1EVJA

Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
352
structure length
340
Chain Sequence
RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a truncated mutant of glucose-fructose oxidoreductase shows that an N-terminal arm controls tetramer formation.
pubmed doi rcsb
source organism Zymomonas mobilis
molecule tags Oxidoreductase
molecule keywords GLUCOSE-FRUCTOSE OXIDOREDUCTASE
total genus 116
structure length 340
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.99.28: Glucose-fructose oxidoreductase.
pdb deposition date 2000-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1evjA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1evjA01
3FN4A 2YUTA 3C1TA 1C1XB 2DBZA 4EZBA 4H3VA 4TVBA 3VZQA 1EQ2A 4XQEA 5EINA 4XIYA 5JO9A 1U1IA 4PLFA 4BKOA 5L7YA 3FTPA 4KTTE 2H9IA 3W6UA 1LLCA 1FDSA 1YXMA 3VPFA 2WD7B 3GVHA 4Y6SA 2B35A 1KEUA 2OUIA 4WLOA 1VI2A 4CMAA 3FRJA 2YZ7A 2VUUA 4OQZA 4HP8A 4AL4A 3KYCA 5IZCC 1EK5A 2B37A 2DBRA 1BDMA 3S2IA 4TZKA 2NWQA 2VQ3A 4ZQFA 5B1YA 5EPOA 3ZH2A 4DLAA 4NMHA 4EW6A 3WJ7A 4TQGA 2YV1A 1WWKA 3GAFA 1LC0A 5BSHA 2BFAA 1JLLA 3UW3A 3TZHA 3WLFA 1XCBA 4W4TA 3TZ6A 4OOFA 3ZCXA 3DONA 1WZIA 3AOEC 3JQBA 1IOLA 2VWPA 3WFJA 1N5DA 3WB9A 3JQDA 3Q0EA 5KKCA 3UN1A 1A7KA 2Y1EA 2OXIA 4D3DA 5A9RA 3D4OA 2B5VA 1DC6A 5L53A 3JQ8A 1QORA 4O63O 5DT9A 1PGQA 1TEHA 1BXGA 4XJTA 4Y9DA 1LSSA 4CUZA 5IJZA 3F47A 1BHSA 4R01A 5CDSA 1JAXA 1E0DA 4J4BA 5K9ZA 2HSDA 1DFGA 3VKVA 2QYSA 3TZKA 1U8XX 3WSWA 4D3FA 5AVOA 4ZVVA 3GFBA 4PLWA 3MOGA 3I9MA 4BNKA 3ZWYA 1HYGA 1EVZA 3C24A 2AMFA 4ND3A 5T8KA 4XRGA 2YHIA 4NBWA 2Y05A 4Z9XA 1CETA 3CMCO 2B4RO 4ZRMA 3I6IA 4I8XA 2VT2A 3C3XA 3UHAA 3WFIA 1SZJG 3DZHA 2YDYA 4BMNA 2D1YA 4J0EA 3OETA 2G5CA 3QE3A 2WM3A 1HLDA 1RM0A 4MVJI 3TFQA 5JDCA 1GL3A 1XEAA 2ZYAA 3RD5A 5DP1A 2PTGA 4GI2A 2HO5A 4MKRA 4MINA 3BHJA 3GGPA 3OIDA 3GNQA 3WIEA 4NR0A 5CHEA 4XYLA 1NVMB 3WIDA 2NTNA 3F46A 4DMMA 5FYDA 5KVSA 3ASVA 1IZ0A 2CF5A 2YJZA 2YDXA 4MOWA 4PGFA 3WMWA 1P1IA 1L1FA 4EJ0A 4QQRA 4N18A 2XPCA 3TZQA 2NQTA 1YO6A 5L45A 1SO8A 5FI3A 3Q1LA 2GF2A 1AHHA 1BXKA 1IZ9A 5DCWA 1HF3A 3DHEA 1UAYA 5BSGA 1NR7A 1QP8A 5DULA 4FFPA 3FPCA 1ADCA 4WPGA 3GOHA 1F8FA 3K30A 4B3HA 3EZYA 4TRNA 1NQAO 4FFMA 3BTSA 2GR9A 1GCUA 4BO4A 4K26A 1S7CA 1Q0QA 2HMWA 4DPKA 3E6AA 3DZGA 1DRVA 4A03A 4D45A 3VTZA 3WMXA 4AJPA 1V6AA 1YVEI 1PL6A 2HRBA 5JS6A 4QFDA 1GTMA 1SCUA 1QYDA 3U3XA 1UDAA 3QJ5A 4BQPA 3Q3CA 3E8XA 2IXAA 3PP8A 3BHMA 3OM9A 3GK3A 1H6DA 2C7VA 4UVIA 1PX0A 2NVBA 2V65A 1A5ZA 1WDLA 2X0JA 1JDJA 1UXGA 4BNYA 3FR8A 3U0BA 3WGTA 4FD3A 1I33A 1CYDA 4BO0A 4S1VA 3JQ6A 3RC7A 2NU9A 4H16A 1T25A 4U6QA 5L3ZA 3NTQA 1D1SA 1XDWA 5LC1A 1JWBB 3GDGA 3JTMA 3VZPA 1PR9A 3VKUA 4W99A 2VWGA 1ZH8A 4GH5A 1NPDA 2JJYA 2ZB4A 3O38A 4MVJH 3RVDA 4J7UA 3WGGA 5IAAA 2JAPA 4HKTA 3CXRA 3WNQA 2V6GA 3KEQA 1QMGA 4F45A 3DAFA 4CV2A 4E30A 3BMNB 1Y8RA 3HB5X 4PLVA 2CUKA 2Z95A 5I9LA 1NQTA 4XD2A 2UUPA 4OM8A 3VHRA 4GX1A 4XR9A 4B8WA 1WDKA 1KEPA 5JYFA 2CDCA 5KJFA 3WYEA 4I5EA 4FR5A 3LC1O 3AY7A 2ZK7A 2I3GA 3GVCA 1QKIA 1I8TA 3WTBA 1PEDA 3PQDA 2DM6A 4FDAA 5KVCA 2EJVA 2VHXA 3LLSA 4I9HA 1N92A 3P2YA 5A9SA 2FSVA 5COAA 4YBZA 3RASA 4BNGA 2XAAA 5DNAA 2C2YA 5U1PA 4GMFA 3WQRA 4ID9A 5U9CA 3HWRA 1UDBA 3FD8A 3R0IA 4RJTA 1DHTA 1RM4A 3BMQA 1H93A 4DA9A 2NVUB 4L73A 4J9UE 4ND4A 3G1TA 3ON5A 4MDHA 4EJ6A 1O89A 4E2YA 1ZW1A 1X15A 3GVIA 3VPXA 1WMBA 1UXKA 1WNTA 3IAHA 1KC3A 2Y1GA 1VRWA 4ROSA 1QYXA 1A4IA 2C29D 2EGHA 4J9VA 4FOOA 4CL3A 2UAGA 4KTVE 1HSOA 3AUAA 2Y0EA 4PLYA 4BO1A 3SLGA 1Y5RA 4RLSA 3DBRB 3A1NA 5ITVA 1HE4A 1XWFA 4L4SA 2X5JO 1QRRA 3DMTC 1V3VA 4BNZA 3FNGA 5JXWA 4J49A 4DLLA 1PIWA 1TLTA 1E7WA 3K6JA 4IXWA 4CM9D 1ULUA 2DU8A 1Y7TA 3OMLA 3VC7A 4YT8A 4J0FA 3EW7A 2X5OA 4UVEA 3JCZA 3Q9NA 4A0SA 4K9DA 4CM6A 3I9LA 2E82A 9LDTA 1CEQA 4XIJA 2VWHA 4EBFA 1IB6A 4FIZA 1Z74A 1MG5A 2Q2WA 1X7HA 5FF9A 2EKPA 3IJRA 5G4KA 1ZXLA 2NU6A 3BA1A 4ALMA 1T2DA 2PD6A 5B4TA 3LK7A 4BVAA 1DJQA 2YFHA 2ILTA 3L6OO 4NHEA 2P4QA 4U5QA 1K5HA 4M54A 4UULA 2G17A 4O6VA 2I65A 1SAYA 2YY7A 3AWDA 1LU9A 3D7LA 3E82A 3PWKA 3VDRA 3VPSA 2EXXA 4WJZA 3M1AA 4GPD1 2WD8A 2PGJA 2X9GA 3MJVA 4KUHA 4YT5A 4WKGA 3JQGA 4CUKA 3KETA 3MWDB 1LLUA 2AW5A 2BGLA 5MDHA 1JTVA 3P7MA 1UDCA 1NAHA 1YWGO 4CMGA 4GMGA 3JQAA 1H5QA 3WWZA 1CF2O 2X8LA 4CMKA 1R0KA 4Q3CA 1MLDA 2P4HX 1U28A 2CNBA 3OJFA 4AJNA 1V8BA 2X9VA 3E9NA 4NJOA 1AHIA 2C82A 3QHAA 4MVJP 4W9NC 1EUCA 4W7HA 3DBVO 3BTOA 4OGWA 4UUPA 4PZEA 3LLVA 5JMPA 2RH8A 3HADA 5L7TA 3R1IA 3QVWA 4Z6KA 2DBVO 3GFGA 3BYZA 2H1SA 5IZCA 4D3SA 4S3MA 1LX6A 3K8ZA 1XQ6A 4E21A 2AEFA 5KOIA 3B1FA 1LDBA 3AI3A 4U6SA 1KEWA 1ZK1A 5JAIA 3LDHA 4TMFA 4BV8A 2OORA 5KJ1A 4OJNA 4XEHA 3B70A 3VVBA 3LT4A 2DFVA 4I5GA 5A02A 1BW9B 1ID1A 1RYEA 3HDJA 4JGBA 1ZIDA 4GL4A 4CLEA 2P9GA 1PR3A 3F3SA 5IZ4A 2PZLA 1UH5A 3HFSA 4AG3A 2JL1A 4CM1A 1KOLA 3PYLA 2Q22A 3QVOA 1WMAA 4RVUA 4XA8A 5I8ZA 4XKJA 1K2WA 1E3IA 2UUOA 3EK2A 1JAYA 4O0LA 4U0JA 5U4QA 5HM8A 1LDGA 3IL2A 3H65A 4BNXA 4WASA 1E3SA 4YEDA 3CZRA 2QW8A 1R4NA 5I9MA 1ENYA 4YAJA 1DC4A 4R9RA 5B4UA 1YOVB 3MWEB 3B20A 4BB6A 1MFZA 5JC1A 3PZBA 4W6ZA 4MIOA 1DB3A 2Q1WA 3D4NA 3T7EA 3A4VA 4HFJA 3B1JA 4RPGA 4GVXA 