1YL7A

The crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 72
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl7A01
4XJTA 1JN0A 3G17A 5G0SA 5G4LA 2Q1UA 1YQXA 3QVXA 4OOFA 4PLFA 1C1XB 3RIHA 1DXYA 5U1PA 4MVJI 3QVWA 3GGGA 2FR1A 2GASA 3V1YA 3VZRA 3HN2A 1R12A 1GU7A 4QFCA 4BV9A 3GC6A 2VWGA 4HFJA 1HDCA 2YFQA 4I9NA 2YV3A 1A7AA 2NACA 2WYVA 4G81A 2YDYA 1Z82A 4PCVA 4UVDA 4XQEA 4FQ8A 3K8ZA 3PZBA 1DIRA 3GDOA 1GV1A 2VT3A 2GERA 3RI3A 4UVHA 1YJQA 3OQ1A 3I6IA 2JCVA 3GNSA 3VKUA 4CLXA 1UDBA 4CLDA 1IZ9A 2X5OA 3GEMA 4BGEA 1NQ5A 1LLQA 1V35A 1R0SA 4J9UE 2JFFA 4YBZA 2IZ1A 1Q2XA 4XX0A 3VZSA 1XU7A 3D1LA 5ENVA 4TRMA 1CQIA 4OO3A 1ZK4A 4XR4A 2BELA 2PGJA 3ANMA 5KVCA 2FSVA 5C5IA 4WEOA 2WD7B 2O4UX 3PHHA 2HMUA 2UAGA 4M89A 1LA2A 1NBOA 4CMEC 4BKOA 1NASA 2EJVA 2CVOA 2Q45A 1Z45A 3H2SA 3C7CB 4BNMA 4BO2A 1EUDA 4CM3A 1JVSA 1AXGA 1WDMA 3H5AA 4BIIA 3B1FA 3ZWNA 1EBFA 1B14A 4W4TA 4YT4A 4DVJA 4HFMA 2Q2QA 4YJGA 2BH9A 2HSDA 1XLTA 1XSEA 1SO8A 4OKIA 1ENOA 4PN3A 1E3LA 1N7HA 4D3FA 5KJ6A 1U7TA 5JW6A 1WDKA 5EESA 5L95A 4K9DA 3GUYA 4AJKA 3IUPA 4IINA 2TMGA 1WAMA 1CIVA 3O9ZA 1FDWA 2EKQA 2DKNA 1J4AA 4RGBA 1YB5A 4WOJA 4ALNA 1IZ0A 1UZMA 3DO5A 4I9HA 3WICA 4IQ0A 3BA1A 1I2BA 1QG6A 4I8XA 4FOOA 3R3JA 3RU7A 5IXYA 3FWZA 3DAPA 3FCOA 1Z75A 3OJ0A 5TT1A 4NIMA 3LLVA 4BMSA 2W90A 4KP7A 4AJNA 4BNIA 3FRJA 1LQTA 3FNEA 4IDGA 3UCFA 1B16A 4NZ9A 1U4OA 2YW9A 2BGKA 4K6CA 2PA3A 3DMTA 4WNCA 1KEUA 2B35A 3D7LA 2YQ4A 4JROA 4RPJA 2VOJA 3HFGA 2PD6A 1BDMA 3WG9A 2VQ3A 2AMFA 3ZV3A 1Y1PA 3AWDA 3GEGA 1EFKA 3QWAA 1BGVA 4KUGA 2X8LA 3VDRA 2CVZA 4XGNA 3MJTA 3HE3A 1YGYA 1TXGA 2DVMA 1XWFA 3SBOA 4TROA 4TRJA 3PWZA 4WLFA 4UULA 1SC6A 3RBXA 4YJGB 3OMLA 2O3TA 1LU9A 2DLDA 1G0OA 3AU9A 4WUVA 1Q1NA 3RFTA 3GOHA 2Q22A 4D3SA 1EZ4A 1BDBA 4YJFA 1LLDA 2P2SA 3JQDA 2YHIA 1RM3A 2DC1A 1ZFNA 3QP9A 3JQAA 4CQLA 4IZHA 2GN6A 3OQ6A 5B37A 1MP0A 3OIGA 1MLDA 5KIAA 2GZ3A 1K89A 1PQUA 5KVQA 4P4GA 3PJGA 3HADA 3PIDA 4FIZA 1TI7A 4R1TA 3MJEA 4HXYA 4J7CA 4BNNA 2F00A 1PQWA 4JN6B 2ZYDA 4IGFA 3F3SA 1M67A 1YWGO 1D7OA 1I10A 1BXZA 5HWSA 1R4NB 3DBHA 4J49A 3TZQA 5JDCC 4E30A 4WECA 3N7UA 2QW8A 3PQFA 3AOEC 2WYWA 3PVZA 2X6TA 4XCVA 1E6WA 2DM6A 3JQ9A 4NG5A 3HN7A 5FEUA 1H93A 1VRWA 2BD0A 4BO0A 1O94A 3PXXA 3RBVA 1VI2A 3Q9NA 4U7WA 2PR2A 4KQWA 1LQUA 3I5MA 3HB5X 3IKVA 1ONNA 3ZW9A 1I01A 3WLEA 3GPDG 1VJ1A 4N5NA 3CZRA 5DCWA 2QRLA 4IM7A 3M2PA 3RJ5A 2DFVA 2PKQO 3GRPA 3BTSA 2VTDA 3L6EA 2EIHA 4B8ZA 5EL0A 5BSEA 1AE1A 2BRUA 3E6AA 1SBYA 2O7QA 3VAZA 1HE4A 1KC1A 4WLEA 4LGVA 4W99A 5IN5A 1DSSG 1ONOA 3NDRA 4J0FA 4MOWA 4YJFB 2YHIB 2Y68A 3JQAB 3JD2A 1K6JA 3CE6A 1O5IA 3NGLA 4B4VA 3BMQB 3C1TA 2FPPA 2NM0A 4Z0HO 1NAIA 3HUDA 1E7YA 3UVEA 5L3ZA 4PZDA 1NQTA 4K1LA 2Z1MA 5B4UA 4Y67A 4JIGA 1W6UA 5JBIA 2F1KA 4CJXA 4QT0A 2V6GA 4LRSB 2A9FA 5IZCA 1E3WB 1E3IA 5F21A 2XPCA 2QG4A 3DBHB 1ADFA 2I3GA 4GKBA 4MO2A 4MP3A 5GMOA 2XOXA 3W4JA 3INTA 1I8TA 3RC1A 5L7YA 4KWHA 2J5RA 1GADO 3GR6A 3PQEA 2X1HA 2SCUA 4L76A 4PVDA 3VVCA 1XHLA 5LDHA 3S2IA 3TJRA 2ILTA 4DXHA 3O4RA 1HSZA 3L77A 2WWRA 4ZQBA 4ZQEA 4A5OA 4WLOA 4CQMB 1V3VA 1UAGA 3QJ5A 4XIJA 1VL0A 4ND2A 4M86A 2BFAA 1A72A 2PD3A 2Y0EA 4J1QA 4BOYA 1N1EA 3EAGA 3IOYA 5CP8A 4OGWA 4CM9D 4DWVA 3WDSA 3EZLA 2Q2VA 1ZK3A 1H5QA 4UREA 2CSUA 5JC8A 1WPQA 4PLCA 1JKFA 1T2FA 2NWQA 3CXRA 3PHGA 4EJMA 5EIOA 1H2BA 5JMPA 1QLHA 3KYCA 3EK2A 4NHEA 3VPFA 4CM9A 4HNHA 2NTVA 5BNTA 4MP6A 3NAQA 5T6BA 3V1TC 1ISFA 1R6DA 3JQFA 1UR5A 3Q2KA 5HM8A 3FNGA 2ZB8A 5TRTA 4DTIA 4YDRA 3V1UA 1DPGA 1I5RA 3TDKA 4M8SA 5KKCA 1OOEA 4HUJA 5G0WA 4RF2A 3DMTC 4N5MA 1Q7BA 1CETA 3CH6A 3O26A 2RBEA 4QXMA 1GUFA 3AI1A 1P3DA 1T4DA 2EGHA 3R1IA 3ZW8A 4KUHA 1JTVA 1R15A 2Y1FA 1E7QA 1T2CA 4Q3AA 4MIOA 3GAZA 3KHUA 4MVJA 4BB6A 1O89A 3E1KA 2AQHA 3CZMA 3BTOA 3JQ6A 4MP8A 3FPLA 4S1VA 4YAEA 1O8CA 3NTOA 5KJEA 4AJ4A 3VKVA 3CTMA 1EK5A 2BF7A 4D43A 3BMNA 1WMAA 4PG4A 4WE3A 5EMHA 2NTJA 3W4IA 3RC2A 2DTXA 3AI3A 3HG7A 1PJBA 4OHUA 1E5LA 2ZKLA 2IDZA 3KYCB 4Q39A 3L4BA 3RSHA 4AICA 1DDOA 1FJHA 1I24A 3RD5A 2PH3A 2VWHA 1T26A 1A27A 2G1UA 3D64A 3ONDA 1ZEJA 4BV8A 4ALJA 1ZSVA 4UEOA 4N5LA 3TOZA 1E7SA 2VZ9A 2DBVO 1UDCA 5KOIA 2ZATA 3CINA 1ZSNA 3BAZA 1XQ6A 4E5KA 1H6CA 5IDYA 1F06A 3F1LA 4NBVA 1GCUA 1J6UA 3H3FA 3JQ9C 4TQGA 1ARZA 4LSMA 1QSGA 1MXFA 3B70A 1HL3A 4L9RA 4YJHA 3QIVA 1DEHA 2ET6A 5L7TA 2IRWA 4AJJA 8LDHA 1Y8RA 2IEDA 4RQTA 1EEHA 3ZNNA 5JSFA 3ZGYA 3I6QA 1PIWA 4JK3A 2H1SA 1I3NA 2AA3A 3A06A 3HZZA 5CPBA 3ASUA 1KVUA 2EF1A 2Y99A 3IUSA 3I9JA 4DQVA 2X0JA 3NX4A 4TRRA 5BT9A 3FTPA 1KC3A 4UUMA 3GAFA 4K28A 3JYQA 4G2NA 3WQQA 3PJEA 1GPDG 1DIGA 2JAPA 4CM5A 3LQFA 4CMGA 2E49A 5HTOA 1A4UA 5L45A 3MWEB 4NFYA 2HMTA 3BMNB 3NDJA 1NM5A 1T25A 1LI4A 1ZK0A 3JV7A 3WSWA 4E5PA 3DBRB 2FZWA 3ZU2A 1YS4A 5JMWA 4N54A 1YOVB 4JJGA 3N58A 4DLAA 3ZU4A 2FZEA 3HB4X 4D7AA 4R4JA 2JKVA 4D41A 1X7HA 4AJLA 4RVSA 2VUUA 1FF9A 2ZTMA 4DPKA 2O2SA 5IZCC 1Z7EA 4X54A 1L7EA 2O3SA 4NJMA 1GV0A 3LZ6A 4QO7A 3V8BA 1ZIDA 5EPOA 4PG5A 2O4CA 4BNZA 1ZSYA 3OETA 2BMAA 3DMYA 4OXNA 1LTHR 2VN8A 2YUTA 3OA0A 3JD4A 1FMCA 2JD2A 4YTEA 5EQDA 2PTGA 4UEKA 2W98A 4H16A 4YJHB 1M6WA 2DBRA 4WASA 