1DIHA

Three-dimensional structure of e. coli dihydrodipicolinate reductase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
272
Chain Sequence
HDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDRODIPICOLINATE REDUCTASE
publication title Three-dimensional structure of Escherichia coli dihydrodipicolinate reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 79
structure length 272
sequence length 272
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 1994-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01113 DapB_N Dihydrodipicolinate reductase, N-terminus
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1dihA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1dihA01
1J6UA 2YFQA 4DUPA 1VE9A 3FPLA 4YT5A 1NBOA 1DC3A 1F0YA 4OKIA 4F6CA 3BMNB 3U49A 4TZKA 5KJFA 2WSBA 3GUCA 5TF4A 1R15A 3FTNA 1E6WA 1Q0QA 3JQBA 2O4UX 1E6UA 5A9TA 1D8AA 1GL3A 3ICPA 1LA2A 3OA0A 1YKFA 1A7AA 1R0SA 1A27A 2HSDA 4NBVA 2AG5A 1DJQA 1B16A 3QLJA 1XKQA 1NASA 4XDZA 3V8BA 5FFFA 2J3HA 3PLNA 3TZQA 3DHEA 1ML3A 3PHIA 1IPEA 1I0ZA 4QXMA 4JX8A 4ALKA 5I8WA 4FOOA 4W6ZA 4MVJI 4FS3A 2ZB7A 1NFQA 2DUWA 3MJ4A 1SEPA 4BMVA 5I7EA 3I4FA 4LGVA 4OAQA 4J7UA 4ZD6A 3FD8A 4D45A 2OO5A 5BNIA 1Y8QA 4IQ8A 1RM4A 1YQGA 4ZQBA 3K2BA 2CDAA 3LT0A 4U7WA 1MLDA 1VM6A 5AXAA 1C1XA 1DIGA 1I5RA 1UZMA 4AJPA 4E5PA 1PQWA 2DC1A 1DHRA 3H3JA 3HB5X 4Z9XA 1I3KA 2O4CA 4JK3A 1H2BA 1GCOA 3PDUA 2OGUA 3UF0A 4BNTA 1Z82A 4RDIA 3WJ7A 4CL8A 3H7AA 3HDHA 4UULA 5A4DA 3LC1O 2Q1UA 1V3TA 3PFFA 2X6TA 1UAYA 3ZZNA 2RCYA 3D5TA 1TA4A 4E33A 1JAYA 1F12A 3OH8A 1I8TA 3GZNA 4R1SA 5AXDA 2VNSA 2NADA 8LDHA 4ILKA 3ZWNA 4LVCA 1WXDA 1A5ZA 4J1QA 4WLFA 2XXBA 1VJ1A 2V6FA 4IJVA 4UVHA 5FEUA 4OOEA 6ADHA 5JDIC 4LMPA 1XHLA 2B5VA 1RM0A 2ILTA 4CMIB 1LQTA 3P19A 4J1TA 5KJ1A 3DBLB 1U2GA 5EN4A 3DZIA 2EGHA 3GR6A 1PS8A 1EUDA 1KIFA 3GVPA 1AHIA 2VHYA 3ZWCA 1PJ4A 4B7UA 2HQ1A 2O3SA 4MVJA 4EGFA 3B20A 1CYDA 1LBEA 1LDBA 1V3UA 3H9JA 4K9DA 3ZW8A 2JAPA 2LDXA 4LMRA 2GRAA 2NVUA 1HDGO 1EDZA 2JFHA 4XQCA 3V5NA 1BG6A 4KOAA 1BTOA 1N7HA 3JD3A 1NPTO 4BO1A 3E8XA 3DFUA 1DIHA 3IQDB 1T4BA 1JAXA 1QV7A 2Z1MA 3EZYA 3G1TA 4EJ0A 3U62A 5AYVA 1PJLA 2CF5A 2DBVO 4BKUA 1E7WA 5B37A 3QWBA 2AQHA 3NTOA 1I24A 2IZZA 1P3DA 4DLAA 1JKIA 1GTMA 1QYDA 2VT3A 4PZEA 1V8BA 3NDRA 4XQ9A 3NDJA 3PP8A 1K2WA 2IRWA 2O3RA 3GEDA 3ZHYA 5DULA 4RVDA 4ONEA 3M2TA 4LRSB 4XB2A 4RL6A 1NPDA 4G2NA 5JCJD 2RIRA 4YBZA 3GQVA 2Z5LA 1D1TA 4BO2A 1U5CA 3SVTA 2WM3A 1E7RA 1PTJA 2DU8A 2FR1A 3DQPA 3OQ1A 3A1NA 4MP8A 4HV4A 3GN2A 1PQPA 2VUTA 4K26A 1JVBA 4B4UA 3E9MA 3JQ8A 4PRLA 4R9SA 1HZZA 1G0OA 4KP7A 1Y8RB 2J8ZA 3VKUA 1HWYA 4MKZA 1E5LA 3JQGB 5F1OA 4L4XA 9LDTA 4A5OA 2EV9A 3P7MA 2DBQA 2VYND 3B1KA 3ADPA 3GG2A 3VDRA 4IDGA 3W4KA 1LSOA 4TKMA 3WFIA 1ZUD1 1LUAA 4TRMA 1EBUA 3TDKA 3KRTA 4Y8VA 4YVFA 1E77A 1KC1A 2AMFA 3RC7A 5AXCA 1ZEMA 5GY7A 5JSFA 4Q9NA 3G17A 3DAFA 3WGIA 1PZHA 3GNQA 2D8AA 4R3WA 2NU6A 3KBOA 4F6LA 3GFGA 2GUGA 1NVMB 1BSVA 3KTDA 1YRLA 3SC6A 3U4HA 4XWYA 2YW9A 1DRWA 4TRJA 3INRA 4FSHA 1BW9A 1DFHA 3GGOA 3KYCA 4HFNA 5JAZA 1R4MB 3WBBA 3AM3A 3NKLA 3WGTA 1GUZA 1KETA 4R3NA 1K0UA 5CDYA 4YACA 1DFGA 4QUKA 1E1NA 3F4BA 3LLVA 4IPTA 3PIDA 3AY6A 1E6EA 3GEMA 5J9GA 3AI3A 1F8FA 4BQRA 3GVXA 2HCTA 2C59A 4OXNA 2BGKA 4ZHSA 7MDHA 4RVSA 3FWZA 3ETGA 4YXFA 1ZH8A 3GEGA 5MGBA 4PVDA 4YWJA 5IFLA 2D4AA 3JQDA 3Q2IA 1P31A 1ZK2A 4GX5A 1Q7BA 4FD3A 5A3VA 3WS7A 3BMQB 1YB4A 3VH1A 3H9EO 4HFRA 1ISFA 4GI2A 4WCFB 1P0CA 3CPSA 2X0IA 4RF2A 4E2YA 4R69A 3ZHXA 5A04A 3ZWBA 5IDWA 2CD9A 2CNBA 4HNHA 3PTZA 1XU7A 3PIIA 5CDGA 3M6IA 2WD7A 1P1KA 2DBRA 4BO5A 5TX7A 4NJOA 1AGNA 3AUTA 4L4SA 4GWKA 4WLOA 4BIIA 1QR6A 1IUKA 2P2SA 3DTYA 3FCOA 3FRJA 1EZ4A 3D1LA 4DMLA 1EE2A 1NTOA 3TQHA 2W2LD 4URFA 4YCAA 2J6IA 4H16A 1WAMA 1B14A 5H83A 4CM6A 3VTZA 4B8WA 2FN7A 1GPDG 1N92A 2O2YA 4OJNA 2YYYA 3RROA 1TT7A 3I9JA 5HA5A 3RKUA 1CRWG 1JKJA 1ZSVA 4IJUA 2A35A 3VVCA 1PIWA 2UVDA 5BT9A 3UXYA 5IN5A 5JY1A 3NV9A 1KC3A 4E12A 3S2IA 4YYZA 5THQA 2HMWA 2Q99A 4LISA 2R2GA 5G0VA 1P1RA 5C7IO 1I32A 1RPNA 1Y9EA 5KJCA 4U8GA 4DGSA 3D4PA 3GMSA 4BNLA 3HE3A 1GR0A 2E82A 5IJZA 4JXKA 1VL8A 3X2EA 2GR9A 3ON5A 3PI7A 4WNCA 3ENKA 3OFSA 5DDIP 2RAFA 4J2HA 3WGQA 1E1KA 3Q1LA 3GG9A 3HN7A 3E5MA 3GNTA 3TN7A 1RM3A 4BB5A 3TFOA 5JYAA 2FHSA 1MXHA 3E18A 4AJJA 4BVAA 2EGGA 4NU5A 3EVNA 4YJDA 3WDSA 3WJAA 1P9LA 3KYDB 5HM8A 3GGGA 3TZCA 3Q9UA 4BGVA 2E6UX 4A2CA 1UR5A 4EI2A 1OZAA 2FR8A 4WLEA 4FFLA 3ZW9A 3GNSA 4CLEA 2PD6A 1PL6A 3ZGYA 1LRKA 2YDYA 1U7TA 1L7EA 3N7UA 3H9GA 1LEHA 1I33A 4E2XA 2TMDA 4BO0A 2H1SA 5EPOA 2FZWA 3UW3A 5CPFA 3DBRB 3MTGA 1BDBA 2E37A 2RHCA 3DMTA 4E13A 3CMCO 3QVXA 2BFPA 4FFPA 3LC7O 2D5CA 3KV3O 1Z45A 4Q3EA 4CM1A 1R0KA 4GKVA 4PG6A 5CG2A 1HEUA 3EVTA 5JCXA 1GQ2A 3ZWOA 4DPKA 3QVTA 1NXQA 3U0BA 2ZB4A 5KCZA 1U4OA 4IJWA 4Y98A 4KDEA 3RUAA 4XYBA 1KY5A 4BGEA 3JD2A 3RFVA 5HS6A 4D46A 4JQCA 4A7PA 5B1YA 2BF7A 1XA0A 4CLDA 4BNZA 1NQTA 1B8PA 4CQLB 2X58A 2VZ8A 4NK4A 4BUCA 1BXKA 2BGMA 3DOOA 1AXEA 2WYWA 3QP9A 1YBAA 2ZTUA 2Q46A 5BSHA 2P4HX 1ADGA 4PCVA 3H3FA 4HFJA 1HETA 2WYUA 2BMAA 3FNFA 3QIVA 2R00C 5CHEA 4FN4A 5IDQA 2PH3A 1NVGA 2DVMA 1ULSA 1PX0A 2QYTA 1SNYA 1Y1PA 1V6AA 2DTXA 