1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
4W82A 1DRVA 4DVJA 2VWQA 1GCUA 5T57A 1K3TA 4BS9A 3GT0A 2GUGA 3DOOA 3K31A 5JDCC 3GHHA 3QIVA 3DOCA 2O3UA 4ONEA 2Y99A 4OMUA 5B12A 4Q3EA 1C1XB 1LDYA 4HADA 2PFGA 4YACA 1CEQA 4J6FA 3JQ8A 3WOHA 4ESOA 4BNVA 2GZ1A 2EW8A 5GMOA 1VKOA 2P4HX 3LC1O 1LXCA 1VLLA 2PZMA 4BNUA 3QY9A 4IJUA 1DAOA 4AJOA 3WGOA 1RJWA 1R4NB 1GZ6A 1QV7A 3AOGA 4J1SA 4O5OA 4E5YA 1DPGA 2DUWA 2BD0A 2B36A 4PLYA 5H82A 4AVYA 1QV6A 2I65A 4XZ3A 4FC6A 1NASA 2NQ8A 4N5NA 3LLVA 5A05A 3WS7A 4CM4A 2AQKA 1GR0A 4R51A 3OSUA 1IYZA 5L4LA 1ZNQO 2OBNA 1Q0LA 1U28A 4BNNA 2JD2A 4J9UE 3ZNQA 1MXFA 1C1XA 5BT9A 3WNVA 2Y1EA 3EC7A 1YQXA 4TRRA 3AFMA 2EW2A 1XLTA 3WGYA 2G76A 2GZ3A 4FOOA 2PD4A 4E13A 1E3IA 2UV8A 5HS4A 1EBFA 1YJQA 3F1LA 4YYZA 2XXJA 4TQGA 4ALNA 1Z7EA 1B16A 3FWNA 4K28A 3UXYA 4DPKA 3ZHXA 1LNQA 1NR7A 3QW2A 2C82A 4R1UA 5GY7A 3V1TC 2VRCD 4E31A 1TT5B 1M76A 3JQAB 1DIBA 5IN5A 1A4IA 1LJ8A 3R3JA 1HYGA 4CL3A 1BDBA 1X0XA 5EL0A 3U4HA 1DRWA 4YWJA 3DHNA 2VZ8A 4PGFA 2QHXA 3EYWA 4URFA 2ZCVA 2QZ9A 4RF2A 4FFOA 2BH9A 2NTJA 3GVIA 4CQMB 4P22A 3BZUA 4G2NA 4KUHA 1P77A 1XELA 1VI2A 2J3HA 1G0NA 2OFPA 3GPDG 3BMCA 1ONPA 1AN9A 2CD9A 1NQ5A 3PHHA 1VC2A 3MJVA 4MVJA 3P5SA 4XJSA 4O59O 8ADHA 3LF1A 2IXBA 3F4LA 4C7JA 4Z6KA 3GZNB 1EMDA 4TMFA 3WQSB 2IODA 3O38A 1P9LA 1PR9A 1SB8A 3HG7A 4YAIA 4FDAA 1PJQA 4GVLA 4P4NA 3KRTA 5LC1A 5MGBA 3OH8A 1ZH8A 1PS0A 4NPCA 4B3HA 2HKIA 2HSDA 1V3TA 3QWAA 4I1IA 3DBRB 2DAPA 1E7RA 1DC3A 2HQ1A 3QP9A 4BO5A 1U7TA 5CPBA 1EQUA 4EGFA 2W2LA 1KEVA 4J7UA 3BXXA 3W8EA 1XQ1A 2BI7A 4D3FA 8LDHA 3LLSA 3F46A 2I6TA 3FWZA 3A06A 1Y8RB 4PIVA 4GSLA 1HT0A 2BMAA 2G17A 1PQUA 2QRJA 4J1NA 4RVGA 1U3TA 2O3RA 1A5ZA 4ZGWA 4QTZA 4HFMA 3WWYA 4Z9XA 3E9MA 1NR1A 2DPGA 2X5OA 3AUAA 1WDKA 4DMMA 5C7LO 1R4MA 4LRTB 1N92A 3U3XA 1W6UA 2GN9A 4JK3A 1BVRA 3A28A 1EUZA 1U7HA 1DC5A 2FR1A 2Y67A 3KXDA 4QUKA 4YQYA 1YB5A 3ON5A 1MX3A 4W9NC 4XYEA 1LTHR 1UUFA 2VTDA 3GDOA 4ZD6A 5I7VA 2DC1A 4Q3NA 1R4MB 3E5RA 4DPLA 3D3EA 5BSGA 4ZVVA 1BWSA 2OGUA 2PV7A 3BYZA 1UXHA 4O0LA 3OQ6A 1BW9A 3SC4A 3IC5A 2WE8A 5DCUA 3RUCA 4EUHA 3JQEA 4KWHA 3F6YA 3U4IA 2Q2QA 2VT2A 3K9QO 4GI2A 4QX6A 5DULA 1JLLA 2W2LD 4TROA 4TZTA 5CFZA 1KEWA 3SBOA 5JYAA 3S8MA 4OH1A 3R3SA 3AU8A 1R0KA 3V1UA 2EKPA 2C07A 1PJBA 1A9ZA 1LX6A 1QXSA 2Y1OA 5ICSA 5JW6A 2X0JA 3ZWCA 4E5KA 4NFHA 3OETA 3WYEA 4KP7A 4GH5A 3KOUA 4J2OA 3GEGA 3GFGA 2DM6A 4M87A 4B4WA 2PD6A 1UP4A 4J1QA 4DMLA 4BB5A 2IXAA 1NWCA 4PG8A 4TRNA 2VT3A 4ROSA 5T67A 1LRLA 2W2KB 4PRKA 4BKQA 1NYTA 4H15A 3VKUA 3PDUA 2PR2A 4BO6A 2DT5A 3G49A 3B1JA 2Q4EA 2P68A 1P31A 3QWHA 1Y9AA 4WPGA 3ANMA 4GMGA 2OHXA 3BMCB 5G0WA 4OXNA 3HADA 3EZYA 2YZ7A 3D1LA 1UP6A 2XOXA 1P44A 1V9LA 1PL7A 3LZ6A 4RVSA 4H7PA 1JKFA 1Y81A 3JTMA 1SPXA 4GKBA 1PGPA 3KO8A 2CF6A 2V6MA 4WKGA 3G1UA 1SC6A 3UAGA 2AE2A 2NADA 4NBWA 4S1VA 5TLSA 1FDWA 1B26A 1XU9A 5C3MA 2J5QA 4UVDA 1WP4A 3W8FA 2NNLD 1GQ2A 3AI2A 1NQTA 1IZ9A 1B2LA 5AQ1A 4YAGA 2GR9A 3GUCA 2V6GA 1CERA 1OI7A 2X4GA 4UEJA 3WYCA 3OFSA 4WLEA 4UVEA 5DP2A 5TT1A 1WNTA 4NFYA 1P1RA 4AJNA 3OHSX 3NJ8A 4FFNA 4J4TA 3FI9A 4BO3A 2BFOA 5JAQA 2AQIA 1LDGA 2ZB7A 1XDWA 1DXYA 4UEOA 3TOXA 3W4KA 1WXDA 1RM4A 3Q9NA 2JCYA 4IJVA 2YW9A 4GKVA 3ZU3A 3VH1A 1EVIA 3I4FA 2WMDA 5DP1A 4IXTA 5ES3A 4YR9A 3HNPA 1RWBA 3INRA 4M1QA 3MWDB 3AM4A 4L4XA 1N1GA 4MOWA 4OJNA 3RROA 2BLLA 4Q3DA 3FN4A 3BMNB 1GQYA 4C4OA 4OIMA 4EJMA 3GGPA 5DBFA 3AK4A 5KJEA 1NTOA 4HFNA 3ZWOA 2YYYA 1MGOA 3F3SA 4HNHA 4IUYA 4Y6RA 4YJDA 2V6BA 2O7SA 3H9GA 4CQMA 4YJGA 4IDBA 5AXBA 1U3WA 1W73A 1O94A 3PHIA 1J5PA 2C5EA 4K26A 1AXGA 3QSGA 3FTNA 5G4KA 2JJYA 2WJPA 4LMPA 3I9NA 4BGEA 1BTOA 3QHAA 4XDYA 4YPOA 4E3ZA 1MC4A 3EVNA 1Z7BA 4FR5A 4FJ0A 4WJZA 3JQGA 5JSFA 4RJTA 3TF5A 4JX8A 1U5AA 3T4XA 4LCEA 3ZW9A 1PIWA 5KJFA 4F6LA 4EI2A 4BB6A 3MTGA 2G82A 1UXGA 4JBHA 4OQYA 3RKUA 4OXYA 4YA6A 3VH4A 1GYPA 1PU2A 5EINA 1MP0A 2EIHA 3AY7A 4Y67A 3E82A 2X8LA 3GK3A 3DB2A 4IQ8A 1LDNA 1F0YA 4FFMA 3IJRA 1H94A 3C1AA 4QQRA 3WLFA 4MVJP 4GX5A 3A9WA 1O95A 1MB4A 4BO4A 2VRCA 1U3VA 2VWHA 3WMWA 2GN8A 3TOZA 2DTDA 1NM5A 5G0TA 1I3KA 3SJUA 4CM6A 1A4UA 1ADBA 4N18A 5AVOA 1Q1NA 5G0VA 4I5GA 1Z75A 1UZNA 2Q1WA 2GRAA 4JBIA 2JKVA 5A9SB 2OP1A 3BTUA 1HZZA 1I0ZA 3ZCXA 1CIVA 5GZ6A 4TZKA 4RLHA 1D8AA 4PLPA 3AFNA 4IIUA 3HE3A 1X15A 4L4SA 1F8GA 5JDIA 2WWRA 4NJMA 3NT5A 1P3DA 1A7KA 3O4RA 3RUEA 4EEZA 3H5RA 4XEHA 3GGGA 1NWHA 2PGJA 3H9QA 3LK7A 2B83A 5FYDA 3DBLB 4BNHA 2PA3A 3NTOA 4TVBA 2FR0A 4CUJA 5B4VA 3NRCA 1LSSA 4OM8A 4OO3A 4CLRA 1C3VA 2YV3A 1PX0A 3RAJA 1XG5A 4RV9A 1SCUA 1M66A 1S6YA 3PWSA 2WEKA 1M6WA 3CKYA 1O89A 4ALLA 3JD4A 5CEJA 4W7IA 3LDHA 3PYLA 3N7UA 3H9JA 3KVOA 4IMRA 2ZTVA 5B4TA 3DHYA 4ID9A 5EPOA 1WMBA 1T2CA 1R66A 3JYPA 4ITUA 1VL6A 4EEXA 4XIJA 4BNKA 5B4UA 2I99A 1YE3A 1N7GA 1ENYA 4N7RA 4ND1A 2VYVA 4PG4A 2G5CA 3PQEA 3HN7A 4E12A 1U1IA 1JWAB 3VZSA 4XR9A 5HTOA 4IXWA 3OBBA 4MO2A 3BTVA 2Y1FA 4KTTE 1PGQA 3JQ8B 3OP4A 1GYRA 3HJAA 2E48A 4AJIA 3PYXA 2H63A 2YHIB 2ZYAA 4KZPA 2YDYA 1GD1O 3IJPA 2HMWA 3Q2IA 1T1SA 1Y8QA 2Y93A 4FJ1A 3ZWXA 2O4CA 4IDFA 3ZU5A 4FGSA 2VNSA 3OJFA 4CMEA 4RPHA 1K6JA 