1DIHA

Three-dimensional structure of e. coli dihydrodipicolinate reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
272
Chain Sequence
HDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
total genus 79
structure length 272
sequence length 272
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1994-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dihA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dihA01
1K5HA 3WLEA 1K2WA 2UYYA 5L45A 4BGUA 5A9SB 2BELA 3BMOA 3HFSA 4TMFA 5G4LA 1PSDA 4J7UA 3R1IA 1YOVA 1TXGA 3IS3A 2HMTA 3VH4A 5DBGA 3F1LA 5KNLA 4DMLA 4CM1A 3NJ4A 3JD3A 2Q1TA 4N5MA 1Y9EA 4NR0A 3S2GA 1PEDA 3TZHA 3WTBA 3ZWWA 1YB1A 1HZZA 2HMVA 3ZWYA 5JBIA 3W6ZA 1K6IA 3I9KA 2JFHA 4BGVA 4ESOA 4BO7A 1K6XA 1LDEA 3W4JA 5TGDA 1ZXLA 3K5PA 1K0UA 1PZGA 3INTA 3BHIA 3GAFA 3EMKA 1BVUA 5TT0A 1E7SA 2GZ3A 4NU5A 5JNLA 4NZ9A 4DIOA 1Z7BA 2C82A 3FR7A 5C5IA 1T4BA 3OJLA 2BFPA 2BD0A 1HDCA 2P2SA 1E7YA 2XPCA 3C1TA 3BMQB 1QORA 4ZICA 2FR1A 3KB6A 4J43A 2B4TO 4TRNA 1QYWA 5B37A 3ASUA 3QIVA 2BGMA 1R4MB 5HS4A 1JAXA 4KDFA 1DLJA 4CLDA 5I9NA 3PGXA 3L4BA 2NTJA 4Y6PA 3AOEC 1QV7A 4CM9D 1F17A 1NQTA 2I3GA 1X0XA 3ONDA 3PLRA 3TF5A 5ENVA 2VHYA 3RKUA 5JYAA 3D1LA 1PQWA 5IZCC 4N7RA 1B14A 4D42A 4IS3A 4XA8A 3NGLA 3DMTA 1SMKA 3Q6IA 2DFDA 1GL3A 1U4SA 3S55A 3MTGA 1LJ8A 3PHGA 4ZRMA 5CDUA 2ZTUA 4M8SA 4K1LA 3O9ZA 2YDYA 3VH1A 3HJAA 4L73A 2RCYA 5I8ZA 3PJGA 3HG7A 2C07A 3C1AA 4YJDA 2GUGA 3HDQA 4IM7A 4HUJA 2BFOA 4CMKA 4PG8A 2QRKA 4JN6B 3QA9A 5I7SA 1H0KA 2OBNA 4AJ2A 4OMUA 3ZWBA 3OEWA 2J5KA 3GZNA 4XDYA 4HNGA 5AXCA 1P9LA 1LLQA 2JAHA 3K73O 1DC3A 4F3YA 1DDOA 2ZB7A 2EP5A 1JVSA 4K6CA 4B3IA 4M86A 1YL5A 1IPEA 4QT0A 5A05A 3ONFA 4BKRA 4DMMA 3E5RA 4CR8A 1SO8A 4Z0HO 3LK7A 1NAIA 1OMOA 1XIVA 2ZTVA 3H3JA 1N1GA 3QRWA 4WLOA 1PS8A 1IYZA 4IQ0A 1T26A 5C7LO 2XOXA 4Z6KA 1KY4A 1FDTA 5T73A 5G0VA 2FPPA 5T64A 5BR7A 4D79A 1NQ5A 2Y1GA 3WJAA 2JFFA 3WSWA 2R6JA 3HADA 4OXNA 3ZV3A 4R1TA 3WMWA 4BNFA 4E0BA 4D0SA 4R01A 4TRRA 3H9GA 4UVDA 5DDIP 3SVTA 4DA9A 2AEMA 4BO1A 3TZCA 4E21A 3DDNA 1XCBA 1U4OA 3U5TA 1NPYA 2VT2A 2V6BA 3D4NA 4PLTA 3UF0A 5ICSA 1TLTA 1SC6A 4BUCA 3JD0A 3FTNA 5H83A 1B15A 5AQ1A 1ONNA 1XG5A 2P4HX 3GVCA 4BMSA 4J4TA 4R4JA 1ZJYA 2SCUA 2G17A 3VH3A 1IZ0A 4RVFA 2IZ0A 3JYOA 2WSBA 4E3ZA 1AHHA 4FFLA 4ZHSA 4AJJA 2A92A 5CEFA 2VHXA 3GGOA 3AI1A 3PDJA 4AJEA 4DLAA 4XYGA 4W7HA 3LZ6A 1RYDA 3GMDA 3ROQA 2WMDA 2H63A 1YONA 1O5IA 3NUGA 3TDKA 3AW9A 1GQQA 1ISGA 1VE9A 3I9OA 4B7XA 1SOVA 5ER6A 3RVDA 4CUKA 3JQ7A 1GTMA 4BNHA 1DPGA 1W4ZA 4CV2A 3CIFA 1CQIA 5DOZA 3OQ1A 4ND3A 2RH8A 3WQSB 4XJTA 5JE8A 1ZEMA 3DHNA 1G1AA 1ZSNA 3CZMA 4NI5A 3MZ0A 2PLAA 1XDWA 4Z0TA 4Y9DA 3Q9NA 1ZBQA 2VRCD 5CEJA 1ISHA 2OBYA 4IJUA 3ROPA 1U2DA 3JQ7B 3UVEA 3DAGA 5JAMA 4S3MA 4PGFA 2X5KO 3ZU4A 5BSFA 3O26A 4R3NA 4WCFC 1EUZA 4FR5A 4YQZA 4WCDA 5JAQA 4BQPA 4IS2A 1PS0A 2NNLD 3K2BA 2HU2A 1VPDA 2DUWA 4YRDA 4Z3DA 1EDZA 5ICMA 1X14A 4G65A 4XQ9A 3IOYA 4J9UE 2FWMX 3RWBA 5IJZA 5MGBA 2CVOA 3F4LA 2ZB8A 3GEDA 3PK0A 5EQDA 1KEWA 4ZVVA 1Q0QA 4P4NA 3CE6A 1IHYA 2WE8A 3GHHA 3DZHA 1S6YA 3H5NA 2GCGA 3JTMA 4EEXA 3I9LA 4BB6A 3UAGA 1L7DA 4OKIA 1B0AA 2PV7A 3BYZA 1EEHA 5C3MA 3AOGA 2OP1A 5DT9A 3DOOA 2Q2WA 1YBMA 3OETA 2OP0A 4WLFA 1C1XB 4R54A 3E9NA 2Z1MA 2EEZA 3C7AA 1ADBA 2V65A 4RVGA 4JBHA 4IQ8A 3WGYA 4NQZA 3ZV4A 3SBOA 3RU9A 2O23A 4D3SA 2D2IA 1VKNA 1Y7TA 1GUYA 4QTZA 5T57A 3DMYA 1U28A 4BL5A 2Y1EA 1LDMA 5FF9A 4URFA 4BNYA 4GSLA 1QKIA 4LSMA 3JQFA 1GADO 2YYYA 2B0JA 4A73A 1LDGA 3PHHA 5EESA 1U7HA 4CV0A 2AQIA 1V9LA 3EVTA 3ZWXA 2OOSA 1ULSA 1BHSA 2AEJA 2BF7A 2GF2A 4ZGWA 3G1UA 4IDGA 1P1JA 1DJNA 4YT8A 1T1SA 3ZHXA 3ZNNA 1HLPA 1ZCJA 1U5CA 2CFCA 3GUCA 4DIBA 4QUKA 3PZRA 4LRSB 3KXDA 1VJ0A 3H5AA 3ZWNA 1WPQA 2Y67A 2JCVA 3BAZA 3BTVA 1E3WB 2VT3A 3PP8A 5HRUA 4FS3A 4UUNA 3D4OA 5J23A 1GZ3A 2AHRA 1U8FO 5JCJA 4CR6A 2Y1DA 4TRMA 4W9NA 4OHUA 2O2YA 1KVUA 2ZYAA 1JKFA 1PTJA 1R37A 2O3SA 3V1UA 4O59O 1PJQA 3PYMA 4M49A 3ANMA 3QWAA 3OBBA 5TS3A 3ABIA 3AY3A 1XKQA 2X7HA 3VVBA 2O48X 3B70A 1F8GA 3AFNA 3KYDB 4W99A 3KSUA 3FNEA 4OL9A 3GZNB 3LT0A 3GLQA 3G0OA 3PFFA 3T4XA 2JFGA 4ALJA 1PGQA 1LDYA 2B4RO 3BA1A 4YJGA 2RH4A 4ALNA 3BTOA 2AMFA 2OGUA 3ZCXA 1QYDA 5L9AA 1Z75A 3DOCA 1A4UA 1T24A 5ILOA 1H5QA 3RC9A 3GN2A 4O1MA 4CM4B 5L7TA 2BFMA 3SLGA 4CQLB 1OC2A 3AUTA 3ULKA 4CL8A 3IUSA 5L95A 4WEOA 4B7CA 3AY7A 4ZQEA 3VTFA 2HK8A 3C85A 3JCZA 4LMPA 3WFIA 1WAMA 4CM7A 4Q3NA 4CJXA 1GUFA 2DBZA 2NU7A 4OXYA 4LCEA 3GC6A 3EGOA 3F6YA 4HFJA 4JGBA 3RD5A 3JQAD 3PYLA 4PIVA 1XU9A 3PWSA 1LI4A 2EKLA 3T7CA 4XB1A 4KTVE 1A4IA 3JD1A 4YDRA 4JJGA 3ZU2A 1GPJA 2DM6A 1EVZA 1XELA 3X2EA 4D43A 4R9SA 1IUKA 3WG9A 1O0SA 2BFAA 1E6WA 1LQUA 3L6DA 1FF9A 4E6PA 3TFOA 2X23A 1G6KA 2YHUA 4IQGA 1SOWA 5TIIA 1X15A 3NT5A 4BNVA 4J1NA 1WDMA 1Y8QB 1V6AA 4YAEA 3TOZA 3PWKA 4BNLA 1CQJA 3H3FA 4OH1A 4JROA 4R1NA 3KETA 4L4XA 4EJMA 3VKUA 5HTOA 3EZYA 1LRLA 5IDYA 2B36A 4BO4A 1VLLA 5KVQA 2C5AA 2UV8A 5A06A 3IP3A 1UP4A 3NAQA 4PLGA 4R68A 4YYZA 2VWQA 3E9QA 3MJSA 2Y0DA 4IJVA 2DBQA 1OI7A 1H6CA 1TT5B 3SC6A 1Z6ZA 4DRYA 4E2ZA 4F6CA 3R0IA 1HETA 4OYRA 3GVPA 4DYVA 3KM0A 1KY5A 2P9GA 4RF5A 4BOYA 3ZZNA 1KYQA 1MA0A 