1DPGA

Glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
485
structure length
485
Chain Sequence
VSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVRDCIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVAPRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFGSEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMIHDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGDAWVFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (choh(d) - nad(p))
molecule keywords GLUCOSE 6-PHOSPHATE DEHYDROGENASE
publication title The three-dimensional structure of glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides refined at 2.0 A resolution.
pubmed doi rcsb
source organism Leuconostoc mesenteroides
total genus 174
structure length 485
sequence length 485
chains with identical sequence B
ec nomenclature ec 1.1.1.363: Glucose-6-phosphate dehydrogenase (NAD(P)(+)).
pdb deposition date 1995-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00479 G6PD_N Glucose-6-phosphate dehydrogenase, NAD binding domain
A PF02781 G6PD_C Glucose-6-phosphate dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dpgA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dpgA01
4Q3NA 1RM5A 2FR0A 4BNGA 1UXJA 2E37A 4F46A 2HLPA 1V3VA 2UV8A 2JCVA 3NTRA 1P33A 2NUAA 2SCUA 3OQ1A 1CJCA 3HJAA 1C1XA 3ZHYA 3AFNA 3RUEA 1YBVA 4CM3A 1WW8A 4I9UA 1KIFA 1JVSA 5IDWA 4IGEA 2DC1A 2NSDA 3QV1A 1VJ1A 3FCOA 3PDJA 3OHSX 1ISHA 1I30A 2WWRA 2R6JA 3KYBA 1I3KA 4J7CA 4NBWA 3HN2A 5LCXA 1B8PA 2AG5A 2GGSA 4P4GA 3GN1A 4JLWA 3FD8A 1GYRA 4PZEA 3W8DA 2BFPA 2VOEA 4Z9FA 1U4OA 2W4QA 1EQUA 4CMKA 3ZWBA 3QJ5A 4E5MA 3ZWMA 5TT1A 3IL2A 2Z95A 3E1KA 1BGVA 1G0NA 3LLSA 4QEDA 2CF6A 1ZK1A 4CMJA 3EAGA 4FC7A 4GI2A 3WGHA 2A94A 4WOJA 5F1PA 1KBZA 3BTVA 2JHGA 5FF9A 3T4XA 4W6ZA 4KDFA 5IAAA 4DYDA 3BIOA 4JP3A 3UN1A 4OMUA 4B8WA 2Q4EA 3EMKA 4YB8A 3WQRA 1YDEA 2FSSA 3BA1A 1LQTA 5KIAA 1MG5A 2PZMA 4MP8A 4OSPA 1VL0A 3OJ0A 1HYHA 3FWZA 4AJIA 5EL0A 3U5TA 3ANMA 5F5LA 5JCXA 5GZ3A 1B15A 1Z75A 3B20A 2EKQA 5A5EA 5G0UA 3VTZA 2Q50A 3K8ZA 4AJPA 4BO3A 3PPIA 4CQMD 3BTUA 4A7PA 3TZCA 5T5QA 1EDOA 1KY5A 4TVOA 3F5SA 4NBTA 1PJ4A 3NUGA 1B8VA 3HZZA 2DKNA 1WDKA 1XSEA 4U6SA 2Q1WA 4K6FA 4YT2A 2VZ9A 4ID9A 4R4JA 3BHIA 1WMBA 1F17A 2P4QA 3F1LA 3WMXA 4KQWA 5TIIA 2Q99A 3AK4A 5H81A 3PQEA 2ET6A 4M86A 4KWIA 3PZRA 1ISJA 1OOEA 1V0JA 3IS3A 4ZQFA 4YBZA 5I8WA 1PGOA 3U4HA 2D5AA 3KYCB 3RBZA 3I23A 4BNKA 2FOIA 1V35A 3Q2IA 1QLHA 4RGBA 5T64A 5CFZA 1E6UA 4BO5A 2NV6A 4U5QA 3JCZA 4WGGA 3TWOA 5EINA 3FBGA 4BGUA 3RUHA 4CUJA 4Z3KA 3ZWWA 2HSDA 4WEOA 1I2CA 3E18A 1E3WA 1ID1A 4TRRA 2QG4A 4CUKA 3I6QA 2EKLA 4JJFA 5LDHA 4A10A 4A5OA 2LDBA 4KP7A 1RKXA 5C37A 5K6AC 4FFMA 3WSWA 5KVVA 5DBGA 3IKVA 4RPHA 1CYDA 1U2GA 3VKVA 5KVSA 1EUDA 3RCBA 2GRAA 2WD7B 5IF3A 3AW9A 3U4DA 5HBRA 1TT5B 2IXAA 1ULSA 3I9MA 3C1AA 1XCBA 1VKOA 4RVSA 5EPOA 4L0QA 3CEAA 4TSKA 4XA8A 3VH4A 1N92A 1U5CA 2J3IA 3OSUA 4E30A 5DOZA 4RPLA 3A28A 4IUYA 4JCOA 4NFHA 5GZ1A 3EVNA 1DB3A 4HNHA 1P1HA 5JDCC 2P68A 1NFRA 4I1IA 3INTA 3M1LA 3I4FA 2FPIA 2CVOA 2HMSA 4YEDA 2NTJA 3LF1A 4N5MA 4RO0A 1LDEA 1SC6A 2FR1A 3QWIA 4OQZA 3HNPA 3ZU4A 3GHHA 5KVQA 1AXEA 3F4BA 3NEPX 5ITVA 1I24A 4RL6A 1VSUA 5L53A 2OP1A 3JQ9A 2C59A 4IMRA 1LLUA 3DZBA 4HX5A 1MC4A 1ZK3A 2HCTA 5K0ZA 1T1RA 2YHIA 5TGDA 4BO6A 2OBYA 4E3ZA 1C0PA 1NX6A 1HL3A 5L7TA 1A4IA 3AOGA 2Q2VA 3DONA 4CM9A 3RROA 4YJHB 3G1UA 4J91A 2IEDA 2W2LA 5IDQA 2FHSA 3ZHZA 5JY1A 5AVOA 2PGLA 1AUPA 4UEOA 4HBGA 1UDBA 1PZGA 4OHUA 2HMUA 3RKUA 1VRWA 3BTSA 4K9DA 4M54A 1E7QA 1KVRA 4OYRA 4BNXA 1FDUA 4NDNE 1NQ5A 1YL5A 3JSAA 2Y67A 2RH4A 1Y6JA 4I5EA 4UUPA 5I9NA 3C85A 3RUDA 1T2CA 3JQ7A 4WLOA 7ADHA 3F9IA 1QG6A 3JQAA 3RBXA 3W6ZA 1WDMA 3RU9A 3VDRA 5BT9A 1NFQA 1H93A 2CVZA 5ER9A 3KBOA 2H5LA 3JTMA 3UH1A 4YWJA 2PD4A 4AJEA 1X14A 1N8KA 5A3JA 5JYDA 3ZZNA 1B26A 5M6DA 3KYDA 1P1KA 4DIBA 2DFDA 1DO8A 4YRBA 2QZ9A 1U7TA 1VI2A 3AU8A 4ILKA 3PHJA 2E49A 2O4UX 2X0RA 1G1AA 3GMSA 4O1MA 4QSMA 1EEHA 1XYGA 3DHEA 3S2IA 3Q9NA 4P22A 4D3FA 4KUHA 3QVWA 1ZK0A 2EP7A 3OJLA 1BW9B 3QRWA 1YBAA 4NMHA 3VPFA 1JWAB 2QYTA 3KSUA 5EERA 3P7MA 3R6DA 4J3FA 2JFGA 1P3DA 1Z82A 2DTEA 4G2NA 4PG7A 4RV9A 4EITA 3I4CA 2VTDA 1UXGA 1I0ZA 1SZJG 1YGYA 1EVYA 5H83A 5F1KA 3GMDA 5THKA 3VH3A 3WGTA 2C5AA 1PJSA 1ZVMA 1IOLA 1HDYA 2CUKA 4DBVO 2AQ8A 3ANNA 1NWHA 2O2SA 2PFGA 4NI5A 4GX1A 3GFBA 3GVPA 3VVCA 3S2EA 3F1KA 2JHFA 1HDXA 1HYEA 5TC4A 1LRKA 3V8BA 1PJ3A 3F3SA 1I3NA 2ZJ0A 1TA4A 4OJNA 5IZCC 1HKUA 1BMDA 1PS9A 1HE2A 5G2OA 1PR3A 5JYEA 4TRJA 3GRKA 5A3VA 3ORFA 2ZB7A 1C1DB 4C7KA 4FJ0A 1FJHA 3OBBA 2D5CA 4ESOA 1I3MA 3FSRA 2RCYA 3IUPA 4PVCA 3BMQA 4NQZA 4WCDA 1ORRA 2OBNA 3S2GA 3ZDFA 4WLVA 1XR3A 1LBEA 1UXHA 1WZIA 4KOAA 1P1FA 4BB6A 4GVXA 5T8KA 3WTBA 4BNMA 1A7KA 1VLLA 1GAEO 3OQ6A 4PCVA 1OC2A 2YFQA 1PJ2A 1LNQA 4P4LA 3ZGYA 1W73A 4BNTA 1GU7A 3F6YA 1SEPA 2UUPA 2O3RA 3M1AA 4PFJA 5CDGA 1BHSA 2Y68A 5G0WA 1BXKA 3MJCA 4LISA 3LQFA 2UVDA 1FDVA 2XXJA 4HKTA 5B4TA 3CXRA 3NJ4A 4PRKA 3GOHA 4R5MA 4KWHA 3DO5A 3HDYA 3CIFA 3DZHA 4RVUA 1U3UA 3KEOA 2GDZA 3HDQA 3RASA 3LT4A 1LI4A 4W4TA 1NQTA 1IHXA 1E6WA 1R66A 2VWQA 3VPHA 3TZHA 4XQEA 2O3UA 4MVJP 1AHIA 2DQ4A 4MVJD 4KTVE 4XJTA 4L8VA 1ZK2A 1SBYA 