3DO5A

Crystal structure of putative homoserine dehydrogenase (np_069768.1) from archaeoglobus fulgidus at 2.20 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
324
structure length
320
Chain Sequence
MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTREGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
publication title Crystal structure of Putative Homoserine Dehydrogenase (NP_069768.1) from ARCHAEOGLOBUS FULGIDUS at 2.20 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 96
structure length 320
sequence length 324
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3do5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3do5A01
2GN4A 4ND5A 1K0UA 1L7DA 3DAPA 1U8FO 3CSDA 3PGXA 4NBVA 4MVJI 3ITDA 4DBVO 3G1TA 5BNFA 3RFXA 1N7HA 5DBGA 3VTFA 4DREA 5K6AA 1CEQA 3HFSA 4E30A 4DUPA 3UUWA 3RUEA 3HDQA 2GN9A 3RASA 1LTHR 3ASVA 4WEQA 4E33A 5A9SB 4E2XA 4DL9A 1PS9A 5ER9A 2Y1DA 3BA1A 3L6DA 3NGLA 4S3MA 5IFLA 2Y68A 3KRTA 4OKNA 1DJNA 2ILTA 3GGOA 4WJZA 4WKGA 1GTMA 3AI3A 5L7TA 1PSDA 3AU8A 3IC5A 4PRLA 1HETA 3IUPA 3LF1A 2P4QA 3WJAA 3ZW8A 3AOEA 1UZNA 3C3XA 3GC6A 1NVMB 4CUZA 2DAPA 2X9NA 3K31A 4R9RA 2VT3A 1I2BA 1WMBA 1OI7A 3OFSA 1TB4A 3AW9A 3IJRA 4OXKA 2Q22A 5T67A 3NUGA 1CRWG 1Z45A 2Q2VA 4KUGA 4ZQEA 5IG2A 1C0PA 3PHLA 1JAXA 3QA9A 1QV7A 4MO2A 4OXNA 1DLIA 4Y8VA 1XKQA 2H6EA 3U4CA 3U49A 5EIOA 5KNLA 1QV6A 1Y5MA 5EN4A 1E92A 3I9KA 3G0OA 3I52A 5U9CA 3UOGA 3SJ7A 4KTTE 5JAQA 2O3QA 1H0KA 2GR9A 2O2SA 3E03A 2E49A 2NWQA 3HE3A 1Q0LA 1UDCA 4CMIB 3OJOA 4J7CA 4XB1A 1NFRA 2DBRA 1EUCA 3AUSA 4PLCA 5EJ2A 4FFMA 4XZ3A 4Z3KA 4EW6A 3O26A 2AQ8A 3ANLA 1PL8A 3NTOA 4IMRA 3Q9UA 3VZSA 4H3VA 3S2GA 1K3TA 1R0LA 4NFHA 4A10A 1LI4A 1R4MA 1NQOA 3AY7A 1TT7A 3MTGA 1NPDA 2JJYA 4TWRA 3X2FA 4JLWA 3D4PA 4BNMA 3HDYA 3JQ7B 4P4LA 2I76A 1HZZA 2WE8A 1D3AA 2UYYA 5EERA 4A7PA 4WCFC 5B4UA 4ZJUA 2RHRA 2AQIA 2B83A 4R5HA 3WR5A 4Z0HO 2EGHA 5ICSA 4CV3A 4O1MA 4HFRA 2PR2A 1EMDA 2NU7A 5IDQA 5JDIA 2ZK7A 4Y67A 1LC3A 4CV0A 4XYLA 1F06A 4GX0A 1RM4A 1GZ6A 2IYPA 4M89A 3UGKA 5TT1A 1HSOA 1KETA 1AHHA 3QQPA 4R3WA 2NTJA 4YEDA 4AJKA 1DSSG 1BTOA 1NPTO 1YBAA 4CR6A 1XYGA 1FK8A 5I8ZA 5TT0A 2UUOA 1O94A 5G0SA 4XYEA 1E3JA 2A35A 3D3WB 1MXHA 4BOYA 3LT2A 3PQFA 1SBYA 1VJTA 3MWDB 1C1XB 3V1TC 5JNLA 1SZJG 1SEVA 3JQFA 3KBOA 4BMVA 3DMTA 3GGPA 1PJTA 3C1TA 3TZCA 3NT2A 3I9OA 3L4SO 2DTDA 1JWAB 5GY7A 5L7YA 1TEHA 3PHGA 1VJ0A 5AYVA 4FFPA 1NWCA 4PG7A 1P1RA 2C5AA 1XA0A 3PK0A 1ZSNA 1DRVA 2O7QA 1BG6A 2ZTMA 5DCWA 3GH3A 3Q9NA 4RPHA 1I3MA 5ES3A 4BO7A 4HKTA 3QY9A 4Q3BA 2J3IA 5JYEA 2ZCVA 2WE7A 1DIGA 2J5RA 5JMWA 1O89A 1T1SA 3LF2A 4E31A 1I5RA 1PR9A 4Z9FA 3AK4A 4UVEA 3PWKA 2Y93A 1NQ5A 3P2OA 3VDQA 5BSHA 2C54A 4A0SA 4FQ8A 1JDJA 3PYMA 2ZB8A 1U2DA 3PYXA 2RHCA 3W8FA 1YS4A 3K6JA 3LT4A 3N58A 5IJZA 4L76A 1E7WA 5FI3A 4B4VA 3QWBA 4URFA 3D5TA 2EW8A 4M54A 1YRLA 4WUVA 3QWFA 1N9GA 1SB9A 3AM4A 5M6DA 4N54A 4L73A 5ER6A 5T8KC 2YYYA 4L75A 4FJ0A 4IDDA 4XR9A 2AEMA 2D3TA 4WCFB 3FR8A 3A4VA 1T2DA 2VWHA 3LU1A 4ALJA 3A14A 3PJFA 3MWEB 3RIHA 4Z6KA 4O0LA 4BNKA 3FN4A 2Y0CA 3P7MA 4M86A 3Q0EA 5LDHA 3ASUA 3F47A 1EFKA 3P2YA 2DUUA 4M1QA 3E5RA 4D43A 2X0JA 4WLEA 3KXDA 4BB5A 1WDMA 3ICPA 1XLTA 4IGEA 4O6VA 4HWKA 3TOXA 4EJMA 2NVBA 4XIJA 4GL4A 1LQUA 3PZBA 3K30A 3LT1A 2V6MA 4B7XA 3RUFA 5L7WA 2C5EA 1I36A 5DCUA 1OC2A 1V0JA 3VZQA 1VRWA 2X9VA 3EY4A 3WGOA 3T7CA 3T7EA 1LSOA 1LDYA 1C14A 1MGOA 3SX2A 3K5PA 2Q4EA 4OGWA 4U0KA 4K28A 3PP8A 1PIWA 1BXGB 4FIZA 4R01A 4RPLA 5EQDA 3RWBA 4BKQA 4YAIA 5LC1A 1H94A 4WCDA 4DXHA 5DP1A 2PH3A 2PK3A 1H5QA 2DTXA 2HQ1A 1OZAA 2NACA 1DDOA 3RROA 2OBYA 4L8VA 1T2EA 1Q0QA 2AQHA 3LLVA 4DMMA 4E2WA 3CXRA 4NNJA 2I99A 4TROA 3GAZA 3RUHA 2VYND 3RCBA 4GWKA 3WX0A 4RLSA 3OECA 4J9VA 1E3EA 4TQGA 2IODA 1LNQA 3AUTA 3PTZA 2PKRA 4BO3A 5K9ZA 4E5MA 1XWFA 2GASA 3ZCXA 4E5NA 1LDEA 3GFGA 2H5LA 1C0LA 4MVJF 1PJQA 1U1IA 4HUJA 1E0DA 5TQVA 4BO5A 3V2UA 2Q1SA 1KVUA 1Z7BA 4J49A 1DFGA 4DPMA 3I3OA 4BMNA 4MKZA 1ZBQA 4KDFA 1Y8QB 3WBBA 3DL2A 1I3NA 4GX2A 2YUTA 3DHEA 1ONOA 3F6YA 3VKUA 1DIBA 3MJTA 2I3AA 3UN1A 3PDJA 5TLSA 1IYZA 3TRIA 1UP7A 4WLFA 1B3RA 1JKJA 3UW3A 2FMUA 3WTCA 3JTMA 4GGPA 3PLNA 4N18A 4BQPA 3GVCA 4O59O 4RORA 4FB5A 1XELA 4ZRNA 4EEZA 5KIAA 3K96A 3ROQA 4YWJA 5KVQA 4E5KA 4RZHA 1YKFA 1PZGA 4BNHA 4GX5A 3HHPA 5F21A 2WD7A 1MUUA 4XWYA 4DYVA 1UXIA 4Y6SA 2CMDA 4TVOA 1J6UA 1HSZA 4B4UA 1N1GA 4JJFA 3BTOA 4ND4A 3STHA 3WFIA 3RC2A 3QW2A 4DBZA 5ENDA 4UULA 4PLYA 2F00A 5AOVA 3OQBA 2HMUA 2UUPA 3OIDA 4JP2A 1ENYA 1PS0A 4FOOA 1SNYA 4FBGA 4KMSA 3K92A 2P91A 4BKRA 2FP4A 1U7TA 4C4OA 4MP6A 1RM0A 4EJ0A 4DIBA 3VTZA 3KUXA 1A4UA 1YDEA 4BHTA 3FTNA 4AVYA 4N5LA 2EHDA 3WIDA 1MP0A 4LRSB 1D4FA 3OIFA 1VLLA 3GRKA 2X0NA 4MVJM 1PWZA 2PH5A 2I67A 8ADHA 2GN8A 1X15A 3M2PA 1Q7CA 1PGPA 3Q11A 3SXPA 3GVIA 1GL3A 1HYHA 4FSHA 3OH8A 2EJWA 1NNUA 2XXBA 2GLXA 4BO6A 4CMHA 2I3GA 1A27A 3MJSA 3I4CA 2IXBA 2EP7A 1ISFA 1EQUA 3JQ9C 4AICA 1ZIDA 3BMOB 3PPIA 3RBVA 2FSSA 1PS8A 4LSMA 3LC2O 1W8DA 1ZKMA 2HK8A 4TSKA 1DC6A 3GF4A 1I33A 1B8VA 3RBZA 3NJ8A 1VL6A 4LGVA 3VDRA 4OMUA 2JHFA 4J43A 1OBFO 2B0JA 4Q3DA 2NVUB 1BSVA 2DPGA 4NBUA 4E2YA 1U3WA 2CVQA 4PZEA 3RFTA 1P33A 5H83A 1GYPA 2CUKA 2GSDA 