1EVJA

Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
340
Chain Sequence
RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a truncated mutant of glucose-fructose oxidoreductase shows that an N-terminal arm controls tetramer formation.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 116
structure length 340
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1evjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evjA01
3QWIA 4FOOA 1LDBA 4E0BA 4CV0A 3I9LA 1Y8QB 4DGSA 4BQPA 1NFQA 1GPDG 4HKTA 1NVGA 2NWQA 1I3NA 5EIOA 3WGQA 4NFYA 1A9ZA 4BNIA 3EMKA 2HMVA 3VVCA 1ML3A 4YJGB 2VTDA 2FWMX 3INTA 4GMFA 1Y8RB 1D8AA 2I99A 1C1DA 5KJEA 1LSSA 1UXHA 1NPYA 3ZGYA 2AE1A 1YVEI 3NT2A 4GMGA 2C07A 4CM3A 1LDGA 1SBYA 1GR0A 1X1TA 2FPIA 4GLOA 4IS2A 1E1KA 4GAEA 3GGPA 5ILOA 1E3IA 1B2LA 1UDBA 2B5WA 3IQDB 5JPIA 3NUGA 3B70A 1YQGA 5H81A 4ZQHA 3NDJA 1PEDA 4CQLA 1PSDA 3M1LA 3GG9A 2NLOA 4I9UA 5DNAA 1DJNA 1PJLA 4PLWA 1U4OA 4CLRB 5JCJD 4NI5A 1C1DB 4WNCA 3JQ9A 4HY3A 2WD7A 4YRBA 5TQVA 1B16A 3PJGA 1GFSA 4ALJA 4MIYA 2GASA 1HE5A 1HDXA 1PTJA 1O89A 3OA2A 3ROQA 1U3WA 4CUZA 3DBHB 3WYBA 3WXBA 2Q4EA 4W9NA 2JFHA 4Y6RA 4XQEA 1DC4A 4A26A 5IF3A 2Y1CA 4NDNE 4EBFA 2I67A 1ENPA 5KIAA 3ADOA 3GH3A 5B37A 1N92A 4TWRA 1P44A 4K6FA 4PVCA 4E12A 2GNAA 1P9LA 4TQGA 3JYQA 3EC7A 5L4NA 3RIHA 1F14A 1CF2O 3LZ6A 5T57A 4H15A 3GNSA 4MVJF 1I2BA 2RAFA 1KEPA 2VWHA 5BNIA 5K6AC 3JQ8B 2NVBA 1GYPA 4DXHA 3CZRA 1MGOA 4MP3A 2GPTA 3QWHA 3ZV6A 2C0CA 4RGBA 1MG5A 4M1QA 1XELA 1ONPA 1ONOA 4EEZA 5ICSA 2D4AA 3PTZA 4E5MA 4GWKA 2X6TA 2VHVA 1PZEA 4UULA 3TRIA 2YW9A 2V65A 3RC7A 2YY7A 4ILKA 3QSGA 1I2CA 2ZATA 5BNFA 4L4XA 3WBFA 4LN1A 1MFPA 2ZTUA 1AXEA 1FDUA 2Z95A 1HSZA 3GMDA 3DBVO 1VSUA 4UUMA 3DR3A 4DLBA 4CV2A 4K1LA 5KCZA 1PJBA 4QECA 4INAA 3Q11A 3GC6A 3JQGB 5ER6A 2YV2A 1T2EA 3RFTA 3RUAA 4WECA 3RUEA 3VC7A 3WYEA 1AUPA 3BMQA 4DIOA 1Q0QA 1HDRA 3LQFA 4B7CA 4FGSA 3E6AA 2GCGA 1P31A 4MVJI 2BGMA 5ICMA 4IINA 4BOYA 1BXKA 1KIFA 3WFJA 1KVSA 1Q0LA 3T7CA 3VZSA 3EAGA 1EFLA 1XR3A 4W7HA 5KOIA 2O3RA 4IDCA 4MP8A 1GCUA 2Y1EA 5HS4A 4YBZA 3A06A 1Z82A 3MWDB 3OA0A 4CUKA 1XGKA 2X1HA 2RH4A 2ZK7A 1HE2A 3DHEA 4ZICA 2C2YA 1MC5A 3WGIA 2X5KO 3IJPA 2HJSA 1RYDA 2VWPA 3UCEA 2DQ4A 1ZMTA 2I3GA 4H16A 4ND4A 2Q2VA 4Y67A 2NQ8A 4DQVA 3AM3A 3U4IA 4HV4A 1XWFA 1JWBB 3WGTA 3FPLA 1Y5MA 4G65A 3OHSX 1EMDA 3LU1A 4NU5A 1GEGA 3SC4A 1H94A 3TF5A 3LC7O 3ZCXA 4ITUA 4DLLA 2ZKLA 1LQTA 3WTCA 2DFDA 4NR0A 3KSZO 4AJJA 1YJ8A 1W8DA 1NPDA 1GV0A 4GSLA 1WP4A 4NBVA 4KP7A 4MVJM 1E3WA 1DLIA 3H5NA 3TOXA 3WMWA 1PR3A 3JQ6A 3NKLA 8ADHA 5A5EA 5DP1A 1DAOA 3QIVA 4B4WA 2BMAA 3SXPA 1DJQA 5L7WA 1TT5B 2PD4A 4R3WA 1ZVMA 4GVLA 4M89A 3ETEA 4QO8A 5CHEA 4DBZA 5I9MA 4D42A 5JDIA 3C85A 1VLLA 3GVPA 3KUXA 4I9NA 1PZFA 4PLZA 1EBFA 2DTDA 4E6PA 1PS0A 3AUTA 3ICCA 1YL5A 1LBEA 3C7CB 2H5LA 3QWFA 3RBVA 3DL2A 5DCYA 4BNXA 1B14A 2AG5A 1SB8A 3ZDFA 1E3WB 3AW9A 4RVUA 1RM0A 1K6XA 3ZNNA 3ZNOA 1K3TA 2G17A 1GAEO 2GZ1A 1YQXA 3WNVA 4AJNA 5ITWA 4RV9A 3MWEB 2FZEA 4BQRA 4YT4A 4RPGA 2X86A 3WDSA 4FC6A 4TRMA 3WWYA 1ZW1A 3IAHA 4XYLA 1BW9B 2VCYA 4LCEA 1PU2A 1DFIA 1PIWA 5JMPA 3BA1A 4AJEA 4E2ZA 1P77A 1LLDA 1L7DA 5FI3A 1DLJA 3B6ZA 1E1LA 2BELA 2E6UX 5L4LA 2RIRA 5L53A 4IDEA 3O8QA 2PGLA 5JBIA 1X7GA 5CFZA 1EDOA 5L40A 3ZHXA 1VKNA 4MO2A 3WSWA 3GEGA 4HUJA 2CDCA 4W99A 4FDAA 4YAJA 2UUOA 4CR8A 1BWSA 3RJ5A 2JCVA 5G2OA 1U2GA 3ROPA 2G1UA 4IY1A 4KUGA 2DUUA 3UCFA 1PJCA 2P4HX 2Q1UA 5CDYA 3GPDG 3VTZA 4WLVA 4Z0TA 3K96A 2O3TA 5KJ1A 4L76A 2O48X 5EQFA 2WDZA 3F46A 2CMDA 2OORA 3DFUA 1GV1A 1MLDA 3F1KA 4GKBA 1FDVA 3WGGA 3G3EA 1NX6A 4HX5A 4DLAA 2NV6A 5DBGA 3GK3A 4CM4A 1XDWA 3FR8A 3IMFA 4FR5A 4JBIA 2RH8A 1AE1A 3CUKA 4HFNA 4MDHA 4RF2A 1WWKA 5G0TA 5A4DA 4GI2A 5ENVA 2AEMA 4E3ZA 3HFGA 4D0SA 5A9SA 1TB4A 3UN1A 2WSBA 3U4HA 4JJIA 1LSUA 4KWHA 4YJHA 5CEJA 2OL4A 4MVJD 3BXXA 1NHWA 4KUHA 1R4NB 4J2HA 1KYQA 1ZK1A 1U28A 1Y9EA 2ZB4A 2HMWA 4CM9D 2B4RO 5TX7A 3Q6IA 3QJ5A 4DIBA 3FR7A 2FMUA 1GTMA 5FWNA 2X5OA 3X2FA 4CUJA 4P4GA 3HB5X 2O4CA 2J3HA 3DB2A 1C0KA 4UVHA 1E92A 4L74A 3P2OA 3GA0A 3A28A 1G1AA 2BFAA 3A9WA 4RZHA 2Y1GA 4HFRA 5AVOA 3NT4A 3PFWO 3FTPA 1SOWA 2Q2QA 2VOJA 3K8ZA 1NP3A 1OBFO 5ILGA 1UP6A 2Z1MA 3EYWA 4CQMB 1ONNA 3EGOA 3AOEC 1GUZA 4YAKA 1SEVA 3RWBA 2FPGA 1JAYA 1BVRA 1AN9A 3NTQA 7MDHA 4MKRA 1ZJZA 2VT2A 2Y0DA 1LC3A 4KWIA 5COQA 3R3JA 3JYPA 1N7GA 3GLQA 4O63O 4XDZA 1GL3A 4WLOA 1FDWA 1ZUD1 4RQUA 2DUWA 4K6CA 3VPFA 3K92A 1DDOA 2IEDA 4U6QA 1A7KA 3A4VA 1P1FA 1V9LA 2QYTA 3C7AA 3W8DA 3GAFA 3O26A 3U09A 4R5HA 3NYWA 4CQMA 5IDXA 2J6IA 4D0RA 4RF3A 3QVWA 4XGKA 4DIFA 1QKIA 3MOGA 4CMAA 4B7XA 1HF3A 2FN7A 3KEQA 2JCXA 2WE7A 4DYVA 1KVQA 1NNUA 4PG8A 1I2ZA 1V8BA 5T8KA 4AICA 2QYSA 3JQBA 3BMNA 5TT0A 2DPHA 4BHTA 3CTMA 4X54A 3DBRA 1JWAB 3TDKA 3G49A 4W82A 5AXAA 1C14A 2F1KA 1B7GO 1BDMA 3NEPX 3VPHA 4TRNA 4CODB 2O2YA 3OICA 4J1QA 1PGJA 1W4ZA 4L73A 1MXFA 2DPGA 2G82A 4ND2A 1G0OA 3RU9A 2WD8A 1BHSA 2RHRA 1WNTA 4HBGA 2NU6A 2IODA 4Y6PA 4YB8A 3OQ1A 4CJXA 1ORRA 3WGZA 1NQTA 3PQDA 2CZCA 4UVIA 2EW8A 3JQDA 5FFFA 3DAPA 1E1NA 4NNJA 1D7OA 3F5SA 5G4KB 2Q3EA 4TSKA 1SMKA 4AJHA 3DBRB 5GZ1A 3C3XA 4FIZA 4TVOA 