4NHEA

The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with nadp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
b'MLKLGVIGTGAISHHFIEAAHTSGEYQLVAIYSRKLETAATFASRYQNIQLFDQLEVFFKSSFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAVSQPQEWFDLIQTAEKNNCFIFEAARNYHEKAFTTIKNFLADKQVLGADFNYAKYSSKMPDLLAGQTPNVFSDRFAGGALMDLGIYPLYAAVRLFGKANDATYHAQQLDNSIDLNGDGILFYPDYQVHIKAGKNITSNLPCEIYTTDGTLTLNTIEHIRSAIFTDHQGNQVQLPIQQAPHTMTEEVAAFAHMIQQPDLNLYQTWLYDAGSVHELLYTMRQTAGIRFEAEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase, Gfo/Idh/MocA family
molecule tags Oxidoreductase
source organism Streptococcus pneumoniae
publication title The crystal structure of oxidoreductase (Gfo/Idh/MocA family) from Streptococcus pneumoniae TIGR4 in complex with NADP.
rcsb
total genus 113
structure length 325
sequence length 325
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4nheA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nheA01
2P4QA 5KWEA 3WGYA 5T5QA 2XXBA 3BHJA 3AFMA 4PRLA 2W98A 4EYEA 4CM5A 3I9MA 2AXQA 1T1RA 4GSLA 4NFYA 2XF8A 2DVMA 1PR9A 2ZQYA 2VRBA 3TWOA 2X6TA 4YTEA 4IJUA 3PZBA 3DZGA 3GGPA 4CLRA 3CZRA 2C5EA 4D46A 1VKNA 3PFWO 4S1VA 5MDHA 1HF3A 5JAQA 3CEAA 1SOVA 4BNUA 4FD3A 2CD9A 1C0LA 4KMSA 2FZWA 2CVQA 2W4QA 4E2XA 1GTMA 1YO6A 1C0KA 1Z75A 3L9WA 1YB4A 4JNKA 3O8QB 2P2SA 4AL4A 5CEEA 4KDFA 3PI7A 1HYHA 3PTZA 5EPOA 3WMXA 3HFGA 4C7KA 2X23A 3GLQA 4NU5A 5TJHA 4WECA 4CV0A 2TMDA 3GRPA 1EMDA 1HXHA 4UEOA 4F46A 4XYGA 3F47A 4LMRA 2EXXA 1E6UA 3DBLA 4CV3A 1H94A 5ES3A 4UULA 1O0SA 4Q3NA 2VCYA 4Z6KA 1FDVA 5K6AC 2P5UA 2X5JO 2IXBA 4GX2A 3AUSA 2GRAA 4IGEA 1QLHA 1E3IA 1M66A 3GNQA 1KY5A 4AJ1A 2BFAA 4R1SA 5JDIA 3WQRA 1DC5A 4FBGA 3IP1A 2EEZA 4XIJA 1E7MA 4EZBA 4E12A 1I30A 1KETA 1A27A 2VUTA 1UDCA 1MGOA 1UUFA 1F8FA 1HT0A 4FIZA 4QUKA 1Y6JA 1PJLA 2X1HA 3PHHA 4D0SA 2HRBA 4BO7A 3C1AA 1JN0A 3ZWAA 3OETA 1ZSVA 4HKTA 4IQ0A 1K5HA 4E33A 3D64A 3H7AA 2B4TO 3OJEA 1WNTA 3LC2O 3RC7A 1ID1A 2BD0A 1HYEA 3VPSA 1U7HA 4IJKA 3E5RA 1HYGA 5L7YA 1Q2XA 1C1XB 3DMYA 1SCUA 2BI7A 4TQGA 2E49A 3I3OA 4K6CA 3KRTA 3RSHA 4ND2A 1ULUA 3JQ9C 4BNWA 4YT4A 4PG4A 4HX5A 4B4OA 4J90A 3B1JA 4YT8A 3JQ8B 4PGFA 2PZLA 5IDYA 5ILGA 1QYVA 2EHDA 3KUXA 3M6IA 5AYVA 5CDYA 2PGDA 3ETDA 4YA6A 4D3FA 4I1IA 3LVFO 2QZZA 5BSGA 2V6GA 3HQ4O 1NWCA 1GV0A 3JTMA 2JHFA 2D5CA 1E92A 4BS9A 4CMEA 2AEFA 1E1LA 3S2IA 4B4VA 3ENNA 3KOUA 4OAQA 3OQ6A 1HLDA 2GR9A 2IZ1A 1KIFA 4W7HA 3E1KA 4Y67A 2Y0EA 4GSKA 1K3TA 1T2EA 4J0FA 3Q11A 1GDHA 4XEHA 4WNIA 1S6YA 1QYCA 2CNBA 3HSKA 1LRJA 4R9SA 4NG5A 2RAFA 3M2TA 1KERA 3QLJA 1B15A 4O6VA 5DZSA 3W8FA 3QHAA 1YJ8A 4BIIA 5F5LA 1N9GB 3L07A 1UXJA 5H82A 4QO7A 4UREA 4ZQHA 4RDHA 3WS7A 2FPPA 1VSUA 4LSMA 3PWKA 4KZPA 3G1UA 3HADA 2PA3A 4UVDA 2YV1A 2ZB8A 4EJMA 4IM7A 1OMOA 4DBVO 2Q50A 3ZH2A 3GMDA 3TL2A 2EJWA 3EAGA 1V9LA 1XIVA 3F46A 4ND3A 2IXAA 4CM9D 4LRSB 3AU8A 4A0SA 1MFPA 3MJEA 4DQUA 1Z45A 3D1LA 1YQDA 3K96A 4Z0TA 1FXSA 3WTCA 2VOJA 4HFJA 3WYBA 4DPLA 1DRWA 2O4CA 3D3WB 3LSYA 3R6DA 4ZICA 2X8LA 3B1FA 3GZNA 3U4DA 4E5MA 1EUZA 1E3LA 2HMWA 4TROA 3M1LA 5GMOA 4BNIA 1W73A 4R16A 4IS2A 4FFOA 5HBRA 1V8BA 3CZMA 2PD6A 4ROSA 5IXSA 5EQDA 4E5PA 4IDGA 3GGOA 5KJFA 1JLLA 2IEBA 1DIAA 4C7JA 1W6UA 1WWKA 3A28A 1T2FA 3HDYA 3RWBA 4TKMA 3EZLA 4FGWA 4HWKA 4CMIB 4RVGA 1NYTA 3HG7A 5F1PA 1HDXA 3ZDFA 4ND1A 2PTGA 3VH3A 5KJ1A 3EGOA 3OQ1A 3QP9A 3DZBA 2WD7B 1YKFA 2AQKA 3U49A 1NQ5A 3HZZA 4B3JA 3ETGA 3U3XA 3RBVA 4XCVA 4HNHA 5TT1A 1U1IA 4FOOA 4PG7A 3TF5A 1GFSA 4RCVA 1MP0A 1ISIA 3IC5A 1BSVA 3Q6IA 1SZJG 1MXHA 3AWDA 3DEYX 4H15A 1NPDA 2VZ9A 4CMJA 1YGYA 2FMUA 4I9UA 3VZQA 1BXGA 2A92A 3L4BA 3AOEA 4LVCA 3K30A 4RLSA 1QYDA 1LQUA 5TSDA 3V2HA 2WE8A 3KO8A 5TF4A 4P8RA 1EVJA 3SBOA 2Q2VA 3T7CA 1BHSA 2W90A 4CL8A 3ENKA 3JQ6A 4RF2A 2X5KO 5A4DA 4IMPA 3N74A 3SJUA 3WYCA 2AQIA 3UCXA 1C3VA 2PZMA 5B1YA 2JHGA 3KM0A 2J3HA 1H6CA 1GD1O 1PWXA 5HM8A 5G4KB 2YDYA 4E0BA 4NHEA 3ZWPA 3UGKA 2DAPA 4YPOA 3A14A 4INAA 2GNAA 4MP3A 2WYUA 1PX0A 1MFZA 3PK0A 5CFZA 3K31A 4NIMA 4F3YA 1NHGA 4OXNA 4ILKA 3GMSA 1K0UA 1E6WA 4IDDA 2UDPA 2RCYA 5KTKA 4WOJA 3AFNA 1Z7BA 3ZU5A 3F9IA 3A06A 4NJMB 3OIFA 4HP8A 2O48X 4YAIA 3ZN2A 3U9LA 4MIOA 6ADHA 1DJNA 2O4UX 3FNFA 2TMGA 3P2YA 1E77A 1VSVA 5BSHA 3V1YA 1B14A 1UJMA 4DBZA 2WWRA 4R9RA 1W8DA 5IZCA 1J0XO 2O3QA 3IMFA 7MDHA 4BO5A 1PWZA 3TZHA 1RYEA 3BMOA 2X0JA 5CG1A 3WLEA 3AUAA 3JQCA 1EDOA 4JGBA 3FNEA 1ZFNA 5ILOA 5LCXA 3S2GA 1O8CA 3GG2A 2IZZA 1HE2A 1ISJA 1GQ2A 3VOSA 4RPHA 3IS3A 3RUEA 1WP4A 1MG0A 4BNJA 1QV6A 3WB9A 5JO0A 5C3MA 4RPLA 2JD0A 5JPIA 3QIVA 3U4HA 3OIGA 2WD7A 1N92A 3JSAA 3BA1A 3DBRA 4M49A 1ISMA 1GEEA 3JYPA 4QXMA 3DZJA 3TZCA 4DUPA 4R69A 2AA3A 1LC0A 3VPHA 5FFFA 5C7LO 5FYDA 3TQHA 4CLDA 1UP4A 1Q7CA 4YQYA 3NAQA 2QIOA 3RAJA 3ZGYA 5DOVA 4E30A 3H9EO 3WXBA 4BKRA 4O63O 5KJCA 3DHEA 3S2FA 2B0JA 1E7SA 1M76A 3BMCB 4XQGA 4GVLA 1Y7TA 4MPDA 4YRDA 2G82A 4QEDA 2NM0A 1Q7GA 2Y1FA 3FWZA 3VDRA 4CMGA 5FI5A 3SJ7A 2QHXA 3OF2A 3R3JA 3WOHA 2E82A 3DTTA 1HLPA 3IJPA 5L4SA 1A9ZA 2FHSA 4E13A 1A7KA 4N5MA 3EHEA 5U9CA 5T57A 2J6IA 3O9ZA 3AJRA 4WGGA 4BHTA 2NSDA 1R4NA 2I66A 1UH5A 4JBGA 5CDTA 4M54A 4E21A 2PH5A 3AY6A 1MX3A 3TJRA 1WLYA 4CLHA 3DO5A 5EIOA 4MKRA 3NUGA 