4NHEA

The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with nadp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVSQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFEAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of oxidoreductase (Gfo/Idh/MocA family) from Streptococcus pneumoniae TIGR4 in complex with NADP.
rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, Gfo/Idh/MocA family
total genus 113
structure length 325
sequence length 325
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4nheA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nheA01
4IDEA 2O48X 3JQCA 2BFAA 2W8ZA 3Q0EA 2VCYA 1X13A 2PGLA 2E4AA 3GLQA 1A9YA 1VJ1A 3BAZA 4DBVO 5KIAA 4MINA 3HB4X 2CF6A 4WECA 4YEDA 3RAJA 1UAGA 1E5LA 1QP8A 5JCXA 5FWNA 3FNEA 1BRMA 1Y9AA 2PKQP 5CDSA 3BMOB 1LLDA 5ICSA 4EI2A 1XR3A 3JSAA 1C0LA 3FNGA 4BQPA 3QVXA 5I9NA 4CM5A 2GCGA 3ENKA 5ILOA 4NIMA 1UZLA 4WCFC 3WIDA 4M55A 5JDCA 1JN0A 3UXYA 2P5UA 4CLDA 4MKXA 3QWAA 3VPFA 3SXPA 5ENDA 3IJRA 4Q9NA 3X2EA 1VL0A 1LX6A 3BMQA 3IQDB 4BV9A 3UCXA 3VOSA 1YB5A 3DMTA 4B7UA 3TZCA 1O8CA 4DPMA 2ZYAA 1UUFA 2D5AA 2I66A 2RHCA 2WD8A 1HXHA 2H5LA 4UEOA 1E3EA 4RF3A 5BSHA 4LSMA 3IIEA 3AFMA 1GR0A 4J49A 5CPBA 2Y0DA 3PLRA 1Q0HA 4WPGA 5FYDA 3FCOA 4YT5A 3OJEA 4FJ2A 2HK9A 2NU6A 3LC7O 1ZSYA 5AVOA 2B37A 4FFPA 1NVGA 4OQYA 3DAFA 3G1UA 1Y8QA 3WGIA 4BO6A 4PVCA 3ZU2A 4ZD6A 4BMVA 1R4NB 5EINA 3ASVA 4TWRA 3RUEA 4EGFA 4CLRA 2OORA 1ENPA 4WEQA 3LT2A 4D3FA 5JLAA 1O6ZA 1ZVMA 4YYZA 1GDHA 4EJMA 2VYNA 2AEFA 3JYQA 3WLEA 3ASUA 2Q1SA 3K8ZA 1A5ZA 4IJWA 3TJRA 4XYMA 3FD8A 2GZ1A 3D3WB 2VZ9A 3KEOA 2CUKA 1LC3A 1HDYA 5I7VA 4OOEA 2O50A 4HNHA 3E9NA 3I6IA 3IC5A 5KVCA 4KUEA 4R1NA 3RFTA 1YOVB 1GYQA 3I9LA 1CDOA 1CWUA 1PSDA 2OOSA 1PL7A 2PNFA 4B4VA 1HYEA 2FPGA 4O1MA 3SJ7A 1VPDA 3VZRA 4IJUA 4RVUA 1LSUA 1A9ZA 2I5PO 3RUHA 2WWRA 1YE3A 3PFWO 2GPTA 2BD0A 4QO8A 5IG2A 3LLSA 1GFSA 1NNUA 3QLJA 2TMDA 4BUCA 1MFZA 4LK3A 2G82A 2BI7A 4G2NA 5LC1A 3AU9A 1GEEA 1EVYA 2IXAA 1EZ4A 1IE3A 4E5YA 1GV1A 1UXHA 4JCOA 5B37A 3IKVA 2NVBA 1I5RA 1R0SA 3KYCB 1RKXA 4MP8A 1B2LA 1T2FA 4D7AA 1QYDA 4AJ1A 3WIEA 1B7GO 5CEFA 4ND1A 2Z5LA 2W2LA 1EFKA 1X7GA 4XR9A 4ILKA 3GGGA 2CDAA 5GY7A 2JJYA 5L7WA 4L8VA 1N2SA 5H81A 3PHGA 1Q2XA 1HDRA 2WYVA 5KOIA 5JC8A 1I2CA 3FN4A 5C7OO 3QWFA 4O5OA 2PZLA 1K0UA 2R00A 1EVZA 1MXFA 2VT2A 4FJ0A 4L74A 4OO3A 1KEWA 1KEPA 5TT1A 1H9BA 3IDSA 4NJMA 3E82A 1PGJA 4DUPA 2PZKA 4E33A 3DZJA 5B4VA 1JKIA 3D1LA 3GNTA 4F6CA 4J1NA 4CL3A 4PIVA 3HG7A 3TZHA 3TL3A 5AYVA 4P8RA 2GF2A 3W8DA 1JQBA 4IIUA 3DBHB 5COAA 4LSWA 1ZSNA 1ZO8A 3P2YA 4CQMA 4UUNA 5ILGA 3UOGA 2GN8A 4EEXA 1N7GA 4KTVE 2Q4EA 2X5KO 1AGNA 4R1TA 1Y5RA 5BT9A 2CY0A 4JNKA 3PHHA 3GVCA 3OIGA 1ULUA 4N18A 5TF4A 3JQAA 5G0SA 3QWHA 2GLXA 4P4GA 4Y67A 4E2XA 4YVFA 1EUZA 1XGKA 1VM6A 3CZRA 1QR6A 3OM9A 2VUUA 3QHAA 3WNVA 3TL2A 3NV9A 3VVBA 4D45A 4EJ0A 1EEHA 5KJ1A 3NDJA 5T6BA 1IL0A 1JDJA 4M1QA 2DUUA 1JVBA 4P22A 5L45A 3UAGA 4E2WA 2JFFA 3RKRA 1OOEA 3TF5A 1DEHA 1JLLA 3AI1A 5HM8A 5TQVA 5L53A 1BTOA 4IBOA 5CFZA 1T26A 4XWYA 2FSSA 3DTYA 1ZZEA 1G1AA 4W6ZA 1QXSA 5A02A 3OJ0A 4R16A 4A73A 4CQLB 4R9RA 1A27A 2GGSA 1T25A 4DTIA 2EIHA 4GWKA 3DOCA 2AW5A 3N7UA 3KV3O 1C1DA 2Z95A 2OP1A 4AJHA 1PR9A 1C0KA 2A92A 3G3EA 2PZJA 1DFGA 2UAGA 3U4CA 3CIFA 2QW8A 2FR0A 1R12A 1SC6A 4FFOA 4DPLA 1LQUA 4RORA 3V5NA 2Y1EA 4RVSA 2QYTA 2HAEA 4BO4A 3E5RA 1TI7A 1PJ2A 3BXXA 4CV0A 1IPEA 4JP3A 3UW3A 4E21A 2O2SA 4Y98A 4CMBA 4OXNA 1ZXBA 3FWZA 1WMAA 2E82A 3GHHA 2C82A 2D0IA 2PFGA 4W7IA 3D7LA 1E7YA 3TQHA 1UDAA 1M75A 3E48A 4ZRNA 5ER9A 1Y7TA 3ICPA 1YJQA 2A4KA 2CVQA 2NLOA 3OICA 1OMOA 2FP4A 4B3HA 3AOEA 1SCUA 4GPD1 1ISMA 1KEVA 4BNWA 2HK8A 4GAEA 4D42A 2V6MA 3C7CB 3ORFA 4CM1A 4XDZA 2JD0A 2YW9A 1T2AA 3GH3A 4AJNA 3ZW8A 4I5FA 5LDHA 2PD6A 3PK0A 4L76A 1CYDA 3WSVA 3TZ6A 2YJZA 3PQEA 4MVJI 1YXMA 2B5VA 5JDIA 4JJGA 4HV4A 2GNAA 4D44A 4PG4A 4ZQHA 5F1OA 3WSWA 3AUTA 1U8XX 2RBEA 1ARZA 3AJRA 3IAHA 3WGZA 2VWQA 4JK3A 4RF4A 4BO8A 4XKJA 4GBJA 2X22A 5DCUA 3LC2O 3F6YA 4ALJA 6ADHA 2QZ9A 4R51A 3BMCA 4XIJA 4GH5A 5KWEA 2D5CA 5TSDA 4PLYA 1MFPA 1NVTA 1F06A 1QORA 2J3HA 4WOJA 2Q2VA 4IIVA 3VVCA 2GZ2A 4QUKA 1D1TA 5HTOA 2OBNA 2AG8A 3ROPA 1RM3A 5CEJA 5A9SB 4FFLA 1WVGA 4UREA 3INRA 3WWZA 4YAIA 3WJ7A 3DBRB 1TT5A 4NBUA 2RAFA 3AOGA 1ZW1A 3ZWMA 3KSUA 3JQAB 1Q1NA 1T2EA 3WGHA 1P1FA 3QVOA 4YAKA 2Q2QA 1E3LA 5DN9A 4Z3DA 5J9GA 4TROA 1OZAA 2YY7A 1N5DA 3OIFA 5CG2A 1I10A 3NJ8A 4BVAA 1DDOA 5JS6A 5GZ3A 1EVJA 1H6CA 4DMMA 1YO6A 1P9LA 2DBQA 3A9WA 3CPSA 4XIYA 4GWGA 2EJVA 1LDMA 1X1EA 5BSGA 3LVFO 2FMUA 2RH8A 3ABIA 1LTHR 2O3RA 4Y6PA 2W90A 4GL4A 4A10A 3BTSA 4L4RA 2Q2WA 3DBVO 3I4CA 2HQ1A 3KYDA 1L7DA 5A04A 4HFNA 3P19A 2C5AA 1NQOA 1HF3A 3MJVA 3WGTA 1Y8RB 1ZIDA 3QVWA 4R01A 3ADOA 3KYCA 2RH4A 1O9BA 5CDYA 1YB1A 4FB5A 1HT0A 2GO1A 3KYDB 1V6AA 3ZI0A 4BNXA 1E3JA 1DIBA 1YS4A 3JTMA 1OI7A 5LDGA 3ZV3A 1WW8A 1H6DA 2V6GA 1MC4A 1L1FA 5F1KA 3W1VA 2W4QA 3H9JA 4CR6A 4GKVA 1PGPA 4BKUA 2GN9A 4BO2A 1R4MA 2IZ1A 2AQIA 4OXKA 4ALIA 3QWBA 4BNHA 4DA9A 3SVTA 4PZDA 3JQBA 3MCVA 2OP0A 3GN2A 3LQFA 4KUHA 4KP7A 5T5QA 1OAAA 4W4TA 2ZJ1A 4ZQGA 4WCFA 2VWGA 2V7PA 4YA6A 1ORRA 4RQUA 1ZK4A 1SOWA 