1T4BA

1.6 angstrom structure of esherichia coli aspartate-semialdehyde dehydrogenase.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
MQNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title High-resolution Structures Reveal Details of Domain Closure and "Half-of-sites-reactivity" in Escherichia coli Aspartate beta-Semialdehyde Dehydrogenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 126
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1t4bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t4bA01
4QT0A 2NQ8A 4I9HA 1ADFA 3WSWA 4MOWA 3RC2A 2J8ZA 2ZYAA 3BMNB 5M6DA 1F06A 4XB1A 4FIZA 1UXGA 4B8ZA 4XDZA 3VDRA 1MC5A 2EKPA 1DB3A 1Y5MA 4GVXA 4AJ4A 4YCAA 4NH4A 1SBYA 4NK5A 4CLEA 3IKTA 5JDCA 5EESA 4R5HA 3RU7A 4HP8A 3PFFA 3AUSA 1GZ3A 1MP0A 3NDJA 3TRIA 3KSUA 2VT3A 1O89A 1T25A 4I5EA 3QRWA 4MVJH 2X0JA 4I9NA 3ROQA 4RVFA 2OZPA 3O8QB 4WNIA 1XLTA 4XEHA 4CM8B 4MP6A 5ICMA 1XIVA 2HK9A 2VHWA 3UICA 3U9LA 3EYWA 3JQAA 4AJEA 4PLGA 1GAEO 1NWHA 2IEDA 3JQFA 4RF2A 3JQEA 4Y8VA 1JKJA 3DFUA 3NUGA 1L7DA 3EY4A 2Q50A 1F12A 4M49A 5C3MA 1PR9A 3BTVA 3FI9A 1WMAA 4PLFA 5CG1A 3PHHA 2Q1WA 2FSVA 5BNFA 2HMSA 2FOIA 1NR1A 1ULSA 1Z7EA 4BGVA 4R16A 1NXQA 5KKAA 4B3IA 2YJZA 1GU7A 1PJLA 2VWHA 3HZZA 4OQZA 5G2OA 2E82A 3IC5A 1DIHA 4ALNA 1E7WA 2Y1OA 4P38A 2GGSA 4RPGA 2B0JA 2DUUA 3WYCA 2HQ1A 4J1TA 5IN5A 4ITUA 5TQVA 1UR5A 5A9SA 1E7RA 4JBHA 5CPBA 3R6DA 4CMAA 1YB1A 1E7MA 2CY0A 2NVUB 1PX0A 1EEHA 6LDHA 3HSKA 1GV0A 2OP1A 3V8BA 3WIDA 4UULA 2ZIZA 3OMLA 3L9XA 1UAGA 1QRRA 1MB4A 3WGTA 4YEDA 4ZICA 4RO0A 3K96A 5IXYA 1V6AA 2DM6A 1YDEA 3DC2A 1UP6A 4RJTA 4WNCA 4CLDA 2FPPA 3V5NA 1PU2A 1VPDA 1NPTO 2AMFA 3RFVA 3K31A 3LT0A 3G79A 5TT1A 3NAQA 4FSHA 2O7QA 1VJ0A 2F1KA 1Y8RA 1R66A 3OICA 1HTBA 5H81A 1NQTA 2HSDA 4XJSA 5C7OO 4Z0PA 1WXDA 1OI7A 1E3JA 1KERA 2VHYA 4LGVA 1NPYA 2RHRA 4XCVA 4XQ9A 1P1IA 5BSFA 1RKXA 4CMEC 2AEMA 3EVTA 4AVYA 3PZBA 2FRDA 4KP7A 3U4CA 2Z95A 5COAA 1A7KA 1O8CA 2QRJA 3DBVO 1YJQA 4FFNA 3ETEA 4H16A 3TL2A 1B7GO 3HB5X 4DWVA 2BKAA 4KTVE 1LI4A 1JKFA 1U7TA 1YBAA 1OAAA 4GKVA 5IZCC 3RD5A 4DBVO 3W8FA 4BO1A 2BF7A 2GD1O 4I08A 4NIMA 5KJ6A 1BW9B 2QZZA 3KLPX 4G2NA 3WQSB 4W99A 4BO9A 4YQYA 5EQFA 1DRVA 5FEUA 4BOYA 1DIGA 3LLSA 3LSYA 5A5FA 3RIHA 3E6AA 5L7TA 5G0VA 2X5OA 1CQJA 1NVTA 3CZRA 2VWQA 2AG5A 3DONA 4WEOA 1W0CA 3DXFA 4BO2A 3LU1A 1NX6A 1VI2A 2YQ4A 3D3WA 4LISA 1LRLA 5HS6A 4YAEA 1Y9AA 3TZCA 3GZNA 3JD2A 3OJEA 1DPGA 1O5IA 2J6IA 2P4HX 5CDUA 4GGPA 1HWYA 2NTVA 5DN9A 5T5QA 4MKZA 3E9NA 1ZJZA 1PS9A 3EDMA 4IDDA 4RVSA 2POQX 4WOKA 4QFDA 3TFQA 3BYZA 2EW8A 3IAHA 1T2DA 1DHRA 1Z75A 2H1SA 4XDYA 1PZHA 3ZNNA 1YDWA 3WG9A 2DFDA 4MVJF 3HDHA 1KETA 1U3TA 2WEKA 5ER9A 4OMUA 4PFJA 1ZCJA 3UKOA 4DBZA 4JJFA 3VVBA 1BVUA 5F1OA 1KYQA 3OQ6A 1LLDA 4HBGA 3WNVA 1VSVA 5G4KA 1LUAA 1HYGA 1HYHA 2CDCA 1IZ0A 1E3WA 4MIOA 4H15A 3SXPA 1EMDA 3H2ZA 3AI2A 5F5NA 4R1SA 1U4OA 2GDZA 1PQWA 4YQZA 5BR7A 4H3VA 2JHFA 1TEHA 2IDZA 4J1SA 3UAGA 3IL2A 1LQUA 2V6BA 5DCYA 1A7AA 1SZJG 1I32A 1GPJA 1GQYA 4YXFA 4UVHA 2FWMX 5EIOA 1JKIA 3X2FA 3PI7A 2XAAA 5KJFA 4EBFA 4FFOA 2X5JO 4ONEA 1LRJA 3W8EA 4W6ZA 4BV9A 3WBBA 3QVSA 4O63O 2I66A 3W4JA 1CJCA 1HDRA 4CMJA 3EHEA 1HF3A 1LJ8A 1R0LA 2QHXA 3RC9A 4RZHA 1XWFA 4W9NC 2WWRA 3VKVA 5JAZA 4MKRA 1L7EA 1I2ZA 3I52A 3WQQA 2E4AA 2J5QA 3DFZA 4YBZA 2GUGA 1MFZA 4AICA 1C1DB 3N7UA 5JYFA 4D42A 3QVOA 1QP8A 1X0VA 4B79A 1NBOA 1H9BA 4RZIA 5H82A 1VL6A 2DT5A 4J91A 3KSZO 4YWJA 1WDLA 1Y81A 5G0SA 3UN1A 1Q0LA 4M8SA 2VTDA 4AJJA 5KVVA 3C1AA 2Z1MA 4E2XA 3FNHA 3CSDA 5T64A 3JQBA 3ONDA 2UDPA 4CQMD 3IQDB 4R1TA 1A5ZA 2ZCVA 1H6BA 3VZSA 1LSJA 2NU8A 3L9WA 2W8ZA 1PZGA 1N1EA 2GN4A 2DVMA 2GLXA 3IUPA 1JWAB 4PVDA 4EZBA 3MTJA 5CDYA 3CINA 3HDYA 2VUSA 1N7GA 4LVUA 1SEVA 1GEGA 3TQHA 3O8QA 5L40A 2NTJA 5DBGA 3BZUA 1ADCA 2HMVA 4PLVA 1EQ2A 5KVSA 5AXCA 3R1IA 4CV2A 3ZV5A 2WDZA 5ENDA 3I9OA 4CV1A 5B4UA 1H93A 4Y9DA 4A2CA 2CVZA 3G49A 4OHUA 2Q1UA 4PRLA 2PZJA 3D4PA 3H5RA 2V6FA 1DDOA 3DBHB 1YBVA 3WSVA 2JCXA 2NM0A 1GQ2A 5KWEA 1I24A 3QY9A 1A72A 3RUIA 3ZU5A 3Q3CA 2VHXA 3O38A 3V1UA 4YT5A 2GF2A 4ALJA 4DPMA 2BFMA 2PGLA 2WE8A 5TRTA 4BB5A 4YT4A 3HFGA 4JNKA 1RJWA 3WTBA 4PG6A 2GRAA 1XCBA 3DAFA 3K5PA 2NVUA 3MOIA 3Q2IA 3GR6A 1HKUA 4ND3A 1KVTA 3JQ8A 3VKUA 1TA4A 3L4SO 1XQ1A 2WMDA 1CF2O 2BMAA 2ZTMA 3CUKA 5B37A 3QVWA 4O6VA 5BSGA 4J9VA 1B0AA 2ZYDA 4W7HA 3E1KA 1X7HA 5JO9A 1Q7BA 1ZK1A 1XKQA 2IYOA 1K3TA 2JCVA 2XPCA 1KC1A 3O9ZA 1BWSA 4BKRA 2BFAA 1ZXLA 3PJDA 1XA0A 4K6FA 3QE3A 1DC6A 5T57A 1GEEA 2YHIB 3G1UA 1U3VA 2JHGA 1GYRA 1GYQA 3FRJA 3LC1O 2OBYA 5A05A 1E7QA 4WLFA 2NU7A 2WTBA 1DIBA 3M1AA 4LRTB 1H9AA 2DAPA 5FI3A 3T7EA 1G0NA 5TS3A 2Y1CA 2IXBA 4RLHA 3F1KA 4GX1A 5A04A 2ZYGA 1I36A 1PWXA 5IJZA 2X0IA 2EWMA 2FPGA 4XIYA 3QW2A 3C85A 5AVOA 4IJWA 3A9WA 1O0SA 2EP5A 4OOFA 4NU6A 4FJ1A 3ZNQA 4GWKA 2OORA 2VQ3A 3WFJA 3S8MA 4DQXA 1JAXA 4RCVA 5TX7A 1BW9A 1I3LA 1TI7A 5HRUA 1TB4A 3U4HA 1C3VA 5TGDA 2HDHA 2J3HA 3GC6A 1P31A 4XGNA 1JLLA 1PS8A 3W1VA 4S3MA 1V35A 4ZQBA 2Y67A 4TMFA 2Y93A 5JS6A 1YRLA 2DFVA 3VH3A 4EEZA 1HDCA 2IE0A 4WGGA 3QWIA 1V8BA 4M1QA 3JQDA 4O5OA 3OM9A 5KOIA 3SEFA 3HE3A 2JAHA 5JNLA 2JD2A 3CMMA 3JV7A 4RPHA 