1YL7A

The crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
b'ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl7A01
4I1IA 3ZV6A 2AQIA 4I9NA 5L51A 4AL4A 1VRWA 3NTOA 5KVVA 5KIAA 1HE5A 3L6OO 1HLPA 3FR7A 3WOHA 5JO9A 1KS9A 1QKIA 2J3JA 3GMSA 3H6KA 4WASA 1PGNA 1JWAB 5BSEA 4CL3A 3LF2A 1Q2XA 3PWKA 4CV3A 4Z3KA 4J43A 2HKIA 1GPDG 1M6WA 4WNCA 1UZMA 2FHSA 4IY1A 3TJRA 3ZNQA 1P3DA 3LLVA 4XDYA 1YDEA 1PL7A 1GU7A 4JJFA 3DAGA 4S3MA 4U6SA 1E3SA 3IOYA 1U3WA 3W4IA 5A5FA 5JO0A 4IPTA 1UP4A 4HFMA 2YJZA 4FBGA 3I3OA 2J3KA 3HFSA 4GSKA 5C7IO 1PL6A 3Q6IA 3U62A 1NASA 1SPXA 1WLYA 4BO9A 1VJ0A 1ZH8A 4AICA 3GC6A 1G0OA 5LCXA 2JFFA 4JJIA 1LEHA 3VAZA 2CMDA 2PD3A 1GYPA 3D5QA 4ZQEA 4CM8A 4NJMA 1IE3A 5JXWA 5TT1A 4Y6PA 4BNTA 1I3MA 2HRBA 2Q4EA 1PWZA 1YB5A 3LYLA 2YUTA 4BQRA 3PP8A 3B1FA 3WJ7A 5FI5A 1T1RA 1JDJA 4ND4A 4PLZA 1LSOA 4RLSA 2VWHA 3A4VA 1LRJA 4E4YA 4OO3A 2QG4A 3WGYA 4UVIA 4Z0PA 2HQ1A 1BDBA 3OIDA 4O63O 2AMFA 3ITKA 8LDHA 1EUDA 2G17A 2OZPA 4RDIA 4J2HA 4D41A 4YAJA 4WOKA 1C1DB 1CEQA 1EVZA 1ADCA 3WLEA 3HDJA 3GZNB 4CLRB 5FEUA 3TF5A 5AXCA 2WE8A 4OL9A 2DLDA 1PGJA 3EY4A 2ZB7A 5DBFA 1EE9A 1WZIA 4DXHA 5I8WA 3DDNA 4PLYA 2X7HA 3R6DA 5BT9A 1YBAA 2V6MA 4HNGA 3WGIA 4JK3A 5L7WA 3RU9A 5A5EA 1IYZA 1FDTA 4PCVA 4RF5A 2NQTA 4N54A 2OHXA 4HY3A 2GN6A 3WIDA 3C7CB 2JD1A 2V7PA 3GAFA 3SX2A 5BNFA 1UP7A 4XGIA 2V6FA 3D4NA 3QHAA 4E6PA 4NU6A 2X9VA 3E6AA 1E77A 3JQ7A 5BR7A 5K9ZA 2B35A 3V1TC 4FSHA 3EVTA 3QV1A 3F1LA 5EMHA 3PZRA 3VVCA 4EDFA 4C7JA 5DN9A 1LNQA 4CM7A 5HTOA 1SB8A 3KEOA 1HT0A 1YBMA 3CZMA 2B4QA 3DWFA 4EEZA 1Q1NA 4QEDA 2QRLA 3BYZA 5JYDA 2ET6A 1DJNA 3L9XA 4O0LA 3E18A 3EMKA 1NTOA 2CNBA 3ZWYA 1A9YA 3M6IA 2AG8A 1DOHA 2X6TA 4NFHA 4C7KA 3JQFA 5T67A 4LK3A 4R01A 3QVSA 4BO2A 2Q50A 1FJHA 3VPSA 2Y93A 4KUHA 1LDGA 1WAMA 2HLPA 1LA2A 2WDZA 3H5NA 4QO8A 4ND5A 4GX5A 4NBTA 1PS0A 1VPDA 3KETA 1ONOA 3F47A 3WBFA 4KMSA 1MG0A 3EGOA 3IAHA 1SBYA 1OMOA 1H2HA 1CRWG 3L77A 4OXYA 3LDHA 4RVDA 3VPFA 3E8XA 2VZ8A 5JS6A 6ADHA 1C0KA 3FNFA 5FF9A 2C20A 1PJBA 3KYCB 1FDVA 1N9GB 4IUYA 5KJEA 2CDCA 2VOEA 4IDGA 4D0RA 1D3AA 4R54A 1HYEA 4UVGA 2I9PA 1D1SA 3C7DB 3GGOA 3A06A 1A7AA 2CDBA 2GCGA 1GR0A 3GG9A 1YVEI 4XRRA 5DDIP 1ZEMA 1W4ZA 4HFNA 3RIHA 3INRA 1PS8A 1GV1A 3W4KA 5TRTA 4XQEA 1ISMA 4IDDA 4WJZA 3FWNA 5KVQA 3PGXA 4TZTA 1UJMA 3UXYA 1T2CA 3GHHA 1KC1A 2FR0A 1S7CA 5TLSA 2LDBA 3HZZA 4J0FA 2X58A 4CM9A 4M8SA 5A03A 3BMOB 1MLDA 1I0ZA 3O9ZA 2DTEA 3DB2A 2PD4A 2JAHA 4KTVE 4O59O 3WFIA 5CHEA 4Q3AA 1VL6A 2YHUA 1NHWA 5DZSA 2EJWA 3LU1A 4YA6A 1HYGA 3CTMA 1HF3A 4CM1A 2BI8A 3RFXA 3HG7A 1WDLA 3GNSA 1BXGB 2FY8A 3H8VA 2POQX 4DLAA 3TFQA 1O6ZA 2DT5A 5DP1A 2HMTA 2BRUA 4A03A 4PVCA 1BVUA 2YDXA 5KKAA 3VKVA 3ZNOA 2QX7A 5EL0A 5L4SA 2Y0DA 1E7QA 5GY7A 3ROQA 1U1IA 3R0IA 1U4SA 1P1FA 5K6AC 1A72A 4J3FA 3COSA 2CF6A 2O3UA 3JQ9A 2EERA 1UDCA 1Z74A 4PZEA 3IUSA 1ZSNA 2CVOA 4IDBA 2Q1TA 1F14A 1XIVA 5EQFA 1ONPA 4U0KA 1HSOA 4IIVA 3TDKA 3FSRA 2C7GA 5F3RA 4YDRA 3VDQA 3ZV5A 4XCVA 4TVOA 1I32A 1QV6A 2C2XA 4DBVO 4FGWA 4YB8A 1O89A 4O6VA 4IJVA 1K89A 2AQHA 4CLOB 1DFIA 4BQPA 4MKZA 5ITWA 3OICA 2NU9A 3FTNA 4BGUA 1BHSA 3SVTA 1EK5A 1K6IA 4R41A 4TMFA 3RJ5A 4EZBA 4RCVA 4ESOA 1I3LA 1NWHA 3L6EA 1AHHA 3EK2A 1NPDA 1AGNA 1B0AA 3RD5A 4KOAA 2ZYGA 4DMMA 1XG5A 1I30A 4MIYA 4FDAA 4B4VA 3FI9A 2IEDA 1ENYA 3DZBA 3ZW9A 1GD1O 2AXQA 2YZ7A 4F6CA 4FC7A 2Y1DA 3UF0A 4XR4A 5F5NA 1ZCJA 3WJAA 4OSPA 2YFHA 3PK0A 5CEEA 4B3IA 4OXNA 4BUCA 4YJGB 3CPSA 4FD3A 2NTNA 1PTJA 4CLXA 3WGQA 2PNFA 2RBEA 2GN4A 4ZRMA 3CZRA 4FCCA 3HN2A 4E5PA 2O4UX 2Z95A 1XCBA 3CXRA 4NBRA 3LQFA 1RYDA 3P2YA 2ZB8A 3W8FA 1O8CA 1DIRA 2NQ8A 3N74A 3QVTA 3DOCA 3C3XA 5JDCC 1ZK4A 4YVFA 4JBHA 3X2FA 3HDYA 3CKYA 4AJOA 3TL2A 1GQ2A 1NR7A 2I67A 1B3BA 2GR9A 2VNSA 4FQ8A 1P44A 4JLWA 1J49A 1L7EA 4BKOA 1PSDA 4CV2A 3LT1A 4BNJA 5TX7A 1U8FO 4MO2A 1YOVA 4OOEA 4JCOA 4GLLA 2I65A 2PD6A 4XX0A 5F1KA 2JL1A 1HWYA 3OQ6A 1HDGO 4TRMA 1IZ9A 3DBHA 3TNLA 3O38A 1Y8QB 2WEKA 4J7CA 3BA1A 4RGBA 1ID1A 4B7CA 3BTOA 2OXIA 5KCZA 2PKRA 3RROA 4BNFA 4H7PA 1TXGA 2Y0EA 4L76A 1MXFA 3KB6A 2QZZA 1HTBA 1Z7EA 4DREA 1ZSVA 2NVUA 4E2ZA 4Y98A 1BWSA 1I2CA 4A0SA 2D59A 3ROMA 1DIBA 3L6DA 1UR5A 2Y68A 4UUPA 4BKUA 1HZZA 2IZ1A 5A1TA 4CM6A 2Y1FA 3QRWA 3BHMA 1EFKA 2ZTVA 5AVOA 4GBJA 2BGKA 4F6LA 5MGBA 4P4GA 5KJ1A 1A4IA 5I7FA 3HDHA 4E5YA 5JMWA 4RV9A 2TMDA 2ZCVA 4GSLA 1OAAA 4QTZA 3DBRA 4MINA 5KWEA 1HKUA 5AXBA 4BGEA 1FDWA 4FOSA 1I36A 5JNLA 2FRDA 4PLWA 1PS9A 3NJ8A 1VKNA 3VH3A 4ZQHA 4BNLA 3PTZA 3RFVA 3U3XA 4HBGA 2EF1A 1W8DA 3Q9NA 4IDAA 5L3ZA 3TOZA 4J16A 3L9WA 3I5MA 4NK5A 2C2YA 1ULSA 3O8QB 1UDAA 3T4EA 2Y1GA 4JX8A 5DOZA 4DL9A 2DFVA 5H83A 3CE6A 2AEFA 1YL6A 3JQCA 3INGA 2JHGA 3WSVA 4ALNA 1KY5A 2DTDA 4AJJA 5ENVA 4ZRNA 4KQXA 3O26A 3ZU3A 3FNGA 1Y7TA 2E82A 1B15A 1SB9A 3MJ4A 4R1TA 5T6BA 4MVJI 4AG3A 1GL3A 2W4QA 2D3TA 4K28A 2G5CA 5DCYA 4NH4A 4XA8A 3KOUA 1JWBB 2O3TA 2VQ3A 4AFNA 3S2GA 1DJQA 1IY8A 1MFZA 2AQ8A 3KYDA 5DT9A 1NQ5A 4WNIA 2EWMA 9LDBA 1T4BA 1R0LA 2VTDA 4YQZA 1JVSA 3D4OA 1EEHA 2Q1WA 4EYEA 4KWIA 5JDIA 4YCAA 4DGSA 1DEHA 3ZH2A 2GZ1A 1KC3A 1LLDA 2X0IA 3WBBA 3AY7A 3NUGA 4D43A 3U5TA 