4QTZA 5COAA 1PZGA 3RU9A 4DQVA 2QW8A 1ZMTA 3B20A 4E5YA 1R4MB 3I9NA 2PGLA 3DBHA 3RCBA 3DBVO 1FDUA 5DP1A 2PFGA 1ADFA 1EVYA 1IE3A 1O6ZA 4EI2A 2DKNA 1KC1A 4ZJUA 3IUPA 2UUPA 2V65A 3H5AA 4J9VA 4CR7A 2HRZA 3TZQA 1H9BA 4GGPA 3W6UA 1KY4A 4IBOA 4PLTA 2AQHA 2OOSA 4U7WA 3CMMA 3NDRA 4YRBA 1PR3A 2R6JA 4K6FA 4BO0A 1SEVA 5I8WA 3VPXA 3U0BA 2X0IA 4QO8A 4AJPA 1JU9A 4MVJE 2A94A 4PLPA 1DHRA 3ZWVA 4ZQBA 2J5QA 4YJGA 5JAZA 2GF2A 2OUIA 2PKQO 1J4AA 4AG3A 4JK3A 1GPDG 4I5FA 1R0LA 5A9TA 2JD1A 3AY7A 3KZVA 5IG2A 2NU9A 1B3BA 4YRAA 1RM0A 2O50A 4I9HA 2VYND 1LDNA 5DDIP 4RPJA 4E2WA 3PJGA 5IFLA 1YXMA 1R0SA 1CJCA 5C37A 4XDZA 2B5VA 5DCUA 2V7PA 4IDBA 4XD2A 3ZNOA 1X14A 4CM6A 4DTIA 4EGFA 1T2DA 4XR9A 1T1SA 3BXXA 2A35A 3TDKA 2P9EA 4NDNE 3VZRA 1LJ8A 3I6IA 4X54A 1E3WB 2D4AA 1K2WA 4QQRA 5FEUA 3KSDO 1LDEA 4XR4A 5ER9A 2CVZA 4DWVA 1XEAA 3DZFA 1OOEA 2NVBA 3UAGA 3EC7A 3JQAB 2ZK7A 1DDOA 4BNGA 1VM6A 1LSSA 3C1TA 1HDCA 3TOXA 4AICA 2R00A 4RV9A 4RF4A 2Q45A 4NBTA 3H2ZA 5BNTA 2PLAA 3JQ8A 2DUUA 4YJFA 2NU8A 4RPKA 4ZQGA 5CDGA 1HSOA 1SPXA 4Y6RA 4YJFB 3VVCA 2HDHA 4EEZA 1YE3A 4LGVA 1PJSA 4PZCA 3ON5A 2GZ3A 3GZ4A 2QRLA 1P1KA 3PZRA 3GF4A 1XU7A 3PLNA 4R41A 4XGKA 4AFNA 3FD8A 3PQFA 5BSEA 3QY9A 5L4LA 3RC2A 1DXYA 4IQGA 3V8BA 1HEUA 1E1NA 4YBZA 5ER6A 3GRKA 4A73A 5TT0A 1S7CA 5EESA 2VTDA 4TWRA 3RC1A 2Z1NA 2VRCA 2I76A 1XU9A 3HDJA 4R54A 1B8UA 1IHYA 1V6AA 2P91A 3OFSA 1AHIA 1I2ZA 1P31A 1YB1A 3FCOA 3MWEB 3FI9A 1H2HA 1UZLA 3C8MA 4YT2A 1A7AA 3P5SA 4H16A 4CMHA 2V6FA 2WYVA 1NFFA 4PLCA 1F0YA 2P68A 4OXYA 1MB4A 2C59A 2EP7A 2HO5A 3C7DB 4OQYA 3VKUA 4BMNA 3BAZA 3Q9UA 2RHRA 4HFNA 4D43A 4LW8A 1UXKA 4TZKA 5IF3A 4L74A 1IB6A 3R0IA 1F06A 5JE8A 1PZEA 1R15A 2HQ1A 3HN7A 3WGGA 3GN1A 4DC1A 3GUYA 1IL0A 1Y1PA 2FOIA 4YR9A 4FB5A 3LZ6A 3L6EA 1I32A 3EY4A 4AJEA 4N5LA 5I7SA 4Q3BA 4FR5A 4IDFA 1B26A 1GUYA 2Y1DA 4IPTA 2DTEA 3HFSA 1SB8A 3AW9A 4CUJA 3BMNB 3JQDA 5TQVA 4AJLA 1Q0QA 3LF2A 1V0JA 1EBFA 4J4TA 2H63A 2YV3A 3QVTA 3LC1O 1ENOA 3AUTA 1RKXA 4YACA 1LQTA 1ONOA 3K92A 4DA9A 4XYBA 1KVUA 4WASA 4L73A 4PFJA 1DRUA 2XOXA 4II2A 3L77A 3W1VA 5DF1A 4D0RA 1EVIA 1A4IA 5TGDA 3VPGA 4IZHA 3UH1A 3ABIA 4WCDA 1VJ1A 3FTPA 1JVSA 1PJ2A 1PJ4A 1P1JA 4RVHA 2Y93A 1GAEO 1QXSA 2Q2QA 3LC7O 4FN4A 4JX8A 3H5RA 4OIMA 3WTBA 4CMAA 1TI7A 3DAFA 4JLWA 4GWGA 1SC6A 5J23A 3DONA 2Z95A 2FSSA 4RVSA 2CVOA 4NH4A 3VH1A 3I5MA 5JAIA 4OXKA 1HDOA 2DBQA 3MOGA 1JKFA 2Y1EA 3PDUA 1UZNA 4RORA 4OQZA 1ZK2A 3MJSA 3MJCA 6LDHA 3L9XA 5DOZA 4H3VA 1ZMOA 3INGA 2IZ0A 3WG9A 5I7FA 1GUFA 2DT5A 4J0EA 2FPGA 1J5PA 4NPCA 2OBNA 4CLOB 5A04A 1YL7A 4JN6B 3TZ6A 1OZAA 3OM9A 4IJWA 1OI7A 1TT7A 4K1LA 4WLFA 1NR7A 5EERA 2JFHA 4DPKA 5AXCA 2A9FA 3N58A 4YB8A 2VNAA 3LYLA 1NQAO 3NT5A 1DIRA 1HZZA 5IN5A 5BNIA 4CQLB 1QKIA 4YAEA 2C2YA 4BOYA 1NVTA 3K9QO 2VOEA 3H3FA 4ONEA 1E5LA 3S2EA 1X0VA 2QRJA 1ZK3A 3U4IA 4GL4A 2HJSA 1ZH8A 3CUKA 5HTOA 4CMEC 4JJGA 3JQ7A 1LDYA 1BGVA 3DZIA 5IZCC 5B12A 2P9GA 4KTTE 3R3SA 5L9AA 3NDJA 4MKZA 3I23A 3A1NA 4A03A 3S8MA 4JQCA 3EVNA 2Y0CA 5JC8A 1FMCA 3DMTC 4KWIA 5DP2A 3JD3A 3GEGA 1DSSG 4BNNA 1ADGA 4YJGB 3RJ9A 5JY6A 1GEGA 5ITWA 5EN4A 2O3JA 3E82A 5TX7A 4CMKA 3MTJA 1Y5MA 2OBYA 1NVGA 4XQCA 3LF1A 2O3RA 1NR1A 3FTNA 1CIVA 3OICA 4WJZA 4E4YA 4YDRA 1WDLA 1E7RA 2B4RO 4G81A 4KUGA 5GY7A 4XYLA 3NJ4A 2X9VA 2YFQA 1ADCA 3DBHB 4WEOA 1MA0A 4BNVA 5I9NA 1D1SA 3AI1A 3H3JA 4A26A 4ZN6A 4B7UA 1DLIA 2GO1A 5L40A 3C85A 1OBFO 3E6AA 5U1PA 3AI3A 3BTSA 4ZQEA 2C20A 4I8XA 5ENDA 4OM8A 2DFVA 3OA0A 3W8DA 4EITA 1IZ9A 4FJ1A 3K2BA 4TVBA 3RD5A 1EK5A 2YUTA 1EQUA 3QJ5A 4NMHA 4CL3A 3NEPX 1R0KA 3K5PA 4YYZA 3U09A 2OP1A 4B8ZA 5CG2A 3WJAA 1PGPA 4CR8A 1N1EA 4IZIA 4YWJA 2AG5A 3UXYA 4AJHA 1T2AA 1KOLA 2GCGA 3OQBA 3E5MA 4WCFC 1D3AA 3DC2A 1T2CA 3RIHA 3DDNA 4FCCA 3I4CA 4CM8B 5IDWA 3NT4A 5JC1A 3E03A 4I5EA 4CM1A 4TRMA 4ALJA 3KLMX 4GI2A 1NX6A 1EFLA 3HDQA 4XJSA 4QFCA 4G65A 4O1MA 4CV2A 3VPFA 1R12A 3ICCA 3VVBA 1UAGA 4N18A 3QW2A 1GZ6A 4UAGA 1B3RA 1LLQA 3GPDG 3PHIA 1E3JA 3AK4A 2GUGA 1LDBA 3TRIA 3ONFA 2Q4EA 4F45A 3PYLA 5JDIC 1GCUA 3GDOA 2OP0A 3D4OA 3UW3A 4BO1A 2I3AA 2WYWA 3ANMA 4TZTA 2VN8A 1GPJA 2D5AA 2NQ8A 4GX1A 4J6FA 4FJ2A 2I5PO 4L4SA 2BHLA 3RBZA 3DFZA 5ICSA 1TA4A 1DEHA 1NFRA 1EVZA 4Y6PA 1U8FO 3PEFA 2HKIA 2EGGA 3RUAA 1O95A 4MJLA 2EGHA 3EDMA 4BB6A 3WGQA 1QSGA 1YJQA 2DPHA 2JJYA 3M2PA 4J1SA 5BNFA 3ZWXA 1R37A 3OHSX 3GNSA 4NBUA 2XXJA 4IS3A 3OBBA 3JYLA 4O5OA 2HU2A 2PNFA 1KS9A 1YONA 3ETEA 3INTA 3ITDA 3PRJA 5JFOA 3SX2A 4MVJI 1C0IA 3SLKA 3ZHXA 2FY8A 5IDXA 1E7WA 3ZNNA 4MVJG 1P74A 5CP8A 5H83A 4JXKA 1MUUA 1H2BA 3D4PA 5A05A 2VWQA 3EW7A 1YDWA 2Q2WA 4A10A 1GQYA 1N7HA 1YQXA 2A4KA 1PS9A 2VWGA 2BFOA 1XCBA 4CODB 2WSBA 1DBVO 2X22A 4PLFA 2O3UA 2DU8A 2EKLA 3RVDA 1Y5RA 3FBGA 4B3HA 1LDMA 1SBYA 4M87A 4E32A 2DBZA 4FFMA 4E31A 4R4JA 1PZFA 4L4RA 1DAPA 3GN2A 1Y8QA 3VDQA 3I9JA 3ZNPA 5JCJD 3ZV5A 4L8VA 1ISFA 3SC4A 4IXWA 4XZ3A 4GX5A 3AM5A 4PN3A 3V5NA 1KVRA 2PV7A 1YL6A 2IEDA 3KXDA 3NRCA 4W4TA 2BMAA 1P1IA 2EW8A 4RQTA 2UVDA 1U3WA 1XQ1A 4U5QA 1UR5A 5DNAA 5A1TA 3WBBA 1AN9A 1LXCA 1H9AA 5L95A 1WVGA 2O7SA 2G76A 3PLRA 4PVDA 4BKOA 4KUEA 1HDYA 2P9CA 1CYDA 1J6UA 3KETA 1BTOA 3HHPA 4PLWA 1LI4A 2NTNA 4GKVA 2C7VA 4IGFA 4BO6A 3OJ0A 4B8WA 3GQVA 5FWNA 4WNCA 4PLZA 3QVSA 2LDXA 