3DO5A

Crystal structure of putative homoserine dehydrogenase (np_069768.1) from archaeoglobus fulgidus at 2.20 a resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
324
structure length
320
Chain Sequence
MIKIAIVGFGTVGQGVAELLIRKREEIEKAIGEFKVTAVADSKSSISGDFSLVEALRMKRETGMLRDDAKAIEVVRSADYDVLIEASVTREGVNYIREALKRGKHVVTSNKGPLVAEFHGLMSLAERNGVRLMYEATVGGAMPVVKLAKRYLALCEIESVKGIFNGTCNYILSRMEEERLPYEHILKEAQELGYAEADPSYDVEGIDAALKLVIIANTIGVKASYEDVEVTGITQITPEAFQVAAEKGYTIRLIAEVSREKLKVSPRLVPFHHPLAIKGTMNAAMFKTDTAGSIFVAGRGAGKEETASAILSDLYEIYAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Homoserine dehydrogenase
publication title Crystal structure of Putative Homoserine Dehydrogenase (NP_069768.1) from ARCHAEOGLOBUS FULGIDUS at 2.20 A resolution
rcsb
source organism Archaeoglobus fulgidus
total genus 96
structure length 320
sequence length 324
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00742 Homoserine_dh Homoserine dehydrogenase
A PF03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3do5A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3do5A01
1P1FA 3PQDA 1H9BA 2BFPA 3NKLA 2ZK7A 4II2A 1W4ZA 2Y1EA 4WJZA 4X54A 2D1YA 3H3JA 1T2AA 4LRTB 5IXYA 1NR1A 4DWVA 4RPJA 4AJNA 5IDYA 4CM7A 2PNFA 1Y8QB 2QYSA 4AJEA 4TRMA 2V6BA 1U5AA 1B14A 3EUWA 3RUDA 3LT1A 4GGPA 1DIRA 1MUUA 3CH6A 3O26A 1T2DA 2VUUA 1M75A 3JQGA 3X2EA 1MG0A 1YBMA 2QRKA 1B7GO 1PGNA 3Q0EA 3ZNNA 5JNLA 4LGVA 2IXBA 1J49A 2DBRA 1BXGB 1UP7A 1U28A 4PLTA 5A1TA 3ZHYA 1J5PA 4RO0A 4EEZA 5U9CA 2YV1A 3RUEA 2OGUA 4CV0A 4U6SA 1NX6A 1SAYA 4YTEA 1ISGA 1ZFNA 3GDGA 3DZJA 2CSUA 1MGOA 2WE8A 3I9KA 2PGJA 5CEFA 1HYEA 3NUGA 4QECA 3IL2A 3RC9A 5FI3A 2OP1A 2AEFA 2VRCA 2AE1A 3WTCA 4CLOB 5CEEA 5JC1A 1YGYA 4BOYA 3C24A 1WW8A 1A9ZA 3ZU2A 2LDXA 1W73A 3BA1A 2BRUA 1GPDG 4LVCA 3M1AA 4FSHA 1B8UA 2H9IA 2Q2VA 3GEMA 2CDCA 3FWNA 3MJ4A 5ITWA 1NHWA 3I83A 4JCOA 3OJOA 2VHZA 4Y9DA 3ETDA 5EMHA 3OECA 5T5QA 3MJCA 4CPDA 3TOXA 1H6CA 3INTA 3ON5A 5BSGA 4WPGA 5EJ2A 5TSDA 1KETA 4TZTA 1UDBA 3IP1A 1Z6ZA 2QRLA 4AICA 3WQSB 4BNKA 3OQ1A 1JVBA 3VPSA 2FRDA 1Z7BA 5AXCA 1ZJZA 1CRWG 3KSDO 1A9YA 4E5MA 2BH9A 2PY6A 5FEUA 1GUYA 1BXZA 1EBUA 4O6VA 5H81A 4QQRA 3WIEA 2DUWA 4OJNA 2PR2A 5DN9A 4CMEA 4YA6A 5FF9A 2DQ4A 3H65A 4EYEA 1DLIA 2PA3A 4Z9YA 3OA2A 3NDIA 2EWMA 2JFHA 4BNXA 4FFOA 4XKJA 3ZV6A 1LLDA 1NTOA 1NAHA 4TSKA 2HCTA 3DOOA 5I7EA 4YT5A 3DZIA 1PR9A 2WEKA 4O5OA 5HRUA 3COSA 3FTPA 2V6GA 3P7MA 4YRBA 3OMLA 1BVUA 4CM1A 4GL4A 5IDWA 3BMCA 4WNIA 4A10A 3ASUA 4KOAA 2DT5A 3QRWA 1XHLA 3JQFC 1PSDA 5KJEA 3RU7A 1VM6A 3HE3A 1X7GA 1Y8RB 3DHNA 1E92A 1ENYA 1V3UA 5JAIA 2DPGA 3GZNA 2FSVA 4G81A 4YACA 4AFNA 4JBGA 4TRNA 3RBXA 4FFMA 2YFQA 3G1TA 1F12A 1XG5A 1BSVA 2AG5A 5JCJA 3RUIA 1UP6A 2IDZA 5F21A 4XJTA 1B26A 1WXDA 1W8DA 4OMUA 1MC5A 1BWSA 2XXBA 3BMQB 3GNQA 4XGKA 3JQAA 4B4OA 1JWBB 1PL6A 4BNTA 4L73A 4J1SA 1K2WA 4YPOA 5K6AA 5MDHA 4RQTA 3KYCA 1V35A 3WNVA 1OZAA 3JD4A 3BMOA 4J9VA 3FRJA 4BNUA 3ANMA 3KETA 2AG8A 1KIFA 4GMGA 2DBQA 1I10A 1N7GA 4KWIA 4BKPA 8ADHA 3DZKA 4FBGA 5A9RA 1E3EA 1K3TA 4KQWA 1N1GA 3RUCA 2EG9A 1KEPA 2D0IA 4YAEA 3E03A 5DT9A 4B3JA 4M55A 5A9TA 1JU9A 4DIFA 3WBBA 5ADHA 1E3IA 1KERA 4FOOA 1LU9A 5IZ4A 3ITDA 3D1LA 5DBIA 3C7DB 3WLEA 1LDBA 3FBGA 3WDSA 3CZMA 3WGIA 3PWKA 2OP0A 4D41A 2YV3A 4K1LA 1E1KA 3G1UA 4ZD6A 2O3QA 1KVSA 3GFBA 4ZHSA 3OIFA 4GLLA 2DTDA 4E0BA 1DRUA 3VZQA 1LDEA 4I9HA 1W0CA 4JN6B 1C1DB 1P31A 2DPHA 1LLCA 2RH4A 1OOEA 4IDBA 4E3ZA 4Z6KA 5IDQA 1P0FA 3B1KA 1DC5A 2BFOA 8LDHA 3H2ZA 2R00C 2EERA 3ZDFA 3VTZA 5TIIA 3D64A 4BIIA 4HP8A 2GF2A 1R0SA 1EE9A 2C0CA 4URFA 3GEGA 1ZSNA 4EJ6A 3AI1A 3R3SA 4MO2A 1ZW1A 2ZKLA 3KHUA 3C8MA 4FPXA 3QJ5A 1KS9A 1R37A 3AM5A 3MTJA 1PJBA 2HQ1A 5BSEA 3ZWOA 3A1NA 1CWUA 4GI2A 4CM6A 4J4HA 1A72A 3OSUA 1NWCA 3VAZA 1NHGA 3RC1A 1T4BA 2A92A 3GGGA 3KSUA 1JKJA 4J49A 4KDFA 5TT0A 2J5QA 3DAGA 3FNHA 1I2BA 5T8KC 4IS3A 5G0WA 5DULA 1L1FA 1H6DA 3I5MA 4ILKA 5EINA 4Z3DA 2ZTUA 3GC6A 1GYQA 4J16A 1NNUA 1ZNQO 3HUDA 4L4XA 2PH3A 4CLHA 1GADO 1RKXA 3ZWPA 3SVTA 3TFOA 1T1SA 3FN4A 5JC8A 3D7LA 2CNBA 3LQFA 4CLRA 3IIEA 1AGNA 2X86A 4CLDA 3MCVA 4FR5A 4YRDA 3RFVA 3C1TA 2J3JA 2RBEA 4I5FA 2PD3A 4GWGA 2EKQA 4NZ9A 4CM8A 3S2EA 4OXYA 1N2SA 3Q1LA 3NTRA 3RROA 1PQUA 3PHLA 3G49A 4IJVA 3CINA 2NTNA 1FMCA 4PLPA 1XQ6A 4Q3BA 5GY7A 1EEHA 4CR8A 3U49A 1O5IA 2FR8A 1HLDA 3ZGYA 2NWQA 2HO5A 4IINA 4H3VA 3ZHZA 2Y1OA 3KYBA 3RSHA 3JQ9A 3H5RA 4FW8A 2EXXA 4NH4A 3HN7A 7ADHA 1HETA 4E5YA 5G4LA 2DTEA 1LQUA 3WWYA 4NJMB 3VDQA 5AXDA 1MC4A 2AEJA 3VKUA 2Q99A 5AYVA 3TF5A 2BMAA 1N5DA 2NNLD 4CMKA 3ZNPA 3WGQA 2YHUA 5A3JA 1WAMA 1XYGA 4WCFC 4MVJF 3SJUA 4IPTA 3I3OA 1I3KA 1OI7A 2P9EA 3D4OA 1O94A 4P4GA 3C1AA 4BKUA 4MKRA 4DIOA 3CEAA 4RLSA 3G17A 4FJ2A 4DXHA 1QXSA 1MG5A 2X0RA 3T7EA 3K6JA 3JSAA 5EQDA 3GVPA 1JTVA 2Q45A 2ZQZA 1HF3A 2VRCD 2ZATA 3ONDA 4NBVA 2EKLA 4FOSA 1JWAB 3ITKA 4OAQA 2VNAA 3DR3A 1LSSA 1KEVA 3L07A 4BMSA 1LQTA 3FSRA 3AOGA 2P5UA 2EP7A 3HQ4O 1JDJA 2O3SA 4BS9A 3PIIA 2JL1A 2J5KA 4YYZA 1LRJA 3AFMA 4XA8A 3AJRA 3PRJA 2C29D 5IJZA 1H2HA 1E3WB 3QVOA 1GR0A 4DLLA 1P1RA 2NADA 4J2HA 2Q1WA 5G0TA 3IOYA 3RI3A 5A03A 4ZRMA 5TX7A 2POQX 4E12A 1SOVA 5DCWA 4AJHA 4IJWA 2CFCA 1DIGA 3NJ8A 3TZKA 4BO1A 2YZ7A 2BLLA 