1XYGA

X-ray structure of gene product from arabidopsis thaliana at2g19940
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
345
structure length
345
Chain Sequence
KDIRIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQKEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAGRGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative N-acetyl-gamma-glutamyl-phosphate reductase
publication title X-RAY STRUCTURE OF GENE PRODUCT FROM ARABIDOPSIS THALIANA AT2G19940
rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 113
structure length 345
sequence length 345
chains with identical sequence B, C, D
ec nomenclature ec 1.2.1.38: N-acetyl-gamma-glutamyl-phosphate reductase.
pdb deposition date 2004-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1xygA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xygA01
1EBFA 1HDGO 4R5MA 1L1FA 3PWSA 3INTA 3Q3CA 3WYBA 1EUCA 3GY0A 5AXAA 1I2ZA 1W0CA 3DC2A 4L75A 4GX1A 3QJ5A 3KSDO 1XIVA 4A7PA 1HDYA 4MIYA 3GA0A 4CR7A 4FDAA 3FPLA 2NU7A 3EAGA 4BGIA 5KNLA 1Y5MA 3ZDFA 1PL6A 2VRCD 1IE3A 3PGXA 2I65A 2JCYA 4WCFB 5DBGA 5B4VA 3LYLA 4K28A 2NU8A 4LVCA 1R37A 3WSWA 4YRDA 3JQFA 1F8GA 5DCYA 4TZKA 3QE3A 5JC8A 1QMGA 2C7VA 3KYDB 4KWHA 1CEQA 2VRBA 3MOIA 2B37A 4EUFA 1EVYA 3CZRA 3IAHA 1T1RA 4UEKA 6LDHA 1I5RA 4N5LA 5C37A 3DEYX 1ZXLA 5IAAA 2X0NA 2VNAA 4Q3CA 1BHSA 3ZWAA 3SLGA 3W4KA 4YPOA 2VUTA 1QR6A 1NAHA 3MTJA 4MKZA 4O5OA 1EQUA 5G4LA 3SX2A 1U7TA 2NACA 5DOVA 4R4JA 2NV6A 5ER6A 4MINA 1IPEA 3HNPA 3IP3A 2P5UA 3AU8A 5G0SA 4J9VA 4J1SA 4YXFA 5AOVA 1Y6JA 4NU6A 4R1TA 1IYZA 2VT3A 2O3JA 1FK8A 3QWIA 4AFNA 4CV1A 1X0VA 4Y9DA 3VZSA 4WOJA 3UCXA 4KUEA 2RH8A 4LCEA 2FPIA 5A5FA 4ZRNA 1PJ2A 3VH4A 5DULA 2DBZA 1PGOA 5C3MA 1H2HA 3HE3A 2DKNA 4R5HA 1WDLA 2YW9A 3G3EA 4CM6A 3QWBA 2AG5A 3JYOA 3INRA 2FR1A 2J5RA 4OQYA 1E7YA 2VCYA 4NFSA 5FEUA 3QVWA 4W9NA 2C82A 2VUUA 2W98A 4IBOA 1X1EA 4CLRB 3DHNA 4DIOA 4GSKA 1ZK4A 4ND5A 2RHRA 2DBRA 4E21A 3JQCA 3LK7A 4ID9A 3WIEA 3TOZA 4KTTE 5C5IA 5JCJD 1Y9EA 2BGMA 4TVOA 1NFFA 4IDFA 4B7UA 2EV9A 4E13A 3COSA 5AXDA 2OP0A 3AM4A 4BNNA 1BTOA 3DMTA 1KC3A 4NK5A 4IJUA 5AXCA 1SBYA 2EEZA 1WZEA 3F3SA 3M6IA 4RORA 4CJXA 4E4YA 4JXKA 1NQ5A 3UF0A 2X5JO 3QW2A 3ZI0A 2PLAA 1LDEA 2FOIA 4A10A 4BV9A 1FMCA 4RDHA 1YWGO 3L6EA 3RUCA 3GZ4A 1JVBA 1P0CA 4BNUA 4LRSB 4Y6RA 4OSOA 5IG2A 1I24A 5EQFA 1E3LA 2CF6A 3JQAB 3JD4A 1QLHA 1U3TA 2YY7A 2DM6A 1EE9A 4BKUA 2O4CA 1GZ3A 1GEGA 2EHDA 2Z5LA 3D4OA 3M2PA 3PYXA 1VL8A 3SJ7A 3DDNA 1QLJA 4FGWA 5ITVA 5BQFA 1E3EA 3AUUA 1ULSA 4GKVA 4HFMA 3ZU5A 2JD0A 5TS3A 4RDIA 3LLVA 1CF2O 1PJBA 5EESA 1R4NA 2DAPA 3I83A 2P4QA 3PFWO 4FC6A 1VJTA 5BNFA 4R69A 2HDHA 3O38A 5LDHA 3CPSA 3UHAA 3ZNPA 1N7GA 1X7GA 3IDSA 3F46A 3HDHA 1H6AA 1EFKA 1H9BA 3IQDB 2Q46A 3TDKA 1D3AA 1E5QA 4HADA 1PGNA 1LLCA 3C1OA 3W8EA 1LDMA 5JMWA 3E03A 3TJRA 4CLDA 3K6JA 5H82A 3V2UA 3JCZA 1V9LA 1ZKMA 3WYEA 3AUSA 3I9KA 1YH3A 1D4FA 3WQQA 3UW3A 2I67A 3HFSA 1P1FA 3N7UA 1K6XA 4BUCA 4CMGA 1B26A 3L6DA 4NFHA 5JYFA 3JQ7B 4M8SA 4JN6B 2RIRA 5JFOA 3P5SA 2G17A 2ZIZA 3KUXA 4DBVO 1H93A 1DIBA 3QWFA 5CDYA 2GGSA 1BXGA 2HLPA 2WJPA 3ADOA 2GSDA 1GZ4A 4BKRA 4L4XA 5ICSA 5G0WA 1CIVA 2PZLA 4CM5A 4JBGA 4O6VA 1YL6A 1QV7A 3VPXA 4QQRA 5FFFA 1YOVA 3TRIA 3DTTA 4YJGB 2YQ5A 3DQPA 4GX2A 3WWYA 1D7OA 1Q0LA 1HZJA 1RJWA 1EDZA 3FI9A 4PLFA 2X0JA 1Z6ZA 1HETA 2Y1DA 2BD0A 4OKIA 4XR4A 1JWAB 1MXFA 2AG8A 1A72A 2EKPA 1BVRA 1ZSYA 3T4EA 2WE8A 1PL7A 3NT2A 1B7GO 1KYQA 4CMAA 2AEJA 4G81A 2YV3A 2R00C 4CM9A 2QHXA 3RU7A 2B5WA 4D3DA 2ET6A 4KUHA 4M54A 1TT5B 1P1JA 2CD9A 2JFHA 1W4ZA 2HUNA 5LDGA 2GDZA 4PZCA 1S7CA 2Q22A 1PGPA 2J3IA 1XA0A 4R9RA 3KYDA 3AFNA 2D0IA 5G0UA 1MA0A 3DL2A 3PHLA 4PLHA 4N5MA 3W6UA 3VPSA 2VT2A 4LW8A 1BXKA 4EJ0A 3ZWPA 4YRAA 5JDCC 3WQRA 1I2CA 3ZWCA 1WPQA 3GPIA 4ND4A 3WBBA 3LVFO 3RVDA 3FBTA 2CNBA 4XRRA 3AI2A 1I8TA 1T2EA 2HK9A 4XGIA 2CVZA 2XXJA 9LDTA 3ZWNA 1J0XO 1W73A 4JK3A 4DLLA 2VHWA 2NQTA 1SOWA 4O1MA 2Y1FA 5JDIC 2JKVA 4MP6A 3O8QA 4E5PA 3AI3A 1SEPA 4B7CA 1LDGA 1V0JA 2QRJA 1MFPA 4U6QA 3L0DA 3QVSA 3GG2A 1GYQA 2H5LA 4MVJI 2WYWA 1EFLA 2QW8A 4EJ6A 2Q2WA 3A4VA 4J1NA 2EP5A 4F6CA 1WP4A 5KTKA 2AEMA 2OZPA 3OEWA 1GL3A 2I3GA 1GUZA 1ZJZA 1YB5A 2I76A 4HUJA 3U62A 3ASUA 1Y8RB 2Q3EA 2UUOA 5A3JA 5L95A 2CF5A 4YACA 3ETDA 1CQJA 4DIBA 4FN4A 4CM8A 3Q9UA 3V1TC 3JQ9A 3CUKA 4XYEA 3CMMA 2GLXA 2O50A 3VHRA 1T4DA 1PX0A 1ONNA 3ANNA 1W8DA 3NEPX 4FGSA 3OQ6A 2DUUA 1X0XA 1ZO8A 1T2DA 3MJCA 3PK0A 5MGBA 5M6DA 2OMEA 1E6WA 2I6TA 3VDRA 4CL8A 3K73O 1HRDA 1U5CA 2YZ7A 4BKQA 1ENYA 1UXHA 5AYVA 5GZ6A 1EUZA 3QVTA 2PY6A 3NDJA 1NR7A 1HKUA 2FZEA 3DZFA 3VKVA 1UDBA 4MDHA 2ZK7A 3OJEA 4RPJA 4B8ZA 4OO3A 4BVAA 4E30A 3DO5A 2DTDA 3H3JA 2CDAA 4YJDA 1H2BA 1TVEA 3WGQA 1DAOA 3CKYA 4RF5A 5DCWA 1EK5A 3UKOA 4J43A 4CUJA 3F1LA 1B16A 4FFNA 3B70A 5I7FA 1UXKA 4M1QA 5T73A 3HUDA 4OH1A 3I5MA 1KIFA 1WXDA 5IXSA 4NIMA 5TRTA 3U09A 2JCVA 1UXIA 1LXCA 1DJQA 4QX6A 3H9JA 1ZSVA 3JQGA 3U5TA 1BRMA 3PGJA 1JWBB 5IDXA 4J4TA 1FF9A 2HMVA 4XRGA 1E5LA 3I4CA 1VPDA 4I9HA 4WKGA 4ALLA 2E49A 1Q7GA 3DOCA 3GVIA 1K89A 2WYVA 1ENPA 5HS6A 4UVEA 1OMOA 5KIAA 2WEKA 3ABIA 1E0DA 5KVCA 1V3UA 3D3EA 1YQDA 1YONA 4R9SA 4GI2A 1Q7BA 3JQ8B 3CSDA 