5RA 1VE9A 5U1PA 2J5KA 3BMNB 4GX5A 4WEOA 1UXIA 2JHFA 3CZRA 4QEDA 3ETEA 3E5RA 1YBVA 1G1AA 1VJ1A 2P5YA 1GR0A 1YL6A 3AM3A 4EITA 4ZICA 1I8TA 3G0OA 4YJGB 4D43A 4MVJM 1ZK1A 4FFPA 4QO7A 4HP8A 4QO8A 4CM7A 1SCUA 4ESOA 1JKFA 3C1AA 2JD1A 4BIIA 4BO6A 3MOGA 3UCFA 1T4DA 1LRKA 3RBXA 4II3A 5AOVA 3C3XA 3EGOA 4IZHA 3WBFA 1CJCA 4RDIA 5T6BA 1GAEO 1PX0A 2HUNA 4Y8VA 3L6DA 3MJVA 3ANMA 2DVMA 1LI4A 2DFDA 3AU8A 4CM9A 1IL0A 4IDBA 5HRUA 2V65A 4EUEA 1BSVA 1QV7A 3TOZA 5L45A 3HE3A 1WDLA 2LDXA 1T1SA 5COBA 4WOJA 4TVBA 3GVHA 5L3ZA 1NR1A 1DC5A 2IZ0A 4R3NA 1PJ2A 2GNAA 3BTSA 1HYGA 1C1XB 1U28A 2J5RA 1GPDG 1UJMA 4I5GA 1XQ6A 3JSAA 3C85A 4BNHA 4CMCA 4R51A 2P5UA 2IXAA 1YB4A 3FBTA 3OM9A 5CHEA 1NWCA 4BKPA 3FTPA 3PDJA 1X15A 2JCYA 4ZN6A 3ADPA 4BNMA 4B4UA 2PA3A 4CR7A 3I1JA 4K28A 4WLOA 3NEPX 3QVOA 2UAGA 1E77A 4ILKA 1QORA 1NNUA 1GZ6A 2Q1TA 4J2OA 3EMKA 1IHYA 4W7IA 9LDBA 3WGQA 4RORA 3QWFA 3M2TA 1P77A 3X2EA 3NX4A 1U2DA 1GADO 4MINA 1NHWA 1QYCA 2O2YA 2BKAA 2YFHA 3JTMA 2FP4A 3JQBA 4FN4A 1M2WA 4GQAA 4BV9A 1JTVA 1PS0A 5JYEA 2GGSA 2Q1UA 4CM1A 4YRBA 4WLUA 1BHSA 1I3MA 3OJFA 4EJ0A 4J43A 2Y05A 1J6UA 1Q0HA 1CYDA 2QYSA 3HDJA 3PQEA 5ENVA 4H7PA 3ZWNA 2Q4BA 1BRMA 4NQZA 2EKPA 3TSCA 3V1TC 2W90A 1GZ3A 1ADGA 1Y8RB 4CMIB 1C14A 3PFFA 3WIEA 3VKUA 2J6IA 4FGSA 5I7EA 1Z6ZA 4ND2A 4B7UA 2HMVA 1L7DA 3N58A 2EKQA 3JQDA 1HZJA 3RC1A 1JA9A 5G0WA 2ZTMA 3LYLA 1KERA 3CZMA 5ER6A 5C7IO 1HE5A 2VWGA 3OIFA 2C7VA 2O4CA 1R0LA 2RBEA 3WMWA 5F1PA 1RM0A 4D3DA 2UVDA 2YQ4A 5TT0A 2VYNA 2EERA 4PZEA 1LSJA 1RKXA 1DJQA 1NPYA 3GEMA 4JK3A 1NFRA 4YT5A 2HMUA 3CINA 5IN5A 5I8WA 2FR8A 1ZK4A 1K3TA 5COQA 1SBYA 3RCBA 3WYBA 3OBBA 1B3RA 2BFMA 4J1QA 3K96A 3ZWOA 4Z3KA 1KC3A 3Q2KA 2HDHA 2O7QA 1Q0LA 3C24A 3BHIA 3CSDA 4MPDA 4FC7A 3FTNA 3TDKA 4CQMB 3DZIA 1EUCA 1DIHA 3D5TA 5BNTA 1WPQA 3RI3A 4EYEA 2FPIA 4DMMA 3BA1A 3QVTA 2DTXA 2NLOA 1S6YA 2J5QA 4J49A 4CV0A 4BGVA 1N9GB 3OMLA 4FR5A 5IDXA 3UH1A 4HFRA 3ADOA 3EVTA 4PGFA 5F21A 2EGHA 2Y1CA 5DZSA 1B15A 4IDCA 2DU8A 4DVJA 3K73O 2NUAA 4CLOB 3I4CA 3EVNA 3ZDFA 1EDZA 4AJOA 4AL4A 4WCFB 5CFZA 4BKOA 2BHLA 4FJ1A 5I7SA 3JD0A 4DBZA 1P1RA 3KBOA 1KEWA 4IGEA 4KUEA 4E31A 4XQ9A 1GU7A 3AWDA 3FCOA 2ILTA 4FOSA 1UDCA 4GGOA 4W6ZA 5EQFA 3VPSA 3DBRA 4NBUA 3WJAA 3IJRA 3FR8A 4L9RA 4FPXA 4MKZA 5HS4A 4U8GA 4BNFA 3GN2A 2EJVA 1P1KA 3RD5A 3D64A 2X7HA 5IXYA 1DXYA 3BHMA 1IZ0A 1DJNA 1MFPA 5CDYA 1HTBA 4O63O 1R37A 1U5CA 4JN6B 2B69A 1AUPA 2Y1EA 3K31A 1E3JA 3FPLA 5JAIA 4I8XA 1NAIA 1B8PA 1JVSA 4PVDA 2HAEA 3OP4A 4FIZA 1FJHA 4XA8A 3ENKA 1ZJYA 2JFFA 2PKQP 1P44A 3OA0A 4TSKA 4I9UA 4YT8A 4WPGA 4XX0A 3GOHA 1GYPA 2YYYA 3WQSB 3HNPA 1EUZA 4RQTA 1FDWA 2O3RA 1YQXA 1BW9A 3EAGA 4PN3A 1NASA 1RM3A 3WLEA 2IDZA 5FYDA 2DUUA 3OQ6A 3I83A 3WOHA 2GASA 1SB9A 3H2ZA 5T57A 4R16A 2QRKA 2VTDA 3C1TA 3PIDA 4R1SA 3U09A 1YB5A 1K89A 1XCBA 4FC6A 3D7LA 3DBHB 2WJPA 5TT1A 2HU2A 4YT2A 4CM8A 3DMTC 1R4NA 2B0JA 2W4QA 3BXXA 4EJ6A 3LC7O 4DMLA 3KVOA 4R1TA 4UUNA 4MVJI 5B1YA 3TZCA 4A26A 3KSDO 1JDJA 1MLDA 1ONOA 3ZH2A 2Q46A 4AJJA 3A06A 4F3YA 4RPJA 4AG3A 1HDXA 4XJTA 3GUYA 1ZZEA 2FR1A 3L4SO 5TGDA 4E5KA 3WYEA 1F12A 2B5VA 3DZHA 3QW2A 1LEHA 3JQFA 3AFMA 3C7CB 4GVXA 4HUJA 3BMOA 1YJQA 1PL6A 2BFAA 4E33A 1LQTA 3ZNNA 2W2KA 4CUZA 1U8XX 4BOYA 5KJ6A 1W4ZA 5JCJD 1HYHA 4UVIA 2Q1SA 5COAA 1PZEA 1LDEA 3U0BA 3PPIA 2VWQA 2CNBA 5C7LO 1X1TA 3QLJA 2VQ3A 4IJUA 3ZHYA 3GMDA 3DAGA 1K0UA 1P3DA 3VHRA 1WLYA 1NFQA 2DUWA 3QWAA 3W4IA 3JQ6A 1YS4A 4BO1A 4XYMA 1DBVO 4J3FA 