1I3LA 2FY8A 1P45A 4GLLA 4J7XA 1LEHA 3HNPA 2X7HA 2O3QA 3DONA 2O23A 3R0IA 3G1TA 1UR5A 3IMFA 3UFXA 4HXYA 4UVGA 1YOVA 3OFSA 2HDHA 3RC7A 1ZH8A 4OM8A 3AU8A 4QEDA 4XB2A 3A28A 1FDVA 4J90A 1UXIA 3TN7A 4NBVA 2V6BA 2HMTA 3ETDA 2DKNA 1NXQA 2HSDA 1BVRA 5HS4A 4S3MA 3KSDO 3LF1A 2JFHA 3UF0A 4BNVA 3KB6A 2Y1OA 2HRBA 2VOJA 1NYTA 3CTMA 3Q1LA 4YTEA 5TLSA 2DBVO 2VHVA 4BNYA 3IJPA 2WM3A 1EUCA 1FDSA 1LU9A 3KM0A 3FNHA 2C2XA 4IDDA 3UVEA 4CR8A 3GOHA 4H15A 3OSUA 4UUMA 3T7EA 4EBFA 1QYVA 2YHIA 1I24A 2YFQA 4YJGA 2NACA 4OGWA 4CMIB 1PJLA 3I1JA 4K28A 2LDXA 5A1TA 3S1LA 3ZV6A 2CD9A 3BTUA 1WXDA 3NTRA 3ZWAA 4F46A 1SEPA 1E1KA 2YQ4A 3EVTA 5T57A 2YHIB 4YJGB 3Q2IA 2FN7A 3HSKA 3GPIA 3KETA 1W73A 1KVRA 1HE5A 1ZNQO 3U62A 2D1YA 3K2BA 2P9GA 1TXGA 1IOLA 1XCBA 3D64A 1V3TA 3L4BC 4E12A 3N74A 1BDBA 2X8LA 2J5KA 5ER6A 2O7QA 1YQDA 3TZQA 4YR9A 2PV7A 4MIEA 3AI3A 5CDTA 3QJ5A 4UVHA 4FDAA 5A03A 3GVXA 1EK6A 4I5EA 2Y0EA 2PA3A 4PG8A 1BMDA 1VJTA 1DHRA 4BKRA 3NTQA 5JCJA 2JHFA 2PKQO 4PLVA 2X9GA 3O26A 4MP6A 1PJQA 2I3GA 1ZK2A 4CM9D 1I33A 3IL2A 1YQGA 3FPCA 3RCBA 3E18A 5JPIA 4RJTA 4WASA 3JQGA 4CQMB 4OHUA 3SLGA 3WR5A 2EW8A 1J5PA 2GERA 3GNQA 3PWKA 2B0JA 2OL4A 1Y8RA 1FXSA 2O4UX 1LDNA 4I5DA 4DVJA 3NJ4A 2E6UX 4IS2A 1E3WA 3EMKA 4OKIA 2EG9A 1TLTA 1XU9A 2QRLA 3B20A 2VT3A 2PK3A 5HWSA 4ND3A 2ZTVA 2C20A 2W98A 3PZBA 1LSSA 3E8XA 3PFFA 2B36A 1WWKA 3ST7A 3JQGB 1PWZA 1IY8A 4FBGA 4PLHA 3JQFC 4FN4A 5KVVA 1VL8A 2NQTA 3QSGA 4HWKA 4RQTA 4L73A 4U5QA 1IULA 3KHUA 2I65A 1HE2A 2HRZA 1LLUA 5G0WA 1K6JA 3T4XA 2JD1A 3LT0A 3JQ9C 4JJIA 2JCYA 5CDUA 4FR5A 2D59A 1HE3A 4I8XA 3JYNA 5IDXA 2IEDA 3GRKA 1QYWA 5I9MA 1N1GA 3RBXA 2I76A 4U0KA 2NM0A 4RVGA 1DIRA 4PLCA 3FNFA 1C1XA 1N8KA 1ZMOA 2P9EA 1LLCA 3AM5A 4LCJA 4F6LA 4J7UA 4IUYA 1LLQA 4E5MA 4MKZA 3TOXA 5I7SA 4RPHA 1C0PA 3H8VA 4KDFA 1AXEA 3S55A 1DSSG 3T4EA 1PJSA 2CDBA 4MKRA 5F3RA 2CDCA 5DT9A 3DZBA 1W6UA 2C7GA 5EERA 1ADFA 3UICA 3U09A 3FHLA 4IGFA 3W6UA 4BNJA 3PIDA 2O3SA 1WLYA 1XQ6A 1IPFA 5CPFA 4EYEA 2Q22A 3MTJA 5MDHA 3BHJA 1HSZA 4RVFA 4ALKA 1I2BA 1IZ0A 1P0FA 4DIOA 3RC9A 4WNIA 4XQEA 4NZ9A 3COSA 2TMGA 2BGLA 2A94A 3QV1A 1SBYA 1DPGA 2C59A 5K9ZA 1M67A 1ENYA 4FOSA 4UVEA 4LISA 2JAPA 2X9VA 4CM4B 4Q3CA 2GN6A 3OH8A 3A14A 3I6QA 2PTGA 4J2OA 4BB6A 1B3BA 1KETA 1P1JA 1HSOA 1HDZA 3PDUA 3DR3A 3GF4A 4K6FA 2C7VA 3CMMA 3WQSB 4MVJG 3RVDA 4BOYA 1VI2A 4RLSA 3A4VA 2JCVA 4Z9XA 4GSKA 3VPXA 4CM9A 3K31A 4FS3A 5BNIA 3RJ9A 2FWMX 5A05A 4D79A 2F1KA 4CLXA 2XXJA 2YDYA 1RYDA 2NWQA 4EUFA 5U9CA 4IS3A 1VSUA 3RIHA 3FF4A 4LCEA 3ZU3A 3P7MA 1QYXA 3WBFA 2ILTA 4CM6A 1V3UA 3KEQA 4WLUA 3NEPX 3RU7A 4PLFA 4K9DA 4BNFA 1A4IA 4Y6SA 1Y1PA 2B83A 1MGOA 3GAFA 4RPGA 1DC4A 3IP3A 4LRTB 1WZEA 3GAZA 3ZU4A 3MOGA 4ALLA 4IQ8A 1AN9A 2DUWA 4MDHA 1P1HA 2C54A 4RVDA 3DEYX 1X7DA 1GZ4A 4PG7A 3PPIA 4QECA 1P77A 3GVHA 5TGDA 1DFHA 3ZWYA 2BFPA 1UXKA 3GK3A 4D0RA 4XGNA 2JD2A 2EXXA 3KLMX 3NYWA 4GX1A 4WKGA 1YDWA 1CETA 4CMCA 1ZJYA 3X2FA 3DL2A 5DCWA 3GQVA 4RZIA 3E1KA 3ICCA 1KVQA 1R37A 5IJZA 5F5NA 3OJFA 4IDGA 1ADBA 4GGPA 5L4LA 4IQ0A 4TRRA 3GMDA 1PIWA 4QO7A 1V35A 3VZPA 2PGDA 4K26A 3H7AA 3H3JA 4Q3EA 4CM8A 3H9QA 2BGMA 4UUOA 5C5IA 1D8AA 1B8VA 4TMFA 3GZ4A 3AUUA 1Z73A 2OFPA 1XDWA 2VTEA 1JAXA 5KJFA 3I9MA 1ZSVA 5JO9A 1ZEMA 1ZK1A 2H63A 4NR0A 1WNTA 3R3JA 3M2PA 3NGXA 1MC5A 4QFDA 1V9LA 1K3TA 5IDQA 3SC6A 2XOXA 1TT7A 2VOEA 4CV1A 4K1LA 1R4MB 5DZSA 5IZCA 3ITDA 3DXFA 4DQXA 2JAHA 5EQDA 4GX0A 4OQZA 1HYHA 1ADCA 3NT2A 4J43A 2WE7A 5KCZA 4IDAA 3A1NA 3K9QO 3WLFA 1VSVA 4D0SA 1C1XB 4UAGA 2C5EA 1YBMA 1DBVO 2PGJA 3GZNA 1ONPA 3ZW9A 1EFLA 2Q46A 4B4OA 1PTJA 4YWJA 1IZ9A 3KSZO 2X1HA 3PZRA 3ITKA 5I8ZA 1JTVA 5AXAA 1ENZA 4BHTA 2WE8A 3E6AA 1NAIA 1Q7BA 1DJQA 1J6UA 4BS9A 4R3NA 4ZQBA 5KJ6A 4NI5A 3DZIA 3Q11A 2NNLD 3DAGA 1GYRA 3IS3A 4FFMA 4BB5A 4E5NA 3VC7A 1QV7A 1P1IA 1ISGA 4ND2A 3P5SA 1HYGA 1E5QA 3GMSA 2IXBA 1VE9A 2PZMA 1UZNA 4B4UA 5CHEA 1UXGA 4Z6KA 3PVZA 4ZGWA 5C7IO 5HBRA 1Z7BA 1MA0A 2IYOA 1LDEA 5ENVA 1ZJZA 1Z6ZA 4H3VA 3B70A 3KVOA 4A26A 1T4BA 4IQGA 5JAQA 9LDTA 1ISHA 3AY6A 5B4TA 5DP2A 3TNLA 2OUIA 2VNSA 2G0TA 1I32A 4GQAA 4DPKA 4CM7A 1DOHA 2QIOA 4XRGA 1O94A 4I5GA 4AJJA 3ZHZA 4X54A 3VHRA 1BVUA 4JGBA 5JDIC 5JBIA 5BNTA 3CSDA 1U5CA 3GR6A 4NU6A 5EQFA 3BMNB 5F5LA 2Q1TA 2CVZA 2YFHA 4Z0TA 4J6FA 1QLHA 4U6SA 2HUNA 5KVQA 1E7QA 2Y1DA 2Y68A 3WX0A 3H9GA 4BKQA 3VTZA 4WLEA 2C29D 5C7LO 2WEKA 4P4LA 1L7EA 5L51A 3ETGA 3NUGA 4IDFA 1GY8A 5ITWA 2NVWA 4AJKA 3DB2A 2WMDA 1VKNA 1KVTA 2AQKA 2EHDA 1UZMA 1ZBQA 4Q3NA 2BMAA 2GRAA 4RF2A 3I83A 4Q39A 4NJOA 4BNTA 4JIGA 1LRKA 4J0EA 2D2IA 4NFSA 3QP9A 3AM3A 4N5MA 2HLPA 3K92A 1HDOA 1NPDA 1R4NA 2NVUA 4ALNA 2H1SA 1U5AA 5TRTA 3TZKA 2Y1GA 5C3MA 1W4ZA 4Y9DA 2FZWA 3DFZA 5JAMA 1X0XA 4UEJA 4CMIA 1BGVA 2WDZA 2NVUB 1I3MA 4BO3A 4P38A 4C7JA 5T67A 5G4KA 3S2FA 4LMRA 4GSLA 4BGEA 4BO0A 1T1RA 4XJSA 3D3WA 2J5QA 4JJFA 4EITA 3MEQA 2X5OA 3C85A 1M6WA 5JC1A 2X58A 4GLOA 3EZLA 2P5YA 1U3TA 2WYUA 3H4VA 1NASA 3ROKA 4CODB 1XG5A 1DLJA 1XIVA 4XQCA 1Y81A 2W2KB 3O38A 1NBOA 2FHSA 4JBIA 4YDRA 1WZIA 1PS9A 2BRUA 4RGBA 1Q7CA 1H94A 2DQ4A 4O63O 4YPOA 3CEAA 1Y8QB 2P2SA 4FCCA 1NQ5A 1EK5A 1I2ZA 2AXQA 3RD5A 1O0SA 3LDHA 2YHUA 3BHIA 3M1LA 5LCXA 3T7CA 3VH2A 