1T4BA

1.6 angstrom structure of esherichia coli aspartate-semialdehyde dehydrogenase.
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
367
structure length
367
Chain Sequence
MQNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSREEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLRRMLRQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title High-resolution Structures Reveal Details of Domain Closure and "Half-of-sites-reactivity" in Escherichia coli Aspartate beta-Semialdehyde Dehydrogenase.
pubmed doi rcsb
source organism Escherichia coli
total genus 126
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2004-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1t4bA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t4bA01
1J5PA 4QECA 5AYVA 3TN7A 4RVUA 2XF8A 3I1JA 3WICA 1H9AA 1U7TA 1Y7TA 2YFHA 3LF2A 3JQAB 1NPYA 1VPDA 3V5NA 3T4XA 5G0TA 1SC6A 1EQ2A 2VNSA 3L6DA 1A72A 2G0TA 5A03A 5FI3A 1N92A 4JJIA 2E37A 4U8GA 4CUKA 1ORRA 4QX6A 3HQ4O 3RKUA 3WQQA 2WE7A 4LVUA 3Q11A 2EKQA 1TLTA 2AQHA 1LSOA 1YXMA 1H2BA 4E2YA 4DMMA 4EEXA 3AOEA 3E1KA 5BSFA 2GN9A 4E3ZA 2BMAA 4G5HA 1HDYA 1ZMTA 3GG9A 1WZEA 3INRA 2Q1WA 3EAGA 1NPTO 1T4DA 3ZWNA 2UV8A 4KDEA 3IUPA 5FWNA 1WMBA 3JD2A 3GN1A 2VZ9A 1MFPA 3OJOA 4AFNA 1E1KA 1K2WA 3H7AA 4BKPA 3GNQA 2JFHA 1EVZA 2WEKA 2V6BA 1BTOA 4ALLA 5JY6A 2GDZA 4MIOA 4Q39A 3OP4A 1VKNA 3D0OA 1QYVA 2EIHA 4BGUA 4CPDA 2NQTA 4O63O 1JWAB 1EEHA 2VQ3A 2YJZA 3DZHA 1RM5A 1ISFA 3CINA 1R4NA 5I7SA 5KKCA 4GWKA 5L4SA 3MZ0A 1P1KA 1TI7A 4CR7A 3OA2A 4NBUA 3RKRA 4RVFA 4RF2A 4B79A 3AY6A 4A2CA 5AOVA 1VJ0A 3ZWBA 3GAZA 1GYRA 4RZHA 4XR9A 2VTDA 3ETEA 1PGJA 1DLIA 2CDBA 4N54A 5JC8A 1F0YA 1JTVA 1X1TA 3VAZA 2Q22A 4OQYA 3GA0A 5GZ1A 5A9RA 3H9EO 2P2SA 5CDSA 5IF3A 3RQSA 1YDWA 3DTYA 4JLWA 5EIOA 1HDOA 1HF3A 4HY3A 2AG8A 3F47A 1A7KA 3F4BA 3UGKA 1PJSA 3QQPA 2VNAA 3M6IA 4DLAA 2QG4A 3GQVA 4R41A 1TT5A 3PRJA 4N5LA 1XLTA 3WDSA 4J3FA 1JQBA 2GCGA 4FN4A 4Q3CA 3VPFA 1FDSA 1LEHA 3G1TA 2GN8A 4U7WA 3O4RA 4QFCA 4OXYA 2C0CA 2X86A 3QVXA 1J4AA 3B70A 3KEOA 1XA0A 4XGKA 4BNZA 4J7UA 1P31A 2W2KA 4BS9A 1EUCA 4NMHA 5G0SA 3UF0A 1SEVA 1TXGA 4BNIA 4F45A 3HJAA 2ZB7A 1AN9A 3A28A 4FB5A 1MG0A 2YV1A 3W4JA 5DCWA 1T1SA 3EVTA 3WBFA 3L77A 4E5KA 4JX8A 1Y9EA 4CMEC 2VOJA 2OFPA 3DZIA 3UN1A 3DAPA 1PWXA 1CQJA 4D3SA 1I2CA 3KYBA 4U0JA 3UCXA 5JAQA 4WJZA 4YJFA 5TSDA 4E30A 2BRUA 3ON5A 3UKOA 1Q7BA 2HQ1A 4A10A 1WDLA 2PR2A 4AJHA 1EUDA 2AW5A 3P2YA 1XCBA 3OEYA 3WLEA 1MV8A 4C7KA 2XXBA 4DBVO 1O0SA 2FWMX 3TDKA 4EGFA 4YJDA 3MJEA 1E7MA 3ZWWA 1UXGA 4NBRA 5IJZA 1Q1NA 4LRSB 3ONEA 2GO1A 3R1IA 3FHLA 1HEUA 2UAGA 1CF2O 3EUWA 2QRKA 4NBTA 3H5AA 5CPFA 1Z75A 4CMHA 5EESA 1ISGA 2LDBA 5G0WA 1NQAO 1YB4A 2P9EA 5C7OO 3D64A 4PFJA 4E12A 4DIFA 4CM4A 3FBGA 4MP8A 1DOHA 2IYPA 4TROA 1I2BA 5EPOA 3DONA 4CLEA 5CG2A 2ILTA 3JD4A 3DHEA 3BYZA 5M6DA 3DOOA 1KVTA 3FNHA 1A5ZA 1LSJA 3OQ6A 4BUCA 3S2EA 2RAFA 3S55A 1NHWA 2E6UX 5FFFA 5TT0A 1VM6A 1PJ2A 4MDHA 2C20A 2YHIB 1DC3A 1ADBA 4PLZA 1B0AA 1ZBQA 1HZZA 4LISA 1MB4A 3RUIA 2RHCA 3AY3A 2NUAA 3OF2A 1D7OA 1HWYA 3DFZA 1ML3A 3I23A 3W4KA 3O9ZA 1PR9A 2FR0A 4D45A 4XDZA 3JYPA 3BTVA 1B26A 2Q49A 3KLPX 4L8VA 4CM8B 3AI3A 4XD2A 5L3ZA 1N1EA 1ENYA 1V9LA 1P44A 1GZ4A 1IZ0A 3NX4A 4GVLA 4DPKA 1HDZA 3X2FA 5GZ3A 4YA6A 2AMFA 3K2BA 3L07A 3EDMA 5HA5A 3KUXA 4TSKA 5TT1A 1PZHA 3FTPA 4IXWA 1J0XO 3WTBA 3U4CA 1PJ4A 4OXKA 5A06A 4IS2A 1ZK1A 4MKXA 4B4WA 3PYMA 4IMRA 4YJGA 4CLDA 1N8KA 4BGVA 5JDCA 4WEOA 5DNAA 3ST7A 3H2SA 1PWZA 2Y1CA 2D3TA 2DFDA 1U28A 1DFHA 2VWGA 1T4BA 4AG3A 4RCVA 5F21A 3V1UA 2XPCA 4Q3NA 1Y5MA 4CQMB 4DPMA 4TZTA 4AJ1A 3WLFA 2HMWA 3L6EA 1X0VA 1LTHR 3KZVA 4Q9NA 3L0DA 1Y5RA 2FPPA 1UZLA 5IZCA 3GGGA 1CYDA 3E8XA 3EVNA 4BNJA 5U4QA 2D8AA 4U0KA 4CMIB 5DBGA 2B0JA 2PV7A 4A26A 2GRAA 2P68A 2I5PO 4M54A 2JD2A 5CEJA 3MTJA 2PLAA 3QLJA 2B83A 4C7JA 4PG7A 1V0JA 1Y8RA 2ZB4A 2CDAA 1IOLA 3AY7A 3RC2A 1AGNA 2Y67A 4TRJA 3PWZA 4YXFA 5JC1A 3Q9UA 1GUFA 1W4ZA 4JBGA 5JW6A 2Y0EA 3COSA 1B3BA 3BMNB 2Q2QA 1SEPA 1PR3A 4GQAA 4M49A 1H5QA 4IJWA 2W8ZA 1EZ4A 1EK5A 5T8KA 1H6CA 2ZCUA 1VC2A 3NT2A 2NV6A 3ZV4A 1TB4A 3K2EA 1BVRA 1X1EA 4BNWA 3VTFA 1I3KA 1LQTA 3GHYA 1ZIDA 5DP2A 3GMDA 2D5AA 4M8SA 5JPIA 5JCXA 1YRLA 2HMVA 1MFZA 4PVCA 1ISMA 2VWQA 2ZTVA 1P0CA 3F9IA 4ZN6A 3O03A 5DCUA 4NFSA 4OO3A 3WGGA 3BHIA 4FFMA 1NXQA 1W8DA 3ZV5A 5JE8A 2NSDA 3U49A 4PIVA 2HK7A 2VZ0A 4L4SA 3JQEA 5G4LA 2AA3A 4ZVVA 2GYYA 1UDCA 1XWFA 1OZAA 2DQ4A 2ZIZA 4IQ8A 3OJ0A 2CVOA 1JAYA 4CMCA 5LCXA 1EE2A 4EDFA 1WWKA 3MOGA 4IJUA 4E5MA 4DL9A 4DVJA 4JN6B 2Q1TA 1IHXA 2Q46A 3QWBA 3RFXA 1EFKA 3UUWA 3ZU5A 1ZXBA 4IS3A 3FN4A 2FN7A 5EERA 4OKNA 4ZRMA 3NV9A 1LDGA 2XXJA 4WUVA 3RFTA 4ZGWA 4CM6A 1YVEI 3RBZA 1S7CA 3SLGA 4N18A 4YJHA 3RCBA 4AICA 4AJ2A 1DFGA 3L4BC 5B12A 2GN4A 3PYXA 4D43A 1SB8A 1P74A 4J2HA 1Z7BA 4BO9A 4BGEA 2ZJ1A 1HETA 3GVIA 4YAEA 4BO4A 1HSZA 1M66A 3D4NA 3ZCXA 3P7MA 5G0VA 5BSGA 5L45A 5A9TA 1NWCA 2YFQA 2E4AA 1HE3A 2YZ7A 4XQCA 3R3SA 2EXXA 4EI2A 4LW8A 3ZZNA 4PVDA 4IY1A 5HS6A 3UFXA 3UVEA 3ZU2A 2ZATA 5DF1A 5BNFA 4GX5A 3WGHA 5T73A 2EGHA 5L95A 1YJ8A 1R4NB 4KWHA 3S2GA 2O48X 4RGBA 4BNGA 3LLSA 2WYVA 3LSYA 5BSEA 5BSHA 1KIFA 1HRDA 4JIGA 