2YV1A 1J0XO 3MZ0A 1GU7A 2EERA 2O2SA 4XYGA 1B2LA 4RO0A 3RJ9A 1LDNA 2DLDA 4BOYA 3OJ0A 4E32A 1E1LA 4ZN6A 2EXXA 1P1FA 4EITA 1X1TA 3PJDA 5JAQA 3IJPA 2A92A 3ONFA 2Y68A 4O0LA 3KHUA 4DBZA 4CMHA 5A02A 2EF1A 2RH4A 4MVJP 1ZVMA 3QWHA 4OM8A 3L0DA 3E1KA 4J6FA 3WLFA 4IBOA 1PR3A 3ST7A 4CM9D 3H9UA 2YHUA 2C2XA 1P33A 2DPHA 4S1VA 3W4JA 2O3JA 1YGYA 1YDWA 4YT8A 5CFZA 3IOYA 2NVBA 4Z9YA 1HXHA 1WNTA 1KEVA 1UXGA 3ZV6A 2B0JA 4K1LA 2VTDA 1UP6A 1YS4A 4C7JA 4Q3AA 2B83A 2D5AA 2VOEA 5K6AA 3OSUA 2NNLD 3F3SA 1H94A 4MVJE 5H82A 2Q1SA 1LSSA 2GZ3A 1HYHA 3DMYA 3BTSA 4CQLA 1MG0A 4TRRA 4KQWA 4MOWA 1LC3A 4NH4A 4I9NA 5JY6A 2WDZA 4I5DA 3UCFA 3S2EA 5BR7A 5TIIA 3UUWA 1KVTA 1PR9A 4J9UE 4LK3A 2F00A 4PLHA 3DZHA 1YQDA 3V2UA 1JDJA 1Y9AA 2YFHA 4RZHA 1R6DA 2C5AA 1ZK3A 4K6FA 4H3VA 1B7GO 4PGFA 4BO7A 4GSLA 4LRTB 2V7PA 5G0WA 4CR8A 4GPD1 4RF5A 1C3VA 1TB4A 3STHA 5JLAA 4P4GA 4CMEC 2P91A 1OC2A 4A03A 3CH6A 3RUHA 4BL5A 3B70A 3BYZA 1ZXLA 4YT4A 1OC4A 5DCYA 5EJ2A 3DZJA 3VH3A 2RHRA 1Y7TA 4DYDA 2PD4A 4FJ1A 4I5FA 4W4TA 4QQRA 4CM4B 4F46A 3MJTA 1F14A 1Z6ZA 5G0UA 1KOLA 4IM7A 3ROKA 4MO2A 4IGFA 1QYWA 3I9MA 4E5MA 2Q50A 5COQA 1RKXA 1UXKA 3RBXA 4L4RA 3ANMA 3IIEA 1MB4A 3K2EA 4DBVO 1K6IA 2BI8A 5I9NA 5IXSA 2V6GA 4UVGA 4TWRA 5U1PA 3C1AA 3ONDA 4RQTA 5TSDA 1ENOA 3WXBA 2GERA 2Y66A 1DO8A 2OFPA 1ZK4A 4B4VA 2VRCD 2V65A 4L74A 4BQPA 1C1DA 3DEYX 4GAEA 4M49A 5G4KB 4M89A 2CFCA 5A03A 1CF2O 1M67A 1W73A 4WUVA 2R6JA 1LI4A 1NVTA 1UUFA 1LU9A 1T2CA 2HMVA 3MWEB 4HNGA 4ALIA 3I23A 1YB1A 1ARZA 2PLAA 1V0JA 2J3IA 3VZQA 3CKYA 1LQUA 5T8KA 4BMNA 4J9VA 2EG9A 3W4IA 3PDJA 5TJHA 3L6OO 1QRRA 4AG3A 3ROQA 4FIZA 2C54A 4CLOB 3NTQA 1NNUA 3GMDA 4CM7A 1A9ZA 5BNTA 2PTGA 3EC7A 2A9FA 4CL3A 3F4LA 1Z7BA 3E48A 3UH1A 4EBFA 1ZK0A 2CVZA 3CSDA 3TJRA 2Q22A 4RVFA 4Q39A 3KB6A 2P9CA 1E3LA 3HFSA 5DBIA 1V9LA 1ZNQO 3WGGA 3H5RA 4J7XA 5EERA 5KNLA 3MJVA 3PHJA 3IKTA 1DAPA 4NBTA 1O6ZA 3V1YA 2QHXA 4B3JA 3JQAA 1DFIA 3TZ6A 1ENZA 3GT0A 4J4HA 4PZCA 3RBZA 3W1VA 3B6ZA 2F1KA 4YJHA 2Q45A 4ALJA 1HF3A 1PEDA 3PHLA 3O9ZA 5KIAA 3RWBA 5C3MA 1U8FO 3MOIA 4DXHA 5AQ1A 5B4VA 2IEDA 3SC4A 3WGHA 3D4NA 5CDSA 1B26A 4YRBA 4IS3A 1BXZA 1TXGA 5T57A 1OFGA 1UDAA 3IL2A 2JHGA 4EYEA 5G0SA 4RPHA 1EEHA 5JMPA 1SO8A 4RF4A 2QW8A 4D3FA 3I5MA 2OP0A 5KOIA 5EMHA 4J43A 3WSWA 2IXBA 5EL0A 1W6UA 1CDOA 4EDFA 3DC2A 2AE1A 5DBGA 1P45A 3TOXA 1UP4A 1R12A 4OXYA 1HT0A 2Z1NA 1M2WA 2HU2A 5DNAA 1Y8QB 2C5EA 3HN2A 1R0LA 1ISGA 3OJEA 4JBIA 5L95A 2FMUA 2Y1DA 5DN9A 3SJUA 4CLHA 1I10A 4INAA 4I5EA 2WYVA 3GC6A 1C1XB 1O95A 4RPKA 4J4BA 5IF3A 2CY0A 1MUUA 2VOJA 3AUUA 3M2PA 3WTCA 2GZ1A 1UZNA 4WLVA 4UUOA 4MKXA 3RBVA 1MA0A 1KBZA 3O4RA 3SLKA 1ZBQA 2VYVD 3S8MA 1LLQA 3KLMX 4CV2A 3E9QA 4HP8A 2OXIA 2FRDA 1MXFA 5IZ4A 3HWRA 1ZZEA 4S3MA 3RC1A 2C07A 4Q3CA 2UDPA 1JW9B 3GZNB 4J90A 3T4EA 4MVJH 3DFZA 1I2BA 3K8ZA 1K6JA 1A7KA 1Q0HA 3IMFA 4JGBA 1E92A 2ZB8A 1DB3A 1KEPA 4XQGA 1PL7A 4U5QA 3N58A 1X0VA 3C7AA 1G1AA 5JFOA 5A06A 3C85A 3ADOA 3RUIA 1GPJA 3IP1A 4JIGA 2C7VA 2IYPA 3OBBA 2EKQA 1GYPA 4LSMA 1DC4A 4ESOA 3GY0A 4NNJA 5BSFA 1IL0A 1MG5A 1UZLA 2EW2A 3PVZA 1NQAO 1PGQA 4UEOA 3Q3CA 4PZDA 4YB8A 1U4SA 1P1JA 1H5QA 5I7VA 3BXXA 5JC1A 1IOLA 3E5RA 5AVOA 1HL3A 1LLDA 4Y6RA 3AOEC 4CM8A 1ONNA 4WK6A 4D41A 5JYDA 3PQEA 3RJ5A 1N8KA 1XQ6A 2X86A 1YWGO 2NVUB 1E3EA 2J5RA 1YOVA 2QRKA 2WE7A 3KLPX 5TT0A 3TZHA 4D0RA 5EQDA 1GEGA 4XGKA 1SAYA 3ORFA 3JQCA 5L3ZA 5B4UA 4YAGA 3L9XA 1H6DA 4FB5A 5GZ3A 1CETA 5JDCC 3VTFA 1H6BA 2DKNA 2BI7A 1NQ5A 2IZ0A 4XRRA 1OAAA 4JLWA 1YL7A 2X8LA 2HLPA 2AA3A 1N7GA 1EK5A 4W9NC 3WYCA 3JYOA 5CDUA 1O89A 4YT2A 1ZEJA 3PQDA 1GYQA 2HJRA 1ISHA 3ITKA 2W4QA 4QEDA 4ZQEA 3R3SA 4FC7A 4IMPA 1R66A 3ROMA 4KDFA 4WGGA 4R5HA 3F47A 3K73O 4R51A 3H5AA 5I7SA 4JBHA 4XB1A 4MDHA 3VH2A 1NWHA 1YJ8A 4NZ9A 7ADHA 2NWQA 3TFQA 4DLBA 3LZ6A 2J5QA 3ZWMA 2QRJA 1BXGA 5JXWA 3PZBA 5JDIA 2JKVA 3JQ7B 4DQXA 3CIFA 3JQ8B 4FCCA 2GDZA 4GGPA 1FDUA 2PH5A 2W98A 2X9NA 2ZK7A 4CV1A 4ND3A 5L9AA 1JWAB 1IULA 1SBYA 3DL2A 3OJLA 1C14A 2BELA 2FP4A 4J2OA 1WPQA 4I9HA 4M86A 4E5KA 1F8GA 2EKLA 1SOWA 2NM0A 4AICA 2DPGA 3RUFA 3I1JA 2IDZA 1RYEA 4R1TA 3Q9NA 1GUFA 2X9VA 3KM0A 3LYLA 1QYXA 2Q4BA 3DO5A 5ENDA 5IAAA 1G6KA 4FFNA 5ITWA 3PLRA 2O3TA 2Y05A 2O3UA 5L40A 3D7LA 2NV6A 3QRWA 3JYNA 4AJ1A 1VJTA 4FPXA 1TT5B 1SB9A 1XGKA 2YQ4A 2B69A 4MKRA 5IDXA 1QYCA 2VWPA 2E4AA 3S2FA 4UVEA 3FNHA 1MC4A 4Z6KA 2H63A 5ER9A 4J16A 5AXBA 4AJ4A 4I5GA 2ZYGA 4OKNA 1BW9B 1BRMA 3KYCB 1K6XA 3NEPX 5KJ6A 1ENYA 3PWSA 2HK8A 1U3WA 3ANLA 4GSKA 3PJEA 3ZH2A 4YQZA 3V1UA 1X14A 2PGDA 3OICA 3DONA 1ONOA 2H9IA 3WLEA 3KETA 3KEQA 4GX2A 4ZGWA 3OHSX 1C0IA 3WX0A 4BO9A 3AOGA 1NPYA 3RASA 1KYQA 1U28A 3AI1A 4GX1A 1PWXA 1T2EA 2Q1WA 4RVHA 4D43A 3BTOA 3JQ7A 2PGJA 4DIFA 4BNMA 3WNQA 2NVWA 4P8RA 2DFVA 4PG5A 3WG9A 1PGJA 2E48A 5J23A 1B8UA 4ROSA 2HO5A 4LW8A 3F9IA 3GHHA 1DRUA 4N5LA 2RBEA 3AI2A 4N5NA 3G49A 4ND1A 3RI3A 2X22A 1NFFA 4MP6A 1KS9A 4N5MA 4PFJA 5C7OO 1EUZA 1KVRA 2X1HA 3GDOA 4FJ2A 4B7CA 4YAJA 2WD7B 1TT5A 5LDHA 4JJFA 4XIYA 2C7GA 4W7IA 1GUYA 2CZCA 3UHAA 3JYQA 1ZIDA 4IQGA 5F5NA 5I9MA 2I3AA 1VSVA 3K92A 3GN1A 1MP0A 2AEMA 4DPMA 4UUNA 1SCUA 3DAGA 1Y5RA 1N2SA 3A4VA 4TROA 1VPDA 4XKJA 5JPIA 3AJRA 2VTEA 3F6YA 2NU8A 