2X0NA 3KEQA 3LU1A 3PIIA 4XQEA 2NUAA 2EERA 3HE3A 1I01A 4ZU3A 4BMVA 1SNYA 1UDAA 1DLJA 3F3SA 4S3MA 3UKOA 4TRNA 4RZIA 4RZHA 4XA8A 3ICPA 3ROQA 1G6KA 4IXTA 3WGIA 4DMLA 3GFBA 2BF7A 3K6JA 4GH5A 1RM4A 5G2OA 1NP3A 2PZJA 4ID9A 1UP6A 2UAGA 1Y81A 1K6XA 2AEMA 2NU7A 3NX4A 4FFNA 5KIAA 1X15A 3FN4A 3IDSA 1PJ3A 5AXDA 2FRDA 1U2GA 3ONDA 1A9YA 4Y98A 2B37A 4PLVA 4TRJA 1N8KA 1CQIA 4RQUA 4TKLA 4JP3A 4DREA 1PJQA 3E9NA 1JWBB 1C1XA 3K73O 3GVPA 1H5QA 1HETA 1PQWA 2FP4A 1D1TA 4OOEA 4Z3KA 1NTOA 1PJBA 1OC4A 4CM4B 5T67A 3UFXA 5A9SB 4EW6A 5JNLA 1GYPA 3RUDA 3JD4A 2NWQA 1ONNA 4DYDA 1ZO8A 3OSUA 1TLTA 9LDBA 2UV8A 4M1QA 3GHYA 1OC2A 1OAAA 4R01A 1X7HA 3IOYA 1FF9A 4J49A 4EJ0A 5G0SA 3UHAA 1JW9B 3CE6A 3Q3CA 4U8GA 4F6LA 1BW9A 2V6MA 2OXIA 4E6PA 2DBRA 4CMBA 3HUDA 2BH9A 5F1OA 3RU7A 4PLHA 2W8ZA 5KJ6A 2EJVA 2PR2A 1L7DA 5JYFA 1GY8A 2O23A 4PLGA 2E4AA 2VT2A 3CSDA 1DO8A 1U5CA 3NKLA 3COSA 3ZNQA 3PGXA 4AJJA 2GASA 2ZB3A 4RLHA 4GGOA 5KVQA 4U6QA 2X58A 1HZJA 5EQFA 3FF4A 5COBA 3NTRA 1C1DB 4M86A 1A71A 4FJ0A 2HAEA 4FPXA 1ZW1A 4O0LA 3UUWA 3PFFA 4QX6A 3DAGA 4JBIA 1PGJA 1EDZA 1BDMA 1L7EA 1LEHA 1MC5A 4IDEA 2WEKA 2G17A 3W6ZA 5A9RA 4RVDA 3Q1LA 3SXPA 1P33A 4OMUA 5TRTA 1PU2A 1BRMA 5I8ZA 3WJ7A 1Z74A 1M67A 3TFOA 2VRCD 1UXIA 4WCFB 4NFSA 1I33A 4E2ZA 1I2BA 1JAYA 1ZK0A 2ZIZA 3X2FA 3SC6A 1HRDA 1BW9B 3UCFA 4NFHA 2H6EA 1KVTA 4EUHA 1UP7A 3PPIA 4WOKA 2ZB7A 3D4NA 4ZRMA 5L7WA 1NPYA 1VLLA 2CUKA 3ZWOA 1IYZA 5G0UA 1YL5A 5JYAA 5HA5A 3QRWA 3DBLB 3FWNA 4WLUA 4QT0A 3ZV6A 3JQGB 4W7IA 5EL0A 3WFIA 1KVSA 1YOVB 2CF5A 3PHGA 3RUCA 3EUWA 1DFGA 2EKPA 2I99A 3E48A 2NTJA 1LNQA 3ORFA 4PCVA 2GD1O 3WNQA 1LX6A 4P38A 4WPGA 3RUIA 1QV7A 3O8QA 2NVWA 3KEOA 2ZYGA 1VI2A 2YFHA 5K9ZA 1UXHA 1DHTA 2B69A 3JQAD 1XGKA 2EKQA 2IDZA 1ZCJA 2VNSA 2ILTA 3S55A 4CR6A 3UOGA 2FZEA 3GDFA 2DC1A 3PHLA 3OH8A 4KQXA 2Q3EA 5A03A 1YB5A 2PY6A 3QWAA 3TFQA 4DIFA 4L4XA 4PRKA 3DAPA 4K26A 3CMCO 5KVSA 1ZXLA 2JCYA 1GV1A 1ONPA 1T24A 4P4GA 2FR1A 4YEDA 2BLLA 1E3SA 2JCXA 3IP3A 2DLDA 4B3IA 4R5HA 3G1TA 5THKA 1JA9A 3B6ZA 1VKOA 3B70A 3KVOA 3E18A 5ENVA 1RM5A 4ESOA 1I5RA 1XWFA 3K2EA 3MJ4A 1R66A 1I3KA 1C14A 1K89A 4U0KA 3BMNA 3H65A 2Y1OA 4E5NA 2G1UA 4IIVA 2DQ4A 1BXZA 3MTGA 3QE3A 4R3WA 4CLOA 3F1LA 4BO3A 2GYYA 2IYOA 3KBOA 1D7OA 4ITUA 5TJ9A 2OZPA 1YWGO 4J7UA 3MOIA 1AHHA 5KNLA 8ADHA 4J2OA 2VHVA 1AE1A 4CLXA 3ZW9A 1XYGA 1XR3A 4LN1A 1VL8A 1CWUA 3I6QA 1LLCA 2B5WA 3LLSA 5IXYA 2VTEA 3U62A 4CMCA 2E48A 1HDGO 3BZUA 1E7YA 4W9NC 1E3WA 3QWIA 3NGXA 1ZXBA 3VAZA 1BG6A 1DPGA 2W2KB 1P0FA 1H6BA 4ALLA 1SEPA 4FOSA 4CQMA 3IQDB 1WPQA 4OYRA 4HBGA 4WLOA 3ZW8A 2OGUA 4PVCA 3ZWMA 4CQMD 3INRA 5HS6A 1U2DA 1GL3A 4D79A 5T8KC 3MCVA 3QV1A 3S1LA 2CSUA 3IKTA 1KEWA 4UUOA 3FNGA 3PQDA 1F14A 2C2XA 3GNTA 4PG5A 4YAKA 1DRVA 2JAHA 3NJ8A 4ZHSA 4JJIA 4YAJA 5K6AA 4L9RA 3WGOA 1LRLA 4Q3EA 2FR0A 3WSWA 2D8AA 1UZMA 4PZEA 4MDHA 3UICA 3WIEA 3FBTA 2CZCA 2HK8A 1QR6A 2DTXA 2ZATA 2NQTA 1I3MA 4LSWA 5G4LA 5LC1A 4D42A 2D59A 4XB2A 4NK5A 2C0CA 3C24A 4BNZA 1DIGA 1Y9AA 3GHHA 4XRGA 5TS3A 3KYDA 1T25A 1X0XA 2PWZA 4D44A 2Q1UA 5KJEA 5LDGA 4CPDA 1XSEA 5L51A 2R00C 5AXAA 1LBEA 2O3TA 2FPIA 2Y68A 4I5GA 1VPDA 3LT0A 2NLOA 1U7TA 1UDBA 1ENZA 2SCUA 2W2KA 3PVZA 5JYEA 4BNYA 4DYVA 3ULKA 5A5EA 1X1TA 1U4SA 2Q1SA 3EZYA 1N2SA 1LRKA 5JY1A 1NVMB 4Y9DA 2CDBA 4IY1A 5JMPA 1I10A 4JROA 2X86A 3JQFC 1X7GA 3ZHBA 2C54A 1VC2A 1AUPA 1FDWA 4J43A 3KB6A 5FI3A 2UYYA 2Y67A 4Z3DA 2DPGA 3WIDA 1Y8QB 5BR7A 2FR8A 4IJVA 5IDQA 5CAEA 4W99A 4TVOA 4RF5A 1LSOA 1N7GA 1HE4A 2G5CA 3BMQA 3PDJA 5L45A 4ZGWA 4P22A 3RKRA 3JV7A 3BMOB 4XWYA 4XYEA 1P1FA 5DCWA 5MGBA 2CFCA 4IDAA 1QORA 3O38A 3KSZO 3L6OO 4HFMA 5DN9A 4BMSA 3HDHA 1V3TA 1C1DA 2F1KA 2PD3A 5TC4A 2Z5LA 3O4RA 3JQBC 1PS8A 1NAIA 1ZJYA 2EIHA 2PH3A 3PQEA 4ZA2A 5F1KA 3I9KA 1OFGA 5JXWA 4J1NA 4IDCA 5F21A 4DL9A 1DJQA 4GMGA 2EW2A 2W2LA 5A02A 4ALNA 4CLEA 5KVVA 1DIHA 1I0ZA 4OO3A 5L4NA 4DXHA 3A9WA 1T26A 3QSGA 2W2LD 2VYNA 3DBRB 1I8TA 1TT5A 2YHIB 4J4BA 1Z7EA 2QRKA 2CF6A 5DBIA 5JDCC 5IN4A 3LDHA 4EDFA 4UUNA 3RFVA 4G5HA 4DPMA 3I4FA 1BDBA 3ZCXA 1YBMA 1HL3A 3GAZA 1VL0A 1B8VA 1PL7A 3DOCA 2CY0A 1Y8RB 1ZKMA 1P0CA 3F4LA 4BNMA 2YQ4A 3EK2A 2P4HX 1O94A 3OECA 4FW8A 4E2YA 1WMBA 1B7GO 3A4VA 3ANNA 2E6UX 3DXFA 3ZU4A 2X0RA 5J9GA 1GZ4A 3CPSA 2JD2A 3OJLA 4Q9NA 3GR6A 2VZ8A 4GVXA 4LRTB 3L0DA 3ROMA 3GA0A 3DWFA 3ZHZA 4DRYA 1TXGA 2O7QA 3GOHA 1MLDA 5GZ1A 2WTBA 2QZ9A 1XHLA 5JCJA 4BQRA 1QP8A 3V2UA 3FR8A 4NBVA 1GCOA 1KVQA 4NJMA 1W4ZA 2C07A 4LCEA 4ZQFA 2PD4A 3I1JA 1LA2A 3FPCA 3STHA 2YHIA 2GDZA 3TSCA 2Y1CA 4I9NA 5JYDA 4FC7A 4Z0PA 4EUFA 1CRWG 1LSUA 2GGSA 5DBGA 3UF0A 3PWZA 1LU9A 3NDIA 4R1UA 1CF2O 5C5IA 1B2LA 4DVJA 2C29D 4UUMA 3AI2A 4HFRA 4ALIA 3LK7A 4RF3A 3DZHA 2RH4A 3ZU2A 2I6TA 2NV6A 3ADPA 4KTVE 4PZDA 2YY7A 2AW5A 2NADA 3JQGA 3KLPX 3T4XA 2QYTA 1ENPA 1PL8A 2IE0A 3SVTA 1SMKA 1ZJZA 4LVUA 3RUFA 2G0TA 3ASVA 4D41A 1A72A 1IULA 2DFDA 3WYEA 4IIUA 5CHEA 5K0ZA 2H9IA 5KKAA 5L3ZA 4L75A 5CDSA 5EINA 1YVEI 1ZZEA 1HE3A 5C7OO 1PQPA 4GLOA 5F3RA 5FF9A 1IPFA 4MOWA 1FK8A 4XX0A 2OO5A 4FQ8A 2VWPA 4HY3A 4ALMA 2ZYDA 5JMWA 1NXQA 4A5OA 1GR0A 1IUKA 4XKJA 3BHIA 4Q3DA 3IAHA 4ZRNA 4W6ZA 2UUOA 3RI3A 4AJ2A 4CM7A 3PP8A 4AVYA 2VHZA 3AOEC 4GLLA 2YQ5A 5KCZA 3WBFA 5G0WA 4FFRA 5IJZA 4B4WA 