1EVJA

Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
340
Chain Sequence
RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE-FRUCTOSE OXIDOREDUCTASE
publication title Crystal structure of a truncated mutant of glucose-fructose oxidoreductase shows that an N-terminal arm controls tetramer formation.
pubmed doi rcsb
source organism Zymomonas mobilis
total genus 116
structure length 340
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1evjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evjA01
2HDHA 3DBLB 2X22A 2UDPA 3NGXA 1ULUA 4F6LA 5EMHA 2GR9A 4XJSA 4TVOA 3GY0A 1F0YA 3T7EA 3O8QA 3QV1A 1NNUA 2IZZA 2NU6A 5TJHA 3QW2A 1XSEA 4ZQFA 4E13A 2H5LA 5KVCA 2VYNA 3TZKA 5AYVA 4MVJI 4QFCA 5KNLA 2DFDA 2ZKLA 3JD0A 4ZA2A 2YV2A 4B3IA 4LMPA 2I3GA 3MJ4A 3ZWMA 4CUKA 4GKVA 1DO8A 4NJOA 2J6IA 1K5HA 1J4AA 2AG8A 1BSVA 2ZYAA 1I3LA 2F1KA 3AI3A 1GQQA 2WYWA 4W9NC 1E6EA 4U7WA 1FDUA 4BKPA 3L9WA 2VZ0A 3WWZA 2ZB8A 4J1NA 5CAEA 1E1MA 4NHEA 1MC5A 5AXAA 5JCJA 1N92A 2HU2A 4LRTB 3NDJA 3QA9A 3WDSA 4J0EA 1B2LA 3PWSA 1HE3A 3Q1LA 4GX5A 1ZMOA 1PR3A 2GERA 3UW3A 3ETEA 4BNTA 2ZIZA 4I9NA 1AHHA 3AWDA 2HK9A 3FR8A 2ZQYA 1O8CA 4EJMA 2CDCA 3JD1A 3H4VA 1D1SA 2ZQZA 1E3SA 1GY8A 2D8AA 4RF2A 4HWKA 4B7CA 1GAEO 2AHRA 2AQHA 3CZMA 3HN2A 1Y6JA 1QLHA 2BFOA 1UXGA 2OORA 5F21A 5JC1A 2WSBA 2Y0CA 4W6ZA 4XYMA 1WLYA 1XDWA 3DMYA 2VRBA 3DBRB 4XX0A 4BKUA 2X8LA 3D0OA 4MVJF 5A4DA 2I6TA 1CYDA 2Q2VA 4M8SA 4OKIA 1ID1A 4BO5A 5IZCC 4DRYA 1KVQA 1PS9A 3OJLA 4CPDA 1T2DA 3PI7A 3U9LA 1LBEA 3SC4A 1U5CA 1ADGA 1Z74A 4D46A 3K92A 1E1KA 5ENVA 3B20A 3W4KA 1QXSA 1DIHA 5L4SA 3E9QA 3VH4A 5C7OO 2NWQA 3KEQA 2VCYA 3QRWA 1MUUA 4WJZA 4HBGA 4IIVA 3G49A 1OC2A 3P2YA 2NADA 3GEGA 1GDHA 3LT2A 1HE4A 4FDAA 5DULA 1E1NA 4DTIA 4XRRA 3PJEA 3ZU2A 1LSJA 3OECA 1AHIA 4ND3A 1YONA 1W0CA 4MP8A 4OOEA 3WGHA 3D3WB 2VWGA 4H7PA 1WDKA 3MZ0A 1GEEA 2B37A 3WIDA 3A9WA 1ENYA 3GK3A 5DBFA 4C7KA 4PVCA 2VTEA 4EZBA 2PR2A 3GR6A 1E5QA 1ZFNA 1DJQA 3BMQA 3ZWNA 1YL5A 1PL7A 3ABIA 1U4OA 2Q99A 3AJRA 4FJ2A 4OAQA 5TRTA 4A27A 4YT5A 4Z9FA 1XG5A 3DZHA 4DGSA 3ROKA 4BO3A 4PLWA 1RM5A 2PGJA 2VWHA 2Z1MA 2JCYA 4IS2A 3GG9A 2UYYA 4RCVA 3E6AA 1P31A 3LQFA 4GX1A 1HSOA 3FTPA 4BO4A 1GADO 2PWZA 3P2OA 2C5AA 5JXWA 2Q50A 2PA3A 3QE3A 1JQBA 3MWDB 3CXRA 3DFUA 2WDZA 1I2BA 4GWGA 4Z3DA 2I76A 4WLFA 3NDIA 1VL8A 2C2YA 2DTEA 1YO6A 2TMDA 4XJTA 1MV8A 3JQDA 1UP7A 4LCEA 1HYHA 2BELA 1YDWA 1PGNA 5BNFA 3N74A 1G0OA 2JAPA 1DEHA 4O5OA 2WTBA 4PLCA 1E3EA 4UEKA 4WCFB 4EGFA 2X9VA 1X1EA 2IYOA 4NJMA 5ITVA 3SEFA 1E3WB 3GHHA 3WGIA 3HUDA 4MP6A 2IZ1A 4CQLA 3Q3CA 3KYDA 5HS4A 2Y66A 2VYVA 1TT5B 1ISJA 1MB4A 2O4UX 4W7IA 5DBIA 3RIHA 3VPXA 3ZV6A 4RZIA 3H3FA 4NIMA 1T2EA 2OZPA 3ONEA 4M55A 4D0RA 1XHLA 5JMWA 5A06A 3RC1A 4WECA 5FI3A 1TI7A 2YHUA 5L45A 1OFGA 4XA8A 4M89A 3RKRA 1QORA 5KCZA 3KETA 2YQ4A 3QVTA 3GGPA 4QFDA 4XDYA 1XIVA 2PGDA 2GD1O 1IYZA 3KLMX 1BXKA 1UP4A 3AFNA 2QX7A 1BW9B 3C1AA 1LLQA 1M2WA 4PZEA 3VPGA 4BKOA 3ST7A 3GZ4A 2VRCD 4HP8A 1HDXA 4M87A 3NTQA 1NWHA 1X15A 1TT5A 3IKTA 4MVJD 1PZEA 1E3LA 2HK8A 2R00C 4Q3NA 3M2TA 5JW6A 5CDGA 3AY3A 3WMXA 1DLJA 5JAMA 2FR8A 1QYCA 2H9IA 4R3WA 4C4OA 4E6PA 4FW8A 2IEDA 4R01A 2W2LD 4TROA 2GLXA 1YL7A 4IDCA 3NJ4A 2W2KB 4RL6A 2QW8A 4EITA 3TFOA 4HXYA 3I9OA 5DCYA 2EWMA 2NM0A 3DOJA 3W6UA 1PWXA 3VTFA 2FZEA 4D0SA 3PZBA 4OQYA 1MG0A 3OJOA 2DM6A 5FF9A 2RHCA 1WDMA 3FRJA 4R9SA 2V6MA 2JHGA 1P1FA 1ISIA 5TX7A 5U1PA 3NUGA 4R68A 2ZB3A 4CMJA 2PK3A 1TA4A 2YYYA 2GN9A 4BMSA 3RUFA 2XXJA 5C7IO 1F8GA 1M66A 1UP6A 3DAFA 4ALMA 4PVDA 1E77A 1X7GA 2O7QA 5F1KA 2XXBA 1SBYA 1FF9A 1I10A 1XELA 1EFLA 5FWNA 3LC1O 4FJ0A 2VT3A 3I5MA 3ICPA 1E5LA 2GF2A 4B4UA 3E8XA 3JYPA 3UCXA 3PIIA 5LCXA 1PJBA 2WYUA 2EEZA 4ALLA 3MJEA 4MVJG 3T4EA 3L9XA 4J0FA 3VC7A 4AJIA 4KUGA 1KVRA 3H5RA 4JCOA 3WS7A 3WWYA 4LCJA 4CR7A 3KSZO 4E5KA 4O1MA 3V2GA 4WNIA 3OETA 2AG5A 2O3QA 4LISA 1Z6ZA 2O23A 4RPKA 2D5CA 1R4NB 3CEAA 1H9AA 1CEQA 1H93A 3PZRA 1WWKA 1KVUA 5LDGA 2IYPA 4NU5A 5K6AC 1JU9A 1LRJA 1DIBA 4RO0A 3AOEC 4A7PA 2AE2A 2G82A 4PG7A 1FJHA 4BNKA 1H0KA 2FMUA 5EN4A 1GYRA 2C07A 3JD4A 2A92A 5CPBA 1C0IA 3AI1A 4XWYA 2C20A 3DONA 3JD2A 5H81A 5CEEA 5EESA 1BXZA 2A9FA 2DUWA 3VKUA 4CM8A 1ZEJA 3T4XA 4DPLA 3RC7A 3FSRA 1ZKMA 3INRA 1NPTO 3LC7O 1K6XA 1PQPA 1OAAA 3EGOA 3OEWA 1Y8QB 3BIOA 4J3FA 1NPYA 4IJKA 5U9CA 4QSMA 1KVTA 1XEAA 4RVHA 2WWRA 3WJ7A 3INTA 4RF3A 2NVUB 4Z0HO 3RUDA 5T64A 3MJCA 2P5YA 1ISGA 2B83A 2OUIA 4XZ3A 2YY7A 4MO2A 5T8KC 4JXKA 1T2AA 2DQ4A 2E37A 5T67A 4GMGA 1PGPA 2JJYA 2Y67A 5T57A 1QV6A 5JY6A 2P9CA 5CG2A 1A7KA 3PHHA 2GASA 3TZHA 2H63A 3ZV3A 2JCVA 2Y99A 1MXFA 3TL3A 1GCUA 5B4UA 1NVMB 1DRVA 4FB5A 3R6DA 4UVGA 4XGKA 2NTNA 3WR5A 5A3JA 6ADHA 5TS3A 4E0BA 4XCVA 5KTKA 1GV1A 5CDYA 1IE3A 2TMGA 1YBVA 4ITUA 4M49A 1P1RA 2BFAA 4A26A 3F5SA 2E49A 1HYEA 3AU8A 4DBZA 1QMGA 2O3RA 4ILKA 2GZ2A 3DQPA 3C1TA 4J9UE 1ZJYA 3FPCA 3JQBC 4R1NA 1LJ8A 1NFRA 2VHYA 2O7SA 1GFSA 1DLIA 1JKJA 4CR8A 3BHMA 4R41A 4KZPA 3VDRA 1V35A 3DFZA 4CV0A 1GV0A 1VJ0A 3KO8A 3RI3A 4DQVA 2NQTA 4E2WA 3M1AA 5LDHA 1C0LA 2QYTA 2FR1A 4JBHA 3WX0A 1VJ1A 2DVMA 5CDUA 1D7OA 1Z75A 2BGLA 2OHXA 4M86A 3QWIA 2G17A 1F12A 4CM3A 