1EVJA

Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
340
Chain Sequence
RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a truncated mutant of glucose-fructose oxidoreductase shows that an N-terminal arm controls tetramer formation.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 116
structure length 340
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1evjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evjA01
4P38A 2W2LD 4TRMA 1YL6A 1C1XA 1EMDA 4W6ZA 1QKIA 4WK6A 2WM3A 4XEHA 3RU7A 5F5LA 4O0LA 1PGPA 2J3HA 4HFRA 1QYCA 3HB4X 1W8DA 4ID9A 5I8ZA 2BELA 3ZDFA 2P5YA 1DAOA 3SLGA 4YAKA 2X22A 1U1IA 4J2OA 3K30A 4L4RA 2WSBA 3GC6A 1RJWA 4J0FA 1EFLA 2PGJA 3RUDA 4CLEA 5IXYA 1FDWA 4A27A 3GMDA 3UGKA 2D1YA 5CPFA 1XLTA 1KY4A 4JJGA 4FQ8A 3ETEA 1KVSA 1PGJA 4QSMA 1W0CA 2X0IA 3VC7A 2Q4BA 2I6TA 2IRWA 3INRA 6ADHA 1NPYA 5KVQA 4PRLA 4FOSA 5JAIA 2GZ3A 2B0JA 3RUCA 4D43A 2O50A 1VKNA 5IXSA 5JYAA 1NHWA 3VPGA 3GDOA 2EGHA 3ABIA 3EZLA 1AUPA 3FTPA 1Y8QA 1ONPA 2D4AA 4BKPA 8LDHA 4OYRA 2WD7B 3DHEA 1B8VA 4BKRA 1MC5A 3WQQA 4BUCA 4A03A 2VYVA 3DHNA 4TKMA 1YH3A 4MKXA 1Q0QA 3E18A 3DOCA 2NUAA 5KVVA 2YZ7A 3MJCA 2IXAA 3WQRA 3AOEC 4UUPA 4ONEA 1Z82A 3RUFA 4OSOA 2BI8A 5AYVA 3IMFA 1MG5A 2G76A 4J7UA 1K2WA 3PYXA 4HXYA 1BXGB 4WOKA 4PLYA 1WXDA 5F1KA 4BNTA 1PZFA 1DB3A 4K28A 1YL5A 1JLLA 2ZCVA 3PHHA 1PZHA 1B3RA 4EEXA 4D42A 4BNXA 5KNLA 4NJMA 5DOZA 4EW6A 4IPTA 1WDLA 4ZN6A 1ULUA 1ZFNA 2W2LA 3OICA 4J91A 2WYVA 2J8ZA 4PLFA 1LRKA 5IZCC 4MPDA 3BMCA 4UUMA 3MOIA 4L74A 1YOVB 5M6DA 1B16A 4Z9XA 3RQSA 3NYWA 3VPSA 1QYDA 4GMFA 5AXDA 1N1GA 4DTIA 4IDGA 4WLUA 3K92A 5JCXA 2EJWA 2VTDA 3WB9A 3RFXA 4CM6A 1IHYA 4FB5A 4OXYA 4YJGB 4TROA 1IHXA 2AEJA 3WTCA 1PU2A 4TVOA 1QORA 3NT5A 5JYFA 1DBVO 2ZYGA 1XQ6A 3BXXA 3IJRA 4XYGA 1YL7A 5JFOA 5GZ3A 3FI9A 4R69A 5T5QA 1MC4A 2BD0A 2Q1SA 4Y6PA 1PWXA 4BO3A 2P9EA 3GH3A 3QWAA 3E8XA 4AG3A 5ES3A 4UEKA 4BS9A 2O2SA 4YJDA 3UUWA 1ZXBA 1Q7GA 3E03A 4L73A 3R3SA 4YEDA 5IG2A 1R4MB 5K6AC 4XD2A 4YA6A 4B3IA 1TVEA 4PLGA 3ENKA 4CMGA 3Q9NA 3MEQA 3OH8A 3D0OA 3I9LA 3LSYA 1D1TA 1U7HA 2NU8A 3HE3A 1RM4A 1KVTA 1HL3A 3VPXA 3A9WA 4RPGA 3IIEA 1AHIA 3L6DA 1T4BA 5A03A 4D3DA 4ZICA 3BYZA 4DWVA 5JLAA 3TZHA 1MA0A 1QYVA 3G0OA 3GR6A 2FZWA 1PJLA 4F45A 2P68A 1I8TA 2YUTA 4TRNA 4E2YA 1UXJA 3OA0A 4OAQA 2Q1UA 3WJAA 2UYYA 1LI4A 3OECA 1VM6A 3WYEA 2RHRA 5B1YA 3PZBA 2HKIA 5TJHA 3BMNB 3F1LA 1BMDA 5FEUA 4WKGA 1OC4A 1CF2O 3KTDA 1GYQA 3L77A 2IZZA 5IDQA 5G4KB 1NFRA 3DMYA 3D5TA 3DZGA 3BMNA 3IOYA 4R16A 2VQ3A 3KETA 1I24A 2VZ9A 4GX0A 1RPNA 4O1MA 1DRWA 1T2FA 1QV6A 1S7CA 4U6SA 4DIBA 3WGTA 3CSDA 5ITVA 2J3IA 4PLHA 3WQSB 1DC3A 4RVDA 3VDQA 3OJ0A 3ROMA 2CF6A 2Y1OA 3ZHBA 1P31A 4ZHSA 3MTGA 2VUSA 3CEAA 4E5MA 3L4BC 1PIWA 4IDFA 4GL4A 3VZPA 2JCXA 4CM4A 4BO0A 4HV4A 2X9GA 1HDXA 1GUYA 5BSFA 3NX4A 5FWNA 2YV1A 2G17A 4LSMA 4F46A 2VHWA 2CVQA 3LT1A 4YJFB 4D3SA 2HK9A 2HAEA 1CWUA 1NQTA 3H2ZA 1I33A 2P4HX 3H9GA 2YDXA 4E5PA 4G65A 2Z95A 3GGPA 2Y0CA 3FBGA 1LC0A 3DR3A 2AHRA 1H6BA 1X0XA 4PLVA 4RQTA 4JROA 5I7VA 4M89A 5KOIA 2NSDA 3VAZA 4CPDA 3GN1A 3EAGA 4JNKA 3SBOA 1PS8A 3HFGA 4W4TA 5EL0A 4BVAA 3TZ6A 2JD0A 1XGKA 1K5HA 3B1FA 2PV7A 1SAYA 3NAQA 3V5NA 1XA0A 4MVJG 3CH6A 4A7PA 4CJXA 4KWIA 2VNAA 4JJFA 5L95A 3BMQA 3FNEA 3QIVA 4LMRA 4PIVA 3ZGYA 2F00A 3D1LA 1ZZEA 2X1HA 1T1RA 1DC5A 2QW8A 1SPXA 5A02A 3GK3A 3GZ4A 3D64A 4MVJD 4LW8A 3MZ0A 3K31A 4BGEA 1XEAA 4DREA 1N1EA 2RCYA 3UFXA 1JDJA 3I4FA 4E6PA 1P1JA 4CQLA 2DKNA 4EJ0A 1PX0A 1UDAA 3I6QA 2I5PO 2PFGA 4K9DA 4RZHA 4Y6SA 1MGOA 3DZKA 3H8VA 3KBOA 4D79A 1U4OA 2B4RO 1ONNA 2OBNA 3DBLB 4QEDA 5C7LO 2W90A 6LDHA 4Z3KA 3KO8A 3JQAD 5BSEA 2Q99A 2OFPA 3ANMA 4UREA 3LK7A 2FSVA 3ONDA 4PG6A 4GX1A 4Y67A 1GV0A 1HE3A 2WMDA 1D1SA 3PFWO 1KVQA 1XKQA 4BO7A 4IXWA 4RLSA 4YPOA 5EQDA 5L51A 3H9JA 1KBZA 5HRUA 1YKFA 4GSKA 1WZEA 3TFOA 1PL6A 1HE5A 2EWMA 3ZU4A 1FK8A 1LLQA 1P45A 3HQ4O 1LDEA 2AXQA 1NWHA 2Q4EA 2HLPA 2VOJA 3QVWA 3MOGA 4IIUA 3SJUA 2VCYA 3NV9A 4IJKA 2P2SA 3GLQA 3JYPA 1E7MA 4NFHA 1YWGO 3UCEA 4GSLA 3GN2A 3T7EA 3I9JA 5JW6A 3OMLA 2Y66A 1T24A 4CM7A 2X5JO 1NAIA 3UN1A 5H83A 3C7AA 5COAA 1E92A 1CRWG 2OORA 2ZK7A 1Y5MA 5BT9A 4B3HA 3KVOA 5KJEA 5JSFA 5EIOA 2QZ9A 3H2SA 3P2YA 2PNFA 4RJTA 2YFQA 3LLVA 1IE3A 3WWYA 3EZYA 5KCZA 1B7GO 4J1QA 4IUYA 4CM9A 4UUNA 4Z3DA 3ENNA 1EDZA 4NH4A 4RPLA 4JCOA 1Y8RB 2VRCD 3AI3A 1I5RA 4CM4B 1LRLA 2Y93A 1DDOA 3JQBA 4E0BA 4R41A 3HG7A 2JJYA 2JFHA 4FJ1A 4YRAA 1T2DA 1I32A 3BTSA 1VL0A 1PJSA 1NVTA 3VKUA 4RCVA 1RM0A 1XU9A 4ALJA 3QW2A 3GEDA 1K6JA 2ZYDA 4M54A 5CDSA 1FDVA 2EJVA 3KEOA 7MDHA 5KJFA 4L8VA 3VH4A 2FSSA 2JAHA 4R9SA 1KEPA 3WICA 1GAEO 4FD3A 2EKQA 4PG4A 1W6UA 3GPIA 1LDMA 2O3RA 2AG5A 4DC1A 1XR3A 1YQGA 3H4VA 3LU1A 3N7UA 2Q2QA 4IINA 2DUWA 2DBVO 5FI5A 3B1KA 2IZ0A 2VNSA 3E9NA 3TZKA 3W1VA 4AL4A 4RVUA 2PZLA 3KYDA 2PWZA 4OJNA 4YVFA 3V2HA 4BB6A 2I65A 1IYZA 3C3XA 2ZTUA 4WLEA 3D4PA 1V3UA 5G0WA 1EEHA 4E33A 2PZKA 5K6AA 3ZV5A 2D8AA 4BB5A 3AY6A 1GY8A 2HK8A 2A35A 3JQFA 4YAJA 2PTGA 1R15A 3PQEA 3LYLA 1I2BA 3TSCA 2G5CA 1P1HA 1WZIA 4YBZA 5AXCA 1Y9AA 2J5RA 1GV1A 1Z73A 2ZB4A 1OMOA 1JA9A 2C20A 1IZ9A 4YT2A 4OOFA 3AFNA 3BIOA 