1E6UA 1NFQA 1QXSA 4TSKA 2EW2A 2OOSA 3AUTA 4GBJA 1HDXA 1U5CA 5DZSA 3E9QA 4YR9A 1P9LA 2VTEA 5T67A 4HBGA 4O63O 2D1YA 1Y5MA 1NR7A 4TKLA 2I67A 2D3TA 1U3UA 4LISA 3UXYA 4EI2A 3TQHA 1Q7CA 5T5QA 5CEEA 3MTJA 1T2AA 1T1SA 1QYXA 2A35A 1W0CA 3UICA 1E3SA 5BNIA 1MC4A 5T64A 2PZMA 2OMEA 1A5ZA 4RVHA 5TSDA 4CUKA 1YDEA 4B4OA 1KVTA 1G1AA 4NBWA 1DFHA 4RZHA 4HKTA 1JLLA 1HDGO 3E9NA 8ADHA 5A03A 1ULSA 4R1SA 4ZN6A 2FPIA 3JQFC 3GVIA 2HMVA 4GWKA 3WQRA 3QHAA 4Z0PA 1W73A 1QRRA 5COAA 4LCJA 1TT5A 3GZNA 3LT2A 4BB5A 3TFQA 1S7CA 3AY3A 1L7DA 3U62A 1PR3A 2E4AA 2VT2A 5C7OO 2IYOA 2PK3A 3JCZA 1JAYA 3OH8A 5T8KA 3ZHZA 4WJZA 5I9MA 3WBFA 1IOLA 1ADCA 4NJMB 3I23A 1Q7GA 4C7JA 3WGYA 3M1AA 3B1JA 4BKUA 1ISJA 5KJ1A 4Q3BA 3GNTA 4GSLA 1SAYA 3ETGA 3IS3A 1KEVA 1SZJG 3AUAA 2GR9A 4MVJP 5IG2A 4R16A 3WX0A 2VNSA 4BO8A 3VPHA 3ICCA 4ZICA 3EC7A 1PJ4A 1HETA 4R3WA 3H9EO 1O6ZA 2WYUA 3TRIA 3H4VA 2AEFA 2FY8A 1QKIA 4OXKA 3C8MA 1PJTA 2P4QA 5AOVA 3H3JA 3OIDA 2C54A 2J3HA 2NLOA 2O48X 3I4CA 4NDNE 5DBIA 4YRBA 2Q4BA 4OSPA 1PWZA 4MPDA 3EGOA 3ZN2A 4PLGA 3IAHA 4E13A 1A9ZA 4XEHA 3L4BC 1GQQA 1YB4A 1ADBA 5IAAA 4BQPA 5GZ1A 5L9AA 3FF4A 4IIVA 3C1OA 1ZNQO 3VC7A 3D3WB 4UAGA 1EUZA 2PZJA 4L4XA 3ZU3A 3CKYA 1C1XA 3W8EA 3HNPA 3TFOA 1IUKA 2FSSA 4E2XA 3ONFA 3JSAA 3GA0A 2VNAA 1IB6A 3JYLA 3ULKA 1HYHA 5IDWA 1TT5B 3BMCA 4E32A 1TVEA 3GZNB 2P5YA 4CMIA 4XYLA 4CMJA 1EVIA 1NVGA 5GY7A 1WLYA 4RLSA 3RCBA 1A4IA 1P45A 2BFOA 1QP8A 3OP4A 5A06A 2GN8A 4J91A 1CQJA 1PGNA 4GLLA 4L4RA 3ZHYA 3ZWOA 5A5FA 2BI7A 2OUIA 5I9NA 3QWHA 4R1NA 4RO0A 4XRRA 3F1KA 3WLFA 4BL5A 4HFNA 3S1LA 2Y1GA 1P31A 3PHIA 4YJDA 1DIBA 4K26A 2BFPA 1ISIA 1J5PA 4ALKA 5L4LA 5IN4A 1H0KA 3W8FA 2GPTA 1LDYA 4DMMA 1E7MA 1RM4A 3NEPX 6LDHA 4FFMA 4YAGA 1NQAO 4YXFA 2EERA 2ZYAA 3QWBA 4DPLA 2OBYA 4P4LA 3ANNA 3I83A 5F1KA 4E21A 1N8KA 3INGA 1FDTA 4QO8A 4GGOA 1RKXA 4NBRA 3GNQA 3OJEA 3C7DB 1ZVMA 3GFGA 4LN1A 5ADHA 5ICSA 3W8DA 1LLUA 4I5EA 2RIRA 3U49A 4KUEA 2VRBA 4XYBA 3ADPA 3TNLA 2EKPA 2TMDA 1D3AA 4CLHA 2B37A 4XB2A 3G1UA 1EDZA 2NU7A 1NFFA 3M2TA 5TT0A 2HRBA 2P4HX 2DPGA 2VUTA 1MC5A 4CODB 3ASVA 3BMCB 4EJ0A 2WEKA 2C07A 1YBVA 2AQIA 3G79A 4GL4A 4Z3DA 4OSOA 1E7RA 4I08A 4CMIB 5KKAA 5C7LO 1V0JA 4DYDA 2QX7A 1UXJA 3DOOA 3KRTA 2Y1CA 1U1IA 2A94A 3R6DA 1KBZA 2RH4A 2Y05A 2VYND 2HAEA 3P19A 3W6ZA 3S2EA 3OBBA 3NTQA 1ZBQA 4RQUA 3ZNQA 1VLLA 2UVDA 2RHRA 4QFDA 3D4OA 1LC0A 5L51A 2CF5A 3WGQA 4HFRA 4IGEA 1ZJYA 3ZV5A 2VYNA 4MIYA 1H6BA 3GN1A 4RORA 1AUPA 3PFFA 2AEJA 4NJOA 2HMSA 5F5NA 3CIFA 1LEHA 4P4NA 3A28A 5ENDA 2Q99A 3W1VA 1DC6A 3W4KA 4YAJA 2P9CA 3GPIA 3WWZA 2O50A 5JXWA 2EP5A 4ND5A 2R2GA 1U9JA 3P5SA 3R3SA 4UUPA 1E6EA 3Q6IA 5AYVA 1R37A 2FOIA 1GYPA 4R5HA 2LDXA 4NPCA 1U3WA 2NV6A 3DZIA 4I1IA 4BO4A 1C1DA 2IEBA 1HDRA 4LCEA 5DF1A 4Z3KA 2ZB7A 4FW8A 1XYGA 2HQ1A 4A27A 1WW8A 5T8KC 1VL8A 3ENNA 3NT5A 1Z7BA 3UUWA 1QMGA 2WD8A 2RCYA 3OQBA 2H5LA 1Q0QA 4AJEA 1HT0A 2VCYA 5A3VA 3SEFA 1PJSA 4JLWA 4NH4A 1KVQA 1YXMA 1PTJA 1E1KA 2HCTA 4J90A 3MJ4A 5JAQA 4A7PA 2VHXA 1GDHA 1C0LA 3QRWA 2IXBA 2JAHA 5A9RA 4J6FA 4YYZA 3EUWA 4O0LA 1X1TA 4J16A 4PFJA 2Y1DA 4U5QA 3ZDFA 1UXKA 1V3UA 3F4BA 3F5QA 2PV7A 5ES3A 4GI2A 1R4NA 3WGHA 4RDIA 3BMOB 4R9SA 3NRCA 3FR8A 1KIFA 4YB8A 4E12A 3MTGA 3QVOA 3G0OA 2HUNA 4FGSA 4MDHA 3WOHA 4UVEA 1EQ2A 5BSFA 2OHXA 5MGBA 1IY8A 1LSJA 1GYRA 5AXBA 4ZGWA 1KETA 3NT2A 1V8BA 5CAEA 5HBRA 3Q2IA 4EITA 5TLSA 3IMFA 4W6ZA 5KNLA 2X5JO 1O9BA 4PRKA 4WOKA 4OOEA 2W8ZA 3QA9A 1QYWA 3WQSB 4CMBA 1Y8QA 3VTFA 2PGLA 3AUSA 2ZTLA 3UHAA 4CL8A 1LDMA 3UGKA 1K5HA 5KJFA 1SCUA 4DBVO 2R6JA 3H5NA 2ZIZA 1EE2A 3DONA 4PLVA 1C1DB 1HDZA 1YVEI 3JQGA 4J3FA 5JC1A 4JQCA 3JQAD 3ZV4A 2WDZA 3AFNA 2O3JA 3KEOA 2O23A 3PPIA 1AXEA 4BKQA 4CLOB 1GPJA 4Y6SA 2FPGA 3ZHXA 2OXIA 2FN7A 4CV2A 4ND4A 5MDHA 3KYBA 1PGQA 4FPXA 1XA0A 3VPGA 1DC3A 4GMGA 3QVTA 1Y7TA 3BMQA 3PYXA 2YFHA 4ALMA 2Q2WA 1HLDA 4TKMA 1N92A 2GLXA 5JS6A 1XG5A 2PKRA 3PK0A 1E3WA 3UF0A 3LT4A 3K92A 4IPTA 4AJOA 4TRNA 2ZCUA 4RVDA 1P1HA 4U0JA 3OIFA 1C0IA 4CQMD 3F4LA 2AW5A 2GDZA 4OQZA 2GN9A 4GH5A 4D45A 4BMNA 2B0JA 5G0VA 4CMCA 3AM5A 1PZGA 4I9UA 5ER6A 1E5QA 2AXQA 3QV1A 4OM8A 1SEVA 1M75A 4TZKA 2DAPA 6ADHA 1ADGA 4CQMA 1CERA 2C0CA 2EG9A 3DZBA 3KTDA 5AXCA 1Y8QB 1PQPA 4DA9A 3X2FA 1IPEA 1U3TA 2YQ5A 1FDVA 4CV3A 1UDAA 4FFOA 3LC7O 4II2A 4J7XA 3RASA 1UXGA 1UP7A 3I52A 3KXDA 5G0TA 3JQGB 3RUDA 5KCZA 2X9GA 3AW9A 1V6AA 1MB4A 3DFUA 4CLEA 4R01A 2I66A 1PWXA 2P9EA 1NR1A 4MVJM 4F6CA 3BIOA 3U09A 4WLNA 3DHNA 5AXAA 1NVMB 2A4KA 1NQOA 2DUWA 4G5HA 1FXSA 4Q3NA 3A1NA 5IDXA 4IJWA 1V9LA 4DQUA 4PLYA 4M49A 1E77A 1B15A 1G0NA 3WS7A 1ONPA 3CMCO 4NI5A 2B5WA 4ZU3A 2OFPA 3LF2A 3RUIA 1F14A 1ISHA 1B0AA 5HRUA 1MG0A 1MFPA 1PJLA 3EW7A 3IP3A 3KETA 3HFSA 4LVUA 2X58A 1X0VA 1NAHA 4KOAA 2OZPA 2O7SA 1LDGA 5IDQA 2X9NA 4KMSA 3KYDB 4CM1A 3L6OO 3VH2A 3C24A 5L7WA 3RC9A 1PU2A 2Q4EA 3PLRA 3AM4A 3AUUA 3ENKA 3RC7A 4BO6A 4CR7A 1WNTA 1Z73A 3DTYA 2C82A 3K9QO 2C20A 1PJ2A 4BNTA 4CV1A 1VM6A 1HF3A 4BNVA 1QORA 5EINA 1SPXA 2EXXA 1E1NA 5JCJA 1HZJA 1DIHA 2V7PA 3LU1A 2X7HA 1DC5A 1GEEA 3AY6A 4RCVA 1F8GA 3FHLA 2A92A 4KTTE 2DTEA 2JHFA 3SX2A 3EYWA 2VHVA 4N7RA 