4JGBA 3GDGA 1GUFA 3MTJA 1HYGA 2FSSA 1YBAA 5TNXA 1PJTA 4HNHA 4BB6A 1ENOA 1HLDA 2QRKA 4R3NA 1H6DA 1I32A 1JLLA 1XQ1A 3OBBA 4KQXA 4RORA 3SXPA 3AUUA 1SC6A 1E6WA 2PH3A 5A9SA 4D43A 3AM5A 1VKNA 5A05A 1Y81A 3MWEB 4PLFA 4YT2A 4CM9D 1GCOA 2ZTVA 2W90A 3GC6A 3RWBA 4J91A 3PIDA 4CR6A 3UF0A 1XR3A 4AFNA 1U28A 1IY8A 3FR7A 4E5NA 2I5PO 1DIGA 3GGGA 5IDXA 4FQ8A 3QWFA 2PZJA 4BGIA 3D64A 1HDZA 4TRMA 1U3WA 2JD0A 1GL3A 2E82A 2PZKA 3WXBA 1E7RA 5EQFA 3UCFA 2EERA 2B36A 4PRKA 2WM3A 3JYQA 1JKIA 4OL9A 3RROA 3HJAA 1U3VA 4U6SA 3E1KA 4P8RA 1RPNA 4QT0A 3RCBA 1EK6A 2OO5A 4UEJA 4EJ0A 2VHWA 3G3EA 4P22A 5B4VA 4DBVO 1B8VA 3CINA 1E6UA 1BDMA 3W4IA 2VHXA 2YDXA 1RKXA 3I9NA 4OSOA 2V65A 4BNZA 3WICA 1ENPA 1BXGB 5AVOA 2O48X 2BRUA 1LC0A 3DR3A 2BD0A 3A14A 3G1UA 5DP1A 5G0UA 1E7YA 1R0SA 4P4LA 3L6DA 2RHRA 1NM5A 1O89A 2B35A 5DOVA 2EF1A 1RM0A 5JYDA 3AUSA 2EIHA 2EKPA 2RH4A 3HFGA 3BMNA 1AN9A 4GLOA 2FPPA 1E7QA 3GF4A 4PLTA 3ZCXA 3A4VA 4DMMA 1UXJA 5T73A 3PRJA 2EGGA 1DFGA 3HHPA 2FOIA 4Z9YA 2GSDA 3BMCB 3LDHA 1HLPA 5G0WA 3R1IA 2P68A 4F3YA 1T1SA 2GDZA 3JD3A 4DIBA 4BVAA 4CMIB 1R4MA 5B1YA 1WDLA 5K6AA 3ZWPA 3GPIA 2ZJ0A 1Y7TA 3D4OA 1YVEI 3I1JA 1M6HA 3EW7A 1MFPA 4F46A 4TVBA 3OJEA 2JD1A 2NNLD 2IODA 1BDBA 3FI9A 5JAQA 2HSDA 4L4RA 4JN6B 4G65A 1YQDA 2HQ1A 4RVUA 4IJVA 3FN4A 3ROPA 3G0OA 4RDIA 4NU6A 3V1UA 1A5ZA 3HNPA 4JJIA 3NAQA 3PGJA 1DC5A 4U0KA 1JWAB 4IQ0A 4IJUA 3JQFC 2DBQA 2XPCA 4DYVA 3HB5X 2PGLA 3DWFA 3OH8A 3KZVA 3E03A 3DHYA 4UVEA 1C1XB 5DNAA 1F14A 3IIEA 1W6UA 3U5TA 1ZUD1 3D1LA 3KOUA 4CLRB 4DUPA 3OICA 2EKLA 2IE0A 3F47A 3PWZA 4O0LA 1CWUA 3RUIA 4AJHA 5L7TA 2D59A 1XKQA 3V5NA 1A4UA 2DTDA 4OXKA 3RUCA 3VPFA 5AQ1A 4WOKA 3H2ZA 2IXAA 3BMOB 4G5HA 5JDCA 4HUJA 1VC2A 1K6JA 1K3TA 4NH4A 2HMVA 3LLSA 5TSDA 3EYWA 3DTYA 5IN5A 2VHVA 5J9GA 3GT0A 2NTJA 4Y8VA 1R66A 2WMDA 3AY6A 2CVQA 3Q2IA 1KEPA 2I67A 4CLRA 1SEPA 4ALIA 3S55A 3WBFA 3OJFA 2JFFA 3JQBA 3ZGYA 2VUTA 5L51A 3X2FA 2BFMA 3DZIA 4WASA 3JQGB 3JQCA 1V0JA 4K1LA 4KUEA 4HADA 3GZNA 3I23A 1T26A 4BO6A 2I66A 5I8WA 1SEVA 1HWYA 1ZK3A 1DC6A 3NEPX 4OGWA 4YDRA 4NFSA 2C0CA 3DDNA 2NSDA 4PCVA 3SJ7A 3PLRA 5COQA 4CMKA 3OIFA 2B0JA 3QLJA 1JAXA 4GQAA 3SX2A 4E4YA 1E3IA 4GVLA 2G1UA 3UVEA 1BHSA 1KC1A 2Q4BA 2UUOA 5EINA 4PLVA 4KQWA 4DL9A 2EJWA 2JFGA 3ULKA 5COBA 4WPGA 2GO1A 1HDCA 1EEHA 1N7GA 4FGSA 4MIOA 1QYDA 4RLHA 3H3JA 4J7CA 4PIVA 5ENDA 4XYBA 2BH9A 2X0IA 3JQEA 4CMGA 3TN7A 4IQ8A 4N54A 3H9GA 4JIGA 1IOLA 2PD4A 1QG6A 3DTTA 4FJ1A 3OA0A 4OH1A 4U0JA 2W4QA 4JJGA 3WGGA 1ZSNA 1GR0A 3HDYA 3HB4X 4NDNE 2D0IA 3GNSA 5KJFA 2NTVA 2GN4A 3Q2KA 5HTOA 1PS8A 4WCFC 3WNVA 4UAGA 5G0SA 1WW8A 4TRJA 5JMPA 3E5RA 2IXBA 5HS6A 4D41A 3PLNA 1YB4A 4E30A 2C59A 2C54A 4XQGA 4E31A 4F45A 2GRAA 2B4RO 4CM4B 3SJUA 2D2IA 2QRJA 4MKZA 5ILOA 3F4BA 3P5SA 3DBLA 2NV6A 4YWJA 1HF3A 4E5PA 3ZV4A 4E5MA 1DAOA 4JX8A 1I2CA 4I5FA 5LC1A 4DIFA 3GEMA 4XR9A 1F17A 5ICSA 2FN7A 3MTGA 2IRWA 2EW8A 3C8MA 4AICA 4HY3A 2ZYDA 1EZ4A 1L7EA 1TLTA 1NAHA 2J8ZA 4MVJM 4J1QA 3PHIA 4RVGA 1R16A 4Q3CA 2WEKA 4P38A 3X2EA 2WD8A 4WLEA 1V6AA 5KJCA 1PZFA 6LDHA 4L76A 1B26A 4OXYA 3NJ8A 9LDTA 5U4QA 3BTVA 1D8AA 1O94A 3ETGA 2VZ8A 3NKLA 2J5KA 4ROSA 4BL5A 4XRGA 4FFPA 1YB5A 5M6DA 2IDZA 1R0KA 3IC5A 3C7CB 3VOSA 4S1VA 3WYEA 3Q0EA 3JV7A 4L0QA 3HDHA 4QO8A 4IDGA 2HLPA 3C1OA 1PJQA 4M1QA 4BNYA 5JYFA 2PZLA 1Z82A 4IBOA 4W99A 2RBEA 5L3ZA 1X0VA 4MPDA 4CUJA 2HJSA 3DAGA 3BTSA 1Y1PA 3DZBA 1KIFA 1MX3A 1J5PA 3EUWA 3CSDA 5KOIA 3HADA 3HDQA 3NTOA 3FNEA 4OO3A 3GGOA 4YPOA 5I7FA 4FOOA 3LT1A 4BIIA 4I9UA 5G4KB 4GBJA 4BGUA 2B4QA 2P91A 4J7UA 3KVOA 4W82A 3UOGA 1HDYA 3WOHA 5BNIA 3EVTA 1LXCA 5H82A 4DA9A 4R5MA 2VRCA 3GUCA 1U4SA 3DBRA 2PKQO 2CD9A 4PLHA 3D4PA 4WKGA 4UVDA 1I3MA 4MVJA 3WGQA 1R6DA 2X7HA 5EIOA 1C1DB 4ONEA 1G6KA 5GMOA 1A9ZA 3KSDO 3LLVA 4BV8A 5JDIA 1P1HA 4GPD1 5F1OA 2Q2QA 4GSLA 2Y1OA 4GL4A 1WXDA 2OL4A 3JQ8B 4YJFB 4AJLA 3K73O 4CV2A 4EUFA 2PKRA 1ISMA 3LSYA 4ZICA 4RPGA 5IG2A 3HE3A 3OHSX 1HT0A 3GNTA 1AGNA 4UUNA 2W2LA 1ZBQA 4ZVVA 4B8ZA 3NX4A 4DYDA 1P1JA 4WLVA 1RWBA 4FOSA 3RFVA 3ANMA 1GEGA 3M6IA 1T4DA 4UVHA 1T2CA 1L1FA 4GLLA 1KOLA 5A03A 4PN3A 4KTVE 4TRRA 1Q0LA 4O6VA 5CEFA 4IJWA 3UXYA 3DHNA 3F9IA 5EPOA 1K89A 3F5QA 1P0FA 1LA2A 5IFLA 3PQDA 3D3WA 4XGIA 3VVCA 4A73A 4E2YA 1UXHA 1EVIA 3PHGA 1PEDA 4Y6SA 4CMAA 4J90A 2WD7B 2XF8A 1D4FA 3H8VA 4YJHB 2GZ1A 1I8TA 4ZU3A 3GVHA 1Z7BA 1IHXA 3PYMA 4XQCA 2VWQA 3WFJA 3S1LA 4EYEA 4DREA 4XEHA 5IXYA 2WE7A 1CERA 3I9KA 3ZWWA 3QQPA 4QQRA 1J49A 1ISHA 3PHJA 3WNQA 4TZTA 1Q1NA 4D7AA 1KC3A 3EZLA 1EVJA 1P3DA 4U6QA 3JQ6A 1HXHA 3WJAA 4YB8A 4JP2A 4DPKA 5BSHA 4GAEA 5L4NA 1I36A 1JA9A 1LDBA 1E7MA 4ND2A 3TZQA 4R5HA 2HKIA 5DF1A 5IJZA 3L4BC 4Z0TA 3R0IA 3BHIA 5MGBA 1U2DA 4D3SA 4YT4A 1WPQA 4BNXA 2ZTMA 4RPJA 3TOZA 1CDOA 2JL1A 5G0TA 1N8KA 2Q4EA 5ER9A 4WCFA 1OBFO 3RQSA 5A9TA 8ADHA 4FGWA 1E3WA 1UAGA 4J6FA 2VN8A 4ZQEA 4NNJA 4CM5A 5F5LA 2VQ3A 5KJEA 1WMAA 2Y05A 4G2NA 1I5RA 3Q6IA 4Y6RA 1PGOA 4K26A 3VZSA 3U49A 1B8PA 5I8ZA 1MC4A 1LI4A 3WB9A 1RYEA 3U4CA 4H3VA 4WLNA 1KEWA 1DC4A 2PFGA 4OJNA 4D42A 2QZ9A 1NQOA 1XGKA 3F1KA 4JQCA 1B3RA 5JAIA 1Y5RA 2CMDA 3MCVA 4W9NA 5A02A 3FNHA 4YXFA 2HMSA 4XYEA 1B0AA 1ZW1A 4E32A 3EAGA 