3DO5A

Crystal structure of putative homoserine dehydrogenase (np_069768.1) from archaeoglobus fulgidus at 2.20 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
324
structure length
320
Chain Sequence
b'MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTREGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine dehydrogenase
molecule tags Oxidoreductase
source organism Archaeoglobus fulgidus
publication title Crystal structure of Putative Homoserine Dehydrogenase (NP_069768.1) from ARCHAEOGLOBUS FULGIDUS at 2.20 A resolution
rcsb
total genus 96
structure length 320
sequence length 324
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3do5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3do5A01
2HLPA 2OP0A 1VI2A 3K92A 3QVSA 2CDCA 2PFGA 2Y0CA 1XKQA 3ADOA 3TL2A 4CV3A 2A4KA 2I3GA 2IEBA 4KWIA 1IB6A 3PYMA 4P4LA 1ZO8A 1EDZA 1ONOA 3HWRA 1NWCA 3QSGA 3K8ZA 4G2NA 3ENKA 3FRJA 1P0CA 4TKLA 5A5FA 3A4VA 3BHJA 3S8MA 3VTFA 4BQPA 1PJLA 3RU7A 1FF9A 2NVWA 1A4IA 3GDFA 3UICA 1DC4A 3ST7A 3DO5A 3CMMA 1MA0A 2VZ9A 3KLMX 4UVIA 4KWHA 4WOKA 1PGNA 1TT5B 1Y9EA 2NTJA 1V0JA 1JLLA 3F46A 4Z3DA 2NVUB 2DPHA 2JD1A 1DIRA 2CMDA 2LDXA 4WPGA 4IDEA 5FI3A 3W8FA 1FDUA 2BI7A 3DOJA 5B1YA 5DDIP 3KXDA 1ZEJA 4J7CA 2X9NA 5IAAA 1EZ4A 2D5CA 2A35A 1QKIA 3H7AA 5IG2A 3OM9A 1PJSA 3QJ5A 2A9FA 1SMKA 4RF2A 1XQ1A 4CLOB 1YVEI 3ONDA 4E2XA 4WEOA 3HE3A 5DCUA 4L8VA 4J4HA 3F6YA 1BHSA 1PIWA 2J3JA 1C1DA 2Y0DA 5CPBA 4CM9A 5DN9A 4GX5A 3I5MA 4RQUA 1I32A 1YXMA 1ISGA 1B3BA 3U49A 3GVPA 1EFKA 5F1PA 5AXAA 1GEGA 4UAGA 4IUYA 1TXGA 2EJWA 2Y1OA 3EYWA 4RVFA 4J0EA 1KY5A 3S2FA 3JSAA 1ZSVA 1I0ZA 1R6DA 3AUUA 1BTOA 5HRUA 2X4GA 2EEZA 3WSWA 2X22A 3DAFA 5KJEA 3VPFA 1NR1A 1YDEA 1KETA 2ZYDA 3IOYA 1I3MA 5B4UA 5U9CA 5L4SA 1NHGA 4RLHA 3GG9A 4DRYA 4TSKA 2C7GA 5LDHA 3VPGA 3OETA 3LF1A 5JMWA 5A04A 1U2DA 4OXKA 3ZU5A 1B3RA 3KHUA 2FHSA 2PD3A 3BMNB 4BKPA 1GUFA 1CERA 2I76A 3OECA 3GFGA 4R01A 2C2XA 4HFMA 4XYGA 4HXYA 4FJ2A 4LRSB 4GMGA 3Q9NA 4UULA 5GMOA 4BNXA 4GPD1 2D2IA 3DHNA 1T1RA 3QWFA 3LT4A 4FOOA 5AVOA 2FOIA 1M2WA 1MX3A 3GVXA 1ADBA 1I10A 1B8PA 2NACA 3U9LA 5JNLA 2VZ0A 4IQ8A 1DIHA 4GLLA 5TLSA 3INRA 1KVSA 2VT2A 2O7QA 2DBVO 4KTVE 1H6CA 1VSVA 1C1XA 3PXXA 4CMCA 5B4VA 4NH4A 3T7EA 3JQ9A 1HE2A 1EVJA 2EKPA 2JAPA 3S2IA 2JL1A 3DWFA 3F9IA 4BQRA 3R0IA 3RBVA 3QRWA 1NFRA 1E0DA 2HMTA 3ZHYA 1PTJA 2OO5A 4J1TA 1ONPA 3OJOA 1B14A 4UUPA 3HFGA 3TWOA 3WIDA 5I7FA 2ZYAA 1EUDA 1XGKA 1HYGA 4IIUA 3FBGA 3VDRA 3HNPA 3L4SO 3RI3A 1IZ9A 3ZV3A 4BO9A 5BSFA 1DFIA 4YJGB 4KP7A 1Z74A 3CTMA 4IZHA 3FPCA 1P44A 4II2A 1RPNA 1QYVA 1WLYA 3EAGA 2ZK7A 1X7GA 3TOXA 1J6UA 5BQFA 2OXIA 1Z7EA 4D46A 4PZEA 3RSHA 2VHVA 3LC7O 4GX1A 4LMRA 2I3AA 4RVUA 1EVIA 2FR8A 1C14A 2FP4A 3U09A 4MVJG 4KMSA 4RDHA 1LDYA 5FFFA 4GKVA 1O89A 2E37A 2X1HA 1ZK3A 3JD1A 5JCJA 1Y8RA 2ILTA 3PIDA 4XD2A 5IN4A 5C7IO 1UAYA 3C1OA 3KV3O 1PZGA 1Q0QA 3A28A 2P5YA 4TWRA 5JPIA 5L7YA 3GVHA 5THQA 2H6EA 2CFCA 3WJ7A 2FZWA 4CMAA 1SEPA 4PGFA 5LDGA 1YKFA 2I65A 2PTGA 4O5OA 3WLEA 1MV8A 2GO1A 4A27A 3G3EA 4ZJUA 3KVOA 3KOUA 3L4BC 2HKIA 4XEHA 1GR0A 3DL2A 4DVJA 3LVFO 4BO0A 4NBVA 1YJ8A 1LU9A 4KZPA 3GAZA 3T7CA 3VHRA 1YE3A 2DFDA 1X0XA 3D3WA 4JN6B 1LDMA 1HXHA 3WGYA 5T64A 1ENOA 4J9VA 4ROSA 1ISHA 1GQYA 4UVHA 4OL9A 2J3KA 1GCOA 4YAJA 5FYDA 5KKAA 1Z75A 3I9OA 3P2OA 3AU9A 1DEHA 2CDBA 3FNGA 4BB6A 4R41A 4RGBA 3ZV6A 4TRMA 1SOWA 4CJXA 4GI2A 1ZZEA 2P4QA 2IXAA 3JQ7A 1C0LA 3PGXA 1GQ2A 4Y9DA 2CSUA 2W4QA 4OOFA 1YQGA 3M2PA 1F12A 4H3VA 1ZK2A 4TKMA 1LC0A 1F14A 2PKQO 1QLHA 4CV2A 1SOVA 4QSMA 3SBOA 4AJNA 1K6XA 3LDHA 1CF2O 3D4NA 3IP1A 2BI8A 1BXGA 5TNXA 5DOZA 3GUYA 4HWKA 1KVUA 3MJTA 1LSJA 1LC3A 2JJYA 1E7WA 1Y8RB 2R00C 1PGQA 4OXNA 4DYVA 2Q2VA 4DLLA 2VHYA 3CEAA 4D0SA 1K89A 2V6BA 4CV1A 2CZCA 1MXFA 1GUYA 2VQ3A 1JKFA 4TVBA 5ITVA 3H2ZA 1WXDA 5GZ6A 1S7CA 1RM0A 1O8CA 2O2SA 1L1FA 4GGPA 3UGKA 3AM3A 1FXSA 3LK7A 3BTVA 2WE7A 8LDHA 5ILGA 3R1IA 2ZIZA 4XYBA 1JQBA 4ND5A 4CQMA 5IJZA 3R3SA 4GSKA 4WCFB 1PSDA 1KBZA 5A5EA 2HAEA 4YAGA 4YWJA 1E6EA 2O3QA 5H83A 1ZK1A 4WNIA 1ZXLA 5CP8A 3I52A 3PRJA 4PG7A 4S1VA 3RKRA 2P91A 4NHEA 3C85A 5TRTA 3A1NA 3BYZA 2AEFA 5CEJA 4Y6SA 2B5WA 3IKTA 3GY0A 4YQYA 4RJTA 3FTNA 5IN5A 2JAHA 3GNQA 2D3TA 3ASVA 4CMIB 1HE4A 2I99A 2FRDA 3IAHA 1Z45A 3KO8A 4E4YA 3KYBA 3ZN2A 3EZLA 4PLHA 2VYVA 1SZJG 4TMFA 1SB8A 3Q1LA 1NQAO 1EUCA 4DPKA 1E1NA 3RD5A 3GT0A 3NJ8A 1XU7A 5CFZA 4I1IA 2Q2QA 1KVQA 5A02A 1PEDA 1VKNA 4IDBA 4A2CA 3PJFA 4RF5A 5M6DA 1WDKA 1U3UA 5COBA 4WNCA 1YL6A 4EW6A 1ULSA 4MVJF 5T73A 5JMPA 2Z5LA 4E13A 4IPTA 1A72A 1PZEA 2J5RA 3TDKA 4J1SA 4M54A 3U4DA 3H9JA 3ZDFA 1L7EA 3ZV4A 4RPGA 4CMBA 2CVZA 4ND3A 1GL3A 4HP8A 1RKXA 2JFHA 2CY0A 1E3SA 2DBZA 3ANNA 4BNZA 4BV9A 4M86A 3GG2A 2QRLA 4PLTA 4CQMD 5L7WA 2WWRA 1P9LA 2YQ5A 4Z6KA 3OSUA 1RM4A 1XELA 4J91A 3JQAA 2DPGA 5DZSA 4A0SA 3NAQA 4HY3A 2WD7A 1SEVA 5K6AA 1FDVA 4N5LA 3H4VA 3DZBA 3IIEA 4IMRA 1FK8A 5F1KA 1HZJA 1LDBA 1Y1PA 3MZ0A 3AFMA 2NVBA 3EVTA 3NDIA 3NT2A 2ZTUA 4ALJA 4ONEA 4FBGA 2EGGA 4BO5A 1HSOA 4DMLA 3KYCA 1X0VA 3L9XA 1C1DB 2VWHA 4DIFA 1DFHA 2VYVD 1CYDA 4FFRA 5L53A 3MWDB 4P8RA 1LRLA 4MVJH 2TMGA 4DGSA 4JCOA 3PHJA 2WDZA 2FMUA 2EKQA 4DPLA 3GRPA 