1T4BA

1.6 angstrom structure of esherichia coli aspartate-semialdehyde dehydrogenase.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
MQNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution Structures Reveal Details of Domain Closure and "Half-of-sites-reactivity" in Escherichia coli Aspartate beta-Semialdehyde Dehydrogenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 126
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1t4bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t4bA01
2Y0DA 5EN4A 4E31A 1PTJA 4JBIA 2D5AA 4XEHA 3PWZA 3RC7A 5DOZA 3GG9A 2BMAA 1DIRA 1E7RA 1NXQA 3DHYA 3DXFA 3UF0A 2W4QA 4OSOA 4TRRA 1MV8A 1I2BA 3V8BA 3M2PA 2VZ8A 1PS9A 2F00A 2CY0A 4UVIA 1CETA 4RF2A 1YB5A 3PFFA 5TT0A 3N7UA 4IIVA 5KCZA 2YDXA 2R00A 2O3QA 2VUTA 3EHEA 4RV9A 4U5QA 5U4QA 4YJHA 5KJEA 3PJEA 3IQDB 2AW5A 1IOLA 4WCDA 2BELA 1V3TA 1XELA 2EGGA 3W4KA 3GZ4A 1YDEA 1ZZEA 4AJ1A 4BNXA 4J7CA 3WS7A 1DIHA 1PQWA 4TRMA 3EVNA 1E1NA 3O9ZA 1X7DA 4HNGA 4BNVA 3VPFA 1Y7TA 3LT2A 2O3UA 1W73A 2YJZA 4DVJA 2P5YA 3N74A 4P38A 4HADA 1NPDA 3SC6A 1XQ1A 1ZK0A 1LDNA 1ZBQA 1K5HA 5CDGA 3DTTA 1NWCA 3I9OA 5H82A 3ZU5A 1D3AA 4L75A 3ZW8A 4E2WA 3E6AA 4GX2A 4DWVA 4TRJA 5EJ2A 4XGKA 2G17A 4L74A 2HO5A 3GGOA 3PHGA 2RBEA 3TWOA 3R3JA 1SNYA 4NH4A 4OAQA 4FQ8A 3FBGA 2D2IA 4GAEA 1Y9EA 3AFMA 3ANLA 3RVDA 3IJPA 2O3RA 2Y1FA 2CMDA 2ZTMA 3AY6A 1YBMA 5G2OA 4WLVA 3SC4A 2PD6A 3AY3A 3JQ8A 4RVFA 3EGOA 2J5KA 1P9LA 2RH4A 2DQ4A 2PKQP 3WIEA 1XWFA 3IP3A 2WM3A 4W9NA 1IUKA 4CLHA 3GK3A 3AK4A 4B3JA 4DTIA 4IQ0A 4XA8A 3PZBA 1WMBA 3OHSX 3NKLA 4OYRA 1FMCA 3NJ8A 3A14A 3WWZA 3JQDA 2OHXA 2C59A 2ZJ1A 1TT7A 3F1KA 4RGBA 5BNFA 2VZ0A 2DTEA 4HP8A 1CIVA 3PK0A 1E0DA 4KDEA 3ZU2A 5F1OA 5GMOA 3MJSA 1PJCA 3U49A 4Y67A 4O1MA 6LDHA 4M55A 5A5EA 4GGPA 1GR0A 3MOIA 4WGGA 1O8CA 2W8ZA 4ZJUA 4O6VA 3KM0A 4BO6A 1C0LA 1WNTA 2PZKA 5LCXA 4D3SA 4CMIB 1NASA 4B3HA 4M1QA 1U4SA 3UN1A 4EEXA 2C5EA 1XG5A 3DBHB 4FGWA 3HB5X 3AJRA 2GUGA 1A4UA 4D41A 5JXWA 4MVJD 4NBTA 3GHHA 3VH3A 4BNYA 1Z73A 1TT5A 5EPOA 4BGVA 4Y6SA 3DZIA 1Z7BA 2FPGA 4NMHA 3U4CA 5IF3A 1U9JA 2OO5A 4D3DA 4PRLA 4ZN6A 4M49A 4YT2A 2Q4BA 3LF1A 4JGBA 5DP2A 1C1DA 3JQ8B 5JLAA 4PLPA 4GI2A 1HE5A 5JDCC 4IJKA 1ZSVA 3C3XA 4B4UA 1VKOA 2A9FA 5CDUA 2ZB4A 1JLLA 4KTTE 3OJFA 3AW9A 4OH1A 5L3ZA 3TN7A 1X1EA 2UUPA 4N5LA 2X7HA 3QRWA 4OOEA 4CLDA 4OMUA 1UZLA 3DZFA 4NZ9A 1D8AA 3T7EA 4M8SA 2BRUA 1EVYA 4KDFA 1C1XA 1G0NA 2C5AA 4ND3A 3DBVO 2H1SA 4RDHA 1R4NB 1J4AA 2Q2VA 5A4DA 1HDYA 4ND4A 2PR2A 5L51A 2XXJA 4Q3CA 1PEDA 4B7CA 5GY7A 3H9QA 3E9MA 3RD5A 3ZI0A 4NJOA 4AJ2A 4BNWA 2V6BA 1GZ4A 4BNHA 1XEAA 3F47A 3UOGA 4I8XA 3WYCA 2PFGA 4DRYA 3RIHA 3DBRA 4E5NA 2ZTLA 3O38A 4HBGA 2FPPA 4FFMA 4TVOA 4DL9A 4I9UA 2NWQA 1FDWA 2C7VA 2VUSA 1Q1NA 3ZV6A 5BQFA 3HDYA 4IJVA 2JL1A 4WUVA 1YB4A 2PWZA 3ITDA 2B37A 4LK3A 1GCUA 4H16A 1V8BA 4I5EA 1QYXA 3CZMA 3U09A 1QV6A 3BHJA 5F3RA 5L7WA 3LK7A 4LRTB 1EFLA 5BT9A 5CDSA 3DZJA 3F4BA 2PNFA 4AJOA 3DONA 3G3EA 2G82A 2HDHA 3MJVA 5JDIA 3IKTA 3VHRA 3DMTA 4GX1A 4G5HA 5JYDA 3H3JA 1PJQA 4XRRA 1ZJYA 1CJCA 4YAGA 3L4BC 3UAGA 4QSMA 5JCJA 2HK7A 4G2NA 3WG9A 3C7DB 4YXFA 4CMEC 3LT0A 3D4PA 5L4LA 1YQGA 3QY9A 4KUEA 1ZSNA 2R2GA 5EL0A 4G81A 3I6QA 2VTDA 1IE3A 3PTZA 1SCUA 4BO8A 1I2ZA 5DBIA 1ISFA 2VOJA 3VPGA 2NADA 4D3FA 2PGJA 4GVLA 5JBIA 1NTOA 1ZFNA 4PG8A 1WWKA 3AI1A 3D3EA 3OM9A 4IQ8A 2AQHA 3GA0A 4PRKA 1R4MA 4QO8A 3C85A 3SEFA 3ZWOA 1ZNQO 3PYMA 2FMUA 3H4VA 4OOFA 3C1AA 3RJ9A 1DDOA 1LLQA 1WW8A 2FZEA 5JW6A 3JD3A 2HKIA 3DB2A 2VYND 3IAHA 4PFJA 4R3WA 1EFKA 3JQCA 3V1TC 4BNMA 3HFSA 3V1UA 4FOSA 2FWMX 4CUZA 3WGQA 4Y98A 1LQUA 4N5NA 1VSUA 1L7EA 4XR4A 5JMWA 1DC4A 4P4NA 1KS9A 1LSJA 1DEHA 3CE6A 1LRJA 1EDOA 4E13A 2FY8A 3IJRA 4TWRA 4PN3A 3INRA 4Y6PA 1XHLA 1SOWA 4EUFA 2VHXA 4J1TA 1H6AA 2I65A 1RM3A 2IZ0A 2GF2A 4B3IA 1SB8A 1M67A 1QG6A 2A4KA 3VOSA 3RUCA 1QLHA 1I32A 3E48A 3UFXA 2X22A 2YV2A 1GZ3A 3I1JA 4NIMA 4R51A 3OF2A 3S2FA 1DPGA 1T2DA 2EEZA 1PZFA 3RFXA 1E6UA 2BLLA 1RM0A 4FW8A 1LDBA 4CM1A 4NU5A 5HBRA 3DZBA 3KTDA 1IY8A 3B1FA 1A9ZA 5FI5A 2DU8A 1P33A 3GDOA 3TOXA 4WKGA 4MINA 1QYWA 4RF3A 5TRTA 2AG8A 2FP4A 3AUAA 5C7LO 4IJWA 5I7FA 5AOVA 4YT4A 3FI9A 2Q99A 3ZDFA 4ALJA 4N18A 2HMSA 2JD1A 5T73A 5M6DA 4KUGA 3F5QA 5U1PA 2PKQO 4ZQBA 3JQ7B 3FR8A 4AJPA 4B79A 5BR7A 2HCTA 3KV3O 1HE4A 4RVHA 2AHRA 4XQGA 3GEGA 4BNUA 1SMKA 5TNXA 3G0OA 3GPIA 4MKXA 4BO0A 5A03A 1QV7A 4RQUA 4CM4B 1AHIA 3L6OO 3Q2IA 3U4DA 4NBVA 2B4RO 3M1AA 4D79A 3Q0EA 5A06A 4FJ2A 1F0YA 2ZATA 1GCOA 3CTMA 3DOCA 4CLOB 4MKZA 5DZSA 2FPIA 3K96A 3RFVA 3E9QA 3GN2A 3WOHA 3ZWWA 1T24A 1WZEA 2PD3A 5FI3A 4QT0A 2Z5LA 3GGGA 3ICCA 5ITVA 3WICA 1YS4A 4BS9A 4J1QA 3SJ7A 2B36A 3GR6A 1I5RA 2W2KA 5HRUA 1JKFA 3EMKA 5IJZA 2X8LA 4FJ0A 5F1KA 1GPDG 1AXEA 2EG9A 3EY4A 4PG4A 4TRNA 5KIAA 5IN4A 3TZCA 5MGBA 5TLSA 1UDBA 1E3EA 3B1KA 1FXSA 4FCCA 4DIBA 1E3LA 1O5IA 5F5NA 3DC2A 1C14A 1HF3A 3MJ4A 3QSGA 5AXDA 2Z1MA 1VPDA 1UAGA 1KERA 1RYEA 3RC2A 2E4AA 1CRWG 3JD0A 3TSCA 4CMCA 1GUZA 3E5MA 2Z1NA 4P4GA 2NU9A 2EXXA 3NGXA 5A9SA 4MVJM 4CR8A 1N92A 3WR5A 4R4JA 4EGFA 4PLTA 4EDFA 4HFRA 4NJMA 1PS8A 1VJTA 2V7PA 4ZD6A 5BNTA 1K6JA 3I3OA 1M6WA 1JAXA 4J9VA 