1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
3DOOA 3CH6A 3GUCA 3HDHA 2AEFA 2CZCA 3GEDA 2Y0EA 1XKQA 1P1IA 3KHUA 4IDBA 8ADHA 2DBVO 4WNIA 1KBZA 3H9EO 4J1TA 4BVAA 2JL1A 2PGLA 3TSCA 3ZHBA 3DONA 2OGUA 4IGEA 4B7CA 2ZIZA 2NTNA 3MJSA 2VCYA 1VPDA 1WMBA 3GH3A 4BGVA 1EBUA 4FGWA 3C85A 3OBBA 4CL8A 4QEDA 3FTPA 5IAAA 2D1YA 4CV2A 3LF1A 2F00A 2XAAA 1ZMOA 5A1TA 1HDOA 4IDCA 5F5LA 1I30A 1XA0A 5DF1A 4AJIA 4AJLA 1XHLA 4JJFA 4GGOA 2NSDA 3HFSA 3PWKA 1JWAB 3ONDA 5DBGA 3DZHA 1AHIA 2UUPA 2GN9A 2YW9A 2E82A 2WE7A 4U0JA 3DQPA 4BKUA 1R4MB 2Y1EA 3H9JA 5CFZA 3QWFA 4TSKA 3WGHA 2YY7A 1EZ4A 4L73A 2DPHA 5FI3A 3RBXA 1NPYA 3ITKA 3OQBA 1I2BA 3NUGA 3OA0A 3GDOA 4I8XA 3WGOA 3DHNA 4J4HA 2GASA 1ZMTA 2J5RA 3JV7A 3VVCA 3I5MA 5L53A 4YAKA 1PZEA 4B8ZA 1UZNA 1WZEA 4YA6A 3I3OA 1EVYA 1LDEA 3DOJA 4WCFC 3T4XA 5LDGA 2B83A 1D1SA 1RM4A 1WP4A 2A35A 1ML3A 2PTGA 1DAOA 4AJ2A 4CLOB 3ZU5A 3FPLA 4KTTE 2DKNA 3NTQA 2BFMA 4OJNA 1TVEA 2PNFA 1PJSA 2ZTVA 3UCEA 4DYDA 2O23A 5A3JA 1UUFA 5THQA 1ENPA 2GZ1A 4NFSA 4CLHA 1B3RA 3E5MA 4RQTA 1E7MA 2Q2QA 1UXGA 3GA0A 4LVCA 4TRMA 5FI5A 4DPMA 4FSHA 2NU7A 3PHLA 1GV0A 2Q1SA 2DUUA 3ZN2A 3RUHA 3QVWA 3ZWMA 4J2HA 4MVJP 4Z0TA 3BYZA 4P38A 3K96A 1YONA 2PKRA 1HZZA 5MGBA 4PLTA 2X5JO 4GKVA 2LDBA 3OQ1A 3GG9A 1E3IA 1XU7A 2B5WA 1GQ2A 4YAIA 2VNSA 2ZB4A 1EQUA 4X54A 4J49A 2CVQA 4MVJD 1B26A 1R6DA 4NFHA 3CMCO 3GVPA 1UZMA 1QG6A 3OMLA 4YAEA 2J3KA 4DVJA 1TLTA 2WYWA 2X4GA 3IKTA 1SZJG 1YBMA 3WJ7A 4W4TA 3RWBA 4FFOA 5KVSA 1B3BA 4L8VA 3K73O 2EGGA 4OIMA 2WTBA 1EBFA 2HK7A 3EVTA 4XGKA 5JDCC 5EN4A 5IN4A 3NJ8A 3OJ0A 1Y6JA 4WLVA 2FR0A 4BOYA 1A5ZA 4ONEA 2OL4A 3C7AA 3E48A 5BNIA 3QIVA 5KJEA 3H9UA 1P74A 3A9WA 2VOJA 1PGJA 3EYWA 2NTVA 1QYXA 4AJPA 4CM3A 4YYZA 3ZW8A 3ZV3A 1BXGA 3DZGA 3FN4A 5BSFA 2BELA 3FPCA 1QXSA 2C82A 3HDJA 4IQ8A 3DBLB 4RGBA 1ZZEA 1L7DA 2D0IA 3WSWA 3H4VA 2W90A 4Y6RA 4ALJA 4NU5A 3GRKA 2H1SA 4DLAA 4AJ4A 4WNCA 5COBA 4ND1A 1V3TA 3PRJA 1YXMA 4R9RA 1EEHA 1GEGA 2VRCD 3ZHZA 4INAA 3S2EA 3ZWYA 2EP5A 4GX0A 5JYDA 4E2ZA 2I3GA 3E9NA 1ADCA 3ZWAA 2CD9A 3V2GA 4W9NC 3EY4A 3WICA 4Q39A 3V1TC 4Z6KA 1AE1A 1Z7EA 4R4JA 1WLYA 4UVEA 2IEBA 4FQ8A 4AJ1A 1M76A 5KCZA 1LDYA 3IKVA 4AG3A 5DCYA 4B4WA 4CMGA 5JDIC 2IZZA 3NDIA 5JBIA 1Y9AA 2GZ3A 1UZLA 2HMSA 3BMCB 1ZFNA 4ALMA 1GZ3A 3ZU2A 3H65A 4XB1A 3WGQA 3R6DA 3GN1A 4BO1A 5ITVA 2AQ8A 3U4DA 1UP4A 2GD1O 1YDWA 3NDRA 2NU6A 3JQEA 4BHTA 1GZ4A 3NGXA 3MCVA 4PLVA 3LVFO 1JLLA 3UF0A 2NACA 3D3WB 4HNHA 4TRJA 3IP1A 3EW7A 3OM9A 4C7KA 3DZJA 2RBEA 4G2NA 1ADGA 5T73A 2I67A 3QP9A 3GPIA 5EQFA 1ULUA 5IXYA 2F1KA 1RKXA 2ZTUA 3I9NA 3H9GA 3ZWPA 3L4BC 1N1GA 2I3AA 4U5QA 5L4SA 2HJRA 1DLIA 3GDFA 3JYPA 3R1IA 4RPGA 4DRYA 2Z5LA 3AI1A 2E6UX 5U9CA 4CM4B 2V6MA 1GAEO 1BDMA 5AXCA 1HSOA 1R4NB 1XELA 3DBRA 2OHXA 4Z0HO 1N7GA 4D41A 4BNVA 2DT5A 2PWZA 4NBWA 3ZHXA 4IZHA 3U4IA 3HUDA 5A05A 1E1NA 1KC1A 1KEPA 4GX1A 4UUOA 3A1NA 1VJ0A 2AQIA 3EZYA 2CMDA 4XYEA 1DC5A 5T6BA 4CQMA 3GGPA 3WTCA 4BO9A 3V5NA 2AXQA 3QHAA 4XDZA 1D1TA 5ES3A 4NDNE 3GVXA 3DDNA 2FR1A 3D4PA 1IE3A 5G0WA 3Q2KA 4J7UA 4YJFB 4J43A 4TKLA 2BRUA 4CM8B 4YXFA 2NNLD 1C14A 4EUFA 2R6JA 1M2WA 3N74A 4CQLB 3WTBA 4MVJM 2DM6A 3GNSA 4QQRA 3INTA 3UW3A 4K28A 3WYEA 4E33A 3WNQA 1NQTA 2JD1A 4HP8A 4RF4A 1UDBA 2I65A 4LMPA 2X0IA 2NVWA 1NYTA 2HLPA 3GMDA 1LQTA 3VOSA 3UXYA 3DEYX 1M67A 4NU6A 2TMDA 4YT5A 4IXTA 4A5OA 3EMKA 3ZU3A 1C0PA 3R0IA 2PGJA 5K6AC 3L0DA 3KYDA 2QYSA 3JD0A 4JK3A 3TWOA 4CJXA 1ISIA 3GQVA 3ANLA 2DTDA 1M75A 4JJIA 3PGJA 3OETA 1N9GA 1P0FA 1A9ZA 2D8AA 2BFPA 5CDSA 4I9NA 3PZRA 4OXNA 5JFOA 4AFNA 2AEJA 1C1DB 1MC5A 1XCBA 3IDSA 5AXDA 1AXEA 2VHXA 3LDHA 3TDKA 4E5NA 4Y8VA 2CSUA 3FWNA 3E9QA 1ZXBA 3VDRA 1QYWA 3I9JA 4YCAA 4JBGA 3BTSA 4IDGA 3DBHB 4B79A 1QORA 3KB6A 1YWGO 1BMDA 1BWSA 3EC7A 1EVZA 4MVJE 2CY0A 5THKA 1MG0A 2YQ5A 2LDXA 1VC2A 4FB5A 3GF4A 2JKVA 2P2SA 4NH4A 1DIRA 3VH4A 3RKUA 2B4TO 4OO3A 3RJ9A 3QW2A 1DC6A 4QSMA 3JQAD 2Q49A 1HTBA 4ZU3A 3RUFA 1LA2A 3BXXA 1MX3A 1U1IA 3MEQA 4OMUA 3TOXA 4BGEA 3DBVO 3C1TA 4OSOA 4XQEA 3PWZA 2J3JA 4B3IA 4ZJUA 4E5MA 2I99A 4XKJA 3H5NA 2A94A 5HRUA 3OHSX 4Z9YA 3RUIA 4WK6A 3S2IA 1B14A 1HE2A 2C7VA 4BNGA 5BQFA 2ZCUA 1KEUA 5CG2A 2FSSA 2C2YA 4I9UA 2PZMA 3TL3A 3MJVA 4FC6A 1Z82A 2Q46A 5C3MA 4DQXA 1ZUD1 1P31A 4OOEA 1HDYA 3ZU4A 3Q0EA 1NASA 2Q3EA 1PJ2A 4FD3A 2DTXA 1X7DA 1KIFA 4FOOA 4Y6SA 3RU7A 3AUAA 4IUYA 5EPOA 1SEVA 2AE1A 1DC3A 3I9KA 3QLJA 4GPD1 2PLAA 3DB2A 3RASA 4D7AA 5I9LA 3ULKA 2Y66A 3QJ5A 4CR6A 1YRLA 3QVSA 4F46A 2PK3A 1D8AA 2YDXA 4M55A 1YJQA 1I33A 2X0NA 3PLNA 4GVLA 4NIMA 3GVCA 1U9JA 3KYCB 2WM3A 4WLNA 2DLDA 1NQ5A 1I10A 2PH5A 3L6EA 4NBTA 5TJHA 4L75A 4E32A 3VPFA 2YDYA 4B7UA 3DOCA 3GC6A 3GZNB 2OUIA 4PVDA 3P2OA 4RJTA 2CF5A 4KUHA 3U09A 3VVBA 2IE0A 1M6HA 3MJEA 3RUCA 1Y8RB 1T2CA 4PGFA 1R66A 1IY8A 3INRA 3LK7A 3DR3A 4XA8A 1TT7A 1PJBA 2JD0A 1RM5A 3H9QA 3RIHA 4FFNA 3DAPA 5TIIA 2D5AA 3I23A 3BMOA 2RH4A 4HFMA 5TS3A 2RCYA 5ILGA 2YV2A 4CLXA 4O6VA 2OZPA 3LT0A 3K5PA 1QMGA 3QV1A 5A02A 2X23A 1IZ0A 1ORRA 2GGSA 1NX6A 4IJKA 3W8DA 3W4KA 3HFGA 1Z75A 3HQ4O 1YQDA 4JQCA 1VL0A 3GAFA 4MOWA 5BNTA 4GQAA 1X7HA 1EFKA 4K9DA 