1VL0A 1GZ4A 4YAGA 4M54A 5L51A 3NKLA 2GR9A 2I9PA 3JD4A 1KEWA 1MX3A 4A7PA 5KCZA 1X15A 2B4TO 1ZMOA 3GNTA 4RF3A 2QX7A 1U3UA 3PLNA 4MIYA 4FB5A 5ILOA 1CWUA 3AM4A 3U4IA 4CUZA 1SOWA 4J9UE 3I9NA 4HX5A 3GDOA 4ND1A 5JCJD 1TVEA 2VZ0A 3EZYA 5J23A 3ZW9A 5C7IO 2O3JA 1NTOA 4GMFA 3JD3A 4I8XA 2R2GA 4BNMA 1BGVA 3P2OA 2W90A 1YJ8A 1PJ4A 4YACA 4OO3A 1QXSA 3MJTA 2ZB7A 2PTGA 4OXNA 3RFXA 2JD1A 3Q0EA 4NMHA 4BKPA 1SB8A 2BFOA 2O3SA 1PJ3A 4YA6A 4EUEA 3QWHA 1FXSA 1WNTA 4P4GA 4WEQA 3VZQA 1GV1A 1HETA 2D59A 3WGIA 3AUAA 7ADHA 3U09A 4NJOA 1Y8RB 4P4NA 1B15A 2C07A 3Q6IA 5FFFA 3KEOA 4YPOA 1I8TA 2Q49A 1AHIA 3Q9UA 3ETGA 4Z9FA 1UZNA 4IGEA 5KTKA 3OHSX 1LX6A 1VLLA 4CPDA 4CM4B 4EUHA 2Q3EA 3SBOA 4CL8A 2JD0A 4ZRMA 2XOXA 4Z0TA 4W7IA 1FDTA 1VL8A 3UCFA 3HNPA 4PLWA 5CEJA 1F17A 2YFHA 1NPDA 2B36A 4DL9A 2X1HA 3O4RA 4GPD1 1U8FO 4BO0A 3E9QA 4DIFA 4J16A 3VH1A 3HUDA 3SX2A 1H0KA 4AL4A 4RVDA 3HN7A 1X1EA 4I1IA 1LA2A 1HT0A 2JJYA 5JFOA 2FR8A 3GGPA 3IKVA 1C1DA 1JQBA 1IPFA 3PWKA 4K9DA 3NRCA 4D46A 3A06A 2JFGA 2YY7A 5BQFA 4E2YA 4LSWA 4ND4A 3D3WB 3PPIA 5LC1A 4HFMA 1E3LA 1LSOA 3WMWA 1ZK2A 3GZNB 4IDCA 1YOVA 3PYXA 4JJIA 2VNSA 3OA2A 2GNAA 1LC0A 3INTA 6ADHA 3TDKA 4MVJA 3GRKA 1ZJYA 4KDEA 4YJGB 5DP1A 3FWNA 3I83A 3IJRA 3PJGA 1XYGA 1BHSA 1LLQA 4UUPA 3DZJA 5DNAA 2P91A 4IUYA 2W2KB 4IINA 1DC3A 1KOLA 4CV3A 5TC4A 3RWBA 1ZSVA 1WAMA 2QW8A 4Z3KA 4D7AA 3ULKA 4CM3A 1GFSA 1KVSA 2IZ1A 3I23A 3H6KA 3GN2A 1LDMA 4CM5A 2NU6A 3ORFA 4QX6A 2Q2VA 4WK6A 2HCTA 3OIGA 4YRDA 3QVXA 3LK7A 4D43A 4U5QA 4NBWA 2QQ5A 4UUOA 4J4BA 1WLYA 4GBJA 3TOXA 3HFSA 1SPXA 3E18A 5DOZA 5G4KB 3CPSA 3DZGA 3ROPA 3GT0A 3ITDA 1ZFNA 1FF9A 2P2SA 1ISMA 3BTOA 5F1KA 3ZDFA 3GDFA 3DBHA 2AQHA 4RPJA 3JQGA 1QLHA 4XB2A 2C2XA 3I5MA 4NPCA 2J3IA 4GLLA 4PG5A 2GZ1A 1B2LA 2FHSA 3RASA 4GL4A 4DYVA 4I9UA 4DGSA 5J9GA 1K6JA 1IUKA 3RC7A 1OZAA 1YGYA 3WYEA 1PR3A 1MG5A 3GEGA 3NYWA 5C5IA 1XU7A 3ZV4A 4AJHA 4J7UA 1WPQA 1EVIA 4XR4A 3KLMX 1P1HA 2QG4A 4QEDA 3PTZA 3I6IA 1NQOA 2ILTA 5COBA 4E13A 1DFGA 2AEFA 1BVRA 3MCVA 1A4IA 4RGBA 3DOOA 2VWPA 4PVCA 3D5TA 1P77A 1NHGA 3EVNA 1Y8QB 3GPDG 4E21A 5COQA 2E48A 4DLBA 1JDJA 3MEQA 4R01A 3F6YA 4W82A 1C0LA 3DHYA 1DLIA 2I3GA 4JBIA 2C2YA 4OOEA 2PV7A 3H2SA 1Q7CA 2FR1A 3FN4A 3FWZA 1D1SA 3KYDA 5L7WA 2YDYA 4PLCA 2YHIA 3E9MA 4LCEA 4RQUA 1KVUA 5F1PA 2PZKA 4FC7A 1C1XB 4R54A 3PIDA 4WLEA 5I9MA 4HFNA 1OFGA 2O3UA 2P5YA 4LN1A 3AI1A 4UREA 5JDIC 1A9YA 1IY8A 5MDHA 5CFZA 5F5LA 3VZPA 2EJVA 4OIMA 3ZWOA 4EDFA 3E5RA 3QLJA 3L6OO 3QQPA 3W6ZA 1ZBQA 4NR0A 2OMEA 2UVDA 9LDBA 4IDEA 3RU9A 3PRJA 2I3AA 4FFPA 3ETDA 1X0XA 4ND2A 3OQBA 2FMUA 3GFGA 3T4EA 2AG8A 5L4NA 2HJSA 4ZQHA 4M89A 1WP4A 4OSOA 2PR2A 4PG8A 4NZ9A 1LU9A 1L1FA 5ADHA 1B14A 4R3WA 2H9IA 1F14A 2DBRA 3D64A 1J6UA 4KMSA 1PWZA 5IXSA 2CUKA 3MOGA 5CDSA 2C0CA 1PIWA 5B1YA 2Y1EA 3ZWBA 1CYDA 1WZEA 1X7DA 2UUPA 3GNSA 4D3SA 3K2BA 4IS3A 4EI2A 2Z5LA 1JVBA 3OA0A 1LDEA 4N5MA 3X2EA 1EDZA 1PQUA 2C54A 1ORRA 3RJ5A 4MO2A 3PFWO 4MVJI 1P1KA 2B4QA 4FC6A 4NBVA 4R3NA 1NAIA 1ZSNA 4YR9A 2Q1SA 3ANNA 3I4FA 1GTMA 1BG6A 1XG5A 4RPKA 2Q4EA 3DZBA 1R37A 3TJRA 5L9AA 1YBMA 3K6JA 3DOJA 3ZWAA 1IHYA 1FDVA 1LNQA 3I9KA 2B5WA 3WGZA 3ZN2A 4WLOA 4F6LA 2P68A 3JQ8B 4B7CA 3LT4A 3VPXA 3NEPX 1DRUA 4IM7A 3INGA 3KB6A 4R68A 4RDIA 2VN8A 3TZQA 1PJCA 1E0DA 3KRTA 3GDGA 1F0YA 3KVOA 3V1TC 3ZHXA 5I7VA 4Q3BA 3WICA 3PP8A 1H6DA 3B1JA 2FSSA 4Q3NA 4BNKA 1O95A 1WDKA 2DLDA 1P1RA 3ZHBA 3BMCB 1C0KA 4IIUA 1T4BA 1PL8A 2D4AA 1KEPA 4YDRA 4FN4A 1P74A 3FBGA 1O6ZA 2YV3A 1DJNA 4RVGA 3D4OA 1M67A 4GSLA 4WCFB 1RPNA 3U3XA 2C20A 3MJ4A 4UUMA 3LQFA 1P9LA 4B3JA 3ZCXA 4XWYA 3OECA 1MV8A 3JQ9C 3K8ZA 1X1TA 2O3RA 3HQ4O 1VJ1A 4OXKA 4XZ3A 1UZLA 5L53A 1AGNA 4PRKA 4HNGA 3RROA 2CMDA 4CM4A 3RUAA 1WZIA 4BNYA 3VHRA 4MINA 4YAIA 4R41A 1QYCA 2TMDA 1LSSA 1E92A 1UZMA 4C7KA 4ALLA 4RV9A 4BKUA 3BHIA 1LEHA 4CR7A 4PG4A 1ENZA 3PHGA 1CIVA 3COSA 5L45A 4BO7A 1IPEA 4JXKA 5EMHA 4CMHA 3GFBA 3KHUA 4IDBA 2HRBA 4N18A 2WM3A 1YE3A 1U2DA 1R15A 2X9VA 4JIGA 7MDHA 5JCJA 3DDNA 4HFRA 3ENNA 1Q7GA 4NBRA 5LCXA 4D41A 4XYLA 2PFGA 1YL7A 2CFCA 4E31A 3H3JA 4PIVA 3ROMA 4NFYA 4CODB 5HM8A 2D5CA 2H6EA 4UEKA 2OXIA 1ISJA 3A14A 2QRLA 4JP3A 4X54A 4DXHA 4E5KA 3ZI0A 1U28A 2GCGA 3G17A 3C3XA 5KIAA 1DFHA 1T24A 4BB6A 3GPIA 1AN9A 1LSUA 4YJGA 2XXJA 2FR0A 1JVSA 1DXYA 5DZSA 4YTEA 2EG9A 3BXXA 9LDTA 3OQ1A 5IDYA 1LXCA 5EPOA 1C14A 4B4UA 1G0OA 1G6KA 3GHHA 2PKQO 2W2KA 5AYVA 3GK3A 4TRRA 2BRUA 2G0TA 3IS3A 3L6EA 3GGOA 1FDSA 2O3TA 2P4QA 3DR3A 1PGOA 4KWHA 1U4SA 4L8VA 2NVBA 2X23A 1R4NB 3P7MA 3GHYA 4I5FA 3QSGA 4II2A 2IRWA 4PGFA 4DC0A 4OJNA 3AFMA 1E6WA 3ICCA 4JK3A 4EJMA 5ICSA 1KBZA 4JP2A 4Q3CA 2HLPA 2AW5A 4B4VA 1A9ZA 4J2OA 4K1LA 3S1LA 4DIOA 3FTPA 4IXTA 3TZKA 3WWZA 1H5QA 2WD8A 1P1JA 3W4IA 3GMDA 4YVFA 4DPKA 1T2EA 1E5QA 2C5EA 5DF1A 4D44A 4EJ0A 4ALKA 5T8KC 3PQEA 4D0RA 2Y1DA 2Q22A 1QSGA 1MGOA 4PLPA 4ROSA 4TZKA 3GF4A 4XA8A 2F00A 3RJ9A 1QR6A 2PD6A 5JY1A 2NQTA 4FJ0A 4Q9NA 5DCWA 2FP4A 2V7PA 1HSZA 2D5AA 2WYUA 3TZHA 2J5KA 1R4MB 3WS7A 1YO6A 5L95A 1IE3A 1HRDA 1MA0A 5C7LO 1S7CA 3GVXA 2ZQZA 3DWFA 5F3RA 4AG3A 3E8XA 1HXHA 1E3IA 3GAZA 3NDIA 4J7CA 3WLFA 4E5YA 4GLOA 1ENOA 1Z6ZA 1PGQA 4FOSA 5CEEA 1Y5RA 