4XZ3A 5EMHA 3DMTA 4EUFA 5FEUA 2R00C 2ZK7A 5I8ZA 4CM3A 1LUAA 4OOFA 3VZQA 1D8AA 1U3WA 5TJ9A 4J2OA 3GEDA 2GNAA 4QEDA 2OO5A 1O94A 1Y81A 1IULA 2PD6A 1EVYA 4IJKA 4HKTA 4J7XA 1UAGA 3F3SA 4PLPA 4E2WA 1OOEA 2CVQA 3IC5A 1KEWA 4K6CA 4RV9A 3KSDO 2HK9A 3GF4A 1IY8A 1I33A 4E5PA 4YAIA 1ADCA 2UUOA 3OBBA 1EUZA 4BQPA 1Z7EA 1U1IA 4MIYA 3EHEA 3IQDB 1UP6A 3TZKA 1QYWA 2JCVA 3DXFA 4E5NA 1TT5B 4ILKA 2GGSA 3NT5A 4KUEA 3JTMA 1GQYA 3E82A 4YRBA 4GKVA 5JS6A 3ZGYA 1SCUA 1WW8A 2A4KA 2GZ3A 4EYEA 1GZ3A 5A9SA 3CIFA 3NGXA 4E6PA 4YR9A 2C82A 1HYEA 1B8UA 2VTEA 3TSCA 1XEAA 2X8LA 3HDYA 2W2KB 3HDJA 3NJ4A 1TT7A 3STHA 1Z73A 2CSUA 4DPLA 3VHRA 3ZWXA 5BT9A 2ZYAA 2FHSA 3FPCA 1E1NA 2X22A 4YTEA 4N7RA 2BLLA 4BNNA 1JVBA 2IE0A 3K9QO 2B5VA 2NVBA 5COBA 4WCFA 4AJJA 1XELA 3M1LA 3BMCA 3GEMA 2BFPA 4GX2A 5KKAA 4J6FA 3UCFA 3I83A 1LRKA 4MVJP 1H9BA 3WYEA 2HKIA 1DB3A 3C1OA 2B37A 4PG8A 2OHXA 1MG5A 1BXGA 4BO5A 4YJFB 2C54A 4QO7A 2FSVA 5JO0A 1HTBA 4IGFA 2BGLA 2JAHA 3Q6IA 4CL8A 4TWRA 1TEHA 3NDJA 3W1VA 3D4OA 1H2HA 3ONDA 4W7HA 3KOUA 1ZK4A 4FFRA 4IDCA 4E5YA 3RROA 3EMKA 3FWNA 3GRKA 2PH3A 1BXZA 2PGDA 2PZKA 5I7FA 1LLCA 2YHIA 5CFZA 4TRMA 4BNVA 3F4LA 5IZ4A 2HLPA 5ICSA 3LT2A 4NJMA 4YCAA 1IE3A 3A4VA 3RU7A 3SJUA 4R68A 2PKQO 1LLDA 5AXBA 5AXAA 5T57A 4LSMA 3AM5A 1UXJA 4CM4B 4RPLA 3NRCA 3KYCB 3VH4A 1F17A 5IXSA 4WGGA 5JXWA 1D1SA 1A9YA 1QP8A 3TNLA 3HN7A 4X54A 3PZBA 2VWHA 4N5MA 5TQVA 1FK8A 1L7EA 3OA0A 4P8RA 2NU7A 3KLMX 5THKA 2XOXA 1MLDA 3BZUA 3JQBA 1QXSA 5DOVA 4HFJA 1R37A 5DZSA 3M2PA 2C7GA 4DLBA 2WD7B 5L4NA 5K6AA 2D5CA 4DQVA 4BO0A 4Y6RA 8LDHA 2V6MA 3CXRA 1PJTA 1Q7CA 2VT3A 1PL8A 2DBRA 2Y1OA 4ND4A 2J6IA 5B37A 1ZSNA 3ZHBA 1XU7A 4B8ZA 3E18A 1ZJZA 4UULA 1WXDA 4Y9DA 4AJPA 4W9NC 4CV3A 3O38A 4DGSA 5KCZA 4HWKA 3EC7A 1PJ3A 2D4AA 3AFMA 1ONPA 1N5DA 3KXDA 4EJ0A 4IDAA 4XQEA 3TL2A 4B7UA 4U6QA 4GL4A 1D3AA 4EEZA 2UUPA 4RF4A 3G17A 5DP1A 1BDBA 4PCVA 1RWBA 2V6FA 1YL7A 1LDBA 4K9DA 1IB6A 5G2OA 3TZ6A 2NWQA 1H6AA 4JJGA 4WLUA 3OJLA 4HUJA 4D3DA 5L7WA 4WEQA 1I36A 4NJOA 4L0QA 3E03A 2FPGA 2I6TA 4J1QA 3TRIA 1QRRA 3PI7A 3B6ZA 4WECA 3ABIA 3WGIA 4J0EA 3TFOA 4BNUA 2X0JA 3PHHA 3Q3CA 1LSUA 4FJ0A 4BKUA 3NTQA 4CLOA 4FFOA 5DOZA 2CF6A 2B35A 1ZKMA 2X9GA 1KVRA 4O1MA 1ONOA 4J4TA 4PLVA 1NQ5A 1QV6A 2OZPA 5TGDA 1KEUA 3PFFA 1F12A 1EQUA 3CZRA 1T26A 4NK4A 4LCEA 4QT0A 1PGQA 3ANLA 1B14A 3SJ7A 4HX5A 4LMRA 3KBOA 1ZSYA 4PLHA 4RDHA 4Q3EA 1CEQA 1CJCA 3WSWA 3VPHA 1K6IA 3JQ9C 4UVIA 1VKOA 4DIOA 1RM0A 3WNQA 3AW9A 5L7YA 1PGNA 1T2EA 3ZW9A 5FF9A 2FMUA 1G0NA 2PZLA 3ZWMA 1GV1A 1YB5A 2Q3EA 3KO8A 3L9WA 4D41A 3JV7A 4FPXA 2QHXA 3C7DB 3DOJA 2HRBA 3MTGA 3NYWA 1K6XA 4ROSA 2H9IA 1VJ1A 5C5IA 4IDDA 4ZJUA 4NU6A 4EJ6A 3AU9A 4IQGA 4NI5A 1BW9A 3PPIA 2YQ4A 1LX6A 3RI3A 2PZJA 4EJMA 3DZGA 4OL9A 3IP1A 4GGOA 4I5GA 4W82A 1KEPA 4I9HA 2O4UX 1C0PA 2IXAA 4IDGA 1KS9A 1ZNQO 1GY8A 5F1KA 3RUEA 1HDCA 2O2YA 3F1KA 1MC5A 5T67A 4BGIA 4BVAA 1YONA 2DTEA 3D3WB 4AJEA 4LN1A 3PDJA 4BO6A 1I3MA 3CTMA 4B7XA 4BL5A 1DRUA 5KJEA 5HM8A 3HE3A 3H9JA 1U5AA 4YEDA 2WJPA 3IAHA 4CMAA 2Y1GA 2CDCA 4YJHB 1ISIA 2ZCVA 3UHAA 3AUAA 3PJFA 3GZNB 1AXGA 1JAXA 2X9NA 3EK2A 5JY1A 3PLNA 1NVGA 3B1KA 3PHLA 1RKXA 1R4MA 2I65A 3F5QA 3TZHA 2HMTA 1K3TA 4NPCA 2Z95A 3ZNQA 4NG5A 5IDQA 3OFSA 2V65A 3JQCA 1PZFA 3VKUA 3ZV6A 5HTOA 3ZU3A 3OJFA 4J7CA 3GH3A 3ROPA 2BKAA 1U4SA 5CDGA 2NTJA 4JCOA 2IZZA 3AJRA 4UUOA 4CMJA 4DA9A 3FI9A 3AM4A 4O59O 2Y0DA 4YVFA 1B7GO 4NFYA 1T2AA 2FR8A 3ADPA 4R5MA 1PIWA 3QE3A 3WS7A 4NZ9A 5H81A 4XRRA 2C5AA 1U3UA 3K6JA 1PSDA 5IN5A 3A1NA 3VPXA 5B4TA 3WOHA 4BO7A 1ISHA 1GTMA 2H6EA 3KTDA 4MP3A 1YL5A 2DT5A 5A1TA 5A02A 3QP9A 3ENKA 1C0KA 1VL8A 4KMSA 4NQZA 2J3HA 1ADFA 2PTGA 2ZKLA 4RVSA 5A3VA 1GYPA 2JAPA 2VHVA 4I5FA 2YY7A 1BG6A 5FYDA 1OBFO 4YT8A 4BNKA 3WB9A 3WYCA 1N2SA 2QQ5A 2PFGA 3QWAA 3B1FA 5F1PA 4E2XA 1E0DA 1N7HA 2Y1DA 1HE5A 1MA0A 3CH6A 2Z5LA 4FOSA 5GZ6A 1L7DA 4GBJA 1I8TA 4II2A 4L75A 4AJKA 2BELA 3FNGA 3SBOA 3OM9A 4TVBA 3LVFO 4Z9YA 2YW9A 1H0KA 4CJXA 3KV3O 3ITKA 4R5HA 3QSGA 3FPLA 3W4IA 2VUTA 3DHNA 4TKLA 2P9GA 4KUGA 1QG6A 5G0UA 3OEWA 4HP8A 3AOEC 3VH1A 2CUKA 3TQHA 4OHUA 5A9SB 2NU9A 3S8MA 3IUSA 1GR0A 1UP7A 4R4JA 4Q3AA 4PN3A 4GWGA 4BNHA 1GL3A 4IIUA 1VI2A 3IOYA 4ZRNA 1JKIA 4ND1A 2NVUA 1YGYA 4DC1A 4QXMA 3PWKA 4XYEA 3BMQB 4IMPA 3KSUA 1EFLA 4R01A 4UVDA 4WCFB 4OJNA 1GPJA 3F46A 2DVMA 4FGSA 4B8WA 2W98A 3BMCB 2EKPA 3IP3A 5ITVA 3PHJA 4GAEA 1BXGB 3SVTA 4PLYA 1GQ2A 3K96A 3ZHZA 4NBVA 3DEYX 3FWZA 4MIEA 2JJYA 4H7PA 2ZQYA 3KYCA 1JWBB 3E9MA 3LU1A 3NTOA 1FJHA 3T7CA 1ZFNA 4WNCA 4OM8A 1B2LA 1ZMOA 4HADA 3V2UA 1HXHA 3OQ1A 1T1RA 4FFPA 4DC0A 4B3HA 1C0IA 3E6AA 3AWDA 3PFWO 3JQ8A 5JBIA 3D3EA 1ENPA 2YDYA 3IJRA 4NJMB 3JQGA 2IZ0A 1GCOA 3OETA 3VC7A 3DZBA 2YHUA 1JVSA 5AQ1A 3JD3A 2WD7A 5COQA 3FR7A 1F14A 5KJFA 3RUAA 2D0IA 4PZDA 5BR7A 4UEOA 3WYBA 4DBZA 3ZHXA 5DN9A 6ADHA 1E5QA 4Z0TA 1NVTA 4RORA 3VZRA 5C7LO 3GDFA 4HNGA 2X0NA 2PKRA 4GKBA 5LDGA 1KOLA 3AFNA 3X2EA 4QSMA 4B3JA 2DUWA 4CQLA 3RC1A 1GZ6A 1FXSA 3ZDFA 1HDGO 4WKGA 3OIGA 5U1PA 1QV7A 4B7CA 2CVZA 2DPHA 4ND5A 5CPBA 4YRAA 2I3GA 3PIDA 2H5LA 4XIJA 2EP7A 3WGTA 4Z0HO 1I32A 1U5CA 1LXCA 4KP7A 1XQ1A 3C3XA 1V35A 4XA8A 3WQSB 3IL2A 1D1TA 3GZ4A 5KNLA 1Q7GA 1GUZA 5L4LA 