2CUKA 3IJRA 4CMGA 1MC4A 3DBVO 3LC7O 1XLTA 3ZHZA 3AM3A 1TA4A 2QHXA 1UH5A 2VQ3A 4IXTA 4CV3A 4NJMB 5JYDA 3OQBA 3ZN2A 1PGPA 3FTPA 4PLVA 3JQ8A 1NR7A 1UZMA 1N7HA 4JQCA 3BIOA 3GN1A 1GU7A 1A9ZA 1U8XX 3GGPA 4RPGA 3KVOA 3RFTA 3L4BC 3R3SA 4WPGA 4I9NA 5J9GA 1P45A 4CUZA 3ITDA 1HDXA 1N9GB 4WK6A 4DBVO 4PN3A 1C0PA 4NBVA 3TFQA 4Q3CA 5CDYA 4YJFA 3FNFA 1U9JA 2VYVD 1ZFNA 3G49A 1R0SA 2DC1A 4B7UA 1E6EA 1C1DB 4MP6A 1Q7BA 3DZJA 1SAYA 1F0YA 1YDWA 1YBAA 3F47A 5CFZA 1H6AA 3NGXA 4TQGA 1ZK1A 1EVIA 4P38A 1GAEO 4WGGA 3SXPA 1XR3A 3HZZA 4XQGA 1UR5A 3K92A 1EVJA 3AI2A 4I5EA 5CPBA 3WR5A 5KOIA 3WNVA 3GNTA 4EZBA 1PWZA 3NTOA 1Y9AA 2NACA 2VYVA 4MKXA 1GQYA 4CM8B 3A14A 3CPSA 1ZSVA 3GRKA 3WX0A 2IXAA 1Y6JA 1TT5A 4D45A 2HJRA 1E6UA 2CY0A 1MP0A 3ORFA 2X58A 5DCUA 5IFLA 1LSSA 5JY1A 4KUHA 1R4MA 4CV1A 4PFJA 1ULUA 3DHYA 1IPFA 3OM9A 1VL6A 1GPDG 2OORA 1NQOA 3LC1O 2O3UA 3GNSA 4PVDA 4MVJP 1OAAA 1CEQA 3WYCA 3FI9A 1NX6A 1DFGA 5AYVA 4FGWA 3D64A 4DWVA 5HA5A 1KVRA 3TL3A 4EBFA 2Q4EA 1E7RA 2Y1CA 1WDKA 5FI5A 5BQFA 2RHCA 3GPIA 4XDZA 1Z74A 1N1EA 2DFVA 5IZCA 2IYPA 1N2SA 1AXGA 3A4VA 1BXGB 1N8KA 1DC6A 1QRRA 3QY9A 3KLPX 1KC1A 5A5FA 1NVGA 4QEDA 3B1FA 1O94A 5AOVA 4YJGB 3GVXA 3LLSA 2WE7A 3RUIA 1I3MA 4TKMA 2A4KA 5DCWA 3CEAA 2AEFA 4FFRA 4I08A 3UICA 2PZKA 1Y1PA 2F1KA 1PL7A 3LYLA 4LISA 4R5HA 4YAIA 4CMAA 4BQRA 4XCVA 1YGYA 3EY4A 3T4EA 2NTNA 3KRTA 3QE3A 2FMUA 2FSSA 1MXFA 1P1IA 4GPD1 2X5JO 3I3OA 4EEZA 5DCYA 4MJLA 3FBTA 1MC5A 3N74A 4RF3A 3VDRA 1R4NA 3I4CA 3M2TA 1V8BA 3A1NA 1DO8A 3H2SA 3RU7A 3I1JA 4ALLA 4UULA 1JDJA 1DRWA 4DUPA 5H81A 3H9UA 2WD7B 3LT2A 1HEUA 1UXHA 3U4CA 5GZ3A 4NBUA 2DLDA 2IZ1A 3WGZA 5DNAA 1H2HA 5FFFA 3G3EA 1ISJA 5G4KB 4II3A 4MVJH 3FPLA 2GLXA 1RKXA 2FR0A 5AXBA 1DB3A 1ENPA 5G0WA 5L3ZA 3I9MA 3UCEA 1AN9A 1L1FA 3F9IA 2C2XA 2W2KB 3BMCB 4AJIA 4I8XA 3O38A 4WLNA 2WD7A 4EITA 2EW2A 3BXXA 2VYNA 1I33A 4EDFA 2B4QA 4R69A 4BO6A 2OHXA 4OIMA 4CLRA 2G1UA 1YS4A 4Y6SA 2YV1A 3WGGA 1U3TA 4RPHA 3BZUA 4U6QA 3QWBA 3ETDA 2GPTA 1IULA 1XQ1A 3L9WA 3ZNPA 4CR7A 1UXJA 4EJ6A 1HXHA 4WUVA 4ILKA 1I2CA 1R66A 3FBGA 1NPDA 1JW9B 1T2FA 1ZH8A 2VYND 4RO0A 4DXHA 3CTMA 4PVCA 1HE3A 4E32A 4NU6A 2B5VA 4FQ8A 1JKJA 2VUUA 1HTBA 3LVFO 4BO9A 3TZ6A 2RAFA 5COQA 2Q1UA 3ICCA 4WOJA 1PJBA 3JQBC 2B83A 2OFPA 2CF5A 3OFSA 2YFQA 1ADFA 3ZWAA 1HF3A 3PJDA 1JWAB 3GR6A 1ZW1A 4PLCA 5BSEA 3UUWA 3OIFA 4J91A 4PRKA 3K6JA 3KO8A 3BMQA 1E5LA 5JSFA 4GX1A 2NTVA 2XXJA 4JIGA 3AK4A 4KUEA 4CM8A 4B3JA 1RM3A 2HUNA 3ZWVA 4BIIA 4DQXA 1SPXA 4PLFA 3UCFA 3OJOA 5AVOA 1HWYA 1UZLA 1ADGA 3JQFC 1U5AA 2DU8A 4LVUA 4BKQA 3QWHA 1IB6A 1P1FA 2O3RA 2VHWA 2I67A 1WMAA 4WASA 3U9LA 3VZPA 5B4VA 1X7HA 3WJ7A 2R2GA 4AJ4A 4BB5A 2FRDA 1GQ2A 3NRCA 3WXBA 1OC4A 1NR1A 1PJ4A 3HFGA 1D1SA 2YW9A 5DF1A 2DAPA 1BTOA 2ZYGA 4B8ZA 2ZJ0A 4BNJA 1T2EA 1PJSA 3B6ZA 4Z0PA 3TWOA 3CSDA 4II2A 5JLAA 5GMOA 4FC7A 3JYPA 1C0IA 4R51A 4XYEA 1VRWA 4MIOA 5EN4A 3B20A 4J1SA 4OSPA 2Q3EA 1DHTA 4A0SA 4BO0A 1EBUA 1GUZA 2X9NA 3AY6A 3IQDB 1NBOA 3K31A 2PD4A 3W4IA 1NNUA 3IMFA 1R0LA 5KWEA 3D4PA 1I0ZA 1UXKA 1I32A 3L77A 4OQYA 2DPHA 3DO5A 1E0DA 4FFPA 4AICA 3V5NA 1J0XO 2Y66A 3H9QA 1WLYA 3ZWCA 4DQUA 1E7QA 3Q9UA 3QHAA 4K26A 5I9MA 1ZMTA 3MJ4A 4E5NA 1GD1O 4BNTA 4C7KA 1S7CA 1IOLA 2P5UA 3Q11A 4OO3A 4BV9A 2IDZA 2GN6A 4MVJF 3OEYA 3PYXA 3DL2A 3DZFA 1NYTA 1E1NA 3WIDA 3JQEA 5M6DA 1UXIA 4XQCA 5HS6A 1WVGA 3U09A 2PKQO 3CINA 2I76A 1VKOA 3LT1A 2CDAA 4OJNA 1R12A 1H9BA 5KJCA 3E82A 3D3WB 2EGHA 1JU9A 1U3WA 3DB2A 3H7AA 4RCVA 5JDCA 2JAPA 3JQBA 3OMLA 3ZHYA 2TMDA 3G79A 4B4VA 3F5QA 3GGGA 4RZIA 1JVBA 4XYLA 1E3EA 4D7AA 2Y68A 3ZHBA 5F5LA 1H6BA 4JLWA 3L4SO 3IAHA 1K6JA 3RROA 4R5MA 1MFPA 1MX3A 2CDCA 4EGFA 4YRAA 4LN1A 3ADOA 1PJLA 1XGKA 1ZMOA 3LSYA 4MIEA 3H5RA 2P68A 5KJ6A 4H7PA 4OGWA 3U0BA 3IIEA 3COSA 2GDZA 3VZSA 1KETA 1KERA 1YL6A 2V7PA 5EPOA 4M87A 4KUGA 1SCUA 4J16A 1PIWA 3RC1A 3Q1LA 3U3XA 2JCXA 1O89A 3KEQA 2Z95A 4GBJA 4RVDA 2ILTA 2YHIB 4CQMB 5LDHA 1ZIDA 1EVYA 1NFQA 2VRCA 1PZHA 4LVCA 1XYGA 3GA0A 4E5PA 7MDHA 4M55A 5A9RA 1DIBA 4W4TA 4GWKA 3V2GA 1GYRA 3NV9A 3NX4A 2DVMA 2LDXA 4DPMA 1YH3A 1Z73A 2PZJA 3KZVA 3TZKA 1HYGA 1HT0A 2J8ZA 2FPGA 4R3WA 2EV9A 4ALMA 2NADA 1BDBA 4J1QA 2HMWA 3BHJA 4W82A 5JO0A 1VC2A 5JYEA 3OIDA 4H15A 5K0ZA 3FF4A 3MEQA 1FDVA 2PZLA 2VOJA 4GMFA 3BMNB 1LQTA 3I6IA 3HQ4O 3HDYA 1P33A 4TZTA 4HBGA 5C7OO 3M1AA 4PRLA 4FGSA 4TROA 2NM0A 4HADA 3A06A 4FIZA 4UEOA 3U49A 3PIIA 2NLOA 1G0NA 3DZKA 1V3VA 5F1KA 2QG4A 3C8MA 4G81A 4M54A 4KQXA 4UREA 4NPCA 2W8ZA 3PPIA 2X0NA 1PGOA 2FP4A 5H82A 3AJRA 1YB5A 2J5RA 3U4HA 3DOJA 1DEHA 3EYWA 3GVHA 3ZW8A 1YJQA 1GR0A 4YQYA 4E30A 4F6LA 5BSGA 1CWUA 1DFIA 5JXWA 4WE3A 3TRIA 4AJKA 3EVNA 1T4DA 2FZWA 1YL7A 1SB9A 1UP7A 4OM8A 1GEEA 3HDHA 4YACA 5KVSA 3C7DB 3L6OO 5TLSA 4ND5A 3DFUA 1E92A 2DKNA 5KKCA 2EKPA 5I8WA 3QW2A 4ID9A 1ZVMA 1U7TA 2GZ1A 1EMDA 1YRLA 4XRRA 5A04A 1ZZEA 1YE3A 3WFJA 1LSUA 3JQGA 4XKJA 2ZCVA 3MJCA 1DAPA 3RUEA 3FHLA 3DBHB 3WWYA 1ADCA 5CDGA 3GOHA 5G0TA 1A9YA 5EERA 3EHEA 2D3TA 3VZQA 4RPLA 4RF2A 4JP3A 3PZBA 1E1LA 3HWRA 4I5FA 2IZZA 1WWKA 1QV6A 2A35A 4DGSA 1GV1A 3ONEA 3U4DA 2EERA 3M6IA 3H8VA 1DLIA 3E9MA 3AWDA 4IDBA 3L6EA 1HSOA 4U5QA 4NFYA 4WNCA 