1XYGA

X-ray structure of gene product from arabidopsis thaliana at2g19940
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
345
structure length
345
Chain Sequence
KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords putative N-acetyl-gamma-glutamyl-phosphate reductase
publication title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940
rcsb
source organism Arabidopsis thaliana
total genus 113
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1xygA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xygA01
4QO8A 1JKIA 4OKIA 4XQGA 4CMIB 5B4TA 5BNFA 3DHNA 5T73A 3B70A 3QE3A 1Z82A 3TN7A 1A7KA 4RVDA 4QECA 4LK3A 4AJ4A 1SB8A 4GX2A 5EPOA 5JDCC 2Y68A 4LCJA 3CPSA 3SLKA 4E13A 2GO1A 2NQTA 1T2FA 1DEHA 3DMTA 1E7SA 4IIUA 4URFA 4WJZA 1E5LA 1WP4A 1RM4A 4GLOA 1I10A 4R01A 4YT2A 1LC0A 4IQ8A 3AY7A 1R4NB 1BXGA 2WYUA 3LK7A 1SNYA 1UAYA 1YDWA 2VHVA 3E8XA 2LDXA 3FNGA 4FIZA 4XWYA 3BMCA 1A71A 3DFUA 4GWKA 4XJSA 4W9NC 3FI9A 3MWDB 3FTNA 5A4DA 3EUWA 3QY9A 4RDHA 5L4LA 2CDCA 4B7XA 2X0NA 1C1DA 3DOOA 4OSPA 4ZJUA 1HLDA 4MPDA 4AL4A 2RHCA 4UEOA 5KJEA 4B7CA 4M87A 1J4AA 1FJHA 3OM9A 3VZPA 4UEKA 4UUMA 3PJGA 5JY6A 2NSDA 2ILTA 5TF4A 5I7SA 4FC7A 2ZQYA 1VJ0A 3NGLA 1HF3A 4CV1A 4J6FA 1LSJA 2ZYGA 3JYLA 3WTBA 1C0PA 4FSHA 3WGTA 3K96A 4IQGA 3H9GA 3ADPA 1X14A 1YBMA 3B20A 1S7CA 1BG6A 1EDZA 2NVBA 4MINA 3DMTC 5BSHA 2Q1TA 4D0SA 1PQWA 2LDBA 2YQ5A 1GUFA 3VVBA 3ZCXA 1NYTA 2YW9A 1TI7A 3I9JA 3DR3A 1EFLA 1VJTA 2J3KA 4KP7A 1LI4A 3TJRA 4CM7A 3BTVA 1E6EA 4XQ9A 5HA5A 3IL2A 3D7LA 1B7GO 2G5CA 4IPTA 3GUYA 3LQFA 1LLDA 4NJMA 4OHUA 5G2OA 4HXYA 1AGNA 2V6FA 1E5QA 2AEJA 2D59A 3OHSX 3FSRA 3O8QB 3NTOA 1YB4A 1CEQA 1PIWA 1R37A 3H4VA 4RPGA 4E5KA 4EW6A 5JAMA 3S2EA 3TZKA 1RM0A 3CE6A 5DOZA 5EJ2A 3UAGA 1DLJA 2CF5A 3ON5A 1B3BA 3NTQA 1DJNA 1I0ZA 3CZRA 1KEUA 4IZIA 4DWVA 4HX5A 1DAPA 1PS9A 3I9MA 1X1EA 4IJKA 3PJFA 4MKRA 1U2DA 1PJ4A 4IDBA 3WIDA 3NTRA 3KSZO 5KJ6A 2PD3A 4TRMA 1BXKA 3Q9NA 1LEHA 4RL6A 2JD1A 1CERA 1NWHA 3I4CA 1QLJA 2C54A 3MJSA 3RKRA 2RAFA 2VOJA 3GMSA 2FN7A 1UZMA 3H8VA 1GDHA 1HYGA 1PL8A 2BI8A 1SB9A 4IDEA 3EAGA 1FDVA 1KBZA 3JQFA 2RBEA 3UF0A 5KCZA 4YJDA 2NTNA 1VRWA 4Z3KA 4OH1A 2I6TA 5C5IA 3ZHXA 5JE8A 3I6QA 3MJ4A 2EW8A 1FDTA 3HDHA 1HL3A 4MJLA 5AXBA 4MIYA 1ZEMA 5ENDA 3AUTA 4CLDA 2V6GA 1Q7CA 3OBBA 3AY3A 3KLMX 2PZKA 4BKQA 5KJ1A 1F17A 4DYVA 5IFLA 3PYXA 2Y99A 1YOVB 3WFJA 3UN1A 3T7CA 4J2OA 3AK4A 1EVIA 4Z3DA 1PJCA 1NP3A 4ALNA 1PZEA 3OIGA 5JAIA 1ARZA 3KETA 2VZ0A 3RUEA 2J3JA 4NBRA 2NUAA 4ZVVA 1Q0QA 1Q0LA 4YTEA 3WOHA 4MP3A 2X0JA 1OFGA 3ZU2A 4YAKA 3RC9A 3DZHA 1EUZA 4WNCA 2O7QA 3NJ4A 1M6HA 4PZEA 1MG5A 3MOIA 3MTGA 3B6ZA 3I9NA 2EGGA 2XPCA 1HDRA 3C24A 2Y0DA 4J43A 4CLHA 3NAQA 1MV8A 2IRWA 3ONDA 3VPXA 1DDOA 3ZHBA 1HE4A 2O4UX 3JQ9A 3QP9A 4PLFA 1KS9A 4PZCA 5BQFA 3WQSB 1G0OA 2OUIA 3RD5A 5L4SA 3O03A 2B35A 4FGWA 2OO5A 2O2YA 4R4JA 4Y6RA 2Y66A 1XU7A 2YV2A 5L3ZA 1DC4A 1IPEA 1ONNA 1TLTA 1SMKA 1YXMA 4GVLA 4U6SA 3ASVA 1WLYA 2PKRA 3LVFO 1NASA 2W2KB 4BMVA 1H2HA 1O5IA 3E03A 3PZBA 4I5FA 3BMNA 2BF7A 2IXBA 2A35A 1HDZA 4BV9A 4MVJH 1DHTA 4EUHA 3BMQB 1P1HA 3ANLA 3OEYA 2C5EA 3ZWYA 1EUCA 1NVGA 3F4BA 5L40A 5CFZA 5KKCA 1BHSA 1WZIA 2QG4A 4ZRNA 3MOGA 2JHGA 4MIEA 2GGSA 2Z5LA 1YJQA 4OYRA 1YH3A 2Q46A 1WW8A 4GMGA 4HWKA 5EN4A 3GY0A 1B8VA 1W0CA 3FCOA 4YRAA 1O9BA 4G65A 2ZB8A 3HADA 4MKZA 1XA0A 2YDYA 4J4BA 1I32A 1LLCA 4YJGA 3W6UA 5I9NA 5MDHA 3LC1O 1B15A 1NAHA 1YJ8A 3JQ9C 1UH5A 3WWZA 6ADHA 3VOSA 5JFOA 4ND2A 5DULA 3TFQA 3H5NA 3IUSA 1NFRA 3LSYA 4KQXA 4E31A 1CETA 1GUYA 5IDXA 1ZVMA 3OQBA 4DBVO 1EE9A 3ZDFA 4I5EA 3RU7A 2AEMA 3JD0A 4J91A 4KDEA 2ZTVA 3ONEA 3E6AA 3AOEC 5DBIA 2GUGA 4AG3A 4XJTA 2DTEA 2G76A 1Z7EA 1H2BA 3TNLA 1GL3A 4B4VA 5A04A 2D4AA 2X6TA 2PWZA 2P2SA 3F4LA 1NR1A 1E1MA 3H9UA 3HDYA 4XGIA 2PH3A 5THKA 2I67A 2W8ZA 1NVTA 2WJPA 2ZQZA 4H15A 3TQHA 2NQ8A 3GRKA 2GR9A 5CPBA 2ZJ1A 4CM4A 3AI1A 1I24A 4M1QA 3KEQA 4WCFC 5A9TA 4EI2A 5IAAA 4Q3EA 5TLSA 4O1MA 3RBZA 3GDGA 2Z1MA 4BO6A 5DDIP 3SC4A 2UVDA 4EJMA 2JCYA 5KWEA 4XB2A 1H6AA 2PA3A 3EHEA 4Y67A 2C07A 1YWGO 1SZJG 4JNKA 3TF5A 1DIBA 3JQ7B 4DVJA 4PN3A 3F6YA 4E12A 4BO8A 4Y8VA 4AJHA 3ZWMA 2R00A 4S3MA 3EVTA 3WGQA 4I9NA 1CF2O 2AA3A 2X0RA 3ICPA 1E1NA 4N5MA 5F21A 4R54A 2BELA 3NDIA 3VPSA 2E37A 3L4BA 4WASA 3BHMA 1DRWA 4KWIA 1MC4A 2CUKA 4ZQGA 3JD4A 2QQ5A 3Q1LA 3AW9A 2IYPA 5ER6A 3ZV6A 3WNQA 5FF9A 4U0KA 2ZB4A 3LT0A 3MJEA 1NPDA 3WLEA 2BLLA 4YT8A 1T1RA 4J49A 2FP4A 1DRVA 4QFDA 4K6CA 3WFIA 4CR6A 4W82A 4CLXA 1YB1A 2YV1A 4K6FA 1BMDA 3PHIA 4MVJM 4YQZA 3ITKA 2B83A 3Q0EA 1HDYA 5FEUA 1IULA 5F3RA 4E32A 3N7UA 1Z7BA 2O3QA 3ST7A 1A7AA 4LVUA 2AQ8A 3QVWA 1A5ZA 3K31A 2PK3A 4MO2A 1Y9AA 4I5DA 1YGYA 4RQUA 5JY1A 2X58A 2G0TA 5L51A 3RUAA 4O59O 4BS9A 2A94A 4YRBA 5JYFA 2GF2A 3P7MA 3GPDG 1EQUA 2WYWA 4Z6KA 3AI2A 3AWDA 2HU2A 1BXGB 4J1SA 1Y1PA 4D45A 2YJZA 3W4KA 3BMCB 4R5HA 5JCJA 5DBGA 1L7DA 4BO7A 4YQYA 1E3IA 1Y8QA 2Q99A 3V1TC 3WB9A 4JP3A 3WMXA 4IIVA 1HE5A 3PPIA 4R1TA 4UREA 4BO5A 1OI7A 1C1DB 1Y5RA 3EZLA 1T4BA 3CINA 1Q0HA 2XAAA 4ND3A 4XQCA 2D8AA 3RC1A 1SC6A 3GVCA 3FRJA 3IJPA 1OC2A 4F45A 4BUCA 1E1LA 4MIOA 2BGLA 1PJ2A 4GX0A 5ILOA 4BNUA 3D4NA 2VTDA 