4NHEA

The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with nadp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVSQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFEAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, Gfo/Idh/MocA family
publication title The crystal structure of oxidoreductase (Gfo/Idh/MocA family) from Streptococcus pneumoniae TIGR4 in complex with NADP.
rcsb
source organism Streptococcus pneumoniae
total genus 113
structure length 325
sequence length 325
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4nheA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nheA01
4AJPA 2YV1A 2ZIZA 1QRRA 4WK6A 4BMNA 2F00A 4RDIA 4ZU3A 3NTOA 4YJDA 5HBRA 4NBWA 3TN7A 3LK7A 4IMRA 5JY6A 1Y81A 5AOVA 4QSMA 4BOYA 3CINA 4ALIA 4HFMA 3CUKA 4IM7A 5TSDA 1MA0A 3GEDA 2PZMA 3BZUA 4CR6A 1GYRA 1Y1PA 4O6VA 2PV7A 1EEHA 2Q22A 3DAPA 1U7HA 2WEKA 1Q0QA 2J5RA 1EVJA 1JKJA 3PHLA 2P4QA 8LDHA 4IINA 1C0IA 3DTYA 1KEPA 3SBOA 3I9NA 1HXHA 4MVJA 3TZCA 4KTVE 1F8GA 3EHEA 2OXIA 1KC1A 3U5TA 1LSUA 4DC0A 2AEJA 3N74A 1T2CA 4RVGA 1JDJA 2PD6A 1XU9A 4XGKA 1EUCA 2PD3A 3JTMA 2X22A 3NUGA 2BGKA 1ZFNA 4NU5A 4OXNA 1OC4A 4PLPA 4WJZA 4Z6KA 1GU7A 1Y8QB 3N7UA 4CLOA 1CF2O 3O8QB 1K89A 3JV7A 3EC7A 3GAZA 4BO1A 4PG7A 4WLFA 5FWNA 5C5IA 4AJ2A 1YB5A 3V2GA 3JQGA 5B4VA 4BGUA 4IBOA 3OHSX 2HJSA 1QG6A 5AXDA 3DBRB 3U4HA 2ZCUA 1I36A 4GH5A 4BKQA 5KTKA 3KHUA 4I9NA 1E6WA 4RZHA 1A9YA 3DQPA 3VH2A 4J90A 4BNNA 4XA8A 2X0RA 3QJ5A 2CVQA 3IP3A 1XQ6A 4NI5A 3TL3A 2C2YA 3P5SA 4AJNA 3B1FA 3CXRA 4L8VA 3OQ6A 3GQVA 3U9LA 4K9DA 4YCAA 1A7AA 2HK7A 2Q4EA 4M86A 2OUIA 4RV9A 3VPFA 1NHGA 3KYDB 2JHFA 2GYYA 2XXBA 3WG9A 3P19A 2CVOA 3F3SA 1W4ZA 3RD5A 3VAZA 1E3LA 3GPIA 3IMFA 4ZQGA 3JYOA 3CMMA 5KJFA 1YONA 3E5RA 5DDIP 1VI2A 1YB1A 4CV2A 2B4QA 4ZRNA 1UP7A 1XKQA 5BNIA 2X9GA 2J3JA 5JSFA 2FZWA 4ZICA 5HRUA 4RPJA 4LMRA 3OECA 4N5MA 3D0OA 4IZIA 1DRVA 3RWBA 1WAMA 2B69A 2FY8A 3LDHA 4NDNE 4RF5A 2RH8A 1ONPA 1LQUA 4KQWA 2VWGA 1E3WA 4MO2A 4K6CA 1GTMA 4Z0TA 4DBZA 3QP9A 2RHRA 4MP3A 2SCUA 1N7GA 1B16A 5C37A 3CPSA 1MXFA 1C1DB 4YEDA 3ULKA 4II2A 3CH6A 4J7UA 2D2IA 1H0KA 2CNBA 1U3WA 1LLCA 2O3SA 5I9LA 3RUDA 2G76A 5T64A 1R0SA 4CM1A 4O63O 1LQTA 4WCDA 4HFRA 4UEOA 4WE3A 4NPCA 3B1KA 1UAGA 3AY7A 5TLSA 2O4CA 5A5FA 3NGXA 3H8VA 3AI1A 5DCWA 5JFOA 2OMEA 3ZWMA 1MUUA 1J4AA 3ITDA 3QW2A 1B0AA 3PGXA 4J1SA 1A5ZA 3NDJA 2AHRA 3PJDA 5JDIC 2IEDA 2Y93A 3COSA 1Z45A 3JQ7B 1AUPA 2XXJA 3GOHA 3QE3A 4N7RA 4CQLA 3BIOA 4J16A 5KJ1A 3UCEA 2ZYGA 4TRMA 1V35A 4J6FA 4XR4A 2XPCA 4XGIA 2FR0A 4BNGA 3KETA 1ZIDA 1SEPA 3C1TA 1NPDA 3E48A 1Y7TA 3VTZA 4E0BA 1DRWA 3WWZA 4RJTA 1GQQA 2AE1A 3OSUA 2X23A 2OP0A 4XYLA 2VT2A 3GFGA 2DBVO 4O0LA 1WWKA 4J49A 4DMLA 2C7VA 1WMAA 2ZB3A 2JFFA 1YDEA 3IUSA 5EIOA 3UFXA 2WTBA 4MVJM 1GCOA 1PL8A 1QORA 4YAJA 4CUZA 3B1JA 3KO8A 3LLVA 2PGLA 3BAZA 3VKUA 3VPHA 4FOSA 1DJNA 1Y6JA 4GL4A 2DUWA 3G17A 3VZQA 5KNLA 5JCJD 2EG9A 3DTTA 1YQXA 3K8ZA 4RZIA 1PZHA 3RC9A 1YJ8A 3GH3A 4CQMD 2C29D 4J1TA 5KJCA 4JJIA 3RAJA 2E48A 5EESA 4DYDA 3F6YA 4NK5A 1MG5A 4KDFA 5L95A 1P45A 4JX8A 1ISFA 2JD0A 3RFTA 1ARZA 3E03A 4IMPA 5JAIA 2YDYA 3EVTA 1WP4A 4XYGA 1UUFA 1N92A 4FOOA 2H1SA 1FK8A 5TT1A 2HO5A 3ETGA 1SOVA 3IIEA 3GG9A 5CEFA 4FCCA 3AU8A 1ORRA 2X4GA 5IN5A 3F46A 3SJUA 3RROA 3VDRA 4LSMA 5CG1A 1HWYA 5L9AA 1I01A 3WGQA 2BFMA 2VUUA 3ANNA 3M1LA 1N2SA 1PJ3A 3DBLA 3S2GA 3GMDA 3DBHA 2VHWA 1N7HA 4HFNA 2HMUA 4NG5A 4U0JA 5A05A 2ZB8A 2A94A 3OIDA 2UVDA 4PLFA 1H6CA 1IHXA 2EW8A 2JCVA 1F0YA 4JBGA 4BIIA 4MIOA 4N54A 1FDTA 1J5PA 1DAOA 3H7AA 1PWZA 4FJ1A 1PQWA 4ND2A 1Q7BA 3I4FA 5A06A 4WLEA 1ZSNA 3OFSA 4LN1A 3TNLA 3GT0A 1JKFA 1T4DA 1I24A 5JCJA 3ROKA 3ZI0A 3PYMA 3T7EA 4XDZA 4CM9A 4DPLA 1GDHA 1DJQA 1IOLA 1NNUA 1U5AA 4E3ZA 1EBUA 3HWRA 4GX0A 4I5DA 3U4DA 2WDZA 4OOFA 3RFXA 1HE5A 3DFZA 3PZRA 3HN2A 3OBBA 2IYOA 5L53A 2Q1TA 1JWAB 4U7WA 2WE7A 4GAEA 4PG6A 2O48X 1D8AA 4ZRMA 4RVDA 1X1TA 2HMWA 1CDOA 3F5SA 2BGLA 3GRPA 3PHGA 4JN6B 3TOXA 3L6OO 5JYEA 4IJWA 4TQGA 1WW8A 2BELA 3AUSA 4QT0A 5L7TA 1K2WA 4J2OA 4CMJA 1PGPA 2J6IA 1HYGA 5J9GA 1U2GA 2NQTA 5T73A 5T67A 2ZB4A 3BYZA 3IJPA 3WNVA 1GR0A 3KEQA 2X8LA 1UP4A 3LLSA 1F17A 2GR9A 3KM0A 2GCGA 1WDMA 3JYLA 1F06A 3AU9A 5TNXA 3W6ZA 3AM3A 4H3VA 4NQZA 4WLOA 1SBYA 2IZ0A 3BTUA 5CDSA 1EVIA 2EERA 3EZLA 4Y9DA 5LC1A 5IN4A 1GUZA 3BA1A 2EW2A 4NBUA 2Y0CA 4FGWA 1R15A 5G0TA 3R0IA 5JC8A 3K73O 4R3NA 3FWZA 3IS3A 4NJMA 2VRCD 1NX6A 3LT4A 3ZGYA 3DFUA 4FW8A 5JDCC 4AJJA 4PG5A 1LI4A 4K28A 4AJIA 2BI7A 3FSRA 3WTCA 3PJGA 4NJOA 2UDPA 4E13A 5JE8A 1N9GA 3P2OA 3OJEA 4OM8A 4CUKA 3NJ8A 3LYLA 1E1KA 3D3WB 2ZTUA 3R6DA 1EDZA 3GEGA 3V8BA 1R4NA 2ZYAA 3UCXA 1BHSA 2C07A 3IQDB 4IIUA 1UDAA 4FC7A 4CM7A 4ALLA 1YL7A 1U4OA 3ETDA 1E6UA 1CETA 3GNSA 2VRBA 2X7HA 1TB4A 2NTJA 5B1YA 1A7KA 2YV2A 2W2LA 4OQZA 5ADHA 3GZNA 1EK5A 1BDBA 3D3EA 3JQ9C 1QYVA 3PJEA 3IJRA 4P4LA 2E37A 2R00C 4IXWA 2HLPA 2ZCVA 4F6CA 3GF4A 2QQ5A 1PL6A 3GVXA 1XQ1A 4R1SA 4XRGA 3PYLA 2GN9A 1E5QA 2Z95A 1HDYA 3PTZA 4M89A 1YL6A 7MDHA 1ZVMA 4MKZA 3JQ9A 1WNTA 3DMYA 3PDUA 1M76A 4JIGA 4FD3A 3FNEA 1QSGA 2R00A 4EITA 1RWBA 4KUHA 4NBRA 3PZBA 5FFFA 2JAPA 2EJVA 2BD0A 3D4PA 2C20A 5AQ1A 3SC4A 