3BMOB 3SX2A 4WK6A 4DYDA 1Q0HA 3KLPX 1U3VA 2X58A 4FJ0A 3VH2A 1A71A 4K28A 3VAZA 4U8GA 4L76A 3RAJA 1A4UA 4RDIA 2V6FA 1PJBA 1DIGA 1PGJA 2GERA 2VCYA 2R6JA 4XYBA 4KQXA 2P9CA 1XSEA 1T2FA 1YJ8A 3PIIA 4BGUA 2E48A 4PG8A 4IZHA 3EC7A 1NHWA 1UR5A 1J4AA 1H9AA 1ADGA 4E6PA 4JN6B 3LT2A 2BFMA 3DMYA 4XDZA 2UDPA 1NVGA 2PA3A 4XYGA 3HNPA 3GEGA 1GUYA 1DIHA 1K89A 1I3LA 5AOVA 2RBEA 2PV7A 1E1LA 3QW2A 5JAQA 1Q7GA 3E1KA 3P2OA 1DEHA 3VH4A 4AJLA 1BVUA 3VZSA 5BNTA 4GLLA 4AJOA 5TRTA 4YB8A 4ALLA 2V7PA 4EI2A 4H7PA 1PZFA 4IDFA 5I7VA 2GASA 3GZNB 1XIVA 3I9JA 7ADHA 4JJGA 4L4XA 1GQ2A 3UFXA 3ZDFA 4B4UA 3C1OA 3OQ1A 4R3NA 3U4IA 3QWBA 3GH3A 3DO5A 1C1DB 2AG8A 2VTEA 2WMDA 3H6KA 5BSFA 1LTHR 2EP7A 4J1SA 4JK3A 2HU2A 3WSVA 4CPDA 3L6EA 4YAIA 1E7MA 4LISA 2VNSA 4YT2A 1SOVA 3DC2A 1CDOA 1I3NA 1C0PA 4P4NA 4CR7A 1IY8A 2OFPA 5F3RA 1B3RA 3WJAA 1B16A 5JY6A 1B26A 3CZMA 1B8UA 4PRKA 4XB1A 4M86A 3RUIA 3ZV3A 1VPDA 3D1LA 5A06A 2OMEA 4JROA 2XOXA 1JKFA 3DBRA 3JQ9A 5L40A 4MKXA 4J3FA 4Q9NA 1E3LA 5G0WA 2CVQA 1ZSVA 1I10A 3I6QA 3TZCA 4OXYA 1R66A 4AJ2A 2SCUA 4ZQHA 5GY7A 5ES3A 3ICCA 3BTVA 2JCXA 4YR9A 1AE1A 1NPYA 3AM5A 1GYPA 4WCFB 1PJ3A 3VPHA 3CIFA 4NBUA 4UAGA 2PNFA 2ZQYA 1UXIA 3CTMA 1TT7A 1P0CA 4PLHA 4RZHA 3CE6A 4I1IA 1EBFA 4Y8VA 3GVXA 4AJEA 4J2HA 1EUZA 3IUSA 4XGKA 2D2IA 1NTOA 3ZWPA 5A9SB 5A05A 2NTJA 2B5WA 4Y67A 1NP3A 1HZJA 4L8VA 1EE2A 4OAQA 3UCEA 4NDNE 4Q3BA 3S8MA 4IMRA 1HE3A 4KMSA 3L9WA 2OBYA 4RV9A 1M2WA 1BGVA 2QHXA 1PGPA 4N5MA 4PLCA 2Q50A 3OBBA 1SNYA 5A5FA 4UEJA 3BTUA 1QYVA 2OP1A 1I30A 1XR3A 4BKPA 3PGXA 3N7UA 1YL7A 2W8ZA 1VLLA 1JN0A 3FI9A 3OHSX 1ORRA 2YHUA 3BMNA 2WEKA 2NQ8A 3I9KA 2BI7A 3MJ4A 5TIIA 2HCTA 3DZFA 4CLHA 2CSUA 2AE1A 4Z9YA 1I2ZA 4BO5A 4HBGA 3ZI0A 1F14A 2IEDA 3AUTA 4DXHA 2GNAA 5DOZA 3PK0A 4J91A 5JO0A 1ZEMA 4MIYA 5G0SA 5JLAA 3OA2A 1P31A 1F17A 3IJPA 4BO8A 2JAHA 2QX7A 3U09A 2HQ1A 9LDBA 3GDFA 2ZQZA 1B8VA 1UXJA 1HL3A 4OYRA 1P1KA 5A9TA 2P5UA 3W8DA 3GZ4A 3UCFA 4DTIA 5JAMA 1O6ZA 4RF3A 3PQEA 4M8SA 4C7KA 4D0RA 3QWHA 1ARZA 1B7GO 5KVQA 3IMFA 5M6DA 2VN8A 4RVSA 2Q1SA 4OXNA 1NM5A 1E5LA 1X13A 2F00A 1XU9A 1PQPA 1LDMA 4KUGA 1U4OA 1M6HA 1G1AA 5F1KA 4PVDA 1JVSA 1KVRA 3FCOA 4I9NA 1NHGA 3ONFA 5CG1A 5ICMA 2A92A 1GU7A 3GRKA 3U9LA 2Z5LA 3PLRA 1KVUA 3HFGA 1W4ZA 3PVZA 1LDNA 1YH3A 4D7AA 1LC3A 1OI7A 4R4JA 5TC4A 2Y67A 1PWZA 2ZB7A 4J16A 2Y99A 3DWFA 1U3UA 1ZNQO 1J49A 1ONNA 2GDZA 3ZWCA 4CMEA 3PJDA 5JCXA 3WS7A 4GKVA 1KVTA 1R16A 2C0CA 4XGNA 3BMCB 5H81A 4BUCA 3UXYA 3LVFO 5KNLA 4IY1A 2EJWA 1VJ0A 2CVZA 4B3IA 4PN3A 1WPQA 1I01A 4JNKA 3WGQA 4CLRA 4TZTA 2PR2A 4CMIB 4DQXA 5JDIC 1YE3A 1B14A 1YL6A 2VYVA 3KBOA 3HG7A 2PH5A 3AFMA 2BH9A 3ANNA 1KY5A 3ONDA 2EKQA 2F1KA 4LSMA 4IBOA 4BHTA 4C7JA 4NH4A 1LJ8A 1MXFA 1XYGA 3EYWA 4KQWA 3KB6A 3NYWA 4L4RA 3GNTA 1ZK0A 1BG6A 5EQDA 3F4BA 2EWMA 4QO7A 3NX4A 2R2GA 1OFGA 3HN7A 2GZ3A 4NU5A 3RC2A 2D0IA 4GSLA 3TJRA 4D0SA 2Q2VA 4XCVA 3EVTA 2GN9A 5G2OA 3KXDA 3ZWOA 3PZRA 3PWZA 4R68A 4CMHA 1LSJA 3CKYA 4A27A 3GEDA 2O3JA 1PJSA 5JC8A 3W8EA 2P9EA 4CQLA 3KYDA 2VHZA 1HZZA 5GZ1A 3OEWA 1BWSA 1YONA 3NUGA 4FC7A 4YJDA 4BS9A 4MPDA 4I9UA 1JKIA 2RHRA 4LN1A 3GAZA 5DBGA 3ZHBA 4A73A 4J1QA 2P5YA 5IXSA 3G49A 4IQ0A 1KYQA 4DRYA 1Y9AA 2Q45A 2POQX 3Q9UA 2IZ0A 2WDZA 4HFNA 1XHLA 4LMPA 1DJNA 1G0NA 3STHA 4LGVA 4M1QA 1A9YA 5TS3A 4YQZA 4BNJA 4WCDA 1DPGA 4RL6A 3WICA 2V6BA 4IMPA 4E32A 4RF4A 3LQFA 1C3VA 3V1TC 1LSUA 4LW8A 4WLVA 1GZ6A 3PQFA 1LDYA 3ADOA 4OO3A 1HXHA 2C20A 1EBUA 3M2PA 3NKLA 4HV4A 1LI4A 1ZBQA 3W4JA 4YYZA 1C1DA 4BNHA 2CZCA 3NGXA 1CQIA 5A1TA 2JKVA 2NADA 1LRKA 4DPMA 1GR0A 1N8KA 4IDGA 3FHLA 3SXPA 3QVSA 3LU1A 5BR7A 5JYDA 2JD2A 3K5PA 4E5NA 2HK9A 2DAPA 4E5YA 4YWJA 5KVVA 5A03A 5CEFA 4XQ9A 3ITDA 4BV9A 1VC2A 1PZGA 4KDFA 1ZZEA 2JD1A 5FEUA 4FFNA 1KVQA 4G5HA 4WOJA 1WVGA 1U7TA 4NFHA 1T26A 1R0LA 3F5QA 4RQUA 4XWYA 1M6WA 3GGGA 3ZWAA 4Q3EA 4CMJA 1K3TA 4FS3A 3MJCA 3WGHA 1UJMA 2BLLA 4OMUA 4Z3KA 3GN1A 1C0KA 3KOUA 1ZK2A 2JFGA 3NRCA 2OP0A 1MA0A 4JJFA 5MGBA 4CM3A 1RWBA 5IFLA 4Z0HO 1I2BA 3ETDA 3KSZO 2HK8A 3JD2A 4YAEA 4E2XA 3CSDA 4U7WA 1AGNA 1MV8A 1GCOA 5IN4A 3HJAA 1C14A 4J43A 1HDGO 2P68A 2Z1MA 5CEEA 1WP4A 1H6BA 2DVMA 2PFGA 3WLEA 4CV1A 2Q3EA 5T67A 3OJEA 1GUZA 3RFXA 3ORFA 1KBZA 2HUNA 3EAGA 2EG9A 4AJIA 1VM6A 1PJCA 2AHRA 3O8QA 4TVOA 5BNFA 4GSKA 3E5RA 3UUWA 1NWHA 2G1UA 4FBGA 5F21A 4TROA 4JP2A 4RF5A 4ALIA 5B4VA 4WLFA 1LQUA 4MVJD 4MJLA 2BELA 4L74A 2D8AA 2X22A 3AM4A 2X7HA 1O9BA 1V3TA 4F6LA 1PL8A 1ZSNA 2O4CA 3RCBA 3D0OA 1VKOA 4BGIA 2CVOA 2NACA 4R54A 3L4SO 2RHCA 4ZU3A 3TPCA 4ZHSA 3ABIA 4ILKA 4JX8A 4R3WA 3MCVA 1UAGA 3PEFA 3ZHYA 1Z45A 5JFOA 4P4LA 4JXKA 4BO6A 4B7XA 3PHIA 3OQBA 1E3JA 2J3JA 3L6DA 5HS6A 1PSDA 1HKUA 2GLXA 4BO9A 1ADBA 4CMCA 5H82A 4ZQGA 3O9ZA 3KYCB 3ADPA 1PQWA 2EIHA 3BAZA 1CERA 4JJIA 4YJHA 3A14A 4UEKA 3PDUA 2C54A 5A4DA 5C7IO 3PHHA 1ISJA 3W4IA 3IP1A 4J7XA 3DOJA 4Y98A 2NSDA 2P91A 1IUKA 1N7HA 4E2WA 2GN8A 2WE8A 4MVJF 2PD3A 4NBTA 2QYTA 4EITA 1NYTA 2JHGA 3DFZA 1DO8A 1P3DA 1Q7BA 5TNXA 1YB4A 1ONOA 2HK7A 4EYEA 1EVIA 5JBIA 1Y1PA 4DIOA 3C1AA 4B8ZA 3GRPA 2DKNA 5DF1A 5J23A 3ZNQA 5L4NA 1JVBA 4RVDA 2JCVA 2X4GA 3ICPA 1ZKMA 2HKIA 1GFSA 4PIVA 2YQ4A 2FHSA 7MDHA 2IEBA 1UZNA 1Y8QA 1JW9B 