3ST7A 4HADA 1B2LA 2QQ5A 3S1LA 3GZ4A 3PJDA 1C0IA 4DA9A 5CEFA 1SOWA 4LRTB 5B4TA 4CLOA 4A5OA 5IZCA 2EEZA 1NWHA 3ZV4A 4LK3A 1LDBA 1Z74A 4CL3A 3PZRA 5JBIA 1HDCA 4XDZA 1JAYA 2C59A 3TDKA 3ROKA 5T73A 2XAAA 5KOIA 1FDSA 4I5FA 3O03A 5EMHA 4L9RA 3E8XA 2OUIA 5F1OA 1U3UA 4ONEA 4OO3A 4FN4A 3GT0A 4WLOA 3DBLA 3ICCA 4AJJA 1UZMA 1IZ9A 5CDTA 1VI2A 5THQA 3CKYA 4L74A 1NAIA 4CM8B 2D5CA 1RYEA 1JQBA 1PWXA 1ZFNA 5F3RA 2RBEA 4Q9NA 1E1LA 2NU9A 4TKMA 1Z7EA 3DO5A 1EVIA 4HFJA 4XQ9A 3ROPA 3CINA 5IAAA 1U3TA 1XEAA 1P1IA 5AQ1A 1SOVA 2OXIA 1Q0HA 3DXFA 5T57A 2YJZA 1GV1A 2PD4A 1ULUA 4HBGA 5JAZA 4R51A 1PZFA 2IZ0A 1IZ0A 3SVTA 4NBTA 1T25A 2Z1MA 4ALNA 5GZ1A 4DWVA 3H5NA 4G65A 1MC5A 4A03A 1F0YA 3WS7A 1AXGA 3IIEA 2BFAA 4JX8A 4IXWA 4JP3A 1GDHA 3U62A 4BV9A 1ZK0A 4TKLA 2IZZA 1DB3A 2J3HA 4IY1A 3PYLA 5JPIA 4PG4A 2EP5A 5G0WA 4MVJH 4DPLA 3F1KA 1IB6A 5BR7A 5KVVA 1VSUA 2NSDA 1DC3A 4UVIA 2X5OA 4ZQBA 1DIRA 5G4LA 1L1FA 1BVUA 3JQ7A 3WQSB 3G3EA 3UF0A 4YJFA 4E5YA 1QYCA 5G4KB 4HNHA 4FR5A 2E37A 2OO5A 3INTA 4HP8A 1BDBA 1M67A 1E7MA 2BI7A 4J1QA 4GSKA 2TMGA 3ANNA 4CMAA 4W9NA 4E3ZA 4YQZA 5U1PA 1AE1A 2C2XA 1JN0A 2Q1UA 4BO4A 6ADHA 1R6DA 2Y1GA 4CM3A 3RU9A 3E6AA 1Y81A 4G81A 4QTZA 3EMKA 3WB9A 5CDYA 5JDCA 2IEBA 3C7CB 5CDSA 3H3FA 3L6EA 4R3NA 3VC7A 3Q2IA 1FDUA 3H65A 3A1NA 4WGGA 3TZKA 4BKPA 3WDSA 1BXZA 3GPDG 4BNWA 3NTQA 4IPTA 4CQLB 1JKIA 3RUAA 4IDFA 5JAIA 1G0OA 1LRLA 4W7HA 1EVJA 2GN6A 1H6CA 2AA3A 1K89A 3U3XA 2Q45A 3VHRA 2BLLA 2X5JO 4HFNA 1UXJA 1Y8RB 2P9EA 3TZQA 3WICA 3KB6A 1YOVB 1PJLA 1WPQA 1WW8A 2DBZA 2VUUA 2FR8A 3ZZNA 3C8MA 3AUUA 4I9HA 3DZBA 2O48X 4RVHA 4M8SA 2CDCA 3A28A 4FFNA 2NM0A 2OP0A 5KWEA 1F8GA 2I9PA 2DBVO 5FEUA 1PZEA 3VPXA 1XG5A 3CUKA 2X8LA 5HS4A 2PZJA 1WDLA 5AVOA 1YJQA 3ZU2A 2GPTA 4Q3CA 3H2ZA 3BMQA 2WYWA 2Y0EA 2W90A 3ON5A 2JD1A 3DBHB 2YFQA 4Y98A 4PG8A 2O2YA 3IUSA 4CM5A 2W2LD 1KEUA 1E3WA 5CEJA 1QR6A 2O3TA 3UH1A 2AEJA 1DRWA 5IF3A 1E1KA 1E77A 2QW8A 1DBVO 4Z0TA 3JD3A 2HJRA 4K26A 3OM9A 3FNFA 3ZWAA 5DT9A 2UDPA 4GWGA 4NJMB 3ZDFA 1KC3A 2X6TA 1HE5A 1RM5A 5G0UA 3ZV5A 4WE3A 5EESA 3BXXA 5IN4A 4RLHA 3ZWNA 3COSA 3CMMA 3F3SA 4F6CA 3L6OO 2BGLA 2P4HX 4CLRA 4ZICA 1ARZA 3ROMA 1BW9B 1ZJZA 1VE9A 4WASA 1Y9AA 2QRKA 1S6YA 2ZTUA 4IJVA 1LQTA 5JCJD 4WLVA 4EDFA 4GI2A 4ZQHA 3DZIA 2RAFA 3ZI0A 3FBGA 4J9UE 1DAPA 3IAHA 4UAGA 2ZTVA 1Y9EA 4U8GA 3BMCB 3RSHA 2VRCD 1PEDA 1YQGA 2ZB3A 2Q99A 4JROA 2JFHA 1ZXLA 3RC9A 2DM6A 3IMFA 4R1TA 3QJ5A 1HDYA 2O3JA 4YJGB 1BXGA 2CDAA 3AUAA 2BELA 3B1JA 1GQYA 3IL2A 1DOHA 3MJ4A 3E9QA 3VH2A 3BTVA 4DQUA 2O3SA 4IS2A 4PLPA 2P9CA 3ZWCA 1SCUA 4BO0A 5KCZA 3O9ZA 3GDFA 4DC1A 3ZV3A 1U5AA 1GCUA 1HE2A 3GG9A 4H16A 4FFRA 4I08A 4BNTA 1PGNA 3HSKA 1DIAA 3R3SA 3D1LA 4CMBA 3I23A 2H63A 2RIRA 5T6BA 2ZATA 3I9NA 4C7KA 3KETA 2FPPA 3KEQA 1C1DA 2VOJA 3HB4X 1GQQA 3H9JA 5L45A 4JJGA 3OHSX 2RH8A 3DAFA 4FPXA 3K2EA 3WNQA 4IM7A 4FC6A 5KJ1A 4J91A 4EZBA 3RD5A 3JQ8B 4IDAA 1Q1NA 3FPLA 4XRGA 2E4AA 3NAQA 2VHZA 5H82A 5KTKA 4IQ0A 1FMCA 1ADFA 1Y8QA 3C85A 1NX6A 2O4CA 2VYNA 1JVSA 3OICA 2V6FA 2OL4A 1KVRA 2J8ZA 4AJ1A 3MOGA 2DC1A 1CETA 4XYBA 1HE4A 4YTEA 3ZU3A 1T1RA 3S2EA 5FF9A 1DHRA 3OA0A 2J6IA 4P4GA 2JFGA 4DLAA 5L9AA 1CQIA 3TF5A 2WMDA 5A5FA 2YDYA 1DAOA 4ALLA 2TMDA 2FZWA 2PV7A 2Z95A 3JYNA 4MJLA 3WGGA 1ADCA 2PLAA 5IDWA 2LDBA 2GCGA 2HU2A 1O6ZA 3WLEA 1E1MA 2Q2QA 1HZJA 2A92A 2B35A 2D4AA 3E18A 3VH1A 3WYEA 4J4HA 5L53A 2BMAA 4KOAA 3ZNOA 4CV2A 4CMEC 1VL0A 3BHMA 4E2ZA 3I1JA 5L51A 1GZ3A 4D0SA 2GERA 1J0XO 1LUAA 3LQFA 1GCOA 3GRPA 2Y66A 4Z0PA 4I5GA 4I1IA 1ISGA 1BWSA 3NGXA 4CLDA 3ZV6A 3VAZA 1V3TA 1DRUA 4FFOA 1MFPA 1ZK4A 2W2KA 3JQBC 2HKIA 3I9MA 2PZLA 1U4OA 3KYDB 3SLKA 3HG7A 2VYVD 1P3DA 3TL3A 4NBRA 4PLGA 2PNFA 3F5SA 1UDBA 2O50A 4BQRA 3NDIA 1R4NA 3VPFA 2QIOA 2VZ9A 1NVGA 3TQHA 4PVCA 4J90A 3KTDA 3UCEA 4TRNA 4BNFA 1X7GA 2HMSA 1CF2O 4RJTA 3W4KA 1KYQA 1U7HA 3PWSA 3C1OA 1DHTA 4XD2A 5FYDA 4DLLA 1UDAA 1PQPA 4ZD6A 5LDGA 3QVTA 2VHXA 4CM4B 1FDWA 1TVEA 4EJ6A 3JV7A 1GYQA 1QKIA 3D64A 3H8VA 3JYLA 3QIVA 3WGYA 4LMRA 3ZWMA 2G76A 1NYTA 1XQ1A 3ABIA 2PY6A 4MP3A 1GZ4A 4AJNA 2V65A 4YA6A 4L4XA 4AJPA 2ZB7A 1G1AA 2V7PA 5KKAA 2VWGA 4LVCA 3JD1A 3NTRA 3W8EA 4E32A 2FRDA 2P5YA 4GLOA 4IQGA 2P5UA 1ZK3A 3JQGA 3JYPA 2FHSA 4JNKA 1XDWA 4GLLA 2HAEA 3C7AA 2QYSA 1N2SA 4WEOA 1JTVA 4YJHA 1UP4A 4Z3DA 1KC1A 3EK2A 3ZGYA 5COAA 4CMJA 3JQ6A 5DN9A 3SLGA 4QQRA 4KTVE 5CPBA 4DIFA 3WJ7A 4RZIA 1Y5RA 3WFJA 2BD0A 2EJVA 2ZJ1A 1HF3A 3TL2A 1NTOA 1T24A 3R3JA 1E7YA 3UVEA 4CR7A 3D5QA 5L4SA 3DZHA 4R41A 4J1NA 3RJ5A 1VPDA 4NIMA 1N7GA 2Y05A 1E3IA 1UJMA 1HDOA 1UAYA 4GPD1 2E82A 1SEPA 2ZYGA 4JBIA 4RPJA 1MG5A 2JHGA 2NADA 3SJUA 3KYCA 2FZEA 5K6AC 2QZZA 1DXYA 1KEVA 3DQPA 3IJPA 2OMEA 1TT5B 3QRWA 4CM8A 3CZMA 3AOGA 1NASA 4FFLA 4U6QA 1WWKA 2SCUA 3S8MA 3AFMA 5HA5A 1Z75A 1UUFA 4YRDA 2I66A 1KVSA 1DC4A 3QSGA 1M2WA 4BS9A 4CODB 1UP6A 1QYXA 3BHIA 3ZNQA 3HDHA 1ML3A 3IKVA 5C3MA 3PHJA 4FDAA 3AOEC 5KJ6A 3DONA 4OOEA 4FW8A 5DP2A 1G6KA 1LDNA 3WYBA 3OP4A 4EGFA 1PL6A 4PZDA 1A71A 3ONFA 4IMPA 5F5LA 4YT8A 1C3VA 3EAGA 4LVUA 4ZHSA 2VT2A 2UVDA 5A9RA 1WNTA 4R5MA 3IDSA 4R54A 2ZB4A 4DLBA 2QG4A 3KLPX 4YVFA 3GZNB 4CM6A 3L4BA 4R68A 2X22A 3ZW9A 4DVJA 1PJ4A 1H2BA 3JD4A 3O8QB 4BKOA 