1YL7A

The crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) in complex with nadh (crystal form c)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
245
structure length
245
Chain Sequence
ARVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKLIAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate reductase
publication title The structure of dihydrodipicolinate reductase (DapB) from Mycobacterium tuberculosis in three crystal forms.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 72
structure length 245
sequence length 245
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05173 DapB_C Dihydrodipicolinate reductase, C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1yl7A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1yl7A01
1FK8A 1EE2A 4OGWA 4EUEA 4NQZA 4K9DA 4R5MA 3RIHA 4BO0A 4PLGA 1X1TA 5HA5A 4YT5A 4QFCA 5ADHA 2D3TA 3P2OA 2AE2A 2CF6A 2X0JA 3QVOA 4BGIA 4C7KA 5IG2A 4HP8A 3CMCO 3DR3A 4HNGA 1SPXA 3E6AA 1L1FA 1E77A 3H8VA 4FGWA 4L4RA 2AE1A 1D4FA 3U0BA 3DONA 3ZI0A 1YB5A 2A4KA 3N74A 4UUPA 1V8BA 3LU1A 1C0IA 4BQRA 4HY3A 3JSAA 1PIWA 3WBFA 3B1FA 3V5NA 1JAYA 1TVEA 3E5MA 2AMFA 3OIGA 4YJHA 1GYPA 5HTOA 3TDKA 1VJTA 2A35A 2C0CA 4CMEA 3LVFO 3QVWA 5A3VA 2WSBA 1B3RA 4A03A 5ICMA 1HKUA 3AJRA 1E1LA 2OFPA 4A27A 2XPCA 3PQDA 2X5KO 2Q2VA 2BFMA 3GMDA 1NP3A 3DZJA 2VYVA 3I9MA 4FJ0A 2Z5LA 4LW8A 3IUPA 4GVLA 5TJ9A 4FB5A 1GEEA 2H1SA 3IQDB 6ADHA 5EL0A 3OETA 5JCJD 2OMEA 4ZQBA 4AG3A 5AVOA 3DB2A 4NFHA 4Y6SA 2EGHA 3HDHA 1NM5A 4OYRA 4AL4A 4JBHA 1LXCA 3DHYA 4LVCA 2VOEA 4J6FA 4U0KA 4CQMB 5KKAA 5JNLA 3RFVA 4DWVA 4YRDA 1QYWA 2CVZA 1QP8A 8LDHA 2B69A 3TZKA 3M6IA 1CWUA 4QUKA 5TLSA 4AJ2A 1E0DA 4BO1A 3HADA 4CM4B 4ND2A 4NPCA 5TRTA 3SJ7A 1EMDA 4M89A 1AXEA 5FYDA 3FNFA 4BB6A 3I9KA 3QIVA 1PEDA 3HB4X 2UVDA 4Y6RA 2YFQA 1MUUA 4CJXA 4GGPA 1T2EA 2GN6A 2Q1TA 4FS3A 5L4NA 4WECA 3NRCA 4WNCA 3ZN2A 1B3BA 3VDQA 4Y6PA 1UXKA 4HUJA 5TIIA 4E5NA 1CYDA 2ZYGA 5JLAA 4GGOA 4NBUA 4MKXA 2W2LA 4EUFA 1RM3A 4BGUA 1O95A 4TQGA 1LDGA 3GRKA 3ETEA 3ZWAA 1NQTA 4BV9A 2ZTUA 4E5KA 2Q45A 3M2TA 4JJFA 2HMVA 2I3GA 3AI1A 3ZDFA 1M6HA 1R4NA 3C24A 4WE3A 4XR9A 2P9CA 1E6WA 5I7EA 4GH5A 3QE3A 1Z7BA 3T7EA 2JFGA 2NM0A 4R54A 2V6MA 2NUAA 4NNJA 3C85A 4WGGA 2EW2A 4PCVA 4Q3BA 5BNIA 2F1KA 4AVYA 4W6ZA 1IB6A 3L6EA 4EGFA 5IN4A 4XJTA 2R6JA 2QYSA 3GDFA 1LLUA 1MGOA 4I9HA 3ASVA 3OA2A 1Q0LA 3HN2A 4RLHA 1UUFA 3WIEA 1QSGA 3DBRB 3UXYA 5T57A 2I99A 3CE6A 3GNSA 1JWAB 3GLQA 4XB1A 3GY0A 1ZNQO 4FC6A 4K26A 4LMRA 4PGFA 4BNFA 4BMNA 4J4HA 2O48X 3MZ0A 5IN5A 3T7CA 3KTDA 5B4UA 1IHYA 1SEVA 2X1HA 1U28A 1S7CA 2Q49A 1X0VA 4FFMA 4R1UA 1P3DA 4OAQA 2FHSA 5DP2A 5EN4A 3UAGA 3AUSA 2POQX 4F3YA 4J7XA 3QA9A 4UUMA 5AQ1A 3RU9A 4RPJA 1HDRA 4RPKA 3B1KA 3WSWA 1JN0A 4Z9XA 1JLLA 2OORA 3INGA 3ABIA 2XXBA 4OJNA 5IDXA 5JAZA 2Y99A 5TQVA 3MJTA 4K1LA 4PZDA 1PWZA 3OEWA 2DVMA 4R68A 4RJTA 4CM5A 4XYEA 1LRKA 3TFOA 2O3JA 1ISMA 1E6EA 1SC6A 3Q9UA 2GN4A 1BDBA 2H63A 2VWQA 4A5OA 3F46A 1QLJA 3GVXA 1XELA 5I9NA 1PZGA 3S2EA 4CV1A 4H7PA 5HS4A 3C1TA 3ZU5A 1YOVA 3DEYX 4GPD1 2OZPA 2BRUA 4F6CA 4TRRA 3HHPA 1SZJG 3JQ7A 4YQYA 4IJWA 1P77A 2E82A 1AE1A 4D41A 4IDFA 3OA0A 2PA3A 2OBNA 3JQ9A 1VRWA 4XQ9A 5CDUA 3FPCA 2ZB3A 3WYBA 4ND3A 2GUGA 4DTIA 1WP4A 3D0OA 2X0NA 4B3HA 3BTVA 3QWFA 3ICPA 3IKTA 1MXFA 2HMWA 4CLRB 1YJ8A 1P1KA 3MEQA 3CKYA 3WXBA 2WD7B 4Y9DA 2Q1WA 5KVCA 2BI8A 3MJ4A 4I1IA 3WMWA 1GL3A 3PXXA 2NACA 1AHHA 3FNEA 2IDZA 1QRRA 1OFGA 3QJ5A 5L3ZA 3RU7A 4CL3A 1KIFA 2GZ3A 4II2A 5JDIC 4FC7A 1ONPA 3SLGA 4E13A 1AXGA 1BXGA 1B8VA 2C5EA 5KOIA 1OMOA 2QRJA 3LC2O 1OZAA 1YBMA 1C1DA 3GPDG 5K6AC 1JKJA 2B4RO 1GY8A 1N9GA 2E37A 1GADO 3MOGA 4WPGA 3KSZO 4J7CA 1G0OA 5TT1A 4D42A 1C0PA 1GQ2A 3PWSA 4W82A 2I3AA 1RYEA 3LT0A 1MP0A 2NU6A 4K28A 1I0ZA 5JC1A 3DFZA 1M66A 5CHEA 2VZ0A 4R9SA 2YDXA 5ILGA 1FJHA 3WDSA 2YJZA 1E1MA 2DAPA 4NK5A 4RO0A 2PKQP 1C0LA 3H5RA 2CFCA 2EJVA 4TRMA 5JMPA 5L9AA 3F4LA 4IGFA 2ZB8A 4Z9FA 4TKLA 4Z6KA 4J2OA 1QYCA 3RFTA 2EIHA 4BNYA 3V2GA 3RUDA 1X7GA 3EZYA 1HE2A 1ZJYA 2B37A 4CMCA 3CEAA 2X86A 5F21A 4JK3A 3ZWOA 1KEWA 1RM5A 4WK6A 2CMDA 3JTMA 3WMXA 4CUZA 1RM0A 3WYCA 4YWJA 2Q2WA 3EDMA 3H9UA 3ZNPA 4BS9A 4J4TA 3QWIA 1LTHR 2Q50A 4HNHA 5T64A 4WEOA 2PGDA 1OOEA 3ADPA 5KNLA 4IZIA 4A26A 1U9JA 4YAKA 1LA2A 1PSDA 1Q1NA 4H16A 2GZ1A 3KBOA 2YV3A 2WYWA 3AY7A 3G1TA 3GT0A 1E1NA 3DOCA 1JKFA 3HB5X 2ZATA 4J0FA 4XDYA 3HQ4O 1L7DA 5COQA 4QQRA 1LSJA 1LDEA 1DJQA 1R4MA 1PGOA 2VCYA 4J16A 1VL6A 4ROSA 2CNBA 2YQ4A 1XHLA 2IZ1A 4D45A 4RF2A 1C3VA 3X2FA 4OXKA 5CP8A 3DBLB 3F3SA 4RDIA 4C7JA 2OXIA 3UUWA 3KHUA 4DLAA 2D8AA 1NPDA 4PLHA 2O4CA 1DDOA 4N5MA 1EVIA 1NFFA 5JS6A 2DBQA 1QKIA 4OM8A 1TT5A 2HO5A 2C7GA 2AXQA 1SB9A 4PLYA 2VYND 3DBVO 3NGLA 4A10A 1NR7A 4E0BA 3WYEA 3F5SA 5A05A 4LISA 1J0XO 4RORA 4CM9A 2VWPA 3CXRA 3GMSA 3GN2A 3JYPA 1PU2A 1KEUA 1GAEO 2YQ5A 1DIHA 3I9JA 4MVJH 5DP1A 3KYCB 3L4SO 3VZQA 4WLFA 5H81A 4BNXA 1KY5A 1SOVA 1JU9A 1Q0QA 5TJHA 3RSHA 2NADA 4BIIA 3SEFA 4MOWA 3GN1A 1HEUA 4KWHA 2BF7A 3OECA 5IXSA 4CQLB 3L9XA 1U8FO 1R15A 2Q99A 2DFVA 4M87A 4S1VA 3PFWO 4LK3A 3P5SA 3FTNA 3TOZA 1ZK1A 1U3TA 2P4QA 3BMNA 4KTTE 1MLDA 2GN8A 1DO8A 1BGVA 1Y5RA 1D7OA 4RV9A 1PR3A 