2XF8A 4NK5A 1V6AA 1X0XA 3S8MA 3VTFA 3WB9A 1G6KA 2B35A 5IDYA 1U9JA 2VRBA 1LEHA 3RBXA 3INRA 3OQBA 4IS3A 5TGDA 3O4RA 1WZEA 1KERA 5AXDA 3QWBA 3ZV4A 3FNGA 4IUYA 4NH4A 1QRRA 4OL9A 3VDQA 4MOWA 1FXSA 2WJPA 3KEOA 1NR1A 2D59A 3H5RA 4U7WA 1FK8A 3BMQB 3RD5A 1ZO8A 2P68A 4ALMA 5HRUA 3EHEA 4R1UA 3ZI0A 2CSUA 3IJRA 1DRVA 2XOXA 3K2BA 4HNHA 3AUSA 3ABIA 3PYLA 3ZHZA 4YJGA 5L95A 1LNQA 2C20A 4Q3DA 3AUUA 2P9EA 3EUWA 1ZIDA 2OMEA 1DHTA 2JL1A 2EIHA 4E5YA 4D43A 4WLNA 4G81A 5ADHA 1O6ZA 2IRWA 3GHYA 3PK0A 2FSSA 2C7GA 1WAMA 3E5MA 4BO3A 4AJ1A 4BNYA 4NQZA 3HUDA 1U1IA 2HQ1A 4JP2A 3SEFA 1FF9A 1B8PA 3GHHA 3QRWA 1RWBA 1EQUA 3T4XA 3VZRA 2JFGA 4RVDA 4IXTA 2D8AA 2HLPA 1YS4A 2DLDA 4E33A 9LDTA 3HSKA 3VKVA 1OOEA 5JY6A 4WOKA 2R00A 5L45A 1PL7A 2FR8A 2QZ9A 3GFGA 4QO7A 1IULA 5ES3A 3F4LA 1E7QA 2AE2A 2DBZA 2Y0CA 5KJ6A 1LRLA 3H9JA 3PJDA 3DOCA 3AI3A 1GD1O 1MG0A 5A05A 1X13A 2ZTMA 5IJZA 3PWKA 1H6BA 1TXGA 3QA9A 1IZ0A 1E7SA 3FD8A 5BT9A 4TMFA 5IXYA 1NQ5A 3KVOA 2WWRA 4J90A 2HMUA 3BHMA 4OAQA 2PD6A 1TVEA 2P5YA 4JROA 2ZYGA 4JN6B 2BKAA 2X9GA 1F8GA 2VZ9A 4Z3KA 4PVDA 1NYTA 4CLEA 4H7PA 5DP2A 1HYEA 2GLXA 4GX2A 3KM0A 4NU6A 2O3QA 4NK4A 2O50A 3C24A 1AXGA 1O94A 3ZWOA 1E77A 3VAZA 2EV9A 5CDSA 5MDHA 2P4QA 4CMHA 4E5KA 4BNUA 2E37A 4CMEA 1Q7BA 3U9LA 1VM6A 1CEQA 2CDAA 3CE6A 1ULUA 4LSWA 4CMKA 3TWOA 3WGOA 5C37A 3F4BA 2YV3A 1Z6ZA 3CMMA 1F0YA 4FW8A 3DQPA 4AVYA 1U8FO 4EGFA 2W2LD 5A03A 4BO5A 4D45A 3FSRA 2AG8A 3RC2A 4Q3CA 2ET6A 4ZGWA 5GMOA 3H2ZA 3I1JA 1WDKA 3I23A 1M75A 1R16A 3IP3A 3UOGA 4JJFA 3W8EA 3H6KA 4J4TA 2X58A 1LLCA 2Q50A 3E48A 4WGGA 5C7OO 4AFNA 1Q7GA 2QIOA 4BV9A 5I9LA 3VDRA 4CM8A 1OFGA 1HRDA 5ITVA 1R37A 4MVJG 3PIIA 3DC2A 4XB2A 3GAZA 4XYMA 2EP5A 3D7LA 5BQFA 1M6WA 2PK3A 4PRKA 3D64A 1H6AA 2P9GA 4R69A 2PKQP 2ZQZA 2O7QA 2GN4A 1Z73A 3GN1A 1KEWA 1U5AA 2PTGA 4ZQFA 3NDRA 1P1RA 1EVYA 2VNAA 4IM7A 2NTNA 1ZKMA 3OM9A 3FCOA 3WGYA 3GEDA 2GRAA 2UUPA 1VRWA 3Q0EA 4PLFA 5T6BA 3G17A 5KVQA 4A27A 3UF0A 2HJRA 4F3YA 4FBGA 1XIVA 1YB4A 5AXBA 2D1YA 4E31A 4M55A 2JAHA 1DPGA 3IDSA 3TFOA 3FNHA 1HDYA 2X9NA 4YR9A 2PGDA 4Q3NA 3FPCA 3RAJA 2PH3A 2I6TA 2R6JA 4CM7A 1ZK2A 3I4CA 4TZTA 4PLVA 1Z7BA 4E4YA 1U4SA 4GH5A 2NSDA 2W4QA 3RC9A 4DPKA 1OC2A 4F46A 1O5IA 1YE3A 5JDCC 4ZHSA 3L9XA 2Q2WA 4IJUA 3ITDA 1D3AA 2DU8A 3JD3A 3IC5A 4XCVA 2VYNA 4DC0A 1DC6A 4PLGA 4PLYA 4BGUA 4K26A 3KYCB 4IQ8A 1SEPA 2IDZA 5DCWA 1P74A 2VT3A 4Y9DA 3ZU4A 1CERA 3GVCA 4BO8A 1R66A 2EWMA 4J1TA 4WEQA 1A72A 2H9IA 4J43A 4J7CA 4WE3A 5A9TA 3RUHA 4GVXA 1RM5A 2VNSA 5TC4A 4CMCA 4CQLB 2AQ8A 3CSDA 1NASA 4PRLA 4EYEA 3BZUA 1BDBA 4RDHA 2VHWA 3MJTA 1I30A 3JQFC 5EJ2A 4QTZA 3CZMA 1T2AA 1HDOA 1WPQA 1UXGA 3S1LA 2QRLA 4FC7A 4CPDA 2VRCD 5TJHA 2I3AA 3L4SO 1PGPA 2CVZA 2YFQA 5T67A 2YYYA 1UP7A 2H6EA 2OHXA 5B12A 4ND1A 1HSOA 1EK5A 2G0TA 4FFPA 3MJSA 4OXNA 1HYHA 4YJFB 1NHGA 3GVHA 3LT0A 1QYWA 4J3FA 5L7YA 2YQ5A 3ETGA 3AOGA 3KYBA 4H3VA 3VKUA 4YDRA 3S55A 2YDYA 1PL8A 4WK6A 1CYDA 3GY0A 4F6LA 1DIBA 1HZZA 4WUVA 4YXFA 3IKVA 3AU8A 4KQXA 3HFSA 3BMCB 4BNTA 1KC1A 3ZWYA 1M76A 1X1EA 4MJLA 1YWGO 4MPDA 3UCXA 7ADHA 1DEHA 1C0LA 3O8QB 1YQDA 4Q3BA 1YH3A 3H9UA 2BFOA 5F21A 4WLFA 1SCUA 4WOJA 3OJFA 5MGBA 3I9MA 3QVXA 2WM3A 3H9GA 4C7JA 2HDHA 2EGGA 2JFFA 3E5RA 2PKRA 4Z3DA 2IEBA 1DC3A 1YXMA 2FR1A 4B4OA 4NZ9A 2C7VA 4I9HA 5K6AA 1L7EA 1XU7A 1MV8A 4P22A 3BMCA 4DPMA 1EDZA 2IZ1A 4NFSA 4QSMA 4B79A 1NTOA 2ZB8A 1GCOA 1BXGA 1I32A 1U3UA 5CG1A 2W98A 5I7VA 2X0JA 4YAIA 1KS9A 1XHLA 1HDGO 1DC5A 2BD0A 3H8VA 2VWQA 4BNZA 1EVZA 3IUPA 4UREA 3SVTA 3UKOA 4BO0A 3GVXA 4DBVO 5THKA 3QQPA 3ZW9A 4BO6A 5JC1A 2C29D 2SCUA 4WLUA 1HT0A 3AUAA 2PZKA 3WIDA 1FDSA 5T5QA 1YOVB 5IG2A 5JS6A 8LDHA 2O23A 1ZSVA 4Y98A 3I52A 3D3WB 3Q9UA 1X14A 3QWAA 2I9PA 4LVCA 4P4LA 2W90A 1QV6A 1R4NA 1PGQA 4UEKA 5EMHA 4W7IA 4KTTE 2UDPA 3JYLA 3FNFA 4OQZA 3NV9A 2E49A 3SBOA 5HS6A 3BTUA 2OUIA 4YQYA 4GX1A 3GOHA 3GN2A 3NJ4A 3KOUA 3PHGA 3OF2A 4JP3A 4I5EA 1IHYA 1PL6A 2QW8A 3GR6A 4U0JA 1B15A 2Y0EA 3VVBA 2GN9A 3ZWNA 2VN8A 4DQUA 1A71A 3U5TA 4QX6A 4R9SA 1U3VA 1W73A 1C0PA 1H93A 1B26A 4A5OA 4LMRA 3CINA 3OJEA 4XYGA 3V2GA 4OSOA 1X15A 3DONA 1XLTA 5TIIA 3GNTA 3PYMA 1NFRA 2BGKA 5EQDA 3RFVA 4N7RA 4R1SA 4BGVA 3VH2A 5DDIP 3CXRA 3LDHA 3LSYA 4CQMD 2DBRA 1D1TA 2GZ3A 3BTSA 5A9SB 3E1KA 3ZNPA 4XIYA 2B37A 5HWSA 3KO8A 4W6ZA 3D5QA 2LDXA 4XYBA 3K5PA 5JDCA 1HETA 5TT1A 3S2GA 1Y8RA 3KB6A 1N9GB 3DZKA 4RJTA 2QHXA 6LDHA 1EE2A 1KBZA 2B36A 4KUEA 3ETDA 5EESA 3PGXA 3F3SA 4OXYA 1Y9AA 4PZDA 4XEHA 5LDHA 4EJMA 3DDNA 3WOHA 4BMVA 4E13A 4XYEA 2VTEA 2J3JA 3RSHA 4FS3A 2EW2A 1NAIA 3DAGA 2FR0A 4CMGA 6ADHA 3ZWMA 3OH8A 1DOHA 5COAA 1QMGA 3H4VA 4P8RA 1O95A 1MXHA 4FOSA 2QZZA 2D5AA 3CH6A 4ZRNA 1P1HA 4FPXA 4LGVA 2X8LA 4D3SA 3P5SA 3UVEA 2F00A 3PWZA 2A92A 3DMYA 4JGBA 3RFXA 3KYDB 4UVDA 3DOJA 3M1AA 3MTGA 1ADGA 3KXDA 3OSUA 1QORA 4BNKA 1WMBA 4CLHA 1ZEJA 1E3EA 1JN0A 4CMEC 1EBUA 1GZ6A 2WMDA 2NU8A 4OMUA 1TEHA 1PJTA 2A94A 3EW7A 4OYRA 3ZV3A 1DXYA 2LDBA 1B8VA 3OETA 1OC4A 3GEMA 3M2TA 1E3LA 3EY4A 3HN2A 5I9NA 2NACA 5I7SA 3OECA 2AHRA 2BF7A 4ID9A 4ND3A 2W2KA 4R68A 5TLSA 1K89A 3WJAA 4UUNA 4Y8VA 2TMDA 1XKQA 3KSDO 1HZJA 5B4UA 1WDLA 4KMSA 4NMHA 1XEAA 4AJ2A 1NQOA 