1EVJA

Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
340
Chain Sequence
RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a truncated mutant of glucose-fructose oxidoreductase shows that an N-terminal arm controls tetramer formation.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 116
structure length 340
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1evjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evjA01
2NV6A 1LQTA 1NWHA 1FJHA 2Q45A 4LW8A 5I8ZA 1A7AA 3ROMA 2WSBA 3BAZA 4WPGA 2D0IA 1I2BA 3ONFA 4FW8A 4DIBA 4BNGA 1H6DA 1RM4A 3P19A 1EMDA 1ZEJA 2JJYA 3VHRA 2GDZA 3F5SA 4OOFA 1QSGA 4Q3EA 1DC3A 5H83A 1BXZA 1MUUA 2UUPA 1EBFA 4J1TA 3RBVA 4XZ3A 4BO2A 4GX2A 1PR9A 2JAHA 3AOGA 4GWKA 3FN4A 3HE3A 4EYEA 5EN4A 1P1JA 1E1LA 1OMOA 1EVZA 2I3AA 3AM5A 5KIAA 5I7EA 5A9RA 3VDRA 1NHGA 4N54A 1I3KA 2BGMA 5EPOA 3AY7A 3GY0A 4HV4A 2BI8A 1HDGO 2GN9A 3WG9A 4AG3A 1DJNA 4B8WA 3X2EA 1T1RA 1ZMTA 4QO7A 3RUHA 1CF2O 4ND1A 3HQ4O 4BNXA 2ZYAA 4JGBA 4DYDA 2WD8A 1P1HA 1O5IA 4WLUA 5TLSA 3JQFA 3QY9A 1UXKA 1H5QA 1NNUA 2YJZA 4UUMA 5LC1A 2W90A 4BOYA 2VTEA 5TQVA 2EP7A 3BXXA 1PGQA 1I24A 3GDGA 1YOVB 3GF4A 4E2ZA 1NQ5A 4L0QA 2JFGA 2X5KO 1ENYA 4CM1A 3INTA 4XIJA 4ND2A 2X23A 1VLLA 2FPPA 1DIBA 2CDAA 3G79A 3GDOA 3ZCXA 2DC1A 3UN1A 1QMGA 1NHWA 2AQIA 5C5IA 4BNHA 4DBZA 1FDWA 5GZ3A 1XYGA 5HM8A 5LDHA 4NJMA 1E7RA 1YQXA 3NV9A 1DRWA 4NG5A 4BGIA 1I2CA 4E5NA 1HDRA 3HZZA 2EKQA 4EJ6A 2Y1OA 1RJWA 4NBRA 2UVDA 3D7LA 3DC2A 2X9VA 1HDXA 5L7YA 3E8XA 3CSDA 4IIUA 4N18A 2A4KA 2I6TA 4CUKA 1F8FA 2BF7A 2G76A 1P1KA 2OUIA 5FFFA 1EVJA 4ONEA 3JTMA 1CDOA 3VPHA 4BGEA 3OECA 4UUPA 1V3TA 4GX1A 5DOVA 2VWPA 1GPJA 3H65A 1NVTA 1DRUA 1R15A 2Q1SA 3SC4A 5CDTA 1DSSG 4WLFA 3PQEA 5G4KA 4BB5A 3UCXA 1KY5A 2PWZA 3AK4A 2VZ0A 3PJGA 3T4XA 4DGSA 3PYXA 3LT0A 3F1LA 1GEGA 2X0IA 4UAGA 2UUOA 1HDZA 1QYCA 3OJ0A 4XQ9A 5K6AC 5AOVA 3RCBA 3K5PA 3FWZA 3MTGA 1CJCA 3JD2A 4MJLA 3DBRB 3GHHA 4FDAA 4CLXA 1GFSA 1Y8RA 4RVGA 4ZN6A 2QZZA 2QYSA 3T7EA 3UGKA 3EK2A 3LSYA 5KJ1A 3ZI0A 4CMIB 5A9SA 3PWKA 5I9LA 3WWZA 4IPTA 2WJPA 4KQXA 3HDYA 3JQ7B 3L9XA 3G3EA 4R01A 3O4RA 4MVJM 3E1KA 2WD7B 4YVFA 3AU9A 4BO1A 2EV9A 3HWRA 1G6KA 1PS8A 1W4ZA 3DHEA 3JD4A 3P7MA 5L51A 5ICSA 3GN1A 3E9MA 2YV2A 4B8ZA 1FDSA 5U9CA 1VJ1A 4PRLA 1PJSA 3QWIA 1ONOA 4MINA 3RC1A 3EVNA 1MXHA 1DC6A 2X9NA 3DMTA 2YFHA 4FBGA 3EGOA 4NJOA 3E48A 4Z0HO 3RIHA 5I7VA 5JDCA 5J23A 5A5EA 1E3WA 2AEJA 3WICA 3WIDA 5B4VA 3L6OO 1HTBA 1G1AA 4PZCA 3OHSX 3ZDFA 1ENOA 4E5KA 3KRTA 1PJTA 3KXDA 2HK8A 2HRZA 1NFQA 1K6JA 1U28A 2QZ9A 5JYEA 4IZIA 3TL3A 4D3FA 1PJLA 1EBUA 4QTZA 4OXKA 2RHRA 1MFPA 3HHPA 4CM8B 3W6ZA 3HNPA 3DBRA 1H2BA 1RM5A 1PQUA 3BMQA 3KEQA 1AXEA 4J3FA 4MVJF 3UFXA 2HJRA 3EUWA 1MG5A 2FZWA 4MPDA 2WYVA 4PG5A 4JJFA 3ZNOA 3WQSB 4HADA 2IEBA 4NI5A 3PRJA 3ZWOA 4AJLA 4J0FA 1LDMA 1IYZA 1PZEA 1GV0A 1T1SA 3FTNA 3RWBA 1ENPA 1RKXA 3BMOB 3VVCA 2OOSA 3EVTA 3DMTC 1E92A 3IDSA 1XQ6A 3CPSA 4MVJA 3JQBC 3HJAA 1Y81A 5JYAA 1M75A 3DZKA 2QRJA 1KEPA 2BMAA 2X0NA 4BNMA 3WXBA 1C0LA 1H6BA 2C82A 1YDWA 3ZU4A 3RUFA 2I66A 3GVCA 5L4NA 1TI7A 3P2YA 3V1YA 4CM9D 4CM4B 4RLHA 4XGIA 1H93A 1LLDA 2QQ5A 3GDFA 5JMPA 2IYOA 3OSUA 2BHLA 4LCEA 2NU8A 1EE2A 2G82A 3DWFA 4ALNA 2OORA 3MJTA 5TJHA 1R0SA 3BMCA 4IMRA 1QYWA 1XQ1A 5U1PA 3PJFA 4HWKA 3VPSA 2Y0CA 1TT7A 3RSHA 5COQA 5ADHA 2PFGA 2IRWA 1SCUA 2OO5A 1ZMOA 2AXQA 2NWQA 3TSCA 3WLFA 1BGVA 1PZHA 1PJQA 1VRWA 3D5TA 3ZWAA 1BTOA 3I9KA 4DXHA 5FF9A 3BYZA 2V6FA 3LQFA 3RUIA 1JKIA 1SAYA 4GGOA 3BTOA 3ADPA 4R69A 4JCOA 4E21A 3WYBA 1I30A 1UJMA 3ZWCA 5A05A 4JIGA 1KBZA 4JLWA 4BKPA 3PP8A 2X6TA 3H5AA 5CDUA 5M6DA 2EEZA 4ZQGA 1WDKA 3OFSA 5C7LO 5B4TA 3TOXA 2X58A 4BNTA 2C5AA 4WK6A 1WNTA 1Y5RA 3OJOA 2HK9A 5JS6A 1HZJA 3GGPA 1YRLA 3IS3A 3PDJA 4J49A 5ES3A 3W1VA 3FSRA 5KVVA 2OBNA 1R6DA 5DBFA 1I3LA 5JY6A 4J9VA 1EQUA 4MP3A 4I9NA 5U4QA 1ZK0A 1L1FA 2WMDA 1NBOA 2FR8A 4CQMA 3DDNA 1JVBA 3KYDB 2VNAA 4LVCA 3UH1A 4RQUA 4OXYA 3EC7A 1HL3A 4BO3A 4CL3A 4J7UA 5KWEA 1L7EA 5COAA 1L7DA 4LSWA 3EHEA 4WLNA 2PKQP 3HB4X 4BGUA 1IULA 1GUFA 4M86A 4HNGA 1ENZA 2R00A 1YWGO 1ZEMA 1LSSA 4D3SA 5CEJA 1D8AA 4CQMD 5EQDA 3LU1A 4OHUA 4YJGB 4A27A 5L4SA 5ITWA 2Q49A 1PWZA 3MJEA 1U5CA 3ST7A 3ETEA 3SBOA 3L0DA 5F5NA 1E3IA 4J4BA 2BI7A 4YR9A 4PG7A 4NIMA 1J6UA 4M55A 1LI4A 2FPGA 4EEZA 2CY0A 5CHEA 1WDLA 1HETA 4XYEA 2PR2A 2DM6A 3WFJA 3DBHA 2Q4BA 2Z1MA 3RC2A 3HN2A 5BNFA 1R12A 4JJIA 1V35A 4P8RA 1KERA 2VZ9A 1YB5A 4GKVA 3B1KA 4W4TA 1E7YA 3LK7A 4PZEA 1NTOA 3GUYA 4YJHB 4D44A 2ZYGA 5G0TA 5F1KA 3BHIA 1CERA 1YVEI 4QUKA 3KEOA 4RVUA 3DOOA 4XJTA 3OEWA 3FTPA 2EF1A 4FJ2A 3AM4A 3Q6IA 1LLCA 4P22A 4J1NA 1TXGA 3FBGA 3IP3A 4YACA 3S1LA 5C7IO 4WUVA 4IDCA 4P4LA 1EFKA 4D42A 1VL8A 4JX8A 3WBFA 4LMPA 3OA2A 4OH1A 4UULA 4IDGA 2AG8A 4L8VA 4BO9A 3C1TA 3BMNA 3PWSA 1NFFA 5BQFA 3C3XA 4K26A 5AQ1A 2PV7A 3EAGA 2GSDA 5A9TA 3WOHA 3VZQA 2IEDA 8ADHA 3GRPA 5CFZA 4PN3A 1QR6A 4B7UA 4CM9A 2P68A 4P4GA 1R4NB 4OKIA 4FPXA 3WBBA 1I0ZA 3ZWNA 2QG4A 3PHIA 4J43A 2GRAA 3IIEA 4DLAA 5IF3A 4B3IA 3DZIA 2NTVA 1ZW1A 1UZMA 3AI2A 4PG8A 3KB6A 1ZH8A 1I3MA 3MWEB 3Q3CA 5CDSA 2P5UA 3FF4A 3RFXA 4GSLA 1F8GA 1PJCA 2FRDA 1DIRA 