1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
1I32A 3RUFA 3U4CA 1DSSG 4XYLA 4I9NA 1VL0A 2FZWA 3STHA 5COQA 2HDHA 4DQUA 2ZYAA 3CH6A 4GKBA 3ZWYA 2VRCA 5CG1A 3S8MA 4L4XA 4BO3A 2ZQZA 5JPIA 3UUWA 1OBFO 3EUWA 1LDBA 5JYDA 4RORA 1DHTA 1LDGA 2QYTA 2X7HA 3PHLA 4Q3CA 5L4SA 4XJSA 2PV7A 3ZU3A 3TJRA 3GR6A 1EZ4A 3KB6A 4NK4A 1GQQA 1I5RA 4BNMA 4E4YA 3D3WB 3OH8A 3RUIA 1EQ2A 3P7MA 4PGFA 1ZNQO 2BI8A 4A2CA 2B5VA 4BO6A 1UXJA 3RI3A 1F12A 5JAQA 4Z9YA 3CE6A 4UEKA 4A7PA 4D44A 3T4XA 5L51A 5FI3A 3PHIA 3SJ7A 2CMDA 1YXMA 1AXGA 1DC3A 4AFNA 4BKPA 2CNBA 2QRLA 2D4AA 4KUGA 4RVHA 2TMDA 2NVUA 4YPOA 4A03A 5F5LA 4I1IA 5HS4A 3GQVA 1OAAA 1SBYA 4JJGA 5EQDA 3ADPA 3ZW9A 2IRWA 1T26A 2H1SA 4PG8A 4RPKA 4QTZA 3ETGA 4YACA 5JFOA 3KO8A 4RQUA 5HM8A 2AG8A 3ETDA 3R6DA 1X7DA 1R0SA 3WBBA 4U7WA 1YWGO 1Y8RB 4A10A 1U3VA 4ZJUA 3VPSA 1KEWA 1IULA 1PX0A 1ZSVA 1E3WB 4J16A 5IZCC 3WXBA 1ZBQA 4OHUA 3FCOA 4EITA 4KMSA 5A9SB 4E5KA 4KOAA 5T8KA 1Y5RA 5AXBA 3ZNQA 2PNFA 1DAPA 2AQKA 1U5CA 1N1GA 1WMBA 3GNTA 1ZK0A 4W82A 5M6DA 2OBYA 2YW9A 3AFMA 4IS2A 2EGGA 4RVSA 2NU8A 4ALNA 1ZXBA 4PZEA 4G5HA 2I5PO 1NFRA 2DUWA 2O23A 2GDZA 3BMOB 3MZ0A 1U5AA 5A5FA 1GV1A 2X58A 5TQVA 3QVWA 2AHRA 2AEMA 2G0TA 4GI2A 2OHXA 4JX8A 1H2HA 3ONFA 4BKRA 2R2GA 3QWFA 1VPDA 4FDAA 4WEOA 5L7TA 2CY0A 2X0JA 4D0SA 3DONA 3ANMA 4R1SA 2E48A 1DJNA 4NJMA 1QYCA 2W2KA 4WPGA 4R3WA 3EZYA 4CLEA 4XWYA 1N7HA 2HMUA 4IPTA 3L4BC 5A9SA 1PJQA 2GN9A 3DZBA 4CM4A 1DC6A 2B35A 4CMBA 2DVMA 4XZ3A 1A5ZA 4PZDA 3WGGA 4NQZA 5JDCC 4B4WA 4DMMA 2Q1WA 5TX7A 3VKVA 4RVGA 1K2WA 2ZK7A 4NR0A 4C7KA 3AOGA 3F3SA 4ZU3A 3K92A 2O4CA 4DVJA 1E7MA 1HWYA 2ZTVA 2VZ8A 4OSPA 1HDXA 4PG7A 5F21A 3SJUA 4BO8A 3ZN2A 1JWAB 4R1TA 3JQBC 2O7SA 1GYQA 1LSOA 3ZWVA 1C0IA 2EP7A 2IODA 3M1LA 1HE4A 3GMSA 1UDAA 4AICA 3H6KA 4GLLA 2DLDA 4CQMB 4GX5A 3W1VA 4CM3A 1UZNA 5A3JA 4CM1A 3I83A 3DBVO 1KEVA 1KVSA 4R9SA 3U09A 2W2KB 2JCXA 1GZ6A 3MJ4A 1R37A 4AJEA 3ZWNA 4MVJE 1I0ZA 1WDLA 2YFHA 1PIWA 1Z6ZA 2Y1CA 4HADA 3BXXA 3QSGA 5BSHA 2ZATA 3VC7A 5DOZA 2Z95A 2CD9A 2OOSA 1QYWA 2FRDA 1B16A 4CUKA 2ZTUA 3IIEA 3KSZO 4D43A 1DLIA 3ZU5A 4AJOA 3RC2A 1FXSA 3H65A 3VZQA 3HHPA 2Y66A 1GZ4A 2JHGA 3WBFA 1GPDG 3CSDA 1SB9A 4BNHA 3M6IA 4NDNE 1N9GA 2DUUA 1P0FA 1RYDA 1NM5A 2E82A 4NFYA 4XR4A 3WQSB 4HY3A 3EVNA 5JBIA 3QWIA 1FMCA 1Y5MA 2Q2WA 4GVXA 4WGGA 1VI2A 4H3VA 2PZMA 3E18A 4IDAA 4KUHA 1KVQA 1K6JA 3FBTA 3NEPX 3QA9A 1GAEO 3AWDA 4TKMA 3IAHA 3OA0A 5TGDA 1DIAA 3FN4A 3PJDA 5JYAA 1J6UA 3UN1A 4IDGA 1U9JA 3OEWA 3F47A 5TC4A 4D46A 4FJ0A 4GL4A 4DYVA 2GPTA 1ZVMA 4JK3A 5KJ1A 4M1QA 4MVJM 1MB4A 3K9QO 3ZV5A 1B3RA 2VCYA 3JQ7A 1X0VA 4TRRA 1NFQA 4BMSA 3U9LA 1MP0A 2DTXA 3TDKA 1SCUA 3VDRA 3BZUA 4R01A 4BHTA 2QRKA 2GCGA 1DOHA 1Y7TA 4RPJA 3QVXA 1H2BA 4FOSA 4S1VA 5MDHA 2AQ8A 3HZZA 1YB5A 1V9LA 3FI9A 3MJCA 4CQMD 5KIAA 3PI7A 4FFOA 4HUJA 4OM8A 5I8ZA 4EGFA 1U2DA 3LQFA 5G0SA 1RYEA 1YQXA 2QHXA 5EJ2A 4CM6A 1ZXLA 4MP3A 5T57A 1HDCA 1OC4A 3RUAA 1I8TA 2D2IA 1XQ1A 3PJGA 3RROA 2YDYA 2Y0DA 3GVCA 3C8MA 2C29D 4F3YA 5BR7A 1HYEA 4BO5A 2NQ8A 2EXXA 5AOVA 3DHEA 3OJOA 5L95A 3O8QA 4BGUA 3I6QA 1NNUA 4IIVA 5JO9A 4YT2A 5CEEA 5JLAA 5JE8A 1C1DA 3MCVA 2FOIA 1UDCA 3C85A 4CR7A 1TB4A 3PZBA 4WCFB 1FDSA 3LF2A 2P4QA 3F46A 3H2SA 4RZIA 3D0OA 5G0WA 1EFLA 3FRJA 3S1LA 4RV9A 3C3XA 3NUGA 5AQ1A 3NTQA 3NX4A 4I5GA 2VYVD 4Z9XA 4BNJA 3ENKA 1JVBA 5ICSA 3LT2A 3GK3A 3VZSA 1ISMA 3N7UA 4J9VA 3DC2A 4IQ8A 2AEJA 1MV8A 1T25A 3C24A 1H6DA 2PGJA 1YJQA 5EINA 3TF5A 4E3ZA 5CEFA 4B8ZA 3P2OA 1ORRA 3H5RA 2HLPA 4XIJA 2O3TA 3L07A 5JC8A 2NUAA 1GUYA 4AJJA 4JGBA 4CM8A 1YL6A 2BFAA 2QRJA 3ONEA 4FR5A 2POQX 4EUEA 4E2YA 3TZ6A 4DBZA 4E30A 1N92A 3AI3A 3ULKA 1VSUA 1HSZA 1SNYA 1WXDA 4J90A 4YAEA 1JTVA 3NDRA 3WICA 3CIFA 6ADHA 2FHSA 5KVSA 4DPLA 1HZZA 2X23A 4GX1A 5DBFA 1CERA 4DMLA 3KEOA 1EVJA 1Q2XA 3QE3A 3KYCB 5HTOA 4E2XA 3VDQA 2HK9A 1SB8A 4AJ2A 4DC0A 4TRJA 5A9RA 3CMMA 4UEJA 4AL4A 1HDYA 2JAPA 4RJTA 4OQZA 1NVGA 1TT5B 3MJSA 4ZQBA 1HE2A 1XU7A 1DBVO 2OMEA 2V7PA 1UR5A 2AG5A 3GAZA 4E5MA 1B26A 3JQEA 4CMAA 1KEPA 5DCWA 3ZHYA 4II3A 3HDJA 5L7YA 3BTOA 3LLSA 3NAQA 3ST7A 3DB2A 1B3BA 3VTFA 4CM4B 5K9ZA 5A02A 1NVMB 2IE0A 3DZJA 4WLVA 2IEBA 2V6FA 1YB1A 2ZB3A 3R3JA 1XA0A 4E13A 2X1HA 2JKVA 2X0IA 5GMOA 1T2DA 1Q0LA 3VH1A 2ZCUA 2Q1UA 4XRGA 1DAOA 4ZN6A 4XB1A 4WCFC 1HLPA 1P0CA 2HJSA 5T64A 1B14A 1E3WA 4EJMA 1SOVA 4NJMB 3D4PA 3PJEA 5J9GA 3G49A 4MDHA 5G0VA 1T24A 2ZCVA 5T5QA 3QVTA 1UAYA 1LSUA 1M67A 4U0KA 4XKJA 1T2FA 2ZB4A 1ISJA 5JAZA 1DHRA 1DO8A 3W6UA 3DO5A 4W7HA 4MOWA 2X22A 3ROMA 4WLUA 3RWBA 3BMOA 4FN4A 2IYPA 2AE1A 2E49A 1RM0A 1E1MA 3LDHA 1YKFA 1BWSA 2FR0A 1MFZA 4WE3A 1GTMA 3AOEC 2E37A 2I66A 4FS3A 1YL7A 2DT5A 3V1YA 3K2BA 3C1OA 3GPDG 4R3NA 5A4DA 5U1PA 3UHAA 2Q1TA 2Y1EA 3GLQA 4YT4A 1H6BA 1P45A 1PR3A 2VT2A 3L4SO 1EVZA 4BQRA 4N54A 5U9CA 4W99A 3A28A 3C7CB 4CMEA 2BH9A 1KVTA 1V35A 4XQEA 4EJ6A 1U7HA 2SCUA 4HFRA 5CDTA 2DBVO 1T1RA 2HK7A 4CL8A 4MIYA 4MVJA 1BXZA 4OXYA 1U8FO 4YJFA 2EF1A 3LT1A 2A92A 5IDXA 3GRKA 1RM4A 4ILKA 2R6JA 2VTEA 3WWZA 2EJWA 4UVDA 3GZNA 4A73A 3SVTA 4KUEA 1Q0QA 3Q6IA 2NQTA 4B7CA 4FBGA 3GN2A 1CJCA 3OJLA 