1NQAO 1ZEJA 4M1QA 2FR8A 1A7AA 5G0WA 4TVBA 4FJ1A 4Q3DA 1W73A 3WGGA 1XIVA 3LK7A 4XWYA 5JYFA 1UP6A 4ZICA 4P4LA 4GX0A 2QZ9A 1E6UA 3FBGA 4OMUA 4MP3A 2QQ5A 1YXMA 3JQ9C 4LSWA 3ANLA 4U0JA 1V0JA 2J5QA 4J0EA 4MDHA 3V1TC 2BH9A 4OOEA 4BO4A 3DAGA 3C7AA 4CLDA 4ZA2A 1K3TA 1VL0A 5IF3A 1HLPA 1S6YA 3OIDA 4NI5A 4MINA 5IDWA 2EJWA 1HDZA 3AI2A 3RUFA 3O9ZA 4N5LA 4CM8B 3NDRA 4WCFA 3P19A 3ZV5A 5DZSA 4AJJA 3Q2KA 4J7UA 1HTBA 3DZKA 2FR1A 3DAPA 2QIOA 4MP6A 3E18A 2FPPA 1GYRA 4FBGA 2P9EA 4R51A 5JW6A 1EFKA 2EGGA 2Y1DA 1DLIA 1UH5A 1WLYA 2YDYA 4MVJA 1GV1A 5LDHA 4PLZA 1ENPA 1GTMA 4BNZA 1VI2A 4FCCA 2AQHA 4NBRA 3P2YA 2B0JA 3D64A 1NAIA 3ZWBA 1B26A 3KXDA 2OUIA 2QZZA 4KUHA 2JD1A 3PTZA 4J9VA 1R0SA 4O59O 2VRCA 5G4LA 3GAFA 3PEFA 3PDJA 4GX2A 1NPYA 2AEFA 5IJZA 1E7QA 3TZHA 4OOFA 4GLLA 4L8VA 1O8CA 1YS4A 3WGZA 3RVDA 1GU7A 3L77A 4H15A 4EYEA 4XYLA 5JC8A 4QEDA 3BZUA 3ORFA 1YB4A 2BI7A 2C29D 3WFJA 3LDHA 5JYDA 3H9JA 3QVTA 2TMGA 3WTCA 1LQUA 3PYXA 4OIMA 1Z73A 3Q11A 3O03A 4IUYA 4KZPA 3BMQA 3ZHXA 3KM0A 3ST7A 3RI3A 4RF4A 4DC1A 2NNLD 4N5NA 4YJFB 1FF9A 3NTOA 3EW7A 5L51A 3RC1A 4IDGA 1DIAA 2DTXA 1Z75A 2CDCA 1ZH8A 4QO7A 3K2BA 3RCBA 3ZWMA 1WVGA 4B8ZA 3VZPA 2BLLA 4MKZA 1IOLA 1R0LA 2LDXA 3G1UA 4GX5A 3RKUA 3SX2A 3C8MA 1N2SA 1I10A 4IQ8A 1E3IA 5COBA 1X0XA 4CM6A 3FBTA 1XSEA 3U4DA 5DBIA 2NQ8A 1I01A 3JQAA 2B5WA 2FMUA 2WE7A 1P1FA 4I5DA 2VUSA 4XD2A 4BNHA 1MX3A 1T2FA 3ETGA 5CDSA 1JWBB 3GOHA 3L4BC 3C3XA 4U7WA 5LCXA 4MP8A 4U6QA 4CMJA 1ENZA 2O7SA 3E9NA 3KYDB 3ZU2A 4E5YA 2Q4BA 3K96A 1IPFA 4XB2A 3ZCXA 4L9RA 2QX7A 4RPHA 3UKOA 3PZRA 1HSZA 4L4SA 3ZWXA 2PR2A 1L7EA 1E7RA 3CH6A 4GWKA 4P4NA 4KQWA 5JAQA 2CUKA 5JYEA 3MJCA 4BHTA 1A9YA 2DPGA 4B3JA 3DTTA 3GZNB 1KVQA 4QX6A 4QECA 3IS3A 2PKRA 1JVBA 3JQBC 3BMCA 2O3QA 4D46A 3RROA 4JP3A 3OFSA 2VOJA 5BQFA 2P5UA 4J3FA 3HNPA 1YKFA 4DQUA 3AU9A 2DUUA 3TOXA 4ALMA 1VM6A 2C07A 5JAMA 4DREA 4FFNA 2FWMX 1N8KA 3AFMA 1XCBA 1KC3A 4MIYA 5A5EA 4RVFA 3GK3A 3QWAA 4GAEA 4IPTA 4FDAA 3ZU4A 1EE9A 1EK5A 1E5QA 3GPIA 4MO2A 4EUHA 2DKNA 1AUPA 2VZ9A 3QWHA 1UXGA 5GY7A 1LQTA 3O8QB 4YRBA 3W4IA 3FN4A 3GH3A 2X0IA 4NBVA 3QQPA 1NHGA 1WPQA 3RBZA 1F06A 1LC0A 4RPLA 3S2GA 4L0QA 2GSDA 3ZHYA 1I30A 4E2ZA 2CVOA 3KOUA 1WMBA 1BHSA 1R6DA 4UREA 2RH4A 4MVJE 2OO5A 1B14A 3PPIA 2AG8A 1LX6A 2V6FA 2I66A 3DOOA 3W6ZA 2J3JA 1ADBA 2NQTA 2Y1FA 3ONFA 3U62A 2DPHA 1ZKMA 1Z74A 4BO2A 1SEPA 2WD8A 2Y68A 1Q7CA 4F45A 1XGKA 2X7HA 4D79A 1I8TA 1Z7EA 4RCVA 3LLSA 3FWNA 4WCFC 4CV0A 3GDGA 4MJLA 3AUAA 1EBFA 4IDDA 4JJIA 2ZJ1A 5FI5A 2X9NA 3RQSA 4EI2A 2RHCA 3PHJA 4YXFA 2BGMA 2VWGA 5THQA 3UICA 2R2GA 4BNKA 4PG4A 3DQPA 3NEPX 3KVOA 3X2EA 5L45A 5AYVA 1P1HA 3ENNA 3FNGA 3JQ7B 4BNIA 1O89A 3D4NA 1NASA 3FRJA 1ZK4A 3OBBA 1DAOA 5HBRA 1PWXA 2BKAA 2WJPA 3S2FA 4UUOA 5TS3A 2BFOA 4J90A 1KS9A 2IZZA 4XGKA 3ZW8A 2X8LA 2YFHA 3H2SA 5TF4A 3SXPA 3S55A 2GERA 4Q3AA 1WAMA 1ZBQA 1D1SA 4UEOA 2EKLA 2V65A 4GKVA 4D43A 3KETA 3E8XA 1Y9EA 4FPXA 1U3WA 2Y1GA 4EJ0A 4ID9A 3DAFA 5IDQA 3TL2A 4UEKA 3COSA 4EITA 3GG9A 1I3NA 1U3UA 2VHZA 1BW9B 1YQXA 1ENOA 1YBVA 1R12A 3OIFA 3PWKA 3OJ0A 4GVXA 4PLPA 2ILTA 5BR7A 2JD2A 1KVSA 1BMDA 4PVCA 3TFQA 5L4LA 4M55A 5KTKA 2FRDA 4DPMA 1PJCA 3EY4A 1PGPA 1BXGB 5JDIA 4M49A 2VYVD 2UUPA 2JAPA 3A1NA 1Y8RA 4BO8A 4MVJI 1C1DB 1W0CA 1HDGO 5KWEA 1UR5A 1XKQA 2X58A 3JYLA 1PS8A 4N54A 1NNUA 5K6AA 3D3WB 2XOXA 1PJBA 3NGXA 4JXKA 3WLEA 1DIBA 4IINA 1OC4A 4BNJA 4B79A 5DT9A 4YAEA 5KVSA 5CG2A 1R37A 2A92A 5G2OA 5L4SA 4CLOA 1CQJA 5IXYA 4BMVA 4NBTA 3BTUA 3DDNA 3GDOA 5B4TA 1NVGA 1PQPA 1ZK2A 3H7AA 4BGEA 5L7YA 1X7HA 3EVNA 2XAAA 4GX1A 3Q2IA 3OM9A 4UAGA 2Y0CA 3JCZA 2OOSA 1MC5A 3KSUA 5ENVA 1P44A 3JYOA 1MV8A 4YAIA 3E48A 4E33A 2DTDA 3WICA 4YACA 4B7XA 3BYZA 2VT2A 5HWSA 2J5KA 5JCXA 5EESA 3OJLA 4YR9A 3BHIA 4Z9YA 2X9VA 4S3MA 1X14A 1QYXA 2W2LD 1ORRA 1ISFA 4QTZA 1YL6A 3AY6A 5KJFA 1IPEA 1P74A 2YYYA 2O3RA 2ZYAA 5BNTA 1ZUD1 1IE3A 3G3EA 3AM4A 2X22A 1SMKA 4J49A 3ROQA 1H6AA 3T4EA 4CMIA 4R5HA 2VNAA 3ZH2A 1TB4A 4W9NA 4DLBA 5C3MA 4NFYA 5ER6A 3D3EA 2CF5A 5COAA 4MKRA 1KEVA 1DJNA 4TSKA 4UVIA 3ITDA 4ZU3A 1ZIDA 2QHXA 2UUOA 3BAZA 1PJQA 5F5LA 3W1VA 5JE8A 5IZCA 2FN7A 1E3WB 4IDAA 4ZQFA 5A9SB 3VTFA 4R1NA 5J9GA 1FDVA 4YJGA 4BKPA 3DZHA 2P91A 5A1TA 3R6DA 4AICA 3V8BA 5JO0A 1T2DA 1RKXA 1N7GA 1ADFA 3K9QO 2BMAA 4BKRA 4DIBA 1ISHA 4HX5A 3W4JA 1DPGA 1YL5A 4I5GA 5KKCA 2I5PO 1WDKA 4IMPA 2Z1MA 2VUTA 3LT2A 4YYZA 1E1KA 1QYVA 1ZJZA 3JQ8A 4JIGA 1C14A 3NT4A 3C7DB 3DHNA 4LRTB 3KZVA 4PG6A 4A0SA 5G4KA 4BNMA 4PRLA 3IIEA 1XLTA 3JQ6A 2NVUA 1Q7GA 1TI7A 3C7CB 1IZ0A 1JKIA 4DBVO 3EYWA 5GZ6A 2IYOA 3VKUA 2E6UX 4AJNA 1KETA 3AU8A 4QXMA 4I9UA 1JTVA 4OKNA 3S2IA 1PJ3A 4LCEA 3KO8A 4XA8A 3PYMA 3RJ9A 3TQHA 4DMLA 4OXYA 3B1JA 2Y1EA 4O63O 3DHEA 3HDYA 1IY8A 2GRAA 3NAQA 1EUDA 2O2YA 1CDOA 4CLEA 3D4PA 2YY7A 3EVTA 2G82A 4OH1A 3AW9A 4IJVA 1NX6A 3WNVA 4BKOA 3ZHZA 1Z45A 2YZ7A 2JFHA 4L4XA 3TZQA 1M76A 4CL8A 5TC4A 4AJ1A 3RUEA 3NDJA 1OC2A 3RBVA 3VKVA 5L53A 2HKIA 2Q1UA 1G1AA 4GKBA 3ZWYA 4BKUA 3GNQA 3F5QA 5I9LA 3ROPA 4P22A 4XX0A 1P9LA 5ITVA 1H94A 1K89A 1YQDA 3KB6A 3GEGA 3OJOA 4CUKA 3IDSA 3UF0A 3GZ4A 3W4KA 2P5YA 2I6TA 5I9MA 5B4VA 5AXDA 1A71A 1D8AA 3U3XA 1CJCA 1TXGA 4L73A 3UN1A 3VHRA 1K6IA 4EJ6A 2YHIA 