1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
b'VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
2VCYA 1YONA 1ZFNA 9LDBA 1BVRA 2UAGA 2POQX 3V2HA 3GAFA 2P68A 2V7PA 1WDLA 4RCVA 4XJTA 3ZWWA 2VZ8A 4RO0A 4Z9YA 4KTVE 1K89A 1NQTA 1ZZEA 1IZ9A 3A1NA 3MJTA 1R0KA 4YJGB 4GMGA 1EUDA 3EY4A 4RORA 1IPFA 4EGFA 2EP5A 3ZWNA 2ZTLA 2YZ7A 1QXSA 3IJPA 1K6IA 1YO6A 2P4QA 3L6OO 2C82A 4L73A 1P45A 4Q3DA 4N54A 1PS9A 2PD6A 1XKQA 4QEDA 3BAZA 4FFLA 3NJ4A 5LDGA 1SMKA 4CV1A 3KHUA 4IIVA 4JNKA 4GVXA 1LI4A 3GGPA 3I9OA 3VPGA 1ZIDA 3LF1A 2BKAA 3PQEA 3ZNQA 1JDJA 2PH5A 3VTFA 1W4ZA 1SPXA 1NWCA 3NTQA 2OL4A 3VH1A 1D8AA 4OOFA 4OJNA 4CMCA 4NH4A 2DPHA 3BMNB 1DRUA 3QVWA 1UXGA 5FYDA 3H2ZA 1PWZA 3DZGA 2P5UA 2G5CA 4I9HA 5HBRA 1PIWA 3ZV5A 1FDVA 3UHAA 3RFTA 5B4VA 3WLEA 1V8BA 3RC2A 2YDYA 2UUOA 3UOGA 7MDHA 4MDHA 3JQDA 2AMFA 5IG2A 4CQMB 2PZLA 3PJFA 4LVCA 3LU1A 2FRDA 1Y1PA 4R1UA 2C2XA 1ZKMA 4BNVA 4B7CA 3PHLA 2DLDA 1E3WB 1M6WA 3FTNA 4A5OA 4II3A 1B15A 2NU8A 2ZATA 2HMVA 4LCEA 1Z7BA 3WBFA 4EBFA 5CDUA 1NX6A 1GDHA 4FBGA 4NI5A 4Y6SA 4NBTA 4RV9A 4AJ2A 1N2SA 2PZMA 4PGFA 1CRWG 2Q1SA 1ADGA 4J1TA 4PG8A 1F0YA 1E1KA 4ZQGA 2VQ3A 1QLJA 2PKQO 4GX5A 3LC2O 4J9UE 3E82A 2EHDA 2BRUA 2EW2A 4CLOB 3DAGA 2I76A 1JVBA 3JQ8B 1EE2A 3RBVA 1R12A 1UP6A 1IHYA 2VYNA 4BNGA 1BGVA 1YQXA 1X0XA 1IHXA 5F1KA 1NFRA 1XCBA 1DPGA 4RF2A 5DT9A 4DLLA 3B1FA 3G1UA 4RQUA 1M76A 1YBMA 2PH3A 2Y05A 3ENKA 1BXKA 3Q9UA 3JQFA 1UZMA 2IEDA 4A7PA 5L4LA 3QW2A 4ZQBA 4BNTA 3MJEA 5I9LA 4J1QA 1U7TA 1U9JA 3C8MA 4GQAA 4A03A 4OSOA 3HUDA 3PZRA 1F14A 1PJTA 4IDEA 5LC1A 3VAZA 4IS2A 2DBVO 1K3TA 1WWKA 2C7VA 4GGPA 3WYBA 2YW9A 3KOUA 4QQRA 4ND4A 2C29D 1DIBA 1GUFA 4S1VA 1HDGO 3AM4A 1R0LA 1Y7TA 4EUHA 1MP0A 1I30A 5JDCA 1GYRA 2X9NA 4WK6A 2VUSA 3IUPA 4CM3A 2WWRA 5U1PA 4M55A 1M75A 1E0DA 1ZMTA 4R41A 5F21A 2B0JA 3VTZA 2B36A 3ZWAA 4MKRA 2VZ0A 1BW9B 3HADA 5IDWA 3UVEA 3OQ1A 1P1KA 1A5ZA 5L7TA 4TRMA 1A9YA 2IZZA 1HDCA 2I99A 2CY0A 4XGNA 1HYEA 3JQCA 4L8VA 1E3LA 2DFVA 2A94A 5B4TA 1YGYA 1BTOA 3IIEA 5HA5A 4FFPA 9LDTA 2ZB7A 3OSUA 4XD2A 6LDHA 5G4KB 3DFZA 4RPGA 3GRPA 2PK3A 1V0JA 2WYWA 1ENPA 1K5HA 3OECA 4B8ZA 4UULA 5F5LA 4C7JA 3QRWA 2UUPA 4CLXA 3AOEC 4HFJA 1KEUA 3GRKA 3RCBA 4PLWA 3CZMA 3RFXA 1N92A 4FFOA 4H15A 4L4SA 3LK7A 3M2TA 1GPDG 3BMOA 4XYMA 5I8WA 3PRJA 3KV3O 3Q1LA 4C4OA 3WIEA 3D5QA 3P2YA 3WMWA 3TOZA 2O3UA 4XRRA 3TJRA 4DBZA 2QYTA 1U3WA 3L07A 3F1LA 4PN3A 4XCVA 4R3NA 4YAGA 4B8WA 2VT3A 5COAA 2VHWA 4K9DA 4DIOA 2FR8A 2OMEA 4TVBA 3VPHA 1F12A 3MEQA 4CQLB 2SCUA 1GEGA 1Z6ZA 1E6WA 1XQ1A 4BV8A 2D1YA 5T6BA 4FFNA 3G1TA 3PYXA 1GQQA 4I9UA 3D64A 4DPKA 2B4QA 4BKOA 1QLHA 1CYDA 3WFIA 4J49A 4LW8A 1C1XB 2Y93A 4TRJA 5COQA 4GWGA 4L76A 4XEHA 5CFZA 2VOEA 2UDPA 4B3IA 1E7SA 4MIEA 4XJSA 5F1PA 4DVJA 4CMHA 1ARZA 1GR0A 3O03A 3ZV4A 5JYDA 2EGHA 4ZA2A 3DZJA 1OAAA 1IOLA 4LSMA 4LMPA 2JHGA 2C07A 1ZBQA 3JQAA 1Y5MA 1ID1A 3GOHA 2DBZA 4XX0A 2E48A 1Q7BA 3TL3A 2JAPA 2B4RO 2Y1CA 4IXWA 2Z5LA 4FJ0A 1C1DB 1EVIA 3HDYA 2XPCA 4FN4A 3IP1A 2E4AA 3PEFA 2BGMA 2J3IA 3RSHA 4E33A 3L4BA 5AVOA 4URFA 3S2GA 1M2WA 1BRMA 3ZU3A 3AWDA 4CQMD 5DN9A 1HDZA 2O3RA 4UVHA 3H65A 4DYVA 1T1SA 1WNTA 2EXXA 4JK3A 5G4LA 3SLKA 4D3DA 3GC6A 4IZHA 2CMDA 1Z73A 5K6AA 4CM9D 1SAYA 4J0EA 2D5CA 1HDRA 1ZJZA 3QE3A 3LDHA 3MOIA 2Y1DA 5L4SA 4AVYA 3DONA 4TVOA 4CUZA 4YVFA 2CVZA 1H2BA 1KS9A 4PLFA 3O9ZA 3F5QA 2GUGA 4ZHSA 1SOWA 1VL8A 4KQXA 4B3JA 5AOVA 1ZK2A 3L4SO 2ZYGA 5KKCA 2Y99A 2Q1UA 3H9QA 4J43A 3PHHA 4LN1A 3IDSA 4PLTA 2G0TA 1E3IA 5JFOA 5KVQA 1X1TA 3FPCA 3IAHA 2D4AA 3F1KA 2X6TA 5CHEA 3WQRA 4ZRMA 2I67A 4N5MA 5FF9A 1OBFO 4Z6KA 1BWSA 3NT4A 3AM5A 3BHIA 4WLUA 4B4WA 2CFCA 4BNMA 5COBA 3PLNA 3VOSA 3NYWA 4F6CA 3GHHA 4KWIA 1YH3A 2BFMA 2BI7A 2Q4BA 1HSOA 2VWPA 3RVDA 5JAIA 4FIZA 1B2LA 1IPEA 3KBOA 3WDSA 4DPLA 2GDZA 4OKNA 4MKZA 1T24A 2J8ZA 5G0TA 3PJEA 5TS3A 1K6XA 8ADHA 3AJRA 1QKIA 1BSVA 4DYDA 2NVUA 1O94A 1GADO 3ZHZA 1LDMA 2GSDA 2X9VA 3C1TA 2PGJA 4WLNA 3OICA 4IDAA 3C1OA 2VUTA 1Y9AA 1M67A 1PL7A 3VH4A 1W6UA 2PTGA 1XELA 2Z95A 3TZ6A 3CXRA 3I9NA 1H93A 2EF1A 2ZYAA 4BNYA 3ROKA 1Y6JA 4ZQFA 3OJOA 3FTPA 4YRBA 5H83A 1GYPA 4BGIA 4PLYA 5L51A 1U5CA 3ITKA 3IKTA 1LJ8A 5JLAA 1LNQA 4ZGWA 4HFNA 1RM3A 2Y1EA 3I4CA 4YQYA 3S1LA 4U7WA 3LLSA 4BNWA 3GF4A 4I5DA 4WCDA 3WTCA 3JYOA 4OM8A 4ROSA 1CETA 2QRJA 2X9GA 4MVJE 4J7UA 4Y6PA 2Q2VA 4R1TA 5CP8A 2J3JA 1DJNA 4R5HA 5GMOA 5EPOA 5C7LO 1T1RA 3COSA 5THQA 3DDNA 2O4UX 4P4LA 2I65A 2OXIA 4IINA 1B26A 2GASA 4IQ0A 3RIHA 3U5TA 4O59O 2E82A 4RPKA 4BMVA 1PJLA 1QYVA 4NMHA 3A28A 2ZB4A 5T8KA 2HJSA 2BMAA 3ZCXA 1N7GA 2PR2A 1LBEA 4JBGA 2O7QA 1WPQA 5KNLA 2WTBA 3D1LA 1ISGA 1HF3A 5JY1A 4J90A 2OBNA 4HBGA 3ZH2A 4B79A 5BSGA 1WXDA 3ZWCA 2OGUA 4YAIA 4QX6A 4CMIB 3PZBA 5DOVA 3I6IA 2CF6A 3MWDB 3WNQA 1XQ6A 4Z3DA 3TOXA 1I36A 1R0SA 3P7MA 3RUHA 3SVTA 1U1IA 5EQFA 2RIRA 3RAJA 4RF4A 5FI3A 1VL0A 1L7DA 3NDIA 4I1IA 2FR1A 3VC7A 1DIHA 3U62A 4CMKA 3KYBA 4FB5A 2JCXA 3G79A 3JD2A 4AJJA 1DFIA 4BO9A 2J5RA 5JMPA 1F17A 4KP7A 1JW9B 1SBYA 2VTEA 4YT8A 4NK4A 4TWRA 4B4VA 4BB6A 1ZCJA 1NPDA 1SEVA 2Y1FA 3OJLA 4A27A 1X7DA 4J4HA 2NM0A 1A4IA 1WZEA 4CMBA 1LRLA 