3QIVA 1YQGA 4J4HA 1R0KA 1Y8QA 2NTNA 5JE8A 3HG7A 2PGJA 1GZ6A 4YJFB 3N58A 4MIEA 3UVEA 3KTDA 1N7HA 4R5MA 1LDGA 4FS3A 4BIIA 1DRWA 2DBQA 3HJAA 4ZA2A 2YZ7A 4M87A 1O94A 3HADA 1B3RA 3DAPA 3DBLB 1YOVB 1QV7A 1C1XA 1ZK0A 4CMCA 3UFXA 1RWBA 4GX0A 4OKIA 3PVZA 1IHXA 1IZ9A 2DUWA 3F3SA 3MJCA 5JDCC 5JCXA 2GSDA 4HUJA 1ISIA 3F4BA 3K92A 2LDBA 2DPGA 4GH5A 1R16A 3DOCA 1KEUA 3H9JA 4EYEA 1HZZA 2X6TA 2PNFA 3DMTC 4BV8A 3H5AA 2BFPA 3ZV6A 3VH2A 2I67A 1N9GB 4YYZA 3RCBA 1E3SA 2I99A 3IUSA 4Z6KA 3CIFA 4NDNE 4TZTA 4U7WA 4XQEA 3RAJA 4BMNA 4UAGA 1GR0A 1EFKA 4XJTA 4DIBA 4BO3A 2P9EA 1OMOA 1HDYA 5A9RA 5JXWA 4GWGA 4IQGA 4GQAA 4QTZA 1DOHA 3D3EA 3FR8A 3OBBA 4AJPA 4F45A 3DTTA 4BGIA 3L4BC 1EBUA 2ET6A 1ISFA 3WYBA 1UP4A 2I65A 4LMPA 3PQDA 4OXYA 4Z9XA 2NVWA 1HDOA 2I76A 1AXEA 3JQGB 3KM0A 4R51A 3RVDA 1QYDA 3AY3A 3FNFA 4LMRA 2E37A 4TQGA 1RM4A 3ZWCA 4BMSA 1HL3A 1NYTA 4KUHA 1NWCA 2J3KA 4OKNA 3AFNA 4HV4A 1GPDG 1I10A 3KYBA 4F6CA 5IG2A 5A9TA 2O2SA 2G17A 2O7SA 1GYPA 3RFTA 4KZPA 3AW9A 4J6FA 3OF2A 4Q3AA 2W2LD 4J3FA 4HXYA 2V65A 2R00C 5T73A 4MPDA 3ZNPA 1PJQA 1XEAA 4D3DA 5I9LA 1IB6A 3KEQA 4CQMB 2V6GA 2AXQA 5K6AC 1UUFA 4PZCA 2GO1A 2WYWA 1ZO8A 5U9CA 1I3NA 4O1MA 2CSUA 3C1OA 4WASA 5KVQA 5CEFA 3ANLA 3K2EA 1NHWA 5GMOA 1QORA 2I6TA 3PJEA 1YB5A 2JFHA 3GEMA 3KYDB 3PJFA 5CPFA 3BMCA 2BH9A 3LLVA 2O4UX 2B4RO 5IFLA 5IDXA 1EUCA 5ER6A 4EUFA 2G82A 4WCFA 1HE4A 2B37A 2WJPA 4E30A 4DA9A 3L77A 4W4TA 2X8LA 4WCDA 5CHEA 2VCYA 1ZEJA 2EHDA 3IJPA 2YQ5A 3AK4A 4EITA 5TIIA 4UEJA 4JLWA 4F3YA 1UDAA 4ND5A 2YV1A 4JQCA 3WB9A 1TT7A 2A4KA 5FI5A 1D4FA 3WMXA 1JTVA 1LLCA 3BMOB 4KUEA 3F4LA 4BNFA 4J1QA 3AM3A 2YV2A 3H65A 5DP2A 5ES3A 2RBEA 3K30A 1DLJA 1E6UA 3F5SA 1K0UA 3GEDA 3ONEA 5JAQA 4XD2A 1P3DA 3K73O 4R9RA 4CM9D 1B8UA 3I1JA 3B1KA 4C7JA 1Z82A 4NQZA 2RHCA 3ADOA 3IP1A 4CQLA 2CDBA 4Y6SA 5TNXA 4PLHA 3G0OA 3R3SA 4E5PA 2VNAA 4P4LA 3GLQA 1EE9A 2JCYA 1Z7BA 5KJ1A 4K6CA 2X5KO 1LC3A 1RM0A 1E1MA 3DHNA 4YRBA 1HZJA 3BA1A 4QQRA 4RLSA 4XYMA 1KEVA 5A03A 4OYRA 2X0NA 1PSDA 3AU9A 2Y68A 3ROKA 3UGKA 5GY7A 1SEPA 3L0DA 2VOJA 2Y0EA 1DO8A 3QWFA 4HFJA 3CXRA 5JC1A 1V0JA 1K6XA 3EMKA 2LDXA 4JX8A 4GVLA 5CAEA 1HDZA 3A28A 3K9QO 1EQUA 4AJNA 3RUHA 1DEHA 1GADO 2UV8A 1EUDA 4DC1A 1JW9B 3KETA 3PHIA 4FR5A 1QKIA 2NSDA 1ZKMA 2YUTA 3C8MA 3M2PA 4RF5A 1SMKA 2HUNA 2ZJ1A 1MFPA 3FCOA 4HNHA 2PY6A 3H9GA 5A06A 1IULA 4DQUA 1HSOA 3KOUA 3BTSA 3HDQA 3Q9NA 3PHJA 1W8DA 1VM6A 4TVBA 4MVJM 2UYYA 3PWSA 1R4NA 1U7HA 1E7YA 2YFQA 3U49A 3INRA 4U8GA 3EGOA 5IN4A 1ZXBA 5CDTA 4A10A 2NADA 5MGBA 2CZCA 4UEOA 4ZHSA 4J7XA 4BNIA 5FYDA 1T4DA 2QYSA 4JN6B 1M76A 4WPGA 5EINA 1UH5A 2G76A 4U6QA 4ZQGA 3WGGA 4ZQEA 3SVTA 4G5HA 2OOSA 2NACA 5L7YA 1N8KA 4DRYA 2OP0A 2CDAA 3NJ8A 3DQPA 4C4OA 5I8WA 5A3JA 5TT0A 1R4MA 3PYMA 1HEUA 3GA0A 4DLAA 4ZGWA 1I01A 3AI3A 3W6UA 4RORA 2ZB8A 4AJLA 1EK6A 2ZCUA 4XQGA 5K0ZA 3RUCA 4FDAA 4CMIB 2XXBA 1P45A 5HA5A 4OH1A 1U5CA 4Y6RA 3PLRA 3M6IA 1DC4A 4QO8A 1H6AA 1VSUA 4CMEA 1P44A 1VKNA 2C29D 4YJFA 4HKTA 4TSKA 3JD1A 1VRWA 5A5EA 3AJRA 5IAAA 1T26A 4LVCA 1T2CA 4CLXA 1PQPA 2EW2A 3FBTA 3IIEA 4TROA 5IZCA 2P9GA 3JQBC 2I5PO 1SAYA 3WXBA 2GN6A 3DBLA 2Y0DA 2B69A 1QG6A 4FOOA 1U1IA 3WX0A 4CV0A 4R9SA 2X0RA 3M1LA 1E1KA 3TN7A 1ULUA 4TWRA 4IJVA 1I33A 1DIRA 2DU8A 3JYLA 1P1FA 3PQFA 2EP7A 1MUUA 1BDMA 4NBTA 1XR3A 1F8FA 4JGBA 4BNTA 1Z45A 3TFOA 1WVGA 5CDGA 3GQVA 1K2WA 4ZU3A 1BMDA 4UVGA 3CZMA 3C1TA 3SC6A 5I7SA 1N9GA 4RQTA 3ADPA 1C0IA 1SC6A 3GH3A 5JYEA 2B5VA 3ITKA 3VTFA 5EQDA 3L6DA 3CE6A 3LF1A 4LK3A 3ZWNA 4R4JA 3HHPA 2BGLA 2EEZA 4L0QA 1PL7A 3PIIA 1NQ5A 5I7FA 4NFSA 2PWZA 3WOHA 5H83A 4BO4A 2RH4A 4BNZA 4DUPA 5JMPA 4B4WA 4CMBA 2HKIA 3RC1A 3ZWMA 4IBOA 3CMCO 2GPTA 4E2ZA 1XELA 5JSFA 3QHAA 3BAZA 4E5NA 2HJRA 1D3AA 3H9UA 4GAEA 1PJBA 3VDQA 1P33A 2RH8A 3ZWPA 4INAA 4IMPA 4DMLA 4WLUA 3SC4A 5IDQA 2EF1A 3P2YA 1DBVO 4XX0A 3ZWVA 2HMWA 3L07A 1W6UA 4FD3A 3KO8A 2NNLD 2NV6A 4GGOA 1M2WA 3E03A 4M86A 4PZDA 5KNLA 1CDOA 1GUYA 2A92A 2A94A 2G5CA 4KQXA 1PZFA 2V6MA 3TOZA 1A71A 1ZVMA 3ZNOA 3ZWWA 5HS4A 1YQDA 1TLTA 1JAYA 1UJMA 2IODA 4CQMA 4AJKA 1YB4A 3Q11A 3QV1A 3OFSA 1EK5A 3ICPA 4MP3A 1FMCA 5T8KA 4XYBA 4CM1A 4E4YA 1N5DA 2A35A 3WJAA 2VYND 3ZGYA 3A4VA 3I6QA 2B83A 3GN1A 1B3BA 1I5RA 3GRPA 2BI8A 1WW8A 4BNVA 4FQ8A 3WDSA 4AJOA 2O4CA 1BDBA 1M6HA 3RBZA 2PLAA 4E5MA 5JY6A 1B8VA 3KYCB 3WWYA 3UW3A 3OH8A 1SB9A 3VPSA 1E77A 1XQ6A 3IMFA 1R0SA 3RUFA 1Q1NA 3GVPA 1P0CA 1BXKA 3AOEC 4E12A 3Q2KA 3LC7O 1NFRA 1XHLA 3JYPA 4PLYA 4W9NA 4CUJA 2CF6A 1Z74A 1PGJA 2Q46A 2HO5A 1QV6A 3OSUA 4PZEA 1LDYA 1FJHA 2ZTVA 3D5QA 1TT5B 2H5LA 3TF5A 3CEAA 3FSRA 3H9EO 1U5AA 1YKFA 3KXDA 3NDRA 3GNQA 3BMOA 1BSVA 5JPIA 3UF0A 1E1NA 3GUCA 5JYDA 3IOYA 3LT2A 3GOHA 1G1AA 1VJTA 1NVMB 2EKQA 1UXHA 2AQ8A 2X22A 3HWRA 4YJHA 3UOGA 2W2LA 4E32A 3FPLA 1LTHR 2AQKA 4HY3A 4M55A 4JBGA 4YRAA 2QIOA 2PA3A 4UVIA 2BLLA 3V2GA 1V3TA 2FZWA 5G0WA 2BGMA 4NBUA 4R1UA 4NU5A 4MVJG 1ZW1A 2BHLA 3OIDA 2Q2QA 3DMTA 5I7EA 4IZHA 4DREA 5L4SA 3EUWA 3S55A 3BHJA 1I3KA 3VPGA 3RUEA 4GSKA 3RKUA 2UUOA 1PL6A 4O0LA 1E1LA 4L73A 4DVJA 1AE1A 2PH3A 1R6DA 3UHAA 3FTNA 3H3FA 4UUNA 3GVCA 3OP4A 1UXKA 1CERA 3DZHA 3L4BA 2IZZA 3KSDO 1ZSYA 4D3FA 5A3VA 5HWSA 