1GFSA 4TZKA 4OSPA 2DM6A 4RO0A 1AE1A 5FYDA 1GEGA 2D0IA 3I52A 2DAPA 1HE3A 1IE3A 3PQEA 4NIMA 2A9FA 1U1IA 4TZTA 4EUFA 2NVWA 3I1JA 5CG2A 1IULA 1GEEA 2NUAA 4IS3A 5KJEA 4MVJI 2C54A 3WGYA 4II3A 2GNAA 3E9QA 1IHYA 1Y8RB 3D4OA 1DFGA 3KYBA 3I5MA 2VWHA 2DT5A 3DDNA 1D1TA 3UCFA 3W1VA 4CMAA 2TMGA 1QXSA 2FPGA 3F47A 5TQVA 4CLRB 2OOSA 4AJKA 1M6HA 4ZD6A 3C7DB 4XYMA 3WOHA 4J1QA 4BNIA 4DQVA 4OOEA 4ZQHA 5DCYA 4DPKA 1O0SA 3PXXA 4IGEA 4ESOA 1VSUA 3H9EO 1GZ3A 5JY1A 1ULSA 1OBFO 1YWGO 2NV6A 1LDEA 1EVYA 2B4RO 2DPGA 2NU7A 4IDFA 5A9TA 1TA4A 3LC7O 4QFDA 4PLTA 5CDGA 2ZTMA 3OP4A 1H6BA 1I33A 4DIBA 1Y5RA 4DQUA 1Y8QA 2YHIB 3CKYA 3ZV4A 2PFGA 4PLHA 2DQ4A 3O8QA 3OJLA 5BSHA 4ALNA 4P4NA 3PYXA 4BNHA 4GPD1 2FN7A 2I6TA 2VZ9A 3RBXA 4BQRA 1WZIA 2Y67A 2FWMX 3GN1A 3I9MA 3PVZA 2ZQYA 4EUEA 3DAGA 1NYTA 4BKRA 4YAGA 1NWHA 4HBGA 3EY4A 5B4TA 4FC6A 4C7JA 1LU9A 4CQMB 2WYUA 1YGYA 2VYNA 3ZWXA 5JC1A 3GRKA 2VUSA 4YWJA 3FTPA 2O3JA 1LNQA 1LSSA 3O9ZA 4J91A 4Y8VA 3JSAA 1GUFA 3EVNA 4BO8A 2Y1EA 5IDWA 1DIHA 2X58A 2P9EA 2PY6A 2PZKA 3ZWAA 1I3NA 3UH1A 4UVEA 3E5MA 2BFAA 1ID1A 2HSDA 5L51A 4CLHA 4JNKA 2VYVA 3E8XA 1VL8A 3KYDA 5KOIA 3OJFA 4P4GA 2B36A 2P68A 1ZSVA 3TZ6A 4Q9NA 3D64A 4TROA 5DBIA 1MFPA 1BXZA 3PRJA 5BNTA 3FPCA 2Y66A 3C24A 4YRDA 2JL1A 1KEVA 1O9BA 3U4CA 5IDYA 5G4KA 1SO8A 5T57A 4BB5A 1ENYA 1HETA 4YR9A 1HDOA 3AUAA 4H16A 3W8EA 4MOWA 3ZH2A 4DLBA 1A71A 1UJMA 2GDZA 4IDGA 2P9CA 3PLNA 2QG4A 1NQTA 1WXDA 3ONFA 4CLXA 3LC2O 3DZBA 1V8BA 2PR2A 1HE4A 3F1LA 2IZ1A 1HT0A 2DKNA 3WLFA 2X5KO 3ZCXA 3H5RA 1C1DA 5ICSA 4OIMA 5IXSA 4PFJA 3U3XA 1UXJA 1LRLA 2EV9A 3I4CA 1HSZA 1P0FA 3H4VA 3KXDA 2H5LA 1DEHA 1T25A 4YT8A 2G82A 3Q11A 4DTIA 5KVVA 3NT4A 4ZHSA 3FBTA 3W4IA 2QIOA 4CMHA 1YBMA 1T2EA 4LK3A 2XF8A 5TGDA 2DVMA 1Q0LA 1SC6A 1L7DA 4W9NC 4EYEA 3HDYA 4URFA 3QVXA 4P38A 1YO6A 4TRRA 1TT7A 2D1YA 1GPJA 3LU1A 4CPDA 1JAXA 4QX6A 4BNFA 2PZJA 3GMSA 3ZWPA 5TF4A 1EE9A 5EMHA 2WSBA 2LDBA 5KJ6A 4J3FA 4KP7A 4W9NA 5DOZA 4DBVO 1PJCA 2AMFA 4Q3AA 3HJAA 1C0LA 1EVZA 1UAYA 4S1VA 1U3UA 2CVZA 2FSSA 3LF2A 5I8ZA 3VPXA 2VN8A 3JCZA 1I3LA 4ND1A 4WGGA 2OFPA 4WNIA 1U3TA 4XRRA 1IZ9A 2RCYA 1XIVA 2PWZA 4OGWA 4RPKA 3H3FA 5JCXA 2OHXA 3T4EA 3QVSA 1FDSA 1DLIA 2VCYA 5IG2A 3QWIA 4EDFA 2RH4A 3WGOA 4CMGA 1BXGB 1OAAA 1SPXA 5K6AA 5ITVA 3RJ9A 1UZNA 5JMPA 2JHGA 3HSKA 3GVIA 3OH8A 1CWUA 2I3GA 5ES3A 5DN9A 4RF4A 1I32A 4QEDA 5HWSA 1NASA 2FRDA 3F4BA 3GY0A 3JD4A 2BI8A 3GC6A 5IF3A 3PIDA 4HXYA 1GQYA 3RUFA 5A04A 3SJ7A 3ASVA 3B20A 2GD1O 4TSKA 4YAKA 4HP8A 2H9IA 3GPDG 5EJ2A 3KTDA 3BHMA 2Q2VA 4FQ8A 4OXKA 4W4TA 4L4RA 3GVPA 5G0SA 2OP1A 4ONEA 3DO5A 2YY7A 3V2UA 1LLDA 3O03A 4Z3DA 4CUJA 4B3HA 4W7IA 2WMDA 3C8MA 4FJ2A 5A4DA 1PJTA 3ANMA 3JQAB 1KVUA 5F1OA 5U9CA 4PZCA 4RLHA 3ST7A 1ZK2A 4A2CA 5JYDA 9LDTA 3W6UA 1UDCA 1K3TA 4RQUA 5TC4A 1A72A 3RVDA 3JQ8B 2AQIA 3ZWCA 1XWFA 1FF9A 3KLPX 4XJSA 3K2BA 2IE0A 1CQIA 3FI9A 3TFOA 2VZ0A 1XHLA 3K30A 4JP3A 4YJHB 4B4VA 5GZ3A 2G5CA 3OA2A 4DWVA 4YT5A 3ETEA 1PL7A 2QYSA 4J1NA 1A27A 1KBZA 2CY0A 1LDGA 4HX5A 4I1IA 5GZ1A 3LF1A 4QXMA 4G65A 4D3FA 1I10A 1EQ2A 3WLEA 3HB5X 1UDBA 3RUIA 1RJWA 2VHZA 1JWBB 1P1HA 1F8FA 3SLKA 5HS6A 2YUTA 4KUGA 4YDRA 4A27A 4WOJA 1ONNA 5DP1A 3H3JA 2F1KA 2W2KB 5C7LO 2GGSA 1MX3A 2WD8A 4UULA 2WJPA 4RDHA 1EZ4A 2X0NA 4CM6A 5BQFA 1XG5A 3QWBA 1DO8A 4E5MA 4KQXA 2Q4BA 3WBBA 3A14A 3QWHA 3T4XA 1PX0A 4Y98A 1NR7A 1U8FO 4RPLA 3V2HA 3WQQA 3GNTA 3ICCA 4G81A 1GPDG 2ZQZA 1DHTA 1RYDA 5COBA 1E7SA 4B7XA 1DXYA 1LLQA 1CJCA 1X0XA 2BHLA 4PVCA 3NRCA 3OICA 4GX1A 2O2SA 4FDAA 4WLVA 1VKOA 1P1IA 2O4UX 3WJAA 5J23A 2VOEA 3TZKA 2JD1A 4A0SA 1LC3A 1D7OA 4QO8A 3IOYA 3WYBA 2FR8A 1P74A 1ADCA 3DOCA 1O5IA 1SOWA 4L4SA 4TMFA 4BO4A 5F21A 4A10A 4BNWA 4MDHA 5LDGA 5CPFA 1E7MA 3WXBA 4E5PA 5L4SA 1EE2A 3FCOA 1B2LA 3DOOA 1I3MA 4WEQA 4B4UA 1GV0A 1U8XX 2DTXA 1YS4A 3OQBA 1DIGA 3CMCO 4FR5A 3P2YA 4DYVA 3RBVA 2NADA 4FSHA 4EJMA 3GUCA 1HDGO 3WNQA 1ZXBA 4LW8A 2G17A 3AI3A 4O59O 4MP8A 3KBOA 2Y0EA 6LDHA 3ZHYA 4U8GA 2VOJA 3HFGA 4IDCA 4DLAA 2BF7A 1PSDA 3JQBC 5DBGA 2PD4A 2Q49A 1C0PA 3EW7A 3K96A 3VZSA 3D5QA 4BL5A 4ZVVA 2CF5A 4IUYA 4J9UE 2C7GA 3X2FA 4MP6A 3C1OA 4IQ8A 3AOEC 3I23A 1PIWA 2QYTA 3PFWO 3ICPA 4I5EA 3IC5A 4B79A 4HNHA 4JROA 4JXKA 3KYCB 5I9NA 2NU9A 1ENZA 1TXGA 3JQBA 5JAZA 3H2SA 4E21A 3GDOA 4R1NA 1QLJA 4E5NA 3ZV5A 3TDKA 1B8UA 4XB1A 1VPDA 4FJ0A 1R12A 2GN8A 4AJHA 1P33A 5TT0A 3UN1A 3VDQA 4CLDA 1EUZA 4AG3A 3FN4A 1NVTA 5I7EA 4NMHA 1DRUA 3GUYA 2X0IA 1GZ6A 1Z6ZA 4W82A 4XQGA 3UICA 1AXGA 2YQ5A 3W8FA 4L0QA 2FR1A 5JDIA 2GZ1A 4GQAA 1NPYA 2NVBA 4KDEA 1M2WA 2CZCA 1E3JA 5TS3A 1Z73A 2DTDA 1MGOA 1ZK0A 3KSUA 3OM9A 2NVUB 4MVJG 4PG4A 1ZK1A 2UUOA 3GEMA 3I9OA 2Q50A 1PR9A 3GDFA 1UZMA 3B70A 3WICA 1NFFA 4C4OA 4R1UA 3NT2A 4R41A 1Q0HA 1X7DA 3LT0A 5L4NA 3VTFA 5B12A 5THKA 2FSVA 1QR6A 3D1LA 1T26A 2QRKA 2NU8A 1ZK4A 3BMCB 1E77A 2WE8A 4IXTA 4BGVA 1QLHA 3M6IA 1NP3A 1LRJA 4WPGA 4OYRA 3MZ0A 3ROQA 4BS9A 1BXKA 1JU9A 1Y8RA 3BMNB 3ZWOA 1HEUA 2VTEA 1AHHA 4GX2A 4O1MA 2I9PA 3G0OA 2DU8A 3ITKA 3PQDA 3WWYA 3BMOA 4WNCA 4J0FA 4K26A 4LISA 3RU7A 1GZ4A 2GO1A 3C1AA 2Z5LA 3B6ZA 2OO5A 2Q2WA 3UKOA 3ZWYA 4NFSA 3NJ4A 2I99A 3G49A 3Q2IA 2D4AA 1RPNA 4CM4A 1SEVA 1TI7A 2HJRA 2CF6A 