1RYDA 4OH1A 3OJFA 3QWBA 3DQPA 2H5LA 1EE2A 1MXFA 4BO4A 5HRUA 4BV8A 5B37A 4E5KA 3ZHYA 4DIBA 2NACA 3VH4A 4PIVA 1I2CA 5EMHA 4CQMB 1P1HA 3VZSA 1I3NA 3QVXA 3TN7A 3GK3A 3CXRA 1R16A 2HSDA 2HK9A 3QWFA 1KEPA 2VHWA 4URFA 3C3XA 5ADHA 5JS6A 3NGLA 4YVFA 1YQGA 4OKNA 1N9GA 3GPIA 4IUYA 4LMPA 2I65A 4K28A 2HK7A 5ICMA 1VJTA 2BFPA 2EG9A 3GUCA 4IQ8A 4J1QA 2PKQP 4DC0A 3JQ9A 3GZNB 2D2IA 4FGSA 4FDAA 1O5IA 5HS4A 3PYMA 2WDZA 2X9GA 4BGEA 4DMMA 2J8ZA 3DFUA 2JFGA 3GT0A 3WICA 1U9JA 4N7RA 1PJTA 1BVRA 2Q46A 3BTOA 3KYDB 4UVHA 5I7EA 3BYZA 3NYWA 2Q1WA 2YW9A 4NR0A 3VH2A 3I52A 3ZI0A 4FSHA 4MKXA 4MVJA 1P3DA 1N1GA 2AHRA 4CV1A 5CDUA 1CERA 1HTBA 1DC3A 3GY0A 1IOLA 2WD8A 3RC9A 3E9QA 5DBFA 1V35A 3DOOA 1XG5A 3ZV4A 4UEJA 1T4BA 2JFFA 3ZWCA 3OA2A 3WNVA 5AXBA 1K6JA 1EBUA 1LC3A 3ST7A 1HKUA 1GQQA 1PZHA 3FR7A 1XDWA 1ARZA 1VJ0A 3JYOA 4PG6A 3KYBA 4P4LA 2ZTUA 1E0DA 3QQPA 2FWMX 4II3A 1RWBA 3NV9A 1J49A 5B4VA 1JAXA 2ZKLA 1F12A 4NI5A 2RBEA 3G0OA 1QRRA 2ZJ1A 1Y9EA 5ITVA 1R6DA 4RJTA 3RFXA 4RVFA 1WXDA 1XELA 4MVJF 1F8GA 1BWSA 1EUCA 3CTMA 2X4GA 4KDEA 4IMRA 1L1FA 2DBVO 4R51A 2NU6A 3OEYA 3BMCA 1G0NA 1NHWA 2AQ8A 4W9NA 3CH6A 1NPTO 1JKJA 1YBVA 4OSOA 3P7MA 4RVUA 4MVJH 2D0IA 4OJNA 1WAMA 1VE9A 2Y66A 4WE3A 4JIGA 1BXKA 4MP8A 5H81A 2NTVA 2XPCA 4BNLA 5I7VA 3U4CA 1N5DA 2VWHA 3FSRA 3OEWA 4BNFA 2EP5A 3D5TA 3NT2A 3I83A 4AJNA 2GN9A 3CKYA 3P2OA 5IZ4A 3LT2A 2X5OA 1HWYA 1PGOA 4B4UA 2X9NA 3WGZA 4KQWA 4BB5A 4BQPA 2LDBA 1PJCA 2POQX 4YQZA 2BFMA 4K9DA 2WE7A 1WZEA 3B1KA 1AGNA 1EUDA 1W0CA 2ET6A 1U5AA 1H6DA 2I3GA 3Q2KA 2BGKA 2E37A 1Y8RA 4UVGA 3VTFA 3LQFA 3ZWYA 5IAAA 4WEQA 3P19A 2IYPA 2HCTA 1E1MA 1ZIDA 2QYSA 1I3LA 4B7XA 3HN2A 2B36A 1NQOA 1H93A 1E7QA 1EEHA 3WFJA 2QQ5A 5JLAA 1DOHA 2IRWA 1AXEA 2J3JA 4J3FA 4BKUA 1YS4A 1C0PA 5T6BA 2PGJA 4O59O 3M1AA 3PWSA 4OSPA 3CINA 4HV4A 3PGJA 4JCOA 3GAFA 2HMVA 2JKVA 3BHMA 4PG8A 2DM6A 4HXYA 2EF1A 5B4TA 4ZD6A 1JDJA 3AM4A 3H6KA 1SB9A 2YV2A 5KKCA 3JQEA 1P9LA 3DL2A 3KYCA 3GVHA 4B7CA 4IINA 4D45A 1WMAA 3DTYA 1NAHA 5G4KA 3HWRA 3DMTA 4U0JA 4YCAA 1P77A 3D0OA 4BNXA 4RPGA 1V3UA 2BI8A 4P4NA 4U6SA 3L6DA 3X2EA 1UXGA 5GZ3A 1WZIA 1FDSA 3ITKA 4EUEA 3MJTA 2AE2A 5AOVA 2VT3A 3H8VA 4Z0HO 3C7AA 2GN4A 1PTJA 2OL4A 4I08A 3WWYA 3L4SO 4Q3AA 4H7PA 2RIRA 5JDCA 3MEQA 5LDHA 2R2GA 2ZQZA 4AJOA 1R4NB 4YAGA 1NBOA 4R1NA 1QLJA 2GN8A 2GSDA 4MO2A 5CPFA 4YJDA 3ZWNA 4ALKA 2DTDA 4AJ4A 3HB5X 3GDGA 1O89A 2YZ7A 4OOFA 3JYQA 3NTOA 3RKUA 4XQ9A 4KWHA 4YJHB 4XDYA 1BMDA 4MVJM 3GFGA 1EZ4A 3DR3A 1EQ2A 3ZWWA 1TB4A 4BKPA 2D3TA 3PXXA 2HMTA 3DHNA 4XRRA 1QYXA 4A27A 4B79A 3F5SA 2Q49A 1ZBQA 4HNGA 4RGBA 3GVCA 1FDTA 2FSVA 3H9QA 4NBWA 1DIBA 2VQ3A 3I9OA 4RL6A 1M2WA 3D3EA 1P44A 4ZVVA 3TZKA 1ZSNA 1HE5A 3H5NA 1GADO 1EE9A 3ASUA 1Q0HA 4BL5A 2C82A 1CQJA 3H4VA 3F5QA 1I24A 5I9LA 1JKIA 1Q1NA 3ZV3A 4WLVA 4A7PA 2OORA 5AVOA 2AMFA 3D7LA 2J5RA 1U4OA 2NVUB 3WWZA 1U8XX 3PJFA 4GX0A 1XLTA 2NVUA 2VHXA 1RPNA 3W8EA 1YH3A 3VHRA 3MWDB 1PGQA 3RJ5A 2YYYA 1IZ0A 3GEDA 4BGVA 5A9SA 1EFKA 1YBAA 3H9JA 2BRUA 4YJHA 4MINA 1D8AA 4NQZA 2XAAA 5U4QA 1VL6A 1EK6A 2YHUA 1B16A 2BGMA 3AY3A 3EMKA 4NJOA 1M75A 1ZSYA 2HLPA 4WLEA 1ENYA 1LUAA 3GVIA 4CM3A 2GN6A 2VHYA 2Q99A 3OP4A 3O26A 4CUZA 1PQUA 4EEXA 2OHXA 2OFPA 1GYRA 5A5FA 5COQA 3D5QA 3W4KA 3FPLA 2O3SA 4UVEA 3RUHA 3RBXA 1Q7BA 2B83A 2PKRA 2QG4A 1PEDA 3RROA 1DC6A 1HDRA 4DLBA 1CETA 3WQQA 2O2SA 1GU7A 5L53A 3V1UA 3ONEA 5CEJA 1G1AA 5BQFA 3T4EA 4G2NA 1ZK1A 4I5DA 4BNHA 3GH3A 3H2SA 4F6CA 4D7AA 4BGUA 1X13A 2RHCA 3GC6A 4WK6A 4TSKA 1SOWA 1KEUA 5GZ6A 4XYMA 5CEFA 1BVUA 4R68A 1SAYA 2ZJ0A 5DULA 3WGTA 3FHLA 4BUCA 1FJHA 4EJ6A 1ZEMA 4OKIA 4M55A 4XJTA 3AU9A 2DUWA 3JQFA 3AM3A 3KSUA 1Z73A 4FC6A 5JCXA 1PIWA 4YXFA 3E9MA 1KYQA 1D4FA 3G79A 3WSVA 1U3TA 3JCZA 5C7IO 1E5QA 2Q1TA 5L7TA 2EWMA 3L4BC 3QA9A 2GZ2A 4NU6A 4J2HA 4GMFA 2FN7A 1KC3A 2CDCA 4Q39A 4TRRA 4MVJP 3H9GA 3QVOA 4L0QA 4Y6SA 3VTZA 4ND4A 1YDEA 1O9BA 4RDIA 5JBIA 3KHUA 9LDTA 2VZ0A 4CMIA 3F1KA 4WKGA 2PK3A 2F00A 3UN1A 2B35A 1GUZA 4JJFA 1NM5A 1HDZA 2HMSA 1AXGA 1U28A 3JQBA 1TVEA 4XB1A 3RFTA 4C4OA 3MZ0A 5AQ1A 3JD0A 5G0TA 1PL6A 1XKQA 3WR5A 3BIOA 3F6YA 4TMFA 3DHYA 3PHJA 3VC7A 5M6DA 5A3VA 4AJIA 2ZYAA 1NNUA 2Z1MA 1BXGB 2ZTVA 2X7HA 5B4UA 5DT9A 1ULSA 4UVIA 3GG9A 1U3VA 4MIYA 4J7XA 4R3NA 3HNPA 4WLNA 2HJRA 4OHUA 2WMDA 1MC4A 1T4DA 2GLXA 1F17A 1G0OA 4GQAA 4BNTA 2AG8A 1ORRA 1XA0A 1QMGA 5T64A 1P1RA 3W4IA 3DB2A 2YDXA 1NQTA 3JYNA 4Z9XA 3C1OA 3OMLA 4J1TA 3LT4A 1I36A 2ZB4A 4GKBA 1ZNQO 5TNXA 5KVCA 3QWHA 4HADA 2Q22A 1WDKA 1JWAB 1SO8A 2Y05A 3TL3A 4BO8A 2QX7A 3E8XA 3VZPA 1LLUA 4GPD1 1E6EA 4LCJA 4XIYA 5G0VA 4FFPA 1X7DA 4J9UE 3PYXA 1NFQA 1PGNA 1Q0LA 2ZTMA 3AOGA 4HUJA 3BTVA 1KBZA 2P5YA 4M8SA 1LLDA 3IL2A 3JQ7B 1VRWA 3ADOA 1M6WA 4GAEA 2GZ1A 3IUSA 1TEHA 4DQXA 1DC4A 3FRJA 4CJXA 2J3IA 1HSZA 2C7GA 5JO9A 4BO2A 1WW8A 4J4HA 1DFIA 1PSDA 2AEJA 2JAPA 1ISGA 3C7CB 4CM8A 4WCFA 2Y1GA 4FFLA 1JTVA 4NNJA 4QSMA 3Q2IA 4DIOA 1H6AA 2OMEA 3V2GA 1IY8A 4BKQA 8LDHA 3EVTA 4LISA 4R1TA 3G17A 5KOIA 2VUSA 2J5KA 1MV8A 3KYCB 3JD1A 3G3EA 1K6IA 1GYQA 2ZCVA 1MG5A 4E3ZA 3VKVA 2BGLA 4Y8VA 1A5ZA 2O2YA 3JQAA 5BT9A 5T8KA 3NTQA 3ZU3A 3BTUA 1GZ3A 4NZ9A 4GBJA 4L76A 4EBFA 2HUNA 2PZKA 1RJWA 5DCYA 3SLGA 3O03A 2HMUA 3F4BA 4D3DA 4DLLA 5JAMA 3WLFA 