1T4BA

1.6 angstrom structure of esherichia coli aspartate-semialdehyde dehydrogenase.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
b'MQNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
molecule tags Oxidoreductase
source organism Escherichia coli
publication title High-resolution Structures Reveal Details of Domain Closure and "Half-of-sites-reactivity" in Escherichia coli Aspartate beta-Semialdehyde Dehydrogenase.
pubmed doi rcsb
total genus 126
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1t4bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t4bA01
2OP1A 4BO8A 4E2XA 1CIVA 5IFLA 2P9CA 1T2DA 4L4SA 2PD4A 3RUHA 4MVJE 3DZJA 3M2TA 3K30A 4LVUA 1UXHA 3ITKA 4DXHA 1UDBA 2W4QA 1ZSVA 4E2WA 4RZHA 1T4BA 4NBUA 3CE6A 4YAIA 3I9LA 5G4KB 3W4JA 1EEHA 3EVTA 2G5CA 5ES3A 4GSLA 1SBYA 2CMDA 5B1YA 3RCBA 4M89A 2PR2A 4CLEA 1BDMA 5JLAA 4OQYA 3VH4A 5F3RA 1EUCA 5CDTA 2AQKA 2E6UX 3CKYA 2O3UA 4J43A 1K0UA 1WWKA 3PQDA 4TKLA 1OC2A 1N1EA 2P68A 1PGPA 4YT2A 1PR3A 1UXJA 2O7SA 4PLTA 2QZ9A 3GZNB 4LW8A 4OAQA 1P1JA 2OZPA 3ZDFA 2Q1TA 1Y8RA 4YACA 4BNUA 3JQBC 3HE3A 4CM8B 5JS6A 2D59A 1LX6A 3BMCA 3LF1A 1G1AA 3CXRA 4TZKA 2CVZA 1GPDG 2GF2A 1ENPA 4CM9A 3JQ7B 2QZZA 4DPMA 5U9CA 3EK2A 1OBFO 4HWKA 4D41A 3TZKA 3GDFA 2VUSA 1GADO 2D5CA 4XJTA 1EFLA 3PI7A 4NFYA 2C29D 4BNWA 4KDFA 4LSWA 4CM7A 3JQ6A 2PGLA 1I30A 5JDIA 1HYEA 4XR4A 3ROQA 1B16A 3BZUA 1P0CA 2X5OA 1R15A 4BKPA 1D3AA 1ZSNA 3ZWVA 2AE1A 2O3SA 2O23A 3ZNPA 5IAAA 3BMOB 3DOOA 4MIOA 1R0SA 3BIOA 3TSCA 1H6CA 3A9WA 4Y6RA 3UW3A 2QRJA 3F3SA 3L0DA 1RWBA 3KETA 4G5HA 3RFVA 1AE1A 3IP1A 3VAZA 1QLHA 4FBGA 3GGGA 3OECA 1V0JA 3R3SA 4ND5A 4YQZA 3JQ8B 3NGXA 4IGFA 1DIRA 4BKQA 4OGWA 1ENZA 2FPGA 1G0OA 3JYLA 1ZBQA 1YJ8A 3GVIA 2J3KA 4R3NA 3ONEA 1BXZA 5HS6A 3V2GA 1DHTA 3DMYA 4X54A 3VPXA 1C1XB 1U2GA 3QVSA 4Y6SA 4IGEA 4OKIA 1NR1A 2Z1MA 1R16A 1VLLA 2DC1A 3FWNA 4XDYA 3FHLA 5TGDA 5JC8A 4GVLA 4GMFA 4R1TA 3OQ1A 1F12A 2Z5LA 1MB4A 2Q22A 5DDIP 4DPKA 3VZSA 4A7PA 4XB2A 1H0KA 3WICA 2HK8A 4N5MA 3OICA 4TVOA 4MVJP 1E6UA 4W4TA 3T4XA 1XKQA 1EMDA 1KY4A 4B4OA 2A94A 1DLJA 5F1PA 2Y1OA 1Z75A 1PJ4A 4NNJA 4B8ZA 3DMTC 2W2KB 2Q2WA 2FPIA 2JD0A 4Z3DA 3WLEA 3E82A 3Q1LA 4MOWA 3U4CA 3VPFA 4A26A 4UEJA 4MIYA 1OC4A 2IDZA 3V1UA 5EERA 1Y7TA 4P38A 1QYDA 4HBGA 1ZSYA 4XA8A 5ITWA 3MCVA 4R9SA 1LLDA 3RFXA 4GGPA 2VUTA 1LDMA 3I3OA 1WMAA 1YVEI 4YCAA 4DTIA 4Z9XA 4TQGA 1ZKMA 1EUDA 5EESA 3LQFA 1ISIA 3OJOA 1U4SA 2Z1NA 5DOZA 4MP8A 1GAEO 4CPDA 3WFJA 1ZO8A 2JAHA 3E8XA 3GNSA 4E2YA 3FD8A 2VRBA 3DBRA 1E7SA 4AJ2A 4E5KA 3WQSB 2IZZA 1EE2A 3PHGA 3JQEA 3QLJA 1TB4A 3KSUA 1E3EA 4BNMA 3F46A 1N8KA 5G4LA 2JFFA 2GNAA 1JWBB 1JU9A 2BD0A 1AXGA 4B4UA 4Z9FA 3ITDA 1E5QA 3BTSA 3FR7A 3AI1A 3DBHB 3IKTA 3FPCA 2D2IA 2CD9A 3OQBA 3RUDA 3LC2O 1XU7A 2Y1CA 4CM4B 4MP3A 1ZW1A 1SOVA 3QP9A 1NR7A 1I3LA 1ZK0A 4WLFA 3DAPA 2RHCA 2NLOA 1DRWA 4O5OA 1Z82A 3RFTA 1Y81A 1QP8A 2CUKA 4RORA 4ND3A 2G1UA 4HXYA 3I9KA 3WGOA 3A06A 3GHHA 1HL3A 3W6UA 1BRMA 1Y9AA 1O89A 5L40A 2NU7A 4JROA 3HNPA 4E5YA 1OI7A 4ALKA 5JFOA 1E7RA 1GD1O 1L7DA 1JKIA 1HRDA 3N58A 3CZMA 4NJMB 4Z9YA 4R5HA 1JAXA 1H6DA 2Q4EA 1FDSA 5LC1A 4BKUA 2XOXA 1PJLA 4CQLB 4D0SA 1DFGA 3RC2A 4CM4A 3O9ZA 2GN9A 4D3DA 1RM3A 1LRJA 2HK9A 2VOJA 3DZGA 1O0SA 4FW8A 2GN4A 2PZMA 5KKAA 3NTOA 3NV9A 1ORRA 4XIYA 3RASA 2DBQA 4F6CA 2GUGA 3WGYA 1PTJA 4NPCA 5TLSA 2NVWA 4ZHSA 2B4TO 2UYYA 4OSOA 1ISFA 1FMCA 4JJGA 4ZQGA 5TC4A 4GPD1 3KYBA 3ETGA 4RZIA 4RF2A 2GASA 5HTOA 1EDZA 1YE3A 4Q3BA 4A0SA 3AFNA 4ROSA 2O3TA 3HDHA 1E3SA 2BKAA 3NYWA 1V8BA 4K6FA 3ZV5A 3WMXA 3VH1A 5HM8A 1IB6A 4UVHA 2EEZA 5JC1A 3ZI0A 4BGUA 3KBOA 5EPOA 5L4NA 5KCZA 1ONOA 4AJPA 1X13A 5I7SA 1M75A 4F6LA 4GI2A 3PIDA 3U49A 1UZNA 1NASA 4CMAA 4Q9NA 3KSDO 2VRCA 3WR5A 2HO5A 3HADA 5IDXA 4PN3A 3ENKA 1UAYA 4YJDA 3PEFA 1VJ1A 3SJUA 5JBIA 3PWSA 3H5AA 4DMMA 1B7GO 1ZK1A 2X0IA 3VZPA 4CMEC 3JQCA 3COSA 3OP4A 4TROA 1YGYA 3KEQA 2EV9A 1N2SA 2ZTMA 3E5RA 5A9RA 3CINA 1FDWA 3EZLA 5CG2A 3C7AA 5I8ZA 4MVJA 2YFQA 4LMRA 3ZU5A 1YQXA 1ZZEA 3TFOA 1DIAA 4CJXA 5L3ZA 3NDJA 4MIEA 3PJGA 2WE8A 3C7CB 2PK3A 3GEMA 1U8XX 2O7QA 1BW9B 2VTEA 3WWZA 4RDHA 2O4CA 3TL2A 1A71A 4JNKA 1SCUA 2PA3A 1WDKA 4R1NA 3PHJA 4FSHA 4WECA 5A4DA 2X1HA 5CDGA 3LZ6A 1EE9A 4YA6A 1H94A 2OBYA 3ANLA 4ID9A 1HSZA 2ZB4A 3WQQA 3GN2A 3CIFA 2EXXA 2CZCA 3Q2KA 2ZIZA 5BNTA 2PKQO 4FQ8A 4OYRA 1GQQA 4W82A 3ZU4A 4YVFA 1U3UA 4CQLA 1JN0A 1SEPA 1Z74A 4E2ZA 3DMTA 5T64A 5JAMA 1TEHA 3IJPA 3DHYA 4RVSA 3UKOA 4BHTA 4YRAA 3FSRA 1P45A 1ZUD1 3IC5A 1B15A 2DVMA 2FR1A 2PY6A 1XCBA 4DBVO 1DRUA 4WEQA 1M66A 1VL8A 1DIGA 3UGKA 4B3JA 2C7VA 1VKNA 4YXFA 2BRUA 4P4NA 1GEGA 2X0NA 3ONFA 8LDHA 2NQTA 2NTJA 3H6KA 5JMWA 4P22A 3WJAA 1NHWA 4TWRA 3JD1A 5KJFA 3OIDA 1HZJA 4R1UA 3A28A 3AY7A 2OUIA 1MC4A 3M1LA 3ON5A 1ENYA 2O2YA 3QA9A 3SC4A 3S2IA 2A9FA 1GQ2A 4HFRA 2X5KO 2BI7A 3C1OA 5TRTA 4A27A 2NTNA 4YB8A 1T2AA 1JA9A 3L6EA 4BIIA 2CFCA 3DBRB 3E03A 1HE3A 1O6ZA 3H5RA 2CVOA 2DBVO 2Y68A 2PZKA 3H5NA 4GKVA 3F47A 4CL8A 4M1QA 3JD2A 4NQZA 4BQPA 3RKUA 2PH3A 2PNFA 2OMEA 4FFLA 3I23A 4G2NA 3D5QA 3GPDG 3KOUA 1LRLA 1Q7BA 4D46A 1J6UA 4BNYA 1QKIA 4UAGA 5I9LA 3ENNA 4YAGA 3D7LA 3GFBA 3Q9UA 4WEOA 