3F5QA 2P91A 5GZ6A 1L1FA 2V7PA 1ISIA 1R12A 3V1UA 3FHLA 1IPEA 5B1YA 1NM5A 1Y6JA 1GUYA 2Z5LA 3I83A 1YBMA 1M67A 4I5GA 4D3FA 3N7UA 3GFBA 5F5NA 1TLTA 2CDBA 3H3FA 4WPGA 1RJWA 3B1KA 1Q0HA 3D3WA 3HWRA 3PDJA 5G0WA 1P0CA 4K28A 3TZKA 4CM8B 3DHNA 4DRYA 3GZNB 4Z0HO 3NRCA 3RUDA 4CMIA 4ZQBA 2VYVD 1V3TA 1GZ4A 3TN7A 1LX6A 4DREA 5JAZA 4BIIA 1BVUA 3L6OO 1IUKA 2B0JA 3TFQA 4W9NC 1E7YA 1YBAA 3TJRA 4XB1A 1DIGA 3JQCA 4O59O 1ENYA 4L75A 4MVJP 4Z9YA 3VPXA 1GUFA 1QP8A 2X0NA 3HNPA 1N7HA 1Z74A 3HZZA 2AEFA 4XQ9A 4P38A 5A04A 2OO5A 2Y93A 3AWDA 5JO9A 4YRAA 4EUFA 3MEQA 4J9UE 3V5NA 2OZPA 5T73A 3GZNA 1ZK3A 3OBBA 4FQ8A 4D79A 4XD2A 1EVJA 2PWZA 3PRJA 1Y1PA 1OI7A 3BMOB 4PG4A 1PQUA 2JCYA 1IY8A 3DHYA 3D4OA 3TZHA 4R16A 3VH1A 3JD4A 1LSOA 1B8UA 1R6DA 1ZMOA 2C82A 4XWYA 4JK3A 4JX8A 3ZU2A 2VYND 4R9RA 4BNMA 3GMSA 1KVTA 4PLCA 4F45A 2OP0A 1P1IA 3TZQA 4AJOA 2AW5A 4YRDA 4U5QA 1UAGA 3PPIA 5J9GA 4CLRA 4UUOA 3G0OA 1NVMB 2FRDA 3L0DA 2Y1FA 1FJHA 3RCBA 3ZWXA 3MJEA 1C1XB 3ST7A 4LRSB 5EERA 4QUKA 1DIHA 3KYCA 2HRZA 4JIGA 4II3A 4DUPA 5BSEA 4CM6A 1B3RA 4NBTA 2PY6A 2NADA 4IIUA 1Z45A 4GL4A 4IZIA 1VPDA 3OIFA 3NAQA 1ZK4A 4BNJA 4IDGA 2ZTVA 3HQ4O 3D5TA 4FCCA 1WW8A 2OBNA 3MCVA 2V6GA 3I4FA 4NPCA 4ALLA 1I36A 1H6DA 4FJ0A 1EVIA 1F12A 3WLFA 4OIMA 2UVDA 4LMPA 1P3DA 3BYZA 4ALIA 4OKIA 4EJ6A 1QV7A 3KZVA 3LVFO 4J6FA 1ZSYA 1V3VA 4M86A 2CVOA 3QP9A 1D4FA 3L9WA 3VH3A 1LDYA 1ISMA 3QVSA 2O3SA 4I8XA 3G79A 5COBA 2DC1A 4TKMA 3FF4A 2R00C 3K73O 3PWSA 1YO6A 2HK8A 1DHRA 5LC1A 2O4UX 3OQ6A 1IE3A 4OM8A 3JQBC 3I9JA 3VH4A 4BV8A 3ANNA 1KEUA 1F17A 1U7TA 1UH5A 5JFOA 5F3RA 3DOOA 5AXCA 4IPTA 1PGNA 3WWZA 2VOEA 4N5NA 1LI4A 2QQ5A 4XGNA 5JYFA 4EW6A 3HDQA 2PZMA 1GZ3A 1SC6A 4BNGA 4CLXA 4XX0A 3LF1A 1VL6A 4E2WA 3ONDA 5DZSA 2VYVA 5GY7A 1OMOA 3VPGA 3TNLA 3FN4A 2VHYA 2ZJ1A 3EK2A 3GVIA 1DRUA 3WQRA 1DRWA 3DBLB 2UV8A 3TZ6A 1EZ4A 2VHZA 4KDEA 4OQYA 1PX0A 5G4KA 3W6UA 4TZKA 2BGLA 4II2A 4J7XA 4J49A 1J6UA 1GY8A 3H2SA 3V1TC 4BO7A 1E7MA 2Q1WA 3OMLA 4DA9A 2R2GA 4N5LA 4E21A 1P45A 3AI2A 3OIDA 2BI8A 3JD2A 4FFOA 5FYDA 2AQHA 3AJRA 3PI7A 5GZ3A 3P19A 1E3SA 1GDHA 2OGUA 2UYYA 4HFMA 1PJSA 3ULKA 4BL5A 2HSDA 5JAQA 3JD0A 5T8KC 1RKXA 3DAFA 2D0IA 4OGWA 4OOEA 2BLLA 2X22A 3U49A 2HO5A 3R6DA 3E03A 3EVNA 3DBLA 3X2EA 3CIFA 3RROA 1NFFA 3SLGA 1J5PA 4GBJA 4FFLA 2I76A 2IZ0A 3GNQA 1K2WA 4U6SA 3IL2A 3WBBA 3T4EA 3BAZA 2X5JO 2HAEA 1XYGA 3QVTA 1ZXLA 4PLPA 4EEXA 1HEUA 3TPCA 3HDHA 4XJTA 3SJ7A 1EE9A 2QRKA 3I5MA 4O0LA 1EEHA 4MINA 2NQTA 3IUSA 3ZV5A 5A3VA 1JDJA 2VUSA 3Q9NA 2QG4A 4RORA 3KSUA 5IN4A 1LJ8A 4J0FA 3WJ7A 4R01A 1IHXA 1YB5A 3JD1A 3WFIA 2Q22A 3INGA 3NGLA 2B83A 1A5ZA 1O8CA 3PEFA 3LK7A 4E32A 1R4MA 3CMCO 1FMCA 4ONEA 1I3MA 4D3DA 3RU7A 1LRJA 4Q9NA 1K6IA 2EF1A 1A7AA 1P33A 5JMWA 3GDGA 2POQX 3R1IA 1ISJA 1SAYA 2NVWA 3R0IA 1ADCA 1KY4A 1UR5A 2UAGA 5TS3A 1E5LA 4YYZA 2PD3A 1W6UA 4B8WA 1IPFA 4PZCA 4N18A 1E5QA 2OBYA 1XSEA 3WGHA 4YACA 4IBOA 5JXWA 3FBTA 1PWXA 4MP6A 5JSFA 4N54A 1M66A 1DFHA 1YDEA 2VUUA 4I5FA 3TSCA 1I10A 2Y1DA 2VZ0A 1ENZA 2EGHA 3ASUA 2G76A 2H63A 1JKJA 2V6MA 1HE3A 1LLUA 2CFCA 3D0OA 5KVSA 4BO9A 3UXYA 4CV3A 1YB1A 4ZN6A 1QSGA 4XQGA 4DTIA 5FI5A 3A14A 5EL0A 4BNFA 4MVJA 2BFPA 5IZCC 5C3MA 1I0ZA 4RCVA 1H9BA 3WQQA 4CLOB 4IDAA 3P2YA 2DTXA 5BR7A 3T7EA 2WTBA 4IXWA 4XJSA 4CM9A 1SOVA 3JQAD 1GYRA 4D41A 3WICA 1HDCA 4RPJA 3TQHA 1VI2A 1SZJG 5LDGA 5KNLA 1HDZA 4E2XA 3AM5A 1LQUA 3S2FA 3HHPA 2HMSA 5CG2A 3PFFA 3ZW8A 3MJ4A 2I5PO 2GO1A 3NT5A 1H2BA 2GSDA 3PQEA 3JQ7B 4A73A 3ZWBA 1WZIA 4OO3A 4DYDA 5JAIA 1T1SA 4XR4A 1DAPA 4IMRA 4UVGA 1T4BA 5K0ZA 2ZQYA 4IDDA 1N8KA 3IIEA 1GADO 1PJ4A 5EN4A 1UXIA 3PYXA 4GGPA 5KWEA 4L8VA 3PP8A 4CM4B 4PFJA 4KDFA 1X0VA 4XRRA 3I9KA 2XXBA 2VZ8A 4WNIA 4CV1A 2GERA 1R0KA 1A4IA 4UVEA 1H0KA 4J1NA 3OJ0A 3FWZA 3Q2KA 5F1PA 3AY6A 5I7FA 3PGJA 3HDYA 3UH1A 1GQ2A 3RBZA 1QR6A 1R0LA 3AFMA 1TT7A 2H1SA 2GGSA 4J4HA 5L3ZA 1S6YA 3ZH2A 3ZHBA 2J3IA 4CMJA 4R51A 1CQIA 3ONFA 2V6FA 2E4AA 3C1AA 5CEFA 3E18A 1YJQA 3AI1A 4GLLA 3U0BA 4BNLA 3JQEA 1ISHA 5IN5A 2CUKA 5CDTA 3U62A 3DMTA 4BGEA 4WCDA 3NDIA 3RC1A 5CAEA 2EG9A 2X0IA 3FBGA 4JNKA 2X4GA 1YOVA 4J0EA 5AOVA 2AQIA 3ZWCA 1BMDA 2EHDA 2HMTA 3FNEA 4UEOA 3U4DA 3LC1O 4YA6A 5JE8A 4FN4A 1N9GA 3QHAA 2J8ZA 4IIVA 4U0KA 3WX0A 4BKRA 4ZVVA 3GUCA 1RM4A 3O9ZA 1E6UA 2B4QA 1V35A 4B3JA 4NJMA 2RBEA 5BSFA 3Q3CA 3PVZA 4ND5A 1XA0A 3UUWA 3DTYA 4IJKA 1V0JA 1VKOA 3ADPA 2GD1O 1EUZA 4B7UA 3VHRA 3DZFA 1ZNQO 3TL3A 3C1OA 5A02A 4CL8A 5CDUA 2C5EA 3PLNA 3ZWAA 2Q1TA 1XU9A 1ZJYA 4NFHA 3O03A 4DMMA 3B1FA 3R3SA 3DZJA 2YHUA 3H65A 4R1NA 1NQAO 1EK6A 3I9NA 4O5OA 1ENOA 1YRLA 2J5KA 4G5HA 1TI7A 3JQAA 2YV1A 3NGXA 4RVGA 2ZTLA 1HKUA 4YPOA 2Z1NA 1R0SA 4YAEA 3KYDA 5LCXA 4FD3A 4OSPA 3B1JA 4FJ1A 4NJMB 4OOFA 5I8ZA 1LSJA 3OJLA 4BNHA 2ZB7A 4BKUA 2C59A 1H5QA 2HUNA 5G0SA 2DBVO 4L0QA 3JQ9C 3RUIA 1PJ2A 3H3JA 3QW2A 4EI2A 2FSVA 3ZHYA 5JYEA 5JC8A 1F8FA 3LF2A 3CPSA 2FPPA 2PNFA 2HCTA 1NXQA 3PHLA 4QT0A 4BKQA 1KEVA 3ITKA 2D2IA 3ASVA 3IKTA 1I24A 2DTEA 2VHXA 3H9EO 3KHUA 4BMNA 4F6CA 4J91A 1FDTA 1LUAA 3LT2A 4OH1A 3RASA 2Y68A 1NBOA 5TSDA 3DBHA 2O3JA 5TRTA 1WXDA 5KVCA 1GEEA 3EZLA 1WVGA 2GUGA 5JDIC 2GYYA 2G5CA 1LLQA 5G0VA 4R5MA 