1UDCA 1T2EA 3VZRA 3V2UA 2UUOA 2X0IA 4WK6A 3ETDA 5JYEA 3JQDA 5F5LA 4Q3CA 2X5JO 3UHAA 1R4NB 3VOSA 2O48X 2GCGA 3WJAA 4MINA 1UR5A 4JX8A 2BRUA 1E92A 1E7MA 2O7SA 3RFXA 2PH3A 3JQAD 1A7AA 1U28A 4E31A 4IXWA 7MDHA 1D7OA 3RC1A 3DAGA 2AQIA 1AXEA 4BO7A 4EJMA 2QQ5A 4B4OA 1VSUA 3JV7A 4K9DA 1NHWA 4JJFA 4W9NC 4YAEA 3CPSA 2X7HA 2FSSA 4HX5A 5JCJD 2BHLA 2AE1A 2ZB3A 3F4BA 4KQXA 3T4EA 3WIEA 4B3JA 3VPXA 1J49A 1YL7A 1HDXA 3JYPA 3W6ZA 1U7TA 3D5QA 2X23A 3P5SA 2FY8A 1FDWA 3OIGA 1ZIDA 4XQEA 5DBIA 3UUWA 2PA3A 3MTGA 1P1HA 4YQZA 3LC1O 4LVUA 5BSHA 3WGZA 1HLPA 3OQBA 3TF5A 3IMFA 5EQDA 4MP6A 1YGYA 3BMCB 2OZPA 2GZ3A 3RC2A 2YV2A 3U4HA 4FDAA 3ZWXA 1T1SA 1Z6ZA 2UVDA 1DHTA 4II3A 4PN3A 1JW9B 2W8ZA 3U4IA 4BNLA 4U6QA 2B37A 1QYDA 1WP4A 4GL4A 4Q3AA 3WFIA 3P2YA 1I01A 3E18A 1YONA 2D4AA 3TRIA 1HLDA 3C24A 5JCXA 1H9BA 4YJFA 3MJ4A 4IDDA 3ROKA 2CVOA 1HDRA 5JE8A 1LLUA 2V7PA 4R4JA 3Q11A 1JAXA 2XXJA 4C7JA 1ZMTA 5L4NA 1XG5A 3G49A 4YXFA 3OFSA 5B4TA 2GLXA 2HU2A 4J1NA 3UN1A 3QQPA 1QRRA 4DC1A 2VYND 1Y7TA 3AY7A 2P5UA 2VHWA 4KOAA 4J7UA 4B3IA 1L7DA 3BXXA 4Z0HO 5EN4A 4E5YA 3DZFA 2YHIA 2DKNA 3JD4A 4I5DA 2B35A 1PJQA 2Q46A 4WE3A 4C7KA 5T6BA 4M55A 3PYXA 4BHTA 4L4XA 4UVEA 1H9AA 4YT5A 3DQPA 1GQQA 4YJHA 1FDSA 1NXQA 3DZHA 3W1VA 2NU8A 1NVGA 2CVQA 3GLQA 4C4OA 3ANMA 2GZ2A 4ZQEA 4OIMA 3UCEA 5MDHA 3BZUA 1KEUA 4MDHA 1V9LA 4OHUA 3S1LA 1Y8QB 5A3JA 1M6WA 3WQQA 5KCZA 4DBVO 3UH1A 5IDQA 4E5KA 4DLAA 4E6PA 4FPXA 4WGGA 4XR4A 4LCEA 2H1SA 4LISA 4CR8A 4XB1A 5IF3A 3FNEA 2GF2A 1AXGA 1GU7A 3OJEA 3JYQA 2PK3A 4BNJA 1P0FA 2IDZA 3VKVA 3IL2A 5HS4A 4WOJA 3OA2A 1KVRA 1LRKA 2X0RA 5COAA 3AOGA 1DLJA 7ADHA 1HSZA 3DHYA 2HMSA 3NRCA 4ZRMA 4CMEA 2VOEA 3PIIA 3CH6A 4WLOA 4GMFA 2BELA 1E7RA 3JYNA 4IMPA 1VL6A 4NK4A 4DPMA 3MCVA 2OFPA 5CG1A 3FN4A 3NJ4A 3BMQB 1U2GA 1B7GO 2JCVA 2HUNA 4EJ0A 4EI2A 5CEEA 5JC1A 2Q4EA 5J9GA 2C7VA 6ADHA 1DXYA 4CLOA 3LT2A 4OXYA 3GZNA 3OQ1A 1HT0A 3UKOA 2RHRA 2C5AA 3STHA 3L07A 5JDIC 3NGLA 5KIAA 5AOVA 1DLIA 5JDCC 1Z7BA 2VTDA 3W4JA 1PX0A 1XR3A 3H65A 2OOSA 1BGVA 1P74A 2GNAA 2I6TA 3KRTA 3DDNA 4JBGA 4WLFA 5GY7A 1W8DA 3IC5A 5ILOA 4CLHA 3PWSA 3KTDA 3Q9UA 1JN0A 2RCYA 1P31A 4DA9A 2JFFA 3GGOA 4R5HA 1GEEA 1E1LA 5KTKA 1P1RA 3HDJA 1GV1A 4P38A 2P4HX 2O3JA 1ADFA 3QV1A 2R6JA 1EK5A 4Q9NA 4GLOA 3CKYA 5A3VA 1H2HA 2JD0A 1QV7A 2C54A 4NZ9A 5TF4A 2V6FA 5A9SA 3B70A 4ZHSA 2VUTA 1JAYA 1VRWA 4YRDA 5TGDA 5JDIA 1XCBA 5L40A 1AUPA 5FF9A 3WDSA 3NTOA 1JVSA 2GSDA 1E3LA 2PZKA 1IPFA 5F3RA 4J43A 4K6CA 5JAIA 5CHEA 4U5QA 1HEUA 3E5MA 2NLOA 2HRZA 3BTSA 3PDJA 4FGSA 2HK9A 1X1EA 5T8KC 1KC3A 4RORA 5G4KA 3WMWA 3ORFA 1KEWA 2G17A 1N1EA 3JQAB 4B7UA 1LEHA 2BGKA 2GZ1A 3QWIA 1JKIA 4NBTA 4ZA2A 4WCFA 1B2LA 1Q7CA 2OL4A 5G0SA 3RUHA 1YJQA 3GRKA 1J5PA 4MVJE 4FB5A 4EZBA 3F4LA 1ZNQO 1Y8QA 2HCTA 2DFVA 3PI7A 4IY1A 4Q3BA 2PGJA 4Y8VA 5TJHA 4DYDA 1GCUA 2A94A 4IJKA 4FQ8A 5JXWA 1MB4A 5C7OO 1PS8A 2UAGA 3I23A 2NV6A 3RUFA 1T25A 3D64A 2WYUA 5ADHA 1B15A 1QORA 5G4LA 3L4BA 3NYWA 1ORRA 1U8FO 3QVTA 5JAMA 2GN6A 3WQRA 1PQPA 2GASA 1E3JA 2AG8A 2W2LA 3B20A 4BS9A 3F3SA 1D8AA 3GNTA 2EV9A 2X5KO 5JAQA 3DHEA 2HO5A 5EINA 1ISJA 1V3VA 2YV1A 2UV8A 4RV9A 2J6IA 1XA0A 4OSOA 3E9NA 4YYZA 5DOVA 5L51A 1Q2XA 1KIFA 4X54A 4IJVA 4B4VA 1TI7A 4B4UA 4OQYA 4ZRNA 3I9NA 3JD3A 2HQ1A 1NTOA 2P9EA 5ENVA 4BVAA 4R69A 2WSBA 2CF5A 3JQ8B 3SLKA 1E1KA 3WNQA 1I33A 1PL8A 1W4ZA 3FNHA 5DBGA 3PDUA 4O59O 4AJEA 3GGPA 4BO4A 3SC6A 1GZ6A 3ONFA 3FWNA 2P9CA 1NPDA 4JBIA 4BNYA 1QYWA 4EEZA 4O0LA 3JQBA 1A9ZA 3B1KA 3S2EA 3HSKA 1K5HA 2PY6A 1NPTO 3KB6A 3DMYA 4Z9XA 3WGIA 1F17A 1BVRA 2BMAA 1J4AA 4R9SA 1A5ZA 4E5NA 4BNUA 3INGA 2EP7A 5IDYA 1JTVA 3ZW9A 4DLBA 4DREA 1K6IA 2ZCVA 1P3DA 1IE3A 3TL3A 3AY6A 2DQ4A 2IZ0A 1N7HA 4XB2A 4MJLA 4B4WA 4BV8A 4PG6A 1LX6A 3FPLA 3VTZA 4XJTA 4BNWA 2P9GA 4BUCA 1PWZA 3GHHA 3LT1A 1CEQA 3VH4A 1HDZA 4E3ZA 3QWBA 4FFOA 3K73O 1D1SA 1R37A 2RHCA 4DMMA 1CRWG 3HZZA 3IJRA 4XGKA 4L4RA 4BNKA 1NM5A 2X58A 2Z95A 1ENPA 1DRVA 1H6BA 2F00A 3QVOA 3D1LA 3OP4A 1TLTA 1WZEA 2OGUA 1J0XO 3DC2A 1KS9A 2WYVA 4CL8A 4B7XA 3JCZA 2O4UX 1RWBA 1N9GB 4H7PA 4BKQA 1NP3A 4LK3A 2XOXA 1LI4A 3Q2KA 1IHYA 3G1TA 4I9HA 4N18A 1KERA 3AWDA 4WLUA 4MVJP 2EJVA 4TRRA 1UZMA 4BL5A 1WDMA 3H5RA 4TQGA 1QR6A 4PLCA 3AFNA 4FC7A 4BO6A 1DIAA 4K1LA 2Q1TA 5CDUA 1ZCJA 4J90A 2OBNA 4OMUA 4OM8A 1EQ2A 3WSVA 1OFGA 3EUWA 3GPIA 2HMUA 4S3MA 3JQFC 3UAGA 2PLAA 2GN8A 3VPHA 3UCXA 1ZEMA 4CUZA 3C1AA 2NU7A 1NWHA 1YH3A 2DU8A 3BMCA 2HJSA 2YFQA 1ZW1A 4WKGA 1E1MA 1HF3A 1NAIA 4PCVA 1LRJA 2X0NA 2P68A 1GTMA 4P22A 4NR0A 3PHGA 3UOGA 1ML3A 4ZQBA 4K26A 4XQGA 1GADO 3IS3A 3QHAA 4ID9A 5T5QA 3RBXA 3QW2A 3RUAA 2FN7A 4WUVA 4CL3A 4D43A 3I9JA 4KQWA 1X7HA 3ZV5A 4BGUA 1YB1A 9LDBA 4WASA 4EEXA 1UP4A 3TZCA 5JC8A 3DXFA 1LNQA 2PKRA 4CM4B 2IYOA 1EE2A 3BA1A 1UP6A 4BNIA 1ZJZA 4IGFA 3AY3A 1OC4A 4NIMA 5LCXA 2RBEA 3ZNPA 3EZYA 1DO8A 4D41A 2X9GA 5LC1A 2PZJA 2QHXA 1LSOA 1QLJA 2ZYGA 2Y99A 4U0KA 4B7CA 1PGJA 4OH1A 3ZU3A 3ZWVA 1KEPA 1YB5A 2DLDA 2OP1A 4A03A 4RPHA 1Y5RA 1NVTA 3PHHA 1H93A 4EYEA 3GAFA 2DUUA 3NT5A 1LJ8A 1ISMA 1MXHA 3H9UA 3DMTA 1GV0A 4O63O 3GVIA 4RPLA 3RCBA 4JJIA 4EITA 4RL6A 2GRAA 3MJCA 3P19A 3GHYA 3R6DA 4HFJA 4HUJA 4MOWA 4PLZA 4YTEA 2I5PO 3TZKA 3WLFA 3D0OA 4FR5A 