1T4BA

1.6 angstrom structure of esherichia coli aspartate-semialdehyde dehydrogenase.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
MQNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution Structures Reveal Details of Domain Closure and "Half-of-sites-reactivity" in Escherichia coli Aspartate beta-Semialdehyde Dehydrogenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 126
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1t4bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t4bA01
4Y98A 2X5JO 3JQAB 3NYWA 1QYXA 4CLDA 3C24A 5JW6A 4KWIA 1U4OA 5L9AA 1K6XA 1D1TA 3Q11A 1OZAA 3MJSA 4M49A 3JQAA 7MDHA 1B8VA 1SB9A 5LCXA 2D4AA 5JDCA 3H9GA 4B7UA 1Y6JA 2I76A 5T8KA 2NQTA 3QWFA 4MP8A 4E32A 4Y9DA 5C37A 3FBTA 3V2UA 1U7TA 2NADA 4IIUA 3CMMA 2C2XA 1R12A 2VHWA 3S55A 3RUAA 1EE2A 2WD7A 3FTPA 2EGGA 2XAAA 4GX2A 3A9WA 1DIRA 4E30A 2D2IA 5ENDA 2UYYA 2J5RA 2WJPA 1DHTA 1C0KA 4ND5A 2HLPA 3EZLA 1NAIA 1P1JA 1HETA 1H6DA 4NIMA 5T67A 1ADFA 2HRZA 1B8PA 5AXCA 5DNAA 1H2BA 4PZCA 5AOVA 4CM4A 1Y8QB 5EL0A 5COQA 2C20A 2O7QA 3L4BC 2FPPA 3NX4A 1Y1PA 4IMRA 5KTKA 1DXYA 1JU9A 4NQZA 3ZWWA 5CEEA 3O8QB 4FC6A 1CWUA 1O5IA 2C2YA 1GY8A 4BO3A 5U4QA 1HEUA 4R69A 1VL0A 5FI3A 3K9QO 2Q4BA 1W73A 1BTOA 1V8BA 1U2GA 4CMKA 3ENKA 3U4IA 2NNLD 4CLRB 5A06A 3CSDA 3DZFA 4JQCA 3BMQB 1NHWA 5KVQA 1GQQA 2JCYA 3LSYA 2ZCVA 4EUEA 1E6UA 5KVVA 3PDJA 1JLLA 1PWXA 5B37A 3WICA 4BNJA 4EBFA 5B12A 4MVJG 1OC4A 2R00A 1YJ8A 3Q3CA 5ADHA 1PR3A 2P4HX 4GX0A 4J0FA 3TL3A 1PQWA 3WR5A 1KBZA 2JL1A 4F6LA 4WLUA 3UW3A 2RCYA 4ALMA 4MVJP 3G1TA 1TA4A 3OEYA 4FCCA 3F3SA 5T5QA 3EAGA 5M6DA 1NFFA 4TSKA 5ER9A 4II3A 4U5QA 4XGIA 2OOSA 1QYDA 3HDQA 1AXEA 5FWNA 4O1MA 1V3UA 5DP1A 4GAEA 1LDGA 1DJNA 1T4BA 5F1PA 3ABIA 3BMNB 1PIWA 2X58A 5THKA 3KO8A 4K26A 4WNIA 1LRLA 1QYCA 1SMKA 1VE9A 1YE3A 3ASUA 5B4UA 3PPIA 5JXWA 3F4BA 1EBFA 1MC4A 3JQ9A 2Q2WA 4WKGA 3KYCB 4GLLA 4QUKA 2V65A 2NUAA 3LU1A 2Q1TA 2J3JA 2X4GA 1NVMB 2O48X 4DA9A 3U4HA 2B69A 5BSEA 5C7LO 2GZ2A 3GH3A 3I6IA 3RU7A 1DFIA 1KERA 2CDBA 2FPGA 4R41A 1XGKA 2HK8A 4NFYA 3RUFA 4AJ4A 3HN2A 5A4DA 5A5FA 1B14A 4YBZA 4DPKA 1BG6A 4Z3DA 3LF1A 4IJUA 1X15A 3LC7O 4Y6PA 4CQMB 4KUGA 4E6PA 3PLRA 3WBBA 4J16A 2NWQA 2C5EA 2VT2A 3NDJA 3NV9A 4RPHA 5TJHA 3VZRA 3HDHA 1H0KA 3HFGA 2P5UA 3F47A 3GRKA 3IL2A 4E33A 2ZKLA 2Y1OA 4HY3A 3AI3A 4DLBA 4YR9A 1P9LA 1YRLA 3GVXA 4IIVA 1MG0A 5DN9A 5JNLA 4WK6A 1HDRA 2EKPA 3WGGA 1XDWA 1P1IA 1N2SA 4CLOA 3ON5A 4WPGA 3ZWYA 4WOJA 2GGSA 3OJLA 2VZ9A 1BVRA 3K8ZA 1D7OA 4AL4A 1T2DA 3NAQA 4UEKA 3L0DA 1UJMA 2VUSA 3ZCXA 1R0SA 1XG5A 4XR9A 1E3JA 4GI2A 1NP3A 5JCXA 4TMFA 5EJ2A 4BMSA 1ARZA 1GADO 4NU6A 2E48A 2EXXA 2YDYA 1KEVA 4NI5A 1N7GA 1HT0A 4YDRA 4FD3A 4RPKA 4A5OA 4BNGA 3PVZA 4EI2A 3N74A 1VJ1A 3ADPA 5DP2A 3PWSA 1HE3A 2JFGA 3GUYA 2FWMX 3OA0A 3FWNA 4LVUA 5JY6A 1NASA 2NU9A 5TNXA 4J7UA 3PYLA 2P68A 2YV1A 3WMXA 4A2CA 3U09A 2GCGA 3RCBA 1I2ZA 2H6EA 4L9RA 3WGOA 3P19A 2WYUA 2Y1GA 1I3NA 3R1IA 1TI7A 2OUIA 1C3VA 1TVEA 2Y1CA 3K31A 2EKQA 4BQPA 5CDYA 2X9NA 1FDVA 2PZMA 2BFPA 3BHMA 5F5LA 4BB5A 4L75A 4AJKA 5CEJA 3QVOA 1P77A 2IDZA 5JAMA 3DOJA 3QHAA 3DFUA 4E12A 1X1TA 4Y8VA 1YO6A 1K2WA 3P2OA 2JHGA 5LC1A 2FP4A 2IZ1A 1QV7A 4RVSA 5L53A 5TS3A 1YKFA 4IQGA 2ZIZA 2UVDA 3HUDA 4RLHA 1V6AA 4NMHA 2ZJ0A 3WWYA 1Z45A 3TZCA 3GY0A 1ZVMA 4CM6A 4YJGA 3N7UA 4OL9A 3TN7A 2Q49A 2Q46A 4J9UE 4HADA 1HYHA 5EINA 1PZEA 4IZIA 5G0TA 4J49A 3PI7A 3WLEA 2NQ8A 3CUKA 1YB1A 4BNXA 1LDNA 4QFDA 3EUWA 2P9EA 5A03A 5TSDA 2G0TA 2PK3A 1JVBA 1XKQA 5BNFA 4C4OA 3IP1A 1V9LA 3JV7A 4JJFA 4D79A 4DLLA 1X0XA 3PZRA 3CMCO 4MKRA 2C29D 4BKUA 1TB4A 2QX7A 2GDZA 1YGYA 4WEQA 3VH1A 3E82A 1XU9A 5L4SA 4FB5A 1RYDA 2G82A 1R15A 3ZWCA 1H6BA 2D5CA 3HDJA 3PQEA 1KY5A 2VTEA 1YL7A 1DOHA 2Y93A 3B1FA 4IY1A 1SEPA 1PQUA 4F46A 3H3JA 4KDFA 4IGEA 3KXDA 3X2FA 1FJHA 4JP2A 3ZV4A 4N5MA 1KEWA 3GMSA 1MA0A 2Y1EA 3L6DA 3TSCA 4DBVO 2AG5A 1YOVB 3FR8A 4PLCA 2BFAA 2FSSA 4YB8A 2PFGA 1DIBA 2YZ7A 3I5MA 4BMVA 4KWHA 2AW5A 1E6WA 3JQEA 3VZPA 3WGTA 3RC7A 3NGLA 5BQFA 1A7KA 4M87A 1LLUA 4GMFA 2O3JA 3E48A 4AFNA 1WDKA 3D5TA 1I8TA 1YBVA 1BSVA 3TFQA 4CM3A 1P31A 1AGNA 3B1KA 4PLZA 4CLRA 3DOCA 1DRUA 1NNUA 5A5EA 2FZWA 4YQYA 2BHLA 3UVEA 5TJ9A 4NBRA 5I9LA 2CSUA 4QTZA 2HO5A 2V6GA 1Y7TA 3PHLA 4QFCA 5COBA 5DBIA 1QG6A 3DAFA 1NXQA 3P2YA 2BKAA 5IZCA 5T6BA 4BNTA 4DMLA 2X22A 9LDBA 2ZYGA 3OJEA 3W1VA 2Q50A 1GFSA 1GYQA 3NJ4A 3OJ0A 2PZLA 5JPIA 4UREA 2A94A 2EKLA 4LRTB 4Q3EA 3OQ6A 1XIVA 1CF2O 4L8VA 1UH5A 1I3MA 2FSVA 5K0ZA 5DBGA 3ONEA 4Z9XA 2GASA 1A4UA 1JKIA 1FK8A 4WE3A 1Z74A 3UHAA 4C7KA 3RUHA 1Y8RB 2YY7A 4DC1A 2OBYA 4TRNA 4ZQHA 1NFRA 3I9OA 1NWHA 1HLPA 3KYCA 3JD4A 2AE1A 1EK6A 4CM5A 1SNYA 1P0FA 3ORFA 5FFFA 3IUSA 1SZJG 5LDGA 5CPFA 1MFZA 1CEQA 4FJ0A 4GWKA 1Z73A 3R3JA 1JN0A 5ILGA 2W2KB 3ZWAA 3AM3A 2GLXA 1P1RA 5AYVA 3VPSA 3NRCA 5JAIA 4MPDA 3V2HA 1E1NA 1QKIA 4U6SA 2IRWA 1A9ZA 2ZTLA 5JCJA 4FJ1A 4A73A 4GL4A 1AHIA 2D59A 4R68A 3PTZA 3TOZA 4E5MA 3RC9A 3RD5A 1DHRA 4JBGA 2EIHA 2JHFA 3LT2A 3CZMA 3INGA 3GHHA 3LT0A 5GZ1A 3RAJA 3NT2A 3MZ0A 4R16A 3O4RA 3HADA 2PZKA 2PKQO 1D3AA 3PK0A 4R1NA 2DFVA 1BGVA 4YQZA 5L4NA 4QECA 3TWOA 1Z75A 4FDAA 3DQPA 