1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
1WAMA 1UUFA 2RHCA 3ICCA 4XKJA 4EUFA 3ETGA 2NQTA 3AW9A 3DL2A 3PQFA 3L9WA 5FYDA 3GC6A 4NMHA 4XB2A 4D3DA 1FJHA 2DTXA 3CE6A 3PZRA 4MVJH 2FP4A 1NWHA 1VL0A 3OSUA 5T6BA 2JL1A 1J6UA 3ITKA 1K6IA 3RU9A 1H2BA 1KIFA 5DCWA 2HLPA 4GVXA 2BFAA 5I9MA 4W9NC 3DBLB 4YVFA 2NVBA 4XQGA 2NVUB 5A3JA 1LQTA 2W2LD 3GY0A 2I9PA 1HE3A 2ZB8A 2VTEA 1YJQA 2IYPA 3WMXA 4HP8A 3E5MA 5DN9A 2LDXA 3ZI0A 4A0SA 3KETA 5B4TA 2OGUA 1IHYA 3LT1A 1BDMA 1PGQA 4RZIA 3PHGA 1B14A 5CAEA 3PIIA 3Q6IA 1GFSA 4E2WA 4ZQBA 1GY8A 1Y8RA 2IZZA 4RVHA 3IL2A 1T1RA 1IL0A 2HCTA 4U5QA 3NDJA 4GAEA 1YB4A 4AJ4A 3KYCA 1IUKA 1ZO8A 4XGNA 5CDTA 1VSVA 3NTRA 3UUWA 4FCCA 2E37A 4IM7A 2BD0A 4MKRA 3TWOA 5B4UA 5KWEA 4IDFA 3VTFA 1HZZA 2G0TA 4R1NA 3WTCA 3WLEA 4BB6A 2FRDA 1EK5A 3EVTA 2R00A 3BMOA 4MKXA 4CL3A 3W4KA 1ZCJA 4YQZA 5C7LO 4CMGA 4E3ZA 2D4AA 2B0JA 3VZQA 4GI2A 1ZK3A 4WASA 1LRLA 3F4BA 2PZJA 2EWMA 2ZATA 4U6QA 3GPDG 2ZJ0A 1BXGA 3PHLA 2BFOA 1Y8RB 4J4HA 1DPGA 3WYEA 1KS9A 5GZ3A 3FNHA 3WX0A 2GGSA 3I52A 4K6CA 3GHYA 1TI7A 3KYCB 3S2GA 4CLDA 1E7MA 1T2AA 4E5PA 3H9GA 3DWFA 3GGGA 4TKLA 4XGKA 4NG5A 2YQ5A 2CDBA 3WB9A 4ZQGA 3IQDB 2DFVA 4WGGA 4PRLA 2LDBA 5JLAA 2NTJA 1ADFA 3DBHA 4W99A 3VZPA 2BKAA 3RBXA 4WPGA 2VYVD 3CKYA 2HJSA 3BMOB 1ENPA 2X9VA 2BGKA 2EGHA 4AJKA 1V35A 4BNNA 4ZGWA 4QTZA 3RBVA 6ADHA 3H7AA 2Y99A 1XHLA 4ESOA 1RM3A 4Z9XA 4MPDA 1K5HA 1BXGB 1OBFO 5G4KA 3UVEA 1Z74A 4E4YA 4BO2A 2OORA 3VH3A 3AOGA 3WDSA 1LSOA 1JQBA 1DEHA 2GR9A 3OHSX 3D5TA 3G1UA 3GRKA 3KEQA 3EW7A 1P1JA 2VWHA 4ZICA 1EUCA 3FD8A 1JTVA 4IMPA 1D1SA 2CDCA 3F47A 1X13A 2PR2A 3FNFA 3WQRA 3DBHB 3E5RA 4AL4A 3HN2A 2NUAA 2CF6A 2DAPA 5HTOA 2Y1DA 3QVSA 1E3WA 1UXGA 1X7GA 2C5AA 2RHRA 1X1EA 4K28A 5J23A 1KY4A 2NNLD 4BNLA 2Q2WA 1HE2A 2YDXA 4L8VA 3RFXA 3WGZA 3NTQA 3BTSA 2EJVA 2NLOA 4MDHA 4EI2A 4Z9FA 3R3JA 1E77A 4DPMA 3OF2A 4EEZA 3Q9UA 4R9SA 3JYQA 4EYEA 1FF9A 1SMKA 3DO5A 3H9QA 1YJ8A 5G0VA 1E3LA 5L45A 3WLFA 4IDDA 4JP3A 2AQIA 1NFRA 3P5SA 5T8KC 3TPCA 4GPD1 1Z75A 3PFFA 4DBZA 3AI3A 4NBVA 1EUDA 1JA9A 1PGJA 3L6EA 4PLFA 1ZSNA 1ORRA 2VQ3A 4TRRA 4EDFA 1E1LA 1GV0A 1HF3A 4PZDA 1LSUA 2HMUA 4DIOA 1NM5A 3HN7A 5JC1A 4JBIA 4HV4A 1K89A 4AJEA 1DC6A 3IP3A 1HDZA 1PX0A 4ND5A 1E3WB 2VUTA 3DHYA 3AU9A 3GZNA 3ZWPA 2JCXA 3LSYA 1PJ3A 1VLLA 4R68A 4FIZA 2NADA 4QT0A 4Y8VA 4J6FA 3CIFA 4ILKA 1B0AA 3RCBA 2GUGA 1A9YA 1N7HA 1ZXBA 2GO1A 4MO2A 5JYDA 2Y68A 4CODB 1EDZA 3D4PA 4DYDA 3WG9A 2GN9A 3ITDA 1LSSA 3U5TA 2GN4A 3A14A 4OOEA 4UVGA 4J16A 2PH5A 1P1FA 2JFFA 1ONOA 2R6JA 2YHUA 1I3KA 5K6AA 3JD1A 2RIRA 4TRJA 3P19A 4PG5A 1LLUA 3ZWCA 1N7GA 1U3TA 4RGBA 2RH4A 3E6AA 4J7XA 3ADOA 1VKOA 1LDNA 3JQ9A 4N18A 4CUZA 5JSFA 4ITUA 1WDMA 1R12A 4J4BA 4KDEA 4JX8A 2DU8A 2FR8A 2FY8A 1U2DA 4RF2A 4YT5A 1HSOA 3HDQA 3GZNB 1GQ2A 3A28A 5JXWA 1PZHA 1O94A 1E7QA 4L75A 4CL8A 1GUFA 4E12A 1F14A 4TSKA 3BTUA 3MOIA 4DPLA 1U4OA 1O0SA 2HMSA 1BXKA 4Q39A 2B37A 3QV1A 5F5LA 5LCXA 2VTDA 3TF5A 1T25A 3CZRA 4ALLA 1HEUA 4Q3NA 4NFSA 2B35A 4ALIA 5KVCA 1U5AA 4D42A 3VAZA 3MWEB 3W6UA 3H6KA 2IZ1A 2G1UA 1BG6A 5AQ1A 5EL0A 3AM3A 4JXKA 3LC7O 1PJSA 2ZB7A 3PGXA 3PHIA 1DBVO 1H5QA 3JD2A 4I5DA 2Q2VA 2D59A 4E5NA 5F3RA 1RWBA 3L6DA 4P38A 4EJMA 2ZB3A 4WLOA 5C7IO 1MV8A 4L4SA 2I66A 1D8AA 1ENOA 4WLEA 5JNLA 3E82A 4GX5A 2WE7A 4BUCA 5TGDA 2GLXA 3PK0A 5J9GA 2D5AA 4XYMA 4D3SA 3RI3A 1MG0A 2Y1EA 4FJ1A 1PJCA 3NKLA 3VPFA 4OXYA 1TEHA 4IQGA 3TL3A 4BNIA 4R51A 3TZ6A 3OFSA 4II2A 4DQUA 2Z95A 3SX2A 3SBOA 4QO8A 3ZV5A 5ITWA 3ZWXA 4R3NA 5I7SA 1DRWA 1K0UA 2VOJA 3LYLA 3HE3A 5L9AA 1ADGA 4J7UA 3RUFA 4HNHA 3E48A 2J3HA 3ADPA 3EAGA 3AFNA 4TRNA 4EITA 1E7RA 1E1KA 1GZ3A 1YBMA 2HRBA 3F1LA 5L7YA 3Q2IA 4MIEA 2Q1WA 2BI7A 3SJ7A 3IKTA 4LK3A 4BMSA 4CQLB 4FS3A 4Q3BA 3VKUA 1KETA 4LRSB 4A27A 4JK3A 4MVJM 5AOVA 2OBNA 1C1DA 3V1UA 1LDBA 1VKNA 1O8CA 1Y9EA 1H6AA 2JHFA 4MVJF 2PNFA 3MWDB 2Y66A 3U4IA 3WR5A 3ZU4A 1MB4A 4M87A 1BMDA 2FOIA 2AE2A 5JE8A 3VPHA 2EKPA 4ROSA 1FDTA 2O4CA 3RKUA 2VZ0A 3SJUA 4YBZA 5IG2A 2IEBA 1HE4A 2JKVA 3ENKA 4DBVO 4PG6A 3WNQA 3NT2A 4YYZA 3I4FA 4MJLA 3QIVA 4NHEA 4O6VA 4Z0HO 5TF4A 3VH2A 2JAHA 2EG9A 3B6ZA 4XIJA 1IYZA 3JQBC 1R66A 3MTJA 4DRYA 2C20A 2BHLA 5B1YA 4J0FA 2EW2A 2DTDA 3FNGA 4U0KA 4B4VA 3JYOA 2HUNA 2XAAA 3H8VA 3WBFA 1SC6A 1JKJA 2P68A 1U3WA 5AYVA 3F5SA 2H5LA 1PTJA 4PVDA 4MVJE 3GUCA 5DNAA 3NGXA 1UXIA 1KEPA 4J1TA 4XD2A 4GX1A 3HHPA 4BMNA 5JPIA 3TJRA 4LISA 3DC2A 4MP8A 4XJTA 3WWYA 4HFJA 2VWPA 5B4VA 4HADA 3H2ZA 3D4NA 4RPKA 5EPOA 4NPCA 4P22A 4YXFA 1KYQA 4QX6A 4A03A 3I23A 2VWQA 3PYXA 3JQFA 1U7HA 1W4ZA 3OMLA 5ER9A 3SLGA 1SB9A 2WD7B 3GA0A 4WEQA 1DRVA 1BRMA 2Y0DA 1VJ0A 2J8ZA 2Y0EA 1DB3A 4NNJA 3ZHZA 3V1YA 3GQVA 3PPIA 3DXFA 4BMVA 4D46A 1XGKA 1YOVA 1AHIA 2PKQO 3E8XA 4PIVA 5A1TA 3KB6A 3HQ4O 4FR5A 3TN7A 1JVSA 1YB1A 4XDYA 2VUSA 3K6JA 3PGJA 4BO4A 5IN4A 3EYWA 4II3A 4QO7A 3LT2A 3OQ1A 1PIWA 3S2EA 2FHSA 1AUPA 2O3JA 2X6TA 4Z0PA 3H5RA 4A2CA 1ZK1A 2X0NA 2UVDA 3ORFA 4NQZA 1IPFA 3PLRA 4BQPA 3DAGA 1CYDA 3NTOA 3OETA 1NP3A 2QZZA 1Q7CA 1EMDA 4W4TA 2O23A 3SC4A 1B16A 3T4XA 4PG7A 3G49A 1ISGA 2UUOA 5JW6A 4HUJA 4CM3A 1BDBA 