1XYGA

X-ray structure of gene product from arabidopsis thaliana at2g19940
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
345
structure length
345
Chain Sequence
b'KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative N-acetyl-gamma-glutamyl-phosphate reductase
publication title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 113
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1xygA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xygA01
1GY8A 5G0WA 2D4AA 1P1JA 3QWHA 4KTTE 4CM4B 3MEQA 4J7XA 1GTMA 2OP0A 2W90A 1Q0LA 3B6ZA 4PN3A 3FNGA 5B12A 5F21A 1DC3A 4LVCA 1WP4A 3IAHA 1I01A 2GPTA 1XR3A 1MC4A 2Y0CA 2PZMA 3VH4A 1J4AA 2YHUA 5L4LA 3IL2A 3DTTA 2DTEA 2NADA 4J16A 1PS9A 4YJGA 3C8MA 5ITWA 4WNCA 1Y1PA 1YDEA 1MFPA 2B4QA 4ND2A 4JIGA 3JQ7B 2EWMA 3VKUA 1VL8A 2XF8A 3JQAA 1KEPA 3ZW8A 5C37A 4IINA 5DBIA 4Z3KA 2OGUA 3ZV5A 4FFNA 4WASA 2D5AA 2WD8A 3Q1LA 1HKUA 3MJVA 4Q3AA 1ENPA 2G76A 3IKTA 1DJNA 4QFDA 3W1VA 3QW2A 2PV7A 3C24A 5JS6A 1U8XX 2WE8A 4E5NA 4BIIA 3GT0A 1QSGA 4GWGA 5JC8A 4E5MA 1H0KA 1U4SA 5L45A 4NFSA 4CV2A 4HBGA 4EUFA 3QVXA 2J5RA 2D59A 3RJ9A 3L07A 3Q3CA 1EE9A 3D3EA 3AJRA 4P4LA 2ZB8A 4LSWA 2GNAA 1KBZA 3WWZA 4K26A 1JLLA 3RAJA 4Z9XA 5TQVA 4TSKA 3VH3A 1JKFA 5IDQA 3MTJA 4WCFB 1NQTA 1W8DA 1ONOA 4ZHSA 1PX0A 1X0VA 4MVJP 2BHLA 1PJQA 1T26A 4BMNA 5JNLA 4P4GA 1X0XA 2XXJA 4OM8A 2CF6A 4MVJA 3ZWAA 4D41A 1WZIA 2HK8A 5BR7A 1Q0QA 2GN9A 5CDGA 4MKRA 2V6MA 4D3FA 1P0FA 4UUNA 3Q2KA 5B4TA 4WCFC 5F5NA 3H6KA 4FB5A 5JMPA 4CQMB 2JFGA 3V2UA 1MXFA 1I30A 5F5LA 3VZQA 4K6FA 3DBRB 3F46A 3UCEA 4Q3CA 2VYVA 3ZWMA 8LDHA 3I9NA 5K6AC 2YFHA 4DLAA 4MO2A 2O50A 1V8BA 2J5QA 2Y66A 4II2A 4AJOA 1G0NA 3R1IA 4WLVA 1PL8A 1YL7A 4DLLA 5T57A 1BWSA 3OQ1A 1EQUA 1C1DB 4GKBA 1T2DA 4DC1A 3DB2A 1BSVA 1R0KA 1GQQA 3HN2A 1MFZA 1NFQA 4XCVA 4H7PA 4IS3A 3E5RA 3GGPA 4D44A 3U4DA 4EGFA 4E21A 3E82A 1O5IA 2H6EA 2HUNA 1QYXA 4B7CA 2YDYA 3HB4X 2JCYA 4UUOA 4IDFA 4XGKA 1ZSYA 5BSEA 3GZNB 5MGBA 1F12A 1PR9A 4ZQBA 2PZLA 3DHYA 1TI7A 5EQFA 4PZCA 1O6ZA 4GMGA 5JXWA 2PTGA 3TQHA 5G0UA 2BFPA 1HSOA 2ZTMA 1ISGA 1PU2A 2F1KA 4UAGA 3WLEA 4CLHA 4B7UA 4A10A 1CQIA 3LC2O 4PVDA 3WFJA 1LSOA 4YR9A 1P1FA 3I23A 1E3IA 1P31A 4OIMA 4XYMA 5A4DA 3V2GA 4K28A 1K0UA 3NUGA 2Y1CA 5JDCA 2W2KB 3O38A 3GH3A 4BHTA 2ZQYA 4JP2A 2BI7A 3NTQA 4QXMA 5A3JA 3GNTA 4MP3A 1YVEI 4J3FA 4FQ8A 5KCZA 1NAIA 1XELA 1C0LA 3JQEA 4E32A 5JYDA 3RBXA 3QHAA 3D4OA 2O4UX 1D8AA 3F4LA 3EY4A 2PGLA 2D1YA 5IZCA 4FW8A 1E1MA 4W7HA 4Z0TA 2VT3A 6LDHA 4BO2A 3LSYA 3DTYA 4OKNA 2I9PA 4DIFA 1X7DA 1I2ZA 4FJ1A 2UYYA 2ZYDA 2V7PA 2W2LA 2NVUA 1E3EA 1KEWA 2AEMA 2IDZA 1M2WA 1Q1NA 2C2XA 4CLXA 2HJRA 2AE2A 5DCYA 3B1JA 2P68A 3KO8A 2FMUA 3PWSA 3I6IA 1E6EA 1FDUA 1PJLA 2WYUA 4C4OA 1UP6A 1FJHA 3PZRA 4YQZA 5DT9A 2JKVA 5AXCA 2WD7B 1MUUA 5HS6A 1P33A 3RC9A 1VE9A 1ZMTA 1JU9A 4CLRB 2CDBA 2X58A 4CQLA 5CG1A 1GV0A 2DPHA 2VWPA 2YZ7A 1LDEA 1YOVB 5JY6A 4WOJA 1YB1A 3EYWA 4M86A 5CPBA 2VHWA 4ZQGA 5DULA 4C7KA 3OJOA 4EUEA 4Y6SA 4FFPA 4E13A 3DHNA 1Z7EA 2FN7A 1U3WA 1ZUD1 5JCJD 1UXHA 4BMVA 4YACA 4XQ9A 4OQZA 1F8FA 5GY7A 3WGGA 3LK7A 4FIZA 1XCBA 1H6AA 3C7CB 2QZZA 5JAMA 3F3SA 3FF4A 4R1NA 3NT5A 1H6BA 4IZHA 1P1HA 3OQBA 2NTJA 4BO6A 4EW6A 3U3XA 3ITDA 4URFA 4S1VA 1NQ5A 4FS3A 4KUHA 4YCAA 3G0OA 1O95A 4ONEA 5I8WA 3WFIA 1Q2XA 3HDYA 4ALJA 4AJEA 3JQAB 1DO8A 3VPHA 2X5OA 5AOVA 3JD2A 3W8EA 3ZU2A 1DXYA 4KDEA 3K8ZA 3OIFA 4U0JA 1Y9EA 3AUAA 1UZNA 1YBAA 3U09A 2RCYA 2FR0A 1C0IA 1KEVA 4S3MA 1JWAB 1LBEA 2I67A 3STHA 4XQGA 3AY7A 4DPMA 3D5QA 3DL2A 4ZRNA 1E5QA 3BMQA 1UZMA 2J3HA 1FXSA 3WG9A 4DGSA 1TLTA 2WSBA 3GGOA 4WGGA 1ORRA 2X23A 4QEDA 4R54A 1HDCA 4GX0A 1R37A 3PK0A 2PLAA 2I5PO 5I7FA 1V3TA 4J7UA 4INAA 2C29D 1Q0HA 3G1UA 4D45A 3QQPA 4M1QA 5JMWA 1DIRA 1E6WA 1YH3A 2VCYA 4MVJM 5CEFA 2RBEA 1NFRA 3JCZA 1HTBA 1FDSA 1PJCA 2CZCA 5CHEA 1S6YA 4EYEA 2TMDA 3VVBA 1ZXLA 4IGEA 3L0DA 2YV2A 3RU9A 4RVUA 3T7CA 5BQFA 2GUGA 1NP3A 1U2DA 4P4NA 3FBGA 1HF3A 3HDQA 4QFCA 3RUCA 5C7OO 5JDIC 4X54A 1LLQA 1U5AA 2QRJA 3DOJA 3JSAA 3QE3A 4HFMA 1IYZA 2A92A 3GPDG 2OMEA 2X9VA 3OJEA 3SBOA 2AEFA 4BL5A 2ZB7A 5JAZA 1U7HA 1BGVA 3GN1A 3WGIA 2NVWA 1WXDA 2WJPA 3PJGA 4AJ1A 5T6BA 5EINA 3K92A 4UEKA 1U3VA 1J49A 3ZWBA 1TT5A 4CM9A 1EDOA 1DHRA 3DWFA 1KY5A 1VRWA 3PQEA 1ZK1A 4OYRA 1R6DA 3K9QO 4BO8A 3L9WA 3MWEB 4OXYA 1N2SA 4EJ0A 3GA0A 3EC7A 1UAYA 4E2WA 2DQ4A 2DLDA 4WKGA 2RHCA 3LYLA 2EF1A 3DFUA 3K5PA 1E5LA 1DRVA 3FPCA 4A2CA 4ALNA 2ZCUA 1R0SA 3ZV3A 1DAOA 1C1XA 3AUSA 3PFFA 5B37A 1LDNA 5G0TA 3LDHA 2C07A 3FWZA 5IZ4A 2IODA 4J90A 4BV9A 1EUCA 1QRRA 3ROPA 1E0DA 1LXCA 3ZWXA 2CF5A 3EVTA 5BNFA 4FOOA 3WGYA 3KYDA 4YBZA 4A27A 3GR6A 2P2SA 1R4MA 1Z73A 4I9UA 1PZGA 2CNBA 4YJHA 1EK6A 3SLGA 4MJLA 2P91A 3UKOA 3W4KA 4I5EA 4FJ2A 5JAIA 2EJVA 5ILOA 2EP5A 3CE6A 7MDHA 3WXBA 1SOWA 1R4NA 2XAAA 3NEPX 3LT1A 4YRAA 3GLQA 2CVQA 4XA8A 5JPIA 4DMMA 4GKVA 2VUSA 1V35A 1K6XA 3EGOA 1PJSA 3RROA 5HM8A 1A5ZA 3IUPA 2FSVA 3NTOA 3MOIA 4HKTA 2OOSA 3KBOA 3ZNQA 5A02A 3P7MA 4FFOA 4WEOA 4N5MA 3GNQA 4YAGA 4CUKA 5JDCC 1ZSVA 3PGJA 1L7DA 5TNXA 1U28A 1HDZA 3ETDA 2F00A 2A9FA 1H2BA 1M6HA 3F5SA 3M1AA 1MX3A 3A9WA 3DONA 2HKIA 4KQXA 4H15A 4QT0A 