5JNLA 1NWHA 3U3XA 3ENKA 5CP8A 4PN3A 3JQFA 2NTJA 5KKCA 2XPCA 1O0SA 3WMXA 2WE8A 3CKYA 3S2EA 3ZU5A 4TVBA 4PCVA 2FP4A 4CR7A 4PIVA 4FFRA 4XRGA 2RCYA 5KJFA 3H7AA 3VZPA 1YBVA 2I66A 4HWKA 1HYGA 4TRJA 2PGJA 1K6JA 3FWNA 3HE3A 1E0DA 4Z0PA 5JAMA 2GR9A 1PZGA 1SNYA 1UZLA 2ZJ0A 3PHIA 2CVQA 4RF4A 4D46A 2P2SA 2P5UA 3ZU3A 1JAXA 2Q49A 3C7DB 4NBWA 3KLMX 4RZIA 1LA2A 3BHIA 1AGNA 1NAHA 5IDWA 1LC0A 1U7HA 2B69A 2JD1A 1IZ9A 2D3TA 3ZWVA 5I7EA 4GX5A 3RUFA 1QXSA 3UHAA 3OIGA 2GF2A 3KETA 3GRKA 1CQJA 2ZYAA 3SC6A 3ANMA 2CNBA 2IXAA 3ONEA 2HU2A 4MVJH 3FI9A 1J0XO 5U4QA 2P9CA 4IGFA 1QYDA 3WS7A 2BH9A 2HK9A 1D1SA 3L07A 1ADFA 1JTVA 2PKQO 4ZRMA 1UP4A 1VJ0A 4RPHA 1GU7A 1N5DA 4C7KA 4R4JA 1ZXBA 5L51A 2XAAA 3S2IA 1HE4A 1UUFA 1XG5A 5CPFA 4GPD1 4M49A 3HDJA 1ZK0A 5L4SA 3K2EA 1U5CA 4CM5A 2PLAA 2HRBA 5A9RA 1MB4A 3N74A 2YZ7A 2YHIB 3G1UA 2W2LA 4G2NA 4S1VA 3QY9A 2IZZA 3AY3A 3E8XA 3QLJA 3DWFA 2Q46A 3GGOA 2EKQA 4AJKA 1J4AA 4OHUA 1X7HA 2EJWA 3DZIA 4AJIA 2Y05A 2X0RA 1VJ1A 1F06A 3JV7A 4IJVA 4HXYA 3JSAA 2FY8A 4JQCA 1ZCJA 3U4CA 4QFCA 1UJMA 4JJGA 2AMFA 1JVBA 4LSMA 4M54A 4JXKA 1E3JA 9LDBA 3LC2O 4PG5A 1T1RA 3KLPX 1J49A 3OP4A 3HB4X 1LRKA 2DVMA 3W4JA 5C5IA 2BFMA 3K30A 1E6EA 2Y67A 2OP1A 4HADA 4OXKA 1CWUA 2PV7A 3WIEA 1Q2XA 3JCZA 4WASA 5H83A 1N1EA 3MZ0A 2PH5A 1P0FA 2Y99A 4QXMA 3PZRA 5K9ZA 2Y1OA 1QG6A 4AL4A 3ZZNA 2J3KA 3PZBA 1KY5A 3HADA 2O7SA 5AQ1A 1T2DA 4Z6KA 3W4KA 4FB5A 5H82A 4YJFA 3DMTC 3GDOA 3PJEA 5ER9A 3ROKA 4MKZA 1GYQA 3H9QA 3V2UA 4MIOA 3ROMA 3BMNB 2E82A 4UAGA 2ZIZA 2Q99A 2XXJA 3M2PA 4URFA 2EP7A 2E48A 1WLYA 3TZCA 5DCUA 3L77A 5IZ4A 1H2HA 2PZLA 1CJCA 4ZQGA 1MFZA 5G0UA 4R1TA 2W2KB 3GDFA 4L4SA 2EKPA 1S7CA 2FZWA 3CEAA 2ZCUA 1TA4A 2O3UA 4FFNA 3RJ9A 5DBFA 1T2FA 3DO5A 4RVHA 1XQ1A 4N5MA 5U1PA 3F6YA 4WCFC 2NUAA 3WTBA 4WLEA 5DULA 5U9CA 2NU9A 3DTTA 1PS8A 4RPLA 4PGFA 4KOAA 3COSA 3V2HA 3JQ7A 1V3UA 4BO1A 1QYXA 1UAYA 3WLEA 2JHFA 1HXHA 3C1TA 2JKVA 4YEDA 2D5CA 1GQQA 3DZBA 5F1OA 4HP8A 4IGEA 5C7LO 3AOEA 2JAPA 4CMBA 1CRWG 3ZWWA 1B0AA 1JLLA 3OEYA 4FJ2A 3L4BC 4M8SA 4J1SA 3F1LA 3JQ8A 3RQSA 2X9VA 2VUTA 2NVUB 3AK4A 1T24A 4ROSA 4BB6A 3GZ4A 1P1KA 1DIAA 1QYCA 3GT0A 4PLTA 4B4VA 4B3HA 1P1JA 3UW3A 2CD9A 3E82A 1WMAA 1EQ2A 2EJVA 3QE3A 4E5PA 5KJCA 4YVFA 4PG6A 3DZHA 3W8FA 2IE0A 4DQXA 1YGYA 3B20A 1VE9A 3GG2A 3P7MA 2VQ3A 2CY0A 4RLSA 3I6IA 3OFSA 3PHJA 2C5AA 3BMOA 3F47A 3K6JA 1BGVA 4Q3EA 4XKJA 1NWCA 4NBUA 5DBIA 5L9AA 1DFGA 5EPOA 3NX4A 3D4NA 5BSHA 3UGKA 1CDOA 2V6BA 4DL9A 3JQGA 3WR5A 4CLDA 1I01A 4A2CA 4BKOA 5DOVA 3HJAA 1QLJA 3WYCA 1IL0A 1SPXA 2WEKA 2YUTA 4BGIA 4XA8A 1VC2A 1OZAA 1Z75A 2EERA 4HNGA 2WYVA 3HN7A 3IS3A 5A3JA 3N58A 1HWYA 5BNTA 1LU9A 4EITA 4KZPA 1LXCA 4KQWA 1DSSG 5AYVA 4YAGA 4QEDA 4J7UA 5JO0A 1KVUA 4BKPA 3Q2IA 4R54A 1A4UA 4Z9XA 4TRRA 2PZJA 4GWGA 1SO8A 3EVTA 5JW6A 1BTOA 3PIDA 3WSVA 4A0SA 4RVSA 1LDEA 2RHCA 1T4DA 2OFPA 4W4TA 3D4PA 3E9QA 2ILTA 4ZA2A 2HKIA 1N1GA 1E7RA 1Y5RA 4GSKA 2DFVA 2NU7A 1RM3A 1HLDA 1H9AA 1DO8A 2A35A 1NPTO 3O38A 3SLKA 1Q7CA 1K0UA 1PR9A 5TJ9A 5KVVA 1E1MA 3A1NA 3PQFA 3W1VA 4WCFA 4DWVA 2DAPA 1UZMA 2WD7B 4EDFA 2NM0A 4O1MA 4E2YA 4D7AA 3I9OA 2CF5A 1PJQA 1Z7EA 2B5VA 5HA5A 4U8GA 1PQWA 2AQKA 3K9QO 5HBRA 3W4IA 4BNVA 5M6DA 1T25A 4MKXA 4CL3A 3RVDA 1B3BA 2A4KA 2GZ2A 2DKNA 3NTOA 4J2OA 1DIRA 4AJLA 1ISGA 4RQTA 1BSVA 4RPKA 4QFDA 5JCJA 3D3EA 1BW9A 3RKRA 4AJ4A 5A06A 3JYNA 1XQ6A 5A1TA 1UXJA 3NJ8A 1T26A 4EUEA 5JY1A 4PZEA 1BXGB 5I8WA 4YJDA 4B4UA 2AXQA 4WCFB 1EFKA 1DBVO 1WDMA 3KTDA 1M2WA 1E7WA 4MIEA 4LW8A 4LCJA 4ALKA 2DBQA 3VOSA 2I65A 3V1YA 2JD0A 4I5DA 4C4OA 1YL6A 4J4BA 1JA9A 4WJZA 3GQVA 3MJVA 1AHIA 2CF6A 4DPLA 3HG7A 2ZYDA 1NR7A 2AEJA 2EEZA 4NIMA 3GPIA 5F1KA 2X7HA 3JTMA 4XQCA 2Q4BA 1W0CA 1G0NA 3OEWA 4WEOA 2WYUA 1ZH8A 3AFNA 2YFHA 4XIJA 5IAAA 3I6QA 4YT5A 5DOZA 1RPNA 1ARZA 1JU9A 3DZGA 1RYEA 4XZ3A 5B4TA 5IDQA 3AY7A 3ENNA 4L9RA 4BUCA 2HK7A 2FOIA 5DN9A 2NVUA 4BMSA 1JKFA 1SB9A 2X23A 2JJYA 4BNWA 3BIOA 4A03A 4LRTB 1U3TA 2AA3A 4IMPA 5B4VA 4I1IA 4PLHA 4JBGA 1C0IA 1PZHA 1BRMA 4JLWA 2QRJA 1IOLA 4P4NA 1I5RA 4NHEA 4RF5A 4XR9A 2Q1SA 5G4LA 4E5NA 3KV3O 1I3LA 4YJHB 3ZN2A 2J5RA 5HM8A 3V8BA 5JCXA 4TKLA 1KC3A 3E9MA 2NTVA 2PR2A 4JBHA 4RDIA 3TOZA 5HTOA 3KRTA 4KTVE 1AHHA 4BO2A 3L6DA 5IFLA 5EINA 1PJ3A 4CR6A 2VRCA 1HTBA 2C2XA 3K31A 1YKFA 2DM6A 2EKLA 2O2SA 3DFZA 3IP1A 4IZHA 4BNNA 4D44A 4EZBA 3MOIA 3UFXA 3OJOA 4B8ZA 1VL0A 3L6EA 3BTOA 1JVSA 3LYLA 2W8ZA 4OKNA 1PGOA 3STHA 3W6ZA 4UEJA 5ENDA 1Y81A 3RKUA 3UICA 4J9VA 4ZD6A 4GKVA 1R15A 1R4MB 3PXXA 3WG9A 5A5FA 1HL3A 4RLHA 4OJNA 1O9BA 1U2DA 4IJWA 3ZNQA 1Q1NA 1PWZA 3PLRA 2BRUA 4LISA 5DT9A 1Y8QA 4R3NA 4J16A 1ID1A 3QVOA 4RVFA 2ZCVA 1CIVA 1ADBA 4BS9A 1YONA 2GDZA 4BB5A 2YDXA 3C8MA 2JHGA 3WNQA 4O6VA 1HLPA 3L4BA 2B4TO 4XDYA 4WKGA 4BO4A 4YT2A 3ANLA 5CDGA 2PA3A 4R41A 4YTEA 3VPSA 4XGIA 4NJOA 4YWJA 5BSGA 1OAAA 1C1XA 3BHJA 5FF9A 4YT8A 1X7DA 2BHLA 1MP0A 4L4RA 3LT4A 4GGOA 1MA0A 1ZFNA 3EZYA 1TT5A 1ZZEA 3RI3A 3VZQA 2Q45A 4DMLA 1BG6A 2ZB3A 1LTHR 3G1TA 2OOSA 5FEUA 3TL2A 1KETA 4RO0A 1PQPA 1MUUA 4Q39A 3GGGA 3PDUA 1CETA 1GPJA 4FGWA 1IYZA 1UDCA 4CLOA 1YL7A 1A27A 3LLVA 2GN6A 3QV1A 1ZBQA 3ICPA 4Y6SA 2GN8A 1BXZA 1ISFA 