1Y8QB 3ZH2A 3WJAA 4E21A 1BVUA 2WM3A 4JN6B 5DBIA 4AJOA 1WPQA 1XEAA 1YOVB 4OXKA 4BNGA 3FN4A 4TROA 2WD8A 1GQQA 3BMNA 4IQ8A 1ZSYA 5KKCA 1BGVA 4RPGA 2P4QA 1V6AA 1OC4A 4ONEA 4LMPA 4OOFA 4GKVA 1E0DA 3QWIA 3S55A 3F4LA 3HADA 4F6CA 2VNAA 4BKUA 4H3VA 2VHWA 1RKXA 1BW9B 5TX7A 1QSGA 2DC1A 2C7VA 3U4HA 1I10A 2OHXA 3AOEA 5ILGA 3SXPA 7ADHA 4IXWA 1YO6A 3HUDA 2OP1A 3DHNA 4CM4A 2AEMA 2Y1OA 4NFYA 1EK6A 4R01A 3W1VA 5A5EA 5A03A 4MIYA 5AXDA 4DGSA 3UW3A 3BHIA 4PLZA 4CV3A 4PLPA 3V2UA 4RLHA 1X1TA 4JLWA 4UUOA 5TT0A 4URFA 4ZU3A 4DYVA 1G1AA 3BMNB 4TWRA 1YE3A 4ID9A 2I3GA 5L53A 3D0OA 2YDYA 3JQGA 1ZEJA 1RM4A 2EJWA 3C1AA 4OAQA 1YGYA 4XWYA 2VCYA 2AQHA 5AXBA 2PH3A 5JMWA 3DZGA 4MP3A 4RDIA 1WLYA 2V6GA 3UKOA 3D5QA 3DEYX 4IJUA 2X8LA 2J5KA 4J1NA 2GZ1A 5IN5A 2YUTA 3TNLA 4UEKA 2FPGA 3GEGA 1ENYA 4ZN6A 2PGJA 3ON5A 4GBJA 1ARZA 2E82A 4BO7A 1H6CA 1A71A 2GCGA 4XYEA 3ZW9A 2HK7A 2V6BA 1BSVA 1Y5RA 2UUPA 1HLPA 4IIVA 3UICA 5U4QA 3VPXA 1FDUA 2GN8A 3RASA 1A9ZA 3JQGB 4KUEA 5KJEA 2VRBA 2BMAA 1DSSG 3DTYA 3CEAA 5HS4A 4IDCA 3INRA 3W8DA 5BSHA 2GERA 1HYGA 3KXDA 4RF4A 1YKFA 3TDKA 2O3UA 1PS0A 4OQYA 1O9BA 4BO5A 2NACA 4ND1A 4IBOA 2C59A 3RROA 2V7PA 4IJKA 4JNKA 2WYVA 2JFHA 1ZJZA 1VI2A 3F9IA 5JDIA 4IGFA 1B7GO 4CM6A 3WGYA 3F5QA 1HDCA 1LRKA 4XR4A 3DZHA 1Z6ZA 4KMSA 1U9JA 2I67A 1E7YA 2EKQA 5BSGA 4GKBA 4ZA2A 1SBYA 4NZ9A 5JFOA 1MC5A 5IZCA 1J4AA 3GG9A 3JQFC 3ZWAA 1A7AA 4TZTA 1MXHA 3OEWA 4D7AA 1YDWA 2PD6A 2VN8A 2HO5A 4A5OA 2EW8A 1UDAA 1HRDA 3AK4A 3KSDO 3C85A 1DFHA 4P4GA 2O2YA 5CDUA 2CDAA 4CMEA 1JLLA 2JFGA 3JD3A 2RBEA 3D3EA 3ULKA 3OBBA 1PWZA 1P1KA 5JYEA 1GU7A 3C24A 3QLJA 4ZVVA 5CG2A 1JAXA 1B3BA 3GAFA 1LBEA 5C5IA 4DC1A 2Q4BA 5MGBA 1GV1A 2YY7A 3B70A 3N74A 1F8FA 1UXKA 4GL4A 3DZFA 2B4QA 3WYCA 5THKA 4IINA 3ST7A 5B37A 1U8FO 2PA3A 4JCOA 3U49A 4D79A 4R3WA 3ONEA 3I9MA 1J49A 2DUWA 5TNXA 1X15A 3GNSA 1I3MA 4CR6A 4YJHA 2BGMA 2JHGA 3GFBA 3IS3A 4JGBA 4KP7A 1E6UA 4GLOA 3KYBA 1P33A 1CF2O 2WYWA 5A9RA 4LMRA 1ZMOA 3H3JA 5EQFA 4RPLA 3DBRA 5CHEA 5CDYA 4UVEA 1NWCA 4GH5A 1QXSA 5JO0A 4QUKA 4DC0A 2HK9A 4I9HA 4LSMA 5TJHA 3BA1A 5C3MA 5A5FA 5IDQA 5TRTA 4J49A 3FTNA 1N9GA 3HNPA 4B8ZA 3OJEA 3VPSA 4EW6A 3M6IA 1PL7A 4KZPA 1PR9A 2FSVA 2X9GA 3AOEC 3UFXA 4DLAA 1U3UA 3QVXA 1LEHA 2PZKA 2FZEA 1TLTA 1SZJG 3AM5A 2Q22A 1NVGA 2ZCUA 1U5CA 3EMKA 4J0EA 4YJHB 4AJ2A 4BO6A 5FI5A 1PL6A 3PIDA 1Z73A 4YT8A 3FWZA 3VZRA 1HDXA 3QVOA 1XKQA 3H9UA 1YB5A 3QHAA 4NU6A 1WZEA 2AW5A 5IJZA 3V5NA 4J7CA 4XX0A 4R1SA 1EVJA 1EBFA 4GMFA 1N9GB 4RO0A 2DQ4A 1LLDA 2QRJA 3K92A 5TJ9A 1KOLA 3RVDA 4XDZA 1MC4A 4UVHA 2E48A 1P1IA 3AFMA 4NH4A 1XELA 3LK7A 4RF5A 4HY3A 4L0QA 4M8SA 2A94A 1ULSA 1GUZA 5KTKA 5JYFA 4BKPA 4EBFA 4YR9A 1NAIA 4FFLA 3QP9A 3TZQA 1I5RA 3BAZA 2QG4A 2D2IA 3PDJA 4BQRA 3HWRA 5F1PA 4B4UA 3RUEA 1VL8A 3ZWMA 5C37A 4PLYA 2XXJA 4YAKA 5JY1A 4FFRA 1O89A 4F3YA 3LLVA 1LDEA 4BNYA 4OMUA 1KVTA 4PLWA 4NI5A 4DL9A 1ZK4A 1PJ4A 4JQCA 2X5JO 3ZWWA 5EERA 2YHIA 3WSWA 3WGGA 1MG5A 4Y6RA 3BIOA 3DB2A 1Q0HA 1QYDA 5I9NA 2OUIA 4N5MA 1ZIDA 4J43A 3MZ0A 4XRGA 2A35A 1V3UA 3I4CA 4CR7A 5I7FA 2IYOA 4IS2A 3DAPA 2PFGA 3RJ5A 4Q9NA 3CPSA 1Q0QA 3O4RA 4KUHA 4FC7A 5JY6A 4MVJP 4ZHSA 1KVUA 5I9LA 3QW2A 2V6MA 3G79A 3VDQA 5JCJA 1UJMA 3HG7A 4CV1A 3WFJA 1IHXA 1LNQA 1U8XX 1GUYA 4ALMA 2DLDA 1MFPA 4CLXA 3AU8A 1XQ6A 2EEZA 3DDNA 1I36A 3I9LA 3M1LA 3GEMA 2Z1NA 2ZTVA 4JROA 1B26A 3ETEA 3PLNA 5FF9A 1DIGA 2D5CA 2J5RA 3A9WA 1EZ4A 4WCDA 1R4NA 1E3IA 3Q1LA 1HKUA 2X23A 4J4TA 2CY0A 3T7CA 1HT0A 4PN3A 3OJ0A 3U0BA 1PWXA 4WLUA 1O95A 5G2OA 5MDHA 4G81A 5I7VA 4GX2A 1IE3A 2GNAA 4KWHA 5EIOA 3QVWA 5EESA 1RYEA 3R0IA 3Q3CA 2P9GA 3DHEA 4YJGA 2OFPA 3AUSA 1XG5A 1O6ZA 1J5PA 1U4SA 1SB8A 1I32A 5G4KB 4J2HA 4WLNA 1QORA 2QHXA 2F00A 1NVMB 1PQUA 3RUHA 4O63O 2XOXA 2ZJ1A 3M2PA 4CMJA 2YW9A 1NQOA 4I5FA 5A04A 1PR3A 1KVSA 1P45A 1PGNA 1R4NB 1TVEA 3MJVA 3VHRA 2G5CA 5A9SA 4PCVA 3AUUA 3OQ6A 1IY8A 3OH8A 3WJ7A 4XGIA 1K6JA 4AFNA 4A10A 3NJ4A 4R5HA 3OJFA 2IODA 2C7GA 4BB5A 2J5QA 3NJ8A 4B7XA 1F06A 4XZ3A 3TZKA 2JCVA 1PS8A 5AXAA 2VZ8A 2WJPA 4B4OA 2JAPA 3WXBA 4JIGA 1FDVA 3UH1A 1I2BA 3O03A 4DQVA 2D3TA 4ND2A 4Z0TA 5BSEA 1GZ4A 3ZU2A 1PQWA 5H82A 1Z7EA 1E3JA 3OIDA 5A9SB 2Q1UA 3HSKA 1FDSA 1WZIA 2I3AA 1A72A 4O5OA 1R6DA 4MOWA 1MUUA 4DIFA 4RQTA 2YV3A 3O8QA 2CSUA 2P5UA 2PD3A 1XWFA 1IPEA 4D0SA 4BHTA 1AXGA 4AJPA 5L7TA 1X14A 4RPHA 2DBZA 1GQYA 2JCYA 4G2NA 2J3KA 3GVCA 1O5IA 5KVSA 3EVNA 1NFQA 5TT1A 1NYTA 4AJIA 3GVIA 3PZBA 4CMAA 3U4CA 1WMAA 3MCVA 3UAGA 3D7LA 3BXXA 3NV9A 4DUPA 2QW8A 1VSUA 5FFFA 3ZW8A 4B3IA 4JJFA 3PHHA 3QWAA 1JVBA 1LLCA 4KDFA 2O2SA 3WOHA 3HDHA 4IMRA 4UEJA 4AICA 4IZHA 4FC6A 2POQX 1M6WA 2CMDA 2W90A 3ZGYA 1UP6A 2R00C 3JQEA 3Q9NA 1GYPA 1HWYA 2AG8A 4NK4A 2X9NA 5COQA 3L77A 2CUKA 1WNTA 4E2YA 3GRPA 2QIOA 4WJZA 4C7KA 1LRJA 4N5LA 4OXNA 1Y7TA 4PVCA 5K9ZA 4K9DA 4KTVE 1Y6JA 3I6IA 5TQVA 2VHVA 1LC0A 3WICA 4ZQEA 3ZNQA 3JYPA 3BTVA 1HETA 4OIMA 1L7DA 3PFWO 4BOYA 1C0IA 1DLJA 1OOEA 1UXJA 5L51A 1B8VA 3EGOA 5JAMA 3H2SA 1PL8A 1BVRA 4ZJUA 4BV9A 4ALNA 3PI7A 3RJ9A 3ZV3A 2QRKA 3WGIA 4QFDA 4E31A 3GN2A 2VHYA 4CMIA 5I8ZA 4E33A 4EUEA 5JDCA 5A4DA 2CZCA 