2IYOA 3I6QA 3ROKA 3AY7A 1GY8A 1Q7BA 3F9IA 4DIFA 1Q7GA 2C59A 3TPCA 3C3XA 3TFQA 2A9FA 7ADHA 1LSJA 2P9EA 2ZQYA 4BMNA 1P45A 1CWUA 5ILOA 5C37A 5T57A 4P22A 3TFOA 1IZ9A 5G0VA 1VE9A 3Q6IA 5DCWA 3L77A 2WJPA 4HY3A 5COAA 3VZPA 3TQHA 1NTOA 3PXXA 4JIGA 4RVDA 2IXBA 3QWHA 5JYEA 4TMFA 5GZ3A 4YACA 4XYLA 1DEHA 4BV8A 5JC8A 1Q0QA 4B7XA 3ANMA 4RDIA 1PWZA 5FWNA 4HFNA 1W6UA 1GUYA 1EK6A 2PD4A 2R2GA 3U9LA 5IG2A 1ZXLA 4ND5A 1ZEJA 4NZ9A 4ESOA 4GI2A 2R00C 3PHGA 1JQBA 2DVMA 1B0AA 3L6OO 1G1AA 3TF5A 3WDSA 4NPCA 1T4BA 4WPGA 3C1AA 1O94A 2DBZA 4OAQA 3WJAA 4EJ0A 4I1IA 1U8FO 1RM3A 2VWQA 2VYVA 3HNPA 3W8FA 1EDZA 1NR7A 2O3SA 1BW9A 4RPHA 1Q7CA 2C2XA 3C7DB 3M6IA 1NHGA 3CINA 3WBFA 1I3KA 3DAGA 2NVBA 1IHXA 1GR0A 5F5NA 3AU9A 1X7GA 4MVJI 4BO4A 1XDWA 1QV6A 5CPFA 2ZCVA 1T2AA 4A27A 3D7LA 2XPCA 1PQUA 3VTZA 1NVMB 3FR7A 4TQGA 4HADA 3WYCA 2NM0A 1WPQA 4II3A 4RZIA 4ZRMA 4CMCA 1AGNA 2G0TA 4IJVA 4OYRA 1Z6ZA 2H9IA 3EVNA 1T26A 3OQ6A 4PZCA 2JAHA 2BGKA 1MGOA 2VUSA 4YJHB 2O2SA 4F6LA 2D4AA 2NVUB 4PLCA 3VPHA 3G3EA 3TZCA 1I01A 4PLGA 6LDHA 3ZNQA 4CR7A 1C0LA 3WGGA 5IDYA 3INGA 1X1TA 3OECA 4CLOA 4XR9A 4PG4A 1SMKA 2VZ9A 4DPLA 3DMYA 4MKZA 2CVZA 3GVHA 4OKNA 4R3NA 3KRTA 2VT2A 2W2KB 1DFHA 3G1TA 1HE5A 3QSGA 4ILKA 1I24A 4UULA 2CFCA 4J91A 3WS7A 4KZPA 3JQBA 1EK5A 3ZWVA 4GLLA 2Y93A 1PZHA 2HUNA 1P1KA 1GQYA 3AK4A 4CM7A 5IDWA 1PS9A 3E8XA 4Y6PA 4R1UA 2I9PA 3JYLA 3JTMA 4TVOA 1CEQA 5JNLA 2BF7A 3UAGA 4CUJA 4WEQA 4CLRA 1JDJA 1HYEA 4MO2A 5ER6A 5G4KA 4N18A 5JY1A 1H6CA 1B8UA 1GV1A 3ETDA 4NFYA 4CL3A 3D64A 2QZ9A 3AM5A 3O26A 4KDFA 2G17A 1LDGA 3LF2A 5JMWA 5JW6A 1WAMA 3FNFA 1IULA 4DLLA 5A3VA 3VDQA 1ISJA 1LLDA 1PS0A 1HLPA 2W4QA 3JQ7A 5T5QA 1IOLA 1VLLA 4Q3CA 1QYCA 3F5QA 4ZICA 3FF4A 5M6DA 2P4HX 1W73A 2B4RO 3F47A 3S8MA 2OMEA 4BNYA 4YT4A 2QRJA 2POQX 3VPXA 2Y0DA 3L9XA 1PQPA 4DWVA 4FCCA 1WDKA 1KS9A 3GG2A 1NVGA 1XSEA 4XR4A 1XU9A 4JP2A 3QRWA 1T24A 5IN5A 3OJEA 2VN8A 4KWHA 2C54A 3GHYA 1LQUA 5KTKA 1SNYA 3RUEA 1DLJA 5GZ6A 3DBLA 2VWGA 3ETGA 1VJTA 1JKFA 4BO2A 2HO5A 2Y67A 3Q1LA 1HZJA 3OP4A 2FHSA 2W8ZA 4XGIA 2J8ZA 4QUKA 4HUJA 2E4AA 5EMHA 1N5DA 3TZHA 2VRCA 1WDLA 1ZVMA 3LSYA 3K2EA 2IODA 1V9LA 5T64A 9LDTA 2HMUA 5COQA 2H5LA 1ZCJA 1UDCA 4KQWA 5CEEA 2QRLA 4BNWA 3WQQA 4QO7A 3FHLA 1KOLA 1HDGO 2Q1TA 3BIOA 4GLOA 4A03A 3A28A 5KOIA 3FNEA 4IZIA 4PG7A 4JXKA 1PWXA 1E3SA 1I32A 3EK2A 5IZCC 3VZQA 4FIZA 1BGVA 1HSZA 5KVCA 2EEZA 3PWSA 3AFMA 3AM3A 2BLLA 3AJRA 1ZSYA 3GLQA 2HRBA 4CM9A 1XGKA 1RM0A 1DBVO 4XGNA 1P9LA 3C24A 2O3JA 1JVBA 4BNZA 5CPBA 3WYBA 1WNTA 1KVQA 3JQAA 3WIDA 4DC1A 2DBQA 3SXPA 1E92A 3OJLA 2HJSA 7MDHA 2HK9A 5EERA 5T67A 1S7CA 1KEWA 1Y8QA 5KJCA 3DHEA 1RPNA 1Y7TA 4ZQBA 3Q2IA 2X5KO 4DBVO 3KETA 3S55A 1CIVA 3C7CB 1VRWA 3TJRA 2Q45A 5BSEA 3RC7A 1F14A 3NAQA 3KSZO 3JQDA 5L7TA 1PSDA 3VH3A 3WFIA 5JCJD 1PZFA 2UVDA 2Z95A 2NADA 4NJMB 2E37A 3G1UA 3P2YA 2J5QA 1N7HA 4G65A 2JCVA 4MP8A 5TC4A 1LDBA 4ID9A 1T1RA 4FGSA 4R41A 4BNKA 5IZCA 1HDXA 1QR6A 3CMMA 1VSUA 4HV4A 2PY6A 4P4GA 3DZBA 4BB6A 2AEMA 1EE9A 1X1EA 4H15A 3TZ6A 3KV3O 1LJ8A 4MPDA 3GZ4A 3PHHA 3E03A 4LISA 2GYYA 3KSUA 1ISFA 4BNLA 1IB6A 3ZWBA 2FN7A 3GGGA 3NRCA 5A06A 1CETA 2ZKLA 4Z3DA 2RHCA 1C0IA 3NJ4A 4YB8A 3NTRA 5TLSA 1YL5A 4W7HA 2VQ3A 4YJFA 3BTUA 4CM8A 3ZNPA 2A4KA 3VC7A 1LSUA 1PQWA 4NR0A 4BO8A 2EW8A 2FPIA 4DA9A 1NR1A 1EUDA 4M87A 1H9BA 3PQDA 4DC0A 3P19A 3W6ZA 4XB2A 2VUUA 4M49A 4RQUA 4FFPA 3PDUA 3RSHA 4UVHA 3VPGA 1ADFA 4MVJF 1V35A 4D43A 3U5TA 5L95A 3HDYA 2D2IA 3UH1A 4MKXA 4CM6A 3LT1A 3ONFA 4BO5A 5A9SA 5JCXA 3ZDFA 3DZIA 5ICSA 2FSVA 3HWRA 4H16A 3MJCA 2A92A 3R3SA 4ND2A 4B8WA 1LI4A 2ZTMA 3D4OA 3V8BA 2TMGA 4WCFB 4E5KA 3KYDB 4WJZA 2EKLA 4ZA2A 5A5EA 3ZHYA 3Q11A 1RYDA 1ZK2A 1O95A 3EUWA 2Z1MA 3RFVA 2W2LA 1ZJYA 4O5OA 1RJWA 4WOJA 2QRKA 4R1SA 3KLPX 1U3VA 3WXBA 1SCUA 2P4QA 1FDUA 1R16A 1C1DA 2FZEA 4CM5A 4N5NA 1ZW1A 4UUMA 4NK5A 3WMXA 3RBZA 1NQAO 1IHYA 3FCOA 3OIFA 5TX7A 1NFRA 1C1XA 3HADA 3Q9UA 4YTEA 5HA5A 3GK3A 5DOVA 5B4UA 2FP4A 4LRSB 2ZJ0A 1DXYA 1JAXA 4PG5A 4LW8A 3V1YA 4RCVA 4GX5A 1YL6A 1ZEMA 2G1UA 2CNBA 1DHTA 3PHJA 3SJ7A 1ZK1A 3DBHA 4Q9NA 3OIGA 3JQBC 1A71A 1BVUA 4ZVVA 2J6IA 5F3RA 1A4UA 2B69A 3CEAA 4ROSA 4ITUA 1NQOA 1AHHA 2JHGA 3S1LA 4OSPA 2ZQZA 2OXIA 4L76A 3SLGA 5L7YA 1H2BA 3DZFA 2O4UX 1LU9A 1NVTA 5DBIA 3M2TA 3OJOA 1X13A 1FDTA 4UVDA 3B1KA 1HKUA 4OL9A 4IXWA 1YL7A 1OAAA 2GCGA 3G79A 4MKRA 2QHXA 1H9AA 2CUKA 3IOYA 4GAEA 4E12A 1QKIA 3MWDB 3U4HA 1PGOA 4RPLA 1T2FA 5GMOA 4RPKA 3JYQA 3OEYA 4JBIA 4KUGA 1E7QA 3GUYA 1GQQA 4E0BA 2ZB7A 3HN2A 4RVFA 1H5QA 5EESA 1PU2A 1PTJA 2VHVA 3PYLA 3T4EA 4UAGA 5FF9A 4CLEA 2GDZA 2IZ0A 5F1KA 3V2HA 2GZ2A 2ZYAA 2V6FA 5JE8A 3ENNA 4AJEA 5AOVA 1M6WA 3NTOA 6ADHA 3GGOA 3U0BA 1P33A 5B1YA 1E3WA 1P1FA 3OSUA 1B8PA 2O7SA 4NI5A 3DTYA 4CUZA 2C5AA 1FDSA 1K3TA 1U3UA 1QRRA 5HS6A 3GFBA 2HMTA 4G5HA 2DAPA 2X22A 2O3QA 3IJPA 5JS6A 2BMAA 3CXRA 3R3JA 4U0KA 1PEDA 3FSRA 2VYVD 3OIDA 3TN7A 3WR5A 1I36A 2EIHA 2Y68A 3JQGA 1Y8RA 1YQXA 5JAMA 2P5YA 2VHZA 3NKLA 3MOGA 2O3RA 2FPPA 3N7UA 2Y0CA 3UKOA 4BKOA 1X14A 2O7QA 4GVXA 1XEAA 2X9VA 3L4BA 4N5LA 1DIAA 5DT9A 3RC1A 4GGPA 2YV1A 1QYVA 1PIWA 