3WB9A 2CMDA 4E2ZA 1P1IA 1SOWA 2PNFA 4GPD1 3H2ZA 3DFZA 7ADHA 1VKNA 1ENYA 4AJ1A 2GYYA 4JBGA 1HWYA 4FOSA 2QHXA 1JU9A 3OA2A 3Q9UA 3K30A 3VH3A 4U8GA 1BXGA 1D8AA 1MUUA 5KJCA 5U9CA 4RPLA 3ROMA 4WNIA 3SVTA 2B4RO 4MVJD 5A04A 3IJPA 4DMLA 4JJIA 4L75A 1E3JA 2V65A 3A9WA 4PVCA 5AXDA 4A73A 4ESOA 4PG6A 2C5EA 1YH3A 4ZQGA 3DZKA 4H7PA 1HDYA 2I65A 4R51A 2JFHA 2XXBA 1EDOA 3U4CA 1BHSA 4JCOA 4GAEA 4J2OA 2PZLA 1CRWG 4IMPA 3WXBA 1P1KA 1WDLA 3ORFA 2NU8A 1EQUA 1BMDA 5B4TA 4GKVA 1QV6A 3RFVA 3OF2A 3P2YA 4BNJA 2E82A 1TLTA 4CUJA 5FI3A 1DLJA 4LMRA 4J7UA 1NPYA 3D4NA 3VTZA 4BKRA 4MVJF 3DBRA 4CPDA 5L4SA 4Y98A 2DUUA 5H81A 5L40A 2G5CA 5A02A 3H9JA 1YOVA 2HLPA 2C2YA 4JNKA 1JA9A 4ZA2A 2B4QA 4JJFA 1KY4A 1EVZA 1V3TA 1F0YA 3ZWXA 2ZK7A 2NU6A 3VDQA 4R68A 2IODA 3SJUA 4HADA 4E4YA 2ZTUA 5TS3A 2I5PO 4RPGA 3C7AA 3VVBA 2UUPA 3ZZNA 4GWGA 3OFSA 4RL6A 4OMUA 1WZIA 3OHSX 2H9IA 4IJUA 2IE0A 1BXGB 2UDPA 1YBMA 5DULA 4ZRMA 4AJIA 4Z6KA 3H9GA 5TJ9A 4CM8A 5TGDA 5GZ3A 3HDQA 4BO7A 2EW8A 3JQBA 2WMDA 4PLTA 4ZQFA 5LC1A 4Z9FA 3MZ0A 3GRKA 5HA5A 4DUPA 1I33A 2GGSA 2C7GA 2BI8A 4FD3A 1VSUA 4PGFA 4XA8A 2Q49A 1HSOA 4DRYA 3IKTA 1RM5A 2AQKA 1P33A 1YONA 3NJ4A 4M55A 1VJ0A 1JW9B 4EEZA 4NNJA 4RPHA 2VRCD 3E18A 1K2WA 2QZ9A 2FRDA 1W4ZA 2ZTVA 4IS3A 3SJ7A 5TIIA 3F9IA 1F12A 3EDMA 5FFFA 1QYVA 4RZIA 2ZB4A 1CWUA 3I4FA 3D5TA 3WJ7A 4NQZA 5CHEA 1GZ6A 3IP1A 1OBFO 3AY7A 1C0PA 3V2UA 4IXWA 4Q3DA 1PS8A 4XYMA 3GT0A 2QZZA 2VRCA 2IXAA 1NPTO 4BO5A 3RKUA 3V2HA 4JX8A 1DFGA 4ALIA 4E2WA 2ZCVA 1PX0A 1DAPA 3ZWMA 4QTZA 1Q0LA 4DYVA 4BGUA 4BKPA 4ZVVA 4XDYA 4IMRA 3TPCA 3UCXA 3PP8A 4BGVA 2FP4A 4DC1A 3U3XA 1BSVA 3T4XA 3MOIA 1R16A 1P74A 1Q0HA 2DTDA 2X23A 4OYRA 4ROSA 5THQA 2D5AA 2ZJ1A 1UAYA 1NXQA 1C14A 4DIFA 1BTOA 2DT5A 3K2EA 1N9GA 4D0RA 4EZBA 2V6FA 2AG5A 4NFHA 5BNFA 1X14A 4M87A 4UUNA 5TC4A 4RDHA 3ZWBA 1I2CA 3GEDA 1NP3A 2J6IA 4L74A 1R0KA 4CM8B 4F6LA 5JDCA 3H6KA 3O03A 3PQDA 1QYCA 1WVGA 3GY0A 2EEZA 5TX7A 3OEYA 1OFGA 1P1RA 5I8WA 2PGDA 5TQVA 2DU8A 3CMMA 4M54A 4O1MA 2VHWA 4EGFA 2VZ8A 1Z74A 4MKZA 3KB6A 1YE3A 3PIIA 4XYEA 5DP1A 3UOGA 3MOGA 3JQ8A 1M6HA 2Y1EA 3DQPA 4IDEA 1CF2O 2RAFA 3OJFA 1UXHA 2G76A 2ZQZA 2NSDA 1UJMA 3FBTA 4UVIA 3D3WA 4XGKA 2JHGA 4IY1A 3UH1A 2PLAA 3OJOA 5HS4A 2DQ4A 5COBA 2NNLD 5T57A 3U0BA 4CUZA 3GQVA 3H65A 1LDBA 3DAGA 1UZLA 3BZUA 4Z0TA 1NTOA 5BSGA 4IZIA 3VHRA 1N7GA 3DDNA 1YQDA 2QYTA 4ID9A 1YRLA 2CVQA 4BNGA 4GMFA 3RBZA 1YB1A 5FF9A 4GX1A 3GVHA 4NFSA 3PJFA 1HRDA 2ZB3A 5EN4A 1N9GB 1D1SA 1NPDA 1LBEA 3GVXA 3HWRA 3JD3A 1BVRA 1CEQA 1JKIA 2OORA 3D5QA 3GH3A 4MKXA 1HXHA 4IIUA 3U9LA 4D0SA 2V6MA 3FN4A 2ZQYA 2NUAA 4BQRA 5JY6A 4WLVA 1HE2A 1AGNA 4P38A 2EJWA 2FHSA 2NTNA 4IQGA 4R69A 3ZCXA 2DPHA 2C5AA 1EK6A 4FFRA 5JYFA 3QVSA 2D5CA 5CPFA 3VZPA 5CG1A 1KEPA 2YJZA 4Y6RA 2Y93A 4F45A 3R0IA 3ST7A 3OJLA 4LMPA 3GMDA 1K0UA 3KM0A 1I2ZA 3DB2A 1MXHA 3WJAA 1SEPA 4HY3A 1X0XA 3HHPA 4JP3A 4DBZA 5M6DA 3BXXA 4FJ2A 3JQ8B 1MX3A 2BLLA 4IJKA 4N18A 3RFXA 4YRDA 3ZWCA 2YDXA 1R0LA 2J5KA 5CEJA 1AHHA 5ICMA 1P1JA 5IFLA 1G6KA 3BHMA 4NK4A 3MEQA 3TOXA 3TSCA 4BGIA 3PHJA 4E3ZA 4Q3CA 4YACA 4W7IA 4QUKA 1XU9A 1NWHA 4YEDA 4YRAA 3F6YA 3T4EA 2JCXA 2OP0A 1ZUD1 2C7VA 1LUAA 1PJCA 4LW8A 4D79A 1I3LA 4P8RA 1RYDA 3PWKA 1DJQA 1SB8A 4OIMA 4NK5A 5TF4A 3WNQA 1YL7A 3WNVA 1HDOA 2C2XA 1T2EA 5G2OA 4JBIA 2WSBA 5FYDA 3JQBC 1B8UA 1JAXA 1ZW1A 4AJPA 1WZEA 3M1LA 1U28A 2PWZA 1TB4A 5A05A 5I8ZA 1JDJA 4O6VA 4BO3A 4R3NA 2GUGA 1X13A 4DLBA 2JCYA 4A0SA 3I1JA 1MV8A 4L0QA 1A9YA 3B20A 3E48A 3GGOA 1UP6A 3FNHA 3T7EA 1ZH8A 3ANLA 4UVGA 3B1KA 3UAGA 1OAAA 2POQX 4DGSA 2UUOA 3L07A 4XD2A 5CG2A 5ILOA 2R00A 3C1AA 4TZTA 5F5LA 1PGOA 3DOJA 5CEFA 1AN9A 5CDTA 4IDCA 3A4VA 1E1LA 2OO5A 4CM7A 5CDYA 1BWSA 4H15A 3E03A 4W7HA 3ZNOA 5L4NA 1HZZA 1I30A 2CDAA 4PLWA 5K6AA 3VH4A 3V5NA 3MJVA 4J1SA 1RJWA 2GNAA 4ITUA 3NKLA 3CEAA 4FSHA 4XDZA 3WTBA 5JE8A 4YQZA 3WGZA 5AQ1A 3DOCA 1LRJA 1ZK2A 2D2IA 1PJQA 1F8FA 1JQBA 3ICPA 4IUYA 5KTKA 1Z6ZA 4QQRA 3ROPA 5IXSA 2VHZA 5DP2A 2CUKA 5AVOA 5A9SA 3GVPA 3DAFA 1XKQA 2VWPA 3S55A 1VC2A 3GVCA 5DT9A 3UFXA 2AEMA 5CDGA 1KVRA 1B3BA 4INAA 1EVJA 3BMOA 3PGXA 4IBOA 4S3MA 1GZ3A 2W4QA 2OP1A 3H8VA 3W6UA 3EY4A 5A1TA 4ND3A 4BS9A 3EVTA 1XR3A 3KZVA 2JJYA 5JAIA 1WP4A 1PGPA 4CLRB 2QIOA 1IHXA 4FBGA 3GGPA 4FDAA 1U8FO 4CMAA 3HSKA 1JKJA 2BHLA 1DJNA 1JWAB 1PSDA 1XDWA 3BYZA 3DZJA 3WWYA 5C3MA 1LSOA 2NVBA 1E7WA 2HRZA 3KSZO 3JQ7A 2J3JA 3UCEA 1U3VA 2J8ZA 9LDTA 1XEAA 2HK8A 1WWKA 2Q3EA 3GLQA 2HU2A 1WXDA 4J9VA 1NFRA 4E0BA 4FFNA 3DZHA 3SLGA 2HO5A 3P2OA 4BVAA 3HDYA 2AHRA 5J9GA 2J3KA 3NV9A 3RJ9A 2W2KA 4E6PA 4OL9A 4Y6PA 4CLOA 3EHEA 4CM4A 2DBZA 1GY8A 1ORRA 2X22A 2E37A 3QSGA 2YY7A 3BHJA 3ZWPA 4BNLA 2HKIA 3PTZA 4M1QA 1AHIA 4PLPA 3TF5A 1KVSA 2PH5A 5JDIA 3WTCA 3LVFO 1EVYA 3GDFA 2Z5LA 2Y66A 3L9XA 2B4TO 2JD0A 5C37A 2GZ2A 1Y5RA 5CDUA 5A9SB 1GTMA 1K6IA 3FWNA 1ZEMA 5JO9A 2PY6A 1WMBA 1DHRA 1XGKA 1PS0A 3FI9A 3LK7A 1UZNA 2X0RA 1D1TA 2XAAA 1IHYA 3C3XA 4IDFA 3WIEA 4C7KA 4NU6A 4FCCA 4TWRA 3NDIA 4R5MA 3PEFA 4DPMA 2VOEA 4GX0A 2JD1A 5JAZA 3D3EA 4PLHA 4J4HA 1NHWA 4KDEA 4HX5A 3NTRA 1XCBA 3VPSA 4A26A 4LVCA 2P68A 3IIEA 1PZEA 2BGMA 