1DIHA

Three-dimensional structure of e. coli dihydrodipicolinate reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
272
Chain Sequence
HDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 272
sequence length 272
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1994-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dihA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dihA01
4Y6SA 5A04A 1GFSA 2CDAA 3JQFA 3K30A 3WMXA 3IMFA 5JC8A 1Z82A 3PWSA 1FDWA 2OL4A 2EF1A 3TDKA 2XXJA 2GN4A 3R0IA 5JO9A 2BGKA 3F5QA 4JBGA 4Y6RA 5B4VA 3IP1A 2DBZA 4C7KA 1NWCA 2NADA 3RJ5A 3BAZA 2O3SA 2QZ9A 5F1KA 1GCUA 3E48A 3TSCA 4E2XA 3VPGA 1HXHA 1P44A 3JD0A 3LDHA 5TNXA 1DBVO 1JKIA 4R69A 4BO8A 4IDDA 7MDHA 1B0AA 1ONNA 2O2YA 4XB2A 2D5CA 4WKGA 1RM4A 2D59A 3AI3A 1U8XX 3U9LA 4CLOA 4NZ9A 4ND3A 3GEMA 3MEQA 2O3JA 3H5AA 4JGBA 4TVOA 4MVJI 1EVYA 3MJSA 3GPDG 3FNHA 4BNWA 1I3MA 1LLUA 3QSGA 2BELA 1NQOA 2E4AA 2C2YA 2WE7A 4IIUA 3FBGA 1KEWA 4XR9A 3OJFA 3VAZA 1SAYA 3PDJA 3TJRA 4CM4A 1HLDA 3DQPA 3E82A 4ALKA 3B6ZA 3VHRA 2NVWA 3H3JA 1JLLA 4D0RA 2G0TA 4Q39A 1WDLA 1ISFA 1YE3A 3ICPA 4J2HA 3SXPA 4M86A 4CM3A 2FR8A 2Q3EA 3SC6A 4WCFA 4R68A 1JAXA 3B1JA 4TMFA 4A2CA 3ORFA 3WSWA 4J7XA 4XYEA 1AHIA 1KVTA 1PJSA 4HXYA 4YT4A 5EINA 5JS6A 4DIOA 2C5EA 4AJIA 4WE3A 1KS9A 1WLYA 3VKUA 3ITDA 2QQ5A 3GEGA 4J1SA 4PLYA 2BI7A 1H2HA 2YJZA 4BO3A 1CEQA 1BXGB 1ZJZA 5F1OA 5EERA 3C3XA 1T2EA 3CKYA 2VHWA 5CPBA 1R4NA 5KVSA 5EL0A 5KVQA 4DXHA 4QQRA 2OGUA 4IBOA 1F8GA 4ALNA 1B3RA 2PKQO 4K28A 1NM5A 4BMVA 1GV1A 1E7QA 2Q45A 3I83A 1HE3A 1V3VA 1P45A 4LMPA 3DMYA 3D64A 3M2TA 3JQDA 1WVGA 5C3MA 3K9QO 4PG4A 4B7CA 2AQ8A 1YH3A 2I9PA 3GVPA 3WNVA 2YZ7A 4J4HA 4BV8A 4IY1A 3V5NA 4XGNA 1A72A 3M6IA 5JYFA 2ZTUA 3C7DB 1EUCA 2V6FA 3ABIA 1ZNQO 3FNGA 2J5RA 2JD0A 3QVWA 4MVJD 5JW6A 1ZH8A 1WZEA 3RC7A 3GOHA 4JJFA 4J6FA 4GWGA 4OQZA 4D46A 3W6UA 4EGFA 1CQJA 1F17A 2W90A 5EESA 4OO3A 3DMTC 4UUMA 5DNAA 1VSUA 3AI1A 3V2HA 4DC0A 1B7GO 1N9GA 4QXMA 2AG5A 1U5CA 2JAHA 5JAMA 5A9TA 1UDBA 3BMOB 1H6BA 1T1RA 1YDWA 2VHXA 4YBZA 1UJMA 1X1EA 2YFQA 3ANMA 1P0CA 3PLRA 3TN7A 3VPFA 4L76A 3AK4A 2E37A 3LK7A 4Z3DA 2IYOA 2QYSA 4J9VA 5JMWA 2X23A 1DB3A 1ZFNA 3QLJA 4Y98A 2J3JA 5TF4A 5IDWA 3ON5A 4XJTA 4BO7A 4KOAA 5KJFA 5U9CA 3U5TA 2PKRA 2CDBA 4GLLA 2NQ8A 2TMGA 2VNSA 3F5SA 1H0KA 3AY3A 3OM9A 4CMHA 1VE9A 3TOZA 4W9NA 3AOGA 4YJFB 4AJHA 2ZTMA 2ZIZA 1GL3A 5GZ1A 1E6UA 4XRGA 3H4VA 4WCDA 4W7HA 4RPJA 3EGOA 2UUPA 1VJ0A 2X0JA 2GCGA 2DPGA 1E7MA 3GZNA 4F6CA 2P9GA 1HDGO 2X0NA 2DVMA 3WFIA 3VDRA 4OXYA 4RGBA 1BSVA 3DOCA 1Q0QA 4IS3A 5EJ2A 5BQFA 4RCVA 4MKZA 1FDUA 1BGVA 1SEVA 3W4JA 3Q9UA 2NU9A 4EDFA 3JD3A 3JYQA 1Z45A 3S2FA 3ZN2A 1EE9A 1FDVA 1PZHA 4WGGA 1FK8A 1T2AA 3HSKA 4JK3A 2P5UA 1DC3A 4WLFA 1BMDA 3D3EA 4BO0A 3W8EA 4BQPA 4XYBA 4GBJA 3SEFA 4CPDA 3C1OA 1QV7A 3ZWPA 3H3FA 3CIFA 4IMPA 3DHYA 2GR9A 3CMMA 3BYZA 3LC7O 5DBFA 1PX0A 1DC4A 3KSZO 1MG0A 4FFLA 1MG5A 2ZCVA 2VWGA 3UOGA 4ZVVA 1WNTA 4LSMA 4QFCA 3VOSA 2D8AA 1T2CA 2Y68A 1N2SA 5AXCA 4YEDA 5CPFA 5KIAA 1ZW1A 2YUTA 2FSSA 3A28A 4CMKA 3RROA 5L9AA 5L4SA 4JNKA 3HNPA 4GMGA 1OI7A 2QRKA 9LDTA 2BH9A 3OJEA 2VWHA 1U3WA 2OFPA 4P8RA 5JYAA 3U4HA 2PD4A 2R00A 5IN5A 3EAGA 1Z73A 1OZAA 2Y99A 1JA9A 3NGLA 1DRWA 2Y1EA 1V8BA 1C1DB 1Q7BA 1SB8A 4PLFA 1LTHR 3GHYA 5GZ6A 1ISIA 4NFYA 1QYDA 5L7TA 1QYWA 4DQVA 4EZBA 3RSHA 5T8KC 3FSRA 4F3YA 3PDUA 4BO2A 2FHSA 3DZIA 1PZEA 2Q22A 3W1VA 3JQBC 4J91A 3ZV5A 3ZHYA 1MXHA 3UF0A 4MVJA 4JXKA 1UXGA 1J49A 1B16A 2HMUA 1FXSA 4CV0A 3PHGA 3BTSA 1DO8A 2EIHA 5A9SB 3MOGA 4BO4A 1ZXLA 3PI7A 5L40A 3ZV3A 2EEZA 4XIYA 4NHEA 2AW5A 4IINA 5G4KB 5K6AA 5HRUA 4DC1A 1UP7A 3KSDO 1HF3A 3IP3A 1XG5A 4RPGA 3SC4A 1PS9A 2FY8A 4GGOA 5G0SA 5HBRA 3X2EA 1BXGA 5KVCA 4TQGA 1XWFA 4WLOA 1MFPA 4C4OA 1Y9AA 2VRCD 3RUAA 5KJ6A 4GPD1 3C1AA 1O5IA 2QZZA 1MC5A 2HMVA 4AG3A 2EWMA 3BMQB 3WMWA 3QRWA 2J5KA 1PQPA 1RKXA 4H7PA 4B79A 5I9MA 2YQ5A 3ETGA 3CMCO 1YOVB 4B3IA 3NKLA 4DGSA 1HT0A 4OOEA 3A4VA 3WWYA 2CZCA 4J49A 4PGFA 1VL6A 2JL1A 1HYGA 4NBVA 5J9GA 1HDCA 3OP4A 4GWKA 1VRWA 3QWAA 3UVEA 1UZLA 1PIWA 4J90A 3JYNA 4EBFA 1U9JA 1NHWA 3E5MA 1ZSVA 2BD0A 5FI5A 3Q3CA 1EMDA 4FW8A 3WYCA 2W98A 2XAAA 1K6JA 1Q1NA 3JQ9C 5CEJA 4PLTA 4AJPA 3WXBA 5T5QA 3BMOA 3W8FA 4RVGA 1LLDA 3AY6A 2QRLA 2ZATA 1SO8A 2O48X 1F14A 4FSHA 4HP8A 1BWSA 3QVSA 3V2UA 3VKVA 5CDGA 1PSDA 4RF4A 5FEUA 3N74A 2Q1WA 1RM0A 3HB4X 2HSDA 1ZUD1 2AA3A 1LQTA 1LC3A 1GEEA 4E5KA 3KV3O 3HADA 2V6GA 5CDTA 1SC6A 1XSEA 3P2YA 4BB5A 3ZNQA 3LU1A 1XQ6A 2RHRA 1MV8A 2HJRA 1L7DA 1EK6A 2NTNA 4CMAA 1QR6A 2XPCA 4RF5A 2B69A 4WJZA 2PGDA 4YJFA 4BGEA 2WD8A 4PLWA 3Q9NA 1CETA 3FPCA 1R37A 3AUTA 4R1UA 2B5VA 4BNTA 3C8MA 4TRJA 4N7RA 3V8BA 3WGIA 3WBBA 1LRLA 2WDZA 2D0IA 4D42A 4OYRA 5KWEA 4ND1A 4XDYA 3NAQA 2AHRA 3AUAA 3WGYA 3QA9A 4AICA 2GZ1A 3B1KA 2P91A 3ETDA 3H9EO 4E5MA 3GVHA 4IDGA 1GEGA 4WK6A 2BGLA 5G0UA 4A73A 4DLBA 1VC2A 3ZWCA 2F00A 1LSJA 4GMFA 1NAHA 1YL5A 4EEXA 4GQAA 4UUNA 4RJTA 3I9JA 1RYDA 1Q0HA 5F3RA 1LJ8A 3UCFA 1BTOA 1X7HA 2JJYA 3Q6IA 2W2KB 2NWQA 3INGA 3TL2A 4CQMB 4J16A 1UXJA 1JKFA 2PGJA 2PKQP 1Y6JA 2B0JA 3GNTA 3MZ0A 3SX2A 1Y9EA 4GSLA 4CR8A 1NVGA 5DBGA 2R2GA 