2RIRA 1BW9A 5BR7A 3H5AA 4O63O 1WZIA 3MJSA 1Y5MA 4I8XA 4PG4A 1S6YA 2A4KA 1V3TA 4KTTE 3RAJA 3D5QA 1CIVA 2X0JA 3FF4A 3KTDA 3OIGA 1C14A 3C85A 4FC7A 1W4ZA 1KYQA 4NFYA 1CJCA 4MINA 1ONOA 1NASA 2O50A 1U3UA 3AI2A 3K96A 4LSWA 3KBOA 4BO2A 1TXGA 2P9EA 2AA3A 4PZCA 1YOVB 5CDTA 4N7RA 3DZKA 2CFCA 3ROQA 3NT5A 2W2KA 2FRDA 1LRLA 3LC2O 1MGOA 2Q1UA 4GVXA 5I9MA 3CH6A 4OXNA 4TSKA 1DHRA 2ZTUA 1GYQA 2PZMA 1UZLA 3I4CA 3U0BA 3PWKA 2X5OA 2GYYA 1T1RA 4ALJA 2FWMX 2CVZA 1VJTA 5IZCA 4BB5A 2PH5A 2DT5A 4LK3A 5CHEA 4YVFA 4B7XA 3KM0A 1ARZA 1NHWA 4GSKA 4PG8A 4D44A 5JLAA 1Q7CA 3IJRA 3AW9A 2WJPA 4A0SA 4L74A 4DC0A 4R69A 4XYGA 4E5YA 1PS0A 3ZDFA 3BTUA 2VNSA 3DZGA 4YAKA 1IULA 3OEYA 3WBBA 3DOCA 2V6GA 1PZHA 3UKOA 2E4AA 4LW8A 1DRWA 4N5NA 5J23A 3S2IA 2EXXA 2W98A 2JFHA 4J7XA 2O3SA 1QYWA 1RM4A 2D3TA 4UUMA 4CM9A 1PQUA 3GAFA 5EL0A 5G0VA 5K9ZA 3QVXA 3PQEA 4RVFA 3EZYA 4XB1A 4BO7A 3ONDA 3GG2A 3U3XA 2QYSA 3DHEA 3IDSA 3E48A 3NGLA 1R4NA 4Z3KA 4ALKA 1LQTA 3KRTA 2AEMA 3RU7A 5L53A 1OMOA 5BQFA 3UN1A 3QJ5A 3E5MA 1AE1A 3W8DA 3PPIA 1ZMTA 1HDRA 4DLBA 2C29D 4BMNA 4WK6A 1VM6A 4IS3A 5G4LA 3RSHA 4NBUA 5TT1A 1L7DA 3V2HA 4L8VA 3ZW8A 4YAGA 2DUUA 3BYZA 1GUZA 2HAEA 4WE3A 2VHZA 1B15A 4BQPA 1F8FA 2X5KO 1NR1A 3LU1A 3WTBA 1NXQA 1EQUA 5I7EA 3ZZNA 3OFSA 4ZGWA 1GZ6A 1BRMA 4GH5A 5IF3A 3F1LA 1Y8QA 3I9JA 5FFFA 1YL6A 3E9NA 5KIAA 2YV3A 1KY5A 1HRDA 2GN6A 4PG5A 1TVEA 1ZO8A 2X9NA 3INGA 3FNGA 2EV9A 2NVUA 9LDBA 4RJTA 3B70A 1JN0A 3F6YA 1PJCA 2Y0EA 4Y98A 3CPSA 4H15A 1YB1A 3TSCA 4FBGA 3VHRA 2P2SA 1FDWA 4IPTA 1C0KA 4BO9A 2YW9A 2P4QA 2CY0A 4LRSB 4O59O 3FPLA 3PDJA 4YQZA 5AXBA 4OIMA 1PJ2A 1JTVA 4YACA 4HKTA 3WGOA 1P1IA 2YV1A 3I9LA 4HFMA 4NQZA 3TNLA 5IDWA 1PTJA 1Z7EA 3PYLA 2PLAA 1I3NA 4J2HA 1I33A 4YJGB 4CLOB 3ZWVA 5ADHA 3DMTC 2C5EA 5A5EA 1V3UA 2PTGA 2VOJA 4FFOA 1H94A 1GZ4A 3ITDA 4KDEA 3T7CA 3EY4A 2ZCVA 4A2CA 3FTNA 4BNIA 3E82A 3GPDG 2VTDA 4YAEA 1UJMA 4CMCA 2AQ8A 4K9DA 1BG6A 4WUVA 4YAJA 3VH1A 2R00A 4R1UA 5ILGA 1H6BA 4BHTA 4IGEA 5B4TA 3U62A 5BSGA 1PL6A 2Z1NA 3WGZA 1B8UA 3JQAB 1MFZA 1DBVO 3OQ6A 4IDDA 4YYZA 2RAFA 3ADPA 5JY1A 1XYGA 3A28A 4TZKA 5KJ6A 1LLUA 3WLEA 3TFQA 4B3JA 2YHIB 4Q3EA 5CPFA 4Z6KA 3AUAA 4RVSA 3MJTA 4J4HA 3DO5A 3PTZA 3L77A 3GFBA 5I9NA 3PFWO 4DQUA 4EW6A 4J9VA 2P4HX 4B79A 4IM7A 2F00A 1UZMA 3CE6A 4Q3AA 4URFA 1ZK2A 5DDIP 1DXYA 5T5QA 2Y1GA 3JQAA 2VOEA 4ND5A 3ZU4A 1J0XO 1BVUA 4HNGA 4GMFA 1DFHA 1Q0HA 3F3SA 1GZ3A 3KSUA 5IAAA 1ADCA 1QP8A 3RJ9A 3DXFA 2DBZA 2GCGA 1WAMA 1BMDA 3ZWOA 3GQVA 8LDHA 5DCUA 1KEUA 1YDEA 1LDMA 2Y1FA 3TOXA 3U09A 3IS3A 3LZ6A 2G5CA 4WGGA 3K9QO 3H9QA 1O6ZA 1G1AA 4IXTA 4UUPA 5AXCA 2R6JA 1HETA 1YKFA 2BLLA 1Z73A 3GVXA 4B7UA 1PWZA 3OQ1A 3OIDA 4ZQGA 4YBZA 2QIOA 3DL2A 3EMKA 1NVTA 1BXGA 3SC6A 3TF5A 4EDFA 4IQGA 1U8FO 1LLCA 1NP3A 3U4DA 2DBVO 3HSKA 2NLOA 1NVGA 3AOEA 3TJRA 3ORFA 7ADHA 1H2BA 2P5UA 1HSZA 1FDTA 3IAHA 4CL8A 2NU7A 3PXXA 2X4GA 5TC4A 2X9GA 5I7VA 1MG5A 3GA0A 3OJ0A 2BHLA 3DBVO 2FY8A 1SOWA 1K6IA 1Y9EA 3NYWA 4R54A 3QVSA 1EK5A 4OOFA 3JYOA 1I30A 4PLZA 4ZQBA 1WP4A 3BMCA 4IUYA 4DXHA 3N7UA 5C3MA 5IDQA 3GRKA 4NBTA 4Y6PA 1B7GO 4KOAA 3VZRA 1FDSA 5JC8A 1UH5A 4CMIA 1T25A 2B5VA 2GPTA 4KDFA 3EVNA 4R1TA 3VAZA 4E33A 4JBGA 4IIUA 1XWFA 4PRLA 1Q0QA 4KWIA 4NI5A 3NV9A 1NAIA 2Q46A 2J3JA 3CZRA 2V6FA 3FBGA 4J16A 1KETA 4CV3A 1LNQA 5T8KA 1HE2A 2OMEA 1G0NA 2O3JA 3VDQA 1EVYA 1DIRA 4MVJE 3ZH2A 3RU9A 4CJXA 2NVWA 4QECA 3S8MA 2WE8A 3COSA 4XB2A 4N18A 1PJLA 2B69A 3IP3A 3BTOA 1E92A 3UCEA 5ICMA 2X0RA 1BGVA 3BHJA 3VZPA 2CSUA 3U4HA 1YJ8A 3DZJA 1T2FA 1PU2A 2VUSA 2J5QA 1NQ5A 1GQYA 3ZU5A 5AOVA 1U3TA 1K2WA 3RUAA 2EKQA 4XIJA 3HZZA 1SMKA 3GVPA 1C1XA 3JQAD 2VUUA 4BQRA 3E9MA 2YUTA 2DTXA 4XDZA 3RKUA 4D79A 1CETA 2NUAA 2ZB7A 4FFRA 3RUHA 3CTMA 3MOGA 3I6IA 4U8GA 3ICCA 2AQKA 2C82A 3H2SA 3ZHXA 1T24A 3WQRA 3VZQA 3BMOA 4KWHA 2OP0A 3LF1A 5KVSA 3DMTA 5TLSA 4AL4A 3ASUA 4MJLA 2YJZA 4JNKA 4AJNA 1NYTA 2JD2A 3UFXA 5K0ZA 4Z0PA 1XCBA 3ANNA 4ND1A 3RUEA 3TL2A 1Y8RB 3ADOA 4JBIA 3OF2A 1GQ2A 2FPGA 1H5QA 3QWAA 1ONPA 1HE5A 1IB6A 2OBYA 4QEDA 4AJEA 1XLTA 4E3ZA 1O0SA 4PZDA 2AE1A 3WMWA 1GPJA 4K6FA 4I9HA 3ZW9A 3IMFA 2HUNA 3CKYA 3ZWCA 4CLEA 3DBHB 3JQGA 2Y0DA 1NX6A 1C0PA 4YT8A 2V6BA 1XU9A 1U5AA 4YTEA 2DFVA 4INAA 3VPHA 4CQMB 1LTHR 3WQSB 1DHTA 4CLHA 3V2UA 1D3AA 5CFZA 1IZ9A 1XQ6A 3RJ5A 4CLXA 2NU8A 1ONNA 2A35A 4CMBA 4IXWA 2ET6A 3CUKA 1LX6A 3PHLA 5HM8A 3O8QB 4WCDA 4UULA 3RC9A 3TRIA 2X1HA 3G1TA 1NQAO 4TKLA 3L0DA 3ZV5A 5A5FA 5C7LO 4IMRA 1SCUA 3DEYX 1PL8A 4QXMA 1EFKA 2BF7A 2CNBA 3B1FA 3O03A 4A5OA 1AXGA 5TT0A 1YE3A 1M75A 4BGEA 4WEOA 3BZUA 4II3A 4FFNA 3N58A 4U5QA 3H65A 1DFIA 1QV7A 3C24A 4D3DA 1ZXLA 2YFQA 4L4SA 2FSVA 2FR0A 1KBZA 4AG3A 3FCOA 2NACA 2YDYA 1U2GA 1YJQA 1RJWA 3G79A 4UUOA 1KS9A 4R51A 2B4TO 3ZNNA 4EBFA 4BMVA 2BFPA 3ZN2A 1PSDA 3W1VA 1RM3A 3JQ9C 2BI8A 4IMPA 4HV4A 3VKVA 3IQDB 1I0ZA 4X54A 4LN1A 3GOHA 3PGXA 3PJGA 4UVIA 1P44A 3IP1A 4A10A 4OM8A 4WLUA 3RBZA 4CM4A 2D5AA 4G81A 3GDOA 5TJ9A 5DT9A 4AJ4A 1I01A 5DZSA 1Q7BA 4RQUA 4C7JA 3WLFA 1C3VA 2EHDA 5CG1A 4MIYA 4AJJA 3AOGA 4GGPA 4PFJA 5B12A 1TT7A 3ZWBA 2QZZA 3BA1A 4GX2A 1EBUA 4FR5A 3IL2A 2Q1TA 4FN4A 4RVDA 1LUAA 1SAYA 3L6EA 3R3JA 5THKA 1ZEMA 3NDRA 