4XYBA 3O8QA 3ZW8A 4GVLA 3OEYA 4J9UE 1ZCJA 4WOJA 4HADA 1KC1A 2C2YA 2ZTLA 5TF4A 3ZHZA 2E4AA 4OHUA 2P9CA 3GUYA 1H9BA 2CF5A 2CDBA 3HNPA 1PS0A 4D41A 4DBZA 4MDHA 2HUNA 1KIFA 1PZGA 3VZSA 2AEFA 2X5KO 2I3AA 2B4TO 3PJGA 3G49A 1HZZA 1L1FA 2O7SA 2D59A 2OXIA 1ZVMA 4KUEA 3JSAA 3RFTA 2GR9A 2I3GA 4YRBA 3ASVA 4PZCA 4CMEA 5DCUA 1Z7EA 1HKUA 5CEEA 2WD7A 5T6BA 5ICSA 1FF9A 4BNUA 3CIFA 1ZKMA 3EY4A 3GVXA 4E21A 1V3VA 1LLUA 1V0JA 4S1VA 2AG8A 1DIBA 2X9NA 3GVPA 1L7DA 2NVUA 3WSWA 1E1NA 1MXHA 4GAEA 4QO7A 5FF9A 3WGGA 4ALIA 1E7YA 5KIAA 2WTBA 3QA9A 4H16A 4EGFA 1T2AA 2NM0A 3MJVA 5U1PA 5JMPA 3WNQA 2DM6A 1E3SA 1N92A 1NAHA 3O4RA 5IAAA 3QVOA 4PG8A 5A06A 4NR0A 3K2EA 4LN1A 3M6IA 1T2CA 3ETDA 1ZEMA 1F0YA 2DBQA 1B2LA 3L9XA 4PGFA 3GA0A 4J0EA 3ASUA 3EW7A 3OIDA 3U4CA 2C5EA 3DAFA 3X2EA 3PHIA 1NP3A 3U4HA 3ZWXA 4DC0A 2D3TA 1NQ5A 5DDIP 2W2KA 3CKYA 1UDBA 3E9QA 4I5EA 1I2ZA 2C7VA 1QXSA 3H7AA 3H5NA 4WECA 1VPDA 1YJ8A 4A0SA 1YB5A 2NTNA 2Q46A 5IZ4A 3IQDB 4LCJA 3UH1A 1G6KA 3OP4A 4JGBA 3EUWA 4FPXA 3AUAA 2OP1A 3EK2A 1LXCA 1KEVA 1G0OA 3ORFA 1N2SA 5K0ZA 1UH5A 4PZEA 5L53A 3S2IA 4PLCA 4NZ9A 5I9NA 4FR5A 1PR3A 1HETA 3CINA 3DTTA 4DYVA 2A9FA 2F1KA 3W4IA 5G4LA 3VZQA 2D2IA 4M49A 4AVYA 4OSPA 4NJMB 5IDYA 4FGWA 1YBAA 3FNGA 3NGLA 1XDWA 1YVEI 1ULSA 2C2XA 1NHGA 2NVBA 2W98A 1X1TA 2GZ2A 3PYMA 1R4MA 3VDRA 1Y9EA 1E7RA 1YOVA 1BVRA 4FSHA 4HBGA 1DIAA 3VKVA 1ENZA 3WTBA 5MDHA 5COQA 3ZWNA 3IUSA 3DTYA 1I01A 4YAIA 4YAEA 4NHEA 5TJ9A 2X23A 4MKRA 4F6LA 5HM8A 1IOLA 1R0KA 5DCWA 3V2GA 2VHVA 4J16A 3NKLA 1NPDA 4LRTB 1VJTA 1VL8A 1EQ2A 1Q7CA 5K9ZA 2JCYA 5IZCA 3ICPA 5FYDA 1B8PA 3KB6A 4RLHA 4IMPA 1P1FA 4CMIA 2HCTA 4R01A 1B0AA 2BI7A 2RIRA 3IL2A 3F46A 5IJZA 5GZ1A 2EERA 3BTOA 4NFYA 2PLAA 4P22A 3LC1O 4D46A 1PS9A 3D7LA 4FJ0A 5GMOA 1BSVA 1NNUA 5L45A 1DHRA 1EDOA 3C7CB 3L4BA 1SEVA 2IYOA 2VT3A 4Z6KA 1KYQA 3VOSA 3WDSA 5A9TA 1YBMA 2EW8A 5B4UA 5KKAA 2W2KB 1GQ2A 3V8BA 4EJ6A 2NVUB 4YXFA 1AGNA 1I30A 3P7MA 1NX6A 3AM4A 3LVFO 1G0NA 5ER9A 1E3IA 5F21A 1NFFA 1BW9A 1Q0HA 4DRYA 2HDHA 3KV3O 1BXKA 4FC6A 3DDNA 1UAYA 3ZI0A 2H5LA 4CLXA 1XELA 1QYWA 4IDBA 1HDRA 1U3TA 1RKXA 2RBEA 5IFLA 2AA3A 4WPGA 4P8RA 4R54A 3RCBA 4Q3BA 4YJFA 1QYXA 1D7OA 1HT0A 1X14A 5TSDA 4WE3A 4P4NA 1YDEA 4FFRA 4HKTA 4YQYA 3WSVA 1TXGA 1Y5RA 4EYEA 3PXXA 2VWPA 2UDPA 2NU7A 5ENVA 4CR8A 3RUAA 4MVJH 5ILGA 1BGVA 5MGBA 5HS6A 2OGUA 4M1QA 4UULA 4GMGA 3WG9A 3ZNPA 5JY6A 1TT5A 4J90A 4RVHA 1T26A 4J1TA 4JK3A 4G2NA 1PTJA 2C59A 1EVYA 1WAMA 1VRWA 1V3TA 4QXMA 3L6OO 4ZQGA 2X0JA 4ZA2A 1LDYA 3V2UA 3TF5A 4PCVA 1M6WA 2BRUA 2Y1CA 3WMXA 4BKUA 3F9IA 4CMHA 4CMCA 2V6MA 4RF4A 1H5QA 1H9AA 1JKFA 2YV3A 1CETA 1WPQA 1ZJZA 4UVDA 3RBVA 1OI7A 2YHUA 2HO5A 2O3UA 3KLMX 1CDOA 2C7GA 2VT2A 1LDGA 3GZNB 3AOEA 4D45A 4RL6A 5JC8A 1UP6A 3JQ6A 2J3JA 4R1SA 5H82A 2GASA 2Q1WA 1LJ8A 2HRZA 3GZNA 2QZZA 1B3BA 1I2CA 1X0VA 5JY1A 3UICA 4NNJA 4DMMA 4K6CA 2O7QA 1J6UA 1EE2A 3JQ8B 3PPIA 4D0SA 3E48A 3PI7A 4YJHA 4J9VA 1AXEA 4XRRA 3B20A 2OL4A 2VN8A 3FPLA 3ZU2A 1F8GA 3ZWOA 5C37A 1I3KA 1NASA 3AJRA 4J4HA 1QMGA 5F3RA 2EKPA 1PQPA 2BKAA 4MIEA 1GU7A 1BDMA 1JKJA 1Y6JA 4GGPA 4L4SA 4TQGA 1SOWA 2PH5A 3JQDA 4IM7A 5KJ1A 2Z1NA 5BSGA 4NBWA 3TZQA 3N58A 3WLEA 3ZNOA 2ZTVA 2VYNA 4GPD1 4XB2A 4L4XA 5JAMA 4P4GA 3UCFA 3RWBA 3GVHA 1SB8A 4DPLA 3FWZA 4YCAA 2NV6A 4Q39A 3DEYX 4JN6B 3PLRA 4MOWA 2BGKA 5IN4A 3ZWPA 3EHEA 1UDCA 5BQFA 1O5IA 3QQPA 2VWQA 4QQRA 4WCFB 4J3FA 4TKLA 1ZXLA 5G2OA 1X1EA 5U4QA 1U2DA 2PY6A 2I66A 4GQAA 1EZ4A 4PVCA 3OBBA 4LSWA 4L75A 3WIEA 4BNWA 1XG5A 3DFZA 4W7IA 4IZIA 4OO3A 3VZRA 3QLJA 1N7GA 2C29D 5L7WA 3OJEA 2EGGA 2J3KA 1Z6ZA 5HA5A 5DBIA 1J4AA 2QYSA 4YWJA 2YHIB 1UAGA 4WCDA 3GNTA 4Q3DA 4GWGA 3C24A 3DBLA 2AQHA 3WBBA 4PLZA 4XYMA 3QWFA 3RI3A 3QY9A 4A5OA 4JXKA 3VHRA 5A4DA 3IP1A 2GN6A 2RH4A 4WLVA 4BO5A 4IQ8A 3I3OA 1UZLA 3JQGA 3PGXA 1D3AA 3UAGA 3LDHA 1NFQA 3JQ9A 3W8EA 1PSDA 4OIMA 5L4NA 3T4EA 3OJLA 3RASA 4BNVA 4JBGA 1DIRA 3GDGA 3WMWA 4RVFA 4CMEC 1NQAO 3TL3A 3VTFA 2O4UX 3JYQA 2VTEA 4JBIA 1TA4A 5A04A 3OETA 1C0KA 5L7TA 1HDCA 1ADCA 1B15A 2FP4A 1GDHA 2Z1MA 4E2WA 1DIHA 1HDOA 5JDCC 2FWMX 4BO8A 1ZEJA 3RD5A 3HADA 1WDKA 3H9QA 3JQEA 1RYDA 1ENPA 1P1IA 2P9GA 1YXMA 4XDZA 3WYBA 2X0NA 1K0UA 2FOIA 1FDUA 1MLDA 2FHSA 3WBFA 1R12A 1M75A 3FWNA 4HFJA 4BNHA 3TNLA 3OHSX 2ZKLA 4N5MA 4IDEA 2G82A 3RFVA 4CUJA 4ALNA 3I5MA 4EI2A 2DT5A 3GT0A 3E9MA 4HUJA 1I36A 2ILTA 4JJIA 4Y9DA 3Q3CA 3AUSA 3EGOA 4F3YA 4ZQBA 3PRJA 3KSZO 1Z45A 4PLTA 3WGZA 1M2WA 5JE8A 3PYLA 4BKQA 5THKA 1NQOA 3WS7A 2E48A 3MTJA 4O5OA 3OJFA 1NTOA 4CQLB 3ZWMA 4NU5A 4UVGA 1HDYA 1VSUA 3AWDA 1E1LA 2E37A 4WUVA 5I9MA 4AJOA 2WE8A 1BXZA 4DA9A 3IKTA 3DZBA 2DTEA 1PZEA 3P5SA 1RM3A 2B69A 4IJUA 2WE7A 4BO9A 3DWFA 3ICCA 2PD3A 3FF4A 1J5PA 2ZB3A 3PVZA 5ER6A 1NPTO 2WYWA 4E12A 1R16A 1DOHA 3F47A 3FCOA 1LEHA 3PTZA 3B70A 2Y1GA 2GCGA 3WGYA 1DJNA 3D5QA 3H9UA 1UJMA 3MJ4A 2V65A 3BAZA 1GYPA 4XQCA 4RF2A 1OFGA 3E1KA 5C7OO 1LSSA 4DXHA 3DBRA 3FNHA 4II2A 1SMKA 1IPEA 2GPTA 3C7DB 5LDGA 1RYEA 2V6FA 1E1KA 1U2GA 1HLPA 3LT4A 4XB1A 3L6EA 2PK3A 3AY7A 3JTMA 1OOEA 3MJEA 2UAGA 4Q3CA 4RVSA 5F1OA 4ITUA 5EQFA 5DT9A 5JO9A 3ZZNA 1KETA 2FZEA 5A3VA 1EBFA 3OQ1A 4FOOA 2GGSA 2ZYAA 