2O4CA 5DP1A 4ZGWA 3ASVA 3R0IA 4RO0A 2NVUB 2DBZA 4JJGA 1DLIA 3QSGA 1W0CA 3DFZA 3HUDA 4WPGA 4BS9A 3GVHA 3KEQA 5IZCC 1PTJA 1XWFA 1X1EA 3HDHA 4J9VA 2D3TA 3PIDA 2GERA 4ZU3A 4W9NA 4BGEA 4M89A 3VZSA 3P5SA 1QXSA 3H8VA 1X1TA 3KXDA 2VZ8A 4OO3A 4GL4A 4CQLB 4CMAA 4I9HA 4XJTA 3KOUA 4IBOA 1E7SA 5A9TA 5THKA 1P77A 3SC6A 3MOGA 2YQ4A 4IDBA 5L9AA 3TFOA 2J3IA 2P5YA 4II3A 2AHRA 4LRSB 2Y1GA 4QO8A 2BD0A 2V65A 5CP8A 1P1RA 4NBRA 1M66A 1T4BA 1LLCA 3RIHA 1BDBA 4DQXA 5JY1A 5CAEA 1VC2A 1Z74A 2CSUA 2B4TO 5JW6A 4ZQEA 2PA3A 1DAPA 2BI8A 4DL9A 4E31A 4WE3A 2IXBA 2E49A 3INRA 2IRWA 4XJSA 4WECA 3GFGA 4NU6A 5ICMA 1YJQA 4R1UA 2VYNA 3OIDA 2PGJA 4UVIA 4NBVA 1DIAA 5A03A 4F46A 3GC6A 4DVJA 4L4RA 1HEUA 3O8QB 3UCFA 4J4BA 5CDSA 4KUGA 1IL0A 2VNSA 3MJSA 3TZQA 3UF0A 3EZLA 1XEAA 1CQJA 4OJNA 2Z5LA 1MV8A 2FRDA 4XB1A 3GUCA 1B8UA 2I99A 4K1LA 4Y6RA 1VLLA 4XDYA 4CMBA 3JQDA 4PRLA 4XYEA 3DZGA 5K6AA 4ALKA 4N7RA 1PGQA 1EVJA 1X7HA 2O2SA 2EW2A 3ZZNA 4BKUA 1LEHA 4KDFA 3VDRA 2JCXA 1QORA 1W73A 3UCXA 2BGMA 1ZJYA 4B4OA 1IHYA 3PPIA 1RPNA 1LRLA 5C5IA 1KIFA 4IJKA 1Y8RA 5JBIA 3E9MA 3NTRA 4NK4A 3RSHA 3A14A 4GVLA 4BNKA 4K6CA 5AYVA 5HBRA 2H1SA 4R41A 3IJRA 1I33A 4IQGA 4L76A 3DMYA 3PQFA 3WYEA 5KTKA 4D0RA 3KYCA 5KVCA 3PLRA 1BXKA 3FN4A 3UGKA 1SAYA 4AJIA 1MXHA 3ENNA 1P45A 2UAGA 4RQUA 4N54A 3OJ0A 3H3FA 1SC6A 2X6TA 4IXTA 5COBA 4TKLA 2G17A 2Y0EA 1SB8A 1X13A 1Y8QA 4XWYA 2D8AA 3RUDA 4YAIA 3HB5X 1I0ZA 4F3YA 2HMWA 4CV0A 5BNIA 3I9LA 4KZPA 1RJWA 2VNAA 4YT5A 2AE1A 4CUZA 4Z6KA 1PJBA 2W98A 4PLFA 3UVEA 1WDKA 5KJFA 5IG2A 4TRRA 2ZIZA 4FGSA 2A4KA 1EMDA 1UXGA 2HDHA 3FR8A 1TEHA 1TT5B 1CRWG 3IJPA 1N1GA 5I8ZA 3S2FA 4NK5A 1K6IA 4IXWA 5ICSA 5L7WA 1LC0A 3UHAA 2O48X 3HWRA 1JVSA 4XIYA 3DBHA 1JA9A 3TL3A 1ISFA 4GQAA 4YB8A 2W2KA 3DZJA 3PHIA 1BMDA 2BFOA 3GG9A 4AVYA 5ER6A 1MP0A 4CM8A 4TZKA 2A35A 3COSA 2NM0A 2UUOA 2Q4BA 4TWRA 1T2AA 5IDYA 3L4BA 3CSDA 1T1RA 4GSKA 2DT5A 4O0LA 3WDSA 4HFJA 1E7YA 1PGJA 5COQA 3KM0A 4DQUA 1S7CA 5FF9A 2OXIA 3DQPA 4BO7A 3C1AA 1LA2A 5A9RA 1HYEA 3ABIA 3D4NA 1HDGO 1EE2A 4J1TA 4HNHA 2QZ9A 3KYDB 4ZQFA 2CDAA 2VHXA 3U4HA 3VPGA 4HXYA 4AL4A 2VYVD 2EJWA 4YJHB 2Y1EA 2VRBA 4QQRA 5TF4A 1B7GO 5GZ3A 2BGLA 1LC3A 1OI7A 3FTNA 1LU9A 4JK3A 1WZEA 5T73A 2E37A 3LU1A 1R4NB 4CMKA 3I52A 3BXXA 4YXFA 1H6DA 2Y67A 2QG4A 4R68A 3VZRA 3WBFA 5DCUA 1SEPA 1DEHA 4CLRA 4NBUA 2PR2A 3BHMA 1UXJA 3U4IA 1H9AA 4FD3A 1RM3A 2J3JA 1NR1A 2Z1NA 3AI3A 4GBJA 4BGIA 1RM0A 2GZ2A 3FNEA 4W7IA 3MJCA 2VN8A 3FI9A 4BNYA 1YL6A 1DC4A 3UUWA 2JAPA 1ZO8A 5G4KA 3GDFA 3OICA 3DZHA 3QIVA 2YV3A 4GLOA 3DZFA 1YE3A 2ILTA 4U7WA 2XPCA 1XU7A 3ZV6A 3DMTC 2EHDA 1T2CA 1ADBA 2YYYA 1Y6JA 3BHJA 3JYQA 1EEHA 4MDHA 4J49A 3ZU3A 4BNTA 3PHLA 1KYQA 1Z45A 4KWHA 1WNTA 1VPDA 1DBVO 5EESA 3OIGA 5T67A 4Z9YA 3W8DA 2Q50A 3RKUA 4DUPA 1EVZA 3ZN2A 1G1AA 4RVSA 1KERA 1SBYA 2FR1A 4W9NC 4IDCA 3KRTA 1WMAA 3ZGYA 3WGZA 4XR9A 3OJFA 4CR8A 1PQPA 5G0SA 2NACA 3F1KA 3M6IA 4LMPA 4R51A 5KJCA 5JYFA 4EZBA 1A71A 3D7LA 2ZTLA 1U5CA 3KETA 3TN7A 3GMDA 3QWBA 1DPGA 1GEGA 4RLSA 3ASUA 1ISIA 3Q11A 3JYOA 4BB5A 1HDXA 2HAEA 1U9JA 1GQYA 2AQIA 4IIVA 1IOLA 4E5YA 2YDXA 4J1QA 4LCEA 3FTPA 5BT9A 5T5QA 5FWNA 4OSOA 1Y5RA 3FHLA 1UZLA 1BW9A 1WMBA 3OF2A 1GUYA 3UN1A 5JDIA 1B3BA 5IDWA 4IMPA 4IUYA 3CUKA 3ZWVA 1IPEA 2EKQA 2IZ1A 3NGXA 4N5NA 2DFVA 3PXXA 4DBVO 3JTMA 1Y7TA 2HMUA 3IUSA 1EFLA 2NVBA 1GQ2A 3TNLA 3WX0A 1Z7BA 2E48A 3HDJA 1KVUA 1E7WA 3G1TA 3P2OA 4I9NA 4EITA 3ICPA 2QRLA 2G5CA 1P74A 3CXRA 3QVWA 1I2BA 1Y8RB 4J4TA 4E2YA 1UP7A 4FCCA 1E1KA 5F1KA 1NTOA 4G2NA 4GWKA 4XQEA 4L4XA 1K89A 5GMOA 4YJDA 2FPPA 2ZQZA 1A7KA 4PG5A 1A4UA 1HL3A 4LK3A 2O3TA 3JQFA 4JLWA 3KYCB 3WGTA 5GZ1A 5DBFA 1GCUA 3KUXA 3HHPA 2C82A 4ND1A 4GVXA 5AXBA 1KS9A 3DC2A 3RC7A 1GD1O 1GYQA 1ZKMA 3MCVA 1NVMB 3WGOA 3C3XA 4RPGA 4TZTA 5JO9A 1AHHA 4O6VA 3ONFA 1KVSA 1FDWA 3GEMA 3JYLA 3EHEA 2HK9A 4TRJA 5JFOA 1E1NA 4CMHA 3BMCA 4GH5A 3MTGA 1B3RA 1Y8QB 4PLTA 4W82A 5K0ZA 1F14A 3I9JA 3PLNA 4MKXA 1DIGA 4EJMA 3GNSA 4OAQA 1NHGA 1MGOA 4BNLA 3E9QA 3EZYA 1QKIA 1OOEA 4JNKA 2WEKA 4H16A 2DM6A 4LRTB 3UFXA 4J0EA 4W6ZA 4BQPA 3V1YA 5DOZA 4BNJA 3DEYX 2PD3A 3F6YA 2PH5A 3GPIA 1B14A 1MB4A 3OH8A 3DBHB 3M1LA 1KC3A 2ZKLA 3UW3A 2R2GA 1OMOA 1E7RA 2HU2A 2O3SA 5ITVA 4CM8B 3Q2IA 1M75A 4PLVA 1B8VA 3NT2A 3L77A 4WLUA 1TB4A 3PQDA 4B7XA 1YRLA 2VT2A 1A9YA 2EKLA 2VZ9A 1IZ9A 1GYPA 3JD0A 3B70A 5CDYA 1Q7CA 2Q1UA 2R00C 4DYDA 3TZCA 3B1FA 3Q0EA 1DDOA 1U7TA 2YY7A 4J7CA 3L4BC 3ZCXA 1EVYA 2GR9A 3TPCA 3RFVA 2P4QA 5KVQA 5A1TA 1YBVA 4B3JA 3LZ6A 1NVTA 1J0XO 4IMRA 3F1LA 1X7GA 3GAZA 1XA0A 3SX2A 1D1SA 2WM3A 2C54A 4CM9D 2Y1OA 4L75A 3AM3A 2VOJA 2Y93A 4FOSA 4NJOA 4HFNA 3DZIA 4YPOA 2NLOA 4HWKA 1WAMA 3L6OO 1W6UA 3RUIA 1T2EA 3ZH2A 4BNWA 4MP6A 4J2HA 2IE0A 2B5VA 4KMSA 1BTOA 4XYGA 3LLSA 2ZJ0A 3EAGA 3K30A 3OECA 4ITUA 2O7QA 5H81A 3DZKA 3ORFA 2HCTA 5CG2A 1DIHA 4XX0A 3ZWOA 4FFRA 4M8SA 3ROQA 1F8GA 3PHHA 9LDBA 3UXYA 2GZ3A 5G4KB 1Y9AA 4XGIA 4JBHA 4LGVA 4U0KA 1YONA 4LW8A 3ULKA 2B69A 3ZWWA 5AVOA 3KLMX 4M87A 4YA6A 4UEJA 4KUEA 3RWBA 4GGOA 3ST7A 2D0IA 5IDXA 5KKCA 1TXGA 1NAHA 1VL0A 2G1UA 3I83A 3H7AA 4O63O 3RKRA 4PLHA 2NSDA 5IXYA 4CLDA 3FD8A 2Y1DA 1VL6A 3O8QA 3GN2A 