4Y67A 4R3NA 3IJPA 3NDIA 3HDQA 2SCUA 3S8MA 2ZB7A 1ZXLA 1NXQA 4DRYA 1T4BA 4NH4A 3F9IA 2XF8A 3B6ZA 3OEYA 4OKIA 4AJPA 1VSVA 2Z1NA 3D5QA 3BHJA 3NUGA 4BV8A 4R4JA 3F1LA 1C1XB 2VWHA 3EMKA 3PLNA 5BSHA 1RM4A 1YQGA 2QYTA 2IE0A 2DQ4A 3H2ZA 3GEMA 3HN7A 2YUTA 1R0KA 4KUGA 4HKTA 4IIUA 3M2PA 2V6BA 2W4QA 5L7TA 2PD3A 4KDFA 3M1AA 1Y8QB 2HAEA 1HYHA 5CDGA 3MTGA 1WDLA 5FEUA 4YB8A 1LLQA 3PDUA 9LDBA 4KWIA 3U4IA 4P38A 3QP9A 1DIGA 3V1UA 2B83A 1FXSA 1XYGA 3GFGA 1NYTA 2HCTA 4II3A 5KVVA 3T4XA 3NT2A 3DBHB 1J5PA 4JLWA 4RZHA 3WGTA 2AHRA 3O26A 1LDBA 3ZV4A 3DZFA 4ITUA 3MWDB 1JQBA 2GPTA 4CQMA 3TN7A 2BGKA 2PZLA 2Y93A 3QY9A 1I3MA 1QV7A 3BA1A 4HFRA 4Q39A 1B15A 2IYPA 2C7VA 3UOGA 2PGLA 4Y98A 4CM4A 5JFOA 1PZEA 4C4OA 2NU9A 3PGJA 4NIMA 2JHGA 1SO8A 1WDMA 1EEHA 3GR6A 4O0LA 3TWOA 4B4WA 4JP2A 4DYVA 4EBFA 4HBGA 1NHWA 5CPBA 1ONNA 1YGYA 5GZ1A 5A9TA 1AN9A 5TNXA 1ISGA 2NTVA 3LYLA 1FMCA 4KUEA 4AJKA 5DBGA 1C0KA 3WQRA 4CMHA 5B1YA 4W9NC 4IDEA 3ADOA 4Z0HO 1GZ6A 4XGNA 5U9CA 2VTEA 4OHUA 3QHAA 2PH3A 3H5NA 2DC1A 2IZ0A 1CERA 1WWKA 3PIIA 3L4BA 1EDZA 1UXJA 5DCYA 4RVUA 3S1LA 2ZKLA 2C2YA 1ZVMA 1WXDA 2C54A 4RF5A 4Z0TA 1H6BA 1DRWA 1LDYA 1SBYA 1PR9A 1SOWA 2AQKA 1RJWA 5JMWA 1UP4A 3Q9NA 1Q2XA 4PN3A 2OBYA 3KEQA 2Q1SA 5IZCC 2EKQA 3ZWNA 2Q3EA 2GD1O 1TLTA 3IP1A 3I83A 4B4OA 4KP7A 2VHVA 1A4UA 2ZK7A 4PIVA 5C37A 2RH8A 4YPOA 4ZHSA 5JSFA 2CDBA 4UVGA 5TSDA 3N58A 4CM9D 8ADHA 3JQBA 2ET6A 4ONEA 2E48A 4E31A 2CZCA 3AFNA 3GAZA 5KJ1A 3OQ1A 4WLVA 3JQCA 1GYQA 4D44A 2O7QA 2FY8A 3LZ6A 2GLXA 1PJ4A 2G0TA 1ZEMA 3JQGB 3DBRA 3AUUA 2NLOA 3OHSX 4PG5A 7MDHA 4YAGA 4HWKA 5A04A 1TEHA 1E7YA 1LSOA 4DYDA 4PLCA 1H2BA 4D0SA 3Q0EA 1AGNA 3DXFA 1PL6A 4XIJA 1WMAA 1NR1A 2Y66A 3M1LA 3I9OA 4UULA 3WWZA 2Y1OA 4B7UA 3GEDA 4E4YA 2AQIA 2WWRA 1I36A 4TROA 5HS6A 5A5FA 4WKGA 1NPTO 5JBIA 2FPGA 1Y5MA 4YTEA 4ALIA 3I4FA 3H5AA 4DMMA 1ZXBA 3C1AA 2J3IA 4CPDA 4DC0A 5EINA 1BTOA 3AY3A 4WLUA 5EJ2A 2EP5A 1SNYA 1IULA 2Z95A 4PLVA 3LQFA 3NTQA 3LC7O 1KBZA 3NYWA 4JGBA 4NU6A 4BNLA 3VZSA 5FWNA 3FHLA 5AXAA 1WNTA 4ZGWA 2FZEA 3HSKA 3AK4A 3D5TA 1P33A 1A7KA 1HDCA 1I33A 3P7MA 1P1RA 1T24A 3F47A 5K0ZA 3LT1A 1QORA 1H5QA 1P0FA 4CUJA 4YVFA 2LDBA 2UDPA 3NT5A 4MVJF 4NR0A 3RWBA 4XQEA 3I3OA 2PLAA 3QVXA 5T67A 4BO6A 5BSGA 1LDNA 2V6GA 2VRBA 4YA6A 1HDXA 2JCYA 2VHXA 2JFFA 4MVJP 5L7WA 2WTBA 1PL7A 4Z3DA 2IRWA 2C20A 4G65A 2JL1A 5ICSA 4ZJUA 3BXXA 1YRLA 2C2XA 2VHWA 1EVZA 4AJEA 4MVJD 1JW9B 1P0CA 4B8WA 4R01A 4CM3A 1UDAA 2ZCUA 3ON5A 4MIOA 1KEPA 1X1EA 3Q3CA 2D4AA 3NJ8A 4CLRA 1GZ4A 3PK0A 2RHRA 5H82A 1B16A 1DB3A 4PLWA 3W8FA 1VJ1A 3WBBA 4L76A 1DC5A 2DBZA 1MG0A 1QLHA 2VRCD 2OP0A 1KYQA 3JQEA 3SC4A 3WNQA 3ZV3A 2X6TA 1CEQA 4OQZA 1NFRA 2G17A 5EIOA 4J9UE 2I76A 2GZ2A 3GA0A 4FFLA 4YJHB 4A73A 3RC9A 3VC7A 4EEXA 2HQ1A 1H9AA 1NQOA 4L74A 4CR6A 5ER9A 1LUAA 5CEEA 1A9ZA 3JD0A 3UCXA 1SAYA 2HK9A 4P4GA 2PD4A 5DDIP 4MIEA 5AXBA 4XRGA 1LSUA 5KIAA 3GC6A 2EG9A 4CODB 1ZFNA 4RF3A 9LDTA 5AXCA 3VVCA 4B3IA 5F1OA 1JVSA 4XIYA 3F6YA 1UXIA 1VSUA 3JQFC 3F4BA 4QSMA 4E2XA 3KV3O 4Q3NA 1UDCA 4FN4A 2C59A 4E2WA 3GGOA 4AJLA 4TKMA 5MDHA 3R0IA 4JNKA 1X7DA 4I08A 2DTEA 3W8DA 1N1GA 3QV1A 1XU7A 4TMFA 3CUKA 1F17A 3VAZA 1PGJA 4TZKA 3FWZA 3ZV6A 3L6OO 1PTJA 3K73O 4QT0A 4J91A 1M6WA 2BHLA 3JQAD 4EZBA 2GYYA 4OSPA 5U1PA 3IAHA 4Z3KA 1EVYA 5B37A 3PP8A 4ALNA 4Y8VA 2VT3A 5G0SA 4INAA 5I7VA 3LSYA 3W6UA 3G17A 1RYDA 3VPFA 1UZLA 1T26A 3ROMA 2NSDA 4TWRA 3FCOA 3PIDA 1P1IA 1YONA 4H3VA 3K5PA 5CG1A 1ONOA 3H9EO 1EUZA 1GDHA 1J6UA 1PGQA 2W2KA 4LMPA 1FDTA 2D0IA 3JD4A 3OICA 1CRWG 5A9RA 4TRNA 4RQUA 3IKVA 1KOLA 3QSGA 4WASA 2IODA 4PLFA 4FOOA 3JD3A 5CAEA 1B8PA 3SC6A 1O0SA 1RPNA 2EKPA 4M8SA 3DMYA 1R4NB 1YO6A 4U6SA 1HRDA 3ZWWA 2YV1A 4BNVA 4R3WA 2QRLA 2HRBA 1NBOA 2UV8A 3VPXA 1W4ZA 4R16A 4D3DA 1DOHA 4W7HA 1BVRA 3ZU3A 3ZNQA 3VH1A 1I2ZA 1U7TA 5ENDA 4JJGA 3OF2A 1YJQA 1HYGA 1O6ZA 3D7LA 1HDOA 2O23A 2D2IA 1EFLA 1ZSVA 2IEBA 4PFJA 1GR0A 4R1SA 3AWDA 4W7IA 3ASUA 2DFDA 3H9GA 3D4OA 3JQDA 4E21A 4AJOA 4E2YA 2EXXA 1BWSA 2O4UX 4XDZA 1HXHA 5F1PA 1OAAA 2GDZA 3PQFA 3DZBA 3MJVA 4B4VA 1LC3A 1QV6A 1BRMA 1YWGO 3JYQA 4B4UA 4ZN6A 3PZBA 1TT7A 4FSHA 3GUYA 1DIRA 4FGSA 3O4RA 4IJUA 3DTYA 4GBJA 3LT4A 4I5FA 4IBOA 5DBFA 5G0VA 4FJ2A 3PHIA 4CQLA 4IQGA 1QG6A 3VVBA 5C5IA 1VL8A 2NU8A 1VLLA 4I8XA 2ZYDA 3IL2A 1XQ6A 1J4AA 2OL4A 3IUSA 4J1SA 2NVUB 5JY6A 3IMFA 1I32A 3Q1LA 4JBIA 1GD1O 1IL0A 1NFQA 4X54A 1LBEA 4BO5A 5DOZA 4AJIA 3INTA 1D1TA 3A28A 3CMMA 4OO3A 4XYGA 2IXAA 1M2WA 4ILKA 4PZEA 2R00C 1DHTA 4R1TA 3TRIA 4AJHA 1BVUA 4NJMA 3ULKA 1UXHA 1DFGA 2AG5A 2ZIZA 3CPSA 1UAGA 1YOVB 1WW8A 3RUHA 1UAYA 4ND1A 1PS9A 1T1SA 2VN8A 3WQSB 3I23A 4PG7A 1NQ5A 3PGXA 3L0DA 1VKNA 1D3AA 1EBUA 3STHA 3WGYA 4BQPA 4PZCA 1UJMA 5JXWA 2VZ8A 4CM8A 2UAGA 3QW2A 5FI3A 3RD5A 1T2CA 3JD1A 2FOIA 1U7HA 1O94A 1E7SA 5TX7A 1T2AA 1B0AA 3WB9A 3U4CA 3AM5A 1K6JA 4RVHA 3BIOA 3UVEA 2HK7A 3DWFA 2JAHA 2PZKA 2YHIB 3DZIA 2I65A 4NHEA 3LF1A 2P9GA 4J43A 4KTVE 3WOHA 3VZRA 2WE8A 3ENKA 4WLEA 4BNGA 4CMAA 1ID1A 3A06A 2DBVO 2CY0A 4CV2A 2JJYA 1HDYA 3GHHA 1Y81A 4NK4A 4ND4A 1Y6JA 4UVHA 3A14A 4WUVA 5A4DA 4IZHA 3GGPA 4IDBA 2NVBA 3GHYA 4GMGA 1DC6A 2YHUA 4ZD6A 3KLPX 3PFFA 4BNTA 1N9GB 4J4BA 1QXSA 5KJ6A 1B8UA 1IZ9A 