1UZNA 1KVQA 2GNAA 1DFIA 3H7AA 4JJIA 3C85A 3D3WA 1U3WA 5DP2A 3CSDA 2X9NA 2NVWA 3BHIA 4D3FA 1DEHA 1YOVB 3L6DA 3ONEA 1PJ2A 4IZHA 3H6KA 4RVGA 3U4HA 1DHRA 3JYQA 4Q3DA 4XRRA 3INGA 3DBHB 2X58A 4L8VA 3UVEA 5K9ZA 4NK4A 1NPYA 2FWMX 5BT9A 4R69A 4LW8A 1D1SA 3LT2A 4OHUA 3QWIA 3O8QA 2IYOA 4S3MA 4WUVA 4BUCA 3CZRA 1ISIA 5FFFA 1UZMA 4XGIA 3OBBA 3KVOA 4ZU3A 5IDXA 1AXGA 2F1KA 4ND4A 2YYYA 2C82A 4IDEA 4YXFA 4NI5A 1U2GA 4O1MA 3ICPA 3TZQA 2QG4A 5KJFA 3A4VA 3ETEA 4WGGA 4CJXA 1C3VA 4RJTA 1PZGA 3KYDA 4GX2A 4YVFA 3JQ7B 4HUJA 4OH1A 4WK6A 3GEDA 4JNKA 1E3JA 1JVSA 2ZB8A 3UN1A 3Q2KA 2X6TA 4JJFA 4JX8A 4YAKA 2VNSA 1EBFA 1TEHA 1HDOA 1U9JA 2GCGA 4IM7A 4OIMA 3SJ7A 1BMDA 4CMBA 1I30A 3IDSA 1FDUA 4J43A 2J3IA 1R4NA 2C5AA 3WJAA 2I99A 2D8AA 1DRWA 2NM0A 4JROA 1K5HA 1TT5A 5G0SA 4BO3A 4BKQA 1C0LA 1PL8A 3DAFA 2Y67A 4RVDA 4N5LA 3OA0A 2P5YA 1MV8A 2FPGA 2WM3A 1LDYA 3QWBA 1NM5A 4OXNA 4ZQEA 1N9GB 5JDCA 3FCOA 5C7OO 1N7HA 3IKVA 3K5PA 4WCDA 1QYWA 4J90A 4NPCA 1BXKA 1C0IA 3C1OA 3V1TC 2GN6A 5TS3A 3ANNA 1LJ8A 1Q1NA 1KVTA 2B4QA 4NIMA 5ENVA 2OZPA 3ZU3A 2CMDA 2WYVA 2G76A 3GVHA 4CM9D 1WDKA 2YY7A 2AHRA 3HWRA 1LXCA 1MP0A 3OFSA 1GAEO 4GWKA 3UCEA 2VQ3A 3KBOA 1SC6A 3BXXA 3TDKA 1ISMA 4Q9NA 3AM4A 4CMIB 1SNYA 1QMGA 4I1IA 2PZJA 4CMAA 1D4FA 1F0YA 4EUHA 4D0RA 1DXYA 3ZI0A 3IC5A 3SC4A 4YJGB 4W7HA 5JMWA 4MVJA 2CVQA 5COQA 4M8SA 1K6XA 4MVJH 5A5FA 1M6HA 5I7VA 5JDIC 1VC2A 3OM9A 2D59A 4Y6RA 4TMFA 1A5ZA 1B16A 3WMXA 2GD1O 3ORFA 4E6PA 1FK8A 3MJSA 2WWRA 4RPHA 3MZ0A 1EQ2A 1LDMA 1VJ1A 2RHCA 3QVSA 1R15A 4AJPA 2F00A 3CKYA 4NQZA 2E4AA 4ALKA 4LCJA 1UAYA 3U4DA 4B7XA 3QWAA 3KOUA 2DFDA 2VHYA 1V6AA 3EHEA 5GZ1A 4HY3A 5AXBA 2VOEA 4ID9A 4KTVE 4B4VA 4XWYA 5CG2A 1ZZEA 2R00A 1HYGA 1NAIA 3HDJA 3VH3A 4WKGA 1KEWA 4B7CA 5MGBA 3LC1O 2NSDA 4IQ8A 2GZ2A 3P2OA 3O9ZA 3UGKA 1NFQA 4N5NA 1GCUA 4YAGA 4I9NA 1O8CA 1XIVA 1ORRA 5THQA 5KNLA 1X0VA 4B4UA 1K89A 1IZ9A 2NU9A 1JAYA 2Y1DA 5C5IA 2B4RO 2VZ8A 4J4TA 3C3XA 2NUAA 5FI5A 1LA2A 3QE3A 4KWHA 1NPDA 3DONA 3ADOA 4J1QA 5L3ZA 3RAJA 1GTMA 5IG2A 3UF0A 1A71A 3DC2A 4L75A 2Q46A 4OO3A 3UKOA 4DC1A 4ND3A 2PK3A 1J4AA 4FJ1A 4XYGA 5HTOA 1R12A 3GVIA 2Q22A 3S1LA 4O63O 2AQKA 3TRIA 3U4IA 2VYVA 4NBTA 3MOGA 2Q1UA 2JAHA 3LLVA 4KQXA 4CLXA 1XLTA 3F5QA 5T8KA 2GRAA 2JAPA 3LSYA 3GT0A 2HKIA 3N74A 2O4UX 3PLRA 4PGFA 4TRJA 5G4KA 1DPGA 1HL3A 1BW9A 1HWYA 2R2GA 4KUEA 4OQZA 4UULA 3ANLA 2ILTA 2QZ9A 3OJLA 3H9JA 1FDVA 3JTMA 1DOHA 3QVXA 1I33A 3BTOA 3JQAB 5JS6A 3MEQA 2I3AA 4E21A 3NEPX 5HWSA 1NQTA 3I6IA 2BFMA 1PTJA 4R3WA 4FC7A 2A94A 2EEZA 5C37A 5CDYA 4EGFA 3Q6IA 1VE9A 5L51A 3TPCA 5AXAA 2I67A 2NQ8A 4AJ2A 1XU9A 5TGDA 1L7DA 4IDDA 3DXFA 4JP2A 2ZJ0A 2O2YA 3ASVA 4FJ0A 3TNLA 2H6EA 3GNSA 4A2CA 4YBZA 3JQ8A 3FF4A 4PLWA 4C4OA 1U3TA 3ZNQA 2O50A 1OMOA 2CF6A 4XZ3A 5BNFA 3SXPA 4NBWA 3ETGA 3CMCO 1ENPA 1A4IA 2BKAA 2Y0EA 4A26A 4UUPA 2YHIA 3CMMA 5JYFA 3JCZA 4NU5A 1R4MA 2HAEA 4IDAA 3K73O 1ID1A 3X2FA 3M2PA 1ADGA 1O9BA 5A06A 2PGLA 1JAXA 3WYBA 1P74A 1NBOA 1F14A 1UXKA 5B12A 2H1SA 1ZXLA 4M86A 5U4QA 4LK3A 2PZKA 2B0JA 4PLCA 4WCFA 3QVWA 3G0OA 5T64A 4NFYA 2DAPA 3FWZA 4QXMA 1DAPA 4L4RA 5L45A 2GN8A 1CJCA 3N58A 1H2BA 2V65A 4DC0A 1LC3A 3UH1A 4BKOA 1R0LA 1G0NA 4FQ8A 3HDQA 3ZV3A 1BGVA 2JHFA 1I24A 4U7WA 5JAQA 1LTHR 4ITUA 1B3BA 1CQJA 3GMSA 2Z5LA 4TVBA 2ZYAA 4ZQFA 4PRKA 1E7RA 1DC4A 2ZJ1A 3AI3A 3PGXA 4WLOA 1ISHA 3VDRA 3CUKA 1FDWA 1I3LA 2ZYDA 5HA5A 1YDEA 3GK3A 3QWFA 4CLEA 1P1HA 3JD0A 3VZPA 1YL6A 3SEFA 2Y1CA 3DZBA 1SO8A 4XYBA 4GVXA 4XYLA 3E9NA 3GHHA 4WLVA 3IQDB 1PS9A 2C5EA 2ZB3A 4OYRA 4XQEA 2VTEA 4UUOA 4XCVA 2XF8A 3ZU4A 1YL5A 2X9VA 5JCXA 4BNJA 3RIHA 1PZHA 1VL6A 2AE2A 4PG7A 4E5PA 3PK0A 2W2KB 1X1TA 3AW9A 4J9UE 4P8RA 3W8FA 3IKTA 3L6OO 2FR0A 1U7TA 3RJ5A 1MXFA 2WDZA 3LT4A 3FNEA 1WLYA 1E7WA 2DM6A 4M89A 1K6IA 4XQGA 4F6LA 3OETA 5JYDA 3DTTA 3AM3A 4IIVA 2O3TA 3PZRA 4QO8A 3ZW8A 4CM4A 4A0SA 4ZVVA 4ZJUA 2J3HA 4I08A 3H3FA 2A4KA 1Y9AA 3HG7A 1ZK2A 4RLHA 4HFNA 1U3UA 3OIDA 1N8KA 4JJGA 4YT2A 3OF2A 4Q3AA 1LLQA 1HLPA 1X1EA 1IB6A 2EW8A 2G1UA 4PZEA 1XDWA 2O2SA 4EW6A 1X0XA 2HRZA 1PWXA 3QA9A 3U5TA 4E5NA 2OBYA 1QP8A 1ZO8A 3VPFA 4RPKA 1IZ0A 3VZRA 3M6IA 5JAMA 3A14A 4CMCA 3GVCA 5EESA 3M2TA 1PGOA 2QW8A 4YB8A 1D1TA 1MA0A 2IODA 4J2OA 4OXKA 5CDSA 2RCYA 4ALNA 1ADFA 4XRGA 2IEBA 2Z95A 4IMRA 4B4WA 4YAJA 5JBIA 1B15A 4BO2A 1XKQA 3DFUA 5EIOA 5I8ZA 2FPIA 3OJFA 4R1NA 3H9UA 2WD8A 4BHTA 4J7XA 3QP9A 5DOZA 3HNPA 1HRDA 1AUPA 1GZ6A 3O4RA 5COAA 4CL8A 3FHLA 1R0KA 3EMKA 4LMRA 4YJFA 1NFRA 1EZ4A 1YBAA 3DBRA 4R1SA 4IQGA 1BG6A 3VVCA 1DC6A 1Y81A 1UAGA 4P4LA 5F3RA 5DOVA 1FF9A 2VHXA 3F9IA 4N5MA 4TKMA 3JD1A 5I9LA 5ILGA 2NV6A 3GPIA 1V0JA 5DCUA 1QRRA 4RZIA 4GX5A 1PWZA 3GOHA 3PZBA 2DBZA 2E82A 3UXYA 3S2GA 4IGFA 3WLFA 4R01A 1PL7A 3I4FA 2BGMA 1AE1A 4I5GA 3M1LA 4MVJD 1Z45A 5I7FA 3NT2A 3EYWA 2EF1A 4DPLA 3I6QA 1C1XA 4Q3NA 4CV2A 5DCYA 1QV7A 4FGSA 4QTZA 5ITVA 1DSSG 3DWFA 1SOWA 1IOLA 4PVDA 2VT2A 4INAA 3PEFA 1PS0A 3JQDA 4ND5A 5G0UA 4CM9A 3WSVA 3EC7A 1PJQA 3STHA 4DREA 4DIBA 4M54A 4N18A 3D4PA 3LT0A 4PN3A 2YFHA 4W82A 4ZGWA 3UHAA 4BMNA 4FDAA 4XYEA 2NVUA 1ISJA 1QLHA 3VHRA 1EE2A 5JYAA 1YQXA 2WMDA 4NHEA 1OFGA 2EJWA 3DZHA 1U4OA 4IMPA 5H83A 3AFNA 1HEUA 4O59O 1E1NA 1ISFA 2GSDA 2C20A 4XIYA 3AWDA 2DTXA 4J7CA 2E49A 2P68A 