4OOFA 3PHGA 3O26A 2QX7A 4J4HA 4B8WA 4M55A 3L9XA 4ZRMA 3P2OA 4U0KA 3DFUA 1SBYA 4B4VA 5A06A 2EGHA 2HK8A 3DBRA 4NMHA 1GUFA 3L4BC 4OSPA 3ADPA 3DZGA 3H2ZA 3C7AA 3ANLA 2GN6A 3ZWMA 5FFFA 4HFJA 3C24A 4BIIA 3BMQB 2NU6A 3JQBA 2F00A 4GWKA 5CPFA 1J0XO 2GERA 4UUMA 1HLDA 3K30A 4CM8A 3V1YA 2VZ0A 4M49A 3K96A 2PKQO 2V65A 9LDBA 3O9ZA 4NBRA 3VZRA 4L74A 3L9WA 4ND2A 4RCVA 5IN4A 3P7MA 3JYLA 4GQAA 4Q39A 4XQGA 2JFFA 3MOGA 3MJSA 2OXIA 3CMCO 4D7AA 2F1KA 4RF5A 3KLMX 5KCZA 3DWFA 2P9EA 4J3FA 4YTEA 3V2HA 2EERA 1I2CA 4YRDA 1Q0QA 5L53A 4EBFA 3RBZA 3GR6A 3TZKA 3RI3A 4IDCA 4MKXA 3RBXA 2NV6A 4D3SA 3P2YA 3HSKA 5JY1A 1XIVA 4PLWA 2IRWA 4D42A 1OC2A 3I6IA 1TT5A 2X1HA 5L3ZA 3PVZA 3OJLA 4TKLA 3WWZA 2D8AA 5C7OO 4Y98A 3K92A 4CR8A 5TQVA 2DBRA 3AOEC 4JJFA 3GDGA 1N8KA 1H2BA 4WGGA 1P45A 5JS6A 4WUVA 1R0SA 1T25A 5KNLA 3B6ZA 1GTMA 1OZAA 2CVZA 5C37A 3ITDA 3L07A 5G0SA 1HDXA 3FPLA 1UJMA 5G0UA 3EVTA 3M2PA 3VZQA 2IE0A 4R9SA 2E4AA 3RVDA 3ROMA 5JPIA 4WLNA 1E5QA 1KEUA 1IHYA 3DTYA 4YAJA 4NU5A 3H9UA 1HXHA 4ND4A 4MIYA 1KBZA 5EQFA 4W99A 3WGHA 4KMSA 1HSOA 3TFQA 4GAEA 5F3RA 1D4FA 1UP7A 5K6AA 2Q99A 1T2EA 2RAFA 3IAHA 4RF3A 3DBVO 4FFRA 3PQFA 3SC6A 4XJTA 1KS9A 4JJGA 5L9AA 3RC2A 4OSOA 2YQ4A 4DBZA 5BSEA 2BRUA 4RL6A 4CR6A 1LSJA 3VPFA 1SEVA 1K89A 1V3UA 3PP8A 3HFSA 3VC7A 5L40A 4JLWA 4QO7A 4I08A 2I5PO 3MJ4A 3VPHA 1HDGO 1OOEA 2GN4A 1PQWA 5TRTA 1Z45A 1LBEA 5JY6A 1TI7A 4IGEA 1W8DA 3ST7A 1P1HA 2VTEA 1JTVA 3Q6IA 3KSDO 1EBUA 3CZMA 4ZN6A 3BTOA 4BKPA 3AWDA 5JC8A 1Y8QB 4B3JA 2TMDA 1BW9B 4DLLA 4UAGA 3IMFA 1V0JA 1NHWA 4UEKA 1EVJA 3DZBA 2O3QA 4D0RA 4MKRA 4R1SA 3WSVA 3GAZA 5JMPA 1DSSG 2CZCA 1QYVA 4WLUA 1YS4A 2Y1CA 1UH5A 1WMAA 1HRDA 4PLCA 5TS3A 2Y1DA 3HDHA 3I5MA 3ASUA 1I24A 5CDGA 2RHRA 3LVFO 3FBGA 2ZJ1A 2FPGA 1B15A 4I9HA 2ZKLA 4WE3A 3TL2A 1VSVA 3VHRA 4YT8A 2ZTUA 4E5MA 4R3WA 1QG6A 3SXPA 3LT1A 1SOVA 4R5MA 4N5LA 2TMGA 2V7PA 3GMDA 4JBGA 1K6IA 3TQHA 3PJGA 4TWRA 5DOZA 4R01A 3O8QA 3PJEA 4RLSA 2ZIZA 2FN7A 1PZHA 4OL9A 3JYNA 4CL8A 4E2ZA 2VN8A 1LC0A 1YJ8A 2EP7A 3KV3O 5DOVA 4BNIA 3CPSA 2SCUA 4E30A 3PHLA 2H5LA 4ZQEA 1NVGA 2PH3A 2NTNA 3KM0A 2CNBA 2PTGA 1D3AA 2ZB3A 3D3WA 1ENPA 2VCYA 3AY3A 3UKOA 3L4SO 3ZGYA 1TB4A 1AHIA 3CE6A 4FGWA 4RVFA 1GV0A 1DIGA 1AGNA 2G1UA 4J91A 4K6FA 2Y0EA 4E5NA 2UVDA 2AQHA 3L0DA 3H2SA 3RASA 3HUDA 1NVTA 5DBGA 3JQ7B 1DHTA 3IDSA 3GEMA 1P1FA 3B1FA 1I10A 3GA0A 5F21A 3ZH2A 5JYEA 3TN7A 5T5QA 2PZJA 3D4NA 1ZMOA 1N9GA 3ICPA 5JCJD 1PJLA 2FZWA 5AXDA 4PLGA 4AJ4A 4O1MA 5IAAA 3VH3A 4FJ2A 3T7CA 4KDFA 4JXKA 1DBVO 3B1KA 4UREA 5THKA 2Z95A 1VE9A 4AG3A 3ONDA 4ZQBA 1RM5A 1OAAA 4NHEA 1VRWA 4DC1A 5BSFA 3GDFA 4DWVA 1YL6A 5AYVA 5AXCA 2D4AA 5EQDA 1IHXA 4J9VA 4W9NA 2WYVA 4YAEA 4TSKA 3DZIA 2YDXA 5KVQA 4R4JA 4AJEA 1KOLA 4MVJI 3HDYA 4RVUA 4CV0A 2NM0A 1N2SA 3HWRA 1HKUA 5I7FA 1EDOA 1OBFO 3AW9A 4BQPA 4YRBA 1EFKA 3HB5X 1C1DB 4P38A 4A27A 1GCOA 1Y6JA 4ZHSA 5GZ3A 2J3JA 2AHRA 2C2XA 5JCXA 4BO1A 3ZV4A 4E6PA 1U8FO 3MOIA 1ZZEA 2ZK7A 1E92A 2IEBA 2JHGA 3FCOA 4EDFA 4W4TA 3X2FA 3EUWA 5KIAA 3H5NA 2NWQA 3C1TA 2OL4A 3Q0EA 1WZEA 4E2YA 5I9LA 1V35A 4K9DA 4J4BA 4CUZA 1K6XA 2WE7A 1IZ0A 5IDQA 3LC7O 3RKRA 2PD3A 5DCYA 5JAIA 1KY5A 1W0CA 1XWFA 3DTTA 4M54A 1CQIA 2VQ3A 3EW7A 5H83A 2FHSA 1HDOA 4R3NA 3F9IA 1FDVA 3NX4A 3QWFA 4ALKA 1GEGA 5M6DA 1L1FA 5ILOA 2J5RA 4YT5A 4WNCA 3DBLA 3ONFA 1M6HA 4MVJH 1YQDA 1NP3A 4XQEA 3JQ9A 5EJ2A 5CAEA 3C7CB 3BHIA 3ZWNA 4XX0A 1MC5A 1P0FA 1U2DA 1E7WA 4NBUA 4TVOA 1CYDA 3GRKA 4UVGA 4Z9YA 5FWNA 3LF2A 1GDHA 1NHGA 1ZK3A 1HYHA 1U2GA 4XYMA 1X1TA 3ANNA 2YY7A 3OM9A 1E7YA 4YVFA 5JE8A 3EGOA 3NEPX 1SO8A 1SMKA 4B8ZA 2GCGA 5KKCA 1UDBA 2FMUA 3DOJA 1H9AA 4FC7A 4UUPA 5DT9A 4K6CA 1CWUA 1Z74A 2PKRA 1IOLA 4U8GA 5CDTA 2FSVA 1E6UA 3QWBA 1XSEA 1GQQA 2RH4A 4JNKA 3UICA 1WLYA 2OMEA 2GDZA 2Q1TA 5BQFA 5CEEA 1TEHA 4U6SA 4MVJF 3TJRA 3EMKA 1EZ4A 4E4YA 4J7XA 3KUXA 2Y66A 5DBIA 3GOHA 4II2A 2EHDA 2GF2A 3OIFA 4XWYA 4QECA 2AEFA 4UVIA 1YL5A 1LRKA 3GQVA 3DAFA 4Q3BA 1ZO8A 4CJXA 4FOSA 3WQQA 1NQOA 3ZWPA 2RH8A 3D5TA 3NTQA 1R12A 1TT7A 4RZIA 1LSOA 3RFVA 3F47A 1RYEA 1N1EA 3GMSA 3CUKA 3E5MA 3E8XA 1T2FA 4WEQA 4IINA 5G4KB 4E32A 5IXYA 3L77A 4GX2A 4WNIA 2O4UX 1EVZA 4XKJA 4YJHB 5J23A 3NT2A 5JO9A 3QVSA 2H9IA 3GPIA 4CM9D 4IJKA 2ZYGA 2PY6A 2JFGA 2O23A 4BKRA 1FJHA 3R1IA 1PJCA 5HBRA 3GVCA 1FMCA 3RU9A 4WK6A 5IG2A 1LUAA 3DFZA 4Q3CA 4Q9NA 3ASVA 1LDBA 3BHJA 1SNYA 2AW5A 3F5QA 1TVEA 2Y68A 1CRWG 5JBIA 3N74A 4U6QA 1GAEO 2UUOA 4K1LA 2HMVA 2NU8A 3AI3A 4J49A 2B4QA 1IPEA 2B35A 1UAGA 3AUUA 3MJEA 3DAPA 1JAXA 1DFHA 2X86A 2ZB4A 4WASA 4BOYA 2B4TO 3BMOB 4E33A 1V3VA 3ZHBA 2Z5LA 3OJ0A 1T4BA 1B3RA 4JQCA 3FHLA 2YQ5A 3W8DA 5EERA 4CR7A 1XA0A 2RBEA 2Q2VA 1BXGA 3TWOA 2H1SA 3LU1A 5B37A 3ZZNA 2PGDA 2FR8A 2BKAA 1H0KA 5G2OA 2DLDA 1QSGA 3LT2A 3S2IA 5IF3A 1L7EA 4CLRB 4HX5A 3UOGA 4P8RA 1H9BA 3DAGA 1E6WA 3JCZA 1YWGO 1JKIA 1YXMA 5T6BA 2I76A 1FDUA 3R0IA 4D41A 3K2EA 4DPMA 4Z9FA 4NJMB 4Z3DA 3UGKA 1NFFA 2NVUA 4PLFA 2AQ8A 3G17A 1ZEJA 1FXSA 1YRLA 1XEAA 2P4QA 4OOEA 3H3JA 3G0OA 3GC6A 3JYOA 4FFPA 3DMTA 4MIOA 3MTJA 3I9KA 2IDZA 5FF9A 1K5HA 4BV8A 2BI8A 1ISGA 3P19A 3UF0A 4CQLB 2EKQA 