3W4JA 2VOEA 1ENZA 3VPHA 1NHGA 4JBGA 4OH1A 3RI3A 1WZIA 4Q39A 4FS3A 3NRCA 3QE3A 4FJ2A 1HEUA 2CD9A 4HFMA 5F5NA 1ZNQO 5A3VA 2ZCUA 4QEDA 3RKRA 2Y99A 4DRYA 1JWBB 1ISMA 2YQ5A 2QHXA 2PD6A 1EFLA 3JYOA 2DKNA 3D4OA 3G49A 4ZU3A 4EI2A 1HKUA 3RUDA 1GFSA 5CDUA 1NR1A 2WYUA 1TA4A 1E3LA 1P0FA 1Q7GA 3DB2A 1ONPA 1QYVA 2I65A 2JCYA 5AXBA 1EK6A 2G5CA 2DBQA 1A7AA 1RWBA 1CWUA 3I9JA 4L0QA 3WG9A 4OXYA 3OEYA 3WMXA 4F46A 3QWAA 4NFYA 3PGJA 3B70A 4CM7A 5JDIC 2FSVA 2O3RA 2DT5A 5COQA 4Y9DA 2IXAA 4D42A 3UHAA 5EINA 5G2OA 4XA8A 4XJSA 2ZIZA 3HWRA 1JKFA 4KQXA 2NQ8A 1ADGA 5KVSA 1NM5A 3D0OA 1FXSA 3DZJA 4CMCA 5JY1A 5CEEA 3JQFC 1VL8A 5BSGA 4NH4A 3DMTC 1YOVA 2WYVA 3TPCA 4HNGA 1ZH8A 1DJQA 3GHYA 1Y7TA 4AJ4A 4BNGA 4N5MA 4AG3A 2PKQO 3H2SA 5I7SA 1I10A 4NJOA 4DPKA 4RV9A 1M66A 1QLJA 1R16A 2POQX 4GSLA 3S2IA 2DFDA 1CQJA 2G1UA 2C7VA 1VSVA 5THKA 4GVLA 4MPDA 3AJRA 1X1EA 3DBRB 3GVXA 2QZ9A 1M6HA 3L0DA 4KUHA 1YH3A 4IJWA 3GN1A 1X7DA 2Q49A 3E9NA 4FC7A 4GVXA 3JQEA 1QG6A 3FNEA 4WNIA 4AJIA 4ZN6A 3ZWOA 3O38A 2PGDA 1CJCA 2CSUA 1OOEA 2YV2A 3GN2A 1BVRA 2V6BA 1H9BA 1I24A 2AW5A 3DZGA 4YAKA 3JYQA 4RVFA 1ZEMA 4PLVA 4J0EA 5GMOA 1P44A 1R4MB 5CG1A 4M87A 4UUOA 4IJUA 5JYDA 3H4VA 3G79A 4YB8A 4XJTA 4D45A 2YFHA 2CVOA 4RF3A 3GNTA 2W2LA 4DIOA 4QFCA 1N1EA 3PRJA 4OSOA 1ENPA 1UR5A 4CMKA 1NAHA 2CZCA 3UFXA 2OOSA 4U6SA 4D3DA 5DBIA 3R1IA 5HTOA 4RPKA 2Y0DA 3Q6IA 3E1KA 4AL4A 3O4RA 3WSWA 5A9TA 1PU2A 3MZ0A 5A04A 3F5QA 4JK3A 2B37A 3WGHA 2WJPA 1W73A 3QVXA 3EZLA 4ID9A 4RDHA 1KY4A 3BMCA 1PJCA 1AXEA 3H6KA 3NYWA 4CPDA 1MB4A 3OQ6A 4WECA 3SC6A 3FNHA 3KLMX 4B3HA 3OIGA 1ONNA 2DFVA 3WNVA 3F4LA 3BTSA 4ITUA 9LDBA 1NFFA 5F1KA 4X54A 1F14A 2YDXA 1D1TA 2Q46A 5C5IA 1V9LA 4MIYA 2VN8A 1I3KA 3GMSA 4FOSA 5CDGA 2XOXA 1EEHA 5CG2A 2HUNA 3AY3A 1YO6A 1R66A 4R1NA 2YV1A 5JCJA 4CLXA 2HMVA 1NR7A 4KQWA 3LK7A 2YY7A 2VRBA 3IP3A 3RJ9A 4N5NA 2Z5LA 1EBFA 1ULSA 1ZXBA 2EV9A 4GMFA 2VRCA 4IQ8A 1R0KA 1U4SA 3U4DA 1I30A 1U28A 2YHIB 3RUIA 2VWPA 1DLJA 3UAGA 5L3ZA 4CQMD 4P38A 1DFHA 3EVTA 3EUWA 4IDGA 5A9SA 1KBZA 5I9LA 2R00A 2D8AA 4J1SA 2Q2WA 1ZO8A 4HX5A 5JO9A 4YRBA 2W98A 4C7JA 1EE2A 3OMLA 1V3VA 2PZKA 4JQCA 1VM6A 4BL5A 3TNLA 3GVHA 1ISHA 2I6TA 3PQDA 4NU5A 4PLWA 1GPDG 4I9NA 3WGTA 2G17A 2WWRA 3K73O 2OHXA 3WGZA 2GYYA 1RYDA 2OFPA 4PLTA 4A2CA 2X1HA 3IKTA 4CQMB 4YCAA 3PFWO 3SC4A 1EUDA 2X5KO 1RKXA 3EW7A 5F1PA 2VUSA 2B4TO 4Z9XA 5JC8A 4NG5A 4J3FA 4BNUA 3FR7A 4II3A 4XRRA 5I7FA 1P74A 5I8WA 1P45A 4B8ZA 1N9GB 4RVGA 4ZVVA 1RJWA 1VJ1A 4JCOA 4OOFA 1SPXA 2HRBA 4UREA 1NXQA 4E12A 5K0ZA 4PZCA 2ZTLA 4CMIA 4B7UA 3ZWBA 3C7DB 1N8KA 3E5MA 3M6IA 3R6DA 4BUCA 4OYRA 4BNXA 3K9QO 2WDZA 1FF9A 4MP8A 3FHLA 5I7EA 2E48A 4U5QA 1E7RA 2IYOA 3ENNA 3NT4A 3S2FA 3TWOA 3TSCA 3LDHA 4RGBA 2D1YA 3DAGA 1TI7A 4K1LA 1PL7A 1YONA 4BO9A 4B4OA 9LDTA 2DUWA 3GA0A 4J2OA 3GR6A 1SC6A 1HDRA 3NX4A 3HN2A 1TXGA 3MJVA 2Y1OA 2C29D 1I32A 2AE2A 1GADO 5JYFA 3GUYA 5JCXA 3OJ0A 3ZNPA 3EHEA 4FD3A 3H9EO 3C24A 2NTVA 4RL6A 2C07A 5FI5A 5U4QA 3DFZA 8LDHA 3T4XA 2PZMA 3GMDA 4DTIA 3TOZA 3LVFO 3WXBA 2X58A 4D41A 3DR3A 4YPOA 2H9IA 1OMOA 3KM0A 1QSGA 3HJAA 1J4AA 1X1TA 3SBOA 4XQGA 1GAEO 2LDXA 1E6EA 4II2A 3ADOA 4MKRA 5A05A 1WP4A 3M2TA 1B8PA 2QRJA 5C37A 4BNIA 5A1TA 4O63O 2VYVA 2AG8A 1B14A 3H5RA 3D3WA 2X7HA 2HJSA 1C1XA 4RPGA 3S55A 4MOWA 3GDOA 3GNQA 4F45A 5TNXA 1P31A 2VHWA 3CZRA 1PX0A 3B1FA 2HCTA 4PIVA 1ZSYA 3FRJA 3WGIA 4GQAA 2AE1A 1DPGA 2FOIA 2AXQA 2P2SA 4IBOA 5IXYA 4WLUA 1ID1A 4UVDA 4XGNA 3EVNA 2GDZA 1JVBA 1HL3A 2JCVA 1A9YA 1TLTA 1GPJA 4NHEA 4IJKA 4OJNA 4E5PA 1JW9B 2P9GA 4IIUA 3BHJA 4INAA 3N7UA 1BXKA 4PLFA 1QMGA 3OEWA 4ZA2A 3W1VA 2PTGA 4LN1A 3TJRA 3G1UA 3MEQA 1LSUA 1Q7BA 2HMTA 4CMGA 4XEHA 4A27A 1IY8A 1YB5A 3UXYA 3DWFA 2CVZA 2J5KA 5IXSA 2AMFA 1DIHA 1RPNA 4J6FA 5TX7A 4XYMA 2OGUA 3AI1A 3BMNB 2NU8A 3RC1A 4XIYA 5ENVA 2O3UA 2X86A 1H9AA 3QVSA 5IZCC 4GKVA 3QWIA 4RCVA 1T4BA 1IE3A 3FI9A 1PGQA 3MOIA 4I5EA 2IE0A 5IDYA 1P1JA 3VZRA 4EEXA 2PD3A 4IIVA 2DTEA 3FNGA 3NDJA 4QT0A 4GX1A 5I7VA 2HLPA 3KZVA 2IZ1A 4YAEA 2IEDA 5HS6A 4R16A 3WWZA 2VNSA 5ILOA 5JY6A 2GF2A 2HDHA 4WCFA 1LC0A 1UXHA 1DO8A 4WOJA 4NI5A 3ZWPA 3P5SA 4J4TA 4WOKA 3EDMA 1UAGA 4N7RA 3QWHA 4U0JA 5HRUA 3QV1A 1K2WA 7ADHA 4PLHA 5ITVA 4QO8A 3CPSA 4ZQFA 3PIIA 3ZH2A 3ZN2A 4K6FA 3RFVA 1QYWA 4RVSA 3DC2A 4CM9D 1P9LA 1R0SA 4DQVA 4XR4A 1EDZA 1XGKA 3GZNA 4JIGA 3U0BA 4E0BA 3NDRA 2BKAA 1M6WA 1K6IA 4GKBA 4R69A 4KWHA 1YQXA 4UVHA 3WGQA 1LLCA 1WXDA 3V5NA 3QHAA 5CFZA 5BNIA 3FSRA 1LLQA 5HM8A 3ANMA 3W4IA 1PGOA 2HMWA 3W6UA 2Y1EA 2IDZA 2PFGA 4Y6PA 3V1YA 1PR3A 5JFOA 1O0SA 3BAZA 1HYGA 3DTTA 2EKPA 1V6AA 4XGIA 3G17A 4BO8A 3ULKA 5JXWA 4RF4A 2BFMA 1VKOA 1M76A 2B4QA 4A73A 1OC4A 3AI2A 3ENKA 1U8XX 2R2GA 3PJEA 3VH3A 3GEGA 2EGGA 4AJ2A 3EZYA 4QX6A 1EK5A 3UKOA 2FWMX 2EKQA 1IL0A 1KVTA 5IZ4A 2Z1NA 1F8FA 4D0RA 3DTYA 4YT2A 4XKJA 2QYTA 3ZHBA 4J0FA 4ILKA 1B7GO 1S7CA 5A02A 1GV0A 2NU6A 5JLAA 4MVJG 4YYZA 1BRMA 4W9NC 1KEPA 4CLOB 3FWZA 1B0AA 4QXMA 3NEPX 5C7LO 4LISA 5A5EA 5HWSA 1ISJA 5DOVA 3INGA 3KSDO 2EERA 2PKQP 3K8ZA 3V2GA 2H1SA 5JDCC 3ETGA 5T8KA 1MXFA 5B37A 2JD0A 1ZZEA 1HT0A 1AUPA 1XHLA 2ZYDA 2PWZA 2D59A 1HLDA 4CUJA 1HDGO 3KSZO 3DBLB 4NR0A 3FD8A 4DQXA 2YW9A 2NTNA 3VVCA 