2Y0CA 3KTDA 2UUPA 3JQAA 3ONEA 1C1XA 2O3RA 4N18A 4D0SA 1ML3A 4LVCA 1TT7A 1R4MA 3ZWVA 4E5KA 1NHGA 1AXEA 1LBEA 4YJFB 5JYAA 1CWUA 4E13A 3C7AA 1K6JA 3ASVA 4B4OA 3KHUA 2PK3A 3GY0A 1LRKA 1LJ8A 2R00C 4QT0A 3RC7A 5A9SB 1LXCA 4IQGA 3U4IA 4I9UA 3D5TA 4FB5A 2DBVO 1GCOA 2HMWA 1X1EA 5A3VA 2ZK7A 1D1TA 2AHRA 4BNKA 2UDPA 1GTMA 3AOGA 2V6BA 3GVCA 4CL8A 3GFGA 3ORFA 1AHIA 1PL8A 2YV2A 4R9SA 2Q1UA 3NX4A 3IMFA 4GVXA 4BMSA 5AYVA 4WLFA 3WIEA 4WCFA 3MJTA 1J6UA 1WZEA 5C7LO 4KDFA 1E1LA 1PR9A 2HMVA 2HJSA 2Q46A 1P74A 1KVTA 4OOFA 1JAYA 3NT5A 4M1QA 1I33A 4J90A 4CMHA 4CM4A 4W9NC 4L75A 3WGOA 4ZQFA 4HWKA 3PHJA 1IB6A 4BIIA 5A06A 2GNAA 5DOVA 4XQ9A 5DCUA 1GQYA 4GPD1 1MUUA 1PGPA 1NPYA 3VPGA 3QWFA 3V8BA 3WGTA 3MEQA 1WP4A 3DZKA 4AJKA 4IJKA 3F4LA 4CMKA 1Z73A 3ZGYA 1DLJA 1LLQA 3B1KA 2F00A 1PJQA 2AEMA 1E7YA 4IGEA 4II2A 3F1KA 3DBLB 3RC1A 4L74A 2HAEA 2B37A 4J4HA 3JQBC 4PLCA 3RUFA 1DC3A 2GYYA 2PLAA 4PZDA 4W6ZA 3RUIA 4YPOA 4CQMA 2HK9A 3I52A 3U4CA 4D3DA 4OQZA 3K96A 1YQDA 4RO0A 2VYND 4KUEA 3RUCA 1JKFA 3ICPA 3S2EA 1EBUA 1PIWA 1QLJA 3OA0A 4OKIA 2XF8A 3JQ8A 5L4NA 5T73A 2B69A 1A7KA 1FMCA 4BMNA 1HRDA 4ZVVA 1NPTO 4CQLA 5TF4A 1C3VA 3HDQA 1PZHA 3JD1A 4ALJA 1U5AA 5JAZA 3WNQA 1YQGA 2D5CA 1GFSA 5AOVA 5B1YA 2Q45A 1G0NA 4PLGA 1SMKA 4H15A 3RFTA 2WE7A 3ANLA 3DOJA 3ZHZA 1BTOA 1CDOA 3DXFA 4NFSA 4XRGA 1WNTA 3OIGA 3ZWNA 1ISFA 3F4BA 2OP1A 4R1UA 2QHXA 5JBIA 4MP3A 3R3SA 1LC3A 2FPGA 3IJRA 4A5OA 1ZIDA 4DPKA 1ENPA 2J5KA 3MJVA 3OJOA 4I9HA 2NU7A 3KEQA 4GWGA 4UAGA 4E31A 4FR5A 3C24A 1V6AA 3QQPA 4QFDA 1I01A 2WWRA 2NVWA 2IEBA 3BMCA 3QSGA 5LDGA 3H9QA 1U3TA 2PWZA 1BXKA 3HSKA 1Q0QA 2X1HA 3ZWBA 2PFGA 5CDTA 3S8MA 1KY4A 1YL7A 1I3NA 4JNKA 3RC2A 1D7OA 1EVYA 1DRUA 5COAA 4DYDA 3WLFA 5HWSA 2VWQA 3PVZA 1PZFA 3WGZA 3ZDFA 1UXKA 4CM8B 3V1YA 3HFGA 4NJMB 1EMDA 1FXSA 1ONNA 3NDRA 2TMGA 4JJGA 3H4VA 5I9MA 5JYFA 3MJEA 4GAEA 4B4WA 4OM8A 2Q3EA 2B83A 3TRIA 1DLIA 5T57A 4FFLA 3SC4A 3DFZA 5JLAA 4DA9A 3ETDA 5CDYA 4J0EA 3PIIA 5ES3A 2W8ZA 1UXJA 4IS2A 5ILGA 4FOOA 3SJUA 3IKTA 2WD7A 1NWCA 1LLCA 1ORRA 2A92A 5C3MA 1P0FA 3GK3A 4J49A 2I66A 2Y05A 1GCUA 1HE3A 3AOEC 3NRCA 3ZWAA 4E2XA 3ROKA 5JCJD 5JCXA 5CG1A 6LDHA 3RAJA 1AXGA 3DZIA 3MOIA 4K6FA 2XAAA 4CJXA 1T2EA 1A27A 3PEFA 1BG6A 5A04A 3JD4A 4BGIA 4F3YA 1ZK0A 2IRWA 3VH4A 2J8ZA 2BD0A 1QYWA 2P5UA 2FPPA 3AI3A 4MOWA 4NIMA 3GGGA 5TJHA 4BNWA 1TLTA 2CZCA 2FZWA 5JW6A 3Q11A 1M75A 4XIYA 4Z0HO 4CMBA 2XOXA 4CR6A 4BO1A 3CEAA 2DBQA 3DBVO 2GDZA 4PFJA 4OH1A 3GQVA 4NBVA 3GPDG 3BMQB 2PKQO 3TZ6A 1N92A 1EQ2A 1PJSA 3DC2A 1G6KA 3AW9A 3NT2A 1TT5B 4IJUA 2X86A 2NU8A 1LX6A 1N7GA 5JMPA 4KUGA 1I24A 3TWOA 3TZCA 2GF2A 1NVGA 4RZHA 5EQDA 3JV7A 1XYGA 2ZJ0A 3WYCA 4DUPA 2W2KB 3WQSB 4EI2A 4D3FA 4E21A 2B4TO 2IE0A 1LUAA 3BMNB 1Y9EA 3JD0A 5L53A 4LMRA 4FFOA 4CMIB 1DRVA 3UUWA 3ON5A 4IJWA 4I8XA 1QLHA 3NT4A 2DTXA 1Z7BA 4AJIA 4YAGA 1C14A 5U9CA 3L4BC 3JCZA 4GX2A 3D64A 2EGGA 1ZXLA 2PA3A 2YHIB 4U7WA 3GDGA 4XZ3A 4ZQGA 3JYLA 4IS3A 5L7TA 3JQGA 4GLOA 1V3TA 5COBA 3OJFA 2DAPA 3WG9A 4BMVA 4LVUA 2RH4A 1PEDA 3WGHA 1Q0LA 1VE9A 2RHRA 4G65A 2DU8A 4IDFA 3VZPA 2HO5A 1QORA 3QWIA 5G4LA 1NQAO 5BSHA 5TIIA 4NFYA 4GL4A 2J3IA 4FGSA 1DAOA 1GEGA 1SO8A 5CP8A 3EUWA 1P1IA 3ENKA 3AUUA 4Y6RA 4Q3EA 3NV9A 5I8ZA 3SLGA 3WWYA 4DVJA 3Q3CA 2DBRA 3VH2A 2EIHA 3E9MA 1UDBA 1EVJA 1VL8A 3LT0A 4Z9XA 1HDXA 2P9CA 2W2LD 3MWEB 1V9LA 3H2ZA 4CUZA 5H81A 2VWGA 2BFPA 5IDXA 2VTEA 4IMRA 5BSGA 5TSDA 2VYVA 3ZU2A 1Y5MA 5DBIA 2PH3A 1QYDA 5MDHA 4F46A 1DFGA 1PX0A 3QW2A 4J4BA 4UEOA 3KM0A 4E5MA 3VPXA 4XYMA 3NTQA 4K1LA 2OO5A 1Q7GA 4RPKA 4MP8A 2X5KO 4UVDA 2OBYA 2PGDA 4PVDA 4BGVA 2HSDA 1SEVA 4MDHA 1NR1A 1LRLA 2X5OA 1DC4A 2JJYA 3RUHA 4NU5A 3KBOA 4B7UA 4A7PA 3K92A 4MP6A 3P7MA 4FW8A 3PQDA 4QO7A 5HS6A 3M1LA 5CAEA 1LDMA 3HHPA 1XSEA 3RBXA 1ISHA 5JAMA 3WX0A 2EKQA 4FPXA 3A9WA 3PPIA 1ZK2A 4XYLA 1E6WA 4MPDA 4RJTA 3SXPA 4JP3A 4MKRA 1ZJYA 3H3FA 3QVXA 3WS7A 1ZSYA 1E7WA 4UREA 4Z0TA 1E0DA 1VM6A 2Z1MA 1ZK3A 4Z3DA 1OOEA 3RSHA 3D7LA 3I1JA 2X0RA 3LC7O 1NFFA 3FTPA 2BF7A 4TRNA 1NQOA 1X1TA 1C1DA 4J1TA 2V65A 1RM4A 1NXQA 4XB2A 4XJTA 4CLRA 2GN9A 5EESA 2X22A 5A4DA 5C37A 1WPQA 3VH1A 3UAGA 4Z9YA 5IZ4A 3Q0EA 1IPEA 1Z75A 2O7QA 3HQ4O 3F46A 3GR6A 4OXKA 2OBNA 3AI1A 1E6EA 2C07A 3ETEA 1E7MA 4AJHA 4CMEC 1CERA 2PZKA 2ZKLA 1FF9A 2PGLA 2JFHA 3LT4A 2X4GA 3PZBA 2DUUA 1IZ0A 1XGKA 5A05A 1X0XA 1PJ2A 3OHSX 3GA0A 2FPIA 3I23A 4GMGA 1Y9AA 3JTMA 3HWRA 4MVJH 3RI3A 4FIZA 1EDOA 5F21A 4QXMA 2R6JA 1ZZEA 4EUHA 1CETA 3AUTA 2CD9A 5L9AA 1V0JA 5KNLA 3TN7A 3H2SA 4BKQA 3QWHA 3WTBA 1T1SA 2VUSA 1NNUA 4RF3A 5IG2A 5EN4A 5HM8A 1E1MA 3AI2A 3R1IA 4HUJA 4II3A 4TRJA 2W98A 1C0IA 1EZ4A 4I5FA 3AM4A 4L0QA 1U3VA 2PR2A 3K31A 2DQ4A 4AJNA 1UXHA 4JIGA 3WYEA 4DIBA 1HLDA 1J5PA 2FSSA 4JP2A 5M6DA 2ZTLA 1ISIA 3GRPA 3U4HA 3ZU4A 4O5OA 3BTVA 1F8FA 1E3JA 5LDHA 7MDHA 3V2GA 3K9QO 1UXGA 4WCDA 3QJ5A 2ZTUA 3GT0A 4TKMA 5B12A 4YEDA 5H82A 3K5PA 1D8AA 4K26A 3I83A 3AUAA 2AE2A 1H0KA 4GVLA 2NVUB 4GX1A 1E7RA 1KVQA 2PY6A 1CF2O 1QYXA 2G76A 3UFXA 3RKRA 2NU6A 4M54A 4YRAA 1LC0A 4R9RA 1LQTA 1U28A 3D3WB 1CQIA 4OAQA 1M67A 3IP3A 1U7HA 1UP6A 2JD0A 1N9GA 2VT2A 2UV8A 