3GAFA 1PS0A 3T4XA 1FDUA 5A3VA 4GX1A 1J5PA 4O59O 1I01A 2DU8A 3JQ6A 1JDJA 5KJEA 2X7HA 5H81A 3ZH2A 4YEDA 3G17A 3T7EA 3M2TA 2X0IA 3SEFA 4K9DA 1F8GA 4WJZA 2VNAA 4D42A 3PGXA 1N9GA 4GBJA 3DBLB 4L73A 2W4QA 3CKYA 4J7XA 2QG4A 4LGVA 5IDYA 4ZA2A 2C82A 2PV7A 3C1OA 5L51A 1A9YA 1V0JA 4NU5A 3ICPA 4GVLA 3ZWVA 4PRKA 3IDSA 2NVWA 1EK5A 1IL0A 5JMWA 4BKQA 3ZWXA 4ILKA 1EZ4A 4RLSA 3KUXA 4DPLA 5HS6A 4I5DA 3AU8A 4XRRA 1LSJA 2X9GA 2ZK7A 5CHEA 1GV0A 1ZBQA 2VCYA 2TMDA 1RM0A 3SLGA 1IULA 2VYNA 1WNTA 4BV9A 3AI1A 1B3BA 4HFNA 4KMSA 1Z7EA 4RVUA 3OEWA 1HZZA 2JD2A 4QEDA 1DIAA 1VI2A 2NVUA 2P9GA 2AG8A 4FOSA 4E2YA 1WMAA 3I9MA 3PEFA 4PCVA 1DDOA 1ORRA 1ZKMA 3U4CA 4GKVA 2B5WA 4XIJA 1YJQA 3GZNB 3IUPA 4XEHA 3WIDA 1PZGA 3K30A 3IKTA 5HRUA 4GQAA 4XYLA 2HUNA 2B83A 4S1VA 4L74A 1U8XX 3PP8A 2C5AA 3K2BA 2V6FA 4DLAA 4XA8A 1G0OA 4OQZA 1PJSA 3GHYA 5G0WA 1GYPA 4BKPA 2P2SA 1A7AA 5TGDA 2I3AA 2FY8A 5T73A 3S2EA 3RKRA 3VPGA 3JYLA 4H16A 5EERA 3QWHA 3S1LA 1C1XA 3DZGA 5G2OA 5IDQA 4H7PA 1E7WA 1MUUA 1YBAA 1B15A 1E7RA 2ZB3A 1JTVA 1WLYA 2X0RA 3PHIA 3QY9A 1H93A 1MFPA 3UH1A 2QYTA 3L77A 3H5AA 1HZJA 1PGPA 4FPXA 3O9ZA 3JYPA 3F46A 2CF5A 3WQRA 5J9GA 2GN6A 4YAGA 2CDCA 4RVDA 3RROA 1SOVA 2QRLA 1HE5A 2HRBA 2WYVA 4BQRA 1B3RA 1YB5A 2Q2QA 3DHNA 3WOHA 2JCVA 1BXGA 4PZEA 5CDGA 2WMDA 1VPDA 3G1UA 2G76A 3WMWA 1WP4A 1GUFA 4CMEC 4FN4A 3WSWA 3VVBA 2X0NA 1W4ZA 2DVMA 3OFSA 4RGBA 3GQVA 4PLVA 4WLFA 3RQSA 2DLDA 4IZHA 1E3EA 1LQUA 4MOWA 3AUSA 2P91A 3S2IA 1J4AA 3ROMA 3QWAA 1NVGA 1LDBA 2C7GA 5HM8A 4HNGA 4Q39A 1T2CA 3QRWA 1BW9B 2ZTMA 3DWFA 3WG9A 1VRWA 2RH4A 4H3VA 1U5AA 3PLNA 1G6KA 4WLVA 3BTSA 3D3WB 4TRJA 3UCEA 1QR6A 4ZQGA 1UAYA 4R01A 1LI4A 4ALNA 2CVZA 2GNAA 2CVOA 3OQ1A 1R4NB 2E6UX 3FTNA 3GDOA 3Q9NA 4EZBA 5IXYA 1A4IA 5AXAA 3WJAA 2I5PO 2VTDA 3KLPX 2JD0A 3I9LA 3ZV6A 3L9WA 3UFXA 4QO7A 4GPD1 3AOGA 4EEZA 3B1JA 2VHZA 1GCOA 3RIHA 3JQ8B 4K6FA 4M55A 1Q0LA 4Y6RA 4UVHA 5COAA 2B4TO 3U9LA 4PLTA 1QV6A 4RF3A 3RFTA 1F12A 4AJNA 4DVJA 3OJFA 1IPFA 4YA6A 4TRRA 1ONPA 4CV3A 5TC4A 3AUAA 4KQWA 4BNUA 4II2A 3WBFA 3Q2KA 1DLIA 4CM9D 1E1LA 3ONDA 3AY3A 3U5TA 3AM5A 3LZ6A 1T26A 1OC2A 4BNLA 2BFOA 5TT0A 4E0BA 3Q9UA 3HB5X 4IQ0A 3PGJA 1QRRA 4OQYA 3PDUA 4EJ0A 3GVPA 2C0CA 3RWBA 3DC2A 4NJOA 2HKIA 3AY6A 3HHPA 3DBHA 2Y0CA 4ONEA 2Z1MA 4B3HA 3U0BA 1GDHA 1PL7A 3W8DA 4AJ1A 4BIIA 2YHUA 3H8VA 1HRDA 3QE3A 4HFJA 3ANMA 1UDBA 1P1HA 2OP0A 4GVXA 3JSAA 4R54A 2H9IA 3WGIA 1I30A 4OM8A 5KNLA 1ZK1A 3W8EA 4M86A 5I7SA 3ZN2A 4MJLA 4YXFA 4I5EA 3LC2O 2ZTUA 4ZRNA 3EGOA 2UDPA 4MKZA 3WFJA 1K6JA 4TVBA 5FEUA 2FPIA 1KS9A 3OBBA 4ZQFA 1ZJYA 1XQ6A 1PJQA 4WECA 3H9UA 3GOHA 2HDHA 1PJBA 4FFMA 4W7HA 4R9SA 5JDCC 4ZRMA 3WNQA 3ZU2A 4PG5A 1VLLA 4LISA 2OGUA 3FCOA 4WCFC 4TWRA 4CMBA 1HLDA 1E3LA 3WS7A 4MIEA 3DBRA 2NVUB 2QQ5A 2OZPA 1PGNA 4XB2A 1K3TA 1P74A 4PVCA 3FF4A 4A27A 2Z5LA 1NVTA 2I67A 1T2EA 3BTOA 1WZIA 5ENVA 2DTEA 3GZNA 1GZ3A 2HJRA 4E5PA 4U7WA 4KUHA 3RC1A 3C7AA 4M8SA 1C0LA 2Q3EA 1E7MA 4RZHA 2X1HA 4CL3A 1JA9A 3I6QA 4YJDA 3I4CA 3NTRA 2OMEA 1X13A 3BHJA 1QSGA 2DPGA 1J0XO 1UXJA 3GPDG 2F00A 4WOKA 3L4BA 3ZNQA 2VZ0A 4IDGA 4UEOA 1Q1NA 3S2GA 2JFHA 2IODA 1YBMA 5KJFA 4FFPA 4MVJM 1ONOA 2NTVA 4NZ9A 1ZK2A 4RQTA 4CLXA 4A10A 2C54A 1O95A 2BGMA 3DZHA 3GG9A 2P4QA 2CZCA 3JQFA 2GN4A 4I5FA 2B0JA 3GF4A 3UF0A 4AJ2A 3PHJA 1I2BA 5KJ1A 2I3GA 1VC2A 2NVBA 5I9MA 3W4IA 3DMTA 1BW9A 3DZJA 4YT4A 5JDIA 1HE2A 2D0IA 4E2WA 3D4OA 3I4FA 2CFCA 1XA0A 3F1LA 1VSVA 2OL4A 2VZ8A 3OIFA 3OIGA 4ID9A 1PJ2A 2O3UA 2IYPA 1O0SA 2BD0A 2WD8A 2JAPA 2PH3A 4D46A 2VOJA 4BS9A 2A35A 1E7QA 1XYGA 2C07A 3QA9A 4XRGA 3EMKA 4M1QA 3UKOA 4YJGB 4D41A 1I0ZA 1CQIA 4C7JA 3EYWA 2VUTA 2O50A 3GDFA 2C7VA 4BO1A 4QSMA 4DQUA 3AOEC 4UVDA 3GC6A 1V3TA 4CMGA 3PJFA 2AEJA 2AHRA 3TZ6A 3KZVA 1BWSA 2VHXA 5JE8A 4KTVE 5A9SA 3LDHA 4LVCA 4YAEA 1Y8QA 1LU9A 2J5QA 3JQ9C 5AXDA 5JLAA 3SXPA 4Q9NA 1KYQA 1N92A 5EQFA 1JAYA 1PL6A 1PEDA 1VM6A 1HDCA 2OORA 3IQDB 3ZNOA 3FWZA 3LLVA 4TROA 1PX0A 1LC0A 3HZZA 4ZVVA 5DOZA 4CLEA 3L6EA 2AEMA 3GZ4A 5ICMA 4O0LA 5K6AA 5A9TA 1UP4A 4ITUA 4J7CA 4BO5A 3NTQA 3IKVA 3ZW8A 3E03A 4AJOA 4AJIA 2IZ0A 2EJVA 4L76A 1M76A 1I3KA 4ZN6A 4IJWA 3H4VA 3JCZA 3BAZA 3ADOA 1IZ9A 5TIIA 5JY1A 1ISIA 2YJZA 4LRSB 1ZK3A 5JYAA 4E5NA 2RH8A 5F3RA 4JROA 1MXFA 4KOAA 3D4PA 5IAAA 1LXCA 4YRDA 1TXGA 2VT3A 3GK3A 4MVJF 1H5QA 3I52A 5BSHA 7ADHA 5IDWA 4G5HA 5L45A 4E2XA 5KWEA 4IS2A 4OSOA 4YJHA 5I7FA 3KV3O 3BZUA 4NJMA 4PGFA 1OMOA 5CPBA 2BLLA 4JBHA 4W99A 4YCAA 3RBXA 4DYVA 1ZO8A 1R16A 5F1KA 2EWMA 4XB1A 1SBYA 3NUGA 2IZZA 3TF5A 1ZH8A 5EQDA 1DJQA 1V35A 3PYMA 1ZIDA 3JQAD 4BNMA 3CIFA 1P3DA 2PKQP 1GPDG 3CE6A 3KBOA 1D4FA 1RYEA 3DDNA 3I9KA 1UXKA 1CDOA 2VYND 2LDBA 3T7CA 1H9BA 3GA0A 4XQEA 3H9QA 3UOGA 2EG9A 3I83A 4L4RA 1P1FA 1PJTA 4O5OA 4BVAA 3QP9A 2NU8A 1VKNA 3WGYA 1LUAA 4JJGA 3ZNNA 2W90A 1GEEA 3PQFA 3NEPX 3HQ4O 3NJ8A 4FGSA 1T24A 4CQLA 1KETA 1O89A 1R4MA 2GUGA 3WGQA 2UV8A 3K5PA 3BMQA 3RUEA 1U2DA 1SEVA 3FN4A 4I5GA 3KRTA 5EIOA 3PWZA 4J4HA 3TFOA 4EDFA 6LDHA 4DPMA 3WSVA 5JO0A 4GKBA 4B7XA 4OXKA 5JYEA 1PTJA 1B16A 3VAZA 1PSDA 1LLQA 3UUWA 3UICA 4PIVA 4EUHA 1Q7GA 1EVZA 3PFWO 1RJWA 2DQ4A 4LCJA 1YB4A 2OBNA 1RM5A 2O4UX 1ZMOA 4YPOA 1YXMA 