5L7YA 4BO8A 3DZFA 2Y1CA 1RYDA 2QRLA 4K28A 3JQFA 4W7HA 4BOYA 1UUFA 5DBGA 1QLJA 1JVBA 3IKVA 4K6CA 2LDXA 3QVOA 3EDMA 2LDBA 1E7WA 1ADBA 4OQZA 4GKBA 2OFPA 5MDHA 5JPIA 3NRCA 5H83A 1A9YA 4BUCA 3ZHZA 1DPGA 2ILTA 5JBIA 2OP1A 3RD5A 3QWBA 3WYBA 5TGDA 3GUYA 4CLDA 1IHYA 1Q2XA 2E48A 2NQ8A 3LT0A 4J43A 2HK7A 5L4LA 5BNTA 3K6JA 4UREA 5IZ4A 2B5WA 1HDOA 1X7DA 1F06A 1ZK0A 5AXDA 3TPCA 4R4JA 4EUEA 3HG7A 1P74A 1O95A 1NFFA 1BWSA 5THQA 3GN2A 1ZVMA 2A94A 3C3XA 4CMEC 1X0XA 1VE9A 3ETDA 3BMQB 1LSUA 2BGMA 3S2FA 2JHFA 2Q45A 5KVQA 1Z45A 2PY6A 2H6EA 1SPXA 3G17A 3LK7A 3AU9A 4ALNA 2EJVA 5G4KA 1NR7A 4CQMD 1DSSG 2Q1WA 2GZ3A 2UUPA 4I5DA 3S2EA 4FPXA 1QKIA 3VPSA 4BNLA 2Y93A 2OOSA 4II2A 1A7AA 4GGOA 4CM6A 4LMRA 4P4GA 1PGQA 1QYVA 1HEUA 1C1DA 2VYND 4CM1A 1QYXA 1LC3A 3CMMA 3JQ8A 4YJFA 2J3HA 5FYDA 5HRUA 1NTOA 1S7CA 1W8DA 3D7LA 2X86A 4WNCA 1SO8A 3AK4A 3KYCB 2OXIA 2P9GA 2ZTLA 3NT4A 1JW9B 4ZJUA 3VH2A 4YR9A 3NT2A 5I9LA 5EJ2A 2DPHA 5FI5A 2IEBA 4B3HA 4N5LA 2BKAA 4NJMB 1T4BA 4A03A 3GAZA 3V8BA 3LF2A 4KP7A 3KEOA 2O4CA 2DKNA 2HCTA 5JCJD 2UV8A 2ZATA 1A27A 4CQLB 2QG4A 2DAPA 3KYDB 1X13A 5A9RA 3QY9A 1I2ZA 2YZ7A 3UGKA 4J49A 1J6UA 2WD7A 3K31A 2E6UX 2X0NA 2Y1DA 1P45A 3CIFA 3BXXA 4YJHA 3KYCA 4ND4A 1KEVA 3WQQA 2I3AA 3DAPA 3WFIA 1CF2O 5IXSA 3O38A 1NFQA 2ZB4A 1LU9A 2I65A 5JS6A 3IUPA 2AEJA 3WG9A 2SCUA 4FFLA 3ENNA 4WOJA 4FCCA 4BNGA 4HFNA 4I1IA 1UZNA 4I5EA 4UEOA 2CF6A 4TRNA 2XOXA 1JVSA 5C5IA 2D4AA 1U8XX 1YQGA 4BNNA 2O2YA 4TQGA 2X23A 4FC6A 4ZQHA 4YRDA 2CDAA 1ZH8A 3QWHA 1MA0A 3FWNA 4NZ9A 3B1KA 3GRPA 4KMSA 4J4BA 1Q7GA 4NBVA 2FHSA 3GNQA 3W6ZA 5A1TA 5BSEA 1N7HA 2Y68A 5CEJA 4CODB 1W73A 1N5DA 2HJRA 1XA0A 4DPMA 3KV3O 4RF5A 1PR9A 4JP3A 4Y9DA 5TQVA 3V1YA 2H1SA 3JQ9A 5HWSA 1I24A 5DP2A 4RPLA 5KJ1A 4HFRA 3WGYA 4MP3A 1EDOA 2CUKA 2JKVA 3KUXA 1VI2A 1VL0A 1UAYA 4Y67A 1ISFA 3H9JA 3RFTA 5JNLA 4L73A 2X58A 4QTZA 1TEHA 4D45A 2J5RA 3JCZA 5GZ6A 1UXKA 2QQ5A 3RVDA 1U1IA 1JAYA 4MDHA 3AY7A 3GN1A 4AJOA 4XD2A 2J3KA 2I9PA 1OZAA 5L9AA 1NQTA 4DVJA 1PGJA 1PJ4A 3H9UA 3WGTA 3TDKA 2PD6A 1DC3A 1LEHA 4Q3DA 1OOEA 4BS9A 1LLDA 1ENZA 2YFHA 2ZYGA 4J4TA 2HMTA 1EUZA 4QUKA 5ES3A 5JCXA 1NHGA 1M6WA 3F46A 4MKXA 4TWRA 1NPDA 3UAGA 3KHUA 2GNAA 3ZWAA 2POQX 3C7AA 5F5NA 2Y1EA 1JWBB 1WZEA 3RBVA 1N9GB 4NPCA 1MXHA 2X5JO 1YOVA 3ZI0A 1EQ2A 1X14A 4NMHA 1HTBA 1SB9A 5DCWA 5BT9A 1AUPA 3TQHA 2JAHA 3GEDA 4BNHA 1LDNA 5DN9A 3A1NA 3ZNPA 3W4JA 3VTZA 2Q1SA 5CP8A 5C37A 5JO0A 3Q11A 4LSMA 3MOIA 3B6ZA 4CM7A 5ER6A 2AEFA 4CM8B 3P7MA 1WNTA 1GPDG 3H6KA 3R3SA 1X7HA 2GGSA 1P77A 2W8ZA 4WEQA 2VYVD 1PQWA 3UICA 3E18A 1E3JA 4B4VA 1DRUA 1D1TA 4CMEA 1GYPA 3PK0A 3P19A 1N9GA 2DPGA 4EJ6A 3LYLA 2WYVA 1WVGA 1DOHA 5F3RA 4BNMA 3ZWXA 4IINA 4W4TA 2G76A 2BI7A 1KY4A 1WMBA 1M76A 1UR5A 5A3VA 3UH1A 1ZXBA 4ESOA 1DB3A 4XYLA 3O9ZA 4FIZA 5L40A 1P0CA 3A06A 3HQ4O 1E7SA 3O26A 1ZSVA 2R2GA 3OSUA 2Q3EA 3K30A 3Q9NA 2EP5A 1NWCA 1QR6A 1EDZA 1YH3A 1UDBA 3TWOA 4ID9A 1OI7A 3Q9UA 4JJFA 1LDEA 1YRLA 3HN7A 3LVFO 3I9MA 4RPHA 3V1TC 3OQBA 3SLKA 2DLDA 3MJVA 3WTCA 4AJKA 3PJDA 4GWKA 3GMDA 2OBNA 3H5NA 4LVUA 1I3KA 2C7GA 2FP4A 2RCYA 3GLQA 4BNFA 5JAZA 4OMUA 3U4IA 4FFMA 4XKJA 2Q49A 5JDCC 1PZGA 1LDGA 4FS3A 2Q22A 4BO0A 3ROMA 3PJFA 3L4SO 2Z95A 1DDOA 1N1GA 3ANLA 1CRWG 1EMDA 1ULSA 3K2BA 3L4BA 4IGFA 4MIEA 4EEXA 3RASA 4YCAA 5BSFA 3CMCO 1B16A 3DC2A 4IDEA 5DOZA 4YEDA 4EEZA 4ZHSA 3H7AA 2CVOA 4E2XA 7MDHA 1PJSA 1QSGA 3VVBA 1HKUA 4MVJP 5A9SB 2OGUA 4P4NA 3L07A 3JTMA 2DC1A 5GZ3A 4CQMA 4DLLA 3I3OA 5JFOA 4OKNA 5GZ1A 1MP0A 1TB4A 2O2SA 1YGYA 4CUZA 5JYAA 1FDVA 1LDYA 2HRZA 3HDJA 3EC7A 4PLGA 5JO9A 1E1LA 4AJ2A 3KLPX 4DQXA 4CLOA 2HO5A 1FK8A 1X1TA 4YJGA 4DWVA 1GTMA 4HX5A 1P1KA 1EUDA 4IZIA 3BAZA 1DAPA 3GFGA 4RLSA 3O4RA 3FWZA 2HRBA 2ZCUA 4IDFA 2EP7A 4TMFA 5COAA 1MLDA 3KXDA 4NFHA 3QSGA 1B3BA 3K8ZA 4DIOA 2QHXA 1EE2A 1PIWA 2V7PA 3S2GA 3ZU3A 1H6AA 3H9EO 1V9LA 2JCXA 3M2PA 3RBXA 4BNUA 3IUSA 4LGVA 3IJPA 4NG5A 3GVCA 1U7TA 1A72A 3PDUA 5I7SA 3NTRA 2VNAA 1ZK1A 5IDYA 4DMLA 4JLWA 2RH8A 4HFJA 4E21A 1EUCA 3STHA 2YHIA 3ITKA 2IZ0A 4BKQA 1IUKA 3BMNB 4YAIA 1VSVA 1U7HA 5B37A 5L95A 5EERA 3K2EA 1YS4A 4EI2A 4L75A 1LSSA 1O5IA 1UDCA 2GN8A 3QVWA 4FD3A 3ZHBA 3WYCA 1N2SA 4RDHA 4EUHA 1SB8A 1ML3A 1SNYA 2XAAA 4OHUA 1YBMA 4E12A 1R4MB 4PG6A 1ZK4A 3GHYA 1AXEA 3ZNOA 1FMCA 5JE8A 1GUYA 3ON5A 1A4IA 3PFFA 1EBFA 2J3IA 4J1SA 4Q3BA 1Y9AA 4N5MA 1HL3A 3D5TA 5T6BA 1H9BA 3PEFA 3AFMA 4FSHA 4ZN6A 2HMUA 3GVIA 1DIAA 1HDGO 3I4FA 3QHAA 2HMWA 4L9RA 1LSOA 4L4XA 3WSVA 5CDSA 5TF4A 3ONFA 5FEUA 5IN4A 1K0UA 4ZD6A 2FZWA 1O9BA 3K5PA 4RZHA 2G0TA 4YRAA 3IOYA 2CZCA 4J2OA 4TKMA 4I08A 3QIVA 4OSPA 1A71A 1PX0A 1E0DA 4NBRA 1IZ0A 1KERA 3GH3A 3GMSA 4LVCA 3WSWA 4D3FA 2VT2A 3I6QA 2C7VA 3OMLA 3W8FA 4E2ZA 4AVYA 3KB6A 3ENKA 4RQTA 2DU8A 4XR4A 4BNVA 1UXIA 1P9LA 5KVVA 5KKAA 1IL0A 1ZCJA 2AW5A 5HBRA 5ITWA 3SLGA 1R15A 4XIYA 4YRBA 5TIIA 3C7DB 4IDAA 5F1PA 4QX6A 2UAGA 4CL3A 3FBTA 1H6CA 3DOOA 4YA6A 4B4OA 4J1TA 1GD1O 3UHAA 5EQDA 1BTOA 4ZRNA 1V8BA 4JK3A 3AM3A 5GY7A 1R12A 2EG9A 1EE9A 4H16A 3L6OO 3HWRA 1KVSA 3EHEA 3ZHYA 3GDFA 1CQJA 4XGNA 2DBRA 1QRRA 1VRWA 1CQIA 2NVBA 4GX0A 3AUTA 2O3TA 5A04A 1ORRA 1R37A 1YQXA 2UVDA 2C2XA 4NR0A 4XQ9A 