2CDBA 4KTTE 1OC4A 4BNNA 4OOFA 1RPNA 5JAZA 5FWNA 4IY1A 2J6IA 2EIHA 1J0XO 1PU2A 1Q0QA 2HK8A 1DJNA 3DZGA 3LDHA 1PJSA 4YJHB 3WX0A 1YB5A 4W9NC 3DBLB 2YJZA 4G2NA 4BGEA 4YCAA 3GLQA 5JMPA 1N92A 1GUZA 2X0NA 5HS4A 2I65A 5F1PA 4MKZA 1V8BA 1X7HA 1NWHA 2XOXA 4ND2A 1GDHA 1DIBA 3IMFA 5KOIA 3PDUA 3P19A 3EZYA 3EAGA 3RUFA 3JYOA 2IXAA 2VYVD 1UUFA 5JY1A 4ZRNA 4D43A 5A05A 1Y8QA 2X4GA 5I8WA 1JN0A 1G1AA 4Z3KA 4PLHA 3SBOA 1NQOA 3W4KA 1E5QA 3WIDA 4M49A 3S2FA 4KMSA 4DBZA 4OGWA 4WEQA 5I7SA 1T24A 4U0JA 3ZWXA 5B37A 4Z0TA 4MOWA 3PPIA 3GHYA 5ER9A 4A03A 3RBZA 5BNTA 2FY8A 1BXGA 1NP3A 3VPHA 3IJPA 1NQ5A 1LBEA 2O23A 2W8ZA 1PJCA 3WNQA 3DOCA 1HT0A 2HSDA 5CFZA 4N54A 2C54A 1RM3A 3U9LA 3QIVA 4C7JA 1DLJA 1I0ZA 1YQDA 2J3KA 4FFLA 4CV3A 4D45A 3T4EA 4BQPA 2BELA 2FMUA 3JYNA 4CLOA 4CR6A 2Y0CA 3TL3A 1HSOA 3R3JA 3L0DA 5L53A 3C7CB 5IN5A 3UUWA 1WMAA 3BYZA 3G79A 2DC1A 4S1VA 2VWHA 3U62A 2JJYA 1KC3A 5DDIP 1CETA 3KXDA 1IPEA 1PX0A 5KCZA 1YB4A 1VRWA 1ENZA 4GMFA 5KVQA 4P22A 4ALJA 4JLWA 3KLMX 4K26A 1QKIA 3RKUA 3ZW9A 4M87A 2BGLA 1GUFA 3F46A 4DPKA 2FN7A 3ONFA 1ONPA 2E6UX 3I52A 4YWJA 2W2LA 3HADA 4BO6A 1VI2A 3VKVA 5TC4A 2RIRA 1HDZA 1XGKA 3KEQA 3PXXA 2OO5A 4BO0A 5IF3A 4CQMB 4DLAA 2VWGA 1E7QA 2O7QA 1GPJA 1P33A 1MB4A 1PGJA 3K2BA 3WGHA 1VSUA 4NK5A 5I9MA 4D42A 1LRLA 3KZVA 4J6FA 1B0AA 1AXEA 5IXSA 3PVZA 1N1EA 3NAQA 3KTDA 1X14A 2TMGA 5JO0A 1ARZA 4HFRA 1MXHA 2BD0A 2VTDA 2XXJA 5A5EA 1ZJYA 1YS4A 5IZCC 1IHXA 4OQYA 2ET6A 5H82A 4CUKA 4BNHA 4EZBA 3EZLA 3TZCA 4E32A 5B1YA 3F1LA 4EI2A 1P1KA 2AQIA 4AVYA 1LNQA 1HZJA 1QYXA 1Y8RA 3PJEA 3PYMA 4RVSA 4E13A 4BV8A 3QHAA 1A7KA 5AVOA 4BGUA 1Q0LA 4BNVA 2Q49A 4IIUA 4QSMA 3CPSA 4E2ZA 4O0LA 3T4XA 1SZJG 4GKVA 4DA9A 5CDGA 5ILOA 3HB5X 5HM8A 5T6BA 2OUIA 1LI4A 1CYDA 2D5AA 3TOZA 4LRSB 3V5NA 1VLLA 3ZWYA 2GGSA 1Z7EA 3P5SA 1ZBQA 1YJQA 4WLUA 4H7PA 1ZK0A 1BDMA 3PFWO 3DB2A 3K8ZA 4K9DA 1H5QA 3Q11A 4DBVO 4HFJA 4RF4A 4LN1A 3GG2A 4Y98A 5BSFA 4HBGA 2HK9A 2HMWA 2X9GA 4CM5A 2GR9A 1WVGA 4UVEA 4ZQGA 3K30A 4TZKA 4TWRA 2VWPA 3VH4A 3U0BA 2O3RA 1DAOA 3UCFA 4K28A 3WQRA 2HLPA 3GMDA 5B4UA 1MFZA 3BHJA 4KZPA 1WDLA 4CQLB 2JCXA 1XA0A 2J5RA 1ZSVA 4FN4A 3GF4A 3PWZA 3WR5A 3DHEA 3RWBA 2G0TA 4MKXA 3IAHA 3ABIA 2OXIA 3I9LA 2EKPA 3PHGA 1DC3A 5CP8A 2PWZA 3OP4A 4KUGA 4Z9FA 3HDHA 4F3YA 1SB9A 3OEWA 4XR9A 1Z82A 3DMYA 1UXJA 2VT3A 4CL3A 3UFXA 2NQTA 2FR1A 3V1YA 4G65A 3ZV5A 2UV8A 5IFLA 2O4CA 2P4QA 4BNFA 3RKRA 1J6UA 3AU8A 3GH3A 5F5NA 1HE5A 1XQ1A 3KSZO 1R66A 3BMNB 2RAFA 4TVOA 1VJ0A 1C1DA 1ZCJA 3RFTA 1PS8A 3GUCA 3JQFA 2CUKA 3WMWA 2P9GA 2ZIZA 3NTQA 3QVTA 2ZQYA 3BAZA 3F4LA 2Q50A 5T73A 3O38A 3EDMA 1L7EA 4XYMA 1VL0A 4WLFA 4YEDA 3NT5A 1VSVA 2VRBA 2Q3EA 4PIVA 2P91A 5J23A 4NR0A 3WQQA 2IEDA 3IS3A 1M67A 4K6CA 1GCOA 1YB1A 2VCYA 3E18A 4PZCA 5DBFA 2P2SA 4PG6A 4BO7A 1UXHA 4A27A 3JQGB 3DDNA 5KVVA 3LK7A 2HK7A 1S6YA 4HV4A 5JW6A 3EVTA 5M6DA 3WYEA 4KP7A 3ENKA 3P2YA 1GV1A 2PKRA 1MFPA 3I4CA 4I5DA 1UJMA 1ZIDA 4PLZA 3WGOA 4ZQHA 1GY8A 3GR6A 1MX3A 1TT7A 3ZWAA 3DMTC 2Y93A 4OSPA 1PGPA 1FJHA 4DRYA 4B79A 1E6EA 4FGWA 5BQFA 4JQCA 1B3RA 2JD1A 2RH8A 4BGVA 2JHGA 3AK4A 4RGBA 3OICA 3RC7A 2NVBA 1LRKA 2PGDA 5LC1A 3NJ4A 1Y9EA 4AJOA 4R9SA 1UR5A 1FDSA 2DU8A 2QRJA 3BIOA 3AUAA 3FI9A 4QFCA 3ZHXA 4BNGA 1ULSA 4OKNA 2CDAA 1E5LA 1DDOA 1A4UA 2JCVA 4E31A 2C07A 2SCUA 3FNGA 3WGZA 3A28A 3I9OA 3WG9A 4IQ0A 3WXBA 4OM8A 1XEAA 1E7YA 1EFKA 2JFFA 3RU9A 1SEPA 3E48A 4A5OA 4LSWA 1QYVA 4DLBA 3S55A 3PI7A 1HZZA 1YJ8A 3PQFA 2CF5A 3F1KA 4DTIA 3Q3CA 4Q3CA 2CZCA 1OC2A 2AQHA 4IGEA 3DO5A 3WSWA 4CM4B 4W9NA 1I32A 4MVJP 4WNCA 2XAAA 2ZCUA 5KVCA 1IUKA 4NJMA 5TJHA 4DVJA 3GVXA 4R68A 6LDHA 5L4LA 2BI8A 3H9EO 1TB4A 4BNYA 3RD5A 3DZFA 3LC2O 4LMPA 4E5KA 4AJKA 2NLOA 3GDFA 3KEOA 4FIZA 2X5OA 2OFPA 3JV7A 4D3SA 2G17A 1A27A 3I9JA 5JPIA 4J3FA 3H9QA 1QG6A 3W4IA 3NYWA 3BMCB 2DLDA 1XR3A 4UVDA 3KV3O 1M76A 1NVGA 1E3SA 3BTUA 2JCYA 4D46A 2Q4EA 4WASA 1U3VA 1MLDA 4HADA 2Q1TA 2E48A 3GZNB 1U1IA 4UAGA 2OHXA 4KDEA 4H16A 2B36A 3R6DA 4FD3A 3E1KA 1ULUA 4GKBA 3KRTA 4Y8VA 2OL4A 1EVIA 1LSJA 1T1RA 1EQUA 4KUHA 2HMUA 4TQGA 3WFIA 4J0FA 3RVDA 2B83A 2X1HA 1P44A 2PH5A 4J7UA 4GVLA 2IZ1A 1NASA 1GL3A 1EUZA 2GDZA 3GRKA 5CDTA 2W2LD 3D3EA 2AQ8A 2EHDA 4JK3A 5TF4A 1R16A 1NVTA 1OAAA 4F6CA 3WGTA 3TSCA 4IBOA 2D4AA 3KYCB 3VPXA 4XJSA 4HNGA 3WICA 3BMOB 3MTGA 1B8VA 4AJJA 3RUHA 3OJEA 5CPFA 3RUAA 1F8GA 1EVJA 1I01A 4WLNA 1IULA 5TLSA 3HSKA 1DJQA 3BHMA 4J4BA 1YOVA 1YWGO 2QIOA 1RWBA 1WWKA 2B5VA 2FHSA 1BVRA 5LDGA 1S7CA 3FBTA 5L95A 4Q39A 2VOJA 2XPCA 3DBHA 3I9MA 5A9SA 5AQ1A 3FPLA 3GAZA 4LISA 3VC7A 2PKQO 4LCEA 4BGIA 1C0KA 1PQWA 5L40A 3A9WA 4XQCA 3UICA 1HTBA 3V1UA 1P1IA 4RV9A 4NNJA 3G3EA 2V7PA 3RBVA 4Z0PA 7MDHA 4WOKA 3B1JA 4D7AA 2X0JA 4XDYA 1P45A 2G82A 3AOEC 2ZTLA 2EW2A 1U8XX 4M1QA 3ZN2A 1O89A 4H15A 3R1IA 5L4NA 1TXGA 4BNIA 4WE3A 2VYNA 3OEYA 1F06A 1RM4A 3GFGA 3PHIA 5IZCA 3NDRA 1H6BA 3IUPA 3JD2A 3ZZNA 1AHIA 1QSGA 2QZZA 2NU7A 3B20A 4UVGA 3DTYA 3JQ9C 5TT1A 1TA4A 4AJ4A 4UUNA 4YT8A 3IJRA 5GZ3A 1LEHA 3JQ7A 4N7RA 1HYHA 2GUGA 1HDCA 4MP8A 4TKLA 4PRLA 1JKFA 3HDYA 4JIGA 4WOJA 1E1LA 1ZMTA 1F8FA 5ICMA 3ROMA 1OBFO 3I1JA 3LC7O 2YV2A 4FFRA 4I8XA 1GQQA 1R6DA 1EVZA 4HWKA 1B2LA 3K9QO 4W6ZA 1EFLA 1P77A 4NFSA 2O3UA 1H9AA 1W6UA 2PLAA 3K31A 5JLAA 5BNIA 