3G49A 1BMDA 2VHYA 3BMOA 2Y1FA 2JAHA 4I9HA 1H6CA 4CM4B 1W8DA 3KYDA 3KM0A 5L40A 4XR4A 1GZ4A 3EVTA 4HKTA 3DL2A 1ADGA 1OI7A 2R00C 1TT5B 3M6IA 2HJSA 2BI7A 2BF7A 4WGGA 8ADHA 1WAMA 1GUZA 1P45A 4LW8A 2GN9A 3ZW9A 3RFVA 4PLHA 2D3TA 4W9NA 3KSDO 1MXHA 1XHLA 3O03A 1HE4A 3DXFA 1J49A 3MWDB 1XQ1A 5DT9A 4CL8A 2RHRA 5DOVA 5JSFA 4DXHA 4OIMA 4JX8A 4R3NA 1DFHA 3UGKA 3IP3A 4P38A 1QLJA 1OBFO 1EMDA 1E3WB 3EHEA 3QW2A 4UUPA 4LSWA 1WDMA 2H1SA 2POQX 4ZHSA 5G4LA 1PQPA 5DCYA 3AFNA 5C3MA 2W8ZA 1PWZA 4R1TA 4J1NA 4NDNE 1R0LA 2G17A 1VL8A 3WTBA 1W0CA 1ZK0A 3WTCA 4I9UA 4Z0PA 3OA2A 2RAFA 2W2LA 3MJ4A 1PJ3A 2EP5A 3GNTA 4NR0A 3BIOA 4XQGA 4BNZA 2DBQA 2V6BA 1ENOA 4JCOA 4YJHB 3IS3A 1SC6A 2DC1A 3BTUA 2CD9A 3F1KA 1SPXA 4M89A 4RVHA 4XWYA 3JQDA 1IOLA 1NQAO 3F5QA 4OOEA 3WNVA 3IJRA 3DHEA 3ZWOA 3HWRA 2I6TA 2Z1NA 1M2WA 3RBZA 4YT2A 3AK4A 5IFLA 4UUNA 4J1TA 3V5NA 1T2FA 2O2YA 2J3HA 1O8CA 3GMDA 1L7EA 3M1LA 1ISFA 4IS3A 4RF5A 4BNIA 5JC8A 1LRJA 3O38A 3AUTA 1PU2A 5IZCC 3JQGA 3EDMA 3SJ7A 3D3EA 2VHVA 1DRVA 2ZYAA 3H5NA 1F8FA 1LDMA 3AU9A 5JC1A 4AJHA 4LSMA 1E7YA 5EN4A 1RM3A 3JQCA 2GRAA 1GU7A 4ZD6A 4U0JA 4UEJA 2FOIA 4NFSA 4RF2A 4DMMA 1QXSA 4RPLA 3D5QA 3CH6A 2PWZA 5F5NA 5CEFA 1HTBA 1I3LA 1WDLA 5TLSA 3IMFA 1YL6A 1NWCA 2R6JA 2UUOA 3C1TA 5B4VA 3H65A 4EJMA 1ADCA 5BT9A 2I65A 1HDGO 4PLWA 3VH3A 2PGDA 1ID1A 4Q3NA 4KQXA 5IDXA 2OFPA 3CINA 1P0CA 4AJJA 2VYVD 4L0QA 2GO1A 4CUZA 1N1GA 1U3VA 2AQKA 2XPCA 3MCVA 2G1UA 3WIEA 4BO4A 2E37A 2PZJA 3QQPA 4BB6A 4NBUA 4CMIA 2NV6A 1JW9B 1LSUA 1PGQA 4YJFA 2NSDA 2R2GA 4XIYA 4BNHA 1X7DA 1O6ZA 1MLDA 1LDYA 3GDGA 3KVOA 1UR5A 4UULA 1CRWG 3BXXA 3LF2A 4JLWA 1NTOA 3FPCA 1QYVA 2PGLA 1NR1A 4TZKA 4BGUA 1F0YA 2FN7A 2WWRA 5HWSA 3NTOA 3EVNA 4KZPA 1E3IA 3OMLA 2Y1DA 3FNEA 2AQ8A 1JKFA 3PXXA 2I66A 4BNWA 1GD1O 1EDOA 3F5SA 1QORA 3CXRA 4FW8A 5A9RA 3ITKA 5A9SB 3SVTA 3DHYA 3DB2A 4E5KA 2BMAA 3SX2A 4L4XA 1GQ2A 4XDYA 4CQMD 1CJCA 3GT0A 3GNSA 4U6QA 4JN6B 2HMWA 3KEOA 1KVSA 3RFXA 1RM4A 3VPHA 1E5LA 1T25A 2H63A 1YVEI 1QYWA 2AXQA 3PJGA 3VKUA 1X0VA 1H9AA 4PG6A 1I24A 3P5SA 1OFGA 4TVOA 5A3JA 4H15A 4HX5A 3ANNA 1C1DB 3GGGA 2ZYDA 4U0KA 1YOVA 3KTDA 1ZEJA 1HWYA 2HQ1A 4LCEA 1Q2XA 4YT5A 4XQCA 4EITA 2VYVA 3WB9A 3PFFA 3UN1A 2QRJA 2DTDA 4CMJA 4RPJA 3U62A 4CV2A 4FFNA 4HFMA 3VHRA 1NAHA 4BNKA 5EESA 3RUDA 2WM3A 2Y68A 4UUMA 1KVTA 1DIGA 4Y67A 2HCTA 4YWJA 1Y9AA 1LBEA 3ZHXA 3HDYA 2B5VA 4Q3CA 3S2FA 1EVIA 1YWGO 1D1SA 3OICA 4LMRA 2HK9A 5DCWA 1A71A 1DLJA 1BDBA 4W7IA 3F9IA 4PG8A 3HE3A 4BO8A 3Q0EA 1LLDA 4XGNA 3SLKA 5DDIP 3WQSB 1CQJA 3GVCA 4BV8A 1R6DA 2VQ3A 2P9CA 1Q0HA 2WD7B 3JQBA 1ZNQO 4FQ8A 1VJTA 3OF2A 3U3XA 4WLNA 1Z7BA 4E2ZA 4J1SA 2Y0DA 2X9VA 4HFRA 3GEGA 1V3VA 4IDAA 4CPDA 4N7RA 2Q1UA 1DSSG 1H94A 4TQGA 4INAA 4XJTA 2PR2A 2YFHA 2DTXA 4AJEA 4DC0A 1B26A 5ITWA 4RL6A 1KEPA 1BXKA 2IXAA 2YV3A 4QXMA 2DBVO 4WASA 5TX7A 1ISHA 4DUPA 5JBIA 4ZICA 3ROPA 5JYDA 3MJCA 3DOOA 1KEUA 4GH5A 1EBUA 1ZSNA 2QIOA 5ITVA 3ETEA 4IBOA 4NNJA 3IJPA 2PGJA 4N18A 2CUKA 8LDHA 1IZ0A 3ZWNA 1N1EA 2DKNA 1T1RA 1UZLA 3LQFA 1DAOA 1E3WA 3GN2A 1TT5A 4W4TA 4CJXA 1I10A 2Q1SA 1PS8A 1QMGA 1MP0A 4OJNA 3TJRA 3ZHZA 4E5YA 3ZDFA 2AQIA 4E4YA 4TKLA 1QLHA 3LVFO 3ZGYA 1P33A 1ENYA 2QZZA 5KIAA 4CUKA 3VTZA 4RJTA 3PRJA 1IPEA 4UAGA 1K89A 1X7HA 4P4GA 4IQ8A 4XYGA 2VWHA 1C0PA 3IIEA 5T64A 4NK4A 4R5MA 1YONA 3DFZA 3QLJA 3GAZA 1U3WA 2NTNA 2DPHA 4XGKA 4CLHA 1JKJA 3JYQA 1TEHA 4L4SA 1SO8A 2FR0A 1F14A 5TQVA 4I1IA 4D3DA 3H9JA 2RBEA 3PIIA 3QWIA 2PTGA 3KLMX 4CUJA 5AXBA 4RO0A 3D0OA 3T4EA 3E6AA 1JAXA 4J1QA 1G1AA 1RWBA 4ND4A 4B4OA 3Q1LA 1IE3A 3O8QA 3JTMA 5L7WA 1VSUA 1TLTA 4UUOA 3U4DA 2YDXA 1SAYA 4AVYA 3AW9A 5H82A 1MX3A 3DTTA 3F6YA 1ZSYA 4IXTA 3S8MA 1E77A 2PKRA 2QYSA 3C3XA 1DBVO 3QVTA 2CY0A 3WJ7A 1FDWA 4HBGA 3TRIA 4OKIA 3W4KA 1GTMA 3WXBA 4A26A 1IY8A 4IJKA 2BRUA 1NM5A 2EHDA 4U8GA 3WGZA 4IINA 4RQUA 1BRMA 4Z9FA 1HSOA 3H2SA 4NK5A 1AUPA 1XLTA 3V1TC 3OIDA 3ONFA 2B36A 4P8RA 4FBGA 4BO2A 5CAEA 5G0UA 3ZZNA 4CMIB 2EV9A 3DBVO 2A4KA 2CNBA 4B4WA 5CP8A 5HS4A 2VRCD 4CM1A 1RKXA 1X14A 1MB4A 3STHA 2XOXA 4NBTA 5AQ1A 1KVRA 3MEQA 4OKNA 4ALLA 4BKRA 1IB6A 4J0EA 5L3ZA 5JMPA 4E3ZA 4Z0TA 4FGWA 4FS3A 3I3OA 1GEGA 3IAHA 4BGIA 4O6VA 1XR3A 2ZCUA 5DZSA 2O3QA 4XX0A 3ANLA 3BMNA 4NBVA 2PNFA 2O3TA 1KIFA 1ZJZA 4OYRA 3FBGA 3D3WA 3MOGA 3HG7A 4ND2A 4DQVA 1UXHA 1LLCA 1A72A 1LQTA 4YYZA 5TT1A 3NT5A 1FMCA 3WYEA 2OXIA 3JD0A 1Q7CA 1PJLA 3ZV5A 3ZI0A 1F17A 1NHGA 2V6MA 3RJ5A 4OH1A 2DFDA 5HTOA 2Y99A 3Q6IA 1MC5A 4MO2A 2YW9A 4R9RA 3GVIA 5ILOA 2B4QA 1C0IA 4GSLA 2Q99A 4J2HA 3GGOA 4XYBA 1Y5MA 4J6FA 5FF9A 3L6OO 2QRKA 1ZK4A 1M6HA 1BXGB 4O63O 3VOSA 4CV1A 1NX6A 3ASVA 2X6TA 5TF4A 4LK3A 1NFQA 4NBWA 3N58A 1YDWA 3KETA 4D45A 5B1YA 4RVFA 1Y9EA 3OSUA 5L7TA 1NPYA 1ULUA 3AWDA 3INTA 4ZU3A 1IHYA 1K6IA 4IMPA 4MP3A 1E6EA 3QVWA 3CPSA 4YVFA 3PYXA 4PN3A 2RIRA 4WNCA 5T8KC 4BUCA 2GF2A 2F1KA 1K5HA 1E0DA 1HDXA 1GQYA 5KKCA 3AFMA 4DBZA 1Y8RA 4CMHA 5CG1A 3ENNA 1MV8A 4S3MA 5H83A 3DZKA 1EQ2A 3DZIA 4RPGA 3VDRA 3MTGA 1R4NA 1Q7BA 5GZ6A 4XQ9A 3EW7A 3IC5A 4OMUA 3RUIA 4D43A 5CDSA 4HXYA 3E9QA 3PHHA 2GERA 1R66A 3DBRB 5I9NA 4F3YA 1ISGA 1O94A 2X86A 4IDFA 1CETA 4RORA 2VWGA 5GZ3A 2O2SA 4MIYA 2AEFA 