2BFMA 4EUFA 1DAOA 2YV1A 3IDSA 1ENPA 1U4SA 4L8VA 3JQ7B 3F5SA 3ZH2A 1TEHA 1PS9A 3NUGA 4LSWA 1DLIA 3KSUA 3GF4A 3N74A 1SMKA 2WJPA 3COSA 4OAQA 3ABIA 2GF2A 2Q1SA 3FNFA 4FS3A 4GSKA 3TN7A 5ITWA 2VUSA 3PDJA 1Y9AA 1LJ8A 3GK3A 4DL9A 1YO6A 1IULA 4Y8VA 4U6QA 1IL0A 2P91A 3TZHA 4EUEA 5JNLA 3LC1O 1PZHA 2W2KB 5FWNA 3RAJA 3JQEA 2X5KO 2E48A 3WGOA 1UXIA 1J0XO 4CM4B 1KOLA 3HDHA 4J43A 3KVOA 3H9UA 1ZO8A 3JYPA 1DOHA 3RUHA 4XWYA 4NR0A 1N5DA 4PRLA 4ZRNA 4JXKA 4NU5A 3LDHA 1FK8A 2NQTA 2CNBA 5T73A 1PR9A 1RPNA 5A3JA 4WGGA 3CUKA 5DN9A 4DIOA 5K0ZA 4ONEA 3M6IA 3DBVO 2R00C 3G49A 3HQ4O 1N1GA 1ML3A 3EZYA 4WKGA 1YBAA 4L73A 3S2FA 4CR8A 1L1FA 5I7EA 5F1PA 4XQCA 2G82A 1UUFA 4FJ0A 4BO1A 5JFOA 1BRMA 2GD1O 1NYTA 4II3A 3V2GA 3K5PA 4QSMA 1GR0A 1MGOA 1ZXBA 3KYDA 3IQDB 3ZWAA 3TZKA 2C59A 4TVBA 1EMDA 5K6AC 1JVBA 1YKFA 4Y9DA 5G0UA 4KTVE 3KLPX 1YQGA 4RPKA 3G1TA 3RQSA 1GYQA 3DR3A 2Z95A 4IJVA 4AL4A 4UUOA 2UYYA 5JO0A 1GZ4A 1ZMOA 4BNKA 4RJTA 1ZCJA 3K6JA 4DLLA 4QEDA 4XR9A 2PKQP 4XIYA 1Y9EA 3WMWA 4A10A 2Y0CA 1H94A 4EDFA 4RV9A 1OC4A 1VKOA 4E5NA 3AOGA 2D8AA 2WE7A 4E2YA 2OBNA 5L53A 1TA4A 5LCXA 3E5RA 5G4KA 3AK4A 4O59O 3DL2A 4YQYA 1NX6A 4IXTA 4XGIA 5BSHA 2BGLA 2O3UA 4YA6A 5C7IO 1I32A 4GLOA 1SNYA 1M76A 5DBGA 4ALLA 1O0SA 2Q1TA 3Q3CA 4FN4A 1XELA 2UV8A 5JY1A 3ADOA 4FC7A 5IZ4A 1CJCA 4L4SA 1T24A 3GUCA 1P0CA 4YPOA 2AE2A 3ZWWA 4EJ6A 2RHCA 1IPFA 2NQ8A 4YAIA 3BTUA 5CDSA 2DFDA 1XIVA 3U4HA 4CQLB 4GX5A 3AM3A 4F3YA 3DTTA 2EV9A 3PYMA 1YDWA 1EFLA 2YV2A 4URFA 4WCFA 4B79A 3WYBA 1Y81A 2JL1A 3TZCA 5JCJD 1RYEA 2VHYA 2HK7A 1HTBA 4MJLA 3JD1A 5JLAA 3UW3A 4EW6A 3AU8A 2D4AA 3RUCA 4BNWA 1E0DA 2AE1A 4YAKA 4OKNA 3RWBA 1LNQA 1NNUA 3EMKA 3MJSA 2C29D 3PWSA 3BHIA 4LK3A 4PLZA 1LRKA 3L0DA 5DDIP 1LLCA 5A4DA 5ILGA 1BW9A 5I7FA 2FR0A 5JDIC 4O5OA 1LRLA 3TL2A 5JCXA 5KVSA 1FDSA 3JYNA 4R54A 4LRTB 4PG7A 1SB9A 4ILKA 1DC4A 3GHHA 3FBGA 5G4KB 1U5AA 2PZKA 2Z1NA 2Y67A 3L6DA 3A14A 5ITVA 2EGGA 2VZ0A 4FR5A 3KO8A 4AJHA 3O8QA 3K2BA 4MVJE 3Q0EA 3I9NA 3MCVA 1IE3A 4YT8A 5KVVA 2GZ1A 3ETDA 1R66A 3D4PA 1E3EA 1DBVO 1B3RA 1Y6JA 3FD8A 1X1EA 2I76A 3JYOA 1UH5A 2FR8A 3U4DA 1H6DA 1ZMTA 1U8XX 3GMSA 3QW2A 1I36A 5F3RA 3DWFA 4J1NA 3ZV6A 3ITKA 1GEGA 1H9BA 3E8XA 3H5RA 1KERA 3X2EA 4EUHA 2YHUA 2E6UX 1ZKMA 3L9WA 3LT1A 1ID1A 4WCFB 3IL2A 2QRKA 1T2DA 5TJHA 3RUFA 3FR7A 1KEWA 2HJRA 2X86A 3C85A 2H63A 3QQPA 2D0IA 2FWMX 4R9RA 5CFZA 1T1RA 1YJ8A 3Q11A 3DHYA 3JTMA 3DXFA 4C4OA 2JFGA 3U4IA 5JYEA 2O3RA 4DIBA 2GN4A 4KQXA 3GDGA 1ULUA 3SC4A 4BMVA 1U2DA 5EJ2A 2ZYGA 1FDUA 3FTNA 2G0TA 4BNXA 3VH1A 1BW9B 2AG8A 3F47A 2GO1A 1GUZA 3LF1A 4H3VA 1LC3A 5IJZA 3KV3O 1X7DA 2X0IA 4BNUA 2DBQA 2J5QA 1F17A 3CSDA 2HDHA 4WLUA 4WEQA 3TWOA 3WFIA 1GD1O 2PD4A 3SC6A 2YYYA 2B69A 3DEYX 3VZQA 1M2WA 1PL7A 3OEWA 3O8QB 1X7GA 3IJRA 3PRJA 4I5FA 1VPDA 3TZ6A 4BNHA 1RWBA 3WGIA 2CF6A 1MG5A 5GZ6A 4ZJUA 1DIAA 1LXCA 3DBLA 5TNXA 3MJCA 3ROQA 3ZWVA 1ISMA 2CFCA 4JGBA 1NHGA 1ZZEA 3NJ8A 5IF3A 5J23A 1DB3A 4B7XA 2B83A 1BXKA 2HMWA 4YT2A 1ISGA 3OSUA 4RVFA 5JAMA 2NU9A 1KY5A 4D42A 5LDGA 5H82A 5I7VA 1VJTA 3K96A 3UN1A 4EBFA 3SXPA 4FB5A 2G17A 3HDJA 3LT0A 2HJSA 4W9NA 1GQ2A 1N2SA 3E9MA 2YZ7A 3QWIA 1NVTA 3GG2A 5DCYA 4HNGA 4ZHSA 4QECA 4A03A 5DOVA 2D59A 3KBOA 1LDEA 3OM9A 4D46A 3RKRA 1U2GA 2OGUA 3QY9A 3DZGA 4Z9XA 4BUCA 1SOVA 4EYEA 1D4FA 1R4MA 5JYAA 3ONEA 4DQXA 1HE3A 4GGPA 1CYDA 2ZJ0A 3ROKA 4GVXA 3DC2A 3LLSA 1W8DA 1C3VA 2NADA 2GSDA 3WMXA 2B5VA 7MDHA 4YWJA 1DRUA 4BNYA 2EP7A 1KYQA 2P9GA 4OJNA 4AFNA 4B4WA 4HV4A 4AJ2A 4XRGA 4I5GA 3E5MA 3KOUA 4WCDA 4HWKA 4Z9YA 1ZXLA 2V6BA 3B6ZA 1E92A 4NBTA 2HK9A 1IYZA 1LSSA 1P77A 3DBLB 4B7CA 4B4UA 3AJRA 4AG3A 4J1TA 3BTVA 2WE8A 3SLKA 4WCFC 2VWQA 1PEDA 2P5UA 4HP8A 1ZJZA 5BR7A 4KZPA 1X15A 1KS9A 5ER9A 4XQGA 4GVLA 3RU9A 3K31A 2X0NA 1TT7A 2AQ8A 1HYGA 4TMFA 3PI7A 3PDUA 1JWBB 1BG6A 2H6EA 5EQFA 5A9TA 3S2GA 1DHTA 1VE9A 4DREA 5B4VA 4WK6A 3ZHBA 1PZFA 1O95A 2EKLA 2O3QA 3RUAA 4E5YA 4XZ3A 1T4BA 1PL8A 2QQ5A 4Q3EA 1A71A 4RF3A 2B36A 2OL4A 3ZWYA 1EE9A 3PJDA 4GX2A 4MKRA 1Y8RB 2IZZA 1DRVA 2LDBA 3GHYA 4KDFA 3I9LA 4NMHA 1K3TA 3ITDA 1R4MB 3H7AA 2IZ0A 3OECA 1U7HA 2FMUA 4MVJG 1QR6A 3U5TA 3KSDO 3WSVA 3DHEA 4ND1A 3ZNPA 4CV0A 5FI5A 1DFIA 4CR6A 4I5DA 3WYEA 4MINA 3T7CA 4RVUA 2BKAA 5F1OA 1MA0A 2EWMA 1P44A 4G65A 1HKUA 1I0ZA 5KWEA 1H6AA 1GUYA 2WM3A 5THKA 4CMEA 2IYPA 4K6FA 4CMHA 4F46A 4E5MA 1UP4A 1DRWA 1HLPA 2CZCA 2J3IA 4PZCA 5BQFA 1P0FA 2XXJA 3WFJA 4RF4A 4FFLA 1GFSA 4FFPA 1M66A 4FC6A 1S6YA 3STHA 3O38A 4B3IA 2CDBA 4XYGA 4YVFA 1B26A 3PGJA 3WGGA 4MIEA 3RVDA 1B2LA 1VL6A 3I9OA 4UEJA 3H9QA 4WPGA 3ZU5A 3PFWO 1LSUA 2X9VA 1A7KA 3JQCA 3PZRA 2GRAA 5EERA 2Y0DA 4PZEA 1NWCA 4YCAA 2QRJA 4J4BA 4IS2A 5HS6A 3L4SO 1QYDA 4Q9NA 4B3JA 4RLHA 2I9PA 3FSRA 3E82A 2NVUA 3F46A 3IC5A 4J4TA 2I6TA 2O2YA 1EBUA 2W2LD 3PLNA 3LC2O 1GL3A 5U4QA 2Q50A 3K73O 4FGWA 1I3KA 4RF5A 1C0KA 4GQAA 4R41A 1OC2A 3HJAA 3P7MA 3Q1LA 1ENZA 3KLMX 4OXYA 1BVUA 4BHTA 3DZFA 3QE3A 1OI7A 3QLJA 2VYVD 1MFZA 2W2LA 2I99A 3AI2A 2CDCA 4A2CA 4D3DA 1H9AA 5K9ZA 4XQ9A 2EHDA 3PHLA 1OMOA 3GZ4A 4KWIA 3I9MA 1P1FA 2QYSA 1YL5A 1LX6A 5A5EA 3AFMA 4D44A 4OQYA 3I3OA 1DO8A 