1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
4I08A 4PG6A 1BW9A 4D42A 2WMDA 4CL8A 2Y99A 4AFNA 4N5NA 1DO8A 3RC2A 1SO8A 4JXKA 3W4JA 4XR4A 5K6AA 3KEQA 9LDTA 3ETEA 3NRCA 4S1VA 2W2KA 5A5FA 5TSDA 3GY0A 3O4RA 1ZXBA 2PY6A 1GAEO 3K92A 4LMRA 3GNSA 5B4VA 4IM7A 1YBMA 4EJ6A 4IQ0A 2OORA 2DQ4A 4XQGA 1UP4A 5BT9A 1X7DA 4FS3A 2DLDA 1DB3A 1GFSA 4FBGA 2Y68A 2DBZA 3RJ5A 2NNLD 4DPMA 2O3JA 1Z82A 1JA9A 4PLCA 3DZJA 1ZK1A 1NPDA 1DHRA 2Q46A 4U0JA 3WSVA 4JROA 2O3QA 2IODA 3NAQA 3WFJA 1GZ3A 4OJNA 1U5AA 2BF7A 1DFGA 3HE3A 5CPFA 5CPBA 4FC7A 1IULA 1TI7A 3EY4A 1UXIA 5DULA 5HS4A 2YV2A 4ZJUA 4MVJM 3R3JA 4OXNA 3ZHBA 1ZK2A 2Z1NA 3E9QA 3IAHA 3MJCA 3WLEA 1NQTA 3WSWA 4IJKA 1WXDA 5KKCA 1E5LA 1LA2A 3AUAA 3C7DB 1UXKA 4Y6RA 3GOHA 1RPNA 3E9NA 3UN1A 2BH9A 2NVWA 5MDHA 2W2LD 5TGDA 1EVJA 1JDJA 1EMDA 2YV3A 3CEAA 2UYYA 2JD2A 1IZ0A 1A72A 4LN1A 4ND2A 4ZQGA 4YT2A 3OEWA 2CVOA 2B35A 2CY0A 4HKTA 3IOYA 3WIDA 4GX5A 3RUCA 1E77A 1PQPA 2HMSA 2DTEA 2XAAA 1C0PA 2IZZA 4Z0PA 5TX7A 1GYQA 4FR5A 5T6BA 4WLOA 3B1JA 2O4UX 1Q0QA 5JCJD 4Q3CA 1J0XO 4DTIA 1LBEA 1HZJA 4U7WA 3EMKA 1T1RA 4ALMA 4JNKA 5CDYA 5I9MA 2ZCVA 4UVEA 6ADHA 1LX6A 1B7GO 3OJEA 3WR5A 4KQWA 3VTFA 3TWOA 2J8ZA 5AQ1A 2AG5A 4MVJH 4HNGA 5DP1A 3IKTA 2NADA 2QZZA 4Q3DA 3BMNA 3JD2A 1U7TA 2FZEA 4PLGA 3VKUA 5KVCA 1SNYA 3V1YA 1I2BA 4ID9A 4CLRB 3AW9A 1HE2A 4IGEA 1DHTA 5KVQA 4GMFA 2NUAA 3TN7A 1WW8A 4XRGA 3FI9A 1HE5A 3HB4X 5JNLA 4PVDA 3D5QA 2G5CA 1WDKA 3CUKA 3L9WA 4CUKA 4J2HA 2CDCA 3ZI0A 4EZBA 1WP4A 1NQ5A 4DUPA 5A02A 2I6TA 4LISA 3VPHA 3DB2A 3H65A 1DFHA 4YYZA 3QWHA 5JMPA 4PN3A 4XIJA 4JBGA 3H7AA 4XX0A 5DT9A 2NU7A 3W4IA 4CL3A 4DRYA 1CIVA 3FTNA 5JYEA 5HS6A 1Q7GA 3D0OA 2DFVA 3GA0A 2GASA 4DVJA 4FIZA 2VCYA 2V6FA 4PLYA 1ZMTA 3P5SA 3OJOA 4UUMA 3ZWBA 5B37A 2FPPA 4BNNA 4B7UA 1UR5A 4R51A 2Y1OA 3BA1A 4GKBA 3RKUA 1J5PA 3RJ9A 1D1SA 1GUYA 2QYTA 1GDHA 4NMHA 3TDKA 1H0KA 3RIHA 3VAZA 1PGJA 1BXGA 1GZ6A 1JWAB 4QXMA 3ZHYA 1H2BA 1AHIA 4RV9A 2BI8A 3Q11A 5MGBA 7MDHA 4HWKA 4B3IA 1E6UA 3H3FA 2Q2QA 2ZYDA 3AJRA 4OXKA 5I8WA 4BKOA 4RCVA 1HL3A 4UUNA 1P3DA 1P1IA 3IUPA 3H9UA 4OMUA 4IMRA 3RWBA 1WAMA 1ZKMA 4XYEA 4XYLA 2Y05A 1ISIA 1PJ2A 3I9OA 3MCVA 5JBIA 1FDVA 4Q3EA 4U6SA 4BMSA 2GPTA 3AY7A 1ZIDA 5ADHA 3GNTA 3I3OA 4UEOA 2PTGA 4CLHA 1K6JA 2VZ8A 4DQVA 2D1YA 4Q3AA 1Z7EA 3GEMA 4K28A 3SC4A 1LDNA 1H6CA 3D1LA 1PTJA 4XZ3A 3ZWYA 4YDRA 3ZGYA 4E5NA 3JYQA 2FR1A 1MG5A 2ZIZA 3AU8A 4RPHA 2PH3A 5DOZA 3BMCA 4ALKA 3KETA 1X14A 2NVUB 1E7QA 1HSZA 3RUDA 1ONOA 4N7RA 2O3SA 5C7OO 5JCXA 4W6ZA 1U5CA 1P1FA 1V8BA 2YFHA 1JTVA 2CVQA 1RYDA 4PLFA 2R6JA 1N5DA 2LDBA 1VSUA 5KJ6A 2W90A 3TFOA 4NDNE 1E7MA 5CG1A 1JW9B 1BDMA 1U4OA 2Q45A 2BGMA 3UF0A 2E49A 3INGA 4YRAA 2V6BA 4E30A 4WLNA 2D59A 5L7WA 4RVDA 1YBVA 3RROA 1P31A 5F1KA 5EQFA 2EG9A 3O38A 2OOSA 4D3DA 3C85A 4UULA 1P1JA 1YE3A 4X54A 4BGVA 4CODB 4E5YA 1A5ZA 1QV7A 3Q2IA 2P5UA 3AM3A 1EK5A 4IIVA 3ST7A 3T7CA 3JSAA 1YQDA 1HDZA 1X0XA 3F46A 1WWKA 4B3JA 4DMLA 4E5MA 5C3MA 3BZUA 5JXWA 3W8EA 2OP1A 5LCXA 5L4LA 3ZWWA 1R0LA 2ZK7A 3C3XA 4NK4A 4AJPA 5JAMA 4O1MA 2EJVA 5GMOA 4Z9YA 2Q49A 5IJZA 1K89A 2PGJA 3H9GA 1R12A 4NBVA 2X6TA 4BO4A 1M76A 3PK0A 4FQ8A 4RQUA 3QWBA 4DLAA 3VHRA 3PGXA 4BO6A 3DZFA 4XDYA 3Q0EA 2FZWA 1ENOA 3C24A 1K6IA 3GG9A 4EBFA 4YJDA 3GQVA 3JYLA 2OP0A 4RJTA 3WGZA 3INTA 2I5PO 1O89A 2EF1A 2O3RA 2PR2A 4BNWA 2O3UA 5JDIC 3L77A 1T2AA 2C5AA 5ITVA 2XPCA 1ZJZA 3KXDA 3KYBA 1SEVA 4L76A 2NWQA 4CQLB 2OUIA 2IXAA 5JLAA 4OL9A 4CV2A 5IG2A 5KCZA 1E6EA 3BMQB 2P9GA 3RCBA 3DFZA 5T57A 1UZLA 3BTVA 4A03A 5CDTA 5DZSA 3NEPX 3FNEA 2WWRA 3JQ6A 4IQGA 5TQVA 1Y5RA 3JQCA 3QVTA 2GO1A 5A5EA 1VKNA 3A28A 2UDPA 3CH6A 4BO2A 2J3KA 2QRLA 3OF2A 3ZV6A 4A26A 1PL8A 5AYVA 3IMFA 4OM8A 4CV3A 5ILOA 5L9AA 2LDXA 4XYGA 1ZK4A 2Z5LA 1RM0A 1GQ2A 2X9NA 2HJRA 4R1SA 4CLRA 3E6AA 1YXMA 5K6AC 8LDHA 1TA4A 3RC7A 1WZIA 1JVBA 2CD9A 3VZQA 4TVBA 1OBFO 3QRWA 1ARZA 1P44A 4OQYA 1VM6A 1IYZA 3MTJA 4W82A 4A2CA 5CDUA 2IZ0A 4XIYA 4A10A 3PEFA 2Y0EA 3F5QA 3K6JA 4PRKA 4GWGA 4J91A 1KEVA 4W9NA 3TPCA 4CMCA 1OOEA 3F3SA 1JLLA 1VLLA 5KJCA 2EGGA 3LLVA 3DTTA 3FN4A 2ZATA 3UCFA 1X15A 3KSUA 1PJ3A 4PLPA 4W4TA 5U1PA 1GPDG 3MJTA 5L53A 2PZLA 1E92A 4R68A 4LGVA 2D8AA 3R0IA 1PGQA 2RH8A 4BIIA 3H6KA 4YT4A 1XSEA 3D7LA 2AMFA 1HE4A 3KYDB 3FD8A 4BNXA 4JN6B 3A1NA 1Z75A 3LZ6A 2Q99A 4UREA 3O8QB 5GZ1A 2ZB4A 4KMSA 2VTDA 5G4KB 3LC7O 1DIRA 3LVFO 5BNFA 4Q9NA 2VWQA 4CMEA 1HWYA 1EE9A 3K2BA 1P1HA 2ZTVA 1ADCA 3I5MA 3ZV4A 1A27A 3WS7A 1AXEA 2X0RA 5G0VA 2F00A 4BNJA 3D3WB 3UFXA 4BGUA 3ZNPA 3PYXA 1F8GA 3ZWXA 1BHSA 2QIOA 1C1XB 2R2GA 2W2LA 1VL0A 2NM0A 4OXYA 4O0LA 3KLPX 3PIIA 4WNIA 1R37A 3BYZA 2UV8A 1Q7CA 2WE7A 3WQSB 5I7VA 1SPXA 3S2GA 4E2XA 2GLXA 1UAYA 2OBYA 5J23A 1NAHA 1CDOA 2YFQA 3ZU5A 3LC2O 2NV6A 4EYEA 2H5LA 1L7DA 1DIGA 3FNHA 3GRKA 1QG6A 4LK3A 4YCAA 4RF2A 3RUEA 2R00A 1Z7BA 1HDYA 2NU8A 3RUAA 3TQHA 4DIFA 4JGBA 2NQ8A 5JCJA 4GAEA 3HB5X 2EHDA 3WWZA 1TVEA 3CKYA 1NXQA 4TKLA 4BNMA 2BFPA 4O59O 3HJAA 3ENKA 4A0SA 4R5HA 4JCOA 3VPGA 4C4OA 1EVYA 4FFRA 3X2FA 4NU6A 2YUTA 3JQ7B 2JAHA 3IKVA 1KVRA 4LRSB 4NPCA 3C8MA 1D4FA 5HTOA 4UEKA 3KM0A 3JQFA 