3DO5A

Crystal structure of putative homoserine dehydrogenase (np_069768.1) from archaeoglobus fulgidus at 2.20 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
324
structure length
320
Chain Sequence
MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTREGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative Homoserine Dehydrogenase (NP_069768.1) from ARCHAEOGLOBUS FULGIDUS at 2.20 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords Homoserine dehydrogenase
total genus 96
structure length 320
sequence length 324
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3do5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3do5A01
3R1IA 3FR8A 2Y1OA 1PQWA 3I1JA 3ROMA 4AJHA 4HADA 4K1LA 3PI7A 1T2EA 3PHLA 4Z9YA 4N7RA 2Y05A 3JQGA 1VPDA 4J1TA 4BGVA 4RDIA 3DONA 1ZK1A 1QYVA 5TT0A 3BMQB 3WQQA 4QXMA 1NQOA 3KTDA 3FRJA 1SO8A 3JYPA 3WX0A 4TKLA 1LNQA 3UF0A 1T1SA 4FDAA 1BVUA 4BMNA 1QORA 5KKAA 2I3GA 3GZ4A 3DHEA 5TS3A 1F0YA 4OOEA 3U4CA 4QO7A 2BFOA 2P5UA 2R00C 4JCOA 3PQFA 3KM0A 1IOLA 2Q2WA 2PKQO 2D8AA 3LF1A 3ITKA 1C1DA 2GERA 4K9DA 3NJ8A 4BO4A 4DREA 1ENYA 4R1SA 2DAPA 3TQHA 3JD4A 1BG6A 1LA2A 1K0UA 4U6SA 3CIFA 4OGWA 4AJ4A 4ND5A 8LDHA 4NBUA 2X0JA 3DQPA 2VRBA 2PA3A 5FFFA 1PJBA 5I8ZA 3ZWAA 5G0SA 2GN9A 5IDYA 4CV1A 1R4MA 1PZGA 3KRTA 1HZZA 1MC4A 5JCJD 1OI7A 3Q11A 2ZYDA 3QWAA 3BMOA 2AMFA 4H16A 3RC9A 4BOYA 3AU9A 3FNEA 5BSGA 4NBTA 4LRSB 1ISMA 4YXFA 2E4AA 4FS3A 2DFDA 4D43A 3ZH2A 4LCJA 4JJFA 4GX2A 2FOIA 5F5LA 4PFJA 2B35A 3DOCA 2YDYA 3S1LA 4I5EA 4MVJF 4D45A 1GU7A 1FDUA 3JQBC 3PPIA 4ZN6A 3U49A 1JU9A 2AEFA 2WSBA 3ZWPA 2R00A 3JQEA 2AG5A 2B83A 3H8VA 4NJMA 3H5NA 4I9NA 4ID9A 1I33A 1BXZA 3RROA 1ZK4A 3I52A 5DBFA 4J90A 2FZEA 4HX5A 4MIEA 4INAA 3ONFA 3F6YA 2H1SA 5IXYA 2EKPA 3D4OA 1I36A 1Q7CA 3AU8A 1P1JA 1LX6A 1XGKA 1FDWA 4I5DA 1UP4A 4WLNA 3EK2A 1YL7A 1LDYA 3F5QA 3OFSA 4ALLA 4RVHA 1RWBA 1PZHA 1K6XA 2H6EA 3W6UA 5LCXA 3ZV5A 1I3NA 3PHHA 2YV3A 3Q9UA 4MDHA 3H9QA 2V7PA 4QFDA 1UXJA 2HMUA 3ASUA 1FK8A 4TROA 2HRBA 2VOJA 3EDMA 1Q0QA 4S1VA 1GEEA 3LU1A 1DIHA 1PGOA 4Q3BA 3PP8A 2ZTVA 3HUDA 3RKRA 1Y8RB 3H3JA 3OICA 4R1NA 2W98A 3K2EA 3UAGA 4RPGA 1RYEA 1WW8A 4BHTA 2VZ0A 1KEVA 2QRLA 2VYND 2PTGA 4B3JA 4RF4A 5KVSA 4JP3A 4YAIA 5CDUA 4TMFA 1NQ5A 4WLVA 4M87A 3RWBA 1XDWA 3PZBA 2HMTA 5JSFA 5CPBA 2BF7A 1IYZA 1O94A 2B4RO 5IN5A 3QLJA 2FPIA 3LQFA 2H63A 3ZU4A 1M66A 2JCVA 1R0LA 4JIGA 3N74A 2EGGA 3UUWA 2X9GA 3LVFO 1BMDA 4GL4A 5T8KA 4EUHA 1PQPA 1GZ6A 2GGSA 3Q0EA 4G65A 1ZUD1 2JD1A 3HB5X 4CLRA 1BVRA 3U09A 3WSWA 4YAKA 4XGNA 4UULA 1PL8A 3ULKA 1CEQA 3GHHA 3TZHA 2YFHA 1L7EA 3LLVA 3DZGA 2AHRA 2BLLA 3ENKA 4FJ1A 4U6QA 2HMSA 4GX0A 2HRZA 5I7VA 4Q3CA 5L4NA 3H9UA 3QVOA 4NJOA 1HDXA 5ILOA 3PWKA 2PK3A 5CHEA 5KVCA 5L53A 5C7IO 5IZ4A 3H2SA 1E1MA 3PDJA 2ZTLA 1UZLA 2P68A 4OM8A 2FWMX 2J3KA 3GY0A 4R68A 1PGJA 4MVJP 3W8EA 3DZKA 4HY3A 3MWEB 4KMSA 3SBOA 3K30A 2Y0EA 3EVTA 4IMPA 4W7IA 2WYUA 1B8UA 4KZPA 3M6IA 1ZK0A 1GCOA 4OJNA 2AG8A 2ZTMA 4IZIA 4H3VA 3RBXA 1JVBA 3WLEA 2JFHA 4O6VA 3TN7A 3FPLA 3L0DA 3TSCA 1JQBA 2P5YA 3V2GA 2UYYA 4B3HA 3AUSA 2YQ5A 4OIMA 4CMHA 1N92A 3BTOA 3U4DA 4C7KA 3DFUA 4RGBA 1XQ6A 3EYWA 4L74A 1W73A 1KBZA 4DLAA 1IZ9A 4RO0A 4BNHA 3I9KA 4RF2A 4O5OA 3KB6A 1MB4A 3D3WA 5AXAA 3JTMA 4GLOA 3MJ4A 1EZ4A 1DSSG 5HWSA 4CV3A 4FPXA 3ANMA 4BV8A 4CQLA 2V6FA 2FPPA 3KV3O 1V3TA 2AE2A 2PY6A 4J1NA 3QSGA 2VUSA 3H9GA 1ISJA 5GMOA 1NVMB 3JSAA 1I30A 1I3KA 2CD9A 3QRWA 1ZJZA 3WGQA 5B4UA 3B1KA 2VHXA 1XSEA 5C3MA 2CDCA 1Z6ZA 3PFWO 3A06A 1Q0LA 1P33A 1B3RA 4KQWA 3CZMA 5JC1A 4GVXA 5COBA 4LSWA 1U9JA 1LLUA 2NLOA 1ZSNA 4EJ0A 1NXQA 4FCCA 2NUAA 4XR4A 4BKRA 4ND3A 4IDAA 5GZ6A 1GUYA 3CXRA 3ETGA 2VNSA 5JE8A 1E1LA 2FR8A 5CFZA 4BKQA 4RORA 3I9JA 3BTUA 1CDOA 2RAFA 3A14A 3I3OA 3FCOA 4HP8A 5DF1A 5A02A 3HDYA 1D1TA 3RU7A 1T25A 4OXYA 5G0TA 1O95A 3IOYA 1R0SA 5KNLA 5THQA 4CLEA 1HWYA 4ALIA 8ADHA 2BI8A 4GKVA 5DT9A 3WGYA 3RUEA 4IGEA 4JQCA 4B7UA 1XLTA 1BRMA 1P77A 4J1QA 3FBGA 5JO9A 4BGIA 1I24A 4IJUA 1E3SA 1YL6A 1TA4A 4PG8A 4CL8A 2I67A 1YRLA 2Y68A 4CMBA 1MV8A 4BNGA 1MFPA 3IC5A 4JK3A 4R3NA 1E5LA 2OP1A 2POQX 3W4JA 4BO1A 3DAPA 5C7OO 2NTJA 3NRCA 5I7FA 1E3LA 3EZYA 1LTHR 4DIBA 1DRUA 2O7SA 2X8LA 4ALKA 4A10A 4XYMA 3WGZA 3DFZA 2AQHA 4C4OA 3COSA 1JVSA 4WCFA 2C5AA 3VPFA 1E77A 4Q3AA 4XDZA 1ADFA 1P44A 2G0TA 3BA1A 1CETA 2X22A 5DCUA 3RIHA 3ETEA 4CPDA 1WDLA 2IEDA 2OBYA 4RF3A 3QA9A 3GNSA 1YWGO 3SJUA 3ZWXA 5JAZA 2J5KA 5CEEA 1R16A 4ND2A 1F06A 3HNPA 1L1FA 1ORRA 5MDHA 4FIZA 1LSOA 1EK6A 4YRDA 1U3TA 1ARZA 2X7HA 3OJLA 3JD2A 1A7KA 4M86A 4GSKA 2BH9A 2Y0DA 1HEUA 1PQUA 2GR9A 3SLKA 4WNCA 4ZA2A 4W9NC 2OUIA 4MVJA 1X7GA 1FF9A 4EEZA 5C7LO 3C7AA 4L9RA 5DBGA 5G4LA 3T7EA 3D3WB 4QFCA 3RFTA 1PX0A 4A03A 4IQ8A 1N2SA 4BO5A 2EF1A 5T64A 5A03A 2VWQA 4L75A 3VC7A 1C1XA 3DTYA 5KJEA 1A4UA 1PWZA 1YB5A 5ES3A 2RIRA 4NNJA 5K9ZA 3WWZA 4YT5A 4DPKA 4FQ8A 1QG6A 4YJHB 3LYLA 1DC3A 2EXXA 4QUKA 3SEFA 5KVVA 1B2LA 2YW9A 2B0JA 3T4EA 2C0CA 1UXIA 1YB4A 1Y6JA 3D64A 4EUFA 3RQSA 4E2ZA 5T57A 5B37A 3QWIA 1LC3A 5TJHA 2Q1SA 3WS7A 2RCYA 4NK4A 2O3SA 4XRRA 1QLHA 2NSDA 3VPXA 5THKA 1PJQA 3C24A 1M67A 2ZKLA 2RBEA 4R1UA 1UAYA 1DIGA 3H9EO 1DJQA 1GV0A 2Y1CA 