4IDFA 2DT5A 4TROA 3JQAB 3I3OA 1K5HA 2IYOA 5JYAA 1JW9B 5JYDA 1LDMA 4ZJUA 2IXBA 3EDMA 5JLAA 4AG3A 3F9IA 1XCBA 2QX7A 1VJTA 3FTNA 3AM4A 4M87A 1NVTA 1C3VA 4ZU3A 4QQRA 1JKIA 3ZWPA 2PFGA 4NBRA 5J23A 1E6WA 5T64A 1JQBA 2A9FA 3KBOA 1QLHA 4YQZA 3NTRA 3GRPA 1YDWA 1EUCA 2EXXA 4CMIB 1I8TA 5KKAA 1M6HA 4HFJA 1N2SA 4Q3AA 2FHSA 2YQ4A 4ESOA 3E9NA 3LLSA 3M6IA 1IB6A 3PHHA 5F5LA 4BVAA 1MC4A 5TF4A 3RUCA 1I33A 2JD2A 1MX3A 1UZNA 3FRJA 4B3IA 5IZCA 4CM1A 4AJPA 2Y66A 2VWGA 3GF4A 3JYOA 2IYPA 4FFMA 3UAGA 4MVJE 4PG7A 1KOLA 3H5AA 1ZSNA 4JCOA 3PJFA 4I08A 1U8XX 3BTVA 2WYWA 2C54A 2YHIA 5KTKA 1H6CA 1EUDA 4YCAA 2NNLD 4A7PA 3DEYX 4DC1A 1VL8A 1KVRA 4ZQEA 4K9DA 3AU9A 4RL6A 1DB3A 4UUPA 4IQ0A 3GUYA 1UDAA 5IXSA 2YJZA 5L7TA 1QYVA 3IOYA 3SJUA 1T2CA 4FSHA 3SX2A 1ULSA 3LT1A 5C7IO 1A9YA 2J5QA 4EJ0A 4EUHA 2BI7A 3ON5A 5THQA 1GQYA 4IQGA 3WQSB 4NG5A 4LVUA 1Y7TA 3Q1LA 3DXFA 1UXKA 3ORFA 4DVJA 3MTJA 5TNXA 4ALNA 1LDNA 3D1LA 4GX0A 5CEEA 1ZEMA 2TMGA 4S3MA 1I3KA 1VSVA 4Z9FA 5CPBA 4GQAA 1PS9A 5DF1A 2OXIA 4A10A 3MJCA 4LK3A 4E30A 4IDBA
chains in the Genus database with same CATH superfamily
5KOHA 1FUKA 1LDBA 2HT6A 4OHMA 2X0FA 3UB4A 1F2TB 2IQIA 4DGSA 3GARA 3ZS8A 2GJAA 4B6PA 4QBFA 3VMMA 4EFKA 5JCPA 1I3NA 1I13A 2W4IA 4HGYA 4TUYB 4B6QA 1ONSA 1EAMA 3WHIA 1SUFA 2EHJA 3WBKA 3NZEA 1ML3A 3AHEA 3SZGA 1WXEA 4P31A 2ZETA 4DUGD 2CHEA 3CB2A 4CEHB 3OOSA 1UXHA 1NPYA 3HO6A 4ZOLA 3DNPA 1YVEI 1L7BA 1CXZA 3JW8A 3NEJA 1LDGA 1SBYA 3TAXA 5IT5A 1W5FA 1PR0A 1W25A 2A1IA 2PKYX 5ILOA 2JH8A 2Z08A 4BQFA 2VJMA 4DJJA 4LJ7A 1B2LA 3SM9A 3VBEA 4C01A 4EB3A 5J2UF 3B9PA 4HLUA 2X5XA 3AZOA 3MJDA 1Q6YA 2ZUTA 4FHZA 4NE7A 3B3QA 5CX4A 1ST3A 3ZJYA 5JD5A 3TG2A 4LOAA 1YKSA 1X3LA 2W0SA 3D0KA 3P9ZA 5DWQA 1PSDA 2Z5FA 1Y63A 3QELB 1KDZA 3GG9A 4I9UA 2BIFA 3H16A 4IRUB 4LZLA 2Y0BA 4G37A 1YF3A 2XZDA 3JVVA 5H4HA 1KORA 2BZ1A 2PKEA 3GLHE 3CRW1 2YJNA 1TEVA 3DKRA 4D8UA 1VG9B 3RO7A 4F2DA 1YUBA 3FSGA 1HE5A 5E9JA 2NN3C 1O89A 3J80A 1JEJA 2WSSD 5K4AA 2H2DA 3WYBA 1VIYA 4I66A 3C1UA 2HBRA 4XSVA 4PZ9A 3V1LA 4DT1B 1KFCB 1N6IA 3NQ41 4XQEA 4UATA 5E7JA 1IFXA 2PWPA 5KNDA 3JQQA 4WZ6A 3SJBA 1GNLA 4PYJA 2HIHA 1K7YA 2J3MA 3QGMA 4NDNE 3FCEA 4EBFA 2I67A 5JRZA 5AW7A 2R7AA 4QPPA 5B37A 5CJPA 2IPMA 4BBAA 3AYZB 1DC7A 3A6JA 3II6X 2ZRFA 4PZAA 3RSCA 4F2PA 4FYKA 2AX3A 2DWPA 4E12A 1G4AE 4TQGA 5IVKA 2J9RA 3JYQA 4RKQA 1W0KD 2ECQA 1JLSA 4MSUA 5L4NA 3HKDA 3BDIA 3O2NA 4WKBA 2FMIA 5DNUA 2DFLA 5LOVB 4MVWA 1QF9A 4RLQA 2Q6VA 2ZJYA 3PR1A 4GNKA 3FFAA 3H2BA 3NCTA 4KMMA 1GYPA 4DXHA 1MGOA 4OFWA 4FCTA 1CJTC 2AOVA 2GPTA 3UW1A 1PJRA 1CLUA 1CRQA 3ZV6A 1X38A 4E4TA 5C7YA 5JVDF 5JXIA 3F5DA 2C0CA 1Y4ZA 2UZIR 4OREX 1FIUA 4M1QA 4X44A 1ONPA 1XTZA 3MILA 3V1KA 4WINA 4EEZA 5J4LA 3FUCA 4E5MA 1EZZA 1EFDN 2CUZA 3ZD9A 3TRIA 2WSMA 4UULA 1Z6XA 5IM4F 2YW9A 2YY7A 2VZLA 4QASA 3BD9A 5DO9A 4I14A 5ALXA 4A5SA 4DWJA 1V7CA 4PZ0A 1QF6A 1D07A 3AL2A 4Z86A 1WPXA 2B2XA 3KAPA 4JODA 4DLXA 1MHTA 4IZ6A 2ZSBA 4KE8A 4QKQA 1ZM3A 3OLYA 1ZLXA 3G0DA 3DBVO 1VSUA 4MQEA 1FFXA 4UBIA 3BE5A 1XZBA 3JQGB 1TMKA 4QECA 3VC7A 1AB6A 3ILYA 3VDMA 4DQXA 4PO8A 4WECA 1RAAA 2EX1A 1FX1A 5CH8A 4K9PA 1AM4D 4DIOA 2QJFA 3PXUA 3DLTA 4X1KB 1U8CB 5ELXA 3Q6MA 3QUBA 4D8VA 2GNOA 4MVJI 1XAIA 4PU0A 4F4FA 2HREA 5BNZA 3GLIE 1SD5A 1ZZGA 1K3FA 4YP7A 3WNZA 3THYB 1CY8A 2ONYA 4RTJA 3NATA 2QIPA 1Q0LA 3WFJA 9GPBA 3WRXA 4X65B 2H7XA 1XR3A 4RY0A 1Q22A 4EI7A 3EQZA 2O3RA 2RKBA 2IWRA 1YU9A 5A5DA 5JBNA 3H0WB 1DC8A 1DQZA 3BRCA 2Y1EA 3OZEA 3TW8B 1Y4DE 4GRDA 1D2RA 4KQJA 4DM4A 4N6NA 5B30A 2H0QA 4D3ZA 1JQDA 4RIGA 2IP1A 4L6CA 5JRJA 2HOQA 1NIJA 2JIZA 4CUKA 5I7HA 2GZAA 2C61A 2H4ZA 3CPEA 5KX5A 4W5OA 3AFGA 2GD2A 1HE2A 3ENVA 2JGEA 2WKWA 3SFVA 5JEEA 2QAJA 1OKKA 4C6SA 2Y9MB 5CXQA 3BJIC 1Z5GA 4FYXA 3UCEA 2DQ4A 1ZMTA 1E2LA 4N82A 3QVGB 5CR9A 4NENA 2JNWA 3WFZA 3VSDA 4ZREA 4HBGA 4QOHA 5FLEX 2Q0HA 3ONNA 4L22A 1USVA 3AM3A 1ZH6A 3N8HA 4HV4A 3V9PA 4O25A 1YCFA 1XWFA 3F4KA 3OJCA 1L4GA 2OV4A 3MS2A 3R9XB 3FGZA 3D2AA 5FUQA 1H94A 3WJ1A 4MMZB 1NXPA 4HNAA 2C5LA 1H65A 1JU3A 4ITUA 1RRCA 1MD9A 3WTCA 2GQ0A 3CLHA 4G89A 1ZW6A 3MTAA 2NAPA 1KEEB 1NPDA 1WSAA 2YUIA 3IAEA 3MK31 4GSLA 4RIFA 1Z4PX 2CKDA 2NZJA 1I51A 3M6VA 4MVJM 3E8SA 3TOXA 3UG6A 3NKLA 3L1JA 3ZY3A 1L1RA 4H27A 3TKYA 6REQB 4FHCA 2JS7A 2NO4A 3ZZ1A 3QIVA 4DV4B 2BMAA 5BWLA 3F6CA 3SXPA 4Q9IA 1A9TA 3G5TA 1WXQA 3OZ7A 4NCAA 4M89A 3U40A 4R7GA 1TZMA 4OFXA 2V97A 4HNAB 3I0MA 3JSXA 5H1YA 2R6FA 3Q6NA 3UMYA 4KGDA 3QU4A 3UWDA 1DE0A 8MHTA 2KMLA 5T3YA 2CB0A 2YR0A 1EBFA 3ZQUA 2HV9A 3SFTA 3AUTA 3TLYA 1SVUA 1J7JA 2FN3A 3C7CB 2H5LA 4LJ5A 5C31A 4E08A 5B7GA 3UPUA 3DL2A 1G5IA 1B14A 2QZPA 4C03A 4GKJB 1DV1A 1SB8A 4Q4CA 3UOAB 4DC9A 2R6CA 1RM0A 3O3CA 2BWJA 3DPIA 3RRYA 4OVKA 3WNVA 1GAEO 5FI0B 4AJNA 4ZVSA 4GBMA 13PKA 2VS1A 2W7TA 2WWWA 3MWEB 2FZEA 4V39A 4EKEA 5CDFE 5ITWA 3LQKA 1D6JA 1NLFA 4BQRA 4RPGA 2WJ3A 2X86A 1XMOB 1O94D 1BMQA 2R3SA 1Z2DA 4M0PA 3GJ6A 1EI9A 4P7JA 4U6NA 1ZW1A 1DBQA 3IAHA 3NHLA 1BW9B 1CFJA 1KY2A 5FQNA 1PIWA 5JMPA 4OCZA 1GZ5A 2VNIA 2GAFA 4F4CA 4LDPA 4AJEA 3Q88A 1KQ3A 5AKIA 4BCCA 3U39A 4ZIRA 4QDUA 4E5SA 1E1LA 3E53A 4BWYA 1YRQA 1W46A 2JAXA 4Z9BA 3VFDA 3QVLA 4LYDA 