4J7XA 3ZHBA 2X8LA 4DQVA 4WLEA 4NG5A 4MP6A 2VRCA 3NAQA 4CLOA 5A05A 3M2TA 2ILTA 4E2XA 5IXSA 1QYCA 2EG9A 3JQFC 1BXGB 1ZKMA 2WMDA 1F12A 3DBLA 4YXFA 3PJDA 2D8AA 4I5FA 3EHEA 1I01A 3PLNA 4TRMA 1PZFA 4IQ0A 3ZW8A 4DBZA 5JC1A 1JWBB 1PGQA 1V3TA 4PLZA 2EP5A 3PI7A 2CMDA 3ICCA 4J1NA 2DAPA 1T24A 3GHYA 2NQ8A 2LDXA 2NLOA 3TL2A 4NBVA 1K6JA 3MJEA 1NXQA 1J6UA 4CMIA 2VYND 4M87A 4IPTA 1VM6A 2CDCA 1ZMOA 3D5TA 4LVUA 1Y8QA 1PL6A 4AJLA 4ALMA 2E48A 3TZKA 1GCUA 3ONFA 4XYMA 1KY4A 4R1NA 5DULA 3GGOA 2Q22A 4R9SA 1T1SA 2AQHA 2TMGA 4YQYA 2PGJA 4TRNA 3S1LA 4WASA 5G0TA 1LSOA 1CERA 4JBHA 4RF3A 1KVSA 3L4BA 4OXKA 2GYYA 3RBVA 4R9RA 3HFGA 5AQ1A 3JQGB 5BNTA 5EQFA 1B8UA 5L95A 1WVGA 2D0IA 3ETDA 3FNEA 5C3MA 3JQ8B 4DMLA 1G6KA 4Y67A 5JO9A 3WR5A 3QA9A 2J5KA 3AI2A 3WB9A 3EGOA 3WGGA 4BB5A 1JAXA 1SCUA 4LCJA 5B37A 5GZ6A 3ASUA 1LDMA 3GEGA 3IKTA 1H6BA 2PLAA 1NAHA 4G5HA 2VWHA 4EJ0A 2B36A 2NNLD 4HV4A 4J9VA 5I7SA 3NKLA 1IULA 3A1NA 2OXIA 3WWZA 3DR3A 1HTBA 3D4NA 3O26A 2I3AA 4OGWA 4ITUA 4QFCA 2J5RA 4TZKA 5I8ZA 1D1SA 3DC2A 4DC0A 5DDIP 2CVQA 4Q3AA 3E48A 1Q0LA 4UVIA 1UH5A 2BFAA 2VHVA 3I6IA 4B3IA 5JSFA 3KLMX 1ZXLA 3KLPX 3N58A 4JX8A 3ROPA 1ZZEA 5TJHA 4BO8A 3D1LA 5TLSA 3BHMA 2VZ0A 5MGBA 5B4VA 4E2WA 2PKQP 3ZWOA 4PLGA 3Q1LA 2J6IA 5G4KB 2O4CA 3MTGA 2CNBA 1Q1NA 4IS3A 4WEQA 4JBGA 3P2OA 1HETA 4NFSA 5EN4A 4NK4A 1PGPA 5F21A 1MP0A 3AI1A 4FFRA 3JQDA 4YAEA 4EEXA 1E7RA 4NU6A 2JAPA 3CUKA 3KM0A 3WJAA 3KHUA 2Y05A 1GUYA 5HA5A 3WG9A 3UHAA 1ONPA 5I7FA 1EBUA 1GYPA 4J0FA 4WLUA 4DL9A 3LU1A 1EBFA 4WKGA 5A02A 1PTJA 1E7MA 1EFKA 4J43A 3FNGA 1E5LA 1X7GA 4CQLA 2OMEA 5KJCA 3FRJA 3FNHA 3F5QA 2HK8A 3GGGA 1T26A 2FRDA 2QHXA 4FB5A 4OO3A 3HDHA 5BQFA 2D2IA 3ROMA 4CL8A 4WCFB 1XG5A 2FPGA 4A73A 3DBHA 1VC2A 2ZYGA 5A9RA 4PLVA 3TJRA 4EEZA 3EC7A 3ITKA 4RPGA 1L7EA 2WM3A 3K31A 2OO5A 1P31A 1UUFA 3MZ0A 1DAOA 1E7WA 4KZPA 5CP8A 4YTEA 1DIHA 1GFSA 2YY7A 3WLFA 4WUVA 3H9QA 2X5JO 1IHYA 4MVJE 1DHRA 4J1SA 3QVOA 3I52A 2Q3EA 3FF4A 4FBGA 1T2AA 5MDHA 1R4NA 2AEFA 2QRKA 3C7AA 2D4AA 4J2HA 2NVUA 1EMDA 3U4IA 1P1JA 1IPFA 5COBA 1FDSA 4CM4A 2P91A 3GRPA 2JAHA 5JCJD 2PZJA 5A06A 4BNFA 3ZWXA 3H5NA 3PJGA 4URFA 4RJTA 3ETGA 3OM9A 2CDAA 1D1TA 4OSOA 3ONDA 1LLDA 1A9ZA 4Z0HO 3ZH2A 3NDRA 1XDWA 3WYEA 1UP4A 4MVJF 3AOEC 2DU8A 2GF2A 1E7SA 3D3EA 3OA0A 2CD9A 1HF3A 3BYZA 4L76A 2VN8A 5LC1A 1QORA 5JMPA 4PLYA 3WGOA 3AY7A 1ADCA 3TFOA 1PGJA 3JYLA 1U5AA 4LGVA 2DPHA 1JDJA 2VCYA 4NJOA 5TF4A 1D8AA 3ZU2A 2XAAA 1DC6A 1UZLA 1H5QA 3B1KA 1ENYA 1HSZA 1PIWA 1VE9A 2EERA 2HUNA 4EI2A 3G3EA 3FHLA 1N9GB 2ZKLA 2BD0A 3WICA 4S3MA 1SB8A 5I9LA 2PKRA 1NVTA 1U2DA 1U3VA 4BO1A 1R12A 4E5NA 1ZJZA 4YRDA 4E4YA 4ND3A 2PWZA 4YACA 3OEYA 3DXFA 2PGDA 4CMEC 4NJMB 4CUZA 4LCEA 4NIMA 5BNIA 3DZIA 3RIHA 2AHRA 3VZSA 1B14A 3PRJA 1PWZA 5EMHA 2XXBA 1C1XB 4Z3DA 2PZKA 3V5NA 1XGKA 4XD2A 2B35A 3BMCB 3SXPA 4J9UE 4DC1A 1JQBA 2VUSA 4H15A 4QXMA 3W1VA 2YQ4A 4DLAA 3FR7A 4CLEA 4XR4A 3EVTA 3AY6A 3DMTA 2X86A 5U1PA 4S1VA 4ZQEA 3QVXA 1NR1A 4PIVA 4IJUA 4XDYA 4DWVA 2Y1EA 4HY3A 1K6XA 2O7SA 2ZTVA 4CMBA 4BOYA 3WNVA 1P1IA 4HFMA 4TVBA 4CLRB 2VTEA 5JYAA 5F1OA 4CM5A 3L4SO 1IZ0A 3B6ZA 4BKOA 3LVFO 4JIGA 4OQYA 5F5NA 4RZIA 4HFRA 4MDHA 3ZWVA 4XX0A 2JCXA 1NR7A 1QP8A 1AHHA 1WAMA 2OP0A 4ZQBA 5JW6A 1ISGA 2Y0CA 1KVQA 4CMCA 1O94A 1R4MA 1O0SA 2O3TA 5L7WA 4IQGA 3GDFA 1NYTA 3AU9A 2VYVD 1QMGA 4BUCA 3E03A 3A9WA 1M67A 1WWKA 3ZWYA 3ZV4A 5IZCA 3KETA 2HKIA 1KEPA 1NBOA 4E33A 5B12A 2B37A 3IP1A 2PV7A 2R00A 1B2LA 4RVDA 1X1EA 3CE6A 3GF4A 4PLHA 1CQJA 1B7GO 2W98A 3LT1A 1LSUA 4QT0A 3B1FA 3PXXA 2A4KA 1NPYA 4IM7A 5HS4A 1HDZA 2AG8A 3U49A 2FR8A 3ZU3A 4PRLA 5JDIC 4EUEA 3AUSA 4DVJA 1JTVA 1KEUA 2V6GA 2FZEA 1GV0A 3CPSA 1E92A 3HB4X 1TVEA 1PS0A 3HE3A 3COSA 2X0JA 3ASVA 3NX4A 3RU7A 3L6OO 4E21A 4U0JA 2RHRA 3PHLA 1U3TA 3E9MA 3CZRA 3JQBC 1A27A 4IGFA 4D41A 1U8FO 3UKOA 3HWRA 4Z0TA 1E0DA 3JV7A 1T2EA 4MKXA 3ENKA 5C7IO 3WYBA 3AUUA 3LC2O 3GNQA 2BF7A 1E3WB 2Q1UA 2I99A 5ENVA 1H2HA 1XU7A 4UAGA 4J49A 2E4AA 1ZFNA 4JROA 5A1TA 4B7XA 1TB4A 3MCVA 1O89A 2PY6A 2ZB3A 4IJWA 4P38A 5IN5A 2FY8A 3ZU5A 4JNKA 2EXXA 4KUGA 1ZSVA 1AGNA 1ENZA 4XYGA 1KC1A 1EK5A 2BGLA 4ZU3A 3TN7A 3GZNA 1GZ6A 1DEHA 3H5RA 1S6YA 3FN4A 1SNYA 2EGHA 1HDGO 1PU2A 5AXDA 1F8FA 3JQFA 4BO0A 4CV3A 2WSBA 2GLXA 4YRAA 2B83A 1YOVA 3UCXA 3EZYA 2X6TA 4TWRA 1MB4A 2AEJA 3H4VA 5DZSA 5I7VA 1ZBQA 4CJXA 1CRWG 2YZ7A 4M49A 4IQ8A 2PZLA 3VTFA 4DRYA 1YB5A 4Z0PA 3WJ7A 3AM3A 4YT5A 5FWNA 1OMOA 2ZATA 4IIVA 3OA2A 1U7HA 5TT0A 5HM8A 4XDZA 2YHIB 4I5DA 3GGPA 2IXBA 3JQEA 1VSVA 4E2ZA 3FTNA 3B1JA 4CODB 1Q7CA 3ZHXA 3WNQA 1R6DA 1SO8A 9LDBA 1E3SA 3IQDB 2BLLA 3VPSA 3PHGA 2YQ5A 1KC3A 4GQAA 1QYVA 2WDZA 3UCEA 4HUJA 1P44A 1EVJA 3T4EA 3TPCA 1C3VA 3JD1A 3MJ4A 5JE8A 1EZ4A 4YAKA 1NVMB 2GPTA 3QWBA 4FGWA 2PKQO 1HDRA 4K26A 4XB1A 4GL4A 1WPQA 4JJIA 3D4OA 3DHNA 2PR2A 4BNVA 5ICMA 1ZIDA 5IFLA 3JQ7B 4YJGB 2ZTLA 1IYZA 1YH3A 4NZ9A 5ES3A 4FFPA 2EKPA 4RQUA 4DPLA 4IXTA 1JA9A 2ZYAA 4BKPA 3DB2A 1LSJA 1I5RA 3DZJA 1LEHA 4PLTA 2AA3A 3TF5A 2AQKA 4NR0A 3AM5A 3I9OA 1LXCA 2R2GA 4L74A 3NT2A 1R16A 4PG4A 5BSHA 1GEEA 4IS2A 1N7HA 2WYWA 1BTOA 4NFYA 1GZ4A 5JNLA 5DCWA 1PQWA 5TQVA 3ZV6A 4WCFC 1FMCA 4UEJA 1ONNA 1ZSYA 2D3TA 2PH5A 1IPEA 3P5SA 1ULUA 2VQ3A 3L07A 4UUMA 1LJ8A 4BKQA 2EHDA 2JD2A 3JQCA 