3HDYA 1LDMA 4WKGA 1N7GA 5THKA 3U62A 3GUCA 5J9GA 3EC7A 1E6UA 4LGVA 4XRRA 4GMGA 4GX1A 5IDYA 3T7EA 4DPLA 1R12A 3I9OA 4PLTA 2Q2WA 3WLFA 4D41A 2X5JO 3QVSA 1LA2A 3JYLA 3AY3A 4J9UE 2G1UA 4AJ2A 1KEPA 4CMBA 2DT5A 3L77A 3UXYA 4YPOA 4UEKA 3NAQA 4PLFA 1AE1A 3UCEA 3AI3A 3PXXA 2BI8A 2VWHA 4W4TA 3WX0A 1ZJZA 4N5LA 3KXDA 2XPCA 1N8KA 3L9XA 3K2EA 3BMQB 1Q0QA 1OMOA 4TWRA 3H9QA 3D3WB 4URFA 3TFOA 3ENNA 2C54A 4IIVA 2GDZA 4PLHA 1PJLA 4D46A 4GGPA 4OO3A 4O1MA 1L1FA 4WE3A 4YR9A 1FDVA 4TZTA 3UVEA 1A72A 5H82A 4LVCA 3RJ9A 3E48A 3E18A 3ZV6A 1HDGO 3B1JA 3HJAA 3FPCA 5A5EA 2AHRA 2BLLA 4F46A 2HRBA 1PL8A 1YE3A 3QY9A 5DCUA 2W2LA 1VI2A 3O4RA 4CLXA 2Q49A 2JJYA 3IKVA 5JC1A 1PZHA 3CUKA 4BO2A 2VUSA 4EEXA 4M1QA 4CMGA 1C1DB 2ET6A 1E7QA 1FK8A 1YQGA 3DHNA 3SBOA 4B4VA 4FQ8A 3O8QB 4BQPA 3DONA 1ZK0A 4JP2A 1MC5A 1HE4A 1U1IA 3W4JA 2JL1A 4WJZA 4OQZA 3DBLA 2VRBA 3FNHA 3AK4A 4UUPA 5KVSA 1M67A 2WYVA 1E6EA 4YACA 4BMSA 2VYVA 3PJGA 1ZSYA 1U3UA 1NWHA 4PLCA 4YJFA 3K8ZA 1OC2A 4EUHA 4BKQA 4A10A 4BMNA 2O3TA 1E3LA 1Q7CA 4FD3A 1B8UA 4OL9A 3ST7A 5LCXA 2AQKA 2TMDA 6LDHA 2CF5A 4K26A 2OP0A 4RVDA 3Q9UA 1UP4A 3ZHBA 1SAYA 3ZNQA 4C7JA 4Z9YA 4QSMA 2YUTA 2PH3A 4KTTE 3H8VA 1Z74A 2G17A 1J5PA 3GQVA 3PDUA 4H15A 5A4DA 5B4UA 2CY0A 4F6CA 3H7AA 5G0VA 1OC4A 3UKOA 1ARZA 3UFXA 1ENOA 3I9KA 4GLOA 2IEBA 1IZ9A 4CM3A 4R1UA 2RCYA 2AMFA 1IPEA 2J3JA 2R2GA 3E03A 3SXPA 3KYDB 3GZNB 2FN7A 4W9NC 1QYWA 4ZRNA 4IZIA 4UEJA 4R68A 1A27A 4NFHA 4Y6RA 3UAGA 5JDIA 4YJHB 1VL0A 5B12A 3L0DA 4IXWA 4Q9NA 5K6AC 4DC1A 2J3IA 4IGFA 3WWZA 5IG2A 1UZMA 1E7YA 3WIDA 4Q39A 4INAA 1TT5A 3D0OA 4P22A 4PLYA 3LVFO 3GGOA 5JE8A 3W8EA 4PG7A 1BWSA 1XA0A 2OBYA 2YFQA 3KLPX 1W6UA 4BNTA 2ZTUA 4IQGA 1CERA 1KVQA 4X54A 5AXAA 5CEEA 1YDEA 4I9HA 4N54A 3L4BA 4ZA2A 1ADFA 2I9PA 1EBFA 2I6TA 4RPKA 1HDYA 5KTKA 1PGPA 5ICMA 1R0KA 5M6DA 4A0SA 1T4BA 3A9WA 3GNTA 4P4NA 1X0VA 2BRUA 3VH1A 4ZGWA 4NBWA 1H6DA 2X1HA 1MG0A 4YRAA 4GI2A 3S8MA 3RUEA 1IULA 2ZATA 3HHPA 3RKUA 4Z0HO 3NV9A 2BF7A 4WLEA 2VT2A 3P2OA 4OQYA 4DIFA 1JVBA 2CZCA 1I2BA 2GUGA 4H3VA 2JAPA 3N74A 3FWNA 1CQJA 3C7AA 2ZB3A 1UP6A 1NQAO 1EVIA 2PD6A 3TF5A 3IP3A 5AXCA 4AVYA 3H65A 5HA5A 5TRTA 3BTOA 4WOKA 4UVEA 4J1SA 1IPFA 4CLHA 2Y93A 1RJWA 1JWBB 3VPXA 1PGJA 3OIGA 5JW6A 1P1JA 3BIOA 1A9ZA 1R66A 1NXQA 1U7HA 3PYMA 1PJQA 2O3UA 2R6JA 1KIFA 1DIBA 1XHLA 4R5MA 2NU6A 1DC6A 1Z45A 1ZEMA 5AYVA 1P0FA 1DRWA 4F6LA 2H6EA 2OOSA 2X22A 4YEDA 4BO7A 4OOEA 4Z9XA 1UXJA 1VKNA 4E5YA 3GVPA 4E2YA 2AQ8A 4YBZA 2Q22A 3HFGA 7ADHA 5HS6A 4IPTA 4NR0A 5IAAA 2NTNA 4QUKA 4J6FA 4ZD6A 4BNYA 4XQGA 4IDGA 3F4LA 1NYTA 3EZYA 3AW9A 4JBHA 3MWEB 3DO5A 4KTVE 1GUFA 1PGOA 1PWZA 3OEWA 3S1LA 3U4IA 3CMCO 3K5PA 1EK5A 2EF1A 1LLCA 1Y6JA 5EPOA 5JAMA 4ZVVA 2JFGA 6ADHA 3JQCA 2IXBA 2GCGA 1Z7EA 1UZLA 2CDAA 4LCEA 3VC7A 1H5QA 4BNJA 3Q11A 5CP8A 4OHUA 1ZNQO 4RZIA 3EHEA 2QZ9A 5A04A 1KEVA 4Q3EA 3FNFA 4BNNA 4JX8A 2EW2A 2NTJA 3DOOA 2DAPA 2AEMA 4OXNA 1XELA 3RAJA 1E92A 4BHTA 3GNSA 4RF4A 3INRA 3L6OO 3B1KA 4BO5A 3WGYA 2PNFA 1D1TA 2F1KA 4ND3A 2E4AA 3IC5A 2QRJA 3ANNA 1I10A 4CV1A 3ZW8A 2H5LA 1ADCA 1AGNA 4BUCA 2BI7A 3ZW9A 1HETA 4XGKA 3ZCXA 4RCVA 1PS8A 1NX6A 5A9TA 5KJFA 3GEGA 3WDSA 4XWYA 4M87A 4JGBA 3I6QA 5TNXA 4YQZA 2YJZA 4NJMA 4L75A 3NTRA 1VRWA 2PY6A 3QQPA 3E5MA 1PR9A 3E82A 3PHLA 4I1IA 3VPFA 4UEOA 3QHAA 4IDDA 4RF2A 4Y9DA 3CIFA 4OSPA 1D1SA 4XRGA 2D5AA 1I01A 3DOJA 3ROMA 3DHYA 3FNGA 3G1UA 3WS7A 4AJPA 1QV6A 2XOXA 2POQX 1EMDA 2JHGA 1O6ZA 4XYBA 4E3ZA 3UGKA 2VYND 