2OHXA 4U8GA 4TRNA 3ZNQA 3T4EA 1DFIA 3RC1A 4WLEA 3G0OA 1LRKA 3A4VA 4K9DA 3PZRA 4DYDA 5C7IO 1GEEA 3AU9A 4XYGA 3WGQA 1FJHA 3B6ZA 4J4HA 4ZQHA 4JXKA 4B4VA 3CEAA 2WYVA 5JYDA 3I52A 2YQ4A 4PCVA 1ZIDA 3FNFA 3JV7A 4I9UA 4YJHA 4QEDA 1IE3A 1X0XA 5ITVA 2WD7A 4RCVA 3VPSA 4GMGA 3JD3A 1LDGA 5GZ6A 2Q2QA 2EWMA 4CR6A 1N9GB 1YO6A 3RJ5A 1X7DA 1U3TA 1X1EA 3FTNA 4L9RA 2NM0A 4AVYA 1TT5B 4AJIA 3RD5A 1HDOA 4PLYA 1P1KA 4MKZA 1J4AA 4OH1A 1PEDA 4CV1A 2PH5A 4ALNA 1ISGA 1IPEA 3ZHZA 1GZ3A 2C0CA 5IG2A 3C3XA 1KS9A 1QXSA 5KOIA 3VPHA 3RWBA 4YJFB 2DFVA 1O5IA 3GRPA 4PLHA 4BGVA 3GY0A 2IXBA 1CDOA 4M54A 3ZU3A 3U3XA 3WGTA 2RH4A 4GX5A 4WK6A 2D3TA 2AHRA 1DXYA 5G0TA 3FNHA 3GVCA 1P77A 4BNNA 3B1KA 3KYCB 2XPCA 5G0WA 4MKXA 4CMEA 3GK3A 2F00A 3ETEA 3DBVO 1EVZA 1XIVA 3LYLA 1WP4A 2HCTA 2GN8A 2VWHA 3C24A 4N7RA 2XF8A 4WLOA 1MA0A 2C07A 4BB5A 3EAGA 1EQ2A 1NBOA 2Q1UA 2V7PA 4ZQBA 3WJ7A 2GCGA 1NXQA 1OOEA 1R4MB 4HY3A 5AYVA 1ULSA 1WMBA 1BHSA 3AUAA 1A4UA 2NACA 5AXCA 4H7PA 3JYQA 5JDIC 3D0OA 5ADHA 1ONPA 3U4IA 4I8XA 1HDXA 1U7HA 4K28A 3ADPA 1B3BA 2NNLD 3I6IA 4JCOA 4PRLA 3GEGA 3G3EA 3GAFA 4DBZA 1VC2A 1Y8QA 4JP3A 4BO1A 1LSOA 4GKBA 3H4VA 4KOAA 3DFUA 2HMVA 2BFAA 4XD2A 2GLXA 4S1VA 3ZWMA 4JX8A 4YAKA 2Y1GA 3DL2A 3B70A 3NTRA 4NG5A 2A35A 1EVYA 4PRKA 1N9GA 1XQ1A 1C0PA 3QV1A 2VN8A 4J4BA 4L8VA 1IOLA 4AJEA 2VHYA 2GZ3A 1HE4A 4CV2A 5ILGA 1SB9A 4XQGA 4IIVA 4DRYA 4R01A 4D42A 1GV1A 2H63A 2GYYA 4LISA 3BTUA 4ND1A 3PZBA 1UDCA 4B3IA 1H6BA 4XQ9A 1X14A 4KTTE 2B37A 5COBA 4B4WA 1YBVA 4RF3A 3K8ZA 3FWZA 4QXMA 3PTZA 4A5OA 3MTJA 1PJBA 2I6TA 1UAGA 2IEBA 3C85A 4BNKA 2Y05A 2Y1EA 1WLYA 1GV0A 1E3IA 1A9ZA 1WAMA 1M67A 4WNIA 4Y9DA 1T4DA 1LJ8A 2E82A 3KYCA 1I3NA 2HSDA 1D7OA 4E32A 4JN6B 2Y1FA 4YAJA 2CF6A 2YV3A 4ZQEA 2HUNA 4IDGA 1UXGA 2BH9A 3SXPA 3H2ZA 4J1QA 3GRKA 4DC1A 3ETDA 3B1FA 1R0KA 4Y8VA 5HS4A 1P1IA 3DQPA 3I9MA 3R0IA 1EBFA 2SCUA 1FDTA 4CUJA 2YY7A 1SO8A 5JAIA 3QVXA 4PLVA 2WWRA 4J4TA 3S2EA 3DO5A 4A2CA 5KJ1A 3MJSA 3E48A 3PFWO 1ZCJA 4BO4A 3G49A 1CRWG 3VVBA 3IUPA 1U5AA 1MXHA 1DJNA 3ZN2A 4GWGA 1ZJZA 1AUPA 4BS9A 2HLPA 3D64A 5J23A 4Z0HO 1R12A 2BGKA 4JP2A 1ZK4A 4WCFB 1M2WA 4U6QA 4PIVA 2C54A 5BT9A 1RPNA 3VH3A 2RH8A 4R69A 4AJNA 3KZVA 3GUYA 1OAAA 4RGBA 1QRRA 1I36A 3TJRA 5L7WA 3LC7O 1LEHA 3ICPA 3AUSA 4L75A 3E9MA 2UVDA 2J3HA 4WNCA 2EHDA 2P9EA 3GOHA 3LK7A 2C59A 1XQ6A 4CLRB 5C37A 2CDCA 2EGHA 2PTGA 2CVQA 4EJ0A 2EGGA 1VI2A 3E9NA 3LDHA 5CFZA 2WJPA 3PYLA 5JAZA 1Z45A 4UEKA 5EL0A 1GTMA 1VM6A 1I3MA 4ZN6A 4DIBA 5MDHA 2Z95A 4MDHA 4R16A 3KUXA 5LDGA 3MJVA 3H9UA 2I3GA 3F4LA 1B14A 1PJQA 2Q46A 1Q0HA 1HLPA 5A05A 1MLDA 4L73A 3KEOA 2OBNA 3H7AA 4FFOA 3L6DA 4HFJA 2QX7A 1PQPA 4HNGA 3JYPA 5G0SA 4RLSA 1ZK2A 5IXSA 2O3JA 3GVHA 5CEJA 4MINA 3ASVA 3EZYA 1UP6A 5L4SA 1P44A 1QORA 2J3JA 2J5QA 1DC6A 3K2EA 1ZK3A 1KC1A 1MGOA 3T7EA 3ADOA 3MOIA 4YBZA 5I7VA 3AJRA 2R00A 1DJQA 2TMDA 3I1JA 4Y67A 5IJZA 1EZ4A 4JGBA 2BHLA 1GYQA 3GFGA 3NJ8A 1W8DA 2DBZA 3ZW8A 5CDYA 3B1JA 2CF5A 3O38A 4WJZA 2YQ5A 2IZ1A 2X86A 3LLSA 3NAQA 4IQ8A 3ZH2A 3D4OA 5A9TA 3WBFA 1E3JA 1A9YA 2J6IA 2OP0A 1MG0A 2Q45A 3I9JA 4BB6A 3NT5A 3KLMX 1T2FA 3UICA 1UR5A 2GRAA 5FEUA 1KEUA 3A1NA 3VZQA 2WTBA 3EGOA 3WGIA 2H6EA 3UVEA 1LXCA 2ZK7A 2YJZA 2DPGA 3F9IA 1GR0A 1ZMTA 1LNQA 4HNHA 5THKA 3QY9A 1GDHA 4KUHA 4MVJF 3AU8A 5C7LO 1RM4A 2EKQA 3D1LA 3UH1A 5I7EA 5A03A 3T7CA 4K1LA 1S6YA 4NI5A 4NIMA 1GYPA 3AK4A 1CQJA 4J0EA 4N18A 2VWPA 4BO0A 4LK3A 5JCJA 4FC7A 1PGQA 4BUCA 1KVTA 3IKVA 4HFMA 1B3RA 4DQVA 3OFSA 3LT1A 2FY8A 5KWEA 4PFJA 4RQUA 3PYXA 1EBUA 3JQDA 3BMNA 3QW2A 5TX7A 3WB9A 1YOVB 1KEPA 2WYUA 5H81A 4BNTA 4CMIA 5IN5A 3H9QA 5A06A 4J7CA 4E30A 1IHXA 1H9AA 2DUWA 2EP7A 1TT5A 1B26A 1W4ZA 2VT3A 3RU9A 1Y8QB 4DVJA 4J3FA 5A04A 2O3QA 2X7HA 1DPGA 1U3WA 3W1VA 5CEEA 2D5AA 2RIRA 2ZCUA 4D0RA 1RM5A 1FDUA 2OO5A 1SEVA 1LDEA 1LDBA 1JVSA 2V6FA 3KTDA 4YYZA 2POQX 4P8RA 3BXXA 4OMUA 5F1OA 1MV8A 3K73O 1JW9B 2JL1A 4DREA 2AG8A 3PVZA 4NFSA 5JYAA 5AVOA 3NJ4A 1QV6A 4B7XA 1VSVA 3PXXA 1I33A 3GMSA 1JLLA 4DMLA 5L95A 1BTOA 1G6KA 4FFNA 3CSDA 2EG9A 3ZWWA 3IDSA 1DO8A 5T8KA 2RCYA 2P9GA 5B37A 4BMVA 2FWMX 1I5RA 4DGSA 1LSJA 1VJTA 4BNJA 2IYPA 4XDZA 1HYGA 4L4RA 5CPBA 1W73A 4AJ1A 4EUFA 1EDOA 3DBHA 4FIZA 3RUCA 4RVGA 1XR3A 4EYEA 1UXIA 4JBHA 3RUIA 1K3TA 4W9NA 3GEDA 4D7AA 4ND2A 1K2WA 2P5YA 1U2DA 9LDTA 3V1YA 3M1AA 1ENOA 4Y98A 4WUVA 1NFQA 3D5TA 1WZEA 4ND4A 4B7UA 5T5QA 1SB8A 3TRIA 2CNBA 2RAFA 4IY1A 3BAZA 4CMBA 4DLLA 1R66A 4XRRA 5JDCA 1P9LA 4XJSA 5KVVA 4OHUA 1LC3A 3RC9A 2GZ1A 1TXGA 1I2CA 4E13A 2E48A 5A1TA 1C0KA 1KVUA 4GX1A 4OO3A 2YUTA 5ER6A 2X6TA 3H65A 2ZQYA 3DZFA 3X2FA 3SVTA 3GVPA 4BO7A 4AJ4A 2JFHA 4J7UA 2JCYA 3G79A 4BKOA 1UJMA 1NVGA 2PGDA 5H82A 3MTGA 3PLRA 4QX6A 3RBZA 4IZHA 3GZ4A 4BO6A 3DZHA 4H3VA 3ASUA 3K92A 4CMIB 3U9LA 3JQ9A 3TN7A 4DIOA 1T1SA 1XDWA 1AGNA 4YRDA 3O8QA 4IDEA 4CV3A 5DZSA 4ALIA 1KEVA 3F1LA 1IL0A 1JVBA 3C1AA 2YZ7A 5AXAA 4GAEA 2G17A 5J9GA 5K6AA 1RKXA 2DTDA 1Y6JA 3OETA 1XU9A 4G65A 3L4BA 4Q39A 3GH3A 4WLUA 4YAEA 5K6AC 3G1TA 2PV7A 1LC0A 1YJQA 4CODB 3ZV3A 1ZEMA 3K96A 3MWDB 5DP1A 2NU8A 3V2HA 2XXBA 4Z3KA 1M6WA 2JJYA 3KO8A 4ZA2A 3KYDA 4RLHA 1EVIA 4YRBA 3Q2IA 5JY6A 1BDBA 4B79A 3I6QA 3S55A 