1GUFA 3LVFO 4RQTA 4XYBA 4Q3DA 3PYMA 4RGBA 3OSUA 2G82A 3WSVA 1ULUA 3FSRA 4FFLA 1MG5A 5TSDA 1U4OA 4WJZA 3EVNA 3H9UA 2PNFA 4NNJA 2WMDA 4TVBA 1LTHR 3DBLB 2Q1WA 3UOGA 2IYOA 1R12A 1U1IA 4E5PA 3HN7A 2HO5A 4YJFA 3GDOA 4R3NA 4C7JA 3KHUA 2HRZA 3D0OA 4BNUA 3RBZA 3H9GA 2AQHA 2C7VA 1PQWA 1VI2A 3V1TC 1UDBA 1DHTA 3VHRA 2JL1A 3JYNA 1CF2O 1ZW1A 3I9OA 3FBTA 3PIIA 3WIDA 2ZCVA 4RVFA 4ZJUA 1DB3A 5JC1A 1PGOA 1BW9B 5T8KA 1VKNA 3JD3A 3S55A 5TS3A 2QYTA 1EQ2A 4YTEA 1H2HA 1EBFA 2CDCA 4BNZA 3FWNA 3SJ7A 2AG8A 1DFIA 2ZTVA 1DC5A 1ZFNA 1EFKA 4RF2A 4D79A 4A5OA 1BHSA 1KVTA 2VWQA 5B4UA 4FJ0A 3O4RA 5HS4A 4CM3A 3DOCA 4LMRA 2E6UX 3BMOA 3PGXA 1VJ0A 3ONEA 3DO5A 3KSDO 3OMLA 3ICCA 1IB6A 5DCWA 3INGA 3M2TA 3ZNOA 1LDGA 5THQA 4AJ4A 1YB4A 4R5HA 5U1PA 3S2GA 3PHGA 1XLTA 4PLWA 4MIYA 1NHWA 3AM4A 4PRKA 2YW9A 5TJ9A 4CL8A 3PI7A 3BTOA 4DMLA 3ZHBA 1EVIA 4JJFA 4E12A 4R5MA 1LQTA 1LDYA 3I3OA 3GF4A 4CV1A 4UEOA 2VYND 2RIRA 3O03A 4N5LA 2OBNA 2B83A 4RPKA 3FR7A 1JAYA 4QTZA 1Y5MA 2ET6A 1HDRA 5H83A 4JCOA 3K31A 3OA0A 5FFFA 4IJUA 2Q2VA 1UP4A 1AXGA 1YO6A 3JQFC 3BMCB 2B5WA 3JQGB 2IZZA 3H65A 4Y67A 4IDDA 3JQBA 1IHXA 1PWZA 1YXMA 2VZ0A 3IDSA 2GN8A 4OQYA 5L7YA 2BMAA 4RPHA 4NFHA 3CINA 4CQMD 1L1FA 2VRCA 4ILKA 4RZHA 5FI3A 1P1KA 4TRNA 1QMGA 3GHYA 1UH5A 3ANMA 3N58A 1LLDA 1OFGA 1IZ0A 4J6FA 4RCVA 4DQVA 4E3ZA 4MOWA 1QV7A 5IXSA 1C0KA 2JD1A 3F4BA 1I2CA 5JCJA 2R6JA 3AU9A 5L3ZA 4TROA 5DP2A 4IY1A 4J4HA 2I65A 2YHIB 4IZIA 1AN9A 4B4WA 3LC1O 2X5KO 3VTZA 4OXKA 3E1KA 4Q9NA 4BNIA 3C1TA 3FNFA 3U9LA 4Q39A 2HSDA 4Z0PA 5F1OA 3GDGA 3NKLA 1AHIA 1DJQA 3P2YA 3VOSA 1QP8A 3TOZA 4IDAA 4F45A 3A4VA 4O59O 3E5MA 3L6DA 2H63A 1NQOA 4TVOA 1JDJA 4CPDA 3WGQA 4Z3DA 3DMTA 4DRYA 5L51A 3HG7A 1H5QA 2RH4A 2H9IA 1ENYA 1V0JA 1O94A 1QYDA 2PD4A 4IQ8A 2X0RA 3GY0A 3WIEA 4KP7A 5GZ6A 4PG6A 1EK5A 2Q3EA 1RWBA 2XXBA 4I5GA 1NASA 3G49A 2EKPA 4ZA2A 1AUPA 4I8XA 4BKPA 3BZUA 5ENDA 3BYZA 4O1MA 4CMIA 3ZWCA 3BAZA 4GSLA 2I3AA 3IP1A 4XB2A 2PKQO 2BF7A 3HNPA 1C14A 1V3VA 4IQ0A 5ENVA 3CEAA 2DFDA 3ADOA 4MKZA 3SJUA 4LISA 1H94A 1SZJG 2O3JA 4PVCA 1HWYA 3GUYA 2FZEA 2OORA 4RF4A 3WNQA 3PJDA 1GCOA 2IZ0A 5L4NA 1NM5A 3QWIA 3AK4A 3WB9A 3QV1A 1C0PA 2BH9A 5I7EA 5IN5A 2HRBA 1YS4A 3VPFA 5DDIP 2Q2WA 5AQ1A 3QJ5A 1LUAA 2AXQA 4YVFA 3NDRA 5TT1A 4QSMA 4D3SA 3DZBA 4RF3A 1SMKA 4UVGA 2NU7A 5A5EA 3ZWPA 2FY8A 1NPYA 3RU7A 4FSHA 4PZEA 2EV9A 3GK3A 1P44A 1P3DA 2PFGA 5AXAA 3IKVA 1BG6A 3PFWO 3E48A 1CJCA 5TLSA 4BVAA 1JN0A 1F0YA 3FRJA 4XIJA 1JKIA 3TL2A 1PIWA 4IM7A 1JKJA 4CMEC 2C5AA 3F9IA 3GVCA 4YT2A 1NWHA 4ZQHA 2VTDA 1R15A 3GVIA 5HRUA 2OZPA 1KETA 3PP8A 5IJZA 1PSDA 3GQVA 2BRUA 4ESOA 4L8VA 1PGPA 1QLJA 3ZHYA 2IEBA 4GI2A 1UR5A 4D7AA 4YJFB 3I9KA 2DPGA 2JFHA 1I24A 3MJ4A 3GHHA 3OQ6A 4NZ9A 3OM9A 2JHFA 4BNGA 3RCBA 3ROMA 3HQ4O 5EQDA 2PZKA 4PIVA 1O0SA 5FEUA 4Y9DA 1GFSA 1HLPA 2JFFA 4RL6A 2Y05A 4CM5A 1Q7BA 4FR5A 1RYDA 4BV8A 4AJJA 4WLNA 1EUZA 1ZXBA 3E18A 1B16A 3AUTA 4AJHA 4D42A 4D46A 3JV7A 3HZZA 4XEHA 3OFSA 1NWCA 1F17A 2FSSA 1MLDA 3JQAD 4NIMA 2WWRA 3BMOB 2YJZA 1LI4A 4BUCA 5T8KC 5I9LA 3K96A 1T1SA 4RDIA 3GVPA 4WUVA 2JJYA 2X8LA 2HJSA 2UUPA 4LVUA 3NDIA 2JCVA 1E92A 1O9BA 3ZWNA 3N74A 3D64A 2EGGA 1CIVA 1GZ6A 1DC6A 1HE3A 1HT0A 4YDRA 3RFXA 3TZKA 3IP3A 3TFQA 2AA3A 4OHUA 4RDHA 2QHXA 4FC7A 1HYHA 4WLOA 3I6QA 4J0FA 1E7QA 3RD5A 4BO9A 1D1TA 3C85A 2HMVA 3GG2A 4D43A 2X7HA 3HFSA 2DC1A 5HA5A 1LQUA 1ZZEA 4IPTA 2UVDA 1EDZA 1KY4A 2R00A 4WK6A 4B8ZA 2Q22A 4EBFA 3JYPA 2J8ZA 1CDOA 2RHRA 3NGLA 3ZHZA 1GADO 4MVJD 3KSUA 3DR3A 5F1PA 3V5NA 1CETA 1R16A 4XGNA 4E5KA 5CDUA 4RORA 4B8WA 4XRRA 1JWBB 3ZV4A 1UDCA 1YBMA 2GRAA 4L74A 1I3NA 2EERA 1PZEA 1XHLA 1H6CA 1UUFA 2YFQA 3FPLA 4ND4A 4RVHA 4Y6PA 4BNVA 4YRBA 2UV8A 1FF9A 2B37A 2OP1A 1YQXA 1XQ1A 2CUKA 2O7SA 3QP9A 2POQX 4DPKA 1XIVA 3I4FA 1MA0A 2HMTA 2JAHA 3JQBC 4KWIA 3WGHA 2P9GA 3L4SO 5CFZA 2EW8A 3U5TA 4HUJA 1QR6A 2NNLD 5I9MA 1T24A 3SC4A 2VQ3A 4P8RA 1WPQA 4RVDA 2GDZA 5CPFA 1ZK3A 1SEVA 4BO5A 1WDLA 3CPSA 2DU8A 4OH1A 5U4QA 2AW5A 4RVGA 2VHZA 2J6IA 3AI1A 3GAFA 1GZ3A 3JQ9C 2DUWA 1YWGO 3R3JA 1ISHA 1IULA 2Y99A 1C3VA 4OGWA 3BA1A 3ZI0A 4OOFA 2OHXA 1LSSA 1OC2A 5I7VA 1A4IA 4UUPA 1XYGA 1DOHA 1SB9A 3H5AA 3PDJA 2XOXA 4HP8A 4LN1A 3AU8A 1DSSG 1QYCA 2EEZA 2X1HA 3RQSA 2O23A 4GAEA 1IY8A 5JSFA 4FPXA 4LSMA 1XKQA 1ZSNA 4XQCA 1J6UA 4FBGA 3ZW9A 1B0AA 1SNYA 1LDBA 3AW9A 4GX2A 2GGSA 1HZZA 4CMIB 2NU6A 5C3MA 1ENZA 2PWZA 3E03A 5IN4A 5DBGA 3PDUA 3W4JA 3QVOA 1DFHA 2EP7A 3NAQA 1F06A 1GAEO 1U2GA 2DBQA 4NMHA 3H2SA 3K2EA 5LDHA 3S2EA 4YYZA 1I3MA 5JCXA 3TZ6A 3VH2A 4MVJH 1G6KA 2E4AA 3TRIA 1D4FA 4J43A 3H4VA 3UAGA 5DOVA 4PG8A 4YT8A 5IF3A 4P38A 1B26A 4QX6A 3KYBA 3P19A 4FDAA 1ML3A 2O3RA 3DBLA 5C7IO 1AGNA 2SCUA 1XSEA 5FYDA 2I76A 3E9NA 1PL7A 2GZ1A 3DXFA 1EBUA 1XQ6A 4BO3A 3OEWA 2V6BA 3D4PA 4RZIA 5EL0A 4IIUA 2B4RO 2LDXA 1YDWA 3IMFA 1M67A 1WW8A 3LLVA 3AM5A 2HQ1A 3CH6A 4DIOA 2W2LD 4I1IA 4BO0A 3ZU5A 1IPFA 2QRKA 4CR6A 1GU7A 1K2WA 5CEJA 4BB6A 4W99A 3ANLA 1HE5A 4I5FA 4UVDA 1E3SA 4MIEA 1QV6A 2B0JA 4GLLA 1ZJZA 5EPOA 1O8CA 4J1SA 3T4EA 1GEEA 1ONPA 4HY3A 1NPDA 1WDMA 5G4LA 2ZK7A 2I3GA 3E8XA 2GLXA 1UAGA 1Z6ZA 2PY6A 3K6JA 1ZH8A 4UVEA 4WOKA 4YAJA 1PQUA 2ZATA 2NTNA 