1HF3A 2B4RO 1J6UA 1DC3A 2JJYA 3H3FA 2XF8A 2DBZA 3GLQA 2YQ5A 2CVQA 4J4TA 1YQDA 4KTTE 3TOXA 1N8KA 1HDYA 4MIOA 1PJCA 4Q3AA 2UAGA 3MJEA 3VPFA 2NACA 4IUYA 3C1AA 3HB4X 4JK3A 3KSZO 3OHSX 1LX6A 1ZZEA 4XKJA 1LA2A 4YAIA 4EGFA 4B4UA 1OAAA 1GCUA 4K28A 5JCJD 3PQDA 4KUEA 1L1FA 4D0RA 4Z0HO 4Z9YA 2GZ3A 2EW8A 3QWBA 1ZFNA 1NPDA 1PGJA 2I9PA 2O7SA 4TRMA 5JFOA 3PIDA 3VH2A 3C7DB 5B4TA 4IDDA 4DRYA 3W8FA 5L4LA 3FPLA 1U8FO 4Z3KA 1U5CA 2WEKA 2IEBA 1ZXLA 3E5MA 2HMTA 3F4LA 4ND3A 3WX0A 4YRBA 4IGFA 1KC1A 3D64A 1CYDA 1MGOA 2FRDA 2Q1WA 1UDCA 4CM8A 4WCFB 1S7CA 4R5HA 2X5OA 3ETGA 4GGPA 2IXBA 4NHEA 3JQGB 4I8XA 3KHUA 4YTEA 5CFZA 4P4LA 3C7CB 3NKLA 2HU2A 4MP6A 4J43A 5K6AC 1B0AA 3VVCA 2PH5A 3G79A 3BMOB 4J4BA 1HDZA 5C7IO 3B70A 2PY6A 2J3IA 4K6CA 1E92A 1KOLA 2PD4A 3UCXA 2CDAA 5AVOA 1DFGA 3MWEB 1P44A 2EJWA 4GX5A 3VPXA 1E1KA 2BGLA 1E5QA 3TNLA 4R1UA 3QJ5A 5EMHA 2BELA 4FFRA 4YRAA 3A1NA 2QZ9A 3FR7A 3GGPA 4PG7A 5BSFA 1LTHR 3WFIA 2DBRA 2J8ZA 3G3EA 1WVGA 5A04A 1X7GA 4PRLA 3MTJA 2GD1O 2FR8A 3VZSA 3H9EO 1N7HA 1OOEA 2YFQA 3ROKA 4FC7A 1ZUD1 4D7AA 5BSGA 4J9VA 1WWKA 4N5NA 2V7PA 3FNFA 3R6DA 1WXDA 2QW8A 4PLFA 2ZJ1A 5GMOA 4XYEA 1VKOA 3E9MA 1YDEA 3DONA 4OXNA 3E5RA 1JVSA 4WCFA 1FDSA 1N5DA 2D5AA 4OXYA 4E13A 2DM6A 3NDIA 3BMCB 3A4VA 2PLAA 1HYGA 3RUCA 1ZW1A 1T2AA 2EF1A 3EY4A 2DUWA 5IF3A 4P4NA 2AA3A 2VWQA 5I8ZA 4YT8A 4A7PA 2FZEA 3VKVA 2CF6A 3AJRA 3D7LA 2Y66A 4B79A 4FOOA 4WLEA 1EFKA 3JQ8A 4AJPA 2O23A 5U1PA 1TT7A 1H6AA 2ZATA 3HN7A 5DULA 5IXSA 1AN9A 1R0KA 3NGXA 1D8AA 2HSDA 2AMFA 3OECA 2B35A 2J6IA 5U9CA 3H6KA 2ZQZA 1WMBA 2X23A 3LK7A 1DC5A 1XWFA 3ZHBA 1I5RA 2Y0EA 2Y67A 5FYDA 1BVUA 3DBHB 1N9GB 3RSHA 3B6ZA 3VTFA 2IYOA 4FR5A 1SCUA 1B8UA 2GYYA 1ZMTA 1R37A 1Q0QA 1WPQA 1R4MB 5G4KB 3V1UA 3OQBA 3W6UA 3WGHA 4CM8B 4R3WA 2AE2A 2VUUA 3JQFC 3GEDA 4CODB 1PZFA 4IXWA 4OAQA 4GLOA 3K73O 2WYWA 3OJOA 1HKUA 4MVJH 1CERA 5G4KA 1K0UA 5IG2A 3FHLA 4CR8A 9LDTA 4JBIA 1FDTA 1RPNA 5KKAA 1ENPA 1NQ5A 3Q2IA 3DMTC 1YS4A 4MDHA 1LJ8A 3RKUA 1ZCJA 4BNNA 5TRTA 2I99A 1EEHA 3I23A 2X0JA 4W9NC 1Z82A 5I8WA 2BH9A 1HSZA 1DC4A 5F21A 1M6WA 3TZQA 4GMGA 3R0IA 1UZMA 3WYBA 4BO6A 1PL8A 4EEXA 3C8MA 2A9FA 2AQHA 4IDBA 5ES3A 3TPCA 3W4JA 2E4AA 4Q3BA 1GUYA 4PLGA 1XEAA 4NJMB 2J5KA 1ISMA 5IN4A 2P5YA 4D0SA 1NYTA 4ESOA 1ULSA 1T4DA 4ND1A 4ALIA 4XJSA 4YAKA 1NBOA 3LT1A 4A03A 4B3IA 3M1AA 4TZTA 3AOEA 2YHIB 3ETDA 3R3SA 4G81A 2XXBA 3RVDA 5LDHA 2ZB7A 3GUCA 4ALJA 2YQ4A 3I9JA 3BTVA 2OHXA 4Z6KA 2EERA 2VN8A 2YUTA 5C5IA 3EK2A 2NM0A 3I9NA 3QIVA 2OO5A 3KSUA 2BGKA 5MDHA 2A92A 4B3JA 1HYEA 4RDIA 4XDZA 3JD2A 5FI5A 3DBLA 2D1YA 3OETA 4D3FA 4EUFA 4N5LA 4Y6SA 3BA1A 1EDZA 3DEYX 4CQLB 4FFOA 4F6CA 1H2HA 4ALKA 1IHXA 1LSOA 5HBRA 5DBFA 5G0SA 4DIBA 2VRCA 3AUUA 3QSGA 1E7SA 3G0OA 1AHHA 2FR1A 1FXSA 3ICCA 5IJZA 5KJ6A 3TL2A 3E9NA 4FSHA 3ST7A 1ML3A 1GR0A 1C14A 2W2LD 4MKXA 3FI9A 3L9XA 3P7MA 2VWPA 5JAZA 2YYYA 4R4JA 2YHIA 1KVQA 4QO8A 4RZIA 3GFBA 2Z95A 3COSA 2VRBA 3E1KA 1XU7A 3PJDA 1B7GO 1VJ0A 1B2LA 4DIOA 3JD1A 3ZU4A 1HXHA 5THQA 3EC7A 4BO0A 1Y5RA 4IPTA 4B7CA 3WLFA 3FSRA 5ICSA 4ZQEA 3HSKA 1O9BA 1BXZA 2W2KA 2E82A 3LT4A 4NH4A 1U28A 4AICA 3MJVA 2G5CA 2NLOA 4J3FA 4PLPA 4XD2A 4BMNA 4CR7A 3WYCA 1GV1A 4BOYA 4ZGWA 5CDUA 5KJCA 2OP1A 2IEDA 3VDQA 1DAPA 1ONNA 2EP7A 1EUDA 4CMEA 1U1IA 3H5RA 3BHIA 3SBOA 3WQQA 3JYNA 1DEHA 4GGOA 3DZBA 3DMYA 1IYZA 3K6JA 4WLOA 3RJ9A 5A02A 4OSPA 1NQTA 4HUJA 3UAGA 3B20A 5G0VA 4XCVA 3ZWPA 2TMGA 1HL3A 3OH8A 1U3UA 4OOFA 4BNFA 2HMVA 4D3SA 2ZB8A 4JP3A 4AJLA 3GEMA 5DCUA 4J90A 1U4SA 2CMDA 3ZU3A 1LRKA 2GN8A 1JWBB 3CZRA 4JIGA 3V8BA 1NPTO 3M2PA 3OP4A 4URFA 2HMSA 1BDMA 3MJTA 4G65A 6ADHA 4BL5A 1UP6A 1SOWA 2WTBA 2Q4EA 1EUZA 4FJ2A 1YL5A 3JD3A 1GZ6A 3O26A 1NR7A 4J2OA 3BYZA 1QP8A 2E49A 2O3SA 1GPJA 1UXGA 1YH3A 3CEAA 5F1OA 1JQBA 2WE8A 2ZQYA 3H7AA 2X5KO 3LC1O 4WUVA 1PS9A 3H2ZA 4M54A 1PR9A 4OO3A 3L4SO 4RV9A 4JGBA 4FIZA 5T57A 3NT4A 1X1EA 1VL6A 3JYOA 3WWZA 4PZDA 2EW2A 4HWKA 2ET6A 3ULKA 3RU9A 2FHSA 1PZHA 4W82A 1I32A 1I36A 4HNHA 3GG2A 5I7EA 2Q45A 4GSKA 5I7VA 3INRA 1UP7A 1LDEA 4DGSA 2Q22A 2B37A 1UDAA 3FRJA 1M66A 5JAQA 3K92A 4PVDA 4ROSA 4A0SA 5JS6A 1EVJA 1A5ZA 1U9JA 3BMCA 3DTYA 2JCXA 4QQRA 1EUCA 4PLYA 3TZKA 1P1KA 1GAEO 1DRWA 4CQMA 5A1TA 1PGOA 4DIFA 4KP7A 1EE9A 4CR6A 3RASA 4IJVA 3ZWBA 4BO7A 4IDEA 3ZNPA 5J23A 4G2NA 1LC3A 5CG2A 3KYBA 3VH4A 4NFHA 2GZ1A 1WZEA 3L07A 3I1JA 2NU7A 5ER6A 2VNSA 2ZTVA 2PA3A 5JO9A 3E8XA 1EVYA 2O3RA 4EYEA 2BFMA 5A05A 5EPOA 5BR7A 2O4CA 1ENZA 4IM7A 5GY7A 2RHCA 3JQBC 2FMUA 2ILTA 4F45A 1C1DA 3PHGA 1G0NA 2Y05A 2XXJA 3TQHA 4DYDA 1DIHA 1XCBA 4RVGA 4CLOB 3TDKA 2J3KA 4CV0A 1U3TA 4YACA 4R51A 1LNQA 3IOYA 3KEQA 3JQ7A 4FFLA 4K1LA 3AI2A 2D8AA 5DF1A 2DUUA 3UCFA 2X8LA 1M75A 3ROQA 1E3SA 4E31A 1ADBA 4D44A 2GR9A 4MVJD 4TKMA 5HA5A 4UVGA 3GPIA 2EGHA 3ZWMA 3KOUA 1EQUA 2HMUA 2GSDA 4DL9A 4ZQBA 5KCZA 4UVEA 1DO8A 3VZQA 1UZNA 1GL3A 3A06A 3CTMA 4B4VA 4CMCA 4BGEA 3AY7A 4JNKA 4DQXA 1UXIA 4W6ZA 4DREA 3RI3A 2JKVA 4I08A 2ZB4A 3QVSA 3GN1A 4XYMA 4XZ3A 2DT5A 4GWGA 5L7YA 3V2GA 3DAGA 4CM7A 3DO5A 1XELA 4IDCA 4HV4A 3TZHA 4RF4A 3JQ7B 2NTJA 2UUPA 4DTIA 4YAJA 3HFSA 3RC2A 4HP8A 1NQOA 1KC3A 1IUKA 2LDXA 3ZHYA 4DWVA 2SCUA 4MVJA 