4I9UA 5C37A 4W9NA 1OC4A 2X5JO 3FTNA 5EN4A 3ONFA 3L0DA 3IOYA 4J3FA 1MV8A 1TEHA 4IXWA 4UUPA 1ONOA 1UP4A 4FJ1A 2Q1UA 1WDLA 4TQGA 4NPCA 1E7WA 3BMOA 1K6XA 4W9NC 4AJIA 5TJHA 4E5KA 3ZHYA 1VC2A 4XD2A 3L77A 4YQYA 4WUVA 1E7MA 3RASA 1ISIA 4WGGA 4GX5A 4E2ZA 4IZHA 3MOIA 3U4DA 1EVIA 5AXBA 1D1SA 1PJTA 1NP3A 4W7HA 4AL4A 4J9VA 3R1IA 5JYDA 2PH3A 1G0NA 3HADA 3O4RA 1U2GA 2J3KA 3E9MA 3HE3A 2VZ0A 1XHLA 3JV7A 4IY1A 1R0KA 3E5MA 2VUTA 5BR7A 4JX8A 1LRJA 4RF5A 3ZNPA 2G76A 1QV6A 4WJZA 2BFOA 3MJSA 4MVJE 3AUSA 1PR3A 3QIVA 4OL9A 2B35A 3JQ8B 3UGKA 1IHYA 3LF2A 5L4NA 1U9JA 3VPGA 4BNMA 4YB8A 4IM7A 3GEDA 4PVDA 1U2DA 1M76A 4U7WA 4CLHA 2EEZA 5ES3A 1LBEA 3LLVA 4M8SA 4Q3AA 4B79A 4CV2A 1BWSA 1R0LA 3GEMA 3H6KA 2BI8A 1GU7A 5M6DA 1DO8A 1RM5A 3ONDA 4ND4A 2HMWA 1HDGO 4E31A 2B4RO 2VRBA 2X9NA 2NU8A 2E49A 3PJGA 3GUYA 4NK5A 4CLEA 4W99A 1FK8A 4EW6A 5F21A 2X23A 4BO5A 4BKPA 3D4OA 2C0CA 3ROMA 1Q0LA 1DRUA 2NTJA 3DTTA 4G81A 3INTA 2GYYA 3HZZA 4KMSA 3OA0A 2DFDA 3H5NA 1LUAA 4YAEA 4MVJF 5A9SA 1WPQA 4FOOA 4DWVA 1YL6A 3D4NA 3JQ6A 1JU9A 4J7CA 3CUKA 3GRPA 1NFFA 3TPCA 1NTOA 3VZSA 3C7DB 1XU7A 9LDBA 4R9SA 3UUWA 2Q3EA 5TC4A 3IKTA 4DC1A 1MG0A 3RUDA 3P2OA 3JQEA 4XQGA 1LXCA 3VH4A 1UH5A 2IRWA 1R66A 1SNYA 3V2GA 3EHEA 4B4WA 1B8PA 3QE3A 3W8EA 1XEAA 3DAPA 2FZEA 3JCZA 3JQFA 5IN5A 4OH1A 1UP7A 1ZMTA 1YBAA 4A03A 4CLRB 4DQUA 4DBZA 1ZXLA 4UEKA 4XYBA 3ROQA 4O59O 1LI4A 2SCUA 3PYXA 4A27A 3DBLB 4XYGA 1NM5A 3TFQA 1D3AA 4MJLA 2EWMA 3KOUA 4AICA 3F1LA 2NTNA 5JSFA 2OHXA 1GZ3A 4BGUA 5A3JA 2PD3A 2Q50A 3ZCXA 4XR4A 3DMTC 4PLGA 5HA5A 5THKA 1YRLA 4E5PA 3FR7A 4URFA 3GC6A 1JWBB 4OMUA 2ZCVA 3V1UA 5TS3A 4BKOA 1I8TA 2J6IA 2CVOA 4J16A 2JHGA 2WTBA 3UH1A 1XKQA 3H2SA 2BH9A 3GGPA 3ZNOA 1YL7A 1CERA 3MJCA 5KJCA 4CJXA 4L4SA 1LSOA 1PL8A 3G49A 1H2BA 3BMQB 3HFGA 1R6DA 1H5QA 3JQ7B 4DYVA 4E3ZA 1JVSA 4E32A 3IUSA 1QRRA 1DAOA 2DM6A 1YBVA 1YQXA 5GMOA 2RIRA 5H82A 4BNNA 3GT0A 2EJWA 2DT5A 4OYRA 1C0IA 4Q3BA 1NQTA 4EUHA 4CMGA 5I9LA 6LDHA 1HEUA 3FBTA 1VL6A 4ZA2A 3FWNA 4BL5A 4EJ6A 3JQDA 3HDHA 3L4BA 4N7RA 3RWBA 2AEJA 1X1TA 1U1IA 1BG6A 1B15A 4WEOA 2X86A 3DC2A 3O8QA 2FR1A 3WICA 1E0DA 1WP4A 2Y05A 3ZHXA 1LDGA 3GDOA 4NHEA 1GCOA 3DOOA 4B7CA 4XRRA 2I3AA 4IINA 4J4BA 5HRUA 2HK7A 1P0CA 4TKLA 1DHTA 2O4CA 1SOVA 3OBBA 3B6ZA 3U0BA 3DZHA 2YZ7A 4J91A 3RU9A 1HZZA 5G2OA 2AE2A 3V8BA 1F12A 3G17A 4FFNA 3I9JA 2FPIA 2VWHA 5DCYA 1W0CA 4XGKA 4NG5A 2Y99A 3BTOA 4N54A 2WD7B 3KTDA 4R3WA 1JKJA 2NTVA 1NWCA 2HCTA 2EERA 3CZMA 3K5PA 1HKUA 4L9RA 3PHJA 2NADA 2VRCA 2ZB4A 8ADHA 4AJLA 3OQBA 4IJVA 3JQAD 4JLWA 4OJNA 3OIDA 2P4HX 4KWHA 4TRJA 5I7FA 1WDMA 2ZTMA 3SJUA 2VZ8A 4GI2A 3ZWNA 3LZ6A 1IYZA 1K89A 1HDCA 2ZYGA 3GNSA 1BXGB 4NH4A 1EE9A 2GSDA 4Y6RA 3PEFA 2ZTLA 3I23A 2I6TA 4NQZA 4B3JA 3PQDA 2R2GA 7MDHA 1X0VA 4XJTA 1F8FA 4FW8A 1B0AA 4FC6A 3QA9A 5COBA 5TT0A 3UCEA 4LMPA 2QYSA 4WOKA 4Y8VA 1K5HA 4YJFA 3CE6A 3BA1A 5HS6A 4IPTA 5TX7A 1HTBA 3I5MA 3SLKA 2Q4BA 2DU8A 4GMFA 3HDQA 3EYWA 3NDIA 2ZB7A 3ANMA 5T64A 5CP8A 4QX6A 3ADPA 3OQ1A 2PKRA 2DBZA 3UHAA 5JNLA 3JYLA 1EDZA 1EBFA 1PS8A 3BIOA 5A4DA 1YGYA 4XCVA 1GL3A 2G1UA 3PJDA 3RUCA 1E3WB 5CAEA 1SAYA 1RJWA 3F1KA 5KTKA 4QTZA 4TVBA 1EBUA 2YV1A 1PJ4A 2H6EA 3AWDA 4NNJA 4R54A 3ZWWA 2IODA 3V2HA 2HJSA 4EUEA 1TT5B 2PR2A 1VJ0A 3NRCA 5MGBA 1DAPA 4WLFA 1GUFA 5TIIA 1R16A 3FBGA 3SBOA 4J2HA 4RPLA 3Q9UA 1F14A 4XDYA 1YKFA 5JO0A 3WGGA 3ZHBA 4PLZA 3HJAA 1WAMA 3U5TA 4RCVA 2UDPA 4TVOA 5G0VA 1P33A 1I3KA 4WCDA 4NFHA 4CUZA 2QRKA 3I3OA 1U7HA 2H9IA 1Z82A 5KKCA 3UCFA 2RHRA 3RKUA 1R15A 2YV3A 3VPHA 4FGWA 1HDXA 4HBGA 2YQ5A 1MP0A 1PGNA 5DBGA 4OSPA 4YT8A 2G17A 5IXYA 4WLOA 3WTCA 3TRIA 3S2GA 4TZTA 4MVJA 1XSEA 4MP3A 2GR9A 4E2YA 1A7KA 2YYYA 1S7CA 4D3DA 4DIFA 2V6FA 4M89A 1O89A 5ICMA 2POQX 3M2TA 2IZ0A 4R69A 4DQVA 2VN8A 2ZK7A 2IZZA 3OQ6A 5G4KB 5KKAA 1U8FO 2R00C 1EMDA 3FSRA 4J1SA 1AE1A 3M6IA 5GZ6A 1ONNA 2VYVA 4CL8A 1N1EA 1UAYA 2ET6A 2X4GA 5IDWA 3NKLA 4XA8A 2AHRA 3OP4A 3E03A 2OGUA 5I7EA 1E7RA 3D5TA 1MUUA 2AA3A 2JKVA 1YVEI 4QSMA 3OF2A 3R6DA 5KNLA 2ZJ0A 3H5AA 3DHEA 4ZN6A 3RROA 4YT2A 2ZKLA 4RLHA 3VDRA 5CG1A 3JQ9A 2HU2A 3WMXA 2CFCA 2PD4A 4WCFB 3SEFA 3WQRA 4DRYA 3E9QA 2DVMA 3PWZA 5THQA 3RJ5A 2P9CA 3GG9A 3OHSX 5IN4A 2UUPA 2CZCA 1GQQA 3NDRA 4FD3A 4MVJD 4CMAA 1DIAA 3S8MA 2W2LD 5DBIA 3Q6IA 4JBHA 1GV0A 5EPOA 4NFYA 5G4LA 1ID1A 4OOFA 2Q49A 5DP1A 1PGOA 2DBRA 1V8BA 4OKNA 1B26A 3GPDG 3C7AA 2X0NA 3WMWA 2LDBA 4A5OA 4ZRMA 3JD2A 2HO5A 2ZB3A 4MO2A 4M87A 5BNFA 3LT1A 1YJ8A 1ZK0A 1K6IA 1N9GB 3B1FA 2J3JA 3F5QA 2FR8A 1MXHA 3KO8A 4BGVA 4CM3A 4A7PA 3B1JA 3GVPA 1ADGA 4HFMA 1PU2A 3SX2A 3VH3A 3CKYA 4YQZA 4DC0A 4E13A 3W4KA 1HWYA 3TFOA 1PQPA 1GQYA 1CEQA 1U4OA 4YJHA 3HDYA 3PYMA 1HL3A 1YDEA 4TKMA 4II2A 2Y67A 4CLOA 1RYEA 2BKAA 4HKTA 1NR7A 3TDKA 4RVHA 3VDQA 1IB6A 3U4IA 2OXIA 3NGLA 1X7HA 2IDZA 1SPXA 2BELA 5JMWA 1GCUA 3EC7A 3PTZA 1PX0A 3QRWA 4KOAA 4D3SA 4OXYA 1E1LA 1JW9B 2XPCA 3WWYA 1XLTA 1Z7EA 1UDBA 1GAEO 4YJDA 2XF8A 1GPDG 4YCAA 4YRDA 5DNAA 5JY1A 3VAZA 4CR7A 3QWIA 4ALMA 3DHNA 4J4TA 4N5LA 1Z74A 1KC1A 3PXXA 4NBRA 1B3RA 4I1IA 1ISJA 2VHYA 3CINA 5B1YA 1H0KA 4LN1A 4IMPA 1QSGA 3O8QB 1DRWA 1QLJA 1QMGA 1GYPA 3MZ0A 4PCVA 3PRJA 1UXJA 2PY6A 1I01A 1C3VA 