4WECA 1GD1O 1P44A 1LC0A 3B1JA 4WUVA 3VPFA 3SC4A 2C7VA 1F06A 1PZGA 1ZJZA 3RCBA 3GF4A 5EMHA 2P9EA 5LDGA 5L53A 1ZK1A 4UUPA 4PRKA 3ZU2A 3C7DB 5JYFA 4I08A 3K6JA 1MXHA 1KC1A 3UW3A 1JLLA 4YWJA 4YA6A 1F8FA 1XQ6A 1ZW1A 4QECA 2DBRA 4ALMA 3H5NA 5L40A 2B4TO 4FC7A 5H81A 5IDQA 3S2FA 3DBRA 3LK7A 4KQWA 4WLNA 4LCJA 3HN2A 4CQMA 1ADBA 4I5FA 1GCOA 3ZWMA 1PGQA 3AUAA 3VH4A 3LT4A 1WDMA 5T73A 1NTOA 3BHJA 4GX0A 4L0QA 1LDEA 3KZVA 3U62A 3TZKA 3PEFA 2J3HA 3RVDA 1H5QA 2Q4EA 3AK4A 4XGNA 1EUZA 4TZTA 3PIDA 4NU6A 4DQVA 1MA0A 3GNQA 5TF4A 2C5AA 1KS9A 3KYBA 4PFJA 4BB6A 1ULSA 2G5CA 2XXBA 5JS6A 4XD2A 2VHVA 4BO0A 1SC6A 4CV1A 5JAIA 4OH1A 1E6UA 1B7GO 1JAYA 2D3TA 4JP2A 5HA5A 3GGOA 4ZRNA 3IC5A 3TWOA 5KVCA 3G17A 3BTSA 5BT9A 4TZKA 3H9EO 2IXBA 2Q4BA 5G2OA 1IPFA 3IS3A 1L1FA 2Y99A 4J1QA 3PYLA 1X1EA 4OO3A 2IXAA 3SLKA 1HE5A 1VSVA 2A9FA 4TVOA 1UXHA 4CV2A 3DAGA 2IZ1A 1LRKA 3D4OA 3VZPA 3GEMA 3IOYA 3BTVA 1MC5A 2WTBA 2Y05A 5ILGA 2NTNA 1YGYA 1QLHA 3L6EA 1PSDA 3JQFA 2WD7B 3RAJA 1A7AA 4OKIA 4RDIA 3JQ9C 3HDYA 4N5NA 5G4KA 4B3IA 3PGXA 3WLFA 5B4TA 1JAXA 2VHYA 1GYRA 3NKLA 4B3HA 4YAJA 1J5PA 2D5AA 3RJ5A 3RASA 3MEQA 2GGSA 3UFXA 2ZTLA 2WM3A 2X6TA 3PPIA 3ENNA 1D1SA 1ZMOA 1I01A 3FNEA 1EK5A 1PJ3A 4UEOA 3RUHA 3RD5A 3UICA 3GDGA 3ZDFA 4PLPA 1IOLA 2P2SA 3PYXA 3WIEA 4FOOA 5BSGA 3HWRA 4MVJI 5I8WA 3U3XA 1R66A 3AI2A 2X5OA 2Y1OA 4TVBA 1F8GA 4UVEA 2HK8A 3AW9A 5JAMA 4ZICA 1P1IA 3SEFA 1U4OA 4I9UA 4KDFA 4DIBA 3L77A 3MJEA 4CMGA 1LQUA 4GMFA 1TXGA 1WLYA 4JXKA 5ER9A 4R1NA 4FFLA 4O1MA 4GWGA 2D1YA 1LTHR 2HU2A 4O63O 2GN4A 5ENDA 3WS7A 5AXAA 3D1LA 4FQ8A 4GVLA 4D3DA 5G0TA 2CUKA 2WEKA 3SC6A 2I3GA 1LSSA 3DZGA 3D7LA 2BD0A 2OUIA 2A4KA 3GUYA 2B4RO 1WZIA 2WSBA 2FP4A 4KWIA 1P74A 2UUOA 5EPOA 4LCEA 3AY7A 2J5QA 1V3UA 3H3FA 4EBFA 1DFHA 1NASA 1EDOA 2V65A 2BLLA 2NVWA 3D5TA 3ZZNA 6LDHA 1Q7GA 3PIIA 1OFGA 3GHYA 4IJVA 1C1XA 3HG7A 1DFIA 1FJHA 2BGKA 3I9JA 1GDHA 2JCYA 3ZW8A 2X5KO 1Y8QA 3KEQA 3WYBA 1V0JA 5BNFA 1B0AA 2LDXA 1E3EA 2W4QA 2WYWA 4NZ9A 5IZCA 4M86A 4LSMA 4UUOA 1LDYA 3L6OO 1DXYA 3NYWA 1NXQA 2RHCA 4N7RA 4AVYA 4DL9A 1EDZA 2Q99A 3OA2A 1I30A 3DZHA 5JDIC 4L75A 3VAZA 2HCTA 1B8VA 1R16A 4YJHA 4W7IA 3U4DA 4CMEC 4QEDA 3OP4A 2GASA 2W90A 3WNQA 3WIDA 2J3IA 2AE2A 1T2EA 4EUFA 3FWNA 1LSJA 2O3JA 4DREA 2ZJ1A 3RBZA 3WGTA 2F00A 4OAQA 3F9IA 4J7XA 3PLRA 1T4BA 1EQUA 1XKQA 2EJVA 3A9WA 3NGLA 3DQPA 4CM5A 5C7LO 2RHRA 3GGPA 4K28A 4LN1A 5DOVA 4YAIA 1Y1PA 4FGSA 3DOCA 5CDGA 3RC1A 3W8FA 3UF0A 1NPYA 4NHEA 3PP8A 4R5MA 2GZ3A 3TFQA 1OZAA 5FFFA 4YQYA 3UCEA 4BNGA 2DTDA 4FIZA 4LMRA 2DFVA 1E3SA 1P1JA 1ZCJA 1XDWA 3KYDB 3R1IA 3IJPA 4MVJH 4IUYA 3OMLA 4WLFA 1JVSA 5TJ9A 1PJLA 1P9LA 1A9ZA 4F6LA 1G6KA 1GUZA 4UVGA 1I3KA 5I9MA 4EZBA 4J0EA 4L76A 4YEDA 1I3LA 2G17A 3BTUA 1VL8A 2YY7A 2O2SA 4OMUA 2FR1A 5L4NA 4HP8A 1BVRA 1PJTA 3CXRA 1GZ3A 4P38A 3H5AA 4BNUA 1IPEA 3TZHA 2VRCD 2RH4A 5A5EA 2ZYGA 4IGEA 1F14A 2FR8A 1JW9B 1BHSA 4LW8A 4CM8B 1JQBA 3VPXA 4ZQHA 4IY1A 4LISA 5EN4A 1VE9A 1JN0A 3V1UA 3V2GA 1E0DA 3MWDB 1LDNA 1FDWA 3C1TA 3D5QA 4FC6A 4R9RA 1R4NB 4E12A 3ZHBA 3AI1A 3HUDA 3TN7A 1NPDA 4D41A 3OHSX 3RU9A 1FF9A 3QY9A 5JW6A 1HLDA 4ZQFA 3MJVA 1K6IA 3MJTA 4II2A 4PIVA 4MVJF 4Z6KA 1MUUA 1J4AA 1XU9A 4UAGA 3H9JA 2WYUA 2A94A 3CTMA 4BNYA 2DBQA 2EG9A 4B4VA 4YTEA 3X2FA 4R54A 5DF1A 1NR7A 1CWUA 1E7RA 4BGVA 1GCUA 3U49A 2IYOA 2QIOA 4XA8A 4J4TA 4QT0A 4B7UA 3QWAA 2CVOA 4K1LA 1O6ZA 3OEYA 5DCYA 4IDDA 2JAHA 1KBZA 4BNVA 5TIIA 1KOLA 3PZRA 4BKOA 1ZJYA 1LJ8A 2YV2A 2FWMX 3RUCA 5A1TA 1PGNA 5L45A 2DTEA 3I52A 2DAPA 5TS3A 3JQAD 1UXIA 1YDEA 2X9GA 3ORFA 1CDOA 1PGPA 1O94A 1VKOA 2IDZA 3GRPA 1J0XO 3HQ4O 3G79A 4CMIA 1QORA 4Z3DA 2AQIA 1GV0A 1QMGA 4MIEA 4L8VA 3S2IA 5CPBA 4DPKA 3GGGA 3DBHA 4AJIA 1P1HA 4ZA2A 3OQ1A 4MPDA 1P33A 3AM3A 2DPHA 1BXKA 3W4JA 3WWYA 4BGEA 4QXMA 3WTCA 4WLOA 5JC1A 5BNIA 1KERA 2CFCA 5AXCA 4Q39A 3EGOA 2ZB7A 4EUHA 3D64A 4Q3DA 3QLJA 1QXSA 2HJRA 1BW9A 1M75A 2WWRA 3PVZA 3DBHB 4BO1A 1Z7EA 3A4VA 3ITKA 2RBEA 8ADHA 2EV9A 3I9LA 2NU6A 1IUKA 4K6FA 4XQGA 2GUGA 1T4DA 4YBZA 4HNGA 4L73A 1YBMA 2X9VA 3K96A 4E6PA 4JJIA 2BELA 4E5NA 1NR1A 1T2AA 1N5DA 2B69A 3WMXA 1ZK4A 4UULA 1BVUA 4BMNA 2FPGA 2JD2A 3S2GA 5LCXA 1H9BA 1PTJA 5IZ4A 1A7KA 4H16A 5JCJA 1XELA 3VVCA 1VLLA 1TA4A 4QO8A 1B8UA 4U5QA 2GN6A 4DUPA 2GSDA 2QG4A 4BNWA 1ADFA 1VJ1A 5T6BA 2EW2A 4MIOA 3OECA 4YJFB 3E6AA 3ETEA 3VVBA 3PXXA 5DT9A 3O26A 4CMHA 5KJCA 1WVGA 3B1KA 3OETA 5L9AA 1D8AA 1UZMA 2X0RA 4XJTA 2QZ9A 3MTGA 4XGIA 1PS9A 3H4VA 3H9QA 4UREA 2DC1A 2EIHA 3WGOA 1GY8A 3RUDA 3A06A 3IP3A 3JYQA 3GAFA 3PGJA 4NI5A 5JCJD 3GMDA 4FFNA 4GWKA 4URFA 2NU7A 2J5KA 3PHHA 4NBUA 1X0XA 3UGKA 4JBHA 4EEZA 5HBRA 4MVJP 3QV1A 1ONOA 1MLDA 3DZIA 2F1KA 1YB4A 2WE7A 3E9NA 4Y98A 5B37A 4E21A 1E3IA 3WMWA 5MGBA 2QQ5A 4W4TA 4K9DA 1T1SA 3KYDA 4CMJA 2OGUA 1LUAA 1Z7BA 1MGOA 2Q2QA 5KKAA 4W6ZA 4RPLA 1QLJA 4LVCA 5C7IO 1PWXA 3I5MA 2EW8A 4N5LA 3DOJA 5IN4A 1YVEI 1YDWA 4RDHA 4ALLA 5KJ6A 1WMAA 1XEAA 5I9NA 1YBAA 3QWHA 4UVIA 4MKRA 1TT5A 2YQ4A 1PWZA 4BKQA 1E1KA 3FR8A 4WCFA 3HJAA 3E48A 4YDRA 1ENPA 3BMCB 3L4BA 1A72A 4R51A 1U1IA 4RL6A 3DHNA 3JD2A 4HWKA 3ROPA 3GH3A 1NQ5A 