4CG0A 2PGLA 2Q3BA 5BO5A 3TTSA 3PFNA 4MPJA 2HU5A 2IQ5A 5EIFA 5EWLA 1X7GA 2Q8NA 5CFZA 1DOAA 1R6VA 1L4NA 1ZD3A 3WLAA 3BZBA 4MO2A 3Q72A 2HYDA 3AW8A 1UDWA 4FDAA 1A9XB 1KJYA 2BR3A 2XHEA 4YN3A 3KLOA 4PQYA 4YCNA 5EY5B 1RZRD 3R7WB 5NULA 4LXTA 1UADA 3P9PA 5FYQA 2EBUA 621PA 3RJ5A 2GM5A 2CBXA 5DIZA 4IY1A 5CDYA 2DUUA 1XTUA 3GPDG 1B0PA 4MW6A 4KX3A 2D5BA 5KJ1A 1WMFA 1ETHA 2IWHA 2W6ZA 4LHVA 3NHKA 5EQFA 4F4IA 5B3LA 1OH8A 4UMVA 1MLDA 4GKBA 4HAOA 2V59A 3RM3A 1FDVA 4GSYA 3DZDA 3ZWQA 2BC9A 3WHLA 2C5FA 1XZ8A 2AH5A 4RGYA 5KSPA 1Z88A 2ZE7A 3FR8A 4KI0A 4NCXA 1JLHA 4JBIA 1SQGA 2FCAA 3CUKA 4HFNA 2Q3LA 3VZDA 1XP5A 2QN2A 3QIAA 4Q3OA 4NV1A 4EOGA 5ENVA 3Q98A 1I7QB 1T43A 3MM4A 4F1JA 2X3YA 5LBTA 1Q3TA 3TUTA 2LW7A 1KI8A 4ZAGA 4E11A 3HGQA 5K0LA 3BL6A 3OLCX 5CEJA 2XNKA 4H60A 3IVRA 1C3LA 1DKOA 3LUPA 1GR1A 3ZEAA 5BR1A 1Q15A 3HB1A 4WK2B 3ACCA 1R4NB 1QHSA 1Y9EA 5BN3B 2ZB4A 1W75A 2HMWA 3GGSA 1AG9A 2N9UA 3FSJX 2DH6A 3N0XA 4B35A 5GM1A 4A8JA 5KTOA 2J0QA 3Q6IA 1L1EA 1SVLA 1HURA 2ZVDA 4DIBA 5CA1B 2Q5QA 1DX4A 1VJGA 5FWNA 4BWFB 4B84A 1NN5A 3ORSA 4Q1FA 4LNUB 2O4CA 1XN4A 2GUWA 3E2IA 1SKYE 2V1UA 4L74A 1U90A 3UENA 4UEQA 2JAOA 1G1AA 3OZRA 4HMOA 4D3YA 1CJBA 3H86A 2Y1GA 2JI6A 4DTCA 3PFWO 4C4AA 3MN1A 4YAOA 1SOWA 4NY1A 4ARCA 1D04A 1NP3A 3A6GA 2QNBA 1ZBDA 5CB4B 4RPCA 2MSKA 4Q1CA 1QFYA 3IE0A 1Z83A 1ESEA 4GMXA 4RGQA 1GUZA 3DVAB 4YAKA 2H2AA 3PVCA 3L8DA 2A9RA 2YY5A 2WD9A 3JQPA 5F78A 3HP1A 4MUNA 4CDMA 1KDOA 1R8JA 1AN9A 4JLAA 1ESNA 2XJ9A 3G89A 2PUAA 4HNVA 1LC3A 4KWIA 2ZRAA 1RTKA 3R3JA 1N7GA 2IP4A 3WDKA 3ZU6A 3GLQA 4ZK6A 3BD8A 4AP6A 3IR7A 4IRMA 1GL3A 5FORA 1XWWA 4HH3C 5J4YA 5IJWA 2FUNB 2DUWA 2AJ8A 2QM7A 3TINA 4UXIA 2A0UA 3VPFA 3PC8A 3JY6A 1DDOA 1QIKA 2MSDB 2VDWA 4D4MA 5ADUS 5EJAA 3OC0A 3GMIA 4ZAWA 1MQ9A 2XVYA 3GAFA 4N48A 3FYUB 3I0ZA 4HN2A 2HZ7A 5CLIA 2KE5A 2QR5A 4RF3A 4XGKA 4EW2A 3AV0B 3QKSA 1XRPA 4JP5A 2P8JA 3ZGZA 3BH7A 3OFND 1HF3A 2QRMA 1HTWA 2J31A 3KEQA 2A84A 5HJ5A 3KJQA 1NNUA 1P6QA 5G1NA 4F91B 2H1WA 1L6IA 4OHWA 2P2LA 2DFTA 3PDIB 3PHBE 4I1OA 3QXHA 1ZNWA 4XIIA 4WBNB 2WVAA 4EY4A 3THXA 3IA7A 4LDNA 4AROA 2O2XA 4W82A 1E2KA 4DR6B 2FAXA 3GFRA 1BDMA 3OE1A 3NKVA 3NEPX 5GVSA 3LFHA 5CD9A 2RK3A 1PGJA 1W4ZA 4L73A 1YSCA 4LXIA 2G82A 1CZRA 2HCFA 4P4SB 4B7ZA 2W2QA 3RU9A 5FPKA 2WD8A 1BHSA 5KTPA 3EP4B 2GPSA 2REXB 3I12A 2E85A 2IOFK 3R5KA 2OO7A 1JILA 1NUHA 2IODA 2RBKA 4CJXA 4RMGA 1JDBB 1ORRA 2IY7A 5E95A 2BW0A 1N3YA 2BEWB 3IVXA 5J4VA 1DEXA 2CZCA 5FFFA 2G4CA 4CN9A 3FPAA 2WSIA 1E1NA 4KSCA 4NNJA 3F5SA 4E15A 3EVDA 5E0KB 3R7WA 2P30A 4L8YA 4C3ZA 4NAUA 4EA7A 2OGWA 5CB0A 2ACVA 5D85A 4RXUA 4BGDA 1BX0A 2G63A 2KQUA 2Z2ZA 1VLJA 1V6AA 4UHCA 1X0XA 2GK3A 4H7DA 2Q8PA 2B35A 1B6GA 2Z04A 2VRBA 3QITA 5IDYA 2IIVA 2WVGA 3RBXA 4BMYA 2QW0X 3INRA 3OQBA 2J9FA 3FCAA 2SKEA 1RT9A 2R85A 4IS3A 4P4SA 2WICA 1WZEA 2JGLA 2WU4A 2PDAA 4Q9AA 3U3KA 1WA5A 4L3VA 2HBQA 2RKWA 2AOTA 2EYUA 2V0CA 4KBGA 5ALTA 4MOWA 3ZG6A 2WJPA 1K2VN 1E2PA 1L7XA 1U0OC 3GYBA 4JP1A 2HRDA 4R05A 1RBYA 2VL7A 4RW0A 1UEXC 1KO8A 2J3EA 4GP6A 5EXDA 1FK8A 1AV6A 4TUYA 1ZO8A 5CAEB 3R76A 2HPZA 3EHEA 4R1UA 1NJ8A 2QMEA 4NZOA 3A8TA 3D2CA 3PYLA 4YJGA 2IPLA 1GA6A 1LNQA 2C20A 4G4SO 3H17A 3PCTA 3F5FA 4CU5A 1ELOA 3DXXA 4HSGA 3EUWA 2JGKA 3AXTA 1ZGGA 3N1UA 4YREA 2BM0A 1I6MA 5I3CA 3RB8A 3ME5A 3JASA 1JX6A 2OWEA 4EHLA 4OYHA 2FMKA 2XUHA 3ZQ4A 3GHYA 1WAMA 3E5MA 4Q0MA 1U2RA 4NQZA 2HHHB 5E4YA 1U1IA 5LLTA 2HQ1A 1WQ4A 1JI3A 4HQOA 3ITEA 4MCIA 2ZRPA 3TW0A 1A9SA 2X7JA 4US2R 3SEFA 1FF9A 2J30A 3OEED 1O77A 4BEWA 1KJZA 5IDVA 2P6MA 2DFPA 1RWBA 3T4XA 1QIGA 1G21A 1DG1G 1TIKA 5GJWC 5ALWA 5AH0A 2UUAB 4NABA 4UTXA 1QH0A 3HYCA 9LDTA 1ECPA 2WW8A 3KUDA 3KEFA 1MOSA 2E5FA 2YYAA 5AI0A 3KT3A 5EJ4A 5KZMB 2EQAA 2CEKA 2XTNA 5BWBA 5KOYA 4DT1A 3EASA 4TZ0A 4GP7A 3KPWA 4XCQA 1SFRA 1VE6A 1HEYA 4OU5A 2DBZA 2W83A 1U6IA 3C41J 3LMKA 4YGXB 5KJ6A 4BQQA 2PL3A 3TW3A 1GKYA 1Q77A 2I4RA 4EGSA 1MG0A 5A05A 4XJVA 3CVVA 4RL4A 2WAXA 3EXG1 3EAFA 3OQPA 3QA9A 4KAFA 4Y3UA 2HV8A 5HIKA 1ZAYA 4P35A 3FD8A 3ETNA 1Z4IA 3PGKA 3E27A 1A8QA 4FOPA 2H7CA 4TMFA 3GBPA 3C8UA 5TGTA 1NQ5A 2RH9B 4QQ8A 4BBPA 2PMFA 3DT8A 3KLBA 3QVUA 4IV5A 5JNTA 4JROA 1U9IA 1V11A 5HSGA 1QOQB 4XSHA 2EQ5A 4FOLA 4Z7OB 2QZSA 2ZPTX 2XE8A 5EUMA 4CLEA 1NZDA 3KHKA 4I1VA 4D4IA 4GX2A 3R6LA 4JI7B 5KSOA 4CG3A 2O3QA 2WNSA 2HDOA 3C24A 3EIOA 4UCQA 1CY0A 2OXRA 3HYNA 2VF2A 3KOWA 1E77A 3NJRA 2EV9A 5CDSA 1VSTA 1L5FA 1QO9A 3PFCA 5MDHA 3N2GB 4CMEA 1Q7BA 2GCIA 3DEHA 4L16A 1WDTA 3WL3A 4MARA 1K9VF 4F7DA 1FP7A 1MIHA 4C0HA 2BKEA 4Z54A 5K0CA 1RHJA 1GRCA 2YV3A 1N6OA 1Z6ZA 2ZPAA 2SECE 3DQPA 3FETA 4GKAA 2W2LD 2B4YA 1WCYA 3PCXA 1VI6A 4O8ZA 4ZGWA 3M33A 3I1JA 1DBWA 4N49A 3W8EA 3WZLA 2JDIA 3O4JA 5SZIA 3F97A 2GHQA 1E79D 4TYWA 3EWAA 2X58A 3SZMA 4YJ3A 3SZRA 1STOA 5B1DA 1ES9A 3CJTA 1Q7GA 2QIOA 5HKLA 3LXRA 3ND5A 3CRRA 4C43A 2NPFA 5JNUA 3GW8A 1G7TA 2JIZD 5I9LA 4JMLA 3VDRA 3MBIA 4B4DA 3TSZA 1HRDA 2XUGA 4FVTA 1U6JA 4G1VA 1T0IA 2XUJA 5A62A 1C3JA 4IVPA 2XR1A 5TPZA 3K16A 1L6RA 5BQFA 5DBOA 1KAMA 2PK3A 1ADYA 3LKZA 3UJNA 1FFCA 1RWOA 1HQYE 2R96A 3D64A 4YIKA 3QV2A 2QTFA 2ZQZA 5D3MB 3OZCA 5AW6A 2GN4A 3GN1A 5TQ0B 4ZV4A 