1LDNA 4IUYA 3ZU5A 4GGOA 2UAGA 1ARZA 4G5HA 4BNUA 4QXMA 3KUXA 1OBFO 4YB8A 4DREA 4M1QA 3FNHA 1E3LA 4FOSA 4UVGA 1WXDA 1LU9A 3SJ7A 3TNLA 4IBOA 5JPIA 2AA3A 1CJCA 2X6TA 1V3TA 3GQVA 1EDOA 4KQWA 2OL4A 3WGTA 3UKOA 4JXKA 1E3IA 1P1HA 1LC3A 2RIRA 4IMRA 3W8DA 4TVOA 5HBRA 1B8PA 1E77A 1QXSA 4HP8A 3GG9A 1FDUA 2A9FA 3WGIA 3VPSA 4LSWA 3I83A 1NHWA 3I9NA 3PEFA 4NH4A 4DPLA 1EE2A 3V2HA 5B4UA 2HRZA 1NWHA 1Q7GA 4O0LA 3VPXA 1GY8A 2GZ2A 5HWSA 1W6UA 3QSGA 4J9VA 4OSOA 4BMNA 1BRMA 5TF4A 2HSDA 4DL9A 2E49A 2GN8A 3BHMA 3PJFA 2I5PO 4XR4A 5GY7A 3HNPA 1DOHA 3DBLA 4RF4A 5ITVA 5JCXA 3MJTA 5ENDA 4P8RA 1Q1NA 2ZCUA 3OJ0A 2J6IA 2OZPA 5B12A 5KCZA 1WMBA 2YJZA 4W9NC 5A3JA 5F21A 4ZQGA 1ZNQO 1QYCA 3GDOA 1DIRA 1WNTA 2CVZA 5GZ1A 1YQGA 2YDXA 5A9SA 4E5KA 1PGNA 4RVHA 2Q50A 1M75A 1NP3A 4XQEA 5FWNA 5KTKA 1HE5A 1H93A 3AOEA 2DTXA 2PZMA 2DBRA 4OOFA 4BNGA 4GX5A 4GGPA 4HKTA 4MOWA 4CMHA 5CDSA 2HRBA 3VVCA 3C3XA 4FBGA 4O5OA 2H5LA 4DVJA 2ZQZA 3KV3O 1O6ZA 3F4BA 4FW8A 4NIMA 3PGJA 5CG2A 3NTRA 4IGEA 2HO5A 3DHEA 2EWMA 4LRTB 1EQ2A 3GVIA 1KC3A 1F12A 1VJ1A 4JCOA 4F46A 1Y5RA 4PG7A 2I66A 1F8FA 2GNAA 5LCXA 1YWGO 1ZK4A 4A5OA 2FSVA 1F14A 4YVFA 5BNTA 3JD2A 2QX7A 3AM5A 5TC4A 4FJ0A 2XF8A 1UDAA 4IDFA 5DOVA 4NFSA 1LSOA 5CHEA 1BGVA 3UW3A 1T2DA 3P2YA 2NVUB 4CMIB 2VHZA 1SNYA 2Y05A 2H9IA 4MVJI 4GX0A 4RVUA 1A71A 4CLXA 4EJ0A 4ND2A 3TL2A 3QWFA 2C54A 3RFVA 3VZRA 4UUOA 1M2WA 1DC4A 1B3BA 3MOIA 1EQUA 1NVTA 3NYWA 2EF1A 1P1KA 4Z9YA 2HDHA 5F5NA 1NXQA 2PGDA 2B37A 2NQTA 2Q45A 5TX7A 2VCYA 4CMIA 4CPDA 5IDXA 3QVOA 3KLMX 4B79A 5A9TA 2WYUA 1P1RA 1V0JA 1YDEA 4BNKA 3U4IA 3DBRB 5ITWA 4Q3AA 3S1LA 4JP2A 1ISIA 3GDFA 5IXYA 2RBEA 1AHIA 1C0KA 2QYSA 4XYBA 1QYVA 2C20A 2YV3A 3E5MA 3MTJA 9LDBA 3HB4X 1YB4A 5CP8A 4CM9A 4XGIA 1Q2XA 4BNNA 5T6BA 4HY3A 3RUHA 6LDHA 3WYEA 2C5EA 3ROKA 2YFHA 3RUAA 2DTEA 3RJ5A 1I01A 2PD6A 5JY6A 4MVJE 1QLJA 4RJTA 4Q3EA 2W4QA 4IZHA 3I6QA 1H9AA 4JNKA 5DZSA 3VPFA 4J4HA 2CMDA 4UUMA 5I7VA 3STHA 1U2GA 2X0RA 3LDHA 3O03A 2PNFA 4GWGA 4W7IA 3GK3A 4HX5A 1B26A 1PX0A 3PWZA 3K9QO 2XAAA 1EE9A 1BDMA 1A27A 1NASA 5ES3A 1X1EA 2C0CA 1NTOA 2W90A 1MG0A 2YQ5A 1WZIA 1UJMA 1RM0A 1EUCA 4MKRA 5DULA 4J7XA 3VOSA 5DN9A 3KYDA 2BI8A 1PU2A 1G0OA 5JYFA 3CUKA 3PIDA 4B4OA 1YBVA 5EINA 2CD9A 4AG3A 1IZ9A 3WIEA 3WGHA 2EG9A 4Z3KA 1AXEA 1LNQA 3JQCA 2E4AA 1PL8A 1P3DA 2QIOA 1BMDA 4IDAA 1OOEA 2AE1A 3LT4A 1P0FA 2ZATA 2G5CA 2ZQYA 4DYDA 4NK5A 4MIYA 2G76A 5KIAA 1MV8A 5IN5A 2HJSA 1UAYA 2VN8A 3W1VA 2J3IA 3WWZA 3WMXA 2UDPA 5JW6A 5JDIC 4CLOB 3Q0EA 1LC0A 5DP1A 1UZNA 2QZ9A 1X7DA 4GVLA 3KSDO 4ALKA 1T1RA 4CQLA 4FOOA 2VNAA 3AU9A 3P2OA 2D5CA 3ANNA 2G82A 2DBVO 3HSKA 2Y93A 4BNWA 4YT4A 1VI2A 2IXBA 2O7QA 2AQKA 1NM5A 4RQUA 3GDGA 5IF3A 4MINA 4Y98A 3PHIA 4AJ1A 2YQ4A 4J4BA 3WDSA 3JYQA 4FFNA 1KEVA 3B1JA 2HK9A 4RV9A 4R9RA 3RUCA 4MVJA 3OIGA 3I52A 4H3VA 2WDZA 4Y6RA 3QQPA 2G0TA 4FDAA 5CPFA 3SJUA 3GNQA 3D3WA 3RUDA 3MWEB 1WZEA 3NDRA 1P44A 4EW6A 2PTGA 4JJIA 4XZ3A 4Z9FA 4BS9A 2X86A 3PHLA 2WTBA 4PG5A 4TSKA 1VM6A 1DAOA 3IUPA 1Y8QA 4R1UA 3H65A 4BGIA 4GI2A 3T7EA 1DXYA 1ENYA 1FMCA 5L7YA 1XQ6A 3Q2IA 3WGOA 2JD1A 4IINA 1QR6A 3OSUA 3H9JA 5EQFA 4P4LA 5BNFA 5AXDA 3V1YA 1HDOA 4EUEA 1LRKA 1ID1A 1RM4A 4IY1A 4J7CA 4ZJUA 4D0RA 2VHVA 1ORRA 2QRJA 3DFZA 3RC2A 4GKVA 3AUAA 1MLDA 4UEJA 3W8FA 4BO5A 4YEDA 3IKTA 4NBTA 2GSDA 1X7GA 4NFHA 4ZA2A 2IODA 4ONEA 4IJWA 3WNQA 3UXYA 1D8AA 2AG5A 2X9GA 3O8QA 1GCUA 3H2ZA 3RQSA 1JTVA 2AQ8A 1HRDA 2BRUA 3AFMA 1U3UA 4JBGA 4E2XA 3PLNA 4QECA 4HFNA 2HLPA 1UP6A 3WTCA 1R0KA 3ETEA 3GG2A 2V6GA 5ILGA 5ER9A 1I5RA 4YJHA 1E3SA 4FN4A 3GZ4A 3NT2A 1D7OA 5IZ4A 4YXFA 5CDTA 2NSDA 3PJEA 1EK6A 2C7GA 1HKUA 2ZYDA 3UN1A 1T25A 4IJKA 2P4QA 3S8MA 3MJEA 3HDJA 1I2ZA 4CODB 4BO2A 4J3FA 4WCFB 4HV4A 1E1MA 2QZZA 4YR9A 1KEUA 4YJHB 4NDNE 4AVYA 2PKRA 4A03A 2GYYA 1V35A 1C3VA 3FPCA 3WGQA 1KOLA 5BSHA 2VOEA 3M1LA 2D59A 1I10A 3JQDA 3JV7A 2EKQA 4XWYA 4KDEA 4J90A 4C7JA 2POQX 3VDQA 5C37A 1CIVA 3KYCA 2VWGA 3KBOA 1VJTA 2O4CA 4E13A 1I24A 4E2WA 4FJ2A 3OJEA 5U1PA 2Q4BA 3QWIA 4N5NA 5BT9A 5IN4A 1N92A 1HE4A 2VNSA 1UAGA 5JDIA 5CAEA 4EUFA 4EI2A 5DBFA 4YA6A 3OA2A 1EZ4A 1YXMA 1B8UA 4CMEA 1QMGA 1F06A 4B4WA 5JFOA 1JQBA 5T67A 1NFFA 1V3UA 4DQVA 4FB5A 1E3WA 5JC8A 4NNJA 3QJ5A 4GMGA 2YZ7A 3H9EO 3K96A 3S2FA 3GMSA 3IP1A 1E1KA 4MPDA 1GZ6A 4QFCA 5COBA 1FK8A 1R4NB 4IDDA 4BVAA 2Y0CA 5L4LA 2HK7A 1IL0A 4BNMA 2X0JA 5L7WA 4BV8A 1I30A 4E5MA 1PS9A 2Q46A 4BO8A 3HUDA 3QP9A 4ZRNA 2NVBA 1DHRA 3BTSA 1C0LA 1QYXA 1TI7A 3LQFA 5KKAA 1Y5MA 2VWHA 2P5YA 4RDIA 4XR9A 2Q22A 3MOGA 1SBYA 3R3JA 4X54A 2Q1SA 3RBVA 4E2YA 3I5MA 4CM5A 4B8WA 1YJ8A 2V6FA 3G17A 1SZJG 1PJ2A 5G0SA 3ZI0A 3JQ6A 2E37A 2NQ8A 3INGA 1KEPA 2ET6A 3C24A 4GH5A 4Q39A 5G2OA 4ZQHA 1X1TA 2O50A 1NVMB 5G4KA 2NUAA 1XU7A 4JJFA 4DLLA 4A10A 5K6AA 2PH3A 4D46A 2C2YA 2D8AA 2XXBA 1RYEA 3GPDG 4J0FA 4D3FA 5K6AC 1DRVA 4P4GA 4B3HA 4AJPA 2NU9A 1PWXA 3JQ9C 3Q3CA 1IHXA 3BTUA 2ZK7A 5L4SA 1M6HA 1ZUD1 3E03A 2W2LD 2YUTA 3PXXA 4MO2A 5T8KA 4CM3A 4RDHA 1PJCA 3ICPA 3ASVA 2PFGA 3JQAB 4OXKA 3VPHA 4A2CA 2HCTA 1JKIA 2UUPA 4YAJA 2NVWA 1ZEJA 2Q99A 3DZBA 1BSVA 3TJRA 4MKZA 5TRTA 4JX8A 5L51A 2HQ1A 2IYOA 1W0CA 3KEOA 3MWDB 6ADHA 