1LC0A 1BDBA 4YRAA 4NFSA 1CEQA 4R9RA 1H6BA 1U8XX 1B0AA 2Y1GA 4IBOA 3ORFA 4LSWA 3JQEA 1YVEI 4K26A 1BWSA 4PLVA 3K8ZA 5A9RA 1BHSA 1KYQA 3V2GA 4BKUA 1N2SA 3EUWA 1WDLA 4GLLA 1UJMA 2Q46A 3RAJA 2GYYA 3IOYA 4YRBA 5JAMA 1EK5A 3NDIA 2ZB7A 1KIFA 3IS3A 4BV8A 1PJBA 4FFNA 3BMNB 2AEJA 2NQ8A 1GQYA 1T2FA 1H5QA 3OIFA 5G0VA 3EK2A 1SB9A 4KWIA 3WQRA 4RO0A 2VHYA 2WYWA 2NACA 1NHGA 4RVUA 1LC3A 4TMFA 4IDAA 1DIAA 1O0SA 4JJFA 4DLBA 1WLYA 4L9RA 3BHIA 2BD0A 4WK6A 3Q2KA 4L4XA 1PJ2A 1VJ0A 3BMCB 5KJ6A 3AM5A 1TEHA 5JYAA 1JQBA 3E03A 3INTA 3MJEA 4Q9NA 2YYYA 7MDHA 1ENYA 1O6ZA 2Y1OA 1P1RA 2C2YA 2XXBA 1AE1A 3K92A 1X0XA 1PJ4A 2D4AA 4K9DA 1GD1O 1NHWA 1ZXLA 4J90A 3K2BA 1EQUA 1PR3A 1PJSA 4OGWA 4R54A 3OFSA 4AG3A 4DLAA 2VQ3A 3DZHA 3JQFA 1KEPA 3O03A 4EZBA 5KJCA 4WEOA 4IXTA 3GMDA 4U8GA 1VKNA 3RU9A 2UYYA 1ZK3A 3HG7A 1IB6A 4MP6A 2FZWA 3TDKA 3LVFO 3JYQA 5ADHA 2I3GA 2OBYA 5JE8A 2EKPA 3JQGA 5H81A 1KVRA 1BDMA 4IQGA 1ENZA 3V5NA 1PGNA 2X5JO 4J7UA 5LC1A 3VDRA 1R6DA 3NUGA 1HLDA 3U62A 5B1YA 3TZQA 2PTGA 1YONA 3ANNA 3GVCA 4NU6A 3RUIA 3OSUA 2JCXA 1AGNA 4J3FA 3QW2A 3NT5A 4CQMA 5EIOA 4BKRA 3BXXA 4IZIA 4TVBA 2O2SA 4U6SA 4PZDA 4CMGA 1ZW1A 4CQLA 3SVTA 4M54A 4E3ZA 4NI5A 4A10A 3Q3CA 2H6EA 4PZEA 1RM5A 3H9UA 1U3VA 1KEUA 1P0CA 2NVBA 4MVJA 4FC7A 3WDSA 1ISHA 2OZPA 4TZTA 4ND1A 4DXHA 4CUJA 1EBFA 1E7YA 3WJ7A 5F21A 3AI3A 3BZUA 4HNHA 2C82A 2J3IA 3CH6A 4DQVA 2IEBA 2XOXA 4BNFA 4KUHA 1SOVA 1XSEA 4E6PA 3JV7A 1PSDA 4BNKA 2VRCD 4CL3A 2EP5A 1RJWA 5CEEA 1UZMA 3GVPA 3LLSA 2HRZA 3C8MA 3K73O 2UUOA 3K6JA 5KOIA 2VNAA 2BKAA 4MDHA 1H2HA 4J49A 5HWSA 2AQIA 5G4LA 2JCYA 3JQFC 2OORA 4PLGA 4BNIA 4DMMA 3QVOA 1DRWA 4DPLA 4A27A 3RC9A 1LDEA 2B0JA 3UXYA 2EGHA 2Y68A 1M75A 3OH8A 1T4BA 1E7WA 5FEUA 1WPQA 3GNQA 3KSUA 1YE3A 3ZCXA 2DVMA 3KZVA 1VC2A 4AJKA 4ZGWA 4Q3DA 1ZCJA 5L53A 3E18A 2JFHA 1X15A 4RL6A 4RDIA 4WE3A 1Z74A 4U0KA 3WIDA 5CEJA 1CYDA 2X1HA 3S55A 4A2CA 1FDVA 4WECA 3GEDA 3UVEA 4B8ZA 1ZJZA 3H5AA 2ZCUA 3CIFA 4JX8A 2RIRA 2Y67A 4HUJA 5HS4A 4BGIA 2VYVD 1M66A 1UXHA 5CG2A 1PL8A 1N9GB 4ZQHA 5TS3A 4CLOA 3AUTA 3NAQA 5JS6A 3BMNA 2B69A 1YDWA 4Z3KA 3B70A 4WLUA 1I36A 3VKUA 3GG2A 4WLNA 4WLEA 1LA2A 4PGFA 4BIIA 3ZNNA 4UULA 4R5MA 3PQFA 2AEMA 4WASA 4J4HA 1F14A 2JAPA 3HN7A 2AQKA 3I9NA 1WAMA 1LDYA 1JVSA 3I4FA 3ONEA 4URFA 4IGEA 3UCEA 5IAAA 5DDIP 3QVTA 2V6FA 4YAJA 5IDWA 5GZ1A 2DFDA 2Y1DA 4JROA 4BKOA 3INGA 1VRWA 3ZGYA 1ISMA 5I9NA 4UUOA 2O7SA 1PL7A 2VN8A 3F5SA 4D45A 2GLXA 3TZHA 5A9SB 1TXGA 5T6BA 4W6ZA 3FD8A 4IGFA 3ZU3A 2Y0CA 1LNQA 3VZSA 3QWAA 4I9NA 1PZGA 2QIOA 2HUNA 2GASA 3HDHA 3KXDA 5HA5A 2YFQA 5T57A 1ZVMA 1E6WA 3R0IA 4IJUA 5JDIC 4YPOA 4PLHA 4CM9D 2DM6A 4YRDA 5L95A 1E3IA 2X86A 4JLWA 3VVCA 4TKLA 3IL2A 4Z3DA 4BB6A 1X13A 2WSBA 1H94A 3STHA 2BGLA 1DFIA 3GHYA 3IP1A 3ICPA 4GGOA 4YJGA 3TFOA 1GDHA 4GX0A 3D5TA 4CMKA 1NPYA 4Y6RA 1B16A 1E7SA 3WB9A 2JD2A 1Y6JA 5A02A 2IRWA 3K30A 3MEQA 4MKRA 3VC7A 2J5QA 3FSRA 5IDYA 4B4VA 5CDYA 1E3SA 4XDZA 1QKIA 1ONOA 4LCJA 1HZJA 4GLOA 4MIEA 1HE3A 4IPTA 2Y0EA 1UUFA 4L4RA 5JC1A 1WP4A 3E5RA 3AOEA 5COAA 5T5QA 3FHLA 1KEWA 3UH1A 1NM5A 1Y5RA 3H5NA 2BGKA 3JQ7A 6ADHA 4A5OA 1UP4A 3GUCA 4UUMA 3TJRA 2NVWA 1U28A 4MVJF 2AEFA 3O26A 4CM5A 2EIHA 4ZQFA 3TFQA 4E5MA 4NHEA 1UR5A 4FFOA 4R1NA 2FSSA 4B8WA 1P0FA 1LSSA 3JYPA 3GY0A 1B14A 3DQPA 3H9JA 4CM3A 3HE3A 4OO3A 4AJLA 4MP3A 3PLRA 4YJGB 5DN9A 4CLXA 3F9IA 4AJJA 4BQRA 1EZ4A 1N7HA 1A72A 3OICA 4INAA 4W7IA 4BHTA 2VWGA 4H15A 1U3UA 4R5HA 3D5QA 3CZRA 4FIZA 1PGOA 5L7YA 3FPCA 5AQ1A 2BFPA 4YDRA 4EBFA 5IZ4A 1LQTA 2C20A 1EE9A 4ND2A 1X14A 2CUKA 4HFMA 2EW8A 1U3WA 3AUUA 2VYVA 1P1FA 2O3JA 4FBGA 2Q2QA 4PZCA 1QR6A 1Q7CA 4IMRA 5JNLA 5A3JA 3KSZO 1UXIA 2B35A 2ZJ0A 4A26A 1GQ2A 5JCJD 2NVUA 3DMYA 3O8QB 5K9ZA 1ZMOA 4YBZA 4FR5A 3C1OA 3ASVA 5ILGA 4QECA 4J6FA 5IXYA 3PYXA 2O4CA 1UXKA 1Y8RB 2YHIA 4GBJA 4NBUA 1A4IA 3S8MA 5FYDA 1I33A 3FNEA 3TRIA 1NQ5A 5DP1A 1ZEJA 1HTBA 3MJTA 4J0FA 4OJNA 4XGIA 1T1SA 1KY5A 3MCVA 8LDHA 1U1IA 4RPKA 1PU2A 3RUHA 2IE0A 2NTVA 3BTSA 3L4SO 1GFSA 3A4VA 5F5LA 2B4TO 3GH3A 3PP8A 1J0XO 2GPTA 3DTYA 4R69A 4E30A 2H5LA 4UEKA 1PWXA 4TROA 5TT1A 1LRKA 5L45A 3GEMA 1AN9A 1UDCA 1QYCA 4XB1A 3HUDA 4QXMA 1MFZA 3KYDB 3WJAA 1K0UA 4EI2A 1UAYA 4LVUA 1PIWA 1PJTA 1U7HA 4WOKA 4R68A 1ZXBA 1UXJA 3W1VA 1TB4A 4GPD1 2FRDA 4OXYA 1OMOA 4RLHA 5I9LA 1GTMA 1NAHA 5I8ZA 3BMOA 1Q2XA 2VWHA 2H9IA 4GH5A 1PWZA 1P1KA 3ITKA 2AA3A 3CUKA 2RHCA 2ZB8A 1I3NA 4ROSA 1IZ9A 2X9NA 3GN1A 4IDEA 1QXSA 4I1IA 1OBFO 4I08A 3ZWPA 4MIYA 1BXZA 2XF8A 3DWFA 3KBOA 4FSHA 1XYGA 1OC2A 1K6IA 1VM6A 1MXFA 1HDOA 5THKA 4TQGA 3BIOA 2B4QA 3WQSB 4ITUA 4HFNA 4CV2A 4BNJA 3I23A 1LLDA 3PJFA 2E48A 1H6DA 4CODB 1B3RA 4XX0A 1QORA 1C1XB 4W99A 5T8KC 1MGOA 4PG5A 1EVJA 1IYZA 3BAZA 3PIIA 4EW6A 2FR1A 1R12A 1PQUA 3JQAD 3UCXA 2IDZA 2G0TA 2VHZA 3GDGA 1JVBA 1P1HA 1HYGA 2BH9A 4O5OA 5A04A 2GZ1A 2YW9A 2WE7A 2I67A 3GUYA 3DL2A 1SEPA 3GQVA 2VNSA 1GADO 3JTMA 2JKVA 2D8AA 2J5RA 3GOHA 1EUCA 5AYVA 1BXGA 4AJNA 4DYDA 1LX6A 3EC7A 2FSVA 4GVXA 4J7XA 1U7TA 3RQSA 1Y8RA 2YHIB 1WDMA 3MTGA 2EP7A 4HFJA 4AJEA 3FNFA 1ISIA 2YFHA 3P2YA 2TMDA 3L9XA 2SCUA 1NR1A 2GSDA 2J3HA 1LRLA 1E3JA 3RBXA 1PX0A 5IZCC 3GDFA 1I30A 3M6IA 4DBVO 