1KC3A 5JW6A 1JLLA 4EJ0A 4U8GA 4H3VA 2DTXA 2AA3A 2H5LA 1EVYA 4CR8A 4DIFA 2X7HA 1HE3A 2A35A 3AOEA 4IPTA 4PLVA 5JE8A 3RKUA 3WICA 1UAYA 2DTEA 3C24A 2Y0EA 1A71A 1YOVB 3ZN2A 3VZPA 1ZXBA 4DWVA 1PGJA 2DUWA 2VUUA 3LVFO 3U4DA 3LT0A 2VT2A 4ZN6A 1KOLA 3U4HA 1HT0A 1DLJA 1EVZA 3HE3A 3RASA 5BSEA 1OI7A 4TRRA 3NUGA 1U8FO 4PCVA 5JCJA 3SX2A 1GCUA 3DBRB 3JQ9A 1TEHA 5JXWA 2YQ5A 2C2YA 4EEZA 1EK6A 5AXDA 2WE7A 3K92A 4FOOA 3LT1A 1Z82A 3MTGA 2YFQA 3KM0A 4NBRA 4UEJA 5IXSA 1GQYA 4GX2A 4L0QA 2NU7A 3WYEA 2B69A 4TROA 4BO8A 4IGFA 3PYMA 1O6ZA 4G65A 4YAKA 4YWJA 1I2BA 3FI9A 1P1JA 1BXGA 1ONPA 1A27A 1EZ4A 4OGWA 1VKOA 1ENOA 3U4IA 4ONEA 3Q9NA 2FN7A 4MO2A 3H5NA 1FDTA 1KYQA 3UN1A 4BQRA 1NQ5A 2EJWA 1KERA 3CKYA 1ISHA 1O9BA 4IDFA 4ZVVA 1TA4A 1YBAA 4BO5A 2C20A 4D43A 4J2HA 1KBZA 3VKVA 2AXQA 3VVCA 2NQ8A 3NEPX 4ZRNA 4GSLA 3H3JA 1ZVMA 4TQGA 1BHSA 3WG9A 2HJRA 2YV3A 2QHXA 4R68A 1KEVA 1I01A 3DZIA 2W90A 4E6PA 1IE3A 5GZ3A 3D4OA 4WASA 4YRDA 3ZW8A 1B8UA 3E9QA 3MJVA 4OQYA 4Y98A 3AI2A 2HKIA 3JTMA 3DAPA 1JKIA 1M6HA 3V1YA 1JN0A 3AI3A 4OO3A 4PLHA 4MVJG 4P22A 1MV8A 5DCYA 4NDNE 3PIIA 1VJ0A 4AJHA 1PJQA 4J0FA 4JLWA 4GX1A 4I5EA 1HLPA 1Y9EA 2VHVA 2WEKA 1EFLA 2D5AA 4K6CA 3H2SA 1E7QA 1LLUA 5G0SA 2BFAA 3AY7A 4L4RA 2AW5A 3KLPX 5G0WA 3TF5A 1FJHA 1U8XX 1TT5B 1LDYA 1G0OA 5GY7A 3DC2A 5DZSA 3GT0A 3WGZA 5EL0A 3H6KA 1Y8RA 1DSSG 2CVOA 3DL2A 5K9ZA 4ALKA 5ITVA 4W7HA 1RM5A 3GA0A 1VL6A 5MDHA 3I1JA 4W9NA 4AG3A 1I10A 2IE0A 4CV0A 3BXXA 2FOIA 2GLXA 3SXPA 2R00A 4U0KA 1XU9A 4LGVA 3SC4A 4TSKA 2WJPA 2AEJA 3M1LA 2BD0A 1NPTO 1NYTA 3W1VA 2Q2WA 5JDIA 1HE4A 2HK9A 4BO3A 3PLRA 3ZNPA 5A9RA 1YB1A 4U6SA 5IDXA 3C7CB 3ZWPA 3VPSA 1HEUA 1YVEI 2EGGA 4M8SA 1NM5A 2H6EA 1FK8A 2J3HA 4GAEA 3WFJA 4YYZA 1LTHR 2AQ8A 4II2A 2ZJ0A 2HSDA 2JKVA 1LEHA 4LMRA 2OOSA 2RBEA 4JJFA 3RUCA 4ALJA 5DBGA 3QVOA 1VPDA 3MTJA 3G17A 2B35A 1T4BA 1NVGA 1XWFA 3ETGA 3ASVA 3GGOA 4IJWA 5HWSA 2BHLA 3L4BC 1TI7A 5JAMA 4J9VA 2O2SA 3ICPA 4JJIA 2DAPA 3AOGA 1MA0A 3SJUA 3ETDA 3ULKA 2NU9A 1J49A 3DMTA 3UH1A 1J6UA 1B8PA 3JQGB 5K6AC 3GDGA 2EKLA 1UXKA 3IUSA 4KWHA 2HMTA 3UF0A 1UP4A 1KVUA 1E92A 2GN4A 3CMMA 3C85A 1X14A 4RLSA 5A4DA 2W4QA 1J0XO 1RM4A 4W82A 3H4VA 5JMWA 4BGVA 2HMSA 2V6FA 3D3WA 5MGBA 1LQUA 1GUZA 3ANLA 5BNFA 5DDIP 1AXGA 3ADOA 3GPIA 2NVBA 1GY8A 1R4MA 1JAYA 1T2EA 1AHHA 3DBLA 3GK3A 3C1AA 3DHYA 4PG4A 3FNFA 4YT5A 1C14A 1VM6A 4C7KA 1GFSA 3ANNA 1RPNA 3DBHB 2G1UA 3Q6IA 1EMDA 5DCUA 1XDWA 4PZEA 2X5OA 3RUIA 2O2YA 2O3TA 2Y68A 2X5JO 2P91A 3QWFA 4HY3A 4OHUA 1A7KA 3CZRA 3Q2IA 3GEDA 4AJEA 2ZIZA 3ZNNA 3DOJA 1CQJA 2JCVA 2X58A 2AG5A 5TRTA 1UDCA 4BNKA 1P1RA 3VZRA 3OHSX 2UV8A 3VPXA 3NKLA 2PKQP 2ZKLA 5JPIA 1Z74A 4NPCA 3PJGA 2D2IA 4QO7A 5HS4A 1LDNA 5J23A 3WJ7A 1I3LA 5CEEA 4S3MA 4CL8A 3DXFA 2GYYA 5A3VA 1ENZA 3JD0A 2YDXA 5GZ6A 4BO0A 3EC7A 5CDGA 2FY8A 4NJMA 1ISJA 3AUTA 2VHZA 3OQBA 4LISA 1PQWA 3VH2A 4E5YA 2ZQYA 1P1IA 1MFPA 4DTIA 4CLEA 1XLTA 5CPBA 3E1KA 1I2CA 3MWEB 4Y8VA 2CZCA 4OSPA 2I5PO 1ZK0A 1QV7A 2FMUA 3KZVA 3ASUA 4ZJUA 1HDOA 1W73A 3BA1A 1KVQA 1I3NA 3CTMA 5T73A 1BVUA 1QSGA 2YHIB 1JKFA 1PX0A 3FNGA 4XKJA 3E03A 4KUGA 3WLFA 2HLPA 4AJIA 4D3FA 4MVJD 4YJFA 4UEKA 1EDZA 4U0JA 5G2OA 4WLEA 1H94A 1JA9A 1FDSA 2OHXA 4HFMA 3R0IA 3GFGA 4WE3A 4ALLA 1GZ3A 4AFNA 1VLLA 4YJHB 1R4NA 5ILGA 5L7WA 3KLMX 1D4FA 2VNSA 2W2KB 5ILOA 4CM7A 3V1TC 2W8ZA 4AICA 1N1EA 1SB8A 3EVNA 4Y6RA 1LU9A 1QORA 4XYLA 8LDHA 3F4LA 3O8QB 3P5SA 4J1NA 1DFGA 1EUZA 2B5VA 1HZZA 2QW8A 5T8KC 3ENNA 3BMCB 5DP2A 4YDRA 1XGKA 1Y8QB 4PG6A 3FD8A 1JKJA 1YKFA 4UUPA 4XB1A 3B1JA 5GZ1A 4DXHA 2HCTA 1ISIA 2JFFA 4WLOA 4GL4A 1HXHA 3UICA 3AUSA 1P3DA 1U5AA 3QVSA 3ONDA 3T4XA 2UYYA 3OIGA 4WNIA 1D3AA 3I83A 5THKA 2X0IA 3PK0A 3ST7A 1NBOA 1YWGO 4YJGA 2Q46A 2ZYDA 4BL5A 1YBVA 4KMSA 4JX8A 1DJQA 3HWRA 3LYLA 2PA3A 5ICMA 4CUJA 4Q3EA 1Y81A 1DAPA 3K31A 4I5GA 5B4UA 4MP6A 4CLRB 3STHA 3KXDA 5ICSA 3RBZA 4XGKA 1V3TA 1A4UA 4GGOA 1KEPA 3D7LA 3ROMA 3T7EA 2Z1NA 4E12A 3H9GA 4M49A 2G82A 4Z9FA 5L53A 3BMQB 3B70A 5EIOA 2WYUA 3GMDA 4FGSA 2FPIA 4R1NA 4Z0HO 4ND5A 3HSKA 1ULSA 2I66A 4J4BA 1O89A 1ENYA 3CMCO 4RVDA 2V6BA 1VRWA 3BMNA 3NGLA 4IIUA 5KWEA 3R6DA 1PGNA 2FZEA 2NTVA 1TVEA 4EJMA 1I32A 3SEFA 1ZK1A 2ET6A 4M87A 4DMLA 3GDFA 3NRCA 3E5RA 1NQOA 3IKVA 4HXYA 2QZ9A 4D44A 1O8CA 3I9JA 4B3HA 2VOJA 1EBFA 4Y67A 3OH8A 1I24A 2CDCA 5KJEA 1ZEMA 5BNTA 1LLDA 1PZGA 3WGHA 3ZW9A 3GN1A 3JQ9C 4CQMA 1FF9A 3JQ7B 2BF7A 1UDAA 1SZJG 1ZSNA 1E3WA 1NHWA 2VWGA 4FPXA 3WQSB 1H9AA 3VDRA 1YQDA 3CINA 4CM9A 2VRBA 3NV9A 3I3OA 4W99A 4TZTA 1PJ2A 3RUDA 4FS3A 3KEQA 1NASA 5C7IO 5A03A 1AUPA 4IBOA 2ZCVA 4DLBA 5IZ4A 4ALIA 2IYPA 1DIAA 3KYDB 3HN7A 3PP8A 4JXKA 4RZHA 1I0ZA 4HX5A 3GUCA 3OJ0A 5TF4A 4CL3A 2WMDA 1PU2A 3EK2A 2B4TO 2DVMA 4FDAA 4DRYA 3K73O 2AEFA 2XXJA 4R9RA 5I7SA 3GG2A 4ND1A 1YL6A 3M2PA 1V3VA 4GLLA 1S6YA 3D0OA 3QIVA 4M1QA 4IGEA 1H6DA 4CLOA 4EUFA 3JQ8A 1XIVA 4NU6A 3VZQA 4CMJA 3TPCA 3ORFA 1I8TA 1EUCA 3QWAA 4D79A 3IMFA 2BFOA 3ADPA 2QG4A 2C7GA 4GKVA 1LDEA 1MGOA 1E7MA 4Z9XA 5ER9A 3PWKA 2WD8A 3B6ZA 4OH1A 3PDJA 3B1KA 3F5SA 1CQIA 2NADA 4UVDA 4TKMA 3WGIA 3ZU5A 1E77A 3H8VA 1ML3A 3OIDA 4UEOA 2JD0A 