4FC6A 3DDNA 5ITWA 3IKTA 3VZRA 1SBYA 3MZ0A 3WGOA 2FWMX 4URFA 4XDYA 2O23A 4PRLA 2H63A 2W2KA 4CJXA 4JBIA 4QFCA 1O0SA 5LCXA 1YQXA 4ZJUA 4OHUA 4N5LA 3SBOA 1LEHA 1LQTA 3JQ7A 4E0BA 3JD3A 1VL8A 2PKRA 1XA0A 4BNWA 1M67A 1XQ1A 1HYHA 3LYLA 5F5NA 3B1KA 1NAIA 4BMSA 4M55A 4YTEA 1HSZA 2O7QA 4D42A 4UUOA 3JYOA 1WDMA 2EGGA 4QUKA 3HQ4O 1OZAA 4PLGA 4IJVA 1E1KA 5F1PA 3JQFC 3IUPA 3PRJA 4FJ1A 3OIGA 2NU7A 3UKOA 3P19A 4PG4A 1I0ZA 1U4SA 3JQ7B 4CUJA 5DBFA 3MJSA 3KUXA 3P5SA 5KJCA 1EMDA 1ZO8A 3G79A 3ONEA 3AW9A 4E2ZA 2FPPA 2OO5A 1J5PA 3NDJA 5T57A 4ALJA 1TXGA 4A7PA 3W6ZA 4W82A 4WUVA 2PLAA 2FP4A 5IDXA 3NTOA 1I5RA 1YB1A 1PQUA 4N54A 5DCUA 1V9LA 3O8QB 3L77A 2FSSA 1UZMA 1IPEA 3RUCA 4DC0A 1VJTA 1ML3A 1DBVO 3PHGA 3NJ4A 4WOKA 4ZD6A 3JQGB 5EQFA 2R00C 4OKIA 3AOEA 2PWZA 3JQBC 4O5OA 5CEJA 4NBRA 1XU7A 4ZQEA 4D46A 4AJ1A 3GF4A 2J3IA 1E7YA 3CINA 4MP6A 2VRBA 5G4LA 1ISGA 1E1MA 4IUYA 4ALNA 2B69A 1FMCA 4G81A 5TF4A 4NK5A 4LK3A 2X23A 3CH6A 1PS9A 4G2NA 4XJSA 3EDMA 3DBHA 3WNVA 2R00A 3E18A 2H5LA 5C3MA 5THQA 1DIRA 1FDVA 3S2EA 5CFZA 2FY8A 2ZCUA 4IJWA 1N1GA 3H9QA 3HHPA 4BNIA 4BNLA 1GUFA 4WNCA 1P1JA 2D5AA 2VZ9A 4YA6A 3EGOA 4CMEC 3G3EA 1D3AA 4N7RA 5FWNA 3MTJA 1HLPA 1E7RA 1KS9A 3ANLA 4XX0A 2I6TA 4DGSA 4E5MA 4MVJM 3K96A 5JW6A 3AJRA 3K2BA 4KP7A 4YRAA 3ZZNA 2PK3A 2C2XA 2GD1O 5CAEA 4OXKA 1W73A 1E92A 2ZATA 3NJ8A 3K92A 3V2GA 3T4EA 1GV1A 2FMUA 4QT0A 1YDWA 2NVWA 4W7IA 1KIFA 1A7AA 1LRLA 2JHFA 4AJ4A 4WE3A 1OOEA 3C85A 4IM7A 1QV6A 1PS8A 2Q99A 1WAMA 4F46A 1U8FO 1NNUA 2YV2A 3PHLA 5L4LA 3HDYA 1BRMA 5TGDA 2EERA 3H4VA 4JCOA 1P44A 4BNUA 2DTXA 2I67A 2X0NA 1ENPA 2PKQO 3TWOA 3Q6IA 4CLOA 4BKUA 2G82A 2PGDA 4EUFA 3U4HA 4MP8A 4J1NA 3ZV6A 3PPIA 4CR8A 3D4PA 4B79A 4U0KA 4DIBA 4BNTA 5CPFA 3V2UA 3MTGA 3DTYA 1AUPA 3IDSA 1BXZA 3GPDG 3GPIA 4DREA 4CV3A 1ISHA 1IL0A 4FFRA 3PFFA 4IGFA 1DDOA 4CM5A 4Z9FA 2EW8A 2OZPA 3KYDB 3RKRA 1EDOA 4IINA 4NNJA 3ROQA 3JYPA 3TL3A 4ALKA 3A28A 3HZZA 3D3EA 3PTZA 4P4GA 2EP5A 4RQTA 3U49A 3SLKA 2HMUA 4DYVA 3DB2A 1YBVA 1M76A 3RIHA 1NVTA 4HUJA 5KJEA 3I52A 1H2BA 5EL0A 4WLEA 5JY1A 4LCJA 4PG7A 5AXBA 4D41A 4OOEA 1OC2A 4UVGA 1P45A 1WXDA 4NFYA 4ZQBA 1TB4A 1I3KA 1M75A 2DPHA 1XG5A 1PJQA 1HDOA 4JBHA 4RVGA 1VL0A 3IS3A 5COQA 3UF0A 3OQ6A 3WXBA 3OECA 2X0IA 2O3SA 1NASA 1X14A 1Y8RB 2B83A 4J1TA 4I5DA 1I3MA 1VE9A 5TQVA 2WSBA 4DQVA 4IDBA 3WX0A 1P74A 2CY0A 3I4FA 1NWCA 3INTA 1BMDA 1P1RA 3GHHA 4J90A 3DHYA 3OICA 3ZWMA 2NTVA 1V35A 2UV8A 3FWZA 4QO8A 3TN7A 4A26A 2BGKA 1R6DA 4R9SA 4Q3AA 1AXEA 4FCCA 2GO1A 3V5NA 3DHNA 1U3TA 3COSA 3E48A 5EMHA 4EUEA 1NQOA 1EK6A 1CIVA 5I8WA 1ADFA 1FDUA 2NM0A 3T4XA 2NLOA 3WG9A 4KOAA 5IG2A 1DXYA 3PIDA 3FPLA 5DN9A 2WJPA 3W1VA 2GN4A 3NDRA 4MIEA 2PKQP 5ER9A 3NTRA 4MO2A 4BO2A 1P1HA 4XYEA 3H2ZA 5TSDA 1CJCA 2A9FA 3ZNNA 4XB2A 1TI7A 2CDBA 1ZFNA 3VTFA 5JE8A 3DFUA 3OJOA 5TJ9A 4CQLB 1O8CA 3HB4X 3RC9A 3A06A 2J3HA 4CM9A 1A9ZA 4NZ9A 2C7GA 3IP3A 4UVDA 1MC5A 1PL7A 2PH3A 2W98A 2O3UA 3GGOA 4RDHA 1A27A 3H5NA 2VRCD 2HJSA 5IF3A 1B2LA 3H9EO 4XQCA 3F1LA 2W2LD 1NX6A 4GAEA 4OL9A 3IOYA 3WGIA 4DC1A 4UREA 2Y66A 3TDKA 2GRAA 4OKNA 4BNFA 3UCXA 4IDEA 2IODA 4B4WA 4M49A 1RJWA 5I7EA 1X0XA 1LUAA 4HFRA 5AXAA 2YHIB 2J5KA 4Q3DA 1UP4A 3AY6A 1SB9A 3A9WA 4XR4A 2X9NA 4KWIA 2FRDA 2QG4A 1RM5A 4CLRB 1IHYA 5C5IA 5I7FA 2FR0A 3M1LA 2FN7A 3JQCA 3R3JA 3QWFA 4FGSA 1OMOA 3RROA 3ZWWA 2IRWA 1PS0A 4PLZA 1E5QA 3HSKA 4DMLA 1RYDA 2ZTMA 2YYYA 1P9LA 4HWKA 5EJ2A 2ZKLA 1PTJA 3GT0A 4NI5A 3S1LA 1N7GA 4E31A 3HDQA 1QR6A 2BF7A 3ENNA 4D43A 1YBAA 1XKQA 5T6BA 1IHXA 2VYVD 4EJMA 3RKUA 5L4SA 1Z7EA 3O26A 4BIIA 1GDHA 2J3KA 4EUHA 1LSOA 2NUAA 2GGSA 4WCFA 2BKAA 2LDXA 1NQ5A 1K6IA 1FK8A 2VYNA 1LDEA 1UUFA 5BT9A 5DOVA 1L7EA 2B4TO 3QV1A 2DLDA 4II2A 5DCYA 2BD0A 2W4QA 1T1RA 2IZ1A 4JIGA 4DIFA 1I36A 1QV7A 1EUDA 2Y0DA 3FNEA 4CM8A 2OL4A 5TX7A 5BQFA 4ZICA 3RQSA 4HY3A 4LRSB 5DBIA 3WGYA 2W2KB 3C7CB 1SC6A 1IPFA 5KIAA 5KTKA 4AJJA 1NFRA 1KVSA 3VDQA 1GZ4A 4UUNA 3FWNA 4FQ8A 2AQIA 5KJ6A 3LF2A 4IGEA 4BO7A 4ND2A 1QYWA 2VHYA 4DWVA 2NU8A 3H9JA 2GZ1A 2Y1OA 4FFLA 3U4DA 1C1XA 4PZDA 1E3WB 4F3YA 2X1HA 1P1FA 2Y1DA 4Q3NA 4B4VA 2ZJ1A 1HYEA 3S2GA 4IPTA 5CPBA 1NFQA 4CM4B 2AG5A 5ADHA 1LLQA 2XXBA 3B6ZA 4DBZA 3RU9A 3NT4A 1CWUA 4PG6A 1B0AA 4KZPA 1I24A 3JV7A 4E5KA 2BFOA 3QWAA 3QVXA 1OC4A 1RKXA 3I3OA 4CMBA 5C7OO 4YAKA 2E49A 5G0UA 4KWHA 1GPJA 2BGMA 4J6FA 4YJHB 1B3BA 2DQ4A 2C5AA 1ZK4A 2HAEA 3RBVA 4GX5A 1PU2A 2WYVA 4AJHA 1N9GB 3F9IA 1ZMTA 3KSUA 1TVEA 2GYYA 3BMOA 3DEYX 3KVOA 3SC4A 4WNIA 4WECA 2AEJA 2YQ5A 4CLOB 1TT5B 4LMRA 4Z0PA 2VRCA 3H3FA 5B12A 3MJEA 2D59A 1YOVA 4X54A 2VTDA 1R4NB 2VHVA 3AU9A 3ZNPA 4FGWA 4NPCA 4R1UA 4RORA 3N58A 4RF2A 1HDRA 5F5LA 4YAGA 3EVNA 2O2YA 4UVHA 3GG9A 4CLXA 3PXXA 4BB5A 4CQMB 1IYZA 4IQ8A 3JQEA 2DUUA 3D64A 1DRUA 4IQGA 3ZU5A 5HA5A 4BNMA 4IS3A 3WR5A 1S6YA 3V1YA 1HDZA 3I9OA 2ZJ0A 3ZU2A 3T7CA 4MKZA 1K6JA 1DIBA 3F1KA 3JQ9C 3JYNA 4ITUA 2OOSA 4QSMA 2ZTVA 1DRWA 2O48X 1T4DA 3VH3A 2QZZA 4HADA 1O5IA 2PZMA 4Q39A 4F6CA 4BKRA 3H3JA 4ESOA 4YACA 3G0OA 3GG2A 3S2FA 2Q1UA 4B4OA 3TL2A 1EZ4A 1K0UA 3FNHA 5K6AC 1U3WA 4GGOA 4XGIA 1GQYA 1HE2A 3DR3A 4GX2A 2DTEA 3L4BC 4QTZA 1GY8A 1ONPA 1ISMA 3FR7A 4NQZA 1V0JA 4J2OA 1DLIA 3KYBA 1Z75A 2O3QA 