3K5PA 3S2EA 4CR6A 3D4PA 5AXBA 4CQMA 4EW6A 1N9GA 2R2GA 1XHLA 1QR6A 1PL6A 2I5PO 1LQTA 4E2WA 3WMXA 1YDWA 3ZNOA 1NAIA 4R9RA 2GN4A 4JXKA 2OO5A 1NWHA 1ZNQO 4BKUA 2WJPA 2O4CA 4WK6A 4BO7A 1K5HA 3GLQA 3ZWVA 3KYCA 3DBHA 4D0RA 4YCAA 3I4CA 1MP0A 4KWHA 4O0LA 1C3VA 3GQVA 5TSDA 3RC7A 3GDGA 3JD3A 3WXBA 3WWYA 3RASA 3EHEA 4B4OA 4BNYA 2B4TO 1XU7A 5B4VA 3WIEA 4BO0A 5JXWA 3WTCA 3PLRA 3PGXA 3W8DA 5FEUA 1F17A 1XCBA 3HZZA 5G4KB 3I9LA 5BSEA 3QVXA 4CUKA 4I9UA 1U3WA 2PH3A 4TQGA 1EVJA 3BHJA 4CV2A 5JO0A 3IKVA 3LC1O 1IULA 1I8TA 2DUUA 2NTNA 5JCJA 1X15A 4AFNA 2VWGA 1P74A 2F1KA 2EW2A 4WE3A 2V6BA 3HHPA 2C59A 2UV8A 2FR0A 4UUNA 1T2CA 3VTFA 1AHHA 4YJDA 3MCVA 2DPGA 4J0FA 1E6WA 3TFOA 3UCFA 4NHEA 3L9XA 5IAAA 4P22A 1GYQA 1UDCA 1UZNA 4I5GA 5G0WA 4CR8A 3PJFA 4MPDA 2UUPA 2UDPA 2G82A 3B1FA 3TPCA 3MEQA 3TZCA 2DTEA 4GH5A 3WTBA 4YPOA 1DRVA 1B26A 4EI2A 1D8AA 2JAHA 1PGQA 2Q50A 4IS2A 3GEDA 3GUYA 1I01A 1E3JA 3H2ZA 4XGKA 3Q1LA 4CLDA 4W7HA 3B6ZA 3E18A 2C5EA 4GPD1 4R41A 1XR3A 2H5LA 4KUHA 5EQFA 3WGGA 1R4MB 3VDQA 3EY4A 2X5JO 4P4GA 3ZN2A 2SCUA 3NYWA 5U1PA 4MVJM 1U28A 4DL9A 3WNQA 3M2TA 4CM4A 4E5MA 2Q3EA 4KP7A 4CMAA 1CERA 4IXWA 3N58A 5B1YA 5KJCA 2C82A 4ZQGA 2VHVA 2CVZA 3KSZO 1O8CA 3NDRA 4LGVA 1YGYA 2V65A 4DMLA 1RM5A 1BW9A 5EMHA 3WGHA 1DHRA 4IXTA 2FSSA 1E6UA 4WASA 1U8XX 4MVJD 2HCTA 3BZUA 1MG0A 6ADHA 3MTJA 2OBNA 4JX8A 2O2YA 1ENZA 3WIDA 3OIGA 4PVDA 5EERA 2EG9A 1N5DA 2YDXA 1NTOA 1XELA 2PFGA 5T6BA 1UDAA 3PQEA 1TEHA 4GX1A 4FOSA 1SOVA 2GO1A 1DPGA 1Y8QA 1A4IA 2VHZA 3ON5A 3P2YA 4II2A 1X0XA 1ONPA 4L4XA 4CM4B 4CUZA 4OYRA 3QWFA 1T2FA 1BXGA 2AQ8A 2CF5A 1VKOA 3ZHBA 4B7CA 1NNUA 3ETDA 1LU9A 5EN4A 4YQYA 2J5RA 2VRCD 1F14A 1MC5A 1R12A 2VT2A 4N5NA 3PVZA 5FYDA 5B4TA 3MJEA 3OA0A 4RVSA 5ER6A 4J49A 3RBZA 4JBHA 2WE8A 4Z9XA 4KDEA 2Q1UA 3DMYA 4RZIA 3ZWWA 1X7DA 1LC0A 1ZSVA 1ZJYA 1KVSA 5DNAA 4ZD6A 3HDHA 3S2FA 3CH6A 1N7GA 3K8ZA 1UXKA 2X4GA 4EZBA 1HF3A 4ZU3A 4G5HA 5JMPA 4BNIA 3CMCO 3PXXA 2IRWA 1R15A 2DPHA 4PGFA 5LDGA 4BGEA 3CKYA 1K89A 5COQA 2RH8A 5KCZA 1AGNA 5JAQA 3F46A 3DBRB 2O23A 3BHMA 5AQ1A 3MJVA 4J16A 2J3IA 3GEMA 2WEKA 2Q49A 1NASA 1BSVA 2ET6A 3MJCA 4CMEC 1NHWA 1C1DB 3S2IA 2WD7B 3ZWCA 2EWMA 2UUOA 1MXHA 1PSDA 3OF2A 3W6ZA 3K2BA 2LDBA 4UUPA 4KOAA 3RFVA 5DOZA 3NGLA 2FMUA 4AICA 3PWZA 5IJZA 3SXPA 1HL3A 3JQ8A 3GRPA 3OJEA 2YZ7A 3VVBA 4ZHSA 1AHIA 3WDSA 4BNJA 4RPKA 1P1KA 4AJJA 2X5OA 4AG3A 1E1NA 3WGTA 3U4HA 4E4YA 1NHGA 4KUEA 4XKJA 4NBWA 1OMOA 1F12A 4JJIA 2VZ8A 3OBBA 4OXNA 4YAEA 3RCBA 3HSKA 4WJZA 4CM1A 3HN7A 4CM9A 4S3MA 2Y93A 2NVUB 4BNTA 1PJLA 4W4TA 2IODA 3WSVA 1PJ2A 3HG7A 5IDWA 3DBVO 2ZQZA 2IYOA 2TMDA 4I5FA 2GRAA 5JAIA 2EJVA 4YDRA 3OECA 4BGUA 3TL2A 4Y9DA 4DVJA 1RPNA 3PWSA 3RSHA 4MJLA 5B12A 3H9JA 2X0IA 4UREA 1PS0A 2CDAA 2Y1EA 4PLCA 2J5QA 2HKIA 2X6TA 3DBRA 2P9CA 1V8BA 4TWRA 1HRDA 3P19A 2IXBA 3WJ7A 1DC5A 3OETA 1CJCA 2D59A 3O8QA 1TT5B 4J43A 3QVSA 3VOSA 2NTVA 2Q99A 4E6PA 3VDRA 3JD1A 1MGOA 4L4RA 4CMJA 4URFA 4OO3A 1V9LA 4XJTA 1ZKMA 3ZWNA 4FFMA 1HSOA 2P9EA 1PJCA 3LK7A 3OM9A 3AI1A 1YB1A 4K26A 2VT3A 2YHIB 4OSOA 1PTJA 3BMOB 5L3ZA 4UVEA 1H0KA 4A7PA 2NVBA 4ZJUA 5JDCA 3E9NA 2OGUA 1I32A 3ZWYA 2ZK7A 4RPHA 2VRCA 3VH1A 2P4HX 4IMRA 4IQGA 4LISA 3WQSB 3MZ0A 3GPDG 3VH2A 1DFHA 2QW8A 2W4QA 4D44A 3LC2O 2B5WA 1LDEA 4BKPA 3RVDA 3ZU5A 1FDVA 4ROSA 1VSVA 1PGPA 3IUSA 1ULUA 1HE2A 1I2CA 4X54A 1SEVA 4CM3A 3BTSA 1FDTA 3BHIA 2HLPA 5CEJA 5JFOA 2CZCA 1OC4A 1NM5A 4PG7A 1UZMA 2UAGA 1X0VA 2GYYA 1EDOA 3GRKA 1X14A 1HDCA 3L6EA 3VZQA 3AOEA 4BO2A 3AK4A 4PG4A 3MJSA 2EIHA 2G17A 3JD0A 4CLRB 5IZCA 1K2WA 3UN1A 2Q4BA 3PEFA 3I9MA 5CDYA 4I1IA 4L0QA 4BNKA 5JY1A 3G1TA 3LT0A 4NPCA 4N5MA 3AM3A 3KZVA 4WCDA 4H7PA 2Q4EA 4M89A 3GEGA 3JQ7A 2X86A 1GQ2A 2AW5A 3EVNA 1XIVA 1W0CA 1I10A 2C2YA 3PK0A 5ENVA 5KTKA 5EESA 5A05A 4BS9A 2DFVA 2HQ1A 3ADPA 3C7DB 2QQ5A 3NT2A 4WCFB 2BFMA 2HMWA 1KYQA 5CDSA 4WOKA 4ZVVA 5H81A 1UAGA 3ZNPA 3KO8A 5DP2A 2CY0A 3FWZA 4E21A 1KC1A 3K73O 1QP8A 4CMIB 4NBVA 3LT2A 2GZ2A 1OC2A 5ILGA 2ZCUA 5JDIC 2CUKA 3IKTA 4L73A 2CNBA 2OFPA 1PIWA 4WLUA 1LLCA 3CPSA 1E1KA 1ZSYA 1DDOA 3GGPA 2BMAA 5IF3A 5JW6A 4N54A 5TT1A 3G79A 4BMVA 2G1UA 2C7GA 3UCEA 4HXYA 3W4IA 1XU9A 4FSHA 4Z0TA 3ZW9A 3GFGA 1E7RA 3HN2A 1PJ4A 1ZMOA 4WPGA 3F4BA 1DAOA 1QSGA 1I5RA 3FWNA 1UUFA 3O38A 4IPTA 3N7UA 2G5CA 2ZB3A 4U0KA 4ALJA 5M6DA 4A27A 5BSHA 1HXHA 3DOOA 2EHDA 4YT4A 3PQDA 4RJTA 3RUCA 3ZV4A 1P1HA 3VH4A 1MUUA 4XYBA 2X23A 3GN2A 4W82A 5ER9A 5KVQA 3WICA 2V6MA 3ZNQA 3DTTA 4BUCA 4YB8A 3D1LA 4GVLA 4QQRA 4YBZA 2HK9A 3RBVA 1P9LA 3TFQA 4Q9NA 4HFRA 1DLIA 1WAMA 1CYDA 1PEDA 1L7DA 5J9GA 3EZLA 3JQGB 3AI3A 4FBGA 1EE9A 3V1TC 5DZSA 1KS9A 4WKGA 4BNNA 3JQDA 5JNLA 1ZH8A 1HDOA 4ALNA 3OEWA 3O26A 2QG4A 1P3DA 1XA0A 4BNMA 3FTPA 3HDQA 4P38A 5BNIA 4YWJA 2CFCA 4XQEA 9LDTA 4XD2A 4D46A 2B36A 3NUGA 4I08A 4XEHA 3B20A 3M2PA 3JYLA 1GV1A 1M2WA 5AOVA 4J7XA 4DIOA 1JDJA 4J3FA 3MWDB 1ZBQA 4AJKA 3W4KA 1Q0HA 3T4XA 3PYMA 3Q3CA 3WFIA 4ESOA 4U5QA 1G1AA 4BVAA 4J4HA 3SVTA 3WYCA 1NBOA 1NX6A 1H6AA 1E3IA 1GZ3A 1PJTA 3EW7A 1WMAA 3GMDA 1MA0A 5EPOA 3GZNB 5A9RA 3ROQA 4YJGA 5BNTA 3AOGA 1YH3A 4EJ6A 4D79A 3RUDA 1KY5A 5BT9A 4BNUA 2OXIA 3IDSA 1Z74A 1HKUA 4A0SA 3G17A 4TZKA 1H93A 2GZ1A 2NWQA 