4YA6A 1E1MA 4O6VA 4TROA 4ALNA 1YQXA 3ONEA 4R01A 4XWYA 3MTGA 5L7TA 1BG6A 4CMIB 4L74A 5CEFA 4LSWA 4CV1A 1GQQA 1YRLA 1E1LA 1XIVA 1H9AA 4AJIA 4RVSA 1VPDA 3VH2A 1VSVA 4CLDA 2YV1A 1XYGA 4PLWA 1GUZA 5EINA 2B5WA 1ZH8A 1KVSA 3ZWPA 4G5HA 4TQGA 1ULSA 1KY4A 2VT3A 2GN6A 2PZMA 2W8ZA 4PIVA 3SJ7A 1MGOA 2BGKA 3ZWVA 1HXHA 4F6LA 3L4SO 4LMPA 3QY9A 4H3VA 1MUUA 4FJ2A 3K73O 4OAQA 3BAZA 4XGIA 1KVUA 4KOAA 3G1UA 3KYCB 4JQCA 3AI1A 2POQX 1LDGA 2C07A 3DHEA 2YHUA 2OO5A 4WPGA 4OO3A 3DBHB 4IDEA 2Q1UA 4BO1A 2I3AA 3GAFA 1PGPA 4G81A 3WGGA 3IP3A 1A4UA 4GMGA 5JYAA 3DOJA 2GZ2A 1GV1A 4BNFA 3DEYX 1MX3A 1G0OA 4E3ZA 1N9GB 4JJFA 1PJCA 1LU9A 4CQLA 1MG0A 1LDYA 1MP0A 2VYVD 1ZXLA 4IDFA 4R4JA 5TJHA 4BKRA 4BV9A 1GZ4A 1I30A 4KUHA 4RQTA 3BMQA 1PL7A 4PZDA 3W8DA 5KOIA 4I5FA 4XJSA 3GRPA 3K31A 1I24A 2VNAA 3WGTA 1OI7A 3RFXA 3DAGA 4MVJE 3GUYA 4CLOB 1KBZA 3MOGA 3L6DA 5FF9A 1RKXA 4E6PA 2AE1A 3GDFA 4JIGA 1UDBA 2PGDA 4KZPA 1LLUA 5IN4A 4AJKA 4NBUA 3VPFA 5JC1A 1Y9EA 5F5LA 3B70A 4OIMA 1Y8QB 2C20A 3SVTA 2BMAA 2XF8A 1NAIA 1ZSNA 2VUTA 3GHYA 4QO8A 1PJBA 1ZEJA 4CR8A 4JP3A 1DIBA 1I01A 4L73A 3BHMA 4MJLA 4ITUA 2HSDA 2E37A 2BGLA 1I3NA 2H63A 1HE3A 4WECA 1U3WA 4GL4A 1E6WA 3WXBA 3CSDA 3DDNA 1CQIA 4OSOA 1O0SA 4D45A 2D2IA 1ZFNA 3QHAA 4UUPA 4PG4A 2X58A 4K9DA 3WFIA 2DC1A 1ONNA 4I8XA 2RH4A 1I3LA 1LSUA 2GN8A 3TOZA 4J9UE 1B15A 4J4TA 1C0IA 4E5KA 3WBFA 3PWSA 2UUPA 3F47A 4A73A 1HYEA 1PEDA 1D3AA 2BI7A 2X0JA 1F17A 4WEQA 3ROPA 1LC3A 5BSGA 2O7SA 5M6DA 4D3SA 4XEHA 1R4NB 3CZRA 5IDWA 4GVLA 4K26A 1ONPA 3WG9A 4AJ4A 3L0DA 1CQJA 1R6DA 4W7HA 4AVYA 4U8GA 3DHNA 4TMFA 1NQAO 4NG5A 1VJTA 3LYLA 2NVBA 5IFLA 1IUKA 1VI2A 3FWZA 5EL0A 4NNJA 4UEJA 9LDBA 3ZWCA 4B79A 1FF9A 1B2LA 2Z95A 3PRJA 1X1EA 4NR0A 4EUEA 4RLSA 1J49A 2HCTA 2PGLA 1HSOA 5DBFA 3WNVA 4AJNA 3O8QA 3PWKA 1EDOA 2B83A 5G4KA 3LLSA 1MA0A 4BO8A 5BSHA 1LNQA 3PGJA 2IDZA 1XGKA 3IC5A 4MIYA 4EEXA 2HO5A 2DTDA 4DBZA 4MVJP 4HY3A 2DU8A 3I1JA 3ETGA 4YT8A 3VPSA 2A35A 1W0CA 4M87A 3D3WA 4BNTA 1PJTA 4DC0A 3DONA 4O63O 3ZN2A 1IHXA 3EYWA 1PS8A 1PZEA 2ZJ1A 2Y93A 3UCEA 5C5IA 1XQ1A 2B69A 2DPGA 1DC4A 3Q3CA 1M75A 1LEHA 1YVEI 1GL3A 3M1LA 4E2ZA 1F0YA 1KVQA 4WLEA 2PA3A 2Q50A 3I4CA 1QRRA 4FFPA 4RVFA 1PL6A 2D5AA 4RL6A 1LDMA 3E5MA 1XWFA 3L6EA 2D3TA 1SBYA 4WGGA 5CFZA 1D8AA 3QVOA 5AVOA 5G0SA 4A5OA 1BRMA 4QX6A 5KNLA 3GVIA 2O3TA 3F4BA 3TZQA 1SB9A 1LRJA 3GGPA 2JJYA 3FHLA 3V5NA 3OEYA 1D1TA 4OHUA 4WK6A 3H2SA 1GD1O 1OFGA 1KS9A 1S6YA 3OHSX 1V6AA 4FGSA 4FN4A 2O2SA 2X7HA 5JYDA 3NV9A 2PH5A 4RF4A 3UXYA 3HNPA 3I9MA 1Y5MA 1LSOA 3JQ7A 4GKVA 2BELA 1XR3A 4I9UA 2D4AA 5HWSA 2NU9A 4NFHA 2AQHA 1UJMA 4PLHA 1LTHR 3QSGA 2FSVA 4IXWA 4W9NC 5K9ZA 1GCOA 2PD3A 4CMIA 1TT5B 2CVZA 2WE8A 1U4SA 1UXGA 4WUVA 2A94A 4BMNA 2ZTUA 3JYPA 1YO6A 4J1TA 1JAXA 3CZMA 1QP8A 4YAKA 4LCEA 5JC8A 1ZNQO 1SC6A 3OFSA 5FEUA 3I23A 3GLQA 1R0KA 1LJ8A 3WYCA 3GPIA 1XEAA 1LC0A 4R3NA 1HT0A 3A4VA 3V2HA 3L9XA 1O8CA 1IPEA 2WTBA 4MOWA 1TEHA 4J6FA 1DPGA 5LDGA 1XU9A 2Q3EA 4PCVA 2IEBA 2BRUA 4AL4A 4LVUA 2HAEA 5KJ1A 4Z6KA 4BQPA 1U8XX 4IDDA 3KYCA 4XJTA 3OBBA 3HDQA 5IXSA 2BHLA 4D3FA 3FNGA 2YJZA 2XXJA 1GV0A 4CMEC 3DBHA 1YQGA 2EKLA 1PGNA 3NGXA 3VC7A 4FPXA 1YWGO 1XG5A 1E3LA 3ADPA 3ITDA 4HP8A 1GTMA 1BDBA 1O9BA 5TF4A 4Q3NA 2VYND 3LT0A 3M2PA 3OM9A 1P0FA 3OA2A 1QV6A 2V6GA 1GEGA 2WEKA 4RORA 5FI3A 2AXQA 1QXSA 2FWMX 4Z0HO 1N9GA 4DWVA 3ZNOA 2ZQZA 3CTMA 3OJLA 3PHJA 3WLFA 3E1KA 3TL2A 2RCYA 2VQ3A 4R69A 2ZYGA 4I5EA 1Q2XA 3ZCXA 3PYLA 3T7EA 4B7XA 4YAEA 3GVXA 3JQ8B 4CLOA 3QQPA 1Y6JA 3ZWAA 2EGHA 2GRAA 4N5MA 4CM3A 2FHSA 4M54A 1LRKA 1PS9A 2JL1A 3UAGA 1MC5A 1Z6ZA 3U62A 3FBGA 5IDYA 3WJ7A 3F1KA 4CM8B 1B14A 5IDQA 1ENPA 1G1AA 1Y8QA 2R00C 2I9PA 2HK8A 3OICA 2G17A 4ZA2A 4KDEA 1LDBA 1E3JA 3A9WA 1I8TA 5DBIA 1YB5A 2PV7A 3C7AA 5K0ZA 4XR9A 2O4CA 5LC1A 4L9RA 1D7OA 1MLDA 2FPGA 2FSSA 4YJHB 1Y9AA 1TXGA 3ZV3A 3RU7A 4IPTA 3RUFA 4J1QA 3NTRA 4RO0A 4CPDA 3HN2A 3VH1A 1PQWA 4HXYA 1GYRA 1PJSA 2Q1TA 4CR6A 3KUXA 3QLJA 3EK2A 1BSVA 2HDHA 3AOEA 2WD7B 3SX2A 2A4KA 4GX1A 3DFUA 1MV8A 4XKJA 2EW8A 3WX0A 3M6IA 4IZIA 1HTBA 3I9LA 4OOFA 2PKQO 2JCVA 4RZIA 1R4NA 3EUWA 3DOCA 1ZVMA 2Y1DA 3DBRB 2I76A 4R16A 3ZWNA 4FOOA 3JQDA 3OETA 5COBA 4ALJA 2EKQA 5L40A 4INAA 3ONDA 4ZD6A 1E7RA 2Y1FA 4D41A 3ABIA 3FNFA 1YDEA 5DNAA 4MKRA 1HETA 2Q4EA 4I1IA 3AM5A 5AXBA 1WDLA 4HADA 3AFMA 1WMAA 4BOYA 5DCYA 5FWNA 1EQ2A 4F3YA 1Q7BA 1T24A 3GPDG 3AM4A 4CM4B 4LRTB 1RJWA 2X4GA 4YJFA 4AG3A 1EUCA 1TLTA 3H5NA 5I9LA 2PZJA 3VZRA 4PG8A 5CAEA 5BNTA 4I9NA 2HU2A 1K0UA 1GQYA 5EIOA 5DN9A 1NTOA 4BMVA 1RM3A 1LLDA 4M49A 5EESA 4TZTA 5G4LA 3RFVA 3HG7A 4FD3A 5TRTA 1XCBA 1RM5A 1DRUA 1E3WB 2CMDA 5L4NA 1TB4A 2ZB7A 4PFJA 1HDRA 3QP9A 3WGYA 1JU9A 2VTEA 2V6MA 1UH5A 1DDOA 4XGNA 2WJPA 4ILKA 2OL4A 4BO9A 1KEWA 1B0AA 3MJSA 4ONEA 1E1KA 3RQSA 4BO0A 5JDCA 4BL5A 2ZYAA 1B3BA 2Q1WA 4DBVO 2WD8A 2B5VA 1BXZA 3C1TA 2QRJA 4HFJA 4PRLA 1NWHA 2VYVA 3P7MA 3LU1A 4ZQHA 1IOLA 3CMMA 1T4BA 2GN9A 4JBIA 3K2EA 2AHRA 5HA5A 2WDZA 4CQMD 2VT2A 4N54A 2CSUA 4IJVA 1SAYA 3DL2A 3PLRA 3DZGA 4UVGA 1JKJA 4MO2A 1UAGA 1ORRA 4PVCA 3I83A 5GY7A 3ICCA 1A7KA 1YDWA 4BB6A 2RHRA 3AK4A 