1YL7A

The crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Dihydrodipicolinate reductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl7A01
3IL2A 5TIIA 4TVBA 3IMFA 1ZUD1 2Y93A 1HXHA 4PVDA 5CEFA 2WD7A 4NH4A 1I10A 1NXQA 3QRWA 1KC1A 3ZU2A 4WJZA 1NVGA 1VKNA 2VNAA 5FFFA 3ZH2A 1I36A 2BELA 3A4VA 4Q3BA 4NHEA 3DOCA 5F1KA 2PKQP 4R5HA 3ZV3A 4I9UA 3IAHA 1PWXA 4CMJA 1OOEA 4Z9XA 4PG4A 3RC1A 2Y68A 3AJRA 3ZWBA 3CXRA 3BZUA 1UJMA 3W6UA 5JC1A 2I67A 4KQWA 4R9RA 1DJNA 3CSDA 5BNTA 4CM1A 3LK7A 1AHIA 5KWEA 1T4DA 1SCUA 4LRSB 3VTFA 4UVDA 3L6DA 1A7KA 3PYLA 1NM5A 2P9EA 2X5JO 3EZYA 2DBQA 3C85A 3BYZA 3IOYA 4P4GA 2Y1OA 5BQFA 4AVYA 2PV7A 3RBZA 1ZH8A 2DPGA 1GYPA 3AWDA 3BHMA 1DFHA 4ZD6A 1VRWA 5JXWA 2DU8A 4IQ0A 1U2GA 1F14A 4JJIA 2GN8A 4R3WA 2JKVA 4CM8B 5ILOA 1K0UA 3DZGA 4NNJA 4BGIA 4RLSA 5DCUA 2VTEA 3PHIA 5JDCA 3EUWA 5JE8A 5CDUA 4O59O 1RPNA 4BO9A 1FJHA 4NFHA 1E7WA 1HDOA 1JWBB 4BNUA 2QHXA 2VUSA 1D8AA 3PJGA 3ZWVA 3RUAA 4FC7A 4TZTA 3OEWA 2NU7A 2Y66A 4IQGA 4RGBA 2CDAA 2D1YA 2DT5A 4YAIA 2P4HX 1HZJA 2PKRA 1K6XA 1NPDA 1WNTA 5G4KA 3V2GA 3ANLA 2C54A 1EUDA 3H6KA 3RD5A 1XWFA 3FBGA 4NK4A 1EZ4A 1YL6A 3KYBA 4XR4A 4LISA 3U62A 1GAEO 1GQQA 4CL8A 3ZNOA 3S2FA 1VSVA 2UDPA 1GUZA 2EERA 1YH3A 3PGJA 4YXFA 1SEVA 3GZNA 3ITKA 5CDTA 1R4NB 2YYYA 1NP3A 3GH3A 3ZWOA 4JJFA 3ZNPA 1JVBA 4A5OA 4E5KA 1TEHA 5J23A 1LDEA 4HP8A 4ALIA 1NQ5A 1B15A 1WAMA 3C24A 3GR6A 3KYDA 4FJ1A 3RU7A 3ZHYA 4D46A 1ENZA 4J90A 4P38A 5AVOA 1ADCA 1HEUA 4S3MA 1NHGA 5C3MA 3WIDA 4BO4A 1ZNQO 2GYYA 3B20A 1R12A 4AJJA 4IQ8A 2EGHA 2QZ9A 3WSWA 3I3OA 1YQGA 1PJBA 4MKRA 3WFIA 1JA9A 3IIEA 3L4SO 4BKOA 1XDWA 3PDJA 4BO0A 2Y1FA 4K9DA 4D0RA 4J3FA 5G2OA 1ULSA 3LT2A 4CM4B 1JAYA 4DPMA 4DTIA 5BSHA 2EP7A 1ZEMA 2FPPA 2VQ3A 3GGOA 1YBMA 4XKJA 1R15A 1IZ0A 4NDNE 2CDCA 4OL9A 4HWKA 2C7GA 2Q4EA 1N7HA 5L4SA 2A9FA 2HQ1A 3RC9A 1GY8A 3LT0A 5TGDA 4RPGA 5LDGA 4MKZA 4XQEA 1NQOA 3B1FA 3DBRA 4M87A 2CSUA 1HDXA 3TL2A 4D44A 4CQMA 1JW9B 1Z74A 1ZBQA 2PY6A 3IJRA 1G6KA 3JCZA 3E9MA 5CHEA 2HK7A 3MCVA 3WJAA 3LLSA 2VHXA 4BKQA 1I3LA 2B4QA 1ZSVA 3ZN2A 2DFVA 4RZIA 2PA3A 2ZCUA 4YRDA 2J6IA 4CUKA 3D3WA 3PLRA 2ZYDA 4M54A 3V1TC 3WBBA 4AJ2A 5DNAA 4FFOA 1BHSA 3WGGA 4XRGA 5G0VA 3VZPA 1WLYA 2LDXA 2WYWA 3A14A 3PIIA 4B8ZA 1GYQA 4JROA 3WMXA 2VHVA 2DBRA 1T1RA 1NWHA 3I1JA 2PH5A 3WGHA 5U4QA 2WD8A 5A9SB 5I7SA 4YRBA 1RYEA 2ZIZA 5DCWA 3JQBA 4AJLA 4IJKA 3SLGA 1GCOA 4JBGA 3WQQA 5ILGA 5I8WA 1H6CA 2PWZA 3JV7A 4DC0A 4NBWA 4OJNA 4P4LA 4Q3AA 1SOVA 1Z82A 2BGKA 5COBA 4CQMD 5T8KA 2HMTA 1RKXA 4OXYA 2ZB3A 3WYBA 4Q9NA 4S1VA 3JQAD 2Q2QA 3PHJA 5B4VA 3WGQA 5U1PA 1DLIA 4BKUA 3JD2A 2CF6A 4BV9A 1NPTO 3S1LA 4P4NA 4JIGA 4RPLA 2Q1TA 1E7RA 4EDFA 4R54A 2BI8A 3EZLA 4GGOA 5H82A 3K2EA 3B1KA 1WZEA 3N58A 4Z3KA 4QXMA 1R4MA 3NT2A 2ZCVA 4R41A 1E6WA 1HSOA 3U4CA 5ER9A 2YY7A 4L75A 3DTYA 1EVZA 3K9QO 2NU8A 4FQ8A 1HETA 5DOVA 2E48A 1E1NA 1J49A 1RJWA 3DO5A 3D3EA 1R66A 2X0IA 3NTOA 3Q9UA 3UXYA 5A4DA 2O4UX 4CMIA 3ZI0A 4PG5A 3K96A 2HMUA 3QJ5A 2WM3A 4WEQA 4I9NA 3WQRA 3RKRA 5C5IA 4GX2A 1UXHA 3NTRA 1JVSA 1Y6JA 1C1DA 1W4ZA 4QO7A 3RC7A 4J43A 1QKIA 2VTDA 3RUCA 4ALMA 3DZBA 4XIJA 2JL1A 4K6CA 2J5RA 1VJTA 3D4PA 4BKRA 1VPDA 4J1SA 4Y98A 2V6GA 2O3SA 3BXXA 3IS3A 3FWNA 4I9HA 2RCYA 1ISIA 4I5FA 2IDZA 3OJ0A 1TA4A 5L40A 2PGJA 1KEPA 1H0KA 2Y1DA 2UVDA 4ALKA 4LCJA 4DLAA 4WOJA 3X2FA 4HFNA 2FSVA 1IY8A 1JKIA 1HE4A 1D1SA 1XQ1A 2I6TA 4D42A 2O4CA 5C7LO 3ZNNA 1O94A 3R1IA 4RF2A 4IGEA 3SXPA 2W4QA 2ILTA 5BSEA 1JDJA 4AJKA 5L51A 1EE2A 4XGKA 2O2SA 3BTUA 1LNQA 1X14A 4MPDA 2V65A 4W9NA 3A1NA 1T26A 1DHTA 1WXDA 2RH4A 1LBEA 5ICMA 2HAEA 5TT1A 1B14A 3WX0A 4DLBA 5KJ6A 2J3JA 1A4IA 3HZZA 5L7WA 3VPXA 1NR1A 4NJMB 4IDFA 2IODA 1DRWA 2B83A 2ZK7A 3QWFA 4URFA 3WG9A 1K5HA 3ZWXA 5DF1A 1P1HA 1RM4A 5G0UA 5GZ3A 1PR9A 5J9GA 2C7VA 2YDXA 3VPFA 1PSDA 5IXSA 3BMQA 3K5PA 1MP0A 1UXJA 4NR0A 1I01A 3GC6A 1D7OA 1Z7EA 2G1UA 2ZTMA 3JQ9A 4DBVO 4WASA 2UAGA 3PJDA 1FMCA 3RJ5A 3K31A 1QORA 2WWRA 5IDWA 1I5RA 1ZO8A 3AY3A 3HFGA 4FD3A 4OQZA 4WOKA 4MINA 1HTBA 1XHLA 2X6TA 4E5PA 1VL8A 3WS7A 2QZZA 4XB1A 2RH8A 3Q11A 2C5EA 4BNIA 2NU9A 2FRDA 3T7CA 4FIZA 4HKTA 3AFMA 1JKJA 5F5LA 3TFOA 3HDQA 4F46A 1LXCA 2EG9A 3HNPA 3V1UA 2NVUB 1PS0A 3G79A 4JBHA 1B16A 5KIAA 3OECA 1CDOA 1S6YA 4M89A 4ZQEA 2Y1CA 1YBVA 3MJEA 4O5OA 4E33A 1PL8A 2D5AA 1LRLA 2X4GA 3NJ8A 2Y99A 1BXGB 4QECA 2C29D 2OMEA 1F8FA 3RFVA 3KLPX 2CF5A 4IDGA 3SC6A 3HFSA 1J4AA 4DMLA 1QLJA 3OEYA 4YACA 3SJ7A 3R6DA 4E5NA 4WLOA 3W8EA 1WP4A 3BMNB 3PK0A 4GKVA 1MV8A 4IDDA 1E3WA 5IDXA 2HCTA 2R6JA 4KUHA 2B5WA 4KWIA 2OORA 4K28A 3F5QA 4AJEA 4ALLA 4MKXA 1PJQA 2X1HA 4L76A 4IS3A 3FNEA 2Q1SA 4BNHA 1XQ6A 1YQDA 4CJXA 1HYEA 1UXKA 4CR7A 1PJ3A 4R5MA 4XYMA 5CPFA 1VJ0A 4BNVA 1IHXA 4CQLB 3WDSA 2GSDA 3DFUA 3JYOA 1RM3A 1YDEA 1C0PA 3ANMA 1PJCA 4RDIA 4JXKA 5DT9A 1P77A 4II2A 3INGA 1NHWA 2A94A 2JHGA 1LI4A 3G49A 2VZ9A 3VH2A 3ZWWA 4CMKA 4J91A 4XJTA 4Y6PA 3U5TA 1T2FA 1RM5A 1LDYA 1E6UA 5TRTA 1U4OA 5CEEA 4K6FA 1ZJZA 4EJ6A 1C0LA 4IJVA 1HYGA 4J16A 3I9KA 3QP9A 3I83A 4BMVA 5JDCC 3H3FA 5A9TA 3AOEA 2VYNA 3HUDA 4M49A 1SAYA 2FSSA 5COQA 3GZNB 3V8BA 3NDRA 3LC2O 4JGBA 