3OMLA 2O7QA 3KLPX 5BR7A 4OH1A 4PLHA 1U4OA 5K6AA 3U5TA 1KVQA 3ST7A 4A2CA 3AY3A 1O9BA 3QJ5A 1P0FA 3OIFA 1VE9A 2GUGA 2AXQA 1KEWA 5A9SA 4J4BA 3CINA 2FRDA 4Y6PA 1RJWA 1PZEA 1QV6A 3DZHA 2D3TA 4ITUA 1A7AA 3WFJA 2WYWA 1Q7BA 3BXXA 4NMHA 1T2DA 1M76A 1YQXA 3PHIA 4EDFA 1GZ4A 1SPXA 4L8VA 3DAFA 3HQ4O 2Q2QA 4FJ0A 3NDJA 4GWGA 4AJOA 4D0SA 1M6HA 4RZHA 5HA5A 1HLDA 3IMFA 3OHSX 4RVDA 1E3WA 3TRIA 4LK3A 1ZVMA 5CP8A 2C29D 1CWUA 2VYVD 1EQ2A 4XA8A 2CF6A 1SOWA 2VYVA 4GAEA 4OMUA 3F1KA 4YAGA 5KWEA 2HU2A 4FR5A 3VPHA 4ILKA 2JCYA 4UVHA 3I9NA 3AUUA 3O9ZA 3LLSA 1ISIA 1GADO 3D7LA 3DEYX 4D42A 4E30A 4R54A 4XYGA 3MOGA 5IXSA 4HKTA 3SX2A 3UGKA 2JD0A 3MTGA 4KTVE 5IN4A 4MKXA 3DHNA 2Y99A 2DU8A 4PG6A 3SC4A 1SZJG 5L45A 1NWCA 1UH5A 3CSDA 2DBZA 3AFNA 5U4QA 2J6IA 5JYDA 2O3TA 2CVQA 2W2LA 1RM4A 2B4QA 3JQAA 1TLTA 3E9MA 3GG2A 1TB4A 5F1PA 2OMEA 4UEOA 4NH4A 4BQPA 3V5NA 2X1HA 4J9UE 2VNAA 2BD0A 3D5TA 3FI9A 5L7TA 1YDEA 4JGBA 2E49A 3GT0A 4E5YA 3JCZA 1ZEMA 5JCXA 4DRYA 2VUUA 1IHXA 4MVJH 3H65A 1HETA 5GZ3A 4WEOA 3UH1A 3ZNNA 2VQ3A 5HS6A 5C5IA 4DQUA 2RHRA 3GGOA 1WDKA 1RKXA 3OIDA 4FFNA 4GWKA 1HT0A 1QYWA 2QZZA 2ZCVA 3LSYA 1TI7A 4CM8B 5K6AC 1ZK3A 1P1RA 1QYDA 2I9PA 1VKNA 1IPEA 2PWZA 3VPGA 2QRKA 3P2OA 4IINA 1PJ3A 3P5SA 2QYSA 3RAJA 1WMBA 1Z75A 5EL0A 1D3AA 5HM8A 2D0IA 2YFQA 2HK8A 5F1OA 2H9IA 3LT4A 3E5RA 3UHAA 1ZMTA 2GASA 1I3MA 1C14A 1DIAA 2NADA 2YHUA 3JQCA 1GY8A 3JQ6A 4L4SA 4XWYA 4YVFA 3ZWOA 3PIDA 2A94A 2YV2A 4IS3A 3HDJA 1CIVA 5G0UA 1DIBA 2JL1A 4EBFA 5BSFA 4FOOA 1WPQA 4AJIA 1IHYA 4CMEA 1CRWG 1I3LA 3JQAB 2RHCA 4J7CA 5COAA 1P45A 4NIMA 4YACA 2QZ9A 3DC2A 3C8MA 4CLHA 3AI2A 4YRBA 4CQMD 1X1EA 2RH4A 2X0RA 4EITA 3B1JA 1ID1A 2PKQP 3ANNA 3JQ7B 4IBOA 1I0ZA 3IJPA 4RQUA 3H3FA 4RL6A 4IJVA 4GBJA 5JYEA 4NR0A 3DOJA 2OZPA 1LSUA 3QWHA 5DULA 1VC2A 2E82A 3QE3A 4PZCA 1PR3A 3ITDA 2NU6A 1U7HA 4AJ2A 4JP2A 3L07A 3ZHZA 1E7QA 1GFSA 3RC1A 2I76A 1XKQA 5G0VA 1N9GB 3AM5A 3NX4A 4PZDA 1NPDA 5F21A 1ZEJA 5EIOA 1UDBA 2WWRA 2FZWA 1NVGA 4YJGB 5DN9A 2HJSA 2WE7A 1D1SA 5JBIA 3NAQA 3U4IA 4Z9FA 2PR2A 3U3XA 1NQTA 5F3RA 4ZGWA 4J2OA 3KSDO 1LRLA 1HYEA 2J8ZA 2PLAA 5LC1A 4J2HA 1TXGA 1HE5A 3DDNA 1LJ8A 2ZQYA 5TC4A 1LRJA 2X9NA 2JAPA 1R66A 1QKIA 4EUEA 1E6EA 2Q45A 2B69A 5T67A 2QIOA 4PCVA 4UVDA 4E12A 2Z1MA 1KVRA 4E2YA 4MVJE 2FY8A 5AXCA 4ZRMA 4ZQHA 1B3BA 2A9FA 3NT4A 4IDEA 4KDFA 1ZXLA 3HFSA 2O3JA 1HDZA 1C1XB 4PLYA 3ROKA 4DYDA 3X2FA 1Y5MA 2ZB8A 4MP6A 1O5IA 2X9VA 1SBYA 3CEAA 1BGVA 1R4NA 3GVIA 3EUWA 2VCYA 3VZPA 4HWKA 3GC6A 1E0DA 5L40A 4DQXA 2CVOA 3ZU2A 4MIOA 3OP4A 2O50A 5T5QA 1ADGA 4E0BA 5TLSA 4BIIA 4IDGA 3VVCA 3A4VA 3UCXA 4M8SA 4BNLA 1U5CA 3TZ6A 4G81A 3DZIA 3EGOA 3OJOA 1EBUA 2YHIA 1O89A 3R6DA 4ZRNA 9LDBA 5HRUA 1OBFO 4Z6KA 5ITVA 1WP4A 3FN4A 3SJ7A 3INRA 1ISFA 1ADCA 3FTNA 2D1YA 3AUAA 1ZFNA 2DUWA 2C7VA 3C1OA 1Q7GA 3CMMA 3KHUA 4D7AA 5L4SA 4BQRA 3K92A 2PZMA 3WNVA 4W99A 2VTEA 4TVBA 4R1TA 4YT2A 1YVEI 4DXHA 4GQAA 2EP5A 1K6JA 1Y1PA 1IUKA 1C0LA 4PN3A 1NFQA 3KETA 4DPMA 4IUYA 3HWRA 1R37A 1S7CA 2PNFA 4B4WA 4N18A 2IZZA 1S6YA 2GF2A 1YXMA 2VWPA 1T26A 4J0EA 3GF4A 3PHJA 1E3EA 1EFKA 3TJRA 2PZJA 2ZTUA 4YQZA 3S8MA 2YYYA 2DT5A 2Z95A 4FFLA 3SC6A 5L4LA 3VPSA 4YAJA 3V8BA 3KEOA 2NVUA 3PHGA 4TRMA 1C0PA 2R6JA 4F3YA 5T8KC 3HJAA 1E92A 3R0IA 1UR5A 4A26A 5KIAA 4MINA 2JCXA 5JC8A 1A5ZA 1ISGA 3GZNA 1GUFA 3PJGA 3PRJA 4Q3NA 2NACA 3ZHXA 4CODB 4DIFA 1LQUA 3UICA 5TIIA 2E48A 2XAAA 1NFFA 2EKLA 3TWOA 4DC1A 1ADBA 1SB9A 2QHXA 1G0OA 1ZZEA 1EE2A 4LVCA 5TQVA 5GY7A 3STHA 3AY6A 4QSMA 4R51A 4OHUA 2NV6A 3AFMA 1P0CA 3FF4A 4TZTA 3T7CA 1AN9A 3ZV6A 3V1YA 4WOJA 3NGXA 2Y1FA 1FMCA 4CJXA 3GAZA 3W1VA 4EYEA 3IL2A 1XYGA 4U8GA 1HYHA 2I6TA 5T73A 1RM3A 4QX6A 1IB6A 4WLOA 3QQPA 4E33A 1LDMA 3TNLA 1ONOA 1TVEA 2YY7A 2Q1TA 1KC3A 1R4NB 3TZQA 1GCUA 1VRWA 1P1IA 3GR6A 2Z1NA 4Q3EA 1H5QA 5ITWA 3NJ4A 2DLDA 1ZCJA 1AUPA 1EVIA 3ZI0A 4P4NA 4K28A 4CL3A 3AW9A 2DKNA 4WECA 4RVGA 2HMVA 2W90A 2ZJ1A 4DLBA 1OOEA 4BNVA 2VN8A 3QV1A 4L76A 1MX3A 2IDZA 4IM7A 1GUZA 1KIFA 4BB6A 1A71A 3DBLA 3GDOA 3PGJA 1WXDA 2XPCA 2ZIZA 4XQGA 4OQZA 2G76A 1PS9A 1AXGA 4WGGA 3RUFA 2W2LD 4LMRA 1KY4A 2EGHA 4AJEA 1BTOA 1U7TA 1DLJA 4MP8A 2NM0A 3FNGA 3QP9A 4GMFA 2IE0A 2HSDA 3JYQA 5CG2A 4HBGA 1U4SA 4IDCA 5DBIA 5AXDA 1JAXA 3IIEA 5IDXA 1GEGA 1B8VA 1Z7BA 3C7CB 4OKIA 4A5OA 1HTBA 1VM6A 1LDBA 5A5EA 1DXYA 4YR9A 4FD3A 1LRKA 3AM4A 3V1UA 3LDHA 1ZK2A 2EW8A 4FFRA 3INTA 2W2KB 3LZ6A 4IDBA 4E5KA 3BYZA 1VLLA 1DIRA 5TGDA 4NU5A 4ZQBA 3F9IA 4UAGA 4OKNA 4ONEA 3ZW8A 4BKOA 1WZEA 4P8RA 1QXSA 1SCUA 3DMTA 4YJFB 3C1AA 3CUKA 2OP0A 3DHYA 1SC6A 5A06A 3M1AA 3E5MA 3O8QB 1CF2O 3RKUA 4D3DA 5IG2A 2WM3A 4EEXA 4IIVA 4Z3KA 1IE3A 3I5MA 1NPYA 1NVTA 4MVJG 3Q6IA 4XYEA 3OSUA 1H6CA 1VJTA 3GHYA 1HDRA 4TSKA 5ENDA 3EC7A 4RVFA 2DBQA 3LC7O 5KKCA 3UW3A 3AWDA 4GGPA 4NQZA 2JFGA 3KYCB 4CLXA 1NAHA 2ZYAA 2GDZA 1E3WB 3CZRA 4I9HA 5A1TA 4JBGA 4DC0A 2PGJA 4B8WA 3IUPA 1ZXBA 2Q1WA 4R69A 4D41A 4B8ZA 1EUDA 1UXHA 3RJ5A 3U62A 2NQTA 3H5AA 4W9NA 4PLTA 2Y1GA 3OQ6A 5F1KA 4E13A 4R4JA 1GDHA 3Q2KA 4EJMA 1E7WA 4NFHA 4BO3A 3Q9NA 1LEHA 1D7OA 5DCYA 4CM5A 3VHRA 1U1IA 2X0NA 5U9CA 4KWIA 4RLHA 4QECA 4NK5A 4B3IA 1I2ZA 4ND4A 1ENOA 1U5AA 3PZRA 1VL6A 4D3FA 1H9BA 1N1GA 3DB2A 