2G17A 3I5MA 4BB6A 2Q99A 4WEQA 1B15A 3EW7A 4GLLA 4QFDA 3UF0A 1Z75A 4YRDA 3KUXA 4AJ4A 2ZCVA 3RFVA 3U62A 3SLGA 4HKTA 1GEEA 3QWAA 2Z95A 1DEHA 1C0PA 1YH3A 1IOLA 2PD4A 3M6IA 3ONEA 1D3AA 2XF8A 3V8BA 4EDFA 2R2GA 2ZJ1A 4CL8A 4IUYA 4DLBA 4PLYA 3NJ4A 3C1AA 1X1EA 2VCYA 3AUAA 5KJ6A 3JD3A 2VWHA 3WDSA 4QX6A 1H0KA 4J0EA 5BNTA 2ZTMA 4NH4A 5F1OA 2VYVA 3MTJA 3M2PA 1GZ4A 3JYLA 1EUDA 4Z0PA 3WFIA 5ITVA 5CP8A 3A14A 1AN9A 4K6FA 3LT2A 5KNLA 1MP0A 2J5QA 3GOHA 1P0FA 1V3VA 1K0UA 4HFNA 1ARZA 1HXHA 3Q2KA 3WNQA 4FC7A 3ZNPA 3IQDB 4IZHA 4YB8A 5ENVA 5JXWA 3ZGYA 4PG4A 2ZTLA 1XLTA 4L74A 2DT5A 3SJUA 3U4HA 3L4BA 2NTNA 4RVHA 4U5QA 4Z9FA 1P9LA 3DAPA 2DFDA 3L4SO 2CMDA 2X86A 4CQLB 3UKOA 4Z9YA 4O63O 3KSUA 3KM0A 2Y05A 3PLRA 3SLKA 3JQAD 3ROKA 1H9BA 4HFRA 4Y98A 4CR8A 4AJIA 4XR4A 4PVCA 1A4UA 4DA9A 4W7IA 5G0WA 4A26A 4XB1A 3AY6A 4KP7A 3E18A 1LBEA 4ZD6A 5KTKA 2EG9A 3ICCA 3ITDA 3JYPA 4DUPA 4XX0A 3ZHBA 2PGLA 5HS4A 2JD1A 2VUTA 3JCZA 2GD1O 1BVRA 3AFMA 1Q2XA 1N8KA 3GVHA 4CV3A 4YPOA 1ONPA 3CINA 3X2FA 2GZ2A 3HDQA 1FF9A 1A7KA 4NMHA 1BG6A 1Z74A 1C1DA 4GKBA 4WCDA 4AJ2A 1LXCA 1BXGA 4I1IA 3WWYA 3QVTA 1HDOA 4HNHA 4I5FA 4PLTA 4XGNA 2JAPA 1OBFO 1JW9B 3ETGA 3ZW8A 1P74A 2AG5A 1PS0A 1WMAA 2H6EA 5JBIA 4LRSB 1F17A 4BVAA 3VZSA 3DXFA 4PRKA 4Q9NA 3ON5A 4O5OA 4UEKA 3ULKA 2V65A 1CETA 1A9ZA 5FI3A 4D3DA 4R1UA 2HKIA 4HBGA 4JP2A 4PLHA 5IXSA 2F00A 2X0JA 1M6WA 3ZV4A 5HBRA 1NR1A 4PG6A 4LMRA 2EGHA 2UV8A 2VQ3A 2QIOA 2BGKA 5BR7A 3W8EA 1OI7A 3NGXA 1MG0A 3KETA 1Z73A 3SX2A 4YDRA 3KSDO 1KS9A 2D3TA 3B20A 4RL6A 1DIHA 4J4TA 4ZU3A 3OMLA 2BLLA 4AL4A 3E5RA 4YEDA 3S55A 4NBUA 3PTZA 5JPIA 4CLRB 3PK0A 1ZSVA 1KEWA 1GY8A 3RC7A 4B4WA 1GZ3A 3QJ5A 1HE4A 1HWYA 3ZWPA 3IJRA 4E0BA 3QVXA 1N9GA 3BMNB 3H2ZA 2HMVA 4RZHA 4UREA 4ALIA 3QSGA 1NR7A 1B16A 3U4CA 3PI7A 4PCVA 1YQGA 4YBZA 1HSOA 1KC3A 1DFGA 4Y6SA 5G2OA 3ZWYA 4DQXA 3GLQA 4F6LA 6LDHA 3BMOA 1GADO 3IUPA 3JQGA 2EHDA 1AXGA 3R3JA 4XCVA 4CMHA 3N58A 2DBRA 3G0OA 3ZN2A 4PLZA 5HRUA 1PGNA 1GQ2A 1ZK1A 4WNIA 3HADA 4K9DA 1O95A 4ZJUA 2FN7A 4FFRA 4GVLA 1E77A 2P9CA 2PLAA 3K6JA 4WLOA 1VSVA 4Z6KA 3C1OA 1XKQA 4BIIA 3NDJA 1OAAA 5DCWA 3JQDA 3DHYA 4IMPA 3KTDA 3ZNQA 4NBVA 3GMSA 3GHYA 4E5MA 1LLUA 3Q0EA 4MVJD 3UICA 3OIDA 1IHXA 2CVQA 3ASUA 3K92A 1VPDA 3UHAA 1GL3A 2O3RA 4Q3BA 2I5PO 3VOSA 2X9GA 1E3EA 4TZKA 2WE8A 3GEMA 4J7XA 2J3HA 3GNQA 2VHXA 4I9HA 2AA3A 4BKOA 3WYCA 1ISIA 4I5DA 4FOOA 2PZMA 2NQ8A 4FJ1A 5HS6A 3SXPA 1Q7CA 4CV0A 2E4AA 2O48X 5B12A 4MIYA 3CXRA 3F46A 3O9ZA 4C7KA 4D43A 1ZVMA 3TFOA 4J9UE 3FR7A 1C1DB 4IGFA 3GMDA 3HDHA 4II3A 3CIFA 2HAEA 4OMUA 2ZTVA 3LLVA 3A1NA 4CM6A 4RDIA 5THKA 4BHTA 5G0UA 4HX5A 3QIVA 2EW8A 1CRWG 2GPTA 2OFPA 4UVEA 1LEHA 1IZ0A 1VM6A 4GPD1 1FDVA 3ZWWA 3DEYX 1N1EA 1E3LA 4DTIA 3FRJA 3EYWA 4L4XA 3DOCA 1UXIA 5A03A 3H9JA 3JQ7A 3JD1A 5EIOA 4Y9DA 1DXYA 4GBJA 4BQPA 2I65A 5L40A 1I3NA 1DBVO 3VDQA 3MJCA 5JLAA 3MJSA 1PJ4A 1Q1NA 2NM0A 3GK3A 4RORA 1M76A 1MA0A 4N5LA 2PZJA 2HJSA 4PGFA 3WQRA 3EZLA 4PLVA 4CMEA 5T6BA 3F1KA 1I8TA 1PU2A 1PQPA 4NU6A 3K31A 1LDBA 5EL0A 4OKNA 1FMCA 2W2KA 1Y5MA 1LSOA 5FI5A 4P38A 4AICA 1Y8RB 3RBZA 1R37A 4GLOA 1DDOA 1VI2A 4CPDA 3KZVA 2EJVA 4B3HA 2PA3A 2Y1CA 4OYRA 5DP1A 1WVGA 2O7SA 1J49A 1U5AA 1PR3A 1OZAA 1U1IA 1UP7A 2Y99A 1DFIA 4R9SA 1LC0A 3L77A 2NVUA 1BSVA 3PZBA 1HDCA 4KDEA 2B0JA 3QA9A 2XPCA 3ICPA 3U5TA 5I9MA 4FFOA 4GWGA 5CEFA 4U0JA 2GZ1A 4TKLA 3ZHYA 3DTTA 1WDMA 3AI3A 2Q1TA 4O6VA 1Y9AA 3JQ8A 2VRCD 2Y1FA 3HFGA 1MX3A 3BHMA 3ENKA 4G2NA 4XRRA 4CMCA 5KOIA 4PVDA 1Z7BA 1MFZA 4M89A 1B7GO 2PTGA 1YJQA 4D46A 4E12A 1SB9A 3LT4A 1EQ2A 1PZGA 3ONDA 2ZKLA 1E7MA 2J6IA 5EMHA 1B2LA 4R3NA 1T2CA 3V1UA 4H3VA 1O0SA 3PLNA 4KMSA 1DLIA 1ULSA 4E13A 1ISMA 4MP6A 1HZZA 2JL1A 3QW2A 5H81A 1DFHA 4A5OA 3QV1A 3RC9A 1UH5A 3IAHA 3GPIA 4XYMA 1YB1A 2NTJA 2VYVD 5IFLA 1PX0A 2DTXA 4CJXA 3PQFA 3I4CA 1XEAA 1F0YA 4R3WA 4RF4A 2B5WA 5L4LA 4B7XA 3K73O 1NX6A 5F21A 3VPFA 4WJZA 5CPFA 3VH2A 3GQVA 1UXHA 3GVXA 4ALMA 3PIIA 4HUJA 1PSDA 3WSWA 1UZNA 3NDIA 4MOWA 4XB2A 1QYXA 4JP3A 1JKJA 1SOWA 2EW2A 3OEYA 1P0CA 2IODA 3CZMA 1WWKA 4IJUA 4AJOA 4IXTA 4RZIA 5COBA 4CM5A 3GAZA 2YUTA 4IJKA 4QQRA 1CYDA 2WWRA 2TMDA 1BWSA 2O7QA 5T64A 3CMCO 1H6CA 2ZQZA 4A10A 4CLOB 3KLPX 3N74A 3I1JA 5JNLA 1U3TA 1WXDA 2CDCA 3UCFA 1Y1PA 3PYMA 4YQZA 1X1TA 3I9JA 9LDBA 3GZNA 4ROSA 2AE1A 4BUCA 4CM7A 1NQAO 4LGVA 3R6DA 4KUGA 1ZUD1 2E49A 4RCVA 5JCJD 4R1TA 3ETDA 4RGBA 1UP4A 1SMKA 5A06A 1JN0A 4J1SA 2FP4A 2YHIB 1OFGA 1KY4A 2WYUA 2B4RO 1C1XB 1HYHA 5IN4A 3JQ9C 1B0AA 2PKQO 4JROA 1T2AA 4RF3A 3QHAA 1KVSA 5GZ1A 3OJFA 3OA0A 1VKOA 1FDTA 2X8LA 5TGDA 4AJEA 5IDXA 4YJFB 2Q2WA 4NFSA 3E6AA 3GA0A 2JD2A 3WMWA 4YT4A 2OHXA 4KUEA 1YGYA 1E7WA 4CM3A 1T25A 4G81A 4J91A 4DPKA 1OC4A 5HA5A 4GI2A 4DC0A 1EUZA 2O3QA 4DLLA 1KOLA 3ABIA 3I9LA 4HFJA 4OSOA 2WDZA 4K28A 2DBVO 5L9AA 4R54A 1P1RA 2VNSA 3GEDA 3NDRA 5BT9A 3QVWA 1U8XX 1Y8QB 2YQ4A 4FS3A 3TZHA 1RYEA 4O59O 5JFOA 2Q1UA 1IUKA 3MCVA 1TA4A 4EBFA 2FMUA 1LX6A 4KWIA 2PK3A 5A3VA 1EVYA 1R0LA 5C3MA 2AMFA 2VYND 3DZFA 1O89A 4JBHA 2RAFA 2WD7A 3AU8A 4MKRA 4XWYA 4B4VA 3H9UA 3L4BC 4F45A 2CVOA 3B70A 4KZPA 5KVQA 4DIOA 1LDGA 3K96A 4LISA 3TZQA 1P45A 3GGGA 5MGBA 2JCVA 