4PG6A 3N58A 1S6YA 4ID9A 2DLDA 3HSKA 1DBVO 4FDAA 2J5QA 3L4BA 4ALKA 3DO5A 2ZYGA 4QQRA 4Q3DA 2QRJA 3GMSA 5L7TA 4AJ4A 2TMGA 3FBTA 2B5WA 3QRWA 4WOJA 2VN8A 4O5OA 1EMDA 1XHLA 4GLOA 4KOAA 1RYEA 2PY6A 4EBFA 1DO8A 2FY8A 4DQXA 5KJCA 1ENOA 2UVDA 1T24A 4R1UA 4JQCA 3RC7A 5IAAA 3GPDG 1K0UA 3I3OA 1E7WA 1U9JA 2OXIA 1D4FA 3OMLA 4M55A 1I3LA 3H3JA 4XYGA 3K92A 3QWFA 3MJTA 2AE2A 1U4OA 1DHTA 2O3UA 1PL7A 4WLOA 4BKOA 2JHGA 4JP2A 4YPOA 3ONFA 4TZKA 3B1JA 5JDIC 1GFSA 1E1LA 4CLOB 3S2FA 1DIBA 3EW7A 2R00A 4NFHA 2AG5A 2G76A 1LI4A 3DWFA 3K30A 3SX2A 3WTCA 4F6LA 1JU9A 4MKRA 1MGOA 1W0CA 2X6TA 5THQA 5HWSA 4GMGA 1VLLA 1T2FA 1GUYA 3V8BA 5KVSA 1E3JA 5L40A 5KVQA 4J91A 5HRUA 2VRBA 1LDMA 2O3SA 4DUPA 3PK0A 1E6WA 1X14A 3C7AA 4R51A 2WTBA 4AJIA 5CDUA 3RVDA 1JKJA 3D4PA 1O5IA 3GUYA 3GDGA 3H3FA 2OBNA 4DYDA 1R6DA 4XGIA 4MKZA 3HADA 2WMDA 1HLDA 5CAEA 3UCEA 2F00A 4DTIA 2CZCA 4XYLA 2PD3A 3TOXA 1LDYA 3OECA 2HU2A 2NM0A 5KJ1A 2AQIA 1ONNA 1NTOA 4JP3A 4W7IA 1DRWA 1R0SA 5IFLA 3K73O 4PLGA 4OYRA 3D3WA 1LA2A 4LMPA 4QO8A 2NACA 4J9UE 1MC4A 3GG2A 5EL0A 2VRCD 3U62A 2VOEA 5TX7A 1O8CA 5G4KA 1HE2A 4R1TA 3H65A 1R66A 5TRTA 1QLHA 3E9QA 3GZNA 1V3TA 3MCVA 2BGMA 2VHZA 1BW9B 2NTVA 3BMOA 4PG5A 1LLQA 1NQTA 4CM1A 4XRGA 4I9NA 2A92A 1GDHA 2P5YA 4ALMA 3I9MA 2WYWA 4FS3A 5JMWA 4XQGA 3HWRA 1C1XA 3AU8A 3GHHA 1HDXA 1DC5A 3PQDA 1FDVA 2J5RA 2AE1A 2PH5A 3OIDA 1P1HA 3R0IA 1KVQA 2AHRA 4J0FA 1ZCJA 1ZO8A 1M76A 3OQBA 1W73A 3BTOA 3GVPA 3NGLA 2GR9A 4J43A 4DXHA 3QHAA 1GEEA 2W90A 1MX3A 1R16A 4S1VA 5IZCC 2DAPA 1T2CA 3DZFA 2CY0A 2X5KO 4E31A 5B4UA 1V3VA 2Y66A 1QORA 2Q99A 3DL2A 1FDTA 1R4MB 3DB2A 4K6FA 2XAAA 3UW3A 4NDNE 4JBIA 1OMOA 2P5UA 4ND2A 3CSDA 3C8MA 1B3RA 3F5SA 1RPNA 4K26A 1BWSA 3LC7O 3GNSA 2ZB3A 3H4VA 3UICA 5BQFA 3GC6A 3JSAA 4JGBA 3H2ZA 2DUUA 1LC3A 4UEKA 1BDMA 2AEJA 4MOWA 3WFJA 4L76A 6LDHA 2IEDA 3DBRA 3GGOA 5T8KC 5FI5A 4UEJA 4D7AA 2G17A 1YQXA 3ZW8A 5JAMA 5TF4A 3DC2A 5JAIA 1V3UA 3ZNOA 5CP8A 3WFIA 5DBFA 1YL6A 3NEPX 5EQFA 1I24A 1DEHA 4IDFA 2H1SA 3RBVA 1KC1A 1JN0A 1ZEJA 3U4DA 3VZSA 1BMDA 3FF4A 2POQX 3L6OO 4PLWA 3PGJA 4PZEA 3ASUA 5B1YA 5I7VA 3RUCA 4IBOA 4URFA 3RFVA 1SNYA 1P77A 3RJ9A 4CMKA 4O0LA 2FZWA 2HMSA 4MVJF 2JKVA 4IPTA 1DIAA 2I66A 4L9RA 1EDZA 1UXKA 3BMQA 3Q1LA 3QY9A 4O6VA 5T64A 4CV1A 3Q0EA 4CM5A 4DIBA 4I5EA 4HFRA 3G0OA 3CUKA 1UUFA 2RHRA 4B4VA 3KEQA 4GH5A 1Z45A 4A73A 4ALIA 4KTTE 4MVJG 3L9XA 2NLOA 4D42A 3JD0A 2G5CA 4CODB 1TVEA 1DIGA 1JDJA 2NU8A 3PXXA 4RDIA 3KHUA 4Y8VA 1Q0LA 5ADHA 1FDUA 1ZK3A 4CM9A 4Z0PA 2NVUB 1H94A 1E3IA 4WCDA 1DIHA 3F1LA 2O3QA 3ROMA 4IUYA 4P4LA 2ZTMA 3DQPA 2VHYA 4XB1A 3RUDA 3S2IA 4J9VA 4GLLA 5TC4A 1YOVA 1WZIA 3IJPA 2WYUA 3DDNA 4Z6KA 5BNIA 4EW6A 2YV3A 3OSUA 2FR1A 3VVCA 1CIVA 4WPGA 1UAYA 1ULSA 1JKFA 2NQ8A 4IM7A 4LSWA 2WE8A 5I8WA 2Y99A 4E13A 1H6DA 4FQ8A 2OL4A 3DBHA 4Y67A 4TRNA 2Q45A 3ULKA 5A4DA 5JSFA 2ZTUA 4GX1A 2X0IA 1V6AA 4IDBA 3ZWOA 3EGOA 3LLVA 4PGFA 5I7EA 1HZJA 3FNFA 3DMTC 1IHYA 4XIYA 4CR8A 5A5EA 4E0BA 3GR6A 3EZYA 2B36A 4CR6A 1NFQA 2VHWA 5A05A 2E49A 2D2IA 3JQ8B 4OGWA 4RF5A 3I6IA 1NPDA 4YAJA 1PJQA 2Q1SA 2AEFA 2GLXA 5F1OA 3JQGB 2AQKA 4P4NA 4UVGA 2IZ1A 3CPSA 3N74A 1PTJA 2Y1EA 5ILGA 4CM9D 3DR3A 2AEMA 5JO9A 4RL6A 3TZCA 1E3WA 1WDMA 2BI8A 3H5RA 1XQ6A 2OORA 5MGBA 4EUEA 1Y1PA 3RSHA 4ONEA 1PS9A 3D5QA 4AJNA 3AOGA 4CV2A 3NT4A 1O9BA 1XKQA 2G82A 4MVJI 1HYHA 3VPSA 4WE3A 1AXEA 1F06A 3ZU4A 4CQLB 3TJRA 3PIIA 2Y68A 3NDIA 3WBBA 5ITWA 1GAEO 4L4RA 5A3JA 3VH3A 4ZD6A 3BTSA 3PJDA 5MDHA 1PZEA 2A94A 2GUGA 5DULA 4IGEA 1E92A 4FW8A 3MWDB 5DBIA 2JCXA 3DZKA 1ULUA 1SMKA 1P1IA 2C59A 4XGNA 2I67A 1VL6A 3DTTA 2X9VA 3NKLA 2AQ8A 2FP4A 2EJVA 1AE1A 1VL0A 1ZW1A 4M87A 4A0SA 1EK6A 2GERA 4XKJA 5CG1A 1G1AA 3GEGA 2EW2A 1U3TA 3I52A 1CERA 1YDEA 3RD5A 4BV8A 2ZTLA 1NFRA 4YQZA 3VDRA 4YRDA 4OH1A 1X7DA 2EW8A 2W4QA 1LRJA 1QYCA 5JNLA 2BH9A 3O26A 3FRJA 4C4OA 3U09A 3LZ6A 1E3LA 3BXXA 3IKVA 3H6KA 4UVEA 3R3JA 4IQ0A 4QTZA 3TFQA 3TPCA 4E32A 3V1YA 1KYQA 4W99A 2O7SA 2HO5A 1E3EA 4G81A 2C5EA 1U3VA 1QR6A 2DBVO 1P45A 5A04A 1HLPA 2RBEA 3C7CB 2OP0A 1DIRA 2DFVA 2B4RO 3VTZA 3ZWAA 5HS4A 4FIZA 4PLCA 3DBVO 3JQ7B 2HMUA 1WLYA 2W2LA 2HK8A 3K8ZA 1X7GA 1DC4A 2GZ1A 4YDRA 1IYZA 2HJSA 3NDRA 2EKLA 4LRTB 4H15A 3ICPA 1A4IA 2YV2A 3SC4A 1UDAA 3I4FA 4WK6A 1SZJG 2IDZA 4UUNA 3KETA 1C0LA 1N1GA 4MVJA 2FOIA 1KEVA 2H63A 1V8BA 4FGWA 1KERA 3V1TC 1UZNA 3W6UA 2J3JA 3IDSA 3OJEA 4WNIA 4R1NA 3GLQA 1U2DA 1R12A 1JA9A 3RBXA 2Q2WA 3PTZA 3JQBC 3PJEA 3KVOA 1GPDG 1UXIA 4FJ1A 2PGLA 5JAZA 5ENVA 3JQFC 1E7QA 3GOHA 2FSSA 3VOSA 2BFAA 2X1HA 2PD4A 1P1FA 4ITUA 4JK3A 1BHSA 4D46A 5KVCA 3WIDA 3JQ6A 3BHMA 1ISJA 4NIMA 4NNJA 5K6AC 4BNMA 4YAKA 1MXHA 3GVXA 3AI2A 4GVXA 4BNFA 4DREA 4RQTA 7MDHA 1E3SA 1DAPA 4CMEA 3ADOA 2JHFA 4BO3A 1DPGA 2QX7A 1CRWG 4B4UA 1QKIA 4D0SA 3OICA 5I9LA 2X7HA 1M2WA 5JCJA 3V2GA 1DDOA 3HG7A 4CUJA 2Y0CA 3Q9NA 4MO2A 1LDNA 5JYEA 2IEBA 4RPJA 1DJQA 1XGKA 3W8EA 3WMWA 2O2SA 3U5TA 5G4KB 3RIHA 4IZHA 2HRZA 1UP4A 2FZEA 2W2LD 3QIVA 4QFDA 4CMGA 1DAOA 1NAHA 4BNYA 4BHTA 2DM6A 1NP3A 2RH4A 4YT2A 1R0LA 4BKQA 3ETDA 4J4HA 3HN2A 1A7AA 2DTDA 3BMOB 2PGJA 1LLUA 4YQYA 3JYQA 1RM3A 3H8VA 3SC6A 3ETGA 5A5FA 2HUNA 4K28A 4RVHA 1EVJA 4MVJD 4GSKA 2Y05A 4U5QA 3EYWA 2TMDA 