4RVFA 3C1TA 1C3VA 3PJEA 3JD3A 3GEMA 3INTA 1OOEA 3DXFA 2CVQA 2HCTA 2HJRA 4RO0A 3RAJA 4Y6SA 4LW8A 4DLLA 2F00A 3DONA 5A9SA 3SLGA 3TZQA 4KQWA 2ZKLA 5JC8A 3BZUA 5JYAA 1PZGA 1RWBA 1RM3A 4XDYA 1T4DA 3QVOA 4HFRA 4XGNA 1GFSA 3GK3A 3SEFA 3U62A 2Y1DA 1HLPA 2DAPA 5LC1A 3UGKA 5I7FA 4ITUA 4DYDA 3ZWOA 5LDHA 3CH6A 4IS3A 1E7RA 3QA9A 2YFHA 4NJMB 4RPKA 1EVJA 4KWHA 1UDAA 1NHWA 3UKOA 1NTOA 5IN4A 4GPD1 2W98A 2WDZA 1W6UA 3TRIA 4J1QA 1YOVA 2HMVA 4IINA 2TMDA 5COQA 3OF2A 4FW8A 3ETDA 3GH3A 1ID1A 4A2CA 3E48A 1B8PA 3A28A 1VL0A 3AU9A 4YJFA 4DIFA 2D5CA 1NNUA 2DFDA 2DTDA 3GGGA 4ESOA 2EGHA 3KTDA 1X0VA 3A1NA 2EEZA 1C1XA 2E6UX 1LDNA 4A27A 2EKQA 4QQRA 4OXNA 3WYEA 1WAMA 1IUKA 3F47A 4CQLA 4C7KA 2Y1OA 4BOYA 3FR8A 1U2GA 2R2GA 5ES3A 1XQ1A 4LCEA 4PRLA 1SO8A 3BYZA 1N1EA 3IKTA 1KEWA 3P2YA 2FMUA 4GWGA 3U0BA 5KJFA 5A03A 1O95A 2CVZA 5JLAA 3PWZA 1IYZA 2JD0A 4GKBA 3W8EA 1ISMA 4HNGA 2P9CA 2W2KA 4NFYA 5IZCA 1Q1NA 2JKVA 3ZWVA 3DBVO 3OMLA 1DRUA 3TOXA 3GVPA 4D41A 1EMDA 2ZB3A 4BKOA 3JCZA 5T6BA 3OH8A 1WPQA 3JQCA 3GZNB 1GCOA 1OMOA 4BNIA 1OC4A 3W4IA 1LDBA 3HFSA 4HKTA 2FPIA 1LC3A 1HSOA 4IDFA 1T2CA 4OOFA 4ROSA 1Y8RA 1Z75A 1JN0A 3HSKA 2C29D 3RROA 4DQVA 1WVGA 3KUXA 4OXYA 3I6IA 4NQZA 4BGVA 5JO0A 3HN7A 2Q22A 3RU9A 3KB6A 4BMNA 2FWMX 3G49A 2VRCD 1YBVA 1R12A 1PX0A 2ET6A 5H83A 2VZ8A 4ZRMA 3C7DB 4NDNE 3B1FA 3RKUA 2B4RO 3D1LA 3KO8A 1TT5A 3X2FA 3GHHA 1I2BA 1BRMA 1XGKA 3RVDA 4TWRA 3WQRA 1X13A 3ZWXA 5AQ1A 2VOEA 4BB6A 1ADBA 1KYQA 1ZO8A 3K8ZA 1DIGA 4XRGA 5TNXA 2C7GA 5L7WA 3GA0A 1N9GB 3H2ZA 3HUDA 4CLRA 3U4DA 2DUUA 4UUOA 2AQIA 3TL3A 3CMCO 1E7MA 1UP6A 3BMOA 3W8FA 3F3SA 5A05A 2HLPA 4C7JA 1GYRA 4BNGA 3HNPA 3B1JA 4FFNA 3LT1A 2JCVA 4YJHA 1Q2XA 4FJ1A 1G1AA 1UXIA 1W4ZA 4TRJA 1LBEA 1IB6A 4CL8A 1LSUA 2PZMA 4ZA2A 3V2HA 1H0KA 3KM0A 2NLOA 4WUVA 2DT5A 1MXFA 1ENOA 1PGPA 1K6IA 2PTGA 1QKIA 1QYCA 3RASA 2DLDA 2IEDA 3FD8A 1A27A 4FQ8A 4NIMA 1LLQA 4BGUA 1J5PA 4ZHSA 4GI2A 3P2OA 4EDFA 3COSA 5JDCA 5C7LO 1G0NA 3IS3A 1PGJA 3JQ7A 3OIFA 4A7PA 5TRTA 3WBBA 2RH4A 3PXXA 4N7RA 4ZN6A 4NG5A 3C1OA 2Y1EA 3WJAA 3V5NA 3GMDA 3OJEA 2YY7A 1SEVA 1EK5A 1P45A 2Q2QA 2X7HA 5I8WA 1P1KA 3V1UA 1NPYA 4YJGB 1Z45A 4PLHA 3CIFA 1IOLA 1ZZEA 1VM6A 4W9NA 4BHTA 4CM6A 4GMFA 4CQMA 3DAPA 4CV2A 4E30A 3T4XA 3TZ6A 3UHAA 2GZ1A 1E77A 2BFAA 4KTVE 4D46A 5JCXA 1K6JA 5DBFA 1UJMA 4XYLA 1YL7A 2NU9A 3OETA 1KVRA 1GTMA 3ZN2A 2BHLA 2JCXA 1QG6A 5GZ3A 5EINA 1ML3A 2WTBA 2FR8A 3L9XA 3KBOA 3ASUA 1RM5A 1QLHA 4LMPA 2OL4A 4HADA 1RYEA 3WNVA 4MVJA 3RIHA 4L8VA 1PJBA 1VC2A 2HKIA 1PL6A 2IZ1A 2EP7A 5EIOA 3RCBA 2UAGA 3F5QA 4CM4B 5JC1A 3H9QA 3WSWA 4YR9A 5T8KC 1JVBA 4UAGA 1IL0A 3SC6A 4GAEA 3D4PA 3I1JA 3R3SA 3VZRA 4PLGA 3UCEA 1E1KA 1P44A 2H9IA 4N18A 5JXWA 3VH2A 1VL8A 1ZK3A 4BNVA 1PU2A 2JFHA 1UAGA 3KLPX 3PTZA 1CIVA 4YVFA 1TB4A 2I3GA 3EGOA 3QWFA 1XKQA 4MDHA 1QR6A 4PCVA 2GN4A 3GQVA 4HFNA 3V2GA 4XQEA 5J9GA 3PGJA 1K2WA 1LDEA 2A4KA 4OGWA 4AFNA 4HY3A 4FR5A 5KOIA 2JFGA 4HFJA 3I9LA 2CDAA 4M89A 1RYDA 4FFPA 4U7WA 3NRCA 4WCDA 4GL4A 5DP2A 4J90A 4TZTA 4AICA 1GV0A 4BO3A 2FSVA 5DNAA 3S1LA 3QQPA 3L6OO 5GZ1A 3ANMA 1L1FA 4E0BA 1HDCA 2XOXA 1TT7A 4UVEA 3BAZA 3GG2A 5L7YA 4BNJA 1A72A 3IMFA 5LCXA 3F1LA 4BNXA 2A9FA 2DBVO 1K5HA 4L4XA 2YUTA 1JDJA 5TGDA 2DBRA 3QWBA 4LRTB 4JN6B 5JNLA 3GGOA 2XF8A 2FR0A 1R0KA 2NV6A 3TPCA 4RZHA 2VCYA 2VNSA 4KUEA 4AJ1A 3Q9UA 1FK8A 4UVGA 3FNEA 4YCAA 4J7XA 4CR7A 4TZKA 3RWBA 4Y6PA 3RJ9A 4DPKA 3DZFA 1WMAA 1F12A 2V6BA 4J2HA 1P1RA 4AJEA 3ZW9A 2JAPA 4II3A 4M86A 4CODB 4U0JA 1ISFA 1VSUA 2QRJA 4ZGWA 3KSDO 1MC5A 5T64A 5C37A 3A06A 4WNIA 4B4OA 2EV9A 4OSOA 1I5RA 3AM4A 2NACA 4L0QA 2VRBA 2X8LA 2UYYA 1V3VA 5TX7A 3WGYA 1LRJA 2VYNA 1Y8QB 1UZLA 1VPDA 1ZXLA 1JLLA 4QEDA 2CSUA 2IE0A 4U5QA 4XYBA 1ISJA 3JD1A 4IDAA 1PSDA 4K1LA 4B8WA 1MX3A 1EUDA 1GPJA 4YDRA 4ILKA 3WQQA 1NQAO 2RHRA 4JROA 1HT0A 3BXXA 3PLNA 1YB5A 5JPIA 2DC1A 3F1KA 4WEQA 5CP8A 1V6AA 4R16A 1KY4A 1LSOA 1KOLA 1Z74A 1FDWA 4J9VA 5ICSA 3VKVA 4E6PA 1N7HA 3HHPA 4S1VA 4BNWA 3I9KA 4Y98A 2A92A 5A9SB 4M54A 3DO5A 2Q2VA 1ZCJA 3VKUA 1C0LA 4H16A 2Q1SA 1JTVA 2HMWA 4TRNA 4GQAA 1WDLA 9LDBA 2FZWA 3EVNA 1X7DA 1KC1A 3L07A 4O5OA 3QLJA 5A3VA 1F8FA 4B4UA 3SBOA 5KVQA 2CZCA 4IXTA 4FOOA 3L0DA 4RPJA 2ZTLA 4YT5A 2D2IA 1QSGA 4P4LA 4CUKA 1U5CA 3GZNA 4FD3A 2UV8A 3MZ0A 1DC5A 5CEEA 2AMFA 1U9JA 1LTHR 1XQ6A 1UP7A 2PNFA 4DMMA 1HZZA 4OM8A 5A5FA 4MVJG 4YJFB 3GEDA 1GEGA 2PZLA 4NFHA 4L76A 3UOGA 3ZU3A 4BO2A 3KVOA 5IDQA 1PGNA 4I08A 2VUSA 1GQYA 3D5TA 2OBYA 4WE3A 5DCUA 1GCUA 4CPDA 4DPMA 1NPTO 1XIVA 2GN6A 3AM3A 3C7CB 3U49A 1UXJA 1GD1O 4PVDA 1C1XB 3PQDA 2V7PA 1KC3A 2D3TA 5H82A 4ALIA 3K5PA 4WLOA 1LDGA 3VDRA 1V0JA 4PZDA 4RPHA 1YL6A 2VWGA 4CQLB 1ONPA 5U9CA 3ONFA 3WYCA 1ZH8A 1N9GA 1NQOA 3K9QO 2X9VA 3S2FA 1QV6A 1O8CA 2Q45A 2DUWA 3GGPA 1VI2A 1XLTA 5I8ZA 1H93A 2C7VA 3EK2A 1MXHA 2BD0A 8ADHA 5FFFA 3KZVA 3PVZA 2CMDA 3NDRA 1LDYA 1KVTA 4J9UE 1ULUA 3UCFA 1I3NA 3G3EA 3PDUA 4GLLA 1E3SA 4IJUA 3AOEA 3PWKA 4QUKA 3JQAD 5THQA 1LU9A 1I33A 4Z0HO 2HDHA 4R69A 4NFSA 3FPLA 3PEFA 2BRUA 3N74A 4D0RA 1Y81A 3NT4A 4YBZA 5CG1A 2EKLA 5L7TA 1XSEA 2CD9A 1GYQA 4HP8A 1GPDG 1ENZA 4NU5A 1T2AA 3GFBA 3VHRA 4WCFA 4XEHA 2Y93A 5ITWA 2O3UA 4PRKA 