5A06A 5L40A 2FR1A 4RZHA 1HYEA 5AVOA 1T2FA 5BT9A 5BR7A 2C82A 3OQBA 4ALKA 5U9CA 4Q3DA 3BTOA 3WWZA 3X2FA 3RC7A 1EE9A 3DZKA 3GN1A 1H9BA 3L4BA 1MXFA 4INAA 2P4HX 1N1EA 4JBGA 2C07A 2FPPA 3RC1A 5CPFA 4ALJA 3C8MA 1OC2A 4AJJA 3UCEA 2NSDA 2DTEA 5F5NA 3B1JA 3DOCA 2C54A 1EDOA 2PLAA 4KQWA 5ER6A 3H9EO 3KSUA 5KOIA 1KVQA 4EUHA 4J91A 3UGKA 2VZ9A 2AEFA 5TC4A 4D44A 3LF2A 1FMCA 1DJQA 3IOYA 4QXMA 3HB5X 3LF1A 5F1OA 1A27A 4U0JA 2Z1MA 3M1AA 1DC5A 1WDLA 4BKRA 2GZ2A 3SLKA 3GZ4A 4TQGA 2VT3A 4EJ0A 4YRAA 3DTTA 4HWKA 3MJCA 1PS9A 3NYWA 1WVGA 3GAZA 2EV9A 1F8GA 1SEVA 3HFSA 5IDWA 3G0OA 2W2KA 1T4DA 4QECA 3VKVA 3ZN2A 2Q2QA 4BGVA 4DVJA 3O38A 3LC2O 1QYCA 1NFFA 1C1DB 1I24A 4NU5A 1N2SA 3NEPX 3UOGA 1HTBA 3WGHA 2EKLA 1DRUA 2P2SA 3LQFA 4OL9A 1QYXA 4Y98A 4N7RA 5IDXA 3WGOA 1GADO 5IAAA 3JV7A 3P2YA 1H2HA 2ET6A 3PDUA 1JU9A 3V1TC 1LX6A 1P3DA 3ZNNA 3H5NA 3TQHA 4FFNA 3X2EA 5COBA 1S7CA 3ZDFA 5JC8A 3QRWA 4JBHA 1P77A 2JD1A 3U62A 3I9JA 5HWSA 1VJTA 4WUVA 1T2EA 5I8WA 2W2KB 3DZJA 3QY9A 1GZ6A 1OMOA 3ZCXA 4YEDA 3RBZA 3KHUA 4DLBA 4BO9A 2V65A 4CV2A 1JDJA 5CPBA 4J3FA 1V8BA 2RAFA 3S1LA 4DQXA 6LDHA 4CLRA 4IZIA 5K6AC 4AJNA 2HMVA 3MJEA 3B1KA 1D3AA 4J2OA 3C7DB 4OYRA 3MJ4A 3JQ9C 3L0DA 3CH6A 3QWBA 4RJTA 4KTTE 1SOVA 2HJRA 1IZ9A 3BHMA 2Y0CA 1E1MA 4OQZA 2NTVA 4GX0A 2Q49A 1EQ2A 2C2YA 3QSGA 4R41A 2TMDA 2UDPA 1A4UA 1LJ8A 1N8KA 4RV9A 5JO9A 1E1NA 5AXCA 3GEDA 1YQGA 1AHHA 2ZYAA 4RVFA 2CF5A 5EN4A 4XQCA 3K9QO 3PXXA 3AJRA 3GNQA 1GPJA 1W6UA 1AGNA 1ADBA 3ROKA 4CMKA 1UP7A 3M2TA 4BNFA 4MKZA 1DIHA 1QV6A 1UR5A 3D3WA 2Y93A 4YAEA 3E9QA 1E6EA 1H6BA 1WMBA 4RPJA 2ZTLA 5CG1A 4YRDA 3ROMA 4GQAA 3T7EA 2BF7A 1PGPA 2Y05A 4YCAA 2Q3EA 1DJNA 4J1SA 2W8ZA 3CINA 1A5ZA 1ZK0A 2WE8A 1G0OA 4ZQHA 3VVCA 5KKAA 5JAZA 1XU7A 3GT0A 3DONA 1QYVA 1XU9A 4A73A 4C4OA 1QR6A 4UUNA 4BKOA 5COAA 3F6YA 1R0SA 4YJFA 3K2BA 4FOSA 1CWUA 2Y1FA 1Q1NA 4R1TA 2GD1O 4J9VA 3L9XA 1GEEA 1SO8A 3K5PA 4BNUA 3QJ5A 4LW8A 4FN4A 2SCUA 4O59O 5THQA 2HSDA 1B8UA 3DOOA 4OGWA 5CEFA 1B3RA 3I3OA 4DMMA 1NX6A 3INTA 5FWNA 5EQDA 2PV7A 4W9NA 1YL5A 1BWSA 3VH1A 3CMMA 1X7HA 3CZMA 4BGUA 3FPCA 3GOHA 2VYNA 1VM6A 4IDGA 4E5YA 3ZZNA 1ULUA 1XDWA 3AUTA 3L4BC 4IPTA 3K73O 4MVJA 1A4IA 1D7OA 5DBGA 3WQSB 2VRCA 3TZHA 5DCUA 4CPDA 4CM4B 2OOSA 3PEFA 1E7WA 4PRKA 3PYLA 3K96A 1I8TA 4Q3CA 2VWGA 1T26A 2OL4A 3I5MA 3UF0A 5JCJD 5JBIA 1GD1O 4CM1A 4NFHA 1LXCA 4OO3A 4GVLA 1UZNA 3E1KA 3W6ZA 1I33A 4Z6KA 5CFZA 1DFGA 1VE9A 4L4RA 3PYMA 3L4SO 4YA6A 4PLVA 3QQPA 2PGLA 3FI9A 3IKVA 1DAOA 5B12A 5DOVA 1T24A 2DM6A 3R3SA 4BNHA 2G17A 4K26A 2FMUA 1F17A 4PLTA 3WTBA 1H94A 1QG6A 2QYSA 4JP2A 1K3TA 4ND3A 5DT9A 2Y1CA 4WLVA 3QE3A 4YDRA 2Q1TA 3QA9A 1GYQA 2CNBA 3OJLA 4Q3EA 4W82A 5HM8A 3EZYA 4OJNA 4XR9A 4N54A 5KJ1A 5T67A 8ADHA 4YJDA 1DOHA 4Z9YA 3MOGA 1AN9A 2RCYA 2DFDA 3PQDA 2AXQA 1M67A 4FBGA 4MVJG 2FR0A 3OP4A 1U28A 1Q7GA 1ZEMA 4OKIA 4OKNA 3S2IA 5GZ1A 4WCFA 4CJXA 4XYLA 2G82A 3JQ7A 3LZ6A 1PQPA 2V6FA 4AJLA 1Z82A 5JCXA 3HB4X 4R54A 2BELA 4NBWA 1Y9AA 1EUZA 4WE3A 4ZRMA 3ZWNA 4BS9A 1LA2A 4HXYA 4I5EA 4FJ2A 1EBUA 4L4XA 3KOUA 5IXSA 4JJGA 1U3VA 3DOJA 4R16A 4E2ZA 1SPXA 2GF2A 3H3FA 1E5LA 3JSAA 1OFGA 1XR3A 4WECA 3EC7A 4OM8A 3VH4A 4DLLA 4Z3KA 4UUPA 3KZVA 1KEUA 3WMWA 5KJCA 2Q45A 2W98A 5GZ6A 1CERA 3I9NA 1ZXLA 1LDGA 1LSJA 4PFJA 4YWJA 4N5NA 4OH1A 2YFQA 1HDYA 1HL3A 4K1LA 1UAGA 4Y67A 2OXIA 4M89A 3OICA 4WCFB 3JQ7B 3ZV4A 3FPLA 5JAIA 3Q11A 1GL3A 1FDWA 3V2HA 1UDCA 4CLEA 1KBZA 1ONNA 1NASA 3ENNA 1EFLA 2EF1A 2YZ7A 1TB4A 3HDYA 4UAGA 4BGIA 3WGTA 2B5VA 4D41A 3S8MA 3RUIA 2H9IA 4J90A 3TSCA 3AY7A 3GLQA 4QQRA 2ZIZA 4FB5A 4H16A 1I3LA 1VJ1A 2XXBA 1P0CA 4CV0A 3O9ZA 2O7QA 4ZRNA 3AI1A 1NNUA 2WWRA 1G6KA 1ADCA 1JW9B 5L4SA 1D1TA 3EK2A 3I9KA 2X7HA 4QEDA 3ROPA 4IGEA 1GDHA 5TSDA 5T8KA 5ENVA 3STHA 2I6TA 3B20A 3U4DA 3GFGA 4AJ1A 2X4GA 1LDMA 1TT5A 3W8FA 1YL6A 4IY1A 4GWKA 3E9NA 3ZWYA 3H4VA 2O50A 4IQ0A 2AQ8A 1QV7A 4A26A 2ZTUA 3KO8A 3ICPA 4PG8A 1I0ZA 2HAEA 4I1IA 1I01A 5G0UA 4YRBA 1KEWA 1ZW1A 4LSWA 1ENZA 5L3ZA 2WDZA 4B79A 5EINA 1GEGA 1ID1A 4K6FA 4D45A 3DQPA 3ANLA 3U3XA 4M55A 1CEQA 5BNIA 1XYGA 1T2DA 3I6QA 4HKTA 4BNVA 4EGFA 1MFZA 2HMTA 1EEHA 1JWAB 1M2WA 2PY6A 5I7EA 2UYYA 1V3VA 1ZVMA 3DBRB 4TRMA 1QYWA 4KQXA 1JKFA 3OEYA 4B3HA 4CQMA 5IZ4A 1B8PA 3FCOA 3FBTA 4RVDA 4XA8A 3RFTA 5BNTA 2O48X 3GVHA 3RC9A 4S3MA 3OJOA 4LVUA 3C3XA 1X7DA 2P9EA 3EUWA 2VHXA 2ZK7A 4U8GA 2HKIA 1PJQA 1TT5B 3RWBA 5G0TA 3AI2A 1NXQA 3TFQA 2X5KO 4WNIA 4IS3A 3AUAA 3KM0A 4UULA 2X58A 1C14A 3FSRA 2DVMA 4U6SA 4CMHA 3PWZA 4FGSA 2PZLA 2TMGA 4Z3DA 1V0JA 4L76A 3RU7A 1KVRA 2YYYA 9LDTA 3EDMA 3RIHA 3FNEA 1H6DA 2EHDA 3VC7A 3G1TA 2ZYDA 3VPGA 1NBOA 4XQEA 4RDHA 4MINA 4FQ8A 4UREA 3E9MA 4PG4A 4L74A 3FBGA 2Y1GA 3K31A 4DIBA 5GMOA 5U1PA 3WIDA 4CQMB 4XRRA 3OA2A 3UCXA 3BYZA 4BNTA 1C0PA 3MJSA 1PJTA 1YQDA 1S6YA 2DUUA 2PKRA 3PJDA 3RFVA 4A7PA 4WNCA 3NUGA 3JYNA 3WIEA 3FF4A 4DXHA 4XEHA 4YAJA 2AQKA 5C7OO 1RPNA 1R4MA 1U2GA 1E5QA 3QWFA 4LRTB 4W6ZA 4R9RA 3BZUA 5EMHA 4BVAA 1GTMA 3KBOA 2C0CA 5F1KA 1RYDA 4BO1A 1DAPA 1PJBA 3JQ8A 4BNJA 1JKIA 5T73A 2AEJA 3DMYA 1ZH8A 3SVTA 1NQ5A 2GRAA 4DA9A 1MX3A 1DDOA 2GN6A 