3CE6A 4L74A 4CM8B 3JD0A 4B8ZA 4NK4A 6ADHA 4IDAA 4ID9A 4QUKA 3JYPA 5T8KC 4AJOA 4E31A 5ER6A 4B4OA 3V1YA 2VWQA 3IAHA 4J0EA 4CMEC 4UREA 1PJ2A 4PLVA 3BXXA 5DOVA 4E4YA 5CDYA 2YHIA 5G2OA 1HLPA 2B5VA 2ILTA 4XCVA 5IDXA 1YOVB 1Z7BA 2V6BA 2YFHA 2QZZA 2IODA 3K92A 3HFSA 1SMKA 2A4KA 4EEXA 1ZNQO 3JYQA 2YHUA 2B83A 3DZKA 2NACA 3ZV3A 1OI7A 1JAYA 1V3TA 3AUTA 2X9NA 3HB4X 3W8DA 4BHTA 1LSOA 5DF1A 3VZRA 4CQMA 1LDMA 4X54A 4DUPA 3PWKA 1TLTA 2I65A 1DC6A 4PLWA 2DBQA 4UUPA 5FI3A 1ULUA 5G0UA 3V1TC 3VHRA 3WSVA 4BNYA 5I8WA 3V1UA 1ISIA 5TRTA 3ZWVA 4YRBA 2TMDA 4I08A 5DCUA 3TZHA 1E6EA 3ZWBA 4PN3A 4E5YA 3E9NA 1GYPA 2OL4A 1V0JA 1E7RA 3ADPA 5JXWA 4E30A 4WOKA 1GY8A 1EUDA 3ZN2A 3KVOA 1ADGA 1T4BA 2P5UA 2EKPA 4C7KA 4D45A 4BNKA 4BGEA 3OA0A 3GLQA 1IB6A 2OORA 3K2EA 2CSUA 4A26A 4XYBA 1HE2A 4NFHA 2EKQA 4JLWA 4R68A 3I9LA 1WMBA 4W7HA 3PGJA 2J3HA 4BO5A 1EMDA 5IAAA 3O38A 4Z9XA 1WDKA 2V7PA 1PS0A 3GHHA 1XDWA 2BLLA 4QO7A 3AFNA 4XX0A 1DC4A 1E1MA 1YVEI 1VM6A 1P0CA 1B7GO 1BW9B 3DHNA 1BWSA 2JCYA 4R3WA 2Y05A 1KVRA 3JQEA 4P8RA 1KC3A 1P1JA 3OIFA 1C3VA 2BKAA 2WD7A 4FFOA 3R3SA 3PK0A 4F45A 3BHJA 1M6WA 3DOJA 1B14A 3TJRA 3FR8A 1FMCA 1DBVO 4N5NA 1MFZA 4G2NA 4YJFB 1ML3A 3NX4A 1CEQA 2PTGA 4HFJA 4UAGA 1OZAA 1JVBA 5L7WA 4O5OA 2H63A 5JDCA 3PIIA 2PK3A 2G0TA 1HTBA 2AXQA 2BGMA 4A7PA 3QSGA 1ZJYA 3KZVA 4MVJF 3S1LA 5A1TA 2QW8A 1ENPA 2Y1OA 4GWKA 4AJ1A 2YQ4A 5HTOA 4JP2A 4FFMA 1QMGA 1K5HA 3DMTC 3ZNQA 4MINA 2D8AA 5H83A 4KZPA 1LDNA 3GGPA 2RAFA 2UYYA 3CSDA 5TIIA 3HHPA 3NTRA 4U6QA 1LC0A 1WDLA 4ZJUA 1PR3A 1ISMA 4NBTA 1R66A 2CDAA 2PZLA 3JQAD 4JCOA 3ENKA 3QA9A 1VL0A 3M2TA 5TJHA 4TWRA 2C2XA 1KIFA 5DBFA 4XB2A 4MVJP 2A92A 1NVMB 1XU7A 2NTVA 3I9JA 1MG0A 4XDYA 4ALJA 4CQLB 4D43A 2VRCA 3NDRA 1U5CA 1M67A 4RORA 4PZDA 3TPCA 3GN2A 1TVEA 2IZZA 2P91A 1LSJA 5JO9A 3DHYA 4R1TA 4YBZA 4BNJA 1E1LA 3JD1A 4JBIA 1BXGA 5LDHA 1X0VA 3WYCA 5A9RA 1LDYA 4DXHA 1ONOA 3IDSA 3HNPA 1H6AA 4BNXA 4HUJA 3TWOA 1U7TA 1XELA 1JTVA 4D0RA 3PI7A 3RUCA 2YZ7A 3INGA 4AL4A 2DC1A 3HQ4O 3OIGA 4Z9FA 5KKAA 4PVDA 1UH5A 3TL2A 4KTTE 3Q1LA 2C5EA 1M66A 2PLAA 4NU6A 5I9MA 1BSVA 2Q45A 5KVSA 1BRMA 3JQ6A 1LXCA 1GQ2A 1A4UA 3W4JA 2HCTA 1HDZA 4OHUA 3L0DA 5T5QA 2Q1WA 4EJ6A 5FEUA 1O94A 2FHSA 4DL9A 3RQSA 2GRAA 4L73A 2W90A 1IPEA 4IDEA 4OO3A 3TQHA 4BKOA 2IEBA 2QZ9A 2QRJA 4ZQBA 3ONEA 4XGNA 4BNUA 3DWFA 1H9BA 5EQDA 4OKIA 4RQTA 2AQHA 4J43A 1IPFA 2DUUA 4KMSA 4Z0PA 5AXCA 1DHRA 1ZBQA 4WUVA 4R69A 4YJHA 4WLUA 5BT9A 3FNHA 4U6SA 3QHAA 2DLDA 3GAFA 2ET6A 1QYCA 1KEWA 1C0KA 1MC5A 1ZO8A 3WMXA 2WWRA 4DREA 1UXGA 2VQ3A 5CDUA 4QECA 4XQCA 4WEOA 1AXEA 4L76A 3DBLB 3DBRA 2RBEA 3FNFA 3OEYA 2V6GA 2D5CA 4UVHA 1BVRA 1C14A 2Y1DA 3TFQA 5KWEA 4CLEA 3UHAA 3EGOA 2W2KA 5U4QA 2X86A 1VKNA 3ONDA 4IDBA 2NTNA 5L45A 1R16A 5FF9A 5KVQA 1LX6A 4BQPA 2BMAA 5IZ4A 4OKNA 1H93A 3WSWA 4Z0HO 4XIJA 2BRUA 4I9UA 3GK3A 2POQX 4I5GA 1I2BA 3DZHA 3D4NA 1Y9EA 3WR5A 1ZH8A 2J3IA 3JYNA 5ENDA 4LSWA 5C7IO 5A5EA 1O89A 1XGKA 4FGSA 4ND3A 1D1SA 4I5FA 3HG7A 3SX2A 3TRIA 2PH3A 2J8ZA 3L4BC 1I30A 1T2AA 1GAEO 1ZSYA 4J9VA 4M49A 3PHHA 4J4TA 5MDHA 1KEUA 3MTGA 4WASA 1UXKA 2JJYA 5CEEA 1UR5A 2P5YA 3LVFO 1PJQA 4RVUA 2EF1A 3VH1A 2O3UA 1EK6A 3KRTA 5AXAA 9LDBA 4GMGA 4BMSA 2YV3A 4L9RA 3F5QA 4YYZA 2VZ8A 3PPIA 4QQRA 3PDJA 1PGJA 3L77A 5EERA 4RGBA 3ZW8A 3AM4A 3IL2A 2PNFA 1E3EA 2HKIA 4P22A 4QTZA 2CFCA 2QHXA 4GSKA 4MKRA 1JN0A 1P1KA 3F4LA 3CZMA 4HY3A 3OQ1A 1Y5MA 4FBGA 1L1FA 3MJCA 2ZKLA 3FNGA 3WGZA 2VHYA 5JNLA 2RHCA 1BGVA 3U09A 2B37A 1PZGA 1BTOA 4EGFA 5FI5A 4IIVA 4NJMB 2V65A 2Q2QA 3ROPA 1FDVA 2AE2A 2HK9A 1PZEA 3WFJA 1W8DA 1Z7EA 3KYCA 4R54A 4BB6A 1C1XB 4YPOA 1VJ0A 2O23A 4ZA2A 1HDCA 1YXMA 3TZQA 4CR7A 5KCZA 1H6DA 3JQ7A 4ND4A 2Y0DA 3ZU2A 5F5NA 3TSCA 3AI2A 3ZZNA 3RSHA 1DLJA 4YQYA 4AVYA 5A03A 1EQUA 4XD2A 4AFNA 2OZPA 2Q46A 2ZJ1A 3PQFA 3MJVA 2X1HA 1KETA 4YRAA 4HWKA 4RVHA 4YB8A 1ZJZA 1O95A 2GASA 4INAA 5A3JA 3EUWA 3DZFA 3JQFC 1TEHA 5JBIA 2QRLA 4U0KA 1SZJG 1YE3A 4BMVA 4CV0A 2NVUA 4MVJD 3A28A 5G4LA 3VPGA 3AFMA 3MJSA 3WX0A 2ZTLA 1AGNA 4BO6A 5K9ZA 4L75A 1JA9A 2PKQO 1MP0A 4H15A 1YQGA 4D3DA 4CMBA 2W4QA 4MIYA 4B3IA 1XSEA 2X0JA 3FHLA 4PIVA 3ADOA 3V5NA 1YKFA 2EGHA 4PLCA 4BUCA 5EL0A 3GA0A 2GLXA 4BNZA 2X5JO 1DFHA 1YH3A 1N1GA 1UXHA 3EAGA 3K5PA 4D46A 3BMNA 4XZ3A 3JD2A 1JVSA 3QY9A 4A73A 1NQ5A 3ASUA 3RUEA 1HSOA 3DAFA 4TVBA 4XWYA 4XQ9A 3G3EA 3ZNPA 1JW9B 2QX7A 4W6ZA 3GGGA 4J7CA 3WMWA 1H94A 1HLDA 1QYDA 5G0VA 3QV1A 3K9QO 4D3SA 3MJ4A 1D4FA 2HDHA 3BHIA 3EZYA 1P9LA 2Z1MA 4M1QA 5AXBA 1KS9A 1CRWG 5JAMA 3EK2A 1J0XO 3M2PA 1MLDA 2VNSA 1YJQA 3ZU5A 3O26A 4Z9YA 1EBFA 2IDZA 2PGDA 3KEOA 4CM8A 2HMSA 3FPLA 2EKLA 4XJTA 3RJ5A 1W6UA 1LTHR 4YAIA 1EFLA 4DA9A 3GHYA 1GCUA 4NZ9A 5IXYA 4UVIA 5EQFA 2B35A 1OC2A 3BTOA 4R5MA 3MOGA 5CHEA 2I66A 1V6AA 4BKPA 1X1EA 1NVGA 1DC3A 2NU6A 1BMDA 1KOLA 1NAHA 1VLLA 1YOVA 3A9WA 4YAEA 2AW5A 2DBZA 1SCUA 3H5NA 2HK8A 3DC2A 3NDIA 2P4HX 2CDBA 5CDTA 3INRA 1P44A 5ITWA 1NM5A 4FFLA 2J3KA 3UGKA 4CV3A 1PEDA 3BMQB 2EP5A 2O3RA 2O3TA 4IPTA 2WM3A 3U4IA 2G1UA 4BVAA 4Y6SA 1GL3A 1VC2A 1PJLA 5CP8A 4IZHA 4YJGB 1DPGA 2PA3A 2HMTA 3I6QA 3D7LA 2DBRA 3Q9NA 3MJTA 4KWHA 3UXYA 3ON5A 3WIDA 3ZU4A 3DONA 5DNAA 4CM5A 4KUEA 3RKRA 1G0OA 5A9SB 