1K3TA 4MVJM 1CF2O 3PTZA 1B2LA 2NU8A 3DMTC 3K2EA 4YT5A 1C1XA 1MGOA 3FRJA 4RPJA 2EJVA 4YTEA 4O6VA 1HYHA 3D5QA 4GLOA 2V6MA 3PRJA 3RC7A 3ZWPA 5B1YA 5CEEA 2VUSA 1ONOA 5FYDA 5LDGA 4YAGA 5KVVA 5F3RA 4IXWA 3DAPA 1R15A 2PD3A 3UFXA 1ZO8A 1LXCA 4E4YA 4WKGA 4LCJA 2ZTLA 3HB5X 3KYBA 4RGBA 5U4QA 3PVZA 3MCVA 1HSZA 1U3VA 3OQ6A 4R1SA 4L8VA 1P74A 4U6SA 4Z9XA 1KBZA 2QW8A 4DBZA 3DWFA 3DZGA 1CERA 1KVSA 3ANLA 3VPGA 4AJHA 4UVEA 5JO9A 1W8DA 4QSMA 1VSUA 4E12A 1J4AA 4A26A 3WBBA 1IE3A 4RLHA 3CMMA 4DC0A 3HN2A 4PZCA 1QG6A 3NTQA 2EW8A 4M89A 4CL3A 4GQAA 5AXAA 4CMBA 3D7LA 3I4FA 3TOXA 2WEKA 3GY0A 2Q49A 2DT5A 3E8XA 4GL4A 4WCFA 4PZEA 2OUIA 3PQEA 3NEPX 3GH3A 4S1VA 1BXZA 2X22A 1AGNA 2NVUA 2IE0A 3SLKA 2VZ8A 4PG6A 5U9CA 4KZPA 3PHJA 3QVWA 2I99A 2AW5A 3ZWOA 2I65A 2I6TA 4OQZA 5EMHA 3FD8A 2O7SA 4GKBA 1WP4A 3GT0A 4GLLA 2FOIA 3WBFA 3EDMA 3VHRA 1PR3A 3H6KA 4BNXA 2HKIA 1JAYA 4E5YA 2P9EA 5I7EA 1BVRA 1M76A 1LLDA 3RASA 4Y8VA 1GFSA 4IIUA 4MVJG 4XGKA 3QVTA 5T5QA 4R16A 2IRWA 1LLUA 4YRBA 4L0QA 4MDHA 3GEGA 2C59A 1DBVO 4YT2A 4GX2A 3UOGA 1I2BA 2NV6A 1ZXBA 1K89A 4NHEA 4IMPA 2PY6A 4WEQA 3C1OA 1J49A 5TT1A 5TJ9A 3FR8A 3EAGA 2CDBA 1KVQA 2FY8A 5JMWA 3JQGB 1J5PA 3VTZA 3KYCB 2Z1NA 3OJFA 3W6UA 4BKOA 4YBZA 4J49A 4WLEA 4J2OA 2OXIA 3B1KA 3DBHA 5JS6A 1EBFA 1DFHA 2DTDA 3AUUA 3DEYX 1Z7EA 3EK2A 5JAZA 1PJ3A 1R16A 4D3DA 3FCOA 1U1IA 1WDLA 2PH5A 3LF1A 1MXHA 3CMCO 1PGJA 4CM6A 4LK3A 3L0DA 4F45A 3E6AA 5L4NA 1T2AA 2GERA 3NJ8A 1MB4A 1ZKMA 3F5SA 3A28A 4QO8A 1MFZA 4XJSA 5ADHA 1FJHA 1NPTO 2X8LA 2FHSA 2FPIA 4PLPA 4TZKA 1HDGO 3U62A 3ZNOA 1TB4A 5F1OA 2WD8A 4O63O 1KVTA 4RZHA 4Q3BA 3E18A 2VZ9A 3NDJA 2PR2A 2B69A 3WS7A 3WLFA 2O4UX 2GD1O 1ONPA 4AJLA 3TZQA 3TQHA 4FFMA 1PZFA 2FZEA 4IDCA 4NJOA 1QSGA 1VSVA 1I36A 3AU8A 3ST7A 4DIFA 1D3AA 1DIGA 3JQ9A 4C4OA 3ZNQA 4A7PA 5CG1A 3IJPA 5C7IO 4I5GA 4L75A 2PGLA 1NAHA 1ISFA 2HMUA 4TWRA 3D0OA 1RJWA 3L07A 3M2PA 3BMNA 4OOEA 3ON5A 1MG5A 3INRA 4FPXA 2BKAA 5L40A 2PGJA 2HMSA 3GF4A 4K28A 3L9XA 4FJ1A 3NKLA 3N7UA 1DIHA 3DBLB 4HFMA 3QVSA 2EHDA 4XIJA 3JD4A 1Y81A 4XX0A 2QYTA 2E82A 4XYMA 4U7WA 2JL1A 2R00C 2BH9A 4AL4A 3AM4A 3OF2A 2BGLA 2OMEA 4L74A 3V2UA 1GYQA 4ZQBA 3OECA 4W6ZA 5MDHA 5T8KC 4WECA 1LX6A 2QRLA 4LGVA 3OH8A 3PI7A 4WOKA 5IDQA 3ADPA 4L76A 3RJ9A 2Q2QA 1XSEA 2JD0A 3S2IA 2X1HA 3ZV6A 3ZGYA 1PZEA 1B7GO 2GGSA 2O3TA 1DIAA 3WYBA 1H2BA 3WQRA 5HM8A 2EIHA 3HHPA 3IDSA 4RORA 4Q9NA 3PQFA 4WJZA 3I23A 3TN7A 2BLLA 4N5LA 3KOUA 4QFDA 2BMAA 3C7CB 4YJFB 4I5DA 4IDEA 1TEHA 4CMJA 4PZDA 1A5ZA 2J3HA 4FC6A 4TRJA 3N58A 5EJ2A 1C1DA 3SX2A 3DR3A 5A3VA 3R6DA 1DJQA 3RSHA 2CSUA 3ZV5A 7ADHA 3LF2A 1PR9A 4JK3A 1DRUA 5GZ6A 1LLCA 4GVXA 2ZB3A 2W2KA 1BWSA 1O9BA 5JMPA 4DTIA 1TT7A 2YV2A 2VRBA 3EUWA 3P7MA 4CMCA 3JYNA 3DBRA 3RKRA 1Z82A 3UHAA 4U0JA 1M6WA 2IEDA 2P91A 4CLEA 3FWZA 3Q2KA 2E48A 3KSZO 4NBRA 4YWJA 1GCOA 3GRPA 4KP7A 3RUFA 4KMSA 3W8EA 5KJ1A 4D41A 8LDHA 4ITUA 1HLDA 1H6DA 2E6UX 4QQRA 1UDBA 2Y1OA 4FFOA 4RPKA 3D3EA 1E3JA 3NDIA 1ZK0A 1VL0A 2CZCA 4HXYA 3KTDA 4R41A 2TMGA 2OO5A 1JWBB 5TSDA 1RM5A 1I3KA 4HFRA 5I9LA 3ZDFA 1N5DA 5COAA 1LRJA 1BW9A 3OHSX 1HE2A 4ND1A 5DBIA 4BO3A 4CLOA 3VH2A 3UCXA 1R6DA 1SEPA 5F1PA 1BXKA 1P31A 3EW7A 2JD2A 2I3AA 2EXXA 3GFBA 4ZD6A 1ML3A 1M67A 4XGNA 4QO7A 4U8GA 5DP2A 2ZKLA 1LA2A 3V1TC 1SB8A 2WWRA 2JKVA 1E7MA 4KWHA 1GDHA 4N54A 4XEHA 2UVDA 2B35A 2HAEA 2X9VA 1X13A 1ISMA 2IEBA 1FDSA 1Z45A 3GUYA 2PKQP 2PK3A 1RPNA 3DXFA 4IGFA 3CZRA 3SC4A 4CQMD 4H16A 2WM3A 3X2FA 3HE3A 3MJVA 1YKFA 4G2NA 4WNIA 2J3JA 3OA0A 1HL3A 5A1TA 3HN7A 2AE2A 3DTTA 3KHUA 2JHGA 4BKUA 1QP8A 4FCCA 1ZJZA 1AE1A 1P0CA 2H1SA 4PLHA 1YVEI 4CLHA 4DLBA 3OP4A 3EZLA 2YHIA 4CQMA 3FNGA 4NK4A 3TSCA 4ZU3A 4YAKA 2QQ5A 1XA0A 2JJYA 3A9WA 3P5SA 2JHFA 4MP8A 4XD2A 2Q1WA 1LBEA 3FWNA 1CETA 4NJMA 3LLVA 1O8CA 4FD3A 1I3LA 1UDCA 2EGGA 4PLYA 4RLSA 4BNZA 4UAGA 4E33A 2BI7A 4WLUA 3EC7A 2WJPA 2Q2VA 5A4DA 3GEMA 1VL8A 1ZSYA 1A72A 2A94A 3TPCA 4MVJD 1L7EA 4KOAA 1DC5A 2H6EA 3ITKA 3ZW9A 3O8QB 2UUOA 3PFWO 1CYDA 4IIVA 4NG5A 2W2LA 3F46A 3ENKA 3SEFA 2J5QA 2O3QA 9LDTA 5BNIA 2WYVA 1GYPA 3QV1A 5FEUA 3O4RA 5TNXA 2ZIZA 3ZWMA 1ENZA 4NBWA 4BGEA 1EUDA 1HDZA 4CMEC 1PQPA 1ZK3A 2ZB4A 3BMCA 3CKYA 4LW8A 5FI3A 4DPKA 1FDWA 3QLJA 5KJFA 8ADHA 1AUPA 1XWFA 5IDWA 2RHRA 1XHLA 1H94A 4GSKA 1UXGA 1JA9A 2CVQA 2X0IA 2ZTMA 2GRAA 5L53A 3DONA 1ENOA 1Q7CA 3UGKA 5A03A 2DPGA 2O2SA 2AG8A 3E1KA 3JQ8B 3P19A 4Y67A 4UEKA 5EL0A 2GO1A 3H4VA 4J1TA 4RVSA 1J6UA 3GHYA 1Y8RA 2D1YA 1SEVA 2BGKA 5I7FA 2FN7A 3PQDA 2Y99A 5EIOA 4Q3DA 3ENNA 4KWIA 2DUUA 4WLVA 5TQVA 4P22A 5A5EA 4K9DA 3OICA 1M66A 1Q0HA 2NWQA 3WICA 4I9UA 4AJNA 2X4GA 2DQ4A 3RIHA 2D4AA 3G1TA 1NQAO 1B16A 4LMRA 3RBXA 4FSHA 3DAFA 1TVEA 2ZJ1A 4ZN6A 3IKVA 4XB2A 3FSRA 4PLZA 4J2HA 3NT4A 1E7WA 4ZQFA 1NWCA 1LUAA 3UH1A 2CNBA 1RWBA 3WB9A 4IZIA 1I3NA 1QLHA 2O3JA 3RAJA 1CRWG 4ROSA 2GASA 3WOHA 4EUHA 1ZK2A 2W98A 1BXGA 2WYWA 2EP7A 4I1IA 2JCYA 2VUTA 1HYEA 3F1KA 1LDBA 5KJEA 1NHGA 1MUUA 1HDYA 4YCAA 1YQXA 4HWKA 4TKLA 1GV0A 4ND4A 2PA3A 4PCVA 5THKA 2D0IA 4B4UA 2P9CA 1WW8A 1BW9B 1A7KA 1O95A 4OKNA 1UUFA 1N7GA 1GEGA 4INAA 1JN0A 5JAIA 3GAZA 3FN4A 3RI3A 4L9RA 1GZ4A 1LTHR 2AQHA 3K30A 5IXSA 1EK5A 