4K26A 4NH4A 5AYVA 1U3UA 1Y8RB 1YS4A 1UP4A 4CL3A 1Y5MA 5KIAA 1M76A 4RDIA 1MA0A 3DAGA 4FFOA 3EDMA 2Y0CA 1LA2A 3WDSA 4UULA 5IXSA 4Q3AA 1HWYA 4FOSA 3GVXA 4IZHA 4EEXA 4NHEA 1XWFA 4X54A 3PWSA 1X0XA 5B4UA 4OO3A 3DBRA 1B3RA 2HMUA 3WWYA 5FYDA 4XYEA 2JL1A 1NQ5A 5ENVA 1SEPA 3VPHA 1R15A 1TT5B 4D3FA 1LQUA 1JU9A 2EERA 3E9NA 2P9EA 4B3HA 3Q11A 1ENYA 1PJSA 1V9LA 3FPCA 3RBVA 4GBJA 1Q7BA 2NU8A 3DOJA 4U6QA 1K3TA 4CLRB 1MLDA 3BMOB 4BNLA 5TJHA 3NX4A 1PZHA 3GF4A 3I4FA 4D7AA 1F06A 2NVWA 1B2LA 4FS3A 1BSVA 4CMKA 5A5EA 3GNQA 1P74A 5BR7A 1X1TA 2CFCA 3F46A 3RUIA 4YJHB 3H65A 4ZD6A 2HAEA 3UVEA 4D44A 3QVXA 1NR7A 2DBZA 1WXDA 2H63A 5B4VA 1UZNA 4RLSA 4Z0TA 1E6WA 5F1KA 4MVJI 3ZV3A 4E5MA 3IP1A 2OXIA 3JYQA 4IBOA 4D3SA 1O6ZA 2B5VA 1QYVA 2F1KA 1IY8A 4IXWA 2C0CA 4HBGA 5JMWA 2FY8A 1PGOA 4JK3A 4PG7A 2EWMA 2FZEA 2GSDA 4UUNA 3OJFA 3GAZA 4N5NA 1P1FA 4PLZA 5JAQA 4L75A 2Y1FA 3GN2A 4AJLA 3WGIA 2FR1A 5A1TA 4BNKA 4XKJA 5HWSA 2HO5A 1ISHA 2PFGA 1EK6A 5EL0A 4A5OA 4PIVA 3FN4A 2I65A 4F6CA 4DGSA 3JV7A 5L53A 1JKFA 1E3EA 4CLEA 1AHIA 1P1IA 4BVAA 5BSGA 2Q4EA 4RORA 4AJKA 1XG5A 4WLUA 1R6DA 3T4EA 4BNTA 1YL5A 5A3JA 4CQMB 2PKQP 6LDHA 3S55A 3ZWCA 1YQGA 3H3FA 4IDGA 2RH8A 5AXDA 4YT4A 1IZ9A 4XYGA 3OJLA 4R1NA 4L4RA 3LU1A 2OP1A 3HDQA 4WKGA 2VYVD 1LLUA 1TXGA 2W2LD 4TSKA 1NX6A 3R0IA 3OA0A 1T1SA 7ADHA 2R6JA 1JWAB 2UUOA 3I23A 3H9JA 1QP8A 3JQ8B 4W6ZA 4LMRA 5GMOA 4J7UA 4R41A 4Z0PA 9LDTA 3QW2A 1YE3A 1N1GA 1XR3A 3RFTA 3RFXA 4HV4A 4R1SA 2OORA 2VUUA 2HUNA 3M6IA 1U8FO 5C7OO 1XU9A 4NJOA 3GOHA 5TS3A 1UXGA 2O50A 2FPPA 4MKXA 1B0AA 1D8AA 4IDDA 4RF3A 3WGZA 4YAEA 3H5RA 4IQ0A 1M6WA 3JQBC 4DLAA 2GCGA 3Q6IA 3GDOA 3NDJA 3JSAA 5IJZA 1BGVA 5J23A 1P31A 4F3YA 3JQGA 4CMEC 1ISGA 2HK8A 4R1UA 4EUFA 4CV0A 1QYDA 3G0OA 3ROQA 4WK6A 1E7QA 3RQSA 3ZZNA 4BGIA 4PVCA 4TVBA 1VLLA 5CAEA 4CMJA 4E2XA 2Q50A 3G17A 3OEWA 4OOEA 3HWRA 2AE1A 3DZIA 2WYVA 3TFOA 3VAZA 3VDQA 4GSKA 2CF6A 4FGSA 1HRDA 1P3DA 3OSUA 3QWHA 1RPNA 2IXAA 1DHRA 3KRTA 1R16A 4ZQHA 5KNLA 1Q7GA 1N5DA 3OQ6A 4YXFA 4J4HA 2C2XA 5EERA 1R4MA 1NM5A 1SBYA 1WDMA 3L6DA 4KDFA 4EITA 3DAFA 5G0VA 2CVOA 3VC7A 2JJYA 1UDBA 4Y9DA 5HM8A 1BDMA 5IF3A 4BNFA 1VSVA 2GRAA 3ZU4A 4UEJA 4DXHA 3FWNA 1RKXA 3OQ1A 4Q9NA 4WLNA 2I9PA 1WZEA 5CG2A 4JQCA 3M2TA 4EZBA 4XA8A 4W4TA 1OAAA 2I66A 1BWSA 1DFIA 2QZZA 3H6KA 1DB3A 3WIEA 4EJ0A 3OA2A 1JWBB 1EZ4A 2NWQA 5BT9A 3PI7A 4JJGA 3NT5A 4CM9D 5K6AC 1HYHA 4P4NA 4PG8A 3U4CA 2C82A 2WE7A 3G79A 3IP3A 4E4YA 4XDZA 5CDUA 4HFMA 1UXKA 2O4CA 3A4VA 2QYTA 3VH1A 3IQDB 3F5SA 3F9IA 1ZKMA 3MJVA 4CM5A 1X7HA 2X23A 4AJJA 4KUHA 1CQIA 2OBNA 4B7UA 2GN9A 5JW6A 3D3EA 4IY1A 3E9QA 1GUZA 3GUCA 4BKRA 4CM8A 3VTFA 3WJ7A 1CJCA 3EYWA 4QTZA 3BTSA 2E49A 1YQXA 2BGMA 4QXMA 5CDSA 4PFJA 4P8RA 4JJIA 4CV3A 5IDYA 1Z73A 2YYYA 1AN9A 3KYDB 1G6KA 5U1PA 1I01A 1SPXA 4B3IA 4F6LA 2IZZA 2Z95A 3OECA 3DTTA 4RVHA 2J5KA 2B37A 2WD8A 2X1HA 4YAIA 1LQTA 3ZHYA 2BI7A 3AM5A 1PS8A 3IC5A 4UVHA 5BNIA 2GDZA 3AFNA 4M8SA 4DTIA 1PTJA 2IYOA 3KSUA 1PR3A 1ORRA 3NGXA 1U3VA 3NJ8A 2PGLA 3EY4A 1P1JA 3VVCA 1XYGA 3M1AA 4TKLA 3DBHA 3O4RA 1B16A 3ZI0A 1MB4A 2PGJA 2I99A 2DQ4A 4OJNA 3GC6A 5JBIA 1HXHA 1YQDA 2EJVA 4RPLA 3Q2IA 3IKVA 4W7IA 4NI5A 4B3JA 1J49A 1T24A 3JD2A 3EC7A 1Y9EA 3IUPA 1BDBA 1DPGA 4BMSA 3ABIA 5A06A 5TT1A 2BKAA 5DZSA 3I9OA 1AXGA 4RGBA 1O94A 3UXYA 4LN1A 1HDXA 2WWRA 2PGDA 2ZTMA 4PG4A 4XGKA 4HNHA 1I36A 1NAIA 2VRCA 4RVSA 3TWOA 4WLEA 2PY6A 1EEHA 3I5MA 4E2WA 5C3MA 1LSSA 1C14A 3KYBA 4E3ZA 1MP0A 2AQKA 3RUDA 4CJXA 3QVTA 4I9UA 3C7AA 4DA9A 2OZPA 2J3HA 4K9DA 3BTOA 3HDJA 5CEJA 4WOKA 5DF1A 5JAZA 3LT4A 4FB5A 4BO1A 4E5NA 1PEDA 1PJTA 3A14A 4AJIA 1WNTA 3SJUA 3DHEA 1UUFA 4AJNA 4RF5A 2Z1NA 4R51A 2EP5A 4JBIA 4MP6A 4N5LA 5F1PA 1E7YA 5B1YA 4N54A 4QSMA 2ZCVA 5BNTA 2ZCUA 4CLOA 1H6BA 2GN8A 4GGOA 4R5MA 1LNQA 3E18A 2G17A 4P4GA 3UH1A 3DEYX 4PLTA 4CMCA 1HSZA 2TMGA 3INRA 4DQUA 4PG6A 1JW9B 1U1IA 4WCFB 5T8KA 2P91A 2CY0A 2O3RA 4NU6A 3TDKA 2D5AA 4M49A 1DAOA 1HZJA 2VQ3A 3SXPA 1EBFA 3CEAA 1F14A 4IDCA 5IXYA 1HETA 3ZNPA 3I83A 4JCOA 2WSBA 4IS2A 1T26A 4WEOA 5GZ6A 3ZWPA 2FOIA 4ZQEA 1CYDA 4GKVA 2Q49A 3LC7O 1EDOA 2VT3A 5A9RA 4ALMA 3DBRB 4DBZA 3HN2A 2QYSA 2BFMA 1KVSA 3ETGA 1X7GA 3ROKA 3D4OA 4LRSB 1XDWA 2QHXA 4BGEA 2CDBA 5I7VA 1M67A 4IUYA 4MVJE 3A9WA 2NTVA 1KIFA 4OXKA 2E82A 3G1UA 1UDCA 4D79A 4BKPA 3DZKA 4EGFA 3QV1A 2P4HX 1I8TA 2OOSA 2IODA 1C0IA 1PJQA 3AUSA 3UICA 5F5LA 5CPFA 5DOVA 3KXDA 4CMBA 4OMUA 1NXQA 1DJQA 2QW8A 4DQXA 3E5RA 1N8KA 1AHHA 3C8MA 3PFWO 4FN4A 3ZNNA 2J3IA 1PGQA 1R0SA 3QJ5A 2G82A 2B69A 3ZWWA 3WGGA 3JQ8A 2H6EA 4YB8A 5B12A 3LF1A 3ICCA 3IIEA 4FCCA 4RV9A 1YBAA 4PLCA 3C1AA 3JTMA 4ALJA 5C7IO 1YKFA 4RZIA 3JYNA 3T7EA 4WLFA 4GVXA 3OP4A 4E2YA 3CXRA 3U3XA 3GG9A 1IZ0A 1LXCA 1CRWG 2AXQA 3HG7A 2FSSA 1QYWA 4W7HA 2NVUB 3PDJA 3BTUA 1U3WA 4IMRA 4XZ3A 1S6YA 4XR9A 1D4FA 3AFMA 1LX6A 3VH4A 4II2A 2BFOA 4ALLA 2ZATA 2EG9A 2XXJA 5JSFA 1DFGA 3JQEA 3RJ5A 1MGOA 2QRKA 3PLRA 4RLHA 1R0LA 4A03A 5JDIC 1P0FA 4XRRA 4ZQBA 1X15A 3MWEB 1ZUD1 1H6CA 1IE3A 5BSFA 4ONEA 2RIRA 4KTTE 5TJ9A 1CWUA 5G0SA 3S2IA 4BNYA 4O63O 5ILGA 1ISIA 1DC3A 2X4GA 2VN8A 4OL9A 2VNAA 3BHJA 1D7OA 3HB4X 1HYEA 4QFCA 1JQBA 3L77A 3TSCA 4H3VA 4U8GA 