3OFSA 5TJ9A 3BMOB 4WLEA 1BRMA 3DMTC 3L6DA 2HQ1A 1N8KA 3RFXA 3IP3A 1J4AA 4FFLA 5AXAA 4TWRA 4AJOA 4J2OA 1CQJA 5EQDA 3ZV6A 1YB1A 4FPXA 4OXYA 2PA3A 3HDQA 4D0SA 1HEUA 1SB9A 1CQIA 4RL6A 2P9GA 4CMJA 3O9ZA 1U7TA 2B36A 3HZZA 3FR8A 3LYLA 2J5KA 1YO6A 3RCBA 4URFA 5TGDA 2XXJA 3ZW9A 1UXHA 4DIOA 4DGSA 4EDFA 2IDZA 3OA2A 3D4NA 1OMOA 4UVGA 4GKBA 5ADHA 4PLPA 5C5IA 5FYDA 3T7CA 1GYPA 4BNMA 3QWAA 3JD4A 3QA9A 1MB4A 4WASA 2P68A 5HS4A 2FOIA 2ZB8A 2YJZA 3FI9A 4WLUA 3CKYA 1A72A 1S6YA 1A7KA 1SO8A 2YFHA 4IIVA 3E1KA 3ASVA 1U4OA 3GFGA 4KDEA 4BL5A 2Y1FA 3AU8A 1I0ZA 1PL7A 2Y1OA 3NGLA 3F3SA 4IDEA 4N7RA 1MLDA 1ZH8A 5A5FA 1KYQA 2V65A 2PFGA 3F4BA 3RD5A 1FJHA 1K6JA 1OI7A 4KOAA 2W98A 1VI2A 4FS3A 3DTTA 2ZATA 4AJJA 1MA0A 3GN2A 3GPDG 3PIIA 3RKRA 4KQXA 3IJRA 1BW9B 5FEUA 1P1HA 2UV8A 4J0FA 1DDOA 3JSAA 3WLFA 2X0JA 2OP1A 4UVIA 4FFMA 1U8XX 3BMNB 3P5SA 4CMAA 3JD2A 2JAPA 5CAEA 2B5VA 4AL4A 3X2FA 3DWFA 1GADO 3IC5A 1MFZA 4J1QA 5L9AA 5AXBA 5JO0A 2GUGA 4QO8A 4D3SA 4RF2A 3HN7A 4Q3EA 4ZHSA 1HRDA 1TT5A 3OICA 3LQFA 3KVOA 4FFRA 2X58A 1E1KA 3EAGA 1UXJA 3ORFA 5DZSA 4AJKA 3COSA 1U2GA 1HYHA 2GN6A 4YJHA 3MOIA 4OGWA 3VH1A 4A7PA 3KSDO 3GDGA 1SEPA 2NVUA 5K6AA 1NPTO 4MP3A 1D3AA 2C0CA 1OOEA 2Q50A 1PJQA 1E77A 1TA4A 4F45A 1DJNA 4LSMA 1EE2A 3ABIA 1ZBQA 3AOEC 4CQMD 4DYVA 5LDHA 1N92A 1SB8A 1PGQA 1DAPA 3HSKA 4J6FA 2W2KA 3NV9A 4WECA 2Q99A 3NT5A 3L07A 3WGIA 4YQZA 4BGIA 1YKFA 4M8SA 4L0QA 1B8VA 3CE6A 4A0SA 4E6PA 4ZQFA 3FD8A 1HYGA 1YGYA 2PV7A 4UEKA 3U62A 3UCFA 4BNXA 3E5RA 2Q2WA 4FR5A 1ZNQO 1JKIA 1ID1A 1PR9A 1LDNA 1PGPA 1XYGA 1G6KA 1NAIA 4FW8A 3DC2A 1MUUA 4CLRB 1JN0A 5AVOA 1QYDA 4XDYA 4CM9D 5TNXA 5G4KB 3TOZA 3I9LA 3PJFA 4GSLA 3AFNA 1E0DA 4MVJG 3ON5A 5BSGA 1QSGA 3PYMA 1GTMA 2G82A 2E48A 3H2ZA 8LDHA 3Q9NA 4GBJA 4H3VA 2OORA 3TL2A 1BVRA 4TZKA 4XEHA 4O0LA 4P4NA 1O8CA 4IJWA 4I5EA 3ZZNA 3JQ7B 1UH5A 1LC0A 1GUZA 3EDMA 3KUXA 3FTNA 4XWYA 1U2DA 4DL9A 4XYBA 2YZ7A 3F6YA 1N1EA 1NM5A 2JHFA 2ZTLA 3RC2A 1FDWA 3KM0A 5I8WA 4E4YA 3DZKA 2FR8A 3NEPX 3IL2A 1LEHA 3ZNOA 1OC2A 3MTJA 4NJOA 4WUVA 3GNTA 1J5PA 4O59O 1U4SA 3PZBA 4PG6A 4WOKA 2JFGA 3WX0A 1OZAA 1T25A 1Y1PA 3F5SA 2V6BA 3DAFA 2I66A 2BFAA 5KVQA 3O4RA 3OF2A 2PGDA 4Q3AA 1H6AA 4P4LA 1CYDA 4R1TA 1GCUA 4TROA 2HKIA 4XYMA 1F17A 4RVSA 3WBBA 5KKCA 2WD8A 3D1LA 1GYRA 4PLFA 2BGMA 2V7PA 4PZEA 5DP2A 4RLHA 1CF2O 2VYNA 4OQZA 4M86A 3WWYA 1ENOA 5KVVA 3M1LA 1T1SA 4CMHA 1HWYA 5JDCA 1O9BA 1V6AA 4D79A 5BNFA 4N5MA 5IZ4A 1NP3A 2XF8A 3UHAA 2Q2VA 4KP7A 3LC2O 3ZCXA 4XRRA 1WWKA 3X2EA 3OEWA 4J0EA 1DB3A 4Z3KA 1IUKA 3SLKA 4PLWA 4IS2A 1YDEA 4II2A 2DQ4A 4GSKA 1P44A 1H6BA 5I9NA 5TF4A 2QIOA 3UICA 1T4DA 5IFLA 5KIAA 4R1NA 3WMWA 4CLDA 4HFJA 4S1VA 4BIIA 2QYTA 3S2GA 1MV8A 4B3JA 3MJTA 1LSSA 1GDHA 2DUWA 4RDHA 4EUHA 1P0CA 3AY6A 2OBYA 2O50A 5GZ1A 2VHYA 1IL0A 2HRZA 3ZWXA 2VHWA 3KZVA 1E1MA 4CM1A 4CR8A 3JQAB 2NU9A 4IDDA 3K31A 1PR3A 4PG8A 4J4BA 3JQFC 4DMMA 3FWZA 2NQ8A 3TZQA 3PJEA 4JCOA 4R69A 1Y8QB 1U7HA 4RV9A 4FJ2A 4CMKA 4D3FA 5L3ZA 3U4CA 4BS9A 1E3JA 3W4JA 5DDIP 3AI3A 1PJLA 1DRVA 5I7SA 1VSVA 2O48X 3F1LA 4BO6A 5I9MA 3ANNA 4PFJA 2Q1WA 3SVTA 1FXSA 1L7EA 2UAGA 3WWZA 3M1AA 4Q3BA 4NJMA 3Q3CA 3ZV4A 5JDIA 2G76A 1RYEA 2AA3A 4EW6A 2HMWA 5LCXA 2NWQA 4L4XA 1X0XA 1E5QA 2CF6A 1BG6A 1XLTA 3H3FA 3HB5X 3PDJA 4R16A 3WG9A 3JQ8B 1Z45A 4YJGB 1FK8A 3WIEA 1K89A 2YYYA 1X0VA 4C4OA 1HL3A 1OBFO 1LX6A 3IUPA 2AQHA 1KEVA 1H94A 5F1OA 1PJ3A 2UUOA 3P7MA 1MP0A 2D3TA 3ITDA 4UUPA 3M2PA 1YQGA 3HE3A 4D44A 1Q2XA 4EEXA 1UR5A 3RU9A 1V3VA 5HWSA 3DXFA 4J16A 1PX0A 3QE3A 3GR6A 2DU8A 3DHYA 2O3UA 4C7JA 4Z0PA 5KJFA 1NNUA 2EHDA 2VZ8A 4YAGA 3ETEA 4MIOA 1HE4A 1ZO8A 2X6TA 5DULA 4DLBA 1YOVA 5A9RA 2AMFA 5CG1A 1GEEA 3GMSA 3E6AA 3RVDA 1P1RA 2VUTA 3RQSA 4BKQA 3UUWA 4CPDA 3K30A 1V0JA 3A06A 4K6FA 4TKMA 2BGLA 1JW9B 2WYUA 1O5IA 4XQCA 2GPTA 1QLHA 1IPFA 1Z74A 4BKPA 2RIRA 2PZLA 2BH9A 3SEFA 2PD3A 2I76A 3H3JA 1B16A 2D5CA 2IXAA 1OFGA 4WE3A 1W0CA 4F3YA 4BNFA 1NWCA 1KVRA 1YJ8A 4J3FA 5A9SB 4XYGA 3KEOA 4MIYA 1DFIA 1GPJA 3D5TA 1Y9EA 4E31A 5JYFA 4FBGA 5AYVA 4WCFA 3NT4A 2I5PO 2QQ5A 2CDAA 2AW5A 1FDVA 5L4LA 1PL6A 2GLXA 3ZWNA 3L4SO 2Y1GA 1UXKA 4J9VA 4R68A 3U3XA 3AM4A 1A27A 4B3HA 2GN4A 4GWKA 3I6IA 3BMQB 4R5MA 5I8ZA 3KXDA 1EFLA 3MJ4A 4ZGWA 5A4DA 4DUPA 4IINA 4QECA 4CV3A 1IPEA 1C1XB 1Q0HA 2ET6A 1D4FA 3WQSB 1F06A 4RVGA 4CMIB 5KNLA 1E5LA 5JYAA 2B35A 1Q0LA 2BD0A 3PQFA 3SX2A 4BNIA 1ZK4A 4PRLA 1Q1NA 2J3IA 3DO5A 1X15A 3CZMA 2RHRA 5EL0A 2B37A 1DRUA 1B15A 2JFFA 4RVHA 3AUUA 1A4IA 1UAGA 4YPOA 1A7AA 5A03A 1K5HA 1NHWA 3ICCA 4ZRNA 4XIYA 4BO7A 5K0ZA 2X86A 1GL3A 4IBOA 2BKAA 3CPSA 3KEQA 1ZSVA 1J0XO 4KUEA 1MXHA 3FNHA 3K8ZA 4OM8A 1HDCA 1I3LA 5L7WA 5BSHA 1GPDG 2ZYGA 1JA9A 1K6XA 5H83A 3PGXA 4A10A 3LLSA 3RROA 1NFQA 5CDUA 2EGHA 3GOHA 4UEOA 4AJNA 4XCVA 1ISGA 2VWHA 4W7IA 2C29D 5DN9A 4ALKA 1Z7BA 4ND4A 4G81A 5JCJA 4DBZA 4BNNA 5JAIA 3K2BA 4DTIA 4IQGA 1CJCA 3WNVA 3AWDA 3AY3A 1UJMA 1YBAA 1R15A 3O03A 4J7XA 4DXHA 1LBEA 4QX6A 4PZDA 3OH8A 4YR9A 1U3TA 3VAZA 2GNAA 4R9SA 3WGYA 1XQ6A 1XQ1A 4JBHA 2YHIB 3LT2A 1E3WB 2VTDA 4IGFA 2QZZA 1G0OA 4FJ0A 4HKTA 4WLOA 4ALLA 3H7AA 4BKRA 