1I2CA 4R1SA 3X2EA 4BO9A 1SB8A 2WDZA 5MGBA 3WDSA 3QV1A 3K2EA 1GYRA 1Y81A 4J91A 4RCVA 4B8WA 1BHSA 4LMPA 4NG5A 1DC6A 4I9NA 2IE0A 3K96A 3ITDA 3SC6A 5IZ4A 1S6YA 3DAPA 2DAPA 3GFGA 4PG4A 1AXGA 3AM4A 3EZYA 4RDHA 5JDIC 3W6ZA 4BHTA 1KVUA 2JFFA 3LLSA 1ZSVA 3QVXA 1ZXBA 1U7HA 3PWKA 4N54A 3NDRA 1Z6ZA 1DPGA 2W98A 4OGWA 3U49A 3C85A 1F06A 4BNYA 2PD6A 4YJFB 4P22A 1L7DA 2YV2A 3SJUA 1I33A 3LYLA 4QT0A 2NU6A 3HJAA 3A14A 3PJEA 4PFJA 2WSBA 2QHXA 4WEOA 1UAGA 2WE7A 5KVCA 5JYFA 4WCDA 5IN5A 3HNPA 3PZBA 3DR3A 1UUFA 2C59A 4EJ6A 3KB6A 5L95A 4NPCA 4BGVA 3FD8A 3E18A 1DB3A 1C1XB 4CM9A 5C7OO 4JXKA 4LN1A 1ZEMA 4AG3A 4JJIA 1EFLA 2HK7A 4E21A 1LEHA 5KVSA 2Q2VA 3ZU5A 4KDEA 5KOIA 4BKOA 3VC7A 4EW6A 1A27A 2JD1A 2GPTA 1LSSA 2HAEA 3ZV3A 3D4NA 2EEZA 1YQGA 3UXYA 2VOEA 1YQXA 1T1SA 3MOIA 1PJ4A 3KYDB 1KY4A 3D1LA 1M67A 5BNTA 1CIVA 5BNIA 3OM9A 1E1MA 1JWAB 1XSEA 3GRPA 3GR6A 3GNQA 4B8ZA 3V1YA 4BNVA 1MG5A 1W6UA 4OHUA 2PD3A 4QX6A 3A28A 2H5LA 3FNGA 4X54A 1FF9A 4UVIA 4CMAA 3RBVA 5K9ZA 1WW8A 5CDTA 2BI8A 4MINA 3GVHA 4MVJE 3FNHA 1AE1A 1HDOA 4MVJI 4ZJUA 1ISJA 4Q3DA 3SC4A
chains in the Genus database with same CATH superfamily
2YJ4A 3R5TA 3KT3A 3MWKA 3C24A 1JG3A 3LW8A 5FOWA 5E7QA 4AF8A 4CDNA 5L9AA 1K6XA 4R2JA 3Q11A 2QV0A 4M49A 3F9CA 4BFVA 1FYVA 1B8VA 1SB9A 2O1SA 1KE2A 2D4AA 3IAS6 2AW3A 3VFDA 3R3XA 3VR2A 5JDCA 3KT8A 1M54A 3M5PA 4OHWA 4ARSA 2JAUA 3L1HA 2I76A 4C6TB 1QIFA 2NQTA 5AKYA 4Y9DA 4QXOA 1OYWA 2C3PA 2J6HA 1QHEA 4RIEA 3R5SA 3V2UA 3DTNA 3QH4A 4UMDA 5AW3A 3D8SA 2AWOA 2C2XA 4RY8A 4WN3A 4GX2A 3VNSA 2A5LA 3O1IC 1O97C 2V6IA 3EVZA 4UCQA 1K8QA 2P4EA 4X7MA 3UJHA 3WSTA 1GSHA 1PVDA 1BX3A 2D2IA 3RGGA 4X95A 2QIPA 3MBOA 5ALRA 4ERNA 5CA0F 4O2RA 3AIMA 3OPYB 4Q34A 4RWEA 1HLGA 5A0TA 2Z04A 4HVCA 2PUJA 4DDKA 1OREA 3BKXA 3D7NA 3EZLA 3NASA 1HETA 1R2QA 3D1JA 3H2YA 4C06A 5JCPA 2Z2IA 4XX0B 4FDUA 3GPCA 4PRYA 1W94A 5FAXA 1B8PA 3EWAA 1T6XA 5J2TF 3N5CA 1SY7A 3HYLA 4PZCA 3ZBTA 3CFYA 2HOQA 4QNRA 4YMIA 4KYIB 4AZ3B 2C20A 1F2UA 4CM4A 2FPPA 3NX4A 1Y1PA 1TU3A 2H29A 4MI6A 4TT3D 5C81A 5KTKA 3D2LA 3TGWA 4PANA 1A7JA 2HSJA 4FC6A 1WW3A 4QC2A 3V4OA 3IR5A 1CD5A 3KE8A 5LZ8A 3VZCA 5KUTA 1VDMA 1EWVA 1X1CA 3QHPA 5IS2A 3HR4A 5G1PA 5JSZB 2QUZA 2BEWB 1QCZA 2Q4BA 3OOYA 2JI4A 5BURA 2JJ1D 1BTOA 2FCRA 1U2GA 2XWPA 4X44A 4UJ3A 1X74A 3MGBA 3U4IA 2CLCX 4PYKA 5CFRA 3VYRB 2ANBA 4QAQA 1QFMA 4CLRB 5J1TB 4HZIA 3DZFA 4MX8A 4EMTA 1STOA 2J1LA 3QFTA 1JYSA 4GMHA 4UARA 1GQQA 4WFIA 2C3YA 2HQOA 4ZO4A 5PNTA 1G6OA 3BFPA 3PC8C 4EFNA 5IPFA 1VIDA 4EBFA 5EJEA 2VPPA 3WICA 4BNJA 4L5JA 5JQGF 1F4LA 2Z58A 1HO3A 3HO6A 4DV2B 2DJ5A 1RLOA 1PR3A 2F8LA 1QHHA 2HNKA 3B9RA 4LHZA 3UANA 2XMGA 1TK9A 1C9DB 3WR5A 2EQAA 1XMIA 4LXTA 2OBFA 2EFHB 1I0LA 3KFXA 3UW3A 4F6LA 5JWRA 2O2JA 4U3JB 4EK9A 3WAJA 2ZAMA 1GZSA 4KV7A 1V1RB 4LRQA 5M6DA 2QM3A 4RVNA 3FTCA 5HR5A 4QDZA 1N2IA 3RS4A 3QLTA 1M0TA 5DYIA 3ZXUB 3HDQA 1K27A 4PAMA 3UMVA 1KQGA 2CV0A 3UMRA 1V1MA 4MDEA 3KJGA 3BB4A 2G9QA 4IUDS 1S8FA 2W00A 5GOTA 1XCOA 4GAEA 5BSKA 2EDAA 1OWOA 2Q8NA 4M0LA 1TZ2A 2KHZA 4URXR 3EDYA 4G8BA 2JGFA 3OFJA 4A8PA 2NXWA 3PD0A 4L8GA 4WNIA 1QYCA 4ZEVA 4R2XA 2I3ZA 3VR3D 1HDEA 1SMKA 2AC2A 4OK6A 4OPMA 1YE3A 3ASUA 1XI2A 2BBTA 4EKNB 5B4UA 4NL4H 1YFLA 4FBLA 1EBFA 1Z38A 3VTAA 3T3HA 2O2XA 4AN4A 4K9RA 2WILA 4V0KA 4YRRA 2I87A 4Z99A 3BEDA 5ELLA 2R8EA 2V65A 2G9ZA 2NUAA 1DEXA 1XCPA 1Y3CE 3OJCA 1NC3A 2QRQA 4B83A 2Q1TA 1WMEA 4RZUA 5KNCH 1HL7A 2J3JA 4ZTBA 1NVMB 3IAM6 4TLBA 2IZOA 1U2PA 5F4BA 2Y1XA 3AQ4A 2IOFK 3Q0TA 4BKMA 3IUMA 4RGYA 3AESB 4W1PA 3V3TA 1DFIA 3HVJA 4NFYA 1XGKA 3SYKA 2ORIA 2C4VA 3WAKA 5A4DA 4GKKB 1S8NA 3AR6A 1AO0A 3J80A 4G07A 2AJCA 3CNHA 4DPKA 1BG6A 4MR9B 4YI5A 4Z3DA 4QUBA 1AN0A 3TI7A 5LMCA 2GZMA 3LF1A 1XL1A 3JATA 3PG5A 4O2AF 3TW0A 2HWKA 2I80A 3BRCA 4E6PA 3WBBA 1ODFA 2G77B 1IQRA 1COWA 4B9AA 2C5EA 2VT2A 3UMYA 1EFUA 3AMVA 3AVOA 5TJHA 6ABPA 1KNQA 3V42A 1ZHHA 2ZRCA 5HIKA 3VPCA 5AW7A 2EBUA 1Q0SA 3IL2A 3KIPA 2BHRA 4ZVPA 2ZKLA 1C9KA 4KPUA 5ALHA 3WNBA 1ZOLA 5HUHA 1XZAA 4DLBA 1KWKA 1QOZA 1P9LA 3KVYA 3DMFA 1IUPA 2GPBA 3I6BA 2ZKIA 5DN9A 3IEVA 2V4ZA 4QOGA 4WK6A 4PM4A 4A5OA 1ZMXA 1XDWA 4AULA 2JLXA 1P1IA 3ON5A 4WPGA 3THRA 3X2SA 3OJLA 1RZRA 1BVRA 2UUAB 1D7OA 4AL4A 4UEKA 4RM2A 3L0DA 3L41A 1FFGA 4UCWA 2OAQ1 2VO1A 4DCPA 4XR9A 4DA0A 4TQUS 5AKJA 5EZ5A 3EPPA 4LJAA 4PX5A 1UYJA 1J5XA 2B98A 2BDEA 2E48A 1PI3A 4AKSA 3IPCA 4JQSA 3C3CA 7YASA 3ICEA 1KQ3A 4YDRA 3EGVA 4NF2A 1S0UA 4RMNA 1NMQA 3AJDA 4PHCA 4TUYA 1VJ1A 3EQ7A 1V16B 1GZ5A 1RP7A 3GUYA 3BXPA 3BWDD 3L8FA 3PX2A 1L5KA 3ZD8A 4DTCA 4F9FA 3EH1A 2YV1A 2GD6A 1R8QA 1SG0A 2D1SA 2FU5C 1EUCB 2X13A 1LBSA 2JNWA 5EAIA 3T5GA 1AQUA 1I2ZA 1YDMA 1GPWB 4V0QA 3UWOA 1DJPA 1TI7A 2XEXA 3R1IA 2XRYA 4HDMB 1C3VA 4I14A 1BKDR 5T4FA 4URHA 4UU7A 2X9NA 1FPMA 2IPAB 1RJDA 2PZMA 3BHMA 1ZUWA 3DZ6B 4WZAA 4BB5A 3O1LA 4KXUA 3Q87B 3QVOA 4L95C 1P77A 2IDZA 5JAMA 4MPPA 2XH8A 3DZ3B 2IP2A 1GL7A 4KR0A 2DX7A 1QQ7A 2QT1A 2FW6A 4QYMA 4ZT3A 3IIMA 4EGJA 2FI1A 2NO4A 3CWZA 4X20B 1PF7E 2AH5A 3D8RA 1MEJA 3SHOA 1TCVA 3VM6A 5L53A 3L8EA 3P9KA 1FBNA 2VAWA 1NI4B 5TS3A 3MTDA 4PZYA 3RU3A 2ENUA 4GPAA 4RLHA 4OATA 3RYFA 4CW7A 1PTJC 4G1FA 4ES6A 2FUNB 