1WW8A 2X6TA 4IZIA 2VHWA 4XYMA 1NBOA 3GUCA 3AY3A 4Y6PA 1JWAB 3W4KA 1TT5A 5I9NA 5J9GA 2Q49A 3RU7A 3NV9A 3ZV5A 2I66A 4J4HA 2EW2A 2O7SA 1YGYA 4YXFA 1NFFA 2VOEA 1VKNA 2G76A 1GADO 4LSWA 4RGBA 3TSCA 1EE9A 2HMSA 4RCVA 3LT0A 3DZBA 1LBEA 3GQVA 3CEAA 3RJ9A 3HDHA 4LRTB 6ADHA 5AXDA 3WYCA 1T2EA 5LDHA 1ZJYA 1YBMA 4TKLA 2IZZA 4RPLA 2PGLA 4BO3A 2RH4A 2X86A 3WTCA 3QY9A 3RUFA 5T73A 5ILOA 2HDHA 2P2SA 4INAA 2Q1TA 2PD4A 4RPHA 1J0XO 3VOSA 1X1TA 1U7HA 3I9NA 4BGVA 2J5RA 3PDJA 3GR6A 1FJHA 4G65A 2FR8A 3QLJA 4EEXA 2O50A 4GWKA 4CM8B 1Y5MA 1L7DA 1GZ3A 1A72A 1MXHA 4EEZA 2ZTUA 3GHYA 1QLHA 4ONEA 3V1UA 3AUSA 1T24A 3DZKA 3DMTA 3JSAA 1WLYA 2CF6A 1OAAA 4BL5A 4M87A 1F06A 3I1JA 4GQAA 1DAOA 2E6UX 4DUPA 2TMDA 2OBNA 3KSDO 4AFNA 1RM3A 2A35A 5HTOA 1PWXA 1PJ2A 1UXHA 5G4KB 1T4BA 3GVPA 3UH1A 3H7AA 1H9BA 2C59A 4PLTA 3WQSB 5A5EA 4TKMA 2J5QA 3W8FA 4II3A 4RLHA 1MC4A 2I3AA 1LA2A 1QXSA 1FXSA 3L9XA 4FOSA 1YKFA 2Q46A 1D4FA 1EFLA 2Y68A 3GLQA 4HNHA 2Y0CA 3QQPA 3ST7A 4A10A 3AM3A 1YQGA 1YRLA 1U5CA 4QEDA 5I7SA 2HJRA 1ZJZA 2DBQA 2XXJA 5JCJD 3ZW8A 1QLJA 3PGJA 5CDTA 3K2EA 2HRZA 4NJMB 1FF9A 2BRUA 3ASUA 3RUHA 1SEPA 3IQDB 3FTNA 1QG6A 4L9RA 1HEUA 3NT5A 2FOIA 3JQAB 3JD4A 3G17A 5CP8A 1PGNA 3HE3A 1OBFO 4JLWA 3PI7A 1B15A 2E37A 3NDIA 3DBLB 4CM4A 3H5AA 3TOXA 3KEOA 1W6UA 2JCYA 3HUDA 4YJGB 2QRJA 1U2DA 4ND5A 4QECA 1BVRA 2FPGA 1O95A 3N74A 2FZEA 4E4YA 3EHEA 1VSUA 4O1MA 3PFWO 1R15A 2RAFA 5JDIA 5C7LO 1E7QA 5IDYA 4PG5A 5EERA 5JSFA 1SEVA 4QXMA 4W9NA 5KCZA 4R41A 2VOJA 8ADHA 3BXXA 3O4RA 1DOHA 4WLNA 4C4OA 2BFPA 2ZB8A 3ZN2A 5CDGA 4GX0A 3V2HA 1HT0A 2Q4BA 3F5SA 3OF2A 4TRMA 3RUEA 3UOGA 1E3WA 4IIUA 5COBA 4Y6RA 5GMOA 3UAGA 3ZNOA 3PLNA 1DIAA 2YFQA 3DZIA 3FBGA 4WLUA 3ITKA 4CM7A 5L51A 1H0KA 3MJTA 5K0ZA 3PJGA 4UEOA 1ENZA 1PJLA 4YRBA 2VUSA 3X2EA 2D3TA 1BSVA 4D44A 5G0TA 2DC1A 4IIVA 4P22A 2BHLA 3F6YA 3KHUA 3ROKA 2EHDA 6LDHA 3PJFA 1EVYA 3LF1A 4K6CA 2Y1CA 2AA3A 3H5RA 1Z6ZA 1MUUA 1YJQA 2YV3A 2G0TA 3C7AA 3CPSA 3BZUA 3OEYA 2ZCVA 4BNVA 1Q2XA 4RPJA 3F4LA 4IDAA 2YW9A 1NR1A 2IYOA 3ZV4A 3GA0A 5JYEA 3ZWXA 5FFFA 2Q4EA 1X7DA 2BI8A 2I9PA 2I76A 1XLTA 2I99A 1FDWA 1ULSA 2NVUA 4KDEA 1PJ4A 4GLOA 4H15A 3ULKA 3D3WB 3WWYA 1DFIA 4FN4A 4MVJG 4CODB 4GKBA 5JNLA 3GN2A 1DC3A 3GMSA 3SJUA 1P0FA 3KLMX 1T2CA 1T1SA 2D4AA 4TRRA 2J8ZA 1O94A 4TRJA 1Y9EA 1KY4A 1W0CA 2LDBA 2GCGA 3EZLA 3RSHA 1DFHA 1ISIA 1DAPA 2WYUA 2NV6A 1E7SA 1D8AA 1PZHA 4YT4A 4O59O 1SB8A 3Q11A 3GUYA 1E6WA 3DOCA 3OSUA 4RVHA 3ZW9A 3AOGA 1ZVMA 3TNLA 2V6MA 4M89A 3E9QA 1R4MB 1R4MA 4R1TA 4BQRA 3MOIA 1HE5A 3G1UA 1H6CA 2A4KA 3NEPX 4BMVA 1VL6A 4AICA 5T5QA 3QWIA 5AQ1A 4L75A 4LVCA 3RI3A 2IDZA 3AK4A 5T8KC 3BMCA 4UUMA 1JQBA 1G6KA 1H6AA 2FR1A 2GSDA 2DTDA 4TSKA 4E12A 2O2SA 3I23A 4ZA2A 5TT1A 1Q0LA 1AXGA 1N1EA 3H8VA 3JYQA 3INGA 1B8PA 1MX3A 5A3VA 5JMWA 3LC7O 3JD0A 4CMIA 4R1SA 3D3WA 1FDTA 3AI2A 1GV0A 4YJFA 3QP9A 1F12A 1ZEJA 1VJ1A 4YQYA 1SOWA 4I08A 4GVLA 3C7DB 1HDYA 4N5NA 4EDFA 3SJ7A 1VSVA 5G0VA 3GY0A 5CDUA 2GUGA 3L4BA 3I83A 1MB4A 2B4QA 1JU9A 4R5HA 5DP2A 1GD1O 4NG5A 2O3RA 1ZMOA 4YRDA 1EVJA 4XZ3A 3U62A 2QIOA 2ZTLA 2A94A 1YQDA 1J6UA 3M6IA 4MVJE 1HTBA 3WOHA 1X1EA 1KEVA 1R0SA 1SMKA 3ETGA 3RUDA 4WEQA 1MFPA 1PJTA 5GZ3A 1D7OA 1R12A 2IE0A 2Q2QA 1N2SA 4DLBA 1EFKA 4PVCA 5HBRA 3ROMA 3RC1A 3INRA 3NT2A 4PZCA 4LVUA 3RFVA 3ZWNA 1ZSYA 4CR6A 4BGEA 3V8BA 1C0LA 3QVTA 2EF1A 4NIMA 3JQ8B 3VH1A 1DHRA 5T64A 4YDRA 4YJFB 3K73O 2EKLA 3R3SA 3TQHA 3E03A 3KTDA 3UVEA 1Z73A 1ZUD1 4YVFA 4CQMD 1E3EA 1ISFA 5ENDA 1GYRA 1DSSG 4KUEA 3EUWA 3M2TA 3I5MA 3ETEA 3D5QA 1RPNA 2AEMA 1NPTO 5HS4A 4HX5A 3ZHXA 1YL5A 3IC5A 4RVFA 1YS4A 1AN9A 3FF4A 4E13A 1I2CA 3CMMA 3D5TA 1W8DA 3PHJA 1UP7A 4E3ZA 4BOYA 4WGGA 1G0OA 3E9MA 1GEGA 4K6FA 4A2CA 4TWRA 5HWSA 1I32A 2GZ2A 1CQJA 3X2FA 2QRKA 4GBJA 4K1LA 3DBLA 3DZJA 2W90A 1IULA 5JPIA 4B7UA 1LRJA 2E4AA 3DAPA 1KERA 5A04A 1EDZA 2WE7A 2WD7A 1WZEA 4CV0A 1ENOA 1HWYA 1GAEO 1HRDA 3DBHB 3LZ6A 4LCEA 4WEOA 3AFNA 4DL9A 5CG2A 3R6DA 1YB5A 2C07A 4E5PA 4RZIA 3NGLA 1PGOA 2CFCA 1R37A 5BSEA 5B37A 2JFFA 1UP6A 4OSPA 3RUAA 3OP4A 5ILGA 4YPOA 4YJGA 1ZCJA 5AXCA 4BKQA 2HMVA 3SVTA 1T2AA 2AQHA 1BXGB 2H6EA 1PZEA 1Z7BA 3WGZA 3SC6A 4A5OA 2AQ8A 5EESA 4B3JA 2NNLD 1E1NA 2PZKA 4YCAA 5JDCC 3K9QO 4GWGA 3JYLA 2VT3A 3KV3O 3MEQA 4OH1A 1HDCA 2VWQA 4XQGA 4XRRA 5EN4A 3QSGA 4L0QA 3OFSA 4J7CA 1C0IA 3H9UA 3H9GA 3WDSA 2VYND 5JYAA 1LNQA 3EMKA 3KRTA 4OQYA 4DQUA 1M66A 2WTBA 2DFDA 5TT0A 4IDCA 2IYPA 4NJMA 1ZK3A 1JKJA 4ZGWA 5FI5A 2PZJA 4FSHA 2ZB3A 4JQCA 4CQMA 1E6UA 1H94A 3LT1A 3RFTA 4CLDA 2VUTA 2FPIA 3PJEA 1HDXA 3IIEA 3ZU4A 3QA9A 3RBXA 3Q2KA 4DPLA 2AE2A 3ANMA 1JA9A 3RWBA 2BMAA 3DXFA 1QSGA 1BW9A 4ZRNA 3E5MA 5TLSA 1U9JA 2ET6A 5JAZA 3K31A 4NBVA 1F8GA 1X0VA 2WYWA 5LDGA 4NU6A 2ZYGA 4RO0A 3TRIA 4I5FA 4IS2A 3EY4A 3ROPA 3OJ0A 2AXQA 2HLPA 2J6IA 2RIRA 5GZ6A 4NK4A 4Z0TA 2QQ5A 2VZ8A 4IJUA 5C37A 3WYBA 4EGFA 2IXBA 4E33A 3AUUA 2OGUA 1TA4A 4Z3DA 5THKA 1V3UA 1DC5A 2I5PO 3I4CA 8LDHA 3FBTA 3DTTA 2DT5A 5ER6A 5BNIA 1H2HA 1P33A 1YDEA 1U5AA 1E6EA 4FW8A 4IXTA 4DVJA 3GMDA 3GZNA 3RBZA 2O3TA 3PYXA 2CMDA 2GPTA 4JBGA 3TFOA 4HXYA 1UZLA 2AQKA 2VNAA 5ENVA 4D79A 1D1TA 5K6AA 2Y93A 4BNNA 5IN5A 3ENKA 4R5MA 2Z1NA 3TOZA 2RCYA 