2DTEA 4RF5A 1H2HA 5JSFA 1LSOA 1VL6A 2FZWA 4FC7A 3W4IA 5L4NA 1YE3A 1XG5A 1O6ZA 3GT0A 1V8BA 4Q3NA 5CP8A 2P9CA 3ADOA 2WWRA 4Z9FA 3VKUA 2WD7B 1E6UA 2PH3A 3CIFA 1QP8A 3BTVA 4UREA 1AUPA 1PS8A 2X7HA 4QTZA 1BSVA 4OQYA 5JMPA 3VKVA 1KY5A 3PLRA 4YEDA 3VH2A 4AJHA 3W1VA 1ISMA 4EI2A 3JD3A 5L40A 3JQGB 1ENZA 2O3TA 2DC1A 3QVTA 4W9NA 2AHRA 4F6CA 4J90A 2IYPA 2YUTA 3WOHA 1EMDA 5T8KA 3QWIA 3ROPA 4CV1A 2VTEA 4BQPA 1H6DA 2HAEA 3LU1A 1K2WA 4D3DA 3O8QA 4XJTA 3AOEA 3PFWO 3RBVA 3RC9A 2NV6A 3IMFA 3GEMA 3NT2A 4NMHA 3C8MA 4NBRA 1NFFA 4PCVA 4OKIA 3HG7A 3IIEA 2PZJA 1KVUA 4FN4A 5BR7A 4DQUA 2R00A 4E13A 3D3EA 1JWBB 3E9MA 4EEZA 3RI3A 2E49A 4YWJA 4BB5A 3NDJA 4JNKA 5I7FA 5A9TA 1ZK3A 5IF3A 5L51A 2HCTA 3PP8A 1H0KA 1SAYA 4P8RA 2Q1UA 3EGOA 1KVTA 4JROA 1FF9A 2BFOA 1YB4A 5JLAA 4FOSA 3KYBA 5G0UA 4BNUA 5J9GA 4I5FA 3CSDA 3I83A 1Y81A 3PHIA 1DJQA 2BI8A 3I9OA 1P77A 3BZUA 3EHEA 3JQ9A 3A14A 3JD1A 3DMTA 1XIVA 3B70A 4IDFA 3V1UA 4OHUA 5JPIA 2I6TA 1D7OA 5CDGA 1F8GA 3PTZA 2PR2A 4WKGA 4ZQHA 3E18A 4YRBA 5IDQA 2HK8A 3W6UA 5MDHA 2RAFA 4E5PA 1DC4A 2EKPA 3QVXA 5TRTA 2GO1A 1CRWG 3TRIA 4XJSA 3IUSA 2WSBA 4XQGA 4YT8A 5TT0A 1F0YA 1HDZA 4D45A 5HTOA 4Y67A 3DL2A 1I5RA 1Y5MA 2WE8A 2XXBA 3H5AA 3B1JA 4J9UE 5CDYA 4AICA 1NPDA 3FRJA 1R4MA 1LUAA 1HXHA 1Y5RA 3BHIA 1JTVA 5JAZA 1UP6A 1ZSNA 5J23A 1R0KA 5JC1A 4A73A 4WEOA 3BMNA 5F21A 1MG5A 3KOUA 1NAHA 2YQ4A 3IS3A 3ST7A 4EZBA 1M66A 4HWKA 5IDXA 1I3NA 1R0SA 1YBVA 2X5OA 1EUCA 1GUFA 4I5GA 3GEGA 4EGFA 2ZB3A 3LT4A 1R12A 2Q4EA 5L45A 3LZ6A 5TQVA 5IXSA 1TT5B 4XRGA 4D42A 2IZ1A 2CDBA 4FJ1A 2BI7A 4LK3A 4I5DA 4QFCA 5K9ZA 1T2EA 3I52A 3I4FA 2OOSA 3SBOA 1BXKA 2XOXA 1U5AA 1KC3A 3B1FA 4BQRA 5KJ1A 2W2LD 1DRWA 4PRKA 5IJZA 4M54A 4BNHA 2WYVA 1R0LA 2O2YA 2GF2A 4L4RA 4GH5A 3BHMA 3F46A 1C0KA 1YB5A 2G5CA 5FFFA 1UXIA 3JYNA 4O1MA 1HLDA 4YAJA 5HM8A 1WZIA 3BAZA 4K6CA 1C3VA 5EIOA 4JLWA 1AN9A 4LCJA 1TB4A 3H6KA 4BO0A 2O4CA 5KKAA 1SBYA 1U28A 3NYWA 2ZYDA 4M1QA 4XIJA 3TZKA 2C20A 4XZ3A 1L1FA 1NBOA 4JN6B 3PIDA 5KJ6A 3N58A 4GX2A 2EF1A 2PKQP 4TVBA 5LC1A 3GAZA 3RJ5A 4Y9DA 3PPIA 1TXGA 4Z9XA 3K9QO 5ENVA 2VYND 4LCEA 1WW8A 1R37A 1N2SA 3BHJA 4YQYA 1EVJA 1HDRA 1JAYA 1DHRA 2Y1DA 3T7EA 2EKQA 3ZI0A 3ZWCA 4MJLA 4E21A 5JXWA 1P3DA 5EINA 4H7PA 4RF3A 3FBGA 3WGTA 4HBGA 4RLSA 4E3ZA 4YT2A 4IQ0A 4BNJA 1LC3A 1E7RA 4WLFA 2NQTA 2FRDA 4ZQEA 3IAHA 2Z1NA 2ZJ1A 3ZWWA 4B4OA 3MZ0A 4CUKA 1E7SA 3B20A 3U49A 3V2UA 1LNQA 3STHA 5G4LA 3I1JA 3H2SA 5DBFA 1LLCA 1SPXA 4KMSA 4BMSA 3RFTA 1I3MA 3QQPA 1BXGB 1PGNA 4PN3A 4HFRA 1NWHA 2X1HA 3I9MA 4RO0A 1ENYA 3PK0A 3WSVA 1K0UA 1WMAA 3GNQA 4NQZA 3F1KA 1DIGA 5DCUA 5CHEA 2J3HA 2UYYA 1BXZA 3DFZA 3OJFA 5U1PA 3WQRA 1GCOA 4YDRA 2EERA 3IQDB 4J4TA 4ND3A 4CMEA 1FMCA 3AOGA 1F8FA 1E1LA 4DQVA 1ZK0A 4EYEA 2CVOA 3LLVA 5ER9A 1ZJZA 2DFDA 2NUAA 3ICPA 3S2FA 3I4CA 1CERA 4NK4A 2OP0A 1H93A 1YS4A 1PL8A 1J49A 1IYZA 4IY1A 5B12A 4CV0A 4TRRA 4U7WA 4I9HA 3G0OA 3RAJA 4O63O 3UCXA 5DP1A 3GHHA 2B4QA 4NBUA 4AVYA 1DPGA 4YBZA 3KO8A 3BMCA 1KY4A 3F4LA 2ILTA 3CZRA 3UN1A 4ZD6A 1PJ4A 2HMVA 2GSDA 2UDPA 1KERA 3QWBA 4Q3DA 2X9NA 4IIUA 2HU2A 2DBRA 4A2CA 4WGGA 3RUAA 4CMEC 2EXXA 1LRLA 2X8LA 3C1OA 4J1NA 2BHLA 1HETA 4U6SA 4W6ZA 2EP7A 3AW9A 4B4VA 5JO9A 4IJUA 3ONEA 3D3WA 3VHRA 2JJYA 2V6GA 1XWFA 4BGUA 4EJ6A 4ZQGA 1QLJA 1W8DA 4QFDA 2PZKA 3E82A 5AQ1A 2GR9A 4PLYA 4IPTA 4LMRA 1U5CA 3ROMA 2OO5A 1I2CA 1RWBA 3VZRA 4IS3A 4DIBA 4JGBA 2X9GA 1JKJA 5KWEA 3LC7O 1O0SA 1LRJA 2DPGA 4RORA 5G0SA 4CM4A 4LSWA 1ISHA 5C7OO 1TI7A 3JQ8A 1E3EA 1R4NA 3DBRB 2GRAA 4YJGA 4D46A 1I8TA 5BT9A 4RVUA 2VNAA 1AXGA 4HX5A 4M89A 1VKNA 1F12A 2CDCA 2IRWA 1WXDA 3WB9A 3QVOA 3WLEA 1CDOA 4TRNA 3PQEA 2AQKA 4NG5A 4GMGA 5GY7A 4CQMB 3AUSA 3W8EA 4JP3A 4R01A 4MVJA 4YRDA 4ALNA 1LRKA 2FWMX 1A9YA 4W99A 4FDAA 4MIEA 1E3LA 4LVUA 1ONOA 1YOVB 4BMVA 4BUCA 2H6EA 2P5UA 2OFPA 2OBNA 4XX0A 1E7WA 2B0JA 3VTFA 3JQ9C 5CEJA 1HT0A 1SOWA 4K1LA 3PJGA 4CQLA 4KWIA 5ICMA 3GY0A 4R5HA 2P91A 3HB4X 2HSDA 2WEKA 2H63A 3FBTA 2VOEA 1NXQA 3JYOA 5A04A 1G0NA 5TT1A 1P1JA 2JCYA 4L9RA 4QXMA 4ALIA 4ZN6A 1QV7A 1XR3A 4LN1A 2Y99A 2IEDA 5TSDA 1LDMA 2DFVA 3AI2A 1DIBA 1PZGA 2D59A 4XD2A 4YRAA 4YVFA 3ZV5A 4DMLA 4J1SA 3PJDA 2VZ0A 1HF3A 4RPJA 1KVSA 4IDAA 4E30A 2VRBA 2JFHA 4R3WA 3PEFA 1E6EA 4D0RA 4HXYA 1N9GB 3H8VA 4K26A 1DIHA 1JVSA 3BA1A 4BNTA 3BMQA 5H82A 2NLOA 3UOGA 4DREA 3WFJA 2EV9A 4OOFA 3K92A 3PI7A 4PLHA 1EQ2A 3PYXA 1GZ6A 4JJGA 5DNAA 4BV9A 4NNJA 4IM7A 4CMIA 2FMUA 4A26A 4MVJH 4XQ9A 3VPSA 2QX7A 5B4VA 2AE2A 3PVZA 1LXCA 9LDBA 1DOHA 3DFUA 4OH1A 1BHSA 2QG4A 2JCXA 1BTOA 3O38A 1O89A 2VWPA 3ZGYA 1DSSG 2EW2A 1UAYA 5T8KC 4JX8A 4UEJA 1PJTA 4PVCA 1YH3A 5C7LO 3A4VA 2EJVA 3SC4A 4I08A 2AG5A 3KBOA 5CDTA 4TZTA 3HHPA 4Y98A 4BO3A 3FNGA 1UP7A 2JD2A 3JQCA 5I7EA 4IMPA 1UDAA 3D5QA 5H81A 4HNGA 1VJ1A 1LLUA 2FY8A 4IMRA 3QY9A 2VT3A 2C07A 3ZWOA 3JQ6A 3ZH2A 1ZKMA 3JQFA 3UFXA 1WDMA 2ZK7A 5HBRA 3PFFA 1EVIA 1EDOA 3MTGA 2PKQO 4W82A 3ADPA 1V3UA 1ONPA 1GD1O 2Q4BA 3EZLA 1OC4A 1PJCA 4CMBA 1GU7A 2QW8A 4U6QA 4WCDA 2EJWA 3VZSA 4R51A 1I2ZA 1B7GO 4PIVA 2FPGA 3LC1O 4NHEA 4LGVA 3B6ZA 4GMFA 1SOVA 3UVEA 4RZHA 4E2YA 2SCUA 3ZNNA 