2D5CA 3MJTA 1EEHA 3OEYA 2OOSA 4M1QA 2GSDA 1ZW1A 1Z45A 2QX7A 4FB5A 4JBIA 2AEMA 3KLMX 4TKMA 3UVEA 1EVZA 4XX0A 2BHLA 1JWAB 3BMNA 5TX7A 3D0OA 3X2EA 1PR9A 4BO6A 2O3UA 1QLJA 5TJ9A 2VWHA 3JV7A 2VYNA 4TRNA 3ZHYA 3FR7A 2C2XA 5I8WA 1D4FA 1OFGA 3IP3A 3TF5A 1V6AA 3C85A 1HE4A 3DBLB 1GTMA 1J6UA 2B37A 3RJ9A 4CM7A 1VJ1A 3NT5A 3Q2IA 1BW9B 2HK7A 4NJMB 3ZWBA 4GI2A 4E2XA 4JNKA 4TRJA 3KXDA 4IY1A 3F47A 3WLFA 1NYTA 4PRKA 3JQFA 2GN8A 3KYDB 3VH3A 1J4AA 4NG5A 2X58A 1GQQA 4CMGA 1F8GA 5CEFA 1V35A 2WDZA 2EERA 5A4DA 3BMNB 4JLWA 1X1TA 3PJDA 2TMGA 3K96A 4UEKA 4BO9A 4R5HA 1IY8A 4NDNE 2PV7A 2BELA 2OHXA 3P7MA 1J49A 4FFOA 3DXFA 1B7GO 2PD4A 5J23A 4DPLA 3JQBA 1EVYA 1MLDA 1VSUA 4RF5A 1A9ZA 3GPIA 5GZ1A 2NU7A 4J9VA 3GH3A 3S2GA 1EDZA 2J3HA 1FXSA 5MGBA 1E7YA 1R0KA 1K6IA 5H82A 4DTIA 1BXGB 1NP3A 3G49A 1KOLA 1OZAA 3WGOA 3VTZA 1J5PA 3R3JA 1CQJA 2DVMA 2DQ4A 1QRRA 5JYFA 3ANLA 3H6KA 3F1LA 3M1LA 4B4UA 3GG9A 5CG1A 4E5NA 3CE6A 1PZFA 3H7AA 1Q1NA 1JN0A 1H6BA 4MOWA 5A3JA 1BWSA 2PD3A 3UOGA 3GOHA 1N7HA 4ZQEA 4MVJI 1XWFA 3GN1A 2NU9A 1VJ0A 1LSSA 3IS3A 4LN1A 1YJQA 2AQIA 4R5MA 2PGLA 3TDKA 2ZATA 4XR9A 1G6KA 1K3TA 1BDMA 4DGSA 1XQ1A 4OOFA 4CM6A 1LXCA 4J91A 5DCWA 1ISHA 3BTVA 2Y67A 3KVOA 4G2NA 3NDIA 1YO6A 1XEAA 1YL5A 3OQ1A 4QO8A 1KVUA 1PL7A 2YQ4A 5JDIA 3NKLA 4JN6B 3VKVA 3GNTA 3PTZA 4E5PA 1YOVA 3DZBA 3GUCA 3L4BA 2DTDA 4B7XA 2FP4A 6LDHA 4F45A 3DAGA 3G3EA 4R3WA 4FN4A 1N1EA 1QMGA 3HE3A 1W6UA 1Y7TA 3D5QA 3VAZA 1Y81A 1WVGA 5HTOA 1H6DA 1PU2A 4D3SA 4NU6A 3JQ9C 2EKQA 4HFMA 1HDGO 7MDHA 4Z3DA 1SEPA 3E8XA 2Q22A 2FHSA 3ZCXA 4PLWA 2GD1O 1LDNA 4O63O 3FPCA 1PS8A 1VL8A 2PH5A 2O3QA 4AL4A 2OL4A 3DO5A 1NR7A 2FPGA 5G2OA 2HO5A 1AXEA 2WMDA 2DC1A 2EP7A 5JLAA 5HBRA 2PZLA 3GK3A 3ZDFA 1E7SA 4HFJA 4CQMB 1W8DA 4PLVA 5ICSA 3ADOA 2QYTA 2WTBA 3H4VA 3I9OA 3R3SA 4M55A 4BO8A 3ASVA 4XJSA 1V0JA 1HDYA 5LDHA 4C7JA 3DBHB 2XXJA 3KOUA 4XIYA 3RFXA 2Z5LA 1JLLA 5JS6A 3O03A 1ULSA 4ZICA 1PGNA 2ZYGA 2EJWA 4HUJA 1JKIA 4XQCA 2V6GA 3O4RA 3U9LA 2BGKA 2W2KA 1ZO8A 3S55A 3K31A 1HYGA 2JD2A 4WCFC 3ZU3A 3LT1A 2JJYA 1EK5A 4CM9D 3AJRA 2JHFA 1JAYA 3NV9A 1QYXA 1YQGA 3GDFA 4GLLA 1QV7A 2C07A 2O2SA 2VHWA 4O1MA 4J1SA 1EMDA 1F8FA 2CSUA 4WLEA 3A28A 5ICMA 1WNTA 4OQYA 3ZZNA 1I2BA 4M49A 3AOEC 4GKBA 4HNGA 2DM6A 4XDYA 4YT8A 1UXGA 1B16A 2A4KA 3QY9A 1B0AA 5JMWA 2GLXA 4DUPA 4J4TA 5K0ZA 5JYAA 1DOHA 4OAQA 3FBTA 1B15A 1Z73A 4Z0HO 3GNQA 3WOHA 3WR5A 4RPJA 1FDSA 2BFAA 1LBEA 2Y66A 5EQDA 3IQDB 1SNYA 4ZQFA 2PKRA 2NVWA 1BDBA 4PLGA 3TZKA 3TOZA 3FNHA 1LUAA 1U3VA 2BFPA 1T24A 4PVCA 4TRRA 2D4AA 4WNIA 3NTQA 5AVOA 3C3XA 4J7UA 1C0IA 5JDCC 3OA2A 5G4KA 2F00A 3VKUA 3ONDA 4R9SA 3MOIA 1Z7EA 5DP1A 3F4LA 3I83A 3PLNA 1Y9EA 4BNFA 3PDUA 2XF8A 2P91A 5JY6A 2BGLA 2ILTA 1EUCA 3UFXA 2O3RA 2PGDA 4CMCA 4F6CA 3NTRA 3L4BC 1C0KA 3JQ8B 1P1FA 2VZ9A 4BNXA 5FI5A 1ONNA 3E82A 1E5QA 2E6UX 3PFFA 3UXYA 3EMKA 1B8PA 4NI5A 1FJHA 4Y98A 1WZIA 2WD7A 1UP6A 1N8KA 1Y8RA 3DWFA 1U3UA 4FC6A 1A9YA 1GYRA 1QYCA 4II3A 3E48A 3D4NA 4Y6RA 3IJRA 1ML3A 1KETA 3E9QA 1R6DA 3G0OA 1AE1A 1LI4A 5JAMA 5A04A 2HUNA 3L6DA 5A3VA 2ZB7A 2P4QA 4YYZA 5DDIP 4DBVO 2NQ8A 4FJ2A 1XG5A 2YJZA 5F5NA 3RD5A 5DOVA 3RUIA 2DBVO 3PJEA 5IFLA 3PYXA 1JKFA 2X5KO 1BXKA 3DZJA 2BKAA 4KQXA 2VHYA 1JTVA 5ADHA 3W8FA 5FI3A 4IZHA 3KSUA 4YEDA 1U2DA 4GX5A 3INGA 1NFRA 2GNAA 1YKFA 2W8ZA 4IJKA 1ENPA 2AE1A 1V3UA 3E1KA 2JHGA 4LVUA 3GVPA 4MIYA 5L7YA 3FD8A 1B14A 2J3JA 1GAEO 4IQ0A 1T1RA 1Z82A 1LDGA 1JW9B 3E6AA 5H83A 2IZ0A 4AVYA 2I3AA 3HFGA 4W6ZA 4DBZA 5FWNA 1JA9A 1O0SA 3V2HA 2C54A 5A9SB 3WQRA 3DZFA 4YJFA 1Q2XA 4DA9A 1H94A 2UVDA 1DB3A 4BNWA 2O4UX 3EAGA 4GSLA 4Y8VA 3BIOA 1HE3A 2A92A 3QWBA 1YBAA 1KERA 1EFLA 2NNLD 3OQBA 4B79A 3JQAD 3ZV3A 5C37A 3IAHA 1WWKA 3L9WA 1M6WA 4A73A 2GPTA 4CUJA 1DHTA 1DC4A 3LF2A 3ICCA 4LCEA 1DO8A 2DTXA 3WMWA 1UJMA 1KVTA 3BMCA 5IZCC 2O48X 2ZJ0A 2FR1A 1DEHA 2OORA 4OSPA 4PRLA 5CAEA 4IDFA 5KOIA 4UEJA 2JKVA 1T4DA 2PD6A 1SMKA 3RUAA 2GZ3A 5A5FA 5EINA 3DMTC 1KEPA 4BMSA 4CQLB 3NTOA 1BHSA 5L95A 3WG9A 4LW8A 4FW8A 1U2GA 2Y1DA 4WUVA 3WBFA 2XXBA 5L7WA 4PG5A 3DL2A 1GPDG 1DFIA 4E3ZA 4IDDA 1WLYA 4Q3DA 3I4FA 4PLPA 3QIVA 4PIVA 5EJ2A 3GVHA 4ALMA 1ZIDA 2D2IA 1DJNA 1YBVA 4LRTB 2WD8A 1NR1A 3FNFA 1VI2A 3U0BA 1TT5A 4CV0A 2CMDA 1JKJA 3F5SA 3D3EA 3BMCB 4AJ1A 1DBVO 1MG5A 4DMMA 4GMGA 3BMQA 2NU8A 4DWVA 4F6LA 3KEQA 3DR3A 1TT7A 2BRUA 2HDHA 1GPJA 1EUZA 2AA3A 3E03A 1A72A 1IZ0A 3CTMA 4AJLA 2Y0CA 4NBRA 4RVUA 4UUOA 1U8FO 2GN6A 1T4BA 4B4VA 4DYVA 4RQTA 1NPTO 1Y5RA 3FSRA 4UUMA 1Y9AA 2HAEA 4PZEA 1RYDA 2WYVA 2AEJA 5I9MA 4IIUA 2FSVA 1PJSA 2BGMA 2A35A 4WLFA 3KBOA 4PLFA 1YE3A 4AJPA 2HJRA 3L77A 3JYNA 2VOEA 1V3VA 1J0XO 3OH8A 1GD1O 4R16A 3A9WA 1OAAA 1IL0A 4XZ3A 5I7SA 3GA0A 4TVOA 1YOVB 4FFPA 1E7MA 1H2HA 4BL5A 4CM8A 4CMKA 1UP7A 1WDMA 3ABIA 1MFZA 4GGOA 4MKRA 4NZ9A 1LLDA 4XRGA 4CLOB 4MO2A 5L9AA 1KEUA 1T2AA 4QEDA 5KJFA 1GYPA 1HLPA 4Y6SA 3GMSA 1PWXA 3V2UA 2E37A 2IEBA 4N5LA 5L51A 1NQAO 2Q46A 1HZJA 4H15A 1W4ZA 3L6OO 5IDQA 5CPFA 1H9AA 5KJ6A 3GGGA 4YA6A 4FGWA 1CQIA 4XB1A 3WYBA 4IGFA 3I23A 4O59O 2D5AA 4ND1A 2I66A 4XCVA 3PYLA 3B70A 4UVGA 3QVWA 1X13A 2BI7A 3K6JA 1YBMA 1RM0A 3SLGA 4JROA 1YJ8A 4XGIA 3I6IA 4OL9A 3TL3A 1YQDA 3OJFA 4KTTE 4U0JA 5JPIA 