1T2DA 3UAGA 4WCDA 2PD4A 1DB3A 5LCXA 1BVUA 1KEVA 3OJOA 1BW9B 2VWQA 4TWRA 5TSDA 3JQ9C 1YL7A 3DQPA 1WPQA 1NX6A 2BHLA 5B4UA 4G5HA 3AY6A 4PRKA 1C0KA 1TXGA 1PGQA 1YOVA 3FTNA 3JTMA 5A3JA 4W7HA 4ZQGA 4IBOA 1A72A 4PLYA 1ONPA 2XOXA 1SC6A 2CVZA 1B2LA 1HZZA 2PD6A 1ZXLA 4Y6RA 2GO1A 3L4BA 3WLEA 1GZ3A 5I9NA 2GLXA 3JYLA 1S7CA 3H5AA 4HFJA 4YJGA 2IEBA 4E6PA 2ZATA 4IZIA 4CQMB 3FNGA 3LSYA 2WYUA 2GDZA 4YPOA 1D4FA 3RVDA 3FPCA 5L7TA 3L77A 4JP3A 4BOYA 3R3SA 5JMPA 2FOIA 1V3TA 1HDGO 4AG3A 4W6ZA 1I2BA 3AOGA 2C5AA 2OL4A 1QYCA 1WMAA 3S8MA 1MB4A 1PTJA 3E9QA 4WCFA 4E4YA 1BWSA 2VYVD 3HJAA 3E18A 1EK5A 2OOSA 3H9UA 3OQBA 1E6EA 4E31A 2FR8A 2GR9A 5T5QA 4DYVA 3KV3O 1LC3A 4WNIA 5A06A 1E3WB 1I8TA 3AUAA 3DBLB 3KBOA 4XYGA 2P5YA 4KTTE 4RVSA 3HQ4O 1XSEA 1DFGA 4XYBA 4I08A 3LT4A 4M8SA 4Q3DA 4ZN6A 1IL0A 1X7HA 2EGGA 5TNXA 5DCYA 1V8BA 2EP5A 4Y6SA 2JHFA 2FZEA 4RPKA 3TJRA 2WE7A 2IE0A 1BXGA 3INRA 1MA0A 1B8UA 2E49A 1DIGA 2EF1A 3KHUA 1ML3A 4FFMA 2HSDA 4GL4A 3G17A 5U9CA 3KYDB 1V9LA 2YV1A 3D1LA 1Q0QA 4ND2A 2W98A 4CLOB 5EINA 1PS8A 1ADFA 3EVNA 2DKNA 5CEJA 3GEMA 3GGPA 4BNMA 3ZU4A 4EUHA 1R6DA 9LDBA 4PCVA 1EBUA 3OETA 1NFQA 4U0JA 4BNTA 4DWVA 3G0OA 4OOFA 5AXCA 1E7MA 4BGEA 1Y9EA 3NTQA 2R2GA 4YAKA 1DLJA 2H6EA 3F1KA 2OZPA 1PGJA 3H9JA 3WNQA 4J4TA 3TF5A 1AXGA 3C1AA 1T2CA 3PLNA 4DPKA 3O8QB 3TOXA 2BGMA 4WPGA 3JQ7B 5KKCA 2C20A 5K6AC 1QYVA 3TL3A 4IDEA 1IPFA 4J0FA 3S2IA 1H2HA 4K1LA 1EMDA 2W2KB 3GN1A 3K92A 4R51A 5ER6A 3RUIA 1VL0A 1A5ZA 1UXGA 2QQ5A 1GD1O 1PS9A 3RQSA 3KSZO 5I8ZA 1UH5A 1Y5MA 1TVEA 2YFQA 3GRKA 2HK8A 4L4XA 3ENKA 4CV1A 5KJFA 5DP2A 3O4RA 1P45A 4Z3DA 3QY9A 2NV6A 4AJ4A 5F1OA 4F6CA 5JYAA 4KWHA 1WW8A 1K2WA 4EI2A 4N5LA 3GNQA 1CF2O 4KDEA 3BMNA 3RBXA 1I3NA 2D8AA 4FOSA 1FDVA 2QRKA 1GR0A 5L4LA 1VC2A 1I2ZA 2B35A 2NADA 3F4LA 5A5EA 4JX8A 3NRCA 4CLDA 1N1GA 2NACA 1YB4A 3NGLA 1Q7CA 4UUMA 1HE5A 5CDGA 3PVZA 1PJ2A 1CWUA 3NKLA 4RVUA 4QO8A 2NTJA 3AU9A 4TKLA 1WDKA 3TN7A 3FI9A 2BFAA 4ND5A 3E5RA 3D7LA 4TMFA 2Q49A 4IXTA 4QTZA 5IZCC 4B4UA 2JJYA 2B69A 2GERA 2C59A 3ZDFA 2R00A 5DZSA 1MXFA 3JQGB 3UN1A 2I99A 5A5FA 5DOZA 4R4JA 1GYRA 4WLFA 2VHWA 1GZ6A 3GPDG 4KP7A 4MIEA 2Q46A 1DC6A 2BRUA 4FN4A 5JNLA 4RDHA 3ULKA 4A03A 1WMBA 2E4AA 3C7CB 3D4OA 3LQFA 4MP6A 2C0CA 5EESA 3SC4A 1JU9A 3HG7A 5KNLA 1LLCA 2D5CA 3GVPA 4UUNA 1I3MA 3TNLA 1XIVA 3UKOA 4GX0A 5JY1A 3BMOB 1YL5A 2X8LA 3ZHZA 5JSFA 3WJ7A 4H16A 1D3AA 1PIWA 2HUNA 3PHLA 4AJPA 3RKUA 3COSA 2DAPA 1QYWA 3DBHB 2X0NA 3VH4A 1A71A 1LEHA 1NYTA 2AMFA 3QVWA 4QFDA 4DGSA 4YRAA 1VKOA 3GHYA 3UVEA 4YR9A 1P44A 4YVFA 5JW6A 1PL7A 2I76A 4IDBA 4U5QA 3O03A 1X7DA 3AUSA 1TT5A 1O9BA 3RI3A 2Q3EA 2ZTLA 3ZNQA 4GBJA 3L07A 4XCVA 5IN5A 3ROQA 4TKMA 2VWHA 3H8VA 2V6BA 4J4HA 1SPXA 1YKFA 4FS3A 3OHSX 4OXNA 3NYWA 1MG5A 2UUPA 2JD2A 3LT1A 4YQZA 4Y9DA 3GZ4A 2VUTA 1ZMOA 1PEDA 3PFWO 3HDHA 1ONNA 3KEOA 2AEFA 4KQXA 5IDYA 4CM5A 1BMDA 3DMTC 1E3IA 4R16A 1O0SA 5JCJD 1SB9A 4ILKA 5GZ6A 4CLRB 2YFHA 3S55A 4XWYA 2EJVA 4I5EA 3TZHA 4HY3A 1B3RA 5HA5A 1ZFNA 4J1NA 5BR7A 4RV9A 5JYDA 3DHEA 4EUEA 1I3KA 2JD0A 1AE1A 4MP8A 4FGSA 3PWZA 2VHZA 1FK8A 4UVIA 2HRZA 2NUAA 3UOGA 5EERA 2BFOA 5T8KC 5C7IO 2FZWA 2NLOA 3NEPX 4R1UA 3RROA 4N5NA 3RIHA 4YT4A 2PGDA 4EYEA 1PGNA 3W8FA 5CDYA 1PQWA 3C1TA 2PZLA 4ZQBA 1A27A 3KVOA 3T4EA 1C1DB 3GVCA 1A9YA 2X58A 2VZ8A 1MUUA 4WUVA 4XB2A 1YS4A 1JLLA 1YWGO 1LJ8A 1NAIA 3DEYX 4BO8A 1I30A 3GMDA 5IAAA 4FW8A 4AJNA 1C14A 2PTGA 4QEDA 4HADA 1E7QA 4BO6A 1KOLA 3K30A 2A92A 3H5NA 2PH3A 4E21A 1ZSNA 1UP7A 4R68A 3QVXA 5TF4A 2JD1A 2WYVA 2PKQO 3ADOA 1ID1A 4XIYA 5TS3A 1YGYA 3PYMA 1Q7BA 2GD1O 3DAPA 4LVUA 4DLLA 3SX2A 3X2EA 1GFSA 2FPGA 4EJ0A 3WGTA 1KETA 2RHCA 4ROSA 3BTVA 4B3IA 4RL6A 2XXBA 4C7JA 2BFPA 3B1JA 4IINA 1P1JA 1LU9A 5KJCA 3U4DA 1OI7A 3VH1A 1RM0A 3E48A 3OJEA 5EPOA 3GG9A 3A9WA 4BNJA 4BNNA 3AOEC 1ZCJA 3WGOA 3DTTA 1ISGA 2UUOA 3JYNA 4R9SA 3ZWYA 1Z73A 3OJFA 3WQSB 3DHYA 4YAEA 1UDCA 5GMOA 3PEFA 4YB8A 1Y5RA 2HMSA 3F5SA 3HB5X 3ZV6A 1BDMA 3JSAA 3MJVA 2P91A 2FMUA 3U9LA 2BI7A 4E30A 3CPSA 1LA2A 4J2OA 3PHGA 1CRWG 4LGVA 3IJPA 4RQUA 3ASUA 3GNTA 1IULA 3GVXA 3S2EA 3PYXA 5I9MA 1GQ2A 1O6ZA 4GLOA 3M1AA 4RVFA 1GCUA 4YDRA 5EJ2A 1DXYA 2DQ4A 1X15A 2IXBA 2X7HA 2ZB4A 1ULUA 1LUAA 2VN8A 1V3VA 3M6IA 1U3TA 2IRWA 3QLJA 4WK6A 3PQFA 3JQ6A 2VUUA 5LDHA 3PJFA 1LLDA 2P4QA 5A9SA 2EKQA 1AGNA 5ES3A 1R4NA 4XEHA 2VT2A 1DBVO 4NG5A 5ITWA 1E7YA 4KUGA 1OMOA 3OP4A 3DB2A 2FY8A 4XYEA 2D2IA 1W8DA 3DAGA 4IDCA 3ZU3A 4OO3A 2AG5A 3PPIA 4B7CA 4D3SA 3E03A 4Z0TA 4ID9A 2D0IA 4Z0HO 5AYVA 3F47A 5BNFA 4R1NA 1KVTA 3TZCA 1ENYA 1XR3A 3LLVA 3MWDB 3V5NA 3OMLA 4XZ3A 2D3TA 2P5UA 3FTPA 3RCBA 4RF5A 4OHUA 2BF7A 1UDAA 3ZWPA 1UP4A 3OIDA 1DRVA 3A06A 1HL3A 3RASA 1EQ2A 2JAHA 3DBRB 5H81A 2VYND 1HLPA 3JQGA 3AM3A 4AJOA 3BTOA 3KSUA 1P1RA 3ZZNA 2X22A 4HXYA 5DULA 5HBRA 3PP8A 2VYVA 2FR1A 1EVYA 2F00A 4QSMA 1E3LA 1RWBA 1UDBA 3U4IA 2PD3A 1GEEA 3DWFA 4CLHA 1M6HA 5B12A 1NPYA 3AUTA 3E9NA 2CFCA 3CINA 3WICA 1C0IA 2P9CA 2Y0EA 3WGIA 4PG7A 4M55A 3EY4A 2WSBA 4GAEA 4MOWA 4CM9A 2NTVA 3CUKA 1CEQA 2Q1UA 4BMNA 3Q2IA 4G65A 3CZMA 4XGIA 4D45A 4F6LA 2WJPA 3RBVA 2FN7A 3FNFA 4B3HA 5JDIC 4ZICA 