2AE1A 4R1NA 1E7SA 1ZK4A 4MP8A 2C5AA 2E49A 5G4LA 5GZ6A 4TKMA 1X7GA 1GCUA 1W4ZA 2X9GA 5DT9A 3SJ7A 3EC7A 3H5NA 1PEDA 4QFCA 5L4LA 3U62A 1U8XX 4ALMA 2VOEA 4QSMA 2WSBA 2YHUA 3O26A 3KV3O 2O48X 2A9FA 3NTQA 4MVJP 1PTJA 2Y66A 4S1VA 3WGHA 4BNGA 4WUVA 5B12A 1FDWA 1J5PA 4QO7A 3G3EA 4CM9A 3HN2A 2R00A 4KOAA 2VHZA 4U0KA 1MC4A 4KWIA 4WE3A 3D1LA 4BNHA 5BNIA 1DJQA 3F5QA 4WLVA 1T1RA 3S2IA 3TWOA 5K6AA 2Y05A 4AJ2A 4IJUA 3LC2O 4FJ2A 4NJMA 3S2GA 5JLAA 4Z0HO 2YYYA 4LW8A 4IJKA 1ML3A 2JAPA 2O3QA 1H6CA 1ENYA 1DHTA 2BELA 1CETA 5BSEA 1AUPA 1HLDA 2VUTA 4DTIA 5ILGA 1I0ZA 2J5RA 3JQ6A 1ZH8A 1ARZA 5JYAA 5JAMA 1Y6JA 4NG5A 2OHXA 4D79A 4J2HA 3QP9A 1EVJA 2PH5A 4NI5A 1SCUA 1X14A 2X9NA 4GMGA 1Y1PA 4OSPA 4P22A 4CMIA 4YB8A 4EJ6A 2AE2A 1RYEA 2VYVD 2VT2A 4EGFA 3NGXA 4L76A 4CQLB 4RDHA 2IXAA 1J4AA 3JQ7A 3R3JA 3DBRB 3VH4A 2P5UA 2W98A 1Q2XA 3GMSA 5G0TA 3V2HA 4CLOA 2ZK7A 3C7DB 3CH6A 2VRCD 3DAGA 4N7RA 1RYDA 5I9NA 4PCVA 2EGHA 1EVZA 4WKGA 4QECA 3MJSA 1T2AA 3ZH2A 1T1SA 4PLZA 4ZN6A 2DQ4A 1ONNA 1YONA 3F9IA 1Y7TA 4BNUA 3QA9A 4RF4A 2HK7A 2RAFA 2X58A 2NU9A 1UAYA 1XSEA 4UVDA 4IS2A 1UDCA 1GDHA 2Q4BA 3GY0A 4UVEA 1LDNA 2CVQA 4XGIA 3CKYA 3JCZA 2QYTA 1H2HA 1DSSG 5KJEA 4LCJA 1PGPA 3P5SA 4H7PA 4NHEA 4TRNA 5BT9A 5TF4A 1N1GA 3ZV3A 2VHVA 1IYZA 2BD0A 2VZ8A 3E82A 1ONOA 3MJVA 3C24A 3GG9A 4O59O 4JCOA 4B7XA 3LT1A 4CM7A 3W8DA 4IPTA 3T7CA 4MDHA 1YWGO 3F47A 4CL3A 4A03A 1ZNQO 1NQAO 3DB2A 2CF5A 4CMGA 1YL6A 3B6ZA 4BGEA 1VKOA 2EXXA 1EVYA 5DBIA 4BNLA 1LLUA 4RL6A 5T6BA 3UCXA 2ZATA 4BL5A 4F46A 5LDHA 4QXMA 1WDMA 3V1YA 4XYGA 4Z9YA 3V2UA 4ZJUA 4XKJA 1GQQA 4JROA 1SO8A 1SOVA 4OGWA 1T2FA 3TZ6A 4FGSA 3RI3A 2ZKLA 3I9MA 1I3MA 1V9LA 4B3HA 3QJ5A 4MVJD 1YL5A 3CTMA 4URFA 5THQA 1AXGA 3VPHA 4D45A 2Y0CA 2C7VA 4ALIA 1Q0QA 2FZEA 2P9CA 4K28A 1E6EA 1ENPA 4LRSB 4BUCA 2UAGA 1HLPA 1LRKA 3WFIA 3F1LA 4EEXA 1UXJA 2X4GA 3OJFA 4IGFA 4IY1A 4OM8A 3ST7A 4AJIA 4L4XA 3VC7A 4OQYA 4BQPA 3NT5A 5AXDA 1UP7A 4I5DA 1UXIA 1BXGA 2EIHA 2OGUA 3KYCA 3FNGA 1JA9A 2AEJA 3FD8A 3EZLA 1PJSA 1OBFO 3DL2A 4BO5A 4DYDA 4CMKA 1NASA 4DMMA 4FGWA 1B8PA 2IEBA 3GVIA 4A73A 1V3UA 1NNUA 5KKCA 5GZ3A 3EW7A 1E5LA 1DAOA 2ZTLA 1C0PA 2DTDA 1GD1O 2ZB3A 1ADBA 1GY8A 5C37A 5KJCA 1PJTA 1TT5A 3PEFA 1ZUD1 1PJ2A 3RBVA 4DPLA 1MXHA 1U9JA 4FPXA 2NWQA 3TPCA 2VUUA 1E3EA 1VC2A 3BMNA 5A02A 2YW9A 5B4VA 5A4DA 3OJ0A 3UUWA 3AY6A 4BMVA 5ENVA 4TKLA 3BMQB 3OJOA 4GKBA 1H94A 2IZ0A 1XGKA 3JQFC 4R69A 3RKRA 3DZIA 4L9RA 4OAQA 4BNJA 4BNWA 4U6SA 3T4XA 5EJ2A 3B20A 4A0SA 4XIJA 3WGOA 1ZIDA 3WJ7A 1F8GA 3KUXA 4P8RA 3DHEA 5ITVA 1PGNA 2EKLA 4KDFA 4ID9A 1LDBA 3H7AA 2VTEA 2BGKA 5IZ4A 4B7UA 2D1YA 1NAHA 1QYVA 2VYNA 2DKNA 4WECA 4DLLA 3FHLA 2GN8A 2Y1GA 4CM8A 1KY5A 5DOVA 5LDGA 3FF4A 3OIFA 4ESOA 5BSHA 4CJXA 3QWBA 1B16A 5AOVA 4Y6PA 4CLRB 2WE7A 4OL9A 3VZRA 1I2BA 1EDOA 5F21A 1KVRA 1HE3A 3NV9A 4AJ1A 3MWEB 4U0JA 2SCUA 1QLJA 3ZHYA 3VAZA 3DTYA 1ADGA 3GZ4A 1ZMTA 1ZZEA 1YXMA 2Y99A 3ZWYA 2Q2WA 4YJDA 1ONPA 3QVTA 2Y1FA 3I9JA 3R0IA 3EAGA 3ASUA 2GASA 4L75A 3WLEA 1DFIA 3ZU2A 3ZW8A 3U0BA 1KS9A 1HDGO 2GERA 4Y67A 3WR5A 4YAJA 4MKXA 4XR9A 1Z73A 1RM5A 3NTOA 3NJ4A 3OETA 4E0BA 4YAKA 3I9LA 3JQAD 1YS4A 4HADA 4XGKA 3S2FA 1CRWG 4XRGA 1DC5A 1IL0A 2HK8A 2R6JA 5HBRA 1EUZA 5AQ1A 1XU9A 3G1TA 1ID1A 2OFPA 5I8ZA 4G65A 4ILKA 3ZU4A 3FPCA 4BQRA 4A5OA 1FK8A 4HWKA 5DCUA 4PG7A 3SLGA 4RVUA 5GZ1A 5A1TA 4N54A 1HYEA 2EGGA 1D8AA 4KUGA 4XQCA 2WD7B 1M6WA 2DBZA 2E6UX 1YVEI 3AUTA 5AXBA 1EZ4A 2OBNA 1JU9A 3BHMA 3P19A 1EBFA 1U3WA 1NFQA 3MJEA 3EK2A 4PLTA 4BNNA 1S6YA 4IQ0A 1ZEMA 3RUDA 3RBXA 4E2WA 3F46A 1Y9EA 3PYLA 4KQWA 5ITWA 1UDBA 5DULA 3PGXA 3AOEA 4YJHB 4BKOA 3BTUA 3LZ6A 5JMWA 3ABIA 1FDUA 3AWDA 4K26A 1I30A 5JBIA 3JD0A 3WIEA 4J0FA 2HMUA 5JDIA 4CUKA 2BI7A 3DBRA 1JN0A 2VRBA 4N5NA 4BO8A 3E5MA 2VZ9A 5DBFA 2C59A 1LQTA 1SNYA 3AUUA 4IZIA 2TMGA 3NT4A 1KIFA 5DDIP 1PZEA 1R12A 2PZMA 3I3OA 3JTMA 1NVGA 2O50A 2EERA 3JQAB 5EN4A 4J0EA 3UCEA 4NFHA 1OOEA 3QWAA 4Q3DA 5B4TA 2HAEA 4J1NA 5IDWA 3SLKA 3H4VA 4Z3DA 3TL3A 4NK4A 1CEQA 1M75A 1JWBB 4L4SA 3VTZA 3C7AA 1P0FA 1K89A 2Q99A 1NM5A 3ZWXA 3PGJA 1ZK3A 3GAFA 5L3ZA 2DPHA 4I5GA 2D8AA 3PHLA 2PKQP 2C7GA 1A4UA 1TXGA 2X86A 4BVAA 5HTOA 2X7HA 4A26A 3N74A 4IDGA 2GYYA 4J43A 2PGDA 2DTEA 2CVOA 4WJZA 5A9SB 2IYPA 4BHTA 3LYLA 1LBEA 4B4OA 2J3JA 5CP8A 3UH1A 4ZRNA 2C82A 2QRKA 5KVCA 1HDXA 3W4KA 4YT8A 2EJWA 2OL4A 3TNLA 3M2TA 5AXAA 1OC2A 3D0OA 1A27A 2VYVA 3IDSA 2ZJ0A 4Q39A 4D0SA 3ASVA 2D2IA 2WYVA 1D1TA 4NJMB 2H63A 4ZD6A 3S2EA 4ZVVA 4IDFA 4DQVA 2VRCA 4A27A 8ADHA 3H8VA 2QZ9A 2VWGA 2Q45A 5TJ9A 4PN3A 3DZFA 2HU2A 1D7OA 5JC8A 4Y98A 1YH3A 3HB4X 4IMRA 4AFNA 4J4TA 4LSMA 2W4QA 4XRRA 5U4QA 2PKRA 4BGUA 2DBVO 4YT2A 4E6PA 3KZVA 3ON5A 3IP3A 1HE2A 4CM6A 3U5TA 1DIAA 2NUAA 2RCYA 5JAIA 1Q0HA 3HDJA 4RPLA 1B26A 4FFMA 2DTXA 2Q1TA 3JQ9A 3JQ7B 1J49A 3PDJA 4IQ8A 1VE9A 5EERA 3NTRA 1QMGA 1MLDA 3MZ0A 3ENKA 4RVHA 4CLOB 1EE2A 3AM5A 4L4RA 1ISGA 4E3ZA 4MJLA 4GX5A 4IXWA 3DO5A 4BKQA 2CNBA 3B1FA 1K5HA 3NX4A 5TJHA 2DC1A 1DAPA 1N92A 3RQSA 3H9QA 1MG0A 4WOJA 1X13A 4CR6A 4QUKA 2ZQYA 3LDHA 1NR7A 3O03A 4XYEA 5K9ZA 3MTGA 4E33A 1O9BA 1IOLA 5TLSA 2B35A 2O2YA 3OEWA 5FWNA 4L74A 2EV9A 2PZLA 2OO5A 1V3VA 1NFFA 1BRMA 