4E0BA 5JDIC 3DFUA 4DWVA 2I76A 4QSMA 4FSHA 4ZQFA 2WTBA 3TZCA 4FD3A 3VOSA 5IDYA 3ZNOA 4BO0A 1A7KA 3S2FA 2NVWA 4CUKA 3IAHA 3NT4A 2VT2A 2FN7A 4GSKA 5LDHA 4NJOA 1X0VA 4W7IA 9LDBA 1YWGO 2B69A 3TL2A 2AE1A 4WCFC 2YHIB 3CMCO 2NQ8A 4M1QA 1F12A 3TRIA 1DC3A 1XLTA 3AM4A 2EGGA 2Z5LA 1ZK2A 2AHRA 1QKIA 3NDRA 4XYBA 2HMWA 1Z45A 5IZCC 2Q99A 1VL6A 2BH9A 2X0JA 1R4MB 4XYGA 1ZUD1 1JAYA 2I65A 3ETDA 3GVXA 1YXMA 4CM8A 2YQ4A 2DBRA 4WOJA 1PJ2A 4F45A 2YV1A 2HDHA 1GPDG 4M86A 1VPDA 3JQ8B 1E6WA 2A9FA 3RUAA 4BNZA 5HS6A 3IDSA 3GGOA 4CMEC 1ZFNA 2J3JA 3CXRA 5ICSA 1WDKA 2ZQYA 3PWSA 1SOWA 1FXSA 3I9OA 4DREA 4OSOA 1NQTA 1ZNQO 1QMGA 1XCBA 5JYAA 1AXEA 2OZPA 1WW8A 3PTZA 2BRUA 3F1KA 5T57A 1YL7A 2W4QA 3C1TA 5IFLA 4XB1A 2O4UX 3G17A 1DO8A 1CQIA 3JQBA 2PK3A 1RM0A 4CM8B 3D1LA 4YT4A 3AWDA 4R1UA 4WOKA 5DBFA 2BGLA 2R2GA 3TFOA 1UDBA 2AA3A 3GG2A 2O3QA 5DP1A 1NQAO 3QWHA 3E03A 3ZWVA 2IRWA 4IIUA 4YB8A 3W4IA 1V9LA 1XA0A 3VDRA 4YJGB 1E3EA 4BKQA 2IXBA 1NHGA 1EQUA 5TLSA 2IE0A 3DZBA 3MEQA 1ML3A 1R37A 3GMSA 3IIEA 3DBVO 4UVIA 5G0SA 5ITVA 2FZWA 3SEFA 1P0FA 2O3TA 4B8WA 1K6XA 2C2XA 3JQ6A 4FOOA 3C7AA 5DCYA 3IC5A 4FDAA 2Q46A 4I5GA 2EP7A 5H81A 3WS7A 1P9LA 1OAAA 1MLDA 2X0IA 3KTDA 3OIGA 3VVBA 3QVTA 4HNGA 4GGPA 5G4LA 1YQXA 2B36A 3JCZA 3PQEA 1ISJA 1MP0A 2Y67A 2IXAA 2PD4A 3RQSA 4BNWA 3JQAA 3FR8A 1LUAA 1JN0A 1YH3A 1HYHA 3ZHXA 4AG3A 4UEOA 2NWQA 1CQJA 4O1MA 1ZZEA 2H1SA 4Y9DA 2AMFA 1HDOA 3KLMX 1PU2A 4GMGA 1C0KA 2J3IA 2PZMA 3ZV6A 4E13A 5DF1A 3W8EA 4MVJI 3A4VA 4BO8A 1XQ1A 4I9UA 2CVZA 1LLQA 2A92A 3ZWBA 4CM9A 1M75A 4IXTA 4NBUA 1RJWA 3IUPA 3DR3A 3WSVA 4P8RA 4I08A 3K2EA 4B3JA 3ANMA 2PWZA 3DAFA 4L73A 5TS3A 4RL6A 2O3RA 3L6OO 4FFMA 2P5YA 2VYND 4G5HA 2FSSA 3GGPA 3FTPA 4CMCA 1IZ0A 1E7SA 1PZFA 1IB6A 5KJFA 4DPKA 2GSDA 3JQAB 3O8QB 3U09A 4B7UA 4MVJD 1HE5A 4MP6A 4P4NA 1CRWG 2C29D 2VRCD 3ONFA 3T4EA 2VNSA 4F6LA 5KJ6A 1P31A 4E5KA 4DMLA 3RAJA 2J6IA 5K0ZA 3ABIA 5LDGA 3FRJA 1K2WA 2GDZA 5L95A 1CDOA 4PZEA 3PJEA 4BNKA 3DZIA 3WGQA 1ZBQA 3BMCA 2E49A 3D4OA 3NAQA 1EVYA 2W2LA 4FGWA 4WLFA 3UN1A 1YS4A 3DMTA 1DHRA 2JJYA 2OP0A 4NIMA 4BL5A 1PJLA 4D43A 3KV3O 1J0XO 1M6HA 4CQLA 1B2LA 1DLIA 5DULA 3LC1O 1DIAA 1T4BA 4NBRA 3A06A 1TT7A 5DDIP 1HLDA 3GMDA 2PKQP 5KCZA 1ISMA 2AG5A 3LT0A 2HU2A 1I2ZA 1NAHA 1P74A 3ASVA 4H15A 2RH8A 3GR6A 4IDBA 3V2GA 2QZ9A 5A05A 1NR7A 2VUUA 4ND4A 3JD0A 2B5WA 3WBBA 4CR8A 2GYYA 5CDSA 1EVZA 3F46A 1P1RA 2YFHA 3EHEA 4I8XA 2NM0A 3R1IA 2EXXA 1ZJYA 3BMCB 3RUDA 1N92A 5A3VA 4D3FA 1DC4A 2BLLA 3VTZA 1XSEA 1DIBA 2NU6A 2WSBA 3MTGA 3OIFA 1P44A 3HZZA 1KEVA 3CUKA 8LDHA 3LLSA 3N7UA 3PVZA 5KIAA 3NT5A 4CMIB 3A1NA 5KVQA 1UXHA 3N58A 4GLLA 3MJTA 4OSPA 4PGFA 5DZSA 5GY7A 4AJHA 1EVIA 2NV6A 1PEDA 2ZKLA 1UAYA 1TA4A 3JQCA 1DIRA 1NTOA 4L9RA 1E92A 3HFGA 2PGDA 3DFZA 2WMDA 5CEEA 5LC1A 2HRZA 4NBTA 2GZ3A 4D0RA 4R4JA 1UZLA 3AY3A 1U1IA 1GAEO 3E18A 3UXYA 1HXHA 1W73A 4R5MA 3FR7A 2ZCVA 4R69A 1EE2A 3GVPA 3IJRA 1BHSA 1NPDA 4PZCA 1B15A 5IF3A 1VRWA 3ROQA 4M49A 4TZKA 4KOAA 1D4FA 3EZLA 1ZMTA 1I30A 2EERA 2X22A 3FWNA 4RLSA 2VYVA 5DP2A 1ONPA 1Z7BA 1NVTA 1T1SA 4NJMA 4NK5A 1PZGA 2E4AA 4EJ6A 5T64A 2WD7A 3GDFA 3UCFA 1LDYA 2ILTA 2UAGA 1UZMA 3K8ZA 2WEKA 3GNTA 1T2CA 5ENDA 4M54A 2QX7A 5A02A 5KNLA 4YPOA 4WK6A 4J1QA 1NPYA 4CLOA 1C3VA 2BFMA 1NPTO 3Q0EA 3TOXA 2P9CA 5L7WA 1HDRA 1YBAA 1QLJA 5FEUA 3PHJA 4XJSA 4FPXA 3COSA 3IJPA 2CD9A 2DT5A 4YAGA 1AE1A 4KUGA 1N1GA 4XQ9A 3KVOA 4GGOA 5DOZA 2HK8A 3JD4A 4BO3A 1ISIA 2X0RA 1JWBB 3WQQA 2GASA 2WYUA 3NRCA 4NJMB 1ZKMA 1MA0A 3GK3A 2H63A 1L7EA 4KWIA 5HA5A 1UP4A 4WEOA 5F21A 2Q50A 1H0KA 3KLPX 2IZ0A 2IDZA 1WWKA 2D8AA 3F3SA 4LN1A 3KUXA 1Y8QA 1HZJA 1YDEA 4S1VA 1BXZA 4CLOB 5ADHA 1LC3A 4E30A 4E5MA 3JTMA 1TXGA 1NHWA 4G65A 1R0KA 4EZBA 5CEJA 4TVBA 1F0YA 2DBVO 1P1HA 4P4LA 4YTEA 2YJZA 5BSFA 4IUYA 3LU1A 4PLGA 2GPTA 2VHZA 3OECA 4CLRB 4EEXA 3PJGA 1PZEA 1LQUA 2CFCA 4CQMD 1IULA 1BW9A 4UUMA 3ZU3A 1W8DA 3NGLA 3ZNPA 4LVCA 3ONDA 4TKMA 3TOZA 4B7CA 4YAIA 4RCVA 1IOLA 3PP8A 4FW8A 2I99A 1YBVA 1G0NA 4RVGA 3R6DA 3Q2KA 1PSDA 3ASUA 1LTHR 1M66A 3L07A 1R15A 4FFPA 2Q4EA 4TVOA 5CDGA 2D1YA 1Q2XA 1R16A 3B1FA 4IDAA 2DPHA 4W7HA 1H9AA 1Y5MA 1CJCA 3GUYA 5BNFA 4CMBA 4TMFA 1M76A 1Q7BA 1KERA 1WXDA 2CVOA 2QQ5A 2BI8A 3RUCA 4RORA 1VC2A 4LGVA 4F46A 5T5QA 3INGA 3DMTC 4HFRA 3K30A 4X54A 4XCVA 4XIYA 1Q0LA 5ES3A 4E32A 1X0XA 3BMQA 4BNXA 5HBRA 5FI3A 5JAQA 3D3WB 3CSDA 1DHTA 2X5OA 3ZHYA 3WFIA 5JDCC 3RSHA 2XPCA 2ZQZA 2H6EA 3PWKA 5H83A 4CM5A 7MDHA 4WKGA 2D0IA 3SC6A 2X86A 4NDNE 4HFMA 1ISHA 3P2OA 3OM9A 1OZAA 2EP5A 2ZB4A 4JJIA 4YJFB 3KEOA 2NU7A 1GCOA 4HX5A 1Y1PA 2OBYA 2OMEA 1H93A 2P91A 3GPIA 4NR0A 3ZWOA 4E2XA 1KC3A 3KYDA 3LT4A 3U9LA 2O7SA 4CLHA 3GF4A 4YQYA 2NU9A 3NX4A 3NDIA 5L4NA 4J9UE 3D64A 1C1XA 3BMQB 5A9TA 1SCUA 3I1JA 1EFKA 2B4TO 3H5AA 2DKNA 4E6PA 2JD2A 3UHAA 1SAYA 2QYTA 1Y81A 2OO5A 3WYBA 1DXYA 4RVSA 2BFPA 4Q3AA 2FWMX 2XF8A 4IJWA 2G76A 4RVUA 1KC1A 3O26A 1ISFA 1GR0A 1N5DA 5EJ2A 3PRJA 3WNVA 4FFOA 2Q1SA 5KVVA 2NU8A 1SNYA 3KRTA 1XIVA 3KYDB 4FJ0A 1CETA 2A4KA 4C7JA 3GDGA 3C7CB 1C1XB 3CTMA 2FPIA 1R0LA 2JD0A 1CIVA 4GSLA 1RM5A 1HSZA 2ZYGA 3IUSA 1W0CA 