2Z1MA 1KBZA 5JMPA 3FRJA 3H3JA 4ZQHA 3RU9A 3U4DA 1TB4A 1U4OA 3MOIA 3CTMA 3GPDG 1PTJA 3STHA 5I9LA 2PTGA 3JCZA 2Y1DA 4FFOA 3VTZA 4YAKA 4E0BA 1ZO8A 4XDZA 4HNHA 3ASVA 4KDEA 3D4NA 3VH4A 3DAFA 4GVLA 3OFSA 1I32A 2X9NA 4U6SA 4CQMD 3K92A 2E37A 5DBIA 3KYCA 4HFMA 1BDBA 4CJXA 1D7OA 1UR5A 4XR9A 3U5TA 1GUYA 3WQRA 3SX2A 4L73A 4ZJUA 2RHCA 4GMFA 4HV4A 3PJEA 3E6AA 3NJ8A 4UVHA 2ZIZA 3QE3A 1R4MB 3OJ0A 1GCOA 2I99A 5ITVA 3NT4A 1CETA 1SB8A 4DLBA 3C1OA 4JCOA 1P9LA 2HKIA 1UH5A 2QRLA 3ZNPA 1ZMOA 1V3TA 2PV7A 4NBVA 4BNLA 3F47A 3RFVA 4NK4A 3F4BA 1E1NA 1GPJA 3DC2A 5MDHA 3ROPA 3LF1A 5MGBA 4B7XA 4CV2A 4KDFA 1J4AA 1U7TA 4J4TA 4NBTA 1CF2O 2WE7A 4FSHA 5KNLA 4XZ3A 4IDEA 2EGGA 3HB4X 2NTVA 4BL5A 1RPNA 4TQGA 1X13A 5CPBA 1UP7A 4RGBA 1GEGA 5JC8A 4OXYA 4XEHA 1LRJA 3ZNOA 3SC6A 1KYQA 3WNQA 3IJPA 1PJCA 4MVJP 3OSUA 5A9SB 3M1LA 4CR8A 3VH3A 1M6HA 5FI3A 2A35A 2H9IA 3JQAD 4NH4A 1PWXA 2YDXA 4RPGA 4YYZA 2EEZA 4DLLA 5G4LA 4O59O 3JD1A 5IZCA 3ICPA 4DQXA 2P9GA 4MVJA 2I66A 5A9RA 3GR6A 4ZQGA 3TL3A 1HKUA 1ZCJA 3R6DA 4XYLA 9LDTA 4HADA 2VRCA 1H6BA 5T5QA 1AN9A 1NVGA 4GH5A 3RUAA 2O2SA 1PS9A 2HCTA 4DRYA 2WTBA 1QXSA 2NQTA 1IUKA 4XQEA 5BNIA 3GRKA 2ZJ0A 1U4SA 1Q1NA 1CQIA 2O3SA 3DZGA 5BSFA 3ZWXA 3R1IA 1SZJG 4BGIA
chains in the Genus database with same CATH superfamily
1K4MA 1Z8NA 5CXXA 2EIHA 1H9BA 4LSGA 4I4NA 1H3NA 4TKVA 4DCTA 4E5UA 1WCYA 4BXOB 5EKDA 3N2YA 2VP4A 3IIIA 3U3XA 5FBWB 2UU9B 5F5LA 4LDAA 2GN9A 2A3NA 4MI6A 1UJNA 2Z8YA 3UJBA 3QBVA 3DZ5B 3UEOA 4CMKA 1SPXA 3LYHA 3T5PA 1G6Q1 1XEXB 4ZVLA 1I4WA 4D9KA 3D7RA 1ONNA 4IVRA 1T26A 5AW9A 3CT6A 3FOWA 3TI9A 3GLFB 1EM6A 4JNKA 2GM4A 1W6RA 4FHFA 3H0VB 2OD2A 4OQXA 3TK1A 1VMKA 2ZJ5A 3WDMA 4AT1A 4QKQA 5A5GA 3M1IA 2HTFA 3C48A 1FDSA 2QQGA 1VQ1A 3DFKA 2DH5A 4GR5A 4E2WA 1NF8A 3FMGA 4ZPXA 4LJ4A 3UA3A 5ELXA 4EMSA 4I2NA 1ACJA 1XBTA 1GCUA 4ANFA 4BGUA 1O6FA 1UC9A 3R76A 4E5MA 2X1MA 4P6VF 3MMSA 1Q83A 1WAMA 3DE0X 5HTOA 4MW1A 1U2GC 1Y1QA 2IPOA 4TKZA 3ZJTA 1I33A 4ENSA 5B7NA 5KU7A 5BT9A 3IESA 3A9RA 1DCMA 4B3CA 2FEXA 2ODTX 1C7RA 1RE1A 3S7TA 2ZR9A 4HSGA 1VPEA 4EI9A 5DBEX 2COEA 1JFRA 3H5RA 1P18A 5HXAA 4PRYA 1DE0A 4AN0A 2CV2A 1GU0A 3BB3A 3IS3A 1J8QA 1BEEA 1DP4A 2QMQA 5KYXB 3KJEA 1CPYA 2NYUA 4JLUA 2RGRA 3TUIC 2JGIA 3IBFA 2IU3A 1EZ4A 2X5OA 2GQ0A 1VL5A 2MSNA 2PMWB 3U3MA 3FOFC 5CYPA 5DT2A 4RVHA 1S8OA 4Z3OA 2C00A 4ITUA 4TUYB 2DR0A 1ZN8A 2H1WA 2ERXA 1MC1A 1JLLB 4KUHA 3O82A 2Z1NA 1DAFA 3EGWA 3IRVA 1J09A 4Z4GA 4BEJA 4QZVA 3VV2A 2PZBA 3CM0A 3CUVA 3Q3IA 3N2NA 3NRJA 3TNFA 3R24A 3VTFA 2ZE7A 5DULA 4WL0A 2VDKB 3K70B 4PC3A 5TMBA 3W3AH 3HDHA 4GPEA 2Q9AA 1KFBB 4BJ6A 1DBIA 1NJ6A 1ZIDA 3F74A 4I9NA 3H87A 4LXUA 4QEZA 5HIIA 3T5MA 3UHJA 1TAHA 1U9JA 1YCGA 3BMCA 1RCFA 3RUHA 4RNCA 3NDBB 1FP7A 1SUWA 2Q2VA 4MA5A 4F84A 5B3KA 3D8NA 1CVRA 4KXLA 2VXCA 5FPPA 1EHIA 2H3HA 4U2DA 4AY2A 3GLIA 5TJ9A 1GA4A 3GI1A 1FTNA 3Q10A 1QHFA 5JD5A 2WRZA 2O59A 3QF7A 4JJ4A 1N57A 2NZUG 3PFWO 2F8TA 3KEQA 1SVOA 3V55A 1CUEA 1V5GA 1FJXA 2E18A 2FX2A 1HKHA 4Y0AA 1UOOA 5CCXA 5CA0A 1XEWX 1OTYA 4ZYYA 1EWRA 2WAAA 5I48A 5BRJA 4FFWA 4LSWA 1IY2A 1KBOA 1XZPA 3O03A 4FBGA 1UKVY 2NO6A 2R62A 4KE9A 4KN8A 1OU0A 1G3QA 2EWMA 3SGLA 4DLAA 5KWEA 2YIJA 2XOKD 3GGCA 3CRVA 2A9QA 3TPFA 4A7PA 1CWUA 3FMIA 2A9PA 1B4DA 2HBZA 5IDWA 2C5AA 1Z26A 3A0UA 4G5OA 4JB2A 1G19A 4TVKA 2FV8A 2BSAA 4X20A 4V0RA 5FT9A 5HHTA 4UEQA 4TROA 2DWQA 1EVEA 4NYIR 2BIFA 4FFNA 1EFVB 1JLRA 4ESHA 2IT1A 3MJCA 4Q48A 2GCOB 5JMWA 2VSQA 