3DO5A

Crystal structure of putative homoserine dehydrogenase (np_069768.1) from archaeoglobus fulgidus at 2.20 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
324
structure length
320
Chain Sequence
MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTREGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative Homoserine Dehydrogenase (NP_069768.1) from ARCHAEOGLOBUS FULGIDUS at 2.20 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
molecule keywords Homoserine dehydrogenase
total genus 96
structure length 320
sequence length 324
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3do5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3do5A01
4BL5A 4DMMA 1CQJA 4GSKA 5JMPA 3QVSA 1F14A 3NKLA 5CDTA 3WYCA 3NDJA 1HLDA 5I8WA 2AG5A 2P91A 1YQXA 2QX7A 2Y1CA 1C0KA 4M49A 3EVNA 3LC2O 1GEGA 1SOVA 2X5KO 2UAGA 3ONEA 3F4LA 2OHXA 4BNXA 1N2SA 4QTZA 1W8DA 2GO1A 4FGWA 1XWFA 3UW3A 4ALJA 3DR3A 3V1YA 3HN7A 1QR6A 3DFZA 4WOJA 1GUFA 1GDHA 2PD4A 1IZ9A 1O6ZA 3PZBA 1BG6A 3GNSA 3GZNB 2JAPA 4OO3A 1ISJA 3EAGA 3ZCXA 1NAHA 2VTEA 4DL9A 3OSUA 3WTCA 3DZHA 2C20A 3GEGA 3JD1A 4AJJA 3UUWA 1U8XX 2DBRA 1BW9A 1WDLA 2C2XA 4NBTA 2P4QA 1NM5A 3DL2A 1HDZA 4CLDA 2FY8A 5G2OA 3LT1A 4LCJA 5A1TA 4RF5A 2I3GA 1EDOA 3KYCB 3MJ4A 5TQVA 1ISGA 3R6DA 4MVJF 1C1XB 5KJ6A 5L4NA 1JQBA 2GSDA 4YT5A 2NSDA 2JFHA 1JU9A 2ZB8A 5JO9A 5G0VA 3LQFA 2DLDA 3ZWPA 3PDUA 1X13A 4PFJA 1TLTA 2FPGA 4HNHA 4Q3EA 2GZ2A 3EK2A 2B35A 2OL4A 2HCTA 2VOEA 3GA0A 4TMFA 2X9GA 3HDHA 5CG2A 2GN8A 3Q0EA 1E7WA 2ZCUA 1XIVA 4NMHA 4IQ0A 1B15A 3GC6A 4W7HA 3LK7A 4TZKA 1OI7A 2QRJA 4TQGA 3GGGA 3WFIA 3JQGB 3MJCA 2BRUA 3FTNA 2RH4A 3JYPA 5DNAA 3JYQA 3A9WA 4YJGB 4LW8A 2QHXA 3S2EA 2X23A 2NVUB 5FI5A 3NTOA 2QRLA 4J7CA 2TMGA 1UP4A 4CLXA 1I3NA 2FWMX 3LVFO 3OF2A 3QWAA 5JO0A 2J3HA 2OBNA 3RROA 1I36A 2JJYA 3PZRA 2UUPA 3MWEB 3DO5A 4YYZA 3ZHBA 3GRPA 1YRLA 2B69A 1XELA 4GL4A 2ZKLA 3TWOA 3FPCA 1GCUA 3I5MA 4BKQA 5TX7A 3ZWAA 1M6WA 4XYEA 4BGIA 5COBA 4YT8A 3GFBA 2FMUA 3OMLA 2NVWA 4NJMB 3QWIA 4ZQBA 3BMQA 1QLJA 4BQRA 1WDKA 4Z9YA 3UFXA 4XGNA 3PWSA 1SC6A 2ZQZA 3R3JA 4XRGA 2GR9A 4XCVA 5EN4A 4CQMB 5A3JA 2EP5A 3H65A 1YOVA 5EIOA 5KJ1A 4LVCA 4D0RA 1BHSA 1ONOA 4WE3A 1MV8A 1R37A 3ORFA 3K5PA 3WQRA 3TZKA 4YRAA 1JN0A 4EBFA 2WD8A 5B1YA 2VUUA 4M8SA 1Y6JA 4L4SA 4RVDA 3CZMA 3SXPA 3E8XA 4YTEA 4L74A 1QP8A 1XCBA 1CJCA 2O2YA 4AJNA 4M1QA 4OJNA 1U4OA 1F8FA 2PZKA 2FR0A 4ZU3A 1DEHA 4LMPA 3KSZO 2EF1A 4J4HA 3ZU4A 2W2KB 4FQ8A 5THKA 3MTJA 4BNMA 2VUTA 3KHUA 5IFLA 1VPDA 4ZQGA 1RYDA 4WEQA 1QYDA 3RIHA 4X54A 2Y67A 1JAXA 1ZK0A 3GNQA 2CUKA 3WJ7A 3TOZA 4FPXA 4KP7A 5DOZA 5EJ2A 3ONFA 4UVEA 5LDGA 3Q9UA 1P1HA 1W73A 2B4QA 4J16A 1OZAA 2AHRA 4Z0PA 2X0IA 2RHCA 4CUKA 3HB5X 2OZPA 3GQVA 4N5MA 1ZK2A 2BI7A 3N74A 1LLUA 3RUCA 4CM8A 1O5IA 4UEKA 5JAZA 3F6YA 3PFFA 3AJRA 3KLPX 4A2CA 5I9NA 2BMAA 3DMYA 3OH8A 4F45A 3ENKA 3H9UA 3D5QA 3JYLA 3C85A 3W6ZA 2LDBA 3H4VA 4YAKA 2X58A 1LTHR 1ISMA 2RCYA 4GX0A 5CEJA 4DPMA 2B83A 3EW7A 5DZSA 3DB2A 4Q3DA 3W6UA 2I67A 4D3DA 1NQTA 2J3IA 1KYQA 4P22A 2X1HA 1H0KA 2JHGA 4O0LA 4TVBA 4KTVE 3WNQA 5U9CA 4FS3A 2BLLA 3RBZA 4ESOA 1OAAA 4E0BA 1MFZA 2PH5A 3B6ZA 3GHYA 4CMJA 3VDRA 1XQ6A 3NT2A 1ENPA 4FJ2A 1JKFA 2J8ZA 3T4EA 2XOXA 3GDFA 3WR5A 1YDWA 4I5GA 3L9WA 2O3SA 3WXBA 3FWNA 3GNTA 4MKRA 4CMBA 2EW2A 2QYSA 3OQBA 4BB5A 3Q6IA 4K9DA 3BTOA 3GEDA 4XGIA 1M75A 4JBGA 3H2SA 4BO0A 4RPLA 3BHMA 3WNVA 5L7YA 1C0LA 4QXMA 1I01A 7MDHA 2YHIA 3WGTA 1Z6ZA 3DDNA 3GOHA 4BNHA 3AU9A 3UCFA 4FC6A 3W8FA 1Q7CA 3KUXA 2YHUA 1AN9A 2DKNA 2OUIA 5CG1A 4R9RA 4R5MA 4DVJA 1U5AA 2VYVA 2V6FA 2ET6A 3SVTA 4FR5A 3VKUA 3MZ0A 5EQDA 4UUPA 1YL7A 2EXXA 4DWVA 3K31A 2I76A 4WCFA 1JTVA 1YKFA 1G0OA 3GHHA 4FFRA 4TVOA 1HTBA 5EL0A 1D3AA 1R4NA 2X7HA 4UVIA 2DFVA 2Y1OA 3G1UA 1WDMA 3KBOA 4CM7A 3BXXA 4PG4A 3WX0A 1P9LA 4B8ZA 2AA3A 4YJFB 4NJMA 4D0SA 4DIFA 3JQ9A 5EQFA 4D79A 3HNPA 1WXDA 4A10A 1BMDA 3L77A 4BQPA 4FFOA 2EHDA 1VL6A 1LNQA 1ZEJA 5CEFA 5DN9A 4RPGA 3WG9A 4IGFA 4AJKA 1ML3A 2GRAA 4NNJA 1E7YA 3JD3A 4CQMD 5TJHA 4R16A 3KYCA 3JQEA 3BTVA 4E33A 4WGGA 1Y9AA 4AL4A 4BO1A 4BNLA 5B4TA 1PIWA 5CP8A 2JD0A 4DREA 5T57A 2NTJA 2H6EA 3CIFA 1AGNA 1IY8A 2SCUA 3JV7A 1Z74A 2W2LD 4GVLA 2QIOA 3MJTA 3FWZA 1R12A 1NPTO 2HKIA 4ONEA 1BDBA 4OHUA 1KIFA 1HE3A 3FSRA 4J7UA 1X0VA 4AVYA 1ZXLA 3NYWA 3RI3A 4MINA 3DAGA 3ZWOA 3NAQA 4J2OA 1R16A 2VWGA 1D1SA 4RPJA 4II2A 3L6DA 1GCOA 1XYGA 1MG5A 2E48A 3DZIA 4KWIA 4IXWA 4L75A 4E5KA 3RVDA 3DBRA 4EJ6A 4PG6A 2ZQYA 4TRMA 1CERA 4WUVA 3FHLA 4JCOA 2FZWA 4HFJA 5KVSA 3ULKA 2QQ5A 4ZJUA 5DDIP 5EESA 1MX3A 1UDAA 2D5AA 4BB6A 1UP7A 3AI2A 3NX4A 1IHYA 3GG9A 2ZJ0A 4CM4B 1T1RA 1D4FA 3VH3A 2Q22A 1U1IA 3ST7A 4EZBA 4GGPA 1X1EA 5JY1A 3KV3O 4MVJH 1RM4A 3UHAA 1HEUA 4RJTA 1C1XA 2D4AA 3S1LA 4R9SA 4J2HA 3HFSA 4XDYA 1HE4A 1E1KA 1DRVA 5C3MA 3IJRA 2IXBA 2ZYDA 4R51A 1CRWG 2P5YA 2VCYA 3KZVA 1LLQA 2B5VA 3H2ZA 1Q7BA 3UGKA 4R1NA 2EEZA 4I5FA 4B3JA 2ZB3A 1R0SA 2G76A 4JJFA 1QXSA 3QV1A 2Z95A 4C4OA 1IPFA 4WJZA 3JQAB 3RJ9A 4AJHA 3BAZA 2ZJ1A 2PK3A 1KEWA 5B4VA 2ZTLA 2NU9A 2C59A 4FW8A 5KVVA 1ZMOA 4BOYA 4OQZA 1H9BA 1BWSA 1FK8A 1C3VA 1KEUA 1E3EA 4R1TA 3DZGA 4FIZA 1C0PA 4NBRA 1E6UA 2JKVA 3E82A 3I9JA 