3RUHA 4U7WA 4XB2A 3G1UA 3OJ0A 2YUTA 4CMIA 3VZSA 4BB5A 3KYBA 2IXAA 3K9QO 3HB4X 3JYOA 3FHLA 4J6FA 3QHAA 4Q39A 1GQYA 3WYEA 3A1NA 4QT0A 4HFNA 4P4LA 2XOXA 4BV9A 4PLZA 4RV9A 4YJHA 2ZB4A 3RI3A 1VL0A 1P31A 2B5VA 1A27A 2VTDA 4FGSA 4CR7A 2P9GA 5KJ1A 5TNXA 4E32A 1Y8QB 4F46A 1X7HA 2GCGA 4WEQA 3IP1A 3GVCA 4R01A 4M54A 3KYDA 2CDBA 1YONA 1M75A 1SAYA 4DLLA 4EGFA 4Z0PA 3ZGYA 1IPFA 5AYVA 4RCVA 2DBRA 4E31A 3WBBA 5A9TA 3ENNA 3WGIA 3C1TA 3NEPX 3ONEA 4HV4A 2YV1A 3JQFC 4FC7A 2EV9A 3WB9A 1DRWA 1JWBB 4RDHA 5I9NA 4RLSA 5HS4A 5I7EA 1MXFA 4RPLA 3GAFA 1DC6A 4JJGA 3RC2A 3KUXA 4YRAA 2FN7A 2LDXA 1SB8A 5CDTA 5TRTA 3ORFA 2IZ1A 4NFSA 2VUTA 1DAPA 2I65A 4LSMA 2Q2VA 4NFYA 3L4SO 1H2BA 4YTEA 1YS4A 1GR0A 3VZRA 3I6QA 4UVIA 2P2SA 4HNHA 4K6FA 2IYPA 1HSZA 1EQUA 4KUGA 5FF9A 3QW2A 3ROPA 3TOXA 3ICPA 2EEZA 1DFGA 4CLOA 4K6CA 3WJAA 5BNFA 4LMPA 3GVXA 4XYLA 5CDGA 3PIIA 1LLQA 3BAZA 7ADHA 4DQVA 2AQKA 3AY7A 2QRJA 2JFFA 4AJNA 2C20A 4Y67A 3QVTA 4OXKA 1G0NA 4XQ9A 2I99A 5I9LA 1LSJA 3H5RA 3ZWMA 4QTZA 1EBFA 3RU9A 4MKZA 1GL3A 3UKOA 4XIJA 1O6ZA 3JQ9A 3GFBA 3HADA 3AUTA 2PZKA 4BNZA 4IJWA 5BQFA 4I8XA 3F3SA 5TF4A 4MP3A
chains in the Genus database with same CATH superfamily
2JAXA 5LYJF 3VPCA 1PQWA 3PGLA 3ROMA 2GM9A 4HADA 1L4EA 2AHOA 1T2EA 4IHJA 3LVRE 4ZYZA 2G6TA 1VPDA 2FSPA 2Q1XA 4IH1A 3V9AA 1YZVA 2EZ8A 4RDIA 2W6CX 1UKBA 3ZUPA 3X43A 2IUTA 1YMVA 1YQQA 2EL7A 2YJTD 3ABSB 2AK2A 3O1LA 5FCDA 4KO1S 2C03A 4FNOA 1XNJA 3HB7A 5C0OE 3AINA 1T0IA 4F4HA 4WGFA 2AN1A 1NBIA 2OEPA 3JYPA 1O0BA 3RRZA 1EIWA 4FDAA 3WB1A 2E18A 4JC4A 1OFIA 1OAOA 1QH8B 2IKSA 3DHEA 3OQIB 4N0PA 4YS6A 5TS3A 1TUGA 4HHEA 2AR9A 1YHNA 2WU1A 2Q0SA 2DG2A 1RWVA 3K1JA 1JEQB 1UODA 3WMFA 2XGJA 1N6RA 4MR8A 2ZSIA 4MW9A 3TG8A 2D8AA 3LF1A 1ONSA 2FWIA 3QLVA 1VCOA 3OPYB 4AMBA 4G23A 4GI1A 3VPAA 3NJ8A 3CT4A 4PC2A 3D5EA 3PUJA 2VHTA 4M7OA 5KNDH 3JD4A 1BG6A 3BSSA 3OEEA 1M0WA 4P4UA 1IXKA 1LA2A 3K0EA 4WESA 4U6SA 3CIFA 4OGWA 4TKVB 4UHBA 2VSNA 4JJKA 1EX7A 2D2VA 2JNWA 3H7IA 4HSEA 3Q3EA 4KV9A 4TV9B 4FZRA 5HYVA 3DA8A 4NBUA 2JFYA 2EU8A 5DYWA 5E38A 3KOXA 1PQYA 4TLAA 1XAGA 4EHLA 1CULC 1TVCA 2A30A 2J3EA 3EXIA 2Y6VA 3DV0A 5G0SA 1MJHA 3ZWAA 3MERA 2HRCA 9MHTA 3HEMA 1DAGA 4U9HS 1Z26A 5DVZA 3R74A 2AMFA 2QZJA 4H16A 2PMEA 3RC9A 2A1UB 3AU9A 1LPSA 3RBAA 5BSGA 5HM6A 4NBTA 4BLTA 4CL2A 4PSUA 2DFDA 4PIPA 5CLIA 1U7OA 5A2GA 4D9NA 3IBSA 1RXCA 4OXXA 3NHAA 3UM9A 4JJFA 4B45A 4NCJA 1C3EA 2QENA 3OTIA 4KQHA 4GX2A 5K8VA 4PFJA 1E9RA 1MW9X 1P5RA 2B35A 1FTGA 2BWJA 3PFBA 4MJXA 5TVKA 4R40A 2HX1A 3GB9A 4BB9A 5CBPA 4MVJF 2XMCA 3LX8A 2EC5A 4D45A 1GU7A 1Z2CA 2WSLA 3JQBC 4X9XA 4HQOA 4GYYA 1JU9A 5BN3B 4IX1A 1N5RA 2ATVA 3U6KA 4PFKA 2VF5X 4V1CI 2VNKA 3NCHA 3T3HA 2R00A 3JQEA 2AG5A 2JFWA 5C51B 2EFDB 1M6YA 1Q57A 1RWOA 2GMWA 1I33A 3H5NA 3KL4A 4ID9A 4OK5A 3VHQA 3A6GA 1ISPA 3I52A 4OQLA 1FS5A 1QCCA 5JNTA 3KPJA 5FUWA 2IDJA 4MIEA 1CHDA 1PWEA 3GP3A 4HX5A 4INAA 5IEJA 3K8OE 1KQGA 2H1SA 3RS8A 4ZAXA 5BW6B 3PQ6A 2DFTA 1Q7CA 2ZRCA 3DP7A 3PTLA 1GNLA 3AU8A 1LX6A 1E4EA 4H08A 3TZBA 3BRQA 3ORHA 4DEYA 4EOGA 5I9IA 3FYUC 3SVLA 1EFRA 3C5HA 3EK2A 4LBWA 2BKLA 1U3GA 2B4AA 3U2QA 5K6TA 2PMBA 3OFSA 1E64A 2R8BA 1TW3A 5EJ9A 3K9WA 4U02A 3ZDQA 3PHHA 3Q9UA 2FH5B 2FJPA 2FRXA 2VDWB 4ATNA 3H9QA 1ZLYA 4MW4A 2IXTA 1Y6RA 2HMUA 2WVAA 2X2OA 3OCWA 4YV2A 4TROA 3SMVA 3I01M 1TYEB 2R1VA 2HRBA 3D02A 3OPYI 3O4GA 4WN9A 2FWAA 1I4DD 4ZAVA 4XASA 4D8XA 1Q0QA 1KSJA 1TQ6A 4B32A 1ZM4A 1KHTA 3KFVA 4X90A 1RIIA 5E8RA 2B99A 1PGOA 3L4EA 3QE4A 3U13A 3KALA 4E1VA 5JCOC 3BD9A 2ZTVA 5TPZD 1W46A 1Y8RB 1SVWA 3BL5A 3LDAA 4QDXA 1NV8A 3UV6A 4DRXA 2FHPA 3OICA 5JMPA 4B0OA 2W98A 4BU1A 5G3ZA 3R0ZA 3QZUA 4ND7A 4RPGA 1U0NA 4UNRA 1YRQA 3LCCA 1HLGA 2PTGA 4OL0A 4AZVA 2PPLA 1Z5ZA 5DW3A 1KYWA 1VDZA 5KVSA 4RF4A 3HRHA 5EQJB 4V0SA 3RU2A 2IEAA 4WN3A 5DCLA 4WXYB 2O7NA 4TMFA 1OFTA 4HLDA 1CEXA 3RYHA 3SKXA 2ZJ8A 3KLBA 3RAEC 4TGLA 5J59A 5JSFA 5CPBA 3CRQA 1UBLS 4KR2A 2WAXA 4M1KA 1DBIA 2BF7A 2GNPA 1G60A 1KOJA 1O94A 2B4RO 1VBMA 2GYWA 4S2EA 2RH9B 2W6NA 2PRKA 3HJNA 4KFRA 2FPIA 4DM7A 4WZAE 4PANA 1CZNA 1M66A 4JIGA 3PFCA 2IY8A 1LJLA 3N74A 1C9JA 2X9GA 2CLKB 3LVFO 3I2JA 4D57A 3QG5A 5T8KA 3UV3A 4H3SA 4C29A 4TZ0A 1E4EB 1PQPA 2R62A 3E4DA 4G65A 5LQDA 2H2IA 1WW3A 2PGOA 2DRIA 4JIMA 3G0BA 3OE5A 1PL8A 2ZSHA 1XTVA 2JBWA 5TDHA 3ULKA 1OWPA 4ZVLA 2A4MA 1WW2A 3GJ6A 2PUAA 3T9AA 2VSOA 2HYDA 2D0OB 3LLVA 4U6QA 4HAXA 4JI8B 1AX9A 3O8BA 1JDBB 2HMSA 3OJWA 4GX0A 5ESDA 3OM8A 4LXIA 3IEPA 2HRZA 3PGVA 4Q3CA 1N2JA 1DE0A 3O31A 5AJWA 2ZSAA 4TLMB 4KWEA 2XUAA 3F71A 5ILOA 1ULBA 3ISJA 5CHEA 3GCZA 1NVEA 3QJGA 5ICEA 3B51X 2EDCA 3ZY5A 2B94A 3AFIA 2ZTLA 3H0VB 3CLTD 2IYFA 1GRCA 2DPLA 2O7VA 2XT6A 1OWLA 2H31A 4BMXA 2O8VA 1E6CA 4WXPA 4RCZA 2OA0A 3DZKA 4EJSC 4BV3A 4IV8A 1IQ0A 1K97A 5GINE 4ZJPA 1KKLA 2O2IA 2X3UA 4DVGA 2H2AA 4CW7A 2Q0QA 3IE0A 4LEIA 4UBMA 1KS2A 4CM4B 5FOTA 5KAPA 1E2EA 2VK1A 4POOA 1MTZA 4GFDA 5DMXA 1KSHA 1PR0A 3QOWA 4JLAA 4OB8A 2C2BA 2ORVA 1GXSA 1TAQA 3FZYA 3G0GA 4FHEA 1OLXA 3TX6A 4D26A 1QGOA 3U4MA 3T5MA 2BL4A 5BNZA 1S0UA 1AGPA 3U4DA 3IR6A 3DFUA 4WK4B 3FOZA 4AZ3B 2D1QA 4ADSG 2ZSBA 5IM4F 4ENWA 3H1AA 4CHGA 3WYFA 1UC4B 2VAPA 3YASA 2DWCA 3ZX5A 2YXPX 