5CA0A 2IYSA 2V59A 4N0PA 1S3FA 2JJ2D 2ZJ0A 2XI4A 3FE2A 1Z45A 3ZVNA 5KS2A 1I79B 1WU7A 1ZVMA 5FBZA 4C6HA 5A6VA 3LWBA 1I14A 4L08A 4OL9A 4L50A 3VJRA 1QHXA 1KYTA 2XR1A 3LFHA 2JZCA 1PWHA 2IC5A 2VA9A 3IJ5A 3OO0A 4J9UE 5J2UB 1JVNA 2VNHA 1U0EA 2PMDA 2NQ8A 3H2HA 1E3TA 3JAKB 1YB1A 1KFCB 2IHTA 3CJQA 3GIWA 4L0MA 2PWPA 5IF9A 5A03A 2EQBA 4LTNA 3RV4A 4DR4B 4DMGA 3DMRA 5EKUA 1Z6YA 4NMMA 4OQEA 3VISA 1FFBA 3JV7A 4JJFA 4D79A 2Q9BA 1KQFA 5EE1A 1TQ2A 3A04A 2VTVA 1KYWA 3GBSA 4MKRA 2OZLB 1RQRA 2QX7A 1YGYA 2J9FA 1Z4PX 4D8UA 1XU9A 1MIOB 2AJLI 4GBED 4DQDA 2IF0A 1MO3A 2VDJA 3V7NA 1RYDA 2G82A 1PDWA 4AMGA 3TGPA 2NV0A 3ZWCA 4YCCA 2CCKA 3U16A 3PIRA 2OLEA 5DU2A 3I2FA 4EKYA 3PNBA 1ZN9A 3NNSA 1WS6A 3H3JA 3PXDA 4TMVA 1IBMB 5J63A 3M9LA 3JPYA 3MTEA 5CT8A 4CU5A 4GP9A 3X1ZA 3DE7X 2DQKA 1VJ5A 3JQRA 4F5WA 3KR9A 2PL5A 3I9V1 2HCRA 2J9YB 2OAGA 1A4RA 2ZPUA 5C5CA 4FI3C 1MA0A 3AEQA 2JI6A 4PSAA 5FBKA 4DBVO 2AG5A 1FQWA 3B13B 1OB2A 5TPZD 2ZJYA 4PLCA 2WA2A 1SCNE 1UMCA 2FSSA 2VK1A 1VSTA 1SK9A 5CFOA 5KWSA 3O9VA 3SKVA 3I5MA 3H42B 1QVAA 1IOVA 3EF3A 4KWHA 3WMEA 1E6WA 4BN4A 4G1MB 4FLEA 3V4LA 2C3UA 1EINA 3NGLA 4M87A 3FMIA 1LLUA 2CXSA 5EGNA 3QKIA 4OVKA 2QRNA 1NA5A 3H2JA 3D5TA 3WJ2A 2UZ3A 4UATA 5J4LA 1P7YA 1YBVA 2NVOA 3QVUA 3NCTA 3TFQA 3DKKA 4CM3A 2K2WA 5ECDA 3K0AA 2P2YA 5TMBA 1DRUA 1YU9A 2VJDA 4DCVA 9ABPA 3L8ZA 2BHLA 2PN1A 4LG1A 3CR3C 4NBRA 1JI3A 1HGXA 3OE7D 3Q6NA 4QTZA 2OKGA 4I55F 3BH7A 5DJ5A 3D3NA 2H18A 2UUCB 1Z47A 3ED1A 5CNIA 1NXQA 1M83A 3ILSA 1KPGA 5IZCA 1I1OA 2CXUA 3G0DA 4BNTA 3HXMA 2X22A 3OJEA 5CAEB 2JK0A 5IRCD 4QRIA 4NNOA 2VSQA 4WOCA 2VP0A 3GLKA 1LZLA 2PZLA 4LOIA 1U90A 3KWLA 5E7MA 3BBLA 1AY0A 3IGFA 4WADA 1U8UA 5CW2A 3FFBA 5BN5B 3DZ7B 3BL5A 3IPRA 3FRHA 4L8VA 3V33A 4DA4A 2H1IA 3WB0A 1LNZA 2YV5A 1E4OA 3VYSB 2SBTA 5L3VA 3V2IA 2GA9A 1IN6A 3NH6A 2VR1A 2OGTA 1UT6A 2QMYA 2O8BA 2PBLA 3STTA 1K7SN 1CFJA 1U7OA 5AKEA 2X0FA 5B7QA 4YASA 1O6CA 4ZTUB 2YOHA 5D87A 1DOAA 2GFQA 3IHTA 1NUHA 1E8NA 2RHHA 3UT6A 2IIQA 2AE1A 3S7TA 3VO1A 1EK6A 4AQ7A 5BV7A 4YROA 1HQYE 2PFKA 3C5HA 1GG2A 1EM6A 5J9FA 3A31A 4RETA 3ZCQA 3C3MA 3LH5A 2XCQA 3IUSA 2OC4A 1SZJG 5LDGA 2RG1A 3G85A 1S3SA 5CPFA 1QG0A 4HGYA 1NUAA 3EZGA 5KKNB 1WXHA 3R3JA 2NUBA 2W2KB 1I4TD 2Q6IA 3AM3A 5AMXA 4V39A 3ZWAA 4PR0A 5CXSA 4BGDA 3EDCA 3V2HA 4AUEA 2B8WA 3IQWA 4FJ1A 4WK2B 1KI2A 3ZDEA 4A73A 2IH5A 4PYNA 5L6LB 3TXYA 4PEVA 4R68A 4LV5B 2NZWA 2XUKA 3PTZA 3TOZA 1ZH4A 3RC9A 3RD5A 1TW2A 3B53X 3OD1A 3LT2A 1G9TA 1K7FB 2O0JA 3CZMA 5ITZA 3O8BA 4AK1A 5GZ1A 3QPAA 1FJ2A 1N75A 4R16A 5KQLA 1WSDA 3LSTA 2PZKA 3WWCA 2QX4A 5FT9A 4QOJA 3ZHOA 4BFWA 4Y0NA 5FI1B 4BWVA 4B3CA 4YQZA 4ZO6A 1JJFA 3D3QA 2HF7A 2PZAA 2QSUA 5E1OA 1IQUA 4AUMA 1GZDA 1VBKA 4A1OA 4JJ6A 1KPIA 1Z35A 3HUFA 4C0JA 1FDUA 2EZUA 1LPAB 5A3VA 1GRVA 3CNQS 4C5BA 5IMSA 5KJEA 1I01A 3ZH2A 4QKQA 2NUTB 1ZN8A 3T7EA 1U9IA 1RZVA 4F21A 1DU4A 3MMZA 1XNJA 3C43A 3LKBA 1XD9A 4N1AA 1S2GA 3NALA 5FWAA 5IUJC 1T8WA 1CUIA 5EMMA 3H0VB 2QEQA 3C4JA 3DBLB 3K9FC 1M1UA 3QI2A 2PGOA 1SD2A 3B51X 3F7OA 3RUPA 2ZI5A 5HPYB 3RTCA 5I45A 3AGQA 1LV7A 2FSUA 2XIJA 3L2OB 4I0WB 1BWPA 1TEZA 4NU5A 3OC0A 4GBMA 4GVLA 3B2EA 4GWLA 4MTLA 4HXGA 4CEHB 4PRKA 5BMOA 2G4LA 3VBCA 2OFXA 3GP3A 3O90A 3RS0A 1IL0A 1SKAA 4WIAA 1VPLA 4ILKA 3HJNA 4H1UA 1Z0AA 1EZ4A 3CPJB 4RD6A 1SG6A 2I62A 4CTKA 4BNFA 4I5DA 2P67A 1JS1X 2QT0A 5DBEX 3C4VA 1P5FA 4FYHA 5DHSA 1C3XA 1XU4A 2ZK7A 1K86A 3AW8A 3E61A 3NVAA 3QOYA 4LE0A 4CKCA 2YHBA 5A5GA 1V9CA 3N2NA 4PFQA 5H68A 3RANA 1RM0A 1HMYA 4DR1B 5A3SA 3AHGA 2AN9A 2R86A 1FUUA 5BQPA 4OGGA 4KMSA 1Z7EA 2BPOA 1AOXA 4OY3A 5B3KA 5CCBA 1CRPA 5LYJF 1ORDA 4N0DA 1VI2A 4QEDA 2P9GA 2AG8A 1G3UA 1WMAA 3PEFA 3RYIB 4EKGA 5HIIA 3REQB 3AO0B 3OCVA 3Q7TA 4Y2GA 2QN7A 1RJGA 4V02A 4GE0A 5K3CA 3IUPA 3TTUA 1Z2DA 2QY6A 1OZ0A 1TUEA 3WIDA 4FWIB 1CP3A 1GL9B 1NBIA 1NI5A 1ZN2A 2EJBA 3OOHA 4S1VA 4L74A 2XQGA 3CF6R 3EVCA 5HILA 2VXYA 4K6HA 4MYCA 1SUCA 1F4VA 2V6FA 1POXA 3GXOA 1YZVA 1DTEA 4FZ3A 4PO3X 4B40A 4G37A 1B00A 1KXJA 1AKNA 2M9MA 4OQZA 2W6JD 3HB1A 3WP0A 3MINA 5LFAA 5TGDA 1DELA 1QO9A 3D6UA 4L15A 3T0IA 2I6FA 4WFQA 1I1QB 4WOBA 2FPXA 3HBNA 2H0QA 5ALMA 4JB0A 2OG2A 5CXXA 3DBIA 5G2OA 2IQIA 8GPBA 2CL6X 4I6GA 5F7OA 1CZLA 4F9EA 1RAIA 5EHXA 3MQ4A 2A88A 1B15A 1E7RA 3OKPA 1HUQA 2HZ7A 2W37A 3IULA 1FSGA 5AICA 4QDXA 4O08A 3PHIA 4H4EA 2CXTA 3UH1A 3TAXA 3L77A 3H5AA 4C03A 1KSJA 1PGPA 4G56A 2CF5A 3UXMA 5J9GA 2GN6A 1T5TA 2UYOA 2WHQA 3L6BA 2JIBA 3ZIDA 4HTFB 3FPFA 3K4HA 2QRLA 4LYJA 1HE5A 4LJRA 4F3TA 5TVKA 3ZHUA 1FLNA 3GW8A 2ODQA 4MS3A 4ZT2A 2XGGA 2WYVA 2WSSA 2GH1A 5I7UA 3IEIA 2JCVA 1BXGA 3KEFA 4GRAA 3TR5A 3BIJA 3THXA 2F4VB 2V45A 4RIIA 1AZLA 3WLQA 2Q4DA 4DLZA 1GUFA 3EULA 4JBNA 4A3SA 1KO5A 5TMPA 4LGYA 1RI1A 4D4LA 2BGTA 2P9FA 4DQKA 4U3JA 4RDXA 3HUUA 2C4TA 2XVYA 2PZ8A 3QVGB 4IZHA 2REBA 3OG9A 3P1JA 2P91A 4YO8A 4PYLA 5FTWA 4AXXA 3NDPA 4EKIA 3GJ5A 4RHFA 2XX3A 4CKWB 2Q3MA 2YJ5A 4H59A 3RSGA 2ICAA 1T9GR 2B34A 2GFIA 2H5IA 3CB4A 4HQLA 1EDBA 3R7LA 2CEKA 4Z4EA 1LX7A 1VRWA 3H0CA 2VSFA 2QORA 3QXSA 3PLNA 4ASUD 3QBDA 3PA8A 4MTCA 3D3WB 2VXBA 4B6RA 3W79A 5C1DA 4CIWA 1HI9A 4LJSA 1ZM9A 2BR5A 2VNKA 1RVDA 4XPIA 1SCQA 3O3NB 