3RUDA 2GERA 3H5RA 4L4SA 1VM6A 4MINA 1U3WA 1WVGA 5C7IO 2WMDA 4J7CA 3SJUA 3AUTA 3KTDA 5DOZA 3WGZA 4GL4A 2YHIA 5I7VA 1TEHA 4MDHA 1ARZA 1MC4A 4CODB 3SC6A 1B2LA 3K6JA 2X0RA 3KYCA 3TNLA 1GYQA 1VKOA 5JY6A 2Y05A 2GN8A 3UGKA 4GWGA 1Z73A 4LRTB 1T2DA 2WD7A 4L74A 4R54A 2EG9A 4E2XA 2WDZA 3ENKA 5U4QA 1ZIDA 4EJMA 1ADBA 4S3MA 5ENDA 1ULSA 3GZNA 3HJAA 1GFSA 2C7GA 3MWEB 1ONNA 1J6UA 4QT0A 2YFQA 1JU9A 3CUKA 2YV3A 2PD6A 4U8GA 4YJDA 4KTVE 5B4TA 2RH8A 4PLZA 3G49A 4OXKA 3L9WA 4N54A 2C5EA 4MP6A 3D0OA 1HE3A 4E5YA 1MFPA 1E6WA 3G17A 3GVIA 2HDHA 5G0TA 3BTOA 4UUNA 5EJ2A 2YHUA 2Y1CA 1YVEI 3O8QB 5F1PA 4EUEA 4B4UA 5B37A 3KLMX 2Q22A 1KETA 2NTJA 1EUZA 3GRPA 1LTHR 4NBVA 2EWMA 1DFGA 5ITWA 1K6IA 1LLQA 5JAQA 2AG8A 4DPKA 3JCZA 1BDBA 1W4ZA 3ASUA 3CTMA 5G2OA 4E2WA 4EITA 3ROQA 3NX4A 4EBFA 1MXFA 1DO8A 2NU8A 1E7YA 5CEFA 1VL8A 1SC6A
chains in the Genus database with same CATH superfamily
4L4ZA 5AHKA 3HDHA 4IL5A 4U63A 1FZQA 4G23A 2XNKA 1HG1A 4IDBA 2H7CA 3UGQA 3M6FA 4WY2A 2HRCA 1E89A 3FRHA 1N9KA 4UPDA 3ZHBA 4B7CA 2AG1A 2YHAA 3OZXA 5DYTA 2OFFA 2I4NA 1MDFA 1Z6QA 2V7QA 1FNBA 1ORWA 2GK4A 3GELA 3PGKA 3G23A 3KQOA 1PEYA 1VPDA 3IQEA 3IILA 5EWLA 1IY0A 1WMBA 3FHTA 3GH3A 3RYFA 1C5KA 1A8IA 3ANYB 4FGWA 3C85A 4DCOA 3FCSB 4BE4A 4ETNA 2F1IA 5FWYB 2JB9A 1XZBA 4INPA 4ZO6A 4QEDA 5KYYA 2QSYA 1UDXA 2P27A 2EFCB 4L72A 5EHIA 3SVLA 4W9MC 2QBYA 1KI7A 5F9HA 4FI3C 3X1YA 4CV2A 1ZD4A 2WAYA 3O0DA 4OBBA 1H2EA 1Z83A 3WB2A 5EIWA 1ZMOA 3C6MA 4K03A 9MHTA 2VP5A 1HEIA 3AESA 3QKRB 4XFDA 1KTVA 1SKAA 4IDCA 4ZJYA 5CX1A 3SGLA 3CN9A 5JSQA 5K8CA 3AFOA 1M9NA 2YWBA 1DQPA 3OE7A 5CM9C 4CM4A 1TJNA 2Z4RA 5CITA 5D7NA 3D7KA 1VPVA 1EJ2A 2ID8A 3ONDA 3DZHA 3PG5A 4H3HB 5SY4A 4LFAB 4JI3B 3RVJA 3CZCA 2XBMA 4EO9A 3OKCA 4A0HA 5EMMA 2YW9A 5LBTA 1RYHA 4U0JA 5IK2D 4G4SP 4A0FA 5ALJA 4ICIA 4NMLA 1PR4A 2J0QA 5T4BA 3DMFA 2FEWB 4XLZA 1E9DA 2IHTA 2OZVA 2R8PA 2GI4A 4JP5A 2QT1A 3RBXA 1Q74A 3ITKA 3ZYZA 1I2BA 4B3DA 3GGCA 2WTXA 3VKWA 5E8RA 4LF6B 2CWDA 3LUCA 3NUGA 4FMDB 4EHIA 1QS0B 3LWBA 1KZGB 1P2VA 1PFQA 1LJUA 1U9YA 1YZUA 1ZMTA 2GASA 3DHNA 3QEBZ 3T12A 4ETMA 121PA 2AZDA 4H4EA 2JBAA 3I5MA 3CG4A 3LUGA 3VVCA 3DEZA 4JELA 3VOTA 5I7HA 3NR2A 2AWNA 2W00A 3EPBB 2CSXA 4GQBA 1E9BA 1LWOA 1XMXA 1WZEA 3PDWA 2O59A 1MNQA 5IW8A 1ZD3A 2C4NA 2EQAA 3BFKA 3I3OA 4P5PA 3ZHTA 9ATCA 1VHWA 3UM9A 4RVOA 3SD7A 2GM5A 2BFCA 3EVBA 1LDEA 1OASA 5C8VA 2Z1DA 1Z7YA 3UAWA 1K0FA 1D1SA 1WP4A 2OORC 2A35A 2PTGA 2IA5A 1ECGA 2PUJA 2YXNA 4Z9AA 3HBLA 4EG7A 3G7UA 3FPLA 4RMNA 3ZJXA 1ORDA 1K8ZB 1SU6A 2PUTA 2SHKA 2XQIA 2H4JA 1TVEA 2QX9A 3FUUA 2ZTVA 4LFCB 5BN5A 4DSUA 4HYYA 4XCQA 5J40A 4CLHA 2GZ1A 3JRXA 4K46A 1CC1S 1JILA 3TSOA 4G6ZA 5AW1A 3E5MA 4E3WA 1L8LA 4HPWA 4KU4A 5B7NA 1GNPA 2Q2QA 3WYNA 4LVCA 1XTTA 4TRMA 3GQBA 5JQGA 4DPMA 1UWCA 2J48A 4FCVA 4MZDA 3A4NA 2NU7A 3PHLA 4HAYA 1NXWA 4JGGA 4JOQA 2Q1SA 1X8JA 1QQ5A 1VL1A 1IY2A 2CCKA 3QVWA 3EIOA 1AGRA 4Q6WA 4RH3A 4ZYTA 1QF7A 2BFBA 5HKAA 4P38A 5J3JA 3K96A 1Z5GA 4HD8A 2PKRA 3H11A 4DADA 3EOZA 4U1RA 1OX4B 3RYCA 2X5JO 4CWAA 3AVXA 1QVRA 4GKVA 2HN9A 3HYSA 4CN8A 1G8HA 4TYPA 1RXWA 1ECPA 1ZA1A 3LDUA 4KXQA 4YP5A 5TEVA 2W2PA 1TUIA 4GT1A 2GCOA 2VNSA 4GLJA 1EQUA 3UFBA 3DOHA 2CVQA 3EJWA 3I5YA 2OBFA 1ZOOA 1RHKA 4WKBA 1WD7A 3OMLA 4JT2A 2XJ9A 1U65A 2FMXA 1KO4A 1U7ZA 2Z3ZA 5GONA 3ED1A 1V8ZA 2X4GA 3A9VA 4JR2A 2QPLA 3BXOA 3IKTA 1Y89A 2R6DA 1C3EA 1F4VA 5JS1A 1G9SA 3RWBA 3TBKA 4FFOA 5A0FA 2MMGA 4LOIA 4BLSA 5KVSA 4OIMA 5JD3A 4PC3A 2CV2A 1MJFA 1EBFA 5IASA 4XGKA 3SVZA 1O4VA 2OCBA 5GQSA 2FR0A 3P9QA 1E4EA 4BOYA 1A5ZA 4AZTA 1XRMA 3E48A 5BNIA 3QIVA 1IQUA 3ELDA 4AKHA 1P74A 1RYBA 3A9WA 1SBIA 3C5VA 2VOJA 3PHBE 1V8PA 4HQNA 1V16A 4CM3A 2IPAB 4YYZA 1PV2A 2A2ZA 2H18A 3NATA 2GAJA 5BSFA 4I1PA 2C82A 3OKFA 4C4YA 1IIRA 4IQ8A 4RGBA 1NJSA 1U0FA 1L7DA 3HR8A 4UBNA 4BV2A 1NJ8A 2D0IA 4IIXA 3WSWA 2RHTA 4CIVA 5SZIA 2RBKA 5IFKA 2XUQA 4Y6RA 3GRKA 1BMFD 3ICWA 2R751 2XMPA 4HEA1 1G64A 4WNCA 4AJ4A 5COBA 5LMCA 5GJBA 1M8PA 1V3TA 2VCEA 3PRJA 4R9RA 1GEGA 4X1IA 1T4GA 4GOOD 5DHRA 1V5GA 5FAXA 1V1JA 3UB3A 1KJYA 1T3LA 1PTKA 2XE4A 2JGDB 2I3GA 1BWRA 4NOJA 3NC1C 1DGQA 5CW1A 1LBHA 2RHBA 1ADCA 1BS9A 1XRRA 2CBXA 1Q7TA 4NE7A 4ZTBA 3UAXA 3Q7SA 5K2OA 3EY4A 4ARUA 4YUYA 4L57A 4RD3A 5AM2A 4DJ5X 3A8TA 5EPUA 1XLTC 1DL5A 4MH0R 1BS2A 1Q16A 1QR2A 4G0QA 2EFEB 4U2GA 4YJ3B 3HBNA 3PDIA 2QV7A 2X8JA 2H48A 1UZLA 3IAS6 1FU8A 2ZJBA 1ZFNA 3CM0A 4R2KA 3OOHA 2CLFB 1EWTA 3WFZA 1IIBA 4IEFB 1RADA 2XCUA 4UOQA 4O4JF 1NC1A 3ZLBA 4U9HS 4RTNA 1UP4A 4OLBA 5CJ2A 2Q4DA 3R77A 2HIMA 4KIUA 4DEYA 3AETB 4BLRA 3R41A 1DCFA 4IGKA 2YWHA 3MCVA 5TQJA 4ER0A 2P0AA 5EHNA 2PTHA 3BDIA 3D3WB 3GJRA 4GYJA 2PUEA 2VXCA 4TRJA 7MHTA 4U7JA 1MQSA 4ESHA 1U8AA 4LDJA 4C7KA 2X7JA 4GO1A 1LTKA 3CS3A 4MVXA 1P6UA 1ADGA 3G5AA 4JUDX 4BUZA 2I67A 3NAZA 4D9NA 2P9JA 1I5EA 1ULUA 1UBKS 2ZTUA 3AR4A 3FPBA 3I9NA 5DGXA 5J5AA 3RR2A 2A0FA 2ZZNA 3SHWA 4ZFNA 1ZYUA 5AW8A 2XEDA 2HK6A 2DE0X 3IEUA 1U7OA 3GDFA 3BWBA 1ZD5A 2Z3VA 2Z5LA 1KMQA 3OESA 3LFHA 3AI1A 3DPIA 1G19A 3LBAA 3HO1A 2E6UX 5U9CA 4TLDA 2PUFA 1VIAA 2RI1A 2AUMA 5AT1A 2P3QA 2OO5C 5LQKA 