2H6EA 1IY8A 4D79A 5HM8A 2E82A 4GKBA 1ENOA 4CMCA 2HUNA 5BR7A 2WYVA 4Q3NA 3WIEA 2JCXA 4ZN6A 5JO0A 4EUHA 4UEKA 1Z74A 3A1NA 3U49A 3ZV6A 4DGSA 5KKCA 1N5DA 5DT9A 3PWZA 1HRDA 3AY3A 4IQGA 3UAGA 2C82A 2WYWA 4LCEA 1GYQA 1I0ZA 5HA5A 1PQUA 2EP7A 2W8ZA 3ROMA 2RIRA 3K31A 3E9MA 2EEZA 3I3OA 4NH4A 5U1PA 3ENNA 4ND5A 1T2FA 2VWPA 1BVUA 4Q39A 4J4HA 5AYVA 4CV1A 1DAPA 1BW9A 5EINA 2X6TA 3DZGA 3QVOA 4UUOA 2JD2A 4DIFA 5KVCA 2YJZA 4PG8A 4B8WA 4BO3A 2FMUA 5IDQA 1Z82A 5G4KB 1X7HA 1QYXA 1ZEMA 4E2YA 3OJ0A 5EN4A 4WLNA 4L4XA 4LRTB 1NHWA 4NFYA 1K6JA 4GI2A 4YJFA 3AOGA 2R2GA 1I3KA 2GUGA 1LJ8A 2X5OA 3D3WA 3LSYA 2Y99A 4D42A 2NLOA 1L7EA 3R3JA 3KV3O 1XYGA 3ZNOA 4B7UA 2Q99A 3HN7A 1YL5A 1QKIA 1PS9A 1NAIA 4XIYA 3VKVA 2FZEA 1GADO 1NXQA 8ADHA 3QVTA 1K6XA 1E92A 4UEJA 4Z3KA 5JMWA 3PFFA 4TRJA 4TVOA 3QQPA 3JQCA 3SEFA 2AG5A 4BO2A 2AG8A 2CD9A 3ZDFA 3FR7A 5B4UA 1ZCJA 4MPDA 3L6EA 1I8TA 5K0ZA 1RM4A 1E5LA 5JYAA 1ZMTA 3NGLA 4ZGWA 3QVWA 4D44A 3UVEA 4R9RA 3AOEA 4FN4A 5DP2A 1PZFA 1J49A 2ZJ0A 1LRKA 1P1RA 1SNYA 1KVQA 3OEWA 5COQA 1R4MB 4JQCA 3E1KA 1R37A 3NAQA 4GSLA 1TT5B 4NBVA 2PGJA 3HDJA 1H2HA 1KY5A 1YB4A 3WDSA 4BO9A 2BH9A 1KVSA 1V3VA 3ZHXA 2O50A 4TKLA 3FRJA 5F1KA 3QWAA 4W99A 1ZUD1 2FPIA 1H5QA 4D0SA 3VVCA 1RM5A 1MXHA 1PU2A 2PKQP 3ABIA 2OBNA 3UUWA 1PGOA 1T2DA 4NNJA 1DSSG 3GDGA 1M75A 3H9JA 1HDXA 5A3VA 4EW6A 4BO0A 2VNAA 2P9GA 4Q3DA 3VPSA 1G0NA 1HF3A 4RPGA 3OJOA 4Q3BA 1ISHA 4N5LA 1YRLA 4GLLA 3RUAA 4CMIB 3L9WA 3Q2KA 4D7AA 1XR3A 3AUUA 3D5TA 3SXPA 3Q3CA 1HL3A 3AM5A 4WCFB 1AN9A 1X14A 3LT2A 3Q6IA 5ICMA 3EDMA 3HZZA 4G5HA 2GN6A 4ALKA 2UV8A 3C7CB 1S6YA 1ZW1A 3L9XA 4CJXA 2AEFA 1SB8A 2Y1CA 7ADHA 3GVHA 3RKUA 5B37A 1EFKA 4CLRA 3HUDA 1PJBA 5I7FA 3RBZA 1DIAA 3NKLA 1B8PA 4Y6PA 3DXFA 3WJ7A 4BNLA 4CM9D 1H2BA 2DFVA 1AHIA 3LQFA 1XA0A 4TKMA 5TJ9A 3FD8A 1YBVA 1E7WA 4RLSA 1B3RA 1DDOA 2C0CA 2FP4A 5DZSA 4DMMA 3SLGA 2ZYDA 4YA6A 1PJ4A 2HQ1A 2EIHA 1S7CA 5TX7A 2I5PO 3RCBA 1Y9AA 3JQDA 3GGOA 1RM0A 4A5OA 1FDWA 1VJ1A 3RC2A 1VSVA 4Q3CA 3DEYX 2A35A 4GGOA 4GBJA 2X9VA 4PLZA 2GN4A 5CFZA 4YXFA 2Y68A 3IP1A 5T8KA 4MKXA 1JKIA 4B4WA 1ZK3A 4EZBA 3ZW9A 5F1PA 3OETA 4CMEA 4RPHA 2AEMA 3DZJA 5THQA 4E32A 5ILOA 1T24A 4DC1A 2E6UX 4F46A 4KWIA 1QP8A 4JBHA 4CLOB 3UOGA 3HDHA 4BKUA 3DBVO 2Y1FA 5HS4A 5KIAA 1KERA 4UUMA 2IRWA 4OMUA 1P77A 3NYWA 3C3XA 5F5LA 2PKRA 5ILGA 4MVJH 3X2EA 2YFQA 5IJZA 3OMLA 5F3RA 3LZ6A 3GNQA 4FIZA 1N8KA 2JFHA 3JQGB 4OJNA 3KB6A 4LGVA 2OBYA 2NSDA 5AVOA 1SAYA 2NQ8A 4IQ0A 2VHVA 4YT2A 3O4RA 2NNLD 3S2EA 4E6PA 4E5KA 3BTSA 1I2CA 3OF2A 1G1AA 1WPQA 1NR1A 3S55A 3WGTA 3KSZO 3DB2A 1U28A 2E49A 4OXYA 4ILKA 1ZZEA 1G6KA 3WTBA 4EJ0A 2EXXA 2VHXA 3TOZA 2IXBA 4BNTA 2O7SA 4JK3A 1E7QA 2IYPA 2C59A 1K6IA 1PTJA 2HRBA 2LDXA 3F9IA 4AJ4A 4AJEA 1PS8A 2HRZA 2W2LD 3QIVA 2J5QA 1IUKA 1K0UA 1U9JA 3I9KA 1U4SA 1JLLA 2UAGA 2O2YA 3IKVA 2GSDA 4LVCA 2BFPA 2B4TO 2EWMA 5JLAA 1R0LA 1UP6A 4J4BA 1EDOA 3RU9A 1T1RA 3RIHA 1LLUA 4GVXA 3IKTA 1KVTA 1R6DA 5C7OO 2AQ8A 3NEPX 4MJLA 3Q9UA 5JW6A 1I5RA 4I9HA 1Q7CA 3MWDB 5EPOA 3PWSA 2YYYA 1FDUA 4E2WA 2XAAA 4E12A 3TF5A 3MTJA 2JKVA 1E3WB 4AJLA 4MIEA 1RM3A 1E1NA 1QV7A 1MB4A 2EHDA 4PGFA 1NFQA 1W0CA 3VH3A 1WZEA 2FPPA 4E2ZA 4RL6A 4S3MA 1NWCA 1PWXA 2Y1GA 2ZK7A 4R51A 2DTEA 1LA2A 4EI2A 5JPIA 2YW9A 1C1XA 4Y67A 3EYWA 4DRYA 1E3SA 3C7AA 3T7CA 1H9AA 4HV4A 1MV8A 3A06A 4GVLA 2JAHA 1P1FA 4HNGA 5CPBA 3PLRA 2IXAA 1UZLA 4OL9A 5LCXA 5G0WA 3SC6A 1LBEA 1VJTA 3GR6A 3WFIA 1HYHA 4ALMA 3DMTA 2DFDA 4BV8A 3HDQA 3GVCA 3RFVA 4I8XA 2EJWA 1E0DA 2JFGA 1O8CA 3BTVA 4DPMA 1W73A 4YACA 4FPXA 3R1IA 3RI3A 2R6JA 4IGFA 1O6ZA 1ADFA 1DOHA 1IYZA 2V6MA 2HU2A 3STHA 5L7YA 3EMKA 5MGBA 3M1AA 3WS7A 3ZHZA 4M8SA 2GZ3A 4QFCA 3C85A 1QYWA 1J6UA 1ZEJA 2FOIA 4MVJE 4JJGA 4A03A 4NR0A 3E6AA 4LRSB 1RYEA 2Q1UA 4YQZA 3ZU3A 4CL8A 3RUHA 1GD1O 1V3UA 2GPTA 1YQDA 3G1UA 1RKXA 4WECA 5IFLA 4IDDA 1B3BA 3ZWNA 2C5AA 4XQEA 1ISJA 1NPTO 1LUAA 3IUPA 3K6JA 4XKJA 4FFPA 4BV9A 4DIOA 1GV1A 1WLYA 1Z75A 3VVBA 1CERA 1ZMOA 4EBFA 5JYFA 3Q0EA 3L6DA 4RF2A 4R4JA 4DLLA 4K6FA 2D5AA 1OOEA 4ZQEA 4M87A 3P7MA 1BDMA 4CODB 4IY1A 1HKUA 3PHJA 3G79A 1Q2XA 5BNFA 1ZXLA 1YDWA 3VZPA 1XCBA 1B8VA 3JD3A 3WGIA 2VYND 1BG6A 1GUYA 4NHEA 3JQAA 3I6IA 4CMKA 4E33A 2CDCA 4OSOA 5H81A 1YBAA 3WGGA 3DHEA 3CIFA 3DL2A 4IJUA 4JJFA 3BMOB 3JQ8A 3WQRA 4XYEA 1HZJA 5I7VA 4OQYA 4WKGA 1P3DA 4R01A 1CIVA 2UUPA 4R9SA 2CUKA 3FF4A 4UVGA 2VYVD 3ORFA 2VUTA 4B3JA 4F3YA 3NV9A 1CQJA 1F12A 4BO7A 4CM4B 5L4LA 3ZNNA 4B7CA 1ZKMA 3L4SO 1F14A 4PCVA 2ZB7A 2P2SA 1CYDA 3AY6A 1FJHA 3H9GA 1MC4A 4IS2A 1T1SA 3S2IA 3S8MA 4D41A 3KLMX 3H9QA 4GLOA 5T6BA 3DBHB 3S2FA 1VL6A 3QRWA 2E4AA 3H2ZA 2J5KA 3BMQA 4Q3EA 5ER9A 3WB9A 3MEQA 4AICA 3H6KA 1UXIA 2HMVA 1LEHA 2OGUA 4YJGA 2I67A 5COAA 1OMOA 2NWQA 1P31A 4GMFA 2I76A 5BSFA 3CEAA 3KUXA 4DQXA 2W98A 4PZEA 4R16A 3ANLA 4YVFA 1D3AA 1DC5A 5A9SA 5C3MA 1X15A 3G1TA 4GX5A 3QLJA 2Q1SA 1DIBA 3ZWWA 4J2HA 4RVSA 1NQOA 3H65A 4CR8A 2ZATA 4GWGA 3H5AA 3LC1O 1I2ZA 5GY7A 3GFBA 4UUNA 3CTMA 5H82A 3GZ4A 4XR9A 4K1LA 4PLYA 1XLTA 1PGNA 4GGPA 2VTDA 1A4IA 3U62A 4U5QA 3PHIA 4LVUA 3AW9A 4CL3A 1X13A 5CAEA 3ZHBA 1JQBA 1Q1NA 2EGGA 1U3VA 1SB9A 2AQKA 4OH1A 1DB3A 3E18A 3AJRA 2O3QA 1XEAA 3L4BA 4XEHA 