4TRRA 1QSGA 1C1XB 4DYVA 4W6ZA 5I9NA 3SXPA 2WM3A 1NBOA 1R0KA 1SPXA 3A14A 2RIRA 1UH5A 3ZWVA 5F3RA 4KZPA 1NWHA 2R2GA 3I9LA 3U4HA 1GD1O 1NR1A 3PLRA 4E4YA 1PJCA 1LBEA 4ZQFA 3DBLA 2QYSA 4UAGA 4YWJA 3LC1O 1M6HA 4J4BA 3NUGA 4EUHA 5AXCA 1NAIA 4I1IA 1MP0A 3ORFA 1KBZA 2EHDA 2PA3A 5TIIA 4ZHSA 1NYTA 2VYNA 2VYVA 2WWRA 3ZHYA 1WPQA 5JCJD 3WIEA 3QWIA 3RWBA 4R9RA 5ICMA 5IDWA 1JLLA 3Q2KA 5LDHA 4EZBA 3AUUA 4AJLA 2OMEA 2PKQP 1GEGA 5KIAA 1WMAA 2EP5A 1ZZEA 3I9OA 5ER9A 4XCVA 1WAMA 4CL3A 3G3EA 5JFOA 4GPD1 1FDWA 1YE3A 1OI7A 4P38A 3LDHA 2QIOA 4J49A 4YB8A 1VSUA 1PGOA 3E9NA 3GDOA 3E48A 1P33A 3GN2A 3QWHA 3QVSA 1M67A 1UJMA 3DBRB 4IJVA 2ZYDA 2GZ2A 2BI7A 3FSRA 5EN4A 4HFNA 2EEZA 1ID1A 1Q2XA 4OAQA 2JD0A 2Q4EA 4WOKA 4BO8A 5TLSA 3F6YA 3WWYA 2VZ8A 1N7GA 2FPIA 4CMBA 1A71A 1QYDA 4ALJA 1HT0A 3T4EA 4RQUA 1EBFA 2NNLD 1F8GA 3CE6A 1RM4A 3AK4A 3I4CA 4EITA 1OC2A 3GVCA 2HSDA 2VUUA 4CM7A 3RJ5A 2QZ9A 4FCCA 2P4HX 4CV0A 3WGZA 4PLTA 4A03A 3ANMA 4XJSA 2DC1A 4DWVA 1P1JA 5DT9A 2Q1UA 1I3NA 2Z1MA 4WLFA 2HDHA 3MJSA 1J49A 2ET6A 3RASA 2VYND 5IN4A 3TF5A 2VYVD 4CLXA 1PJLA 2B4TO 4GGPA 4NBWA 3UOGA 3INGA 4I5DA 3KSZO 3ROKA 1FF9A 4XB2A 3BHJA 3MJ4A 3VKVA 1YJQA 2O3JA 3KRTA 1DHRA 2YDXA 4ZQHA 4GX0A 3AM3A 3A9WA 4NK5A 1IPFA 3KM0A 1C1DB 3H9UA 2QZZA 3O8QA 1K89A 2VWPA 1NHGA 1Z6ZA 5I9MA 4TKMA 3MEQA 2I9PA 1OAAA 2GF2A 3N7UA 4W4TA 1WNTA 3LT0A 2Z1NA 1QYXA 1Y6JA 4FOOA 4KQWA 1KVUA 1J6UA 3GY0A 2QYTA 3BAZA 3OIFA 4RF3A 2JL1A 5ER6A 4P22A 4F6CA 1I30A 5C37A 1YOVB 3D5TA 4RVGA 3W6ZA 3WGYA 3KB6A 1YS4A 3WSVA 2X23A 3P5SA 5JLAA 1T2DA 5J9GA 2P4QA 5JDIA 2X58A 5TJHA 4XR4A 4MJLA 4XEHA 4YACA 3WGOA 3DAFA 4PLFA 2P91A 4PRKA 4RPGA 3WGQA 4Z3DA 4ESOA 3DBHB 5B4VA 1LNQA 2G1UA 5U9CA 2OUIA 4M1QA 3ZWPA 2IYOA 3LC2O 1BXKA 5KJ6A 2PK3A 1TA4A 1NX6A 3P2OA 1N9GA 1ADGA 4ZICA 2O3RA 4UUPA 2SCUA 1CQIA 1EBUA 3GK3A 2F1KA 1CETA 1MUUA 4L4XA 2EV9A 5L53A 1SBYA 3INTA 4UVHA 3GVHA 3JYNA 3QVTA 4BO2A 4D3FA 1LQUA 4BMVA 4BQRA 4HXYA 1NVMB 3KYDB 2NU6A 3U4IA 1E3WB 2JCYA 4AJOA 4YBZA 4S3MA 4MVJH 4ZQEA 1YWGO 3GFGA 1AHIA 1NFFA 2O23A 2QRLA 3D7LA 3JYOA 3NTRA 4BB6A 3A06A 4WLNA 2DBZA 3ZNNA 1E5LA 4H16A 2GD1O 1PQPA 2CF5A 1M75A 1C3VA 4FC6A 4KTVE 4IIVA 5TS3A 1SO8A 4WLEA 1H6BA 4BOYA 4BNXA 2V6GA 4CLRB 4XWYA 1PU2A 3ZNPA 3NJ8A 3GRPA 4J16A 3LQFA 3BTUA 1DLJA 1CWUA 4IINA 3PDUA 3K31A 3DHYA 3W8DA 1M6WA 1MXFA 4BB5A 3I9NA 3VVBA 2VT2A 3HNPA 1SOVA 4LK3A 1K6JA 2D59A 3TOZA 1GADO 2FRDA 5IDXA 1YBVA 5JYFA 1E7SA 3PP8A 1PL6A 3AUTA 4JXKA 3JQDA 3C1AA 1A27A 2C2XA 2VRCA 3JQ7A 1IL0A 5GMOA 1LSSA 1DRVA 2J3KA 3JCZA 1Y8QA 4IZIA 4F46A 3LT1A 4R3NA 4J1NA 5EQDA 1KVSA 1ZUD1 2B69A 2EG9A 4OXNA 3WG9A 4RO0A 2I76A 2GASA 4MINA 4ZU3A 3PHGA 4FBGA 4LCJA 4N5NA 4J1SA 4ZQGA 2AXQA 1NASA 3IS3A 1Z74A 4YT5A 4B4OA 5ILOA 1UDBA 1HDRA 1I0ZA 1PJBA 3CMCO 2C7VA 1ZK2A 3E5MA 4RPHA 1NR7A 1Q0QA 1WDKA 4IXTA 1KC3A 1XYGA 3JQAA 1OC4A 2PZMA 3PVZA 2JFFA 5CDYA 1HYGA 3I9JA 4KDFA 4HNHA 3RU9A 2DBQA 3L4SO 4XX0A 5IDYA 3ZI0A 1X15A 4A27A 4FFLA 3SEFA 4MVJM 4MVJE 3LF1A 4E33A 4PRLA 4GI2A 1NM5A 4M89A 1PX0A 2WSBA 1XIVA 3PQEA 1RYDA 2JFGA 3C85A 1I01A 1AUPA 2BFOA 1A9ZA 1SB9A 3C24A 2YQ5A 4FC7A 3S1LA 1LC0A 2IODA 2O7QA 3OH8A 3ZV3A 1ZH8A 4Q3BA 2EERA 2ZJ0A 3FD8A 1EVIA 3NAQA 1PZGA 1VE9A 1VRWA 4ZA2A 1QMGA 4HV4A 3GT0A 2DU8A 1BGVA 3MWEB 4OSOA 3HFGA 5JDCC 2IRWA 2P9CA 3QA9A 4H3VA 5H83A 5C3MA 1O95A 2IXBA 4D79A 4J1TA 4FJ2A 2Q4BA 1U8XX 2OOSA 4E21A 4NHEA 5H82A 5K0ZA 2EF1A 4MPDA 2BHLA 3LK7A 1LJ8A 4K1LA 1K5HA 3B20A 1BVUA 1BRMA 3ASVA 3EY4A 4LVCA 3W8FA 1HE4A 1U2GA 3P19A 3U9LA 1VSVA 3VZPA 2Q2VA 3UH1A 3JQAD 4OQZA 3WR5A 3ROQA 1U8FO 4R9SA 1DC6A 3HHPA 1DJNA 2X4GA 3DOCA 3HB4X 3HFSA 2NTNA 4I9UA 5KOIA 1ZVMA 1YQGA 5BNTA 2J5KA 4BMSA 5DCYA 5CDTA 3PJGA 1PGPA 4WASA 2J8ZA 4B3IA 4TVOA 1B8PA 4IDEA 4Y6SA 3QVOA 3WWZA 2QW8A 3I5MA 1YKFA 2LDXA 4HBGA 2VHXA 3G49A 1R15A 2HJRA 5HBRA 2A9FA 2V7PA 1EE9A 4YT4A 4OIMA 3H5NA 2Y93A 3D1LA 3FTNA 3GFBA 4XYBA 4I8XA 1XG5A 3RC9A 1B15A 4XYMA 3PZRA 1O89A 2EWMA 5DDIP 4WLVA 5L9AA 3MJCA 1IPEA 4XQ9A 4RZIA 3DBLB 3H9QA 2B4QA 2GSDA 3ZN2A 1DXYA 1LDEA 1AHHA 2DPGA 1YBMA 5GY7A 9LDTA 1P9LA 1YH3A 4PZCA 3MOIA 1X13A 3H9GA 4ALNA 3QV1A 4PG4A 1HKUA 3GGPA 3WNVA 3OHSX 2O4CA 4BNLA 3LT4A 2UYYA 4G2NA 2EGGA 3DFUA 5T5QA 4R54A 4BV9A 5K9ZA 1PQWA 2VUSA 3ENNA 5ENDA 4BIIA 3AUSA 3DMYA 2GN6A 4DLLA 2R6JA 1E1MA 1CDOA 1G6KA 1I2ZA 4RJTA 4JROA 1ZXLA 4JBHA 3M2TA 3QW2A 3Q2IA 3FNEA 4Z3KA 1ARZA 1IUKA 4ND3A 1P0FA 4KUHA 1IZ9A 3GNTA 4W9NA 3V2HA 1UR5A 3PWSA 3ZWYA 8ADHA 1O6ZA 3ITDA 2DKNA 3WXBA 3U0BA 1GQQA 1L1FA 4A5OA 4DQUA 3DAGA 1X0XA 2YUTA 3HB5X 3C1TA 1C1DA 3I6QA 4YAGA 3RAJA 4AVYA 5KVVA 4RVDA 1NQOA 4RLSA 5KTKA 1GV0A 2GPTA 4MP6A 1C14A 2J3IA 4Y6PA 3PGXA 1SAYA 3TZQA 3UAGA 2HAEA 1A4UA 1I5RA 5ES3A 3WJ7A 4R16A 2EJWA 2RH8A 5EINA 2C07A 2CNBA 2A35A 3G79A 2JD1A 4NR0A 3T7EA 4Z9FA 2VCYA 3HDHA 4TMFA 1GYQA 3U3XA 4Z9XA 4HFMA 5LC1A 1UXHA 4Y98A 3DZJA 1UZMA 3LYLA 3ANNA 3CZMA 3O8QB 1YBAA 5EJ2A 5JYDA 1P3DA 3MJVA 4XJTA 4QUKA 3VDQA 1PQUA 2CMDA 1G0OA 4OMUA 2D1YA 5T6BA 3WMXA 4CLHA 3IMFA 4NU5A 5CEEA 2DTXA 1SOWA 1P1RA 1HL3A 1HSOA 2WDZA 2C29D 2C2YA 1YB1A 1NNUA 1ZEMA 2Q50A 2UDPA 3HDQA 4NH4A 4L73A 4BO1A 4R3WA 2HCTA 2ZQZA 4P4GA 7ADHA 3E5RA 3WJAA 1XDWA 3JQ9A 