2IE0A 4OO3A 3LDHA 3L4BC 1XU9A 4FDAA 1AUPA 1M6WA 1IHXA 1WZIA 4A0SA 3JQEA 2D1YA 2JCXA 5DZSA 1DAOA 3U4DA 5CEJA 1DOHA 2GYYA 3QW2A 4MVJM 3FR7A 2LDBA 1NWCA 1GQQA 3OQ6A 1BMDA 4G81A 4M8SA 4MPDA 4ID9A 4TSKA 4RZIA 3OIGA 1DLJA 2VHWA 4IMRA 3PJGA 1OOEA 5TLSA 3I6QA 2GN9A 4BNGA 2G76A 3O8QB 3RQSA 4DL9A 4AFNA 4L73A 3VZSA 2UUPA 4FGWA 3BA1A 3PK0A 1W8DA 3GHYA 3LU1A 1HYEA 4QTZA 5H81A 3DZFA 1XYGA 2C20A 3PYXA 4R5MA 2Y0CA 3FPCA 4ZQFA 4RCVA 4CV0A 1NYTA 3T4XA 4WLNA 4BV9A 4A10A 1XLTA 3IDSA 1CWUA 1I3MA 3V2HA 3VPSA 2PFGA 1G0NA 3BMOA 1AN9A 5IZCC 3HDQA 1PWZA 2H5LA 3RAJA 3ZI0A 4NQZA 1E3IA 5ICSA 5L51A 4MVJD 1S7CA 3MTJA 3GAZA 1LX6A 1BVRA 1T24A 2UAGA 3L07A 5HRUA 1D1SA 2X5OA 1NP3A 3VDQA 3D64A 3LVFO 4XJSA 3WTBA 3SLGA 4CM9A 4A73A 4B3HA 3FNEA 4IDBA 5L7TA 4AJ2A 1JU9A 3SBOA 1YVEI 4IIVA 3ZV3A 4JN6B 1M76A 3L77A 1HTBA 3C3XA 3HADA 2GSDA 3OM9A 3MJCA 1ZSNA 4M1QA 4Z0TA 2VHXA 3K30A 3T7CA 1RJWA 1WMBA 1SZJG 1ADFA 1P44A 2G0TA 1T2DA 4UREA 4OSPA 4IQ0A 3ASVA 3TRIA 3ZHBA 2H6EA 1UXHA 2OP1A 2PZKA 3O8QA 2VZ0A 2I67A 4O59O 1UH5A 3PRJA 1J49A 1IHYA 3GGPA 1XELA 3GRKA 4OOFA 2DM6A 4XRGA 5U9CA 4CR7A 5L53A 4ZA2A 4PIVA 3LLSA 1DIBA 4GL4A 5CG1A 3QHAA 4HWKA 1EFKA 1PJBA 1ZXBA 3SJ7A 4CUJA 2EJVA 4CQMB 2HRZA 2CMDA 1JQBA 2NTNA 1M75A 2PKQO 1HE5A 4WLUA 5KVQA 4WCFC 1ISMA 3GA0A 3IJRA 4TKLA 3DXFA 4JP3A 3PWKA 2DTDA 3I83A 5C7LO 1LNQA 4FBGA 4UAGA 1VL6A 2ZJ1A 4BNWA 2POQX 4NHEA 4QT0A 2CSUA 5CAEA 4XDYA 1RM5A 3JD0A 3KO8A 4F45A 1ZW1A 1LRJA 3FR8A 1I3NA 4JNKA 3UOGA 1R16A 3EHEA 5KVVA 4E4YA 4C7KA 1B8VA 2Y0DA 4IXTA 2Q2VA 1EVZA 4Z3KA 4B79A 1EUCA 2I5PO 4ND2A 3A9WA 5ES3A 3O38A 1HE2A 5JO0A 1A71A 1XQ1A 2GF2A 2NQ8A 2P68A 1YE3A 5CEFA 4RJTA 4P4LA 3TPCA 4ZQGA 3TZKA 1YDEA 4Y6PA 5EINA 1E3WA 3OJFA 5A9SB 1Q2XA 3QVWA 3GVIA 2OL4A 3WICA 3OIDA 2W2KA 5ITVA 1XIVA 3FBTA 4U6QA 5FF9A 4Z0PA 1PJ2A 4L8VA 1IPFA 2JHFA 4O1MA 3OIFA 1QXSA 1XEAA 2R00A 3WYEA 1GYRA 2O7SA 4LSWA 3NT4A 1NR1A 4UUMA 1QSGA 4WEQA 1KY4A 2BRUA 3K96A 3KXDA 3PPIA 4CQMA 5K0ZA 3ITDA 1X0XA 4RVUA 1C0LA 2XF8A 4MVJG 4WECA 4GH5A 3ZNNA 4XJTA 8ADHA 4C4OA 3UFXA 3MJEA 4D44A 4ZJUA 4MJLA 1NAIA 1VSUA 2Y67A 4XCVA 3RD5A 3ZCXA 1YJQA 4MINA 4YJFA 5L4LA 4HKTA 3E82A 1YQXA 3NTRA 4PG7A 1LSJA 2SCUA 4N54A 4NFYA 4OXKA 1EVIA 2GZ2A 2EEZA 1N9GA 3DHYA 3MJSA 3GZ4A 3P2YA 1PJCA 1X7GA 2FPIA 4MP3A 3ZV5A 5C37A 1Q7CA 4KWIA 2NSDA 3WWYA 1OI7A 2O23A 5K9ZA 2D3TA 3GH3A 1C1DB 1FDSA 2C29D 4TMFA 3LK7A 3WFJA 3HSKA 3DZKA 2X0NA 1VI2A 1OMOA 2I6TA 4NU6A 4R9RA 2X23A 4R01A 3PGXA 4ZVVA 3VHRA 5A9SA 1DC5A 4DQUA 2GN4A 3G3EA 3RUDA 4CLRA 2AG8A 5IG2A 3AK4A 3EAGA 3E6AA 3JYLA 1WVGA 1HKUA 4CPDA 1QKIA 1ZMOA 3ZNQA 1LRLA 3CUKA 1HRDA 2AEFA 1LLUA 3L9WA 4RQUA 3UN1A 1I01A 3RU9A 3A28A 5DCWA 1LDEA 4CR6A 1I2ZA 3EDMA 3F46A 4PLPA 1TI7A 1NAHA 2DFDA 3I9OA 4CMEA 2Q2WA 4I9UA 3VOSA 3COSA 1NHWA 3VZPA 4AL4A 3EUWA 1LLCA 4K6CA 1B0AA 5G0TA 5DT9A 3INTA 4DQVA 6LDHA 3HZZA 2B4QA 4OYRA 5GZ1A 3LT4A 3DB2A 3ULKA 4B4WA 3H6KA 5JBIA 3GVHA 2VNAA 3AM4A 5A5FA 4PLFA 1R4NB 3BMCA 4Q3BA 1LC0A 1M66A 3HHPA 4JCOA 1KEWA 1YBMA 5FWNA 2HRBA 5EIOA 4J4TA 3WR5A 3KSUA 2VHZA 4Y6SA 4UEKA 1HZJA 2Q3EA 2WWRA 4CJXA 1B3BA 4RF3A 3JQAB 3DDNA 4IDCA 3WB9A 2CVQA 3AFNA 3K31A 4NBRA 4F3YA 2PKQP 5DP1A 4GMFA 4CM5A 4OGWA 4YJHB 2XPCA 3JQ9C 1CIVA 3M1AA 3ZWWA 3JCZA 5T67A 4IDDA 2X5KO 2EP5A 3HUDA 5G4LA 4E5YA 3NDIA 3WIDA 4NBUA 4XEHA 4J7CA 3ROPA 3N74A 4U0KA 5F1KA 2G5CA 3I9LA 4W7HA 4QX6A 3FNGA 3RSHA 3Q6IA 4JBGA 5IN4A 3LF2A 1LDMA 1ZMTA 3ZWPA 4HUJA 3U4IA 1XDWA 1O8CA 4XR9A 5CDTA 1O9BA 1IY8A 4Z3DA 1S6YA 2FPPA 2EHDA 3FBGA 1GQYA 2BGLA 4J1NA 4XD2A 4B8ZA 2OUIA 2WMDA 3QQPA 4KZPA 3KSZO 1D7OA 4XIJA 3ASUA 1HLPA 1ONPA 1ZFNA 2DUUA 4PG4A 3Q2KA 4YEDA 3IP3A 1HSZA 5TC4A 2AQIA 4BNUA 4J3FA 3FI9A 1NFRA 1R4NA 3RUCA 3VPHA 4LCEA 3VVBA 4GLLA 3PXXA 3TNLA 4GKBA 4J49A 4CLXA 4I1IA 4X54A 4E3ZA 3QWFA 3HDJA 3W6ZA 2Q4EA 4LCJA 1H6CA 3JYPA 2CF6A 3NX4A 3OP4A 3TWOA 3FWNA 3HDYA 1HDRA 1O5IA 1FF9A 1T25A 5L4NA 4PG8A 1SMKA 4G65A 4A27A 1BDMA 1RWBA 5FI5A 4IXWA 1GZ6A 4YTEA 2GASA 2JAHA 3E03A 4IY1A 5EQFA 2Q2QA 4Z9FA 3L4SO 4FFRA 5C5IA 4IUYA 4EUFA 2VRBA 3OQBA 2JFFA 2NQTA 3IUSA 1Y6JA 4YAEA 2HJSA 1HSOA 3KYBA 2RH8A 4B7XA 3KUXA 4GQAA 1E0DA 1AXGA 4L76A 3PJFA 1SPXA 1DLIA 3OEWA 2PGLA 2Q1TA 1DIAA 2VUSA 1EQ2A 4CM8B 1JN0A 4BKQA 1HLDA 4PLGA 2NTJA 3F5QA 1H9BA 3UAGA 5TGDA 4MIEA 4M54A 1YOVB 4R41A 3JQFC 4W82A 3K6JA 5JE8A 3CMMA 1VC2A 2YZ7A 1EQUA 4II3A 2ZTMA 1E3SA 2P5UA 4Y9DA 1K5HA 2PR2A 1PS9A 2YQ5A 3C8MA 2YHIA 4ALMA 3WGZA 4JROA 3UGKA 3UKOA 4QFDA 1DBVO 4H7PA 3PWZA 5T64A 1CQIA 2ZQYA 1IYZA 3HNPA 3OMLA 2GGSA 2I3GA 1FK8A 1K89A 2ZCVA 5JW6A 3AUAA 3INGA 3RCBA 1C0PA 3NJ4A 1YL5A 4AJHA 5JCJA 3ZDFA 1Y81A 4AJLA 3TOZA 1VLLA 2EP7A 1EFLA 2C0CA 4KQXA 3EYWA 3RFTA 4ZRMA 1ADCA 1T1RA 4W99A 5DOZA 4EW6A 1T2AA 3D5QA 3KOUA 3KSDO 3UCEA 1BXGB 5B12A 1L7DA 3CXRA 1RYDA 2GD1O 4OIMA 4XQEA 1ID1A 2GN8A 4DREA 3IC5A 3JQBC 4NR0A 4EZBA 3GVCA 3NJ8A 1ZK1A 4BV8A 3D0OA 1ISJA 1CEQA 3NRCA 3TF5A 2DTEA 3I9NA 2A4KA 2B5WA 4TVOA 2YV2A 3GRPA 1XR3A 2FSSA 3PEFA 2VYNA 4AVYA 3RU7A 4ZQHA 3PQFA 4YJGB 4CMCA 3FHLA 3FN4A 3AOEA 3HB4X 4WEOA 5T5QA 4NJMA 1SB8A 4O6VA 1ISIA 1ZCJA 3VPGA 4PLVA 4DLLA 4EEXA 5EESA 1X7HA 1Z7EA 3AW9A 1EE9A 1PJ3A 3L6EA 1QYVA 4DIOA 3GPIA 