4IXWA 1JWAB 1NQTA 2BGMA 1T2CA 2GDZA 2JHFA 3SX2A 3IMFA 2F1KA 5JYFA 3EYWA 4E5NA 1KETA 4FJ2A 4W6ZA 3IS3A 4QECA 3D4NA 4J0FA 5G0UA 5IZCC 1G0NA 2NV6A 4PZCA 1CETA 5DP2A 4IS3A 1LLCA 1MP0A 3WNQA 1JKFA 4DUPA 1LQUA 1QYWA 3QSGA 2I66A 3HN2A 3EUWA 1VSUA 2X0RA 1Y8RB 1ZMOA 3WIEA 5KJEA 4PG4A 3VDQA 2ZKLA 3DXFA 2EF1A 2WM3A 1NAHA 1ZH8A 4MVJD 1B8PA 4PG8A 4I08A 1CYDA 3JQFA 4LVCA 4ITUA 3F4BA 5L51A 2DTXA 3MZ0A 2VZ0A 4H15A 4ZJUA 3RQSA 5KVSA 2AG5A 2Q1SA 4URFA 4BNHA 3BTVA 3JCZA 1KEWA 1C1DA 1X15A 2GSDA 1B0AA 2FRDA 3QJ5A 2FR0A 1Z6ZA 1LUAA 4IDBA 1X0VA 3U0BA 3ANMA 1U4OA 3FPLA 4J1NA 4E0BA 4BL5A 1DAPA 1A72A 3S1LA 5IDQA 3GT0A 4QT0A 4ZQFA 1TT7A 5CP8A 2I3AA 2Q99A 3VDRA 2RHRA 1SOWA 4JK3A 4D43A 2BGLA 4KUEA 1TA4A 3GAZA 1DC3A 5MGBA 5CAEA 3WGZA 3AM4A 1AHHA 1YQDA 3AM3A 2VWGA 4UUOA 2D8AA 3IL2A 4LRSB 3JQ7A 1BXKA 1NPTO 1NX6A 3D3WB 4BMNA 4ALJA 1DC5A 4KQXA 3HB5X 5AQ1A 3IAHA 1E3LA 2Q49A 1DC4A 3BMQB 3CZRA 1I2ZA 1EK6A 4TRJA 5EQFA 1ADBA 3QVOA 5CHEA 5U1PA 5KTKA 3V2UA 4O59O 1EVJA 3VOSA 3DFZA 1ARZA 4ALLA 1HDZA 4II3A 2O4UX 1QYCA 2VCYA 2AEMA 3GNQA 4J91A 1YKFA 2C20A 2JAPA 2HRZA 2HRBA 3AY6A 4IJUA 5T6BA 1W0CA 3JQBA 1E7YA 1MFPA 1NQ5A 3PQFA 2C82A 2YHIA 2DQ4A 3HFGA 3UCXA 1QLJA 2PKRA 1WZIA 4M49A 1B8VA 2JHGA 1ADFA 4UEOA 3OQ6A 1X1TA 3BMQA 3GR6A 1F0YA 4PG5A 3JYOA 4OOEA 4DL9A 1LSUA 4TRMA 4DQUA 3HG7A 3WYBA 4IJKA 1U5CA 1DLIA 3SLKA 3HN7A 1O95A 1QYVA 4IUYA 4PVDA 3C1TA 4FJ0A 4TRRA 4JBIA 5IDWA 3WWYA 3ZWBA 4EUEA 1VE9A 4IJVA 1NTOA 3C8MA 2FN7A 4L76A 4NDNE 3V1TC 5THQA 1QR6A 1F14A 1HKUA 3WLFA 4AJKA 2UAGA 3PWKA 1GUYA 3PK0A 1UXKA 2HDHA 4N54A 3ZW9A 3TPCA 3DHNA 1Q1NA 3FBGA 3HUDA 1QG6A 4KP7A 1KBZA 3NTQA 3UCEA 2X0JA 3L4BC 3TZCA 4YPOA 2Q3EA 4RVUA 4PZDA 3H2SA 2PWZA 4U0KA 3RAJA 3TFQA 4W9NC 2VHXA 1YQGA 3WGHA 3ANNA 2B36A 5I7FA 3FRJA 3ZHXA 1Y1PA 1WVGA 3CH6A 4CV0A 1CF2O 4CMHA 1H9BA 4OM8A 3L4SO 2ZYAA 1SMKA 3WTCA 5KVQA 1WW8A 4IMRA 3UHAA 5EMHA 1Z7BA 3GGOA 3QWBA 3JSAA 1T1RA 1XGKA 1K6XA 4HP8A 3UXYA 4E31A 4Z6KA 4Q3CA 1KY5A 1SZJG 2GGSA 2HAEA 2I76A 3NT4A 2DTEA 2FSSA 5BSFA 1QSGA 1WDLA 5TIIA 2VNSA 1IHYA 1CJCA 1ZEJA 1Y5MA 2Q50A 1U1IA 5JAQA 3QWHA 3P2YA 4KWHA 3DTYA 3UN1A 5IZCA 3OIGA 4QSMA 2J8ZA 2R6JA 4PVCA 4CM6A 2E49A 1NVMB 1TI7A 4U6SA 3ZV6A 4RL6A 5C3MA 1WDMA 4GH5A 4NJMA 1MX3A 1NP3A 3VHRA 1VL6A 3NDIA 3SBOA 5DF1A 4OXNA 3HDQA 1U7TA 1HYHA 3ULKA 4WLVA 4BNFA 4CM5A 2BELA 1WXDA 3RUAA 3BYZA 4MVJM 3LT2A 4IIUA 3BMOA 1YB5A 2NSDA 3RSHA 9LDBA 5DBGA 1Q7GA 3V5NA 3JQFC 4IM7A 4PGFA 3S8MA 4IQGA 4J1SA 5L7TA 3JQAD 3NDRA 4NK5A 2AXQA 5G4KA 4QO8A 4FC6A 1TLTA 4XGNA 4CQMD 4L4XA 5M6DA 4E21A 1EQUA 3OF2A 5F5LA 3WNVA 3WS7A 3PGJA 3SJ7A 3HDJA 3W4IA 1WPQA 1E92A 2EKPA 3I4FA 4R9RA 1ULUA 2B5WA 1PU2A 1VL0A 2ZQZA 3JQ8A 3DBLA 3KHUA 3M2PA 4CM3A 4K6CA 1IZ0A 2JD1A 2O50A 1V3VA 2NADA 3FN4A 1H2BA 1N92A 3SEFA 2VYVD 4MVJG 3IJRA 1YS4A 5ICSA 3I9OA 4FB5A 5DBFA 5I9MA 3L6OO 3BMCB 4BV8A 3IP3A 3ROPA 1MXFA 3ZWCA 1KVRA 4EJ6A 3HHPA 3PWZA 3ROKA 2GPTA 1MFZA 3ZWNA 4YR9A 2VHWA 5IXYA 1M6HA 4YJFA 1R4NB 4J1TA 3WQRA 1RM0A 5B4VA 1XHLA 1BWSA 1TVEA 5GZ1A 2B5VA 2O3RA 4GVXA 4UULA 4MJLA 1X7HA 1Z7EA 4GQAA 1BXGA 1D8AA 4O1MA 5A3JA 3AM5A 1JQBA 2C2YA 3BHMA 2IODA 5TT1A 5A9SB 4IS2A 2YV2A 1H2HA 5BNFA 4FGSA 3KSZO 4KQWA 1YBMA 1YRLA 2VWQA 1ZJYA 4F45A 3OIFA 3W4KA 4EITA 1EUZA 1M76A 4NH4A 4TMFA 3EW7A 2X58A 3R3JA 4UREA 4CMGA 3MOGA 3INRA 4YTEA 2ZCVA 4GSKA 1Q0QA 3KM0A 4YT4A 7ADHA 4BV9A 1IUKA 3GZNA 4I9HA 3H9JA 4P4LA 3HB4X 1E1LA 3HWRA 4YEDA 3PJEA 3TL3A 2I99A 2PGJA 1YWGO 1GCUA 4WKGA 1GL3A 2VTDA 2ET6A 2OXIA 2FZWA 2OL4A 2C7GA 3DDNA 3DBLB 1ISHA 1I0ZA 1F17A 2BFOA 5JMPA 1P31A 2YW9A 4WCFA 1A4IA 1E7QA 3RBXA 4GX0A 3VTZA 4EZBA 1R37A 4OIMA 3DZKA 1DOHA 2AW5A 1DIHA 4NU6A 3BTOA 2BF7A 4UVIA 1E7WA 3ICCA 4LN1A 4Q3AA 5DNAA 2VQ3A 2WDZA 3E1KA 4ESOA 4YT8A 4NK4A 3OM9A 2QHXA 4MPDA 4AJOA 1YDWA 2Q1WA 1GQYA 2PKQP 1KVQA 4ILKA 3CUKA 4RF4A 4EDFA 2DAPA 3U09A 2VYNA 3ZWAA 1R4NA 4U5QA 1NM5A 1YDEA 5F5NA 4H16A 3VH2A 1Q0LA 5BSGA 1I3KA 1GUFA 2W90A 4WASA 3LC1O 5IDYA 3RU7A 3Q0EA 3FNGA 3N74A 3WTBA 1VJ0A 4GBJA 3MJCA 1GFSA 5T57A 3OEWA 4MVJH 3X2EA 4J9VA 3ZHBA 1HE2A 2C5EA 4PLFA 1NQOA 1XLTA 1J49A 1ZVMA 3HFSA 4BO2A 1E6EA 3WSVA 1O8CA 1K6JA 1CEQA 3AI2A 4R5MA 1HF3A 5CEFA 4CQMA 4II2A 1PZGA 2HMWA 2ZJ0A 3JQ9C 5I9NA 2P91A 1C14A 2V65A 3G1UA 4XQCA 2O2SA 2AE2A 1C3VA 4HADA 3EMKA 3RIHA 5JPIA 3Q11A 3JD0A 3DOCA 4YT5A 3VZRA 3PJFA 4TVBA 1U8FO 2VT2A 3GG9A 4J2OA 3GN1A 4ZD6A 1LDYA 4E12A 3TF5A 3HQ4O 4OXKA 4XQEA 5G0VA 3INTA 1UZLA 4J90A 2B35A 4GGOA 4LMPA 4MP6A 3S2GA 4LCEA 7MDHA 1YH3A 1A27A 2PZLA 5AXDA 3W6ZA 1YL5A 2G82A 2OOSA 1C0IA 1GYRA 1S7CA 2XAAA 4FGWA 1C0LA 5TT0A 5TNXA 3NKLA 2ZB3A 5EN4A 4BO3A 4UUNA 4OQZA 4C4OA 2PD3A 3EDMA 1PGOA 2ZATA 4HKTA 2BLLA 5L9AA 2VRCD 3EVNA 2ZB7A 4PG6A 1D4FA 1FXSA 1T24A 4BNGA 1F8FA 3M6IA 5T8KC 5GY7A 1IPFA 4JJIA 3DZBA 3RI3A 4U0JA 3DTTA 2GERA 1LSSA 3HJAA 1IZ9A 3U5TA 2BFPA 4W7HA 3MWEB 4KMSA 1WNTA 2DPHA 2C5AA 3ROMA 1E0DA 4EEZA 4Q3DA 3EC7A 4Q3NA 4FCCA 5CDUA 3W8DA 1HDCA 3PHHA 5T73A 4GL4A 2UUPA 3GHYA 3WSWA 1UZMA 2YDXA 5TF4A 4D3FA 4M87A 4ZVVA 5TS3A 2GR9A 3LSYA 4D44A 4HX5A 1YL6A 1PJTA 4RPGA 4RVDA 2WD7B 1K5HA 1GU7A 4I1IA 1CQIA 4R68A 1HDGO 4DWVA 1HDRA 3AW9A 3A14A 3O26A 