2VYVA 1QV7A 3TL3A 1B8VA 4IDBA 3LSYA 1B7GO 3WGTA 3D0OA 1E1MA 4B8WA 4IDDA 4RVGA 4U0KA 1PL6A 2CY0A 1J49A 4W9NC 1GCOA 1K6XA 3WBBA 1HE5A 2Y1OA 1EUCA 4XKJA 1CDOA 3KEQA 4XJSA 4B3HA 4ZQHA 3GFBA 4OH1A 4CLRA 2Q46A 5H83A 1ZK1A 3RUEA 3ZI0A 4CL3A 4ZD6A 5DCUA 3FPCA 3S8MA 3CPSA 4BO9A 5B1YA 4EEXA 3JD0A 2XF8A 3G3EA 2X4GA 4JBHA 4MVJH 3WR5A 3MWDB 2PFGA 5JPIA 4E31A 2NVWA 1HYEA 3LYLA 3EVNA 4PG8A 4AVYA 3GG9A 3UKOA 4IQ8A 3VPXA 4CM6A 5DOZA 5COQA 1PGJA 1YL6A 1PJ3A 3PYLA 5I7SA 4W82A 1H2HA 5DBFA 2RH8A 3NGXA 2NVUB 2I3AA 4TVOA 3KUXA 1I3MA 5B12A 4DC0A 1HEUA 3INRA 4IDAA 1QLJA 1XQ1A 4FJ1A 4P22A 3GN2A 4J0EA 4YT5A 5I9LA 3RROA 4QX6A 1GAEO 3WYCA 2GCGA 4NBUA 2Q1WA 2WD7A 1VSVA 3ETEA 4PIVA 3VOSA 4E33A 2CD9A 4B7UA 3OICA 4J2HA 3AOEA 5JYDA 4CMKA 1B8PA 1RM0A 3QWFA 9LDBA 4JP2A 3WIDA 2WTBA 1LDNA 4BNFA 3ON5A 1GQYA 1OZAA 4XB1A 3NT4A 3NYWA 3I9KA 4R1UA 4U6SA 5DNAA
chains in the Genus database with same CATH superfamily
2R66A 3SMQA 4XJTA 3VR4D 2B92A 1CB0A 3TKYA 5G0SA 3ABRB 4ENSA 2PHZA 1GPNA 1JSXA 1Y6QA 2Q1UA 1FFGA 1KP2A 1YQXA 2X0FA 3QVXA 5LFAA 1NN5A 3O95A 3NBKA 4WY8A 1C1XB 1P17A 2A67A 1KDYA 1DXYA 1ZCAA 3EVCA 3QVWA 2JIBA 3MILA 2NTYC 2K4MA 4PZ0A 3RS3A 3WY9A 1GU7A 2FWIA 1ACLA 4NYMQ 3GC6A 2VWGA 3HXKA 3OM8A 4HFJA 2QRVA 4I9NA 4Y7CA 4Z4CA 2YV3A 2QAGB 1RXWA 1SZPA 1GQFA 4QXOA 4FXOA 4YMVA 4JSTA 2FNAA 1G64A 3FE2A 4CGZA 2CXHA 4FQ8A 3K8ZA 5IC6A 2IY7A 1DIRA 1PZMA 2TECE 3T5TA 3EHDA 4AKHA 3TTXA 3KQMA 4A0QA 3LVRE 3UKJA 1YJQA 4AN1A 1U7ZA 1I4EB 2ZRLA 3I6IA 2CZQA 3QKIA 4J76A 3BWBA 2PNJA 3VKUA 2WUVA 5JD4A 1UDBA 1WX1A 2AKEA 3HU3A 3NVAA 5EMKA 2GEDA 4BGEA 1V35A 1Y82A 3U9TA 5KHAA 4C6TA 5LMCA 3HKBB 4YBZA 1WB4A 1ZIXA 2IZ1A 4K81B 1MRSA 3OU6A 2EZ4A 4IGIA 5DGIA 4XX0A 2CB9A 2LBPA 2P77A 3OZSA 4GLBA 3VZSA 5B6PA 3WRXC 1WCIA 1BD3A 5HF6A 1QH1B 1ZK4A 1G5FA 3SHTA 4B3CA 4RDXA 2PGJA 1BHJA 1JDTA 1L4EA 2Q5OA 2BGGA 1A97A 1G8PA 2WNHA 2HMUA 4IZOA 1LA2A 1NBOA 1AK2A 2ZJZA 2VJDA 1NASA 2EJVA 2QKYA 3B1YA 3H2SA 3RSZA 5CA1B 2VSFA 3S99A 1AXGA 2Q2OA 1ZH4A 2A0FA 5IT9A 5FADA 5TMBA 1B14A 1MX1A 4W4TA 4EVSA 5FI1B 4YT4A 4DVJA 1H2RS 4AC9A 1V8FA 5DU2A 5TPWA 4GBGA 4YJGA 3HS3A 3EPRA 1SO8A 1BMTA 5CB4B 2J9GA 3TTUA 4PN3A 1K9VF 1QFSA 4MRNA 4D97A 4DS3A 5EHZA 3K9NA 5E4FA 2IL1A 5JW6A 1S3GA 3EWNA 3CC8A 4DYHA 4A2QA 4K9DA 1FFSA 1MPTA 2EFYA 3ISJA 3B3GA 4WFJA 1W29A 1FYXA 2HWXA 3L0PA 3P0RA 2R1VA 2ZS8A 1UJCA 3EAQA 1FDWA 2FP3A 3TQQA 2QRVB 2WFAA 2D00A 4M6WA 5B2ZA 3EA0A 3TNDA 4TGLA 4DY4A 3BRSA 3I2FA 1ODKA 2CXXA 4IJQA 4M8IA 1UZMA 3KQSA 4I9HA 4MQMA 3BE4A 3BA1A 3VZBA 3WICA 1RXEA 5LYJF 3LPNA 4FOOA 1DEOA 2BT4A 3O3MB 3FWZA 3TR5A 1PZXA 2OO3A 5MGNA 4JJ6A 4BP3A 1YE8A 3HVJA 3LI2A 5GTDA 1GPBA 4QVGA 3HU2A 3WMGA 1V37A 3O9VA 3FRJA 4D5EA 3G2NA 4F97A 1LQTA 2CBXA 3EIFA 3RYHA 4YMLA 5KSWB 1B16A 2ZT6A 2YWRA 2YW9A 2PT7A 1A82A 4XX0B 5EUBA 1DWOA 3SZOA 2Q5LA 4BYMA 2I1QA 3SFTA 4DCGA 2N3ZA 1KE1A 2CE7A 5GJWC 4RPJA 1AH2A 1SQGA 2VOJA 2QQFA 4BPBA 5KYNA 2G5GX 1BDMA 2GRUA 3WG9A 4R7GA 2AMFA 4OAOA 2LZ0A 1R9NA 1Y1PA 4RTQA 5CMLA 4BVGA 1XKXA 3LECA 1BGVA 3FSGD 3FKSA 1ESZA 3GJ3A 2D0OB 5HMMA 3VDRA 3MJTA 2Q5JA 1TXGA 3HM2A 1XJCA 2DVMA 1XWFA 3SBOA 1TZKA 1B74A 4DM3A 3HCEA 5AVXA 1QO0A 4JI2B 1Q3KA 2FWPA 2H2AA 3DQZA 4YJGB 5TPWB 3RBXA 4DDWA 3OMLA 8ATCA 3AHGA 1JHZA 3AU9A 1W88B 2IHTA 2ODAA 1JL3A 1YT5A 1JHYA 4PIPA 2Q22A 2O07A 1EZ4A 2Q1XA 4LTDA 4NZOA 3WNDA 2XMGA 2XYQA 1UL1X 1T0PA 1S1CA 5LM3A 1WPGA 4C7VA 2PUGA 3QP9A 4CQLA 1ABBA 4V03A 2HA7A 2GN6A 3OQ6A 2R1VB 3MCAA 1XKLA 4NESA 4DM7A 1MLDA 3QEKA 2JJ8A 5CFPA 3TG2A 3OLZA 2BTEA 4P4GA 3PJGA 1CJMA 1EFTA 4YROA 2BSXA 4R1TA 4HXYA 2ZPAA 1E96A 1PQWA 3NVDA 2ZYDA 2IFTA 3F3SA 3P4UA 5JZBA 4RTMA 3BWYA 1YA4A 2C9YA 4ED9A 2C42A 1CG6A 3HDGA 3RHSA 3A1UA 1FRZA 3Q87B 1U2RA 2AX3A 2RHDA 3H0CA 5DTJA 3R7AA 1GA4A 3BORA 2V7EA 2GBFA 3LFUA 1AV7A 1G42A 2KM1A 3FWKA 1FDRA 3HKCB 3PQFA 4HWRA 2PWAA 2OT3B 2X6TA 1N2ZA 1W52X 2X40A 3BN3A 4XCVA 2EX1A 3ZVMA 3JQ9A 3OQVA 3RYHB 2AGVA 5FEUA 1USVA 3HUUA 1E62A 1KL7A 1VRWA 4X60A 1NUQA 2P6UA 3QXXA 3Q9NA 3PXXA 2VS1A 4U7WA 2QR3A 4G5YA 1MD9A 4HSGA 4MCIA 1LQUA 5CFMA 4LF7B 1XTUA 3ZW9A 1W93A 1MN6A 2I6QA 1I01A 2H7XA 3BJRA 3WDLA 3WLEA 1VJ1A 4RKFA 4YHBA 3DZ2B 5DCWA 3IAEA 5FPTA 5E1OA 1XRSB 1FDIA 2VCHA 3G2LA 2IYSA 1ST3A 1D2CA 2F3SA 1A2KC 3M2PA 2NZJA 2C3PA 4PSDA 3RJ5A 5A2GA 3A6HA 1P5FA 2OCYC 3A8TA 3AHIA 3DO8A 2FUEA 3G2QA 4JQSA 4KKXB 4L8YA 3COPA 2EIHA 1M73E 1CZRA 1YJ5A 1CZUA 1VA4A 4Z86A 5BSEA 1ZG3A 1T35A 2FN4A 1VL1A 2O7QA 5JUWA 3G82C 3P9IA 4W1QA 3ZQ4A 3RS0A 5JARA 3O8OA 1ADJA 3GJ6A 4CRWB 4MQEA 4AX8A 1FYWA 1XZ8A 1QBGA 1QFMA 4GF5A 3TOVA 3Q6NA 2QTAA 3CVVA 1KRXA 4J0FA 4MOWA 5FPPA 3AQ4A 4GR4A 4HB4A 4GPBA 5CNJA 1P4SA 4NAHA 4D9CA 4G09A 1RIIA 1V5GA 1CE8A 3JD2A 5GOTA 3NGLA 1KZ4A 3IBFA 2AVNA 2IYTA 3GH1A 3BGOS 1LQ2A 4K6MA 2MCFA 2HLHA 1FFEA 3HUDA 3KR1A 1Y89A 3BRQA 4URUR 4LFAB 3EISA 1NQTA 4K1LA 2Z1MA 1Q7TA 2P90A 2W11A 2YJ5A 3M33A 3FNRA 2YIDA 3IUJA 4YUXA 3I2YX 3ZJVA 4MR7A 5F21A 2XPCA 4C7XA 1OCEA 2C9BA 1PF7E 2Z9BA 2XTZA 2I3GA 5CH8A 5IAKA 4MP3A 1Y7HA 2VP9A 4H7EA 3INTA 4F5YA 4F4FA 3R3ZA 1T9ZA 2J5RA 3VI4B 3FPHA 1GCGA 3KZKA 2SCUA 1YUBA 