3D4NA 4IDAA 1QYWA 4TVOA 3GUYA 3GGGA 3JYNA 3ONFA 3DMYA 8LDHA 3WTCA 4ZQFA 4WLNA 1AHHA 3OJLA 2AHRA 1GCOA 3BMQA 3WGQA 4Q3EA 2JKVA 2JFFA 4CLHA 2ZB4A 5U1PA 3NGLA 3JQCA 1KC3A 2AA3A 2RIRA 1K6IA 5T67A 1M66A 3LF2A 5CG2A 4KTTE 2PD4A 3ZU3A 3GG2A 1GL3A 1I2CA 1GUZA 3LVFO 3BIOA 1ISHA 1CQIA 3RSHA 4FBGA 2D0IA 3VPFA 5JW6A 1XDWA 3C7CB 3ANMA 1N2SA 2GZ3A 2HRZA 3I4CA 3KBOA 4BNXA 1OC4A 1BXZA 4NNJA 3B70A 3Q1LA 4CR8A 1RM3A 3PK0A 2AQIA 2GN9A 4CLRA 3A1NA 1U2GA 2OUIA 2PD3A 1EFLA 1E3WB 3DEYX 2GZ2A 3NT2A 3E48A 4J90A 3AU8A 3ZZNA 3U4DA 5EL0A 4II3A 2CD9A 4FFLA 1H2BA 3PWZA 4TRMA 3ZHZA 2NLOA 5G0UA 3OEYA 4TRJA 2FN7A 2O23A 1W73A 4GI2A 5JO0A 5BNTA 4JJGA 3FNEA 4MVJE 4FW8A 3VVCA 2YDXA 2D3TA 1YQXA 4B8WA 4FCCA 4BS9A 5IF3A 3PZRA 1KY4A 2HMTA 2FY8A 4GX2A 3STHA 2JL1A 1KVQA 1BXGB 1WWKA 4FFRA 2G1UA 3WBFA 3TSCA 4WCFC 1BTOA 4J49A 5TSDA 5THKA 1WMBA 4G81A 1PS0A 3FR7A 3PDUA 3AOGA 1NP3A 3WQRA 4BO6A 3UXYA 4IIVA 4EW6A 3MWDB 1HE5A 2XF8A 3JSAA 4N5LA 3WGYA 2PK3A 3AY7A 2WD7A 2ZTUA 3DZKA 3JYOA 3SJUA 2FPIA 2Z1NA 3GVHA 3WNQA 1GUFA 3PXXA 3JYQA 3D7LA 1J0XO 1QYXA 1MXFA 3VOSA 5FF9A
chains in the Genus database with same CATH superfamily
5D7BA 3PD1A 2P0YA 3AIIA 4I9HA 1ADFA 1WDTA 2DH5A 3K4QA 3GFFA 4M1MA 4R8RA 3HDTA 1MB3A 3O92A 3JXEA 4MQEB 3CUYA 1UXGA 2WLSA 4P2BA 1YI0A 2VSNA 1XRRA 3H1AA 1AQ6A 3QPCA 2G8LA 4JLNA 4Q4JB 5DMHA 3R9XA 1C4KA 1DB3A 4W8OA 1KH1A 5A62A 3TLGA 4NH4A 1SBYA 4NK5A 2X8BA 3IKTA 3KUCA 2QL5A 1FXUA 1RWWA 4R2MA 4TWBA 1NVKA 2A7QA 1MP0A 4I81A 4U2EA 4R7TA 4PZUA 1JHZA 1MH9A 4B33A 2N42A 5ECGC 1SQGA 2CL5A 3O95A 5F35A 4NENB 3KWLA 3QY0A 4MVJH 1UBOS 3NWBA 5FOTA 3ZLJA 2X0JA 3E2IA 1R50A 4EG6A 3ROQA 4HYQA 4RZUA 3ZDYB 5BN4A 3VC1A 3U40A 2PA0A 2ZBFA 2O8VA 2I62A 1ULBA 2HK9A 3U9LA 2YR0A 3EYWA 4I2NA 4AJEA 1QDEA 3TUTA 1YCGA 3QLUA 5HFAA 1ZGHA 3U3KA 7ABPA 1V1RA 3EIQA 3MELA 4AP6A 1MORA 2Q50A 1SXJD 2XB6A 1EP9A 4M49A 2PLFA 1WV0A 3L0OA 1WMAA 2PN1A 3O4VA 4QBFA 3HACA 5CG1A 4PWYA 4ZYZA 2HBRA 3R5JA 4N0MA 3PHHA 2OLKA 4TSFA 4CXMA 2KW5A 2A58A 2HCJB 5BNFA 2FOIA 1NR1A 1ULSA 3QFSA 5DMXA 2ADOA 1G21B 2VDWB 4QDTA 4OX9B 4RADA 2P6NA 2GN1A 3EFOA 2DJ5A 2GAFA 3IPYA 4TWIA 4B3IA 4BRSA 2J5XA 4DV2B 3BQMB 1PJLA 2VWHA 3HZZA 2NMVA 2PUEA 4ON9A 1PDVA 1RR6A 4R0VA 3KJIA 5AI4A 3TLBA 2IPNA 1MO4A 2JIZA 4JJEA 4P38A 4ZAVA 3AEXA 1DWQA 3UT6A 2WWIA 1G8JA 1U0FA 2ACKA 2FEPA 3BFVA 4Q24A 2DUUA 3WYCA 1A5BB 5HJ2A 5IN5A 4B6SA 3THXB 2UYOA 3RC3A 5KKNB 2ZAMA 4L5CA 4DGQA 1R5JA 3ABZA 3HLKA 2XYRA 3R6DA 2CHFA 1VHDA 1T0IA 1PX0A 1EEHA 1GIAA 6LDHA 3MVEA 1E1QD 1SHJA 2OP1A 2OTCA 3BSFA 3DDUA 5EXDA 5EQTA 1ZC4A 4ZWNA 1O6BA 3MRSA 3WIDA 3IWCB 3OMLA 4UULA 4M0FA 3L9XA 2I6SA 5JSZB 4EPTA 3A4NA 3BWVA 1XP8A 4ZICA 3Q7QA 4RO0A 3STTA 1QZZA 4HDKA 4JXZA 1X7XB 2HFJA 1JQEA 1MQ9A 1H0SA 1Q95A 1RHRA 1UP6A 2EFJA 3OMWA 1UJ6A 4NCKA 4WNCA 3VV2A 4E5VA 4BC0A 1PU2A 3AVVA 3P97A 4WZBB 2ONZA 1WE2A 1VPDA 2IIPA 3IIIA 4LTNA 4NJEA 2AMFA 1IN1A 4HAYA 4U7FA 1M6EX 2X0EA 3G79A 1G5RA 3T5PA 4FSHA 4A1FA 3X2SA 2O7QA 4CE6A 1VJ0A 5AIBA 2F1KA 2FN3A 4TTPA 1WUYA 2HSWA 3G0DA 3DCJA 3WO1A 5IBCA 5C7OO 1YR8A 2H0RA 1JS1X 3LRPA 3PFKA 2DJIA 1QFJA 1P1IA 1RKXA 3PDHA 4EL0A 4JYZA 1S2OA 3EVTA 1T3ZA 3QI7A 3VPDA 2C4KA 2ID4A 4O2AF 1AKUA 2Y27A 2N9UA 4Z4EA 3DBVO 1MD9A 3ZUGA 3ETEA 5CT9A 3TL2A 4QUEA 3HB5X 1XTKA 2D3WA 4G85A 2HPZA 3GDHA 1U7TA 1YBAA 3KR2A 4FCVA 4H7JA 1OAAA 1FP6A 1ZYUA 2D1TA 1IY0A 1AKEA 3WLOA 3RD5A 1TLFA 4PU0A 4BO1A 4YV2A 5IZCC 1R00A 4JI2B 4L4ZA 1DRJA 1VCNA 5EPEA 1WBDA 3KQYA 1J0BA 3KAJA 4G5GA 1DKQA 3EOZA 2SHKA 4KXQA 3S7TA 1VFPA 3CEMA 5FI1B 3KK0A 3DKPA 4W99A 5FOVA 2V59A 4G0NA 3GT4A 4TS3A 1JLLB 5FEUA 1MH1A 3JQQA 4EB3A 1DIGA 2XQIA 2KBFA 3PBKA 3BICA 4NEGA 5H7XA 3RIHA 3E6AA 2AOTA 5JFGA 5G0VA 4RYDA 5L7TA 2J0VA 2X5OA 3RLFA 2IHUA 4LZNA 3W04A 1CQJA 1NVTA 6CHYA 4EIWA 2VWQA 3DONA 4WEOA 1VJRA 2ALJA 2XTMA 3TIIA 1G9XA 4L07A 3WYNA 1Y4ZA 3DXFA 3D6UA 1Z3IX 3LU1A 1NX6A 2YQ4A 2HM7A 3D3WA 1LRLA 3H99A 4XTRA 1DPGA 1O5IA 4GICA 1K8XB 1QFYA 5L3QB 4QRDA 4GGPA 3CGWA 1G2QA 2VYQA 4EGJA 3I2FA 4A6EA 5DN9A 1ZCAA 4LJ9A 4MKZA 3ML1A 4M0CA 4EFLA 1PS9A 1J8VA 3EDMA 2N1BA 3V55A 2POQX 4QFDA 4G4JA 3AYXB 2I3DA 4C0WA 2GXSA 1WHSA 4L9SA 3DVRX 4TXJA 4IRXA 2C0PA 1EB9A 2H1SA 2XKAA 5IT5A 1PZHA 2A0XA 2GM5A 1B43A 5IJ0A 1BC5A 3ERCA 2XEDA 4KYTA 1YDWA 1KXJA 3MCUA 1GG8A 5MHTA 3IP5A 3L5KA 2FXVA 1N7JA 1R4AA 3BZBA 4NE7A 4OQ4A 5H5JA 1XCGB 4C30A 4A6DA 4F97A 3NQ41 4L57A 1RE1A 3IAEA 3NGMA 3UKOA 4DBZA 2XD4A 3QITA 4JJFA 4NBKA 4FWBA 2WJVA 5IRCD 4ZT6A 3PD7A 3RRJA 5I4CA 1KYQA 4IDQA 4HBGA 2M6KA 2FSIA 3W8RA 5EJ6A 1PV4A 8ABPA 4Y1RB 1FDIA 4B84A 1JHAA 2EX1A 3M6LA 2VHUA 5LKRA 3DOHA 1PK7A 3USCS 2IKSA 5JECA 1PG5A 1UIRA 2H31A 4DA7A 3F96A 1LUAA 3H5TA 4QBHA 4EJFA 3GJ5A 1IZ0A 3DMRA 3KGDA 4KSCA 3TDMA 2YZKA 5JS7A 3HEAA 5F5NA 1KMHA 2JLBA 2XWQA 5EVCA 4BAZA 1OLXA 5AW7A 4UM8B 5BR7A 3Q8LA 3ZIAD 4H3VA 1JFVA 2JHFA 1TEHA 2IDZA 2GD0A 3HCNA 3C16C 4KFRA 3GGJA 4P3PA 2PT6A 3EC2A 1A7AA 1SZJG 4CRWB 2Z8YA 4GR9A 1DUSA 4ZXPA 2C88A 2WFLA 2RI6A 1YJ5A 5BOVA 3PI7A 5EAIA 2XAAA 3BL6A 3S3TA 3MRTA 2WTAA 3HXPA 5D8DA 4YRMA 4EBFA 4FFOA 2X5JO 4LBWA 3W8EA 2R6FA 5JJIA 5KDLA 1ZRSA 3QVSA 2IKQA 3W4JA 3GJQA 2ZAOA 4J03A 4OGFA 