3H3JA 1E1MA 3F1KA 3L77A 4WE3A 3DAGA 5HA5A 3PHIA 4OSPA 2E4AA 2B0JA 3DEYX 3PJDA 2AMFA 4HUJA 4C7JA 4RPLA 3AY3A 3WXBA 5FI3A 2Y0EA 3C7DB 1DHRA 1XSEA 3QHAA 5K0ZA 2GD1O 2WEKA 4DLBA 2P5UA 5LDHA 4CMCA 3L9XA 3DC2A 3RUEA 1JTVA 4OJNA 2VZ9A 4FD3A 3QWFA 4CLXA 3QE3A 1GZ6A 2WD8A 1LLUA 1C1XA 4RV9A 2DUUA 2IRWA 4CLOA 1P33A 4E5PA 1V6AA 3F5QA 4IDFA 4ALMA 4XWYA 3OJLA 1XA0A 4I5GA 3PGXA 3PIIA 4A03A 2VHVA 4XZ3A 2X23A 3KXDA 2NVBA 3I4CA 3CMMA 3JQGA 4TZTA 2W98A 3UCFA 2I67A 3RKRA 4EGFA 3L07A 1AXEA 1PQWA 2D0IA 3R1IA 4BNXA 3RUFA 3U4HA 5COAA 1H5QA 4BO5A 3TZHA 1CWUA 2ZTVA 1AHIA 2CSUA 4FFMA 3VKUA 2LDXA 5BSHA 1O9BA 4L74A 2NTVA 3WX0A 1VPDA 4DA9A 4B8WA 5HBRA 1KC3A 1BSVA 3BA1A 4J7XA 1E77A 4W7IA 2PLAA 3GMDA 2W2KA 1A7AA 5DCYA 1LQTA 4ONEA 4BOYA 2A4KA 2Y0DA 1FDVA 2X9NA 1D1TA 5FF9A 4DC0A 3AI3A 1SAYA 1XWFA 4DYVA 4AJHA 4CM1A 3D3WA 3TWOA 4DPLA 4N5LA 3QIVA 4Z0TA 1IYZA 2AQ8A 4RVFA 4CM8A 3AUUA 3PPIA 3ST7A 3VTFA 4NHEA 3OJFA 1HEUA 4EJMA 4G81A 2HMUA 5C5IA 5FFFA 3AOEA 2C2XA 5B4UA 5ILOA 4AICA 4D3SA 4XKJA 3G17A 4OKNA 5L7YA 2FHSA 1OMOA 4EW6A 1HZZA 1MC5A 2YFHA 2R00C 3R6DA 4I9NA 3F6YA 1HE5A 3TNLA 1Y5RA 3TZ6A 3H9GA 1NFFA 2ZJ1A 5IZ4A 1PWXA 4CR8A 3ZGYA 2VUUA 4IXTA 4CLDA 2DKNA 3W8FA 4XEHA 4WCFC 3DB2A 1C1DB 2QYSA 4XR9A 1GY8A 1E1KA 4DIFA 5BQFA 1P0FA 4CM9D 4YJHB 1BMDA 2YYYA 3DAFA 2DU8A 4JBGA 2NVUA 4EI2A 1Z73A 2DLDA 4AL4A 5JSFA 4JIGA 4IZIA 2I5PO 3PRJA 3GUCA 3GA0A 3L9WA 3RJ9A 3FBTA 2VOEA 5A02A 1ID1A 3IIEA 4KZPA 3OJ0A 4C7KA 4R54A 2Y93A 4K26A 1IULA 1NNUA 2I65A 4D45A 3QRWA 4CLRA 1GUZA 3JTMA 3UF0A 3JQGB 1ZXLA 1GPJA 3ZWPA 4FPXA 1VRWA 3ZWOA 4BNIA 1T26A 4LCJA 1MUUA 3TOZA 2QRKA 2VNAA 2FOIA 3CTMA 2JCXA 4JLWA 2H1SA 3LLVA 4ZU3A 5C7OO 4IMPA 4OOFA 1NHGA 5JE8A 2UUOA 3MJ4A 3DR3A 1KVSA 4U7WA 3FCOA 1BXGB 4EBFA 2AA3A 1NFRA 1QYXA 1PS0A 3PDUA 1A5ZA 4O6VA 5B12A 5HWSA 3GVXA 2E37A 1YBAA 4MO2A 3PHLA 1ML3A 2OFPA 3CMCO 1ONNA 4PZEA 4FJ1A 2G0TA 4UVEA 1I32A 3OEYA 4AFNA 4NMHA 1YB1A 1E7MA 3QWAA 3GF4A 1PS9A 2FZEA 3TQHA 4QO7A 3ZNNA 2IYOA 5TSDA 2WSBA 4WCDA 1E5LA 5JCXA 4PLZA 3GGPA 3DONA 4YDRA 3QQPA 1E3WA 1PS8A 2VYVA 2AQHA 2QG4A 3OA2A 3PP8A 3U4DA 3VKVA 4XCVA 4EEXA 3RVDA 1N5DA 3N7UA 3UUWA 5KKCA 4AG3A 1HSOA 3OMLA 3FNEA 1LBEA 5AOVA 4TKMA 4LRTB 4Y6PA 1CERA 1VKOA 5TJHA 5BSEA 4F46A 1BGVA 1U9JA 4NBRA 3I9NA 4PLWA 5A5FA 2P4QA 3MJTA 5B4TA 4BGIA 1RJWA 4AJLA 2YDYA 4NFHA 3V8BA 3JQAA 2AQIA 4A73A 5KJ6A 4CMJA 4TSKA 2EP5A 4GX2A 1ADCA 2BMAA 2XXJA 3DWFA 5DT9A 3JYNA 3NRCA 1J0XO 1R6DA 2P4HX 4XRGA 1PJSA 3PFFA 5ICMA 4GWKA 5JO9A 2JKVA 1XEAA 2D4AA 3CPSA 2QW8A 2NQ8A 1BVUA 4A10A 2CY0A 3BHIA 4J2HA 5GZ3A 2X9VA 4P4GA 3RC7A 4WPGA 4Z0PA 2RBEA 2DFDA 3Q9NA 5JDCC 1UH5A 3PLNA 1DSSG 4IDAA 1OFGA 2FMUA 4WOJA 1UDAA 5FWNA 1P1HA 3H8VA 4QFDA 4YJGA 3NX4A 5TQVA 3TDKA 1I2BA 1L7EA 5CG1A 2Y99A 1AN9A 5A3VA 3K5PA 3AFMA 3SC6A 3WIDA 2NU6A 3LVFO 3NGLA 2H9IA 2ZB8A 3ZWYA 3P19A 1NPYA 4XGIA 2IZ0A 4R1SA 3HSKA 3QVTA 1P74A 2QIOA 2NWQA 1ZFNA 2H5LA 4M55A 5COQA 2LDBA 3S2FA 1HLDA 5JY1A 1A7KA 4FFPA 2HU2A 1ZNQO 1EK5A 1I24A 1PGNA 2DBRA 4O63O 4R51A 4IQ0A 1YOVA 1R0LA 3AOEC 3D3EA 3VPGA 1DIBA 4RDIA 1N7HA 4FN4A 3IUSA 3WYEA 3ZWXA 2GZ2A 2VYND 1E3WB 5F21A 1V35A 5EJ2A 3E18A 2CDBA 2B4QA 2Y1DA 4E6PA 1HXHA 2HK7A 3PDJA 5L4LA 1D1SA 1XG5A 2DT5A 1Q7CA 1OZAA 1NVTA 4F3YA 4J16A 5DBIA 5DCWA 4CUKA 4BKRA 4ZICA 1R4MA 3OSUA 3KLPX 4M86A 2YHIB 1LI4A 2IE0A 3LT4A 3UAGA 4CR7A 3P5SA 3MJEA 3SLGA 5IF3A 3MEQA 4R41A 1O94A 1YXMA 1I01A 4XX0A 4XYEA 4LGVA 3B20A 4IJWA 2X22A 1N1GA 2OGUA 2TMGA 2CDAA 1HETA 2NU9A 1PWZA 4OXYA 1I10A 4IINA 3KB6A 3GNTA 3EY4A 1RYDA 2Q4BA 4PLPA 3AWDA 2EIHA 1LU9A 1LLQA 2J5RA 1YB4A 3KV3O 4FFRA 4ZGWA 2YHUA 8ADHA 2AEJA 5AXBA 5JNLA 5G2OA 4KTVE 1DAOA 2IXAA 1N7GA 4E5MA 1HTBA 2J3IA 1GZ4A 5DOVA 3AUTA 1V3UA 5L45A 4BO9A 2HMSA 3ONDA 2Y0CA 2W2LD 1H93A 1PL7A 1LTHR 3GPIA 5A9SA 1DBVO 5TJ9A 5KJCA 2PFGA 3H3FA 4W99A 2PZJA 3QVWA 2ZTUA 2UDPA 1JDJA 4UVDA 4CQMB 3I83A 1NWCA 2R2GA 1PZFA 4IDCA 4XGKA 1K89A 2P2SA 4BNVA 2V6BA 1B8UA 4GLLA 4J9UE 4JQCA 4ZRMA 5F1KA 4BVAA 3TOXA 2B83A 3OJEA 2I9PA 4O0LA 4R4JA 3GDGA 2BFMA 4RPKA 3EHEA 4GLOA 4QUKA 4AJJA 5U4QA 5FI5A 3ZV4A 3VC7A 1XYGA 2DM6A 1NWHA 3STHA 1PZEA 3LU1A 4PLGA 1UP4A 1LA2A 4I5FA 5CPFA 1T25A 1GCOA 4QFCA 4B3HA 3AOGA 2ZYGA 1E6WA 3UOGA 2VZ8A 4BQRA 2JD2A 2W2LA 4EUHA 4MVJI 1DEHA 2FSVA 1SPXA 4J6FA 2X9GA 2HQ1A 5DCUA 2HKIA 5FYDA 1P1FA 2HJRA 4NR0A 1HDYA 1HT0A 2W8ZA 1DFHA 2GN6A 2D1YA 2UV8A 4NBTA 2YV1A 2ZTLA 4RPHA 4WLNA 2FP4A 1ISJA 1K6IA 2FPPA 5H83A 4NBVA 1NYTA 2V6MA 2NVUB 3RROA 2BI8A 3TZQA 3LF2A 2Y67A 4NJOA 4QTZA 3WDSA 4M8SA 5T67A 2EJVA 4L0QA 1F8GA 2X4GA 3GDOA 3PQEA 3U62A 4I5EA 4E4YA 2NUAA 5ER9A 1Y9EA 3IQDB 1V3TA 1HWYA 3DZIA 3OHSX 3WG9A 1DDOA 1P1RA 3ZZNA 3IOYA 1JAYA 1RYEA 3GC6A 5KIAA 3K2BA 2Q2VA 4KUGA 4S3MA 1PSDA 4CL3A 1DRVA 3ZU2A 1BG6A 4DLAA 1PZHA 2WMDA 1FF9A 1BW9A 3NT2A 4HFNA 4FOOA 4RVHA 5EINA 5KVCA 2EW8A 3K6JA 4XIJA 5KNLA 1Q2XA 2G76A 4WGGA 4QQRA 4JJFA 4MKRA 1YL7A 3OA0A 4ZRNA 5ENDA 2B4RO 6ADHA 4XYMA 4RJTA 4RQTA 2GO1A 1FK8A 5BR7A 3KYDB 1YONA 4NBWA 1PJ2A 1LDNA 1U3VA 3VVCA 4DQXA 5LCXA 4INAA 4RO0A 2HMTA 1E1NA 3H9EO 2VHZA 4IPTA 2QQ5A 4KWIA 1MG5A 4OL9A 2X8LA 3NEPX 4CLHA 3ZCXA 4N5NA 3K9QO 1DB3A 1PR9A 