1XGKA 3HN2A 2JD0A 2CDAA 5DZSA 1GEEA 2QRLA 3GDOA 2B36A 5IDQA 3UICA 5HRUA 4R1NA 1X7GA 3OA0A 3KM0A 5L95A 2DUWA 4FFOA 4JP3A 3WBBA 4NFSA 1EEHA 3RJ5A 5A3JA 4J4TA 3S55A 4WCFC 1GQQA 1LLDA 2W2LA 5IDWA 1Z82A 3PWSA 2ZIZA 2GN6A 3OH8A 3VVCA 2UVDA 1SPXA 1MG0A 1MP0A 5KWEA 2CD9A 1KC1A 3H2SA 1DLJA 4DBVO 3BHIA 3FNFA 3WQQA 4FPXA 3DAGA 2UYYA 4GGPA 3ZWVA 1NXQA 5L7WA 4HFMA 3QRWA 2EV9A 4R16A 1EQUA 2PY6A 2X5KO 2C5EA 3ZGYA 3JD1A 5ICSA 5F1OA 3TF5A 1BTOA 3GNSA 3DOOA 4HNGA 1ZXBA 4AVYA 5JCJA 3Q2IA 2EEZA 2JFHA 1QYCA 4ND1A 4R69A 1XELA 3DQPA 4PFJA 4AJKA 2OHXA 4CL8A 3GC6A 3PYMA 3ZU3A 4IJKA 4FB5A 1E77A 2HMTA 1CRWG 3L07A 5CDYA 3AI1A 2O4UX 3DL2A 4QX6A 2TMGA 1LXCA 2DPGA 3ZHZA 1BDBA 4P38A 2ZYDA 3LC2O 3BIOA 1U2GA 5IXYA 1HETA 5EIOA 3IKVA 1N9GA 2XF8A 1Q7CA 3GEMA 1GYQA 4ZN6A 2QZ9A 4FJ2A 4PCVA 3OJLA 2D5CA 5TJHA 1Y81A 5DDIP 1IE3A 3FSRA 1MGOA 4MP3A 5KKAA 1KETA 4IDDA 3SEFA 3KZVA 4B7CA 3AU8A 5L9AA 4P8RA 1Y8QB 3JQFA 1Q1NA 2WWRA 3WBFA 2Y1FA 5H83A 3LSYA 1GPDG 3QIVA 1F0YA 3VPGA 4MVJA 2B0JA 3BMQB 2X0RA 3ZWBA 1P77A 1Y6JA 3CUKA 3O03A 5AYVA 3UGKA 3U5TA 3C8MA 2VZ0A 3NAQA 4OSOA 4OIMA 4PLPA 3JQAD 3L0DA 4RPKA 3OIFA 2FZWA 1K6XA 4R51A 3U4CA 3KO8A
chains in the Genus database with same CATH superfamily
3TW0A 2O07A 1C1XB 1C4WA 2E9SA 2DBZA 2HLHA 4MQ4A 2PANA 4AP6A 2HK6A 2ZJBA 2E89A 3R6LA 1EQ2A 4XQEA 4PR3A 2UYHA 2WTEA 4MROA 4IVRA 4V0NA 3UO8B 4Z1MD 4TYYA 4PLFA 4RZ2A 1REQB 1WS6A 2OKGA 2LCQA 2HHAA 3AQ4A 4C7VA 5KX5F 5IM4F 4KTTE 2M6RA 2MSDB 1YXMA 4Q9AA 2GXAA 3EIOA 3LAWA 1Y1SA 4KKVA 4WLOA 3SAJA 3KWJA 4U7TB 1U0OC 3CSSA 3FRJA 4CMAA 1N0IA 4ZC8A 2YZ7A 3A8TA 4MI3A 1G18A 4BVBA 4HP8A 2NGRA 2XQGA 3OQMA 1QPGA 1YHNA 2XNHA 4TZKA 2VQ3A 3L0CA 3N2GB 5B1YA 1R0WA 1ZICA 5EPOA 1Z0KA 1IHDA 1YZLA 3N3AC 3U4AA 2R1ZA 2BN4A 2PUAA 4DHWA 2O20A 1P5HA 2I2FA 5FPYA 5BSHA 3IHWA 3GI1A 1QRSA 1H3EA 1HPLA 2AMJA 1JLLA 4B3BA 3TZHA 1WOYA 2HDWA 2F7SA 1T0HB 4BJHB 4QDXA 1K06A 3NEAA 3TE6A 2DCMA 4N3GA 3W5BA 1JH8A 1UBNA 2FW1A 3JQBA 4JL6A 3DE3X 2GK4A 2GZDA 5FV7A 2W6PA 1EX9A 3BXEA 4JEIA 1A7KA 3TLCA 2B5VA 2JI8A 5L53A 2VF2A 4U9UA 3GJ7A 3C7TA 3V4LA 2E4VA 3EISA 4E14A 2XW6A 1S8OA 1BXGA 3BFXA 4XJTA 3RK1A 5IJZA 1X7WB 4F3CA 2BM0A 5DASA 2A14A 2O5VA 4GICA 5EZQA 5DBOA 4BFXA 4ZI7A 1RI5A 2CXRA 4KC0A 2XHZA 1JAXA 5KX5A 1XVLA 1F4VA 4J4BA 2B94A 2IIPA 1P5RA 2C99A 3BKXA 5CT5A 1PDWA 1XCPA 2QYSA 3JWJA 3KC2A 4X6YA 5E6RA 3RHTA 4CKYA 1I4OA 2QTVB 3CNLA 2DFNA 3A2MA 3OURA 4LCBA 3TLGB 4DR7B 4X20B 4UHHA 3I9MA 3E53A 2ALJA 2GFHA 3C24A 4XRGA 1LFDB 1VB3A 1W2GA 1ZIOA 5T8KA 4WN9A 3WLTA 2CNNA 3IULA 4UUAA 1EP2B 4Z9XA 1CETA 3UV7A 2ZBRA 4I8XA 4BQIA 1Y6GA 4U7FA 3OLYA 3SFTA 4RA9B 2XUGA 3UHAA 4LDPA 2GXUA 3VJRA 1M7HA 3IB6A 1ULBA 4FK8A 1G42A 3OETA 1L7PA 2H07A 2G5CA 4L8GA 1JV2B 3BZBA 4PQEA 4MVJI 1YZUA 3AKEA 5JDCA 1KAQA 4KMMA 2OV3A 1S9DA 1CUUA 3GT4A 2IZ6A 1Q7RA 4ZVSA 3WLHA 1YSCA 2I1VB 3TGPA 3LA8A 3C8DA 3PUYA 3I92A 4DNXA 3T7DA 2FDRA 2IQIA 5C4GB 3F46A 4DDKA 1Q2UA 4IWXA 1AS2A 2VF8A 5IHXA 1P5FA 2ZRHA 3C4QA 3EXFA 1U0LA 1Y9JA 4WRRA 1L1FA 3UAWA 3GEIA 3WMWA 5AKXA 3TZQA 5L45A 1FSPA 4JYMA 2Z3ZA 3CX6A 2O0LA 4I4TF 1L5LA 1AHHA 1IUNA 5DCWA 1HF3A 5C1BA 4N3NA 3W9UA 1INLA 1VYVA 5BSGA 3V2IA 1NR7A 1QP8A 1BQEA 4XCQA 4YDHB 3NNDA 4Q9LA 3GOHA 2AEEA 1VCIA 1XZJA 4ARZB 5KKNB 1X8XA 1DQYA 1T9AA 2PIAA 4CEHA 3MWFA 4HRVA 1R5JA 5IVKA 1QM5A 4FFMA 3BTSA 4BVHA 5HG0A 3PUXA 4KIUA 1ZI9A 3ABZA 2H1CA 3TL6A 1S7CA 1AS0A 4C3ZA 5KWJA 4YFYA 2IGTA 2P3SA 3E6AA 1DKLA 3DDCA 1DRVA 1HQCA 4FGKA 4ZT4A 1GG5A 1P3JA 3UZUA 5AUPB 5C53B 2DPMA 1NNSA 4IZ6A 1YB2A 2ZULA 5DX0A 4AJPA 2GFQA 1IBKB 1TJYA 5KMGB 4UBNA 4J0HA 1MDFA 3LUCA 1FBTA 4O2BF 3J81k 3AYXB 3KOWA 5ALWA 1GTMA 3I01A 3RV3A 1D7AA 2H7VA 4ZOAA 5KB3A 1SBCA 1N9KA 3Q3CA 1VJDA 3IUEA 3PP8A 5FPQA 3AXTA 4LYYA 3OM9A 5DI3B 5ENZA 2C7VA 1GITA 2PMWB 1IJKA 2JH9A 2G08A 3EOZA 2X0JA 3V97A 1JDJA 1UXGA 1EQAA 3FETA 1ZGJA 3DT6A 2VG8A 4WIAA 5IAKA 1IQUA 4F4IA 4NHOA 1L7VC 4ZAFA 1RXUA 1PZMA 3OWHA 3PUKA 4RTPA 1F48A 3GLFE 2XUZA 4GHWA 2Q0XA 2AZ4A 4UTVA 1D1SA 1AKMA 1R18A 4JJ7A 4D8VA 4Z8YA 3QEMA 2PMKA 5KINB 5LOVF 3PSHA 2WVJA 4YROA 3WIBA 3WAGA 1JQAA 1Z0IA 3WB0A 2Q7XA 1NPDA 1U7PA 2ZB4A 4DCJA 4DCUA 3RVDA 1FFGA 5IAAA 3KQKA 1G20E 4DZRA 2VXCA 3WNQA 4LK2A 4AO7A 1XJQA 2BEVA 1U7DA 3FFBA 2ECQA 3ZJUA 1NF3A 2V59A 4EZIA 1YDHA 4BPRA 1JALA 1Y8RA 2CUKA 4YN3A 5I9LA 1NQTA 1NMSA 2UUPA 4DEYA 5LL6P 1LH0A 4P83A 4XR9A 4B8WA 1TVKB 3B1ZA 4PZUA 1JG1A 2HNAA 1KBQA 1ZD2P 2AJ8A 5IW8A 5TMBA 1XDGA 2JI9A 2V4UA 3T3MB 1CUDA 3G2OA 3PEEA 3E9YA 4N3AA 2I3GA 2NSHA 4LY3A 3SP1A 3T1HB 4U2DA 1Y48E 1QKIA 2CL0X 2GK3A 2GJSA 3WTBA 3J7TA 1CY8A 1J7KA 1WHSA 2RI0A 2P6PA 3NXKA 5KYVA 1E2FA 4FDAA 5KVCA 5FOXA 1DMRA 2VHXA 3LLSA 3RSOA 4C7OB 3AP1A 4I9HA 1SD5A 4DCMA 1N92A 1QH9A 3KQYA 3CR7A 1U0TA 2FSVA 5COAA 1K7FB 3KZKA 3QG5A 3WQRA 4PRYA 2ANCA 1DHTA 3MLBA 4KFTA 2XNDD 4U02A 1QQAA 1COZA 1SG9A 1QIIA 2DWPA 2ZIWB 3OPXA 4L73A 4XX1A 5F7ZA 2NVUB 4QTUB 4GI7A 2DP4E 3LBNA 4EJ6A 5IJ9A 3EX7C 1TAQA 3E22B 4DSUA 1CRQA 2OENG 3WDMA 2DZDA 2ZJOA 4N6OA 1PVOA 3IAHA 4HF7A 3D5EA 3T5BA 1ZCFA 2F8SA 1A4IA 1E99A 4X00A 1P9NA 1V1JA 5LSAA 3FPEA 3LCMA 4J9VA 4FOOA 1NJ8A 1FU8A 4Y2YA 1XN4A 4CL3A 4KTVE 3IHKA 3OUZA 3IDAA 3AUAA 