1LLUA 1NX6A 3WWYA 4YWJA 1M6WA 2QIOA 4DPLA 2LDBA 2X9NA 3IS3A 1PJTA 4JQCA 1GPJA 2VWGA 3OJLA 4QECA 5I9NA 1KVRA 3W6ZA 1DLJA 5M6DA 2J3KA 4LCJA 5ES3A 1N1EA 1U3TA 1JVBA 4NBTA 4ROSA 4A03A 4BNHA 4OXNA 3NJ8A 5F3RA 2FZWA 2I66A 2A94A 3MZ0A 3GMSA 1N5DA 1V9LA 4YRDA 3V1UA 1HZJA 1ZCJA 3ZNPA 3Q6IA 4CLEA 4ID9A 2GYYA 3D5TA 3DBVO 1LSJA 2Q45A 2Z95A 4WEQA 4CUJA 3RJ5A 3O9ZA 5A5FA 2IEDA 1HLDA 3CZRA 1VM6A 1B2LA 3PEFA 4XZ3A 5EIOA 3PZBA 4RLHA 4D3DA 3PRJA 4Z9FA 4B3HA 1ZMOA 4NHEA 4PG7A 4OKIA 3JQGA 4PG4A 4CMGA 4JJIA 4E6PA 1N9GB 4R16A 2GF2A 1IE3A 4AJNA 3QVSA 3GFBA 3GOHA 2EGHA 2P4HX 4A0SA 4MPDA 3JQCA 3GRPA 3RUFA 3X2FA 2O3QA 1W4ZA 5L53A 5HTOA 3SEFA 4L0QA 5K9ZA 3JQ8B 3LF1A 4AJKA 3OEYA 3F5QA 1QYWA 4MP8A 9LDTA 1Y81A 4Q3EA 5EJ2A 2P5UA 3WMXA 3FCOA 3SLKA 1J5PA 3VPSA 3U0BA 2BFAA 4B3IA 5A9SA 3L9XA 4WNIA 2Q49A 3ENKA 4PLCA 1NYTA 2YHIA 3G17A 3RI3A 1SO8A 4E4YA 2JD0A 3G79A 2EG9A 5LCXA 4HNGA 3W6UA 1V6AA 3DDNA 2IXAA 3BTSA 5DF1A 5ER9A 3WJ7A 4BNMA 4DWVA 1BXZA 1O89A 2QX7A 1MG0A 4MIOA 5A06A 2HLPA 2QW8A 1HXHA 2IYPA 1Q7GA 3IQDB 3WQRA 4OOEA 3WOHA 1ISMA 2EXXA 3TWOA 3NX4A 4NDNE 3D1LA 4GPD1 4YQYA 4FFMA 4FGWA 3KTDA 3W8FA 1TT7A 4ZVVA 1ENOA 3OA2A 3NRCA 4IS2A 7ADHA 3JQ6A 5T64A 4IJVA 4OL9A 3X2EA 4B79A 3CZMA 4M54A 4QO7A 5JE8A 4R69A 4Z0HO 1UXIA 5DN9A 5CDTA 3H9EO 4OMUA 3VC7A 4YT4A 4B4UA 2X4GA 2FPGA 2VHYA 4AICA 4EUHA 1VSUA 2AQKA 2X9GA 1FK8A 3D3WA 3TSCA 3H2ZA 3NDJA 3SVTA 4YEDA 1RM4A 4JBGA 5BSFA 3RBVA 5KVVA 4FC6A 3Q9NA 1FMCA 5AXDA 3ZU4A 1ONNA 1R0LA 3ADPA 3VDQA 3CIFA 3WICA 3DHEA 1P1IA 1ZK4A 2AG5A 4I5DA 1PJ4A 2VRCD 3JD1A 4NU5A 4CMEA 3ZDFA 1V3UA 3BMNB 4ZD6A 5H82A 4IJWA 3PHJA 5L95A 4J9UE 2V6GA 1HDOA 1QYVA 3PWKA 4DBZA 1P9LA 2X0NA 2RAFA 3T7EA 4NH4A 1GZ4A 1DRWA 1SCUA 1N7GA 2C7GA 1KOLA 2X22A 1PGNA 1HE4A 2CVZA 3NYWA 3VH1A 1ADFA 1GDHA 3CMMA 4PGFA 2TMGA 4IDGA 1H93A 5I7SA 1NQAO 2Q99A 5COAA 3F47A 5G0VA 3WYCA 4R1TA 5BNTA 1JAXA 4YJGB 1I36A 4NJMA 5KNLA 1CERA 1EUDA 4CL3A 2X5JO 4MVJF 3ANNA 2DVMA 4N18A 4NG5A 1ULSA 1PZFA 2OBYA 5EMHA 5ILGA 1PJ2A 5J9GA 1N8KA 1NVGA 2W4QA 4G5HA 2FP4A 4KQWA 5TX7A 3JD4A 2WYVA 4W4TA 1M76A 1ZEJA 4CM7A 4TKMA 3I1JA 5KKAA 1I3LA 1QG6A 3S1LA 3KZVA 3K2BA 4AJLA 1VKOA 2H5LA 3HFGA 1FDTA 4A73A 4EI2A 3RASA 6ADHA 3RFTA 2X0IA 5JYAA 4A7PA 2NUAA 1RYEA 2B36A 3I5MA 5JAQA 1CEQA 5G2OA 3B1KA 1T4DA 1E6UA 3QWFA 3LT4A 4UREA 3WMWA 5B4VA 3B20A 2NQ8A 1YQGA 2OUIA 1YQDA 3KV3O 3QRWA 1D7OA 1HETA 2AMFA 3S8MA 1NR7A 4GMFA 3CTMA 4BKRA 2PD6A 1KC1A 2PK3A 2Y0DA 1ZNQO 2ZYAA 4ND5A 4U8GA 4WLFA 1PS0A 1XGKA 4H3VA 4JX8A 3HE3A 1XDWA 2C59A 3HADA 1AE1A 3KSZO 1Z82A 2GD1O 1I32A 1A72A 5TGDA 2Q1TA 3PWZA 1T2FA 2HMSA 3TZHA 2C5EA 2ZB4A 4YAEA 1T25A 3N7UA 4P22A 1OZAA 2NWQA 1BXGA 4JGBA 1ZIDA 2G0TA 3AY6A 1ADGA 1L7EA 4PCVA 1BVUA 3BIOA 4R9RA 2FPIA 4WLEA 4E0BA 2DBRA 4ND3A 4G81A 1CYDA 5A05A 2RH8A 5J23A 1A27A 2Y68A 3R3SA 1ISJA 3QA9A 1JW9B 5TIIA 4XR4A 1GV1A 4GX5A 4CR7A 2B35A 1OBFO 4HX5A 3ETEA 3DAPA 4DLBA 4BNNA 5LC1A 2E82A 2GN4A 3ONDA 4BQRA 1A9ZA 4CMJA 2DKNA 3Q9UA 5C7LO 2BFMA 3AOEA 4PLPA 3JQ9A 4FN4A 1WLYA 2JHGA 2Z1MA 3CMCO 1ID1A 4CLOA 4MVJE 3AOGA 4XKJA 4BO4A 1TVEA 3PJFA 2NQTA 5A9SB 4F6LA 1NFFA 2FHSA 4TQGA 3WNVA 3WBBA 2CY0A 5L7TA 3OETA 5ADHA 4QUKA 1D3AA 5EN4A 2PKRA 3S2IA 1U8FO 1E3WA 2P9EA 1KVQA 2GO1A 1YJ8A 3A28A 4HFRA 3ZNNA 3QLJA 4L9RA 1PZHA 3RVDA 3UH1A 4WCDA 1NBOA 1JTVA 4UVHA 3C1OA 1GR0A 3EDMA 4R9SA 1Z75A 3DAGA 3EW7A 4JP3A 4UULA 1BRMA 2YUTA 1U3UA 4PZDA 1K6JA 4CJXA 1DIBA 2I6TA 3EUWA 3MJTA 1NPTO 4IGFA 5BSGA 4UUMA 1UJMA 3UICA 3WLFA 3U49A 2Q2QA 4RJTA 1ZK2A 2X86A 4L4SA 2Y1FA 4JN6B 3OP4A 1OC4A 4BKOA 2DTXA 3I4CA 3MWDB 1VJTA 4Y98A 4BGVA 3H9QA 5A04A 2WDZA 4IDEA 4CM6A 1WVGA 2WTBA 3RUAA 4CM4A 1YL5A 2HK7A 1YKFA 4MVJG 1K5HA 3PTZA 4R3WA 1OAAA 3TDKA 2GN6A 3RC2A 3INTA 4XDZA 4NFYA 5KWEA 3D3WB 3QY9A 1XG5A 1SOVA 1MC5A 4DIBA 2BLLA 5B1YA 4EEXA 3TOXA 3WQSB 1LSUA 1ZVMA 1PWXA 1NXQA 5KOIA 1G0OA 3LQFA 1ARZA 4RPLA 1N7HA 2CVOA 3IC5A 1I3KA 5FI5A 5HWSA 1ZBQA 3VTFA 4ALLA 1LNQA 1EZ4A 4KOAA 1VSVA 1HDYA 1N92A 2GCGA 2WYWA 3JQ7A 4BO1A 2FOIA 4JXKA 2DBVO 4AG3A 4NPCA 1H9BA 4BOYA 4K9DA 4MINA 5EERA 1GYRA 1LX6A 1R66A 4ALMA 2PH3A 4E2XA 3AWDA 3U4CA 4TRMA 4NQZA 3DOOA 2X0JA 3GZ4A 4NI5A 4ZRMA 1UXKA 2QYSA 5TJHA 4EDFA 4RPJA 1PR3A 3LT2A 3NJ4A 3GGGA 4XD2A 1CWUA 3ETGA 4CV3A 4PLYA 4AJPA 1XU9A 4HADA 4R1SA 2C0CA 1LRKA 1FDVA 3LF2A 2YV1A 3I9MA 2JD2A 4E33A 1B8PA 3E6AA 2NV6A 3AI2A 5L40A 4NJMB 1I10A 1E77A 5JYEA 4Y8VA 5DZSA 2NTVA 4XRGA 2W8ZA 4E2ZA 4DYVA 3WTBA 2YQ5A 1X15A 5TRTA 2FR8A 4R01A 4DREA 4WCFA 5A3VA 3IOYA 3VKVA 4M55A 3QVTA 1BDMA 4U6SA 4ALIA 3HJAA 3U62A 1QLHA 3HSKA 2OL4A 1HYGA 1LJ8A 3KB6A 3RUEA 3ROKA 3T4XA 3BTUA 3BMQB 2O2YA 5IAAA 2CFCA 2GASA 2VOEA 3SXPA 5KJ6A 4E30A 1YB5A 1WWKA 4CQMA 1DFGA 3DBRA 2VTEA 4L73A 3WJAA 3W4IA 5TT0A 4OSPA 3CKYA 5JO0A 4Q3BA 3TF5A 2AQ8A 1E3JA 3R6DA 2Q46A 2UDPA 4GX1A 4HV4A 1PL6A 2WE7A 2FWMX 3GEDA 1KEUA 1X14A 3WTCA 2D2IA 2ZB3A 3NV9A 4J91A 5KJEA 8ADHA 2PZJA 2VWHA 1N9GA 2ZJ1A 1DRUA 2NU9A 4PLGA 3GEGA 4CODB 3WSWA 4RV9A 4A26A 4EJ6A 1C1DA 3M2PA 3JQ8A 4CMCA 4U6QA 4ZN6A 1BVRA 2NU8A 4ZICA 1PS8A 2J5KA 4GGPA 4Q3NA 1SPXA 2OO5A 2CMDA 2Q4EA 4NR0A 4AJ2A 3LT0A 2ZTUA 1LRJA 1TA4A 1HE2A 