1B2LA 2QYTA 3E5MA 3GQVA 1KIFA 4J49A 4XYLA 1U28A 3LT0A 4NZ9A 3Q6IA 2WE7A 5CDSA 1L1FA 2WYWA 3P2OA 3JD4A 4Q3EA 1KERA 1PGJA 3ORFA 4XB1A 5BNIA 4B7CA 1V9LA 3FTPA 4D79A 2AEFA 3FI9A 3P7MA 1J5PA 4BMSA 3F5SA 1PL6A 5A5EA 1X7GA 5HRUA 4CUZA 4UUPA 3GG2A 3NUGA 1W6UA 2Y66A 3KVOA 4UUMA 3K31A 3BHJA 3UFXA 4BGEA 3E9QA 3OBBA 5K9ZA 2JCVA 4FS3A 3ZNOA 2EKLA 1UUFA 3BMNB 2B69A 1PQUA 2ILTA 3W8EA 1ZXBA 4NU5A 4XYBA 4FOSA 5EQDA 3WGGA 1F06A 3ZHYA 3HDYA 3QWIA 3O03A 4UVGA 2X5JO 3ABIA 2PD6A 3DOJA 4PLCA 4WOKA 2EJWA 3Q3CA 5JYEA 1QMGA 2V6GA 4IDDA 3WMWA 4BNZA 1PL8A 5DN9A 1ISMA 5ENVA 4IBOA 5EIOA 3WYCA 4E33A 1SC6A 1I8TA 5JW6A 3DHEA 3RBVA 6LDHA 4FR5A 4YWJA 4YJGB 3WOHA 2HJSA 1ADGA 1NAIA 3FR8A 1JKJA 2OORA 2EW2A 4LSMA 4RPJA 1IY8A 2A92A 5DULA 4RF5A 4PG7A 3D4PA 5IN4A 3HZZA 4YQYA 5JXWA 4R3WA 2QRLA 5JO0A 1KYQA 2IEDA 1NQAO 3PYMA 2J5KA 3O4RA 4FDAA 3WFIA 1KOLA 1H6AA 2FR8A 4CLOB 1PX0A 5JCJD 3INGA 3GLQA 1BVRA 3E6AA 1XELA 4KDEA 3WBBA 2EERA 4I5DA 4HV4A 5GMOA 2JFGA 4BNLA 2ZYDA 1PIWA 1T2EA 1P3DA 3JQAB 1UP7A 3O8QB 3KRTA 5L53A 1SNYA 4CMKA 2O48X 5I8WA 1EFKA 3I5MA 4E3ZA 1PJCA 1PJ3A 3FF4A 1NPDA 1QV7A 3OH8A
chains in the Genus database with same CATH superfamily
4KXFB 3TB4A 3NLLA 1CIVA 4I66A 2RCNA 4L4SA 2F43A 1GGKA 1VSBA 2COEA 3FGPA 4O02B 4RMHA 2PUHA 7REQA 4RK4A 1UDBA 1HDIA 2FQXA 2W4QA 2FUNB 2HRQA 4Q37A 1T4BA 1N0HA 3R5JA 5FYQA 4YAIA 2WAMA 4V24A 1PWYE 1QZ3A 1S02A 3E1SA 4MICA 3W8RA 1W35A 4HWSA 4RD1A 1MZPA 3NBFA 2QPTA 4K1XA 5KVAA 3O4IA 1K4YA 3CR7A 3I28A 3G8DA 4RENA 1C9YA 1EUCA 1QG0A 2JVKA 2Y77A 2E6UX 3K9LA 1K66A 1GPNA 4OQXA 1WWKA 1PG5A 2YCBA 3PQDA 1GILA 4TKLA 1OC2A 1N1EA 2RGWA 2WI8A 5ALUA 3VR5H 1PR3A 1UOEA 4PLTA 1ZDMA 3GLHA 5EMJA 5EJEA 3GZNB 2ZUDA 1E9RA 1ZBDA 4LW8A 1H2ZA 1JU4A 4NESA 4HRYA 3SK0A 3C5EA 2JJ1A 1E0KA 5H68A 4TZ0A 2J7PD 2JLZA 1HGXA 2FUEA 3FJOA 1W581 2IDMA 2XB4A 4IFIA 2QSUA 4CM8B 2X8AA 1V96A 2W2TA 1TJNA 2GK4A 4Y1RA 4OHPA 1VPTA 1GPDG 1CY0A 2ZJAA 5DWQA 3WL4A 1VB3A 3VDNB 4CM9A 2QZZA 1FS6A 1H0SA 4HWKA 1N0VC 2Q4RA 3B8HA 1XD2B 4AG6A 3GDFA 3TRFA 2VFAA 3ES9A 3L7AA 4XJTA 5EHNA 1N6OA 4G4SO 2FEWB 4M1MA 3B52X 4WXMA 2C77A 5IHPA 1I30A 3ELWA 1QH1B 2QJRA 1EP1B 4GT1A 5TE9A 1MABA 1KY2A 4Q4LA 4B3CA 1R6AA 3HSSA 4RM2A 2HR1A 1VI5A 1OILA 4RH1A 3ZHQA 4NPHA 4BKPA 1D3AA 1ZSNA 1EIZA 4F2HA 1N2CA 2ZQ5A 3L6BA 4LYFA 3ZWVA 4H08A 4N3CA 2IS4A 3GFSA 2WAYA 1XJWA 3KOOA 4FWBA 4U3JB 3ZNPA 4BCCA 5BV2P 1OFUA 1W5SA 1RPTA 3BMOB 4FLMA 2R87A 4WKNA 3TSCA 3V33A 4LE0A 3T7KA 4B82A 4MQ4A 3H2HA 2QTCA 2QRJA 1RWBA 3QH4A 1ODLA 4O2BF 4G5HA 5AW6A 5KMGA 4FHFA 4BQSA 3C14C 1AUQA 4FYXA 4LV6A 4UPVA 3ZWKA 3OECA 3R3SA 1C81A 3E23A 4ND5A 3W9UA 2X2PA 4YY3B 1GGVA 3JQ8B 3NGXA 1KYZA 1WRBA 4F1JA 1YZQA 1DIRA 4IGFA 4OGWA 4BKQA 4LI3X 2PUTA 5IAJA 1CCWA 1KJ8A 2I4LA 2JJ2D 2R6HA 1C9MA 1W75A 4QODA 5E9AA 3HBLA 3P5BA 4XASA 1XXHE 3GVIA 2J3KA 2QYOA 4U8HA 5G53C 3CUUA 5LA6B 3DMYA 2NUTA 3AG6A 3OFNA 4HQNA 1O96B 2ZUCA 3IPLA 1C1XB 2CNKA 1U2GA 4JHLA 4EDFA 4IGEA 1F8YA 2V7UA 5E8JA 2QRHA 2WP0A 2Z1MA 3GFVA 5D3KA 1VLLA 2DC1A 3H17A 3GFTA 2VJAA 1NOJA 5EAIA 1SHUX 1Z2NX 3GUUA 4GMFA 4R1TA 1B74A 2RC5A 1F12A 3GUHA 1WEKA 4X85A 2H2DA 4BAUA 2OCKA 3DPUA 2XCUA 4FDLA 4RTPA 2XTNA 2EKDA 1RADA 2ECOA 1TM3E 3BB4A 3NJRA 1A7JA 1AA9A 1ZJ6A 1PR1A 2XECA 4FGUA 4N5MA 2CXHA 4HWPA 1Z62A 4EFMA 2OV6A 5EJ4A 5KNCD 3K0SA 3CLSC 3N59A 4RJJA 3M9WA 2GPWA 2HA6A 3JX9A 1XQYA 1XOIA 2C98A 2ZSAA 4W5OA 2PN1A 1E6MA 1F20A 3I3SR 4LKOA 2A94A 3ABOB 2X40A 3MRTA 4JI7B 3EVDA 4H18A 4NNJA 4QZVA 1YGPA 5EIBD 1Z6XA 3IFSA 2FPIA 2JFUA 3HBNA 4Z3DA 2PRIA 4OHRA 4PPNA 2IYVA 4ZVNA 4G1EB 4UXJA 1VMAA 2WVHA 3VPFA 3ZLVA 2OFFA 2GAIA 3V1UA 2OPHA 1QYDA 2BJWA 4R84A 3VYWA 5ITWA 4RD2A 1I6MA 1LLDA 3RFXA 2CWDA 4GGPA 5IASA 2GSWA 1BZYA 2QTAA 1KPIA 3OX3A 4KN6A 5KPDA 3I3OA 4Q15A 1VJDA 1L7BA 4RELA 1G7RA 1WMAA 1YVEI 2ZI5A 4Z9XA 4TQGA 1W5AA 2VUHB 1M6VA 1HOXA 2FWNA 2ZRQA 3EP9B 1QFYA 1ISIA 3DQZA 1QIHA 2Z1NA 1GAEO 2ID8A 3CURA 4RY0A 3C3WA 3CVOA 2OD2A 4OCZA 1GPLA 3E8XA 4K46A 3G13A 5DI3A 3ORYA 3ZJUA 1PJAA 2IZZA 2V1XA 3LIIA 3WQSB 4ENPA 3JQEA 4AW9A 4OV6B 2GBFA 2FFAA 3CU5A 4BNMA 1NVUQ 1LBHA 4II7A 3E61A 4BFTA 5EZYA 2G9QA 3IUBA 4MW5A 4TWZA 1ECGA 4BPRA 3CX7A 1V25A 1VHLA 5A7FA 5LQNA 1OAOA 1E1RA 4QYIA 3ITDA 1BH6A 3NBQA 5CD9A 3G6KA 3URKA 3I0MA 3FH0A 3AI1A 3DBHB 1L4EA 3IKTA 4M0EA 3BD6A 1H69A 4C4RA 4OGLA 1QK4A 1XU7A 2Y1CA 1KJNA 1SOVA 4HOYA 1NR7A 2ECKA 2UZAA 3LBIA 4L5IA 1UBTS 3EIFA 5BMVF 2D0DA 4WLFA 4HAIA 2NLOA 3LH5A 2DFNA 4C4XA 4Q4JA 3RFTA 1Y81A 4FOPA 3L1VA 5SZJA 3S1SA 4RORA 3E8SA 2O5CA 3I9KA 2RD2A 1QP7A 3OOHA 2JFPA 4LJ4A 3GHHA 2YUIA 1ND5A 4OY3A 4IEEA 1O89A 2FW6A 5L40A 3HI4A 1PV4A 2YMQA 3LY9A 5I7WA 4M8IA 2IIVA 4JROA 3ZWQA 1E0AA 1N5JA 1OI7A 2WG1A 1E7RA 4Y1FA 5HG0A 5JFOA 8MHTA 1HRDA 3G6WA 3N58A 4NJMB 4RHEA 4IMJB 3RNOA 4R5HA 5DFAA 1EK1A 2OR3A 3WO1A 4JBYA 4CQLB 2CL0X 3FKSD 2OCLA 3IQWA 3RC2A 3KD3A 1DDGA 2XY4A 5ESDA 3IUQA 4N6OA 2GN9A 3KR1A 5G1PA 1L5GB 3RARA 5SZKB 5A1JA 3M4JA 1J97A 2JLUA 1LRJA 2QY6A 4FW8A 2FFHA 1T5TA 3ENWA 3NV9A 3V3TA 2DBQA 5E6RB 3UG7A 4F6CA 5J2UF 2G9VA 1PTJA 2K7ZA 4FVTA 4DBLE 1CUCA 1G2PA 1NLZA 4ZHSA 4EPVA 3CUWA 4LQCA 4MZXA 3DCNA 3PNYA 2Q0SA 5JI2E 2UYYA 3L1UA 