3FR8A 3GVIA 4BO0A 2PTGA 3H3JA 1EUCA 1YXMA 1KVSA 3OH8A 4YJHA 2BMAA 4P4LA 3CINA 5T8KC 1ZUD1 1RPNA 1V8BA 1R15A 3BAZA 2WTBA 5EINA 4HNHA 5IZCC 1ULUA 1GQQA 4FC6A 3LC1O 4KDEA 4E5NA 2R2GA 2VT3A 3BTUA 3GEGA 4R16A 3DZHA 4LSWA 3VZRA 4E30A 4WECA 1F0YA 4BNIA 1QRRA 4P8RA 3BMOA 2D4AA 3C1OA 3JQEA 1B16A 4NNJA 3S1LA 1T25A 3ONDA 5J9GA 4GKVA 3E03A 4CM5A 1VKOA 4FN4A 4R1SA 1L1FA 5G4KB 4IXTA 4CM9D 5I7VA 2RHCA 3R3JA 1N7HA 4BO8A 4AJPA 2O3JA 5IN5A 1PJLA 3C85A 4M55A 4YACA 1WDMA 3ULKA 1RM5A 3P2OA 1S6YA 2ZJ1A 4WK6A 1JTVA 1H6DA 1MX3A 4AJLA 1BW9B 1GUYA 2C59A 3GDFA 2H9IA 4J9UE 4LCEA 4CMJA 4D44A 1GYRA 3VZQA 4YTEA 3PHIA 5EERA 3GUYA 1PQWA 4JXKA 3D1LA 4FS3A 5HBRA 1OI7A 1W6UA 1BRMA 2A94A 3HB5X 1EFLA 3QA9A 4OSOA 3RQSA 3WWZA 3F5SA 1N1EA 5I9NA 5B4TA 2X0NA 5DBGA 5B4UA 4A27A 1Y8RA 1XELA 5GZ1A 4KQWA 2EW8A 1BXZA 2OFPA 3EYWA 3I9MA 4PLTA 5G0UA 2D2IA 3KYDB 2NVBA 1ZXBA 3W6UA 4ALKA 1LLUA 2P68A 1EUZA 4GKBA 3K73O 1H94A 3NDJA 5GZ6A 2NTVA 2X9GA 2YY7A 2DFDA 4E3ZA 4G5HA 4E12A 2WJPA 4HXYA 1OZAA 3LC2O 1KETA 2CVQA 5T64A 3G17A 2H5LA 1QMGA 2G1UA 4B79A 4ITUA 1LSUA 4YYZA 4NI5A 3FF4A 4WEQA 4RL6A 2OP0A 4YJGA 1HDZA 3TFOA 3NKLA 1MC4A 2VNAA 1U3UA 3PJEA 5ER6A 3RUEA 1F06A 1D4FA 4R3NA 2H63A 2HJRA 4RORA 3VOSA 4L9RA 1A9ZA 4ZICA 3GOHA 2O3SA 1KBZA 3CSDA 1JLLA 2GO1A 4Q3NA 4B3JA 4AJ2A 1MB4A 1E1NA 2H6EA 4WKGA 5HA5A 3EHEA 1WXDA 3RWBA 1XQ6A 5A3JA 4UVHA 4TVBA 1GZ4A 3I4CA 1YGYA 2JCXA 4HFJA 1M6HA 2UVDA 1HDRA 3INTA 3E82A 3OQBA 4KWHA 2Z5LA 4XR9A 5JE8A 4EJ0A 2DBZA 3GG2A 4KZPA 4MVJP 1SOWA 4RDHA 3AK4A 3IS3A 3DEYX 1YDWA 3FRJA 2HK8A 2GRAA 1ARZA 4MVJA 4ID9A 4RPGA 5BQFA 3DMYA 1U8XX 3VTZA 4J1QA 4H16A 3OETA 4BNNA 3ZWOA 2BH9A 5FWNA 4J2OA 4I5DA 2CVZA 1NBOA 3KLPX 5TT0A 4ZQBA 3B1JA 2Q2QA 4ILKA 3UH1A 1HEUA 4A2CA 1YQXA 1IPFA 4DPMA 1VSUA 1FDUA 2Y1OA 1B3RA 3GNTA 4YJDA 4LRTB 1P1HA 1V35A 1DC6A 1R66A 2GPTA 2FR8A 4CQMB 5FYDA 1K6XA 1UH5A 4BV8A 1YKFA 3DO5A 1R4NA 3P19A 4JBGA 3QE3A 1HYHA 2YW9A 3ZWXA 1Y1PA 4UUNA 3JQFC 4P38A 2X23A 3ABIA 3PXXA 4M49A 4PIVA 3T7EA 3RJ9A 3JQ8B 1YS4A 2VZ0A 3WSWA 2EW2A 4XYBA 5IF3A 1IHYA 4X54A 4D7AA 4LN1A 1P31A 2ZB3A 4BNMA 2AA3A 5JC1A 3ZCXA 3AWDA 1CYDA 2HRZA 2VRCA 3DR3A 1E3WA 9LDTA 5I9LA 3GVXA 2YYYA 2C82A 1NFQA 1XR3A 3GEMA 1U7TA 8ADHA 4NJOA 4Z6KA 2YV3A 2DPHA 1P1JA 4MVJG 3WDSA 3ZV4A 3BTSA 3DHEA 3O8QA 2UAGA 4U6QA 2VUTA 4XJSA 3TL3A 4BO7A 2X5JO 1Q0HA 3DONA 4ZJUA 4J91A 1H9AA 1V3VA 4HADA 3H5AA 4BO6A 3PDUA 2QYTA 3GF4A 4RLHA 4HP8A 1QXSA 3QY9A 1Y6JA 1ZK1A 1ENZA 5DP2A 2BGLA 4XB1A 1ZMTA 4MVJM 3HE3A 1YB4A 4D45A 3V5NA 1Y81A 2QRKA 1T4DA 2HK7A 4PLHA 1IULA 2AW5A 3E9NA 5DCWA 1FK8A 3DL2A 2BLLA 4CMEA 1ADFA 2GZ2A 1I8TA 1K5HA 3PHLA 2ZQYA 2CF5A 4NPCA 1QSGA 5TGDA 5U1PA 3HADA 3B6ZA 1YH3A 2VCYA 3L4SO 3AFNA 3FNHA 4WUVA 4H3VA 2VUUA 2NSDA 2PZLA 2E6UX 2WD7B 3GUCA 4BNXA 4HV4A 1H5QA 5LC1A 5K6AA 4HX5A 1DRWA 3KSUA 4YJFA 3ZWMA 2P5YA 3BHJA 1X14A 3JQAD 4FJ2A 3AY3A 3OEYA 5A9SA 4J1NA 1PJCA 1LU9A 1W73A 1HDOA 1WMAA 1RM0A 2EEZA 1KIFA 4J7XA 5ICMA 1LDNA 4W99A 5CFZA 3ZU5A 1Z82A 2I76A 1Q7CA 3DQPA 4EW6A 1IOLA 1XQ1A 4BO5A 5J23A 2EP5A 1DDOA 4S1VA 3OJ0A 1JKIA 3N7UA 1KOLA 4TRRA 1B8VA 1JU9A 1M76A 1NP3A 3OJEA 4R68A 2DPGA 2FMUA 5CDUA 4ALLA 5JYEA 4CV1A 1OBFO 4EUFA 4CMAA 4QECA 3G49A 2P2SA 3Q1LA 4XQGA 3HJAA 2HDHA 2B36A 3GVHA 3NJ4A 1YJ8A 3VTFA 5CEFA 4XGNA 2J5RA 4BNVA 4MIOA 2Y1CA 1H6BA 4R5MA 1K2WA 1I2BA 4DRYA 1KVUA 4A73A 4PLFA 1YL5A 2AEJA 5G0WA 4BO3A 5A9RA 3UCXA 5HRUA 3AJRA 5IJZA 4DPLA 1DIGA 4IXWA 5IXSA 4C4OA 3G1UA 3JYNA 3L0DA 4FFNA 1ENOA 4MVJF 4MIEA 4M87A 1X0VA 1UXIA 1ZVMA 3ENNA 1YE3A 5T8KA 5TNXA 4YXFA 2J3HA 1PJ4A 2CSUA 3GLQA 4J4TA 3I9KA 4Q3CA 3LT2A 1HDCA 1PQUA 4ND1A 3WXBA 4BHTA 1ISJA 1ZNQO 2AG5A 1NAHA 5EPOA 2IODA 2E48A 4CPDA 3DBLA 3ZZNA 5JDCA 4WPGA 3T4XA 4KTTE 4QFCA 2CFCA 4WGGA 4L4XA 4R69A 2YFQA 4PLVA 1I5RA 3BIOA 3KXDA 1MGOA 2IXBA 2J5QA 3DZFA 3QVWA 4E32A 1XU7A 5JY6A 1DSSG 5CEJA 3HB4X 4L4RA 1KEVA 5C5IA 4L73A 4CQMD 5A9TA 2VHXA 4YRBA 2C54A 1XHLA 2X8LA 2GZ3A 4PGFA 5IDQA 5BSFA 1PJTA 2VZ9A 1DIHA 1U2DA 1WDKA 3KRTA 4YT5A 5TS3A 1PR3A 3G3EA 2WYVA 2QYSA 4DLBA 1C0LA 2YDYA 2LDXA 3I9NA 3AM5A 3MZ0A 3W1VA 1R12A 4N5NA 4U5QA 3ZI0A 4AJEA 1Q7BA 3VVBA 5GZ3A 1GY8A 2B0JA 2SCUA 4FFRA 3OECA 4J1SA 4YQYA 1ZMOA 2GN8A 4QX6A 5CPFA 4BB5A 3I9OA 2D1YA 4RVSA 1E6UA 4NHEA 3IP1A 3W8DA 3JQ7B 3A1NA 1RJWA 1JVBA 1FDSA 1I2ZA 4PZCA 3KSDO 3UCEA 3VDRA 4TZKA 2FZEA 2Y67A 1GYQA 3RVDA 3DZJA 1I3KA 2EP7A 4Y8VA 1XKQA 1E3LA 1DAPA 4PG4A 3GNQA 1J4AA 5ENDA 4DQVA 4HKTA 5IN4A 2ZTMA 4A10A 1EVIA 2UYYA 5JSFA 1MP0A 4D3SA 3WQQA 3OSUA 2AQKA 3M1AA 3PJFA 3SC6A 4IDCA 1JKJA 1KEPA 2P91A 2C7VA 2XXBA 2IZ0A 4UUOA 3ETGA 3BXXA 5THKA 4DC1A 4CR8A 1N2SA 1LSJA 4EJ6A 1T2AA 5AXDA 3OP4A 5JAIA 2FSVA 2JD2A 4UULA 3TSCA 2V6GA 3Q9UA 1LDEA 3H65A 4BNZA 2QRJA 1A5ZA 4DC0A 1SCUA 1JW9B 3K30A 4A26A 4FFPA 3KUXA 1HETA 3FD8A 3KVOA 2ZIZA 4ZU3A 4NQZA 1H9BA 1RKXA 3W6ZA 3OEWA 4RPJA 1CIVA 2QQ5A 1B8UA 4YAIA 3QVOA 5ER9A 3OMLA 4BS9A 4DIFA 1VJTA 1YWGO 4IBOA 4OJNA 1NQTA 5L4LA 4XDZA 3SJ7A 3X2EA 1QG6A 3KLMX 4B3HA 1HL3A 1B26A 3DOOA 3S2IA 1B2LA 1GUFA 1GEEA 3DFUA 2CUKA 2Q2VA 1R6DA 5ICSA 5KKCA 4AJ1A 2O48X 1B14A 3HN7A 