3A06A 4O5OA 3ON5A 1HRDA 3AUUA 3TJRA 3QWAA 2EIHA 4JROA 3VAZA 4M49A 3AFNA 4EEZA 1YGYA 1BXGB 1GL3A 2OFPA 3H3JA 5DNAA 1E1LA 3GZNA 2DAPA 3ZHXA 4XYLA 1RM5A 4BGUA 5LDGA 1I8TA 3PYLA 2QQ5A 5JLAA 3ITKA 3C7DB 3KLPX 4BKQA 2GSDA 3K73O 2PGDA 4G65A 4DTIA 5MDHA 3EK2A 3A1NA 3V8BA 5CEEA 2D5CA 3PVZA 3FNHA 3WQQA 5U9CA 3WS7A 3AY3A 2CD9A 2P9CA 2V6FA 3C7AA 3OBBA 2Q1SA 3BTVA 3V2HA 3WYBA 4PLZA 3VVCA 2DUUA 4J2OA 3VZPA 4DA9A 4F6CA 1ADCA 1A7AA 2VUTA 4BMSA 2O3UA 2VHVA 1P0CA 4CLOB 3MJEA 5BSHA 3KVOA 5IFLA 2AEJA 1RKXA 3H5NA 2ZYGA 4U5QA 3RC1A 1C1XB 1GUZA 3O26A 4JBIA 4CM1A 4AFNA 4DXHA 2C20A 3PYXA 4BNXA 3LC7O 3BHIA 1JQBA 2BGKA 5KJ1A 3AOEC 4I08A 3KEOA 1E3WB 3NT4A 3ZWYA 4J1NA 1ZEMA 1R4MB 1UDAA 4YAKA 5KIAA 5L4SA 1PJ3A 4DC0A 5KVSA 1E3LA 1HSZA 3DAFA 3IIEA 1K3TA 4D0SA 1AXEA 1B15A 1VJ1A 2BKAA 3AFMA 1LDMA 2PKQP 3EMKA 3G3EA 1PEDA 1GPDG 3WR5A 1NNUA 3OHSX 3PJEA 4NBWA 2C2YA 3GRKA 2WD7A 5TC4A 3VPXA 3L6EA 4MVJI 4PFJA 1IUKA 2VUUA 4B4VA 1I5RA 2BELA 4TMFA 2DTDA 3GVXA 4RF5A 1YOVA 1E7MA 3H5RA 4R4JA 4KTVE 3RUHA 3BMNA 1ZK0A 3H9JA 4BNFA
chains in the Genus database with same CATH superfamily
1ETHA 4L9WA 4RZQA 5G0WA 3UJHA 4B6RA 3DOFA 1YCGA 3TRHA 3QEBZ 3NATA 1I1QB 1TF7A 1HK7A 4OHYA 4J7XA 3K4PA 3I5YA 1XFAA 1P1BA 3OPVA 5K0LA 2HD4A 3CSUA 4CDRA 3Q8LA 2WICA 5DNUA 5B12A 5LJLA 4FBLA 1I3CA 4D6XA 3IAHA 1S4QA 1I01A 4WRRA 4KJXA 4JDUA 2HMYB 3RAPR 1YZNA 2PYDA 1T8PA 2EJTA 2WJ4A 4CMEA 5BOSA 5BUQA 2KM1A 5B6JA 4DEYA 3IL2A 5DWQA 4RHFA 1CP2A 4Y1EA 4LXQA 2I0FA 4I0WB 4JLVA 4WNCA 3F7OA 3HCOA 2IF0A 4WXEA 5K0BA 3QEJA 2GEBA 2KMLA 2C4TA 2DF8A 5DXJA 3ONNA 5JSUA 1FFCA 2FVYA 1F3OA 1VL8A 2Q21A 4J3NA 4O2BF 4ZVSA 4MUJA 2D1QA 2XQIA 1WU8A 3PNSA 3ZW8A 2YRXA 3MQFA 4OQMA 2IX9A 5DBIA 3RS5A 4Z3KA 4FFNA 4FN5A 3VHXB 1U1FA 3CH7A 3PC6A 3Q1LA 3EDYA 4C4XA 1VDMA 3I0MA 1M1YB 1ENPA 3D9QX 4GM0A 4Q3AA 5ALLA 1M2FA 1X8XA 4EI8A 2ADMA 2HBRA 5I9IA 2COUA 4Q4JB 2AKEA 3UWOA 4E5NA 2FPWA 2GJKA 5J4HA 3MCWA 2QV7A 3UAVA 1XD2A 2IS6A 1KQGA 1BGWA 4HLUC 5E6SB 2RHDA 4MR8A 3HRKA 1CVLA 1NW7A 2ZBEA 3ID6C 4GYJA 3QVXA 3RSOA 3TCXB 1E3MA 3C0KA 1FP4B 2XADA 2PZ8A 1GFIA 3HCNA 1DKRA 5J59A 3UENA 2CKMA 2FPXA 3BWDD 2O8CA 4OJTA 3WWZA 4EMSA 3G2NA 4HWOA 2G0NA 4M9CA 4Z9XA 3TM5A 3CO0S 5D3MB 3USCS 4IIXA 4B09A 4YY3B 3PNOA 4WCFB 1NQTA 1K7CA 1O9HA 2PH7A 4NP6A 4PC7A 1ONOA 2RGWA 4FFBA 1W8IA 2Q7OE 4EK9A 1RZRD 3TECE 3I2IA 1M1XB 1PJQA 3SN6A 4G86A 1TU4A 1ZWLA 2E2WA 4IRUB 3RG2A 1EFHA 2Q07A 3HKDB 4BMNA 1P91A 4OM8A 2CF6A 5A6SB 1WKVA 4MUAA 5DM2A 3RVBA 1EAMA 3G7SA 3Q7RA 4LXYA 1L7BA 3T5MA 5B6IA 5BR7A 3SJAA 4KL8S 4MR9B 5CDGA 1OVMA 4MQEB 3PXGA 5JD6A 5JFTA 2P40A 3NVMB 4NC9A 2O8VA 4WCFC 4CQMB 2C88A 1CLEA 1HURA 3N2EA 1I30A 4FOLA 4NMLA 3MYRA 3DBRB 4K6FA 4KSYA 5F5LA 3VZQA 4A6XA 5SY4A 3I1YA 3TCNA 1Z2EA 4CBVA 1Q3TA 3BILA 1T1JA 5JIBA 5LKRA 1NJ5A 3BSFA 3BIWA 3HB0A 2HREA 1K5GA 3QLUC 4Q3CA 4Q37A 3ZWMA 3I9NA 1Z5NA 3ZZMA 4EKIA 3TQQA 4N3CA 4RQBA 2JAXA 3W7VA 1V8BA 4X60A 1QF9A 5ECWA 2OKCA 1SZCA 5BV7A 2A7QA 3R1IA 2P2YA 4WLVA 5F2NA 3AFIA 1NUPA 1CS0B 3G6KA 1YL7A 1XZIA 4XWTA 1QVRA 4O4JB 2NU9B 5T57A 1SVIA 1NVWQ 2PRIA 3DEIA 3W5DA 3T7SA 4GKBA 4RY0A 1T2DA 1I0IA 4DC1A 4F60A 4BQEA 1R0KA 1GQQA 1MFZA 1VE7A 4H7PA 3MELA 1U2EA 2DH5A 1OHHA 4I3FA 4RAQA 4UE3S 3DE2X 5EPEA 1U9IC 4Y30A 2H6EA 4AYWA 2I1LA 1E61A 3T7RA 4Z8XA 1UFQA 4R8SA 2HSZA 4UUOA 2JCYA 3RHTA 1VBKA 2Q3HA 4DRXB 3E23A 4OXRA 4NDAA 4XGKA 5NULA 2FN4A 2LTAA 5BXYA 5JRJA 5K51A 1WQ4A 4U2EA 5MGBA 3GZNB 1ICEA 2UZIR 3FZYA 3V80A 4JD5A 2VDRB 2X0FA 2F4VB 4N76A 1UC5B 1KEEA 1P6UA 3U3DA 3F49S 5KTNA 4PZCA 1USUA 3UK2A 5JXWA 1R50A 1IHUA 3WLKX 3DZCA 5G0UA 1M8GA 5DRTA 2P4EA 1U8YA 2F1KA 4KXFB 1S0UA 1SWWA 3QKRA 5FBWB 4YUZA 5B30A 3WFJA 4RW0A 2HXYA 1AKWA 1Z68A 3IEPA 4YR9A 3FVWA 3AEQB 4K28A 3NUGA 3O7MA 4HNQA 1CUCA 3OAAD 2ATVA 4JP2A 5J4VA 2OQVA 1D6MA 1FNNA 4M6WA 1YVEI 4FT2A 3NHAA 2NXNA 1FQWA 1NAIA 3QVKA 4FQ8A 2VXYA 1MZPA 1FSZA 3T54A 1U9YA 3N53A 1X80A 1A9RA 1X77A 2P3LA 4BC1A 4QUJA 1D8AA 3F4LA 2PGLA 4LJLA 4ZAYA 5LVAA 5HKLA 4S1WA 5CLLA 1JDBB 4OBBA 4R2MA 1NATA 3S2SA 2P8SA 2Z2JA 5DEIA 4TL7A 3NHMA 3TTWA 5M04A 1B93A 4OKNA 1XTJA 4ZAWA 1W94A 3C6BA 4GXNA 4Q93A 2I9PA 3I42A 1X7DA 1I2ZA 3IDAA 4FFSA 4FJ1A 2UYYA 2ZYDA 2XYGA 3HCDA 1BE1A 3EYAA 3BKWA 2CVHA 2AEMA 1T29A 4MQMA 3NIDB 1QQ7A 2UU9B 2V4ZA 3FUTA 1K1EA 2C99A 2AE2A 2WZBA 2YVKA 1KDYA 1JDBC 2ATCA 2P68A 4JUFA 2IS4A 3I6IA 2J3QA 2XE8A 1E6EA 1FDUA 3RJZA 2YOHA 1UP6A 2H59A 5DK6A 2XE6A 3PZRA 2QNIA 1U1CA 4MUFA 5AXCA 2JH8A 2Z43A 5FNZA 1LNSA 4CN9A 4ZC8A 1ZOPA 1P33A 3RC9A 5C4IA 3BK1A 3IE0A 3IJEB 1WXIA 2A88A 2FW9A 3IX7A 4O2LA 2JLZA 2X58A 4TLCA 1GV0A 2VWPA 3HXOA 2YZ7A 1LDEA 3ELBA 5JY6A 1BX0A 1W93A 1YB1A 1K5PA 2CXHA 4GNRA 4ZQGA 5DULA 3UMGA 4WBNB 4BEWA 4ZCPA 3F96A 3N7AA 1A97A 2J7KA 2Q3FA 3SYTA 3KELA 2X2OA 3S6JA 1NSTA 2BPOA 3O4JA 4PZ9A 3AQ4A 5G3YA 5CU7A 4E13A 1Z0DA 3B85A 1U3WA 3HA2A 1REQB 1L6IA 4F9GA 1U4NA 4ML3A 2PMBA 5IJ0A 5JCJD 4BMVA 5EJ6A 1AKRA 1KR2A 3FDZB 2ZZNA 4E4RA 4EJFA 4N3BA 3JPYA 4AWXA 1F8FA 3O91A 4GZ5A 3WGGA 1I6KA 2R8OA 4FIZA 5CFMA 4XVRA 5DGXA 1Q15A 3C7CB 1QQ6A 3KQSA 4H77A 5E38A 4DWWA 1YIDA 3EDQA 2X3FA 3HWWA 2ZIGA 5TVOB 3QPBA 4R1NA 3B9QA 1K8XB 