3F46A 5DCUA 4ZQGA 3ZWXA 4BKQA 1I2CA 5C5IA 3GFBA 4J1SA 1G6KA 2Q50A 5ITWA 2GERA 3FR7A 1DXYA 5ER9A 3TNLA 4QFDA 3H7AA 3QJ5A 2BHLA 1WVGA 2HJSA 3CMMA 5TSDA 3CPSA 5TX7A 4DA9A 1GUYA 5L4NA 3WQQA 2WDZA 4FB5A 5CPBA 1A5ZA 3OECA 1DIGA 1JN0A 1R15A 3H65A 3ZV5A 2AE2A 3GRPA 1UZNA 3MJCA 4QEDA 2OP1A 4RORA 3L6EA 3PI7A 3L0DA 1LXCA 2P4HX 5JMPA 1HYHA 2NUAA 5T64A 3ZW9A 7ADHA 4NBRA 2YQ5A 1D4FA 4YJFB 3GFGA 5EERA 5MDHA 3G79A 3EAGA 4DBZA 1Y8QA 5KNLA 5K6AC 4MO2A 3MTJA 5U9CA 1XKQA 3EW7A 3IIEA 1LBEA 2BGMA 3PXXA 4AVYA 2NNLD 1DJNA 4GSLA 1YGYA 4FS3A 4JNKA 4B4WA 1DHRA 1ZK1A 1PZHA 3OA2A 4AJIA 1EVIA 5JDCA 3F3SA 2OMEA 1JA9A 1BXGB 1I01A 3I9JA 2DBVO 2JFFA 4JJIA 1V0JA 3BTUA 2PZJA 3BTVA 3AFNA 3AWDA 3GT0A 3KEOA 2X5OA 5KVCA 1Q7BA 5IZCA 3U3XA 4XJTA 2BI8A 2VRBA 1W6UA 2JJYA 4G65A 3PHLA 4JP2A 5B12A 3GZNA 1C1DB 4IIUA 1MX3A 4EUHA 1U4OA 3LDHA 2P9CA 3AI2A 5COQA 1HWYA 4LMPA 1D1SA 4F6CA 4YAKA 3EYWA 3H9GA 4OKIA 1N9GA 5CAEA 5G0WA 2X58A 2J6IA 2X0RA 3DAFA 1YJ8A 1Z7EA 2EKQA 4FDAA 2CNBA 3Q11A 4IDBA 3LSYA 1CQJA 4K6FA 3Q6IA 1DFGA 1KVTA 2QYTA 2C29D 4FN4A 3PHIA 4UUNA 4JXKA 4L4SA 3RSHA 4LRSB 1K89A 2QHXA 1T2CA 3RUEA 1S7CA 4YR9A 5TGDA 2NU6A 2QRLA 5CP8A 1TI7A 2X0IA 4NR0A 3UCFA 4U7WA 5T67A 3DAGA 3H2SA 1EQ2A 4BO1A 4Y8VA 4DYVA 1QLJA 4PLZA 5I7VA 2EW2A 1B8UA 3U4HA 3WGHA 2PD4A 3GC6A 3UKOA 4FFPA 4LCEA 3WGTA 4GKBA 2DC1A 1NP3A 3FWNA 3SJUA 3ENKA 2R6JA 1D1TA 1ML3A 1GYRA 5AXBA 3W8DA 3L4BA 3D64A 4ND5A 4ZHSA 3HN2A 1WXDA 4O59O 3R6DA 2VOEA 1LEHA 4BUCA 3KOUA 4HV4A 2GN9A 5I8WA 4XJSA 3ROPA 4IINA 3JYLA 1VSVA 4MVJG 3H3FA 4CLRA 1NNUA 4ID9A 2RCYA 4L76A 4WLOA 2PZLA 2EV9A 4C7JA 3GVIA 4RPJA 1HYEA 2IYPA 2PY6A 3FPLA 4CMHA 1U8FO 1XGKA 1R4MB 1WDKA 3QLJA 4XKJA 3U0BA 3SBOA 1ZO8A 3S2IA 1BW9B 4K1LA 5L7TA 2GCGA 2W90A 3G49A 3PVZA 2Q49A 4NG5A 2JD0A 3ADOA 3PEFA 4R3NA 3S2EA 3ZWAA 4BGUA 4D7AA 4BNGA 3UICA 1P3DA 4PLCA 1ULSA 2VTEA 4XYGA 2B5VA 3F6YA 3FNHA 3NRCA 2GO1A 2DTXA 1A9YA 3W8FA 5B4UA 3GNSA 1N1GA 3DZKA 3JQ9A 4L73A 3PHJA 1B3BA 4A03A 2G76A 3ZU4A 1V6AA 4JBHA 2NLOA 3Q9UA 4YVFA 1B8VA 3DBLB 4Q3BA 1I8TA 3OQ1A 5KVSA 2HSDA 1HL3A 3PIDA 4YQZA 1KVQA 2O48X 4RPGA 1ADFA 1A27A 4M89A 3ZWCA 1XA0A 1DC3A 1N1EA 3W6ZA 1YRLA 2V6MA 4E4YA 9LDBA 3WLEA 1PJLA 3GMSA 1E5LA 3DBRB 4J2HA 4Z9FA 3Q9NA 4EJMA 1BGVA 3UGKA 1Z45A 1TA4A 3VZQA 4RPLA 3I5MA 2BFMA 2W2LA 2OXIA 4XR9A 4DGSA 3HJAA 2C7GA 4DUPA 3I83A 4E0BA 4NDNE 4OL9A 4UVGA 1Y8QB 1I10A 4CM8B 3ZHYA 3RWBA 3WMWA 2WE8A 3EVTA 2GRAA 4XWYA 5JCXA 4YT5A 4Q3EA 3JSAA 1CQIA 4YTEA 2P91A 3ZZNA 1SPXA 1YL6A 2D1YA 1TVEA 1NFQA 2DBZA 2X9GA 3C7CB 3LF2A 2RAFA 4P22A 3RFTA 1HDRA 3HDQA 2AQ8A 3MWEB 3JYOA 1X7GA 1HLPA 2E37A 5KVVA 2X6TA 4CM4A 2O50A 2PH3A 2OFPA 2QZZA 2HJRA 4F3YA 1Y5MA 1BSVA 2IODA 1B15A 3O4RA 4H7PA 1ZK4A 1P45A 4OIMA 1BW9A 4PVCA 4LMRA 3QVWA 3AM4A 2HMWA 2IXBA 3OA0A 4Q39A 2QRJA 4KWHA 4UVDA 2ZQZA 5TF4A 4D46A 1IHYA 2I5PO 1BVUA 4ALMA 2GN4A 4JJGA 1MG5A 1UP6A 3AU8A 4JIGA 4R9SA 3P7MA 1F17A 5BSGA 1YOVB 2Y05A 5G4KA 2ZTVA 2YY7A 3KYCA 3PHHA 1VLLA 3DBHA 2GZ3A 4J9UE 1TLTA 2NQTA 3RBZA 1YL5A 1WMAA 3PQDA 4LISA 4DREA 3BHMA 1D7OA 1T26A 2Q3EA 3KVOA 1ADGA 2UVDA 3I6IA 1U5CA 3KB6A 1IZ0A 2X9VA 5HM8A 4LVCA 4IUYA 1SBYA 1XDWA 4CM9A 1Z75A 1LLCA 1FK8A 4IMPA 5G0SA 2VCYA 1UDAA 3NGLA 5JPIA 4II3A 2Z95A 1OC4A 4JN6B 5H83A 4E12A 1RPNA 4DMLA 3U5TA 5I7EA 2CFCA 3VH1A 4MVJH 1R0LA 5B4VA 4WNIA 3GVHA 2EWMA 1MXHA 2F1KA 5F1PA 1ZMTA 4BNNA 4BO5A 4UAGA 2WWRA 4B7UA 2VUUA 4BO9A 4NJMB 1NPTO 1YQXA 3EZYA 1YKFA 5B4TA 1GEGA 3B1JA 5IN5A 2O7QA 1I3LA 2W2LD 3DZGA 4RCVA 3HSKA 5KJ1A 1YBAA 2AXQA 1DC6A 3A28A 3P19A 4XQ9A 1F8GA 1EEHA 4QX6A 3TQHA 1NFRA 4I5DA 2D0IA 4QTZA 3GZNB 2AMFA 4JCOA 1XCBA 3ZWYA 3PGXA 3JQAB 4GWGA 2Q2WA 3BYZA 4IY1A 2DPHA 4M86A 4GX5A 1UXGA 1H9AA 1P74A 3ENNA 2HU2A 5KKAA 1ORRA 2ZB3A 3QV1A 4KTVE 3HFGA 3JQBA 1YOVA 5G4KB 3WSWA 4XIJA 4XZ3A 4W7HA 3KLPX 4E5KA 5IG2A 2J8ZA 2QG4A 3W6UA 1JAYA 3CINA 1HT0A 4X54A 3LU1A 2W2KB 1G1AA 3ZNQA 1U3TA 2IZ1A 4BO4A 3ONFA 1KVSA 3FN4A 1RYDA 4A73A 5FWNA 5JAIA 5KKCA 3D4OA 4ZU3A 2IEDA 3KYCB 3KSDO 3KUXA 3WMXA 3OQ6A 1BRMA 4L8VA 1T2AA 4CV0A 2A35A 4EEZA 3WYBA 4ZQEA 4BL5A 3RC1A 5A05A 1V3UA 1XLTA 3QVSA 2Y1EA 3WLFA 4F46A 3QWIA 2J3JA 5COBA 4AJHA 1R0SA 3VPXA 1E5QA 3PQEA 4FOOA 2CDCA 4A0SA 2ZKLA 4UVHA 2Q1SA 3DFUA 2CVQA 2BI7A 3X2EA 4BKPA 2OGUA 4XYLA 2DTDA 2V65A 1HSZA 2G1UA 3I9LA 1QMGA 4E2YA 5THQA 1P1IA 2HLPA 4FC6A 3HNPA 2DFVA 3TL2A 4GKVA 3V2HA 4YAIA 4RZIA 4WCFB 4I5FA 3LYLA 1HEUA 3OBBA 3SX2A 4BNLA 5L4SA 1E7QA 3ZN2A 1R66A 4BNZA 4E33A 5DOVA 2YV1A 2QW8A 1W8DA 1Q0QA 1T4DA 5AXCA 3FWZA 1GY8A 1NVGA 3TOZA 4YB8A 2YHUA 4CQLB 1C0KA 4MJLA 2NTJA 3DOOA 4HXYA 2R00C 3G1UA 5ENDA 3WFJA 2POQX 1E6EA 2ILTA 3UUWA 5C7IO 3QP9A 2GN6A 4N54A 4BV9A 5BSHA 4NK4A 4Q3NA 4Q3AA 1YBVA 2TMGA 3DHNA 1DJQA 1MB4A 2UAGA 2QYSA 3MWDB 4U0JA 2Y66A 4J0EA 2YZ7A 1DRUA 2NTNA 3LC1O 3RI3A 5LDHA 3PWKA 1EVZA 1P44A 2BFAA 4OSPA 2PKRA 3RCBA 3V2UA 3WBBA 3QWFA 4XGNA 1VI2A 5FF9A 4ALNA 4CJXA 3I9MA 3BMCA 4EJ0A 3JD4A 1JKIA 5CEFA 4TZKA 2EHDA 3IKVA 4WCFA 1F06A 3DBLA 3Q1LA 1RKXA 2JFGA 4F45A 2LDBA 3CMCO 1HDZA 5ICMA 4N7RA 1CWUA 4PLFA 3QE3A 4MP8A 2BFOA 1ZIDA 2WEKA 3K31A 4XB2A 3EZLA 1C0IA 1V35A 5CHEA 2P5UA 4IDFA 5ICSA 4IZHA 