1WMBA 1P0CA 2D1YA 3ZH2A 3AUUA 3RUCA 3WMWA 4BB5A 5G4KA 4DRYA 5T57A 4NBUA 3GRPA 4EBFA 3SVTA 2FPGA 3WS7A 3JYPA 2H5LA 4RCVA 4LSMA 2HSDA 3PIDA 3BA1A 3MJCA 4RVUA 4TROA 5GY7A 2OGUA 1BW9A 1BVUA 3FNHA 3GEGA 2VUTA 4R68A 1E7WA 5DCWA 5H81A 2EHDA 3PYLA 4KMSA 1MFZA 3JQGB 4NR0A 1U5AA 4W99A 3O9ZA 5CHEA 2IEBA 1ZK4A 1JAYA 1P33A 2YV3A 2PLAA 4TQGA 5G0WA 3I52A 4IJVA 3RBXA 2G1UA 4L9RA 3O38A 4AJPA 1V3TA 3JYOA 1U7HA 4BQRA 2C5AA 2VHZA 1J6UA 4OQYA 3OICA 1KY5A 1FF9A 1Y6JA 1XEAA 3V1YA 4FJ0A 2J5RA 4XIYA 5BSEA 4NK4A 1OZAA 2VYND 2NADA 2O3SA 1Y7TA 3DQPA 1KVQA 5L9AA 1YONA 2B5WA 3V2UA 2JFFA 3LZ6A 3KYDA 3TZHA 3PIIA 3BIOA 1R4MB 4H7PA 4K28A 1DSSG 1GQ2A 1V35A 1T2DA 2GNAA 5F5NA 2HQ1A 1PQPA 1B26A 1P77A 4TMFA 2IDZA 2HK9A 5B37A 4OKNA 4CUJA 3K2EA 2ZIZA 3R1IA 4UUPA 3LLVA 4XR4A 4QT0A 5CDTA 3KYCA 3GNTA 4ND1A 4CM1A 3GN1A 3DBLB 1WDKA 3INGA 4A73A 5AXCA 4XD2A 1BXZA 4E33A 3DOCA 3FBGA 2DPHA 2ZTUA 2X9NA 3PK0A 3H9EO 1U4OA 2C59A 3FTPA 5G0TA 2PD6A 5EQDA 4DREA 3HZZA 4NBTA 1KERA 1ZMTA 4DL9A 1C0KA 2P5UA 5LDGA 2VWQA 2PKQO 4L73A 2AG8A 4MP8A 4NPCA 5IG2A 1PJLA 4AJOA 3E9MA 3PFFA 1PQUA 4YRDA 4Q3BA 4ID9A 2DM6A 3D0OA 4OQZA 4DUPA 1R66A 1ZSNA 3B1KA 3L4SO 1HE3A 1KEVA 3LT2A 1LUAA 5IN5A 3WTCA 5CDYA 4WECA 2X0IA 2YQ4A 2X5KO 5EESA 2GPTA 3RFVA 1LDMA 2GERA 2WD7B 5JO9A 1A9ZA 1UR5A 1QV7A 4A10A 2BH9A 4CM8B 3RI3A 3AOGA 3GFGA 3D5QA 1E3JA 1JA9A 4IMPA 2YHIB 4BNNA 5HTOA 2EW2A 3ITDA 3WGHA 4XYMA 3V8BA 3CSDA 5TIIA 1PS0A 3K2BA 2Y1GA 1BTOA 1E3WB 2EXXA 4LISA 5DT9A 5ICMA 4BKUA 1F0YA 1QRRA 4IJWA 1DOHA 1FDUA 4G2NA 4J1TA 3DMYA 1V3UA 3MTJA 2JD2A 5I7EA 1FMCA 4R3WA 3LDHA 3LYLA 2O48X 4DIBA 1GZ6A 4DIOA 3VH3A 1I3LA 3TOZA 5HS6A 2GZ2A 1TA4A 2VHYA 3HJAA 3Q3CA 1N92A 2GASA 1N7GA 2I3AA 3E1KA 2HMSA 3QWIA 3DBHB 3JQFC 1EFKA 3W4JA 1ZEJA 2EKPA 3PZRA 2AE2A 3RUHA 3JQAA 1XHLA 1GZ4A 1H9AA 2DKNA 3S2GA 1PR9A 5L45A 5KVVA 1K0UA 1JKJA 2C2YA 3LF2A 4TKMA 2SCUA 3DTYA 2O3TA 4AVYA 2CNBA 4BO0A 2Y1CA 3L6EA 4YEDA 2P4QA 3BHIA 3TZCA 1PL7A 2DU8A 3MEQA 4LVCA 3LC2O 1JAXA 5AXAA 4J3FA 4D43A 2Q1WA 1E3LA 1MUUA 3JQ6A 3R3JA 2OFPA 1E0DA 1ZMOA 1U8XX 1DO8A 4DMLA 1H9BA 4FDAA 2JAHA 1FDSA 1BVRA 2JHFA 1V8BA 3M1LA 2AG5A 2DBQA 3WICA 4DC1A 3PQEA 5KVCA 1HDGO 1EBUA 3UW3A 3P19A 1DIRA 2ZB7A 5EQFA 4EUEA 3IDSA 3D3WB 1VE9A 2W90A 2YHUA 3MCVA 4AJ2A 2O7SA 1NHGA 3PJDA 5G0UA 4BIIA 4TVOA 1W73A 2B4QA 4YAGA 4CMHA 4G5HA 2Y05A 4CLOB 4UVDA 7MDHA 1IHYA 3DB2A 2NU6A 2HJSA 5ER9A 4RF4A 5AOVA 3OJOA 5EMHA 3HB5X 3GVIA 3CZMA 2UDPA 3W6ZA 1I30A 3AJRA 5HS4A 2I76A 3WGOA 4O6VA 5I9MA 4CMIA 1D1SA 1DFHA 3ZWBA 4G81A 2NVUA 4P22A 4YA6A 3X2EA 5TSDA 4DLBA 3CMMA 3ZU5A 3ETEA 4Q3NA 1ADCA 4GX1A 3SX2A 3JQBA 5FWNA 1ZFNA 4MOWA 1U3TA 2QIOA 2DVMA 1D3AA 4RJTA 3QWAA 3ORFA 3WX0A 4B8ZA 5JYDA 2POQX 4CMEA 3QVSA 2P68A 2W4QA 3ZWNA 4R9SA 3RC2A 1D1TA 1ZK0A 4XIJA 1ZK2A 4BNZA 5MGBA 1A4IA 1P9LA 1R4NA 4J0EA 2EF1A 3GT0A 1M66A 1HKUA 4XX0A 1YDEA 3DWFA 3ZNOA 3GDFA 4MVJF 1I2CA 2QX7A 4BV8A 3ENNA 1T2EA 1ZJZA 4CR8A 2O23A 1EQ2A 3WYBA 3E82A 3H7AA 4E2ZA 4DPLA 4WPGA 4MVJP 2VYVA 4I1IA 1XELA 5CEFA 2OMEA 2W2LA 3OIDA 4CUZA 5M6DA 5L4NA 2FHSA 1SAYA 4KZPA 4L74A 4Z9XA 2D0IA 4JGBA 1AE1A 2P9GA 4Z9FA 3OFSA 3Q2KA 2V6MA 4GSLA 3AUAA 1H6DA 4WOJA 5IDWA 4YYZA 4R9RA 3DL2A 5DN9A 5IZ4A 3W1VA 5ADHA 1M75A 2X9GA 4J16A 3ULKA 2FRDA 5DCYA 1PJ3A 1ZBQA 1Z6ZA 5TQVA 5K0ZA 1NFQA 3QHAA 2Q1UA 4JBHA 1ADGA 3ZV5A 3MJTA 2DTXA 3OJ0A 1HTBA 3IAHA 3WG9A 5K6AA 4M55A 1GZ3A 3IOYA 4I8XA 4OAQA 3GNSA 5KJCA 2R00C 5FI5A 3NUGA 3O26A 4E5PA 1IHXA 4BQPA 3DFZA 2QZ9A 4FBGA 4GX5A 5KKAA 3WSVA 5JCJD 4INAA 3H3JA 1HE2A 2AEFA 1WWKA 3CKYA 3VTZA 5HRUA 3ZNQA 4YACA 2J8ZA 1GEEA 3L4BC 3O8QA 1YO6A 1PZFA 4FFLA 4RF2A 2Q3EA 3NV9A 5JS6A 1L7EA 1O0SA 1W8DA 3JQDA 1GAEO 5A02A 3AI3A 3QRWA 4BNMA 2VHWA 5COAA 4JP2A 3WR5A 1N2SA 2H1SA 4I5GA 3PHHA 4CM3A 1ZXBA 4PLYA 1KVUA 5T5QA 4FPXA 5G4KB 3DBLA 1XCBA 1U28A 4CMGA 1GV1A 4OIMA 1PWXA 3R6DA 4ALKA 3STHA 4RVGA 3GPIA 3NT2A 2ZJ0A 3GHYA 3PP8A 1BW9B 3U09A 1RJWA 3QSGA 4I9HA 2Y0EA 1ZIDA 2V65A 3KV3O 3DZJA 2WEKA 1DXYA 3C3XA 3TL2A 2NU7A 3N58A 5FI3A 3SJ7A 4PGFA 3FHLA 3M2PA 4PG5A 3G1TA 2GLXA 4CM9A 1KEPA 3CTMA 4BL5A 1K89A 3RUFA 1QMGA 4UVIA 5COBA 4JJFA 4NBVA 1LRLA 3GLQA 2VZ9A 4JXKA 5JMPA 3PQFA 2WD7A 4EJ6A 3VPFA 1NFFA 4L4SA 3UUWA 2P5YA 1ZK1A 3LLSA 3PHJA 3GAFA 4J4TA 3PRJA 1GQQA 2YHIA 4NNJA 2HMTA 4XB1A 2NNLD 3KEOA 1U7TA 1GYPA 3DC2A 1E3WA 1EVYA 2WM3A 2ZYAA 4BNHA 4E5YA 3ROPA 1QYXA 4ZICA 4JIGA 1TEHA 1GY8A 1ZNQO 2OP0A 1EVZA 3KYCB 3VPGA 4B79A 1O89A 4JX8A 4FJ2A 3NKLA 1T25A 4LGVA 2O3JA 3EMKA 1E6UA 2Q4BA 2ZYDA 4QO7A 1DLIA 3DZBA 1VJ1A 2QRLA 4ND4A 4A0SA 2PH5A 3QIVA 4J7CA 5G4LA 1E92A 1B8UA 1NWCA 3EZYA 1AUPA 3GR6A 3I3OA 1LJ8A 4BO4A 1GADO 1ZSYA 3ZV4A 2PZJA 3K6JA 4Z9YA 3ZGYA 3GZ4A 1YVEI 2NTJA 4YWJA 2E4AA 3PGXA 3PHLA 4JBGA 3VZSA 2GYYA 2ZK7A 3E5MA 3W8DA 5HBRA 2DPGA 1I2ZA 4CMAA 1OBFO 2YZ7A 3UFXA 4PLWA 3KHUA 1K6XA 3L9WA 4QX6A 2WMDA 4IM7A 4EYEA 1H94A 1U4SA 3C85A 5ITVA 5JYEA 2NM0A 2Q2WA 2YFQA 3AY6A 2GZ3A 5KVSA 2HRZA 1A4UA 1QXSA 3DZGA 3GVHA 3DDNA 3FNFA 3U4HA 3WLFA 2UUPA 2J6IA 2BFPA 3BMQA 4NMHA 4D3DA 5DP1A 3WBFA 4ND5A 4Q3DA 2VTEA 2AW5A 4FFMA 3RC7A 1HDOA 5T67A 1H5QA 1DIAA 3ADOA 4BO9A 4B4WA 3NYWA 1I3KA 4NZ9A 1AXEA 2GD1O 