2UYYA 3D4PA 5DULA 5L95A 1NWHA 3JQBC 4PN3A 4MVJM 2O2YA 2BHLA 4L0QA 3U3XA 3DHYA 2GZ3A 3KUXA 1H6BA 2I99A 4YJHB 3NAQA 1SO8A 1U28A 2EP5A 5KVSA 1T2DA 2QZZA 1NFRA 3HHPA 3K30A 1FDUA 5JAIA 2IEBA 4BO9A 1MG5A 3OJOA 1AUPA 3W8FA 3HN7A 2EF1A 3C1AA 1PQUA 1Z75A 1GQ2A 2EW2A 1JA9A 2GUGA 3OETA 3VPSA 1ULSA 1ZUD1 2P4QA 3PWSA 1V3VA 3CXRA 1I0ZA 5FI5A 2YUTA 4ZQEA 4AJEA 4LGVA 3ZZNA 4TRNA 4CM8B 4CUJA 5IAAA 4MVJH 5L4SA 3RUFA 1H2HA 5JW6A 3EY4A 5JFOA 3V1YA 5B4UA 2AEMA 1N92A 1J0XO 2I9PA 2V65A 2ZQYA 3F5SA 3GN1A 4ZHSA 2QX7A 3ZV5A 3ZU5A 5F1PA 1I3NA 1LDBA 2QRJA 4CM4A 4UULA 4XGIA 1DB3A 3Q9NA 1CQIA 5GZ1A 2HJRA 1KVSA 4BNUA 4YRBA 3GDFA 1A7AA 4CQMD 1B14A 3FI9A 4TRMA 1H6AA 3K73O 4J4HA 3HWRA 1LA2A 2G5CA 2VNAA 4RO0A 2J3IA 2Y1FA 3ULKA 3JD3A 1G0OA 4FGSA 2RCYA 1HZJA 5T73A 3EK2A 1HLPA 1M6HA 3W4IA 3F4BA 1KY5A 3RFXA 5U1PA 5CDGA 3R3SA 3GVIA 1E1MA 4FIZA 5ITVA 1PJCA 4A2CA 4ITUA 5IFLA 3GFBA 4HADA 4G65A 2DPHA 3LYLA 4YT4A 1NHWA 3EDMA 4B8WA 4C7KA 2J5RA 1TVEA 3QVSA 1MLDA 3IP1A 2VHWA 1EQUA 4YJFB 3DZGA 4Q3DA 1CRWG 3GUCA 4NBTA 3VZQA 1S6YA 4BIIA 1BDMA 4QFCA 5DBFA 4M49A 5U4QA 3DOJA 3FR8A 3WS7A 4CMKA 1JWAB 4AVYA 3BYZA 1DJNA 1W8DA 2OO5A 1GUZA 4DXHA 4YAGA 4A0SA 5A5EA 5L9AA 2DAPA 3WB9A 2X6TA 2A9FA 3O03A 4HFRA 2Q1WA 1T4DA 3PJFA 3PGJA 1CQJA 4O0LA 4MIOA 1PZFA 2ZCUA 5IXSA 1MB4A 3JYPA 4J1QA 1Y5MA 4MOWA 4PLWA 5A9TA 1JKFA 2QHXA 3L9WA 1ML3A 4BO7A 2A35A 3FTPA 1Y9EA 4LVCA 1SB8A 3PI7A 3RC1A 4KTTE 1GD1O 3KLPX 4LVUA 4PFJA 5L7YA 3W4JA 1DRVA 1BSVA 1F8GA 5H83A 3HQ4O 2QG4A 3AUAA 3QVTA 2HKIA 3EGOA 2Y66A 3N58A 1D4FA 3ZWOA 3V2UA 5BSEA 5I8WA 2VRCD 1P3DA 5JMPA 4WNCA 1UDCA 3OEYA 3JD1A 3LU1A 4BGIA 1PEDA 2BLLA 5IZ4A 1U3VA 1YWGO 4HNGA 4WLVA 1U4SA 2D4AA 4OIMA 3ZV4A 4PG5A 3AFNA 3RSHA 4BO1A 4MVJP 2YV2A 1X15A 4EEZA 1E6EA 5ADHA 1QKIA 3ENNA 4DMLA 2O3TA 1OC2A 1OBFO 2NSDA 3LSYA 2B4TO 1A72A 3PHLA 4NJMB 3WTBA 3L6EA 2VHXA 1NX6A 2HMSA 4JXKA 2ZATA 2EP7A 3ZH2A 2DPGA 2FOIA 3C1OA 3HFSA 2X0JA 2E48A 3GZNB 4OSOA 5T8KA 4DLBA 1M66A 2CMDA 1P44A 1KEUA 1P31A 4XYEA 1T1SA 4GKBA 3VH1A 2NUAA 2O7SA 3NX4A 3VTFA 3MWEB 4R5MA 4GVXA 3WGQA 1XELA 1E3IA 2VQ3A 5EIOA 1DLIA 4M54A 4CUKA 4NK4A 2FPPA 3WQQA 2Y93A 4GVLA 4ZVVA 1NVMB 4S1VA 3RFVA 1LRLA 1KIFA 3F9IA 4IZIA 1J49A 2CNBA 4HFJA 3B1KA 4RPKA 1E1NA 4IDBA 2EKLA 1V0JA 4BMSA 3GGOA 5COQA 1EUDA 4PRKA 1HLDA 2PWZA 3U9LA 5CEEA 3JYOA 3W6ZA 4DREA 4XQ9A 4XX0A 3RI3A 4CLOB 5J23A 1ZCJA 4F45A 1GPJA 4AJPA 2DFVA 3KRTA 2ZIZA 3PLNA 3ZWCA 4CMJA 1GADO 3H9UA 3JQ7A 7ADHA 1NAHA 3ON5A 5KJEA 1RWBA 4P4NA 3DZKA 1P1RA 1P74A 4R68A 1YONA 5DOVA 1CF2O 3ZGYA 3PP8A 1A4UA 3Q3CA 4J9UE 2W2KA 1DC3A 1N9GA 4NBWA 4ID9A 1HRDA 3EZYA 4K6CA 2Y1CA 3FPLA 3PIIA 4HX5A 4OAQA 3H9EO 1E3SA 3GDGA 1A71A 4RV9A 1U3WA 1XYGA 3NTOA 3QY9A 3DZFA 3UN1A 3OEWA 3PHIA 2O3JA 1DC5A 4YAJA 4CV3A 1VRWA 3RQSA 4E6PA 3RC2A 3F47A 4I9HA 4RDIA 3KYBA 4TSKA 3KBOA 5IDYA 3MJEA 4KQXA 4XYLA 1KS9A 2BGKA 4XEHA 4CPDA 3ANNA 3ZWPA 5JYEA 4DLLA 4TZKA 4YXFA 1EDOA 1YB4A 3GA0A 3DBHA 1FDWA 1C1DB 3WBBA 4E0BA 2VTDA 3M1AA 1KBZA 4QXMA 1M2WA 4FFRA 4WLNA 3ZWBA 4ND5A 1GEGA 4UVDA 2O3UA 1CJCA 2HMUA 3L6DA 1N7HA 5A3VA 1SZJG 2Q99A 3WJAA 2CF5A 3D5QA 2OZPA 3BZUA 3HUDA 2GASA 2R6JA 3U4HA 4BNGA 2VWPA 4DLAA 1E6WA 4HUJA 1WMBA 3HB5X 3K96A 2HMVA 2IYPA 4AJ4A 4E4YA 1K2WA 2JFGA 1DC6A 4KUGA 3VKVA 4YACA 3L07A 3ZNNA 8LDHA 1NR1A 1I30A 1UP6A 1BXZA 1F0YA 1PZHA 3F3SA 3G0OA 2DTXA 3ZNQA 1AXGA 4B8ZA 4XB1A 3H2ZA 4INAA 1ISFA 2D3TA 4RDHA 3AK4A 4D46A 4U8GA 1QYCA 4L75A 3DO5A 4N5NA 3D3EA 4ZQFA 2X0IA 4IMRA 3CH6A 3A06A 1JAYA 3AI2A 4PZEA 2VYVD 1VLLA 5JXWA 5FFFA 4YRAA 2YDXA 1H93A 1PL6A 1ZKMA 2EKPA 3GFGA 1HETA 3PJEA 2XXBA 4C4OA 1BW9B 2Z1NA 4DL9A 4PLTA 5L7TA 1LDYA 3DBRA 1SMKA 5AQ1A 3OJLA 4KDEA 3PYLA 1GZ6A 2AMFA 4MIYA 3GEGA 4KZPA 2UV8A 1E7SA 3EAGA 3ONEA 3C24A 4R1UA 1LC0A 4R41A 3DMYA 4ESOA 1KERA 1P1KA 1U3UA 4NDNE 4GGOA 4PRLA 3BHMA 1H9AA 3O9ZA 2P91A 4Z0HO 2JL1A 3FRJA 3U49A 2FRDA 4IGEA 3WGOA 1XWFA 3JD0A 3AOEC 2NV6A 4WK6A 3C3XA 5K6AC 5BSFA 2PLAA 4JP2A 1ZK3A 1J4AA 4CMHA 4NMHA 1ENOA 4I08A 2WSBA 3ANLA 3OA2A 2FSVA 1G6KA 5BQFA 2B4QA 4DGSA 3MTGA 4FC7A 3RBVA 4JN6B 2AG5A 1DIHA 1LNQA 4HP8A 3AY7A 5EMHA 5TJ9A 4E30A 1NHGA 2X0RA 2EV9A 1XQ1A 4Z9YA 2DLDA 5JYFA 4UVIA 1RM4A 3WFJA 1NQAO 4BNZA 4G5HA 3F4LA 2DTDA 1E6UA 1PZGA 3TWOA 2ZTUA 3VKUA 1OFGA 2EGHA 4ONEA 5EJ2A 4AFNA 4QT0A 1PGQA 5DF1A 1BXGA 4FSHA 2EGGA 1SB9A 3NT5A 2C2YA 4ZICA 1BW9A 3MJTA 4NU5A 3H5RA 5DDIP 3L4SO 1FF9A 1O5IA 3LT4A 4MPDA 4BQRA 2B5WA 1Q7GA 1NPYA 4FQ8A 1B8UA 3NT4A 2ZYDA 1Q0QA 3ZN2A 4WE3A 5T8KC 1YL5A 3S2IA 3JQ8A 1KVUA 3OMLA 3WXBA 5L40A 3ZWVA 5A5FA 3WNQA 5JE8A 1I36A 3BTVA 1Z45A 5K6AA 3KXDA 1CIVA 4AG3A 5A06A 4ZJUA 4JQCA 5B12A 5JDCC 4Z3KA 5FI3A 3L6OO 1EE2A 3DFUA 3V1TC 4W82A 2UUOA 2VYND 3TOZA 5FF9A 4JROA 2I67A 1AHHA 1QG6A 4PG6A 3WGYA 1DIGA 1GUYA 4R1SA 5EL0A 3K6JA 3WDSA 4BNLA 2AE1A 1IUKA 4I9NA 5IZCC 1RM0A 3H65A 4KQWA 4CQLA 1NPTO 4IXTA 2CSUA 1IHXA 4B3IA 2IE0A 5JY6A 4B7XA 1WDKA 3C8MA 2QQ5A 5JCJD 3CMCO 3Q2KA 4D43A 3INGA 3EUWA 1B16A 4L4XA 1Y6JA 5JYAA 4HY3A 4PGFA 1T2CA 3LC1O 3ZDFA 2P68A 4II3A 1PQWA 1T24A 3QQPA 2PH5A 3I52A 2AQ8A 3KZVA 1AHIA 2NU7A 2WJPA 4QQRA 2NQ8A 4U6QA 1TB4A 3LK7A 4BNKA 3AM4A 5AOVA 4EDFA 5DOZA 1U7TA 2ZB8A 