4WCFC 4DLLA 1U9JA 2CMDA 4O1MA 5HRUA 4OXNA 3OQ1A 5JLAA 4G65A 2PWZA 3CINA 4N54A 3ZU2A 3RCBA 3P2OA 5A5FA 5TLSA 3AOEA 1U4SA 4D45A 1CIVA 5TGDA 1VC2A 2HJSA 4RF4A 2GERA 5I7EA 1TVEA 2LDXA 4TSKA 4FSHA 5DOVA 1PS0A 1U28A 4KQXA 3KOUA 5TRTA 1X7DA 5CAEA 1ID1A 5JYFA 4GVXA 1B8VA 1DAOA 5DP1A 4H16A 1YXMA 1PTJA 5BQFA 1ISIA 1HWYA 4EEXA 4CLHA 1YVEI 2YQ5A 1WW8A 3NTQA 3W8EA 1BTOA 3WIDA 3NDRA 3PRJA 4UEOA 5COAA 5JCJA 3LLSA 2BI8A 3W4KA 1HLPA 5IZCC 3RC1A 2UUOA 2BFAA 5BSHA 3MJVA 1R4MA 1PJCA 4A7PA 1AUPA 3WGQA 2IEDA 3F46A 1E6WA 1C14A 3ZU5A 3GLQA 2W8ZA 3KVOA 4HFNA 4TROA 1R4MB 1KETA 1JA9A 3FNGA 3JQAA 4KUGA 2VHXA 1E1NA 1LBEA 2ZTVA 3ZWMA 5JFOA 1YH3A 2CD9A 2AE2A 1FF9A 3ZHYA 1ZJZA 1MXFA 5A4DA 4YJDA 3AWDA 4TRNA 5G0WA 3I6IA 3W1VA 4CMAA 3IKTA 4BNTA 1G1AA 5IXSA 3WQSB 1NVTA 1YL6A 4DIBA 1E7MA 1E6EA 3QSGA 2E6UX 1D7OA 4PLYA 1V6AA 4MVJA 1PZEA 4MIYA 4J90A 3OJLA 1PJTA 5HWSA 3AUUA 3OIDA 1B7GO 1QYWA 3A06A 4B4VA 4ZVVA 2Y1EA 3RD5A 4NFHA 4XDZA 5I9LA 4Z0HO 1B3BA 1JWBB 1Q0LA 3ZWYA 4PN3A 2WJPA 4GAEA 3JQAD 2C0CA 3RC7A 2H5LA 3H3FA 4E5YA 3CPSA 2GN9A 3AK4A 4J1QA 3ZNOA 4AJ2A 4WKGA 2C7VA 2BF7A 3PQFA 4B8WA 3DZBA 4IIVA 3PLNA 4PZDA 4TZTA 4E2XA 2HMUA 1ZK4A 5JAIA 3ON5A 1NNUA 1DIRA 3KLMX 4LMRA 1KVSA 1R66A 3S2IA 4INAA 3BA1A 2JL1A 1PWXA 5KTKA 1Q1NA 2CDAA 1P1FA 1TT5B 3H5RA 3LT0A 4XQ9A 4MO2A 1VM6A 5A5EA 2Y0EA 3PJFA 2PKQO 3GF4A 2GZ1A 1PEDA 4R69A 4P38A 1J5PA 2CFCA 3JSAA 4U5QA 3TOXA 1KC3A 4CLOA 2DTEA 3G79A 5IDQA 1LA2A 3AI3A 1FMCA 4FCCA 1RJWA 4WLFA 4DIOA 2UV8A 4NFSA 3GPDG 4E5PA 2Q3EA 5TT0A 4NFYA 5A9RA 1A9YA 2VYNA 1P45A 1T26A 1PJSA 3JQDA 3PPIA 2RHRA 4H7PA 1U3WA 4BNWA 1UXIA 2AQ8A 3KETA 4EEZA 1HSOA 3MOIA 1L7EA 1YB5A 2NQ8A 5BSGA 3HDJA 2UDPA 1PR9A 3V8BA 2WD7B 3U9LA 2OMEA 1WPQA 4BO5A 4PG8A 2R00C 3VC7A 4PLVA 1KS9A 1DDOA 5GZ6A 1VLLA 2DBQA 3MJEA 2DU8A 1MC4A 4UUNA 5A05A 3U0BA 3PJDA 3ZV5A 1QYVA 5G0SA 4OGWA 1YL5A 5AVOA 4I9NA 4Q3BA 4OSOA 4Q9NA 3HJAA 5M6DA 5IN5A 3C8MA 4CV0A 5JCXA 1PGJA 3B70A 2JCVA 2RIRA 3KO8A 1OOEA 3Q2KA 2YFQA 3R0IA 3DFUA 1ADFA 1T2CA 4ITUA 4GKVA 4DBVO 4FFPA 1TT5A 2JD2A 1C0IA 1HXHA 4RF3A 3LT2A 4XR4A 3JQFC 1QLHA 3IS3A 4ZD6A 3C24A 3BMNB 3IP1A 3WGIA 4BHTA 2I5PO 1P0CA 2R6JA 4CJXA 4GI2A 3ZWWA 4JBHA 3V2HA 3HZZA 5GZ3A 4NBWA 3VTFA 4Z9FA 3UCEA 2DFDA 2VRBA 3SJUA 3IUSA 3C1AA 3DOOA 3ANMA 2VYVD 2GYYA 3OA2A 1LRJA 1PJ2A 2NM0A 4HNGA 5B12A 5CEEA 5ITWA 3RUHA 1GTMA 2BD0A 4BV9A 4YPOA 3D1LA 2BHLA 1EK5A 3H9JA 1LDBA 4GX2A 5I8ZA 2BGKA 1NR7A 4OXYA 2WTBA 5A3VA 1W0CA 1OC2A 2ZTMA 1ZK3A 3V1TC 2V6BA 2FPPA 1BVUA 4IZIA 2CVOA 2DVMA 3GZNA 4AJOA 3DWFA 3RKRA 1SZJG 2W2LA 5T5QA 2QZZA 3PHHA 2X22A 4PLZA 3I23A 3KYDA 4G2NA 2VTDA 2PA3A 1J0XO 4I08A 4KDFA 3WLEA 1W6UA 1QKIA 4Y98A 5IDXA 3U4IA 4E31A 5JY6A 4PLTA 1ZW1A 4CQMA 4YRBA 1W4ZA 2CVZA 3QWBA 3RU7A 1VI2A 1WWKA 1RM3A 4F3YA 1T4DA 4EITA 2HRZA 4RQUA 3E6AA 3L6OO 3BMQB 3VPFA 4E2WA 4ZGWA 2WM3A 5L3ZA 4YBZA 1F8GA 3IMFA 3K2BA 2Y68A 3VPHA 1N1GA 4CQLB 3EVTA 1DB3A 2HK7A 4DQVA 2VHZA 4ZN6A 2AEMA 2QYTA 3EUWA 1F12A 4RVGA 1LDEA 2YDYA 5BNTA 4XX0A 4CMGA 2O7QA 3PLRA 5F1PA 3ROKA 2GASA 3EHEA 3I1JA 1K89A 3EMKA 4I5EA 4IZHA 3RUEA 1V3TA 3VZQA 4B7CA 4KMSA 1MG0A 3VDQA 3GVXA 1HE5A 4GX5A 1U2DA 1R0KA 3P7MA 4KUHA 5U1PA 1ZCJA 1H6CA 1DRUA 5ICMA 1ZNQO 2FSSA 5KKCA 3HWRA 2B5WA 3PWKA 4R4JA 2YUTA 1IZ0A 3VHRA 4BNNA 2VRCA 4QUKA 4S3MA 4MVJP 4Z0TA 4YAEA 1IHXA 2XF8A 2A94A 4CR7A 4EDFA 4RPHA 3KTDA 3H9QA 4CMIA 3ITDA 5C7LO 1CQIA 3GGPA 5T64A 4CM8B 2QW8A 1JLLA 2VZ0A 1QV6A 4O6VA 4CR8A 4M55A 1LSSA 3M1AA 1HYHA 4R1UA 5MDHA 1KVUA 4IINA 1NQAO 4L76A 1UZNA 1S6YA 1YGYA 4ZQEA 1XKQA 1BSVA 3HE3A 3T7CA 2FPIA 3K2EA 3GUYA 5ES3A 1FDWA 1DC5A 3L4SO 2ZB7A 2H1SA 4FJ1A 2PV7A 5H83A 4MVJG 1LSJA 4PVCA 2Q49A 3MOGA 1NFQA 2YV1A 4BGEA 2AW5A 4ZICA 1HDYA 2VRCD 2G5CA 4J9UE 4FC7A 1NVMB 3PJGA 3X2EA 4ALLA 5JXWA 3LT4A 2Y1DA 1WZIA 1ZFNA 4XEHA 4GWGA 5F5LA 4A27A 2VT3A 3Q11A 2V6GA 4CM9D 1GZ4A 1O0SA 1X1TA 5DBIA 3WYEA 2OXIA 3L0DA 3DEYX 4AJ4A 1ONPA 2YFHA 1SNYA 1HDCA 3F1LA 3A4VA 4DQUA 3LF2A 3I83A 1O95A 4Y8VA 4E2ZA 1O94A 1VJ0A 1M6HA 2FR8A 1ENYA 4UREA 1JAYA 1KY4A 4A73A 2EKQA 1P74A 4BNJA 4BS9A 1OFGA 2IZ1A 3ROPA 1U7TA 5JE8A 1A7KA 3I9MA 3VH4A 4NJOA 1VSUA 4BO4A 1B14A 4YVFA 4N5LA 4EYEA 2YQ4A 3TPCA 4NI5A 3B1FA 5AOVA 5FF9A 1NXQA 1H6BA 5BSFA 1ZZEA 4BKPA 4E30A 3WICA 5F1OA 5K0ZA 3ROQA 2B37A 2VZ9A 2GNAA 4PIVA 2WD7A 4F46A 3UKOA 2QG4A 2E4AA 4ALNA 4E32A 4LVUA 1SEVA 3ZGYA 1SEPA 5THQA 3W4IA 1FDTA 1HYGA 5KVQA 4YR9A 3LC7O 2WSBA 1EBFA 1A9ZA 5JDIA 2B4RO 1E92A 4YWJA 2HSDA 4MP3A 4CMEA 4D7AA 5I7FA 1QYXA 1TB4A 3IP3A 3AY7A 4DC0A 3HUDA 3G49A 3H9GA 3UF0A 1ULUA 5KKAA 1NFFA 4NG5A 3EC7A 4W7IA 4BNYA 4GQAA 1UXKA 3QVXA 3DAFA 4EGFA 5IN4A 2YY7A 2B4TO 1L7DA 4RVFA 4MVJM 5TSDA 4IDCA 4OOFA 3O38A 1U5CA 1ZJYA 3L6EA 1FDUA 1E5QA 3KYBA 4JROA 3SX2A 1Y1PA 1LQUA 2PR2A 1BRMA 5A9TA 4RDIA 1HSZA 2BKAA 2HMSA 4FDAA 4NK4A 4YQZA 3ZN2A 7ADHA 3RFTA 4BIIA 2BELA 4XWYA 3ZH2A 1N7GA 4D46A 2Q50A 3SLGA 1ARZA 3RJ5A 3MTGA 3QW2A 2OP0A 2HJRA 1J4AA 2JHFA 2Q1TA 1M76A 3CE6A 3IL2A 4PVDA 1Y8RA 1XEAA 2GN4A 3BHIA 1MXHA 2W4QA 2HO5A 1K6JA 2YZ7A 1HL3A 5JYAA 4Q3CA 4NIMA 4DUPA 4U6QA 1Q0HA 2ZYAA 2XAAA 4E2YA 3F1KA 4MKZA 3INGA 4XB2A 3ZV4A 3HDYA 4AJ1A 3BMOA 4LSMA 4CM5A 2D1YA 2X9NA 