3GF4A 1F17A 2QZZA 4TZTA 1WLYA 3FSRA 4R1NA 5DOVA 4BO3A 4BO4A 3CZRA 5BSGA 3MOGA 1MFPA 5TQVA 1DDOA 2EIHA 2GPTA 2NTVA 5JDCA 1JVSA 4DRYA 2P4QA 5HBRA 2HK9A 3ANNA 4RVGA 1UJMA 2HMSA 3QE3A 4YA6A 4NG5A 1WP4A 1UP7A 3I52A 3OF2A 4W9NA 2I66A 1P77A 3OA2A 1TVEA 5A3JA 4FGSA 4FFMA 3ZWYA 3AY7A 1ZKMA 1MX3A 1P0FA 5A9RA 2B35A 1GCUA 1Q7GA 2CVOA 2X0RA 3GDGA 2JCYA 3G79A 1H0KA 1YO6A 3SEFA 3JQAD 3M1LA 3JSAA 1NQOA 2WTBA 3BMNA 4PRKA 1SC6A 1BWSA 2O3QA 4E5NA 3Q0EA 1QV6A 4I8XA 1U1IA 1PL8A 1FDVA 3F5SA 1TEHA 4R16A 2GN6A 4RPLA 1SEVA 1E7YA 1ZJYA 5BQFA 3PZRA 4LVUA 2J3JA 2JD2A 1YBVA 4YJGA 4PVCA 3DHNA 1JTVA 3FTPA 3GK3A 1T4DA 1JLLA 2X9GA 1DSSG 4FQ8A 3CINA 2IYOA 4B4OA 2ZATA 5LCXA 3ETDA 3WGOA 3PYLA 3QY9A 2V6MA 4IS2A 4KTTE 4QFCA 3D4OA 3ETEA 2B37A 1O94A 3MEQA 2X0JA 2Y1GA 3EY4A 3H2SA 3W8DA 5JYFA 4D3DA 4EJMA 2X4GA 2W2LA 3CZMA 2ZTVA 3DR3A 1GADO 3TSCA 1D4FA 2A94A 4BNXA 1KERA 5BNFA 2FZEA 4ND4A 3RVDA 2OBNA 3QVOA 2OBYA 3B1FA 3DZBA 3UICA 3BIOA 3BHMA 3KZVA 4GVXA 4XYMA 1LTHR 1P1HA 3DTTA 4BGIA 2V6BA 2WEKA 2O50A 2J3KA 3HFGA 3EW7A 4CODB 3C7CB 4RORA 2OZPA 4FC6A 3H65A 3JQ6A 3QSGA 5ENVA 1YL6A 1PJTA 5L4SA 4B3IA 4ITUA 4RGBA 4AJOA 4II2A 1E1MA 3AFMA 2IZ1A 3PYMA 2XOXA 4H15A 1YONA 2AEJA 2ET6A 2PWZA 4EUEA 3WQQA 1IB6A 3U9LA 2BHLA 4XGNA 1PZEA 3G0OA 4AJNA 3VZRA 3R1IA 3AM5A 3AY3A 2I76A 4CMIA 3ZWXA 4K28A 3CTMA 5B4TA 3TL2A 4M55A 3DBLA 1X13A 4DC1A 2VWHA 3ZWAA 5KVCA 3BMOB 2I99A 3DZGA 3T7EA 1OBFO 4YRAA 1WMAA 4CM3A 4NDNE 3WQSB 1HDYA 1FMCA 2OHXA 3V2GA 5G2OA 4KMSA 1FDTA 3P2OA 1QLJA 3KEOA 4XYEA 2P9GA 1BGVA 2OMEA 3S55A 3AWDA 5JYEA 1EBFA 2Y1OA 2YUTA 4WKGA 5ADHA 1QG6A 3RC9A 4XYLA 1PU2A 2AQKA 1NM5A 4IINA 1W0CA 3CEAA 4XZ3A 4O5OA 3BTVA 2XAAA 2UUOA 2VUUA 2GLXA 2FPGA 3L4BA 5DBFA 4BNYA 5FYDA 3ZN2A 3DAPA 4DIBA 2Y99A 1TLTA 1KVSA 1U8XX 3NGXA 5L45A 3VAZA 4BKPA 3JTMA 1IZ9A 1LDGA 1H2HA 1I2CA 4NBWA 4PLZA 4TQGA 5T6BA 4CUZA 4YAIA 2Z95A 2IODA 1U2DA 3GFBA 3QV1A 3ONEA 4HFMA 5JAIA 1XCBA 4E31A 2PNFA 4HBGA 3OECA 4YPOA 5KWEA 1PS0A 2HK7A 2PY6A 3DOCA 4BNKA 4IIUA 4NFSA 3DWFA 1FJHA 2YV3A 4RDHA 5DF1A 1Q1NA 2CDCA 4GVLA 4QO8A 3O03A 1QLHA 5TJ9A 1H6AA 5COAA 4NMHA 4EJ6A 4U6SA 1E7SA 5MDHA 3L6DA 5HTOA 3SXPA 2DQ4A 3G1UA 1HDXA 3GAFA 5LDGA 4BNNA 4BB6A 1E7MA 1Y8RA 4BKOA 4OQZA 3AU9A 5IZCA 1EMDA 3ZU4A 2D0IA 3JQGA 5AOVA 2Y0EA 1PZGA 4YQYA 2NACA 1KVQA 1GDHA 4I08A 3A06A 2JCVA 5COBA 1WZEA 1UAGA 2UV8A 3ZV4A 4XA8A 2WJPA 3HQ4O 1WW8A 5IDYA 1ORRA 2O7QA 3PHHA 3K9QO 2NLOA 3LT1A 4GBJA 3X2FA 3ZU5A 3BAZA 1W4ZA 4E30A 3CE6A 1E7QA 1VJ0A 1IZ0A 1PZFA 2QRLA 3H4VA 2VZ9A 1GZ4A 4XR4A 1A4IA 3NUGA 2ZB3A 4QSMA 3W8EA 2DT5A 9LDBA 1R4MA 1T2FA 1YXMA 4OH1A 2QG4A 3H8VA 4O63O 1Z74A 1E3WB 3HG7A 3RIHA 1U3VA 5KKAA 1N1GA 4BNJA 2W2KB 3P5SA 3WIEA 4OSOA 2BFMA 2FR0A 4XX0A 4R68A 2G82A 2FY8A 4RLHA 3WWZA 2WD8A 5TNXA 4WASA 4MIOA 2QX7A 3RFXA 3GOHA 2PKRA 1X15A 1Y5MA 1WDLA 5ILOA 2BFAA 4BO8A 3DBHB 4GLOA 1FDWA 3NT2A 1AHHA 1ZSYA 2CDBA 2VCYA 5A5EA 3VPXA 5JS6A 4R4JA 3BMQA 3R0IA 2FWMX 4WCFA 3I9KA 3ICCA 1JKFA 3MWDB 4YJFB 1XWFA 3JV7A 4P38A 3UVEA 4J1SA 1LJ8A 3BHIA 3NAQA 1U7HA 1R37A 2PZJA 5TS3A 5HWSA 5JNLA 5JAMA 3A14A 4GWGA 1C0KA 4OHUA 1YH3A 1N9GB 3ZU3A 5I9LA 4CMBA 1BVUA 2BLLA 2P5YA 4MVJF 1E5QA 4IDEA 3WNVA 2GNAA 4WPGA 3DMTC 4FJ0A 4R54A 4GX0A 4KWHA 3R6DA 2AE2A 4QECA 3WGYA 2DAPA 4UVDA 1V35A 5F3RA 2VRCA 1A9YA 2YDXA 2YY7A 4QO7A 4PLYA 2QZ9A 3ENNA 5ILGA 4DTIA 2D2IA 4FW8A 4CMAA 2FSVA 5TT1A 1HYGA 1PJSA 2BKAA 1F06A 3GDFA 3H5NA 2VWGA 4CLRB 3H2ZA 1L1FA 1M6HA 4Z0HO 2QYSA 4MIYA 2VQ3A 4EEZA 2OORA 1QORA 2I65A 1U3TA 1PSDA 4BHTA 1B3RA 1XG5A 1KEUA 5A05A 5F5LA 3C24A 3DBHA 3D3WB 5LC1A 2IXAA 2PD3A 1P1IA 5F1PA 3WBFA 5A1TA 2ZIZA 3F1LA 3LSYA 4M87A 5JO9A 3S1LA 3KYDA 1HE3A 1E3JA 2UYYA 4N7RA 2E49A 2GCGA 4BGUA 4L0QA 1DIRA 3ZNPA 4PLWA 3BMCB 1GEEA 1JA9A 3LQFA 2GO1A 1DHTA 4D3SA 3OETA 2DBZA 1U5AA 5KTKA 1I36A 4WJZA 2HUNA 2JD1A 1UXJA 3NGLA 4DMMA 4YDRA 1N1EA 4BNIA 4YR9A 4DWVA 4CMKA 3QVSA 2ZTLA 1YB5A 1MGOA 3DOJA 5M6DA 1PGNA 4CMGA 1GAEO 3DBRA 1HDZA 1ULUA 2HMTA 3BZUA 3ZHZA 2PV7A 1B15A 4DC0A 4YAKA 3KVOA 2I9PA 3PHGA 4HY3A 4J0EA 4A26A 2G1UA 4L75A 3VPFA 3OEYA 1H9AA 4OQYA 4HADA 3DBVO 1EVYA 5L7YA 1ZJZA 1EDOA 4KUEA 4E21A 4D7AA 4FOSA 1GZ3A 4GGOA 5HS4A 1X7DA 3VH4A 4ALLA 5ICMA 5K6AC 3EMKA 4ZU3A 4E2ZA 4RPJA 4YRDA 5ER6A 3O26A 2ZQZA 4DA9A 4IDAA 3IAHA 2B4TO 3B1JA 3WQRA 3C7DB 2NU7A 2Y1FA 3PFWO 1PJQA 1QMGA 3E9NA 2W90A 1BHSA 1DEHA 4KUGA 1EK6A 3EK2A 5IXYA 2YJZA 3D3WA 4RLSA 1D3AA 2Q49A 1ADBA 2ZCUA 1DC6A 2AW5A 2W8ZA 5I7FA 4EUHA 2JL1A 3U5TA 2HDHA 2B36A 3JD1A 4IGEA 1EVJA 1VKOA 4WCDA 1GD1O 3IKVA 1LXCA 4Y67A 5BSEA 5L7WA 3U4CA 1T26A 1GY8A 4ND5A 5JMWA 3WYBA 3UCXA 2VYVA 5GMOA 1I3LA 1GV1A 2NUAA 3WOHA 4JP2A 4ALNA 2D59A 2AHRA 5THKA 1PGOA 5KVSA 3F1KA 3GUYA 2PZLA 3OJOA 5CEEA 1VRWA 2QQ5A 3C1OA 3NT5A 5DP2A 3S2GA 5F21A 2QIOA 3GPDG 4BNVA 4FR5A 4TVBA 5U4QA 2JJYA 4NIMA 1K3TA 3RUEA 3Q11A 4JJGA 2X5JO 4BKRA 2PA3A 3JQ9A 4BNHA 1U9JA 2HMUA 2B4RO 3IS3A 4JJIA 3VC7A 1CQJA 3BTUA 1UXIA 3PGJA 1VL0A 4D0SA 5DCUA 3V1TC 1JWBB 2BH9A 4IJKA 3RC2A 2PK3A 1U3UA 3I3OA 2XXJA 4L9RA 4HXYA 4DYVA 4PN3A 5TRTA 1LDYA 4N18A 2IEBA 2PZMA 4KTVE 5JC8A 2FOIA 4WOJA 2WE8A 3FF4A 4HX5A 4UEJA 1HDOA 2NU9A 4PLTA 3ABIA 2EW8A 2EWMA 2VN8A 3ZWVA 