4YJFA 4URFA 1B8PA 5DOZA 3L9WA 3NEPX 3JYOA 3D4PA 1P33A 5JO0A 2I3GA 3TRIA 2DBZA 2D5CA 1LDNA 1PL7A 1ZSNA 1YBAA 4UUOA 4YJDA 5DCUA 2VT2A 4F3YA 3GPDG 3GFGA 1DC4A 2NVBA 3RUEA 3BTSA 3AWDA 4ZA2A 2P2SA 1LSJA 4E5YA 2O4UX 4JK3A 1IY8A 3UCEA 1E1KA 1WLYA 4LRTB 5BSEA 1K6IA 4R9RA 3DZBA 1ISGA 3PIDA 3KLMX 4R1SA 2XAAA 3MOIA 1VSUA 3C7DB 1Q0QA 4RPJA 1ZIDA 4GVXA 4LN1A 3JQEA 4BNIA 4GMGA 3ZW9A 4WECA 5JO9A 3LYLA 1QXSA 4BO4A 2I76A 1U3WA 2BFPA 2FR0A 4FGWA 4UEOA 3CMMA 5LDGA 3MWDB 1P77A 2Z1NA 4ZRNA 3WIEA 3ROQA 3OIFA 4W82A 3UVEA 2RH4A 3I6IA 1K2WA 3U3XA 3FCOA 3VC7A 3FPLA 3GZNB 3I23A 4MVJE 1EFLA 4J1QA 2ZIZA 4M49A 4FFPA 4ZHSA 1A72A 5DULA 1DRVA 4YAKA 5JC8A 5T8KA 2ZJ0A 1JTVA 4TZTA 1A5ZA 2P5YA 3FNHA 3LZ6A 9LDTA 4W9NA 5IN5A 3OP4A 4GL4A 1ADCA 5TT1A 3K9QO 4RQTA 1I5RA 4D45A 3V2HA 1CWUA 3SJ7A 4BO7A 1PJ3A 1QV7A 4BNFA 4NNJA 5ILOA 1U2DA 4EJMA 2B35A 2VUSA 2NU6A 2H9IA 3I6QA 1ONNA 2A9FA 2NVUB 1XELA 4Z9XA 3O8QA 1C3VA 1D4FA 5GMOA 4XD2A 1I01A 2IZZA 4MP8A 3DAFA 5A5FA 2GGSA 2RCYA 3DMYA 3H9EO 3D3EA 4JJGA 4QEDA 3VH1A 4OQZA 1XIVA 3HUDA 2IZ1A 1ZO8A 1ZK3A 1ISJA 1LRKA 4DREA 3PEFA 3GEGA 3PVZA 4N7RA 3CE6A 4XQEA 4J4HA 2WTBA 2RIRA 3AUTA 3NX4A 3RD5A 3S2IA 5K0ZA 2QX7A 4ZGWA 1YL5A 3F3SA 3ORFA 1V9LA 2GF2A 1RYDA 2NU7A 4NQZA 3ANLA 2O2SA 4F46A 5K9ZA 1LNQA 2B4QA 2CSUA 3S2EA 4CMJA 4CUJA 3JQCA 4YAJA 3A9WA 4KWHA 2EERA 2Y0EA 4BMVA 5DNAA 2TMGA 1D7OA 2F1KA 2EWMA 4MKZA 4XDZA 3F5QA 3DTYA 2NACA 3QWBA 4BNJA 1LQUA 4NBTA 4IQ0A 3I52A 5AXAA 2EKPA 2O3SA 3RU7A 4IDDA 1HYGA 3IL2A 4CQMB 2D2IA 1R4MA 2IZ0A 1YBVA 3G17A 4WCFB 4TMFA 1GCOA 1TEHA 2PD6A 3UW3A 1ID1A 1W6UA 3GVPA 3KYDA 2VUUA 4DBVO 1AHHA 1QRRA 4BQRA 3RI3A 1JQBA 2FR1A 3OF2A 4YWJA 4MO2A 1YQDA 3IP1A 2J5KA 4IDBA 3S8MA 2D1YA 1UZLA 4M1QA 1SEPA 1P1FA 3N7UA 1T26A 4IDAA 2VHYA 1PGOA 5GZ6A 5JYDA 2ZTUA 5JMWA 5AXBA 2Q50A 2BFMA 4J16A 4RPLA 3WGQA 1EEHA 1N2SA 1NASA 1MV8A 2BELA 3VH4A 1Y6JA 4ZQBA 3TDKA 4E32A 2CNBA 3ADOA 3PHJA 4GQAA 4Z0TA 4D79A 2CDBA 4IJWA 4R51A 2PH5A 2VN8A 4U7WA 1E7SA 1DO8A 3E82A 2YZ7A 3FWNA 5BSGA 2D4AA 3I83A 2Q2VA 3WTBA 4CLOA 1IB6A 3D64A 4DPMA 3ANNA 3W6UA 1N1GA 4ID9A 2ZB3A 4A03A 3PXXA 3LLSA 5JC1A 4MVJH 4MVJP 2BRUA 3KVOA 2CF5A 1SO8A 3JQ8B 3QQPA 4RPHA 3RJ9A 3S2GA 1ZK2A 1F12A 4JBGA 3TQHA 1MXFA 4RO0A 2R00C 4QXMA 1XU9A 4GGPA 2PNFA 1Z45A 2XXJA 2G0TA 3OJLA 3C8MA 1GV1A 1GYRA 2HMTA 4CM4A 4TRJA 3GNTA 4TRRA 4Y67A 3ZWMA 2BD0A 1KVTA 1E1NA 1YOVA 3O8QB 3RASA 3DZJA 5F3RA 5KJEA 5JAQA 3DBVO 1V8BA 2Y1GA 5DBGA 1N9GB 5EINA 4KUHA 1LDEA 4DC1A 1WZEA 2IE0A 3WGHA 1PIWA 5G4LA 3TN7A 3Q9UA 1GYQA 5A04A 4FOSA 1NWCA 4RVSA 5EERA 1PS9A 4WASA 1XHLA 4OM8A 5HWSA 1BDBA 4WCFC 2O3JA 4CLDA 2ZB4A 4OO3A 1KVRA 3A4VA 4IDEA 3GAFA 1DC5A 2UAGA 2VHVA 3BTVA 4JNKA 3K2BA 1U9JA 5I7SA 2HUNA 4QECA 1LC3A 3CTMA 4WLVA 3TZ6A 1M67A 3STHA 2B37A 2PD3A 2VWQA 3IUSA 4AJ1A 3BMQB 4J90A 5G0VA 1CQJA 4B7CA 1X0VA 2C29D 2E82A 2HMSA 3LF1A 5I8WA 3W8DA 5A4DA 4YCAA 2ILTA 2R6JA 3F4LA 2G1UA 2Y0DA 3H8VA 4H7PA 4NK4A 1I33A 4XJSA 4FSHA 3AY3A 2YW9A 2O23A 4LK3A 1DLJA 2YY7A 4IS2A 5CAEA 2B5VA 3AUSA 2Y1EA 4GSKA 4BL5A 2IYPA 2GYYA 4W7HA 5H82A 1Z7EA 4DRYA 4BNZA 1R4NA 3L6DA 2RHCA 4CQLA 5T57A 2W2LD 3LT1A 3LF2A 3S2FA 4YAIA 5JDIC 1PL6A 4AJJA 3QWHA 1S7CA 3QWFA 3F4BA 3ROPA 4EITA 3PHHA 1U2GA 4H15A 1F06A 3HFSA 1EVIA 4C7JA 4H16A 4Q39A 1JVSA 1J0XO 1P1IA 1WAMA 3AFNA 4DQVA 3LC2O 3CKYA 1WZIA 1EK5A 2NUAA 3WYEA 2OL4A 4YYZA 2NSDA 4WKGA 4YT2A 4BV9A 4Z3KA 1B8VA 1R66A 1N7HA 1V6AA 2DFVA 4IDFA 3U4DA 4A2CA 1DHTA 1Q0HA 5DF1A 4CLEA 1SB8A 3EY4A 1UR5A 4I5GA 4WGGA 2E37A 3WGIA 2GCGA 3CUKA 1QV6A 4BS9A 4BO8A 1GUYA 2JFHA 4CLHA 1ULUA 4N5MA 1SBYA 4BMSA 2IXBA 3I9NA 3UXYA 4DYVA 4PZDA 3VVBA 2HK7A 2C0CA 2W4QA 3SEFA 3K8ZA 3H3FA 1G0OA 2C5EA 2JD0A 5JDIA 3D3WB 4MVJI 2DPHA 2EKLA 5G0SA 5B37A 1GZ6A 4R68A 2C7GA 3FPCA 2I9PA 4EUEA 1O6ZA 3QE3A 5DZSA 1NPYA 1X7GA 3RU9A 2EIHA 4XQCA 4UVHA 3BZUA 5L7TA 5TF4A 3NRCA 1Q7GA 5JCJA 3PHGA 3DB2A 4U6SA 4FFMA 4MKXA 2Q4EA 1A4IA 4IGEA 4ESOA 2LDBA 1ZK4A 5IDQA 1U3VA 3A28A 4BO6A 1HT0A 1BW9B 3JQ6A 3Q11A 4FJ0A 2C20A 2DTEA 1GAEO 2Q1WA 3DZHA 3CEAA 2J8ZA 1I36A 4G65A 5EJ2A 2WYWA 1RPNA 4NU5A 4OGWA 5AXCA 5B1YA 2VRBA 3WJ7A 5KKAA 1LTHR 3Q1LA 4NR0A 1Y8QA 4TWRA 1BVUA 1K3TA 5IDYA 3H5NA 2ZATA 2C59A 1RM3A 4ND4A 2B36A 3NYWA 3PFFA 1E6WA 2POQX 5IJZA 1X0XA 1O9BA 1P31A 2EGGA 2UDPA 4XYBA 1EUCA 1AHIA 2Q22A 1XSEA 1EZ4A 2ZK7A 3WJAA 5C37A 4U8GA 2DUWA 4NJMB 4FFNA 3KYCA 5T73A 5G4KB 3I9MA 1BXKA 3B1FA 1LLQA 5JSFA 1EDZA 4YQYA 4FB5A 3FNGA 2Y67A 1WPQA 2OXIA 1E6UA 3RFTA 3BHJA 1D1TA 3V2GA 3ZWBA 2W98A 4BO5A 2GN6A 3Q9NA 2FSVA 2YHIA 1KC1A 3R1IA 1VC2A 1SC6A 1E5LA 1N5DA 4J2OA 1GD1O 4JBIA 3PJEA 2Q3EA 4ZQHA 1QLJA 2ZYDA 3WLEA 4E2WA 1MGOA 1GR0A 3G1TA 1JWBB 2BKAA 2DQ4A 3BMCB 4UVIA 1ZXLA 1FK8A 1IE3A 3L07A 4QSMA 4DMLA 4ALLA 3DFUA 1YS4A 4E4YA 4HP8A 1NFRA 3CZRA 4XIYA 1V0JA 2CD9A 1SOVA 1T2EA 3H4VA 3FD8A 4EW6A 3EMKA 4XGKA 1ZKMA 2X1HA 2D8AA 5IZCC 4I5EA 4CUZA 2FHSA 2GLXA 2BFAA 2FSSA 4DVJA 1YXMA 1YDEA 4HY3A 3KV3O 2AEMA 4ITUA 3JQGB 2B69A 3MJ4A 3GN2A 3MZ0A 5L95A 3VH3A 1JU9A 2O4CA 4PLGA 5JAZA 4IJVA 1HEUA 5T67A 2PY6A 1H94A 1J5PA 1YKFA 3JQAB 1HE5A 1Y9EA 3NJ8A 1ISFA 2UYYA 1U8FO 5L53A 2GASA 4AJHA 1UDBA 3GC6A 