4ND5A 4PLYA 1B0AA 1H0KA 2B4QA 5A3JA 3WGHA 2GERA 1R4MA 4R5MA 3KTDA 5BSFA 1CEQA 4MVJD 4KP7A 1B8PA 4NK4A 2V6BA 4W82A 3I9LA 3GVXA 4XGNA 3G49A 4FS3A 4CM9A 3DZKA 3BMQB 3GEMA 1V3VA 3EYWA 4GWKA 3RQSA 3WQSB 1JQBA 1P45A 2WM3A 1E1KA 4D3SA 2Y0DA 4UUPA 3WDSA 1QG6A 4MIEA 4CM4A 3ROKA 2H1SA 5CPBA 2I67A 3IKVA 4A2CA 2GPTA 1XQ6A 1ZK4A 3WX0A 4J16A 2VUUA 3FNHA 3HB4X 3MJVA 1CDOA 2D1YA 5A06A 1E3EA 4CUKA 2ZCUA 4M89A 3D3WA 4QECA 2BELA 4J91A 3N7UA 3SEFA 5THQA 1M6HA 2VYVD 4DGSA 1NASA 4YT5A 3IIEA 3CIFA 2VYVA 4RO0A 3ZWBA 5TIIA 3UVEA 1DB3A 3LT1A 4KUHA 3R1IA 5HWSA 2YJZA 1Z82A 1IHXA 1NWHA 5F5NA 3V1TC 4AJKA 4OGWA 1ISHA 3TPCA 4NBRA 4LK3A 2NNLD 1ZUD1 4QFDA 3HJAA 4DLAA 2IODA 3PJEA 4BGIA 1LDGA 5JSFA 4JBHA 4BVAA 2RH8A 1A4UA 2J3KA 1YOVA 3H9UA 3Q9NA 2JL1A 2C5AA 3IJRA 1QYWA 3OJOA 3UCEA 5T73A 5TLSA 3U5TA 3PIDA 3QVWA 4MP6A 4UEKA 2Y99A 5JW6A 2Q4BA 2WJPA 5I9MA 1DAOA 4Z9YA 2EV9A 4Z9FA 4BO9A 4KOAA 1UAYA 1JVBA 1KEVA 3OIDA 3W4JA 7ADHA 3K8ZA 3WMWA 3ANLA 1WDMA 3TNLA 2CDAA 4Q3CA 3Q0EA 1ZVMA 3GGGA 4CLRB 4OL9A 1PS0A 5EJ2A 1DFHA 3ZZNA 4JP2A 3RASA 1LTHR 3TOZA 3PJDA 1X1EA 4CQLA 4N5NA 3T7EA 4BV9A 1LSJA 1U3UA 1ADBA 1Z6ZA 1TT5B 3KV3O 4XGIA 1YRLA 4J7CA 3DOJA 2JCVA 2AE1A 3LLVA 2I9PA 1RM3A 1ML3A 2ZTLA 4BNKA 3AUUA 3JD2A 4N54A 2CMDA 4WUVA 1IPEA 2BKAA 1ZEJA 3ROPA
chains in the Genus database with same CATH superfamily
3A1SA 1QWOA 4R40A 4D9EA 3KYJB 5B1IA 4KFRA 5JS2A 5KWEA 1VHQA 3KE8A 5K8JB 1Q3HA 2AOTB 2BRUC 4OB8A 4PRLA 4ZO9A 1CUUA 2GM9A 2V4MA 2OZKA 3IP9A 3G9XA 4N7BA 2ZIXA 3CGGA 2IXDA 2O2GA 2W6IA 3ZE9A 2OE2A 4C3VA 4YCSA 1OKKD 2VDVE 1ZHOA 1UFOA 4GOOD 3TW3A 1NDUA 1T9HA 1JPNA 5KTMA 1FRNA 4IX9A 2W6QA 3W5JA 4DUYB 1QTIA 1F1JA 1QK4A 1PFWA 2QE6A 2ZZNA 4JI4B 2Q5CA 2JJ8A 1AZWA 1LPMA 2YJTD 4AO7A 3KHSA 1NE2A 4WH0A 3RVOA 4D46A 1D6MA 3PFWO 1RVV1 1D1QA 4OQNA 3ND6A 2IPMA 3KZXA 4HMPA 3ZOZA 2GXSA 2O8BA 1QX4A 1JIIA 1RKVA 1U2GC 2FZWA 4ZVUA 4OM7A 4OQDA 4AS2A 3C14C 4I9FA 3FHTA 4BQNA 1KMMA 3KEMA 2RAUA 3L9WA 1BE0A 3HCEA 3MS7A 4AL4A 4CKEA 1QO7A 5CEEA 2XNDD 4UATA 5FV4A 4IHJB 1DDGA 1OWNA 4YQEA 2VHCA 4EPVA 3W3ZB 3A1FA 4C4AA 2TMDA 1EMDA 3R4CA 1MQSA 5HP4A 4XYGA 4LMRA 4ZOQI 4B0OA 3KKOA 5ICCA 1GNVA 1JG4A 1OPXA 1H94A 2A9RA 3OFJA 4KLNA 2IZOA 4HXFB 5TEVA 3W1WA 1Z8NA 2XZLA 5BNWA 4Q3NA 1NVVQ 2VCYA 5JD3A 1FDVA 5K6AC 1ICEA 4FCTA 4HWPA 2IXBA 4GX2A 1TM5E 3F97A 2LCIA 1V2GA 3CNNA 1M66A 1T0IA 2DHDA 1OVGA 4I1YA 5CYOA 3RBAA 1VG9B 2Y27A 2CXTA 2ZRLA 3LOUA 4FBGA 4GLFA 3ACBA 1QOQB 1E7MA 4Q1BA 4XIFA 1YVRA 2ASVA 1A97A 3QUCA 3OX3A 5ITSA 5JD4A 1NJGA 3FJYA 3IHTA 1MGOA 3EZ9A 4Z1MA 1I94B 3K20A 3OZCA 1PJLA 1HUQA 3EULA 3C3AA 5M04A 1TAUA 4I55A 1V5IA 2FRXA 1MX9A 2HRBA 1VHWA 5JR3A 5A7FA 1MO2A 3OETA 5SY4A 1QHIA 1H1LB 4FYWA 2OB1A 3K5WA 5GV8A 2FUNB 2C9DA 2ECFA 4KXLA 3S99A 3TAUA 3VX4A 5LQNA 4E33A 5TQ2B 2EVWX 1QMHA 1JXMA 4AROA 1TJ5A 4NYJQ 3R77A 5LLTA 4KO8A 5EKDA 5JQGB 4NPHA 3OJEA 4MQUA 3ZE6A 4PNEA 3RC7A 1VSTA 2BD0A 1HYEA 1T6NA 3MWLA 4L08A 5CGZA 4KE8A 1Z5VA 2ZJAA 4PC7A 1X1CA 2PLRA 1G60A 1R7RA 3CIOA 3KELA 5K0GA 1RBZA 2BI7A 4TQGA 3VMFA 3I3OA 4K6CA 4MYDA 4AU1A 1POXA 1SA0B 3R0JA 4RA6A 2XT9A 4HXGA 2WSMA 2GYVA 1C3OB 1RYMA 3A3KA 1AU9A 3INYA 2HCRA 5AI5A 1GQRA 4PG4A 4KPFC 4B4OA 3CFYA 4J90A 1VPVA 1NSYA 1GPAA 2P40A 2XGMA 2ENWA 3FPSA 2O2CA 3TLEA 4BRSA 2VTVA 4L07A 3VNSA 1DCMA 3L1KA 1R27A 2Y1KA 5CDYA 3HVRA 4UBOA 3QFRA 3ZGXA 3PCXA 3MJRA 4TWJA 1JF8A 3OKCA 3DZ2B 1P61B 2BVNA 1TRKA 3JTMA 2JHFA 2OGTA 1E92A 1NMQA 1OLSB 4QDTA 4BS9A 4TYMA 3Q7RA 3DVSX 4HH4A 4R0VA 2J0UB 4B4VA 3CB4A 3E1GA 2GHTA 3A4LA 4MR8A 4DMCA 1D09A 4E03A 1B8NA 2VP3A 3HA5A 2CWDA 4Y6GB 3ADBA 1NI5A 4PBRA 1A0OA 3S81A 3PQ7A 4Y67A 3VYVA 3T1OA 4AP9A 1WCYA 1T2EA 2FN8A 2OCLA 4JR1A 4QVIA 3Q11A 3ND8A 4WNIA 2IVFA 5ECWA 2JJMA 5F51A 4G5OA 3RODA 3TKAA 1LRJA 1QGDA 3SZRA 2H54A 5FI0B 2OCYC 3RS5A 2W00A 3QYAA 2JIBA 4QPNA 2HU8A 3HZRA 5DZSA 3QHAA 4QHSA 4RTPA 1QMIA 2FN3A 3UWOA 2XE6A 4E70A 3HBJA 3LO8A 1T0UA 4IO0A 3ZDRA 4EGCB 2W93A 4GECA 3BD6A 4FUTA 1TOAA 1IIRA 4KZPA 3RVLA 1WCV1 2Q3MA 2UZ4A 2PA3A 4EJMA 2YV1A 2ZB8A 5AJYA 4IM7A 1IBSA 3RTEA 1YT5A 3ZH2A 1FW6A 2ZS9A 2WSLA 4C20A 2EJWA 4PFQA 3U7HB 1V9LA 5FBWB 4R8SA 3LP6A 4OUDA 4PAQA 2WHYA 4ZI3A 5EHNA 3V48A 1SKAA 1RYYA 1FNNA 1SQSA 3U7JA 3MJEA 1NW4A 4DQUA 3ELDA 1YQDA 4TXMA 4OHRA 1FXSA 2C9OA 1V1RB 1A5TA 3WYBA 2HY7A 2HB6A 2XMGA 4WACA 4ZALA 4EY6A 3CS3A 4EHKA 4EELA 3Q3EA 1P91A 2VZLA 2W83A 4NYIQ 4ADSG 1EUZA 1E3LA 1DXHA 4L1KA 2PZBA 3FBWA 3V1NA 3CZ9A 4WXHA 3SIWA 3M1LA 4O4LF 5GMOA 4QUBA 4BNIA 4CTKA 4ZCIA 1A8PA 5FBRB 2F3QA 2VXCA 4Q34A 5FAKA 4JC5A 3D6HA 4KYVA 5CXQA 4NHOA 4I8DA 3PFBA 3HZHA 2F9LA 4ENQA 1QNLA 4QQKA 2XDAA 2B8JA 4ROSA 1WBBA 3GFQA 4XVUA 1Q14A 1DIAA 4GC9A 4RKRA 1M7HA 1TECE 1U0RA 3OURA 4IOKA 1PHPA 1H2ZA 1W6UA 3D2CA 5G02A 4DZZA 5I7WA 3K6RA 1T2FA 1P5JA 3KKKA 4NENA 4K86A 2QUZA 3BGWA 3BFJA 3KPJA 5CK4A 4YFYA 3SF8B 3TO5A 4FGWA 3FUVA 4HB3A 5A2GA 4ARUA 3W7AA 3ZY6A 1QG0A 1MB2A 1YC2A 3G85A 5DW3A 3W0LB 3BJZA 4D9FA 1HDXA 2OMKA 3G7SA 4ND1A 3VR5D 1DP4A 1Z3IX 1U9IC 1V1MA 5DMXA 4TL6A 1XAIA 1ODKA 1RBQA 3DZBA 4Q7EA 4MQBA 5K0SA 3A9TA 1V8PA 5BW8A 1Y8AA 2PS9A 1NQ5A 2ZJYA 1W4RA 4J0CA 3RBVA 3HKEB 4HNHA 5TT1A 3IUJA 5A7HA 3K8QA 4V1CB 5JFGA 1ZUNA 1GFSA 5C81A 1MP0A 4B82A 1STOA 