3CWCA 3EODA 4FKMA 4MYUA 5C0OE 1QP0A 3SR3A 3KJXA 3A9UA 1FSFA 1Y5RA 5EPEA 3X1YA 1AK2A 3WHLA 4UMFA 1O03A 3D31A 2OBBA 1RJFA 3LA6A 1XDDA 1XVUA 2OV2A 4FNOA 1YHZA 4KXVA 4ADSG 4EFMA 3KTOA 4WSOA 3MOSA 3AV0B 1C9NA 4BNZA 1ZYUA 4AP5A 2WSLA 4J49A 1YQ9A 2VPQA 4DLLA 4EWLA 1TLTA 3LNCA 2P7IA 1ULUA 4CM9D 3R2JA 3B6JA 1ODKA 3BG5A 3ZHVA 3NP9A 3OMLA 1X7ZA 3VC7A 4UPEA 4YT8A 3GGJA 3EWIA 2X5OA 3JCZA 3JVEA 3HM9A 4K9DA 2D2XA 6PFKA 1PI3A 3LVRE 3M4JA 4NDAA 4QULA 1SC3A 4Y1EA 1KORA 1ZD3A 2P0YA 1KP9A 1TIKA 2CHGA 2J6HA 2X2OA 1IB6A 1L5YA 2WHEA 3GLHE 4LI0A 4GGMX 1Z74A 5D85A 3ZV7A 4Z51A 4YRGA 1X7HA 1XMOB 4TLBA 1WKCA 5FWYB 1YB6A 2B8NA 3GFTA 1B4DA 4AG6A 2ZWMA 4M2LA 2DPXA 5FO1A 5B1EA 1SELA 5FOSA 2E87A 4FM9A 1DJQA 2PMFA 3PRYA 4DUYB 3F6SA 4NHEA 4FYIA 4U5QA 1K5HA 4PPYA 2I65A 1O6GA 3OQJA 2RAVA 4NNPA 5IYZF 4RHCA 3N8IA 4LOLA 3K15A 2IYRA 1UYJA 2WINI 2Z5VA 2Q9UA 3IB3A 5I7RA 3HXQA 2A8YA 4DSNA 2L19A 4WJZA 3THYB 1MDBA 3EGCA 3SKYA 4O4JB 5J4KA 4JVOA 4YT5A 4K9PA 3NVKI 5F4ZA 1XZCA 2Y4OA 1LLUA 3MWDB 3IQGX 3X1WA 5MDHA 1P2SA 3IEPA 1X9HA 3R4VA 1Z3IX 4OH7A 1O4WA 3P7MA 2J3EA 4P08A 1H1TA 5CIQA 4IOMA 2HHHB 3ZBQA 2GKOA 2HBZA 1CJVC 3OX2A 3QG1A 4DA4A 1CF2O 2X8LA 1ILWA 3OLWA 3UIEA 5IS2A 3ESYA 3G8CA 3TFWA 1I7BB 4TL6A 3FOZA 1MORA 3KT0A 4Q3CA 1U28A 3MELA 3VSCA 3G2IA 1E3QA 1EP1B 4NJOA 2QZJA 4MV3A 3S5JA 2UXDB 1E94E 2PCJA 4JOBA 3AVQA 4MVJP 5GOTA 1EUCA 5HEKA 1KAGA 2IE8A 3BTOA 3CC8A 1OWLA 3HADA 2PL9A 1DQPA 3AG6A 3LUPA 4Y2QA 4MULA 2DBVO 3GFGA 2VJQA 2H1SA 4DV0B 1FP4A 2QKYA 1ZA1A 4H77A 2AEFA 2QN6A 2CNDA 4D8XA 3CLRC 4JBNA 3U4GA 3AI3A 4U6SA 4HUTA 1KEWA 1MB2A 4LXHA 3DKPA 4N03A 4B9EA 1FXUA 5FLXA 3JAKB 5IZCA 2ZRDA 4EHBA 3ADDA 1C7JA 2JJ1A 2OORA 3KGDA 3EYAA 1ML4A 2RJOA 3B70A 1KNXA 1D6MA 2FSHA 5A7GA 1M8FA 4B3MB 3GAAA 1D9XA 2DFVA 3DEIA 3WL3A 4F4UA 3CXUA 4I5GA 5A02A 1L7OA 3H2HA 3A4NA 3HDJA 3MWGA 3RADC 2EAUA 4KMOA 4H6WA 4DMCA 1MAHA 4GL4A 3IDQA 1DINA 3QH4A 3R09A 2MSKA 2WPDA 1SIBE 3DE0X 3F3SA 2G5PA 3FSGD 3S1AA 3E7WA 3HY6A 1OSNA 1IJBA 4CFYA 2CXPA 2Q22A 4X1YB 2VHCA 3GLGA 1RR6A 5I4IA 4QM7A 1JPJA 3G2LA 4U0JA 5HM8A 2UUOA 1JAYA 2KI5A 4Q6WA 4UZFA 1LDGA 3UA3A 4CW7A 5J47A 1M34B 4Q4CA 2IX9A 1R6XA 4UDNA 3NC0C 4WASA 3FUWA 3IERA 2ARKA 3PXDA 1ENYA 3NBQA 1EX6A 4R9RA 3EC2A 5H70A 3WK7A 4AY2A 1TAGA 3HDTA 5EZ5A 1M2VA 4KAFA 2B8TA 3FWPA 2BKUA 4FKBA 3I42A 3T7EA 3TLBA 2ILVA 1YQEA 1SBNE 1SKMA 1ECLA 3OZAA 4JR0A 1PDVA 4GVXA 1OV6A 2NV2B 4X6UA 3VJLA 1K97A 3COYA 4WK6A 4LY9A 2PG3A 3AF4A 2CYCA 3KLPX 4Y2TA 1QOQB 3U81A 3UJ9A 3VAZA 4DB4A 3CVOA 3X1JA 2B5OA 5FWAA 2PGNA 3WHIA 1DIGA 1QZ3A 3KE9A 4F9TA 3P9CA 2VCYA 3G9UA 5JPCA 2R6JA 3V8NA 3WGKA 3X1ZA 4KQXA 2P9CA 1VJCA 1XSEA 4KGDA 4QGAA 5REQB 3ZKWA 4B9AA 1YJ8A 4GPBA 1XNRB 2HJVA 3VI4B 3M1YA 4IIYA 2PX0A 2FPUA 2Q4OA 3KKZA 4YI3A 3QF4B 4MHOA 1NDUA 3IQFA 5BRNA 3EC7A 1XK7A 3PQ7A 1FW8A 4YRFA 4JVLA 4K88A 3PSAA 4ZMSA 1HTWA 1JLHA 1UR5A 2CKDA 4E6PA 1UQUA 4AYTA 4JN6B 3SDSA 4QGSA 2R6DA 1FMJA 2WT4A 1X9GA 3BD7A 1WCXA 1GUYA 1DIHA 2XWQA 3E9RA 3GEGA 4GMXA 5AOVA 4YPFA 4DABA 4R81A 4G84A 1IMJA 4KV9A 3QW2A 1T0JB 2VBGA 4EENA 5EYPB 4EP1A 5TS2A 4BMOB 4DHEA 5AKIA 4C76A 1CDDA 1M5TA 3HO6A 3VZSA 5BNTA 1WPGA 4TQUS 5H7XA 4GLLA 3CJTA 4QUGA 2H4YA 4AJOA 1O97D 3LV8A 3MWLA 4NE2A 4YB8A 4DLZA 4G9GA 1J5XA 4IDFA 3SZMA 1GOTA 3M5WA 2GASA 5I7VA 1XIVA 7ADHA 3EZ2A 2AOUA 4GBGA 4L4XA 1R6BX 4RLFA 3H1BA 5H16A 2FEOA 1L5HB 3D8HA 3U4IA 4PZ9A 2CJPA 2H1WA 4UXIA 4M37A 3G2KA 3BICA 4ZZ3A 1QR2A 3K4HA 4TLLB 2ZPAA 2VTEA 1YAJA 2Q5IA 5BQPA 1LTHR 3CW2A 2CMFA 3WSVA 4CPDA 4G5OA 1N2CE 4S1NA 1Z3CA 2F62A 1NW5A 4AN1A 2R5WA 1SOVA 3DC2A 1C0PA 4P4NA 4N01A 1PK9A 3HYRA 4UXHA 3WIVA 1EJ2A 2PZ8A 1ZIPA 1UBCA 4XB1A 1DXQA 3IXQA 3ZV3A 1WXXA 2HA5A 1ZN9A 5A06A 1DDIA 4JROA 2ZIAA 3P2EA 2ZJ4A 2ID8A 3QVKA 3UB4A 4BRWA 5HM6A 4RV5A 1E3LA 5G0WA 1MMFB 4YRZA 2FWJA 3BGDA 3I6QA 5HUQA 2AZMA 2QV0A 2HW8A 2SCUA 5FTWA 4GPIB 2QOEA 3DLHA 4B6SA 4JP1A 1J0EA 1J2RA 2XECA 1AE1A 2VK4A 2F2TA 3UH0A 4YR9A 3OM0A 2WQ7A 1E8MA 3AM5A 4FOLA 2NTEA 2CLOB 3TRFA 2WJ3A 3KEMA 2ZXUA 3QFFA 1GUDA 2C2ZA 2ZIEA 1IY2A 2PNFA 3FJOA 3I2FA 3IESA 3G23A 4BU1A 4EHJA 3CTMA 4RFVA 4PLHA 2MSEB 4RZHA 4I1IA 4AJEA 3GVXA 4PQYA 3LK6A 5LVAA 3N07A 1RYHA 1XTUA 2GCEA 4P3PA 4CKCA 3BSFA 4URVR 1FUEA 2ODQA 1C2YA 1ZMXA 2IT1A 2J07A 4LY6A 1Y1LA 3WDLA 1M8GA 4F96A 3DE6X 5A9SB 2GN0A 2Q3DA 4N48A 3T6KA 4Q7KA 2B5WA 4BJ6A 1G8JA 3DUFA 5KSOA 5EMKA 2HZBA 4L8VA 4LHXA 2HPAA 1V39A 4YWHA 3B3QA 3PRKE 3UCEA 2BIFA 3ZTTA 2C00A 3BCRA 1UDRA 1XEFA 1HE3A 1Y5LA 3AJ9A 1DRJA 1SXHA 1NSFA 3KOMA 4DLXA 4TTVA 2OBYA 3JZFA 2JLYA 5L8VA 2R0QC 1BGVA 2P6OA 2QHXA 3W5CA 5IT4A 1CQZA 1ODCA 3VZCA 1L5KA 4PLCA 4ARCA 5ELMA 3TRKA 1M2OA 1ZVJA 2ZUUA 4UEJA 4CHTA 2NU6B 3H1GA 2VQEB 2JLCA 2PN1A 3N7UA 2LW7A 3QUAA 4L0CA 4B87A 2AZXA 4JHXA 2D4HA 1JN0A 2YHUA 4OYYA 3AHDA 5LZ7A 2NQ8A 4ZVKA 2BI7A 3RSSA 4NYJR 3DZFA 5EWMB 5IF9A 5JNUA 3SQWA 2AE1A 1M74A 5GAJA 3ZZ1A 1M1NA 4OEHA 3UATA 4HBGA 4DXHA 3AUTA 4EPYA 5EIXA 2GNAA 1AQJA 3SJAA 4U5XA 4YMIA 5JLAA 4H6PA 3OA2A 1GA6A 3PU6A 3QPUA 3IJPA 1WXGA 4H0CA 4BO8A 5HJ5A 2JAHA 3EC1A 4ZCQA 3UWOA 4YCCA 2D74A 3U09A 1P4AA 1UPAA 1SHLA 2YVUA 4Y1RA 2P5UA 4IKEA 3UCFA 2Q5OA 4M9SA 3W8DA 1VPWA 4U2EA 4KQ2A 3TBFA 