3IA2A 1DTWB 3LSTA 5FHQA 3OQBA 2RAUA 2ZVQX 3GXBA 2NTJA 4M2LA 1I5EA 4NYIQ 3U3XA 4URFA 4ZPJA 1VLHA 3KEGA 3P52A 2OD9A 4ONEA 2JEOA 2WDPA 2IYRA 3F3KA 4QHTA 4KPYA 1Q2XA 1TRHA 1E89A 2ZSEA 4AJEA 5F98A 1DO8A 2NSYA 3MB5A 5B3LA 2RHBA 3ZJYA 5CJJA 1G66A 5KYKA 3CUSA 3K8ZA 4H6VA 1T10A 3O47A 3CVYA 1OZGA 1U2PA 3QG5A 2WSYB 2EVWX 4LDPA 4AUNA 4ETNA 1SKBA 3VU8A 4S3MA 1ORWA 2ZR0A 2XGOA 4PQEA 2UKDA 1MOPA 3AY7A 3EISA 3M3HA 5CDFE 2WMOB 2G9RA 3DL2A 1E4EB 1E5QA 2J3HA 5TF0A 1FXSA 2B2NA 3L8EA 3NAGA 5LQSA 2PKWA 4TV9F 1WCYA 4WGGA 1I6MA 4R54A 4QBKA 2CGEA 2HU8A 2SKEA 2V7VA 4HJRA 1NNSA 2XVYA 2I5PO 1JAHA 1TD9A 5CYPA 5I7FA 5DTQA 1K98A 3O95A 4F5DA 1CZHA 1B74A 1SHUX 1N6NA 5C5DA 4Y1FA 1U2SA 4RE5A 1Q0HA 4D45A 1RRVA 3HCWA 3HB9A 4JJ8A 1YH3A 1ZUWA 4QOHA 1G18A 4JI5B 1R5OA 5CEFA 5B36A 1P7YA 3Q15C 3KU1A 1NFRA 3JZMA 1GG9A 4KACA 1T0HB 2G08A 2P2NA 5C1IA 1AKUA 1YJCA 2WJJA 5K8VA 5HE8A 2HA2A 2IHKA 4Y2XA 1W29A 2FCAA 5CHEA 5A4AA 5JSHA 5C31A 5D85A 4TWJA 3TMKA 3LQQA 3BSSA 3V1KA 3WIBA 1ZXLA 5AFSA 3OVMA 1G3IA 2QL9A 4HWGA 4RVUA 4UFPA 1NP3A 1XTPA 1R0ZA 1PEAA 2ZRPA 5H1YA 5HFNA 6REQB 3VVLA 1WHTA 3F8TA 4YAFA 3CONA 4E1AA 4RD6A 1B00A 1X1AA 3Q98A 3DTVA 5JDIC 3GFRA 1RRCA 2OC9A 3IBCA 1A3CA 4WV3A 1NW5A 3DOJA 2F2TA 4BX0A 4INPA 4KO1S 3EGIA 1RZVA 3NG1A 1IYZA 2A5DA 3GPDG 2X9VA 3FF1A 3OIVA 3JR7A 4U9HS 1HE8B 2AEFA 3TTUA 1G41A 5JS1A 2WFMA 5JAZA 3N07A 2G9ZA 2PSEA 5DJ5A 3LCVB 2NVWA 3TI9A 5EINA 2OVFA 2FMHA 3QE4A 4G5RA 4UEKA 5ABPA 3Q7QA 5AT1A 4AMUA 3ZVRA 2LNDA 5K4AA 4CM9A 3FDJA 1ZCZA 1EDOA 1EFPA 5KCMA 2QU8A 1U2QA 3EGVA 4B2YA 3WYAA 1ZK1A 2HCJB 2I03A 3K9QO 3VSAA 4BO8A 1FFXA 3T0IA 2D2XA 3H1BA 3L9WA 4ENVA 1N2HA 2XWPA 4J6EA 3OPMA 4OXYA 4Y1GA 3PQVA 1L5LA 2Q6LA 3STXA 5K8JB 4O4LB 3EC7A 4E2WA 2DLDA 4PHTA 2JAQA 2RHCA 1Z12A 4V3CA 5L8VA 3NC0C 4KR3A 1KHTA 1E5LA 1FCJA 4QXAA 4JUIA 1Z7GA 3S1SA 3FPCA 4A2CA 3ZXSA 1ST2A 4RA6B 1G20B 2JANA 4WINA 3P94A 1C1XA 3PFFA 5AHXA 1QO0D 3JWIA 2PIDA 5EGNA 1EXVA 1PF7E 2OG2A 1J07A 2IODA 3PNQA 4J90A 1DZIA 3CEJA 1QRRA 4ACAA 3EP6B 1LXCA 2CF5A 3G2OA 5C5EA 4MR7B 3F71A 2MMGA 3BL6A 4FOOA 5C52B 4R8KA 2E85A 5EWJA 3BA6A 5G02A 3AC0A 1ZMRA 5A5DA 1OFUX 2OLJA 5CYFA 4QYWA 1IWOA 3VR2D 1EK6A 3SLGA 3RSSA 1ZR4A 3AVTA 5C4GB 3O4IA 1TTTA 4D57A 2F1IA 4FX5A 3VMMA 5FA8A 2ZFUA 3BEDA 5AJWA 4AY5A 1IUNA 5JPIA 2VP6A 4TXJA 3D6FA 4EL5A 1GGEA 2UVQA 1K6XA 5JEEA 4RTMA 3RROA 8OHMA 2PGXA 2EDAA 4DR4B 2FSVA 3NTOA 2OOSA 3RYFB 1O6CA 1WTCA 2E6KA 4EKNB 2IOHA 1JYFA 3GNQA 2OV4A 1PX2A 1J90A 1RI4A 2JCGA 2FEMA 3BE4A 3FTDA 3PGJA 2ZI3A 3C6MA 5JDCC 4B40A 2XGJA 3VNVA 1H2BA 1IAVA 2ISSD 1TW3A 1KZHA 1NUSA 1TCAA 1YZVA 2QTHA 3BQMB 3D6AA 3PL5A 1TQ2A 4F8JA 1OE0A 2HKIA 4F8EA 3DYBA 1CSEE 3ASVA 3PPYA 4RO0A 2DBZA 3IDQA 5LNK6 1QE3A 1W0CA 3TUZC 3G7UA 2H1CA 1X1EA 1C2YA 4DCSA 1ZMBA 4LNAA 1HH4A 1MOZA 3ZDBA 2Q0SA 2V9ZA 3QENA 3PIDA 2FDCA 4W9NA 3C48A 1XD9A 4P58A 1BIFA 4DNFA 3HVIA 5DMXA 1TYEB 3KXDA 5H3LA 2MR6A 4GOMD 3QXXA 4UDOA 4CMAA 2C9BA 2ZXFA 4I9HA 2XW6A 4ZZ1A 4KQMA 5AW2A 4XJTA 1I4LD 5A71A 5JSKA 5THKA 4DLTA 3PA6A 3MOGA 4TQUS 1JQKA 2MSKA 1K86A 4UZEA 5EUBA 1QIIA 2Q3CA 3KZCA 4MYCA 4II3A 4LRSB 2V7QD 2Y1GA 4QO8A 3X1KA 1DCMA 2WBLC 1G16A 4ZCIA 4NECA 3SX4A 5IVHA 3KYJB 4KFUA 3VGJA 5CAEA 2ZS9A 3DZ7B 4CEHA 4DIMA 4U7FA 1F2DA 2CSUA 2B4TO 2VSXA 3IALA 3Q3GE 1T0PA 3HRHA 1U2ZA 3CJRA 1OI3A 4ZQEA 3A1EA 2EFYA 3R5FA 4TT3A 2V59A 3L49A 2YMPA 2E49A 2DPLA 3RIMA 2ZWVA 4ON9A 4WECA 4F3RA 1G8MA 1U2RA 3P9SA 4HWTA 4NU6A 2CCJA 4R1UA 3OIDA 3DNMA 4XLLA 1O0CA 2JJ1D 4KVGA 1V26A 2X2EA 4M7OA 2BFCA 1J00A 4LXTA 4TS9A 2RFLA 4YCDA 5LLDA 4QM7A 1N2OA 4J4BA 1NVVQ 2O0HA 5CDSA 4BEVA 3UF0A 3ZXUB 4AULA 1B2RA 1XEAA 1CQJA 4FYHA 2W6JD 1MPXA 4R2IA 4NSNA 4NKRA 1IH8A 1XEWX 4XB1A 1KBQA 2A59A 2FRDA 4Y6RA 1YR6A 4REOA 5E6UB 3LI2A 5DHQA 4CHGA 4E7PA 2G06A 1NYQA 4XDYA 2LZ0A 1WJGA 3PCTA 2RI0A 3AZQA 3O8BA 4JJAA 1F0PA 4KXYA 2YWRA 4OQXA 4ZREA 4A8JB 3CT6A 3TQRA 1F2UA 3ZZNA 4R83A 3UW1A 2Q9UA 3IUNA 3PKIA 3RVKA 2HNBA 2BGMA 1RWWA 3TX6A 2VPXA 3T7IA 1KAEA 2A9RA 3UFBA 4AW9A 4BLRA 5JR3A 1Y8RA 4M98A 1M6VB 1L5WA 3SEZA 2LXNA 3HKEB 3NTRA 5EY5B 4YJ3F 3UWKA 4A8JC 2MU1A 2ZUBA 5TXGA 3BXFA 2PZAA 2GFHA 2UVPB 4BNKA 4W5QA 1WPXA 5HBRA 1QVVA 3DULA 1ZS9A 2H1SA 5BSTA 1R2QA 3H2GA 1I33A 4IQGA 2JARA 2VDQB 4O4HA 4WMLA 2HJHA 2MDTA 3INNA 2IHUA 3PQFA 2GBGA 4DBLE 3SR0A 3O0DA 1P18A 1GRVA 5CIQA 5K0GA 3VO8A 4DKJA 3IUEA 2Z8XA 2O8EB 4NWIA 3MG9A 1RI2A 2MMCA 4EGFA 1YQQA 2QV0A 3DHVA 1JB9A 3F3YA 3F97A 5GAJA 2QTNA 3EGWA 2PMWB 2PYIA 3GCXA 1TGVA 5I3CA 3NHFA 5LPNA 4AJIA 3OE4A 4ZOLA 1L7MA 1KIMA 3ENNA 3EZFA 4N54A 5KTKA 3OCZA 2B8EA 1SC6A 1IC6A 1KO8A 3QKUA 4GOXA 4RKQA 1PYGA 1XMIA 5LBUA 3I01M 4JJKA 1H1TA 3RUDA 4F04A 4ZYZA 2L0XA 2MHCA 3K3PA 3L5KA 3B36A 4O2AA 4F3YA 1ICIA 4CV0A 1V45E 4B3GA 4KZPA 2VNAA 4YT5A 1OYOA 1UOEA 2XA9A 4NCXA 1UOQA 2FSFA 1GUDA 3DR5A 4CUZA 4LF8B 5JT1A 3H0EA 2IWRA 1EESA 3GBPA 1QIDA 4TRRA 5IC5A 5ILQA 4O08A 3LL7A 2HDHA 1PW5A 2IXEA 1TT5B 3FUUA 5B7GA 1N1GA 2GB4A 1B42A 5I8ZA 3G59A 2O1SA 4IXWA 5L7WA 4G4JA 4N5DA 5BNWA 2O48X 1K0FA 3EA5A 1NV9A 3HWRA 1O03A 4BMZA 1CNFA 1MV5A 1XLTC 4QDUA 4GDFA 2ECFA 5LMUB 3H0CA 5AKGA 3PHIA 1BMDA 1AN0A 1YSCA 2Q5LA 4NE9A 5K0NA 