4U8GA 2WM3A 4OQYA 3SBOA 1P45A 3TZKA 4XD2A 2WD8A 3NGXA 3UGKA 5KVCA 3ZHYA 3WTCA 1PWXA 1RM3A 4D46A 1P9LA 4DMLA 1PU2A 1HE4A 4UVEA 1F8GA 1LI4A 1OC2A 4EJMA 2YQ5A 5JDIC 2FN7A 3B20A 2EKLA 3FHLA 1ZFNA 1GZ6A 1P1KA 2QZ9A 2I6TA 4BNHA 4ZGWA 2HMSA 3C1TA 3ICCA 3GZ4A 1E5QA 4IZHA 1QV7A 3WB9A 3BMQA 1EK6A 2C5AA 1DIAA 1T26A 3EZYA 4URFA 5COQA 3GGPA 3U4DA 3KV3O 4CUJA 1IUKA 1TVEA 1IHXA 1TT5A 3LK7A 4PG8A 1LDBA 2Q4BA 3OBBA 3VZSA 4YBZA 3G0OA 4BKRA 4NK4A 3A28A 2XXJA 5DF1A 4IMPA 4IZIA 2O7SA 1TI7A 3ZHXA 5TJ9A 3ZHBA 2W2KA 2X0JA 4B4UA 4I08A 3BMNA 4I5EA 2DM6A 1HZJA 4BV9A 2R00A 3IQDB 7ADHA 4Y9DA 4CMIA 2GSDA 1PJ3A 1LSSA 1X7GA 4CMCA 3G79A 3PRJA 3U0BA 1XEAA 3I9LA 4PLPA 3VHRA 2I3GA 3E9QA 3E5RA 3DMTC 3U9LA 3WFJA 3GPIA 1A4UA 2YHIA 1CJCA 3F9IA 3O03A 2EKPA 3PHHA 4U0JA 3KZVA 5G0VA 3H9JA 4WCFC 4WLEA 3OJLA 2BI7A 1ZBQA 2OMEA 4JROA 3UHAA 2W90A 3GZNA 3NEPX 3I6IA 4FJ0A 2EHDA 2CY0A 3H9UA 3LLSA 4TWRA 4ZD6A 3MJSA 3JYQA 2IDZA 1T24A 3AUSA 5ADHA 1M66A 3C8MA 2GD1O 2PZJA 3QLJA 3GEDA 4YJHB 3PJGA 3ONFA 4W9NA 5JY1A 5FI3A 4LMPA 5JPIA 2D0IA 3DTTA 1XU9A 3V1UA 1ISGA 5T5QA 2BFOA 2YV1A 5IDYA 3S55A 4RF2A 3AU9A 1JAXA 4QUKA 4YT4A 3GMDA 4P22A 4TKLA 2HUNA 5F1OA 1JN0A 2P4QA 3GN2A 3LZ6A 1H93A 3FPCA 1XLTA 1HE2A 1GADO 5I7SA 2OUIA 1B7GO 1YJQA 2PH5A 4TQGA 4PN3A 1DHRA 4EITA 1NAIA 2H1SA 3EAGA 1Z6ZA 3ANNA 3JQBA 3E48A 3RASA 1MG5A 5HS4A 2VYVD 3OM9A 3C1AA 2WYUA 1SC6A 3CH6A 1YOVB 2VOJA 5ITVA 1EQUA 4Q3BA 3OFSA 4DYVA 1L7DA 1YBVA 2IZZA 3ZV3A 2I5PO 3ZWCA 1H6AA 1ZKMA 3DBHB 4N5MA 1DB3A 1E1KA 5IFLA 3CMCO 3FBGA 2ILTA 2OL4A 4FJ1A 2EG9A 2WMDA 3WQRA 4BVAA 4K9DA 3NTRA 1GV0A 1BSVA 3GH3A 3V2UA 4GWKA 2X9NA 1MV8A 4BNGA 2FOIA 2FP4A 1IL0A 2Y66A 3B70A 1R0KA 5EIOA 4IQ8A 1OFGA 5JAQA 1WVGA 1Y8RB 3W8EA 3KYCA 2Y1EA 2EXXA 4DWVA 4DTIA 1O0SA 4JBIA 2DKNA 2VWPA 3PYXA 1WW8A 4GGOA 4OHUA 4RPHA 4NBUA 4CV0A 5I7EA 2Q2WA 2HU2A 1YRLA 4Q39A 2DC1A 5GMOA 5IAAA 1PQPA 2C5EA 2VN8A 2PZMA 4WEOA 3MOGA 1HXHA 3GHYA 1DC5A 4G81A 2PKQP 1VC2A 5F1PA 4Y67A 2NM0A 1PZEA 2C0CA 4M86A 4OYRA 3DBRB 1F17A 3EVNA 3D3EA 4RVGA 5DULA 1ZEJA 5CDGA 2B5VA 1BDMA 5THQA 4WLUA 5KJCA 3AFMA 1BVRA 5U4QA 4NMHA 1XDWA 2JCVA 3DTYA 1BXGA 2OGUA 3LVFO 2DUWA 3ANMA 1LQUA 1KVRA 2B4RO 3QWAA 3ZNPA 3CUKA 5K0ZA 2O2YA 1B8PA 2NNLD 2NWQA 4CM3A 2EGHA 1HDYA 4IINA 3OF2A 2VHVA 2YQ4A 3K2EA 3GVPA 1M2WA 4LGVA 3P5SA 4IIUA 4RPLA 4XYGA 5B4VA 3H9EO 4YR9A 3KO8A 4BNUA 4XKJA 3DHYA 4TSKA 5DNAA 4ALIA 2ZQZA 3AOEA 2NACA 1T2FA 2FWMX 5JC8A 2UUOA 1SEPA 3JYPA 3F5QA 3JSAA 2AE1A 2BELA 3IIEA 3PFFA 4BB6A 3PQEA 3UW3A 1ZJZA 4CLOA 4ROSA 3PFWO 4ALMA 4CLDA 3IL2A 1E92A 4G2NA 2E49A 2JHFA 3ZN2A 3JQDA 3NAQA 4TROA 4N5LA 4O1MA 4L4SA 3D4PA 3AY6A 3RKUA 2HMUA 4R1NA 3WMWA 3IUPA 3FWZA 5F5LA 4MJLA 3Q2KA 3IJPA 1LDYA 1DO8A 3V2HA 4P4NA 2RCYA 3M2TA 1O95A 3JD3A 2C29D 3D3WA 2I3AA 4ND3A 3JQAB 1C1XB 1QYCA 2WSBA 3EC7A 1U2GA 3IC5A 4R51A 1R4MB 3GAZA 3MCVA 2A4KA 3UICA 2VHWA 3PHGA 3MTJA 1GUZA 4WE3A 3HNPA 1QYVA 2P4HX 3FBTA 4JN6B 4XEHA 1SZJG 2BKAA 4MVJE 1BMDA 1H2BA 1JQBA 2BFAA 3ASUA 3OQ1A 1UAYA 3H9GA 4NBWA 1GZ3A 3RBZA 1A71A 1R4NB 1U5CA 4LW8A 3UOGA 2D5AA 3OIFA 3WYBA 3PIDA 2Q22A 1NVMB 1QP8A 3SEFA 3A14A 4BNYA 4WLVA 1ADGA 2E37A 3I4FA 4BKPA 1MXHA 1VLLA 5C7OO 3PWSA 3PJDA 2RAFA 2O3QA 3VC7A 1VSVA 1F12A 1X7HA 2GASA 3PLNA 3DZGA 1X15A 2P9GA 4IQ0A 4B8ZA 3N58A 4R4JA 1P0CA 2GUGA 3L4BA 4XQCA 1E3WB 4EBFA 5G4KA 4B8WA 4M89A 2JKVA 1QR6A 5TC4A 4KP7A 2ZYAA 1X7DA 4WCFB 3UKOA 4OMUA 4QSMA 1K0UA 4OIMA 2JAPA 5ILOA 1R0SA 3NDIA 1TB4A 4GMFA 3TZHA 3KYBA 3WGGA 4CM4B 2O4CA 2EJVA 3L07A 2GLXA 1P77A 2IYPA 2ZB4A 2G0TA 3M2PA 2Q99A 2P9EA 5IDWA 1NX6A 1Y8QA 3PYMA 2B5WA 4GH5A 3GRKA 1BW9A 4PG6A 1WWKA 2IYOA 1SNYA 1Z45A 3G1TA 4K6CA 4PRLA 3LSYA 3ADPA 1VI2A 2NV6A 3PI7A 4NR0A 2O23A 3U09A 3DAFA 3IDSA 3H7AA 1R37A 3WNVA 4GI2A 4WOJA 3ADOA 3RUAA 5CG2A 4WLNA 3T7CA 3CMMA 3WMXA 4I5GA 4J9VA 3JQ6A 2Q1SA 1KEWA 1U4OA 3QIVA 3D0OA 4OKNA 4XIJA 4YT2A 4R3WA 4PRKA 2JCYA 1VL0A 1AN9A 4RVUA 2VYNA 2O2SA 4N7RA 2BHLA 4CUKA 4W7HA 3U49A 4GX0A 2Y99A 3W4JA 1AE1A 3NYWA 1DFHA 4CLEA 4PG7A 4CR7A 4GQAA 3LF1A 4LCJA 2I99A 2WYWA 1EDZA 2OORA 3EZLA 3BHIA 1PGQA 4MKXA 2CDAA 4R5HA 4XYEA 3GDOA 1E3EA 4E0BA 3I6QA 4FFMA 4BOYA 2Q49A 1UZLA 3PGJA 1N1GA 2PV7A 5L40A 4CQLB 3JD2A 1AUPA 3AU8A 1HSZA 3FCOA 3UVEA 2J6IA 4LSMA 3MWDB 1NFRA 3PLRA 4NDNE 3QWBA 1P33A 2BGMA 1H6CA 4AJ4A 1E7SA 3HUDA 4IGFA 5G0TA 5KJ6A 4D42A 1X13A 2OOSA 4J7UA 1KYQA 3TPCA 4XGKA 5KVSA 4DQXA 1N5DA 4NZ9A 1JA9A 2GERA 5G2OA 4E2YA 3GFBA 1V3UA 3DMTA 3RU7A 3SLKA 3JYOA 1WMBA 3WICA 4RVHA 3ZW8A 4UUMA 3BMCB 4UEJA 1NYTA 3FNEA 4DIOA 4EGFA 3K8ZA 5G0SA 1T2DA 3EDMA 2PGJA 3EW7A 1YONA 4INAA 1PGOA 2XPCA 4IM7A 4RF4A 1MA0A 2NTJA 4HFRA 4QQRA 2A9FA 3ZWWA 4RZIA 4DQUA 4EEXA 1Y5RA 4IDEA 4ZN6A 1DPGA 5BNTA 4W7IA 4YAEA 3VKUA 1I10A 3KSZO 2VHZA 5A02A 1RWBA 3PWZA 4OGWA 4RVFA 3TZQA 3NGLA 4CODB 2Z1NA 5TQVA 4E33A 4YRDA 4DBZA 3AM3A 4MVJD 4EUEA 3GN1A 4YAKA 4ND2A 2NLOA 3UN1A 5JCJA 1YB1A 1W0CA 3I9JA 3JQ9C 1SOVA 2DVMA 4NG5A 1TA4A 3ZWPA 4Q9NA 3ST7A 3F3SA 2G82A 3TOXA 2VRBA 4F45A 3RCBA 2E4AA 1OC4A 3FN4A 4Y6SA 2RIRA 1GDHA 3VPHA 4D79A 4LRSB 3H5RA 3ITDA 4ZA2A 1KERA 5B37A 3PDJA 