3S2GA 1SC6A 5DBFA 2QRKA 3LT4A 5AVOA 3JQ9C 3VPSA 5ES3A 2X0JA 1GEEA 1NQTA 3WGGA 1P1JA 3VZPA 4RLSA 3PFWO 4CLRB 3WSVA 3RKUA 3VVBA 4YT8A 5LDGA 3K2EA 1SAYA 2HK8A 4OQYA 1R16A 3KHUA 1E1KA 5EINA 3D1LA 2GD1O 2AE1A 2OOSA 3JD2A 3H9EO 4IDGA 2PV7A 1MLDA 4FJ1A 3RBVA 5JYFA 3PDUA 4ZRMA 4E2XA 4MOWA 4YWJA 1VL6A 3AOGA 4RVGA 3NT2A 1M6HA 1IPFA 1HSOA 1MA0A 1KY4A 1B8PA 2VYNA 1RWBA 2XAAA 3WTCA 5DF1A 5A5FA 4BO3A 1DB3A 4PLYA 2PGLA 1U2GA 1IULA 4IDCA 2ZTUA 4OM8A 3PRJA 2PK3A 1ARZA 1LDMA 1P31A 3DFZA 1EBUA 3ULKA 4MVJP 5FFFA 1OFGA 4PG6A 3IUPA 2EJVA 3GVXA 4XRGA 1DLIA 2H63A 3OETA 1PGQA 4AJ4A 3NDRA 1ISGA 4HKTA 4IM7A 4HX5A 4DQXA 3ADPA 3OJLA 4Z0TA 2I9PA 4YACA 2CD9A 1HZZA 1QRRA 1LLUA 1S6YA 1ZK2A 1DC5A 5TIIA 2NM0A 2VHWA 2CVOA 2EJWA 3VH4A 3BTOA 1AHHA 4RVDA 4UREA 2E6UX 3AM3A 4L0QA 5JO9A 2I99A 2WD8A 4CR7A 4OXKA 3ZHXA 1GL3A 1AUPA 1DLJA 3RROA 2ZYAA 4WOJA 1IPEA 4CPDA 1YWGO 5KWEA 1ZEMA 3D3WB 1A71A 1DBVO 1IHXA 1V3VA 4HWKA 3CEAA 2CVZA 4K6CA 3NT4A 2C54A 3PWSA 3WFIA 2DKNA 4WLFA 4Z9YA 3NX4A 4FD3A 4XQEA 4GMFA 1BXKA 1JTVA 3GGPA 3OEYA 3WYEA 3WWYA 5IXSA 5L40A 1BVRA 4Z0PA 4BNTA 3L6DA 4YA6A 1P77A 3GLQA 3ONDA 4CM7A 4Z6KA 1JWBB 4QFCA 1R4NA 3A9WA 1IL0A 4AFNA 3JCZA 4E5YA 5I7SA 1XU7A 1GYPA 3SXPA 4DPKA 4XD2A 1DAOA 3WTBA 2Q22A 1GU7A 5JO0A 4IS2A 1DOHA 4AL4A 4CV1A 3QVXA 1MC5A 2Q1UA 3PDJA 1U5AA 3C1TA 1DAPA 5T8KA 1X1TA 1HETA 4D44A 4D43A 2VWPA 5EESA 3T4EA 4UEJA 3ZV3A 2CSUA 2NVUB 3AY7A 1CF2O 3GAZA 1K3TA 4IXWA 4BVAA 5ENVA 1BG6A 3DHEA 2WYUA 1NVTA 5DULA 2JHGA 4JP3A 2O2YA 4RVSA 2X23A 1QYDA 2ZQYA 3G17A 4NK5A 2D59A 1NBOA 3HZZA 3WXBA 3QWHA 4BO7A 2G5CA 4TKMA 1XR3A 2JAHA 4KMSA 4MIOA 1LI4A 1OOEA 3MZ0A 3LLVA 1JWAB 1ZH8A 3BMQA 4RF5A 2CZCA 2YQ4A 1YH3A 1KOLA 1VL0A 1OAAA 4RQTA 3VAZA 3HQ4O 1GUFA 3KLMX 5HS6A 2FR8A 3ST7A 1QP8A 1F8FA 2JHFA 3OJEA 3VH2A 2P2SA 4E2ZA 5CDTA 3GNTA 3H5RA 2X5KO 3BA1A 1EK6A 3KRTA 3QQPA 3N58A 4KP7A 2VHVA 3VZRA 2HRBA 1PS0A 4YJDA 4II2A 1Q7GA 2ZCVA 4E32A 1E1MA 1K2WA 4YYZA 2WMDA 3DDNA 3HHPA 1E3WA 1FDUA 1T2EA 1LJ8A 3F4LA 3WBFA 3D4NA 2P68A 3JQGB 2EERA 1DSSG 3S1LA 1YJQA 4GL4A 1LSUA 3TPCA 3ETEA 1NQOA 4I5GA 4DIFA 4OHUA 4R1TA 4QQRA 4WJZA 4BMNA 5KJFA 1EMDA 3LC2O 3D7LA 3PPIA 3KO8A 1CERA 3K9QO 1G0OA 1JU9A 4NFHA 2XPCA 4J43A 5CFZA 4XYBA 1KC1A 1XIVA 3FRJA 3P5SA 1C0PA 4Z9XA 3AU9A 3ROMA 1O95A 5I9MA 2Q1WA 3IDSA 5GZ6A 4LN1A 3KYBA 1MC4A 2GZ2A 4PG7A 2JCVA 1H9BA 2PLAA 2Y99A 5TQVA 4W4TA 2LDXA 4CLEA 4XCVA 3UW3A 3DOJA 5JFOA 4D42A 4R1UA 1Z82A 4FFRA 3VTZA 2WD7A 2CF5A 2O3TA 1H0KA 3DO5A 4CV3A 4PVDA 3PJGA 1NVMB 1YB1A 5TC4A 1Y1PA 3EDMA 1JKJA 4O63O 5TJHA 2YV3A 2RH8A 4DC0A 5C7OO 3NV9A 4YEDA 2HAEA 2IXAA 2I6TA 1O9BA 1HRDA 3K5PA 4J1NA 4KQXA 3G1TA 4GSKA 4D0RA 4A7PA 1T1RA 2GN8A 2WTBA 4R41A 4YJHB 3ETGA 1J49A 2PH5A 5JAQA 2Q45A 3FTNA 4S3MA 1HDCA 4C4OA 1ZUD1 5DBGA 2EF1A 5DCYA 1E3WB 3BMOB 2DUWA 1I24A 3FF4A 3AUSA 3H2ZA 4WCFC 3L9WA 5K0ZA 3TF5A 2A92A 2A94A 1GYQA 1Z6ZA 2VRCA 3ON5A 5CPFA 4UUPA 1HDXA 4YQYA 4CMJA 2OUIA 3GPDG 4BQPA 2C07A 3SLGA 2Q4EA 1R37A 1SO8A 4NFYA 3JYNA 2IZZA 3E9NA 3ABIA 3HADA 1LSOA 3NEPX 2DBQA 1DHTA 3B6ZA 1PGPA 1ONNA 1M76A 1I3MA 3FTPA 5DNAA 2HMVA 3TL3A 2D5CA 3HWRA 1MP0A 2GNAA 2O4UX 1FDSA 5J9GA 3OMLA 1N7GA 3H8VA 3MOGA 4IS3A 1VL8A 1EDZA 4KQWA 3VTFA 4R01A 4WEQA 1E92A 4CR6A 5C37A 3KETA 3WNVA 4YCAA 4GMGA 3ZWVA 3C7AA 3ANMA 1RM4A 1VJ1A 3L77A 3WNQA 2PGDA 3OIDA 1ID1A 2DLDA 2CDAA 1EE2A 1B7GO 2FHSA 5A1TA 4OQZA 5EQFA 5KVQA 4EJ6A 4RPHA 1NWHA 2BF7A 2I3AA 1FF9A 2IYOA 1R0KA 4YAEA 2CDBA 3OQBA 3WGZA 3KYDA 3QA9A 5JY6A 2DAPA 3M2TA 4P8RA 1K6XA 3GF4A 4CM6A 2ZK7A 1QYVA 3NDJA 3NTOA 2WJPA 1OI7A 4BOYA 2NU7A 1I3KA 2VZ9A 3NYWA 2E49A 3OP4A 3W8EA 3ROQA 3AOEC 5BNIA 9LDTA 4XDYA 3RUDA 1H2BA 4B4OA 2DUUA 1TT5B 4XYMA 3WX0A 1ADCA 1DIBA 2RHRA 3CSDA 1HKUA 1KC3A 3D3WA 2C2XA 4OKNA 4ILKA 1ENPA 4I9HA 2P9GA 5DT9A 1B2LA 1KVUA 1AXGA 4J91A 1V9LA 3NTRA 4XYEA 3T7CA 5C3MA 2ZYDA 5G0UA 3LC7O 1KETA 3ZHZA 1GZ6A 4U6QA 1I0ZA 4ALKA 4CM8A 1Y9AA 1EUZA 3PLNA 3CKYA 3TZKA 2UV8A 3SLKA 3L07A 4HY3A 5IDXA 1UP7A 5AXAA 1SZJG 3WGIA 1ADBA 2UDPA 3QIVA 3ZV4A 1XU9A 2OL4A 4EYEA 4ZRNA 4NNJA 4KZPA 1E1LA 4CMIA 4DPMA 1ZKMA 1ENOA 1EUDA 2YUTA 3WGYA 2P4QA 4CL8A 3PJDA 4W9NC 3JD1A 4EUEA 3RJ5A 4JQCA 4PIVA 3ASUA 4H3VA 4GQAA 4C7KA 4S1VA 3OJ0A 5GZ3A 3A06A 4BGEA 4CQMB 4KOAA 1JDJA 1SEVA 5TJ9A 2B83A 3D0OA 2DBRA 3ZNOA 1H93A 1N5DA 4IDDA 3T4XA 3JQAA 4ZICA 2CF6A 4BMVA 4ZVVA 4TSKA 3U9LA 2HQ1A 1N8KA 3I52A 3E8XA 4CMAA 1DO8A 1NR7A 1WZIA 4LW8A 4XQCA 1NQAO 2EKLA 2PZMA 1LUAA 2HMUA 1PZEA 2DPGA 2GR9A 2PA3A 3I9KA 3ZH2A 5EQDA 3RASA 1PQPA 4CUKA 2HMTA 4DQUA 2NSDA 2Y1CA 1J5PA 1HDGO 4ALIA 1HE2A 4J4TA 1MG0A 3GAFA 4BMSA 1VE9A 3LT1A 1E7MA 3OEWA 3IUSA 2I66A 1Q0HA 5ER6A 4E5PA 2J3KA 2QZ9A 2OBNA 1L7DA 2V6GA 3UHAA 1X7HA 2B5WA 3WGOA 3COSA 3ZWNA 5KTKA 1DRVA 2X0NA 1O89A 4Z0HO 1FJHA 2FOIA 2QQ5A 4Y9DA 4EITA 4WNCA 3X2FA 3E82A 4ONEA 3GRKA 3W4JA 1MFPA 4B7XA 3B20A 2FN7A 4BO2A 5IDQA 4W82A 4LGVA 4ZA2A 1GQQA 2NV6A 4MVJI 2AG5A 2FR0A 4P4LA 4PCVA 3RKRA 4NPCA 3PYLA 3ETDA 3NTQA 4O0LA 3LQFA 5G0TA 5A9TA 1ONPA 3LZ6A 3R1IA 4R1SA 4WPGA 4UEOA 1L1FA 3DR3A 4RJTA 1GPJA 2OP0A 3HB4X 4DLLA 3PGJA 2C0CA 1Y81A 4QUKA 5DCWA 3QHAA 4J16A 5EMHA 8ADHA 3U4IA 5JYEA 