5G4LA 5ER9A 1HETA 2JCXA 3ENNA 1P0FA 5IDYA 1ZMTA 3AUAA 5TJ9A 2NVBA 3DBRB 4CM6A 4YQYA 2OO5A 3JQ8A 2NUAA 3ROMA 1Q7GA 5C5IA 2HLPA 4Y6PA 3OJ0A 4PLPA 3LYLA 3B1JA 4TKLA 4ILKA 4D44A 1RPNA 1NASA 3GH3A 1V8BA 1B16A 4GPD1 3ETDA 4JBIA 4JIGA 1UZLA 1N8KA 4NZ9A 1HYEA 2VYND 1GAEO 4TKMA 3GMSA 4FBGA 5HM8A 5B4UA 5AXAA 1WNTA 3DBHB 1ISFA 2X86A 2EG9A 3ZW8A 1L1FA 1T25A 4RZIA 2GDZA 5L95A 3BYZA 2GF2A 1XLTA 3C1OA 4UULA 4YAGA 5L40A 3TN7A 2Q4EA 3HQ4O 3JD2A 4CV1A 4J43A 2PNFA 4GKBA 3JYOA 4HV4A 2X6TA 1P1JA 2DTDA 4BMNA 3SBOA 2ZK7A 3PVZA 4CM9A 4RGBA 1ZBQA 3JTMA 2EWMA 5IF3A 4PLFA 2NQTA 4UEJA 5JDCA 2I9PA 1I10A 3M6IA 4PG7A 4C7JA 3TF5A 1Y5MA 2J5KA 5FEUA 3ZWBA 3F9IA 1YB1A 3DHYA 3IAHA 2VN8A 4PZEA 4AICA 4M54A 4NDNE 1E1MA 4FFNA 4MP8A 1TEHA 3RBVA 4WCFB 1I33A 2UVDA 3N58A 3P2YA 1HDGO 3PEFA 1HKUA 1BXGB 1UXHA 4BKRA 3KRTA 4BO9A 2NTVA 1NWCA 3INTA 4U6SA 4ND3A 1B0AA 4KUEA 4W4TA 1H5QA 3K8ZA 1NX6A 2CY0A 1ZUD1 1R6DA 5JMWA 1E5LA 1BVRA 3WGGA 1H2BA 1QV7A 2OP1A 3C1TA 1X0XA 4P4GA 4Y6RA 4OSPA 4UVHA 4DPKA 2EV9A 5KOIA 4YXFA 1NYTA 1EE2A 4KZPA 4EUEA 1E77A 5G4KB 3EDMA 5A9SB 3DBHA 1JDJA 1X7HA 4IBOA 2DUUA 2J3KA 4E21A 1SB8A 1O8CA 3G0OA 4HWKA 5IDWA 4BGVA 1P31A 3AY3A 5BNFA 1ENOA 4L4XA 4XB1A 4R3NA 2OORA 4Z3KA 2HU2A 3OEWA 2ZCVA 3NRCA 4TWRA 4R5HA 3GR6A 3TZHA 3WTBA 3I4FA 2VT2A 1KEPA 2P4HX 4K1LA 2YV2A 1M2WA 1I2CA 4MDHA 5GZ1A 3ADOA 2PGJA 3E1KA 1PQUA 4J4TA 5K6AA 4RZHA 1CETA 1A5ZA 4IMPA 1PJQA 4MVJI 4O63O 4QO7A 4IMRA 1JW9B 1CDOA 3DXFA 4IJWA 1A72A 1N9GA 5IAAA 3RC9A 4YAJA 4BGUA 1LSUA 1IOLA 4KDEA 3C7CB 2GUGA 1HT0A 3ZU3A 3PHIA 2Q1SA 2FOIA 4DC1A 4QEDA 4EUFA 1RYEA 1ZH8A 4XYGA 1XGKA 5G0TA 2O3JA 2J3JA 1YBMA 2A4KA 4GWKA 3VVCA 3PTZA 3HADA 4DLAA 1PU2A 4GMFA 1QSGA 3QJ5A 4J0FA 4YJFA 3GGOA 3K9QO 2C2YA 2R2GA 3C7DB 3WS7A 4D41A 4M86A 1QRRA 2P9EA 4I5DA 3O4RA 4BNZA 1VKOA 2DT5A 4XD2A 2HMVA 5AXDA 1X7GA 4XA8A 1BW9B 2Q45A 2Y0DA 4WLUA 2NU6A 4CUZA 3SC4A 3WSVA 1KOLA 4URFA 2CDBA 1N7HA 3VPXA 3ZZNA 1PS8A 4OL9A 4BMVA 3KSDO 1XHLA 5TNXA 1E3JA 3RFXA 1LRKA 4NBUA 5A03A 1SB9A 4IDEA 3CZRA 1B26A 3BTSA 3BMCA 3PHGA 4OM8A 3MCVA 1K2WA 3WJAA 1N5DA 1DLJA 5AYVA 3ITKA 3HN2A 2ZIZA 4DMLA 3I4CA 2UYYA 4HY3A 2V7PA 1LC0A 1PX0A 3FD8A 3SJ7A 2Y05A 1EVYA 1H6DA 1H2HA 3CSDA 2NV6A 3P19A 2IYOA 3WGHA 3GVPA 5LDHA 3BHJA 2R00A 1MFPA 3WBBA 2Q46A 3FTPA 2NU7A 1ZK1A 3A28A 2YYYA 5CDYA 4K6CA 3JQBA 5DF1A 4B3IA 3OFSA 4CM4A 2EERA 5C7IO 2IE0A 3JYNA 4NPCA 1T2AA 3LDHA 1Z7EA 4FFLA 1GD1O 4M87A 5CDUA 3VH2A 2X8LA 1E3WB 3FBGA 2VWHA 3WFJA 3I9LA 3PFWO 4JN6B 4Z6KA 1GPDG 4M89A 3CUKA 3IUPA 5JPIA 2ZTUA 1PQPA 4ALMA 3U09A 4PLGA 5IXYA 3E5MA 1C1DB 3RBXA 4CLOB 3FR7A 3IIEA 3RWBA 1I32A 5JBIA 4FB5A 1AXEA 2C07A 4Q39A 5L9AA 2VOJA 4HFMA 4GLOA 5T8KC 2PFGA 2H63A 3NJ4A 4YJGA 1P1KA 1E0DA 3RFVA 4FJ0A 4U0KA 3QE3A 2HAEA 2C82A 1PJLA 4OIMA 4Q3AA 3VPGA 3F3SA 3G17A 2CF5A 4PRLA 3RASA 2FZEA 4TRRA 2OGUA 1RM0A 4B79A 1AE1A 2D2IA 1UDBA 2WEKA 3EGOA 4CODB 5COQA 2B36A 4NR0A 1PL7A 5J23A 3DTYA 1NFRA 1H6AA 4J4BA 3TZQA 5KJCA 1U2GA 1H94A 2CSUA 1UXGA 5IG2A 3ZNPA 4UUOA 4WLVA 2YDXA 4J3FA 4JLWA 1NHGA 2WYVA 1Y81A 1YQDA 3G1TA 3FBTA 1DIGA 3KEOA 3DHNA 1XG5A 4OKNA 4LK3A 1J6UA 1EK6A 4J49A 4LCEA 4E5NA 3LSYA 3WMXA 2YV3A 1NBOA 3O03A 4R68A 5HBRA 3GDOA 1I8TA 3F5QA 3S2FA 1LJ8A 1P44A 3HFGA 3OQ6A 3RUDA 3AM4A 3BMCB 4U8GA 4FGSA 4ZA2A 5K6AC 1WMBA 5DCYA 1EE9A 2FR1A 3TZ6A 2PD3A 3S2GA 4K28A 4MVJD 4L0QA 2X0RA 1DC6A 3WWZA 2PD6A 3OIGA 4YAIA 2DAPA 4MIOA 2CVQA 2DUWA 2EW8A 3PHLA 4KQWA 1OMOA 4PLWA 3GPIA 3PIDA 4HADA 2D8AA 1BXGA 1EFLA 3TZCA 2QRKA 2DPHA 3AM3A 4O5OA 5ENVA 3RAJA 4CR6A 4II3A 1PJ4A 5BT9A 5L7WA 1EMDA 3K30A 3L07A 4PGFA 3FI9A 4B3HA 1LSOA 4BKUA 3NEPX 3D5TA 2HMTA 3FN4A 4P8RA 3PYMA 3I6QA 5MGBA 1YDEA 5A9SA 4WCDA 1VJ1A 5T73A 2HK8A 5BR7A 1PJBA 1M67A 3HDQA 5TS3A 3GY0A 3VTZA 1Z7BA 3W4JA 1K6IA 4UAGA 2GZ3A 1EUZA 1OBFO 4MKXA 1O9BA 2Y1GA 4NBVA 4BO8A 1DSSG 1V0JA 5H82A 1X15A 1N92A 1Y8QA 1IE3A 1UAGA 1WAMA 1AXGA 1PGOA 2PKRA 1J49A 5DP2A 1DJQA 4L8VA 1P1IA 1GY8A 1KVTA 1PGNA 3KYDB 4HFRA 4DGSA 1HZJA 1SAYA 3V2GA 5L53A 3VVBA 4WASA 4W99A 2QZ9A 4ROSA 5ER6A 5T8KA 4RVHA 3JQ6A 1A4IA 2BFMA 4EJ0A 4GSLA 4C7KA 2VNSA 5H81A 2VHYA 4DA9A 3VZPA 2VWPA 3K96A 4JP3A 3GZ4A 4W82A 5DCUA 4Z3DA 5B37A 4YT2A 1DC4A 3FNFA 2GN6A 3RKUA 3D3EA 2I99A 5GY7A 1EUCA 4FN4A 3SC6A 2NACA 1U3UA 3UH1A 2BFOA 1VL0A 2IYPA 2Y99A 2C7GA 1U7HA 8LDHA 1R15A 1DO8A 3O9ZA 2IDZA 3S55A 3F47A 4RO0A 4WLOA 3WBFA 1GV1A 1KBZA 3QA9A 4UVGA 1YB4A 5DULA 4K26A 2O23A 2YJZA 1DFGA 3A14A 1T4BA 3OJOA 3PIIA 3ETGA 3IKVA 4Y67A 1JKIA 3FR8A 3AFNA 5FYDA 4XGKA 2HDHA 2P9CA 3AFMA 4UUMA 5JAQA 2I3AA 1E3LA 4JGBA 3GVCA 3I9NA 3AUSA 1GZ6A 4IJKA 2O4CA 3KM0A 4LISA 4D42A 1DHRA 4IM7A 1B3RA 2TMDA 2IEBA 1IULA 4ZQFA 5ILOA 5JYEA 1MB4A 1VL8A 1FJHA 1BDMA 4NU5A 2NADA 1YBAA 4ZQHA 4EUHA 1ADBA 1U3TA 2HMWA 4UVDA 2WYWA 3HHPA 3DBVO 5ITVA 1YBVA 3QVTA 3STHA 4IQGA 1E7QA 5K9ZA 2GCGA 4IDAA 4BO7A 4NHEA 3LU1A 5L7TA 1F06A 3DMTC 4WNCA 3WYBA 4BV8A 3ANLA 9LDTA 1IPEA 3FPLA 5TIIA 2X0JA 3GRKA 3ONDA 1U3VA 1IYZA 2HK9A 3H5NA 4KWHA 3Q1LA 3AW9A 2DBVO 4CMKA 4D3FA 1EBUA 1AHIA 2ILTA 2VWQA 3TRIA 1ZXBA 4IJUA 3BTUA 3OEYA 5FWNA 1IB6A 4BNGA 4QECA 4E6PA 4FD3A 4DQXA 3JCZA 1GYQA 2J5QA 2PLAA 2ZB4A 4BUCA 4ND1A 1ADGA 2Q99A 