3WISA 2X77A 1CRZA 4ETNA 1JQDA 3HLKA 3OWXA 3LDUA 1QRTA 1TM3E 2X4LA 5KVQA 4WCVA 5M6DA 4UBLA 2A1UA 2VN8A 3LFTA 1UC9A 3UAXA 4M83A 1NM5A 3UPUA 3I2KA 3TYXA 4EATA 1PQPA 3TV1A 1EGVB 1J9EA 1P9RA 2YXDA 3ZDEA 1M6HA 2C5FA 3F90A 1W46A 1DBQA 1I7PA 1T3TA 5C18A 3GRRA 1QK3A 2BHTA 3VPCA 1MO3A 4H2DA 3FDXA 1MX9A 5J2UF 2P2GA 1GU7A 2N1MA 1ORIA 1ZOOA 3GRKA 2QY9A 4HCJA 2YICA 4QWWA 4A6XA 4UNSA 4E7PA 4EYGA 1KVUA 5CHYA 1V1RA 1XC7A 2IF0A 4YNBA 4KQ9A 5HYVA 4MPTA 3HVHA 1CK4A 4R4JA 5TC4A 1OGYA 6Q21A 2Q62A 1NBEA 1KO5A 3OCYA 2ZRGA 1YRQA 4BRUA 5LZ2A 4G0MA 1U3UA 4KSCA 1ONNA 4EKNB 3D2BA 3ZWCA 5JROA 1FUYB 2OFOA 2H2FA 4QOEA 2FE1A 4YJ2A 1JJFA 2B7BA 3KQOA 3L8HA 3ODPA 4GKVA 1R16A 4W1RA 3SC3A 4BV3A 4HT3B 3BMCB 4WXHA 3LVFO 3EUEA 2UVQA 3KR0A 1YD7A 4IY1A 1IBSA 2N9UA 5KNLA 4B3GA 1T5BA 2H16A 2YWCA 4TGLA 4U3JA 2EJWA 3LPAA 4LXUA 1SA0A 5CYFA 1XMJA 4EAAA 4PN3A 4CKCB 3OZSA 4F1KA 2HF2A 3KXPA 4JNKA 3GFSA 5CT4A 3UHFA 4G24A 4DQXA 5H3CA 3QTBA 4F3RA 2UZAA 3FHTA 4BRSA 4HNSA 4YS6A 1DCFA 4OBEA 2Q0QA 4QAQA 2I2AA 2BH9A 3ANNA 3WWPA 5JQGA 2BEWB 1Y98A 5LZ5A 1CW2B 4M36A 1COWD 1GPUA 3P9XA 4TWBA 3K20A 1ZUNB 2P2NA 4KK3A 2C9OA 4X8LA 3PNOA 4NCHA 4C7JA 1MXFA 3DTVA 3EYWA 1NSTA 2IKSA 4C6RA 3RTDA 4L4RA 3GNTA 4ZREA 4TV8F 4EJSA 5EQDA 2QTGA 3D59A 3I2IA 4MRVA 4YAUA 4OXXA 3RC2A 2OV8A 3QOWA 2D0IA 3W6OA 5EFOA 3NP7A 2MYTA 4AYXA 4G0VA 4XCVA 1F5SA 2GN9A 1YR1A 3PUJA 3AC0A 1QMPA 1NJ5A 4AQYB 5D87A 4K9SA 2Q3BA 3ZWOA 4M8KA 1USUA 5LXTA 1M1ZA 3PWZA 4X62B 1LSJA 3IURA 3CKYA 4LV5B 2YINC 2ORVA 2PSDA 1NQVA 1TA9A 2IYAA 5IM5A 2ON6A 4WN3A 1FDIA 1HZZA 5D6NA 3S2YA 1VI5A 1S3SA 3NUGA 5E6UB 3QE0A 1VE7A 4X60A 4MMZB 1QIDA 3VUEA 2B7LA 4I9UA 3M4NA 1CRPA 3GAZA 2QRHA 2P5YA 1IONA 1ORVA 5IXSA 1ZJWA 3G49A 2D0PB 4IQ0A 1SVUA 3V46A 3FM9A 4C0KA 1PV2A 2CBZA 3Q9UA 2IZ0A 2WDZA 1VB5A 1DJNA 2O8CA 4GPZA 4JMPA 3R3YA 5BW4A 1XL1A 3STHA 2W6CX 3EZ6A 3FNIA 4JC8A 4BATA 1YZHA 5AHXA 5TS3A 3QJYA 1Z7YA 1DPGA 2KBFA 1FYEA 2GM9A 4IMPA 2JC3A 3LQFA 5KQGA 3V1TC 3KD2A 2IZOA 4MEBA 4TKVA 4BQEA 1NY6A 3FXAA 5DHUA 3GEEA 1ODJA 4OQLA 2JGMA 3ADOA 2PUJA 4JFAA 1HXHA 2W22A 3AKYA 1ZVVA 4HV4A 4MDYA 1JSZA 1QB7A 1DARA 1ZBQA 4KBGA 3A4TA 1UKBA 1JLKA 4RS4A 5TPZA 1B23P 2JBHA 1DP4A 3TLZA 4ZANA 3EZNA 5F1YA 3VKWA 3WHPA 1TC2A 2Q3JA 4NS4A 2I6XA 3MMXA 3N2NA 4YXWD 1ZWKA 1NT2A 4I1YA 3P45A 1AKWA 3O2JA 4HNVA 4G5FA 2HWXA 2AK3A 1Z06A 3NCHA 5HJEA 5JZOA 3CLUC 3FHLA 2Q3CA 4MS1A 3ZJXA 1YE5A 4PTLA 3SXPA 4CFSA 5BR7A 1RMYA 1H65A 2PQ6A 5JYDA 1LWOA 2NO5A 1BKDR 4RKQA 4NMMA 1IXZA 3BBLA 1KPIA 2B8EA 4MJ3A 5A03A 3ITDA 1ZU4A 1NMZA 2XD4A 1PZGA 1M6EX 1M1YE 3F5MA 4KDFA 5AICA 2JD1A 5FEUA 2R6FA 2OTCA 1KVQA 2IUYA 3EW9A 4WOJA 4G5HA 3QEAZ 4DJEC 1U7TA 1JX6A 1YRYE 2QRVA 1T26A 2I29A 4AUMA 1YJXA 1R0LA 3F5QA 3H75A 1TKAA 4RQUA 4XWYA 1M6WA 4CCAA 3TG8A 1K3TA 1DV1A 4ENUA 4FS3A 3WGHA 3IDFA 3L7YA 3IRVA 3OEED 5I7AA 5K0JA 4NZPA 3GAMA 5JEDA 3FTEA 1KAOA 1T6ZA 1C0KA 4CLQA 1TQ4A 2ZR0A 3HBFA 3MFQA 2ZE6A 3A58B 4WZBA 4YMHA 2JIBA 3V3TA 1XPJA 2AVNA 3FIJA 2P9BA 4TXLA 2H7CA 1QCZA 3GDHA 4D97A 3KQLA 1W88B 2D54A 2B99A 5IFLA 4EHNA 1MN6A 3QJGA 3JD2A 1GXSA 1YR6A 3O4VA 4YAEA 1CY1A 5FP0A 1U1EA 4M0KA 4HO1X 5AKEA 1R8YA 4JH0A 3HJAA 3WV4A 1QE0A 4JLVA 5BYAA 3W5DA 1JU4A 2G28A 3UPDA 1D2GA 1T9DA 2C9BA 4JNCA 3R7BA 4MCAA 4M3NA 3HNOA 4JKIA 4BWVA 2GEDA 2HUNA 4ER7A 4L72A 2FSIA 1BFKA 2JG3A 1JDNA 2JEYA 2ISCA 4ZVLA 3ZVRA 4DNPA 1COWA 2I6GA 2Z08A 5DHRA 3FSEA 3WIUA 5JZBA 4GSKA 4NL4H 2JLXA 3E5RA 3ABSB 3CPJB 2HQRA 4PNHA 1CB7A 1FTWA 2G1UA 2ZJAA 4FBGA 4OQNA 4ZPXA 3L8ZA 5D7NA 1Q1ZA 2J9XB 4PO1A 4JP2A 4TROA 2JEOA 2WLSA 4WBNA 2XOKA 3LZDA 5CFPA 4QYTA 2O59A 5E3IA 2W5UA 4BFZA 1JHZA 1BH6A 1ES9A 1B1AA 3RABA 1R8SA 4URWR 2GO7A 2O4CA 3OKPA 2J9RA 3NIGB 1YMUA 3RCBA 3O5AA 3OPNA 4L6IA 13PKA 3GPLA 2NACA 4R54A 1Y3BE 2ETVA 2RHCA 5F4BA 5AJTA 3L0ZA 1I0IA 2PXCA 2OQVA 1GT91 4ZHSA 3ABIA 3G5AA 4JX8A 1T6XA 3MCVA 3R0JA 2C9ZA 3AY0A 3O9MA 5JFOA 1Z45A 4FDVA 3TEMA 2I1LA 2RK4A 2MU1A 4ZYYA 3RRYA 3AGQA 4PSUA 3UK7A 3BQ9A 1S5PA 5H3LA 4Z4HA 3OQBA 2YBEA 3IOMA 4GT1A 4ZAWA 1E62A 1BVHA 4OKSA 2FWBA 4JD5A 4Q93A 5BV7A 2YBDA 4ZJPA 5ICEA 4BVLA 2GLXA 1T36A 1KE1A 1IM5A 3GWGA 3M49A 5HOEA 1ADBA 4CMCA 5IJ9B 4ZHQF 1UT6A 3VYRB 2FW7A 3ADPA 1PQWA 3DYIA 3SEQA 1TUBA 1Y7IA 4ABYA 2EIHA 2V3VA 5HKAA 2R8BA 4JJIA 5AKKA 1QZZA 3TMYA 1YCGA 5DHAA 2Q8PA 4BBZA 4YP7A 3TS1A 4DEXA 4NZZA 4PPFA 2FMHA 2X13A 5BYBA 3IP1A 2OT3B 3GCGA 4UM5A 3ZTYA 1JR2A 2QN9A 2P91A 2ZSHA 3P94A 1N7HA 4EITA 2WE8A 3CISA 1IU9A 2HF8A 1JLRA 4YCLA 1E2JA 5LQMA 3AF3A 2AHOA 4UBOA 5DYNA 3SR0A 1P3DA 1Q7BA 1OF1A 4ZCTA 2PE5A 4AZTA 1ONOA 4EYEA 3EQZA 4L5CA 4KR0A 1Y1PA 3S99A 2TYSB 3JR3A 4PAOA 2W2XA 3RG2A 3C1AA 1TCCA 4AWAA 2AXPA 5A0VA 5KWSA 2INGX 3OE7D 3KSBC 1II8A 4KLCA 1TMKA 3QX3A 4UDXX 3ZIDA 4BE4A 4RVDA 2JCVA 2F8MA 3EPBB 4NDZA 2X4GA 2FEAA 2HKIA 3WBJA 2Z2ZA 4PIVA 1OXSC 5F9MA 2FHSA 1D2NA 2Q5CA 2R68A 3GRVA 1OWPA 2QP3A 4IUBS 5ITWA 4KXWA 5CX1A 5K03A 3DDNA 5IM4A 1VOTA 3K4QA 3IKTA 1ZWLA 3UXHA 3KJGA 3VYVA 2FWMX 4GR4A 1TFRA 3AXSA 2QK4A 2QORA 4PRLA 4Q24A 3O8OA 3EXEB 3W06A 2W2KA 2D8MA 1T5IA 4ZOBA 2J7KA 4CJXA 2GLUA 3MS7A 4TV9B 4EX6A 4LA4A 2BGWA 2XTAA 4QFCA 1O0SA 4R1MA 4ZJUA 1QGUB 3SBOA 4DQLA 1LQTA 5EJIA 