3HADA 3PZRA 2IXAA 1PWZA 5IXYA 4OKIA 4UAGA 4IJWA 4BO2A 1CIVA 4PGFA 2W8ZA 4Z9YA 3DC2A 3GY0A 4BS9A 3P2YA 2AE1A 3EMKA 1AXEA 5A04A 4ZU3A 1G0NA 4BQPA 4ZRNA 4EBFA 5KVSA 5T67A 2C2YA 3GK3A 1W6UA 4QX6A 5EIOA 2EV9A 4IUYA 3ZV5A 1R0LA 2J8ZA 4WLNA 3GAFA 1IYZA 5A9RA 4RVHA 4BQRA 1DSSG 2X5OA 3ABIA 3OA0A 1MFZA 4GVXA 3WNVA 5DBIA 1M2WA 3PXXA 1KY4A 3JQ7A 3BMOA 1EUCA 1DHRA 1F17A 2YW9A 4IXWA 4E32A 2CNBA 3FD8A 1T2EA 1NR7A 5THQA 3I4FA 2IZ0A 2AXQA 1KBZA 4XQGA 1DIRA 2UYYA 3O38A 2TMGA 1JKFA 4L0QA 3MEQA 5CAEA 2YHIB 5HWSA 1MX3A 1ZVMA 3JD0A 3QIVA 1IB6A 3KRTA 2V6MA 4CM8A 1ZSYA 3IUPA 3RAJA 4BNXA 4A0SA 1PZGA 3C7DB 2G5CA 1Y8QA 3TPCA 3WOHA 3FBTA 1D1TA 4HX5A 1YJQA 1O89A 1B7GO 4CMGA 4J9VA 3RUHA 5ITVA 2OBYA 1N9GA 3Q2KA 2NNLD 4R1SA 4EEZA 3CTMA 2QIOA 1UAYA 3GVHA 2Q1WA 2FP4A 6LDHA 3KM0A 5AXDA 2XPCA 4XR9A 1TB4A 5JAMA 1ZMTA 2O3RA 3QWAA 1U8XX 2Q99A 1DOHA 3P7MA 1BSVA 2CVQA 4DQVA 4AJHA 3ITDA 5I9LA 1O8CA 4ZVVA 2DFDA 2NM0A 2I65A 4HFRA 3UCXA 1BDBA 2Q45A 2WDZA 2EKLA 1ARZA 1XCBA 2RIRA 1N92A 2DBVO 5JO0A 4MVJE 3N74A 7MDHA 3F9IA 4WCFB 3W4JA 2CVOA 2Y1GA 2Y0CA 4YBZA 1GTMA 3JQAB 4MVJA 2E37A 4BGVA 4EITA 4RLHA 2Y1EA 2GZ3A 2TMDA 3AW9A 3D0OA 1K6IA 1A7AA 1B3BA 1E3SA 2IEDA 2O3UA 1U28A 2J3KA 3E82A 2ZB8A 1XA0A 2QRLA 3ETGA 3FRJA 4IMRA 3VZRA 3ZW8A 4D7AA 1X0XA 3QQPA 2GZ1A 1R37A 4D3FA 1E77A 4O6VA 3W6ZA 4J6FA 3I23A 4MJLA 5KCZA 3I9NA 3ONEA 1IOLA 2DM6A 1IPEA 3PRJA 4BNFA 3KZVA 1XEAA 4UEOA 5COAA 5JYEA 3Q1LA 2YQ4A 4D41A 2HMWA 3KB6A 1ENPA 1SO8A 4XA8A 3M1LA 3T7EA 3WTBA 5K0ZA 4UREA 4YTEA 1GL3A 5C7OO 2OUIA 5CFZA 1Z45A 3VZQA 4B79A 4BV8A 2GUGA 3P2OA 3PI7A 5THKA 2HRBA 5JMWA 1GPDG 2DTDA 2IZ1A 1HDRA 1MG0A 3IQDB 3KETA 2PZJA 3ZW9A 4J4BA 4YCAA 4GKBA 4PG6A 2E82A 2I3GA 3R3JA 3W1VA 4IJUA 1LSOA 4OSOA 1U2DA 4OAQA 4YT5A 4Z9FA 1XKQA 1VJ1A 4GH5A 3OBBA 4RF4A 1ZK3A 1FF9A 2BGLA 4DBZA 5AXBA 4WE3A 1HDCA 3GGGA 2FWMX 4INAA 4U6QA 4NBTA 4E0BA 3U49A 2C07A 1EK6A 1Y8RB 4IDAA 3L4BC 3U3XA 2NQTA 2JAPA 4GSKA 5I7EA 3TFQA 4PG8A 1TLTA 3I6QA 3NAQA 3SBOA 2VRCD 1DC4A 3VAZA 3DHNA 2VWPA 1X1EA 3Q3CA 4YT8A 3WB9A 2GCGA 1HDYA 3CIFA 3MOIA 1XU7A 1QP8A 1F0YA 3W4IA 1GU7A 3OQ1A 2VOEA 3BHIA 4DC1A 4N54A 3H4VA 3K6JA 1KVQA 4OMUA 2QYTA 4WGGA 1YOVB 2V6FA 4B7UA 4CODB 5L7YA 1LQTA 5HS4A 3PQDA 5CP8A 2EXXA 4K26A 2YZ7A 2QX7A 5ENVA 3OM9A 3EK2A 4KMSA 1DIAA 5IZ4A 3DDNA 2NVUA 1SBYA 1KIFA 5F3RA 4BO5A 5GZ1A 4DRYA 3QWBA 1QYXA 3LYLA 1PR3A 2VZ0A 3EHEA 2VOJA 5BT9A 3KXDA 4JJGA 1HRDA 2CDBA 5BSFA 1T4BA 1KEUA 5CDSA 1YVEI 3C8MA 1HE3A 4YAGA 2O3TA 1XELA 1EQUA 4PFJA 4RPHA 3VPHA 4U7WA 1LRKA 4BKPA 3WGZA 5F5NA 1P74A 1J0XO 1DC3A 5F1PA 4NFYA 1AUPA 4BNWA 3GMSA 4WLEA 3IKVA 4A2CA 3F46A 4PLHA 4YYZA 2QW8A 1H2BA 2AQ8A 3C7AA 3W4KA 5BNIA 1JN0A 3ZWMA 1V3UA 1GV1A 4DREA 3ETDA 3JD4A 4LRTB 2DTXA 1LTHR 4CLRA 2G82A 4FDAA 4N7RA 2OBNA 2Z1NA 4CV0A 3VPGA 4E2WA 2ZJ0A 1UZNA 2X9GA 1MC5A 4FJ2A 4NJMA 1EFKA 4OOEA 4B3JA 1FDUA 3FN4A 4GX1A 4YAJA 4XYLA 3OH8A 3PWSA 4PLTA 2FPIA 5AOVA 2PNFA 3HB4X 8LDHA 4A26A 2DC1A 3OICA 1YONA 5FEUA 5IJZA 3NDIA 2CD9A 3HN2A 1ZK0A 4JLWA 3BHJA 4IGFA 1T2AA 3VZSA 5KTKA 3MJCA 4L8VA 1E1LA 2O3QA 4RPJA 4TRJA 5I7FA 1C1XA 1YRLA 3T4XA 4CUJA 4XRRA 4IM7A 3L0DA 1PJLA 2JCXA 4QT0A 4EGFA 1DPGA 5FI3A 1KVUA 4TSKA 1UZMA 3MTGA 1H6AA 4CL3A 2O50A 1YDWA 5JO9A 4OQYA 1E3JA 1OAAA 1XGKA 1PX0A 1R0KA 2NSDA 4NJOA 1ONOA 4W99A 5EQDA 3WFJA 4CMEA 3G1UA 2Q50A 4OIMA 1AHHA 2G17A 4LK3A 2Y05A 4JP2A 3DMYA 4ZJUA 3VPSA 3GNSA 3IC5A 1NNUA 3JQ8A 3VVCA 1OC4A 4CV2A 5L95A 1U5CA 1Y9AA 4J7XA 4OH1A 1N2SA 3VTZA 1PQUA 4B7XA 5B1YA 4P8RA 4PN3A 3BMCB 3EW7A 4IIUA 3QWIA 1NQTA 4O0LA 4NI5A 2A35A 4BB6A 2B37A 4CV3A 1LQUA 3WWZA 1NVMB 1O95A 4E13A 3GPIA 2H63A 4GQAA 3I6IA 1U8FO 1OZAA 2PLAA 3F3SA 3HHPA 3KLMX 5K9ZA 2HDHA 1V35A 2OGUA 2DTEA 1KERA 1PZEA 3BMQB 1KC3A 2DUWA 3Q9NA 3GG2A 5JLAA 3JD3A 2EIHA 2LDBA 3D5QA 5F21A 4BNGA 4MVJD 3DFZA 5DP1A 5A03A 4OYRA 3DOJA 3LVFO 4CMCA 4XQCA 3WWYA 4KUEA 1Y81A 4LSMA 3ONDA 1LSJA 4IY1A 4KTVE 4RJTA 4DYDA 1VL6A 5IDQA 3PHHA 1GEGA 4ND3A 1N5DA 2JCYA 2W90A 5TQVA 3VVBA 1NTOA 5G4LA 1EE9A 2VRCA 1NBOA 1ISFA 1I2CA 1PGOA 3GFGA 4X54A 4ND1A 1MGOA 1E3EA 3WLFA 1T24A 1O5IA 1YJ8A 1A4UA 3L6EA 5TJHA 3ZWCA 1PJSA 4HFMA 2DVMA 4DIBA 4DMMA 2C2XA 1R0SA 2X23A 1GUFA 2YUTA 2JFFA 2BH9A 4MVJG 8ADHA 2W2KA 1IZ9A 4I1IA 1PJ4A 2BFMA 4J2HA 4BNLA 3ROKA 4NMHA 1L7EA 3CZRA 3AY7A 1E5LA 3HE3A 2EW2A 4PLWA 3GN2A 3NDJA 4II3A 2WMDA 4ZGWA 1QV6A 3WYEA 3NJ4A 3JQ8B 4E2ZA 3JQCA 3KYCB 4CMAA 3M2PA 4AICA 3WR5A 2FR0A 2EW8A 4BL5A 3IUSA 5JBIA 5FF9A 1MC4A 4E5MA 3O9ZA 1W0CA 2Y0DA 1HT0A 2JFHA 3MTJA 2DBZA 2Z1MA 4RF3A 4ZA2A 3SVTA 4PZEA 3PFFA 5DDIP 3QW2A 5AQ1A 3E1KA 3OIGA 1NWCA 1E0DA 3B6ZA 1GUYA 2ZTVA 3GDGA 1DO8A 4JQCA 1PZHA 3NT5A 2HLPA 3GUYA 4HNGA 1LDMA 3MJSA 3UW3A 1ZXBA 7ADHA 3ON5A 4NU6A 1R4MB 3RFTA 1P1KA 4LSWA 4J7UA 4A73A 4PLFA 3EC7A 1T25A 3DBLA 3UHAA 5A02A 1LDNA 1EEHA 2C82A 1KS9A 1JTVA 5KJEA 1F06A 2I9PA 4TZKA 3JQEA 4FPXA 5LC1A 3GA0A 5JY6A 2Q22A 3QVTA 1HWYA 3G1TA 4FJ0A 1V6AA 1PL6A 4WECA 3AI2A 4H3VA 2R00C 1LLQA 1U3VA 4TVOA 4Y8VA 1Q2XA 1P3DA 4W7IA 1Z7BA 2GN4A 3PJEA 1K89A 4PLZA 5IZCA 3FCOA 5L9AA 4BB5A 4I8XA 4U6SA 4BNKA 5C37A 1HSZA 4O1MA 