1B26A 2C5AA 3QJ5A 1HYGA 2W4QA 4J2HA 4C7JA 3JD0A 3ZV4A 1DRVA 2IZ1A 3FRJA 5I8WA 5DOVA 1SZJG 1PJCA 1T4DA 4XR4A 4IY1A 3Q2IA 4R9RA 1E5LA 3M2PA 4Q3NA 4XZ3A 1A5ZA 3C1OA 5JCJA 2IDZA 4OM8A 3INTA 1PQUA 4IGFA 2XAAA 3E5MA 4R1NA 1JAYA 3V1TC 4WASA 3DBHA 4TRJA 4YT4A 4FC7A 1H94A 3IS3A 4AJIA 5TX7A 5L4SA 1MUUA 4JLWA 4CLOB 1KVRA 3TPCA 1NM5A 4ND2A 3S8MA 3PIDA 4MIYA 3HDQA 1H6DA 2O3QA 2FN7A 3RU9A 1A4UA 2IYPA 3OJOA 4NJOA 4E5YA 4K26A 5CDYA 1HEUA 5JAQA 3T7CA 4N7RA 1WMBA 4WJZA 1ZBQA 1ZK1A 3QWIA 3QWBA 4IDDA 2XF8A 1PJQA 4DGSA 5JBIA 3B1JA 3VH2A 3ETGA 3K73O 4A2CA 5CG2A 4N5NA 1I3MA 3PDJA 3LT0A 1U4SA 5L4LA 3AI2A 3WWZA 4KTTE 2Y1FA 5TT0A 4HFMA 3LLSA 2X0RA 5HWSA 1N9GB 5THQA 3UCXA 3ZU5A 4BGIA 5A9SA 3G79A 4AJNA 2Y68A 2XPCA 4A10A 2JL1A 4FBGA 3ROKA 2R00C 2X86A 1UP7A 1X15A 3ULKA 1E3WA 3U0BA 2EIHA 1PQWA 4I9UA 3F1KA 3HHPA 2B4QA 1U3UA 2AE1A 3A14A 4M86A 5IDXA 4XGKA 1ZSNA 1BW9B 4WCFC 4DL9A 8ADHA 4LCEA 2IXBA 4BO6A 3I6IA 5COBA 1C14A 3TJRA 1MFPA 1YE3A 4FGSA 4AFNA 5DCYA 1HLDA 4WEOA 3PHJA 2HMUA 1X7HA 3H9EO 3DQPA 4ND1A 4JBHA 4Q9NA 5BNIA 1LLCA 4NBVA 3DBRB 3JYLA 4MVJE 1HYEA 3RIHA 1EUDA 4B4WA 4GVXA 4OXKA 5IDWA 3F3SA 3ZWYA 3MWDB 3WYCA 1GADO 3HSKA 4PLPA 3ZN2A 2X5OA 1ZK3A 3T4XA 1DFGA 3GPDG 4UUOA 3OIGA 4BNGA 4MJLA 5JAZA 1F06A 1A4IA 1P0CA 2NU9A 4BO4A 3NDJA 2QRJA 4YR9A 4CLRB 4M87A 1C0PA 3GGGA 3GQVA 4RPHA 1YO6A 2VYVD 5I7SA 4JQCA 1E6WA 2NNLD 2Y1EA 1ZK2A 3I9NA 2Q45A 3QHAA 4YT8A 5DZSA 4CLRA 1GFSA 3AY3A 3ITKA 1UZNA 1F17A 4UEOA 4I1IA 4KWHA 2I67A 2OP0A 4GI2A 1HZJA 2CDAA 1U8FO 4ZU3A 3IC5A 4KUHA 4Z0TA 3V1YA 3HDYA 3R1IA 4I08A 4WLNA 5G4KA 5KJ6A 3FR8A 2JHFA 9LDTA 4FN4A 3BA1A 4XA8A 1O6ZA 1GZ3A 1KY5A 4DPMA 2BGLA 1ISGA 3R0IA 2GN9A 2VRBA 5CDGA 1VE9A 1U5CA 5G0UA 3H6KA 5FFFA 3FN4A 3IJPA 4OKNA 4XIJA 1JVBA 3WR5A 1KEWA 3L07A 3VVCA 5DF1A 2B83A 4AJ1A 1H6AA 5F1PA 4ZJUA 3ADPA 3VH1A 4R4JA 2VHYA 4HY3A 1MX3A 1QG6A 5HTOA 2PKRA 3F6YA 1Q1NA 2XXJA 3UW3A 3GUCA 5A5FA 5TQVA 1P1RA 3I4CA 2J6IA 3WIDA 2Q2WA 1CQIA 1EVJA 2GRAA 4LVCA 4E31A 3JQ9C 1DJQA 4UVIA 1HYHA 4XJTA 1V35A 3M1LA 5GY7A 3S2GA 2FMUA 1MG0A 1X7GA 3IP3A 3BTVA 5F5NA 4IXTA 4MKZA 1P0FA 1CIVA 4CLDA 4TMFA 4W9NC 4ILKA 1E3EA 2GSDA 4XDYA 2DLDA 4BNKA 4KQWA 1ML3A 4PG7A 1A72A 4GLOA 4ZD6A 1UXHA 3WGHA 2VRCA 4PFJA 1WLYA 3AM3A 3PZRA 4BO2A 4AJHA 4NK4A 1E3JA 1FMCA 1D8AA 4B4UA 1DFHA 1A7KA 1YRLA 4E3ZA 2X58A 2X9VA 4MVJF 3NRCA 1TT5B 4BGVA 3U3XA 1PGQA 1C1XB 2GN8A 1ZSYA 2PR2A 4ZQFA 3W6ZA 4J4BA 1M76A 3Q11A 4E2XA 3RC1A 3RUHA 3CZMA 1TI7A 2DBZA 3I1JA 3Q2KA 1E3LA 2A4KA 3PLNA 1P3DA 3HFSA 5JS6A 4BQPA 2YQ5A 1DRUA 3VPFA 1EFKA 4DBVO 3JQ7B 4FS3A 2NADA 3ZWAA 4JX8A 4DPKA 4AJLA 3GF4A 1JQBA 4CMJA 3GFGA 1R4NB 3OA2A 1YONA 4BV9A 4YQZA 3DOOA 3TOZA 5JC1A 1TEHA 1OZAA 2Q50A 3D3WA 2QQ5A 2OBYA 2ZIZA 5T57A 3ZV3A 1S6YA 2YQ4A 2FR8A 2XOXA 3OIFA 1K6XA 1YQDA 5DN9A 4KOAA 4HWKA 4HNGA 4Z9FA 3WLFA 3OM9A 2QIOA 3SC6A 2JD1A 2UVDA 4I5GA 4YAGA 3INGA 1WNTA 1DLIA 1VSVA 3KM0A 4GKBA 4PRKA 4DQUA 3CMMA 3W8FA 1TLTA 3PDUA 3I23A 3DMTA 3RC9A 2QRLA 4U0KA 3RROA 1VLLA 1G1AA 1GZ6A 3LF2A 2OMEA 5U9CA 1ONOA 3ZCXA 3M2TA 5DBFA 1YQXA 4URFA 3LF1A 5EN4A 3HUDA 1ISMA 4ALMA 1E7QA 3JQBC 4H15A 4FFMA 1U9JA 2BFMA 2HSDA 1DXYA 3GG9A 3HDHA 3P19A 4FFLA 3EC7A 2UV8A 2DFVA 4R51A 2H9IA 3KSUA 5G0TA 1LSJA 4XQ9A 4CV0A 1ENOA 2V6BA 2Q22A 1FJHA 5TNXA 4I9NA 4YJHB 4C4OA 2EKLA 4FFNA 4PVDA 4DIFA 3AK4A 3U49A 4DVJA 4GBJA 1PJ4A 4XJSA 4XKJA 4EEZA 4NMHA 2AQKA 2X4GA 4BNFA 4D0RA 2UUOA 4KMSA 3DFUA 1EQUA 4BNLA 4R68A 1ARZA 3BZUA 2GN4A 5IN5A 4A26A 3CZRA 1GCOA 2HMSA 2DBRA 2YJZA 4GKVA 4K6FA 5TRTA 4C7KA 2AW5A 2TMDA 3JCZA 1O95A 4MIOA 3RKUA 4BMVA 2Y99A 3CPSA 2VUUA 5AVOA 3LT2A 4FIZA 3UF0A 4Q3AA 1PWZA 1HF3A 5AXBA 2NTJA 2FR0A 1HWYA 3W6UA 1E6UA 4R1TA 2LDXA 1AXGA 2GF2A 1ZMTA 5AQ1A 5A3JA 2B5VA 2NTVA 5KVCA 1YJQA 4TVBA 4IIVA 3GAFA 4RORA 2CVZA 1GD1O 4E4YA 4XIYA 3U9LA 5B12A 2AMFA 4BKOA 1LQUA 2EP7A 4BNMA 5EMHA 1O89A 2O48X 3FBTA 4GLLA 4OOEA 4DLAA 4ESOA 3OQ6A 3K8ZA 1W73A 3C8MA 1EVIA 2Q1TA 4WLFA 1IZ0A 2I99A 3BHIA 4ZGWA 4J1SA 2Y0DA 3DZJA 4M8SA 4B7XA 4BV8A 2OUIA 2H63A 1DIGA 2D5AA 1PEDA 1E0DA 2QHXA 4BO1A 1U3WA 4B8WA 2QX7A 4O63O 4IJWA 1J0XO 5T73A 3JD4A 2C07A 4O6VA 3AOGA 2C82A 1J49A 5HBRA 1FXSA 1I10A 2YY7A 3ZHYA 4IBOA 4YRDA 4E32A 3OEWA 3CTMA 1YGYA 3JQAA 4Y8VA 1HXHA 1E6EA 3E82A 1Q0LA 1A9YA 1ENYA 2DFDA 3DZHA 4IMRA 2VUTA 1LSOA 5CEJA 1X7DA 1CQJA 2X8LA 4XYLA 4RVGA 5JYEA 1AHHA 1BVUA 2G1UA 4R5HA 1LTHR 1SOVA 2R6JA 3QWHA 3ZWCA 4AJJA 2PH3A 4E5KA 2PD4A 1T1SA 3NEPX 1JN0A 4U8GA 4Q3EA 1CJCA 3X2FA 3FSRA 3S1LA 1Y8RA 3U09A 2ZQZA 2NU6A 5DP1A 4F6CA 3D4OA 4MVJI 4QECA 4WEQA 1VI2A 4NU6A 4EITA 4LGVA 1Y1PA 3PJFA 4MP6A 1PL8A 3GNSA 3C85A 4RDHA 1H0KA 3FHLA 1DSSG 1GPJA 4UEJA 2XXBA 4OMUA 2DTXA 3COSA 2CDCA 3TQHA 2JCVA 3I9OA 3M1AA 5A5EA 1BG6A 4EBFA 2D0IA 5JCJD 1BTOA 2Q3EA 2DC1A 1GYRA 3QVSA 1ORRA 5JDIC 3JD3A 3BMOA 4RO0A 1DPGA 4DLBA 1ISHA 4OH1A 1DO8A 2YFHA 1ISIA 3WXBA 3O26A 4NK5A 2W8ZA 5KKCA 3ROPA 3BTUA 3BHMA 1JKIA 3GAZA 5ICMA 4AJ2A 4QUKA 3GRPA 4EDFA 1LRJA 4CM8A 2CZCA 3K9QO 3QP9A 1QV7A 1ZIDA 2J5QA 4FFPA 1IPFA 4R1UA 1P9LA 1TT7A 3RC7A 3A4VA 4BOYA 4OXNA 3JQGB 3O9ZA 2VZ0A 1V6AA 3MWEB 5L7YA 3RAJA 5TIIA 1YBVA 3PWSA 1XSEA 5I7FA 