1Q7GA 3GG2A 1LDBA 3PEFA 1ADBA 4YTEA 1NTOA 4J7XA 3CZRA 1X7GA 2NM0A 3VOSA 3WBFA 3HADA 4M54A 4PLGA 1E7YA 1FXSA 5L40A 5BSGA 1NFRA 4LCJA 3QWFA 3MWEB 2I3AA 1PGQA 1N1EA 2D3TA 3A4VA 1VRWA 4CM3A 3H9UA 4IJVA 1KY4A 3HE3A 4GKVA 4ZQFA 4JGBA 5ENVA 4HADA 3UF0A 3NTQA 4KOAA 2WD7B 2GF2A 1NBOA 2DPHA 3DZIA 3WQSB 5DULA 3DR3A 1IL0A 3KOUA 3WGHA 5IZCC 3AWDA 1B15A 3RC7A 1N9GB 1PQPA 2D59A 4OAQA 1A9ZA 5JS6A 3FBGA 3I83A 2B0JA 4LMPA 1R4NB 4IJKA 2VT3A 3UW3A 2V6FA 3FWNA 4ITUA 4N18A 4RCVA 2Q3EA 4BNMA 3RASA 1DIRA 1PJSA 4RVFA 3LT1A 1DFIA 1R0KA 3KSDO 3E82A 3MOIA 1HZZA 5IZCA 3VC7A 1R4MA 3INTA 3GZNB 2GZ2A 3AK4A 2AA3A 4YT4A 1TT5A 1B26A 1HYEA 2Z1NA 3L07A 1KYQA 4M55A 4TRNA 4Y6RA 5GMOA 4R5HA 3W4KA 1QV6A 4FS3A 3PP8A 1E3IA 1WVGA 2ZTVA 3PJFA 4BGIA 4ROSA 4E2XA 3N58A 4PRKA 5CEJA 3MCVA 4WCFC 1V9LA 1HDRA 4PRLA 5JAQA 5I7SA 4HKTA 2BFOA 3BMCA 3JQFA 4H7PA 5M6DA 3MJEA 4BNVA 4DVJA 2PH5A 3F1KA 2CMDA 5A02A 2XOXA 5GZ6A 1U2DA 2YDXA 5K6AC 4FFNA 3SVTA 4RF3A 4UVDA 2HAEA 4FFRA 1NQAO 2GERA 4CMIA 2O7QA 3NT5A 4FB5A 4EEZA 3U0BA 1IZ0A 4WCFA 3FTNA 4F6LA 3RC1A 2B5WA 5L3ZA 1VE9A 1OFGA 1ISGA 3WYEA 3VH4A 5BSEA
chains in the Genus database with same CATH superfamily
5LYJA 4AJPA 2YV1A 3KCNA 1I0IA 3F96A 2LUOA 4FFBA 5C8YB 1MOPA 3MWJA 5D5PA 3U4MA 3LCMA 1KKLA 3QNMA 1XBTA 3ROGA 4WXMA 5EXEA 1GJRA 4IMRA 1TVMA 4MGKR 1Y81A 2EKBA 4QSMA 2AOTB 5U4XA 1A8IA 3QSYA 1QF9A 4L2IB 4YXWD 3AILA 2PZMA 5CW1A 3B2QA 2A1TR 3FRIA 1XJWA 1Y1PA 2HF8A 1GAQA 2QL7A 2PV7A 4HQ0A 1Z8HA 1EEHA 1R6XA 1V2HE 4L85A 4DN6A 4J8PA 4GL2A 2EJTA 1Q0QA 2J5RA 1EVJA 1M6YA 2ZT7A 5K8CA 3OZTA 8LDHA 3QUQA 3LRTA 3L05A 1SC3A 5KWVA 3IP7A 3E7PA 4JGIA 1AQIA 3ENQA 5LZ2A 4MS3A 3ZE7A 2Q0QA 2H1LA 4FYKA 4LXQA 4G26A 4HNRA 1D2CA 3IUYA 3D7NA 2XYQA 3G0GA 4IEEA 1YDMA 3JYHA 1KMHB 2NU7B 4W1PA 4YMSA 4IRUB 4AMUA 1AZWA 1I7PA 1T91A 3H5IA 2HBZA 5HJ5A 3GLVA 4UNSA 4AM8A 2M98A 3HA3A 4AUEA 1WUIS 3JTMA 2X22A 1DBSA 4WJZA 1GA4A 4U7TB 2IU0A 1M34E 3VSDA 3VJMA 2PVSA 4M0PA 4FEAA 1CUBA 3K0BA 4CLOA 5FNVF 3JX9A 2VHJA 4DLSA 3U6BA 2JGLA 2RK3A 1E2JA 5JS7A 1J9EA 1PZMA 4BO1A 5TMEA 3FUXA 1GN9A 5KYNA 4UDYX 4O33A 3D7RA 3PNKA 4ZU1X 4DXAA 2LCIA 2XCRB 4AJ2A 4Z8YA 4F7WA 4CL0A 5B4VA 5GJVC 4BGUA 2OCBA 2UZIR 5EJIA 1P60A 1CUSA 2FXVA 1QG6A 4Y2HA 5AXDA 2XUGA 3U44B 2OHGA 3RS4A 3LO5A 1OYYA 2ZCUA 4ZAGA 1P3JA 3ZE0B 2J3LA 4MUBA 4EG3A 2HDWA 3MVEA 1J0EA 4KVFA 4HX2A 2ZUVA 4CEIA 2C97A 3R5FA 1TTPB 2I3ZA 1TAHA 1RTKA 4NI5A 1XQ6A 2XQKA 2ZJOA 5BVGA 4N6GA 2ZJ5A 4FXOA 1QZZA 3P5SA 1KXJA 4ZTUB 2YW2A 2WWTA 2A30A 3U9LA 2R1TB 3A26A 4YCAA 3EIOA 1IXRC 4UCQA 1MX9A 2Q4EA 4LYHA 4H7EA 2OUIA 1UEIA 4DJDC 1NHGA 2H7XA 1SVNA 3DO8A 4ZYZA 4YH1A 1LJLA 3WG9A 3PFKA 1LV7A 3P19A 2IBTA 4WBXC 2CVOA 1W4ZA 5EQJB 3VAZA 2GXUA 4WOBA 2X42A 8OHMA 3CMMA 4L6IA 1DX4A 1ZX1A 3VHXA 7MHTA 3FZGA 4DDHA 1E64A 3N2KB 1DAGA 4F6RA 1ZRMA 1UPTA 2VPWA 1UP7A 1AUOA 3HEBA 4QPPA 4RHYA 1Q11A 2ACEA 2HWKA 2PM8A 2RGEA 4HI0E 5CW2A 4RPJA 3VZCA 1BE8A 1Y4DE 1KMNA 2OGWA 2X13A 5EG5A 4IZIA 4UBKA 3OZRA 1DOZA 1ZOOA 3PDCA 3PNQA 4RA6B 3RWBA 5AH0A 4HQNA 4NMXB 4Z1OA 5DNCA 2FN4A 5LL6P 4RF5A 5DRTA 5SY6A 4HBZA 3L8MA 4KQWA 1YQQA 1ZN7A 4ABTA 3COYA 1EESA 4HAYA 2WV7A 5BQOA 1GTMA 3B60A 3D7KA 3OPQA 1GGJA 4Z0TA 4AUKA 5K20A 1ORHA 3KAQA 3QP9A 4XM2A 1WPRA 2YOGA 2FX5A 5BRJA 2JCGA 3LQYA 2SCUA 4MEJA 5JS2A 5K05A 3AR9A 2B8TA 5EUMA 1NJFA 3CPSA 5DHUA 2RGWA 5F77A 4BX2A 4C7OB 2V0CA 4DTCA 1I3CA 2IKQA 1H0KA 1LLCA 4H3SA 1RW4A 1RJGA 4KI7A 2PHZA 1NBWB 3UNXA 4CM1A 1E4OA 1LQTA 2HBQA 4O4JF 1MVNA 4KVGA 4HFRA 4X7RA 1SXPA 4Y1RB 2B78A 1SVOA 1U7PA 2BKVA 2WWHA 4NPCA 2GCOB 3A6DA 1VI5A 3T38A 3NC4A 4AN0A 1NONA 4H4CA 4QDUA 2O4CA 5TLSA 2PKWA 4MKHA 4TMXA 1Z88A 2VDPB 3ZHCA 1J4AA 4B0PA 4GC9A 2H31A 5AHXA 3I8OA 4EQ6A 4F5YA 4NCBA 4J1SA 1A5ZA 1P5FA 1ZJJA 3CX7A 3NDJA 5EXXA 3SZOA 1Y3HA 1KMQA 2Y93A 9ABPA 5JDIC 3ME5A 2XXJA 3GOHA 3QE3A 4BDTA 1VMIA 1RQGA 4YC7A 3U3RA 3MUNA 3A1UA 1L7RA 1YBHA 2DETA 4LF4B 2VR1A 3A3PA 4O2RA 4FZVA 4F3KA 2F90A 3T4PA 2XUAA 3KETA 1ZIDA 3F6CA 1SEPA 4KQ2A 2GEJA 5IYZF 1U9YA 4UOQA 1QU3A 3E48A 2XZLA 3IRUA 2BYTA 2FUKA 4AZWA 1DRWA 3IXQA 4GYYA 3WWZA 3OZAA 5K0FA 1FJXA 2AE1A 3A1EA 4URXR 4LE2A 4BRUA 4O8CA 3REGA 4U7FA 1X19A 1I51A 3ZCPA 5BN5B 3GPLA 4CIVA 2XMCA 1AMUA 4I6JA 2XMZA 2A6PA 2L17A 1CVIA 1Q7RA 2WIAA 1UPCA 4LYJA 5EIOA 2LNDA 5EOVA 1QS0A 5B1IA 1QORA 2G0AA 1FYFA 4Q21A 2BW0A 4AK1A 2NZYA 3E5HA 4PAMA 3BAZA 3VPHA 4FOSA 1HOXA 3RIXA 1YBFA 3KT0A 1ZD4A 2XTZA 3IMEA 3G17A 1PBNA 4JEUA 1K9VF 4GRDA 2O2CA 3S27A 4B8YA 5JCJD 1KEKA 2W9XA 1I1QB 3A9SA 4M0CA 3EXG2 1J2TA 4V0NA 2C29D 2TMYA 2Q1XA 3RAJA 3ZD9A 5EESA 4RXTA 2BMFA 2OO5C 4DYDA 3F6YA 1AKRA 1VMKA 4KDFA 5REQA 3LKZA 3ER8A 2L82A 1TE2A 2JD0A 2P8JA 3QKUA 1KQPA 3RU2A 1N33B 1ARZA 4IUCS 3T5BA 3CE9A 4LV8B 1AB6A 1JG7A 2QX8A 3T3MB 4EELA 3T3HA 4OHXA 4JI0B 3EVTA 4BFTA 4B47A 4KI0A 1K8XB 3TXAA 2OE2A 1ELOA 2XTJA 4FOOA 4G0MA 2X8JA 2ZBFA 3VAAA 4DADA 1HR0B 1S1MA 3CGWA 2QJRA 3ETGA 4EAQA 3KZMA 3JZDA 3AKCA 1E3MA 3RABA 2C4TA 4X1KA 2BM1A 4V1CI 3AEKA 1H3NA 1GVNB 5CEFA 4FCCA 4DZZA 4QUAA 1JDBB 2F2TA 2XNCA 3F46A 3GJZA 1LTKA 5C80A 4MULA 2CLHB 1P9RA 3OP1A 4MGHA 2AFHE 5I9IA 1QIMA 1HE1C 1UPBA 2DBYA 3A32A 2FSIA 2QQGA 2VUUA 3ETHA 3VR0A 