4BMNA 4CM8A 4DMLA 2X5JO 2X0RA 3VH2A 5L51A 1FMCA 5JMPA 3KYDA 1WVGA 1ZSVA 4JNKA 1LU9A 5COAA 1QLJA 3ICCA 3QVWA 4RPKA 3HUDA 1LRLA 4R1SA 3EZLA 1E6UA 1XU9A 1T25A 1ZK0A 1BSVA 1F8FA 1N9GB 3WQRA 2PWZA 1RJWA 2O3TA 3QJ5A 1E7YA 1PEDA 4RLHA 1Y9AA 4XDYA 3JQFA 2I3AA 2OP1A 5IXYA 1ZJYA 2X5OA 3BA1A 3I9KA 2RCYA 5TNXA 4CLRA 5J23A 1U7HA 4OOEA 1E7RA 1PS0A 4FR5A 1EDOA 4J90A 4TQGA 4CUZA 3PHIA 2I99A 3FR8A 4D0RA 1KETA 4FFNA 3AI1A 4OSPA 1DSSG 5C7IO 2WD8A 3WX0A 5JYAA 9LDBA 2E82A 5KWEA 1DFIA 4WCFC 4CQMA 3G1UA 4F3YA 2BGKA 1OFGA 3JYLA 3PEFA 3RUFA 4LGVA 2OGUA 1XSEA 5AXDA 3TWOA 3CKYA 1GCUA 1JW9B 3R6DA 2Y1FA 1WP4A 4E2ZA 3ZH2A 4FSHA 4CMIA 4YJGB 5F5LA 4A7PA 3ZWCA 5F5NA 1ENZA 1YQDA 4I08A 1E6EA 2OBYA 1B16A 4U6SA 3IKTA 2CFCA 5IG2A 2CD9A 3GPIA 3M1AA 2BF7A 2O50A 3FCOA 1E77A 1H93A 4GMFA 2NADA 3VPGA 4INAA 5CEFA 4M86A 3CMMA 2YYYA 1Q0HA 3BIOA 1XR3A 3K5PA 1KY4A 2BD0A 3RUHA 4DRYA 1YO6A 3HZZA 3SLKA 3TL3A 3BMNA 4L74A 1GU7A 3GUCA 3IIEA 4KWIA 4UREA 1PS8A 1VJTA 4OKIA 1X7HA 3PQFA 1B8VA 4D44A 1I10A 2NVWA 3PYLA 1Y8QB 4FD3A 4G65A 3GAFA 4AL4A 3JD1A 4UUMA 4YYZA 5AVOA 2ZB8A 4R69A 3UXYA 2E48A 4BKRA 5CHEA 1W6UA 4ZQBA 4KQXA 2PNFA 1Y8RB 1Z82A 4JJFA 3CEAA 4II3A 2BFMA 4GSLA 1KY5A 4CQMD 4BNTA
chains in the Genus database with same CATH superfamily
5K8CA 1AKVA 3TN7A 4NYJQ 1J8YF 4URWR 2XF8A 3EQ8A 4EHNA 5FA8A 1H9AA 1Q3KA 1EWYA 1D03A 4PGAA 1VPDA 1XDSA 5FBVB 3T4XA 3ZDBA 2QAGA 3VR5H 3M82A 1Z7GA 2Q6TA 1V48A 1QDUA 3AIOA 1G6OA 4XX0B 1U3CA 4GZ5A 3RS0A 3UKDA 5FI3A 5FWAA 4RULA 4R8KA 3EA5A 2E37A 4ENRA 1V6CA 5DI3A 1LBHA 1ORRA 3ZWDA 3HR8A 2OCLA 4OFZA 2GPJA 2XYGA 4TKUA 1PW7A 3V4OA 2PCLA 1TLTA 4OJKA 2PBRA 4PTZA 4O2BB 1E32A 1RLIA 4H6VA 2VK2A 2WD9A 1Q22A 1KH2A 2YVKA 3BN3A 4JUFA 4RVNA 4WFQA 4PTYA 3CH4B 4EEXA 2LZ0A 3ND8A 4JX9A 5BSFA 1U7XA 4PC7A 4GPZA 1RPAA 1NGSA 4G5HA 4HC4A 5D84A 4BLQA 3C6YA 4E3ZA 1M2VA 2WSSD 4QVKA 1CJBA 2F48A 4ZXFA 3FYCA 1L5YA 3H17A 1WZEA 4IWXA 3EAGA 4X20A 1OH5A 1NPTO 5EP4A 1Z0DA 2QUKA 2UV8A 4OQQA 1AMUA 3VUFA 1GZSA 2OEPA 5AM1A 3VI3B 1CR1A 1QIKA 1QHXA 2EWVA 1WMBA 3EUAA 5FWNA 4INZA 3ESXA 4BMOB 3GN1A 4DC9A 4URHA 4QPDA 1A2KC 2OZEA 3BVPA 1GLGA 5J4HA 2JFHA 2JGNA 1M1XB 3EVFA 2DEUA 1EVZA 2QVGA 2V6BA 2WEKA 1BTOA 3V97A 5AP9A 2G8NA 3B1WA 2OCPA 1DKPA 1EWKA 2F8LA 3DMRA 3OM8A 3O83A 4G36A 4PF1A 3OURA 3H5LA 2M6RA 2QORA 1QP0A 3SG0A 3PX7A 3OD1A 2P3OA 2QRQA 4V0ME 4BGUA 4ABYA 1ZWLA 5BN3B 2XUJA 1JWAB 1SXJB 2VQ3A 2G5GX 1OYVA 3DZHA 2XSZD 1RM5A 5I7SA 4ZOAA 3AKDA 3TQQA 2LCIA 5CITA 1MHTA 1W8IA 1RC1A 4RKFA 4NHOA 1M8GA 1SU7A 2ZI6A 4O2AA 1JIXA 1KO8A 1JHOA 2ZJ2A 5FBKA 5GGYA 5DW0A 1NXWA 3SKXA 1SZDA 2UXBB 3LV8A 3CJRA 2JCBA 3HRIA 1JEOA 4GT1A 1NIJA 2X4DA 4IGIA 1SZCA 3E3AA 2GKGA 4C2AA 1J99A 2VTDA 2G5PA 1XWIA 3ORSA 3GL9A 3F7NA 3RVLA 4RBNA 1E0KA 4DG8A 5JC8A 2PA0A 2RCNA 4FE4A 2XGJA 4LF5B 1G6Q1 3OPQA 3KQKA 1X1TA 2CLLB 5AFSA 1TTPB 4GNRA 4J07A 3O21A 5CDSA 2R1ZA 2ZI9A 1YDWA 2Q6LA 3DTYA 1L4UA 1HDOA 3FFTA 2IFTA 5K3BA 2B2XA 1FQOA 3L93A 4HY3A 1UEIA 5ESDA 3CBGA 4E1VA 2VDJA 3W7VA 3CGWA 2ZT5A 3AH8A 2VNAA 3M6IA 4CYMA 1PK8A 3ZHSA 3PRJA 4N5LA 1AN0A 1S8NA 4NMMA 4QZVA 2FLKA 4J3FA 1HE8B 3VPFA 3ZEIA 1R3DA 4KDRA 4FFVA 2L42A 4LDPA 4LJ9A 3F73A 1QP4A 1GNLA 4U7WA 4J6EA 1RVV1 2RC6A 3FYUB 1C8KA 1V11A 2C0CA 3QVXA 1J4AA 3BXHA 4OXYA 4P32A 3TTWA 1P31A 2W2KA 3PFHA 1Q1EA 1MCZA 3BK2A 1JFFA 1EUCA 2ZLBA 2B1GA 1V16B 1TXGA 2DCUA 2Z98A 4FHEA 4PCLA 3HJAA 1RAGA 1N1MA 2PMBA 1AN9A 4KI7A 4FB5A 3Q7TA 5KOJA 3GIWA 3U56A 2QRMA 4DJFC 1BA3A 1T1SA 4O2BF 2OGSA 3EVTA 3KQMA 4JX8A 1TFRA 3FVVA 2DMRA 3AP3A 4OL0A 5BSWA 1IXZA 4BJ3A 4RY2A 2SICE 4YRQA 2QD1A 1XUOA 2JJ1D 2C4NA 4F2HA 1PWXA 2P0EA 3HBLA 1TZKA 5ITSA 1I2CA 3QBJA 4U0JA 2W00A 1KNXA 4FZRA 1RYZA 4K3UA 1CRLA 4EA7A 3IUBA 1XRRA 2JLRA 2UU9B 4BB0A 4DCOA 4CEJB 4ZREA 5KYUA 1V1RA 1Q7BA 2FMFA 2JZNA 5FI1B 1G21A 3JWEA 5FQOA 3ZVMA 4JMLA 3TW0A 3O2NA 2PR2A 3FF1A 4Q4AA 4ATNA 4IRXA 2QTWB 3LFUA 2H7VA 4IP0A 2BW0A 4OHZA 4RS3A 1AQLA 4W7SA 1Y4AE 2XBUA 4QU8A 1MV8A 1KSJA 4C7KA 2Y0BA 4DBVO 1TO6A 1WM1A 2G9UA 3NAGA 2C8KA 2IU3A 4JLJA 4PINA 4R2IA 3KX2A 4L22A 2YZMA 1Q1NA 1QU3A 3EH1A 3GP8A 1J5XA 1UC5B 3T7TA 1GNSA 3ONEA 4V1CI 2Y2UA 4R8SA 2JRLA 4PNHA 1Z75A 2BFFA 3I73A 3I12A 1TO2E 4M0UA 4BCBA 2W6JA 1NQAO 2F3QA 1ZGZA 3ESQA 3M9WA 1IUPA 4EKGA 1RWOA 3LY8A 4F3NA 5I3CA 3I0NA 1I2BA 1I9GA 2IQIA 3DONA 4MB2A 4RMGA 5EPOA 2ILTA 2CCKA 2F1HA 4PTLA 4H77A 5BSRA 3TFOA 1PUJA 2CFIA 4PE5B 2NV2B 1LSJA 2QT1A 1NHWA 5FFFA 2CLEB 1GPNA 1C2TA 5JBQA 5KTYA 1KI8A 2YHIB 5B58T 1DC3A 4F84A 3UMGA 4J3NA 1OHHA 1LS1A 4IGKA 3K9WA 3IIMA 2RHCA 3ZCRA 1Y3HA 3RRBA 1XE3A 4ZDKA 2PUEA 3DFZA 3OWXA 1INLA 2TYSB 3QGMA 2BEVA 3O9ZA 1PR9A 1JR3E 4XDZA 3HI6A 3BTVA 3JYPA 3P0JA 3OAAA 3FOEC 5AVVA 1TRKA 5EIHA 5TY0A 4XE5A 2FE4A 2FQXA 5L3ZA 1CRPA 3LP6A 3V4PB 1ENYA 1H3NA 3UMVA 2O8CB 1P44A 4YBRA 1OQAA 2ANBA 3FHTA 2XQVA 1HMYA 4RHCA 1KAQA 2RH5A 5GZ3A 3X2FA 5MHTA 3N87A 5IANA 2PX6A 4D3ZA 3EDMA 2VSQA 2FEXA 1FYFA 3E3LA 5K03A 2WG2A 4DMRA 2R7MA 2IUTA 4F0JA 5ADUS 3KUXA 2B92A 3IBFA 2F59A 4PGHA 4I2NA 4AZ0A 4G1EB 3SCZA 3OY2A 5CJJA 4TPKA 3KSAC 4S04A 1N8KA 2C31A 1CUVA 1V95A 4WEOA 2BHNA 2V7XA 2ERYA 4RACA 4AF6A 1Q50A 4YUXA 2VS1A 3ZKWB 4KW7A 3ST7A 2Y1CA 1NW4A 