1LLDA 1ZEJA 3MJTA 4HNHA 4D3FA 4LGVA 1JU9A 1DC6A 3TSCA 2VOEA 1X7HA 3CE6A 4HFRA 5CG1A 3PIDA 1YGYA 3E9QA 3UH1A 1B3BA 1HDZA 4UVHA 1K2WA 3IP1A 2YFHA 3W8DA 1UP4A 1N9GA 3ADPA 1XDWA 1NFRA 4DREA 2NSDA 1DHTA 1XG5A 3OFSA 1JKFA 3EC7A 1PZGA 2OXIA 3V1UA 3ZWVA 5L51A 2QQ5A 2HRBA 2W4QA 2Y05A 3JQ7A 4DRYA 1ENZA 4F45A 2PH5A 4HY3A 4BQRA 1LJ8A 3BAZA 1GAEO 4XYLA 1DC5A 3SJUA 1HYEA 3GVHA 4JP2A 4AJEA 2NTNA 3GFGA 4ZICA 4QXMA 2Q99A 5U4QA 2Y99A 4C4OA 3Q11A 3E5MA 5C7OO 4XIJA 4YJGA 5JXWA 1B14A 1MV8A 3LT1A 3B1JA 5THQA 4MO2A 2F1KA 3QWAA 4II3A 2IODA 2UDPA 3WR5A 1ID1A 4BQPA 2PV7A 4NBVA 4RVGA 1YL5A 2B4TO 4MVJG 5DBFA 4EGFA 1L7DA 3I4FA 4XZ3A 3VTFA 1E7RA 4GBJA 3E8XA 1I01A 3OIDA 3Q9NA 3TFQA 2IXAA 4ILKA 3P2OA 4JJIA 3LT2A 2NVWA 4XYMA 3DBRA 4IDGA 2IRWA 4J0FA 5AQ1A 3G1TA 2WMDA 1P1KA 4FOSA 1PZEA 4D0RA 1NXQA 3L4BC 3O4RA 1GDHA 1T24A 3A1NA 4B3HA 2X7HA 4IQ0A 4D44A 4EUHA 1QYDA 5CEEA 3PQFA 4I9NA 1N1EA 1G0OA 1UAYA 4PG6A 1U1IA 5TJHA 4MOWA 3PFFA 1YXMA 4I9UA 1U7HA 3H2SA 3RC7A 1IULA 3ZU3A 4RLSA 1LDYA 4IJKA 3WGYA 3L07A 3GNQA 4PG7A 4BMNA 4BO2A 1NPYA 1ARZA 1KEVA 2X22A 4MP3A 4EEXA 5CPBA 3P2YA 4I8XA 4HP8A 3ASVA 3H9GA 3NT5A 2OORA 2ZQYA 4NG5A 4YVFA 1HYHA 1DFHA 3PQEA 1EMDA 4UAGA 4YT4A 4E12A 1MG5A 4K6FA 4YTEA 4BNYA 4Z3DA 3X2FA 4R01A 4YA6A 3EUWA 1ZK2A 3RFTA 3PIIA 4Q3BA 4WASA 3U4HA 3DZGA 1K5HA 3JQAD 3RUFA 3M1LA 4QSMA 4N5NA 3T7CA 3ZWWA 4TRNA 3RUDA 9LDBA 3ROKA 2HSDA 2HK8A 5ILGA 3H4VA 4CV2A 1VL6A 2HMTA 1E77A 1ONPA 3HWRA 4ZQEA 4JIGA 1Q0QA 1NHWA 4NBUA 2C29D 2NU9A 5I7VA 3TQHA 5TNXA 3VVCA 2G5CA 4LCJA 4D41A 2GUGA 1O94A 3H8VA 2BGLA 1JTVA 2W2LD 1I30A 4JQCA 5U1PA 4FFLA 1WNTA 4B7XA 3HB4X 1RM0A 3FR7A 5CEJA 4AJKA 2DBQA 2VZ8A 2IZZA 4KDFA 1PJTA 4J1QA 1MB4A 4BGUA 1CQIA 2ZYDA 4CMEC 3X2EA 1P3DA 2ZCVA 1M6HA 2IEDA 1HDCA 4BNZA 4Q39A 5I9LA 1PR3A 1P74A 4EYEA 3RKRA 2JL1A 1WAMA 4FIZA 1I2BA 4BV8A 2Y0CA 3OICA 3GN1A 2VQ3A 3FNFA 5DZSA 1VSVA 4IY1A 3KLMX 4J7UA 1YL7A 4LVUA 3JD0A 8ADHA 3A14A 1ISIA 2VN8A 3P19A 4IXWA 4ZGWA 1KY4A 2BFOA 3WFJA 1H94A 4R51A 1YBMA 2A4KA 3INGA 3VPHA 4RPGA 1OC4A 5TLSA 2EGHA 3EK2A 5HS4A 1X1TA 2G82A 1DAPA 3Q6IA 2HQ1A 5FI5A 4B4WA 1C3VA 1NPTO 4PG4A 5BSEA 3TF5A 1NVMB 3BZUA 4AJ4A 2ZYGA 4IM7A 5EL0A 4BNMA 4RLHA 2OBYA 1L7EA 4W6ZA 4NNJA 4NBRA 3D4NA 4J7XA 3ZH2A 4GQAA 3RUHA 3W4JA 3KYCA 4WNCA 3O03A 5KJEA 2Y0DA 4YBZA 2UUPA 5JAQA 3VDQA 4CLXA 4I5EA 2PD4A 3TNLA 3PJEA 4NJMA 3D5QA 3KEOA 2Y68A 3ZV4A 3HG7A 3C7DB 1ZH8A 1BXGB 4BGEA 1SB8A 3VC7A 2P2SA 1XQ6A 5LCXA 1IOLA 5IDWA 3PYLA 3DTYA 3LZ6A 3S2EA 1HTBA 1YOVB 2PH3A 2GZ1A 3HQ4O 1VL0A 2GR9A 3FBGA 4XGKA 4FQ8A 1QYWA 2A9FA 3BMCA 5I9MA 3JD2A 4AJJA 1ZMOA 4H16A 4WJZA 2GZ3A 1SZJG 2SCUA 3S8MA 3ZGYA 2V7PA 1R66A 3LDHA 1PZHA 3C1TA 1AN9A 4QFCA 3F5SA 2C20A 4BNVA 4KDEA 3GF4A 1YQGA 2X0IA 4M86A 3KOUA 4BOYA 4YEDA 2VYNA 1O8CA 4YT2A 2Q1WA 4FFMA 1Z75A 3GEDA 2NVUA 1JAXA 4IMRA 2IZ0A 3PLNA 2GD1O 3LC7O 2QZZA 2R00A 3VZRA 1TT7A 1E7WA 2DPHA 3OF2A 5BSGA 2BELA 1QORA 1DXYA 1VC2A 3OJLA 2PTGA 4QEDA 5A03A 1Y1PA 4I5GA 1IB6A 1GU7A 3PJDA 1R12A 1ISHA 3GQVA 4OGWA 1WDMA 1YB4A 4J6FA 1F12A 2O2YA 3LSYA 4GLLA 1JKJA 2HCTA 2QYTA 1DOHA 4GAEA 4OKNA 3RKUA 4MVJP 4YYZA 1U3VA 4XJTA 5IN4A 5L40A 1C0KA 2Q2VA 5CHEA 5K6AC 4JJFA 5JDCA 2OGUA 2YFQA 3O8QB 3PWKA 4UEJA 3TZQA 2OBNA 3WGOA 1XQ1A 4FD3A 2H63A 2D2IA 4NBTA 3DOJA 1PGJA 3RWBA 5JDIA 4CR8A 1TB4A 2H9IA 4ITUA 5JC1A 4UULA 4MVJH 3BXXA 1KC1A 4GL4A 1I3MA 1ADCA 5THKA 2AQ8A 3AM5A 1W6UA 1GD1O 1A5ZA 4XX0A 4E5KA 3WGTA 2IYPA 5I9NA 1PEDA 2AXQA 4EUEA 1I3NA 1E3WB 4GX0A 4FFPA 4CM8B 2G1UA 4P4NA 3L9WA 5L3ZA 1C0PA 5COAA 1O89A 4P8RA 4XGNA 3IMFA 4OJNA 2GYYA 3EVNA 3FR8A 4HWKA 4BNJA 3OJFA 2EP7A 3E1KA 3Q2IA 4IDEA 5A1TA 5BSFA 2GZ2A 4FJ2A 2JAPA 2XXBA 4RGBA 5A04A 4WNIA 1P0FA 5C7LO 2I3AA 2I99A 4DXHA 4NK4A 4CUZA 3E48A 2ZB3A 1NP3A 2JFGA 3JYQA 5CDUA 5JY1A 4R1NA 2D59A 3FWNA 5B4TA 3GVXA 5EINA 2B4QA 1RYDA 2CZCA 4ND3A 1YS4A 5IFLA 2PD6A 4FFOA 2RHCA 2PZKA 1ISJA 3NJ8A 1N7HA 2O3QA 3ONEA 1B15A 3K2BA 1BMDA 4XR9A 3AUTA 4M89A 5T6BA 1AE1A 4XB2A 3HB5X 3SXPA 4E0BA 1LU9A 2VNSA 4UVIA 2C7GA 4Q3EA 1C1XA 1IHXA 4Z9XA 4WUVA 4DC0A 3KZVA 3MCVA 4N18A 2VWHA 3JQGB 4UUOA 2YHUA 1PWXA 3KV3O 3ROQA 1H9AA 3Q0EA 1SOVA 3QWHA 4ZVVA 1LC0A 3WGZA 2O23A 2CVOA 4BO0A 1ZSNA 1RM5A 5DP1A 3D64A 4IDBA 3G49A 1DO8A 5ILOA 3DONA 3KBOA 3NTOA 1IZ9A 4GGPA 4CM3A 4FCCA 3LQFA 4U7WA 3QSGA 1ZW1A 3NTRA 2AEFA 3FTNA 5F21A 1UP6A 1EK6A 3ITDA 2O48X 3H3FA 1EDOA 4PFJA 3O9ZA 2Y1GA 4YQYA 4FSHA 4MVJF 3B20A 5CAEA 4WECA 1YO6A 1N9GB 1PWZA 3GT0A 5B1YA 3VPFA 1TLTA 3CMCO 1B8PA 1XHLA 5JS6A 4HFNA 2DPGA 5ICMA 1QV6A 3VVBA 2O2SA 2ZKLA 4L73A 1KVTA 5IZ4A 1HE5A 3JQ6A 3ROPA 3S2GA 4IZIA 4R1SA 1KBZA 4DQXA 3A9WA 4XD2A 4DLBA 3RFXA 1B8VA 2YHIA 2FR8A 2UAGA 2PGDA 4CM7A 3ROMA 1V8BA 1GQYA 2ZTVA 2DFVA 1BW9A 3D1LA 1Y8QB 1LSOA 2C5EA 1NWCA 4CM4B 4LISA 1GPDG 1A9ZA 1H0KA 1B2LA 5I8WA 2B5VA 4IPTA 2Z1NA 4EITA 5FWNA 2GRAA 5L7TA 4H15A 4KMSA 4HXYA 3PHIA 2YUTA 3W6ZA 2Q50A 5A4DA 4D7AA 3ZW8A 3ENNA 4RCVA 2X0RA 3G17A 5A02A 4YJHA 3QQPA 4OAQA 1JKIA 4OM8A 5HA5A 3S55A 4NQZA 1MUUA 3DBRB 2BGKA 4ZD6A 1V3TA 4PLGA 1P1RA 3MJSA 4W82A 1M76A 1T2AA 5CEFA 3GMDA 4D79A 1X14A 3HADA 2JD2A 3A06A 4J4HA 1SAYA 3IL2A 3JQBC 3ZV5A 4II2A 3EMKA 3MWEB 2PR2A 1AGNA 4KTVE 5JAIA 3WGHA 1U3UA 