3GY0A 4FPXA 4BNIA 4GMGA 3WYEA 3I4FA 4LW8A 1HE4A 1LSJA 3RUIA 1PZEA 5IF3A 2AQHA 1DXYA 4R4JA 3WG9A 1X14A 3QW2A 2DC1A 1E92A 3GHYA 3WOHA 1KC3A 4LRSB 3EW7A 4RPJA 4J1TA 4PZCA 4GX2A 4BV8A 3DDNA 1ZFNA 3WFIA 3ETEA 2E37A 2GDZA 2Q45A 4CMEA 2C07A 3BMNA 3L9XA 2OBYA 1TA4A 1PS0A 4O6VA 2J8ZA 1RPNA 3I9OA 4DIBA 5EESA 2B69A 3EVNA 3D0OA 5L3ZA 5JAZA 2VUSA 1NFQA 3DBLA 4RL6A 1MX3A 2F00A 4ROSA 3AY3A 3PDJA 1BXKA 1PJBA 1C14A 5G0UA 5G0TA 1PJ3A 3DWFA 4PLPA 3RUAA 2GD1O 2XAAA 4R5HA 4H16A 3GG2A 5K0ZA 4IDCA 1EQ2A 5TNXA 1XA0A 3AW9A 4BMNA 4D41A 2VHZA 3DQPA 3I9KA 2Z1MA 2JCXA 3I9NA 4F3YA 5AXDA 2WYWA 5AXCA 1BHSA 5FEUA 3STHA 1GTMA 1VKOA 1LJ8A 3JD4A 3RBZA 3MJ4A 4XZ3A 1UJMA 2NU9A 4ZU3A 1YH3A 4YBZA 1ZEJA 4AJOA 2BF7A 4J0FA 3K2EA 4JBGA 3IUPA 4CMEC 1DFIA 3SC4A 3G79A 2GN4A 3MWDB 4Z0PA 2EKQA 2D8AA 1LQTA 3C1TA 1E77A 3F46A 3PQFA 2WD7A 1PWXA 4KWIA 4DYDA 3HDJA 3H3FA 1FMCA 2Y0CA 4U0JA 3HN2A 2OMEA 3WYBA 3OECA 1F17A 2UVDA 1SEVA 3UKOA 1KOLA 4IJKA 1KY4A 1KYQA 1FJHA 4Z9FA 4H7PA 4AJ2A 4M86A 3TSCA 2DTEA 3ZWXA 5A9RA 4RZHA 1O95A 3WYCA 1D7OA 4EZBA 3BMCB 3S2EA 3PGXA 1FDTA 2ZQZA 2BFMA
chains in the Genus database with same CATH superfamily
1NUSA 4MKHA 4QDOA 3JQCA 3TLXA 1Z62A 5LZ2A 2BFAA 2WIDA 1TZBA 3Q0EA 3I72A 3P9XA 1N2IA 3PFNA 4MWSA 4UHBA 2HN9A 3H8WA 1XLTC 2TMYA 1QGOA 4I8DA 4G0MA 4MINA 2QM8A 4HTAA 1RXCA 3S2UA 4C88A 3IT3A 2CF6A 4S12A 5CA1A 4Q4DA 5BN4A 5LXTA 3TLZA 4JLDA 3A4IA 2P0AA 2BJVA 3FNEA 4UAUA 3S4YA 5CGQB 5CCEA 5KHOC 1GLVA 5CDSA 3BMOB 2X0EA 2J0UA 5K2OA 1XFAA 2XQJA 2P4UA 4LDNA 4X84A 2C58A 1Q19A 1KJIA 3K0SA 2LE0A 4UNPA 4CYMA 1WM1A 2R0QC 1AGYA 4YMWA 1I94B 4GGMX 1R3DA 2FSIA 3EIFA 2ZJ6A 3NCHA 4MRRA 3FOWA 4GMKA 2C2KA 3ENKA 1UZLA 3WIDA 1OBVA 1E2IA 2PXHA 1KE2A 4CLDA 1O5OA 3QWAA 1KDOA 3WYFA 1A8IA 1G98A 3IJRA 3EPKA 5LM3A 1YZFA 2PYDA 1LX6A 2C9MA 2SECE 3BMQA 4Q9AA 2ES4A 4GOND 4BWVA 4WINA 3IQDB 2VJNA 1BXRA 3L0BA 5ALEA 3AZOA 3E8SA 1SHKA 3DT8A 3GFPA 5TARA 1ZA1A 1O94D 1TKRA 3FJOA 3Q3JB 3RU3A 4B7UA 5K0TA 4D25A 3TZCA 4WADA 1O8CA 3MUEA 3BL8A 3KKLA 3HRIA 3V34A 4NPAA 2RHCA 4R31A 3U17A 2JF0A 1LPSA 1HXHA 2G4CA 2VP9A 1HX7A 1M2HA 3U61B 5AMXA 4DF3A 2ZPUA 1ZISA 2PE5A 2VJDA 4YCCA 3TKLA 4IFTA 1QVZA 4I4TF 1QH8B 5F9HA 3ORHA 2LWIA 1RABA 1OROA 1QZXA 4HPWA 4JZKA 3LC7O 1NJ6A 2C4VA 4RSMA 3RHSA 2Z4SA 3KKPA 1JMYA 1NVGA 3DW1X 2QTWB 2CLHB 3RB8A 1KRWA 3LQYA 3TR0A 1Y8QA 4WK2B 1J21A 5AI6A 4ZD6A 4LTNA 5JXIA 1R4NB 1Z7GA 5K3SA 4D92A 4BASA 5AI4A 3TG2A 4DB4A 4AY6A 4CLRA 4V1CI 1UPBA 4P3NA 1I4OA 4EJMA 3JYQA 1WBDA 4ZT4A 3TUJC 1QIMA 4F3TA 1RI1A 3E1SA 1L5ZA 5K0LA 1YR3A 3K8ZA 1YS2X 3TJRA 2AVNA 3TLGA 3L4KA 4WJKB 1XO1A 1LJUA 1YDMA 4JENA 3DZ2B 4L5IA 1HDYA 2XQIA 4D8XA 4HNHA 1W93A 1GSAA 3LECA 1WV1A 1ISRA 3A58B 3IC5A 4L3OA 4DANA 2VAXA 5EZYF 3V80A 2I03A 1JE1A 2VJAA 1D04A 2ZRIA 1ECCA 2ZRDA 3QOYA 4WZAE 1GYQA 2CC2A 2XOKA 1CDOA 1RBMA 1SD5A 5D3KA 1CWUA 2OOSA 3HZRA 1PL7A 4AX8A 5DMXA 4GDFA 3QVJA 5H4HA 1ZVJA 2A0YA 4KPYA 5I5EA 1NV8A 1ZOLA 3KB1A 4PAGA 1S4QA 2QP3A 2ZUUA 1TW3A 1U7WA 4B0OA 4PWYA 2I5PO 2BTEA 2EFCB 3IWCB 5A7GA 4ME6A 1YE3A 4C1NA 3LLSA 5EI5A 4PZ9A 1Z17A 1WXQA 2ZSDA 3R7DA 4BUCA 3C6QA 1E9CA 2WQ6A 3SHFA 1GEEA 1KAGA 3EULA 1EZ4A 4RQAA 5LMUB 4JCOA 3HA2A 4B6OA 1JXQA 3B52X 2FWRA 1WE2A 2J48A 3QW4B 4GPIB 2NVBA 1C7IA 1FXWF 1I5RA 1Z4IA 2QIPA 2VXBA 5FUXA 6NULA 2XZDA 3LPNA 5FYDA 4DMCA 5T41A 2V4ZA 4G3XA 3T94A 3KQWA 4TZ6A 1H1LB 1T2FA 3FH0A 4AM8A 3W6NA 2EEPA 2JH9A 3WIEA 3FOZA 1B7GO 3IVXA 3VO8A 1IUPA 3L06A 4G0XA 4Y2PA 3GGGA 1VRVA 2Q6LA 3HVJA 1ZD1A 4UM9D 3S6JA 1N2SA 1C30A 1CTQA 3BZBA 3MT0A 4K40A 2QJWA 4NZPA 3RTAA 5B7PA 3HWWA 4YUXA 5E3JA 2WYVA 2P77A 5ICFA 4ZEXA 3RYIB 4CI0B 3MWDA 5DN6D 5JC8A 1N6OA 1PR4A 2PZLA 4HAWA 4WZAB 5C3UA 1KTIA 3PB3A 4PXYA 4FJ0A 4L74A 4UPVA 1KEWA 2PR7A 4GXQA 1IONA 3I4LA 2PBRA 4QOJA 3O9MA 4NJMA 2WJHA 2JJ1A 4DUPA 2PZKA 3VYSB 4LECA 3IT0A 3FCAA 4MGIR 5PGMA 4EVRA 1NNLA 2R7LA 2DHRA 3GJTA 3DZJA 2TRSB 4OXIA 4RC9A 4HDSA 2DRIA 3P9YA 2FTKE 2QR3A 3LQKA 4F6CA 1Y3CE 3A7DA 5MN6A 2NO4A 4IV5A 4PBTA 1FDRA 1E2FA 3L8YA 1RHRA 3E58A 4UHCA 5AYVA 3SIXA 4UZFA 4UJ5A 1TCBA 3ASYA 3IDQA 1M9NA 4AQYB 3ED5A 4Y9UA 3TRFA 2I2CA 3DBHB 1Q15A 3C3WA 3OURA 1NG1A 2F8LA 2QU8A 4I1UA 4QUHA 1VLHA 2GN8A 3UOGA 2AN4A 4ZK2A 2XXAA 2Q4EA 2X5KO 1K5DA 2HWUA 5DEOA 3U3ZA 3U3OA 4N5DA 2P1RA 2CY0A 3DM9B 4RTQA 5G41A 4HDRA 4JNKA 3SPXA 3PHHA 3RFUA 3GVCA 5B30A 1RBQA 1ULUA 4ZARA 3KL2A 2WLTA 5G0SA 3ABQB 1W76A 1AHPA 5DM70 4MW9A 3HABA 1ETUA 1NXTA 3CZRA 4ER6A 4RMIA 3RVRA 2Q4RA 3WNVA 1KJQA 3TL2A 1L5MA 3HB0A 3NV9A 1UBNA 4WNAB 4WRRA 5GOTA 4H17A 4YV7A 2GM4A 3DZ5B 1J24A 1DAIA 1JDJA 4QBIA 2DUUA 2PEYA 2YKGA 3FFXA 4G56A 4IJMA 3SQNA 1TYAE 3Q8MA 1KSGA 3F6RA 1TIPA 2JDID 4JMPA 1SU4A 4NMXB 1NC1A 2EQBA 3B6EA 1P2VA 1XKTA 3GARA 4UTXA 4GLBA 3UT6A 4LCBA 4XWYA 3GNLA 1DOAA 5E3HA 4KQMA 4J0CA 3N0VA 3IBSA 4W6ZA 5EUBA 2X7XA 5A02A 1FP7A 3AESB 5KDLA 4ZU1X 1A27A 2BGJA 3EOBI 5HG0A 2ZI5A 1PFYA 2OCAA 4CKYA 1U9IC 2PRKA 1NF2A 3DOCA 4DHWA 2AW5A 1ZS9A 2YBEA 3KV3O 1C1DA 2E55A 4MTCA 1GPYA 1X19A 4LKRA 3IV7A 3G3EA 2FUCA 3N3BC 2CJPA 4BNDA 4WW0A 2NZJA 3GPLA 4C21A 4KXYA 2JA2A 4YGXB 1OQAA 1N8NA 1R12A 2Y1LA 4XTCS 5EUCA 4BEBA 1X9IA 3HACA 3IVAA 4NNOA 1CUGA 