4LF9B 1OFTA 3K35A 2OCGA 1BSVA 1WR8A 1HG1A 3Q6IA 5LYYA 1SZJG 5FWYA 4OLFA 3DEYX 4LOLA 1W0JD 1LPOA 1TMKA 1RHJA 2I7CA 2FMUA 4I9UA 2LCQA 1VMDA 2HO4A 2VEDA 4I50F 3RC3A 4AYTA 1ULAA 1X1DA 2CNWA 3L4BA 2FX2A 3MHTA 3AOEA 5KYUB 1K8RA 1ZUHA 2FMFA 4TTIA 2DF8A 1B6TA 2ZRPA 4LDPA 2O8VA 2HHLA 3CLRC 1EP9A 2KI5A 3DTVD 3NVKI 4P8RA 4A2QA 9GPBA 4MICA 4M37A 2IOQA 2W90A 1N8NA 3DTVB 4CL8A 4F4UA 4MHTA 3JQ6A 4HGRA 4RF2A 4DT1A 2PKWA 4Q7KA 4JJ8A 3N74A 5DM2A 3SJUA 1YS9A 5IC5A 4HT3B 2PZMA 5IT9A 1NLUA 3ETNA 3JR3A 1IBCA 2J3HA 1WU7A 2QNBA 1N2CB 1G4HA 1TIKA 5LXTB 3QEKA 1GD1O 3LUAA 4OTZA 1PT5A 3STWA 1JZQA 2CNOA 4L7QA 5SYNA 2HWWA 4E0BA 4NHEA 1T0HB 4M1WA 3DXXA 4YPOA 2ZUEA 1TKBA 4H0CA 1CRZA 3A14A 3O4GA 1D4AA 4B7ZA 4MP3A 3VRHA 5F76A 1A9QA 5I9SA 4MTCA 2XWQA 1DCFA 4AKTA 4NEQA 3O93A 1GWNA 3ZGOA 4D8TA 3Q40A 2CDRA 2AXNA 4DZRA 5JZ9A 3EEOA 4UNNA 2XWSA 4NOMA 1FMLA 1PN3A 2UDPA 3UWSA 2G1JA 3I12A 3TAXA 4XGRA 3U3JA 1ZZGA 4WOJA 5KTKA 4COOA 3V4FA 3FKSA 1Z7BA 3HCCA 2UUBB 1K8YB 3FVRA 1JPJA 4RJIA 1UK9A 4JEIA 5JSQA 4YAIA 3IQEA 4AIRA 2O48X 4HVAA 4HRVA 4FK8A 4MIOA 1VE3A 1DJNA 2O4UX 3FNFA 2V59A 4PAOA 1GSOA 1E4VA 5KHLB 4ZQCB 1YS6A 1QE3A 3IOMA 1TMOA 2WWRA 4G23A 4R9RA 1W8DA 3I09A 2O3QA 3IMFA 3A1EA 2HADA 5LWHA 3W5IA 2PZEA 1KI6A 5CG1A 2V5AA 3WLEA 3UQZA 2HK6A 1RLOA 3NHYA 1ZFNA 2P0YA 1GILA 2OGSA 3QXXA 3SKYA 5ILOA 3B7WA 3IVAA 1HE2A 1ISJA 4S1TA 3ZD9A 1NMZA 4MS4A 2I4MA 4RPHA 4Y2YA 1WP4A 1MG0A 4GPIB 2HBZA 4LF4B 3ZHUA 4KI0A 2D74A 4FE7A 1KFCB 4FOLA 4G5QA 5C3MA 3ZWQA 5TDHA 4KX3A 4EZIA 5BURA 3RS2A 1B74A 4LJYA 1U2QA 5AESA 2FZKA 4JBYA 1JBEA 1PZXA 1RPAA 3JSAA 5KX5A 3ZJYA 3DBRA 2IHZA 2DFTA 3PXUA 1DCKA 1W5SA 3JYPA 4GW3A 1RHRA 4R69A 4XOIA 3T7DA 1LC0A 3VPHA 1JFRA 4CLDA 3LQQA 3TQHA 1WBJB 4E30A 4WZBE 1R9GA 3IQXA 5T4BA 1TA9A 3RAJA 3SHOA 3IE1A 5FBZA 2X2EA 3ZCVA 1RABA 4BKRA 1GRQA 3VI4B 1KEKA 3TG8A 3JW8A 1QCYA 4GBGA 1DL5A 5H0IA 3RF6A 2F3TA 4RHTA 3X3HA 4IGIA 2NTEA 1KAEA 2WJYA 1PG2A 1RXYA 4QEDA 3KC2A 4BBZA 4G4JA 2OB2A 5DJ5A 5CCXA 2OSBA 3DTTA 3F67A 2YWEA 2MYUA 2GESA 3IJPA 2Y8EA 4PR3A 1VIVA 2DFPA 4N5MA 4E13A 1RQPA 5BV7A 2VSNA 5T57A 3A6JA 4RHXA 4LOJA 4CL0A 3KGDA 4IVQA 4G9EA 3O84A 4BHTA 3R3YA 4GS5A 1R4NA 2P2NA 1W19A 3K0CC 1X70A 4C14A 4OSEA 1O54A 4HAIA 1Q57A 5E4TA 1AMUA 1K7EB 1YVPA 1QIIA 3AFGA 3PBKA 2HX1A 2W2QA 1JLLB 4JT2A 1GOTA 1CRLA 4O8CA 3D8SA 4HZIA 5AI0A 1OH7A 5BQ5A 1FX1A 3VI3B 1E1QA 2HPHA 3RU9A 1ZMTA 3B20A 1GTRA 2WSYB 4E5YA 2PGLA 1A9PA 3CM0A 1ADFA 1O6ZA 3KQMA 1UC5B 1UBNA 4ZJUA 4JYMA 2FF5A 5BWMA 3QLVC 3H5AA 1CNFA 2B30A 3E53A 3GRFA 3PSAA 4JLOA 3T0IA 4AWBA 4CR7A 3QVMA 5EZQA 1L5NA 3TZQA 4DEVA 4DV3B 4K0KB 5GJBA 3T99A 4RIIA 5CIWA 3A04A 4PLTA 2AQHA 4YRBA 4V3BA 2P90A 1PR3A 2R6JA 4Q7LA 1KYZA 4PWYA 2XD9A 1SEVA 4BO0A 4XTCS 2H8GA 5JOQA 2IY9A 3VPXA 1KE2A 1IXRC 4M1KA 4Z2AA 4Q02A 2WMYA 1G8KA 4FEAA 4K88A 1USWA 1I2MA 3NVMB 4MVJE 2A94A 3Q2OA 2DUNA 3PCTA 3Q41A 1GCAA 5J59A 4F2PA 5JAZA 2CK3D 1R0CA 3ZIUA 1MJFA 2G9ZA 1GPDG 4JK3A 4Q1CA 5ALYA 3VJMA 5K3FA 5A9TA 2AZXA 2JD1A 2H0QA 3KZVA 4CG0A 5IG2A 2XE8A 3RTGA 4YRAA 4I9HA 1E2QA 5B58C 2VYND 1LDNA 4E2WA 3PJGA 1DJMA 2E4ZA 3ZOKA 3D81A 3ZLJA 2FZGA 2D6FA 1C1HA 1X80B 1EZ1A 1R74A 5HFJA 1VXRA 4XD2A 5DHQA 2DKOA 3GRVA 1T1SA 4NPAA 1Z26A 3BRCA 1UK8A 5ALXA 1F4LA 1XCOA 2P9EA 4EY5A 4EUKA 1YBHA 2RGNC 3RYCB 1LJ8A 2ZAMA 2DWCA 3ORQA 1EFRD 2ZRKA 7MHTA 3E3NA 3R8FA 2Z2IA 4DWVA 1XEAA 4YLGA 3GO4A 1EIZA 1OOEA 3I2HA 4MVYA 1VGVA 2ZK7A 1YS2X 2I8CA 5CX1A 1ONSA 3GEBA 1T3ZA 3BE5A 4AWXA 1PUIA 4PW0A 1JB9A 1C30A 3IVRA 4AAYA 1LJUA 2Q45A 3NANA 5DEOA 5BNTA 4JZKA 3MQ2A 4E94A 2DUUA 2H16A 4B73A 1WB4A 5CCEA 3WE7A 5CDGA 5KHAA 3EQ9A 1HSOA 1SPXA 2PDAA 5E3IA 1XL1A 1PJSA 3QKTA 1R2QA 5AW4A 2WLTA 3ON5A 1JQLB 1YCGA 2MSDB 2MSEB 5GONF 4EG6A 2QTTA 3RQIA 4JR2A 3RH0A 2QY6A 3UHPA 1Z25A 1I3CA 2WTMA 3GF4A 2VJYA 4J0KA 3VTAA 4AFNA 4WMLA 1S8AA 3SE0A 5BSEA 3ICQB 5FL7A 4MRMA 3MAGA 3FMFA 2ZDQA 1WE2A 1YCDA 2VQSA 2QX9A 2ZSEA 2PRIA 5D2CA 3U9TA 3K4QA 4A73A 3KOOA 2VDRB 2J0QA 1X7ZA 2I76A 1E79D 4XE5A 1HY3A 3HDJA 2QV0A 1IHYA 2Q4OA 5F2KA 1YB1A 1I2ZA 3DL4A 3FCOA 5JMTA 3UMGA 3FI9A 4H31A 3PDWA 1A7AA 3CH7A 3WQBA 4FI3F 1PYDA 1ZMBA 2V6FA 3GJXC 4CXMA 1NFFA 1F0YA 2C9ZA 3GEIA 2EP7A 2HO5A 3EMDA 1OH6A 1G41A 3ENQA 2RHRA 4HFNA 4BTVA 3U60B 5HOEA 3BDAA 1T8PA 3D2LA 2X8JB 3O75A 2QENA 3WLKX 3A26A 3OKAA 4TZKA 1M7GA 1U2EA 4F12A 4AP5A 1Q11A 4XFJA 1USKA 4UMDA 5JE8A 3UK7A 3COPA 4JEUA 4K03A 4A92A 1AF4A 3HO6A 1CUBA 1UBKS 3HN7A 3BB1A 2VSQA 1JLMA 4FLEA 3OIWA 3GUYA 4DC1A 3WWOA 5KI6A 3KQUA 4TTRA 1PW5A 1BU8A 4FB5A 2Z9BA 1EUDB 3IDZA 2V98A 1I32A 2H1RA 1SQ5A 2YWBA 1DS6A 5AW8A 4Q3BA 4IDFA 3FM9A 1CU1A 3KJFA 3O8BA 4P5EA 3QYFA 1B26A 5BORA 3R7WA 1JFVA 1R88A 1JNXX 1W5BA 5FHQA 4QM6A 3P71T 4Z1OA 1T4MA 2HJHA 5M7EA 3PFIA 1Q0QA 3QE9Y 2FDRA 4EH1A 5U4XA 3ACCA 2C3OA 3HKEA 3NBZC 4JXXA 2PT5A 1FTNA 1HLFA 3LC1O 2YV3A 1FTQA 2QTAA 2YZNA 3CEJA 1RKXA 3JWJA 1NBMA 1LQTA 1IZZA 4NZNA 4U2BA 4WXRA 4XQ0A 2UUCB 1COWD 2QP3A 3GX1A 3K92A 3PR1A 1W4CA 3EDYA 4FM9A 2DPMA 2PX8A 3MOSA 2BFEB 2YZGA 4RD0A 4DA9A 1PSWA 1VECA 1SD2A 2J41A 2R1VA 3CY6A 1HEIA 4FHFA 4PO1A 4LFAB 1KVUA 1EJ2A 1H3EA 3K9HA 3G2NA 4L73A 2K87A 4PFJA 5BNZA 1DRUA 2O19A 1Z5NA 1RTKA 3W1VA 3BT7A 5EE9A 1BAPA 2OYCA 4UC0A 4B6QA 