1PJ3A 1O94A 2X4GA 3HDJA 5JAZA 3V1YA 2VT3A 2WD7B 4E21A 1NFFA 2GDZA 3NJ4A 3VPHA 4CQMD 3C24A 1UH5A 3ZNPA 1ISJA 1HXHA 3ROKA 3ZHBA 4R16A 4FFLA 4BB5A 3F1LA 4F6LA 1LDGA 4AICA 1ULUA 1A7KA 1NX6A 1J6UA 1ZSYA 3RU7A 1OZAA 4JK3A 4UVEA 1GV1A 4DC1A 2O3SA 5JSFA 4J4BA 2HK9A 2DT5A 4DIOA 4D0SA 3ZWBA 1FDTA 3W4IA 4FPXA 1NYTA 3JQ6A 5J23A 1MUUA 1PR9A 3IMFA 1KBZA 4LSMA 4QO7A 5L9AA 4K28A 1W4ZA 3DAPA 2GGSA 5B37A 4J2OA 4NBWA 1W0CA 3I4CA 1LU9A 1A7AA 3ZWMA 2P9EA 3VDQA 3TZ6A 1GV0A 1F12A 4MPDA 4N5MA 1PL6A 3FBTA 2NU8A 5CG1A 1NAIA 1JW9B 2ZIZA 5IFLA 5A3VA 1C3VA 4M87A 2E82A 1Q0LA 3IC5A 2I76A 3JQBC 5HTOA 3FCOA 1BMDA 4PLWA 3DEYX 1BTOA 3QWBA 4CMEA 1M2WA 2ZYGA 5BSEA 4RF4A 1PGJA 3RUAA 1B26A 3RUFA 5K6AA 3OIGA 1GAEO 1H6CA 4GWKA 2YDYA 1YL7A 1E77A 3OJOA 3H6KA 4RZHA 2O23A 3O8QA 3PZRA 2W98A 2VWQA 2Y93A 1YQDA 5JY1A 3BMQB 1LTHR 1T25A 3DMTC 2QX7A 1U2DA 4YJFA 3P2OA 3M1LA 4ESOA 1YXMA 4CMBA 5BSFA 1QSGA 1YO6A 2Q1TA 4MVJE 5ILOA 4ALLA 5JC8A 4OXNA 1CDOA 1KEVA 2ET6A 2WYVA 3A1NA 3E1KA 1XQ6A 3CXRA 4JBGA 3FNGA 1DFHA 2D3TA 3KEQA 3R3SA 3VKVA 4XIYA 2VT2A 4NQZA 1X0VA 4FGSA
chains in the Genus database with same CATH superfamily
1Q77A 4O5AA 1YVDA 1IOWA 4GECA 1G3IA 1R8SA 4RGQA 4RXTA 1JFRA 2BFBA 1TPZA 1NSFA 1Y3HA 3FYTA 4O4HB 4P4UA 3SX0A 2BH2A 1N78A 3PWZA 2R7LA 2VJKA 2Y9PB 4IKPA 5DOZA 2VXCA 4EA8A 1XVAA 3DPIA 3IR5A 1SA0A 1N4DA 4O4JA 1E9FA 3HXTA 1NXQA 3T8YA 4Z4QA 5KQSA 2P41A 4OQFA 4ZDJA 1MV8A 3O3NB 4JODA 2VZ8A 2WI8A 1NIPA 2CY0A 3ZDRA 4UVIA 2IYZA 4KK3A 1YB5A 4U6NA 3RTEA 3SYKA 5TT0A 4AXBA 3SQWA 4JYAB 2GOYA 1VSTA 3FZNA 2ZT8A 4LRWA 1CF9A 3QLVC 1EWYA 2E21A 2Q9BA 5FFNA 2IX3A 2AW3A 4HAIA 1JFTA 2FE4A 2R4TA 3JQQA 3EASA 4E1BA 1YZNA 5GVRA 2O3QA 1V26A 2P8JA 3DJYA 3UHFA 4QAJA 1H3FA 3I28A 3P9RA 4YJHA 3OLWA 2PNJA 3IQDB 3LPLA 3TIVA 5CYFA 3TXXA 3WGUA 3REGA 2AW5A 1IOLA 2UYQA 4I14A 4PZLA 2COUA 2G3YA 3OG9A 5DI3A 1REQB 3PEEA 3GZ4A 4AECA 1LWOA 1J2RA 1YDEA 2WAAA 2WAXA 1JIXA 3IJEB 1ZCAA 2DJIA 2ZREA 4J7CA 4WKCA 3DWIA 1QG4A 4TRMA 3VR5H 3WS7A 1E1NA 1X7DA 3O9ZA 2FN9A 3TEFA 3N7AA 3VPFA 2QGNA 1LS6A 1Y7TA 3P8ZA 4BPBA 1XAGA 2CUTA 5JBQA 4ZU1X 5A3RA 5JROA 4BLOA 3N74A 3AR9A 2NZVG 2GBLA 1GP2A 1GNQA 3C15C 1XQ1A 1HUQA 3GJ7A 1LDNA 1PSZA 4X64B 1QCZA 3DTTA 4MKGA 1UFKA 3I9OA 5H82A 1JKMA 3ZU5A 4C08A 1D3AA 3TX2A 3DE1X 1IWBB 3ZGXA 1E1CA 5DX0A 1ZU5A 5CJJA 3I61A 1T15A 3P9SA 3OPYA 3LT5A 4GX2A 4ER3A 4L51A 1QH8B 2FQQA 4LI3X 4C7OA 3I2HA 4BZPA 8ATCA 2G17A 2YQZA 3TWOA 2W2VA 5JD3A 3K4QA 1SNYA 4OAQA 3W9UA 2BR5A 1E20A 1E64A 1G5FA 3AFMA 3RVDA 2FK7A 3KQUA 4HC4A 1AXRA 2GTIA 2CMDA 2ZTMA 1TL7C 3AY6A 4N5IX 4GRIA 2PUEA 3WP1B 1T3TA 4TPKA 1YBMA 2BGRA 5G2OA 2E18A 4D4KA 4DKJA 4C7XA 1UPTA 1VYUA 1F7VA 1RAAA 1XCGB 3EGOA 1M0EA 3ZYZA 2ZWAA 4A8PA 3WIEA 3RABA 4IZOA 2XZPA 3EEQA 3OCCA 3H5VA 1BE1A 1QVZA 2WOOA 4J3JA 4W9NA 1IUKA 4CLHA 1IN8A 3ZW7A 1TA9A 3SNHA 3WBKA 4IQ0A 1JLHA 5CTJA 4ZCSA 1Y98A 1JUDA 2QAGB 3FZGA 2CYBA 2LE0A 5HFNA 4E94A 5LQRA 1HG0A 1FMCA 1HKHA 3WWZA 1ODTC 5BNFA 1OT3A 1QNLA 2AT1A 2DTEA 3ZG6A 2BFWA 1KA9H 4BEVA 4EGJA 1ZA1A 5ALPA 3JYHA 4FEAA 4KPUB 2XUAA 2ZB2A 4LHWA 3I0ZA 4AK9A 3STUA 4EHIA 3ROFA 4R7GA 1OU4A 2J0VA 4GKAA 4OL0A 3BG5A 2CLDX 1XZLA 3Q7SA 1PJCA 2QZJA 4UM5A 4GZ5A 3TEJA 1HI9A 4EY8A 1M2VB 1M2VA 5F2OA 4FN5A 3D8HA 4GGPA 5INTA 1NVXQ 4IH1A 4JFRA 4KOEC 1IOVA 4WGGA 5IM4A 1QCCA 2W6OA 2W8ZA 3ED5A 4ZJUA 5DJ5A 1M6VB 4O6VA 1WNTA 5LBIA 5LCXA 1P7YA 4H3SA 4D3SA 1ZVVA 4KK4A 4NABA 1W8IA 2H7YA 1KHTA 3K9FC 1LX7A 3BWXA 4M1QA 1AF7A 2WHRA 4OUDB 2C5EA 4N12A 4EEXA 1OR8A 3OWHA 3DBHB 3WLNA 1F6WA 3NEAA 1OD6A 1FYXA 2EFYA 4OJKA 3HUFA 2G9UA 3IJ5A 2D7DA 2GUGA 4MVCA 5JXWA 1OPRA 4HRXA 3D3QA 3EEIA 2RHOA 1W59A 3DCNA 5LJLA 1FOEB 2QTMA 4GMXA 4ZAGA 4B80A 4BGDA 5EPOA 2ZPAA 4JZYA 4TTTS 2FCRA 3IPCA 3DZIA 1Z7BA 3WLJA 4M9SA 3U4CA 5IF3A 2B94A 3B7WA 2XWPA 4YT2A 3LBHA 3Q8XB 1Z7YA 2GETA 4PLPA 2WABA 2G4VA 1GTJ1 3LUDA 4GI2A 2HA4A 4GUAA 4TYQA 3T41A 4ENQA 1UC4B 4B4UA 3R44A 1T8UA 4V03A 2XQVA 1O96A 1EWVA 4YRPA 3OJFA 3AW9A 4F06A 2Z4TA 2XECA 3HVHA 3HY4A 5L3ZA 2I8LA 2XUKA 1XNJA 5ED0A 1XRRA 4WI1A 4GDFA 4TZ0A 4MW4A 4X84A 3QRWA 4YYEA 4CLDA 4MYHA 5AH0A 1UZLA 2Z4SA 3DZFA 2JGNA 1EJBA 1S96A 1SHJA 2JASA 2OHVA 3MJRA 1TJ4A 3P0HA 3T7EA 3WNDA 2WMYA 2BRUA 1YNOA 5CCBA 3CVXA 3Q8WA 1G0NA 1TJPB 1CY1A 2A84A 3RKSA 2PR2A 5L51A 4LJKA 4H0CA 1RAGA 4JB3A 4LHVA 5J5AA 1SM4A 4IHAA 4RBNA 3H9QA 1PI3A 1SXHA 2PSFA 2YWHA 3R5JA 4YFYA 2V6BA 1GZ4A 1V2HE 1E5VA 2H5IA 2JH3A 3UOGA 2BWJA 4NZYA 3WYCA 2H2DA 1UBEA 1EVLA 1O97C 1AKVA 5BN5B 3BE5A 3URKA 4MS1B 2NUAB 5KQPA 2H4JA 1P1CA 2WZBA 4ODIA 2XB9A 1U2RA 1X8XA 1FDWA 4IH4A 5EIWA 1OXVA 1Q1NA 3FETA 3HDYA 2QP3A 4M0LA 2WSYB 2W6ID 3AV0B 1Z2DA 4R6WA 2PWZA 1TMOA 3N8IA 2OD7A 1GCUA 3Q98A 4H16A 1MPXA 2V4MA 3COZA 1V8BA 1QYXA 2HTFA 2WFLB 1L1RA 2Q1XA 1XP8A 3PNMA 3ZWQA 4AF7A 5L7WA 5ALXA 3LCVB 1EUQA 1H9CA 3QU5A 1N0IA 2JPDA 1FE8A 3IAS6 4EX6A 4LRTB 1K9SA 3QI7A 1WP9A 3IBCA 5EE3A 3DZJA 3F4BA 3KDAA 3H2GA 3KOWA 4PWYA 3RK4A 3ZJVA 3G3EA 3IKTA 3VBEA 1T9BA 3UYLA 3KCQA 2YRXA 4GX1A 3OZEA 2VPTA 3PQ5A 1R9NA 3BJIC 5JYDA 2NT4A 1ZJYA 4MPRA 5LLSA 4DDHA 3PF9A 1AC5A 3TBHA 3HXPA 5IH3A 1N57A 1FLAA 4Y2RA 1E58A 2HK7A 3QYAA 2RKOA 4HEJA 