2NU6A 3IKTA 4ALMA 4E32A 3F46A 3RBXA 1N7GA 1E3LA 3K96A 3OEWA 3PWZA 5TC4A 4K9DA 5ER9A 5JXWA 1DFGA 4ZA2A 3KEQA 1A4UA 4XGKA 1U7TA 5LDGA 3WQSB 5ADHA 2F1KA 2IE0A 3DWFA 2HCTA 3DOJA 4QX6A 4BNIA 3VH2A 2GN6A 2XXBA 2VRCA 3E8XA 4Z9FA 3D4NA 1C1DA 3ZNOA 1TXGA 3STHA 1OOEA 3MWDB 3IKVA 4D43A 4EYEA 2X5OA 2D4AA 4Z0PA 3T4EA 3FHLA 3GZ4A 3QHAA 4LK3A 4R01A 3GC6A 4P22A 1U2GA 1P1RA 2X8LA 3GUYA 4YJHB 4BO6A 4DBVO 5FI3A 4J4TA 4LW8A 2WYUA 1PJCA 1YDEA 3S1LA 1NNUA 4PRLA 5I7EA 4WLVA 5HWSA 3RIHA 1MLDA 3K6JA 4CQMD 2O2SA 5A9SA 5GMOA 2DM6A 5F5NA 2OXIA 4G81A 4CMCA 4E6PA 2EG9A 4YJGB 3RKRA 5A05A 1IHYA 3JQEA 3DONA 1YQGA 4L4XA 3WQRA 5G4KA 2EKPA 4NJOA 4FFNA 2WMDA 1I36A 3V2GA 3CXRA 5BNFA 4BMSA 1N1EA 4UULA 1XLTA 4QSMA 4AJEA 1IOLA 5FFFA 4MP8A 1ISGA 1E92A 1JVSA 2NUAA 1W6UA 4HUJA 4YACA 3QV1A 1R6DA 4YAJA 2QG4A 2PWZA 3VZRA 4MIOA 3L9XA 1DHRA 4WUVA 4XDZA 4CR7A 4FB5A 1IY8A 1U2DA 5CG2A 3DBRB 1OBFO 2EJWA 5JDCC 3DFZA 4EEZA 1T4DA 5BT9A 2VQ3A 2Y0DA 3KOUA 1KVQA 1YOVA 2NVBA 3FTNA 4ROSA 3WGHA 3GAZA 5BSHA 2FWMX 4PG8A 3UH1A 1PZFA 1ZK3A 4XQEA 4ZQGA 2YQ4A 2YY7A 2BFPA 4UVIA 2AXQA 3NGXA 3F4LA 4BNZA 1SOVA 2NV6A 3PJGA 1N1GA 3F1LA 4IJKA 3DR3A 3RQSA 2H1SA 1MP0A 1VKOA 4XZ3A 5MGBA 5BSFA 3WB9A 2O4UX 2SCUA 3B20A 4LRSB 3DFUA 3E6AA 4Q3CA 3K8ZA 3F3SA 4R5MA 2GD1O 1FDSA 3IJRA 2QIOA 3LT4A 4BNUA 4CV1A 2HJSA 5KNLA 1ZO8A 5G4LA 5EN4A 4JX8A 1N5DA 2DLDA 1ADCA 4S3MA 4AJ4A 1ADGA 3DBLB 3WR5A 1GAEO 4FD3A 4E4YA 2YFHA 2HMTA 4Z6KA 4KWIA 2J3IA 2DAPA 4DPKA 1UR5A 3OECA 5IXYA 1RWBA 2EKLA 1HSZA 1O94A 1BVUA 4YRBA 2DBQA 2DPHA 3KRTA 1H9BA 4CMEC 3WX0A 2JKVA 4BNXA 1G0NA 3X2FA 3V1UA 4UUPA 3ZWNA 4PZCA 4DTIA 3VPXA 4G65A 1H93A 4IUYA 1OAAA 2YV2A 4PZEA 1XCBA 3C24A 3F4BA 5FYDA 3JYLA 2XOXA 1NR1A 2EKQA 1U1IA 3ZU4A 3GVIA 1GQYA 4FGSA 4IJWA 5DF1A 2I65A 5G0TA 2BFAA 5L7WA 1AXEA 3DL2A 3ADOA 1Q0LA 2IZ0A 4QO7A 1I2BA 2PZMA 1QLHA 2YDXA 3WIDA 3WJAA 4IDFA 4ND2A 4D7AA 4WOKA 3NT4A 1VJTA 4H16A 3K2BA 2DTDA 3V1YA 3S2EA 4NH4A 3SJ7A 3ONDA 4IDAA 2BF7A 1NFFA 5TJHA 1JKJA 5C5IA 3GVXA 1XQ1A 1NPDA 1PQUA 4E5YA 5A3JA 4FC6A 2CD9A 2ZYDA 1O95A 1SB9A 1P74A 5F1PA 3QY9A 5A1TA 4NFSA 4XD2A 4RVHA 3A9WA 4RPKA 3E9MA 2W2KA 4B4OA 5TIIA 4CQMA 4TKMA 1QXSA 1OC2A 4PRKA 3JV7A 1RM5A 1NP3A 2AMFA 1Z74A 5JC1A 3ETEA 5HTOA 2YHUA 1EFKA 1DSSG 1XIVA 4BB6A 4AJJA 2C7GA 2Q46A 5JAZA 5L4NA 2FSVA 1ZIDA 4IGEA 3C1TA 3VVCA 3ZI0A 4RZIA 2Q49A 5J23A 1SCUA 1GDHA 1LXCA 2GF2A 4BNKA 4B3HA 4OXKA 3WIEA 1NVMB 2DQ4A 3DAFA 4BGUA 1QG6A 3OMLA 5L3ZA 4ZJUA 4W99A 2IYPA 4FJ0A 4XRRA 1SZJG 5K0ZA 4GKBA 4O6VA 5JMPA 4Z9YA 4E30A 5G2OA 1I2CA 3DZBA 3R3JA 1MC4A 4YT2A 4JN6B 3ANLA 3M2PA 3S55A 4U0JA 1E77A 3PTZA 3RKUA 4FIZA 3ZWXA 2PZLA 5DDIP 5AVOA 5ILGA 5KJ1A 3R3SA 2I67A 1G6KA 1ZJYA 4A26A 2E48A 3R1IA 2G1UA 4YJHA 1WP4A 3KVOA 5ENVA 1UXKA 4UVDA 1GUYA 1JW9B 3H65A 2QYTA 3PEFA 4WLNA 3Q2IA 3JQFC 1Y81A 2O7QA 1VPDA 2JHGA 2GNAA 5COBA 5A3VA 1CIVA 1EE2A 1PGPA 2R6JA 3OETA 4WASA 4Z0TA 5AOVA 1Y5RA 2PNFA 4NR0A 2OP1A 1EUDA 4YJGA 5A06A 3L6OO 5JY1A 1RJWA 3H5RA 2ZKLA 3ASVA 4CL8A 5TQVA 4J7CA 1LDEA 3ST7A 3WTCA 3ZDFA 2NLOA 2G17A 3INRA 3Q1LA 4GKVA 4GVLA 1KETA 4C7JA 5TRTA 1Q2XA 4GX0A 4DIFA 4J7UA 1ZK4A 1TLTA 4IDEA 3LT2A 4LMRA 5T67A 2AQHA 1UAGA 3LYLA 4MVJG 3IL2A 4KMSA 2OZPA 1F06A 4UEOA 4F6LA 2H5LA 3B70A 3CUKA 2VYND 3T4XA 6ADHA 3IUPA 3AOEA 3DBRA 1PS8A 3ZZNA 1H6DA 1BVRA 5ER6A 3TNLA 3WLEA 3COSA 5BR7A 4O63O 1NBOA 5T73A 3BA1A 3GK3A 1UP6A 1R0LA 3CZRA 4O0LA 4R4JA 1JAYA 4JP3A 4O5OA 4WLUA 1LSOA 2W4QA 2EJVA 5KKCA 4NU6A 3WGOA 4L9RA 4JROA 2YYYA 1DXYA 4KDEA 1A27A 2VTDA 1GZ6A 4WCFC 3NT5A 1GTMA 3CTMA 2FR1A 1H94A 3G1UA 3L9WA 2HK9A 5ICSA 2A94A 3U4IA 3DAGA 5HA5A 5F21A 3D1LA 5JCXA 1E6EA 2Q4BA 3WYBA 4J43A 3TWOA 4GLOA 4D44A 1A5ZA 2J6IA 1ZKMA 5KOIA 3HFSA 3PIIA 4LCEA 3HFGA 4MVJP 1PJ2A 4JLWA 3FRJA 4E21A 3RUIA 3EZYA 3INTA 2V7PA 4EI2A 3DBLA 4N54A 1YO6A 2OMEA 3HHPA 3TFOA 1PEDA 5U4QA 1U4OA 1K89A 2C54A 4FDAA 1B8PA 2C82A 3IDSA 3EMKA 4IDCA 1NQ5A 5B4UA 2EW8A 1UAYA 4BNHA 3L0DA 1E6WA 3PXXA 1NXQA 2FPPA 5H81A 4II2A 3PQFA 2B36A 1PZGA 3PJDA 4QO8A 4FN4A 3ZW9A 1SOWA 5B4TA 3QJ5A 2EERA 1LSSA 4Y8VA 1SEPA 4IZHA 4AJLA 5JPIA 2X86A 1TA4A 5EIOA 2O4CA 2WWRA 4N18A 1GR0A 1A7AA 4PIVA 2Z95A 1XU9A 2I6TA 3LZ6A 4ZQBA 9LDBA 2IODA 2VWPA 4KQWA 2VNAA 3ZWOA 2UAGA 1NQTA 4PG5A 3S8MA 2Z5LA 2J8ZA 2GERA 3GUCA 3HWRA 3SVTA 3U4CA 3LF1A 3GN2A 4LISA 4OMUA 4LVCA 3IS3A 3KLMX 1PGOA 4IXWA 4RDHA 2C20A 1LBEA 1KEPA 3NT2A 4DQXA 4HY3A 2GRAA 4E2WA 1D7OA 2B37A 3KEOA 4M8SA 4PVCA 3ZU5A 1O8CA 3ENKA 3OH8A 1UDCA 4J0EA 5G0VA 1GZ3A 2D2IA 4CM9D 3ZH2A 5T8KA 4M49A 4L4RA 3U0BA 4KUGA 2Q2QA 2NVUB 3PJFA 2PH5A 3G0OA 5A4DA 1KC1A 4F45A 2X0IA 3JQBA 4BGIA 2DBRA 1ENOA 3O26A 4I5EA 1KVUA 1LLQA 1QORA 4BO1A 2BKAA 3IQDB 4FCCA 4IGFA 5JFOA 3FCOA 4EW6A 1U3VA 2Y67A 2ZQYA 3UUWA 2NM0A 2VYNA 2JCXA 4BQRA 1DFHA 3HUDA 3PJEA 3HDQA 5CP8A 4HADA 1HE5A 3I9OA 4DVJA 1SMKA 4FFPA 1BXZA 4AFNA 3PYXA 1DLIA 5T57A 3CINA 1VSVA 3KZVA 3VTZA 4B7UA 1AXGA 1YS4A 4Q3AA 2AEFA 1HWYA 1SBYA 5ENDA 3RUHA 4YA6A 3UKOA 5DP2A 4DPMA 2JD1A 3P2OA 4DYVA 4HNGA 1E1LA 2JAPA 4BO9A 1E1NA 1ULSA 3CSDA 2P9CA 3GNQA 3WJ7A 4BVAA 4Z3KA 2QHXA 2VYVD 1DIGA 1Z7BA 3MJEA 3DC2A 1P0FA 5DT9A 5JYDA 1MUUA 