4F6CA 1E3SA 3S2GA 7ADHA 4J43A 3PK0A 3ZW8A 1ZK1A 3U62A 1I33A 4N54A 4OHUA 4U7WA 2DBZA 4B7XA 1GADO 2EWMA 1XKQA 2B0JA 2C0CA 4PZDA 3NV9A 3K5PA 4CV2A 5CDUA 2HO5A 1HZJA 1MLDA 2YUTA 4GL4A 4HUJA 3VTZA 3D3WB 1E7MA 3CXRA 3RUHA 5TIIA 4QO8A 2QRLA 1ULUA 2DFDA 2YHUA 1I3LA 5DN9A 5L7YA 1KYQA 1J49A 4WCDA 2J3IA 1LU9A 4L76A 4JGBA 2DQ4A 1KERA 4XR4A 4B4OA 1PGNA 2VWPA 4A7PA 3O8QB 3MJTA 4AJLA 3KZVA 3K73O 3FRJA 4XQCA 2Q46A 2I67A 2NUAA 1ZSVA 5A03A 4DBVO 3H9EO 5KJ1A 2VHVA 2HCTA 5KVCA 3DBHA 2UUPA 4IIVA 3Q2KA 4ZQGA 4AICA 4XDZA 4YRAA 4NI5A 2VNAA 1WDLA 1A71A 5A4DA 4QSMA 4XA8A 1LA2A 1P1JA 3OA0A 4WLOA 2QYTA 3VTFA 4BNXA 5L4SA 2VHYA 5CDSA 3D0OA 4J0FA 2AEJA 4LVUA 4RDIA 4ZQHA 3UCFA 2AXQA 1TLTA 3RBVA 1T2AA 3AI1A 3E48A 1B3BA 2IYOA 2D5AA 4JROA 3ZWVA 1K0UA 4II3A 5KTKA 2W90A 4H16A 2GO1A 3DZJA 5CHEA 1OC4A 1EK5A 1E3WA 1F17A 4OKNA 3WYBA 2FY8A 4YB8A 3VKVA 4XB1A 1Z82A 1A9YA 2A35A 1Q7CA 3ZN2A 1ZBQA 1WWKA 2O2SA 4IY1A 2BF7A 5U9CA 4IDDA 4W7HA 5A04A 3GNSA 3MCVA 3NUGA 2DBQA 2FSSA 1BXZA 2Y1GA 4Y6PA 1HE4A 2Q3EA 2VUUA 4YJFB 2E49A 2C20A 3DZKA 3T4EA 2I3AA 1RPNA 1YBVA 3H6KA 1ID1A 2B5WA 2B37A 3KTDA 3RSHA 3GN2A 3OIGA 4CMAA 1KC3A 4BO9A 2Q22A 3I9LA 3GUYA 3MZ0A 4I5EA 4C7KA 3L6DA 3WX0A 3WIDA 1QR6A 4CM7A 1EUDA 1N9GB 3GVHA 4RQUA 4YT2A 4XYGA 3DO5A 1PQPA 3D4OA 4R69A 1BXKA 1NFRA 2X9NA 4R41A 4KOAA 3KYCA 5ENDA 1PGOA 3C3XA 5TJHA 4I8XA 3L6EA 3HB4X 5TT0A 3W1VA 1LQTA 4DREA 4IBOA 5FI5A 2RIRA 3ZDFA 2QIOA 3N58A 4E2WA 1E3LA 2QRKA 2VHZA 4BGVA 4DRYA 3GF4A 2VZ9A 2DKNA 5FEUA 2X58A 3ZU4A 1GV1A 2BELA 3ONEA 3Q11A 3ROQA 3WDSA 1K2WA 1AXEA 2GD1O 2W98A 1LC3A 4HP8A 4AJ2A 1JAYA 1YGYA 3WICA 1GEEA 4FD3A 2E82A 2GGSA 1JU9A 3NGLA 2IZ0A 1DHRA 3OICA 4OAQA 2FWMX 4A5OA 1LLDA 3IUPA 1U3UA 3MJCA 4N5MA 4RDHA 5DNAA 1YOVA 3DZHA 2X7HA 3U49A 1ZXBA 3RFXA 3RJ5A 4DLAA 3GVPA 4FN4A 1CF2O 2R00C 1KVTA 5IXSA 4XRRA 5K0ZA 3QVXA 4ALIA 1B8PA 5I8ZA 5KOIA 4FFLA 3I9MA 3WSWA 3FNHA 4NU6A 3PFFA 4LSMA 1G6KA 4S3MA 4CUKA 1HDYA 3Q3CA 1MG5A 4DC0A 5T64A 4AFNA 3ZNNA 4D45A 1A27A 4GLLA 2BGKA 3GHYA 2AMFA 1V8BA 3JSAA 4PFJA 3VDQA 5KWEA 3UUWA 4MVJG 2X0RA 3VOSA 2ZTMA 4BO8A 1XU7A 1O6ZA 1ISJA 3A1NA 4BKUA 1JWBB 1E6EA 1U9JA 1PL8A 1PJTA 4CLXA 2HU2A 1XGKA 3JQ6A 3C8MA 3B70A 2W2KA 4J0EA 4CM8B 3U0BA 3U5TA 1NAHA 4GVXA 3ZU2A 5A1TA 3U09A 3BMQA 3V2GA 1KVSA 4XIYA 3MWEB 1EE9A 5JDCA 2IZ1A 1GY8A 2P9CA 3ADOA 1QRRA 4LN1A 3SEFA 1LLCA 3I52A 3QJ5A 1DFIA 4IDEA 2EJWA 4GSKA 1BMDA 4EYEA 2CF5A 1T24A 2DUUA 1CDOA 4I9UA 2CVQA 4D3DA 5C7IO 3AOEA 4GGOA 3KYDA 4MJLA 1M67A 1GU7A 1O5IA 1R6DA 2Q50A 3Q9UA 3HDQA 1ZJZA 3GRPA 3WTBA 3ZWAA 2POQX 1H6BA 3GZ4A 3EY4A 3X2EA 4BNFA 2EP5A 4BO2A 1NVMB 1OFGA 1UXIA 1R37A 3JQFC 4OGWA 4DQXA 1GL3A 5L95A 3ZNPA 3WFIA 5EIOA 3E9QA 1DOHA 1I3NA 4WECA 7MDHA 3FSRA 4R9RA 5IDYA 3AU9A 4HXYA 1HEUA 4BKOA 1DB3A 2IEDA 4L8VA 3PYMA 2D3TA 1HSZA 2JCVA 2BFPA 3H5AA 4NBTA 5AXAA 4WOKA 1UZLA 4RGBA 1GZ4A 1MV8A 3JQFA 3HFGA 3WTCA 1UDAA 5TJ9A 4U5QA 2JL1A 4JN6B 1RKXA 3OEYA 2VYNA 3ZWWA 1WPQA 5JAMA 1H6DA 1JA9A 4BGIA 1IPFA 3I3OA 1EQ2A 4RO0A 1LLQA 1ISMA 2BHLA 3GLQA 4M86A 4RPGA 3RUAA 4DQVA 2X5KO 5COBA 2BFAA 3TL3A 3E6AA 3CSDA 1BSVA 4XRGA 5IZCC 2I3GA 1HF3A 2O3JA 2IYPA 4FIZA 1HE3A 4OXKA 3UN1A 1EK6A 4YDRA 2HJRA 2VOEA 3JQAD 1GYQA 4XD2A 3W6UA 1R0LA 1ADGA 4IQGA 4J16A 3GGOA 4IZHA 1EEHA 3OEWA 2OOSA 5A9RA 1JKJA 3GFBA 3V5NA 4IM7A 1EVYA 2LDXA 5HWSA 1C14A 2OBYA 1ADCA 4CMHA 2Q1UA 5L7WA 3DEYX 1E1NA 4HY3A 4CLHA 1E3WB 1LQUA 4E0BA 4BNTA 4CM3A 1NX6A 2X9VA 3BMOA 2VHWA 3FR7A 3GZNA 3PI7A 5KVSA 3SVTA 3KEOA 3JQCA 1KETA 1XCBA 1ISHA 1QKIA 3QLJA 4CM1A 2O7QA 4HFRA 4IZIA 5T73A 2CDCA 1NAIA 2C2YA 3STHA 1AUPA 1E1MA 1LLUA 1IY8A 1PZEA 5L7TA 3GNQA 4CMCA 3DC2A 4AJJA 2HMTA 4XQ9A 2FOIA 6LDHA 2WYUA 2I66A 3GH3A 4FBGA 4EJ0A 4DUPA 3QE3A 3KB6A 3SLGA 1ONNA 4IMPA 1JVBA 2R00A 4P4GA 4CMGA 2PZKA 1NFQA 3D4PA 3UHAA 3JQAA 3VVCA 3D7LA 1DAPA 1DIAA 1QYXA 3ULKA 3E9NA 5COQA 3PXXA 2EV9A 1UAYA 1W4ZA 2NLOA 4DIBA 1O8CA 4J90A 3RQSA 2NVWA 3I9OA 1I2BA 5TC4A 3SLKA 4R54A 4AJHA 1BXGB 1PWXA 1N7HA 1H5QA 1OMOA 2YHIA 4R1TA 3WBBA 2NACA 2Q4BA 1GUYA 5I7SA 1G0OA 1WVGA 2O2YA 3I6QA 4MDHA 2XXBA 3HQ4O 4KWIA 5IDWA 5LCXA 4Z0PA 3LC2O 1C0IA 2GASA 3G3EA 4G65A 3TZHA 3W4IA 4BO7A 1MUUA 5KJCA 3FD8A 4AJPA 1GFSA 3WB9A 3AUTA 2CDAA 3FF4A 4A2CA 3WFJA 4X54A 3IS3A 5I9MA 1NPYA 1P1IA 3G1TA 3GY0A 4WCFA 1PL6A 3NTRA 2Z1MA 4YT4A 1T26A 5FI3A 1U4OA 3NKLA 1FK8A 5F5NA 2H6EA 2NVBA 1T4DA 1ZXLA 4PLZA 3U4CA 1H2HA 5T8KC 4A03A 2HAEA 1F14A 4YAKA 3FNFA 2DBVO 1ULSA 5L51A 4LMRA 3ETGA 2GZ2A 1B14A 3JD3A 4EJ6A 5LDHA 4MPDA 1T1RA 2JFHA 2X9GA 1EUCA 3FNEA 5JDIC 3ORFA 2CDBA 3NDIA 3WJ7A 3ROKA 3CTMA 2O3TA 2WD7A 3UH1A 2CVOA 4EZBA 2VRBA 3KETA 3IUSA 1C0PA 1E3EA 3JQDA 2C29D 1DFGA 1BGVA 4ZQFA 3COSA 3PWKA 4L9RA 4CQMD 4CM9A 3WXBA 4JCOA 4MP6A 1SAYA 3JD1A 2DTXA 5HRUA 2WYWA 3VZPA 1DIHA 5A9SA 4EUFA 4ZJUA 1RYDA 3JQ7A 3V2UA 4WCFB 4A26A 4BNGA 2PLAA 4YBZA 1CJCA 4IS3A 1HWYA 1H6CA 4R1NA 1U5CA 5JC1A 1R4NA 1LSUA 2ZCUA 3TRIA 1WZIA 3UCEA 2EJVA 2QZZA 3H8VA 4D44A 2OZPA 1YDEA 3PWZA 4UVHA 1HETA 1EE2A 1SEPA 3H7AA 3WBFA 3S2FA 3C85A 3ZI0A 4ND3A 3RUDA 2HJSA 3DQPA 2HDHA 1Q7BA 3BTSA 2D0IA 