5TS3A 3U4IA 2LDBA 3L4SO 2NQTA 2IEDA 1PJ3A 4JP2A 4II3A 3PIIA 1OAAA 2H1SA 1RM5A 2E6UX 2EEZA 2NQ8A 5EERA 4CR7A 5I7EA 3DL2A 2O3JA 3BHJA 3O38A 1NBOA 4E5NA 3E6AA 1E1MA 1UXGA 5CG1A 3SXPA 1W4ZA 1EUZA 2BFOA 2Q2VA 4RPJA 1GUFA 2D5CA 5ENDA 4BNIA 3JQCA 2OO5A 1QSGA 1EE9A 4CMAA 1LUAA 4CMIB 1FDSA 3SEFA 3TRIA 5H81A 1YB4A 3F4BA 1E5QA 3JYNA 1N5DA 4KDFA 1XYGA 4RV9A 3C1AA 3KYBA 1Y7TA 4MVJM 4BHTA 5CHEA 4BQRA 2Y05A 2VOEA 1XWFA 4OL9A 3VTZA 4B4OA 2ZATA 1P74A 3GGOA 4E30A 3OF2A 4G81A 4J7CA 2WWRA 3L0DA 4GWKA 4Z0PA 2VHXA 3GHHA 3DBHB 5GZ6A 2GO1A 4FW8A 1E7WA 3LC2O 2X6TA 3G1TA 3KOUA 2NVWA 3ZNQA 1LNQA 5EPOA 2DQ4A 3WGQA 5JXWA 2I76A 3HN7A 1MFZA 4H7PA 3HDJA 3H5RA 4DUPA 4EUEA 4OQZA 3C1TA 1ISJA 2YW9A 3JQ8A 5TT1A 3NJ8A 3ON5A 2CD9A 1Q2XA 3TWOA 2SCUA 1GR0A 1E3WB 4W7HA 2RHCA 4J6FA 4NIMA 4IJVA 9LDBA 4AICA 5KJCA 3K5PA 1HSOA 5B37A 1IY8A 4XX0A 2HU2A 4KUGA 2VWHA 4J43A 4LISA 4PZDA 4PN3A 1O8CA 1HE2A 4U0JA 5JDCA 1KC3A 2G0TA 2B5WA 3SJ7A 2FY8A 3I83A 2CY0A 2O23A 2DU8A 4E13A 3Q0EA 4LRSB 1DC4A 3RC2A 2Y67A 3FPCA 3DMTC 4XRGA 4W99A 2JAPA 5L40A 1ZMOA 1ZW1A 1U5AA 1B8UA 1MP0A 2B36A 4JIGA 4XR9A 1L7EA 2FR1A 1A9ZA 5KTKA 3ADOA 1SEPA 5TC4A 1K3TA 5HS4A 3KRTA 1SB9A 1T25A 3RBXA 4N18A 2IODA 2OZPA 3NDRA 4I9HA 3TDKA 2ZCUA 5JO0A 4CV3A 1KS9A 2OHXA 3RBZA 3BMCB 3SX2A 5CAEA 3DB2A 2GYYA 1IUKA 3DAGA 3AU9A 2YV2A 5LC1A 4B4VA 2PKQP 1ZUD1 3H3FA 1SCUA 1H2BA 2EP5A 3DAPA 3FD8A 2BGMA 4U7WA 1ZSVA 4RPKA 3WFIA 5CFZA 1I3LA 4IDCA 2CFCA 1IULA 4BL5A 4TRRA 5FI3A 2DPHA 4AJKA 1GQQA 4INAA 4NQZA 4RF3A 4YJGA 3S55A 2JHGA 3BMQB 4IQGA 3KXDA 4HP8A 4R3WA 5EINA 3WX0A 4I8XA 1EUCA 3DZIA 4RDIA 2DVMA 2UUPA 3NTOA 5CP8A 3GHYA 4DIOA 1DEHA 5JYDA 1R4NA 1NYTA 2AE2A 3RJ5A 1DC6A 1Y81A 2YYYA 1ISFA 1BDBA 3KEQA 2H6EA 4ROSA 2HQ1A 4I5FA 3ZH2A 3PEFA 1WP4A 5CDUA 4CQMA 5AXAA 1IL0A 2ZJ0A 2O4CA 1D4FA 2AEMA 4KQXA 3W8DA 4N5LA 1WMAA 4FCCA 4OGWA 3JYOA 2CMDA 3PK0A 4FFOA 1XHLA 4MO2A 2YDYA 3NTRA 4CL8A 1JW9B 5JDIA 1VJ0A 4CR6A 1LDBA 3PGJA 4WGGA 5T64A 4CM9D 3CXRA 4YT5A 1M6HA 5CDTA 3AU8A 4BNZA 2NLOA 1NVMB 1NXQA 4I5DA 4XCVA 3AM5A 4ND4A 4GX5A 4BNYA 1GTMA 2GZ1A 3B6ZA 4AJPA 5KVSA 4EJMA 2VHZA 2P4QA 3GG2A 3KYCA 3DO5A 1F12A 1QLJA 4E2ZA 1GEGA 3NDIA 3U5TA 5TGDA 4L9RA 3SVTA 3R6DA 1ADBA 3ZNNA 4YTEA 5L9AA 4B8ZA 1Z74A 4QO8A 4L0QA 1PR9A 5KWEA 2GDZA 4GX2A 2PKQO 4RGBA 3DXFA 3H5AA 3S2EA 3FTNA 1ZH8A 2WD8A 3PQFA 1N7HA 3GFBA 5DNAA 4W82A 4R3NA 2EXXA 4XGNA 2PGDA 1VL6A 2P91A 4BMNA 4LK3A 3ONFA 3QVXA 5B4TA 3GVCA 4KDEA 2ZJ1A 3WFJA 3PJEA 1DFIA 3LC7O 1P33A 1C3VA 3GVIA 1GEEA 1LU9A 3DZFA 3UOGA 2HMWA 3KZVA 3JD1A 4D44A 3PHGA 2VZ8A 4NBTA 1O94A 3GDFA 5EJ2A 3ZWWA 2EV9A 5BR7A 5A05A 2ZB7A 1SBYA 3MJTA 3P2OA 1JTVA 2HK7A 4J4TA 4MP3A 3ZWBA 4IQ0A 4Y98A 5AOVA 2NACA 3ANNA 1HDGO 3ZV6A 4HFNA 1R0SA 1ZO8A 3OQBA 3GY0A 1SNYA 2EW2A 5JNLA 4WNCA 2DAPA 2FPGA 4CMBA 3DOJA 4IS3A 1LLDA 4PLWA 4J1NA 3GMSA 5BNFA 3E5RA 3UXYA 4CUZA 1O0SA 3K2BA 1AN9A 4XGIA 3ZW9A 2DUUA 1MB4A 1RWBA 4QX6A 3VH3A 1ZK4A 2E82A 3UHAA 3UVEA 2AQ8A 1K89A 1LDNA 1X13A 3RSHA 5DP2A 1LA2A 4BNNA 1Z7BA 4CQMB 3O03A 4UVHA 1HSZA 4TZTA 5LCXA 3ZHXA 2NWQA 5EESA 1DHTA 3H3JA 4ALKA 4LVUA 3IDSA 4EUHA 2DTDA 1WDMA 4EUFA 4IDAA 1JVSA 2FPPA 2WYUA 4Y6RA 2ET6A 4WCFA 5CEFA 1LQTA 1PL7A 1JU9A 3G17A 2X7HA 4P4LA 1UUFA 1LX6A 3KLPX 1SC6A 3I9MA 5ADHA 3WGOA 2RH8A 4R5MA 4BMSA 4CLOA 2QG4A 4Z9YA 3KYCB 2V6GA 3WJ7A 1O9BA 3JQ7A 3F5QA 3HWRA 4L76A 3V1UA 2O3TA 3DHYA 3AFMA 1A71A 4CMKA 1T2EA 5ITWA 4HNHA 3QV1A 1UZMA 1ZJYA 3RJ9A 3ST7A 1EBUA 1ADGA 2A94A 1C0IA 3EDMA 4XWYA 1OC2A 2Q49A 1M67A 1QP8A 1E77A 2FPIA 3AUUA 5A9RA 3SLKA 5C5IA 1NWCA 5J9GA 3DBVO 1GQYA 5IF3A 2BF7A 1DAPA 3I9KA 1CYDA 1KVUA 2Y0EA 2DPGA 3EYWA 3G1UA 2WEKA 4IS2A 3UKOA 3KSDO 1P77A 3H65A 5A9SB 4G5HA 4H3VA 4NFSA 4QTZA 3PWZA 3JV7A 1MV8A 4XQGA 3D3EA 4D7AA 5BSHA 1P1KA 2O2YA 2HJRA 2GUGA 3HJAA 4MVJP 4U5QA 4AJ4A 3BMOB 4CM5A 2WDZA 1BHSA 3ZWVA 4KP7A 2PZMA 2Z5LA 3IUPA 4CUKA 4PG5A 3F5SA 3N74A 1AE1A 1U7TA 2VYND 3AUTA 3EMKA 4TSKA 5T8KA 1A27A 4NPCA 4KTVE 1CERA 3STHA 2BH9A 3HZZA 4B7CA 1GUZA 1YB1A 3IKVA 1QR6A 3JQFC 2GD1O 1N8KA 1QLHA 2JD2A 7ADHA 4B7UA 1XIVA 1YS4A 4Z0HO 5C7IO 1R0LA 1JAXA 5BNTA 3F4LA 3FNFA 1ZK0A 1NR1A 2Y1DA 1Z75A 4MINA 2IEBA 2R00A 1MXFA 4LMPA 1JWBB 4FDAA 3ZU3A 4BGUA 3U62A 5A1TA 2TMGA 3EVTA 1E7SA 1FDTA 3GNQA 1JWAB 4IGEA 5C3MA 4GH5A 4ND3A 3ROQA 3GOHA 1A7AA 2R2GA 4ZRMA 5G0VA 3WNVA 4CLHA 4D3FA 5TLSA 1SO8A 4RF5A 1EK5A 3D3WB 1UR5A 4O59O 2YHIA 1H6CA 3TOXA 1YDWA 4MVJA 4DQVA 1EK6A 3DONA 4YYZA 4ALLA 2O3SA 3W4JA 3W4KA 3QVTA 4GGOA 2E49A 3CMCO 1VJ1A 4HX5A 4IZHA 1R66A 3JQAB 1C0LA 1P44A 4KZPA 3KYDB 3NGXA 2P5UA 2B37A 1I0ZA 2QYTA 3PWKA 4JP3A 1XU7A 4K1LA 3OSUA 1NR7A 4UVEA 2CVOA 4ZVVA 1I3NA 1K6IA 4BIIA 4B3JA 1WWKA 4ZQHA 2BFPA 1PGNA 3JD2A 3GRKA 1KERA 1PJTA 4U6QA 1LSUA 1KOLA 3TZCA 3U4DA 3MCVA 3AW9A 3RUEA 2GERA 1Q7BA 2WJPA 2PZJA 1UXKA 4AJEA 5T8KC 3FR7A 4QFDA 1HDZA 1NVGA 1WVGA 2BFAA 2EG9A 4MP8A 4UAGA 2POQX 1EVZA 2GNAA 3O8QB 1XQ1A 1TB4A 1WW8A 1ADFA 5L3ZA 3CUKA 1UXIA 2C0CA 5I9LA 1DLJA 4BNJA 5T67A 1ID1A 3A06A 1HRDA 3ITDA 4XYEA 4N54A 3QSGA 4TZKA 4DYDA 2RAFA 3NUGA 1ZNQO 3MJSA 4OKIA 2BHLA 1V9LA 3D4NA 4ND5A 1H93A 3NT2A 4M55A 2PA3A 1GCUA 4QT0A 4ZRNA 