1J7KA 4AXBA 3TG2A 1TPYA 1XCMA 1CKEA 3H7IA 1F0NA 1HDEA 1Y7IA 1RJ9A 3EG9A 4KXVA 4YMIA 5DK4A 5A7GA 3MILA 4M1EA 3WDSA 2HF8A 4RHXA 1E7YA 3L05A 4ZHQF 3KM0A 1YZTA 1FUIA 5FF9A 1RWNA 2OXIA 1YJ5A 1XJ5A 1LA2A 2B0CA 3ETHA 4OL0A 1YA4A 1FFSA 3D5EA 4W8OA 5ALKA 1HT3A 3REOA 3EQ2A 1OH7A 1KFEB 4CFZA 1MJFA 4HNAA 1VPEA 2QL6A 1R9NA 2QJWA 3BFPA 4GHWA 4QYTA 4MVXA 4WK0B 4YECA 1XHFA 1J22A 3DOHA 3VPGA 2IYVA 1XMOB 1WCWA 2KW5A 3FSEA 4HXYA 4MS1A 1Y0BA 2EJWA 4YJHB 2B78A 4H7DA 4Y0VA 5TF4A 2CW5A 5GZ3A 1BEEA 4LY3A 2BH2A 1GTG1 1IHPA 1LC3A 1OI7A 2BGLA 3NIBA 1GGFA 3FTNA 2XKJE 4A2PA 4CT0A 4DUPA 3ZHRA 1BU8A 1M2NA 2QX6A 2X7JA 1M74A 3PX2A 1ATIA 2VA8A 2QYHA 2XSZA 4YXFA 4TMYA 3TNYA 3KKQA 3WK7A 2GMWA 1MU0A 3WBFA 3K72B 3Q12A 2O6HA 1JG3A 3EGXB 3FOCA 3SS7X 3VZRA 3HJBA 4NBUA 4D3ZA 4ZMSA 4CLRA 3IP8A 2PQ2A 4MVWA 3BHMA 4G36A 5GONA 2H18A 4O1IA 4ICIA 3FNEA 4PNPA 2VN8A 3L1JA 4DLUA 2BWJA 3BWEA 1T5TA 4XW2A 4ZVNA 1C7FA 2C5BA 1DC4A 1JXOA 1QC5B 1F4PA 3BWCA 3GEEA 4M8LA 3ZQJA 3ZCTA 4BLQA 1L3BA 2BZGA 2OGTA 3A1SA 5G4KA 1M1NB 3KOWA 1QH8B 2VYCA 3QI7A 1ECCA 5THXA 2PYZA 1A5BB 1OXBB 4O02B 4AKEA 1DQPA 3GDFA 3AXSA 5EE1A 2OK7A 1HG1A 3F6EX 3JZFA 1T4GA 2ILTA 2V7WA 3KZOA 4JR0A 4NEQA 2YL2A 4ZAZA 3K35A 3TSZA 4AP9A 5AK0A 4C0SA 4GICA 2QBYB 3JATB 3K0BA 2XA2A 3JYQA 2WINI 1ZH4A 4MDHA 2HEGA 1RABA 3ZU3A 4IMJB 1NN1A 2VYQA 3CF4A 1Z45A 3H0WB 3EMDA 2CHQA 3SQOA 1TTPB 3REQB 1VPDA 5EESA 2G9VA 5EQTA 4YMUA 2EIXA 3W8DA 4IG4A 2H29A 3PC2A 4ZAGA 1PTJC 2WG2A 1Y37A 3M6MD 1DS6A 3RKUA 4DM7A 4RPIA 4DZZA 1SBYA 3WLQA 1DRJA 3U7RA 1TM2A 1PKXA 3KQPA 2W8BB 3KRTA 1IBLB 2JH9A 3PEYA 5LQRA 5GJWC 4CR8A 1PQPA 4JSRA 4BLWA 5A4FS 1RW4A 2JEYA 3F5MA 3M6IA 2CFSA 1R6XA 4KO2S 4RCYA 4URUR 3EEIA 4EZBA 1JQ3A 4E1VA 1W581 2ZTLA 5IASA 1U5CA 3CLTD 3GMDA 3QWBA 1XEFA 1DPGA 1GEGA 1RQPA 4EOGA 3ASUA 1Y7HA 1HE1C 2BHTA 3R5JA 5AW9A 1SA0B 3VBCA 1Y5LA 2HWWA 3L43A 4NZZA 5SICE 2YDXA 3OPNA 3G9QA 3A2LA 4J1QA 2YCBA 1BDJA 3DBOB 1JR6A 1QDEA 1AK1A 4LCEA 2QTCA 5ESRA 5K99A 4NBLA 2FPLA 2A0UA 3FHLA 2X8WA 4KMOA 4PNZA 3IQEA 4PX2A 3OF2A 4ZANA 1GUYA 3L7CA 3PB3A 3UN1A 1AK9A 5HFAA 5B3JC 1EGQA 4DQ0A 4W1PA 1T2UA 3WMGA 5IDWA 5ELXA 2GK7A 2FYTA 5IYZB 1SUAA 2AD5A 2WVAA 4DW8A 1IPEA 1OT5A 4MI9A 5TQ2B 1EUQA 3KVVA 1QB7A 3DE4X 1GAQA 2RB5A 2F8MA 2XNDA 2YNMA 2HMUA 2ZE7A 4L5CA 6CHYA 7ABPA 1DWUA 1J0BA 2O1WA 3IUSA 2NVBA 1GQ2A 4KBGA 3WX0A 4UXJA 4BPRA 1F4VA 1Z7BA 1N5RA 3GJQA 1KFBB 1KVUA 3IIIA 4NQRA 2WIKA 5HOQA 4BFWA 3QE9Y 4I9NA 1NOIA 4EITA 1JG2A 3RVQA 4BLSA 3CXRA 4EGJA 4B7ZA 1BJRE 5IT4A 3F4KA 1JHRA 2WWWA 1YJAA 1A98A 4MGKR 4FCCA 5CM9C 1RCTE 1UKYA 4G2NA 1S01A 4XQEA 3U61B 1UBGA 1SZPA 3GI1A 1AKVA 1W2HA 1XXHE 4WSOA 4CW7A 5CD1A 1XLVA 3LDFA 3DMHA 3RTBA 3U16A 3KTAA 3OQHA 1E0SA 4C20A 2H1VA 4RTSA 4FOTA 1HL3A 3TEMA 1ZI9A 3DDUA 4LK3A 1PBTA 2G25A 2XMRA 3NHSA 4D96A 2OA0A 3DDHA 4ZO6A 4JLWA 4MGYR 2C42A 5EHNA 4L57A 5DBFA 1O95D 4ZT4A 1MO4A 2AC2A 2FZKA 4ND1A 6AT1A 2W2MA 4TXNA 1EA5A 4UCXA 1KS9A 3DC2A 4DEXA 2XXAB 4RPGA 1NVMB 3QVLA 1RCFA 2A1TS 4O6VA 3ONFA 1UFKA 1FDWA 3CN7A 3U7EB 3WKCA 4M4SA 3PFCA 2HSJA 3G2MA 3EFHA 4Q01A 5EE9A 2QW0X 3BMCA 1JHDA 5K8TA 3GWGA 3WVNA 1MC1A 2HBQA 3R0JA 1E5TA 2GN1A 1L4BA 3UOAB 2AVNA 2G9NA 2ETVA 5ALRA 2CNNA 1BA3A 3GJ3A 1F14A 2JJ8A 3OQVA 3NHJA 1NJGA 1FUEA 3VVMA 2JFUA 4FLMA 3GBVA 1E6KA 1UBNA 4NF2A 4EECA 1QP0A 1G21E 2J9YB 2WEKA 4X85A 2O8BB 1O0BA 3D4BA 4W6ZA 3RVMA 2IP4A 4BNJA 2XUAA 3DEYX 2PD3A 3TGPA 3GPIA 2V55B 1B14A 2DHDA 2WSMA 2E5WA 2BEKA 2VPIA 3QPWA 1OGYA 4GSYA 3DBHB 5GJCA 1UC8A 16PKA 1V1RB 2DLCX 1IEWA 1IIBA 1M34A 1T3HA 4PYIA 1OMOA 1N7JA 4JI4B 2C97A 4YH1A 3R3WA 3ESYA 3BS4A 4ZALA 4JI6B 4FEYA 3SQNA 4CM8B 3TSAA 3I2JA 4I6GA 2PKCA 3LLMA 5LWQA 4EO4A 3TBHA 2H9AA 4ARZB 1APBA 1ZPDA 2PMFA 1TX4B 1Q0TA 2CJYA 1Z6XA 5F23A 4B7XA 3IIJA 4FYMA 2PKXA 1J5EB 2TYSB 5EZQA 5IK2A 1G4UR 4O8JA 4LAFA 4B33A 3V7FA 1JIXA 4DQLA 2R00C 2GDJA 2WR8A 1C30B 4CCSA 4I8IA 4GGMX 1Q50A 5BSVA 3EF3A 3K6SA 2Z1DA 1ND5A 3C3KA 2ORED 3RFCA 3L4BC 2VK2A 4MITA 4PX5A 1ODJA 4EYOA 3AR5A 4Q18A 1NXXA 2P4QA 5KVQA 3F2IA 4R31A 4YP1A 3LZ6A 4ESVA 4G0WA 4WHMA 3A2NA 1NUTA 4IMRA 1TZ2A 1UBKS 2FJUA 2ZT7A 4FW9A 4UM7A 1YBFA 1XA0A 4LV6A 3M81A 1QBGA 3KTOA 5F73A 5K8UA 1UPFA 2C2ZA 1KE2A 5LU8A 5CB4B 1J25A 2AT1A 3AUYA 4K3UA 3GARA 4LZJA 3UUFA 2IEAA 4NJOA 4O4IF 1CRLA 4AZ0A 1G7TA 4HWKA 1BCRA 1WAMA 1NR5A 3ND6A 3RUIA 1N3IA 5JQGF 4MQBA 4JUBA 3WAGA 1MJGA 3EZXA 4YV2A 1BTOA 1UINA 1YRAA 1C7JA 5IUKC 3LLSA 5J1TB 2V7GA 3K30A 3A6JA 3ORFA 4JJ4A 3OZRA 1XPOA 3MINB 4GMKA 3LCCA 3HYSA 1F8GA 3QFCA 1CBUA 2GZ3A 1SIUA 1T8TA 3R3XA 3UXYA 3F8WA 1YDMA 4DTCA 3PE3A 1N2CB 4UTRA 3NI2A 2B69A 5HQTA 1L6RA 2BM8A 5TGTA 1L7XA 4N1AA 3TVYA 3K1TA 5K1ZA 2DKOA 2HJGA 4TV8F 1VOTA 3MGGA 3NHPA 3L0ZA 5INTA 1IUPA 5FUQA 3CJQA 2Z5VA 1NAHA 2G1UA 4M7WA 1GQSA 2I4IA 3DMRA 4O63O 4R1MA 4PLHA 2QUJA 4E3WA 4CU2A 1GCIA 2PT7A 3FD8A 1MH1A 2Y1DA 1VL6A 2IPLA 3VTAA 3EP3B 1C9DB 3V3KA 3VR5D 4UJ3A 4XYBA 5FORA 4QL3A 1IN4A 2BGUA 3L0PA 1I9CA 4RGBA 1K63A 1QO7A 2G82A 1H2FA 3VR3A 1EP9A 1ES9A 3FSRA 2R7AA 4NARA 1R3UA 3PDHA 1MG5A 5TSDA 3SF8B 4D6YA 1IBMB 4HN9A 1Y8CA 3QBJA 1ODFA 4REQB 5FTKA 4A8HA 2FEPA 3DBLB 3KD3A 3E84A 4NOLA 2IOFK 