4ZDJA 5CCBA 3G2HA 3M82A 4XVRA 4D0SA 2B2XA 1KJYA 3MJDA 3OX2A 3F6PA 2OFWA 3G2IA 4FDVA 4R01A 4V0LA 3UQZA 2AJLI 3BWVA 4KX3A 3HCDA 3RVLA 3ZLVA 4AZ3A 4CL3A 4RJTA 1SC4A 3G59A 3BVPA 3ZXXA 2XF8A 4RF5A 4TVOA 4YLGA 3FHLA 1L5MA 1FDUA 1QRTA 4LF9B 1RBZA 2YH2A 3GAZA 1RXEA 1EM8B 1QHYA 1C7JA 3CLSD 3QTBA 4DPMA 2V6MA 1GYRA 1L5RA 1WVMA 3FCUB 3HKCB 2QZZA 3NFYA 4I55B 4N03A 4WOCA 4AJ9A 1KMNA 2CUZA 4EGAA 5AVUA 4E94A 1MHPA 5CK5A 2AQIA 5EA2A 1OUMA 4UQLA 4LHVA 1OYYA 4YJGA 2H4XA 5E95A 1Y6QA 2ZRLA 5P21A 2OZVA 2JG3A 4P08A 1IMJA 3IT1A 3WLQA 1XZNA 3W2EA 4E32A 5HF5A 4OKIA 2CXUA 1H2AS 2BMAA 3K9BA 4HUQA 2JFYA 3NBFA 1V25A 3USZA 5K8LA 4V1CI 2O8BB 3KG2A 1FNMA 1U2ZA 2OHXA 4RETA 2VUTA 1BU5A 5EC8A 4WLNA 4ZJZA 3E35A 1YVDA 3TW3A 2AD1A 2JH9A 3L4EA 4L7VA 3D4LA 2UZIR 2QA5A 3M9LA 4R1QA 1GILA 3PYXA 2WIJA 3W4KA 3EP3B 1SO8A 3RC3A 2DEUA 4WX2B 1Q91A 4KGZA 3RAGA 1THTA 1EH5A 3BRQA 4UTVA 1B2LA 3DOIA 4EFDA 3HG7A 3IERA 3ZVMA 2H48A 3OEYA 4DZZA 2OCIA 2IIQA 3DDOA 3S6JA 5DNYB 5AK0A 3GL9A 5AKGA 4OP3A 3RJTA 4M9QA 5CFMA 3U4QB 3IAS6 2XGSA 1TD9A 2Y1WA 5CM9C 1FDRA 1B7GO 5CTAA 1JEYA 4MS1B 3KWMA 1SKYB 2GRAA 3JQ8A 4G9GA 4IXMA 1CUCA 1Z29A 2O1WA 2ZXEA 1PI3A 1SU7A 1N36B 3I1YA 4KQEA 1E6KA 2WA1A 1QBKC 2OZEA 3SLKA 2NZJA 5KUTA 4RTPA 2ID4A 4CEHB 1NNEA 3DE4X 4UFPA 2XKJE 3GVIA 1SUAA 2RJOA 1G8SA 1FNDA 2V7QD 4ER0A 1TZBA 3KJXA 4WWHA 1KF0A 2NO7A 3BIWA 2PIAA 1WV0A 2ZS9A 2GVZC 2ID9A 1DOHA 1ABEA 3JQ9A 2FPPB 4CV3A 4QUJA 4D0LB 1D09A 2D59A 2GZ3A 1C1YA 1ZBDA 5JDCC 1P2UA 3OTHA 2XRZA 3IEIA 4OK3A 5JS8A 2G9UA 3CUTA 4MYSA 5FPQA 5HFNA 1MRZA 3L93A 1ESMA 4AFNA 2B83A 3WG9A 5J5CA 6PFKA 2HCFA 4ME6A 2Z3ZA 4PCLA 5AJYA 4YUAA 3EK2A 4R2KA 3ZDXB 4KPUA 3T06B 1C3VA 4CKCA 2HF7A 1DFIA 2W98A 2C58A 3T7CA 1QGDA 4EX7A 1RXCA 5ITSA 4FSXA 1XLVA 1Y6RA 1T6YA 3G5AA 2HDOA 5EGNA 5ELLA 4E22A 1GQRA 1NAHA 3KB8A 3NFRA 5IVPA 2B5WA 2QLBA 1JT9A 3LNCA 3IAEA 1SXGA 5CVCA 2PLNA 1W5AA 2AE2A 1XZCA 1E5QA 2VNHA 2VJCA 3OEEA 4NAHA 2RK4A 5CVDA 3VOTA 4BCBA 4CMHA 2J59A 1R15A 2GCEA 3CNEA 1XP5A 5EJMA 1L9XA 3W2TA 3CBQA 4DQUA 1BMQA 2RK3A 2VL7A 3DLAA 4XPIA 4F7WA 3EP7B 4CLOA 2ZJ1A 1PSWA 3HY3A 1V48A 3SQOA 3UJ3X 4PLVA 3S2EA 1IN7A 5BXQC 2W58A 1FFGA 4LUCA 4PYKA 3D3QA 1FSPA 1LSUA 1UT6A 1AO0A 1CQXA 2HIAA 1NOJA 2UZAA 3B38A 4YAWA 1HQDA 1H8EA 1T34A 3L6RA 4JBGA 4NATA 4OFBA 4Z6KA 1E8DA 1JDVA 4ZVOA 2JIQA 1RRCA 1LW7A 4JEMA 3A14A 2PG3A 4C7OA 2X77A 3IQZA 2ZPTX 2UYGA 2VHXA 3H7IA 2XF2A 5ALRA 2MR6A 4E2XA 2JD2A 1ZXXA 2G1AA 5FTJA 5LZ2A 4YQYA 5ILGA 3KYBA 1G6KA 1XRSB 2G04A 2PS1A 3H6KA 1EINA 3BK7A 1G66A 2B4RO 1XNGA 1BOOA 1TQ6A 1VHJA 2Z4RA 1R4AA 1N92A 1EK1A 3JZMA 4FVTA 5E2AA 5FL3A 5BNFA 1E6CA 1N2GA 5AHKA 1B8OA 5CBPA 3I62A 4E11A 1ZS9A 2V98A 1KR2A 4BQFA 2QUJA 3FLEA 4DBVO 2F3PA 3W5HA 1GR1A 1M1YB 4G37A 3H0CA 2Q5EA 2ZIAA 1VYHA 2I4RA 4MVCA 3NT2A 3I5MA 3WK5A 1I94B 1CIVA 3QNWA 2VDQB 3DNFA 4YH1A 1D2EA 3WK9A 3QEMA 1QFJA 2RIRA 3KPJA 2IBTA 4KU4A 2PKXA 2NO1A 1JP7A 4I5DA 4RU1A 3Q3GE 3QSGA 4N0QA 1E7MA 2XIJA 2EOAA 2XT6A 3G5LA 3ZZTA 3OCCA 4EO7A 4ENWA 2R1UA 1R7RA 4DABA 1Z5UA 1M2OA 2IKQA 4HX5A 4R31A 1EFHA 2R6GA 1UDWA 1VZ3A 2Y68A 3KSRA 1KO8A 4WNAA 1QP8A 3VI4B 2CNNA 1JI0A 2GO1A 1K97A 4H08A 3KXLA 4IJKA 3DYVA 4QGSA 3VDQA 3PUIA 1PYGA 5JT1A 4YRDA 4JI8B 2ZI6A 3IDOA 3EIEA 5KDLA 1YU6A 5ALMA 5K45A 4YWJA 3V8PA 2ADOA 2MYUA 2RK6A 2HCBA 3ROGA 1NMEA 2ACEA 2W6ID 5AW6A 2GD0A 4ZCQA 4ZT4A 1K06A 1K7EB 3GZTB 4A16A 1O87A 4LC0A 1L4KA 2HDNB 4FGUA 5HW0A 2C92A 2VRWA 2I2WA 4EUSA 3C8MA 