3ZNQA 3UUWA 4DLAA 3SBOA 2FPIA 5KKCA 3VH3A 4DC1A 3D4NA 3B1JA 1V3VA 1ZZEA 3TZCA 3RC2A 1PJ3A 3I52A 2ZK7A 4NK5A 2EGHA 1VLLA 2NU9A 4M54A 4PGFA 5JSFA 4XQEA 3M1LA 3PYXA 1UDAA 2ZJ1A 5JDIC 3QP9A 4AJPA 1LQUA 4JROA 1P33A 4RGBA 1HZJA 3PVZA 1GU7A 3SVTA 3GZNB 5G2OA 4PLYA 4PLPA 4BNJA 3F4LA 3I83A 1U9JA 2AMFA 1VKOA 3OA2A 1B14A 1IPFA 2EW2A 3JQ7B 5L7WA 4MOWA 4Z9XA 2I99A 2VWPA 3JSAA 3TZ6A 2AXQA 1LRKA 4RF4A 4GI2A 1FXSA 1M67A 4IDBA 2D1YA 3DB2A 4CV1A 4OYRA 4F6CA 1SOVA 1ZSYA 1VL6A 4BV9A 1JDJA 4R16A 1IPEA 2BGKA 3PP8A 4I5GA 4Q9NA 2Z5LA 1ADFA 3OM9A 2CF5A 1YXMA 4BO1A 3ASVA 2BMAA 1SZJG 1VSUA 4BGVA 1ZIDA 1ZJZA 3KYBA 2PD3A 4NBWA 4BNWA 4YJDA 3ZWYA 3JQ7A 3D3EA 3HFSA 2PV7A 3FHLA 1JKFA 1VPDA 1H2HA 3JYLA 2PNFA 4Q39A 4AJ1A 4MVJH 3RFXA 1BVRA 4IY1A 4ZRMA 1N1EA 3JYNA 4R1SA 2GUGA 4MKRA 2CDBA 1XU7A 1HZZA 2Q2WA 4YQYA 3WIEA 1Y8RA 3OP4A 3FD8A 5HA5A 2PKQP 3FNFA 4RV9A 4B8WA 2X6TA 4NK4A 4WLOA 4BKRA 2AQIA 4S3MA 4IZHA 2VZ9A 3PQFA 4B4WA 1EVZA 2YQ5A 1NBOA 1R0LA 4KUHA 1DJNA 3DBHA 4R9RA 3MEQA 3W8EA 4CMHA 3LT4A 3AM4A 4QO7A 2O3UA 1YWGO 1OC4A 3EK2A 1ZNQO 5KWEA 5JYEA
chains in the Genus database with same CATH superfamily
5KB3A 3PXAA 2AYXA 1FU7A 3LBIA 1MB9A 2ZRQA 3NGXA 1J09A 3ROFA 3S7ZA 1QIDA 2XNHA 4RTQA 2AFRA 2GR9A 4XJSA 2GZSA 4TVOA 3GY0A 2HQSA 1IBRA 1CZLA 1NYLA 2IZZA 2DHEA 3KZCA 1KI9A 3O8QA 1IHDA 1OKKD 5TJHA 1R10A 1OXSC 5KVCA 3ER9A 1PK7A 1UPUA 5CT9A 4RDCA 5AYVA 4BBJA 2QM7A 1WY7A 2HL6A 2ZKLA 3NM5A 5CB4A 3A7DA 2NXCA 3HCCA 3JD0A 1QQTA 5CYFA 5IWCA 3U4QA 3ZDDA 4L5BA 4B3IA 3OZEA 4G36A 2QI9C 4JY7A 3GFPA 1K5HA 5C4GB 1V4NA 3I76A 1W9MA 1KJYA 2ZT8A 2OZKA 2LZ0A 5H70A 2OGZA 5DGIA 5LNK6 5LIRA 4QGAA 4H6VA 4C0QC 4G4SP 2C9BA 3FI0A 5G1PA 1DX9A 2WYWA 1XMXA 3DKPA 1SK9A 4Q18A 4U7WA 1FDUA 1R8YA 1TQ6A 4J1NA 1ZJJA 1N3LA 2ZIWB 4C4RA 1RE1A 5AXAA 5JCJA 4DMKA 3QA9A 4M98A 1J25A 3WRXA 1NJFA 2XMQA 3KE9A 1TVKA 2FJPA 1F1BA 3M34A 1HE3A 2IPLA 2WUWE 2YR0A 2NO1A 3G0CA 5ADUS 2IEZA 2HBZA 1XALA 3ZVMA 3UW3A 3ETEA 4NAVA 4CKZA 1OU4A 4G1UC 1AHHA 2EWVA 4HNQA 5HF6A 5JAOA 3SDBA 2YWXA 1TLFA 4EA7A 3JD1A 3LHDA 2B1GA 1RC0A 3U16A 2OESA 2ZQZA 5BR4A 1YDHA 1E3SA 1GY8A 3N2NA 4B7CA 2AHRA 3F6EX 1Y6JA 4M9XA 1QLHA 4IP0A 4LC1A 4XUEA 5F21A 4EPVA 1UK9A 5JC1A 2RAVA 5LXTF 3FZNA 5LXTB 3RSCA 3A6EA 2CVFA 3OURA 3SDZA 4XYMA 5TMDA 2WJ3A 1O03A 1XKTA 2VRBA 2WUEA 2PRJA 2GBFA 2JGKA 4MVJF 1DQNA 1Y4UA 3B6MA 4L9WA 4NMMA 4B33A 2Q2VA 4OX9B 2RD2A 4AQYB 4GDFA 2GCOB 1UL1X 4M8SA 5A62A 5IZCC 3ZKWA 2IHBA 2P0AA 3ZXUB 4BO5A 2J08A 1D8TA 4D3ZA 3WLQA 3ENWA 4EPYA 1YVUA 4J2TA 5KYKA 3BT7A 3LS2A 1E1RD 1X7YA 3K2QA 3LX5A 4M38A 2CL5A 5ENVA 2WF7A 3QHQA 5ECWA 4EB8A 5J5AA 5KVVA 5KBYA 1JG1A 2YZKA 1FRFS 2HA6A 1TTQB 4OATA 1FJXA 2VQSA 3C48A 4GMDA 4OFWA 1MUUA 1M0EA 3AWIA 3D0RA 2C9YA 1OC2A 3P2YA 1EAMA 4WFJA 4BN0A 5B3JA 3V9PA 3EPKA 2W8BB 3LT2A 5DULA 3IP6A 1XLWA 2XECA 3BL6A 3ZU2A 4FT2A 4TPKA 4ZAWA 1TJNA 1UOOA 2VUIB 3NI2A 3WP1B 4D6YA 2Q7DA 4YH1A 3KB8A 3WGHA 4BQIA 3D3WB 1WDKA 3D6MA 1T8TA 4Q00A 2B82A 2WVGA 1FLVA 4RESA 3BRCA 4DCVA 3AEXA 1L3IA 3EIXA 5DMXA 1VCHA 5K51A 1M8KA 3HBLA 1XZAA 4U7PB 4RYLA 3SEZA 2PR2A 5DPMA 2IU3A 3BMQA 1W4RA 2WU0A 5EQJB 3SR3A 3STTA 1JHPA 3OPMA 1XZCA 4CCYA 3ZS9A 1W96A 2A78A 5TRTA 5JSHA 3FOZA 1XG5A 5F23A 1GR1A 3T3HA 1YULA 3S6JA 3HZOA 2IV3A 2VBCA 1ZINA 4PLWA 1LBQA 1NE2A 2VQDA 2Z1MA 1AK9A 2OA0A 4AN0A 4DEYA 5IH3A 2UYYA 4RCVA 3E6AA 1QX4A 5L53A 3LQFA 4TX1A 1J9GA 1A98A 4X61A 4AUNA 3DLTA 2IH2A 2VIIA 4F85A 3QVJA 3Q3IA 2B5OA 2PWZA 1WQ3A 1T6XA 2JARA 2Q50A 5T4FA 1EX7A 2AS0A 1DKRA 1L4KA 2GTHA 3QE3A 4I4NA 4MWSA 4PC7A 4TWAA 3VISA 5JARA 4PN3A 4RTNA 2H7VA 3T34A 2X0DA 1QK3A 5CDFA 1KF0A 4GWGA 3S40A 2I76A 5E2IA 1QRAA 2EARA 2Q7OE 1TZBA 2VSOA 2YYSA 1TJ5A 16PKA 1PYDA 2DTEA 2HEIA 2ZJ7A 1FMLA 2TMDA 3E9ZA 4KGDA 4ZVNA 5FOQA 4Z8YA 2VDVE 3JQDA 2MSEB 3HM9A 1YRWA 3PGMA 1YDWA 4NZZA 5U4XA 4JC5A 1AM4D 1DEHA 1QIHA 4WZAB 1E3EA 1F4PA 4HDKA 1X1EA 2IYOA 4G3XA 1KFEB 1JLHA 2HPAA 2OK7A 3B1WA 4LBZA 4NJMA 2Y1WA 4JOCA 2L2QA 1O3YA 2BM9A 1UT5A 3BXZA 3QYFA 1DDGA 3IIJA 1T9GR 5HS4A 4W1QA 4UPEA 4CNQA 3RIHA 3VPXA 1BC5A 4ZPJA 4RZIA 4RY2A 2A6PA 3HY6A 1GPUA 4PZ9A 1T2EA 3RNOA 4C43A 1F2VA 1EVEA 1U04A 2IFTA 2JK0A 2XCUA 4NABA 5ELMA 5ESRA 5FPSA 3WYGA 5AVXA 5H4GA 3PC4A 5FI3A 1GZUA 1X7ZB 2V0CA 1L5SA 3KQKA 1OFGA 1QOQB 1X94A 2QMZA 4XA8A 4A6PA 1E99A 5JWRA 3CVXA 1KJ8A 2ZIUB 4LWOA 1Z62A 2V98A 3ETJA 2PXCA 1ESCA 2P6RA 2PGDA 1K8ZB 1CB7A 1DKOA 4OUDB 3GJ3A 3PFKA 2QX7A 4Q4DA 3SZMA 3OP1A 5IX8A 4M76B 5HW0A 1GG9A 2VRCD 4NMLA 3VMMA 3ABSB 5A71A 4TN1A 1VB5A 2HK8A 4Q3NA 3IAAA 3AF0A 4BP1A 3GBSA 4FYHA 2Q5IA 1QGYA 3QK7A 1DLJA 1FRNA 4BV2A 5F7OA 1OXXK 2HCBA 2JFQA 3O8CA 1QYCA 2XLBA 4BDTA 1J2TA 3TS1A 2C2OA 3MWFA 3SY8A 4DKJA 1WCXA 3Q87B 3I2GA 4R01A 2ERYA 2W2LD 2P4SA 3FGOA 4TROA 5HG0A 4Z1OA 3TOVA 2VTVA 1IVNA 4HQ0A 3C7TA 2MINB 4UQLA 2Z5GA 2ZIFA 1BYIA 3BD6A 4HXYA 5DCYA 4YV1A 2GK6A 3IODA 1MDBA 1RXUA 5FIUA 2O2HA 3A3OA 3PZBA 3IVGA 1BDIA 4RA6B 3EARA 4LDJA 2YYZA 1ZCFA 2JIDA 1SCDA 1VSTA 5FF9A 1EIWA 1WDMA 1NVKA 2IT1A 3FX2A 1ZLXA 2OECA 2V6MA 1ISIA 3HUUA 3II6X 2P6UA 3QMWA 4MW2A 4NCJA 4TTPA 2AUMA 2Q5HA 4X7MA 5JCZA 2B1QA 2IY7A 4JU8A 2ESRA 3WO1A 3NHPA 1I7PA 