1N7GA 1T91A 2IPXA 4J2TA 4C21A 2J5XA 4PC1A 3HO8A 1OX6A 2ETXA 4FUQA 4BLTA 5B3AA 1JB9A 1L5VA 3VR5H 3A1NA 2IUSA 3QNUA 2QAIA 5I7AA 1DC5A 4OK6A 4FDTA 4BO9A 3V5NA 4M0KA 3VC1A 4B3BA 2HHAA 2H29A 2OZEA 3QHAA 1WDTA 4REQA 4HNQA 2JI8A 1NVKA 3NOXA 3SF0A 1GNVA 4D9EA 3D6TB 2QSZA 3OQIB 4DNXA 4AKGA 3Q2KA 4PTZA 1Z0FA 4YJFB 1EJBA 4J43A 4CM8B 1FRNA 5A4FS 1L1QA 4RESA 2NNLD 3QFFA 4ZQIA 3FYUC 1CFJA 2WUEA 3QELB 5AOAA 4EWLA 2DETA 3JAMA 1M2WA 1IEXA 1N32B 2FPSA 1TYAE 2CL0X 3ZXSA 1EUDB 2DM6A 3DB1A 3GNSA 3T5BA 2P69A 2ZVJA 1SA0A 2CE2X 2IFTA 1UOEA 2VNHA 3VM6A 3WYEA 4ETWA 2JD1A 3GFRA 1QCCA 2Z58A 3FPHA 4HP8A 3ZK7A 3U60B 2WSSD 2AH5A 4HWOA 5CB0A 1O9GA 4MKFA 2CDNA 3ECAA 5HF6A 5CB4F 1E9SA 2CUZA 3GMDA 3MTIA 3VOSA 1EFVA 1Z4IA 3DEYX 4NU6A 3L3BA 5CK4A 4CKWB 4Z4CA 2Q3JA 3E4CA 2YMLA 1EK1A 2V58A 3EMKA 3H2IA 2J7PA 3ZU3A 2YUIA 3IJEB 2BRUC 3NNNA 3ILVA 2F3PA 2QYSA 3DE0X 3O83A 1KK1A 3UJAA 3R3ZA 4BE7B 4MEBA 2HDOA 3L6RA 1TYCA 1KNQA 1TNDA 2DTDA 2QK4A 2WA1A 3FGPA 1AY0A 1C9NA 1G8GA 2DY1A 3NBUA 3PGJA 3OETA 1BEEA 4TLAA 1VYVA 1N6LA 3PZRA 4G9BA 2MHCA 1SCUB 1YNOA 3HC7A 4I9NA 1KZHA 1WPXA 1ZD1A 1GNTA 3RSOA 1C1DB 1MC5A 1YHZA 4P5DA 4UNQA 1I2AA 2VHXA 2VBIA 2CXNA 1TCAA 3FWYA 4JR1A 4U5XA 5K8TA 2DJ5A 2EYUA 3O21A 2PXAA 2E5LB 4FWBA 1RZUA 1KAQA 1X86B 4E5NA 3OPVA 2AI3A 3FWNA 3RABA 3IA7A 2CNNA 1MIHA 3K0CC 4HSEA 4O08A 3STYA 4EJSA 1VHQA 4LMAA 1Y3CE 1QYWA 3I9JA 4EYKA 1PNOA 2IWRA 3ZXIA 2QJTA 1TZJA 4OY3A 5TY0A 2FWJA 4IDGA 1V7CA 5HZGA 5ISMA 2BUCA 4R0NA 3SU8A 1D1PA 3KJHA 1T4CA 2GM9A 5JAUA 1AQUA 3UJ8A 4D8TA 2DHRA 3D6AA 1XXHA 5A4JA 4DJJA 1Y5NA 3DD1A 4MGZR 1GL6A 2QG6A 4MW5A 1H1DA 1MG0A 1JJBA 3BORA 2P2GA 4FB5A 5A6VA 1BD4A 2MMCA 1PNVA 4EMTA 4B5KA 2F67A 2QUAA 4QXPA 5KYUA 3RKUA 4A4DA 2BYTA 4OHYA 1P5JA 3OWHA 4XM0A 1TFRA 4B6QA 1A2OA 3M33A 4M46A 2CXQA 4Q4HB 3WNBA 4ZU3A 3EY9A 1U1IA 1GFZA 4BGEA 2NAFA 4AIIA 5C5DA 2FLWA 4XQEA 2IEYA 3PWZA 2WJJA 3RRMA 4ZJUA 2XITA 1G21A 2XVYA 4PHGA 5C8YB 1EESA 3CT6A 4CI0B 3B3GA 4MDYA 5HRUA 3LQYA 4JLAA 4MKHA 2GHIA 3NNDA 4BBZA 3AXSA 1BC5A 2KLBA 1DBPA 1KEUA 4WA8A 2A5JA 1HLGA 4KQ2A 4I9UA 4MQ5A 3S0JA 3GD7A 3OCCA 1WXIA 4HYEA 4QU8A 3TL3A 1SCAA 2Q46A 3Q87B 3UO8B 5C3MA 1OZHA 4XARA 3HB1A 1HDYA 2F7SA 4YR7A 1NASA 1OWPA 2AUNA 2Q3EA 5AM4A 1X7DA 4FOOA 4KSYA 5LZ2A 3UHPA 5ESDA 3W9SA 1QIEA 1GTJ1 2DSNA 3TW0A 3AUAA 4OM7A 4IUYA 4IHQA 4JASB 5KWSA 4S2EA 3EQZA 3I37X 3KX2A 3UUEA 1O0CA 4GPD1 3R6WA 5I9LA 4ZZ2A 1VG0B 2OT3B 3QJ5A 1XDGA 4PTLA 4ZAZA 2PMKA 3KVVA 3QVSA 4OHKA 5EMLA 1GO2A 2FDCA 4AG6A 2PK3A 1OVMA 3PLNA 4NIMA 5BPFA 1K8RA 3GVCA 1SULA 3L4EA 4IH4A 3I92A 3OQVA 5CFNA 4RELA 3C6QA 3FDIA 1Z18A 3TW8A 1J8MF 1K27A 3FOBA 3AH8A 4KVZA 5IP5A 2IDKA 2VQEB 2F8TA 3VMFA 5HQ3A 1P73A 2R84A 4ZPXA 1VCHA 4PVDA 5ALLA 4RC9A 2A33A 4RTSA 4AP5A 4GYYA 4QPZA 1OIVA 3Q8WA 2O8NA 1R74A 4KO1S 2FUCA 3LD9A 1Y8RB 3KBBA 2JJMA 3MUEA 2X19A 3KAPA 4J0DA 3O92A 5KHOC 2QL7A 2AHOA 2C3MA 2BGWA 3E8MA 3LUDA 3CLKA 1PJBA 1ZRNA 2P9BA 3QU2A 3H9QA 3RIHA 2K7FA 4FFNA 3DAPA 2V9CA 3MSCA 4W5JA 1HE1C 2D5AA 1EKXA 3UMRA 3PEUA 2YRXA 2RH4A 1ZGHA 1NQXA 4HFMA 5F64A 5E9WA 2HTFA 2N3ZA 2YV2A 2FJUA 1CJUC 3S1AA 3UOAB 1SVWA 3K5PA 1L5HB 5BQXA 2OHHA 4BX3A 4HNUA 1ZMXA 1IZ0A 4MA0A 1N2CE 4PZLA 4C7BA 1EJ6A 4RLFA 4BCDA 5EKSA 3RRXA 4ZVQA 1VLJA 1Z75A 3NUQA 4JQCA 4MOWA 1QGYA 4C9BA 4LJLA 5BXQC 3SS9X 4GQAA 3GGSA 4YAOA 4M53A 2R1VB 3T1OA 1EFKA 2VAVA 3I42A 1NVFA 3HFRA 3RS0A 2G8LA 2PKYX 3I6QA 1W4RA 1T8TA 2C59A 4UTXA 3C3XA 4JBWA 4NECA 1LSJA 5SZKB 4E70A 2ZQYA 2PT6A 2A6PA 3JQQA 5T57A 3ESRA 4WACA 4F4UA 2Q9AA 3G5UA 4B5LA 5KU7A 3VNVA 3LQKA 1V96A 1AZWA 4K3VA 3S2SA 2F8SA 5COAA 3IR5A 2IT1A 4QEZA 3VZPA 5LJLA 3D6MA 4UE3S 2Q6TA 4RVDA 1NXOA 1IXKA 2IXBA 2P2YA 2ZJ5A 2B9EA 4M76B 5KTTA 1QK3A 4HLDA 3A31A 2VNJA 4B7XA 5IPFA 1E1CB 2GD6A 3ANMA 1SQ0A 3LOQA 3KDAA 4JI8B 5LM3A 4JOCA 1W6UA 1GUYA 1M2GA 2NUBA 2PD4A 2QN3A 2WNHA 1ZHOA 3GARA 2FG6C 2W8BB 1PQ4A 4KXUA 4WCVA 4ESOA 3COZA 3AFHA 1U0LA 3BF8A 3FOCA 5AHRA 4ZMSA 5EE1A 2DVMA 4XE5A 3L6OO 1Q12A 2Y9MB 2B3TA 3GJ7A 3A1UA 4Q1BA 1SCNE 1T4BA 1G17A 3C1AA 2DBZA 4OAQA 3FOFC 3R9XB 4HUTA 4X65B 2H8KA 1N7JA 1QAMA 1SVOA 4I1IA 2JFVA 4Q7EA 2VWQA 1WXXA 5E9JA 3BL6A 3FA2A 3FYCA 4N3CA 3N2LA 3MTDA 2I4OA 4KYTA 2XKKA 8AT1A 3ZE7A 5K3FB 4HB4A 4U02A 1SUCA 3C7DB 3M6IA 4EPVA 5BNZA 5HOQA 4D26A 4N0PA 4U2KA 5CGZA 5HOEA 3DAGA 2C8KA 2EATA 1IHXA 1KA9H 1W88B 1GR0A 2IYLD 2QD2A 2Y2UA 4MUKA 5F5NA 4B2PA 821PA 3LTNC 2JZNA 4CE6A 3AU9A 2OCDA 2ZXFA 1X7GA 3SKVA 1U3DA 1RKBA 5FNVB 3TGPA 4X5OA 3OFND 4XFKA 1U94A 1CR2A 2PHZA 4CZ2A 3IGFA 3D7LA 2UZ0A 3F96A 1PQUA 3PT9A 1NVMB 2AOUA 2DWQA 3FR7A 4TQGA 2NM0A 5CLIA 3MTQA 3BWDD 4RZIA 4US1R 1AGNA 3EXEA 4IJVA 2H9IA 5AHWA 3OQ6A 4Q1DA 2ZP1A 3LV8A 1P5FA 2JAHA 2J0VA 3VSEA 3PPWA 1Z5OA 1JG3A 4MRNA 3R75A 2H1CA 4Q12A 4Q21A 3DV0A 3ZX5A 2P6MA 1FVXA 4W63A 3VPHA 2I2AA 5LIRA 3G3EA 4JJ6A 3ZOZA 2ZAIA 4PLGA 4EB0A 5AUNB 1OTHA 2ZIAA 3Q88A 2CMKA 4CLOA 1YE8A 1TUBB 3SXJA 3P2EA 2FZCA 2B20A 4PG4A 1SMKA 4DPLA 1QKJA 3DMYA 3KJGA 3NTUA 5KNCH 5FOTA 2CVZA 4OKNA 4R3NA 1ZGAA 3SAJA 3P9NA 3G1TA 1T9AA 3A1SA 3JAKB 1DP4A 1HE5A 4YH1A 4ZHQF 3DT9A 4Q93A 1RLMA 