2O4UX 1X7HA 2D5AA 4TVBA 5A3JA 3GEMA 1O95A 1L7EA 1QP8A 1HRDA 5CHEA 5CPFA 3FCOA 3JSAA 1HYEA 1JA9A 1AN9A 4L4RA 1NHWA 3B20A 3DBRA 2W8ZA 1EVZA 5MGBA 1MG0A 3UCFA 2JCXA 4J2HA 4OL9A 1LRKA 3PVZA 4EUFA 4UUPA 4D7AA 1EUZA 4GAEA 3VPSA 1YL5A 4XQCA 2ET6A 1M75A 3M1AA 3U4HA 1HXHA 3GQVA 3A06A 1D1SA 1GU7A 3KSUA 3ZWVA 1Q2XA 1MC4A 2P68A 1LDMA 2GD1O 3NT5A 3EGOA 2CDBA 2HRZA 1E5LA 1ORRA 1O9BA 2A9FA 3OBBA 1GEGA 5L4NA 3ONDA 4HXYA 1E7QA 3CIFA 4JBHA 4PG6A 3HADA 5J9GA 1UXKA 3DBVO 3L07A 2B36A 3CE6A 4W6ZA 4PCVA 5CAEA 4YJFB 1D7OA 4LSWA 4DYDA 3E82A 1PJ3A 2OZPA 1AHIA 1UZLA 2QX7A 2ZJ0A 2HK9A 3BMOA 5BSFA 5COBA 1YB1A 4YQYA 3ZU4A 3I6IA 3DEYX 5B12A 4TRMA 3WLFA 4OSPA 1B8UA 1A72A 4WPGA 1HTBA 2XF8A 1PZHA 1E3SA 2NVUA 4OHUA 4F6LA 2FR0A 1A9ZA 3QLJA 3VOSA 1YXMA 3U5TA 4U7WA 4BNLA 3LSYA 5TS3A 2EG9A 4P8RA 3FF4A 4OKIA 2Q1TA 3DOJA 5EQFA 1V8BA 1I2ZA 1EE9A 4UUNA 4D46A 3IS3A 3GAFA 3DMYA 3PJGA 4NDNE 4BNVA 1A7KA 1ENOA 5L95A 1QORA 1ZVMA 2D0IA 4W82A 4I8XA 2EW2A 2VQ3A 4LCJA 1EBUA 4WNCA 3AWDA 2NLOA 5A06A 4BNYA 1XU9A 1CDOA 4NBWA 2YHIA 5TJ9A 4E21A 4PN3A 1UXGA 4R1SA 3EYWA 3IQDB 4MIOA 4JGBA 1YL6A 4OQYA 4NFSA 4HV4A 4J1TA 1Z73A 2BF7A 3F46A 5ADHA 3DOOA 1PJSA 3I5MA 2CF6A 1NQAO 1ZK1A 4IUYA 2R6JA 4QFDA 1ZEJA 1CYDA 1LA2A 1KERA 3PIDA 1KIFA 3GNSA 4FGSA 4B4WA 3QP9A 1U9JA 4OAQA 5A4DA 4OIMA 4MKXA 3BMQB 2BFOA 4ND2A 3BTUA 4CQMA 1ADBA 1DC5A 4GH5A 4D3FA 1E3WB 4D44A 3GLQA 3I9LA 4G2NA 4E13A 2GRAA 3V1UA 3JQAD 4JN6B 4RF2A 4DC0A 2G82A 2ZKLA 3MCVA 1WLYA 4K9DA 1QYDA 2A94A 4UEJA 3C1AA 4WK6A 2I5PO 1A5ZA 4OM8A 2UAGA 4YT5A 4ND1A 4BB6A 3ZWYA 4BO2A 1H93A 1YB4A 2UV8A 1HLPA 4AJLA 4D79A 4RDIA 4W7IA 4B79A 4Q3EA 1IULA 3JQ9A 1PJBA 2DQ4A 2JAHA 1E7SA 3K2BA 3LLSA 3Q3CA 3SEFA 4YJDA 4MVJD 1J49A 1B26A 4DGSA 1V3UA 5T64A 4R1UA 2ZQZA 3V8BA 1I0ZA 4EITA 4RVDA 5TRTA 4NMHA 3NKLA 1PGJA 3JQAB 2HO5A 1I8TA 2YZ7A 4CLRB 3JQCA 3D4NA 4XB2A 5GZ3A 1X14A 3FPCA 3V2HA 4BO1A 4CJXA 3L9XA 5G4KA 3WTBA 3PHIA 4AJEA 1YGYA 1KVQA 4IZHA 1YWGO 4IXTA 2BH9A 2VWQA 1KY5A 3MJEA 1C0KA 4XYGA 2YV3A 4ND3A 3HUDA 4BIIA 4CUKA 4IDCA 5B4VA 4ZRMA 3TN7A 4IDEA 3HNPA 2FY8A 5C7OO 2Y1CA 3LC1O 2X0IA 3ETDA 1U5CA 4TRJA 2F1KA 4B3JA 2WM3A 3N74A 3Q2KA 5IDXA 5L4LA 1ZK2A 4YXFA 3LZ6A 4G5HA 1OFGA 1IHXA 1T2CA 4Z9YA 5T5QA 3FWNA 4BKUA 4EBFA 4EUHA 5KKCA 1GD1O 3CTMA 3DZKA 4RO0A 2C82A 1E1NA 4XCVA 4LW8A 5FFFA 3TZHA 1QRRA 2XXJA 3PQEA 4XQEA 2J3JA 4CQLA 4ZQGA 3GUCA 4B8WA 2BGKA 2CY0A 1XSEA 4YDRA 2BI8A 1X0VA 4JJIA 1C1DB 1NPYA 1WZEA 4BGVA 1HDXA 1Y8RA 2C7GA 3GY0A 1F17A 1Y6JA 1RM3A 4J7XA 6LDHA 5JMPA 5DNAA 4QUKA 3ADPA 1R15A 1XU7A 2YHUA 4UUMA 4QSMA 1NP3A 2WTBA 3U4IA 4NK5A 2FR1A 4KP7A 3F1LA 5AXDA 4BNNA 2ZYAA 3PWZA 3GG2A 3NV9A 1WVGA 1D8AA 3CMCO 3R0IA 4PVDA 2W4QA 1LXCA 1LJ8A 2HSDA 1MA0A 4J16A 2J3KA 4KUEA 1LRJA 3MTJA 5TJHA 2VZ8A 3RVDA 5TSDA 1Z6ZA 3BMNA 3DBHA 2GUGA 2NUAA 1NFQA 5LCXA 3TFQA 4IDBA 2D2IA 1BHSA 3QVOA 4R4JA 3WIEA 3OF2A 1VKNA 4RVUA 1OAAA 4BV8A 1K5HA 3KHUA 3LC7O 1MV8A 4BGEA 1T26A 3MJCA 3RQSA 4YT4A 4IGFA 1I2CA 4H7PA 3RAJA 3ITKA 3OA2A 1A4IA 2O23A 2JKVA 4NJMA 3RUCA 4TZKA 3RU7A 4FCCA 3E48A 4TZTA 2W2KB 3KOUA 5DF1A 4CL8A 3F9IA 3ZHXA 4TRRA 2RCYA 4EYEA 2WD8A 2RH4A 4JXKA 1DFIA 5JC1A 4PG5A 3VZPA 3TFOA 2FPIA 1BW9A 2VHVA 4AJOA 1R4NB 4GBJA 3PEFA 2OORA 4BVAA 2DPHA 4E6PA 5L40A 2PGLA 3GPIA 3WMWA 3I4FA 4P4NA 1P1FA 4ZGWA 3D7LA 5JS6A 4PFJA 2CNBA 2WEKA 2CF5A 5ILGA 3KO8A 4KDEA 7MDHA 1YJ8A 1LSJA 4Y6RA 1EQ2A 1IPFA 3A9WA 4YJGA 1MFZA 1E5QA 3ZWWA 3CEAA 1VC2A 3L4BC 3WWYA 3OJLA 4NZ9A 3OETA 4ALIA 3WQRA 2GZ3A 5EPOA 3HFGA 3ETEA 1KS9A 4CM9A 1QXSA 3RC7A 5DZSA 1QLHA 1Z82A 1IOLA 2PGJA 3OQ1A 4YBZA 3JQGB 5TC4A 5A03A 1JLLA 1PQWA 4LMPA 3ZHZA 4S1VA 4CLHA 1N5DA 1YQDA 2VZ0A 2VTDA 1LX6A 3IP1A 3PI7A 3ZHYA 5JW6A 4EUEA 3H7AA 5HBRA 4UVGA 3GOHA 5EL0A 4YJHB 4FJ1A 2PA3A 3GGGA 3ZWXA 5I9MA 1AGNA 2V6GA 1KEWA 2EIHA 3W8DA 1F12A 4AFNA 2GZ1A 3JQ8A 2NQTA 1NBOA 1XIVA 1ZUD1 4YAJA 4QECA 4IINA 3PLRA 1E6WA 3OJFA 3OJEA 5BSEA 1GUZA 2EF1A 4W99A 3L77A 1MLDA 3HQ4O 2G0TA 1P1HA 3BIOA 4NU6A 4H15A 1WMAA 5BT9A 3Q1LA 3U9LA 4MDHA 5AXCA 5TF4A 2C0CA 4YRAA 5KVCA 4BNZA 2WSBA 5JO0A 1GQ2A 3UICA 3EC7A 4GMGA 2JL1A 3KYCB 3GDGA 1PQUA 2BFPA 2B5VA 4YACA 4A26A 1P0CA 2E6UX 4NQZA 1FJHA 1YL7A 4BMSA 4QO7A 3GEDA 4UEKA 3KEOA 4J7UA 2VNAA 4K6CA 3DHYA 3DFUA 1H6AA 4BNJA 2O7SA 1E6UA 1LEHA 3DDNA 4PLZA 1HWYA 1U2GA 2BRUA 4RQUA 2DU8A 3GVPA 5DOZA 3INRA 5H81A 1P1KA 4ROSA 3NJ4A 5KJEA 1BGVA 2QRLA 4M49A 5I9NA 5KJFA 4B7CA 1LU9A 1K6JA 2VHYA 2AQKA 1GR0A 1J5PA 1H6BA 2ZQYA 2X4GA 3VH4A 2XPCA 3ORFA 3PDUA 3VVBA 3I83A 1PJ2A 1CIVA 1U3VA 1WAMA 4L4SA 5TIIA 1B15A 2OP1A 4UEOA 2OBNA 3BZUA 2AEFA 3KYDA 1GUFA 1NVTA 5DULA 4XGKA 4PRKA 4NPCA 2X0RA 1W6UA 4NK4A 1FDTA 2Q3EA 4CM1A 2Y67A 3ZNNA 4Q3NA 2BGMA 1LLUA 2BHLA 2NVWA 3H9UA 1MX3A 2JFFA 5BNTA 3B1KA 5J23A 3FTPA 3U09A 4YR9A 2EWMA 4P22A 1R12A 1GEEA 3WOHA 1I3LA 2X23A 3KVOA 4OQZA 3JCZA 5G0VA 1EZ4A 4MVJE 1GYRA 1XQ6A 3E9MA 1P77A 2HK7A 4B3IA 4CM4A 1GUYA 5B1YA 4PGFA 3T4EA 1JU9A 2NNLD 1V35A 4E4YA 4BGUA 4YAGA 3WYCA 3RBXA 4IS3A 5G0TA 1PTJA 3UCXA 4CV1A 2GO1A 4O5OA 1XR3A 3W6ZA 3KYBA 1Y1PA 2C2YA 1ZMTA 5KJCA 5JAMA 1SO8A 3X2EA 1T4DA 1YBVA 1NQTA 1YDWA 3CH6A 4Q3AA 4D3SA 2B5WA 2JAPA 4M55A 3WQQA 3HB5X 4W4TA 3H9QA 