3GUCA 2ZTMA 1CIVA 4QTZA 2WEKA 2VTEA 3VDQA 5ICMA 5A9TA 1NAHA 4R68A 5THKA 3RKUA 3EVNA 5CEFA 1UH5A 5KKCA 3KLPX 1YBVA 3IP3A 5KVVA 3VH2A 2PKQP 3ANLA 4J16A 1IZ0A 4DUPA 1WZIA 1ZFNA 3ITDA 3O03A 3PTZA 1HE3A 3SJ7A 4NBUA 1MLDA 2ZCUA 2HJRA 5I7VA 1QYXA 1D3AA 4I5FA 3GZNB 3K96A 8ADHA 3GMSA 4R1SA 3S55A 3I6IA 3ZHBA 2RAFA 2ZJ1A 1YL5A 3WGHA 4XRRA 2I67A 1YO6A 1LSSA 2Y1CA 3K2EA 3X2FA 3PFWO 3O38A 4OKIA 1YOVB 2NQ8A 2YFHA 4U8GA 1C3VA 4EBFA 2XXBA 3HQ4O 2VZ8A 1BW9A 4UEKA 4Z9YA 4CQLB 1UZLA 1PJCA 5C5IA 4B8WA 3PK0A 1LUAA 1U7HA 5JLAA 3JD0A 5EPOA 3PHLA 3JQ6A 3V2GA 1EEHA 2W90A 4U0JA 1EVYA 3WMXA 2DBQA 2JCYA 5IXYA 4AJJA 4QO7A 3CINA 3Q2IA 5A05A 4NBWA 4NQZA 1WMBA 5JYDA 1RM5A 1SO8A 1G1AA 2H5LA 2VNSA 3DONA 3TQHA 4CM5A 1E77A 3UFXA 2ZQZA 3AK4A 4BKRA 4BOYA 1JU9A 2Y05A 3E1KA 3RFVA 3WGOA 1A71A 4J4TA 1PR9A 5FWNA 4BNHA 5JO0A 3ZCXA 4BMVA 4JQCA 1DOHA 1U8XX 3ZWPA 3DOCA 4E2WA 4E0BA 1T2CA 4BO3A 3M6IA 1ZH8A 1U5AA 5GZ1A 2O3TA 1UXIA 3RWBA 5FEUA 4Z0TA 3KEOA 4H15A 4XRGA 1RYDA 3I4FA 2P2SA 2GGSA 3GF4A 4PG4A 3ON5A 4R16A 4LGVA 2PR2A 2R2GA 4E5MA 2FR0A 2O3SA 1BMDA 1ADGA 1K0UA 4J2OA 2CUKA 3GGGA 4PLPA 3U4CA 2VRBA 4NPCA 4W7IA 5KJFA 4BKOA 1O6ZA 2NNLD 4HFNA 3L77A 4DXHA 1QP8A 4YAKA 4FW8A 1U9JA 4YA6A 4RPJA 4DC0A 1E3EA 1XEAA 3SXPA 4AVYA 3TZ6A 1V3UA 3OQ6A 4R51A 1QV6A 4PVCA 3OEYA 4F46A 4BO2A 3TFQA 3RIHA 1GZ4A 4YCAA 3GNSA 3AOEC 2W98A 1EFLA 4RZHA 2EW8A 3KYCB 4HNGA 2VHZA 2G5CA 1PWXA 4J6FA 4AG3A 3OA0A 4BNMA 1AE1A 4XIYA 3ULKA 2OORA 3AUSA 5KWEA 1SNYA 1ZVMA 3T4XA 3F5QA 1KY4A 3EHEA 1R4NA 1ID1A 1ENYA 3EK2A 3OJLA 4Q3DA 4CLRA 1Z73A 3DZGA 2Q50A 3DMTC 1IY8A 2NTNA 4RQTA 2GD1O 1H0KA 1MFZA 3VKUA 1NVMB 1VL8A 3HB4X 1R4MB 2HMVA 2VHXA 2IEDA 4CQMB 2BFAA 1DFGA 3K6JA 5K0ZA 4QFDA 4CM4A 3GOHA 4OJNA 3LYLA 2WM3A 4ZQFA 1VM6A 4M8SA 3E5RA 3A14A 5EMHA 3CXRA 1HZZA 3Q3CA 3U0BA 1N8KA 2EERA 2AQHA 3V8BA 3UW3A 3MJEA 1U1IA 5JAZA 1YWGO 3QWHA 1I8TA 1LQUA 3M1AA 2BFMA 2AG5A 4P4NA 3WR5A 2Q4BA 4NG5A 3BHIA 4D3SA 1RM3A 5JBIA 1O94A 1AN9A 1Y5MA 4ILKA 3UVEA 1R15A 2AQKA 1VC2A 2IE0A 2ZTLA 1KOLA 3PZBA 4RCVA 4PG8A 4IJWA 3I9LA 3W4IA 2DVMA 3NTRA 2O23A 3QVWA 1N1GA 4FC6A 5A4DA 1GYRA 3RUEA 3KSZO 1NFFA 3AI2A 2AEMA 4BO8A 3MOIA 1X14A 3OJ0A 2B5VA 3GEDA 4N5MA 3UF0A 1X15A 1XQ6A 1P45A 2E49A 4F6CA 1MG5A 2QRJA 5I8WA 3MJVA 1XIVA 2FPIA 1QG6A 5B12A 4MIYA 1TT5A 2NVUA 2B69A 2O4CA 2NM0A 3QVXA 2E4AA 2UDPA 2W2KA 1FDTA 2NSDA 3HDQA 1H6DA 2W2KB 2Q99A 3GVCA 3ZWBA 2PD4A 1SCUA 3BAZA 2Q22A 2BFPA 5AXBA 4RVGA 2B36A 2SCUA 1R0LA 3X2EA 3D3EA 4CM7A 3QLJA 4OAQA 4D3DA 1ISFA 1I3KA 3FR8A 1M66A 5JSFA 4GAEA 5GZ3A 2UUPA 1VLLA 4YBZA 5A9SB 2PGLA 3COSA 3RC9A 2G1UA 2RH8A 1PZFA 3HN7A 4XR9A 5B37A 3F1LA 4U7WA 1NFQA 3K31A 4CM8B 3NT4A 3AM4A 1I30A 2E48A 1IUKA 4FJ0A 2C0CA 1YDWA 1BWSA 4P4GA 1H5QA 4RDIA 1YQXA 4ZQGA 2WE8A 2FSVA 4NK5A 2AXQA 1LBEA 1Q0LA 3IKVA 3GN1A 4CMHA 2C07A 4KDFA 1I3NA 3JTMA 4W99A 1DIGA 3I3OA 1W73A 3TFOA 3HJAA 1O9BA 5DP1A 4Y6PA 4FJ1A 4H16A 1V6AA 1JDJA 4E2ZA 1DJQA 3CE6A 4FFNA 4K28A 2X9VA 3B1JA 2Y1DA 2V6GA 4UVDA 4WJZA 1B8UA 2JFGA 3ITKA 2YUTA 1BXKA 3FWZA 3WBFA 2QYSA 4J9UE 5TC4A 4F45A 3E82A 4QQRA 4QEDA 4A7PA 3DBLA 3RFTA 2IYPA 2DUWA 1PR3A 1F8FA 4KDEA 3KETA 3ETEA 5IXSA 1X1TA 1R12A 3LLVA 1B8VA 5COQA 4CMJA 1W6UA 1LTHR 2YDXA 3D3WB 1P77A 1K2WA 2UYYA 2ET6A 4CR7A 1GD1O 4YT4A 6LDHA 4YPOA 1DIBA 2VUSA 3SC4A 1R0KA 3GC6A 4AJ1A 2EF1A 1I36A 3INTA 4GWKA 3ICCA 3LLSA 2AMFA 3FBTA 2ZTVA 3DFZA 1G0NA 4G5HA 4IM7A 4CPDA 3WYBA 3PLNA 5TIIA 3GR6A 4CQLA 4XWYA 3WX0A 3ROPA 3C8MA 2YJZA 1JKJA 3CUKA 1PS9A 4EUEA 3ABIA 2CDAA 3JQ8A 3K2BA 2JHFA 3RUIA 1HYHA 3E9QA 1N5DA 3CZRA 3PZRA 3KZVA 3EMKA 2BF7A 4R1TA 5ES3A 3RBZA 1ZBQA 4GKBA 2BH9A 3ETGA 4E12A 3I9KA 2DT5A 3DZIA 1ZSYA 3LZ6A 2LDBA 4GGOA 4YJHB 4IQGA 5IZCA 1GFSA 1PQWA 3ASUA 3AUTA 4IQ0A 1WPQA 3KSUA 4MP3A 3RQSA 3FHLA 5ITWA 4FOSA 4GBJA 5I8ZA 5TSDA 1P33A 2TMDA 3ZHXA 4JGBA 4PRKA 1LSUA 2PD6A 3EDMA 3KYDA 3ICPA 1ADCA 3LC2O 1DAPA 1BG6A 4QX6A 1JA9A 4MP8A 4F6LA 4AJHA 1Q7GA 4WEQA 2AHRA 9LDTA 4FFMA 1XU9A 4XIJA 1HDGO 4WECA 4M1QA 2J8ZA 5BT9A 1PJ3A 2EW2A 1MG0A 4CM1A 3H5AA 3AM5A 1LLQA 2OMEA 3DBLB 3PHIA 4A73A 4A10A 4ESOA 3GZ4A 3WB9A 2B4RO 2D5AA 2V65A 2CF6A 3TZQA 4AJ2A 4MVJD 5CPFA 4YT2A 3EY4A 3PGJA 4PIVA 2E82A 1A9YA 1OI7A 5H82A 3H6KA 4NJMA 2YW9A 1WVGA 3F1KA 2C2YA 2CD9A 2OUIA 2ZJ0A 3O8QA 3K9QO 3V5NA 5DNAA 3D5TA 1Q7BA 3H8VA 4CUJA 3DBRA 3ZU4A 1HYEA 1QXSA 4MKZA 1HDOA 1T2DA 2IRWA 2Q45A 3WGQA 3C3XA 1UXKA 3ZH2A 3RUCA 2GYYA 1NR7A 1IL0A 4D79A 1UDBA 2WYWA 5F5NA 2EXXA 3ZWAA 1C0IA 2X86A 2DBRA 4CM8A 4ZD6A 3H9QA 4ALKA 3ZWNA 1N2SA 2PGDA 1LLDA 3L6EA 3RASA 1PJ4A 2YHIB 4YB8A 3DBHA 4ZU3A 4CMGA 4EGFA 3BIOA 2BD0A 1OZAA 5BR7A 3DOOA 1ZMOA 2GR9A 3B6ZA 2C59A 2VOJA 1UJMA 4W6ZA 1NASA 3M1LA 5G0UA 1GUZA 5L7TA 1PL6A 4J3FA 5TQVA 2BKAA 2NQTA 5JYAA 1O5IA 2Q1SA 2EWMA 1E7SA 1DRUA 3HHPA 1KC1A 2Y67A 1LQTA 3DTTA 3PJGA 1LLCA 4ND1A 4DQUA 1GY8A 1R66A 1UDAA 3GEGA 2HRBA 5A06A 4L73A 4NFYA 3C7DB 4CLRB 4JJGA 2A92A 2VNAA 1N9GA 1PJTA 4XQCA 3TJRA 2YYYA 4INAA 1VE9A 4GX0A 3SVTA 1MGOA 1JVBA 4IBOA 2IXBA 1PGOA 4IZIA 4WLNA 3PJDA 5TJ9A 5EJ2A 4QT0A 3ZNOA 5F1OA 4GVLA 1ZXBA 4PFJA 4XGIA 1EBFA 3HUDA 3L0DA 5KVSA 1EBUA 4Y6RA 5G0VA 4PLGA 3DTYA 4CMEC 4IGEA 1RYEA 3GA0A 1RJWA 3DZJA 