1HTBA 2VUUA 4E2WA 4D42A 4OIMA 1HETA 3ICCA 4WNCA 2HSDA 2HRZA 2ZIZA 1NQOA 5ICMA 3ZHZA 3RUEA 5KWEA 4QSMA 2CZCA 2RCYA 1H9AA 4P22A 1Y81A 1HSOA 4BNNA 4HKTA 4PLGA 1W4ZA 4G2NA 2CVZA 4EEXA 4BNXA 5EESA 2AQHA 3GFBA 3JD4A 1P31A 3TZQA 4GSKA 2YV3A 4NIMA 3U4HA 1NAIA 4IMRA 2GO1A 1GPJA 3CZMA 1ZK2A 3LU1A 3NJ8A 3DR3A 1GFSA 4RVFA 1N7GA 4E31A 1PS8A 4DTIA 2CDAA 3NTOA 5TSDA 4U8GA 1P1RA 2PFGA 2YHIB 4OXNA 3GN1A 4JBGA 1QG6A 1X13A 4IQ0A 4BO9A 2PKRA 2YZ7A 3B6ZA 2VWPA 2O3SA 3DZFA 4GH5A 4HX5A 4A5OA 5T8KC 3NJ4A 1HDZA 4D3SA 1A71A 4J7UA 1KVUA 4YT8A 4ND2A 3HNPA 3TFOA 1LC3A 1L7EA 1XWFA 2EKLA 5C7OO 1Q7CA 3OJEA 4NU5A 3SXPA 3DXFA 4NBWA 4J0FA 3TL3A 3HSKA 3T7EA 2HMVA 4J49A 1LNQA 1ENZA 1M66A 3D4NA 2PGLA 1EVYA 4OOFA 4RF3A 3EW7A 5DP2A 3RJ9A 4ZD6A 4N18A 4CLHA 4OKNA 5ILOA 4ONEA 1NWHA 2PA3A 3LLVA 3DOOA 3OQ6A 1H6AA 2GZ1A 5B4UA 4TRNA 3PK0A 3WB9A 2AA3A 3I4CA 4U6QA 3WYEA 1ZSYA 2GR9A 1JA9A 1I3NA 2B0JA 4WNIA 3JQ8A 2I3AA 1IYZA 2FPPA 4Z0TA 1VRWA 4DIFA 4XYMA 3HFGA 3PFWO 3KHUA 3AY6A 1ISGA 3WGYA 3RC9A 2WYVA 1OMOA 4PLVA 4ALIA 1W6UA 5B1YA 2W98A 3I3OA 4KWHA 5DCUA 4Z0PA 4X54A 4DLAA 2WE8A 4P4NA 5CDYA 3ZWPA 1O0SA 3JYPA 4ZHSA 1MFPA 1EFKA 2J5RA 2Y1GA 1GYPA 1VM6A 1NAHA 2HMSA 3RFVA 1I2ZA 2YQ5A 4J2HA 4ESOA 5KNLA 4Y6RA 4MP6A 3ZV6A 3IP1A 4YJGB 2EEZA 3Q3CA 1E1LA 3CKYA 1K89A 1U3TA 1XLTA 3EMKA 4IDBA 3BMNB 4Y6SA 3O8QB 4PN3A 1ZEJA 2NVBA 2CVQA 3OICA 1BRMA 1P3DA 3T4EA 4R41A 4F46A 2VYNA 4I8XA 3ZWAA 3BAZA 4JN6B 2DU8A 2YHIA 1F17A 3ZWOA 1P77A 1R0LA 4CLDA 4CMCA 5JDIA 5B4VA 3PWKA 5I7EA 3WG9A 3IMFA 3F1KA 3WSWA 3BHIA 3QVOA 4DIOA 2B5WA 1KIFA 5A03A 1XR3A 1ZO8A 1Y8RA 2P68A 4IM7A 4HFJA 2WMDA 3P2YA 3OJ0A 3ICPA 5IXYA 2Y68A 2NACA 5KCZA 2OBNA 1CQIA 4MJLA 2BKAA 2PZKA 3NV9A 2J6IA 1HEUA 5FF9A 1HRDA 2VOJA 1NPTO 1RPNA 1NVTA 1JKJA 3JQAB 2PZLA 1E1NA 4Q3AA 1UP6A 3KLPX 1WW8A 4B4UA 3JQDA 2FZEA 1X1TA 1DIGA 2Y93A 4P4LA 1ULUA 2HKIA 3ZCXA 4RF5A 3INTA 1ZMTA 3WNVA 4PZCA 3I4FA 1K0UA 3P19A 4JNKA 3AUUA 4PG6A 4CLOB 1PL7A 4QFDA 3RC7A 4NH4A 4YQZA 1YQGA 2TMGA 3V8BA 1X7HA 3JQGA 3WGIA 4NFSA 1BW9B 4LVUA 3ZHXA 4C4OA 3EY4A 3H7AA 4R16A 4CLRA 4GGOA 3Q0EA 5L4LA 3I9OA 2EP5A 4CQLB 1D1TA 1E7SA 9LDTA 1PQUA 3O4RA 5B12A 1P1KA 1MC4A 5KTKA 3I23A 3AY3A 4PRLA 4RO0A 3QJ5A 3DMYA 1H6CA 1ONPA 1PR9A 1R4NA 3KM0A 3QP9A 3WDSA 3KUXA 3E03A 2EKQA 3I9MA 3IUSA 3EHEA 4OSOA 3ZV4A 1PL8A 2V6BA 3WFJA 4CJXA 4CL3A 4M8SA 1DDOA 4O59O 3EYWA 3GC6A 5H83A 4BNKA 1FDVA 2C07A 3GG2A 2VHXA 4PLYA 1M6HA 5JNLA 3EK2A 3ANNA 1HE3A 3I1JA 1DB3A 2V6GA 5DZSA 4Y6PA 1I36A 4UVHA 4ZRMA 2Y67A 1Z74A 1PZHA 2J3KA 4RVDA 1UJMA 1AHHA 5DULA 1X14A 4A26A 1X7GA 1Y9EA 2YYYA 5IAAA 3ZWCA 4BO7A 3DMTA 4CQLA 4EDFA 3JYLA 5THKA 1I24A 3JSAA 4RF2A 4L4RA 5JYEA 3TL2A 4BOYA 1N8KA 4NBVA 3UOGA 3JQFC 4IJKA 4CLRB 1X15A 1FDTA 4B79A 3VOSA 4F6CA 3GUCA 5I7SA 1ENYA 3ANLA 3D3WA 3PJFA 1TLTA 5GZ3A 5KVQA 3CUKA 1IZ9A 3TZCA 4CM7A 3PQEA 5IG2A 5CHEA 5F1OA 2GYYA 2O50A 1QSGA 3KBOA 4CM9D 5JDCA 5TNXA 2PD6A 2ZYDA 2PH3A 3L9WA 4YB8A 3F5SA 1ADCA 2C82A 3MTJA 4WOKA 4IZHA 5DN9A 3S55A 4EYEA 1ENOA 3LYLA 3ZI0A 1EMDA 4HNHA 3OF2A 2Q2VA 5THQA 5I7FA 3OIGA 1ZSNA 1DJQA 4RQTA 2Y0CA 3GG9A 3D3EA 2DQ4A 1KEUA 1C0PA 2BHLA 5G4KB 4CV0A 1YL5A 4WK6A 1ONNA 1I3MA 2W8ZA 2NM0A 2NADA 3CEAA 2G1UA 2VWQA 1AXEA 1XYGA 2Q22A 1GL3A 5DBIA 3NDIA 1PJCA 4U0JA 3O9ZA 4YVFA 1Q7BA 2JCVA 2Q3EA 1CRWG 4DBVO 1R15A 3EAGA 1UZLA 4RLSA 4DXHA 3WOHA 1RM5A 3JD1A 4Q3EA 4GMGA 4RVUA 5BSEA 5CDUA 5CPFA 1PJ2A 2VYVA 2H9IA 2FSVA 1SZJG 1CIVA 1R0KA 2P91A 4IXWA 4ALKA 4FW8A 2RAFA 5IDYA 1YBVA 4XRRA 4YRAA 1KY4A 2IZZA 4GSLA 3PQDA 2BMAA 3HADA 1NWCA 1Z75A 2I65A 1KETA 1LLQA 5IF3A 1LQTA 3WJAA 1LBEA 4BNIA 2NSDA 3ZNPA 5KJEA 4LMPA 3TOZA 4HBGA 1EBUA 4QQRA 4YAKA 3IL2A 4HFNA 4B3JA 4PLHA 1QV6A 3H8VA 1PQWA 1HXHA 2C54A 5K0ZA 5IXSA 5CG2A 4DLBA 4R5HA 3HN7A 3DTYA 1WP4A 1PU2A 1UP7A 2VN8A 2H63A 1V6AA 5DP1A 5L3ZA 3CPSA 4AJHA 4BQPA 2E6UX 2PD3A 2PKQP 3A1NA 2DBZA 2PK3A 2HMTA 1HDRA 3SBOA 3ZWBA 1R12A 4E32A 4NMHA 3AOEA 2O3RA 2O3UA 3GEGA 3UVEA 3W8EA 3KYCA 1LU9A 1QR6A 4JROA 3TOXA 3FBGA 1PGJA 3GOHA 4BO2A 1C1XB 2VYND 2VUSA 3OBBA 4ZQEA 2GLXA 2NTVA 4WEQA 2VT3A 2NU9A 5I9LA 1G0OA 5ER6A 1GUFA 3DFZA 5KJFA 3F6YA 5BNTA 1Y6JA 2G76A 3H3JA 5GZ6A 1GEEA 2A35A 3K8ZA 4NBTA 4R1UA 4EJ0A 4FCCA 4J6FA 1G0NA 3LT0A 2P5YA 1LX6A 4YYZA 4U6SA 4KQXA 1RJWA 1V3TA 5AXDA 5JO0A 1LXCA 1TEHA 2P9CA 3E1KA 1DIHA 1ZKMA 3UCXA 2P9GA 2PKQO 3LC7O 4FD3A 4IJUA 2EGHA 3KVOA 3Q2IA 3JQ9A 4MVJG 3JQGB 5COAA 1WPQA 1ZUD1 3S2EA 2ZB8A 4Q3NA 1ZH8A 1A4IA 5A05A 2D59A 3UCFA 3PTZA 2ZKLA 3JYOA 2X4GA 2RIRA 1NBOA 2HMWA 4AJPA 1GADO 2CF5A 3WLEA 4PG4A 4Z3KA 2R00A 2H6EA 3EDMA 3R0IA 1JDJA 2X9NA 2CSUA 1BDMA 2J8ZA 4DYDA 1AGNA 1YQDA 5F1PA 1HYHA 4CPDA 4P8RA 4FJ1A 3MOGA 3GPIA 1XGKA 2VOEA 4M89A 3E9MA 3DEYX 2GD1O 3V5NA 1UP4A 5H82A 5A06A 7MDHA 2GERA 5AVOA 5U4QA 4LRTB 1E6WA 3AUSA 1PZEA 2O3QA 3E5RA 3JQAA 2BGMA 5TLSA 3FF4A 3FTNA 2VUTA 1PJSA 4A27A 2O2YA 3FWZA 1D4FA 1CQJA 3OSUA 2C20A 1JKFA 4L9RA 4RGBA 1SEPA 4DA9A 1E5LA 1UUFA 1OOEA 2FN7A 5ENVA 2PD4A 3QIVA 2H5LA 2YFQA 2UUPA 4RZHA 4FPXA 3K5PA 1LLDA 4ROSA 1RKXA 1PQPA 4YXFA 3NT4A 2B4QA 2VRBA 3ITDA 2Q50A 3VZRA 