1J5PA 3H9QA 4NPCA 5KKCA 4TRNA 3AU8A 4RPGA 3QA9A 5T8KC 4CMJA 2ZJ0A 4E6PA 3AUSA 5KJEA 1X1EA 2O48X 3WMWA 2X7HA 1WDMA 4PLCA 5FI3A 4NK5A 4BNFA 4CUKA 4ZICA 3EZLA 2G17A 2YHIB 3SX2A 2TMGA 1DXYA 2BD0A 4CQMD 3ZU2A 4LN1A 1CERA 4AJIA 2Y1EA 2JFGA 1DRVA 1Z73A 4G5HA 4NFHA 1V3VA 2VHVA 1NX6A 4D79A 3W6UA 1QP8A 1DPGA 4IZIA 4UVIA 4OL9A 4DVJA 3U3XA 2BFOA 1J4AA 1SOVA 3LT2A 3C1TA 4CM4A 4J0FA 3JD4A 2AQ8A 2VWQA 1H93A 2C82A 1A72A 1Z75A 2AXQA 1XSEA 1GFSA 4WE3A 1IE3A 4UUPA 2J5KA 1MV8A 4D42A 3WSVA 1KVUA 1HDCA 4BMSA 4CV3A 3EGOA 5GZ6A 2JD0A 3IUPA 4U0JA 1FXSA 1NR7A 2C2YA 4Q3NA 2ZYDA 1I30A 1PQUA 1A4UA 5T73A 1N5DA 1UDCA 1P74A 2VT2A 3MCVA 4ZRNA 3HJAA 1DJNA 5G4KA 4IDFA 5CPBA 1NHGA 1VKNA 2Y93A 4P22A 3K5PA 5I8ZA 4E2WA 3RKRA 3NYWA 4E0BA 1T1SA 3I4CA 1CJCA 1ENPA 4NJMB 4R1UA 4WNIA 4DPLA 2OOSA 1ZO8A 4BS9A 2ZKLA 4KUHA 1WWKA 3GLQA 3TL3A 2P9EA 1PGPA 4Q3DA 3JQFA 3ZNOA 1MFZA 1O0SA 4BO6A 4NI5A 3U09A 3QJ5A 3LC2O 2Y1CA 3D3EA 1Q0LA 3LF1A 2HKIA 4CLOA 4J91A 1AE1A 1LSUA 4OMUA 3I6IA 2ZYAA 4FFOA 4WOKA 1MC5A 2CUKA 3QWAA 4IZHA 3WMXA 4AJEA 2EKPA 3VKVA 1UDBA 3BHJA 3R3JA 3W8FA 4RV9A 1WDKA 4XGIA 4GMGA 1GV0A 3QWIA 1HE4A 2HAEA 5CP8A 4P4NA 4AJKA 2EJWA
chains in the Genus database with same CATH superfamily
2GCOA 3VSAA 4EKNB 4TLEA 1OLUA 4YFVA 4OVKA 4UC0A 5IJ0B 4YT5A 1YDHA 2RAUA 4QUBA 3ZKAA 1UMBA 1DC3A 1F0YA 1FSFA 2OCYC 5CT8A 3BMNB 3U49A 1WXFA 2O2ZA 3A9VA 2WF5A 5EE1A 3FJOA 2ERCA 3GUCA 1G6HA 4MLZA 4AM8A 3O8NA 3WKDA 5BQ5A 1Q44A 2VDWB 4RTKA 2PU7A 3TQRA 3I9FA 4EHLA 1RWKA 4JBXA 4KV7A 4M6WB 4DAEA 4AN1A 4ZK2A 5KC9A 4XDZA 3CLRD 1XKQA 1NASA 1FPQA 3OKFA 3RS3A 1J0CA 2JAWA 3K0FB 3V8BA 1JPVA 5AW9A 1A1SA 3DHEA 1GQOA 4QXMA 2K7ZA 1RWVA 2FG5A 5I8WA 2OCLA 2XV1A 4MVJI 4FS3A 2ZB7A 2REXB 2DUWA 3PXCX 3UAZA 4CIAA 4RXMA 3PR1A 4UARA 5AOBA 1C8LA 16PKA 5HF5A 3SMQA 2VNHA 4HB3A 4LX8A 4OAQA 1JQKA 2OO5A 1Y8QA 3VR2A 3JWGA 1QWSA 4OQQA 3PXEA 4ZQBA 3K2BA 2CDAA 4Q4AB 5HE9A 1QVVA 3JZAA 4O0MA 1TCCA 4ENUA 1RBQA 1C1XA 1DIGA 2Z3VA 2NPOA 3R0JA 4J3JA 3NC1C 4ZALA 2QXYA 3WIUA 1DHRA 1L8OA 1KK2A 4ZVOA 1D0IA 1I3KA 3CEHA 3DWEX 4KXYA 4LSGA 1ZOSA 4MWBA 1TL7C 4GZ5A 1A2QA 2CVPA 3MBIA 3PDUA 2OGUA 3SK0A 3PEWA 4HVLA 2ZYTX 3LP8A 1Z82A 4RDIA 3WJ7A 1PZNA 1XZFA 4RK6A 4BVBA 2AFHE 1R3UA 3QMMA 3PHBE 3HGMA 5CR9A 2G5PA 4RK1A 4MAMA 5A4DA 3GLIA 5IFKA 4FTWA 3Q6MA 4X1OA 5TVGA 3GQBB 1UAYA 3ZZNA 3C0KA 4E33A 4XSHA 1RACA 1YULA 3IAFA 5AW8A 4CN9A 1OH5A 3A9SA 2P6UA 1WKBA 4QVGA 1OHHA 2INGX 3S8YA 1C7JA 4PSKA 8LDHA 3C15C 4IV8A 4WLFA 4U2CA 3V7FA 5BN4A 2XXBA 4TYWA 1KEEA 3RNOA 4WBNF 4F04A 3PGMA 1KU0A 5HMLA 2B98A 3BPSA 3JRXA 3L8DA 3T9AA 2B5VA 3ENQA 521PA 2J9XB 3EYAA 3P19A 4OAPA 5FDFA 4J1TA 5KQRA 3BB4A 1NMSA 1G8KA 3B5IA 4RIFA 3HYLA 1T6ZA 1U2GA 3ETJA 4H7FA 4YRMA 1UAAA 2PZGA 1L7NA 3LY8A 3F0TA 3I62A 1EUDA 3BZWA 3QVKA 3GVPA 4G84A 2IOFA 2B61A 2HCBA 1KR5A 3W2IA 4RA9B 4LNUA 4YMUA 1CYDA 2IY8A 1LBEA 1J09A 1ZN9A 2A57A 1WPGA 3EZFA 2O8EA 3ELWA 3VR5H 4WINA 1G8AA 1JHXA 2JAPA 2LDXA 2D2FA 1BX1A 1T9DA 4H9GA 2GRAA 2ZAGA 4MJ3A 4X3PA 3KQVA 1GGJA 4FMCF 3UK1A 1BG6A 3JD3A 5AO9A 1UKVY 2MINA 1DE0A 4PSUA 5DN6A 1X80B 1DIHA 3QX9A 4KO4S 4Q48A 1JDTA 2DMRA 1T4BA 1QV7A 1JE0A 3EZYA 2OESA 4EJ0A 4JYAB 3IHTA 4Y2YA 3AL0C 2P69A 5GIPE 1EHYA 4ZVUA 1CUJA 3BCHA 1JPJA 3DOIA 3EIWA 3K05A 4I55A 2PMEA 1VBNA 3NTOA 4G9BA 5JMTA 3QEJA 2PN1A 4NOKA 3ITNA 4LHWA 5CTJA 4HH4A 2WP0A 1YRWA 4PZEA 1V8BA 3G1WA 3AF2A 3NDRA 5DW3A 2JIMA 1DWQA 2VHUA 1WIWA 3PP8A 5D3ZA 4AY5A 1I13A 2IRWA 2O3RA 3ZHYA 2QD5A 5JH7A 4RD3A 1SUEA 4QOHA 5DTQA 1GGFA 4H6WA 5DULA 5CFMA 3M5CA 3M2TA 1MOSA 2WQ6A 2R68A 1Q17A 4XUGB 2RGNC 3NBXX 4KPEC 3OM1A 1JU4A 1U2PA 1X92A 3WWCA 3LT5A 5FQNA 1FYWA 1EBBA 4M8NE 4MYCA 4R9VA 2PMFA 3QU2A 2NVOA 1PTJA 3JPYA 2NGRA 4RXUA 3RVBA 5BPFA 3OQ1A 1CHNA 4V0NA 3SDSA 5IM4F 3WKBA 3KZ1E 4K26A 2BI4A 3GA5A 4PWYA 3EPRA 4OUKX 5IVKA 3RE1A 4I99A 2X2PA 2ODPA 3JQ8A 3J80A 2ZJ5A 2O2GA 1T8TA 3G5TA 5CVEA 3W5AA 3T52A 2GM9A 4JYBA 5DHFA 5EJFA 3EUFA 4KP7A 3HJGA 2HZ7A 1HWYA 3V48A 4MKZA 4MPRA 4TM7A 3F7TA 4PHGA 4L4XA 3DOUA 1JR3E 4PY2A 3TD9A 5DBEX 4WOBA 5DM0A 2RHMA 1RHJA 2JH3A 2QW1A 1VOTA 3T9FA 1US8B 1LSOA 1T4MA 4TT3D 1FFBA 1LUAA 3UA4A 1RYMA 4RHFA 1JDPA 4DOMA 2HWWA 3KRTA 3L0PA 3C6ZA 1KC1A 3CLSD 3NDPA 3FGZA 1J0AA 1WLSA 3HABA 4QICA 4ZVPA 1OAOC 1IMJA 1XCLA 4HGPA 4E5PA 1M6VA 3BULA 4ZCIA 3DAFA 4DMHA 4YDQA 2WAMA 3GFGA 1B2RA 1UZUA 1SIBE 3OLYA 1UK9A 3SC6A 3TNDA 4BJ6A 1JT2A 2YW9A 1DRWA 1II8A 4MWGA 1G60A 5D6OA 5CXQA 2H1HA 5BVHA 3NWBA 3DKPA 2IOYA 3WBBA 4KXQA 5AHRA 3K3PA 5KYVA 3WL4A 1XMJA 4LZWA 4EG5A 1E1QA 1IBCA 1KETA 2GKOA 2QMZA 4RH1A 2ODEA 3VTAA 9ABPA 4YACA 2XYRA 1H1TA 4QUKA 1XDGA 1E1NA 4CKXA 4D5EA 5HRAA 2HV9A 2VAMA 2ISSD 3O4FA 5LUBA 2RCNA 4I3FA 2QU7A 3M9XA 5ALVA 1NI3A 1BJTA 1ZL2A 5CB8A 1IG0A 4X3OA 3HXTA 2GAOA 5SZHB 4PC6A 2C59A 2RHDA 5HILA 2XYQA 4QTTB 4QHSA 4YCSA 3UYKA 4RULA 2O8BA 1CZOA 2Q5IA 2FPRA 3D6HA 2FTKE 1KMNA 3IUBA 1ZH8A 1JLSA 1BU8A 4EI7A 2VK4A 4L2IA 1JG3A 1Q84A 3RTAA 2DKOA 3G8YA 3Q2IA 1P31A 3O8BA 3WS7A 1Q7BA 2ALJA 5DIFA 4UAVA 1XKTA 1UBRS 3RS5A 3DZ7B 4BB0A 3I72A 3H9EO 4WCFB 1WR8A 3ETCA 4DYHA 2J0UB 1ZMXA 2OCPA 5IBQA 1CNMA 3CPSA 4RF2A 2JIBA 3C1UA 2X2OA 4HAYA 4HNHA 5E6SA 1TJ4A 2BFDB 2RK4A 