2RHCA 1DRUA 3H3FA 2XF8A 4ILKA 4XYLA 1WDMA 2VWGA 4B3IA 2B5VA 3ETEA 3RU7A 1UXJA 2GPTA 4YXFA 1Q2XA 3ZWYA 1PGJA 2PGLA 2FPPA 3AM3A 3DDNA 3FTPA 1I32A 5HA5A 1E3JA 3I1JA 4RVDA 1U4SA 2XAAA 1S7CA 4BMSA 2DU8A 5DDIP 3AUSA 5TF4A 1IUKA 3VPXA 4EITA 1LI4A 1RM0A 3FBTA 5JCJA 5EMHA 4DGSA 1VJ0A 4OYRA 4LCJA 1DC4A 3BAZA 4DIFA 3UW3A 3OIDA 3KYCB 4PZCA 3WMXA 4DTIA 4KUEA 1QLHA 4DL9A 1ZMTA 2QG4A 1JVSA 1QLJA 2VUTA 4Z0HO 2QW8A 3JV7A 2D2IA 3ROPA 3VDRA 2C7VA 4BUCA 1TA4A 2EXXA 3NYWA 1YO6A 1YVEI 3HN2A 3KBOA 1I36A 3LT4A 1FDSA 1EFLA 5ER9A 5LDGA 3ZNOA 1Z6ZA 1GUZA 1HDCA 1ZFNA 1M75A 1NNUA 3EZLA 1YONA 3LYLA 4NK4A 4QFDA 5HS6A 4HNGA 4IGFA 3ENNA 3WQRA 2LDBA 4KQXA 5G4LA 1D1TA 3PJFA 3W6ZA 4GGPA 4ZICA 1ZK0A 4O63O 4CMIA 2AG8A 4BVAA 2NQTA 1XR3A 1Y8RA 1ZSNA 3PPIA 4NJOA 5KVVA 3LSYA 3VPSA 4WLFA 3UVEA 1QORA 3WGZA 4HBGA 3QRWA 1IULA 5ITVA 3ENKA 1P33A 9LDTA 4IDAA 4EUEA 3RUFA 1BVUA 4G5HA 2GLXA 3F4BA 1PWZA 4DLBA 3BIOA 1NQAO 1LEHA 3PZRA 1DLJA 1E0DA 3IP3A 2JAPA 3FPCA 4CV3A 3DHEA 3GAFA 3KSZO 3WGIA 2VHXA 5U1PA 3RC7A 1PSDA 1P74A 2WSBA 3WG9A 1CETA 1V6AA 1ZIDA 2C54A 2O48X 3BMNA 4GX0A 4CQLA 5F1PA 1Q0HA 3LQFA 3JYQA 4GMFA 3TNLA 4KTVE 3NT4A 4YQZA 2CY0A 2AA3A 1JQBA 3PHJA 2HLPA 3H4VA 2YFHA 3E18A 1I3MA 1SB9A 2EF1A 5L4NA 4RVHA 2DFVA 2FP4A 2Z1NA 4IJWA 1G1AA 1DC6A 3G79A 1ONOA 1X0VA 2X5JO 2P91A 3JQGB 3WJAA 1PJSA 5C5IA 1E77A 4LRSB 1ISFA 3F5SA 3L6OO 3VVBA 3RUIA 2X0NA 3IP1A 3SX2A 5A3VA 3KYDB 4JP2A 3GVXA 4BMVA 4Z3KA 1DJNA 4YJFA 4AJKA 2VYVD 1VPDA 3OMLA 3WLEA 1M2WA 4INAA 1ZVMA 3PFWO 1H6AA 6ADHA 4I9NA 1DIRA 3QVOA 1BG6A 4LGVA 2X0IA 1I5RA 4M8SA 3QV1A 1ZEMA 4NDNE 4D0SA 1DJQA 1YKFA 1AHHA 3LT0A 3PZBA 3K8ZA 4CMBA 1IE3A 1C0LA 2OP0A 4PZEA 2ZB8A 4E2XA 2B4RO 4NBVA 1E1KA 3PLRA 2EKLA 5F1KA 2CSUA 4CLEA 4NFSA 4BNYA 3VPGA 1U8XX 1ARZA 3NGXA 3TSCA 1T2DA 4PLHA 5TGDA 1C1DA 4JIGA 3RC1A 1ZK2A 4AL4A 2JCXA 1X1EA 1ADFA 2P9GA 3JQ9C 4PCVA 1F06A 3RJ9A 4LK3A 5A3JA 1X13A 2HRBA 3ZV6A 1X7DA 3WR5A 4BV9A 1LRJA 1HYEA 4RPLA 4MP8A 4QXMA 2OO5A 4L0QA 3W4JA 4TRJA 5KKAA 1PJ3A 3WIEA 1MFPA 2W8ZA 2X6TA 3GG2A 1ORRA 4LSWA 3I83A 2IZZA 1SZJG 3M1LA 4WCFC 3HZZA 1VSUA 1N5DA 4CMJA 1YH3A 2ZJ0A 4BQRA 1O9BA 1Y1PA 2PWZA 2XPCA 2ZQZA 4OKIA 4RPKA 3CH6A 1JN0A 5BNTA 2PK3A 3MEQA 3FNGA 4BMNA 1YBAA 5JXWA 1YQGA 3CEAA 3ZV5A 1DDOA 1LDMA 5TNXA 4B7UA 2Y05A 4A10A 5IZ4A 3OJOA 2Y0DA 3WGGA 3D5QA 1A7AA 2AE1A 3AY6A 5H81A 3PEFA 4CMEC 3Q1LA 3IKTA 1ZJYA 2OORA 3OF2A 1KIFA 4J1TA 2GSDA 1ISIA 3INTA 3PRJA 1YBMA 2HMSA 1MXHA 3IL2A 3I4CA 4P4LA 2PH5A 1PZGA 4WLVA 2DTEA 1L7DA 4D46A 4CLOA 4IDGA 3UCXA 3M6IA 2CUKA 5MDHA 5CEFA 2RCYA 3PGJA 4MVJE 4CM5A 3OJEA 4RF4A 4MIEA 2I9PA 2HMUA 4R5HA 1B8VA 3D64A 1VJ1A 3IQDB 3DXFA 3CMMA 2HUNA 4ZU3A 3UFXA 3KSUA 3PIDA 1BRMA 3VAZA 1YOVB 1P1KA 5DCWA 2WD7B 1HE2A 1VM6A 2NTVA 1J6UA 2J6IA 4IPTA 3CINA 2WTBA 3JD0A 4BO0A 3ETDA 3C1OA 2WDZA 1KC1A 1FF9A 4NR0A 4UULA 5F5LA 1ENZA 5IZCA 3TZ6A 4UUOA 3ABIA 4NH4A 3PQDA 3TZQA 1XYGA 2DVMA 2JD0A 2Q49A 2VUSA 5ITWA 5GZ1A 3WGQA 3U9LA 1EDZA 2NU9A 5AOVA 5J9GA 1KEPA 2Q45A 4WEOA 3NDJA 5IDXA 1UDCA 4G81A 5BR7A 4RQTA 3A4VA 5DF1A 4JP3A 4NZ9A 3PJDA 3PGXA 4XGKA 3WNQA 2YJZA 3TDKA 2JHFA 1X14A 2AEMA 3PIIA 4D79A 1BDMA 5F1OA 2OUIA 1X7GA 2HK9A 5DZSA 5THQA 3QQPA 3RFTA 4FCCA 4FB5A 2HK7A 4DXHA 3S2EA 1QMGA 4NQZA 3M2TA 3I9JA 5BSHA 2C59A 4GBJA 4F45A 3NJ4A 4YJHA 3TFOA 3QVTA 2J5KA 1Y5RA 1Y5MA 3F1KA 1QYWA 2UYYA 3I23A 4DYDA 3INGA 1ZSYA 4LISA 4IS2A 2PNFA 2QYSA 4L75A 1NPTO 1F12A 3C7DB 5I8WA 1HLPA 1NBOA 2D1YA 3DZFA 3GNTA 5B1YA 1UZMA 4MVJM 2P5UA 4L4RA 4B79A 1NPDA 3S55A 2X23A 1X7HA 4F46A 2JD1A 2ZTLA 4XCVA 3TZCA 4PN3A 4RPJA 4NG5A 5EESA 3OA2A 5TSDA 4PG6A 4LW8A 4I5FA 3RC9A 2A94A 2D59A 3KYBA 5HM8A 4DA9A 1IB6A 1TXGA 1XQ6A 1H93A 2Y0CA 3IOYA 4BGUA 2ZQYA 4O6VA 4Q3AA 4CODB 4CM4B 3PDJA 1KVQA 4CPDA 3OECA 1ENOA 4PRLA 3A14A 4PVCA 4QFCA 1HDRA 4KDEA 1J4AA 3EK2A 1DEHA 5K6AC 1A72A 4XGIA 3QVWA 1WAMA 1PTJA 1LDEA 3OQ1A 4J2HA 1I2ZA 2BGMA 1UXKA 1HL3A 3WGTA 3AM5A 1QP8A 2V6FA 2PKQP 3FR8A 2FZEA 1BHSA 4CMKA 2NVUB 3K2BA 1F8FA 5A5FA 1YB1A 5ENVA 2WD8A 4FSHA 4DIOA 4IQ0A 2CFCA 4M89A 4JJIA 3E03A 2O3SA 1FDTA 1ZW1A 5T8KA 4TKMA 4BHTA 1D1SA 1R16A 1SOWA 4CLOB 1E7SA 5A02A 3GG9A 4FQ8A 2GYYA 2Q1SA 4NNJA 5ER6A 1QYCA 2VOJA 3ZWBA 5KJ6A 3O03A 1E1LA 1MFZA 1PEDA 3DONA 4GWGA 3PLNA 5ADHA 1MA0A 1VL8A 4DQUA 3EDMA 2YV1A 4L73A 2D5CA 2HRZA 3V8BA 4R16A 1D7OA 3BHMA 3NDRA 1ZCJA 1R15A 3JQBC 3T7EA 3B20A 4KUGA 1KVRA 3TPCA 3H65A 1PZFA 2UAGA 1XHLA 1HE5A 2PZLA 3GN1A 1Z73A 3PTZA 4EW6A 3L4BA 4KQWA 5IFLA 4HWKA 3RWBA 4XYBA 4HKTA 4W6ZA 4Y9DA 1VJTA 4AJ1A 3QWIA 3ZHZA 4Y6SA 1PJ2A 2A4KA 3DL2A 4PVDA 3EAGA 3AJRA 1I8TA 4DYVA 1VKNA 4XGNA 2E37A 1PS9A 2FRDA 3KLPX 4GX1A 4Y8VA 2G0TA 3KEQA 1CQJA 1HTBA 2CMDA 3JD2A 5COAA 1YDWA 4MINA 4E21A 4PG5A 4HV4A 3EHEA 1KVUA 4ZA2A 5JNLA 4GLOA 3GEDA 2EG9A 3E1KA 4F3YA 3U4DA 2A92A 3KHUA 5TX7A 4CMIB 5JAZA 3HHPA 4FS3A 2DPHA 5ILGA 4U0JA 4ND5A 5CDYA 3ZHYA 2WM3A 2B69A 2O50A 3NAQA 4J7CA 4BNLA 3IIEA 1PJ4A 4OQZA 2ET6A 2R6JA 4D43A 4BNJA 2EGGA 4BNZA 4CLDA 1QYDA 1VL0A 4MKZA 4NK5A 1NXQA 4A0SA 1I01A 3RIHA 5K9ZA 4BL5A 5A9TA 1GPJA 4WOJA 1DO8A 2ILTA 5A5EA 1YL7A 2NSDA 