2PA3A 2HMSA 2Q4EA 2RCYA 3HZZA 4W7IA 3ZU2A 3PYMA 3UW3A 3O8QB 2R00C 3AUSA 1K0UA 4L73A 2FPGA 1MXFA 2VZ0A 4GX2A 1LNQA 4FFMA 3OQ1A 2NU8A 2EGGA 4AL4A 3RCBA 4LSWA 3TZHA 5CDSA 1C0LA 5C7IO 4UVEA 4UVHA 1NX6A 4R5HA 3E9NA 3H7AA 3WNQA 4CUJA 4EUEA 5G0WA 2Y66A 1DDOA 1M2WA 5L7YA 4ZICA 1R0KA 3LLVA 4DREA 1ZEMA 3BHJA 4P4LA 1JU9A 4E31A 4MKXA 1CF2O 1UXHA 4DIBA 2BFMA 2QX7A 1YB5A 2B5WA 3IC5A 1C1XB 3JQ9A 5DCWA 2B83A 1VL0A 3I4CA 3PQEA 4U8GA 4CLDA 2IXAA 1J4AA 4DYDA 5A5FA 2OHXA 2V6MA 3TRIA 2FRDA 3GDGA 3QWFA 1LI4A 4YR9A 1EK5A 1E5LA 4L8VA 1PJQA 4BNNA 1B2LA 4CMJA 6LDHA 3OEYA 1HDOA 4IJUA 2D5AA 3WGGA 3WWZA 4BKRA 4B7XA 2G76A 1B3BA 1PGQA 2X9GA 1U4SA 3RFXA 1AHHA 5K6AC 3GMDA 3UCEA 5KKAA 1WAMA 3I9KA 4ND4A 1JDJA 5KVVA 3E5RA 4CUKA 1IPEA 3PK0A 1JN0A 3KB6A 1IB6A 1A7KA 1EDOA 4GL4A 2AQIA 3OJOA 4R54A 1I0ZA 4IJVA 3PIDA 1T2DA 1ENPA 3C7AA 4Y9DA 1JQBA 3EHEA 2OBYA 5L53A 1JWAB 1NYTA 1UDAA 2VOEA 2LDBA 4I08A 2H6EA 4ALIA 4TWRA 4CM9A 2P4HX 3AU8A 2DTXA 2OP0A 4XA8A 1PJ3A 1CWUA 1K6IA 4RPHA 2H63A 4YPOA 4PLGA 2G5CA 2CVQA 3L07A 3OIGA 3RUDA 4YQYA 1D8AA 4XQ9A 4BMNA 1NTOA 4OKNA 4QFDA 1OFGA 2PD6A 1DIRA 2YV3A 3RI3A 1CDOA 4UEJA 2CMDA 2J5QA 2HQ1A 2GN8A 4E0BA 4NBRA 1F12A 3EDMA 4RLSA 1X0VA 3WG9A 1DIHA 3ONFA 2VZ8A 4B8WA 3HJAA 4MVJH 3GMSA 4J9UE 4E2YA 3ZGYA 4OAQA 3GEDA 4JP2A 3L4SO 3FI9A 1M75A 3D7LA 4FQ8A 2AQKA 1DJQA 1HDYA 2Q1SA 3VZQA 1CYDA 2OUIA 1M6WA 4J3FA 1XR3A 1H6CA 2AEMA 4Q3NA 4YT8A 3EC7A 3GDFA 3DBHB 4BO5A 1ISHA 2VYVA 1E7SA 3F9IA 4GI2A 5AXBA 1CRWG 3AJRA 1NR7A 3GAFA 3IUSA 4JJIA 4S1VA 4XR4A 4A10A 4IZIA 2ZB4A 2YHIB 1FF9A 2NVUA 3PGJA 5BNTA 3ZWWA 3HQ4O 3MTJA 3OIDA 2ZCUA 3UFXA 3K5PA 2VT3A 1B14A 2JFGA 4BIIA 2HDHA 4AJKA 4BKOA 2VUUA 1M76A 2BFOA 4WOJA 1W4ZA 3H9UA 4NQZA 1CJCA 2NNLD 4HBGA 4ZGWA 3GGOA 4TRRA 2BHLA 1DC5A 4HNHA 1K3TA 3HB5X 4XJSA 4DRYA 1A4IA 1LRKA 1MX3A 3MJ4A 2VTEA 5TS3A 3VH1A 5AQ1A 4NNJA 3MTGA 2Z1NA 1DAOA 1GPJA 5IDYA 1T4BA 3ZCXA 1PR9A 2NTJA 4A7PA 2W2LD 4LRTB 1ZK2A 2GGSA 4NK4A 4CV2A 5IF3A 3TZ6A 2UDPA 3AY7A 1HYHA 2DFDA 3LLSA 3KYCB 3G49A 2D1YA 3VPHA 1PL7A 3QWHA 4GVXA 3L4BC 4EUFA 3DTYA 1C0PA 2ILTA 5HS4A 2BMAA 4DLLA 2GASA 3PLNA 4RDIA 2Y1OA 3EW7A 4PG6A 4FFOA 1NPYA 2A9FA 3DZHA 4RVUA 3AM3A 1NHGA 3JQAB 4IIVA 2PLAA 1K6XA 3O8QA 2PK3A 1H5QA 3DXFA 4JCOA 4YB8A 3RUFA 5L51A 2A35A 4KUHA 3FNFA 4K1LA 4ZQEA 3H9GA 2DC1A 1ZCJA 2RH4A 3ZHZA 3JD1A 1E1KA 2IZZA 3FWNA 3OICA 2DUUA 2P5YA 1V3UA 4BNVA 5JY6A 2DKNA 3RUEA 1J6UA 3ZHXA 1O89A 4AJ1A 3BMQA 4AJOA 2X6TA 3U3XA 1V3TA 4PLVA 1PGJA 4KWHA 1E5QA 1HETA 1T26A 4YVFA 1C1XA 1KEVA 2JCYA 4XEHA 5JCJD 4YAIA 3NYWA 4E5PA 1T24A 5BSGA 3GVCA 3P7MA 1R4NB 3BMNB 3S2GA 3QQPA 4FGWA 1NFRA 5DBIA 4LN1A 3NDJA 4YAKA 4BGVA 1WDKA 3CE6A 3AW9A 2ZJ1A 1BDBA 1DRVA 2UVDA 1CERA 1NPTO 4ITUA 2AEJA 1RM3A 4TKLA 2OO5A 8ADHA 5JAIA 2FR0A 3HN2A 1HRDA 1GYRA 1MFZA 4I5GA 4A27A 4BNGA 3H6KA 4CMEA 3NJ4A 4I1IA 4AJNA 2EW2A 5A02A 3K2EA 1M6HA 2FZWA 1IHXA 1PWXA 3NRCA 1U28A 3JQAD 4ILKA 2ZB7A 3PGXA 4RPLA 3GRKA 4PLPA 1GCOA 3JTMA 4BNJA 4U0KA 3PWKA 1PR3A 1C0KA 4MJLA 3H2SA 3O9ZA 3AUUA 3E03A 5IJZA 5I9LA 5U1PA 3KO8A 5JNLA 2DTEA 3ITKA 4GX1A 4OL9A 2I76A 3NDIA 1XA0A 1E0DA 1Y1PA 2Y1CA 4FBGA 4M55A 5TGDA 4D3FA 2Z1MA 3I23A 3Q0EA 1ID1A 2HMWA 2VUSA 3AM4A 2I3GA 2JD2A 3VTFA 4K26A 3DB2A 3TQHA 3UICA 3MJTA 4BKPA 3D4PA 5ES3A 3PHLA 3N58A 4D3SA 1QKIA 3KTDA 2RIRA 4U6SA 1HE2A 1X7GA 2H9IA 1I24A 3T7EA 4DWVA 4RVDA 1EBFA 1YXMA 2FN7A 4CV3A 3I9LA 2AE2A 3JYPA 1EVZA 4GX5A 1K5HA 4GSKA 2ZK7A 5IXSA 5KJCA 1OMOA 4MKRA 1YWGO 4K6FA 1E1MA 1ZSNA 1J0XO 2BRUA 4KUEA 4M1QA 1W73A 4WNIA 4Z0HO 1ZMTA 5IZCA 1YJ8A 2E6UX 1KYQA 2CNBA 1M66A 4ID9A 4HFJA 4QUKA 1QP8A 3AU9A 5THQA 1NFQA 4I5DA 3ULKA 1P1HA 1B26A 3ROPA 1ZMOA 1E3WB 3PVZA 1PJTA 2W2LA 1HEUA 3FBTA 1P31A 2B35A 1X13A 1YKFA 4XKJA 1R15A 4MO2A 3NJ8A 3ZWVA 1F8FA 3LQFA 4IXTA 3GT0A 3HDYA 3PHJA 1WMBA 5JDIC 2EP7A 4HKTA 2O7SA 4CM7A 3PYLA 1LC0A 1A71A 3BTUA 4JJGA 1V0JA 3DBHA 3LVFO 4CLRB 1ULUA 1KVRA 2EP5A 4P4GA 4HV4A 5M6DA 3WFJA 4WEQA 1YONA 3MOIA 2CF5A 2BI8A 3KM0A 3OHSX 3ZV6A 3PFWO 2HO5A 2Y1FA 3QVTA 4OHUA 5LDHA 2X58A 5L95A 3RC9A 2YHIA 1WDMA 2PR2A 3HE3A 4TZTA 3EZLA 1ONPA 2J3KA 4BNLA 2B4RO 4BOYA 2WYVA 1O6ZA 2JCVA 4M87A 1GYPA 1ISJA 2O50A 2O23A 1HSOA 5BSEA 1GUZA 1KVSA 1S7CA 5TJ9A 4R41A 4FC7A 3PP8A 3IJPA 1PJBA 5CG1A 5EQFA 3G79A 1XYGA 4ZRMA 5L4LA 3KXDA 1NAIA 1KIFA 3RC1A 1DOHA 3M1LA 4NIMA 5I8ZA 1D3AA 3AFNA 3DHEA 3CH6A 4WPGA 5JCJA 5HM8A 1TB4A 3P5SA 2HK7A 3GGGA 1ISMA 1Z75A 3PZRA 2NACA 4R16A 1M67A 3QW2A 3PRJA 2CUKA 3RU9A 4FFRA 4EJMA 1LDBA 1MGOA 2C0CA 5MDHA 1P77A 4IQ0A 2POQX 4G2NA 1ORRA 4ZQHA 4PZDA 1HDZA 3ZWYA 3KYCA 4QT0A 4ZD6A 1XHLA 3I9NA 4D79A 3BIOA 1XU7A 4J1TA 3VDQA 4DBZA 4PN3A 1HL3A 1R66A 5TT1A 3JCZA 1P1JA 4U6QA 5FF9A 3UCXA 3ZWMA 4KDFA 3ZV4A 2VN8A 4NBTA 2ZB8A 3GRPA 3LT1A 1UUFA 2P4QA 1VKNA 3JQAA 3RBZA 1ML3A 4RL6A 3I5MA 4E5NA 2ZTLA 4CL3A 4I8XA 1FJHA 2X4GA 2P2SA 3ROMA 2OOSA 3L6DA 3NUGA 5ICMA 4KP7A 1XDWA 4KZPA 3IAHA 1L1FA 1QYCA 2WEKA 2DU8A 2O3QA 2DUWA 3W4KA 1I33A 2ZJ0A 1E3SA 1AGNA 3KBOA 3H5NA 5JE8A 3DMTA 5DOVA 1V6AA 1H2BA 3FNEA 1GPDG 3GY0A 2DT5A 4GAEA 4IQ8A 1ARZA 1KEUA 1WW8A 4LCJA 1UXIA 2G82A 4LGVA 2WYWA 1IE3A 2YV1A 3BMNA 2PFGA 