1KOLA 1YE3A 4HY3A 1XCBA 3L9WA 4ESOA 4WLNA 2Q1WA 5CP8A 3IOYA 1CERA 3DZFA 4CLEA 3AFNA 1BDMA 1EDOA 1LSSA 2A4KA 3M1LA 1WDKA 1EVYA 3LT0A 4XDYA 2VTEA 3B6ZA 2C20A 1LBEA 2Q4BA 2EXXA 3DHNA 3F4BA 2GGSA 1YVEI 1YBMA 3AM3A 2GZ2A 5DBFA 3GHHA 1SAYA 5IN5A 2AHRA 4CMEA 2JD2A 2Q50A 3JQDA 4AJHA 3GK3A 5AXAA 1H6DA 4TMFA 3GFBA 2WD7B 1X0XA 2CFCA 2FN7A 3LYLA 1GY8A 3AM5A 1TT5A 5JYAA 4J4BA 4IZIA 3I6QA 3JQBA 3KV3O 1W4ZA 3ONEA 2R00C 2VUTA 4FGWA 4MINA 1I01A 1T2AA 3TZ6A 5C7IO 4MIEA 1B3BA 3H9GA 1K6XA 3PXXA 2NV6A 4ALKA 1N92A 4DMLA 4CR8A 5TGDA 3FBTA 3HN7A 4F3YA 1ISIA 4BGIA 3OSUA 1ZMOA 5DDIP 1IHYA 2DLDA 5MDHA 1ZSVA 2YQ4A 1FDVA 3PFFA 1LDGA 3D3EA 5ITWA 4RF5A 3VPGA 1G0NA 2Y1FA 4GGOA 3VKVA 4R9SA 3AU9A 4I9UA 1UH5A 1X13A 5GZ6A 1ZJYA 3ZU5A 1R37A 1LLDA 2J5QA 5JE8A 5ICMA 5JSFA 3O8QA 1O8CA 3JD2A 2FPGA 2X9GA 2B69A 4XX0A 1BMDA 2B4RO 3JQAA 2DVMA 3PHHA 1ZW1A 4I5DA 3P19A 3H3JA 2VCYA 1IUKA 4KZPA 3JD0A 4ALMA 3RKUA 1IPEA 3WBFA 1HDZA 2IRWA 3BYZA 1O5IA 2GNAA 4MVJP 3HDJA 1SB8A 4MVJA 1ZCJA 3HZZA 5FWNA 3DOCA 1W0CA 2EKLA 3WSVA 3H5AA 4KWIA 3QVWA 4LCEA 5DCYA 1T2FA 1DEHA 5BQFA 4RQTA 1H2HA 1HE3A 1SMKA 2AG5A 1B16A 3AY6A
chains in the Genus database with same CATH superfamily
3OEHA 3N2KB 1XZLA 2GN4A 4OB6A 3O3OB 4XPIB 3EZ2A 3HBJA 2OFWA 4BO8A 4ND5A 1L7DA 3DAPA 2BVNA 1T6ZA 2YN2A 1HTTA 2ZDQA 3PGXA 3DOUA 4HDNA 2DGDA 3ITDA 2GNOA 4I1VA 3DZ5B 5J2UB 3DE6X 3THXA 4NG4A 3B9RA 4XLTA 3BFKA 1N7HA 3QIAA 5DBGA 2BKVA 4G0XA 1E9VA 2QN2A 4E30A 5DTMA 1V41E 2OGSA 3HCAA 1NP7A 1PD0A 3ONWA 1TMGE 4G1CA 4RVNA 4WEQA 4HYYA 3ZZUA 4DL9A 4N3AA 2PX2A 4FDMA 4TWZA 3L6DA 3CR8A 1LBQA 1P4RA 1XTVA 3FTDA 5IFLA 4FGUA 4N8EA 4DILA 2LVBA 1T3GA 4IH4A 3D6AA 2ACEA 3KELA 2ISCA 5L7TA 4AZ3B 2AX3A 4ZOLB 2MCFA 3I9V6 3A6HA 4XLZA 1Z5UA 2A9RA 2C2KA 3IUPA 3WJAA 4D82A 2J9XB 3COZA 1E3QA 3BXOA 2PBZA 1ZJ4A 4OQDA 1BDHA 3EXFB 2NSHA 1BHJA 1CRWG 3NUGA 4KK4A 1EFHA 1T0PA 1ULZA 2PL9A 4ZQEA 3T5GA 1JAXA 4D3FA 4R1LA 4FFVA 3HN6A 2H6EA 2Q6TA 4N49A 3U4CA 2LP4Y 3MCWA 1DKPA 1QV6A 5DVZA 2IGTA 5U9CA 3UOGA 4U3JA 2VAVA 3MM4A 3DZDA 4JL6A 3Q10A 2QRQA 1W7AA 1D5WA 4X91A 3AVYA 1UDCA 2B8NA 1REQA 4J7CA 3P45A 1E1DA 5SYAA 1ZJWA 5KNBH 4Q03A 4Z3KA 3CLSD 2OZKA 4W7SA 4Y9RA 2GKSA 4J03A 4A36A 1U5BA 3AEQB 3G2MA 3VZSA 3S2GA 1K3TA 3D8SA 4EELA 2H3HA 4RFSB 3QPCA 1KQ3A 4OSEA 5AI5A 3FNBA 3D4PA 1UFOA 1SKYE 2ROQA 3AWIA 2JLQA 3IT0A 1H69A 1JZQA 4PBSA 3ZK9A 4B76A 4IXDA 3U37A 3DE0X 2XZLA 2EWVA 1D3AA 1RWOA 1WVIA 1XF1A 4A7PA 1XRJA 4KGXA 3AIOA 2B83A 4R5HA 4JOBA 2KI5A 2V4ZA 4PPFA 4Z0HO 1X1RA 3LPLA 2R8EA 1EMDA 4CFSA 5IDQA 4RJJA 4DR2B 1MQ9A 3QBJA 1D09A 4BEJA 4PC6A 2A9KA 1LC3A 1RSZA 1AGPA 3NUZA 4CV0A 3EZXA 2W7TA 1QCZA 4OHWA 4YRQA 2F43A 2MSEB 2PSHA 3K4PA 1C30A 3DL0A 5D1HA 4Y2RA 1UFRA 3GW8A 1AHHA 2JZOA 5AKZA 3C5WP 1RRMA 4KODA 1DINA 1S01A 3SC3A 3LCCA 1U0SY 4PSKA 4C88A 3TO5A 2H3EA 2UUOA 3B7GA 3IPLA 2HW8A 4XYEA 3MQ4A 3BULA 1B1CA 2A35A 3D3WB 3LT2A 2R6FA 3PQFA 4RS4A 1UBUS 2BGNA 2EATA 2QN3A 1C1XB 4UD6A 4ER6A 1SEVA 5JS2A 2XVXA 5JNLA 3KBOA 4LE1A 3DUFA 3DMTA 1A97A 1PJTA 1Z26A 1KL7A 3C1TA 1E8DA 1MJFA 2PAFA 3NT2A 2WIFA 3L4SO 2XMSA 2ZXEA 4KMOA 5CDHA 1U80A 4MMZB 5B1HA 2WABA 5A4AA 3RPEA 4BVHA 3U1TA 1VG0B 5L7YA 3PHGA 2QPTA 3RSQA 3HLYA 1PVVA 4D3YA 5K05A 4FFPA 5DMXA 3P9QA 5JZOA 3HKDA 2XNSA 2VHEA 4RJKA 5FPYA 1SKMA 2A84A 1KU0A 4LBZA 3BGWA 3V1KA 4KBFA 1NT4A 2FW7A 3Q15C 1NI3A 3HSSA 2FCRA 2VHCA 2XQKA 3GH3A 3Q9NA 5DCWA 2FPSA 4X90A 2X1VA 3FX2A 3GRYA 5FP0A 2QR5A 3ACDA 1GPKA 1OVGA 1NZFA 1Y5IA 2WNSA 2J46A 2G9UA 3V4VB 3LF2A 2B94A 4Z9FA 5EEGA 5D7BA 4EJFA 4F3NA 3T0FA 4QREA 2XI4A 5FPTA 1JIKA 3VDQA 1W4RA 2YJNA 4FQ8A 5AQEA 1JDJA 1UL1X 2I9KA 3PYMA 2ZB8A 4RK6A 2EARA 3WHIA 1OGIA 1U2DA 4DC9A 4EG1A 4LF7B 5D01A 5CG1A 2WJHA 2RHCA 2M6RA 3W8FA 1UJ2A 1YFKA 1YS4A 3BFXA 3LT4A 4AY4A 4JR0A 4L76A 1E7WA 2YC2C 3QVUA 5FI3A 3G0IA 4MWZA 2PO7A 5JEDA 3HU2A 5CM2Z 3QG5A 4GMHA 3PQVA 3LKVA 4ZO9A 4PZPA 2O0LA 3OQIA 3AM4A 3ZJ5A 4N54A 4DV0B 5T8KC 4BUZA 2Q3MA 1CFZA 1EP2B 4XR9A 2P2LA 4X63A 2D3TA 2YWFA 4KPEC 3LUPA 3T4UA 1YFLA 3LU1A 1CDZA 5JBNA 1L7AA 3KKNA 5HF5A 1AUOA 4TMYA 2JIZD 1GFIA 2GPYA 4O0LA 1O95C 2KLHA 4B3GA 2VAPA 1N2JA 3ASUA 3KE8A 1AZTA 4R83A 3RRXA 2YYZA 4F3CA 3GFRA 1UBNA 1Q15A 1SUFA 1V16B 1IAVA 3RVRA 3MUOA 4D9BA 2X0JA 1N6HA 3KXDA 4Q37A 3EIHA 4IGEA 3HYTA 4Q01A 1T6NA 3MAJA 4F21A 3ESRA 3PZBA 2H29A 3K30A 1VDMA 1YCGA 3ABRB 4B7XA 3KK0A 5JJKA 2C5EA 2VTKA 1I36A 1FFSA 4QDJA 1OC2A 4A9AA 4C5BA 1V0JA 3L8MA 5KQSA 3Q85A 5JBQA 5JD5A 2B21A 4HLQB 4WBNA 1AS2A 3T7EA 2CHGA 1LDYA 3LH5A 5K0LA 1Y63A 4R01A 1X8KA 3TLAA 1Y8ZA 4NHOA 1TK2A 1L4YA 4EHNA 4WCDA 3KJHA 2NO9A 1TO2E 2Z1DA 1A7UA 1HTWA 1TIKA 4B48A 4BN4A 1GZUA 1R6UA 2DTXA 1OZAA 2JLAA 2WF7A 1DDOA 1TVKA 2WV9A 4ZEXA 3TG2A 4B3RB 1MIOA 1IG0A 3E27A 2FUEA 4CWAA 4DMMA 4YLYA 4B6SA 1ZR2A 5KAMA 1JEAA 2VYND 3PA6A 4GWKA 4EX7A 2OCPA 2BH2A 1V1MB 1EGHA 1LNZA 2YQZA 2XYPA 2NMVA 4BYGA 3F6SA 1ZOOA 5K9ZA 2PKRA 3HJGA 4LJYA 1W87A 2ZYHA 2GASA 3KPUA 1GILA 5FUWA 1LDEA 4K7JA 2DMRA 4KVAA 2QDKA 1C0LA 3W9YA 1PJQA 1U1IA 3L5KA 3SF8A 4HUJA 4REMA 4OX9B 2XE7A 5TQVA 3RAGA 1XI2A 2I7CA 2WPDA 3B36A 3BCUA 3EFBA 3PC7A 4DG8A 2WG2A 2HF9A 1GXSB 1ATIA 3I3OA 4MKZA 3LDAA 4UCQA 4DHWA 2ZE6A 2XTNA 