4J0FA 5U4QA 2BMAA 1ZJYA 4FC6A 2PR2A 5TC4A 4Q39A 3WXBA 5AVOA 4IGEA 4ZQFA 3D64A 2EIHA 2VWHA 4ZU3A 4PLVA 3U4IA 3UCXA 1J0XO 4EEZA 4E21A 3EW7A 1CQJA 3D3WA 1DC6A 5TT0A 1FXSA 3U9LA 2BGKA 1KETA 1ONOA 1LRKA 1QORA 3FBTA 2DFVA 1M2WA 4KUGA 2B0JA 2X5OA 4PLPA 4O0LA 1DIHA 4FFRA 1SOWA 2X5JO 5F1OA 1GU7A 3NEPX 1ZSVA 1YRLA 3AU8A 1VKNA 3HQ4O 3JQAB 2E48A 3K92A 4JLWA 4GGPA 2OHXA 2XXBA 5CDGA 3H2SA 1NVMB 5IZCC 3VZQA 2PD4A 2IZ0A 3FWZA 3S8MA 4GH5A 2C20A 2B4TO 2I5PO 2WE8A 4P38A 4F46A 5KTKA 4HUJA 1PWZA 2VWPA 4NBWA 3BMNB 1HEUA 2B36A 1VKOA 4IGFA 3KOUA 1I3MA 3ZW8A 4A26A 2X86A 4DC0A 1A9YA 2HRBA 1IPFA 3CUKA 4C4OA 4D42A 2Y67A 3RSHA 1VL6A 4LSWA 2X22A 8LDHA 2HK7A 1TVEA 4R3NA 1CDOA 1JVSA 4YPOA 5K9ZA 1GR0A 1MFPA 1MG0A 1DBVO 2O2SA 2YDXA 1NBOA 5JDIA 5I9LA 4J1NA 1ZW1A 4CQMD 3P5SA 3K73O 1NQTA 3FR7A 3ZWAA 1UXHA 3ENKA 3H5AA 4YAJA 4XCVA 2VT2A 3HE3A 3K30A 4TRRA 2AHRA 4RQTA 1ENPA 1B14A 3PYMA 3DHYA 2RCYA 3FF4A 5L95A 3ZHZA 2EJWA 2J5QA 2VHXA 3U5TA 1SOVA 3ANNA 1SCUA 3PHGA 2AQHA 4KOAA 1F8GA 3HFGA 4NK5A 1ULSA 1ADFA 4WGGA 3ROMA 2PV7A 3IJRA 4MVJD 4Q3CA 4WLVA 1EE2A
chains in the Genus database with same CATH superfamily
2GETA 1YBHA 5HF9A 1OLSA 4QO8A 2W2PA 3CCFA 4XQGA 3N0VA 4QQKA 1FMJA 1QIKA 5BNFA 5G53C 2ATEA 4EPVA 5EIXA 4B3MB 2J46A 4G23A 5CJPA 4YCDA 1OB5A 3EEBA 4CI9A 4IWXA 4F4JA 5CLJA 3Q8LA 2BHNA 1EJ2A 3EF3A 1PEAA 2V45A 3OWOA 4B6OA 2WJWA 3R7FA 3W3AH 4XA8A 4AJ4A 1KEEB 1P4SA 1ZD1A 2AOXA 4LX0A 4ZEVA 4MV5A 2ORED 3LWDA 3LUHA 2IVZA 3WK7A 3EAQA 2XQKA 1DEHA 1HE8B 2R84A 2NPFA 1I80A 2ESRA 2WF5A 5CVDA 2OCGA 4NEHB 3WDKA 5KYTA 3B6IA 5EZQA 3V32A 2RI0A 2DQZA 1D0VA 1O57A 1WP4A 1PT6A 4PC2A 4GLOA 2I8LA 2L69A 1ZM9A 4TXJA 2XYRA 2Q9UA 3Q88A 3ADDA 1FS4A 5LQDA 3AY7A 3HWWA 1R4NB 2WYUA 1JFLA 3NHRA 1UAYA 2H1WA 4YJ2B 2VHVA 3HJRA 3E8XA 4KN9S 2V7VA 3L7MA 4XJSA 1U1FA 1XD2B 2V7QD 4W9NC 3FI9A 4D96A 3DV0A 4EVRA 3ACDA 2O1XA 1NSYA 1YFJA 1WO8A 2ZAMA 4N3BA 3LHKA 1Y63A 5A4DA 3EUWA 3O2QB 5L4LA 1V37A 1Q21A 1I72B 2C77A 2X0NA 2UVPB 1U8EA 1TFUA 5AH0A 1KOJA 1WXHA 4ZJUA 1YS6A 4PU0A 2HWYA 3BRWD 2IS1A 5DHRA 5DLYA 2YNMA 3DE3X 4FILA 4MPDA 4ZT3A 4AL4A 2P9ZA 4PBTA 2O8FB 4M87A 2PVCA 4DM7A 2QLBA 3K8OE 4G0UA 5F35A 1FJHA 4Y9TA 3HYCA 5HF8A 2WVHA 3VZPA 2X2PA 1XXHB 3PJGA 3STTA 5JY6A 2C7PA 2ILTA 2B9VA 3BXEA 5IP5A 1OV6A 2BN4A 2MYUA 3NGLA 4PHTA 3TVYA 2AH5A 2IUYA 2VJMA 1G4AE 3N9IA 1LSJA 2MSCB 1U1EA 2ZYGA 3OZTA 4LWOA 1C0PA 1Q15A 3WK5A 1ZVJA 4GKAA 1J21A 1UFQA 2Z1DA 4HSEA 3JU3A 2M6KA 5LZ7A 4DBLC 3AEUA 4PWYA 3ADPA 2I0FA 1ODTC 1J23A 2C3YA 2VSNA 1EDZA 3H1TA 4XVQA 4EMSA 3QEOA 4F5YA 2EDCA 2WG1A 1B2RA 2LV8A 2GDJA 2LDBA 1O6GA 3ZCXA 1NYTA 3I0MA 5JCOC 4LDNA 1NVUQ 1JZSA 2EZUA 4XM0A 3ZGLA 4CHGA 2QRPA 1SBHA 2IIPA 3TJRA 2RSLA 5DNWA 4CM7A 1GU0A 3BTVA 3G2QA 1J24A 1AZSC 2N42A 2ZRNA 3H86A 4JLJA 4V1CI 1SXJB 1OAOC 2G5CA 3GLVA 3LQFA 4RY0A 3X1WA 3URMA 2XB8A 4OHUA 3B7WA 1SHKA 4CEIA 3O8QB 5DNCA 4MMXB 2OV2A 2FA9A 2B3DA 2R7AA 1S2MA 1VHWA 3GB9A 3ZWDA 4QUBA 5AIBA 5KU1A 1UWCA 3U4QA 1NW6A 1IQRA 1VMKA 3TLYA 1RM0A 1XZFA 1PP4A 3HGTA 5BW6B 3FPSA 2KB0A 5CYGA 4ZIRB 1B3BA 1RXIA 1W44A 2DR0A 3EP3B 4IZIA 4DWVA 4ZOQI 5ADWA 1DAPA 1YB7A 1XK6A 3HDTA 4DJAA 1CD5A 2O0HA 1GT91 4MKRA 1T5LA 3WIDA 4AMZA 2JFUA 3O3MB 4Q4AA 3E8MA 1U7ZA 2PD3A 5KJ6A 3FLBA 4BRZA 3GI1A 4HNVA 4OAOA 3BE5A 3KQOA 2J9GA 4QBTA 2II6A 2J3QA 5JSYA 4JLPA 2MYNA 5D3MA 3L5KA 1ND6A 4IIJA 3RKRA 3GLGA 2XVXA 4CG1A 4LYYA 4GO1A 1QR2A 1UZMA 3K1JA 1I3OA 4YV1A 1NQVA 4DUGA 1HYGA 3PNSA 2UUCB 3GJ6A 2JFVA 2XYQA 3DE4X 1SB9A 2OZVA 2C8KA 2OBLA 4Z86A 5EP4A 2ORIA 1LF0A 2GK6A 1RQPA 1FDVA 1KI9A 4DS3A 3UF0A 4WN9A 3AHJA 1GCIA 3A9RA 2OB2A 3SR0A 1VRWA 3RNLA 5JEEA 2DFNA 2QR2A 4Y2SA 1MAHA 2AL7A 2I1VB 1QE0A 2ATXA 2I6TA 2TMYA 5AW3A 3TLMA 2F62A 5JE8A 4ALMA 1YZ3A 2EW8A 1QIIA 3HDHA 1HL3A 2IGBA 2HRCA 3RSGA 5CNMA 2REBA 4FCVA 5AXBA 3UK2A 1NP6A 1V2GA 2FSFA 1GA4A 1Y8ZA 2HUPA 2HDNB 1SOUA 2ETVA 5LKAA 1EAMA 4ZTBA 1F17A 1J5EB 1T0BA 3PYXA 1BIFA 2WJ4A 1MABA 2XMCA 3V4VB 4CNBA 4DWWA 5C5DA 4CKCB 4PPQA 1G8GA 1DI0A 3G0IA 1PJCA 4HXGA 4QTTB 2GTPA 2AYXA 2YZGA 4BLSA 4BQQA 4PCAA 1Q0PA 5FOQA 1KDPA 4QQ8A 3KETA 5DGCA 1EFRD 4FMBB 2GVNA 1HKHA 4HHEA 4ZVVA 2IS2A 2JZNA 5EIWA 1LBTA 1DAKA 1J8FA 3NHAA 1BZYA 2VJLA 1OFGA 1CY8A 1TW2A 4PBSA 3ZU2A 3OLVA 4I46A 1EWQA 5FBLB 3RRBA 1O5TA 5KNCH 2O7QA 3NJ4A 1M6HA 2OESA 4ZYWA 4RYLA 4I36A 4N49A 1F4LA 1OH7A 3I9NA 2EGGA 4R1OA 2BV3A 4FM9A 3AXSA 4MPJA 4WNYA 3PQ3A 2PZ8A 4OHPA 2JVIA 2R8EA 2XPCA 2GTHA 4D4JA 2XZOA 2Y0DA 5B1HA 2GWRA 3NAQA 1MV8A 3MBOA 3NYRA 3AGQA 4TYWA 1NVVQ 1MJ5A 2NZWA 3ENWA 2R8RA 2YIVX 3JQ9A 2OR3A 4LXYA 3HI4A 4RPCA 5LR6A 1UBCA 2HTEA 2HD4A 2Q0QA 2RGYA 2V3WA 2YV5A 3QMMA 3JQQA 4HQLA 5BQFA 3ZU6A 2OUIA 4MKFA 2OCPA 3O03A 4E14A 5LNK1 1MO4A 1QC5B 3JATB 4FGWA 4M99A 4X7PA 4R4JA 4N7JA 4EGCB 4EX7A 4XVUA 2Y66A 1FLNA 5DM1A 3OM0A 3GEBA 3TBHA 2D13A 5BR4A 1YFLA 3EP6B 5D6OA 1IWOA 4GVLA 1TLTA 3ENQA 3FCAA 1T4MA 4PX9A 4U6SA 1XMXA 2C5SA 1NASA 4UCQA 1F48A 1MB9A 1NYLA 1H2HA 2IT1A 3PUKA 4OP1A 4I5FA 4QLOA 3USCS 4JJ4A 4XUCA 1S1MA 5FO0A 4BCDA 2CMHA 1ESZA 3DP9A 3FYUB 3CLRD 3EDRA 4V0KA 5TGTA 3ZWYA 2C5EA 3V4OA 1T6XA 2ZZNA 2A4MA 3F4BA 3DMRA 3FM9A 3ZBQA 1MPXA 5KKCA 1GGKA 