3NTQA 3K96A 4YB8A 2V7PA 4W9NA 3G3EA 3RUIA 3NT4A 4YACA 5CPBA 2ZQYA 4EZBA 4YDRA 1PJ2A 4NI5A 1XCBA 3GEGA 4S3MA 1U8XX 4CL3A 4NDNE 4CM3A 3ONEA 4NBRA 4CV1A 3TFQA 1CEQA 1BWSA 4DQXA 2B35A 1UP4A 2FRDA 1C1DB 1GPDG 4A73A 1LC3A 3PHLA 2AQIA 3VPHA 2ZTMA 3NJ4A 5J23A 3ANLA 1PJBA 3WGIA 3A28A 2HMTA 2BLLA 5ILOA 3PQDA 1KEUA 2EF1A 3I52A 1GL3A 1V8BA 4WNIA 3S2FA 2GLXA 1B14A 5DULA 1U28A 3HB5X 4J7XA 1R37A 5LDHA 3R3JA 4CV2A 1BXGA 4CM8B 3PJDA 2HMVA 4FJ2A 3L9WA 1LBEA 5B4VA 1VKOA 2JFFA 2J5KA 2ZB8A 3WOHA 1HE4A 1BRMA 2OOSA 3QRWA 2JKVA 3SC4A 4DLLA 2BMAA 2EHDA 4XQEA 4OQYA 3TL2A 4TWRA 1F14A 3KUXA 2A92A 3LZ6A 3DC2A 1R6DA 2HRBA 1VC2A 3RVDA 4RZIA 1HTBA 3LQFA 1U3VA 3CE6A 4DMLA 3EVNA 1N9GA 1IB6A 5DBGA 1Y8QB 3QE3A 5JPIA 1M66A 4NBUA 3Q9UA 2CUKA 3RKRA 2I9PA 2VWGA 3TN7A 3AI1A 3OFSA 3Q1LA 3IAHA 5JMWA 4J49A 3A1NA 4NG5A 1H2HA 2PD6A 1GZ4A 3Q6IA 2CNBA 3HN2A 1OBFO 2IE0A 3KHUA 4WLOA 4QFCA 2CSUA 3PP8A 2JFGA 4RQUA 3PFFA 1QRRA 2C54A 4X54A 4B79A 4CM1A 4CODB 4CQMD 5G0SA 1C1DA 1PGOA 2PGLA 3K6JA 4ZQEA 2HJSA 1F8FA 3GEMA 2QRKA 3VVBA
chains in the Genus database with same CATH superfamily
4TM7A 2R8YA 3HXMA 2DHRA 4TRMA 4PBTA 2H06A 4FD2A 1CZRA 5IK2A 1QHIA 3HY6A 1QKIA 4W6ZA 2WM3A 5C0OE 5F5LA 4O4HA 3O74A 2XWSA 1PGPA 2AZMA 3DL7A 3TMYA 2GHQA 1XNHA 3FOCA 3U7JA 1UKZA 3VC2A 3K16A 3OZXA 2VSFA 4ID9A 5AKXA 5A0FA 3DJYA 1XNRB 2I3BA 1M2VB 3O8OA 3TKYA 1DAOA 3SLGA 1OXXK 4KFTA 4KR2A 4G4GA 5C31A 3UQYS 4YAKA 1X1RA 1U1IA 3UK6A 1DEXA 4QYWA 1BE6A 3HBAA 3HKEB 4IO1A 3HL4A 4MR8A 1XDUA 3B6MA 2IHKA 2PGJA 1YKSA 1NIPA 2VDKB 5DTIA 3PA6A 1MRNA 4YRSA 3GMDA 4OGFA 3UGKA 2D1YA 5CPFA 4ADSG 1V43A 4WUTA 4ES6A 1KVSA 4F84A 5HSGA 4P36A 2XDQB 2IRWA 3NPAA 1EXWA 2NVOA 2QN6A 4MGHA 2IS6A 2ZU6A 3CLUC 3HM2A 4Q1BA 1KIAA 1Y48E 1ZGBA 1JXQA 4EG8A 2O7RA 5BR4A 5SY9A 4GPZA 2W6NA 4FOSA 4N65A 2IIQA 3PX7A 5JAIA 3MRVA 2PQMA 3BXHA 3F7MA 2WKRA 5BY2A 1Q6YA 3GDOA 4A8PA 1RJFA 1V7ZA 1P4RA 2D4AA 4CL2A 3UUEA 1KI8A 4KXFB 3A6EA 1YZHA 2F7SA 4OYRA 3Q7EA 4DADA 4B4KA 5AM2A 4UMFA 1YIAA 4PSCA 3ND5A 1HT2E 4ZIRB 3AP2A 2WSIA 4D9IA 1YH3A 4DB4A 1SD2A 2LWIA 3I53A 2OD7A 3O3MB 4UUBA 3C6ZA 2IUYA 3GQBA 1KORA 1PO7A 3L0BA 4LQLA 2FZ5A 2H11A 4KWTA 1P9NA 1YFKA 4G0QA 4WI1A 4GO1A 5C2JB 3SZLA 1M8PA 3RUFA 3RU3A 4B3DA 2JARA 3VI4B 2BFDA 4FHCA 3EH2A 2XGGA 1MG5A 521PA 5CB4F 4UQLA 4HXYA 2WW8A 3O31A 4ZV9A 3TOVA 4WOKA 4LZJA 1UDXA 1VGRA 1WXDA 2FG6C 2ZSHA 3BKXA 4PLYA 4EW2A 5LNK1 1EESA 2MR5A 2BR4A 4DGQA 5AVZA 4JXZA 5FA6A 3O82A 4P86A 2V59A 3IVGA 3WB2A 1N7IA 1YE8A 4J6EA 4TKVB 4DLPA 4AG5A 2GJSA 2GNOA 4BNXA 2H65A 3GIDA 5KNLA 5KYTA 2F1RA 1HGXA 1MB2A 1MJHA 3D6AA 4IPTA 2M6KA 1XXHB 1Y42X 2AHOA 4UTXA 1JHRA 3BERA 5EE5B 5E95A 2BSQA 1LRKA 4RYDA 1DARA 3BMCA 4MPDA 3UAYA 4MYHA 4AIIA 4DQDA 2C7BA 1XTIA 3B6EA 4DQLA 2VHQA 5FYQA 3LW8A 4GMFA 1B00A 4KU4A 2DKFA 1K63A 4P3XA 3MUEA 4FYPA 4KQ2A 2AC4A 2GAOA 3CX4A 4GLFA 5BRNA 1O9GA 5SYAA 4B3XA 5AICA 4G24A 4F5YA 4LXGA 2VTDA 3RIEA 4ISCA 5J4LA 5JCXA 1DMRA 5M29A 4FB5A 2HCRA 4OXYA 3KR0A 1Y9JA 3KZKA 3PNSA 4JB8A 3U1VA 3SDBA 4AZ3B 1QIFA 3NT5A 3WL5A 3EPJA 1LB1B 1OA1A 2V7TA 5A0TA 1GL7A 2LXNA 4B6RA 1CD5A 5JFOA 1U7PA 1IXZA 1GQFA 2RI1A 4A0FA 1XZHA 2BEKA 1MC4A 4Y6PA 4BJ6A 5JZSA 2P9EA 4U2KA 2WMYA 1SBZA 5E6RA 2FMXA 3G9ZA 2QV7A 2QUJA 3E8XA 2C2BA 5ES3A 5FTWA 3OO1A 5KCMA 3A9CA 1LPBB 4YJDA 3T1NA 1FP4B 4MS3A 3UUWA 1GAJA 2NPFA 3E03A 3AW8A 3GROA 1MABA 2JFYA 1GKUB 4RPIA 1AZWA 4ND8B 1E3DA 1JI0A 2R7MA 2KBFA 4XD2A 3EQ7A 4YA6A 2VP2A 1QHHB 4KG7A 1PDVA 2QLMA 3KB1A 3ENKA 1R3DA 1II8B 2OPHA 3I9FA 3G6WA 3Q9NA 3MF4A 5GJWC 1NXWA 3D0OA 2B20A 3DWGA 1D1TA 1Z5OA 3IPLA 5EJAA 5CCEA 5IH7A 2NU8A 4RSGA 4O3FA 2EC5A 4ARUA 2IYUA 1KVTA 3GRUA 3WIVA 4RDCA 2VJAA 1THMA 4N7MA 5E1OA 4E7OA 2R751 3RS2A 1NXPA 4D3DA 3U13A 1CNMA 4ZICA 1V16B 3G0OA 4AS2A 3A2MA 2FZWA 3DCNA 2LPMA 3G6KA 3OHMA 1CV2A 4P33A 3V42A 4IFIA 4ZT3A 3T5PA 3ZJXA 1I8TA 2YUTA 1JSCA 1M72A 3HO8A 4TRNA 3SWWA 3OA0A 4OAQA 3KJNA 2QMUA 1JDNA 1LI4A 1FMJA 2A3NA 1VSQA 3II6X 4KVGA 3SXUB 1HYQA 2RHRA 1JXOA 1A96A 4LRXA 1P0IA 2GH1A 4H1TA 3LVRE 3THXA 1KO5A 3WAGA 2WK1A 3BMNB 1BMDA 3PUYA 4ESEA 1GGEA 2UZIR 1OC4A 1CF2O 1D2AA 3KTDA 1PV4A 1GYQA 1YHNA 4M9XA 3L77A 4IGKA 3WNCA 1NXVA 2JLWA 1S8NA 5JI2E 1GXSA 4GX0A 1SUCA 2IH5A 4D98A 2C1ZA 2RHHA 3CSDA 2QRZA 1H1LB 2J3IA 2YYZA 4LZAA 1DC3A 2ECKA 3KDSE 4PLHA 3SFVA 4RVDA 3OJ0A 2CF6A 5LUBA 1Z4MA 4ZYZA 5JZ9A 2B34A 5EPUA 4ZHSA 2PL9A 2RG7A 3RR2A 5KNCD 3IDZA 2DPXA 4WXHA 1W49A 2QT9A 3OCJA 5B1EA 1KMHB 4DA0A 5REQA 4EVQA 4GL4A 3L7NA 4AIRA 3KHTA 2JCXA 1W93A 3FNRA 5JASA 4OQ4A 4YREA 1PTKA 1SHKA 3NBXX 4TWZA 5EHXA 5BOVA 3BRSA 5BW4A 1PR1A 1MO3A 5AW8A 1ZN9A 4ZAZA 2FSVC 3CCBA 4HUTA 1GGHA 1USGA 4MKFA 1SN7A 3NX4A 4XEUA 3DMNA 2EX4A 3L8CA 5K1ZA 4OVKA 4YV0A 3EVDA 3C7TA 2C0PA 2G04A 3LT1A 2V7QD 2DHDA 2ODAA 3OOSA 4YJFB 4O2BA 3VUEA 2NU7B 3AB8A 5EPEA 4FP9A 4FFSA 5M04A 4Z2YA 3Q8LA 2HK9A 3V8NA 1CWUA 2QN1A 3HDTA 4HYYA 3E23A 2QU7A 1FUYB 3H9GA 3LV8A 4IOKA 3S6JA 3LFHA 4E5PA 2Z8ZA 1WVIA 3HR4A 3PVSA 2DGDA 3FBGA 1Q44A 4CF3A 3BB4A 2IH2A 1Q7RA 3PV0A 1YV9A 2AHRA 2ZEJA 5AW1A 1H6BA 4PLVA 5SICE 5K7SA 1BMFA 1V26A 4P81A 2NSDA 5H7XA 4NOKA 2QM3A 5DNDA 3UJDA 2QE6A 3V9AA 2C7PA 