2E49A 3DBLA 1XDWA 1CF2O 1K3TA 2I65A 3ZW9A 1DFIA 1LLDA 4RV9A 4DRYA 4EJMA 2F1KA 3QIVA 1QYCA 3GN2A 3TJRA 3HSKA 4GLLA 2EIHA 1EZ4A 5AQ1A 3ICPA 2G82A 3ZV6A 3K92A 1DIHA 1JVSA 2XXJA 3NV9A 4RVSA 2ZYGA 4YACA 2YW9A 2JFFA 2FRDA 3GFGA 3ICCA 3F4BA 3K6JA 4XIYA 1PR3A 1XSEA 4R1SA 4IJVA 1BGVA 4MPDA 1ZVMA 4XQCA 3JQ8B 4CV2A 1GZ3A 2Y93A 4PRKA 3QP9A 2RAFA 1ENZA 4AJLA 3PHJA 4RDHA 1EUDA 3ZV3A 3E9MA 3O8QA 2HQ1A 1KEVA 2FSVA 1TXGA 1WVGA 3U3XA 1IUKA 4IUYA 1PQWA 4N7RA 5CPFA 2C54A 4P4NA 4YB8A 1A71A 3RQSA 4OKIA 2VQ3A 4NK5A 1UR5A 4JJIA 3H9EO 4OH1A 1DPGA 2IRWA 4RVUA 1DIAA 2J6IA 3E9NA 4PG5A 1LDGA 1T2DA 3DONA 3PWZA 4ID9A 5HA5A 3M2TA 4JNKA 5I9MA 1GUYA 5L4SA 3H3JA 4BVAA 5JW6A 4LGVA 4MOWA 3SEFA 1PSDA 3B20A 4L73A 4QFDA 1XA0A 3NT4A 4ALIA 4HP8A 1NTOA 3JQCA 2WDZA 1Q2XA 4RL6A 4CM3A 1VKNA 3AU8A 5TF4A 3R1IA 1YONA 3L9XA 4LN1A 4PLCA 2E82A 3B1KA 1KY5A 4E12A 4JK3A 4PCVA 4YEDA 3GN1A 4I9HA 4WNIA 3O8QB 3ZWCA 4Y9DA 5KJEA 2EKPA 1ZKMA 1LU9A 4P4LA 5BNIA 3WQQA 1HDOA 3U5TA 4N5NA 2O3RA 3GK3A 1GQYA 5JSFA 1ZEMA 2X4GA 3D7LA 3LF1A 2GPTA 3LZ6A 3WLFA 1Z45A 4B7XA 6ADHA 1I3MA 2Q4BA 2WYUA 4OYRA 4HXYA 3G3EA 5F5NA 1YO6A 3RUAA 4JQCA 4WLEA 1I3KA 1EEHA 2AG8A 4CL8A 4DTIA 4NU6A 4RF2A 4O59O 1UUFA 3U4DA 4AJEA 1QMGA 3DZJA 2FHSA 1I3LA 1PZGA 5DBFA 2O3UA 5KNLA 1PL8A 4DXHA 2Y0CA 1EDZA 3D3WA 3GG2A 4YJHB 1K0UA 2A35A 3IQDB 1NQOA 4OXKA 3TL3A 1LRLA 1DJNA 2WE7A 3KXDA 3X2FA 4HX5A 3L4BA 1DC3A 1D8AA 5IZ4A 5HTOA 1OC4A 2C29D 1GL3A 1QG6A 1UAYA 3QWHA 1YS4A 4J9VA 3COSA 3JD0A 1LXCA 3P5SA 1ORRA 2PTGA 2Q1UA 2EGHA 4CV3A 6LDHA 4L9RA 1V3UA 3PGJA 2RH8A 2E37A 4EI2A 4JP2A 1Z73A 2JD1A 1E7SA 3NDIA 1T2FA 3PI7A 4RLSA 4CM1A 1YWGO 4HKTA 3DC2A 4XR9A 3CMCO 3NUGA 3ZDFA 2PGDA 2AEJA 3RSHA 3DOCA 4ND5A 1LDNA 3RUFA 1HZZA 1SO8A 3OBBA 2JCYA 5JC1A 3AOGA 4LRSB 3ZWNA 4IDFA 4B4OA 9LDBA 1MUUA 1NHWA 5HS6A 3D4PA 1GQQA 3OM9A 3SLKA 1G0NA 5DCWA 1ZSVA 2YHIB 4IGEA 4CLRA 5KJFA 5LCXA 5IZCA 3E9QA 2G1UA 4WLNA 3OICA 3JQBC 4QT0A 3VZRA 1GYRA 2J5RA 4IXTA 1S7CA 4BMSA 2AXQA 3ABIA 1A4UA 2DPGA 2VHVA 3CKYA 4IS3A 3QVOA 3NJ8A 2XPCA 1B8UA 5L4LA 1PGQA 4DBZA 3V2UA 1R0LA 1T2EA 3Q2IA 1N1EA 3UICA 4R01A 2EGGA 3WGZA 5G0UA 5A04A 3UOGA 3EZYA 5CFZA 4IQ8A 4RLHA 4ZRMA 4A03A 1YE3A 4R41A 2O3QA 2OBYA 3OA0A 4I9UA 3C7AA 1DBVO 3MEQA 4FOOA 4KOAA 1ZSYA 4I1IA 1YJQA 2DBZA 2X5JO 3BMNA 1Z82A 3DMTA 4RPKA 1ULSA 1LLCA 1AHHA 1VSVA 4H3VA 2CDCA 2HUNA 2W2KA 2Y66A 1ZIDA 4J1TA 2NWQA 1KC1A 5KIAA 1MLDA 4CMIB 3ZI0A 3GMDA 3AI1A 3AUTA 4D3SA 1LUAA 4BNVA 2DQ4A 2BGMA 2Y1FA 4J0EA 3RU9A 1U8FO 3F5SA 3FNHA 1UZMA 2CZCA 2NVUA 3EYWA 5AXCA 3JQGA 3GAZA 1BXKA 4XJSA 5ILGA 3ETEA 1Y8QB 2Q2VA 1PS9A 4JX8A 2CNBA 1E3WA 4G5HA 3WGYA 4J7XA 1IL0A 2G17A 3FF4A 2V65A 1GQ2A 2VHWA 1TI7A 4J1SA 1UXJA 2BGLA 1YQGA 4EW6A 4YT4A 5ADHA 1DAPA 3PGXA 1EVIA 3TL2A 5I7VA 1CYDA 4B4UA 4MP6A 5TT1A 2Z5LA 4AJIA 2PGLA 2XXBA 4B4WA 1DLIA 1I30A 4E4YA 4BO3A 1DFHA 4OAQA 3ZNQA 2P68A 2CF6A 3WIEA 1GEEA 1WP4A 3H5AA 2AEFA 2PY6A 2P2SA 3CXRA 1EQUA 2PZMA 5JNLA 1PZFA 1R4NB 3V1UA 5JS6A 4Z9XA 3FNEA 3UXYA 1DHTA 2RBEA 3RUIA 3UVEA 3GUCA 5HS4A 3UAGA 3I9OA 5F21A 3MJSA 3LC1O 1LI4A 1E3SA 4OOEA 1BXZA 4W9NC 1NQ5A 2F00A 1C1DA 1ONNA 3CEAA 2IXAA 1UH5A 4YRDA 5KWEA 1NPYA 2A9FA 4RORA 1P3DA 5EINA 2V6MA 4DPLA 1XR3A 3H7AA 1Y5RA 4WK6A 3GAFA 3PP8A 1HE2A 1GU7A 3ZWXA 1YOVB 1P77A 3QHAA 2I66A 3NGLA 4TRJA 4XRRA 1LDYA 5CDSA 1HDRA 3TDKA 1XQ1A 3C3XA 1MGOA 1NR1A 4A26A 4ZHSA 3IDSA 3M2PA 4JXKA 4W6ZA 3GEMA 2WWRA 4F6LA 5JDIC 1GV0A 3D64A 4ALKA 5I7SA 2AE1A 4YCAA 4XKJA 3I9KA 4R3WA 1QORA 5LC1A 2PH3A 2IZ0A 1GYPA 3PQDA 2WE8A 1V35A 2AQKA 3Q3CA 1WZEA 5T67A 3AM5A 2OOSA 4BO6A 4G81A 1KERA 3CH6A 4H15A 3U4CA 5JYDA 2Q2WA 2VZ8A 3OJEA 3OETA 3PK0A 3D3WB 2PZLA 4MVJE 1I0ZA 1T24A 2AMFA 2W90A 4XIJA 3AOEC 4FFMA 3ZHZA 5EPOA 4ZRNA 1N9GB 4QQRA 1UDCA 4CUJA 2BFPA 1LDMA 3JQ7B 4AG3A 5AXBA 3QVWA 3PYXA 4OQYA 3UCXA 2O48X 1V3VA 4WPGA 4XQGA 3E5RA 5L51A 4PLHA 1LX6A 1VRWA 3WSWA 1F0YA 1DXYA 3U4HA 2PZJA 3CMMA 1H93A 1UP6A 3VZSA 1B8PA 3QRWA 3BZUA 1KVQA 3QWFA 4IDGA 3NTRA 4WECA 5KCZA 3VOSA 3DOJA 2Z1MA 3EZLA 3GT0A 1WLYA 3I52A 3E48A 3I3OA 1NWHA 1RWBA 1RM5A 1FDSA 2VNAA 4CPDA 3S8MA 4L4RA 1I2BA 3INRA 4BNIA 1FXSA 4XQEA 1UJMA 4D43A 1DOHA 3PQEA 3QLJA 1Y9EA 2NLOA 1PL6A 5U4QA 5JAMA 3M1LA 4QX6A 4IY1A 5CHEA 1YJ8A 2DTXA 4OMUA 2D0IA 2D3TA 3DQPA 4F6CA 1ISHA 1SPXA 3DZKA 2O4UX 2JFGA 4IDBA 1I24A 1GPJA 4AFNA 1MA0A 3K73O 4KTTE 1EVZA 1Y8RB 2H9IA 1DRWA 3D4NA 4S1VA 3ZHXA 4XZ3A 5L45A 3ASVA 1TA4A 3TFOA 4NH4A 2OFPA 4RCVA 2FP4A 1NVGA 3WMWA 4CLRB 3RC2A 2O50A 1LC3A 4ND4A 2EP7A 4CLEA 4DYDA 4XYBA 4W9NA 1GFSA 1Y7TA 3WOHA 1MP0A 3QY9A 3T7EA 5F1KA 5GMOA 8ADHA 1PGPA 1B2LA 2GLXA 1D1TA 1HRDA 1I2ZA 5ICSA 1V9LA 4LRTB 3U49A 4AJPA 4BNUA 4PZCA 5CPBA 4GBJA 4XYMA 1ZO8A 4XJTA 1ZSNA 5DBGA 2HRBA 5JDCC 5DT9A 1G6KA 2VUSA 3WDSA 2NNLD 3HB4X 4MIEA 1E1LA 5CDGA 2I6TA 2AQHA 1E3IA 4E5MA 4IPTA 3L4BC 2A92A 3PXXA 4J6FA 4Q3NA 3E18A 1LEHA 1EFKA 3V5NA 2EJWA 1LQTA 2P9GA 3NGXA 3DZFA 3JQ9C 3O26A 4J91A 4HBGA 1M66A 4RQTA 4A0SA 1SOWA 3ADPA 3ASUA 4IDDA 5C37A 4XYLA 5EERA 5J9GA 4E13A 1JWAB 4IIUA 2DM6A 1Z75A 1E7RA 2EJVA 1H9AA 3JQFA 4N18A 1KVRA 3Q9NA 4GH5A 1P1RA 4HUJA 3TNLA 3D4OA 4QSMA 4CMCA 5A02A 4CMHA 1VJTA 2EKLA 3OIFA 3IOYA 1EVJA 