3MMSA 2FPIB 3FGOA 3ZHTA 1BHSA 3O95A 3MJRA 4FUTA 1TQ2A 3K9WA 3H0WB 3QVMA 2ZSEA 1G16A 4OKSA 1E2UA 4OYRA 1QCZA 2Q6VA 2Q46A 2VPXA 4I55A 1UK6A 1IZZA 2K7ZA 1S9DA 4GMGA 4TKZA 1B8VA 1PR2A 2HF8A 3KQTA 5K8JB 3EZ2A 1Z5GA 4G65A 4HLDA 1EK0A 1W87A 1HX7A 1FX0B 4N8EA 1N5KA 5K0EA 1ZUNB 4JQSA 6REQB 2P3QA 2PRKA 1W25A 4BB9A 3VOSA 1WCYA 3G9UA 4E31A 5JXHA 3H5NA 3IUSA 3RAPR 5SYNA 1CETA 4PQGA 4FYXA 2WWGA 3ISJA 4YRTA 1ZVMA 4AZ0B 3B1YA 1EE9A 2W2VA 4WA7A 5BOVA 3WWDA 2RJNA 4AS3A 5H4GA 4UUBA 4JJEA 5KMGA 5T3UA 3JD0A 1Z88A 2DLCX 1IJEA 4YMHA 3TTVA 3ONEA 1W5TA 3PVSA 1P2GA 4ZU1X 4CU2A 4DV1B 3GLIE 2GUGA 4L9WA 4KOEC 1FP4A 3TNLA 1H2BA 3UTCA 1LVUA 4HTFB 1SCBA 4B4VA 2PWZA 2WJ6A 3J7TA 1VJCA 3F4LA 1QB8A 2J45A 2P8JA 3H9UA 3NBZC 3HDYA 4D81A 3OPQA 1T6BY 5THKA 2JCBA 4UATA 5IHXA 2BEWA 1ZOPA 2XMZA 3E9ZA 1TGYA 4WY8A 1JENB 1FUYB 1Y6ZA 1ODLA 4GOMD 5AM2A 2FMIA 2G6TA 2EBHX 3NKFA 4OQPA 4Q4DA 3ZXIA 4O1MA 3OTIA 2ZXEA 1YS7A 4RK6A 5L6LB 1V4BA 4BO6A 2IU6A 3MINA 4DLPA 5DDIP 1CY2A 2GBLC 1FUUA 3IURA 1O2DA 4DT1B 4EJMA 5H59A 2R4QA 1T10A 5JZSA 4FW9A 4CKBB 1E2KA 1YWGO 2A0UA 1EGVB 5ALWA 3UO8B 5LQNA 1DEKA 3ISVA 4N01A 2OG1A 4C6SA 4AKHA 4MQFA 3TF5A 5EZSA 4DVJA 4PN3A 1ATIA 2OCDA 3F6YA 4P3OA 4BO8A 1DKOA 2XOKA 4JT2A 4ABTA 1IY2A 2PEYA 1AQUA 2R6ZA 2ZAIA 1II0A 1YRYE 4DGQA 1Z07A 3LKDA 2XW6A 3TAXA 4C0QC 4XQ0A 1HBJA 3PF9A 2OXCA 2BELA 2F4NA 4KXWA 3VPSA 5BUZA 2E37A 1UFVA 2NZ8A 3BIWA 3BHMA 3E2IA 4EG5A 1IONA 2WVJA 2XNHA 4HDQB 4KWIA 4RBNA 4EDHA 2O8CB 4HVTA 3E3AA 3DUWA 3ZJ4A 4P4SA 3ASZA 4HLQB 4OGFA 1KSGA 1C7EA 3WYDA 1R6VA 1VLJA 2JARA 1MHPA 1U6JA 1BX1A 2PIDA 2I55A 3ZV6A 4BQOA 1T36A 1WOYA 3BB1A 2QSZA 4O2AA 3MJEA 2F3PA 3D7SA 1S2NA 4RENA 4ZDIA 1T1RA 5E1BA 5E6RB 4DA9A 3NRBA 1JEAA 5AICA 4C0AC 3TGPA 2VTVA 3HCFA 4K6FA 5BV1A 1XRSB 3I9V6 2VAWA 1E98A 4M9RA 2FX5A 4L5BA 4WXHA 3PHCA 5FT9A 4LXGA 1QTQA 4F1WA 5FEUA 2GFQA 1GKUB 1IULA 2VZEA 3QV2A 4OQLA 5F3RA 1TMKA 3KFVA 3N7UA 4FQ5A 4QJBA 2RD2A 3TB6A 1XQVA 3RYFA 4F3NA 2C4NA 4YX9A 4NXMB 3QVWA 1ZGZA 3JWPA 3MWGA 4MO2A 1OF1A 3C3WA 2BGGA 1T4CB 2WZBA 4LJKA 4ZOCA 2Y27A 1BROA 1KP9A 1OI3A 1P7ZA 2M9MA 3IVMA 3PDIB 5EE0A 3RUAA 4JVSB 1NN0A 3EMBA 4Q6WA 1O03A 5AKXA 4BS9A 2A94A 1R10A 4HQKA 3KNZA 5TPZD 4AKGA 3GPDG 3AI2A 3I72A 1BXGB 2B2CA 3HRIA 5MHTA 1YACA 3MCUA 1PLLA 4LJ7A 3VR3D 2QN1A 2YJZA 3BN3A 3PNVA 1D4AA 3SZ3A 4BFSA 4EAQA 3BMCB 5JNSA 2ZE5A 1U6IA 5REQB 3UK1A 4BO7A 4WZ6A 4TYMA 3ZCUA 1LZKA 1Y8QA 3FGPA 3NEYA 1Q92A 3MJFA 3V1TC 3F73A 2A86A 3BDAA 3PG5A 2FDXA 2F43B 5AKJA 3PPIA 3RK0A 4R1TA 4BWGA 4E1BA 1M5RA 1EWRA 4BO5A 1OI7A 1XNGA 4KW7A 3GU3A 3LWZA 1Y5RA 2A7XA 3AQIA 3OQVA 3GL9A 2D1SA 1WU8A 2C2HA 4ND3A 1HLFA 1TK2A 1SC6A 3URKA 2COKA 3GVCA 5ALGA 3OTWA 4G1MB 4CF4A 3AB7A 4GC5A 4AZ3B 1TGVA 2FEXA 1PNQA 1THTA 4AIRA 4F45A 4MYSA 1AMOA 5JWHA 2F1OA 4KE6A 1DAEA 4J0KA 3JZFA 4ZQIA 3P2EA 2ZAOA 3TTSA 1RTTA 1GFIA 3KKOA 1T15A 5CYPA 5CFOA 1C3VA 3BGSA 4XGQA 4MZDA 4B9AA 3JD3A 1BCSB 1S4QA 2Q2NA 3EVFA 5J4VA 1QZUA 4I1PA 1OOEA 2IYLD 4LXIA 4A8HA 2ZM5A 3DXFA 1PDOA 1OSNA 3P0EA 2NX2A 3RAJA 2FJPA 4PFSA 3A36A 4RM3A 2NXJA 2WYIA 4Q9IA 5CT8A 1SR8A 4BCCA 5BUSA 3O4IA 3AGPA 4PQYA 2FYTA 3G5LA 4F2HA 3V97A 4Y2HA 1MAAA 1UADA 1NN5A 4KQWA 3DF7A 3BZUA 4X8HA 4OSEA 1Z3IX 1RWBA 1CK4A 1UJNA 4F71A 1IK4A 1XKTA 2ZUUA 4XDYA 3WGNA 4AY2A 5K99A 1GFSA 4RU1A 1T35A 5IABA 4V1CA 1EWVA 3LUJA 1US8B 3LZDA 4JJAA 1NYQA 4GZ3A 4ITUA 3W3ZB 3ZWOA 1IY0A 3CH6A 1Y7HA 5LDHA 1E7RA 4IH4A 3QA9A 2QI9C 2V96A 4J2TA 5E7MA 2PCLA 4M8IA 5NLLA 3CS3A 1V71A 3V7UA 2IYQA 2W11A 2M6SA 4KO4S 1TYBE 4M8NE 4UHFA 3RR2A 1ACJA 5FWYA 3H0VB 4GPD1 3MWLA 3QPVA 2GOYA 3TMKA 1BWRA 1W6UA 3UK6A 2I2FA 1CJVC 2GN2A 3DDOA 5AKYA 2GD0A 3R4VA 4LBVA 1JXQA 4JODA 1YQUA 4OB8A 3GH3A 1IM5A 4A2CA 4QJ3A 2ZZKA 4YJFA 3AHFA 4DIFA 2X14A 1J70A 3COYA 4MW9A 1ESDA 4I0WB 5IAGA 3VSAA 4PAMA 1RXSA 1YI0A 3LCVB 4BP9A 2IUSA 3WKDA 4G0MA 5ELXA 4RY2A 2E6UX 5HJ5A 2FWRA 1DTWA 1VQ1A 1RRFA 3GZJA 4WBXC 2PH7A 2A88A 3WYEA 3GJRA 3BWYA 1IUKA 4NZMA 2F3SA 4CQLA 4HUTA 5JHGB 4C7KA 3FYTA 3RRXA 3SPXA 1A69A 2QL6A 3R40A 1W0JD 2R2GA 3FCYA 2PLNA 3MTEA 4GRIA 1EUQA 1XQ1A 3ZJUA 5IASA 2Q6IA 5HOQA 1U7OA 5LM3A 3OKAA 3P2YA 2P4UA 4XASA 4XFJA 1XTPA 3N1UA 1N36B 3IPAA 5BMVB 4CTMA 3CF4A 2GK7A 5KX5F 2DUNA 2IY7A 3H7IA 5IYZB 5KJFA 4ZVRA 2PMWB 2GPJA 3BBLA 2WJIA 1IYZA 4LYFA 1MU0A 4GKBA 5KWIA 1ISMA 3U31A 4KHPB 2IIBA 2P9CA 2PLWA 3F8TA 3CRMA 1XQYA 3MQ2A 4UU0A 3WLAA 421PA 4CR6A 2JLVA 4DRXB 2HNKA 4PYOA 2CB9A 3OMLA 1DRUA 3MWKA 2BDTA 1I6KA 2GXQA 4FZJA 4PPFA 4U4AA 2ZB3A 2F90A 3CNBA 4DAEA 2EQAA 3ROEA 2DETA 4TUYA 1DBSA 3JQCA 1Y3BE 1YZFA 1GCOA 3U9TA 4BNIA 2O19A 1A5AB 1KJWA 2YWDA 5HW0A 1FFHA 2FN4A 3CLTD 4HKTA 3MMXA 4I4TF 1M1NA 4POAA 1LC3A 4UBKA 5T4EA 5DTEA 3WYFA 3CX3A 1Z7YA 4OOFA 3RH0A 4LBZA 2DECA 3X1MA 3RROA 5J1SB 4Q00A 2IDMA 3I6IA 5DCLA 3FHJA 5AUQA 4DQKA 4HUQB 1OXUA 1Q57A 2NYVA 1GGMA 2VNIA 1FX1A 2H8GA 3G49A 1YBVA 1YQQA 3D9QX 1GNRA 1R12A 5FL7A 3A1VA 3U2QA 2JLXA 1L5WA 2VZ8A 4ZN6A 4TV9B 1OB2A 5DLDA 3TUXA 2VXCA 3D1LA 3OO1A 2AK3A 1L5VA 4D6YA 1EKXA 1I2BA 2YXDA 3GHHA 4IHJA 4HGNA 5LP6A 2JCSA 2Z09A 4FMDF 1QH1B 3GGJA 3PC3A 4TWRA 1X13A 3ZWXA 5IJXA 3KALA 3SFTA 1DIGA 1A8PA 2FVXA 2WMYA 1GLVA 