2YWBA 2Y1EA 2QYTA 2C5HA 2HAEA 2F8MA 3IURA 3H1FA 4AUEA 5DIFA 2AR7A 3UWOA 5DGIA 1C5KA 1SGWA 1AUQA 1PJ2A 2XEDA 3OPNA 4GI1A 4CV0A 5ETJA 4JP3A 4QNMA 5HF8A 1P9WA 3PXEA 1YZUA 3ILVA 1NLFA 1FLVA 2P6RA 5GVSA 2PH7A 1AXRA 1FX0B 4OXNA 2PZFA 2RAUA 1WMAA 4LHZA 4W7IA 2I4IA 1W36C 4R9NA 3KAQA 5F5XA 2FFQA 2ZDQA 2CVQA 3EJWA 3PTAA 1OMOA 4CIDA 4ZV4A 4IMIB 5IAKA 3AEUA 3BWYA 4ISBA 3ORFA 4DJ5X 1PK8A 1T43A 5JADA 4OX9B 5LUAA 3CZ4A 2YW9A 4QYWA 1G291 5SY6A 3K9HA 3F90A 5I9TA 4EFMA 2RDMA 1IZ7A 1YI1A 2AYXA 2CXHA 4NATA 4ZDIA 3TZ6A 1BCRB 3GCWA 3GMTA 1YR7A 1G5HA 2YYAA 1BKDR 3B3AA 3ORSA 5CX1A 5JD3A 5BVHA 3ADBA 4O2RA 1GG8A 3EVDA 4Y9SA 4MGYR 3GQBA 4E1VA 3AUTA 3LYAA 3WLTA 2C95A 3PNOA 2LCQA 5BUCA 2JGMA 2OGWA 3E53A 5JR3A 1C9DB 4GBJA 3A1CA 1P5JA 4XDHA 4ALJA 1Z2CA 1HDIA 4Q02A 4J0QA 4LDZA 2Z5GA 2GFIA 1ZNYA 1MFPA 4BQQA 1L7BA 4G5YA 5DWVA 1F06A 4C0XA 2Q2VA 4ND8B 1OFUX 3VVCA 2PFSA 2R11A 3MILA 3ORYA 3ADCA 3D6HA 4LYDA 1M2OA 1YC2A 3N76A 2I87A 1M2NA 2IV2X 3G88A 4KO1S 3G5UA 2I3BA 4AY3A 1FSZA 5DGTA 5HTOA 1FTSA 1OX4B 2PLNA 1PVVA 2G9UA 4JSRA 1SQSA 5A9SB 1E9RA 1XJ5A 1BFDA 3DQQA 2C2HA 5DNYB 1IOWA 1Z06A 4LYHA 4HAZA 4UREA 3ESRA 3INRA 1YZQA 3WWZA 2VPXA 3LQ4A 2VQEB 5J2TB 2GA8A 2IEGA 3DBRB 1D4OA 1TT5A 2GSWA 3OPMA 2AJ8A 3TNDA 2AOTB 3ZWMA 4US2R 1AY0A 3WGHA 5KMGA 3QFCA 2PXAA 4Z3DA 1COWD 1QV9A 2L0XA 5J9GA 1I4EB 3I2GA 5DTEA 1VYVA 2YY7A 3ZVRA 1E4YA 1H69A 1RJFA 2QBYB 3R7WA 3NALA 3ZG6A 4QZVA 1L4MA 5K3FA 1WTAA 1J8QA 2W00A 3ECCA 1SXJB 1R5JA 1YO6A 4H3KB 4X00A 1P9LA 5LBTA 3L7YA 2ZAGA 1T5SA 1RMTA 3OKPA 3VKGA 3LVQE 1UMCB 2EJVA 5AW2A 1GGJA 2E4WA 2Q3FA 3B6MA 1LVUA 3DS8A 1X1EA 1PFQA 1K4YA 2F17A 3GWGA 1U3FA 3ICVA 2FMUA 2I33A 2RH8A 2O3RA 2EAUA 4RZSA 4BTLA 1NDUA 4DLSA 2KQUA 4PPNA 2QL9A 3CUVA 2Q2WA 4C01A 1PYDA 3EEIA 4QIHA 2Z6QA 4EB0A 4CKWB 3CF0A 3TX2A 3SJCA 3MJVA 4UHJA 1ZIDA 4R01A 4DDKA 4ZI3A 2DSNA 3KUDA 2DT8A 1O9BA 1YB1A 2C2GA 4KVAA 5JOQA 4N9WA 1HT0A 2GO1A 1S3IA 3KYDB 4GNKA 1CW2B 2PKXA 2Z8XA 3D4IA 4IGKA 3I42A 3ZCQA 2OGZA 4G9BA 1TLFA 3ZOZA 3AEKA 3TLAA 1S0UA 2EGUA 4C05A 2G6BA 5LDGA 4DIMA 3H1TA 4KW7A 4LG1A 1NBIA 5K45A 4I4CA 5LQRA 3AL0C 1L1FA 3ZGOA 1F2UB 2QTGA 1E2HA 4OLFA 1R10A 4GLFA 4I81A 4XQ0A 5J40A 5DXJA 5B1HA 1R4MA 2HBRA 2IZ1A 2WFZA 2AQIA 4YK7A 4BCDA 3K6RA 1Q84A 4DA9A 3ZD7A 1JDVA 4IXNA 3F6PA 3MCVA 2OP0A 5SYNA 4P7GA 1SVWA 3LQFA 4YRQA 2EYUA 4MYRA 4WMLA 3FW1A 5G1OA 2DR2A 4ZQGA 3N2KB 1EGVB 1XMJA 3V00A 3ZR4B 2RJOA 1CUVA 1CBUA 4XPIA 3RJZA 1A69A 3K6KA 1V1MB 2O2HA 4F5ZA 1HZZC 5CCDA 1I3LA 2WJYA 2XWJI 3ZTTA 4GLLA 4BRSA 4FD2A 4Q66C 4Y9RA 4RK4A 3VM6A 4J7XA 3VO2A 3HNPA 1L1QA 2X7HA 2OYCA 1T91A 3DONA 3KR9A 3LLMA 3CR8A 4HLNA 9MHTA 4GL2A 2Y2UA 3N05A 3UFXA 5G40A 3IUJA 2JJQA 5EMLA 3OFSA 5TE9A 3OOYA 3REGA 3T5DA 3UK1A 3V7UA 4CKBA 2HDHA 2Z2ZA 3RC7A 1BX0A 3PENA 3W2TA 3O9VA 1T5OA 2XLCA 4MAAA 3ZE6A 1Q57A 4QEDA 1RI4A 4XB2A 4TL7A 3A28A 1RIIA 2IPLA 3I2JA 3UMJA 3MLAA 3TN7A 1X38A 5FPQA 1W36D 3T35A 2HSDA 5HDBB 1BVRA 1V26A 1GNTA 4W9RA 4ARAA 3H2GA 2XCTB 4KBGA 1EFVB 3KSDO 2ODTX 3RS5A 4YV0A 2KHZA 1G8HA 3KB6A 1K7SN 2Y1OA 3KQMA 2CXRA 1DRKA 3Q1LA 4J1TC 5TLSA 2VJPA 3HRHA 4BNYA 3GLFB 2WM3A 3KWMA 2XUZA 1FDSA 3IBYA 3KM0A 3W78A 4AYTA 4CR8A 2CEAA 2JLSA 2QV7A 3OSUA 4FNGA 3ETCA 3T7EA 2D1RA 4FP9A 3QNMA 1I24A 3K0CC 4YJGA 1Z4KA 4LQ4A 4OGWA 4KODA 3AC0A 4K28A 4NX2A 3ROXA 3DD1A 4DUGA 2G5PA 3JW8A 1OH6A 2VDLB 1B74A 3FPBA 3QPAA 4PGAA 1HRKA 5BXQC 2YQ4A 5T57A 3VR1A 4DC9A 4YJGB 5JT1A 4NNPA 3Q2IA 2FN7A 3HSKA 3GPIA 4FVTA 4L51A 4P3XA 1H8HA 1HE5A 5A1JA 3NH6A 5JXGA 4ARSA 1TXGA 3VOBA 4F1KA 1T1IA 1XCBA 5C8DA 2ZI4A 4Y2VA 1P1BA 3BM5A 3BUSA 3CO5A 3N2KA 4HN4B 3EBOA 4M0LA 3SC2A 1P62B 2BKXA 1BDBA 2X8LA 4ASUD 3TZQA 5ABPA 4YAUA 1IXYA 4G84A 1H5NA 3AI3A 3L01A 3H1GA 3NM5A 4BGDA 5CDTA 1RYFA 3QJ5A 2YL2A 4UVHA 4FDAA 5DLPA 1UBJS 1N4DA 3GVXA 3MT7A 2K7ZA 3OQIB 4ZT2A 3QENA 4I5EA 2PA3A 3SD7A 1WF3A 4F93B 3B8EA 2FZCA 4RS3A 4PLVA 2PKQO 4S0ZA 4TMYA 4XUCA 1OXVA 1PJQA 4WXRA 4AMYA 5FWXB 1ZK2A 3WNBA 1QU3A 1HBJA 3UJ9A 4JR0A 1DG1G 2H5JA 2NXCA 1W75A 1W94A 4KRXA 1UK7A 4IRUB 1G8PA 4UDNA 1X8XA 1YS1X 1U8CB 1Z4QA 1TMOA 3L6RA 3PC8C 2X6RA 3IAUA 4KQHA 1HYBA 1OX4A 2V58A 1QGZA 4FGKA 4Q4AB 4UAVA 4W1SA 5H16A 3WIOA 3WR5A 4B80A 1O4WA 3MTIA 4EW2A 4M7WA 4IW3B 3W6OA 4HYYA 4MPPA 5ITZB 2C5SA 3P96A 5FQNA 2OCLA 2GM9A 5EHQA 4L15A 1FXSA 3O4HA 1BJRE 4KNVA 4BQSA 4M1ZA 4OBBA 1WMSA 1ZM7A 3NJ4A 1NY6A 2E6UX 2VF7A 1K7FB 4M88A 3TBHA 1AN0A 3OIWA 2V7XA 1Y4DE 4EB6A 3GLHB 1XMSA 1XU9A 4IJ6A 3IVMA 4DLRA 3B20A 5DU2A 6YASA 2MU1A 2VT3A 5IABA 2PK3A 3CCFA 3LUPA 4ND3A 1LD3A 5FUVA 2OHGA 3C3AA 4LFCB 2G8NA 1IQ0A 5HWSA 3E8XA 1C9YA 3W8RA 1W85A 5FA8A 2R7AA 5ERYA 2C7OA 2G71A 3H17A 4D9EA 1EWKA 5IK2A 3WAJA 1VPLA 4WOCA 1JPVA 2BL4A 4XJXA 1PWZA 1IY8A 3K0AB 4QDJA 3PRKE 4FBGA 3TQTA 1PR6A 1S02A 1UBLS 1PT9A 4RQTA 4CEIA 3ENWA 4U5QA 1CHNA 1X2BA 1W4RA 2I65A 2NO5A 4WKCA 1DQZA 4M0FA 1OYYA 2ZJ7A 4U2KA 5I47A 3QE2A 1LLUA 5G0WA 1K6JA 3DKPA 3W5UA 4JL8A 3PX7A 1U7XA 2Y0BA 1C7ZA 2VHEA 2D59A 2OHJA 4MRMB 2WVGA 2LV8A 3FKQA 4RZXA 5T3YA 3NM4A 3GIWA 4NYJQ 5FBVB 1QYWA 3KVYA 2A9OA 2I76A 3ZTWA 1M34B 1T9BA 1GL6A 3H5LA 1YE8A 2YWDA 4NESA 2H3HA 1E66A 3P2MA 1UQTA 3T06B 2YRFA 3QELB 2GBGA 4J7UA 