2Q1WA 4A5OA 1CWUA 3TSCA 2D5CA 2X9VA 1VE9A 2C5AA 2X5OA 4J1NA 4BO2A 1EQ2A 3OP4A 1XU9A 2Q2QA 2AQIA 3PDJA 1SCUA 3OJFA 5JC8A 3ZNNA 3BMOB 1P33A 5ENDA 2P5UA 5KVCA 3PJEA 2NTNA 4U7WA 1PZHA 1WMAA 3BIOA 3HG7A 5G4KA 4BNFA 3MWDB 1GUZA 3KEQA 3KB6A 1MC5A 3VPSA 4BNKA 3W8DA 4B7UA 3H6KA 4NQZA 5C7OO 1GADO 3N7UA 1Q0QA 4K6FA 3EY4A 3TFQA 3U62A 1SBYA 5FI3A 1PJ3A 4DYVA 1F17A 2FN7A 1HF3A 1X14A 3VH1A 1GR0A 2O2SA 3GVIA 4Y6SA 4MJLA 1FDVA 2Z1NA 3AY6A 3GDGA 4QFCA 4WOKA 2JAHA 4ND2A 4LSWA 4QO8A 1CEQA 2O7SA 1O89A 3LLVA 5BSEA 3IJPA 4DLBA 5A06A 3FCOA 2WMDA 4YA6A 2GD1O 4YDRA 1K5HA 3DTTA 5F3RA 3VKVA 2B0JA 1NAIA 3DHEA 4GMGA 5T6BA 3IC5A 5FFFA 2IZZA 4R54A 3D0OA 1ADCA 4I8XA 4CL3A 3NT5A 3ANNA 4WEOA 2BH9A 4E3ZA 3R3SA 3WWYA 1DIBA 2NU8A 3E03A 1A7AA 2G0TA 5JCJD 3QQPA 1JKJA 1XU7A 4IS2A 3CTMA 1NP3A 3DAPA 2IODA 4FOSA 4U0JA 4CMEC 1K6XA 2X0NA 2D59A 3JQ7A 3VAZA 1A27A 1PWZA 3TQHA 3ZWVA 1T1SA 3PYLA 1I5RA 1TT7A 2O3TA 3GVHA 3OECA 2GGSA 3UN1A 1RKXA 4GX1A 1NPDA 2ZATA 5IJZA 4YJHA 2POQX 1HDXA 3DBLB 3A1NA 3WGOA 3T4XA 4GGOA 3WB9A 4BKOA 2DC1A 2W98A 1SMKA 1JVBA 2C5EA 5EMHA 2PKQP 5TC4A 3H8VA 3JD4A 3KSUA 4JJGA 3OHSX 3FRJA 4CQLA
chains in the Genus database with same CATH superfamily
2GTPA 5DHPA 5JNTA 1CQJA 5EWJB 2GN1A 4M7WA 4ZT7A 5KDOA 3QVSA 1HG1A 3KWMA 4TMYA 3WYCA 3FCEA 3LX4A 3NDJA 3H2HA 4B76A 2JS7A 3RK0A 2QA5A 1YQXA 3MQ4A 1G8GA 1ZN9A 4M1ZA 2ADFA 2BL4A 3KUCA 4M49A 2R8OA 4JL5A 1GO2A 3S2YA 1GEGA 2WUFA 1SOVA 3VU8A 2X5KO 2YKGA 1IN8A 1EFUA 4A6DA 1OAKA 4QTZA 1W8DA 3OD1A 2C7QA 4JJAA 5K3EA 4AZTA 4ALJA 9ABPA 1YR6A 1QGOA 2J32A 1VMDA 3HN7A 3MS2A 4P36A 5IHPA 3K16A 4WOJA 2PX6A 4JB0A 4AXXA 4FBLA 4ZAYA 2CHQA 1IZ9A 2D62A 5EMJA 3PZBA 1BG6A 5DNUA 3GNSA 4DQLA 4HEJA 1P29A 4YUZA 4RESA 1D2EA 4YALA 3WADA 4WBNB 3KAKA 1G7SA 3TSYA 2VTEA 3UWOA 3CWZA 2P6MA 3DB1A 1E1QD 2ZJFA 4HSEA 4RJJA 3MYYA 3VO9A 2H3HA 2C31A 3JD1A 4HRXA 1T9KA 1U8XX 1PT6A 3LJKA 4DIKA 3SK0A 1ECBA 4P2GA 2HX1A 4KWCA 3HK2A 1W19A 2X2OA 5DVZA 3AG6A 3DKIA 3G6KA 3PUYA 2D2VA 5G2OA 5A1TA 2MINA 2E89A 2NO1A 3TR5A 3ZDZB 1PI3A 4MVJF 3L7CA 3ZV7A 1MVOA 4A0HA 1JQBA 5BMOA 2GSDA 1J8QA 2QMYA 3KU1A 2IPLA 2QTTA 3QXJA 5LP6C 3K9HA 4Q4CA 2F8SA 4PNPA 4GG1A 5JO9A 2ZB8A 2NW6A 5G0VA 3DT8A 2L19A 1WB6A 2DLDA 3ZWPA 3LVRE 1IRIA 1X13A 2I91A 2FPGA 4Q3EA 4JT4A 1PYDA 4EA6A 3OG9A 4ODIA 4ZOLF 5AO9A 1TTPB 1KKUA 3DOHA 3NWBA 2B98A 4GR4A 1QRSA 1NI4B 2Q0QA 4H1TA 5CG2A 4LX8A 3Q0EA 3IV6A 2ZCUA 3CTPA 4FKBA 1T1IA 4N01A 1X3LA 4IQ0A 3ISTA 5CVUA 4AXBA 4EHBA 2C8VA 3GC6A 3ZKWA 3WIUA 4MRAA 3RVQA 4C1BA 2G9NA 4G8JA 3AEYA 3KJZA 1U65A 4HZUA 4IQFA 4M1WA 1TM3E 4P7KA 2BRUA 1QFJA 4DLWA 4JI2B 5DNAA 3F49S 4YJGB 4LW8A 3S2EA 1FX1A 4ERXA 2X23A 4ZAXA 4YUYA 5FI5A 3NTOA 1UJCA 1QGAA 4X44A 3CC8A 1QP4A 3IIJA 3FHCB 1K7YA 3K4PA 1N3YA 1UP4A 1I3NA 5CJ2A 4W5RA 1YCFA 3FX2A 4OLHA 2WJAA 4QKQA 4KQ9A 4M99A 3QLVC 5J2TF 4MB0A 4BEVA 2JAQA 3FW1A 5KTPA 2CVHA 4I1UA 3SIRA 4YUVA 3TCNA 2IP1A 4H1UA 1C2YA 3QVGB 4I46A 1JLSA 1TCAA 2RI0A 1C3OB 1T5DX 4W1QA 2QD4A 4D5GA 3PZRA 1VJDA 3MWEB 4CDGA 1NVBA 1DVRA 4XFJA 2JIZA 2BEUA 1PR6A 3RV4A 1F2DA 2IWHA 4AP9A 4YYZA 3VJLA 3EFBA 3LECA 3GFVA 1OI3A 2P2GA 2XTAA 3TR0A 2B69A 1VCOA 3MTAA 3I0ZA 2Q5FA 4DMGA 3NNNA 1N2CA 3IV9A 1DQZA 3FPCA 1XJCA 3E3AA 3EXFA 3GARA 4TYQA 5TX7A 2O8EA 1G4HA 3KAQA 3L4EA 4XYEA 1U2QA 4BGIA 4YT8A 5JNSA 4QOEA 2FMUA 2R25B 2QTCA 5TEVA 5CNIA 4AROA 3OMLA 3EC1A 1QCZA 1HQDA 1U02A 2BEKA 2PCLA 4NJMB 2P5SA 1BU8A 2LNDA 1B8NA 2NYRA 3QWIA 4LTNA 4QEZA 3TKAA 2PAFA 1QLJA 2PSSA 1QHHA 1JR3A 2OXEA 2YJ3A 3HFRA 4BQRA 2X3FA 5DGDA 4LVOA 2DR3A 4CIVA 1FP1D 1MVLA 1Y7PA 2GR9A 2OQRA 5EN4A 2R6R1 4MPJA 4CQMB 4DYHA 3EG9B 4F1KA 1E18A 3QG5A 2NXNA 2YWDA 1YOVA 4FXOA 5EIOA 5KJ1A 3T0IA 4D0RA 1BHSA 2Z4TA 5K6TA 1MV8A 1R37A 2FN9A 2YOGA 3NC4A 3HVKA 4J2TA 1LNSA 4YRFA 3WQRA 2I8CA 5B1YA 1Q17A 2W6OA 1DZ3A 3FFTA 2OBLA 1Y6JA 5IT9A 4L4SA 1XNGA 3DMFA 4M76B 2X1LA 1WHSB 2PZGA 3I6ZA 4H0CA 1SVWA 5D85A 1PFUA 1WKVA 2JGNA 1PV4A 1V1RB 4XSHA 4K3VA 1XCBA 1E2FA 1QOQB 1WCV1 1GKIA 3C3KA 3CFYA 1VL5A 2PGIA 4F5WA 3IHKA 5IABA 4D9BA 3DNMA 1KK2A 4FQ8A 4KN5A 1JIIA 3COYA 2Y2VA 1JJVA 1G5IA 4OXRA 5GOZA 5JZMA 2I7CA 2OHIA 1VPDA 2JLSA 1NJ8A 1RYDA 3K1JA 2CFOA 2DCUA 4WEQA 1C8BA 2GBCA 4X54A 3P26A 2Y67A 2WA1A 4OU4A 1N0IA 2NZUG 3QI7A 5GM2A 4M0KA 2M98A 3C3BA 1ZK0A 4M37A 2Y77A 5IFKA 2HPVA 1IZZA 2HRQA 5ERXA 3WJ7A 5DOZA 4ERNA 2C3UA 2ZT6A 1Z5GA 1ZG3A 5LDGA 1W73A 4GOND 2QDXA 2B4QA 2V7GA 4MZDA 1U9CA 2H4XA 4W1RA 4CUKA 2CCKA 2GJSA 4Y30A 5KEIA 5DNVA 1YNSA 3BJIC 2P9BA 2IKSA 1O4VA 1HQKA 3N74A 1QC5B 3RUCA 4CM8A 1O94D 1RRMA 3M7IA 4QBKA 5ALZA 3F6YA 1JEAA 2JRLA 2YX1A 3L0BA 5DM2A 5K20A 3GLHA 4A2CA 4RY0A 2WJVA 3IP5A 4I4CA 4AECA 4F45A 3ENKA 3H9UA 3L02A 1LPBB 3AFOA 3D5QA 3JYLA 5JSQA 1VI5A 1CVLA 3W6ZA 3OE7D 2LDBA 2VSNA 4Q7EA 1KKMA 1LTHR 3OZBA 4RPIA 4GX0A 4ZT3A 2FJPA 1US8A 3EW7A 2QL9A 3RFUA 1ESZA 3DB2A 2WICA 2D7DA 1GPYA 3K4HA 2BP7B 4JFRA 5DK4A 2QN6A 3W6UA 4UHJA 3TW3A 1G21B 1BH2A 4EG3A 1JALA 3JWGA 2D06A 3QFCA 4UOQA 1Y4UA 2O0LA 4P22A 2J67A 2X1HA 3RRMA 3VM6A 3L6CA 5FFNA 4C2TA 1JIXA 1T5SA 3LDAA 3OZVA 5K3DA 5U9CA 4FHEA 5J1SB 2ZIAA 2WWGA 4R2XA 4XUCA 3RBZA 2ATCA 2D7JA 2O2ZA 5LQCA 2YWFA 2X19A 3CNQS 1T4GA 2LVBA 4CMJA 3VDRA 