3ABIA 4WCDA 3SP1A 1M2VA 1PJ2A 1PJ4A 1KHTA 2ECOA 2I3ZA 2JBAA 3KUCA 2PFKA 2VLBA 1C9KA 3LPNA 2F43B 2J5BA 3O1IC 1QXSA 1I0IA 3LC7O 2YC4C 4KK4A 1P7YA 1R6UA 4CMAA 4IL5A 1AK2A 3CUTA 3TLXA 4KDCA 3RHFA 3EVFA 4LNHA 4PICA 3CBQA 2BMEA 4MRSA 3AVVA 2ECQA 2OXTA 1ORHA 1ZKDA 2NZXA 3VR2D 1SZPA 3ES9A 1ZJ5A 3JAKA 4TMWA 2EL7A 1Z8HA 1JS1X 3O95A 5BN3B 2ACKA 1HDOA 2VUHB 4B6EA 3ZHSA 1Z13A 3PDUA 2VNIA 4HC4A 3OOYA 3BRWD 5ALKA 2UZ1B 4RORA 4EY3A 1E2KA 3MRSA 3UMYA 3MJCA 2F59A 2EL9A 1KFKB 3G5MA 3NBMA 1NSFA 5C46F 4G41A 2IZ0A 3PCRB 1G8HA 3TM4A 2DT5A 4YR7A 2XYGA 2F1IA 3D43A 4URVR 4LYGA 3ZCUA 3WAGA 5F4ZA 3TLAA 2BYTA 4F91B 4CLOB 2VF7A 1QQ5A 4WQMA 1WF6A 1JLHA 2XSZD 4KMMA 4OVKA 4DPKA 5F35A 1PNOA 2B5OA 4YB8A 4AX8A 3EQ6A 3TYXA 2CB0A 4WGFA 3C5CA 3LYLA 2WJZB 1DIRA 1W1WA 4JP5A 3TQSA 5IFKA 2ZYSA 1AHPA 1QKIA 1YNOA 3PKJA 5B7PA 4H7EA 4DV5B 2QSJA 2XNCA 3R3XA 3BGVA 1UBHS 5LZ9A 1NZDA 2DSNA 5IK2A 2GD0A 3U4IA 3N0TA 3QHPA 3E9DA 1ZH8A 3CUKA 3CRVA 1YNSA 2EBHX 2FEWB 4OGLA 3TKLA 3WLSA 4EG1A 1TTTA 4FILA 3JQ7A 1BKSB 2UYOA 1Q1ZA 2YNMD 3AFHA 3DP9A 2BY4A 3WGNA 4DAOA 4EG4A 3SC2A 3KKMA 2BKVA 3R3SA 2I2DA 5I4KA 2FPSA 3NDJA 1OFIA 4MUMA 4P0QB 4PX9A 2IHNA 1KJIA 1KO1A 3G9ZA 4JT4A 3I73A 1Y3FE 1ODFA 4G8DA 1FTWA 3VR0A 4PN7A 3DMTC 2DECA 3GRCA 3ZDEA 1SUSA 2HHJA 3A3PA 4BNNA 4ZZ3A 2PVCA 4OQPA 1CY7A 5ALEA 1IFXA 4NLLA 4U7GA 3R20A 4CN8A 2HREA 1IHUA 2XLCA 1NV9A 4A0FA 2O3JA 2PX6A 5JPCA 2OO3A 3QELA 4QWWA 2P9YA 1Y5MA 2V7QD 2FFAA 4TTJA 4BTLA 4GEKA 4BWFB 5JJKA 4M7OA 3OICA 4WJZA 2YWHA 2G07A 3VR3A 1OZHA 2IIPA 1O96B 1K6EA 1XLVA 1ADCA 1QRDA 3QU4A 4EK9A 5KTPA 1JUDA 1D1SA 3QUTA 1Y37A 3D8TA 5DMHA 2X4DA 5EUMA 1ESCA 5L40A 1KEZA 3NETA 4M9QA 2VYCA 4DWJA 3D8RA 3E6AA 1I6WA 5U1PA 3IQFA 1T9GR 4I0WB 8ABPA 4OREX 4NCAA 3PQVA 3VO1A 1L5RA 3KZOA 2EWWA 1Z0IA 2ZWAA 4QPZA 3ZJVA 1MOQA 4MQFA 2GKSA 1ZC3A 4KGZA 4PPQA 3SJAA 4OM8A 1II9A 3AQ4A 1FS5A 3FWHA 2BEWA 1T9ZA 3PR2B 3OA0A 1FU7A 2G83A 1QV9A 2YZ2A 1GUBA 1CUZA 2Z56A 4FDMA 4FFVA 4DMGA 2TMYA 4FT2A 1EK5A 3DDUA 1AT1A 1EX9A 1EQUA 1UT8A 3R3WA 1SA0A 4RA6B 5EE5B 3K5PA 4ROTA 3P0EA 5MN4A 4DMKA 1EFCA 1IEXA 3K1ZA 3L79A 4FHZA 2R6GA 4V0SA 3UXYA 7AT1A 4S2EA 4F2HA 2GAIA 1L7MA 1T2AA 4AJHA 4RDXA 1KOLA 4KN6A 3TRHA 3E5MA 4HQ0A 3ZQKA 1QHXA 4QVGA 3RIHA 4GYJA 5HQ3B 2IEIA 3H9BA 5ALGA 5TQ0B 1Q20A 3E03A 4CM1A 3ZJUA 2IHKA 5DT2A 4YGXB 1AOXA 3RFCA 1HX7A 4B71A 1T5IA 2GZHA 2J30A 3HDQA 4U6NA 4F8JA 2W2TA 3VSCA 1H2XA 1M54A 2CBGA 4HSEA 4O1MA 1U9IA 3ZW7A 3S6JA 4CV2A 5BY2A 2UYHA 1GZUA 3ICCA 4G1CA 1UAGA 3L18A 2A9JA 4KQ1A 4N18A 3AEKB 3VVBA 3M4XA 4FI3C 4X8HA 1U8ZA 3BL6A 4UAGA 2HYDA 4C0BA 1OLUA 1ZESA 2WFMA 1WY7A 3GPDG 2D2VA 2HMYB 3P20A 3PHIA 1QP7A 4R1MA 3AK4A 3D4LA 1Z4NA 4MWSA 1M2OA 1XE3A 3ONFA 4PTZA 1BRTA 2HMAA 4B80A 4F45A 4AY2A 4U63A 2VRWA 1WQ3A 3GDOA 3D4OA 3M7IA 1AXRA 4R8LA 4RM3A 2VQDA 3COYA 4QRDA 4M1ZA 3DQZA 2B7CA 1XEWY 2I3AA 3ANMA 3JAWA 3BQNB 4L2IA 5TY0A 4HK4A 3THOA 4NBKA 4AMGA 2WVHA 4GX1A 1W85B 4KE6A 4MMXB 4GLJA 4R3UC 4UFNA 5HIJA 4HPJB 2L0XA 1EEXB 1BFKA 1Y82A 2BHLA 4L4SA 1D07A 3W77A 5ICSA 1DEHA 1EHYA 4IUDS 4Y2GA 2J09A 2HKIA 1AKYA 1UMBA 3LLCA 4F21A 1E4EB 1PWEA 1P3Y1 2OD9A 4ZOLB 4DY4A 1N2CE 5CUQA 1QONA 1FSFA 4MJLA 4L9SA 5CVEA 1ZHHA 4BB6A 2DY1A 3ZWXA 3HSSA 1JYFA 4S1OA 2BISA 3QVKA 1V39A 3OHSX 4HGPA 5C8ZA 1VG0B 1V25A 3UAXA 2E4UA 2V9PA 2ZDHA 2CL7X 3FPKA 2OPHA 2HWXA 1SD5A 1K7CA 2QTFA 4ZC1A 5AW1A 3VPDA 4EPYA 2YYZA 1BE6A 1LK5A 1YONA 2CKDA 3ETEA 4A2PA 4OQFA 3KAQA 1TZMA 1RLJA 2V7EA 2XGSA 3ZHQA 3K5IA 2IU6A 5JUWA 4KQEA 2OA0A 5IDXA 4RW0A 3QSYA 3GCWA 1THZA 1S3IA 2PUTA 4OGGA 4MVJG 3DW1X 5CP8A 1KGDA 2F1JA 1KI8A 2YWRA 4U2KA 4ZO4A 5A71A 3F2VA 5A05A 1QCDA 5D6NA 5LBTA 4B46A 4X3PA 521PA 2Q2WA 2QTLA 3OD1A 2GF0A 2OAGA 1TAGA 1JAHA 3EDQA 3F5DA 1QKJA 3N5CA 4PBSA 5T3UA 2OFXA 4CODB 5K5EA 2DMRA 1ES9A 4PLFA 2EKLA 1Y5RA 1Z6TA 3FBGA 1ZGHA 4C6SA 3R6TA 2BUCA 2C9BA 4OY3A 4KR3A 1ZM2A 4KK3A 4E31A 1JFFB 4L4RA 1N7JA 4MW1A 1V48A 3CH5A 3ACDA 2ES4A 3LFTA 3RHZA 3V7YA 3QFSA 3DF7A 2QA5A 5EUBA 1PV1A 4BLRA 3JQQA 3V8RA 3ZV5A 3JWEA 4DILA 3LDGA 1Z88A 4BVBA 4HI0E 3GARA 3HJFA 2NPFA 3SC4A 1LPNA 3A6LA 3L6UA 4CG1A 1M5UA 3AM5A 1NC3A 1Y48E 4FIDA 4XFDA 1JIXA 1KP3A 3KKEA 4PN3A 4X8LA 1R5JA 4CGYA 3WHIA 4W4TA 3T1YB 1V3QE 3P2EA 3OPYA 1Y34E 4C4YA 2NSHA 2Z08A 2QUAA 4RQTA 4XUEA 1XQ1A 1U3FA 4YALA 2YY6A 3EIXA 4CZ2A 4P7JA 2WKWA 1CNEA 3B6IA 4FHDA 3KZMA 3WBBA 4JA2A 5A1TA 3B52X 5EUCA 3DVAA 2IPLA 1H9AA 4YXWD 3QPDA 4MA4A 4P58A 2XJ4A 3L93A 5FADA 1COWA 2P67A 3ZH9B 1E5XA 4BDTA 1VLHA 1YZUA 4KUEA 4EB6A 1J6UA 3QEMA 3QU7A 1U7PA 3ICOA 4TLLB 2UUAB 2BJHA 1K27A 3HHPA 3MS4A 3O92A 2I0FA 4G37A 4PZLA 3SCZA 5E6RB 1X1QA 1SOAA 2LKCA 1JMVA 4BO6A 2BBSA 2BHSA 4IGFA 5MN5A 2GPJA 2AW3A 3MWGA 3OJ0A 3PEUA 3CLUC 3QV2A 4B8WA 2XKKA 5JJLA 4GMXA 5FWNA 1SHKA 2C7QA 4MKHA 3KLNA 5KHOC 3M6WA 4XQEA 3OLXA 2NUAA 4G25A 4JASB 3BWXA 3HE3A 2VPTA 1I01A 4QRHA 5AW7A 4EHDA 4S3MA 1ZIOA 3UKOA 1IHPA 2YYSA 3HDGA 4TRNA 2D54A 5KEIA 3KKPA 4LI3X 2H2FA 1H5UA 1IEVA 3ROQA 3R5XA 4PYNA 5KYXB 1S7GA 3GFBA 4PNHA 5HMLA 1FIUA 2ZUVA 1RM4A 5G2OA 5MN6A 2ORVA 3SU8A 3OZFA 3VKGA 1E60A 5E8JA 3VYWA 4FFNA 1EE1A 4LX0A 3B1WA 4P86A 4Z4FA 1FQOA 3FN4A 1P81A 3H1FA 3BXEA 3BK1A 3P8ZA 4V24A 4Y98A 2XIJA 2BV3A 2B37A 3AIMA 4PPYA 