1CQIA 2I66A 3EYWA 3LC2O 4OM8A 4U7WA 1BW9B 2I5PO 5LC1A 4TROA 5DN9A 1B8VA 2PZJA 1J5PA 1DC6A 2X0RA 1LQUA 3JQGB 3TFQA 1YQDA 3K31A 1E7YA 2X22A 4E33A 3TF5A 1A9YA 2WJPA 4YRAA 5A9RA 5FWNA 4UEKA 1PJ4A 4TVBA 4TSKA 3ROKA 5CDUA 4WLEA 2HAEA 1HLPA 2CVOA 3GH3A 3SLGA 4P38A 1YL7A 3PFFA 4PFJA 3WGQA 1T25A 1KY4A 5TLSA 3VH3A 3UGKA 1QYVA 4A03A 2DBVO 3RC2A 3ZWBA 1IPFA 1D1TA 2P9EA 4R3NA 1HKUA 3AOEC 4YAEA 2FPIA 4W4TA 4YRDA 5ITWA 3DBVO 3OQBA 4XB1A 4XQGA 3GGPA 3FN4A 1X0XA 3O03A 3KYDB 4O59O 1GUFA 1HTBA 1LLCA 2UYYA 1PS0A 1KC3A 1B15A 1W0CA 4XGIA 5TX7A 1YQXA 1IUKA 1YGYA 1DHTA 1LRJA 5C7OO 3I6QA 1YVEI 3SJUA 3W4IA 3Q2KA 1YJQA 2PY6A 3K92A 3VZPA 5TSDA 2EHDA 2GO1A 4CM1A 3NEPX 4I9NA 4PCVA 3FR8A 1I5RA 1Q7CA 2A4KA 3DTTA 2JFFA 4BNYA 3JD2A 1TEHA 2CDCA 1KERA 3ROQA 1PJLA 2JHFA 2Y93A 1R0SA 3U09A 1E3WA 4MINA 3G3EA 3EK2A 5EPOA 4MPDA 3RFVA 1I3KA 1EDZA 4CUZA 4OQYA 2HUNA 2NSDA 2X7HA 3CPSA 4FOSA 4YJDA 4CM5A 4Q3BA 4UVGA 1FMCA 3EVNA 2CFCA 2Q50A 3TL3A 3GA0A 4UREA 4Q9NA 4EJ0A 3GQVA 4CLRA 1LU9A 2V6BA 3H2ZA 4W9NC 5ITVA 1QYXA 4U5QA 1B8UA 4FS3A 1E7WA 3FR7A 5B37A 3FF4A 7ADHA 5KCZA 2ZQZA 1YRLA 4TRNA 4IDBA 3W8DA 3D4OA 2HRBA 2WTBA 1NWHA 2IXBA 3GG9A 1HZJA 2X5KO 1QMGA 2B4TO 3GPIA 4JBHA 4FJ1A 4YWJA 1R16A 4E2ZA 4KQXA 4XIJA 4ALJA 4N5MA 3ZW8A 5DP1A 5T64A 4A5OA 4BV9A 3I9MA 1HDRA 3ANNA 1N92A 3GR6A 4MDHA 1GY8A 5F5LA 3UXYA 4PLHA 3VH4A 2JFHA 3GHHA 3WLFA 2X5JO 1DEHA 5L45A 2O3RA 5EMHA 4IMRA 2GSDA 5H82A 4E12A 5I7SA 5B12A 4MP3A 4R1NA 3R6DA 4KTTE 1FDTA 1O0SA 4ND5A 4D45A 4RO0A 1GU7A 1Y8RB 3KYBA 3OA2A 4NMHA 1Y5MA 2C07A 4UAGA 3OFSA 1V9LA 4CM8B 3P19A 4NJMB 3WTBA 4HFRA 5COAA 4XYLA 4ESOA 1BG6A 3NV9A 1GZ4A 1Y8QB 3PPIA 1NQAO 1PWZA 1JVBA 1TVEA 1AUPA 1EQ2A 1EQUA 3DZJA 1WMAA 1U7HA 3ENNA 2W8ZA 3SLKA 1D4FA 1UZNA 5COQA 3EUWA 4K6CA 4NDNE 5DCYA 2NQTA 3DZGA 3GN1A 1LEHA 2RH8A 4L0QA 3RJ9A 3C7CB 3QVXA 2Q1UA 1U3TA 4ZQFA 4I5FA 3RWBA 3TOXA 3A06A 2VRBA 4FPXA 2QW8A 2GLXA 5GZ3A 2VOJA 5JBIA 3TZQA 1BRMA 4HWKA 4IPTA 2PTGA 2AE1A 3FD8A 1PL8A 3HDHA 1L7EA 2HLPA 2CF6A 3WDSA 2Q2WA 3OBBA 4ZRNA 3M1AA 4ZU3A 4D41A 2D3TA 4ONEA 3JQ8B 4NU5A 5I9NA 4B4WA 2FMUA 1TT5B 4LVUA 4Y67A 1IULA 4NG5A 5BNIA 3S2IA 3WS7A 3ZNPA 3D3WB 3OQ6A 3KUXA 3EY4A 3DZKA 2HKIA 1C0IA 2EGHA 5EQDA 2PZKA 3QIVA 3NTRA 4BS9A 3CEAA 1E7RA 1UP4A 1BW9A 1UZMA 2X9VA 1DJNA 3L6EA 2FP4A 4M89A 1TI7A 1N7HA 1DAPA 4NPCA 1EUZA 2O3UA 3JQGA 1YB4A 2GDZA 1U5AA 1AE1A 3AM5A 2I99A 4RLHA 5ILOA 1W8DA 1ZK1A 4B4VA 3C85A 3H8VA 4FJ2A 4TRMA 5CEEA 3OSUA 5KJEA 2CVZA 4BL5A 3QE3A 4HFNA 4I9HA 4HX5A 1QRRA 4CMIB 4NFHA 4RQUA 4YTEA 5IDQA 3E1KA 4IS2A 1DLJA 3WQQA 1EVJA 4CQLB 1GQQA 3CZMA 1P3DA 3AI2A 4M54A 1HDXA 3G1TA 5DOZA 1X1TA 2GN9A 3WSVA 3LC1O 2O3TA 4J0FA 2Y0EA 4QEDA 4XCVA 4MIEA 2PH3A 4RZHA 4R1SA 4RF3A 8LDHA 2XF8A 1C14A 1ZBQA 2VZ9A 1YBMA 1G0OA 3SBOA 2ZB3A 3KYDA 2ET6A 4CODB 4D0SA 3RU7A 5JO0A 2VUTA 3OA0A 2VHVA 1RPNA 1BHSA 4NI5A 2Q1TA 1YBAA 2WD7B 3QP9A 3DZFA 3LT0A 3HDJA 4WECA 3PZBA 2A92A 1EZ4A 5CAEA 2TMDA 3B1FA 2QRJA 3EVTA 4NK5A 2NTVA 4YT5A 4Z9XA 2CSUA 1G1AA 3E9QA 1XGKA 1E3JA 1R4MB 3BMCB 3E18A 4E13A 3KETA 1ONOA 3RASA 1TT7A 1ZVMA 1ENZA 4W82A 4A0SA 2DFVA 1N8KA 1O9BA 3BZUA 1ADBA 2VCYA 3N7UA 5DZSA 1GYQA 2Y0CA 1ZEJA 4CLEA 3GG2A 3GFBA 1LDGA 2AG8A 2CY0A 4DL9A 2C59A 3GF4A 1HE4A 4OSOA 3HG7A 4NBUA 1IZ0A 3LF2A 4OJNA 4FOOA 1WPQA 1PGNA 4RF2A 3G17A 3H9QA 3QVOA 3PQDA 5CEFA 4ALLA 2PD3A 1DIBA 3DOOA 2C5AA 3F47A 1XKQA 1LDMA 4MVJF 4R3WA 4FR5A 3RUCA 4URFA 1YBVA 3DAPA 1U8FO 4J1QA 5H83A 1LUAA 1VJ1A 4CM6A 2VHZA 5JAQA 2UUOA 2C2XA 5B1YA 3RVDA 4F46A 1EVIA 3DDNA 1DPGA 2P68A 1X14A 4BKUA 2NU7A 1IL0A 3JQ7B 1VM6A 4B3JA 2HU2A 4Q3EA 5IZ4A 3ZHBA 3OJ0A 3ZU3A 3ADPA 1P33A 4IM7A 1E3IA 1XELA 5JYEA 1NASA 3Q11A 1JTVA 2I3AA 2YW9A 3L4BA 1K2WA 3WGZA 4HFMA 4RVSA 3I4FA 5I8WA 1I2ZA 3TZCA 5AXAA 2HRZA 1GQ2A 1PL6A 1MB4A 5HS6A 1A9ZA 1WWKA 2FOIA 2BGMA 2PGLA 1HYEA 3ZWAA 3A14A 2Y1GA 1YB1A 1F0YA 2Q2VA 4EUHA 5A03A 5A5EA 3K73O 3KLPX 4IQGA 4CLOB 1RYEA 5IN4A 1Y7TA 1Y8RA 4RV9A 3U49A 5JSFA 2RBEA 3VZSA 1GD1O 3NDRA 1LDNA 4XYGA 3ICCA 3UAGA 4CM8A 2LDXA 3OJLA 2IZ1A 1SNYA 4NJMA 4WEOA 4EJ6A 5IG2A 1X7DA 1Y8QA 3TZKA 1BXKA 1S6YA 1WXDA 2RHCA 3GFGA 3MJVA 5JDCA 1SPXA 4R9RA 2YDYA 2EXXA 3FPLA 4JBIA 4DMLA 1Q7GA 1P1IA 3D5QA 3NTQA 3H9JA 5CHEA 4CM4B 2E49A 1EEHA 4OKIA 1HZZA 1BDMA 4CLXA 3WYEA 4GGPA 5IFLA 1WZIA 2GPTA 3FWZA 4YCAA 4BHTA 4BNFA 4E3ZA 2GYYA 4INAA 1ZXBA 4JIGA 1P1KA 4DMMA 4MIYA 3WICA 3OF2A 3VVBA 2X1HA 4WCFB 3KHUA 4BKQA 3O38A 3T7CA 5KTKA 4YDRA 1NVTA 3GLQA 3JQ6A 4DPLA 4P4NA 1KY5A 5DULA 1LDYA 2GZ3A 3BXXA 4DQUA 1KOLA 1VL8A 4MVJM 1PQWA 3MCVA 3IIEA 4QECA 1IZ9A 1GV0A 3JQ8A 1QSGA 2FZEA 2HK8A 2C29D 4RORA 3W6ZA 1TT5A 4H15A 3DHNA 4UUOA 3MWEB 3JQCA 4XQCA 2V65A 2RAFA 3D3WA 4XX0A 3WBFA 4MP6A 3BTVA 1H6AA 4R9SA 2VHYA 4BUCA 4YAGA 1X15A 1T2FA 3NTOA 4J4BA 4L4SA 4PLCA 1D1SA 4Y6PA 2IDZA 1LA2A 4AJ2A 4N5NA 4CMGA 4X54A 3ASUA 4NBWA 2GUGA 5THKA 3IOYA 4YQZA 4D3DA 4G5HA 5LCXA 2IEBA 4CLHA 1I32A 3U62A 1DFIA 4BNMA 4N5LA 3D5TA 4Q3DA 3V1TC 1KBZA 2VWQA 1ADFA 3GNSA 1I01A 2IRWA 1DIAA 1Z7EA 3I52A 5AYVA 4CMBA 3D0OA 4ZN6A 1LSUA 5JLAA 3UHAA 4CMIA 3JSAA 3A1NA 3FTPA 3I3OA 1T1SA 1I3NA 3MJCA 4CQLA 1GADO 2C7VA 2ZYGA 4DLAA 