3DLIA 1RQ7A 2CFSA 3EHEA 4R2LA 3R7AA 4Y0AA 3SS8A 3HKBB 2XITA 3O21A 4NWIA 4W9NC 2WWRA 5JAZA 5BOSB 3HLTA 5CX1A 5FBZA 4EM6A 3WQQA 2E4AA 1P2GA 1ZL2A 4LY9A 4UU7A 1IBCA 3DFZA 4QKQA 2R11A 2VF7A 4UTVA 2PS0A 1PFQA 3MPOA 1U02A 4ETNA 4HDNB 3UG6A 5KQSA 2YUIA 1WPGA 3REFA 2OHFA 1VDZA 1C1DB 1PNRA 1QQAA 2A0UA 1GTSA 3MLEA 4NNOA 4RSGA 4WOPA 3RRXA 3B6IA 1QP8A 1X0VA 1XROA 4B79A 1EVQA 5H82A 4WADA 1VL6A 2DT5A 4PX9A 5BUCA 1PFGA 3KSZO 3HO8A 3ZOKA 4RKRA 5CFLA 1NRJB 2HXSA 1Q0LA 3KD2A 4EFKA 4JYMA 3C1AA 1R74A 4HN2A 1TZ2A 3GT3A 3AKDA 4ACAA 2AIRA 3OIYA 4MUYA 2Z2KA 3JQBA 5EXEA 2F1RA 2BDEA 3T7IA 1F7UA 2IS4A 3C15C 2UDPA 2NXEA 4CQMD 1NL3A 1T35A 4OGLA 4R1TA 3CLRD 4DY6A 3CF6R 1GA4A 3KQKA 4PYNA 1A5ZA 1Z6GA 2GCEA 3KJQA 3KKZA 5GVRA 2F59A 1HFWA 1LSJA 3RVMA 3L9WA 1ULZA 3STYA 3PQ8A 2GN4A 4BCCA 2E9SA 3ZR4B 2L19A 2UZ1B 1RKBA 4J76A 1OPRA 2PVPA 3GD7A 1MC8A 3UAWA 4QPJC 5CM9C 3KB8A 3LYHA 2HHJA 3WWOA 3CINA 1ZH6A 3IAS1 4ZOQI 4C0KA 2VUSA 1N7GA 3G2OA 3L1VA 2Y76A 2B30A 4ZOAA 5DBGA 1JEQB 4KMMA 3VYWA 3BZUA 5CA1A 2R6GA 4OI0A 3P0IA 3OJCA 3EBLA 2RC5A 1EJ6A 4MZDA 5KVSA 3RRBA 2H00A 5ECYA 4RVNA 4D9GA 4A6XA 1RXSA 1QE0A 1JG3A 1GGKA 2BM1A 2ILVA 3N6VA 1A0OA 3NALA 5ENDA 5LMNB 3NXSA 3ETNA 3O8BA 4GZ6A 4I55A 2CVZA 2YW2A 4XGRA 1R9GA 4A2CA 5H70A 4LWOA 4PRLA 3ZDDA 3V3KA 3D4PA 1KTVA 3I0ZA 3GLHB 3AUFA 2JCXA 3C6KA 5ESDA 5C0OE 1CUXA 1A72A 3QI2A 1K7FB 2EZ4A 2EZ8A 2XMGA 1C1YA 1ATZA 3E22B 3V1UA 5AJYA 4CCYB 1YRQA 2R8OA 4QPZA 4DPMA 4R01A 1A7JA 3GQBB 3VU1A 1JHXA 2PPLA 4PC3A 5G1OA 1P1BA 5TRTA 3ZGNA 4BB5A 5PNTA 3EPLA 1W0JD 5KHAA 3HFGA 5LOVA 4ZMRA 1QK4A 2PQMA 4BTLA 3MJDA 3OZ7A 4X66B 1FYVA 4N7JA 4IVPA 3HBJA 1ZUWA 5SZHB 4DE5A 1YZLA 1XCBA 3H8WA 1ND5A 2JFXA 1T1EA 3K5PA 3MOIA 1EWQA 5JOQA 2HIMA 1UBTS 4ND3A 2VAPA 3EZ2A 3VOBA 3C4JA 3JQ8A 4HRVA 3OLVA 4Y6QA 1NBHA 1UFVA 1RRMA 1W6RA 3L4SO 3ITNA 3MB8A 2F2TA 4CKZA 1I9GA 3R0JA 4X62B 4OLHA 3L7MA 4RH1A 3MT7A 5FNVB 2BSAA 5A3RA 2ZBPA 1RP7A 1IWPB 4GXNA 1ZK1A 1XKQA 2IYOA 1K3TA 2V0GA 1E2DA 1RABA 1W88B 1UBGA 1AKVA 5M34A 3AJAA 2R8XA 4WKPA 1P73A 5K8UA 1V4NA 4EKDA 2COEA 4O4LA 1M0TA 3NWOA 3OUTA 1GEEA 1CUUA 2YHIB 3G1UA 3UOAB 4BIMA 1U3VA 4H1TA 4H1VA 5G1PA 3WIOA 1E7QA 1YZHA 4MPJA 4P7JA 1WUIS 1R4ZA 2R6DA 4U7TB 1AGYA 4ZC8A 5T41A 5AW6A 1DCMA 3CW8X 1IBSA 1G0NA 1U2DC 3AL3A 5TS3A 1AA9A 3E3MA 2Y1CA 2QRMA 3BORA 5EG5A 4BTEA 2IEGA 3QFFA 4GX1A 2C3MA 2CXSA 2ZYGA 1PWXA 4DDKA 2XODA 1PKEA 2X0IA 3OOHA 4I1SA 1M2EA 4TM8A 5AHRA 5A1JA 3NVKI 4C7OB 2EBUA 4ZOEA 5AVOA 3A9WA 3EAFA 4D1YA 4QUAA 4FJ1A 1UCFA 4RAOA 1ORIA 4IO0A 3W3ZB 5BN4B 2OMKA 2XYHA 3IAM6 5A0FA 3PF8A 3WDKA 3S8MA 2IGTA 3WFJA 5K3DA 3TTWA 4OUDA 4RCVA 3L4KA 3PFNA 3G5UA 1V1RB 3U4HA 4M38A 4MQMA 3WHIA 3KOYA 2HDHA 1K6EA 1L6RA 2J3HA 5CCDA 1CZUA 1FFBA 1V35A 4ZQBA 4WL0A 5JS6A 1WXHA 1YRLA 3PFCA 4OQEA 5DN6D 3D6FA 4Q47A 4WGGA 2HJ9A 5E7QA 1NYLA 4HK4A 3ZQJA 4EMSA 3QWIA 3EFOB 4O5OA 1OV6A 1LTKA 1QP0A 4ZDWA 2W37A 2JD2A 3CMMA 1TKRA 5CVCA 1GKIA 3TQOA 1L7NA 1GZ4A 1SXJE 4JJZA 1T8RA 5K0BA 5KTSA 3H2KA 4EG4A 3A36A 3DGFC 1KEWA 3T1NA 1CCWA 1OYWA 1E4OA 3F67A 3QYJA 3NHFA 3O3MB 4ZP1A 1QHIA 1ZGGA 2IPLA 3AHHA 2R48A 2YBDA 3C7TA 4QELA 5K51A 3NNNA 4JI6B 2ECPA 3TLAA 5JYCA 5C5CA 4A6PA 1FEZA 4TXMA 1HBJA 4MAFA 3IUBA 1CWUA 2GPSA 3H16A 4JUAA 4MX8A 3RK1A 3H0EA 4CUZA 1WXFA 1IMOA 1WX1A 1CY2A 1P9OA 4II7A 4D8YA 4R6WA 3GP8A 2VZ0A 3EZYA 5J23A 5KU7A 1TF2A 5ALYA 4REOA 2O3JA 2WF8A 3JD3A 2GJ4A 1XCPA 1VSTA 2CLEB 4JWTA 3IR5A 5CLLA 4HDKB 4BNMA 2W90A 4YACA 1PJ4A 1IVNA 1X7ZA 2PTGA 1LK5A 2ZWMA 1MW8X 3B8HA 3Q0EA 3HC7A 4BKPA 3BSYA 3KLNA 4O4JF 1SB8A 3VI4B 2B21A 2I1LA 4L51A 2PUCA 4EUEA 5J2TA 4WEQA 5ES4B 3PNLA 2J0QA 1RXVA 3SX0A 5KC9A 4XIYA 5LBIA 3W5SA 1MO5A 2O07A 4RL4A 1YZQA 3U09A 2OV1A 2HPHA 4BU0A 1B15A 2F1JA 2XMRA 3DCYA 1L5HA 5FFFA 4MJXA 4YPOA 1XTVA 3CX4A 4LDAA 3ETGA 4Z9FA 4KDCA 1NRXA 5KTKA 2AV6A 5B3JC 3OHSX 1G20E 1XKXA 4CU5A 4NONA 2FPSA 5GV7A 2Q5JA 3IUYA 2ODNA 1ADYA 1BFUA 3EG9A 5LQMA 4N41A 1K4YA 3ANYB 4EUHA 4QYXA 2CXRA 1TL7C 2WUWE 4BVFA 4QNMA 1W96A 3MGCA 4OEHA 4RPIA 4EKIA 1N8TA 1T9BA 4R8KA 1GZDA 2NYAA 1XAHA 5CLHA 3B5IA 3DNPA 2Y4NA 1FDTA 1K9SA 3EDOA 1D6NA 3UCFA 2PWAA 3ACBA 3HNPA 4G8DA 3DZ7B 1M8PA 1F17A 1WBJB 2B36A 3CUTA 4YC7A 3O4RA 1AF4A 1VFNA 3W5DA 1U8FO 1RYHA 1C7FA 1KKLA 2IUSA 2WU8A 3O2SB 3VH1A 3EVEA 4YI3A 1H0KA 4GP6A 5JQGA 4S1WA 4C89A 5DNVA 2O7RA 2GHRA 1QVAA 4EAQA 3X43A 4WXYB 4I1IA 3L6BA 4Y2PA 4QT4A 1TU3A 1HT0A 1ESCA 2FR8A 2AOTB 2C9OA 1E9FA 5D6NA 3PWKA 1CQJB 2JRLA 5IAKA 2JFGA 2O06A 3L8MA 3K94A 5SYNA 4EMTA 1E6LA 2RHMA 4ID3A 3FVTA 2OCGA 2PUHA 4LSWA 3D3WB 2H29A 4KVGA 4BX8A 3F8TA 1E3LA 4HFMA 4TWZA 3WMWA 2BTQA 3SICE 4XWKA 5HDBB 1LS6A 5JS2A 4F1JA 2NNWB 3PYXA 4IR7A 4GYWA 3K2QA 3DOEA 1IN7A 3EGVA 4M1KA 5CXXA 3OA2A 2OZKA 3TLEA 1LC0A 1LKZA 3ZX4A 5JBQA 3GPLA 2FK8A 3TDKA 4K40A 3QXGA 1JJFA 4QWMA 4BFZA 1QVVA 4KDEA 4C0AC 1K86A 1VQ1A 3FWNA 3IJRA 3FUUA 3FOEC 1WF3A 1BHSA 4YBRA 4F1WA 3REGA 2P1DA 2ECKA 3DZJA 1R1DA 1VMDA 1KOJA 2PBFA 5K3EA 3DR5A 4PYIA 4C0QC 4Y9RA 2DBYA 1H5UA 4EB6A 1QB7A 3RNLA 1F20A 3G2JA 1GLVA 5EEGA 1ZSVA 2HJWA 3KXPA 5BQ3A 4CM3A 2GZDA 2AW3A 4QLBA 1Z8HA 1KVSA 2IZ1A 1JLMA 3OEHD 4JT9A 2CL6X 1Z7YA 1LDMA 2PL5A 