4CMIA 3DBHA 4PLTA 1XEAA 5AVOA 1WW8A 1BVUA 2FPPA 2G0TA 2B0JA 4I1IA 3DZKA 4G5HA 5G0TA 1VKOA 4L9RA 2ZCUA 1AXEA 3L4BA 3PRJA 4JBHA 1DIRA 2WD7B 1VE9A 5ES3A 3NAQA 5KJ1A 4M55A 5TC4A 1G6KA 4AJOA 4R1UA 1K3TA 1O0SA 4X54A 1XKQA 2CVQA 2BFAA 3OP4A 3HDYA 1ENOA 1ZK0A 5F5NA 2EXXA 3V5NA 3FF4A 3V2GA 5L9AA 2IDZA 3MJ4A 4N54A 1D8AA 1LQUA 4FOOA 4WLVA 4XYBA 4BNGA 1AUPA 3ZU2A 4F46A 5DNAA 2O3SA 3AOGA 4BB5A 3ZNOA 1KEPA 3WLFA 4DTIA 2CY0A 2DTXA 1Y7TA 3RROA 3I6IA 2DVMA 1VRWA 4B4OA 4IS3A 4Y67A 4O63O 3C24A 3DZIA 2E4AA 5HRUA 2YDXA 1TA4A 1Q2XA 2EJWA 5F1OA 2BMAA 2UV8A 3GNTA 1RM4A 5JE8A 4IUYA 3ZWMA 1B3RA 3DZBA 3KTDA 2C54A 2J3JA 4PVDA 4CLHA 5DBIA 1A4UA 3M1AA 1E3WA 1JN0A 3UUWA 1V3VA 2P91A 2F00A 4E31A 5ADHA 5HM8A 3D5TA 4A03A 5KWEA 2C2YA 3RBZA 3F1KA 4RVDA 2C5AA 3OIGA 4R54A 4PIVA 2EF1A 4IQ8A 4FJ1A 3EVTA 5CDSA 3M2TA 2QZ9A 1KY5A 4HV4A 2FP4A 1Q0HA 3HJAA 2GN6A 4CODB 1EVJA 2GN8A 4U5QA 2PZMA 1GY8A 5DCUA 4DYVA 4PLCA 1HT0A 4BMVA 1DC3A 1J6UA 3IKVA 1U4OA 1JDJA 3I23A 3R3JA 4P4LA 4GMFA 3GRPA 2EG9A 1HDRA 1UR5A 4PZDA 1KVRA 5J23A 3PZBA 1AHHA 1YB1A 3GDOA 1PJSA 1ZJYA 3JYNA 1LSSA 3R6DA 3I52A 3RFVA 3VKUA 4BNHA 4TMFA 1B0AA 3UFXA 3AM3A 1RKXA 3D3WA 1U8FO 3D4PA 4LMRA 4BB6A 7MDHA 3ZV3A 2DT5A 4XIYA 4ALIA 1LBEA 2J3HA 3KYBA 4WCDA 3HZZA 3NUGA 3FHLA 2RH4A 3UXYA 1Z82A 5KVVA 1NX6A 2CDBA 3IIEA 4YAIA 1CDOA 4I5DA 3DHYA 3C7CB 4C7JA 4YAKA 4OOEA 4ZQGA 3C85A 1R0LA 1YQXA 2Y66A 1ZIDA 2OOSA 1DSSG 2POQX 4IIVA 1RPNA 3FPCA 3GC6A 4K26A 3ZWXA 4ROSA 4NJOA 4DC1A 4E33A 4CM9D 3KYCB 5FYDA 2GPTA 4E2WA 4GLOA 1QG6A 4W4TA 3I9MA 2EGGA 3T7EA 4NJMB 5ENDA 1DBVO 4CMBA 3H5NA 4JX8A 1UDCA 1PGQA 2YV2A 4BO5A 4L0QA 5FI3A 4ZQFA 3WLEA 5JO9A 1GUFA 4BNXA 2HAEA 3HN7A 1HZZA 3OH8A 5FF9A 3BTOA 3ZNNA 2XAAA 1JA9A 3IUPA 2ZB7A 4RO0A 5L4LA 3BMCB 4BKOA 4BMSA 3C1AA 2CMDA 3JTMA 4M49A 4BHTA 2WYUA 4UUNA 3AOEC 3NYWA 4QECA 5IXYA 1QXSA 3GGGA 2AQKA 2J8ZA 4QFDA 1CRWG 3QP9A 1RWBA 1FJHA 3EZLA 3VZPA 5A9SB 1Z73A 5IZCC 3NTQA 2OFPA 3SBOA 1PS9A 3NGLA 3AY6A 4R3NA 4J49A 2Q45A 4CMCA 2JD1A 3IJRA 5K9ZA 2NADA 1LUAA 4IZHA 5TX7A 1HYGA 2VTEA 3BMNB 2NVUB 1R0KA 3N58A 4CUKA 1F0YA 2AE1A 2V6BA 4DQUA 4XYGA 4AG3A 4Z6KA 1Y8QA 2ZTLA 3FN4A 4BO1A 4INAA 4CM4A 1NFQA 4WPGA 4TRMA 4CPDA 4E6PA 2A94A 4DQVA 5IDQA 4H3VA 1UZNA 4L4RA 3ZHBA 1ISFA 2JCXA 1ZUD1 3IOYA 3ZHZA 2PFGA 3PLRA 4YDRA 1EVZA 4MKXA 1Q7CA 3ZN2A 4WGGA 1M67A 1GUYA 1RYEA 4RZIA 1K0UA 4GGOA 1PQWA 3I6QA 1HLDA 3IS3A 5DOZA 2B83A 3KVOA 1V35A 3ORFA 1LLQA 3VPGA 4WCFC 2VTDA 3RUAA 1N2SA 3ST7A 1YBVA 3H5AA 2BI8A 3IJPA 4BO4A 3PHHA 1E1KA 1XYGA 4IJWA 2DLDA 1U4SA 1PJLA 1NHGA 4PRKA 3IC5A 2AE2A 5K6AA 4UUPA 3OBBA 1T25A 3GMSA 3K92A 2UVDA 5KCZA 5TSDA 2V65A 1IZ0A 3W4IA 1QSGA 2WD7A 3I9OA 2V6FA 1I3KA 4PLWA 5GMOA 3QHAA 5KJ6A 1YVEI 3EY4A 1LTHR 2NNLD 2AQHA 2PK3A 8LDHA 3ON5A 4TZTA 5I8ZA 1MGOA 3BA1A 4LMPA 5HBRA 2FWMX 3WG9A 4FS3A 1ISGA 5JCXA 5A06A 2O3TA 4XDYA 2JJYA 1ZEMA 1MX3A 4KQXA 4BO8A 1HDXA 1P33A 3S2FA 1SCUA 5JSFA 4ONEA 2O3RA 1ZCJA 5DF1A 1T2FA 1Q1NA 4GSLA 4IGEA 3MWDB 2VRCA 4IQGA 3RIHA 2J5KA 4YJFA 3QV1A 3ENKA 3Q1LA 4U0KA 4ZQHA 2X5KO 2GN9A 1VI2A 4CR6A 5T64A 1KVUA 1I32A 3JQDA 4MIEA 3U4IA 1U5AA 1DLIA 2ZJ0A 3CIFA 2W90A 5HWSA 1G1AA 4S3MA 3NJ4A 3STHA 1SO8A 3JV7A 3AY7A 4RZHA 2Q49A 4JNKA 1NR1A 3SLKA 2H6EA 4UREA 4BNWA 1I33A 3CH6A 3H6KA 4NI5A 4GWGA 1C1XB 3B6ZA 3RBVA 3HHPA 3TL2A 1DRVA 1ADGA 1J49A 4MJLA 1F06A 1KERA 3ETEA 1LSUA 2BF7A 3I9JA 2FPGA 2DU8A 4NFYA 3AUAA 2W8ZA 1NTOA 1HSZA 3DB2A 2C2XA 4D0SA 4NDNE 1A4IA 5CDTA 1O9BA 2BI7A 1PSDA 4RQTA 2LDBA 4JP3A 5T67A 3PJGA 1HEUA 2FZWA 3OECA 3PXXA 2ZQZA 1E6UA 1P31A 3H7AA 3PDUA 4RVHA 2C07A 2YYYA 3V8BA 2OO5A 3GR6A 4GWKA 3QVOA 1YKFA 3GRKA 1N8KA 4UVDA 5B12A 4RF3A 3BTUA 4D46A 4OXKA 2QG4A 4ZHSA 1GV1A 1PS8A 3E9NA 2VOJA 5DN9A 4EI2A 4FW8A 1QYXA 3WYCA 1Z45A 2EERA 2FSVA 5BNIA 5F1PA 2V6MA 2RCYA 1BSVA 4W99A 2A35A 4WK6A 3OHSX 5GZ3A 3QLJA 3ZCXA 5K0ZA 3BYZA 3WICA 5ITWA 5L53A 3TL3A 5JMPA 4A5OA 3A28A 1E92A 4OIMA 2XF8A 1KEWA 4WLNA 2C0CA 2J6IA 1S6YA 3S2IA 4DYDA 1P1HA 3H9UA 5IN5A 3WDSA 4L76A 5TJ9A 2Y1CA 3GNSA 3GAFA 1WDKA 3ZHYA 1GCUA 3UCFA 3OQ1A 3L6OO 3WB9A 2JFFA 2QX7A 4JGBA 3D0OA 4E2XA 1OOEA 1FDTA 1CERA 2PNFA 4BS9A 3ZNQA 1GCOA 1OFGA 1U2DA 2YHIB 4JBIA 1H6BA 1UUFA 1OC2A 4DIFA 1XELA 5EMHA 3GGOA 4IDAA 3ZW9A 1BW9B 3KHUA 1NASA 1A71A 1FDSA 3D7LA 2GNAA 3LT0A 1P9LA 1MC5A 4S1VA 3NT4A 4RJTA 3OSUA 4GMGA 3Q2KA 4BO9A 2CUKA 4FBGA 4PRLA 2O4UX 1GFSA 1C14A 4FB5A 2IZ1A 4J7CA 1PJ3A 1U3WA 3O26A 4LRTB 1GYRA 4J3FA 4PLZA 5A9SA 1ZVMA 3VH2A 3GDGA 4YJHB 2JHFA 5AXBA 4EZBA 1DRWA 1ZXBA 1D1SA 3T4XA 1R6DA 4CV0A 2IEBA 2DC1A 3KEQA 2OHXA 2DQ4A 3RSHA 3R1IA 1AHIA 1R0SA 5EQDA 2IXBA 5BNTA 2B4RO 2GO1A 5BSHA 3BMNA 4TRRA 1WVGA 1HSOA 1YJQA 1T4BA 4B4UA 3F5QA 1K6IA 5LC1A 1NNUA 4MVJE 5G4KA 1LRLA 5B37A 4Z0TA 4WE3A 4DWVA 3L9XA 3OEYA 5CP8A 4URFA 4CMIB 4E2YA 3DBHB 1F8FA 2Z1MA 1TEHA 3BHJA 3ZU4A 2P5YA 3GAZA 4PG5A 4ND2A 1QKIA 4YCAA 2VWGA 3JQBA 1WWKA 3RU9A 5JLAA 3RI3A 3U4DA 4E32A 1LEHA 3GG9A 4Z0HO 4BNTA 2BFMA 4YAEA 3ZWBA 4BNIA 4IINA 4K6CA 1NPDA 4E2ZA 1HLPA 1JQBA 1BDMA 1QRRA 3U4CA 1GADO 4OMUA 1HL3A 3WSVA 2XPCA 2WSBA 3MJEA 3H9EO 4UVGA 3I9NA 4YRBA 3C8MA 2AHRA 4UUMA 4GVLA 2YDYA 4CMJA 4R16A 5JBIA 3RBXA 1O95A 4HNGA 5U9CA 5KOIA 4R41A 3AWDA 