2IZ1A 3QE3A 4EGFA 4CM1A 1U1IA 1H6AA 3H5AA 3UFXA 1TT5A 2I6TA 3UF0A 4Q9NA 4LW8A 4BMVA 3ZI0A 3DTYA 3ULKA 5A9SB 3QSGA 1N7GA 1Q2XA 4R54A 8LDHA 4BO9A 1B0AA 3KUXA 4W82A 3FR8A 3LYLA 4D46A 1NVGA 3D5QA 2Y1GA 3NT5A 1O5IA 4GWKA 2BELA 1U9JA 3QQPA 5DCYA 4CLXA 3E5MA 4RF5A 5KWEA 2DM6A 2ZCVA 2FPPA 4GMFA 4JGBA 3U09A 4XQ9A 2ZQZA 2BRUA 2EJWA 1LDGA 1ZO8A 1ZNQO 3OMLA 4B8ZA 2P9CA 2VOJA 2O3QA 2Z1MA 1NQOA 1T4BA 3LT2A 1P0FA 4D0SA 3EK2A 2JJYA 5EQDA 3L0DA 1HE5A 1E1NA 4RZHA 2VUUA 1RM4A 2OOSA 3WBBA 4OM8A 5DBIA 3V2HA 2VRBA 2CF5A 2B0JA 1TLTA 2Y0EA 3IC5A 1MFZA 1TT7A 4EUHA 2NU6A 4PG8A 3D7LA 3C7DB 3GVHA 5L45A 3V2GA 3W4JA 3BMQB 1MLDA 3RFVA 1MGOA 1LA2A 1E3JA 4DREA 3DBRA 3N74A 4RORA 4XZ3A 1YXMA 1Z7EA 2OZPA 2WJPA 2VT3A 2QYSA 2B5VA 5T6BA 1Z74A 3GLQA 4PG5A 2YV1A 4A2CA 4X54A 3V2UA 4Q3EA 3OJFA 1MA0A 2FMUA 2DTXA 2O23A 3PGJA 3RI3A 3RC2A 2IE0A 1QRRA 1HZZA 1UAGA 1YQDA 4BV9A 3CZMA 3R1IA 5ER6A 4Z9YA 1NNUA 3DAPA 4O0LA 3U0BA 3JD0A 2BI8A 3GDOA 3DOJA 4B4OA 3NGLA 4II2A 4XWYA 4YAJA 8ADHA 1U8XX 2HK7A 2JL1A 2YDYA 3K2EA 2G0TA 5DT9A 5CG2A 4BKUA 1M66A 1KETA 2JD1A 2J3HA 4INAA 3PYMA 1GUZA 3Q3CA 4MVJI 4AJ1A 3DMYA 4IMPA 3AOEA 4DA9A 1HYGA 1BDBA 3UICA 3LSYA 4Y98A 1DHTA 3KVOA 4JQCA 5BSFA 3F46A 4J90A 4M89A 2C07A 5IDXA 2I3GA 2GZ1A 2VHYA 3VZPA 4B4VA 2NQTA 3GT0A 1PQUA 1I10A 1H2BA 1MC5A 1BW9A 3AM4A 5DNAA 2NU8A 1NPTO 4ZVVA 1MUUA 3DZKA 4ONEA 1AE1A 2Q1TA 3OF2A 4A03A 1NM5A 5CPBA 4B79A 2O3SA 2W2KA 4AL4A 4C7JA 2UUOA 1KYQA 4CLOB 3L9WA 3R3SA 1Y9EA 1P77A 3CH6A 3GDGA 1JN0A 4EJ6A 3UUWA 2DBZA 3DBLB 1YKFA 2XPCA 3ZNPA 1ZSNA 4BNUA 3OP4A 4DMMA 4RLSA 3MOIA 3WGIA 4UULA 1LC3A 1GPDG 4BQRA 1KEVA 1V8BA 3W6UA 1EVZA 1FK8A 5EIOA 1HT0A 4HNGA 1ML3A 3V1UA 2WE7A 4LN1A 3FWNA 2IYPA 3RUAA 4DQXA 3E6AA 2FP4A 3ETEA 4OOEA 4E31A 3WDSA 3PWSA 4PLPA 4ZHSA 4LK3A 4J7UA 3OETA 4IDBA 2QW8A 5L40A 2RH8A 4FR5A 4R51A 4UREA 3TDKA 3BXXA 3Q6IA 4FSHA 5CEJA 3D64A 3EW7A 3EY4A 3O8QB 3RWBA 2Q46A 5A4DA 5IG2A 3RAJA 1UAYA 3RFXA 4IDAA 3QIVA 4G81A 4EBFA 4E5YA 4M1QA 3I83A 1Z45A 4TKLA 1GQQA 2EWMA 3H3JA 3PJEA 5ICSA 5BR7A 1GV1A 4O63O 4IDEA 4IZIA 2EGGA 4FFLA 5T67A 4AJOA 2QQ5A 3DFZA 4BVAA 5FI3A 3PFWO 4OKIA 5TSDA 3E5RA 5JMWA 3KSDO 2C82A 3RJ5A 1PL7A 1RM3A 4WE3A 3OIDA 4OXNA 4IJVA 4J2OA 4XQGA 1QYXA 1ZW1A 1E3LA 2Q1SA 3GK3A 5CEFA 3CMCO 3L77A 3QVSA 5FI5A 4D43A 1YQXA 1H6CA 1PJLA 1GL3A 3WTCA 5C5IA 3AJRA 5JAQA 2UYYA 1BG6A 3OJOA 1DFHA 2I66A 3ON5A 4GGOA 5K9ZA 1B3BA 4FQ8A 3F4LA 3TQHA 4FGSA 4CV0A 3H6KA 3RC7A 2OHXA 3K96A 1F8GA 1ENOA 2GERA 3LT0A 5KVCA 4BQPA 1SAYA 5KOIA 1ADGA 2GD1O 4L4XA 4D45A 3VOSA 4AJJA 1CQIA 4BNIA 3PZBA 5JDIA 1Y5MA 1H9BA 1CDOA 4AG3A 4CQMA 1HWYA 4O59O 1UXKA 2ZJ1A 4XEHA 3LC1O 2JCYA 4UVGA 3U62A 1UDAA 1P74A 2P9EA 3DQPA 3JQBA 5KJ6A 4EDFA 4Q3BA 4UEKA 2UDPA 3O9ZA 2OGUA 3D3WA 4YR9A 1EK6A 1QV7A 3AUTA 4U6QA 1PZEA 4OL9A 4RVFA 3W4IA 2DLDA 4CQLB 3GNSA 4IZHA 5TS3A 4DGSA 2XF8A 4XQCA 1IUKA 1XU9A 3QHAA 3DBHB 1GYQA 2DUUA 2Y66A 1SOWA 1ZEJA 1A4UA 4ND2A 5AYVA 5JO0A 4E5KA 1EUCA 4ZA2A 5J9GA 3TZQA 2WTBA 4GSKA 3HUDA 6ADHA 1U4SA 3FBTA 1W0CA 4Y8VA 1PL8A 1P45A 2FN7A 4J4HA 3I5MA 3GEDA 5HTOA 1ZEMA 5JAIA 5KJFA 2NWQA 1LU9A 3AUAA 4I08A 1KERA 4CM9D 2F00A 4YAIA 1Y8RB 1R4NB 4LSWA 1D4FA 2ZTUA 1DIRA 4ALIA 2NVUB 2EV9A 3PQFA 2W2LD 2CSUA 4BNLA 5FYDA 4CM4B 1SPXA 2AW5A 4M55A 3BMOB 3GG2A 4NH4A 1N5DA 4K28A 2GO1A 2AEMA 1MG0A 2CFCA 2EW8A 5KNLA 1ISMA 4ND4A 5K6AA 1J0XO 3G17A 4ZN6A 2Q49A 2I5PO 4U0KA 1XEAA 2BMAA 4DYVA 2C2YA 4CL3A 3C1TA 3JQAD 3QWFA 5AXBA 3FTPA 3PIDA 3S55A 2AE1A 1PJBA 4IINA 4XCVA 4NBUA 2ZQYA 4J1TA 1MXHA 4E5PA 7MDHA 3H9UA 4W99A 3VKUA 4QO7A 1CEQA 1Q7GA 3RFTA 2RIRA 3VDQA 4ND5A 3K9QO 3V1TC 5JDCA 5GMOA 4FOOA 3I1JA 5IJZA 2O2YA 3IJPA 3GVXA 4CM8A 2GZ2A 1U28A 4XGIA 4FPXA 4QX6A 4QUKA 1DFIA 1QYDA 4YJFA 4NHEA 1EFLA 4GH5A 4ALJA 3ZV3A 2C5EA 3AY3A 3VH1A 4BGIA 3SVTA 4II3A 4EYEA 3RUFA 3UXYA 1LTHR 4N5NA 4MP3A 1O9BA 1X0VA 4JBIA 5A03A 5KJ1A 4MVJG 3HHPA 2V65A 4J16A 3RJ9A 1EDZA 4XJSA 1LLQA 3OFSA 3I9KA 2NADA 1KVUA 3K92A 1HLDA 1ZUD1 1XLTA 4XIJA 4EZBA 1VPDA 2H6EA 3NTOA 1PX0A 5DBFA 2EEZA 3IIEA 1HEUA 1BVUA 5J23A 1YONA 4WCFA 3PGXA 5COAA 2AQIA 4MIYA 3ZN2A 5JYFA 4R1UA 2JFFA 1LRJA 1UP6A 5T57A 1ZXBA 2HU2A 1UJMA 1WNTA 4KTTE 1AXGA 3LF2A 4PG6A 1MX3A 1KEWA 3RKRA 1CETA 3CINA 3WGYA 2O7QA 1DFGA 1WLYA 2PH3A 4XGNA 3WWYA 4BO7A 3I9JA 3UGKA 4BNNA 2OORA 4QECA 3ZWPA 1R37A 3SC6A 4I8XA 4L4SA 2HJSA 4BNHA 1Y1PA 2V7PA 4E0BA 4MPDA 1DRWA 1I2BA 3DZFA 2BGMA 4CR8A 5IXYA 4K6CA 1R4MB 4R16A 5U4QA 2CY0A 4FIZA 4IBOA 4OIMA 4MIEA 3NDJA 1X7HA 1HE3A 3H2ZA 3PHIA 1TXGA 4LSMA 3SEFA 3BMNA 1F14A 1N2SA 5BSGA 4N18A 1P1RA 5HRUA 2BFMA 3G49A 4BS9A 4ZICA 3WGZA 4J1QA 3S2FA 4ALNA 5L3ZA 4ND1A 1W6UA 3BTOA 3O4RA 2V6BA 2IYOA 2Y0DA 4D79A 3U3XA 2C29D 2B4RO 1M75A 1OZAA 3G1TA 4GKVA 2J8ZA 3KEQA 2X1HA 4GVLA 4EW6A 5COQA 3X2FA 1EE2A 1PSDA 3DDNA 3ZWCA 4B3JA 4N54A 5DOVA 3I9NA 4F3YA 2IDZA 2QRLA 3Q0EA 2AXQA 2GZ3A 2C2XA 4YCAA 1ZK4A 4GKBA 4LRTB 4R41A 2GN4A 3PQDA 3ST7A 1P0CA 1WXDA 4XYBA 3UOGA 2VHWA 4LMPA 4YA6A 1A71A 4NJMA 1LSSA 4ZQHA 2X0IA 4ALKA 4XB2A 1K89A 1OBFO 3GA0A 4OKNA 4PLCA 2VRCD 3ABIA 3E9NA 2GR9A 1BDMA 3DOOA 3BMCA 1NTOA 2OL4A 4TKMA 1PR9A 2TMDA 4NPCA 3H7AA 1YBMA 4BNYA 2J5QA 4NNJA 4G65A 2BH9A 5CEEA 2C7GA 4GGPA 3WQSB 5EJ2A 3L6EA 2ZIZA 1LX6A 2AE2A 4RDHA 