3WOHA 1R16A 3RFVA 3SLGA 3C7DB 3MJSA 4WUVA 5M6DA 1NVTA 4AJ1A 2Q22A 4NNJA 2YHUA 1GQ2A 1X7GA 5AXCA 2P4HX 3FBTA 4EITA 2VTDA 2PZJA 4WGGA 3OQ6A 5TT0A 4CM5A 3INGA 1ONOA 1ZO8A 3DTTA 3RU7A 3ROQA 3ZWBA 1VE9A 5EERA 2HAEA 4WCFB 5H82A 3ZWYA 1C0LA 4F45A 2RAFA 4W9NC 1N8KA 3CIFA 4OOEA 1BW9A 4PIVA 5TQVA 2DU8A 1SO8A 5B12A 3MOGA 3QA9A 2R00C 3UFXA 4CM4B 1H0KA 1PS8A 2CDBA 1Z75A 4BNUA 4E21A 3RWBA 1QG6A 1LDBA 1DHTA 5JDIC 4MIOA 1OC4A 2HMWA 2ZQZA 1OMOA 2H1SA 2WDZA 3AY6A 3A14A 3W4JA 4UVEA 1P77A 4M54A 2Y0CA 1HLDA 2EIHA 5G4KA 3IJRA 3ZV3A 5CDSA 1H9BA 1KETA 4PLPA 2EKQA 1HKUA 2C54A 4JIGA 3E48A 4DREA 4WEOA 4DBVO 1R37A 2WD7B 5A05A 4NBVA 4QSMA 4BHTA 1U4SA 2FHSA 3PWSA 4IQ8A 2FZWA 4K28A 4XYEA 1W8DA 4N18A 2E6UX 3A4VA 2RCYA 4P4GA 1EQ2A 3E8XA 1ADCA 1ISMA 4NU5A 2WSBA 3H5AA 3CE6A 5TGDA 4XR9A 1E5QA 3LC1O 2Q2QA 1CEQA 1UDBA 4MVJF 1N9GB 1SNYA 3GAZA 4ALNA 2OO5A 3D4PA 1VSUA 2CF5A 4ID9A 1GU7A 2ZJ1A 4E5NA 3DMTC 1PGOA 4BS9A 1DXYA 3RUAA 4EW6A 1GD1O 4HADA 3OEYA 2PWZA 2AQHA 4CQLA 3K30A 3KYCB 2O23A 2GR9A 3H3FA 3RUEA 3VPFA 2Y1GA 4IS3A 3HNPA 1WVGA 3JQEA 3PFFA 3GVCA 3WR5A 5A9SB 2NVWA 4ZICA 1C1XA 3GHYA 4BNIA 4GKBA 4HKTA 4RPJA 4UVGA 4G5HA 2R6JA 3TQHA 4AJNA 1Q2XA 1P0CA 5KVCA 1DEHA 3BHMA 4IDDA 4RF3A 2NUAA 3F3SA 1NP3A 2HO5A 2O3QA 1OOEA 2YYYA 5TNXA 1LSOA 2WM3A 4BO1A 1KEWA 1NFFA 2DBRA 4P4NA 4Y9DA 1JVSA 1KY5A 2FR0A 3G3EA 3GPDG 2OBYA 2NU6A 2VNAA 3BIOA 3V5NA 4R9SA 1GCOA 5TT1A 1V9LA 4K6FA 4CMAA 4YTEA 2Q50A 5JCXA 2XOXA 2AHRA 3DB2A 1C1DA 1GV0A 3DZHA 4FJ1A 2I6TA 1XR3A 3GGGA 4YB8A 5I8ZA 5IN4A 5U9CA 4XB2A 1Q7GA 5JAQA 1QYCA 3PJDA 4CLDA 4JQCA 4UVIA 3T4EA 3KO8A 4RJTA 4WECA 2UVDA 5HRUA 3W4KA 2NTNA 4MVJH 3N74A 3RUFA 1ZSYA 4BMNA 1G0NA 2J5QA 3WIDA 4YT2A 2D3TA 5A5EA 5AXAA 3ZHBA 4DL9A 3CSDA 1Q0QA 1LA2A 4DPMA 3GZNB 1P74A 1PL6A 4OXKA 3RD5A 4BGEA 1S7CA 3RC9A 5ENDA 5KJ1A 4L75A 1D1TA 4QFCA 5U4QA 5DBFA 1WP4A 2C0CA 3INTA 3JD4A 1MX3A 4JN6B 1WMAA 3BYZA 5EJ2A 3DTYA 4PVCA 1NR1A 1T25A 5C37A 3AFMA 3HG7A 4ZQEA 1LRJA 4HV4A 1MG5A 2VYVA 1HL3A 3QWHA 4BKRA 1WLYA 2E37A 4XGIA 2PGLA 4XR4A 1W0CA 3F4BA 4XZ3A 3W6ZA 4X54A 4CM8B 1DIGA 1P31A 5EN4A 3DZFA 1I3KA 1PSDA 4YAJA 2YV2A 1P1FA 2HK7A 1NPYA 3QP9A 1L7EA 1E7WA 4FFRA 3L0DA 4JP3A 4XIJA 3GNQA 5B37A 1XG5A 2NSDA 3RKRA 4E3ZA 4JROA 3PHJA 3O38A 1UR5A 1BDMA 2BLLA 3FNHA 2B5WA 2DPGA 3IC5A 1LC0A 2PNFA 1Z45A 1I2ZA 3RC7A 4FJ2A 2W2LA 4W6ZA 1CF2O 1ZJYA 2RH4A 3TFQA 3WJAA 1QYXA 3WSWA 1Q0HA 1IYZA 4AJLA 4PRLA 4MP3A 3FNEA 2NNLD 4A0SA 4RF5A 2EV9A 3ITDA 4CMGA 3ZU2A 3OJEA 3KVOA 3S2EA 4BQPA 3TFOA 1PJCA 4J7XA 4I9NA 4GPD1 4E31A 1PS0A 3KSDO 3ZHXA 4DIBA 4BNFA 4BB5A 4IDCA 1I3MA 1AGNA 3AK4A 4HNHA 2VWHA 2H9IA 2X86A 3L9XA 1BMDA 4FFMA 1P44A 2FWMX 3GZ4A 4BNXA 2JL1A 3HDJA 4R16A 1WAMA 2C5AA 3WYCA 4IJVA 3WQQA 4AJPA 3FR7A 3LF2A 1B3BA 3OFSA 2X0RA 2YY7A 1NFQA 3U4CA 4PZCA 4YPOA 5BR7A 2GN6A 3W8EA 1PQUA 4AL4A 4H16A 3MJCA 4PLZA 4OIMA 1IY8A 4BOYA 3S8MA 3V2UA 2TMDA 3UGKA 1PZFA 3TZKA 3GMSA 4RVSA 2VRCA 3TSCA 3D3EA 3UW3A 1E5LA 3BTSA 1EBUA 1LDGA 1DLIA 3WGGA 3PDUA 4J7CA 4YCAA 2Q99A 2R2GA 3OA0A 4QO8A 3WWZA 4CLHA 1VSVA 2PZKA 5T67A 5JCJD 4DQUA 2AE1A 4D46A 2HQ1A 2IXBA 3Q2KA 4CMIA 2G17A 4K26A 3JD3A 3DR3A 2VHYA 4HUJA 4YRAA 3HB4X 4U5QA 1YJQA 1Z7EA 3CEAA 1LQTA 3NTOA 4XDZA 1U2DA 3JYQA 4BNLA 5JYAA 4UUOA 3RI3A 3FR8A 3DMYA 3RJ9A 4MP8A 1E6EA 4GSKA 2NTJA 3EDMA 4IUYA 4RGBA 3OM9A 1J4AA 3DQPA 5AYVA 2BGKA 2OP0A 2OFPA 1E3JA 3C3XA 1GL3A 1C0IA 2Y0DA 5HM8A 4IY1A 3JCZA 5IJZA 4BIIA 2BFPA 4IM7A 2X23A 4K1LA 5JYFA 4L74A 3DWFA 4NG5A 3S2FA 1B0AA 1NTOA 3ZZNA 3K2EA 5JNLA 1GYQA 2ZK7A 3JQBA 1LC3A 4NFHA 2Q49A 3UKOA 1H2HA 1MXFA 1GPJA 1DHRA 4CV2A 4N5LA 4DMMA 4FGWA 3H7AA 1ULUA 1NAIA 3R3SA 3DO5A 4NBUA 4R51A 1YOVA 4W4TA 3QV1A 3MCVA 4XA8A 5J9GA 4BNHA 1IB6A 4YT4A 4LCJA 1PZHA 4CJXA 5HTOA 2DTDA 1J5PA 1EQUA 3QWBA 3LQFA 1PQPA 5KTKA 1X0VA 3JYPA 3DBRA 3B20A 2Q4EA 1UP7A 1LSUA 3W6UA 4DQVA 1HTBA 4PG7A 3CPSA 3GG9A 4EI2A 4UREA 4JJGA 3ZDFA 1HSZA 2DFDA 3C7AA 1TT7A 5FEUA 2BH9A 2O48X 1UXJA 5AQ1A 1K0UA 1I5RA 4ZU3A 1NR7A 1NAHA 5JSFA 5BSHA 1K6JA 1RWBA 4UUNA 4QT0A 1JU9A 1PGQA 2IEBA 3FCOA 3HDHA 4ZQHA 1MG0A 5I9MA 3IOYA 5JS6A 1ISFA 4R01A 5KOIA 1DOHA 1YQGA 6ADHA 2X0NA 4ILKA 1B7GO 1OC2A 1B8VA 1RJWA 1P33A 2Q1WA 2HMUA 5KJ6A 3WNVA 5IDYA 1HDXA 5G0UA 4MINA 1UXIA 4RLHA 3I23A 4MVJA 3NJ8A 2QRKA 2ZCUA 4MIYA 4W7IA 4HWKA 3WXBA 3WGYA 5A3JA 4DGSA 1HZJA 1JWBB 4B7UA 5EMHA 4FD3A 1R66A 3WGOA 3ZGYA 4B4OA 4Q3AA 3U9LA 2JD1A 1DRVA 3BHJA 4N5NA 5KIAA 4ITUA 4FSHA 1KIFA 3I52A 1UUFA 5DCWA 1HDYA 4FR5A 5KKAA 4BKPA 3OBBA 4IXTA 4HFRA 1V3UA 1JTVA 2CD9A 3HDQA 4E5MA 4E2WA 1TLTA 3DHEA 3GNTA 3PQFA 3ONEA 4O0LA 2NWQA 2QYSA 3GR6A 4Q3CA 1EFKA 2J5KA 3N7UA 3X2EA 1DB3A 4BNNA 4GLOA 3K6JA 1O95A 1PR9A 3ON5A 3OEWA 4HNGA 1TB4A 3BMOB 1F06A 1GZ6A 1HYGA 1X15A 3GFBA 3EZYA 3H5RA 4FC6A 2HU2A 3O26A 4PG5A 3UCEA 3K9QO 3ONFA 3NTRA 1NXQA 1TT5A 3E9NA 3P2OA 1DC4A 3TL2A 5A02A 4J3FA 1DAOA 4INAA 1KVSA 3X2FA 4A2CA 3L77A 4PLCA 3W8DA 4AJ4A 3GVXA 4FW8A 5EESA 4NJOA 4GVLA 4D7AA 5BT9A 5CEJA 4GMFA 3K5PA 4IJKA 3PYLA 3OMLA 4CUKA 2AE2A 4D41A 2GZ1A 4RDHA 3AU8A 3K8ZA 1MUUA 3NAQA 3NT5A 4RPLA 4CMEA 3FPLA 3EYWA 