1T2FA 3PPIA 4Y8VA 3HSKA 3T4EA 1GCUA 3DBHB 5DBIA 4OOEA 3JYNA 2Q46A 4F6CA 2OBYA 2J5RA 1QG6A 3UOGA 5DT9A 5KCZA 1EDOA 4R41A 2QRLA 3B1JA 4KDFA 1DAOA 2VHZA 4R1NA 4TRMA 4MIEA 5J9GA 2NU9A 2HSDA 1K89A 4GH5A 3AOEC 3LC7O 2DAPA 2YHUA 4EEXA 3CH6A 3O03A 3OETA 1NVMB 3H2SA 4WE3A 1NPTO 5DN9A 1VL6A 2EJWA 4HXYA 4XDYA 2J3JA 3I9OA 2BH9A 5F1PA 1NXQA 1Z82A 4IQGA 5JY1A 4IXWA 1ORRA 5AYVA 1GU7A 1H6AA 3G49A 3FHLA 4L75A 3HDJA 3MJVA 1C1XA 2VRCA 3C24A 1FXSA 5KKCA 1ADGA 2DU8A 4BO0A 3M1LA 3NTRA 1HSZA 5EESA 1UAYA 3E03A 5BSFA 5TX7A 4R16A 3RJ5A 4IIVA 1QORA 1BDMA 1XCBA 4E2YA 2NVWA 2AHRA 2GZ3A 1JDJA 3ANMA 1F14A 4IQ8A 1YJ8A 4Q3CA 2E48A 3PJDA 4NHEA 1GQQA 1AUPA 3DHNA 4OXNA 5I7FA 2YQ5A 4IY1A 1UXGA 3AI1A 1LSUA 1XDWA 3OM9A 4E6PA 1YL6A 1HLPA 4B79A 1YE3A 3GUCA 3ZNNA 1UDAA 1DPGA 4K1LA 1LRLA 2O50A 2HQ1A 4W9NC 3PZRA 3QLJA 1YBMA 3ZWVA 4Q3AA 2VT3A 1X13A 4EI2A 3F47A 2CZCA 1I2ZA 3A06A 4RF5A 2I99A 7ADHA 4RDHA 1U7HA 4W6ZA 1JKFA 2NADA 4PIVA 3KSZO 4CMGA 1RM0A 1ZBQA 5MDHA 2X22A 1BRMA 4R5MA 3K30A 3VKVA 4FR5A 4FCCA 1O94A 3TF5A 3U9LA 1MC4A 1G0NA 4AFNA 6ADHA 4QFCA 3AW9A 3R3SA 3U4IA 4NK5A 4TROA 1YL7A 5L45A 1J4AA 4TKMA 4FQ8A 5CG2A 1C0IA 4PLCA 5CEEA 1UUFA 5TT0A 1HRDA 3ZV3A 3ZU2A 4CR6A 4BNUA 4PLWA 2JKVA 4A0SA 1AE1A 4AJNA 4BNNA 5TRTA 3WNVA 4BNYA 5JAIA 4MIOA 1MB4A 3O26A 3V5NA 5THQA 2SCUA 1W0CA 4J7CA 1EE9A 1SNYA 3KBOA 3OQ6A 3PFWO 4TVBA 2W2LA 1DB3A 2P9EA 1BMDA 1QP8A 1PZFA 1JLLA 1SPXA 3NT5A 2VTDA 1ISHA 3VAZA 1HLDA 4ZQEA 5T8KC 1NVGA 2PKRA 4XR9A 3Q2IA 1OOEA 4R4JA 1X14A 2DUUA 1O8CA 3VZPA 3D3WA 1LJ8A 4Q3NA 4I8XA 1R4MB 3ZHXA 3M2TA 1YO6A 4EGFA 3BTUA 1C0KA 2X4GA 2GN4A 1KEUA 3WR5A 3VPXA 3RVDA 4YA6A 1LA2A 3WGTA 5IG2A 1W73A 2H1SA 2O3TA 4II2A 2O3UA 4YAGA 4U0KA 1DHRA 2P91A 1PWXA 5BSHA 4BKUA 4BNVA 3NTQA 1IZ9A 1B3BA 1ZXBA 1Y7TA 1MLDA 3GVIA 1ZJZA 4CV1A 2B4TO 4UVGA 5TSDA 3BIOA 1B3RA 4HFMA 4YRBA 1BW9A 7MDHA 4TSKA 5T5QA 4EJ0A 5L7WA 4WCFA 1WW8A 3D4NA 3LVFO 3W4JA 5TC4A 3ZWXA 3H3JA 3OIGA 3D4OA 4DL9A 4XYGA 3SVTA 4EUHA 3C85A 5ILGA 2P9GA 2FWMX 3NUGA 4L73A 5LCXA 4D7AA 5EQFA 4L76A 1UAGA 4RJTA 1E3JA 3E9NA 3ZZNA 5A02A 3OQ1A 4GMFA 4RPGA 3OBBA 4L4SA 3QRWA 2WE7A 3U09A 1ZCJA 2IXAA 2J3KA 2VZ8A 1K5HA 2WM3A 5FEUA 2BGLA 4K6CA 3H5RA 3PWZA 1BXGB 4ND5A 4JN6B 4M87A 3RBXA 3D1LA 4YT8A 1DAPA 1OC2A 3NGLA 4O1MA 4Z3DA 2FOIA 1H9AA 2YYYA 2D5AA 2ZB7A 1X15A 4GAEA 2CVZA 3K2EA 4S1VA 5KJFA 2GERA 5JYFA 2JFFA 3PQDA 1KIFA 3KYBA 1MC5A 1VL0A 3NT2A 4M54A 2OP0A 4IM7A 1QLHA 1PGJA 5IZ4A 3RUCA 3F9IA 4EUFA 5ICMA 2A94A 5A9SB 2W8ZA 1M66A 3JD0A 4LVUA 1KYQA 3D0OA 4BGVA 1I32A 1M6HA 5HTOA 4UUNA 2PZLA 3WGOA 2GR9A 2DKNA 2RBEA 4E2XA 1PEDA 3W4IA 3GG2A 2VOEA 3VTFA 1VE9A 3GFBA 1GQYA 1XU7A 1LUAA 2EP5A 3EZYA 3DONA 3QP9A 2OGUA 1N92A 4IINA 3DBLA 3KO8A 4UEJA 3F6YA 4KOAA 3GG9A 3IMFA 2V6MA 3TFQA 1QYDA 1NQOA 3UUWA 4RVDA 3DO5A 1LDYA 1XA0A 3QVSA 4E5PA 3TOZA 1UDCA 4I08A 3ZHZA 1T24A 4KTVE 3V1TC 4GX5A 2JCXA 1TLTA 1HDYA 1ZNQO 2YDXA 4DPLA 3TZKA 2HLPA 4CMKA 3H9QA 3WGGA 2AQKA 3HB5X 4CODB 5JCXA 5JDCC 1ADFA 1XWFA 1U4OA 4PLPA 3U0BA 3DOJA 4OJNA 1T4BA 1GUZA 2JHFA 2QRKA 3DL2A 1X7DA 3W8FA 4OL9A 2VYNA 4BNLA 4CR7A 2FPIA 3WS7A 2HO5A 1JAYA 3PYLA 1IPFA 1XGKA 2EXXA 3KHUA 4J6FA 5DCYA 2Z5LA 4FIZA 3HG7A 4QO8A 3NKLA 3JV7A 4JXKA 4E31A 3TPCA 2NNLD 4PLFA 4WLEA 1JAXA 4TQGA 1W8DA 1PJ2A 3VTZA 3IJPA 4FN4A 5TS3A 3TZCA 3WQQA 5KVSA 3GRKA 4KTTE 4U6QA 3FBTA 5TIIA 2DLDA 1FDUA 4GX0A 1VKNA 5F5LA 4Y6RA 4MVJG 1BHSA 1AGNA 4BNKA 5IZCA 4XKJA 4BV8A 2D59A 5B4UA 1DIGA 3M1AA 2JCYA 4A7PA 2VOJA 2CFCA 2G5CA 3GH3A 3O38A 5FYDA 2YDYA 2XOXA 2C7VA 1U3UA 3WMXA 1YB4A 4ZQFA 2H5LA 4AJKA 1I10A 1E0DA 4WOKA 2PZKA 3RUDA 1C14A 1KETA 3KOUA 3UAGA 1Q7BA 2HCTA 3ZV6A 4WNCA 4EZBA 5A3JA 5JAMA 2H63A 1VJTA 2C07A 4TVOA 1LRJA 3WX0A 4O0LA 3COSA 4NZ9A 3VKUA 3TJRA 1WMBA 1TB4A 3D5QA 2VWGA 1NYTA 3DBLB 4CV2A 2OMEA 3P5SA 3ITKA 5KJCA 2YV1A 1WP4A 4FFLA 4B4UA 1SEVA 1QKIA 5FWNA 4NDNE 1E5QA 5TNXA 2ZQYA 3H9GA 2A92A 3FR8A 4ALJA 1CIVA 2DTDA 4DWVA 5ER9A 1H2HA 1KEVA 4FC6A 1E7QA 1Q0LA 3R0IA 4A73A 3B6ZA 5ENDA 4P4NA 1KVQA 3TWOA 4XEHA 2LDXA 4Q3DA 1EK6A 3WGZA 3DAGA 3T7CA 1P3DA 2JHGA 2V7PA 4DQUA 5BNIA 2W2KB 1SZJG 5AVOA 5I9NA 4LSMA 1IHYA 4YAEA 3W4KA 1PQWA 1VJ0A 2WEKA 5C7OO 1HF3A 5DDIP 4RV9A 1HE3A 3DR3A 3E9QA 4OSPA 2Y66A 4RF2A 5JE8A 2HRBA 3JQBA 4Y6PA 1TT5A 3ENNA 3VZRA 4D41A 4YRAA 2YFQA 3OJEA 4NFYA 4XQGA 1R0KA 3IKVA 4L9RA 4MDHA 5CG1A 4FGSA 3PGJA 4JQCA 2PH3A 3DQPA 2P4QA 1PTJA 3I3OA 4N5NA 4YJGA 1DOHA 3L6EA 5GY7A 4D0SA 3GGOA 1CQIA 1T4DA 2J3IA 1V3UA 2DVMA 2V6BA 3DZGA 1A9YA 2Q2QA 3H6KA 1TVEA 3RUAA 3SC6A 1QYVA 4WEOA 3JQAA 4OAQA 2X7HA 1XG5A 2A35A 2O2YA 3NTOA 4BKRA 1LU9A 4ALKA 4ZRMA 2Y93A 3LDHA 2X5JO 4NFHA 4LCJA 3G1UA 3DFZA 1IPEA 1Z6ZA 1ZSYA 2RH8A 1IL0A 5A1TA 1T2DA 1U7TA 4WOJA 3NAQA 1ZJYA 3EDMA 1RWBA 3GNSA 4E33A 2AW5A 2FY8A 3LC1O 1ML3A 3P2OA 2B83A 1K6XA 2AQHA 4BKQA 4M8SA 2P4HX 4UVDA 4RLSA 4ZVVA 3RROA 3JQ9A 3FI9A 4CMEC 2HMUA 3ZU5A 5TJ9A 5CPBA 3HN7A 2Y1DA 1PGPA 3ZU3A 3MOGA 3PHLA 1R16A 1P44A 1ADBA 2HMWA 5AXDA 5JW6A 2XXBA 1HYEA 3AUUA 1E3SA 3WSVA 2PGJA 4AVYA 4B4OA 2ET6A 2DPGA 2HDHA 3GR6A 4R5HA 1GTMA 2FZEA 1X7HA 3WGYA 2AQ8A 2GN8A 3IC5A 3U49A 1NP3A 3OICA 3H7AA 1N7GA 3AJRA 