2VQ3A 4LVUA 4E30A 3CZRA 4IS2A 1U5AA 1HSOA 3LF2A 3PHGA 3PRJA 3U9LA 5JDCA 4ALJA 2WM3A 1G6KA 3FR8A 2EERA 2P2SA 3FI9A 4YT4A 3MJSA 1XU9A 5JAIA 5JCJA 3WJ7A 5C7IO 3E9QA 1HE3A 3OQBA 2H6EA 4YJFA 2D5AA 1MFPA 1IYZA 1EUCA 4PLTA 2G5CA 2VNSA 4ND5A 5EQFA 3NJ4A 3OQ6A 1HE5A 2DU8A 2HLPA 3I1JA 5A03A 4KDEA 5G0TA 5JYAA 3B20A 3KRTA 4NFSA 1DSSG 5KVQA 1UP7A 1K2WA 1CQIA 3I6IA 4RLSA 5LC1A 1VJ0A 2FSSA 2NWQA 3IC5A 1MC4A 4DGSA 3WTBA 2CDAA 1HT0A 2F00A 2BD0A 4DIOA 2X5OA 3UHAA 4EW6A 1DHRA 4TRJA 4TZTA 4HXYA 2QG4A 1SB8A 4OL9A 4IXWA 2Y1CA 5CEFA 5DF1A 1X15A 1R4MB 3HUDA 3WJAA 1VC2A 3KYDA 2CVQA 4NMHA 3TPCA 1NVMB 4AJ4A 4ZQEA 5T5QA 3NKLA 3BMOA 3FPLA 1TA4A 2XXJA 3U49A 1HETA 3HZZA 5EPOA 1VPDA 3H3JA 3I9NA 4IS3A 5T8KA 3GFBA 4CM7A 4BNUA 3GQVA 4WLNA 4LCJA 2NVWA 2WYVA 3GZNA 1P45A 4YJDA 2HUNA 5AOVA 4D0RA 1FDUA 1TT5B 1U3VA 4F6LA 4MVJM 3I5MA 4K6FA 5FF9A 3RJ5A 3PQEA 2B36A 2VHYA 2W8ZA 2PK3A 4DIFA 4ALKA 2ZQZA 3TF5A 4YQZA 4BO9A 3FSRA 1ARZA 1ZCJA 2OHXA 2O2SA 3EGOA 1NWHA 1BXZA 2DUWA 2GN9A 2GO1A 2ZTVA 1HE4A 5DNAA 4OXNA 1F8FA 1VE9A 4KQXA 1A4IA 3PLRA 4JBGA 1U5CA 4FR5A 2RBEA 1YL7A 2GF2A 3JYNA 1OBFO 1PX0A 1ULUA 1XWFA 3ONDA 2X23A 3PI7A 1PL8A 3FNHA 4IM7A 3O8QA 1GPJA 3NTRA 4DPLA 3VPHA 3BMNB 3WS7A 4DQXA 2Q46A 1V3TA 3AOEA 5ES3A 5CEJA 3PJGA 1GV0A 4DL9A 4BOYA 2EHDA 3L9WA 3VDRA 2GASA 2HMTA 4ZRNA 4QO8A 3OSUA 4JN6B 1LSSA 4KOAA 1ZMOA 2JHFA 3R3SA 5IFLA 1G0NA 2C82A 3EAGA 3DFUA 4NJOA 1BG6A 2JD0A 3G49A 3K30A 1E3SA 2VUUA 4XR4A 4YT2A 4GI2A 2PNFA 1AHIA 4FW8A 3KUXA 2PH5A 3ZWVA 2PD6A 1MXHA 1EDOA 1R16A 1E3JA 1HYEA 2AEJA 3V1YA 1WZIA 2C5AA 2FP4A 3CSDA 5KJEA 3HFGA 4WCFB 1LEHA 1GUZA 1ZK3A 2NU7A 4UUNA 5C7OO 4JROA 1U2GA 4CMBA 5EERA 3E82A 3K2EA 1BXKA 3E5RA 2D1YA 2DM6A 1ULSA 3K31A 3GVHA 1F12A 2PV7A 5A3JA 3QRWA 3K6JA 5I7FA 3FTPA 4LRSB 1KVRA 2YV2A 3EHEA 3MOIA 4DXHA 4CMGA 1NWCA 4ESOA 1DAPA 2H9IA 2ZB4A 1HZJA 3HJAA 3LLVA 5DCUA 2X4GA 4D3SA 1YVEI 5DCWA 2AEMA 1HF3A 1LLCA 1U1IA 4BO7A 4CMEC 1ENYA 4FIZA 1BW9A 3N7UA 3ICCA 4G5HA 5JDCC 3WGOA 5J23A 1PJLA 4RZIA 4G2NA 2HJSA 2ZTMA 1T25A 4E5PA 1GUYA 3G79A 1HZZA 4XQCA 4GLOA 5H83A 1LU9A 1LNQA 5M6DA 3CINA 5L40A 1ZW1A 3TJRA 1GCOA 5EQDA 3NX4A 4JCOA 3ZNNA 2BFPA 2HJRA 1Z82A 3WX0A 3BMQB 4I9NA 4IDCA 4RVGA 3VH3A 4A2CA 3D1LA 2CSUA 2HU2A 4WLOA 3ANMA 4XZ3A 2BELA 1KVTA 3D3WA 2GCGA 3W8EA 3WGHA 1U2DA 3ZGYA 3ZWPA 1YDWA 4PVDA 3JQFA 2PZJA 4CQMD 1V6AA 2WEKA 2JCXA 1XQ1A 2FR0A 1QMGA 5B12A 4O5OA 3RFXA 4ZQHA 3ZW9A 3VOSA 4GQAA 1W6UA 2DLDA 3F1KA 4O1MA 4XCVA 1LLDA 3R3JA 2DT5A 3JQAB 3RUAA 1UDBA 3HE3A 1Z6ZA 3WGIA 1I24A 3PJEA 4NBWA 2Y0EA 4HFMA 1O9BA 3VPGA 2Y05A 4R69A 2BFAA 3ETDA 3K8ZA 3PVZA 4NDNE 1Q0HA 2TMDA 3L07A 4Q3EA 1H93A 1LRLA 1N7HA 5IDYA 2EP7A 3EK2A 4P8RA 3TZCA 3WWYA 4URFA 5U4QA 1M75A 5F5NA 1DBVO 5TT0A 4CLXA 3H6KA 1U4OA 1A5ZA 2B4TO 4BO3A 5T8KC 3DO5A 1PJSA 1DRUA 2W2KB 3KLMX 1I3KA 1GFSA 2WMDA 4IJKA 4AFNA 3CIFA 4FFPA 4BNNA 3FD8A 4XQGA 7ADHA 3HDJA 1E7MA 5G0UA 3IOYA 4G81A 4IGEA 5ITWA 2EW8A 2CD9A 3FF4A 3E9MA 1ZK0A 3E03A 3GRPA 4M54A 4YDRA 2ZQYA 3VTZA 2HK8A 2J8ZA 3C1OA 3VPSA 4NU5A 1E3LA 3DMTA 4E6PA 1LI4A 3ZZNA 3RUCA 1PGNA 3BMCB 2FPIA 4UEJA 4WEQA 4EJMA 4R41A 1A72A 1P1JA 3DL2A 2QRKA 2WDZA 2B4QA 3Q6IA 3LC1O 5I8WA 1PZFA 4I5EA 1BSVA 1V3UA 4FD3A 1E3EA 1R66A 4R9RA 1DLJA 5JPIA 1MFZA 4LN1A 3QVSA 5F3RA 2VYNA 1H0KA 2HRZA 1E3WA 3GVCA 2JKVA 3VH4A 5A9SA 4IQ0A 4YAJA 1NAHA 4HFJA 6LDHA 5MGBA 5I7SA 1GUFA 1RWBA 3U5TA 1V9LA 3AOEC 4IXTA 4Q9NA 3MTJA 1FDWA 1PS0A 2EWMA 4CR8A 1F14A 2O50A 1M67A 4RVDA 3PJFA 5CDYA 3IP3A 1PJTA 2EF1A 4L75A 1ISJA 5TGDA 4YCAA 5KJCA 1NVTA 2O3SA 4XKJA 4U8GA 4F46A 4CV3A 4UVDA 4NZ9A 4K6CA 4DBZA 1V35A 5IAAA 4BMSA 2GGSA 4GL4A 1X13A 4WNIA 1U4SA 1QR6A 1YBAA 1O5IA 3OJEA 4XJSA 3WQQA 5A02A 1N1EA 2ZCVA 1IUKA 2WYUA 1T1RA 1YH3A 3ROKA 1YDEA 5BSFA 4J1QA 4NG5A 1PQUA 3I4CA 3I6QA 4WCDA 1A27A 1W8DA 4ZVVA 4RQTA 4NJMB 4DVJA 3INRA 3UW3A 2R00A 2PY6A 3OJFA 4W4TA 3KYBA 4BVAA 3RAJA 4ALLA 1I2BA 4GMFA 3AOGA 2B35A 2OP1A 5F1KA 2H5LA 4YBZA 1MG5A 5GZ3A 3NV9A 1VKOA 2O3UA 4RPGA 3OH8A 4MVJG 4GSKA 2PTGA 4BL5A 3ANNA 1ZSNA 1J49A 1UZNA 4XRRA 2ZTLA 3ONEA 4FOSA 1JDJA 4WOJA 1I5RA 2G76A 4CMKA 3WG9A 5A06A 1DC4A 1GPDG 3G0OA 4LGVA 3BTSA 1XG5A 2WD7A 1K5HA 2D5CA 4XEHA 1XEAA 5HRUA 2Y67A 2PFGA 3U09A 1CIVA 2YW9A 3WSVA 1U8XX 2AW5A 4QFDA 2FSVA 1ZZEA 3A4VA 2D59A 1ZMTA 4U5QA 3DZGA 4DA9A 4DPKA 1XR3A 1H2HA 5DULA 1EVJA 2A94A 3H3FA 4RVSA 3SBOA 3V2HA 4CM1A 4W99A 4B7CA 3QWBA 5JY1A 4BB5A 1PQWA 4XGIA 4WOKA 1DFIA 1C1XA 3KEOA 5HM8A 4D7AA 4PRKA 1GCUA 3H4VA 5T73A 1E7WA 3O38A 4WJZA 1XDWA 3CZMA 1Q7BA 3QLJA 4E12A 3JV7A 1DRVA 1Y8RB 1CF2O 2GR9A 3V2UA 3WLFA 1H6CA 1H6DA 1K0UA 2IXBA 3U4HA 2W90A 5T6BA 3B70A 1Y8QA 1K6XA 4CR7A 1GEGA 4BUCA 3WIDA 1HL3A 4J2HA 1ZSYA 2ZJ0A 3RC2A 3UFXA 1HWYA 1YE3A 1B7GO 4DLLA 5C7LO 1MB4A 2AA3A 4CLOB 1EZ4A 3DBHA 4DQVA 2PWZA 5JO9A 1XA0A 2DBRA 2RCYA 2HDHA 2NTJA 4N18A 3IJRA 4Q3CA 5LDGA 5ILOA 4A7PA 3R1IA 2J5RA 1JAXA 3A9WA 2EEZA 2Q2QA 4OQYA 1DXYA 3E1KA 4IIVA 5IZ4A 1N92A 2Q4EA 2Y0DA 1BDMA 1Y9AA 3PJDA 4DUPA 5K9ZA 2JCVA 3ZHBA 4EDFA 2VTDA 3EC7A 5GMOA 5THKA 1F0YA 1LJ8A 4RL6A 2BGLA 4FFOA 4BNWA 4HFNA 2EV9A 1SCUA 2X0RA 1QYDA 4YEDA 1WZEA 3GUCA 4Z0PA 4E5MA 4JX8A 4YT8A 1OI7A 1FDSA 3L6DA 2J3HA 1ML3A 1PZHA 