3ZNNA 5HWSA 1QKIA 1G1AA 5LDHA 3RBVA 5J23A 4BIIA 4PLWA 2Q1SA 1VC2A 4CMKA 1YOVA 4YAGA 3ASVA 3M2PA 3O38A 2Q49A 3H9UA 3WGHA 3C1AA 3EVTA 1K6XA 2IZ0A 4IDEA 4JLWA 3HB5X 3PLNA 4O5OA 2WD7A 4ZGWA 4YRBA 4IZIA 4FFPA 3CZRA 4F45A 4G81A 1K5HA 2PR2A 4OJNA 2CF6A 3A14A 1QYVA 3JV7A 4I5EA 3BIOA 3B20A 2NVUB 1DC4A 1YRLA 4RLHA 1GR0A 3GY0A 1AN9A 4TRMA 1WNTA 3INRA 2EKPA 5BQFA 1C1DB 2VNAA 4GKVA 3DBRB 1EVIA 3V2UA 1XSEA 1D3AA 4KTTE 4ALJA 3U0BA 3CMCO 4EW6A 2Q45A 4PLZA 3OM9A 3JD3A 3V2HA 1NHGA 4XQCA 4RPGA 2UVDA 4R68A 1HF3A 3FSRA 4S3MA 3VPHA 3HDQA 3RQSA 3PYMA 4C7JA 3FNFA 3QVSA 3OQBA 1I2BA 1YS4A 1U28A 4GX2A 4IINA 3GT0A 3WSVA 1R6DA 2C0CA 1I2CA 4XYGA 4CMIB 3ZU4A 4BMVA 1CEQA 1IHYA 4FSHA 1I10A 4J1NA 4BO4A 1NHWA 4GGPA 4J1SA 5C5IA 4M55A 3FHLA 2JJYA 2BFOA 3WGQA 3WYCA 1SMKA 3BMNA 4YCAA 2XOXA 4IXTA 2QYSA 4YJGA 4J7CA 4PG5A 4MKZA 4HXYA 2WDZA 2LDBA 3HB4X 4PLFA 3JYNA 1XCBA 3DTTA 4AJ4A 5CDSA 3QHAA 4BV8A 4E33A 3PDUA 1Z82A 3AM5A 2NNLD 1YO6A 1NX6A 5K6AC 5EQFA 4CR6A 3WFIA 4NFHA 4GBJA 4DQXA 2OORA 4LGVA 5CP8A 3K73O 5IFLA 4IIUA 4INAA 3OJFA 3G1UA 4WOJA 1IZ0A 3GZ4A 4BV9A 5JMWA 5ITWA 5FEUA 2BRUA 1U7TA 3UKOA 3WQRA 5KOIA 1H93A 2AXQA 1R4MA 3BYZA 3GEDA 3G1TA 3DDNA 1Y9AA 2BFPA 3JCZA 4PVDA 3DMTC 3W8DA 4CV3A 5DDIP 3F1LA 2JL1A 3INGA 3JQ8B 4IDCA 2OP1A 1ISFA 3UAGA 1M2WA 2B83A 2EWMA 2VZ0A 4Y8VA 4JJFA 3QRWA 5FWNA 3N74A 5ES3A 1VKNA 1ISHA 2FY8A 4B8WA 3FNGA 3P5SA 4BNFA 4JIGA 1BXGA 4GAEA 5G4LA 1PL6A 4DWVA 8LDHA 4IS3A 3VH3A 1HL3A 4NPCA 4YJHB 3ZWWA 2HRBA 1BGVA 1Z73A 1ZEMA 4JQCA 5CEJA 1VL6A 4I5DA 2V6MA 3X2EA 3EC7A 2YDXA 4J1TA 3B1FA 3FTPA 1SAYA 3PWSA 3WTBA 3ZV3A 2PGDA 2VTDA 2BF7A 3BMQB 1I33A 2EHDA 2Z1NA 2Y1DA 4NK5A 3LVFO 3GFGA 1WAMA 3M1AA 3JQ7B 4B7XA 1SPXA 4EI2A 3DAFA 4WKGA 3PFFA 3T7CA 2I99A 2OL4A 2X0NA 3ROKA 3PHGA 2VQ3A 2VWGA 3PDJA 5EIOA 5G0UA 3LF1A 1LRLA 5JMPA 2RH8A 2DFDA 3Q2KA 3RSHA 3GDOA 3K2EA 2YUTA 2ZJ0A 1YE3A 2XAAA 4XDYA 2X5JO 4J9UE 3BMQA 1DRUA 2ZQYA 1ZZEA 5JCXA 4QO7A 1QV7A 2G82A 1KY5A 5KVVA 1PJBA 2HO5A 2I6TA 2X8LA 2BFMA 2AEFA 3E82A 4XEHA 3I9KA 3L6DA 1WDKA 3ASUA 1O9BA 1NFFA 1W73A 1BTOA 1PS0A 1BXGB 3IKVA 2VWHA 3Q1LA 3GVPA 3EZLA 1T2CA 4NG5A 1EUCA 4BB5A 1DIRA 3K31A 1MX3A 4WCDA 3W6ZA 4TROA 1ZIDA 2JHFA 4AJ1A 4PLTA 3VH2A 3QQPA 4XYBA 4BL5A 1J49A 3I9NA 3KV3O 2YJZA 3ZWXA 1B2LA 5LC1A 4J2OA 5IDWA 3E5MA 1V3VA 1Q1NA 4ND4A 5JY1A 3ZNOA 4P4GA 4MO2A 4Z9FA 1FK8A 4JCOA 1DPGA 3RBXA 4Q3BA 4R69A 1F0YA 5DBGA 1LLUA 1DRVA 4XCVA 5JY6A 2ZTMA 3OFSA 3GVIA 4CM9A 4DPMA 1LRJA 3AU8A 4YRDA 3PHJA 5FYDA 4XYEA 3UH1A 4H15A 3KETA 3AM4A 3QWBA 4YJDA 1MG0A 3GNSA 3GVXA 2D5CA 1M6WA 2CDCA 3TSCA 1P1FA 4OL9A 4J3FA 4CUJA 1YJ8A 1Z45A 2GNAA 4XX0A 1A9YA 5COBA 9LDBA 4E0BA 1BDBA 3AU9A 1BG6A 3C7AA 3PQFA 1OI7A 2PTGA 5TJHA 5F5NA 1QYXA 1S6YA 4IQGA 1UH5A 3DZKA 3KLMX 2NTJA 2P4HX 4BS9A 2GF2A 2VHWA 2W2LD 5A9TA 1E7YA 4NNJA 4BNLA 5ADHA 3IDSA 1JWBB 5F1KA 3WR5A 4BVAA 2DPGA 3RFXA 3KOUA 1DRWA 2BI7A 3RU7A 3COSA 3DBLB 3UXYA 4MKXA 1ZFNA 2P5UA 2UYYA 3W4KA 4WJZA 1B15A 1U2GA 2PWZA 3RKRA 4G65A 2FPIA 1V8BA 1CETA 4M87A 4KZPA 4M54A 4B4OA 1ID1A 4ND3A 2GZ2A 3IUPA 4TQGA 4E5PA 5AYVA 1O89A 5JSFA 1H94A 4ND5A 1Q0HA 4J91A 4BKUA 4D45A 1GU7A 3G0OA 3Q11A 4XGKA 1YOVB 4FJ2A 4H7PA 4XQ9A 1C3VA 4TMFA 5I7VA 1O5IA 4LRSB 4DC1A 3GA0A 1TVEA 3L0DA 1IHXA 2XF8A 1MXFA 3VPGA 2I67A 1PEDA 4J4HA 3KSUA 1YH3A 1W0CA 1AHIA 1L7DA 1DFGA 3DBLA 4UUMA 2D0IA 3O03A 4BNZA 1AUPA 5CAEA 1IE3A 2OFPA 2WJPA 2XPCA 1PJ4A 4OYRA 4NBRA 1ISIA 2E4AA 3L9XA 3Q9NA 4IMPA 4KP7A 1H0KA 3FD8A 4HV4A 1VJ0A 3ADOA 1E5QA 3U4IA 3F4LA 2FMUA 4O0LA 5JXWA 5A04A 1YONA 3IQDB 3CINA 3NT5A 1KVRA 1ML3A 4J43A 4PLCA 3TNLA 4DLLA 4OXKA 1A27A 2C7GA 3NTRA 1HKUA 5EERA 1U4SA 1WZEA 3Q9UA 1Y8QB 2NV6A 2C59A 3GVHA 3PRJA 4AG3A 3ONDA 4M49A 3KSDO 1IY8A 4ZVVA 1SO8A 2FSSA 1HDGO 2O4UX 7ADHA 3BMCA 1RM3A 4Z0HO 1DC5A 5A3VA 2OZPA 3TPCA 3JD0A 2AW5A 2PH5A 5L7WA 4RF4A 3JQBA 4GQAA 1GEGA 2D8AA 5EL0A 4E5YA 2C5EA 1GQYA 3V1TC 1O95A 1DLJA 2Y1FA 5HS6A 3SLGA 1WWKA 1B8PA 4Y9DA 3R3SA 1LA2A 3HFSA 2DM6A 1LLCA 3IKTA 4MINA 2YHUA 4MVJD 4LK3A 3WQQA 1N9GB 4L4SA 3ON5A 4QFCA 3TRIA 1HDOA 3NDJA 1K3TA 1LEHA 3GZNB 3M2TA 2OP0A 3DAPA 4D3FA 1BSVA 1N2SA 3KXDA 3WX0A 1RWBA 5TRTA 3U5TA 1XG5A 1NP3A 5ITVA 4RCVA 2NWQA 1NQAO 3ROQA 5GY7A 2PZJA 1EE9A 1U3UA 1E7WA 2O48X 3DWFA 4FFMA 3RKUA 3F5QA 3LSYA 4TWRA 4QUKA 2PLAA 2J3JA 2CDBA 4DGSA 2GN8A 3H9GA 3JTMA 1EE2A 3ZGYA 4TKLA 5K6AA 3DL2A 2HUNA 4R4JA 2VHZA 3FPLA 2UV8A 1HYGA 4OGWA 2WD8A 4W9NA 4IBOA 3MOIA 2ILTA 3I6IA 4CUZA 3B70A 1ARZA 3H2ZA 1E3LA 3W4IA 2C2YA 2X86A 2Y0EA 1E3JA 4IGFA 4ZQGA 1CYDA 4TSKA 4XB2A 5TT1A 4K6CA 1C0KA 2OXIA 3RFTA 4YR9A 1KC3A 2UDPA 4RPHA 3E9QA 4WLEA 4D79A 2QZZA 1IB6A 2HQ1A 2ET6A 4ID9A 3F4BA 4OQYA 3BHMA 4KDEA 2VNSA 4WASA 1VJTA 4GPD1 5C3MA 2PY6A 4JP3A 4CLOA 3FNHA 3LC1O 1M76A 3E8XA 3OIFA 3NRCA 1EBFA 1QRRA 1DIBA 1XIVA 5T67A 5GZ1A 3KRTA 4XR9A 2JFFA 1E6EA 1TI7A 1OC2A 3VHRA 3HE3A 4DRYA 4J4BA 3AFNA 1R4MB 3KTDA 1JU9A 2NLOA 3DHYA 3QW2A 4ND1A 4Y67A 3WGZA 2BGLA 5IN5A 1SOWA 2B36A 2VZ9A 1NQTA 3GDFA 3MWEB 3OIDA 4CR8A 4CODB 1XHLA 5C37A 5DNAA 4MP8A 4AJLA 4BGIA 3PWZA 3LZ6A 3ABIA 3JQ6A 3JQCA 4GLOA 5IJZA 