1LB1B 1XU7A 2YWJA 3JRNA 3PIIA 4RKFA 1K27A 4ZO6A 5ALMA 4CE6A 3WWPA 4N01A 4QG3A 1O3YA 2GFQA 4A3SA 1X19A 4HI0E 4UMVA 3KZKA 2DBRA 2JIRA 4DG8A 5TX7A 4NJOA 5K1ZA 4L4SA 1KRHA 4WLOA 1D0VA 1IUKA 2P2SA 4F8JA 1YVDA 4WZBB 1OT3A 3HU5A 5AW7A 4F21A 4DMLA 2XCOA 2V4UA 2W2LD 3HEMA 4D82A 1MOQA 2RFLA 4CM6A 5LMZA 1TJ5A 1QNLA 2FN7A 3ORYA 1OWMA 3JAKB 3FFWA 2I4OA 4OJNA 4ZKEA 3MWFA 3JASA 4ZJPA 5DOZA 4JDUA 1BXRA 1CRWG 2CK3D 1K2VN 1JKJA 5KNCH 1ZSVA 2VP3A 5ICFA 2X42A 2A35A 2C94A 3EARA 3HMKA 4Q1BA 3EUAA 5IN5A 3HJNA 4RV4A 5K6TA 3SZLA 2H07A 2RGRA 3ONNA 5LNK6 3H2IA 3UUEA 1ZMBA 4GICA 1P1RA 5C7IO 3I1IA 5KJCA 3TIVA 3GMSA 1GR0A 3CNOA 3NTUA 2E4XA 1FTQA 3X2EA 1RPJA 1E2UA 2ETXA 4P34A 2HY7A 1EP1B 4JC4A 3PI7A 3SLRA 5DDIP 2OCBA 4A1FA 4N6GA 4BWYA 3WGQA 3WDKA 1MEJA 2QL5A 1IQRA 3RRMA 3HN7A 3TN7A 2P6PA 3GNTA 3ZIAA 3VV2A 4O25A 3USES 4H4DA 2EGGA 3WKCA 4YJDA 2D1SA 3KYDB 3JVEA 3GGGA 2ZEJA 3QKIA 1KYIA 1XXHB 3I0ZA 1N2IA 3TLGB 3Q9UA 3VPBA 3WWOA 3ZIDA 2WV7A 5FORA 2OHOA 2FUNB 2QTNA 1UPFA 1N2EA 1W1UA 2AJTA 2DSNA 2IU3A 4OSEA 3ZHTA 4EI2A 2VJMA 1J24A 2FR8A 3EF1A 1ZJ4A 5GGXA 2CVFA 4A8JB 2WILA 4Z86A 5TDHA 3PNKA 4PZLA 1QIJA 4M9UA 4AUMA 3ZGYA 1QQAA 3C74A 4RFVA 1NXXA 2RGYA 1U7TA 4RKQA 5G02A 3IPXA 2GEDA 2H7VA 1LEHA 1KQNA 3M3DA 3QXCA 3ZQJA 4EAAA 3IH5A 3HP1A 2HO4A 2TMDA 3QV2A 5EPOA 3GLGE 3NWPA 2P2ZA 2GI4A 4L3VA 3YASA 1Q1BA 4E13A 1LZLA 2O8CA 2Q9AA 4Q9LA 2IEYA 5TQ2A 7REQB 2WVHA 5IK2D 1H5NA 1GSAA 2BFPA 3DE1X 3LA6A 4PNHA 5A5DA 1MGPA 1Z45A 2XYPA 3T9CA 4CM1A 1Q1GA 2PLWA 5JNRA 3ZX4A 1FP7A 1U5BA 2LTAA 1QP0A 1QTRA 1EXDA 2FF7A 2CFOA 1UT5A 4X62B 2P3SA 2ZSUA 4QEZA 5CB6A 1EK0A 4MS3B 3WL8A 1U4OA 1YACA 4BZXA 1CHDA 4LE1A 4Y98A 4KDEA 2FJUA 1KY5A 4BGEA 2Q3FA 4XW2A 1JQAA 4AK1A 5HS6A 3RFVA 2IVFA 4D46A 2AJ8A 3BJMA 4D9HA 2X14A 5C81A 4PO8A 3WWEA 1XA0A 2J0EA 3GA7A 3AP2A 2P0EA 2C2OA 2C7RA 4JS0A 5LOVA 4RD0A 2LW7A 3IVGA 2X58A 3ABRB 2VZ8A 3RS2A 3FOZA 2BGMA 2HH9A 2BAGA 2X40A 2ZANA 2ZTUA 3DTNA 1O9HA 2KBEA 2ZYWX 4XJXA 3VDMA 3VKHA 5KWVA 1J8YF 1J9GA 4IZOA 4I50A 3DP9A 4HFJA 4EIWA 1HETA 2WYUA 2BMAA 3QIVA 5CHEA 1Z2OX 1BA3A 1CUUA 1NVGA 1BE1A 1FRZA 4PNZA 2Q7OE 1PX0A 4EQZA 3NHUA 3L7DA 2FWAA 3HB0A 4ZV7A 2QYTA 3HXQA 1JF8A 3ZVNA 2F4NA 1ORVA 1Y1PA 4M1YA 1SC9A 4R2XA 2RGXA 1GU7A 1X7YB 2QP3A 2NUAB 3SFZA 4NCHA 5CVTA 3SFTA 3AB8A 1FW8A 3O9VA 4QVIA 3VNUA 1FSSA 1LDNA 2DLDA 3VA7A 2HPVA 1KJZA 4HGOA 1VI5A 1NKTA 3PJDA 3NW9A 1VXRA 4QXQA 1UMCB 4AJ9A 3QEAZ 3GGJA 5LUAA 2XNDD 1XRLA 2DHRA 2JFNA 1EJ2A 4CMHA 4DIMA 4H6XA 3FKJA 5GJCA 2RH4A 4N82A 4X7BA 4GXRA 3OO1A 1YB2A 2IYFA 1TTTA 5IP5A 1R9JA 2Y4OA 5DFAA 3TDMA 2JLCA 2FAXA 4EG8A 1FB5A 2A3NA 3EVBA 4ED9A 5BSWA 2IYAA 3QH4A 3EFHA 1MAWA 2C2XA 4MUIA 3S70A 1P33A 1QGYA 2QZPA 3HCOA 1YDWA 2PX8A 1FDOA 1M8JA 1BKYA 4S04A 3CVXA 2V1UA 3EXHB 1NC1A 1NXWA 3TI7A 2YC4C 1UXGA 4OX9Y 3W8RA 2QTCA 4J0JA 4I8IA 3IWCB 4FM9A 2H7XA 2EGUA 3TIIA 2NMVA 1ATZA 3ZHUA 1JYFA 1IY0A 2AMJA 2IY7A 4Q3AA 2D5AA 3O4VA 1R6XA 4WNAA 3GEHA 2XUQA 2H0RA 1DAMA 1ESEA 1HYHA 3CE9A 3LFTA 4L8FA 4EP1A 3PUHA 1GAXA 2R1VA 4KQWA 4X91A 1LC3A 1KAGA 4NH4A 2R1ZA 5ELLA 2Y0BA 4FYVA 5GVRA 3IE1A 1XK6A 4I5DA 5BR7A 3QKRA 1L8XA 4BFTA 3UUWA 3RFUA 4J9UE 4LK3A 3FVRA 3TRKA 3WLPA 1S2IA 2H85A 3QKTA 1JDJA 2YFHA 4BBZA 2HA2A 4HB4A 2FSPA 1JPUA 1CR6A 3E9CA 4OA8A 4RDCA 1WQ4A 5AVTA 5JSHA 4GSLA 4LRTB 4C14A 4GPD1 4I81A 4RF5A 4KRXA 1WEHA 3T95A 1W52X 4FCVA 1C3VA 5D6NA 1JZQA 5GJBA 3IVMA 5K20A 1J20A 4P4GA 2IHJA 4CMEC 1RW4A 1OXBB 1WCWA 3ORSA 4JKOA 1V96A 3OQOA 3V7NA 4EVRA 3GX1A 4OI0A 4A03A 4N3AA 3CH6A 4BL5A 2PQMA 3BYZA 1N2ZA 5JSZA 2HYDA 2JIZD 2P2CA 1ONSA 2RHRA 3PXBA 4XSVA 2GLTA 1E9DA 4W4TA 2ZJ3A 1DZIA 3KD3A 3CV3A 3NRBA 1ZHFA 4NULA 3MJTA 2QL9A 2QY9A 1NVXQ 4JQSA 5IABA 2Y92A 4PO9A 4HAZA 4IFEA 4KI0A 1QYWA 2C0QA 4E5MA 4EMSA 3PNOA 1UXKA 4OXIA 3VUFA 1XAJA 1U99A 2P77A 5IXSA 1MO2A 1MB4A 1P81A 2PCJA 4GI7A 1ZN8A 2XBMA 3I6MA 2XGJA 3LA8A 3LWNA 5E8RA 4LECA 5ETJA 5D5HA 5U1PA 2WJYA 3FRHA 4LTMA 3F3KA 4D0NA 3K71B 4N7JA 1Q12A 2XMQA 4RQTA 2BEUA 4G0ZA 4KLAA 5TSDA 4QEKA 3WXBA 1DOZA 4A2WA 2BISA 1DO8A 3WP0A 2GK3A 3OEHA 1Z5VA 2XE4A 4MB0A 4X3CA 1JYSA 4BP8A 1C1DA 1M1YB 1IJEA 3D8TA 5J5CA 1FFAA 3OT1A 4M49A 4NS1A 1TTHA 3OOYA 4Z2YA 1A77A 1ZZGA 2AR9A 1T0HB 4GXNA 4M89A 4UHFA 5L3QA 2CLFB 3TEMA 3R9WA 1SQ5A 3E7DA 4NCXA 2FPSA 2GKSA 4KO2S 2CFCA 4ZCRA 4W5NA 5A03A 1O0BA 3NASA 2X19A 3LWZA 4F38A 1NE7A 3ZLJA 1UUFA 1TZJA 3MWEB 3QF4B 4HNGA 3K1YA 4OREX 4EPXA 4HATA 2IYTA 2J3IA 4P6VF 3P9ZA 3K7EA 3CKYA 2ZW9A 5T8KA 4V0MA 2EG9A 4BFLA 3L7BA 1IOWA 1H4SA 1E2MA 1U8TA 1ZD1A 3EDYA 4MS4A 4QNNA 2Q5HA 3E3NA 1F3LA 4GNKA 5H3LA 1FZTA 1QRRA 1PK7A 1CSEE 3HWSA 4FIZA 3WIOA 1NNUA 2CWWA 4BP9A 3HKCB 3U3RA 1A9ZA 4LHZA 4B81A 1YHNA 1L7XA 3ZD9A 3AJ9A 5BNTA 3O2QB 3EC7A 3HKBB 4E5UA 1PTKA 2UKDA 3E48A 2C3PA 3UH1A 1Q0TA 2IT1A 1ZK0A 1EM6A 1HMYA 2CVZA 2KX7A 2Q22A 3SBEA 1GZ5A 4Q39A 5EJMA 5G1OA 1HFEL 1IH8A 1Q0UA 1A9XA 5K03A 4LXYA 3ADKA 1VFNA 1XEWX 3KU1A 5DBIA 1V9LA 1ZNQO 5AJZA 1MNQA 2FF5A 2IV3A 3IV7A 1KDVA 5J4YA 5AVJA 3PR2B 1DAPA 4PRYA 1NIJA 2CBXA 2CNWD 3PX7A 2HJHA 2GCOB 1CV2A 4BAUA 1OLUB 2VSQA 3EP5B 1CB0A 4FYPA 5ITZA 1MU0A 1ZGBA 4LXUA 1WUKS 3S5JA 1UMBB 1GQSA 3MC1A 2R8BA 5D5QA 3B2EA 3B9QA 1OBOA 4J4HA 