2NUAA 2ILTA 4PVCA 1KVQA 3FNGA 2IE0A 1NM5A 3KXDA 4TRJA 4Z9FA 4CM1A 1GTMA 3NGXA 2HMSA 1BXZA 1C0IA 2PKQP 2VZ9A 3K9QO 3GVPA 2OP1A 5L4NA 4CLOB 5L7WA 4RVFA 3CINA 2V6GA 4K9DA 4PGFA 2VHXA 1Y5RA 1ZMTA 3RASA 4CQMA 1RM3A 3KSUA 2WWRA 3LLSA 2PGJA 3B1KA 5J9GA 7ADHA 1Z7EA 3K31A 4IDDA 3RQSA 2WDZA 3HDJA 1IL0A 2BRUA 4TKLA 3OA0A 4IMPA 4PLYA 3VH1A 2NTVA 1PQPA 1QYVA 5JNLA 3HSKA 4FR5A 4LSWA 5T5QA 3GK3A 2ZATA 3VAZA 3EDMA 3WTCA 5GZ1A 1QYCA 3UCEA 4YAJA 4QUKA 2FY8A 2X23A 1MFZA 4BNFA 4FC7A 1ONOA 1YE3A 2P68A 3CXRA 3CZMA 4Y98A 1P77A 3C3XA 4W7HA 4J2OA 2HMWA 3FNHA 3BMOA 2X8LA 1GEEA 3D3WB 1YRLA 4IDCA 1Z7BA 3GZNA 3TFOA 4K1LA 4WOKA 1GQQA 3JYPA 4U0JA 1R16A 1EVIA 4DUPA 1WMBA 4QT0A 5JAZA 3PZRA 4P22A 3CEAA 1BG6A 3F4BA 4JCOA 1R4MB 4M87A 2ZTMA 3ETGA 4G65A 1LX6A 4P38A 1EUDA 4RPLA 5A9TA 3DWFA 5TQVA 3ICPA 3ULKA 1A9YA 3E6AA 1I0ZA 5COQA 2FSSA 1J4AA 3L4SO 4J16A 2GASA 1KVSA 1CWUA 3ZWOA 5EJ2A 4J0EA 4NHEA 4Y6PA 4YT5A 4IJVA 1F14A 2X4GA 2I9PA 2EW8A 3NRCA 4NZ9A 1PZFA 5BT9A 1JW9B 3KLPX 3BTVA 1U9JA 2FR0A 4Q3AA 4A73A 4DA9A 4HFJA 4BO6A 3EZYA 1O5IA 2O7QA 4L74A 3UVEA 1GPJA 4AJIA 1UZMA 2VYND 3WWZA 2Q1UA 3RUIA 5JYDA 3DZJA 4O59O 2NLOA 1KETA 4BO7A 1GR0A 2Y1OA 3U0BA 1MLDA 3GN2A 5KJCA 4IIUA 1E1NA 5CG2A 3FD8A 1PR9A 4XJSA 4ZRMA 2DFDA 3GEGA 2GF2A 1A7KA 1DIAA 2GERA 4BKPA 1JAYA 1UJMA 1ADBA 1WMAA 1P1IA 1WZIA 2A92A 2P9EA 3LC2O 1I36A 5T57A 1X7DA 4D42A 3ANMA 3SVTA 2ZYAA 4J2HA 1OZAA 4KZPA 3U9LA 3DBVO 3PPIA 4JJGA 1EZ4A 3UICA 1ML3A 1PU2A 4F3YA 4RPHA 4U8GA 1O6ZA 1DRUA 2VHYA 1D1TA 4TVBA 2Z95A 5T8KC 3PVZA 4UEOA 3MEQA 1N92A 2H1SA 2HRZA 3AOEA 4PLPA 1KS9A 1HF3A 1PL8A 3NV9A 1NQAO 4FPXA 3AI1A 1ZFNA 2CDCA 3VZQA 5IZCA 4DPLA 3MTGA 2VHZA 1HE4A 4BNKA 3BTSA 2C59A 1HXHA 3H65A 3WMWA 3WNVA 4A26A 4AJNA 1XR3A 1UXJA 4WLEA 3TZ6A 1F17A 3WJAA 5CFZA 3S1LA 1TI7A 1FDWA 5EPOA 4B3IA 4E5MA 1YDWA 2EJVA 3GDFA 4E5YA 3GUCA 4XB1A 4TKMA 4XCVA 3OQBA 4TWRA 1U2GA 4BGVA 4CQLA 3QA9A 4YWJA 1C1DB 1FXSA 1NAIA 2Y1EA 3RAJA 1LDNA 4CQMD 4JLWA 3BHMA 3VOSA 4NPCA 3U49A 5EIOA 4QO8A 2G76A 3QVXA 4H7PA 4QTZA 4B8WA 4MKRA 1E3IA 1DFIA 4EDFA 3DFUA 3JQFC 1CYDA 2E6UX 2CFCA 5C7IO 1ADFA 1SC6A 1VJ1A 4AJHA 3C7AA 4MIOA 3UOGA 2AMFA 5JW6A 3DXFA 2ZJ1A 3DZHA 2NTJA 4WCFA 2GN4A 5IDYA 4YT8A 4RPKA 6ADHA 1H5QA 2UYYA 2PZJA 2NM0A 3KO8A 2W2KB 4WLFA 2D8AA 4WLUA 1LI4A 2D1YA 3GPDG 2X9NA 3FWZA 3H5RA 1ZBQA 3LU1A 4GKBA 4RF4A 5TF4A 3RJ5A 3WFIA 2R6JA 3MZ0A 2X9VA 1DIHA 3LC1O 3RCBA 2WE7A 3VTZA 1K6JA 1T2CA 2X9GA 4IS2A 2Q1SA 4YB8A 1NVTA 3PYMA 3AY3A 4TROA 4F6LA 2WM3A 1DC4A 2HKIA 3H9QA 2Y0EA 1PS0A 5I7EA 1U28A 2VHVA 2BHLA 4R68A 5MDHA 2O7SA 4BIIA 4YAGA 4AJLA 1KOLA 2D5CA 5H81A 1NYTA 3LT4A 3OMLA 4ALJA 1LRKA 4YJFB 1YJ8A 3DMYA 2FRDA 2BKAA 5JY6A 5CPFA 3EW7A 3ANLA 3GFBA 3PQDA 1NVGA 1OAAA 4MP8A 2XOXA 3BIOA 1IY8A 1J5PA 4PN3A 4CLOA 5L4SA 3NDRA 4CMHA 1P45A 4J90A 5F1KA 2HU2A 4HBGA 4WLOA 1VM6A 5CDGA 3N74A 1LRJA 1XU9A 5JYEA 1C0LA 4W9NC 2X1HA 5DT9A 4Y6SA 1UH5A 2YQ4A 1XU7A 4DGSA 3WGIA 5GY7A 3FCOA 2AQIA 4OXNA 5KJFA 3RD5A 3HN2A 3EYWA 3PP8A 4A27A 3B1FA 3IUSA 1DEHA 4ND1A 4AJ2A 3AW9A 4CL3A 4CLRA 2BLLA 4CMEA 4XQGA 3BMQB 2EIHA 4J1TA 1PJ4A 3DMTC 2P9GA 2WD8A 3NKLA 4OL9A 4AVYA 4BL5A 2J5QA 2OUIA 2YJZA 3WX0A 2JHGA 1PQUA 1N5DA 3WGGA 2FN7A 4YR9A 2BH9A 2E37A 3JQEA 2JAHA 1IUKA 4IGFA 2VYVA 1E7QA 1H6DA 4RV9A 4KWIA 4ZA2A 4QO7A 4W7IA 1GV0A 1R4MA 4L4SA 4E3ZA 2DTEA 4WEOA 3F47A 3WQSB 5KVSA 1V6AA 2PKRA 3KRTA 3TOXA 4GPD1 4J91A 4HX5A 1JLLA 1OI7A 1UXGA 4DPKA 3DBLB 2DUWA 5JYAA 3JD1A 1LLUA 1DJNA 1E1MA 1DFGA 4O0LA 1U8XX 3GLQA 4XEHA 3W8FA 3AFMA 4PZEA 4OYRA 4OSPA 4DL9A 5KKCA 2EKQA 1Y81A 3P7MA 4PCVA 3RC2A 3OIFA 2QRKA 2P4HX 3UGKA 4CV3A 4XKJA 3PDJA 1ORRA 1T26A 4ZU3A 1GYPA 1X13A 3JQAA 4DMMA 5JAMA 2X58A 3PI7A 3GUYA 3RJ9A 4JROA 3R0IA 3DAGA 4FFRA 1I10A 4P4GA 3F4LA 1HE2A 2GCGA 3WTBA 3JYLA 3KSZO 5B4UA 4EW6A 5EERA 1SNYA 4ZN6A 1GQ2A 2DBVO 3F9IA 2HK7A 1ULUA 2W2LA 2ZB8A 1XLTA 3V1YA 1EQ2A 3K30A 1SB9A 4EJMA 4EBFA 1VKNA 4BO3A 4MVJA 2PGLA 4ESOA 1M75A 2I66A 5JO0A 3WNQA 1E7SA 3K5PA 3OA2A 2PA3A 1E3JA 3JD3A 3GGPA 4DPMA 1BWSA 3EGOA 1LSJA 2PD3A 1CJCA 5G4KB 3ZHXA 3R3SA 3PHGA 2NQ8A 1I3LA 3QIVA 3KETA 1VSUA 3E82A 2HJSA 2J3KA 4XWYA 3WIDA 3U3XA 2HO5A 4OOFA 1EE2A 4NU5A 4XA8A 4G2NA 4OQZA 1FDVA 3GHHA 4XQ9A 4GVXA 4AJPA 1LA2A 1VLLA 2D3TA 3TZKA 5H83A 4XDZA 4A0SA 1GZ6A 1IHYA 4Z3KA 3LF2A 3TN7A 3OJ0A 1ZK1A 3WBFA 3DOOA 3WS7A 1C1DA 5TT0A 3QY9A 3DHEA 2O3UA 2RBEA 1WLYA 2X6TA 4LN1A 1ZNQO 3TZHA 3ZWYA 4B79A 2WTBA 3LF1A 5L45A 3MOGA 4NMHA 4FJ0A 4B4VA 4DMLA 2VUSA 3WXBA 2FMUA 4EEZA 2E48A 2Q1TA 3G79A 5A5EA 3RC9A 2AA3A 3E5RA 4N7RA 5IJZA 3TPCA 4R3WA 4DLAA 1TT5A 2EWMA 1X15A 2W2KA 3GHYA 1YBAA 1NWHA 2NU6A 3F6YA 3G1UA 3BHIA 3OJOA 1LQTA 3ONFA 1SEVA 4HKTA 1UZLA 4Z9YA 4D3SA 4YQZA 3HFGA 4Z0PA 4ALMA 4ZJUA 4OXYA 3K2EA 4PG8A 1MC4A 3DAFA 4U6SA 4RVSA 4CQMB 1M66A 1TXGA 2PKQO 2VYVD 1DDOA 3I1JA 2D5AA 1P44A 4RL6A 3TWOA 4I08A 2X86A 2AW5A 2ZB4A 3FSRA 1PTJA 4WEQA 1Z74A 2QIOA 4ALKA 1M2WA 4E5NA 2IYOA 1DPGA 5JPIA 4Q3DA 1HWYA 1DHRA 2NWQA 4TQGA 4IXTA 2ZTUA 2HMUA 4Q9NA 4ALNA 2Y93A 3VH3A 1NQOA 1DLJA 2YV1A 1DB3A 3AU9A 2VWQA 1HE3A 4XQCA 3KB6A 1EEHA 1EBUA 4KOAA 1E3SA 3DFZA 5HTOA 1UAGA 3PJFA 5DP2A 3BMOB 1SPXA 1DIGA 1FDUA 1N1GA 3GZNB 3G0OA 2B36A 3ONDA 