4POOA 3EH2A 1RR6A 1G98A 3C74A 1WZNA 4G01B 5B3JC 3PEWA 3DMNA 1D6JA 3KFXA 4RF2A 1NGSA 4RZIA 2EVWX 2P6MA 3OQIA 4KR9A 4ZI3A 4MVCA 5C8YF 3AFNA 3RYIB 2O3TA 3T5GA 3SX0A 1RXCA 2AZMA 3NYWA 5GP1A 5T4EA 3VNQA 1I7SB 3WMXA 3VH1A 3LUKA 1IB6A 1OVMA 3NHLA 1SBNE 1TU0A 4JVSB 5D1HA 4HRVA 1EVQA 2X2FA 2KLBA 3BFJA 4JYPA 2XZTA 4OIFA 3HU1A 4F0JA 1X13A 4IL5A 1P0MA 3TKLA 2UVPA 4TTIA 4F6LA 4JDUA 1CFJA 3PIDA 2B4KA 4AY5A 1UZNA 1Q6YA 3U44A 2Q6KA 3BF7A 3I0NA 2NAPA 4Q9NA 3KSDO 3VMFA 1FMFA 4M9ZA 4AP9A 2IP1A 3HADA 5IDXA 4PM4A 2JAUA 3ENKA 5DO9A 4PZLA 1DAIA 4CNBA 3CLTD 4PTLA 4I4LA 4YJ2F 4B33A 2NU9B 1RBYA 3MT0A 1P2GA 2DLNA 2OBFA 1FSFA 3SJUA 4CL0A 2R85A 5LOVB 1RQPA 3QUSA 3VA7A 2EAUA 3H5AA 4FYJA 3U56A 3L4JA 3JQCA 4TROA 1YGYA 1UPAA 3LFUA 4EW1A 1NP6A 2EV9A 3R9WA 1N2SA 1NVEA 1U8AA 2ZTMA 4IMIB 3E5RA 3TR0A 3NP7A 1DTWB 1SULA 4C0LA 1RWXA 3CINA 1JKJB 3FWYA 1IAQA 1FDWA 1YASA 1GZ5A 1K2VN 1GPWB 2ZSHA 2O2IA 1XMVA 2R8PA 1N25A 3C7AA 3GA7A 5I8ZA 1L4BA 1A5BB 4LMRA 3BXEA 5LU8A 3F3YA 1ZZEA 3LPNA 3STXA 4KW7A 5LZ4A 1Z13A 4KIFA 5L3ZA 1JNYA 5ICEA 1QONA 1IPHA 1HZZC 3BE5A 2FRVA 3PC3A 4QPPA 4PFKA 4RKYA 4PC6A 1WB6A 1GL7A 3JALA 1H85A 1R74A 3BA6A 1G59A 1V7PC 2IIBA 4G97A 2L82A 3H05A 3HB1A 3L7MA 4PQEA 1S8FA 3BE8A 4RDHA 1T8UA 3TL2A 3C45A 1QNFA 1UK7A 1SCUA 2W9XA 4JNKA 3ZE1B 1XXLA 2PVPA 2DULA 1VHJA 3LZ6A 2NO9A 1ABFA 1K7CA 5D7NA 4QRDA 2ZB4A 2ZUWA 1R0ZA 3GN2A 3I8OA 1FZQA 3Q2KA 1CQWA 2ZIZA 5BNTA 3P2MA 1NU8A 4X66B 1YTLA 3PT5A 2D54A 2ZYTX 3MWLA 5H59A 4E2ZA 3DMTA 5HF5A 5T64A 4NZPA 1TEHA 1P5HA 3CLSD 3JWGA 4OGFA 4P0TA 3UKOA 5EXSA 4XLLA 4L2IA 5AWFC 3SWWA 2DFPA 1Y5NA 5IYZA 2HA0A 3BDVA 3IC5A 3NHJA 2Z6VA 5CFRA 1YQEA 3X1XA 2P8SA 2Q5LA 5FPTA 5CT9A 4LWQA 3HUFA 5PGMA 4C89A 1AT1A 2NSLA 3X1YA 1F0PA 1HEIA 221PA 2R5WA 3OCVA 5J4LA 4MRRA 1NF3A 4B3JA 3FMFA 4KXUA 4AO7A 1LPPA 1YZNA 2G6TA 4P4NA 1KAQA 3UMRA 3UOAB 4DBLC 3EVBA 3ONFA 1OU4A 2NQTA 2NTJA 5FTLA 5AHOA 1U2GC 5JZ9A 1G6OA 1UMKA 2ZRHA 2OE2A 3OUTA 2BSQA 4MYCA 3LLCA 2DSTA 1F7VA 2C8VA 1HZJA 5SY4A 4KGDA 2NSYA 2QM0A 3A1FA 3SC4A 4C0HA 4RULA 2VHTA 4FMBB 5DASA 4CN8A 2HPZA 4Q1AA 3IQFA 2HSZA 1VG9B 1WDTA 2XOEA 4KK3A 1J8YF 5BQXA 1NYQA 4EO9A 4JH0A 1ETUA 2X5KO 2BI7A 4YUVA 3Q3HA 5BPFA 5LPNA 1OE0A 4Z4EA 1T2AA 1JA9A 3ADDA 4V2IA 3GPLA 2HPHA 3E03A 4HMOA 1O6ZA 1QWSA 2WU0A 3KPUA 4QFMA 1LTQA 4IFBA 4XFDA 5AKXA 5HK8A 2UUAB 4TWAA 4C88A 2Y68A 5IM5A 3BXOA 2I0FA 5AMXA 4A23A 2DETA 3Q85A 4RD0A 2PX6A 2IXEA 1BWQA 3JD2A 4KIUA 1LI7A 4PEVA 1OBCA 2G7ZA 2PH3A 1H4TA 4RIHA 2OMEA 2KMLA 1U5BA 1SKMA 3STYA 3HZRA 3RABA 3KOUA 3LA6A 1Q7BA 4KRFA 1VQ1A 1QP4A 3R7BA 1DAKA 4O4HF 1XRJA 3WE7A 3F8TA 1WCV1 4KJZA 5BYBA 1OHHA 3VM6A 5I9LA 3ENNA 4YAGA 3VAYA 2BE7A 2DUMA 3GFBA 4WEOA 4X61A 2GWHA 3OOYA 2JIZD 3KYIB 4TRNA 3VNRA 2PL5A 4RBNA 1DFIA 5I3CA 3FKQA 4EO4A 1SM4A 3BHNA 3PZRA 4XYGA 2AOXA 3AU9A 4J0DA 5JMOA 5HRAA 2IBTA 3B6ZA 2YJTD 3RVJA 4ZYXA 2OESA 1JB9A 2BMEA 4JXKA 4B4VA 3F6BX 2FX3A 5FOTA 4C07A 2VJMA 4I9UA 2PL9A 1H1LB 1VSQA 1C2YA 5FBVB 3E15A 3HYNA 4HI0E 1JDTA 3F6PA 1FTGA 3HVHA 2WD7A 4PBRA 4RCVA 2ONJA 3UV7A 1PFVA 4Y7DA 2N46A 2XXAB 2C58A 4B6GA 3B5JA 1MIOA 2Q2QA 1IEWA 2PO7A 3BIWA 4F9GA 1M8KA 3JAMA 5BSMA 1YO6A 7AT1A 1X7DA 3FTNA 1B41A 2I6QA 4RTSA 2R86A 1R8YA 2ZWVA 1AU9A 1KOJA 3RD5A 2GO7A 5HIJA 3CJRA 2Q9AA 4MGYR 4QXAA 3EIEA 3R5KA 4OH1A 3ZHSA 4CV1A 5K0SA 2Y1LA 4E70A 3CX8A 4ALNA 2MCFA 1ECFA 3PB3A 2I54A 4FEAA 4I19A 1NDHA 1CUGA 5K0LA 3OQPA 4OI4A 3TQCA 5IRCD 3A7DA 4XARA 3TH5A 1KS9A 3E3MA 2Y6VA 3TEJA 5EE5B 5KOIA 3VPHA 4F1KA 1O5OA 1NZDA 2DFVA 2Q4TA 5FI1B 3GY0A 4ZZIA 4GP9A 4CU5A 5KINB 1P1CA 2IXBA 1JG4A 3R41A 2BEUA 3U3XA 3RG2A 4OHBA 4F7DA 3I2FA 2N9UA 1GTVA 2B8NA 1RACA 2R7MA 1P77A 2PJUA 4KN9S 3B1KA 3HCCA 3QG1A 3KQHA 2AG1A 4B3FX 4MKXA 2F00A 2QD1A 2QZ4A 1T3SA 3PI6A 1BE8A 2HCTA 3C24A 3B7WA 5LZ9A 2XF8A 1JXOA 3SIWA 2O5VA 5HGJA 3DOUA 1SURA 3UT6A 2VAXA 4X7RA 5FPSA 3ROGA 2F48A 3WJ7A 1UXOA 2I6FA 3LSTA 2GCGA 1OOEA 1R4MB 1T8WA 3A2LA 4HY3A 4MUJA 4U4AA 4L8YA 4XPIA 5AYVA 2PDAA 2WFLB 3GD5A 3HLYA 1XZLA 4U7GA 1GWNA 4XM1A 5AXCA 3PQ3A 3OZEA 4DSZA 5IF9A 2ID4A 4DCOA 3LIPA 1U1EA 2QUZA 4GO1A 1HL7A 5JOQA 5JJKA 2QT0A 1JT2A 4P3PA 3U4IA 2QN9A 1YA6A 1ETHA 2XF2A 3B6JA 3JQRA 2C9ZA 3GLIA 1CEXA 3M49A 4ZZ0A 1PBNA 1B3BA 3I6IA 4J16C 5F2NA 1EE1A 4PRLA 3UAOA 1ZI8A 1NOKA 3GAFA 3UJ8A 3KSAC 2WABA 3I92A 5K5EA 5LQRA 4O08A 5FUVA 1YFJA 2HM7A 5EG5A 5BN4B 2JCBA 1TGYA 1GA6A 3U3ZA 3W3AD 4X94A 3ZCVA 3BBPA 2AVDA 1P9NA 2HMVA 1FYXA 3FRIA 2GLXA 3IMKA 2P0EA 3QNWA 4RAOA 4DHWA 4QL3A 5BQ3A 4JR0A 3H19A 3JW8A 2I1WA 1UFQA 5AT1A 1J09A 2L19A 3JR7A 3B70A 2UVPB 2C1XA 2VKTA 4NG5A 2MWMA 2A35A 4RM3A 3RIXA 1E2LA 1F2UB 2G8LA 3UB2A 4V0MA 3QJGA 4J4BA 3OMWA 1LB1B 4L8VA 1ZHHA 2LD4A 3HCBA 4B32A 5LP6A 4CEJB 3EUEA 3HXLA 2XDQB 2GZ3A 3UJAA 3ZBUA 4EL0A 5IK2D 3NHYA 1SB9A 5FI0B 2FU5C 3X43A 5HOQA 3H5WA 4R01A 1O6GA 4Q3OA 1EQAA 3L1KA 2FGKA 2QP4A 4BFLA 1SD2A 2H63A 2BR4A 4FBLA 4IHJB 3BTUA 4KE7A 4B3IA 4QXOA 1Y3BE 2N75A 3QMVA 3B82A 1VCIA 4YI5A 1H6BA 4XQ9A 1WHSB 3NASA 4XIGS 3WLLA 2QAGA 3A10A 3OUUA 4R8LA 4G26A 1YBVA 3ZC3A 4GM4A 5MN6A 5K09A 3CH7A 4K86A 2GPNA 3ZHVA 3T3MB 4A5OA 1PJBA 1S7GA 2IYEA 1UAGA 3DWIA 3FVWA 2Y05A 2Y1EA 2ZJBA 3O8RA 