2AFHE 3LUFA 3NAZA 4NYMR 4WY2A 4IHJF 2ZE8A 4IHJB 5LUAA 1V6SA 3E22A 3QVMA 4JBYA 4TMZA 2HHAA 2O7QA 5EHNA 3V1NA 1YDFA 2PBRA 1PCXA 2QQFA 4G9EA 1XELA 5HZKA 5KPDA 2OCYC 1R3UA 3HJBA 4B6FA 3ZCPA 3CZAA 3UB4A 4YX9A 2F9LA 2ADOA 3ADKA 1E5LA 4FVTA 1QG0A 3EXG2 4AF7A 1GAWA 3E8XA 3FMIA 3JYPA 1TO6A 3AR8A 4BWVA 1KO4A 3PIIA 4YO8A 2O7VA 3IPAA 2WYUA 4Z54A 4QDZA 1A9XA 2M1XA 1J23A 5DI9A 1M72A 2CCJA 2WIKA 4TOIA 1ZWLA 2HCFA 3BWEA 1TCBA 1J39A 3C5WP 4GM1A 2KSQA 4KUGA 3WS7A 2P90A 4JCOA 3HC7A 3HYRA 4JA0A 4LCJA 5DCLA 2GBPA 1FFXB 5ALEA 1OI3A 4KBFA 3V2GA 5JS8A 1SQGA 5CIYA 3C3JA 4GOKA 4LISA 3KJEA 1M1NB 3CEAA 3MM4A 1W2WB 1H9AA 4YP1A 1H93A 3SR4A 1GGEA 1SD5A 2H2DA 3M5CA 1XZLA 5BWCA 4NU5A 1HNXB 1E61A 3FZQA 1JU9A 2BGTA 4QELA 3AOEC 3Q7TA 4C7MA 1NJ8A 4JJEA 4UPDA 3GYBA 2J6BA 5JBQA 1GYRA 1P1CA 5ICCA 2VJDA 3JD4A 2IWHA 3WRYA 1X39A 2HN9A 1C0IA 1S9HA 3GLFE 3GP3A 3DONA 1QMIA 3PTLA 1G2OA 4LPSA 1SJ9A 3X1DA 3JRXA 3Q5DA 5F64A 1SKBA 1CY8A 4AS3A 4AZ3A 4C14A 4D0LB 4OB8A 4PZUA 3GWZA 3BIJA 3DV2A 3T4XA 4B32A 3RC7A 2ZJ4A 2IGBA 3PPWA 4Y2QA 5D3KA 2H1HA 2VYFA 4OYYA 1L1QA 4Q12A 1ZKMA 4D9MA 3CG0A 2N42A 1K6XA 2PAAA 4A4DA 3KZMA 1QG4A 2JHPA 4FWBA 2KQUA 4KQ9A 1YKSA 2FJ0A 4J3FA 2XUAA 3I37X 4E5SA 4HOYA 4CLEA 3COYA 3KQOA 5CLJA 1S8FA 1E5TA 2A5FA 2IOFK 4PE5B 4ZCMA 4Y18A 3INTA 4RGVA 4XI9A 4N76A 2NVUB 1U63A 3BE5A 2C04A 1JEOA 3LL4A 2P5YA 5KMGA 2XCLA 3Q0IA 2B83A 2YZ2A 4J07A 5FBLB 1ZA1A 4JXKA 3KLOA 4OI4A 3EG9A 3HKEB 2E37A 3RIYA 4H7FA 3W5AA 3C8UA 1PGPA 1OH5A 5M04A 3LO8A 4PONA 4HPXB 5JY6A 2QYOA 2QF7A 3G2JA 5AK3A 1A7KA 1QV9A 3EDYA 3K5WA 3TZHA 1RJGA 3TL3A 1D0VA 1GCUA 2VP6A 1JSZA 2YQZA 3OKFA 4BQSA 1V1RB 2VF4X 3HB1A 4LEIA 1Y3BE 1DRVA 2PFSA 4FB5A 1K7SN 2QTHA 4MQLA 4UVGA 4EJ2A 4BPBA 1HC7A 2GHIA 5A3JA 6ADHA 2DCUA 3I5AA 5IM4A 3IBYA 2XE7A 4BQFA 4E0BA 2Z9CA 4XCVA 3HKBA 2P30A 3LY5A 1JFVA 3LPAA 4C7VA 5CDYA 1GAJA 1IE3A 3FLEA 4ACAA 2X2EA 4M49A 1E4YA 5DXAA 2CFTA 4IYRA 4JJKA 1BX1A 2CCKA 3PE3A 4X1YA 1QH8B 2ZFUA 3SOPA 4AKTA 1PEAA 1ZJYA 3FPCA 4PANA 2HZBA 4FEYA 1L4EA 1CNMA 2AN9A 3LW7A 1T3SA 4EA8A 2WJIA 1GFSA 3LGSA 1KU0A 1RLJA 4JAVC 1EA5A 4QZVA 3ZVNA 2ID9A 4S24A 1CUAA 2OV6A 5CVTA 4WKOA 1PVVA 2CHUA 2IKQA 3G6WA 5B7NA 2VYCA 3QELB 4BVBA 3KO8A 4MWTA 3M1AA 5E7MA 2OV4A 1RPTA 1R8SA 3KZXA 3WX0A 2EFGA 1OHHD 5CT6A 5CDUA 4P3KA 4TSFA 1D7OA 4GRIA 5FDFA 4CM3A 3B82A 3OMWA 2G17A 1F12A 2NO7A 4V02A 4UCFA 4Q1DA 2YN2A 3ECSA 3GDGA 4RQAA 1YBAA 2NAFA 1J7JA 1Z4LA 2WKQA 2HDWA 4OA8A 3TLKA 2VNIA 3T4UA 1QRUA 4HNHA 4A5SA 4BB6A 3MJFA 1DBWA 3LVRE 4QA9A 1XQ1A 1I32A 1JLLA 4RORA 4AAYA 4ZKDA 4X60A 5AKHA 3AUUA 4XM1A 1E6WA 5FO1A 5A9SA 4P83A 5BQOA 4D43A 4YT2A 1Y81A 4YP7A 3ZV7A 1FMFA 4CLQA 4O2RA 5DSZA 3QLEA 5LZ7A 1E1CA 3RAFC 1ZLYA 2CHGA 1V8OA 2L42A 4CN9A 1PUIA 1QKKA 3I53A 2ZE5A 1N8TA 1XFDA 1SBIA 2VYQA 1OBCA 3ND9A 4U7JA 2IITA 3UF0A 3FR7A 2HJHA 4DIMA 5B30A 3THWB 2I5PO 3EPAB 1DIGA 1E9EA 3DFKA 2VKQA 5IDXA 4FQ8A 4G1VA 2C31A 1PNTA 2PLWA 4LHZA 4IX1A 4Y3UA 1CQPA 4N0MA 4BGIA 2RGRA 2XTNA 1T36B 1U3WA 1WKBA 2JD0A 1II8A 4P92A 5F2EA 4L8WB 4PCUA 5KQSA 1AKNA 5EQFA 2EERA 3ER8A 3DF7A 4RV5A 4ASUD 1JKIA 3FH0A 4CTKA 1E6CA 3JWEA 1U98A 4W9MC 1U3VA 3I2FA 3VDMA 1LQ2A 1TTTA 1QU2A 1RPNA 4P8RA 1GKLA 2I0FA 4QT0A 1JFFA 1E4OA 1OSNA 1EM8A 4UHKA 4B3XA 3CLSD 2CFRA 4BMXA 2BEVB 2DKFA 5B4VA 2FEAA 2BFEB 4WKPA 3A26A 2A5LA 1B8VA 1TO1E 4KGVA 1BDMA 3CW9A 2VHXA 3GOQA 1VBMA 2BJWA 2V7VA 4OB6A 3TSZA 4LBWA 4UHFA 3X2SA 1J5XA 1RKXA 1LVGA 4NYIQ 1R7RA 2PT6A 4AG6A 4V24A 4BVHA 1R6TA 4EVIA 3PLAE 2O48X 5CJJA 3DR3A 1IVYA 4PSCA 3H2JA 1TK3A 1P19A 1S3IA 1YDMA 1R0SA 3L0OA 4MWCA 1VOTA 5G0UA 3EGXB 3L6DA 3USZA 1XPRA 5JYDA 2R2AA 3C3AA 4F4FA 2X7XA 1JSCA 5F51A 5FWYB 3AUSA 3TMYA 4JUIA 2EKPA 4A8HA 4GLOA 4QU8A 2NU7B 2QL5A 1YCHA 1BMFA 1E7QA 2YJ5A 3Q4GA 3GF4A 1EJ6A 1KI6A 1YRHA 2AN4A 5A7GA 3UM9A 4XUDA 3S2ZA 1SURA 3P94A 4Q21A 3T0GA 2HO4A 1Z2NX 3EXFB 4JVMA 3QG1A 3OE1A 1P60A 5JJCA 1JZSA 3T5GA 3BMCB 4D80A 4RFSB 5L3QB 5IJ0B 3JWGA 3B3GA 2GKGA 5G0WA 4AMVA 2B8NA 5FCDA 2P68A 1RYMA 4YS6A 1V26A 2CNWD 3T5DA 3BKXA 4N12A 4R6WA 1RAGA 3UT0A 1Z37A 3GPIA 3T54A 1GO2A 2CFOA 1Y7TA 1KO7A 1O94C 5TPZD 2WSLA 4ARAA 1PW5A 2P65A 2RK4A 3G5MA 1Z7WA 4F46A 4ENSA 4BZPA 1T2UA 2P8JA 1KEEA 1C5KA 4KMRA 4CGZA 3PFIA 2HMYB 4RXMA 5JAQA 3MRTA 2OHVA 4Q1AA 2GYUA 4U7DA 1JQLB 1NQUA 1GFZA 3A04A 3L46A 2PGXA 4X1OA 1EDBA 4DV4B 2AOTB 4KNWA 2AFVA 4Y2SA 2BW0A 2FZLA 1I6LA 2JFPA 1DKPA 2PZGA 3R41A 1RWQA 1O0BA 1JWAB 4IQ0A 2I1LA 2UZ1A 4REQB 3SIPA 2UZ0A 1YR8A 2J7PD 4NCIA 1NLUA 3RFUA 5LQUA 1EXVA 3FOWA 1YI8A 2XPCA 1FXUA 2DRIA 3TMAA 3KUDA 2D2XA 1JG4A 5EVJA 3TLJA 4BFCA 2HHHB 2PGLA 1VPWA 2H31A 4PC2A 4X91A 4YHBA 3DHYA 2R7MA 1N7IA 3N9IA 1C1XB 3P9NA 4RBNA 1WXQA 2AOUA 1L7XA 4IIXA 1W6UA 2F7SA 4HX9A 1N4DA 3D1LA 4GE3A 4ENWA 4CLRB 4DUPA 4G0OA 5G3YA 5BQPA 4DKXA 1GGJA 4JB0A 2PL9A 1Q3KA 4DCNA 1Z29A 3LQ4A 2OLKA 1E89A 4GQIA 4W1SA 3CNHA 3CNEA 4E4TA 3FNQA 2C99A 3FSJX 4G5QA 5HZGA 4J0JA 1CBUA 1T8SA 4YCJA 4G26A 4HZIA 3RFFA 3THRA 1A4UA 3RUCA 3ZXSA 4MYHA 3AVVA 1X74A 4NX2A 1C7ZA 2QD3A 8AT1A 1Y1RA 2RHOA 4F8JA 1I7MB 1H2WA 2I4IA 2F3PA 1Y9ZA 2FCAA 1K3TA 4N3AA 4Y1GA 2ZETA 3VSAA 3DV9A 4HH4A 3G9UA 4N3NA 4UTVA 4Z7OB 4J75A 