5B58T 4B3XA 1JKFA 3W1EA 1OB5A 2DB3A 1R4AA 2H5EA 3GDFA 1WMSA 3WL8A 1YDWA 2CV2A 1LFAA 3TDNA 5TXGA 4FYPA 2O3SA 4I2NA 2PFKA 3GNTA 1L7MA 1TMYA 3FMVA 1AKUA 3TW0A 3Q6IA 2XZOA 2R4UA 3QJYA 2C2WA 3TSWA 3MFYA 3CX3A 2XRFA 1KGSA 2AC7A 3PCRB 2QL7A 3UGKA 1P91A 5JNRA 1RYBA 3H2SA 3MT0A 2BE9A 3QK7A 3V6MA 4PAWA 2XTZA 3BHMA 4RPLA 3WB2A 2QJWA 2QUHA 1C0LA 4L72A 5L7YA 4QXMA 2IF0A 4B3RB 2DJ5A 2XBMA 1EWRA 5JG7A 3AU9A 1FP4A 1L5SA 1RCTE 1KFKB 1K97A 1Q7CA 2B61A 5DRYA 3TJMA 3W8FA 5G1NA 3A2NA 3A2MA 5B3JC 2DKNA 2OUIA 1KAQA 4OP3A 3IEIA 4IJ5A 3QG1A 1X7YB 1IIRA 1F48A 2YJ6A 1L1RA 2UZ3A 1K3FA 2WR8A 3MZ0A 3JVDA 1KOFA 4G36A 2WAXA 5EQDA 4BLPA 4EQ6A 2I76A 2QRGA 1YKFA 4FFRA 3GHHA 3P8ZA 4Z4EA 5EL0A 1WR8A 1BX0A 3BWEA 2C98A 1W85A 2FF7A 2CNWD 3I4LA 4IDHA 1C29B 1XMVA 2DFVA 4JASB 4P83A 5K0LA 4F2HA 2EKZA 2CJXA 1QHIA 2YBEA 5KUTA 2ZZNA 2XLCA 5E4JA 1P9LA 3GLIE 3OLXA 1BAPA 4NJMA 1WPGA 5K8IA 1WXDA 1KFCB 2X0DA 3MJHA 1GAWA 4BQPA 4DV5B 2EHDA 3DGFC 5LKAA 1LNQA 2Z4SA 3TLYA 1E9CA 4RCYA 4ZTBA 4URWR 4O1IA 1AKQA 4R16A 5FV4A 2DWPA 2VXYA 3KXIA 3KOXA 4NCXA 2MSEB 5HKOA 5I7AA 3BL5A 4J76A 2JJ2D 4AL4A 4BNLA 1DBWA 5B4TA 5KNBH 2XEDA 3CLRD 3GGCA 4EGSA 4PHHA 4LF8B 2GA9A 4AKTA 4DREA 5T57A 1XFDA 1D0SA 3B7PA 2NUTA 4CEIB 1MZPA 1Z74A 3RVNA 1RRPA 5I9TA 5SZKB 4B4UA 4ZCIA 2HXSA 4K6GA 1VMKA 2MDTA 4L5AA 4ONEA 2J3LA 1V43A 1FNDA 3UWKA 1HE3A 3FSRA 1F51E 2WAOA 1FFWA 3ABOB 4TKVB 4AVYA 1KMCA 4E22A 5D51S 3N76A 5EIXA 3CUTA 3BILA 3NAQA 1L5LA 5KOHA 1HY3A 3A6LA 4RPJA 2JAUA 4AY5A 1MG5A 3DZIA 1TJ3A 4JBNA 2HW8A 4V2UA 5CNKA 2AFRA 3DBRA 4E5KA 5TPWA 4EJ6A 1J90A 2ZQYA 3PB3A 1XDUA 1BHQ1 3M4XA 5HQTA 1SXJA 2O5CA 4WUVA 4FSXA 3HR8A 3GJ5A 5D3ZA 1NGSA 2XTMA 1NUSA 4L6CA 3OCUA 4MCIA 2OGWA 4Y2UA 3SX4A 1QRUA 2WG1A 5DDIP 3Q6MA 1MX3A 1UDAA 1QYRA 3B3FA 3JASA 5AK3A 1E98A 3DA8A 5ECDA 2WT4A 2V9PA 2IYYA 1MH9A 3VH3A 2JBAB 2XNHA 3IPRA 3KR1A 1X1EA 5CCEA 3K8QA 3KV3O 3GA5A 4E15A 1RM4A 3I2JA 3UHAA 1HEUA 2X6QA 2PL5A 1DEXA 1O97D 2AK2A 5J2UB 3V7WA 5FPKA 1J23A 3S1LA 3G8CA 1FBTA 1F8XA 5LZ9A 1BU5A 2G0AA 3T3NA 1OLUA 1SCKA 2IXEA 1DRVA 1J2JA 1KXZA 1T6XA 2JFXA 2MU1A 2ZYDA 3DDHA 4JP8A 4MUYA 4FYKA 4ISBA 1JE0A 4RJ2A 5JRJA 1N25A 1IM8A 1K75A 2B5VA 2P1RA 2YYZA 4RZXA 5HKBA 2P41A 1XZBA 5LKRA 5ALPA 3E0QA 1N6PA 3MW8A 1II9A 3ZXYA 3KSBC 2VA8A 2VP5A 4UEWA 4PGGA 5CLQA 1WZCA 4DR2B 1QXSA 3QV1A 1PFQA 3HEMA 3JTEA 3LVQE 3O4HA 3LBYA 3P2IA 1TO6A 4HDSB 4KV9A 4MRVA 5F7ZA 1VKHA 2JF0A 5BYBA 3P32A 4OK6A 4MV0A 2C59A 5B4VA 2WNSA 2FW7A 2UZAA 4OQZA 3SYTA 1BWSA 2L2QA 2I3ZA 4MRSA 5IC5A 1V7ZA 2QQ0A 4ZOLB 3T5PA 3U1BA 3FE2A 3DZGA 1IH8A 1C0PA 1C9JA 2GWHA 3I9JA 4NBRA 2WWTA 3VI3B 3W05A 3FZEA 2CMDA 2CFTA 1XXHA 3VUEA 1W2HA 3OQ1A 5HRUA 2Q2NA 5JLAA 1EP9A 2ZPAA 3AUKA 1M8GA 1QBGA 2OV2A 3DMPA 4XJVA 5AJTA 4PW0A 3L0SA 4N54A 1OKKD 2CWWA 2UUAB 3RCBA 1JHXA 1BC5A 1QQ5A 3P2OA 4L0MA 5EFOA 4CF6A 5A5FA 1JMYA 3FTCA 1N0HA 2C5SA 4D45A 1Y34E 3TRHA 4A0FA 3OZRA 1XEWY 1C7FA 1BDIA 2QU7A 1JFSA 1NP7A 3AUJB 2VJDA 4KKVA 4O4IB 3D81A 2AWOA 4FSHA 1U28A 4KX5A 4U9HS 3KOUA 2B1JA 5DOVA 5ETJA 1G291 4DJ5X 1B4DA 4YNBA 2X2FA 3C6KA 3QUAA 5TRTA 3RRZA 2ZBVA 3QU2A 5EXEA 5EKTA 4NG4A 4AO6A 1N2OA 3EGEA 4LDZA 1KMNA 1K4MA 5IT4A 2BTOA 4KMRA 4H16A 2FLWA 4MGIR 1YR9A 2R6CA 3GP3A 3UT0A 5GIOE 4HX9A 4GRAA 3SXPA 2EWWA 4MR9A 4P3OA 3TTVA 4CLHA 4BP1A 4TTQA 4RS3A 4YAUA 1Z06A 2YQ5A 1BTOA 1TD1A 4IDNA 3T5GA 3T1YB 3QEBZ 2CV1A 2FFRA 1AK2A 4IKPA 1QP7A 1B76A 1GSAA 4F3CA 3LLSA 2AFHE 4XI9A 1CEXA 3DZDA 1HLPA 3G9QA 3ZBTA 3L46A 1W88A 2BFAA 1RWWA 3CHYA 3BQ9A 2MOKA 2X76A 4KXWA 3MJVA 1TZ2A 2ISCA 3BJMA 3HLKA 4PPNA 5AOCA 1AUPA 4WFKA 4D0NA 2HWWA 4F56A 1MO3A 4IO1A 2RAVA 5M04A 4AKHA 1E4EB 3LUGA 3PR2B 4FYJA 4PPQA 3ZU5A 4C9BA 1P9NA 4HH3C 1LZLA 3H2GA 3NRJA 1M6NA 2IHZA 1RQGA 2W8ZA 4FYVA 4KCGA 4QULA 3KXKA 3L92A 4TROA 3VHXA 1UEIA 1OH8A 3AB7A 1SOMA 3FNGA 1FVHA 2PVSA 2OCGA 2QMHA 3GFSA 3ZWMA 4ZV9A 4FBMA 2PO5A 2J0EA 2PL1A 4JAVC 1ZJZA 3ZHYA 1MXFA 5A4DA 2ZIWB 3EVBA 1OF1A 4DUGA 3B8HA 3M6MD 3P2KA 3QX8A 3FJYA 2A1TS 1KOJA 3L40A 4JT9A 4CMAA 3IFSA 4BNTA 3N2IA 2AVNA 2DYKA 4S35A 4BFVA 2XLBA 421PA 4DIBA 3TXXA 4C20A 5JCZA 1U6JA 5TMBA 3ZHRA 5AVZA 4WZAB 2E6UX 2V54A 4ZALA 3O4FA 1XZHA 3RK1A 3I5XA 4MVJA 3PGVA 3PQ7A 5HKKA 3GRFA 4J90A 3WRYA 2OKCA 3LY7A 4MUKA 5HWSA 5ISMA 4OI1A 3TG2A 1Q1QA 2C1XA 1YA8A 4B4VA 3COVA 1Q0TA 1FTYA 4JI5B 1OFVA 3IQIX 4X45A 1H2YA 2OECA 1T5LA 2WJYA 4X7MA 3JAMA 4GAEA 2HZBA 2G25A 1ML4A 1SD1A 2C0CA 2ZJ8A 3PPXA 1VBFA 3CXUA 3GEPA 4DE5A 1QR2A 4CCSA 3KVVA 3W2IA 1HR0B 3AK4A 1YJAA 4J1QA 4QHTA 3ZNOA 4AJ2A 4B8WA 2BF7A 3PQFA 4EBBA 5JXHA 3DZBA 4NCBA 1KZHA 3LOQA 3M8KA 1ORDA 3VV3A 1EJ6A 4LJSA 3CN7A 1RXYA 2XA1A 4JU9A 3ZG6A 3DDZX 3KUDA 1DIRA 3KLMX 3L0OA 1KVSA 3D8NA 1EFVA 3PENA 3AF1A 1R66A 1PEKE 2F48A 3BA1A 1P8JA 3E2MA 2JL1A 4RSHA 3M1YA 4XQ9A 2WHRA 4Q15A 1BIFA 1AHNA 1QBKC 3WWPA 5A5EA 4V38A 2X6RA 2COEA 5I7UA 3MRVA 3CSUA 1IHPA 5I4BA 4DFDA 1XMXA 4DNXA 2EBUA 1S02A 2CFCA 1KC3A 2RI1A 4L4YA 3G79A 5ADWA 2ZS9A 4OBXA 5HKLA 1TUEA 3VYUB 4KPUA 1KZ7B 2HV9A 4WLFA 5FL7A 3OY7A 1AZSC 3W5CA 4KAXA 3REQB 3GPDG 3R6TA 5KHLB 2Q3EA 1IWBB 2BGUA 1DG1G 5DYYA 5BYJA 2GNOA 4URHA 3AF6A 3AKZA 5JU6A 1JH9A 2ZREA 4DNPA 4GPTA 1GTL1 5F4ZA 1PJSA 3JQDA 