1NR1A 1TT5A 4FJ1A 3PHGA 4GWKA 4NJMB 3IP1A 1FDTA 4B3HA 2X5JO 4RPLA 2JFGA 2RAFA 3K30A 3L6OO 1I36A 1W6UA 3H3JA 4WLVA 4O5OA 1ADGA 3CPSA 5A03A 3AWDA 4MIOA 3WGOA 2IYOA 4FGWA 1A71A 2I67A 2V65A 5T67A 1NPYA 4BVAA 1XQ6A 1EVIA 2FPIA 1TT7A 3JD4A 1V0JA 4DGSA 2ZTMA 2AEFA 4BGEA 4YB8A 1HDOA 3D4NA 4OOEA 4PLVA 3CINA 3VKVA 5TLSA 2HMUA 3L07A 3PJEA 1ZW1A 2AQIA 1UP6A 4TVOA 4B4WA 3W6UA 1DLJA 4B4UA 4IDCA 1GPJA 2D5CA 2WYUA 5L3ZA 3HWRA 1T2DA 1UDCA 5AXDA 1CETA 1N2SA 1SEPA 2H6EA 4NU5A 1NYTA 1P0CA 3PHLA 1B26A 2RBEA 3F6YA 3NTOA 3NTQA 1DEHA 4BGIA 3WB9A 1CRWG 3KRTA 4AJEA 5DCUA 5ES3A 4Z9XA 1WVGA 4RPJA 4AJ1A 4QTZA 4DC1A 1BTOA 1GU7A 3OIFA 4QO7A 2A92A 1N92A 1ZSYA 3D64A 4ZVVA 2P4QA 1MB4A 1XLTA 3LF1A 1GADO 4BNGA 1JWBB 5KVVA 1QLHA 3UH1A 1AGNA 2HQ1A 3F5SA 3JQ8A 2OGUA 1G6KA 4D43A 4M89A 2FN7A 3E18A 1U2DA 2VHVA 3JQBA 5T73A 1S7CA 3MJEA 5EN4A 4CM8A 4MVJI 2VZ9A 4RVHA 4IY1A 2EXXA 2CF6A 4ALLA 1C14A 1T2CA 3S2EA 2P5YA 5JAIA 3W6ZA 2I3GA 3N74A 2ZB8A 5CHEA 3OIGA 3NX4A 4EJMA 4OKNA 1VE9A 1UZMA 4G2NA 4R1NA 1FMCA 3FPCA 5C7IO 1K3TA 1XDWA 2VWGA 3PYMA 3ZZNA 2OBNA 5COQA 1ZZEA 4YJHA 4CUJA 2GDZA 2DAPA 3WQRA 3QWFA 4WKGA 3DZHA 3UKOA 1A7AA 4IIUA 3FSRA 3H9JA 2NQTA 2CF5A 1KEUA 3FR7A 5EMHA 4IDAA 5TT1A 1N1GA 2EP7A 2O50A 4ROSA 5F1OA 1OMOA 3PIDA 2Y1GA 4J9VA 4CQMB 3LSYA 4WNCA 3GDOA 3DZIA 3JYNA 2C29D 3DMTA 3DBRA 3ENNA 3PDJA 3V2UA 5T8KA 4MKXA 1PR9A 3ULKA 2I66A 3S55A 2VNSA 3IUSA 3OH8A 1N7GA 4PGFA 3PWZA 2YDYA 1E3SA 5EPOA 1JN0A 3ITKA 4D7AA 5IF3A 3VVBA 4FFLA 4M8SA 4DA9A 1B3RA 1C1DB 1YL6A 1YBAA 3HHPA 3I6QA 1SCUA 2Q4BA 3M1AA 5JO9A 1L1FA 3GZ4A 3TFQA 2GD1O 1KC3A 3W8FA 2VRCD 1UXHA 1XU7A 3AI3A 4QEDA 1LXCA 4AICA 1LUAA 4CM4A 4TRRA 2CDBA 2DFDA 4DLLA 2NVUA 5G0TA 1NP3A 4RPGA 3RBZA 4DPKA 4Z0TA 3EC7A 1ENZA 2JHFA 3IDSA 5A06A 3I4FA 5BSEA 2IYPA 4U6QA 1HEUA 4FFNA 5B4UA 2O23A 2AA3A 2FP4A 5LDHA 1E3WA 3NGLA 4IBOA 2ZTLA 4TRMA 3SBOA 3GVHA 1YH3A 4ND3A 2O48X 4BB5A 1SOWA 2GF2A 4DYVA 1MC4A 3PDUA 4EW6A 1A9YA 4RGBA 4XB1A 5HRUA 4PG7A 3HSKA 4YAJA 5EERA 2PLAA 1FJHA 3G49A 1M66A 3GMDA 4FC6A 2GN4A 4J4HA 4CLEA 1DAOA 5I7SA 3HFGA 4CMHA 1B8PA 2NACA 1ZEMA 1YOVB 2G0TA 1BXKA 4QQRA 3VH4A 3F1LA 5L45A 2PKQP 3O03A 3WWYA 4EUFA 3EZYA 4WLUA 1RYEA 1R16A 1IE3A 5IDXA 3PLNA 3PVZA 1NFFA 2A9FA 1GY8A 4B7CA 2W98A 2PWZA 1LLCA 3D4OA 2HK7A 2G76A 4L75A 4NHEA 3S1LA 4IINA 3HDJA 2ZKLA 4XQCA 3KEOA 4RLHA 2DBVO 3UW3A 3AOEC 4E2WA 1U9JA 4MPDA 2HK9A 1WLYA 2IXBA 1EZ4A 1P33A 4GLLA 2J5RA 1V3TA 1Y8RB 3FRJA 4TWRA 4CMJA 2VUUA 4NJMA 4HNHA 1IPFA 4QUKA 5KWEA 3ZU3A 2YQ5A 3X2EA 1QYDA 4AJOA 3BMOB 2Y66A 4GQAA 4NZ9A 5A4DA 1DIHA 3OSUA 1IY8A 4PLTA 1IHYA 4H7PA 3UOGA 2WM3A 3TZKA 3GFGA 2X5KO 3Q6IA 3ZV5A 1O5IA 1X7GA 1HDCA 2E4AA 4DPLA 4GPD1 2AQ8A 3W4KA 2NTNA 4D0RA 3KHUA 5T5QA 1X7HA 5ENDA 1ZMOA 3DTYA 2O2YA 5ENVA 1QKIA 4GX2A 4KDFA 1YL5A 4KP7A 2E82A 3RUHA 1NR7A 3TF5A 3GK3A 1M6WA 5ER6A 4D44A 4KUGA 4U0KA 4Z9FA 4BKQA 4J16A 4ND5A 3OIDA 4F6CA 3E82A 4IQ8A 1AUPA 3HADA 1SMKA 3OMLA 5BNIA 3AY3A 3STHA 1B16A 1ZK0A 2HMVA 3JD0A 3TJRA 4EEZA 5JS6A 5B1YA 1R4MB 3EVTA 3PI7A 4B8WA 1K2WA 3GH3A 2J6IA 5BSFA 1E1NA 3ANLA 5KVSA 1LQUA 4GI2A 5DP2A 3T4EA 5JO0A 3E8XA 3PXXA 3JD1A 1WDMA 4J0FA 5IZ4A 4WCFB 2X23A 2P9EA 1Y81A 1V9LA 2GR9A 1N8KA 3SEFA 1BWSA 4OQZA 3GUCA 5G2OA 1KERA 1I0ZA 1XKQA 1DC6A 1VKOA 2PKRA 5JDCC 3NYWA 3NT4A 1N1EA 4ZQBA 4KWHA 1I32A 4OGWA 2X8LA 3PHIA 4DQUA 3EGOA 2YYYA 1HDGO 3UVEA 1CF2O 1AN9A 1EFLA 5FI5A 1NASA 4MVJD 1DBVO 3WYEA 3WNQA 3NT5A 4UVDA 4FJ0A 3ROQA 4R5MA 3OQBA 1HZZA 3LF2A 1U28A 3KV3O 3AUSA 4YTEA 5G0UA 2FMUA 1YB4A 4R9SA 4R9RA 1DRWA 3G3EA 1ZUD1 5CG2A 1NVGA 1QYXA 3V1TC 3AY6A 3ADOA 4MKZA 4N5LA 3VZSA 4R3WA 2GSDA 5JAZA 4XDZA 3IS3A 3TOXA 1QSGA 4KWIA 3KYDA 3DR3A 3KSDO 2E6UX 3WBBA 2C59A 2XOXA 3ASVA 3DXFA 1YKFA 1AXGA 3JTMA 1Y1PA 3NUGA 4ND1A 3U0BA 1PX0A 3RFTA 4URFA 4CQMA 4PZCA 3AI2A 3TRIA 4E4YA 5F3RA 1E0DA 4BO3A 2QG4A 4LW8A 4XRRA 4YR9A 4Q39A 4FDAA 3JV7A 3KVOA 3Q2KA 4I9HA 2PZKA 4BKUA 2B4RO 1YJQA 3AFNA 1C1XA 1QYCA 3ICPA 3WTBA 1VJ0A 3O26A 4IXTA 4A27A 2GZ1A 3H5RA 4FCCA 5I7FA 1C1DA 4P4LA 3SLKA 5GZ3A 1W8DA 3H4VA 1WPQA 3VZPA 4FB5A 3B1KA 4FSHA 4MIEA 3D4PA 2Q2VA 4GLOA 4DIOA 1CJCA 4JK3A 3ZNQA 1PQUA 4HFMA 4ZU3A 3DOOA 2P91A 2ET6A 3GF4A 3RUIA 4C7JA 1RM4A 5ICMA 1ISJA 5I7EA 5DF1A 4LSMA 1VJ1A 5EQDA 1V3VA 3IJPA 3NKLA 4CV0A 1BVRA 3FWNA 4ND4A 4ALIA 1GR0A 4R54A 4JLWA 2GUGA 4EITA 4R41A 1EUZA 3PZRA 1DLIA 4CM7A 1EFKA 1PIWA 1K5HA 3RBVA 1E3EA 2H1SA 3PHHA 4Y6PA 3FF4A 4R1UA 4W7IA 4E31A 3FBTA 4I5GA 1HYHA 1MFPA 1T4DA 4R1TA 3JQBC 3RC1A 3F9IA 1V3UA 1PSDA 3IQDB 3ZH2A 4BNYA 1XA0A 2B37A 1F06A 1CERA 3WGQA 1IZ9A 2ZJ0A 1FK8A 4YPOA 1VRWA 3S2FA 4YVFA 2EP5A 4CMAA 4NBRA 4EJ0A 2PNFA 1NFRA 4P38A 1E7SA 1PWZA 1YOVA 4S3MA 3KOUA 1R15A 1DFIA 1O95A 2WSBA 2CZCA 4BNIA 3LT2A 4CM6A 4J90A 1T1SA 3GR6A 4IGFA 4NIMA 5C37A 1JAYA 3QWAA 2E48A 3GGOA 3L4BA 1P45A 3PFWO 3I9NA 3E03A 1LLQA 3INRA 1L7EA 2J3HA 1DC3A 3WGIA 2X1HA 1H2HA 5JW6A 3MEQA 4IS3A 2CNBA 1YS4A 4WOJA 2EV9A 1E7WA 3DO5A 1Y8RA 3WMXA 4IMPA 3DQPA 1NFQA 4TKMA 3BMOA 1DXYA 4CLXA 2BD0A 5AXAA 3AOGA 1NM5A 3U4IA 4MP3A 4ZRNA 3DMTC 4OKIA 3UGKA 1W73A 1EE2A 4RVUA 