2PD3A 3BZUA 3EW7A 4QXMA 3Q3CA 4BUCA 1P9LA 3NGXA 4PZDA 2CNBA 5G0VA 4R1SA 1Q7CA 3V8BA 1QV6A 1YRLA 4NQZA 3JQAB 1QRRA 2CVQA 3KEOA 3N58A 4BNJA 2WYVA 3DZKA 4RVHA 5L4NA 4ZD6A 2J3KA 2IDZA 2PGDA 1RKXA 2OZPA 1B16A 4E5KA 4IZIA 1OFGA 1DIRA 2JCYA 4RPHA 4DA9A 1YB5A 2W98A 2LDBA 4R54A 3GY0A 3EUWA 1YB4A 5T64A 3ZV6A 5JC1A 4XQ9A 1PR3A 5CG1A 1E3SA 2YFHA 4GI2A 4UAGA 3IQDB 3WTBA 3PVZA 3EZLA 3TRIA 5JY6A 1HE5A 2X5KO 3FN4A 1UAGA 1DDOA 3AM3A 3GVPA 3K96A 4Q39A 5ENVA 2RHCA 3JQGA 4LSWA 5ES3A 7ADHA 5I7EA 3QQPA 5KCZA 4KDFA 2JJYA 3UXYA 1ONNA 2I9PA 2D8AA 3F47A 3ICCA 5KVVA 3E9MA 3ROPA 1PJBA 2ZTVA 2C59A 4JCOA 2GNAA 4B4UA 2AG8A 1VJTA 3E5MA 3KUXA 4E0BA 1NHGA 5L95A 4I8XA 1LLQA 4BO7A 1UJMA 2D59A 4XYGA 4CR6A 1LRKA 4RVFA 3WGTA 1ZXLA 3A06A 4WCFC 2HK8A 4WKGA 3RBXA 1WMBA 3PGXA 3AUAA 4PFJA 3IL2A 1N7HA 1X13A 2ZTMA 4J2OA 3GLQA 1UZLA 3DBHA 2PV7A 3OA2A 2VYND 1RYEA 2EWMA 4E5PA 2D0IA 4P8RA 1AE1A 1BG6A 4F6LA 2ZTUA 2VWQA 5A9TA 3K2BA 1DO8A 2Q45A 1Q0LA 3WB9A 4MOWA 4R3WA 3HZZA 4NZ9A 1QR6A 4MVJP 4ESOA 4KDEA 1ZEJA 3S55A 4RDIA 3SJ7A 1NQAO 1SB9A 4FQ8A 4P38A 4H7PA 2XXBA 3GEMA 1XU7A 1QP8A 4N7RA 1H6BA 2PY6A 2NVUB 2JD2A 3MJ4A 3HB5X 3VH3A 2FPPA 1X7HA 4BKUA 3AW9A 1T2DA 3D5TA 3INRA 1DBVO 4E13A 2FPGA 3FRJA 4I08A 5FFFA 4DC0A 3D4NA 2O50A 1PTJA 3WS7A 2O3SA 5B1YA 5L40A 2GERA 4IMRA 1EDOA 1LSSA 4G2NA 3HFGA 1Q1NA 2YHIA 4NFYA 1UXHA 4QTZA 1E1LA 5IZCA 1DFHA 1XHLA 3TZHA 1E1NA 5C3MA 5H81A 5TJ9A 3EVTA 3H9JA 3I9KA 4DC1A 1XSEA 4IJUA 1SCUA 3VKUA 3I9MA 3Q0EA 3ETEA 4RZIA 2B37A 4DQXA 5CDTA 1E3EA 4YJHA 2F1KA 3ANMA 1LX6A 1L1FA 3KRTA 2ILTA 2FSSA 4BMSA 3ABIA 3PFWO 2HDHA 2W2KA 2V6GA 1U3TA 2AEMA 4CM1A 5JO0A 2GO1A 1AN9A 3H9UA 3NX4A 3EAGA 3RROA 5JYEA 2GF2A 4TMFA 3LSYA 1T2CA 4L9RA 5TJHA 2DUUA 2GN9A 3O8QA 2EERA 1SOVA 2DC1A 1U7HA 4KUEA 3GEGA 5T5QA 3VDQA 5JC8A 1E1MA 2DKNA 3BMCA 3SC6A 3RC1A 3L6EA 1K2WA 3ZWVA 4BNZA 1Y8QA 1ZMOA 4E4YA 4EUEA 2JHFA 3DEYX 2AQKA 1T4DA 1GEEA 3DOCA 2O3JA 1ORRA 4XIYA 5C7OO 3GH3A 1A72A 2Z1MA 2ZB8A 4MJLA 1PEDA 4U6QA 1C3VA 1KVTA 3PTZA 3WWYA 4BO4A 5CG2A 2JFHA 3GQVA 5CPFA 5IAAA 1PJSA 4RL6A 4EYEA 2Y1OA 4OKIA 2IZ0A 3ZWOA 1LSJA 1WZIA 3QJ5A 4CM6A 1RM0A 1D7OA 1IUKA 1H6AA 1HYHA 2DT5A 2Q3EA 3FWNA 2CDAA 4ND2A 1YXMA 4CLRA 5DNAA 3LC7O 1IL0A 1BXZA 3W8FA 5I9NA 3FSRA 2JAHA 1V35A 3I9LA 5F3RA 4LVUA 3NDJA 3NT2A 4GBJA 3ZNOA 3F6YA 4MVJI 2NACA 2DQ4A 2GZ2A 5AXBA 4YQZA 3TWOA 1HETA 3U09A 2V65A 4PVDA 1CERA 4TRNA 4D42A 1R15A 3BMQA 1ZW1A 1E6UA 1VJ1A 3E6AA 1B14A 2BELA 2FSVA 5F1OA 5KVSA 1GV1A 5TLSA 2XF8A 2DBQA 1U2GA 3JQBC 3DOOA 4EZBA 4I5FA 4WOKA 2EJVA 1YL7A 2X1HA 3M1AA 4JBHA 4D0SA 3OIFA 2RHRA 4LRTB 3JQAD 3UCFA 5IXYA 1UZNA 1T26A 3PI7A 3NDRA 5TSDA 1N5DA 1UH5A 4MKXA 5CDYA 1JAXA 2EP7A 4WLVA 4PRKA 3GDOA 2I3GA 1CIVA 4CPDA 4D45A 2HRBA 2P9CA 4M86A 4J1SA 3MZ0A 1ZNQO 1H6CA 2P9EA 4IDBA 2QRLA 4MVJM 3QWIA 2GN8A 1KVRA 2YUTA 3AI1A 2IXAA 3LZ6A 2JFGA 4KTTE 4UUMA 1CWUA 2OORA 2GGSA 2QIOA 3JQ7A 4Z0PA 5L45A 3ZU4A 4A10A 4E32A 2C5EA 3PHIA 3HN2A 3U0BA 4EJ6A 2Y66A 2VZ9A 4O1MA 1HE2A 1AHIA 1N1GA 3UUWA 1V6AA 2BI8A 4XRGA 3M6IA 3S2IA 1E7YA 1VC2A 4D3SA 3EGOA 3JV7A 3HQ4O 5BSFA 4J91A 1MC4A 5KJFA 1U28A 2QZZA 3JSAA 4KOAA 2IYOA 3I5MA 1KC1A 5KJCA 3KSZO 5A1TA 4GWKA 5I7FA 3O4RA 3KYDA 4EDFA 1BXGB 1PGPA 4YXFA 1U4OA 2IZ1A 3L6DA 3DFUA 4FOSA 1VI2A 1VKNA 2X0JA 3JQ6A 5BNIA 3UAGA 4JGBA 1LLCA 1SEPA 3DAFA 1EVJA 3TZCA 4A73A 3U3XA 2I3AA 5EQDA 5JBIA 3UCXA 1C0KA 1PJ3A 1YDEA 4KUHA 3OP4A 4BV9A 2A92A 3ZI0A 1WDMA 1I33A 1F8FA 3H9EO 4E2ZA 1MXHA 5I7VA 1YS4A 5ER6A 2VN8A 1SC6A 4XQEA 3WSVA 2NLOA 3FBGA 3VVBA 4ND3A 2YJZA 4OXNA 4XQCA 2QQ5A 5HS6A 2GZ3A 1YDWA 4OXYA 4TKLA 4XWYA 1M66A 5A04A 4Q3NA 5JO9A 2GCGA 5JAZA 1ZK4A 2A9FA 3HHPA 1C0PA 3TN7A 4YA6A 4QUKA 3CUKA 1MC5A 4A26A 5CEFA 5IDQA 1ADFA 1HRDA 1GTMA 2XAAA 4XQGA 5DOZA 2OUIA 3WMXA 4E30A 4Z3KA 3VZSA 4Q3BA 1GAEO 3LLVA 3PQDA 2X4GA 4NFSA 4OQZA 3LT4A 5L3ZA 4R5MA 1MLDA 4DLAA 3WBBA 2E49A 5L9AA 1YJ8A 3BTUA 3FWZA 1F8GA 2PLAA 4E2XA 3TNLA 4WEQA 1T2FA 4J4TA 4WCFA 1QYDA 1PZEA 1Y8RB 4RQTA 1JWAB 4RVGA 1PJ4A 4DUPA 4HP8A 3VHRA 2HUNA 4BGUA 4CM4A 1E7RA 1GZ4A 3F9IA 5FWNA 5A06A 3PIDA 3HJAA 2DM6A 2ZB3A 4YACA 4XYBA 3QHAA 5A5FA 4YEDA 4ALMA 4CMEC 2IRWA 1AXEA 2NQTA 1XA0A 5DULA 2CSUA 3JYLA 4M89A 1DC3A 1ADBA 3GNSA 4BVAA 4JP2A 2LDXA 2OP1A 2GD1O 3Q11A 4RVUA 2WD7A 4PLGA 1T2AA 3FF4A 4NHEA 3OF2A 1IULA 1MFZA 3ZWXA 5ADHA 4OAQA 2G76A 2WE8A 2PKRA 1DC5A 3QSGA 5LCXA 5IN5A 3GVHA 3ZHYA 5CAEA 1FDUA 4WLFA 4OMUA 5IF3A 2X22A 4IDGA 3PHGA 1BDBA 4OYRA 3GUYA 4AJOA 1D1SA 4JBIA 3JQFC 1N9GA 4E2YA 3V2GA 4F46A 3WX0A 3BTVA 3QVXA 1QYWA 4QECA 4LK3A 3U49A 3R3JA 4J16A 1A9ZA 1XEAA 1ZSVA 3A9WA 3AFNA 4B7XA 5DP1A 3KYCA 5FI5A 4EEXA 3BTOA 5LDHA 1P1HA 2P5YA 3TZQA 4AJKA 3RQSA 2B83A 3AUUA 4GX0A 3KTDA 1FMCA 3DBVO 1TXGA 1YE3A 3DHNA 5A9SA 3AU9A 4NIMA 5T57A 5JDCC 3T7CA 1A7AA 1NWHA 3I6QA 3JYNA 3PXXA 3D3WB 2P2SA 4CODB 1QMGA 2FP4A 2J6IA 3JD1A 2O7SA 1YL5A 1EK5A 1FDWA 4KQWA 5DF1A 2PD4A 3WGQA 1X1EA 3HFSA 3CH6A 4KZPA 4J6FA 2TMGA 2VYVD 1R4MB 3DBLB 3R1IA 1FXSA 2F00A 4IQGA 1EEHA 5ITWA 2YV1A 5BQFA 4WNCA 3E18A 1B3RA 1H5QA 1PWXA 3P19A 1CDOA 1EE9A 4BO6A 3TDKA 4R69A 4FCCA 1G6KA 