1KEWA 5I9SA 3G7NA 3RS0A 3ZDQA 5K0FA 2WJVA 4F72A 3FVRA 2NAFA 3CZ9A 2VP6A 4OPMA 5IBRA 421PA 2VNAA 3RK0A 4F4JA 1RDFA 2OQRA 3OEEA 3ZXSA 1S2MA 3OM9A 1Z0DA 1EXVA 1RQGA 2GRAA 2ZIGA 3O7WA 5EP4A 3VM6A 3K1JA 1NUQA 1TUBA 1UT5A 1VRWA 1OI3A 5HXAA 1OTYA 2Y6VA 4R9NA 2VPTA 3CHYA 2VPWA 3O47A 1M34B 4PLFA 1KDRA 1SG0A 5KVQA 2VDOB 2RHOA 1P2BA 3C3WA 4PX9A 1PFGA 2HJRA 1HQDA 3CNEA 3D3JA 1YZQA 3S7ZA 3ET5A 1GPNA 2ZREA 1YVRA 2PBLA 5AXBA 3DBOB 2CJXA 4MR7A 3V1MA 4E31A 4M55A 5A5GA 3FNHA 1TYBE 1FVXA 1HDYA 2ZRJA 1PT9A 5AVRA 2BHSA 3REQB 3FPCA 4BQSA 2QSJA 1J23A 1R9MA 1WO8A 4OHZA 1XMQB 2Q41A 5J1TB 4CM7A 3CF4G 3I4CA 2PZEA 1Z7BA 2OHVA 3DOHA 2NSDA 4LZOA 4UTNA 3GRFA 4PPNA 4F46A 3B89A 1QFJA 2K5UA 3QX9A 1YE3A 5JDCC 3ZHSA 1DWUA 4QUBA 3P0FA 1BEZA 4V0KA 3IC5A 1D4AA 5EWJB 4A0GA 4F96A 3IALA 1EFAA 4BGUA 1KJIA 2CLFB 3TTWA 3TVYA 5TVKA 4MGEA 1BH6A 4F5EA 1ODIA 2IDZA 3FOEC 4Y9DA 3ZU4A 4N47A 4BO8A 2DR2A 3DZ7B 1R66A 2QUJA 3A11A 1HE8B 4PR3A 4QUJA 4WE3A 5A9TA 3ZJ4A 3KR9A 1DMSA 5TC4A 1BROA 2ROQA 3ITNA 3ICQB 1MO3A 4CU2A 4P5PA 4EYEA 4RDHA 1BDBA 1LV8A 1X8KA 3MJTA 1X8LA 3T7JA 5B53A 3DTNA 1DZIA 1XJCA 4QTZA 4H4EA 1QO0D 2O7RA 3EOBI 2P9HA 1QGZA 3OF5A 5HMLA 3WWOA 5TJHA 2I3AA 2CVZA 1PGPA 4JI0B 4Q37A 1BA3A 5T67A 2YYYA 1MQ8B 3U7QB 3ZE6A 4RK6A 5B12A 1GAQA 2C99A 5KYWB 2G0TA 1JE0A 4OXNA 4LGYA 5E9AA 3P71T 1JHRA 2OQVA 4AT1A 3SMQA 3KYBA 1D1QA 3QH4A 4P2BA 3QI7A 3SQOA 3S55A 1OSNA 1EKXA 1SVWA 1NNEA 4G8DA 1OE0A 5I7WA 2ZJBA 2HF9A 1T2VA 2ZDGA 4IG4A 5DYYA 2V9ZA 4YXFA 1KI6A 2OD9A 3UAOA 3AKZA 3IKVA 1NN3A 4TL9A 2VQSA 2CNWA 4QDXA 3BMCB 1RW4A 1E79A 2XBUA 4DIKA 5I8PA 4W1RA 1E0KA 4I6EA 4CF4A 1M76A 3HLTA 3TDNA 4G25A 4HR7A 3UCXA 2BE9A 3A6ZA 4I3FA 4E46A 1DEHA 3IAS1 1SVIA 3KQMA 1Z68A 4IOKA 1CW2B 2FDXA 4LS3A 3IQHX 1K97A 1RC8A 2P9QA 1YH3A 4HAWA 5EJ5A 3H9UA 5K3BA 3HO8A 3HCDA 2CEAA 1B43A 3C3AA 4WLFA 3I9MA 1K9SA 3QVXA 2BFEB 3EOAI 4C7JA 3VKWA 2NO0A 4CI9A 5BV2P 2JFFA 1Z7WA 3KKPA 4LG1A 2W70A 4TSFA 5IUKC 1MO4A 1YXMA 2ACWA 3CCBA 1CUIA 4C21A 2X6RA 5LL6P 4NZ9A 1OAOA 3OP1A 4I9HA 5IUNC 4R81A 1L7EA 1N6NA 5F9HA 1XU7A 1MV8A 3R5FA 1SXJE 3BMCA 1EDZA 2IZ1A 3HRHA 1EVKA 3PA6A 2VDRB 3UC9A 3NGMA 5BYKA 4CETA 2ZB8A 4YUWA 1RXVA 1U3UA 2HL6A 1QBKC 4FEEA 5I7VA 2X0JA 3Q3JB 4LXGA 1XX6A 1YB7A 1KS9A 3ZJXA 1WZUA 1L1QA 3PC4A 3EUAA 4F5YA 1I1QB 2OAEA 2Q0SA 4FFBB 2H06A 2B34A 2F17A 3EG9B 4GG1A 1MO6A 4Q16A 4UW9A 2ZI3A 5IXJA 4RZQA 5K8UA 3R3YA 4QTXA 2FRDC 3C3CA 3FPKA 4M8LA 2HB6A 4YECA 2WWIA 1T9BA 4BMZA 2C2GA 4DBVO 2FRXA 1Y9ZA 4B3CA 4UHFA 1YS2X 5JC1A 1PR2A 1FP4A 3DAHA 3FOFC 1ZITA 1Y3FE 2IYSA 1AB5A 2WRZA 3MPUA 4RTMA 4DKJA 4U2EA 4H7FA 1QHFA 1J00A 3AUAA 1FDSA 2Z4RA 3KE8A 1K0FA 5T5QA 3FI0A 4B48A 1CUYA 4KU4A 2O23A 1ZSVA 2RARA 3DMDA 1KU6A 2LZ0A 4AECA 3I52A 3NC4A 1RJ9B 3D3WB 1LW7A 4KJXA 1X14A 3BGVA 3WO1A 5GJBA 4QAQA 2W6MA 1QV6A 1R4NA 1PGQA 2V7WA 3CUSA 3HACA 4J1TC 1S3FA 4W7IA 1KTVA 3UUFA 3WYAA 5AW2A 1MNAA 3FNFA 1L3IA 1A5SB 3NV9A 4D9JA 4DWOA 1ZHOA 1YB6A 3TIGA 3PFIA 3SBOA 5TMBA 5HS6A 4YY3B 2IZ7A 5DHFA 4G0OA 2E21A 2XUPA 5HILA 4YV1A 1YC2A 2LRHA 5FLXA 1ESCA 3GOHA 1H2FA 3ND9A 3WL6A 4L9SA 3KOUA 4C29A 4OMDA 1PNQA 3ZXIA 1PSZA 3E23A 4JP3A 4ZAYA 1K6EA 1G8AA 3NHRA 3EGDA 2PKXA 2QW8A 2HRRA 1B15A 4RGVA 3VO1A 4MROA 4NZPA 3H6GA 1BZYA 4TXMA 1IBSA 4KR9A 5KVCA 5JMOA 3OQOA 1PR5A 3ZKAA 4HATA 4KPUA 3SM3A 3U5TA 1QWSA 4R9SA 4IIFA 4RS3A 3Q8KA 4NYIR 4GP9A 2A3RA 1H93A 3KHTA 4LRXA 4MRAA 4EYOA 4N1AA 1TQ6A 3AILA 1TTTA 3A2MA 1TECE 1ZOIA 4UMDA 5B2EA 4KXNA 4OSOA 1X15A 4AF8A 1XA4A 3DONA 3OOJA 2G67A 5JLJA 3FGPA 4FDMA 5M29A 4DHEA 5EQDA 2C9CA 3WIVA 3DSRA 3BA6A 4XWTA 3KJEA 5KDOA 3C16C 1XZAA 2DBRA 2GZ3A 1BWRA 2XAUA 3LZCA 3E1KA 3A7EA 2IYQA 4XIYA 5M7EA 1OJLA 3S81A 2B37A 5CTAA 3F8TA 1KYTA 3NAGA 5JWHA 1YI1A 2WAOA 3K5PA 4X3OA 3S2GA 1XO1A 2R4UA 4N9QA 4B73A 1P39A 1CP3A 4C4PA 3A36A 5T64A 5FTMA 1TZ2A 5EESA 2ZVJA 2ZYUX 3LY8A 3GNLA 4M88A 4XEHA 3RSZA 5LDHA 4BAGA 4DY6A 1KO7A 4KIFA 5FUBA 2CCKA 3LWZA 3ADDA 3EPJA 3O6VA 1Z2CA 3EIWA 3ORRA 1Y7HA 5EIEA 5K0TA 3DAGA 2FR0A 4CMGA 4XARA 3ZWMA 1DOHA 4IHJF 4DBLE 5K45A 1GZSA 4NSNA 1Z6YA 5C1OA 1QMGA 5AW1A 2AFIB 1TUIA 2JAUA 3DFMA 4YMLA 3S5JA 5FJJA 1O95A 1GTJ1 4MV8A 1FVHA 2R48A 3PD7A 4B8YA 4BNDB 4ZI7F 1T6XA 4ZRNA 4YS6A 7REQA 3NPMA 4NP6A 1Q0TA 3CU5A 4UNNA 1FLDA 4HYEA 2WAAA 3UVEA 2F00A 4V0OA 3P52A 5F35A 2R2AA 1SD1A 3UUGA 2ONKA 3RFXA 4LY6A 2V9PA 4YRLA 4AY6A 3NYRA 4UVDA 2QMZA 1JPJA 4DV6B 5ESWA 1PVOA 4BNKA 3KXDA 2AMJA 1KRHA 3CKLA 1YDHA 2IU3A 3LS2A 3QE4A 2HIGA 5ALFA 5EJMA 2D6FA 2X19A 1E3EA 1LNZA 4JIMA 4A0RA 1B42A 3TI9A 1PDWA 3K70C 4OMUA 1TEHA 3KR1A 1PJTA 2CLLB 2A94A 1S3IA 3BGDA 3EW7A 4X7RA 3MINB 3HK2A 4FSXA 4WXRA 3HN2A 1E3LA 1BDIA 2NACA 2ZCJA 2ATIA 2A59A 1G7RA 3P2IA 4NAVA 4R68A 1K89A 3WJAA 4URWR 4WXMA 4Y8VA 2TMDA 1XKQA 2R5FA 3IFSA 3F7TA 1N6RA 3HEAA 2VP4A 3O1HB 2XIQA 4NMHA 1GCGA 1UJ2A 1A69A 4QJIA 4XX0B 3WWPA 3EXHB 4EQZA 3EVZA 2R65A 1ISIA 2BVNA 1R12A 3I37X 3V1UA 4QA9A 4D9NA 1IPEA 4Q4DA 1E96A 4JBXA 4K9QA 4QPDA 2Q2OA 2QJTA 3AVXA 1GUYA 1JV2B 3B2QA 3NC0C 3H2HA 1M67A 4QLBA 3DPUA 3TV1A 2OCKA 2ZAYA 2YBEA 4HWTA 4Q03A 2H85A 3QEMB 4MITA 2PPVA 2F3UA 2XNJA 2CDBA 4URYR 4CL0A 1GDTA 1RJ9A 1Q0HA 