1R0SA 5T8KC 5U4QA 4CM1A 4DXHA 2DT5A 3GMSA 4FW8A 4H15A 3JQ9A 2VWPA 5KJFA 4J7XA 3TNLA 4Y9DA 2HMTA 1GYPA 1I3KA 5TT0A 1EUDA 4YBZA 4Y6SA 2HMWA 2J3JA 1DSSG 2EKPA 4MINA 2EIHA 3WIEA 2RIRA 5IZCA 2G1UA 2QZ9A 2J3IA 4GGOA 3BXXA 3JD3A 4J3FA 4RVGA 1PJQA 4ZRMA 1H6DA 2Q22A 1LSJA 3WQQA 4E32A 3DMYA 4CM9D 1R66A 2P4HX 3RASA 4EUHA 5CEJA 3I6IA 3D5TA 2G82A 4MP6A 3U3XA 4PLZA 4J0EA 2WYWA 1JKFA 3UCXA 3BHJA 1ADBA 3U09A 3VDRA 3U4CA 4BHTA 2AW5A 1U8FO 1P1RA 1QLJA 1GCUA 2SCUA 3QW2A 1R4MA 4II2A 3U4DA 3ZDFA 2JCXA 5DBGA 3WJAA 1U1IA 2C0CA 4UUOA 2AEMA 2YW9A 3B1FA 3HDYA 4GSKA 4XCVA 5CP8A 4ZICA 5JAQA 3S2IA 1PZGA 3JQAD 2VRCA 4B4VA 3RU9A 2ZCUA 1QYVA 4WCFA 1YL7A 2DBRA 4XGKA 4Z3DA 3DAPA 2DPHA 2NSDA 3FPLA 3NJ4A 3ROKA 3MJ4A 4E0BA 1MXFA 1ADFA 3GT0A 5A04A 4J2OA 2J5QA 2VOJA 2DKNA 3ZHXA 2Q2WA 2X0IA 3JQFC 4NJOA 4UVIA 2X9VA 5JE8A 2AEJA 2DM6A 1DIAA 5A9SB 1Q0LA 1UP7A 2JAPA 1OC2A 3V1UA 2VWHA 4KTVE 4Y98A 2P9CA 4YAIA 5ER9A 3E5RA 3WOHA 3H9QA 5F5NA 1EVZA 1PR3A 2YY7A 1EK6A 2Z1MA 1Z74A 1KEPA 1CWUA 5TS3A 3KLMX 4RDIA 4JBHA 1F14A 4TSKA 4XQEA 3BTUA 1P77A 2OFPA 1PJLA 5L4SA 4EGFA 1UUFA 3QVWA 2VHYA 3UICA 4NBTA 3GC6A 3OJFA 2X9GA 5A1TA 4U5QA 3MJVA 2NU6A 1KETA 3GDGA 4L8VA 5C7LO 3JQGB 4RF3A 5TNXA 1ZSVA 1NHWA 3G0OA 3G1TA 4YJGB 1PZHA 3D3EA 1Z45A 2IE0A 1KOLA 3U4HA 4L4SA 4BQRA 4BKPA 4OYRA 2V7PA 1ZCJA 4E12A 3RSHA 3NDJA 4IJUA 5AOVA 1DOHA 2I65A 3DHYA 1DJNA 1G0NA 3PZBA 4IJWA 4MP8A 1BMDA 4D79A 1Q1NA 1HF3A 1VC2A 3U49A 3SXPA 5JY1A 1P9LA 1J4AA 2UVDA 3CXRA 4AJJA 1NQOA 3NJ8A 5A9TA 3QE3A 1T2FA 3UUWA 2BFMA 1OC4A 3PJFA 3FCOA 4WJZA 1ISFA 1JKIA 4XB2A 3GN1A 2JD1A 3C1OA 2CFCA 3OA0A 4E33A 1H93A 3N58A 3IJRA 4NK5A 1XELA 2AE2A 4Y8VA 4JJIA 4DREA 4CMBA 4TRNA 3COSA 5JFOA 3GG2A 3OECA 4L4XA 4TRJA 1CEQA 1U3UA 1MXHA 2B36A 3I9KA 3WMWA 2GNAA 3CMCO 1K6XA 4ZN6A 5B4TA 3KB6A 1T25A 3PQDA 3V2GA 4PG5A 2GGSA 1KVTA 3MWEB 3PJDA 3CE6A 5L95A 3ZHZA 4LCJA 4XYBA 2AG8A 2HKIA 3MOIA 1ENYA 4K1LA 1I2CA 1NNUA 1EDZA 2IRWA 2HLPA 1ZK3A 4IS2A 3Q9UA 4KUEA 1ML3A 1ULUA 3DBVO 2Y0CA 4GX0A 3V8BA 3ZU2A 3PQEA 2YQ4A 2BFOA 4RZHA 5IAAA 4BNUA 2X0NA 1E5QA 4J4BA 4DMMA 3JQAB 3SLGA 5JMWA 3DC2A 4ZQEA 2C2XA 4QSMA 1ZBQA 2XXBA 4YWJA 3PTZA 1PS0A 4BO5A 4L4RA 1X0VA 3K96A 3WYBA 4YRBA 5KIAA 1SB8A 4BNVA 5KTKA 2B4QA 5J9GA 5T64A 1YGYA 2JCYA 4YACA 3VOSA 3WTCA 1NPTO 2VHXA 4NH4A 1I3MA 1T26A 1YB1A 5F21A 5G0WA 4HUJA 5A3VA 3K8ZA 4MVJA 1HDXA 1BVUA 1M67A 1FXSA 1LDEA 1P74A 2HRZA 2VOEA 4UAGA 4GVXA 4WCDA 5COAA 3KO8A 3K5PA 4CM5A 3QV1A 1FDUA 2JFHA 5IXYA 1EQUA 2QX7A 5ITWA 2QRKA 4IDBA 5I8ZA 3TZ6A 3VH3A 3ROMA 1J6UA 1X1TA 2QYSA 4JP2A 4RPKA 2PK3A 1NX6A 3P2YA 4K6FA 3G17A 2EW2A 1ID1A 5CDSA 5A05A 5L7YA 4ZGWA 4GH5A 1EBFA 2H9IA 3AU9A 3Q9NA 5HBRA 1NVTA 1AE1A 2YHIB 1H9BA 3RC9A 3JYOA 4WE3A 4WOKA 4DL9A 3DAFA 2DTXA 1AHHA 1M6HA 3KTDA 1CYDA 2CUKA 3DZBA 4WASA 1IL0A 3LT1A 3GNQA 4M86A 4J49A 2C82A 1NBOA 2HUNA 1ZO8A 5L51A 3EAGA 3QA9A 2JD0A 1N7HA 3S8MA 1EEHA 1UDAA 1DAPA 3GZNB 1Q0HA 2AQKA 3VPXA 1FDWA 1W4ZA 3GAZA 1YONA 3OQ6A 1H94A 4NBWA 5KKAA 4HBGA 4MVJG 1V35A 2FY8A 1QORA 2EJWA 4CMGA 5ICSA 4YEDA 4FFOA 1FDSA 2F1KA 2Y67A 5I9NA 5JY6A 3HN7A 1U3TA 4BUCA 2BLLA 2VUSA 3C1AA 5DCWA 4IZHA 1UZNA 4II3A 4CR7A 3MWDB 4E13A 4QECA 1HLPA 2DUUA 1WNTA 3VTZA 3HQ4O 3Q1LA 1O6ZA 3F4LA 2PFGA 2WD7A 1H6AA 3RKRA 5A9SA 5BR7A 3GFBA 3AUUA 3R1IA 4BNHA 1HRDA 1IB6A 4ZQFA 1T2EA 3WGHA 4HV4A 4WEOA 3TZHA 3DBLB 2ZQYA 3GEGA 2DBQA 3EVNA 1SZJG 5THKA 4AJHA 3L4BC 2GERA 1UXJA 3LDHA 2FR8A 2JFFA 2PD4A 4FOSA 5DDIP 4J1SA 4JJGA 4P4NA 1KYQA 2GZ3A 4AJLA 1PWXA 3SJUA 1HKUA 4YXFA 3BTSA 4IUYA 2X86A 1DC5A 1OAAA 2JKVA 1I10A 3GHHA 3TSCA 4M1QA 3WDSA 3GVCA 2VHWA 4CJXA 2GYYA 3JQGA 1E3IA 1NWCA 1WMBA 5HM8A 1F8FA 3HDHA 4M55A 2YZ7A 4YJGA 2VZ0A 1NHGA 3PPIA 1ISMA 1JQBA 5A9RA 3LT4A 1BW9B 3ZWMA 5F1PA 1KIFA 3KBOA 4EDFA 3JQ9C 2WYVA 1VL6A 3DWFA 1ISGA 4F46A 2W2KB 2EWMA 4HFNA 4AJ2A 4TZKA 4GSLA 4IDGA 4NFYA 1QMGA 2UUOA 4DIBA 5IZCC 2NTJA 4CMKA 4OH1A 2VYNA 1Y7TA 1QYWA 1C0KA 1LI4A 3P19A 1M2WA 1LRLA 3BTOA 3T4XA 4ESOA 4UVHA 8ADHA 2C2YA 4KQXA 4BV8A 2HRBA 3A06A 3U9LA 2B4TO 3QVSA 4B8ZA 1PGOA 4XYMA 3QIVA 2OHXA 3B6ZA 5H82A 5GZ6A 5FYDA 3BIOA 5CEEA 2BKAA 4EI2A 1I5RA 4GBJA 1Z73A 3OP4A 5DOVA 2DVMA 4WCFC 4D0SA 1U3VA 4YT5A 3H8VA 1U7HA 2C54A 4CM9A 1NVMB 3GVPA 3G79A 4W99A 3RAJA 2TMDA 2FR0A 5BQFA 2PD6A 1GUFA 4CUZA 4YQYA 2Y0DA 2HJSA 2VHZA 4ZHSA 1I33A 5JSFA 4J7CA 2TMGA 1ISHA 2JHGA 4P22A 4MVJF 3RBXA 4J43A 3FR8A 4BS9A 1KY5A 3ONFA 3PFFA 3RVDA 5B12A 3GGGA 3SC6A 4DLBA 3ZNNA 4J7UA 3JQAA 3HFSA 3PJGA 4RDHA 1DRVA 4G65A 5JPIA 2QQ5A 3EHEA 2ILTA 1P1KA 3M2TA 3I9JA 3IIEA 4FFMA 2D0IA 1EBUA 3WICA 4K6CA 5AXCA 4HX5A 3HZZA 2C7VA 4NQZA 4WLFA 2EEZA 2IZ1A 5TC4A 2BFAA 5H83A 4XD2A 2OXIA 3ANMA 4Y67A 2O7QA 3VVCA 2X5OA 2J5KA 1PJ4A 2C7GA 3NT2A 2IEDA 3AUTA 4D46A 1F12A 1XHLA 3MZ0A 5CDGA 3ETDA 3BMNB 3H2ZA 2EERA 4OSPA 5U9CA 1C0LA 2P68A 4C7KA 1H6BA 3K9QO 3NDRA 5EJ2A 3B20A 2YHIA 4NFSA 1HLDA 4H16A 5KJEA 4NI5A 1MFZA 1BGVA 2RHCA 3ASUA 2QW8A 3O9ZA 3W1VA 1E7YA 4YQZA 5IN5A 4HFRA 3QWIA 1DJQA 3HUDA 3ZWOA 3PQFA 2GCGA 4Z3KA 1H5QA 2I99A 3BHIA 3QJ5A 4LVCA 3KSZO 5A3JA 2VN8A 3R3SA 3ANNA 4GGPA 3LK7A 