1WDKA 1CJCA 1R6DA 4F3YA 5K0ZA 2Q1TA 4QFDA 4NK5A 3KETA 1OZAA 3QY9A 3G0OA 3IP3A 1ZUD1 1XYGA 2NV6A 3EMKA 1HWYA 1WW8A 2EG9A 2IODA 3PPIA 5EINA 1LXCA 2AQIA 3QLJA 4NJMB 4L4XA 2W2LD 1Y5RA 2PFGA 1MB4A 4BKQA 3QVTA 5IFLA 3AY3A 3KB6A 1JQBA 3GZNA 2RH8A 1RYDA 2O4CA 3IS3A 5C5IA 1ZK3A 1U3VA 4G81A 4GH5A 1O5IA 3LT2A 1P0FA 4IMPA 5IZCC 4NR0A 5TX7A 4YR9A 3ZWMA 3PGJA 1KY4A 3GVIA 3V1UA 2CUKA 3L9WA 4WOJA 4Z0TA 2X8LA 4XDYA 2EW8A 4LRSB 4YJFB 3RU9A 1GUYA 4NBWA 1G1AA 3FHLA 1IZ0A 3EHEA 3DZBA 3F46A 3SBOA 2EKPA 4BO2A 4WPGA 4Q9NA 2GRAA 4CM8A 2VHXA 3W4IA 4CV3A 1R4NB 2H63A 5F5NA 4YAEA 2EEZA 2Y67A 2YQ4A 1DC6A 1U3UA 5TC4A 4CR7A 3PWZA 4D0RA 4TZKA 1O0SA 2HRZA 3RJ5A 3I4FA 3KSUA 3GN2A 2P9GA 4WJZA 4O63O 5TIIA 1NVMB 2A4KA 1PL8A 4O6VA 4R4JA 2GPTA 4MPDA 4O5OA 1NNUA 3G49A 2QX7A 4YJDA 4FC7A 2V6MA 2BGLA 5DBIA 5L7YA 2VRCD 3OJFA 3OETA 4OL9A 1ZH8A 1LUAA 1DRWA 4YBZA
chains in the Genus database with same CATH superfamily
1QZUA 4ARIA 2OFFA 1ZN7A 2QRPA 1JEDA 3DKIA 1A9XB 2SBTA 1Q91A 3ESDA 3EVFA 3R5HA 4OQMA 1AHNA 1VKZA 2Q3JA 1QGED 5EXPA 2POQX 1F2TB 4MRAA 3V2HA 1EK2A 1KH1A 1WDLA 4RCVA 4XJTA 2VZ8A 3ADDA 1CV2A 5GINE 4KTVE 4YCSA 4P31A 5FEMA 3STYA 4KXYA 2AR0A 1ZZEA 3TVTA 1G2PA 3LVRE 4A6PA 1Z36A 1WJGA 3A1NA 5BV8A 4A6XA 3X1JA 4ZMSA 1YIDA 2PRIA 4YJGB 4YMLA 1UKEA 4FUTA 2QJWA 3R5TA 4RORA 3K09A 1IPFA 3TBFA 1EG2A 3BL6A 2EP5A 3WLJA 4PPNA 4B33A 3GLGE 4JBWA 2ZTLA 4G6ZA 3TIVA 2R8YA 4C43A 1PE0A 4X20A 4ZU6X 1K6IA 3R77A 1WP9A 2HA7A 1YO6A 3L8EA 4CL2A 2QTZA 2HEGA 2WP8J 4FKMA 1Y6ZA 1YUBA 3ZQKA 2NPFA 1KZ9A 1CVIA 2HBZA 4QEZA 5EJ8A 4L73A 1E5XA 2JBAA 5ED4A 1P45A 1CZLA 4IKOA 4HXEB 4YLEA 4N54A 2FSHA 2PD6A 3M4YA 5EJ4A 1W59A 1LK7A 3BAZA 5KKNB 1EP1B 4G4JA 4CV1A 1BOOA 2IHYA 4C04A 5J1SB 2IP2A 1JX6A 4GVXA 1LI4A 3VPGA 4DR3B 3FGOA 1RE1A 1UMCA 1U2GC 3G0HA 1NBAA 3MS4A 2JAWA 1Q2UA 2GM3A 3LKBA 3VTFA 3ZNQA 5JJKA 2Y3IA 2C9OA 1ANKA 1JECA 1W76A 1NWCA 1KK1A 2ZU0C 3VI4B 3EGWA 1TQ6A 4PXYA 2J6HA 3V4OA 1V5FA 4ZCTA 2HMAA 5IJWA 5JRJA 2DPHA 3O95A 3GEHA 2Q5JA 2JNWA 5K3FA 1IBCA 1Q6ZA 1AKTA 3FCXA 2WZBA 1GPKA 4RA9A 1JB9A 1EGAA 1QIKA 4F7DA 2A9VA 3OZAA 5FYDA 3H2ZA 3MJDA 4EHNA 2P5UA 2G5CA 4R2HA 5HBRA 3QG5A 4GBGA 3VNSA 1HPLA 5EWLB 3FPBA 3RFTA 1I9GA 2GPSA 1N5JA 1TEVA 4F4HA 2GZAA 3B5IA 4RYLA 5JQGF 2YDYA 2FXVA 3PIRA 4D9KA 3PQ8A 2ONZA 2AMFA 4AJ9A 5IG2A 1QFMA 4CQMB 1Y3IA 2WMOB 1T9CA 3AONB 1DV2A 2QXTA 4QOFA 4YS6A 5CITA 3GPLA 4D74A 2W6IA 1T8PA 2IEIA 3NBUA 2OHVA 5JCOA 3PHLA 2V6JA 3FTNA 1E62A 3I64A 2FEKA 4II3A 4ZVPA 5SYNA 3BHNA 2HMVA 3WZMA 4C4PA 5HIMA 1ZP6A 2I7CA 2BBTA 3D2BA 4BFLA 4UPEA 5CK4A 4NI5A 5CDUA 1Z18A 2ECPA 4OI2A 3VDNB 1XRNA 1DP4A 5K8UA 1MC1A 4WN9B 3MFQA 2PZMA 5JSKA 5C81A 1DWUA 2ORYA 4IH1A 4WOCA 1PR6A 1ADGA 4KE9A 5ICFA 2O6LA 4AQDA 1F1JA 1L7VC 1RACA 1TYBE 3HKEA 4CDNA 4HNUA 1RI3A 5CFPA 4WJKB 2B4AA 2VF4X 10MHA 3HKBB 1QLJA 4P7JA 2RD2A 2G7ZA 3A4MA 3CZ9A 4P58A 3II6X 5B36A 1Z25A 3MWGA 5A0FA 3F2VA 4KU4A 2BRUA 2C94A 2OB2A 4IICA 4NFLA 1L4KA 1JVBA 2X15A 4H59A 1EE2A 3A3KA 1R12A 3BUSA 1CZRA 3HM9A 3T1QA 2G77B 5BSUA 2VYNA 3GZJA 1BGVA 1TE2A 1YQXA 4MXDA 2O7RA 4Y2XA 2IXEA 4C4TA 1X0XA 2JA2A 1OGYA 2OILA 1KEEA 1NFRA 1ACJA 1DPGA 4RF2A 3EP8B 5DT9A 5IDVA 1E3TA 1S02A 1V7CA 4E5VA 2HQRA 1L8QA 2XUAA 3B1FA 4TT3D 3LXRA 2Y05A 3HJNA 4RTSA 4F6RB 4QTTB 4FXOA 1JDZA 2ERXA 3QK7A 4MUEA 3CLKA 2IWRA 1UIRA 3WLNA 4BNTA 4WK4B 3V4PB 4J1QA 3UA3A 4NJEB 1U9JA 3C8MA 1N2CE 1P17A 1SU4A 5FQNA 3TR0A 4DQDA 4A03A 1HTTA 2QX8A 3HUDA 2AW3A 4OSOA 4YI3A 4UQPA 1Z06A 5HF5A 1U2PA 1QONA 3PZRA 1WHSA 2OMKA 3IEIA 1PJTA 3FLBA 2X8WA 2Y4OA 1HFEL 5JD3A 1TF5A 1Z4OA 4RS4A 2ON6A 3F74A 2YW9A 3G13A 1GNQA 4ND4A 2P1ZA 3TUJC 4RNCA 1R0LA 2H16A 2YBEA 4OATA 2PKXA 5DXFA 5FUWA 1RI1A 2JG3A 4WT7A 3QBTA 1GYRA 2X9NA 4G56A 1PEYA 1U7WA 3O47A 4WK6A 2ZJOA 4CM3A 1HM5A 4QTXA 2WWRA 1JS1X 4LXTA 1M75A 1QHYA 4XIGS 1UPTA 1SIBE 4IDQA 5TB5A 1E0DA 2QVZX 5FPQA 3STUA 4R41A 2DR3A 5KYGA 3IIKA 1RR6A 1D1PA 1G8AA 5HUHA 2B36A 4UFNA 3DZ7B 4N1AA 2HBYA 4MKRA 2X8JB 3HADA 5T4FA 1WQ3A 4DQKA 3UVEA 2VJCA 2XVMA 1A5ZA 1UEXC 5KAPA 1A9YA 1G17A 1V16B 1HG0A 1VE1A 2IQ5A 3DLTA 4K1XA 2CY0A 2VDVE 4A3SA 3U9TA 4AO8A 1W4RA 1H1DA 4MVWA 2VP9A 1RI4A 1XTJA 2AFRA 3HL4A 1YVUA 1ZVKA 3V8RA 1BTOA 3VKGA 5HZMA 3PUJA 4PX3A 5PGMA 4BV3A 3BH6A 1T8RA 2FLWA 3A6DA 3QW4B 3DFZA 2XI4A 4IF6A 4RPGA 4B2YA 1EK1A 1CP3A 1FFSA 2V5AA 1ESDA 1FL9A 1V0JA 3M81A 1ENPA 2BCEA 3KQOA 4IZOA 3M89A 1G1MA 4L3WA 4UULA 2UUPA 4JHLA 4RL4A 4C7JA 4LXXA 2YKGA 1W5FA 3MMNA 2L2QA 3ORHA 4HFJA 3EGDB 1SQSA 4KXQA 1AM4D 3RCBA 4PLWA 4B6QA 3F7OA 4B3CA 5JS8A 1RPZA 2LBPA 4FYMA 3M2TA 5F64A 3BMOA 3LYUA 3GYGA 1SXPA 1NNI1 5DYIA 3PRJA 3ANSA 3Q1LA 3WO1A 1DBRA 2PA0A 3AIOA 2QE7A 2XQKA 4C21A 1Z22A 1Y80A 4AWAA 5ISMA 3Q3IA 1BMFA 1X1CA 1PQ4A 1JZTA 4H2DA 3AR9A 2HPHA 2CUNA 3H0CA 3EWSA 3S3TA 2QYTA 1U3WA 1C30B 3L07A 2BVNA 3LTEA 1BEZA 1S7GA 1N5RA 2GWRA 4JJZA 3WMEA 5JNRA 4PZ9A 4XCVA 4MAAA 1M2EA 4HQKA 1E2BA 1JJFA 3LLCA 4BQFA 2HV9A 2ZPUA 4I1YA 2BSAA 4DIOA 3SZGA 1Q0RA 2OMEA 3HCPA 1M2OA 4CQLB 1LS1A 1SPBS 3G0BA 2RHGB 1GEGA 4HVAA 1E6WA 4ZU1X 5C5CA 5T6BA 3ZQJA 1NNEA 3AIMA 3I0ZA 3EFHA 1DJMA 