5A3QA 2QVLA 2R7KA 5FLYA 1I24A 1IBLB 2VJMA 1UOOA 4KZPA 2CNWA 5IJWA 1XNQB 2HO4A 2NXCA 2P5SA 2R60A 1T1GA 4QYSA 3R3UA 2NU7B 4GLLA 2Y93A 4X66B 3W8NA 5IXJA 4FNAA 1PS9A 5K03A 4Y6PA 5AJHA 1XZAA 2JATA 1U6JA 2I9PA 3JYLA 3JTMA 1CEQA 3OY7A 5JNLA 4JYZA 1OX4A 5AIAA 4TQUS 1SURA 1ZOSA 3PL5A 4OXRA 2F4VB 4TZ6A 2F90A 3T1NA 2W6CX 4J6EA 4N18A 3ETDA 5B5SA 3UGTA 3OJWA 3AM5A 4RGVA 3O26A 4G0XA 2GXAA 1Y3DE 3LF2A 1N1DA 3DWEX 5FBKA 3UV7A 7ABPA 1H8HA 3QHQA 3H5IA 4MPTA 1QQ6A 5F76A 4P34A 2ALJA 4DLLA 5FYQA 3T1YB 3PNVA 3OZAA 3P52A 4C5AA 1PYOA 2XV1A 1OAKA 4HUQA 1XVAA 2W4QA 3GPLA 2HDNB 5KPJA 1BD3A 1VLLA 3T4PA 5BYAA 2C4KA 2PX0A 1HQYE 4OHCA 3F5QA 4DB4A 1U04A 4ESEA 2V7VA 1QIFA 1XJ5A 4QPCA 4X91A 1G3QA 2AC2A 4GMXA 3DBIA 3HJFA 2C57A 1FYXA 4IDNA 4FBMA 4RZUA 3N0VA 4ZREA 2QRJA 4G36A 4N6NA 1G21E 1CEXA 3G8CA 1BNCA 1FMLA 2QR5A 2YZKA 5DTRA 3TI9A 5KBYA 3RYTC 1KS9A 3R23A 4XR4A 2QD3A 4HH0A 2D4HA 1XK7A 3AHEA 5JD5A 2VPIA 4JP2A 1RKVA 3SG0A 1T4MA 2F3QA 2LGJA 4IIHA 2BEVB 1L9XA 3B82A 1RQNA 1ZISA 1OA0A 4TMVA 2C54A 2XD9A 4BZQA 1EYZA 3GHYA 1ZCZA 4EUSA 4AZ0B 3I34X 3DBLA 1MJGA 3ETGA 3A6EA 3CPHA 1EP2B 1Z6PA 1ZGJA 2Q3HA 3L18A 7YASA 1VJTA 4CEIA 2HO5A 1E1DA 4PFQA 1HZJA 1QQAA 2QL6A 4RIIA 4JXZA 1KH3A 4EYGA 1KJJA 2IX9A 3OP4A 5BVGA 2QN6A 1T0JB 3O8RA 4QUKA 3SY8A 1NYRA 3LO8A 4DT1B 4LF5B 2CD7A 3RF7A 3T7TA 1B6SA 1EXVA 3T3MB 3D43A 2XXAB 1QQ7A 1F2UA 4KWTA 5L8VA 3UMMA 4QGAA 1V9LA 1IVNA 2Y2VA 4ZVUA 5HCIA 3CURA 1ZU5A 2VDOB 4PHTA 4Q4AB 4EMUA 5A4AA 1LBIA 1UBFA 2BW0A 1FTYA 2CXUA 2IHBA 2QENA 2QTTA 3PQ8A 3H2JA 4L9AA 3F98A 5K20A 1UDCA 2M6SA 3HU1A 4KQWA 2ZUDA 3WQQA 2CHEA 4QO7A 1XX6A 2M6RA 4BNWA 3FHLA 1KMHB 1HDGO 1N0IA 3BIOA 4A03A 5KOIA 1OFUA 4IZIA 4BN4A 3KTAB 1I32A 1GFIA 1MRSA 2IVFA 4HB3A 4LVOA 4R1PA 4NU8X 4UTZA 4F93B 2HHHB 2EEZA 3PWSA 1SCDA 1SM4A 2ZB2A 3EEFA 2XKAA 1ZSYA 2X8JB 2YWFA 3GLQA 2AC4A 3JSXA 2CFOA 3DEAA 4PPNA 1OFHA 4QUBA 3ESYA 2I6FA 2ID9A 3K9BA 5DWVA 2ZRMA 1L6IA 3C24A 2XYGA 3ILYA 4J76A 5C81A 2AN5A 3JQAA 1BQ3A 3I5XA 4DC1A 4AJ9A 2WUFA 4PO8A 3SXPA 1E92A 4ZDJA 2M98A 2ZVDA 4LY3A 3OJLA 3KHSA 5ICCA 1VXOA 4RTLA 1KEWA 1KBQA 3ZLTA 5CD1A 4Q4JB 5JATA 1AG9A 4ZVPA 3KETA 5FBQB 1YDFA 1RQLA 2YMQA 1ELOA 3A0RB 5CNKA 4J7AA 2V7XA 3S55A 1VRWA 5JZOA 2CLHB 2Q45A 2YXDA 4QDZA 4ROTA 5BSWA 3CLRC 3RC7A 4OF4A 5DHFA 2JGKA 5KVAA 3NAQA 1Y8ZA 2OWEA 4ADSG 3GROA 4K81B 3EGDB 3T3HA 2Z09A 1I6MA 1PZFA 2ZT8A 2MSEB 2E37A 3QI7A 3S29A 2HCBA 1ZN2A 2YRWA 3G8AA 4GOJA 1T1RA 4ID9A 1JXOA 4RK7A 3EGXA 3ZXYA 2FUG6 4AB1A 4EJ2A 3LWDA 1JZSA 4BNKA 3V34A 3IKMB 5K0CA 1HDXA 1OUMA 5DHAA 1VSUA 1GA6A 3ENVA 4F71A 2PLWA 2PY6A 2QUHA 3DZBA 4BB6A 2PLRA 4HV4A 1U28C 4MSUA 4L5CA 2V6JA 1EE9A 2XRZA 2Y1WA 3B6EA 1X1EA 5KOJB 2RARA 4H15A 5BUQA 3KV3O 2XCTB 3G59A 3HA5A 4ZI7A 3Q7PA 2QTNA 3RHTA 1WTCA 1ZGBA 3GZ4A 3T1TA 4LISA 1T36A 3KSUA 2YHSA 4EUNA 1X19A 1ISFA 1Y4ZA 1PFVA 2RC5A 1QO9A 3OIVA 4BFSA 4ZO9A 3RTGA 2DFNA 5MFPA 5T7BA 1WRBA 4EKDA 1CZHA 4REQB 3GGGA 4PN7A 4Z3DA 2RHCA 2PSJA 2OE2A 3MJFA 3RREA 2VQ3A 2PZEA 3S5UA 3BTUA 3BQ9A 4URZR 4CM8A 2VSOA 3OHPA 1LSUA 4C20A 3P2JA 3PE4A 3VPDA 2XRYA 1EZ1A 1PL0A 2FPIA 2VQFB 1NR1A 4M87A 1CJMA 4DC0A 3GCDA 1SN7A 2XWPA 2VUUA 3L0ZA 4PQGA 5BUSA 1M2KA 3HN6A 1OU0A 4HXEB 3ZQUA 5D5HA 3RSHA 4MVJF 1V35A 4DQKA 5I47A 2WQ6A 1U02A 2YZMA 4MRRA 1LJLA 2G4VA 3UH1A 3F6EX 3KGDA 3SXUB 2HU5A 5A9SA 3OZGA 2LZ0A 2FSVA 3SHQA 3HWRA 5HGXA 4KFCA 3NMUF 3I04A 2WB4A 3G0BA 1LI4A 3B8HA 3NWBA 4MV6A 3ABSB 4ZHQA 4WJZA 1DUVG 2J1LA 3CNOA 5L3SB 3FTQA 1DAGA 3Q11A 3M4ZA 1H69A 4FR2A 1I6WA 4C0QC 4KWCA 5C3UA 1ECCA 4NVRA 5IHPA 4M83A 3RFVA 2W2LA 3VTAA 1UBLS 3E7XA 2XE6A 1C9YA 1YVUA 1RJWA 1QIMA 1UODA 1RJDA 3QI2A 5F78A 3E9ZA 4R1SA 2BUAA 3KLPX 3WXBA 3L0BA 3ZDZB 1GIAA 3CEPB 2GBGA 2HPHA 3BL5A 1DTWB 3GNLA 4N5NA 4LMBA 3PNMA 4GUDA 4RS3A 1R1DA 1AQNA 4O4HA 1RAGA 1V9SA 4HJXA 2ORYA 2DLCX 3VDMA 3HDVA 4FNGA 4GLBA 4KHZA 2YFYA 4C06A 1FBTA 5DOVA 5B4UA 1IN1A 1KF0A 2FP4A 2EIXA 4MUEA 3R8XA 2ZJ0A 5AKXA 1BU5A 4TXJA 4XYMA 1DXYA 1JAXA 3SC3A 3UT0A 4JDPA 4Z3OA 4UZSA 3WNDA 2CNBA 3H0CA 3ND7A 1W85B 3E22A 3IAAA 1JZTA 3ESBA 2HT6A 2RG1A 4HDNA 3JQBC 4U3JA 5I01A 3ZWQA 1M72A 2VTKA 1XAIA 4V0RA 3CSSA 4PAOA 3QEJA 5ALMA 1IHOA 2JNWA 2R4UA 3VOAA 4OIFA 4UNRA 1Z5PA 2B99A 5CXQA 4WQMA 3P2KA 4ITUA 4OSPA 2ZQZA 4C0BA 1UAAA 1CR4A 1Z0ZA 2Q5HA 3A3PA 1WMFA 1YAJA 5GIOE 1GZUA 2EJCA 4IHJA 2FQXA 3N2GA 3N3AC 4F56A 1B23P 1H2BA 2AD5A 1JNYA 3I04M 3QBEA 4WNYA 4RTKA 4BN5A 2VNKA 1RQ2A 2BGJA 1H3FA 2OG2A 1TF7A 3B2QA 4Q66C 2ARKA 2EJUA 1RS0A 3HSYA 3C7TA 4N3GA 4R3UC 5AW0A 4Q7QA 3K16A 3G88A 1YL7A 2VAXA 3G79A 2WNIA 4ZCSA 3LMKA 3IQGX 4RTQA 4QBHA 1OLSA 1GCIA 1P4HA 4GPZA 5MGNA 5D84A 4QWMA 4BXOA 2D3WA 3NIBA 5DM1A 1C9KA 1BGWA 1JECA 1GQQA 2ZWMA 1H5QA 5L3QA 2X4LA 3I8XA 1IVSA 2VHVA 2X2PA 3T4EA 2ZR9A 5IJ9B 4WSOA 3M3HA 1A8UA 2QUZA 3OLCX 4JKIA 5EIAA 2V6FA 1JLMA 1GLNA 1KZ1A 3ENNA 3IUBA 5EP3A 5AOVA 1FUUA 1T6NA 1XTQA 4LNAA 2PZ8A 4OMCA 2QI9C 3BERA 4KQCA 4FNOA 4YP7A 4Q3OA 3OSUA 5IMSA 3BRCA 4EPWA 2W2QA 1CUGA 1U3UA 2CYBA 4OQMA 5HS6A 3V4ZA 3HJHA 2YASA 3LE8A 1TRKA 1JQJC 3BE6A 3X44A 1JLSA 2HJHA 5F98A 2DAPA 4MICA 4Y6QA 