2WM3A 1C3VA 4OIMA 4R1TA 3OIFA 4W6ZA 3JD4A 2E82A 3QWBA 1JWBB 4OXNA 3UN1A 1ENYA 1N9GB 4II3A 2GZ2A 2EV9A 3RAJA 2ZYAA 2Y1DA 1I3LA 3DEYX 3F6YA 3L77A 4KTVE 4J1NA 5K9ZA 1Z6ZA 4O1MA 4PLZA 3WOHA 3VC7A 1R12A 1ZK0A 1VI2A 3I1JA 5I7VA 3RBVA 2ZTVA 4H3VA 4YXFA 1EBUA 4WNCA 1P9LA 1I8TA 2IEDA 2X9NA 3BTOA 1U3UA 2WD7A 4I9UA 5AXDA 3WGTA 3DO5A 5IAAA 4OOFA 5T6BA 4OGWA 3O4RA 4EITA 3KSUA 5JDIA 4CJXA 2BLLA 3VPSA 3F1KA 4MOWA 1R4MA 1ZZEA 3BMCA 4RVFA 1QV6A 1DRUA 4PVDA 1MA0A 5TT0A 1I30A 2B4QA 3HN7A 4XYMA 1XEAA 1UH5A 2WSBA 3AWDA 1P1FA 1IYZA 5IDXA 1EFLA 4XWYA 2UV8A 1AN9A 4B4UA 5CFZA 3ZNNA 3ONEA 3I6IA 4ZHSA 1I10A 3RD5A 1H9AA 3GZNB 3BHIA 5C7LO 3GDOA 4R51A 1ZSYA 3RFTA 4DA9A 2J3HA 2VT2A 4OSPA 5I7FA 4J2OA 4DUPA 3BHMA 1E3EA 1PTJA 3QWIA 3PHHA 4GH5A 2WE8A 4TZKA 3JYOA 2OORA 3LSYA 3PHIA 4AVYA 4MVJE 4JQCA 4L75A 4PG7A 4B8ZA 5CDYA 1PU2A 2Y05A 2PV7A 1VLLA 4L74A 4YYZA 4RQTA 2OBNA 1YL6A 3TPCA 5GY7A 5C37A 1LX6A 4QTZA 5DCUA 3U4DA 2Q99A 3AFMA 4OH1A 4CR6A 3JQ7A 1V35A 1QLJA 3NX4A 1OC4A 5IZCC
chains in the Genus database with same CATH superfamily
4MUAA 5M3BA 2Y0BA 3KVVA 4PCLA 2C57A 4IUCS 4RANA 2P35A 1B6GA 3C4QA 3A6LA 1AZLA 1NOKA 2ZWOA 3OUUA 4LC1A 5KSYA 1I7BB 3T4PA 5AW2A 2GN4A 1R0YA 4ZCIA 5JO9A 4LZNA 2XUHA 2B8TA 5K3AA 1OXSC 2ETXA 3LIIA 3MAAC 1OU4A 5A5DA 5B4VA 3IP1A 2DBZA 4NEGA 5AJXA 4C7KA 3RJ5A 2ID8A 1YB2A 3BAZA 2O3SA 4X44A 2ZIUB 1D09A 3KT3A 1JR6A 3ZY5A 1EK2A 4HUQA 2GXUA 2WF5A 3P9PA 3T61A 1DI0A 1HXHA 4JKYA 2Q9BA 4XASA 5JJKA 1R88A 3SS7X 4R69A 2REOA 4KQCA 4R2IA 1X8XA 2IYNA 2UVPA 5I7UA 4RTNA 2D59A 2NT3A 4YHHB 2TMYA 4JGGA 2Y76A 2YN2A 3BBLA 3U9LA 3C14C 4CLOA 4ND3A 2RARA 1VTKA 2JGAA 3UT5A 3R7FA 3GQBA 4XXHA 1JR3E 5TGZA 2O3JA 3H5AA 4HNRA 4BQEA 4P31A 4MVJI 1YNOA 3F6CA 4TVOA 1YK1A 1GAXA 2ZLBA 2VNIA 1OLOA 2ZWMA 1I3MA 4FLMA 1M1YE 5C0OE 2BELA 4GECA 3K0AB 3OBIA 3PDCA 2E4AA 4B76A 4ZZ2A 2VP3A 3NIFB 2WE7A 2V3CC 3L79A 2IP2A 3FBGA 1KEWA 1F1BA 3IAAA 2VJLA 1JQJC 4XR9A 2WC1A 4DG8A 1SAYA 4G26A 5ECDA 1UC4B 2YJGA 3TJRA 2XHEA 2UZAA 1W1WA 1UMDB 1GL6A 3D5EA 3DQPA 5JRJA 3QEJA 1ECCA 3B6MA 3B6ZA 3QEKA 3VHRA 5B36A 4D0RA 4G56A 1WMSA 4HGQA 4KK4A 4D9EA 1L4LA 4Q39A 1YMVA 1YULA 3ICPA 4P7BA 3RTBA 4EKGA 3CBQA 4H1HA 4QGBA 1E9CA 4ZVSA 2V58A 4WCFA 5LJLA 4H18A 3X2SA 3R6WA 2P65A 1IVNA 4J7XA 1NW5A 2KBEA 4XYEA 1AHIA 2ORYA 1T5TA 1X9IA 3BWCA 5JXIA 2W7TA 1Z0SA 2J31A 4HVAA 4EQ6B 4LX0A 1MQAA 2C5EA 2R6R1 4PFKA 1A2KC 1PFGA 3BN3A 5L3SB 3EXFA 3SBDA 2CE2X 4I14A 2QQ5A 2TS1A 3M1IA 4RVNA 2ACEA 5JNSA 2VRNA 1H2HA 1PTKA 2XQVA 4BO3A 2GJ8A 1EESA 1BXGB 4F7WA 3C3XA 3CKYA 2VHWA 1NF8A 1X87A 1ZD4A 1ZZGA 1J9EA 2E9SA 5EL0A 5BYJA 5AUQA 3EP8B 3R3VA 5HJ2A 3H75A 4PYIA 2PKQO 1K8XB 1JQEA 4BMVA 2XBMA 5FP0A 5ANRB 5IFKA 2Q45A 4L9WA 4U6NA 3E3LA 5IJ0B 2JJ1D 5HK8A 1CJKC 4LMPA 5HF5A 2BC9A 3UTCA 5C8VA 1WVGA 1PW5A 1YOBA 4PG4A 1Z0AA 1TECE 2QTZA 2IXDA 3MS2A 4KQMA 5CX1B 4MVWA 4DSTA 2NXEA 2RJ3A 1QFMA 3T3GA 5F7XA 4Z86A 3ZYZA 4I0WB 3RVSA 4LXQA 5DYWA 4MV3A 3LP5A 2WWVD 3RT1A 2ZTUA 2WAOA 1EUCA 5IH7A 4K46A 3D4IA 3T5GA 3AJAA 3FNGA 4PZ0A 3QVWA 1ESMA 3ESRA 1Q1QA 1Y42X 1ZH8A 3EB9A 3HCBA 4Y9UA 2B5OA 4TN1A 3K09A 4JQYA 4ZO9A 5AKIA 4EGFA 3ILXA 4OO3A 4UUMA 1BJKA 3WGKA 4DC0A 5DNAA 1IBCA 3AI1A 4Q1FA 3X0DA 1B7GO 1RW4A 1N9GA 3LG2A 4QXMA 1U5CA 2H4FA 1VMAA 5JAMA 2DG2A 5CFOA 2G4CA 5A9TA 5FO0A 3IP8A 2I91A 2E2WA 3U3DA 3OQIA 1RI3A 3EPRA 4QYIA 4OHBA 3T8YA 1VJGA 3M6XA 4W1SA 1HGXA 3UZUA 1X1EA 2YFQA 2MIIA 4WQMA 3VPFA 4A7PA 1ODFA 4MW6A 2X1LA 3CUEF 3FM9A 4L76A 3W7AA 2MYPA 3AK4A 2A88A 2FJUA 5FIUA 2C1ZA 4AW9A 4L3VA 3RRNA 3IBYA 1MH1A 4DUYB 3I5YA 2D3WA 1JFRA 2X6RA 3LHDA 1E62A 1UADA 2IOHA 3DDWA 2IHKA 1Y7IA 1TQ4A 2V5UA 1ZVKA 4KOAA 3BXHA 3M6FA 4ISCA 2PKRA 1E1CB 2JGEA 4GLLA 3T1OA 2NQ8A 3F5SA 1H0KA 3FZNA 3AY3A 5KTOA 3OM9A 1WOMA 1VA4A 4AUNA 4CMHA 1YHNA 4YJFB 3DJFA 3TK1A 5GZ1A 4NCXA 1ZVJA 1NXXA 3BXFA 1F6WA 4IYRA 1SVIA 3T7AA 2I78A 2PL3A 1I4EB 3FX2A 3ZV7A 2JFNA 2V59A 4QU8A 5IBQA 5CB4A 4OU5A 1VG0B 4JFAA 3IEKA 4W7HA 3EGOA 1C8VB 2X0JA 2GCGA 2GEJA 3FTQA 3GJZA 3IEIA 5FOUA 5KS2A 1VSQA 1O0CA 4LE1A 1NVBA 1KJQA 1QFSA 2DVMA 3F96A 5HTKA 5LBIA 4KXNA 5AVJA 4Q9KA 1ZM4A 4AZ0A 9ABPA 4JJ8A 3LOQA 3Q6NA 4IS3A 2YINC 5EJ2A 2ZDQA 1R00A 2JI6A 3RYFB 1P5HA 1W4BA 1QHNA 1FDUA 1WJGA 4MLZA 3W4JA 3Q15C 1EVEA 3DFMA 4ZPXA 2NU9A 1IC6A 4EDFA 4DV5B 3JYQA 3ZY2A 2F9LA 3S2FA 3V1LA 3ZN2A 5AVWA 1PZHA 1ZICA 2VJYA 3EZ9A 3FVQA 3HU1A 4F4UA 3HSKA 2C5LA 4ZT6A 5CNJA 3WIOA 1GVHA 2J07A 4DR3B 4BO0A 3ZE2B 1X38A 3LKBA 3NDPA 4EI9A 4KXFB 4XYBA 4GBJA 5FTKA 3RAGA 3U1TA 3RF7A 3WL5A 1I1OA 2V7BA 4CPDA 1DXHA 1KMHB 4E09A 5LOVF 3CMMA 2QG6A 2E87A 2GLUA 2PEZA 3AZQA 4J94A 4KVGA 1U8YA 4AJ1A 5J4YA 1LS1A 1RTKA 1TM5E 1XJWA 2VWGA 4ZVVA 4ENRA 1HO3A 3EG5A 3D6TB 2UYOA 2JLBA 5LA6F 4BAZA 3OM0A 5GJBA 1V1MA 2BBTA 3VOSA 4FE3A 1L4YA 1T2CA 4L3WA 4P84A 1N2SA 2EFGA 4MIKA 4YEDA 5HG0A 5JJ5A 5KIAA 2HJ9A 2ZRDA 1VRVA 2ZI7A 1LK7A 4NOKA 1FUIA 1JIJA 1SK8A 4DUGA 1BD4A 1ACMA 4BASA 2E55A 1Q6YA 2PRIA 3HNPA 1UKBA 4PY2A 5CXUA 2KBFA 5GIPE 1KKLA 4BMPB 3EISA 4V38A 2GCNA 2QORA 4Z0NA 2KM1A 1VDMA 2QV0A 1NNSA 2PD4A 1Z7WA 1Z73A 3EAGA 1IG0A 2CHUA 3L8CA 4M1SA 3ZUPA 3U13A 2FEKA 3GPCA 5EIFA 