1S3GA 4QJBA 3UOGA 4Q00A 4RH1A 1R12A 4X94A 1U1IA 4E5PA 2HO5A 1G8YA 2COKA 1O96B 2LIVA 1KH2A 3KHUA 2HRZA 3N5KA 3HBLA 3QTTA 1FRNA 4FDUA 3H9GA 3NLLA 1UMBB 2C7VA 1E4YA 2QMHA 1EX1A 1IAQA 3GGSA 4YRQA 3COPA 4HVLA 1NBWB 2CXNA 1UDBA 1DHTA 2ZVPX 4QA9A 5BMVB 3TDNA 4C4RA 5KMGA 2GKOA 1QQ5A 1U90A 4LA4A 5FLKA 1PGOA 4D9GA 1WM1A 1R9GA 3QEMB 3RO7A 5FR2A 3NWEA 1E2UA 1EQ2A 4M9QA 4R6XA 4YTEA 3M5PA 4F3NA 3DFKA 4EY5A 5DN6A 3LPMA 3IBYA 1DFIA 2GEDA 4PIPA 1DC5A 4C0KA 1EFKA 4RF2A 1EHYA 1VSBA 1BHSA 5DHFA 1BYIA 4X7RA 6GPBA 5JJCA 4MDYA 1ZX1A 5EWLB 3H4MA 1Q2UA 4L07A 3IVCA 3NXSA 1PG2A 2ZBFA 2AK3A 2GAOA 2PGAA 1W0KD 1DOZA 1R8XA 2XYQA 4QTUB 2B6HA 2BJVA 3CUTA 1G5FA 2AG1A 4I19A 4JCCA 5CX4A 3OMLA 1E66A 3ESDA 1UBCA 2PEYA 5AJYA 2H1FA 2XDQB 1TU0A 1SXJE 4AT1A 1N8NA 2B4KA 3GV0A 3GDHA 3EVFA 3QH4A 5U1PA 3S2GA 2IF2A 2VUIB 1ZHOA 3FY4A 1FFWA 5H4GA 5LQDA 221PA 3H0VB 2R8ZA 2YW9A 5JASA 1UEXC 2BJHA 3BTOA 4HNUA 5HR5A 1T1IA 2Q5QA 4JJFA 3V48A 3B53X 3AR4A 1B0ZA 1LQTA 3WGJA 1OLXB 3DM9B 1LDYA 4DG9A 1H23A 2IIQA 4CV1A 5K03A 1EWYA 2A78A 4A8PA 1FSPA 1RPJA 2D2FA 4LV8B 4AY4A 2QMZA 2VYND 2V7EA 3A1FA 4HOYA 3HTXA 2C61A 2BC9A 1M0WA 4MK4A 5L3SA 4C76A 2GD0A 2OBNA 1YI0A 2X1VA 5E8RA 4OI2A 1FSSA 1ODSA 4G0QA 4AYXA 2XDAA 3KL2A 5H83A 3VU0A 1M2OA 1CJKC 1F1JA 1HT2E 2YICA 4L02A 4JCOA 4UKDA 3OQPA 4RL4A 1NSYA 4IJUA 1FDOA 1C9EA 1AXGA 1UP4A 3JQFC 4BJ6A 5AVYA 2HB6A 4E6EA 2B5WA 2ZW9A 3MCUA 1RXWA 2ATIA 3H65A 3L7DA 1I5OA 1UANA 2E9SA 1H1DA 4ENUA 2V4MA 3BDVA 3JQBA 3AFGA 1PWZA 4BQSA 1YXMA 4EAAA 3IDSA 2O06A 3W5UA 4CT4B 2EX0A 4DMRA 1OI4A 8ATCA 4MUXA 2AJ8A 4CQMD 2CXRA 4JHXA 3LBYA 2IIPA 5FI3A 3KWLA 4A0QA 2C7PA 3DWEX 1DC7A 1FFHA 4YV1A 3D6VA 4XVCA 2AKAB 4Z5XA 3TS1A 4A8TA 4IWXA 4KBFA 3ROTA 2C78A 3O82A 4Y2PA 3UHPA 2QUBA 4QRHA 1NULA 1VBMA 2JD1A 2JFYA 1I2CA 3F4BA 3I5AA 3TD9A 1DV2A 2R1TA 4GBGA 4BKMA 2G70A 4PSAA 4W8GA 3TGWA 4N6NA 4RSHA 3IO3A 1AN9A 5B3AA 3LC1O 3NOQA 3A1VA 2GK6A 4OB6A 4X64B 5CK4A 3Q8KA 1SKYB 2W4IA 3FNFA 5CCEA 5ALHA 4WXMA 4Q39A 3U9LA 3ABOB 3OZIA 1NNI1 5F1OA 1QHEA 1KJQA 1PNTA 1AKTA 1FDRA 1U0TA 2R8YA 1P0PA 3GDGA 1TQDA 1P5HA 4HGOA 5FT9A 2XNJA 3P9RA 4F45A 1V4VA 5BW8A 2GFQA 1NQOA 3BDIA 4TVOA 5GOTA 5IAGA 1YRYE 3L6RA 5ECGC 1JDJA 1U0SY 3B3AA 4AJ9A 4WNYA 1FOEB 3QV2A 4K9PA 4Z3DA 3DMTA 4NHOA 5CTAA 4DRYA 2G09A 2CT8A 3MJHA 1I72B 1H5QA 2RH4A 3FSGD 1ENYA 1I1NA 3HG7A 3O3NB 1D0SA 4O8ZA 4IQ8A 2G67A 1O57A 1T6YA 1Z4LA 4MGIR 3PGA1 5GZ6A 1EFVA 3N0VA 4DQDA 2VTBA 2ACWA 2B4AA 2XXBA 3I6BA 4JLMA 4N6GA 2FUNB 4Q3LA 3LDAA 2XMGA 1QAMA 2VKQA 3PFHA 4JP8A 4L7VA 4X7BA 1WKBA 4I8XA 4WQMA 2J4FA 4CVNA 3SWWA 3EAQA 5IKEA 2BMWA 4MVCA 3ZWCA 3BAZA 2I3AA 1WOYA 4F2GA 3IP1A 3OPYI 2QVXX 4QAJA 5HJ5A 4XB2A 4WZBA 4UUBA 2HW8A 5I3ZA 2BF7A 4U9UA 2FWIA 4JFAA 3W06A 3W5SA 3T5TA 3L4KA 2DSTA 2NZ2A 2C57A 5KX5A 3NAZA 3LMKA 1L5VA 5ENVA 2DFDA 3FLBA 3FJ1A 3GPCA 4RVNA 3SJUA 1B1CA 1OI2A 2VHJA 1LQ2A 1KPIA 2O3JA 4IV5A 4PVCA 1BWQA 2WK1A 3Q3JB 1KIAA 4IDPA 2J41A 1I2AA 5MN6A 2BBTA 3C8UA 1GCOA 2IZ0A 3FFTA 2BFEA 3O8LA 4J0QA 1C3OA 4WCVA 4QDOA 2YZKA 4D9KA 3DZDA 3UZUA 1FYDA 1TUBB 2RBKA 5DH9A 3UT5A 3S68A 1J1UA 2E1RA 5EKUA 4L85A 3W5CA 2BH9A 1T8UA 5I7EA 4Q1VA 3SDBA 2HRBA 3MOSA 2VSNA 4UHHA 1X2BA 2UXCB 2VAXA 5DDIP 3BIXA 2X1LA 4KN6A 3C5HA 5AM2A 4GECA 1GPMA 3EEOA 4DRZA 1MQSA 4JXJA 4PZ0A 5D7BA 1IZ8A 2IUUA 1SMKA 3PA8A 4FUQA 1Z0FA 4U8GA 2FY8A 3SC2B 3EFOB 1T9GR 3MMNA 4FSHA 4PZEA 2PFGA 3LD9A 2ZZKA 3B6EA 3KPVA 3N2IA 4MB6A 1YFZA 4QU0A 4ED9A 3OO0A 1JEEA 1W1WA 4HQKA 1QFZA 1JN0A 4UNNA 1A4RA 4P4SA 4M9SA 3OLQA 1OYVA 3DCYA 4K88A 2HPZA 1Q20A 2C5AA 3QF4B 3ZOZA 1R5NA 3AJEA 4YT2A 1C4KA 1RHRA 3DEHA 3DE5X 1T15A 1KETA 2CFTA 4JB0A 5HRUA 3P32A 3GQVA 3OZGA 1E79D 4X1KA 1BKYA 4KKVA 4ESOA 5DBEX 4L8VA 1Y42X 1QM5A 4G4SO 2ZRIA 1GRCA 1XAHA 1UR5A 4YJFB 5I9TA 5HKAA 3PUVA 1RWOA 1YVUA 1P5RA 1ESNA 1I24A 1M33A 3DVAB 3AIOA 3QF7A 4NZ9A 3RFUA 2JHFA 2PJUA 4BNGA 4C1NA 4L2IA 4EVRA 4ZZ0A 2OXTA 3RVNA 1JAZA 4EO7A 5FNVF 1L4FA 2HPHA 3IXMA 4KGZA 3ROMA 1VYHA 1JDTA 1TQHA 3LO5A 1QONA 2RHLA 4LE2A 2PZKA 4PYQA 1O0SA 5HIKA 2OESA 4XFDA 3WAJA 1TK2A 1UK6A 4L8FA 1NVXQ 3QXHA 3GP8A 4JBYA 2V03A 3BM5A 4AXXA 4RIEA 4KNWA 4ZTBA 4AJJA 1KF0A 5MN5A 1RHQA 3U4MA 3QPAA 2WAOA 1MC8A 3I9V1 4DS3A 3AUTA 1CQPA 1SCJA 5D2CA 1I4WA 1CUGA 3VYRB 1TTHA 1UBUS 2RC6A 4D42A 5BUZA 2Q28A 4RACA 5HUQA 4C2BA 2WB2A 4P6VF 2CYCA 2PUHA 3RYTC 1RXCA 1EWVA 5JI2E 1UWCA 1JSRA 1FFGA 1GGJA 2CDNA 2CB9A 3H2HA 5FOTA 4JL6A 2A9KA 4PYOA 3BMOB 2YJZA 4K03A 3VSDA 2BSQA 4QLBA 1M2VB 4I55F 4RENA 5T8KC 3K96A 4RDIA 1T0JB 4Z7QB 1XF9A 2R60A 5DTMA 2HJSA 4KITB 4XVQA 2JCVA 1O9BA 3EPBB 2V3VA 1O1YA 3LHKA 4MCIA 4WUTA 3HMKA 1SC9A 4Q34A 4UBOA 1EHIA 1GZ6A 4KKXB 1QKJA 4ZI7B 1GNTA 4D4KA 4NPAA 2PJZA 4HAIA 2QRGA 3AHHA 4I9GA 5ALEA 3TFQA 2YY6A 2JJMA 5LP6A 4HEA6 5I9BA 3WLSA 3FSJX 3AO0B 1ZN9A 1A96A 2WTMA 3E7PA 3P2KA 3R74A 2H5IA 4GI3A 2H4YA 2FW6A 1N5IA 1V7CA 1UBEA 3H9BA 3QZUA 4TMZA 5HX7A 4ND8B 1R9MA 1J33A 4X8MA 4D4IA 4X6XA 4WZAA 1Y4ZA 4ZKDA 4C0WA 3NNDA 2DC1A 1NDQA 2ODWA 5JNWA 1HFEL 3S4YA 4HS9A 3P26A 2ID4A 5JRZA 3K6RA 2PCJA 4YGXB 2W9XA 3FGZA 4DXAA 3OLXA 5AVUA 3UWMA 3B51X 2W6CX 1XA4A 1X7WA 4NZYA 3A9CA 2YCLA 2AMJA 3PRKE 1DO2A