4JBIA 1EK6A 3IJRA 4HFMA 1DEHA 1E7QA 4IDFA 2QW8A 3WJ7A 2JFGA 1IL0A 2QX7A 2W2LA 3NGXA 4IJWA 1AE1A 4N5MA 4FB5A 1N1EA 1UDBA 3TQHA 3ZH2A 1QP8A 1EEHA 4LSWA 4W9NC 1C0LA 1UXKA 2JD1A 2UAGA 4L74A 2EERA 2GRAA 1BMDA 3BA1A 3K30A 1PZFA 2XXJA 2R00C 1FDUA 2Q46A 4I9HA 4YT5A 5F3RA 1KYQA 1HZJA 2Z1MA 1U8XX 3AUTA 4PVCA 1PGOA 1TT7A 5HRUA 4Q9NA 1ADGA 4O6VA 1C14A 2C2XA 2B37A 1ZK3A 2AMFA 1QYDA 2JFHA 1UAGA 2I76A 3FR7A 4BUCA 1SEVA 5CFZA 4XDZA 2JD0A 5BSFA 3GHHA 4D0RA 1D7OA 2YV1A 1E77A 3N58A 1S7CA 3SX2A 4BNTA 1JKIA 3AJRA 4KTVE 4AJKA 3NT2A 3LC2O 1CF2O 1GQ2A 1NYTA 4OOEA 1U3WA 3RIHA 4AJNA 3HDHA 4CLXA 4PCVA 1HT0A 1MG5A 1W8DA 4FGWA 2IEDA 1EUDA 4XIYA 1LDMA 2Z5LA 5TT0A 1LI4A 4UUNA 1O8CA 4E2ZA 3VTZA 1E92A 4QX6A 2HAEA 4ITUA 4K26A 2OO5A 3FPCA 2I9PA 4NJOA 5FI5A 3VKUA 4A0SA 5KKCA 3G3EA 2O7QA 2DKNA 4D7AA 1UXGA 3DFUA 4FFRA 1A4UA
chains in the Genus database with same CATH superfamily
4B3FX 3AKYA 4XYLA 2FW8A 4Y7CA 4I9NA 4ZT2A 3I5UA 1VL0A 4B48A 3STHA 4ZYVA 5IH3A 5LU8A 2HDHA 2VP3A 1E20A 5BN3A 4KMOA 5FAKA 1M74A 2PX0A 2QT1A 4KGDA 3C4QA 4KDCA 4JDUA 4WN3A 5FUBA 5BVGB 2BONA 4L4XA 4BO3A 3UUWA 1OBFO 3EUWA 2ZAMA 4IEIA 4KI7A 1SQ6A 1V47A 4C0SA 1UDXA 2OCLA 3WGUA 4ZI7A 4RNCA 4XJSA 3N28A 5CGQB 4NYIR 8GPBA 3GR6A 1CRLA 1ZOPA 4NK4A 4IX1A 4AY2A 4HQRA 5EHGA 1NR5A 5CH8A 1CE8A 3WSTA 3OH8A 1EXWA 2BI8A 3H1BA 3IP9A 5E38A 1BYIA 3FLMA 4LF6B 2PS9A 1XOIA 3FY4A 3ID6C 3RI3A 5A4IS 1OGYA 2B0CA 1OHHA 1UM8A 3DVAB 5FA8A 1BQ4A 2O2DA 3CYFA 3GGCA 4JC0A 1YXMA 4AFNA 2YMQA 3TYXA 1MO2A 2QY6A 4KUGA 3U13A 3M5CA 1VG9B 1NVFA 2TMDA 4C07A 1F2TA 3FYTA 1KSFX 3MWLA 4A03A 3ZIAA 1RJGA 5IM5A 4FM9A 1H8ED 5E1MA 3B13B 4F12A 4ZYYA 1SBYA 3ZDBA 1PG2A 5BMVF 1T6ZA 4EL5A 1YACA 2F4VB 1U04A 4S12A 4RQUA 4BTEA 5CCDA 1KO4A 3R6DA 1W88A 2IYEA 2HTFA 1SD5A 4K87A 4MWSA 5EJIA 1BD3A 2PFKA 3WBBA 1SD2A 3VR6H 1ZWKA 2XF2A 4U7WA 1YWGO 1Y8RB 5BW6B 5DW0A 1ZSVA 4ID3A 3UYLA 3ZOKA 3AEUB 1KYWA 1GU0A 2QE7A 5A4JA 5IZCC 2W9XA 3WQHA 5CT9A 3BRSA 5IC6A 1CLUA 3SR4A 4EITA 4ZCRA 1V4NA 1Y5RA 5AXBA 3OD5A 2P65A 2VHQA 1IM2A 4LDNA 1HPLA 2YC4C 4LZWA 1FW6A 2M98A 4W82A 2XB4A 5M6DA 3B89A 3DZ4B 3LBYA 4R1LA 5AUQA 2EGGA 4ZVRA 4TGLA 1OT5A 3CBGA 3LVBA 4AP9A 1ZXBA 4G5HA 1UK8A 4I1UA 2RGGA 1NFRA 5IJAA 2DUWA 1J90A 2J1LA 3OZTA 3CVOA 4GPAA 1WF6A 2JI4A 2G1AA 2G04A 4DCSA 1GV1A 4M6WB 4PYKA 4JYCA 4C6RA 1PEYA 3SY8A 3H7IA 3U4QB 2P75A 1JSCA 2AHRA 2G0TA 4RD3A 3ESRA 3WRYA 3WOHA 5BWCA 2OXCA 4V1CA 1GT6A 2R2GA 3AF4A 3WK7A 1VPDA 3HKBB 2AG6A 5CXUA 4ICIA 5CD9A 5KPJA 1QH1B 4ZARA 3D0RA 2E48A 5T4FA 2VP6A 4D97A 5B30A 1QYCA 4F11A 1FTSA 2R79A 3BWVA 2P3SA 3O73A 3SMVA 3QXSA 4MKIA 4YRQA 5CJ2A 3KLOA 1EFUA 1V25A 3FSGD 1RLJA 2ATCA 2QXTA 4XWYA 4YIKA 3STXA 4CLEA 1N9KA 1CD5A 1PTKA 2HMUA 3LPDA 2BR4A 4KQ6A 2H65A 1KE2A 1B0UA 2XCRB 5AM4A 4KNVA 4CM4A 3DVAA 2ZJOA 2B35A 2HA5A 4XZ3A 1A5ZA 3REQB 5JDCC 2ZWPA 5CNJA 2IKQA 5ESWA 5JJ5A 3LM8A 3E58A 4EY6A 1W49A 4NR0A 1I94B 2C57A 2MSKA 1IWOA 1HMYA 4ZU3A 1J8VA 3K92A 2VXCA 5BNWA 1E7MA 2VZ8A 5C0OE 4DNQA 2VJYA 2J7KA 1JWAB 2VDOB 4CT4B 1TA9A 3NEYA 4OXIA 3WHIA 2C8KA 4A6DA 3K35A 4D9IA 4DDKA 2V7VA 2IODA 5ALXA 3H2BA 2XA1A 3L1UA 4HAVA 1JR4A 3M3PA 2XZOA 3GMSA 4AICA 1YI0A 4R9NA 2V74B 4WNYA 1M5UA 4CQMB 2K2QB 3W1VA 2QNRA 4UBOA 5A3JA 2NO6A 3D3JA 3KT8A 3C45A 3ZK7A 2UYCA 2QJOA 4LZAA 1HO3A 3MRTA 1D1PA 1EP2B 1JHAA 3I4LA 3VKWA 1S2LA 2P35A 2RGWA 3MJ4A 1R37A 2P90A 3ZWNA 4MYDA 3TRKA 1SK8A 1A98A 4AUNA 5CCEA 2QLLA 1WO8A 3QSGA 4HADA 1X92A 3BXXA 5BSHA 3PLAE 2F90A 5LZ7A 3VC7A 1R9NA 5D00A 3MSCA 3NETA 2O0KA 4XQ0A 1H42A 3NHLA 1KY2A 2VAMA 1B16A 4DSAA 1OZHA 2X0DA 5M29A 3IVGA 4WSOA 4BVEA 4QUEA 4LWOA 2ADOA 4M0EA 4B73A 4M88A 1FX0A 4A6PA 4OLBA 4ND8A 1R9MA 3D31A 1TAQA 2QN1A 3O2QB 1IY1A 2PGIA 1HI9A 4OHCA 1KXJA 2EDAA 5JANA 1TEVA 3A6PC 1QV9A 2J4CA 1YNOA 3M6IA 1P0FA 1YQ9A 4NFYA 5B5SA 2XMDA 1SVLA 2N46A 2VPYA 4TMVA 1VPTA 5I9BA 3T41A 2PXHA 3RGWS 3RODA 1CSEE 2A59A 9ABPA 4UTNA 1Y5MA 3ZGOA 2QIPA 3SJCA 4M8LA 4NNOA 3BT7A 3RC8A 2IYRA 1ONBA 3E18A 3AEKA 2B92A 3N6RA 2HWXA 4DT1B 1BDJA 3RTBA 3D2AA 3L84A 2C4TA 4GKKB 1ZH4A 1YZUA 5D7NA 4ZHQB 5AM0A 2X2OA 5B1SA 3CRNA 2HL6A 4YC7A 3PGVA 3PWTA 5FBVB 1J6UA 5JALA 2ZCJA 1U9JA 4BB6A 3E7DA 2NXEA 4KHPB 2RMKA 2LTAA 4JI7B 2E4WA 2WVAA 4FD2A 1PFUA 1RR6A 2C7OA 4HRYA 5EZYF 5KJ1A 3L01A 1RPJA 1ZIYA 1R3DA 3QE9Y 2VCYA 4AK1A 5HKBA 4P7GA 3FPFA 3ELDA 2BTQA 3L2OB 2OGWA 4U9UA 4UBJA 3BE6A 3W6PA 1O4VA 2QDXA 3AP2A 3GFVA 4C5BA 3ZGZA 1AXRA 1BKSB 4TSFA 3AO0B 5JSUA 3ZCPA 5MDHA 4RPJA 2BAGA 4S1VA 5H4GA 1QANA 2AQ8A 3HZZA 4NOKA 1Z3CA 4NCBA 1LI7A 4CQMD 4BP8A 4EB3A 3SVZA 5CA1F 1OLUB 2OORC 3L0IB 1U2DA 3WLLA 3U39A 2Y1KA 3EVBA 1Y42X 1OWMA 3RAPR 1RIFA 3WKCA 3NEAA 3BJIC 1OC4A 4WXMA 2NUAB 1I8TA 2D2IA 2CMKA 1XQ1A 3RROA 3TM4A 2Y0DA 3GVCA 2IDKA 4RMIA 1K4MA 1SUEA 1G6Q1 2AJ8A 2ZIXB 2IYTA 2NZVG 2OT3B 4BO5A 3R7SA 2EXXA 1WMSA 5AOVA 5EMKA 3ZJVA 2ETVA 5EE0A 5ADVA 2HHCA 2AWNA 2JLWA 2IHBA 4WI1A 1U7DA 3ZKAA 4X1KB 4PSAA 5JLAA 3T1OA 4YV2A 2VDLB 4XFJA 5JE8A 2H48A 3MCVA 4DHWA 1FP4A 1MX9A 2D7CA 2FOIA 1XA3A 2FXVA 1JLRA 4KLZA 2VPXA 4CR7A 5BPHA 5JTTA 4TN1A 1PHRA 4HS4A 3NP7A 4DXDA 4DDMA 