1MB4A 2QXYA 1Q3HA 3W7BA 2ZG6A 4FONA 4ETMA 4MV6A 3ZWDA 2WAOA 2IHNA 1JEQA 3PD7A 4A4DA 1XPRA 1IG3A 4MHOA 1E9AA 1R8JA 4J0KA 2HSWA 3ZCUA 1YQEA 3G7NA 3L0YA 2FPPA 3ZS8A 3LBIA 3KV3O 3E61A 3KV1A 2D5IA 2VJKA 5GJWC 1ECLA 4WKCA 1WUKS 1ISJA 4KXNA 5AVSA 2WJ3A 4M46A 4EGCB 3QRWA 4JBYA 4JC0A 2F64A 4B31A 2DSTA 2HNKA 1BFDA 4P08A 2J7PA 3TXAA 2KX7A 4JJ4A 3CUVA 5C3MA 2JIZD 2JJ2A 2WFAA 4KO2S 4YIHA 3A06A 5CU7A 1OAOC 1B3RA 2HCBA 3VZCA 4KQWA 1W581 1KAQA 3ML1A 4MB0A 4OFBA 4MGHA 3V55A 4C2AA 4GVXA 5SYNA 4C3OB 1HT1E 5FWDA 5A2QA 4WA7A 4PYOA 3QXHA 5CB4F 1FDIA 1U9JA 2NLOA 4WBNB 4JL5A 4Q9JA 1GAQA 3D6HA 2IYZA 1C7JA 5EMMA 3N8KA 4LIPD 821PA 3GJ5A 3LGXA 2CMFA 2BGGA 5JFGA 2OBBA 1GUYA 2PSDA 1NOJA 4DWWA 2C1XA 3HCNA 3P27A 2I6SA 1Q83A 2CJPA 1CDOA 2RAFA 4L7VA 3Q8XB 1KORA 2RIPA 3DE5X 4ZI2A 1TTQB 4WKNA 1T25A 2A0KA 3FPSA 4ZC8A 4DNXA 1I79B 1UOOA 1J8MF 1U3FA 5KNLA 4CLEA 1W47A 2RI6A 1P75A 1NUAA 5E4JA 3SF8A 4BXOB 2GJ4A 4XPIA 4WESB 4R9NA 1T10A 3EXG2 2BI8A 2ZSJA 1G16A 1T8YA 1SHJA 4E6EA 5BV7A 4JQCA 4X8LA 4YGYA 4B7UA 2RGEA 1MW8X 3LP5A 1A5TA 4J1QA 1NNEA 1XLUA 4UHFA 2OG2A 3DAYA 3G5UA 5JO9A 4PZUA 4KDCA 4JWKA 3T7JA 1YL6A 1M2VB 1ULHA 2Y68A 3C7KA 3KFXA 3AJAA 1YZYA 2OBXA 1MT0A 2OD7A 1DEOA 3OE4A 4R3NA 1YRBA 1GSOA 1E5LA 2EOAA 2FUEA 4A82A 1VMDA 4B9EA 4EA8A 5ALZA 3AVWA 9ABPA 1N1DA 4BO1A 4N0MA 2PZFA 3EXFA 3GFTA 3NRCA 2HMAA 4FTWA 5TVGA 1E3LA 4AP9A 2F48A 2ZS8A 1CPYA 3MB8A 4YJ3B 4HAVA 1GNRA 1PJ8A 2ZITA 2AQHA 4P81A 5AW8A 3HYLA 5LP1A 1BCSA 2YL2A 2C5AA 3VPFA 1N0HA 3JVDA 2DKFA 4Q3AA 1DAFA 2PH1A 3CW2A 4JUAA 1TK3A 1U3DA 3LDUA 2ST1A 3F2IA 5IASA 4MK4A 1G18A 4G5QA 1WUHS 4UHHA 2X22A 4JR2A 5JVDF 3GLFA 4BAZA 1WDLA 2IEDA 4OHWA 3BSFA 2GHTA 3FOCA 5JAZA 4LPSA 3ZQJA 3WC4A 1XZMA 1R16A 1F06A 3ED5A 1L1FA 5MDHA 3AR3A 1LSOA 2HWKA 5HPYB 1FP4A 1VHTA 1H85A 3C5EA 2YVUA 1A7KA 2QUZA 3W7VA 1PUIA 4FMDF 3ORRA 5EKSA 1VMKA 4ZA2A 2Q9CA 2OHFA 4ZIRA 1T6YA 1Z15A 2RGYA 1MOPA 6ABPA 3OWHA 5G4LA 1AKNA 4DLZA 3T7EA 3PWTA 3D3WB 4QFCA 2V7VA 2ZRGA 3RFTA 4A03A 1C7RA 4EHAA 5BNWA 3THXA 3TRJA 2C3MA 1IIBA 4MV0A 5GONF 3USZA 1Z25A 2VWQA 3VU9B 3Q3VA 3Q3IA 1C1XA 3KWFA 3N0TA 4QPPA 5HQJA 3NHYA 1A4UA 1PWZA 4H0FA 4I19A 4M7PA 3EEYA 2Z09A 4RV4A 5IF9A 2CD7A 2LXNA 1QQ6A 2P0YA 4FDTA 4R81A 5EJFA 2CFOA 4YT5A 1QG6A 1WX1A 2Q5LA 3LYLA 1EQAA 4QUKA 4M88A 2QVGA 2B0JA 1NF9A 2C0CA 1F4VA 1WM1A 2VUHB 4OEHA 1T3LA 1Y6JA 5EZYA 3FETA 2O8BB 3RQSA 4E2ZA 2NXCA 3CLSC 3HB1A 4RK6A 4IX9A 2O8CB 1SBIA 3I01A 4XW2A 2FYTA 2Z3VA 1Y8CA 1IBKB 2A7QA 3RLFA 5CA0F 2F1JA 4KQKA 5FULA 2RGRA 5KTNA 1QLHA 4AC9A 3AIMA 1BWPA 4U7TB 3BFVA 5GJVC 4IUCS 1M67A 3B5IA 3EFOA 3Q6NA 4HJRA 1DJQA 1GV0A 1P2FA 1EP9A 1TMKA 4MUIA 3D4PA 3P2EA 3TIXB 4F45A 3ZHSA 3N2IA 1W93A 1RI1A 3LPMA 1MQ9A 1FLAA 3OMXA 4F0JA 3V4RA 1NZFA 1SQ6A 1K63A 2ZS9A 1M72A 1G8SA 2QLTA 4JQYA 5GWXA 4QLBA 1FSPA 3M1YA 2O5VA 2E2WA 1DBSA 3KS9A 2DEUA 5LIPA 3R0VA 4BAGA 4TTAA 4E2WA 4CIYA 1X77A 4DB2A 2AMVA 4FWTA 2C7BA 2RHDA 4N8DA 2BGTA 1NWHA 1LQ2A 2BUCA 1QOZA 2O4CA 1BHQ1 2H1CA 3CX6A 1K5HA 3BL8A 3GLQA 2VJDA 2F3TA 3KYCA 4GUAA 1NYQA 1SKYE 1P2BA 1WCWA 1YTLA 1GQRA 3Q88A 4KC0A 4L4UA 4Q66C 1C3VA 5TSDA 4KAXA 3RC7A 4X3PA 4H1UA 4TMVA 3WWYA 3VR5D 1QVRA 2G80A 3LBYA 2B4TO 3L8GA 2UYHA 3V6LA 1D2HA 4GRDA 5JXWA 2JJ2D 4RM3A 3HBNA 3I8OA 4TMTA 4PCAA 4PPQA 4AQDA 3VJMA 4WXHA 2ENUA 3PGXA 2FJ0A 3IR5A 4M4SA 3CZPA 5FEUA 1SKAA 1U4NA 1XCBA 3HZZA 5DNUA 1DAMA 1U65A 5BSEA 2H2FA 1A8HA 1XNGA 1Z33A 3GOQA 4I9UA 1U3WA 5KAMA 1MJFA 1NVFA 1EVJA 1KJNA 3FYSA 3BHJA 2JZNA 5DRYA 2GQ0A 3IKVA 3CN7A 3VR5H 4JP1A 4PYJA 2FLVA 2NTNA 2ODBA 2A6PA 5JCJA 4ZEOA 1JF8A 1P7CA 4WI1A 4AFNA 3ZKAA 4HGRA 3AI7A 2VWGA 3RTAA 3S6JA 1ZJWA 1N2CE 2FF5A 3ZHVA 4UM8B 5A0FA 2Q5HA 1PG0A 4ERXA 4UUNA 5HZGA 2UV8A 1MR3F 2FR0A 2HXYA 4JLVA 4MLDA 4S1TA 5D51S 1SELA 1GKYA 5D84A 4EG5A 1XAJA 5F9MA 5BSMA 2DPGA 1DKPA 4D81A 1EE1A 3BFKA 3VYUB 3TFOA 3RAFC 3A10A 1FTNA 2NU8B 3L9XA 4GLBA 3B3GA 1P9RA 4EF6A 1OYOA 5G0WA 4DIEA 3PJFA 3OCCA 3AR5A 2CWWA 1VBNA 3FPAA 2UDPA 2ZR0A 3W2GA 1FDOA 4AF7A 1D4ZA 1FNBA 3OCUA 2BEUA 1Z5UA 2GXUA 4BLPA 1JNXX 3WTBA 1PDWA 1YMUA 3UMSA 1FP6A 5BN1A 2XOEA 5EHZA 4EI2A 3ZGZA 1B8OA 4RD4A 3SYTA 4MAFA 1WQ1R 3LCUA 1G38A 3X1MA 4OP2A 3JZFA 3R5KA 1V96A 1YZFA 4RMHA 3VDXA 1ODLA 1N0IA 4CLDA 3TCKA 1UBHS 3HCOA 5LKRA 3EIHA 1IZYA 2X4LA 3VU1A 3CNQS 5JI3E 2B4YA 4YV1A 1QC5A 1FDRA 2PXCA 3KJIA 4YRTA 3IUBA 3UEOA 5DASA 5GM2A 1U28A 3KE8A 3CG4A 4E5MA 2Q3EA 1K8RA 1O7JA 2H92A 3AF3A 2Z8YA 4B74A 4WA8A 3UHFA 4CMAA 5IH3A 2UZIR 1AMOA 1ZU4A 1JH9A 3FLBA 3N58A 3M6FA 2JGMA 2VHVA 3B9BA 3I9FA 4OHKA 4X1IB 4JGIA 3PKIA 3UMVA 4AUMA 1JIXA 4PBRA 5CVVA 3TRKA 4Q4CA 4HG2A 2FZVA 3G9UA 1ORDA 3L7NA 1CG6A 3E22A 4BX3A 3OESA 1UDXA 2Y0PA 4MVCA 5DHAA 4W1QA 6ADHA 4JX8A 4MWZA 4UM7A 1E2LA 1KA9H 2IQIA 1K4MA 3WIDA 2QNRA 2QQEA 4ES6A 3QX9A 5IJWA 3IP8A 1N5DA 2V4ZA 4OFWA 1XJ0A 3DKIA 1T5IA 3H4IA 4GS5A 2CXHA 1EA7A 1UDAA 4ARIA 1IBRA 2X4DA 3AJDA 4GX1A 5EIHA 4D5EA 5LDDC 1SOVA 1F1BA 3LL7A 1T5DX 2C88A 2GO1A 1NE7A 3B3QA 1A97A 1NLFA 4RHEA 4ZREA 5FHRA 1MC1A 1XUOA 4OI1A 5EIFA 3QWFA 2ADOA 4Q4HA 5EI5A 2BBTA 3TM5A 3BUSA 3GGJA 2HU7A 2OQVA 2AQ8A 3USES 4CIXA 2CF5A 3MWJA 4NMLA 1DTWA 3FMFA 3NHPA 5EN4A 4IHJB 2VT2A 1F14A 1MC5A 1YBFA 