1E7MA 3JQ9C 5A05A 1PJCA 1CETA 2Q4EA 2HJRA 3WOHA 1XSEA 1ZZEA 5A3VA 1A27A 1LNQA 3GH3A 4KUGA 3UAGA 1Y8RA 1Y9AA 4XQEA 3JSAA 2CSUA 1H6CA 1MXHA 5G0VA 5I7SA 2Q2QA 3SC4A 2X5OA 4CMKA 1ZK3A 3K8ZA 3ZV6A 1A7AA 2OL4A 2TMGA 3I3OA 5TIIA 3OETA 4MPDA 1M6WA 2NVBA 4MVJD 5EN4A 5TGDA 3BMQA 3TZCA 4C7KA 3RC1A 3PEFA 3OM9A 2P9CA 1JVSA 4J9UE 1BGVA 4LK3A 4Y8VA 2TMDA 5TT1A 1SMKA 3MJVA 4LSMA 4DVJA 3E18A 1NQTA 2LDXA 1VJ0A 4I5FA 1UDAA 3ITKA 1XCBA 4AJ1A 2EKLA 1NBOA 4PLVA 3NDIA 4MVJM 2VWPA 2D4AA 1BDBA 4GH5A 4NR0A 5G2OA 3NX4A 1HDOA 1PJQA 2B35A 5COBA 1MP0A 4RVUA 1E6EA 4RQUA 3ZZNA 4DBZA 4RF2A 3DAPA 3QRWA 4B3JA 1R4NB 3ICCA 1T1SA 3DBLA 3EHEA 2BFPA 1YDEA 4TSKA 3SEFA 5A9RA 1LDBA 1LC3A 5ER9A 2RAFA 2R2GA 3CTMA 4BNLA 3GVCA 2PWZA 3I9LA 3GEMA 3K96A 5KVQA 1ISMA 3V2HA 1XGKA 3WJ7A 1UP7A 3FRJA 1IPFA 2Y67A 3PWZA 4NH4A 5L7YA 3IKTA 1OBFO 4D45A 2QYSA 2VZ0A 3HDQA 4OHUA 5JCJA 5ENVA 5F5LA 4ZQBA 1B8UA 2QRLA 3DR3A 1AXGA 2Q4BA 1G0NA 1R15A 4GX5A 1QP8A 3PHJA 3AJRA 1PIWA 4KQWA 4NBWA 3RUEA 3W1VA 3KM0A 3GOHA 5T8KA 4Q3NA 3UN1A 2I5PO 3PTZA 4AL4A 1XWFA 1KEUA 2E82A 2EW2A 1E1LA 4J4BA 3SC6A 2B69A 5F3RA 3JQ8A 3FTPA 3H2ZA 4A2CA 1MG0A 3FNEA 4KP7A 5BR7A 3L77A 4D43A 3WMXA 4CQLB 3AK4A 2FHSA 5KKAA 4CLEA 4AICA 5DDIP 4L8VA 3E9MA 5IF3A
chains in the Genus database with same CATH superfamily
1J9GA 1EBFA 3ZHOA 1EAMA 3DPSA 1H2YA 3L84A 1VJDA 3WYBA 4OI1A 5JJ5A 1D2RA 1W0CA 1Q91A 4OJKA 3U7GA 1Z7YA 3LQRA 2IE8A 3HCOA 1HDYA 3GA0A 4QIHA 4BJ1A 3EAGA 2R9VA 4RTRA 4L3OA 4Q4JB 3ZDFA 5BYBA 4LZAA 3H5IA 4DDKA 2NU8A 4CG1A 2VPIA 1GZUA 4N9QA 5ECYA 1QPGA 3T1VA 1BQEA 4LVCA 4IEIA 5EIFA 1MJGA 2O14A 3WGMA 2OSVA 2R48A 3KZXA 4O2BB 3IBFA 5FKJA 1QIHA 4L95C 2PKWA 1D6MA 5HK8A 3LX4A 1UXOA 2LV8A 3QE3A 4OQNA 2VDKB 3I2IA 3U7JA 4D4GA 3OEED 2IHNA 2IJGX 2C9MA 2J4CA 1V7QA 2VRBA 5FI0B 3LA6A 2B37A 3EEYA 2ZE8A 2GFIA 2XWSA 3O95A 3IAHA 1DTWB 4N5LA 3DEYX 4QM6A 1SGWA 3MTBA 2X0NA 1GTG1 2NGRA 2OLJA 2PSJA 4Q3CA 1LF0A 1KI2A 5HKKD 2D54A 2NNWB 2VBGA 4JLOA 1NAHA 1OB2A 3MTJA 2PG3A 1CJBA 3ZBPA 3UAOA 4DJAA 3BE8A 1FYFA 4M60A 5KTRA 1GSHA 2NV6A 1VG8A 3H86A 4KGZA 2II6A 4MUHA 4P36A 2P5UA 5SY9A 2XTJA 3SBEA 3NM4A 4J9VA 4B3BA 5LWHA 1NDHA 2GNPA 4YXFA 4BWFB 1Y6JA 3P8ZA 3RU3A 3S7TA 3H5VA 1X77A 4MTLA 5K5EA 2HPZA 1ITZA 1FK8A 5KMGB 2VI5A 1NY5A 4AFNA 2QI9F 3QFRA 2YS7A 3AF4A 3AHGA 2G5TA 5KSPA 3D0RA 3L02A 2WR8A 1ZM2A 2RH8A 4KUEA 4UFNA 3R7WB 5JXHA 1I4OA 3D6TB 2IGTA 2DJIA 3CLHA 3GYBA 5ALLA 1EDEA 2OORC 5AKLA 1PJ2A 4BLTA 3FPEA 1YUNA 2FKNA 1KPHA 4TXMA 2HWKA 3VR6A 3JWEA 4AO7A 3LGXA 2DKNA 1WDLA 3LQ4A 2YW9A 3G3EA 3NBFA 3ZDQA 4CM6A 3ICWA 2A58A 1IHOA 4S24A 2FP3A 3JYOA 1Z22A 2FR1A 3RVKA 3T6KA 3CLUD 2F55A 3BDAA 3R7AA 1CJMA 2FUKA 4W9NA 1VSTA 4ZAZA 3TYXA 5B3AA 1NUQA 1DCKA 3WKAA 4B5KA 1OYYA 1V95A 3GWGA 5CB4B 4KWEA 1UK9A 1E4OA 2RHRA 4E21A 1S5PA 1VCIA 1L5FA 2Z08A 3WNDA 2R6FA 3ZJXA 3OM8A 3OWHA 3TOZA 4KTTE 3RYHB 4M0MA 1M6NA 1FJXA 5JCJD 1QCZA 2BGMA 3LFHA 4PSUA 2CV0A 3KJEA 1PVDA 4TV8A 2WJWA 3COSA 5AXDA 2IDMA 2OP0A 1JSRA 4IKPA 1SBIA 5DXJA 5BT8A 1BTOA 1ID8A 4C01A 1Y1QA 4KOEC 3UUFA 3IXQA 5AXCA 5LMCA 3FFTA 4HQNA 1PWYE 4CJXA 4UBMA 2X5JO 3OUTA 4F5WA 3GGDA 1FRNA 4WZAB 3EP3B 2ZRJA 3ZBQA 3D1JA 2E87A 4HNSA 4MDYA 5J2UF 1P8JA 1FYDA 1LI5A 3IRVA 5HZMA 1YBFA 1KYZA 3EGIA 2WWIA 4LHYA 3L6EA 3FMPB 3RUCA 3TPFA 2AZXA 1G5FA 1JVBA 1P0CA 2QX8A 2Z1DA 1XLVA 1KRWA 1R3DA 1GPLA 4KYVA 3QUBA 3AV3A 3KD2A 4Y6RA 2WMNB 1L7OA 3JZFA 3U40A 3WHPA 4CNBA 2PJZA 2FPWA 4L78A 3S44A 2PBRA 2QROA 1E3LA 1K8XB 1EFHA 2CF6A 1U3TA 2XLCA 4U2GA 4LYYA 4B4KA 1EE9A 2GETA 2O4CA 1OFHA 3CVOA 4FLMA 3IWCB 4J3JA 3D54D 2EHDA 1F20A 2G63A 3F7TA 4HJXA 5F77A 4YMTA 1A2KC 3VYTB 3M2PA 1EFVB 1XZFA 5MDHA 1QLJA 3KC2A 4FGWA 4I36A 1F0PA 4K9PA 5ITVA 1HQCA 1E3EA 1JSCA 3G7UA 4ZI7B 1SD2A 1E79D 2TMYA 4QBTA 2E1PA 2PGOA 1CF2O 1NJGA 2WZDA 2GB4A 3JR7A 5EESA 2PXXA 5KOHB 4DMFA 4DIDA 2GD0A 5LQAA 2C2WA 5JJBA 1XJWA 2P4QA 3PFWO 4QUHA 3KQLA 1PT6A 1X86B 3O38A 5LDHA 1TC1A 4QTUB 4S2UA 1DDIA 1X7GA 3IDSA 3E3NA 3HB0A 2KLHA 1EFKA 1H9BA 1FSZA 3TDKA 1W5BA 3VSEA 3MUFA 1E5QA 4DY6A 3EYAA 1ELOA 2QTLA 2VZLA 3EF1A 4ASUD 3WMGA 3HK2A 2J6CA 1TTTA 1NG1A 2Y77A 4K9MA 3TJRA 1N6RA 4JUBA 4Q4HA 4UZSA 4CLDA 1UMBB 3O90A 3V2UA 1WABA 4S35A 5K01A 2IF0A 1XZAA 3QI7A 3WYEA 2JIOA 1O95D 3IX7A 5KC8A 1N0UA 1DINA 2EP8A 2ZE5A 2ZRMA 4N0EA 5AIAA 3HFSA 4MHOA 2AKYA 2GXSA 1YR7A 4RD1A 3SF0A 4AUKA 4BUCA 4DMRA 1UFKA 2Z2IA 1KH3A 2W6QA 4M8SA 3ANXA 4JN6B 1YDMA 2RIRA 3W2GA 4NARA 1FP6A 1YZGA 3WL4A 4IG4A 2XDWA 4PZ9A 5CDYA 1AUXA 1OFIA 1CULC 3FI0A 2IW3A 3K20A 3LHKA 4EQ6B 2KHZA 5HQ3B 1L1EA 2HV8A 3HB9A 3RVLA 4MS4B 5G0WA 5BQOA 3DE7X 4CM5A 2EX0A 1DKQA 4O6VA 3AB7A 3FW1A 4JH0A 1NMXA 4JIMA 2VSXA 4R40A 1YZ3A 3DQPA 4H31A 2VH1A 4WN3A 4D4KA 6ABPA 2N42A 1W36C 2BHSA 1QX4A 2O2JA 4PLFA 6AT1A 3DEIA 2GQ0A 4OKIA 1XCJA 4XR4A 1YE8A 3ESQA 3N5CA 4GR9A 2QJFA 1YJCA 1I4TD 2G1AA 3THYA 2DSTA 3IQEA 4I7EA 1TVKB 5DTQA 3T4EA 2VUHB 3OU6A 4KITB 3O8CA 1D09A 1PL7A 3BWMA 4LOLA 1B7GO 1KYQA 2AEJA 4P4TA 5EUQB 1VB5A 2AUMA 5AW3A 1QU2A 1M7HA 2R96A 1R8XA 4LE0A 1TT5B 3T3PB 5I51A 2I3ZA 1W4ZA 2HUNA 1U3FA 3LCCA 1UBMS 3KYIB 3K72B 3L7OA 4H59A 4OB6A 2GI4A 5IVHA 5LP6B 1VKZA 3FY4A 5CUQA 1XMQB 5LU8A 4CRWB 4I1PA 2JFOA 3VI3B 2W37A 