3VDQA 2DUWA 3GZNA 3E48A 5JYFA 4E2YA 2OZPA 5TJ9A 4A7PA 3KZVA 1O94A 4RF5A 3EZLA 5TIIA 1A4IA 5FFFA 3EDMA 3I52A 1A9ZA 3UHAA 3C7CB 3FTPA 4XA8A 5THQA 2ZB3A 2Y1EA 4YAGA 3DZKA 4L0QA 1KC1A 3OQ1A 1LQTA 4XQ9A 1LSSA 3ZW8A 3LC1O 1B8UA 3ZW9A 3E9MA 3LQFA 1PU2A 4JX8A 2CDAA 5ILGA 4BNZA 1BXGB 1HYGA 2Y1CA 4MDHA 2UAGA 4F45A 3GEDA 3TL3A 4Q3BA 4P8RA 3OJ0A 7ADHA 4N18A 1WZEA 1U2GA 3CIFA 4DYDA 1B8VA 2FOIA 2Q1SA 3JCZA 3ON5A 4QFCA 4BNKA 4BNLA 4DQXA 2YDXA 3QVXA 3ORFA 1YJ8A 3N7UA 5JDIA 1GEEA 1RWBA 1X13A 3DBLA 4E5PA 2B0JA 4I5DA 3PP8A 3H9EO 1PZFA 3JQEA 1C3VA 2P2SA 3EW7A 2QHXA 1QR6A 2VRBA 4KTTE 6LDHA 4QFDA 5H81A 3ZU4A 2NLOA 4QT0A 3GN2A 3A14A 4E21A 2NTVA 1I2ZA 4J1NA 3U5TA 4PZEA 3R6DA 2X22A 3RD5A 3NDIA 3H5AA 1OZAA 3IL2A 1ZJYA 4P4GA 1JVSA 2FRDA 2OMEA 2W4QA 1VL8A 3BMCB 4YJFB 4B4OA 2C5EA 3RI3A 1SOVA 4YRDA 4BO7A 3TZCA 3P2OA
chains in the Genus database with same CATH superfamily
4KPEC 4I08A 3RABA 3BM5A 4MS4A 1IY9A 1G4AE 2F7SA 2Y99A 4AFNA 2YR0A 4BBAA 4JI4B 1J1UA 2PJDA 3TZLA 1WXWA 5JZSA 3KTOA 3WLKX 3UAYA 4MLCA 4YP7A 2MU1A 4P34A 1JLKA 4WZZA 9LDTA 4HAUA 2QR2A 4I4TB 1AV6A 1PG5A 2AN4A 3O4RA 2KS6A 3CF4G 2PY6A 4MQ6A 5EZ6B 3B60A 3GNSA 2TS1A 4O2RA 3ZD8A 1VTKA 4ZK6A 2ES4A 2ID9A 3VO8A 3VR6H 4EFNA 2DLDA 3SEZA 1ND6A 3MXTA 1OXXK 4PICA 2ZU6A 1ZNXA 2DBZA 2HF7A 2NNLD 1ZVJA 4JB8A 4DPMA 1Z82A 3LT5A 3DZJA 3RODA 3W2IA 2W2PA 5JPCA 3LAWA 1GCAA 1FBTA 4O4LF 1JFSA 4KNWA 4W7SA 3VOAA 2K7FA 4OJNA 1U5AA 2Q0QA 3DP9A 4N7MA 3QOFA 2AN5A 3EVBA 4QYSA 4Q7QA 1DFGA 4HGQA 1D2RA 1FQOA 1PAUA 2GESA 2O8CA 4FC7A 1IULA 2OHVA 1TI7A 2K4MA 2XD9A 3EY4A 4HXEB 1UXIA 4O4JF 5DULA 2OBLA 2EFHB 4MVJM 5I48A 1CS0A 2HN9A 5IYZF 2XMGA 3MJCA 1XD2B 3CF0A 2J59A 3DL0A 3GMTA 1E5LA 1LA2A 4Y6RA 4LYAA 1QTQA 1ECCA 4N49A 3UN1A 4M1MA 2IYZA 1NUQA 3IUEA 4QRHA 4Y2HA 4AURA 4ZZ0A 1Y7PA 5MDHA 1Z18A 5TGDA 1O08A 3G2JA 5AW9A 3GJYA 1RNLA 4LRUA 1JDJA 1RBMA 4K7JA 3ZEIA 5AVUA 4KBYA 1L7MA 1H0RA 3O1IC 4F6RB 4UASA 3BGDA 2JD2A 1IZ0A 5DHFA 1M8FA 2WNHA 3KJGA 2HCJB 3CEPB 4ZQGA 4DFDA 1VE3A 1T6ZA 4DCCA 1EQAA 2B35A 4W9MC 1D2HA 2NSHA 4YECA 4HKTA 4D5EA 2G1JA 5K3OA 1JG1A 3IOYA 5FI1B 2XQIA 3DT9A 3MJRA 1RI3A 4X84A 5DV9A 4ZDIA 3EPLA 1CCWA 4JLBA 2Q3JA 1ODIA 3R6LA 3CPJB 1G7RA 2AIRA 2WVGA 3WNDA 2XAAA 4LWPA 5AK5A 2MYPA 3H18A 1D04A 1TJYA 5EXTA 3EIUA 1GYQA 1LPOA 3ILHA 5E9WA 1ZH2A 1OWLA 1JI3A 1T1JA 2O4UX 4Q37A 5EZQA 3T0IA 4C0KA 2EZ9A 1T8RA 4Q3CA 2F9LA 1ORHA 3DH0A 4DTIA 3NIFB 4U7WA 3SN6A 2JEZA 3OPQA 1T1RA 2P2CA 4JNKA 2LPMA 2E5WA 3HU3A 1D4OA 1EKXA 1YR7A 3KQMA 2C2GA 3HCNA 2ZCVA 3L1HA 1Q57A 4L85A 4UVEA 4HMOA 1Y7LA 4DV3B 4XWOA 1LX6A 4MK4A 4UXIA 1IEQA 4CTOA 4HX2A 4KQWA 3ZIDA 2X2FA 3TWOA 5KTNA 3MB5A 2WJ6A 4KE8A 4W1SA 4MVJH 3IKTA 3KD3A 1ZC3A 4Q3DA 2CSXA 2PBRA 1ZYUA 3BMNA 1JL3A 3QPUA 4QFMA 2D7DA 5KVCA 1L7PA 1QPGA 4D9CA 1KK2A 1Z36A 2IY9A 5EUCA 4A1FA 4CLRB 3Q6MA 4ZHQF 2J41A 1VCMA 2O7VA 2O2GA 4IV8A 5EJIA 4PNHA 1WXIA 4GMFA 1P9NA 3IDQA 1KJJA 4PYIA 1JQKA 1SQFA 3HKDB 3L0IB 1G59A 3O2JA 3TB6A 1E89A 2B1RA 3AFHA 2FPOA 1HE5A 5CLIA 1SRQA 5E6UB 3SYTA 5EMKA 1GAWA 1NSTA 5LB4A 1HEYA 4KI7A 2DQYA 1TF5A 2I7VA 3BF7A 4J2HA 3N5CA 4KAAA 1F2UB 1WP4A 1OFUA 1NQ5A 2DY0A 3M33A 4YCDA 3AMVA 5LVAA 2ZZMA 1JLLB 4PAWA 5J47A 1PWEA 3ABRB 4LISA 4FYXA 2ZXFA 3LPCA 1A97A 2IF2A 2BHRA 5IM5A 1KORA 2YMMA 3X1MA 4PC6A 3ZTYA 5KSWB 3QFHA 4IIXA 3NH9A 5LNK1 3CCFA 2G09A 2Z6QA 3L4EA 1E2DA 2BM1A 5JYEA 3S2SA 4Y3UA 3D0OA 1UMCA 2DFVA 1U8TA 1DAGA 3KR1A 1ZMTA 2EIXA 1T5LA 2BHTA 1Y80A 3PNBA 5DM4A 4R2XA 5B6IA 4GRDA 4GYYA 2IXFA 5FX2A 5B37A 2FPPA 5F2NA 4QVIA 3ZLJA 1UR5A 3SQXA 4R51A 1WP9A 4GKBA 2X4IA 2ECPA 3RJ9A 3BQNB 1GUYA 4KQ9A 4NMHA 5C53B 1RJ9A 1YMVA 2F8SA 3I42A 3BXHA 1PGJA 4D25A 4NCNA 1BXGA 1JWAB 1SBZA 5C3UA 2WKSA 4QXMA 1W35A 3ZHYA 5DHSA 2XLBA 2BI8A 3AJAA 3UWMA 1APBA 4HWKA 1K4YA 3PSAA 2Q2QA 3H2HA 5CH5A 3JWPA 4EW1A 2P2NA 1CUWA 2B6HA 1YZFA 4B83A 2FFQA 5EE1A 4UUNA 1OW3B 2DFPA 2E4YA 3VGPA 3X1ZA 4PYJA 4WQMA 5CIQA 3BGOS 2A6PA 3ZK7A 1PUJA 3IUPA 2WIGA 4G1BA 1ZJ4A 2WWWA 3W5DA 2DHDA 2O6LA 3UFXB 2WZCA 3I9FA 4QOEA 4XYLA 2Y05A 2G04A 1RXVA 1PJ2A 2VJOA 4J0HA 1E3DA 1C5KA 3QENA 1X7XA 2NV2B 3CONA 4BMSA 3AY7A 5ADHA 5LMNB 3SYNA 2GK7A 2VZ8A 4WY8A 2YC2C 5IAJA 1B23P 2CLKB 3CNBA 4Q3AA 1SBCA 1FQWA 1Z7EA 2ZB2A 2FE4A 3ND8A 5DT2A 5A7FA 5JASA 2IS6A 1S8AA 5JNUA 3ZHOA 1T1GA 3G02A 3V8PA 4L3VA 1KJYA 2PRZA 1BMFD 4C43A 3AU8A 4Y7DA 2QT9A 1PYGA 3BMCA 4I3GA 3U7IA 4ALKA 3KETA 2QP4A 3OFNA 2NVUB 4NYMR 1HSZA 1ONOA 4N7RA 1YZKA 1P39A 3L7MA 2Y1KA 5C7OO 1N0UA 3IGFA 2V7WA 1P1FA 1V8BA 2QT0A 2WJJA 3CKLA 3BHNA 3H86A 4GP9A 4QULA 2NU8B 4C7BA 2ZJ2A 2IYRA 1U0JA 3E58A 4LE2A 1TO2E 3W04A 3SHFA 5CDHA 2VBGA 2YZKA 4NDNE 3R5JA 4I9GA 5CG1A 4D26A 1BDMA 3T5CA 1U7OA 4NYIR 3RGGA 4DIUA 3UF0A 1U9ZA 3INGA 1H2RS 1M1ZA 1F20A 4K3VA 1HEIA 1ZVQA 3K94A 4Q01A 1QVAA 4WLNA 3I9V6 3SFZA 2K5UA 1CRQA 2WP8J 2XIQA 2HBYA 2XCOA 2YY5A 2PVPA 1ZD8A 3CGGA 3L1VA 4RVDA 1P31A 2JH8A 1I7DA 3M5PA 4BWGA 3LI2A 1P4JA 3VOBA 1KBQA 4KSYA 2PUCA 4D3DA 5FADA 4CODB 4X54A 1P1JA 1YE3A 3OLXA 5ALKA 3UG6A 3ROZA 2Y1LA 4BGVA 1A5ZA 1QV7A 2P5UA 3AM3A 3WNCA 2WJVA 3ST7A 1SVNA 1K7EB 4M22A 