1KERA 3CTMA 1N5DA 1PJ2A 2PZMA 3DMTC 2FZWA 1E5LA 1GZ3A 1T4DA 3RUIA 3ZNOA 1IHXA 1E92A 4LSMA 3WGQA 4J1TA 1EQ2A 1ADGA 3MCVA 5FFFA 3KSDO 4HADA 4TVOA 3UCFA 3TSCA 3UCEA 3ZWCA 4CMIB 3JD2A 5DOVA 4IMRA 3GNTA 1KY4A 4O6VA 3BMOB 3WFIA 1Y7TA 4J1NA 2OGUA 2A9FA 3DBLA 3SJUA 2I67A 2O3TA 1JA9A 3SLKA 1LRJA 2P4HX 3PHLA 3EZLA 3MJEA 2AQ8A 4ZQGA 1ZO8A 1ISIA 3AI3A 3DC2A 2IEDA 1KVUA 5EMHA 3RC7A 4RGBA 3K92A 1UZMA 3TL3A 1I3LA 3RKRA 2UYYA 1GQQA 2PGJA 4RDHA 5L95A 1I2CA 2E4AA 3UH1A 4EEZA 3MWEB 2HSDA 1NTOA 4YJGB 2J3KA 3HFSA 4XYBA 4XYMA 3KYCA 4JQCA 2RIRA 3EUWA 1LDMA 5BNFA 3WR5A 3GG2A 2X5JO 3GVIA 3JQGA 3GVPA 1DFHA 2RAFA 1GQYA 3AUTA 4M86A 4FQ8A 5DN9A 3JQ8B 4KMSA 4ZRMA 2GNAA 1DEHA 2QW8A 2HMSA 1Y1PA 5CFZA 2P68A 5G4KB 1EK6A 4IY1A 2PKQO 4PG8A 3DOJA 3I9LA 2X9GA 1P31A 2I9PA 2V7PA 3PYLA 5I8ZA 3VH2A 3UGKA 4BKQA 3TZ6A 2W98A 2HMUA 1DC3A 3HG7A 2Q22A 2J6IA 4GSLA 3ITKA 3TNLA 4FFRA 5CPFA 3OMLA 1ADCA 4GWGA 5KCZA 1YB1A 3OP4A 1KC1A 3SVTA 3BTOA 4UVEA 1B2LA 2B5VA 3GF4A 1EQUA 4N7RA 1HLDA 2NTNA 4OSOA 4MPDA 4CLHA 3PHHA 3PWZA 3GGGA 1H9BA 5BSEA 4E32A 2E49A 3RBXA 3RASA 1F8GA 2G1UA 4HV4A 4D3FA 4BGVA 2NV6A 3AM3A 5BT9A 4E3ZA 1CETA 5CDTA 3BHMA 3H9QA 3H65A 1MA0A 1V3VA 3I52A 3FR7A 4YRAA 3HWRA
chains in the Genus database with same CATH superfamily
1G5FA 4UBIA 3X43A 3E2MA 2JLAA 4KPUA 4UW9A 1T2VA 2P6MA 1USUA 2ZYHA 1GG5A 3HSYA 5DXFA 1X1TA 1QGZA 4B3CA 2XEDA 4P35A 4YT5A 3SS9X 4YMVA 4ZCPA 2OA0A 2AE2A 4JOBA 5DBHX 5BN3B 2UYGA 4HNGA 4UDOA 3TLCA 1JTEA 3E6AA 1ODKA 4KLCA 1IZYA 3KT0A 3PUWA 4NCAA 4L7VA 3WRYA 1I1NA 4J6EA 3IDOA 5E6RB 4C04A 1V8BA 1IAVA 4Y2JA 4HY3A 4QOIA 1L4YA 2WVJA 3AEQA 3ZHSA 3O8RA 2IGBA 2OG2A 3WBFA 1G5QA 2IYUA 3L8GA 5ETJA 4IGAA 3H5OA 3V5NA 2WP0A 4G01B 4REOA 2AFHE 2OB1A 4N3NA 4Z5XA 1XD9A 1GYPA 4BLTA 4N41A 1MVLA 3TDKA 4CMEA 2C0CA 1WHTA 3T3GA 1ZN8A 2Z43A 3WLTA 4ILEA 1RBQA 5A3VA 1LNZA 2AOTB 4L9WA 1Q7RA 2NZ2A 6Q21A 5ICMA 4ARIA 3KVVA 3AJRA 1MO4A 1JKXA 3EDRA 4A27A 2XPCA 1CQXA 4HB2A 2Q2VA 5TEWA 3TW8A 4WBNB 4LNAA 5C1OA 3DDSA 5DIZA 2Q9UA 1TADA 1NYQA 4TTQA 1YBHA 4PZ0A 1D2GA 5KSZA 1Z5GA 3UOWA 2H1SA 5BWCA 2BM8A 1PLJA 4OGLA 4V3BA 2C7BA 3E3NA 4HTFB 3FPBA 5EL0A 4C9BA 2OMEA 4JJZA 3I01A 4ZQBA 4QRHA 3DB2A 2YIMA 3IAM6 1YZVA 4KYIB 4Y6SA 3NB0A 2YVUA 4AL4A 3AR7A 1LXCA 2H85A 1C9MA 3BD9A 4J6FA 4UEQA 5HR5A 4O08A 4TMTA 4JVLA 4RSGA 3GLTA 3RFVA 3EVGA 3QIAA 4DWVA 4C08A 4BIMA 5F7XA 1T0HB 2GARA 1IFXA 3O91A 2QN9A 1E0DA 1W87A 2C61A 3PHCA 2VP5A 4O2AA 4ZTBA 5C8YA 1QAOA 1AUXA 2G9VA 1EMDA 2W6IA 2QEQA 3LUFA 4JLKA 4M89A 4UJ5A 5I9IA 3RHTA 4TTPA 2PMBA 3AV3A 2R7NA 4G1MB 5BMVB 1F4LA 1JHZA 3LUDA 2Q7OE 2YFQA 2Q5HA 3KLBA 2IUFA 3C97A 5J1SB 3VU9B 2XVMA 3FCYA 3JZAA 4P7BA 1DVRA 4I99A 1T9KA 2E87A 3AESA 4LWOA 2C77A 2F9LA 1E60A 3CLKA 4FS3A 1PCXA 5L4NA 4DSNA 5IVPA 3A4LA 2PQMA 1PUJA 1P75A 4OREX 3W8NA 4MMZB 4EATA 4Y6PA 2Z6AA 2X77A 2Y71A 1REQB 2Y4NA 2UYCA 1RQPA 1FFHA 1QH9A 4OX9Y 2LCFA 3T5TA 5JLAA 4RZXA 5IVHA 2HJWA 2W2LA 2H06A 4NBUA 1RM3A 3SQDA 4BGUA 4CRWB 5JSQA 4TQGA 3FNIA 1M2OA 3GRKA 1PK9A 4MHTA 2OUKA 3FZGA 5DPMA 3IAEA 3H04A 1NY6A 3DL4A 2DECA 1USVA 3AHDA 4JJFA 1FTSA 1Y48E 2FX2A 2GYWA 3AI1A 1BYUA 4C4AA 1R4NA 4WE3A 4XR9A 1QZUA 1F9AA 1F3LA 3MM4A 3QE3A 1KXJA 1RXEA 1S0UA 2V6MA 4HS9A 4NNJA 3WHLA 3EJ6A 4WGGA 2WJGA 2X3FA 1TUBB 4Q3BA 4ZVKA 4DF3A 4RHYA 3KWLA 4AT1A 4RIFA 1P2SA 2J3QA 1CJMA 1GNPA 3DMGA 4Q4LA 2XOKD 4EGFA 3B8HA 5IN4A 2R6JA 1WVIA 2OHGA 1B41A 1RKBA 4MS1A 3GDFA 2YHBA 1H1LA 3U81A 5BPHA 1LLUA 1SRQA 3ASVA 2FCRA 4RLHA 2XD4A 1LJLA 3IPRA 1E2NA 4I4TB 4WFQA 3W9BA 3WXMA 4ACBA 3O47A 2DQKA 1BAPA 4LMRA 4BNFA 2ZDGA 3QKRB 4DIMA 1PFVA 2I2FA 4YUWA 2IW3A 3T7CA 3KTDA 3LGSA 5DISB 5BSRA 5B4UA 2G9ZA 5JD5A 1YZGA 1XKLA 1CS0B 1U28A 4LHYA 4YNBA 4J3NA 1V3QE 4CNQA 5FOSA 3LO5A 4M0EA 4FFMA 1US8A 1XV5A 2FHSA 1SIUA 3DNFA 3GPBA 3K2IA 5DP2A 2O59A 3P9RA 1T1JA 2F48A 4MPTA 3V8MA 1K1EA 3FOCA 3UAGA 5BOVA 1HMPA 1Q1GA 2FPGB 2FB9A 2WTXA 1ESCA 5CIWA 1TGVA 4F3YA 4PBRA 4QXQA 1N5JA 1EAYA 1UPBA 4UUMA 4YJKA 4L0MA 3RU9A 4Q9DA 5T3UA 1TEXA 4I8IA 5P8WA 4RTNA 2ZVPX 2HK6A 2NPIA 3RRFA 3C6BA 1Z5PA 5B1DA 2FSFA 3WSWA 4Z9XA 2OR3A 1JLLA 2OORA 3DV0B 3EFOB 4RKQA 4YP0A 5JAZA 221PA 1OXTA 5F9MA 1AKWA 5TQVA 3VYVA 3MJTA 3KHKA 3K71B 3RJMA 2V4MA 4EHHA 4RD3A 1T3ZA 1WB6A 2C4UA 4WKCA 4XYEA 1R0XA 2C96A 5M34A 3EZGA 1SC6A 2RGNA 3LBAA 3CF4G 3T0GA 3LPDA 3N0VA 3NFYA 2EJCA 1ECBA 4UHKA 3B1ZA 4D0GA 5JHGB 5J2TA 1BCSB 4BMPB 3F46A 2MHCA 1QONA 1S9DA 1MH1A 1QZ3A 1RPTA 2G4VA 1SG9A 3L06A 1SU6A 5LZ8A 3C1TA 5EJEA 3ZU5A 4U2CA 3JAWB 3THSA 2W37A 2QSUA 2VJBA 3A1VA 4PYIA 5DIFA 5FWDA 1JTFA 5DHRA 4M38A 3I37X 3N7TA 3KB2A 4F6CA 1T36A 1KU0A 1ETUA 1KQGA 1SZJG 3NBUA 2ZRIA 5GVSA 2QU8A 1OTHA 3ZHUA 3HUUA 5H80A 1AE1A 1NKSA 4JEHA 5KI6A 3OA0A 4L07A 4D41A 5CBPB 2ONYA 3KK0A 4WBSA 5CDUA 2ZT7A 3H1EA 1GQSA 3ZY5A 1A9PA 4CVNA 2FJUA 3LJKA 3EVCA 3MMXA 2O8DA 2XTZA 3DD5A 2GUGA 8MHTA 3V8VA 2Z4RA 1WP4A 2EFGA 1ZA1A 3A25A 1UOQA 2V4UA 3LWNA 3OOYA 4QDOA 5BOSB 3PUJA 4JLMA 4B3HA 1RPZA 3BTVA 2X4IA 2QP3A 3DULA 3ICPA 4KKVA 2FKAA 1MXFA 2J85A 4NMWA 1QFYA 3P71T 1YJ8A 1J7JA 2CHFA 2V6JA 1P1KA 3CKYA 2ZS9A 2ID7A 2WD7B 1E3QA 4Q5IA 2HADA 4L5JA 2VJYA 3I1FA 1DWQA 4P84A 4J94A 2I6UA 2JGRA 3USZA 2PJZA 5JVDB 1AHHA 