4CLRA 2PGDA 4L4RA 1NQTA 4G5HA 3QVOA 3PDUA 4D0RA 2YV3A 2Y68A 4XRGA 1S6YA 4E30A 4YXFA 5CDGA 5IDWA 4XA8A 3V2UA 1GDHA 1HKUA 3ZV5A 4ZICA 1TT5B 1M2WA 1GYPA 3RKUA 3VPGA 3E5MA 1ZZEA 2AEFA 2E6UX 3RKRA 1ZFNA 3KYCB 1NAHA 4DMMA 5CDYA 1NM5A 4PFJA 2X5OA 3JYQA 4J2HA 4NBWA 4OQYA 3ASVA 3C7CB 4YT5A 1A27A 1GPDG 4FD3A 4NPCA 4AJPA 1E3WB 4ILKA 4C4OA 4S3MA 4RPKA 2HU2A 1KVUA 3PGXA 4ND3A 3RQSA 1JWAB 4E3ZA 4BNWA 3IOYA 4BMNA 2X0RA 3FNEA 2OZPA 4XYLA 4IS3A 2DBQA 2QHXA 4TRNA 3TNLA 3BA1A 4QT0A 1CEQA 3JQFC 2ZCUA 4W99A 1E1MA 1D1SA 4RVFA 4CMIA 1B8UA 3OH8A 1E6EA 3RAJA 3I4FA 1PJBA 2VHWA 3AM3A 3TL2A 4CM8A 2GUGA 5IAAA 4CMBA 2V6GA 2GNAA 3IKTA 3WB9A 3JSAA 5IXYA 4B3JA 1HE2A 3GT0A 4OIMA 3FNFA 1PL8A 1NPDA 4CMAA 4X54A 2NQTA 3INGA 1YONA 3C7AA 5DP2A 5KVCA 2ZB8A 4INAA 1XR3A 1JA9A 1NAIA 2C54A 1DJQA 2BFOA 4I9UA 3WTCA 4YJHA 5L3ZA 4DIFA 5K6AA 1U4SA 3ZH2A 2C2YA 2QW8A 3NT4A 1UXJA 2OP1A 2QYTA 5ER6A 4YTEA 2C2XA 1UP6A 3INRA 1B26A 2IDZA 1B14A 3GZ4A 1A71A 2NLOA 2AE2A 1DIAA 3OQBA 3AOEA 2CF6A 8LDHA 4KQWA 2I67A 4IBOA 2GO1A 3MEQA 2CUKA
chains in the Genus database with same CATH superfamily
3SX4A 5AVYA 2QYOA 3I92A 2PUJA 1H0RA 2F6RA 3N59A 2ID9A 1Z0UA 3S4YA 2VJKA 2RHHA 4MB2A 5HUHA 3AHHA 3ZX5A 2D0IA 2H1CA 2W6ZA 3AJ9A 2PYDA 4FW8A 3REFA 4O3MA 3M7IA 3GLFB 3AB3A 5IJXA 2JG3A 1H6DA 3WIOA 1Y3DE 3ZHTA 3VPCA 1ZC3A 2WTUA 3F5SA 4FILA 4OOFA 2OHVA 1DC3A 2VFAA 2W2QA 2B8EA 4EG7A 4YRNA 5KMGB 1YQWA 5IVKA 3A9VA 1AN0A 1E5XA 3M6FA 1QP7A 3OCVA 3HA7A 1XT6A 2JAHA 2PKYX 3NUQA 4E4TA 2JVKA 4PNEA 3FWHA 4GWKA 3FN4A 1EGAA 2CUNA 1NY5A 4G0OA 5G3ZA 1P1JA 4WVFA 2UZ4A 1GGNA 2CBZA 5KIAA 221PA 3I53A 3VDRA 1XA4A 4BLOA 2GKGA 4NZOA 1LF5A 1O8BA 2Q9UA 2WKPA 2BTEA 5EE9A 1A7UA 4QDXA 2BI8A 2P8SA 4K9MA 3F71A 4KN5A 1T1RA 1Y5LA 4IJQA 1ZMTA 2C9OA 1FFAA 2JGRA 3ILSA 4QO7A 3CH5A 5CH5A 3VR3D 1E2QA 2P4UA 4LS3A 4MLCA 4DYDA 1PE0A 5TY0A 1P1HA 3TW8B 4RHTA 1HQCA 1Z0AA 3DAHA 3K4HA 3DKIA 1UXKA 2AG6A 2R4QA 3WX0A 5LC1A 2VH2A 3ODGA 3SSOA 5EGSA 2IZOA 1PGQA 1I24A 3GDGA 4OGGA 1KH2A 4YJ3A 1YOVB 4LHXA 2H85A 4JAVC 1NQ5A 3FUVA 4LZJA 2JFGA 4CM1A 2CLDX 3INTA 1MB0A 1KKUA 1ATIA 2FPPA 3SHFA 4LEIA 1YRBA 4G85A 4L8FA 1KO8A 1LPBB 1ZGCA 1ZH4A 1QMGA 1NHWA 3PNBA 4OJYA 5C8VA 5IHXA 1C80A 4IFEA 5JSHA 1F8XA 3CF6R 3BWEA 1JEOA 2AS0A 2GPYA 1E99A 1J0BA 2NZ8A 3DO8A 5E4TA 4DBZA 1FDWA 4J2TA 2GH1A 4TMYA 3C3EA 4M6WA 2OXTA 1JHVA 5A6SB 1KJNA 1T0JB 4JL5A 5GTDA 2NVOA 3QUSA 3SPXA 1I2CA 1L4LA 4RTNA 4P4TA 4KVZA 1HDRA 3ZBTA 3UM9A 3I0ZA 4Y3UA 4BP1A 4LV8B 1IZ7A 1TEXA 4AG5A 4EG5A 3UPUA 2P9QA 1RJWA 3TZCA 2AFIA 3IAM1 4NBRA 5DHTA 4Z0NA 3D8UA 3WLNA 4JLPA 4MKIA 1XTJA 1ZH6A 3KJNA 3U44B 1D6NA 2V96A 2XZLA 3ZY3A 4KIUA 4IIUA 5E38A 2A4KA 1KDTA 1F8FA 2HRCA 3HFRA 2OUIA 1P1KA 2OC9A 3K9CA 3JVEA 3JTMA 5ECYA 5KTMA 2GTHA 4BGEA 5TARA 2BBSA 2PS1A 3OECA 2G08A 4GX1A 1WIWA 2VWPA 4DNQA 2Z8YA 1NVTA 4LJ5A 3FCYA 4OK3A 1XLWA 3E84A 1FJGB 2QN8A 3CW8X 3S5JA 3MAJA 4WLFA 1WRBA 3FFWA 3IPLA 3UCXA 3GFRA 3T4XA 2CLSA 3PJGA 3EGDA 4RE6A 3LT0A 1NT4A 1GEGA 2C5HA 2NZUG 2IUUA 4B73A 4BCBA 1RXUA 5A5VA 1CS0A 1HDZA 1Z8NA 1MB9A 3QXSA 5K6AC 3KG2A 3DT9A 2BV3A 5LP6B 3FWZA 4QUHA 4PHGA 3ABZA 5BOSA 3KVNA 3JD2A 1NBIA 1U9CA 5CT4A 4MDYA 5E7IA 5H70A 4HQLA 1D0IA 5F1YA 1ZCZA 1Y8RA 3HJBA 1G1MA 4BUJA 2CT8A 1H8ED 4KBFA 2W6JA 3UFXB 1GDTA 4LHSA 5IC5A 3T7EA 3UGKA 4UUAA 3LSYA 1M1XB 4ZODA 5CB0A 4CMIB 1QFMA 2VUHB 4JI3B 4RD1A 2QQFA 2QUBA 2QUZA 5IC6A 2YVLA 1B43A 2IYVA 3DV0B 3H11A 3VC3A 3WDKA 4IPTA 4WZBB 1Q84A 2WC1A 2PUBA 1QZUA 1JG7A 3Q9LA 4MV1A 1P29A 2QP9X 3KVVA 2C4MA 1TGYA 3OOWA 4M37A 3O4RA 3TAUA 4MVJM 2HNKA 3STUA 3E1KA 1PQ4A 3AU9A 3GELA 4XIGS 3HWRA 1PS8A 1TYCA 1FFYA 2I87A 2MR6A 3P7MA 3UB3A 5ICSA 2BKLA 4FOTA 4RGYA 1R6TA 3OZVA 5CX4A 3FTFA 4U2FA 1S96A 1VIAA 2FUG1 2HY7A 2ABWA 5AM5A 3D8NA 5U9CA 2W6MA 3GW8A 1ONOA 3RC1A 3GEIA 4MYTA 3FGPA 1DC6A 3FOAA 1QJ4A 4NJOA 4QFBA 1DTSA 1GVNB 3EGOA 4XDHA 3QU9A 3LOPA 5IJWA 3U7HB 3HTXA 3IEPA 4QBKA 5A5EA 1ZPDA 3WICA 1PR2A 5DCLA 1HTBA 4BECA 1G1AA 4PZCA 3OHSX 2QJRA 3CX3A 1G6OA 4C0HA 1XZPA 2H4XA 1P6XA 3STYA 3BGSA 1B4DA 3KXDA 3TAHA 1XZ8A 4GNRA 3NHUA 1CTQA 1LNZA 1PT8A 2BR3A 3WDMA 3KTOA 3KIPA 3TL3A 4D3FA 3V4VB 4DLRA 1LF0A 3MT8A 4DG8A 4KIWA 1G21A 1MFPA 4G1UC 2ON6A 1MNAA 1ZICA 5AK0A 3W6ZA 4CM8B 4DANA 1E9FA 5EUQB 4JHXA 3KEQA 4IEFB 2RHJA 1AXEA 3B78A 1VI5A 2CJWA 5AUPB 4EM6A 5CRIA 1NN3A 2DZDA 2C77A 2QQ0A 1NI4B 4HADA 3AERB 4JJFA 2VSNA 3A37A 5F2KA 4V3BA 1TL7C 3W3AH 3ZWOA 5HM6A 4J0FA 3BGOS 1PZEA 4JKOA 4FYMA 2ZR8A 3MCUA 1TZJA 1T1SA 4JX9A 2BSQA 2Y9MB 1VJGA 2X2EA 1QX4A 1RKXA 2P3LA 2OOSA 4MUEA 3VSCA 3UO8B 3DMTC 2X4DA 2C5GA 4MVJA 2P2GA 4OEHA 1T5LA 3DZKA 3O91A 2Q6KA 4YRLA 5FBQB 3T0FA 2FXVA 1JQEA 2QRJA 4WRRA 4YRTA 1E0SA 1T8PA 3UY4A 3VR4H 4PW0A 2X0NA 1P7YA 1X7YA 3ER6A 3BX1A 3M9XA 3P2EA 3RE1A 1VL5A 3WXBA 4DZZA 2C82A 2VXBA 2H4HA 1CE8B 2H1RA 4IV5A 3ZU4A 4O4LA 1NRIA 1U8ZA 3LM8A 1PT5A 1GZHB 3CE9A 3ZK9A 5BP7A 3OCYA 5LDDC 1TQHA 3WYDA 2P0AA 3V1YA 4CM9D 4DHEA 1D2GA 1H93A 5BYKA 2JBHA 4TMZA 3UHJA 2HJ9A 2ZZNA 3TMYA 3TUXA 4AAYA 2K4MA 3COPA 4LCEA 2NU8A 3TLAA 1JA1A 2G82A 2QOEA 3CUEF 4EPXA 5E9QA 3COJA 4ALNA 4BNDA 1UZAA 2KQUA 3UMRA 5CK4A 4BB9A 5TJHA 4OXRA 2C8JA 