5FX2A 3L18A 5DTQA 5L7WA 5LFAA 3A58B 1MQAA 2YJ4A 4IYRA 1CNMA 1FOEB 4OQMA 1CPYA 5M7EA 2AQIA 1O95C 3CMCO 1UP6A 1QONA 2CNKA 3T3MB 3TL3A 4PHHA 4U3JB 2W83A 3P52A 1GYRA 3QOYA 4UBMA 4AO8A 4C7JA 4CGZA 3OLYA 4LF7B 5A5EA 1WXIA 3HNPA 4FFNA 5DXFA 4Q1CA 2LTAA 2NSYA 2Z04A 3HLTA 4YJHA 2FMKA 3EIWA 1G1AA 1FVFA 1MO6A 3Q8MA 2XQFA 1BJRE 4S2EA 1P9NA 1BA2A 2OV8A 2WSSD 2I80A 1AF7A 4IJMA 4UPEA 1VLVA 4FZRA 4X20B 2HPZA 5I5GA 5IM4A 3UMJA 1VMIA 2NLOA 1O96A 3FSEA 4HX2A 3QU4A 3MERA 2HWUA 4UJ5A 5BOSB 4PCLA 4CZ2A 1MXFA 4GR9A 4S04A 1PGPA 1K6IA 4K6HA 2XXAA 4AO7A 1NDHA 1E66A 1Z4QA 3MELA 3HPQA 4C30A 1EU1A 3MGKA 1LLQA 3F6RA 3V46A 4MW6A 2AI1A 4ZHSA 3JZAA 1O94C 5AI8A 2IYUA 4QGGA 5JDCA 5JSUA 2V9CA 2AD5A 4HMQA 1ZN8A 3WRYC 1GN9A 1JNYA 3FB1A 4LHWA 3QEBZ 3OE7D 2XNSA 2NSLA 1CUGA 1JKMA 3C1OA 2Y1EA 1SHZA 3A1UA 1SBNE 3WJAA 2V0GA 3Q8WA 3USZA 3GJXC 2Q2QA 1P45A 4QSHA 2ON6A 3M82A 1BOOA 2Q5HA 2QMOA 4NV1A 2WT4A 2ZAGA 4YJGB 5IC5A 3RANA 3CN9A 1ZZEA 3BSSA 4C4SA 3SWWA 1UMKA 3ESQA 2E4WA 1O6BA 1WXEA 2Y1KA 4CQMA 1SCKA 3R8XA 4CV2A 4AECA 1X3SA 2GZ1A 5JCXA 5B6PA 1CULC 1K6JA 3ZWKA 3LCMA 5IJ0A 4TQ9A 2CLCX 1U8ZA 1YFKA 2SICE 1R27A 1YL7A 1KJ8A 2XUQA 4XYLA 4YRKA 1GTMA 3G6WA 3ZN2A 2AMVA 2JCXA 2BFFA 3ZYZA 1G20B 4DSAA 5BV7A 5EINA 3TLCA 2UXBB 5H0IA 3I5UA 3NCHA 1Z25A 3V1NA 4BXOB 3CX4A 4L6IA 4G89A 2FR8A 1DOAA 3ELBA 5ESDA 3F7OA 3VC3A 3WB0A 4NP6A 4C78A 4RFLA 1JAIA 3EC2A 1IXSB 1LPBB 3CNOA 4LMPA 2OL4A 3AESA 4HAUA 1WXQA 4LRUA 2GEKA 4LPKA 3JAMA 2YICA 4P98A 4L8VA 1FY2A 1PJBA 2HKIA 3VDRA 5EIOA 1KH1A 2A78A 4HB3A 5JC1A 4UAGA 3SC6A 4EVSA 2RH5A 4FNOA 2C42A 3I1JA 3R3SA 4IIGA 5EZYA 3HA7A 2QVBA 2VKQA 4OHZA 5DSTA 3GGSA 1PD1A 2H9IA 3OOHA 5LYJB 2B4KA 5JXWA 1D2AA 1G6HA 1HYQA 1ZK3A 3DCYA 1PDWA 2Q3CA 2R1TB 2C5HA 3A27A 2P3SA 4LMAA 3OM1A 1UAGA 5J4HA 2B5OA 1CIVA 1CB7A 1FYDA 2QTBA 1YZKA 3QWFA 2XR1A 3IAM1 1NJ6A 3T5DA 1AZLA 3NAMA 4NESA 1QR6A 1E6KA 2R3SA 4WZBB 5JJCA 5EXTA 4XQEA 3VQTA 3WP1B 4AKEA 1V5FA 5FUQA 3JAKA 1K2WA 3HZOA 1SUWA 4OGWA 5EGSA 2PX4A 3JALA 4B45A 1KOFA 2B20A 2JIMA 1SXQA 4M89A 1I4WA 4P3YA 1J7JA 4HDNB 3U37A 2V7QA 4WCDA 3NRCA 3G89A 5BV2P 2YBDA 2HFKA 4J90A 3CVUA 1XO1A 1L3BA 3NHMA 1IDN1 1S2DA 4BO3A 3IT2A 5DNAA 3ZHRA 4NCNA 3NZEA 3PGVA 3ANMA 1L1FA 3DTVD 4URYR 1P91A 5GINE 4YRLA 3BAZA 1IOWA 1U2ZA 3GG2A 4MUHA 5L7YA 1S89A 2ZT6A 4EPXA 5AJYA 2PYIA 1K5HA 2FP4B 1JDJA 4WBNB 1XEXA 4G67A 1Z3CA 3QWBA 2FPWA 2DPLA 3BG5A 2W2MA 3NAGA 3GGOA 1ODCA 3CH5A 3LDAA 5JNLA 1G17A 2JFWA 5K6TA 4FDLA 2QGNA 2NV6A 4M88A 3PL5A 2ZUEA 1JSRA 2NG1A 2OO3A 4UOZA 3UG7A 4AJ1A 2NTEA 3FNEA 3NM5A 4G5FA 4J7XA 5CURA 4A82A 1TF5A 3QEMB 4B3XA 4GRDA 4Y6PA 5T41A 5CFLA 3RJ9A 4PHFA 2CFTA 1DWPA 2W93A 1R8QA 3FUVA 2FWJA 1WMAA 3FDIA 4J2HA 1P1RA 4KQ2A 4AMUA 2JAPA 3IQEA 4II3A 4EKYA 2A9PA 4TS1A 4QZVA 3WZ2A 5HIJA 3A6PC 3ZJXA 1NP7A 4YS6A 3P9YA 4W1SA 5T64A 4HQ0A 2V59A 2VYFA 3UJHA 4WNIA 3PA8A 3MS4A 4RLQA 4P2GA 4K6GA 1ORVA 3TXXA 3MT9A 1O0CA 1NNEA 4UPVA 3LNTA 3AUKA 5ARCA 4QOGA 2WYHA 3AM4A 2KX7A 4RA6A 4Q1VA 1P4AA 2LCQA 3GLGE 3TAUA 2X8LA 1CX9B 3VGJA 1TU3A 1TZKA 1Y6RA 1V3VA 2OLKA 4MIKA 1VPDA 2EWWA 2GRUA 2NO5A 1ISJA 3Q15C 1PSDA 3LH5A 4Y7DA 1F2TA 2ECKA 1JI3A 3QFSA 3REGA 1EUDA 4ZV7A 3HR8A 3ELYA 3NHPA 4HDRB 2BZSA 3ZVRA 4RQBA 3RS5A 1P4HA 4DAOA 2ZBEA 4HQRA 2RHRA 4QXOA 4G84A 2Q1YA 3Q7TA 1TD9A 1YQ9A 5JPIA 4RNDB 2JZCA 2VXBA 4CEHA 4WEQA 5FOUA 4RTQA 2AN5A 4CCYA 4BWYA 3LT5A 2AKEA 1V6AA 1S7GA 3KXKA 5DHUA 4MW1A 4IOMA 5CVEA 2C7QA 1UM9A 3W5JA 2WG0A 4RA9A 1FDWA 1YUMA 2QMQA 4E4RA 4JJZA 4LY9A 4C3UA 2JIRA 4BASA 2GXUA 3W5VA 1X70A 1U2RA 1ZC3A 3SDZA 4WZAE 3VKVA 4GP7A 3HHPA 4QBFA 4MJXA 4UXIA 4S1VA 4BNWA 2CJWB 1UPFA 3I9KA 4YRCA 5A9SB 4M54A 4IUDS 3AP1A 3RW9A 5FOTA 3VKUA 4LWQA 2HMWA 3MMPA 5BV8A 9LDBA 5AI0A 3HYLA 3JARB 4JYMA 1OASA 4UTXA 5HIAA 2FZWA 4MKHA 2OHHA 1X7DA 2PWAA 4MMYB 4Y9SA 3TW0A 3TG8A 3AY0A 3EF0A 1ZNZA 4E1VA 2CZCA 4INZA 4IZOA 4RPJA 1GRVA 1JQAA 4K2HA 4IKPA 4RK1A 2BGRA 2QE7D 4KMRA 5K3AA 4C2BA 1EHIA 1JS1X 1N8TA 1QSGA 1TCUA 1U8YA 3CNQS 3PGLA 2JLBA 4P4LA 4RZSA 5TQ2A 3WI7A 2JJ1D 4N5DA 4QGSA 3SHTA 1N0IA 4B85A 1ML4A 1FXWA 1X2BA 1LTHR 1XQ6A 3T3GA 4P53A 2PNFA 2JGRA 3T5CA 1HZZA 1ETUA 2P4SA 3LXMA 4OM8A 3RVOA 3RO7A 4TM8A 4H0NA 2XT0A 5EXEA 4EA8A 1AGYA 2ONYA 4RXTA 4N47A 1NIJA 1IHOA 2IUFA 3IPXA 4TMXA 2VDKB 5I5EA 1VCIA 1R3DA 4OGGA 4OQ4A 2OBYA 2MDTA 3QUTA 1GCUA 4WE3A 2OGTA 3H2KA 3T61A 1GGNA 4ZVOA 1NE7A 4FINA 4TT3A 3CVVA 2JIZD 3H11B 4UQPA 3U49A 2FOLA 3HB7A 2QBYA 1GD1O 1WD5A 1PJAA 2E4XA 2EF0A 3PKZA 3PQDA 4ND7A 4PVDA 4YLEA 4DLSA 1PR0A 4NE9A 2FEWB 1CZNA 1JJIA 2A5LA 3UMSA 2R8OA 2CKMA 1LDGA 4G1BA 4NCXA 4BLRA 4OMFG 1WB6A 4WINA 2OEPA 2UZ1B 5CDHA 3ONFA 1DZ3A 3WYCA 3LY8A 5C8YA 4YLYA 4W5NA 2C4WA 3K9QO 2X9VA 3A4TA 4HEHA 4DR4B 4Z7QB 1T2VA 3Q9SA 4NABA 4WDRA 5KDOA 4X94A 1MXHA 2BD0A 4UD2A 1XAJA 2FPSA 5CFPA 1TZJA 1YR8A 1FU8A 1SHJA 3NDRA 2VUHB 2WY2D 4MUNA 1LDYA 3L0OA 1AKVA 1S8NA 1N32B 4B6PA 3G3EA 4H6PA 4B6GA 3QKUA 5JZOA 4WESA 5EWJB 3PWKA 1Z34A 3AEYA 4QUKA 3R6WA 3S6JA 4N0MA 3T1HB 1IZ7A 3G8AA 1I33A 4A9AA 2Q21A 3BC1A 4NYJQ 2BRUA 1Y81A 4CF3A 1TQ6A 1E8MA 1W48A 1NXTA 4QL3A 1XSEA 2CD9A 2ADMA 2Y76A 2YYAA 2VAMA 4S1OA 2N0SA 1W2WB 2P7HA 4NU5A 4QULA 