4XGNA 2AX3A 3O3CA 3NXSA 5A6SA 2FE1A 4OG2A 4OUDB 4RVSA 4F4IA 5F9FA 3TFWA 4D79A 3EARA 1ADBA 2D1TA 4WFKA 3JQGB 4BO0A 4QTYA 3RSLA 2Q3LA 1JEOA 4I5EA 4BUJA 3H9BA 5EQDA 1UDBA 3O3OB 1RKQA 2RH8A 3DZFA 5K8UA 3G9ZA 2ZM6B 2DQ4A 2IYEA 1SURA 3TLEA 3WGMA 1VOTA 1KO4A 2JIPA 4GZLA 4LG1A 1U9YA 1BN7A 1TYEB 4L0QA 4M86A 5EN4A 3ESBA 3LS2A 2KPOA 1UXKA 3PGXA 1ODJA 3BIFA 3O38A 1RP1A 1GLGA 4MO2A 4D81A 3NOQA 1EDEA 2YRFA 3A8TA 4QSHA 3LL4A 4XCQA 2QQ5A 1YZVA 5AUQA 2FFHA 2XDQB 1M0WA 3NNNA 621PA 1IBMB 1N2ZA 1P1IA 1Y9EA 1S8NA 2P9TA 1FSFA 4JBIA 3A6PC 4KMRA 2FMTA 4H6WA 1WF6A 5HIMA 1A5SB 4NDNE 3S8YA 2GPTA 3CY6A 3TZ6A 1U3CA 1NVVQ 4UDYX 2AZ4A 2N3ZA 1V1MB 2FN4A 3H1AA 3LAWA 4FW9A 2GKSA 2DBYA 3DE7X 5CU7A 1FYWA 1OVGA 3TXYA 1TF5A 1I7SB 2PGLA 4GSKA 2BGKA 3G6WA 2FOLA 2DF8A 2G28A 1ZNZA 1OBCA 3AC0A 3LY5A 2X7JA 2Q41A 3JARB 3DQQA 2JAXA 4MIYA 4E1AA 5JSQA 1DAHA 1J8FA 1GTL1 4ERNA 3IIEA 5L95A 4KPFC 3P26A 2VP2A 3P94A 3GLQA 1ZRNA 3BPSA 5HDQA 1QAMA 1LJLA 5G0UA 1RACA 3CLHA 1DCTA 1TA9A 5LYYA 5HCNA 4TLAA 1GG5A 3UMGA 3GVCA 3D3EA 2OXCA 1DLJA 4MUJA 5G4KB 1ISMA 1JG7A 2A0KA 2ZSAA 1Z5OA 3KO8A 5A02A 1PBNA 2JFOA 4OLAA 4IR7A 3K0FA 4BC1A 2Q9CA 4DDKA 1YK0A 1Y81A 2C0CA 3HZZA 2IHKA 1RWKA 4WGGA 4L8GA 2QTNA 3KYDA 4DREA 3RWBA 2Y1OA 1S8FA 1BCRA 1VIAA 2OCXA 1MEJA 3CIOA 1FFWA 1MRNA 1V8BA 1GCGA 4GWGA 5TJHA 3MLBA 2PZKA 1M76A 2YOGA 4P5EA 2P7IA 4AWXA 2OO5A 5FD8A 1PYDA 1CJUC 4N7RA 5HJEA 2FY8A 5J5AA 1LCIA 3D59A 1RQ2A 2GZDA 4AK9A 2RHHA 4EF5A 3E0QA 3QRWA 4NCNA 1OWNA 2NMVA 4D3SA 3E27A 3FDJA 4HRXA 2DR2A 3A4MA 3G8CA 1WLSA 1NLYA 1FNNA 3HV2A 3DTYA 1NMXA 3AOEC 1XDZA 1J5XA 4ZK2A 3B82A 4QA9A 1YOVB 3GLGA 1K1EA 1DKPA 2JFWA 1RKBA 3MWLA 3NDJA 3ZJXA 1Q3KA 2BCGY 3MBKA 1Z22A 5DM0A 5IMSA 2TYSB 3OZEA 4A0GA 4DPKA 3S7ZA 1HDZA 5LP6A 1XMIA 4TS1A 4J1TA 4YRSA 1FPMA 4MR8B 4CN9A 1KDPA 1PL0A 4CKWA 1XZHA 4ARVA 1XSEA 4F96A 1VJDA 3G13A 1G5RA 4R2MA 2OCGA 1Z06A 4GXQA 1P2DA 1WSAA 1U0SY 2FRDA 1A7JA 3COWA 3EDQA 3DH0A 1AK9A 4MA4A 1TPZA 4LXYA 3EBOA 2X3UA 4H7FA 4KNWA 1OLUA 1PBTA 4G65A 5JNSA 2XB9A 2E89A 2N9UA 3EGEA 2BMJA 3O84A 5EI5A 3T1VA 5K9ZA 1QIMA 3HCWA 1W5EA 3LT0A 2N1MA 3KT6A 1C1DA 4WSOA 4WVLA 4GIBA 5ERYA 3K6RA 3FH0A 3D2AA 3WJ1A 4E21A 5HBRA 3VNQA 4XOIA 2PQ2A 2FFJA 1I1OA 3GHHA 4OB8A 4W9RA 4E46A 2O8EA 4B7CA 3ZGOA 1Q44A 5AKLA 4DCOA 4ITVA 4XSHA 2GLXA 3HB9A 4MDHA 1BGVA 2YVAA 3K70D 4I8DA 4NNJA 3ZZ1A 3HYTA 1B0UA 5KTNA 3IR7A 3GT0A 5FBQB 3HDGA 1NUQA 3GUHA 2UVPA 3CZPA 1DOZA 2JZOA 3ELBA 1SHZA 2XUAA 1N6HA 3X1ZA 1VHTA 4PR0A 2VAWA 1BDJA 4RIEA 4BNZA 4DGQA 1R5JA 1II0A 2WM3A 3R40A 1R5BA 1SG9A 2GJAA 4R54A 3MXOA 5IM5A 3EPJA 3T9EA 2PZMA 3TR0A 3RQSA 2PGIA 5I9SA 4KV7A 1IEVA 1WY5A 1W85B 2OA0A 4ARSA 2OESA 1DX6A 3DMTA 3QELA 2PGJA 1UXGA 3CWZA 1QTRA 2ENWA 3P45A 1H93A 1YJBA 4BFTA 5A5FA 2GPSA 2G8NA 4JLPA 4D4GA 1HK7A 4PHTA 4MTLA 4BV8A 2ZI9A 3R0IA 3KLBA 1HE8B 4KYTA 4B3TB 1K5DA 3LBHA 2CWDA 3DZ6B 4Z4EA 1RW4A 2D0IA 4YUVA 2XIQA 5ER9A 3SXUA 1Z3CA 2V9CA 3L1JA 4J4HA 4MP8A 4OJQA 1E4YA 1WPRA 3AR3A 1UBUS 3KTAA 4KHZA 2QTHA 4M0UA 1ZHFA 4WK2B 1PIWA 3H2SA 4RD4A 3F3SA 4R84A 4V0OA 3OLWA 4ZO7A 3RFCA 2B21A 1EUDA 1SGWA 4WN9B 3SIXA 5C52B 1S2MA 4NFLA 2RHJA 1W0CA 1I4EB 2Q9BA 2Z2JA 3P52A 3WRXC 1PJSA 1TCVA 2EL7A 4UTNA 1T6BY 2OEPA 2OG1A 2VK2A 1H3FA 5AJHA 2A9FA 3EMBA 1LRLA 1F48A 2BN4A 2LKCA 2CYBA 3IILA 4J16C 4TGLA 5HTKA 5E6RB 3QEAZ 4ARZA 2IUSA 5B64A 1LLDA 2O0HA 4R4JA 1FX0B 3B6JA 3GFPA 2FUNB 4NPCA 4B4DA 1RLIA 1Z33A 3ESZA 3QTLA 5ALIA 3UN1A 3AJEA 2A84A 