3CKLA 1Y8QB 4EKEA 4KRFA 1IM5A 2VAMA 3F2IA 3U3DA 5FH9A 3GT4A 4WN9B 2FPWA 3QXHA 3UKJA 4ZU1X 4DB4A 2AK2A 5JISA 4GQIA 3TEMA 5MF6A 2YUTA 2W0MA 1IXRC 3DHEA 4ZOBA 4YFYA 2CXTA 2FKNA 4BP9A 1O6GA 2CBXA 2BWJA 3S7ZA 3PDJA 3SJBA 3KUDA 3I32A 2ZVQX 3QMMA 1UP7A 2ZUCA 3QEMA 3TSAA 3OKFA 2UUAB 1JKJA 2FMTA 5HF9A 2OV4A 1JLHA 3JTMA 4EYSA 2I2CA 2YRXA 1LPBB 4UEQA 3SLRA 4YWJA 3NJRA 4E5KA 4DSNA 1H2EA 1PZGA 2ORWA 2AKEA 3AEXA 1SXJD 3CVUA 3TLMA 3JATA 1M5UA 1MUUA 2WIAA 5LXTA 1UXIA 5LBUA 1XD2A 2AOUA 1V1RB 3TW8A 4GKKB 2WIDA 1W5FA 1N1GA 2QY9A 1GNVA 4ZYLA 4UBNA 5ENDA 3U19A 4IHJB 4FONA 4PXAA 1GQFA 5A5DA 1ULHA 4MS1B 1EFRA 1O87A 4P33A 2G83A 2O06A 3UOAB 1BU8A 4AIRA 1RRCA 1FMTA 1PS0A 3UJHA 3CVVA 3EA5A 1JIXA 3BXHA 1U7TA 5FCDA 3NIWA 5JOQA 1RM0A 4HAIA 4EJ0A 4DIBA 2O2GA 1YDEA 2RI1A 4A6EA 1SUDA 3OIFA 1V11B 1G21B 4MQ5A 4JSRA 3HI6A 1CW2B 3PGLA 2X0NA 4P9NA 1UBHS 2PH5A 4HO1X 2YXBA 4KLZA 4TTIA 5AUNB 2GN8A 3M2PA 4QUJA 2VZLA 1Q7CA 1PGPA 1JHRA 3BQ9A 4Q1BA 3AB7A 3B52X 4F72A 2RKOA 4GI1A 2SBTA 4RY2A 3DXZA 3AF2A 4RANA 1W34A 2GLXA 3IJ5A 4QBHA 2YXDA 3WKCA 2C94A 1KMHA 2I3GA 4HGOA 5CIQA 1HV8A 1UEJA 3V48A 3I4CA 3S2SA 4YJ2B 1F2VA 1OJ7A 1JNYA 3AJ8A 4MO9A 1T4CB 3LC2O 1L4MA 1ZKMA 4TSKA 4YRTA 2WILA 4ZTBA 4MW9A 3LFUA 2FPNA 1I33A 2RK6A 4KMMA 3RBZA 3T54A 4AUMA 3T3IA 2JANA 1WP9A 1VL6A 5H4HA 1M1ZA 1ZNWA 4ENRA 1IEXA 3WRYC 2Q9CA 3NWEA 1BQEA 1M1XB 4MUNA 4Q3DA 2DPGA 5JCZA 5JH7A 5K03A 3DKRA 1U3WA 5DSTA 1SBIA 4PZEA 2ONCA 3DH0A 1JSCA 3RRZA 3P9KA 4FNGA 4CIDA 3VYWA 2CUKA 2I4RA 2RBKA 1K0FA 1WX1A 1II0A 1BC5A 3AVQA 3QFHA 1ZDMA 3BX1A 3NHWA 4TXMA 3UV7A 2B6HA 3VZCA 5C35A 2YINC 3S1LA 4RTJA 4ETIA 1JENB 3WWEA 2C8KA 3CNQS 4DA9A 4AMYA 1BIFA 3K9WA 3G0GA 4MUMA 4NAUA 5CEFA 4GBGA 1G41A 3Q41A 1J0CA 2QP4A 4WH0A 5B4TA 3E7DA 4CLOA 3KU4A 1QKJA 3ZY5A 3KS9A 5K5EA 2Z98A 3F9CA 2C2GA 3NFRA 1IC6A 3DLIA 4CL3A 2P1ZA 3VSEA 3C5CA 5JS7A 4RTNA 3DG9A 2EZ8A 3WYGA 2WG0A 5KOIA 3OZSA 2AN1A 3LWNA 2GZMA 1US8A 4HMQA 5EMHA 4YMVA 5K09A 4L9RA 3E8XA 5F1OA 4OO3A 1OBHA 5C8DA 4CDNA 3ND6A 3AFOA 1XDDA 1MAWA 1H5UA 3FE2A 2DHCA 4WLOA 3H2GA 2IF2A 4EG4A 5C4GB 3EPLA 1NYRA 3QELB 1VI2A 3V55A 2HTFA 1YZHA 4L74A 5IAJA 4WVFA 2ZTHA 4Y9TA 4B84A 4CM8B 2M6KA 1LPMA 2JJ8A 2BEUA 1ZFNA 4GKJB 4DDTA 4BLTA 3MFYA 1KFCB 2NU9A 1SQGA 2ADMA 4ARVA 3SEZA 2L18A 3FAKA 3OQJA 1YIAA 1PX2A 1XYVA 5HZHA 3DO5A 2IY8A 3DE1X 4PHCA 3ROPA 3CINA 1GRVA 4GKAA 3GLTA 3CZAA 4FI3C 1CRQA 1E5TA 2OESA 5GONA 1XTPA 3RRFA 3VOBA 5AW7A 5T57A 4IWXA 3PGMA 2HDNB 3RJZA 1GV1A 2HXGA 5A3QA 1XZIA 1ULUA 2JFOA 4HBGA 3TOVA 1BDIA 3QH4A 3NM6B 5KTPA 2B1GA 3L8FA 2VSYA 2RAVA 1P0IA 2QRVA 2RK3A 4LYEA 3V4LA 3LO5A 4I7EA 3UANA 2AJLI 4JJ4A 2MDTA 5EIAA 5GZ1A 1OLXB 5JAOA 4DWVA 5EJAA 3OQVA 4MR9B 1EK2A 3AR8A 1I3OA 3IEVA 3JALA 3DMRA 3EVBA 4JX8A 3A7EA 1T43A 3KHSA 1FS4A 2VJCA 1H1LB 4JP3A 2R6GA 2FUNB 4UFOA 2GN0A 3U62A 4BV9A 2MHCA 1C3OA 4IY1A 2BMFA 1E60A 3RK4A 3W3AH 3IWCB 2P6OA 4PG4A 3P0JA 3LCRA 2IS4A 2GBLA 2YWEA 4B6FA 2R4QA 3O93A 4DPLA 1JSLA 1QDEA 3F1KA 4MQLA 4ARZB 4QGGA 2KBFA 2XNDA 3AFHA 5FTWA 3VYRB 2E0IA 3ZTWA 1NATA 4HDSB 5AK4A 4HNRA 1DIRA 3KKKA 2E18A 4GPBA 4FGKA 5EZ6B 1L1FA 3R41A 2EW1A 1FVFA 3JQ7A 3WQSB 2HJHA 1C5KA 1P9NA 1N6OA 3IHKA 3PQ4A 4KXXA 3ZEAA 3SSNA 2PRJA 5PGMA 2VDMB 4K6GA 3SKXA 5EY5B 1SVWA 4PTYA 3NV7A 4TT3A 3OQMA 4XSGA 4Y6QA 3DBOB 3T94A 1HNZB 3HXQA 4LZOA 2AMVA 5FA6A 2XHEA 4O8JA 5LU9A 3RQSA 4CMAA 3Q8LA 3ERCA 1KDPA 4WKPA 4IDNA 4UHEA 3AJDA 3O4GA 3T7IA 3PV0A 3EUEA 1CJSA 3GAAA 4MV6A 2VP5A 1C80A 2WTMA 2C2XA 4OBBA 2QLTA 2PDAA 1R6DA 4NYMR 4EGSA 3E6AA 4FK8A 3QXGA 4CCWA 1Y81A 4COOA 5CFRA 4Z4GA 2GEVA 3N70A 1IBRA 1BFKA 1HDEA 3C7CB 2HSZA 4KLAA 2N1MA 1HOXA 3L6EA 1TQHA 1T3HA 2Q8NA 4PYLA 4WGGA 4C4AA 5C8YF 2CYBA 2LW7A 3LBHA 2EL7A 1BXZA 3GPDG 1Y3AA 2XKJE 2ZJAA 4GG1A 4KRXA 3ZCQA 3R3HA 4CTJA 3TD9A 1LRLA 3H05A 4R1PA 4ZIRB 4W7HA 5DHTA 3T5CA 4FFBA 4DOMA 4N9QA 4I55B 5I01A 2N9UA 2AZ4A 5HGJA 4E3WA 1R0BA 3FFWA 2DX7A 2X5JO 2CXHA 2GEDA 4KQHA 1XPRA 2XUHA 4RK1A 1LGYA 4PW0A 2DPLA 3W2EA 1YOVB 3VR4H 4TYQA 2QQGA 4GI7A 4RETA 3DZCA 3NEAA 4I9HA 1PVDA 3IR6A 3RYHB 2H4JA 3LBAA 3SBXA 4EQ6A 1AQNA 1VMDA 5F4ZA 5KAPA 4PSUA 1QP4A 4FEYA 1LCIA 1XMSA 2OP0A 2B92A 3RV4A 4DUYB 2RGRA 1U2EA 1CQJB 4Y0VA 1PZEA 3VPXA 4NMMA 1MD9A 1RHUA 2W2QA 2X8LA 5B1EA 1K7SN 3W90A 3PCTA 3OWHA 2YXNA 1IIRA 1X8JA 3RTCA 1PT8A 1C8LA 5AVOA 2B1JA 2ZS9A 3FY4A 3SEAA 3ZU2A 3ESCA 1HQCA 3F96A 4UUAA 5EE3A 4OGFA 1PG2A 1VSBA 2YVUA 3WQBA 2W90A 5CK4A 1Z36A 4AMBA 1XJ0A 1NJ1A 4U39A 1WJGA 1A9SA 3DFKA 3RC3A 3DTVA 2TRSB 3C3CA 2G1KA 4G9EA 4RV4A 2YXPX 1SFRA 4HVAA 1N9KA 1PFUA 4ZJYA 2O3TA 3DZ6B 2R25B 2VSNA 4DA0A 3H0EA 1QANA 3S99A 4BLWA 4EX6A 2KSQA 2OVBA 4BX3A 4TLEA 4S1NA 3I9FA 1DAEA 3K1ZA 5K0EA 1RHKA 3ZDBA 2I2WA 3VC1A 3E4DA 4JQOA 4UBLA 4XM1A 1DC7A 4ME6A 1J56A 4B75A 4GWGA 4JI4B 3R23A 1G21E 1HE5A 2B9EA 2HU8A 1RM5A 2R6CA 2NUTA 1UFVA 2WYOA 3AF0A 5EESA 3FYUB 4WE3A 4D5GA 1V8ZA 3D3QA 2HF8A 1E0AA 4O29A 1P8AA 1Y4ZA 1LPAB 3COSA 3VPDA 4F6CA 5IVPA 1MV5A 3SJAA 1LH0A 1XRMA 3CKMA 1PHPA 3ZIAD 2DE0X 3A2MA 5C52B 2AMYA 4BX8A 4BTEA 4RD0A 2BRUC 2P4HX 3QKSA 1WZNA 2FPIB 2I8AA 3ZCUA 1VHJA 1ZJZA 5KPJA 1FX0A 1M0TA 1CUYA 1S6YA 3C87A 4G5SA 5HMLA 4F3KA 1L5YA 5IJ0A 2CUZA 