2EP5A 3EGOA 4HV4A 4BO1A 3PEFA 5A9RA 1X13A 4FFPA 4RLSA 1AGNA 1UUFA 2O50A 4CLEA 4UUNA 1NNUA 1GPJA 2J5KA 1MC4A 3W6UA 1UAGA 1EK6A 3DR3A 1XLTA 3CZMA 4XDZA 4JBHA 2JCXA 1O95A 4MO2A 4JP3A 2WD7B 3SJUA 3SX2A 3PWKA 3ZWOA 3GDOA 4NI5A 4JIGA 5JO9A 1VL0A 1QMGA 4EUFA 3KEQA 3BTOA 3D4PA 4TZKA 4I9UA 3TPCA 3FSRA 4XYEA 3AW9A 3AI3A 4DQVA 3F5SA 3K30A 1VJ1A 1V8BA 1TB4A 2NU6A 3UCFA 4D45A 4IDAA 4L74A 1HL3A 4G65A 4XYMA 5ENDA 1M75A 1PS0A 3WYEA 4MKRA 4I9NA 3QE3A 3ZNNA 4ALNA 3OJFA 3RAJA 2X5OA 1PGPA 3DEYX 4W82A 3CSDA 1T2FA 4Q3EA 1NBOA 1AHHA 1B16A 1YRLA 3GQVA 4ALLA 4KUGA 2J3HA 4N5NA 4UREA 5EQFA 3HDYA 1PJBA 4TRJA 3KUXA 4NJOA 4CR6A 2CNBA 3H3JA 4J0FA 1BDBA 2C5EA 2B0JA 2FR1A 3ZU2A 4CUKA 3S2GA 4WLEA 1ZK0A 3ROQA 4DTIA 3OF2A 1GAEO 4NMHA 1AHIA 1E7YA 1CQIA 2ZQYA 4IDCA 3RJ9A 4DL9A 1YBMA 2GUGA 5I7SA 4UEJA 1D1TA 4OGWA 4Z9FA 3E48A 4IS2A 4R3WA 3JQEA 5L3ZA 3WWYA 3IJPA 1V35A 2X6TA 2HMWA 4LCJA 2NU9A 1HRDA 4YJFB 2G82A 1FMCA 1U4SA 3F47A 5IFLA 2I9PA 3OHSX 2O3UA 4RF4A 4MVJM 1OOEA 4J49A 3OMLA 4CMKA 2H9IA 4EJ6A 4JP2A 3O9ZA 4UUOA 1ISIA 1SAYA 2RIRA 4LVCA 5AYVA 3U5TA 1YBAA 4BNTA 1MC5A 1U3VA 1T26A 3GH3A 4LN1A 2VWQA 3KYDB 4E2YA 4DIBA 3DBHB 3PQFA 4D0RA 5KVCA 4HNHA 4ZQHA 2EIHA 4R54A 1U3WA 2YHUA 4XA8A 1WAMA 2PZMA 2QYTA 2ZB4A 3OH8A 1I5RA 1MFPA 5KVQA 1LDNA 3PQDA 4PG5A 5AXDA 4EDFA 3EW7A 4Y67A 3TOZA 2VUUA 2QIOA 4YAIA 3V1TC 4FSHA 1EDOA 1UXJA 2O3RA 2NWQA 4YRAA 3WGTA 1BVUA 3VC7A 1OBFO 4BKUA 1BXGB 4NU5A 4O6VA 3B1FA 2YZ7A 4XKJA 1OAAA 3GK3A 4GWGA 1M6HA 3NEPX 5C3MA 3WWZA 4A5OA 5CDSA 4D42A 3GMDA 4B3HA 4PLVA 3NV9A 5TS3A 1QSGA 5ER6A 1EMDA 2PNFA 4CMIA 1DBVO 3ZWMA 2AW5A 3D7LA 2AQ8A 4BMNA 5KOIA 4AL4A 3A06A 3C7AA 3L6DA 5AXCA 3JQ7B 2GN9A 3WS7A 3E9MA 4IINA 3IDSA 1JWBB 1H6AA 5L9AA 4E30A 3LT0A 3C1TA 3DB2A 3QIVA 3NUGA 3VZQA 2J3IA 2Q2WA 4B79A 4FS3A 4L9RA 1ULUA 4GH5A 5T57A 4CLXA 1UP7A 3EC7A 4RPKA 1Y81A 3BMNA 5HA5A 4ND2A 5DCWA 1SB9A 3QWAA 1U3TA 3OBBA 4J7XA 3G79A 4ZN6A 2C20A 3RUDA 3WTBA 3TN7A 2RH4A 3FR7A 4BNFA 4IJUA 1XSEA 3I9MA 4M89A 4E33A 3JD2A 2GERA 4CODB 3V1YA 1ONNA 3O26A 3PVZA 3GN2A 4WCDA 4M49A 1HETA 4RVSA 3ZWYA 3VVBA 5KJ1A 1EVZA 2F1KA 1I24A 1E6WA 3PWZA 2EG9A 4R1NA 1Q1NA 2OHXA 2YDYA 2DTEA 5HM8A 4TZTA 4Q39A 5I9NA 2JHGA 5KJ6A 1NQ5A 3U3XA 2NADA 3ENNA 1Y9AA 4XCVA 1GZ3A 1WNTA 4CM3A 3NDRA 1M67A 3WQSB 2WD8A 2XF8A 3DFUA 4KUEA 4NFSA 3VH1A 1V3TA 1WWKA 3NGXA 2Q1WA 4RZIA 4ITUA 2VN8A 1KYQA 3WNVA 2Z1NA 3MWEB 3I83A 3PP8A 3PLRA 3FI9A 1P1FA 4R3NA 2NUAA 2PV7A 4W7HA 1DAOA 3ZGYA 4XZ3A 4LSWA 1E6UA 1EQUA 5JW6A 1NPYA 1SPXA 2HDHA 4ND4A 3NX4A 4YJDA 3HADA 4HFRA 2QZZA 4LMPA 4KUHA 5MGBA 5IDXA 4DBZA 4LRTB 4L76A 1UZNA 1BSVA 2WJPA 5C7LO 1MP0A 2QW8A 2XPCA 1Z82A 2Y93A 3Q6IA 4I5GA 3HB5X 4GQAA 1ZJYA 3DBVO 1MUUA 2OBYA 2VT3A 3LF2A 4I5EA 4PLWA 4BNGA 1XYGA 1DDOA 4NJMB 4BNNA 4NNJA 5DBFA 2FWMX 4D44A 2Y1GA 2YY7A 4QFCA 1CETA 1DC5A 3AJRA 2YQ4A 1T4BA 3FCOA 5BNFA 5TT0A 1NQOA 1X7DA 3G17A 2VYNA 1OMOA 1E5QA 3AOEA 3GPDG 5DCYA 2IZZA 4UEOA 5EIOA 3PYLA 4F3YA 2DTXA 1I2BA 1XDWA 3VPSA 5K9ZA 3K5PA 4W4TA 4AJOA 1HTBA 2NTVA 1YOVA 3D4OA 3ZI0A 5CAEA 1P1JA 1VJ0A 3W8EA 2ZB8A 3DBRB 1PQUA 4BIIA 3LU1A 4RVDA 2GPTA 4BNVA 2BGLA 3H5NA 1F0YA 4N54A 4YDRA 3MEQA 4MIOA 2B4TO 3PFFA 1VPDA 1Y6JA 5L4LA 1PL7A 1ENZA 2BFOA 2R00A 5G4KB 4JK3A 1ZUD1 4TRNA 2E6UX 1VKOA 5IZCC 4YACA 4MIEA 3E03A 4Q3NA 5I9LA 3SEFA 5CG2A 2YV3A 4JXKA 2VRCD 4TVOA 5H81A 2C29D 4RVHA 4Y98A 1G6KA 1R0SA 4FIZA 3RC7A 4UVGA 3PJEA 1LA2A 1F8GA 3N58A 4URFA 3FNFA 4JNKA 4NDNE 1G0OA 3OIFA 4TROA 3KSDO 2Y68A 3LQFA 3V1UA 4D7AA 2DAPA 3L6OO 1T2AA 3JYLA 4L0QA 3KM0A 3N7UA 4PRLA 3R3JA 2GN4A 2WMDA 1E3WA 2HSDA 3N74A 4GSLA 1H94A 1I3LA 3NKLA 3WXBA 1JWAB 2JKVA 2C82A 4KTTE 3O4RA 3MJSA 4IS3A 4N7RA 3WTCA 1ZK4A 3H2SA 2DTDA 3VAZA 5JYFA 1HDCA 3RROA 4Z3KA 5HS6A 4I8XA 1Q0HA 3VZSA 5HBRA 1BDMA 2G0TA 1GYQA 4OYRA 1BRMA 4WCFC 2IZ1A 5A03A 4XDYA 3TNLA 5JY1A 2FPGA 3I4CA 3H9EO 1TT7A 1YS4A 1K3TA 5ER9A 3ZHZA 5IDWA 1SBYA 3H9GA 4FN4A 5G2OA 5KNLA 1EUZA 4RO0A 5DT9A 4DIOA 4QO8A 4LSMA 3JQCA 4M87A 4GX2A 2B4QA 3G0OA 3L9WA 1DB3A 2QG4A 1PU2A 2V6MA 3OIDA 4OOEA 1CJCA 5T67A 2G76A 4AFNA 4OO3A 4L4SA 1CWUA 5DF1A 1IYZA 1A27A 1EE9A 3BMOA 1E3WB 1IULA 3C7CB 1GDHA 4FFLA 3AU8A 3HG7A 3KBOA 3E8XA 5DP2A 1B26A 4YT8A 1DRWA 1GPDG 2Q3EA 4Z0PA 4HKTA 4CM6A 4CM9D 3IUPA 4AJ4A 2H63A 3M2TA 2D1YA 3A9WA 3ONEA 5C37A 1E7QA 3W8DA 4YRBA 2I66A 1K6JA 3FTPA 3QY9A 1NYTA 4BMSA 3RVDA 1N7GA 4BGIA 4I08A 4ALIA 2BGMA 2PWZA 5TX7A 3WYCA 3HFSA 3W4KA 1QYCA 1WW8A 3O8QB 4YEDA 5KJCA 3QP9A 3ZWCA 1PJ2A 1FJHA 4MVJI 2EGHA 4YJGA 4R5MA 4XGNA 1C1XB 4IIVA 4NBRA 2QRKA 4D3FA 3FD8A 3ZNQA 3ZWWA 1DPGA 3P7MA 5EESA 2Y66A 3OEWA 5EERA 5CDTA 1LDGA 2VRCA 4AJLA 1UXHA 2VWGA 4W9NA 4J2HA 4AJIA 5G0TA 3LSYA 1D4FA 4YVFA 3WFJA 3HN2A 3JQ9C 1ZKMA 4PZCA 4OQZA 1BXZA 1XWFA 5BNTA 2ZKLA 3G1UA 3PPIA 2EKLA 4O1MA 4QUKA 5K6AC 4QECA 5I9MA 4DWVA 4WLVA 3JQFA 4E21A 2QZ9A 1GYPA 1O0SA 2GDZA 4UUMA 5HTOA 3BMOB 4ALMA 1R16A 5JY6A 3PQEA 1S6YA 3CMCO 4XQ9A 3NDJA 4CLDA 5AQ1A 1P1KA 4OSPA 5JFOA 2VCYA 5IZ4A 1B0AA 3I6QA 4J4BA 4U6SA 4FD3A 1HE5A 5T8KA 5U4QA 3VZPA 3V2HA 5TT1A 3BMQA 4DQXA 2QX7A 2XAAA 2W2LD 2FZEA 3CIFA 3FF4A 4JROA 1N92A 2HK7A 2Q1UA 5G0WA 4ZICA 3JQGA 3GFBA 2EHDA 2DC1A 4NFHA 1UXGA 3RJ5A 3DAPA 