3K2BA 3AI3A 1ADBA 4FBGA 2NWQA 4GWKA 5JPIA 1FDTA 4MVJI 4YJFB 3TRIA 1I32A 3H3JA 2RAFA 4IZHA 1CQIA 3ICPA 5JAQA 3TZKA 3AK4A 4AJIA 1BGVA 3OA2A 3L9XA 3ONFA 4HUJA 4YEDA 4L73A 3ZU5A 3GFBA 4ALNA 4BNYA 3GOHA 4LMPA 1U7TA 2G0TA 5HS6A 3CKYA 1BW9A 4J49A 3R0IA 1G1AA 3VKVA 3NT4A 5A3VA 5GY7A 4PRLA 4U8GA 3MJ4A 3RUDA 3QV1A 1SNYA 1P1IA 3ZV4A 4KDFA 4BO3A 2QYSA 2ZTUA 1SB8A 4A27A 5A05A 3MJTA 3K8ZA 4MO2A 2P2SA 3JQFC 1H9AA 4CLEA 5EQFA 1UP6A 4FR5A 4ITUA 4CLOA 4AJ1A 2HU2A 4XJSA 4TRMA 1BG6A 3CH6A 3GEDA 3AU8A 1DIBA 1NASA 4UEKA 3W8DA 3D64A 3STHA 1M76A 4FC6A 3TDKA 2EEZA 3TZ6A 4GVLA 4U0KA 3MZ0A 4HV4A 2O7SA 1A9ZA 2HJRA 4DIOA 3ICCA 1B0AA 4JCOA 1NFFA 4L4RA 3NGXA 5KVQA 1L7DA 3ORFA 4C7KA 3PDUA 3UCFA 1KVSA 2OXIA 3U09A 2DPHA 4NBVA 2X5KO 1PU2A 1E1MA 1E92A 1H6DA 4YJHB 3JQAA 1DAPA 4GSLA 4J7CA 2OHXA 1Y8RA 2GN6A 2EKPA 4EJMA 2P9GA 3M2TA 1F12A 1KY5A 4FFNA 1U3WA 6ADHA 1HLDA 2Q2WA 4YA6A 1J5PA 2VNSA 4LMRA 4YJHA 1VLLA 1OC2A 3VDRA 2AG8A 4CR8A 3DZKA 3C3XA 4RCVA 4CM4A 3EDMA 4DVJA 2O23A 4N18A 3KTDA 3WXBA 3DBVO 4A7PA 1GDHA 1NVTA 4PZCA 4YJGB 5IG2A 3DAFA 3U0BA 1I0ZA 4GMGA 1NQAO 1SMKA 5EL0A 2VCYA 1GV0A 3NV9A 2AEJA 5HRUA 2W2LD 3NX4A 4EUFA 4QQRA 3TOZA 2VWGA 4LCEA 1OFGA 1ZZEA 2BLLA 4ONEA 4WKGA 2A4KA 1BXZA 1ZK4A 4FGWA 4UUPA 1LDBA 2ZYAA 1U9JA 3V1YA 1WWKA 3ASVA 2SCUA 1UZLA 5TLSA 1B8VA 1IE3A 4DXHA 4WLUA 1KEWA 2GZ2A 3GLQA 4HBGA 4L4SA 4XD2A 1DEHA 4R3NA 3KEQA 2AHRA 1LRJA 5TJ9A 2AQIA 1FDWA 1I24A 4QUKA 4WCFC 4Z0PA 3RJ9A 3UICA 3Q0EA 1YB1A 3ROMA 2AQKA 1ZK2A 1WDMA 2EJWA 2OFPA 2PGLA 3MOGA 1YE3A 3Q6IA 4BHTA 3AI1A 4I5DA 3JYPA 4BMSA 1E1KA 4LVCA 3H9GA 3H65A 1QXSA 2ZYGA 2DLDA 5G4KB 1XYGA 4FB5A 2ET6A 4RZHA 2NTNA 2I3AA 3I52A 2B4RO 4IMPA 3OJLA 2HK9A 3P5SA 3H2ZA 4MP3A 4F45A 5IN4A 4YJFA 2D4AA 2Y67A 3HN7A 1MLDA 1HDZA 1LDGA 2X0RA 1H93A 1DFIA 3I4CA 1B26A 4XX0A 3SJUA 3IKTA 3CMCO 2BMAA 3F1LA 3UUWA 4CQLA 2O48X 2NU6A 3F4BA 4QFCA 2XXJA 4WEOA 9LDTA 4CMEC 2J5KA 3OF2A 3GF4A 4BGUA 2IYOA 5ADHA 1GZ4A 2JCVA 2YDYA 5HTOA 5H83A 1BTOA 4B8WA 2AEMA 5EN4A 4E2XA 2AQHA 3WGYA 1WDLA 1QRRA 2B0JA 3GUCA 3H5RA 3PWKA 3FNHA 3PIDA 1ORRA 2B5VA 1ISMA 3LDHA 3FSRA 4FFLA 1I33A 5DN9A 2NQ8A 3FHLA 4OGWA 2ZQYA 4W4TA 4PZDA 1CYDA 4CM7A 5IFLA 1KYQA 2ZKLA 4YWJA 1DC5A 2VRBA 3CE6A 3VC7A 2EWMA 1Y1PA 3L6OO 2AE2A 1VM6A 1JQBA 1U7HA 3JYQA 5G0WA 4WLVA 5JS6A 5B37A 2D59A 1U5AA 1N9GB 1FDSA 2OP0A 4IPTA 3GEGA 4MVJM 4YT2A 1XG5A 1J6UA 1QLHA 3BMCA 4UVHA 4B4VA 2VHYA 3D4NA 4Y67A 4OKNA 1UAGA 4OSPA 3DMTA 4RVGA 1EVJA 4GMFA 5FI5A 5JYFA 1M75A 3QVOA 4XGNA 2AA3A 4G2NA 4R1TA 2O3JA 2YHIA 4BO1A 4YJDA 3N7UA 1C3VA 3FWZA 4NU5A 4J1TA 2GNAA 3KYCA 4PLVA 1LX6A 3I9MA 3TSCA 3DZIA 4CMHA 4XDZA 1NFRA 3DZHA 3HWRA 1SEPA 5A1TA 5CPBA 4UULA 4NFSA 4EW6A 3I5MA 3RSHA 1IHYA 2J3IA 4MVJF 1U4SA 4YQYA 1WZIA 4M1QA 4CMIB 4CUZA 5TT0A 1HF3A 4XDYA 1GPJA 4G81A 2Q4BA 1UR5A 2P68A 3DZJA 4ZHSA 3RWBA 3I9LA 4CM3A 1MFPA 3VDQA 3IP1A 4JK3A 1H94A 3ROPA 2DUUA 2W2LA 3WSVA 2Z5LA 3ZWAA 1B8PA 2PZKA 1CETA 3E5MA 1IUKA 1VI2A 1VSUA 2QG4A 4MIYA 2H1SA 2FHSA 3O26A 5JCJA 2GASA 2G76A 2NVBA 3RFXA 1YXMA 1X1TA 1M67A 4GI2A 4DIFA 1Q1NA 1M66A 3P19A 1QR6A 3B70A 4BVAA 5JAZA 4JBIA 4JN6B 1K6JA 1N7GA 3AFNA 4DQXA 2O7QA 3KO8A 3ADPA 3DXFA 2V7PA 3ZGYA 3TQHA 3EGOA 2YV2A 3V2UA 1BVRA 2GN9A 1RYDA 4FFPA 2WTBA 4IS2A 3DOOA 1X13A 1WVGA 4TRRA 5TC4A 1BXKA 5JCXA 3FF4A 3TWOA 3NUGA 5FWNA 1EVIA 1Y7TA 4D3DA 4UVEA 3BIOA 1EFLA 4CLXA 5KJ1A 2PZMA 3PGXA 1LLUA 3EVTA 1Z6ZA 4Q39A 1P33A 2F1KA 4ND4A 4CMBA 4R69A 3PTZA 3C1OA 2EHDA 4D43A 3RUFA 4B4WA 1KVRA 1QV7A 1PQPA 3BA1A 4PIVA 2B36A 2H5LA 1QYDA 2X86A 4NBUA 5KKAA 3JQDA 5I7VA 2POQX 4HNHA 3GAZA 2BD0A 2XF8A 4PLCA 4DPLA 3UH1A 4BNZA 1LC0A 1HKUA 1NAHA 3HDJA 4AL4A 1ZJYA 3HSKA 4MVJH 4DQUA 2I66A 1YQXA 3RUEA 3WBFA 2WE8A 4D0SA 2YHUA 4AFNA 3K73O 3A28A 4PVCA 1P1FA 3H7AA 1SOWA 2GGSA 4NZ9A 5L4NA 4M86A 3IP3A 3EYWA 2Q2VA 4ZQFA 3LF2A 2I5PO 5T73A 2VT3A 1ZK1A 1C1XB 1GADO 3JQFA 4GGPA 3FPLA 2YQ5A 3D3WB 4RO0A 2JFGA 4ZQHA 3ZCXA 1DIHA 2ZJ1A 3DZFA 1UXIA 1U1IA 4BUCA 3IDSA 1E5QA 1P31A 5K6AA 4MDHA 4XQ9A 2UV8A 3D5TA 1YBAA 3FR7A 1YB5A 3DONA 1SZJG 4RVDA 1P9LA 1P0FA 2IYPA 3RC2A 3BAZA 1ISJA 4E3ZA 1DDOA 3HDYA 2AW5A 4PLGA 1ZIDA 3SLKA 4IIVA 4DUPA 2HO5A 3E8XA 1H9BA 3GVIA 4DA9A 4WNCA 4UUOA 3U4HA 5L3ZA 1JWAB 3CEAA 1DAOA 3PQEA 2CUKA 3VHRA 5G0SA 3WIEA 4TQGA 4CM6A 3UF0A 1N1EA 3QA9A 5BSGA 1CERA 2YV3A 1E7SA 1EDOA 2ZQZA 3EAGA 4N5MA 3VKUA 2O2YA 3QSGA 3INTA 4J9UE 3ZHBA 2PK3A 4NK5A 4E5YA 4FSHA 4RORA 1LSSA 2CZCA 4TROA 1QMGA 1EUZA 2PR2A 4FCCA 1QSGA 5T57A 2B4TO 2E6UX 2GPTA 1CQJA 3GDOA 4R01A 4GX5A 5FYDA 2WEKA 4J0EA 1JAXA 1PGPA 3S2GA 5MGBA 1OBFO 1EDZA 1K3TA 2X9VA 3QHAA 2OO5A 4ZRMA 3CMMA 1GQYA 3OQ6A 3FR8A 3F6YA 5T6BA 4ESOA 3AM4A 1W73A 3ANNA 4GPD1 5G0TA 2PFGA 5T64A 3GRPA 4L9RA 3L9WA 1HE2A 3LU1A 1H5QA 4NIMA 5AXAA 5TX7A 2CY0A 2J3HA 4D79A 3G3EA 1XLTA 3ZHXA 1DRUA 1X7GA 4UEJA 5DBGA 1Q0LA 5KOIA 2OP1A 1PJTA 2X0JA 4KOAA 5KVCA 4CR6A 4FFRA 4TRNA 4DL9A 5IF3A 3LC1O 3ENNA 3KOUA 4C4OA 4E2YA 3ZWNA 1TI7A 3RU9A 3QWHA 3DBHA 4Z6KA 4LN1A 3ST7A 3TZQA 1P0CA 4LW8A 4KZPA 3VH3A 4H7PA 4BO7A 3H9QA 1Q0HA 4W82A 4CPDA 4JNKA 5B4TA 2QRJA 5ENDA 4W9NC 3V2HA 