5ILOA 5G0WA 1KY5A 4U7WA 1OI7A 4GWGA 3OA0A 3HDJA 4O0LA 1QRRA 1LI4A 2UV8A 4BGEA 1YONA 4H7PA 3V8BA 5L4LA 3GDOA 3I83A 4BIIA 4HBGA 4Y6PA 2C5EA 1GCUA 3H65A 4BV8A 2B83A 3C1OA 2CVQA 1LU9A 5BQFA 3IMFA 1DFIA 2EIHA 2B4RO 1MGOA 4PLHA 5CP8A 2ZTMA 5IXYA 4YT2A 1FK8A 4QFCA 1GYRA 4RF3A 4DTIA 1WP4A 3BHJA 1C0LA 4PLCA 5TIIA 4CUJA 3ANNA 3RD5A 1I3NA 3VZSA 1YVEI 5JMPA 1PGOA 5M6DA 2VOEA 3G3EA 3GHHA 3LDHA 4ZD6A 1E3SA 2NTNA 3IP1A 4MIOA 4IJVA 5HRUA 3PJFA 3ZHBA 4LCEA 4YACA 2I5PO 2HQ1A 4UVDA 4Y6SA 1QP8A 3JQAD 1YRLA 3JQDA 4IDEA 2IEDA 3EY4A 1ZSVA 3W4JA 4CM7A 3KSZO 2F1KA 2DPGA 3HJAA 2PTGA 2O3SA 2QRLA 1QLHA 2E6UX 5ICMA 3LVFO 1I2CA 1UH5A 3H9JA 3AY6A 4B4WA 2YV2A 3FHLA 3GH3A 4LCJA 3RC2A 4BNMA 3RKRA 1L1FA 2DBQA 3DBLA 4OHUA 5JS6A 1HDGO 4RQUA 1NR1A 3P7MA 3ZU5A 4CM9D 2X1HA 2NVUA 4AVYA 3JYLA 1BTOA 4HFNA 1SEPA 4I9NA 1V3TA 1U7TA
chains in the Genus database with same CATH superfamily
2YZ2A 2QY6A 4KXYA 1WAMA 2PZAA 4PSAA 1BFKA 1NQWA 5A4IS 3TM4A 1I7DA 3DL2A 2HT6A 5FYDA 1JV2B 4NMHA 4TSFD 3RTAA 5IBCA 5IX8A 2GPAA 3MN1A 3PFCA 1A2QA 2H4YA 4L3WA 2EFEB 2FP4A 2JLVA 1NWHA 4XWOA 2IDMA 1J0BA 2VKTA 5TPZD 5SICE 4AN0A 3X1DA 4DUGA 3I3SR 4DE5A 1Z4KA 2AN4A 5KEIA 4LJRA 1H2BA 4OMFG 5TEWA 3AKEA 2XKJE 1VSQA 1OHHD 1U5BA 2B61A 4H1HA 4LDNA 3EDQA 4W1RA 5I9MA 3BWBA 3ZDAA 1ZIPA 3V2IA 5FWYB 3NNDA 1GGKA 3QG1A 3WYAA 1EX9A 1OX4B 2F3RA 1I94B 3T7JA 2IL1A 4OIFA 3PUWA 4AS3A 2XXAA 1PT6A 3PF9A 2J4DA 2DR0A 2JLZA 5JT1A 1R8JA 3CCBA 4KRGA 2AMJA 1FP1D 1DJMA 2ZB8A 3TNYA 4A2QA 2VTEA 3WMXA 2IYPA 3H17A 2YHAA 5F77A 1XTVA 2I8CA 1KYVA 4WXPA 3ZQ6A 4TSKA 2OGUA 3COZA 1IJBA 4HPJB 3RUPA 3OQNA 1B14A 3TV1A 1WJGA 2I4LA 3OY2A 3OFKA 3PIIA 5LQSA 2Q62A 3WP1B 4M0MA 4CCSA 4BWFB 2JS7A 2OLKA 3FCXA 4JH0A 1BJKA 3K1YA 4RVHA 3BUSA 3W5IA 2HCTA 3VBCA 1UPFA 4U5QA 3C6KA 1N0HA 2P65A 3C6QA 3TQTA 1IUKA 4RHTA 2D0OB 4XGNA 4HGQA 5JQWA 3NTRA 3UUWA 4RJJA 1QHIA 4BU1A 1Q2UA 3QYPA 1RTKA 3CUSA 4HR7A 2BD0A 4JS0A 1NE7A 4F6RB 1EI9A 2HA7A 5FPYA 3I2HA 4XH9B 4N7MA 1I13A 4GM4A 2UYCA 1CK4A 4DBLE 2QMQA 4BB6A 1JHOA 1EK5A 1L5YA 1M1YE 4JQOA 3OURA 5AJUA 5TE9A 2GTHA 4A8JC 1FVHA 2R66A 3BMOA 3ZK7A 4MKXA 1KKUA 3SF8B 4EZEA 3COJA 4YQZA 1KI6B 4MH0R 4CMGA 1WPGA 1L7VC 4BWVA 1XI2A 1WRBA 2GF0A 1HOTA 2VJMA 4MUBA 5LP6F 2G8LA 1ZJWA 2QUJA 4K9SA 2DYKA 2EWMA 2ZATA 1YA4A 4HYQA 5K8CA 3T5AA 3EPHA 2PIDA 2ZJ0A 4L5AA 4C6SA 2ODEA 5IU6A 1Y8RB 2AZDA 1Z29A 1XX6A 1QGUA 4J4HA 2VJYA 3K6SA 4CNQA 2KHZA 3P2MA 4IH9A 5DSXA 1OJLA 1T9DA 2J9ZB 2P79A 3F3KA 5J9FA 2WWYA 3NM4A 5H3CA 3FFBA 3QOFA 1U28C 4E5PA 4FBLA 4TKLA 4EYOA 3FVRA 1QC5B 2CDBA 3HDTA 3MAAC 4PYIA 5DKFA 2O2XA 2HWXA 3IQIX 4GZ5A 4PRLA 1RLMA 3IKJA 1DWQA 2B25A 3M5CA 4NONA 5DJ5A 5JLAA 4R31A 4RPIA 4KWEA 2F48A 4FYHA 4YLEA 2O0JA 2QUAA 3R3HA 2PE5A 3CKYA 1W59A 2Z2ZA 3EODA 3TGPA 2EGHA 2WIBA 4GM0A 1V35A 4LHEA 1JHYA 3A0RB 3QEBZ 5D86A 3OG9A 4UKDA 3OKCA 1ZPDA 3FUVA 2EWVA 4K87A 4IDPA 5J2UF 1GA6A 2QU7A 3GPLA 2WG2A 1OBFO 2FMKA 3IAXA 3UC9A 4DB2A 2X4DA 5ANRB 3UB4A 4AI6A 1T13A 1Z7WA 3TAUA 3HDVA 1U0BB 3OZCA 1MO2A 1WDTA 4Y2PA 4U7PB 3IPRA 1L2TA 2IIPA 3WDSA 1Z4IA 5HOEA 3KT0A 1LSOA 1JQBA 3A04A 2X0EA 3OHSX 2VNHA 1YIAA 5FOUA 5CDHA 1P1JA 2P4UA 3OCWA 4ZICA 1JTVA 5JAZA 5DASA 2BL4A 4QRIA 3WK9A 4DFDA 5K05A 4KKVA 2RK6A 1E2JA 1MCZA 1TM5E 2YXDA 2YNMA 3AR8A 3AQIA 3Q9SA 3OESA 4AL4A 4UAJA 1AQ6A 2C03A 3EPLA 2ZIXB 3MAGA 1L0BA 2Y1DA 3VFDA 1E3WA 3ZIAD 1T9BA 2C5AA 2FWIA 2RHRA 2NSLA 4HZIA 4ZCMA 3NO4A 3M4YA 1KY4A 2F2TA 4BNLA 4NPAA 5CITA 1H8HD 3TG2A 3N2YA 4XUGB 5LA6A 1HE2A 1G3MA 4L8VA 4RTKA 1MAAA 4KRFA 3ELBA 3F67A 3BTSA 3NANA 3IVCA 5GONB 3K0FA 4MDHA 3K2IA 4HS4A 1SXJE 2WTNA 4EEZA 3PQ5A 3Q9UA 1FF9A 1SZPA 4A8HA 1IATA 4JEUA 3WLFA 5FBLB 4B82A 1K5DA 2AQIA 2JBAB 2X7XA 4NEQA 3RABA 3L7MA 2BW0A 3EZGA 4CCYB 4FOTA 4YLYA 3LW8A 3CSSA 8ATCA 1ORRA 3CLTD 2GOYA 4ZYTA 4GPIB 3VRHA 3ZVRA 5E7MA 1LSUA 4RTRA 2R11A 1NF2A 2JFOA 4MO9A 4Q48A 4H1WA 4HQ0A 2BN4A 4HV4A 4MLPA 3PFHA 1OLSA 1DC6A 1ILWA 1HDZA 2IYVA 1R4AA 4ENTA 4Z1MD 3NOVA 3DUWA 2JC3A 2AR0A 1JU4A 4BQFA 1A9OA 3KPVA 3ZY5A 4R68A 3V7WA 4QTXA 4FIZA 2NADA 2PCLA 4Y8VA 3A1SA 3S1AB 3CIFA 4ILKA 1BDHA 1B0AA 2WUFA 3HPQA 4C7VA 3MGGA 1N7HA 4TTVA 3NBYC 3VNBA 3TECE 1C7ZA 3D6MA 1EDZA 3PC8A 4DAOA 1N2XA 3D4PA 1U7XA 2GN9A 3ITDA 3KDPA 3G02A 5L8VA 3CN7A 1IBMB 4OOEA 1MBZA 1UF9A 2CLKB 2VP4A 3N87A 3DR5A 3NUZA 4DLPA 5BUZA 5A4AA 3C6BA 1QIDA 4J0KA 3B53X 2RIRA 2QLMA 1DP4A 1N7GA 1U3TA 1HG1A 2WSIA 3NKFA 4LRXA 3U7RA 5KUTA 1SRQA 3JAWA 4J7XA 5F78A 4WBSA 1EYZA 3TDNA 3O3NB 2WQ6A 1TTHA 4TYPA 4CUZA 4ITUA 1XF1A 1PE0A 1R12A 1KMNA 5BSUA 3WNZA 1KI9A 1BVYF 1JE1A 3ZS9A 3WK8A 1VJGA 4CLQA 2FQ1A 2QTBA 4M9XA 4YT5A 2QN3A 3K05A 3M81A 1SBZA 1WV1A 5EIEA 5HUHA 1E9EA 5DM70 1E9DA 3DVAA 1YR9A 3R7NA 3SAJA 3UK1A 4UTRA 1PZHA 5K8JB 2O6HA 1G42A 1QIKA 1U8EA 1X1RA 2QSUA 2XT9A 1F14A 2FQXA 2OXEA 2HMSA 2M9MA 2HA3A 1O0SA 3EH1A 1BXKA 3CRMA 4Q39A 4UBLA 2HQRA 2PT7A 3AF4A 4NCNA 5F5LA 3ISVA 5C1BA 5A0TA 2ZYUX 2BSAA 1SUPA 1VMDA 5F64A 4OX9B 2WJ6A 5EY5B 3HBLA 3V8QA 5FBVB 2BZ0A 3ESQA 5DHQA 3PNYA 4D42A 4WBNA 1Z4JA 3VAZA 3EG5A 3MWEB 3H6KA 1WF3A 2IZ1A 4UCFA 1IVYA 5AQ1A 2Q4DA 