1MFPA 5L45A 4YT8A 3ROPA 4RQTA 4CMGA 2GGSA 3MJCA 1C0PA 3CIFA 3OA2A 3RC9A 4ZHSA 1UUFA 4YWJA 1XA0A 2RH8A 3MTGA 2F1KA 1XWFA 2VHYA 4W82A 1RYEA 1UAGA 1O94A 1DHTA 4RQUA 1NVTA 1SAYA 1U9JA 3IKVA 3ZNNA 4PG5A 1P1RA 3O4RA 4AVYA 2BFMA 2O50A 1O5IA 1R16A 3TQHA 5L7YA 4E2WA 1NM5A 3F6YA 1ADBA 1G1AA 2ZYDA 5FFFA 5AXAA 5L95A 1J0XO 2A35A 3E5MA 2VRCD 4DLLA 5JFOA 3DAPA 3Q2IA 5AQ1A 1E3IA 1VJ1A 5EJ2A 1GPJA 3RBVA 4BL5A 2JFGA 1GAEO 5KTKA 2ZATA 1DBVO 2FR1A 4Z9FA 5CDSA 3WR5A 3PQFA 4GGPA 2QW8A 3QP9A 4B7XA 4CLHA 3BZUA 4W4TA 2QIOA 2D8AA 2ZCUA 1EE2A 5KOIA 4L8VA 4LISA 1PZGA 4UEKA 2IXAA 4ONEA 5CPBA 5IZCA 2EV9A 3PYLA 3E1KA 1BGVA 4WLOA 3RUDA 1E5LA 1K3TA 2NUAA 2HCTA 4BO4A 4JQCA 3UCFA 4J6FA 3K2BA 1YO6A 3JQGB 3S2FA 1TEHA 1MC5A 3STHA 1LTHR 1UZNA 1O9BA 3K6JA 2NADA 1KEUA 4XWYA 4JGBA 1DXYA 1EBFA 1N8KA 5IXYA 3DHNA 5KJFA 3FPLA 4Q3DA 1CQJA 1ZO8A 5BNIA 1ZW1A 2W2LA
chains in the Genus database with same CATH superfamily
4IXMA 4JIMA 4I1IA 5FOTA 3V34A 2B82A 5CYGA 4UBIA 2AF3C 5CBPB 3WKAA 2IX3A 4OJKA 4W63A 2AYXA 4AL4A 1FFDA 1KHTA 4LXYA 4RE6A 5KVVA 4RL4A 1IC6A 1U2ZA 1GGHA 2Z9CA 3WOHA 4YR7A 3GMSA 4WASA 5I4IA 3H6KA 1V16B 3T15A 1BEUB 1JX6A 1VLJA 3RTEA 3TSOA 4E4TA 1GTSA 1CE8B 1HE8B 1Q2XA 4BLOA 1GQFA 2OD9A 3PPYA 1TYDE 4JC5A 4RULA 2J32A 4Z3KA 1V7PC 4Y1FA 4HDCA 4C06A 3G2HA 3TVTA 2QQGA 1G3MA 4K88A 5JOQA 1MJGM 2MCFA 1BHQ1 2O0LA 1JIUA 3OWXA 1KPGA 2QI9F 3IOYA 1U3WA 3D6UA 3K0KA 5BQXA 1YC2A 1UP4A 4YRQA 2CXHA 2YJZA 1MJFA 4FBGA 3MUOA 4MA5A 1PNQA 2ZIEA 4I55A 2BHRA 2F3SA 5C7IO 3A9RA 4UNQA 5DNUA 3IUBA 1E60A 1TMOA 4M1TA 1NASA 1MENA 1SPXA 3PHCA 3P27A 1T0PA 2C1EA 4URZR 4YHBA 3RVNA 3ADKA 4KCGA 5CYPA 3Q15C 3SDSA 3L1HA 1AU9A 1ZINA 2CMDA 3N7TA 4KPYA 1QK4A 4NJMA 1SVMA 2XUGA 4E15A 4EPRA 1Z2CA 5KX5F 1NVDA 4LDZA 2B5OA 3WLJA 3QENA 4DMCA 1C30B 1M2VA 1PWZA 2YUTA 3GI1A 3L0OA 3OPQA 4NXNB 3GEIA 2P3QA 5FI5A 1T1RA 3WMFA 2C4MA 4TSRA 2H17A 2LVBA 5B5SA 2N1BA 2QG4A 5AW4A 5JCPA 3Q6MA 4B9AA 2IHNA 5TMDA 2FPLA 3NM5A 2LE0A 3V7NA 1SURA 4B7ZA 3T7TA 4O63O 1QIEA 2VBFA 3MLBA 4V02A 3HO1A 1JDPA 3F0TA 5G02A 2FSGA 8LDHA 2IEGA 3ENWA 1EUDA 3FFWA 2G17A 2OZPA 1ZG3A 2A7QA 3H4IA 4J2HA 3NBUA 4TTVA 3QFHA 2AN5A 4C05A 3N2YA 3RPEA 3TZBA 2WZCA 5LQUA 4A4DA 5AO9A 3EVBA 4WOKA 5LQDA 1CEQA 2FMTA 1ADCA 3QX7A 3D8UA 2Q3BA 1YR2A 5AVKA 5FEUA 2WOJA 3A32A 2WE8A 1G8SA 4OL9A 1PGJA 1RLUA 2ZB7A 3AHGA 4YNBA 1EE9A 5BR4A 1F2TB 1NLZA 2N9UA 3NFRA 3HM2A 3DDNA 2YRFA 4QG3A 5KOJB 4O2AF 3UZUA 4PLYA 5I7RA 1I4WA 5BT9A 3QF4A 5BWNA 4MV9A 1JWLA 2XQJA 1RAAA 3BCUA 1M74A 3CBGA 2HH9A 4BYGA 2OGSA 1ESCA 3DP7A 4M1OA 5L7WA 4L8GA 2JHAA 3RVPA 1IYZA 2QR5A 3ELDA 4WWHA 2IY9A 2ZRKA 4KGXA 5KBYA 5EP3A 5K0SA 2QV7A 4QTXA 4FYIA 1I4DD 1RKBA 1WZUA 2ZVQX 2QLMA 3BFKA 4HY3A 4QWMA 3T7JA 5A62A 4PYLA 5BORA 2JD1A 2V7PA 4PM4A 5BNFA 1UKBA 2HWXA 3U3RA 3GP8A 1Z63A 2P2GA 2OT3B 2VIIA 3ESQA 3GRZA 4P32A 5IP5A 4KFCA 1B6GA 2VPWA 4NU6A 4KC0A 3VV2A 1AY0A 1G3IA 1O6FA 2DWCA 1NDHA 4PFKA 4U1RA 4HNUA 2VDPB 3L46A 4JX9A 2FCRA 5BR7A 5K9ZA 1GU0A 2B35A 3O1JC 5IK2D 4J3JA 1L5MA 3EVTA 5EMHA 3AUYA 3PZRA 5K3AA 2Y1KA 2FR8C 4F91B 3CLTC 1LNQA 3K0FB 4CM7A 5C1OA 1WB6A 2ZRHA 3CZMA 3KEOA 4Q9IA 4NS1A 1BFKA 5CB4B 2NO1A 1MIOB 3GAMA 1SIUA 1N4DA 3FRIA 3MPOA 5IM4F 2CNOA 3BXGA 3UK1A 4UTXA 4BQEA 1NTOA 3ZWYA 3LXUX 5I01A 2AG8A 4FCTA 4J0QA 2GBLC 2H48A 4RELA 1DAMA 1QNLA 2PX3A 3O3OB 7ABPA 5IVHA 2IBSA 4LK3A 2E55A 3AHEA 3AQ4A 4HSEA 1XMSA 3UJPA 4BO2A 2Q50A 4Q21A 1FJHA 1BGXT 1NJ8A 3I58A 4YJ2A 1R0CA 4C0HA 2RBGA 5JSHA 4JQSA 1LDGA 3GA7A 3R44A 2WDZA 3H5NA 3I9V6 5DFAA 2C5LA 4GX5A 3OX3A 1U4NA 3EEBA 4GLFA 4KLCA 1PS0A 1YZVA 5KNCA 2YW2A 1PSZA 1ONOA 2W5UA 3K0AB 2WKRA 5B3JA 3MQ2A 1E6CA 3DUWA 3EGOA 1FMJA 2W42A 5HG0A 1VOTA 6ADHA 2P7IA 4D4HA 3E8XA 2BBWA 1RYYA 1Z7GA 2XRMA 1Q1GA 1V3QE 2ZE6A 3D7NA 2VZ8A 4NFYA 5K6TA 1ESEA 5KNBD 3KYCB 1FDVA 4G8JA 2VF2A 5TR9A 4ED9A 3TW8B 2V7UA 4RANA 3X1MA 2CDCA 2FA9A 2VOEA 1KK0A 4EVSA 5JZVA 1HYEA 2V3CC 1EUCB 4MUKA 2OPBA 1D1SA 3CZCA 3GGOA 1SXQA 4OX9Y 1NXOA 5IAEA 4FMCB 1A7AA 3VHXA 2CE7A 3VNVA 1CEEA 1YVEI 4Y2VA 1QIJA 5DDIP 1A9XB 1W4ZA 1L3CA 3MA0A 4FONA 4NLLA 3RIHA 5DI9A 5LUBA 1KYZA 5C8YB 1PR4A 3CBQA 1ZN2A 2FUKA 3KTFA 2AFHB 1RJ9B 4I8IA 1O58A 4EZEA 1MR3F 1T2CA 4PV7A 1L7NA 2FR0A 1NURA 3HU5A 5JJBA 4CM9A 5A03A 1KSGA 1P2SA 1UBFA 3VVLA 3DDCA 2NNWB 1XDZA 2VQ6A 2YHAA 4Q3AA 5CW2A 2YHUA 1NHWA 1TOAA 2EJWA 3LU1A 3QG1A 3RRZA 1ZUNA 2JBHA 3GJTA 3ZLBA 5FI0B 2NOAA 1HL7A 3W3ZB 1GARA 4GMKA 3V80A 1WDLA 1L5KA 2FY8A 2POQX 1MVOA 4Q34A 1ZU5A 2AFIE 4S2UA 4KO8A 3S7TA 1DX4A 3PITA 2HMTA 1G5HA 2BKEA 4OBEA 3KC2A 4PVCA 4I55F 1KKMA 5HCUA 3KB8A 3TR6A 3NPMA 5KWVA 3JVDA 3A6KA 4PEVA 4ZWNA 4AURA 2V58A 2C4HA 2NP6A 1P1FA 3EAFA 4MW4A 2MYPA 1RP1A 3AZOA 4YV1A 4KVAA 3JQ9A 2JFWA 5LVAA 3DEIA 2R8EA 2XADA 1KJQA 2NPIA 3KL2A 4IZOA 4D4KA 4G0UA 2CVOA 1R4AA 4WKPA 4YXWD 2Q1TA 4LXXA 4KQ1A 3Q0TA 4UQLA 1OI3A 2M9MA 4LDJA 2DQSA 3EP7B 3ELUA 3ZV5A 5K3OA 4HNAB 3SZ3A 3W5UA 2C2XA 3ZLUA 4YB8A 4O6VA 3I6ZA 3LV8A 1WCV1 4KFUA 2DKOA 3EEQA 5KC8A 4OHRA 1HKHA 4JD5A 4FYHA 1UJ6A 4IIJB 5ADVA 2HJGA 2NU9A 4O4LB 1EK5A 1K6IA 2WIAA 3JPYA 3MPUA 3C87A 4IHJB 5BN5B 4RCVA 3VZDA 