1T2AA 4Q9JA 3H05A 3DVLA 1CS4C 2O5CA 2IYFA 2AX3A 5AYVA 3WZLA 4JD5A 4QNMA 2P2DA 2QVCA 4YRZA 3V80A 4QTYA 3E9RA 1GHTA 3K15A 4FFOA 3VSCA 1AXRA 2NUBA 1DBQA 3AFOA 3NKVA 4RC9A 4NHEA 1W35A 4EY7A 2DERA 1Y4AE 1X0XA 4LQCA 3UJ8A 5HE8A 3UGJA 4L4YA 5FYDA 4XYEA 2JL1A 3WYAA 2YXPX 3ZGZA 5JASA 1WZ2A 4GRAA 4H7HA 1DBPA 4M60A 3MLAA 5EIEA 1XALA 5IS2A 3WHKA 1PJSA 4BMYA 1V9LA 2JFXA 1TMYA 4GBJA 4J1TC 3QELB 5FOVA 3TW6A 4CLRB 4EECA 1G4UR 3G5AA 3DW3X 1WF3A 3BMOB 2WI8A 3GF4A 1XVUA 4E5VA 3A25A 1F06A 4B3BA 4UM9D 4FS3A 5EWLA 4TVSA 1W2HA 3SC2B 3ESYA 4GQBA 1E2LA 4QPDA 1C4WA 4D44A 1V43A 1JLMA 3NBUA 1IG3A 1WXDA 2QN6A 2C92A 1MAWA 1UZNA 5KDDA 5EUBA 5BW8A 1YVDA 5JQWA 1KPGA 1OX5A 2C9BA 4MVJI 1JBKA 4AN4A 3IP1A 2OXIA 1XL0A 1NVEA 1TUBA 4F5WA 3SZOA 4D3SA 1O6ZA 3PHBE 3IAS6 3F71A 4ZAWA 3GCXA 3I1FA 4MWEA 2AKYA 1HQCA 1KI6A 1PGOA 4LHYA 4O2BA 3RK1A 1SQSA 2DUMA 1Z2EA 1GQFA 2A0XA 5FRDA 3WXMA 4E70A 4XUEA 4PLZA 5JAQA 3ROZA 3WNCA 4BIMA 4DRZA 1GTSA 5KOJA 3GN2A 4AJLA 3WGIA 2BJHA 2ZJ3A 4MITA 4F5DA 5A1TA 3FPJA 2FQQA 2BFCA 5HWSA 4ML3A 5IJ9A 3QK7A 5JTUA 1EK6A 3QF7A 5M04A 1QMIA 2I65A 2OKGA 4M1SA 1JEQA 5SZIA 4LZOA 4NH0A 4U1RA 2CLDX 2HA5A 2ROQA 3R23A 3INYA 3LS2A 4CTNA 4Q82A 4Y1RB 3VMFA 2Y0BA 1XG5A 3L8YA 1RQ7A 1UQRA 1XDZA 3HSYA 1TVKA 2JAOA 1I4TD 2V03A 2NSJA 4KAXA 4NCJA 2VDNB 1PHPA 1GPLA 4MQMA 4R2WA 4X1IA 5G1PA 6LDHA 4KO2S 1GL6A 2PTHA 2LBPA 2VIIA 4RIFA 5HFJA 5BQ3A 3WBJA 4N65A 4DJEC 3TKAA 1ZM4A 1EFPB 3UB2A 4D5EA 4XYGA 4Z51A 1VCOA 1HQKA 1XYYA 4P54A 1PNTA 3UMRA 1F5NA 2P6OA 2VYVD 1LLUA 1SVUA 4KNWA 4WDQA 6GPBA 2IPOA 1GTRA 1GPMA 3DXYA 3WL8A 5BVHB 3K9LA 4HSGA 4UXHA 3GEIA 4PNEA 2XUIA 3HI6A 3EJ6A 3VNAA 3DLIA 2H52A 5KYYB 1KZ1A 3DS8A 2UUOA 2J0UB 5FA6A 4ECAA 3H9JA 4B43A 3JQ8B 4W6ZA 5IX8A 4RJKA 2NZYA 3LE8A 2P5SA 1L7OA 3R8FA 4R41A 1X7YA 2ZSJA 3BAFA 3G0DA 1G7SA 2JK0A 4HDKB 4Q3LA 1VIYA 1SBCA 1OLXA 2HUNA 3M6IA 1M73E 1EBBA 1XU9A 1ZY2A 2HXYA 2O2ZA 3HU1A 3Q7PA 1M54A 1YCHA 1R0YA 4JUDX 2FPPA 4L8YA 3N3AC 1D8AA 4IDDA 4RF3A 4KH1A 2XB9A 2A84A 5EIBD 2CLOB 2E9SA 4YAEA 4LAFA 4IQ0A 3NBMA 4CETA 3KE9A 1FNMA 5H9VA 3Q6IA 3GDOA 3THXA 5AKEA 3JSAA 2BL4A 1W4AA 2K87A 3G7UA 2YY6A 4JSRA 2OAQ1 4F38A 3G9XA 2PGOA 4JI4B 4QOIA 1RDFA 3HP7A 4HH4A 1NRXA 3ROQA 3KSBC 4TX1A 1SXJD 4NCKA 4MLZA 4X8OA 1QQAA 4PVCA 5CU7A 5H68A 3VR3A 4KR0A 4PICA 1SK8A 3QMVA 5DX8A 4J8PA 3FY4A 1K92A 1WY7A 1MDBA 4V39A 2DWQA 5FB3A 1DVRA 2PXXA 4BQNA 2OBXA 2GAFA 1WPGA 4O4HB 1OROA 2ZSBA 4NE2A 3OFND 1P3DA 1OTHA 1MRNA 3QWHA 1RPNA 1KOGA 4QOSA 2ZE6A 3DBOB 3GRCA 1YC5A 1R16A 2Z57A 3KKZA 4FHEA 4GPAA 3RVRA 4JQZA 3VV3A 5J63A 1K6EA 1N5DA 3LPDA 1X1AA 2DJIA 4ES6A 1H2YA 4J4HA 1Q3HA 1SBYA 5EERA 1ODSA 1NM5A 3DE6X 2OFOA 2HXGA 3OJCA 3QKRB 2QN8A 5JZMA 1ZR2A 1JR6A 1F20A 5AW2A 1E9CA 3DEHA 3PDCA 3SOZA 3VC7A 4QEKA 4Y9DA 1BDMA 1USIA 2PVSA 3VX4A 1KMQA 4PXYA 2GRAA 1SA0A 2AR7A 2I9PA 4EKIA 5CG2A 4GW3A 5AVYA 3KVYA 4EZBA 1I2DA 3PKIA 4MDYA 3ICQB 1U0GA 5FLYA 1AS3A 1XU4A 2PUCA 3TZBA 1VKRA 3I32A 4QLAA 3H6KA 3IUBA 3OA2A 4KQCA 1EZ4A 1Z63A 2NWQA 3F6CA 4AROA 3EASA 1NBME 1ZH6A 5C34B 3EIQA 1DG1G 1WX1A 3LTNC 1RRMA 2X8JB 4P4NA 3BE8A 3C6MA 2C82A 2P6NA 3ELDA 3R5JA 3G79A 1NIPA 2I4MA 2BMFA 3KD3A 1MPTA 3G9QA 3VOBA 3IP3A 1X80B 5JH7F 2KLHA 1HH4A 3HCCA 1WKBA 1N6OA 3EDOA 2RGNC 3U44A 5CDUA 1C9KA 2O4CA 3A4VA 2EX1A 4D9GA 3IQDB 3REFA 1ZKMA 3DVQX 3WY9A 3FI0A 3EFOB 4KBYA 4RAQA 4CM5A 3HVRA 3U7HB 3DO8A 2WIBA 3CG0A 4G8CA 4M6WA 4KUHA 3TQIA 2OBNA 4ZO6A 4P5DA 1WUJS 1W59A 3ETLA 3G5MA 4L95C 3E9QA 4RELA 3RSQA 1WHTA 2UU9B 5ED4A 1YTLA 1IN8A 1G8FA 1U81A 1BFUA 1X19A 3DTNA 2D0OB 4M1YA 4D0NA 4FI3C 3NPMA 4QDZA 5CA1B 2BGMA 2BKLA 5LXTA 4C4ZA 1Q7EA 3NFYA 3PE6A 4O2LA 2J9ZB 1UBRS 5FNVB 1IWPB 2HH9A 1ST2A 1XLWA 1VSTA 1GCGA 1IJBA 3IOMA 3LL7A 1JJVA 4DL9A 5U1PA 4ZMSA 2BFWA 4NARA 1I01A 4MGHA 3GEEA 4F6LA 3WJ2A 2QM3A 2J9RA 1BVHA 1IEVA 1HYBA 1E9BA 2KBFA 5FFMA 2XRMA 2AFHB 2J5KA 3G0GA 2B37A 3EFBA 1C9YA 2WD8A 4OX9Y 4PR3A 1W0JA 1LQTA 2LP4Y 2XZPA 4JY7A 2ZRDA 4P5PA 4XLLA 2OZLB 1CE8B 3GELA 3ZE6A 3AFNA 4KPGA 4Q9LA 1GTL1 2AR0A 4R40A 2IYOA 4DTIA 1CZUA 1PR3A 1M2HA 1TX4B 3TRDA 1WABA 1XCGB 1X7ZA 3MT7A 1WCWA 3LUFA 4RCZA 2YVQA 4AT1A 4GHWA 1XYGA 2OCYC 3M1AA 3T3EA 2A58A 5HIIA 2IXTA 2JBAB 4NECA 2BPOA 2KWIA 4C3ZA 4RKEA 5JJBA 4S1NA 4QFBA 3O4RA 1TJPB 4RK7A 4RTJA 1GPBA 3ZI0A 2PEZA 2DQ4A 2VYQA 4OJNA 4L02A 3FHOA 1JILA 1REQB 2YV4A 4MICA 1HXHA 5JBIA 4NNOA 4RPLA 2CNOA 1Y1LA 4W7IA 4BTEA 1OZ0A 2GNPA 1SBIA 4GLBA 1P9WA 1ID8A 1SCQA 4GMHA 1E20A 1Y9EA 2QPAA 5EUCA 3U3DA 2HU5A 1JRLA 4MS4A 1TPYA 1V3QE 2WFLA 3WADA 2BW0A 3CONA 4AZSA 4ETNA 1RQ2A 1DUSA 3TIFA 1RABA 1YCGA 1GXSA 1MO3A 1HDXA 3GUVA 4F6RB 1Q0ZA 2C03A 2JJMA 4DJFC 2HEIA 4NMWA 4ZZ1A 5HM6A 2ZTMA 3K0CC 2G9ZA 1NW5A 4QYIA 4MK4A 1Q3TA 4XGKA 3VHXB 4F86A 1P81A 1V7ZA 3F49S 5KEIA 1KP3A 1ISRA 3D0QA 5E2AA 5JQGA 1H2FA 4WLEA 5DPMA 2PY6A 4ZAGA 4RJJA 2AMJA 3OQMA 1VHLA 1I7SB 3OCZA 1EEHA 4IXDA 2JBHA 2REXB 4BVKA 1NY6A 2Q8NA 1D9XA 3DC7A 1QU3A 2QTVA 2BMWA 3H99A 2I4OA 3H1PA 1G291 3IWDB 2IUTA 1E5XA 3LX6A 1Z5VA 2D2VA 4FOTA 2J3HA 1B43A 1GPH1 4AY6A 4TV8A 3S2ZA 5F4BA 5DF1A 5JZVA 3MC1A 4MYTA 5K2MA 4J0QA 1A0OA 2ONKA 5YASA 5TF0A 1DBWA 1J8DA 2VHQA 3TNDA 1J39A 4AJIA