3IKVA 1KY4A 3DMYA 4ZRNA 1C0KA 4PLTA 3ITKA 3CIFA 1E5LA 1Y7TA 5JYFA 4PG7A 4QEDA 4QT0A 3ICCA 2A9FA 2GNAA 2C7GA 3S1LA 2R2GA 1O0SA 1PR3A 2J3KA 1B0AA 1B7GO 2C5AA 2P2SA 1Y9EA 4R68A 4RZHA 4YEDA 4XB2A 2FPIA 4NIMA 3SJ7A 4ALJA 1I30A 3R6DA 1WW8A 4Z0TA 4MP3A 2NU7A 5I9NA 2QQ5A 3K6JA 1GZ3A 2E6UX 1ZKMA 3BA1A 5JLAA 1YB4A 5BNFA 4CV1A 1IL0A 1UR5A 3HDJA 1JDJA 1ML3A 1B8UA 3ZV3A 5ICMA 2YFQA 5CG2A 3QA9A 2JAHA 4YCAA 4B4UA 1E7QA 1MG0A 4E5PA 3OQBA 3DR3A 5EN4A 1Q7GA 3RCBA 3CZRA 4GPD1 5JMWA 1ZUD1 5CG1A 4PLVA 2VYND 4A73A 2UDPA 3VH2A 4BNMA 3DMTC 5I7EA 1PS8A 4YJGB 4B7CA 1GPDG 1JW9B 2ZATA 1P0CA 1ZK4A 2X22A 5CP8A 2J8ZA 1DLIA 4RORA 2BGLA 5U4QA 2Q2WA 5BNIA 2BFMA 4MVJD 3DBHB 4UUNA 4FW8A 2P5YA 1HDZA 5JO0A 2YV2A 5JYDA 4BNWA 4FPXA 4LVCA 1AE1A 2ZYDA 1RM3A 5L45A 3M1AA 2AG5A 4ALMA 4H3VA 2W4QA 3RD5A 5JFOA 4I5DA 5IJZA 4TRMA 2EEZA
chains in the Genus database with same CATH superfamily
5IMSA 1DRVA 3ZCPA 1GCUA 4L7QA 2XMBA 4JHXA 2DF8A 4E1BA 1QP7A 3TNDA 1SVOA 2YV4A 4BS9A 4BWGA 1ULHA 1SKBA 2GUGA 4XGRA 2TMYA 3K31A 4WBSA 5JDCC 3VHQA 3PC8A 3QIVA 5ERYA 5IBCA 2B7CA 3FOCA 3LUCA 2Y99A 3QBDA 4OMUA 1ECCA 4R98A 1K6MA 5B12A 2PZBA 1TZJA 5KTMA 3BBLA 1LDYA 4YACA 3N8KA 3VHXB 4IL5A 4IIGA 2H4ZA 4ZQFA 4JHLA 2V5AA 2X5NA 5D01A 1NW9B 4IRMA 4LXYA 4BNVA 2EW8A 3NNSA 1VKOA 1XJWA 1LXCA 4H6PA 3QY9A 1UPAA 1DAOA 1ZVQA 2P41A 1HRKA 2R4TA 2BKLA 3BB1A 4AJOA 2H4YA 1ND6A 3NANA 2CXOA 2Q1XA 4P35A 3RT7A 1KRXA 3AOGA 1GZ6A 3MM4A 2DUWA 3ETNA 2BD0A 2MSWA 4JNCA 5H82A 4AVYA 3HK2A 2X0KA 5E0KB 1SVUA 1E2EA 4IUDS 1I72B 2WJJA 1KI6A 1UT6A 3ANSA 5A05A 4Z9BA 4CM4A 2ZJ2A 3EGXB 1GR0A 4HH4A 2NP7A 4L5BA 4RHXA 1QRTA 4J6EA 1VHTA 4RH1A 1ZNQO 2QZ4A 1SUSA 3DVAB 3GEEA 4AN1A 2CXRA 2R79A 4GZMA 4J9UE 1J39A 5A4MS 4AZVA 5D85A 1V4NA 1CDEA 1PFKA 3IAS6 1OWLA 1YQXA 3D7NA 1CJSA 1Z13A 1RZRA 4GKAA 1Y63A 3EIQA 4L5YA 5ICCA 1E3IA 1W93A 4IUBS 1EBFA 5HS4A 5IT0A 5CVJA 1CB7A 4DJJA 2PRYA 4O5AA 1IN5A 2CLHB 4KSBA 1UPFA 3FWNA 4Q02A 4PBSA 1LNQA 4PYRA 2OZLB 5ALDA 1QE5A 2IIQA 3ZVRA 4FEAA 4C5BA 2WLTA 5IN5A 4TYYA 1KAOA 2GFQA 4YAFA 4CL3A 3BRCA 2IHVA 3L0OA 4A0FA 3KG2A 4RBNA 2F8LA 1NC3A 4URFA 3JRNA 2QZ9A 3ROTA 4CQJA 4CEIA 4RF2A 1WP9A 2NTJA 4NY1A 3IEPA 2FP4B 5EMNA 1IATA 3EG9A 3UYLA 2OQ2A 1O5TA 2WTEA 4YV7A 1CQZA 2PTHA 3BZUA 5BWNA 1P77A 4Q18A 2FUG6 2GBGA 1L4YA 1G0NA 2ZAYA 5SZIA 1E2HA 4G9GA 4EG0A 1UJBA 3GPDG 4JUAA 2A5LA 3U7QB 4B45A 5IASA 2Q3LA 1VC2A 2G36A 3SS9X 4XJSA 1E2NA 3OVMA 4XWTA 4Q4HB 2JZNA 4MI6A 2FPLA 5IM5A 3STTA 2BI4A 1ZMBA 1BYUA 1NNSA 8ADHA 2IXBA 1AS3A 1UOQA 4C7JA 3GZNB 2FDRA 2QYHA 4L7VA 4LZPA 3P0FA 2QTRA 3QLTA 1CY2A 4KR9A 3WE7A 2VJPA 3DXZA 1P9LA 1SB8A 3C7TA 3IAFA 2II6A 2QVYX 4MVCA 2BZ1A 5HQJA 3QTLA 2YY5A 1NUTA 3IT3A 4GVLA 1YB6A 1GQRA 2O2XA 3KRTA 1H2YA 1X74A 2BKVA 2VJYA 4KSYA 1DINA 5DKFA 2ZIAA 1ZH8A 1Y48E 4TM8A 4YX9A 2EZUA 2XECA 4B3HA 2HSDA 1J8FA 3OO0A 4KQIA 1M10A 5DWQA 1WB4A 2O6LA 4FSDA 3W5BA 1DC3A 2HTEA 2P2ZA 2IJGX 3G7NA 3TKYA 4EGFA 1GTJ1 1KEVA 1IRXA 3BXXA 1V5IA 3W8EA 5H0IA 2DXIA 1CZLA 3TLKA 7MHTA 5AKJA 3OEHD 2OYSA 4V3CA 3SJCA 4PCUA 2R8RA 3K1ZA 1Q3KA 4KB5A 2JFXA 1HT0A 4IDHA 4Q9LA 3K9HA 1E58A 3TVTA 1U3TA 1Z6TA 4ZGWA 7YASA 1JTFA 4HAIA 3WWYA 5JNTA 4A91A 3KLBA 5LA6F 1KO7A 2ILVA 1NR1A 2X5OA 2P6UA 1HEIA 4LTNA 4M0PA 5HEKA 3TD9A 2PH7A 1UKYA 1QH8B 5DK4A 3MTBA 1WDKA 2J0UB 3LIPA 2RGYA 4OQ4A 1OYYA 1R4MA 1N92A 4YS6A 4QUEA 4EJSB 3HYSA 5J2UA 2B61A 4QUIA 2FZVA 4PF1A 4UAJA 5HF9A 5EMLA 1M2FA 1T3SA 3B8EA 2XMPA 4QUKA 2NU9B 5IXYA 4ZD6A 1A98A 4M83A 4UW9A 4C78A 5BURA 1X70A 1AKMA 2FFJA 4DPLA 5JBQA 4N3AA 5DB4A 1Z7GA 3ZZ1A 2W8BA 3G2NA 1VYVA 4XSVA 3DZ4B 1UXHA 4LDQA 4RSGA 1XP5A 2LCQA 2H0QA 3KJQA 3HNRA 3DPIA 4QHYA 4IXDA 5I5EA 1J0DA 3VI3B 3FDJA 1MMFB 1KAQA 3JQEA 4KWHA 3U4IA 2VT2A 4RY8A 4P32A 4KQJA 4DQ0A 3W6NA 2C8JA 2CLEB 2QN9A 4UQLA 4QX6A 1X7YA 4YMWA 2BSXA 3VKHA 3ZLBA 2P7IA 4RE6A 1H2WA 3EQ2A 2FN9A 3SBOA 5JYAA 2ROQA 1F51E 2GXAA 4GHWA 3QTTA 3WZMA 2EKPA 1XD2B 3I39X 1E1YA 1A9ZA 4DLPA 1C5KA 3RGGA 3WL7A 1G8GA 2HU7A 1GNVA 5JW6A 2QTTA 1A2OA 4ND8A 1N6OA 1SVWA 1GZUA 5FWDA 4HEA6 3TH5A 3SBDA 1YBFA 1NW7A 3WYEA 4DV1B 1FPQA 2DERA 5IC5A 4J2OA 4QBGB 1EG7A 5HJ5A 4KR7A 1DQNA 3C5CA 2EAUA 4NAHA 1L8XA 3IIKA 1SXPA 1Z3CA 1G21B 2AJ8A 2R6DA 3AR3A 2QD4A 2V3CC 2YVAA 3NM5A 4EAQA 3TI7A 3C3KA 4RYDA 3KPJA 1XTSA 2W83A 3EP5B 2D7DA 4BKQA 4H15A 4WKBA 4ENUA 5CLLA 1RQPA 1C2TA 2CHUA 4REOA 3QF7A 5H3HA 1M8GA 1ZD5A 3G2KA 2DT5A 5GINE 1W19A 4FWBA 3TW8A 2ZRDA 1Y9AA 4WPGA 1HI9A 3BJEA 3BMCB 3DYVA 5JECA 4OJQA 4UE3S 1OW3B 3D1LA 1Z26A 1FCJA 4DAEA 4WZBE 3A1SA 3LZ6A 3LRXA 4H0CA 4R40A 1ZS9A 2QX4A 4Z54A 3T41A 3JTMA 4EVQA 2PL3A 1JDBC 1G8FA 3HMKA 4RZ2A 5C51B 2HIGA 3KFVA 3X3HA 4F38A 4NBWA 2JKZA 4BX9A 5C8VA 1PR5A 5C8ZA 5FAXA 4YQEA 2ZUTA 3FPEA 2WHEA 3GJ0A 2J5QA 4EL5A 1RRVA 1WP4A 4JWKA 5HIIA 1GQ2A 3BFXA 1IZ9A 4BYGA 1L7QA 5AQ1A 4D5EA 2FCAA 4WA8A 1BVYF 1RQ7A 3GUCA 2WHXA 2R0QC 3PGA1 1T8SA 4NCKA 1YCHA 2CWDA 4WLEA 5TT1A 2TMKA 4NFYA 1P1RA 2CWWA 4OHWA 3NJ8A 3ZYCA 4HRAA 1IY9A 4P3KA 5LOVA 1STOA 2IPNA 1H1DA 2JGEA 4LQDA 4M9ZA 3LKDA 2BFOA 3Q8KA 3N5KA 1LDGA 3IPRA 2Y1WA 1XDWA 1R6VA 2XDWA 2RB5A 