2AD1A 2WYIA 3D3WA 3HWRA 3NORA 1Z5OA 4K28A 5G0WA 3SC2A 5GQSA 4PC2A 4G85A 4DA0A 9ATCA 4DR2B 2HT1A 1IONA 2PVPA 2QGNA 4OB6A 3UHJA 5BW5A 4ZQBA 3O8OB 1GZ4A 3SZOA 3E15A 4DREA 5FNVB 1JYFA 5JAZA 4WZBE 1OGJA 5L6LB 5DWDA 3LCCA 4WK0B 2XNDD 1IUKA 2B0JA 2H5EA 3KSMA 5CLHA 3S99A 4P58A 3HJTA 1G20A 2VA9A 5ECGC 2EU8A 4GECA 3AINA 1GP2A 2B2NA 2VAXA 1PJZA 2XMPA 4R1OA 1CU1A 2WHEA 5PNTA 5DYNA 3VPXA 4DJDC 3ISJA 2X0NA 3HZZA 3VZCA 1Z74A 1IEWA 3R4CA 4UCFA 5K0SA 3VU8A 4M7OA 1NV8A 4MCJA 3T61A 1UDXA 3UV3A 3AWDA 3R20A 1ZN8A 4UM8B 1BU8A 3LWNA 5DASA 4B32A 4EUFA 3V5NA 5K01A 3SQXA 2WQZA 2WBLC 5T73A 2VYQA 1E5XA 2BSXA 1O97C 3D8UA 4AAYA 1NT2A 3PRJA 1J0EA 3Q7EA 4UU0A 1OI7A 5LQRA 4L9AA 1WZ2A 1BOFA 1PQUA 4WFJA 3K1AA 1IY8A 3DHYA 1X8JA 1EGMB 4OGLA 1S8NA 3AP3A 4R16A 4H77A 3EQ8A 5AJWA 3JD4A 1CD5A 5AM5A 3MUNA 4KRXA 4LHXA 5F7JA 3ZU2A 4DCTA 2HHJA 3AHDA 2VYND 1G17A 1QDUA 3WIOA 3MJFA 2CV1A 3DV0A 2ECPA 2XH8A 2BCGY 3L0IB 3LM8A 4N01A 721PA 1XZEA 1Z6QA 2EF0A 3IBFA 3E3MA 3E84A 1RYMA 4HOYA 5M2QA 3PPIA 4JQZA 4CLRA 3OCUA 1NKSA 2PWBA 2YTZA 3G0OA 3U6BA 1NVMB 4TXHA 1UFRA 2PEYA 3QPUA 1Z6TA 1VDMA 2IY9A 3OQHA 3CTPA 2Y1FA 3M1YA 4LYGA 3TM4A 3ZWXA 5HZGA 1YR7A 3GT4A 3MJEA 3PJRA 1U2DC 1THMA 3NHPA 4QUKA 4YAFA 3BPSA 4UOZA 1KPGA 1DIHA 5GP1A 1PJ8A 3OHPA 2OCXA 2YFKA 2E9SA 4M76B 1F3OA 2Q3MA 4CM6A 1PR1A 3U3MA 1H8EA 1I7CB 2VHEA 4IKOA 3BGSA 3P0RA 1BGXT 3BZWA 3OIFA 3MOSA 3NAQA 2I6SA 1S2LA 1U1FA 2QSUA 2XE6A 1F60A 4IDGA 3HQ4O 3O8NA 4B45A 3W7BA 4X84A 3FOBA 1P7CA 1HNNA 5GAJA 1LK0A 1AQUA 4NPCA 4DLZA 3WLOA 3CX8A 1I36A 5SZHB 2R8ZA 2B7CA 4Q6WA 4AKHA 1VDZA 3GB9A 5FBVB 1P3DA 1PNOA 5KHAA 1IJBA 1ZH2A 3FM9A 5ENZA 1M0EA 3H3XA 4LK2A 3LVFO 1QIMA 1SBQA 2CMKA 3QYFA 2AUMA 1V3VA 4M86A 5ECWA 2CVOA 4IDPA 3LCVB 2EL9A 5JYBA 1M2NA 1W6RA 1WQ3A 1ISMA 3U2QA 2GS9A 4UXHA 2M2IA 4LCBA 1YO6A 1NBWB 2NZVG 3AVUA 3ND6A 3O92A 5TVGA 4CEIA 1V4VA 1VGRA 4ZDKA 3ZDRA 3WYNA 4U9UA 3EPAB 1Y8CA 4L7QA 3VH4A 3I9JA 2LBPA 3ANNA 3DOOA 5AXCA 4XW2A 1G38A 1FYEA 1TQHA 3BCSA 4B3SB 4INJA 2FGKA 1KZYC 2V7VA 3O9MA 1A5AB 3OHMA 4P3NA 5BSTA 4KO8A 3T1OA 3JALA 3HCFA 2QNIA 4BNGA 1XRJA 2FMXA 1M8GA 1W87A 2A7XA 4E2WA 1E4EA 2GZMA 2O2IA 2NO9A 2AOUA 5DZSA 5EZYA 3FMIA 1QUFA 3FG9A 2R1TB 1OMOA 5GY7A 4DBLC 3VPGA 2VHYA 2KLHA 2ZSFA 5LMNB 3RSFA 2OHOA 4OHRA 2UV8A 3N8NA 4XWOA 2VHZA 1WHTA 3W6UA 2XQKA 1U7ZA 3H2SA 4TTVA 3IEUA 2YXNA 1Z0ZA 2Q1WA 2RHHA 3OJWA 3PICA 4ZAZA 3SLRA 4E21A 3EEQA 4KFCA 3COJA 3JD2A 1A9RA 1GOTA 2FFAA 4FFOA 4GUAA 1E3SA 1W2GA 4DLKA 4YALA 2TMYA 4DUGA 3DB1A 4HFMA 1AQJA 4JR1A 3MMSA 3L1HA 4MV7A 1G8GA 5AHRA 3S1SA 5EZQA 1SK9A 4BL5A 4HRAA 4JEMA 4C9BA 2ZRCA 4BJ3A 3D43A 1RKXA 4E5DA 3KGDA 3SX0A 3W2EA 2F8SA 4HSEA 3U49A 3O95A 1EWTA 4RVCA 3REFA 1Z63A 2XBMA 3K1TA 5KNCD 2IOYA 3CIFA 4HRVA 3JATA 1QDEA 1J5PA 4FFLA 4ME6A 2YZ2A 3T4EA 3GP5A 3BAZA 1R8SA 3A6DA 4PIPA 1YIDA 1JHVA 4Q19A 3QVTA 3AF0A 4Z2AA 5HOQA 1OZFA 3RPEA 3FPBA 1MBZA 2YJ4A 1NN0A 4XJTA 4BN4A 3UNXA 4D1YA 2IEZA 2WLTA 3EGIA 4BN0A 5MF6A 5T7BA 3ZPXA 1EEHA 3NBQA 4RZUA 5CT6A 3LHFA 1GRQA 4RH1A 2Z9CA 1ZM4A 2HNAA 4RULA 1L7VC 1TCUA 1JLKA 3LNTA 4XVCA 4QDTA 1FFXB 2ZIVB 3DL4A 3WJ7A 2X3FA 4R01A 1IHXA 4DR1B 1H1DA 2V4MA 3JD1A 5J59A 1GKKA 3OPMA 1CUSA 1BQ3A 2CLIB 4H17A 4MW7A 1W36C 5E6UA 1RQXA 1AGPA 2I4IA 3G2OA 5A7GA 5HYVA 1A5ZA 1IVYA 1O8CA 4C0LA 1NBME 1VCNA 3F9CA 3C4QA 3LK7A 4NONA 5MFZA 2B1JA 2ZKIA 1RXWA 3OWXA 3THYA 2A0KA 1I3MA 2GLTA 3R5SA 5AM0A 3RU7A 4ENVA 1R1DA 3P0EA 4URUR 1K6IA 4JL5A 2XKJE 3TSOA 1TU3A 3GDGA 2POQX 4ODIA 1JA0A 1SAYA 2P75A 2RGBA 4BQOA 4CYMA 3K5HA 1EA5A 1LF0A 5FX2A 1GPLA 3IDQA 1KY4A 2I6QA 1LJLA 4P0PB 3NNDA 5TS3A 5J9FA 1FSFA 3DUFB 5AK6A 1MOPA 2QLMA 4FKMA 3U9SA 3I01A 3H11B 4TLLB 4YPVA 3SKXA 1P7WA 1UPUA 5H16A 2OBXA 3P0IA 4IH9A 3E70C 4PZCA 4YCCA 1GQFA 1F4LA 1E5QA 1W48A 2XWQA 3IDFA 3NYQA 4BYGA 3QOWA 2ONJA 3RSSA 1YNSA 4IBOA 4IJMA 3FBTA 1X1SA 4ENQA 3DDWA 2C7BA 3KE9A 1H2XA 4I5FA 4ZT2A 4AO6A 2HXYA 1RRMA 3MAJA 1O6FA 4O8CA 3PGVA 1ENZA 3UJBA 5LJLA 4CF5A 1MPXA 1XTKA 3D7NA 3B1YA 3VMFA 4AKTA 1HE3A 1LLUA 5HHTA 5KVSA 3AY0A 3B9RA 2ONZA 3LG2A 2AW3A 4HEA6 2WNHA 4IV0A 4CF6A 5IS2A 2FZ5A 4UM7A 3W5VA 5LQCA 1YB1A 2RGAA 1L5RA 2ZSKA 3SFZA 2AB0A 3X0DA 4N0PA 4RNCA 4DTIA 5EMNA 4D2IA 6NULA 3A14A 1AU9A 3GOQA 3GLFA 1U9IC 4JUFA 3PUKA 3VPDA 2HDWA 2BFPA 3FRHA 5LFAA 4XSGA 5ICFA 5LP1A 1YQWA 3REGA 3H4TA 5BOSA 3F6BX 3ABZA 1L5SA 2BTOA 3PGMA 2JLXA 1UBGA 1EP9A 4F1KA 1QHNA 2PMCA 2V3VA 2EFDB 1MJHA 3TUIC 4B6JA 1NP6A 4B85A 3TQHA 2BTQA 1MCZA 3K53A 1SZJG 5CYFA 1FU7A 1IG0A 3AM5A 4PFQA 3S2FA 3HHPA 4HLNA 2HMSA 2F43B 3IVCA 4QULA 4ZRDA 3OQNA 2I0FA 3MJ4A 1LW6E 4K87A 2GO1A 3NT5A 3LXMA 5AVUA 2XB4A 5JQGA 1Z39A 5DPMA 5KTTA 2PXCA 5LJIA 2HSJA 2GSDA 1F2VA 3JQ7B 5EOVA 3AVVA 1WZIA 2CXTA 1EZ1A 4M21A 1PT6A 2QUKA 1IN6A 2OFOA 4H7EA 2CFIA 1GCIA 2QD5A 4BFCA 1T4BA 5K0ZA 2ZQYA 4LSZA 4O2AB 2UUBB 1WSBA 1TAQA 1L8XA 1GADO 1JZSA 1YVDA 1DO0A 2YVLA 4M83A 3MS7A 4HH4A 1C3EA 4GGPA 2ZWOA 4FGKA 4OQPA 4L95C 3DDSA 3V97A 3D6VA 4PFJA 1I4OA 1LK5A 2HO4A 5LKRA 4P86A 4M9CA 5FTJA 2F43A 3JXEA 3QXGA 1HFJA 1ZL0A 4JLSA 4KPGA 1XRMA 3PUWA 4JYPA 4QHTA 4R1QA 3RVRA 1KHTA 3OJ0A 4Q15A 5A4KA 2VDMB 3CCFA 5DV9A 3EGDB 3PNLA