3M8KA 1RQ7A 2Q22A 1PGPA 2Y1XA 3OPMA 1UJ5A 4ZC1A 2X0EA 4R8RA 3UAWA 3DEKA 4TUYA 1M8KA 4O08A 4F72A 1L5RA 3LXRA 3I1YA 1IN5A 2VT2A 3A25A 4LW8A 5DX0A 2JAOA 1Y7IA 3ZWPA 3ZHTA 2F48A 3DC7A 1O5OA 1V5WA 2IQ5A 1RHMA 3ZWCA 4ACBA 2OHHA 3SQOA 3WBBA 3RVDA 1J1ZA 4XRRA 4KV9A 4DWJA 5J4HA 3MYYA 4TS1A 4K3UA 4KMRA 2IUYA 3IUYA 4D92A 3GJQA 2IHVA 2XXJA 1TO2E 2HW8A 3ZWNA 4JK3A 1DOAA 4DV2B 3HKBB 2VHWA 1RJEA 2NQTA 1MJHA 3HBAA 4JDPA 2XJ4A 3N2GB 5JDIC 5AK3A 3ZVKA 2P75A 2JKVA 4LHSA 1U8UA 3MRTA 4NYMR 2YOFA 1SEPA 4B7CA 2FPXA 2PNJA 2QRJA 3RIGA 1MFPA 5JYCA 5IKMA 3GG2A 2RKOA 3VVMA 7YASA 4ABTA 2F43B 3KQUA 3VKFA 1GPUA 4WKPA 4JVMA 2KE5A 3ZXSA 1CUDA 1M0TA 2RH9B 4IW3B 5LN1A 3OX3A 4L2IB 4QGGA 3UG7A 3CJQA 4CIVA 1QIFA 2DPYA 1CR1A 4I4LA 3HXMA 3IMEA 3ZKWA 1W30A 3OEWA 3BIWA 2D0OB 5SZIA 3ROZA 5HF9A 3BDIA 3K1AB 2I76A 2P90A 4P53A 5DKFA 1YQWA 3TCXB 4BFXA 5KX5B 2FSIA 1SQ5A 4Q6WA 2YC2C 4YACA 1CQJA 1MRZA 2BEUB 1QZXA 5ITSA 3AKZA 2DQKA 4G0PA 2H5EA 2JEZA 3JQ9A 3CUKA 3L1KA 2GJ4A 3WP1B 5JH7F 2NAPA 3CMMA 3KKPA 3KT3A 2WRZA 1T13A 4MYTA 1T4DA 1PX0A 1U8YA 3CNEA 3E15A 1VA4A 3NEPX 3OQ6A 4FGSA 3BKXA 1IJBA 1X38A 2BM8A 3A9RA 3MJCA 3PK0A 3WSTA 1AQ6A 1FNCA 3HCFA 5M6DA 3PF9A 3EF3A 3ZGNA 5DTJA 3VDRA 4CL8A 3K73O 4MQEA 1I80A 1HRDA 3HRHA 3TRDA 3NHYA 1LVUA 2YZ7A 3RSQA 1UXHA 5AYVA 3JWJA 4R0NA 4EPRA 3ICOA 4CT4B 1EUZA 1YZKA 2Q9CA 2PY6A 3I73A 2WU0A 5H9VA 2JHCA 1KTIA 5ERYA 2YJGA 1UDBA 2XB4A 1UC9A 5IH7A 1KDYA 1T1IA 5GOZA 2IOFA 1Q0PA 2IL1A 2ISSD 2BEWA 3CR3C 3O8NA 5J2TA 2A5DA 3AUKA 5JT1A 1EM8B 3C8HA 4GUDA 1UKBA 2WT8A 4D26A 4DSNA 1GGMA 2BSAA 3CKYA 1AH2A 1Z4MA 4HQRA 4R8SA 3B70A 5EG5A 1ECPA 3LBHA 4Q4LA 4PSCA 3SJBA 4M1QA 5T73A 2QTMA 3HUDA 4IOLA 1WXDA 1ZJJA 2BHTA 5K0SA 1V6SA 5TRTA 2PRYA 5ESRA 2AJLI 3U09A 1P4SA 1TCVA 4DSTA 4QX6A 3H9JA 4IJ6A 3JQGA 5DYTA 2GK4A 3PGJA 4LY9A 3ZXUB 4JKOA 4J4TA 3UXHA 2W43A 1KKLA 5A4FS 1M1YA 2QD1A 2PLWA 3IQWA 3LW7A 4UHBA 4AF7A 2IP2A 4Q4CA 3GLIA 1BEZA 1ZGJA 1RYBA 1U11A 1DBPA 1FL9A 3C4JA 2I7TA 4I9HA 4KSYA 3GVIA 3DOCA 3QFHA 1O58A 3L0YA 4X92A 2FMTA 1G21A 5HS6A 2EDAA 2K6GA 3X1XA 3D6AA 4BFCA 1FJ2A 2FK7A 1ULTA 3DVSX 2GHQA 4I8IA 1WKVA 3ABIA 3PPVA 3KOXA 3HWSA 1YQDA 1JJFA 4MJXA 4R9SA 3JQ8B 4PV7A 1XALA 3CSDA 3VO1A 4EPVA 3T54A 4D3FA 3TSCA 2VOEA 1H1LA 3CE6A 3O7MA 4A2WA 5BQPA 3L0IB 1C41A 2YWJA 3OO0A 5K8IA 3PIDA 1UFRA 3E9QA 2VNIA 3OI7A 1CUXA 1J9ZA 1TM2A 1HDZA 2FRVA 1BO6A 1N5KA 3CE9A 3IP1A 2GTPA 2ZYHA 4G24A 4H1VA 4JQYA 4BASA 1K1EA 1QOPB 3R3UA 3CR7A 5TMDA 2ZZMA 3ADPA 1N9GA 3D3KA 1IBKB 2DPLA 3VX3A 1RHJA 2FR8C 1W9MA 3OFSA 2E55A 5A7HA 3NHMA 4B2IA 1HG0A 4R1LA 5IVPA 1XXHE 4TSFA 2QQ5A 1NX9A 1YS6A 2HRBA 4LF8B 2W4QA 1V1RA 1FVFA 4UDXX 3RR2A 2Y05A 1KNXA 2QRHA 2NP7A 4F45A 3MN1A 3NG1A 4HY3A 1ZN2A 4BQRA 1JZSA 1NLUA 2XTAA 2F17A 4XGQA 3JZMA 1HYEA 3GVHA 3ZWDA 3ZXIA 3ROEA 2XUHA 3FETA 3CZ4A 4UNQA 4RXUA 4ZICA 4QXMA 4KZKA 1THTA 4FKZA 3KR2A 3EQZA 2ZRHA 3GAMA 4YJGA 5JXWA 3KB2A 4KV7A 3LT1A 3B1JA 4AN0A 2LBPA 1G2PA 1KJWA 2POCA 2C4HA 4ZEOA 4HAZA 4HWPA 4N3BA 4OK5A 2B4TO 4RVGA 4KK4A 4ARVA 1E2QA 2W4IA 2R7NA 5EJMA 3BSWA 3VTZA 1L7DA 2HWYA 3I4FA 3PQ5A 5BOSA 3R9XA 1E7RA 2GBLC 2WJYA 3DR5A 1PT7A 4TYQA 3BWYA 3OZ7A 4KAAA 3WLRA 4D97A 1I01A 5DNCA 3OIDA 3TFQA 4TTRA 2VHCA 3EGDA 3HPRA 3JQRA 2WAYA 4DC9A 5H8WA 3AEKA 4HGOA 4ZOAA 2I62A 4IDGA 3OEHD 3ZX5A 3CVWA 4U9IS 5AQ1A 1ZG3A 5FQOA 3AQ4A 2OHOA 2ZSUA 4HAIA 3L4BC 5I7UA 4GKAA 1PFKA 4B3HA 2X7HA 3HA5A 3SNHA 3A6EA 4WD3A 1N1EA 2CVHA 4N1AA 4QUBA 5TQ0B 2AX4A 3B9PA 2HZBA 3NM5A 1RRKA 2NX2A 2PUWA 1GGNA 4MOWA 4K2HA 1K7CA 4I9UA 5K8JB 3H2SA 5I7AA 3RC7A 3DNPA 2QS9A 3AETA 3DVQX 4HN9A 4YI3A 3ZU3A 3T5DA 1Q0RA 4WESA 5BYAA 3X1MA 5ERGB 3W34A 4IJKA 2PMKA 3V1KA 1Z36A 3WGYA 1MIHA 3DP9A 3O84A 5BN1A 5IAEA 3VHQA 3I8SA 2CSXA 1KEVA 3BHNA 4MDEA 1SQGA 4MP3A 4F2WA 4EEXA 5CPBA 1IJFA 2ZJ5A 4KR0A 4I4IA 2MYTA 4GPBA 3M4YA 4MR7B 2KSQA 1DFHA 5AUOB 1MG5A 3KUUA 3EE6A 3I0MA 3KDPA 4BNYA 4BP9A 2MT9A 1XD2A 1USGA 1L7RA 4RLQA 3RVBA 2HTFA 3UA4A 3X2FA 4J76A 4OXRA 3EUWA 5D00A 1A69A 2IW1A 2IWRA 4ARAA 4CBVA 4COOA 5FH9A 3OTOB 3CJTA 4G01B 3M1LA 4NMWA 1UFQA 3RT9A 3T7CA 4XM2A 2O5RA 1JA1A 2QN8A 2D7DA 3CRRA 2QUZA 4CV2A 4U2KA 5I45A 2HMTA 1SU4A 2XI4A 1E18A 2YRXA 4JJ6A 4M9ZA 1QHFA 2IH2A 2JI9A 1PYGA 5EP3A 5TNXA 3TQHA 1J07A 3KKEA 2G5CA 2GS9A 5HJEA 4LCJA 4CCYA 1JECA 2IZ5A 1YCFA 1C30A 1O94A 3H8VA 1V2HE 2VXBA 1G20B 2BGLA 1WLSA 4MLPA 1ONSA 2QTAA 3TLYA 5BR4A 3V7WA 3N2KA 1I30A 3TE6A 3CLRD 2XVAA 3JPWA 4RMNA 4FFLA 3PC4A 1R7RA 1YS1X 1Z29A 3AYXB 4Q9KA 1NVVQ 2N3ZA 3BPSA 4WIAA 2OGTA 5AM5A 5ARDA 5FTLA 4TZ0A 3HO6A 5B6JA 4JI3B 2DBQA 1DKMA 3HACA 3TAXA 5KHAA 5DNDA 4A5SA 4ERXA 3OESA 2YZGA 3U7FB 4RIGA 1CIPA 1JL3A 2JEOA 4F4JA 4CT5A 1A5AB 4DA8A 1I1NA 5DWQA 5AIBA 1RMTA 1VE7A 2X42A 2QE6A 3RKRA 2JL1A 2NZYA 4NRDA 1WAMA 2Z6AA 4FIZA 3ET4A 4UAUA 2VQ3A 2UUBB 1OX6A 3BH6A 1JNYA 5DZSA 4UD6A 1GLNA 2PAFA 5KQSA 3ET5A 3TINA 3SJCA 5D5HA 1A7JA 3CNQS 5IBPA 5AK6A 4EBBA 4IXWA 3W8RA 1DO2A 2IXTA 4YFYA 1TO6A 2BFOA 2NYVA 2VLIA 1UJ2A 1LFAA 2IA5A 1H94A 1VIMA 2XMQA 2XNDA 4M8IA 3RV3A 3UENA 4N49A 4YMLA 3TO5A 3PCXA 1J2EA 1DI0A 4Q1VA 3INGA 3W2IA 3L43A 3PRHA 4A6PA 1OROA 3VPHA 1PKXA 4RPGA 3E9ZA 4BFTA 5CRIA 3DV2A 2G82A 3Q6IA 3QBVA 4B44A 5FI5A 1IDN1 