1NFFA 4ONEA 2PD4A 2AW5A 4IDFA 2EGGA 1N9GA 2HMTA 4FFNA 1Y6JA 4R1TA 2UUOA 1H6AA 2YDXA 1QLJA 2VN8A 2QQ5A 3RASA 4YDRA 4XGNA 3HB4X 4E4YA 1WZEA 4EBFA 1X15A 3MWEB 4IXTA 3FR8A 3MWDB 4BB5A 1P0CA 4YQZA 1SB8A 4RCVA 1LSUA 4AJIA 2Z1MA 2DBVO 3Q9UA 1Y5MA 2G5CA 3LVFO 3AY7A 4XR4A 4B3IA 1KY5A 3BTVA 4B3HA 1FDTA 4IDGA 4CMIA 1M6WA 5C3MA 2WD7A 1TLTA 4YRAA 1IPFA 1EDZA 3MOIA 3PP8A 1ZMOA 3OQ6A 2P9CA 3PJGA 4CLRB 3S2IA 4YJGA 4J1TA 1PGQA 4NFHA 3KO8A 1IE3A 1T2FA 3W8DA 4CM8B 5JFOA 4L9RA 4R41A 5CAEA 1JKIA 2OOSA 3K96A 3ROPA 1EK6A 3A06A 5TRTA 4F46A 3PYXA 1QYCA 4R4JA 2YDYA 4U8GA 4NU6A 3R0IA 5L9AA 3D5QA 4RQUA 1GYPA 2RHRA 4MVJG 1IHYA 4NDNE 4A73A 3DHYA 2O7SA 1BTOA 4DYVA 5HBRA 5KTKA 2UYYA 5L4SA 2VUTA 2FP4A 4QX6A 3TZ6A 2Q1SA 4GSKA 1ZEMA 1Z75A 3ICCA 4HX5A 1P9LA 4WEOA 3AUTA 1PJLA 2GLXA 3K92A 4MP6A 3DBVO 1FXSA 4RF2A 4CMJA 5C7LO 3HZZA 2J8ZA 5DNAA 2OORA 3UAGA 1I3NA 2GN9A 1CF2O 1UXGA 2BHLA 2X5JO 4OOEA 4IJUA 3ROKA 3GA0A 1RM0A 2H5LA 4ALIA 4OL9A 4GH5A 2X5KO 3WTBA 1QR6A 2C7VA 5CEJA 1O95A 1GEGA 5G0VA 1HDRA 3KM0A 3WOHA 1T2CA 3PIDA 4PLVA 5TQVA 1IY8A 1V3VA 2O3JA 3MJTA 2QHXA 2EV9A 3ADPA 4EJ0A 2Y1GA 4BNWA 4PLYA 1E6WA 1DFGA 3WFJA 3DMTA 2YQ4A 5L7YA 1H93A 2FPPA 4TRRA 3SC6A 3SLGA 2WE7A 3ZV4A 3JQCA 2Q2QA 1LLUA 2YUTA 2I9PA 3PGJA 4RVFA 5L7WA 4DPMA 2P4HX 4RORA 5CDUA 5CG1A 4Y6PA 1K0UA 5JDCC 3LU1A 4FB5A 4I9UA 2EJVA 4WLEA 3E8XA 4FFPA 3V8BA 1Y5RA 1GV0A 2HU2A 3MJVA 5EL0A 2HMVA 3F3SA 3D4NA 4CQMD 3AY6A 3AY3A 3JYPA 4GLOA 5JDIA 1NYTA 4RVHA 2JD0A 3S8MA 4JXKA 3L9WA 3PJDA 3D3WB 4GAEA 1Y1PA 1YL7A 1P1JA 3MJEA 5KIAA 5KJ1A 3DEYX 4XEHA 1AN9A 1DB3A 2Y68A 2VZ0A 1DO8A 1V3TA 2YQ5A 3FR7A 1KY4A 1BDBA 1ZK4A 3ZWNA 4YAIA 5A02A 3WYCA 1U8FO 1UH5A 4WECA 4W7IA 4UEJA 1G0OA 2D3TA 3O8QB 4UVHA 1LX6A 1UDCA 1A7AA 4W4TA 3WS7A 1WP4A 4E2XA 2Y1FA 4QUKA 3F4BA 1DFHA 1H0KA 2HMSA 3O03A 3CE6A 4ROSA 4CMHA 2WJPA 1YO6A 1ONNA 2Y0DA 3GUYA 4PFJA 3OHSX 4IUYA 1TI7A 1WPQA 2VUSA 2A9FA 1HDXA 1GQYA 4BNZA 2GZ3A 3JQ6A 3KYDB 2VHVA 3UOGA 1V9LA 4W99A 2PZMA 2JD2A 4Z0HO 4PLFA 4F45A 3L4BC 4MVJM 3UCXA 4BO9A 2I5PO 3JQBC 3FPCA 3ZWWA 2QYTA 4E30A 2HRBA 1R4NB 3KLPX 4BMVA 4G5HA 1TT5B 1G6KA 4RDIA 1NXQA 2FZWA 3LF2A 2UUPA 3GGOA 1PJTA 4EUEA 1XCBA 4C7KA 2PV7A 3LZ6A 4CV1A 4EITA 2X0IA 1BRMA 1KYQA 3DOJA 3ST7A 4JBIA 3KB6A 3LLSA 3W6ZA 1I36A 1HE4A 4CUJA 3NV9A 3CXRA 1GFSA 5T57A 4NG5A 4DMLA 5EN4A 2HJRA 4UUMA 1LUAA 5A4DA 1DHTA 2WYWA 4MPDA 3AU9A 1SBYA 5CHEA 1I2ZA 3QWHA 3ZHBA 1ZEJA 2D2IA 2ZTMA 4ZA2A 5F5LA 3UW3A 3D0OA 3F5SA 5CPBA 5LDHA 4R5HA 2W2KA 1D8AA 1GZ3A 3QSGA 9LDTA 5BSHA 2C2XA 2IYPA 4L4SA 1X13A 3WGYA 1DIAA 2FOIA 1E3LA 4YR9A 1T2EA 1Q7BA 4JGBA 2VYND 2H63A 5HS6A 5EERA 1NPTO 1KOLA 4D0SA 2HUNA 3NDJA 3V2GA 3LYLA 4YQYA 2C2YA 2GZ1A 3H2SA 3N7UA 3H5AA 2W90A 1EUCA 2PTGA 4MIOA 1CDOA 4UEKA 4CUZA 4R9RA 2GYYA 4L0QA 4Z9XA 3GZ4A 3JYLA 1Q0HA 2CY0A 3AOEA 1ENOA 1AHHA 1D7OA 4GSLA 3E6AA 3VH1A 3PQEA 4DUPA 2IZZA 2UAGA 1TVEA 1EDOA 2DKNA 4I5EA 3DQPA 2NTVA 4J91A 1U2DA 2Y05A 2CD9A 5KKCA 3PWSA 1K6JA 4B7UA 2PZLA 1QYDA 3TJRA 4BB6A 2HDHA 3WBFA 1VKNA 2NU8A 2I76A 1YONA 1GZ4A 4NMHA 1E0DA 1M66A 4BV9A 2C59A 3OH8A 4PCVA 1YDWA 5A3VA 5TJ9A 4ND1A 2AXQA 2B35A 3HFSA 5EQFA 3VH2A 2OMEA 1IYZA 1YVEI 1DIHA 2ZCVA 1PJ3A 3PJFA 1YH3A 1WDMA 2B37A 5EPOA 4ZN6A 4YT4A 4BO5A 1T25A 1NQAO 1XWFA 5THKA 2X8LA 2Z1NA 2IRWA 2HJSA 3B1FA 5COBA 3E5MA 5DP1A 4MVJE 4RL6A 4OSOA 4R51A 4DGSA 4L74A 3BMQA 4BNLA 2EP5A 1CEQA 4J0EA 5U1PA 3V2UA 3FTNA 4A7PA 2DFVA 4EDFA 5ER6A 4R1UA 4AJLA 2BF7A 4AJ1A 5JSFA 1HDGO 5B4VA 1CIVA 2V6FA 3K2EA 1VKOA 4XDZA 4BO8A 4D79A 3NTOA 2QX7A 5G4KB 1BW9B 1GU7A 2PKQP 1RM5A 1JLLA 3GNTA 1UDAA 3H8VA 4U5QA 5JYEA 2YW9A 4E2WA 3C7AA 4PVCA 1RYEA 1EVYA 5TNXA 5A04A 2UVDA 2B4TO 3IUSA 3TZHA 3TWOA 3ZWMA 1I2CA 3E9QA 3JD3A 3ZNOA 1SPXA 1H94A 4E2YA 1BHSA 3PTZA 5I9NA 4EEXA 5GMOA 3W1VA 3NRCA 1YKFA 4RPGA 4IJKA 1E1MA 3DAPA 3V2HA 2FSSA 1C0PA 3GDOA 4IDCA 1PEDA 4FC6A 4EJMA 1WMBA 3L9XA 5KVSA 1HKUA 3EY4A 1VJTA 3AUSA 2OBNA 3JQ8B 4DQXA 5A9SB 1ZXBA 1T26A 5GZ6A 1RYDA 4R16A 2BGKA 4XB1A 1HE3A 2YHIB 4UREA 4GQAA 3OIGA 2WYUA 3TL2A 4CMEC 1R4MB 1HE2A 3JQEA 3ZWCA 1DBVO 5ES3A 4BVAA 4QFDA 1ONOA 4YJHA 1E7MA 1HSZA 3DBLA 1GEEA 1Z73A 3AUUA 4CR7A 2NTJA 4BQRA 3GGPA 1Q7GA 4P4NA 1NR7A 1NVMB 4CMGA 1YBVA 3U09A 3GPDG 3FNFA 4XX0A 2B5WA 1O0SA 1SEVA 1VL8A 2VHWA 4B8ZA 4MP3A 4EUFA 4WCFB 3BTSA 5FYDA 3NGXA 3F6YA 2R6JA 3VZSA 4ZICA 4L76A 4HKTA 4YJDA 4PLGA 2Y99A 5ENDA 3ZWBA 5KJCA 3Q9NA 1XU7A 5G2OA 1IL0A 5JCJD 3RCBA 4B8WA 3TQHA 4D44A 2Q2WA 1QORA 4AL4A 4DL9A 4UVIA 1ZH8A 1JA9A 1PJ4A 2W4QA 1UXIA 2Y66A 3QLJA 4QEDA 4GX1A 3JQAD 2E37A 4XB2A 1U7HA 1M2WA 2X23A 3E82A 1SCUA 4MIYA 3DFZA 2PFGA 4R5MA 1CERA 3RC2A 2ZB4A 6ADHA 1Q7CA 3T7CA 4BO4A 3GAFA 2NU6A 3GRPA 1UZLA 3DL2A 1XELA 3ZU5A 3HJAA 4RZHA 1YQGA 3L6EA 3OJ0A 2W98A 1JW9B 3NX4A 1KC1A 1ZKMA 4R3NA 1O6ZA 2GPTA 3QV1A 1E77A 1U5CA 4RF5A 4Q3EA 1I3MA 3VTFA 3OQBA 1LSOA 5K6AC 3WB9A 3F47A 4NJOA 3GY0A 3B6ZA 4MVJI 3WJ7A 1XSEA 2BI7A 5JY6A 1ADBA 2V6MA 4MDHA 1LDNA 3HFGA 3EW7A 2VWQA 3TN7A 1RJWA 3E9MA 3PDJA 4P38A 4RPLA 1ML3A 1KVRA 1ZK1A 1CQIA 4MINA 3SX2A 3ULKA 1SMKA 3NT4A 4XD2A 4D3DA 1UP4A 2WD7B 3ZCXA 3WWZA 3EVNA 4R54A 3GN1A 4CQMA 2PD6A 1DRVA 1U4SA 1YE3A 1Z74A 2JFGA 2DVMA 3PHHA 4IXWA 4K6FA 4MJLA 4QT0A 1PIWA 4DMMA 2AMFA 2BFAA 5IN4A 