3FA2A 3Q7QA 4R9VA 4XD7A 1QYWA 2NTYC 1XQ1A 2XGGA 3HKBB 4B2PA 5K45A 3ZY6A 4HWKA 1P1CA 5EJ9A 1CB0A 3ZZ0A 1II8B 3FFBA 3KKNA 3ECAA 5COQA 1A5SB 2IRWA 5EWMB 1VLVA 2DCMA 2NWQA 4FMDB 1PJ8A 4FMCB 1G8KA 7REQB 5A6VA 2G07A 1VRWA 4TTIA 1DV2A 3WRXA 1QP4A 1OYWA 3KDSE 5DSZA 2D1FA 1EX7A 1Z6XA 1AS2A 3DV9A 5JH7B 3A4IA 1QIMA 2BYTA 1BTOA 4DXHA 1OWMA 3BYZA 1G2QA 3TSZA 4U2BA 1XVTA 4MQEA 2NXJA 3LQFA 4IGKA 4EGJA 2QSYA 1H4QA 1VFNA 3G2JA 1ZM3A 3CX4A 3IURA 3TD2A 5ITZA 1HDEA 4TMKA 3CZ5A 4P82A 3WYBA 4QIHA 1W4LA 1RJGA 3ZWCA 4D8UA 4EPRA 5A05A 1L7NA 5K09A 1KBQA 3DWIA 3R4CA 4BKPA 3C3AA 3UATA 3PP8A 2GVDC 2ISCA 3ZXXA 5AK5A 5CDUA 3EX7C 4YX9A 4WDQA 2EEZA 3OMWA 1KPGA 5FAKA 4P86A 2VA8A 3L6BA 3AEZA 3T1OA 3PFHA 5K3CA 3HFJA 2H2AA 5B4TA 1W34A 1F2DA 4BNTA 1R0XA 4W5OA 3PX2A 2HK9A 4UDNA 2C4UA 3GGPA 4J49A 3W1VA 4BBAA 1Y8CA 2F59A 3IVMA 2Z6UA 2R4TA 5LR6A 1QMPA 1N8TA 1R6DA 1V39A 2ZE5A 3BE6A 4MP3A 4JBNA 2ORWA 1YAHA 2OVBA 4I9NA 4J9VA 3GGJA 3OC0A 4RD0A 4UCFA 4ZDWA 1L1FA 4QOGA 1S2IA 1RZ3A 4GOKA 1V9CA 2G88A 3JY6A 1V45E 2A7QA 2FJPA 1DP4A 2VNAA 3DDNA 3Q98A 4L57A 4LVCA 4PFKA 3ET4A 4RQUA 2Q0XA 1HL3A 1K6MA 1HG1A 2E1PA 4B74A 5KWEA 3OPQA 5JMTA 5COAA 5EP4A 1L7DA 4LSWA 1IN7A 4BGUA 1IULA 1LPSA 4M86A 1AKWA 3FTDA 5DO9A 1ENZA 5DLQC 2R00A 4G8CA 3LDFA 5EQDA 2H0AA 3LU1A 4YJGB 4MULA 4RADA 3UJDA 4A27A 4R81A 4BJ3A 2WTEA 4ZAXA 1VCIA 1UKYA 1SVWA 4NIMA 2H2DA 1XMVA 4JQOA 1ZUNB 4DDVA 2E6KA 1JG2A 2FUKA 1GKUB 4QQNA 5DI3B 1U28C 4MB6A 2PR2A 2ZUSA 2JLZA 4I4CA 1TJYA 2I4IA 4O4HF 1OGIA 3FPKA 3TLEA 4JJIA 3PT5A 4M9QA 1OF1A 4CEJA 4KYIB 4C78A 5AHWA 4Q9LA 5HFJA 1TPZA 3PGMA 3TD6A 4LOLA 4A92A 4GXQA 5CVTA 1E7YA 4KE8A 2XIJA 4YJHB 1S2DA 4ZMSA 2RB5A 4E15A 2I7VA 3UK2A 5F1KA 2C5LA 4P33A 2IIPA 4ZDJA 4IL5A 1OLXA 1G8HA 4F38A 4RIEA 2UUAB 1LK0A 2PUFA 1ZN9A 3KEOA 1GR1A 1GCIA 3MQFA 3ED5A 1L7PA 4YRSA 1TQ6A 2EF1A 2L2QA 4DDUA 4HDOB 1P4JA 3L0YA 2JLXA 4JOBA 1PWEA 1E2NA 4KQ6A 1T8RA 4FP9A 5INTA 1AC5A 2AMYA 4NCXA 2Q21A 4IDCA 1W9HA 3OE1A 4BMPB 3DDHA 1PX2A 1SVNA 2OKCA 3HVHA 3E81A 2OCGA 4OH1A 4JUIA 2XYPA 2WT8A 2JGLA 5JYBA 4FWBA 2IV2X 4FIDA 3OM8A 3WLJA 3GEEA 1LI7A 4LHZA 3C1TA 3W05A 521PA 1AV6A 3BMNA 1XZIA 4P0QB 4Z4QA 3C3XA 3NCTA 3WB2A 4K26A 4FDLA 1M34A 3A31A 1UODA 4ESVA 3EAGA 2OR3A 4ZYZA 1D6JA 1CP2A 4LYGA 3LUJA 8ADHA 2PWBA 3GRPA 3R6WA 4WBNA 5HQ3B 4CM9A 3U13A 5K8JB 1XTZA 1E3TA 5F4ZA 2P68A 3NWJA 4L27A 3WK4A 3Q9SA 3SOPA 3QXCA 4FPXA 4OKIA 3JARA 5J5VA 3KKKA 1J2UA 2CN1A 3OZSA 4UKDA 2HDOA 1QM5A 1PNVA 2IW3A 3WP1B 4N7BA 5IF3A 2M2IA 3GROA 2PMWB 2P6UA 3WISA 2H18A 4M7OA 4DF3A 2R6AA 4L9WA 2XKJE 2WKSA 3ZEAA 1UZMA 2Y2VA 4MLDA 3FRHA 3AI2A 3NYQA 5H9WA 5K0SA 4PG8A 2I78A 3COYA 1E9AA 2WABA 4MWDA 3MWEB 3UV6A 1QRDA 3Q88A 3RFXA 1F8GA 1WZ2A 2W4IA 1DIRA 2JIDA 1ABFA 3I5MA 5BY2A 3O4FA 3CW9A 4MYRA 2JGIA 3BRCA 1B15A 2Y6VA 2A1UB 2B61A 4QFDA 2R6R1 1UBJS 3CFYA 3ZGLA 1DIOB 1MORA 2YMMA 5FTWA 5AO9A 3QUTA 4L85A 2A5JA 4MAAA 2GZHA 3E2PA 2WJVA 4X45A 2VPXA 4L6AA 4GOXA 2Q1YA 1C4WA 2FW6A 2H8GA 4IVQA 1WDWB 4JL6A 1IOLA 3ONEA 4C08A 2RHMA 4OK6A 4UTRA 3QHPA 2Q5HA 1SKAA 1BU8A 1O3YA 2WBLC 4Q4LA 2QLMA 1P17A 4PLYA 4Z7NB 1X1EA 2VCYA 1J8FA 1I0LA 1UOOA 1KDOA 4MW4A 4U9IS 5SZIA 4EGQA 4BLVA 1CVLA 1H0KA 3AR6A 1BXRB 3A4MA 3R23A 3DA8A 3RVSA 4LJRA 5JJKA 4NH4A 3D0RA 4Z7QB 2VYVA 4GE3A 2LCFA 2XMCA 3JYLA 4RTLA 2AGVA 1IHUA 2CCKA 3A3PA 3C8HA 3WRYC 2QVLA 5ITVA 3IUBA 1FUUA 3A14A 2J6BA 4OHBA 1TO2E 4V0KA 3SMQA 2BW0A 5DXJA 1XZMA 4EARA 2CMGA 3GOHA 1RHMA 1WU7A 3QU4A 2VP5A 3DDUA 3R3UA 4RK4A 3QVKA 4OQLA 1TKBA 1HXHA 5FFNA 3WNQA 1HFEL 2IGTA 3QUQA 1STOA 3ACBA 3HCEA 5EJ5A 2VPTA 3SJUA 2DT5A 4CIVA 3N6RA 5BWCA 2X3FA 3L4BA 1QHFA 1SG0A 1QR2A 3PGA1 4IIJB 2ONCA 3GLVA 2BUCA 4QARA 2ZEJA 4F2HA 3L4SO 2HBQA 2O06A 5LIRA 4G07A 4Z9YA 1Z34A 1LH0A 4FVTA 4C4TA 1H9BA 2R1UA 4OD0A 4B9AA 1G98A 4CR8A 2HR1A 1RWNA 3OC6A 4P83A 1PZMA 3KLNA 5BQ5A 3Q8KA 4PVCA 1CNEA 3OCZA 1QZZA 4E5VA 3IUJA 3CX7A 4YBRA 2IGBA 4CKYA 3QKWA 4JLNA 1M74A 4G5XA 4D98A 2ZAIA 2K5UA 1SBZA 9ATCA 2F8LA 5KTKA 1TK2A 3ITDA 4Z8XA 1CS0B 2GEFA 5B58T 4DUPA 2W6NA 1JEDA 2WIDA 4XX0A 4JYMA 5HS4A 5CLHA 2JW5A 3JCZA 3BJMA 1N5OX 1SUSA 2J1LA 4H4DA 1MABA 1BVRA 1C8LA 5FUYA 2GBIA 1Q2XA 1A8UA 1YB7A 1CY6A 3CINA 1IDN1 3EF0A 4IKEA 1FF9A 3LGAA 1E60A 4NMHA 1OJLA 2TRSB 4Q4JB 1UMDB 3NBKA 2ZBRA 4ZO4A 1MX9A 2VYQA 3R6TA 5CXXA 5LP6C 421PA 4ZEVA 3V9AA 4QXPA 5HKKD 1BXGA 3FJ1A 5JCPA 4I1IA 1U7WA 3HZHA 4WFQA 4JFAA 1BFDA 1LLFA 1WOMA 2E21A 2X0DA 5BXYA 1OBFO 1XTBA 4X95A 2AG5A 3SZ3A 3SDSA 4P3KA 3RVMA 1GT6A 3K0EA 3G89A 5JBIA 1F17A 4I55A 1Y1QA 5B3JA 3WADA 4PRKA 1MJGM 1VSTA 2Q9CA 1Z4JA 1SA0B 2GK6A 3ON5A 4O5OA 4UEKA 3RT1A 1NYQA 4QPZA 1I9CA 4PLHA 5AI5A 5EJEA 4C0AC 3O93A 1E9CA 3UGTA 2ZU6A 1KWKA 5AVZA 2SHKA 2EJTA 5HBRA 4M9CA 3EXEA 4PG6A 1P4RA 1ZS9A 3AHDA 3UUGA 2XH8A 2WSLA 5C7YA 1FSFA 3NGXA 2HB6A 2EIXA 4KE7A 1UKVY 3SX2A 1UJCA 1SK8A 3UJCA 3KSDO 4BEVA 1TJ3A 2GYWA 2ZUDA 4MQMA 3D6UA 2FRXA 3A32A 2ADOA 4TLMB 5ALIA 1GA6A 4RL6A 2K2WA 1DIHA 4J4TA 3A3YA 3OMLA 4PYOA 3GGDA 2VBIA 1UWCA 2QJOA 3MLEA 3E5RA 2H2IA 4XIYA 2RB4A 3PEWA 5JPIA 3I28A 2HQRA 2GK7A 1WB5A 1RWOA 3ZS9A 4RKYA 3L82B 4K46A 4U8HA 2GA8A 3OD5A 4I19A 1HE4A 3L7NA 