2ZZMA 3IEVA 2OZEA 2EWWA 3BAFA 1HZZC 3PGXA 4N82A 3CU5A 3OU2A 3JD2A 1W5BA 4HZUB 3GLSA 4CT4B 3PFNA 4D81A 2Q2VA 4M0EA 1RWBA 2FEXA 4FWTA 4Y0AA 2REQB 4EG5A 4U7DA 2I66A 3VNRA 3UPUA 2XGGA 5FA5A 4BQIA 4TT3D 3EZXA 4HNAA 2AOTA 2DGDA 1RYNA 3JTEA 3N2GB 4UFPA 1I7SB 4BUCA 1KAGA 5HRCA 1GPUA 1FYXA 4PONA 3ZE0B 1CY1A 4WOPA 1LK0A 2P9BA 1O9GA 3PK0A 5J9GA 2CLEB 1PJCA 1AK1A 1E2UA 3NKLA 4F8YA 1CFZA 1AHPA 2W42A 4H0NA 4TTTS 1DCKA 1L5WA 2FGJA 3EEQA 1O3YA 4AULA 9GPBA 4II2A 3K9CA 1VBFA 2Z95A 1MDBA 2HSEA 4H9GA 4QO8A 1XTQA 4D9EA 2EG5A 2C4WA 5LDDC 4F97A 4R3NA 3T0GA 1DRWA 3LYLA 5L9AA 1ADGA 4Q21A 4GEKA 4DY6A 2Q3MA 1XLTC 3HV0A 4YAOA 3R5JA 2J3HA 4MRRA 1M2OA 3EAGA 3CC8A 4TRNA 5ILQA 4EITA 4GI1A 4KDCA 3EFBA 5C4GB 1YBMA 3SZUA 3ZEAA 1G2IA 2H00A 1FJXA 3AXSA 2ROQA 4A16A 4KQ9A 1JYSA 2DFTA 4GG1A 4PYLA 5AKLA 2BSQA 2IHVA 1PVOA 4FMDB 1WP9A 5CB6A 1KO1A 3KR9A 4KFRA 1Y0BA 1T2UA 1AZSC 3WK4A 5AHOA 3GA7A 1LDBA 1E5XA 3ETLA 1PL0A 4IYRA 1AS2A 4KKXB 5SZKB 2WSLA 2Y66A 4FDMA 2PUFA 2Q1YA 1KH3A 2IYNA 3KXPA 1MO5A 3WR5A 2BGGA 1T5BA 2FCRA 4DYHA 2FOIA 1AOXA 5JE8A 1ZIYA 1BMFA 3W3ZB 1C8BA 2E4YA 2D2VA 1E69A 3CNOA 1TA0A 1C4KA 5IG2A 1ZL0A 3O8LA 4PG6A 2HB6A 5TMBA 4D3XA 2J32A 2QRQA 2AFVA 1OIXA 2JJMA 3FWHA 3IYLW 2IBTA 4LJKA 2EG9A 4RK1A 1DC8A 4P36A 5HKBA 1VPEA 4JC5A 3LYAA 4ZT2A 4CG0A 2JJ2A 4ENRA 4ZDKA 1QU3A 3KPYA 2XMPA 1AV6A 4JA2A 3F8TA 3FNGA 4B2YA 3KUDA 4MA4A 4HNTA 5CIYA 2P2CA 3NIWA 1KOGA 2FUG1 3TW3A 3H8VA 3KOXA 1SC6A 1QNFA 2P68A 3HFJA 1U0SY 4HRAA 5JJLA 3L0CA 2QSZA 1YS7A 3GLHE 4WK2B 4EPWA 4EO7A 4ZT4A 2I91A 2JFVA 1XEWY 3E3MA 3O31A 1J2UA 4TS9A 1QH8A 1H4TA 2R47A 1MH9A 3Q12A 5DNAA 3VOTA 2PWYA 2NUPA 4WMLA 5HG0A 1N3IA 4B0OA 4HQNA 1Q6ZA 4XD2A 3PQ2A 5A3RA 4H3SA 1UZUA 4BFZA 1ZOIA 2WB4A 2WT9A 5JPIA 4C0QC 5IKXA 3QV2A 2OPBA 2P6MA 4LISA 3VAAA 1UPTA 1NM5C 1YNOA 2JRCA 4PSCA 1M0EA 3H4MA 3BKXA 4IIXA 4RPKA 2OZLB 2IV2X 4YXFA 2GLTA 3AFIA 5AHKA 1U0FA 1JG6A 1O5OA 2DP4E 4TX1A 3I23A 1TAGA 4WKNA 3UO8B 1YS1X 4H17A 2Y6VA 3OMLA 1W4ZA 2OK8A 1E5TA 3KJZA 5ER9A 3SLGA 2HU8A 1O6CA 2PL9A 2CC2A 1PX2A 4ZYVA 3UKDA 2Y27A 1U8ZA 3ZTTA 3VYVA 1G9TA 3RF7A 2H7YA 4I50A 3MLEA 3FVVA 2Y0EA 4FMCB 4NNJA 3VUFA 3P8ZA 1A7JA 5ADWA 5H4HA 2GJ4A 1FQWA 3DXFA 3I39X 1YOVA 4NYJQ 1ATZA 4C4RA 3UOAB 3KTOA 4FR5A 1JVSA 2EEPA 2O8NA 2VTVA 1EZ1A 1PVDA 2J31A 4P7BA 1FZQA 1VL1A 4CMIB 5CFMA 5IN4A 5JXHA 4QFMA 4RVNA 2NZUG 3LT2A 1B6RA 1AUPA 1NL3A 2GEFA 4TYQA 3JZDA 4B6JA 4A2CA 4MQBA 1KFBB 4NQZA 1Z6PA 1IPFA 5TPWA 3G9ZA 4HHEA 3VR1A 3QPCA 3WLTA 4C0LA 3OETA 1NP3A 1SCAA 1Q7CA 2QZZA 2YBEA 5BN3B 3Q8KA 4N1AA 3EIHA 1CJKC 1YQUA 4QTTB 4AD8A 3RRBA 2HNAA 1TGVA 3UA4A 4UE6A 4FZRA 2UUOA 4RD3A 1X70A 3P4YA 3RSQA 4Q9DA 4IIDA 2PFSA 3GFOA 1TECE 2VK2A 2APJA 3CWQA 5CT8A 5H9VA 3WJAA 1UC4B 2VSYA 3MUEA 3RJMA 2DUNA 1GP2A 4YMLA 4OXKA 1KSHA 3PXAA 4EECA 3FN4A 3FKSD 5E38A 2D5BA 4ZKEA 3HA5A 4UHDA 1BGVA 2ID8A 4RPGA 1V6AA 3TG8A 1OC4A 2YOHA 3VKHA 5KTMA 1HUQA 5FJJA 2EATA 1E0DA 1EWRA 1N9KA 3QWIA 4D9HA 3E15A 3RS0A 3N2NA 4R2LA 2GESA 2PU5A 4MWBA 2WNSA 2XGSA 4JP5A 3NI2A 3U4HA 2WSSD 1BH2A 2FFBA 5BVGB 4RQBA 4MEBA 3A1FA 4IXWA 1YO6A 5FXMA 3DHNA 4P4SB 3HKDA 1IJKA 4S1WA 2Y1OA 2Q8NA 1T0BA 5A03A 2CD7A 2G28A 1CJUC 1PW5A 3BXZA 2FFJA 4OA8A 3BHIA 1UL1X 3TJZA 4JYAB 1E0KA 3F6RA 1TK9A 1XU4A 3DDSA 1X1TA 1XVTA 1M34A 2DCUA 2W6JA 4HN4B 4UUOA 5TT0A 2FDCA 1RZ3A 1GARA 1CD5A 4DYVA 4G24A 5TMDA 2OXTA 3F97A 5EXTA 3BMNB 4BVHA 5JISA 1JEJA 1OVGA 2BP7A 2OXFA 3C4QA 5DSTA 3VR6D 4AMGA 2I3GA 5L53A 2FN9A 2ZG6A 1QDUA 4AKEA 3NC4A 3CH4B 3BQMB 2FN3A 3E9ZA 2M98A 2IOHA 4XOIA 1VL2A 1UK7A 3A4NA 3R3VA 4O5AA 5JMWA 5J4VA 4H7EA 4G8BA 2XTZA 1J99A 2VH2A 2PX4A 4B9AA 2IHKA 1D2NA 4BBPA 4TLDA 1A2OA 1UANA 2JI9A 2H18A 3ZWKA 1W0KD 3ZJ4A 4EMUA 3DEYX 5IN5A 2Q6LA 2VHEA 5D7BA 2ZJ8A 4I1YA 4D3ZA 3VR4H 1NN1A 3BPSA 2PGJA 3ON5A 3I05A 4GBJA 3O7WA 1DXHA 3KIPA 1H6CA 4ZVSA 3FDZA 2C84A 3WLHA 1A71A 2GCGA 4XSGA 3U9TA 2V6BA 4AY5A 2YMQA 4Q9HA 1Y5RA 2UUPA 4IIVA 1KIMA 1RR6A 5A0FA 1FDUA 1LY1A 2YN2A 4G0XA 4HWSA 1LZLA 2RKBA 4LJAA 4X6YA 1MO3A 3HCEA 5A0VA 3FUCA 2IYLD 3IXMA 3JQGB 4B40A 1XNRB 2V7BA 2QMUA 2QRMA 3IHWA 2W6ID 2NU9B 2ATEA 2CLDX 3UT6A 1GKYA 3CEAA 3ZXSA 4NMMA 1NXOA 1RZRD 1EESA 5T4EA 2EFGA 3CSUA 2DHDA 5DWQA 3TR6A 5KNBD 2F55A 2GERA 3WLNA 1HYGA 5AW6A 1KWGA 1FUEA 3KXDA 4RF4A 4KDRA 2VHUA 3I6BA 2JHCA 3TDKA 3M0EA 1PS0A 1YU9A 2P3SA 3UM9A 1PK7A 4ND8A 5AK6A 5K2OA 4BQOA 1CEYA 4MW5A 4ND1A 2QWXA 2P6RA 3A8TA 1PR6A 2V7PA 3RFUA 3E0XA 3WMFA 4CKXA 2QTHA 3W7VA 2UZ1B 1E1QD 1E6CA 1ZJZA 3NFYA 5AKKA 5JSYA 5JDIA 2AMVA 3QUAA 3DE4X 4H7KA 4P86A 1EWVA 1A9PA 5CB0A 2GO7A 4LC9A 2JGLA 2PRSA 4NRDA 2V0NA 5KTNA 2ISCA 2LNDA 1HDCA 3WDLA 8ABPA 4PCUA 6YASA 2I67A 4PGHA 3WRXC 4YJ2F 1E7YA 4CEJA 4NYIQ 4FZVA 4LYHA 3JSXA 1Z22A 1M2JA 4UHHA 4Z51A 2ZRIA 1SBYA 4P31A 1QZZA 5ALVA 2Q4TA 3H6HA 1WY7A 3DWGA 3AY0A 1G8PA 2BEKA 4FN5A 2XE7A 1J4AA 4OU5A 5IZCA 4YRIA 1FP6A 4ACAA 2FXIA 2HC9A 2ASEA 2XCIA 1E1YA 1NYRA 4YRJA 3WQBA 4D7AA 1AX9A 2XRZA 2VNIA 1VPLA 2EKDA 3QVVA 1PKXA 3THOA 2HO5A 1UBGA 3H5IA 2LCQA 2EW8A 1UDAA 2WV9A 3AK4A 3PC4A 4A5OA 5EKTA 4YRNA 2O2YA 3D7SA 3M3DA 2A5GA 4EY8A 1V5EA 