1C3VA 4D98A 3EP4B 3T9DA 4M98A 5BSEA 1X2EA 5EXXA 3MXTA 5K0TA 3WJ1A 1TO1E 4Q4HB 3BZUA 4B3MB 1L7AA 2ZYGA 4IM7A 4DEYA 2OESA 2V7UA 1N2XA 4RLHA 2OBYA 1DTEA 5L6LB 1JDBC 1G6OA 1GQRA 2BMDA 4NBRA 5LIRA 3ZH2A 4GQAA 3W4JA 3KYCA 4WNCA 1HZZC 4M1OA 4AYTA 1U1FA 2UUPA 3NIDB 3SS7X 4YUWA 4F4UA 3MWLA 1JG1A 2R8EA 2QQ0A 4PWYA 4CKZA 5CH5A 3C7DB 1ZH8A 3GQBA 3N39C 1WHTA 1X7WB 4BGEA 4QPJC 1IRIA 1JEJA 2CL0X 3DE1X 1DP4A 2D1RA 1NJ1A 5LCXA 2RGNC 2ZU6A 1CT9A 1XRMA 5IDWA 5CJ2A 1VIAA 4OAOA 1JI3A 3GGCA 3LZ6A 1X92A 4JI8B 1JENB 1HTBA 2IXFA 2R1UA 3F49S 3OZTA 2GR9A 1BYUA 4YJ2F 3FBGA 1Z8DA 1WCIA 1X1DA 4CKCA 1QRTA 1QQ5A 2IHTA 1DEXA 1EP9A 4IFIA 1KOJA 3T1HB 2TMKA 4Q7JB 3JD2A 1VG9B 3R75A 2FWNA 3HABA 2Q4TA 2FWBA 3THYB 1DEKA 3TIGA 1H0SA 1ORVA 2E4YA 2IPNA 4HB4A 4QUDA 3S8MA 3KQNA 1EUQA 2BEVB 3KZCA 3WYDA 2V7PA 3HKDB 2BGWA 4O8CA 4QRHA 5DHRA 2ZM6B 1PHPA 1K5DA 2XV1A 1RYZA 1AN9A 1TZ2A 1RI4A 3TTXA 4BPBA 1TQ8A 1C9EA 4BNVA 3WISA 4E4RA 4EHIA 1YQGA 2OAEA 2JGAA 2PT5A 1P2GA 3FYDA 4PZ0A 2R3SA 4Q7EA 4Q48A 4YEDA 3RAFC 1NJ8A 3AUFA 3D6FA 3ZK8A 4YT2A 2VDMB 4FFMA 2Y9MB 3ZZTA 4DCCA 1XUOA 3GEDA 1LPPA 2NVUA 1IHDA 1K4KA 2W4MA 1WBJB 2QEQA 3A31A 3QU2A 1FBNA 4MCIA 2GD1O 3N75A 3LC7O 5BNZA 3IWBB 5K03A 2R00A 2WVAA 3FZQA 3WRXC 3HGQA 2DPHA 5BSGA 4RXTA 4FONA 4L6CA 3LI2A 4RDCA 1YMQA 5J4YA 3S40A 1QK4A 1P2VA 1JDPA 3MIZA 3PJDA 4I5GA 4PPGA 1EQAA 3TOVA 3MS7A 5DLDA 5EP2A 1WDMA 1LK7A 3KFXA 4J6FA 4XIFA 5C1IA 3I61A 1G4HA 1ESMA 1VPLA 1WXEA 2QYTA 4OKNA 2QG9A 3RS0A 3ODPA 5DBHX 1FRVA 4YYZA 3RSZA 1J2YA 1U3VA 1Z6TA 1DT3A 2F90A 3EEBA 3EODA 4PQGA 4X84A 4ZOCA 2Q2VA 2QVYX 5KOYA 1T6XA 1XTUA 3ANTA 1KU0A 2RGYA 2OGUA 3BXHA 5LZ9A 5HMMA 5K3DA 3A4NA 5DYIA 1XTTA 3BRCA 5IM4A 3RC3A 3PWKA 1NUSA 1X94A 1OF1A 1OY1A 3TZQA 2OBNA 2YW2A 2PH7A 2D2IA 1KQPA 3QYAA 4ZAWA 1BYIA 3B51X 1PGJA 2JFZA 4BUJA 3FOFC 1B74A 4Y1RA 4YCCA 2VDOB 5MGNA 3Q8XB 1B0UA 2ZU0C 1MT3A 1SFRA 1DUIA 1IAQA 1VGQA 5A71A 1YR6A 4UBKA 4ITUA 3GJ3A 1H69A 4YROA 4O3FA 3ER8A 2X0KA 4GL4A 2A9VA 2FFRA 2VDQB 4I3GA 3ZCTA 1ODFA 1OHHD 5DH9A 2CW5A 1IUPA 1W9HA 1A5ZA 1W6UA 3IE1A 1C3OB 2VPXA 1XC7A 2AXQA 3A6FA 3SEZA 4CL0A 2C4WA 4MWBA 3HJCA 3SXJA 4JP8A 4OI2A 1CQJB 1FNSA 4P4NA 4DV4B 4KX5A 1C0PA 2AMJA 3CN9A 5COAA 2GN2A 5FOXA 3FCXA 3UMCA 4QJ3A 4P8RA 2XEDA 2W6OA 3IMFA 4NTZA 5SYMA 3EVNA 4RCYA 4G9BA 3FR8A 4HEQA 3SIRA 4B35A 2DH5A 2EP7A 2O7RA 1RBMA 4MX8A 3CV3A 3SQDA 4I4NA 4FJ2A 4RYLA 3WKEA 3MFQA 1RC0A 4LV6A 5A04A 2XITA 2I3AA 3F7MA 1TJ5A 1J8VA 3IUBA 1ORDA 1V7PC 1MOSA 4HVTA 4JUFA 4MQEB 4CUZA 5I4BA 4L5YA 2ATEA 1XN1A 1U3GA 3BJMA 1A9PA 4GI3A 5C1BA 4JS0A 4R1NA 3PDHA 1EZ1A 3RJTA 1TIKA 3SSNA 3TECE 3OMXA 1QQAA 1D7AA 3GVXA 2IU6A 3P5BA 4UJ5A 3RTDA 1C4XA 1YS7A 3O3OB 5IXSA 2Z6QA 3M6UA 4EGSA 3R7NA 4FFOA 5B1EA 4LRYA 3N1UA 2BEWB 5ALRA 4J0IA 4CF7A 4KI0A 5J2TB 1MC1A 3MFYA 3DLBA 3NJ8A 2F9LA 3IP9A 3ESRA 3K6RA 3K2BA 4JC0A 2G0NA 3AUTA 3FPBA 2O1SA 2V3WA 4QXQA 1L7BA 1RCFA 3SWWA 1LU9A 4EY5A 4REQA 1SBTA 4L28A 1JIXA 1QWOA 1SR8A 1TDJA 2GJAA 1VRCA 4RA6A 3R3YA 2C7GA 2Y92A 1KDVA 1C1XA 4V38A 1KAGA 4DIEA 4JFRA 2B34A 5EKXA 1Z33A 5I48A 2OO5C 3R5HA 5CK5A 1SUIA 3UBMA 3JQGB 1AA6A 1ZD2P 3KV3O 5ED0A 2ID8A 4NHOA 3WO0A 5BWCA 3Q0EA 5M29A 3RYCA 4ZVVA 5JG7A 3CB4A 4NULA 2ZUFA 2NT3A 3PR1A 4QNMA 1FCJA 2VAVA 4BO0A 4N76A 1K6MA 1CY2A 2PIDA 3C6ZA 4Y2PA 1ZSNA 4O4HB 2FSVC 2VQ6A 2XOKA 3NWJA 3RM3A 4HDOB 1H8HD 4OQFA 4LJ7A 3LUDA 3U0VA 1HLFA 1Z6QA 2ECKA 2AN9A 3C3KA 3NTOA 3EP6B 2OHIA 2Q6LA 2QD2A 5AI6A 4JC4A 4FCCA 3IQFA 3FPJA 4JYZA 2ZR8A 5KC9A 4G4SP 1H1LB 3FTNA 2IYLD 1XXHA 3PDCA 2O48X 1T9CA 2N47A 1FFCA 3VGPA 3PNQA 4C20A 3C5VA 3QE0A 1GPMA 3S4YA 2Y1GA 1PR6A 1O4VA 2QUBA 3AIMA 4YQYA 4DR3B 3B20A 2BGRA 5CAEA 4LF9B 1N9GB 5B1YA 2PYZA 2HRDA 2AMVA 2IF2A 3HBMA 3HXKA 1F4LA 3KR1A 1TLTA 3CMCO 1JUDA 1I7PA 1WUJS 2C9CA 1N5LA 5LD2C 1KYTA 2YWBA 4HFNA 1FMFA 3EC2A 3PQVA 1QV6A 3CRZA 3LT5A 4FDTA 4DADA 4YRLA 2O2SA 3TAUA 1VYUA 5BP7A 1V1RB 1XEXB 4LOIA 5IH3A 1KVTA 1Y5NA 4KW7A 3ROPA 2O54A 1XJQA 1GP2A 1WEHA 4YI5A 2F3PA 1QMPA 2XUDA 2ZJ6A 4XD2A 4DLBA 3IURA 2P1RA 4I4TF 2QZ4A 5AOAA 2A1TS 2YHIA 5KYWA 3A4MA 4KODA 5LNK1 2BFCB 1RE1A 3TR0A 4XOIA 4CM7A 1TJ4A 1FUKA 1V8BA 1YK1A 2ZWIA 3PLAE 4I6EA 3H5OA 3SHQA 4D3XA 4DE5A 2ZTVA 5K4GA 2DFVA 1BW9A 1KIAA 1OV4A 3AB3A 3RWMB 3ZE9A 4ZV7A 2R5FA 3C6BA 1LSOA 1NWCA 5ALHA 1INLA 8ABPA 1GNTA 4JUAA 4AAYA 1H0KA 1P2FA 4TTAA 5C5EA 1CJSA 3TTTA 2B5VA 3P9IA 2EYUA 2P35A 4IPTA 1ZITA 4OXIA 4BEBA 3WAJA 1IWBB 4Z54A 3QVGA 4KMSA 4HAXA 3RYIA 4EY3A 1FB5A 5BOSB 3R9XB 1DXQA 4YCMA 3SKXA 2CE2X 2Q50A 2ZFUA 3ZW8A 1ZC4A 3ENNA 2QAJA 3ENQA 2X7JA 1JKIA 3QQPA 1NR5A 3NTVA 4OM8A 3EGDB 3HN6A 2XB6A 4AUMA 1ZHHA 4ZD6A 1XZDA 2BGKA 2GILA 1V3TA 1TVCA 1P1RA 1VL5A 4EG3A 5J58A 4O4JF 3VSAA 3IUJA 1ZIYA 2C2HA 3URKA 4W82A 1M76A 1T2AA 5CEFA 1PFUA 2AEEA 1K6EA 2REOA 2GEBA 2WU8A 1X8KA 2JD2A 5LQSA 4RQAA 2B1JA 1PTKA 2CXNA 4BE9A 2Q28A 4TGLA 3EEFA 2C3PA 2AN3A 5K3EA 2P8JA 1EXMA 2PR2A 2QRMA 1FRFS 5J5CA 2J0EA 2Y6VA 1XMXA 2XRFA 5DCLA 1WF3A 2I1LA 5CITA 3TL6A 3U4MA 3FDXA 4RESA 5CNJA 2G0TA 3PNKA 4TTJA 4PQFA 1LPSA 1NTRA 1VKOA 1R9JA 1NLMA 2ZCUA 3D5EA 3T34A 2YNMC 3B2EA 1DIRA 4JBHA 1VE9A 4P93A 4WESB 5ES3A 4P32A 1R0BA 4W8OA 5TR9A 3IHLA 5TC4A 1G6KA 1EB8A 4R1UA 1G8AA 