2GQ0A 2IIQA 4G5RA 5JG7A 5AT1A 2QZJA 1CHNA 4W9MC 3DMRA 3F46A 4ZVKA 4CKBB 4JDPA 1XWIA 4NYMQ 3NTQA 2VYVD 4H31A 1G21A 2FW9A 1NSYA 1EVLA 1FP4B 3PSHA 3GK3A 4DMKA 3VZSA 2JGRA 3UAXA 4FDMA 4QWWA 3N7UA 1RRCA 2R1UA 3DC2A 4YPFA 5AI6A 4Q7MB 2F3UA 3WJ1A 2AEJA 1MV8A 1T25A 2B1IA 3TF5A 3RARA 4DUGD 2AMLA 3G1WA 5CEFA 4B8ZA 1U63A 2OQ2A 3H5RA 1IBSA 2EYUA 2VBFA 3FUVA 4XIJA 3QKSB 5JC8A 2NUAA 3CVWA 4R7GA 2ADFA 1KR2A 4AJJA 3AQ4A 3WWDA 3PGMA 8AT1A 4CM8A 5BUQA 1YL6A 4FR5A 4HSGA 2RGXA 2W4IA 5CT6A 1K68A 3HCFA 1QS0B 5KAMA 1U7WA 1Q6ZA 5AI9A 3L0BA 3J81k 1V1RA 1JFSA 3PQ7A 5DI3B 1K63A 1Z2NX 3R09A 1TTHA 1L4UA 3U37A 1GZHB 3IIJA 3KZOA 4DV6B 5DSXA 5FR1A 1GQRA 3N76A 4GMHA 3LNCA 1WCV1 4L7QA 4L2IA 1ZIXA 2WRZA 1HZZA 2WHQA 2X23A 3AHCA 3GJTA 4GX1A 4MV8A 4RKFA 4Y9RA 3T3DA 1CERA 1LBQA 4AKTA 4MRRA 1EVJA 4UE3S 1Q2XA 2HCJB 4RSMA 4YRCA 4YQFA 3I2GA 3NHYA 4FLEA 4RY8A 3R7WA 3A6HA 1U0GA 3K09A 3KYCB 4FBLA 4FS8A 5HTOA 1KMCA 2CVHA 4I8DA 1WD7A 2GN1A 4AJ2A 2PT5A 2W2MA 3WK9A 1E2NA 2VDNB 3BXFA 1K2VN 4DC0A 3CMMA 4TPKA 4UEJA 5KI6A 5A9RA 3L93A 5K0JA 5FOVA 2RG7A 3ESCA 1KPHA 3LHDA 3LPMA 5EJMA 3SQOA 2GWRA 3ERCA 1TT5B 1C80A 1V8OA 4N8SA 2IS2A 1FNDA 5JQWA 2V7PA 4YMVA 4BYGA 5DMXA 3AKCA 5KDLA 2AG5A 4E5MA 1FEZA 4CMAA 1R0XA 1KEPA 5DCWA 5IKPA 5L7YA 3HDJA 2I2XB 4B87A 3ZC3A 3LLSA 1FQJA 3ELBA 5F77A 1NVWQ 4QUHA 2OYRA 3VPBA 4Z1MD 5HVNA 1ETHA 5A02A 1M2OB 4QRIA 2GM9A 4MKGA 2QTLA 3KFVA 3VDNB 2V6FA 4LJKA 5LQKA 1AKNA 2ATVA 1U0NA 3EZFA 2PUWA 2OLJA 1X42A 1Q0PA 2ZEJA 3IMCA 1JBEA 3M4NA 2DFPA 2DR0A 4FGUA 3QEBZ 2ZCUA 3KFXA 2CLMB 3DE7X 3AXTA 3PT5A 4DG5A 3LQ4A 3P97A 4WCFC 4WZBB 1HLPA 5BMOA 3T7KA 2E4XA 2WIJA 3CEPB 5IJ9B 4JEMA 1PYGA 1Z7YA 2XVXA 4X71A 1N4AA 1E6MA 4MDHA 3INNA 4MVCA 1V41E 4GC5A 5T5QA 1UKCA 2ZVPX 3E9DA 3EXFA 4U0KA 1M67A 3HA5A 1T2FA 5JAZA 1ABFA 3W6UA 1PYDA 2QDKA 5AJYA 2A0WA 2BL4A 2O8CB 1XQWA 2FSPA 4TSRA 1KP2A 5TQ0A 4HF7A 2VRNA 4WZZA 4W5QA 3BUSA 3BMOA 3VTAA 4FN4A 3MSXA 2JJ1D 2E49A 1E1MA 1GNSA 3V4LA 4P9NA 4KREA 2ORVA 2WFLB 3LDHA 3LLCA 4E5SA 3FM9A 4TQ9A 4K9LA 5B6PA 1ZUWA 4MVXA 2REQA 4KIUA 1VJ5A 1KDZA 3UBMA 2I66A 3WL8A 4KGZA 1YL7A 4OF4A 2FJUA 3V1YA 2V58A 2XQVA 1GZ5A 1SKQA 2JC3A 3C1OA 2WF9A 5U1PA 4KHZA 2Q1TA 3GLQA 4M7RA 5BV7A 3LDFA 4Q7LA 4G5QA 2PAAA 1P45A 4W8HA 2HJ9A 2WOJA 2J5BA 1Z0JA 2JIPA 2XA2A 2WW8A 1PHPA 5BN5B 4W99A 1GA6A 1II9A 3C7CB 5KC9A 2BH9A 1KVTA 3KE9A 3P52A 4MR9A 1P1CA 4EJ6A 4EPXA 1TNDA 3K9WA 4PSDA 3BD6A 2ZYHA 3R7DA 4F71A 1XK6A 2ZUUA 2UYHA 1KYTA 1FC0A 1H8HA 4B3MB 1NJ6A 1NIPA 4NFLA 3NHUA 1BWQA 4EHIA 1P62B 5BWMA 4C0HA 2EF1A 3LT1A 1U9YA 1UPAA 2QVLA 3M6UA 4PNEA 3KR0A 3LO8A 3PKZA 5B7QA 1P2SA 1X7WA 2YXBA 4UVDA 4ZAGA 5LMNB 1QKKA 4KV9A 2AJTA 3AJ9A 5CVJA 2NQTA 3L6UA 3KXPA 2DE0X 4B7CA 1C8KA 1E69A 2J30A 5DKFA 4FMDB 2YMPA 4N9QA 5I7RA 2QVGA 1P44A 2K4MA 1ODLA 3B1JA 4W5OA 3VPFA 4PU0A 2C7VA 3TW8B 1CHDA 1PZGA 1T5HX 2EL7A 4JD5A 2ZRJA 4MGZR 3HY6A 3OKCA 3W5VA 1O9HA 2ZBVA 4RFSA 5EXTA 4BVHA 1LNSA 1AV6A 2P9EA 3WYDA 1JWLA 1ZK1A 1ZAYA 4QPJC 2CNWA 4RAQA 3H9BA 2NP6A 2X76A 1JEEA 3HYCA 4RK0A 1CDDA 1ICIA 3K6JA 1KC1A 3PV0A 4MV7A 2MMCA 1FSSA 4PGGA 1E2HA 4YWJA 3CEHA 1ZW1A 1YZQA 3UHOA 1O6FA 2DBRA 1YU9A 3QV2A 3H5NA 3L4KA 1TMGE 5L40A 3FBWA 4FC7A 2A67A 2ZIEA 3S2FA 4KQWA 5KQLA 2XR1A 3ZXYA 4X20B 4QUBA 2HZBA 4DC9A 5F7ZA 5ADUS 3ZJUA 1T9DA 1FNBA 5HMLA 3QI7A 3UOAB 2I6FA 4W1PA 3AUAA 3TBHA 2RGEA 3QMVA 4P98A 2XB9A 1J8YF 1UBTS 4K46A 1YR7A 3KZVA 3Q8XB 3U62A 3TZKA 1KYIA 3PEFA 4B71A 2WWIA 3NHWA 2C1EA 3CRW1 4RK5A 1WUJS 2CT8A 4A36A 4GXTA 3SHVA 3KYBA 3VR0A 5KNDD 1Y1TA 2ZRLA 4QICA 2G5CA 4R3UC 4XD2A 5FIUA 1SC6A 4B8YA 1SHKA 5JZBA 3WP0A 1WKBA 4YDHB 2D3TA 3RFCA 9ATCA 1NKSA 4JP2A 1AKMA 2CVPA 4DSOA 4ZRNA 3BS4A 2ONJA 3RYHA 5BT9A 3BTSA 3R3YA 3NBXX 4TZKA 5F4ZA 3H9EO 3T9FA 2IXBA 1TGVA 3CN7A 1WUTA 2QB5A 4M1SA 4RETA 1T9AA 1TUBA 2HRCA 2ZBRA 2IXAA 3CH7A 4C2BA 4C88A 5CFRA 3PB3A 2XUHA 3L4EA 1ODKA 2WP0A 4TVOA 2OXTA 3C14C 2GMWA 4DY4A 1KJQA 2PSFA 3GRCA 6PFKA 2R0QC 3JSXA 5EUBA 1JDUA 5ITZB 3C5CA 3A6JA 4W8GA 5HQTA 1WB5A 4AM8A 3ZLUA 4DA8A 4JKOA 1T3SA 3UA4A 3SIXA 3MT7A 2BGNA 1I72B 4RDIA 4RSGA 3T1QA 2KMLA 4CTKA 1JYFA 5BV0A 4N5NA 4N5DA 5G4KA 1NL3A 4DR1B 4AZ3B 4DV3B 3Q8LA 2OXEA 1RQXA 4B3HA 4JYPA 1L2TA 3MEQA 3RASA 3TLAA 4E3WA 2XUFA 4OMDA 2ZTLA 2WM3A 2X6TA 4MI9A 1D03A 2OB1A 4PXSA 3FNEA 1U1GA 2VQ6A 4AJ9A 3AIOA 1EK5A 3EVEA 4AK9A 1QPZA 4LF9B 5AJZA 1CS0B 2B8JA 3ZDFA 1NONA 4KR0A 4Z7QB 1ZOLA 2P2SA 3WIEA 1FY2A 3IUJA 1JL3A 5BSGA 2AR7A 3E70C 2HA7A 2M32A 3KEMA 3U3XA 1R66A 3D9QX 1C81A 1QIKA 2X5OA 4O3FA 4Q4HB 1ZU5A 5B1IA 5JAMA 5MFZA 3RLFA 2HN9A 1K97A 1TU4A 4I9UA 4KDFA 5ECYA 3MJEA 2AF4C 1LQUA 1ESNA 4G0UA 2P2CA 1RRGA 1BOOA 4GU5A 3R8FA 5FYQA 4N9WA 1H66A 5ER9A 3HUFA 1KPGA 4O1MA 1VLZA 4IDNA 5LP6C 2JFPA 1GDDA 4RPIA 5J1SB 1XZMA 1YZ3A 3FVVA 4GVLA 1H2ZA 2VJQA 2F48A 2QAIA 2ZREA 4I4CA 3I9FA 5K0CA 2D2EA 3C6KA 3DZGA 3K6RA 1GHTA 2OCDA 1YIAA 2VK8A 3IIMA 4UQOA 2HCRA 5BOVA 4I3HA 4XLLA 2XYQA 3GUYA 3U26A 3E61A 2G7MC 1OE0A 4P3PA 1RI5A 1IZZA 2HNKA 3A0RB 1QQTA 3HS3A 3ZX4A 1RRVA 3L6CA 4KWIA 1P74A 5EPOA 5DTMA 4TMWA 1KXZA 2G70A 1USIA 1H2XA 1Z4JA 3GPBA 3S7ZA 