3GZTB 1FRZA 3FWHA 1DARA 1GAWA 1GGVA 2R65A 2VP2A 3OA0A 5ER6A 2RGNA 3BF8A 4AKHA 2VJAA 4XE5A 2A9RA 2WE8A 2Q5FA 3D3NA 4P3KA 4Z9XA 3RBZA 2Q1UA 3RJMA 2VP3A 3ZWWA 1T1EA 1PT6A 1ZJYA 1LPPA 1KVSA 1SWWA 3MSCA 1JIIA 3UJ3X 1TAUA 1ZJ5A 4CKBB 1E5XA 2C84A 4MHSA 4YP1A 2E4ZA 3K8ZA 4AY4A 1GPAA 2X4GA 4EZBA 3NH6A 1VPTA 4P5EA 2J6HA 4ZU3A 4COOA 3UBTA 3H9BA 4RHUA 4WNAB 3CMCO 2BM0A 3PXXA 4FX2A 4PGFA 4TSFA 5AR1A 1KSFX 5FL7A 3ESBA 3SS8A 5COQA 3EFEA 3QE9Y 4QARA 1B6TA 2YR0A 1AGNA 3GLUA 3GFPA 1SY7A 1PEKE 5DM4A 5FKJA 5SICE 1GPBA 5C2JB 5KWSA 5YASA 4M3NA 2GUWA 1ZVKA 1UBEA 1YI8A 2Q0HA 2ZRDA 4JMPA 1OHHA 4PX3A 5T4EA 1NASA 1BSVA 2Z6VA 3IEIA 2N3ZA 4JJ6A 4CMEC 2ECFA 2WD7B 4JDUA 3MWDA 2D2XA 1CIJA 2GOYA 4XTCS 3GJ0A 1JSCA 3ZWCA 3I6ZA 3OF2A 1DWUA 1T5BA 2LDBA 2OV8A 3KLOA 4UUPA 3QPCA 1PYOA 3O74A 2VPPA 4D8VA 4AICA 3OLXA 5IJZA 5BSUA 1HL3A 3GRPA 3JSXA 3TMYA 4FUQA 4D3YA 4QOHA 1F0NA 5AI6A 5E6SB 3KUCA 3N76A 2X5OA 2H08A 4AG3A 4INJA 3RVBA 4E4YA 2B25A 2GXSA 1NHGA 4KUEA 4XKJA 3ZCTA 3R8FA 1EX6A 2IX9A 4NBWA 5HKKD 2OKGA 1YR1A 1M2JA 2UVPB 3G82C 2WHXA 1EB8A 2XZTA 3PVCA 2TYSB 4PHHA 2XCTB 3HSKA 4AECA 1JFLA 2GKGA 4KXFB 4TL6A 1XZQA 3OUZA 1DC8A 3OPVA 3HN7A 4LZLA 3WMEA 3KQPA 2IS6A 1M5TA 1PJLA 1IUNA 4N8SA 5CA0A 2JIPA 4LHSA 4KFTA 4RLFA 4EX6A 3K1TA 4Q3OA 3DBVO 2WTNA 3T1QA 2A3RA 2HLDA 1TFRA 4Q4AB 4XXHA 3L18A 3S1SA 3DW3X 3FGOA 4TYYA 4QFBA 2OY0A 4BGUA 5A7FA 1L5MA 1KMHA 1A98A 4WXEA 1BMFD 1OX6A 1GGKA 2NXEA 1R5JA 2PANA 2P9FA 3RSHA 4HZUB 3D2BA 5F3WB 3H9JA 1MAVA 4CTMA 2BKVA 2CDAA 3B38A 1G1MA 1YZUA 2J5QA 2CBZA 3HV2A 1L9KA 2YOHA 3DBRA 3QF4A 4IG4A 1V8BA 2WUVA 4TWRA 2XEXA 4Q9IA 4O4IB 1W5EA 4H60A 4LY9A 1BHO1 2Q28A 4FBMA 1DTSA 4DJ5X 3CQ9A 3OT5A 4J43A 3TLCA 2NTVA 1B42A 4DJJA 1L5LA 1MDFA 1I9GA 1V16A 2I7VA 4XJTA 3KK0A 4RFVA 3WOVA 1NMXA 1TE2A 2P9EA 2PS3A 2R6FA 3MYYA 4EUSA 3GNLA 2VT3A 2ZDHA 1PTJA 3B6MA 1L2TA 3OLQA 3S44A 1KZYC 1T6BY 3WB0A 2JANA 1GG9A 2O0HA 4FZ5A 4TLEA 5L3ZA 3AM1A 1XA4A 3LXMA 3QG1A 2CHQA 2VZLA 4C5BA 5C34B 1EJ0A 1Z8FA 2PRYA 1OZFA 1I4OA 5E2AA 2DZDA 1QDUA 4ARZB 3E9NA 2OGUA 2JFXA 1AK2A 3DZDA 3NHLA 5GPBA 3ZWYA 2DF8A 4OYLA 2RBKA 4R8KA 4DBLC 2YN2A 5EVJA 3ZEIA 2Q3CA 5F23A 2C57A 2P4HX 4LC1A 5KVAA 1CYEA 2ZRAA 4LISA 1HFKA 1HT2E 1XZKA 2Q5IA 3CH5A 3CNNA 3IQFA 3NHUA 3WNDA 4D44A 1EESA 3LC2O 2I6GA 1DJOA 2ETVA 4YNBA 2QI9F 3WLRA 4MEAA 2OR3A 1BGXT 2ZAOA 4OI2A 4PHFA 4NOKA 4FMDB 4LNUB 4P82A 2OXTA 1ESNA 1SRQA 2FB9A 4LVNA 1FDVA 3UKJA 2BGUA 5D7NA 4AZ0A 4TZ6A 1GZUA 1D09A 1SEVA 4EHKA 5KQRA 3BTSA 3EP5B 1E0KA 3BHIA 3NTXA 4ZVOA 5TEWA 5JFOA 4JC8A 3KNZA 4H6VA 1NM5A 5HX7A 1X0VA 1HE8B 4ZTBA 3HKCB 4ZV7A 1EVLA 3C3BA 5MN4A 1NA5A 5HFNA 3LUFA 3EUAA 3QBEA 5HOEA 1GTL1 1YI0A 3OHPA 1M3SA 2XTMA 4PBSA 2DHEA 2H4XA 4GR9A 4B40A 3REQB 4KMOA 1I7CB 4KSYA 3A6KA 5IEBA 3UN1A 4RIEA 5CD1A 1VLJA 4I1IA 1BJRE 4MARA 4BNKA 3IMEA 2WSSA 4CDRA 3VUFA 4CKCB 1KAEA 2BPOA 1CR4A 1OTYA 1LH0A 1R3UA 4KX5A 4NPCA 4MEJA 3AM3A 3L7BA 5ALGA 1FP1D 4RVNA 2Q4EA 4F4IA 4N3BA 1ABBA 1TTTA 1V7PC 1XDUA 2WT9A 1GQ2A 1G21A 1E63A 1OWNA 3LRPA 4JXJA 4XSVA 3C4QA 3IIMA 3QI2A 4JQOA 3ZE6A 1XCGB 5LD2B 3STVA 1KJQA 3TW8B 1CY8A 3A1VA 5EHGA 1T2UA 3HS3A 3VR2A 3L0CA 1LVHA 2DFVA 3P2IA 3F96A 3NT2A 3PITA 4LI3X 2LWIA 4QASA 3BBPA 4D9HA 4U5XA 5LU8A 3COZA 4WOKA 1G55A 5IT4A 4YR7A 2CY0A 2PRIA 1G9SA 2WIBA 2PVCA 4D74A 4E21A 5E3JA 5KSOA 1KC1A 3K73O 2GF9A 2P77A 4NDAA 2POCA 4GSYA 1UPAA 5DGIA 3WLLA 3LT2A 4X8HA 4CMIB 5ILGA 4GE0A 3RYFA 5JDIC 5LNK1 2WQ7A 2BW0A 1LV8A 3IKTA 1XPJA 1ZOOA 4GP6A 4L73A 3RK1A 1PIWA 2E6KA 2BRUC 2WWWA 3ZJXA 1ZSYA 3IP9A 4FD2A 4LE2A 5IF3A 2HUPA 2PPVA 5TT1A 4BMVA 3IEXA 5KOYA 1U9CA 2EP8A 1K2VN 4QREA 2B92A 3UCEA 3LYAA 2CUNA 4HXYA 1CCWA 3DH0A 5BVHB 1SVLA 3GFGA 2XUDA 3SIXA 4N3NA 5CM2Z 3AHEA 3G8BA 5FD8A 5BURA 5MN6A 1QHYA 3HJGA 3DOIA 4KNVA 3TTXA 3FWNA 3DYIA 4IDOA 3RNLA 4U0KA 1MV5A 4ALJA 3A27A 1TO1E 2H5EA 1C3LA 3CBGA 4IG9A 3I5YA 3R9KA 3ZVRA 3L82B 1HXHA 1KO7A 3DOOA 2M1XA 2ORYA 1A2QA 4HAZA 3QBDA 3ZXUB 2HV9A 3IQZA 3PI6A 3DOHA 4YT4A 1P61B 2F9FA 8ABPA 4QHSA 4W82A 4EI8A 1F7VA 4IKEA 2ZR7A 5ER9A 3WLJA 2V6MA 3ZNQA 1S3SA 4PPYA 4G3XA 1Q95A 4KBGA 5BQ5A 3RBVA 3CVWA 1DKLA 1PUJA 1SXJB 3EMVA 4HFRA 3SZUA 4G01B 2HT1A 1A2OA 5GM1A 4UE3S 1J21A 2CVHA 2X15A 4B6GA 3V80A 2IHTA 2OMKA 4YV7A 2AX4A 4MQ6A 2XCUA 4NP6A 1A9RA 4KQ6A 4F9TA 5JNLA 5TMEA 2KI5A 4QKQA 1HDOA 4E3WA 5BV8A 2M6SA 2JLXA 1OZHA 2AFIB 1F0PA 1X2BA 3KQTA 3L8YA 3O26A 1SURA 2ZR9A 2V7UA 4JUCA 4KEAA 4GC9A 4OY3A 3SQOA 4BCDA 3R77A 1CVIA 4ZT7A 2PFSA 5BNIA 3MJFA 3KQOA 4GPZA 2H8KA 2C4TA 1GN8A 1T1GA 4XD2A 4D46A 4XEHA 3E8MA 3SKYA 1REQA 4C0QC 1L4HA 1M2WA 2AS0A 4FYJA 1RAHA 1P7WA 5AOVA 4J3FA 3T7IA 1RMTA 1IOZA 1Y4SA 1YCGA 5AHKA 4MWSA 4OJTA 5CCBA 3IUJA 1HQYE 3P8ZA 4HMOA 4L6AA 1CK4A 2ZXEA 4I66A 3T4XA 6AT1A 3RVRA 3LUPA 2AXEA 3OCVA 1N6NA 4Q01A 3WFIA 4ESOA 4R0MA 2DLNA 4ZZ2A 4KR0A 4AD8A 2ZBVA 1X7XB 3WYCA 1THMA 1NX6A 1Z6XA 2QL5A 2WUDA 4NH0A 5DMHA 1GZ3A 1PJTA 3B2QA 4I3FA 4Z9AA 2XNCA 5LBTA 4DW8A 4ENTA 3HM9A 1X1QA 4P32A 2QN7A 4C2TA 5CYFA 2BHRA 3REFA 3ROQA 3SNKA 2R8EA 4DA0A 4EJ6A 4AX8A 4TKVA 3OZAA 1QFJA 5IH7A 2ZSUA 1OTHA 4OMFG 1B1CA 3QNUA 3H4TA 5FOXA 1ZUHA 2YW2A 3IDSA 1Z74A 1HKUA 1U9ZA 2NO5A 3K94A 2JCBA 1XYYA 