4MKXA 1DC3A 4L75A 3U62A 1CDOA 4A26A 1WDLA 4RF3A 4B8ZA 3MOGA 2AA3A 1OC2A 4OKNA 1U5CA 4BGEA 3WBBA 1I2CA 2AEJA 4ZGWA 1TEHA 4R1UA 3GDGA 1IOLA 1YQDA 2PH5A 4K6FA 1TA4A 2JD2A 3IUSA 5BSEA 3H3FA 2AE2A 4BB5A 1T4DA 5BNIA 1R4MA 1IPEA 4R9RA 5F21A 3DZKA 4E32A 1LDEA 4G81A 3QA9A 1C0PA 3ROMA 2Y1EA 1BW9B 4NU6A 3SLGA 3ZZNA 5A1TA 1ZSNA 1WMAA 1E3IA 2Y1FA 3NTQA 4PLYA 4AICA 2HK8A 3JQGB 1P1IA 2POQX 3WOHA 3RU9A 1HDYA 2ZATA 4PZDA 5L95A 2B83A 1T24A 1A7KA 2X0JA 5CDYA 1IHXA 1CQJA 3VVCA 4QXMA 3UXYA 4E5PA 5BSGA 1ARZA 4HADA 3JYOA 1DJNA 1H2BA 4MPDA 4YR9A 1DC6A 4MVJA 2O2YA 5DULA 3HDHA 2J5QA 5FI5A 3BHMA 2PZLA 2Y0EA 3WICA 1KVTA 1XHLA 3OICA 3I1JA 4PVDA 1DHRA 1YB4A 5L45A 3WG9A 5JS6A 2X8LA 2D8AA 4XYLA 2WTBA 3TSCA 5U1PA 1HKUA 3JQBC 3BTUA 4CV0A 1NX6A 2Z1MA 2D0IA 4HBGA 2D59A 4IDGA 4FGWA 3VH3A 4AJPA 4JLWA 4EUHA 1I2ZA 5CDGA 2VWPA 4BGVA 3GEMA 4IXTA 1KEVA 3WGGA 5I7EA 1A4UA 1F06A 2BLLA 2DM6A 1VJTA 1W0CA 5JDCA 5J23A 4ZVVA 2IODA 4IDFA 5EL0A 3TZHA 5ICSA 4AJKA 1C0KA 4GVXA 1U4OA 3ZW8A 1E5LA 1PZHA 3IQDB 3AI1A 3MTJA 5HWSA 3E6AA 1NQTA 1HWYA 1LXCA 2Q49A 3Q0EA 3AUAA 4PLFA 4XJSA 4XX0A 2FPPA 1DSSG 4LW8A 3ADPA 4J1QA 4FCCA 1SC6A 1TVEA 2ZB7A 1M76A
chains in the Genus database with same CATH superfamily
3F6CA 2AR0A 2HLPA 2OP0A 1P18A 1UZUA 5CMLA 1WXFA 3LUKA 4YRQA 4I8DA 3K92A 4P82A 2PFGA 1IWPB 2O8DB 1FU4A 3IGFA 4CV3A 4X6YA 5EWMA 2I3GA 2IC5A 2IEBA 3B78A 1IB6A 5AM2A 3O3CA 2HJHA 5JALA 1OYWA 1ONOA 1JDUA 2VTVA 3A31A 3MXTA 4AF7A 2C77A 5K0JA 2HIGA 2XGSA 5AKJA 1X19A 4AS1A 1UC5B 1S2DA 5AOAA 4AX4A 2OV8A 2RGUA 5FXMA 1USUA 2J30A 3A4VA 1UOOA 3AIIA 3E53A 2CFOA 3MJHA 2WQ7A 1ZCBA 1Q91A 2PYIA 1PJLA 2UZ1A 5BWNA 2QL7A 4Z54A 1A4IA 3GDFA 5CLGA 1KSHA 5CK5A 3UJPA 3A6JA 2VZ9A 4JXJA 4K3VA 1WU8A 3IAS1 4IKEA 4MWEA 5ALIA 4DMUB 4DWWA 3ZDEA 4A2PA 3X1JA 3DE2X 3L7KA 3TLCA 4RD3A 5KYGA 5MN6A 1PGNA 1V0JA 3HEBA 2JD1A 2CMDA 1YQ9A 2LDXA 1WQ4A 4URZR 2ZS8A 4WPGA 5FI3A 2C2KA 4GDMA 5B1YA 4MR8B 5EHIA 5KSPA 1HG0A 3H9BA 3IEKA 2JHCA 3FOZA 1R2QA 2D5CA 1MCZA 4E11A 5IG2A 1W4AA 3OM9A 1H8EA 3GT4A 2QD3A 4OGGA 2Q8QA 4M9XA 4QARA 4AZ3B 2RSLA 4IIJA 2W93A 3EBOA 4HMQA 5DCUA 4IR7A 4UHFA 4EUKA 3O2SB 3WYAA 1XVLA 3GB9A 1WU7A 3NIFB 4OI2A 2XMZA 3R6LA 4XUEA 1E2NA 1PSZA 1XROA 1A9SA 3EQZA 1Y34E 1ZHHA 5AP9A 5K8LA 3DA8A 4G89A 2HF8A 2XB6A 5AVWA 3GVPA 2L82A 2W6ZA 5AXAA 2ZITA 4RKWA 4MGYR 1GPH1 4O2BF 5HJEA 3QEBZ 2Z9DA 1SC3A 1T0JB 4MLZA 2YXNA 1EXNA 3TR6A 4UAGA 1XCLA 3I5XA 4IUYA 4ER0A 3VPAA 2EJWA 3Q5EA 1D4ZA 1R27A 1NXTA 4Q4DA 1BDJA 4KLRA 1LF0A 2AFIB 1R6DA 2WJ4A 2RJOA 2E4XA 4LYHA 5FWXA 2ZUVA 3ELDA 1KJQA 2P3SA 1NVXQ 4YRFA 3U5ZB 4E09A 1T43A 3QX3A 2ZYDA 1E6KA 4CL2A 3H2YA 1Z7YA 1UPCA 4UTOA 1WBJB 4S04A 3KQKA 1XYVA 3NHJA 4O4JB 1V45E 4X95A 2ZS7A 1CQXA 1H1LA 2ZJFA 3VKFA 4EKYA 3VPGA 1PUIA 3LF1A 3DEIA 4OXKA 1VRCA 5M2QA 2FHSA 1GUFA 1CERA 1WHSB 2X2OA 4QQNA 1D09A 1UCFA 3EN0A 4ZT4A 3OECA 3RS3A 3KD3A 3MT0A 1NRJB 2ZWMA 3DG9A 2HPZA 5F33A 3K9CA 2YWHA 4HXYA 3SSNA 4GMGA 4HQOA 4BNXA 2QTLA 1OUMA 1UFRA 3K1AB 3WNBA 3DL0A 1M2WA 2BHRA 1IM8A 2DSTA 2H5IA 1DIHA 1XZPA 2VZ0A 4Q4AA 4TT3A 1P9OA 4NYJR 1G6OA 1OA0A 4P1ZA 4EPRA 4NYMR 5F7JA 1QO0A 3T7DA 3MF4A 4ER6A 2DBVO 1GPWB 3O8OA 2PRKA 4M9CA 5C1PA 5IKMA 1EB9A 3O73A 5T3UA 1VYHA 5AVQA 5ALGA 2FUNB 4YP6A 1XEWX 4RVCA 2EKPA 1N2EA 1WLSA 2ZDQA 3S2IA 2VDUE 4HAOA 3FAZA 3BT7A 2AVNA 4LDQA 3MM4A 4JI0B 3QRWA 4RXMA 2ZJ3A 5G1NA 2HMTA 3WIBA 3ZYZA 2OO5A 1AMNA 4BMYA 2CXNA 5JQGF 5A2GA 3BULA 5G41A 2IHJA 3S7ZA 2YVQA 1DXQA 2VP5A 4UUPA 2QRVB 3SJAA 3V4LA 4R84A 4JYMA 4BZXA 2G6BA 3TWOA 5HM6A 3WIDA 4D3XA 4YIKA 3QF4A 2ZYAA 3L6BA 3NH9A 3V42A 3C5CA 1AQNA 1RTTA 5JHGB 2XQVA 3HM2A 4EB3A 4FMBB 3RI3A 1IZ9A 2X7XA 1RBZA 2E18A 3TVYA 1L5VA 2VPWA 1DFIA 3GJRA 3K0CC 4U2GA 3NTLA 2RONA 3FPCA 4ASUD 1NT2A 5JROA 1KP9A 4LF8B 2PSSA 3EAGA 1X7GA 1QE0A 1J6UA 2WA1A 3X1KA 1YCDA 1N2CA 1M73E 3ZZTA 1KSGA 4BDTA 3RSHA 3BXHA 1RHMA 4O2RA 3DMPA 5JNVA 3BFPA 3EXIB 3WNCA 4D6XA 3VYTB 1V8OA 3D7KA 4H4DA 3U09A 4G2TA 2RC6A 4RDHA 3WISA 5B1IA 3E3AA 3QTTA 4GKVA 2B21A 1PFWA 1ZK3A 3JD1A 4PE5B 4TXNA 5JCJA 1I9GA 2R4UA 3PIDA 1YACA 2IHYA 2QP9X 2BFDA 3IR5A 1UAYA 4KBGA 4MA5A 1E4OA 1G19A 4B43A 3X2SA 4A0RA 1A8UA 3BEOA 3OX3A 4ZVRA 2P5YA 3ZBQA 3AINA 3EDCA 5L7YA 5THQA 3KKOA 1U0BB 1JH8A 1KRXA 2FZWA 1SEPA 4DILA 4PGFA 2FPKA 3H17A 3V55A 1VIVA 4WXYB 3WLEA 2QROA 2FTKE 4PAGA 4A27A 4X71A 1FFCA 1Z2AA 1RZRD 1NG1A 1GR0A 3MRSA 2I3ZA 1X9IA 4MR7A 2PQ0A 3E9ZA 2HF9A 3OOHA 4KZPA 3GAZA 1K97A 3R5FA 3T7CA 3P96A 5LP6A 2OWDA 2I1QA 2H11A 1NVFA 1Z12A 2HJ9A 3GXOA 3NWEA 4LIPD 4U9IS 3VHRA 1OX4A 1X0XA 3HB1A 1CZKA 2P75A 3WGYA 4HF7A 2XHEA 4J9VA 5CJJA 2WB2A 4UVHA 4WGFA 2XAUA 3O1LA 2OT3B 3KPJA 1S1CA 1GCOA 2BCEA 1DX4A 4DCVA 3S81A 3P2OA 3AR3A 3I9OA 4BB6A 1DEHA 4BFYA 1BJTA 4TRMA 1SOWA 3I0ZA 3VJLA 1U0FA 4V2IA 4RTOA 3RVPA 2I0FA 3CB2A 3SDBA 3SR3A 3HJUA 4XWOA 1XLUA 5F2KA 1H2ZA 2GDJA 1YQGA 3M2PA 4OOFA 1TRKA 3E35A 4IHJA 1ACJA 4G0PA 3GPBA 1OGJA 3SIWA 2WF5A 3Q5DA 1LC0A 1OZFA 2PKQO 4M9ZA 3R41A 1SOVA 4AB1A 5IFKA 2BTQA 1VKRA 4LECA 1KI6A 1KAEA 1RADA 3T12A 1CF2O 4OL0A 2BI8A 3BZWA 5DV9A 1QHYA 3BA6A 3CW8X 3CVVA 5HIAA 2ANCA 3CJRA 1WA5A 2RAPA 1LSJA 3HA7A 3MJTA 3PNVA 1Y8RB 4MWCA 2R00C 1A5TA 5DWVA 2HA6A 2V74B 