2PUVA 2RHRA 3EY9A 3PUVA 3SPXA 4N3GA 1KR2A 1U3WA 1XEWX 5ALUA 3A04A 3CKLA 1R74A 4ZEXA 1CQZA 2CJWA 4EEZA 3KETA 4KQJA 3IWDB 1YC5A 4HRVA 2VR1A 4Q66C 3EZ6A 1VA5A 3HCPA 4NJEA 4GPBA 1J2EA 2UDPA 3V00A 1Y82A 3RFCA 1RLMA 1FYXA 3P0FA 4OGKA 4QYMA 3HTXA 1WPQA 1U6KA 1XLTC 1Y98A 5K0SA 4PG8A 1NONA 3VC7A 5IK2D 1G2IA 2V7QA 4PLVA 2G71A 4JLVA 5FBQB 3S40A 3UAOA 1KS9A 4TN5A 2WIDA 3F6SA 1Y1TA 4GSYA 4JENA 4FONA 3TBKA 4UCFA 2DBQA 3FFBA 2JKYA 3UNXA 5LD2C 4LF6B 4N6OA 1YMUA 3NOXA 2XUGA 4E7PA 1R9MA 5IK2A 1EIZA 1YL5A 3QKWA 2YNMA 4OSOA 4B3GA 2WG0A 2ZUWA 1QH1B 2EJUA 5KTOA 4RD0A 5M6DA 1NULA 4TVSA 3OMXA 1ZN8A 1QRTA 2QI9F 2OCYC 3SS9X 4XDGA 4MRMA 4ZYVA 1EHIA 4L8YA 3R5SA 3N1UA 3PT5A 3ZIDA 3V34A 2BFCA 4OHYA 4ITUA 4UBKA 4EHKA 4DT1A 4DHEA 1C0IA 4E7OA 4RF3A 4DDKA 4I14A 1Z5UA 4XR4A 2FYTA 3A9SA 4EFNA 2WM2A 3EZ9A 4GI7A 2AT1A 4PX9A 3WMRA 4MW0A 5B1EA 5LQJA 5AESA 1P4GA 4ZD6A 4I66A 5H7XA 3KB1A 3B6JA 4BHTA 3PUWA 1TZKA 4UD2A 1X8KA 5DM70 2QVYX 4R9UC 1V47A 4PWYA 3V2HA 5LP6B 1A2BA 3CVUA 3FYUB 3TIVA 4BCDA 3PKJA 4MQ4A 4QBHA 4NBWA 1G9XA 2HC9A 3VTFA 4OBWA 1USIA 4QU5A 5KQPA 5EZYA 4IIJA 4O08A 4I36A 3C1AA 4O8CA 4AT1A 2Z5FA 2VYVD 1C4KA 1L5ZA 2YW2A 4JC4A 4DCOA 2BKEA 3OA2A 1LRJA 3AP1A 4HNGA 3SDSA 3UWMA 4QE3A 2LXNA 5ITWA 4BV9A 4CKWA 1V95A 2HIHA 4HI0E 1EK5A 4PHGA 4XASA 3AXTA 3ISVA 1LDBA 4GX2A 3HV0A 3FWKA 4OXYA 2WTBA 1Z7WA 3BXHA 4G24A 4M60A 5A3VA 4YP0A 3QKRB 1OC2A 4EIWA 2ZTMA 3UQYS 1QZTA 1ZNXA 2OMKA 5LJIA 1BVUA 1SIWA 1HDIA 3L0IB 3O8BA 4FX5A 1P7CA 4ZAFA 1I4DD 5T3UA 4BLWA 3A4IA 3SEQA 4MRMB 2DPMA 3PQCA 3RKRA 1RZ3A 2W2LA 3FVTA 2D5BA 4X7PA 3I23A 4G2NA 4TTPA 1J0XO 4KDFA 5DWQA 5IYZA 1JSRA 1O94C 2ZJ2A 4UFPA 3DAYA 4LEIA 5JH7A 3H16A 1BQ4A 2O07A 5AOBA 3TQCA 1QKIA 4B34A 5IDXA 3L7YA 1CZUA 2DLNA 3DE5X 4O2BB 1G19A 5AICA 2D2EA 5JTTA 2HTEA 4EQZA 1W4ZA 2FG7C 5LA6A 1WWKA 1ZD3A 4GM0A 2ZI7A 1BCSA 3BBLA 2HRZA 2CL7X 2Y1KA 5FWXA 3LAWA 3E6AA 1LBSA 1UC9A 4ZGWA 3V4VB 1KI6A 1CFZA 1M6EX 1QK5A 2WM3A 1WKCA 4GPAA 4WESA 4B44A 4EGAA 3GYGA 4WH0A 1GNLA 3UENA 1N1GA 3HCDA 4CQLB 5I47A 2YL2A 1YULA 3TS1A 1ODSA 4MJ7A 1I9GA 4DQVA 1Z0SA 2XZLA 2VHZA 1DO0A 3EUWA 3CPJB 4HAOA 1TOAA 2H1FA 2YDYA 1QRDA 3C3DA 3ESYA 4RVGA 4CMGA 1K8QA 2ZRLA 2A84A 3KT0A 3WA6A 5DXAA 5F1PA 3ROKA 2GASA 4IZHA 4V3BA 1K89A 1MC8A 2H5JA 4F4HA 5CCXA 2JLUA 3A1UA 3VJRA 1ZAYA 2KWIA 2W93A 2YWHA 2RB5A 1RPAA 1ZUNA 2P3OA 2ZYHA 4H59A 4XM1A 1VBNA 3AVYA 1U90A 3FOEC 5D5PA 4YROA 1CY0A 1ZCJA 1UC8A 1ZWLA 1DRUA 1LKZA 2R48A 3U9SA 5BSKA 2WHYA 2F3TA 2GRJA 2EDCA 4QDOA 3E0XA 4BNNA 4LAFA 3FROA 4S3MA 4MVJP 2WHPA 4LY3A 3HXMA 2HL6A 4NMWA 2QPAA 2GPSA 4F92B 4C4ZA 1VOTA 1IHXA 1IMJA 1Y33E 2I2DA 2QZSA 2VHTA 4UHEA 1R0CA 1Z36A 3V8RA 4BBAA 4B31A 2F4VB 1E9AA 4IRMA 4AZ3B 4FGZA 3VR5H 1RBQA 3GLIA 2I78A 3ITDA 1H2AS 2E4XA 2VAPA 3B1YA 2O2GA 1CQIA 4U4AA 4KOEC 5T64A 4CM8B 1W1IA 2QW8A 2XECA 1JLLA 4QJ3A 1YACA 2YWEA 4O6VA 1QV6A 3GDWA 4HZGA 2X4DA 4RJLA 4WVFA 4ZI5A 4CR8A 4ENRA 3M1AA 4R1UA 3DHVA 4IINA 3FJ1A 1V26A 3MB8A 2REXB 5A62A 3O9VA 1JT2A 2BT4A 2WLSA 1BSVA 2R8YA 3O5AA 1IC6A 3K2EA 3GUYA 1JLRA 3U48A 4C22A 1F3OA 1YQQA 3D1VA 4P54A 3L43A 1JEDA 3GFQA 3BIWA 3GW8A 3T38A 2W8BA 4BFCA 1RC1A 3D6JA 4MVJG 1X86B 2Q28A 4PVCA 4XWGA 4C78A 4ZCTA 3QEMB 3MOGA 4DCUA 2J4CA 1T8WA 2MYUA 2Q27A 2GBLA 3NBMA 4K9QA 4OXQA 4HPJB 1F3LA 3S5UA 3VR2A 5LMNB 1JJAA 2G5CA 2YMLA 5DK6A 1NP6A 1EFDN 4OM7A 3MWEA 5DW0A 2OBMA 2IWRA 5IVKA 1FFCA 3TTXA 5C8YB 1YKSA 1GPH1 3LA6A 4Q9DA 2X2EA 3TLAA 1MTOA 2ZUBA 4M0PA 4CRWB 1B93A 1AKVA 1J21A 1ZFNA 4GWGA 4L27A 3THYA 1ATZA 1MQAA 3BDIA 3Q11A 3L7BA 2V6GA 2V7XA 2GAOA 2AOUA 4CM9D 2IEGA 1Z83A 4AZ3A 5LD2B 3DD1A 3WYEA 3MLEA 1ZJ4A 3L0DA 3R40A 3JASB 2OXIA 4WDRA 2P65A 1ZD4A 4OQMA 1CR4A 1LVHA 1NSYA 2OFXA 2NZJA 3AHDA 3A4VA 2GRUA 1LH0A 2PX8A 2ZSUA 5DGIA 5IAOA 4UZFA 3VBEA 2D2FA 4EB6B 1M6HA 2FR8A 4UREA 4LBWA 2AC2A 1JEEA 1E4OA 2H31A 2HSWA 2XDAA 4BNJA 1KJNA 4C6HA 1OFGA 2HXYA 1ZUWA 5JD4A 2CD7A 4JA0A 4Q93A 2IPNA 1K5PA 4HLDA 4BO4A 3D6UA 4D56A 1NI4A 3UFXB 3F96A 3NBXX 3WNDA 4KR3A 3Q5EA 4D4MA 1UXOA 3WYGA 1R6AA 1M0TA 5FF9A 3RYTC 1YZNA 3VOBA 3VKFA 1RLOA 3I1IA 1AKNA 1AQYA 1RABA 5ICFA 3WICA 3ROQA 5SV2A 3FUCA 1VB3A 1BQEA 1AB5A 2J1LA 5FTJA 4UHDA 1CS0A 3VPCA 1TU3A 1KMHB 3DCJA 4LVUA 4PQRA 4TTIA 3BXPA 2ICAA 5E38A 4PE5B 2QYOA 1F6BA 1M2OB 2PH7A 3E9DA 4YAWA 1FDOA 2Z2XA 3GZTB 2ZUTA 3JR3A 3LC7O 1VG8A 2HDNB 4I50F 3SZOA 4YR9A 5GJCA 1A9ZA 5JCOC 2FEPA 4DM7A 4ITVA 1U8CB 2PMBA 2G9QA 2YWXA 4TV9B 2Y0BA 2IU0A 4D7AA 4YWJA 2CHVA 1NN1A 2HSDA 2HU8A 2Q3JA 3F3MA 5BPFA 4ZK6A 4PBSA 1AD2A 4QQKA 3AY7A 3REFA 4U9UA 3HUDA 1NW3A 4G5RA 4DCVA 4C2AA 1NFFA 3WV5A 1DKMA 1K9VF 3TQSA 1UXKA 3QVXA 1PJRA 3DAFA 1ZZGA 4ZT4A 3V80A 1THTA 2C7PA 2UYGA 2HRDA 5IN4A 1J2UA 2B4TO 1UM8A 3EMDA 4RVFA 1YDFA 2IU4A 4TQAA 2VPZA 4MVJM 5TSDA 4IDCA 1PJZA 4S24A 2PGOA 3O38A 1QFYA 1GL6A 1ZJYA 4JROA 3MWYW 1JSXA 3KYBA 5FO0A 3VYVA 3QE9Y 3C70A 4Y2TA 1QB7A 1LQUA 3T9DA 4ZZ2A 2PR2A 1P81A 2PGNA 4F2DA 3DFFA 4RDIA 3LD9A 1HSZA 1R0ZA 2PHZA 3ZXXA 4FDAA 2WIGA 1NMEA 4YQZA 3AVVA 1H1DA 5F3WB 1SXGA 2V6JA 2QM0A 3F97A 4FLMA 2BELA 3VO8A 4DV6B 4ITRC 1V37A 2MSCB 3UJAA 3MRXA 3ANYB 2X9LA 1U04A 1MZVA 1YGPA 4L9WA 1NVWQ 4REQA 3MTGA 4BWGA 3QW2A 2OZKA 1JX6A 4RKFA 