3ND9A 2IP2A 1JHYA 1K06A 4K6KA 3D5TA 3TLGA 1FS4A 4JVOA 4JC4A 5JVDA 5ALQA 5EA2A 4NL4H 2ID4A 4U7TB 1TJPB 5F3DA 1NW6A 3I9JA 3K05A 1DKQA 5KTMA 4D9KA 2NTYC 3TFOA 1PV1A 3JARA 5IVKA 1B0AA 5JRZA 1B4DA 1N8NA 1NXWA 2P0EA 3KUUA 4TLDA 2ODEA 3OOYA 5DTJA 1GKLA 2WI8A 4A2PA 2QU8A 4C22A 4LSMA 1JZQA 1M1YE 4B6QA 1PF7E 4N7RA 4OQQA 3ZK8A 2RHLA 1CW2B 3OA2A 4JI1B 1RJEA 4L75A 3KVRA 2HCTA 1UFVA 2PQ6A 2ZIWB 4ZI7B 1TVMA 3EEFA 1UMBB 2KS6A 3BIJA 3EAQA 4MLCA 3TLXA 4BVKA 3FVRA 3NEJA 1FBNA 3A4MA 4Z1MA 3VNVA 3SK0A 1EHYA 3ZTTA 3SDSA 2ZDQA 1MENA 2YQZA 3PNKA 3CZ5A 2ZXFA 4O3MA 1E1CB 1T8WA 3HJHA 1Z0SA 4G25A 4IOKA 3B7WA 3RBZA 2RB5A 2V3CC 1E1QD 1BWRA 4QVGA 2F00A 3B2EA 4F93B 3TSAA 3F9IA 5C32A 2RGBA 3PLRA 1T4BA 1EQUA 2EJVA 2IIPA 3A9WA 4UHKA 2Z6QA 5CFLA 3ZGLA 3O83A 3ZCTA 3QEOA 1CVRA 5DEIA 4S1WA 2ASVA 1JG3A 3LCMA 4WZAB 3RJMA 3OZSA 1DCTA 1JUDA 3ENZA 2XUAA 4ESEA 3PP8A 2F8SA 4TT3D 3KKMA 1TU3A 3EN0A 4ETIA 1JHZA 5FFFA 1ESEA 1UM9B 2YNMD 2FJPA 4YQYA 5C51B 3ORRA 4ZHQF 5KYUA 2XSZA 4FYJA 1S8NA 2DFVA 2G9QA 1E3SA 1P1JA 1EXNA 2PRSA 3B6KA 1ZCJA 5DX0A 1Y5IA 5GJBA 1NF9A 1U1CA 1Z6QA 4Z4GA 2XZPA 3KYDB 4J7AA 3W3ZB 3R1IA 1Y5LA 4WLFA 3MTIA 3P9IA 3OMLA 4IUYA 1JVSA 4S35A 5EGNA 5BW8A 5JSHA 1AKUA 5EZYB 1N0WA 5KPDA 1XZQA 4K5QA 1A9ZA 1UEIA 1GUZA 4XDGA 2ZUWA 3FOAA 4HRXA 1WCWA 1XZDA 4BLUA 5BN3B 4JLOA 4BXOA 3BIFA 2G17A 3BTUA 1KMHB 3UC5A 1OLXB 4UKDA 5IAOA 3C48A 1QP0A 1E2GA 4B6JA 4OK3A 1UQUA 2YY7A 2O2SA 2FR1A 4YRGA 4NEGA 2Y2UA 2A84A 3IOCA 1HORA 4DV7B 5LBIA 3H5AA 3WRXA 3KJHA 5C1PA 4LF7B 4DUGA 3BMXA 2XQJA 1XB2A 3B53X 3PU6A 5CA1B 3VO8A 3ZD6A 1JW9B 4WNAA 3GFOA 1BHSA 3PDIA 3VC3A 1RD4A 1LI5A 3VPXA 3K0CC 4OHXA 4LNUA 1J33A 1KZ7B 3DLAA 3KGDA 3ZX5A 5BUCA 2BKLA 1VE9A 1YJCA 3B5EA 4PS1A 3V2GA 5CURA 1E0DA 2JAOA 4TTSA 1TPZA 2HQBA 1GNTA 3OPNA 4HAYA 3ZHBA 3F6BX 2B2XA 3TN7A 1EIWA 3OHSX 1OF1A 1U0JA 1CJVC 2CKMA 4C9BA 5JNVA 2IVZA 1OQAA 3M89A 4JBLA 5ALEA 2E87A 1HLDA 2PGNA 2NXCA 5CLLA 3ZU6A 2FZVA 3CLUC 3IAS6 4E94A 2HF7A 1H4SA 4BJ6A 2R85A 1AN0A 2QJWA 4IIGA 2GM4A 1DTEA 4I4TB 5EIBC 2ZI5A 1XU9A 4UAGA 3H9JA 1XP5A 3PQVA 3DVLA 2ZR9A 4FQ7A 2DBQA 1W88B 3RVLA 2GHTA 2P77A 3FFBA 5AKGA 3H04A 1E7RA 3P9YA 4WZAA 2Q0HA 1NDHA 4L50A 3GH1A 2V0CA 1GNRA 2FWPA 1JR3D 3DWGA 4FDUA 4BLTA 4CIDA 5JWRA 2QIOA 2JLUA 5H3CA 1AMUA 1SVWA 2QD4A 1KSJA 2HH9A 1G38A 1FFHA 2GT1A 4PS0A 4A0GA 5T6MA 4L3WA 2GDJA 1RHMA 1WCIB 2Q6TA 4IDDA 1GCIA 1Z4IA 3NIFB 3P27A 1L7QA 3OLQA 3J81A 2VAWA 4JYZA 4DQDA 5TIIA 1DQNA 3PZRA 1FSFA 1GL9B 1LJ8A 1N3BA 3B3GA 3E22B 3GJ4A 2FPLA 4BKOA 2ZBFA 5DI9A 5DYYA 2DTEA 5TS3A 2GZAA 1VE6A 3KJGA 5TEWA 2ZTSA 1HH4A 2AS0A 1KMQA 2DR2A 2EOAA 2ODQA 1QFZA 1VKOA 1ESCA 2FKAA 3I2JA 3KAPA 4QJBA 3FAZA 3L8GA 4XIIA 3QG5A 4KO4S 4YPVA 1X1QA 1QVRA 4JXJA 4PTYA 4Z3DA 5HRAA 4X7BA 3S2YA 1Q50A 2PSDA 2AQIA 4UNSA 4ANFA 1TRKA 2A1TR 3GJXC 5JRDS 2XD9A 3TQRA 3V6MA 1E5XA 4EHJA 4MIEA 3S2IA 1CKEA 3QXCA 3ZWKA 3SICE 2ACEA 4QSHA 3WOVA 1CP3A 2BEKA 3W78A 1P1HA 1KEKA 3MHPA 3OQ1A 4ZA2A 3IDOA 2XMGA 3BD7A 3DZ7B 1RMTA 3IJ5A 3WWYA 4IIJB 4UM8B 1A7UA 2X0EA 3HEMA 1ORTA 2HSWA 4I66A 4ZYWA 3JAKB 4IWXA 2BKVA 1DAMA 3GCXA 1K7FB 2HBQA 2OFOA 5IRCD 2J7PA 4L72A 3F5MA 1XP8A 3AI7A 4RJIA 2JAXA 1COWA 2W70A 3SBXA 1PL0A 1QXSA 2HJRA 2VDQB 1KFJB 4V0RA 4GPZA 1J2RA 2EQAA 3EPAB 4MNTA 4MWBA 4NYJQ 4PAOA 3TZEA 3WO1A 2RBEA 3CUUA 8ADHA 3I9LA 1IUKA 4HO1X 1YQUA 7YASA 3VSAA 5BN4B 4YBZA 3VDMA 4HNGA 1JAHA 2Q5LA 1T0HB 2BELA 1U2TA 1JG4A 4I1SA 1HG0A 1XJCA 4Q9JA 4EI9A 3W3AA 5HF5A 1BVUA 1L6IA 1TK3A 5J40A 4D3XA 2FPGA 2JD2A 5GQSA 4M99A 3TRHA 2PH1A 3S2GA 1P8JA 4JYBA 4X3PA 1PTJA 2GUWA 1A7KA 1VG1A 1XELA 3HWX1 3KKKA 1G4HA 2N3ZA 2G3YA 1VLLA 2PSHA 4JITA 1MJHA 4OCZA 3T3HA 2GN6A 4B9EA 2QG4A 4F4HA 4RM3A 4J76A 4IF4A 2QN8A 4TLEA 4TOIA 1B1CA 1QZXA 3V48A 4DKJA 3L0YA 2WHXA 4YJFB 1HNWB 5DT9A 4EX6A 3O26A 2AYXA 2VHEA 3GGDA 5GP1A 1ZI8A 3T9EA 2P30A 3AB3A 4AUMA 2JVKA 5B36A 3OETA 1O8BA 1ZHOA 4XASA 2IC5A 4XFKA 3U1BA 1LPMA 1MR3F 2DFLA 2EKZA 3NBKA 3NUZA 3DTNA 5A2QA 2MSWA 4YECA 5THXA 3F9RA 1FTGA 1GIAA 1GY8A 4LJ7A 2AK3A 3RUDA 1XRQA 1YV9A 3F6SA 3UMJA 2WWGA 4BRWA 4XM1A 3PGJA 4NI5A 2GRUA 2PX4A 4K6GA 2HHAA 4FFNA 1NBMA 5BORA 1HYQA 2NU7A 2PZGA 3BSWA 3A9UA 4EELA 4NBUA 1URPA 2CXTA 2GARA 2XZTA 3H1EA 5HBRA 4PC3A 3QE4A 3PC7A 4IV5A 5AVTA 2WE7A 1YB4A 2PS3A 3E9NA 5HUHA 5B37A 5MGBA 3WMWA 4HDSA 1PSZA 1WUKS 1W4CA 5TPZD 1TYDE 1XTPA 4W4TA 5BW4A 4K9DA 1P0PA 1IMJA 3HZOA 1T1SA 3MBKA 4CTJA 1E2BA 4A2QA 5CCBA 1MGOA 2JIDA 2Q2QA 1QFJA 4RPLA 2Q0QA 5KKAA 1XVVA 1H0SA 2FW0A 1QLJA 1VSBA 4FINA 4ZVOA 3UTCA 4LVCA 4B5KA 3KZNA 5KYYB 1DEKA 3I5MA 2LZ0A 4GE0A 1IN1A 4U00A 4EKYA 1D07A 1DV2A 3OF3A 4EMBA 4KMMA 3TZBA 5EJ8A 3FYCA 1G59A 4WY2A 1ZCAA 1WMAA 1LPAB 3LX4A 3IRVA 3QWHA 3TTUA 2W93A 2G83A 3BB3A 4D8WA 1KH2A 2AXNA 3P71T 4UVIA 3WNDA 4H60A 1TMKA 4BKQA 1VGQA 1E1KA 1Q7RA 3HR8A 1FYFA 3QU7A 1QO7A 1GM5A 4BN4A 1T8YA 5L6LB 2YVKA 1S4MA 2RHGB 4JGIA 2Q5JA 2FPIB 3K6KA 4ZGGA 2OV4A 3RSGA 4WAUA 1NQ5A 1HTBA 1OBVA 3KR9A 4E2WA 2VKTA 4BX2A 1TZMA 2MOKA 4RFLA 4D25A 3I9V1 4YMTA 4HDMB 5DNCA 2IXGA 3ZHZA 1AT1A 4DJJA 4QSMA 3IVCA 4EKNB 2RCYA 4YAOA 4U7DA 1Y1RA 