3DP9A 3LWDA 4GI1A 2CVPA 1PS8A 3CZ9A 4FZVA 4K40A 5EL0A 4BVAA 4RTKA 1F8XA 3FHJA 1YUBA 1XGKA 2CNOA 3EGEA 4M1TA 1ESNA 1JE0A 3TECE 4GKKB 2JAXA 3E05A 1GGMA 2XVAA 3R76A 4AXBA 4MVJG 4CJXA 5BW5A 2XOKD 4O4JF 5L95A 4BCCA 2ZBPA 1DINA 3BMQA 3FNEA 4LMRA 4ZCTA 2PU5A 2F00A 3E2PA 1OB5A 3AEYA 1DXQA 3F7OA 3PKIA 1T1RA 1KO1A 1DC5A 3RH0A 5HKAA 3ISJA 4D9CA 3N59A 2ORVA 4MV9A 1IPHA 2QW8A 4TTTS 3GZ4A 2J59A 1MQ9A 3N0XA 4L28A 4Y1EA 1EXDA 2L42A 4U1RA 4GPEA 5BNWA 4DREA 1N1EA 1AY0A 2IDKA 3UFXA 1JDJA 2CBXA 4L6CA 1GG8A 6YASA 5ILQA 4CQLA 4DUGA 2YIJA 2J7PD 2Q4RA 3V48A 2XUAA 3SYKA 1PHRA 1MGOA 3KBOA 2F9MA 3DE5X 4LNUA 1JB1A 4TTAA 3CWCA 4G0VA 1Z22A 4QEDA 3RSFA 4L8GA 2IXTA 4UMDA 3S99A 5KOYA 4UTRA 1RI5A 1QHFA 4QASA 5BSEA 2OFPA 4WHMA 3TI7A 3ANMA 1J9GA 2YWFA 3BX1A 3LK7A 2W0MA 2G28A 4UREA 5EUBA 5JFTA 3GLIB 2D74A 2WMDA 3PFWO 1GVNB 3IWCB 2ILVA 4IXWA 1ODFA 4P54A 5HG0A 4TL9A 3SR0A 3AF5A 2IU0A 4MW5A 2QJOA 1UBJS 3IBSA 2PUCA 3TM4A 1OI4A 4YS6A 1NV9A 3VJMA 2Q5IA 5EA2A 1PL6A 1IG0A 1QC5A 1JIXA 2D00A 3W1EA 5EJ9A 5T7BA 4KQ1A 5EIXA 4QUBA 1FK8A 3ZY3A 1KU0A 1P45A 2YHSA 4OEHA 2JA2A 4EECA 1YR8A 3CF4G 2W43A 1NWHA 2Q4EA 5GJVC 1J9EA 1R9JA 2X3FA 4IIUA 3T1QA 1IBRA 5LYJB 4ZEOA 3GLQA 1OROA 4PPFA 1E7MA 1ZNWA 1YI8A 2DWPA 2IXEA 4NFHA 4PSAA 4RD2A 1DOZA 1YWGO 1HQDA 3K32A 3A2KA 1L1QA 2WYIA 2PX8A 3OMLA 5DMHA 4XXHA 1AS2A 3GFRA 4PGMA 4JEUA 1KAGA 1WU7A 2ZK7A 1UBHS 1UPTA 3NH6A 5BT9A 5IMSA 3WLNA 3M3DA 5JYBA 4JUDX 1FSFA 2V9ZA 4OBBA 5AHOA 3TPZA 3O5AA 1YSCA 4Z7OB 3WWYA 3U3ZA 3EG9A 1KZ6A 3WSTA 1QQ7A 1KSHA 1Q7EA 1B7GO 1Z29A 2ID7A 2XEDA 2XV1A 2ZI9A 3QOYA 4HUQB 4J1QA 4UUNA 3T1HB 3ENNA 2HN9A 3A37A 4RZQA 2ZRJA 2GCEA 1GRCA 3L93A 4JCOA 4Q1DA 1I5RA 2R2AA 3LZCA 4CM4B 4QDTA 4M0DA 4EFNA 2Q62A 1QR2A 5I8PA 5KOHA 4DSNA 1V6CA 1Y7LA 3BRCA 1YRBA 5AI9A 3OJXA 3GXOA 1LWOA 5HIJA 3HG7A 3ED5A 2C7RA 4ITVA 4TYQA 4FJ1A 4YRAA 5TDHA 4OQXA 1EX1A 1AX9A 2Q3DA 2CE7A 3C15C 3WYDA 4E94A 4RUKA 1OZ0A 2WF9A 3UMRA 5KWJA 3CJQA 5ALGA 1EUQA 4HB4A 1FU7A 2G5PA 1GTSA 2F62A 4ALJA 5T4HA 1Q21A 2H3HA 5LA6F 2ZYDA 4U7HA 1R5JA 3JZFA 2EJVA 1U1DA 3KJHA 1J09A 5IBRA 4KPEC 4O25A 1LPMA 2DG2A 1Z0ZA 4LA4A 2VDPB 2GPYA 4RJJA 1LFDB 3LFTA 2XLBA 1T5LA 2JAHA 3ELYA 3VH4A 4EHHA 4JYAB 3ZOZA 1GAEO 2G72A 4EPXA 5LZ5A 1BX1A 3FWHA 4QVGA 1UEIA 2ZJ3A 3PEVA 4PG4A 1W6UA 5H3CA 3EEIA 1ZI6A 1K4KA 1I1NA 1G5TA 2PWAA 4ARAA 4LNHA 1ZA1A 1XR3A 3OQHA 3D8TA 1T9GR 4OP2A 2P0EA 3ADDA 5FI5A 4RTMA 2CB9A 3D6JA 4O2AB 4Y9SA 3U3RA 4PM4A 2CVFA 3L5KA 3UWOA 3JATB 4MLCA 1MOSA 2ERCA 2PZLA 4HVTA 5J2TA 3R3XA 4OJNA 3V2HA 3SICE 4UNNA 4PXSA 1JALA 2VDWB 1IYZA 5FTNA 2G5GX 1K7XB 4QGBA 3S2SA 1V3UA 2IPLA 4BTVA 1XCJA 2ZW9A 3QMMA 4DHEA 4EGQA 1PQYA 2APJA 2G09A 2PZKA 4TVKA 4E33A 1DBPA 1TO2E 2GHRA 1U1EA 1YQTA 1GY8A 2G1JA 2HK8A 2EEPA 1WVMA 2QP4A 1GUDA 3NIDB 1JJ7A 4H6VA 4DUZB 4DR6B 2A88A 1DTEA 2IOQA 2IYYA 3VPBA 2E1PA 1P75A 2PTGA 3GLUA 3JU3A 3DT9A 2AYXA 2ODBA 4LWZA 3LOUA 1VKHA 3TZBA 3CNNA 3MT7A 2OR3A 5A4KA 5AXCA 3K9LA 2CN1A 3SX0A 3LE8A 4KX5A 1FZQA 5AW0A 4WNAA 2FNAA 2IY8A 1VPTA 3KOOA 1YZKA 2QW1A 3AONB 3DEZA 4KLRA 2O8FB 2DCUA 2DWCA 1BC5A 3OEYA 2DH6A 1ESEA 1W1WA 4IOJA 3ZHZA 3AUJB 4OHUA 1Z62A 1OYOA 3WISA 5F2EA 1OKKA 3DVLA 4PN7A 2G1AA 3WIOA 1FY2A 4CXMA 1C9DB 5FWXA 5JNSA 4CG3A 4DBZA 1VP9A 2X9LA 3RU2A 1KIFA 1YR6A 1R5BA 5EWLB 3VZSA 4ARZA 1PD0A 1RW4A 5I7OA 3E27A 5LXTB 3MFQA 1XKTA 1WO8A 4B3SB 3R5JA 3G49A 1W46A 4ZVOA 1HZZA 4BE7B 1L1FA 4S24A 2Q07A 4KUEA 1K9SA 3GJSA 4XVRA 5F78A 1CY7A 2QG9A 3K4QA 4BFYA 2PWBA 4YMGA 2PUHA 3AKZA 5D00A 1IEXA 1Z7EA 2CZGA 4L3VA 3ZK8A 2PUAA 2Z6VA 5TEVA 1X9GA 3Q8MA 1CT9A 3MC1A 4OXRA 4TT3A 3V46A 5FULA 4AB1A 4MW9A 1RRKA 1E1CB 1Z0FA 1ZKMA 3GVXA 5E7MA 1O54A 3WL4A 5LQJA 4YN3A 1C9YA 3H16A 3OLZA 3OU2A 3TSOA 4D4IA 4GP6A 5FTMA 5LQCA 1L7DA 2E7ZA 1X1AA 2AG1A 2IITA 5FF9A 4GAEA 3K20A 4BVFA 1EM6A 1EYZA 1JG2A 4CCWA 1E7YA 2XKBA 4CI9A 2R7NA 1VHTA 2OFOA 1UPCA 3QA9A 5DV9A 3TSAA 1TTTA 3ZDDA 4EGFA 2NM0A 2VPYA 3MJVA 2P4SA 3KE8A 1SXHA 1F2TA 4AUKA 1KJNA 4DMRA 5BN3A 5JMPA 3T3OA 4KMMA 3CB2A 2CJFA 4M21A 2PU7A 5BYKA 1PVOA 3IQEA 1MC1A 4CT4B 721PA 3ZXSA 4CKYA 2W0SA 4PG8A 2IGTA 3OX1A 3UG7A 4HNUA 4H4CA 1GNPA 2P2DA 3ETDA 5D3QA 1ORVA 3L9XA 4DRXA 5BVGB 3GA0A 1Z0KA 4J0EA 2XY4A 4TV8A 3X2EA 4BTEA 4TS3A 3A6ZA 2VJQA 4DC0A 2D3TA 3KD2A 1VE5A 2QL9A 4BEJA 3CKYA 1KEEB 1VRVA 1Z4NA 3E9QA 4Q9AA 2MHCA 1JFVA 1I2ZA 1ZCBA 4Y2JA 1EQAA 1JENB 1QXSA 1OXSC 2VPPA 3EP3B 3FYHA 2ID9A 1VPDA 2B82A 1KDOA 3WKAA 3FYDA 3HEAA 3DKPA 4KOEC 2QD5A 1E3MA 4LCJA 2VK8A 3R7AA 2EFGA 3OP4A 2RGUA 5T3YA 5AJXA 1IN4A 2FVYA 2JHPA 2SECE 3HJFA 2OP1A 4W1RA 5IKMA 1RC0A 1SVNA 3ORFA 3E9YA 3ZC3A 4ER0A 1TEVA 1UH5A 3GPCA 3H5VA 4MW1A 4QUEA 1V5IA 3LKZA 2II6A 4L4UA 1FZTA 3WHKA 2PFSA 4OGKA 2AIRA 3CINA 3UKJA 1BD4A 3DTTA 4DW8A 3A6JA 3SP1A 1MEOA 5KBYA 3EPHA 2YVKA 4N03A 2QWXA 3K70D 2A5DA 4AVYA 3ZVNA 3C48A 3T7DA 4UHCA 3KL4A 1U9CA 1N5LA 1L5LA 5SZHB 2JB9A 3FNGA 3NGLA 2Q1YA 3A3KA 4HVAA 1XAIA 4JKYA 5EMLA 1YVEI 2C2XA 3U40A 4YUAA 4R2JA 1Y9EA 1E7RA 2HQOA 3IWBB 1A8SA 2ZSAA 4GP9A 4N6OA 3Q7SA 2XA9A 4HBGA 4HWOA 1E5VA 3VX4A 3D59A 1ENZA 4WFQA 4ZDKA 3WTBA 3MGGA 2XTJA 4HQNA 1Z35A 5COQA 1JSXA 3LWZA 3RABA 3DTYA 