5JOQA 1P0QA 3HGMA 5K0SA 4RSGA 2J5XA 4JUAA 3FLMA 4U0JA 1HH4A 3V4LA 5JZ9A 2ZB8A 1ZIOA 2XHEA 2UVDA 3WGNA 4UBJA 5B6JA 5FAKA 1USWA 4MIOA 2NX2A 2J1LA 1J5PA 2ABWA 1PWZA 1XHFA 3OX1A 4ND2A 5J59A 4EO9A 3EBLA 5JQWA 1SCUB 3CM0A 1ZVJA 2ZI7A 1FYVA 1EE1A 1QHHB 2FXIA 2XHZA 3OT5A 4FCWA 4ZU6X 5CBPB 3BAFA 3GT0A 5JCOA 4TXNA 3EZ7A 4BZXA 3G2NA 5A5VA 3S1SA 1PSWA 5FFMA 3DAHA 3VKGA 4COKA 3T7EA 3KPYA 4XDZA 3UMBA 1CJSA 3GCDA 3T9FA 2WJGA 3OG9A 2BVNA 4HDSB 5DTJA 5HEKA 3LFHA 4E3ZA 2XGMA 4AO7A 3O4HA 4EA9A 1R8XA 2BP7A 1LD3A 1OFUX 3D6JA 3DFZA 5FPKA 2ZJ7A 2W6QA 3LWDA 1GCAA 2C4UA 2OORC 2GHQA 4QHYA 3IHKA 5DHAA 3A9CA 4Q02A 1MJHA 5CFOA 1WUYA 2NO4A 3WBKA 3K9NA 3TIXB 1GPBA 1X1TA 2HMWA 5FBLB 2BGLA 2QENA 5FXMA 4PPYA 3PHGA 5TDHA 4F4FA 5IKEA 1AG9A 4MQUA 1TUGA 6CHYA 5JYEA 1WW8A 3KYJB 2ZSUA 3AUSA 4RCZA 5L7TA 5DM2A 5J9GA 2PL9A 1JV2B 5T67A 5JYCA 5JALA 1UZUA 3ES9A 3T7DA 2Q7DA 1WHTB 4XPZA 3IEVA 2X8LA 1OLXB 2E4WA 2RKBA 2OHFA 4QKQA 1BRTA 4OVKA 5CD1A 2BGIA 4IJMA 4MQ4A 4YONB 1Z83A 4QDOA 3OQIB 1F06A 1Q1AA 3AU9A 4FLEA 4N5DA 4PZAA 4RPIA 1TW2A 5DTRA 2PZBA 5TNXA 3PNYA 3TZBA 3VVMA 3W6ZA 4F71A 4ZVTA 4JJEA 2CXRA 4C5CA 4ETNA 5CDSA 2XZOA 1T5SA 1FFHA 3EISA 3BA1A 2BUCA 4NH0A 1D2RA 1B0UA 2ETXA 1C8LA 2Y0CA 4X5OA 4N0EA 3V42A 3O8CA 5G0TA 4ZVRA 2CLSA 2BFFA 3BF8A 3JZFA 4Q9IA 1MQ9A 1V1MB 1Z33A 5F2NA 5JC8A 1R9GA 3FWZA 3I9V1 3R6TA 1L5LA 1NX6A 1E9VA 1NKTA 3BWCA 3DFUA 5JDCC 3T9AA 4AJJA 4MHTA 4PG5A 1LI4A 5C5CA 4K28A 4W5TA 2BI7A 2GWHA 3IBSA 1RAIA 3PJGA 5FL7D 3WXMA 4NJOA 4B71A 2HW8A 4YO8A 5I7UA 1Z5ZA 1M83A 3LLCA 4ZMRA 4HL6A 1UC5B 2XVYA 1ZRHA 4OREX 4GQIA 4HWSA 4ZXFA 3BIFA 4B6OA 1S1CA 3GCXA 3NJ8A 1SRRA 3D3WB 4JYMA 8GPBA 4FMDB 3GEGA 10MHA 5DW0A 1R4NA 1VHJA 4J0GA 2H16A 4IQFA 1QRUA 1SKYE 1E9FA 1UDAA 2JIQA 4ALLA 1YL7A 2QW0X 4Q6WA 1IUNA 4JJ8A 4MLCA 4B3XA 3ETDA 1E6UA 1CETA 4PWYA 2VRBA 3L7LA 1YC5A 1TB4A 2PMBA 1FMLA 2GPBA 1Y3IA 2IEGA 3DUWA 3UK7A 3CVWA 3ZD6A 1EX7A 2O19A 3W7BA 2CBXA 2QYOA 2NU9B 3H9CA 5DM4A 1C9MA 1EK5A 1BDBA 2PT7A 2DLNA 3PJEA 4PW0A 4LHYA 4WERA 3C3CA 5ERYA 1G9TA 4LY3A 1UOEA 5CJJA 3V4RA 2QQ0A 4D4MA 5I7RA 3IAFA 2ZCVA 3RSFA 2F7SA 4B83A 4OB7A 4F6CA 4F4HA 2CVFA 2FDRA 3P26A 4TTAA 5FPQA 5AVXA 2G1KA 4R1SA 4KGXA 3PYLA 1VQ1A 1XZIA 1E5QA 2GN9A 4BVHA 2KMLA 1XDGA 1MOZA 2GBPA 3TTSA 5FUMA 1WL8A 4MS4A 2OCXA 4M89A 3TNFA 3U7JA 4B46A 4RTSA 4YJ3B 3IDQA 2P7IA 1PT8A 3DMYA 1M76A 5ILQA 1XYYA 4JIGA 1I7CB 2R00A 1SIBE 5AICA 1RWBA 2BJHA 3DZ5B 4WAUA 1J99A 5DX1A 5FFFA 1G7TA 3CT4A 3NBZC 1QO0D 3CX8A 1ZOIA 4XFKA 5EXSA 1TQ6A 3PTAA 1YUMA 4A36A 3CGGA 5AQ1A 1K63A 1OYVA 3BRWD 4PC3A 5FHQA 4CETA 3DTVA 4X95A 5G3YA 2ZB2A 4V0ME 4JLOA 4Q4AB 4RADA 3F6EX 3NWEA 4G8BA 3FB4A 3P9CA 4S1TA 1KQGA 4JI4B 4V0KA 1IBLB 4G8CA 4N3AA 1XAGA 1U0OC 3LSTA 1K92A 1C4OA 1U1IA 3LW7A 1TM1E 1UBRS 3CS3A 3I1JA 1SPBS 5DLDA 3SXJA 4AWAA 5KTMA 2R1UA 4ITVA 5C8YA 1E59A 2E85A 2PKXA 4ZOEA 4JLNA 3DAYA 3V34A 1FS6A 2J6BA 5A71A 1ESMA 1OVGA 3H0VB 1IHYA 4CUZA 9MHTA 1OBOA 2AOTA 2HC9A 5E9WA 3B6IA 3PB3A 3IR5A 4BP9A 3I5MA 5CRIA 2VNHA 3C8DA 2XMPA 4MROA 2H4FA 3GT7A 2OPBA 3A27A 3DDNA 3BXPA 3CF6R 5DWQA 2LP4Y 2NXJA 1RPJA 2TMGA 4FBLA 1QXSA 3COZA 4OLAA 4EVIA 1Z4KA 3ACDA 1N2OA 2AXPA 3C41J 4D8WA 1OIWA 5JFGA 4LNHA 4AJKA 1LK7A 1M6HA 1O5TA 4ZD6A 3C7DB 3WOHA 4J1QA 1EWKA 1QF6A 1O6BA 4LIPD 4OOEA 4B2LA 2OD9A 3P0FA 5DM60 2H3HA 4J76A 7AT1A 1DAEA 5JYBA 3AUXA 1TX4B 2FOLA 4IGEA 1XL1A 3HBLA 3SJCA 1ULSA 2VJYA 4GPEA 5TV2A 1OBFO 2D1TA 1JHQA 2NV6A 3EPAB 4Y7DA 1CY7A 1EVYA 1KMHA 1L4EA 2B94A 2BMEA 1XN1A 2NU7A 3BVPA 3EVCA 3LPLA 2XCIA 2IVZA 3IPXA 2IS1A 3BXEA 4MLZA 4OFXA 4G9BA 3OP4A 5CU7A 1FRQA 1CRQA 3FWYA 3A4TA 3MG9A 1Y5RA 2D5IA 2ID8A 4YNBA 1J42A 3U80A 4G5OA 2LW7A 4D9IA 4UQLA 2YHIB 3NALA 1CUAA 3D0QA 2DQ4A 3C97A 4PLHA 5FOSA 2C2WA 3N2IA 2FSUA 3HA5A 3C7TA 4LBVA 2GN0A 1QG0A 1CK4A 4ALNA 4AKSA 3KHKA 4RQBA 2I6TA 4BNDB 3FUTA 1KY2A 3V7UA 1H8EA 1VLVA 4NE2A 4BQRA 4YRGA 2Y67A 3X1ZA 3PVZA 2ZQYA 5CLHA 2JJ1A 3IPYA 3OTQA 3RS9A 4C6RA 4KAXA 5LP6B 1XMQB 1WB5A 3EY4A 5B4TA 4D92A 1B74A 1FBNA 4CQMB 1TZMA 2G83A 2I6GA 3U44A 1XK6A 2Y4OA 1YZLA 3VR5D 3GRKA 1BGXT 3INNA 3HV0A 4G0PA 5FDFA 1ZP6A 2FUG6 1PVDA 4A23A 1EXWA 3EVNA 1E2HA 1AZTA 1GUFA 1Q12A 2JAQA 2Y1EA 4IMJB 4PINA 3ZE8A 1EWRA 3ZGVA 3TLGB 3ZX4A 4CIDA 1QTNA 1S3FA 4HB4A 4M9RA 2XKKA 3QVLA 2BEJA 3TJZA 4E1AA 2PZKA 4ZYYA 2IHJA 4D9CA 3IGFA 5ADWA 3CYFA 1KHTA 2K7FA 2R1TA 1FMTA 3RRBA 3GFSA 3HRKA 4PNHA 2RBKA 5AIBA 4K9RA 3WMFA 3RHZA 3E8XA 4LY6A 4QGAA 3W5BA 4MKGA 5BT8A 3BE6A 3OJFA 1DT3A 1SUBA 4HH3C 4P4GA 4BWVA 1G4HA 1GPH1 4XWOA 1IBMB 1TIKA 3MWLA 1ZSVA 1VPWA 3NASA 1WOYA 2KJQA 4G1EB 3ROTA 4YP0A 1FL9A 3BGVA 4LS3A 1MFPA 4WZAB 4U7HA 5HUHA 2IY8A 1SC1A 3BSYA 2RDMA 3BWDD 3R7AA 4ZOLB 3VVLA 3WMGA 5JSQA 3T5GA 4DV3B 3RSQA 3U4CA 1YS9A 3LX5A 1ENYA 3K72B 3PUIA 4WY8A 4BB5A 1DU4A 3RVKA 2WUWE 2BZGA 2G0NA 5IABA 1T2UA 4ZZ1A 2H1HA 4Q4DA 4QRIA 4DJAA 2J6CA 1N3LA 1W5TA 1NP6A 4XX0B 3M5CA 5A4JA 4Z2AA 1NYLA 1OFUA 3PC8A 1F2UA 2P6RA 1M3SA 3HJGA 1UJMA 2GDZA 2IX3A 3OOHA 3GRUA 1KF0A 3ONFA 3SI7A 2WFZA 3LC2O 5C8VA 4MQEA 2OENG 1DCKA 1SZPA 3KLOA 4G8JA 1GNSA 1JSLA 4I1PA 1CS0A 4C7OA 2HQBA 5EJAA 3QOYA 5IXSA 5ESDA 3U3XA 2GVZC 3DMPA 3F4KA 3QKTA 2YWHA 1XJ5A 