4TZKA 2ZT8A 3HRIA 3IJEB 1ODSA 2NWQA 4ZOEA 3KLPX 2XV1A 1DCTA 1W88A 3UJCA 3U5TA 3NS7A 4Y2GA 4QXPA 3O75A 1L5GB 1OXTA 1KVQA 5CFNA 3ST7A 2VT7A 3WNBA 4PSVA 2WG2A 4ACAA 2G7MC 5AW7A 5B5SA 4QHYA 5HE9A 4LZOA 2NSYA 5J2TB 1QZZA 1CUXA 4ZVUA 5K3BA 5CB6A 4PZYA 1XTQA 3CINA 4O4HA 1KQ3A 1X7ZB 2BFFA 2VPQA 4PXAA 4PZZA 4YHBA 5JNWA 2D3TA 1A7AA 3BXXA 4HPXB 1UFKA 4NMHA 4E03A 4YQFA 1I7BB 1M76A 3JAKA 3CURA 1II8A 1GZ4A 3EBOA 2BFEB 5IAJA 3DAFA 3D4IA 4AMVA 2P79A 4FJ0A 2JH3A 3LTEA 1KYYA 3NDJA 2H9AA 4GWGA 1J0EA 1UKYA 4JUFA 1AVTA 5B1EA 1M6HA 4RZHA 3RHFA 3HB0A 3LOQA 1HLDA 4G4SO 3ZR4B 2Z08A 3MUNA 1V5FA 5TPWA 1ZVMA 3DHVA 2Z57A 2F1RA 2AN3A 1ST3A 5REQA 3DLHA 1CWUA 2V5VA 5D1NA 4LZWA 1E0AA 2DGDA 2NUTA 4BATA 4GAEA 4EO7A 2Z5GA 5JXJA 4YROA 4UHEA 4CN8A 4DQLA 4P35A 1AQLA 5C4MA 1GADO 3D7LA 3MOGA 3RK4A 2PBZA 4HKTA 2PL5A 4O0MA 1IEQA 1H0HA 5FQOA 1R9JA 1ZH2A 3DHNA 4D96A 2Y99A 3LCMA 4UZSA 3SC4A 1WCIB 3ZDBA 1SZJG 1ID8A 2OCPA 3QGMA 3ENZA 1GU1A 1UKEA 3BJRA 3EZ2A 4LYAA 4XWTA 2W2LA 5ARDA 1RBZA 2B4QA 5HQTA 2JRLA 2R1UA 1TB4A 1T3GA 1C50A 3JU3A 3MCAA 1V4VA 2GLUA 2X6RA 2ONKA 3GLVA 4GOOD 4UEOA 4G0XA 4UDOA 4RDXA 4IP0A 1N8TA 1QGAA 1V5IA 2BD0A 2I1WA 4DG9A 1OZGA 1QWSA 5EIBD 3GT0A 3JCZA 5JCXA 5G1PA 3UH1A 1UBSB 2J9FB 3WJ2A 2VQ3A 3KZCA 2RHRA 4L8YA 1C5KA 1JBQA 2B30A 1RKXA 3OIDA 4BJHB 2C8LA 3KCNA 2BN4A 3SEQA 1QYWA 2IYQA 2ZCVA 1TI7A 2ZAIA 2ZU0C 2ASEA 3E2MA 3I6YA 1XP8A 2I9PA 3W2IA 4BTLA 1VKNA 1BKYA 3ANSA 4JU8A 3U3JA 2O0LA 3M4JA 3EAFA 1RC0A 5LA6F 1GVNB 1NONA 1VTKA 2HU5A 2GCEA 4JSYA 2Z5FA 3QU2A 1A9OA 3HLTA 1Y1TA 1Z4MA 3N39C 3TLKA 2B9VA 1D3AA 2AMJA 1RI3A 2YFQA 1TUIA 5TQ2B 3L7AA 3I6MA 5F1OA 1NOIA 2FP3A 2FPXA 3DM5A 4M0KA 3UHAA 5IJ0A 2GASA 2NADA 1DIAA 3JQCA 1FMFA 2YHUA 4YVFA 2HF2A 3B6KA 4F7DA 1MKYA 2A94A 2ZULA 4F8EA 3P2KA 4EBFA 2JL1A 4PXYA 1USWA 5ECYA 1D8TA 3O83A 4AJIA 3PS9A 1IHYA 1NUHA 3KR2A 4CMEA 1I3LA 1U0BB 1G3MA 5DYNA 5EWJA 4ARAA 4G25A 3ZCRA 5JCZA 2ACWA 4JLBA 4NIMA 2QGZA 4DV3B 5B1HA 1YE8A 3E5HA 3PUIA 1GOTA 3WRYA 3S2SA 2C98A 3EVAA 1Z4IA 4CQMD 1A96A 4Q1AA 1RZ3A 4ITVA 4EITA 2PKQP 1QHHA 2BMJA 2Q6LA 5DWVA 1ZGJA 1I0ZA 1MAUA 4K3UA 4AO7A 4C0BA 3WO0A 2FWJA 4O8CA 4RL6A 2OOKA 1V47A 2OZLA 3PQ5A 4GBJA 1DWOA 1JYFA 4K88A 4PN7A 1XDDA 3DOJA 5DULA 3QWHA 4R9UC 3FHOA 1OB2A 3QE3A 4DSZA 1ODKA 3OKFA 1CUYA 1L1QA 3ITDA 3WLOA 2FN9A 5ALYA 5KWJA 2MSEB 3LXXA 4AJ2A 3A1EA 1JJ7A 2YYZA 3NWPA 3MAJA 4Y2RA 1J2RA 3WHLA 1ZNXA 1JFRA 1DG3A 1QF7A 1L5RA 1E79A 1IK4A 4ZXPA 1ES9A 3VHXA 3AM5A 5FA6A 3U31A 1Y0BA 4C6TB 3U9TA 1V48A 4PM4A 4PZDA 5IJ0B 2JFQA 1V6SA 5EIOA 2D62A 4YJGB 1K7FB 4KE8A 2RHBA 2WE7A 4LJKA 1D1SA 4QTYA 1FSFA 5JBIA 2HZ7A 1VLVA 5M29A 1NQTA 1B93A 1LRLA 1XVUA 3G23A 3W5SA 5FO0A 1KP2A 2OG1A 4RY8A 4U2CA 3EXHB 1WXXA 3PXCX 4QGAA 3O0TA 3COJA 4JBLA 2HBRA 2ZQYA 5AP9A 5TC4A 3DVLA 1ZWLA 1R66A 2YZKA 2ZPUA 3I1FA 4IFEA 1X8KA 4GMHA 2G5PA 2J0EA 3G8AA 5AJYA 4BBZA 3IKLA 4MUHA 2O8BA 2W42A 4Y2SA 4L0CA 1KPGA 1QLWA 1KVRA 4E2YA 4MVJE 1OYWA 5F7XA 1MZPA 3G0DA 4ZRMA 5CLFA 2W5UA 4KN5A 2XDAA 3O8RA 1W48A 2Q6IA 3ZGLA 2WQ6A 1U7DA 2C2HA 2A9FA 3UWKA 2QVBA 3QEMA 4KDFA 3NPMA 4HX9A 1R8SA 4JZYA 1XTKA 3DMNA 1HDZA 2P4EA 1C1XB 4MKFA 3HVKA 4JJ7A 4PLYA 1C7EA 3O3CA 3DTVB 3UK2A 4D9EA 2ZB8A 4DYDA 1XNQB 3ZHRA 4DV2B 4BUJA 1AHNA 2X9VA 1SBYA 1BGVA 3GVIA 4OP1A 1BS9A 3EVZA 5EXSA 5AVZA 1KH1A 2VCYA 4OGFA 1EWQA 4CT4B 1CUJA 3NKFA 4GMDA 3PUXA 1JENB 2BBSA 4TQUS 2R1TA 1DCKA 5L40A 4DQXA 1NW3A 5I7AA 5TF0A 4YDHB 3MD9A 1T13A 1X7YB 3VR4H 5HUHA 3ZCPA 5TLSA 4B3TB 3T3NA 4EPVA 4KO8A 3K4QA 4M8SA 4HGQA 4P0PB 3EGOA 1SUFA 1EBUA 1T9BA 2NXNA 2FWNA 5C8VA 4Z6KA 5FADA 2RHWA 1TCVA 4IF6A 4LGYA 5C5EA 3ENQA 4YXWD 3JVEA 1BD3A 2G0NA 2ERYA 2NO9A 3FTNA 3GUUA 5FYQA 3AQ4A 5TQ2A 3W5HA 1ZFNA 4F2DA 5L6LB 4D7AA 1NNLA 3A1UA 5L4SA 4B5KA 1D6SA 2G63A 4NZOA 2QP9X 1HL7A 4L16A 4A1FA 4CCWA 1UDWA 2G9VA 3PQCA 4A92A 3OTQA 4NC9A 3P0HA 4CGYA 3QSYA 4DXHA 1CQIB 2XVAA 2OCKA 1C0LA 1CZRA 4PN3A 4OXQA 4IUYA 3IILA 4QE3A 4R3UC 1DXHA 2QMHA 4IMIB 4IJQA 4JP8A 2LTAA 1TRKA 3KGDA 5AHRA 4E5VA 3CCFA 3BWYA 4OHMA 3DEJA 4KQ2A 1V11A 4J0EA 1XU4A 3OG9A 3PHJA 1HDIA 1OXKB 1EFKA 3A2MA 3TJRA 1JSRA 2BIFA 2P11A 2YYYA 2DT5A 3N0VA 4HDRA 1IVSA 2QRGA 3IJ5A 3VPSA 3OQNA 5EQTA 3EZNA 3SQDA 4TRMA 1ECJA 2C92A 3TV1A 3RK0A 5T8KC 4K5QA 1E92A 2YMPA 3I58A 3CWZA 3IBGA 3LKVA 1CY2A 3Q15C 1G9XA 1G20A 1RZUA 1L1EA 1IN8A 1W8IA 4H7KA 4OV6B 4Z5XA 5JC8A 1GTRA 2DERA 4TTSA 2O2GA 1ZN7A 1Q16A 1EUDB 2XA2A 3FXAA 3PRJA 4Q3NA 4CODB 1X3LA 2R4UA 4DIFA 1NJ1A 2XAAA 5TQJA 1NFFA 1SG6A 4BU0A 1CJTC 4D4LA 3UWMA 3TCNA 4CKWB 1R7RA 2YWXA 3LFTA 1RXEA 2Z4TA 2D2FA 2C8VA 4LZPA 1JEEA 3QIAA 3STHA 3U4QB 1KDZA 3AY6A 2HM7A 2C97A 2J59A 3DPSA 5AW2A 4H31A 3TMKA 2NV6A 4XB6B 3PEEA 2ZR8A 4OQXA 3MLBA 3KB8A 5B58C 5CHYA 4WOJA 1MD9A 3D6VA 4JQSA 4M1MA 2Y1FA 4J29A 3SR4A 4FNGA 3UK0A 3WHKA 3ZY4A 4AS3A 5FORA 3IL2A 3GLFE 1HH4A 2AN4A 3EH2A 1IB6A 1VIVA 1R6VA 2C7PA 1VCMA 3BX1A 1LDMA 1US8A 2MWMA 3X1KA 2YY7A 2Q1TA 3DQZA 1MPXA 1C1HA 3TZQA 3C3YA 2QPAA 5A6VA 3VKGA 3DL4A 4Q3EA 4U7HA 3LOPA 5K3CA 3NJ4A 4KVZA 2DLDA 4LBVA 5SY9A 5KOHB 1AUPA 2MMGA 2OM6A 2X2PA 1G8HA 3A31A 4P4NA 4CL3A 2DKNA 3CR8A 2HMVA 2W90A 2OK8A 4ZYUA 3VMMA 1UM9A 3U7QA 1UK6A 5BWCA 1N8SA 1MJ5A<