1I01A 2C8LA 1XEWY 4W5HA 4KZKA 4NHEA 3TR0A 1QP4A 3HK2A 1NYLA 4MYRA 2XB4A 4F6LA 3DKVA 3SC2A 2WJ4A 1WKBA 1R0KA 2RHMA 3V2GA 2QTWB 1ECGA 1TA9A 4J16A 3PDHA 2RBGA 4LRTB 1NR5A 5CFLA 1VJTA 3S1AA 2CLKB 3OLXA 4W5WA 3C87A 3K70C 2ASVA 4B4DA 3ICPA 2GBCA 4NONA 1G5QA 4C6TA 2UZ3A 4IMPA 1P1FA 3IP5A 5CB0A 3HEMA 3P9XA 4F38A 1RWQA 4IKPA 1RLTA 3OCUA 3T38A 1WKCA 2PMFA 3DTVD 3LQYA 4QJBA 3F46A 4XASA 5IJZA 3HNRA 2PKEA 3M4YA 1TC1A 2EERA 5CT9A 4U7FA 3J7AC 2YWJA 1Z07A 3HSSA 2NSLA 5HKOA 2C4KA 5LBTA 4P22A 4ED9A 4FJ0A 2X1LA 3DAHA 1FX0B 1ZM4A 2EJTA 5JXGA 2GPAA 1FIUA 5GONB 5L45A 3GMTA 3C7CB 3QLUA 4HPJB 5KX5F 1SEVA 5GM1A 4QYIA 3USZA 1UK9A 2NAPA 1U9ZA 2MMCA 3A1CA 3EODA 4LS3A 1R27A 1ZPDA 3O8CA 1YBMA 2EW8A 2PH1A 1B0PA 3P7MA 3AM4A 1SY7A 1C7RA 2R8RA 4OMFG 4WXEA 1E3IA 3NHJA 4YMLA 3QOWA 5F21A 4BVHA 1TKCA 2VH1A 1Q0HA 3GW8A 4OBWA 4H0FA 4IWYA 4DRYA 1A5SB 1UMKA 3AFOA 2AUTA 2F9FA 1KAQA 2ZI3A 1NSYA 1XQWA 3KV3O 1BXKA 2V1XA 5ALOA 3SOZA 2PUFA 3DDNA 3ZGNA 1UAYA 3DMGA 4KYUA 1XELA 1HDRA 2RBEA 1JSLA 3GBPA 1JIIA 2ZAMA 3LUJA 3QVKA 3IP9A 3SBXA 1X1QA 3W7BA 4P8RA 2IXDA 5C1IA 1L4YA 1YFZA 5JNWA 3C74A 3NAMA 4QICA 3X3HA 3CX8A 1KEZA 2ZJ7A 3K0AB 4KE9A 4Q47A 3SYTA 4BXOA 1A9QA 1IAQA 3KT8A 1WABA 3OPXA 3GZTB 3GFQA 1FS6A 3HA3A 2HFJA 2WHRA 3EXG1 3PITA 4FFRA 1UMCB 3RYCA 1PYOA 4QOSA 4H1WA 3WSVA 1C50A 3T94A 1AQJA 2H0RA 1Y5RA 3N6RA 4RJIA 1GKIA 4NCHA 5UKDA 2A9PA 4JI2B 5K3AA 1ADYA 3LUGA 5K2OA 1ONSA 3DOFA 2RGXA 3ESRA 1XRNA 2PO7A 5CXSA 1PTJC 2OUKA 4CR8A 1FFXA 2RHOA 5ILGA 2Y9PB 1BGVA 5MGBA 3QEAZ 2RGDA 2PNJA 2R96A 3V7UA 4UULA 1G4AE 2P5TB 5AK5A 3ZNPA 1U9IC 2NXJA 3UXHA 1T26A 4JK3A 3TV1A 1ILWA 2C59A 2AGVA 1P5RA 1U81A 4I19A 3L6OO 1TK9A 3F2IA 4BFUA 3UA3A 4KRFA 1OJ7A 3REOA 1L8OA 1NT2A 2QN2A 2VF7A 2V6MA 2REOA 3BF7A 4RF4A 1E58A 2ZT7A 2D1FA 1NU8A 3CUVA 1CETA 2ST1A 3Q6NA 4OB8A 3RBVA 2QX8A 2R1TA 1OD6A 4FTWA 2HO5A 4HYEA 4EG4A 3KLMX 1CK4A 2C7GA 4D45A 1NRXA 5LP6A 3FYSA 3PQVA 2J3JA 3AZPA 2PUVA 5IKXA 1H22A 2PS3A 3D8RA 1Z17A 3QPVA 2MINB 2PA0A 4KFUA 1BCRA 3A4NA 3PENA 3AG5A 2VP9A 2AN3A 4K6CA 3INNA 2HYIC 3G0HA 3PPIA 3G9UA 1EE2A 3CRW1 1MHPA 1CUXA 4JI1B 1SUDA 2GVDC 2BSXA 2WVAA 2ZJBA 4LWOA 2A8YA 3VR5A 4MSUA 4CKEB 4IV0A 4J9VA 1ZG3A 1M1XB 2I78A 2RGCA 4L8FA 1GJRA 4XRRA 3E0XA 2VN8A 3FPLA 4B6OA 4IDPA 5EEGA 2UZ1B 2JIZA 2X8BA 4CNBA 3KC2A 4B6PA 5FOQA 2Q5EA 1E9DA 1T5DX 1J9ZA 1M0WA 4IHJB 2HZ7A 2BKAA 4HSGA 3VSDA 5C4IA 4EL0A 2WMNB 4BPBA 3R7WA 3V1MA 2ZG6A 2PEYA 2VSQA 4B46A 5DN6D 1JKJA 1NBMA 4M99A 2VH2A 5JNRA 1LI5A 3VGJA 5MFZA 3EEOA 3JZIA 1ZRMA 8ABPA 2P1ZA 3SJCA 5KJ1A 1FFEA 3FAZA 5BSGA 1KMHA 4NBWA 2OV8A 4JASB 1CHDA 1TYZA 2PHZA 3WLEA 5I4BA 4GPD1 5REQB 2VDRB 3CN9A 2J0QA 3RWBA 1E8NA 1O95D 1WF6A 2WU8A 3GVHA 1DNPA 4MTLA 3FWZA 5AK6A 2QSYA 3PRKE 3GLKA 4QUGA 2WHXA 2YIVX 2KLHA 1TJ4A 3PLRA 4LGCA 2BGKA 3ZWPA 3VDNB 3KKKA 1UDCA 2ZAIA 4GM0A 4I0WB 5CM8B 2VWQA 1EFVB 3WLHA 4BLQA 3OZAA 2IPAB 1Y8CA 4J3FA 4TKLA 1ZXLA 1VBFA 4ZJZA 4YJKA 3D0RA 2ZRNA 4X8LA 3BGDA 5U4QA 2WNIA 4GKAA 3RF7A 4HAYA 3OQIB 2CXNA 4G1FA 4L75A 1A1VA 4BZPA 3KUCA 3DFZA 4W7IA 2QKYA 2XODA 5EZYF 1V1MA 2HQBA 5LZ2A 3V8VA 4DWJA 1AF7A 2FSFA 2EGGA 3GYGA 3PL5A 4KIWA 4NDZA 1J8FA 4QDZA 5E4YA 2QUBA 1J4AA 2ZUFA 5AKKA 4EABA 1X9IA 4WCDA 4M3NA 4D4MA 1AKMA 1WU8A 4G09A 1UOEA 4GOXA 3VYRB 4ARBA 3DBLA 4IKOA 1EP3B 2OEPA 3WBBA 2MSLA 2XBLA 4ZDWA 3QY9A 2H29A 1P4HA 4LF9B 3VHRA 1G2OA 5AKIA 3FA2A 3IP1A 1V2HE 2GN6A 2RH4A 2XI4A 3KZMA 4H1UA 2NTYC 5D7BA 1JPNA 5EWLA 4ARZB 4EA6A 3JQGA 5FPSA 3UAGA 3EZ2A 4L6IA 3RK4A 3W8EA 3DMFA 1PSDA 1FXWA 5GOZA 5L4NA 2OYRA 2C97A 2IQIA 1EJ6A 1JQJC 5E3JA 4PAGA 1TECE 1NQAO 2HJWA 3LI2A 2Q5HA 3JYQA 4ZP1A 3QPDA 5A04A 2DHEA 4A0HA 1RQ7A 2IYQA 3C1UA 3LT5A 4Y2QA 4BMZA 3AQIA 1UEXC 2GEKA 3TW0A 4E2WA 1O94D 3HV0A 4F3RA 5H9VA 4I3FA 821PA 4BO8A 3JASB 4YLGA 4KNYA 3H2GA 3LXXA 4L5CA 3T6KA 5K8CA 1H4TA 4RTJA 3JQEA 1BJKA 4I50F 3ZD6A 3T3GA 1ENPA 2P9GA 3GJ3A 3RTAA 4HLNA 1UC8A 3A8TA 3WYBA 3LUFA 2HREA 1ZUNB 3M5PA 5LXTF 4X91A 3ELWA 1Z0IA 4DG9A 4HFJA 2OV2A 3OT5A 5EG5A 5LA6A 4D2IA 3NH9A 3DJFA 3RYFB 3RFVA 5BQPA 4ARIA 4DSUA 1O6CA 1JG6A 1R00A 4DNXA 4YUYA 4OB6A 5F3DA 2I6GA 5SZKB 5K0LA 4L2IB 4F3YA 1V8OA 5DT2A 4PLTA 3WGZA 1N2CA 1P81A 5JE8A 1YS9A 1DGQA 2VZLA 5THKA 1A95A 3MB8A 3W8NA 4MH0R 2R6AA 4GYWA 4MKIA 2HA3A 1JHDA 2ZPTX 3MIIA 2H4WA 4NU5A 5I9MA 3K9BA 4AJOA 4CF5A 1BXZA 4DA9A 1NVWQ 1P2FA 1TVKB 2XRMA 4ZK6A 5JJ5A 1IDN1 1PZEA 4ZOLF 3OZEA 2NP7A 1MO6A 3L82B 4DRZA 1QJ4A 1RWMA 1IN7A 3MD9A 3FETA 3ICCA 1H23A 1ORDA 1Z25A 2E4XA 2BZ0A 3FF4A 3PVZA 1NPTO 2ZUTA 5CBKA 3CYFA 4WZAA 2E4ZA 1E2UA 4MCIA 2WI8A 4C0JA 2H0AA 4QUJA 2PV0A 1DJNA 1M73E 3THOA 5HRCA 1F9AA 2VDVE 2ZBEA 3MJ4A 4EUKA 3BAZA 2SNIE 5FL3A 4RF2A 1VCHA 4YIKA 3UPUA 5C7OO 2JBAB 1WCIA 4II2A 4NMLA 3GARA 1SMKA 2DFKB 4Q7LA 5HZKA 4LZWA 2GK4A 4C0LA 1IXRC 5KNDA 1CS0A 2NQ2C 3BCRA 5TVOB 2O9JA 1CUUA 3JTMA 3DKRA 4ZT2A 2QSZA 3HPQA 1YZVA 4NYJR 1GZHB 2RG1A 5BN5B 3RJTA 3C14C 1RKBA 5JO9A 3ZQ6A 1PFUA 3W2TA 3ZZNA 1FS5A 2FZEA 4UBJA 2GGSA 2VJBA 3QJ5A 4EKEA 3HCWA 1HYGA 3WO1A 5DW3A 1HQCA 1Q14A 2IZ1A 3FRJA 1M6VA 5I8WA 4LYAA 4ZRDA 1KJ8A 3P0RA 2ZXEA 2AI2A 1TFRA 5FFMA 4BQSA 2B1GA 1T4DA 1JHOA 3AI7A 1G2IA 