3TKAA 4UOZA 5LB2A 5IBCA 2O3QA 3Q3IA 3IJPA 2ZUBA 3M6MD 3A2KA 2GD2A 3MQ2A 1YACA 3CUTA 3KKOA 4I55F 4M0DA 5C1PA 5EE5B 5JS6A 1GNQA 3AUJB 3OIDA 3N7TA 1PYGA 3TQQA 1MN6A 3CEJA 4NABA 3QKWA 3O73A 5H80A 1ABEA 1Y8RA 3K72B 4QYIB 1V4BA 2P2ZA 3E8SA 5M3BA 3N7UA 3NYQA 3M34A 1DQSA 1JHAA 1U8TA 4H7HA 4MULA 5EXEA 2O7QA 5H9WA 5BN3B 4N5LA 4AG5A 4AP6A 2R66A 5G40A 2W7TA 3B12A 1I9CA 2YV1A 3MNFA 2DWCA 3LNCA 3Q3JB 4REMA 1ESZA 4MLCA 3SE0A 2IZOA 3BMOB 3C3KA 4JI7B 4LSGA 4I3GA 3EEYA 3DJYA 4N1AA 1N8KA 3RVPA 3RFXA 4AURA 1Z0DA 5AXAA 1GSHA 4X1KB 4AJOA 2V7TA 1CLEA 3LECA 4IOMA 4DSTA 3YASA 1G55A 2RGUA 3BB3A 1YB1A 1Z35A 3ZV6A 4YCCA 5B64A 1DX4A 4TTRA 4M9ZA 5ITSA 1XEWY 2SNIE 4LYFA 1U7TA 1JNXX 2B36A 3FR8A 2APJA 1Q1BA 4MW0A 4MYCA 2R1VA 4IQFA 2CNOA 2XXJA 3G7NA 4BCBA 4DIOA 2XGJA 3C3AA 2JH9A 3Q8XB 4DBLC 1SIUA 4IP0A 4JLVA 4I46A 1XWIA 3A6KA 4PSKA 2OGZA 2IV3A 1WS6A 1OMOA 3QF4A 4ER5A 1XV5A 4UKDA 5EE0A 2GYWA 3UPTA 1GYPA 4UTRA 3TLXA 1JHUA 2MYTA 2JVIA 2FSPA 4WASA 3HU2A 1E1YA 4ZOLB 1DBWA 3HCFA 3F73A 2XI4A 1J0BA 4M1ZA 2YJZA 4PGAA 4FYMA 4DFDA 5HF9A 4LDNA 1KWGA 1ZJJA 4KOEC 1O5OA 1GVHA 4JOSA 4B9AA 2XSZA 1C81A 3N28A 2HWUA 1KBOA 2O5VA 3I39X 3PKJA 5F2EA 4D0LB 1PE0A 3E1KA 5AJVB 4BL5A 1SHLA 1E1RD 2Y1FA 3ONVA 1DBRA 4PCLA 1I0ZA 4WN9B 2RD2A 4U9UA 4AULA 2G7ZA 2IYXA 2X5NA 2WVHA 5FUYA 4IDEA 3BKXA 1VTKA 3T0IA 5A5FA 3AVQA 2W6ID 3F4BA 5CGQB 4YRKA 2MYUA 1OI7A 1W47A 1HEYA 4RMGA 1OX5A 3THXA 4HWPA 1YRYE 4F9EA 3I9V1 4FS3A 3GP8A 1WETA 1ZVKA 2Z3WA 3P20A 4X8HA 5FL7D 2F43A 3RIGA 3ZCPA 4B1FA 4W5OA 1VG9B 1V7PC 3P4YA 3PIIA 4M60A 1U63A 5AUPB 2P9TA 4YCMA 1Z2AA 5ALEA 2QSUA 3IE0A 4LOHA 1P91A 2GBLA 3CWZA 4J0FA 3ZQ6A 1SU4A 3JSAA 1HPLA 4RDCA 1SIBE 3R9KA 2CUNA 3WAKA 3G0HA 4FFMA 3EXG1 1P7ZA 1XRPA 2FK7A 5CIQA 1L4LA 1CR1A 1X9HA 2ZUTA 3G2PA 4AL4A 5K8VA 1KAOA 1MVOA 1X1DA 3DWFA 1GADO 4NU0A 1L5OA 3KCQA 1FOEB 3X2FA 3ZDRA 3OJXA 4TKUB 2QTVA 5JO0A 2Z6UA 3RSZA 1LNSA 4A8TA 2PMBA 2X1MA 1A88A 3L06A 3KKZA 4RSMA 4KEAA 3CLTC 1D6JA 3EXEB 2QU7A 1SWVA 3Q1KA 2X58A 1E1KA 4M8IA 1UK8A 3EAGA 4LZNA 1UXJA 3ORFA 3M4YA 3OWXA 4AJKA 1CJKC 3VH1A 4K0RA 3MOIA 4OGWA 4YJHA 3DV0B 4MV0A 2GZDA 2JGEA 2BFEA 3IAUA 5K6AA 1NPTO 3P9KA 4MP3A 4OQQA 4DAEA 5A71A 3NWPA 4ANFA 2GEUA 1R64A 2HF7A 2VRWA 4LSMA 4IDQA 1M2JA 2Y76A 2HI0A 1SB8A 5AKLA 4NOMA 1ZUNB 5A4MS 3JARA 2W2KA 4J6FA 1PW5A 3L07A 2BR3A 1GZ7A 1BDIA 4EY8A 3EB9A 4A0SA 1OZFA 3MBOA 4ZQFA 1CUCA 4E6PA 2R85A 2ZGVA 1YGYA 5A2GA 1CYEA 4HGOA 3TRKA 4YMTA 4JWTA 3E5RA 3EASA 2Q2WA 4QOHA 1JKIA 1ID1A 2A0YA 3X1MA 4UHEA 3H5LA 3U81A 1PGPA 2BE7A 1XYGA 2LVBA 2AR9A 4I55B 3GH1A 4FW8A 3DC2A 2FFHA 3C3MA 4CLRB 1QYDA 1K3UB 2RB4A 1GU1A 1KYZA 3N05A 2JJ2A 3FFXA 4HNTA 3HXMA 4GSLA 1Z0AA 1S2IA 1RZVA 4WFJA 3B1YA 4Q00A 1E0DA 3HDGA 4ZHQB 3PYMA 3ABRB 3F3YA 3UAZA 1IEVA 3NFRA 3TIXB 2OCIA 1C9EA 1Z4QA 2VJLA 4GBJA 1DINA 4GEKA 3V2IA 5L3VA 4XEHA 4O0LA 3JTEA 4UFPA 4IJWA 3H2GA 1VBNA 1MB2A 4FYJA 4LGMA 2G1JA 3T5CA 4IVNA 1LC0A 4EKEA 4JYAB 2FI1A 4MQ6A 3KUXA 3FTNA 3MHTA 3N2EA 2B0CA 2I6UA 2HEGA 2YZ7A 2BHRA 1M6YA 2OQRA 1WCV1 4UATA 2JHFA 3AQ4A 2ZTLA 3RC2A 4DABA 5LKRA 1HX7A 3KQNA 1RWWA 2XA1A 2OAQ1 2ZI5A 1L7XA 3KM0A 3STTA 2FR8A 3IL2A 2V9PA 1LEHA 3PNPA 1BJKA 5KWVA 1KMNA 1OC2A 4DGQA 3CWCA 5A5DA 3GNTA 3FVTA 4QSHA 4HYQA 4QYXA 2N1BA 4ZVOA 2X41A 4PG6A 3CZAA 3DC7A 4WOKA 1OZAA 1ZM9A 3EUAA 3F5SA 1RC0A 2I66A 2BFAA 5H3HA 4EI8A 3H6GA 1ZA2A 4DR1B 4XUDA 4J03A 1JHMA 1H6AA 1CYDA 3L0IB 1AZLA 3NHFA 4TROA 4BLWA 2I2CA 4EGSA 2HPAA 3NM6B 4GKJB 1F17A 3L8HA 3QW4B 4RVSA 5HFAA 1KEZA 1SOAA 2BI4A 2WD8A 2YJ6A 3K0FA 5DP2A 1D5CA 4CEIB 3ZIAD 2RGDA 2MWMA 2RIPA 2OK7A 4KNVA 3WWYA 2Q8PA 5BVGB 5EJ5A 5KVVA 4XM2A 2P9FA 1U2TA 2BEKA 3DYBA 2QE7D 1VBFA 1H5UA 1ZKDA 3LOPA 4D79A 5KOYA 2JVKA 2XUKA 4BECA 2H92A 2JHPA 4OBEA 4I4TF 4B6GA 4KP7A 2BBWA 2ONZA 3I4LA 3B9QA 3X2EA 3FCEA 3OEWA 3GMIA 2CXTA 4QBIA 2VHEA 3C45A 4RVNA 4Z3KA 1AQ6A 4PLWA 5FR2A 1NV8A 1WXHA 4U2BA 2RAVA 3OAAA 1H85A 4GSKA 4JFRA 2A4MA 1AVTA 1OYYA 2CLMB 2QJOA 1W19A 5C4IA 1AN0A 2FMKA 2QIOA 4JGIA 3WNCA 1SVUA 2I1VB 1S8OA 2FSHA 5ITZB 3WMWA 1Z47A 2XDWA 3JWPA 4JHLA 1V1RA 2YOFA 2X0DA 2YV4A 4OA5A 3S2GA 1GGFA 1KSFX 2HGZA 4ZRDA 5E7IA 1I3CA 3TD6A 1Z06A 1QRTA 3ZUGA 3C87A 1P0CA 5KPDA 4RTPA 2YR0A 1DQRA 1RPZA 2OBYA 2YY5A 3E3OA 5GZ1A 1NL3A 3N76A 3NNSA 3Q7EA 2I7VA 2VHYA 1IL0A 3R6LA 2XOKA 521PA 4DIKA 1NLMA 1R5OA 3U0VA 2HRZA 2XLCA 3NIDB 4PR0A 1OFTA 4CM1A 4X61A 1GZ5A 2PXHA 2NU9A 3JQAB 2A5GA 1PR3A 1M2NA 2FMIA 2Q5JA 2WTAA 2XCLA 3K31A 4PQFA 4J4BA 4NMWA 3TFWA 4EELA 3DMGA 3H0WB 5FFNA 4D3ZA 3PJEA 1U31A 4DY6A 1FRFS 5EZ5A 2R6HA 4Z4EA 2FCRA 4F4DA 3U4CA 4BS9A 4EO4A 1E3JA 3V9PA 4WJKB 1CE8B 1LTQA 5DDIP 3B60A 3PGVA 1DRVA 3V4OA 3B1XA 3OOJA 3OCUA 1FX0A 3TB4A 1E3TA 3ANNA 3SVTA 2IS6A 1ZVQA 1FXSA 4F86A 2AX3A 3HWWA 3OZRA 4BZWA 5C5EA 4FEAA 2HXGA 3U7HB 4KXVA 3FRIA 4W5RA 2O0KA 4M6WB 2QTGA 4EW6A 1CRQA 2AR7A 3GBPA 2FW6A 4L4XA 3ILHA 4PYQA 1LCIA 1E5QA 2CF6A 4R40A 5HDBB 3SF8B 4HAZA 3H3FA 3JQ8B 4UQPA 4MXDA 4QU0A 1GRRA 2QRVB 1K89A 1X0VA 5ALTA 1OBFO 3R7SA 1LV7A 1LX6A 1NNSA 1H94A 1T15A 1LK7A 2UUOA 4Y1GA 3KNZA 3W5HA 4D44A 3M2PA 4O0MA 1A1VA 2NMVA