1X0VA 4MIOA 4Q3NA 5HM8A 4P22A 5CG1A 3OSUA 3MWEB 2HKIA 1FXSA 1ZKMA 5MDHA 4O63O 3AUUA 5JC8A 1ZEJA 3BTSA 4L74A 1ISHA 2HMVA 4J1QA 4GLLA 5JAIA 1YO6A 3H9EO 3VOSA 1TT7A 3AM5A 4ALJA 4Q3EA 1CJCA 3LC7O 1QG6A 3LF1A 1HYHA 1AN9A 3GQVA 3KUXA 5JFOA 3OIFA 1MXHA 5L45A 3SEFA 1U3UA 3PZBA 1H6BA 4I5GA 4H15A 1N8KA 5KVVA 4BIIA 4E12A 4B4OA 4CM9D 1Z75A 2BKAA 5EMHA 1XU9A 3GDFA 1EBFA 3WYCA 2YJZA 4GWGA 3UGKA 1DJQA 1UUFA 2ZB7A 4UVGA 4NPCA 5ICSA 3JQBC 3JD1A 4EEXA 1R16A 3KSDO 1G0OA 2XAAA 5DBFA 4PLPA 1Y8QB 4RQTA 5JDIA 5L53A 1TT5B 3QE3A 3LZ6A 2HJSA 4MVJP 3E6AA 2WD7B 4A10A 2H9IA 4F3YA 2RHRA 1F8GA 3H2SA 4NQZA 3UCEA 2GRAA 4OM8A 1T1SA 1ZW1A 2Z95A 4FOOA 3DR3A 5CG2A 4Q3CA 1V0JA 2NVWA 4NBRA 5M6DA 1BRMA 3QVSA 1VE9A 3OFSA 1LSUA 1L1FA 2J5QA 2GF2A 4EZBA 3WTCA 2X9NA 3DL2A 3UFXA 2CMDA 1PZFA 3GHHA 3WMWA 3O8QA 2IZZA 3GT0A 3I9JA 1ADGA 4OXKA 1M6WA 1Q7GA 2RBEA 3ETEA 3I9OA 1ENOA
chains in the Genus database with same CATH superfamily
4TVBA 2WI8A 3A6EA 4LF4B 4CIDA 2WAOA 3V3KA 1ZUD1 1U2SA 2Z0MA 5JROA 3MUEA 3L0SA 2IPOA 2JANA 3DLTA 3LLUA 4NH4A 1I4DD 1NXQA 5ESRA 5E3HA 4WJZA 4CDNA 4ENRA 2XWQA 5AKZA 4QM6A 1T1JA 1EB8A 3FCUB 5LA6A 1NVGA 3JZIA 3KFXA 2G71A 3ZH2A 1P2FA 4HX9A 4D8UA 4ZGBA 1P80A 1HQYE 4RKRA 5F1KA 2PKQP 3BX1A 1SKAA 2Y2UA 4J16C 5AM0A 2BR3A 3G2PA 2V5UA 4PG4A 2Y68A 3GWGA 2PL3A 3UJ6A 5DNUA 2WZBA 4RTJA 1NW4A 2PUWA 3RVOA 5G1OA 8AT1A 2ZUCA 1CDZA 3ORYA 1DX9A 2I67A 3GV0A 1P3JA 2A1TR 4G36A 4UJ5A 5FBZA 2ZULA 2OECA 2ZT7A 2XYGA 1SM4A 4RADA 2CGEA 3C3DA 2ZIGA 3WBJA 3RK4A 5CH8A 5KWEA 3B53X 3BCSA 4L07A 3ZOZA 5EIHA 2M6LA 2YZ2A 3NYQA 1I14A 4OCZA 5CM2Z 3WL6A 3NBZC 2VJMA 3C6QA 1W0KA 4Y1GA 2X5JO 2YWJA 1U5BA 4FR0A 2X1LA 4KB5A 1HE1C 5LZ5A 1ZL2A 1WSAA 5BQFA 1U02A 2R1VB 3W3AH 3AWDA 2FW8A 1DFHA 3MCUA 5AUPB 5IHXA 1IM8A 1VRWA 4NPHA 5KPDA 1J06A 2DU8A 1L3IA 1U2GA 2I2DA 1F14A 4Q1VA 1SC3A 1YQEA 1EJ6A 3B5JA 4YCSA 4F84A 4MK4A 3VXKA 5HJ5A 2AL7A 3VNAA 5ILOA 1QPZA 1K0UA 1X7XA 5M5BA 4V0MA 5LP1A 5K2OA 4BGIA 5DCUA 2VDQB 3PHIA 5CVTA 2HMYB 4O59O 3G2NA 3F4KA 4NFHA 4V0ME 3CFYA 4EVIA 4DV2B 4JASB 4BNUA 2PDAA 4A5SA 1PEKE 1D8AA 1STOA 5ADVA 1UDWA 2NZYA 1Y3AA 2WFLB 8GPBA 1RBYA 3PJGA 3KKEA 4IOJA 1KKUA 3DVAB 3RUAA 4D3YA 4KQJA 5I8PA 1BMTA 3OJXA 1JEEA 1RRGA 2CDAA 1GVNB 3WLSA 4YAIA 2OCKA 1E2HA 1NPDA 4GM4A 1WNTA 3V2GA 3H13A 2C54A 4R6WA 3UENA 3USZA 4B33A 2TYSB 3HCEA 1P0MA 1XWFA 3FBGA 2RIPA 4NK4A 3N0RA 5JWRA 4JI7B 4MAMA 2Z8XA 4J8PA 4X1IB 4JLJA 1ZP6A 4EVQA 4P82A 1BWRA 3T95A 4BBPA 4QJ3A 3BF7A 3ORQA 1NL3A 3W3AA 1N6OA 2EFYA 4YXFA 1QKKA 5KOHB 3ITKA 4MW2A 5CDTA 4TLCA 5FOWA 1RC0A 5AW0A 5LB2A 3ZWOA 2MDTA 1KBOA 1JVBA 2MYTA 2VXCA 4TKUB 4A5OA 4E5KA 2V45A 4EYSA 3ANSA 3M9XA 3O73A 2VKTA 2ANBA 3WLIA 2QN8A 4H3HB 4INJA 1H4VB 2CJPA 1C0EA 1B15A 2QNRA 3C24A 3KYDA 4IIEA 3O8CA 4HZIA 4EIWA 1CC1S 5BSRA 4X00A 4W5TA 3U40A 2DXIA 1H0HA 3UWKA 5C3MA 2I34A 1I51A 3BD6A 1QGOA 4BO4A 4YXWD 4RULA 2GYYA 1G17A 2WM2A 1UF9A 3B20A 4MA5A 1R12A 3BL5A 4AJJA 1OX4B 3A4TA 3LHSA 4UM9B 1AS0A 2A9KA 3HWSA 3LQQA 2ISQA 2OFWA 2OV1A 3UWOA 5ADUS 1XC7A 2AYYA 4MKRA 4XUEA 2FOXA 1CCWA 4BO0A 2Y1FA 2XGJA 4K9DA 4Q4DA 1PKXA 4J3FA 5G2OA 4LJ6A 4TSFA 1SA0B 1IC6A 1UC4B 2CXTA 3GJ7A 3H2IA 3I34X 4DPMA 1PD0A 4TVKA 2EP7A 3PE3A 3U81A 1ZEMA 2FPPA 2WIJA 1YBMA 5HR5A 4XKJA 3RC8A 5SZIA 4AK1A 1QQ5A 1E3QA 1NVVQ 4UNIA 4Y9UA 4KJXA 1DNPA 3P9YA 2EJUA 2V7VA 3PA8A 2Q4EA 1N7HA 3P71T 5L4SA 1NRIA 4MRVA 4P3NA 3D8BA 4DLYA 3RC9A 2NYUA 2ACKA 3O84A 4F2HA 2AN9A 4NXNB 3G7SA 2PL1A 4LKOA 5HPYB 1NQOA 1COWD 3AQIA 4MHSA 4POOA 1OX5A 3W1WA 4OB7A 5AVRA 4NCKA 4D9IA 2RDMA 4YUXA 3LTNC 1RZRD 2CEAA 4DDUA 4OBWA 4PTLA 4Z8YA 5CHEA 3GFRA 3LLSA 5TQJA 3CW2A 2QAGA 4OUKX 4KXMA 3RVBA 2PA3A 3FUVA 1M8JA 3OFKA 2J6IA 1G59A 2YN0A 1IZZA 4NEQA 1WB5A 1QDEA 3V1TC 4AJ2A 2ADMA 4FFOA 1BHSA 3JAKA 2WILA 3S44A 2XADA 1TF2A 4XRGA 1RVV1 2C5HA 3V2IA 4YC7A 3ZCQA 5G0VA 4DXAA 4UJ3A 5HQTA 2G77B 1K5DA 4KO4S 3ANYB 1EFRD 5FORA 2ZIWB 2QDKA 4KLCA 4ND8A 3V4LA 3ZIUA 5K7SA 2I78A 2QW1A 4RTSA 1M34B 4EHLA 4C5CA 1QCYA 2CL5A 3QX8A 4PSUA 1E0KA 1NQWA 1UKBA 2F1HA 3GCXA 3WO1A 4CIAA 3P4XA 3WGHA 2ZJ7A 5BV1A 1Q7TA 2WD8A 4F0JA 5I7SA 5B64A 1U6IA 4IX1A 3OWXA 4YRBA 1OH7A 3AB7A 1RYEA 2IY8A 4WX2B 3H05A 4IRMA 1O0CA 1FSSA 1M2OA 3OOJA 1U7DA 3QITA 1D6JA 3SLGA 1QKJA 1W5BA 1H6CA 5AOBA 3JV7A 3WIUA 3D6VA 4DC0A 3G6KA 4C7OA 1Y3IA 1CUDA 3SSAA 2OWEA 2QR3A 3C3PA 4XOUA 4P4LA 3P0RA 3AUYA 1N32B 5COBA 1VIMA 5AM4A 2V4UA 1YMVA 4CQMD 2CEKA 2YASA 1J21A 4OXYA 4MKHA 1NC3A 3RLFA 3VUEA 5FBRB 1FFGA 1MBZA 4HMPA 2VH5R 1KAQA 2Q2QA 1BQEA 2BBWA 5HEKA 3VOBA 4OJYA 3WGQA 1ZOSA 3HB9A 4EK9A 1DLIA 4MRNA 3BH0A 4TKVA 1Z4PX 2C4MA 4ZDJA 1LJLA 4N8DA 2ZJ4A 3WLRA 1TYCA 1NGSA 4OMDA 3O3MB 3HEAA 5EIFA 1GL9B 1NUPA 2BI8A 4C0QC 1JALA 2O8NA 4KACA 4KE6A 3SN6A 3K2EA 1FC0A 1U0EA 1WZEA 2NZWA 3FCXA 3N58A 4KWEA 2QZJA 4XI9A 4B6FA 2F9LA 1SXJE 4BJ5A 5KOYA 1LPNA 3AX6A 5AICA 1OAKA 2YWRA 3IUMA 2YMMA 2QTLA 4DRXB 4Z4EA 2J4CA 1FMLA 2YY7A 4P4TA 4DV7B 1KDOA 3WNBA 5AH0A 3FRHA 2PUHA 3K9QO 2RHTA 4CNBA 2NSYA 2VBGA 5DOVA 1CF9A 1YJ5A 1POWA 3QZUA 1Q7EA 1E4OA 4URUR 1WXHA 3ZHOA 3JS5A 1WO8A 5IKPA 3VR5D 3A6GA 4RHCA 2FFBA 2HEIA 