3L0YA 4TN1A 1K68A 3NPAA 1AV7A 4EPRA 5HRAA 5KYYA 1E1DA 1W46A 1BA2A 3QVUA 1QX4A 3DKVA 2WF5A 1REQA 4BUJA 2F43A 1VMIA 3EXG2 3QLJA 1GU7A 4BVJA 1CRLA 1XDGA 2EAUA 2WAAA 3D7RA 2Y92A 1B3BA 4KFUA 4YGXB 4D82A 2PLWA 1WU7A 2QF7A 3HO8A 1K8XB 3HU5A 4CFSA 2EF0A 1F8FA 1Y37A 1S2IA 2B4QA 1UC8A 4MLZA 4N7BA 2TYSB 2VDOB 4DMRA 1U8FO 2QE6A 4TN5A 2AFHB 2ZR0A 1N6HA 1KH1A 1Q7EA 2PA3A 4P3YA 5BWLA 4D79A 1J49A 4DVGA 5DLEA 3L8ZA 1SUBA 1J24A 1X15A 5J4YA 5ABPA 1EB8A 1G291 4G1UC 3GFBA 5K5EA 2Y0PA 1YA8A 3IS3A 3L1UA 4HDNA 2A9JA 5HIAA 3KYBA 2GAJA 3U7QB 1CF2O 4RC9A 1QIFA 3CKLA 1NBME 1M8KA 1P7PA 5EHXA 4JKYA 4GGMX 3SBDA 5JO0A 4DC0A 2ADMA 5C3MA 3WDMA 4J49A 3FTNA 1N9GA 1Z36A 4L8GA 4MEJA 3V32A 3SVTA 3OJEA 2PRZA 3M6IA 1PL7A 1UWKA 5TQ2A 4RTNA 1H2YA 2AKEA 5SYMA 5LLSA 5TMPA 3RVQA 1WB6A 4JLNA 3Q0IA 2FSVA 4L6IA 3UFXA 3BXPA 4CGZA 3AI7A 1LEHA 1MD9A 1IPHA 1BCSA 2P67A 2ZE5A 3H0KA 3AM1A 2PMBA 3EJ6A 3UWOA 1SZJG 3ZKWB 3EVFA 3AF2A 2IJGX 1Y3AA 1MKYA 1ITZA 2BEVB 1SG9A 4QE3A 4J0EA 2X42A 4AJ2A 3A6DA 4Y2YA 2GXAA 1CF4A 2OQRA 1L5MA 1A8QA 1Z73A 3PIDA 2AN5A 4JT2A 3VZRA 2RAVA 3W7BA 2O8DA 1N5LA 3DV0A 3CUTA 3H9UA 3QOXA 1YB5A 1E1CB 2IVZA 4FZ3A 1XZBA 1PJ8A 4UQOA 1F8XA 3W9BA 2HXSA 3OEHA 4QOIA 4PXSA 3QFCA 1H5NA 2HSWA 2WJYA 1I79B 3FAZA 3V5NA 3B1VA 4IG4A 5IJZA 2VDLB 3PXBA 3ZGVA 4EG7A 1F3OA 3PJRA 4QEKA 1KQFA 2O5RA 1RC0A 2BEUB 4LXYA 1IJEA 1MOZA 2EFHB 5LYJF 2DQ4A 1KOLA 5H16A 4XDZA 3E3OA 4UVHA 2JFYA 3MQ2A 4BBZA 1U5BB 3N7AA 1P1IA 1MV5A 1U2ZA 1XELA 1ZUNB 1T9ZA 3PDCA 5JYBA 1E6KA 4C4PA 3RS4A 4L0QA 1OXBB 2A94A 1ZQ1A 1GKKA 5H5JA 1ABEA 1XVLA 4Q4AA 1TRHA 2UXBB 4EBFA 4Q6BA 4Y6QA 1NAIA 1AKWA 3QP9A 1O1YA 2VKQA 3R20A 1QVWA 2OO5C 4KXUA 4FVTA 2ICAA 2I2AA 3ZUGA 2D2IA 2QJOA 1GJRA 3CJTA 4BQRA 3K7EA 4B4UA 5CK5A 3RUEA 2ZAMA 5IYZA 5LMZA 1U7PA 4PLYA 2ZRDA 5JY1A 1O97D 1O89A 3GLUA 5ERGB 4EGSA 2CXPA 2V6JA 3EVGA 4OUKX 4K86A 3NVAA 4HYYA 2AF4C 1KVTA 4PLWA 2KSQA 3OUZA 1CB0A 4Q93A 4XX0B 2X5JO 3ZY2A 3IA7A 2WJJA 4WN9A 4DNPA 1MNQA 1IBKB 4Q1DA 2J5BA 2RC5A 3WGGA 2PGIA 5EUMA 2ZJ2A 5CXQA 4Z4GA 1QYDA 2ERCA 3ND8A 3D8RA 4N5MA 4YRSA 1ZIDA 1E3DA 4HXEB 3PWTA 4LVNA 1PK8A 3O9VA 4UD6A 4PZ0A 3V8PA 3MYRA 4EY3A 2MR5A 3I4CA 4RANA 4CCAA 2IYOA 4IS2A 5I7FA 5KNDH 3EY9A 2PFGA 4EYSA 1XVAA 3DEZA 4ZQCB 3BWVA 4XIIA 2O2DA 2D13A 2QN7A 5EYPA 5IRCD 4GO1A 3PFBA 1H3NA 1ZNWA 4US2R 4J03A 3V1NA 4ZHSA 3A6JA 2OM2A 1YDMA 4B3GA 3ZCUA 5EGSA 1Z16A 1C5KA 2JA1A 2WSYB 3RS9A 5EJ4A 4Q1AA 3HG7A 2VJMB 1IHXA 2ID7A 1PEKE 4ALMA 2DLDA 2GJ8A 1CY8A 2CKMA 2FPNA 4BCDA 4MUHA 1PG2A 2UXDB 1I36A 3KU1A 1QGUB 5ARCA 3T3PB 1XTSA 4XD7D 4HQLA 3GEMA 1UDWA 2CCGA 1JR2A 3BF7A 4KVFA 2FG6C 1DQZA 1FLAA 2D5CA 1UADA 4ZOEA 5DXAA 2FLWA 1HI9A 1OV4A 4WCDA 1HE8B 4QU0A 1D6NA 1PDVA 3RU2A 4J4TA 4LDRA 4MB6A 3RLFA 3RWMB 1HT0A 4A0HA 3U0BA 2H2FA 2GD2A 1J00A 4TXNA 1NLMA 4YMHA 2YWRA 3E9DA 1YACA 5I7VA 3IESA 1IE3A 3ZLTA 1B93A 5GP1A 5AW3A 4V0LA 2GI4A 4L50A 3JU3A 1YNSA 3GT4A 3CEPB 4LHSA 1NQXA 4AP6A 4FXOA 2I1QA 5MFZA 3R0IA 1I14A 3Q7EA 5AIBA 5KOJA 4HNVA 1X1CA 4F96A 4P6VF 3DVQX 3WOVA 1PYDA 4K9RA 1O6ZA 3OZAA 3P0JA 3SZLA 1TVKB 4KE8A 1GT6A 3QSYA 4J2HA 4ZIRA 4M9QA 4MW4A 1NLYA 1NR5A 3I32A 4TZ0A 1JQJC 1NA5A 1EHCA 1NVMB 1DARA 3BSYA 3KZNA 1FOEB 1Y1KE 4MRNA 5GJWC 5J2TF 2ABWA 1W0JA 2ZJ1A 3BFVA 2YW9A 4EW3A 1MJGM 3VC2A 1K6MA 2I4RA 5LM3A 5A04A 4OD0A 3I28A 4HATA 3NEYA 3GLIA 1HA3A 1A96A 2F1HA 4H1TA 2B3DA 2IEYA 1TAQA 3MJVA 2YRFA 3F0TA 1YFJA 3LT5A 4O4IF 4PFKA 4TXJA 1WCIB 1Z68A 2JGRA 4YCBA 5BQPA 2PJDA 3QPVA 1IY0A 3WJ7A 1K6JA 1FVFA 1RXSA 3W3AH 3ZQUA 4ZHQB 5AW0A 1SRRA 1C29B 3HWSA 4CWAA 4PC2A 1YB2A 2C4KA 3LRTA 4R05A 3UKJA 3OJFA 2IODA 3LLUA 4FILA 1JEYB 4AMBA 4ABYA 1A88A 3UANA 2I4MA 3CRVA 1GGNA 3NJ8A 3OAAA 3USCS 1WXEA 1F06A 3PR3A 2GHTA 4XZ3A 4MI9A 1OI4A 1WDWB 1SY7A 2QD4A 1VLZA 5SZIA 3RQIA 3SIWA 3CVUA 4AY6A 3AR4A 4XUDA 5A6VA 5AI4A 5HM6A 1N8SA 2JAPA 1BQEA 2JH9A 1I7LA 3WXBA 4CDRA 4Z4QA 4DQVA 5BSEA 1FXUA 2AVNA 1KL7A 2XVMA 1GZ4A 2EU8A 3R6TA 4KB5A 2NUBA 3T5DA 4I8DA 4C87A 2IEIA 1R6VA 4BEVA 4C3OB 1KYYA 3PRKE 4LAFA 3HSKA 3KZXA 1XNGA 5CIQA 2FH5B 2O0MA 3WYGA 3P5BA 1R6DA 3QPDA 4DIFA 2YV3A 2QRVA 3KXLA 4F11A 4WZ6A 2H29A 2GBIA 1MQAA 1ZA1A 1D03A 2CB9A 3STUA 1G5QA 3K09A 1D9XA 4QDJA 3NTLA 3F5FA 3A3PA 3AC0A 1RNLA 1RE0A 4Z49A 5L7TA 2J3KA 1OXVA 5AJHA 2WM2A 2BFBA 3GRUA 4JBXA 5JSHA 5KVSA 2VPZA 3L4EA 4LOKA 1KZYC 1NFQA 5CYPA 2CMGA 3EH2A 5AVKA 4BE4A 2REOA 1WV0A 5KYXA 3B5EA 1ULTA 4JB8A 2VJDA 2FW8A 3GRRA 3U3OA 4UXHA 5C1OA 1D5CA 2RG1A 2Z09A 3BXXA 2H52A 1XUOA 2ZT8A 3CLHA 1OASA 5FFFA 3D3NA 4BKMA 4EO4A 1U0GA 4N41A 3BDAA 1T4GA 2C04A 5DGXA 1I4WA 1WQ4A 4O3MA 2GCEA 4IMRA 3ZDRA 3JAWB 4BJ1A 3EA5A 4JB2A 9ABPA 1M6WA 2CMDA 3AJ9A 5ULLA 1XP8A 2W90A 1JG7A 1QIMA 3S7TA 5IVHA 1UP6A 4DC9A 3Q9NA 3PDHA 5HJEA 1GQSA 2O8BA 2Q7XA 1IY2A 3DZ8A 2WDPA 2X9NA 5AVVA 4E2YA 3DVAB 3CG0A 4G4JA 1EX1A 3K2QA 4N5LA 1RFGE 2FPXA 2H06A 2VPYA 1FPQA 3LCMA 4HGOA 4K5QA 1Y6JA 4KTVE 1CTQA 4KXFB 1DTSA 4Q18A 1LC0A 3O8RA 1TUEA 3B8EA 1N25A 3LGSA 1EZZA 4Q3OA 4PWZA 5I3CA 3B89A 1RMTA 1Y3BE 2ONCA 1C0EA 1ECPA 4BOYA 1ODJA 2I2FA 3F6PA 3LQRA 1UXJA 2R6R1 4M46A 2B2NA 2FX5A 