1TCBA 1NZJA 4M21A 1QKKA 2GARA 2OHGA 4QT4A 5TS3A 1G0NA 2JARA 3OE7A 3QP9A 4OYHA 4ZU1X 4LI0A 1JALA 2PZLA 4JVOA 4Q47A 4J9VA 3R3XA 4UBIA 3K9LA 3WIVA 2XA9A 4AKGA 1HQYE 2FUG6 4QHSA 3RYIA 1UBCA 4URXR 1L5HA 2I9KA 3QEMB 1JQKA 4D1YA 3JQ7A 1Z5PA 3HYLA 3H6HA 4IQ0A 4HXGA 1XK7A 4PYLA 4PZAA 1EAYA 2BMDA 4IJMA 4PM4A 1RBYA 4P5PA 5AQ1A 3UWPA 2HI0A 2RSLA 3UMBA 2ZB7A 3B51X 2HNAA 3PDCA 9GPBA 3IEVA 5K0ZA 3IDFA 4KOEC 4C6HA 1V37A 2OLJA 2XVZA 3PUXA 4P58A 5LDGA 5BMOA 4AUKA 5FA5A 4EHNA 3V4RA 3ONDA 1QRDA 2OUKA 2QX7A 2V54A 3FNQA 4CUKA 3DLPX 5BSHA 2DR3A 4X92A 3VYUB 4YUXA 1YQDA 2D8AA 2WABA 4GC9A 1XLWA 2WUWE 4MCIA 1JSZA 4BQOA 6Q21A 4RTMA 5DBFA 5LUBA 1WXFA 2HA3A 1RJFA 2IEYA 3R4CA 3H75A 5IARA 3DV0B 3OESA 1SC6A 1OGJA 1YC2A 2YOFA 3KQSA 1L5YA 5FLEX 2FRXA 1EM8A 4DCNA 1JQ5A 3RK0A 1RQ7A 2G63A 3HY4A 2L19A 3AG5A 4BMZA 2E55A 4E3WA 1K66A 4S24A 1WMSA 1WXQA 4Q7JB 3E1KA 1IUOA 2FWJA 1FRVA 2OK8A 3GEHA 4Z9FA 2V6GA 5GIOE 2O0JA 3WKDA 2GJKA 1XN1A 2PUCA 3V4SA 1SQ6A 5E7QA 4D25A 1CJVC 5JYAA 1QG0A 4IGIA 5WRFA 1JEAA 2CMGA 5K1ZA 5CLGA 4JLAA 4JXXA 3B3AA 1OLXB 2PAFA 2GBGA 4LYYA 1V26A 2IEAA 3DEHA 1W5BA 3L92A 3RUCA 5DHPA 3ICEA 1H6CA 1SA0A 4FILA 3CUYA 3LQKA 4CM6A 3GEBA 4BN5A 1IY0A 4Z0PA 4EMUA 2JCXA 2FOXA 2W2MA 2Q3JA 4FYXA 4MGIR 3EG9B 3WGOA 4FGLA 4QNNA 1ZH2A 3OT1A 3NALA 1JDZA 3AUYA 3UC9A 4MIKA 1U8FO 4HWGA 3K1AB 1XQ9A 3K8YA 4QRHA 2C8JA 4MP3A 3C14C 1FFSA 1E2FA 2VZ8A 3HNRA 4PPFA 3CLKA 1NVMB 2PSEA 2NU8A 3Q9SA 5ECYA 2YL2A 1DPGA 1P19A 3B89A 3HBMA 3K8QA 3L7DA 4G3XA 4QPJC 3Q8KA 2WW8A 1TU0A 4UMEA 1CTQA 4FHZA 3HYNA 1T0BA 1C3OA 5DI9A 4G2NA 4A0FA 1DG9A 5JVDA 1GGJA 3O9MA 3T4UA 3EOZA 4KWCA 3IMKA 4YXFA 1ESZA 2BFCA 1SWWA 2PD3A 3K0BA 3SEQA 4JASB 2CDBA 1DFHA 2I4IA 4RXTA 2DFVA 1CDOA 5HBGA 4KR9A 1Q0TA 4B47A 2R66A 1MX3A 1C2TA 4H4DA 4GKBA 3MQ4A 4LYJA 3N5CA 4MWGA 2N42A 4EHJA 5FWAA 2LTAA 1UWKA 3C3WA 1XTRA 2BFFB 5EZYF 1T24A 3USCS 5HIJA 4JGIA 3PFCA 4RYLA 1M7HA 1NMQA 4MVXA 2V9PA 2AN4A 1TRKA 3QI7A 2FEMA 3F71A 4H35A 4PAWA 3TSOA 2ZQZA 4RVGA 5IF3A 1ZVMA 2VDRB 3NRBA 3CKKA 1GNVA 4DE5A 2GHTA 3BN3A 2ZE5A 1LVUA 1M8KA 1EG7A 1V3QE 1GPWB 1JLLA 3PNLA 4L85A 5AW5A 3C3YA 4CLRB 3UW3A 2D5BA 4PQGA 4AZ3B 1ACMA 3VAYA 4KPYA 3IPCA 1Z5VA 1P31A 1DSSG 4UDOA 1XDWA 5TPZA 3DEJA 1PJ3A 2QQ0A 1O08A 3DZBA 1X77A 3V8NA 5ALPA 2CK3D 3VH2A 1RPAA 1FDIA 1YD7A 1GFSA 2NQ2C 2YYAA 4PSKA 2M2IA 1GLVA 1Y1RA 2HQBA 1KJQA 2I55A 1N7HA 4C4XA 3T1HB 4MK4A 2CXHA 3DHWC 4QQNA 1PFKA 1LWOA 3I39X 2JIZD 2YWEA 2YCLA 3V7YA 5AI9A 1ZAYA 4HN4B 2WG0A 3FCAA 3CUWA 2P9JA 4P31A 4ZO9A 5FNVB 3ZYZA 1MUUA 5FORA 1P6XA 2XWQA 4GRIA 1N2OA 1NP7A 1EE2A 4JLVA 1B6SA 5CT8A 1T3HA 3EIOA 2C7BA 1I2CA 1PFGA 1RRPA 2RG1A 4UBJA 3RVOA 5LP1A 3PE4A 1QV9A 1B42A 2X8BA 3Q2OA 1Q0RA 5EINA 1G8KA 4DLRA 4M9CA 3ZGZA 1C0IA 2O4UX 1EYZA 4B3HA 3GLIB 3BK2A 5GONF 1Z7GA 1MB3A 3W1WA 4C3OB 3D8HA 1QF6A 1IDOA 2AGVA 4L7QA 4YQEA 4EEZA 2MHCA 4I19A 2IP1A 1OASA 4Q1FA 4QBTA 4RXMA 1VE6A 3FF4A 4OGFA 4D8XA 1OFIA 2G5CA 3ZCPA 1DAKA 2UYYA 2G4VA 2YZ7A 4DNXA 2ZUVA 1BXZA 1JX6A 3GJXC 3MM4A 3NDIA 1NI3A 3HMQA 5CA1A 1POWA 4KXQA 3KDAA 1BMFD 2E82A 4YAIA 3IDAA 1X7WB 4OSOA 4AYXA 3FB1A 3SYRA 4HDQB 5CDGA 1NUUA 2F1IA 4KSYA 2I71A 3UJAA 3N2EA 2WWTA 3EEYA 4LDJA 1MZVA 4CMEA 1KZ9A 3LF2A 1Y3CE 1G5TA 4ZQIA 4UPDA 1YR2A 3LPNA 1ST3A 1VTKA 3WYAA 1NYQA 1P1HA 4NOJA 3CZ4A 4NFYA 4UTZA 2GVNA 5JZVA 4TMYA 3WMXA 1NNLA 4B2YA 2FSVA 4YA6A 3ZWBA 1EFRA 5HQ3B 1Y4AE 2J3EA 3GJQA 2JFHA 5J40A 3PWZA 2GN6A 1QZUA 2ZS8A 3ZGXA 3PR2B 