4EKIA 4I9UA 3U7IA 4DPKA 1TRKA 1AMNA 2CNNA 2YXNA 3AR2A 1KHHA 4LW8A 1UJ4A 3CZPA 4NXNB 4EPRA 2AZXA 3UTDA 4O8ZA 1PI3A 5DU2A 5FBVB 5KYXA 4KR6A 4EECA 3DOHA 4PINA 1M2VA 4OHBA 4B3IA 4KPYA 5F1PA 4LBYA 3BOSA 4ENSA 1T4CB 5BN3B 1J24A 5JH7B 4RJIA 2A5LA 2H4FA 2ZSJA 2G28A 1GR0A 1SBNE 3RQIA 3WGVA 5IUJC 1KO7A 1N36B 4BWGA 2AFVA 4NEHB 4CU2A 3DVAB 2DG2A 5HCNA 1ZBQA 5IBPA 2BGTA 3BB3A 3D2LA 5ADWA 1ZWLA 5CA1B 3GOHA 4ZCMA 5CH5A 4D98A 1VYVA 3IDFA 5LPNA 1Q7BA 4O2BF 2Y1CA 4IXWA 3RVRA 4PHTA 4EI7A 2VP4A 4MUAA 2PL3A 3CPHA 4HWSA 4N7JA 2G6TA 1ICIA 1TQ8A 1SURA 3M70A 4X8OA 5D2CA 4EA7A 2BGMA 1ZHOA 1YS9A 2BY4A 2JCSA 5AVOA 2ZKIA 3BICA 3ZJXA 1TQ4A 3S2GA 1J00A 1UQUA 1XU4A 3HGTA 3NWPA 1QIEA 2ZULA 4ZV4A 3S28A 1N0VC 4RTKA 5FO0A 3H65A 3NBQA 4MPJA 2BEUA 1I1HA 3AUXA 2COUA 2RAPA 1OYWA 4P3XA 4C6RA 3PXUA 1CQPA 3S8EA 3OP1A 4X3PA 3GC6A 4IZHA 1JB1A 3WY9A 5LU8A 2RHDA 5D6NA 3OZUA 1ZAKA 5DK6A 5M2QA 4JLVA 1SAYA 4L8FA 2LNDA 3FZQA 4J0EA 5LJLA 2PDAA 4D3XA 5IHPA 3QNWA 4QL3A 4N5IX 4K6OA 4BDTA 1RYHA 3QE3A 1WU8A 2G1JA 1XL0A 2Y1DA 5L4SA 2LTAA 1H22A 3D2AA 4N0EA 4NS4A 4TVOA 4QJ4A 4YCJA 4YVFA 5EIWA 3ZE1B 1E2PA 3DPUA 3MF4A 4PZYA 4FX2A 1DQPA 1QHGA 3AXTA 1YRQA 2QORA 3EP7B 1A5AB 1NVVR 1V2GA 2G72A 2RB4A 3DL4A 2PAFA 1SOWA 4KQXA 3B48A 4EMBA 2BV3A 3RTCA 1NQVA 2FWNA 2RH9B 3FFAA 4Q1EA 5JD5A 5IVDA 3PGVA 2IP4A 2I1QA 1JA1A 3D8BA 2C9CA 1KHTA 1E3MA 2Q1UA 1IN1A 4DM7A 3PHHA 4IZ6A 4B5LA 2W2QA 3A1EA 3IDSA 1F4VA 1YFKA 1UJ6A 2NOAA 2P6NA 3EJ6A 1UPFA 1N7JA 1X1TA 3FWHA 1YB6A 4P92A 4ARZA 3E2MA 5IHXA 5CHEA 2X6TA 5MHTA 4CIVA 2Q4RA 4N5MA 4ZRMA 5FF9A 4AULA 1UBRS 4OSEA 1EAYA 1OLOA 3TTUA 3NJRA 3C4QA 1L5RA 1ZUNA 4NV1A 1NYQA 4TWBA 3LFUA 4BNMA 4Z4HA 4KWIA 1YH3A 2BFMA 2H4YA 4ND6A 3P9ZA 3QUSA 4Y9RA 1HURA 5HDBB 5KHLB 3RVDA 4KPEC 1DAFA 1IPEA 2H07A 2IYYA 3TIGA 4DPLA 1O6GA 2GDZA 2Q5IA 3EGXB 4RS3A 1U7PA 3T3HA 4OKNA 4YMGA 2J8ZA 3RYCB 3PJEA 3DOIA 3SE7A 1K6XA 3LPNA 8ADHA 4C2BA 3AJRA 4X45A 5E7IA 1QMHA 2GM9A 3HYRA 2JJ2A 3ZHZA 2JK1A 2X9VA 4RMHA 2ALJA 3M6LA 1P6QA 3TB4A 1A9OA 4AZVA 4J0IA 4R71A 4RXUA 2AN5A 3B2EA 2PIDA 1M67A 2FOLA 3C16C 1H23A 5KWIA 3VH4A 4PXAA 3AR8A 3DXXA 2WTEA 4EFLA 3NYQA 3I9NA 2EF1A 5LZ8A 3B13B 4KSYA 1Z28A 4BNYA 2F1JA 3OCJA 4G2TA 4BIMA 3AF1A 3AILA 2WU0A 2C84A 3E9YA 2BIFA 3FTPA 1SC3A 3H5OA 3OHMA 3TSYA 5H83A 3W06A 2WSIA 4RHEA 4Y7CA 3K09C 2CXHA 2RSLA 3IILA 3SKYA 1QQAA 3CB4A 1IY9A 4BBZA 2QLTA 3LPAA 5EWMA 3HTXA 1LNQA 4V0SA 4JFAA 4LIPD 5J2UB 3SBXA 2QR3A 5CBPA 4LK2A 4I5DA 4OLFA 1RBMA 1V37A 3NHWA 1PYDA 2VFAA 3WB0A 5ANRB 5FHRA 1Q7EA 4OM8A 4WI1A 3V8MA 1TMOA 2YY6A 3MPOA 2X9GA 1BHO1 1YS7A 3BE6A 1TTQB 4OGFA 2VXOA 1QC5A 3NBAA 2OWDA 3JRNA 1DJNA 3TCNA 4R5HA 4R31A 3UYLA 2FQQA 3LBNA 3T1VA 1JEYB 2FGJA 4MULA 3RYTC 5BOSA 4BN0A 3ZJTA 5C8ZA 3DDNA 4MTCA 1XAIA 2O4UX 4LWQA 3KVNA 2RGXA 4C6SA 1XX6A 5DO9A 2GASA 3H0KA 1NLFA 2HCBA 4QYIA 5EMNA 4YP7A 5K3BA 1PUXA 4XWKA 4GYKA 3RHSA 2ACEA 4MSUA 4NMHA 3T7JA 2VQEB 2EZ9A 2DKOA 3OLVA 4KKVA 4NCIA 1WB5A 3UMBA 1ZR2A 4RFVA 3MLAA 3OLZA 4P54A 4XPIA 1MEOA 2LVBA 1QIDA 4IOJA 4P7BA 5IKOA 2SKCA 4ZOLA 2AYYA 2BZGA 5GM2A 1YFLA 1WPQA 5AW0A 4C4ZA 1GPMA 4JWTA 4UDOA 1WPGA 2VHJA 1EFPB 1HF3A 2OLJA 3T35A 3V8EA 1OX5A 4J90A 3ZH2A 1JVNA 3R0ZA 1W88A 3RG8A 2H7CA 4YAIA 2H52A 5PNTA 4COKA 3CW2A 4PZLA 3W5HA 3HVIA 3U56A 3ED1A 1ABFA 4AO6A 3UC5A 2CF6A 1N9KA 5JCOC 3L92A 3FZYA 2Q7OE 1XQ6A 1J7KA 1IG3A 3HI4A 1YA8A 3TOXA 1QQ5A 1Q0PA 1MABA 1THGA 2QNBA 3HSSA 3SQDA 4BLRA 3N2EA 4QDTA 3BD6A 5C8XA 3F6CA 1ZX1A 3RDPA 3CX6A 5ECDA 1VL0A 1CUFA 2GHIA 1SXJD 4BV2A 3NDIA 1YRYE 3IX7A 2FR1A 3MRTA 4FB5A 4JP5A 1RLMA 1SUDA 2JCXA 5FD8A 5JZOA 4EQZA 5CGZA 4LKOA 3ECCA 1T91A 3KAJA 4KP7A 1S1CA 1KYXA 4F5YA 4YT8A 4NK4A 4OXXA 4TWRA 1XZKA 4B4VA 1CK4A 2X2OA 2X42A 3HJUA 2VJAA 1NPDA 1SEVA 1RS0A 1SVUA 2Y1FA 3NS7A 3PFCA 2B8WA 2NM0A 4IDPA 4URXR 3BD9A 5IUKC 4XB6B 4ZI7F 5JD4A 2JVIA 2EL7A 2ZTSA 1L4LA 3EIEA 3LX4A 1KC3A 5JW6A 1JLLA 1NVDA 2BRUC 4JJEA 1VLZA 3WI7A 3K7EA 2Q3CA 3LBAA 4R9VA 4CR8A 4DIFA 3V8VA 4NCXA 5TXGA 1RPTA 1J56A 3OOYA 4PU0A 3SFTA 4OQ4A 3D8RA 2Y0EA 2XCQA 1YOVB 2DWQA 1N9ZA 3CLSC 3SGLA 3VZPA 4DWVA 1K0FA 3W6NA 2HA4A 3W5DA 4CTJA 2DUWA 2Q41A 3LVFO 2VUUA 4MGHA 4EO4A 4M1EA 2DT8A 1FMLA 1WBBA 3W3AA 4JJ6A 4BJ3A 2IZ5A 3RASA 2CUTA 1TZKA 2PHZA 3NUGA 5H3CA 5JCJA 5IULC 1GCUA 1TFRA 3ICOA 1THTA 4KRFA 2C2YA 1EK6A 1UC4B 4ZCSA 4KB5A 4HDMA 4PPQA 4X90A 1YRBA 4B32A 2WE7A 3K92A 4P7FA 4Q6WA 1Z82A 4PZZA 5UKDA 2CYBA 5KDOA 1MEEA 3EZ9A 5JSQA 5KX5F 1R88A 3K1JA 3SS7X 4A6EA 1KYYA 3PGA1 1YZQA 2CWWA 2AKAB 2B69A 5BYKA 4BO8A 4X1IB 3W3ZB 5LDDC 3IEMA 1Z0UA 4HXFB 5CRIA 2ZUTA 4G65A 3VNAA 1TJNA 4YWJA 4MYTA 1PK7A 4HGOA 4Q7MB 3ZY2A 3FI9A 1BXGA 2FFAA 3EIWA 3FCSB 2NO6A 3NWEA 1EZ4A 2XUZA 3U7QB 3VTKA 4XDGA 3M1YA 4KE7A 4E88A 4MO2A 2VIIA 5JD6A 1FDTA 1NMZA 4OMDA 4LF7B 1KERA 3CKYA 1ISHA 3JR3A 4JJKA 3LQ4A 4MITA 2BI4A 1IY2A 2P62A 4KIFA 1R0ZA 2VSXA 3L5KA 3A4IA 4ACAA 2HB6A 1KFJB 1DBPA 3U3RA 2PX3A 2AXQA 1BWRA 3FKSA 3UPTA 2PL1A 1DAEA 3QKRA 1JI0A 1MAUA 3IERA 5IH7A 1NUHA 4J3JA 4PXSA 1JL3A 4ZRNA 1XTVA 4TQGA 1BHSA 4KN6A 2PPVA 2QHXA 1ZW6A 1XMPA 4U9UA 1ZESA 4R68A 3CNQS 4DMFA 2TYSB 