3MELA 3ZE8A 4HEJA 1NOJA 5J5VA 2F1KA 4BFCA 5LA6A 5DGTA 3JQRA 1HF3A 1PEDA 3PHLA 4PZAA 3UXHA 5FBRB 3RWBA 3UT5B 4DWOA 5DEOA 2NW6A 4B87A 5C3MA 3MOIA 4DXHA 1MORA 1LPPA 1R8XA 4ZK6A 2OM2A 1RC1A 3GBPA 4B83A 5KMGA 1TM3E 3BFXA 1E79D 1ZR4A 2BFWA 4YRBA 3ORHA 2WI8A 4EPRA 1QWOA 1ZGGA 3VR6A 4AZTA 4UXIA 1Z36A 2JHGA 2YRFA 1GGEA 1JR4A 4DR6B 3TCNA 1QRTA 3FWKA 3MWKA 3LC0A 5CK5A 3D4IA 4KQ9A 4J43A 4LWQA 5DH9A 2IXBA 2XX3A 3BX1A 4MVCA 1W6UA 2PGIA 2WRZA 1MJHA 3DVAA 1T9CA 4PYQA 3AHFA 2W5UA 2ORWA 2H5JA 3EMVA 3LGAA 4X7RA 2PSEA 5AIBA 2CSXA 2Z1NA 2N0SA 3UYLA 1N2GA 2HU2A 3IGFA 2IXTA 1Y8QB 3L7MA 1N6KA 3LQKA 4S05A 3II6X 3HN2A 3IQZA 3OJEA 2IDJA 5EKSA 3EPBB 1KAQA 4FMDF 3ZY4A 3SJUA 1ZGAA 1C1XB 2H7YA 1SIUA 4I5IA 5IF3A 1PT6A 1UKZA 1AV6A 2VOJA 3V3TA 4LDZA 4H7HA 3J81A 4RH3A 3N8NA 2GZ1A 1U7UA 1MA0A 5CB4B 1OXSC 1VB3A 1ZBQA 2VYVD 1N0HA 1JEEA 2PJDA 3PIRA 4GYJA 4XUEA 3FPFA 3S8MA 4RTRA 2JA1A 3KCQA 3LUFA 1O97C 1Q7EA 3D6UA 4KAJA 5FTMA 5JLJA 2DF8A 3GLIB 2L0XA 3GCGA 1LI5A 3LDGA 4MAAA 3TLMA 1I2AA 1ZZEA 4S3MA 5F23A 5KTMA 2C07A 2FN9A 3IP5A 3IQGX 1P73A 4ZEXA 5AIAA 3ZDAA 4G1BA 4P33A 5ESRA 4MVJH 1I2BA 1LWOA 3K8ZA 1X9HA 1NATA 3AFHA 3WSTA 3C7TA 1JR3D 4CRWB 2IOHA 1C7RA 1U65A 2XH8A 3HL4A 4KNWA 5BN4B 1KEEB 4D4HA 5BQ3A 4XQGA 1PL7A 1PE0A 4LOLA 3N58A 5IAJA 2EOAA 5C1PA 1G1AA 3JU3A 1N77A 5JFOA 5EGSA 2AEEA 3UM9A 1EINA 1UBGA 1RQNA 1I1QB 2XGSA 3IP1A 2C7VA 4DTCA 2EKQA 3IBYA 4IDQA 5DLEA 4UOZA 5AK6A 3FWPA 4PICA 3K70D 1YR6A 4HGZA 4NNJA 5BSFA 3DDUA 5C8XA 4V0LA 3JVUA 2Z2IA 3PVZA 4INJA 4M98A 3UMRA 1EUDB 2EZ8A 2XNCA 2Y2UA 1KFEB 4E5DA 2WG2A 1U4SA 1P1JA 1E0SA 1H5QA 5FLKA 2HQSA 3H99A 1JUDA 5ERXA 3SNKA 2O8DA 4UUBA 1VIAA 1RJDA 1RIFA 4QZVA 1OH8A 4EYSA 4AZSA 1HL3A 1LLDA 2O8EB 3I2JA 4ZJZA 3KAQA 5CXUA 5IRCD 4D41A 3PQEA 1F2VA 1RQLA 1N8KA 2AZTA 2WG1A 2X86A 4TL8A 3RJ5A 2XWJI 2AI2A 5KTOA 1ADJA 2QAGC 4IYJA 4MKFA 2C5SA 4FYWA 5EUQB 1WVIA 2F6RA 2MINB 5CH5A 3LCRA 2P2LA 5A0VA 2ILVA 2E3JA 3KS9A 3H3XA 2VQ6A 5B4UA 4JJ7A 5JAOA 3LCCA 2AHOA 4LHEA 2CL0X 4FI3C 3D31A 5LD2B 1NN0A 2IHZA 3L9XA 1TZKA 3OZAA 5GZ3A 5EMMA 4BE4A 4I55B 1FP4A 3GIWA 4B74A 1NQ5A 1HTTA 1HLFA 1B73A 1G3QA 1OGYA 1QOPB 4QGHA 4UMFA 4GW3A 1YL7A 1MTOA 2RKWA 3L8YA 4H77A 1BS2A 1EK5A 1N7GA 4WDRA 4ANFA 3QJYA 3JYOA 5JH7B 1WSDA 1SWWA 2J9YB 2XUJA 1L4EA 2V7QA 1SBHA 1JVNA 2XCUA 1B93A 4YRFA 3KZXA 1ISHA 4FQ7A 4MEJA 1LBSA 4URUR 3D3KA 3ROMA 4KDFA 3PKZA 4WGGA 1L1RA 3N2IA 5HIMA 4R5HA 3WISA 4N76A 4V0QA 5I7SA 1M2GA 4JBHA 4XB1A 2WINI 3VH2A 4F97A 3HSYA 4NZ9A 4EABA 2J3EA 1JLRA 2NWQA 1JIUA 1N8NA 1U0EA 2D13A 2JNWA 5T4HA 4DLBA 3I2HA 4O4JF 2J5QA 3C6QA 4U63A 5LQJA 3I5XA 1IEXA 3DCYA 2IFTA 2QMQA 4R2IA 2QRPA 2I7DA 3F6SA 2XF2A 3JQ7B 3OCUA 3JQ8B 4DQXA 1D09A 5BWCA 2XUHA 4CV1A 2X9NA 2ZK7A 1NJ1A 1SBYA 3C6KA 1RSZA 2XGGA 4F4CA 3OHMA 3PQVA 1JHUA 1KI6A 4I9HA 4LZNA 4A8HA 3MM4A 4R1OA 4AY6A 3H0KA 2C42A 1SOWA 1XN4A 3WL7A 4EDHA 2QPTA 1NVDA 3T9BA 2DPGA 3W9BA 3I1JA 1SCKA 1RYEA 3C3AA 4BVGA 3L6UA 4EATA 1RAEA 5B7QA 3DO5A 1G6KA 4PYJA 3H1GA 3PLRA 1YZYA 3MUNA 2DHCA 2EJUA 3GJ7A 3D7LA 2AG0A 2NV6A 4AJ1A 1FTGA 5EZSA 4IDNA 1TT5B 1SB9A 3NCHA 3FOBA 1P39A 2YQ4A 4TTSA 3HJFA 2A0XA 3ZDBA 2VCHA 3RYIA 2JARA 4FXOA 4CIBA 4MKRA 5IDXA 4QASA 2CXOA 3HVJA 2E4AA 3QTBA 2IF2A 4R31A 4ZGBA 4Z6KA 3FMVA 1HNZB 2MSCB 2VPWA 4D9IA 1NG9A 1II8B 1Q1ZA 1BFKA 2AC7A 1C1HA 1O97D 4IP0A 3WZ2A 5KJ6A 1ENYA 1IDN1 2P2YA 1M54A 3KVVA 1YTLA 3HVHA 5JVDF 2HK8A 4FDLA 1U3WA 2PFKA 3ANLA 3Q1KA 2FSFA 5JSQA 2ZWMA 4YQZA 2EFGA 1PVVA 4NARA 3V1UA 4PBSA 2PGDA 4EJ2A 2GX6A 2RGNA 2DJ5A 2B4YA 4CU2A 1Z13A 4LJ5A 3CGWA 4CKYA 2CVHA 2Z3ZA 1EZZA 5IAKA 4ZGWA 2WMYA 3WX0A 1UZAA 2Q21A 1KI9A 2GEFA 3AOGA 4KIUA 4PR0A 4MW5A 4RMGA 3AVXA 1T2EA 1VLVA 2WPDD 5LQSA 3EP7B 3NHBA 4QDUA 2JIQA 2HA6A 3SYRA 1SVWA 1M6NA 3OSZA 2PGJA 4QUHA 1VECA 2AF4C 1DO2A 1WABA 3KSMA 3MYYA 4BNMA 1WHSA 4L2IB 5AKXA 1FTYA 2CJPA 4NABA 5B6PA 1F7VA 3OTWA 2HO5A 3A0RB 1AKNA 1EFVA 4TYPA 3HXLA 1RYHA 4R2JA 1T5SA 5HVNA 4L7QA 3SYLA 4FIDA 4UD2A 4ZIRA 2L19A 1EFPA 2G4CA 4JLVA 4N5NA 2XQGA 4LYEA 3A70A 2I2AA 4ON9A 1NFFA 4PFJA 1ABEA 4N5MA 5E6SB 1Q3TA 5C7OO 4G89A 1VA5A 2X1HA 3ZH9B 4OPMA 1WMEA 1XTVA 4RZUA 4B7CA 4YAJA 1RLJA 4X8OA 5GVSA 1UBHS 4QWMA 5DX1A 3KQWA 4XIYA 2G1PA 2C7GA 3K0CC 1GUYA 1XMPA 3WMFA 1U7ZA 2CZCA 4F0JA 5JU6A 1CC1S 1NLMA 1WXWA 1WPRA 1Q15A 4IQGA 5F5NA 1YJAA 1GU0A 1VSVA 5EIEA 1MP0A 1OAOA 4G86A 4DPMA 7MHTA 3V4LA 1SCUA 5JRJA 1RCTE 1IWBB 4XKJA 5JPIA 3OO0A 2HB6A 2NG1A 5HR5A 3F6YA 2IE0A 3JASB 4M88A 3DR5A 3LDHA 3MRXA 1BXRB 3L4BC 1JKJB 4FDAA 3EIOA 1DV2A 4L57A 2NZ2A 4A0SA 3QYPA 5CEJA 4D81A 2ZVQX 2CLOB 1IUPA 4H59A 1Y8ZA 1WX1A 4R1MA 4DFDA 1RXIA 3FHOA 3FR7A 4F93B 3FLMA 1GQQA 2GNOA 1FTWA 4MPDA 3DLHA 1FRQA 2BGRA 1E8MA 1EYZA 4A5SA 4D6XA 3ZK9A 3A2KA 3DBIA 4AI6A 1DLJA 3A4MA 4KMRA 3Q10A 1OOEA 5J9FA 1FZQA 4RDXA 1NVAA 2J08A 1UANA 4AFNA 4JL5A 3RYFA 1NL3A 3N70A 1UBNA 2QA5A 4BFZA 4Z4QA 2WU8A 3NG1A 1RXCA 1EWKA 3W7VA 3OQMA 2ID4A 1XXLA 3EJ6A 5JRDS 5CMLA 1P62B 4G1UC 5BRAA 4AWBA 4H1WA 4UBKA 1QG2A 1TKCA 4BJ1A 4HK4A 2Q1YA 2PYIA 5H81A 2HXGA 1Y3CE 3DZFA 3QKSA 4Y30A 3VJLA 4C0HA 4Q02A 3SN6A 1NBWB 3PYXA 2Y0CA 1J5EB 1NOKA 4L50A 2I6FA 3DTVA 4E6EA 1T6NA 3LCJA 3Q3VA 4Q16A 4ZT6A 3EIQA 