1ZLXA 3VX3A 3WLHA 1V8BA 3GLKA 1Q7BA 1COWD 1WZCA 3SXUB 5GZ6A 1UK8A 3I8OA 4RZSA 1QYDA 1XZFA 4UAVA 3VX4A 2I6UA 1Z6PA 4LFCB 3VR6A 3RSHA 1MENA 3S0JA 4KRYA 4GIBA 4D0GA 5IHPA 3FSRA 2QE7A 1IUOA 3KZMA 4LWQA 2EF0A 3PDUA 3V1KA 2FHSA 2Y0PA 1KDRA 3PNQA 4GHWA 1PZEA 2VTVA 4KPFC 4B80A 1P7VA 1TYEB 3H4MA 1JLHA 2X2PA 3VR5D 4ATNA 5KO2A 3ZHYA 5I9TA 5FBKA 4MVJA 3SFZA 2I7TA 5FAXA 3OX3A 2HMUA 4LDNA 1ZD2P 1H3EA 3QZUA 1JMKC 1WEKA 1CZKA 3LWNA 1GM5A 5TF0A 3MOGA 2CBXA 4GI5A 3N07A 1MX1A 2FGJA 4HWSA 4K9LA 4Y18A 4PYNA 1ZRSA 3FA2A 4AO7A 5L40A 1H65A 2P0EA 4JT8A 3K1AB 4UTPA 1GPLA 1OW3B 4IXDA 5B2EA 4WXHA 4IINA 2FXIA 2R7AA 4CKWB 4O4JF 1G19A 2ZEJA 1PDWA 1AT1A 4TUYB 5DMHA 3KSDO 3LY8A 3E9ZA 4EYQA 1CJTC 3IP3A 2ZVJA 4BFVA 1ZUIA 2PVSA 4RPGA 3UJBA 3A6EA 3FI0A 2IPMA 1PS9A 1Z0ZA 4YDSA 4GGOA 3WYDA 5KB3A 4XWOA 3NIGB 4K9QA 5G0SA 3ERCA 2ZVDA 5EA2A 1A9TA 3EXEA 5H4GA 3LUFA 4OUKX 4OX9Y 1XWFA 2XZLA 3JR7A 1JB9A 1F60A 1O3YA 4JFRA 4WLOA 4C4OA 5HUHA 3H1TA 1UBFA 2GF9A 2Y92A 4IIJF 4R6XA 5DYTA 2F4VB 1O5IA 3AEKA 2LGJA 2C4MA 2HMVA 3TOCA 2EWMA 1G4HA 3BMQB 2YZNA 3F6RA 3QRWA 2J5KA 3VHLB 5EQTA 3AEXA 5EPEA 3CZ5A 4XH9B 1QIHA 2VQSA 2YQ5A 2XQKA 3ETGA 1LFDB 4X90A 4V0ME 4DGQA 3CMCO 1YOVB 2G7MC 3KELA 3KKMA 3QIAA 4B3IA 3NKLA 3LS2A 2RAPA 1P29A 1GLNA 1HT0A 2WWHA 3QENA 3CLUC 2CZCA 3FZGA 3CS3A 4XW2A 2XCIA 4NZNA 1QTQA 4G1CA 3EHDA 3E5NA 4QXOA 2H4JA 3HPRA 5EFZA 3K4PA 3PG5A 4L0MA 2QL9A 5JSKA 1PFVA 2IW1A 4GWKA 3UVEA 4CT5A 2A78A 3HXKA 5AO9A 1SGWA 4B8YA 4J90A 4KLRA 1JRLA 3DC7A 3JYNA 2CJYA 2LP4Y 4RK1A 1WUYA 3QVKA 4NV3A 5EIBC 3RVLA 1KI6A 1U9JA 2CN1A 3HJCA 3HRKA 3HYNA 3ZI7A 2BD0A 3KFXA 2ZWVA 3U7FB 2FZKA 1EMDA 4ZC1A 2ZUSA 2W98A 5C51B 3HY3A 5DLQC 1Q1NA 3JQ9C 1B6RA 1EQAA 2F3PA 1SH7A 4AJPA 3IWBB 2X1MA 1BVHA 1LLDA 2PMWB 3RFFA 1A97A 1U7OA 2O5VA 2QRLA 1P7CA 5IS2A 1SO8A 4MB2A 1K7SN 3GDWA 4FSHA 3B89A 4B32A 3WIBA 3GI1A 1RM0A 2CWWA 8ATCA 3L8MA 3QH4A 4M0FA 5HOEA 3C0KA 2IE8A 1DU4A 2IF0A 4MKGA 3KV3O 3KCQA 1M8GA 3DE1X 3T9EA 4XUCA 5AK5A 3TSWA 4ZYZA 1B1AA 2Q5LA 4RM2A 4AKTA 1OQAA 4GKAA 1MV8A 1SVUA 1DELA 2HJRA 4TMVA 2BSXA 1U0GA 2CV0A 1ZW6A 2TSYB 1XYVA 2GCOB 3C3JA 3U40A 2B9EA 4AY2A 1NY5A 3QX3A 4PLWA 3L7MA 2A1IA 1CETA 2W6IA 3FPCA 3AUTA 4K2HA 4R1UA 4EF6A 1RCFA 3QLVC 1V16A 4N7RA 2IW3A 2Q6LA 2OWDA 3CLTD 1CZNA 5BVHA 5KWEA 3K0FA 3JASB 1G6HA 1P4RA 5KYWB 5AVVA 3F78A 4UMFA 1ODCA 1XNGA 4E5DA 1G8JA 3SZ3A 1QGDA 5B1IA 4AICA 5K7SA 4Q3LA 2TMKA 2P91A 2BR3A 4QTTB 3O84A 1VL1A 2O8EB 3GRRA 3IO5A 3O4VA 4XLZA 5EMJA 4LCBA 3NJRA 4IDGA 4PNEA 3TLGB 1IIBA 1TAQA 2VNJA 3AUKA 3LRXA 4OQDA 4TXJA 4WK6A 3WGMA 2BGLA 2OM6A 2ZI4A 4TV8B 3ANSA 5G0UA 1YBHA 5K0CA 4P35A 2Z9CA 4DLBA 1VC2A 3U16A 1NAHA 2F00A 1VCIA 3FDZA 2JS7A 4KXVA 3MELA 5G02A 4PBTA 3TQIA 4RMHA 2QAGC 4UUNA 3ZPXA 4AZWA 2JLZA 3UEOA 4MW0A 4OF4A 3BDVA 2UXBB 5KBYA 1RWVA 3I8XA 5P21A 1IVSA 3DZ3B 1KO5A 1X7HA 2JJYA 1YR9A 3TVTA 4BJ1A 3K0HA 2W2KB 2Y4OA 3INGA 3H5WA 1JKFA 1KKUA 3K32A 4RTPA 1Y6JA 5KNBH 4YMUA 7ABPA 4N3NA 2OKGA 1A82A 2OCDA 4YCJA 4ZVPA 3IWCB 5CFQA 2R2GA 4S05A 4BFYA 2FK7A 2Q0QA 3AUYA 4AS1A 1NLUA 1MO2A 4Z8YA 5H9VA 1SC1A 1RJFA 1V2GA 1JG3A 1FNNA 3DW1X 2J3EA 4K9DA 3BIXA 5ER9A 4ZYXA 1IK6A 1DFGA 4D6XA 4HBZA 5HKBA 3AHIA 1SCUB 1A4UA 2HLDD 1ZYUA 1U7TA 1U6JA 5DIZA 3WQSB 2PR7A 1SUBA 5ADHA 2IE0A 1RI2A 4DHWA 4BNIA 2HI0A 5JJLA 2PL9A 3R5JA 4RPIA 5DGTA 3ZWKA 1EWTA 1Y3AA 2WJWA 3D4NA 4OGGA 5F33A 1BGXT 4FCVA 2RHWA 1ZXXA 1TXGA 2NYRA 3STHA 1OOEA 3A32A 3DNPA 3FHJA 3R3XA 4L50A 4CIVA 4EAAA 3PR1A 3UBMA 5KYXA 4ARSA 2PBFA 3Q3IA 4EYEA 1AKWA 4NX2A 2UZ3A 3T4EA 3K1TA 4UNIA 1FSPA 1QHGA 4CQJA 3DYBA 1XDGA 3GZ4A 4PSCA 2GVDC 3I05A 1NR5A 4ZHQB 4D98A 5CA0A 4WNAA 4P22A 5ALOA 3GUYA 2J1LA 4W5OA 1JQ3A 1FFAA 1NI3A 3JQQA 4LW8A 2WYUA 1PJCA 3PEVA 5THXA 3S1LA 3T3IA 4CTMA 5K8LA 4Y30A 5CA1F 3LPDA 2WJ6A 1S2OA 4AK1A 3V32A 2CB9A 1XD2B 3K6JA 4K87A 1Q0TA 5HF6A 3GLSA 1JHPA 4OB6A 1TRKA 1M54A 2D2VA 2DM6A 2G0NA 5F5NA 1Z2CA 5A9SA 3OZBA 1UOPA 2VDKB 1Q21A 1VJDA 4W1PA 5LMCA 4YYEA 3QF4B 4JMLA 1P3JA 4YJGB 5EJMA 2BMWA 4AROA 1QBGA 3A3KA 4HDKB 2XQFA 5K0FA 1TUBA 1K7FB 2XUKA 3DONA 4L4XA 1N2JA 4NEHB 4NJOA 5G4KA 3JVEA 5B1DA 1GL9B 2AX4A 1OI3A 2HEGA 2WSSA 4Q15A 4BMSA 1VB3A 1YDHA 2VA8A 3EIEA 3TUTA 4AJEA 1IOLA 1X1BA 4MP8A 4GYJA 1W2GA 3PI6A 1QGZA 1WX1A 3E3MA 3E1SA 4O33A 4Q47A 5FTLA 3H1BA 4EO7A 5M2QA 4BPBA 3QV1A 1JJIA 3E2IA 3ZHRA 1X7XA 4RIGA 3W6NA 2PWZA 5HIIA 3VZRA 2GMWA 2IHBA 2YV5A 3NIBA 2NYUA 1DHRA 1RXEA 3OPYI 3MCZA 4N5IX 3NNSA 4WUVA 3T3DA 1BEEA 4AC9A 5H9WA 3RODA 4A82A 5C3MA 1OBFO 5CVDA 3V8VA 5JDCC 3NATA 1RE0A 5JTUA 5C8YF 4WW0A 5KKNB 3KOUA 1KWKA 3UMMA 1XXLA 3OD5A 5BSHA 3FTNA 1DAHA 2V45A 3GAZA 1HZZC 3FFXA 3HO8A 5LZ8A 5BOSB 1EXWA 4C87A 1JP7A 3AG5A 3LUAA 3M9LA 3UH1A 4D9JA 2A0FA 4RA6A 5DTQA 4JLMA 2CBGA 2OCGA 1FP4B 1DAKA 1XZBA 4HZIA 5BSTA 2I87A 3UPDA 2F3RA 2YY7A 5AQEA 5JS1A 2RHOA 3PR2B 1NUHA 1BEUB 2YVAA 1VG8A 3F4LA 2CXNA 4U7DA 1LQ2A 3A2NA 3L1UA 4HH0A 3Q12A 4MVXA 3R9WA 1FEZA 3DTVA 3F1LA 4HAIA 4ZWNA 3TW8A 3FUUA 4EB6A 1N1MA 1Z18A 4F60A 1VKOA 5MGBA 6Q21A 3L6BA 4B33A 2JGDB 5K45A 2O4UX 3AWIA 5JHHB 1S3IA 2WA2A 3EDYA 1ADJA 1M2KA 3DPIA 1A4XA 2WJJA 3PV0A 2IYTA 3IEMA 1K5DA 1X7ZB 2HXYA 