4LI0A 2CVQA 2BFAA 5ALKA 5LQCA 1ENOA 1ZK0A 4JASB 3V5NA 3SDBA 2XCTB 1GRVA 1EHYA 3MJ4A 3QV2A 5U4XA 4FOOA 4GC5A 3GUHA 4ICIA 1ORIA 2AG1A 2XWBF 3FVWA 1AZWA 4NMMA 4BNGA 4F46A 2AKEA 3ZNOA 1E20A 4E51A 2O59A 1NVUQ 2OYCA 4GPIB 3WLFA 2WHEA 1HGXA 3RROA 1H65A 1NLZA 3HMQA 4DNPA 3BQ9A 1JHUA 1VRWA 4MUAA 4Q3OA 3QOXA 4MB0A 5IJ0A 1XNJA 5E3JA 1AJEA 2F3UA 1NW5A 3DZIA 4W5WA 5J5VA 1SVSA 1N2EA 5SZJA 1TA4A 4U7FA 4XI9A 2EJWA 2FXVA 3G8CA 4LZJA 5IJAA 1SVWA 1L5HA 1KFBB 3WDMA 3QE2A 4BFLA 1CRQA 3ZWMA 4Z4HA 1UJNA 4UM9D 2D5BA 5DI3A 3AEZA 3CZ9A 5HKAA 1FFGA 1KP3A 4CLHA 3ETCA 4KXLA 4RVHA 1UAAA 2YS6A 3M1AA 1E3WA 3QYJA 2QXYA 3UUWA 2BM1A 2ZBDA 3QVVA 3N8IA 4D57A 2F00A 4ENTA 5ADHA 1NVXQ 5KYKA 4NMXB 2BRUC 5AJZA 2DLNA 3LKDA 4CIBA 5FUBA 4XLZA 3RBZA 4JYAB 1NW9B 4KQGA 4RTPA 3TVTA 2XCOA 3T41A 2HLHA 4R54A 1TUIA 1Z3CA 3KZ1E 5HQTA 5CDSA 2X9QA 3M2TA 2HA6A 3EIFA 2P2CA 3NTXA 3UJ9A 4XPIA 2YHSA 1CZHA 2Z2YA 4JQOA 4IICA 1EYZA 4CODB 1E99A 4ZODA 2EQAA 4AX4A 4Y2RA 4KVAA 1HFKA 5ADVA 1YQ9A 4U5QA 2KQUA 4LRQA 2JNWA 1GVNB 5L8VA 3LECA 4EGCB 5E4YA 3TDMA 2XDAA 3WMFA 1Z8FA 4ETMA 4JOBA 3WGUA 3BGOS 3RTCA 4RENA 2FJUA 3T35A 3OHPA 3R3JA 3JS5A 2FCRA 4A8TA 2IIQA 3GRPA 2HIHA 1HDRA 2EC5A 3U61B 5JD6A 1MB2A 3PZBA 4AURA 5FPSA 4MV7A 4V0QA 3RV4A 1J0EA 1LSSA 3I52A 3RFVA 3VKUA 2VK2A 3M5CA 1LH0A 1B0AA 3PX2A 4YJ3F 3K15A 1FY2A 1KKUA 1VJRA 4WXMA 5CXSA 4P1ZA 1XJ5A 3D3WA 4OP1A 1WTAA 1D4ZA 3ZUGA 2JLQA 3IR5A 3CH7A 4J16C 2FQWA 2WUEA 5J47A 1CHNA 4IWYA 1YGPA 2H0RA 1XZJA 3OZBA 3KYBA 3SKYA 1Y37A 2RH4A 3UXYA 1Z82A 3SFTA 1FYVA 9ABPA 4U7TB 1VXOA 5TY0A 5AUPB 3C7CB 4ARUA 4YAKA 1UDWA 3U17A 2AJDA 5DYGA 5B1DA 4ZQGA 1KJYA 5F7XA 1EUYA 5K05A 5F2KA 3ZIDA 3UK2A 2OOSA 2PANA 5FUQA 2LKDA 1SELA 4XOUA 1ZWKA 1G7TA 4I99A 3G2NA 2LIPA 4L6IA 1V5FA 4EFLA 4ROSA 5EWLA 3TQIA 4QBHA 4YV2A 3KYCB 3FHCB 1Q1EA 4H0FA 4NATA 4GPZA 4S0XA 2ZT8A 4W4TA 2PLFA 3I9MA 4ZU1X 2WP8J 3TQFA 3T7EA 5ENDA 1DBVO 1N5MA 3QU9A 4JX8A 1YKSA 1NJSA 3GQBB 4IHJB 2YV2A 4JQSA 4LBVA 3BDVA 2Q7XA 3T7DA 4ZQFA 3WLEA 5JO9A 5JR3A 2Q1YA 4LDRA 2LKCA 2YZNA 1UKCA 4FMCB 2HAEA 3WXMA 3HN7A 1X74A 1BD3A 1N8SA 3QKRA 3EZGA 3OFJA 4MKHA 1N0IA 1OWMA 3PICA 3BIJA 2KW5A 4QG7A 4RO0A 2ZB7A 5K1ZA 3VR1A 4ESEA 1P62B 5HJ2A 1SKMA 2CMDA 1T9DA 2QDXA 2XBMA 1VCNA 3WLKX 4Q21A 5CB8A 2NV0A 3R3ZA 1N6IA 2JFNA 2IIVA 3IQXA 1VCOA 3OLWA 3W1EA 3WY9A 5IXYA 1JDZA 3TXYA 1IUNA 1RC8A 2AQKA 4JL5A 1CRWG 1JA0A 2VAXA 5A9SB 1RWBA 3EZLA 4KVZA 4UQPA 1FSFA 1OWNA 1Z5PA 4XWTA 3SBOA 1Z0DA 1KMHA 2BDTA 2ZETA 4ZZ1A 1XDUA 2JEYA 3AY6A 1FW6A 2Q45A 1DUVG 1SUEA 2QTFA 2LCFA 4P7BA 5TV2A 4CMCA 3BD9A 4UCWA 3W2FA 4JC5A 3ZXYA 1OPXA 4GR4A 1PFVA 1UBCA 3NFRA 5FD8A 3WP0A 2J07A 1BHO1 4GWLA 2NVUB 1F6BA 1R0KA 5E1MA 3N58A 1EIWA 1VLJA 4DQUA 4FCWA 1OUMA 4Z6KA 2VJDA 4INAA 1X1QA 1NFQA 1ODCA 2VCHA 3BC1A 3CVYA 4B3GA 3W7BA 4Z9BA 4CPDA 4H7IA 4DQVA 3QPDA 4LECA 4UUBA 5GP1A 1U0OC 4ZZIA 2FMKA 3AJ8A 5BNWA 2JCXA 3EUAA 4PBRA 3V2GA 1BEUB 2BFDA 3IOYA 3ZHZA 2HJVA 4HQOA 3PHCA 1AGYA 1Q22A 3PLRA 5B64A 4YDRA 1VRVA 3FVVA 1K92A 1TZBA 2XOEA 4WGGA 4CNQA 3DZ8A 1OH5A 4JLJA 4O2AF 2Z6UA 4RZIA 4RJLA 4Q5IA 1K0UA 3G6WA 5IT4A 2GMWA 1PQWA 2YN2A 1AO0A 5DOZA 3ORFA 4LTNA 3SZGA 3H4MA 2A1TR 2QRVB 3QXXA 1KHTA 3CKMA 1BMTA 1WSWA 4Y2HA 3RUAA 3FZGA 3ZDDA 3H5AA 2B8WA 1WV1A 1RWVA 2OVBA 4B6GA 4WADA 4NDAA 3F8TA 3OOJA 3T5GA 4CG2A 2YRWA 4BO4A 1E1KA 2Y4NA 5J5AA 3UWSA 3B53X 1RLUA 5BQFA 5BV1A 1YJBA 1U4SA 1RPZA 3D2LA 1NHGA 2JJ2A 3IQHX 1ETHA 1KL7A 1P2DA 1XQWA 1T25A 3OBBA 4WA7A 2CXXA 2Z9DA 4MR9B 3FTFA 5J9FA 4D9MA 1BA2A 2Q5OA 2JZCA 2XUZA 1YBHA 4FYPA 4G0QA 4DLKA 3GIDA 1J39A 3PKIA 3FNIA 5E0KB 7GPBA 3K5HA 1GTL1 2WD7A 5D3QA 3O8OA 4Y2GA 3MCUA 1J70A 2QUJA 4PLWA 1PNVA 2BF4A 3L7JA 4NVRA 3WLLA 5F73A 4UTRA 2XDQA 1SUPA 5IVIA 1G5QA 1LTHR 1BMFA 2OY0A 4R8MA 1XNHA 3RFFA 2PK3A 5CA1F 1W88A 1S8OA 2XUJA 3KTAA 4I8DA 1LX7A 1MGOA 1MDFA 5HBRA 2XX3A 3HCBA 1N3BA 4D8XA 4YUAA 2QPLA 3IOEA 2O3TA 3M6WA 821PA 3DHWC 2G7ZA 2BONA 4KQXA 3EIHA 5JNRA 3CGGA 3AIIA 4Y7DA 3RSFA 3GW8A 4MV8A 4Y2VA 2E4VA 4OHYA 2EIXA 1T2FA 2RKBA 3A1SA 2P6OA 5BORA 1Y6RA 2PXAA 4KE6A 4MCAA 4WDRA 2A84A 5JTTA 2J4DA 5FNVF 3RIHA 1WULS 2PZAA 4ZKDA 1O03A 3N2YA 4ACAA 3PA6A 4ZQHA 3UYKA 2D1TA 4CR6A 1D03A 2VYQA 1F0NA 1KVUA 3UYLA 4YPVA 1XMIA 2P65A 3JQDA 2RHLA 4FP9A 3MYRA 5JSZA 2HI0A 2QR3A 2KM1A 3U4IA 3U9TA 3V32A 2OKCA 1U5AA 3GJ7A 3QMWA 1Z5WA 4S3MA 4K2AA 4WK2B 5CFOA 1SO8A 4E1BA 3AY7A 3D8RA 5KNCH 3H05A 1A9XB 1NR1A 4OYYA 4RELA 4REQB 4ZYWA 1ZLYA 1GIAA 1FDRA 2HRQA 4QM7A 1C1XB 3B8EA 4C4YA 1W44A 2GYUA 3A58B 3HHPA 3L6UA 1ADGA 4RTMA 3L4JA 1EIZA 1F06A 3X1DA 1KERA 3ETEA 4IV0A 1LSUA 1VMDA 2BF7A 4PZZA 1QU3A 1SVOA 3MOSA 3AUAA 2SKEA 1NTOA 3IAEA 3PKJA 3DB2A 4JGIA 3IJ5A 4KC0A 2MMCA 2RE8A 2COUA 1IM8A 4UDOA 4H6WA 4KO1S 4CCSA 1QFXA 5HKBA 4JOCA 3LUAA 3H7AA 5LBIA 1M1NA 5EJGA 2QMYA 2PL3A 2XT9A 4C30A 3LDAA 1KI9A 1WP9A 2V8BA 3IAXA 3RRYA 3JWHA 3QVOA 3GRKA 1TM5E 3HBFA 4UVDA 5B12A 2GBIA 4RF3A 3BTUA 4DCGA 3OE7D 2Y1LA 1AA9A 3D59A 5HJ5A 4R81A 4OXKA 2QG4A 1GV1A 1PS8A 1GAQA 2XE8A 3GFTA 3EDQA 3TPZA 1NF3A 4AP5A 4BLWA 4WBNB 2AFIB 2PUVA 2WICA 2Y4OA 1XVIA 3V7FA 4DR4B 3CRVA 1C5KA 3OHSX 3N0XA 1OTYA 3ZCXA 2WKQA 3BYZA 3QTBA 5HM6A 2PGIA 1GO2A 3A28A 4AWAA 3RAGA 1BH2A 2ZAGA