3AHDA 2I6GA 4EDFA 5JHHB 1TLFA 4CKCB 1KI6A 2RAFA 1BYIA 1AN0A 2DYKA 3G59A 5EWLA 4K2AA 1Y9EA 4M0CA 3VYUB 2O1XA 2C3YA 4NDZA 2WUGA 2CBGA 3BMCB 5JWHA 2OM2A 4NVRA 5LQUA 3HYRA 2Q2OA 2ZB3A 2Q99A 1TJ4A 3FVRA 4FZRA 4XWGA 3H97A 5IYZA 3Q7EA 4JROA 1ZXLA 3RC9A 2OZVA 1VHDA 1IOZA 1ZC3A 2ZJ2A 3DE2X 2WMOB 4R1TA 1HDYA 5FBHA 3TOCA 3P9IA 4YJ3B 2EKBA 2ZYUX 3B1JA 5JZ9A 5IWAB 1T8SA 4OVKA 3E9QA 4JITA 2O5EA 2Z4SA 3VH2A 3BTVA 2ZI7A 2J6CA 4C0AC 4DQUA 3CX6A 4IS2A 2WUVA 3S0JA 3ZWCA 4JKIA 4QM6A 4DF3A 4DC1A 1E9BA 4ZPXA 3KPWA 1P1BA 1KDZA 1U5AA 5BP7A 1K4YA 1GCUA 2J9ZB 3PQCA 4K86A 3SQOA 4I08A 4BNTA 2P4SA 4CMBA 3D1LA 4JBWA 3I23A 4QA9A 3GPCA 2H63A 2RIRA 2OCAA 2WWFA 3BIFA 3EPBB 4L9SA 5T6BA 4D8XA 2A59A 2PYIA 2I71A 3G0BA 3N2EA 4YRFA 1ZONA 4C7KA 1YA6A 5L3QA 1HH4A 5B7NA 3UUEA 2VOJA 2RBGA 5HF6A 4JJGA 1TF2A 2RH8A 1OT5A 3WNQA 2ECFA 3CVJA 1URPA 4BECA 4XRGA 5KYWB 1BROA 1VKJA 2OK7A 2VHZA 1O03A 3DSRA 2IP2A 3ZI4A 3J80A 3BGOS 1ADFA 1J8FA 2V74B 4PYQA 5LB4A 3REQB 1DX4A 2J3EA 1YR2A 3WLKX 4C3OB 4YLGA 1JVSA 1CJTC 3GJZA 3KTFA 3NBXX 5F12A 4GR5A 5ALQA 4AJ1A 2QYOA 2GCOB 2ZU6A 3MD9A 4L7VA 1MW9X 2G25A 4XYBA 4RK5A 2E85A 3FVVA 3ZU3A 3M34A 2ONZA 2E1RA 3DUWA 3FJYA 1YMVA 4GLJA 2J6IA 3RU2A 1HKHA 1I5OA 2ZRAA 2IHYA 1ZICA 3EPAB 1CQIA 4CF7A 4HSGA 2WMDA 3HVKA 4BAUA 2ODQA 3QVJA 3TF5A 3OQOA 2PXAA 4MUAA 3VR4A 1TW3A 4ACAA 4AIIA 4RK7A 4UE2A 1NY6A 3SP1A 2RG7A 2PVPA 3N59A 5A4MS 1UC9A 5F33A 2OQVA 2PIDA 1TM3E 1P2UA 3G8CA 3NG1A 3SIWA 1YNSA 2F1JA 1HZJA 2D4AA 3HBFA 4H9GA 5CFPA 2V3WA 1AOXA 3HV0A 4ZV9A 4ZO8A 4EGQA 3MUNA 3CT6A 4CV2A 4KOAA 4CMEC 1VL0A 1EA7A 3GEHA 1KIMA 3KVRA 1F6BA 2F59A 5HZMA 2VDWB 5AM4A 4D0SA 1U8AA 3ECCA 5BYJA 5TY0A 3EAQA 4KOEC 2BM1A 1GCOA 1NBIA 2EFJA 3R3ZA 3FCSB 2Y66A 3GRPA 4YK7A 4YV7A 2IH5A 4I1IA 1ISGA 1BWSA 5UKDA 4CLDA 1HM5A 5BNWA 1H3FA 5FHRA 5EC8A 4FFOA 1RI3A 3SXJA 5AJWA 5KSYA 3OZVA 3GRZA 3I9MA 1QK4A 3IRVA 3IDAA 3KYDB 3SLKA 2FN9A 3IBGA 2CV0A 2G67A 2A7QA 1SUPA 3PSAA 3ILXA 4NBRA 2WAXA 4DRZA 4YMLA 1ZGHA 2PNFA 3CV3A 3F5SA 2O50A 4N82A 5AH0A 3NDIA 3ZLUA 5KQMA 2QIOA 4HAZA 1WKVA 3R09A 4X71A 3AUYA 3EZNA 2CC2A 5LQNA 1PAUA 1U8CB 1X7GA 1CNFA 4N6NA 3HB9A 4P08A 3EPKA 2VTVA 4D25A 1I3CA 3I0MA 1MOZA 2N0SA 3LQ1A 1GG2A 1Q2UA 5D85A 4EB0A 4Z1OA 1E1RD 2V96A 3U4MA 1B41A 4PU0A 1NN5A 1SHZA 4DLLA 4M60A 4ZD6A 1KZ1A 3QVTA 2VHXA 5A7GA 1MJHA 5U4XA 5GWXA 4G1FA 2A1TS 1FDWA 3U60B 1SXIA 2GHQA 4WJLA 4Z4CA 4MGIR 4X24A 2XLCA 1E9RA 3QBEA 5LR6A 3UAYA 1YRBA 2ZIXA 2L42A 2PY6A 3ABIA 1XQVA 2OENG 5BPFA 1AF7A 1JF8A 1SIBE 2VTBA 4QXOA 4AJPA 1YR3A 1QRUA 4QUIA 2I22A 3GD7A 2VO1A 1YJCA 2V7PA 2XCLA 5KKAA 2VWGA 3NTRA 5B1DA 1SXHA 5CURA 4EB6B 4V38A 4AD8A 4IQGA 1UPFA 2P5UA 1JHXA 1NF9A 1YACA 1MAUA 5JEEA 3JYPA 4US0R 4PQGA 2AMLA 4A91A 4FYKA 4P98A 4ATNA 1YDHA 4ZMBA 5CB4F 4JNKA 2ZYWX 5LOVF 2BYTA 2HAEA 2WVJA 2ZYIA 3C7AA 4JVOA 1NNLA 3HJFA 3C43A 1G5HA 2XD4A 4WEOA 2XWSA 2C31A 3ZGYA 2A14A 4JB8A 3WGUA 1UKYA 4Z3OA 2GM3A 4KSBA 1CJVC 4QQRA 2KQUA 3D0QA 4KTVE 5DGHA 2J9FA 3N0RA 4ZTUB 1Y5RA 3GP3A 1G16A 2BD0A 2VPWA 4IRMA 3ZHUA 1QH1B 5CA1F 2WHEA 4D5EA 1HF3A 1VCNA 2HHHB 1T24A 3CRVA 1E7YA 3TQTA 1CLUA 3GIWA 4ZC1A 1W9MA 1S2NA 2P1DA 2ZUSA 4HF7A 1IVNA 3FH0A 2C4TA 3IUMA 3UA4A 1N7GA 2J30A 5LM3A 1UJMA 2E82A 3BJIC 3ONNA 4G1UC 4MAFA 5FBRB 1SEPA 2C5FA 1FVHA 2ZYGA 4JBIA 3ETCA 4P5EA 4RPJA 1L3IA 1NE2A 3E61A 1EJ6A 3L7NA 2QZZA 4MR8A 2WHYA 1KEVA 3CX8A 3A6FA 3QNWA 3R7DA 5K3EA 4E15A 4LBVA 4LEIA 4XIGS 1X86B 1NASA 1WD7A 2ISSD 2ZRDA 3E7FA 4F5YA 3P97A 4QGAA 3VU1A 1UUFA 1U6IA 3L0YA 1KVSA 2GOYA 5K3DA 5BMVA 1ZN8A 2NPFA 2H0RA 4NF2A 2BE7A 4PNZA 1RFLA 3IPAA 4BS9A 3NIFB 1UP6A 3LUJA 4EHJA 3BHIA 2HCJB 4PAOA 4LSGA 4S04A 4OY3A 3VO1A 5C3MA 1K7XB 1U2PA 4LX8A 3DONA 3UATA 4CF3A 1R4AA 5BUCA 3LIIA 1FLNA 2QAJA 1W0JA 3H8JA 3OP4A 4E5UA 2QTCA 5TQ0B 4UCXA 3ORHA 4RNCA 3AESB 3ONFA 4JDUA 2JJQA 5F5LA 4KNVA 3Q7IA 4B6PA 3QKUA 4C4TA 3NS7A 3NONA 1KDYA 1WNTA 1WHTB 2FW8A 2HGZA 3M8KA 3CRRA 2RHLA 1NQVA 2ZB4A 4P86A 3SZOA 4R2XA 1WZUA 1XAGA 4DLBA 4EENA 2F1RA 2FXIA 3SHTA 4F8JA 3GZNB 5KUTA 1XXHB 4CM6A 3L4BA 1X7ZB 2X22A 3AR6A 3EXIA 3I04A 4PAQA 2YNMD 1H2BA 4BKOA 4H17A 4FNOA 1JWLA 1ENZA 1CDEA 1KSFX 3SYNA 2VXCA 4COKA 2QJRA 4IGKA 3K70D 3RI3A 1NUSA 3FMVA 4Q39A 3AB8A 3NRCA 2A8YA 1WMEA 3L0BA 3O8OB 5JI2E 2QV0A 1LVGA 2OE2A 1RQXA 3RS2A 1N0HA 1XWWA 5F5NA 2P8JA 4B33A 1ZNQO 5A3VA 4TV9B 5EHIA 1WQ1R 2Y2VA 1PRYA 3EQ2A 3B3JA 4OAPA 1ISMA 5C5EA 4QDXA 2QHXA 2DXIA 3JYOA 1FPQA 4Z7NB 2L17A 4MEAA 2C2HA 1PR4A 3C70A 4EI2A 1DEXA 4Z4EA 1U0HC 3F74A 1X6VA 3UJPA 2B6NA 2WYUA 1TA4A 4KKXB 3EEQA 5F4BA 2XT6A 3W6NA 1AC5A 3K1JA 1Y3BE 2Z57A 4H4EA 3PBKA 5I9BA 2G5CA 2ONKA 1K7YA 1RWBA 3G2HA 2YN0A 4L0QA 4QUEA 3U7EB 3WG9A 1KEKA 3ICVA 3L1VA 1GZDA 2GXAA 5K6AA 3HLKA 2HU7A 3JZDA 3PPXA 2CJWA 4R7ZA 4Y9DA 5COQA 3IP9A 2IXAA 1Y3FE 3DEFA 4HDNB 5AKHA 1CQXA 3UHAA 5EINA 2H2FA 3EW9A 2OV2A 4M0EA 5EQTA 3UYKA 1U9IA 5KYYA 4AF8A 4BVKA 4QJIA 2IDMA 5AM0A 1JTEA 2D7JA 3G5AA 4ZQCB 1U94A 4OREX 2QV7A 1NRWA 3DLTA 5CLFA 1X80A 2WM9B 4G4SP 4XWOA 1ADGA 4LWPA 4ZYZA 2F9MA 5JY1A 1FU4A 3FZYA 3BWBA 4B31A 2VPPA 5CEEA 3BZWA 3DMTC 1UPUA 1QO9A 2WYVA 3ME5A 1DS6A 3TPCA 1OWPA 2BM0A 4S24A 1DZIA 3B89A 4UTRA 4INOA 1SULA 5T4BA 5KYNA 