1O8BA 4LI0A 4E94A 2VHVA 5J9GA 2FMKA 3CT6A 4DF3A 1W88B 1VE5A 1XXLA 3AY6A 2CVQA 3Q2IA 1V96A 2WM8A 1OTHA 1J0CA 2GK4A 1YHYA 1V1MB 3LHIA 2AN3A 1SEPA 3O2JA 1JJAA 3O4VA 1QGDA 2GQ0A 4KIFA 4KQ2A 3S55A 4BQEA 1LWNA 3N0VA 4LXTA 2FOXA 4JC4A 3B3JA 3CZ9A 3EZGA 3GJZA 4CDGA 1JE1A 1GGFA 1EX6A 2FMHA 1NV9A 2XI4A 1Q3TA 3RAGA 3ZH9B 3DZIA 3I2KA 1GTRA 2ASVA 3DGFC 4R2XA 2HLNA 4R81A 1FUKA 2JCGA 3JQCA 2C3MA 3MLBA 3PENA 3HTXA 3RYFB 3QMMA 4RA9B 1NP7A 4CDNA 3I23A 3JWHA 1ZVJA 1N6RA 1RJDA 2PA0A 3KTFA 4MW1A 4BO6A 1ULHA 5KINB 2HA0A 5CNJA 1DC6A 3PVCA 1C4OA 4PX5A 4X62B 2C0CA 4QQ8A 3MUFA 1SUIA 1GN8A 2NSDA 1ZHOA 1A9QA 4GQAA 2XW6A 5EXTA 4E4YA 4QOIA 5CA1F 1E3IA 5CA1B 1JLMA 1FLDA 2DULA 2VL7A 4GVLA 5KDOA 2LCIA 1KC1A 2UUOA 1HY3A 4Q66C 5EINA 2WI8A 3B6JA 4GP7A 2JFGA 3RG8A 3ULKA 1SUFA 5COBA 4J03A 4WPGA 2CV0A 2GO1A 2EQ5A 3EIFA 2FN3A 3NKVA 4NATA 1QYDA 1XZDA 3P0IA 3K35A 3SKYA 1XMOB 3TQCA 3H3JA 2ZSEA 1QK4A 3LDFA 2R6CA 1U0OC 3IQEA 1LW7A 2B0CA 1JR3A 1C2YA 1SZCA 2GEVA 3F5MA 4YP0A 4CMGA 3VX4A 4ZEVA 5BYKA 4IQ8A 1G9XA 5DM4A 4JIGA 3VR4H 3DT9A 2FEMA 2A86A 2PBFA 1AY0A 1T2NA 3OQVA 4HB4A 5ALPA 1Z6YA 5IBPA 1GR0A 2ZKIA 4OQPA 2VPYA 2O5EA 1YRYE 5HJ2A 2J41A 3HCBA 5KJFA 1FP4B 2F8TA 1KZ4A 1QMPA 3Q2KA 3DULA 4TXHA 2WRZA 1PS8A 5REQA 1PJRA 1LS6A 4MUJA 2AKYA 3QOFA 3WAKA 3JPWA 6ABPA 2O8DB 3ZGOA 5AVTA 1OV4A 2VCHA 4V39A 1AGPA 3N0WA 3E5RA 1Q74A 2FQWA 3UKDA 3PLNA 3M7IA 2ZSDA 1U7OA 1DXQA 4XQGA 1RYYA 2C59A 2C54A 2EJTA 2H7XA 1IJBA 2O52A 2V7QD 4FYIA 3NWJA 4WMLA 3V8PA 2HYIC 3ANXA 4IUBS 4YMUA 5M29A 4H77A 4N0DA 1EXDA 2VK2A 3BJIC 1BWPA 4L5YA 2ZI6A 3SJUA 3LX4A 4PIPA 4F3RA 1BJRE 4MW4A 4MKZA 3TPFA 3KDPA 5ILOA 3WDLA 4ERNA 4KN8A 3P5SA 3M4NA 4M21A 3RW9A 4YWJA 3TUJC 2GBCA 2H2AA 3CF4A 5A0FA 4E5PA 3FPGA 3ZV4A 4JR1A 5JBNA 4MDEA 1V47A 4I5FA 4AP6A 5CXQA 3GEMA 2P1DA 3BS4A 1JX6A 2GOYA 5ECDA 3FNIA 3F2VA 3MTGA 3QFSA 2I4LA 3C43A 3K9BA 4MXDA 4PM4A 4ANFA 2XD9A 4HY3A 1L7EA 5KOHB 2J8ZA 1ZMXA 3VOTA 5CT5A 4TQUS 3UV7A 3PHIA 3LECA 3U61B 3FDZB 4D9EA 3U7EB 4A36A 2HBYA 2HX1A 4P38A 2E3JA 1JG6A 1BE1A 4NPHA 1BMTA 2OFXA 2P9TA 3BWCA 3OT4A 3PE4A 1AKMA 2H2FA 2RMKA 1NU8A 1PZFA 3DXYA 4AP9A 1IXRC 5CHYA 1RPZA 5E0KB 1YJXA 4OXYA 3G0DA 4FMDB 1JJVA 1O94A 1XD2B 3LWDA 4FMDF 4BDSA 1NNI1 4UKDA 5AIAA 2P69A 4HGNA 1YNOA 4QULA 4EF6A 2OLEA 5CVUA 4BL5A 1PYOA 3E7PA 3WLLA 5DNUA 1N2ZA 4UNQA 1R5NA 2P67A 4QLOA 4HYQA 4UE3S 1G5RA 3Q1KA 4WFQA 2I8CA 4FMPA 1XJWA 4L0QA 1KH3A 1QGOA 1HDEA 1T1GA 2F8LA 2GN2A 5DM0A 1PJQA 1T9KA 5JYFA 2PZLA 2A30A 2J0QA 1RQ7A 3I8SA 1OLOA 2H00A 2V54A 4XD7A 4PN7A 1KE1A 3WKBA 1F9EA 1FEZA 4CUJA 2HJSA 4IIEA 2A5DA 5AJXA 5IT4A 1CRZA 3F7MA 3LWZA 3SBDA 3P96A 6NULA 3V1LA 1HFEL 2GM4A 3SS7X 2BUCA 2PN1A 3CSDA 4OYLA 3QPCA 4L51A 2WT4A 2J45A 1W49A 4FEAA 2J9YB 2IYXA 4D0NA 4YPOA 4P5DA 3LT1A 4BIIA 4I9UA 5TMEA 1P9RA 2C8JA 4B3MB 4K9PA 4BGUA 3HVRA 1CQXA 2B4QA 5CLHA 1YIDA 5LXTA 1CIJA 1HDYA 2EFEB 1YDGA 4MV8A 5F35A 5H82A 5KTSA 4R5MA 1QUFA 1GSHA 2CCGA 3A7EA 3GUCA 1C3EA 2PKQO 2DWOA 1ZGBA 4MVJA 5EIOA 1C1DB 3C2QA 1SXJB 2GCOA 3KSDO 4BMPB 4BV8A 1P1HA 2JH3A 1B41A 2IE8A 3NHUA 3NHBA 1WXDA 4BUJA 5JNUA 3EP5B 4K6GA 3UV3A 4YMHA 2WAYA 1GUDA 1IBSA 1TKAA 1WSWA 3AYXB 3FLMA 4MUYA 2LP4Y 1YI1A 4QNRA 4RYDA 5MN6A 2BYTA 3SE7A 2ODAA 3IB6A 2BM0A 3D59A 1E5DA 3TSWA 2EAUA 4ZVVA 4B8ZA 5LLTA 5EYPB 5TQJA 4YK7A 1P1JA 3RM3A 2FG5A 2QMHA 2WINI 4DQKA 2C3PA 3FUTA 3STYA 4DJDC 1T4DA 4FKMA 2J85A 2P75A 2QV0A 1N7JA 1L5KA 5M7EA 1L1FA 2W8BA 2C2KA 4GLLA 3H4IA 2V7WA 3VU9B 4X8MA 5CEFA 3AIKA 4ILEA 4QEKA 3FUCA 4RLQA 1NR5A 2I8AA 2QA5A 1K89A 1K8RA 1P0FA 3VR6A 3C41J 3QITA 1F0KA 3KQVA 1CJBA 3D3WA 5HILA 4XGIA 1KQFA 1N6NA 1SVLA 4RKRA 3I9V6 1EVIA 2OHIA 1PEDA 1X1SA 3W34A 3BSWA 4YRTA 1X70A 1P4GA 4HQLA 4GLJA 5IJXA 1PHPA 3GVHA 4KRXA 1ZD2P 2QSUA 5AESA 4OK6A 4CW7A 3WFJA 2OCXA 2KBEA 5YASA 4OB7A 3S1LA 4EYEA 1C9MA 2NUPB 3VAAA 4OJMX 1XPUA 1REQB 4XEUA 3WLKX 1M1UA 3B36A 4UDXX 3ZWWA 1E9DA 4G4SO 1K66A 2HK6A 4KVGA 1EAYA 1VPLA 3OJWA 1J49A 1YQQA 1ISHA 1CF9A 2H4HA 3ESDA 3LDAA 3WNQA 2ZWAA 4OHYA 2QZPA 2VDMB 1Z5NA 1WEKA 5B7GA 3EZLA 3L84A 2I3BA 4LY6A 1PSWA 4LF4B 3STXA 3V33A 1IBKB 4O25A 4LF5B 2D0PB 5BV2P 4MROA 2ZUEA 4UNNA 4M1MA 1HXHA 2B25A 2ZRDA 4PPQA 4BN5A 1PR1A 3ZG6A 1W4CA 3T3NA 5CVDA 4U9HS 3P0EA 1M83A 3TBFA 1HTTA 2WTXA 1JA9A 1HEIA 1LDBA 2VH2A 5JIBA 3B60A 2N1MA 3IE0A 2QJRA 4C5AA 1N6LA 4I6EA 5HJ7A 2FW7A 1KQNA 4OBEA 4LS3A 4QQNA 4BVLA 4P7GA 1XF1A 5MGBA 3K4PA 3KVNA 3LSTA 4WDRA 5F2OA 1F0PA 5AHRA 1OFTA 3N07A 3R23A 3OZBA 2O7NA 3FSGA 2JL1A 4N3CA 4G0WA 4ZYZA 1Y1LA 4TTQA 3UHPA 3UJHA 4WZAA 3ZD6A 3RQSA 3DPSA 3DA8A 1K98A 3NUQA 4HEA6 5A9TA 2CLKB 3LYAA 4TXLA 1KRHA 4UBKA 4C2TA 1WXHA 5DYNA 1XKXA 3KKKA 4OP3A 4KH0A 4JLUA 5DLDA 4E09A 2XB9A 2QLNA 2RG1A 2Y05A 1XD8A 2QR2A 2YRWA 2V3CC 1U8CB 3K0CC 3UXHA 1PGOA 1NBWB 3K0KA 1HNWB 2I4OA 5JJ5A 2MSDB 1EUYA 3KQMA 2MIIA 1LI4A 4UJ5A 5I8ZA 5JPDA 5LYJF 2RGDA 5HEKA 1Z5WA 1E8MA 2PH7A 4HDMB 2PFGA 1O95D 1X7ZA 2XA1A 4I4IA 4OJNA 4D42A 4DB2A 4B71A 1P4SA 1XZNA 1WPGA 1DU4A 3KQQA 1M8JA 2QVGA 5LQCA 2CGEA 3KAQA 2H29A 1TAUA 1Y5RA 2ZRJA 4W9NA 4ETIA 5A02A 1DJPA 3FNHA 2R97A 4G0QA 4YUXA 3TB4A 1K7EB 1RVDA 2VTBB 2EP8A 3L1UA 4OUDA 4XYEA 1B0AA 