4FR0A 3DT8A 1U0LA 2CNLA 4QEKA 4Y2UA 5LUBA 2CVOA 1T8UA 3PEYA 3ET4A 5KPJA 3F0TA 4IGKA 3I9LA 3N0RA 3ZV6A 3HMKA 3PVCA 2MSEB 2XOKA 3NWPA 3UFXA 2ODBA 5JBNA 2M2IA 2PMCA 5CK5A 5HRAA 3BQNB 2PWYA 2VJAA 2Q6VA 3MF4A 3Q5DA 1L4LA 2QB5A 4I1SA 5BOVA 5K3DA 1TK2A 3G0CA 3UKDA 3V1LA 4EELA 4K6FA 4TXLA 1J56A 3A9RA 2DSNA 4D9CA 4BQEA 3EQ6A 4H4CA 4AC9A 3MWGA 3G5LA 2L82A 1SHJA 4PO8A 3H0WB 2AOTB 4PLTA 3RLFA 4ZT7A 3C5VA 1WNFA 4KG7A 3CPEA 2Z4SA 4AJNA 3HYCA 1ZI6A 2HBYA 3R6GA 4TRRA 3E23A 4CV3A 3X44A 4KQWA 4BNUA 5JH7F 5DN6D 1OLSB 4B3GA 4RIFA 3S5UA 3AM5A 3U5TA 3GEHA 4AS3A 3PC7A 1T26A 4A2QA 3T15A 3V46A 2BFOA 1NYLA 5AVYA 1JQ3A 4JQZA 1UPCA 1QRRA 3PGJA 3M3DA 3EPAB 4EJ0A 4AG5A 2PUVA 1AS0A 1W88B 5K0SA 1NXPA 2C0CA 3FMPB 5DSXA 1ZJ6A 1ZMRA 3DC2A 3NBAA 4MUXA 1MPXA 3BE6A 3ONNA 3HHPA 4ON9A 5LXTA 5E2BA 4KFCA 1G3MA 3IUJA 4ZAFA 1GDHA 1PL7A 3U0BA 3W8DA 4BIIA 3H8VA 3QE3A 821PA 5JQWA 4HFJA 3V7YA 1P1HA 2OP0A 3JSAA 1LF5A 1J2JA 4MWGA 4OJQA 3ZQUA 1N2CE 1I30A 4GOOD 4OM8A 4TV8A 3AHIA 4OQQA 3PA6A 3HPRA 2CVFA 1LS1A 1AKQA 1JIIA 1T5DX 2FRXA 3ESRA 3HM9A 4YXFA 3CVVA 4H31A 4QQ8A 4AKHA 4MKZA 4EL0A 2JLSA 1K6JA 1C41A 3N0TA 1KS9A 1PJ8A 2ATIA 1AZTA 2ZS7A 2QX9A 3H9UA 3KQQA 4JI1B 2DERA 1GCIA 5ANRB 1V8PA 1PJBA 4FFMA 2WF9A 4P80A 4CKBB 4NOMA 4R9SA 3SOZA 2YWBA 4P4SA 1KOJA 2D6FA 3PEEA 3LA6A 4NESA 4UTVA 1RPTA 1VLLA 3BH6A 5KYUA 2C7PA 2O7VA 3MUNA 2OGUA 2BHSA 3PRYA 4WCFC 4Z2AA 1R6VA 2J09A 3PX7A 2P3LA 1E3LA 4RZXA 3W8RA 2YQZA 3W05A 3WS7A 4DRZA 4EMSA 4TLAA 5LP6C 5F33A 1K3TA 4EGCB 1P74A 1TQ6A 4PVCA 4WXHA 4A27A 5K8UA 3G8CA 1ECPA 4KO1S 1ISRA 4NV3A 3BTOA 2XITA 1K97A 4BFSA 4DCTA 1JH8A 1GTVA 1FP4B 1G6Q1 4P3KA 4U7WA 4XPZA 4YY3B 3DP9A 5F3DA 1C0LA 1XA3A 1E7MA 1K8ZB 2JBAA 2WUGA 3O2NA 1R0BA 1JA9A 4HNTA 4Y30A 3KSAC 4NP6A 4FHCA 4RDCA 5HP4A 1B1CA 1T91A 2BZSA 2HJGA 1M8GA 2F00A 3L4BA 5EXSA 5HFAA 5IVDA 5K7SA 3EPLA 2VZ0A 3DF9A 2JFZA 3SPXA 1R9JA 2CHUA 4UEOA 5B1HA 5E4JA 3FY4A 3GT3A 2CFIA 4JLOA 2IODA 3CLSC 4WKCA 5KJFA 4MNTA 2NGRA 5HUJA 3TOVA 1ONOA 4IZ6A 1E2FA 1ZK2A 3AR3A 3PEWA 1XRNA 1DQRA 5IMBA 1N5OX 1P1CA 1Q84A 1ZMBA 1RI3A 2ZVPX 3CSUA 4CLXA 3H5TA 3EPKA 1QRUA 1RC1A 1SRRA 3B52X 3M9WA 1OROA 4D6XA 3OQMA 1Z22A 1O95A 1TEXA 2G71A 4ACAA 1FNSA 3LX4A 2IL1A 4FMCF 5ALKA 4R1MA 2CZCA 3GV0A 3U7QB 4BB9A 3BFKA 2J45A 4OQDA 3KPVA 3RFUA 3VYTB 4C0KA 1NXXA 3FYCA 4G5GA 4F2WA 1E1RA 2VBCA 1BEZA 4EH1A 3UF0A 2B0JA 3RRJA 3CF0A 1U04A 2I3GA 3INNA 4TMWA 2CWDA 1MJGA 3F8TA 2F2TA 3PDIB 3W4IA 1BW9A 4UZSA 5JUWA 1HE2A 3RRZA 2VQFB 3E1GA 3WZLA 3HI4A 3U39A 4J3JA 1DNPA 4MR7A 1PBTA 3F1LA 2VKQA 4ID9A 1R74A 2HCFA 2QE7A 2F6RA 2GAIA 1MJHA 1UBRS 4DIUA 2WD8A 4BVKA 4DEXA 2JAPA 1CUZA 4GGMX 4LHEA 4S0XA 3N7AA 3PFHA 1XYGA 4XRGA 2CK3A 1O96B 2I6QA 2YFYA 3GDHA 1ORVA 3QA9A 1JE0A 4M1QA 3UKOA 5KC9A 4YJGB 4C4AA 1B42A 1L7AA 4DQ0A 3FYDA 5HK9A 1I0ZA 1WV0A 4GQIA 4C7JA 2VUTA 2EKDA 2B99A 2GSWA 4H6PA 3PUHA 4BO1A 3BDAA 1L5ZA 1J39A 3GC6A 2ZREA 4MB6A 3GLRA 1R5BA 3CNOA 2BGUA 3SR4A 1KJ9A 2AHRA 5BMVB 4CETA 3T7RA 3KZVA 3IMGA 4L5YA 1X3LA 3LDHA 1W5BA 3MT9A 4JVMA 3JQ9C 3FTDA 1KRXA 5AXDA 1IRXA 1MVLA 1A50B 3T7DA 1J70A 3SXPA 3IKMB 1GAJA 3P27A 3HJTA 1UJBA 4E5VA 1WDWB 1NW3A 3DTVA 3P2JA 4PX9A 3SEZA 4NBNA 1GTG1 2IX9A 4HGPA 3U3ZA 4AO7A 4YRMA 3FDXA 3OC6A 1L7BA 1LC0A 2KLBA 2NV2B 1SKMA 4XDHA 1AMUA 4G6ZA 1JPVA 2ZW9A 2AEMA 3HVIA 5AKKA 1V8FA 3I4LA 1QIHA 2C9OA 3RVKA 4KGDA 4A9AA 5DNUA 5ICMA 5LQCA 2JFOA 3A1WA 2A0FA 4BO5A 4J7AA 3B8HA 5JFTA 4OLAA 2XYQA 2ZDQA 4JB2A 1UQTA 3ESAA 4JASB 1FYDA 1M76A 1PHPA 2P2NA 1ZCFA 4BAUA 2W48A 3OFVA 4MGKR 1MH9A 1NDQA 2IUFA 4V3BA 4ZJYA 1RWWA 2D1TA 3PKIA 3TNJA 3V1MA 5BVGA 2OCLA 2R8RA 1ZK3A 3DHVA 2ILVA 4RBNA 4KPGA 1NF8A 1IAVA 1TJ5A 1MXFA 1X1DA 4AECA 1ZU5A 4B31A 5KYWA 3D4PA 4Q4LA 3QXXA 2XZOA 4OYYA 1TXGA 2VT3A 4S2EA 3HP1A 5LBTA 1EXDA 1U3CA 2H57A 1H5QA 4JSRA 2ACVA 4FEAA 1D5CA 3PQ2A 1DO2A 1E4YA 3HB9A 4YPVA 4BPBA 4MV6A 2XUIA 2PT7A 4P53A 4K86A 2GBFA 3A6HA 3AC0A 1K7EB 3A6LA 4PGFA 3IMCA 4D02A 1W19A 4IVPA 5GTDA 1KOGA 4RYLA 4Y9UA 1N2HA 1ZO8A 2HUPA 3KDSE 5F1KA 4YCBA 3RS9A 3D8NA 3Q6MA 4XB1A 4LWQA 1ZICA 2NPOA 3G82C 1UADA 3VU0A 2V1UA 3RR2A 2ZYIA 1YHYA 2Z0MA 3CLRC 3HY4A 5IKPA 4PU0A 5EG5A 4O25A 3M5WA 4ZC8A 2GVNA 4BNMA 3CIFA 1P3DA 1D2AA 2HRCA 3RM3A 5JARA 3VI4B 4EF5A 4MEJA 3TUIC 1FS4A 1LWNA 1H9BA 4L5CA 3H7IA 1M2NA 3LIIA 3UOGA 4QU8A 3LXRA 3RRNA 5B53A 4MYUA 1QGUB 3I83A 1P1FA 4HPJB 4L4RA 4O5OA 2VT7A 4JBYA 2NU8A 3RTBA 3WGYA 3TSYA 3ZNNA 2W90A 4INZA 3T3PB 1V48A 4I66A 4ZKDA 3DL0A 4M1TA 5EIBC 4IIEA 3ZQKA 3W2IA 1JZTA 3H5LA 1R4MA 4CQLA 3WGQA 2V3WA 1WEKA 1M6EX 3I3SR 3JAWA 5KO2A 2QPAA 3BB1A 4TV9A 3OQNA 2JLWA 2HN9A 2Z9DA 2AFHE 2ZUCA 3AINA 1H1LA 4BLOA 2DUMA 4URVR 1C4KA 2A1TR 3PWZA 3P9NA 4J4HA 4OGLA 3GRZA 5LQAA 3TXAA 2CVHA 1JB1A 2V4UA 2OCKA 3FNRA 4GKBA 4B7XA 4AROA 3GP5A 1PTJA 3BJMA 3VU9B 4NTZA 1PSDA 5KB3A 1LLQA 1ITZA 4BP9A 3UICA 2QR2A 3HKBB 2ZWPA 4EUHA 3S44A 1EVZA 4LCJA 1YK0A 3MGKA 3VPBA 1AJEA 2ZT6A 2ZOSA 1Z6XA 5FOVA 2OBNA 3EVDA 2XE6A 3PF9A 4Q4HB 4AUKA 1ZMOA 3HWWA 3CEPB 4PO1A 2BTOA 2JK1A 3BMOA 2JAHA 4CT5A 1H6CA 1UMBB 4FE7A 4IL5A 3RSLA 5C51B 1NVVR 2C97A 5DH9A 5D7NA 2F4NA 1KDZA 1N1DA 5L40A 1SXQA 1WKCA 3RYHB 1FXWF 2HYDA 