4QX6A 1GRQA 2Q2VA 3KPUA 1W0KA 4JR2A 4KPYA 3OIGA 3CKMA 3QVXA 4OH7A 4BFVA 2A57A 3NU1A 4XUGB 1X1QA 1Z4MA 1O57A 3OZVA 4GBJA 2E87A 1VLVA 1L5MA 3MLAA 2I4TA 4IQ4A 1X2BA 2QGFA 2BBSA 1QIFA 1ZFNA 3OTOB 4D57A 1U90A 1DWUA 1V48A 3DWIA 4RMGA 2P2SA 1WXQA 2AG0A 2H1CA 3T4PA 4ZMBA 4BB0A 2P9YA 5LQKA 1OVMA 3ZY5A 5F1KA 2AQHA 2CLKB 4RFLA 2JK0A 5F7OA 1JMYA 3Q85A 2IHJA 1L9XA 3JQGA 2O20A 4OREX 1DPFA 1DXQA 1GARA 2XR1A 1K9VF 3HYCA 1F2UB 3A7DA 3RR2A 4XB2A 2XECA 3I5MA 4GLLA 2C8VA 2NO1A 4B9AA 1O6CA 1XMVA 3GBSA 3NWJA 1TIKA 4GL4A 4H6XA 3DM5A 4DGSA 4E5SA 5BNWA 3X1MA 2CXHA 4QRIA 5J9GA 2AXPA 4HNRA 4PYKA 4G63A 2W6NA 4ZT2A 2VH2A 2D8MA 3G5LA 2O7VA 3RC7A 3BK1A 4QTTB 2WWVD 3SC2A 2BFEA 1I6WA 3WK7A 3GEGA 5EJFA 1DBIA 3GUZA 1K27A 1LPPA 1OUMA 2D4HA 2FWIA 2JGKA 2WKPA 1TUGA 4J7UA 5SYMA 4EOGA 4XR4A 3O1LA 4O0MA 2QG4A 5JTUA 3HA7A 2O19A 1G63A 4QEDA 5I9SA 3CRRA 5CX1B 3ZZ0A 2ILTA 1DFGA 1XZNA 2HLDA 3EDQA 3KZ1E 1JAIA 1RLTA 2PSFA 2VWPA 1TYDE 3N2EA 3KKOA 3OOSA 3CNOA 3WLSA 3THWA 3UG7A 1YDHA 1H2XA 3NBQA 2E48A 3LQKA 3MSCA 4BJ5A 4ED9A 4DLBA 3V1LA 4TV9F 4PQRA 3T0FA 1NU6A 3EXEA 3MEQA 1QLWA 2GBFA 4GUDA 1WEKA 1PVDA 4JBYA 3QQ5A 5TMEA 3SF8A 3ECSA 2EX0A 2G7MC 2Q4RA 2W83A 1YRBA 3FDZA 2WU1A 4MS3B 1DIOB 4OOEA 1R6XA 1CNEA 3FWZA 2MSNA 1D1SA 1YVDA 2J67A 2GHQA 4DBLC 3HKDA 4LVNA 3E9MA 3H6HA 4OBWA 3I5YA 1H69A 1BCSB 4LC0A 2WQZA 3NIGB 1LBIA 1C1XB 3WZ2A 4R54A 1CV2A 3PNOA 3PUZA 2OBFA 1EK1A 2XWBF 3JSXA 3PIDA 3F7TA 4PSVA 3ND7A 2QN9A 5I9MA 1V4BA 4HFNA 1UKVY 4LN1A 3TUJC 4F72A 4UREA 3U2QA 2HR1A 1E2JA 4Q21A 5B1DA 3A2MA 3W2TA 5KYWA 1KI7A 2DQSA 3WGKA 2XXAA 2KLBA 3GT7A 1XPJA 2IX9A 2ZE5A 1T6YA 3QQPA 1ZBQA 2PCLA 4NR0A 2DXIA 1F2DA 1W4CA 3R23A 3LZCA 3S6JA 3M6VA 5DIZA 4A2WA 2NAFA 3U7JA 1O6GA 4GM4A 4QDXA 4R8MA 4FMCB 5CCXA 1T1JA 3A6ZA 1Z5VA 3UM9A 4M8IA 4M89A 1XFAA 3M33A 1II9A 1K4KA 3V7NA 1TFRA 4PG8A 5EKDA 5EPUA 3UT5A 2R7AA 4AP9A 2GZAA 2H9IA 2M6RA 1U9IC 1XX6A 4QLOA 3B5JA 1F14A 4EI9A 5LLTA 4AXXA 4UOQA 1PWZA 3A0RB 2IYQA 3EZ7A 5JRJA 1L7BA 4MS1A 3UK0A 4DJDC 3WIVA 2VPXA 5DYYA 3ZLTA 3O9MA 2QVYX 4BAUA 3FDXA 5B1YA 2QBYA 4WT7A 2Y1EA 4I55B 2H1RA 2UUPA 4I1PA 1ODIA 2YFYA 4JR0A 2B98A 5FB3A 4IS3A 3SR3A 4Q9LA 1TQ6A 2QRUA 1XEXB 1LI5A 1EDZA 1WR8A 2XZOA 3NHZA 4IZ6A 1FXWF 1QVZA 1JR3A 1JJIA 1M7HA 1QAOA 2HF8A 4R3NA 3R0ZA 1NAIA 3LYAA 3UHJA 3KVVA 3V6MA 3VQTA 3UB3A 3I4FA 3UWKA 3NATA 4Y6LA 3VUFA 2YWDA 1XMXA 2YY5A 5AKXA 4YMLA 1E79A 3QVGA 4RPKA 3E1SA 2Q4EA 4URZR 2XT6A 5LOVB 3JWJA 4GECA 4HSGA 2ZUUA 1YBMA 2QLTA 2QJWA 1V8DA 1FDVA 1Y4DE 1Y34E 3O8DA 3E9DA 3WGZA 1BD4A 2HQOA 4F3RA 4OMDA 2AF3C 4MI3A 1CUBA 3ZN2A 5K05A 1KJ9A 2XE6A 1TQ2A 2A78A 2P68A 3JQ8B 5AO9A 4DCOA 5JISA 3NEPX 9MHTA 1T5HX 1XNJA 5M29A 4PZ9A 1XWIA 5FJJA 3W3AH 3JY6A 1JXOA 4UUQA 2VN8A 5CT8A 3D81A 3KRTA 2X19A 3V1TC 5C46F 2J5BA 1DJMA 5JD4A 1WETA 5I7VA 4JA2A 3U9SA 1GPAA 1JSCA 1T5TA 1SQSA 3RJTA 1H6DA 9GPBA 2QG6A 5FPSA 2V3WA 1A2KC 2G0NA 4LY6A 2AF4C 4UNPA 3ZHBA 3A9RA 1KH2A 1Z06A 1H5NA 3DM9B 3KSAC 2MMGA 3NTUA 1CR0A 1O6ZA 5B7NA 1UBMS 1QYIA 3A6KA 1M67A 5I4KA 3U3XA 2BZ0A 2C95A 1X39A 3LQFA 4ZJYA 2Q21A 4O33A 1F9AA 2KQUA 2P6PA 3KT8A 3OOWA 4IHKA 2NPFA 4B3JA 1CEXA 4EHNA 1BFKA 1XVAA 4W9RA 3JQ9C 2O3RA 3IE2A 1VJ1A 1FX0A 3VU9A 1KI2A 1NSTA 3SI7A 4ENTA 1AGNA 4HNGA 2H4ZA 2K7FA 4EPWA 4KB5A 2BBWA 2GEJA 4E09A 4BNYA 3VHRA 1TKBA 2CXQA 4LJAA 1CY0A 3UTCA 3TD9A 4TX1A 5CYGA 2TMDA 2J7PA 3ICWA 3UANA 2OYSA 2C04A 3A1WA 3VX3A 4C7KA 5GGYA 1C8BA 1CBUA 3BHIA 4CR7A 4PG4A 1ENZA 1HLFA 1VJCA 5L45A 1QQ7A 2WOJA 3ANSA 4JUCA 1XZDA 1OT5A 1V47A 4FVTA 3TYXA 1PD0A 4JXKA 3KHUA 2OLJA 2HRBA 4IF4A 2FEOA 1W49A 3EVGA 2WV9A 4RTMA 1OW3B 5TMBA 2X9VA 1GPBA 3D5EA 2OO5C 3AM1A 2PGIA 4ENRA 2PCJA 5JCJA 3HYLA 3RT1A 4GXQA 1PAUA 2HIHA 2RI0A 3DDNA 5TQJA 4WNAA 4DCVA 2Q6VA 4D41A 4HXEB 4ZEMA 3WYAA 4XYLA 2XA2A 4QM6A 2GNOA 4M22A 4E31A 1OR8A 4DJTA 4IL5A 3H3JA 1ESMA 3Q6MA 3A10A 4TT8A 1JFSA 3ROMA 1KTIA 1EGVB 4NFYA 5HM8A 2H6EA 2Z57A 2CK3A 1ISJA 2EBFX 3RE1A 2HU8A 3CUEF 5LXTA 5ED4A 1ZY2A 1QQTA 3ZGOA 2PU7A 5DSXA 3ZI0A 5JVDA 2WAMA 3FMVA 4Q4HA 3ZY2A 1P7YA 3G17A 4PPFA 3RHSA 4OGGA 2ZYHA 3D54D 1UPAA 3GPIA 5AKEA 1U1CA 1ZR4A 4YJGA 1IEXA 2SKEA 1SU7A 1FSGA 2XXJA 1W2HA 4IOJA 1DXYA 1XZFA 3IQHX 2IW3A 3KLOA 5DZSA 3T9EA 1RXEA 3VYSB 1FP4B 3G0HA 5IDYA 3QGMA 4WX2B 1JWLA 3U3RA 1W52X 3JVVA 1G6KA 1TD1A 2V0CA 2W2KA 3IV7A 3KHSA 3CR3C 2I1WA 4OHXA 3UK7A 2XIQA 1JSXA 3L6EA 4Q1AA 2V7VA 1GGMA 3SP1A 3P71T 4ZI2A 4YX9A 3DR3A 1SBIA 5CB4F 1PGOA 3JASA 4AECA 4YV0A 4Z99A 1EM6A 4PO8A 4KN5A 2IY9A 1Z6PA 3DEFA 3UUFA 3O1IC 4I5FA 1XVUA 2ZDQA 5J2TB 1P17A 1E6WA 3K53A 1KBZA 4Q3CA 3TI7A 2HTEA 3T4UA 4RTPA 4B4VA 4KR2A 1QGYA 2Q6LA 3ES9A 4J2OA 4URVR 1HMPA 3ID6C 4K1LA 3WWZA 4ENQA 1G8KA 3JATB 1H5QA 2WD8A 4C2AA 1DC7A 5E9QA 3WKDA 5F2NA 2VTVA 2WA1A 3UGQA 4EUNA 4ALKA 2UVPB 2ZSEA 4LDZA 5BWBA 5FRDA 2Y1DA 1I7BB 2JAUA 1ZM9A 3EG9B 4BMOB 2YMMA 1KNQA 4GYJA 1QVWA 4ZHQF 2PD6A 3CF4A 2PU5A 3O93A 2NQTA 4FJ0A 1HE1C 4Q9NA 5AW2A 3TJZA 2YCBA 2V7PA 4HAXA 3C39A 2HXGA 3R76A 4AMGA 4CTKA 4YRNA 5AVTA 3NRBA 2ZZMA 2D5AA 4AULA 5HX7A 2HADA 3BKXA 5IUNC 3A3PA 4W5QA 1J1UA 1YO6A 4EYGA 4KNYA 4UMEA 1L8QA 2WRZA 1UWCA 4G8JA 5ALQA 3LXMA 1S7CA 2MSDB 3GVXA 