2K2QB 2HJRA 1GFIA 1LCIA 2IVFA 3CE6A 1F4PA 2HJVA 3EXIA 4IFEA 1XEAA 2GN4A 4YLYA 3QPCA 1MXHA 3VA7A 2XOKD 3UAWA 4DA4A 1QIGA 3AB8A 2YZ7A 4N4AA 1HL3A 2GSWA 3OT1A 1QHNA 2GJ9A 3JWHA 4FXPA 5IRCD 4OG2A 4LOKA 1TMOA 3GELA 1MOSA 4QOIA 1Q0HA 5AVKA 2J3EA 2XUIA 3R09A 3F1KA 4GS5A 4X1YB 3IOBA 3INGA 4FCWA 4NABA 2J09A 2A5FA 2XZPA 2JFBA 1ZC4A 3QXHA 2D1YA 3N75A 4HR7A 2GKOA 3HJBA 5ER9A 1DJOA 1HETA 3P9CA 4HNTA 2JCXA 4LI3X 1AX9A 5IDYA 4M1OA 3MQ2A 4Q1EA 2VSXA 1UOPA 2J7KA 3KKQA 3AUAA 3JAWB 4ZQIA 1AS2A 1CRQA 4V1CA 5TJ9A 4L2IA 3DBRB 4CM6A 3SF0A 2QL5A 3NB0A 3WLKX 1QK4A 1Q7GA 2JFNA 2E9SA 4MWGA 1NBHA 3RVPA 1HNZB 2P2ZA 3CYFA 4TKLA 2L17A 3HEBA 4ILKA 4UPVA 2HJHA 4P3YA 3LPDA 5K0BA 1B16A 3RAFC 4D80A 2VDJA 1N8KA 3FMPB 5HM8A 1N34B 3JAKB 4WINA 2ONZA 2EZUA 1GZHB 3GUUA 4Y2VA 3WXMA 3UMMA 2CB9A 1ISFA 2EG9A 3G2JA 4UTXA 1KR5A 4FEEA 4AZSA 4S05A 2HD4A 4MR9B 3BYZA 4WZBE 3EPHA 2VBFA 4PTYA 1O03A 2Q4EA 2CXOA 1C50A 3C8UA 2GHRA 2X7JA 4UUQA 2QLTA 4ANFA 4PPYA 3N8DA 1UC5B 3RANA 1P1JA 4M8LA 3AY0A 3B82A 3UHFA 3WKBA 4FFWA 4C3OB 4DDTA 3J80A 2ZK7A 2XI4A 3L0ZA 3TLGB 4WQMA 4CM9A 4Z86A 1GPKA 3O31A 5T7BA 2QB5A 2EWMA 4PLFA 4CCAA 4F3RA 4EL0A 5EJFA 5BRAA 1RAGA 5E6UA 5JXIA 4KGDA 5JDCA 2QNIA 2ATXA 3E7PA 4Q7KA 3FPBA 3AP3A 3M6IA 4PG7A 3GUVA 4W5HA 3TF5A 2J5KA 4LOLA 4U7JA 4AG6A 4UBJA 4AICA 4RNCA 4M54A 2O5EA 3RARA 1PDWA 3TIFA 1SKMA 1C81A 4RENA 1II8A 4G41A 4WCFB 1SBTA 3PKIA 3GLIB 2G7ZA 1N8NA 1QIHA 3CH4B 1AQUA 4Q4JA 4WFQA 2IX9A 1BXGB 1UK7A 3HI6A 2AN1A 1J42A 1GXSA 3KC2A 3DLCA 4AZVA 1NN3A 1SBNE 4BKRA 2A1TR 2FRDC 1IN4A 1Z56C 1Z6QA 2BV3A 2NTVA 3NFRA 4CNQA 4ZANA 1KJWA 4RIHA 4NTZA 3CW2A 1BFKA 2REQA 3KUKA 4ND3A 5LOVB 2J0SA 1B0AA 4HXFB 3D3NA 3O9MA 4RQBA 4P7GA 1OSNA 4KNVA 4W4TA 4F5ZA 3VISA 2VJKA 1V11A 5IAGA 3LOPA 1CUEA 3QBDA 1JBQA 3SI7A 1XP5A 1QONA 3BSWA 1SCIA 3GV0A 3L1VA 1ZUD1 2H4YA 3EIEA 2ZVDA 4N3NA 3OUTA 2Z5VA 1QV7A 3VC3A 2AEEA 2EQAA 3STWA 3TNJA 4UVHA 1TO1E 2WTNA 4M9QA 2EV9A 3PPVA 2ODBA 2G09A 3DZ4B 4I19A 2PX5A 1EE2A 4KZPA 1D4OA 1OA1A 2EFHB 1O5OA 3USES 1W25A 5DLEA 1SVSA 2W8BB 3EDMA 5DLYA 3WLSA 4YS6A 3JY6A 1KZ4A 3F7MA 1YB6A 4IBOA 2DUUA 4QL3A 2GCEA 1V7QA 3R9KA 3NHWA 1YOBA 4HNRA 3Q0TA 1SGWA 3GEBA 1RHJA 1NBEA 3UMYA 5IDWA 4BGVA 1AUVA 3S8EA 3C3PA 1R8SA 3I39X 1NJ5A 1ENOA 4JVMA 4XPZA 5BNFA 2IH2A 3G7UA 4R3NA 2M32A 3FTFA 2HU2A 2N42A 5TVKA 1UMKA 3A3OA 4G37A 3C15C 3WTBA 1XO1A 3BHNA 2A9OA 3I4FA 3RKSA 1FP2A 1E4EA 1OXSC 1HO3A 1UJ2A 3AL3A 3G2OA 3OQMA 1RXWA 3TLCA 3LRTA 4K1LA 2F55A 3IMGA 1UBMS 1I2CA 1S8FA 5GZ1A 2LWIA 1CR2A 2O9JA 2PGJA 1FRNA 2GEUA 3C74A 3ICOA 3PQ4A 3W9YA 4B85A 2JGLA 1ECPA 3JWPA 4RK4A 4OI2A 1TKCA 1CETA 3MMPA 1N5RA 2GD6A 3GGDA 4G5GA 2A5GA 1QO0D 1AB6A 4LECA 5IAEA 3IT1A 5E9AA 2R8PA 3BWYA 5EHNA 4EB0A 3GLRA 3WQBA 1I7LA 1A72A 1ZGBA 1N9GA 2JGJA 1PG0A 3GLVA 1G9SA 2NUPB 2A7QA 3HVJA 4XLTA 4KPFC 5AK6A 5AKGA 1IOLA 1OKKA 3OCCA 3DT6A 4GKKB 1VIVA 2ZJAA 3OLCX 2VAVA 4LYHA 4M9RA 4DKXA 2XCSB 2Z3ZA 1DCTA 1RWMA 2NT3A 5L8VA 4QU0A 3ZU3A 5JATA 1CJSA 3EFOA 2Q1SA 3PHIA 4M1MA 1KDPA 1XKXA 2E4YA 1RYEA 4EUFA 5BV1A 1KIAA 3U44A 1X1QA 1ZH8A 5JS2A 1NQXA 5G0TA 2O3JA 2X3UA 2BEVB 3CRQA 3ELDA 4GWKA 1DQSA 1IOVA 2FPRA 1TK3A 3ET4A 3MD9A 2IXTA 4X3OA 4YMSA 3WL5A 4BCCA 3AETA 2P2LA 2VKQA 3RS4A 3TIIA 3PQ3A 2C2YA 4YRPA 3ZR4B 3C7DB 4D1YA 5JVDA 4WK0B 1XZFA 3WS7A 3WLQA 4YRMA 3EIUA 4KG7A 2A5DA 1UC4B 5DRTA 1X2EA 3CONA 1AU9A 1Y89A 3GCXA 4O2BA 3U3KA 3RF7A 5JJIA 3OJXA 3RREA 3WLLA 3GJYA 3TQQA 4TM7A 4TT3D 4Q1FA 4PC7A 3BWXA 4IHAA 3T7IA 3VPXA 4BMVA 4IOMA 2ZYSA 4XH9B 1RXVA 3CGGA 1QMPA 1TCUA 4CIBA 5A03A 1UIMA 3GLFE 4GRDA 2IQIA 3I9V6 1L5MA 3HRKA 3NONA 4KMMA 4PGAA 2VNJA 4QPPA 3BMCA 3UMBA 3PHGA 1AC5A 4RKQA 1IXRC 4E94A 2LUOA 1N5DA 5AYVA 1YUMA 2ZU0C 3ITKA 2JAWA 4MUFA 3PS9A 3PFNA 4TLBA 1J7JA 4FX2A 4B6RA 3DYBA 1SUPA 3U31A 4HY3A 1RTTA 4F6RA 4YX9A 3SJ7A 2Y05A 2RH5A 3A1WA 1H2HA 1P4RA 2VA9A 4NXMB 2NV6A 2P2DA 3P19A 3KP1A 3PDIA 4EF5A 4YJ2A 2QX8A 5EWJA 3N0VA 2XWSA 1XQVA 3WFIA 2Q46A 3FTPA 4AN1A 2G0NA 3HB1A 1KP9A 3NV7A 4DDUA 1O6GA 1BX1A 2YYYA 1KA9H 5TQJA 4NZNA 4YV0A 5AI0A 4PEVA 1E9SA 4CM4A 4JC8A 3O2NA 3TD9A 3M3HA 3HBFA 2FEXA 1Y0BA 3P9PA 1T2AA 4G86A 1JXMA 4F8EA 4M87A 1IMOA 1VBMA 1VKJA 1WCWA 2IYWA 5GJVC 1OGIA 4PXYA 1E3WB 3KELA 5BPHA 3OC0A 2VWHA 3K9BA 3WFJA 1F7VA 3QEOA 4JN6B 3SICE 4M89A 5BSTA 2RH9B 4ARAA 4HH0A 5JPIA 1PQPA 3T5DA 4L5YA 1X2BA 4Q05A 3E5MA 4OHBA 1RHMA 3D0RA 3I76A 3KDPA 1A8SA 2XMGA 1QPZA 4PX3A 4DN6A 3GO4A 5J63A 5M34A 2H57A 1GLNA 4G8BA 1E0DA 3SNHA 2BUCA 1XMOB 4HAYA 4NYMQ 4U0KA 1XA4A 4X8MA 4AN0A 3U1VA 3LLUA 5A4KA 5A4JA 1X92A 2I4LA 5FUQA 1D0IA 4PRLA 4QSHA 2IV3A 2AG1A 2AN5A 3FDXA 3P27A 1WB9A 4EHJA 2SKDA 2Z09A 4FP9A 4QYIB 3HCBA 2COKA 3EXG2 1AKMA 1UDBA 2WEKA 4KODA 2DUNA 3HO6A 4NR0A 1QQAA 4HDRB 2FW8A 5CVVA 1FTWA 1UKVY 3M6UA 5EWLB 2G70A 8ATCA 1UXGA 1PR4A 4B6EA 4BP8A 3TOVA 4BX9A 5IS2A 4WLVA 1SK8A 1SD2A 2DPLA 2X2PA 5BW5A 3EA4A 2ZIXB 1TZJA 2IHJA 1QTQA 2A30A 3FUXA 1Y81A 5SYNA 2G06A 2RGXA 1P2BA 1YQDA 2FLVA 3G1TA 1X70A 3M0EA 1IPHA 4QBIA 5U4XA 3ABSB 4U8HA 4ZARA 4LCEA 5LQSA 4BN4A 4QQ8A 1QU2A 1KRXA 1UBOS 3S2FA 4WXRA 3GDOA 4KXVA 3RSQA 2OPBA 1P44A 1M1UA 2FUEA 2GFQA 3PSAA 3RJTA 1UBUS 4KACA 4DRZA 2NYAA 3QFTA 4ZA2A<