5L4LA 3QY9A 4KUEA 1ZSNA 2VJYA 3U7HB 1N6PA 1Y3IA 3G5UA 3EPLA 1B6RA 4EG3A 3KZCA 1SCUA 4BO8A 4O4HF 3NBYC 4HDNA 3GCZA 1UK7A 5EE0A 5C32A 1K5GA 4QDTA 1NJFA 4U5XA 3GBPA 3A70A 1WWKA 5CT8A 3R9KA 1U0RA 3OPYI 4IQ8A 1T1EA 4URHA 1FJXA 2DECA 1DBRA 1ZI9A 3ETJA 3TIGA 1ZUHA 5D5QA 2FMUA 3W78A 4PCLA 4QJ4A 3RJ9A 4BRWA 1DQRA 3BH0A 3EQ8A 4AUNA 2HLHA 4H77A 4HEA1 2IXFA 4CEIA 1CG6A 3I04M 1BO6A 3M5CA 5JW6A 4OQPA 4C43A 2HKIA 1W47A 3DB2A 2Q4OA 3IAHA 3JALB 2X42A 4PFJA 2BE9A 4R3WA 1TE2A 2JGMA 2H7XA 4TKVA 1ECJA 3JQCA 4W5JA 2ZVPX 4PXYA 5EVCA 1VHWA 4FOSA 5IJWA 2WB2A 2FWMX 4LQ4A 2HM7A 3PBKA 3MRTA 3MLAA 1LQUA 4LBWA 2JGLA 2BFDA 2YBEA 3GX1A 1QS0A 2X4DA 5G1NA 1VHJA 1XXHB 2HCFA 2Q9CA 3WGLA 1DC4A 4DLKA 1K68A 5A7FA 3PL1A 4D9KA 2PUHA 4QNRA 1DEHA 3H8WA 1LRJA 1RMQA 2PZ8A 3CLUD 3R77A 4KKVA 3VO8A 3TNFA 4TWRA 1KY3A 3L0BA 2V1UA 1XHLA 5F7XA 1TUBB 2O54A 1ZDMA 1ZQ9A 4MR9B 3NETA 4KR0A 3AMVA 3DUFA 4RUKA 1C5KA 1SB8A 1M67A 1QG6A 2J3QA 3HGTA 3PC4A 3QNMA 4L6IA 4OP3A 4QFBA 5GWXA 4JI3B 4CNBA 3UFXA 1JG7A 4IJ6A 4OXIA 5DB4A 3GJSA 1I2DA 2Z09A 1RE1A 4DE5A 3F5FA 5CFLA 7REQB 1D6JA 1MRNA 4Y6GB 5D3MB 5FUQA 1RWPA 3MFQA 3S2FA 1NULA 1Q0PA 4DM4A 2Q3LA 1O57A 3PR1A 1RTTA 1NBHA 1YBFA 1Z12A 2EEZA 2Z04A 4JVMA 5JAUA 4MKHA 5TS2A 13PKA 1FFXA 3O83A 4ESEA 4I2VA 1CUIA 3JRXA 3THOA 1E5XA 3KTDA 1JDPA 2Q0HA 5FI5A 2DU8A 1BAPA 5GJCA 4DCTA 2ERXA 4MINA 4ZZ1A 2G8NA 1ECBA 2FP4A 3OCXA 3AUAA 5C7LO 1Z4IA 2X2PA 3RODA 4AP6A 1KYIA 3CX4A 3FI9A 1XJWA 3QE9Y 2W43A 3G8DA 4HTFB 1FXWF 3DV0A 2E4ZA 3M8KA 4UDNA 1VL5A 3UJ8A 4ALJA 4KUGA 5T73A 5M6DA 3NTUA 3L1UA 1KY2A 5IANA 1M1NB 5AKYA 5U1PA 2PKQO 1RBQA 3L7IA 3L0IB 3N5CA 1WB9A 1PFQA 1X39A 2OWDA 2QTFA 2AFHA 2XWSA 4B79A 3DDWA 1G8AA 2ZUEA 3DMRA 3KV3O 2OV2A 1SCNE 4CDGA 2QLJA 5FA5A 3WE7A 1QIMA 4GG1A 2UYOA 3ROXA 3GEGA 4D5GA 4OFXA 2QWXA 5TNXA 1UBGA 2PXXA 3GPIA 5GJBA 5CLHA 1NONA 1OU0A 1SZCA 4BO0A 5LKAA 4X97A 2XD4A 2VKQA 2C9CA 2FUNB 2R6ZA 2Y1WA 4BVHA 2EFHB 2B4RO 3M1AA 4UCQA 5A06A 5E6RA 4EW1A 2XUZA 2GCNA 3TLEA 3CTMA 3DOCA 4TQ9A 4EPTA 2IGTA 2F4NA 4IQFA 3H05A 4ZDWA 3EFHA 3GN2A 3LY5A 1JJAA 1SUCA 1T24A 2WU0A 3ICCA 5KYVA 1P4JA 4CXMA 3FOFC 2UUCB 2Z83A 1WX1A 3KT6A 4OAPA 1ELOA 2Q8PA 1I5RA 2W2KA 2YV4A 4UHKA 3ICEA 5CVEA 1T29A 5F1KA 5TPWB 3N05A 3OFKA 3BXOA 4Q12A 2EG9A 3ZK9A 1SXJB 5KIAA 5H70A 5IN4A 3TS1A 4GLJA 1EHIA 4M38A 1U8TA 5DSXA 3NXSA 4EJSA 4NDAA 2ZIAA 4DIBA 2EWVA 3T7RA 4KIWA 4GDMA 5KOJA 4GF5A 1CEYA 3EPAB 1PK8A 2ZIGA 2F43B 4R05A 5CM8B 5A0FA 2O5CA 4IP0A 3OJXA 1YB6A 3IELA 1RYEA 1MO3A 3RC2A 2AI2A 2E4AA 4QBTA 3NIBA 5EJFA 1KIAA 1ZI6A 2KMLA 2QD3A 4QATA 2Z1NA 4CMCA 3W5CA 3AH8A 3NGXA 1MEOA 3W06A 3C2QA 4O4IA 3WR5A 3HKBB 3OT1B 3BA6A 4DSNA 4BLSA 1QM5A 1ZLXA 1UEJA 1O6BA 1N3YA 2DHCA 2G72A 3LUPA 1M6WA 3UXMA 1JAXA 4KRYA 5FOUA 1VJGA 4ZDIA 3W05A 1QHGA 3L0SA 3H16A 4YJ3B 1H2ZA 1U8XX 1Y1LA 3LUGA 3N2KB 4IIHA 1MDFA 4L5BA 3ORFA 2V0GA 1Y7PA 4F04A 4PLVA 1BWSA 1DI0A 3THXB 4O2BA 4RPIA 1BHSA 5A9RA 3MT7A 4RIHA 1RC0A 2BDUA 2VAVA 4HK4A 1N2SA 4Z8XA 4BKUA 4GKKB 3EUWA 1WDLA 4FHCA 2VJNA 4GLLA 1CUHA 3KSRA 1KBQA 1SUEA 3NEJA 3TLYA 5IYZB 1FP2A 1N0UA 2BMJA 5JAMA 1QAQA 4NU8X 4LDJA 2CFSA 2CK3A 4Y2SA 4DSUA 2PWYA 5B2EA 2WJIA 3DPUA 1N6IA 2AEJA 1IQPA 3BMNB 4MYDA 1GQYA 4XLTA 3TLCA 4BU0A 2LR0A 5I4IA 3I2KA 2VSFA 3P1JA 3OIFA 3GGJA 2NUPA 5G0VA 5HQ3A 5MFZA 4KWIA 5HKLA 3WQRA 5CJPA 3VPAA 1P2FA 2MINA 3KUCA 1JI0A 3NP9A 1N2CE 4HO1X 2FUG6 4KQFA 4TMFA 4DLBA 4JJFA 3GPBA 5ANRB 4YCLA 5KYTA 2CN1A 4L9RA 3EMBA 3WA7A 4KNYA 1JG2A 1FPQA 2PX4A 4RIEA 5IKPA 3THYA 1U9YA 4NMLA 4EG0A 3WQBA 1EGMB 4X00A 1IRIA 4A2QA 2BYTA 3SJZA 3KWFA 5KJ6A 3EX7C 1G16A 4KDCA 4Z53A 1GSHA 3EG9B 5KDDA 1YQWA 4HXEB 2H1IA 3B7PA 2SICE 3VYWA 3ZUPA 4DA8A 3NP7A 2WHXA 4ADSG 1DG1G 1B6TA 1I1QB 3VX3A 1SVOA 1IBRA 3ANXA 1U2GC 3AILA 3K92A 2CHVA 5JVDA 2WKPA 1FRQA 1ZXLA 1GD1O 5BYKA 4DSTA 1TK9A 1UC9A 2P9BA 1JT9A 3FZQA 4GPBA 1WB5A 1PJSA 2ON6A 3Q12A 2HSEA 4MTLA 5CIQA 4HS9A 1NW5A 4LX8A 4US1R 2FWBA 1YKGA 2Z5VA 4FZ5A 4NCJA 1KEPA 5AICA 5SYAA 3KQLA 3WP0A 4WEOA 1IY9A 1AY0A 4HLQB 1Z37A 1B93A 4FDVA 3NVMB 1C4KA 2FZWA 3EDOA 3IXLA 1E1YA 3JYQA 1WUHS 5FADA 4Q7JB 5BRAA 2QD4A 4NONA 3BGDA 4X66B 3R2JA 1ENZA 1U5BB 1PGNA 4LOAA 3CLSD 4LE1A 2E85A 3U62A 3WGJA 1A9PA 4RV5A 1C4WA 3RUIA 3PS9A 2OO3A 2BEWA 4AMBA 2JCXA 2GBIA 2JGEA 3GP3A 3QW2A 3NT5A 1PT6A 4F9GA 1CSEE 1R6AA 3GRAA 1OFUX 1OXMA 2W83A 2BGGA 3PXEA 3ABZA 1YOBA 3KV1A 4I1RA 2KM1A 1CUYA 1DC7A 2OZLA 2OZLB 3SVTA 1YQUA 2H6EA 4WAUA 1RM5A 4WXMA 1U3CA 3A3OA 5TQ2A 4NCHA 1I6WA 1E89A 4I1OA 3WDSA 5EZSA 4JT9A 1ISHA 3QVMA 4MUAA 2J9YB 4OQLA 1Y7LA 4ARSA 4DXHA 4KPYA 2ATXA 4PFSA 5F21A 2AOUB 5M04A 1EKXA 2WP8J 2J3IA 4F4CA 4S05A 3OZSA 1CK4A 1E8NA 1NMYA 2BC9A 4MVWA 2VAWA 3OE1A 2ZJOA 1T1GA 2ROQA 5HCIA 3RHZA 5M7EA 1J9EA 2HIAA 2V3VA 1H4QA 2PBFA 2R1TB 1RJWA 4GQIA 1UZMA 1N2OA 3G2OA 3LOPA 3L7NA 3C8MA 1VQ1A 2Q5EA 2PKWA 4FB4A 3AVOA 2G4CA 2OR3A 1I94B 5HWSA 3AR2A 4YDHB 2WT9A 821PA 1DQZA 2AQIA 2QM7A 3K1ZA 2OV1A 2WWVD 4LV6A 5KYUB 3KJQA 1XAIA 2P65A 4MCIA 4O33A 2OORA 1MJGA 4PLGA 4BNIA 1EWQA 3QVOA 4AYXA 1UIRA 1DRWA 4DPLA 1Z2EA 2PRYA 1DZIA 4IVNA 3G2LA 5DYGA 1LCIA 1L5LA 4A27A 2EP8A 2PMBA 3OQIA 4N8DA 1JXAA 2P6NA 1BD3A 