1HXHA 1ZVMA 1F17A 3INRA 2AA3A 1EMDA 4ALLA 5JXWA 1ADCA 5DZSA 5C7IO 1ZSYA 2CVZA 3ZH2A 2I3GA 1ZK3A 3H5NA 2IE0A 2ZYGA 4XIJA 2IZ0A 4DQUA 3EK2A 4ALMA 3GN2A 3RQSA 2C7GA 4U6QA 1VPDA 3ZWVA 3W4JA 3W6UA 3BZUA 3VOSA 2ZB7A 3E5RA 2FZEA 4HFMA 4AG3A 2EGHA 1GQ2A 1I8TA 4IS2A 2TMDA 3L4BA 5B4TA 1WZIA 3JQBA 2JKVA 3VVBA 5DBGA 4FS3A 1I5RA 1WNTA 1X7DA 1B8PA 3D5TA 3B70A 4Y6SA 1PZEA 1PQPA 4MIEA 1GD1O 3QQPA 1JQBA 5L7TA 3PYLA 1EK5A 4DYDA 4LVUA 3H4VA 5K0ZA 3PHJA 5BR7A 4YJFB 4NBRA 3DBRB 4GPD1 3FD8A 1E3WA 5T67A 1PZFA 1QV6A 5JE8A 3IP3A 3GQVA 1GYRA 4PG8A 4RF3A 3Q2IA 4RDHA 3RFXA 3W8EA 3I23A 4ZQBA 3PFFA 5LCXA 1C14A 2D5CA 3QY9A 3CTMA 4CM3A 4UEOA 4RVUA 3PLNA 1D3AA 2GASA 4E33A 3TFQA 3U4CA 4FCCA 4OKIA 5AOVA 4CODB 4GBJA 3GG9A 1HDYA 4HNHA 5JO9A 1C1XB 2A35A 4HXYA 4PG4A 4J1NA 1E7SA 2GN4A 1EUDA 5J9GA 4CQLA 2B69A 4GX0A 1P3DA 5ICSA 3RJ9A 3ROQA 4JBHA 1Q2XA 1KVUA 5KKAA 3QW2A 2GERA 2UDPA 1LC0A 4IZIA 1YXMA 2NVUB 3NGLA 4BKRA 3U3XA 4ESOA 9LDBA 4GGOA 2CVOA 3SLKA 1KEUA 2X7HA 4NBUA 2O48X 2WSBA 3I9NA 5KWEA 4LSMA 1Y7TA 4BL5A 4QO7A 3L77A 1E6UA 4XQ9A 4BNMA 3H9GA 2LDBA 4Y67A 4PG5A 4U0KA 3KUXA 3CIFA 1YRLA 2DUUA 4PZDA 3WGGA 4II3A 1T4DA 5KJ6A 3BMNA 1PR3A 3AI2A 3L4SO 4JP3A 2I66A 2AEMA 5IAAA 3HHPA 5DF1A 5F1OA 1LDGA 2Q4BA 2I6TA 1ZUD1 1KBZA 3ENNA 3LF1A 4TROA 5F1KA 2X22A 2ZTVA 3VPGA 2NACA 3EGOA 2GO1A 3HN2A 4DQVA 2WTBA 2VZ9A
chains in the Genus database with same CATH superfamily
2B78A 3PQDA 2BFPA 1XX6A 3I8XA 1J0CA 3NKLA 2ZK7A 4X54A 1RYZA 3SEQA 4EJFA 1RPZA 1E9FA 2FE4A 3V4FA 4QM7A 5IRCD 2QN7A 3NALA 3S5JA 1ETHA 1T2AA 4LRTB 2BBTA 2QM7A 2QZPA 4P0TA 4UFOA 4DWVA 3EEOA 4AJNA 2QTFA 1Y8QB 4AJEA 1YVDA 2XOKA 3RUDA 3EUWA 2ZQ5A 3LT1A 3P0JA 4GD3Q 2Z3ZA 4GGPA 4MW4A 1DIRA 5EGNA 3I8SA 5SZKB 1R50A 3WKCA 3X1ZA 4C3OB 2GKOA 2D1RA 2W9XA 4I6EA 1KWGA 1U0BB 1GVHA 4EB6B 4C7XA 1JXOA 1BAPA 1M75A 4UOQA 3JQGA 1KH2A 2A0WA 2XMZA 5DVZA 2X0EA 3X2EA 4BPRA 1YBMA 2R6R1 1B7GO 2P75A 5B2EA 4YMUA 3PIRA 5JNLA 3EFHA 1M8GA 2OSVA 1IMOA 1FP7A 1UP7A 3INNA 4HO1X 3VJRA 5ECWA 3CX3A 1VPEA 1Z07A 3MC1A 3NH9A 4CU5A 1NJFA 4RO0A 4EEZA 4QDXA 3FUVA 2QT0A 3NGMA 1U9IC 2ZUTA 5BXYA 3T7SA 3GDGA 5E9QA 1IBMB 3DZJA 5T4FA 4ZAYA 1MGOA 1UPUA 3A1SA 3I9KA 1FP6A 3RE1A 4M7WA 4DJEC 1OFHA 3D3JA 3RC9A 5FI3A 1FDIA 2AEFA 2OP1A 4Z4IA 3UK6A 4H3HB 1TAGA 3TDMA 1R64A 3CPHA 4R1LA 1U8UA 2JKYA 1I6KA 4K2HA 3AM1A 1WW8A 4LJ5A 5ALJA 1Z25A 4HQRA 1V6SA 2BRUA 3PUZA 4PFKA 1GPDG 4XIGS 2BFNA 2OC9A 4UDNA 3ZI4A 1NVFA 2XY4A 3M1AA 1B8UA 2P9YA 2PRSA 3L05A 4FSHA 5LLSA 5TMBA 2H9IA 3FPGA 4HB2A 3RVPA 2CDCA 2XRYA 5HQTA 1BMQA 4CIWA 2KPOA 3MLBA 2NO9A 3NDPA 2VHZA 4Y9DA 1XXHA 3K9CA 5EMHA 2AF4C 4CPDA 3IOBA 3F8TA 4PZYA 1MRSA 4Y1RB 3MQ2A 3D4LA 2PZGA 4OF4A 2FJUA 2NO7A 4ZGBA 5LUAA 2JFWA 2EF0A 3KEMA 3VNAA 3F4KA 7YASA 1R5OA 3DZ2B 1JQKA 1UDBA 3WDLA 1L3CA 1G3UA 1JQDA 2K4MA 1WMEA 2QRLA 3IP1A 3WLKX 4AICA 4MGZR 2YYSA 1GGMA 4BNKA 2Q8QA 4K9PA 1BN7A 1GITA 1GPH1 1ZJZA 2PKWA 1ZOIA 2W6OA 3N2YA 4JL8A 2BH9A 1E9VA 4AMGA 1BXZA 4EMTA 1RP1A 1SGWA 3T1NA 4OG2A 4QQRA 4B74A 2WUFA 3BKWA 5DN9A 4CMEA 1RW4A 1Z83A 2AG0A 2P8SA 4DW8A 3H65A 1BS1A 4XVCA 4GL2A 3LDGA 1K97A 1KORA 1DLIA 3W5DA 1MU0A 5AW0A 2QTVA 3NBFA 3W0LB 3KAJA 4MW0A 3OA2A 1DKUA 4D81A 3ITEA 3H2IA 4FFOA 3KSBC 3V48A 1NTOA 2W8BB 4HAWA 4GR9A 2HCTA 3DOOA 4S0ZA 3UAVA 5I7AA 1MJGM 5BV0A 1P4JA 2OHHA 3F3KA 2BHTA 4KHPB 1CC1S 3V7UA 2P78A 4QD3A 4YRBA 3KQSA 2CL5A 3CR7A 1A77A 2D8MA 4LX0A 4CM1A 1F2TA 4Y9UA 4WY8A 1G8YA 5F77A 3I0ZA 4A10A 3FMPB 2QA5A 2ZE7A 1DIOB 4TSFD 3QMPA 3ACBA 4OQPA 3LA8A 4RFLA 5KO2A 2X6QA 5KJEA 1IAVA 2BZGA 3X44A 2HWWA 1QTQA 2Q5HA 1E9SA 4BAGA 3QH4A 2D1QA 2I4OA 3K9GA 1MJHA 3N76A 2B8WA 3VZBA 1V3UA 1FE8A 4DT1B 4NY1A 5DYTA 4WL0A 5DMXA 2DY1A 1SXQA 3IDAA 2FSVA 3PITA 2H2HA 3PX2A 1DC8A 1QO0D 2EBWA 4IDNA 3ZGLA 5JXJA 1M7GA 4KV7A 4TRNA 3GI1A 2W42A 1IVYA 4A8TA 3LY9A 3FTFA 1MQ8B 1XF9A 5D84A 2A9JA 5IAGA 3F9CA 1BSVA 4P2GA 2VH1A 5JCJA 4C6SA 4MVWA 5JZVA 5F21A 1LB1B 1ZM2A 1MTZA 2MWMA 4OMUA 2UZ4A 2HADA 4JB2A 2A0UA 1NXVA 4XLZA 3U7QA 1JWBB 2YXNA 2D62A 1T9ZA 4BNTA 4UEQA 4L73A 1DUIA 1DJPA 5C34B 4ARIA 2F3PA 3LBYA 2BUCA 5JECA 1FMTA 4KQMA 4KN6A 4H7DA 2FPWA 4RQTA 3WNVA 3RHFA 2ZBFA 1Q7RA 1OZAA 1JR3D 1OXSC 2P2DA 3AYXB 4BNUA 3ANMA 3DFIA 3S1AB 1BH2A 1NXWA 2P2YA 2I87A 4CQJA 1KIFA 2RHMA 4LG1A 1N7GA 2JH3A 4Y9RA 8ADHA 1PHRA 5AW3A 5IFKA 3TJZA 4KQWA 2COKA 3B1XA 3KPWA 3UB3A 1Y3AA 3ISTA 1SD1A 5DT9A 2D1SA 1S3SA 1ZD5A 4IL5A 5DTRA 1GSIA 1HFKA 5A9TA 2AN9A 2B1IA 1TM1E 4CWAA 3C5CA 3OZUA 2AD1A 2ZYVX 5K3FB 3W3AH 1BYUA 5AI6A 5BV2P 4GRDA 3EUAA 3FSEA 3GEHA 4RH1A 2C4WA 2R8PA 3FYUB 3KD2A 4BRZA 1GN8A 1KERA 1LVUA 5AJHA 4AZ0A 2PL3A 2WKWA 3PDCA 1YB2A 1LU9A 5D2CA 1Z62A 2O5RA 3WLEA 4NAVA 2WK1A 1WIWA 4HCJA 3WGIA 2RBGA 4JFRA 1EFAA 3UFXB 4DILA 2VTKA 3D8HA 3DCIA 1FYFA 1I4EB 1UQUA 3OY2A 4MI6A 3CRRA 2VNIA 2O3QA 2Q3CA 5SY9A 3ER6A 1U6KA 3NWBA 2E1PA 1E62A 4LGCA 2YHBA 3JZAA 2ZUUA 2WF6A 1AO3A 1CNEA 3U4QA 1EFUA 3J7AC 1N8TA 1C1DB 5CXXA 5EHGA 2DPHA 1UDXA 1OOEA 3DE5X 3JPYA 4OD0A 1EVEA 1DC5A 1V7PC 2BFOA 4TT3D 3ZDFA 3P2MA 4C07A 1ECPA 2AFIA 2PNJA 2GF2A 1JNXX 1RWQA 1QG2A 2A8YA 4JA0A 2FPOA 2WJGA 1VCHA 1ZRSA 4EJ6A 3P9SA 3MSXA 4CEHA 2W2TA 2XUZA 3KQKA 4NCIA 2PMEA 1S8FA 3C8MA 3DL4A 4FPXA 5AW8A 2W6QA 4P34A 1UFRA 3MRTA 