2OFXA 2VPTA 3OO0A 2BZSA 4NECA 2Z3VA 4WBNB 4Z8YA 4H6XA 1E1RD 1QF9A 5EHNA 3G68A 3VUEA 2SNIE 3GJ4A 4M21A 3ZHTA 3AVUA 4EG1A 4ZJUA 1IUOA 3RJ9A 4KLNA 4NMLA 3C0KA 3L4KA 1Y5IA 1W4RA 1I0IA 3V6LA 4EUEA 3Q5GA 2O2CA 4CMIA 4F85A 2CZCA 1T6ZA 4IGKA 4TV8A 5U4XA 5A4DA 4IX9A 5BT9A 4NAVA 1OYWA 2RGGA 3U37A 3V8NA 2GHIA 2FPOA 3OQBA 3HRKA 4FT2A 2H1LA 4B32A 1DG3A 3AR3A 1F7UA 3AESB 4MRAA 1H9BA 1E2QA 3Q41A 5AKGA 1QTQA 2AOTB 2P4HX 1XXLA 1H85A 2GSWA 3OPYB 4XB6B 1WABA 2KW5A 4ZEOA 3GLVA 5SV2A 5SY6A 4OU4A 1KAMA 3RLIA 3WGJA 4DY4A 3C8MA 1NI3A 5C4IA 4AJJA 3PNKA 4H4CA 3HGQA 5CU7A 3S8YA 1U0HC 2DTEA 3C2QA 2ZYVX 4UEWA 4WXRA 2J9RA 2C54A 5ER6A 4S12A 3M9WA 2RJOA 4JLMA 4PRYA 3KQPA 1GUAA 1K86A 1KVQA 3OZFA 4PXAA 3W5SA 3UGKA 3VPDA 2WINI 4INZA 5TC4A 3KVNA 2Z2JA 1PLKA 2JLBA 1E8MA 5F1OA 1QWOA 4XVRA 4U0JA 2JIZA 2Z1MA 3FMFA 4UNSA 3HNOA 4YP6A 1WDLA 4H1UA 1VLQA 1IN4A 4MQ5A 4BKRA 5GTDA 2GZ2A 1Y48E 4GLFA 5CJPA 1JG1A 2VT3A 4OI1A 3ORQA 3QH4A 2HPAA 4MI1A 3DTVD 3V34A 2OHIA 2W0SA 4JEHA 3NYWA 2A0UA 1WUJS 1L9KA 2EV9A 4NG4A 3G6WA 4HAVA 5CUQA 2ZAOA 3HFSA 4MUFA 2WFAA 3UG6A 3N3AC 4DLTA 2CHFA 2R8PA 3EVCA 4D8VA 4F84A 4H3HB 2NX2A 3RYCB 4ZZIA 3ZN2A 1SCBA 2Q2QA 4QXRA 4BGVA 2FRXA 2JPDA 3O38A 5GJBA 1V4NA 3ONWA 4TYYA 5CHYA 3E05A 1JHQA 3VU9B 4RTQA 1I24A 2ZJ4A 4Q9IA 3BXFA 1N2SA 1N3BA 3MCWA 3UOGA 3GD5A 3TO5A 1JG4A 1HT2E 2LW7A 4PO1A 1DRUA 4QYSA 2H4XA 4HDRA 3U1TA 3H3XA 2D2FA 4N7RA 3D81A 5BV2P 1GADO 1E4YA 3Q1KA 2X7JA 5G3YA 4ASUA 1NTRA 1H2HA 3LY5A 4U2BA 1JU9A 3ZBUA 4G97A 5FTWA 1LX6A 3D8SA 2ZUEA 3AEKA 1WD5A 3TZBA 4Q16A 1S7CA 3RV4A 3ZDFA 1G3RA 1NF8A 2OYSA 5JC8A 1PFQA 4JBHA 3U62A 1AB5A 1H69A 3I9JA 3N8KA 1JG2A 1QO0A 1ZUIA 4D6PA 1MZVA 3NH6A 3G5MA 2B94A 5BORA 5K4GA 3GLTA 4JXZA 3DZJA 3ZDXB 2Z2YA 3ND7A 5CLQA 5CVJA 3RBAA 1N8NA 3VR5H 3RBZA 4AZVA 3KHUA 1MQ9A 2WRZA 4BO9A 3PC8C 1MENA 4YP1A 4N0EA 5B1EA 5B1SA 1IEQA 2CLFB 1RI3A 6LDHA 3Q3IA 5FV4A 1TYDE 2D7CA 1XK6A 1DQYA 2XKAA 2HMVA 1YI0A 1LD3A 1JECA 2RONA 3AW8A 2XTJA 3MIIA 3FPSA 3B1KA 1GZDA 3A2NA 3NHMA 3OE4A 4JLKA 4EHDA 1HR0B 1SIWA 5LIRA 4IJ6A 3MJ4A 3K15A 3QWBA 4JYMA 5JZOA 4RJTA 5KMGA 5FNVF 3BHMA 3FH0A 4OQZA 3LOPA 4WZBB 1EQ2A 4FYPA 3TPZA 3IKLA 1WR8A 4EUKA 5F7XA 2XCSB 4R41A 2TMDA 5AHRA 1WXWA 3IEPA 3T7DA 1E1NA 2WT8A 3MGKA 3V1KA 2EL7A 3LBNA 1EAYA 1IB0A 1AHHA 4HWPA 4RVFA 4V2UA 4JLOA 5IXJA 5JWOA 1BQ3A 1KP3A 1CUCA 4ENPA 3EPJA 1XZEA 5EWLA 1JR6A 3AJRA 3PDIB 1BNCA 3UWSA 4UXJA 4GU5A 1QF7A 1M1NA 2B4YA 2JEYA 1YAHA 1T35A 3B9RA 2VJPA 2QR2A 1ZN2A 4XQ0A 4GUAA 2GYWA 3RS7A 4CMKA 1J90A 3TQFA 1F6DA 4OYLA 2KS6A 5HF5A 1XWWA 3IXQA 3JVDA 4ENWA 2A5LA 4F4CA 4MR9A 2REBA 4WT7A 2IZOA 1QV6A 1UR5A 2WFZA 4DCNA 2NPFA 2O8VA 1E6EA 3KEMA 1YTLA 2PO5A 4MITA 3NHAA 3ZH9B 2ZTLA 1K75A 5CG1A 5GVSA 3G2KA 4GQAA 3T7EA 3KJXA 2JAUA 1V5GA 1WMDA 1MORA 3UAXA 4EG3A 3AG5A 1UKAA 5FQNA 5BWBA 4UOEA 4X84A 2Q3EA 1NVXQ 1DJNA 4FWIB 4IDHA 4D26A 3CINA 1ZK0A 2MHCA 3DF9A 4CL0A 3FWYA 5BWCA 5TPWB 1V39A 3QMMA 4DLWA 2DQKA 1G0OA 1NSFA 4F92B 3H2BA 3HXOA 2P2YA 3RSZA 1VFPA 3BB1A 3ANTA 1QYVA 4V1CA 3MS2A 4ZPXA 1C30A 1W9MA 1QGOA 3F6YA 5COAA 3HXQA 4YJFA 1FMTA 2YJGA 3K2BA 3DB1A 4FOSA 4W63A 3K9BA 1VFNA 1SKAA 1RZVA 1KZGB 1C8KA 1GRNA 1TUGA 1FQOA 2XMSA 1C9NA 1G5TA 2OBBA 4LW8A 4QYIA 1C7IA 1FLDA 4R8KA 2WNIA 1FXWF 1T10A 3OQMA 2IUSA 4LQCA 1Y89A 5CEFA 4OJTA 3ICOA 2OQVA 1B3RA 1KJYA 2XD9A 3I3OA 4CF4A 1JFSA 3INTA 2R7LA 4GWLA 4W9NA 4EHFA 1YL5A 1BWSA 3CMMA 2ZAGA 3E70C 4QHSA 4Z5XA 2MSDB 3MOSA 4OGGA 4P3NA 2P6PA 1PJZA 3HLKA 5JCZA 5JJKA 1DKNA 4J7AA 4XM1A 2VYNA 1BGXT 2QX6A 2NO6A 4E5YA 3LS2A 1SUDA 3OSZA 4LE0A 3ZZNA 1EUYA 3EXIA 5HXAA 1RWNA 3CIOA 3K73O 2QMYA 1MAHA 4MVJA 1A4IA 1P60A 1RYYA 3HSYA 3OI7A 3NLLA 3L8GA 4JJZA 4OF4A 4MGIR 3CO5A 1EXVA 4DJEC 2CSXA 4NE9A 3LY7A 5H1YA 4F2DA 4EB0A 2GD0A 3H86A 3G2NA 3N59A 2F6RA 4C3UA 2Y9MB 1VG9B 1XVUA 1G2QA 1YRYE 4HPWA 3VJKA 2BI4A 4KX5A 1GD1O 3AB7A 1M34B 1YHYA 4CM1A 1JJVA 4GVLA 1UZNA 3Q40A 4Z6KA 3OKAA 5CFZA 1DFGA 4LFBB 3H99A 1ZRHA 4BP9A 1ZW6A 1NXVA 3KR2A 2I4OA 4RUKA 2RGBA 1LK5A 4GXRA 2GARA 3IBTA 4XCXA 2XOKA 1VMAA 3EGDA 3LP5A 1BXRB 4O29A 1USIA 1N57A 4U6NA 4H7DA 4P5PA 1H94A 3UA3A 2VJBA 2X5XA 3C5VA 4R1PA 1HQKA 3FZEA 4RW0A 4MUMA 1QX3A 3N86A 3UXEA 3KXIA 2Y1CA 1L6IA 3RO7A 1XRJA 2P1RA 1WIWA 1EFPA 2B1IA 4K46A 3TQOA 5KTTA 1H2FA 1O95D 2DHCA 1I6KA 1NJSA 3EOBI 5DNEA 2UXCB 3GL9A 2ZIGA 2Q1TA 3KAPA 3QA9A 2O7VA 4DRZA 5F4ZA 4DA7A 1WXXA 5CM2Z 2CNWA 3G85A 2WUDA 5ALIA 3SNHA 1FC0A 5BRAA 1XTTA 2XUFA 4IO0A 4LZWA 1H2EA 1R0BA 2Z5GA 2HBRA 1T0IA 5KJ1A 1S2GA 4DV1B 3FDZB 4OXRA 5T67A 1U0NA 4EY7A 1RQXA 3L40A 4D98A 2QQEA 5T41A 3FDJA 3LPCA 2Q5JA 2BJVA 2AWOA 3PQDA 4XUEA 3M33A 1ML4A 2FR0A 3OP4A 5AUNB 3OLWA 5DPMA 1PYOA 3KJQA 2VJOA 1ZEMA 4EFKA 3D6AA 1Z7GA 1IJFA 2AFRA 3CVOA 2PUJA 4KN6A 3K4QA 5CNMA 2RB5A 5FTJA 4CJXA 1QAQA 4XYLA 2G82A 2Z0MA 1CUVA 3LZ6A 1IDOA 4FLEA 2OMKA 4IEFB 4NC9A 5ALQA 5JCXA 3R9XA 3G0IA 4R54A 3CLUC 3HB4X 3QKIA 4X60A 5EXDA 3RYIB 4DR3B 1EFUA 4Z7OB 1VIYA 2ZRLA 4BS9A 1JHRA 3R5HA 3BB4A 1WO8A 1QUEA 2IH5A 3HMQA 2ZXEA 4FJ2A 4I5EA 4MYRA 4L4XA 3HI4A 3R7WB 3M9XA 4ND8B 2FOXA 3F9RA 5JNUA 1RYMA 1Y80A 1SQ0