3LKDA 5EMMA 3Q3IA 5FNVF 4DB2A 5LDHA 5HIMA 1OBOA 2PN1A 4H9GA 1Z06A 1NY5A 2ILTA 1KQPA 1TKBA 5LIRA 1CUWA 2GKGA 3GPLA 3H87A 3A3OA 3O4RA 1XA4A 4S12A 1QQ7A 4A5OA 2O2ZA 9ABPA 1U90A 2PRSA 4F3TA 1LK5A 1D07A 1FPQA 2VPZA 1JPJA 5FT9A 4PFKA 1FSPA 4BOYA 3L2OB 5SYAA 5CYPA 2GCIA 3T7JA 5ADWA 5CP8A 3KPYA 3AJEA 3RVLA 2O52A 3R3WA 4C5AA 3EZLA 4HQNA 1ZK3A 5KTNA 3IBGA 1EK0A 2WIKA 4UREA 1CZHA 1J5XA 1TAHA 1JKFA 2ZJ7A 3CXRA 3E8MA 4TS9A 3BGDA 2FSUA 4UATA 5E9AA 4EJMA 1BDHA 1V95A 3AC0A 4BE7B 1XU4A 1H1DA 4X20A 3DDOA 2Q7OE 3O7WA 4MQEB 4NU0A 3OAAD 1HLFA 3Q9LA 4CM9A 3ZE9A 1WV1A 4OB8A 4RY0A 3E2IA 4LXXA 3O8CA 4MUEA 2OQVA 4KO1S 2X1VA 2XGSA 3V1TC 1ZMBA 4BMPB 1UR5A 4PGAA 1NMYA 1E6CA 2OMKA 3DV9A 3QVKA 1U2PA 4Y18A 5DIZA 5MN4A 1C8VB 1V47A 4R7TA 3BCSA 4YDRA 2QUAA 2HY7A 3QNUA 3C98A 3FBWA 1I5RA 2QK4A 2V6IA 1EVLA 3EUAA 4P80A 4HUJA 4QGSA 5BNZA 4OLHA 1KMHA 4FEAA 5EGSA 2IUUA 3EB9A 3R7WA 1I6LA 4N5MA 3VNQA 1Q7BA 1CETA 3O26A 3DBOB 2VBGA 3LRTA 1M72A 4CIWA 5KQSA 3UOAB 4OATA 5DGHA 1Q1ZA 1T4DA 3OZFA 4UNNA 4L0DA 3N2KA 1UC8A 2AOTA 2APJA 2SCUB 5IYZF 3LCVB 4YQFA 4PZAA 1T2CA 1QRSA 3U1BA 3COYA 3VPDA 1XQVA 3KHUA 1QZUA 4BB6A 1AGPA 4C0SA 3LHDA 4F93B 1GDDA 3FPLA 4S1VA 3KQPA 3BXHA 3M8KA 1EM6A 3IAS1 4MO9A 3P9QA 3BWCA 1EZ1A 1JFSA 4E1BA 3NHYA 4KAXA 3DPUA 3VZCA 3ZHTA 4PYQA 4Q15A 3BMNA 1DPFA 3CR7A 3IDAA 2CXPA 1X87A 1M8KA 1WPXA 4GXRA 3V7WA 3FUVA 4QLAA 1XTZA 2R6AA 3WGUA 4PHGA 1SVLA 4G4SP 2DGDA 1ICEA 1V8OA 2HEGA 2DTXA 1J23A 1T9BA 2VDWA 4Z4EA 3INNA 4P31A 5DN6D 2ZKLA 4YX9A 4KR3A 2CNKA 4ZT3A 3RYFB 4PTZA 5B3JC 1O5OA 3O9MA 3L4BA 4X20B 2X15A 1EP2B 1FS6A 4WDQA 3RSHA 3U80A 2ONYA 4OQXA 1ACMA 4JITA 3FHOA 3HP4A 3E3OA 4MKIA 3W2HA 3V8QA 1RKQA 4JENA 4LXGA 4AMUA 5A71A 4FUQA 4ZYYA 3A3YA 3R41A 4BV8A 5EEHA 2B5OA 2FPRA 3TOZA 9MHTA 2VZ9A 2DBVO 4MPRA 5KOIA 1VYHA 1CT9A 4QDTA 1XQ6A 1C9JA 4MYSA 3CG0A 3WBJA 2EOAA 2XQIA 4JWTA 1GCUA 2QXYA 4QG7A 2JFVA 1MXFA 1I80A 1NF3A 2E5WA 1HL3A 3ZVKA 4L9RA 1O94C 1KMHB 4C2TA 1UK6A 4AZSA 1CUHA 3D0KA 1DEHA 3T5AA 4ARIA 3DJFA 3A3NA 4AJJA 1OIWA 2VKQA 1Y8RA 5AJHA 2XE6A 3CNOA 1EEHA 2JLQA 3HDTA 3I6QA 3T41A 3N2KB 2GNPA 2XE8A 5AKZA 2AA3A 4IIGA 1P3JA 1XTBA 4C6SA 1KVUA 3SVZA 3MOSA 5JYBA 3IEPA 2VO1A 1KZ7B 1C9EA 3I9JA 2X0JA 2XVXA 3NX4A 4G0QA 4HH3C 2PZBA 4ZVPA 2Y9MB 2XT6A 1XD9A 4C4YA 4OLFA 4L5JA 1E9CA 1PLKA 1LTKA 3OX2A 1IAQA 1C4OA 3R3VA 2Q7DA 4K28A 4V0LA 5GONA 3JYQA 4G2NA 1WP9A 2OSBA 1A04A 1CUVA 1GPDG 2CVHA 3D8SA 3S0JA 4CM5A 3MS2A 3LQFA 2CLDX 1A4UA 1S9DA 3ESCA 3OD1A 3RAGA 4BIMA 4O4JF 2F4VB 3MWEB 4EG7A 3BMNB 4I1VA 1JHDA 3N2LA 5DHSA 4OQDA 2GFIA 4QGAA 4IICA 1JDUA 4ENWA 1ZK0A 3EDQA 4C04A 1A3CA 3ZU2A 4D6YA 4CT4B 4UDYX 2HRCA 2VDWB 1SQ5A 4D6PA 4N54A 3N28A 1J09A 3PD1A 3B12A 4QPJC 4X6UA 5BQPA 5A6SB 3ZV7A 2JKVA 4Q1BA 4D41A 4WTOA 2ADMA 1OY1A 2H1VA 2E0IA 4ZVLA 4P3NA 5J47A 1ZUNB 1JSRA 2CNOA 2QJRA 4H7JA 2MINA 2R5NA 3F6CA 2JASA 3NEAA 5JH7A 1EB9A 1K7YA 4MEAA 1BH2A 3GLTA 1JEDA 3C5CA 2ZDGA 3LYUA 1J2YA 4N01A 4NENA 4ZXPA 4E94A 2QTVA 4F3KA 3GFRA 5CFQA 2LIPA 1GV0A 3DG9A 1JG6A 3ED5A 2QTLA 2MSWA 3E9EA 5JPCA 2VHJA 3OETA 3DMYA 2ZIVB 2YUTA 3JD4A 1FMCA 4GI5A 2JD2A 3QU4A 3TBFA 5KNBA 1G291 1C80A 2W98A 2WILA 3JWGA 3OUTA 5IT5A 2ZBPA 5TQJA 3UAWA 1M6WA 2J7KA 4O33A 3M49A 4ENTA 3DV0A 1AO3A 4RSHA 4W6QA 1IZ8A 2MMGA 5FX2A 2FU5C 3O3CA 3V8NA 2O1XA 1NT4A 3PX3A 5ESWA 4YR9A 4OQQA 1IFXA 1J2UA 4HBGA 4I1OA 4DF3A 5IJ0A 5I7HA 2PKXA 1DADA 2CEKA 3G8DA 4TKLA 4TL8A 1U3UA 2HEIA 1F60A 1HEYA 2NN3C 4XLTA 2HU7A 4G1VA 4FOLA 4RQBA 4O08A 2M32A 4TKUA 2PKEA 2RBGA 3BXGA 2FUG1 4NV3A 4BYGA 5HCNA 1FFYA 5KB3A 2P3QA 4MKFA 4I50A 3UICA 2D1RA 2JGDA 2ZIAA 2G4LA 4JL5A 3N0RA 3H19A 3QEJA 4JLSA 1A5ZA 1K8XB 2IYFA 5IHPA 1KVTA 2X8JA 3T1OA 1KHTA 3IIJA 4RKYA 3V1LA 4C4XA 1QTNA 5CB0A 3JQFC 2PRJA 1GGFA 3AGQA 3IUEA 2QP4A 3PU6A 5E3HA 4RMNA 1X19A 2HMVA 1KQFA 1U5BA 2WQ6A 1T8SA 5CT6A 3OFNA 3IB3A 3WQRA 4Z0PA 3RDPA 3HJUA 4LZJA 4DAOA 1JIXA 3G5UA 4LCJA 5A5GA 4CIAA 3C3EA 1S7CA 5JG7A 1T9DA 1L7DA 2MINB 1ZMRA 2CNWD 5JH7B 4L5CA 4X7PA 2PK3A 4G4GA 3CJRA 3NLLA 3OH8A 4WJZA 4JBYA 2A59A 4NENB 3RRFA 1DTSA 3PSHA 2Q6LA 2ZJBA 1SKUA 1ADCA 3ZKAA 4DFDA 3C4VA 3EGVA 1Z5OA 3M1AA 1ZLXA 3B1JA 5BUSA 5KJ1A 1KMIY 4D8WA 3USCS 1RQGA 1QMHA 2JZCA 4Q9JA 1YMUA 5FNZA 4UMDA 3I0MA 5A5VA 2I2BA 1KEVA 2BBSA 3D2LA 3OJWA 4L3WA 2ZXUA 1EXDA 4K6OA 4EH1A 3NFRA 3R0JA 3KFLA 3DV0B 3L0YA 3NOOA 3TKAA 4WBNA 4ZICA 4PZYA 5EIBC 1IIRA 3ABSB 5HEKA 3EZ6A 5I9BA 3SYTA 1HETA 4ZO8A 2LKDA 5LXTB 5CLLA 1GTVA 1ISSA 3H9EO 4JZYA 3WWCA 1E98A 2WYUA 1JBEA 1ZMXA 4TXHA 4PAWA 4WFKA 1EM8A 3OIDA 3TEJA 1YR8A 2NLOA 2O48X 1ND5A 1ZOLA 2BBWA 2HSWA 2X9QA 3I5UA 2O20A 4RW0A 3T9EA 4TKUB 3VUFA 4DXAA 2DKOA 4ND6A 3VDMA 1K6MA 3ZN2A 4PLGA 3HM9A 1CJUC 3IAHA 3NP9A 2JGDB 3HCRA 3ND8A 4I50B 3WKCA 3CNLA 5EXPA 3UHFA 1REQB 3OOHA 5D1HA 1ITZA 2XUGA 1FU4A 1IK4A 2XYPA 1TU0A 1E3TA 3OHMA 3HNPA 3QE4A 4LY3A 2G83A 4QEZA 2YINC 1SXJD 1U5BB 4NWIA 5WRFA 1IB6A 1TYCA 3DZ7B 1HYHA 4PGHA 4WFQA 5JWRA 2NT3A 4BUJA 3L6UA 4DDUA 4R81A 4AF7A 2JFYA 3JVUA 3H1EA 1DQRA 2VL7A 4CMIA 1SVSA 2WOJA 3S8YA 4MVCA 4OB7A 4Z49A 1ZX1A 2BMDA 3E7PA 3T7SA 3VNSA 3WL6A 2C0PA 1OLSA 1LY1A 