1S2NA 4B09A 4OBXA 4HQKA 1P2UA 3HP4A 5L3ZA 3WYAA 2W11A 4UHJA 5DRTA 5FUXA 3RU7A 1KIFA 3UJPA 1SXJD 2WM9B 1NKTA 1TJPB 2PLWA 4II2A 1M2NA 3F3KA 3WRVA 2EU8A 2CT8A 5AHRA 4BMDA 5KS2A 1NIJA 2DOKA 3K0EA 1GVHA 4RABA 1UXOA 4X20A 4XARA 1J0BA 1XZQA 3LC2O 1OZAA 1KJWA 4MYDA 5DXJA 1NM5C 1UMBA 2AWOA 2RGBA 3UWOA 2B4RO 1GY8A 1QR2A 1FDIA 2Z30A 1Z6TA 2NPFA 3IIMA 4YV2A 1FNCA 3PKIA 2GMWA 3MOGA 1TPZA 1XMPA 3TIFA 4PONA 2NO0A 1CZUA 4RKWA 2NOAA 2C3YA 2QJOA 3L05A 4MYHA 1XHFA 4Z9AA 4X92A 4QC2A 1MW8X 2YXBA 4MB2A 1L7XA 2E4WA 2I3AA 2JA1A 4L9AA 1K75A 3F6EX 1XDBA 4Z4FA 3PF9A 4I4LA 1M66A 1JB9A 4DV2B 3OT1B 3T7IA 5ILGA 3WDSA 1XMOB 4Y1RB 2CCJA 2V5UA 4HPXB 2BBSA 3H5RA 1YASA 3WAGA 2CFCA 2FFAA 3RHFA 4TRMA 4WFIA 4INJA 5L9AA 1IU9A 2C4WA 1D4ZA 2FZKA 2ZB8A 4Z9FA 4BRZA 2C00A 4EA7A 1TYAE 2EIHA 3RFTA 4BNYA 2ZIGA 3GGDA 5LQKA 3UG7A 4E70A 3WA7A 4CMCA 4PZZA 1G7RA 3T9FA 1NNEA 1ZUHA 2ZYSA 1QC5B 1RRKA 3EVZA 4KCGA 4DLSA 4RSRA 3E5HA 1KEWA 1RM5A 4FYYA 4LXHA 3JTMA 3RS4A 3ZNPA 4YWJA 1EP2B 3H9UA 4TL9A 4ZAFA 3SKXA 2QQEA 2VL7A 5E9WA 4RHEA 2FF7A 2HWYA 1FQWA 4HNHA 3W5AA 2IYSA 5GTDA 1QF6A 1L4FA 3ADPA 2BIFA 4GU5A 3VKHA 3OCVA 4KLAA 4A26A 1PSDA 4HDMB 4H16A 4EVRA 3IRVA 1GCAA 2QSYA 3AERA 2YV3A 1KI6B 3G1TA 1R9NA 4OVKA 3DOCA 2H4JA 3SQOA 1SWVA 1VBNA 1XZHA 4X93A 4QGSA 2FPMA 5AESA 2XNDA 4Q18A 3DDUA 1LSJA 5KNCD 4C4PA 4EL0A 4HVLA 4F3RA 2IA5A 3LS2A 1RKQA 4J16A 4NCIA 1AUVA 4DIDA 2DGDA 3MC1A 4A2PA 1UK6A 1HQKA 4D45A 4MSUA 3L8ZA 1E2DA 4ENPA 3MUNA 1IDOA 2FG6C 4QYIB 1LV7A 4ZZ2A 2OXIA 1TAGA 1M1YE 3UK0A 4ZEXA 4DLAA 2D8AA 1U0TA 4G9GA 2ZEJA 4NDZA 4PLHA 3HTXA 5T4FA 2WF5A 4IEFB 4AN1A 5AKYA 1Z63A 1CDZA 5JS6A 3DLHA 4JJEA 1GN8A 1XMJA 4P7JA 4OM8A 1Z0AA 5IAKA 4XDHA 1IEWA 2PUEA 2P2YA 4AY2A 2G7MC 2QM0A 1BC5A 1NR7A 2I4IA 1WO8A 3CUTA 1UBCA 3F5SA 4LISA 5DM2A 4MJ3A 5I9TA 3C8UA 3OZ7A 3U26A 4XVCA 3NC0C 3IEVA 5DN6D 4MV9A 4MVJH 3KYCB 3L4SO 4BNXA 4PTZA 3CVWA 1NUQA 1JU9A 1OAKA 3UB2A 4MA4A 2UZAA 5TJHA 4R8KA 1R6VA 2O2DA 1IONA 2NADA 2Q4OA 1C9YA 1T3HA 3RSHA 3VTKA 4B71A 1JQ5A 3GCZA 3GN1A 4WERA 3FDZA 1T43A 2FMFA 1IBSA 3K0BA 4JI2B 4KWHA 1AU9A 2BF7A 3L1KA 4NYIQ 3U9SA 3L9XA 4CQLB 3T1HB 2OXCA 1U8FO 4KO3S 4ZOLA 4HYTA 2FU5C 2DFVA 1T5TA 4Z51A 3NEYA 1U3GA 1G8FA 1L7OA 3EB9A 4RV5A 3PQVA 3EIUA 4LVOA 2HA3A 4JITA 2PXHA 2R85A 1MLDA 2I91A 3PICA 1D7OA 5LP6C 4A2WA 3FPHA 1PR3A 3AEXA 3N6RA 4F93B 4M1QA 4QTTB 5FUMA 1FLDA 3AH8A 1XTTA 2RCNA 3FLMA 3IKMB 4DRXA 5ALSA 2WVGA 5JY1A 1YVUA 3LK6A 2V9PA 3G23A 3CG4A 3STWA 2BLNA 3RF7A 3EUEA 1TM1E 4XI9A 3ZX5A 5JLJA 4HOYA 1NQUA 3LLMA 1UC5B 3TRFA 1NJ8A 1YXMA 3JQ9C 1JV2B 3ANLA 5T41A 2IH5A 3P2KA 3HI6A 1V4NA 5JZ9A 1FP4A 2GQ0A 4ZA2A 2IF0A 3BD8A 4CEJA 4HB4A 2VI5A 4CG2A 1HLPA 1S6YA 2AUMA 1LPPA 2JFPA 2JIZA 2QXTA 3OIDA 2QI9F 3O21A 4NI5A 4UU0A 5AI9A 4MINA 3RUFA 3UENA 2YWHA 1SQ0A 3QKSB 5I6DA 3B85A 5KNBH 2PX6A 1KYYA 4N5LA 3EEIA 1PFWA 1SBCA 4FUQA 3KDAA 3EIFA 4FEEA 2IHJA 2JVKA 4MEJA 4BLPA 2DUJA 2YBDA 2XCTB 3AETB 1ZUNB 4QXOA 4WKPA 3Q2KA 4DR7B 1O5TA 1U0EA 4KGVA 1Y33E 5EUQB 5I47A 3DZKA 4DILA 1P2GA 5LMCA 2VZEA 4W9MC 1PDVA 1AS2A 4PBSA 2JK0A 2P9EA 4HEJA 5F23A 5JW6A 4Z4GA 4K0KB 2Y1DA 3MAJA 4YHBA 2YDYA 1WLYA 3BK7A 5E7IA 4EQ6B 1LKZA 1I7MB 4V38A 5BT8A 3P9XA 3C5WP 2FSUA 4AN4A 4LSZA 1Y8ZA 2NT4A 4EB6A 4EHDA 5C52B 1OLUB 1EX7A 2B61A 3HDGA 1N2IA 2CL0X 4X8HA 3WRXC 1II0A 3A27A 4DDWA 1XXHA 1VI2A 3I1IA 2AQHA 2GESA 4OXIA 1U6KA 5CMLA 4U3JB 4ZHQA 3I0ZA 2ZM6B 2FPXA 2YICA 1MU0A 3KXDA 2OUIA 5H9VA 2DY1A 4O59O 5G4LA 4D81A 2I33A 1WF6A 3DE5X 3MQFA 2BZSA 4QOFA 3PDJA 1Q0SA 1NPYA 2WLTA 2LRHA 4X1YB 4FILA 1X77A 1RIIA 3TZHA 4EG1A 4OI4A 3QG5A 1O8CA 4EO4A 5HKAA 3WGZA 2HSWA 1KRXA 3RVDA 2NXJA 4EYEA 4F4CA 3M6FA 2XDQA 5JC8A 4QEDA 3ORFA 3BRSA 3K9LA 3WL6A 5JSHA 2C29D 1CUYA 3MHTA 3H9JA 2IYAA 4MV3A 2TMGA 3DFIA 5IEJA 1CIJA 1XCLA 1KYZA 4IILA 1LQUA 3AVXA 3PYXA 4DT1A 5CURA 3N5CA 3O03A 4KZPA 3BMQA 3TUXA 1ZR2A 5ARDA 3UYKA 3ST7A 3LAWA 2TSYB 3IUBA 3O4FA 5CGQB 5JI3E 2NNLD 2X8JB 3QI2A 4N0QA 2A9OA 4FGJA 3RC1A 4LXIA 4MUBA 4G23A 4D9JA 3OLQA 1DIAA 4UNNA 3KTFA 1Z75A 2WLSA 2Y9MB 5ICCA 4URVR 2O8EB 1Z16A 3ZBPA 1Y4SA 2RHHA 3PQ8A 3W5DA 4GX5A 3OPYB 3V4FA 2Z9CA 4CT5A 4E4RA 2CGEA 3OQMA 1QUEA 4DM4A 4IRXA 2Q6OA 5DBIA 5A3RA 1Z68A 1I01A 3JQAA 1BJRE 1KHHA 3I05A 4GP7A 5DM1A 4DLYA 1LCIA 2XE6A 1Z18A 1MNQA 4QU0A 4UOQA 1O4VA 4BQQA 3HY3A 4TL6A 4I5DA 3OZBA 2ZUEA 1CR1A 1Z8NA 4HX2A 4XD2A 5K4GA 2CJWA 3BDAA 5CDSA 4ZFNA 1GUDA 3I5AA 4Y0AA 4R2JA 4CMJA 2W2MA 2Q4DA 1IBRA 3NNDA 3ZU2A 4KQFA 3IQIX 4QZVA 3SP1A 2CL7X 4L9RA 3DMPA 1PEYA 3R5FA 4RPHA 3PZRA 1OLXA 2GBLC 5K8CA 4HH4A 2PR2A 1L7EA 1WR8A 1EA5A 1QPBA 3LZCA 5J3JA 1CIPA 5AM0A 1ZD8A 5AVZA 4D3YA 3N2IA 3CH6A 4F12A 2PRZA 5JSZB 2VDMB 3DAOA 3L41A 5JYEA 3HDVA 1TZ2A 4OA5A 2DPGA 2ASEA 1EYZA 3H2HA 1OXSC 2D2EA 4YP6A 1ANKA 1KVQA 3CNOA 4KRFA 1RI2A 1TZCA 4F1WA 1QO9A 1JVBA 4KQ6A 2ZUFA 3BMCA 4BYGA 1UBMS 2OFWA 3A9UA 3NXKA 4B2LA 3H8WA 1QWOA 4C2BA 1HE8B 4AWBA 1E2BA 3NOOA 1KGSA 4LYJA 1F0KA 5TPWB 1V5FA 2HCBA 5E2AA 2R7KA 2V5VA 2WKPA 3TOXA 1K7SN 2V9ZA 3IPXA 3ESDA 3Q3VA 2I34A 4YI3A 2XUQA 5CT8A 4DREA 1XVTA 5A2QA 2OZEA 1SHUX 1Y1KE 1N8KA 3FVRA 5JWHA 1XCBA 2LKDA 4LYYA 4MIYA 4RVFA 2O2ZA 3GK3A 3QWAA 1IM8A 3EEYA 4IPTA 4JBWA 4OV6B 