4D57A 4V3BA 2I4MA 3CLSD 3PTLA 1MORA 3ZVMA 4BNUA 1TYCA 1HDIA 4MGHA 1ND5A 1ZO8A 3BWBA 3X1XA 1M6VB 2DLDA 1ADCA 2FK8A 3JYHA 1YI1A 3DBLB 3WR5A 1GAEO 1HLFA 3FUCA 1NLZA 2Z5FA 1MR3F 3F74A 3UMJA 1AG9A 1KP2A 1YV9A 5DXFA 2DAPA 3LLUA 4DPKA 3CX4A 2VLIA 3LWDA 1XTKA 3LCUA 1RWBA 3FYHA 1O94A 1BVUA 5KX5A 5F51A 4DDKA 1IN8A 2DBQA 2H51A 3KRTA 3MSXA 3MRVA 5KTTA 4QVIA 3L8YA 3QXJA 1YJCA 3OLXA 4WJLA 5J1TB 1QONA 2FPPB 2IOFK 3V1UA 3BD8A 5HGXA 1MNQA 3NORA 4NAHA 3VPXA 4Z2AA 4G65A 2W2XA 4WD3A 4Y2SA 3L1HA 1AIPA 1ECFA 1IG3A 2YV2A 3BGDA 3IAUA 3HSSA 4PZEA 2NZXA 4URWR 4ZT5A 5FYDA 5HDBB 2XOXA 4F4FA 5KQRA 2EKQA 4G89A 3P9SA 4DLZA 1MQ8B 4F2DA 2JPDA 1NQXA 1RPJA 3H2GA 2WJAA 3FKSA 1ZNYA 4FGSA 4FYWA 1QU2A 1ZC3A 3LHIA 1PX2A 2G77B 4YCBA 1Q0LA 1KDVA 3ZS9A 1ZISA 2PZMA 1QLHA 2P9YA 1VZ2A 3WJAA 4PW0A 2XR1A 5IVPA 4JELA 3DE4X 4NY1A 3NT4A 1E9FA 3NHSA 3K2BA 2DTDA 2P4SA 1DQZA 2NO7A 3O47A 4GPAA 4H16A 3SJ7A 4YUWA 3EY9A 2BFNA 3VAYA 1E4EA 4LXTA 4YCDA 1JKJA 4BCCA 3EH2A 1GRCA 3KB1A 3KG2A 4Z7OB 4E5YA 2GPJA 2CCKA 2CD9A 2J7PD 2SECE 4B6RA 4WADA 3HVKA 1Y3FE 3AO0B 4HQ6A 2GEFA 4CHTA 3N76A 3A9WA 4KNVA 4FFDA 2BRUC 4MR7B 1RHKA 1IN7A 5IUNC 1QXSA 2KYRA 2OV1A 1TUEA 3FPJA 1AXRA 3JV7A 4PRKA 2CXTA 1Z5PA 4UMEA 2AZ4A 5FQOA 4C6RA 4UOEA 1JLSA 3HB0A 4EUKA 4ZT4A 1KSGA 3T12A 2AJCA 4I9GA 2O1WA 4BFWA 5JC1A 2XNJA 1Y8AA 1AZWA 5EWJB 1EFKA 1X1QA 1AQYA 1TMOA 1XIVA 4AJJA 5F4ZA 2FH5B 3D1VA 1CY2A 1D2HA 3LL4A 5EIAA 3FPEA 3PB3A 2O6HA 4M9SA 1ZIDA 4QOGA 4E51A 5L4NA 3C1TA 1VA5A 1ZJ5A 3ZI0A 1NN0A 1TQDA 1X1RA 4FMDF 5AOBA 3AJ8A 4B7AA 1GDHA 2E0IA 1LXCA 4OXIA 3O31A 4OXKA 2CXHA 2GO7A 2QLMA 1NVMB 1U2RA 3DWGA 2PX8A 2E1PA 3DAFA 4BB0A 2IL1A 3OMLA 4LJKA 5EYPB 4W99A 4PHHA 4W5HA 5TQ0B 2YICA 1FQKA 3ZIUA 5JMPA 2JDID 1T3HA 2ID9A 4CIXA 2Z9BA 4I1OA 1MV5A 3G9TA 1MC4A 3IB6A 2PV0A 3WHKA 4D96A 3S55A 1QVWA 4U0JA 3PTZA 5ALTA 1XLWA 2P2YA 3QY0A 3DAYA 3ZWXA 4KR6A 3KZ1E 2FPMA 3WLNA 5E1OA 5DDIP 1OA0A 1RQGA 2GBPA 1RQPA 2O0MA 4QNRA 5KJ1A 1H2WA 2I67A 3B9QA 3KU4A 1Q0UA 3FMIA 2UZ1B 2W2MA 4TZ6A 3R1IA 1CW2B 5ENVA 3C6XA 5GPBA 1W25A 1WLSA 3JWHA 1XF9A 3EGDB 4UVDA 1GUYA 4C0QC 3CZ4A 2QYTA 1K88A 2OZLB 4BVBA 3Q2IA 2H29A 3JQFC 4A0RA 1Y81A 1VPDA 2JHGA 3R6GA 3WWDA 5JBNA 4BE4A 3MXOA 2ZR7A 4Z0TA 4WASA 1XMSA 2XUPA 3NW9A 3NUZA 2IS6A 4MKFA 4RH3A 2JZOA 1W85A 2AD1A 1EUDA 2LE0A 3OOYA 5EHQA 1V7ZA 4PC1A 2GK3A 5HMLA 3L6OO 3GLIB 1KTIA 2CVHA 3BF7A 3R0XA 5LOVA 2IYLD 5KAPA 2E5LB 1DRJA 2WJZB 2ZKLA 4JT4A 4WY2A 4EIWA 5SY4A 4GRDA 1ZVQA 4J7CA 3ZZMA 4DLWA 2DE0X 4C06A 5LA6A 3RS2A 2HA7A 4GVLA 4C7JA 4GXQA 1JXOA 4BUJA 4EJFA 4YO7A 4B82A 1G4AE 2PRKA 1ZK4A 3ZQUA 5AM5A 2EL9A 1RZVA 5T67A 4MVJG 1GZHB 1Z06A 3IL2A 1Z8DA 5D00A 4KYTA 1N34B 4NMLA 2J3DA 1AO3A 5D3KA 4F6LA 3LKVA 4NDAA 4G0WA 3L7DA 4M6WA 2QZJA 1IATA 3IUPA 4BN5A 1FP2A 2OBBA 1PS8A 4O4HB 3NHLA 1BH2A 5KPDA 1YS9A 1GPWB 4F4CA 4KV7A 1Z2PX 3WLEA 5CUQA 3LA8A 3COSA 5CVJA 5H02A 4C3ZA 1BXRB 1M72A 2RK4A 5CYGA 3PFIA 4G0NA 1GUBA 4R8KA 1OVGA 3O21A 1G8HA 3GK3A 1UP6A 3OPYA 1OAKA 5GJVC 4X6YA 5BQPA 3N3AC 5ADWA 2MMGA 4HS9A 1E2QA 2FU5C 2PGAA 4IX9A 4NU6A 3OQOA 2ZUVA 3R9XA 2FR8C 2QRHA 1ICIA 4QUHA 5ILQA 1VYHA 1A27A 4AYXA 3KQTA 1DEKA 1M1YB 4QFBA 2CYCA 3CTMA 3EH1A 3HK2A 4A0QA 2AXPA 2A3NA 3U4IA 3UXMA 3ND8A 1GT91 1KRHA 3ZVNA 2HQOA 3RSZA 3FZEA 1XVVA 1XRJA 1D1PA 2N42A 4GPIB 1P60A 3C70A 2N1MA 5JCXA 1FSSA 1QJCA 3IT0A 3O8LA 1DWPA 3WYBA 2JARA 2OSBA 3TWOA 4MARA 5JASA 4WX2B 3OWXA 1Y80A 2FZLA 4GLOA 2YNMA 5AJZA 2I4OA 2J6IA 3K9HA 2RKOA 4D44A 1AQJA 3HFSA 1CY0A 3PIIA 5CJJA 1V7QA 3HFGA 3ZBUA 4JLWA 2C4WA 3ORSA 2X1VA 3FRJA 4ZMRA 4DE5A 3GEHA 4DRXB 2QF7A 2JFOA 2X9LA 4OJMX 2RHLA 4XQ0A 1YO6A 2OMEA 3OZWA 3AF1A 3I3SR 4JVOA 4E7OA 1U4OA 1LY1A 1QK4A 1Z6YA 2DZDA 3OCYA 1ZN7A 4KWCA 3RADC 1B8PA 1OBVA 1Y3BE 2HSZA 2XA9A 2FSGA 2ENWA 3P1JA 4O4JA 1SY7A 4PE5B 4Q12A 5B4UA 4BNHA 3G82C 4P7JA 5ARCA 4DV1B 1G7RA 1BMTA 1DKPA 1TGYA 1KARA 1W19A 3HU5A 4FN4A 1NIPA 3ZW9A 4LNUA 1SOWA 4ECAA 4GZ5A 2H1HA 4OTZA 2M1XA 2C9CA 5AKYA 4Y8VA 3G8YA 2PJZA 3H7IA 4BE7B 1AA6A 5HIKA 5D3ZA 4EA8A 3J81A 3CY6A 5JPIA 2XCRB 2X86A 4I4IA 1D6MA 4DJFC 2H4HA 5KQMA 1JDNA 4F91B 5AKEA 3TTUA 2H06A 3QF7A 2Z6UA 1GR0A 1N4AA 1A7AA 3OMXA 3ZK9A 3KT6A 1R7RA 2HCJB 3QPVA 3L0CA 3L49A 3LZ6A 1HBJA 3C16C 2VSOA 3W6UA 1V1JA 4BCBA 3F5DA 4RKYA 1NUQA 3G8DA 4WKNA 3PXGA 2WQ7A 3R6LA 3ZZTA 4X61A 2G6BA 3GJTA 3H2KA 1MZPA 3QTTA 3ZWOA 1N2CE 4YMSA 3ZOKA 3OUZA 4PG5A 1RLOA 1YZKA 2G9ZA 2JIBA 3CF2A 4HF7A 5E3JA 1UMBA 4L57A 1QYIA 1J0DA 2BEJA 1YFJA 3GUCA 4A0FA 1YJXA 2F9FA 1RXWA 3H87A 3LF1A 2RIPA 2O57A 3AC0A 3UJ6A 1RJGA 1XEXA 4L4UA 4S35A 1PFYA 3KLMX 4IXWA 3E23A 1LBEA 1PR2A 3RC8A 4W5NA 4MZDA 3JVDA 3SQWA 1AGYA 1L7MA 1IJFA 4HLCA 4URUR 4NCBA 3KPJA 3UJHA 5AVQA 1I6WA 3L7JA 2ZRBA 4ID3A 4PO9A 4JB0A 1A69A 1KZ4A 2RHMA 1T2UA 2VDUE 3SR0A 5DHFA 3ENKA 1HPLA 3NC1C 3OH8A 2VF4X 1KH3A 4CM9D 5DYNA 2Q62A 5LP6C 2IPOA 4UBMA 5IAOA 1XAIA 1WTCA 2FUEA 1SOMA 2HU7A 3FKJA 3G7NA 4G1BA 2NVUB 3PJFA 4XVUA 1IWBB 2J08A 4MWDA 4RA9A 1AGXA 4OFBA 4UDYX 2X0IA 4F45A 4D0NA 1EVQA 2WJGA 1BQ3A 1EK0A 2Q9CA 4AT1A 2DBRA 1ENOA 3O26A 5JD5A 3UWDA 1OLSB 2JGFA 4OLAA 3L41A 1BN6A 3G2KA 3QMVA 1GNLA 1OY1A 2OQIA 2QN1A 