3RS8A 5AI6A 2WTNA 1CY1A 1GV0A 1JEEA 1Q17A 1M67A 1JGTA 2GEKA 2PLNA 3YASA 2DQYA 2WJWA 5HW0A 4JUCA 2MINB 1SBTA 1DADA 1WMSA 4MS3B 4PCAA 5DBHX 2WD9A 1D7OA 4E32A 3K6KA 2Y1FA 2QZJA 1FXWF 3BQ9A 2E4VA 5IT9A 4V3CA 1WHTB 2W2OA 4N8EA 3FVQA 3R6WA 1TUEA 1Z37A 4IDGA 5TPWA 1WO8A 4BFUA 1EIWA 3SXPA 5B2FA 1W2WB 1H2EA 1E8MA 5CMLA 1RAHA 2DPXA 3O9VA 4QHSA 3U31A 5KYXA 1UDRA 5CNJA 3TIGA 3R0IA 1Z9BA 2SCUA 2CB9A 3H1FA 1FDTA 5TF0A 4CUJA 4FINA 1ZCBA 1D8TA 5JAIA 3SYLA 1XC7A 4J4TA 4MW1A 4QJIA 3S2EA 1XQ9A 2OECA 4A2CA 5KJ1A 1E2DA 2Z1DA 3A6FA 4D0NA 3MJSA 3OWHA 1HLFA 2R44A 3HJBA 3R09A 4MR7A 1B0UA 3SOZA 1LBQA 3JARB 3OBIA 1QQ6A 3IUPA 4WFQA 4WIAA 2IX3A 1YA8A 2IGBA 3VSDA 2O8EA 3RV4A 3WDKA 3AG5A 5J23A 3T3NA 2DECA 1R12A 4X9XA 3B48A 4FNOA 1EHYA 4PIVA 3G2QA 3H86A 1MAVA 5HK9A 3VH3A 3VR1A 2H2FA 4R69A 1SQ5A 2FLKA 4Y0AA 1I1OA 5JBNA 3F8WA 3ETCA 2BTQB 2R79A 4ZHQB 4X84A 2XNKA 1B93A 4L75A 4X6YA 2FA9A 3L0BA 2V98A 4I1OA 5AVTA 4BFWA 3BFVA 3BDAA 2EHDA 3C3AA 2QMQA 2PZGA 2ZT8A 3AEKB 1DJLA 4RTOA 1SG6A 1YB6A 4ENQA 4RHCA 4NE7A 3QSYA 5DWVA 1XQ6A 2NW6A 1J90A 2IU6A 4OUDA 2CDCA 2GCIA 3AR2A 3VOAA 1QFXA 1KIMA 1W9HA 2EGGA 1DV1A 1VI2A 4L9AA 2HJ9A 4EJ0A 5IULC 3MLAA 4QXQA 4E1VA 1OFTA 4J76A 2AX4A 2CGEA 4FFWA 3T0FA 3IULA 4ZN6A 4UCQA 5MDHA 1Z8DA 2H00A 1CZUA 5I7AA 2AR9A 5LA6F 4N49A 4MDHA 4R16A 3RFUA 3ENVA 3PNPA 5AJWA 4IR7A 4AS1A 5LDGA 1IONA 2I3GA 5JNVA 5AVXA 4CIXA 4WXPA 4HDKA 5BW5A 2PE5A 1PJQA 1DWOA 1Q0HA 1HLPA 2L2QA 5A05A 1FDOA 1MLDA 1TUIA 1G38A 4B3RB 5IT5A 1AKMA 3L06A 5JHGB 4N01A 1MO6A 4AUMA 3L6DA 5KWJA 1VLJA 1VLZA 5CXSA 1CUSA 4KKXB 1G20A 4LZWA 4ZVRA 2YN2A 5KTMA 5BUQA 2IY7A 5K0EA 1QOPB 4XQ0A 2C88A 5E9JA 2J87A 1QNLA 1EI9A 3C8ZA 3PXCX 1VYUA 2O3JA 4AX8A 4MINA 5CEJA 2E4WA 1CJMA 1UP6A 5G41A 1EX6A 3GB9A 5E1BA 1P6UA 1QORA 1VHWA 2A8YA 4EM6A 3UT5B 3ZDBA 4WBXC 4Y9SA 3GBSA 2OCDA 3FSGA 5LQUA 1UBRS 4ZAZA 4FZRA 4YBZA 5FCDA 2PT7A 4KLCA 3USCS 1T1EA 2TMDA 3EMBA 3I1JA 4BAGA 4PINA 5SZHB 1NU6A 2JIMA 3IAM6 5KNDH 2BHLA 5T7BA 3H1PA 3R44A 3NW9A 4FKBA 4WZ6A 1T6XA 1L7RA 3NJ8A 1W8DA 4RWEA 5KYKA 1ZM3A 5CDYA 4C4PA 4FSXA 1UIRA 1W5TA 4PHGA 1OXMA 3QXCA 2H1FA 4QPCA 4QKQA 2RKBA 5A9TA 1E3JA 2J6IA 3I9JA 4S0ZA 3HHEA 3R7FA 3NT5A 4Y2GA 3U44B 3G9TA 3GFFA 3PUIA 1LW6E 2GRAA 3PNBA 3NGMA 1T15A 2JEZA 3BGOS 2WTBA 3AGQA 1ZJJA 5AVJA 1R1DA 3UVEA 1XDBA 3QEMA 2Z2KA 1LNQA 3UG6A 1AV7A 1QANA 3LCMA 4KUHA 2WF7A 4A9AA 4F86A 1K8RA 2A84A 4C21A 2CXTA 2EKQA 2YXPX 3D1LA 1G8AA 1GFZA 2J5XA 5A03A 1W0KA 4I99A 1KQ3A 4UBNA 1S6YA 4G24A 4DCUA 3CUYA 4GF5A 4NIMA 3TLBA 3HCFA 3KWMA 3ABRB 2X14A 4N18A 3KOYA 3ORHA 4ITVA 4DRZA 4LK3A 4MARA 1NDUA 4LZPA 421PA 3HR8A 4G0OA 1QFMA 2GCOB 4U39A 3ZTTA 4MJ3A 4B9AA 4XSHA 2A4MA 3MCUA 2G7MC 2J9GA 3AY0A 3GLTA 4BUCA 3OPXA 5C35A 5AJVB 1XCOA 3SU8A 1T91A 2XWQA 1J25A 1I72B 4NBNA 4MRAA 3W6PA 3L8MA 3VR4H 3BOSA 3K15A 4P80A 3E2IA 1EBUA 3ANSA 5CFMA 3MUEA 3SZRA 3LV8A 4YAUA 1E6CA 3U61B 2V7WA 2BFEB 3WHKA 1OH8A 5EUBA 3H9QA 4HATA 2IU4A 3VJRA 1BFDA 4J7CA 4RXTA 4AQYB 2FVYA 1H9AA 1FL9A 2EP7A 1ZU5A 2C0PA 2P77A 4DE5A 5FBZA 3NYIA 2GYVA 4FYKA 4QC2A 4G8DA 1Z0ZA 1GPBA 1VBKA 4D74A 1LPBB 2RGUA 3A32A 5TPZA 4K6HA 4PAOA 4TYNA 3VZCA 5A04A 1KSHA 2X7XA 1ZH0A 1FNNA 2Q8NA 3IQGX 4PN7A 2IV7A 3TNFA 3N87A 4URUR 1XVAA 1K4KA 3K32A 3TQRA 2ZCUA 1JJ7A 1ZHFA 2ZJ5A 1OFUX 4MRMB 2OO5A 4P35A 2V6FA 1HG1A 1JVSA 2P9QA 4A16A 1JSRA 1TC2A 3BXXA 3CYFA 3KUCA 3LT5A 4KFCA 3DKVA 1JYFA 1MV8A 2R60A 3EGEA 1JW9B 3HLKA 4KI7A 5AW9A 2JL1A 2PLFA 1P5JA 3K0CC 3PVZA 2J59A 3S70A 3T7DA 5JNUA 1BDJA 4B7XA 3PXXA 1JECA 3GMSA 4DMLA 2AHOA 4RK1A 5TEWA 1VHTA 1G6KA 1N6NA 1W85B 3K5HA 3FPSA 2IEGA 3CSDA 3ZWWA 1JX6A 2B8EA 2Q5IA 3MQ4A 3DE5X 2FWMX 3L7BA 3VHXA 3H11A 5BQOA 4DGSA 3ZY3A 2W7TA 3CF2A 4LOIA 4I50F 3ESBA 4L4RA 2D5BA 4AJ1A 4PWYA 3VNAA 2K5UA 1TK2A 2AC7A 4BASA 4M8NE 3RUCA 4LNUA 4Q93A 3ROZA 1LS1A 4PZYA 2ZE6A 3DFMA 1UXIA 2PWAA 5DLEA 4U2BA 3TUJC 4RACA 5GTDA 1NIPA 3GEDA 1XAIA 1MAAA 2H9YA 2XNCA 1SUAA 4ND2A 5AI8A 4AKSA 3ABQB 3M1AA 5BVGB 4JYAB 1ENOA 2CFOA 1U8UA 1NFQA 1REQB 1K92A 1WZEA 4H35A 3W1WA 1SB8A 3EQZA 3UWSA 2RAFA 2Y2UA 3MM4A 3BAZA 3VMMA 4CMBA 2V55B 5C2JB 1R66A 2VHJA 2ID9A 4HO1X 2IS6A 2A86A 5KNBD 1D07A 5K4HA 4TQAA 4XRRA 5JDCA 2V7XA 2PT6A 3SHOA 5KVVA 2ZI6A 3IAS6 2ZM6B 3RC9A 2GZ1A 1TTQB 2V3CC 2ZYRA 2E48A 5JJBA 3PD1A 5DH9A 4LJ9A 3TLMA 5A3SA 3V1MA 4AXBA 2ZQYA 3WGUA 3X2FA 1CUYA 3GGCA 2FX2A 2SCUB 2XYQA 2PVCA 4G67A 3KR9A 5EMMA 4WN9A 5GIOE 2RGXA 4NU8X 4AJ4A 1XVLA 4J7UA 4N9WA 4UD6A 3NFRA 5A5GA 3KL2A 5DKFA 5CLFA 4TUYA 4IZHA 3GZ4A 2W37A 4MB2A 4BN4A 5A4JA 4L28A 3H0VB 3X1WA 4H3VA 1CR2A 1JILA 3K92A 3PNVA 4IRUB 3JQ9A 3Q4GA 4JEUA 1X1AA 3GAAA 1M8PA 3R8FA 4BIMA 3NOVA 4AY6A 4IDEA 1VOTA 4JQYA 4O5AA 1RZVA 2JJ8A 4GPTA 1P5RA 2IKQA 2QLLA 3KKEA 4UE3S 1IL0A 1ECCA 1E1YA 4Z2YA 4BJ6A 3C1AA 3HRIA 1SCIA 4YCJA 5AXAA 1O0BA 3HFRA 4GAEA 2HNAA 4M2LA 2ZWIA 2DTDA 1VBFA 3DMGA 3GZJA 1Y6JA 3RRNA 1XU9A 3DV2A 3BGSA 3L4BA 3NEAA 5G3ZA 3AVTA 1TX4B 2QT1A 3IE0A 4YAEA 4JI0B 1WSBA 4WOPA 1GDTA 5HIKA 1YJQA 3EFHA 3SQWA 1QAQA 3FA2A 1ZEMA 2IIPA 3MWDB 3ZEAA 5FV7A 4EJFA 2OZLB 3KO8A 1KI7A 4RLHA 2AN9A 2Z5FA 1P4AA 1KYIA 5HF6A 1HT3A 2IP4A 4C22A 4DR4B 1SU6A 5H3CA 3VXKA 5CM8B 