2D3TA 2R7KA 3SX0A 1U28A 3PNQA 4BWYA 4V1CA 4F93B 2P5TB 1YMQA 1RU3A 1YZLA 4C7OB 1QZUA 1T0IA 1T4BA 4YWHA 4ZYZA 4P3KA 4X7BA 2HEIA 4OK5A 3KL4A 4NQRA 1DRKA 2Z3ZA 4G0OA 2VH1A 1RWXA 1UWLA 3OPXA 1VFPA 3BDVA 4UNSA 4CQMB 3AIIA 2DSNA 3IJEB 3RVBA 3WLSA 4C20A 4M1TA 3L6EA 5SY6A 1GPMA 1X0VA 4KXXA 2D3WA 4WZBA 2XMGA 1N1DA 1Y5RA 3EIQA 5AW2A 1UZLA 2DCMA 4BNJA 1W48A 1UJBA 2GN1A 4L02A 4RJLA 5DBGA 2NZWA 5T4FA 1QVZA 2OC4A 3ESDA 4GMXA 4A26A 4A9AA 4K9PA 1TJPB 2I22A 2FSUA 3EQ6A 3LNTA 3QLJA 2P11A 3UJHA 1ZM3A 1Y8RA 2FG7C 2IDKA 2ZB4A 3DDZX 4KYTA 3ZTYA 3AY7A 1IWOA 3RC2A 4B84A 4A92A 3CY6A 3H5TA 1NI5A 2QLMA 1QCYA 5EXXA 4MRPA 1EJ6A 3AHJA 1CY6A 1J8DA 3NBQA 2HCRA 4ZKDA 1SC1A 4HNSA 4OX9Y 4YMWA 1FRQA 4FR2A 4F1KA 1QJ4A 1W4ZA 1MO3A 3LUHA 2FFJA 5JW6A 3X1JA 5CFQA 4CT4B 2Y0EA 4Y2UA 4NZZA 2FE1A 4UXIA 3G1WA 1PR3A 3CPJB 4GDMA 2J4DA 4UEWA 4JEHA 2ZUUA 3S7TA 4EMTA 2Q9AA 1EZ4A 3V7UA 1H6CA 3TDMA 1IM8A 2QY6A 4BNWA 2EWWA 1U0LA 3B3FA 3T3PB 3G8DA 4P36A 4BBJA 1X7XB 2QX8A 1ZIDA 3KOWA 1V3QE 2D5AA 3K0AA 5G40A 5JPIA 2H31A 4DUYB 2FEPA 4H7EA 4RMJA 1N0HA 4F3TA 5K8VA 1E2HA 3HJBA 1WLSA 4ZN6A 3F9IA 3ZX5A 3RVOA 4LWOA 3WDMA 1IBCA 5TS2A 2QN8A 5J5VA 4OO3A 1QVAA 3BHIA 4FLEA 3SEZA 3TVDA 3R3VA 2P90A 8AT1A 4CVNA 1YQUA 3BEOA 4PIVA 2VZ0A 2ZPAA 4NV3A 3KWJA 1LFDB 5BNZA 1WEHA 2X6QA 1UDCA 1XWFA 1OZAA 2AG0A 2W0SA 4LHSA 5BN4B 4W9MC 2CVOA 4KVZA 1JAYA 1UM9B 5ALMA 1AHPA 2J41A 4WFJA 1Z0UA 3GUUA 4QASA 1HBJA 1EE2A 3FW1A 5LCXA 2GPAA 1S4MA 2O1XA 4V03A 4JCCA 2PLFA 4A0RA 2C95A 4MB6A 1U2QA 4E5MA 1IH8A 4DY6A 2D5IA 4DVJA 4JN6B 2Q46A 4PY2A 3RFXA 3UUWA 4YJ3F 1BU5A 4P92A 1U90A 2GEUA 1XMXA 3I9V1 4IS3A 3FN4A 3N2YA 4OKNA 2DKOA 1T36B 1U1FA 2FUG6 2HSJA 4RMNA 4ZRMA 1NDQA 2NO7A 3O2QB 3Q85A 4CM6A 4F04A 5YASA 1YJAA 4JJ8A 5IM5A 4CDMA 2B3TA 2R62A 4UQOA 3RBZA 5LJLA 1E58A 3SLGA 1NE2A 3I2JA 1WJGA 3IUQA 1G19A 4UZSA 4AJ2A 4DRXB 4ENQA 3IIJA 1XMSA 1U65A 1G41A 2GXSA 1VYUA 1FOEB 2GN4A 3QX7A 1F9EA 3UXMA 4H35A 1M2HA 4UBIA 5EFOA 1SB8A 3OWOA 3ZJTA 4BASA 2V7BA 1F20A 4IIDA 1FDOA 3SVZA 4BGEA 1OXMA 1RHKA 5HZGA 5CVCA 1MGPA 3TRDA 1ZM4A 2R8YA 2CK3D 4B3GA 3L8ZA 1RDFA 3LBIA 3KAKA 4LKOA 4ZC8A 3WDLA 5EIBC 1MVNA 2ZS7A 5G0VA 3FAKA 4BXOB 3DE5X 1N2CA 2FVYA 2O8DB 2BBSA 1Y9ZA 3IIKA 4Z99A 3IEVA 2E4AA 2OD7A 4UPVA 3VR6H 3NDBB 3R3SA 2PS9A 4LW8A 3ZZNA 1RZVA 4UBKA 3SXUA 1NVAA 3UFXA 1ZN2A 3EVDA 4UHKA 1XD2B 2RB4A 1KAHA 2R44A 1XLWA 3L8CA 2YW2A 4KGDA 1XFDA 5CVJA 1F6BA 1IN7A 1XPJA 3DWGA 4HWPA 1KIFA 1POXA 1HA3A 1NF3A 2G83A 2H3HA 1XCLA 3IA7A 5EMHA 5LUAA 1M5UA 4EUFA 5FEUA 2R00C 1AKQA 3DXYA 4LPKA 4E09A 3JASA 4F86A 1UC9A 1V9CA 4AB1A 2QRGA 1T5HX 1D8AA 1YI8A 2R1TB 4RD1A 1N7JA 1FP7A 1U3WA 1W9HA 2C5BA 3UY4A 1THMA 3TG2A 4QXQA 2OO5A 1Z4NA 1IULA 4S1TA 2YZKA 3FLMA 1Y3IA 1E0JA 1QGZA 3I2YX 3QQ5A 4PLPA 1JKXA 3WL3A 1OOEA 2VP2A 3ANTA 3QPCA 4LDZA 2XZLA 4UU1A 2H2IA 3GYBA 4BLWA 3DZ8A 5LP1A 2HK9A 2AX3A 5K3FA 4X97A 2ZITA 3WK7A 5I7WA 2J6CA 2ADFA 1L9XA 4PNZA 4EFMA 1Z18A 1SOMA 3D8NA 3OBBA 1EUZA 1ZCBA 2V6IA 5B6IA 1Z7EA 8LDHA 2QXTA 3IQDB 1UP6A 3DXFA 1KBOA 4HNUA 3R5HA 3NT5A 1UDWA 2GSWA 4KUEA 1GQYA 1MPXA 2HQBA 5JS6A 1SCUA 1M54A 2A4KA 2IX9A 3CIFA 2G1PA 1YZTA 1TYZA 4NBNA 3L0ZA 4E6PA 5SYNA 1LW6E 2OCAA 2C82A 3FKQA 4DLSA 2VTEA 1OA0A 1XDZA 1I2DA 4KYUA 3QOYA 4HAOA 3VNBA 1M1NA 1TT7A 5H68A 3STHA 3SFTA 1N9KA 1Q17A 1UFOA 1XCMA 2ZYAA 1ESNA 2WPDA 3FPCA 5BT9A 2FEWB 5F9FA 2X22A 4O08A 1IRIA 3TUJC 1BCRB 4B44A 4ENUA 2PKCA 3GGDA 3S40A 4AYTA 4BNNA 1JVBA 1V96A 4DSUA 1HFEL 2PFKA 2B5VA 3LO5A 3KL2A 3Q2OA 2PJUA 4ZU1X 1VGVA 3M1LA 2H9YA 2IV7A 1CC1S 3KJFA 1SKYE 4JDUA 2BFPA 2HRDA 3UCFA 4FXPA 5F9HA 2A4MA 4DNOA 1H9BA 3TKYA 2MJLA 2X4IA 2HKIA 2HDWA 2JI6A 2B37A 3VOAA 2JAUA 1TZMA 1CUSA 1O94D 1ZD8A 4G89A 4XVQA 4YJFB 3SIWA 4HRXA 4PAOA 4F4FA 3U44B 1E2UA 2FSVA 2NU9B 5DT2A 3A9UA 3B1VA 2BGLA 2JAHA 2NUBA 4TYQA 4UQPA 1VYHA 3ROXA 4CL8A 4RYLA 4KN6A 1U6KA 3A04A 4TKVA 1H2HA 1HOTA 2C9OA 1XEWX 2GAOA 2R66A 3QIAA 2QXYA 4W7HA 2JH3A 1G8GA 3EMKA 5CXQA 3TSWA 3D4LA 5IUJC 3PD1A 2PZKA 2BPOA 5EXDA 1W5EA 3U7FB 2C1XA 2WIGA 3NOXA 4QDXA 3DPIA 3R7SA 2XMZA 3D8TA 4S24A 3RLIA 2VP5A 3AR8A 4BTVA 2AMVA 1ZICA 5I5GA 2LE0A 3QMMA 2FRVA 2RI0A 1DTWB 1KJJA 4FMBB 5ICSA 3PIRA 3LT2A 4Z9BA 1IE3A 5DYTA 1X1SA 5I4BA 2ZJ3A 1N2OA 2PKQO 2I4MA 3DE2X 2PM8A 3OEHD 3PEUA 5AXBA 4YXWA 3FZNA 2V0NA 2VPPA 4Q7EA 3UT5B 1RKQA 4LSMA 3AM5A 4RZ2A 4CM4B 4D9GA 3VO2A 3AIKA 3D8RA 2Z43A 3NRCA 2WNHA 3M4NA 3NQ41 4MR8B 4AJEA 3GDHA 1QGUB 1MAHA 3VH4A 3RBAA 1N2IA 4EP1A 5IXSA 2Z5VA 3OZEA 4WGGA 4DVGA 1US8B 3ZY6A 4EHFA 4EG6A 1GKYA 3THSA 1GCIA 4IVQA 5HCUA 2BFBB 1A9YA 4GP6A 1YVRA 1QP8A 2ZBVA 2I4OA 1GRNA 3AUYA 2ZYWX 4X54A 2GUWA 1S3IA 5AVXA 1FK8A 4GC9A 3RGWS 2H59A 3R5XA 4YAOA 1E2FA 1F4VA 2JZOA 3IELA 4J0JA 4P8RA 1MC1A 2BDUA 4QJBA 5THKA 2C84A 5B55A 3BZUA 2NUAB 1LBTA 4D4LA 3GAAA 4YAWA 4HFJA 4CG2A 3SYLA 3T9AA 5DZSA 2XHEA 4A0GA 4H0NA 3M2PA 2I2FA 2VH5R 4WH0A 4AX4A 2I7CA 2R6FA 2WD7B 5K6AA 5MFZA 2Z4TA 4UQLA 5FAXA 5ALNA 3EGCA 5BN5A 4Y6RA 2WHRA 1E6MA 1U0TA 2V6MA 3CXRA 3E81A 1Z4PX 1NVFA 1G5TA 1PJTA 4IFBA 3T7JA 2I6QA 4KE8A 4AZ3B 4C3ZA 3EP8B 4NKRA 3EDOA 2VT3A 1PL8A 1XPUA 5B37A 1ZSNA 1U8UA 1XU7A 1ND5A 3PUJA 1R88A 3Q5DA 1KFJB 4GU5A 3ZHBA 2FPWA 3CVUA 4ZALA 5JZSA 