1N2XA 1Z2CA 2Q4DA 4WASA 4M8KA 3E9QA 2PUWA 3UQYS 1BXRA 4Y98A 1Q1BA 2XCUA 1JDBC 3JXEA 3JTMA 1J2JA 3JVDA 1P39A 2TMKA 3V1YA 1DIOB 1P9WA 4LHEA 1R0WA 4OO3A 2W6ZA 3LQ2A 4TN5A 5DNEA 2B4YA 4MVJG 1AT1A 4L08A 4NDNE 5MGNA 3MWKA 2VATA 1N57A 4AJHA 3IP8A 4Z3OA 1L4BA 5CD1A 2RAUA 1BKYA 3HWX1 1U3CA 1GG5A 3D8UA 5H1YA 3AZQA 2WEKA 4R1PA 3TW4A 3THXB 4C76A 3KNZA 2UYQA 1DNPA 1E7QA 2VQDA 2BBOA 3A58B 2MYPA 4M60A 2GRUA 5TR9A 1C8BA 4F8JA 2IUFA 4YJ2F 4NMMA 3PEWA 2NZWA 4JUCA 1D9ZA 3KIPA 4B2PA 1ZIYA 4BLVA 3BREA 1EEXB 2PWAA 2UZ3A 4KVAA 1T8SA 2N9UA 3V97A 1ZL2A 3VVMA 3QVJA 3V3TA 5GY7A 4MW2A 2JKZA 3TTXA 5KTTA 3VYVA 2AZ4A 5C1OA 2Q6LA 3WGZA 1Y8RA 3CR7A 3DL2A 4WESA 2CE7A 2J7KA 2XEDA 2AFIA 4FW9A 5MDHA 3S29A 5BW8A 1ZJ6A 4W9NA 1I10A 2AD1A 2Z2JA 4KAAA 1BCRB 4WBNF 4UHCA 2PUJA 4TUYF 4C1NA 1LVUA 4IVNA 1WF6A 4GPBA 2V3CC 1XU9A 2CL0X 1G9TA 3SC4A 3CA8A 2RHWA 4W1QA 3KZCA 2ZSDA 2BEVB 2QS9A 1NPTO 1RJFA 2PWPA 2YMMA 3A70A 2XUIA 3E3MA 3HN6A 4ZHQA 5KINB 2YWXA 4RHTA 2Z58A 3IAM6 3V55A 4MGZR 1YB1A 4U6SA 4O0MA 1OLXB 1MH9A 5P8WA 3AR4A 2DE0X 2EJTA 5KQPA 3JR7A 1OFTA 4QEKA 1BX0A 2DBYA 3H1PA 2J3HA 1O03A 4JS0A 2DCUA 1QAMA 1MVOA 3CZ5A 3LHKA 1NMQA 1KDVA 5EE5B 3TRJA 2HADA 4LMRA 1LEHA 4JU9A 2OOSA 2Z8YA 3L0PA 3R5JA 1FUUA 4KN8A 4RZQA 1Q1QA 3ACBA 3ROZA 4CCSA 2B99A 4Y2VA 1T1GA 3I0NA 5F2OA 5FADA 3RAPR 4ECAA 4U7HA 3MT8A 1VPDA 3DZ3B 2I3DA 2F62A 4NBLA 4F2PA 3KSAC 1NVGA 2JLUA 3VAYA 4IJWA 2ILVA 1OPRA 3NVMB 3K1YA 3EVAA 5FOVA 5L6MB 4J9VA 4KQMA 1JI3A 2FW6A 4LJ8A 3CUYA 5H7XA 3RFUA 3THOA 2PMCA 1YJXA 2YXBA 1QRUA 3SJUA 2NU9A 4JSRA 1KE2A 2NZXA 3DMTA 3O3MB 3UH1A 3E9ZA 2UVPA 3IV7A 3TRDA 3NGMA 2BGWA 3HBNA 3OIYA 4ZTUB 3GDGA 5FOUA 3OE5A 4PYKA 2BFBA 2FMFA 3V7NA 4LF4B 1O08A 4P3NA 2WWXA 4TV8A 4UATA 2A9RA 1UP4A 5EXEA 4IIJB 2BZSA 3MSCA 4M1YA 2Z6AA 1J0XO 3PDWA 3NHSA 4FE4A 4N01A 4M4SA 1S9HA 2V6FA 3S44A 3E9EA 1LQUA 4QD3A 2FZGA 4L22A 3N3AC 1L8XA 5CW1A 3BIXA 1RZRA 3SC2A 2A8YA 2ATXA 1KNQA 3W77A 1R5JA 1SUCA 4D02A 4RHFA 2A5FA 3CPJB 3QF4B 1YR6A 1AHHA 2OBFA 4GOMD 4LA4A 3WNDA 4IRUB 1FTNA 4RGQA 2DEUA 3DHYA 4PG4A 3FNFA 4IJMA 5BWBA 5JARA 1CW2B 2EW1A 4UJ3A 4X8LA 1RPNA 3DBHB 2G1UA 1R9JA 3AXSA 5DCUA 1G21B 4NOLA 2ZWPA 4EATA 3VYTB 2IZ6A 5ALXA 2XMQA 1RI5A 3FHJA 1OZ0A 2X5JO 1GZ5A 2P91A 2J85A 1AKMA 1A7KA 2ICAA 2ZUWA 3EVBA 3UOAB 1YGPA 3OM1A 1QE3A 3R5XA 1QX3A 3ZNNA 2OT3B 3UQZA 1CQJA 3IDZA 4L6IA 2W6OA 1UDCA 1P7WA 3OHSX 1H4VB 1UDXA 2UV8A 3LPCA 4WDQA 3VZRA 2H0QA 5AOCA 5FQOA 2JLZA 2IPAB 3D1JA 3PJGA 2D2IA 4W5NA 5HS4A 1CUBA 5J23A 3RSZA 5BPFA 3GFPA 2GYYA 2QD3A 1UBLS 1ML4A 5AUQA 4BO0A 4EHJA 4G24A 4HNQA 3EC7A 1NRXA 4HAOA 3OQBA 5BWLA 1XCLA 3CNBA 4OEHA 1H2XA 3UV6A 3WP1B 4E5YA 2G4CA 4MPTA 5HUJA 2FPPB 3FIJA 4MS4B 5HZGA 4DTIA 4DMGA 3ZGZA 4IG9A 1L6RA 3R7LA 4CT0A 3VR4D 1JDUA 1GPLA 3KZVA 3OOHA 4ZJUA 3C97A 3W04A 1DCFA 1W73A 3BA1A 5HK8A 1IZ7A 1J8VA 5EEHA 1YQUA 3P4UA 1BVUA 2DB3A 1VKJA 2W2MA 1QSGA 3U60B 4ASUD 1XAJA 3FNIA 1JKFA 1KJNA 5H02A 4GKJB 1E32A 2VPPA 3DSRA 4FU0A 2YZMA 4KE8A 2NZVG 3SQOA 1P0MA 4EX6A 1FQKA 4Q16A 4JYZA 4U4AA 1VI5A 3ETHA 3UWKA 4UDXX 5J4LA 4PIPA 4F4UA 4KPUB 4YRSA 4US2R 4WLEA 4XLTA 1JA9A 1FDSA 3JZDA 3OX2A 3RS8A 5JCZA 2B82A 3OJCA 5GIPE 4MQFA 1HNZB 5L3SA 2ZXEA 4JWKA 4UZSA 3DKVA 1KK0A 4EA6A 1R4NA 4UFPA 1I7SB 4OP1A 5L7WA 1C3JA 1B41A 2BMWA 1SD5A 1K08A 1E5VA 3L2OB 1JXOA 3DGFC 3PDIB 5CB0A 5ILOA 1U8EA 4DJ5X 3IWBB 4HWPA 1VXRA 4CM7A 2CCJA 3ZD8A 1C29B 2A1UA 4AICA 1N1EA 1XTRA 3EVNA 3FPGA 4CFYA 5IWCA 3QFFA 3RNOA 3G8DA 3UV3A 3OX3A 2FTKE 5E0OA 3H2YA 3P5SA 1NVKA 4J1NA 3ML1A 2B5VA 3LKVA 2JZOA 4E22A 3UBTA 3HU3A 2QTBA 3LHSA 4P33A 4LF6B 4O4IF 4F91B 4YDRA 4PG6A 5E9WA 4J03A 4XB1A 5GZ1A 2XRMA 2OVBA 3EYAA 4RJLA 2HRDA 4X91A 4DG8A 1I7PA 4DLUA 4CTKA 4GL4A 2HL6A 1HXHA 4AZTA 1P3DA 1U5AA 3QVSA 3G0GA 3OUTA 3EIQA 4AURA 4DMRA 2C1EA 1YIAA 3EQ9A 2ZDHA 3I83A 3KL2A 4MJ7A 4QWWA 4BUZA 4Q9LA 1HNXB 1NBOA 2X7XA 4HATA 2I2FA 2JJ8A 2QOEA 3IOBA 3KVVA 2W6ID 3RF7A 5ICGA 4KN5A 4BL5A 4N6NA 3WK4A 3IP6A 4Y1RB 4KMSA 3MXTA 5JHGB 2B7LA 4GVPA 4MICA 3LYLA 3NYIA 3BJIC 4IF4A 5JXIA 4OHVA 4FHGA 5NLLA 5LQRA 5BXYA 1XCJA 1DAPA 3K31A 4RBNA 3OTHA 3UT5A 3STHA 4UE2A 4PW0A 3G9TA 3ND5A 3ZCVA 5CXXA 4A2PA 4PQEA 4FI3F 3CY6A 2KX7A 1T4GA 1GKIA 1M73E 2VJMA 3QZUA 4G4SP 3EVCA 3H2JA 4MS3A 4UFOA 3ROMA 4OJKA 4E12A 3H9GA 1IUNA 4IQ4A 3AFHA 3ESQA 3K70B 4FMCB 4LS3A 1EINA 4D3ZA 4YCBA 4DDUA 5L53A 2XMRA 4JODA 3WK9A 3PNYA 1M5UA 1Y3HA 1OVGA 2FPIA 1JG1A 4R1NA 3WK5A 4ND5A 2F64A 1ULSA 2I66A 3C8DA 2L82A 2LZ0A 1SHTX 1O89A 1ENYA 1W2HA 1JFFA 1USGA 4B31A 2V6BA 1P8JA 2G04A 1RFGE 1ZH6A 5KWEA 3CX3A 2BT4A 5CFRA 1PGNA 1H3NA 1Q83A 1TVEA 2NTVA 2QQ0A 3PQ5A 5K6RA 4AM8A 2F55A 3A1DA 5E1DA 5DLQC 2Q4OA 5DTIA 3GDFA 1EYZA 3CG0A 3IKVA 1DKUA 3EEBA 5HMLA 4JD5A 3IIMA 5EWJA 4KX3A 2RJNA 5EKDA 2R9VA 1NDUA 3N59A 2J48A 4LMAA 4WH0A 2CDCA 3TAHA 3L1JA 1YUMA 3K9WA 3ZCUA 3TEFA 3GN1A 2CCKA 3UC9A 2PX6A 2MSNA 3B5JA 2BF7A 4TLEA 2DLNA 5JZMA 5H8WA 1FJ2A 1PFGA 1SQ6A 1ILWA 5CURA 3DBIA 1ZSNA 1E3WA 4DILA 1PW5A 2XMGA 5KB3A 1GFIA 1YQDA 2ZSBA 4CM9A 3EDRA 2NSLA 1OJLA 3NV9A 4W99A 1GAJA 1PJ2A 3RUDA 2ZSEA 2GNOA 4FS3A 4RD4A 5C7IO 