3ER6A 4R1MA 2ZQZA 3BA6A 4KMOA 1TYEB 1U31A 3DKKA 4OMCA 4PS1A 3U19A 1K7SN 1FVXA 2EW1A 3E8XA 1FRNA 2QE7A 3G13A 1E3IA 1UPFA 3NDIA 3FPGA 4HXGA 4QJ5A 3GJ0A 3T7KA 2CBXA 1ZVQA 1N25A 3AB8A 1V9SA 4DV5B 3QEKA 1T9DA 4MVXA 4OK5A 2Z6AA 3JWPA 4J4HA 3WLHA 1N3IA 2XOEA 1S2GA 3B8EA 3ABOB 5BUSA 4LOKA 5AOAA 3N58A 1OXBB 2R60A 4MUHA 4FYMA 3UVEA 1N7HA 4Y2VA 1GTZA 4O4HA 1GAQA 2IP2A 4IAOA 3WKCA 4B47A 4C5AA 1Y8ZA 4WWHA 2ZIEA 1VE5A 4QXAA 4UHBA 4ZA2A 1NJ6A 2LR0A 3HJFA 2PT7A 4OJKA 3WJ1A 3EOBI 3HCCA 2PL9A 4ZARA 3ZXYA 2B1QA 1B3RA 3W3AD 4ZZ0A 1GVHA 1I1OA 2BTQB 5KEIA 2C96A 1T8UA 5IASA 3SDSA 5EZYA 1UBFA 1W85A 4I2VA 5H1YA 3EUEA 3Q98A 4CT4B 2ZJZA 2WMYA 3FTDA 3BBLA 3EFEA 4FMDF 1INLA 1FX1A 1JPUA 3PVZA 4N47A 3UFXA 5JCXA 3MJCA 3DCNA 2MYTA 3AHIA 2AJLI 1ISIA 2RKWA 3SEQA 2VJOA 3FJOA 4QG7A 2VA8A 4EDHA 1C50A 2Y1WA 4NYJR 3PPVA 2JGDA 3LQRA 2WHRA 3ZGXA 4EYEA 3A1TA 3SZGA 4UNRA 1A8PA 2FEAA 2ZI3A 4W1RA 2BSXA 2FW8A 1DE0A 4MI6A 2PXCA 5EVJA 5FCDA 4XUCA 4HNVA 3DMTC 4RNDB 5ALDA 2J31A 5E4YA 3VH2A 4BX3A 1MZVA 1N9GB 3W34A 3RCBA 1XLTC 2QLNA 3OTGA 2B6HA 1JXAA 1XQXA 1YTLA 1SCAA 3FCYA 2I8AA 4NDNE 4Z6KA 4MDEA 1Z6TA 2WIDA 5L6LB 1SN7A 2JB9A 4NV3A 1BMFA 4XJTA 4DIBA 1MTOA 5I4IA 3VR6A 1FU7A 4GWGA 4O4IA 1UK8A 5DNWA 3FBWA 4M8KA 3QE9Y 3D3EA 2OD2A 4G0ZA 2RJOA 4MGHA 4RANA 3F4KA 4AWBA 1Y1KE 1CEYA 1EBUA 2J7KA 3I2YX 1ISFA 2BFCB 1UP4A 5IAOA 3WAGA 3SIPA 2W2MA 2K87A 3DO8A 5JWOA 1MCZA 1BH6A 4MMYB 4HYYA 1A2BA 1WLSA 3K20A 4G8CA 1FCJA 4PX2A 3JQGB 2BHSA 5AD1A 3LCRA 5BNZA 4B75A 2E37A 5IAJA 3UA3A 2PHZA 4H6VA 3ZWCA 5B30A 1RXIA 3IP9A 4U2FA 2IZ6A 4GRAA 2Z04A 3K0EA 4YCJA 3PXCX 2A9PA 5EIFA 3UGTA 4ZVNA 2HBQA 4FTWA 2LPMA 3ZUPA 1TAGA 2EYUA 2DWUA 4F6CA 2YKGA 2D2EA 4L50A 2IHTA 4PZ0A 5A9TA 3TW3A 4UBKA 4LE2A 1GU1A 1XALA 1U6JA 4J6FA 4PQGA 2WKWA 1A7UA 1V9CA 1PK8A 5KWEA 1TNDA 2VDNB 3PPXA 2V65A 5BYJA 1X42A 2R00C 3A9CA 3ZNPA 5C1PA 5JH7F 2QVXX 4JOCA 1AUVA 3URMA 1MV5A 4UASA 3BFKA 5CITA 5I9LA 5F7XA 1Z7GA 3RV3A 2ZIWB 1UUFA 1I3OA 4AZWA 3I37X 2VNHA 2L17A 2WYWA 1RSZA 1DQPA 2VC2B 4KACA 3V33A 5BORA 4O1MA 1J39A 1NUTA 3C1OA 1GILA 5DX8A 5CEFA 3OWOA 2XYPA 4KYVA 4URHA 1FUUA 5BQOA 2I34A 4ZU6X 5KYYB 5DM4A 1B6TA 2I6UA 3EXEB 5C1IA 1ABFA 5D85A 1VBKA 1Z33A 3PRHA 4D9NA 1FS4A 1Y4AE 2PL3A 3MERA 3GPCA 4DCUA 1E2FA 1FYFA 1RI5A 1ZX1A 1CUVA 3BMCA 3SS7X 3L18A 2BH9A 3HKDB 4HUTA 5LP6A 1B2RA 1PZNA 1V6SA 3F0TA 5BSTA 3I6BA 3GCWA 1WOYA 3QPWA 2GBIA 4EUFA 4WCFA 4D98A 1GUDA 4EB8A 2W6ID 1Z83A 4DA9A 3EA0A 4ARAA 4C0SA 4DMRA 2CJXA 4WCDA 1ZEJA 4M1YA 1SBQA 2EHDA 3KQSA 4IFBA 3AKCA 3EJWA 3LM8A 2P4SA 4JLWA 5K0SA 1JG1A 1UDAA 2Z2XA 3C74A 2XXAB 4YMUA 5IAGA 2H8KA 4FE7A 2OE2A 4XASA 3CTPA 3D0RA 3ZK8A 1Q1ZA 3B3QA 4BP8A 4KX3A 4P4TA 5E3JA 2Q4DA 4I19A 3L6CA 3F4LA 3V1KA 4J1QA 4BNFA 5IH7A 5BN1A 4Z7QB 5D1HA 2YV2A 3H65A 5DP2A 3EUAA 5EMKA 5B2ZA 3P9PA 2C7RA 5C8YF 1E6UA 1EJBA 4B6RA 4B6QA 1HV8A 5L9AA 1Z2AA 3MGAA 3SK0A 1AGRA 3T99A 2WM2A 5JAQA 2VS1A 3KQPA 4YQEA 3B6JA 4CM9D 3T3DA 1CEEA 1B8UA 3R8FA 1XDUA 1A4RA 1Z82A 2B20A 1B0ZA 1C7IA 2FN9A 2IXTA 2YXLA 3I34X 3OCVA 3ADOA 1SK9A 1UF9A 4M1WA 1M7GA 3SZLA 2CDBA 2QBYB 1VP9A 5JT1A 4V02A 4W5HA 4E5PA 4P32A 1FE8A 2VNAA 1SVNA 4P4LA 1QMPA 4E08A 5JSHA 4DLUA 2DFTA 1Z7BA 5F77A 3DFKA 2ORIA 4OXIA 1RM0A 3DHNA 4IOLA 4MYCA 1HZJA 3BA1A 1QH0A 4WZAA 3CF2A 4HZGA 1NMEA 3BDIA 3ESBA 3BJMA 1ODTC 2X0NA 1PFVA 3FB4A 1E4YA 3X0DA 4DLSA 1G20A 1SEPA 2VOJA 3TX2A 1DO8A 2EDCA 4N0PA 5JC1A 1Y1QA 5DH9A 3K0AB 3QVGB 1V0JA 5EYPA 1CB0A 2XSZA 4JX8A 3V46A 1HDZA 1ZD4A 3FWPA 5D86A 1EQUA 2GK3A 4XXHA 3RUHA 1B6GA 3LO5A 3PX2A 1K7CA 1DEHA 3DAOA 1DO2A 5BRNA 4Q9JA 5A7HA 2NUTA 1EUDA 2WF7A 4ZIRA 1QRSA 4CTJA 4FFWA 1NVVR 4EKEA 2ZIVB 3DL7A 3TXAA 1NE2A 3O83A 1SQFA 1YDGA 3FNRA 3WB1A 4BFUA 1D0IA 1Y48E 2EG5A 1LBQA 1WSBA 3ONVA 1JHPA 4DBLE 1S1MA 3H9GA 4DQUA 4MQ4A 2BR3A 2ZPUA 1HKHA 4WACA 5H02A 2G06A 2GILA 3D6NB 4X1KA 3HDQA 3CIOA 1E96A 5A4AA 2UYYA 3M1IA 4TT3A 5BVGB 1L5RA 2YFQA 4MV8A 2LTAA 4FGJA 4U8GA 2B6NA 4B6GA 4A1OA 1UBEA 5GGXA 4MGEA 1ZXBA 1H66A 1NXWA 1T5SA 3L7IA 2GDJA 3ND8A 5J5AA 5EIBD 2YIMA 2VQSA 4J7XA 3VO1A 4FB4A 4I1UA 5FYDA 2PVCA 4BNIA 1T4DA 1P81A 3H3XA 2QTVA 1M76A 1W9HA 1S7GA 4WPGA 3KHKA 1UH5A 3TNFA 4DV1B 1E0AA 1YF3A 1RQRA 2JLXA 2AN5A 3BL5A 3SXUA 4ZQGA 1Q1QA 1DEXA 4IRMA 4DLZA 4JUBA 1JSLA 4ZQEA 2A9KA 3AW8A 3S70A 1YZFA 4G5HA 2NACA 1FFXA 1N5IA 3DOFA 3UMJA 4F21A 1KRWA 1N8KA 4DRYA 3S81A 1HG0A 1C4WA 5CBPA 4C4OA 5A3JA 2HMYB 5TT0A 3TLYA 2YQZA 4RHUA 4KQCA 1CX9B 2OK8A 1JEJA 3M82A 1L3IA 2ZRFA 4OIFA 4B7ZA 1JKXA 4DLAA 4GM0A 4ZGWA 5AKGA 3TW0A 2GJAA 4R05A 4GLFA 1I01A 4YGYA 1Y6ZA 5MGNA 3COZA 3NXKA 4F60A 4QGSA 4ZMSA 4GPBA 6ABPA 2FMXA 2QX9A 3R3YA 4JH0A 4U2CA 5C18A 2G28A 5IWAB 3MS7A 4OH1A 2BFFB 2WTEA 4FMPA 3TB4A 2WIBA 3EVAA 1DC4A 2Q41A 3R74A 1VSUA 4MR8A 4UNNA 2E7ZA 3K71B 1P44A 1VKNA 4YJFA 2JFZA 4PYMA 5IAAA 3AJRA 3EODA 4Q93A 3UO8B 1KZGB 1T26A 3IJEB 4JEMA 1NR5A 1XP5A 1FDOA 5KI6A 3U6KA 3H2BA 1ZVKA 1P9RA 4C4ZA 4HH3C 3AESB 4ESEA 2EW2A 4ZT7A 1W94A 1QGOA 5E3HA 2XTNA 1WDWB 1P6QA 4GWLA 2XA9A 3CLSC 2VPPA 5IZCA 5U4XA 4HAIA 5EMJA 3IALA 3KOWA 3WXBA 4D6YA 1CRZA 3KYJB 5LXTB 2XDQA 2P1ZA 2BVNA 4FQ7A 3VPAA 3RADC 1T9ZA 2OQIA 4Q4HB 1QG6A 1OX5A