4HWRA 5FBVB 4OQMA 3M6AA 3FOZA 2QBYB 4AKIA 2O3QA 2FMUA 1ZMBA 2VIIA 2ZIGA 1G21A 1FTWA 3A4NA 5G0SA 4J7CA 5HUHA 1YF3A 4DMGA 1TQ2A 4FCCA 1RZVA 4NOLA 1NW9B 2DM6A 4PICA 1L7MA 4CM9D 2BDUA 1O77A 1O9BA 2F3QA 2W11A 3LSYA 2VBFA 2UKDA 2PT7A 2AI1A 3VXKA 1KEUA 5FQNA 1FYXA 1BAPA 2DQSA 1QHHA 2IXDA 4BEWA 3OEHA 4FCVA 4WZBA 5C1OA 2EF0A 3RYTC 2FZ4A 3LC1O 1GPMA 2VHZA 2Q7XA 5FWNA 5IKEA 4Q1CA 5TX7A 2XQVA 4IMRA 1N0IA 3AHJA 3PS9A 4BNIA 4EG4A 5JY1A 3KJNA 4WBXC 5CEFA 4CZ2A 2G72A 2Z9DA 3BWMA 3L05A 4ZZIA 1Q5PA 1U0EA 3GGPA 3K9NA 3RYHB 1IE3A 1FP2A 4IYRA 1ZM9A 4KACA 4LMBA 3L0BA 3JQFC 4Y2XA 5B37A 1LFAA 5DHTA 4EBBA 3VPDA 1T2VA 3ICCA 3ITKA 4BLRA 1T4CA 4PN7A 3NGLA 4UM8B 5D1NA 5LQMA 1Z9BA 3GUZA 2JGLA 1BE8A 3BDVA 3U9LA 1CY4A 2X0JA 1A9OA 2OHHA 3AF2A 1PQYA 1J8VA 4TT3A 4A5SA 4BQQA 3I9MA 3DFZA 3NNDA 3EXHB 1S1CA 3KEMA 3M89A 2OPHA 2I62A 3WWYA 1XA4A 3A3NA 5EOVA 1E61A 4JB0A 1A95A 3KOZA 1TZ2A 3EUAA 1GZVA 3L8MA 3DBVO 2WDPA 3AU9A 1I2AA 1YFLA 4ZMRA 1QRSA 1SKUA 2ZJOA 4Q1BA 5JEDA 4QOJA 3S2GA 4CMIA 2XCRB 3Q6IA 2HMTA 4Q9HA 5F9HA 1A8HA 4PX5A 5KMGB 4JAVC 2AFIA 4ZWNA 3EQ7A 4FOLA 5ESRA 4GAEA 2ZGVA 4N48A 4JEHA 3PXCX 3UJ9A 3KQWA 4AJIA 3RTGA 4BO9A 1XZQA 1E2BA 3LJKA 2C2OA 2O8DA 4ZI7B 2G09A 4JFAA 3UJ7A 2DY0A 1TCAA 2BP7B 2QNRA 1IXZA 4LHEA 4O0LA 5A71A 3RYFA 2Z2IA 4MUYA 4RMJA 1BA3A 2RGXA 1NQVA 5AVSA 1SY7A 3ZIDA 3NPMA 1WUHS 4WT7A 4DSTA 3RKRA 2I3DA 4ECEA 1XTSA 1FEZA 4NMWA 3QIAA 3J7TA 2Y66A 5EP1A 3WRYA 2DP4E 4LQDA 3B3QA 1WZIA 1ULTA 2GN0A 4F1WA 1V2GA 4PIMA 3NKFA 2FRDC 1SCDA 1NE2A 3EW9A 2GERA 3REGA 3Q3VA 5H3LA 2FW6A 4HNQA 4CL8A 2VJNA 3G7NA 4CDGA 1ZFNA 3K9FC 3U2QA 3DDUA 1QH8B 4L0MA 1JN0A 1DBPA 2IYLD 2PYZA 4AS1A 1GTMA 4IIYA 4NXMB 1DLIA 1WDMA 4BX8A 4MWSA 1YB1A 3HB0A 3K6JA 2AXPA 1E5LA 1RYNA 3TDMA 4D8UA 1HNNA 1PF7E 1EJBA 2J3LA 2I78A 2VLIA 4WXEA 3A70A 1E1YA 3ILVA 2HW8A 3TMYA 3UCXA 1Z36A 2C59A 3MWFA 4OCZA 2OCDA 2ZIXB 3BBPA 3KB2A 1Z2PX 2QUHA 3O5AA 3X1XA 1JG4A 1Q84A 2CE2X 3GA7A 4GQBA 2IV7A 3EPBB 4A0RA 1HYEA 2BGRA 4JLNA 4Q9KA 2Y76A 2QF7A 4X1KB 2OZPA 4TZ6A 2J9FB 4YV2A 4XIYA 4AMBA 3C2QA 2JLCA 1M7BA 3A6GA 2CUKA 3LTEA 4YI3A 2G40A 3FUCA 3MA0A 2EP7A 1E3WA 3TAUA 1FB5A 2IH4A 4ZAGA 1NT2A 3AEUA 3W3AA 5JJBA 2VPPA 5KJEA 4J03A 4LOKA 2HBQA 2QOEA 3TQIA 1QLHA 1PQPA 4DCVA 4JXKA 2ICAA 4LV8B 3IKMB 5LMNB 3AM1A 3GD7A 1JPVA 1ZOOA 3DMGA 5REQB 5GVRA 3N2GB 1PT8A 2XXBA 2WNIA 4C7BA 1JEJA 3IDZA 1KFEB 4RBNA 3DF9A 3ZGLA 3G79A 1SOAA 2F3RA 1YDWA 2QL7A 3IAAA 1L7RA 2G67A 2XITA 5B2ZA 3NS7A 2C7QA 1HDIA 5H7XA 2B0CA 3A4IA 3AI7A 2FG5A 3EIWA 4GYWA 4QHYA 4V1CB 4G0OA 1FU4A 1UKCA 2IYXA 1O1YA 3CNLA 4MTCA 4DA9A 5GMOA 3F78A 4L95C 4XB1A 1PNTA 3ZHXA 5EJ7A 2EARA 4TMKA 3O8OA 1FRNA 1P91A 1Y5NA 1EWKA 5DI3B 2J0SA 1F17A 2X19A 2X76A 3A1VA 1H0KA 3BMOB 4YO8A 3JQGA 4TRNA 5AKEA 5FOVA 1UWCA 3WLTA 3AVYA 4CPDA 4YCAA 1VJ0A 4NEQA 5JNRA 3BRWA 4IIJF 2WG1A 1Y3HA 3G2JA 4HDKB 4KFTA 4YP1A 2OV3A 4LNUB 5ADUS 4GOOD 1IVSA 3ZH9B 3VOSA 3K4PA 2VDPB 4U7WA 3VSEA 3LD9A 4D82A 3LRPA 2P9CA 2C3MA 4MGYR 1AX9A 3JYNA 2O0KA 4XQ0A 4RD3A 3Q1LA 1VIVA 2ZAYA 5IJ9A 2B78A 4MJ3A 3EX7C 3OICA 4EF4A 4P4TA 4ZQEA 3AOGA 5ALZA 4EO4A 1LDGA 2WJAA 3DOEA 3ZX4A 1NVUQ 3GPIA 1TAUA 1N9KA 3UMJA 1V8FA 4LBVA 4BWVA 3KZNA 5TEVA 3VR6D 1J0EA 2OFOA 1IVYA 5M7EA 1TYCA 4PLZA 4TKUB 3DTVB 4HD8A 5ERGB 1L5NA 2OOKA 1I3KA 3HXMA 1IATA 1F3OA 4JIGA 1OZHA 1MDFA 1CKEA 3SS7X 1ZXBA 3WL7A 2XCTB 1ZUNA 5FWDA 4ZVUA 1P6UA 2IXEA 3ZEIA 3LLVA 3BB1A 1Z2OX 2VZEA 2A9JA 5CCEA 4HDMB 3LC2O 4WKPA 