4GBMA 1J56A 1OGYA 3AHIA 4DLLA 4EG0A 3CEAA 5ADUS 2NX2A 3C41J 3M5CA 4D0SA 3KPWA 1JE1A 4EECA 4CV1A 4TVBA 2HU5A 4IRUB 1WXDA 4YY3B 1BVHA 4FNMA 3TLEA 2FCRA 1TYCA 1O8CA 1HFWA 1QE3A 3UO8B 5LQRA 4JAVC 1L1FA 4GGPA 3UGKA 5MN4A 1FXSA 2O2EA 3E3MA 5CYGA 2BGGA 8LDHA 4EBBA 2XCRB 2ZIZA 1XD9A 4WNYA 4JYZA 2OHHA 3EH2A 1WIWA 2FWJA 3QG1A 4CQMA 5LL6P 3D6HA 1EGVB 4EO7A 4P84A 4GSKA 4W8HA 2OOKA 2XQGA 3JATA 3MWGA 5A5EA 4TM8A 3AJAA 3WWEA 1NLUA 2YRFA 3KVRA 4U2KA 5CAEB 3S44A 4H59A 3GJ4A 5H83A 1NQXA 4JI3B 2B99A 1P8JA 2QG9A 4TM7A 4NABA 5CP8A 3CFYA 1FSPA 4QOHA 3QNUA 3PRJA 1FVHA 3EHDA 4S1VA 4QQ8A 2HUPA 2Q3LA 1EUYA 3C85A 3ZVLA 3GX1A 4R2HA 3W04A 1TGVA 4F9TA 1X1QA 3AVPA 1QQ5A 4ZYLA 2ARKA 3KPVA 5JXJA 2ZUTA 1K7CA 1YK1A 2B5WA 3CISA 3GY0A 4PZLA 4RJTA 3IKTA 2QT0A 1JHUA 4URVR 2W48A 2AG0A 1GQRA 1HQKA 1NN1A 4CMIB 1HE4A 1JSXA 1SCBA 1OH6A 2O2CA 2FRDA 3E7PA 4TKUB 2F8SA 3KO8A 2ZJ6A 4PQRA 3ZN2A 1I79B 1ZM9A 3ABSB 3IOMA 1BHQ1 1CD5A 1M72A 1NULA 3EZLA 3V7WA 3VNQA 1LPAB 3L82B 2VYVA 1PRYA 1V2GA 1SZJG 4TMFA 1SB8A 2GUWA 5CFMA 4ECAA 1RHKA 3WLTA 1EUCA 1QRTA 4DPKA 4DSNA 5BMVA 1XU4A 1BA2A 4NNPA 3RD5A 5AJYA 1CUYA 1XU7A 1YRQA 3FM9A 4I1IA 1JA0A 4JOBA 1KVQA 3V4RA 3AO0B 1FFGA 3LBFA 5FUMA 1YA6A 4ND8B 6AT1A 2PXHA 4L3WA 4RF5A 3UUGA 2WILA 5M6DA 3V3TA 5EXDA 2AH5A 3L4JA 4GF5A 2IF2A 2XKJE 5H70A 1CY4A 2RHTA 3QVMA 4JWTA 4MVJF 3A3PA 5T73A 1DO2A 1EM6A 5JMPA 2ZJ2A 2BGUA 4IPTA 4LZZA 4F4HA 4AJ9A 2OXFA 2VI5A 2VJMB 4L57A 1N2GA 4EY4A 3H9JA 3KKNA 2HMAA 2WU1A 3AT1A 2CVZA 1NKVA 3M8KA 4HP8A 4XX1A 4C0BA 1DKRA 1VJDA 2CY0A 1V7PC 3ANNA 4AKTA 2J3LA 1G59A 1RLUA 4L6IA 1NN0A 1DMSA 2Q5QA 5K3EA 2E7ZA 1W36B 1P9LA 3U4GA 1JPUA 4CG0A 3IELA 1N2IA 2FZKA 3G5UA 4YYEA 1BGWA 1TF7A 1ZIPA 4E15A 2XECA 4ZI7F 1XHEA 2Q29A 3IODA 1WF3A 1FYWA 3NAQA 5HKBA 3GNLA 3IQZA 1CDDA 1Z28A 2AFVA 3RS2A 4LZLA 4BFVA 5K6AA 5D6OA 1CS4C 4AZVA 4IYJA 4N5LA 2GMWA 3HKDA 3H4VA 1KOFA 2ZTHA 3DZBA 4IMRA 2NZ2A 4KQJA 4TSFA 1QZUA 4QREA 5F1KA 2IYXA 3AFMA 5LYJF 3ENVA 2ZSJA 2L42A 4ALJA 1TJYA 2BP7A 1EHIA 4B3TB 1KI6B 1YCFA 2VP6A 1Z39A 2K2QB 2XRFA 5DSXA 1QIHA 1J70A 3HO1A 5DPMA 4F6RA 3AHHA 1KZYC 2CWWA 1IVNA 1AQIA 1CDEA 3T61A 1F51E 1YDGA 3MWDB 1QG4A 4GNRA 2ZE7A 3DZDA 1ZMRA 4HN4B 1J22A 2J3DA 4G86A 1QH1B 1E9AA 2XYRA 4JCOA 4AMVA 1C3LA 1JHYA 4UFPA 4YLYA 4NNOA 3ESXA 2FMUA 4KQIA 4PEVA 1UDCA 3OCUA 3NIGB 2HYIC 1G8PA 1UK9A 4K6HA 4RDCA 3ZI7A 2KHZA 4LOLA 4CEHA 3G8DA 1F3OA 5ETJA 4QE3A 4GOXA 5FV4A 3UXEA 4B3XA 2I4IA 4A6EA 3UHAA 1HFJA 4RTRA 3KCQA 1XI2A 2YVKA 5BN5B 5C80A 2X8BA 3V32A 4HZUB 1UM8A 1UR5A 4JX8A 3RRXA 4C7VA 5IC4A 4YRIA 4E51A 4NF2A 3I42A 3MINA 3CT4A 4DRZA 4TYNA 5JZMA 4LOKA 3JQAD 1IBCA 3Q1KA 4C5BA 1XMQB 2QQEA 1DEOA 1NNI1 3B51X 7MDHA 5H4GA 1D7OA 3O4IA 3TPFA 1AXEA 1ZM3A 4EJMA 4Z4EA 5FPTA 4B4OA 1W1IA 1VSUA 4IL5A 4CIAA 4RTQA 4YAEA 1MENA 3CPSA 3A6LA 5JCJD 4HX5A 1SUDA 2BHLA 2AE1A 1JR3E 3F4BA 3NC0C 4MB6A 3TX2A 2W8BB 3EJ6A 3THWA 4KVGA 1LV7A 3HMKA 3MGKA 1WSDA 3JYPA 3A10A 4C07A 3W6ZA 4O3FA 3PNMA 3ILSA 3DAOA 3FA2A 1NZDA 3WKAA 4U7FA 4EELA 3U80A 5LNK1 2VQDA 3OIGA 4XQEA 3R0QA 5DBIA 1YSCA 1QIEA 4BB9A 2C9DA 4R8LA 3MTGA 5IASA 2RI1A 3LC1O 3FLAA 4ZEVA 2ZI6A 3JU3A 2PBLA 3ASZA 4UMVA 1HMPA 5F2OA 2P1DA 1N8SA 5BSHA 1A1VA 1OX4B 5D5PA 3GJYA 4RA9A 2HTFA 3THYB 4B34A 4MP6A 5DYYA 2QTRA 4ZAZA 2ES4A 2R3SA 3O0DA 1QGAA 4OP3A 2YV2A 3NIDB 4UJ5A 5EQTA 3U4HA 3UJCA 4PN3A 4U39A 4F2DA 1XD2A 3UV3A 1P72A 3VC2A 4UNRA 1HZZC 4UTZA 4ZHQB 4WJKB 4QOIA 2HF2A 1YC2A 2B37A 2XR1A 1WP4A 5KOJB 4GL4A 3K32A 4HLNA 5BSKA 5KYNA 2FEPA 1KBOA 4M60A 3SNKA 5ANRB 4YUZA 2PANA 1T0HB 1JYEA 4JJ6A 1HLDA 3KOWA 4RD2A 3KBBA 3ZJ4A 2UUBB 4TWIA 1NM5C 4OD0A 2QN6A 4A6DA 4GWLA 4ZYTA 2C5BA 1O1YA 5A4IS 2WNHA 4IDDA 5KOYA 3ROKA 3FFAA 2O5EA 1EDDA 1HDRA 5JE8A 4DANA 5CA1F 1NBME 7REQA 1JAXA 2JIZA 1Y1TA 1ZMTA 4LEIA 1XOIA 1XG5A 1P2GA 2CXOA 4KCGA 4MR7B 2GTHA 3OFSA 4N0EA 3P94A 1P75A 3D02A 2BPOA 3PQ8A 3DHWC 3HC7A 4J1NA 1TQ2A 2OBLA 3QQPA 1FS5A 1QRRA 3UAVA 4DC1A 5BURA 2P5UA 4J7UA 3QPVA 5EJ5A 1MAAA 4M8KA 1PBNA 4AUKA 5BYAA 4PW0A 3TUZC 4JXZA 4AKGA 5AJUA 5LR6A 2HWUA 4E5YA 2YHIA 2NYAA 3FCYA 3M4ZA 1WW2A 4ETWA 3VKHA 2Q46A 1V71A 3IKMB 1O95C 4C7KA 1T6ZA 3R7SA 5ERGB 2I91A 2P2DA 1L4HA 4LE0A 1CBUA 1H9AA 2GHQA 3OE1A 4N4AA 5AMXA 1GQQA 3SCZA 4BVJA 1E64A 2PBRA 3BSWA 3LIPA 2NU8A 3SEZA 2H2DA 2WT4A 5H3CA 2A0WA 2AJBA 1DKLA 1ZIYA 2A3RA 3WMEA 4BFWA 4B31A 2XQJA 3BZUA 4YH1A 1WDTA 1FTSA 1KJIA 4XCXA 5EP2A 2QT1A 5E4YA 2NU9B 3S1LA 1H42A 1WCV1 2JGDB 4NCHA 2ZZKA 3RVQA 5A3JA 4DBVO 5J1SB 3GLIE 3UH1A 2Q41A 3KJHA 4P54A 4TMYA 1LJLA 3CLSD 4P7BA 1CZHA 3B7GA 3NCTA 4LCEA 3AVXA 4XB1A 1IG3A 2ZWPA 5IF3A 3WV4A 3H5WA 4LJYA 5KAMA 1BFKA 2O59A 3P2EA 1P0FA 3QFSA 2V98A 4YV2A 5JRJA 5B53A 4FTWA 3IPRA 4OJKA 2YASA 3QENA 1NI3A 1L8QA 2VJBA 3P0HA 1HSZA 1YA8A 3NRCA 2XZPA 3HVHA 4QPZA 4RAOA 2VOEA 2CNLA 4K9LA 2GD6A 2XIQA 2HHAA 1R6AA 4IMPA 1JFTA 3VPCA 4DPMA 1KYWA 3JYHA 4LE1A 2FW1A 4YCCA 2QGNA 1UYJA 2HA3A 2FFRA 3FMIA 4PFSA 3FN4A 1XZDA 3STUA 3BMQB 1VECA 1U2GA 2OCKA 1B7GO 3H7IA 1ZYUA 1WL8A 1QP0A 4WA7A 3I0NA 4XD7D 5AM4A 2ZM5A 1DXYA 4E1VA 3VX4A 1H8HA 3KTAB 3VTAA 3QKUA 4KE8A 2C5AA 1K3UB 1MOQA 1U2GC 3L07A 5KIAA 4P7KA 2VDKB 3O4JA 1DLIA 1FB5A 1JDZA 1JSRA 1ORTA 2O7NA 