3QBVA 5JSHA 2V55B 2W2MA 3VR5D 3NWPA 1EA7A 3CXUA 3CLHA 4LTNA 3M2PA 2X42A 1A5ZA 1U0TA 2N47A 2WWTA 2HBZA 3DB1A 4G1VA 2VJOA 3USES 4DV5B 2XAAA 4R1NA 1Y80A 2VNIA 3V1TC 4DAOA 1PDOA 4WASA 4TRJA 3KKPA 3KT0A 2XE4A 1AGRA 3KPUA 1H94A 1P3Y1 2QQEA 1N3YA 3UOWA 1Z3CA 4AJIA 3UBMA 2ZYWX 4JLWA 4ZVMA 2XCLA 3WK6A 5D01A 3DKKA 4ND2A 2ZQ5A 3RRYA 4UNPA 4MIYA 3HDQA 5JVDB 3S7ZA 3RU9A 1A4UA 3WI7A 4NJOA 5AQEA 1NUHA 1SQ5A 4K26A 3PEWA 3LMKA 5CDYA 4PHFA 1HEUA 4LJ5A 3T7CA 5LYYA 1ZK1A 3QWIA 3VAYA 2RGGA 5GWXA 2XF8A 4DGSA 3MNFA 4CEJA 3O9MA 2ZUDA 3SHOA 3K73O 1C9JA 2CB0A 1JNXX 1U02A 3NKVA 4D9KA 5CG2A 1NN0A 1RKVA 1QRTA 4DLTA 2X7JA 1U4SA 1KHHA 3WWZA 5JQWA 1K88A 3NANA 4ZYWA 4U7PB 2CYBA 2DKOA 5ALDA 3LLSA 4NOMA 5HWSA 4WRRA 1KI9A 2V96A 2HU8A 2XE6A 3HRKA 4OK6A 2IEGA 1JDBB 1TJ3A 1P4AA 1QMHA 4Q7MB 4C0AC 5A9SA 3G79A 3H4MA 3C6XA 3REQB 1Q15A 5A6SA 2JL1A 1R0RE 2R48A 2SICE 2Q6IA 5EKSA 5C35A 1OIWA 5KO2A 2JLAA 4LZZA 3FTFA 4Q9IA 2R00C 2X86A 3RVRA 3KKNA 1ZD4A 3E81A 1THZA 2C03A 3U0BA 1N2ZA 4Q9DA 1N2JA 3HR8A 4Y2VA 5TPWA 4KR7A 2B4QA 1U3UA 2ZROA 2QB5A 2HYDA 5AW5A 5H9WA 5HIIA 3UT0A 5JHHB 1BW9B 3AHGA 3K2QA 4IIGA 4DF3A 4F9TA 3SQWA 2PLFA 4C05A 2ZYIA 3I6IA 1KKLA 2ONZA 1C14A 3E3OA 2R1UA 4GNRA 3UZUA 4IOMA 4EQ6B 1SCJA 3EAFA 4XFDA 4KPUB 1QYRA 3GQBB 4UCQA 4TOIA 4JVOA 4S0ZA 2O1XA 3P0EA 3HWX1 4GPBA 3AHIA 2HA5A 1GCGA 2ODEA 3DO6A 1QGUB 2HMUA 4C4RA 2EL9A 4PC7A 2V0CA 4JBHA 4G97A 4Q9NA 4R9UC 1LLCA 3PBKA 4MUJA 4PAMA 5CJJA 3DBRB 3WQHA 1LBSA 7AT1A 1HYEA 4EHLA 2ORED 4GVXA 4H3KB 4B4WA 4OXKA 4E03A 4A0RA 3L0ZA 3PXCX 4KNVA 3QX7A 1CUAA 1NJGA 5DHPA 1BXRB 2VUHB 2O2GA 3P0HA 4KBFA 4WFJA 3IEXA 4G4SP 5CLQA 5G3ZA 1ZNZA 2IHYA 2QUZA 4I99A 2BMDA 4WA8A 5HMMA 4GD3Q 1I7PA 5FPKA 4JJ8A 2ACWA 3QVLA 3GPDG 3LC0A 4HLDA 3OIGA 5KAMA 1CJBA 4Q05A 2PRKA 1F2DA 2V6JA 3EUFA 3GJRA 3IAM1 1UWKA 1Z5NA 2BHRA 3G89A 2PSDA 4FLFA 1MORA 1XZGA 1K7CA 1OBVA 3GQVA 1PR0A 2REQB 1YO6A 1KSGA 5I7SA 3U7RA 2YASA 5J1TB 1JEJA 1ZK2A 2CUZA 2GJAA 3IUEA 5BW6B 1V48A 5DZSA 1PFGA 1TJNA 3ITKA 1XZ8A 3N07A 3UWDA 1YVDA 3BF8A 3L8EA 4IQ4A 4X5OA 1W9MA 1SCDA 4KWHA 2OP0A 1XALA 1NU6A 4GI2A 5CIQA 3ZY5A 1FRFS 2IXFA 3GIWA 4MDEA 1U8FO 4YNBA 3IC5A 4ZU3A 1CB0A 1CUZA 3R1IA 4H7IA 3SEZA 3ZLVA 2DXIA 3KQQA 1KI6B 4BECA 2D2EA 3L0SA 2C88A 3GJXC 2MYNA 3HUEA 5F64A 1O6GA 1T35A 2J09A 4RK7A 3GJ6A 3IT2A 1GZ3A 1HBJA 3H0EA 2GN9A 3BSWA 1JIQA 4PSVA 3JPWA 1CRPA 2Y27A 3MUOA 3TQOA 1WRBA 3W06A 2J30A 2OO5C 3H6KA 1M2KA 3RRMA 3TNDA 3UENA 3CKMA 3FN4A 2XMSA 1KYVA 1T3SA 4OKNA 1TM5E 4HJRA 2AWNA 2XWJI 1A77A 1KEWA 1OTHA 4IFBA 1WPXA 3VVCA 2B83A 2RI0A 3L79A 3G2IA 5IASA 1AMOA 3W2HA 5H59A 4MQFB 4RANA 3AJAA 4WKBA 4I55B 4DEVA 5IVPA 4WA7A 1Q1NA 1XQ9A 3UW3A 1UBOS 5A5FA 3I4CA 4POOA 3PC3A 3SY8A 3WLTA 1XAHA 2DH5A 2JC3A 5C4GB 4I55A 4QWWA 2Z5VA 1BJTA 2GRAA 3ED1A 3FLEA 4LMAA 3BCHA 4U7TB 2BKLA 1XMVA 3JQ9C 2YIDA 1CZKA 4U2GA 3CJRA 4UVIA 1HYHA 3IDQA 121PA 2J3MA 4M83A 4QUAA 3S2GA 2DHCA 3BGSA 4GI3A 1CVRA 4DY6A 2RDMA 5ERXA 3AEUB 3CUTA 5DO9A 5F5NA 2ZJ8A 4MKZA 1P0FA 3D8BA 1K86A 3EZXA 3PCTA 4IXTA 4LOKA 4TMFA 3RRBA 1GGNA 1ZR2A 3PXUA 1KI7A 4ZXPA 5EVJA 4AYXA 4HEA6 4KQWA 1WQ4A 4IHJF 3WK4A 2ZBUA 1EZ1A 1Q7TA 1KQPA 1US8B 4H7JA 5DCLA 2O8BA 3PZRA 3K1YA 4BDTA 1Q0TA 4EG6A 1E3JA 2GEJA 1U3FA 1FMCA 3SYMA 3AHHA 1RQXA 3H86A 3PC4A 4CKWB 1RNLA 2BEWB 1QANA 2X58A 1ZXXA 3NUZA 1T9BA 4XVHA 4YLEA 4CEIB 3CLSD 1V5GA 3NRCA 2WTNA 5J58A 1TT5B 2ZR8A 4BGVA 2GN8A 1PGQA 3VA7A 4I5IA 4J4BA 2ZPUA 2RKBA 1MV5A 1WCV1 3L8HA 3Q11A 1WLSA 2H4FA 1M1UA 3PUKA 1RJDA 2VDJA 3I1JA 2A4KA 2NU9B 3HFSA 2YXEA 3G0BA 1AGXA 3H5OA 2EZUA 1PBNA 2ZT6A 3MTDA 4MWCA 4JEIA 4DM3A 5JS6A 1JDPA 1S01A 5K3FA 5ERGB 3UFXB 3TEJA 1AVTA 1NDQA 1U9YA 2DMRA 3FYUC 3I2KA 1P7CA 4H6PA 3RVJA 3WZLA 4EG5A 5EIFA 5CD9A 1L1EA 3VNUA 3GFGA 3MM4A 5DNWA 1YONA 4JEHA 2QM8A 3QKSA 4YQZA 3TOZA 5H3LA 1M2HA 4LNUB 2OBYA 3F71A 4KI0A 5T57A 1KSFX 3LK6A 4PHTA 4FIDA 2XOXA 3OIFA 1BX3A 1K6XA 1YQDA 3KJQA 5HBGA 3NZEA 4HNGA 4HWKA 2PKWA 4GU5A 1Z2OX 1O5TA 2G0AA 4I5GA 3SC6A 1L7VC 5DIZA 1WNTA 4ZZ1A 2FW0A 2YVUA 3LNTA 4MUHA 3FM9A 3HI6A 3S8YA 2OK8A 2FEPA 2P2CA 3CMMA 1KK3A 3KOYA 3ZJYA 4B76A 3MINA 1M8KA 1WUHS 3USCS 1CNFA 3P9RA 4DA6A 3RC9A 2QRLA 4TUYA 4U0KA 1CJVC 1J42A 3M5CA 1Q74A 1D6MA 3VKHA 4C1NA 5DASA 1VLLA 2G25A 3QPWA 2H2IA 5LOVF 4O5AA 3ZCXA 3M2TA 4MV6A 5DBFA 1D4AA 1DP4A 2Y76A 3UUGA 1Z6XA 3IBFA 1BCSA 3LF1A 4FNAA 4R8RA 1E3QA 3CY6A 4PS0A 4GHWA 4I4TF 3GELA 3VHXB 3X1XA 2JGKA 3NBZC 1JEAA 3G2OA 5LYJA 3B6IA 5C5EA 1U2PA 4K03A 4O4IA 5F2NA 1Q6ZA 1D8TA 4L9SA 5DNCA 2UV8A 4MS4A 1JJIA 1XV5A 4R51A 4XQ9A 2QAGC 2BMFA 2PGNA 2OWEA 3PD7A 4QAJA 1FJHA 4C4OA 1BE8A 4PVDA 2IYXA 1UJ2A 1CVLA 3DOIA 1T5HX 1WDWB 4KAAA 1ACMA 1XNGA 3RE1A 3VR6A 4MI1A 5JSQA 1S2IA 2PRZA 4NMHA 2AQKA 1VBMA 4BASA 4JC8A 4D0RA 3DS8A 4PPNA 4RK4A 5C1OA 3NXKA 3GRAA 4WDQA 1EQUA 4BQEA 5IN5A 3BZUA 5FCDA 2GN4A 5D85A 3I37X 2DBRA 2YJZA 2AW5A 3D6UA 4LOHA 1BD3A 1O95A 1RPAA 3BRWD 3JWJA 3RKUA 2JF0A 2V45A 5JH7B 3LUCA 1FFXB 5G1OA 2MCFA 4AZ0B 4W5QA 3KZOA 2C4HA 2IE8A 4DMFA 4K9MA 4XH9B 2FR0A 1U3CA 2WWXA 2ONJA 5C1BA 2J48A 1AXGA 3H13A 4KE8A 1ZMTA 1VYUA 5KX5B 2B5VA 4GQBA 4RORA 2NO4A 3GAFA 3OEHA 4CLRA 2ZCJA 1YZGA