1PW5A 3T4PA 1NWHA 3O1LA 3CZ5A 1KWGA 1AHHA 1G21E 4LQLA 3RD5A 2O8DA 3JQRA 1E2FA 3QE4A 4PPQA 2ACVA 2WJZB 4B4VA 1X8JA 3FKJA 1IHUA 1XNRB 1JBEA 1GD1O 1Z56C 4C6SA 3OJXA 3O92A 2VAWA 2FEMA 2FWNA 1JI0A 3UF0A 2QT9A 1QV9A 2NG1A 2R7NA 4BZZA 1A2BA 3L1KA 4XWOA 4XR4A 4YUAA 1U7PA 5C8VA 5MN6A 3BEDA 1YI1A 3V1MA 4GP7A 1PR0A 2ID4A 2CUZA 4B3IA 4OXNA 1GDTA 1ZUWA 3UT0A 2QMOA 4BUCA 4YJGB 1MMFB 3CPSA 4FD3A 4N3NA 4A2WA 1T8WA 3AL2A 3L8ZA 3L4KA 2PNFA 3T3EA 4F0JA 1QC5B 3U4GA 1RI3A 2NO9A 5F3DA 3AP1A 1JJIA 1R0WA 4A82A 4ZTZB 5F9HA 2G04A 2MOKA 2LW7A 4H3HB 5LZ5A 3QU2A 1NQUA 3CXRA 3EXEA 1AQLA 4W9RA 3COJA 3ROTA 3P2YA 1KMHB 4EA6A 5K05A 4PZAA 2BFDB 2IBTA 3E70C 3CE9A 3QVTA 1TCVA 4D9FA 721PA 3EZGA 1IHOA 1A96A 5CTJA 3HDYA 4AJOA 5KNDH 3PEUA 3SQNA 1NRWA 3JU3A 2VDWB 4ML3A 4R7GA 2AG1A 3EMVA 2DBYA 1GA4A 1P44A 2XMRA 2O5CA 2QENA 1FQWA 1U0FA 3PV0A 3URMA 3TAXA 4CV2A 2A0UA 2H51A 1P0MA 4BNJA 3CRZA 4NEGA 1QIDA 1Q14A 1SA0A 2UVQA 3HDVA 3MUNA 4MO2A 5ALRA 3RHSA 5DLQC 2AUNA 5EMJA 3ENVA 4JCOA 4B6EA 1QGZA 1JZQA 2FW1A 2ZBFA 3ZJ5A 5BOSA 4HYEA 2PD6A 3VRHA 4CF7A 5EJGA 3GMIA 1HDGO 1GPAA 3UMMA 1IZ9A 4XOUA 3MUEA 4B34A 5JYCA 1D2GA 3HY4A 2ATCA 5I9BA 3OF3A 4RGBA 4ZT4A 3S2YA 4EMSA 3EH1A 3DOEA 4FZVA 4XIFA 4OI0A 3BTOA 1JPJA 2OXIA 2PKRA 2DFPA 4YJ2F 3RROA 4H7PA 1MXFA 2QZZA 1U1FA 1HTBA 1G17A 1DRJA 4E2ZA 1H1TA 1VSTA 4P4SA 2CEAA 4KPUA 4Y98A 1H4SA 2D59A 1JDVA 1QHNA 4WNYA 3ROMA 4LIPD 1TNDA 3MHPA 2XQFA 3TW6A 5LFAA 3DF9A 4LZPA 1ZH2A 4Q01A 1UR5A 1H8HD 4KDCA 3AHCA 1N78A 1X3SA 2QZ4A 1KXJA 3GJ6A 3L8MA 4QL3A 3P94A 2Q9AA 4EX6A 1GAJA 2W2XA 5M29A 1IVNA 1F0PA 1AUVA 2G07A 4O2BF 4CZ2A 2Y1FA 2JGKA 1BU5A 1KMMA 2XUQA 1S1CA 3O2NA 4X61A 1Z33A 3B6EA 3AP2A 2ZTVA 4RGQA 3UJ9A 5AVOA 4GBJA 5MGBA 3O4FA 2P0AA 6Q21A 3LUPA 4WK4B 3TCNA 4DM7A 3HDHA 1S2IA 3IMEA 2BI4A 4FZ5A 2WQ7A 4A8JC 3ZD6A 4CN8A 1FEZA 2BUAA 3TLJA 4QM7A 2XNHA 1JFTA 8AT1A 4QTZA 1BDHA 1NYRA 1YMQA 4QPCA 3L8FA 5HGJA 4CHTA 5FLKA 3BIXA 1RAGA 1T4MA 3AERB 4M0DA 3LUJA 2HRQA 3DB1A 1ZICA 4Q1CA 5D01A 4J3NA 3UK0A 2C7RA 1T9KA 2X5XA 1PS9A 2Q8QA 2VJPA 3SHOA 1VKNA 3WYFA 4KXWA 3PUIA 2CBZA 1A8SA 1EM8B 3CRW1 4KVGA 1X2BA 1EBBA 2CBGA 2EKBA 3JZIA 3Q9NA 4UFNA 3HO6A 2WSLA 1O77A 4LZAA 1H0RA 4UE3S 5TARA 3L9WA 5GTDA 3A58B 3WLIA 4NK5A 2YNMA 2RHOA 2QMZA 5JH7A 1ULSA 4L4UA 1UDAA 5DRYA 4JUBA 4DL9A 1ZY2A 5K6RA 3L0IB 5ED0A 1NDQA 1OAKA 3CE6A 3HCRA 2JRCA 3U1TA 3INGA 1JJFA 1RWOA 3FVTA 4E08A 5L3QB 1KY5A 1A7UA 5ENVA 3KQYA 3WVNA 3DXZA 1N5MA 1MAHA 5FOSA 3PXCX 3OCCA 3CRNA 5AUQA 5HPYB 3OLYA 1Q3HA 1LPAB 3GFFA 3KKNA 4EKGA 3VO8A 4Z4HA 2FEWB 4AG3A 2W4QA 2P75A 3DEJA 2D3TA 1GSHA 4HB2A 2EQBA 2G5CA 1N0HA 4KIFA 3Q8KA 3OCWA 4AB1A 5B7NA 1RZ3A 2O7VA 4AMUA 2GM9A 4G63A 1C3OA 1Y3IA 1KK3A 1JJAA 1U9IC 4IDQA 4KWEA 1JWBB 6ABPA 1JFSA 5E3HA 2ZE5A 4FMDF 1XD2A 2DXIA 3AYXB 4M6WA 5LPNA 3IE1A 1NQ5A 1NMSA 2QN8A 2CEKA 4MJ3A 4AP9A 1HUQA 1SHLA 4LF8B 1FQOA 2QXTA 3LIIA 3I9FA 5D6NA 1C4XA 2VF7A 2YV5A 3P9NA 4WXRA 4DGSA 3B52X 3GNLA 3ZH2A 1LLDA 3AY7A 4LTDA 2GAIA 3OZ7A 3AF6A 1M6EX 2HU5A 1KU6A 1XZ8A 1GAWA 1V1RA 3AV0B 1KFBB 3CF4A 1WW2A 3OFVA 1E18A 3HKDA 3WKCA 3ONEA 3B1XA 4PICA 2IBMA 2R7KA 5FPPA 4CKWB 4M8NE 4D0SA 3SQWA 1R4MA 1IH8A 1E63A 4MHOA 3BGDA 3QG5A 1RTTA 2EHJA 2OFOA 4LC0A 4M8KA 4AT1A 1K88A 4MRAA 1XZKA 3WL3A 5BXQC 4N76A 2B30A 3BBLA 2G72A 3BJMA 1ZJJA 2F1HA 3KHUA 3PI6A 4GKKB 4QT0A 2WSMA 2ZSEA 3RJZA 5EP2A 2Q7OE 1LXCA 1UJCA 1SXJA 2C2MA 4I9UA 4JVMA 3O8OA 2ZZKA 2DBVO 2QMHA 1RVDA 2HMWA 2NPFA 1OX6A 3PKZA 3EPKA 2OOKA 2ZK7A 3QXJA 1Y82A 3TCKA 1M0TA 3DJFA 1YA6A 1GTMA 1ZONA 3A04A 1CR6A 4PZ0A 1WVMA 2R65A 2OHVA 1F0KA 2VPZA 3ORFA 1GPLA 3H16A 3R5JA 3PFNA 4TT3D 3RB8A 4EO4A 1KZ9A 4NZYA 1T6BY 5ALMA 2YV2A 2DEUA 4HK4A 2Q6KA 4M8LA 4RTOA 2WG0A 3TB4A 4WLFA 3WIEA 1M2OA 4OPMA 5C4GB 5H4GA 1S3IA 5EI5A 2ZI6A 3REQA 5KOHA 3RSFA 2CXNA 5FL7D 4DNQA 4F4IA 2HMVA 2HJSA 2ID9A 1Z37A 3HXKA 3LKVA 1P74A 4GPZA 1HRKA 2IYXA 4QJ4A 4QLBA 3VUEA 3HM9A 3G9UA 2WI8A 1IAQA 4F7DA 2ZDQA 4CMHA 2O06A 4J90A 3TSZA 4CM4A 1GPNA 1SVOA 3OQIA 4W9NC 3SYLA 2JFXA 2XXAB 3WGOA 3SSAA 1GLVA 2R3SA 2YYSA 4HWKA 2HLDD 4QQNA 1YFJA 1FTNA 2O2DA 5FA5A 4CL0A 3IIIA 3LNCA 1ZKDA 2PUHA 3BD6A 4XQ9A 4G41A 3MB5A 3AW8A 4LECA 4O2RA 1KDPA 4HQ6A 5DCUA 4B9EA 1GTRA 1XXHA 3KHKA 2ZSHA 4DLWA 2MYTA 1MDFA 1TFUA 2R44A 3F8WA 4ENVA 4RYLA 2R1ZA 1QE5A 4RVCA 1DLJA 5JI3E 1G38A 2RBKA 2VJNA 3FOWA 1PJQA 5HTKA 2GH1A 1QMIA 1OH7A 3EPHA 4EGAA 4IGEA 4EI9A 4F1WA 1ZW6A 5KYGA 3TVDA 3ZUPA 1KQOA 1U8UA 3F96A 4GI3A 4C4PA 3W7BA 4BN4A 2B2NA 4U2EA 1JZTA 1THTA 3DYVA 4YP6A 4F85A 4MS4B 1TGVA 5K0LA 1XK6A 3HU3A 4WX2B 2O0JA 3FAKA 3VQTA 3U4CA 4WDRA 3SZLA 4BV3A 1AKEA 2OVBA 1S4QA 4RO0A 2XHZA 3DUFB 3JWEA 4LJ9A 1RIFA 2R8XA 3SR3A 2VNHA 3SZUA 1MOSA 3KCQA 3HWWA 4WFIA 5HKKD 3WNBA 4PZZA 3OA0A 3C6YA 2XF8A 2XE4A 3H0WB 2VZLA 1CQJB 3BRWA 3HCPA 1TA9A 4BMNA 4ZVVA 1YI8A 5A7GA 2OCBA 3H18A 1PDOA 1JRLA 4H17A 4E2FA 1UF9A 2QN6A 2GXAA 4I6GA 1XZBA 1SHJA 3EG9A 3KYJB 3RRYA 2VJAA 1B43A 4H1WA 1DKRA 1ZA1A 2G67A 3EA4A 3JAWA 3PL5A 4JITA 2SCUB 4KIJA 2Q6VA 1GFSA 3LPCA 4U7HA 1P3Y1 5AOVA 4ETMA 3ZD9A 2Y9PB 3ANLA 3IP8A 4ZVNA 1LLFA 2Z6VA 3C0KA 3QYFA 4NFSA 