5FKJA 2D00A 1DXHA 2HSWA 1GKKA 4D9KA 5D8DA 3PF8A 3MFYA 3M89A 1AUQA 2W2NA 1WY5A 3TM4A 3MTJA 1EJ2A 2HXSA 5BSEA 1IBCA 2E0IA 3ZWOA 1XDSA 3LX8A 1ZRMA 2C9CA 3R09A 3IAXA 3HP1A 4FYVA 4QJ5A 3NTXA 1T4BA 2A92A 3LGXA 3IA2A 1T1IA 4IH1A 4AUEA 4J49A 1CF4A 2OG1A 2C61A 5LMUB 4KDFA 5AKKA 2JJ8A 2NZ2A 4YMWA 2HPHA 3O0DA 3EXHB 4IH4A 1TQDA 3CZCA 3D54D 4P0QB 2W4IA 2Y1XA 5DULA 1QHGA 1M2VB 3MWDA 4TT8A 3NRJA 3PXCX 4LQLA 5K20A 3UG6A 1HR0B 4E4RA 1MORA 1ODTC 2ZTUA 2EQBA 2MYNA 5EJFA 3L46A 2Y1WA 1ZR2A 4EYKA 2XDWA 2CLHB 4LBZA 1XZQA 4LTMA 1AUXA 2PH3A 5BVGB 2PT7A 5G53C 1ULAA 1M0WA 2ZRFA 1NBIA 3G7SA 3SVTA 1LNZA 3TFOA 3Q4GA 1UDWA 2APJA 2XNDD 4PHFA 3UY4A 4FYWA 2CNBA 3UC5A 3LQFA 2GO7A 1VYHA 3CNOA 1SR8A 1JVNA 3C1TA 1CLEA 3F90A 3RFVA 3TMYA 1LTQA 4RGYA 2EKQA 4NZ9A 2C4VA 3QHQA 4CM8A 1PV2A 2BM0A 3HJTA 3EDQA 1WHTA 3NTRA 1SCQA 3PHLA 2O1EA 3SHWA 1JG2A 1XQ6A 1P2VA 3LX6A 4Q3BA 6GPBA 5GY7A 1FYDA 3SZMA 5JJIA 1EEHA 3IV6A 1RWNA 3U49A 1O5IA 1RTTA 1U6JA 4I55F 2BMJA 2BCJQ 3ZGYA 4JLKA 1W0JA 2NWQA 3B9PA 2FQQA 3JPWA 2F3RA 2XSZD 4EFDA 3OZBA 2HO5A 4IINA 3U4GA 2NAPA 2FZ5A 1HORA 1PK8A 4QPPA 5FRDA 5ARBA 2H07A 1U0GA 4N6NA 5CLQA 3TAUA 3H5RA 3H5OA 1KP2A 3KKNA 5KYVA 4P7KA 3TW6A 3WOVA 2EXXA 3HN7A 4EAQA 1YMUA 3NOOA 1K8RA 4R2JA 4NJMB 3DLHA 3IBSA 4F3TA 2Q5JA 3RYHB 5KNDA 3ZS8A 2EAUA 1GXSA 1DAMA 5EJ6A 2WTMA 1N5DA 3R76A 5CH3A 5EXXA 4HAZA 3ZNPA 3F7TA 1P3Y1 3KZXA 1RCTE 2ATEA 3SHTA 3ZZ1A 1P0IA 5FTNA 4HYTA 3VBEA 3L06A 3VDNB 1EXDA 4G09A 1QCZA 1A8IA 4F4CA 3TJMA 2YZGA 4QHYA 2E18A 2OAP1 4MKRA 2ZIVB 4DIOA 3PRHA 1ECJA 2JBAA 4FJ2A 1TL7C 2X0RA 2C42A 1QS0B 5JBQA 3HCRA 1JTVA 2F43A 2Q45A 2WMNB 4IIHA 4PC3A 4UOEA 2WJ6A 5BN3B 1NDHA 4OAQA 2QI9F 2RB5A 3HVJA 3I5AA 3DR3A 3HWSA 4MICA 1AQNA 1YJCA 5KKNB 5IYZF 3KL4A 3ABRB 1NXSA 4NCKA 2WF9A 4HLQB 2VSNA 1N33B 1D2RA 1F8YA 3A0RB 1LQTA 1J99A 4DUZB 2ZWIA 2EP7A 4BWVA 3EISA 3IUMA 3KOZA 2J5KA 3F7OA 3EVDA 4YYZA 1G8HA 2VHCA 2EFCB 2B2CA 3ORYA 1RBZA 2LUOA 5KQSA 2AYXA 4M9XA 4HDCA 2J5BA 5IUKC 5LP6B 2G6TA 4QGBA 1H2HA 1E3WB 3QVOA 2FQWA 4Z1MA 2JFXA 2NADA 4J2HA 4LUCA 4M37A 3ZBTA 4DLLA 2PYIA 5A03A 3FYDA 1G3MA 1NW8A 2PEZA 3LCJA 2H16A 4I1YA 2O2IA 4TYQA 3PLAE 3DEIA 3QM1A 3E0XA 1WKBA 3JASA 1N25A 3JZMA 2QS9A 3FRHA 5GP1A 5AW9A 4FYHA 3IELA 3DWGA 4F5YA 1XJWA 1IM8A 3AHJA 3C85A 4OP2A 3O5AA 2NYRA 4IUCS 3JW8A 4ECAA 3TX6A 4EKGA 2WMOB 3ZHUA 3Q41A 1MAUA 3CSDA 2X9NA 4D3FA 1Z5NA 1DEHA 2VJYA 1GLVA 3PFIA 4FR2A 1PJ2A 4I3HA 5AM2A 1JFTA 2AXEA 4EHJA 4ND7A 1U0HC 3INGA 4PRZA 2X58A 3LECA 1WXHA 4PR0A 5K3AA 3RRMA 3UVEA 1KIMA 1ZNXA 2HPVA 4NK4A 5K9ZA 3X43A 2FWMX 3HB1A 3OUTA 4IFEA 1NW7A 2PUWA 4JI5B 3LT2A 4GQBA 1U8CB 2JI8A 3HZOA 3C3DA 3H5TA 9MHTA 4WUVA 1E5VA 4NX2A 1QH9A 2I2AA 3NTVA 3EXAA 5CYPA 4JKIA 4MI1A 1WZNA 4D3ZA 3OBBA 2J6HA 3BRQA 1YZHA 2MSKA 5E6SB 4MV7A 1QTIA 1Q57A 4DEYA 1HC7A 2F1KA 3K6KA 4YXFA 4NI5A 1PFKA 1U2GA 2X8JB 2XGMA 2EL7A 4FD2A 4MW2A 1ATZA 3ICPA 2RGAA 3COZA 2W93A 2QG4A 2XYGA 1C81A 2XVXA 3RIXA 3R3WA 4FDUA 5GOZA 2UYCA 2PBLA 2CSXA 3ZLTA 1CR2A 3I76A 3MBKA 2PAAA 5BMVF 1BFKA 3GJXC 1O1YA 2B7BA 3EYAA 3PSHA 4YJ3B 1QP7A 4ERXA 2UUCB 3VO2A 3VGPA 3R6GA 4GX2A 3JQ7B 5H59A 4KRGA 3ICVA 3NLLA 3GJ7A 4ATNA 4OH1A 2O8DB 4WK6A 4JBYA 1JB1A 5IHXA 4KR7A 2Q1YA 1Q0RA 2ZB8A 3UN1A 4JJFA 5DM60 3U60B 1JF8A 4TLMB 4FEEA 4WOPA 1DP4A 1TEHA 1VYUA 4DSZA 1HDOA 1U9JA 2BW0A 4U2EA 3MM4A 3SJ7A 4CMBA 1I30A 3IDSA 3KXKA 2J3IA 1R4NA 2C5AA 2D8AA 2YMMA 1G4AE 2NM0A 4GI5A 5G0SA 4HN9A 4BO3A 4QBGB 4BRWA 1IK6A 3A7EA 5B57C 1C0LA 1OREA 1VMAA 2O5CA 4IOLA 1Y1QA 2FPGA 2P5YA 2WBLC 4OXNA 4EO7A 1A04A 3P9YA 4QFMA 1N2ZA 2P4EA 1SA0A 4RW0A 3ESXA 4A0FA 2VJMA 2A7QA 3PD1A 3MUNA 5BWOA 1PLJA 2VPTA 3P9IA 5AVXA 5EJ8A 4I55A 3V1TC 1TM4E 2VQ6A 2VS1A 3Q2OA 2MIIA 3RTDA 1Y6QA 3D4IA 5E3JA 2GCIA 3W3AD 1KVTA 4BBPA 2QPTA 4YHHB 4MLCA 3LPMA 1NQUA 4OJTA 2EKBA 1YRWA 3GRYA 3TD2A 4CDMA 4Z7JA 2X15A 4P82A 3ZV7A 1WMFA 3JARA 2C99A 4GWKA 4L16A 1VXRA 3IQIX 1QE5A 2MTBA 1ISMA 3QFSA 4TLDA 1AC5A 1TA0A 3TUZC 4PEVA 5G1OA 1JDBB 1XJ0A 3ISJA 3OZSA 4CMIB 1RC8A 3L8EA 4PCUA 3FVTA 3N2ZB 3OQVA 4I1IA 4UCQA 3ENQA 4CMAA 3T9AA 2KMLA 2XH8A 1GO2A 3UBMA 1OTYA 1HTWA 5SYMA 1U0NA 2BIFA 1GJRA 3C3WA 3IC5A 1O4VA 1Q16A 2J9FB 2XCUA 5C1OA 2PUDA 4QGFA 1K6XA 2GESA 3ML1A 1M6HA 2ATIA 3WK9A 1VC2A 2D59A 3EGIA 4G8BA 5HDQA 3HRKA 4HX2A 3SS9X 4ACAA 2V8OA 3DT9A 1ST3A 4YAUA 3A0UA 1KJQA 2V0CA 4QARA 2OV2A 3KHTA 5MN6A 3MJSA 1U1GA 4MYCA 4WZZA 3V8MA 1NF2A 2B0CA 3CY6A 4W8OA 2RD2A 1Z15A 2YBDA 1RZRA 3AGQA 2XVYA 2JBWA 1GUBA 1Z5PA 3E9DA 3ECAA 4FFBB 4U02A 5EYPA 3UWPA 3HCNA 3BT7A 4TS9A 1TOAA 1Z4JA 2HT6A 3LZDA 5B2FA 3EQ6A 2O7VA 3IQZA 2C03A 3U4DA 5IYZA 2PUAA 1SQGA 5BP7A 5C3UA 1EGVB 4JB0A 2WAXA 5ARDA 3F6EX 2QN9A 1RBYA 2QM8A 3O8OA 5BW4A 2BGWA 5FV7A 1Y42X 3O3MB 3AXTA 4DCOA 4KTVE 2QRZA 4UQLA 2XZOA 3ER9A 2JZCA 3O92A 4XWYA 1LS1A 2BFEA 3QEKA 5CG2A 1ZZEA 1NAIA 3HDJA 2X13A 1KR2A 4GOOD 1GDTA 4XDGA 3RPEA 2GZ2A 1NMXA 1QC5B 3O9ZA 4TTRA 1J0AA 2P69A 1NX9A 4N5NA 1XYVA 3ZEAA 4XARA 4I9NA 2FCAA 1Y7IA 1AKNA 4QATA 4B4UA 5KNLA 4F1JA 3DJYA 4Q1AA 1L5HA 4NJEA 1IZ9A 5AVJA 4DV4B 1NUQA 3NBKA 1IQUA 3RADC 4P0PB 1DEOA 1W2HA 1W88B 3VQTA 1XT6A 3RSOA 1LA2A 1H3FA 3H83A 3QE3A 3DONA 4GOXA 4KWHA 3O7MA 1JG7A 5L3ZA 1GTMA 4CBVA 5JXHA 1WF6A 2EU8A 4YAFA 2WSLA 2Q46A 4M1YA 