3ZU3A 2YY7A 1OZAA 2VZ0A 3AUSA 3GFGA 1B3RA 3CH6A 4BMVA 4E31A 4JBIA 3VC7A 5TJHA 5IG2A 4L4SA 4RL6A 2PWZA 4OAQA 4UUPA 4MP3A 4A27A 5JCJD 3PDUA 1FXSA 4U0KA 2BHLA 1Y8RB 4D44A 1NFRA 5A02A 1LSJA 5LC1A 1YO6A 3JSAA 3D5TA 2B5WA 3DC2A 1EFLA 3VAZA 4IPTA 3S2EA 4YPOA 2Y0EA 4HNHA 1EFKA 4GAEA 3ROMA 4BNIA 1PQUA 3VKVA 1LEHA 1KIFA 2D5AA 3BMOB 4XRGA 4BKPA 1E5QA 2I9PA 5KVCA 1YOVB 1HDRA 2GR9A 2Y1FA 4PG4A 1I8TA 2J3KA 5K9ZA 4ALIA 4CM4A 4PLWA 5THQA 5JC1A 2EJWA 1CDOA 2CF6A 1PJTA 1Q0LA 2C29D 5G0UA 1YQDA 3QVXA 3RCBA 4UVIA 1X0VA 3JYLA 3CXRA 1JLLA 1W73A 2NU6A 4KTTE 2X5OA 4I9HA 4CLRB 3I9JA 3JQAA 2LDBA 3W4KA 4UVHA 4DC1A 3RBZA 2AXQA 3ETGA 4BHTA 2VTEA 4L4RA 3LC2O 1D4FA 3LU1A 3IL2A 1OFGA 3DQPA 2R00A 1KS9A 3RFXA 2C7VA 1HZJA 1T2CA 3DZIA 1BG6A 4J0EA 3V8BA 3WSVA 4CUJA 2FR8A 5B4TA 1D1TA 2F00A 3E48A 4N18A 3F3SA 3WQQA 1DSSG 4RQTA 2Z5LA 3IC5A 1P77A 5JDCC 1C14A 2GN4A 4AJOA 3DTYA 4NMHA 2VTDA 1XEAA 4J6FA 4EYEA 5IAAA 1A7AA 3ZH2A 3K8ZA 4K6FA 2GN9A 4TVBA 1B8VA 1IY8A 3AI3A 4AFNA 1PL6A 2VWPA 4QX6A 1N9GA 4XIYA
chains in the Genus database with same CATH superfamily
3M1YA 1K5HA 2FZ5A 2PQMA 3FUVA 4I1YA 4TLDA 1E32A 1KP9A 4EFLA 4BGUA 5A9SB 3MHTA 2BEWA 3BMOA 4PTLA 3C6QA 3GD7A 5BUSA 3DAOA 2IUTA 4AZ3A 1TXGA 3IS3A 8ABPA 3VH4A 4A0QA 5IJ9A 3I2GA 3ZWWA 1Y9EA 2EX0A 3WTBA 1L7NA 3PFIA 1ELOA 3H1EA 3WK9A 2HMVA 5AW2A 2XKAA 3WK6A 5JBIA 3I9KA 4FEYA 4G5FA 4B71A 3PLAE 4JIMA 4MYTA 1K0UA 1PZGA 3D3KA 2BCGY 5AESA 3KWJA 3GAFA 5BY2A 5HMMA 2PKCA 4B3GA 4OQFA 2B21A 2WT4A 1Y98A 3H75A 4IEFB 2EARA 4NU5A 5LD2B 2RKBA 1IJBA 4KQGA 2G40A 3X0DA 2GETA 3AL2A 1Z7BA 2CBXA 4DIOA 3B13B 2UYOA 2ACVA 1SY7A 5C5IA 2GXUA 4E5VA 3OJLA 2BFPA 4YRIA 2BD0A 2VEDA 4AS2A 1AF7A 1FPMA 2G1AA 3GJSA 3BMQB 1QORA 4COKA 1ZYUA 2B4TO 1HGXA 1QYWA 3EEFA 3ASUA 3QIVA 4OQEA 1BS1A 1R4MB 2QGZA 2G06A 3Q6MA 4GLFA 3ZI7A 4KDFA 4FR0A 3L4BA 2UZ3A 3AYZB 3UB2A 3AIIA 2R8XA 1VECA 5FOUA 4AF8A 1MKYA 5AM3A 2Q4RA 4JXZA 3JVDA 2HMAA 4KAXA 1MF7A 2VKTA 1X0XA 4UNQA 3T94A 4NOJA 3W3AD 4GR5A 4WFJA 3MBOA 3PLRA 1IM2A 3TFWA 4R84A 4BEBA 4F5ZA 1P18A 1L4KA 2PN1A 5FOVA 3RTGA 3F6PA 4N7RA 4C4ZA 3K0SA 1XTBA 2C5FA 2DPYA 4E1VA 2RD2A 3TAHA 1Y7IA 3OCXA 4IS3A 3NGLA 4CT0A 3EDRA 1ADJA 4GBGA 1WU8A 2DFDA 3L3BA 4JYBA 1VDMA 2PS3A 4BQSA 2OWEA 1XAIA 2R1ZA 3L6BA 2NV0A 2BY4A 5L3RA 5B3JC 5LJIA 3S55A 2FN3A 3ETJA 4ZRMA 4A1FA 1HDIA 2J59A 4DJ5X 3NVKI 3QMWA 1ST3A 1VOTA 3G2JA 4JVNA 4NPAA 5DTRA 4F11A 2Z2YA 4L73A 2ASVA 2RCYA 2YWCA 3HG7A 4EF6A 2C07A 2F3QA 5EJ4A 4QYIB 4TTTS 4IM7A 4DCOA 4HUJA 4RPCA 1QIEA 1FJGB 4PG8A 4C76A 2J5XA 1OJLA 4QUIA 3IWDB 3ZZMA 4ZCLA 5JAHA 3RSLA 1KOGA 3ONNA 5BW5A 1XQVA 1P9LA 1ZG3A 3GRVA 3S28A 2FMIA 1MOSA 4F3YA 4B3IA 3O8NA 4BXOA 4YFVA 2D74A 3KVVA 1Q16A 3AF0A 4HGRA 2OQRA 3L7DA 4BKRA 5IU6A 3S7ZA 5K0BA 2R0QC 3E9EA 1SO8A 3MERA 5SZIA 1NAIA 1XIVA 2ZWMA 3H3JA 2C2HA 3QRWA 1R0WA 3QVVA 5EMJA 2Y76A 4BAUA 3VV2A 1CUJA 5IYZF 2ORIA 2QLFA 5C7LO 2XOXA 1DXHA 3MT0A 3S7TA 2DHEA 1J0DA 2HMYB 2XMCA 3VR2A 2IYUA 3S40A 3WJAA 2JFFA 1FVOA 1YRWA 2VUHB 1QM5A 4D5GA 4OXNA 5FBVB 3PNVA 3W2EA 1BA2A 1PN3A 1PG0A 2L17A 4FGJA 3H9GA 3UUFA 1AZTA 3IQHX 4ZCQA 2RBKA 5FWXB 2AEMA 1I7CB 3TZCA 1WL8A 4NDZA 1XCBA 3U5TA 1J5EB 3D4NA 3QYJA 1J8YF 1C0EA 3UF0A 2XNDD 1R9MA 1DXOA 1N2BA 3ZHQA 1WUKS 3L1VA 2WJ4A 5H83A 3QKRB 4RTNA 5IW8A 5AQ1A 1ONNA 3ECCA 2W71A 1XG5A 3V1MA 4CIBA 4ME6A 1ZJYA 1A0OA 1BO6A 1NMSA 3NEYA 3TW8A 2HT6A 1IZ0A 3HJTA 3ZCTA 2SKDA 1X9HA 4RVFA 2NP6A 4I1UA 2GF9A 1MQ8B 1GKUB 5TGTA 5BPHA 3IVAA 2W8BA 1ZDMA 1U3CA 4JH0A 3W9SA 5CEFA 5GJWC 1M0EA 5ULLA 3VFDA 3TSWA 3O4GA 2HLHA 2M6RA 3GW8A 4W7HA 3F74A 1RYDA 3HB0A 1ZD8A 3GMDA 2PVSA 3K7EA 3WYFA 4TQ9A 1LK5A 2JK1A 1QHFA 1FP6A 5ADWA 1CUXA 2M6KA 1VE9A 2I7TA 4FHDA 1JG2A 1SOVA 3C43A 4JL5A 3W2FA 1TM2A 4BNHA 1SBZA 1NJ6A 2F1IA 4OREX 4UBMA 3CIFA 1CQIA 3DFFA 1JHDA 3OQ1A 1TPZA 1A7JA 4WY5A 4ANFA 2P0EA 1TIKA 1ZEMA 1JMVA 2FZGA 2SECE 3LOUA 5JE8A 1DADA 4D9EA 1GPLA 1MO2A 1GGNA 1ZMBA 4GRAA 2OO5C 4N47A 4K2AA 4UAVA 2PLAA 4PNZA 1O5TA 3TTSA 1H66A 2XT0A 1ZBQA 3MGKA 1CQJB 1Z4IA 5CNKA 2FZCA 2HCRA 1DTSA 2WU8A 3ORSA 2BTQA 4KWEA 1FOEB 5JADA 3OESA 2YVQA 1M3SA 4D02A 4JA2A 4JC5A 1TJPB 2YVLA 3UVEA 3MS2A 5BSFA 3HV2A 3PXAA 4EYSA 4LJLA 1EUZA 1VLQA 3C4QA 3CUYA 4YQZA 3U4MA 1CB0A 4OMFG 1CVIA 5JAQA 4L4UA 4OH7A 4BNDB 3O5AA 2YRFA 4HHEA 4UU7A 1PS0A 2NNLD 1COWD 3VZDA 4U7GA 4P3NA 1KJ8A 3R5KA 1WHSA 2ILVA 3UA4A 2DUWA 4YRDA 1KYIA 1Y6ZA 1X14A 1XX6A 3DM5A 4IOKA 4TN5A 2DWQA 3IOYA 3E9RA 3AR2A 4M3NA 4RHCA 2DSTA 5CIQA 4EGCB 3TGLA 2CVOA 3GEDA 1OH8A 3ZDDA 2UYGA 1KEWA 1Q0QA 2AOXA 4P4NA 4ROTA 3CE6A 3GHHA 1KI6B 4JBYA 2FWNA 1IJKA 2Q29A 2YYSA 3RH0A 4QULA 2HU7A 1P2FA 4XUDA 4AJ9A 1ZNZA 3WKAA 3YASA 5JNRA 5C3MA 1E2LA 4INOA 3GUVA 3BXHA 3VO1A 1P2BA 4GI3A 3UMCA 4UTVA 1Z62A 3GLHE 4R54A 3LGSA 5DGHA 3EGWA 3FW1A 3DPUA 1C30B 3E9NA 3PPXA 1FMJA 5HUJA 3C7AA 1UK8A 3AJAA 2VK1A 4JBHA 1Z5NA 2NZVG 5FADA 3ORYA 3FLEA 1YQUA 3LZCA 1H8ED 4NENB 4D3SA 3IEKA 4LJ7A 1RRPA 1X1CA 1FTYA 1Z34A 2CUZA 3UGQA 1EUDB 4O2AB 1ODLA 4BL5A 5J4YA 2P9FA 4GM1A 1EFCA 4LWQA 2B3TA 2I6UA 1WQ1R 2J4CA 2X8WA 3FA2A 3H5WA 3H8SA 4UBKA 4URFA 3VM6A 4GSLA 1QKIA 2O2IA 4RFSA 3JQFA 3TD6A 2YYYA 1QBKC 4M9RA 