2PL5A 4CV3A 2OBXA 1N32B 1PV1A 4ZEXA 4DGSA 5KCZA 3EISA 3TD2A 1O0BA 3EC7A 2P40A 3K05A 3HP4A 2D4AA 3AFMA 4HPWA 5ALSA 4Z7NB 3CNLA 2H0AA 2YR0A 3UFBA 3TGLA 4CTOA 4PSKA 5CNMA 4IDAA 1W5BA 4BAZA 3V3KA 4B3RB 4IWNA 1KJYA 3G17A 3CZAA 4XGRA 1OZ0A 3B6EA 4LA4A 4FCVA 3ZBUA 4AZSA 4H2DA 5FTWA 1RHQA 1R5JA 3ICVA 1TVKB 1YL7A 4M1KA 4ZCMA 3TM4A 3RVPA 1E2GA 3GFRA 3HXOA 1WUTA 3TZ6A 3HCBA 4JT4A 4WLUA 1H6AA 4CF5A 2VJAA 4UHBA 1T13A 1NMQA 1RAFA 1OLUA 2VPXA 2P62A 4RHXA 4LNUB 4UFOA 3W2IA 4YH1A 1BKDR 1VXOA 1EGHA 1KJIA 2F4NA 4WECA 1KQGA 3OPYI 1TEXA 3WGIA 2E4XA 3GGSA 3AJAA 1JEJA 4MRMB 4RHFA 4J0EA 2FPPB 1N3YA 2Q28A 3KJEA 1QHNA 3L92A 3L7CA 4G07A 1QNFA 3FLEA 4O1HA 2ZS8A 2ZRDA 3OI7A 1NONA 2BUCA 3FMOB 4FFOA 2Y92A 4CWAA 1YZYA 2CF6A 4Q7JB 3KCQA 1CEYA 3K9GA 1O6FA 1VE5A 3EQZA 2DH5A 2X9GA 3QEJA 3QFSA 4LS3A 1MB2A 1KY2A 4XD7A 5IT0A 2PKYX 4C3OB 3N86A 1NQ5A 1QV6A 3A1CA 4ROTA 3L8YA 3OPVA 4V3BA 3TR0A 1O3YA 1R6TA 3PFFA 4Q4CA 4QARA 1NLFA 5CIWA 3RVSA 4LCEA 1GKKA 2O07A 4P3OA 5GJCA 3ANLA 4AM8A 1XVAA 2RGYA 1NF8A 3FGZA 2B82A 2Z04A 1BWRA 2VR1A 1JLHA 3QZUA 3BSWA 3FCUB 4RDHA 4XX1A 3EEIA 2JASA 2MSCB 2DT8A 3VPHA 2JFUA 1VKOA 3QU7A 4LYYA 4B0OA 2HHCA 1RBQA 4UBOA 1U1DA 1IHDA 3H04A 1USVA 1YCHA 1OXSC 1Q3TA 5F23A 3X1MA 3U7RA 5A62A 2UXDB 2RGEA 1YQQA 3Q7EA 5EE5B 5FR2A 3KO8A 3ZCSA 1A8QA 1BX1A 4MUHA 1ZD5A 3A4LA 2E0IA 3A0RB 2YXPX 4S35A 4CIVA 4XVCA 1VJ1A 5J58A 2CXSA 3BSSA 2P2LA 5JFGA 2ZQ5A 1G2OA 1BC5A 1MAUA 4NU6A 5KINB 4JJEA 2V5UA 1PV4A 4MW2A 4MHSA 1FMJA 1KYIA 4ARZB 1YZKA 2KBFA 3O6VA 3PR1A 4HEJA 1LX6A 4EJMA 3CLSD 4HVCA 1E9VA 1DX9A 1TK3A 4I5GA 3T54A 4WBXC 1PR1A 4B3CA 4F4JA 3ANYB 4IDGA 4BRUA 2H4JA 3RUEA 2W2VA 1HDCA 2PCJA 3BSFA 3EYAA 4OP3A 5E6SB 2PVCA 4MRVA 3THRA 4CFZA 1WUIS 5KMGA 4BVAA 1RQXA 3IWDB 2DTEA 2PWBA 3D3WB 4EY5A 3OPYA 3VHXB 2RGDA 4NDZA 4IILA 4EQ6A 3PTLA 1W85A 5FOWA 2VL7A 1DRUA 2E87A 4QXAA 1D8TA 3R5SA 3SX4A 3A3NA 1N6HA 1PR2A 3KPWA 4EKDA 3OQNA 3WL5A 3S29A 4YJHB 1ISIA 2ZCVA 3UHAA 2UZ4A 5JVDA 1AXGA 1JAXA 4LQ4A 121PA 3PLNA 4I0WB 5FJJA 4B3DA 4ZV4A 2IIQA 3FCYA 1PLKA 2I65A 5PGMA 3N8NA 4OHCA 3UXEA 4B7ZA 4S1OA 1D2CA 2XT0A 3G0CA 1ZCZA 3KQNA 4HL6A 1LPNA 4TX1A 3WLIA 3G2OA 3ZV6A 3IEMA 3ZU3A 3P32A 3MAJA 1JBQA 1CF9A 3ND9A 4J7CA 4DNXA 3LCCA 1ZJ6A 2GTIA 2NTJA 3B7GA 3GARA 5AMXA 3VR4A 4BFVA 1AKYA 5CDGA 3NBYC 3ORRA 2YIMA 1DELA 4O59O 4PONA 4U39A 1B7GO 1FP1D 1RZ3A 2ILVA 3HMKA 3QUQA 4NOLA 4CKZA 1T2AA 2FR8A 4UATA 4R9NA 1PIWA 1IB0A 4FZ5A 4NZ9A 5H81A 4ZAXA 3SKYA 4AXBA 4DA7A 2ZIVB 5AI4A 3E1GA 3L5OA 1WXQA 5IYZB 3HJCA 4UAJA 4HK4A 2DHEA 3NWJA 1PSDA 3VPXA 3GJXC 1EM6A 1QKKA 1SHZA 2XECA 1TEVA 3SEAA 3AKZA 4L6IA 3UMJA 1G8HA 1UMCA 1T8SA 1E8MA 1IN1A 4MP3A 1D5CA 2DT5A 3BFXA 3DVQX 3ENKA 1C0KA 3V6MA 1VL8A 2HF2A 4KMSA 4RTLA 1OAKA 3I45A 1TD1A 1ADFA 4HR7A 2HIAA 3STTA 3H2BA 5LIPA 3JZMA 3RK0A 1U2DC 4RGYA 4HQFA 4OXQA 4I5FA 3SVLA 3AVXA 2IX3A 3MIZA 5KOHB 2D1TA 1D6NA 1SURA 1K2VN 3QA3E 1GQSA 2W7TA 2W37A 3HFRA 3QNWA 5EKDA 2B1JA 4E2XA 3QLUC 1N7HA 4FOSA 4M0PA 1MA0A 5GZ6A 2CMKA 4ZO9A 4U00A 3DEJA 3G2QA 4AJKA 1VYVA 3FNGA 2R65A 1Z4JA 4U3JA 4X94A 4EI7A 5LD2B 1BJKA 2GPNA 2LXNA 2YW9A 3SMVA 5EZ6B 3UENA 2JGFA 1B6SA 3FPLA 4Z0NA 4TKLA 1S3SA 1YFKA 3QE0A 1IJBA 1GT91 3OEWA 3VH1A 3VBCA 1RRPA 1BVHA 1OXUA 5HFNA 2OYRA 4D9IA 3S8MA 3EVBA 2B8TA 3TQOA 3WNBA 3IUSA 2WWFA 2IE8A 3WISA 4Q3AA 5A5DA 1U0OC 4IIUA 1CHNA 5E1BA 1VI2A 3NHFA 1ODLA 2H4XA 2VAWA 3IOYA 3QI2A 3HKDB 4ARCA 4ND1A 3CBQA 2IP4A 3PGKA 1HC7A 3WYFA 2J31A 1R6XA 5KNCA 1OXVA 5ELXA 1W93A 3CNBA 2FK7A 4XYEA 4ZEVA 4IMPA 2P30A 2X77A 2FKNA 3EXHA 4PX3A 3TLGB 5KS2A 1CS0B 1UJ2A 1ECGA 2VHEA 5CVUA 2HQOA 3LUDA 3I5AA 3ZC3A 3B2EA 4B8WA 5J4KA 2OGWA 5KYTA 3W5JA 3W5SA 1U81A 1EE1A 2BMFA 4AO8A 4LJ7A 3EC2A 3C8UA 1U0JA 4ZCTA 2E5FA 2DWOA 3FUTA 5ITVA 3FHJA 3NIDB 3PHJA 4GAEA 4RVCA 3L5KA 2JLAA 1V8FA 2DH6A 1R5BA 1W0KD 5AVZA 2PO5A 1FY2A 1RCUA 3N8DA 3EJ6A 3FWZA 3ZHZA 1L2TA 2GPBA 2ZQYA 3R9XA 3HYCA 4S1NA 2GFQA 4FYPA 1JWBB 1ST3A 5FBRB 2FZ4A 1RR6A 1P9WA 3LU1A 1OTHA 3ADDA 1IRXA 1FJHA 1K8QA 3HB0A 3A9SA 5I4CA 1DQSA 1U7UA 4OM8A 3W5AA 1K08A 1BKYA 4QM6A 3U3ZA 3VPBA 3BBLA 4XJXA 3TIIA 2Z6QA 1HXHA 2A9JA 1T1RA 1JB1A 3DLIA 4MW7A 1QX4A 2AI1A 3H05A 3VBEA 3KSBC 1YR2A 1NJ5A 1YUNA 2KE5A 2YNMA 3AWDA 3FTCA 3JQ8A 3SZ3A 4YMIA 1EZ1A 4U2DA 1ENPA 2YDYA 5HZMA 3JPWA 3DT9A 1S8OA 4L3OA 4M99A 5IYZF 3O4HA 4FMCB 4QLBA 2IS6A 4IWYA 4UNRA 2CXRA 1K75A 1L5OA 1T9KA 3CS3A 3DFIA 3KNZA 2YHUA 4JSTA 5GV7A 2OGTA 3I72A 4F6RA 1C9DB 1RXCA 2J6BA 3R6WA 3W1WA 1W76A 2KX7A 1ONSA 2R8PA 3MA0A 4PHTA 4W5HA 1NNSA 3R9IA 1J00A 1K7XB 4DBZA 3EPBB 3U9SA 1IK4A 3KJNA 2AFHA 4BP9A 3FKSA 4S1WA 4D9MA 3SI7A 4EG0A 5A6SA 5B2FA 3MPUA 4Z0TA 1O2DA 1NVTA 5BRNA 3V8PA 3VZRA 3UB3A 3L8HA 3QBVA 5C7YA 1FBTA 3VFDA 2X0NA 3O94A 1XLTC 1UEXC 3FXAA 5EIEA 2F1OA 4YASA 1KOLA 3AFNA 1NQXA 3CNEA 3H1TA 3GRVA 2DULA 2QTVB 4YMHA 4QSMA 4WCVA 1W581 4GM1A 3RC1A 4Q21A 3OOEA 5HIJA 2A78A 4B3JA 5KSYA 3ZDFA 1HDGO 2NU7B 4WKGA 4PC6A 3CU5A 1EFPA 2XQFA 4FQ5A 4ND5A 5CPBA 1WMDA 4MULA 1EESA 3WKEA 2OXTA 1G63A 2Y76A 2R5WA 2H5LA 3OZVA 4XIJA 2IH5A 3TE7A 1SBCA 1YSCA 1JMVA 3QF4B 1NQUA 5ALEA 4P0TA 1I32A 5E7MA 1QRAA 1U5CA 2IQ5A 4R1MA 2OCGA 3A9RA 2UZ0A 4AG6A 1KSHA 4CKYA 2C2BA 4IIFA 