4AG5A 1A4IA 2YN0A 2PX0A 1P45A 2BFOA 2ZIEA 3IULA 4L4RA 2GN8A 1H05A 4R40A 3ZWWA 4F04A 4RTNA 3UOWA 3EGDB 3I53A 2OUIA 5I9NA 2I2WA 4I4TB 3QWHA 4RO0A 3WLFA 1XZIA 4BL5A 1QRDA 3TQRA 1J00A 1XNRB 4G2TA 2GAOA 2Y1GA 3S4YA 2RGEA 1AB6A 3RSOA 3TMAA 2GHQA 4FYMA 3CVUA 3A3PA 3IT0A 2R6CA 1ZESA 1NMEA 2GPTA 2ZI6A 3PWTA 1UKZA 4DMMA 1MT3A 4ZCTA 3O82A 2C7PA 1RM4A 2BHTA 4BEWA 4HNQA 4FFMA 1U3CA 3B9RA 2O9JA 4LYYA 1WXHA 4FX5A 1P0MA 2PMBA 4WZBE 3PPYA 4JJAA 4HI0E 3EXIA 4IP0A 1EM8B 4E21A 1FW8A 2KHZA 1J56A 5AO9A 1GO2A 1FDTA 4N47A 4PXSA 3WYAA 5EWMA 1RKXA 3C3DA 4OHWA 3OJEA 4PR3A 3GFFA 3P32A 2H65A 5E2AA 4C3VA 3SP1A 3T1YB 2JNWA 3V8EA 5ICSA 4G0YA 1L5HA 3E0QA 3EP4B 3F98A 2VRBA 3U49A 1U0NA 4JYZA 1QFYA 2FA9A 3Q8WA 4FS8A 4FVTA 2F3TA 2RHWA 3BFJA 5F7XA 2B37A 4XB2A 4P81A 1FYFA 5CA1F 1APBA 1IZZA 3O7MA 3M2TA 3HCDA 3L7OA 1Y1LA 2VUTA 2ZYSA 3HWSA 4M2LA 1QQ5A 5FTJA 4CODB 1BE0A 1FPMA 2NUPA 4EJ0A 1RZRD 2WEKA 4L4UA 2I4MA 4TLAA 1G3RA 3G79A 3QTLA 4KPYA 4CMIB 5CB4F 4I08A 5IWAB 2BEVA 2QRPA 5KKAA 2FG7C 1HTTA 2FW6A 2WSMA 2XJ4A 1K6EA 2NSLA 3OQIA 1BCSB 2REBA 3C70A 3GNLA 1KBZA 4LNUA 1OLSB 2X77A 3P19A 3BILA 3OO0A 1NJ5A 3O92A 3S2EA 2FOXA 2ZDHA 4CFSA 1Z5WA 3RABA 2HT6A 3U3MA 3K4PA 4QFDA 3A2MA 1EQAA 1S01A 1QK5A 2WJYA 2CF5A 1T15A 3C5VA 4QE3A 3KQQA 4HFRA 4YDQA 2J09A 2DT8A 2G09A 1IONA 2VYNA 4KEAA 5TARA 3ZV5A 4CKZA 3GN1A 4RORA 1AUPA 2PT6A 1UZAA 2AEJA 1TMGE 3CIFA 1NN1A 1IQRA 3O1JC 4P4NA 1HH4A 1UBRS 5F78A 3VOAA 2ZFUA 1U0OC 1DC6A 3SD7A 2VHEA 3LE8A 4BZXA 1B1AA 3R7SA 2GJ9A 2L19A 3BIWA 3P5SA 3A05A 3R3SA 4GZ5A 2J30A 2R8YA 2VF5X 5AYVA 3TR0A 1QDLB 1R74A 3EXIB 4CYMA 3PFGA 2HX1A 4NPCA 3L0CA 1XXLA 3IQIX 4DNOA 5EWMB 3DDZX 2A9QA 2RD2A 5G3YA 1E4VA 2JFNA 3CUUA 3RNOA 3CUYA 4Z99A 1MIHA 4DEXA 4EPYA 1TVMA 3WE7A 1EB8A 1ETHA 1HDRA 1L5HB 1NJ1A 2ZTHA 4LCEA 4Z3KA 4PZ9A 5EJIA 2BCEA 2ZSHA 2HQ1A 3RU9A 3KHSA 1S0UA 3GBVA 4HH0A 3TSOA 4BQNA 1N3LA 1CUGA 1VE1A 1Z7BA 4PQGA 3UUWA 5IULC 4CV1A 2H5LA 3EX7C 1J33A 4RD1A 2VCYA 5SYMA 2V5UA 3EG9A 3NTVA 5TMPA 4QXPA 2QV7A 3BREA 2NUPB 1YXMA 5JS8A 2ZBUA 1XFAA 2Q5FA 2P8JA 1HO3A 1JQ5A 2HCTA 3L41A 5DI9A 4B6PA 5JAQA 3M6UA 4A7PA 2IYEA 3CLUD 3O2NA 3QRWA 3ELWA 3VO2A 3AR6A 3OQIB 2C1EA 3EUWA 5FAXA 3JRNA 4LNUB 4GI7A 2DP4E 4U5QA 2GXQA 2GZHA 1I4TD 4PANA 1N0UA 1NDHA 2XB8A 3F4BA 3L49A 4HJXA 4X71A 3IA7A 3WGHA 1GSIA 2G88A 3LY5A 3QG5A 4G9BA 4DLSA 1G7CA 1FTWA 1KO8A 2CCJA 1KIFA 3PEYA 4ZI7B 3MTGA 3QPVA 3G0OA 2HUNA 3WGLA 2X19A 3WOHA 1JR3D 3PC4A 4ZHQA 1ULHA 2IP4A 1LSJA 5EIWA 2C9MA 3HMQA 4HPJB 4RK0A 1R6UA 1N9KA 1TK3A 1QTIA 4FHEA 2VF7A 3CW2A 3TX2A 3W05A 2K87A 1E5DA 4U00A 2IT1A 1YS7A 5TLSA 3N7TA 4PQYA 3EP9B 5FOVA 4W6ZA 5GP1A 1IK6A 3V2IA 3WV4A 4AXBA 4E09A 2B3TA 2PX3A 2NSYA 4PRKA 4WOKA 2XWPA 4YAWA 3QA9A 1QYWA 2QNRA 6PFKA 3BHNA 1GCAA 3GFPA 2OUKA 4LYGA 3EF3A 1HEIA 2O0JA 2PGLA 5IFKA 1WO8A 2OCLA 1KK0A 2P9FA 3AB7A 2VK1A 3VR6D 1N2XA 5ISMA 3TR6A 5KJFA 5AI8A 1QB7A 1D2NA 2EVWX 3H5NA 1O6BA 4S04A 5HF8A 1CHDA 2C88A 1R6BX 5AM2A 3Q8LA 2W6JD 1DINA 4EP1A 4NXNB 1DG3A 1R0ZA 1TRHA 5TQ2A 2FW0A 1UPBA 3KEOA 3R0VA 2O23A 3RS9A 1JG3A 3PPIA 2C5SA 2QN7A 4RTJA 2RGRA 4BKQA 4CLOB 4D4JA 4OJTA 3ZHXA 4CCWA 5ALOA 1TUGA 2J0EA 4ND4A 3SM9A 4MR8B 3H2KA 2PS3A 2CLIB 2XY4A 3O4IA 2XSZA 4DUGA 5CT9A 4H6XA 3EG9B 2OYSA 3VPGA 4DQDA 4EY5A 4GMGA 5HHTA 3BT7A 4TPKA 2BWJA 4WXMA 2PPVA 3G59A 4Z4QA 5NLLA 4MYDA 4WZAE 2YMLA 3RANA 4HAZA 2BDTA 1R8JA 1QX4A 1Y9ZA 1MVLA 2P11A 2PX5A 4C2AA 4X64B 2Q2WA 3HYRA 4QPDA 3TJZA 3VC2A 1WUIS 4YBRA 2RI6A 5JS6A 4UTZA 3FVVA 1B42A 1BS9A 1E3WA 4UXIA 4PAGA 4TRNA 1V96A 2J9XB 3WIBA 4E07A 4S05A 3QKUA 3TJMA 4EGJA 1H4QA 1CDDA 5BW8A 2XKJE 4RVDA 1GN9A 1P1HA 2V54A 4ITRC 3D6UA 2LTAA 5FOUA 3ZEAA 4DV1B 4JJ8A 4ZHQB 3ROEA 3KQVA 2V0GA 3KOOA 2UZ3A 1BGXT 5CW2A 1TF7A 4D45A 1UBUS 5G0VA 1W47A 3LPMA 5ER6A 2XGJA 5KU7A 1N5MA 4YJ3B 1E5QA 2WAAA 1Z2NX 2XD4A 2INGX 5D7NA 3FMGA 4OHRA 4P53A 3OBIA 4TZKA 4MEJA 6ADHA 1ADGA 4RH3A 2QBYA 3UHJA 2H7VA 2Z6AA 1MZPA 2EG9A 2FG6C 4I8IA 3KTDA 4LYFA 4QM6A 1X80A 4HDRA 2FX5A 4U2BA 2VJMA 1PQPA 3SK0A 1KYZA 3X2FA 5ED4A 4K9SA 2VUIB 2YJ4A 4O5AA 1E1CA 1NW6A 1TMYA 1YV9A 4MW0A 2X6RA 5CJPA 5E6RA 1AX9A 1P1BA 2JGKA 3AUFA 3RASA 1FJXA 4LDJA 2FFJA 1F2TB 1W2HA 3C3KA 3L0ZA 3KXDA 1VIAA 4PICA 1HY3A 2GZMA 5G0TA 1OI4A 3ECSA 2BL4A 3EDCA 3ND5A 3KWMA 3RUDA 4YUYA 3VSEA 5KCZA 4K9OA 1LX7A 3AW9A 4C88A 2R8ZA 5TQ2B 4CLEA 5IUJC 1AQUA 4KI0A 3BE8A 4KQ1A 3IVRA 1PWXA 2GCPA 3OT5A 3UMSA 2P9EA 4JP1A 1J7JA 3I8SA 3KHTA 1NR1A 4LYHA 4OK5A 5AJYA 2IP1A 4JEUA 4MV5A 5K4AA 3IKLA 4AMZA 1BHO1 3SZRA 2O8DA 4WLNA 1NVMB 1ULAA 1YMQA 4LDPA 2PKCA 2DUWA 4GDMA 4HT3B 2ZBEA 2HIAA 4EB8A 5B1SA 4UZSA 1SD5A 4RZ3A 1WPRA 1IEQA 3UT5A 1ZGBA 4NFLA 3UK7A 5IDXA 5CBPB 3OOJA 4AQYB 1YI8A 2A2ZA 1V9LA 4V0ME 3MBOA 1I7SB 3WS7A 1U8UA 4MV3A 4LGCA 1MF7A 4M0FA 2W2MA 1V9CA 2B5WA 2VEDA 4O2AA 3ZDAA 3CLRC 5F2EA 2YJ3A 3VPCA 5FPSA 2FCRA 1N0WA 1D9XA 1NQVA 1AS0A 1XQXA 1SG6A 5B2EA 4LVUA 4D98A 3ECCA 3UTDA 3TQCA 1X0VA 4N82A 5JLJA 3N0WA 2D3WA 3BE6A 3ML1A 4IH9A 4MGKR 4LDAA 2O0HA 3C6KA 4K9LA 5H4GA 1SIUA 4G36A 4KMSA 4P3XA 4GS5A 3HTXA 4FE4A 5ELLA 3U3JA 3JR7A 1JVNA 4KV7A 4ACBA 5IVIA 