1H3NA 2CB9A 1MDFA 3ANSA 4LDRA 2RKWA 5LNK6 3BMNB 3H2ZA 4ZARA 3WJ2A 4RZHA 4CRWB 4FHEA 4HTAA 1NR7A 1B16A 3ABQB 1EWKA 1RACA 3PT9A 3PI7A 4WK2B 1G5HA 4RXTA 4F6RB 3RYCA 1S8OA 5A5GA 1HSOA 1SQSA 3FAZA 1SA0A 3VBCA 4DR6B 4NENA 2V1XA 4A1OA 1LBSA 1N57A 2HIAA 1Z4PX 3ZWYA 1U1FA 3N2KB 4I6EA 3HBNA 3O9MA 3WAKA 1HFJA 1AXGA 4XCVA 3NTXA 3FJOA 2RHBA 4OB8A 4CMHA 5AFSA 4JUDX 2DBRA 1X8XA 2ZOSA 1QJCA 5I3CA 2OE2A 3AO0B 2XAUA 3EF1A 5E9AA 1SXGA 4JI7B 1R0YA 1YA6A 1Y3HA 3HP7A 3RANA 5FNVA 1IXZA 4Q4JA 4TS4A 3E70C 4FFRA 4MR7A 3EZ7A 3M0EA 3GUVA 2PLAA 4KJZA 3K6JA 4I1OA 3AVUA 1Q3HA 5IYZF 3M82A 3NBQA 4QQ8A 3C1OA 1YBHA 5IAEA 4BLPA 4DLSA 3ABSB 3BRQA 5AM2A 4NS1A 3UJPA 1Q95A 1V48A 5FQNA 3MTAA 4OY3A 5JBNA 4GLJA 1RAAA 1G63A 1OAAA 1F1BA 3ZNQA 3KTDA 3GMSA 3GHYA 4OHVA 1LLUA 3Q0EA 5BT8A 4ZT4A 5CA0F 2GS9A 3KR0A 1SULA 1TZKA 2PL9A 1M34B 2OB1A 2PJDA 3ASUA 4KQ1A 4WZZA 4LFBB 1JSZA 1QFXA 4D1YA 5KX5B 3VO9A 4E2FA 1QIDA 2XUFA 3N6XA 5HF9A 4D02A 3AGPA 1YR8A 4TVSA 3K0FA 2W2OA 3GNQA 2VHXA 2I62A 2YJGA 5JWRA 1M1ZA 1ISIA 1CY8A 5JLJA 1Y0BA 1V5GA 2F3SA 4PCUA 2PZMA 4AI6A 4UPDA 1GKLA 1Q74A 4DBLE 1QU2A 4CV0A 3KFVA 2J9YB 5ULLA 4US0R 5B12A 3IEVA 3IXLA 5KEIA 2FKNA 4OBWA 4AWBA 3FDXA 4ARBA 3TFOA 3ELWA 5GVSA 3EOZA 2FQQA 2UVPB 4KXUA 4EUSA 4II3A 4UC0A 5C4IA 2HAEA 4OMUA 1Y5IA 3LLVA 4HQ6A 4ARSA 2CJXA 4ZZ2A 2O8BA 5THKA 5H4GA 1GNVA 4HX5A 4O2BB 1RCTE 1XV5A 5E8RA 4QSHA 1FDVA 3GRCA 2WWGA 4Q9JA 4ABTA 3ZWWA 2AFHB 3CEJA 4G1BA 5TVKA 1W88A 4KQ9A 2OAEA 5AM3A 1GSOA 3T5DA 4B3GA 3SAJA 3JQ7A 4RJIA 3ICQB 1G3UA 2FAXA 2PYZA 4FZJA 4G5GA 3RK0A 3MG9A 4DJEC 4B80A 1SHUX 2A86A 1NA5A 2I65A 1ULTA 3HL0A 1QKJA 1DBVO 2NAPA 4W8GA 3VDQA 1VA5A 3AILA 3QXXA 2LR0A 3GK3A 1JJVA 1JJIA 2QMEA 3SS7X 2GAJA 3FYUA 1P4AA 3LPLA 4Q6WA 4XWTA 1PP4A 2IZ7A 3AYXB 3WQRA 4PC6A 1N9ZA 3O8NA 1QU3A 1GPBA 4GVPA 3IOCA 3DAYA 1I0IA 3F1KA 4PLVA 5EA2A 1T5DX 3F5MA 5FXMA 5T6BA 1IY9A 3SYMA 1PQPA 2HIGA 4WOBA 1Y1LA 1T1JA 4OKNA 3THOA 1NVKA 1J2RA 1FNSA 5HJEA 4EHAA 2QE6A 1C9MA 1EUYA 2ENWA 4Z4CA 3JYHA 1KZGB 1ODIA 2DQYA 1VI2A 2EJVA 4MWSA 4OYRA 3EFHA 1JEJA 1WF3A 3IBSA 1J49A 1PFWA 4HDNA 3A8TA 5TV2A 4G0NA 4RTMA 1N78A 3DMDA 3QFSA 2NVUA 4UBLA 2Q3FA 4PX5A 1HDCA 2ZRDA 2B0JA 5AKJA 1A9RA 4M46A 3U37A 1UWLA 2XZTA 1DJMA 4EKNB 1NONA 3UMGA 3CJTA 4TT3A 4G9GA 4GWGA 4U0JA 3ONWA 4TKLA 2ID8A 1J39A 4D4KA 1E32A 2J6CA 3DLCA 4BE4A 4QYWA 2JA2A 4WA7A 4F1KA 1Y9AA 3JQ8A 4L8GA 1G19A 3NPMA 1KNXA 5IP5A 3VO2A 3ZV7A 1M8FA 1NP6A 2GJ8A 2Z1DA 5LSAA 3AM1A 1P0MA 1CZOA 4BU0A 5KNCH 2XWSA 3EQ9A 1Y7HA 4DZTA 3HUEA 3I2YX 3O3MB 1NBMD 4EKGA 1B7GO 2PTGA 1WUHS 1YJQA 2YZNA 4KR0A 5BMVA 3ZQ6A 4D46A 1Z18A 6GPBA 2VF2A 4RTSA 2XBLA 4WADA 3L6UA 2PBLA 4YRKA 5I3ZA 1T2CA 2E2WA 2I2BA 3ZE9A 4G4JA 4XM1A 5ELXA 4H3VA 3K4QA 1GZ5A 3PLNA 1U0HC 2IYZA 4GS5A 4EYSA 5JI3E 3MWEA 4RU1A 4DW8A 2GAAA 2OHGA 3CVWA 1HZZA 1V8OA 1YUNA 2JFBA 2OSBA 3PFCA 3QV1A 3V8QA 3VU9B 4A5OA 5IX8A 1CHDA 2JGMA 3Q12A 1RWPA 3MXOA 3TIXB 2IH2A 1XDZA 4CJXA 3T3HA 2HWWA 3R77A 1KFEB 4ZTUB 4RF4A 5ALKA 4LDNA 2HV8A 4Q7KA 3F73A 4UE6A 1VB5A 4JGIA 4WJZA 3U56A 1UXHA 1L1EA 1L3IA 2NSLA 3GVXA 3OE7D 4ALMA 3F6PA 2Q7XA 4NNOA 3NDIA 3KQNA 3JRWA 1U0FA 1JKJA 4OQDA 1SOWA 2ZI7A 3ABOB 2ZJ3A 3OEYA 5AKGA 4CG2A 1VLZA 1A50B 3OZIA 4IXTA 1GRQA 3V1KA 1EZZA 1L4KA 2GFQA 1CYDA 2WWRA 3T7TA 4UUBA 2DFPA 1L0BA 3PXUA 5EKXA 3NBAA 4CLOB 1XD9A 4RKRA 3I1JA 1U3TA 5DM2A 1NDUA 3UCFA 1JGTA 3COWA 2FMHA 3KU4A 3ZU3A 5ALGA 1DJPA 9LDBA 4RMGA 2PCJA 3GZNA 4BMOB 4YCJA 4L0DA 1R50A 3FX2A 3B9PA 4KUGA 5JNTA 3NO4A 3LZCA 4FGJA 1GSIA 4DR7B 1GZ7A 1RVV1 4V38A 4ENQA 4G26A 2UZAA 2W5UA 1FQJA 1LV7A 1Q15A 1OT3A 1SMKA 5A06A 1UP4A 3CHYA 4RGBA 5AJHA 1XEXA 1GRVA 1KY4A 1XP8A 2ZBQA 5B3JC 4ZCSA 1C1XB 3NP7A 2CVHA 3E1SA 3JQ9C 1NBME 4MR9A 4K9SA 2AVDA 2QTZA 3D5EA 4RF3A 4BX8A 3T3NA 3AHJA 5TIIA 5AP9A 3AL3A 3SF8A 1WBDA 2X8LA 3UMYA 5A4AA 5IDXA 2P40A 3GJZA 1A2QA 2JA1A 2Q5QA 4MLPA 2ZWPA 1CJVC 4RK1A 3WMWA 2JD2A 1ZGAA 4X6LA 1X86B 2ZRGA 3AP3A 5EQJB 2XVYA 3JPYA 4RULA 3NC0C 4G8JA 5BV7A 3DYIA 2A1TR 3F97A 4DNXA 3V7UA 4G81A 1X7ZA 4J91A 2ZRJA 4UAJA 5HA5A 4CDMA 2QMYA 4BP9A 1KOLA 1MT0A 1WB9A 4Z53A 4HFJA 2NXWA 4OSOA 4GW3A 1P91A 4DARA 3ZJUA 1FNMA 2XZOA 1P1RA 4HSEA 3QOYA 1EX9A 2LZ0A 1Y8QB 3FNRA 1XHFA 5D3MB 1IEXA 1L1QA 3MCVA 5FTMA 4W9MC 2WA2A 2H7YA 1MAWA 2H59A 4EBFA 4UQLA 4KWIA 5DHPA 2R47A 1XDBA 2X13A 2HO4A 3ETJA 4HH4A 3SFZA 3DZFA 4BVEA 4XWYA 4ENPA 3AU8A 4B4VA 3E9EA 1RBZA 3RVKA 2HC9A 5LQAA 2W2NA 4CW7A 1Z8FA 1Z0KA 5TGTA 2Q07A 3AW8A 2J0UA 2A6PA 3NOQA 5MGBA 2FFBA 2D2FA 3ESZA 4G63A 3PICA 3V80A 4FFVA 3EP7B 5BSRA 3UJ3X 4JIMA 5KOYA 5DOZA 2GEKA 5DI9A 4D74A 2JZOA 3CPEA 3LECA 3M9WA 5DYNA 1TW3A 2H00A 4YJDA 1ACLA 1TYAE 1ISSA 2VT2A 5DCUA 1FL9A 4F3YA 3GPDG 4B3SB 2ACVA 1DC4A 5CA0B 3AQ4A 2FSHA 5ALTA 4ZEXA 1ITZA 3BTSA 4WX2B 5A6SA 1DQRA 2P2SA 1TF5A 2BDEA 4OAPA 3TRHA 1BKSB 1DKRA 4JP1A 4EB6A 5LP1A 1DU4A 1WLYA 4F06A 3T3MB 3KB1A 1PZNA 3A6EA 5B6IA 3OEED 1I7NA 2OAP1 2XGSA 3MOIA 3MK31 2XR1A 4JJKA 1I5OA 4PNHA 1F3OA 3ASZA 1UADA 3WLPA 1F38A 4EBBA 4GMDA 4XOIA 4G67A 1QGUA 3F49S 5JWOA 4RLQA 5LA6A 3LYLA 5IASA 1XXHA 1Z12A 1V5FA 5F5XA 1DQSA 2BFPA 2I76A 5AKKA 2VPWA 2PV0A 3QFHA 1V11B 5LDGA 2MCFA 