2JBAB 1VI6A 4F7DA 4A6DA 3WA7A 3EOZA 3GZ4A 2H1VA 1Q7GA 1H0RA 3GCXA 3OMWA 2QI9F 1UXOA 1QAQA 2XKBA 1S6YA 4IRUB 3FNIA 3CB4A 2JFQA 2W93A 1JG2A 1G64A 2DLDA 4R8RA 5JLJA 1XZFA 3GLVA 1YS2X 4ALKA 2ZYGA 3DAYA 4QQRA 4ZCRA 2VJNA 4ZVOA 4JLOA 2XLCA 1QUEA 3FBTA 5CNKA 3TYXA 4AJ4A 2K7ZA 3UA4A 3QHQA 3QRWA 1T3HA 3AXSA 5I7OA 5GM2A 2CSXA 1CB0A 4WOJA 1G9XA 1DKQA 1VCHA 3I0ZA 4UCWA 1N6KA 5IK2A 1EMDA 1XHLA 4K9LA 5KO2A 2H65A 2EFGA 1WXWA 4KODA 4YLYA 4BEWA 6GPBA 1MO4A 3R3UA 1NYLA 2VJCA 2NO1A 1Q1GA 1ENOA 4Q24A 4QC2A 5DX1A 3ZY4A 4ZYTA 2WA2A 3MK31 2Q0HA 4R1UA 4JQCA 3RC7A 1OSNA 3IP9A 3I3OA 4JQZA 4PICA 1B6TA 4B45A 5KYWA 2R8EA 1ZH6A 4WY8A 3D9QX 5CT8A 3GLHB 1E3TA 3K92A 5SZKB 4JBLA 1X8KA 3LY7A 3PGLA 5DSZA 2GJSA 4I1OA 1IONA 2FPGB 2O0HA 4B3TB 2YYAA 5CMLA 1RPZA 4WLOA 4LV8B 4RTRA 2R9VA 1QH1B 4G0UA 3VKWA 4PAMA 5JDIC 2QR2A 4AKEA 1PV2A 4QULA 3BCSA 1E9SA 1NBME 1BA2A 2I2BA 2C8LA 1C3OB 1UFQA 1W1UA 3I2IA 3ZQUA 3UIEA 4CLOB 1FRZA 3GJQA 3LXXA 2GM9A 2ON6A 1Z22A 2C7PA 3QLVA 1G2IA 4PX5A 5LOVB 1B41A 3K1AA 1VKZA 3L0OA 1OLSA 3SX2A 1JU9A 1LK5A 4UFPA 1JG6A 1MGOA 1NBIA 2D2XA 4O4IB 5ALOA 4C01A 4C0BA 5HWSA 1JR6A 4FMCF 1L5SA 3C3WA 4I46A 1ZC4A 2M98A 3OIUA 4FGZA 4C05A 4CTNA 1FSPA 3CGGA 4U2BA 5TPWB 1E3JA 1AKUA 1UQRA 2OR3A 2EYQA 3F49S 3NVMB 4J91A 4X91A 5HRUA 2F3PA 1IWPB 1V4BA 3JS5A 4NARA 2ODPA 2GZSA 1EB8A 2GJ4A 5CDUA 1JKJA 2W83A 1E1CA 3FHCB 7ABPA 3JW8A 1FRFS 3BICA 1G20E 3MT7A 1BMFA 1RI1A 2RMKA 2J1LA 2YJ6A 1D2HA 3O3MB 4UTPA 2AJDA 1ZHOA 2WPNA 1A88A 1D2EA 1UJ6A 4NZYA 4FEAA 1ZM7A 4DR4B 1SIWA 1WHSA 2PD3A 1NKTA 1KQNA 3UHJA 2NM0A 4ZGBA 5KJ1A 1ZUIA 2W6OA 3T7RA 4X9XA 3BMXA 3D8HA 5TMBA 4E5NA 3VYRB 4I6JA 2BISA 1Y0BA 1DRWA 3Q7IA 4OYRA 5EA2A 2D2VA 4QO8A 4JODA 2J3LA 1MC4A 2PVPA 1MV5A 3H1FA 1KO7A 3AW8A 4LXUA 4M1OA 2M6LA 1J20A 2P75A 2F7SA 2VRCD 3DCNA 1FFXA 1POWA 1G4AE 5EL0A 3U62A 4AZVA 5G4KA 4C21A 1XEXB 1BJRE 1NI4B 1BDIA 1C8LA 1L9KA 1R66A 2D00A 3JZAA 4WGFA 2IUFA 3KOYA 2IUSA 3G9XA 5TRTA 4A6EA 3MCWA 4O3MA 3SD7A 1GFZA 2BGMA 1BW9B 5IX8A 3T5CA 1GTL1 4X8HA 1NQTA 3AX6A 3KTFA 4I9NA 2A92A 4X62B 3SHTA 1ZHHA 1GFWA 1L6RA 3HGTA 3PC8A 3K8OE 3P26A 1JIUA 2JVIA 4DYHA 1CW2B 2KLHA 2X8JB 1IATA 4ODIA 3HWRA 5ICEA 1C1XA 2B1QA 2ZRGA 1X74A 3CLHA 5AK0A 2J5RA 4FNAA 1L3BA 3SFZA 1S0UA 5MN6A 4YJ2A 1KVQA 1M1YB 2IUYA 2M1XA 1ZCJA 3L02A 4P86A 5CX1B 5DM1A 4G5OA 1V9SA 1HOXA 4PR0A 3IA2A 4RH1A 3CLUC 2GR9A 4IVPA 4RA6A 1R0RE 4J43A 4PXSA 3QHAA 3E0XA 3I5YA 3ESBA 3K0CA 1QZZA 2O7NA 1S2LA 3NBXX 3HVKA 5CD1A 2DAPA 4QOIA 4CTMA 2GCPA 1XOIA 3DZFA 3OFJA 2CY0A 4LQLA 5JOQA 1YZHA 2JFBA 3RU2A 1RI4A 2G67A 3N59A 3TW8B 1OWMA 1UF9A 2ZE6A 4BVFA 3BGDA 2Q99A 4HXFB 3DMPA 1FDTA 4GOJA 4OXRA 2O5CA 1Y3BE 3RWOA 2FPMA 3IESA 4K6FA 3DKKA 1NXXA 4LEIA 1C3XA 3ZZUA 2NSJA 1JR4A 4Y2PA 2XCUA 1LNSA 2ZDGA 2VNKA 2ZAYA 1OMOA 1WG8A 3C6KA 3EZ6A 4JBIA 4NDNE 4OFBA 2R5NA 3CSDA 1M2OA 3REQB 3F5SA 4LI3X 1L4GA 3R74A 1HK7A 1ZJJA 4FLFA 1DJOA 1R9JA 4M8KA 2MSKA 3N8KA 4JGBA 3W3AD 3C3YA 1LC3A 3O9VA 5DN6D 4EO9A 1BDMA 4WVLA 1U0EA 3RVQA 2IEDA 3X43A 5AW1A 5LOVF 3DBRA 1L8XA 4KN9S 4K6OA 2FZGA 3QG1A 3UOAB 3EPKA 4OLFA 4O4IF 3AF5A 2ODNA 2HH9A 2IPXA 2ATXA 3MMZA 4OLBA 3DC2A 4JWKA 1F0KA 4P58A 3TTUA 2B7LA 4BZWA 4R83A 5EQFA 1I24A 3CZPA 2Q4OA 1TM7E 1U0NA 3H11A 2GCOA 3L43A 3RBVA 4H7JA 1ZEJA 1TIBA 3G2LA 3IO3A 2ZIWB 3Q3HA 3U4DA 1E94E 3KLBA 4K03A 1UINA 4GUDA 1NG9A 2J0SA 2POQX 3L6OO 4IIJB 4URVR 3PGJA 3F3MA 4A8JC 4D57A 3FCSB 4RADA 3NAMA 3HCRA 4URFA 1QM5A 3AEUB 1P77A 3UJ3X 3QJYA 5B3LA 1Q0ZA 1XXHA 5DGCA 3UXHA 3T4PA 4KFCA 4PANA 2YJTD 1AO3A 1J0DA 2HMSA 5K6TA 4JL6A 3VGPA 3KQWA 13PKA 3HBFA 3NETA 3VDNB 2F8SA 1O95C 3QY9A 5JRJA 4O6VA 3UAXA 1J25A 1LK0A 2XGGA 3ICWA 5AO9A 4AK9A 1N2HA 4ZGWA 1T5LA 1RNLA 2FDXA 2RHRA 2FMTA 1O7JA 3QYJA 4LXHA 4XIGS 2J0VA 2XVZA 1K0FA 4A73A 4ALIA 2FF5A 1X19A 2YY6A 1M10A 4MVJG 2WKWA 3IT3A 3EA4A 3JD0A 4TLBA 1M33A 4X1YB 4CKBA 1AXRA 1Z5UA 2J5BA 4D9JA 1W2GA 2JI4A 2H9AA 2H5EA 2B94A 5T6MA 5IJXA 5LQRA 4OAOA 1ZK3A 4CM9A 1BX3A 3E8MA 4ENVA 4Z0PA 4M8IA 1XQ9A 5JZVA 1KDTA 4JQSA 4LIPD 3ILSA 1J1UA 4DV1B 1QE0A 5LZ8A 2ERCA 1DIHA 1X39A 4YUVA 4FFBB 1NSYA 5JH7A 3LDFA 1Z2NX 4TTVA 3DQPA 4EFLA 4J9VA 1YZQA 4S2EA 1LI5A 1ND6A 4GLLA 4XUDA 1C9YA 3L0SA 5DM60 1YOVA 2WYUA 3IJPA 2ZG6A 4P35A 1XDGA 2F1JA 3DDNA 3MYRA 4U2FA 5F2OA 4TWBA 5BNIA 1E2QA 3OSUA 1Z3CA 4OFXA 1SC4A 1W6RA 4WNAB 1L8LA 1N9ZA 3OCYA 5CIQA 4AP5A 2FGJA 2EDAA 1ULSA 5D6NA 5E1OA 3TD9A 1C30A 1MT0A 2EBFX 4OD0A 4Y0AA 5C8VA 4KNYA 1H6DA 2OL4A 3PRKE 4Y67A 1Y6GA 2BSQA 2X13A 3SAJA 1JT9A 4KAJA 2ZTUA 4GX1A 4UD6A 1V6AA 3CUTA 4NMWA 4R2WA 3LKVA 3PBKA 1HZJA 1CX9B 1YNOA 5EPUA 4F8JA 1C7IA 1IHOA 3D81A 4XIYA 3OCVA 1XYYA 2ZSBA 3ENVA 5A6VA 4Q6BA 4F9EA 2IBTA 2XUPA 2E49A 3UJ9A 1NVUQ 2FWNA 3I6IA 1NPDA 4N0DA 1DINA 2AEFA 2GLXA 2XOEA 4O4JA 2G09A 1TVCA 3MS2A 1EINA 3HKEA 4M38A 5BORA 4YRNA 4UVGA 2JIZA 4Q3KA 5C51B 1Q7EA 3D43A 4HDKB 3CPSA 4YFVA 4C08A 4K40A 4N6GA 4BV3A 5EJAA 1N0VC 2Q9UA 5FNVA 4QLOA 3ZPXA 2OORA 4L7VA 2VO1A 5CB4B 1D04A 4K9SA 5AI5A 4Z4QA 2I6XA 4WN9A 2IV2X 1EGVB 3PPYA 4IIJF 4ONEA 3RSHA 5I5EA 4IH1A 1L5ZA 3HCAA 4M0KA 2IEGA 3NT4A 3GUVA 1O9BA 3BDIA 4MVJI 1HYHA 2YN0A 3AZOA 4NPHA 3VU9A 1KZ6A 4HX2A 2FZCA 5IPFA 3VPSA 4LF7B 1IBSA