3PUJA 3W4KA 1XDZA 5CDHA 1V7QA 1Y6GA 2JCYA 2BOVA 1WA5A 3LPLA 4YLGA 4BVAA 1WB5A 2I71A 2CFIA 1QHNA 2WMDA 2X13A 3DVAA 4MB2A 4OXQA 2IXEA 5HX7A 1P9NA 1Z5OA 4IXTA 2E89A 2FB9A 3HNPA 1AUXA 1RWBA 2BKUA 2H08A 4A1FA 3AM4A 4OJNA 2AI2A 2P27A 4UD6A 3ICVA 3CZQA 3FN4A 3LL4A 3STXA 4Q7EA 4IOJA 2H5IA 1NTOA 1MGOA 1H2XA 1OXSC 1KDPA 2QU8A 3F3SA 4HNHA 4IUYA 2GCEA 2V6BA 1FQWA 3E7WA 3EVFA 4H0FA 3TNFA 1N34B 2QTHA 5KNDH 4YJGA 1FDRA 4OHPA 3LDAA 3UJ9A 1C3JA 1W73A 3LW8A 3RSOA 3R3UA 1MHTA 2V7BA 4FOTA 3H5WA 2DWCA 4F97A 3BUSA 4RW0A 4G97A 4DBLC 4IHJF 2J3MA 1H05A 4QU9A 3RIMA 4L6IA 1A9TA 2B20A 5G4KA 4CT0A 2D5LA 2WJPA 3AL2A 3RS8A 4GKKB 2WSMA 5HE9A 4BGEA 4NXNB 2EFJA 3N76A 2FA9A 2ZW9A 4MUBA 1UC4B 1BD3A 1XMVA 1MC4A 1Z7BA 3DHVA 3FOWA 4FNGA 5DHPA 2K2WA 4FJ0A 4E3ZA 4WXPA 3HU5A 4H2DA 2HXGA 5IFKA 1W5FA 2ZJ4A 3KAPA 2UZ1B 1PIWA 1RMTA 1QFMA 3SU8A 5KJFA 5EZSA 2WZQA 2MCFA 4BB6A 1SY7A 1UZAA 2DHCA 1F48A 4OQYA 2C5GA 2IXDA 2C7PA 4OXYA 1RI4A 3DBOB 3E82A 1UDRA 2X8LA 1CUBA 3DB2A 1J99A 1KDVA 2QVXX 3AVYA 1F0YA 1H42A 4O4LA 2Q9BA 4EKDA 2FX5A 2KJQA 1BX0A 5GONA 1K2VN 3OPXA 3W3ZB 4GX5A 1RHQA 3A9WA 2WJ3A 4I6GA 3RVLA 3K0BA 3EY9A 3OIYA 2VWHA 1PT9A 4UU8A 3WMWA 2ZTSA 3TOZA 2ZIXA 3A1FA 5JSYA 3U7QA 4F2HA 3L0PA 2HO4A 2YVLA 4CM6A 1A4UA 4JYPA 3UAYA 3ESAA 1DRKA 3NNDA 5D1NA 4G63A 1XT6A 2DUJA 1Q7TA 1Z75A 3DMDA 1UZNA 3K8YA 3T5MA 4R7TA 1L2TA 3R5SA 3KOWA 3ZCXA 1CIVA 5GZ6A 3PUZA 1U1EA 4G24A 4RLHA 4LZZA 1GXSA 5CFMA 5ALYA 5LJIA 5KC9A 2Q0SA 4JR2A 3QV2A 2GEBA 5IWAB 2CNKA 5K4GA 3TLCA 2GM5A 4W7SA 1KRHA 1BA2A 2WWRA 2ZUUA 3H5TA 4N8EA 1A7KA 1ZITA 2V03A 4OXRA 3DDZX 3WZLA 3IPCA 2H9AA 4IYRA 2PGJA 1NOJA 1VSTA 2YASA 5FYDA 3DBLB 4JLMA 5HTKA 2R2AA 3ZK9A 3M3PA 4ARBA 5IHXA 4D4IA 3LK6A 5B4VA 3IQFA 4P3YA 2IHKA 3NRCA 4WK0B 4CLRA 1G5HA 2ACVA 4C01A 1JQEA 5LNK1 4FZVA 5JSUA 5CT8A 3IHLA 1H69A 2ZJ7A 3A05A 1ANKA 1CD5A 1FVOA 4G0ZA 4NJEA 4NNPA 4QZVA 4JI5B 2INGX 3RVKA 3TTWA 3U5ZB 1O89A 1RS0A 1GVHA 3JD4A 3LDHA 2UUCB 4DCVA 4HPWA 1C7JA 3H9JA 1A7UA 3KVOA 3EEFA 2X14A 4IMRA 3ONVA 1QH1A 4D9MA 4PZYA 4Q19A 1GT91 1SXJE 2R86A 3C3MA 1E3DA 2MINB 4ID9A 4KEAA 4BX3A 5H68A 2FFQA 2JARA 3FYTA 4XIJA 1ZGGA 5SICE 5B4UA 2ZPAA 4HQKA 4F4JA 4QDJA 2GXUA 2V0NA 4BPRA 4EQZA 1YE3A 1OB2A 4RGQA 3VKWA 2EOAA 4R2JA 4QATA 3E3LA 1G5PA 3MINB 1NJ2A 1W6RA 1WCIA 1NW4A 1CDDA 2BBWA 2R7AA 2OK7A 1NUQA 3B6MA 4R84A 1H1LB 1M34B 3MMXA 3PDIA 4UU0A 4KTTE 3W8RA 4C14A 4D4LA 2B34A 2ECPA 3E8SA 2E48A 1CEXA 1PJAA 4B76A 3RR2A 5ES4B 2YHIB 4ER7A 2IH5A 2NGRA 2AX3A 1T1SA 3GRCA 3JAMA 1BJRE 4FJ1A 4KQ6A 1G4AE 1EM8B 5B53A 4IDFA 1Z38A 2ASEA 2JGDB 1J42A 3PPVA 2W6PA 3NHBA 3Q7QA 4JELA 4C0XA 3FDXA 1EX6A 2FFRA 4CW7A 4XI9A 1Y1KE 1A8IA 4EGJA 1GL9B 2J7PA 4ZRMA 3P2OA 1LPPA 2CHGA 3DFUA 1J33A 1Y1SA 5FCDA 3U3OA 3B89A 3I2JA 3MIIA 3A36A 3L4BC 3H2ZA 4U3JB 4DR1B 4KRYA 1J24A 2Z2XA 1V39A 2GN6A 2X1MA 1AGPA 3OAAD 1ZD1A 4BIIA 2NU6A 1U0NA 1E8NA 1ZVKA 3NWEA 5E2IA 4JD5A 4Z1MD 5CPFA 3RANA 1YTUA 4UUMA 2GERA 4LJYA 1HLDA 3K30A 5KSYA 1NMSA 4ZAYA 4B81A 1GKIA 3JPWA 3HACA 1UPXA 2ZQ5A 3O9ZA 2LTAA 3EAFA 5LKRA 1G9XA 1A9XA 2OC9A 5F98A 3ZLUA 3P7MA 4FYHA 3JYLA 4P3NA 1KL7A 3QVLA 4Y2VA 2X41A 4TLBA 5IBRA 4G37A 3R7WB 1DUVG 3VU3A 4FGUA 4AXBA 1O58A 3PEWA 3TRHA 4OGLA 4W1SA 3AEKA 1KDRA 4J3JA 4IO0A 3X1KA 3O7MA 1P29A 3AVOA 3B52X 4NMMA 1DEXA 3V4SA 2JIZA 2IVFA 2IEAA 1I2CA 2QRQA 3CX7A 4NFLA 4LPSA 1U2QA 1Q0QA 5IJ9A 5L53A 1J07A 2HB6A 2OENG 1ZUHA 2B98A 3FVRA 5ESDA 4TL9A 3EF0A 4WH0A 3TZKA 1P4RA 3RI3A 2EFDB 3MLEA 5IW8A 4F9TA 4AURA 2ODBA 3GLVA 3EA5A 2OV3A 3OCZA 5SZHB 2Q5OA 4ARVA 3LZCA 1GTL1 2VIIA 3HJHA 4J0IA 3DE0X 2V8OA 4LZLA 5DWDA 2IHBA 3QUTA 3RS7A 1OUMA 1LFAA 5CD1A 3Q2OA 3ZD6A 2PUTA 4COOA 5CTJA 5EE5B 3DEHA 5L3ZA 3OJLA 1Q19A 3Q0TA 5I9IA 4HLCA 3KOYA 5TQVA 5KSWB 2ZREA 2NV2B 3AOEC 4XSGA 2IH2A 5AJYA 3REFA 4YUAA 3E1SA 3CRNA 1IG0A 1YJ5A 4MRRA 1A7JA 4WUVA 2GBLC 3KKZA 5JU6A 2XRMA 2ID8A 2VXOA 2Q5EA 1GTMA 5KX5A 1OZAA 5G0UA 1E6MA 3EVTA 4MUMA 1VCNA 1RI5A 4GUDA 1M2VB 2E4AA 2HA4A 4WZZA 2WWHA 1TUBB 4OTZA 4E88A 1E5QA 1RJDA 3OM1A 1KEUA 2OGZA 1KAEA 2C2ZA 4NU5A 4YAJA 1UFKA 4D8WA 3RM3A 1V4BA 4ZMSA 1OY1A 4V1CA 3ABSB 3NHRA 4FE7A 5TQJA 1ESMA 1PVDA 5F3RA 1D4FA 3TW8B 4B43A 5HZMA 3VBCA 4WVFA 2Q99A 1T2EA 1TECE 2YWFA 3NWBA 5AJTA 3ETLA 5D8DA 1Z7YA 3MWYW 1Q0SA 2WVAA 1Z6AA 2YS7A 3FVQA 3IGFA 3PQFA 3AG5A 3U1BA 5C35A 4KX3A 4NABA 2AS0A 3G8BA 1E2GA 2J3LA 1SEVA 1V3UA 2YIMA 2QWXA 3CCFA 4LJ8A 5L40A 1JV2B 2RJNA 3A4NA 5EKSA 5JARA 2WF7A 3W90A 3AR4A 4H17A 3DVQX 1JAIA 1ND5A 3MJ4A 3N6XA 3VPHA 5CR9A 5J4VA 4BQEA 4I55F 1PQWA 2ZRLA 5TRTA 1U2RA 1TI7A 3D8RA 1H9CA 1E9CA 1RBZA 2QQEA 3BQMB 4ON9A 1M33A 5MN4A 4IFEA 2ON6A 4I50F 3KSDO 3CZMA 2V7GA 1TK2A 1BE6A 4JUDX 3BFVA 1CB0A 2H5JA 1JJVA 5FPSA 5KTPA 4MV6A 1PVVA 2P67A 4KVFA 4NE2A 1G21E 3DWEX 3RC8A 2ACWA 5LOVF 1BW9B 4DLLA 3WDLA 5IRCD 4RS3A 1UBNA 5K3SA 1V0JA 4YQFA 4KFCA 3D4LA 2B6NA 5EZYA 2F8TA 1L5FA 2R6HA 1T15A 2IVZA 4R1SA 4KIFA 1NY6A 1DSSG 1QYVA 5CFLA 1O95C 2AJBA 1VIAA 4WLUA 3ADBA 1UH5A 3IO5A 1XZDA 1HRDA 2HPVA 1TEVA 4WACA 1B0UA 4I8IA 3FCYA 3HDHA 1SCBA 2OG2A 1YZLA 3ASUA 1I24A 1KJZA 5CDGA 2RHRA 1N25A 3HXTA 