3DAFA 5TRTA 3JYNA 1PGNA 5KJEA 3NJ8A 4DTIA 4BL5A 1RJWA 1BVRA 3DEYX 3ZCXA 3GVCA 2I9PA 4KDEA 4OXYA 4CLRA 4A27A 3L4BC 3PFFA 3QLJA 1H9AA 1K5HA 3OEWA 3GZNB 3TOZA 3ADPA 4RF2A 1FF9A 1S7CA 4WK6A 3KSZO 1B16A 3HADA 2ZB8A 1YOVB 4OH1A 1LDBA 3MWDB 4BGEA 4MVJA 5G0VA 3HFSA 4NBRA 1YVEI 1DDOA 1VKNA 4XYEA 1GPJA 4PGFA 2O48X 1EQ2A 2PK3A 2X58A 1XHLA 2Y1DA 2ZK7A 3GC6A 3DWFA 4QQRA 1QV6A 3UW3A 4IXWA 3GR6A 2BFOA 1MV8A 4L73A 4UUNA 5TX7A 2E82A 5KKAA 3AI3A 3BZUA 2YHUA 4YT4A 4B3HA 3TSCA 2GSDA 4J4TA 1H0KA 4LVCA 3OQBA 4XKJA 3H9JA 2Y99A 1K6IA 5JS6A 2VT2A 3WFJA 3INGA 3QWAA 1RWBA 5A9TA 5JBIA 5A5FA 3A06A 4IDCA 5G0SA 1LQUA 2VYNA 2H1SA 3JYQA 2WD8A 1BSVA 3FPLA 2OUIA 5JAMA 4W9NC 4RLHA 4F45A 1PJQA 4R3NA 1EUZA 2HK9A 2Y1CA 5AOVA 3TOXA 3K6JA 1DOHA 1XQ6A 4GBJA 4Q3DA 5CPFA 3EUWA 3CKYA 1ZH8A 4GWGA 4DUPA 3WQQA 4FJ1A 1HE4A 3OIFA 1RYDA 4CR7A 3F47A 2PNFA 4RCVA 1DRUA 1J49A 1YJQA 2EF1A 2Z5LA 1Y5RA 2HAEA 4LMRA 5GY7A 2YJZA 1C0LA 2IEBA 3QVTA 4WECA 3WMWA 2HJRA 1P9LA 2J3KA 3UVEA 2BHLA 1N1EA 1HDCA 1QKIA 1I3LA 1GUFA 4BNZA 2DTDA 5DP1A 4B7CA 3SJUA 3RUIA 2DVMA 1LDNA 3LK7A 4WNIA 2X9NA 2P4HX 4PLFA 1VJTA 5THQA 4R1SA 3K5PA 3U9LA 3VHRA 3ANLA 1E3EA 1YQGA 2P5YA 2Z1NA 3GN2A 2DPGA 1E1LA 3TNLA 2G82A 3WGQA 1T4DA 2Y1OA 4YT8A 1I32A 1BRMA 5FEUA 1ARZA 3KO8A 1XQ1A 3WYCA 3QW2A 4ROSA 5JLAA 3SBOA 3BAZA 3EZLA 3H3FA 5JXWA 5IZ4A 2PTGA 3IDSA 3KZVA 5H82A 4AVYA 1BWSA 3I9LA 3JQAB 3KYCA 3G0OA 4CV2A 1X0XA 3HN7A 4GX5A 3KTDA 3WBFA 2B4TO 2G1UA 3H2SA 5L4NA 4JXKA 5DCUA 2VWGA 4XR9A 1TI7A 4Q39A 2XOXA 1DC4A 4FOSA 3PHHA 5CAEA 3KYDB 2C54A 2ZTMA 1O8CA 1R15A 4OAQA 2J3JA 2GN6A 1M76A 5B4UA 2Y1FA 2X4GA 3ICPA 4WOKA 4D3DA 1YJ8A 1L1FA 1VJ0A 2O3JA 1KOLA 1I2ZA 4E32A 5CDYA 3JD3A 4YJDA 4FDAA 5KCZA 2UAGA 1DPGA 2WD7A 3OIGA 3VZQA 3RUCA 3E82A 1OI7A 4GLOA 3SX2A 1KVTA 2GUGA 4UVDA 1B3RA 5L7YA 4O6VA 2DBVO 1JKIA 1GCOA 1ZJYA 1V9LA 4FCCA 3W8EA 4E2YA 5B1YA 2VWPA 1D7OA 2X9VA 4E12A 3RSHA 4ALLA 1CF2O 4CM6A 3GZ4A 1O6ZA 4R5HA 2PD3A 3AWDA 1DIBA 2VHXA 3DBRB 3NTQA 1TEHA 4JP2A 4MKZA 4I5GA 3GNTA 4H16A 1D3AA 1YO6A 1I36A 1GR0A 4UUOA 5ILGA 4NK5A 5ENDA 2IODA 5HS6A 4L75A 5AXCA 2DBRA 3CTMA 2NTNA 3N7UA 2QX7A 4YJGA 1HZJA 9LDTA 5ITWA 4PN3A 4Q3CA 1XIVA 4BMSA 3VPXA 5JY6A 1JVBA 4I9HA 4IDDA 3PJFA 3D4PA 1RYEA 1K2WA 3MWEB 1JLLA 4YJHA 5BSEA 4YVFA 3ZNOA 2C20A 4BKRA 1DBVO 1LDYA 1ONOA 4IY1A 3LDHA 1IL0A 4D42A 3JD2A 2C0CA 1AN9A 2W8ZA 5JCJA 2GNAA 4MJLA 3DL2A 3PYXA 2B5WA 3DMTC 1ISFA 3E8XA 1IE3A 3JD4A 5AXAA 2PA3A 1DIGA 1J5PA 3PP8A 1M2WA 3IUSA 4MVJM 4OOFA 1RM0A 3Q2KA 4BHTA 2H9IA 3GAFA 4FS3A 4GX2A 1C14A 2C7VA 3ROQA 5DF1A 3OECA 4AICA 2QZZA 3M2PA 3NRCA 3VH2A 1X7DA 4R68A 2W2KB 3LC7O 4TMFA 5A9SA 4MO2A 1Z7BA 1LUAA 4R3WA 3KB6A 1E5QA 5I7EA 4FFOA 4MKRA 5ADHA 1X13A 4RPKA 5TNXA 2RAFA 3ITDA 2IZZA 1FDTA 2HO5A 1HSOA 1OC4A 3L9XA 4I9NA 4ZJUA 1EVIA 4GMGA 1YE3A 3K30A 4PVDA 2EIHA 4Z6KA 1NFFA 3T7EA 2HMVA 2X23A 3V1YA 3R3JA 1HLPA 4HP8A 1YL7A 2DBQA 1NASA 3LZ6A 1JAYA 1A5ZA 2X0NA 4U8GA 2R00C 2POQX 1MFPA 2NACA 4EUFA 4H3VA 2FZWA 2JFHA 3RC9A 2B69A 3T7CA 1JU9A 4O5OA 3CSDA 1C0KA 3GFGA 4HWKA 1FXSA 2FWMX 4IIUA 2X7HA 3C24A 4KQXA 1Q0QA 3VPGA 1VL6A 3MTJA 4ZRNA 3QP9A 5L51A 3AFMA 3W8FA 3MJSA 1LC0A 1YWGO 3A4VA 4WJZA 2BI7A 2A92A 1DIAA 1T25A 4DLLA 3PWZA 1UR5A 3IP3A 2HQ1A 5DN9A 3ZV5A 1PWXA 1SOVA 3SLGA 4CR6A 6LDHA 4K1LA 4CMEA 1YRLA 3NGXA 2DFVA 4IDGA 2IRWA 4CMIB 1JKJA 3UAGA 2NTVA 3DFUA 3VC7A 4F6CA 1Y8QB 1OAAA 4J0EA 3Q11A 2DUWA 2HMWA 3GVIA 3OH8A 3JYOA 2VUTA 1J4AA 4FD3A 1XA0A 3FPCA 4RF4A 1C1DA 1DSSG 1ZMTA 4WPGA 2G17A 1YS4A 1IY8A 2EJVA 4MVJH 1E1KA 4YYZA 1WZEA 2VNSA 1E6EA 5TJ9A 2RBEA 3B70A 4L4RA 3DAGA 1HDOA 2G76A 3KOUA 3PK0A 1DLJA 3RC1A 2VYVA 5EESA 3RQSA 4RQTA 4HFJA 1EE9A 3UCFA 1SEVA 2VNAA 1Z6ZA 3GUCA 3OJEA 1N1GA 4HXYA 4QO8A 4AJHA 5ILOA 4BIIA 1NWCA 2EW2A 3LLVA 3WSVA 4RVHA 1W4ZA 1PJTA 2WYVA 2ZYDA 3RD5A 1R0LA 1ZCJA 5KTKA 4CQMB 1NPDA 4B4WA 3GPDG 2W90A 2RHCA 3FNFA 4HADA 4TQGA 2FSVA 3EDMA 4FW8A 1UZNA 4CM7A 5C7LO 1DJNA 4B4UA 3NYWA 1DAPA 4A26A 4BO4A 4Y9DA 4AJ4A 4MIOA 3D3WB 3KXDA 3O03A 2G5CA 3R0IA 3SLKA 3PTZA 1SB9A 3GQVA 2AMFA 1QYWA 3TRIA 2X9GA 3M6IA 4PZDA 4CMAA 2OFPA 3C7CB 1Q0HA 2ZCUA 1E77A 4N7RA 1QR6A 1XKQA 3DZGA 4DIOA 3ADOA 1IB6A 2QRJA 3WOHA 1F0YA 5CDUA 3VZRA 4J4BA 1QXSA 5A04A 1UXIA 3U4CA 3WIEA 1BXGA 1IZ9A 3RVDA 2HRZA 5C7OO 3O8QA 1U3WA 1I33A 2PD6A 1GADO 4J6FA 5JC8A 4MOWA 1MXFA 3WXBA 4Z9XA 1GQYA 3WX0A 1O95A 3JQ9C 3S8MA 3JQ6A 2P2SA 3ROKA 1ENPA 5L9AA 3NT4A 1R0KA 2V6MA 2Q4BA 4CMGA 1NAIA 1QLJA 3H9EO 4DXHA 1X1TA 4KUEA 1UZMA 3DHYA 3HQ4O 3MOGA 4DLBA 4H7PA 4U7WA 1F06A 3TL3A 5JAZA 1ADFA 1UDCA 2GASA 4WLNA 3NV9A 3INRA 4BNJA 2I76A 1QSGA 4R1TA 4WLFA 4DQUA 1H6DA 1YDWA 1GTMA 1PEDA 3WS7A 1KS9A 1NHGA 3L6DA 3HSKA 3C1OA 2NU9A 4MINA 3D0OA 4CPDA 4JN6B 1A7AA 4FFNA 5JFOA 5F3RA 3JQGA 3GG9A 4NU5A 3ZWAA 3PIIA 2GN8A 1E1MA 3C3XA 4YDRA 3HDJA 1CIVA 3DTTA 3JQ8A 4W9NA 2GN9A 3PYLA 2YFHA 4DPMA 4P4NA 2X5KO 4Y6RA 3ZNNA 4BMNA 2A9FA 1V3UA 2D59A 3STHA 4CM8B 1C0IA 3O38A 4YJFB 1V6AA 2GCGA 1DRVA 4LRSB 3BHJA 1PQPA 4D7AA 2QIOA 1YB1A 4CLHA 2HMTA 3Q9UA 1R0SA 3WFIA 5U9CA 1PJCA 4CMHA 2X22A 4BGVA 2JKVA 2NM0A 2WYUA 4BO2A 3IJRA 1HRDA 3ENNA 2VZ8A 4ZD6A 5T73A 3GEMA 4RVGA 4YPOA 4AJKA 1YL6A 3QY9A 1E7YA 4IDFA 4FJ2A 5JPIA 1LLCA 1LRLA 2P5UA 3HG7A 2H63A 3MJTA 3PDUA 