5FEUA 3IO3A 1E7WA 2O8VA 4L5JA 3TM5A 2VP9A 3LFUA 1ECFA 1UPCA 1RYYA 1YE3A 2ONZA 3HI4A 4GU5A 4MNTA 4JJAA 4MYUA 5D3MA 5FUWA 2DVMA 3QXHA 3QFSA 4DOMA 4ZGWA 1ZMBA 5BMVB 3NGMA 4HSEA 4Q3DA 1JDSA 3R7SA 3LHKA 2A58A 4RDIA 3AEZA 1S3SA 5KHLB 3NCHA 3IEXA 3DW1X 4RCYA 1JIJA 3OHPA 4A2CA 5KTRA 4WECA 1QPBA 3KQWA 5CT5A 4B8ZA 1ZJZA 2PH1A 2I22A 4RNCA 2ZCUA 1W49A 1NW6A 2RIRA 1M66A 1UDXA 1UXHA 1PL8A 2JBAB 4EKNB 4BRSA 5AM5A 5TS3A 4CIXA 3GJTA 3GZTB 5KOHA 2PT5A 4LNHA 3UANA 2WPDA 5HJEA 2QUHA 3ZZUA 2X5XA 3OLYA 2FJUA 3IWDB 4CBVA 3BMNA 4D9HA 3TR6A 4GP9A 3K1YA 1PKXA 3VFDA 4B0PA 5GM2A 2MSKA 5DN6D 2RJNA 3JALA 3DE6X 1F0PA 2FDRA 4BIIA 4WK0B 2QN6A 2R62A 3LO5A 3GLGB 1RXSA 4DM7A 3F90A 2XNJA 5G1PA 4AS1A 2VF5X 1A69A 1B0ZA 1W88A 3GGSA 3IQIX 3QU7A 4CGYA 1MB0A 4K6MA 5CB0A 1KAQA 3HN7A 3OOWA 2AQKA 4GI1A 1QS0B 1ST2A 3LOUA 2XGJA 1JHXA 1BQEA 4G4SO 1XUOA 4URFA 3AKEA 1ADJA 3UCEA 2HV9A 3QVTA 4L7QA 5CVVA 2O2HA 4UMFA 2Y1DA 2DFDA 1P75A 4BKOA 3INGA 4G63A 3EQ2A 1VRWA 3PUKA 1FLVA 3KDSE 5I9NA 3AHDA 3N1UA 2VN8A 2CLFB 3P9ZA 4UE2A 1XCPA 1XRNA 3DT6A 3GNLA 3RS2A 1A88A 3FCYA 4MQ4A 5ALNA 5EIAA 2PJZA 1E9VA 4YWHA 3FAKA 5HCUA 1TXGA 5WRFA 5A9SB 1E2PA 1EI9A 3EN0A 4FKBA 4GOKA 4LDRA 3FD8A 2MT9A 4OQEA 2G6BA 1OBOA 1Z26A 1PFVA 2Y0CA 2JLSA 2YMMA 3NWEA 2NZYA 1GG9A 2ZAIA 3EP8B 4TXLA 2JNWA 3AIKA 3EWAA 3KTAB 1Z5OA 2VF7A 3RC3A 1QF9A 2PBZA 3N0TA 2GASA 3CZQA 3HDHA 2GJSA 4BVBA 1KGSA 3V9AA 1ZVMA 3UIEA 5T7BA 4X8MA 4LJAA 4IJUA 4PGGA 1BJTA 3EPRA 1IN7A 3T7AA 5FL3A 1OREA 3KQKA 2DM6A 1SCQA 3VR3D 3ZLVA 2QROA 1WOYA 1IZYA 4YLGA 3ZVMA 4D8UA 2PE5A 2A5JA 2WWFA 3FCEA 2GESA 5BVHB 3KEFA 3B2EA 2JFZA 1X13A 2WSBA 5HUHA 2O2EA 3ONNA 3U17A 1XB2A 3HXKA 2WZDA 5KNBA 3PFHA 2IJGX 4Y2XA 5DT2A 2XTAA 1ABFA 2XR1A 5J4HA 1MZPA 2H08A 2ECFA 3AESB 1NOIA 2NXJA 3K30A 5J59A 4MKRA 4ECAA 2MINB 4KMMA 2ZVQX 3FSRA 1G21A 1C0EA 1SKAA 1EZ1A 2YYZA 3H1GA 1ONOA 2VPWA 2EU8A 4A0HA 2OCBA 4AYTA 2ONKA 1HZJA 5FRDA 3I1YA 4ER5A 3KL2A 5D3QA 1ICIA 1PR6A 4JDUA 3O7MA 4IPTA 2Y0EA 2IOQA 4HLCA 2VJDA 1QO0D 4RHFA 3UK6A 3AOEA 4WZBE 5COAA 2FWAA 1ZLYA 1POWA 3GEBA 1KEWA 3TLJA 3VSAA 2OEPA 1Y5RA 2B3TA 1RC1A 1PJZA 1O77A 1TCCA 1XBTA 1RBMA 3P2EA 3WYFA 5H4HA 3AZOA 4MVJF 1EG7A 1XEWY 1I80A 3DWEX 3IPAA 3ID6C 4L22A 1EK2A 1AS3A 3HP1A 3PGVA 1P9OA 2AEFA 1XTZA 1LBIA 2XUFA 3L1JA 1XZPA 4DEXA 2P79A 1V5GA 3E0QA 3T7JA 1WZ2A 4RKRA 3RK0A 1NA5A 4NHEA 4FFOA 4R1NA 1YZTA 3S2UA 3RC8A 1SIOA 1LSSA 2FVXA 4YAWA 3CZ9A 5EKXA 1VB5A 3IVRA 4JYMA 1TGVA 3NKVA 3H9JA 2QTGA 4PO8A 4E4TA 1SCIA 4I4TF 4AJLA 4A2WA 1AZWA 2QT1A 3F9IA 3NC1C 1AK2A 3HY3A 1NOJA 5JJBA 3FMIA 1PNTA 4MW2A 3L8YA 5IVKA 3OICA 4INAA 3OT1A 3ERCA 1U2EA 2Q6KA 5ABPA 4BUZA 1M2GA 4F5DA 1J8FA 4F5YA 1Z16A 4TGLA 2RIPA 4BHTA 2VWGA 5J4KA 1E2KA 2EQBA 3D5QA 3CZRA 4Q7MB 2JH8A 4WV3A 4HH1A 1JT2A 3HEMA 3T5AA 1L4FA 1C8LA 5IZ4A 1YTUA 1MC8A 1T4MA 3H17A 4MI3A 1YJXA 3FLBA 1T5OA 2C0PA 1U0TA 1TIBA 1F2DA 1K6MA 2G36A 4HFMA 1L7BA 5DXFA 1SVNA 4FBGA 4CKZA 4PZCA 3TB6A 3A1UA 1QR6A 1AIPA 4QU9A 3S2ZA 1UXIA 1FTWA 2WPNA 2ZJ0A 4ER7A 3QXJA 1Q1GA 4INJA 4A26A 3KJGA 5E7QA 3RARA 5K9ZA 4MZDA 1P5RA 2NYRA 1ZMOA 4L16A 4M37A 5AM3A 3TW3A 1OZFA 3E22B 4TVSA 1YKSA 1QRSA 3ASVA 4HNSA 4HDOB 4J6FA 3ZLBA 4YHBA 4F71A 3R3YA 1WCWA 1Y8ZA 1XHEA 2C7BA 2CNNA 2PPLA 1UXKA 1Y8RB 4WBNA 2FFQA 2ZJ6A 1A4IA 5A1JA 2R84A 5JSZB 2J0QA 1PYDA 5DHUA 4O08A 4WMLA 4U2KA 4A91A 4J0FA 1JMYA 4H59A 1DBIA 4O1IA 5BUSA 4JQSA 4FKMA 1KY5A 2ADOA 3A6LA 4W9RA 5E6RB 1G8YA 3H86A 1K8XB 3IAXA 3U3JA 5FTMA 1U1IA 2PQMA 4N48A 1YQQA 2NTVA 3S68A 4F9FA 4HQ6A 4F3CA 4PAMA 5FBKA 3L4SO 2FZLA 4QXOA 4EY7A 3EVAA 1HM5A 2PAAA 3G0DA 3PTAA 5E3IA 4E30A 3AKYA 2XE4A 4UAVA 4YAFA 4BC0A 5JQGB 1KI6B 3UHJA 5L45A 3EVGA 2B5OA 3SE7A 4XVQA 1JSZA 3WADA 1MFZA 1GPUA 3KYDB 4Y1FA 1K0UA 4EI2A 3ABRB 1XMPA 1PJTA 3P4UA 1U7HA 1ORWA 2VL7A 3DP9A 4C2UA 2GJAA 1BCSB 4JLAA 4Q1FA 1ACLA 3HWX1 3LIIA 3OY2A 4GPD1 4OXYA 1U7WA 5FR2A 2V1XA 3K09C 1GTMA 1ZKDA 2Z43A 5I8ZA 3VKHA 3AERA 1Q2XA 1JAHA 1G3MA 2H9IA 2IUUA 1Z4JA 4BNDA 1P1KA 3DPSA 2ODEA 3ITKA 3DZCA 4QLBA 2FUEA 3CZPA 3MCAA 10MHA 1K92A 3AP1A 3FJOA 3T1OA 1V11B 3T9DA 3O8NA 5FI0B 1HFKA 1GITA 4WT7A 3ZD7A 1EFDN 1Z2AA 2R6CA 3JASA 2YNMC 4IDEA 1OFIA 3ZKWA 2BL4A 4V0KA 3VGJA 1U6KA 4ERXA 1BXZA 1U0GA 3DWFA 3HZRA 4ZEVA 3AFGA 3OZGA 2WJJA 4OLJA 1OC2A 1CRZA 3KFXA 1MXFA 1FPMA 1HDOA 5THKA 5JS2A 3IVXA 4FHFA 2UXBB 1R8JA 2NT3A 3GQBB 3IULA 5DM70 1ZM3A 1Z4NA 1J5EB 3L8FA 2QLNA 2QDKA 2WSLA 4HFNA 5E9QA 2QA5A 4H7FA 3OLXA 1E1DA 4YXWD 3GOQA 3V1LA 1TCAA 1UC5B 2C4MA 3BBLA 1A95A 1ITZA 2HF7A 4B45A 3M6LA 1Y4SA 5I7OA 4IIYA 1WMFA 1H6DA 2AHOA 1I1HA 2G08A 4CLQA 4M98A 4REMA 1DQNA 5AM4A 1FP6A 3MPOA 3V8VA 4WL0A 3QHQA 2Q3DA 1WPRA 2PQ0A 2FGKA 2QTAA 3TPFA 4A5SA 4MLZA 1MQ8B 1EVKA 1OLSA 4M88A 4QXPA 4O25A 2J85A 1IYZA 2A4MA 2ACEA 2W6MA 3A6GA 3BAZA 3BL8A 3PIIA 3RT7A 4BV2A 1JG6A 1OVGA 4IJMA 4KU4A 2JA1A 2WB4A 1U9ZA 2Z08A 1OFUA 3IURA 2I7XA 3PVCA 2Y9MB 2VHZA 5DGCA 5BOVA 3U7JA 4AO7A 1P1HA 1HYGA 5J2UA 3HL4A 2AOUA 1YRQA 1JEOA 2YW9A 2WE7A 4JP5A 3TUZC 4HQOA 3GQVA 1O5TA 3MG9A 3ZE7A 3OESA 4PY2A 1QZXA 4D99A 1Q7EA 1XMXA 5JNTA 4RMHA 3WI7A 1W94A 3UK7A 2CXRA 5AYVA 2BLNA 4PRZA 4UPVA 1LX6A 2HRCA 3SKVA 2XYPA 