5JDCC 3BWXA 3EOZA 3O8NA 4JJ4A 3ZBUA 3C39A 1PX0A 1TQ6A 4UBOA 1P74A 2GNAA 1BE8A 1W1UA 4HTFB 4ODIA 4WLFA 4BIMA 5GY7A 1GN8A 1TW3A 1W8DA 2NPIA 1X7XA 2REBA 3IC5A 3Q12A 5LQAA 1N77A 4JT8A 1KWKA 1ZH4A 4DA9A 3OFJA 1ZXXA 3HB9A 1QGZA 1PV1A 2UZAA 1E1LA 1Z7WA 1GL9B 2JZOA 5KTKA 2WWGA 2CK3A 3HDJA 2YW2A 4IKPA 1II8B 1X2BA 2OCYC 1P4JA 1ADFA 4NESA 4UDXX 3QV1A 2NG1A 2WP0A 1Q2UA 2JFYA 1BEUB 3WBKA 5JS8A 3W5AA 2HI0A 2XH8A 2TMYA 2ECFA 3A37A 3L02A 1PNVA 2NXJA 4GLOA 1GGHA 2YVLA 1ZGBA 2JGMA 3E81A 1EFPA 4IIJB 1M7BA 1TKBA 5EPEA 1IUNA 1QV7A 1X87A 1D2RA 4NZ9A 1RLTA 3NHAA 4G5GA 5TF4A 1VYTA 1GGNA 4RPCA 2ZT8A 4ZHSA 5FNVF 1EFRA 2GM4A 5ED0A 1WDWB 3V8RA 3R09A 5LJLA 1M34A 1J42A 3ND5A 1AUPA 2RKWA 4RFSB 5L40A 3KKMA 3BXGA 1MBZA 2IH5A 5FF9A 3IHLA 5BMVF 5AJXA 1JVSA 2ENWA 3FNQA 4RHCA 3BFVA 3QGMA 4V0NA 5F3RA 3A8TA 2IBMA 2PFSA 3K0FA 5KQSA 1A8IA 5ALTA 5A0FA 3F49S 2HRZA 4N65A 2JLYA 1E1QA 4FGSA 2RGCA 4G9BA 1WZCA 2HK9A 1JT2A 1CUGA 1X1EA 1KC3A 2V4UA 4XEUA 3JR7A 5FUVA 5T8KC 3EULA 3PD7A 1L7XA 2WR8A 5TE9A 1PKEA 4DCTA 3O2QB 1C1YA 1ORWA 3Q15C 4MQEB 1GGVA 4MA0A 2Q4OA 3DNPA 2GZ1A 1BFUA 2H5JA 3SZOA 1P9WA 3AUXA 4ZA2A 1B2LA 3E5HA 2OL4A 2R97A 3MSCA 2G80A 1DINA 2P41A 5G0SA 5K5EA 2NT3A 4MWOA 3LBAA 3F4LA 4MQUA 4EZBA 3WC4A 1TAUA 3R3YA 4KQHA 4MS3B 5LA6F 1JB1A 5BUQA 1CJVC 4DYDA 1GCUA 1YS9A 2O2DA 4UQLA 4KYVA 2DHRA 1VCMA 1RXEA 1L7BA 2H07A 4ZV4A 3QBTA 2B8JA 2REQB 3PICA 5HF5A 1FE8A 3V8PA 1JDBB 3SBEA 4F06A 1STOA 3LBHA 2FQQA 2B94A 3TIGA 1B15A 1QORA 5G4LA 1NR5A 2ZUEA 2QTCA 3K16A 4A15A 2Q5CA 3RPEA 2EFDB 2FWAA 1QK3A 2NW6A 4Q3KA 1U8FO 2N1MA 4UFOA 2GN6A 4I8IA 4DQ0A 3PDIA 4Y2SA 4F92B 1E8DA 2GASA 2J85A 2OD9A 3AF0A 4L51A 4QICA 3EC1A 3N5KA 2QPOA 2HU8A 2W2TA 1H22A 3Q87B 4K88A 2E9SA 3NFYA 5BYBA 5LQDA 1JU4A 2R6DA 2PCJA 3F3SA 2IU4A 3NM5A 4ZJZA 1YI1A 2QLFA 1D8AA 3O7WA 4FILA 4JOSA 5JAQA 4EKNB 1WUIS 2JLRA 4KRGA 3FGNA 3N0TA 5EINA 3KEMA 1V39A 2UV8A 3FMOB 3ROGA 3RYHA 1U2QA 3S29A 3BGDA 1XA0A 2QTNA 5DSTA 1Q2XA 2QT9A 1NU8A 4MI9A 2QS9A 2C8JA 4IJVA 3O5AA 4OQYA 4B6SA 4B9EA 2FDCA 2HF7A 4WL0A 1IM2A 1GU0A 1R9JA 1ZINA 1FUIA 2BKUA 3RYIB 4UE2A 3SLKA 3N6VA 2JFQA 2XODA 1QIJA 2P9QA 1PL8A 4RK7A 2VH1A 1Q0TA 4OHOA 1ZD5A 4DMGA 1MA3A 4WW0A 3W3ZB 4AJEA 1RKBA 3CNHA 3D4IA 1S2OA 3GGPA 2LNDA 1RQGA 3L3BA 1YJ5A 4JLPA 4K5QA 1A50B 1GZ6A 4JBIA 3H9CA 1NBMA 1UBFA 5CA1A 3KJNA 2ANBA 1K5HA 1V5EA 3OZCA 2SBTA 1I0IA 3DMYA 4FFWA 4NRDA 3A6FA 5FOXA 3OZGA 4C0XA 3UQZA 4EOGA 1IRIA 1F17A 5IVIA 4WDRA 2XDQA 3I1YA 1KZ7B 4FDVA 4R9SA 4GP7A 4EI9A 1UAAA 1T4CB 4KC0A 4E5NA 2AN3A 5BW8A 3WB0A 2EP7A 1KA9H 2C1EA 1DBSA 1SBTA 1FFEA 2GK4A 5FOQA 1UMBB 2XCIA 4ITVA 1I51A 1IE3A 1P3DA 4S1OA 3WWDA 3AY6A 4F1WA 3MS2A 3F6EX 1E20A 2I6QA 2DQ4A 3IP7A 1N7HA 4MJLA 4JYPA 4L0CA 2QI9F 1R8QA 2B20A 3RSGA 6CHYA 3ITNA 3LBNA 1Z36A 5TS2A 4LNUB 3IAXA 1C7ZA 4HQNA 3VTZA 3QELA 4XJTA 3FVRA 3VH4A 1JJBA 1UBJS 2J3MA 3BKXA 5DGXA 4ZT5A 3UT5B 4F4CA 1KQFA 5IF9A 1ZD3A 2RHCA 4YUAA 1P7CA 5C35A 3RRZA 3HZZA 3ZIDA 5KWIA 4C78A 3U4AA 4XGKA 4L4RA 1NM5A 2Q6TA 1WXHA 2X58A 1ENPA 3AEUA 1Y5LA 3DDCA 3NOQA 4FT4A 4IH1A 5ILOA 2F00A 1N3YA 4XDGA 4YHHB 3OP4A 3QE9Y 3ZUPA 1TLTA 1WZEA 1UKEA 2FFQA 1XKXA 5SYMA 4TV9B 3MUEA 3FOBA 2C3MA 3Q3GE 2VP2A 4RESA 4QGSA 3NTUA 3GLGB 4Z4GA 1OFVA 3PIRA 2X4LA 3ETCA 4ARUA 4CL8A 4EJSB 1DOZA 1V2HE 4K6KA 1N9GB 1NSYA 3N8GA 1JILA 4H7PA 1XTPA 1QVAA 4G01B 4LK3A 2F3PA 2XOXA 4ZI3A 1LI4A 2N3ZA 4MQBA 7REQB 2VP9A 4G4SO 1ZD8A 4I9HA 5IJWA 5AFSA 2LZ0A 3RK1A 1AZLA 1N6HA 4WLUA 4PNPA 2R60A 3EPRA 1SXIA 2BISA 2EJVA 3KL2A 5FYQA 2ZRQA 1UZMA 1OB2A 3SYNA 3CBGA 4BL5A 2O6HA 5TQ2B 4BWYA 3VU1A 1WDMA 1I3OA 2D3WA 4QPCA 4DJEC 2LWIA 5DVZA 2WUWE 1YMVA 5CA0F 2P11A 1VDMA 3T5PA 4BO6A 1DIAA 1F38A 2Q1TA 3QMWA 3T5GA 3UWSA 1IK4A 4WOPA 1ZCJA 4MV8A 2OBNA 3WO0A 1ZN9A 4OM8A 1QIDA 3TRDA 5C81A 1LZLA 1OFGA 5ENZA 3WSVA 4S05A 3JQFC 5JRDS 4V0ME 4TYYA 1Q0RA 2PLAA 1XHFA 3ZD6A 5I3ZA 4Q9KA 4YCMA 5K8CA 3UCXA 3WA7A 4CUZA 2KBFA 3C1AA 2NU7A 1NWHA 4BY9E 3OZRA 4HYYA 5I4CA 1ZW1A 4F2PA 3ZS8A 4X66B 2W6PA 4RA9B 5F2EA 4Z2AA 1RC1A 3WHPA 3KXLA 4PCVA 1LRJA 1Z8FA 2X0NA 1NXOA 2RAVA 4FYXA 5ALNA 3RK4A 1F6DA 1RD4A 3AIOA 1JPVA 4RE6A 3TECE 2DH6A 1UPAA 3HP1A 3G1WA 3OCCA 1Z34A 3AHJA 2DCMA 3UOGA 2HFKA 1UC4B 3IS3A 4NULA 4PY2A 5EIWA 4EQ6A 3QW2A 5IPFA 4AMYA 1ODTC 3I9JA 2UVQA 1TYDE 1XD8A 2QIPA 2W8BA 3NH6A 3BXOA 4JMPA 4DDVA 4AQYB 1DKMA 2ZIXB 4HSGA 1V11B 3BWEA 1A7UA 4WASA 2J6CA 1AGPA 1UP4A 5HUQA 3DXFA 1VG0B 1LNQA 2RGGA 4BYGA 1NBWB 3OZWA 4ZQIA 1DJOA 1UP6A 2ZYSA 3LCMA 1KRWA 1NZJA 4NZMA 1OC4A 1R5BA 1QHHB 4NIMA 2W5UA 3HGMA 4NQRA 1JYSA 4PWZA 2RBEA 4RFVA 4HDCA 1OX5A 3E1GA 4F85A 4MGZR 1DO8A 2OAP1 2LD4A 2Q7OE 5LC1A 2PZJA 4AYTA 4B6JA 3U81A 2PJUA 1IQRA 6PFKA 1I1HA 4BQSA 3KGDA 1WS6A 2N75A 2VJLA 4WKBA 5AVSA 4PX3A 3I32A 1T2UA 2O2JA 4L07A 3T0IA 1OYOA 1PR2A 5KOHB 2DLDA 1VXRA 5LNK6 1YV9A 4B3GA 2F3SA 3LZCA 1NW4A 2I71A 1ZICA 3GAFA 4WD3A 4OP1A 4MS4B 1MXHA 1Y4UA 4JBXA 1Q0PA 3ROTA 1GV0A 1TCAA 3WGKA 4R8MA 3DJFA 4BLUA 4D80A 4PYKA 4LTMA 4RL6A 3F3KA 4FVTA 3R6DA 3WLFA 421PA 1B6TA 1IZ8A 1UINA 1FFHA 3FCXA 3PQ4A 1QPGA 3CHYA 4FR5A 4W5TA 4LJ7A 4LYAA 2GZDA 1BCRB 4QTZA 3GROA 1XB2A 4MK4A 2VTEA 1YI8A 5A9TA 3RYTC 4JI4B 1W48A 2BT4A 3IILA 5KKCA 