1WCXA 4F2DA 3QMVA 5K3FB 1PK9A 4D8XA 1P77A 4H9GA 3BB3A 4ZEOA 3OZEA 3PNSA 3T95A 1K2WA 3FCOA 1T0PA 3PX7A 1YD7A 4GM1A 1VCMA 1VPWA 2XMBA 1O6GA 3EISA 3JALA 4JLJA 4LA4A 4L0MA 4NCIA 4EHLA 3FPLA 3GZNB 4P2GA 1Q77A 5FWYA 4FYHA 1ODKA 2BP7A 3Q1KA 4UMVA 4P32A 1DO0A 2Z8ZA 1KJ8A 2ICAA 3T54A 1IZYA 4ZC1A 3L7LA 4FFPA 1AMNA 4ZHSA 1A72A 2O8FA 3EOBI 4YK7A 1GZSA 2XODA 1PV2A 2PMBA 4FNMA 1JTVA 4ZOBA 1DJLA 3MFQA 3N87A 5CX1A 2ONJA 1V37A 4W9NA 4GL4A 4LKRA 1ADCA 1TVMA 3MPOA 5JECA 5KWVA 2R86A 1W47A 5MFZA 1V9SA 2A9PA 3V4LA 1XPRA 5EE3A 2Q27A 1J00A 3HBLA 1QV7A 3S44A 4NNJA 4K6OA 5DLDA 4BNFA 4IFIA 3OX3A 4KR6A 1RZRD 2O8EA 1CFJA 3PDWA 1YR9A 2NU6A 3N2LA 4DXDA 1FE8A 1G20E 4D25A 2A9FA 4D9EA 4Y2UA 2NVUB 3LUAA 3G8BA 3MTEA 4Z9XA 3TECE 1THGA 1X92A 3CX6A 1GFWA 3P4YA 1C3VA 4PHCA 5GMOA 5DNYB 1WHTA 2A4MA 2BGGA 1I01A 2IZZA 2J33A 3B1XA 4FHGA 3VVLA 3UWSA 2JI9A 2RCYA 4TZ6A 3DMYA 1Y7LA 2IBMA 3D3EA 3BF8A 2FN4A 1CJTC 2IZ1A 4YJKA 1NXPA 1Y34E 2YXBA 4IYJA 1FFDA 2IHTA 2C3PA 3W77A 4ZT7A 2FZ4A 3PVZA 1QK3A 4XQEA 3CE6A 2YOFA 2XCRB 3W34A 2IHNA 3PR1A 1SBTA 5GV8A 1FYXA 1Z0IA 1Y4AE 1V9LA 3DG9A 1BRTA 1W0JA 3ANLA 3BBLA 2B4QA 4QJIA 3W9YA 2ZQ5A 3ICVA 8OHMA 1MX5A 2PN1A 2J9RA 3URMA 1YF3A 1K2VN 3JQCA 5I9IA 1YNSA 1LVHA 1GLNA 2R8BA 4NYJQ 3VGJA 1XD2A 2VDKB 3A9WA 3AEQA 1UOQA 2EDCA 3BFXA 2EERA 5D87A 4BYMA 3KAQA 4IHJF 4Y6GB 5FCDA 1CQWA 2C7OA 1GZUA 4RBNA 1GLVA 1NRWA 4H3SA 1JU3A 3F5QA 4K87A 3QWBA 2G1JA 1N34B 4BNJA 1LQUA 3KEGA 5AXAA 4OAOA 4MNTA 1BC5A 2O3SA 5B2FA 1Q7TA 4KBGA 4IDDA 2QLJA 5FNVF 1HYGA 1X8LA 3TUJC 3IL2A 5GWXA 4CQMB 1RLIA 2OWEA 2IZ0A 3PXBA 3PC7A 1FVOA 3G17A 5FUQA 2R7MA 3CVJA 4TMFA 1GCOA 1I14A 1U81A 4TUYB 3GVPA 5BRJA 3PGVA 3UG7A 3KEMA 3KYDA 1T8SA 4W5JA 2X19A 3W9BA 3MMSA 1W4BA 1AHHA 5GINE 3X0DA 4PBRA 1JQBA 1IUPA 4YWJA 4MGYR 4ER7A 1OB5A 4OHOA 1IY1A 2O2DA 3IP1A 2C92A 3SQNA 4W8OA 2BGNA 1RRVA 1UZLA 3VR4D 3QPUA 1W0JD 1CZHA 1JG1A 1PYOA 4JLVA 5ERGB 4RY8A 3N7UA 1WKBA 3MT7A 2JAQA 2M9MA 1FVFA 1PGOA 3BKWA 4GD3Q 3BE8A 2B30A 2ZTUA 1EDBA 3EW9A 2WFZA 1KRXA 3ZIDA 3B6MA 3E7FA 1XAJA 3TV1A 4DB2A 3N6VA 1NASA 2I7CA 2NU7B 5E4YA 1W93A 3D31A 4AKSA 1DGQA 1U2TA 2VH1A 1VJDA 2OZKA 5J40A 2IPXA 1AMUA 1Y6JA 3IGFA 1CUXA 2B25A 4KQFA 3TDKA 2IVZA 2H5EA 3L7DA 5IK2A 3THWA 1NIJA 1Y63A 3EVEA 5BMVF 3HJGA 5KX5A 2W6QA 1YRAA 4Q02A 2CDBA 1AQUA 3HB1A 3FWNA 1WXWA 4G4GA 5ARBA 1LV8A 4WBSA 1DAIA 3KE8A 3RKSA 5K99A 2XMGA 2VT7A 2W0MA 1U4NA 3I83A 3PNMA 3VGPA 3WTBA 3X1YA 5ICCA 1C9KA 1MZVA 2GBCA 1VDZA 3AESB 2IDJA 3SSMA 3W6UA 4D9BA 1IVNA 2D1SA 4R7TA 4JVNA 5F4BA 4MVJH 4XUGB 2CSXA 3EIHA 4ZVOA 2QPLA 2ZP1A 5DSTA 1SO8A 3QQPA 3L7OA 3R0XA 3S2GA 2WI8A 5EMLA 2VA9A 3NHLA 5IAGA 4RO0A 2EYUA 4XAQA 3N2KA 1XU9A 2PNFA 5JIBA 1OA0A 5K1ZA 5DJ5A 4ZI3A 3E4CA 1OROA 2AFIB 3C8MA 3GNTA 3Q8WA 3CVYA 2Q41A 1JTEA 4H1UA 2AFHE 4Y67A 3ZWMA 2BD0A 2QEQA 1KVTA 4QBFA 3A1TA 4IZ6A 4JSRA 1YZTA 4BU1A 2CHFA 3RASA 1FFGA 4P54A 3MVEA 1V2HE 2GVZC 4YCSA 1NRJB 4B7AA 3I5UA 4EMUA 3QVUA 3RC8A 1JF8A 4X6UA 3UWKA 1G9TA 2ZDQA 4N7JA 1V8BA 2IF0A 1ESCA 3TMAA 3MINA 4O29A 5EHGA 1UJBA 5E8JA 3RBAA 5I45A 4NECA 4UMDA 4UM5A 5F51A 1EFVA 3G5MA 4WXHA 4DC1A 3NNSA 2HXYA 3WGHA 4ER5A 1ZH2A 3Q9UA 2I8LA 2GWRA 5A0FA 1SU4A 4FOSA 1NWCA 2NUPA 1PS9A 5HWSA 1JP7A 3KQTA 3DT6A 4LTNA 4CLDA 2ZB4A 4OO3A 3A4VA 4RA9A 2IXTA 1M33A 2UAGA 2ZIEA 5JZ9A 3BTVA 3K2BA 3ONVA 5EJ7A 5E6RA 1AOXA 2Q9AA 2EJUA 3G8AA 2VI5A 3QI2A 4L5BA 3CLTD 4N41A 3TZ6A 4JYZA 2CFSA 3I1YA 3BMQB 4EYQA 1CQJA 4TXHA 5KINB 4E70A 1TM4E 2OCPA 2JFYA 1L5KA 2E82A 3TDNA 1KQGA 1Y4UA 3W8DA 2DBYA 3T0IA 1K88A 1FA9A 2IPNA 2PU5A 4Q18A 4DCUA 2PVCA 4NK4A 4M1TA 3MA0A 2NSJA 1SHJA 2QTCA 3OLVA 1DLJA 3CUUA 4MYDA 3GCWA 1BYIA 1VCHA 3AUSA 3CNHA 3KJZA 1N4AA 1QFJA 1J7KA 2EKBA 1NUAA 3H0KA 3NBZC 2IYPA 3GLTA 5CBPB 5AW4A 5H82A 4DRYA 4KO3S 1GAJA 5ALUA 2PVPA 3ZYZA 3CSSA 2QQGA 3S2FA 3TW6A 4YAIA 3RRXA 2XZPA 3LDUA 3PUIA 1W94A 1ZA2A 3ND8A 5J63A 4B1FA 3ROPA 5HNKA 4EITA 4UE3S 3ETHA 4I3GA 4X9XA 1AHNA 2WU4A 3HFSA 1TIBA 1TO1E 1KP2A 4KMOA 5HBGA 1JVSA 2ZYRA 5B1DA 4DQVA 3AF6A 3LC2O 3HY3A 4HN9A 3IIJA 5AKXA 3SS8A 1DKNA 4S1NA 1LVUA 4WA8A 3R0JA 2GOYA 4BP8A 1MQ8B 1M54A 3AF0A 5BO5A 4WUTA 4BV9A 4YT2A 1B8VA 1OFTA 1V6AA 4TQUS 4B35A 1XA3A 2DMRA 1FTQA 3JXEA 4KAXA 4A2CA 1XVLA 3IWBB 4Z49A 5MN5A 3BJRA 4NKRA 4I5GA 2VC2B 2RBGA 4UMEA 1O6FA 1NU6A 1JQ3A 3PI6A 3KOOA 1YRHA 1KH3A 2LD4A 3EEFA 4F96A 5BVHA 4NEHB 4X8HA 3LRXA 4DYVA 2YJTD 5CA1F 3VVBA 3QEAZ 2OILA 2C0CA 1X7XB 2VF8A 2W4QA 3HNOA 3I30X 3QH4A 1YR3A 1PG0A 3K8ZA 2C5EA 3LX5A 3L7AA 1OWPA 3D3WB 1BA2A 2WYOA 4R8LA 2PGOA 5CBPA 1KZ7B 1IB0A 3UXMA 4J0HA 4OKSA 3I01A 4DDKA 5AW8A 4AXBA 4RZUA 3QM1A 3TVDA 5EE5B 3G68A 1ECCA 1EA5A 1W30A 1PW5A 4J0QA 1FCJA 1SXJA 4D80A 1MVLA 1X7GA 4EHIA 4GG1A 4YRGA 5GONF 3SKYA 1GGKA 1UM9A 5JMOA 4MAFA 3P20A 1HLFA 3AT1A 3FLBA 4E08A 4K2AA 3VC1A 2XTAA 2XB6A 2V5AA 3LBNA 4QA9A 1TCVA 2RJ3A 3PHGA 5I9BA 2FEKA 5JCJA 2BM8A 4Q6BA 1QVAA 4MKXA 1A4IA 4F2PA 1R64A 1EXNA 1SKQA 3NEYA 3EP5B 2XCLA 2DR3A 1U3VA 4GE0A 1HT0A 3RRZA 2C20A 4LCBA 2VP9A 3CEAA 4IOLA 3FPGA 4MQ5A 1MH1A 1RPNA 4P3YA 4Z4EA 5B1YA 1KDPA 1R10A 3UPDA 2VRBA 3WJ7A 3G0DA 4NF2A 3WK6A 4X65B 3Q1LA 1RMTA 4V0SA 4DG5A 1DAMA