5BO5A 4FMBB 1U81A 1P7PA 1TW3A 4YALA 4LSGA 1XNJA 3RC7A 3NOVA 3BICA 4BO6A 4NABA 2A5YB 4HDRB 3G8CA 1I2DA 1Z36A 2C20A 2VJMB 4UNPA 2HDNB 5FLEX 1XD8A 4NBKA 4PZPA 4ZT4A 3MB5A 4HDMA 1HF3A 1E1CB 1UOPA 4R2IA 1QORA 5E6RB 4QPPA 4WXEA 5GM2A 1J06A 4XWOA 1NVBA 3IUNA 2O2CA 1HZJA 1DIHA 4CLQA 1EAMA 1V5IA 3CT6A 3LQRA 3OFKA 3SU8A 3QEBZ 2R8RA 4UU7A 1E20A 4F7DA 1IHOA 3K4HA 3I28A 4H0NA 2G9VA 1QVWA 1P62B 3DKIA 5ALPA 4W5TA 1DGQA 3V00A 3D2BA 4G5QA 1BE8A 2PXHA 3BQNB 2CLFB 4KVFA 5JZSA 3EIHA 4EHJA 1NLZA 4Q93A 4E1AA 3KAJA 2CMDA 1QGOA 4TYMA 1O6FA 1P1IA 2D13A 1SUSA 2PNFA 2WF8A 3FUWA 3LBNA 3OSZA 4UBJA 4DR3B 1UMBA 7ADHA 1ENYA 3IXLA 1F8YA 3MN1A 1K2VN 3UT5B 4FOSA 3LAWA 4TMKA 2QHXA 4Q9KA 1PV4A 2DY0A 3OA2A 3Q9UA 5C34B 3VH3A 1C3JA 1BOFA 1GUAA 4B0OA 4U8GA 4JMPA 4MWTA 1SC1A 4OGKA 5F76A 2B7LA 2PMFA 2P0EA 1UT6A 4JUFA 4RPLA 3N59A 4IOKA 1NW4A 4AZWA 3SMVA 4FFBB 1QE0A 1JP7A 3Q3GE 421PA 3UEOA 1E3JA 4ESOA 1EDDA 4PG6A 1UPFA 3L5KA 2UYCA 4UZEA 4KITB 3DZKA 3IAUA 2Q4TA 1W5AA 2I65A 4WK4B 4R51A 1G59A 2I91A 3DP7A 1SVWA 2XXBA 5K09A 1EDOA 3U4CA 1LBSA 4DA8A 5CNMA 1IBRA 4DIUA 1TQ8A 5E6SA 3TAHA 4J2OA 3WXBA 1IG3A 1ZIPA 1P1KA 1WDLA 1CXZA 2NU8A 2R87A 3NUZA 4ENUA 1L8XA 1OAOC 4B3DA 4EFMA 3KKNA 4MQFA 4DMHA 1DO2A 1WMDA 2E82A 3AKEA 4ABYA 3A37A 1GUDA 4HDMB 3MNFA 1Z26A 5FI3A 1DLJA 1I72B 4M0MA 5GGYA 4XCQA 5ALDA 4L9SA 2CMFA 4UFPA 2CJXA 5K8IA 2DUUA 5L40A 2G5CA 5K0EA 3KQNA 1NVXQ 1YOVA 2OCDA 4BFLA 4RZ2A 2BC9A 4ZA2A 1G9XA 2B4QA 3VFDA 2B4YA 5IEBA 1Y7PA 1EDBA 3AJDA 1T9CA 3HV2A 4L4ZA 4MYHA 2ZWPA 2ZK7A 4XVQA 3KAKA 2V8BA 4S2UA 1Z2AA 3REOA 2E1PA 3ANTA 4YNBA 1P7ZA 3H6GA 1K0FA 3UAYA 4XVCA 4HADA 3R76A 1JRLA 3OE7D 3R3UA 2H0QA 3MA0A 1QO9A 4HLUA 4Q19A 5CA0A 3F5FA 1UMBB 4WN9A 1XZJA 2V1UA 1T5HX 2HM7A 4WJKB 1OILA 1CRQA 2WIAA 3OFSA 1RMTA 3ZYCA 5G02A 1WZIA 2OAEA 2ZSUA 1R0WA 3RSSA 3V4ZA 4LCBA 4EL5A 1NQUA 4R6XA 3FVRA 2WWXA 3EFEA 2IE0A 1TAUA 1WB6A 1YBMA 4ZRMA 2ID9A 4YASA 2ZE6A 1MMFB 3GLHA 3HBFA 1U0HC 3T15A 3H9GA 1UPTA 5TJ9A 4YRMA 3H0VB 3MUFA 4BO7A 1WXIA 2I0FA 5A1JA 1PT5A 5AVJA 2JJ2A 3VKGA 2XH8A 4E1VA 3AYXB 1XTJA 2GGSA 2R79A 3AR7A 4W1PA 2I2DA 1G2PA 2IOHA 4YONB 1VSUA 2I4LA 2Q49A 1QHHA 2FN9A 4YAOA 1Y1RA 4ZK6A 1BEZA 3MUEA 2O1EA 1TJPB 4YYEA 1YONA 2ONCA 1BNCA 3MPOA 4M55A 5ALXA 1JW9B 1RC0A 1NN3A 1G1MA 2FSGA 2VIIA 3PNYA 4J03A 3JAKA 1O2DA 3B8HA 2J31A 2QZ9A 2RC5A 3CBQA 3QJYA 4O3FA 5E6SB 5FEMA 3RARA 2J45A 2NU8B 3SJ7A 4QTYA 5FFFA 4RZIA 2ZB4A 3H16A 3HR8A 5ENZA 3WJ7A 5CHEA 1W4AA 5HBGA 4MQFB 1W76A 1DJLA 1UKAA 2E4XA 3ACCA 5GOZA 1YZQA 3PNLA 4UXJA 5LU8A 1T3LA 5H3LA 3NP7A 4EABA 2VRCA 1AT1A 4ZODA 5HE8A 3NAGA 3I34X 3UK6A 4KZKA 1AQIA 5DHQA 4ALIA 2RGWA 4Z9BA 3FFBA 5LN1A 3GLRA 3A6PC 3AVVA 3I05A 1ILWA 4RNCA 2LD4A 2OHJA 2WPDA 4DYVA 5A4IS 3B5JA 4HLDA 1KZHA 2W83A 3EC1A 4WX2B 2AC4A 4U4AA 3O1IC 1Z5NA 4RLFA 3UCXA 3PP8A 3CRZA 4DC1A 1BSVA 3B8EA 3T4XA 3CNBA 2F1RA 4H6VA 4MAFA 3VXKA 2X23A 3KR2A 5THQA 3M4JA 4OYRA 2ZJ1A 1MEJA 3EMVA 1NXQA 1C14A 1QUFA 1BTOA 3IAM6 1RIFA 3NUQA 4L6AA 4PTLA 5H9VA 1EP9A 3TPZA 3U81A 2EQAA 3FPJA 2IWHA 4FYKA 2JDID 3HYSA 2F62A 1AUOA 2G8NA 3JRXA 4P36A 4RNDB 5D3MB 3TXAA 4DVGA 4ZZ0A 4LHZA 1X14A 1XZGA 2H00A 4AK1A 5JH7F 3ZWBA 2OHOA 3GLHB 1NP3A 2WK1A 4F6LA 2QM7A 1EUQA 2IYAA 2YMMA 1NJ2A 3O03A 3PQDA 4M21A 4S1PA 5BV2P 1P2TA 3TIFA 2VKTA 3F6RA 1U8TA 3OEED 1OFGA 3L5OA 2P3LA 3RM3A 5I8WA 3VISA 4PNEA 4X41A 2Q1YA 4M54A 4O1MA 4D8TA 4LSZA 1L1EA 4B32A 4K6GA 4MKZA 1IG0A 1M2EA 1V25A 5DEIA 4EF6A 3KB6A 1RLIA 2YWBA 3HL0A 3JAKB 3ETJA 5DP1A 5EKTA 2FVYA 3F7OA 3MOGA 4ZANA 1M6HA 1U3DA 2DFLA 2GF0A 5IP5A 2W43A 3GQBB 3G2KA 3MGCA 1JAIA 2EZ9A 5LXTF 1SVIA 4RHYA 4BY9E 1BOOA 3RIGA 2RAFA 2G76A 4NV0A 1CULC 2PS1A 2Q6IA 3DAYA 4GNRA 4UVIA 3D3WA 3AB8A 2XUKA 1CV2A 3M6FA 3L79A 5J1SB 1ODSA 1SD1A 4DM4A 3PE4A 3BL5A 2PLAA 2I54A 1GRNA 5HS4A 2ODEA 3PQ2A 2AR7A 2NNLD 2OHGA 2PZEA 4G8DA 2W6MA 4I50F 3H65A 4IRXA 1NE7A 1LDBA 1RRVA 4NCJA 2XVAA 4Y1GA 5JJIA 3ZY6A 5KYKA 2PG3A 3VHRA 2GMWA 3CS3A 1M10A 2PWPA 1RABA 1YQDA 2QYTA 4ID9A 4RD0A 1OGYA 1U9YA 2IW3A 2JK0A 2QN1A 1ECPA 3FTEA 4JAVC 3RVMA 5FF9A 3GVHA 1SUFA 3WO1A 1ID8A 3IWBB 2XMSA 3PJFA 1G7SA 1HRDA 4HAOA 3JPYA 3GAAA 5M2QA 1D1SA 1ZWLA 5KNCH 1E60A 1GNVA 1CRPA 2OORA 4KW7A 2IELA 3Q3HA 5H3HA 1TCBA 3ADKA 2RGGA 4IIUA 4D0SA 2V6MA 5A62A 2ZQYA 2NXCA 3QSYA 4XQ0A 5T4FA 3KJNA 4WLVA 1HE2A 3PENA 1SQ0A 3HWWA 3U1TA 2XB2A 4YFYA 4G56A 4R69A 1GZHB 2JI6A 2P6MA 5BRJA 4FFRA 4EATA 5JYFA 1JMKC 2D5CA 3KKKA 3PC7A 5CPFA 2M6SA 2OLKA 1RTTA 1RVDA 2V4UA 3EP7B 2IK8A 1KEPA 3BULA 4I4TF 2Y93A 3L1VA 4UCXA 4F45A 4J94A 1KXJA 4LMPA 4D2IA 4Z4HA 4JR2A 4P0PB 1U04A 4KE8A 4XOIA 4QUBA 1HURA 4US1R 3REGA 3WJAA 1H8HA 1A96A 1IXZA 1N9ZA 1X0XA 1DJOA 2OBFA 3CF2A 3G88A 4G8JA 2BBTA 4JP3A 3DKKA 3TQSA 4A92A 1EK1A 3VJRA 1ETUA 1EX6A 3QMMA 2QR2A 3AEQA 5J5VA 4RK7A 2BLLA 4IJKA 3U40A 1A8HA 3PC8A 2BP7A 1RHUA 4OUKX 4JB0A 5DKFA 3RFXA 1K06A 1RQ7A 1R0LA 3RADC 5GWXA 3U61B 4OB6A 5CEJA 4ZYWA 5KQPA 3I4LA 3UYKA 5ICMA 1F4VA 2BKLA 3BHMA 3WYGA 1SC4A 4F96A 5AKLA 5EUMA 3TOXA 4BGIA 5JFTA 4QVIA 2W42A 4E3ZA 4Q3CA 1GKUB 1XU9A 5F35A 1EFRA 4YRAA 1I7QB 1M74A 3LBIA 3T4EA 2LUOA 1QZTA