1N8KA 2H4ZA 3I34X 2C7OA 2ZE6A 4JP3A 4DDWA 1G6HA 2VPWA 4US1R 3E9NA 1JWBB 1KR5A 5CA1B 2RI1A 3Q3VA 1H5QA 3HGQA 4Z3KA 4OOEA 4QNNA 2OM2A 1SCJA 3EXFB 1EJBA 1OC4A 3AXSA 1O5OA 4W5WA 5SYMA 4HLUA 4CM4B 1QH8B 2FE1A 1M2NA 3BWVA 1GYPA 3E0XA 2CLSA 3WHPA 2E3JA 1IXSB 3ABSB 2XVMA 4DYDA 3B5JA 4JUIA 1TLTA 2UV8A 3P97A 1KYWA 4XEUA 1YZVA 3GHYA 1OC2A 2PS0A 1OAAA 3NHRA 5LM3A 1LPBB 3MUNA 1QIHA 3SYKA 1EWTA 2Q62A 3ANTA 3SG0A 1OWOA 3UW1A 1WUYA 5GP1A 3BD8A 3UHAA 4RY8A 1UMCB 3OY2A 3Q3CA 4U8GA 5EGSA 5LQMA 1IK4A 4F6LA 4TT8A 2VBFA 2OHOA 3H8JA 1ATIA 1O97D 1L8AA 2X5NA 3OLVA 2J0UA 4KMOA 4L8YA 4MWCA 4RH0A 2EZTA 5AMXA 4I3HA 1U3DA 3ZEIA 4CMBA 4ZZ2A 3T34A 3TIGA 5F1OA 3FFXA 4JSRA 3ZIAD 5CGQB 3T3OA 1QS0B 2QOEA 3G2PA 4PTLA 1B8OA 3UHOA 5BXYA 5JI3E 4I19A 5JYFA 1KQ3A 2ZUDA 2E4AA 5K3SA 1DO8A 1XZFA 2YHSA 4PY2A 2AB0A 5BP7A 4OHOA 2G1AA 1D0VA 2ZB3A 3QGMA 4RLHA 4EA7A 5B64A 5KVQA 2JGIA 2X58A 3AL2A 3V34A 4ZYUA 1FTSA 3ZIDA 5CNMA 1A71A 1OBVA 1U7DA 4FJ0A 2X2PA 5GM1A 4PYIA 4AZWA 3KQLA 1YACA 2V0GA 1ZC4A 3LXXA 4K9OA 4UHHA 3SQLA 3K72B 1TRHA 2WBLC 4JBIA 5IAEA 1MIOA 1EDZA 1G5TA 1BDMA 1L7EA 1MC5A 2NUBA 2C9MA 3K70C 2PLNA 4HEHA 4YNBA 3SLRA 3DLIA 3K7EA 4EYQA 1NF8A 4OMUA 1XZJA 3CPEA 3K8YA 3VSAA 1XMOB 3TFOA 3LVBA 3H5LA 3BUSA 5DK6A 4QU8A 3T38A 4ACAA 2BGTA 4E2ZA 1MJNA 3STYA 1ZK0A 5JHHB 1XX6A 3SC6A 2ZTHA 3VYSB 1BW9B 1GNPA 1RC8A 3UKJA 3UCFA 4NFHA 1BYIA 1DAKA 2D1TA 3R5HA 4EUHA 1GPLA 2BFBB 1YIAA 2GK3A 3W5SA 3RYIB 2Z6AA 3D4NA 3PNLA 4H7JA 2DBYA 1NPYA 3NHAA 1AHNA 1IYZA 3BHNA 2BPOA 4KU4A 5B7NA 3UC5A 2ZT5A 4CVNA 4IGAA 3ZGVA 2HW8A 5HA5A 3QRWA 4JBLA 4IJ5A 3L0ZA 1E9SA 3LECA 1SVUA 3FWNA 3X1XA 3DH0A 3BFXA 3H6GA 1U0EA 3NM4A 4KODA 3PE3A 4DXDA 3WFIA 1KVSA 1J2EA 3PHGA 4RMNA 3I8XA 4KIGA 1FB5A 2W0SA 2AOVA 5EIFA 2J45A 3PV0A 4MGYR 4RYLA 5E3JA 3DJYA 4V0RA 1R0YA 1AUVA 4P38A 4JDUA 5IYZA 2D1SA 5IJXA 2OKCA 4KRYA 4QLBA 1EAMA 4L85A 4OMDA 5F73A 2EARA 4NENB 3SF8A 3IAS1 4EW1A 1IHOA 4ESVA 1NQXA 3A70A 3ZJTA 4KSBA 3N86A 3BRWA 4BEJA 1C9EA 4IIDA 2QLMA 1TEZA 2WMOB 2ILTA 3VBCA 1OJ7A 3I04A 2AR7A 1KDTA 2FZEA 3GDFA 2E6KA 2QLBA 5THXA 1VL5A 4REQB 1P7ZA 2O0HA 1OYVA 2AXEA 3E58A 3JRNA 3OT1A 3DOIA 2Q3EA 3VYUB 1ABBA 3O4HA 5A03A 5BSRA 4V2UA 1KP9A 4CKXA 4ECEA 3DDSA 1ZD4A 2AI1A 1W29A 2PY6A 1M73E 4XVRA 5CT5A 1M2KA 5JPDA 4MCJA 5K0BA 1KFEB 2FW1A 1X1AA 5J4KA 5E9QA 1HQDA 1GV1A 2OPBA 3HEMA 4U7TB 1ONPA 5DU2A 3SBDA 2QY9A 4MR9A 2FQQA 4X6XA 5B3AA 3PPWA 2O2DA 1JDNA 2NIPA 2OEPA 1BMFD 1FLNA 3IB6A 3T4PA 3PEYA 1F2DA 4B3IA 2ZIUB 3SGLA 5TVKA 3NWOA 2NMVA 3TTYA 4LKOA 3R0VA 3U16A 2PRZA 5DTJA 2ZIFA 1RM5A 1I5RA 1XWFA 3K2EA 3KJHA 4AB1A 4AN0A 2CV0A 1R66A 5FR2A 4BFVA 3WIUA 1PDOA 3CB2A 4KFTA 4EX6A 3IIJA 1NLZA 2I2XB 2XAUA 4MVXA 3IV7A 2BH2A 1BA3A 3O31A 5IKPA 3WXMA 4B83A 5L6MB 4B4KA 3A4NA 4F96A 5FLEX 5JVDA 2AL7A 4R31A 3E4DA 2X8BA 1MCZA 3HGTA 4LYDA 3FWYA 1D7OA 1FFAA 5HQ3A 3A6GA 4ZVSA 3R23A 1U7OA 3LY7A 2XY4A 4J7UA 3OEEA 3HM9A 1NBME 1EBBA 1AHHA 4FT4A 4GP7A 3WZLA 4J2OA 3W1EA 5DX0A 5KNLA 4DLUA 4JLMA 2QLNA 1XR3A 4G84A 4NOJA 1CWUA 4NOKA 3GLHA 3R9XA 2BGNA 3UOAB 1C81A 4HAVA 4S35A 1P5ZB 3PVCA 1JNYA 3RSZA 4R1PA 2KS6A 2VTEA 3AX6A 3H4TA 1M1NB 3CVOA 3VFDA 2KE5A 2GH1A 1M2GA 4K9PA 2V7QA 1E9AA 5JXHA 1RXIA 1X42A 1LS1A 3F6PA 3P2JA 3TNJA 2XT6A 4PHCA 1ITZA 4PAGA 1BG6A 2GCEA 4QXOA 4XSVA 1H6BA 1NY6A 1NXTA 1TLFA 2O7RA 5DH9A 3TUJC 3IQDB 4WLOA 5C8YF 3Q3JB 4HBGA 3ZW8A 2OGUA 2G40A 3EXEB 3ILSA 1U90A 3INRA 4HYQA 1GL3A 4JKOA 1T8RA 2CN1A 4YH1A 3R7AA 3RGGA 1Z36A 2I7TA 2ZP1A 3OOEA 5TPWA 3S1LA 1KEWA 3ZHVA 2A8YA 2G80A 4UUOA 3ZDYB 2JHCA 4H1UA 4QOFA 2C2XA 2RFLA 3D31A 2JFBA 1DAFA 1B6GA 5FWYB 1E66A 4YAKA 4JJIA 4OJTA 4UM9B 2VNHA 3I8OA 3BE4A 4QDKA 1AUXA 3MFYA 4I5IA 4B8YA 1SXQA 5FUBA 2JASA 3UICA 5HOQA 3CH4B 1PT9A 4F6RA 3D59A 4HGNA 5IANA 3E2MA 3EZFA 1JPVA 3GP3A 3IVGA 3WAKA 4XB2A 2QM3A 1GKUB 2GYUA 2Q6KA 4NK5A 2C0CA 4NMMA 5JROA 5JWOA 3PHCA 4KLCA 4KAJA 2CXOA 3GHHA 1T9KA 2DJIA 1IY0A 1NUQA 1TVKB 1TQ4A 1JILA 2ICAA 1DKQA 1UKZA 2PWZA 3GP8A 2Q1UA 4YCDA 4U02A 5KJEA 4CPDA 4F3KA 1U8YA 2GJ9A 2O3TA 2FFQA 2FPIA 2Y68A 1VPDA 3IERA 1NL3A 4M3NA 4LXTA 1U7TA 4HGQA 2C57A 2SCUA 2W2KA 5A4FS 4L3VA 2VJQA 3CLKA 4ZI2A 1DO0A 4P98A 2O14A 3ULKA 2FEOA 3OTIA 3H2HA 1JSXA 4WFQA 2YN2A 2Q1SA 1Z6YA 3IXLA 1XVLA 5LZ4A 1LRKA 1TK2A 1ZQ9A 3O73A 1TM4E 5HF8A 3EPRA 4JROA 3ETJA 2X86A 4G97A 5REQB 5AW0A 1X7GA 3VQTA 4RNDB 1BGWA 2ZLBA 1XZHA 1VC2A 2VDKB 1AUPA 1FDWA 3ESRA 2UYYA 4YX9A 5BR7A 1E1CA 3U9SA 4WY8A 5CNJA 3MS2A 3SZUA 3OPVA 4DMHA 4TVOA 2EFJA 4C76A 5JZVA 2G5CA 3C4QA 3CLTD 2D2XA 2EDCA 4P22A 1VYVA 3VJRA 5JD5A 3JV7A 4MPJA 3AVYA 5E6UB 4WESB 2Q5QA 5EIEA 5JECA 4KGXA 1ZJJA 1CZRA 2M1XA 2JJ1A 3FNQA 4WDQA 1UJ6A 2B4KA 1NVKA 2CFCA 5FTKA 3V33A 1ZHFA 2REQB 3CBGA 2D00A 2QORA 3AHFA 3KQWA 4PZPA 4AC9A 3HDHA 4BMSA 5AUPB 5ESXA 5TC4A 3O4RA 4A0RA 4PS1A 1NAIA 1NDHA 3PQEA 2ZYRA 3I9KA 2ZYIA 3ND5A 2C2OA 1A04A 3FCYA 5AK0A 4CLEA 2WWXA 4D8UA 3OX4A 4M99A 1FUKA 1T26A 3QSGA 4YMHA 2W2LD 1Q17A 4JVMA 3O74A 1TT5A 4J4BA 2CF6A 1Z06A 4X92A 4DT1B 4MWTA 4X91A 5KUTA 4KQKA 2WF7A 2RBGA 4IIFA 5ALRA 2AN5A 1H8HD 3N6XA 1BDBA 3LPAA 4GU5A 1ESEA 4XI9A 3URMA 1HL3A 3PC3A 2C99A 3HY6A 1VL0A 4ZPXA 1E1CB 1B8VA 3TB4A 1P8AA 1PL7A 1TCVA 3EIUA 2G8NA 4MGHA 4X0EA 4YECA 3L8