1LRLA 2N1MA 2O8BA 1TC1A 1HSZA 1P0FA 3GJ4A 1DEHA 4H59A 3NVAA 3AVPA 4N76A 4Q01A 1ECGA 3CNOA 5KVVA 4N48A 1MPTA 2B0CA 2GA8A 1N2ZA 3ENWA 4IWNA 4QYSA 4LY0A 1YBMA 3Q7IA 2QVYX 5DKFA 3VTAA 4LK3A 5GADl 3IE2A 2GCOA 4HUTA 2P6MA 2JEOA 1Q0LA 3PEWA 5IANA 2GFQA 5JZSA 1L7DA 2IYLD 4W9NC 2VEOA 4JLVA 2W43A 4YREA 4PQFA 4URFA 1DEKA 1GP2A 3UGJA 4DM4A 1RBMA 4FX2A 2I3DA 4P38A 4EMTA 2IGTA 2B92A 2F9FA 1Y1TA 2NYAA 1FDOA 2D1YA 3F7NA 3U4GA 3LU1A 1PE0A 4CPDA 1JAXA 4BNFA 1QBGA 3A2LA 4MTLA 4NDAA 3HB9A 5LQJA 2W58A 2LDBA 2CXOA 2GAAA 2Q5QA 1JNXX 2V5UA 3PQ8A 4FLMA 5AW4A 4DBVO 5KJ6A 1JTEA 1L5QA 4C4AA 1UAYA 1XZKA 4S1VA 5D1NA 2CVZA 2WFAA 1E8NA 3AGPA 3LF2A 1FNSA 1S8OA 2VN8A 2ZRPA 1I3LA 3JCZA 5FBWB 3SQXA 3LMKA 2ACWA 4MQ6A 1ZNWA 4WNIA 3HL0A 2G71A 4D0NA 2Z9CA 3JALB 4EKDA 3HJHA 3T7JA 1IZ9A 2O05A 3PCRB 3VOAA 4RPKA 3ZHUA 4ID3A 5C18A 3ETCA 1U1EA 3GAAA 5DN6A 4AP5A 5BN5A 3HJNA 5KREA 5BN4B 3HI4A 3LXMA 4M1WA 3L46A 1XEXB 3QWIA 1JLHA 3AVUA 2IPXA 5CJPA 4AKHA 3GLSA 3WGOA 4BCBA 4L5BA 2ZRHA 1LWOA 1CJTC 3WLAA 1PAUA 3BEOA 1IXYA 4KQMA 5ITVA 3GCGA 2WU0A 3RRXA 4QYWA 5JNRA 1DV2A 4U7JA 4QUBA 1NLZA 4Z0NA 5ES3A 3LPAA 2QPTA 3IDAA 4KE7A 3WLKX 5FL3A 4YFVA 3OT4A 1VTKA 1M6EX 4WFKA 4QEDA 3DLBA 1NLUA 1POWA 3FCAA 1IK4A 3JD4A 3AB7A 2PBLA 3M82A 2WPNA 3AR8A 1HEYA 3NHUA 3PIDA 3NCTA 4G0OA 4JDUA 5A04A 3EXHB 2VQ6A 3ASVA 1ZDMA 3S68A 5H59A 4PR0A 1YSCA 3KAPA 1PP4A 1Y7HA 3GPDG 1WTAA 4M9CA 3KTDA 4MRRA 5EJ2A 3D59A 1L4NA 4FQ8A 1K4YA 4L4RA 4YAOA 5A7GA 3SIPA 3I6ZA 2YY7A 5K3SA 1LLDA 4LA4A 3C43A 2V9CA 5SICE 1UMKA 5BSWA 5T6MA 3GJ3A 3KFVA 5ALRA 3UK6A 2WMDA 3C8MA 4M99A 5A4DA 4HXEB 4LI3X 4LXTA 5E1MA 4ZVOA 4GM4A 4KN8A 1WEHA 4FHGA 2OC9A 3OWOA 5JZBA 3A37A 3R77A 4PZCA 4RLHA 3V1LA 3WDLA 2EC5A 3ST7A 4QPJC 4UXIA 2H4ZA 4A2CA 2EG5A 1CJVC 1UDCA 1RLMA 3GYGA 2I7VA 4I8DA 3EXAA 2ZREA 4K1XA 3ZWCA 1I72B 4N65A 4R7ZA 1T1GA 1FF9A 1RLJA 1Y0BA 2VZEA 4L4ZA 2PX2A 2FMTA 3FI9A 5M3BA 3O3OB 1XHLA 2O9JA 3ECSA 4N6OA 4DWVA 1VJRA 4COOA 3QE4A 2O5VA 4X94A 2XCUA 1EX1A 4IG4A 1VIMA 4C0BA 2MR6A 4MA4A 1WXWA 4WDQA 1QFJA 4QICA 3JARB 4HX5A 2DKOA 2WQ6A 2OCAA 1YTLA 1RLIA 4G65A 4FE3A 3U0VA 1Z4OA 3TQSA 4BFCA 1I10A 4U2BA 4HT3B 5CBPA 1NUPA 1EQ2A 3P2IA 1SIUA 2C31A 5DGHA 3HJCA 2BZ0A 1N5IA 5CM9C 3FGZA 5DO9A 5LQDA 3T6KA 2NGRA 1GGNA 4MWSA 4G97A 5HYVA 3QEBZ 1NNEA 4YDRA 5CYOA 4WOJA 2WBLC 2ZSAA 1B6TA 3THYB 2UU9B 2F1KA 1RP1A 2QRVA 2W2KB 4V1CB 4C2AA 4K9SA 4JC5A 1MX3A 1RKUA 2WD8A 5J47A 1LBQA 3TD2A 4Y0NA 4BEVA 3O1JC 5BQFA 1U2ZA 4LDPA 4D6YA 2XBMA 1OXBB 4YMTA 2F3SA 2CD7A 3U3JA 2Q4BA 1ZGAA 4ZQIA 3A14A 2COUA 4YRFA 3N05A 5GPBA 4X65B 1U8FO 4RPLA 2GUWA 2QUIA 4KJZA 1V5WA 4FT4A 3ICCA 4C0JA 2D54A 4OSEA 1XTKA 4OHFA 4M37A 3TTVA 1DHTA 1Z16A 4P7KA 5IC4A 1JR4A 3G9UA 2PJDA 2RB5A 2P3SA 4Q12A 1CJCA 4OBWA 2BHLA 1FJGB 1WHTA 3DDZX 3NZEA 1OLXA 4JUFA 3CVXA 3CCCA 4OP3A 4CF3A 2X8BA 2JJ2D 5I9BA 2O4UX 3A3NA 4II7A 1ZA1A 3KQLA 2I9KA 2DPLA 2JD1A 3OQIA 2R1VB 1SUDA 3E23A 3SZMA 3IOYA 3I45A 3MWDA 3EGXB 4L4SA 4TMFA 1LJUA 2IV2X 4I6GA 2M1ZA 4BO6A 1CZOA 4EHNA 4TV9F 5LDGA 5CPFA 5CAEB 2HMAA 3WXBA 4E5PA 3MK31 4J29A 1MQSA 2WJHA 4HDNB 4RGYA 3FCOA 2Z8ZA 4WEQA 4UBNA 1G7CA 4RIEA 1EI9A 1F4VA 4RTNA 4ZRDA 1TM3E 3GIWA 3BZBA 1V1MA 5JCPA 3O82A 4FR5A 3MMNA 4MV7A 3NP9A 4DYVA 4YAUA 1X3SA 3B36A 3GUCA 2VA9A 1U04A 1ZXBA 2ZBQA 5HIIA 1EM8B 1SCKA 4EHDA 1AHPA 2LKDA 4MP8A 1GQSA 4QNMA 2Y0EA 5IJZA 1TEZA 1XPUA 2UYQA 2GXSA 2V55B 3EW7A 1C0PA 3K96A 4PHGA 5LZ8A 1ZH2A 3SEAA 4P3YA 1KI1A 3TG8A 2WP8J 2YJNA 4LE0A 3EEOA 3Q8LA 1RWMA 1FS4A 3VO8A 1NV9A 4FHEA 3RARA 3ND9A 2HLDA 1TCUA 3AOEC 1PIWA 3K9LA 2O0KA 3PFWO 1T4CB 4I5EA 3QVVA 1UPAA 4RAQA 4EABA 4MRPA 4ISCA 3KXPA 2NU9A 1QK3A 2J32A 5JAZA 2A5DA 3NIDB 1VSBA 4KIGA 1VCOA 3K16A 4R1NA 5M2QA 2CV2A 2WM9B 3ZV5A 2Z09A 6PFKA 2GN2A 3TDKA 1QTQA 4DQ0A 4FJ0A 2GH1A 5CIWA 2DFLA 3BH7A 4AG3A 4JODA 5CDHA 5BRNA 4NMHA 1DRUA 1P80A 4W82A 1GPUA 3BK2A 1E4VA 2PSFA 1XFAA 3I2FA 4YJ3A 3NIFB 1SRQA 3TBKA 1XRNA 3V4FA 3W78A 1WV0A 1NPYA 1Q1QA 1VYHA 2F3RA 1YB2A 2GM3A 2MSWA 3AKEA 1L5WA 4PNPA 4L1KA 5HFAA 4C0HA 2H51A 1H4VB 4G89A 3VR4A 2P2CA 4KL8S 1YDHA 2DTDA 3KSUA 1OXTA 2XUFA 4JBWA 1E2QA 4R3UC 4WIAA 5FD8A 1Z18A 5HRAA 3GEMA 3I9OA 1VL5A 2ZZKA 1PR9A 1UZMA 4JC8A 1NFFA 4Q4AA 1XTRA 2R9VA 3WICA 5IRCD 3I64A 5JAOA 4WOPA 2PLRA 1Q0HA 2K2WA 3A8TA 3LT0A 1JKXA 2O2XA 4EUNA 2G1AA 3GRRA 1T26A 2QRKA 2YWRA 3BMCB 1E77A 4IXTA 2NZ8A 2BUBA 3O4IA 5EAIA 2EDAA 1V1RB 2W11A 5HZMA 3HM9A 2R8PA 2XW6A 2OLKA 4YGYA 3IHLA 3TD9A 2YJ3A 4BS9A 1RKVA 3N2EA 3UMJA 2P4UA 2WILA 3OCUA 1WR8A 5BMVF 4HVTA 4IIGA 4P4TA 4CFZA 2ODQA 2G1PA 4Q5IA 1OA1A 3IEPA 1HEUA 2W6JD 4TM7A 4EHLA 3TTWA 3HCOA 4I50B 4HSEA 3T12A 3ZWDA 3NOOA 1BS1A 1RJ9B 3O31A 3UG7A 4PN7A 1A7UA 4Q4JB 2P9HA 3BXGA 3ITKA 2JI6A 3OE1A 3P27A 2GRUA 2P11A 3BMOA 3G85A 1M0SA 5DPMA 3RU7A 4OYLA 1GZ4A 3ZYCA 2VQDA 4CDNA 4QNNA 2CJPA 3KE8A 1R0RE 2XEXA 1GTJ1 3B6ZA 4UNNA 1RYFA 3AO0B 4NJEB 2Q2WA 4C3UA 3ZWYA 4NFSA 3NJ4A 1P2DA 2I99A 2GX6A 4E3WA 4C0SA 2W42A 3H16A 4ND6A 3J7TA 5A7HA 3S0JA 4V02A 2FJUA 4QWMA 1SEVA 2HJRA 2HU5A 4LWOA 2CF6A 2PWPA 4ON9A 3JD0A 1XCMA 1V1JA 2P9TA 1XYVA 4Y2UA 4NK4A 1BD4A 4BE9A 4IDAA 4N3NA 1CUXA 3G9QA 4D57A 1RQ7A 4QUKA 4DIUA 3U7GA 5LQMA 4Q9DA 