5AI0A 5BWLA 1Z5ZA 3OUZA 3VJMA 4TYPA 2YVQA 1J4AA 1JLRA 1OAKA 5CJJA 2PUVA 5EIFA 2IITA 1R12A 5T41A 5KI6A 3S1LA 2Q22A 1UWVA 4C87A 4XCXA 1HEIA 4EH1A 4GMXA 5HXAA 1KKLA 2YWXA 3EMDA 1JT2A 3LLVA 2KYRA 4CLXA 1Y9JA 2GPSA 3DTVD 1HFEL 2JAPA 3LSYA 3QU5A 3RK4A 2HO4A 4DRXA 2HKIA 1CDDA 5G4KA 2R2GA 1BW9A 1X74A 3DKIA 4KUEA 4UULA 5CR9A 1TW2A 3CW9A 2P79A 2QZ9A 3OJLA 3H9JA 3WAKA 3R77A 1I4OA 2ZWMA 1FLDA 4RV4A 3JQAB 4N3CA 3R9XB 3K9NA 4DLWA 5JS6A 2Z8YM 2ZAMA 1YQUA 1RCUA 1D9XA 5CB6A 3FCXA 3KK0A 3NEPX 4FGZA 4XH9B 3C6YA 3AR7A 4Y6GB 3SM3A 3X3HA 4FC7A 4BX2A 1ZC3A 3VR5H 4S1TA 2A94A 4UZEA 4W5RA 1K7YA 2H51A 4AF7A 3Q6IA 1JSXA 3G8AA 5L51A 3BCUA 5JFTA 2WZDA 1UBEA 3LW8A 5BMVA 2NQ8A 4D8XA 2P9JA 3CN7A 2C78A 1QQTA 1AX9A 4XWKA 4DF3A 1NXPA 3SSMA 1XQVA 3HY4A 3MTBA 1DUSA 1F38A 1KXZA 5IP5A 1QU3A 2LV8A 1ZUHA 3BF7A 1TU0A 3H2YA 1UJ5A 3GNSA 3U7RA 3IAS6 1PJAA 2QAGC 3K1JA 4O4HB 3EBLA 4PLWA 5DI9A 1U3TA 4FMCF 3ZNQA 2VQFB 3I2JA 2ZSHA 4XZ3A 2ZZMA 2Y4OA 2QUKA 4A2WA 3SQXA 5IW8A 1C1HA 1YA8A 1SQ6A 2LGJA 2R8BA 3L7BA 1ENPA 4FP9A 2BKAA 4O4LF 4YCJA 3PDWA 4BTLA 1HA3A 2IS2A 1T5HX 3NCTA 2YYZA 3TUXA 1NY6A 2E4VA 1E63A 1GN9A 2HAEA 2AXPA 4YV7A 3K73O 3RAGA 1G6HA 1O94D 1RAAA 4Z4HA 2RI0A 3M2PA 1AKMA 5GONB 5A06A 3A6FA 3SBDA 3WYBA 4ZKDA 1QJCA 2CKMA 2UVQA 2FEKA 3V7FA 1UXKA 1W36B 4M86A 2G83A 4RANA 2J7PD 3DTNA 3DGEC 1VE3A 4O2AF 2B0JA 4WCFA 3T1HB 1JU4A 3HKCA 2WF8A 4NFYA 2QUZA 4QXMA 4DJFC 2H1CA 1TQ6A 2Q9AA 4JI6B 4B6SA 4BCDA 4L4RA 4GWLA 2OFOA 2IEAA 3BGWA 5C1PA 5FWYA 1CJCA 1D2EA 4HLNA 2AOUA 1KL7A 1LW6E 2PKCA 4TLBA 5E1OA 2Q8PA 2CK3A 4WFQA 1GGKA 5FTWA 1R0LA 1G0NA 1M34B 1A2QA 2QU7A 3FYTA 4OPMA 3VPAA 5L8VA 4R1OA 1R8XA 1TA9A 2P1DA 4U7WA 5JAQA 2WIAA 1B3BA 2Z5LA 4RABA 2XAUA 1BJRE 2QLJA 1TCUA 2ZYAA 4FYMA 2FFBA 3U81A 3DLAA 1XALA 3UUEA 3AI3A 4WLOA 3ZLUA 3G2MA 3FI0A 4IZ6A 3EQZA 3G0IA 3VDRA 2OESA 3LZCA 1EXMA 5FOTA 3FHTA 1KP9A 3CJQA 3RYIA 4PYLA 4QIHA 3DT6A 3KEGA 4X5OA 4CLEA 2JIDA 1P1HA 3LUHA 1DCFA 3WI7A 3VZPA 2RH5A 3E22B 2FRVA 3B3JA 2P3LA 2YTZA 3CLHA 3RSFA 1E9AA 4C0AC 2DSNA 1P2TA 4MUBA 3E9NA 4A2PA 4EATA 1XNQB 2C8VA 4F3CA 5FBQB 4FOPA 4WLVA 4XQEA 1RPJA 1H4VB 2IYWA 2VCHA 2ZB3A 4OYRA 4JI7B 1R88A 1ATIA 4XCVA 3A3PA 2YJTD 3U44A 5JCXA 3D8RA 2AMLA 2XHZA 3RIHA 3TW8B 1Z4LA 1PZHA 4NYIR 5AKGA 4ITVA 4PQFA 5A7FA 2XMBA 4R6XA 1FQWA 5KVAA 3BGSA 2ZE5A 2RK6A 2IV7A 3IKTA 5AVYA 3L6OO 2BJVA 1U7TA 5HPYB 3EWIA 2WDZA 2BTOA 2C4HA 3DDHA 4M89A 3TCNA 2QRQA 2CJFA 3B8EA 5AK4A 4LXTA 1EFVA 4DIEA 2TMKA 5FBZA 3ZIAD 1DTWB 5IAEA 1HNZB 2B8TA 2H4ZA 2XMRA 3G5TA 4J0GA 1MDFA 2WJJA 4HS9A 1RWKA 4B7AA 5P8WA 2Y2UA 1UMBA 1A5AB 1XRJA 1OPXA 4FBMA 3H3FA 5SZJA 5JG7A 5LR6A 2A4KA 1IZYA 4RMNA 2WF7A 2OA0A 4QHSA 4RLHA 3DZ7B 3THOA 1M5TA 2BHRA 4J94A 2P2LA 3GH1A 3THYA 1G38A 2PQ2A 2PX4A 4JJGA 2ODBA 3ZDYB 5IVPA 1HLPA 4GKKB 5L6MB 2EW8A 5EWLA 3SQNA 4PZEA 2HRZA 4G89A 2XTNA 2IHYA 3WZMA 4E5NA 1QP8A 2AWNA 1P5FA 1ZO8A 3VPFA 3EPHA 4R7ZA 5JAMA 3GVCA 1SQ0A 3M2TA 1PGOA 3RSLA 4OLFA 4B9AA 3LY7A 3U4AA 1OWPA 4IKOA 1D1TA 2MSWA 1HFWA 4J2OA 1QIKA 2G3YA 2MINB 1PKEA 2CUTA 4KQIA 3RT7A 3AUXA 3TQTA 4EY5A 5LD2C 4Q12A 1TFUA 1W4AA 3CF4A 2Z95A 3TZLA 1E2GA 1EA7A 1H5UA 1SC4A 1WHSB 3I30X 4NMWA 4HLUA 4KQEA 5JBIA 1HT2E 5I8ZA 5EIOA 4A0GA 1YRAA 1JE0A 1WMDA 1ZCBA 2CUZA 3FOCA 4R1NA 5CVEA 4IJQA 3ZIUA 1T9DA 3M6WA 4MMXB 5K4AA 4J7XA 4RHXA 3ZJYA 5AHKA 4BHTA 5A5GA 1OV6A 5DOZA 5EWMB 3U7EB 1AUPA 2JZNA 4QWWA 4YPVA 2XUHA 4J03A 4YJFA 1CE8A 3CB2A 4GKJB 1NR5A 1EZ4A 1YBAA 1WDWB 2NIPA 3GD5A 4IV5A 4R1SA 3VVCA 3FOFC 4LTDA 1H4TA 4YRKA 1ESZA 1OJLA 4P4LA 1UAGA 4Q4AA 1BA3A 1PFVA 4QXAA 2FPNA 2VHXA 1HV8A 3ADCA 3JD1A 4DE5A 1Y4SA 4YECA 4LFAB 3WLOA 3J81k 1MB0A 5ILGA 3OPQA 1V0JA 4ER7A 1J5EB 1P6QA 2CXSA 2FWBA 3TW4A 4FB4A 2DBZA 3OE5A 2P11A 2XCLA 1Q0SA 5JSUA 3PTLA 3D3KA 2VJBA 2QN8A 3VNRA 1UPBA 1AE1A 4I5GA 5F98A 4OQLA 2OV1A 2X8AA 1SC9A 1OI3A 4LTNA 4B31A 4PYOA 3OTGA 1ZMBA 3WK5A 4FWTA 3M9LA 3P45A 3CNEA 5JCZA 3KJQA 1UMKA 3W2IA 4AIRA 3INYA 3N2IA 4S0XA 1AIPA 3Q88A 1V6CA 5ITVA 3HZHA 1SOWA 1DTEA 5AM5A 3B3FA 2YWRA 3D81A 1Z5VA 3JQDA 5K6TA 1DMSA 4RJ2A 3H1FA 1P39A 2PLFA 4DIBA 2R79A 4M54A 3LT0A 1QCDA 4O2AA 4PN3A 3UHAA 4XYEA 4Z9BA 2C97A 2YASA 2NVUA 2L0XA 1QLHA 1L5MA 1NVXQ 1RJ9B 3HLKA 1YQXA 4ZOLB 3JRXA 2EJWA 1XD2B 3MMNA 4U9IS 4RJKA 1GZDA 1YNSA 3HVRA 4EPTA 5I9IA 4R2MA 4O59O 3MMXA 4CF4A 4CKBB 3PD7A 2C20A 1N6OA 2OCPA 4G9BA 5AOCA 4D0LB 2P68A 3QOWA 2HA6A 5YASA 1TW3A 2AC7A 4BNNA 5AM1A 3KQQA 4OOFA 3HGTA 5JAZA 2QBYA 3I05A 1GNRA 4GSYA 3M81A 2EIHA 2V5UA 1J0XO 3T7DA 1DJNA 1PJSA 1ZITA 4YJHB 2E6KA 1YB5A 4R2KA 1F1JA 5WRFA 3TLYA 5D85A 3USZA 3WX0A 4B3RB 1KMHA 1LLFA 2IXFA 1U8TA 3GLQA 4YCAA 2EYUA 2PHZA 1W48A 5JMPA 5HIKA 1GUZA 2ZR0A 2X0NA 4LRYA 4WA7A 5BVHA 1VECA 5F1PA 2WFMA 1ZIXA 3X1YA 1EYZA 2A3NA 1H8HA 1NWHA 4GC9A 3UUGA 2Q0QA 2QR2A 1GDHA 1QCYA 1MT0A 1YTLA 4N5DA 1I4TD 2ZE8A 3JYOA 2IXAA 1GG5A 1S8AA 2IP4A 2YJGA 3K1YA 3O4JA 2HZ7A 4XD7A 4XGQA 4YN3A 5JY1A 4EVSA 4ZRNA 4D43A 1Y8QA 5DYYA 2AOXA 2PZAA 5BWMA 2FW6A 1E98A 4PLHA 4H0NA 1E3TA 1U7WA 3ZX4A 2CLFB 1E5QA 3M6UA 3WIDA 2DR3A 4M49A 2UZ0A 4KMSA 3MS7A 4OGWA 1AA9A 4WEQA 4EB6A 5I7SA 3K09C 4RBNA 3PQVA 3WRYA 3GFPA 3FF1A 2AZMA 3L6RA 4MW9A 3X1KA 4ZHQB 1PR2A 3LDAA 3EXIB 4A03A 3RBZA 5BNTA 3GEPA 1JHAA 1NP3A 