1KSFX 1LDGA 3PHHA 1GJRA 4DV2B 4GNKA 3K5WA 1JIVA 2FFJA 2QPOA 2Q4DA 2AK2A 3EVTA 3NHSA 3AUYA 3C45A 4LOHA 1N2ZA 2F9MA 5KYWA 3GLSA 1JEOA 1BU8A 3MT9A 3G1UA 4KR9A 1KMCA 1R9GA 4HPXB 1T1SA 1KEEA 1HLPA 2IS4A 3DLPX 4L8WB 3G02A 1U5CA 4C2UA 5K3EA 1XVVA 5K09A 3NTLA 4PBRA 1QO0D 4QUKA 4AMGA 3A6KA 1KPGA 3INYA 3H5AA 4M1KA 3THOA 4ZPJA 1I4OA 2JCVA 2ROQA 3GJ7A 2GEFA 1Y3AA 2QN3A 4OHKA 4C30A 3WLAA 4RU1A 5CIWA 3TXXA 3JR7A 3P2IA 4UUNA 5TPZA 3D4OA 3TM4A 4IEIA 1M0WA 4UOZA 5IJ0B 5IVPA 1U8FO 4PR0A 4X7BA 5JCJA 1PL0A 1XPUA 2O2YA 3O73A 3I5YA 1PTJA 5I8PA 4O59O 1WXQA 3PYMA 1L6RA 2V7EA 3ANMA 4XTCS 1CLUA 4KIJA 3E1GA 3VGPA 3P9RA 3OBBA 4TTQA 3CG4A 4L3OA 5EKDA 1JSCA 1O5OA 1XKQA 2X7HA 5CMLA 3ZK9A 3VVBA 5KTSA 2O48X 1ESEA 1N5JA 2C3OA 1Z0AA 1KZGB 1R50A 3B6MA 4GPAA 3GEBA 1SC3A 3JQRA 1N2GA 3KSUA 4W99A 3FUCA 4UJ5A 4CW7A 3ZJXA 2FPRA 3BL5A 1SKQA 4ALJA 3OQIB 4KN9S 2PANA 3DE1X 1BS2A 2RB4A 4Z86A 1ACLA 4R2LA 3D43A 4V0OA 2HZ7A 1FCJA 1M2HA 2ZTHA 4Z4IA 2HDOA 1Z75A 4EKNB 1MJFA 3I09A 4QPJC 1A4UA 1K63A 1E98A 3SC3A 3WBJA 3RC9A 1V9SA 4M8KA 3G2LA 2XCUA 5IT9A 1YZKA 5ALVA 2BFMA 2A78A 4CQLB 4CL8A 1BDJA 3IULA 2CNWA 4U2EA 3I04M 2VYFA 4Y2SA 4K87A 3UYLA 1AQJA 2F8TA 4ZQEA 3VTFA 4TTVA 1RLOA 1WAMA 3EXG1 4EGSA 1TK9A 5DYTA 3MWJA 2NU7A 4QOIA 2IYRA 3GC6A 3UEOA 4BFLA 1N2CA 1GR1A 2RGGA 4HTAA 4JGBA 3RD5A 3K0CA 2XUFA 4MMXB 1LI4A 1TZ2A 3A4NA 3STWA 1BCRB 2JFYA 4QGFA 3JD1A 2HHLA 2ZI5A 3FM9A 1X1QA 1VI5A 2W2TA 5FTNA 1S3SA 4X92A 2BGIA 4PZPA 2ONJA 5FBRB 1QRSA 4CIAA 2NNWB 4CT4B 2IL1A 1Z0SA 1XELA 3ZZ0A 4JB0A 3KQSA 3VMFA 3WG9A 2BFAA 2H07A 3OIWA 5CJJA 3UWOA 4E6PA 1G6KA 1G8GA 2P6NA 3Q7QA 4FMCB 3VHLB 5TIIA 4GI1A 3U7FB 1WE2A 2VCEA 2ZT7A 5KQSA 1MN6A 4X0EA 4ISCA 2CZGA 4J1NA 1SCUB 4Y2XA 3UGJA 3I2FA 5D85A 1Y8QB 3UWKA 1ANKA 2PUJA 5EQJB 1P6QA 4I50B 3NC1C 3PCXA 4K81B 1Q3KA 1U7PA 3SMQA 2WZBA 3NBFA 4JROA 4L2IA 2Q9UA 4C0BA 4GMHA 5A6SA 1TUIA 1QNLA 3KETA 2IXDA 4Y0AA 1GGEA 4WACA 3U7JA 3QNUA 3GH1A 3DMNA 3MTEA 4S1TA 3ZCSA 1UWKA 4FDUA 1UP4A 2R6CA 3GEPA 1GL7A 4CZ2A 4YYZA 3FUWA 3FXAA 1EB8A 1NRJB 1FFDA 2Y0DA 1JXAA 4MLCA 2CVHA 2QWXA 4MS3A 1H6CA 2B1GA 4HDRB 5LZ8A 4A2WA 5JBQA 1KWKA 1HG0A 4DRYA 3KQUA 4Z49A 1HETA 2G4CA 1IONA 3RSZA 2R6FA 2ZYHA 6NULA 4ATNA 4F4HA 1KY5A 4MCJA 1NVFA 2XYPA 1QMPA 3FAKA 2CUKA 4KXMA 3W1EA 1TA4A 2QHXA 2VQ3A 2AYXA 3A4IA 3DS8A 4Q18A 4NJMB 5IM5A 5IUKC 5C8DA 3QVJA 1OB2A 3ZN2A 3RSOA 2HQSA 1CUVA 4QEKA 1SKAA 2XRFA 3C97A 4PLVA 5DXAA 3JQ8A 4NL4H 4BE4A 1UZMA 4BP3A 1DZ3A 1N7HA 1QVAA 1CQPA 5DSZA 3WE7A 1U8XX 1A9ZA 2E6KA 2FGJA 2NPIA 5B7QA 2OGTA 3FRIA 2VJLA 2VQSA 4I9NA 1P45A 2GPJA 1QRUA 3ITDA 1Z68A 2NO5A 2YQZA 4HR7A 4R31A 1EJBA 3LBIA 4MYDA 4O25A 4Q3CA 2WWTA 1ZC4A 4YJFA 2JBAB 3I9FA 2CMFA 2VYVD 1ZFNA 3GCXA 4J94A 1DBIA 3WRXC 1I6KA 2ZT5A 3A8TA 2AJ8A 3G49A 4GPTA 3W7VA 1STOA 2QKYA 2WPDD 4OP1A 3LFTA 4IRXA 1AT1A 2LTAA 2VJAA 3GOQA 4ZI7F 3N8HA 2RSLA 2J4FA 3UFBA 2NIPA 4EMSA 1PDWA 4MPJA 1CNFA 2XQGA 1Z26A 1GAEO 2HV8A 1UR5A 3W79A 3D0RA 1OZGA 5CPBA 4HDQB 5ADVA 2R79A 4QDZA 3CUEF 3EXG2 4JJAA 4KXNA 4XJVA 1VE3A 1NRIA 3TNYA 3ZC3A 4ZKDA 4OX9Y 1Y9AA 4OHMA 2WZCA 4MKXA 1GQYA 1P73A 4C7XA 3I2KA 4AN0A 4ZU6X 2FPNA 3GRKA 2AOUB 3U61B 4NCAA 2IXAA 2GCNA 3KQLA 4HH4A 1SQGA 2GZAA 1EHCA 4D45A 2G6BA 4YLGA 3GGCA 3LUHA 4Q02A 2W2MA 1U04A 1IRIA 3KJGA 3K72B 4PQGA 1G64A 4QUAA 2JI7A 1PBTA 3SGLA 3WYAA 2O0KA 3V00A 4D9JA 5JY1A 3K8YA 4OLAA 1R4MA 1GQFA 1NP6A 3T34A 1MU0A 1URPA 1V48A 4GE3A 4Q47A 2IDJA 1CUFA 3DHYA 1IPFA 3OM9A 4JELA 4WHMA 1C7IA 1WU7A 2O3UA 4PVDA 3GNSA 4BIMA 4GC5A 4J0HA 4JVSB 3OU6A 4C6TB 5AK4A 1JEAA 3A4TA 3AR7A 3HJRA 1DFGA 1XRRA 5F3WB 5EJ5A 3C98A 4D56A 3MUEA 3D64A 2Q5JA 3GROA 1NF9A 1C2TA 4QOGA 4R40A 1HTTA 2AFHE 3BIFA 3IGFA 4OGKA 1M8PA 2GILA 3IVGA 3JARB 1DQNA 3SM9A 2W83A 3JPWA 5FBKA 1IHPA 4LZZA 1PVDA 5FI5A 4QJ4A 1BQ3A 2RHCA 3VZCA 4E94A 5BQFA 4YCDA 5IZCA 2IYPA 1QIMA 3H13A 1BXRB 3SXUA 2FN8A 1AXGA 2YWFA 4ARZB 1DC6A 4PYNA 3QY9A 1L3BA 1KC1A 4BP8A 4N5IX 1NVGA 4QEDA 2IH2A 3ELWA 4YJGB 3T9BA 3U6BA 1X1BA 4FYPA 2CHUA 1CZUA 2R5FA 3PKIA 2MU1A 2YINC 2A4KA 2XTNA 1W49A 4NPHA 4F86A 5L3SB 3CEAA 3EY9A 3CUTA 4A6XA 1JH8A 4C3UA 5JQGF 2AEFA 1M7HA 2XNDA 3C48A 1OF1A 2PL9A 1PL7A 4LISA 1J2YA 3RIYA 4BQRA 4UATA 1BYIA 2FG7C 3NVMB 2WQZA 4C5BA 5L3QA 3KRTA 1Y8CA 3QE3A 1JRLA 1PFKA 1Y1SA 4ISBA 4N1AA 3W5UA 1ORWA 3DAHA 1E5XA 4OIFA 1J7KA 2Y1XA 4EEZA 2IS1A 3F9RA 3MWGA 1I3CA 3TXYA 1X7ZA 2VO1A 2C2OA 5JQGB 1NMQA 2WM9B 3BMXA 4R2HA 1J25A 3BJMA 2ASEA 1OXTA 2F9FA 4I4LA 5CU7A 2CLSA 1T5DX 1YVUA 3IP9A 3I4CA 1WQ3A 2OPHA 3IUQA 3VDRA 1AUVA 1DO8A 3GFTA 3RVMA 3K53A 4AZ0A 4R9VA 4KIWA 3RU7A 4ALLA 3DQZA 5EJ9A 4DUPA 1DRWA 4I3GA 4WOPA 4BWGA 3HXLA 1UXHA 2WOOA 5AOAA 2VF4X 4NBUA 1IN6A 2R1VA 2IZ1A 3N8NA 5DNAA 3HLYA 1R6BX 5G4KB 4II3A 2VC2B 3DB1A 4XX1A 4AMBA 1Z8DA 2FPSA 1T8TA 4X1KA 1IJFA 3UUGA 2N1BA 4S0XA 1DB3A 3CISA 1MRSA 3UV3A 1ENPA 1SUAA 2PPVA 2RK3A 2GNOA 3PFNA 2A58A 1AN9A 1CUCA 1G5PA 2IY7A 4RC9A 3UCEA 1FRQA 4BFTA 4E3WA 1E9FA 2VHJA 4AJIA 5KNBH 5LLTA 4YDQA 3AFGA 4FUQA 2EW2A 2I55A 3WLOA 5J47A 3A31A 3VHQA 3BXXA 4ZO7A 2XQJA 1I33A 3T38A 5L8VA 3GELA 4EDFA 4F5WA 2B4QA 1L4NA 1WM1A 2BR5A 5KNCH 1M0TA 4GR9A 4M4SA 1E1RD 1X7XB 