4ZOLB 5IX8A 1GP2A 4F5ZA 3NALA 5C3MA 1ZX1A 5EJ8A 3BZUA 3W9BA 2H2AA 2QN2A 3W8EA 4CTKA 5JXWA 1RC8A 3MQ4A 5EZSA 5AJZA 3TLYA 3ZWWA 1F6BA 2ZK7A 3S68A 4N0DA 4NK4A 3SNKA 4AJPA 4DM7A 5JAMA 2Y6UA 1PNVA 1V8FA 2EJVA 3P0FA 3BQMB 1ZVVA 3IPXA 1O94C 2Z09A 3LSTA 4DMFA 2Q49A 1KFBB 2H9AA 3ESRA 3H9GA 4PR0A 4R0VA 1HT1E 4MCAA 1F2TB 2X6TA 3C3JA 4NBVA 4U7FA 3PNQA 2R8PA 3QWBA 1DNPA 3I2HA 2HADA 4DLAA 1FNSA 2W93A 2W48A 2A78A 1TTHA 4K40A 3QA3E 1WBBA 4ARZA 2EYQA 2AX4A 3ZDXB 3C24A 3WMRA 1K6IA 1PV2A 2DECA 4YJDA 3GQVA 1Z6XA 2OP0A 3R7NA 4L5CA 3ZXYA 3WGZA 3O47A 3INTA 3KFXA 5KNDD 2G3YA 3G5TA 2O3RA 2QRNA 4ZYXA 4R8VA 4ZC8A 5CFRA 3JWGA 4GVPA 5T4BA 5IJWA 3OZTA 4N7BA 2J30A 2XPCA 3NHKA 3AF3A 1YJBA 1BE6A 4PX9A 1ZJZA 4LEIA 1OX6A 1SEVA 3KYBA 4L76A 4MRAA 4BDSA 1Z22A 1E9EA 4NFLA 4D9FA 2IXAA 5IG2A 5KCZA 1M1YB 1JUDA 4K86A 3NQ41 2WR8A 4TLAA 3QJYA 3DFZA 2OZVA 3PF8A 3VPAA 5M04A 1XTBA 4A03A 4EGSA 3OQOA 3U37A 1CRPA 4H4CA 2I7TA 4WXEA 4YK7A 1JHPA 2FRDC 1U4NA 3QVTA 4YRJA 1V43A 4Y2VA 3A28A 4KNVA 5FV4A 2QRLA 3L1KA 3ZY5A 1CDEA 2BMWA 3P9QA 2OZLA 2V96A 3D81A 4IFIA 1XFDA 2LDXA 1BKSB 3K8QA 4EJSB 1ZK4A 2MINB 2F1JA 3R7SA 3VVMA 4D02A 1G64A 1J7KA 4E5DA 2A0FA 1V11A 2HJRA 3B6EA 3M70A 3IVCA 4FCVA 1YI0A 4EK9A 1SXPA 1GTJ1 5K6AC 4ZVMA 1KPIA 2P0EA 4JCCA 1MDFA 4U2CA 1JVBA 1QG0A 3FFXA 3WK8A 4EQZA 3CVXA 2RHOA 3FWHA 1EP1B 1LY1A 2TECE 3FJOA 1JJAA 3PFNA 3SQWA 2HQBA 4X65B 4W82A 4A2CA 4CZ2A 3LKBA 2IZ0A 1VFNA 4HEHA 5DXAA 3IOEA 4QU8A 4ZKDA 1TLLA 3K6JA 2O5RA 4PRKA 1I7CB 4I1PA 1E32A 3EHDA 1UPAA 1IMJA 1GNSA 3SC2B 4ZU1X 1E2UA 1OV6A 5KJCA 3LLVA 3FPBA 4IWNA 3B5EA 4OFBA 4LNUA 5C1DA 4YIHA 5HZMA 4QOFA 1XA3A 2ZRCA 2GM5A 5KOJB 5GGXA 4HWGA 2H85A 2A9RA 1T91A 5GVSA 4LXTA 4O02B 2MMGA 2XYRA 3OPYB 4UHKA 1P80A 3LOUA 1R10A 4XWAA 1XALA 2C2BA 5FL7D 4HLDA 3N2KA 1Y48E 4BWYA 2C03A 3R44A 2FUKA 2W8BB 1PGQA 4KXMA 4L3OA 3PD0A 5JAUA 5MN4A 5E1MA 4ZEXA 4YMHA 2DR3A 4BJ6A 3CNNA 4OHVA 4Z9BA 3O2SB 3D7LA 2AMFA 3OQVA 5I4KA 4IFBA 2E55A 3WE7A 2Q7XA 4N0PA 5DNVA 5LP6C 2BUCA 1FJXA 1UAAA 5JJ5A 1C9JA 1ZJ5A 4UREA 5T3YA 3Q0TA 5GZ1A 5C1IA 2ZB4A 5G4KB 4MULA 4MDFA 4MWSA 2RK6A 4IFTA 2QPLA 3K0BA 5F4BA 3RM3A 4Q9NA 2VWQA 1SCJA 2G36A 4O2BF 2ZTVA 1UWKA 4D4IA 4PQFA 2O19A 3NRBA 3KOMA 3JVEA 3QU9A 2P9HA 5JD6A 4EELA 4RY9A 4DJJA 1PX2A 3IV7A 2VC2B 3B7GA 3EFOB 1NMQA 2ZSAA 2X0RA 1ZWLA 4ZV9A 4F4UA 1GGHA 2GK4A 3MTIA 4MV3A 1NOKA 5JQGA 1P60A 3V6MA 3EA0A 3ZNPA 3R3ZA 2C5SA 2R2GA 2NM0A 3CX8A 3VZBA 4O0LA 1EVKA 3UXHA 5EIEA 3DW1X 1N2XA 2VDNB 3PIIA 3NVAA 4HTAA 4WNIA 1S8NA 4LI0A 4NABA 3SJAA 1Q7CA 5HRCA 3OCCA 1JEQA 4YRKA 3FHCB 2WE7A 1NUSA 1SPXA 5K8LA 4DXAA 4I4TF 4YRLA 4X0EA 4E2XA 1R27A 2FOXA 2IXDA 3UQZA 1CJMA 3AEQB 3KXIA 1QNFA 4MJ7A 1CVLA 3V4OA 3ZDQA 4ASUD 2YFQA 1SG9A 3DXYA 4EO9A 1PW5A 4ZTUB 3VNVA 4CHTA 1XMJA 2JFPA 4HDKB 3QXHA 4EYEA 5BNZA 3B89A 1UF9A 3QK7A 2PUBA 1VOTA 4BE4A 2R00A 1JVNA 3HKCA 1HDYA 4XFDA 5HDBB 4EX7A 5ALRA 5K0CA 4IIDA 1DBRA 3O8NA 2NQ8A 4RDXA 2CT8A 1VIVA 1NW5A 2OBMA 3WWZA 1G3IA 4CKCB 3B1YA 4JJEA 4Y2SA 3ZG6A 2PSEA 4Y2YA 2ZI3A 3BRCA 2EC5A 5BP7A 5JYCA 3HJAA 1ULAA 1XEXA 3D0QA 3G0IA 5EI5A 4JCOA 3HWX1 1MQ8B 3MWGA 3TZEA 2IQ5A 4FFRA 3X2FA 2W42A 2JFVA 2RI1A 4NU6A 5FWXB 4P33A 1Q6ZA 3C8MA 1VCHA 4O2LA 3HWWA 4ZDWA 3UK6A 2H4WA 4X1KA 1E1MA 3ZJVA 2QV7A 3FMOB 3PTLA 2R1TA 3QVJA 1JH8A 4DR2B 4R01A 3NOOA 2I34A 3BG5A 3MTGA 2QPTA 3SVLA 4KXWA 5EE5B 5CEFA 2X9QA 4Z2AA 4MWBA 3FTEA 1DKNA 1VG8A 1VYTA 4YS6A 2DF8A 2YHBA 1XDBA 5BOVA 2L82A 2R8OA 4K9PA 1F60A 4E07A 1THMA 3R3UA 4L07A 3DULA 1Z3CA 5T4EA 5EINA 5IYZA 3RYIB 1ZH4A 3LUCA 1ULSA 1KY4A 2CHEA 4G5SA 2OTCA 4F2PA 3PKJA 1CNFA 1ITZA 2PZMA 4INJA 4PIVA 5CH3A 2M1ZA 1N8NA 5IJXA 4F6LA 4CFZA 1FX0A 4LMPA 2WV7A 1W581 4UTZA 4OHPA 4H3VA 2ATCA 5D87A 4FJ2A 3K73O 1DDIA 4OAQA 4LZJA 3SZRA 3P4XA 2I2AA 3ORRA 1E4YA 2GJ8A 4DCSA 1I3CA 1JPUA 3AI1A 3PUKA 5AI8A 2IDJA 4G0MA 1LV7A 3CF6R 3QVLA 2WVAA 1FUKA 4X6LA 2UYCA 5BW5A 1JU4A 5FLKA 3FOZA 3ZD9A 2VH5R 2I3AA 4YJ2B 4AWBA 4OBEA 1QZ3A 4R2IA 4GMGA 5JYAA 5IUKC 3THSA 1Y34E 2GZ2A 2ABWA 4K8OA 5J43A 1GV1A 2JGRA 3JWHA 3NH6A 4BNFA 1TAQA 1AB6A 3VC3A 3B3JA 1N9GB 4JJFA 1PJCA 4MQ4A 3VR2A 1LU9A 2WD9A 1C9KA 5F9FA 4MRPA 1R74A 4XTCS 4JBYA 4PSAA 4BKRA 4LC9A 4F96A 1OXMA 4BV9A 1GZ4A 3FDXA 4CEHB 3TL6A 1XTQA 3C4JA 3BMQA 4JT2A 4EW2A 3AVYA 2XNSA 1SFRA 3MUNA 4OJQA 3LD9A 4URUR 5AW1A 2CBGA 2CLOB 1I24A 1D09A 1KK0A 4P4TA 3K8OE 1JIKA 1KBZA 1MNAA 1K6EA 5AI9A 3WMEA 2AK3A 1QKKA 1WXGA 1G6HA 2OT3B 4TWBA 4EYSA 1W85B 2UYQA 4N48A 1VYVA 1I4OA 1R0WA 1UPCA 4KR9A 2KW5A 1K3UB 2E5LB 1SUAA 3B70A 3EA4A 2QGFA 3GJ7A 3SVTA 4GQBA 4LF8B 1L7XA 4O8ZA 1NX9A 4C0SA 1I01A 4G8CA 4L73A 2W2MA 1EXNA 2HSDA 2QUBA 1I3NA 2NO7A 4FGZA 1SVOA 2P69A 1HE3A 3QG1A 5KTMA 4LF5B 3H16A 1D8TA 4GL4A 1TW2A 4EMTA 2YIDA 3S0JA 1C1HA 3M6MD 3SG0A 4OSOA 3CV3A 5DLQC 3VVLA 2ZM5A 2ZR0A 2D2IA 5TQ2B 1Z3IX 3DTVD 1XWIA 3IT0A 3RS4A 2R4QA 1ONNA 2C1ZA 4I8XA 1SA0B 1WVMA 3ZGOA 1XKTA 3MLBA 7YASA 1ESDA 1LSUA 1IBLB 4WESB 1H2EA 3O9VA 4J9UE 4J4TA 2EFDB 3WHLA 3WBFA 3DP7A 3D8HA 4RGVA 3SZMA 4A73A 1PEDA 4GPEA 5FNZA 2V5AA 1CJUC 4XEHA 4LAFA 3PQCA 1T4CB 4D98A 3S3TA 2XV1A 4ENTA 