4MROA 1B23P 5KVVA 3IXLA 3PNPA 1R64A 4OUKX 4KFRA 4R2IA 3CVJA 2I78A 3VH2A 1R8JA 2O1XA 16PKA 1QTIA 1WZIA 2KI5A 2QMZA 3O03A 4QPPA 1MIOB 4ZAFA 1II0A 3UMJA 1MLDA 2HJRA 2VNIA 3BCUA 4PYNA 3ESRA 4KLNA 1J25A 2BJWA 2C04A 2ZSEA 4OHRA 4RKQA 5CYPA 1D3AA 4YPFA 4D0GA 1UDWA 2HQRA 3GMSA 2A5JA 3PRYA 5FBWB 2GF9A 4A8HA 1YL5A 4EL5A 3DYVA 1FP4A 1KGSA 5AW0A 2GAOA 2DHDA 2ZU6A 1QCZA 3FTDA 3DZ6B 1W4CA 3R8XA 1P2DA 2HCFA 1GG2A 4C7XA 3C3BA 3OJWA 1W36C 1CVIA 4PHFA 2XXBA 3NANA 4Z9YA 1BW9A 2ZRFA 4CF6A 3ZXSA 1QTQA 3UMRA 2D5IA 1K1EA 4ZMRA 1XZEA 4P31A 5JD6A 1XDZA 3GLIB 3ZDBA 2Y4OA 4LJ4A 5EEGA 4YMWA 1T3TA 5K0CA 3QKSB 3W77A 1RNLA 3I01M 1GL7A 1XTIA 1EEHA 4ZK6A 4U0JA 3P26A 4YXWA 1T3HA 5JAOA 1W2WB 3WMXA 2VCHA 1FYFA 1NI5A 1Z29A 1Q50A 3Q9LA 5ALHA 1NW6A 4P35A 1U80A 3DVLA 5KQLA 5GGXA 3V7FA 1RM5A 1SO8A 1TDJA 3AGPA 3D2AA 4G6ZA 2VNSA 1BO6A 4ZOLB 3TQHA 4HGZA 3H0KA 4ARIA 4HDRB 5IYZA 1MVOA 1IG0A 3IQFA 3SGLA 2PMFA 4CM5A 4CG3A 3HO8A 4GI3A 1C7JA 3UFXA 4E70A 3WGLA 1G8AA 3E1KA 2I2XB 1XZAA 4PSKA 5JS7A 3EFBA 4YECA 1A71A 1XVIA 2VPXA 1SELA 3MRTA 4P3KA 2BUCA 2FYTA 3QPUA 4G5SA 3ZHQA 5ECYA 2HLDA 3DW1X 3FHJA 3UK0A 3NR2A 1DOHA 2FQYA 1C8LA 2Y0BA 2XB2A 1MRSA 4UCFA 1YIAA 4Z3OA 3A6DA 3M6IA 2JBWA 5TB5A 5GZ1A 3K9NA 3C5VA 3RWBA 3STXA 1WABA 2PXCA 3OIVA 4P34A 3KEOA 2QV0A 2NO1A 4Z0TA 4DT1A 5FEUA 2O1SA 1QONA 4JR1A 5EHXA 2GJ4A 3I4FA 4G84A 3WKEA 4PR0A 3TKYA 1G21A 4DUGD 1A82A 1OXBB 4RIEA 2YKGA 4EG4A 4TMZA 1DDGA 1YTLA 3GQBB 4G1UC 5THXA 2GXQA 2WWFA 4Y7CA 3CURA 1OT3A 1AIPA 4TS9A 5LMNB 1NJ1A 4A16A 4C01A 2CUKA 4PLPA 3GGGA 3OOWA 4G5XA 3SZ3A 4F2WA 2PMWB 4NPCA 1O6ZA 2NNLD 4Y1GA 4HAWA 4OP2A 3L77A 3SXJA 1Z26A 1U04A 3FNBA 1QP8A 1Q0SA 4PCAA 5F12A 4YA6A 4J0JA 1ZHOA 1B93A 3EVDA 2Q6IA 4PX9A 4AVYA 4EUSA 3TZ6A 2RBKA 3O1JC 4HSEA 1V3UA 5F7ZA 3OQ6A 3LLUA 4KO1S 3TSYA 1WQ1R 2XE6A 2ZRLA 3I1FA 4F46A 1H2EA 4AG6A 1V5FA 3E8MA 4YCAA 1W47A 4GMHA 2EW8A 3AL0C 2VHZA 2OYCA 2X6RA 3R7AA 3LVBA 2J07A 5E0KB 3RREA 1RI4A 1CUFA 3HB0A 4MKGA 4ER3A 1PLJA 1V8DA 3AUSA 5HCIA 1Q1ZA 1F2UB 1SU8A 1KY4A 2VF4X 1J1ZA 1ICIA 1R4NA 1ID1A 1MRNA 2PKWA 1RQRA 3LO8A 3K0CA 1IIBA 5CHYA 4DNOA 1Z73A 2Q50A 2H4YA 3LWNA 1T0PA 5K8VA 4TN1A 2GD1O 3SICE 2GARA 4KXNA 1MFZA 5L6MB 2J9FA 1NVMB 3CWQA 2WF7A 4QUAA 4CKZA 1ZGCA 4QNNA 1YZ3A 3VI3B 3WLHA 4ZMSA 1ZRNA 3IHWA 4JP8A 4ZIRB 1Z0ZA 1E2QA 5IEBA 5JYBA 3DTVA 3FJ1A 3K6JA 3PD1A 2QTWB 2C61A 3OZEA 4N0MA 4QFDA 3MTEA 4EWLA 5JQGA 1M0TA 3GOHA 4WVFA 3B7WA 4UBKA 3RHTA 1LBTA 3EPPA 2WQ6A 4EHBA 1N33B 1RXUA 4Q0MA 3U0BA 4EX6A 3WAKA 3EZ2A 4RZXA 1N8KA 2EERA 2WFLB 2PG3A 1IJFA 4R2KA 4QXOA 5CYFA 4B35A 4XVUA 5IRCD 1S7GA 2E3JA 3MK31 4LQLA 1MTZA 2ZWIA 1I8TA 1DUSA 3HBLA 3M1AA 1QNFA 3E3OA 5DW0A 2DF8A 3GIDA 1TW2A 3MBIA 3M81A 1EXWA 1RJGA 4D3SA 1X74A 1Z8NA 1O94A 1AN9A 1MB2A 2I29A 5EWJB 2AQKA 4QLAA 1VC2A 2WV7A 4FZ5A 3A7EA 4IIHA 5AM5A 1QFXA 1TMGE 2I1VB 2BFBA 1KOLA 4QQFA 3VR5A 1QFMA 4HPJB 5EYPB 4D9KA 2P40A 1EM8A 3E61A 1T5DX 2JAXA 4CCYA 3NTRA 2O23A 5BR8B 2V59A 5A4DA 4PHCA 1RC8A 3H16A 521PA 5JSZA 2DWUA 2D1QA 2H4WA 3RUEA 3KSZO 1QIKA 3BJMA 5BQ5A 2BJHA 3MILA 3G6WA 3OAAD 3OJ0A 4I66A 4RL4A 2CMGA 5H16A 2B5VA 3WB2A 4CT0A 2P69A 4N5MA 3UF0A 2QAGC 1JEDA 2O0HA 3LWBA 3ZDYB 2NUTA 1P45A 4KV7A 3BEDA 2D0DA 4BFSA 3NALA 2A4MA 3QQ5A 5IMSA 5E4FA 2QYHA 1QO0D 2IOHA 4LVNA 4DV3B 1XF9A 2ZTSA 2HR1A 1CEEA 3DLCA 2NM0A 4L9AA 2JFVA 1JXMA 1R5NA 1JPNA 2ZEJA 5KB3A 3HDQA 4NEHB 1VBFA 4M0PA 2P2YA 4KXLA 1HDIA 4XX0B 1KYXA 3KR2A 1YKSA 3RS7A 2PT6A 4REQA 4M7RA 5I7RA 1L4NA 4CVNA 2QNIA 3OO1A 1KFKB 4EMTA 4CF7A 4IW3B 2Z3ZA 3UOAB 5I4BA 1W5EA 1YRWA 1XCJA 1KHHA 2B7BA 1ISFA 2I55A 2J5BA 3FR8A 1M66A 4ZT7A 3RT7A 2HY7A 3ZHUA 4KN8A 4NZYA 5GZ3A 2UUPA 4LVOA 1XK7A 2CHVA 2PGLA 3NHUA 5DBOA 2C84A 3COSA 5LLDA 3IAUA 3FYCA 2XGOA 3OLZA 2FG5A 4MZDA 4WNAA 2GYVA 4XR9A 5FAXA 2HRQA 4UOEA 3I6YA 1ATZA 4TMWA 4UM8B 1AK9A 2WMOB 1XVVA 4IO1A 3ZY2A 2JLVA 1NFQA 4LFCB 1CULC 2YRXA 3K31A 4IAOA 2XMQA 4M1SA 2OXCA 3AETB 2OHIA 2BKEA 2LCFA 5A3SA 4KQGA 1YDWA 1BWSA 4HJXA 1W0JD 2HCRA 4Z4QA 2ZR9A 2NO7A 3GH1A 3HBJA 2FSVA 2AXQA 5AUPB 2PUHA 3GN1A 4KDFA 2XB9A 4QUEA 1W73A 2IQ5A 3KQUA 4ZO7A 2XE7A 1X6VA 3DDOA 4IMIB 4Y6PA 5IJAA 5C8YF 1PP4A 5JD3A 5A7FA 3EPKA 3AF6A 5JJ5A 3OPXA 2QF7A 3A3KA 5EIFA 3X43A 4FFNA 1S3FA 3F6RA 4KPEC 4UVDA 1RMTA 2TS1A 3M9WA 5EUBA 2JFGA 2PUWA 3AR5A 3KHSA 4ROTA 2AD1A 1N2JA 4CKXA 4QVIA 3WBFA 4PBSA 2NUPA 2ZUDA 4QG7A 1OWOA 4MO9A 4RSHA 5TC4A 2RAUA 4AZTA 4JJZA 2FFAA 3TQOA 4LHYA 1YJCA 4OFBA 1PR3A 3AFHA 5LD2B 5L3QA 2OO7A 2FSFA 2Z2ZA 3TMKA 3UUEA 3KETA 3CRQA 1Z2EA 1X1TA 2O7VA 4FZJA 3LLVA 4YPVA 4W1PA 1Z3IX 4HX9A 5COQA 3BQ9A 1O0CA 1RI1A 4KJXA 4LYYA 2P79A 1NBAA 3RAPR 1K2WA 2ET6A 2AXEA 4CR7A 4FEEA 1W87A 3CX7A 1ZJ4A 2H0QA 3LFHA 3WWOA 1RSZA 3CVXA 1DIBA 2A30A 2JGJA 1NNSA 2R7AA 3N2NA 1GKUB 5JG7A 2YWGA 4JU9A 4LSZA 1I36A 3INTA 2ODWA 3B12A 5JV5A 1ZM7A 2P7HA 1TTPB 1A5BB 4HDOB 1NMSA 5CX4A 2HEIA 2OAEA 5GIOE 3VZCA 4C0LA 1THTA 2HRDA 3AQIA 3COWA 3PLNA 4MITA 5J5AA 4CQLA 1Q22A 4PNEA 3A4IA 5JDIC 2R25B 1IJEA 2HFJA 3ABIA 1WTCA 2HLHA 3RUIA 2WABA 3E9QA 4BVBA 1N5DA 1QQ7A 3CZRA 5KS2A 3CRNA 3KZVA 1AM4D 2OFXA 5LQKA 1RYZA 2XTJA 1D04A 3SZRA 1EHCA 4BFXA 2F1RA 4AF8A 4PTLA 3LZ6A 4YJHB 1RXWA 3PKZA 4UD6A 1I6MA