3X43A 2UXCB 4Q15A 1JJVA 1BZYA 4RY2A 1QKIA 3TIXB 2IHZA 2NU9B 4NDZA 1N5OX 3FUXA 3GP5A 2O1SA 4NEGA 2R1TA 4NMLA 3SDSA 1TO1E 4Y2JA 1FP4B 5C4GB 3EDYA 2IK8A 4Z0NA 4MVJF 1HLDA 3EOBI 1C41A 4KQXA 2XXAB 2X8AA 2WIFA 3JQBC 4PLGA 5CBPB 1Q50A 1J0AA 3ENQA 3MJEA 2ZBPA 4JJAA 4UJ3A 3QPBA 5EXXA 5J63A 3TEMA 1V11B 4YRIA 3CPHA 3ZI0A 1Q0PA 3ZQJA 3HKEA 5KVVA 3P9SA 2Q99A 5TQ0B 5A62A 3QKTA 1V11A 2RD2A 1UBMS 1MOPA 3AUUA 4S0XA 5BQ5A 5KWSA 1Z18A 4Q4AB 5DHSA 4RKYA 5E7IA 2D0DA 3OCXA 3H5OA 4UOZA 2BCEA 2PGXA 4R8VA 5EERA 3UBTA 2Y1LA 4D0RA 4GICA 5CD9A 2CYAA 3GEPA 1ZM2A 4BLOA 1BVRA 4WBNF 4FEEA 2IOFA 2A5GA 5ALNA 3ZLBA 4EDFA 1O0SA 5K0GA 5MN4A 3RSHA 3U7QA 4X6XA 1OX4B 4JD5A 2WU8A 4CF6A 2BTQB 3ODPA 4GSLA 3H9EO 2P27A 1NJ1A 5DSZA 1C3LA 1ZIXA 2UUPA 1PJBA 2OV4A 3CPJB 4Z3DA 4ONEA 2VCHA 5ENZA 4B3BA 3DE1X 2WFMA 4LXXA 4B8ZA 3I72A 4IKPA 1C8VB 2V9ZA 1LBSA 1ZI8A 3UICA 1E9DA 4OK6A 4QXPA 1QAOA 1L4FA 4XQCA 3ZD6A 4K9MA 1AMUA 1E89A 1C9JA 1U3FA 3TRIA 3GHYA 4XUCA 3T3OA 1V3UA 1CUYA 4LK2A 3AV3A 3K1YA 1KJNA 1ECGA 2EJCA 1IB0A 3P2EA 4K7JA 5EQTA 2G6TA 1R74A 5BWCA 4HYEA 5K6TA 4EY6A 3JALB 4MR9A 4D4IA 5JFTA 1T29A 1QB8A 4OXKA 1P74A 1SUPA 3QXSA 3VKVA 3H99A 1NUHA 1S9DA 1RKUA 3JAKB 3AFOA 4BFSA 1V9LA 4MUXA 1BXGB 2WKPA 3MINB 2YJ4A 4WESB 1NW4A 3ED5A 4R9SA 5KVQA 2AR0A 3NKLA 4ALKA 4R5HA 2QI9C 5ALFA 4B84A 1TTHA 1WA5A 3LWZA 4QPPA 2ST1A 4OLFA 4YJDA 3R0VA 3T4PA 1OH5A 4LF6B 2R2AA 3UQYS 1E5XA 4BASA 2QP9X 4NBSA 1TEVA 4P4SA 3HBJA 2H1HA 3F5QA 4MW4A 3KQNA 4CEJB 1OW3B 1HDCA 2LV8A 4OMUA 3I9V6 2A0UA 4E4RA 4XVQA 5LN1A 1K5GA 5KAPA 2GZAA 1LQUA 3MCTA 5KX5F 4KO8A 3BA6A 4HTAA 4LISA 5J1TB 2AE1A 1W73A 2WVJA 1S5PA 3S1AB 4KZPA 3UGQA 3KJIA 1JR3D 1VBKA 4WKNA 4JI3B 3QVXA 3WB9A 2R85A 4M4SA 4Q02A 4IIBA 4N82A 4C7XA 1W36D 3H2YA 3LT4A 4JC0A 4X41A 1ORTA 3H5NA 1RLTA 3LL7A 1UPAA 1XLTA 4UHKA 3JQ8B 4WEQA 5G0TA 3EXEA 4ATNA 4DLNA 1WP9A 1AXEA 1USVA 4FKBA 3CB2A 2Z43A 4H1UA 1IY8A 1WKBA 2ODEA 2WVAA 4W5WA 3DQPA 3RVMA 2ZU0C 4Y1RA 4Z7OB 4LJ6A 4LYAA 5DYGA 3PVCA 1KYXA 1QQ7A 1Z0SA 3D4PA 4L8VA 4MW2A 1GEEA 2Z09A 4FNMA 4D9HA 3CMMA 4I4TA 1I7NA 3DP9A 3IULA 16PKA 1H23A 4YO7A 1KJIA 1RRVA 4ZQFA 4A15A 1DG3A 2Q6IA 3K0CC 1CU1A 1VL6A 4QC2A 3LZCA 3RVSA 4KOAA 4C43A 2J0EA 3W2FA 5JYFA 3WB0A 3ZDEA 2NNLD 1NATA 1JB1A 4HKTA 1SK9A 3LCMA 4BECA 4ZYZA 1QR6A 1NN3A 1SU8A 2DKNA 1Z0JA 2V3WA 3BRWD 4FU0A 2GTIA 1U6IA 3PXUA 1G8YA 1RI1A 2IZ5A 2J5KA 3I45A 2H4WA 4AS2A 2C96A 4PYJA 1UXIA 4NCAA 4P53A 2WT8A 2FN9A 4QAQA 2QD4A 3OPVA 4HZGA 1AUOA 5EIBC 5E1DA 3E5RA 3QELB 2LVBA 4P84A 4TMZA 1VJ1A 5E9JA 1F2UB 2BEWA 4I50F 4OF4A 1FLDA 3ZUPA 3MHTA 4O0MA 3G0OA 1T8YA 3S68A 2JVIA 4YJGB 5LQJA 3JZFA 4D43A 1Q7RA 4QO7A 2HB6A 4A92A 2Z1DA 3VZBA 3M6FA 2JD1A 4BIIA 4BO6A 3AP2A 4JJ7A 5TS2A 1L7VC 2V7TA 3PHCA 3HKDB 4LZLA 1JSXA 2YN4A 3AV0B 3C3XA 2YTZA 4KAFA 5T6BA 4N6GA 1KMMA 5BXYA 2IHJA 3HKDA 1HTTA 2ZANA 4ROTA 3UFXB 1MIHA 3L6DA 3ANMA 2DVMA 2Q6KA 2V58A 1PTKA 3IP7A 4A3SA 5KOJA 2YN0A 2GYUA 3DOFA 2C4WA 1T0PA 5J9FA 3WGNA 4F04A 1NGSA 2VTBA 3RYFB 1BSVA 3QYAA 1T5DX 2OE2A 4OBXA 4YWHA 2AOXA 2LDXA 1WD7A 3X1WA 4TVBA 4WOJA 2Q8NA 1ZONA 2J41A 4ZI7A 5AM1A 1TCCA 2FQQA 5DGXA 1DC5A 1X8XA 1N2BA 3LY8A 3UT6A 1CJSA 1P62B 2GLUA 3O7WA 4S1NA 2J5RA 1MAHA 2JGNA 2WTEA 4MPPA 1PNRA 3HACA 4B17A 4NARA 2XQIA 4XIFA 4CMCA 5ADVA 4B80A 1JTEA 3KQYA 1ZUIA 3WAGA 3FBTA 2FRVA 3COZA 3T5CA 1J1ZA 1JR3E 3VOBA 2ZRKA 1ITZA 3OUUA 3GRVA 3O95A 4I14A 3V6LA 1V96A 3E3MA 1X19A 1U63A 3V4VB 2HU7A 1E2EA 4MRAA 4WLOA