3IBYA 3LVFO 2NXCA 4YMSA 4DEXA 4HQLA 2ES4A 3FBGA 1NI4B 3EXHB 2JASA 4WWHA 4D9CA 1PV2A 4G8CA 3U4MA 2FPGA 1B15A 4I9HA 3TL2A 4CU2A 2X4DA 1J56A 1GG5A 3R3WA 3FCXA 5B58T 3TIIA 2ZTUA 4FYIA 4YT8A 4QLAA 3RS3A 1SBCA 2HLDA 2IS2A 3Q3HA 3WKEA 3DZCA 4UQOA 2GH1A 3GXBA 1QG6A 3RLFA 2O7NA 3ADKA 2WR8A 3GBVA 4E4TA 1W2GA 4C4RA 2QR3A 1Z2AA 3SEAA 2TMGA 1I7DA 1X3SA 2PZFA 4Z51A 5AICA 2GEVA 4TWRA 2PFKA 5DOZA 1NVVQ 1QUFA 2I9KA 1Q17A 3P96A 4RLSA 4QPPA 5J5AA 3RT9A 1YB2A 3IIJA 4G5YA 4CWAA 5IT9A 3UJ6A 1PZHA 5CNKA 3REQB 4CL8A 4CF6A 4V0MA 2R66A 4G26A 4KN5A 5CDFA 1LC0A 1C7RA 4FKZA 4HLUA 5DSXA 2HUPA 1O03A 2OVFA 4AX4A 1L5MA 2ENUA 4BVGA 2CN1A 3TLBA 5C7YA 5KYWB 1NUSA 1T0BA 3NWJA 4FD2A 2NMVA 2NPOA 2ZWAA 2PTGA 2CNWD 4K0RA 3LUHA 1CUJA 3L4SO 2VJMA 2FQQA 3DHWC 2QMHA 3KOOA 4QDZA 2D1TA 3KTFA 4FGWA 1GV0A 2P4UA 4L6CA 4R2LA 4RVFA 5FI0B 3RWMB 1XCMA 4DMGA 1G20B 3TD6A 1KJ9A 4E5NA 5EPUA 2AQHA 3L0DA 2W6MA 3CLSD 3HUDA 1NVTA 1MZVA 3VPBA 1YK0A 2C94A 3B1FA 3GEMA 1XF1A 2BCGY 3GA0A 4MV5A 3R5KA 4FK8A 2MMGA 4UBJA 3SF8B 2V3WA 5I48A 3IT0A 4B75A 2IYNA 3MRTA 4EKGA 3C48A 1K4YA 3HP7A 5CNIA 5AW1A 1CVLA 2CLIB 3VR0A 2PWYA 4CG3A 4TN1A 1N9GA 5HKLA 4PZZA 4OI0A 2I4RA 3ICPA 1OROA 4N49A 3OZBA 2OAP1 4GXQA 3CZ5A 4AJ4A 4MKFA 2PX5A 2B25A 5MN6A 1MAAA 3QVMA 1Z5ZA 3ZQKA 4C0HA 3U80A 4QA9A 5HMLA 2KB0A 1ZD3A 3B6IA 1W1WA 3FNRA 3G9TA 4RKRA 4ER0A 4EM6A 1KYWA 1PX2A 3KJEA 4UREA 5THKA 4BZPA 3T3OA 3ONDA 1RM5A 1MAVA 1OAAA 3FCSB 4D2IA 5A4AA 1H3NA 2QAJA 1A96A 1YL6A 1V25A 3LYAA 2ZBFA 5AYVA 4OH7A 1VBNA 5EQDA 3C3DA 3IMGA 5LLSA 2C5FA 8ABPA 3QA3E 5JVDA 3ETHA 4ISBA 4PR3A 4W9NA 4JFAA 3KQVA 2WYVA 4BFCA 1X1SA 3ZQUA 1RQGA 1P2GA 2QM3A 2PYDA 4TSKA 5K3FA 4E4RA 1R2QA 3ECSA 5ARCA 4E09A 4F93B 1KPIA 1YA4A 3P32A 4FFBA 1KQOA 4FMPA 4TOIA 1F8XA 1TZMA 3HO8A 4HSEA 3LJKA 1EGHA 4XEUA 2JJ1D 3AMVA 1EDOA 3NS7A 3WL5A 4XM0A 2MTBA 4DSZA 1EFKA 1TPYA 3HLTA 1VMEA 3HB5X 1C1DB 1MX5A 1UFQA 3U7EB 4A27A 1G6OA 4OB7A 3HLYA 5G1NA 5JH7B 4LX0A 4KQGA 3AIKA 1VKRA 1NULA 2E2WA 2H85A 2J3JA 2NZYA 3COZA 3OFJA 4KBYA 3ZV4A 5K0GA 2C2BA 5TQ0A 4ADSG 4JP5A 5FOSA 1EFPB 2IEBA 5KNBH 1R0BA 4GOXA 5BYKA 2C99A 2WKWA 4Z86A 2YWBA 3H5NA 1QIGA 3DZ2B 5KX5B 5LXTF 3IBSA 3SHQA 3KVYA 3Q0EA 5HFAA 1XEWY 1E79A 4KGVA 4OHOA 3MF4A 4DUGA 3IIMA 3R5FA 1CEEA 5C0OE 4K9DA 3OCCA 1NW6A 4CUZA 4L78A 1YQTA 4AX8A 5B1SA 1PNQA 2J6HA 5C8XA 3CQ9A 2IIBA 2PSEA 5CVCA 5JAIA 1QTQA 2GD0A 3T9BA 1FUIA 1KY5A 1XWFA 3CF6R 3X1MA 1Y0BA 3MD9A 5FUBA 1CQIA 3S6JA 5H83A 1XQ9A 2FHSA 1HDOA 1M1YA 1M2OB 3VYTB 2J6BA 2KMLA 4G9EA 3F9IA 3NX4A 1YHNA 3BD7A 3QWFA 4INJA 4OV6B 1GEGA 5ILOA 2QMOA 3T5BA 4BP8A 4L9AA 1X1QA 1LPNA 4YT5A 4WNCA 4EO9A 5LP6F 1M6HA 4MVJH 3CZ9A 1WV1A 2Z08A 5EJ2A 2G70A 5T6MA 3C7CB 1BOOA 1UANA 4IO1A 5E6RA 5JS7A 1MC5A 1P0FA 2RHTA 3K9CA 3UGJA 2LP4Y 2BJWA 1TCUA 2F67A 3CR8A 1QGUA 5CW2A 1CYDA 4CEJA 1KBOA 2AIRA 2P9FA 1Z0SA 3Q15C 4JEIA 2A6PA 4OPMA 1WB6A 1ZK3A 1HYHA 3ZXUB 1VL1A 4XYMA 4RMNA 2A1TS 1I0IA 3N05A 4Y2XA 3EZ2A 4EB3A 5JE8A 2ZIUB 3F5MA 4JL5A 1SMKA 3BFKA 3G82C 2IFTA 3DTVA 4OD0A 4IWYA 4L0DA 3TK1A 4C0AC 4ZOQI 5IVPA 2ZI4A 3EP9B 5KYVA 1XYVA 1WD5A 1JHPA 1Q1BA 2AFVA 5CD9A 2LIVA 2P62A 4ZC8A 3JAWA 2O20A 3BB3A 3FA2A 4LJ6A 2Z3WA 3P2JA 5KTTA 2ZKIA 2FOXA 4RIHA 3AJ9A 2AUTA 1Z0AA 2HPZA 1IOLA 4CGYA 4U8GA 1E5VA 2FSVA 2BGIA 3CSSA 2YMLA 3AF0A 4YMVA 5CDTA 1XSEA 1GQQA 2Q1TA 5BQFA 1A2KC 4ZTBA 3OSZA 3EMKA 4ZZ2A 1X8LA 2Q0XA 2W2PA 3GLSA 2C4KA 4KKVA 2VK8A 3MRSA 3KUXA 2ABWA 4EKYA 3ORHA 2W2QA 5JNRA 4MW0A 4XWYA 1YI0A 2AEFA 1YL5A 1LRKA 2O2HA 2WABA 2XMRA 3DAFA 3EFHA 4M36A 5ESXA 1YA8A 1GR1A 3ZYZA 4CJXA 1E1CB 1VCIA 5IYZB 3ZWPA 4WJKB 2YY6A 5HZGA 3R5TA 4O3FA 2WZCA 3OU2A 3TBHA 1N1EA 1ZGCA 2WNIA 2VPWA 3GMSA 4EYSA 4FYXA 4EA7A 3LP5A 4MYTA 1QFSA 2EKZA 1FEZA 1T2FA 3O4VA 5B36A 3L77A 4WNIA 2O4UX 1EVZA 2H11A 2IDKA 4BYMA 3BK1A 2NO0A 3F78A 3TJZA 2H9IA 1JLLB 1NVFA 4K9PA 3GPIA 2HEGA 1HLFA 1P80A 1S4MA 4CM9D 5BN1A 2XI4A 1RP1A 4XGQA 5FR2A 4C4YA 5EIBC 1FJHA 4ZV9A 5KSPA 3TZBA 5KQRA 3QFFA 2H51A 4WZAA 4D26A 4WK6A 4Y2HA 2UXCB 4DA8A 3ASVA 2B4KA 1TVEA 3EIXA 3UMGA 2B0CA 1NXTA 1SHUX 2FQ1A 2UUOA 4GPIB 1H1TA 1VSBA 2GZAA 1ETUA 3GQBB 1Q7RA 2B4QA 4J49A 5ALJA 2NO9A 3KIPA 1P6UA 1L7OA 3OQNA 3AUUA 2O9JA 3MJEA 2GK6A 2X86A 3AERB 2XR1A 3FMPB 1XMQB 1P4HA 1TM1E 3FKSD 2CXPA 4M1ZA 4X8OA 3DZ5B 1F2TB 2ZB4A 1J23A 4BOYA 2B4TO 4PSAA 4EFNA 4W5OA 1KI1A 4E33A 5DN6D 3VQTA 2YQ5A 4DCJA 2FK8A 1GDDA 3MVEA 3V3TA 1YVPA 4CR7A 1XA0A 5E6SA 1XZPA 2Q2VA 4EELA 4K7JA 1XAJA 2FFBA 2FR8A 4EENA 2FEPA 2DLDA 3GCWA 4D8TA 1QSGA 2QUKA 2ZJ3A 4AQYB 3N0TA 3S2IA 3NBUA 4CLRB 4Y2YA 1Q7EA 2WSIA 4F4UA 4MARA 4W5TA 3ZVMA 1E6WA 1YWGO 4IVQA 1T8WA 1JT2A 1M5UA 5KYTA 5NLLA 3WLTA 2PRJA 1FDUA 3KJGA 1Y9JA 3R0IA 1C9KA 3GJXC 1O6GA 4DPMA 1YI8A 3P9SA 4E07A 4JFRA 5IJ0A 2OXCA 1ORTA 1VHQA 1ZEJA 2B3TA 1ZISA 2PUFA 2WK1A 4QJBA 2WV7A 5AHKA 1NBMA 3G0OA 3JYOA 1NMYA 2ZSKA 2HI0A 3PE3A 2BJVA 4O4HA 1G5TA 1XXLA 4Y9SA 1XRSB 5ISMA 5FF9A 2JHAA 1K5HA 4QELA 1EWTA 1SUCA 2LZ0A 1QAMA 3B1ZA 3W5JA 1L5HB 2BI8A 3Q6MA 4K9KA 4ZEWA 1ZOSA 2EKQA 1VFPA 2BDUA 4WD3A 4YHBA 3RAFC 3S2GA 3ZZUA 4RK1A 7ADHA 2W6ZA 1ZDMA 1PT6A 