1C8KA 5EIHA 5TMEA 4FILA 4O08A 1IM8A 1GPH1 2ZCVA 4QGGA 4DLBA 1ZUIA 1F8UA 3RLFA 4MB2A 4NOJA 1N33B 3C1UA 4HH0A 2FN3A 4PIMA 3PP8A 1TRHA 4NHOA 5CFMA 1MMFB 1DKLA 4MR7A 5CLQA 3EK2A 2CJXA 2DVMA 2GCIA 2R8EA 1S01A 3DDZX 1OH7A 3UOWA 1XK7A 4QU0A 3R7DA 2FZVA 4HGYA 1EGMB 1V3VA 5IUNC 1YIOA 5D1NA 1RU3A 3D0OA 3DE5X 2OYCA 3THYB 4WKNA 4JU8A 1TPYA 4KXMA 1XIVA 3QVKA 3KQPA 1KU0A 1FYVA 1I8TA 1OAKA 3RS0A 5B6PA 5I4IA 3IMFA 1B4DA 3EOBI 3IVMA 3AYZB 3ADBA 3ZYZA 5ER9A 3GO4A 3BFVA 2O54A 1MGOA 2Q8PA 3KR2A 1F5SA 4MK4A 3P8ZA 4GYJA 5ALLA 2OXTA 3WGJA 2XZPA 1SFRA 2WHRA 3ZEIA 1Y5IA 3UB4A 3HJRA 4WCVA 4RLQA 1KZGB 3CUWA 2QRZA 3ZDZB 1SC4A 3IE0A 3EFOA 1G38A 4B3SB 4K9SA 3CONA 3UHJA 2XDAA 3U1VA 3GLRA 4JMLA 4DQ0A 3OO0A 3VU1A 4F04A 3K35A 4Y18A 3OIDA 1EVLA 1EFTA 4QRHA 3ZDRA 4Y6LA 5I4CA 1XNJA 2FPRA 3CGGA 5EZ5A 3RFVA 3V4FA 5A3RA 4M9XA 2IXFA 4PQGA 3M9XA 3PHCA 1B43A 2VDWA 4GC9A 3HGMA 5J2TB 3ZBUA 2ZS7A 1FP1D 1W4CA 3A05A 1BMFD 4JKYA 3KD3A 3JSXA 4L85A 1DBQA 2Q6VA 5TT0A 3GLFB 4MQUA 1ONOA 3DTVB 3DTTA 1RQPA 3P32A 4RHXA 3TW6A 2HIHA 2C88A 3OCUA 1KMHA 3FGNA 3PG5A 2VRNA 4WIAA 3W5BA 2HAEA 4YPFA 2VPXA 2R96A 4OXQA 5H82A 2AN3A 3ZWYA 1NOIA 3EE6A 4W9NC 1EVKA 3B1ZA 5HPYB 1K7CA 2RONA 4M8IA 2K7FA 2CYAA 4UZEA 3GCGA 1SO8A 2HXGA 2HTEA 4GT1A 1LV7A 4NCHA 3PXDA 2F3SA 2Y4NA 5CT4A 5KDLA 4LJ6A 3UFXA 5BN1A 2AFIE 1VYTA 5LQJA 1V1JA 2JC3A 1TCUA 1QG6A 2SICE 1DHTA 4G0YA 3GPCA 3RWBA 3LUJA 4MIOA 3B8HA 2ZQZA 5C2JB 2PCJA 1AMUA 3G0DA 3AY6A 4ZANA 1MW8X 2WUEA 1GXSB 4Y2PA 4FZ3A 1O96A 3SZ3A 3VX3A 4ILEA 3EQZA 2XECA 4C7OA 4UTVA 1HLDA 3AERA 3K0FA 4DV2B 1V11A 1LI7A 1VECA 1L4MA 2OVFA 3DBOB 1CZOA 1ODIA 3PKZA 5LQDA 3I09A 1Z2AA 4I46A 2CC2A 1W9HA 4PICA 4QSMA 5BO5A 2BWJA 2FZWA 4XYEA 2VLBA 3X0DA 4Z1OA 5JMTA 4DV5B 4N18A 3DE6X 4E5DA 4NQRA 1BFKA 4X94A 2ZWIA 2R47A 3QYFA 2B9EA 1ULHA 1CEYA 1ISMA 3FOCA 4RESA 1OZHA 4GE0A 5G3ZA 4D4MA 4QKQA 5KHOC 3KKQA 4AZ0A 3C6YA 2OC4A 3JALA 2A5DA 2DSNA 3V9AA 4BTLA 2OHGA 5KYYB 1OI2A 4MVJF 1CY8A 4G0OA 2FWRA 3GAZA 3HPQA 2OO5A 3RPEA 3QUTA 5HF8A 1MO3A 3LNTA 4M88A 3R9XA 1KJYA 3KJEA 2MSWA 3DMTC 1PGOA 2ONCA 1JTEA 2CJWA 4ENUA 1EHIA 2XUDA 4Q93A 2ZBGA 3BRSA 1PJRA 4GP7A 1I6WA 1II8B 1SD2A 2AQHA 4HZUA 1HQYE 3RSGA 5JPDA 2O23A 3QV2A 2NT4A 3VUEA 4AY2A 3LGSA 1WVGA 3JQEA 3PFFA 3QJGA 3ORRA 5A9SB 4ZICA 1W75A 4QYSA 3CLTC 3RTEA 1C1XA 3OQIA 2BFWA 3THWA 5AM0A 4BNIA 2P4UA 4A82A 2FJUA 4L4YA 4KODA 1ZG3A 2XYGA 3MMZA 4RPJA 4B4DA 4G5HA 2R6JA 5CVCA 4I66A 4AJNA 2FP4B 2ZETA 1VB3A 3PX2A 4IDDA 3WL6A 2G0NA 1IONA 1NP3A 1VSBA 3PQ6A 3UG7A 4S35A 4JA0A 2HSGA 2G9RA 1F8XA 3O9MA 5K51A 2C4NA 3ZJ5A 4BO1A 5BSVA 1XRMA 1KEWA 4GSYA 3H0VB 1NFFA 1UBKS 2DBRA 5ALTA 5FI1B 3RIMA 3U7RA 4V1CA 1JVSA 2WBLC 2FR0A 2IELA 4R8RA 2NU6A 1UZAA 3KKPA 3NATA 2FZ4A 2JFVA 5AW3A 2FB9A 1SZPA 3FMVA 4K6FA 5JCXA 1ISRA 2CEAA 4GPZA 4D96A 3JWGA 3DB2A 3NI2A 2CXUA 1GPYA 3DZHA 1PZXA 2I6TA 3QLUA 2PX4A 4KR2A 1YD7A 5IN4A 5U9CA 2E4XA 4JGGA 2ZRKA 1T2NA 4DCTA 1NF9A 4CLDA 2REOA 1DWQA 1U6KA 4OUDA 1EESA 4TLAA 5ALHA 2FV8A 1DKPA 3NWBA 3I5YA 1CLEA 4MVJH 1SUFA 3KOZA 4EAQA 5JASA 5KTPA 3PPWA 4K03A 2PLRA 4BMNA 2VLIA 2ZG6A 2ZM5A 1WE2A 3Q7EA 1Z08A 4MQ5A 3WIDA 3KHKA 5CIWA 2X6QA 3NPAA 1NF2A 1RW4A 1JZSA 3MD0A 2P0AA 4WBSA 2IH4A 1ZLXA 1RPJA 4I55B 1GL6A 4MX8A 5HF6A 4EB8A 4O4HB 2BR3A 3IOEA 3EP5B 1A1SA 1B1CA 2XE8A 2ST1A 4LBZA 3W2GA 1KK3A 1LA2A 1ZUWA 4DPMA 1AV7A 1URPA 3BA6A 2FA9A 4IILA 3P20A 1M2FA 1YU6A 3RD5A 4ZZ1A 1YQWA 5ENDA 4D41A 1G8YA 4M0UA 3CF4A 2ZAYA 2G06A 5FLKA 1M1YA 4CKEA 1ZJWA 3IMCA 4MWSA 1WMAA 4RTOA 4EQ6A 3DTYA 4NSNA 1EJ6A 4PVCA 1MJFA 1JYSA 1IXZA 2BMFA 2BOVA 2XBLA 2YNMA 1SVIA 4KITB 2SKEA 2A67A 3V8PA 3BT7A 4ZQEA 1Z8DA 3IO3A 2IP1A 2VYVA 1PNTA 1EJ2A 4FFDA 5EJAA 1WM1A 1WLYA 3DE7X 4ISBA 4BKRA 3I6YA 3BGWA 1PUJA 4XR4A 3F4BA 1ZD3A 4HNAA 4CBVA 2QTNA 2J0QA 3KALA 4X93A 5H3HA 2MTBA 2XGMA 2XJ9A 3WOVA 1DIGA 4ZV9A 3TVYA 1DL5A 1PBTA 2WA1A 2JB9A 3EF0A 5CM9C 3DT9A 2O19A 3DZFA 1I3KA 4RXMA 4YAJA 4N3BA 5DB4A 2MMGA 1NPYA 1S8NA 3F49S 4UXJA 1L7EA 4FFRA 2CDNA 5IT0A 2X3YA 4X63A 3R7WB 3T0GA 3AF6A 2QTRA 3GNQA 1DKNA 3IKMB 1NRJB 1HEYA 2BUBA 1I4TD 2NSDA 2XQIA 3UT0A 2O0MA 2RGUA 4BWVA 4F38A 3PHJA 3TLCA 2AFHA 1UR5A 4S24A 1BDMA 3QXGA 4LE0A 1V8PA 2ZLBA 3TR5A 2B5WA 2I2AA 1R5NA 1CQWA 2DPGA 1RADA 3KPVA 4G37A 2R7MA 3M82A 3ZLTA 3T3PB 2PNFA 4TSRA 4C0XA 4M9ZA 3O2JA 5BR1A 5KU7A 3E1SA 2RH4A 2X2EA 4EW2A 1QYXA 3MAJA 1YAJA 3O0TA 2HDWA 3NP7A 4H7KA 2QQEA 3SICE 3WSWA 4ZDJA 3TLJA 4NZMA 2CNWA 5KWJA 3IMKA 4B80A 2FWBA 4NAUA 4D8WA 1JU3A 1CUUA 3EZ6A 1SUBA 2V45A 3OFND 3ITDA 4QXPA 2PYDA 2OD9A 2PXCA 2Q5LA 3OJEA 4Z8YA 4CCWA 3NHLA 3KVOA 4ODIA 4OB6A 3VJMA 3S2EA 2HCRA 1PJCA 1OIVA 4GPD1 5AW4A 4A4DA 3N7AA 4HAWA 2DCMA 4DIBA 2ZJ3A 3H2GA 1OHHD 3L7IA 3ZBQA 3W9YA 2OHJA 2HK6A 4IKEA 1RRMA 1W6RA 4G5FA 4NYIR 4DRZA 4B45A 5F4BA 1VL2A 4G5XA 3L9XA 1VHQA 4KIJA 4Z9AA 4C14A 1OX4B 4FEYA 1AIPA 1BMDA 2BTQB 2ECOA 4QGAA 4TV9F 4D4LA 2JLWA 3WZLA 3GZ4A 4ZIRA 2G25A 3A1CA 4BNXA 3HDJA 1NVEA 4R16A 2C5AA 3HXLA 1Z63A 1U1EA 1P9NA 3WQQA 4PFSA 1A9TA 4HDSB 4LXYA 4ZYLA 3S68A 2E0IA 2WUFA 5ICCA 1BH6A 4MZDA 4RY0A 1NFQA 4YPOA 1LI5A 1EXVA 2QSZA 5ARBA