1IJFA 4EY5A 4OA5A 2VWQA 5H1YA 2IOYA 3UY4A 1PJ2A 2RGDA 1ZCFA 4R1QA 2YHIA 3A3KA 4KE9A 4D81A 5CFRA 1HLPA 3L0BA 4MUKA 4JEHA 2A58A 2ILTA 2AJBA 5IDXA 4TMZA 4CIBA 5KNCD 3E0QA 3OESA 2YFHA 4LV6A 1SN7A 3C6BA 2IODA 3K92A 3RYTC 4EEXA 4BNDA 1C5KA 2GN1A 2NSJA 2QJOA 2YHUA 3JYQA 1OBHA 1VSQA 4EHHA 3MGGA 2X77A 3DTNA 3QJYA 2NTEA 1JAYA 3ZV3A 1SBTA 4M0LA 1IY0A 1V3TA 3AUTA 4O4HF 4BEBA 5LP6A 8ABPA 1QNLA 1RFLA 3CEMA 3DEFA 1BFUA 2FA9A 3ZK9A 4CIAA 2WF8A 5I5GA 4CQMA 5KTRA 5K5EA 4X54A 3C7KA 1GTZA 2PH7A 2Q4RA 4E4RA 5L3RA 2I65A 4MYDA 3KJEA 4RH0A 1KU6A 4IQ4A 1XTIA 3FOFC 2DBQA 4Q7EA 4UUPA 1DUVG 4E5VA 3MAGA 3OEEA 4RIHA 5JWOA 5I8WA 1TVCA 2XNHA 3G8YA 2O8DB 3FMOB 3TIGA 3IP9A 3R7FA 1ISIA 1IDN1 3EMDA 3A4YA 1FNBA 1E6EA 5CCDA 3AFGA 1HMYA 1W8IA 5DXAA 1J2YA 1LI7A 1VPTA 3EXG1 5SZJA 1E7RA 3ADPA 4UU1A 4E30A 3E8MA 1GY8A 3IWCB 1M7BA 1WULS 2QR5A 5KQLA 3G59A 1N5MA 4HHEA 1XTVA 1ORTA 2F48A 4W5WA 4D45A 1HG0A 1QVRA 5JRZA 3RS3A 2UZ4A 3LY7A 4PYRA 5A3QA 3K2EA 2CSUA 2GM5A 1IN1A 1HE2A 4R68A 2H57A 3VDNB 1U7WA 2EZ4A 2OAP1 2R87A 5CCEA 5DVZA 3NG1A 1EP1B 1WMBA 3N7AA 4MI1A 4CDRA 3PGJA 4BO5A 1TQ8A 4ERNA 5E9QA 3A25A 3BGSA 3OWHA 2G80A 4MJ7A 3UMYA 2PMDA 5IULC 1E0JA 1U9CA 3OE7A 3I39X 1WDKA 2QN7A 1PS0A 4OGFA 1FMJA 1K5DA 3LFTA 3AFNA 3LDUA 2O8FB 4XX0A 4NCKA 3D8HA 1T10A 3M5PA 5CNJA 1ODKA 4EPTA 4UZEA 3SHWA 3FTCA 1BW9B 3NAMA 1ZAYA 4KQFA 4R3WA 4Q7LA 1AQJA 4BVLA 1ORVA 1Z6TA 1NMXA 2GYUA 2JZOA 2K4MA 1IHOA 2Q3FA 4KXWA 1NTRA 4RKQA 3U40A 3FJYA 1MT0A 2ZW9A 1R0ZA 2CHEA 2ZSKA 3DE0X 3DLTA 3GJ0A 2VDQB 3OIFA 1DMRA 1BXRB 3NONA 5GONF 5JSHA 2WD7A 1LK0A 4JMLA 1KBOA 1FP2A 4FFOA 3I6YA 3M7IA 3AEYA 3R3SA 4MUXA 2VSXA 2XVXA 3E3LA 2KB0A 2VP0A 4RBNA 1WW2A 5ED0A 1WF3A 4F45A 1WUHS 1OX6A 3G8BA 4PYIA 1NLYA 1FMCA 1DBVO 2CHGA 1MFZA 4MUHA 4ZFNA 1ML3A 1KO1A 1OGYA 3BH6A 2R8YA 3D6AA 2Y76A 4UAGA 1YFJA 2FU5C 3GV0A 1R88A 3PIIA 1WCWA 1VOTA 2PK3A 1HTBA 3MYRA 2BGMA 4RHEA 1HT1E 3MTDA 3EDCA 3GMTA 3IAUA 3KZVA 3HY4A 4MVJF 4RV4A 1EWQA 3Q7SA 1C8KA 3RVLA 4LDAA 1UKZA 3K7EA 1ENPA 3HB1A 4IRXA 5AK0A 2EFCB 1QRSA 2Y1OA 1HYQA 2XMDA 3LVQE 4GWKA 2YQ4A 4HATA 4RDCA 4BB0A 3AR2A 1J5XA 4ZAFA 4XFDA 4PCUA 1QVVA 3GP5A 5B3JC 5K09A 2QF7A 5AJVB 1A7JA 4BP8A 3RJ5A 5H83A 1N2CE 2E9SA 1LW7A 3IQFA 2RAFA 3KHTA 1ZQ9A 2C8VA 4R98A 4U6QA 3KCQA 1PR3A 2P7HA 4O4IF 4HEA1 4KBYA 3P9YA 3I04M 1QE0A 4YJKA 3K70B 3JAWB 1C30B 2V96A 4JOQA 4MRMB 1X1SA 1QAOA 2L2QA 1VL0A 3BICA 3M2TA 3OLZA 4X00A 1ECPA 4FMCF 1U9IC 2DKFA 5FEMA 1KIFA 5DBFA 3JALA 4XB2A 5KYWB 2X4IA 4B6QA 1HTTA 1AOXA 1IUOA 5D5QA 2CLFB 2NTVA 4KG7A 3RF6A 3MLBA 2EJBA 2H4XA 1MG0A 2VNKA 3F8WA 1QLWA 3W90A 3EH2A 2VRCA 2ZI4A 4OQQA 3CZPA 1GPWB 4PZDA 4RORA 5HG0A 1AMOA 1XEXA 1LSJA 3V32A 3DHYA 1Q1ZA 3MTBA 4YBZA 4ACAA 4AUMA 1JU3A 4HQ6A 3RR2A 3CN7A 2O2ZA 5LDHA 1X0VA 3WYCA 2O7VA 3N07A 4IJQA 3UXEA 1KRWA 2QE6A 1MF7A 2ZS8A 3F3MA 3BBPA 5AVKA 1Z08A 4JD5A 1U7TA 2DULA 1P6QA 1YZTA 2QLTA 1ZD2P 3AJDA 4K6OA 1H05A 2YJ5A 3T9DA 4D0RA 2BKXA 2PMKA 4NYIR 2DC1A 2AGVA 3OIGA 2QTNA 3P9RA 1LB1B 5KKAA 1MIOA 1R9JA 3MCUA 2C5EA 2PLAA 1BRMA 1Z25A 3B1VA 3DPUA 3EXHA 4H7DA 1IG3A 2CE2X 4LCBA 1PBTA 4UU7A 2ZJYA 2Y1KA 2B4KA 2IY9A 1CQWA 1ZH6A 2AX4A 3QXJA 3RT1A 2VDJA 4ZQCB 1FMFA 4IHJB 1RQ2A 5T5QA 5B64A 4E7PA 2IH2A 5FEUA 3LTNC 3N8DA 2G08A 1O94A 2R6ZA 3RVSA 4DL9A 2JGDA 3BGOS 3ZQ4A 1SUIA 2W90A 1PV2A 2NAPA 1NG1A 1I2DA 5FADA 3TQHA 3N3BC 4E22A 3SQWA 1N4DA 2FP4B 2FWBA 1SQSA 3IV6A 2W48A 3DVLA 2PL3A 1XMPA 1X87A 1R0XA 1RWQA 3D3KA 1OHHD 3ZI7A 1D6JA 3EJWA 2GAIA 3L93A 3EA5A 1I9CA 2VK2A 3QM1A 4HGPA 3WLJA 3PDHA 2VP9A 4XCXA 3WK4A 3HC7A 4J43A 2WLSA 4KMSA 2DUUA 1UEJA 3ESBA 4L8WB 1A9PA 2ZUBA 1Z0IA 5L51A 5AXCA 1E1YA 5K6AC 1C29B 4WLUA 5EHNA 5PNTA 1CUHA 1E4YA 2VSNA 3PF9A 4R8KA 2TS1A 2HH9A 3WLRA 3NNNA 3P94A 4Y1FA 1C0KA 1E1DA 3DCYA 3MHPA 2FQQA 4JHXA 3JARA 1BO6A 1CZRA 2ZJ8A 3TOVA 2QSJA 3BRQA 3PV0A 5CDUA 5KBYA 1W34A 2CFOA 2O5CA 4YMIA 4L76A 4N5HX 4WADA 3E84A 4E5UA 1G3RA 1YS1X 3VR6D 5KOJA 3O4GA 2RBEA 4OQEA 2H85A 3ED1A 3A9TA 1MRNA 2J59A 3E9YA 4U6NA 3MS4A 4UVHA 1NN1A 4BRSA 4MV1A 1IC6A 5BV1A 2CMKA 4HWPA 1DBWA 3THYA 1RXEA 3DC7A 4X3OA 3EGOA 4LF8B 2W2KA 2HA2A 3EDOA 3GLRA 3X43A 4IDBA 1THGA 2N9UA 1XPRA 5IAJA 2AXNA 2B4AA 1G291 3O84A 4JLMA 5FF9A 5KVQA 4TT3A 1WE2A 5IVDA 1IJBA 2J4DA 1JDTA 4CWAA 4DJFC 4I55B 1ZL0A 2QMQA 2P9JA 4OKNA 4DCNA 4OHYA 2QRNA 2BV3A 1UMBB 1KA9H 1V7PC 3VSAA 4QGGA 1YAHA 2QUHA 3GK3A 4I5GA 3ZJ4A 2RGNC 2C8JA 4RMJA 4RK6A 1QX3A 2H1CA 2RIPA 4AF6A 2XCSB 4IXDA 3KEFA 4FCTA 5FPHA 4BEWA 4DR2B 2X5XA 3OIUA 5IBCA 3UJNA 2G72A 3HG7A 2E21A 2AN4A 1JKMA 4O4LF 4YAFA 3VDMA 4AECA 5JJCA 4KO4S 3TRIA 2PH3A 3L4BC 4M49A 3PQ2A 5B3KA 1GAEO 2C3MA 2HZ7A 3N2NA 1KEUA 1PR2A 2B1GA 4Q3LA 4WASA 3DDUA 3DV0B 3HP4A 3OO0A 2FG6C 2P5YA 2PQ6A 3EG5A 4N47A 3ZIAA 1QKJA 1BE6A 3CW9A 3K0AA 2EF1A 2ZM6B 1NXTA 4MB2A 4HDNA 1XRLA 1AO3A 3C3MA 1A2OA 3H6GA 3KFXA 2VXOA 2QAIA 2VG8A 3KTAB 1LX7A 3KRTA 3DH0A 3RNOA 2YN4A 3TCNA 3BKWA 4C7VA 3AM1A 3F5QA 7YASA 4TMWA 4DR3B 2VZ8A 3LUBA 3R0JA 3GT4A 5FA8A 1NOKA 4HC4A 3BT7A 1NE2A 1P7WA 3RSSA 3ZW8A 3IL2A 1VG9B 3DXZA 4ZCTA 1CUFA 1UBEA 2H8KA 2RHDA 3M3HA 3ND8A 3PIRA 4QTZA 5E7IA 4ZCLA 5TQ0B 4JYCA 2REBA 5CD9A 1BFDA 4FT2A 4I1UA 3F4LA 3CZMA </