3D3EA 3WK7A 4IFIA 1A8QA 3ROXA 3NDPA 4RY9A 3WKDA 1U0NA 5A4DA 2AOTB 2ODAA 3Q9UA 4O4HF 3UXYA 2V6JA 3K96A 1M1YB 1ZIXA 2HMUA 3QJ5A 3R5FA 5DX0A 3ROFA 1WCYA 4WEQA 2X2FA 4BN0A 5CURA 1A7JA 1OAOA 1UWLA 4RWEA 1PEAA 4BAGA 1GFZA 1ZOIA 5JAOA 2JLXA 1X42A 1TCAA 3B1YA 3DT6A 4KV7A 1U63A 1GTSA 1Y3FE 1QUFA 2WHXA 3G9QA 3RUCA 5JCOC 3RC7A 4CKZA 3THXA 3EQ7A 2KW5A 3B1ZA 3EFHA 2HRDA 4FE3A 4GFDA 2JZNA 4ZCLA 4RDXA 5EJ4A 3AHEA 4K6CA 2O2CA 4JP1A 1VJTA 2I2BA 2P62A 4PE5B 3NTXA 3ZQKA 1U11A 2AOUA 4XAQA 5M7EA 4F12A 2XY4A 1XQXA 3EZ7A 4KR9A 3IS3A 4KQFA 5FRDA 5JI2E 4UEWA 4RTKA 1Y7HA 3P27A 2DPXA 2ZSFA 1G55A 2IDZA 1D2HA 2SKEA 3FM9A 3NAZA 3OJ0A 3UWPA 7GPBA 2OD2A 2HOQA 1F2TB 2PGJA 5KC9A 3ZVNA 1LW6E 1Q3KA 1B74A 1XNHA 2UVDA 3J7TA 4ALKA 4CL2A 1IWPB 3X2FA 4W1QA 2QAGC 2XITA 3GLGB 1HE4A 1XQ1A 1OGYA 3ZNNA 4KR2A 4UU0A 4OM7A 1O94A 3LX8A 4OFBA 4BQIA 1PEYA 1HTTA 1XZEA 4IGEA 3N0VA 3AO0B 1WSDA 4LRQA 4TT8A 1WXIA 2BE7A 4ERNA 1BKYA 1S02A 4XGKA 3LDGA 2O0KA 2BHRA 2O2SA 2HA3A 2H0QA 2V5AA 4UQPA 1PBNA 1CUEA 5IUKC 2PANA 1WXDA 2HCRA 1Z6YA 3VR2D 2WU1A 3WX0A 3CUVA 2JVKA 4QG3A 4LRWA 2D1FA 2J3JA 1A4IA 2VKQA 5JS2A 3HZZA 4XWKA 4YBRA 2ERXA 5DXFA 1XJWA 1XZAA 2C5SA 2P9HA 3WG9A 2GTPA 4MI1A 3SQXA 4GP7A 4L8FA 4RXTA 5DF1A 2IYSA 3BM5A 1P1HA 2XUIA 4IG4A 4LZOA 3R5SA 2FB9A 4QICA 1XD2B 1GPKA 3KFLA 5F7XA 3SICE 2C7VA 4EVSA 1PFKA 3HMKA 3FGNA 3P9ZA 2G09A 2AFHB 5K8LA 1EWQA 4ACBA 1UXJA 1XX6A 1IG0A 2QTVB 3IOEA 4C0WA 1Z7EA 3HP1A 3EQ6A 2G1UA 2V3VA 3I4LA 5JT1A 4F5EA 3I5XA 3QBJA 1WZCA 2O1XA 4WASA 2C77A 3PJDA 5J40A 3G5MA 5HHTA 5K20A 2HJ9A 1USWA 2GFQA 2QBYB 3AY3A 3EA5A 1ZD8A 1RACA 2JDID 4JYZA 1CLEA 2DPMA 4M9XA 4YMVA 4FXPA 1E6CA 1S7GA 2REOA 3F5FA 1VL8A 5PNTA 2OGWA 4XB1A 1NA5A 3NHAA 2NZJA 2WPDA 5FOVA 4ZEMA 4I1PA 2CJFA 5CFLA 2BTQB 2FRDA 2NU9A 3LNTA 2IKSA 1AO0A 5GP1A 3RHFA 3AVXA 3AJDA 3WIOA 1Q0RA 1JKJA 3HDQA 3CISA 4C5AA 5FAXA 2DFPA 3HNPA 3ZQUA 2NVUB 1PS0A 3UB3A 2NUPA 5F35A 3UG7A 3FSEA 1EXMA 4O4JA 2BBOA 2Z8ZA 2QTCA 3G79A 2GAAA 4BQOA 1B16A 3KKKA 3HJHA 1G5PA 1UBKS 3A9VA 4IIYA 5KIAA 1CDOA 4M89A 4RHEA 3MJEA 3DDHA 3WJ2A 5BN4A 1A9OA 3ECAA 1RXIA 1BXGB 3NHPA 3O4FA 3H97A 4GR5A 3VA7A 1QYRA 1ZN2A 1ZMBA 3ZE8A 5KSPA 4BLOA 1GAWA 3RFVA 2CF5A 3OTWA 3O9MA 2JLAA 4IDGA 1IBLB 4II7A 2XYVA 2ZR0A 3AJ9A 3JZDA 4YRCA 2AR0A 2XDAA 4DMUB 4FMPA 4L5CA 4OHRA 3TG2A 4E5NA 1EFPA 2RB4A 4LY0A 4YAWA 3W8EA 3BMNB 4QGAA 4ARBA 4FCVA 1MV8A 4R0VA 2BYTA 3R7AA 3S7ZA 2IXFA 2AOWA 5HIKA 5JVDB 3WL7A 5IDXA 2HCTA 1PJRA 1A8UA 2R6JA 4G25A 2B5WA 3UAXA 3GRAA 5HCNA 2O8DB 4AJEA 4JC8A 1T3HA 5BV0A 2QJWA 4MKXA 1JX6A 3CH5A 3DWIA 4RJ2A 4XWAA 4Y0AA 2M98A 2X1HA 1XAJA 4FI3C 5DEIA 4MRMB 5JZVA 4DR3B 3PPXA 3Q3IA 3HEMA 3PUHA 2ZPTX 1YQDA 2ZR7A 3H11B 2GBGA 4JXXA 2PSJA 1PJ3A 4R5MA 1VJ0A 2JJQA 3EBPA 5TMBA 3DFUA 1RM3A 4N9QA 2ENUA 4P53A 1QK3A 1JSLA 1MU0A 3O2QB 3C8ZA 4RDIA 4RCYA 3WGJA 3ONNA 1EG2A 5BMVB 2IBTA 4OH7A 3F8TA 2A94A 5T3UA 1CD5A 4RIHA 1LI4A 4WTOA 3ZWWA 4KPFC 2XYHA 4Y6PA 6PFKA 3R3ZA 2WTXA 1YTUA 4NE9A 1C9KA 2GX6A 2WIKA 1P75A 4YMIA 2PQMA 4X97A 4TS9A 1VE6A 4K6FA 4BRSA 1R18A 4TMZA 3QP9A 1F6WA 4JR2A 5A9TA 3H87A 5SY4A 1ES9A 3HDTA 4IHJB 1E2JA 4M0KA 1MAWA 4AXXA 1XN1A 4CCWA 5FA8A 1QH0A 2ATIA 1VLJA 3EC1A 4LX0A 1YS6A 4MWDA 2QX6A 4YPFA 2ZRCA 4DSZA 3GZNB 4MW0A 3V8BA 3TYXA 3HNRA 3TJMA 2P1RA 1GPLA 3AONB 4JGBA 4LMAA 1Z5GA 3UAGA 4E7PA 3QKTA 2XNKA 1NUQA 3C3BA 3FTEA 1ODJA 2PD4A 5DYYA 1P7WA 1FFXA 4XIFA 4DEXA 4X1IA 4KJZA 1BVUA 5IKMA 4P6VF 2VWQA 3JQ9C 5AK0A 2JLWA 1D5CA 1GGJA 1Z16A 2HH9A 1QYIA 2WKQA 4DT1A 1HRKA 1TECE 2CKMA 1F1JA 4G5HA 4BIMA 1QU3A 3AY6A 4HNAB 1L1EA 5GJBA 3V4VB 1A98A 1YOVA 3JTMA 2IP4A 4D6YA 5MFZA 2B8WA 2NV0A 1XZIA 3AKCA 2QAGB 3KOWA 2IWHA 2H5JA 2PD6A 2P9JA 1LI5A 2GO1A 2H5EA 3H04A 1DJPA 1GZ3A 2ZI6A 3RVRA 5HIAA 1NSTA 2WAYA 3KXLA 4KQIA 3JYLA 3GUVA 5HZGA 3H5AA 4YJGA 3SSOA 2IEBA 3AB3A 1XVUA 4X6YA 1L1QA 4JJ7A 3LSYA 1LD3A 1ZIYA 1XWWA 2XX3A 4G4SP 3RUPA 3RVDA 1RHMA 4GKAA 5SY9A 1T9DA 4BOYA 5AKKA 3R3SA 1AGPA 2FOIA 2J6HA 3CE9A 1I2BA 3EPJA 4TYWA 3T1QA 1Y6RA 3FZQA 3IPLA 1WMAA 4P7KA 3S8MA 3LKZA 3E9QA 3B8HA 4WCFA 3RDPA 4DIUA 3TGLA 4F45A 2VYVD 2C7BA 3BH6A 3WHLA 3HJAA 4ZI5A 2FFRA 4EVRA 2F3TA 3OQBA 1YZVA 3HA2A 4KL8S 4X95A 5JJ5A 4LX8A 2GK6A 1XZLA 2GR9A 1FFHA 2A5DA 4DYVA 2R6AA 3IT3A 4Q1EA 4BX3A 1Q2UA 2QM8A 3OEED 3KBOA 4H7DA 1SA0A 1RPAA 3NHJA 4LE1A 4OJTA 4Q9DA 2P2ZA 4KTTE 4NFLA 2CLKB 2F48A 4K6OA 4PWYA 5HUJA 5LP6A 2ROQA 4TX1A 3LT4A 1INLA 3UT6A 1VKZA 3BB3A 3WMGA 3ANTA 2FF5A 1CW2B 2B25A 4Y6SA 1WCXA 3IUYA 4F3KA 4Z7QB 2WIFA 4RPKA 2ZTHA 3PRYA 2WUFA 3R3WA 4CTJA 3INRA 3LUPA 5EWLB 1QK4A 2Z30A 1XXHB 2E49A 2SKCA 3DG9A 3L7OA 3R0VA 5ECGC 4Q00A 3S2UA 3KHUA 1PKEA 4OVKA 2HSDA 4DB4A 4DR1B 5U9CA 1OH6A 3CPHA 3EIHA 1FFEA 4XUDA 2XUQA 1IEVA 1Y63A 1M2VB 1VG8A 1UBMS 1G41A 1ZC3A 2PMWB 4CLOB 2IVZA 1K7CA 4L95C 4UHDA 5BV7A 3EQ9A 1AKNA 1RQ7A 2A86A 4V0RA 5IEBA 5CEJA 3GEMA 4CHTA 2IYTA 3GJ6A 5IT0A 4EFMA 5LYJA 1AMNA 4PYRA 3COJA 3ZU4A 2X41A 3Q10A 4FT2A 4MVCA 4A91A 4RS4A 1A9RA 4JP5A 3AR9A 2ILVA 3MRSA 1MENA 4PCVA 1SN7A 1DQZA 4U0JA 4OOFA 3RT1A 4LQLA 1KPIA 3WA7A 4YAKA 2HMAA 2CKDA 3NI2A 4RETA 1GN8A 2QZPA 4XVQA 