2YJ3A 1EE9A 5E4JA 1UKZA 1E5QA 2WJIA 4MO2A 2YWGA 1HNZB 4EUHA 3R3HA 2HMYB 1NUSA 4Q15A 5FA5A 4ZYYA 1LI5A 4NJEA 3D8SA 1UXGA 3ZVRA 4PAWA 4E88A 2G1JA 2F4VB 1YZTA 2MDTA 3O8QB 5E1MA 3W4IA 3EZNA 2QN7A 4RPLA 3RYIA 4N40A 4UDNA 1JJFA 1V41E 3DZ3B 1BHSA 4S1WA 1W36B 4OXXA 1R6DA 4UREA 1C3JA 2RH4A 2B5OA 4JSTA 4JBXA 1T3SA 2PBZA 2C5SA 2MTBA 4HDKB 1S2DA 2AG8A 3LP5A 2ERXA 3VR6A 1SVNA 2V6FA 2YZ2A 3SM3A 4EKGA 2J3JA 2Q6TA 2NQTA 3ONFA 1QIIA 2JAOA 3Q5EA 4A0HA 3TZEA 4B3RB 1DQYA 1TF7A 1QCDA 2QL7A 1QNFA 4Y2XA 4BO2A 5IWAB 4KR3A 4BFWA 2H1LA 4QM6A 4OUDA 5FAKA 1O6BA 4MHOA 3FROA 1WUTA 1YDMA 2WNHA 1QB7A 1I8TA 1YGPA 2NP7A 1Z7EA 1VPTA 1CB7A 2DHRA 2QDKA 3ABSB 1T3GA 2HLNA 3DDZX 1MORA 5EJ9A 3KXPA 5TQ2A 5KMGB 4MJLA 2P3QA 3AUAA 3N8GA 1ZDMA 1V26A 1XYYA 1ZGGA 2X9LA 3EF3A 1XFDA 4UHFA 5HIMA 3RQSA 4F4DA 1UKYA 1KHTA 3PHJA 3KKPA 2BGMA 5THQA 4W1SA 3O1HB 1JSLA 4BNKA 4PG4A 2ADMA 4UCXA 2AVNA 4JAVC 3ENNA 3JQ7B 5AOAA 1G42A 2P2ZA 2ZETA 4NSNA 4QNNA 3FRJA 3OBBA 1DAOA 4N5DA 5HBRA 3LH5A 4CEHB 3F98A 3PB3A 5FLKA 2WJPA 3E0QA 4UUOA 5TS3A 4HSEA 2GN1A 1JJIA 2GCOB 3PBKA 3TG8A 3IQXA 1L3IA 5LLDA 1ZQ9A 2XKJE 1N2XA 3P96A 2YFHA 3OUTA 3DEFA 3SXPA 4Q3AA 1H4SA 1S4QA 2GN0A 3DBOB 3HVKA 4L08A 5AR1A 2EKLA 1L4KA 3S1AA 4GKVA 4I4CA 4D43A 5KHAA 1CY6A 1NJGA 2K2WA 1SZPA 1X74A 4FPXA 5HIJA 1W88B 4YO7A 4FW9A 3DFKA 4N3GA 1VP9A 2ZE5A 4KEAA 3TL2A 3VAYA 3GG9A 1I3NA 3O8OB 4CGYA 1H42A 1YQXA 1RJFA 1QDUA 2M9MA 3OIFA 2L17A 3OJ0A 3D4BA 1WUKS 4GVXA 4PLPA 1N5LA 4H7DA 3ICQB 4YMUA 1E9DA 5I51A 1NC3A 4B40A 2JIRA 1I7SB 4HS4A 4LF9B 5L4LA 4YMIA 2FRDA 4JYBA 3GPCA 3IR6A 1QRSA 2ZWVA 2HQBA 4QUHA 3UWKA 2WKSA 4MR7A 3BCSA 4WINA 2Q7XA 2A5GA 3A1NA 4UU8A 4BO8A 2IUTA 1ZONA 1PG5A 4JFRA 4URHA 1C1DB 1TU4A 3LUGA 4FFBB 3VKFA 4Z54A 3Q8KA 4QHYA 3QNUA 2J0UA 2LD4A 2BZ0A 3NP9A 4JMLA 5FBZA 1A2KC 1YUBA 3R7AA 3VR0A 4YRIA 4UPDA 2IK8A 3HPRA 3D3WB 3QYFA 3AB3A 4EY6A 2VF7A 1WUYA 2VSFA 4NCHA 2DWPA 1E3MA 2OCXA 5EHIA 1U0BB 5E7MA 4B79A 4M0DA 3VMMA 1R37A 1UF9A 2IYXA 4MCHA 5G2OA 4MUXA 5L4SA 3V8PA 3ZY3A 1OCEA 2CNWD 4BMVA 1PV4A 3PC6A 5JD4A 4ZI5A 4NBTA 3BTUA 2WHRA 4F8EA 4DABA 1THZA 1UKBA 5J5AA 2SECE 1ZK2A 3H7AA 1NDQA 4GRIA 1ZVKA 2VAVA 2C3OA 3KJXA 4AB1A 3MT7A 1WY7A 2PZEA 3A6HA 3SF8A 3AIKA 3UT5A 2Y0CA 4EZIA 4FCVA 1MC5A 3GWZA 3K09A 1UADA 5H59A 4CG1A 5ENVA 4UHHA 4DMKA 2PAAA 1U9IC 1G8SA 1QH1A 3RFUA 4IRUB 1FU4A 4YAIA 4UZFA 2RONA 1YR7A 1PQYA 2C9BA 4YACA 2XKKA 5DGDA 1UOPA 1E0KA 4NH0A 5BUZA 5HWSA 2J5KA 1W75A 5EESA 2F2TA 5JCXA 2WDPA 3LIIA 1NVUQ 3BHIA 4Z9YA 3QKWA 3FDIA 2H52A 1X14A 3M6UA 4Q1CA 1EGAA 1O95D 1ORRA 2XSZA 4MI6A 4A3SA 2AR7A 1PDWA 3EMBA 4DRZA 3U4QB 1OI4A 2WJVA 1IPEA 2XODA 3ECAA 1P74A 3AVWA 1W96A 4DCJA 3HA5A 2ZJ7A 4ARSA 5BNTA 1QS0B 3G3EA 2BCJQ 1SVUA 5HW0A 1OX6A 3OIYA 1E5TA 2ONKA 5B1HA 5K0BA 4CKYA 4R5HA 2VNAA 4KN6A 1TB4A 3L49A 2CFTA 1II8A 1K8QA 2IU3A 2O2IA 3A1DA 1WB5A 5EUCA 5HRCA 1MJGM 4B9AA 4NFYA 4YALA 3WADA 2WOOA 4UM7A 1A9QA 2CF5A 4HDSA 3AM1A 4QLAA 4KN9S 3T41A 1F48A 1KEVA 5T7BA 2D06A 2GD6A 3ITDA 4ZU3A 3SCZA 3C98A 3MBOA 4HQRA 3A6PC 4XSHA 3WY9A 1SVLA 5JNWA 3GGSA 5JE8A 1EA7A 1G8KA 4FKBA 1V2HE 5JQGB 3F5DA 2W6JD 5A9SB 5TMPA 1ZCFA 3VTFA 1E66A 4M83A 2O2CA 3TR0A 2WHXA 1ZJ5A 2VRWA 2VTKA 3DW3X 3LRTA 1MV5A 4X7RA 1L2TA 1J56A 4HK4A 3HCAA 2XUJA 1RKXA 4BZPA 1QCZA 1ADFA 1R5BA 1P5RA 1B00A 1R6BX 4RU1A 1ISHA 4O33A 3VYWA 1DPGA 2WM2A 2WTMA 1Z47A 1Y34E 1WDKA 3I30X 4IMPA 4R7TA 4AK9A 4C0WA 1VPWA 3VVMA 1F0PA 1YJAA 2DWQA 4YYZA 1RWOA 1ZJZA 5CA1B 3ZHCA 1Z13A 2QXYA 4OI0A 2ZDQA 1C14A 3RNLA 3C7DB 3N05A 3DHNA 4LRTB 4HZUA 1UWLA 5CLGA 5F4BA 5G4KA 4A0SA 3SFVA 2CKDA 5ERGB 1XVAA 2V7UA 4NATA 2FG7C 2ZJ8A 4DJDC 1OIXA 1IZ0A 3Q10A 5P21A 3LDAA 5GZ6A 2FJ0A 1GA1A 3QBEA 3V6MA 3VKUA 1E59A 3BK1A 4JLOA 3VQTA 2WF7A 4PSCA 5FTJA 1OWPA 2ZYWX 3DF7A 1TQDA 5BXYA 1NKVA 5LZ4A 2E5FA 1PJ3A 4LCEA 5LP6A 2VHJA 3DL7A 2I62A 4WJLA 3TQHA 4DMLA 5AM5A 4M7PA 1NVDA 4MTLA 4OXYA 5FBQB 4QUIA 1C5KA 3BXFA 3HDYA 3KJZA 1IY8A 3HNRA 1T0UA 3LA8A 4MQMA 2VBGA 1OGJA 4YONB 4Q1AA 5JS7A 2VNJA 4U7DA 1EUDA 4CIYA 5ENZA 3U60B 1WA5A 4M0MA 1CDOA 4BGDA 1KIAA 1E2IA 5DM4A 2QT1A 3KCNA 2YY7A 1PYDA 2GOYA 3P9CA 3AW9A 1NX6A 1WF3A 4L3WA 3WNVA 1A1VA 2QZSA 1P9RA 3LHIA 2QV7A 1A9XA 5KPJA 2I7CA 1ZGZA 2IW1A 1EDDA 2Y0BA 4OLBA 4S2UA 5JISA 1BE8A 4FZRA 2YL2A 1YS2X 5D5HA 1Z2NX 1BXRB 3SSMA 4KH1A 3VKVA 1XEXB 4GKBA 4BKUA 1DAGA 3W2GA 1DEOA 1L5MA 4P22A 4OPMA 1P9LA 3FHJA 1H94A 3RSOA 1YQDA 3BZWA 5ERXA 3PJRA 1SVWA 2G6TA 3FXAA 3MELA 3O8BA 4IICA 1OBCA 4NS4A 1TCBA 1WXXA 5GGYA 1V37A 5I9MA 1P7CA 2IS6A 4A15A 2ACWA 5D5QA 2OKGA 3VHRA 5K8JB 1ZIYA 4G4GA 1O1YA 4IUBS 1BHO1 4RSHA 4Y67A 3IJPA 4HLUC 2ZM5A 2VJKA 1HQDA 2SCUA 3O31A 1WVMA 3S8MA 3SZ3A 3B6JA 2VDKB 3OZRA 3C6YA 3F9IA 5FNVF 1VLHA 2O2XA 4JYPA 2AC7A 2AW3A 3MILA 5DJ5A 2P7IA 4DTCA 1TAUA 2DYKA 4OK6A 3CR3C 3OOSA 3TEMA 1VSVA 1CUJA 4GS5A 1WD7A 3W90A 3EP3B 3HCDA 4BLRA 4X71A 4BYMA 1RZRA 4BV8A 4NU8X 5L8VA 4R4JA 2E9SA 2J3MA 4G5SA 3WRXA 4CZ2A 2VWHA 1AVTA 5AKHA 5FPPA 1NN0A 1WQ3A 1N6OA 5BSHA 3AJ9A 1JJAA 3AR2A 5I3CA 2IE0A 3K6SA 3GEMA 1C3LA 3EA5A 2D0PB 2AH5A 1ZU5A 4YPFA 1UOEA 2N9UA 3HWWA 2AKAB 4PX5A 2V6BA 5JR3A 1UKVY 2VJPA 1G4UR 4GR4A 3GJ0A 5KNCH 3W5HA 1BU8A 1FC0A 3M1AA 4WOPA 4GO1A 4RESA 