4BIMA 4E11A 1PV1A 2BR3A 2IH5A 1Z62A 3U80A 4XVCA 1USVA 1IG0A 3OZXA 4KBFA 2QHXA 2XLCA 3LECA 5JH7F 3TOCA 1RXWA 4Q4JA 1CIJA 1O0CA 2EBHX 5FDFA 4IIHA 4CF5A 4V1CA 4CLEA 2V4ZA 1YHNA 3MJVA 3MXTA 5IYZB 2PWPA 4QGFA 1G4AE 1QE3A 1Z4LA 1I01A 1Y6ZA 3A0RB 5IAOA 1NF2A 2IEBA 1EX7A 1HNZB 3PHBE 4EB6A 1U3TA 5J4HA 1BXKA 1KRXA 4MS1A 4FHDA 1KDTA 5CDTA 1I3NA 4DYDA 1JKJB 5HWSA 3ZJYA 2PG3A 4MPTA 3WLFA 2AMVA 3BFPA 4URYR 4W1PA 2OBBA 4EB3A 3N8GA 1PZFA 1Z18A 4BYMA 1K5PA 2AOTA 2CLCX 3QW4B 3V1YA 5D1HA 1GNQA 1FXSA 1N6RA 2K6GA 2JNWA 1VIVA 2XODA 3NDRA 4OAOA 4OUDB 5IULC 3ZDRA 2ZULA 3BHNA 1I51A 4B4WA 2GVNA 3U3OA 2QLFA 1KE2A 3K70C 1RXCA 1OX4B 4MI6A 2C8VA 1HLGA 2Q3EA 1NMYA 2Q5LA 2QG6A 3QQ5A 4QYSA 3TRIA 3GLIA 3C3MA 1ORVA 4P92A 1DTSA 3DFZA 4DRZA 3GLKA 4YCMA 2BDEA 2DHDA 4WAUA 4K9SA 4KMRA 5CDYA 1CYEA 1ZI9A 3LT5A 4LA4A 4YP7A 4B71A 4JVLA 4UU0A 1AF4A 1W49A 1GSOA 1UXJA 1FSZA 3D6JA 5ILGA 4FOOA 1WOYA 3T61A 4GXNA 4ZDIA 2C7OA 1N34B 1LZLA 3S7ZA 3KPUA 2ZROA 1NWCA 3ZVLA 3OMWA 2A92A 1VCHA 3JWHA 4FLMA 4J49A 4HDKB 2YS7A 1Z5PA 1MN6A 1BE8A 1HE3A 5AOCA 2R5WA 3WB1A 3WGKA 2ODWA 4E2XA 5JCJD 5EWMB 4WVFA 5A4KA 3TEMA 2XAAA 4FINA 3L41A 3SP1A 3WWDA 2PUCA 4PGHA 3F67A 2GESA 1S8FA 4BGIA 2ZITA 1ZK0A 1U98A 2J8ZA 2QE7A 5KSWB 4UDXX 4WA7A 5G40A 3TD2A 2P5UA 5KQLA 4WQMA 5CU7A 2FPPA 1KAHA 3L8YA 3QLUA 1WSWA 1VCOA 1WUIS 2PEZA 3GGGA 2BFFB 5TJHA 4AIIA 1U2TA 3I0ZA 2F7SA 2FZWA 4QU0A 5JW6A 1MC1A 3BDIA 3NNSA 1M75A 3FCEA 2CJWB 2WTUA 1DIOB 5DO9A 4EHBA 3SN6A 3ESRA 1DWPA 1OLSA 4JYMA 1V1MA 5E6SA 3U3ZA 3U1BA 1UK7A 5ECDA 3UMBA 1KMIY 2I4RA 4M0KA 4M38A 4ZVOA 3V4LA 2EFEB 5K3DA 4P58A 4X8LA 2GDZA 3R8FA 4YRSA 2PS3A 5AVTA 1HLFA 5ED4A 2ERCA 5I4BA 2PKQO 1PJSA 4PHFA 4RD0A 2R7MA 1NVXQ 3R7LA 2WVAA 4N47A 4B87A 1XL0A 3U7QB 3AUFA 3NBMA 2NU8A 4QC2A 3BULA 2NMVA 2A78A 3DMFA 3FKSD 1VJRA 5LQMA 2H2WA 5M34A 4HWTA 3A1EA 2ZJ0A 4DUPA 2W2KB 3PIRA 4AY6A 4D3FA 2BMEA 1T4CB 3KWLA 2IE0A 1ZGBA 4COOA 4KQFA 1W5FA 1G8PA 3JD0A 5L53A 2HA4A 4LMRA 1MO6A 4YQEA 4BQNA 3KD2A 4B0PA 1S8OA 5JADA 4RYDA 2G9RA 4ID3A 4KHPB 1PG2A 2BP7B 2ACEA 2DTXA 3QBVA 1C14A 3A70A 4N9QA 3D8TA 4IVQA 3L4BC 3RYIA 5BRAA 3JCZA 1IY2A 2J41A 9GPBA 4DV6B 4QREA 4D8WA 5HJ7A 2PX8A 2PA3A 3GDGA 4XCXA 1CY7A 2W43A 1JU4A 2YVKA 3PBKA 5L7TA 3JQGA 2VEOA 3NHSA 3V1KA 4BJ5A 2DAPA 3B36A 3F2IA 3OKPA 3WG9A 1N0IA 1NBHA 2ONCA 4LVUA 2R8OA 4ND8A 3JXEA 1MTZA 1PEDA 2HM7A 2OEPA 2ZREA 1Q0LA 2RHRA 3MS7A 1BDJA 2DU8A 4IDFA 3VZPA 2HO5A 1QORA 1NBWB 4HPJB 5HOQA 1FMLA 3G0DA 1PUIA 5EPUA 5BVHB 4FDLA 2V0GA 4FYJA 4CWAA 4BC1A 1GEGA 1J5EB 3TRDA 2ZRBA 1HURA 5LKAA 4DSUA 3DCYA 4FXOA 3ONNA 3MERA 3I37X 4Q3EA 5I8ZA 1BU8A 2YIVX 3SLGA 3ZE0B 2KW5A 4KV9A 3ND5A 3H11A 1HH4A 1WPXA 2VP5A 5K7SA 4ND7A 5EOVA 1UDBA 3LT0A 4MWDA 5FWYB 2GSWA 2Z6AA 4Z9XA 2NXCA 2QTWB 2V7QD 2JG3A 3D2AA 3H2ZA 4UM9B 1XF1A 3A7DA 3BIFA 5JFTA 3A0UA 1L9KA 2VTEA 1ABEA 5GV7A 3ZU2A 3RTDA 1C4KA 3PXUA 1KTIA 1QYDA 3JW8A 4G5SA 1XROA 3NEAA 2OFWA 1NX9A 2XSZD 3H6GA 3EP4B 1BWPA 2IX9A 3RARA 4W8OA 3UAVA 3QK7A 2OORC 2ZSBA 4AUNA 2FE1A 1GGJA 3OC6A 1Q7GA 3F6EX 2FEXA 3IOEA 4EG5A 2VSOA 3NBYC 3M1IA 2X5KO 1OH6A 3AQIA 1E4YA 4IP0A 2OBYA 4DUGA 5F7JA 2X7XA 4BNDB 5JS8A 1WMSA 4EY4A 3T3GA 2L0XA 4FKZA 3W7AA 1RADA 4L22A 3SR4A 5A5GA 1A77A 3HPRA 4O02B 3RUHA 3K92A 4TVSA 2ZWIA 3O7WA 2EYUA 4NG4A 4BAUA 3LQ2A 2X9LA 5T7BA 4JI7B 1VMIA 2FP4B 4CKCB 3W5IA 3BOSA 1KEEA 1ISHA 1S5PA 3BDAA 4MEJA 2XUFA 3V6LA 4JH0A 4ZARA 1ULBA 3HZRA 4HL6A 2N3ZA 4MKRA 1Q0ZA 3H3FA 3ACBA 4I4IA 2HX1A 3WS7A 3IMKA 1D5CA 4HAZA 2QI9C 1GZSA 4LWOA 3WWPA 2GLTA 4Z0TA 4CTOA 5CD9A 2O0KA 4QFMA 1K7YA 4Z3DA 1JQEA 4GF5A 5JSZA 2R6DA 2X0RA 5DX0A 2FW6A 5IT9A 2XV1A 5LU9A 3TOSA 2EDCA 4EYQA 1X1TA 4NECA 4FLFA 1DJLA 4FHEA 5KYUB 4DUZB 4DLRA 3I92A 3M5CA 4LVOA 1ORWA 1RM4A 2H29A 3HA2A 4XJTA 4MYUA 5CCEA 1WPGA 5J4VA 3DFMA 1EXMA 5EESA 4AZ0A 3D0KA 1W36D 1GRQA 2IP2A 4MWZA 3VH1A 4QE3A 2WNIA 2HA3A 5F7ZA 2C4TA 3Q0EA 2QVCA 3OZTA 1QQ7A 3HJCA 3BB4A 5HJ2A 2JEOA 4ARAA 2C07A 2ANBA 4GXRA 4I36A 5CT5A 3I32A 4HI0E 5GOZA 4AJHA 4CMEC 4LS3A 4C2AA 5DGDA 5H3HA 2XKBA 5L6MB 3N3AC 2NVOA 2MHCA 2X4GA 2CHFA 3PZBA 1IZ0A 1LK0A 1XGKA 2HMYB 2PMBA 4RJIA 5SYAA 1VB3A 3ZX5A 4BMCA 3TG2A 4KN5A 1Q50A 3SYRA 1FW6A 1P6QA 3I23A 1O7JA 1T36B 4GMGA 1Y9AA 3NIGB 3ZGZA 4IV0A 1P8JA 5BT8A 1KZGB 4FHZA 2GETA 1JHAA 2R6JA 1ZNWA 3WIVA 1K2VN 1ZZEA 3OT4A 3RIGA 4MRMB 3CM0A 2OZEA 4JQOA 2SECE 4WK2B 5KNLA 1GKYA 3H2SA 4F84A 5MHTA 3A9SA 1ESZA 4MTCA 4XWKA 5IG2A 1DMRA 3QFTA 1I5OA 3RAGA 3AI2A 1T0JB 3R1IA 3R2JA 4HUJA 3UJ7A 4HCJA 2PFSA 3ORHA 3PICA 4I5FA 4X20B 1ICIA 2QRGA 5K03A 1XTVA 1U3VA 1BEZA 3ZJTA 3K31A 3LKDA 2OXTA 1GCIA 2CXXA 4AG6A 4JIGA 4AJNA 1HLDA 3MMPA 4C0XA 2WHEA 1ISIA 2ZG6A 2KLBA 1QM5A 2JH8A 4O5OA 2PRZA 5JVDB 3ZY2A 3TQFA 4CKBA 3S8YA 1E3JA 1VGQA 2ZAOA 4LQDA 3I34X 3V2GA 5JXJA 1LK5A 3SHWA 3C70A 3G5MA 3ZX4A 4G6ZA 1N3LA 2R25B 3QYJA 1UEJA 4XI9A 4E07A 4Z1OA 1LFAA 1FPMA 1SFRA 1N0VC 1BFUA 4WH0A 1SUCA 3E2MA 2ZJ2A 3A2MA 2NYRA 4EHHA 1TEZA 1A95A 4N0PA 2WV7A 2XH8A 2VEDA 2B2CA 4M1MA 3FDJA 3G2PA 1Y1QA 4WFJA 1OV6A 3UFXA 1TIPA 3OAAD 3UUGA 1N2IA 1V5FA 1LQTA 1SOMA 1DNPA 4G1UC 3ETNA 1VKZA 3IP3A 