1Y7TA 3VNVA 2EX1A 1C3EA 3Q5GA 5AKEA 1XDSA 4CCAA 1Q6ZA 4EG7A 4NJOA 3OJCA 1QLJA 3A58B 3C48A 1ZHOA 2POQX 4GSLA 2X4DA 4LDQA 1RLIA 5DM4A 4Z5XA 4W5NA 4O5AA 2ZXFA 3LD9A 3VMMA 3TCXB 3BT7A 3ICOA 4YRKA 1D07A 4ECEA 3C1UA 4LTNA 5THKA 1L0BA 4MPDA 4XDHA 1U8UA 3DLPX 2HYIC 3EY9A 1RPZA 1QJCA 2Q5EA 2ZETA 4KUHA 4LYAA 1DAGA 4WI1A 1RHJA 3IALA 4IJWA 4FHZA 3TI9A 3C45A 2VHJA 3WO1A 1JHUA 4FC7A 2X2EA 1QH8A 4GVXA 5C1IA 1QG6A 3TQRA 1XP8A 3AF4A 1NUHA 2Q6KA 5DXAA 1T9AA 1O08A 4ZN6A 1REQB 3WK8A 4HMPA 4K9RA 3W7AA 5BWMA 3O4HA 3GLIA 3JY6A 3U48A 2YV2A 1NUTA 4ZVKA 2AYZA 1H9BA 1NU8A 1PSZA 2AW5A 2QMEA 3JYQA 1MOSA 1W36C 1XPUA 4LPKA 4J0EA 1S1CA 1X1QA 4QQ8A 2HR1A 4RKRA 5JYDA 1Z6GA 3FRHA 1QFZA 3H4VA 1KGDA 1P72A 3C0KA 4GNRA 4DUGD 1MJ5A 5EWMA 2BZ0A 4L8WB 4UUBA 5HF8A 3PA8A 4RF3A 3P26A 3GNTA 2PKEA 4QFCA 5B2ZA 1N1EA 4UOEA 4ZOQI 2AJTA 3KB2A 3OHPA 3RAEC 4GI3A 4MR7A 3LP5A 4AAYA 1L7PA 3VPBA 4AS2A 2GI4A 2CZCA 5BNZA 5HDBB 2ZUVA 2DJIA 3TTWA 4UU7A 4U6SA 5F5XA 4AS3A 2ETVA 4UBMA 3MT9A 4RPKA 4BU0A 3E2PA 2W6OA 5FULA 5A9TA 1RHMA 3V7YA 1B2RA 3OPYI 3T06B 3F5QA 3W5CA 1Z29A 1W73A 2F43B 1ETUA 4IIEA 1C7EA 1C30B 1AXEA 1PJCA 3EF0A 4PSAA 5E4YA 2OHIA 621PA 2Z9BA 5CNIA 4R81A 1N2IA 2VXOA 1BS9A 1E58A 4ITUA 2RB5A 2NX2A 1NFFA 1STOA 3MINA 4B6EA 2PEZA 2ZBQA 1KYWA 1QIHA 1CV2A 2IPNA 2DPXA 1EX6A 1JU3A 1Y89A 2ZRGA 4FOSA 4F4UA 5F3WB 3E84A 3DUFB 4S0XA 3A9RA 3AY3A 2RJOA 5CG2A 3HNOA 2J3LA 5H68A 5BSRA 3UGJA 2VNIA 2MSWA 1NR7A 1EE1A 3R5XA 1O9GA 4KQWA 5I3ZA 3A9CA 2XODA 4FOTA 3KUUA 5ELLA 1EXWA 3HKDB 4URYR 3U3ZA 2VRCA 5FTKA 1U4SA 2GM9A 4U2BA 5HFJA 3RUIA 2VAXA 2ATIA 2J9GA 3UAGA 4CQMD 3N8DA 4P38A 1DFHA 4D8UA 4JY7A 4R8MA 1KBZA 1TU4A 1SKAA 5YASA 5KSPA 4MS4A 4MZDA 1P6QA 3F4KA 1Z4PX 5HQ3A 1FTSA 4ACBA 2P6NA 3KDAA 2Q5LA 1KDOA 4QPJC 2D7CA 3JWJA 4BL5A 5EXDA 4LJSA 2Y6VA 4BEWA 1CUXA 2HHJA 1NKVA 2VF4X 4M1SA 1UKEA 1GPDG 4RFLA 1F5SA 5LB2A 4QWWA 3WGTA 2G17A 1AQJA 1G3QA 2FE1A 3K73O 3GFVA 1CY8A 2YIJA 1LW6E 3B8HA 1Z2PX 4KIWA 3CCBA 4L5JA 4PLTA 5JD3A 3WWPA 3G7NA 4QGFA 3BK2A 3A6GA 1AS3A 1TEVA 3WMFA 1P80A 1TZCA 4PSDA 5DWQA 3EW7A 1RKXA 3R24A 5SZJA 4FN5A 4DABA 4DT1A 2BFCB 2PUVA 4EOGA 4CCYB 4L78A 3HEMA 5B3JA 4XRRA 1FJGB 1RCTE 4DV6B 1P45A 3UNXA 4B8ZA 1NMSA 3OQIB 1E9FA 4RVGA 4X00A 2OGWA 5A7FA 4MVCA 4K9KA 3GDWA 1T6XA 5H3LA 4DMGA 1G6Q1 2QT0A 1ZIYA 2VCHA 4B7UA 3ZWBA 3C7DB 3M6IA 1VPTA 4R31A 3R6DA 3STTA 4QZVA 1ZISA 2W9XA 1P2DA 4JA2A 4OYRA 1W44A 2NTYC 5DBEX 1TGYA 4J0KA 2EKDA 5I9SA 3Q8WA 4JT9A 5JADA 3CVOA 2A1UA 4Y9SA 3ZDXB 2I62A 4NYJR 3TSCA 1XXHE 1VL1A 1Q0SA 4Q3KA 1TI7A 4HYTA 4MRMA 3T7RA 1V5FA 4N5DA 2PPVA 3GA0A 4J2OA 1KZHA 1HDRA 3VHXB 3HU1A 4YJKA 3SHFA 1A7JA 1NZDA 2Y1OA 1MR3F 1I32A 1QMPA 2AE2A 3MJVA 4RMIA 3X1KA 5JCXA 3OJ0A 2VDNB 4G8BA 5ELXA 1R5JA 3EHEA 4FD3A 4LJRA 3H9EO 4MGZR 4L85A 3WGNA 2GK6A 4FM9A 3LY7A 1Q14A 1CF4A 1V26A 4A16A 3D7KA 3LVFO 3V42A 2X58A 4AMUA 3RDPA 3OOJA 3DZ2B 2NZUG 3KFXA 4NENA 5TE9A 4QARA 5CB4A 5LFAA 3LE8A 4NLLA 2VL7A 2YVLA 1IRXA 2RHMA 4QHSA 2PQ2A 1MAVA 3PUJA 5DWDA 1MHPA 1E6EA 4II2A 2IZ5A 4MRSA 3D6NB 5HKLA 3RVQA 1SD1A 2HHCA 4QYIA 1WP4A 3M2TA 3OD1A 4I50A 5JNUA 2CLKB 2WP0A 1GSAA 1UPCA 1TVKB 1MIOB 1RLMA 2J31A 4Q7LA 2PSSA 3CH5A 1QDUA 2Y1WA 5C9ZA 7YASA 3KUKA 5CA1A 4RPGA 5LMCA 4RHTA 5CA0F 3S55A 2Y1XA 3DA8A 4FP9A 3L4KA 2JEYA 4Z99A 4QICA 2AKAB 1J0DA 4XWWA 3TAXA 3CZRA 5JAPA 1SC3A 4PCLA 4PIVA 3EDYA 4M0UA 2XE4A 2H1OA 2W22A 3B78A 2OC9A 2AE1A 1DPGA 2FOIA 4O8CA 5FTMA 5IXYA 4PINA 1Q12A 4IZOA 3X1JA 1PL0A 1QFYA 3SF8B 3AL0C 2OV6A 4N5HX 1LBIA 1HNWB 4UVDA 2HCFA 4NZOA 1H2AS 2QTTA 4Y2QA 2GDZA 2QN1A 1DWPA 1JVBA 4MV1A 1KPHA 4E5PA 1JW9B 2P9GA 3FYDA 2DBYA 3WDMA 1LTKA 5ESXA 5TGTA 3WGKA 5JJ5A 3UJBA 3ZE9A 4INAA 4MJXA 5IANA 1BXKA 1Z2CA 3UPTA 2ICAA 3OCYA 4S1PA 1R8QA 4G0QA 4C2BA 1RRVA 2ZR0A 4EY4A 2YHAA 3BBLA 4DV4B 1JH9A 4GICA 4LN1A 1QIJA 1ACLA 5J63A 3LQYA 4HS9A 3ROEA 2QA5A 4GYYA 3LRPA 3W5AA 3UXYA 5TVKA 1JI3A 3F71A 3OG9A 3TUZC 1DIHA 1RPNA 2B61A 5BRNA 3E53A 1AQ6A 4FGZA 2GFQA 3ELBA 4KVGA 5AJZA 1RAEA 2IKQA 3NNSA 3AI1A 3N86A 4BZWA 3AUXA 3QEJA 3RC1A 4XIYA 5LP6F 3NTLA 2XCTB 1F0NA 4QTUB 3NC0C 1LZKA 3QMVA 4GKVA 5E7MA 4B3SB 1SIOA 1Z83A 1T4BA 1IE3A 1BCRA 3ZVLA 2COKA 4FHFA 4V0MA 3IERA 1MRZA 2IE0A 5IDYA 1U2QA 3JATB 5FBZA 1XQYA 3EWAA 1XRRA 4KGDA 1XD2B 1Z4NA 1OKKD 2AOUB 5BWOA 3JWHA 4QT0A 4IRXA 1ETHA 4R84A 3TW8B 1TYBE 3X1DA 1DO0A 2HWUA 5BYAA 1IJFA 2IZ1A 3EGCA 3TKYA 4D9JA 2IEDA 4G0YA 5FR2A 1JXOA 3EXG2 5ILOA 2BL4A 4WCFA 1LC0A 1J8QA 3KOMA 4KC0A 2YBEA 4I3HA 4BBPA 4WOJA 2QAIA 1Z0AA 3P0IA 4G67A 3HHEA 4UQPA 2ZRBA 2CVHA 1MB9A 3OQNA 1SKUA 1T0UA 5HRUA 1KSHA 3G8YA 4B09A 5ITVA 1JFVA 1PV4A 4MUEA 3CPSA 1PE0A 4JC4A 1I1QB 4TWIA 4K6FA 4ZZ1A 4BQEA 4CM9D 2M32A 1NXXA 2VJKA 5AK0A 3FIJA 2H2HA 2Q6OA 2Q4RA 4BKMA 4QUGA 5FEMA 1XGKA 4E0BA 4W5JA 4D4GA 2HJVA 4JU9A 3D6MA 4R69A 4Q9JA 1YQXA 3KEGA 2ZR7A 1WXDA 3QHAA 3V5NA 1J0AA 1ZI8A 2QM0A 4YUXA 4M1YA 1ZYUA 1JDZA 3GLFA 3IKJA 2O1SA 5D3QA 4QTTB 1PGOA 2HMWA 3M81A 2Y1EA 1JXAA 1YUMA 3AHFA 2OB2A 4F6RA 1MMFB 1XAIA 3BAZA 3BL8A 3SVZA 3VV2A 2EKPA 1V6AA 2GBLC 5JHGB 4ZARA 3B1YA 5JXWA 5EJ8A 4RKYA 1UM9B 2CMGA 3T7SA 5A6VA 3WNBA 2B4QA 4A73A 1U8XX 3AR4A 2WAAA 2PMBA 4WVLA 5JH7B 3DEJA 3EZYA 2HV9A