4AFNA 4R01A 5IDYA 2HRBA 4GX0A 3P2YA 2CDBA 4M8SA 1DXYA 4RDIA 4ZRMA 5G4KA 2BKAA 5CHEA 1Y81A 3K2BA 5CDTA 1T2DA 4N5LA 2B4QA 4PLWA 3EYWA 3H9GA 4B7UA 4WNCA 4D3SA 5KKCA 1I8TA 5L4LA 2NVBA 2YUTA 4UVHA 4F6LA 1XELA 3CMMA 1YB4A 4ZQGA 4KMSA 1Y8RA 3A14A 3H65A 1Z73A 1X15A 4GPD1 4W7HA 1K0UA 1DC3A 2NU7A 1GEGA 2Y93A 4TZTA 3JYPA 1W8DA 3BMOA 1CWUA 1PS8A 4A0SA 4FN4A 1GZ3A 2E6UX 4R69A 1GY8A 3KV3O 2A35A 3GY0A 1A72A 1M6WA 2IZ0A 1XWFA 3I3OA 4YAGA 3X2EA 1H94A 3HB5X 2O50A 3GPIA 2JD0A 4DIFA 3BMNB 3WIDA 1GDHA 4EJMA 2D1YA 2HDHA 4UVEA 4E13A 4JK3A 1DLIA 1L7DA 2Q2WA 3GUYA 4GAEA 4AJNA 5CDSA 4ZGWA 1WP4A 5T8KC 3DBVO 5HWSA 3K73O 3ONEA 4CV1A 4QTZA 5G4LA 5L4SA 3KRTA 3GAZA 3IOYA 3MJVA 1PZHA 3VAZA 3H8VA 1DJQA 4C4OA 3VVBA 5I9MA 1NQAO 2V6FA 1G0OA 1A9YA 4XRGA 3ZWNA 4BV8A 3MEQA 4BNWA 1M6HA 4GLLA 1BXZA 1Y7TA 2NVWA 1NP3A 3IMFA 3ZNQA 4XRRA 4CLDA 3PEFA 4RPJA 3FI9A 1WDLA 3PVZA 1DC5A 3GH3A 3IAHA 1ISIA 5CG1A 3E9QA 2Q2QA 1OFGA 2P9GA 2F1KA 1JKFA 3PLRA 5FFFA 4HFNA 4Y6SA 3P19A 4E6PA 3TFQA 1K3TA 2I67A 3PWKA 1ADBA 4GSLA 4XIYA 4Y6PA 5BNFA 3WLEA 4DPKA 1SMKA 1GD1O 1JW9B 5DP2A 4IJKA 2YYYA 3OICA 5LDGA 1WMAA 4AJ2A 2YW9A 3SJ7A 1HXHA 2ZB4A 1FDWA 1Q7BA 2WE8A 2YV2A 3NDIA 4YQZA 3ZW9A 3QWHA 4P8RA 1E3IA 2VHZA 4FC6A 1VL8A 2I65A 2X5OA 2WEKA 2YV3A 4W7IA 4D0RA 3W4KA 3TZ6A 1T2FA 2CZCA 2Q45A 1GQ2A 3G79A 4XGKA 1NHWA 2YDXA 1N9GA 2BGKA 4TROA 5IN4A 3SC4A 3DOCA 4L9RA 4JJGA 4PZCA 2DT5A 1Y9AA 3C8MA 1UP7A 4QFDA 4XYLA 1RPNA 4D44A
chains in the Genus database with same CATH superfamily
4C4PA 3A3OA 4L9AA 3ZE6A 1R74A 3EEQA 1SKUA 4IJ5A 4ARAA 2ODTX 3CNEA 2GHRA 1UXJA 1SUAA 2E37A 3THWA 2O1WA 2Y9MB 3WBJA 1M2FA 3L0YA 1RZVA 2LCFA 3BMXA 5CT6A 5GGYA 2NUAA 1J0CA 4R9VA 4NYJR 4X1OA 1WPXA 4QICA 1XRRA 4R7TA 4BYGA 3K70C 1YBVA 1WW8A 4GOMD 3QUSA 8ATCA 3G2JA 4IGEA 2DC1A 5K09A 1VJ1A 1LX7A 2B7LA 2PXXA 2C57A 3OHSX 1C3XA 4A2QA 5HP4A 3Q5EA 1RLOA 1RJDA 5JD6A 2R6JA 2WIKA 3VBEA 5FWXB 3PQCA 2BY4A 1M7GA 1YZTA 3KKLA 3GN1A 4JLWA 3FD8A 2J3LA 3DKVA 2R6R1 4IIXA 4IIDA 3QENA 4B48A 3W8DA 4MK4A 4Z9FA 3QXXA 4MRVA 4NMXB 5EJAA 5GOZA 3N6XA 5INTA 4IAOA 1D4ZA 1EQUA 2SHKA 4ZC8A 5DI3A 1GL7A 4GI1A 3QJ5A 4IILA 4X8LA 2HLDD 1F51E 4L5BA 3WRXC 1AMNA 5BQPA 2JB9A 5TT1A 3MTBA 1BGVA 1G0NA 1JDPA 2X0KA 3AJDA 4QEDA 1MBZA 2VKQA 5DYTA 4KPFC 4CMJA 3GYGA 4PS1A 3OLWA 5EJ6A 3EAGA 1U0BB 1KAEA 2ZE7A 4BNXA 3W5VA 3N2IA 1Z0DA 3OTGA 3U61B 1DV1A 2A94A 4FU0A 4K2HA 5F1PA 1C4OA 3BTVA 1KBZA 1V5WA 2JHGA 4W6ZA 4UU0A 1M34E 1G8SA 3PC4A 1QVAA 3IKLA 4DYDA 5IAAA 4KN8A 1HNXB 5JWOA 2H9AA 4OMUA 5LXTA 3PEUA 1E1YA 4E15A 1C8VB 3EMKA 2AXNA 3IEXA 2H4XA 3P0JA 4ZOLF 3WAJA 4KH1A 3GT7A 3TQSA 2FN8A 3DQQA 1EZZA 3GLFA 5NLLA 1T34A 4HUQA 2OBXA 1J00A 4MP8A 3BE8A 3IQZA 4KYTA 1OX4B 4YGYA 4RYLA 3FOCA 4QREA 3M4YA 1U0HC 2HBRA 2ZIUB 3PQ6A 2Q41A 5KHLB 3RHTA 3F2IA 1ZUHA 4MRNA 3B20A 2EKQA 2PXAA 3ET5A 3M4JA 4W5TA 5IVDA 2Z6VA 3VTZA 3RVSA 3Q0IA 1T4CB 4AJPA 3WMGA 3BTUA 4MDFA 1OWMA 5T5QA 5I9BA 1KY5A 3WK9A 5IMSA 2JGIA 4TVOA 2BBTA 1T5SA 2OCKA 4DSAA 1M54A 4NV3A 4HGOA 4AAYA 4P3KA 2DKNA 1WDKA 2IHKA 2JLBA 4OP2A 3C3AA 4H77A 3EFBA 4U6SA 3DM5A 2Q1WA 5K3DA 1EI9A 1LJUA 2JBHA 1FFDA 3RIGA 3WKDA 4EG7A 4G0WA 2VT6A 2VZ9A 2E18A 2JVJA 1C9EA 3BHIA 4ZI2A 1F17A 3F1LA 4LZJA 1JEAA 3R6TA 4PFQA 1XNQB 1QNFA 5F4ZA 2WHRA 1YC5A 1H9CA 4KWIA 4JUIA 1H8HD 2FXIA 1MOQA 1TF7A 3G82C 3N2YA 3NM4A 4KFTA 1OGYA 2FOIA 4ZVTA 5FBHA 1BCRB 2J9FB 4ECAA 4RK6A 4UFOA 5JBQA 1UKVY 1BROA 4BO5A 5ELMA 2L82A 4ZYUA 4AULA 3O1IC 4I8DA 4B3CA 1NMZA 4KXNA 4BGUA 2BEUB 3AI7A 4RE6A 3ZWWA 3E53A 3BL6A 3G02A 3NH6A 2WK1A 3E18A 1ITZA 4TRRA 2OESA 4RD6A 3I6QA 4QA9A 3OD5A 1FS6A 4BFCA 1KGSA 1G8HA 4IV8A 4OG2A 4UAVA 4HDKA 4QHTA 1FW8A 2OTCA 4A10A 1GA1A 2LDBA 2Z98A 1RKXA 4MTCA 1X92A 1XZCA 2C00A 3KYIB 5C37A 5KVVA 4HWRA 4CG0A 3IKVA 3L40A 2J6CA 4BN5A 4II7A 2JEOA 3DC7A 1WOMA 1OBOA 1T10A 1QHYA 4QQKA 5IF3A 3LAWA 2JGEA 2IXAA 1C30A 2CLDX 3I9MA 2NPIA 2I3ZA 3GGSA 1VKOA 2XWJI 4ZVMA 2R65A 2ZXEA 3P45A 3TZEA 2H3HA 1QVVA 1DTEA 4XA8A 4K6KA 2J3IA 1NE2A 1YBFA 3U9TA 2HNAA 2DOKA 3T52A 3TR5A 4RPLA 1SCIA 1IXKA 4IUYA 3LQ2A 2ACKA 4JCOA 5DHPA 1Y8AA 1N4AA 3EVNA 1KI1A 3O83A 2ZAMA 1B6SA 2ZG6A 3KPVA 3INTA 3M1LA 3I4FA 2WUDA 2CVOA 5ITZA 5AR1A 1U28C 3COVA 2K7ZA 1Q92A 4RO0A 1LDEA 1WCIB 4P4TA 2JGKA 1P0MA 5HZHA 3MHTA 1LFDB 4OQZA 1K1EA 3ZGZA 2CYAA 3QNMA 3R24A 5SY4A 3RRXA 1TL7C 2ZCJA 4IWYA 1I24A 5L53A 1G9TA 3AV0B 2OP1A 2I62A 1YB6A 4Y0NA 2WA2A 4IMRA 1LLUA 1BMFD 3BBLA 4HX5A 4D6YA 1MC4A 3V7FA 1QMHA 4DJEC 2JEZA 5K0ZA 3ISVA 3O94A 5EUBA 5J59A 3Q10A 5FOWA 4KXUA 5ALDA 2ATXA 3DONA 3HBFA 4CM9A 1UM9A 4LEIA 3RROA 1GZ5A 4LWPA 2C3OA 1TTPB 3ZDQA 2FB9A 1K5PA 3C70A 2W2LA 5EMNA 3DE6X 4NNPA 4M9SA 3V1KA 3ZHZA 2NUTB 4WA8A 1X8KA 2PGLA 4UEOA 3IUYA 3BL5A 5LA6B 1Z6PA 2VH1A 5IVHA 1UDBA 4OHUA 2WABA 1VRWA 1S01A 4K9DA 2OT3B 1KVRA 1GNRA 1SK8A 3IJEB 1YRWA 2R6GA 1NW3A 3MD9A 4M54A 5FBLB 3W2IA 4O3MA 3TW8A 4E1BA 5E8RA 1RHMA 1GKLA 3ZHCA 4I5EA 4V39A 2IU4A 2IIBA 3NG1A 4JJ4A 5LQCA 3H3XA 3AR6A 3JQ7A 4U7FA 3DYVA 3LRPA 3LUFA 5ILQA 3L8ZA 3RBXA 1FP2A 3U6BA 3TAHA 5C51B 1NSYA 2QYHA 3NZEA 1H93A 4G5FA 2QBYB 5FBZA 2CVZA 2OPHA 1WCXA 4UAJA 2QG9A 5ER9A 1KYZA 2H5LA 1PFKA 3CU5A 3ZWDA 4UXIA 3G0BA 3W5UA 5GOTA 3SBEA 3ZZNA 5JZMA 1R0YA 1VYHA 1KMQA 2XGSA 5J4HA 3T41A 1V47A 