3VUEA 4ZYLA 5I6DA 2QU7A 4RPHA 3AWIA 3S55A 2JASA 1DSSG 1IN4A 1L5HB 1PJSA 2CDBA 1QH1A 4FYXA 2XV1A 5F3RA 5A4JA 2DETA 4M2LA 4EBBA 1ADFA 5SV2A 2IXDA 3GRZA 1FSGA 3OTOB 1OH8A 1F7VA 3FHLA 4LOHA 2NU7B 4BNJA 1ZH0A 1DTEA 1WQ4A 2O3SA 2R8EA 1JEYB 1O54A 1XTQA 2EQ5A 2Q22A 4MWEA 4FEYA 5CPFA 3T7DA 2DQKA 3LW8A 4C6TA 5JANA 4OGKA 4N12A 3W2IA 4JU9A 3CN7A 3ZE0B 5FL3A 1I2BA 4IDNA 3UXMA 3EIEA 3GJYA 1Z4JA 2OFXA 3K2QA 5EJAA 5TXGA 5BOVA 2ACWA 2OHIA 3GCDA 3TO5A 1PLKA 3KALA 1M67A 1M73E 1YA8A 4RCYA 4KH0A 1X7WA 5IC4A 3OQMA 5FOSA 1IM2A 1OLOA 1M2GA 3I2FA 4XOIA 2WHYA 3WLLA 2GN6A 2ZIWB 3HU5A 4ZIRB 3I6QA 1DBIA 2LTAA 4QEKA 4ARVA 2ZBRA 1KETA 4RMHA 5FOQA 1HDZA 4UKDA 1QIFA 3UK7A 4KGDA 3GF4A 3V32A 3H1PA 2C7VA 4IWYA 5EP4A 4PPQA 4MW1A 1TZJA 1O1YA 1K1EA 3RVDA 4BOYA 1RHUA 1VI2A 2IH5A 3A4VA 2JCVA 1USUA 3VPXA 4PSCA 4CM9A 3K31A 5BNWA 5KOHB 3RJ9A 5A05A 1TZKA 3R8CA 3PQ5A 3T5BA 2XXJA 3ZJYA 2ODEA 1FS4A 4R84A 2XI4A 2Y6VA 3TOSA 2WVJA 5DLDA 5U9CA 1VSUA 4F86A 1OZ0A 3L40A 3CH5A 1DAHA 4WHMA 4QREA 2RKBA 4XWKA 3P7MA 2ILTA 5B3JC 3KEQA 4MQ4A 2D7CA 5AJZA 4OMCA 3TTYA 1EM8A 3ZDZB 3NEPX 2AJCA 2XUPA 1I2DA 2HU5A 3WWCA 5KVAA 1J1IA 1CS0B 2IFTA 4Y6SA 2OGSA 1Y1PA 1XDUA 4I1PA 1K9VF 1W29A 1Q1EA 1DC4A 3TMAA 4PEVA 1ZJWA 4KWEA 2RHLA 1XCJA 2QKYA 5LZ5A 1NXSA 4IQ8A 1AD2A 1ABFA 2HREA 4ICIA 4MDHA 1RQPA 1U6JA 3T5TA 1L5YA 1UKVY 3PPVA 5A0FA 4CTOA 1YCHA 3EHDA 3K09A 2WF9A 2PGOA 4HQ6A 5EQJB 5K3AA 3KPUA 2AFIA 2BFPA 3ELBA 4KVFA 4Q6WA 1SVMA 3CZAA 2YJTD 1QC5B 4Y2UA 3H83A 5KYUB 1U9ZA 2EXXA 3KLMX 3NYWA 4GX1A 1FSPA 1YDWA 3LIIA 3PEUA 5JYBA 2P65A 2QE7D 4KSBA 3EXHA 2QTLA 3M6VA 1QCZA 4QUJA 4RUKA 4D56A 2C3YA 3ICCA 1CJBA 3U81A 4DNOA 1X3SA 4B5KA 2EF0A 4IVPA 5LZ8A 4IDGA 5JV5A 1QP7A 1A98A 1RHMA 1ZIXA 1ADBA 2P90A 2ZOSA 5LQDA 3C97A 1ESCA 5J59A 1U11A 1PIWA 1CUYA 2CXTA 1V35A 2IA5A 2WOJA 3ENQA 4R0MA 1V48A 3THXA 5CLHA 3VZPA 2PGDA 4ECAA 1SCAA 3LCUA 2QZPA 3MWGA 1E2EA 1OXMA 3H7AA 4Q3EA 3GFOA 1QH9A 4UUOA 2GBLA 2ZYWX 3N07A 3ZDDA 1Q17A 4CEHA 4TMFA 1GAWA 4B47A 3HS3A 1HC7A 2X2FA 1L4YA 4ABTA 1QTIA 2PVCA 4ENSA 1TOAA 1I0IA 1NVXQ 1ZSVA 4NR0A 2RGEA 4QFDA 3RW9A 1IB0A 2CMHA 1ILWA 4OU4A 3VZCA 4JXJA 2VP5A 2Z08A 5IDQA 3SC6A 1IBRA 2FWNA 2QVXX 3A6JA 3DEZA 4BP8A 1YACA 3UTDA 3OCJA 2LP4Y 4PC2A 1Q21A 4DQXA 3HJBA 3UMVA 4UNRA 1E5VA 3AF0A 1HA3A 1TAHA 3NT2A 4Z1MA 3MTEA 4P0PB 3B1VA 1GM5A 2WHXA 3A1NA 3K9QO 5AI8A 3TTVA 1UOQA 2HQRA 3K9NA 1F5NA 2IYYA 3TGWA 3BVPA 1N7JA 1ONPA 1EHYA 1EFLA 1H0HA 2H8GA 3NHRA 5G1PA 5BQXA 4YWJA 1RRGA 2CW5A 2I4MA 3TK1A 2X1HA 1JZSA 3SS7X 1OH7A 1ENZA 3KVVA 2ZE6A 4KOEC 1XTIA 5I7HA 5JROA 3CO0S 3HJTA 3NYQA 3UWDA 1JV2B 2I2DA 4R3NA 2HRDA 3HR7A 4UZSA 4ZOAA 4C7OA 1PI3A 4UNIA 1IJFA 3BB4A 5KJ6A 1RZVA 4NI5A 3DZIA 2NNLD 4RWZA 4YFVA 2GKSA 1P1IA 1IY2A 1HYGA 2FWIA 1E5QA 4P5EA 2XVXA 1VE9A 4CIWA 4M0EA 4TTTS 4B4UA 4Z5XA 1ZL2A 1KYXA 1Q14A 4P31A 2GAJA 5CHEA 5HQ3A 5C7IO 4AY2A 2BEVA 1GGKA 1Z6ZA 2PKWA 4OQEA 1N3YA 2GPNA 2R4QA 3EBLA 4ZFNA 3B70A 2G72A 4B6EA 5JAQA 4KFTA 4ZI7B 1L7OA 1T8TA 1Q1QA 5DP2A 4GRDA 2F48A 4L9WA 4PSVA 3MSCA 2C42A 3SP1A 2XJ9A 4URZR 3W9BA 1I32A 3OHMA 4I7EA 4DPKA 2HO4A 3VQTA 2JLYA 4MUEA 4WOBA 4DCUA 1DOHA 4XRGA 2JRLA 1WBJB 2QIOA 3CH7A 1FNNA 1G2QA 2VAWA 5JBIA 2BGTA 3QLUA 4FEGA 2ZWPA 5BNTA 1U5CA 4NU6A 5EQFA 4MGZR 4RPIA 2F59A 5JJ5A 3BH7A 2WJ4A 4Z0TA 4ZAFA 1EB8A 5AKZA 4RNCA 4DV5B 3G8YA 2YY6A 2HUNA 3D6JA 5LU8A 2Y68A 2G6TA 3EVCA 2BHRA 1E1RA 2RGNC 4N0MA 3TBFA 2G67A 3SJBA 3VGPA 5KU7A 3HCCA 3NUGA 4IX1A 4QODA 5KCMA 5D84A 6PFKA 1Y1LA 4HWGA 4AJKA 1JYFA 1EUYA 3ZDAA 1HGXA 1JSCA 3SDBA 1CRPA 4N76A 4OI1A 3MLBA 2IWHA 1V7ZA 4KIFA 2CYAA 4R05A 1UZMA 1EFTA 1X7ZB 1Y63A 3QFHA 4Q3NA 5FRDA 4CL0A 4RTLA 3NWEA 2C7PA 4Q39A 1BZYA 1UJNA 1D5CA 3G2OA 3EPLA 1WW3A 1JU4A 3Q6NA 1WDWB 5LXTF 3LGSA 2A1IA 4UUQA 1NVAA 2I7VA 1G5PA 4AKTA 1KZGB 3ME5A 4WD3A 5A0TA 4KIWA 4YJ2B 2OY0A 1QR2A 1R4NA 3OLCX 2JBHA 3ADDA 2NVUA 3CUUA 4ALNA 2F43B 4F85A 3SK0A 2H1SA 1U5AA 5TRTA 3ZVLA 2H4HA 3ZY3A 2Y1GA 1ZHHA 1G8JA 2QG6A 4GKAA 4MS3A 5LA6B 4CKEA 1CP2A 2Q3MA 3R3WA 4WXHA 3NWBA 1O0CA 1DQSA 4YDHB 1EWVA 1KIAA 2QRMA 3CNLA 1BGVA 1LQ2A 2NVUB 1N3BA 3DCNA 2J7PA 3HKBB 5LUBA 4BC0A 5ECYA 4BO0A 1IVSA 4L4YA 1I5EA 5E9AA 4UFPA 2QTMA 3MGGA 3TAUA 1GXSB 5JC1A 3PT9A 3OE1A 2Q4TA 4Z8XA 1P9RA 2WYUA 3PKIA 1EKXA 1SOMA 1EFVA 3I8OA 2D1FA 1RC8A 5C81A 5PNTA 2VAVA 4AWBA 1RAFA 3LOQA 1JJIA 2V0NA 1V6SA 3RARA 2JIBA 3O38A 1SC9A 4DS3A 3WYDA 5M5BA 5DMHA 4M1TA 2PZBA 2BRUA 1Z83A 2IHJA 2QVZX 1RXVA 4LX0A 4KGVA 4E08A 1RCFA 1BWRA 2C4TA 3SOZA 2DXIA 3DUFB 1XDDA 1Q1GA 3RD5A 3ZHSA 1O0SA 3GJRA 4C6HA 2I4RA 1W8IA 3S27A 1QHGA 3G1WA 4I9UA 3RS8A 1OC4A 1CJMA 2W22A 3ONFA 3R3XA 3L0DA 4O4HA 4Y0VA 1DC7A 2H1VA 3E2MA 4J3FA 4QYXA 4JI1B 1TEHA 5JS7A 1JG6A 1UP4A 2G9QA 4P7BA 4TQGA 1R5NA 5AVTA 1OXSC 2B61A 4W9NC 1XYVA 4LBWA 1PLJA 3FVRA 4U7FA 1VC2A 5GPBA 1C3OB 5BSKA 3BXFA 1PK7A 3MCWA 1QX3A 1WHSB 2ZBEA 3ETJA 3OWHA 4WUVA 3NBQA 4L57A 1MV5A 5AK0A 5ALHA 1FW6A 5K99A 3CU5A 4WGGA 2BFBB 2QN1A 1QAQA 3I6ZA 5CURA 2DHEA 5FTLA 3NUZA 3U4DA 1D1SA 1PJTA 2QVBA 2OG1A 3H6GA 3AKDA 3M6WA 4B46A 2KX7A 3ORQA 3A3OA 4ZVLA 1OXXK 1NL3A 4EGCB 2PH3A 1WUHS 1G0NA 4D02A 3P27A 3ROZA 4OYYA 3OZRA 3OLXA 2J3KA 5JUWA 2WLSA 