5E8JA 4URVR 5CH8A 3QX8A 5B7PA 2FU5C 3SC2B 3VR5D 4JODA 1ZIPA 1XMQB 2OKGA 3R3YA 4YMLA 1GKUB 3WNQA 5FFMA 3E3OA 1HT0A 2HSDA 3IUYA 4N54A 2ZUVA 4RC9A 1NBWB 1RM3A 1D2GA 3FHOA 4K9SA 4CF6A 3STXA 2H00A 4MULA 2C2MA 4RFSB 4KQCA 4D45A 5J4HA 4EYGA 1YFLA 2FMUA 3NWOA 2IXGA 5J63A 2AMVA 4ADSG 4C20A 4CR6A 1IUPA 2Y0CA 3U48A 2HMAA 4XWTA 3R3JA 4Z9AA 4F8EA 5L53A 3U56A 3UUWA 1TF5A 1Z2DA 1Q20A 2V3VA 2QTWB 4FHDA 4K0KB 2A0XA 2VWHA 3OOHA 5JEEA 2XNCA 3OPYI 2QE7D 5KPJA 1O6FA 5DDIP 1MAVA 5KCZA 1M10A 1PX0A 3CRQA 4WDRA 1E2BA 1SRQA 4C6RA 4GMFA 1TIBA 5KVQA 3C14C 2ZJ8A 4LY3A 4PXYA 1FBTA 1QKIA 1FP4B 3RKUA 1AQLA 2DPLA 4PWZA 7AT1A 4I9GA 4AX4A 3TE7A 1REQB 2FN7A 1QVVA 3ZLBA 3HKEB 3Q3VA 2IBTA 5AUPB 3WGNA 1YZGA 1UPAA 4NE7A 5CJ2A 4YWJA 1KMIY 1L5KA 4Z1OA 2ZVPX 1VZ2A 4H1UA 4KAJA 5B1HA 3ZY2A 1C4OA 1YDGA 2H8KA 3VKVA 1C50A 3HABA 3KT6A 3EFOB 2PSSA 1TMKA 5LYJF 2GWRA 5IF3A 2Z6AA 2P7IA 3NHRA 1BGWA 4CQMB 2V7GA 4KVAA 4P5DA 5K7SA 1V95A 4G1EB 1CQWA 2VWGA 2Z30A 5F7JA 1VLZA 3VPBA 4DMUB 3S7TA 4HNVA 2C7OA 1IBLB 4RNDB 3T3IA 1UANA 1ZVQA 3ZVNA 1JYFA 3EVEA 3PFHA 2ZWAA 3F49S 3WGHA 3O9VA 2GZMA 4CT0A 4HR7A 4U9HS 1HH4A 4Z0NA 1AXEA 2Z04A 2JCGA 3GLGE 3PVZA 5IVDA 1L5OA 4UUBA 2F6RA 1T1JA 1XZFA 1ARZA 2I4RA 2W8BA 4D99A 1YUNA 4Q5IA 2QKYA 5A5EA 4XB6B 5LYYA 1PT7A 5AQEA 1VDMA 2BCEA 3BIWA 1VFPA 1TO1E 4OQYA 1ECCA 5MHTA 3QPDA 2ZRAA 1ONSA 3ZTYA 3KQHA 1CRPA 3AH8A 1NBEA 4CUKA 3IWBB 1PW7A 1J70A 3OIWA 5EVCA 3VAAA 3EZLA 3TZCA 4EZBA 5B1YA 1AMOA 3VHLB 1KQPA 1RAFA 1Y63A 4OU4A 4PHTA 5A5VA 3EA0A 3LNTA 1HZJA 5LQNA 3RQIA 3G02A 1R0BA 3A6EA 2GETA 4RZSA 3ZHCA 4Z49A 3PJEA 3O83A 2LTAA 4KODA 4BWFB 2JLRA 4DT1A 4EGCB 2AJDA 1SXHA 3LTEA 3H05A 3T95A 1E2LA 2WSSA 3QHAA 3HKDB 5G02A 5AVOA 1ZL0A 4BNVA 4KO2S 4M1EA 4M6WA 5JZMA 2IUSA 5JNSA 3M5WA 2GZHA 4OHFA 5T3UA 1SZJG 2NU9B 4DA9A 1M1UA 1ILEA 3SXJA 5CDGA 3VNBA 5HM8A 3PFKA 4X97A 2OGTA 1QYIA 4MQ5A 4M0KA 4MS3B 1V26A 2QMZA 3G6WA 3K8OE 3EHDA 4IHJB 1KJZA 4EAAA 3SM9A 3QQ5A 4EW3A 1VLLA 1OFUX 2EZ8A 4KQFA 4YPFA 3S29A 3CLTC 3ELDA 3M1YA 1Z7EA 3P5SA 1ZBQA 2QZJA 3LHFA 3KT3A 2H7XA 4H7PA 3IEPA 1BDMA 3PFWO 3FGZA 3DB2A 2ECFA 1I14A 2FSHA 2YFKA 3A1WA 1H5QA 3Q11A 4DBVO 1JAZA 2O2GA 3DEAA 4HFJA 4EA6A 3IBGA 3DC7A 4HBGA 4RJLA 3S1AA 2HK9A 2JGDB 3TSAA 2GR9A 4CM5A 4BQIA 1BC5A 3TSOA 3NHMA 1RYYA 3K30A 4ZQGA 5IS2A 4TWRA 1HUQA 3GJ6A 4JJ8A 2O3RA 1SG9A 3TINA 3V00A 1Y5NA 3MTIA 3E7PA 4ARZB 1R8SA 7REQB 1OGIA 1EUDB 4OFXA 1LBIA 3QG1A 3ZDCA 3K70D 3G9UA 3EGXB 1XA4A 3EEYA 1M6VB 3KJXA 4MPTA 1E3QA 5H0IA 5K3FA 4AO7A 4HB4A 4MKXA 2WFLB 1VA5A 2OXIA 2YINC 3I9LA 3QOXA 4G0OA 4KLRA 5CP8A 3AWIA 2D7JA 2PWZA 1CNMA 4CEIB 2G63A 3HBJA 4M8KA 5EMNA 4KUGA 4CKCB 2X77A 3ABQB 3GEBA 3L02A 3P9KA 4E6EA 4EPXA 2W11A 5LP6F 1XTBA 4MZXA 5DHAA 4X92A 2VT3A 4UNQA 3UFXA 3WV4A 1WDTA 2OECA 4KLCA 1CS0B 5HZMA 3NYRA 4HQKA 5AHWA 1DU4A 2UV8A 4BNFA 3OX4A 3B78A 2FPUA 4J3NA 5LQAA 5EIXA 1JJIA 2Q9BA 1OXMA 3OD5A 2BGGA 5F5NA 1D4OA 1UCFA 2ZJ2A 5EXDA 4C2BA 4IG9A 2RAFA 3CISA 3RT1A 4X84A 1C1DA 1SUBA 1XD9A 1KO4A 2R6AA 3R0JA 2X1LA 4JYMA 1I0IA 4NQRA 2CUKA 4QXOA 2XE8A 4KVGA 3TR0A 5IJ9B 3LQKA 1PG2A 1CUJA 4A2QA 2ZIZA 2ZQYA 4OHCA 3F4LA 4YRQA 2VAWA 4XWOA 4EGAA 3O38A 1JEEA 5J47A 3AONB 4WLFA 4G97A 2DB3A 3TVYA 1VSVA 2A7XA 2VRBA 3P2JA 3V8QA 3RSGA 1XKLA 1QM5A 4PIVA 2B2XA 3HXOA 3UHPA 5ELLA 2W2PA 1L5ZA 3OMXA 4K6CA 5CFNA 1N2OA 4EGJA 4F3KA 1J21A 2BISA 5A71A 4NCNA 4RLFA 1OLUB 4PZCA 5K5EA 4DRZA 2FZKA 3JVIA 4QWMA 4RPIA 1GT91 2I6GA 2Z2YA 1OBHA 1W2WB 2WZCA 3V3KA 5GJCA 3RF7A 2OQRA 2QUJA 1D9ZA 3KZMA 3O21A 4JYZA 4GR5A 4IIBA 3IPXA 4EKYA 3Q3HA 3ENKA 4CKXA 4Q4DA 5LYJA 2AKEA 2PKRA 3I4CA 1AGPA 4C7BA 1E96A 2NV2B 3EDCA 3EXHA 4YJ3F 5T4EA 1XRPA 4G9GA 1GY8A 2R1VB 3GR6A 3L8MA 4ZQHA 2ZTSA 5HE8A 1M2VA 2ZIWB 4UU7A 5A3SA 4GI7A 1U2PA 1FFXB 3ZWAA 4F2HA 1PGPA 1KQNA 3IT2A 1S1CA 2DT8A 3WQBA 3QVKA 2IX9A 1XWWA 4RD1A 4B79A 5IWCA 1WCV1 3I3SR 4N0PA 1PUIA 4FGWA 4D9NA 2K5UA 2G04A 3L0SA 1JENB 4HQNA 4JQCA 4COOA 5KAPA 3WLAA 3UT0A 4JLJA 5BVGA 2RH8A 3QLVA 4AZ3B 3UHJA 4UHEA 2ZWVA 3I12A 4MEBA 3TL6A 1RADA 4G56A 3RC7A 1T9GS 1YDMA 1LRKA 2NVBA 3PNPA 1FNDA 4LZAA 4DJTA 2F3TA 2G28A 2HWXA 3QE0A 1UR5A 4RGVA 4IOMA 2DU8A 4V0NA 3GWZA 3D43A 3CVVA 3N07A 3FI9A 2GTPA 3I2FA 4OMCA 4E31A 1DRKA 5EQTA 2C07A 2WJAA 1X7YB 3WGZA 4NYIQ 5FTJA 2PT5A 4B6JA 2WVHA 1G17A 3QIAA 3WXBA 4F71A 1IJFA 1D2HA 1JL3A 4MK4A 3KYJB 4UC0A 2XW6A 2E4WA 3BPSA 5GV7A 1XEAA 2VYFA 1E7YA 4YJ2B 2VSOA 1KZHA 5C1BA 5I7WA 1IJKA 1IJEA 1BA2A 3SR0A 4A5OA 1CZUA 3KQTA 4LSWA 2PR7A 1QYVA 3NKFA 4ICIA 2X42A 1HZZA 3AEYA 1DDIA 3BJRA 3PQFA 4IDPA 4B81A 1EDDA 3OFKA 4EFLA 3OEHA 1J24A 3KJIA 1OC2A 4Q3CA 3B89A 2V7QA 2P5TB 4BFWA 4MVJP 4WNCA 2QY9A 2XAAA 2ZCUA 1IUKA 3A6GA 4NJMA 5DISB 5TJHA 3GVXA 4R68A 1FNCA 2PT9A 3BE5A 3H9EO 3HUFA 2INGX 4OATA 3RYHA 3A9TA 3E1SA 3UGQA 1QP4A 4E5KA 3EPRA 1E2IA 2F48A 2WU1A 3EVCA 3GDFA 3KEOA 5DM0A 4AY4A 2JG3A 1KAGA 1N2GA 3BIJA 1JJVA 5BUCA 2F62A 2C4UA 2G17A 1A27A 1CLUA 2WI8A 3CPJB 4HH1A 5JPIA 2DG2A 3BE8A 3H9QA 3W4IA 3NYWA 3MELA 4X1IB 1XR3A 3WMRA 1J8YF 4DN6A 5KOJB 4Q1VA 2CLLB 3IPRA 2GM5A 1M76A 1O03A 3U7IA 2WVJA 1NV8A 2WM2A 3CR3C 1Z0UA 1QS0A 3ZE8A 4WASA 5CX1B 3SIRA 4B4KA 3T1VA 2D5IA 5JARA 3A6PC 3S7ZA 4A1OA 5BN3A 3QVGB 1U1IA 2B1JA 5PGMA 1KY3A 2V7VA 3ZQJA 1ZCFA