3U62A 4LK2A 2E4UA 3USZA 2NO6A 2V4UA 3BD8A 4N5HX 1OXBB 1CUWA 4RU1A 2I54A 4GBMA 2BGRA 2EZ8A 2WRZA 1UOEA 2ZVJA 3CLUD 4LE2A 4TXNA 3HN6A 2XT0A 3NV9A 1JFTA 3A3YA 5D87A 4AZ0A 4F3TA 4HUTA 2R5WA 3W7BA 3ET4A 3TLJA 4X65B 2C0QA 4WXMA 1J22A 2N0SA 3LOQA 4JMPA 1V43A 4ZZ1A 5GTDA 3B7PA 4OHFA 1E7MA 4MUAA 5FL3A 2PWBA 3ICQB 4K86A 3OP1A 1E3TA 1RADA 5DN9A 5CBKA 4G1UC 3HCDA 1G7TA 2YN2A 4WCDA 4IMJB 3KTAA 2I6FA 3M83A 5AKEA 5F33A 1LU9A 2B9EA 3SR0A 2P6NA 3R9XA 2DQ4A 3ZY6A 4XR4A 1KJNA 1RRFA 3BB4A 4NOKA 4OCZA 3OLWA 3MJTA 5E1OA 3A0RB 1V11B 3DQZA 3IQGX 3KZVA 4XASA 5LB4A 3K73O 1JG2A 1I94B 2I67A 3R6WA 4WW0A 3PRHA 4RLFA 5KVCA 3BCRA 2PKEA 3DBHA 4MWCA 4AICA 4XDZA 3RODA 4NI5A 1QCYA 1A71A 5J3JA 1FRFS 3Q12A 3KX2A 2ZYHA 2P9QA 1CQXA 5FHQA 1APBA 1T3HA 2IGBA 2ODTX 4WLOA 5AJUA 5EE9A 3ZHQA 2QYTA 1HX7A 2P65A 4Y2PA 3DZ7B 2P3LA 1NRWA 3Q8MA 2VHYA 2MIIA 3R0XA 1YJBA 5GM2A 1CDZA 1Y4UA 2CK3D 4P80A 4ARUA 5M29A 4MAAA 5HFJA 4D99A 2IHNA 5K8CA 1WIWA 5F7OA 3V1LA 1B3BA 2ZWIA 4MITA 4HN9A 1GCGA 4BJ3A 3E35A 1VLZA 3T9EA 3ZWVA 3D8UA 3I61A 2RJOA 2W90A 3F6SA 2YJTD 3AW8A 2X40A 1GITA 1LVGA 3O2QB 3EUFA 3TR6A 3ZWQA 1T1JA 1OC4A 2HHJA 4GP7A 3RSQA 2YNMD 3EQ9A 2FY8A 5EXTA 4XB1A 1Z82A 1A9YA 2A35A 4ZVLA 1SZDA 1UQUA 3M3DA 3SQNA 3ZN2A 1I6WA 1ZBQA 2DCUA 4P4SA 4IIXA 3KSMA 2O2SA 4M7OA 3HXMA 2BF7A 5U9CA 4IDDA 4W7HA 3KQQA 3MCVA 2PJRA 1AJEA 3E4CA 3K0FA 2OV2A 3HKBA 1HE4A 2R5FA 1EB9A 1FDIA 2E49A 2VUUA 3DZKA 3QMWA 2I3AA 2P35A 3Q10A 5DO9A 3T4EA 3ZGLA 1ID1A 1Y8AA 1TMGE 2B5WA 2FEAA 4GYYA 4DSTA 3ER6A 4R1QA 3LFHA 2ZCJA 2J9RA 4G09A 3I9LA 1LS1A 3EJ6A 1XKTA 5GQSA 3PXCX 3OD5A 4C7KA 3L6DA 4K5QA 3R8CA 3Q87B 3LX5A 1N2OA 2FEMA 3GVHA 1NMXA 3RAEC 4X91A 3DO5A 2WT4A 2YXNA 3C2QA 3MMZA 1WCYA 3C8ZA 1BXKA 4F8YA 2X9NA 5CMLA 2WHPB 4QXAA 3KYCA 3LWBA 5ENDA 4TYWA 3C3XA 5TJHA 2PU7A 1P62B 5TT0A 1LQTA 2O1EA 3UPTA 1WXQA 1M1ZA 4IRXA 1IIBA 2QIOA 3N58A 2RHBA 2QRKA 4BGVA 4H1HA 4DRYA 3V4RA 2VZ9A 2Q7XA 3BJMA 1ZIOA 3ONEA 2W98A 5F4BA 1NNEA 3E61A 1RBMA 5DIZA 1XZJA 1QQBA 4GRIA 1JAYA 4KJZA 2GGSA 1DX6A 4PIPA 3QI7A 1TTHA 2H92A 3OZFA 1XL0A 1DHRA 1SHLA 4OAQA 4IIJF 5H80A 5FPKA 4JYAB 4ABTA 1VOTA 3ND8A 4EEKA 4Y6GB 3U6KA 1WX1A 3PGVA 3O92A 2X7HA 3RJ5A 1MT3A 1O4VA 2R00C 3GXOA 4YMIA 3A1VA 4V0LA 1O4WA 1W5AA 2OCAA 2PJZA 3BK7A 3D0RA 4HAXA 3QVXA 4JB8A 4XRRA 4ZAXA 2AX4A 4WCVA 5KOIA 4Z4IA 5HGJA 1FNSA 4TV8A 5K51A 3FNHA 2ID4A 4S3MA 3PB3A 4ETWA 3K5WA 4UNRA 3K0AA 2VTBB 3O47A 2AXEA 4XIGS 2V1UA 1VLQA 2N1MA 4AFNA 1SURA 2J46A 3DCJA 4TLEA 3SD7A 4D45A 2O8DA 3NHWA 2QPOA 3GUVA 2I4TA 1V8BA 4BZZA 3VPCA 4PWZA 3KELA 3NAMA 1PRYA 2IP2A 4HPXB 5DI9A 1CTQA 1F9AA 3VDQA 1NVDA 4MUXA 5JJKA 4YCJA 5HGXA 4MVJG 2X0RA 2C83A 3PX3A 2GEKA 1D2CA 2OECA 2Q3BA 1OYOA 5LQCA 3C16C 4LPKA 1R6AA 3OZTA 4KN6A 1ORHA 2EFCB 3BILA 1TO2E 1U9JA 4DV6B 4GUAA 2BTQA 2GAAA 1UBHS 1XK7A 1C41A 5DTQA 4KLCA 3B70A 3T7KA 2W2KA 1A5BB 1Z28A 2OLJA 2P6PA 4J0EA 3ZXIA 2XADA 1E59A 4DDMA 1XCOA 3HLKA 3C6KA 5DGHA 3H1TA 4ZT3A 3U5TA 2PQMA 3ZU2A 3K5HA 1SXJB 3HVIA 5A1TA 2ZWVA 4YFYA 3T7IA 5KPJA 1FA9A 1KVSA 3AKZA 2TYSB 2VH5R 2WIDA 3DULA 4JCCA 3EXFB 2Z57A 4LTDA 2YWEA 4GNKA 4WZBB 3U19A 2OAGA 5HG0A 2L18A 1MKYA 1URPA 3ADOA 1C9JA 1EDEA 4HWOA 2C9YA 1DFIA 1ACJA 4N0MA 2EJWA 1XJQA 2F3RA 4GSKA 2WUEA 2LIPA 2CF5A 1DKMA 1QQ7A 1ECLA 3NBMA 2WVGA 1D2GA 1E9EA 1ZIPA 4GYWA 4PCAA 4B3XA 3GLGE 3AOEA 5EOVA 2Q50A 1TMOA 3Q9UA 3U7IA 1S0UA 1V2GA 2DUMA 4R9VA 2GK3A 1IN8A 1DU4A 5TQ2A 3BH7A 3GZ4A 2P9BA 1J2JA 1THMA 5DYIA 4JLUA 4BNFA 2EP5A 2WKRA 3A11A 4DQXA 1GL3A 1DKRA 4EBBA 2PSSA 3H6GA 2JC3A 3OU6A 1XVLA 3V9PA 1KMCA 4JLJA 3ONNA 1SUBA 2J9GA 3E9QA 1DOHA 4B0PA 3O0DA 5KYYB 1Z56C 4Q05A 2Z5VA 3FSRA 2SBTA 4R9RA 3EGEA 1C29B 5IDYA 2BVNA 4NYMR 2CNLA 1RHUA 4CTKA 2IEDA 4L8VA 2D0OB 1U0JA 4P2BA 2QUHA 2WSYB 2VBIA 3H5AA 4CCYA 4X7RA 4DG9A 1M1YE 1TVKA 4A92A 4KWEA 4DARA 1KIAA 3WRXC 2WTNA 2Q28A 4WOKA 1Z68A 3UAXA 4A8PA 3MPOA 1ZM3A 2C2WA 2HLNA 2PT5A 2H00A 3HFGA 4C2BA 3A9VA 5FLXA 1MB0A 1SKUA 5AUPB 4M9QA 4JN6B 1RKXA 2H1OA 1H6DA 3ZD7A 1JA9A 4BGIA 4G5QA 4BMZA 5J58A 3AKEA 1JYFA 4BAZA 3Q3IA 3GLQA 3K16A 3OT1B 3B82A 2FUKA 2WWYA 1NDHA 2HNKA 5KYGA 4JLNA 2BFAA 3IOCA 4MIKA 2G71A 4P34A 5IZCC 4GR5A 2Y9MB 1HF3A 4JB3A 4B82A 1C1YA 1O95D 4J1TC 1JB1A 2IYPA 4Q82A 4RFSA 1GGEA 1HE3A 1TDJA 1R7RA 1EK6A 3MUFA 3UN1A 3EDOA 2SNIE 5B2ZA 4DMRA 3VGPA 4ZV4A 2JA1A 4XD2A 2JFBA 2XSZA 1R0LA 4GLBA 3W6UA 2DEUA 4HDOB 1JZQA 4DLUA 2E3JA 1G2OA 1NXXA 1XDDA 1TD9A 2FGKA 2OOSA 4H27A 2PXCA 3V2IA 1CUGA 3V5NA 1KJJA 1N5KA 3ZD8A 2LDXA 3OQVA 5HWSA 3UKJA 1YRQA 2OBYA 2QP3A 3CZAA 1U1FA 2Q5QA 4H4CA 4DG8A 2RKBA 1VRVA 3DEYX 3HCNA 3LMKA 4HDMB 4AZ0B 3VVLA 4DXDA 2AG1A 3OLYA 3TQIA 1E2QA 4QOJA 4OLFA 3BMOA 1L4EA 2B1IA 2VHWA 1A8PA 3G8YA 3KEOA 4J0DA 4N8SA 3Q7RA 5K8IA 2AK3A 1XCBA 2RGWA 1QKIA 1VJRA 5IHPA 3MS4A 1KGSA 1S2MA 3AQ4A 4IZIA 5T73A 3JATA 1NAIA 1N4DA 2X42A 3STHA 1E1MA 3N5CA 5D5HA 2XXAB 1A2BA 1O6FA 4I3GA 4KQKA 5K3CA 3PR1A 1LLUA 1IY8A 2PKXA 4TSFA 3BWBA 2JEOA 3GNQA 1UKZA 1ZLYA 3D7MA 1UFVA 3DC2A 4IIEA 5DMXA 4DWJA 1CYEA 2JIDA 5CB6A 1OH5A 2BMFA 4HL6A 4FBGA 3HJRA 4LWPA 4PW0A 3V33A 3WK9A 4PAOA 1I4OA 2HBRA