1XPJA 3W90A 5EUMA 3AQIA 4U9UA 3L79A 1JR3A 5REQA 1MO5A 5LIPA 5AUOB 4LBVA 4NG5A 4K6HA 3TFWA 1VJTA 4JWKA 4A16A 3G59A 1EXVA 3FWZA 4NNJA 3C6YA 1EFDN 1P0QA 2XJ9A 8GPBA 9LDBA 4DR6B 1P19A 1TTPB 2A1UA 3BDIA 1B2LA 1JHZA 2ZAGA 3AGQA 3PXCX 4KC0A 4MYCA 2QMOA 4RLSA 1A9RA 5DBFA 3INYA 4JFRA 5CLFA 2F43A 1X1BA 1V7QA 2HV8A 3IB6A 3LX8A 5CA1A 1CEYA 3LLSA 5MN5A 5CTJA 3K6SB 4M98A 3ZVRA 1KJQA 2IDZA 3GLFB 1IXSB 5IVIA 5EHIA 1XZEA 1JJ7A 4U7DA 5H7XA 2BBTA 3RWMB 4EEXA 2HO5A 3S7ZA 3UANA 2W00A 3R77A 4NE7A 4UZFA 1C8VB 1CFJA 1W34A 3KR9A 4QG3A 3VPSA 4P36A 3G2LA 1BZYA 3QVKA 4M87A 1MEJA 1SHKA 4IXMA 4DC0A 1Z62A 1AMNA 2AKYA 5T3UA 5HJEA 3EYWA 4HPXB 4DCUA 1PZEA 3RRXA 5ALXA 5C5IA 1R8QA 3UMGA 5A1JA 3TI7A 1M75A 1LEHA 1UC5B 3L5KA 2HA4A 2G9NA 2WFLB 1GL3A 3T7JA 3W1EA 4JSTA 2QP9X 4G26A 4E2ZA 1KVQA 4EKYA 3VHLB 1AC5A 2YJNA 3VR5A 3KOYA 3BWEA 1PL6A 2D5AA 3EN0A 2VQFB 1LDMA 4F4CA 2O2ZA 1NR5A 5JOQA 1VZ2A 1UBOS 4IH9A 5G0SA 4S05A 1QPBA 4JITA 3GVIA 4D99A 3VDNB 5HP4A 1SELA 3F4BA 1YBFA 3IUJA 1FTQA 3CIOA 4OBBA 4YAOA 5EWMB 4FHGA 1SVIA 4DMKA 4E70A 4ZOLF 2HNBA 3OTHA 5M7EA 4RIGA 3FLAA 3LYHA 1RYHA 1GHTA 1KQPA 4M76B 4WI1A 4EF4A 2O2SA 5I9SA 4MNTA 1KPGA 1NI5A 2E85A 2XDQA 2PH5A 4RF4A 4DV4B 2P77A 4ZTBA 4Y2QA 2GEFA 1KGDA 3I2YX 5JEEA 1W29A 3T8YA 2JFXA 4WX2B 5TPZD 3ESBA 1M1XB 3LHKA 2Q28A 4PO3X 1UIRA 4GKVA 4ZALA 1ECGA 4HVCA 3OQMA 4J76A 2VATA 2WAYA 3TW8A 4H3HB 2QSZA 4OB6A 1UFKA 1OGYA 1M74A 5HCNA 3ZE7A 2AQHA 4M0MA 3CT4A 3A4TA 4LOAA 3DZ2B 2HBZA 3V34A 1PNRA 4QXQA 4W9NC 2CFSA 1GCOA 3OT4A 1IBCA 4IHJB 2AFRA 2GT1A 4CMIA 2ZSFA 4ZZIA 3HEAA 2WE8A 1PT9A 1UXGA 2V5VA 3W3AA 4WUVA 2A94A 4L15A 4BX8A 5HX7A 1YO6A 1L4HA 1U04A 4J1TA 1JAXA 1A9QA 1E64A 3KSMA 3QTBA 1CZNA 2FUEA 4MUYA 5DI3B 3R6WA 4LGYA 2WU1A 3PCXA 1OIXA 1ZNQO 1FNDA 1MOPA 1SC6A 1Q1ZA 1U1FA 2CXRA 3DTVB 4QC2A 4UCFA 3N2YA 3ZE1B 4C1BA 5IBCA 5TMBA 5C52B 2IYUA 2GOYA 5LYJA 4R3NA 3O82A 3T9AA 3N8KA 2EFEB 1O8CA 3N07A 3N28A 1IPEA 1PK9A 1TEHA 2MSNA 5LDGA 2XWPA 2CNDA 4QGSA 4PCVA 3K9HA 2NTEA 1OQAA 2ZVPX 2QM8A 4TQAA 3DEZA 2W70A 4BQPA 4Z1MD 1T3SA 2QAGC 2QY9A 3KYCA 4XJVA 2WB2A 3JRXA 2CUNA 4AK1A 4D3FA 1QFZA 2D5LA 3FNGA 1PYDA 5IBRA 2CJFA 2YRFA 4ZAZA 4D9HA 1PGNA 5FUVA 1JEYB 4K9KA 4FPXA 3IBYA 1YWGO 1F4PA 2DJIA 3DDOA 4NCJA 1GTRA 5TF4A 2VYND 2QLJA 2W6QA 3CLSD 3LT0A 3OM9A 4HRAA 3OA2A 1HI9A 1QV6A 2R1VB 5BN5B 1DJMA 1GEGA 1MVNA 2WEKA 3F7NA 4PPQA 1Y9JA 2BTQA 3LYAA 1OJ7A 3KDAA 2FWMX 4RZ2A 3EQ2A 1ZISA 3SM9A 3CTMA 2Q3FA 3OJLA 4D56A 4GIBA 1JDNA 4RETA 3E1KA 1WB4A 2VJYA 1QVRA 4QFBA 5C8YB 1U8CB 4RSMA 3ECSA 3H2JA 4R69A 4G4SP 3AG6A 4TYPA 5FUMA 1Q2XA 1Z68A 3N3AC 4B7XA 5H9WA 2HUPA 3M3HA 2F59A 3EUFA 2A58A 1C4OA 3JQ8B 3VR3A 4LJAA 3QQPA 1X8JA 2GRAA 3KZMA 5BWOA 2FHSA 3DPSA 1LRKA 1NXWA 5FXMA 4OG2A 3R24A 1PS9A 2JL1A 3KWJA 4QE3A 3PFBA 1MC5A 3MA0A 5KBYA 3WGLA 2RC5A 1UJ2A 1H4QA 1KF0A 1LK0A 1Y8QA 2G5PA 4IJ6A 2FWJA 4RKQA 3THWA 3C48A 2HK8A 4DQKA 3WAGA 5CYPA 3GLGB 1LDBA 4JXZA 1E3JA 3KAQA 4BLSA 1DG1G 4X7BA 3ZUPA 4WINA 5K0ZA 3LV8A 1VSQA 3DFIA 2O4CA 3GB9A 4TV9B 4W5HA 1JT2A 1Z6AA 3R9IA 1P0MA 5EJEA 4J0IA 4DF3A 1AK1A 3PEEA 1Y9AA 3DCJA 3I01M 3RUFA 2C7RA 4J1QA 3T95A 4MSUA 1UQTA 5LZ2A 1GYRA 5IKOA 4DE5A 4UPDA 5ADUS 2Q1TA 1VE6A 3OZGA 1KAMA 2Q1YA 1IBRA 4KBGA 4UZEA 3KUXA 4DMCA 2JGDA 3QLJA 5EJ4A 5FUQA 3UPTA 3EK2A 2HCRA 3AOEA 4OJMX 4WNYA 3P27A 1YZQA 4DABA 1QE0A 2YN2A 1GWNA 4ENUA 3GD5A 4UHEA 1L4MA 3WX0A 4IJMA 1K0FA 3HB1A 3HK2A 1SVUA 4Z9AA 1Y8ZA 2GCOB 2NZJA 3DOCA 1MEOA 3I92A 4RNCA 4BJ5A 1EA5A 1XQYA 3OJCA 4TM8A 2QIPA 4PZPA 2BGNA 2EBWA 5IKXA 2YOFA 4B9EA 1E7RA 3EXG1 4FYVA 1JDPA 3GA5A 4ZIRA 3ENVA 3R3WA 3G9XA 3OOEA 1R8YA 2JJ8A 1NU6A 4QGHA 3SR4A 3V7WA 5LZ5A 3D8RA 5BSVA 1WMAA 4YDSA 1N34B 4I2VA 5DCYA 1YZGA 4LY6A 4Z7JA 1D5WA 2AGVA 3OFKA 4F3YA 1U6JA 2P9ZA 1N5MA 4CM4B 4LRTB 1RJWA 2AOUA 1KZ9A 5BUZA 1DX9A 3IHKA 3QLEA 4RHXA 3OF5A 3EZ2A 1YC2A 3KQPA 4YJFA 4ZO9A 5C81A 3AKZA 4L08A 3KZCA 4Z0NA 4JI5B 1OLSA 2PKXA 7ABPA 5EIOA 1LBQA 4Z8XA 3RS7A 1NTOA 4Z54A 3CBQA 1LLDA 3HDVA 1WCV1 5EESA 2O57A 4TZTA 5G4LA 3FY4A 3U61B 3HG7A 5HW0A 2QRGA 2PUAA 1YASA 2V58A 2EZTA 4ZAWA 1S0UA 2JDID 4CF7A 1RM5A 1DRUA 1E3WB 2QUIA 5L4NA 3VPCA 2I7XA 2RGWA 4BMDA 4JT4A 5KHAA 1A69A 4KIUA 4M0LA 4NJEB 1BCSB 5LZ9A 3KAKA 1L3BA 4IR7A 3AILA 4ILKA 2OL4A 4E4TA 3BJIC 3PEYA 3TVTA 2AXNA 3RQSA 2VHJA 3L8YA 3PL1A 4E22A 1O2DA 5JDCA 3GAMA 2CJPA 1QX4A 1X39A 5A7HA 4P5DA 3A1EA 3A2NA 1V3QE 1TF7A 4MITA 3RHFA 1DO0A 3C1TA 1A5SB 4TQUS 1OIWA 4P3XA 1EG7A 1ZHHA 4WZBA 4KPYA 4UHJA 3EMDA 1MB0A 3NBAA 1Y82A 5E1BA 1RYFA 1IOLA 2J45A 2P7IA 3E05A 3CUSA 5K8TA 3TKLA 1RWWA 4A3SA 1EWKA 2HFKA 3ETCA 2VJCA 3K2EA 3MT7A 5HA5A 2WDZA 2XQFA 2VAVA 2IYFA 3OU2A 4G8JA 1HYQA 2GEDA 1BA3A 1RRKA 4XXHA 1ABBA 4B17A 4JJZA 4JXXA 1GNTA 3DZGA 1BCRA 4UVGA 3RTBA 1JKJA 5AKYA 2H1RA 1UAGA 4YY3B 1ORRA 1XE3A 5GY7A 3TXAA 4EG5A 2NMVA 4RD4A 1RXSA 4D97A 4BEVA 1YDWA 1DWOA 3DKRA 1QH8A 5B3JC 2OG1A 2FMKA 2DPLA 3K70B 3SJ7A 3IP1A 1FDTA 4B3HA 4ZI7B 1U7DA 2X5JO 2JIPA 1ONSA 4RPLA 4LFBB 2OCKA 3G5MA 2RAFA 4G0YA 4O29A 1MQAA 3K30A 4PNEA 1R9JA 1W6UA 1WXEA 5B7QA 1KA9H 4O5OA 2AMVA 4FSDA 3CPSA 13PKA 