3OF3A 2PRYA 4UHEA 2BFDA 3H2BA 2DLNA 4FK8A 1KOFA 4OHFA 4UE2A 2R62A 2FQ1A 3UFXB 4DDMA 2B83A 1XYGA 2HCTA 3NCHA 3TIGA 1X3LA 2EF0A 1DCMA 2RHDA 3D31A 1XZCA 4II3A 3HCBA 4HVAA 3JWIA 2JF0A 4I55A 3DBHB 3PEWA 3RS7A 4OX9B 2FEPA 4BE7B 3DC7A 3ABQB 3UMCA 2WF8A 3ME5A 3ZV4A 1FMFA 1G2OA 1PQ4A 1GNSA 1O4WA 1TM5E 3MWDB 2WK1A 1G21A 5FAXA 1E4OA 4I6JA 2FF5A 3A3YA 4PR0A 1ULHA 3AB8A 2WBLC 1M6VB 1DEXA 4B6SA 1I3MA 2I1WA 3IO5A 3L0IB 3BA1A 4HFRA 3PPWA 4Q39A 5LL6P 4ZIRB 2R1VA 4Y98A 2HF9A 1W59A 3IQFA 4NIMA 1W49A 4S35A 1Z8HA 3WLLA 4B4WA 4O0LA 5LN1A 3D43A 4U7HA 4EBFA 3CB2A 3K72B 3JALB 1Q91A 5CPBA 5KNDD 5GZ1A 1NW8A 2H7YA 1E2KA 5H02A 3R76A 1AN9A 4GL2A 5TNXA 1ISGA 5B2ZA 5EYPB 1UT6A 2NTVA 4AJKA 1NMXA 3BXOA 5CGZA 4WDRA 2VK8A 4EG7A 1SN7A 4R6XA 1UKEA 2Q27A 2R0QC 1XTPA 1JHAA 4M0CA 5U9CA 3S2SA 2VTEA 2O19A 4I1OA 3H5NA 3RYHB 1CERA 1G41A 1KQPA 4KGXA 1GRVA 3WK7A 1UXJA 1ZIXA 3PUIA 2NN3C 4LHXA 4LAFA 1U0HC 1ZVMA 5G02A 3TYXA 2C54A 3G8BA 2QORA 2DX7A 1H6BA 2Q6IA 3CN9A 3N59A 2H5EA 1SOWA 4LRWA 4RF5A 3W3AA 1U04A 2Q0SA 3NHWA 4B76A 3HL0A 2ZJYA 1H8HD 2WNSA 4QLBA 4ZDKA 3H9CA 4PSDA 3HXOA 1TKRA 1I7BB 2Q1SA 3KEQA 4KDRA 2R6GA 8ABPA 3LCVB 5IZCC 4JL8A 3JVDA 2Q3EA 2YCLA 3QLUC 5IBCA 1K6MA 2XRMA 2VYQA 3MGKA 3WSTA 3ZEIA 2NO7A 3F9RA 1A4UA 4RIEA 1SZCA 1XRMA 2HA0A 4XJXA 2XI4A 2O5CA 4KJXA 4YPOA 3HR4A 1XVUA 4X0EA 4XW2A 3OURA 5JSFA 2OCPA 4RTKA 4R9UC 3OHMA 3KUUA 3TXXA 2AOUA 3C43A 4ONEA 3IBSA 3UEOA 2CZCA 4FNAA 3GAZA 2A84A 4ATNA 2O8BA 1GYQA 1Y42X 2O7QA 2ZRDA 2RK4A 1GP2A 2ZJ3A 4TLCA 4XD7D 2ZBVA 4XVQA 4E22A 5KPDA 3JQGB 1J97A 3AUUA 4PG5A 3D3KA 4ZAWA 3G9TA 7MDHA 1X86B 4EWLA 1SOAA 2G9UA 1RE1A 2GYVA 4ZZIA 2IP2A 2O1SA 4AULA 3HO1A 4GKAA 4UQOA 3L5KA 2WFLB 4D0SA 5IEBA 1PL6A 5J4KA 4Y9RA 1WMAA 3A04A 1QUFA 3NETA 2C8LA 2C1ZA 4UULA 4B7UA 1MTOA 3W1EA 1G66A 1OE0A 1W2HA 4E4YA 1MB0A 3AUFA 3Q7EA 3CH7A 1I36A 4B3BA 3UWPA 4P4TA 3KQSA 4F84A 2PO7A 1NPTO 3OZSA 2JFNA 1XTIA 2VA8A 4ESVA 2FWAA 3V7WA 2ZSJA 4DC0A 4WLUA 5EXTA 1GQRA 1SNYA 3KSMA 4F4UA 4PLVA 4DBLE 3N3AC 3NTQA 1VHQA 3LC7O 2IP1A 3NYWA 4CGZA 4RTLA 3R8CA 3VZSA 5DASA 1Q12A 3ZW7A 5YASA 4ZGWA 4P4SB 2J5XA 2J9YB 4G1VA 3VO1A 1W0JD 4BX8A 4KOEC 1HDCA 3EOAI 3UWDA 1I33A 2OSBA 3L1UA 3AP2A 2FW0A 1TDJA 3F47A 3IEKA 4TQAA 2OCYC 1Q95A 2V7TA 4R8MA 5ESWA 4UXHA 3BE5A 3LT1A 4Z99A 3C0KA 1P0FA 3ND8A 4XWOA 4Q0MA 2HEGA 3RU3A 1SU4A 2VQDA 3ICEA 5ALMA 3ILHA 2OWEA 4O2LA 3RVNA 5T67A 3K8QA 1Q0ZA 1YCFA 1LDNA 2PWPA 4N0PA 1QH0A 3AR4A 1KBOA 2QN3A 3KGDA 1LBHA 4DQKA 5CNKA 2QQ0A 3P9SA 3O0DA 3G9ZA 2G83A 2GJ4A 5DSXA 4ARZB 2WTBA 3AF1A 4Z3DA 3GEEA 1TKCA 3R3XA 4G65A 3RK0A 5AJVB 3KR2A 1DBIA 4QYMA 4ZJUA 1VCIA 4AK1A 2XTMA 2C2XA 2ISCA 3ILSA 1B6RA 1MB2A 2VS1A 3QUQA 1LZLA 4IIXA 4R01A 3P9NA 3W8RA 1BH2A 5FOXA 2ZCUA 5BSTA 2XCOA 1TM4E 4ZVOA 4HQOA 3NJ8A 3OUUA 1U0OC 3ENZA 3O6VA 5HUQA 1GZ4A 3PK0A 4KJZA 5KZMB 2JCSA 1X1AA 4TWJA 4HC4A 1VJ1A 1MABA 5GPBA 4B32A 3M5PA 4P2GA 1N0WA 5FOWA 1PUXA 1WM1A 1QLHA 2OCIA 2VRCD 2OP0A 3JQEA 1KP9A 4NOLA 3SC4A 3UZUA 2G6BA 2X6TA 3OQIB 3QKIA 4RK0A 1V8PA 1Z6QA 2GEKA 3QEMB 4OQZA 3A2MA 1VL5A 3HKEB 3PCXA 4J9UE 2B2XA 4P3XA 1U11A 3OQNA 3GJ5A 3RC9A 1FL9A 4EEXA 3HJNA 1S3IA 1YHZA 3K5WA 4L74A 1N1DA 2HYDA 4CIXA 3UA4A 5CEEA 5CYGA 1T0IA 3CN7A 3T3HA 1HUQA 4MRPA 5DTJA 4MIEA 1TU0A 2WKQA 1KJZA 3F74A 2FE1A 2X8WA 2CCGA 2EG9A 3AF3A 3BF8A 3ODGA 5LU8A 3KHSA 5B3AA 1GZVA 3WGNA 3D2LA 9LDTA 4CXMA 4S04A 5F1OA 1JVSA 3GRUA 4XWAA 4EECA 5HUHA 1YQQA 2EFCB 2KLBA 3J7AC 1N2CA 1QVWA 1XCPA 3JQFC 5A3QA 3WWCA 1Y3FE 4Y1GA 1A4RA 5E6SB 4RA9B 1M8KA 3HJGA 1TAQA 2C2WA 3H16A 2B4KA 1YAHA 4H2DA 2GEDA 4A1OA 1G4AE 1XJQA 2G08A 4EF4A 1U5BB 1KYWA 5JRJA 1PFUA 5PNTA 1T2UA 1WKCA 3N7AA 3CRQA 3M4ZA 4JNKA 4ZKEA 3RYFB 4LKRA 1WCV1 4UTVA 4YCNA 1WMDA 3QV1A 1XU7A 4GRAA 4P08A 4BE9A 5C18A 3WNCA 4NCNA 2YFKA 3MF4A 5FWXA 1W1IA 1QHHB 3VAZA 2WJJA 3OIUA 2PYIA 4HRXA 5FHQA 3IP7A 5JTUA 2X6RA 2LR0A 1GPYA 4OQFA 4E07A 3IHTA 4F6RB 3CC8A 3LLUA 3A0RB 3IDFA 2I6QA 3BD6A 3KE9A 4G26A 1II9A 2IQIA 4G8DA 5U1PA 5F2NA 4OJQA 1GQFA 1EFTA 1LI7A 3S8EA 1EZZA 1OAOC 2WC1A 2VT3A 1G9SA 2CB9A 4LEIA 1ODFA 4X6LA 4Y8VA 4IHJF 4LJYA 1QZZA 3LSYA 2ZE6A 4RVOA 4A91A 3G17A 1NI3A 4L85A 4EG3A 2YV4A 4Z4QA 3OLXA 13PKA 1MIHA 4NMLA 4BLUA 3ROMA 2R4UA 2FWNA 1CUZA 4MRMB 4BV3A 3PC8C 5DLEA 4L8WB 1FMTA 1L7VC 1OYYA 3PIDA 5E6UB 4H3VA 1P4GA 4B35A 4DCPA 1E1QD 2CVHA 1C3XA 1PGQA 1E0SA 2PEZA 2Q5OA 3LCCA 5AVXA 1MOPA 3RTDA 3E22B 4WZBE 1CRWG 4EA8A 1TQHA 1E8MA 1KI8A 3IKVA 1KOLA 3EXAA 4EUSA 4FOLA 2IODA 1GZHB 3JD3A 3F8WA 3P1JA 4EKDA 4B48A 1Z5UA 4CU5A 3DMYA 1EFHA 3U3JA 4UMEA 1YTLA 4B75A 3S4YA 1L8LA 5J4YA 2MOKA 4RHXA 1GPLA 1GAQA 4LUCA 3T9BA 4R3WA 2M6RA 3MRVA 1VYHA 4P98A 1NW5A 3EEBA 3RK1A 3VPXA 5K01A 4QJIA 3ICVA 3K0AA 2OFXA 5L3VA 3ZHQA 4GF5A 1BVRA 4W7HA 1J9ZA 2FFQA 2WVHA 3HKDA 4RYDA 4Q02A 3SYRA 3VH1A 1V5IA 2BSXA 1I2ZA 2O06A 2W6PA 4X6XA 1WKVA 3FYUB 5DI9A 1YJQA 3OO0A 5ECYA 3RM3A 4DMFA 2IP4A 3QEBZ 3I4LA 1HDOA 1IN8A 4M88A 3IDQA 3SYNA 3TRHA 5JOQA 4PO8A 4F71A 2D2IA 3OZVA 1GR0A 4R1SA 4B6RA 3AWDA 3ASUA 3TLGA 4O2BF 4G4JA 4KIUA 2YOGA 1UPUA 4ENWA 2DFDA 1HT3A 4RZ3A 4TUYF 4KR7A 4E2YA 1A9OA 3RW9A 1KDPA 3EF0A 3H17A 4BAGA 4XDZA 1YI8A 3CNHA 1YMUA 1JT9A 1Q3TA 2PANA 3S28A 4F56A 1MAVA