2ODNA 4HEA1 5AVZA 4NYMR 1BX0A 1JHMA 1Y4UA 3ETJA 1NI4A 4HRAA 4H1TA 5HM6A 2WJIA 2HJSA 5F2KA 2O8FA 2BF7A 4WGGA 1GGEA 4G0QA 4LW8A 2FZ4A 4OFBA 4U5XA 3UK0A 4EL5A 3RFVA 3IX7A 3KG2A 3DS8A 2O19A 1QQ5A 1XP5A 4BP1A 1MXHA 3DXXA 3O03A 3DBOB 4D25A 2MINA 4MAMA 4DCUA 1ZWKA 3C39A 5CYOA 2RHRA 2OK8A 2X6RA 4JX8A 4QDOA 1DFHA 2CKMA 4P35A 4FU0A 5FNVB 2Z43A 4RYDA 1B8NA 4P38A 3H3XA 3EHEA 3A1SA 1FMFA 2GJ4A 3QW2A 4V0LA 4LSWA 1ZNWA 2GMWA 2QVBA 3LA8A 3LVBA 3RT7A 1G20B 4RS3A 5BYKA 3FDJA 1V39A 2H1SA 4G3XA 4ZHSA 3LY8A 5FUQA 3EXIB 1PQPA 1M1YE 1YK1A 3A4MA 3K9WA 3KC2A 3PC6A 5C3MA 2QVYX 2H1CA 2HHAA 2W8ZA 2WSIA 4R1TA 1U0FA 2DT8A 2PO7A 3RSOA 3ZKAA 2JZNA 4RKEA 1F0PA 2XCLA 1VL8A 4JVNA 4LBWA 4FYJA 4L72A 1W5AA 2C04A 5JNSA 1U6KA 4YCMA 2C88A 3OURA 4N82A 4ZV4A 4GZ6A 4XQ0A 2J0VA 2EP5A 4JEMA 3I8XA 2JRLA 7GPBA 2DC1A 1T0HB 3CBQA 3K9HA 2YNMD 2FFJA 2NZ8A 3QXCA 3FFAA 4NCAA 1NVXQ 2ZT7A 3QKTA 4C87A 2H1FA 1TUBA 2FSHA 2P9TA 2FV8A 4FN5A 1A1VA 1TKCA 3VPDA 4OEHA 1URPA 5FL7D 2XCTB 4EYGA 2I6TA 4BVLA 1X9HA 1TQHA 2JLYA 3Q10A 4PQEA 4A36A 1YNOA 4I5IA 2WTMA 1G60A 1T2FA 2G9NA 2O2YA 3P96A 5KYXB 3M1LA 1O8CA 3UG7A 1ISFA 2ZRNA 3CGGA 3D6NB 5A4KA 1LRJA 3AUTA 1PU2A 1XZCA 3QKUA 4PZ0A 4QICA 5IZCC 1X8KA 3D3EA 1DRVA 4YAUA 4TSFD 1SKQA 1O4WA 1F8FA 5MFZA 3PC2A 5SYMA 4A8HA 2ISSD 2YJ6A 3TNFA 1QMHA 4LSMA 1P2UA 4EZEA 2BFFB 5EN4A 1Q16A 1RM3A 3JQCA 3N70A 3J7TA 1MO4A 5K0FA 2W71A 1M34B 2IH4A 1CVIA 3F4KA 2YIVX 2VSYA 4WTOA 4HLUA 5KCMA 2R4QA 2PYZA 5FQNA 2BH2A 3G2KA 2YS7A 3CH6A 3QENA 1ZL2A 2FSVC 1M2HA 2RGDA 5IJAA 2ZPTX 1S4QA 1NWCA 2R6JA 1W2WB 2GPAA 2IWHA 5BT9A 3DE6X 1KEEA 3SZRA 4A8TA 1ID1A 4W8OA 1G3QA 4E1BA 1XPUA 3S2SA 2GARA 2RJOA 4K40A 4TTRA 3K70C 4LYEA 4AJJA 1UZAA 3FNIA 2R9VA 4L0QA 3KOZA 3HFJA 3MTAA 1G8GA 4V3CA 5TQ2B 4EJSC 3UPTA 4CUZA 3SE7A 3DMHA 3L7MA 2PJRA 1N1GA 1U3VA 1Y0BA 1A5SB 1M7HA 2BEVA 2LCFA 3HJUA 4M99A 4YIKA 4D6PA 2W6IA 4DR6B 2PZJA 2OILA 2BFBA 3NVMB 5CIQA 1L5HB 4CMIA 2QJTA 4ENQA 5LIRA 5H8WA 2Q6TA 1LSUA 3L8CA 3X1WA 4Z51A 2F1JA 4JKOA 4RAOA 3OE1A 4KSYA 4BRZA 3KEGA 1CJSA 1CUGA 2CBXA 1OKKD 4B82A 4YP5A 4HDSB 1Y34E 1G19A 1KF0A 2JKYA 1N5LA 1AA6A 1G55A 3BGVA 4J75A 3GQBB 1W47A 3V8PA 4E70A 2PUAA 2EYQA 1NTOA 3FPCA 3OZFA 1QFSA 2FN7A 4BDTA 4L8WB 2HIGA 1VCNA 2Q9AA 4LXIA 2X76A 1AS3A 3ZYCA 4KZPA 4O4LA 1Q74A 1E3IA 3OMLA 1E1CA 3ZDQA 4RTRA 1RYFA 2O2GA 1G7RA 4B5LA 2BGJA 4BNWA 2ZRQA 2W8BA 1W0KA 4MUAA 4O2AB 3IAXA 1QR2A 2G36A 4RCYA 3RVRA 3NM4A 4MV1A 1REQA 5EVJA 2H4WA 2PX5A 1ZQ1A 4QXQA 1RXVA 1RKUA 2GF9A 1A8UA 2BJHA 2REQB 3CKMA 1JLHA 1KQNA 5THXA 2ZJFA 2I91A 2PYDA 2VSOA 2OEPA 1ZN7A 3MGGA 2XYHA 3N76A 1OBHA 2V7UA 2VJBA 2ZBVA 3G0HA 3UG6A 2OC9A 4TYQA 1WTAA 3UK2A 1YVEI 1X8XA 2YIDA 2HV8A 3AH8A 3C74A 3PJGA 2CHGA 4Q9KA 2ZZMA 4A82A 1H9AA 4PG6A 1E18A 4XWKA 1P1BA 4R83A 2CKDA 1C9JA 1DTWB 2CLIB 1K6EA 1A5BB 2C2OA 2PKEA 1EWRA 1L9KA 2ZYDA 3GGGA 4P3NA 4KO4S 4U0KA 3TSAA 1YCHA 5BWBA 5KTSA 3DOEA 1QU3A 4NAUA 3VHXB 2CJWA 5KMGA 5K3FA 1U7XA 3LQRA 2Q7XA 3PFFA 5DWVA 4EITA 2VQSA 4CMJA 1H66A 1WUYA 4L3WA 4YMSA 2AN1A 3N8NA 2V03A 3BK1A 4OHFA 4DUYB 1SVMA 3AM1A 4P0TA 3BQ9A 5HUQA 3OQOA 1BFUA 1JU3A 1PT9A 2X3UA 3LUFA 1U1FA 2D0OB 1YRAA 1QONA 1WCIB 3AG5A 3JVVA 2BBWA 2C4KA 3KTAA 3R6WA 2ES4A 4IJ5A 4KXLA 2WJJA 4UQOA 4ZO7A 5FL3A 5B3JA 4Y67A 4EFKA 4NU0A 1N1MA 3CNBA 1LBEA 4GLJA 4U39A 3R4CA 3HDYA 1QHNA 4LXHA 3S2FA 2VSXA 1EVIA 3EAFA 3STUA 1YWGO 4LMRA 2P9ZA 5C35A 1UM9B 1BDBA 3NOQA 1DKQA 4P32A 2TECE 1ZITA 3C16C 4O2BB 3WK5A 3SBEA 2AOTA 1WV1A 4ETWA 4H9GA 4REQB 1N32B 3GVCA 3FVTA 3EDQA 4HMQA 1I2AA 1TJPB 2N42A 2ZSAA 2C84A 1EFVB 2QP9X 1YMVA 5DT2A 1Z7BA 4E2ZA 4RKYA 2X9VA 1FU4A 4HFRA 4HTFA 4RSMA 5IAGA 1RFGE 1DSSG 2Q1UA 4H6WA 4UHFA 3O8OB 4INAA 5FO1A 2XSZA 5LWHA 1PT5A 3P9RA 4AJEA 2VQEB 3DDOA 1J97A 5HF8A 2ZVJA 1BXKA 2YV3A 1VYVA 3FWYA 4WASA 4ZVTA 1DEAA 1OVMA 4HH0A 3ROPA 721PA 3DOOA 3CZQA 3N87A 3QNMA 3K8OE 4GH5A 1FVHA 4BNDB 1H4TA 1ZSNA 5C53B 1M2JA 4QBIA 3SX4A 4E1AA 1FTQA 1YE8A 2MOKA 4XJVA 3AZQA 8LDHA 3R0JA 2CFSA 3N28A 2G40A 2BJVA 3N05A 1N1EA 2PGNA 4CKWA 4KFTA 1UZLA 1GG9A 2ADMA 1DAOA 4MQEA 4KVGA 3GN2A 1TT5A 3Q9LA 5FX2A 3OTQA 4DLXA 5BV2P 4EVRA 3A37A 4KWEA 5AH0A 1AUOA 2PVSA 4OJNA 4DCMA 1DBSA 3TJRA 3ZHZA 4XWWA 1QE3A 1ZQ9A 3O93A 3R8FA 1SIWA 3LVFO 3IAS1 1XTRA 4QIHA 4ZEXA 3C45A 2RK3A 4KQCA 3IESA 4CUKA 4EG3A 2VRNA 5KIAA 3ADBA 1IB0A 4YRIA 3PRJA 3EFHA 5EWJB 4P4GA 4X41A 1FFYA 3NBQA 4BX0A 1C0PA 1N2JA 3GARA 4JU9A 2XUPA 3ZZTA 1IBCA 3IIEA 1B4DA 5HIJA 5T64A 3RK0A 1EVLA 2FZLA 3AJ8A 4BTLA 1ZGHA 2DPHA 3C2QA 1JKJA 2B2XA 1WF6A 2IY8A 2Y2VA 2D2VA 1SO8A 1ODKA 3I2HA 3PBKA 4IX1A 4L4SA 3CJTA 5EQJB 1Z5OA 2OWEA 2QUHA 4MUKA 4NE7A 3CX4A 2IDMA 4I1IA 4Y2TA 3H9JA 5DSZA 4D3DA 1XB2A 1U2GC 2HQSA 1GG8A 2PTGA 4ZAZA 3NZEA 3KLMX 4MPJA 3T0GA 2G1PA 1DJMA 5AHOA 1J8VA 2PRJA 3B5JA 4PCLA 4RO0A 3COVA 3T4EA 4P3PA 4RKWA 3RSSA 3KLBA 4B4OA 3OUZA 1NW7A 1PFUA 1MAWA 4FKBA 3L0CA 3JWHA 4E6EA 3LCVB 1TLTA 1YR6A 3TZBA 4M9ZA 1GFWA 4YLEA 1K9VF 1AK2A 3L6RA 4YJ3B 1F8YA 1MX3A 2IKSA 3WADA 1U8CB 2AB0A 4D9HA 2W2XA 4M1YA 4IXTA 3EXG2 1E77A 5BWLA 4OKSA 2PKRA 3U5ZB 4WKPA 3GJTA 3THWB 1H2XA 1SC1A 1NLZA 3WJ7A 4JYBA 3B1VA 3DEJA 2XKJE 1F51E 4Q9DA 4F4HA 3W4KA