3C2QA 1L5YA 4FGWA 3WGOA 2BFFB 3OKAA 2V65A 1YC5A 1RQ7A 2ZREA 4DV1B 4NESA 4QDOA 1EVIA 1IVYA 1L5ZA 2ATVA 2ZR9A 4B6SA 2A0WA 4XUEA 1G1MA 5DYYA 1AS0A 3GLHB 3UAZA 4YB8A 3NNSA 5EIBD 4PLVA 1RTKA 3CINA 2D7JA 3F5DA 3L07A 3NG1A 3NIDB 5ERYA 4AYWA 3FMFA 5EG5A 4AO8A 4BAGA 3W6UA 2ZE5A 1SXHA 3LK6A 2K2WA 1WQ3A 2YXLA 4IDCA 3SHVA 1KR5A 3V32A 2VPPA 2WJWA 1A8IA 2PG3A 3TD6A 4TN1A 4D74A 1THTA 2RCNA 1D7AA 2XMSA 5AXDA 2QRUA 2Z3WA 4QWMA 2OHFA 4NU5A 4YMGA 1B26A 2D8MA 2Q3BA 1O97C 2JLAA 2PT6A 4I1SA 4P80A 4QU5A 5KYVA 3ZYCA 5EKXA 3NTQA 4BGIA 3WB9A 2H08A 1QOQB 3GJTA 2W6IA 1PR0A 1NBMA 2JF0A 4AJEA 1SVWA 1J23A 1USGA 3NV7A 3OCXA 2DCUA 4L2IA 3IQFA 2GCEA 1RYNA 4QTZA 3OE4A 4DA0A 3T5AA 4BUZA 3KJEA 4QREA 4TL9A 4PQRA 5DO9A 3TSYA 3LC0A 1N92A 4H1TA 5MFZA 4FMDB 4NZNA 1XLTA 3B2QA 1GADO 3IBFA 2PMKA 4AY2A 2BFBA 4ETNA 1AGNA 3TNFA 4N3AA 2HQ1A 4KQKA 3S6JA 4H18A 2OGUA 4D43A 3ZY3A 4YGYA 4BU0A 1GGNA 1WSBA 1UC8A 2VHVA 3GJ3A 1ZIPA 4OLHA 2O8EB 2BDUA 4PANA 4RD1A 1BE0A 3P97A 1RLJA 2X6RA 4CM8A 4MVJI 4DV2B 3N75A 1R6BX 2WWXA 2XBLA 2VZ9A 3NEYA 4R8SA 2OCAA 2YW2A 3LIIA 2EXXA 4ALLA 2ANCA 1YJAA 2P5YA 3W6ZA 1W2GA 2ZB8A 3E5HA 1G42A 3PF9A 1KFKB 5CHEA 2C8LA 3O4JA 1QAQA 2NW6A 2A4MA 2FNAA 1FMCA 4GR4A 1LI5A 2OBNA 5BXYA 2HTFA 1EX6A 1YGPA 2P1DA 2ISCA 3JSXA 4YJHA 4BMCA 4CUJA 3A04A 3L3BA 3EOAI 4IGIA 4J3JA 4UDYX 2C88A 2ONJA 3DZHA 4PBRA 3WZ2A 4M9SA 3UKOA 1GCIA 3AF2A 2XTJA 4IIUA 3V4FA 3IESA 2H92A 2WYOA 4B87A 4REMA 2CW5A 4OHMA 2O2HA 3FSRA 1DJLA 4X8MA 2VUIB 3Q8KA 2FSVC 2NQTA 1TMYA 2CXHA 2LUOA 3ZS8A 4IIGA 3FR7A 1GLGA 3OOWA 1XEFA 1I4EB 1JFLA 2P2YA 3R4CA 1NQUA 5ISMA 4UARA 4CNBA 2O50A 4HLCA 4NHOA 4NV0A 4ROSA 2L0XA 4D3YA 1OTHA 3PIDA 5G1NA 2Y1GA 3TSAA 1QHYA 2GAOA 3W34A 1A9XB 1G60A 1RKBA 3GDOA 3DZIA 4CBVA 2X3UA 1YRAA 3PDJA 3OT1A 3A6FA 2NZVG 4KDRA 3TX2A 1KJWA 2QA5A 3QPCA 5EXPA 4MV1A 1Q3KA 3GFRA 5DM2A 3D6MA 1EK2A 1HV8A 1ATZA 3IUSA 5IJ9B 4V3CA 3E2IA 3PWZA 5JMOA 2BV3A 3KQQA 1U3FA 1E3SA 1YDHA 1JN0A 2YFYA 1K4MA 5IF3A 1SU4A 4IIEA 1NG1A 1SM4A 5AW8A 5I01A 3VVBA 4DA9A 2BRUC 5KNBH 1B3RA 2AS0A 2BFCB 3CX7A 3T5PA 1QC5A 4W1RA 1VPVA 2PSJA 1SCUA 4ZREA 3BFJA 5KC9A 5JO9A 3W8FA 3GZ4A 5K01A 2GD1O 1KC3A 3EZFA 1IN4A 3BJZA 2VRCD 3N2IA 2ZSKA 1RZRD 2AB0A 1NMYA 1F9AA 3OMXA 2O0MA 3HCBA 5E3HA 2XYVA 1KOJA 4JNCA 2NVUA 2BPOA 2CWWA 3EC7A 1QDEA 1SXJE 2JHFA 2GI4A 2CLMB 2F6RA 4WNAA 4BQIA 4WXPA 4YO7A 5BUQA 3DDCA 2IYPA 5SY9A 1HEUA 5IANA 3S8EA 1G2IA 5HKKA 2RHHA 3EX7C 1OX5A 3IDFA 1Y4DE 1QNLA 3FSGD 3ONNA 2B4YA 2HD4A 2FP4A 2W2QA 4YFVA 3YASA 5LDHA 5TVOB 4RKEA 1Y7IA 4AI6A 1NVFA 1ZIXA 2EYUA 1DKMA 2IEAA 2B4AA 2NZ2A 3H2IA 3N0TA 4TRMA 1L5KA 4L5JA 2FWPA 1Y63A 1FLAA 2I4NA 1D2MA 1SOWA 2GF2A 2PL3A 2QSYA 3AZPA 4NENB 1TRHA 5T4HA 4UFOA 3I2KA 3ZOZA 1LFDB 4X7MA 5DASA 4EG7A 1GUBA 2ZAYA 5CTAA 1T5IA 2YY6A 3EXEB 3RSSA 3PL5A 2IW3A 3HRKA 1A4XA 4PG7A 2JPDA 4YALA 1ZJ6A 5FA8A 2FLVA 1KJZA 5JSZA 1KSFX 3ZLUA 5EXSA 1M66A 4FC6A 2GN4A 1NDQA 1YB6A 4IHJF 1B8PA 1R8XA 5CCBA 2WMYA 1XCOA 2HH9A 4V0RA 1BXKA 4LVNA 4AUEA 1RAIA 4MMXB 4HGYA 2D62A 4LUCA 3WWYA 2O2IA 4YMUA 4RE6A 5GONB 4WLUA 1SXJD 1R16A 2IHYA 2FQQA 3PLNA 4L78A 2ECOA 1NFFA 2A9FA 2WPDA 3U26A 2B98A 1N5LA 3EZ7A 4QXRA 1DQZA 4XVHA 3WRXA 3ZGLA 4MQFA 3FIUA 3EG9A 2P2LA 1FUUA 2UZ3A 4BXOA 5K8IA 3DMNA 1BX1A 2RGYA 4RHUA 4H1UA 3VR6D 2VDKB 4D4LA 3FCXA 5EFZA 4BECA 3UW3A 2H4YA 2RBGA 4MDEA 2FRXA 1ODFA 1WLYA 3A0UA 1Z5NA 3P9RA 3HP7A 2FG7C 4NJMA 4R0MA 1IPFA 1AURA 1GLVA 1CVRA 1QJCA 1C7IA 4YV7A 4KDCA 5KWEA 2X2EA 1EWYA 2HV9A 3DPUA 2QBYB 2Y66A 4KYUA 4ICIA 2PEYA 3GJZA 4GOLD 1M2NA 3B1WA 4KQFA 4NZ9A 3AUJB 3OSUA 3VU0A 4DTCA 4PR3A 1USUA 1PQYA 4D57A 3PC7A 1T4MA 4L6AA 1G291 2AJDA 2BE9A 2KWIA 3GFGA 3W6OA 3Q6IA 3ZV5A 3I62A 1N6IA 2A2ZA 4HL6A 2XQVA 3EVAA 2W6CX 3GT3A 2HJ9A 2WU0A 5AR1A 3R5TA 1A7UA 3SHQA 2EFCB 2NTNA 3L0PA 1Z0SA 5SYAA 1JAHA 3KHUA 2F1OA 4QL3A 5T5QA 4ER7A 5ENDA 3PC6A 4EA9A 4KP7A 1NR7A 2CD7A 1YHZA 2ACVA 2GJSA 2XR1A 3ISTA 3OZIA 4L27A 3FVRA 3RVRA 3WRWA 4D44A 1GXSB 1YB2A 2OYRA 5D8DA 5M2QA 2J4FA 4BKQA 1QIDA 4IOMA 4F06A 4ND5A 3VYSB 3IAEA 2ZQ5A 3IJ5A 4F6CA 1NY5A 3HADA 1AUPA 2VF2A 4FKZA 4EWLA 3AY3A 2R68A 4GXQA 1T3GA 4KMRA 1BEEA 2Q5HA 3STHA 2HMVA 2EFJA 2D6FA 1HQDA 1HFJA 4LC1A 3SDSA 4BMYA 4US2R 3UO8B 2ZIVB 3EVTA 2VDLB 5EMNA 1UMKA 3KT0A 3NBYC 1FP4B 1K2WA 2PS0A 4PZ0A 3L7JA 3OOSA 1T9ZA 5BSFA 3ANLA 1SKAA 4IIYA 2FH5B 1LQUA 3S5UA 5DP2A 5JO0A 2OE2A 5HMMA 4QPNA 2XUPA 1EAYA 2LP4Y 2G83A 2BISA 4K9RA 1BMFA 4F4FA 2X23A 3KHKA 4TV9F 1V9LA 5BR4A 1X6VA 1YDGA 4G0ZA 4LQDA 2Q4RA 2REQB 2BVNA 4Q9KA 2ZYIA 3CXUA 3S99A 4O3MA 3GZTB 2RGGA 4C5BA 2VSNA 3NT4A 4KGZA 1N1EA 3LLCA 2H4XA 4RFSB 4DUYB 4KO2S 4OGWA 2D2FA 2X8LA 2A0KA 5LZ8A 4DCGA 3FDFA 1XT6A 4QKQA 3U4MA 3KELA 1KJNA 2GD6A 4WA8A 5CH8A 4G56A 2CNKA 1KSHA 3V48A 2DH5A 3U7HB 3LXMA 1VMDA 4MVJD 2YYZA 1DBVO 2C83A 3H17A 3WNQA 4TYQA 3MVEA 3OTGA 3ZV7A 1KU0A 3WXMA 4MKFA 1NLZA 4J0QA 3LF2A 1SIWA 4B6GA 2CXOA 5D51S 3J81A 4YTEA 1SQ0A 3D54D 4R9RA 4R9SA 1GJRA 1DRWA 1N2OA 3MWFA 4MS1A 4F04A 1ZUD1 3MG9A 1NVGA 1LTKA 4MUIA 3V1TC 1EGAA 1C81A 1IC6A 3T7AA 4EPXA 3NUZA 4PS1A 2R87A 1PBTA 3VZSA 4K6KA 3OFJA 4C4S