4P6VF 4Q18A 3NBAA 4JLKA 4X44A 2C7QA 4DIBA 4QYIA 2BEKA 2H5JA 2M6LA 3RO7A 4YRBA 4WOCA 5JD4A 4EHDA 2O4UX 5IYZF 3SQLA 1QFJA 1T4GA 2ZUUA 5I9IA 2X5XA 3PX3A 4IVPA 4RKRA 3FCXA 2RHOA 1KQFA 1OCEA 1ZOSA 1XRSB 2EKBA 2PFSA 3GLUA 3OJLA 3T5CA 3L2OB 1YQQA 3VISA 5BRJA 2QORA 2W6NA 2IXTA 2AZMA 2FNAA 3AIOA 4N6NA 4WY8A 5HZMA 1JWAB 2XWQA 1FJXA 1Z33A 2TYSB 2CMFA 2VJBA 4H1UA 1RXCA 2RH5A 1LK7A 1XLUA 3KB2A 3R6DA 1SVSA 4J3FA 4IIFA 3ZBQA 4HC4A 1TOAA 2IOFA 1Z82A 4G2NA 3OCYA 4OF4A 4PG7A 3T15A 1OHHD 3IMEA 4EITA 4LUCA 1AV7A 1UXGA 1M6VA 1L1RA 3PPWA 3QXJA 4C2BA 2Q0SA 1G4UR 5AT1A 2GPNA 5THKA 4LOIA 1XPRA 1JHUA 1HX7A 1PJSA 2O1EA 1AS0A 2PO5A 4CKCB 2BFBA 1HDYA 3ANNA 4DBVO 5H59A 3CVVA 1NWHA 4BX8A 1W9HA 2O2SA 2PFGA 4C7OA 4KEAA 3AEKB 2KBEA 4BFWA 1VG1A 5EMKA 3EXIA 4F1JA 3JPWA 2ZYTX 4HAXA 5TPWB 2P2DA 1FEZA 3EG5A 3TG2A 2PMFA 1P2DA 4E4TA 4DV1B 1TA4A 4OJNA 3KWLA 2ZYUX 4K81B 5IZCC 3ASZA 2XUPA 3RRNA 1NDQA 1P6XA 2R44A 3LHFA 3T8YA 5LNK1 5LLDA 3LPDA 1IQRA 1XEWX 3OCVA 2YZ2A 3ROFA 3EP6B 4ZV9A 3H17A 3QU5A 2ZB7A 2CXPA 4FJ0A 3BCSA 3B8EA 3BCUA 1DGQA 3IWDB 4ESOA 4KR9A 4KPEC 1PK8A 1QS0B 3U3ZA 2FGJA 2IDJA 1ORRA 2OBNA 4JITA 3TLCA 2AB0A 3QLVA 1WPRA 1FFSA 3GRRA 2J67A 4MCHA 1WZIA 4OBWA 3PUKA 5TQ0A 4KOAA 4REOA 2ZIEA 2ZOSA 3V46A 4B75A 4UBJA 1WDTA 2KMLA 3WTBA 4G1FA 4JIMA 1C29B 3VX4A 1W29A 3ANSA 1GAEO 2FK7A 2QNIA 4P4LA 1LNQA 3ZGYA 4ESEA 3VNUA 1CS4C 1NLFA 1CJBA 2YIJA 3FWHA 2E4YA 3M3PA 4PSAA 5DV9A 5GP1A 2DT8A 4Z2AA 5FBVB 1Z0IA 3P4XA 3KG2A 3B51X 1M74A 2I2AA 3E58A 4ETNA 1FJ2A 2FLWA 5IYZB 4TVSA 1YQEA 1Z6QA 1OZGA 2IOFK 3LQFA 1GN9A 3CQ9A 3PNOA 2ZWVA 3K0AB 4EI8A 3PDHA 5K51A 3J81A 4XSHA 4OHCA 1SHLA 4C43A 4D6XA 1Q1GA 3JQPA 3IP8A 1R9GA 1FMJA 3GOHA 4R5MA 1DIOB 4ILEA 4EKIA 3HDYA 3OT5A 3JALB 3LQYA 1ZR4A 2B1RA 2W48A 1RAAA 4RKEA 1E69A 4ESHA 4QPDA 4M0DA 1FTYA 1IMJA 1TKRA 3ZK7A 4Z7NB 4U2KA 3LT4A 2REQA 4KX3A 5GV8A 1JG2A 4LXGA 3LPLA 4LV5B 3TZHA 1W75A 5DEOA 2APJA 3VKGA 3PS9A 2H07A 1V45E 2N75A 4GNRA 4KV9A 5AQEA 3ADCA 3FOZA 1AHIA 1JSXA 2FE4A 2VPZA 3G89A 1BNCA 1QOPB 3U81A 4HLCA 3VYUB 1SBYA 4KKVA 1BOOA 1KI7A 2IU3A 1CY0A 3M5DA 2YJGA 5FUQA 5FYQA 1MC1A 1CLEA 1XRPA 2D06A 4NG5A 3NAQA 3LCRA 1Z5NA 3PUZA 4MS1B 4TXLA 4X45A 3WLRA 4XWKA 1W5TA 2PMWB 3G5LA 3KL4A 4P98A 4E2XA 2C9OA 5K3OA 3FFAA 1ZKMA 5LD2B 1KDVA 121PA 3PJDA 2OCGA 3LQ4A 1ORDA 1BC5A 2VH5R 4F6RA 4L28A 3H7IA 3KZOA 4X8HA 1YA4A 3PGKA 1BJTA 1VZ3A 2OVBA 4IQ0A 1QHIA 3B2QA 5DWVA 3RUPA 3A4LA 1V3TA 2XKJE 3PI7A 2K6GA 3EW9A 5E6UB 3KAQA 4ENWA 3ID6C 3ICCA 1W47A 3KUDA 4J1NA 4XDHA 2HLDA 2NLOA 2UUAB 4NBVA 2ERCA 3W0LB 1G3MA 4G3XA 2VYND 3C3MA 1X7XB 4M87A 2QD2A 5DXJA 4MA0A 3TVDA 1VM6A 2CDCA 3D5TA 1E0AA 5ADVA 1Y8QA 1I79B 3A1WA 2C1EA 4AJLA 1UWKA 2IX9A 2MR5A 1FFXA 4R1MA 1M1NB 1M33A 5CFRA 1KY4A 1ZESA 1BA3A 2FSHA 4R1NA 5D7NA 4ZZ2A 4UBOA 4Z51A 3GUHA 4YQYA 4R9SA 2AQHA 3TSZA 4EJSC 4M36A 1I4EB 2OOKA 2X5NA 2G83A 2VXCA 4FD2A 4TRNA 5B3AA 3S1LA 3MJHA 5C1IA 2FEKA 3V34A 3O4VA 1CERA 2WWWA 3CCFA 5LZ4A 1VMDA 2VF2A 2ICAA 1MVNA 3WRXA 2PUWA 3NWPA 2IOQA 4M9CA 3SEAA 1NQUA 5AQ1A 5BNTA 2NYAA 4TTRA 1K5GA 5EQFA 2PVSA 4KN5A 1L7MA 2V7WA 3EPAB 3HXQA 1HG0A 1OKKD 3WKBA 1OT3A 3WB9A 3WGGA 4DLWA 5JNVA 4J2TA 2R8EA 2OGTA 4QPJC 2ETXA 4TTVA 2A78A 2JFZA 3ASUA 4QVGA 4JVOA 1PD1A 1WMSA 3OU2A 1LDMA 1Q2UA 4IW3B 3T4UA 3I30X 5E0KB 3UO8B 2FEAA 3G9XA 1UKCA 3KPWA 3IKTA 1H6BA 4RZXA 2OV2A 1NAHA 3JWIA 2VWHA 3P9PA 1EPUA 2A14A 2B36A 2NNLD 2ODQA 2P9QA 2R1TB 1IULA 2IKQA 3IR7A 4K6OA 3WWZA 4DM4A 3A9SA 3D4NA 2I3AA 3WHIA 1P17A 2PRZA 4C78A 1TF2A 1D1SA 3LO5A 3PGA1 3QMVA 2WPDD 4X24A 1P5HA 1ZGGA 3ESDA 3A26A 3IR6A 1G9XA 3CO0S 1GNTA 4LXYA 4M1YA 4U39A 4WY5A 4O2RA 2I4MA 3H8SA 2CCGA 5E1BA 3A6PC 1J33A 1VP9A 1W88B 4CEHB 3IBTA 2BFAA 1ZJWA 5A5DA 3EZFA 3TLMA 3ROPA 2YN0A 3N8KA 3OO1A 4JX8A 1UZAA 1H8HA 2WG0A 4IFEA 5H68A 4ZMSA 3PNPA 4TV9F 3D1LA 2QY9A 5E7MA 4BDTA 4ENTA 1JLMA 3WL7A 4OKSA 3HV2A 1P7CA 4MNTA 5TMBA 3NNSA 5MGBA 3Q12A 3T6KA 4X66B 2J46A 1LWOA 3Q1LA 2OV3A 3D2BA 2QX8A 4H1TA 1B6GA 3NIGB 3DSRA 2OXRA 4XVUA 3PQ8A 5DSXA 4F8EA 2I4NA 1JBEA 1QZTA 2QRZA 4IIJF 4JBGA 4WEQA 1E2IA 1HETA 3LXXA 4NFSA 2NPOA 4AWXA 1MP0A 3QVKA 3PF8A 1QOQB 1GQOA 1NF2A 1PBNA 1ZJJA 3OPVA 2QGFA 4TKUB 3C8HA 5JRJA 1FQOA 3UG6A 3VNSA 3WJAA 4DADA 1F9AA 1SXQA 1WTCA 5A4JA 4BJ1A 4AN0A 3RTBA 3DZ6B 2E85A 3WG9A 4NLLA 3UHAA 1ONPA 5K8CA 3OE4A 1JJAA 4J0FA 3A9RA 2KM1A 2EQBA 4JLPA 3WL5A 3E8SA 4WKGA 1IBRA 4RFLA 1J2RA 1EFKA 3AP2A 1E5VA 1VLQA 3IYLW 1S2DA 2ECQA 2F2TA 5KJCA 1CJUC 2AVNA 2B6NA 1J97A 3TYXA 4OO3A 2C8JA 5DGDA 4K9OA 2Q1YA 2IZ6A 3DMDA 3F49S 3I5AA 3KT0A 2PT9A 1RRKA 3C87A 3ROMA 3SP1A 1XFAA 4A73A 4CKWA 1VC2A 2ZYGA 1W5SA 4V2IA 4PLVA 2G0AA 4XUDA 3HFJA 4HAZA 1Z5UA 2V6JA 4JUDX 1P31A 4IZOA 5CP8A 3BE5A 4PQFA 4YTEA 5C7YA 1PP4A 3B6EA 4POAA 1EK2A 3KR0A 3B9PA 4KQMA 1G2QA 1Q19A 1PFWA 3WLFA 4WUVA 4MVJE 1GKKA 1BMFA 4ZVKA 4DMKA 3BGVA 4KLZA 5FBKA 2B98A 3GFSA 3TXYA 3UWOA 4AN4A 4KRFA 1JHMA 1T2AA 4FDUA 5MDHA 2VDUE 1R4NA 1ZC4A 1XQXA 3UPTA 3RJMA 2P6OA 1JXQA 1K9VF 3OFND 1CUYA 1EMDA 1P1JA 4HAUA 1FDSA 1GUAA 2F8SA 5IF9A 4RSHA 3X1DA 4A92A 4MUMA 4YPVA 4URFA 3PJGA 5A2GA 5JS1A 3ETGA 4R8VA 1D1TA 4BPRA 1SC1A 3ONDA 1LLDA 1V96A 3QU4A 3R4VA 1H3NA 4Z0HO 1KYIA 4OEHA 3ZH2A 3NDRA 3V42A 4RZUA 4IV0A 2IWHA 3WLHA 3FDZB 2W2OA 