5BVGA 2JLZA 2OZPA 1WHSB 1K92A 5FLXA 1GHTA 1KYWA 4YQFA 5ALUA 4RD0A 2H1IA 3PLNA 3RT7A 3FFAA 4DPKA 3TB4A 3WXMA 2QN3A 1E9VA 1L5GB 2BGMA 4JC0A 4WPGA 1VRCA 3JQ7B 2C20A 3ZTTA 3IR6A 3VDMA 1CQIB 1SUFA 4TS3A 1IPFA 2FMIA 4J0FA 5IULC 3G88A 4NBLA 2C2HA 3AHGA 1KZ4A 4DOMA 3WV4A 1AZTA 2JNWA 1SRRA 2J9ZB 2PPLA 1VL0A 2D13A 4W7SA 4BJ3A 2QQ5A 3B12A 3NPMA 4GM0A 1X7XB 2D0PB 4B2YA 1UEJA 1PS9A 3QF7A 4R1LA 3RQSA 2P75A 5I8ZA 1WZ2A 3GRKA 3ZDDA 4MR8B 1X80A 2HQBA 1ZD2P 4DVGA 3ENKA 2XNDA 4CV1A 3MRVA 5DP2A 1H2FA 1E4VA 4JUFA 3O4RA 3UUEA 4XVRA 5ELXA 3VU8A 3FGZA 4F6CA 1K2WA 2HA4A 1MT0A 4I55F 3HFJA 3NIFB 2HREA 3FLEA 3B6EA 3HBLA 3TGWA 1M6NA 3RBXA 2D8AA 3LW8A 4PGGA 4TZ6A 4GMHA 3T7AA 4Q19A 1QHSA 1E4EA 3TAUA 1TGYA 1TTQB 1UPTA 2B35A 3F4LA 2IHYA 2CV0A 3B5EA 2A7XA 3NRCA 4A36A 5CNMA 1JQLB 1HE5A 1Z25A 2R8ZA 3R6LA 4O29A 3BXZA 2VK8A 3DCJA 2FQWA 3PQCA 2NTJA 2C3UA 3PFGA 3QJGA 4P93A 4QWMA 4QT4A 3GLGA 1DIOB 1S4QA 1WDKA 3I04M 3TN7A 2JHPA 2ZRAA 5EEGA 2MR5A 4GXQA 4ND5A 3ZDEA 1X8LA 4YMUA 2BGUA 1P0PA 4JVMA 4BMPB 4RH3A 3K70D 5TDHA 3RS4A 4OKSA 3W5VA 5IZCC 3HGQA 2NXEA 2B69A 1MEJA 2YMQA 5AI8A 2C59A 4DA4A 4KQKA 3UPTA 2J08A 5KBYA 3ZDFA 2RGEA 5LYJF 3CRZA 5KYYB 4JLUA 3IP5A 3O3NB 2PJRA 2JJ8A 2YYZA 3B36A 4EB6B 3RV4A 3IDQA 3ZLTA 1GZ6A 3IOCA 3OKFA 4X62B 4KP7A 5DPMA 2Q46A 3NJRA 4O8JA 2BRUA 1C4KA 3GYBA 2BM9A 3QQ5A 5D5HA 1WMBA 2DR0A 3D4OA 3HWWA 3PNVA 4MV3A 3SC4A 5EESA 2VUHB 4RXMA 5CB4B 2VK2A 1YR3A 4UOZA 5FPKA 1U2ZA 2C8KA 2D5CA 3Q88A 5KNLA 2P6RA 2Q4TA 2YJNA 3TNLA 1I3CA 4KIUA 1RAGA 4GX0A 3ESYA 4JKIA 1QNLA 2X8LA 4WERA 3RVMA 2AOTA 3FZEA 5CW2A 1EXVA 1FOEB 2B7CA 5JSFA 4H16A 2DAPA 4LJKA 3RYCB 3BIJA 3REOA 1RYHA 1WHTB 3CF0A 4HB4A 2AMFA 2BHSA 2O7VA 5CIQA 5JSKA 3SC2B 3VOTA 5LKAA 4JLAA 5F23A 1NUSA 1POXA 3CONA 3X43A 4AROA 1P44A 4YVFA 1FYXA 1HO3A 2I76A 4IDBA 4AMGA 4WKOA 1RAEA 1QX3A 1FP4B 1PFUA 3G5LA 3EEFA 1Z33A 2FU5C 1NDHA 5FBVB 3SE7A 2YJTD 4XIGS 3VQTA 3V1KA 4XCVA 4EL5A 2QW0X 2B2XA 3I32A 3NVDA 5E1DA 5IN5A 1C7ZA 2Z56A 3HRHA 1H2XA 3AMVA 3IKMB 2R6DA 4Q4HA 3MVEA 5EMJA 4PZZA 2VTBA 3A2NA 2W48A 3L8MA 2VP3A 2YRWA 1MG5A 2E55A 2JD2A 2UUPA 1W0JA 4I9FA 5IW8A 1ZMOA 2QY6A 3EEIA 3PTLA 1JEQB 3LXUX 3OP1A 2G67A 4AO6A 5KNDH 2ZYWX 2UZ4A 2PUJA 3VKHA 1BMDA 4R98A 3N2ZB 1SIWA 1CJBA 2Z09A 3N86A 3ZE6A 3JALB 1SB9A 4ILKA 1C4XA 2C7PA 4L85A 3S55A 5KYXA 4EKNB 5L8VA 2IUFA 3QPDA 1ECJA 2EJVA 3CPEA 2JHAA 2YWFA 1QG0A 3D9QX 4AKHA 4NOMA 1YFZA 3MBOA 2ZCJA 2A9PA 2FA9A 4P58A 5KINB 1VG1A 2OHFA 2NP7A 3JVVA 1KS2A 5JH7A 5DI9A 3ND5A 5I9TA 2JF0A 5IT4A 1FK8A 7ABPA 2I33A 2HRZA 2NUAA 3T3NA 3OEHA 5EERA 3VDXA 3BE6A 2II6A 2QLMA 2ESRA 3HKCB 2NLOA 2JB9A 4F1WA 2X1MA 4EG3A 5I5EA 4EKEA 4E1BA 3CWCA 1WDWB 5BOVA 2PZLA 3OQIB 4ZQBA 3KT0A 1WCWA 1EGHA 2X58A 1V5WA 2FSIA 1MUUA 2QX9A 2YOHA 4TPKA 4WUVA 5E7QA 1LJ8A 4PQYA 5IAAA 3T5AA 2B7LA 2W6IA 2D8MA 4E70A 4FW8A 1A4RA 1OXUA 3DFFA 5JUWA 1QZUA 4I8IA 5DX8A 3LIPA 1MTOA 2A92A 4N40A 2PH3A 1JMKC 2FPNA 1ZSNA 4E21A 4R68A 5TF4A 4EG1A 1TQ4A 2JD1A 3OD1A 3RF7A 4HI0E 3FOFC 4XIYA 1T5HX 3PYMA 3RS8A 3DAPA 3PHCA 4GZMA 5CDFE 3EVAA 3UEOA 4FN5A 1UC9A 3SX2A 2WA2A 3M4ZA 1P5RA 2I6FA 1T8WA 2X8AA 5KOJA 1GFSA 1PN3A 2VRWA 1CQXA 1DX4A 1FUIA 3OAAA 4K86A 3WGTA 2NU8B 2RHCA 1YB6A 3HO6A 3QEKA 3ZTYA 3EDRA 3BTVA 4X1YA 4B3IA 4H1WA 2BR5A 4OP3A 4UQLA 2BFPA 1W35A 4OD0A 5B3JA 1P1JA 2IFTA 4CU5A 3U80A 1UPBA 3K4QA 1XK7A 3OJEA 3E48A 5GJVC 1EXDA 1ACMA 4ZYWA 3AOEC 1ZCJA 5E6SA 1ISGA 2EBHX 2UUOA 3JYNA 3IODA 4ISCA 5EIWA 3OJFA 4A6DA 3NW9A 2JZCA 1S8AA 3WQSB 3SXUB 4YAEA 5LOVA 2ZAOA 1TVMA 1FFYA 4G84A 1R8QA 3PEFA 3UAZA 1KZ9A 1Y5RA 5AMXA 3F5SA 4EHDA 3AJEA 3BJRA 4LYYA 2YVLA 5CA1A 2Q4OA 1RBZA 2FMUA 1MB0A 5LQJA 3O8OA 2BI7A 3IVXA 4QLOA 3ZXXA 2CMKA 4J2OA 4N39A 3U1VA 5KCMA 3Q6MA 4K0KB 3UT5B 1QMPA 3KCQA 2J33A 3H7IA 4F7DA 3WV5A 4NS1A 4C0AC 3TLXA 1E5TA 4BB0A 1IULA 4BEWA 3F7TA 4KAAA 2DECA 4TT3D 5BP7A 5CX1B 1JEYA 2DY1A 3PYXA 4RYDA 1O6ZA 4U2GA 3A4IA 3HC7A 4FDVA 4RVFA 5HDQA 2OOKA 5KWVA 3OOWA 2XMGA 1Q0ZA 1VGVA 1C8VB 3JAMA 3O8OB 3OPNA 4EATA 1DXYA 2X7HA 4RMIA 2ZB4A 2VN8A 1SK8A 4TVSA 2VQ6A 2IRWA 3QLJA 2JC3A 5KDLA 1A9XA 3NZEA 3PQFA 1TTTA 3JQ6A 2VUUA 1K27A 4IXDA 4KODA 2OC9A 1V2GA 5AHWA 3S70A 3V7FA 3A1WA 1R0XA 1HMYA 2JIMA 5BSTA 1BQ4A 1K6MA 3PXBA 3VO8A 4CCSA 1KNXA 5A71A 4U3JB 1E6LA 1GWNA 4X61A 4H6XA 3Q8LA 1L5QA 4NG5A 3M5WA 5ITWA 4RA9A 3CCFA 1FP4A 3N0WA 3TW8A 4BLPA 1OMOA 4BMOB 5ISMA 2HHHB 2GVNA 2JIPA 3WNZA 1A1VA 3DAGA 1P2DA 1SKYE 1UJNA 4OO3A 4OX9B 2FPGB 1HT1E 1NTRA 4Y9TA 3PPIA 3HCFA 3E03A 3OBIA 2JFVA 1BMQA 2FEKA 4LNHA 4B87A 4D26A 5FA6A 2XCLA 1IBRA 3VMMA 4G23A 3F47A 1DCTA 1KFKB 3L7LA 4HPXB 4QD3A 4LF6B 4XH9B 2RJOA 3IXLA 4P31A 4Y9SA 3WHIA 3AESA 2CYAA 3WLAA 1XR3A 1XTJA 4HQ6A 2ES4A 3LLVA 3ZDQA 3E3LA 1OWPA 2P2DA 4JJ6A 1P0IA 4MWEA 5K09A 1U8ZA 3FTPA 2BCGY 3H1FA 3RCBA 2VXOA 5JSZB 4C2UA 1VBMA 4NU8X 1UP4A 3OIDA 1NG9A 1U1EA 4MRPA 4RSGA 3A06A 5REQA 1HL3A 3G23A 3FCEA 1UOOA 4F5WA 1JVNA 4CLQA 5I01A 2OD7A 2BGJA 2JAHA 3MBKA 3RIMA 1HLPA 2XTZA 1IOZA 2BFEA 3A04A 3KB2A 5ERXA 4C6HA 3ZOKA 3BTOA 5BN5A 2IEGA 2X22A 3LNCA 5DULA 4INOA 1GG2A 1VA4A 3PP8A 3DGFC 5IJAA 3TCNA 4UZEA 1XQVA 