1RVV1 1N9GA 5KNCD 4IIXA 4IFTA 4C89A 3GVIA 1E2LA 3JZFA 3LHFA 4G8BA 1Z36A 2ZUCA 2DUNA 2C8JA 2ZW9A 3AKDA 5DASA 4D26A 4YJHA 2BMAA 2RI6A 4BJ3A 4P4LA 1H1LB 1TAQA 3HYCA 1BXRA 3B2NA 5T8KC 4QNNA 1CRLA 2E5LB 2Z30A 2F3PA 3IBTA 4HGPA 1RPNA 1OPRA 2W6NA 3KZOA 4PTZA 1VHLA 5EJ8A 4HNHA 1GQQA 3BTUA 3I5YA 3DZHA 2PX4A 3NALA 2WB2A 1ODIA 4LSWA 5KB3A 3T12A 1FRZA 2AC4A 2ORED 1ODCA 3WV5A 4WXMA 3TUJC 4BCBA 4Q5IA 1D7AA 3BMOA 2D4AA 3VPAA 5BQOA 1WD7A 4FIDA 1RRVA 1YRQA 3OD1A 1AK9A 3S1LA 4ARUA 1II0A 3ONDA 4GKVA 3E03A 3VAYA 3M5WA 2W6QA 4CM5A 1DWOA 1VKOA 1P5RA 1J7JA 1YZHA 2BM1A 2P9BA 1TM3E 3AMVA 3Q1KA 4U3JB 4CM9D 2RHCA 4CEJA 1MQAA 3GLHE 4LY9A 1B8OA 1E5DA 3O0TA 5HUHA 1S01A 2QWXA 1J07A 3DKPA 2IXDA 1G8KA 1OR8A 2YIDA 3L01A 4HQNA 2FWPA 4U7GA 4YACA 4QDOA 1WDMA 2KQUA 2XIQA 3CB4A 3FCAA 1T5LA 3K9LA 2JAWA 3Q98A 4LHWA 4OCZA 4MDEA 3RYTC 4YPFA 3P2OA 5B7PA 1U2DC 3PNMA 3VU1A 2IZ5A 4D9BA 5ALIA 3X1JA 5F7XA 2A9OA 1A8HA 2HCRA 2X2FA 3CZPA 3CC8A 4DW8A 4ER5A 2ILVA 4EYSA 4GL2A 1H6DA 1YGPA 1GUYA 1NZDA 2AJ8A 2C59A 3GDFA 4ABYA 4CMJA 5LD2B 4N48A 2EQAA 2WW8A 2ZVPX 1C81A 3BFJA 1C4OA 3BSWA 3GUYA 4V2UA 4Z3OA 9MHTA 3ID6C 3IEKA 4FS3A 5HBRA 4LFBB 1KI9A 1BRMA 2JEZA 2QIPA 1L5WA 1M8GA 2RKWA 1CNFA 3KNZA 3R5HA 4H0CA 3JRWA 1QHYA 4OSOA 3K1TA 3KTAA 4YPVA 1N1EA 4V0QA 2ZT6A 2J09A 5B4TA 4X1IA 5EJ9A 4FDTA 4KGDA 5LQCA 1PNVA 1XELA 5GZ1A 1LJUA 1CU1A 2O2HA 3A1TA 2ZSFA 3NATA 1JR4A 4ZV4A 1Y3CE 4X95A 1BXZA 4D9IA 1Z8FA 3ZHVA 4D6YA 4ERXA 2OZVA 3SICE 3KYDB 5FHQA 1Y5NA 2G5TA 2JH3A 2NV2B 3CVOA 2G06A 4ALKA 1OZFA 4ZXFA 5FOQA 2GEFA 2IYEA 1H94A 5GZ6A 4B6JA 3VKGA 4J0JA 3M3DA 3BB3A 5LZ8A 3T7AA 3ZK9A 3ND7A 3QE9Y 1EJ2A 1IB0A 1WZCA 2NTVA 2X9GA 4BLPA 5F33A 2PXHA 2R5FA 1QGED 2LKCA 4BJ6A 4E12A 2D5LA 4HXYA 1OZAA 2GWHA 4Z8YA 1KETA 4ZVPA 3IE2A 2X0DA 1EFAA 4P7GA 3G17A 5ICFA 1VI5A 2GZSA 5E0KB 3THYB 1WB4A 2C1XA 5JZMA 2WUGA 4JEUA 4NI5A 2MT9A 4OGGA 1NNLA 4DUYB 1BYIA 1SUFA 1JG1A 1HDZA 4FFVA 5AJVB 1U3DA 4KR6A 3NKLA 3WL6A 1U3UA 3GJ7A 1A0OA 3PPVA 1XXLA 1RWPA 3BE4A 3KQLA 2FG6C 4JR0A 3OO0A 4CCYB 3DHVA 4R3NA 2HJRA 5CD1A 2R8YA 2RHHA 4TL6A 4ZQIA 5FBQB 1A9ZA 3NU1A 1JSXA 4ZYLA 3IEMA 3GJ0A 3GOHA 4QTTB 5K8VA 5LWQA 4KLNA 2FB9A 4PPYA 3SEQA 3OZSA 4BECA 4E4RA 4RDXA 1N36B 2FN9A 1E1NA 1W5TA 4EJSB 1Z5ZA 1YMVA 5JS7A 1W36C 1MOQA 3W5JA 4BU0A 1ZN8A 2HSJA 1SHUX 1CBUA 2DSNA 3IA7A 4O3FA 1FUEA 3EULA 1TM2A 3TMKA 2COKA 5KO2A 3CUWA 5FOVA 3RWBA 3M4XA 4FMBB 3UK6A 2AJLI 1YJBA 5C18A 2QTNA 1XJ5A 4TVBA 2JBAA 4BMXA 3FTEA 3AI7A 4W8HA 4JL8A 3FPGA 2JCXA 1RKUA 5JE8A 4XR9A 2Z5LA 3PUYA 2DBZA 2OM2A 3B60A 1EX1A 2FQ1A 1UZAA 2GFQA 1SOWA 2AB0A 4HXEB 5YASA 2A5LA 4FOTA 4ZREA 1OWNA 3DEYX 2GT1A 2FRVA 2SICE 1MW8X 3R74A 4P36A 4F06A 2WAMA 3VTZA 2NZXA 3IP5A 1FDRA 3VNQA 3AEKA 3GGJA 3HJUA 2BH9A 2FZ4A 3OLXA 3OZIA 3BH0A 3FNRA 2GXSA 3NH9A 1U80A 1NG9A 4KR7A 1YZFA 3RI3A 2I2XB 5ITZA 4DM4A 2IDJA 1IWBB 3P2KA 1YQXA 1KZ4A 3V8RA 1QFSA 5DHSA 1OFHA 2Z08A 4RA6A 5FBWB 3DG9A 1ZM2A 2REQB 1TYEB 3F8TA 4DG8A 3GWZA 3T5PA 1C7IA 3RIMA 2HWUA 1TVMA 5FYDA 1XMIA 5DHRA 2M6KA 4X1KA 4PN7A 2VJLA 1UH5A 3OOJA 4BV8A 2G40A 5GV8A 3FLBA 3UB2A 2JLYA 3P19A 1TAHA 3ZWXA 3RLIA 4AF8A 3G9ZA 1N5RA 1Y1PA 2RGAA 4UD2A 3NI2A 2ISCA 2X23A 2XJ9A 4M49A 4D0LB 4PIVA 4FT2A 3ABSB 2GILA 3JQ8B 4MKIA 3UWMA 2XCTB 2EW2A 3U37A 1RPJA 3R3YA 2CJFA 3I0NA 5IJ9B 3IWDB 4QJ3A 1ZVQA 1ZS9A 2CB9A 1P31A 5DTMA 2ZB3A 3T3IA 5JC1A 4LJ8A 3ZCXA 4HMPA 1BKSB 1CYDA 1SELA 2R1VB 3JS5A 3DR3A 1WB9A 5LLSA 5B3JC 2XMCA 3H8JA 5I9LA 1MABA 2MYUA 3H0KA 1VLVA 4LHVA 2E5WA 4IH9A 5EXDA 3EX7C 2Q3DA 5JXHA 1ELOA 1Q0RA 4MV6A 5EXPA 4CTJA 5KTPA 2QR3A 3ZPXA 5TVOB 4DV7B 2AOXA 5F98A 2O0MA 1P1JA 1US8A 2HSGA 5K0TA 3DYBA 4ETWA 4XJSA 2R1UA 3TL3A 4OEHA 4UPDA 1ZUIA 4JBWA 1GVNB 1HY3A 2HA2A 2NU7B 3VUFA 4J91A 4PWYA 1KMCA 4PAOA 5E6UB 2D2FA 2RKOA 4OHXA 2YNMD 3SBXA 1MU0A 5AKLA 3CF4G 3CX4A 3OCUA 2QYTA 1X86B 2FMHA 3BVPA 3H9BA 4YP1A 3QY9A 4FUQA 3SCZA 1G20E 1Y6JA 3G8YA 4JU9A 3T1VA 1FDIA 1JQJC 2HTEA 3C3CA 3RDPA 1ENZA 1XLTC 1ZD2P 4WBXC 3TRJA 3NKVA 2BGLA 5DP2A 3R7SA 5JT1A 2YXLA 1J23A 1IFXA 3FIUA 1Q77A 1ZMTA 2JGAA 1XLUA 1CB7A 3B6IA 1T3SA 3V5NA 5AHXA 1W35A 2ROQA 2QRKA 3BXEA 3NUZA 4J0DA 4PLHA 4RM3A 5DCWA 5HKAA 4GXQA 1FK8A 3MMSA 2BLLA 3NWJA 3A31A 1TQ6A 1UFRA 4H6VA 4S1PA 3EXHC 2C9BA 1GGFA 2NT3A 3R77A 4KLZA 1KJWA 4OK5A 3B6ZA 4UPVA 5TGDA 3WK7A 1LPMA 5B2EA 4PTLA 4BVGA 1F8XA 1B41A 3KJQA 3MB8A 2HO4A 2O52A 1YB7A 2PZLA 3W5VA 5CA0B 4QEKA 3SJCA 4PCAA 5DCLA 4HDNA 1C8VB 4F56A 1H5QA 5FV7A 4X1YA 2ZUSA 4HX5A 4YLYA 1XRJA 4QODA 1II8A 3FVRA 2V8OA 5EHIA 4A6PA 1F8YA 4EIWA 2P5YA 3QEBZ 4WZAE 2R4QA 3LCUA 4DR4B 3O84A 3MG9A 4P3XA 1LU9A 1MQSA 1ULHA 1HTTA 2OV8A 3K8OE 1RM0A 4J7XA 1KIFA 4DJTA 1LF0A 1TW3A 4M9SA 4ZDWA 1LKZA 5AI4A 3T7RA 1GRVA 3ZU5A 1AKYA 3DQPA 1IOLA 3PUWA 4R2KA 3AFOA 3FPHA 4P5PA 4S1VA 5FUYA 4LX8A 5J23A 1JKIA 2OWEA 1IY1A 2R6GA 4IIFA 4NV0A 1KOLA 1B00A 2AZXA 4TRRA 3ZLVA 1ZNYA 1QH8A 1M76A 4B35A 1BAPA 2H92A 4TYPA 3WKEA 3OJEA 3DKKA 4BEJA 5ALEA 4TL9A 1SXJD 3G0HA 2FMUA 1AVTA 3VJKA 3DKRA 4M9QA 4BQFA 2YHBA 1WQ1R 4GP9A 4RU1A 1BS1A 3TUTA 1BVYF 2FUNB 5K45A 5CBKA 5BN4A 2VJMB 1A8UA 1SIOA 4LC9A 4OXQA