3E9MA 4DY4A 1WHTB 4FCTA 4NCHA 1JEOA 4FYKA 2QRPA 1I1NA 2IEYA 5LSAA 1ZGHA 3R3VA 1E79D 3E5MA 1QHEA 1V37A 2R44A 2WMOB 2P2CA 2PMWB 5EFOA 4IF6A 5DO9A 1PV1A 1NKSA 1JEAA 1IHYA 1LI5A 1ND5A 2FX2A 5C5CA 1DEKA 3HU2A 2RGYA 4RKFA 1U9JA 1SHZA 1RYYA 4S24A 1KI8A 3QXXA 3ZXUB 4L8FA 4MUYA 5HKBA 3WOVA 3BHNA 1VBMA 2DHDA 5ES3A 2AOVA 2CNLA 1R0LA 2XNDD 1YAJA 3VJMA 1V4VA 1Z35A 1H2WA 1UDXA 3R3YA 4YJ2F 5CR9A 5BV0A 5C80A 3FOFC 1NVDA 3OFKA 1PN3A 2A84A 3OTIA 1FX1A 2C88A 3ZJXA 1YI0A 2N47A 3D6TB 4YMSA 1XYYA 4FFDA 3FNRA 2CWWA 4FCWA 2ZZNA 1HKHA 2CXOA 3A9TA 4CLEA 3WK8A 2A59A 3KE9A 3VU1A 4BIMA 4DNXA 2PS1A 2C0QA 3R5TA 4XD7A 3V46A 3D4OA 3ROMA 3DTTA 4YLEA 1G3IA 2PUEA 1VBFA 3T7IA 2V6IA 1M7GA 2FX3A 4RD0A 4FB4A 5J2TA 1DJMA 2QI9F 3HZZA 4OKSA 4EF4A 4KMSA 3OOJA 4AUKA 3IAAA 5JJCA 4MVJF 4BV2A 5ECDA 1DAFA 1W0JD 1AUXA 2HC9A 3JALB 3N28A 4JJEA 3TNFA 3JQ6A 1GAQA 1KHHA 3CUKA 1NFFA 3FHCB 3PC6A 5CM8B 3RNLA 1NTOA 3VZSA 5BMVA 5M29A 2EJBA 1XE3A 3IAS6 1Z16A 9LDBA 4FKBA 4R9SA 4EG4A 1L9KA 1MJGM 2XODA 3D81A 5LJIA 3IKTA 2IEZA 2WZCA 2VPQA 3JQEA 1SZDA 4KO2S 1LXCA 3IP9A 2OZEA 2FFJA 4B4DA 1PBNA 4AJ9A 3ZQUA 5K0EA 3HKEB 4E2FA 3QKIA 1SNYA 1SKAA 3V2GA 3ZJ4A 3IP6A 2BBOA 3O1LA 4WDRA 4BDTA 4V1CA 2R6R1 1XEAA 3N8KA 3UWSA 5J4KA 1W4CA 2HHCA 3JQFA 5IN5A 3VJKA 3VSDA 3CM0A 2PCJA 1NU8A 2NV0A 3FPEA 3IRUA 2QZSA 2HK6A 4DBZA 3KLOA 4DQUA 5HZGA 1VFNA 4CXMA 2G04A 4JCCA 3AR2A 4X85A 2YOFA 3UPTA 2SCUA 5HMMA 5AT1A 1F2TA 2WOOA 1UDWA 5DH9A 2XZOA 1UWCA 2RARA 1XTKA 3QA3E 2QD2A 3GJXC 3JASA 2AKYA 5ILQA 1MB9A 3KOUA 3L1HA 4CW7A 3E0QA 3F1LA 2NTNA 3R9KA 2OHXA 1WULS 1OBOA 1CUEA 2PD3A 2Q50A 3EG9A 3ZCXA 2QVYX 4JNCA 4DQLA 4HUTA 4XR4A 5F7XA 2QMEA 2QR5A 5EJGA 5HA5A 3WGJA 5IYZB 2QI9C 3A9VA 5IKXA 1EUQA 4BBPA 4C76A 2L69A 4OMUA 5B6JA 1F1JA 4P4SB 1WO8A 3MELA 3A6EA 5CRIA 1L5KA 2QTNA 1AZTA 1M2VB 4RDCA 1FX0A 3UMRA 2AJDA 3K9LA 3THXB 4Q3OA 4JWTA 1T9ZA 3SFTA 4BATA 4XLZA 2Q8QA 5DYTA 2HNBA 4ZCLA 1VE5A 3UZUA 2QN6A 4QRIA 4L4SA 5EE9A 2OT3B 2PLWA 3G49A 3HN6A 3JQRA 3NASA 4MUKA 2G06A 5B2FA 2Z2XA 3EQ6A 4ZO4A 2H2HA 2ECQA 4AD8A 4C29A 4DYVA 4QATA 2ZI7A 1JPNA 1JVSA 4HCJA 2OBFA 2DHCA 1QRRA 3CGGA 1SXHA 4TSFD 1JALA 1YQXA 821PA 2JI9A 3CLRD 3GT0A 5FNVB 2EJWA 4AI6A 3UATA 2DT5A 2IOFK 1C0IA 4JODA 4Q3BA 1CF4A 5I9LA 5FTWA 4MVWA 3L3BA 1MRSA 4V39A 1NOKA 1VL6A 1N5MA 5ESXA 4BL5A 2O8BB 1IN5A 1L6IA 2MR5A 1L4BA 1FNBA 3A32A 1L9XA 3K16A 1U0FA 1ULAA 1VSTA 1U1IA 1BG6A 1Z6QA 4LJ6A 4N7RA 3KOXA 1RQXA 3EVEA 4ZVNA 1LPPA 4MULA 1JQ5A 3RVKA 3GDOA 2JATA 4B2YA 1MOQA 2QTZA 4ZAYA 4FGLA 2I3AA 3IQEA 2R7MA 4FK8A 4NCXA 3GEBA 2GAAA 2NT3A 2NP7A 1A8HA 1F4VA 2D74A 4QXAA 2ECPA 1DHTA 1IOZA 2O4CA 3OBBA 1C3LA 1CNFA 4FX2A 4TKLA 1QBKC 3RU9A 2I8CA 1HZZA 1RP7A 3PBKA 3QF4A 2AE2A 2R68A 2HWYA 3G17A 4BJ5A 2FUEA 2C31A 3I9JA 4AQDA 1Q0ZA 4LRYA 3TJZA 1GO2A 5DCYA 5SYMA 1RFLA 1W0CA 4NG5A 4X8OA 1E2GA 5REQA 3I9FA 2IZ6A 1HY3A 3KTDA 3R0QA 2W8BA 1SHJA 2AX4A 4FXOA 2JJ1D 4MYCA 2FSPA 3PE6A 4TM8A 5E7IA 4HDNA 1QS0B 1Y6FA 1R9GA 2GCEA 4EKDA 3CZPA 1U0LA 4DVJA 2SKDA 2IXGA 2G88A 3ICWA 4AJLA 4ZIRA 3SAJA 1OWLA 1X1AA 5B7NA 3P0RA 3OIDA 3W5HA 1JLRA 2P4HX 1RQRA 4M22A 3ZY6A 3EFHA 5EPUA 2REBA 2AWOA 5BPHA 5CXUA 5E9QA 1P7CA 1CQWA 2A57A 1NNI1 2FMKA 4BWYA 3UJAA 2REOA 3EEQA 3G2MA 1U90A 3MYRA 4MWCA 3V3KA 1Q12A 3GNSA 3OEEA 4RPCA 4NH4A 4QJ4A 2YR0A 1E63A 4XLLA 1J22A 5JPDA 2EHJA 2I6TA 4G09A 2MYNA 3NTVA 4HRAA 3WMRA 3SU8A 4DG8A 1F8FA 3EP3B 5F52A 4FC6A 4O3FA 3GW8A 1H9CA 5COBA 5TT0A 3ZEIA 1JHQA 5F64A 3DFMA 1KQGA 2P0EA 4WOKA 2IHBA 3SXJA 3SLKA 3RYHA 3KKOA 4AECA 3I5MA 1NIPA 3HDQA 4CKCB 1QG0A 4L8YA 4DR3B 1JR3D 1ST2A 3ANMA 1U8TA 5E7QA 5CP8A 3C45A 4QX6A 1Z2AA 5DI3A 5F3DA 3X1MA 4B5LA 2PKRA 1V2HE 1CUZA 3O0TA 4H7HA 4O4LA 4UAJA 4WA7A 2YMPA 2IOQA 5A4DA 2QTVA 4JYCA 4EVIA 5JJIA 1B41A 1L7AA 4BTVA 5CAEA 3NHBA 3JZDA 5KTKA 1IM5A 3MBOA 1Q5PA 1Y6ZA 3VNQA 1IK4A 2H6EA 3AWDA 2OE2A 3IHKA 3SHWA 2GEVA 1RNLA 3NKVA 3WRVA 5K01A 5D7NA 5GQSA 3V2HA 3DE2X 5FBKA 1TT5B 1XRSB 1GUFA 1DTWB 4FMPA 5LP6B 4W8OA 3H6HA 1CEXA 4K1XA 5IBPA 1A1SA 4KO4S 3AJEA 2JAUA 2YN2A 1T8YA 4ITRC 3DZDA 4UHDA 4WV3A 3WGGA 2X15A 3PCRB 5ALUA 1JUDA 1K9SA 3LL7A 1MU0A 1W4BA 2WZQA 1Y7IA 1L5OA 2PX2A 3HJNA 4HYQA 3IOEA 4B17A 2C7QA 2HIAA 2ODPA 1YZGA 3K1ZA 5G0VA 1J5XA 1K6MA 2JI8A 4TWJA 2GCIA 1AKRA 2KI5A 1W0JA 3C70A 3QUQA 5EZYB 3WL7A 3I3OA 1Z5ZA 5HUHA 2IK8A 4EY7A 2QEQA 3OX3A 2I7XA 4V02A 3UCFA 4UQLA 1R15A 3AR6A 3DYIA 5SZKB 2YV3A 2Q6VA 5M34A 3VPHA 1Q0TA 4EYGA 1HORA 4FGWA 4EY8A 3VVLA 3O7WA 2YQ5A 1MP0A 1QGUA 5DBGA 2F9MA 3ZGNA 1XAJA 2VTBA 1QM5A 1M0EA 5FA5A 2ZSFA 2QD3A 4NICA 3AFGA 4DV1B 2GEJA 1J0CA 2XTNA 4WLOA 1O58A 3IWBB 2GEUA 3TRIA 3IA2A 2GR9A 4KDCA 1A7KA 1VECA 2YN0A 3B48A 3GI1A 3SZ3A 1MD9A 1RD4A 2V6FA 4M89A 5HNKA 2POQX 3C43A 3L8DA 2XIQA 1C2YA 4M6WB 2WG2A 5G4KB 2AS0A 1MIHA 1FSFA 3QLUC 5FBLB 5FX2A 4QASA 2R00C 1XKXA 1NMYA 3EIWA 1L5NA 4RTOA 4GZLA 1E2JA 3BN3A 4A1FA 5GZ6A 3COPA 1KMNA 4YJ3B 4HUQB 1G60A 1GVNB 3MWLA 4KQFA 2OAQ1 5JNSA 4NXNB 2ET6A 1H66A 4H4CA 3IFSA 5KPDA 2OGUA 3G2JA 5F3WB 1TQHA 4HNSA 8ATCA 3GRVA 1X6VA 3LQ1A 1DBPA 3L93A 2NW6A 3HCBA 3ZDQA 3BXZA 2JGRA 4I2VA 4QSMA 3TTXA 1YK0A 4E09A 2IPAB 2JKZA 2VQDA 4EG0A 3R6DA 5IT9A 3ER6A 4TWIA 2ZJ0A