4ER0A 5HQ3B 1XAIA 1VL8A 4R0NA 2PKRA 1YV9A 3O3OB 3FDJA 1Q16A 1XMIA 2IFTA 5DMHA 3W5VA 4ARIA 1GTVA 3VR4H 1F6DA 2G9QA 1HK7A 3TRDA 4YTEA 2HPHA 2ZG6A 3TEFA 4WBNB 1FVFA 2YNMA 4TUYA 2FZ4A 4KB5A 2CLHB 4YRJA 3HQ4O 1A3CA 1VGVA 3EXHA 3JPYA 4KK4A 1U2RA 4YMTA 4PZLA 1DOZA 2CCJA 5ELXA 1E1KA 1R3DA 2CXXA 2YOGA 3JQFC 1ZDMA 3OIGA 3PRJA 1CJSA 4EMTA 1EEXB 3C4JA 4MYTA 3SM3A 4PG4A 1CR0A 1PT9A 3A1UA 4J0QA 4YCJA 3MSXA 5DBFA 3MJSA 1Y5NA 1XUOA 1Y5IA 2WNSA 5HKKD 4ZI3A 1ZO8A 3BFJA 4E2ZA 1SHTX 4MSUA 2OO5A 2GTHA 2LIVA 1CUSA 5JS8A 2CHVA 3AF1A 4J16C 1QWSA 2AX4A 4ATNA 2XWJI 3K5IA 3KCNA 3W6ZA 1K92A 5KHOC 3VYTB 1FL9A 3SZLA 1I5RA 3MSCA 2EZ4A 1H69A 2H1FA 1ONSA 1QVAA 4FYPA 3O8QB 3ZU6A 1MR3F 2H4JA 1UZMA 2ZWAA 1JH9A 3BIFA 2G88A 2JFOA 2YN0A 5BXQC 5E9WA 4DC0A 1VJTA 1ML3A 2FG7C 4EH1A 1E1YA 3V1KA 3OAAD 1Y37A 2XUQA 1UANA 1W5FA 4GRDA 1TUBB 2R00C 3ZYCA 4MW9A 3AOEA 5CEJA 1YDMA 2DKOA 4F8EA 3U37A 3F7MA 5FUXA 3GF4A 3H2KA 4LJ4A 3U9TA 2VRBA 5EKUA 5G4LA 3IAXA 4N12A 2QUKA 3VFDA 1BJKA 1HY3A 2GNOA 4UJ5A 3TQRA 1E1MA 1SQGA 4MUNA 3NH6A 4R2XA 2NU8B 3D7MA 5FR1A 4YLYA 1CDEA 1PS9A 3EDMA 2ZBVA 3QBDA 2IXFA 3EDQA 4HSEA 5B5SA 1I5OA 2WIGA 1FQKA 4GP6A 3KAPA 3PF8A 4MWDA 1DAGA 2B7CA 1DIRA 1FDVA 5A5VA 1SKAA 2FY8A 1RRMA 2ZCUA 3HUTA 1D03A 1Z37A 1CUVA 1UBRS 2NXCA 3H9QA 4MYDA 4QUAA 4BNIA 1SVIA 3FCAA 4OM7A 2VUHB 1H2EA 2J08A 3RRFA 2JIOA 2XE8A 1TAUA 1I79B 4WNCA 2GBPA 3H5VA 4L2IB 4WESA 2TS1A 3OHMA 4S0XA 4N65A 2ZRLA 1D3AA 3G3EA 3RBAA 4V2UA 2XWSA 1F9AA 2EBFX 2ZXFA 1Z0AA 4R40A 2TSYB 1Z5PA 3WO0A 1HLPA 1W4RA 4MW0A 3WYNA 2TMKA 3ANLA 4UM9D 2RGBA 4E5MA 2XZTA 4IO1A 3E7DA 3KKKA 3KSAC 2VPXA 3DDWA 3K96A 5JW6A 2Y2VA 4KL8S 3T7KA 2R4UA 4C2AA 2G9ZA 5JH7F 2MINB 3AJRA 1VIDA 2D1RA 4KP7A 1Q7EA 1MOQA 2V0CA 4OLJA 3TPZA 1WXFA 4YRNA 3HYLA 3ESQA 2XRMA 3Q3HA 4MR9A 5BPFA 1AA6A 1W36D 1SWVA 1Z2OX 3K92A 2OLJA 3V2GA 2NZJA 4L5IA 1BNCA 4QT0A 3T9BA 3CLTD 4LYJA 1SD1A 4IJ6A 4W7SA 2J9YB 2IU0A 1N0VC 4JR2A 2JHFA 2QXUA 3VOBA 4WE3A 1OOEA 4L9SA 2WFLA 1QV6A 3V8MA 4A36A 1VKZA 4RH1A 2Q99A 3UWPA 1WAMA 1W5AA 4KGVA 1U8FO 2GOYA 1Q5PA 2YV2A 2ZLBA 4XVRA 3U7RA 5L4LA 1ZESA 4K40A 1BRMA 3RHFA 4R8KA 3H4VA 4Y1FA 3VNSA 1JR6A 3O75A 1ZD5A 4JCOA 4EYQA 4RDCA 1S2NA 1SXJE 3W2HA 5ULLA 1WUTA 2X0NA 4YUXA 4DCCA 1OV4A 1ENPA 3RS4A 4DUZB 3SHWA 2BDUA 4EUFA 1E2PA 1OIWA 1VG9B 4DUGA 1FJGB 4J1NA 5K1ZA 3RRZA 5ESRA 4ZEOA 3TVDA 2BGTA 3LOUA 3TGLA 2QN2A 3MTGA 1Z63A 3OU7A 3EPJA 3SXUB 1AUPA 1GPH1 4HPJB 3DS8A 3GPDG 5JD5A 3SE7A 2R8RA 5EZYF 2Q5JA 1NLMA 5DHPA 5FAXA 4LZZA 1IL0A 1CUXA 4UQOA 4F0JA 1DDOA 2HM7A 2QWXA 4FZVA 2BL4A 2OC4A 4IINA 4E07A 1CEYA 3O8CA 4ZEXA 2R7KA 3OIVA 1RJGA 4ZVUA 5IX8A 5K20A 3TL3A 1A2BA 4GEKA 5EI5A 4OL0A 2IOQA 4IR7A 3STWA 5BVGB 3C3JA 2NO1A 1ZM7A 2GA8A 3A28A 4NAUA 4Q34A 2YJ3A 3S2ZA 4YDSA 4P4GA 4UBIA 3SLKA 4L3VA 3ZI7A 2WSSA 3I3SR 3O31A 3R3ZA 3AHEA 1UM9A 5AHRA 2LVBA 3O7MA 3R3VA 4KBYA 4X84A 4E5UA 2BDTA 4F11A 1H22A 4HDSB 3ZGNA 1DVRA 3R7WA 4PAGA 1THTA 1Q0UA 5BWNA 1UJCA 3QVGB 2ZBUA 4HB0A 3I52A 4FNGA 2PL1A 1HR0B 1H2BA 2BR3A 1C7ZA 4XSHA 5EL0A 5JY1A 1F6BA 4UU8A 3QA3E 4RVNA 1ETUA 5AXBA 2Z1DA 3FLAA 3L04A 1C7EA 1P45A 1P4HA 1WXDA 2PO7A 4MV5A 1I3KA 4P7JA 4EVIA 3IAUA 1T3HA 3GEBA 4IHAA 1VL0A 3OI7A 2XMPA 2EC5A 2FW6A 4XM1A 3OQ6A 3H1PA 3CNOA 2X0IA 2O3SA 2YJNA 3LI2A 4JB0A 1Y8RB 2B83A 4EMUA 4ETIA 1JEOA 1QHEA 2D2EA 4IZOA 5IH7A 5KYGA 4TXMA 2VJLA 5I7UA 1DKMA 2UYGA 2QDKA 3P4XA 3CVXA 3T0IA 1Y4UA 1P74A 2WNHA 2OYRA 4K0RA 1E6MA 4EHAA 1XXHB 1UJBA 2GPAA 4R7ZA 1Z12A 3VU9B 1KZYC 4RK0A 3DHYA 5KX5B 3TN7A 4KPUB 3W78A 4LXXA 4C03A 4A9AA 4KXUA 1PR4A 4IIFA 1SVMA 5AI8A 3E48A 1U3TA 5CD1A 1L9KA 4FOPA 3LRXA 4CEJA 2JDIA 1T2UA 1J1UA 3WG9A 1GTSA 1KFCB 3P9IA 3PIDA 4KWEA 1T9HA 3V00A 3NDRA 3V3KA 4YV0A 2VLBA 3R6TA 1IHUA 5GPBA 4H7IA 1UM8A 1QFYA 1TL7C 1DO0A 3IT0A 1TGYA 2B61A 1F5NA 1CJCA 4S1WA 2GZRA 4CCWA 3RHZA 1R8XA 1Q1AA 2CDBA 4C4XA 2FR8C 2G7ZA 5EIWA 5EJMA 3T3IA 4XD7D 3AVYA 1U2TA 3TIIA 1IQPA 1E5TA 2BM8A 3PCRB 4J07A 3OJOA 2COUA 4U63A 4ACAA 2I7CA 5B1DA 4CQLB 3L7BA 1I6KA 1RC8A 3HB4X 2JVKA 3AR7A 1A9ZA 3UJPA 1QH8A 2Q1XA 3RF7A 1RWWA 4HH4A 4WA7A 3X2SA 5GV8A 2BEUA 4EJ2A 4GM4A 4UVDA 2AK2A 5KQLA 3CZPA 5BYKA 2YX1A 1PL7A 1I7DA 2W98A 1AV7A 4BCCA 4OG2A 1KI9A 1Y1TA 2WG2A 4TKUA 5FBZA 1R10A 1A27A 1BWPA 3DTVD 1FNNA 5IF3A 4XQCA 3H9EO 1G60A 5EUMA 3RU3A 2JFNA 2C7BA 4G23A 4QUHA 1CQWA 3F1LA 4RD2A 3V4PB 2YWBA 3B78A 1IN4A 1KJZA 5KU7A 1J8FA 2R8PA 5J2UB 4MUFA 2O7NA 3IOYA 2GF9A 1A69A 1B0UA 2PYZA 4EABA 3UJBA 3OE5A 2Y66A 4WKCA 1YULA 2OGZA 4BNFA 1G1MA 2WAOA 2ES4A 4L78A 4CNQA 5SZJA 3GJ4A 2X7JA 3KQNA 3BN3A 4Z4GA 4YRIA 2KBEA 2QL6A 3DAYA 3JSXA 4ZVRA 5T4EA 1GZUA 1PYOA 2OD7A 1G4HA 3BCSA 3F8SA 3KVRA 1J70A 1LUAA 1JDBB 2WWXA 3L8MA 5EP4A 2YHIB 4RY0A 1NBMD 1R2QA 1Z6PA 4TYQA 5CVVA 2JIZA 4IDOA 4J7AA 3BRCA 3NBXX 3GMIA 1MAVA 1SB9A 1PR1A 1V2GA 2X9NA 2FRDA 4XGQA 4DYHA 1IHYA 3RJMA 2VYQA 4G0WA 1JZQA 1T0IA 1KJYA 3JRWA 1EFRA 3NO4A 4H08A 1S3FA 3AR8A 3ZWWA 1PUIA 2V7BA 2IRWA 1J9GA 1PS0A 3CLKA 3RRNA 2BISA 4HAOA 4IIJF 4FD2A 3HCNA 3HSKA 2OZKA 1PE0A 2YOHA 3E2IA 4ANFA 3URMA 3K05A 2YYYA 2WFLB 2PEYA 4LKOA 4WK0B 4B44A 4N0PA 1QQBA 4JDPA 4DAOA 1ANKA 4ZZ1A 3S0JA 3BRWA 1G16A 5GONA 3ZLUA 1ESMA 2EJCA 1GZ5A