2YS6A 4WKPA 2E1RA 3U7HB 1RC8A 4DRXA 1YS4A 1RQGA 3WGGA 1KI2A 2XMRA 3ZCUA 2EBWA 1TZJA 3VNQA 1T1EA 1YVRA 3IXMA 5AVKA 4FR2A 3GWGA 5ALUA 5LN1A 1WX1A 5CUQA 4JI3B 1XQ1A 2VTBA 1UXJA 1A77A 3WGNA 1JW9B 1ZH8A 4DXHA 1L7MA 3CTMA 3H4IA 3JZFA 1HX7A 2B5VA 3X2SA 5JMOA 3HXQA 3CURA 4N0EA 3LVFO 2RAFA 1H2RS 3ICCA 1PJBA 2QRVB 1PFWA 2B83A 2CCGA 3ZY2A 4CCYA 4DYHA 5C2JB 3T3EA 4DAEA 1C3EA 2JGDB 1K4KA 3K0EA 1ZW1A 2CXNA 4AULA 4EABA 1ABBA 3AX6A 3TX2A 3SLRA 3K8QA 5FL3A 1RJFA 4J91A 4MQUA 3WLRA 2AKEA 1X3LA 2YL2A 1E5LA 4PIMA 2ZIFA 3IOCA 2E5LB 4S04A 1QPZA 2PSHA 4GX1A 4EA8A 4CDMA 1QFZA 3WNDA 5HE9A 2WRZA 1H69A 4NBSA 4KUEA 4MQFB 4B6JA 2PH1A 4EO9A 3G85A 1YI8A 1T8PA 3CZQA 4H60A 1XQ9A 1J8MF 3ZWVA 1ULZA 1G8FA 1SPXA 3CVXA 1C7RA 1UMDB 3C7KA 3JQFC 1U5AA 3N0VA 1JHAA 1KMNA 5DGXA 3EXEB 1WMAA 1EK1A 5KAPA 3LPLA 3A0UA 3L8FA 3U9LA 2Y0PA 1QG2A 1X7HA 3WJ7A 3UV7A 3B3JA 2I54A 1MQAA 3NV7A 1JR2A 2AZXA 1GQ2A 3CT4A 5I47A 3T1TA 3T4PA 3I1FA 3W5AA 1D1SA 3ZJTA 5DJ5A 5C1PA 1JH9A 1U0RA 5DF1A 2ZYGA 3SYMA 4B8ZA 1LBQA 3CJQA 4BNJA 5CT4A 4DXDA 2FF5A 1FQKA 1PJSA 1JJ7A 5HRAA 5CLLA 1J70A 2BFWA 2PZ8A 2VSOA 4NBLA 3TWOA 4AROA 3UJ7A 5AVVA 4JC0A 4A4DA 4ZO4A 3L0CA 3ESZA 1N3IA 3PGVA 1V95A 4C5CA 4DSNA 3H1TA 3VVLA 5KTTA 1CF4A 1GLGA 1C9EA 1QIDA 4R51A 2ZBRA 3DBOB 3OC0A 1VRWA 4D74A 1E66A 3ZTWA 4J1SA 4OSPA 5FBZA 3X1MA 2BC9A 3R0XA 1WMDA 3SYRA 3FMVA 1NBOA 4RZSA 4FNMA 3W4IA 4LZOA 2OHOA 1PWHA 2IP2A 3U1VA 1FU8A 1KMIY 1S2OA 3D4PA 4MI3A 1PLKA 3AEKA 3R7WA 2DPHA 3TSYA 3O4VA 1RW4A 4EGQA 1ZIOA 2Y66A 2N3ZA 2J7PA 2GH1A 3NGMA 3OT1A 1MGPA 4IWNA 3T5TA 4HXEB 3Q9UA 3ZY6A 1WD7A 4YN3A 1B23P 1VRVA 2OAGA 2Z5VA 3MJ4A 1HNXB 1YDHA 1IOLA 2XDQA 4OO3A 2FDCA 3BUSA 4BV9A 4G89A 5HP4A 3L8DA 2M32A 3C15C 4Z4FA 1L2TA 4LNUB 2F55A 1R27A 1DG9A 2ZRIA 4MVJF 1Y3CE 3HXOA 3TTTA 1MJNA 1TYAE 4KQ9A 1R3DA 2VQFB 3MCTA 3ESYA 3JQEA 3G7NA 1C9KA 1VJCA 5M6DA 4XQCA 1EXWA 1SVNA 1WVGA 2FPIB 4K3UA 5MN5A 1Z4MA 3LT1A 4RK7A 3N2LA 2REXB 2CDAA 1APBA 3A9VA 5KWVA 5ITZA 1R7RA 3ILYA 4LQDA 4NOKA 4D80A 3GJQA 3WB2A 1N5RA 1QHNA 2OHIA 2R86A 3KOXA 3DB2A 2WINI 2AUTA 4RCVA 3WKDA 2JAPA 5JDCA 4WA8A 1QFXA 3UXEA 1O94C 3OMLA 4ZHQA 3QTBA 1TD9A 4LPKA 1PTKA 3G79A 4YX9A 2Q3BA 4C1BA 3A26A 3GGGA 4ZXPA 4OV6B 1JVBA 2HEIA 1U2RA 4RZIA 4AN4A 1E3EA 2IZOA 1UFVA 3LPAA 4XYLA 1KAQA 1OX4B 3D54D 3K9WA 3RC8A 2R96A 2RHJA 4L8GA 4DR7B 5H70A 2COEA 3H1GA 2GM9A 3PUYA 1T5IA 4LN1A 3IT3A 3Q4GA 2GEJA 3E2MA 2M98A 1XGKA 4YUVA 4AM8A 4MIEA 1KI3A 5I9IA 2QLJA 5BW6B 2P68A 2RBGA 2PL1A 5KJ6A 4H7PA 3Q3JB 4YCNA 3O1JC 4OGWA 4RULA 3IIEA 3COSA 3ME5A 3C0KA 4IILA 4P0PB 1WZUA 2Q9BA 2D0DA 2PSEA 4IFEA 3ESQA 3VZSA 5K2OA 4M87A 3R7WB 2GXQA 4JL6A 4UUQA 1PIWA 3R0JA 2I6XA 3A6EA 4MB2A 1UDXA 2II6A 4LG1A 3VPAA 4AN1A 1QYIA 3JWIA 3KEQA 4D0LB 3VYWA 5JV5A 1R18A 1AY0A 1ZOIA 4JLSA 2BV3A 2ZS8A 4FYKA 4CQMB 2HJVA 3B60A 4E5PA 1XYGA 7MDHA 4RA6A 5LA6F 1ZM2A 1XTVA 4M55A 4WZAB 4YCSA 2FUG6 4W4TA 3RGWS 3WYDA 4HNVA 5G1PA 1ECCA 3NX4A 3B7PA 4HRXA 2PQ0A 2DVMA 2LDXA 4HDMB 1B1CA 1X94A 3QELB 3KZVA 5EE0A 3HKCA 2J8ZA 1RPAA 1JJVA 3KE9A 3G2KA 4LXHA 4PYOA 4ZVSA 1EXVA 3T3MB 4OI4A 2NADA 1NONA 1FNMA 4J1QA 3BHJA 3HJHA 5JO0A 2G3YA 2W00A 4BPRA 5JYEA 3IPAA 3OIDA 4H15A 4LJ9A 3CT6A 2PT5A 1XD9A 3BB4A 3NH9A 4LYGA 3FF4A 3G5MA 3L1UA 1FDVA 3C39A 3MEQA 2PZLA 3H2JA 4NU8X 3RVNA 3JATB 4PU0A 3S3TA 3OEHA 2Z83A 1LQTA 3QOFA 4NCIA 1TU4A 3H17A 1V1MB 3HDYA 2Q8QA 3ZG6A 1VLHA 5C7OO 2LR0A 2VNKA 4GMDA 4IXMA 3EAFA 4PRLA 4HADA 5A3SA 1IWPB 4UEOA 2ODQA 2FW8A 3U49A 2C4WA 1IWOA 2V58A 1JL3A 3PIIA 1VJDA 5D5PA 2NLOA 1BDIA 3KALA 4RPIA 3K71B 3UUEA 4EG8A 4WKOA 1VCNA 4HGQA 2DQSA 1QFSA 2TECE 4M54A 3N2KA 2JHCA 2PAAA 1R0ZA 1PZNA 2W8ZA 3V8RA 2BMDA 3VC3A 5C7YA 1PJAA 3AHFA 4QREA 4N49A 3SJBA 2X1LA 1OLSA 1XF1A 2FP4A 2VHEA 3UWPA 4B76A 1H1DA 2YJNA 3N5CA 1DEHA 2VATA 3GVHA 3H2GA 1ZLYA 1O95C 1GR0A 3ANXA 3HRIA 4G25A 4YQYA 1XCMA 2P9TA 5BSGA 1CWUA 4WE3A 3TRIA 1IH8A 1K66A 1SIBE 2ZRPA 3F3KA 3FGOA 1K08A 1YL7A 4UNNA 3T9DA 4OM8A 3NR2A 4RFLA 2ZB2A 3C3DA 4I4TA 4UU1A 4NAUA 4YACA 2Y71A 5HKLA 1NZFA 1JEYB 1U3GA 2OLKA 4LOKA 4KE9A 4O4LB 2VTVA 3SMVA 2Q1YA 3GDHA 4EPWA 3PC8C 2QENA 1UCFA 3BSWA 4UPVA 3EWIA 3R3ZA 4XRRA 5HILA 2YXEA 1ZZEA 1YE3A 2VJQA 4HAOA 2BONA 3DTVD 3ETLA 3IRUA 3LDGA 4CYMA 1XMPA 2JJ1D 3EISA 1U8TA 3EZFA 3LXXA 3L8HA 1DAPA 3CGGA 4X62B 4TS3A 3OVMA 2GEUA 1FLAA 1LW7A 4MWDA 4QQNA 4N03A 4B43A 3GOHA 2I2CA 2QG6A 2XYRA 4RH0A 3CZCA 4RPLA 1JBQA 4P4TA 2ZI6A 1F6DA 3LX5A 1E1LA 1M1NA 1YUNA 4S2UA 4P84A 3WBKA 2A5DA 4KXFB 1EFPB 4B83A 1ZRNA 3L7BA 4HCJA 1E3MA 5JJIA 5CITA 1XN1A 1OGJA 4YP9A 4DGSA 3R9XB 1ORDA 1WV1A 2C8LA 2FQQA 4NXMB 2Z2KA 3M6IA 4ZO9A 1PR2A 2YXPX 3C6KA 3E9MA 4NJEB 5FBWB 2C3MA 2ID9A 3L6EA 4QYMA 3JU3A 3OLYA 4IUYA 1TQ2A 1YB2A 1P1BA 3ZBQA 3R7FA 1FYWA 3ZU5A 1ZI8A 3Q98A 2UAGA 4D3XA 4ZGGA 1CUBA 2BHRA 1RWMA 4BNUA 5J2TB 4I1RA 1H4TA 3C5CA 1ZOSA 2O0LA 3LO8A 4Q03A 1JI3A 2CFOA 3CX7A 3LQ4A 1DMSA 4CG2A 4RAOA 3FPAA 4OI1A 4X6YA 1YCFA 3RUPA 4G26A 1U1EA 3O93A 2QTCA 5EIBD 3WHKA 2JEOA 3UBTA 3CEPB 2OL4A 4BJHB 1MEEA 1ISRA 1Q0SA 3EH1A 3OJWA 1M1UA 4JXKA 3TLZA 2AI1A 2RIRA 4IMRA 2D6FA 4TVOA 3QKWA 1IN7A 1SXJD 1YRBA 2VK4A 1E77A 3R0ZA 4K0RA 3OFKA 1ZR4A 