5E6RA 2F00A 3EF0A 4OQQA 4QSMA 3U4IA 5IM4F 3DQQA 5EJFA 1IDOA 1UKEA 2QE6A 3VR1A 3GQBB 1L4MA 1MQAA 4UMFA 3UWMA 1I7MB 3AP1A 3NHSA 4ZVOA 5AT1A 5TEVA 1BCSB 3LQRA 2Y0EA 3WGIA 3I42A 3W6PA 3A2KA 1ONSA 4M55A 1PV2A 3RFUA 3SHQA 2P3OA 5EG5A 1RHRA 1EX9A 2WSBA 4GAEA 5DNYB 4WFIA 3R4VA 5CG1A 3CF4G 1E4EB 4M9UA 1FRFS 1DTSA 3CUKA 2Q1UA 5CCBA 3FUXA 3CZMA 5BWOA 3UJNA 2HLDA 4RKEA 2HW8A 3RBVA 1YFKA 4B3HA 3LUBA 4PU0A 4S35A 5CLQA 1GRVA 5EIXA 2OVBA 1N0WA 5IXYA 4HWRA 2ZSAA 3GLRA 1H2WA 3GD5A 3K9HA 3PEVA 3EDQA 3FWPA 3ZY2A 1NI4A 5JHGB 3FE2A 1OQAA 2JGFA 5AJUA 3GY0A 2IH2A 1BVHA 1JH8A 3CCCA 1KGDA 1PUJA 2RGXA 1QANA 2AE1A 2WSMA 3P2YA 3QPAA 4D9NA 1AXEA 5AUNB 4ZU3A 5E7JA 1G0NA 4EBFA 5AIBA 3PR1A 5DKFA 2C2YA 1JAIA 2VR1A 4LXUA 4EQ6A 1QHXA 3DNPA 5JBNA 3JVIA 4QX6A 5BQ3A 1TZ2A 4IUYA 5AHXA 2AG6A 3GAFA 1IYZA 2BGRA 5C1PA 1TM7E 4RW0A 1AG9A 4RVHA 4KNVA 1DSSG 3OZWA 1L7QA 4D9JA 2X5OA 3ABIA 2VQSA 3HR8A 1NXOA 3PQ3A 4X8HA 1KY4A 3GCDA 4NVRA 3BMOA 3AL2A 2VT7A 1MAHA 1KY2A 4XIIA 4E32A 1JIVA 1E8MA 1G2OA 2I22A 5I5GA 3ZW7A 2XKKA 1TM5E 4X6LA 3EWIA 4XQGA 1GTVA 1ESNA 3O38A 2FDRA 4FONA 3WRXC 1JG3A 1NN5A 4M6WB 3KQQA 5CR9A 2HR1A 1GZHB 2KSQA 1Z5OA 3D7KA 2I4LA 1ZVMA 1ZUWA 1ZAKA 1IB6A 4DCUA 2JEZA 2G1KA 1BKSB 3CIOA 4RTMA 4O1IA 4RXUA 2JFNA 2XDWA 3HKBB 2UXDB 3ROTA 1Y8QA 1FUKA 2EU8A 3MLAA 3ZK8A 1WABA 5F4BA 1O89A 4CMGA 2B8NA 3RUHA 2RONA 8ATCA 2C57A 4V03A 1ZM9A 2E89A 3INNA 4DJEC 2E2WA 4UM7A 1U5BB 3HJUA 2XUKA 3LHIA 2PT7A 2WM9B 3RSSA 4NNPA 3NAMA 2PUEA 4L08A 3A31A 3T9CA 2GF9A 4EUSA 3M70A 1ZIPA 3EVDA 4B9EA 1KZ1A 4FMCF 1O97C 2C88A 1QO9A 2C0PA 3KM0A 5IVHA 2PBLA 4JIMA 3PFHA 3HVJA 4XR9A 1ZMTA 1UDXA 3QWAA 1FLAA 2B2CA 2R4UA 2YIVX 3EHDA 3TI7A 4TXNA 3P7MA 5BYKA 1BSVA 1RRCA 2CVQA 4HZUA 3LGXA 1YACA 2ZETA 2WF6A 4PC6A 2Q5QA 1BCSA 5DHUA 4AJHA 5I9LA 1O8CA 4ZVVA 2JLUA 1VCMA 3MAAC 3OZRA 3VO9A 2G9QA 4JI2B 4UNNA 5CX4A 1AKWA 3FYHA 4I1SA 3UCXA 1C7IA 1PQYA 2Q45A 1BVYF 1DU4A 2RIRA 1N92A 2G7MC 2ECKA 3KPUA 2JJMA 1QDUA 2WIGA 1JA1A 3M0EA 1SWVA 2R11A 2ZRQA 3DXYA 3W4JA 7MDHA 1GTMA 1P1BA 1VMIA 2E37A 3WRYA 3A27A 4OREX 4FGUA 1GG9A 1YJCA 1K6IA 2JARA 4JLOA 5HILA 3V4OA 2REQB 4EF5A 1T4CB 1A50B 3FAZA 5FO0A 1E3SA 1QIIA 2VL7A 5REQB 4ZEWA 5JSYA 4IIHA 2BJWA 2GQ0A 1DP4A 2BONA 2QRLA 3VZRA 4DJTA 3ZEIA 2OFFA 4D7AA 2YIMA 3EGDA 3H1TA 2GZ1A 3JQQA 4X64B 5IARA 3LHDA 3I23A 4MJLA 2J0EA 4TV9A 5I7AA 3WLJA 5KCZA 1CF4A 4PYJA 4F06A 1LVUA 1IOLA 5CA0B 5LQDA 4MGHA 2FPOA 3C4QA 5LQAA 5M04A 1G8HA 2EIXA 3KZVA 4Z0NA 1MABA 4ENUA 4ZDKA 1ANKA 4G56A 2V58A 2R6R1 3AVOA 2HADA 1SCJA 1UMBB 4M0EA 1KY3A 3MGGA 1P4AA 1OYYA 5CFMA 3UAWA 1PBTA 1C29B 3FDIA 3KKMA 4HN2A 3M1LA 5LDHA 4UE6A 4JYPA 4F1KA 5K0ZA 4OP1A 4PNZA 2A5LA 1O57A 1GL3A 2OUIA 2WTAA 5CFZA 4BFVA 1Z45A 1MOPA 4B79A 4B46A 5HK9A 4JDUA 5GOTA 4U63A 3V4ZA 2HRBA 2P5SA 5JMWA 4LXHA 2SECE 1GPDG 2IZ1A 3BN3A 2IZ5A 1YVRA 3ZW9A 3VZCA 5AK4A 2VTBB 4YCAA 3D81A 1QNFA 1P4RA 4BEBA 4B2LA 2I3GA 3SYTA 1DXHA 1ZRNA 3PCTA 3RK1A 3TNYA 2GN1A 4B44A 4YDSA 1IWOA 4Z4QA 4KMRA 1OVGA 1XKQA 4DRZA 1IG3A 3QX3A 4GPBA 2YNMD 2RHDA 3ZCVA 4DWJA 4RF4A 3AR6A 5AD1A 3ZBTA 1FTYA 1JA0A 1MJNA 1ZK3A 4EQZA 5C3UA 3N2YA 1YZKA 1CR4A 1OXMA 3MERA 2FW6A 4PRYA 4ER5A 4DIKA 4GNKA 1H42A 4QU9A 3CUSA 2FSUA 6GPBA 1YFJA 1VHLA 1NBAA 3EIFA 1V39A 1SVSA 4U6QA 4NBTA 1B0UA 1XVVA 1Z8FA 2NZVG 4XJVA 4E0BA 5H0IA 1J7KA 1EK6A 1VLHA 3O0TA 1N8TA 3KQNA 4IDAA 4QAQA 3R7WB 5FIUA 4JVLA 3HLKA 1P7VA 4ZYZA 3JWGA 2HL6A 2H4WA 2NQTA 2JAPA 1H0SA 5I7EA 3QE9Y 3GFQA 2CJYA 3JWIA 2PKXA 5CJPA 4REMA 1E59A 3NAQA 4A6PA 1L4UA 1I4WA 2JW5A 3VAZA 1UJ4A 3D54D 4M7OA 4HATA 1Y5NA 2VWPA 4L50A 4JYMA 4WY2A 3DCIA 1EXNA 3CIFA 4AS3A 2RKBA 1XU7A 5KAMA 3KXPA 1F0YA 4LOLA 4W1SA 2WRZA 3W4IA 3FYCA 4DC1A 3DHWC 2GUWA 4PYOA 3K6JA 5CLLA 2BIFA 2MYNA 3IHLA 3KKZA 5IKOA 4DDHA 1NNLA 1YOVB 2V6FA 4QEZA 4UBIA 1L5YA 2W93A 3NWEA 2CMFA 4WGGA 1LW7A 1XDGA 1LQTA 1U2PA 2OGZA 1JNYA 4DXDA 4F8JA 3DKIA 4K26A 2QE7D 2YZ7A 4IJMA 4PSKA 3OM9A 2FMKA 3EK2A 5CP8A 1GA1A 4ZT7A 1M1UA 5EXTA 3V7WA 3NWOA 1VLZA 3LCVB 4L8WB 1PI3A 1A3CA 3OKAA 4MULA 1WJGA 3QWBA 4N0DA 4E03A 1QYXA 2ZJZA 3LYLA 3WHPA 2XI4A 4NYJR 4EY4A 4IVQA 1J39A 2UVPA 1WEKA 3RNLA 1NMYA 1HRDA 4K40A 5LQCA 1QIJA 2G6TA 1ZQ1A 2IPLA 2ZUDA 3ZEAA 3EOZA 2QTGA 1SWWA 3OZ7A 1QFYA 5JWOA 1QVZA 1DUIA 3BIWA 3BQ9A 4H17A 1S2MA 4H7HA 1EQUA 3C8UA 3HBMA 3MS4A 4RPHA 4UTRA 3NHKA 4U7WA 1LRKA 1Z0JA 2J7KA 1ZN8A 3BF8A 3IQGX 1P74A 4IH1A 4MA4A 1CFZA 4F3TA 2GCPA 4ZJZA 1SXJC 4RD1A 3ZDAA 2L82A 1JI3A 2AYXA 2XA9A 3AQ4A 4QEKA 3FJYA 5EA2A 1Z5WA 3H8WA 4YYZA 2R47A 1QZXA 3C7AA 3IT0A 3W9UA 4EA7A 4XVCA 4DKJA 4B80A 2GZAA 4QM7A 3ILHA 2F8TA 3H99A 1HORA 1SHJA 2DTXA 4YPVA 4DADA 1WBBA 4FDAA 5EE1A 1YS2X 4HCJA 1F1BA 1N75A 4TYPA 4Y2PA 4FJ2A 1KMMA 3OX2A 4NJMA 1GJRA 3U5ZB 3D6MA 2CLHB 1I6MA 4ZAXA 3LP6A 1XCJA 4RENA 1FU8A 3P32A 3FN4A 5LBTA 2JLVA 1T91A 1NM5C 1WXQA 2DKFA 3BGOS 4GX1A 4NKRA 4O8CA 1E96A 4TWAA 4YAJA 4AYWA 4L28A 5SZKB 3E61A 1DDGA 4OI1A 3PWSA 1T9KA 1OGIA 4GKJB 2FPIA 2HO4A 1VMDA 2PNFA 2YXDA 1XBTA 4LHWA 8LDHA 4A26A 3U44A 1PT6A 1GVHA 2ZWOA 1G8SA 1WQ1R 4NARA 3RIYA 2PYDA 2WTEA 3IQEA 2VAWA 4WOCA 5D7NA 4YRQA 4JLWA 3QEJA