5K3BA 2GF2A 2QRVA 1E7SA 3TTTA 3OA0A 2X77A 1E2EA 3BYZA 5AI0A 1Y3FE 4L76A 1JJBA 1JYFA 2IOYA 1AC5A 3DE1X 1QORA 5CLLA 3D8BA 2GJ9A 3DTVB 3L0PA 5C53B 2ZPAA 4DWJA 4QLAA 1ZNZA 4BRUA 2V0GA 2XMDA 1Z2EA 1JDJA 3OZVA 1T9GS 4WWHA 1A04A 2H1VA 4NJOA 1D8AA 4OQQA 5TF4A 3ZU2A 4EGQA 4UTPA 2XAAA 1UZLA 2EERA 2HUNA 3RR2A 1Q84A 1BHQ1 1AN0A 1QX4A 4KWEA 1POXA 5K45A 2Q8PA 1N9GB 3ICQB 3QTTA 2AYZA 2ZKLA 2BFDA 2XMGA 1HUQA 4S3MA 5DXAA 4I36A 2QTWB 2NXCA 2P4EA 5I9LA 1U5BB 1IK4A 1NVTA 1UK9A 3G5TA 3H6HA 5AKXA 3RYCA 1R12A 2QMQA 1ZJZA 4MQLA 3T9DA 2HNKA 4ND3A 2PWZA 3WDKA 4RHEA 3TIIA 4EG1A 3VSCA 1YJCA 3DXFA 3CRW1 3O4HA 1ZBDA 4NF2A 1JXAA 4CMEC 4KFCA 4ZT2A 4MEBA 4ND6A 1KI8A 5J4KA 5JIBA 3KQPA 3PRJA 2EZTA 1PWZA 2F43A 3F9CA 5EMHA 2NUAB 2Q5OA 1FSSA 2G5GX 3RWMB 1Q0UA 3A1CA 4XD2A 1DBPA 1XGKA 3FGZA 3BMCB 3SXPA 5HKAA 3TMAA 5JQGA 1E2MA 1JQBA 4ZO9A 3A9VA 1SK9A 2C2WA 4H15A 1TZJA 4N4AA 4QXMA 4C5AA 3WVNA 1Q21A 4H0NA 5TMDA 3EVTA 3KQNA 1YZYA 1USGA 3H1AA 1KO4A 3L1UA 4NEQA 3SICE 2X86A 3ZKAA 2BEWB 4G67A 3TZLA 4JB0A 4ENRA 1MQSA 4LWQA 3H1FA 4G41A 4MI9A 5BNWA 1SXJC 3A36A 4EJSB 2YVQA 4K0RA 5JJLA 3S5UA 1J20A 5EMMA 4MMXB 4Z8XA 5JI2E 5DI3B 5F12A 4MH0R 1V1RB 2VTEA 1QR2A 1MIHA 4X6LA 3VHLB 2A67A 4DILA 3L4SO 1SJ9A 2GCOB 3IDFA 4DQ0A 4BKOA 1OY1A 5FLYA 1C7IA 1KYYA 3VMFA 4MDHA 3EIWA 4F2WA 4LXXA 1WUHS 4R2KA 4A0QA 4ZEWA 4B6JA 4ZDWA 4D74A 5F9HA 1ESCA 1QK5A 1QP8A 2VVTA 3FKQA 4RTSA 1S3FA 1AHHA 1TRHA 1OXTA 2XEXA 2J7KA 3LZCA 3LCVB 4ZQBA 1E2NA 1ISGA 1SXJD 5KYUA 4S05A 1J1IA 3V8VA 3MMXA 2FXVA 1O94A 3NAGA 5FJJA 5LXTB 3OX3A 2DE0X 3TCKA 1KQOA 5AI8A 1NVVQ 2G0NA 4J8PA 3NBFA 2Q28A 3ND5A 3NPMA 4G0MA 1QIDA 4HUQB 3F7TA 4V1CI 5FV4A 2LV8A 1NXPA 1NLUA 1KO7A 3ZWYA 5BV0A 4KQJA 2D5BA 1R88A 5IZCA 1YTUA 4AS2A 2N1BA 5HKLA 4IVRA 5KTSA 5DM70 2ZETA 1B7GO 3SN6A 4AO7A 3FOAA 2XB6A 1OVGA 1PE0A 3EIQA 3LT1A 3UXMA 2AZ4A 2JA2A 2ZW9A 3I5XA 3O82A 2A4KA 3H2HA 3T7AA 1WBBA 3BC1A 4K2AA 3FW1A 2QRNA 1HDZA 4EHJA 4KO3S 3CEPB 3RYTC 5M34A 3KLOA 3ZZTA 3ZU3A 5JDIC 1AK1A 1U0TA 2WHXA 3FRIA 1FLAA 4DMHA 2HHAA 5KYKA 3IT1A 1WB9A 1E92A 4WBNF 3HB4X 5F33A 1EJBA 2AYXA 2ZRDA 5HJ2A 1U90A 1MV5A 3COSA 2X0JA 4EGJA 4D4JA 1KHTA 2J31A 1B93A 1QBGA 2RHRA 3S1AB 3LC0A 2ZSBA 3E9MA 1NXVA 3JQBC 3V80A 2IEIA 1D2GA 4HWPA 1Z3IX 1L5OA 4Q1VA 4JY7A 4Z0TA 2BN4A 2CXNA 3RLFA 3N8DA 4MKXA 4U9IS 3IVCA 5C7IO 1EDDA 2B3DA 4K9NA 3WYBA 2GD0A 1DXOA 4XIGS 2W2TA 2WF7A 5DT2A 2VHEA 5J2TF 1RXWA 1SU7A 2Q1UA 1IU9A 2JLRA 3P27A 1XU7A 1E5TA 4JJ7A 3IQWA 2YS7A 2C77A 4HDKB 1ZH2A 3HDTA 1E98A 4J49A 5HE8A 1PUJA 2IV7A 4KAXA 4JROA 1TJPB 3HB0A 1XDSA 1VPEA 1O89A 3MCVA 3TW0A 2V5VA 3NHWA 4YDSA 5LBIA 5BSRA 4IJWA 4EMTA 4E07A 5IJ0A 3ZU5A 1Z17A 3HFRA 3QU7A 1CLUA 2DR2A 1BN6A 4PONA 1AGNA 1AO0A 1ENZA 2X2EA 2UZIR 1XZLA 1KC1A 4KQCA 2DMRA 4RNCA 1EK5A 2BGLA 4X8OA 5CNKA 3TN7A 1WUKS 1D5WA 4EDHA 3GJXC 1S6YA 3FN4A 3G1WA 1EA7A 1RC0A 3NHFA 5HTKA 3H1TA 3IEKA 2WZDA 1F8FA 5AXDA 4CV3A 4EKNB 3W06A 2C4NA 2G9UA 1YOVA 4L8FA 5C8YF 5ITZB 4Z4GA 3E22A 3QMMA 1RYMA 1R2QA 3WGLA 1XMQB 3Q88A 3ZIDA 1RLMA 1Z39A 3FYUC 4MVCA 1BRTA 3IUNA 4X9XA 3D2AA 1ZP6A 2RGGA 3USCS 4H3SA 1CJKC 4GLBA 1PZMA 2IL1A 1ZONA 2ZATA 3L7JA 2FA9A 3FNBA 3HJBA 3R2JA 1L5GB 2WUEA 2HY7A 2ZQ5A 3CUTA 4I5DA 4RJJA 3OIWA 4FR0A 1EVQA 3FJYA 2I6XA 3ESAA 1VSVA 4UJ5A 4IQ4A 1DCKA 1EBBA 2H1LA 1NI3A 3FFBA 3L02A 3L46A 3I8XA 3QY0A 3RTGA 1UM9B 3ZHXA 2IYWA 1EVKA 2O0LA 3O4JA 2XNKA 5AUQA 1A2QA 3PFBA 9LDBA 1DCFA 1JR2A 3U37A 3IQDB 2GAJA 3FETA 3DKPA 5A71A 3ENQA 4WBNB 2IC5A 5KOJB 1W93A 3A6JA 4HUJA 4INOA 1P44A 3A58B 5KYYA 4EK9A 4Z8YA 3PX7A 3ZHTA 2AWNA 5A3QA 4WL0A 3ESBA 5JE8A 1C9MA 2RK3A 1EZ4A 2G7MC 2PZFA 2VHCA 3U3RA 4Q4CA 5HKKD 4K26A 1MPTA 1IEXA 4RMNA 2JJQA 1PVVA 4GL4A 4F91B 1WPQA 5HFNA 1VE6A 3CNBA 4JJIA 3D4OA 2EDAA 3FCAA 1KFEB 3CN9A 4UKDA 1OPRA 1MR3F 1E5XA 3JQ7B 2CNWD 4YJGB 3UXHA 1RXSA 2EZ9A 4DV7B 2JH8A 1NQWA 2XA9A 2EKPA 4RQUA 3RRJA 4WFJA 4H2DA 3NUQA 3E84A 3DB2A 5J4VA 3A70A 1JHZA 3STTA 3PGVA 4URVR 1DKMA 1NMXA 2YNMC 3A0UA 2OXCA 1COWD 2AA3A 2BEJA 1K86A 2AQKA 3DO8A 2WT4A 3L05A 1IFXA 4P5DA 3PEEA 4MRSA 2VSXA 4L74A 3WLIA 4JI4B 2ZWMA 5F76A 4PG4A 4GOOD 3RK4A 3GAAA 5BSHA 3K1ZA 1IXYA 5H0IA 1U81A 4GBGA 1SBCA 5CTAA 4QOHA 1CK4A 5C31A 4N0EA 5TQVA 3EDCA 1XI2A 5FWAA 3T7RA 5D5QA 2XKKA 4J0GA 4G63A 5IKOA 5DWQA 1EJ6A 1BVYF 1WABA 1K7EB 1Z6TA 4G5QA 1UXOA 4BCCA 3CT4A 3P5SA 5ARDA 5AKLA 1EXMA 4UUMA 4ZCSA 1UDWA 2OECA 1GILA 3RHSA 3FCCA 4CM1A 3ZDBA 1UBMS 3ICOA 3C6ZA 4P3YA 3H5AA 2A86A 4OHFA 2I6TA 4I4NA 3UF0A 4LW8A 2AC7A 4N9QA 3S27A 1T5DX 1VMEA 3BJIC 3ZI0A 5BMVF 4OB7A 3M5CA 3SSMA 4B45A 1N7GA 1RYNA 1U8CB 3S44A 3LX6A 4R1LA 1M6VB 1WXGA 2XNHA 4NCKA 2B9EA 1B0AA 5AI4A 1JR3D 3AW8A 3KUXA 2AT1A 4MW2A 1CT9A 2O6LA 1W85A 4FNGA 4F4HA 3HXOA 2HR1A 3I73A 4RY8A 3B38A 1SM4A 3NT5A 2X4LA 4UDNA 4EHBA 4GWKA 2BELA 1U9JA 2YJTD 3QQPA 5DCYA 2BFBB 3E7DA 4FTWA 4B71A 5BSFA 3CX6A 5HZGA 2CVFA 4YP7A 5MN5A 2DM6A 1ULTA 2Z4SA 2QM7A 5KOHA 3R5JA 3D8NA 4QEZA 3EXIB 4JGBA 2WT8A 3NP7A 1MO6A 2P8JA 4GXTA 3IUBA 1E4VA 5DYGA 3ZCUA 1AQLA 4D81A 2EJWA 4F8YA 3OMLA 4B8ZA 2M1XA 3NORA 2Z1MA 4A2PA 4NOMA 1P0FA 2R6FA 4KXYA 4NXNB 4PE5B 2JJYA 4PPNA 3L0DA 2GFHA 3H0WB 1E1NA 3DVQX 4RTQA 1RM4A 4F9TA 3WBBA 5B7GA 1GAQA 2IPXA 2IXEA 3FXAA 4CU5A 1TLTA 2Y0EA 1N6OA 1AUQA 1MFZA 