1T1IA 4REQA 4PLGA 3VU8A 4UFNA 1W4ZA 1CT9A 1Y1KE 1IXSB 1OA0A 1P2FA 2BZ0A 4G2NA 4JIMA 1XMQB 1YS2X 1BS1A 1P31A 3CWZA 2YZMA 4GSKA 2YV3A 3P9QA 1DRJA 2AL7A 3SZGA 5CIQA 2ZYVX 2GO1A 1GPJA 5H70A 2JZOA 2RG1A 1X8KA 1YD7A 3LU1A 3UT5B 4RVFA 1NDQA 2WNIA 2YJ4A 4DZZA 5JUWA 4E31A 3PC8C 2E4ZA 2NXJA 2RKOA 1PS8A 1L5ZA 2CDAA 2XE7A 4XE5A 5TSDA 2H1OA 4P0PB 3KPYA 5IEJA 2JA2A 3GLHA 2GVNA 2PR7A 3ND7A 4JYMA 4PZYA 1X13A 3DMNA 4IQ0A 4BO9A 1D5CA 4BRUA 4A5OA 2GAJA 5F23A 5DBEX 1Q84A 1HDZA 1NNEA 4A9AA 4J7UA 1G8MA 1U0SY 4NU0A 1YDGA 3NHFA 4R71A 1DTSA 3SXPA 5EZ6B 5A0VA 4J0FA 3ONNA 5F7JA 1FZQA 3RV3A 4FEEA 4J49A 2HC9A 4ZZ3A 4JUIA 3W5CA 1LNQA 1ENZA 2C99A 1BRTA 1I7PA 2WTMA 5DP2A 3EW7A 3RJ9A 2VP5A 5JH7F 2IEYA 3RTAA 1WJGA 4HNAA 3STVA 3IV9A 2HU5A 3UJ6A 5C1DA 2GEJA 1H6AA 4IW3B 3S40A 4M0KA 5B4UA 4TRNA 1Y1QA 2D13A 1FFXA 1W87A 2VPQA 3QE2A 3I4CA 4R2JA 3BOSA 4PGAA 4U6QA 3F4KA 3FJ1A 5ALYA 5AVKA 3QF7A 4BGDA 1I3NA 1EUCB 1Y3HA 2RBKA 3JQ8A 3KL2A 1JHPA 3KOYA 3WA7A 1IYZA 2FPPA 4R2XA 1VRWA 3HFGA 3QEAZ 1GTJ1 2FPKA 2Q6VA 1VECA 1FXUA 1MN6A 1Z5PA 3RYTC 3WGYA 1WR8A 4JLDA 5ESDA 2ONZA 2VH1A 5EVCA 1TC1A 1JTFA 2ZROA 2H1IA 4ZEVA 5A3QA 5IASA 2IUUA 1N3IA 2VP9A 4GPEA 3I3OA 3AG6A 3EGCA 1FFXB 5DCUA 1GN9A 2DT8A 4Z0PA 5B64A 4X54A 4BFLA 3O8OA 1FYEA 2PZBA 1COZA 1KRXA 4ZHSA 4QOEA 4X92A 3HEBA 3SBDA 4KFRA 1P7PA 2WV7A 2Y1GA 1N0UA 3UV7A 1FDOA 1GYPA 1D7AA 1HQDA 1NAHA 2HMSA 2XIJA 1I2ZA 1Y9JA 3B12A 3IMGA 4ESOA 5J4KA 3KKEA 5AW2A 1CEYA 2SKEA 1LPOA 1NV9A 2H07A 3OE7A 5K4HA 2QN7A 1FXWF 4N49A 1DL5A 3V1NA 4KIJA 1XLTA 4I6EA 2Q7XA 3BMNB 2L42A 2G9VA 4IDBA 5CX1B 5TEVA 5TS2A 3ROTA 1SN7A 2DKFA 4H0CA 2XODA 5IAKA 3N2GB 4UJ5A 5D8DA 1BRMA 4ABTA 3C43A 1P3DA 2IPMA 2IU6A 4R41A 4PNPA 3T4EA 1YHNA 3G9XA 1NLYA 3ZWOA 4BN0A 1C4KA 2BMWA 4Y1FA 2FVXA 1FMJA 3RF7A 1XTKA 1QOQB 4CLDA 4UATA 5JDIA 1KEEA 3DLHA 1KRHA 3LGXA 4Q37A 4BQSA 4EGQA 4LECA 3FOFC 4ON9A 3Q41A 3WSWA 1DTWB 4B2PA 2A0YA 3MWYW 3FSJX 4G0VA 5A03A 5AW0A 1UKZA 3W5HA 1W85A 1KFEB 5IXYA 1ULZA 4RH0A 3AUFA 3QELB 1EDDA 3CT4A 3A4YA 3WRVA 5DYWA 2JFUA 2FSUA 3CUSA 3ITNA 5FPSA 2R68A 2NUTA 3S8EA 1RC8A 1KJYA 4C3ZA 1HRDA 4LCBA 3V7NA 3OD1A 5FV7A 1NVTA 3CW2A 5DHQA 2ZU6A 4EVIA 2PZLA 1Y37A 5AW7A 3T0FA 1YMUA 1UP6A 3NHBA 5BT8A 4H4CA 4UEQA 4RK1A 2D06A 4Y2UA 5DM60 1X1TA 4NQRA 4ZU6X 1ULBA 4GOND 1VFPA 1XZNA 3F6RA 4OLAA 2CKDA 2AUNA 1ZM9A 3ZCXA 2WU3A 3BGSA 4P4LA 3UG7A 2DBYA 5BUSA 4XWKA 1ZRSA 2HPHA 4C2UA 3BQMB 1E4EA 5HQJA 4UE2A 1WBJB 1X39A 4QJIA 3O3NB 4PZCA 3I4FA 2II6A 4JNKA 4DV5B 4BX3A 2J3EA 4HWGA 2GYVA 2OTCA 1LBSA 3H0VB 2FQWA 3NYRA 3OC6A 1US8B 1MT3A 4QXRA 3ZZMA 4EZIA 1NNSA 1OVMA 1I5EA 1NJSA 2CXNA 3WGIA 4NFSA 3RSZA 1R8JA 3OO0A 4F92B 2JH9A 3HCWA 1SOMA 2P2LA 3EY4A 4R16A 2V7WA 3L7NA 4UZFA 4LXTA 3Q0EA 2CC2A 4D0LB 3I9OA 5H1YA 3VNAA 1E7SA 2WSSA 1YBHA 4BN5A 3R0QA 3EY9A 1NULA 1PQUA 3O4RA 1P1KA 4IIYA 5EJGA 1OIXA 3D7KA 4PRLA 4RO0A 4XX1A 1IHOA 5TR9A 5KX5B 1TZKA 1MAVA 4RSHA 1R4NA 2BP7B 4B83A 2XIQA 3KM0A 3QP9A 5ADWA 2R62A 3TG8A 3ANXA 2EKQA 3CB2A 3KQUA 3EHEA 2F4NA 3CHYA 2BDUA 3ZV4A 1PL8A 4YMWA 3OIWA 4X41A 3FGZA 3QW4B 3TCXB 3O0TA 3BL5A 3EYWA 2XOEA 1AV7A 1MX1A 2JANA 4BNKA 3GG2A 3PR3A 1XF9A 1GTSA 1W52X 2VJMA 2H7YA 1JA1A 2W2QA 2BGWA 3AUXA 3FPKA 3I1JA 4PXAA 4TM7A 3HK2A 1WVIA 3X44A 2B99A 1FA9A 1GTG1 3KKOA 4WKPA 4OI2A 2RKWA 2ZZMA 2FPOA 2NO0A 5DULA 3IOEA 1ZGAA 2R5NA 3BVPA 2BZSA 3NHZA 3QKSA 3TQIA 2IH2A 4TT3A 1X7GA 4JLVA 4TYMA 3FPJA 5H4HA 4JKYA 3RC3A 5K0EA 1TECE 2IYFA 1TL7C 4EDFA 2Z4RA 3DMTA 3UK0A 4C4RA 1DJMA 3JSAA 4RF2A 4L4RA 3FWHA 4BOYA 3UOGA 3M4JA 1X15A 1THZA 1Q74A 4F2WA 4NTZA 2GNOA 3ZZ0A 4UEWA 2QT9A 3AHFA 1BJTA 2PBLA 4GE3A 3D3WA 3PJFA 3W5UA 4KK3A 3DMFA 1CCWA 1IZ9A 4XSVA 5AK0A 3H2GA 5J9FA 4BFVA 4CM7A 3I8SA 4YV7A 1ZJWA 5CHEA 4OA5A 1A0OA 5M34A 4OI0A 4CTOA 1LWNA 1QSGA 1Y9DA 3KBOA 5ARCA 3I32A 5A3RA 4RTPA 5TNXA 3ZVNA 2VF5X 3HFJA 2A5LA 4LOJA 4O4HF 3DYBA 2R65A 4JC5A 3S55A 2BISA 3EXAA 1NVXQ 4EX7A 1N0VC 5AJTA 2C2BA 4HS9A 1BCRA 3MC1A 1YS6A 3MGKA 2QAGC 2CE7A 5DNDA 2Y0CA 4K05A 4HNQA 4CEIB 4FLMA 1BE1A 1C0PA 2BM0A 3IALA 2G80A 3M0EA 4A8TA 1E89A 1RJFA 2L0XA 2P6MA 2W8ZA 4A0HA 3CEAA 1JFLA 3ZQUA 3BGOS 3IESA 1AXEA 4WBNA 1AUOA 3GCWA 1PJCA 1GTL1 4M1EA 4S0ZA 8ABPA 3IURA 2F55A 4WMLA 1T10A 3NG1A 1UZLA 3NC1C 1E8NA 4LDQA 4G85A 1X8LA 3IVXA 1RM5A 1YC2A 3JD1A 4Q3EA 4RVUA 3GD7A 1DI0A 4U9IS 5CPFA 5BSEA 5C8YF 5CDUA 2VYVA 3WAKA 2FSVA 1CIVA 3TKAA 4EZEA 2VAXA 2C5BA 1YRAA 4ALKA 2ZM6B 4XIFA 5LOVF 5EIAA 1GTRA 5IDYA 1K3UB 1BYUA 1DQSA 3Q72A 1YFLA 1Q21A 4RD0A 1H85A 3OZBA 4LJAA 1ORIA 2FTKE 2Z5VA 4N39A 4C6TB 2A9VA 4CDRA 2BCJQ 3HKCA 1KETA 1LLQA 2IEIA 1DOAA 4UAUA 2G5TA 1FNMA 4NXMB 3TOZA 3VZCA 3EXHC 3E05A 4QQRA 4YAKA 4KLRA 3GLHE 5HZMA 3H8VA 3WKBA 5JCZA 3QBVA 3O47A 5ITZA 3DULA 1RLIA 1CUJA 1RQPA 4ARCA 4YRNA 4LRXA 4I4TA 1JLMA 1R6UA 4YCLA 1EINA 3CKMA 3TNDA 1UP7A 1K7YA 1K98A 1OPRA 1PUJA 3HM2A 3QPBA 4AJHA 3DT8A 2E6UX 2PD3A 1DKMA 2IHVA 3U61B 3QBJA 3AYZB 2WVHA 2DBZA 4WXHA 3SBOA 2G07A 3Q87B 4DR4B 2AZTA 4DIEA 1HK7A 3DOHA 4NMHA 5B53A 4Q4LA 4E07A 1A9QA 1GN8A 2WU4A 3GEGA 3IERA 2WWVD 1OTXA 1LU9A 4YCDA 3IBFA 4OX9Y 1M2GA 1PGJA