3E70C 3IQDB 5JFOA 4M38A 4EW6A 1ESNA 1U3VA 1MOSA 2HWWA 1W9HA 3UUWA 2Y67A 3DFFA 3WK7A 1O6GA 4M7OA 3N6RA 4DT1B 1Z37A 2QIPA 5JPDA 3HWX1 1OBOA 1ZC4A 4HADA 1JIKA 4PHGA 5E9AA 4S24A 5FCDA 4ND8B 4FFPA 3V3TA 4YWHA 5A3RA 3EWIA 2ERYA 3JW8A 1JHAA 2YC4C 1WSBA 3IUYA 1DLIA 4GOND 4YJ2B 2WY2D 2ZIVB 5LXTB 1J22A 1WXQA 4TKUB 1VSVA 4I19A 4F7DA 1UBNA 4Q82A 1MJFA 3IMGA 1AXGA 5SZJA 3KXIA 4TTRA 4FQ7A 4MITA 4J03A 4NONA 5MN4A 1WDTA 4HNAB 4L16A 2ADOA 6PFKA 1FYFA 1TO1E 4DPMA 2QN8A 4ER6A 4MROA 5E6UA 4E1AA 4V1CB 1CIJA 3P2OA 4O8JA 1C9DB 3AG6A 3LCVB 4ICIA 4DMGA 2HV8A 4PYLA 3OIUA 1ULSA 1Y6QA 3R9IA 3WJ7A 5DHTA 4R1LA 4QU9A 3SFVA 4D5EA 3SIXA 4Z3KA 1FU4A 1DIGA 2WINI 1SKUA 3CUYA 3OLQA 3HXPA 2H9YA 3DC2A 2C7OA 3AERA 1P0FA 1SD2A 1A50B 4MPRA 5DT9A 5E2BA 4O4IA 3ZCQA 2JHCA 5AHWA 5ABPA 3GB9A 1Z4JA 3I9FA 2JHAA 5T4EA 4BAUA 4MCJA 5EIXA 7REQB 3PYMA 3FJYA 1SUAA 3G88A 5IBCA 1JPVA 1OWMA 3L7YA 3L7LA 3B9BA 3DEIA 3U4QA 1CB0A 3C98A 3HB7A 2VZ0A 1L5YA 5E4TA 4FFMA 2H8KA 3GIDA 1MABB 1EP3B 1T0IA 2GZRA 4LSWA 3TZHA 1JHDA 3GOQA 4W8OA 3TNJA 4F1JA 4Z3OA 2VJMA 3PNSA 1NX6A 1PKXA 5AOCA 4OB7A 3FB1A 1XTIA 4MGEA 1KZ9A 4IDPA 5G0WA 5DLEA 2O06A 4E07A 5L7YA 1R0KA 1C8KA 2Y1KA 1VCNA 3LLVA 1RI4A 2C1XA 2DMRA 2J9FA 3DMFA 1SHUX 4QXAA 2BTEA 4O3FA 2WUFA 2JHPA 4K9KA 3I53A 1SCKA 4H17A 1WBBA 4UJ3A 4DIBA 2QX7A 3JQ9A 1YB5A 2B5WA 3QA3E 1C1XB 3QU2A 4P98A 4FE4A 5KHAA 1YJ5A 3U1BA 2IXGA 4CLDA 2XB2A 2CV1A 1J4AA 1QMPA 2CK3A 3E3OA 2V6MA 4EKIA 3MIZA 1RPAA 1LI4A 4XSHA 4HEHA 1EK5A 4QGGA 3S1AB 1T8RA 1K7XB 2ZCJA 3HCWA 1JB1A 2HGZA 1GRVA 3QEAZ 1HDOA 4IJUA 3NHUA 3T7RA 4C08A 1NW8A 2JBAA 1OB2A 1B3BA 5F4BA 5DHPA 5DHUA 2JEOA 5EE1A 3RFXA 3W6OA 1NXTA 2GFHA 1CULC 3QVJA 3GMDA 2NZYA 4O08A 1Q57A 5KKAA 4Z4QA 3TECE 1L5QA 4ND4A 5EWLA 5CA1A 3E5RA 3IPLA 4CUKA 4R2HA 2FQ1A 3D7KA 3UAXA 3V4PB 4BX8A 4D8UA 1A7JA 5JBQA 1Z0JA 5AI0A 5JUWA 3QLVA 4HAUA 3FZYA 3HKDB 4TT3D 4DR1B 4V0LA 1SKYE 1ORVA 4R54A 4INJA 2FTKE 5K3FB 2ZR8A 1I0ZA 4IJVA 1E8DA 1T2DA 2H7YA 3C7AA 4L0CA 4M98A 4Y9DA 1DEAA 1JQBA 3EHEA 3MD0A 3VBCA 5ICCA 2OXCA 1UDAA 1F5NA 3TSZA 1M7HA 3LMKA 1S8OA 4KAJA 4YPFA 3FRIA 1TVCA 5BY2A 2YZGA 4RUKA 1IMJA 2SKDA 2H59A 4DABA 5F35A 4QLBA 1Z2DA 4B4DA 3K2QA 3SHTA 1XTPA 2V96A 3AU8A 2HYIC 4D81A 1T5IA 1T9AA 2DTXA 4FYPA 1SXJB 4NZYA 3WLLA 1M2VA 3R3ZA 3SVLA 4RPHA 2Q3CA 3AQIA 4PLGA 4OLBA 3N2GB 1E0KA 4OK6A 3K6RA 1DEXA 2IYXA 2G5CA 1D4OA 5AKZA 3DLAA 1C7IA 3W8NA 1OFHA 3RUDA 3A9RA 2QAGA 1JPJA 1NN5A 2OGZA 4FGZA 3BJZA 1F3OA 4LS3A 1NTOA 1H2ZA 2VK8A 4F4JA 1FIUA 4TWZA 1DIRA 3VQTA 3DW3X 3T1NA 1F3LA 3KEGA 5C8ZA 4IIGA 5J1SB 1ZRMA 1EWYA 4OQEA 2GN8A 4E0BA 1C7QA 3VR4D 1F12A 4FLFA 3EDMA 4M1KA 5GWXA 5C8YA 5BWLA 1X0VA 4FE7A 5KQGA 5IM4A 1SCQA 1WQ1R 1A5BB 2LW7A 4P1ZA 3LGXA 3FGZA 4AQDA 4KV9A 1IHDA 3BB3A 2CUZA 3K70B 4RTMA 4M2LA 2A1TS 3NYQA 4AY4A 3QV2A 2EC5A 3CKMA 4Q5IA 4ARZA 1EP2B 4HT3B 2AQKA 1KORA 1HDYA 3EGXB 2H1IA 1CYDA 1QRSA 1MB3A 2ZWAA 3AEUB 1N36B 1M6WA 4HX9A 1P39A 5CH5A 1JTFA 3SEQA 4CF6A 4PYJA 5ALGA 5JYCA 1KH1A 3A36A 5IYZB 2FXVA 2WHQA 3DBHB 3H8JA 4CCYA 2VYVA 4QLOA 4YBRA 5FI0B 1V8PA 4HLQB 3WRVA 3ADBA 3JWJA 3L0BA 1LS6A 1NR7A 5GOTA 4S1VA 3O2QB 1QG4A 3R5FA 4XR4A 3RHTA 3TLAA 1E2KA 1XMPA 4EABA 2AZMA 3EQZA 9MHTA 2ZB4A 2C4UA 3QUSA 2BM9A 1OV4A 1SXJD 4O4LB 3GYBA 4UJ5A 3PSAA 4B0OA 2ZROA 3GFSA 4ZQCB 2QVGA 4L78A 5I4CA 4Z7QB 3EIXA 3U26A 4OEHA 4MWEA 4LDJA 4LGCA 3UFXA 3NNNA 4WNYA 2K5UA 2G6TA 2VDLB 2IUEA 2GZHA 3PUWA 4GU5A 4BKOA 3OOWA 4OI0A 2YY6A 4NQZA 4WOJA 4IR7A 5K3BA 3W3AA 16PKA 4HBGA 4YV2A 4NYJR 2L42A 3GAAA 4GYWA 1RAGA 4PTYA 2ZRNA 1DC5A 1SQGA 2PYDA 2QS9A 3TFWA 3HB5X 4TYYA 3L05A 1A4IA 1IY9A 1LRKA 2B20A 3MJ4A 1U8UA 5TS3A 1NATA 5AQ1A 3VH1A 4ZYVA 2WP0A 2G72A 4PONA 2V8OA 3CNEA 1DAOA 1GL7A 2CZGA 3D2AA 2ZJOA 1T4BA 5DXAA 2YWXA 5DLPA 2IXFA 4B3MB 3UV7A 2WJ3A 2GGSA 5FA5A 4G9EA 4NK4A 3OKFA 4I6EA 3OKAA 1ZR2A 1UBJS 1HYHA 5DVZA 3KYCB 1EAMA 2HDNB 3ELDA 5B7NA 3SK0A 4DB2A 3QWHA 3RRXA 2PU7A 3I9V6 1KZ6A 1TC1A 2BMAA 3SHFA 4DLLA 2ZSKA 1NLFA 2Y1OA 5EZYB 3UWPA 5E7QA 3GJ6A 3IPYA 4K6OA 5FBZA 3R7DA 4EG1A 2G06A 3AF3A 1G2PA 1HQCA 1I2DA 3OG9A 4HVTA 2YWBA 5B7PA 2X7JA 2PLAA 4QOIA 3O8QA 2PK3A 1FLNA 3RUFA 1WPXA 2YN0A 1MGPA 2L18A 1KSJA 2YOGA 5AJUA 3VBEA 1U0SY 3X44A 2V7TA 4L22A 1DX4A 5BN5A 1Z38A 2BTQB 3BEOA 1YC2A 3JD1A 1E1KA 4BYGA 2IZZA 4GQBA 2HX1A 3WZLA 4D4HA 3JALA 1QOZA 2P5YA 3ISVA 5JY6A 5BQXA 3PT9A 1J6UA 2C8VA 1GUDA 4AMYA 3PX7A 2X6TA 2WFAA 1NBAA 4RKQA 3N2KB 1PGJA 3HYCA 4UDNA 4YP5A 1U2GC 2VA9A 4MA0A 3SZOA 3ZDRA 5FBVB 2QSYA 3GFTA 3N6VA 4MCAA 4BLPA 4YAIA 2REBA 4KG7A 2JCBA 4E5PA 4EHJA 4WK0B 1RQRA 1AOXA 2VAMA 1ECGA 2EFDB 1FMJA 3S2GA 2J3LA 1CQIB 1P2FA 1SU6A 1NFRA 5DBIA 3KQYA 2R68A 3VHXB 5KYYB 2R1VA 2RGBA 2BKXA 3AW9A 3CE6A 3HB9A 4WBNB 2ZJ1A 4FXPA 1DRVA 3UMFA 1CERA 5ALHA 1YVDA 4TKLA 5JAIA 1U2EA 5JSUA 2YRWA 3HN2A 2PKCA 2W6JA 2C3YA 4A27A 5LP1A 3ZVRA 5D5HA 1J0EA 1UODA 4KYIB 2FSPA 1O97D 4I1IA 4V39A 2WDPA 5JECA 1GQOA 2FZWA 3AFOA 1R3DA 3QPUA 4UU0A 1OB5A 3SR3A 3IERA 1L8QA 1XRPA 4KE8A 1DKQA 3CZPA 3P0RA 3CGGA 2VUHB 5I48A 4EB3A 4G0UA 2H7XA 3PGXA 1MHPA 2D1FA 1W5BA 4ZAVA 4DW8A 4JBNA 4I46A 4MWTA 3TQSA 1B41A 1UCFA 4MJLA 1M9NA 1NVKA 4PFSA