3B1YA 3IC5A 3BXFA 3OFNA 2NU6A 1NULA 3GVHA 1UPAA 2O0JA 3AJ9A 1QZ3A 4LTDA 4NL4H 3LJKA 3SEQA 2ZM5A 4C1BA 3HV0A 10MHA 1E3JA 4RGQA 3N74A 1Z7EA 2VT3A 2B5VA 3CT6A 1EA5A 4PG5A 1TNDA 3BS4A 3QEKA 4QARA 1VJDA 2W6OA 5IM5A 4Q3EA 5KSOA 4JXZA 3TOVA 1RE0A 3N2GA 1Z0UA 3OJFA 4N3NA 5KDLA 2O23A 5KHAA 1O5OA 3O7MA 4JI7B 4FVTA 3RI3A 3D4IA 5EZYF 4RFSB 3RBAA 4Z9YA 4CIXA 4O0LA 3U0BA 3JD0A 2BI8A 3DOJA 3ZHVA 3FPEA 4II2A 1TMGE 4BUJA 4XWYA 2J4DA 4QYSA 2F1RA 2O07A 2QN8A 2ZZKA 1E3DA 1L5FA 2A7QA 2L19A 2LCIA 3SHQA 4Y2TA 1AMUA 3T3OA 1TD9A 2R7NA 1M66A 3FLAA 2J3HA 4P2BA 5BV2P 3OWXA 5CNMA 2C2OA 4UHEA 3JWGA 2VQFB 1ORTA 3LSYA 4D9FA 4JQCA 3MJFA 3G7NA 4QUAA 2XB8A 4J90A 1VTKA 1NBIA 2EBUA 1VE3A 1KSFX 2G71A 2QTBA 3FZNA 3H2BA 3UOAB 4AXBA 4TKVA 3QITA 2VHYA 3VZPA 3UM9A 1JU3A 5HNKA 4V2UA 4FYIA 3I01M 1PQUA 4JOCA 2XUZA 1H2BA 4QBTA 1HKHA 2JGAA 4Q1EA 1BW9A 3AM4A 4DF3A 1GZDA 1Q20A 4ZVVA 4DCNA 4DA4A 1MW9X 3O21A 5ED0A 4EG0A 4PANA 5B5SA 3UOWA 3LW7A 1XXHA 1T5BA 1ZRMA 1XX6A 5EWLA 1FYEA 1RAGA 1W5EA 3W8NA 4B79A 4AYTA 1DDIA 2UUOA 3LHDA 5C18A 4S1TA 4Y1EA 4L78A 2GCIA 1EVLA 2HJWA 4ZTZB 2O14A 2PWPA 3GDGA 3KQKA 4URXR 2ETVA 3LKDA 4M60A 3TPZA 4RD4A 1TVCA 1KK3A 2FFBA 5CCDA 3NCHA 3V6LA 3STVA 4F6RB 1BOFA 1MTZA 1QH1B 2WWIA 1SKMA 1C1YA 4FW9A 3MOIA 3WGIA 2A1UA 2BHTA 4FOPA 4ZEXA 4RHXA 2O8BA 2CLMB 1LBIA 1FK8A 4DDUA 5EIOA 1HT0A 4HNGA 4NHOA 2WE7A 1ZNYA 4LN1A 5K0EA 1AKQA 2GPAA 4LKOA 2Z2JA 4DR4B 3E6AA 1JIXA 1YS9A 2G67A 1TU3A 1PYOA 4PLPA 3EUFA 4GE0A 4K6GA 2IUUA 4DSZA 1FUEA 3K70B 4PRZA 2WQ6A 3RG8A 1T6YA 1KRHA 5FIUA 3B89A 3QF4A 1I1QB 1ZM3A 1FFXB 2DP4E 3GOQA 4IDBA 4B35A 1CB0A 1JIKA 3M1IA 2A1IA 1KJJA 2BKEA 3R75A 4EY8A 1PT8A 1ZWLA 2XLBA 4P0QB 2PGNA 3TDKA 1TZ2A 3BXXA 2G80A 3EC1A 1DKQA 2F90A 1U9IC 2HYDA 1UMCA 3FHOA 4R8LA 3RYHB 4JGGA 4OQEA 2ZR0A 1HOXA 3O8QB 3UT6A 3CVXA 4OLAA 3JU3A 2Q46A 2WJAA 1ZHHA 2IPOA 5DGIA 1L7NA 3ED5A 4MW1A 4G81A 1IOWA 2C4MA 3MYRA 4EBFA 1QBKC 4EW1A 3ENVA 3I83A 5BYKA 1YI0A 3SQDA 2BW0A 5ICSA 2A9RA 2FN3A 2GH1A 2ZIFA 5AHOA 2WM2A 4F3RA 1QFXA 1Q0SA 1VHQA 3LUHA 4WDRA 5FFMA 2BM1A 5T67A 3ROXA 3SQWA 5A0VA 5DLDA 3PFWO 2WLSA 3UAXA 3UMMA 3EIFA 2OV6A 4LC0A 2IWRA 1F2DA 3OIDA 4HH1A 2OCDA 3DZDA 1ZH6A 4IJVA 2ZXUA 3MILA 1SCQA 2GEFA 2ZYVX 3BIXA 2ZUFA 2V6IA 4JCCA 3R5KA 4CEIA 2GTHA 4FGLA 4AK9A 1E3LA 2ZRKA 2Y6UA 1DWOA 2Q1SA 2BC9A 5HM6A 1RQPA 3FPFA 1BWPA 3CMCO 1PO7A 2NV2B 3H5LA 2WVHA 3L77A 2GA8A 2IYEA 2YINC 4FMPA 5HRAA 4OFWA 3ZX5A 3DDSA 1M3SA 3MUEA 4IHJF 4NOJA 1HA3A 3IA2A 3CF2A 2ODNA 1W25A 2PXHA 4MJXA 1EFRA 2ONCA 1UWCA 1AKYA 3QPWA 1OGIA 2C92A 5C80A 4ZO4A 3DXXA 2QGZA 4TV8A 4CV0A 2AOTA 3H6KA 3QU2A 2PFKA 4JL6A 1P9WA 1A97A 1CRQA 2GERA 3EDRA 3BGDA 3L1JA 3LT0A 4PPQA 5HJEA 4LYDA 4ZO8A 1WU7A 1Z5OA 3R3WA 5TVKA 3DDUA 1UPCA 3FYDA 4I4TA 4D9CA 2GD1O 1NBEA 1SA0A 4V0OA 3K0FA 5CDHA 3DLHA 1CQIA 3K53A 4BNIA 5JDIA 1OT5A 3KDPA 5AKIA 4DBLC 1VKRA 2R8ZA 4IO0A 1CDOA 1WSDA 3EGDA 2R8OA 3HO8A 4M83A 4AUKA 3D02A 5JCZA 4ZI3A 3LVRE 1XQ9A 2ZSHA 4E5DA 1Z68A 2ZRBA 4V1CA 4DXAA 3JQBA 1N2CE 4JZYA 3BVPA 3DWGA 3BWEA 2IBTA 3B5IA 4IO1A 3AUTA 3E5NA 1BKDR 1LW6E 3CLRC 3VTAA 1C3OB 1AKNA 3R5HA 4OL9A 1ORWA 1P7WA 1RAIA 4RY0A 1TGVA 1M2EA 3N53A 4KXXA 2AMLA 1GPYA 4BB9A 3CG4A 4GUDA 4DGSA 1K7FB 1LVUA 2JHCA 2N3ZA 3OTQA 1PG0A 4GPAA 4XM2A 1NBAA 1IUKA 1XU9A 4CKWB 2DUUA 3DPIA 1TM1E 1USKA 1MKYA 1R6VA 2IP4A 3NOQA 1A4UA 3H75A 2WAAA 5AYVA 2WV7A 3WKCA 4B5KA 5JO0A 4Z2YA 5JS2A 5LKAA 5J9GA 3EB9A 1FXUA 2WW8A 5L3RA 4LE2A 6ADHA 2C3PA 1KZ1A 2PX6A 4EUSA 2GN0A 3V4OA 1VDZA 1Y9DA 4Y8VA 2P41A 3CLRD 3EAFA 1J2EA 4H6WA 1YRHA 5B1IA 1DQNA 1M7BA 1V8OA 1ZI8A 3OZCA 3I5MA 3GEDA 2ONYA 4J4HA 1ZEMA 4MV3A 3X1JA 5JAIA 5KJFA 3ZV7A 1FSPA 1AZLA 1LU9A 1PF7E 3AUAA 1KERA 3PUIA 1EGMB 3QEOA 5AKEA 1BGWA 3GJYA 1L8XA 1R4NB 3NOVA 4GF5A 3UW1A 4DCTA 4CGYA 5B3LA 2BV3A 1WL8A 3C3CA 3PQFA 3HXKA 3LUBA 3EOAI 4JGIA 5G41A 3GLIA 1FE8A 4BNLA 4HDQB 3MYYA 4JB8A 2K7FA 1GWNA 1JH9A 3H87A 3MAJA 4P81A 3L8YA 4R2WA 3GG2A 4NH4A 5SZKB 2V9ZA 3U4QA 1A98A 4JEMA 4MQ6A 5AH0A 4PSDA 1K8XB 3FYUA 1E8DA 2PA0A 5KNLA 1XRQA 3MCWA 1T6ZA 2V7BA 3W3AA 5K6AA 1P3JA 1OWPA 3G6KA 2I5PO 2QRVB 3BPSA 3FLBA 4U0KA 1XEAA 2BMAA 3F6RA 3HH8A 4ZYTA 2C2YA 4UTZA 3EVEA 4QPNA 4I1PA 4DJFC 2MYNA 4HQOA 1FZQA 3E3OA 1ZJ4A 3QWFA 4RSGA 4ALIA 3Q2OA 3FTPA 4PFKA 3QX7A 4CCAA 2REBA 4GNKA 1H0HA 4YP6A 2HSEA 2ZJ6A 4OHPA 4IINA 4D4LA 3AX6A 3NYIA 4NBUA 4NG4A 4J1TA 1SG6A 1PYGA 3H9UA 2FX3A 1CEQA 4LJ4A 4TMWA 1S0UA 3NAZA 3WJ2A 1COWA 3DNFA 5AJUA 4W1PA 1VE1A 3V48A 5JDCA 2GVDC 5IJZA 4WCVA 4PHHA 3GLFE 1H0SA 4QX6A 1QYDA 1EFLA 2WOOA 4OYLA 4C6SA 2O8DA 2CW5A 2D2VA 3UIEA 5KSZA 3VH1A 3RYCB 1C4XA 3T0IA 2VA8A 4II3A 4B85A 3DJFA 4P86A 3RUFA 2C2KA 4DDVA 1ZVVA 1LTHR 1WG8A 5JNWA 3TTYA 1I0IA 3DZ3B 2RGDA 4LY6A 4URZR 4G85A 5F52A 1VXOA 5A03A 2PJUA 3ESYA 5KJ1A 2TECE 3HACA 1BQ4A 2V65A 3SDBA 1QHHA 2DWCA 2C5BA 4Y2PA 1OLSA 1QPGA 2CE7A 2YNMA 4NMLA 4XJSA 4ZREA 5C4GB 3KOMA 2WHPA 3BF8A 2F43B 4QATA 5DI9A 4NCNA 1ZG3A 2VATA 1UCFA 3W79A 1ZGJA 5BUCA 4DCPA 5CH8A 1UKYA 3G9UA 3K92A 5JQGB 1HLDA 2CT8A 1ZUD1 4G0VA 3SQNA 4US0R 2QB5A 3LBIA 3MD0A 4MS4B 4LSGA 1E1CA 3IIEA 4A1FA 4EF5A 1BVUA 1WXIA 1JR3A 2XDYA 2A8YA 5HF6A 3KQHA 2YVKA 1IN4A 2FU5C 1P61B 2J08A 1CP2A 2P4UA 3QUBA 1KMIY 4ARBA 5TVOB 2JFPA 4C01A 2I91A 5E6RB