1VXRA 1W0JA 1F5SA 3ZLBA 1JWAB 1X19A 3L7NA 4GG1A 4TL6A 3IHLA 4QG7A 2ZJOA 1IVYA 3HWWA 3QFSA 3W1EA 4BB0A 3NAMA 5JYFA 1LNSA 1NZFA 4DAOA 1KETA 4FJ2A 4KEAA 3AGPA 3IS3A 5B3AA 3GDHA 3BJIC 5C1PA 3UBTA 3D4NA 4B76A 4M1YA 1OZHA 2ZETA 4NATA 4LSGA 3H7IA 2NV6A 4YHHB 1QO0A 2PBFA 2E55A 3S2ZA 4Q24A 2CB0A 1SK9A 1MP0A 4DUPA 1E3TA 1LQUA 1YBHA 3FUTA 5ICGA 3A05A 5EVJA 4OFWA 3V97A 4A8JC 1WETA 1UQTA 3HN2A 4KZKA 3PDIA 3EUWA 4GNRA 1WXFA 2Q41A 1ZMOA 4AS3A 4DGQA 5A4MS 3IURA 5KJEA 3CGGA 3GLFA 4IV0A 2O2ZA 4QARA 3L6RA 3VDQA 1JL3A 1SRRA 4C0XA 4ARZB 2WM3A 5BURA 2VPQA 4KPYA 1R5BA 4PG8A 4I08A 1XWIA 2ZS9A 3VC1A 1EFUA 2QTFA 3F4BA 5L51A 1WCXA 1NC3A 3BKXA 4LTMA 1S96A 3N70A 3MZ0A 3C48A 2HEIA 3RSFA 5KVSA 1I6LA 2YHBA 2GEVA 4TMXA 1PT9A 1X15A 1C1DA 1KFJB 3QJ5A 3MMXA 1P80A 2B98A 5EHZA 5KOJB 3CVXA 5J2TA 1SQGA 3QLTA 3OO0A 4EMUA 5FWXB 2AWNA 3D31A 4V1CA 2OGSA 4MWCA 2CL5A 2MU1A 4CEHA 5IANA 3CT4A 3QU5A 2B21A 1AQYA 3E9EA 4BL5A 3V7YA 1DAPA 2P40A 1Q50A 3GT0A 2WJYA 1WZCA 4QT0A 1EA7A 1OGYA 4D9MA 4Y2VA 1J2UA 2PMWB 2IOFA 3KTOA 5EWMB 3S1AA 1EGAA 1QHSA 3VR6D 3WK8A 1QOQB 2ZSBA 4BLUA 2DEUA 1VIDA 2ZRDA 2CWWA 1SQ0A 1RWNA 2BZSA 4BCBA 1JG3A 3A4TA 2CV0A 1OVGA 2BCJQ 2IYYA 1KYTA 2VUIB 1IJKA 3L8DA 1JE1A 2BFFA 4KRXA 4TMTA 3GAZA 5HKLA 3ZPXA 3FWKA 4K9SA 4BCDA 3IO5A 2XZPA 1ZNYA 2XKBA 4F93B 2E2WA 3PGMA 3AQ4A 3AM4A 3MJRA 5C0OE 1AHHA 2H29A 4UUOA 2VWGA 1QB7A 2CLDX 2D8AA 1I1HA 1E3QA 1ZMXA 2JGDA 4LRQA 1U1GA 5FUBA 3BGDA 1DG3A 2WKRA 3L43A 3SYKA 4GIBA 2B34A 3D3WB 4NCHA 3DGFC 3LHIA 1ZP6A 3FMPB 2BKLA 3TUTA 5DSZA 3V4PB 4ALJA 4BMNA 2CJYA 2GPAA 2RB4A 1B8OA 1ZIYA 4KQXA 3IAHA 1EFVB 4UTVA 1T5BA 4AZSA 2QL6A 2Q49A 1Z3CA 3E9RA 4J3NA 4ENRA 1I2ZA 2ZYVX 3U7EB 4OQFA 1TCUA 4ZVQA 3N0VA 3KZNA 3PR2B 2GVZC 2ZT7A 1EVJA 1CULC 4OAPA 3IP7A 3NOOA 3EXFB 4II3A 2P8JA 3QW4B 2IT1A 4ZVUA 4OHYA 1QYCA 2EBFX 2AEMA 2OBMA 1SVMA 3GNQA 1T4CA 3IYLW 4HDMA 1MEEA 2IX9A 2HRBA 4IJUA 4N6NA 4PIMA 5T6BA 4XX1A 4C4ZA 2V1UA 1MFPA 4DLPA 5I9SA 2ZVJA 3QKSB 2OAQ1 3MLEA 2DQ4A 2Q5OA 2I8CA 1FNMA 3PSHA 2QQGA 4JB3A 4A6PA 8ATCA 1WZIA 1S2NA 4QOIA 1XLWA 3CRZA 1ADFA 4G3XA 5ILQA 2A6PA 3H4TA 5LLSA 4G0ZA 4PX2A 1HTTA 2OO5C 3Q3VA 5LR6A 4UNPA 4A1OA 3HKCB 3Q3GE 4JVLA 1CR1A 3O91A 1G6HA 4RVNA 4FFBA 2YJ4A 1ZNXA 1RBZA 2XX3A 2Q0HA 4DQUA 3HG7A 1XTPA 4Q1EA 5GJBA 4QGSA 1MX1A 1T0JB 1O95A 1K7YA 1K5DA 3B85A 3BICA 4HQOA 5AHWA 4J0IA 4AKHA 1Q84A 2VBGA 3BILA 3N39C 3X1DA 1KS2A 2C2MA 5KSZA 1IBKB 2ZBFA 3ZWBA 4MMYB 3T94A 1VE9A 4EUEA 2FW7A 4NICA 1SOMA 1NTOA 2ZKIA 3C8MA 5AW3A 2XKAA 5ITZB 2HIHA 2VAWA 2VHCA 1EXVA 1F14A 1HKUA 2XITA 2XQFA 4D8UA 3TTTA 5AW4A 5M04A 2WRZA 3AP1A 4LJAA 4N54A 2IUUA 3HUDA 3KT8A 5K0FA 4KWCA 3NTQA 2IC5A 4FT4A 1CJUC 1JJBA 1RC0A 3FTCA 2P6UA 2FMHA 1P81A 3C3PA 1KAEA 1Z2DA 4PGGA 3CVJA 2P6NA 3WGHA 3ANNA 2B36A 2GN1A 2ECFA 3TEFA 3VR3A 4CBVA 1KMNA 4P33A 5BMOA 5BUZA 1SR8A 3CH6A 1CF2O 5F3DA 1Z35A 1BEUB 5CR9A 4MZDA 4OM8A 4DEXA 4O25A 1V26A 3R4VA 1SMKA 4MLCA 1EUYA 5D3ZA 2YINC 5KVQA 1JPVA 4IMRA 4M1EA 3UHAA 1QPGA 3WTCA 5AOAA 1T1RA 1MW9X 1REQA 1XGKA 4HP8A 2XUPA 4E31A 4Z6KA 1TW2A 3F2VA 4AZ0B 1YMUA 2XYHA 2Z9CA 2OHOA 2ZJ7A 3AO0B 4GSYA 4OG2A 5D84A 4ZALA 4F2DA 5JCPA 1WDLA 3OO1A 2P62A 4IZOA 4YCSA 1IHYA 2VTVA 2Q50A 3RSQA 3U3DA 2G4VA 2O5RA 5C1BA 4JQZA 3ER9A 3QWHA 5C7YA 2KSQA 4EMBA 2JATA 4DJTA 3EVZA 3GMTA 1BQEA 3L49A 3DTYA 4ZWNA 4WAUA 3A6ZA 5E0OA 1MJ5A 2EFEB 2R6JA 2YXLA 4FN5A 4L51A 5KREA 1HV8A 4AP6A 3EVCA 1NVMB 5EP3A 5CA1F 3BH6A 3NNNA 2CMHA 2H17A 2WHPA 5TVGA 3ZV6A 2AEEA 4YP5A 5EKUA 3SZMA 2L69A 4GH5A 3GJRA 2WAAA 4GDMA 4NJMA 1PVVA 1W85A 3LHKA 5FPPA 3WLPA 1UEXC 4QREA 4K40A 3HDQA 1GTZA 2F2TA 3T7RA 2ZBGA 3AHCA 4KVFA 2WU4A 3ULKA 2NQ2C 4WLVA 3KJEA 4FGZA 1IN4A 4HNRA 3HCEA 5IAKA 3L84A 4OKSA 4MVJM 2QRUA 4AYXA 2VQDA 1RQLA 4TQ9A 1Q7GA 3BEDA 2GM5A 1BROA 3S8MA 4J1SA 4KX5A 4BJHB 2VJBA 4ENUA 1K8XB 1W46A 2YYAA 2ZIFA 3Q40A 4M60A 4CIYA 1IHPA 2O8BA 1ZWLA 1TLTA 3KVRA 3KSBC 2GUWA 1CP3A 4L4XA 3N0TA 4E21A 3EF3A 3OF2A 4P93A 1P2TA 2WM8A 2XXAA 2QRQA 2V5VA 4H2DA 5GONA 2ZSDA 2OLJA 4NYJR 3IO3A 4RY8A 3SAJA 3W4IA 4D81A 1SXJB 1IUNA 1XN1A 2JKYA 1B6RA 4QTUB 2XWPA 4R9RA 3ZX5A 2A1UA 3QPAA 4C0QC 2B5WA 4I5IA 3W5SA 4TQUS 2ZUSA 3QZUA 3BGIA 5K0BA 1QGZA 4WDQA 2XB2A 3EZFA 1G5HA 2X3YA 2ZITA 3OX2A 4JXJA 5IPFA 1ODCA 4C87A 4EFNA 5I7UA 2J41A 5I9MA 4P36A 1OAOC 3BMCB 4EMSA 3G2IA 4EJ6A 2IYNA 3EULA 1XFAA 1FTSA 2GPTA 1MFZA 1XEWX 3CO5A 4LI0A 5IXYA 3D7NA 4ZVKA 4ZKEA 4DV7B 4IXDA 4J1TA 1SU7A 1RM0A 4G07A 3H1AA 4A8JA 3ITEA 4GRDA 1KJIA 3KTAA 2CXQA 3HYCA 1Y3IA 1SWVA 2MYPA 3ZDYB 1OB5A 2B5VA 2I34A 3RTEA 4U7TB 1GQSA 5KEIA 3CPHA 1X7HA 2V4MA 4O1MA 3EP5B 3DJFA 2C3UA 1O7JA 2ZAMA 4JYZA 4AWBA 1CUIA 2IODA 4G56A 1B76A 1VZ2A 2I2WA 2ILVA 3ZGNA 3GLFB 4O4IF 3PHCA 5BXYA 2VWQA 4I4TF 3NVKI 4F45A 1CUEA 3O2JA 4M6WB 1KOGA 4XUDA 2QSJA 3JZIA 2PUJA 1QQ7A 3DKRA 3V1NA 3R76A 1M76A 2XE7A 1SIUA 4NH4A 2OBBA 1QC5B 3W05A 3EE6A 3LGSA 5C4GB 5AHXA 1PG2A 3AVXA 4GSKA 4S24A 4KRGA 4JDPA 1Q0QA 4YT4A 2FUG6 2PGOA 4BV9A 2D6FA 1V1MB 1RHJA 2QTGA 2B9VA 3E9YA 4RDXA 3L0SA 3U7HB 3MW8A 3KG2A 4UPDA 4ZAVA 1JHRA 5AM5A 3T34A 4YEDA 1U2ZA 2OZVA 3NANA 3TLZA 2ODEA 5HCIA 4C2AA 1S8AA 2I99A 2P2LA 4ZEVA 5AI5A 4EYOA 1J0BA 2ZJ6A