4KHPB 1ZW1A 1E2GA 3O8OB 3EAGA 4KXLA 4E32A 1ESMA 5BR7A 3KQUA 1G7RA 1PX2A 4O63O 5IUKC 1Y5MA 3H5OA 5DFAA 4FBLA 2CL0X 1WA5A 1HR0B 4KTTE 3RAJA 2WFZA 3M0EA 4C7BA 4P4UA 3U6BA 3CZPA 3KTDA 2F1JA 3AVUA 1LCIA 2J9GA 1RKBA 3ERCA 1JR6A 3FHOA 3RRZA 1CVLA 5HE8A 1FP7A 3SZRA 5K2MA 3ENZA 4MINA 3QYPA 1G66A 2O50A 2KS6A 1NX9A 1TLLA 3K96A 3M49A 1O9HA 3OLWA 4FWTA 5ED0A 4IOKA 5HQTA 4FKBA 3L7IA 4PZCA 5DTJA 4OHPA 1KK1A 3JZMA 2Z58A 3MJRA 2BCJQ 3F0TA 3I73A 4E3WA 3K2IA 3ROQA 4UMDA 4BRSA 1Q83A 3H8JA 3QVLA 5BOSB 1LRLA 1ICIA 1ECCA 4GVXA 5CH3A 3V8EA 4D8UA 3C16C 3E4CA 3U3JA 5JS7A 3QBVA 1UZLA 1Y42X 3PWKA 2X5OA 4RA6A 3G0BA 2I2WA 2OWEA 4GWLA 2DFKB 3MCAA 3FOFC 2M6SA 4D9FA 4YJ2F 4YJ2B 5CHEA 4BEBA 3KM0A 1ARZA 1WXFA 1GNTA 1XN1A 1FPQA 1NHWA 3MJHA 4IKOA 4V0MA 1KWGA 4G0UA 4BRUA 1ZD8A 1SIOA 3BM5A 2CXPA 2BI4A 4FWIB 4IHJA 2GA9A 4L74A 1P8AA 2NT4A 4D5EA 3WYFA 1PS0A 4E5YA 3ZDFA 2QUZA 2F2TA 1V45E 1IULA 2FFJA 3OEYA 4UD6A 3CVUA 4IVNA 3URMA 3FPBA 3I0NA 3CZ4A 3VOBA 4N5NA 1PFQA 4UTRA 1Z0JA 2NZ2A 2R6AA 5DN6A 1K3FA 4JT8A 2RE8A 2JKZA 4YASA 2XADA 3E61A 1FFAA 3GRFA 4OXXA 3SHQA 5CLGA 3FYUC 4B0OA 1ZGHA 5G0VA 5KQLA 3Q7EA 5JWOA 3HUFA 4P7BA 2O2XA 3EZYA 4XB1A 4BO7A 3ONDA 3L06A 3DO6A 3GG2A 2DQYA 3B1ZA 1E20A 3IJ5A 2GEJA 5I4KA 1M1NA 2EQBA 1V4BA 3GRAA 3KRTA 3BG5A 5KKNB 3IOMA 1PDOA 4KREA 3RKSA 3P9ZA 3UN1A 4AN1A 3E5MA 3PQ4A 1RBZA 3D6JA 4RTLA 4G63A 3AT1A 4CEIA 1F2DA 3NHAA 4NYIR 3W8DA 3N8NA 5AW2A 5IAOA 3JRNA 4WAUA 4DSZA 2OAEA 1BJKA 1X8LA 1HX7A 2DX7A 3B7PA 4NBUA 3VKWA 2F90A 5CDHA 4L8VA 4RMGA 2Z2ZA 1XN4A 2Q6LA 4HH1A 3BYZA 1Y37A 2IWRA 2VHZA 4BQPA 4FIDA 3N2KB 2ANCA 1GNVA 1F8FA 4O02B 3AR5A 5KDDA 4UEQA 5BNWA 5J47A 1Q84A 5FA5A 3X43A 4M60A 3T41A 5I7EA 3ZZNA 3OFSA 4UBLA 1W19A 5AK5A 1GZ6A 2PBLA 4XWTA 3EMBA 4F38A 4JBNA 1YL6A 3E9NA 1TVEA 2IYEA 1E8DA 2J9FB 5LWQA 1NT2A 2BGRA 2WP8J 3FNGA 4HDQB 4P81A 2B9EA 2NVUA 5D01A 2ZTHA 3CF2A 2Z8YA 2QY6A 5HIIA 1S5PA 4CZ2A 1XPOA 1KI2A 2QTMA 4H15A 3AMVA 3UY4A 2VRNA 2YWJA 3TSCA 3HKEA 2NO9A 3VHRA 3ZZTA 4FFSA 1AG9A 1FDWA 3KHTA 4DXAA 3KJHA 4JXZA 2YW9A 4QJ4A 2H1CA 3NHMA 3NUZA 1M5RA 1ZL0A 2UXCB 1L5GB 2CY0A 4LRSB 4O59O 2EZUA 4I1UA 4N5IX 4YQZA 5AXBA 2DB3A 3X1YA 4JOSA 3ZD9A 4URXR 1JA0A 4YRMA 1JTVA 1Z08A 3EJ6A 3FWHA 1VBFA 3OLXA 4CWAA 5A1JA 1RQRA 3C74A 4QBGB 2FDCA 1PN3A 3DEJA 1V1RA 5IDWA 2PZFA 1AS3A 1I3NA 2JBHA 2JIOA 3A3NA 3JVUA 4YJGB 4MGEA 4WTOA 2C5EA 5A5EA 1VHWA 1GZ4A 3ZGXA 4OXQA 3ITDA 1XMSA 3CH7A 4BAUA 3WYNA 4BLWA 3NALA 4X94A 2CHFA 3NC4A 1YTUA 2ZCVA 4EB6B 5M34A 3FTNA 4BNIA 3E82A 3FFXA 3GPDG 1K0FA 4N6NA 1QH8A 3M6VA 3R8FA 4LV5B 1UJMA 1YC5A 4FYJA 1GQFA 3UC9A 2CB0A 3PNVA 2QT1A 2DFPA 3CLTC 3E35A 4YJKA 4WUVA 3UA4A 5IJWA 4HXFB 4WNAB 1NVVQ 1UJ2A 5AH0A 1E59A 2QN2A 1M0WA 1NOIA 4R1UA 5ILGA 2Q8NA 2JRLA 5B4TA 2QRMA 4ZVLA 2F3RA 3ESXA 4CT4B 1R6AA 3K3PA 3CRQA 1D9ZA 2V7EA 1PL6A 4RM3A 1W36B 2BHRA 3MLAA 3OPYA 1DBVO 2DKOA 2B2XA 2F3UA 4YYZA 3DE1X 3TQSA 2CZGA 4C4PA 1KSFX 1GM5A 5JY1A 5CK5A 1P4JA 1U5BB 3GCXA 5J4KA 2R5WA 4LDQA 4MMYB 1W75A 4N03A 2A1TR 3SF0A 3WI7A 4Z86A 4MKIA 1ZC4A 1ISPA 3E15A 4MWBA 5JH7A 4N4AA 1CZKA 1F60A 2Z56A 1H4TA 3L77A 4OEHA 5AK0A 3WBKA 2NTEA 4YRSA 2F9FA 3PFWO 2B6HA 5C8XA 1AC5A 2D3WA 2IPNA 1QWOA 3KLNA 4D8VA 2ONZA 4DRZA 3IUJA 1Z3IX 2BTQB 5C1BA 4B48A 1UZMA 2ZYIA 4LOKA 3UWMA 4B46A 3GLHE 3IUYA 4JFRA 4CFZA 3OO0A 1YZVA 3NTXA 4CI9A 5HPYB 3FGZA 2OAP1 4FZRA 2MSLA 4MQ6A 3FFBA 3LWNA 1BVUA 1Q0HA 2CUTA 4PXSA 3H1TA 4LPKA 1GZ3A 1TJPB 2XDQB 3ZBPA 4UU8A 1QP8A 3ZQKA 4B6OA 3U44A 3DXFA 5FLYA 5C81A 4KJZA 2PZBA 1NMSA 3T5BA 4UBIA 5AUQA 4BE7B 3DC7A 3TDMA 2IYUA 2UXBB 3NPMA 3U09A 3IS3A 2EOAA 3DLBA 1T3HA 4OFXA 4WGGA 3GRVA 1T8UA 1VJ5A 1BN7A 2NV2B 3K9QO 4ADSG 2BEVA 3TGLA 2BFEA 5AXCA 2O0LA 2IDJA 2QSYA 3E1SA 1I4OA 2JBWA 2HGZA 4P0PB 1IRIA 1BCRB 3MC1A 1L9XA 3GVXA 4F5DA 1PWZA 2I55A 3G02A 3AEYA 3OIDA 3OQ1A 5EA2A 2DOKA 1IC6A 2FVYA 2PGOA 2FX2A 1D03A 1RLMA 1T9ZA 1NVTA 3G2OA 1EXMA 4NICA 4DMHA 1EWTA 1H1LB 2YCLA 2WIFA 1F8UA 1TPZA 3O4HA 5SZJA 4JU9A 3GLGB 2ORVA 1P6QA 4Q48A 2CV2A 1N33B 3WOVA 1P0IA 3EGXA 4A15A 1XQXA 4RTOA 3CISA 3UYKA 1HSZA 5FWYA 3OOEA 1FDTA 4KSCA 5TQ2B 3REOA 3UWKA 4LJ6A 5I01A 2E0IA 2NU7A 3C7KA 4EAAA 3FPHA 1MG5A 3OJ0A 3HJGA 4ZQIA 4DZTA 5GTDA 2FY8A 821PA 1Y9EA 3NYWA 3RYHB 3RLFA 2W7TA 1UEXC 1WEHA 3ETNA 1ZNXA 3BHNA 3EXFA 4HDSB 2NG1A 3PEEA 4ZQBA 2FMTA 1WP4A 3BMCA 4IVQA 2OG1A 4RFSA 5AKLA 5EIHA 4EY8A 1FL9A 5IJ0A 2AW3A 5L3QA 1B7GO 3WHLA 1E1DA 3GGCA 2QUBA 2CWDA 1MJHA 2FW8A 2WU1A 4RTKA 1LK5A 4X85A 4E33A 4JBGA 4IIUA 3VR5H 4D8TA 4JLNA 1NRIA 1NW4A 2C61A 2Q46A 2WJJA 3EWNA 3NV9A 4J16A 1H2EA 3E3LA 1SVNA 4HPJB 1KETA 2ZDHA 1LNQA 1YNSA 2OMEA 3V4VB 3VDQA 2PUFA 3GAAA 5ALLA 4DA0A 1M2EA 4BEVA 4N3BA 3OIVA 2NU9B 1GZSA 4IDOA 3LL7A 1Y0BA 1G59A 4QECA 3N70A 2A33A 2OVBA 2WE8A 3COSA 1RI4A 3KEMA 3LBAA 2AOTA 2KI5A 2YVKA 1MO2A 3CNQS 3IP3A 4PEVA 1E92A 4H1WA 5ICMA 3DQZA 1IY2A 4ZTUB 3OZTA 3HZHA 5A4AA 3M3DA 4V0NA 5SY9A 3WGUA 4D4IA 5ALSA 3TLBA 4OQDA 5EIBD 1NQ5A 4UHDA 1RXVA 1U3TA 2OD9A 1K2WA 5LFAA 3GRRA 3IR6A 1XPJA 1U90A 4AI6A 2IYRA 3MTBA 1DNPA 4A16A 1VSBA 1C1XA 2RBKA 3H75A 1JXAA 2YUTA 3V9AA 3HP1A 5E8RA 1I1HA 1E79D 1VA4A 3RKUA 3I5UA 1LPSA 4GEKA 4ARZA