1R5BA 3BWDD 1FDUA 4F56A 3UPDA 3I83A 2XOKA 4GZMA 4U5XA 4NH4A 1MO3A 4UHHA 1ATZA 1NLZA 2FVXA 3FKSD 1NWHA 1Q7GA 3HA2A 4O0LA 1E1CB 1GY8A 3GV0A 4J0KA 5AH0A 5HWSA 1NXOA 1K4MA 1CE8B 3QSGA 2L42A 3IJ5A 4J9VA 1QO7A 1BRMA 2EZUA 2HSDA 2E1PA 1JAHA 1UK7A 3BHMA 4XR4A 3IV6A 1Z39A 1DOHA 4BQFA 3Q41A 1CLEA 3MJTA 4P8RA 1S2IA 2IQIA 2EFDB 5ENDA 4BFXA 5B12A 3THRA 3SPXA 5B7GA 1LBIA 2GVNA 5A4AA 5KCZA 1NVEA 1V3QE 4W9NC 1OX6A 3THWB 4QXQA 3GJ5A 4ARZA 3NAMA 2JARA 1DIRA 2GAAA 1LBHA 4JJKA 1EUYA 5IAKA 1Z56C 5CXXA 4ESVA 2FG5A 1P6UA 1TM7E 1TW2A 1JIXA 1NW9B 4G5SA 3OOYA 2OFXA 4RVHA 3A4LA 2Q50A 2H17A 1YS1X 1M75A 3FDXA 1NP3A 4TXJA 5FWNA 2MDTA 2XD9A 2WJVA 1H93A 3AOEA 1XDUA 1Q5PA 4L3VA 3C6XA 1NN5A 2Q6KA 4P4SB 2DBRA 4OOFA 1CDEA 4AX8A 1B41A 3WLJA 4GX5A 4UXHA 5BWBA 4XEUA 4EYGA 2HRBA 2QVBA 3EZNA 4N5DA 1H5UA 3HVHA 4PFSA 4DVJA 4QELA 4DMCA 2W58A 3CN9A 3U40A 5EWLB 5F2NA 2QTRA 5KU1A 3D81A 4K9SA 3NTRA 2HO5A 4Q66C 521PA 3ITEA 3GVIA 4MW9A 1GNVA 1GAWA 2I4RA 2O8EA 4P0QB 3V48A 2LBPA 5CX1A 1PK8A 1AXRA 4JT2A 1SXPA 2GNAA 5AK5A 2Z6VA 5JI3E 3K70B 3ER9A 2PBLA 1F14A 3TNDA 3T35A 4F5EA 2O5VA 5FNZA 3GYBA 3T7SA 1JEQA 5BNTA 2JGAA 4OMCA 1VKJA 2QX7A 4DIUA 4HLUA 2SKEA 5GV7A 4ZVUA 1UPAA 4FJ0A 5DW0A 1EGHA 5DOVA 4HN4B 1UPBA 4XTRA 4DCPA 3U80A 5ELMA 4NFSA 1LSOA 4F2GA 1T2DA 2ZDQA 4AB1A 3JASA 4LRXA 2PA0A 4HDAA 3C41J 1RDFA 1RWPA 2OTCA 4EW2A 3FDIA 1PJZA 1A82A 1D2NA 1TYEB 1WMFA 3GLTA 3TL2A 4F5YA 3QWFA 2C54A 5IM4F 2AFRA 4LZJA 3R75A 3TL6A 3A0RB 1VG8A 2LCQA 3U7RA 4A8TA 3TQTA 4FUTA 4IGKA 4CKWB 2A9PA 3MOIA 1EQUA 3CRQA 2BMVA 1BGWA 4FWTA 1NVTA 5SYAA 5BVHA 5HZKA 4OUDB 4JP8A 1SUWA 1FRFS 1T5LA 5JT1A 1UAAA 4DV6B 2B37A 5JAOA 5F35A 2NQTA 3EVFA 5EWMA 4F12A 2Q45A 3O0TA 5TX7A 2JAQA 1TM4E 2J41A 3PXGA 4EOGA 3RS0A 1TTTA 1L4UA 2NUBA 2WT9A 3KLMX 2AF4C 2WYUA 1P1RA 3L4KA 1V41E 2AFHB 4KXVA 4FEAA 1GNLA 1ISIA 1ZRMA 4BTLA 1EWYA 2AFVA 3OIVA 1GNQA 1MMFB 1C7FA 2QYSA 4KO8A 3ZXSA 3RVSA 1CUUA 2YV3A 1YR2A 4B6EA 3QVUA 4OTZA 2SCUB 1S8AA 5U4XA 3A1EA 4G9EA 4BNNA 3NHKA 3RUHA 4ZZIA 4FTWA 2C5EA 2Z57A 2ZSBA 3ABZA 4M0LA 1FTWA 3ROKA 3M4YA 2GXAA 5CD1A 4JD5A 1XZ8A 4QVGA 3DMGA 1CSEE 4L95C 1M2VB 4YJ2F 5EHZA 4ILEA 1KEZA 2H0RA 5AP9A 1DJPA 1MB2A 3N2YA 4NV1A 1D2AA 1ICEA 1M1YE 1RMYA 3M6FA 1LPOA 5AJUA 1SQ5A 3NCHA 1MHTA 3MJRA 3LW7A 2DECA 2VRNA 4JNKA 1JDSA 5DZSA 3QLTA 4A5SA 1M72A 2CMDA 4UUMA 4D9GA 5I7VA 1U99A 3STHA 2WJIA 4JOBA 1WLSA 3C3MA 3RLIA 3LDHA 1E9AA 2PHZA 2ATVA 2ZITA 4NAVA 3VR0A 1J0EA 3OZUA 1ORHA 3MAAC 3QPDA 4IIDA 2J7PD 3A1CA 4DSAA 4CG3A 3LUCA 3QEAZ 2OOKA 2HSWA 5CCBA 3V6MA 4OJKA 2V5AA 2B99A 1UJMA 4TL8A 1MB9A 4H1VA 1VCMA 2ADMA 2EBHX 3AGQA 4O4JF 5DN9A 2DWCA 3QX8A 3RK0A 5C4IA 5CXSA 1IVNA 3HGTA 3E22A 1PU2A 2WSIA 3P0IA 3ZEIA 1E2EA 1P6XA 3CUKA 4V0SA 3RSSA 3BREA 3PIDA 4OK5A 3IIMA 4PHCA 2BGTA 3H0CA 3V4SA 1DEAA 2CD9A 2CFRA 4AG3A 3JRXA 2RGEA 1W6RA 1RBZA 4JLNA 4FI3F 4MUIA 4Q9LA 1QP4A 5LQAA 2JKZA 2FP3A 2AFHA 1LNQA 3BHNA 3JQCA 4Z3KA 1IOVA 1P3DA 1BMDA 1JHPA 4LYAA 3EPPA 4PAMA 4QU8A 2ZATA 2FPUA 4UW9A 3D0QA 2BFDB 1UJ6A 3V7UA 1Y80A 3JAKA 2H1RA 2WTMA 4DYDA 4GVPA 3NMUF 4DJJA 1MV8A 4W5NA 2VN8A 4JY7A 2J3IA 3WWZA 1LI7A 2UDPA 3CW2A 1RJEA 3ZI4A 3Q0EA 1LC0A 1XZIA 3QH4A 3BPSA 1DL5A 1XXHA 1IBCA 2GK3A 2XB6A 5ALLA 3K1AB 1XC7A 3NH6A 3FJ1A 1I0LA 4DS3A 4ALKA 5EC8A 1PVOA 4CQLA 1O2DA 1N5MA 2VNAA 2IYSA 3KKZA 3I04A 2GD2A 1NUAA 1JJBA 3ADDA 2Y93A 4KGZA 1WCWA 2AQKA 3PQ3A 2AYZA 2QI9F 4KXQA 2KS6A 2YFYA 4RQUA 1OFIA 3GJRA 4JT4A 1WBDA 5LP6F 3B9QA 3PEUA 4J4BA 3B78A 4GPEA 5FA5A 5IUJC 2ACKA 3COZA 4JBXA 1CR4A 3B1JA 1UPTA 3FNIA 2HK9A 4Q5IA 4R9RA 4QRIA 2BLNA 5YASA 2OO3A 4FCVA 4FT4A 4ZOBA 4GD3Q 3I52A 3QOWA 4FDAA 1M1YA 1T5OA 1PR0A 4ZVLA 2XZOA 4NTZA 5CCEA 5F77A 1HE1C 2Z04A 4EW6A 4JJIA 3MNFA 1ISPA 4RHXA 3AGPA 3H0VB 3F8SA 4WK0B 3G2MA 1B93A 1KO7A 2WTBA 4PG5A 4HL6A 3UXMA 2BE9A 3QF4B 5DTIA 5B1DA 4Q1BA 5I48A 4PYMA 2P2LA 3H65A 4EPTA 5BRNA 3VNSA 1R88A 4DJDC 2ZZMA 3F6EX 5FLYA 1JDUA 2OK8A 3WIUA 2YWEA 4G0PA 4C21A 4NKRA 4WADA 3MK31 1OBOA 1TW3A 1EWQA 1XE3A 2OV3A 3H2YA 3G6KA 2HB6A 3E9YA 3RRJA 3OEHD 5KOYA 5E6UB 2HU8A 3V1YA 5AXDA 1LRKA 1T8RA 1ESNA 1RM4A 2Q5EA 3IO5A 4IY1A 4CTOA 2VEOA 3VOAA 4M9SA 4L78A 2QRJA 3DFZA 4C2BA 3RC2A 1K92A 4I4NA 3OBIA 4BO5A 1T36B 2F43B 4BX3A 5IABA 1X7GA 3KOOA 4ETIA 4NCJA 3CH5A 5EXTA 1WABA 2A2ZA 2AG5A 4UUBA 3SK0A 3UXYA 2A3NA 1I6LA 4KOEC 4WZAE 4DXAA 1WXFA 2XBUA 3H2ZA 3HCOA 3CCBA 3ML1A 4FFBB 3RQSA 3C5VA 1MDBA 2BRUA 3LGAA 5HOQA 4QDKA 3AFMA 2F1RA 4GKJB 2ZS7A 4R7TA 4E2XA 1G18A 1UWVA 2WP0A 4P1ZA 4HFNA 4ETMA 5C0OE 3GG2A 2JJ2A 3HWWA 3KKOA 1TLLA 4KIFA 5IKPA 3IAUA 2AC2A 4FN4A 3WMGA 1RYHA 4TTIA 3NT2A 2ZWOA 1YRQA 5CDTA 3TD9A 3GX1A 1JWLA 3G0CA 1PT8A 3R3WA 3TD2A 4QVKA 2C7GA 1USVA 3M5WA 1PHRA 1W85B 1QZUA 4IJKA 1UKZA 2Q3FA 5IJXA 4OQ4A 3S8MA 3BJEA 3NNSA 1I2ZA 4AZTA 4CF4A 1NXWA 3CLTD 4U4AA 3VC1A 2CCJA 1E1MA 3T7AA 1Y9DA 3IXLA 4F9FA 5E1BA 5JH7B 2C9MA 2QRVA 2XRYA 1K7XB 4NDNE 4RVNA 4YJHB 1GNTA 5AKJA 5EVJA 5HJ2A 4EG6A 3GP3A 1RI2A 1Y1KE 1T1IA 2FUNB 3FPCA 3WGQA 3K1TA 4JHLA 4NYIQ 5D2CA 5CAEB 1KDYA 4DA7A 3P2EA 3HKEB 5G1OA 5JTTA 3JQDA 1I10A 4U2BA 5BWOA 4XWYA 4KDEA 4Y9UA 5B6JA 3VDQA 4EARA 3OZGA 3FCAA 1CIVA 2WM2A