4BV9A 3MLBA 3DEIA 2H1VA 3CQ9A 3S29A 1I3MA 3B7WA 3PGKA 4G5XA 1G0NA 1E0JA 1AN9A 5K3AA 3TAUA 3H2JA 2H5LA 3IIMA 1NXSA 4NQZA 3T5MA 5LQAA 3DZ5B 2Q6VA 5L51A 1S7CA 5FUVA 1LX6A 2QUKA 2OQRA 3IQHX 1C7IA 1G4UR 3D1VA 4CIVA 2G6TA 2O8CB 5TQ2B 3LVFO 5LJLA 3C3JA 4B3HA 4IDBA 4JT4A 1YVEI 3AF4A 4IIVA 3WLQA 1U5BB 2BE9A 2QTFA 3TOZA 3KOYA 4N0EA 3L77A 4S35A 3V7WA 3D3QA 2IL1A 2WSYB 1ZSNA 4NZYA 2PZAA 4RAQA 3V8QA 4B35A 1RJWA 4GPEA 3B1VA 4M7WA 1ADFA 1P44A 2O20A 3A2LA 3H5LA 3R5SA 3BREA 4S2EA 2G0TA 3DAHA 1EUCB 4TWAA 4E88A 2QMOA 1X1BA 3ZJ4A 4N8EA 4IQ0A 5J2TA 3TRIA 1FFDA 1M1XB 4J0KA 1XDUA 4R8RA 4IHKA 4LZZA 4NCBA 1OKKD 1W76A 4MUFA 2N42A 3AUXA 2W4MA 5LOVB 1TC1A 3CR7A 3W2HA 1CK4A 4LYJA 3O8QA 3PA6A 1X1DA 4NG4A 3CG0A 4O59O 1UH5A 1Y89A 1OREA 1X42A 3VYUB 4HMQA 1QE3A 4ITVA 4IV5A 4TN5A 5CA0F 4G0XA 5F4BA 3DGFC 4I50B 3V1LA 1QV9A 4OOFA 1YQTA 4S0XA 4CR7A 5LP1A 1FUYB 3LLSA 3LY7A 2XVMA 1E9AA 3EGXA 3Q87B 1VE3A 4M7OA 4PIVA 3TLJA 3W5SA 4B32A 4YMGA 5HPYB 2J5XA 2C97A 3CLTD 3O84A 1CKEA 4C01A 5AM3A 1AMUA 4Z51A 2EEPA 1R8QA 5JJLA 4NMWA 3RVKA 2FRVA 3D7NA 4CQMB 2OXCA 3KUCA 1JQBA 4G0QA 4C30A 1IEVA 1AVTA 2J48A 3DD1A 1M8PA 2XA9A 4WLUA 3ZY3A 5KVQA 2J87A 1KZ9A 2BGGA 4ZI2A 1KH2A 1TQ6A 4P2GA 1IQUA 3I83A 3VVMA 1CNFA 3RLIA 1LNQA 3OOEA 4BMYA 2EX4A 1OLXA 1YZ3A 4D99A 1TJNA 4HZUA 4TGLA 2Q0XA 4N8SA 5CAEA 4YAOA 2DY0A 2J33A 1RM5A 3CS3A 3QY0A 4HMPA 3KSBC 2CB0A 3T7RA 1I3NA 2SCUB 3CNHA 3SIXA 3TUTA 3EHEA 2QAJA 2IU4A 3AIMA 4J2TA 1KAMA 2JLQA 1J0EA 4H1UA 3BCSA 1C3JA 3N28A 3RFFA 4IXTA 2PL5A 1W2WB 2JJ1D 2FPIB 1ZM2A 4B79A 4HZIA 4RTSA 5EA2A 1VLHA 3AKCA 3LYAA 3W5UA 3O38A 1HE2A 2UVPA 4WNAB 5BUZA 1RCFA 3R5HA 2NQ8A 2P68A 2XVXA 2N1MA 3QOYA 3PKJA 3T0FA 1LV7A 1Y7LA 5DNCA 2YC2C 5KSZA 4DANA 2UZ3A 1KMMA 2R1VB 1LWNA 4QYSA 3S5UA 4EH1A 1QK3A 2QTTA 2TS1A 4PC2A 3QKRB 2QX9A 4HDCA 1T4CA 1E3WA 3VBEA 3Q8XB 2E5LB 1QX3A 3HBJA 3KUKA 2ZUWA 4I4IA 1BYUA 3GJ3A 1Y0BA 2FX3A 4Q4HA 3AZQA 2VHQA 1N7JA 3E27A 4L8VA 3LDUA 4GNRA 1SXJE 4O1MA 4AMYA 5CLQA 4EFLA 1QXSA 4RY9A 3CPEA 4X1IA 3KKNA 1YE5A 2AFHA 3Q7SA 2GESA 3HYCA 5KPJA 4LSWA 4YJ2A 2XT6A 1QSGA 1AQNA 5KNDD 1V7QA 2OVFA 1X3SA 3PPIA 4UM5A 3VZDA 2HGZA 5K0ZA 5LNK1 1C0LA 1Y98A 4J75A 1LY1A 3OZDA 4JEMA 4DKXA 1JZSA 3CUUA 1FQOA 10MHA 3OZUA 4GH5A 2QRQA 5D87A 5HJ5A 3AKEA 2ZIFA 5AK4A 2P3LA 1JHPA 2QF7A 3Q72A 4RQAA 5JSZB 1J70A 1TIPA 4MJLA 4OGGA 2JLAA 3NTLA 3S27A 5ILQA 1VSUA 4XCVA 3MWDA 2OV2A 3ZCXA 3Q41A 1YJQA 5TPZD 4YJFA 3HVRA 1Z7GA 2P7IA 3ZUGA 3EH1A 5L4LA 4C2TA 4QXAA 6YASA 1V6SA 2JLSA 4M21A 1G59A 3SEZA 3BSYA 1H42A 3H75A 2OD7A 1EVIA 2JRLA 2CNWA 2EEZA 3PQ8A 1C81A 4JZKA 4HDNB 4RJIA 2R6R1 3HM9A 1AZWA 5CW1A 1XTZA 2D1QA 3B85A 3DW3X 3P2IA 2BEUB 2ZBPA 2NSDA 4BGDA 3Q3IA 2OKGA 5AHKA 3KQMA 2Y6VA 4Q3OA 2UZ4A 3GJXC 1G17A 2A7XA 3JWHA 4FHZA 5EIBD 1ZRHA 5BN5A 5EMJA 1PG5A 2O23A 4XVUA 5K9ZA 4A92A 1TNDA 4DCJA 1BS9A 1C1DB 1E9SA 1FDSA 4UTXA 3UB3A 3LK7A 3OT1B 4XUCA 5HKAA 1OH7A 2BFFA 4KE7A 4B3SB 3DZKA 2X0NA 5T4EA 5L3QB 2XR1A 4R9RA 2X23A 4GXTA 2V7WA 4E22A 3PGXA 4ZVVA 3VHRA 4P92A 1DC5A 2P65A 3G3EA 3RUDA 2GCNA 1E1RA 2Y4NA 2AG8A 5B3JC 3C5HA 5IG2A 3JYLA 4QDKA 1QKIA 3ZNQA 1R0CA 2IZ7A 3MTIA 5C7YA 1NBIA 2AEFA 3VKGA 3REGA 1SC1A 2XTNA 4GPZA 4JB8A 1XZPA 3G6KA 4MS4B 4XVRA 2XKAA 3PUIA 3W77A 2WM9B 3A28A 2VL7A 1DCKA 1QMIA 1LDEA 2C9DA 2CW5A 1BVYF 4QYXA 1HQKA 1TI7A 3LHDA 2OCIA 3LHSA 4DQ0A 2DFDA 1VE7A 4CMEA 2JFXA 2MYTA 2Q2WA 2GHQA 3VOSA 4I9UA 4AL4A 3IAM1 5G0TA 3AEYA 3F9RA 5K4HA 4C0KA 1JLKA 3C39A 3T3HA 3M33A 1MRNA 1A9XB 1I6WA 4YO8A 3GVHA 3AM4A 2C2MA 1VMKA 2G6BA 4MI6A 2CHVA 4Q3BA 2R79A 4TMTA 2JCSA 1SKUA 5IAEA 3BILA 1YBMA 4Q4JA 4BLOA 4YGXB 4A0GA 4EW1A 2BUAA 4J4TA 3WR5A 2WWXA 4MQ5A 3N8DA 1ISSA 3W5IA 1OA0A 4A6EA 3AINA 3G82C 2J7PA 5BMVB 4HVTA 1UL1X 2JBAB 1LVHA 4G0PA 2JZOA 2QN3A 3K31A 2W6CX 2RC6A 4F3YA 2PKQP 3WB1A 1MNAA 4OGWA 2AKEA 5LA6B 1CIVA 1JR3A 1Y6QA 3M1AA 5DV9A 4KMOA 1N5KA 1YHZA 2NT3A 1THMA 1OXKB 2EP5A 4PZ0A 3SIPA 1UMDA 1A8QA 5CJ2A 5AICA 4CKEA 2XXAA 5KMGB 2X3UA 3BEOA 4J94A 4HTFA 4IX9A 3PB3A 4NBUA 4XEHA 2BKXA 4BYGA 4O2RA 1BU5A 1S8AA 2C7BA 5FLEX 4E3WA 5F1KA 2G5CA 2QQGA 1GKLA 5JXGA 3RSHA 4OHMA 3G5AA 4JBGA 3ZE7A 4OLBA 5E3IA 1Z39A 1P5HA 4KV9A 5FKJA 3NXSA 5TGZA 3V1NA 1FW6A 3NHWA 3OD1A 4RBNA 5EIWA 3U37A 3U4AA 1O8CA 3PF8A 2H1OA 3ENWA 1NW3A 3DVAB 2OYCA 4Z3DA 3SQNA 2WWRA 3FBGA 1W29A 5EI5A 4DSNA 1CR0A 1SVNA 4B8ZA 2Q5QA 4G8JA 1B74A 2Z83A 4LYFA 4OY3A 1AIPA 2IP2A 1YDMA 2WIJA 4I19A 1E1CA 1L7VC 3GV0A 1UKEA 4O5AA 2PL9A 4PG4A 2DJIA 2PLRA 2ZDGA 3CNBA 1AUVA 4GYWA 5I8PA 2NT4A 4YEDA 1NA5A 1KS2A 1HFJA 3V00A 1Y8AA 2A5JA 2XTJA 5EE0A 5TC4A 3UHPA 4X90A 4BNUA 5KTYA 1H3EA 1IM5A 1CUXA 2Q2NA 4FVTA 2YMMA 4OX9B 1QQTA 5BN3A 1NFRA 3WB2A 1VE5A 1F4PA 1QNFA 2HBQA 4S1PA 4TV8F 2KW5A 3TD6A 4QL3A 1RHRA 3RSSA 4DV5B 4J49A 1SCBA 1W5BA 4I1IA 4ZCQA 3PENA 3VPDA 4E3ZA 1FU8A 1ZINA 1IZZA 5DM2A 3HDJA 4M4SA 2Q4EA 3QX7A 4C4YA 4EY5A 1ZNWA 3JX9A 2IVZA 4RHTA 5IM5A 4LCJA 4UNPA 2Q28A 1ACMA 3JYPA 2GYUA 2X8AA 1NC3A 3N0TA 1FSGA 2VDPB 4QJIA 5JJ5A 3FWNA 2FHPA 2ZJ4A 4TMKA 4N12A 4NE2A 1SMKA 4FBMA 3R6WA 4CQNA 3F7OA 5ALQA 1BDMA 4HS9A 4MR7A 1I7NA 3KOWA 2BFCA 3EFEA 1YZUA 1DUIA 1MEOA 3L0BA 1UYJA 3SFVA 4KHPB 4LC0A 5EJAA 2GASA 1ZLYA 1Z6G<