3ZJ4A 2YHIB 4HAYA 1WDMA 4WNAA 4DA7A 2EP7A 4QQFA 2DERA 5JD6A 3EZ7A 2YFHA 3DNFA 1FIUA 3QUBA 5ALQA 2J3HA 1LRLA 2ZRPA 2ZUTA 1XQWA 2VYFA 2WV9A 4A23A 1U9IC 5H3HA 2GKSA 2ZYSA 4Q1VA 5DFAA 4JJ8A 1UKZA 1I2CA 3N2GA 2JZNA 2WFMA 3OP1A 4I99A 4J1SA 3U60B 2Q50A 1IXYA 3PXDA 3UV3A 4H31A 1DXYA 1KMNA 3DVQX 2XD9A 4JJZA 3H7AA 2P6PA 3OMXA 2BHLA 1WVGA 1GJRA 1SXJD 4DA9A 4DCGA 5JS7A 1GUYA 5JALA 2YV5A 3Q41A 3NAMA 3ZCUA 1UAAA 2BFCA 4GSYA 1S8FA 3TAHA 4C5BA 6CHYA 1JLRA 3T52A 1DIGA 4RTJA 1JN0A 1H2RS 1S3GA 1XWWA 1KZ4A 3GDWA 4FHEA 4LS3A 4Y6OA 5CK5A 4Y9UA 4CI9A 1F51E 1RRFA 2O8FB 3IOCA 1SD1A 3OOEA 4HH3C 5FHQA 3H1EA 3VR5A 2HHJA 1QLWA 3LY7A 4XCQA 3L6EA 5TQ0A 3FPSA 4EARA 1U3GA 4EKIA 1TZKA 1HYHA 2JJMA 1LGYA 1IH8A 4GMKA 2RG1A 4K9QA 4GFDA 5AOCA 5HZGA 4YQFA 4I55B 4IEEA 3WL4A 4K9MA 4CEJA 2YQ5A 1D4FA 3QBTA 4MA5A 1O95C 1PT7A 2RONA 2Z2KA 3G79A 1X1AA 4I6JA 4X7RA 3O93A 5BW5A 1NZDA 3OFVA 3T0IA 3ZCQA 5K6AC 3MTJA 4Q3KA 3SR4A 3EW7A 1WBBA 4FUQA 3HWSA 3C8UA 2GD2A 2RDMA 2IH4A 4WY8A 1I0LA 1DJNA 4HT3B 4G5FA 4JNKA 5DLQC 4B4WA 1GTG1 2H2GA 1PZHA 3OA2A 1L5VA 4GBED 2H2WA 3IEIA 2IYWA 1S9HA 1X74A 3NOVA 2WMNB 2WU3A 4GZ6A 5I5GA 2OMEA 5HKBA 3MWFA 3N76A 5KNCA 4BVFA 3O1JC 4JL6A 1BXGB 1M72A 3LA6A 3RS0A 5IJ9A 3GCGA 3LDUA 4G9BA 3R7LA 5EJMA 3QIAA 1K08A 3AWDA 3KEOA 1XEXB 2FX5A 4ECEA 1O3YA 5IZCA 2XE6A 1TKRA 1AN0A 2CC2A 3KFVA 3QMWA 4Z1MA 4BBZA 2BI8A 5BWNA 3NAZA 4ZZIA 4F1JA 4HDRB 3RVLA 4G65A 1XCJA 3THRA 3PHLA 3MCUA 3QPAA 4GLBA 5B12A 4M1MA 1JIIA 5M2QA 3QEAZ 5F12A 4QRIA 1RBYA 1RYFA 1NBIA 4IIUA 3THXA 2YN4A 3WL5A 4BZWA 1EFPB 1U4OA 3LDHA 4GLFA 5ECDA 3QU9A 1KI7A 1D1SA 4RQAA 1VFNA 3SC2B 4F6CA 4ZMBA 2WKWA 1MJGM 3MSCA 4TT3A 5CAEA 3HR4A 1K7XB 2J6IA 1R0YA 2X0RA 1E79A 3C87A 4XFJA 2Z2XA 4FDAA 1DS6A 1G19A 2CNBA 3Q11A 1NTRA 2P69A 1ZOIA 2B4YA 4IDBA 3IT1A 3LSYA 3U80A 4EKEA 1CQJA 1DFGA 3AKZA 3H8SA 1G20E 2NV0A 2P40A 1ZJ4A 2V7UA 3MTDA 2G25A 3HVKA 4LK2A 4A0GA 5C4IA 4CIVA 2QHXA 4IV5A 1DX4A 2Y71A 1A4RA 1J0CA 4MS4A 2X41A 4YR9A 4HL6A 5CBKA 3GL9A 4AU1A 2HQOA 1HTTA 4OHMA 1WXIA 3IFSA 4U7WA 2WJWA 3HGQA 3HP4A 4DLRA 4NAVA 5JC8A 2CNWD 3O4IA 1Z8NA 5EXXA 4XTRA 2D1FA 2PSDA 5DHPA 1SBCA 5UKDA 5FX2A 5H5JA 1E9CA 3B8EA 1M2HA 1EESA 4FFPA 2DC1A 1K06A 4H7DA 3SJUA 1HH4A 4G8CA 3WL3A 4EB0A 4QHTA 4XOIA 1GYRA 3TQOA 1K4MA 2NU6B 2UZ1A 5AXBA 3W8DA 3SD7A 1QOPB 2PUVA 3K0EA 1AD2A 2OLJA 5A6SA 4M8IA 1WXDA 3A6PC 5IULC 3OX4A 5CH5A 3MCTA 1QGYA 1LEHA 4IH9A 4WFKA 5DHTA 5EXSA 3OPQA 1BEEA 2QAIA 3BWYA 3KOUA 2Z8XA 4HV4A 1BJKA 3ROPA 2N3ZA 4HGOA 3JYLA 4MVJG 1XZ8A 2WJ3A 2WSIA 3B9QA 1NNUA 1T0IA 4DG9A 3PG5A 1KJJA 1T3ZA 1JE1A 4TV9F 1DQYA 3HZHA 2G09A 3FPLA 3QVKA 4N40A 2QN1A 4U2GA 3LCJA 3EVBA 3NBAA 3DXYA 1ATIA 1ZOLA 1WDKA 4Q6WA 4DR4B 1O87A 5DGTA 3U0BA 2H29A 4Y2TA 5BPFA 2HADA 4X5OA 3V6MA 3QY0A 4B48A 5L7TA 2O8DA 2GXQA 4NG5A 1OVMA 3ZWAA 4BGUA 1A7JA 4X8OA 2I3ZA 4G0YA 1G5HA 3S1AB 1E5DA 2OB2A 4LC0A 3N2IA 4PLCA 1FZTA 3F73A 3B36A 4BP8A 2I1WA 4V0NA 5JYCA 1WV1A 3R09A 4BV3A 2VTEA 3OM8A 3ILVA 1GSAA 3I4LA 4K05A 1M83A 2DTXA 2GO1A 3KJXA 3P45A 5CK4A 3P4XA 5F64A 3W5IA 1N1GA 3DZKA 3N0RA 3W8FA 3WHLA 2UVPA 4CKWB 5HR5A 3OLCX 1F5SA 3GELA 4A03A 3PFGA 4C6HA 3H2HA 4GI5A 3ZU4A 4AS3A 4BBPA 4H7JA 3ISJA 2BKUA 3Q9UA 3KJFA 4NZOA 5K6RA 4OYRA 1I8TA 3OQ1A 5SZHB 4BYGA 1T10A 5KVSA 3Q2OA 5FLYA 4YQZA 3W9BA 3FUXA 2O48X 2W2TA 2O8BB 3LLUA 2ZWPA 3SE0A 3CRRA 1A27A 4P4SA 4FE4A 2JVJA 3QEBZ 2X6RA 3REFA 1YRLA 2G28A 3NOOA 3P9QA 4ZI7B 1DTWB 1XDUA 1Y3CE 2POCA 3FYDA 1SU7A 2ZYRA 3KPJA 3O94A 4KG7A 4R83A 5F7ZA 1OXSC 5HQTA 3G0GA 3M4NA 2PRKA 4EJMA 1WD7A 2C98A 3Q9NA 5IT5A 3UGKA 2PUJA 4RIIA 3LC0A 1J8QA 3USZA 3VZQA 3AJ8A 1P62B 3E70C 3I5MA 5C52B 4KSCA 3CB2A 5H02A 1DEKA 2F64A 1MA3A 3GEEA 2FEKA 3ZQ4A 4RJJA 3I83A 3CF4A 1NYQA 2XQGA 3U40A 4QQ8A 1HTWA 1NJSA 2CLSA 2MR5A 1W46A 3KOYA 4OL9A 4UVGA 3CRVA 1I7BB 3W2EA 4C0XA 4NVRA 4KCGA 1CD5A 1YC5A 3A25A 2DWPA 2HEIA 4HYQA 4YT5A 5DW3A 3JSAA 1H2YA 3SEQA 3ZQ6A 1VXRA 1UFQA 2RG7A 2IHZA 3O73A 2X9GA 1TVEA 1NFQA 3C7CB 3PRKE 3AONB 1TIKA 2RAFA 2X6QA 3P9CA 4Q37A 4JBNA 4AWAA 4FI3C 3EW9A 4TTQA 1SH7A 4MGEA 3FSJX 3CS3A 1B1CA 4YMIA 4B9EA 4HRYA 4YRLA 1X7GA 1HLPA 3BWVA 4H2DA 4QDKA 1YRAA 5KVVA 1KEKA 4UU0A 5MN5A 2G71A 1W5AA 4F3YA 2V97A 1RAIA 3GH1A 3M4ZA 3GWGA 3OPMA 2XSZA 2JG3A 1BSVA 2YZ2A 3KALA 3D54D 1F8XA 4C01A 4NV1A 4KE7A 4HSGA 2CJYA 5K1ZA 3KVNA 4BB9A 1LS1A 1DJMA 1W7AA 3QVWA 1MRSA 5GJWC 2HMWA 3OA0A 4GXQA 4UVDA 3WK7A 2ZQZA 2C97A 4BAGA 2XRFA 3CNQS 4RENA 3A9TA 2EFJA 1GT91 3MFYA 1D03A 1BKSB 4XX0B 1WBDA 1WDWB 3L06A 2NUBA 3AU8A 4JJGA 3I01M 3L43A 3P7MA 3V7FA 2YIDA 1GNVA 2HLDD 5BSGA 1Z39A 3FKSD 4JL8A 3HDTA 2OFFA 4CRWB 1D2EA 3C4JA 3Q3GE 3SEZA 1YL5A 2IITA 4DBLE 4A0RA 1D7OA 2BKLA 4EECA 3HCNA 1X86B 1LTKA 4IJ5A 5ALKA 3HXQA 1GTSA 1R7RA 5DMHA 1VPTA 2IHVA 4INPA 3QKUA 4PC1A 2X9VA 2YS6A 4LF7B 4F4JA 5CVCA 5AW8A 4GRAA 4KO4S 3HBAA 3Q7IA 1Z75A 5EIHA 1NNEA 1FK8A 2IBSA 4Y0VA 2BGWA 1AKUA 1HFWA 2CKDA 4MKFA 5FQOA 3MHTA 1IEXA 2E5LB 1JV2B 4RTOA 5C8ZA 2PRSA 4ZREA 4KI7A 3Q7QA 1ESCA 1GXSA 1NGSA 1RPNA 1KI2A 5IP5A 4C3VA 3DA8A 4EHAA 2W2XA 5I7EA 2C2ZA 2VH2A 3NWJA 4M7RA 4EZEA 2AMLA 5JATA 4KQIA 3CX6A 3EGEA 1V6SA 4HI0E 4JVLA 2WWTA 1VLQA 1MXHA